1CZRA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
b'AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGNQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
molecule tags Electron transport
source organism Synechococcus elongatus
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
total genus 57
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czrA00
1YCFA 3F2VA 3QFCA 3FVWA 1B1CA 4FGLA 1FLDA 4R81A 3TZBA 4CF6A 2D5IA 1AKQA 1KBQA 1KBOA 2KLBA 3UXHA 3N3BC 4FGJA 1FUEA 2QMZA 4YALA 4C0XA 4BMOB 4QOEA 1YCGA 3B6MA 3ESZA 1OBOA 1J9GA 1DXOA 2MOKA 3N3AC 4M0CA 3B6IA 4QODA 5LJIA 2FX2A 2BN4A 4H2DA 3F6SA 2FAXA 2V9CA 5EA2A 1CZKA 4ZVLA 3NFRA 2WC1A 3B6KA 2BMVA 3SVLA 5FUQA 1AKVA 1YCHA 2FZ5A 4LTDA 5TGZA 1TLLA 4S24A 4YQEA 3HA2A 5EAIA 1JA0A 2FOXA 5LVAA 1AKTA 1QBGA 2FDXA 2R96A 4PTYA 4F8YA 2QX6A 2QMYA 3D7NA 1H69A 1RTTA 4DY4A 1ZWKA 2FVXA 3FW1A 3O73A 1YRHA 4YAFA 5LLDA 2BPOA 2F1OA 3RPEA 1AG9A 3QFRA 2QX4A 3NHSA 3R6WA 1FLAA 5BUCA 3W7AA 4GR9A 2OHHA 3GFQA 4FX2A 1OBVA 5LBUA 1E5DA 3KAPA 2MTBA 4N65A 1CZUA 1AKRA 1WSBA 4YAWA 3W79A 4CETA 2Z9DA 3NHKA 4FGKA 3OWXA 4N9QA 4QOGA 3OVMA 4PU0A 1D4AA 2FCRA 1AHNA 3FNIA 2ARKA 2Z9CA 3NHFA 3OX1A 2MWMA 3G5MA 3OWHA 3P0RA 4HS4A 4QOIA 4XDGA 4ZVMA 1YKGA 5FX2A 1XYVA 3OX2A 4C14A 4NULA 3K1YA 2RG1A 3NHPA 3JSXA 4XDHA 1YOBA 3UXEA 4J8PA 3EYWA 3NHJA 3OJXA 5EMNA 4YAOA 1AZLA 1J9ZA 4H6PA 3TE7A 1T0IA 4ZVNA 4D02A 1FVXA 2KQUA 1CZOA 4LTNA 1XYYA 2FLVA 3NHUA 3OJWA 2M6RA 3U7RA 1VMEA 3ESXA 2HNBA 3NHRA 1FLVA 1J8QA 2R97A 3HLYA 5B3LA 1CZHA 1BVYF 3S2YA 4YAUA 1FX1A 1DX9A 3QE2A 3NHLA 3GFSA 3OX3A 3EDOA 2HPVA 4ESEA 2AMJA 2Z9BA 3F6RA 5LBTA 1C7FA 1SQSA 2OYSA 5JROA 2QWXA 4LTMA 1AMOA 4C76A 4PTZA 5F51A 1NNI1 1TIKA 1XI2A 1ZX1A 2Q9UA 2HNAA 4LA4A 2QX8A 1AKWA 2XOEA 1DXQA 3LCMA 3KAQA 3NLLA 1I1OA 4Y9RA 3W78A 5B3KA 5NLLA 3L9WA 2A5LA 4QOHA 2OHJA 3KLBA 3N39C 4U7GA 2Z98A 1F4PA 4Y7CA 4DILA 5F4BA 2OHIA 4Y9UA 1OFVA 5ULLA 1QRDA 2W5UA 3B6JA 5A4KA 2GSWA 5LJLA 1J9EA 1WSWA 1T5BA 5LMCA 3W77A 4DIKA 1CZRA 2ZKIA 4GI5A 2QR2A 1YDGA 1GG5A 1CZLA 1H66A 1QHEA 1QR2A 2M6SA 1D04A 1V4BA 3ESYA 4BMPB 5F12A 2BF4A 4QOFA 4NLLA 1RLJA 2V5UA 2FZVA 2BZSA 3NHWA 1CZNA 2N1MA 1JA1A 1SG0A 2X2OA 3LT5A 4OXXA 4C0WA 3NHYA 3ES9A 2Q62A 4GQIA 5FA6A 5NULA 2X2PA 3TEMA 3U7IA 1FTGA 3GAMA 4ICIA 1BU5A 3F90A 4U7FA 3K20A 4U7HA 3HR4A 3KEGA 4LAFA 1C7EA 4N82A 1X77A 1ZWLA 3FX2A 3O2NA 1RLIA 2B3DA 2MT9A 3GFRA 3ZHOA 1AKUA 1FLNA 3FJOA 4QOJA 2QX9A 3L9XA 1D03A 2V5VA 2XODA 4HEQA 4ZVKA 6NULA 1XT6A 1RCFA
chains in the Genus database with same CATH superfamily
3EA4A 1LVHA 4G2TA 4RHXA 3ER6A 4N49A 1HZJA 2YV1A 1U11A 2QAGB 4X45A 1UZMA 1Q74A 1KI4A 4H7KA 4MQFB 2Q21A 5IAKA 3BWBA 1N0IA 4EY6A 2ATVA 3RS0A 2A3RA 4MPTA 2EWWA 2DHRA 2E18A 2FR8C 4XGRA 2G9NA 1ZA1A 1PL7A 3HB5X 1QFZA 5CVUA 2VF7A 1NUPA 4WFKA 5KQRA 4OHKA 5IMBA 1L7QA 5I45A 2C96A 3FWKA 2OXTA 2JJ8A 3MA0A 4LY3A 2IFTA 1G21B 3KQYA 4IDDA 1VJ0A 2A1IA 4LHSA 2XW6A 2F3SA 3MOSA 3W5VA 3D6NB 3DBIA 3E7XA 4ENTA 4OP3A 4NYJR 2OHGA 2WY2D 1D4ZA 4MP8A 4Z49A 1XA4A 2OK8A 3RRXA 4LJLA 4DG5A 4UCXA 2FG7C 2IPXA 4ZAWA 1WF6A 5HJ2A 4KUGA 3NOXA 1MOQA 3K8ZA 1A9YA 1QX3A 3C15C 1EUDB 1MNQA 4GR9A 4ND2A 5KOHA 1CS4C 2CSXA 2VUTA 3F6CA 1CW2B 1W0KA 3HWX1 2VAMA 3O3NB 4Q7LA 4S1WA 3RUEA 3SD7A 4P84A 2RHDA 3KLMX 3O47A 3ZK9A 4DSAA 4X62B 3EUEA 1GZUA 5K3AA 3I0NA 3EDYA 3M83A 4RY9A 3FVTA 4E5MA 2PMDA 4EJ6A 4I55A 4CEIA 5IVIA 1MEOA 4WKPA 3TZEA 1U9IC 1V48A 2X8BA 2XHEA 4XWYA 5EL0A 3T99A 3KU4A 1CQJB 2N1BA 4O4JF 4KKVA 4XVUA 5CA1A 5A0TA 1HG1A 2TMGA 3VR2D 1VKRA 2AKAB 3IQEA 4P22A 1JWBB 3AILA 4RAOA 5CHYA 4BAGA 3W5BA 4CM9A 1W5SA 4UNIA 5DNWA 4B48A 4GHWA 2Q45A 3Q8WA 3CZCA 2RONA 1ISRA 2WM2A 5DXAA 5EPOA 3TNDA 5C1DA 4BKMA 2BI4A 4EKDA 4AJPA 4AKGA 1NHWA 1WB4A 2VXYA 2ZI6A 5KNDH 5B3LA 3H13A 1P8AA 1PL0A 4I1VA 5CNJA 1OGIA 3GZNA 2GLTA 3IERA 3K53A 5FBZA 1WG8A 1Y3DE 5CCDA 1DE0A 5HKBA 3IEMA 4QAJA 4MNTA 4RTSA 3K0FB 2R7MA 1VG1A 2ZWPA 2EDAA 1QO0A 1CS0B 2R25B 2CLLB 1Q11A 1R4NA 4G4SO 4S05A 4AL4A 3CLTC 4BZZA 3LUJA 4Q7QA 2IDZA 2V9ZA 2J0VA 3O1HB 5JVDF 1WD7A 2RC5A 4YN3A 1A9XA 1RWMA 1PWXA 2V7VA 4CM4B 3OFJA 4H7DA 3DR5A 1Z4PX 5DE3A 4DILA 4W9MC 1HR0B 1V6CA 3SICE 4FLFA 5HF8A 1YKSA 3TAXA 4BPRA 1T9CA 5EE0A 3QKSB 5SZIA 3QNWA 1HC7A 1NR1A 1KY4A 1NT2A 3MGAA 5DKFA 1H66A 4IHAA 3RAPR 8MHTA 2OPBA 2SCUA 4K05A 4LZWA 4ZAXA 1VLVA 2JJ1D 4KTTE 2NXWA 3MINA 3I32A 5TARA 3RAJA 4Y9DA 1ZFNA 4YP5A 1KXZA 2G0TA 2FX3A 3HGTA 4IZ6A 4ISBA 4YJDA 2X5KO 5D1NA 4O29A 3SYMA 5L6LB 2Z83A 4EHDA 1ECLA 1PW5A 3EZ6A 5FO0A 2IU6A 1Q1BA 1W0CA 2ZTLA 3ABIA 5ABPA 3AVWA 3L93A 4HVLA 1I8TA 1N57A 3IE2A 4Z53A 3GIDA 4BO1A 2QN3A 2NVOA 3OM9A 4LHXA 5EQJB 4ETNA 5HUHA 2I62A 3GVCA 4MLCA 2YQ5A 1Z0DA 2C5HA 1ZI9A 3EZGA 1IY1A 4TV8B 1I4WA 1X9HA 3K6RA 3ROTA 3ON5A 1U2PA 4YALA 2GPYA 2Y6UA 4CYMA 3A2NA 3QQPA 4QWMA 3ULKA 4QSMA 2Z3VA 1RJ9A 3EEBA 4GL2A 1NV8A 1FF9A 1KZ1A 1WCYA 3TI9A 2VWGA 4PVCA 1S01A 2QLTA 5FA5A 3S44A 3U1BA 2Z08A 1U3DA 2B8NA 1W5BA 1Q12A 2NZ8A 2QRMA 3EHDA 3NTQA 1GPLA 1M5UA 2H9AA 3QBVA 2QRJA 1T13A 1U2RA 2A9QA 4ADSG 1XX6A 1OAAA 2HMAA 1KJQA 2O20A 2WSSA 3G0OA 3OZIA 3SLGA 3ICPA 3LMKA 3FMFA 3MTEA 4ZO7A 1I3LA 4MROA 3N2KB 3PHHA 3QPBA 4IDEA 1BFDA 4Q82A 4Y9SA 2FE1A 2BFNA 2H0RA 5IEJA 4O2BB 4IVPA 721PA 2Z2YA 3JAMA 2NXJA 1E79D 2J67A 4A2QA 1UDCA 3DFUA 3PKJA 2C4NA 1X1SA 2XQGA 1ZS9A 1HDOA 1WNFA 4LJ7A 3AWIA 3GOHA 1WVMA 2JGRA 4AX8A 2FF7A 5EYPB 3G0HA 2H2IA 4EVRA 3GMSA 2AFIE 3D8UA 3E35A 4A8TA 2HRBA 4YMHA 2HM7A 3SM9A 1YOBA 3X1ZA 4BBZA 1P4GA 4E1BA 5JLJA 4FMCB 4UOEA 5JWOA 1X7YA 2A59A 1AUPA 1U0OC 1YJAA 3PIIA 2WJAA 1XZEA 3EVAA 3M4JA 4OUDA 1V41E 5DBGA 4IDBA 4M1QA 2IZ1A 5FTNA 3CO0S 3U49A 2F9LA 2OZLB 1FTWA 3AUYA 2MYUA 1TVCA 3BCHA 3R7LA 3ZW9A 3JYHA 3RFUA 3HPRA 4Q1CA 2YCBA 2PUEA 1BW9B 3JR7A 1N6NA 2JI4A 2OVBA 2IUYA 3VJKA 1Q0LA 5GOTA 2HA0A 3RYHB 1OKKD 3GEIA 4P3XA 3V2HA 1QTRA 4E4TA 4P7BA 2G76A 1ECPA 4U3JB 4MKHA 1R64A 4TQAA 3Q6NA 4Q3LA 3CLVA 2PO5A 1Y8ZA 1DTEA 4PLTA 2JIBA 4UDOA 2V7WA 5BQPA 3ILVA 5TF0A 4LDNA 2PZJA 3DTYA 5E2AA 5A05A 3EG9B 1XDSA 4QO8A 2CNDA 4CG1A 3NVDA 2VP4A 2GZMA 2QT0A 4FD3A 3ICQB 1Q21A 1LB1B 1SBCA 1RC0A 2BV3A 2GPAA 1N8TA 1OT5A 2QGZA 3A2MA 1RSZA 3GAAA 4K8OA 3QEKA 5T6MA 1KPGA 1PJBA 1W5TA 1PL8A 2EEZA 2CNOA 5BW5A 3R20A 1RYYA 3LF2A 2J45A 4MVJP 2IP2A 3CU5A 5K4GA 1TJ5A 3RVNA 2Y2VA 5FH9A 4K6OA 2PZGA 1D7OA 2W2LD 4GS5A 4C0KA 1ZIYA 1CY0A 2ODWA 4FZ5A 3D7SA 3DT6A 3GRPA 1BQ3A 3VU1A 1P60A 3PSAA 1CE8A 5LOVA 5IAOA 3AO0B 4E6EA 3FAKA 3K92A 1BDJA 4YVFA 3QOWA 4B34A 1VDZA 2WUDA 3K9CA 1E2HA 4C4AA 4X65B 3T7DA 2BOVA 4PHHA 5AK6A 1G5RA 3U7GA 2A9OA 4NMMA 2NTNA 1P1IA 3H1EA 3VISA 2OGZA 5H02A 2D7CA 4OAQA 1TK3A 3TW8B 2PS0A 1KQOA 1U0RA 3F78A 5PGMA 4WY8A 4MIYA 2FPGB 4EUFA 1H05A 4S35A 1GTRA 2ZUBA 3IPAA 2BTQA 1O1YA 1UJ5A 1PJRA 5G02A 5GQSA 2HMUA 1ZUIA 1TQ4A 4KGVA 4BFZA 4YA6A 1YCHA 4XQEA 5EXEA 1WD5A 3BHIA 3GEMA 3NRCA 3M89A 2OWDA 4PX3A 1DUVG 3QZUA 3QVJA 5T4FA 3UA3A 5B1YA 5CURA 1J90A 3TCNA 2VF8A 2VK2A 3CZAA 1Z73A 4QE3A 1RLOA 3L8MA 1A88A 5HFAA 1ID8A 1O95A 1CY8A 1B41A 1Q7CA 1YGPA 2EZ8A 2W6OA 2IYUA 2WJYA 3IT2A 1XAJA 1ZDMA 2P6UA 1GJRA 2G9QA 3FLEA 1KK0A 4DLAA 5DPMA 1A9XB 4D6XA 1I33A 1VBFA 1QFMA 1W5FA 221PA 2GDZA 2PLRA 4Y2TA 2PZ8A 2UYYA 5HA5A 1SCQA 3KL4A 1RHQA 2D6FA 4DMLA 2QTMA 5E4YA 3B48A 4ND6A 5DW3A 5FL7A 4RQAA 2W6QA 3ZW7A 3WV5A 4B33A 5I7UA 4OLAA 5GJBA 4R05A 1L9KA 3W5HA 4E31A 4YROA 3N0RA 3KIPA 4FEAA 3VZPA 1J4AA 4YT5A 1RKUA 3R3UA 2DY0A 4IBOA 4MWGA 3ZK8A 1BKSB 3EGDA 3IDFA 2J3EA 2OCGA 3BFVA 3I76A 3AP3A 3MLEA 4WRRA 4EB3A 2QMOA 5DFAA 1KSHA 4J6EA 2NU8A 3R5SA 3RBAA 3JCZA 2HI0A 2M6RA 4BECA 3TO5A 1F2UB 4G5YA 3RNOA 3WGVA 1Y82A 4BB9A 2JIRA 2ZRBA 4D5EA 1GSIA 2QB5A 2PCLA 4TYQA 5HQ3B 3LDAA 1TCAA 5JD6A 1IXZA 1M2WA 2V0NA 3LRXA 4F6CA 3LTNC 3QXGA 1OZAA 3H16A 4JOQA 3RB8A 3RUDA 3VU0A 4BVEA 4TVKA 5J9FA 3KBOA 1I7DA 1N6HA 2EKBA 1A9SA 4JUDX 2YWGA 1USWA 2GM3A 3BXOA 4K03A 4LWZA 4QBHA 1ZLYA 2HDOA 3IC5A 5G1OA 1YQWA 4G86A 5B4TA 3GOQA 1EVYA 1WXWA 3PGLA 3DVSX 4KAJA 3L6UA 2QL9A 2H2GA 2C4TA 3GVXA 5FYDA 2XDQB 3C3YA 1LZKA 3NP9A 4J2TA 4PZDA 4WXRA 4D8YA 1BVHA 1O57A 1WR8A 3GUZA 3HDTA 3I9V6 1NC1A 1DBPA 1Z74A 1TC2A 4M0LA 5IS2A 1A8HA 4X6YA 1WDTA 2ZYWX 2WJ6A 1PG5A 4NYMQ 4V24A 3CX4A 4YRCA 4GT1A 1JFLA 2DT8A 5CHEA 1LJLA 1XJWA 3TRJA 3ESDA 4OXXA 5K0JA 1FYDA 2P9YA 4PX5A 4YHHB 1E2GA 1F1JA 1GGMA 3A4YA 3IPLA 3LPNA 5KX5A 3LT2A 2VP0A 2WRZA 4KQMA 4ICIA 4Q93A 4QPNA 4YP6A 3WWZA 5B57C 2FSVA 5ALXA 3RBVA 3BMNA 5GPBA 3RC2A 1T4MA 4KO1S 5EXSA 1W47A 5AYVA 5A3JA 4J0FA 4D8UA 4MUGA 3RYFB 4JSYA 4CKBB 4BVJA 1LBTA 2FPIA 1G3UA 2RAFA 4N9WA 4MRAA 3PNQA 2WWFA 1AKQA 4YMUA 4GOLD 4GX0A 4C7OA 1M8FA 2RBEA 4M9UA 2A58A 4KX5A 3PTZA 3U4IA 4DWVA 2LCIA 3CNEA 3IS3A 1FK8A 1RAIA 1U3WA 1YR9A 1IEXA 2PBZA 1AGRA 3TW4A 1KNXA 2HWUA 4CLHA 4QLBA 3TPFA 2NO4A 3ZDQA 4DCVA 2XKKA 1P45A 1G6HA 2CXSA 5JO9A 4ZWNA 3S7TA 5HZMA 1ABEA 4NARA 1Z75A 3M2TA 4Y30A 2OWEA 2V8OA 1UKVY 4MS4A 4AUMA 2IZZA 2YIMA 3ZH9B 2WU3A 5EJIA 4E70A 3HXLA 1Z63A 1R6AA 4CCSA 1ODCA 2VUHB 5DOZA 4OHFA 3MQ2A 2F2TA 3PE4A 3TQSA 4ZYWA 2FOIA 4QHYA 3N8NA 5HHTA 1JMVA 2CEAA 1Q6YA 3CNNA 3BICA 1EI9A 1BZYA 3ZGVA 5FI3A 3REQA 2NYAA 4DEYA 1TM2A 1XU7A 3L6CA 2FETA 2OCLA 4ZV4A 1YNSA 3GRRA 2ZB2A 5JDCC 3CLSC 3VO9A 3RC3A 2CY0A 2IGBA 5HDQA 4F2WA 1L5QA 1DRUA 1VG9B 3ZE8A 1OXSC 2BHSA 2OP1A 4DZTA 4DJDC 1AT1A 3DTNA 4I5EA 1NOIA 1H2ZA 3SJAA 2IRWA 3GB9A 4IXWA 1A7KA 3AVOA 5ER9A 3TBHA 4MGIR 4F1WA 2CZGA 4BGEA 5CLJA 2N75A 3N74A 2HNKA 2WYHA 3IMGA 2CL0X 4RANA 2I9KA 1D9XA 2DBRA 2UVDA 2HT1A 4M0FA 4UUQA 3OEWA 5FBQB 4TSFA 2J33A 5FWXA 2B78A 3GARA 1G8HA 4O6VA 5ETJA 4FMDB 3UBMA 4AJ9A 1VPVA 2F1HA 3UJNA 3ZGLA 3CA8A 2C31A 3JAWA 3NXKA 1ECFA 1A2OA 1HMPA 2HYDA 1E8NA 4L4YA 3WYBA 4AJHA 3DPIA 3F1KA 3OIDA 5DISB 4YAIA 3FGOA 2OV4A 2W11A 2GN8A 2WNSA 4TWRA 1H0KA 1SULA 1EVIA 1G21A 2JJYA 2OO5C 3HE3A 1XKLA 4MJ7A 4DLTA 5JXHA 4W5QA 4ZALA 2LV8A 3CUTA 3TIGA 2JLVA 2VK1A 2I6UA 1J09A 1G5PA 3JPWA 4IIBA 5CXXA 3HB7A 4PLVA 4H31A 4A8JC 4DVJA 1K3TA 2HUNA 1OLUA 3RT1A 3ICVA 2A88A 3UCFA 3V4VB 4ALJA 3EZFA 1GGVA 3LOUA 2IDMA 4BVGA 1GPMA 1IBSA 4ER5A 5COQA 3WLPA 2FWPA 3SYRA 4EGJA 3KFVA 5JCPA 1L5WA 1CEXA 3ITNA 3JARA 4F96A 3WL8A 5F3WB 3TD2A 3AC0A 2LD4A 5LU9A 5B3JA 2C4HA 2PRKA 4YI5A 4BGUA 2OFPA 4HO1X 4XIGS 4BO4A 3KM0A 2JASA 1ONOA 5LZ7A 1I1NA 1ZWLA 1PIWA 4JB0A 1SIBE 3FJOA 1FLNA 1WY7A 1OFUA 1OR8A 2QX9A 3SM3A 4BBPA 1H4VB 2G08A 2MINA 5K0SA 2G25A 3OZ7A 2CJYA 1PYDA 1KZ6A 2DEUA 4FFVA 1DPFA 1N4AA 3SOPA 4JH0A 1K6EA 1CDZA 2NZWA 2ETXA 4B6GA 4YUXA 1COZA 2F4NA 3ENQA 1KYQA 2IZ7A 1JLLB 3KYCA 4DKXA 2Q3DA 3ANSA 5CIWA 1Z82A 4OGFA 1XCLA 2IYQA 1F9EA 3KJXA 4F38A 5KI6A 1CJCA 2GAIA 4XUDA 5FPHA 3X2SA 3NT5A 3R0JA 1ESDA 3QY9A 4AXBA 1ETHA 2YRWA 1EIZA 1Y6QA 1RYEA 2ORVA 2SKCA 4ZOAA 4A0SA 4F8YA 4TZTA 1CRWG 3PF9A 4MCJA 3T7KA 2P5TB 5CBPB 4Q7EA 3OC0A 4G41A 1CUUA 4RH1A 4NZOA 4A3SA 3SZRA 1CRQA 1G9XA 4RD0A 3KYJB 4I7EA 4G1UC 4UM5A 1Z5UA 3STVA 5P21A 3CR3C 3R6WA 5IYZA 3CRZA 3I01A 3CC8A 4JJFA 1J2YA 2HTEA 2I4TA 3CM0A 3NHZA 1A4XA 3ECCA 1Q0SA 5AVTA 1MP0A 1KO1A 1PT6A 2BJWA 2NT4A 4TZ6A 2GAOA 3RFFA 4X00A 5FUVA 4B45A 3PJFA 4BMVA 3ZK7A 1MLDA 2OFXA 1EK5A 1G0NA 1UK7A 2MWMA 4ZO9A 3ZE6A 1F51E 5TX7A 2PMFA 4HTFB 1OB2A 5ESWA 1HPLA 4NSNA 4GZ6A 2LWIA 4JYMA 2EFCB 2XKAA 3ZDBA 1Z7YA 1G0OA 2MSCB 3IUNA 2Y1DA 1Z2PX 1UOEA 3GVPA 3OLZA 3QI2A 4UZEA 1RBQA 1AHHA 3OICA 3IALA 2C20A 3W04A 1QC5B 2VAXA 2EKPA 4AF8A 1NXXA 4WZBE 4TM8A 3FI0A 3A6ZA 2O1SA 1MIOA 4KL8S 3HJAA 3CZMA 2OYCA 1I0IA 1O77A 2R3SA 3KT3A 4NNJA 4M8IA 3SX4A 3BGDA 3TUJC 4GVXA 4X7BA 3NWPA 2MHCA 3OZCA 5EPEA 4TYWA 4A36A 4TYYA 1FXWF 3WAGA 1NMQA 4GPD1 5AVKA 4DJAA 1IZZA 1MH9A 2VP6A 2IH4A 1GCUA 3TLBA 3W9SA 2HB6A 4LJKA 3UEOA 1NBEA 3KVNA 4KN8A 4IW3B 5KINB 3EPJA 2YTZA 4HI0E 2BMDA 4TKUA 2J3IA 3D8NA 3WHPA 1HNZB 4PE5B 4LZPA 5FTMA 1JTFA 4PFKA 1B8OA 4WOJA 2NV0A 3U3ZA 1PG2A 1J7KA 3TVDA 4NBRA 3GW8A 4TRJA 1L7EA 1QUFA 2FMTA 2PFSA 1D5WA 1R0CA 4O4LB 2B30A 5AKGA 3HP4A 4PWZA 5J2TF 3V4OA 3WK7A 2HLHA 2BMFA 3HEAA 2QVCA 2YXDA 3FNGA 3O95A 3DFKA 1QK3A 2ZG6A 3IUQA 4GSYA 4INAA 1RYBA 3H4TA 4P0TA 2QI9F 1FFCA 3UHFA 2ZWOA 4PG8A 1R5OA 2E9SA 5B55A 5NULA 3I4LA 1GNRA 1NUAA 4RO0A 5GV8A 4TL7A 8GPBA 1JEDA 2JKVA 2V98A 4H08A 2W8BB 2VT7A 4HFMA 4M9RA 4EFLA 5IJ0B 1FNNA 2H8KA 4H1UA 4UBLA 5EHZA 1QZXA 1XVLA 3LHSA 4I6EA 1U63A 1SC4A 4KACA 4N03A 2LIPA 4JJ7A 3VZDA 5KBYA 3ROZA 1MO3A 1QH0A 3RHTA 4XWOA 3JQAD 1J99A 4CKCA 3ZWVA 2B69A 2Q3HA 2BBWA 2C58A 4KAAA 1XTRA 3VPGA 2JAHA 4D8VA 4ROTA 4TMXA 4QKQA 1KMHA 4RMGA 2YMLA 2FMHA 4H7FA 5BSEA 3DAFA 2DPGA 5KTOA 3ESAA 1GCIA 4Z2YA 5AESA 3D7KA 3M3DA 1KJNA 3K0EA 2IITA 1T5DX 4BYMA 3T0GA 5IJ9B 3OWOA 2QRNA 1YA8A 3URMA 3G0DA 4HDSB 1WZEA 4MUMA 2CT8A 1EA5A 3D0OA 3D2CA 3TIFA 4B3XA 1UR5A 3D7NA 3PFNA 5KZMB 9LDBA 1H2AS 3LIIA 3NPMA 4ZU1X 4LOKA 2CZQA 4IOKA 3TXXA 4GLJA 4UEQA 4M1EA 3JD4A 1ZGBA 3ND6A 2XNDD 3SEQA 2ODAA 3TLGA 1XB2A 2G3YA 4FONA 5DVZA 3R7NA 3JD2A 1OTHA 1H9CA 2H11A 4RK7A 1Z5NA 1F0PA 1GTZA 1HDCA 2EZTA 1H2HA 2G77B 3IV6A 4HYQA 1FSPA 1XD9A 3K0BA 1U94A 1VL0A 3NDBB 3P2EA 1Y3FE 1Q0TA 3IO3A 5JANA 1Z13A 1ZOIA 2ARKA 2J0UA 2QSYA 9ATCA 3P0HA 1B1AA 2QW8A 3CCFA 4XDGA 2X0DA 3WSVA 1YQUA 4Q1DA 5DEOA 2E4XA 5F7JA 1M1NB 5HNKA 4X66B 1DADA 2W9XA 4PGGA 4UTXA 5C81A 1FPQA 2F90A 4GXNA 2H63A 8ADHA 2E85A 2D5BA 1AIPA 3AETA 4NHOA 3MRTA 2CVPA 5F7XA 2P9ZA 1XZPA 2E5FA 3CY6A 4YP1A 5TEVA 2ACVA 2FN4A 3DZ8A 2Q07A 5JBNA 4MQLA 4LTNA 1G18A 5TMDA 4JLVA 3IAXA 1IZ0A 1Z33A 2OUKA 2EG9A 3AB8A 3COVA 4ZV7A 4B3JA 3OHMA 3U7FB 4JQSA 5D2CA 3UAWA 1BVYF 2QG6A 3FIUA 1MR3F 4XLTA 3ZTWA 4AIRA 4E5NA 5LP6A 2PUCA 4DOMA 3IP3A 3F7TA 4D5GA 4W7SA 4AY4A 2RJNA 3EDOA 1OZ0A 2XRYA 2RGAA 3CNQS 1NP7A 3DTVD 3QWBA 1TQ2A 4MW1A 5H4GA 3EVCA 4EARA 1DUSA 3OA2A 2NO9A 3LOPA 5BSKA 1FFXB 1TT7A 1PJ8A 2ASEA 2EBHX 2REQA 2E55A 3HJBA 3IHLA 2OAQ1 2AQKA 3DW1X 3NI2A 1UWKA 1G8JA 3G0CA 3WMRA 3HUDA 4BEBA 1PZFA 3AEQB 2JFVA 3ZX4A 1BO6A 1MB4A 4DNFA 3QMVA 3CEPB 2OQ2A 4QQKA 1P75A 1WHSB 1Z2CA 3PWKA 5K3CA 2FJPA 1XBTA 3G6KA 1RQRA 1JPVA 4HQRA 1JB1A 1PTKA 3J81k 2H52A 3EZYA 4J90A 4A8JA 2AMVA 4IMRA 2OQIA 1Z6ZA 2GBGA 2Q28A 3SK0A 4DUGA 1ORHA 2C0CA 4YRJA 1JSRA 2VHWA 2X3YA 4YMSA 4ZVTA 3N2NA 2XWPA 3AH8A 1XFAA 1MC8A 1N25A 3GU3A 3LK6A 4UAVA 4UQPA 1XNGA 1XK6A 4LDPA 3SC4A 3GUHA 1JEQB 5JY1A 5H3LA 1QH9A 2W6NA 1J0DA 1EFRA 4QYMA 4ZJUA 1K3UB 1PZXA 1QIMA 2XTNA 3CHYA 2W6ID 3NWOA 1NGSA 1GQYA 4UUMA 2J9RA 1ML3A 4OHRA 4HVCA 5ADWA 1T2EA 4EUKA 5DTIA 5CITA 1QF7A 1Z37A 2H1WA 2QOEA 2RAUA 3ICOA 1NQOA 3JW8A 4FZVA 4OXYA 3V8VA 1JHAA 1YUNA 2OSBA 1KNQA 1P33A 2X14A 3A8TA 3EFBA 4XLZA 4BU1A 4CKWA 1RAEA 1X1EA 5IC6A 3U3KA 4D3FA 2YKGA 3PKIA 1XRRA 4UEWA 4Z5XA 1ADYA 1YQDA 4ZIRA 3TSYA 3QYFA 4Q6WA 2RARA 2YHIA 3IAS6 4URXR 1Y98A 4LRYA 5CPBA 4EMTA 1B0PA 2ZB3A 1HQYE 4FFWA 1NDUA 4DCMA 1T3ZA 3KTDA 1RTTA 3F5MA 5AVJA 2GMWA 1U2SA 2R8OA 3EASA 3IJPA 1MFZA 5GWXA 1UKCA 4EWLA 2JLYA 1WXXA 3KV1A 2ZRAA 1T9BA 5H5JA 2G80A 4FX2A 3LWDA 1T4BA 2FP4A 2AFHE 5KX5B 2FSFA 3GLFB 4FJ1A 3F5QA 2DKNA 1ZAKA 3IR6A 2LDXA 5AD1A 1IN4A 2IYPA 4P86A 3QA9A 1OLOA 1NC3A 1T8WA 2C4MA 2RHHA 3OM8A 3QLUC 2QTGA 3RJZA 3CEHA 1UCFA 3HV0A 3KNZA 3WLNA 2ADFA 1VYTA 5AJXA 2D13A 2C2ZA 3A27A 4LXQA 1E99A 1XZGA 1H5UA 2VBFA 1V8DA 1LBSA 4X94A 5DLYA 3DAHA 3RU3A 4ERNA 4EL0A 1DQNA 1C4KA 2BCEA 4NMXB 4RCZA 4ZCLA 1GM5A 4WNCA 3R76A 3UYKA 2LIVA 1OXBB 2IHZA 2QUKA 1YVPA 4UU7A 3DYBA 3W4IA 3KFLA 4YX9A 4ZOQI 4C3UA 4HUQB 5BUQA 1NU8A 1SBYA 3JYNA 3PXEA 4PX9A 1MG5A 4U6SA 1M34A 1J8QA 3DE0X 3CLSD 1KJ8A 4GD3Q 4PICA 3EBOA 5F1PA 3ZH2A 5JS2A 1IQUA 1NWCA 1XHEA 2W8BA 4NYJQ 2RMKA 4IDCA 4OA5A 2FEAA 4RIGA 4U0JA 3V7NA 1YL6A 3VKUA 2AMYA 4LZNA 3KHTA 5BSUA 1YB5A 3MYYA 4A0HA 4MRPA 4Q66C 4TMVA 4WJZA 1IXSB 4JMPA 4KYUA 4I4TB 2IXTA 2WNIA 2ZS7A 5ICEA 5CJJA 3M9WA 1DRVA 2SECE 3Q2OA 1SOAA 5FOTA 2XIJA 2GCIA 3WNZA 2OY0A 3OEED 3F6PA 5F1OA 2HCRA 2M98A 4HTAA 4TN5A 4UHKA 3H2ZA 5U4XA 2OQVA 3HBMA 4M8NE 3DA8A 2ZBDA 3C1UA 4IGIA 1JDBB 1O89A 4L7QA 3PFWO 3WX0A 3X0DA 4UCFA 4MUNA 3W5UA 3IAM6 3K0CA 1DV2A 3QUBA 4RS3A 1CX9B 4A26A 2QRUA 4F4UA 5A9SB 3BC1A 3HDJA 5HIAA 1GDHA 2Y1OA 1J56A 1W36B 1I5OA 5CXUA 1A95A 5DWVA 3I9MA 1L4HA 5IKXA 3V00A 3DSRA 4UULA 4H0CA 4FOSA 4HF7A 1R8QA 4G4IA 1O0BA 3ZHOA 1AKUA 4MUHA 4N3GA 1MC4A 2G5PA 1JXQA 4B4KA 3KJHA 3I5MA 1E6MA 1MEEA 1P61B 3HACA 2YYYA 3LF1A 4E2ZA 4MV3A 3LYAA 2J0UB 1XZNA 4YUVA 3X1KA 1KJWA 3KELA 4N40A 2OZKA 3R9XA 2OV6A 3ACCA 3B5EA 4UPVA 3AEXA 2G06A 5K0LA 3VHRA 1YZKA 4WBXC 1L4UA 1IN1A 2HWWA 1K2VN 1K7FB 2NYRA 2PYDA 1FVOA 4K86A 4FFLA 3QKWA 1D6SA 4OF4A 5AKXA 3RASA 4U7PB 2PNJA 3UJDA 1JG1A 2OAP1 1ZGGA 4YT8A 5ALIA 2ZBQA 2XB6A 4YRNA 2GJAA 4HWGA 4FE4A 1E3WB 3JASB 2OZLA 4OI1A 2ZVDA 5C34B 1BEUB 3SFVA 4LF6B 2BMEA 1NVGA 4Y98A 1L5RA 2G70A 1MX1A 2O2HA 4LX0A 1G5TA 3L7NA 3OO0A 3A9UA 4E5PA 3W7AA 5KS2A 4GKBA 3GBPA 2VJPA 4H1VA 4QLAA 1N1MA 2XQKA 3AHCA 3E53A 4TZ0A 2P9HA 3W79A 3GLHE 1CULC 1GRVA 4AYTA 2ZSEA 2ANCA 1A97A 3MM4A 2A5GA 2IOFA 3LCJA 3PPXA 1RQLA 1WU7A 5LDHA 3GDGA 2UYCA 4L7VA 2R751 3OKPA 5C1OA 1SOVA 3PI7A 4U4AA 4U63A 1BFKA 3RHSA 4B2PA 5SYAA 4BNIA 2Q50A 4D3SA 5BXQC 1Z62A 3EUAA 4JHLA 4NULA 5CVCA 5HQTA 4PLGA 1G8AA 4HAYA 2JIMA 3EA5A 1PDOA 1P9RA 2IEBA 5AKEA 4N41A 3F6EX 4KWEA 3ZZ0A 5FFMA 1MJHA 3VC2A 5I3ZA 5C53B 3WLOA 3DKVA 3KVYA 4L28A 5HBGA 2O7NA 3DCJA 4IG9A 3I45A 4RKQA 1DXYA 3PRHA 3W4JA 4AMZA 4AY5A 3PFGA 3TSZA 3TX6A 3VTFA 1SHZA 2XITA 3L7OA 5JYDA 3NS7A 5KO2A 3KQLA 1P3DA 3OJ0A 3R3SA 3DE4X 3JRXA 2GLUA 3R6TA 1C80A 4KBYA 1C3LA 4J0KA 1ZCZA 5EYPA 2JGMA 3RFVA 3LPMA 3OMLA 4D4HA 3BK7A 4DJ5X 3T4PA 5C8YA 3A9CA 3FBWA 1U9IA 1CHDA 1TT5A 1SGWA 2QUBA 2WWGA 2GBLA 3HGQA 1EWQA 1OH5A 1GZDA 3TW0A 3UZUA 4YQFA 2B98A 2GTPA 4JMLA 1VIMA 5JS7A 2FPGA 1LDGA 1Q0UA 4X6LA 2OBYA 3R3WA 3RBXA 1IU9A 2SCUB 3G8AA 1KQ3A 1T5LA 3HU3A 4TUYF 5I8WA 4EI7A 5BV7A 1K7XB 1SC6A 2FSIA 1DTWA 1QVAA 2VJKA 3JD3A 4II3A 3PC8A 4RZSA 1O5IA 4M55A 5CB4A 4QTXA 4OOEA 3EA0A 1D0SA 5CFNA 1ZK0A 4MGYR 5DT2A 5HCNA 3CNBA 4TLDA 1W35A 2F8SA 3V7UA 1N2CE 2QM0A 5BRAA 2LDBA 3B7WA 1DFHA 1S2MA 4O8CA 4BLPA 3VVCA 3NV7A 3A2KA 3BDIA 3D1LA 3ZDFA 4D9FA 1QP0A 2V96A 4W6QA 2FR8A 3ZI7A 4OP1A 2O1EA 1XF9A 1LV8A 2HA3A 3M49A 4MUIA 4GSLA 4IMIB 2HC9A 2Q5FA 4QULA 4REQB 4XUGB 3SSNA 4MEJA 1KF0A 1Z4NA 1ENYA 3B3QA 3WISA 4D4LA 3DJYA 4KQ1A 3C5EA 3I92A 2PR2A 2W6PA 3IV7A 4DR1B 3AVYA 2PZLA 1E2KA 2QRGA 4B9AA 2H9IA 1A8IA 2UXCB 5HE8A 1MABA 1DBSA 2V03A 4B7ZA 1XVVA 2RIPA 1V7QA 4Z4HA 1OU4A 3L7JA 4GPTA 4O4IB 4MVJA 4POOA 1OOEA 2M1ZA 1ZAYA 3GFVA 3LQ2A 2D5AA 4M7PA 2HCJB 2WU4A 1WZCA 3IDQA 4AT1A 4DTCA 4K9SA 3ONVA 4HJXA 3U37A 3E27A 3MJSA 1ZD3A 1U1IA 3ECSA 3TLMA 1IDN1 2OB1A 2RGBA 3OIWA 4I4IA 3E7WA 1QYVA 4TKUB 3GNSA 4H7EA 3AF1A 4EHAA 1CZUA 4NIMA 4BTLA 2PGXA 5AKYA 5FJJA 4HRYA 1ZNYA 1H65A 4N5LA 2XUIA 3ETEA 1HYBA 4BKOA 3JATB 2IIPA 1ZRSA 3PDCA 3R7WA 1D1PA 3AI7A 1MC5A 2B83A 4L3OA 3DVRX 4YIKA 3TXYA 3DMRA 3NW9A 3TSAA 2XDQA 3ZI0A 1IBLB 3TOCA 3SDZA 5DYYA 2BFFA 2WAAA 3AETB 2XLCA 3E61A 3MUFA 2Z1MA 1P1HA 3DD5A 2J41A 3JV7A 5U1PA 3MGCA 1R27A 5EIEA 1GN8A 4LYGA 2QXYA 3CXRA 4RK4A 1ZNQO 3C3AA 5BQFA 2VSNA 3I2HA 2IXBA 3NHRA 1EM8A 3L6OO 1UXHA 3AY7A 3TL2A 1Q2XA 4MHTA 3IQZA 2G0AA 5FPKA 3M2PA 1GLNA 2PGJA 2GK3A 4JITA 5A1TA 4NTZA 4O59O 1XHFA 2VZEA 4YBRA 4EG8A 4QDTA 2AOVA 5CT5A 3U2QA 5CIYA 5EERA 1VI6A 1QLWA 4BQIA 4PAOA 3TFQA 5CTAA 2QLMA 3OKCA 4D4KA 4G25A 3H11A 4IILA 1VE6A 4QOHA 1C7RA 1H2EA 3EFOA 3C3BA 1RYHA 3DKKA 3L6DA 4Q03A 5AKHA 2OHIA 2AE2A 3PRYA 1Z6GA 3LUHA 3NKVA 1Y1RA 2O2CA 3IPXA 3TGPA 5LQDA 4JVMA 5AOBA 4RMHA 2VDMB 5KYVA 1OASA 1T8RA 5REQB 4MWEA 4EJSB 2DR3A 1SQGA 3TLCA 1B76A 1REQB 3FN4A 4NLLA 3HEBA 4YJFA 1U7PA 3KVRA 2PXHA 1R0RE 4ZT5A 5M04A 1BQ4A 1SG0A 4LC0A 1DAFA 1B15A 1CWUA 2V7TA 2XE7A 4Y2QA 4KGZA 4IIGA 2ZAYA 5FWNA 5IU6A 3TEMA 2XGMA 3PJDA 2VTBA 3L7IA 3FLMA 2JGNA 2NUPA 4KN9S 3DDZX 3Q85A 2JI9A 2JCBA 2QL7A 1IRIA 3PEEA 3AY3A 4Q7KA 4DR5B 1DOHA 4OYRA 3LZCA 1GUZA 2GWRA 5DI3A 2AL7A 4PQGA 2BP7B 3TRHA 4L8LA 1E1DA 2FWJA 2IV7A 2PMWB 2DJ5A 4UOZA 4BNZA 2R6CA 2WF9A 3E5HA 3KSRA 1N5KA 2Z1DA 3FOAA 3OEEA 4LXGA 4RVOA 4B4WA 3GGJA 5JW6A 1G20B 4PIMA 1J0BA 2CDAA 1QHNA 3EZ7A 4LZAA 4BZQA 2O0JA 5HTKA 4B3MB 1TD9A 1BTOA 2WTNA 3STWA 5BNTA 2FX5A 1YUMA 2CDBA 3OQIA 5JRJA 2DFPA 3AZPA 1KVTA 1CZKA 2FN3A 3PD1A 2YJGA 1IVYA 4OJTA 3ABOB 2CHFA 4CKEB 1VRVA 1P18A 3L04A 4ZK6A 1ODLA 1IVSA 4DG8A 1E5TA 1KRHA 4NDAA 4OFWA 1MBZA 2H1CA 4RESA 5JS6A 4XWAA 4QC2A 5EJGA 2QMYA 1NN3A 3RQIA 3O2QB 1AQUA 1UWCA 2XNSA 2IHJA 5EP3A 2ESRA 2CN1A 1NAIA 2FFRA 1F8GA 2ZYTX 3FCAA 4OH1A 3LPCA 1DAOA 1JQDA 4MKXA 4RZ3A 2AVDA 3NXSA 1IM5A 2IYLD 1F06A 3H2GA 3FWNA 4FDVA 4I4CA 5LQMA 4Q9JA 5ITVA 4FR0A 3X1XA 3JQFA 3G9QA 3KLOA 4LQCA 3DCNA 3PWZA 3QJ5A 3EIEA 1E1LA 3QY0A 2Z5FA 3OVMA 4H6WA 4WLFA 1J97A 3FETA 3WIOA 4ETWA 5LUAA 4A03A 1J1IA 4AJJA 2ILTA 2ZRFA 4N3NA 4TV8F 3WYGA 3TGWA 3B85A 3WRXC 4DR2B 4EYQA 3WLKX 4K46A 1H3FA 1YZVA 4LJAA 3JD0A 5LQCA 2YIVX 1IOLA 4K0RA 5EG5A 3A25A 4ZTBA 1TM5E 2HXGA 1MFPA 4WWHA 4E33A 1W85A 1DJPA 1E3LA 2OZPA 3LUFA 4OXNA 1PI3A 1BGVA 3ZCUA 3O3CA 4TRNA 5KVQA 1VDMA 3KTFA 3QW4B 4OIMA 3SS9X 2JC3A 3IUMA 4AROA 4EITA 4IHQA 5HZGA 3NFYA 3PFCA 4M54A 4LI0A 1U1DA 3CF2A 2POQX 2J31A 3E58A 3L77A 2A0YA 4TLEA 5ENZA 3S3TA 3W9BA 3LUGA 3MOIA 5E6RB 3LLVA 3ZBTA 5LOVB 1RLTA 4LC1A 4OHOA 4BQOA 3FYUA 3QVKA 4GI1A 4YPVA 4ND1A 2X4IA 4UASA 3K9HA 4IGKA 4PHGA 1AURA 1BWQA 4XIFA 4D9KA 4DC9A 9GPBA 2GVNA 5K20A 3TNFA 4IEIA 1I7PA 4MK4A 1C1HA 3PKZA 4FNAA 1LEHA 3E7FA 4HSEA 2NU9A 1POXA 2FGJA 1XCMA 4KCGA 4OL0A 1JHUA 3NLLA 5LNK6 3TUIC 2AG6A 1RI3A 2ATCA 3IOCA 4B43A 2A9KA 2FN7A 1AKYA 1F4LA 2JGJA 2Y2UA 4Z51A 5EFOA 3V1YA 3IEKA 2W93A 1SIWA 3NEPX 4DDTA 3PL5A 3A1TA 4R31A 1V7ZA 4V0OA 3Q7SA 4FMCF 1E63A 3IELA 2NSDA 4RZ2A 3WKDA 4DLKA 4D26A 3DV2A 3ZLUA 3Q3EA 5HM8A 2PRIA 4UBJA 2OBBA 2JAUA 1NKSA 4IQ4A 1DV1A 4BO5A 2ECOA 4P54A 1SUFA 1EIWA 2V6IA 4JXKA 4BX8A 1JHOA 1QQAA 2VUSA 3ICEA 4TLLB 3ZUPA 3I9OA 4DEVA 1M5TA 3KBBA 3QF4A 4KE8A 3URKA 4CGYA 2J9FB 1JKMA 3RDPA 3UW1A 5HKLA 421PA 4BUZA 4E0BA 1PS0A 5I7HA 4E4RA 1QAQA 1RAGA 2D2VA 2PGOA 3ZW8A 4BV9A 1ZIDA 1JMYA 1HFKA 2ZJBA 3CLRD 1GRNA 2NXCA 3SY8A 1I3CA 1I6WA 3AV0B 3VZSA 4PC1A 1A3CA 2R11A 1BGXT 1OX4B 4HYYA 5DDIP 2P2ZA 3EOZA 5AM5A 2W4QA 4AAYA 1BA3A 3LXUX 4QUDA 1IN8A 4N7RA 3WLFA 5DHTA 2AZMA 2J5KA 1M34B 1M7BA 1NVFA 1U9JA 1ZRMA 2R8RA 4PXYA 2JAWA 3IPCA 3MUOA 4Q48A 5SICE 2XF2A 3KXDA 3RG2A 5JSKA 4WNAA 1D2AA 4DADA 1AKVA 1U7TA 3O5AA 4FZRA 1SKAA 1XXHA 4FE7A 2OB2A 4M38A 5HQ3A 5JS8A 4BXOA 4J43A 3GP3A 1UXIA 4PZLA 4V2IA 2JDIA 1CRPA 2XPCA 3WGUA 1C14A 2EJBA 1M1XB 3F3YA 4MP3A 4RD3A 4F0JA 1OD6A 3ZQ4A 3DWEX 3W5IA 3O0TA 2IOFK 1YB1A 2XKJE 2EJCA 5J2UB 3AHFA 1J00A 3MWKA 3QITA 1YZQA 3FHCB 1SG6A 2ZE6A 5PNTA 1UMKA 1CJVC 2HFKA 3HY6A 3K2EA 3VU9B 4DUPA 2ZZNA 3KYIB 5TDHA 1G98A 3WQBA 3S81A 3I9FA 3O4JA 2C2XA 4YAEA 3LPDA 3MJVA 4GQBA 3OKFA 1NMZA 1C5KA 5ED4A 3FPBA 2WW8A 3EMVA 3GNQA 3I53A 5JNTA 3HKBA 3PUYA 4RQUA 3LX6A 2Q7DA 4R69A 5CBPA 1QQ7A 3IGFA 4JP5A 2AEEA 3I72A 1K98A 3JVUA 4RZHA 5JNVA 1P3Y1 5AJYA 2FE4A 3DZCA 4OQLA 4Q3DA 1T3GA 2VJAA 2FJ0A 4CTJA 4D02A 2H1HA 2O2XA 1T1JA 3MFYA 5JCJD 3MPUA 4E1AA 5EE5B 1V25A 1D6NA 4UNRA 3D81A 4Q9NA 2MR6A 3SIPA 4XEUA 1IJFA 3JRNA 2ABWA 3B3FA 3HSKA 3ZJ4A 4WFQA 3QTBA 4DMMA 1KU6A 1BHSA 1MB2A 3CN7A 3SP1A 2VJNA 1G63A 3DOCA 1YNOA 1WQ3A 1UOOA 5C4GB 1Z2OX 3QBDA 2DPHA 2FJUA 4OBBA 4MA4A 1I1OA 4FBGA 1TAQA 1KL7A 5F3DA 3T41A 2GN4A 2JD2A 2YN2A 3DEJA 2R48A 3KWFA 1NULA 1K88A 3B7GA 4Q3CA 4BIMA 2VDRB 3C7TA 3KCQA 4BNFA 1RMYA 2ODEA 4RF5A 3S1AA 2J8ZA 3MWFA 1WSWA 3H05A 1HFJA 4JC4A 5KWSA 3Q8KA 2XSZD 3SDBA 3ZIAD 3OT5A 2HLNA 3FSGA 4BMPB 5F12A 1B0UA 1OY1A 3PE6A 2FWMX 2VJQA 2H4XA 2FSUA 4YJ2A 2WMOB 2Q7OE 2AV6A 4Q1AA 3VUFA 1U0BB 4S2UA 1CUIA 4ZOCA 2NU7B 3KUDA 2X6TA 4PLZA 4OB8A 3CNHA 3K9GA 3SLKA 1PEKE 4X64B 1ZD1A 5JAQA 4EL5A 3J7AC 2FZCA 2XEDA 3BSSA 4ILEA 1CQIB 1Z8HA 4X3CA 5JS1A 1Y4ZA 2RHLA 3G8DA 2G5GX 1XNQB 1RWPA 4JLOA 3GJXC 4R1TA 5D1HA 4EGFA 1IHUA 2C29D 2RGNC 3T38A 5I7FA 1CR1A 3QUCA 3EQ7A 1FLDA 5JDIA 2H48A 3A26A 3K0AB 2GAFA 3VJLA 4M0EA 3TZ6A 2AJCA 1LFDB 4WI1A 4X93A 3C4QA 4O4LA 4X7PA 3TR5A 1AQYA 2XJ9A 3ISJA 1V47A 4BS9A 4G97A 4BFCA 4F4FA 4MQUA 5IEBA 3G82C 3HU2A 3KVOA 3I8OA 1EFVA 4ECEA 2C3YA 4RMNA 1A04A 2FAXA 3FFTA 3JQ7A 4EUNA 3LW7A 3HCFA 4EABA 5FUQA 2HRCA 1TCBA 3IP8A 4OQZA 3GLGB 3WGIA 1QH8A 2AUMA 3OEHD 5EIAA 2CLOB 4XI9A 2P9QA 1BX1A 5E6RA 5F23A 3G5UA 2XB8A 1PYOA 2RJOA 5B7GA 3UMJA 3KKQA 4JGGA 4PSVA 1N3LA 2CVHA 5D3MB 2XMGA 4KIFA 1Q0QA 3VR6D 5BORA 1SRQA 3VDMA 5BNZA 5D5HA 3WK5A 5CX1B 1NQUA 3GZTB 4J07A 1CUHA 2CJWB 4YRLA 3H1GA 2E4ZA 4LHVA 5TRTA 2GFIA 4DCOA 3T34A 1H6AA 1VRWA 5K05A 2J08A 4L22A 4BNDA 2UZ4A 2CXHA 3CMMA 3A1VA 3K30A 3OZDA 4J1TA 4M7WA 3UUEA 4ZTUB 1WCIA 2IWHA 1V9CA 1KYYA 4Q12A 1KMQA 1U3UA 2GBLC 2Z5GA 5IMSA 3IAFA 2CB9A 1FP4B 3GIWA 3K4QA 1TXGA 4FEGA 4E2WA 4P3OA 3GT4A 4WLVA 5KKCA 5F98A 4YK7A 5IP5A 2GPTA 1UT5A 4RE6A 4B82A 4C07A 4P4TA 4HFRA 4OOFA 4FFBA 1QVZA 3K0HA 4HXEB 1WHTA 4LV5B 2WTMA 1NP6A 5HM6A 3BD6A 2ZYRA 3JVDA 1O6ZA 2SBTA 1GAEO 2W58A 2JEYA 2DY1A 1SCBA 2VJLA 1ECJA 2IX9A 5AVOA 2PO7A 1GZ3A 2PCJA 2Y8EA 2PV0A 1ZD2P 3NH9A 4JR0A 1R9NA 3U3XA 1UPFA 2BF7A 2QQFA 3GCWA 1N5RA 5DOVA 4IIJF 3GFTA 1N5JA 2IC5A 4LDRA 2RGDA 1FX0B 5SYMA 1E1NA 3M5DA 1ZKMA 4FBMA 4WDRA 4WECA 4JKOA 1I24A 4S2EA 2Z95A 3MTQA 4NATA 2DWQA 1NNLA 4CLXA 3SGLA 1QRDA 3QPAA 4CEHB 1C9KA 3RVBA 2CNWA 1TVKB 1G8GA 1Y3IA 4RD2A 5KPJA 4GBMA 3QMWA 2WF5A 2XB4A 3BD9A 2VHQA 2VJYA 4DDHA 2P9BA 4TVBA 3VQTA 1U3GA 4C43A 1FNMA 2O3QA 4D96A 2CXOA 1EQAA 4WLUA 4JJEA 5K0EA 1RP1A 1Z9BA 2VDWB 1JPJA 3T7RA 3FZNA 2H2DA 3EVEA 1Z7WA 3PI6A 3I64A 1J5EB 3LCRA 1MKYA 2REBA 3L0ZA 1N2JA 2Z58A 1X77A 4R1SA 3OQ6A 1QCDA 1YBMA 2FP4B 2CLKB 4RD1A 4K3UA 4AF6A 3A3YA 3GD7A 4B81A 4G0PA 2PLFA 4Z8YA 4G0QA 5HMMA 1KFEB 2DOKA 4NZ9A 5A02A 3UF0A 2O6HA 5JCXA 2QD1A 1BMFA 2MR5A 1ZK4A 1FUEA 2Y1XA 4PYRA 2PX3A 4LYDA 4CLDA 5BSVA 4G5HA 4L4XA 5HCUA 1T1IA 1KZ4A 4QODA 5JAOA 1QC5A 4OU4A 3DE6X 3P9YA 1E7RA 2WBLC 2XYQA 3B6KA 3HXTA 3NQ41 3PQ8A 3W3ZB 3PGA1 1ZVQA 4NCAA 4OP2A 2GT1A 4X24A 3TZKA 4S24A 1YA4A 4LIPD 2WQ6A 4Q7MB 2UZ1A 5JAZA 1G20E 5FXMA 1JL3A 2OCIA 1GYRA 4L3VA 1PJZA 2JIZD 2Y76A 3LBFA 4BWYA 2QAGA 1A1VA 1RJEA 3FYCA 1HE3A 1NNUA 5COAA 4RA9B 1QGDA 2VP9A 3JALA 5E9QA 1I94B 1HO3A 3WE7A 4ESHA 2A0XA 4CM4A 3BCSA 3WLLA 2OM6A 3E9CA 1Z2AA 2X9NA 3OTQA 3UWSA 1OFUX 1G6OA 1WUYA 2J3LA 5AVXA 4WH0A 1SBTA 2VZLA 1QV9A 3G1WA 4EATA 1RWKA 4LMPA 2AYXA 1ORVA 3GF4A 4BZXA 1U2DA 1XTJA 2JI6A 2CFCA 2X23A 4O2AA 1HEUA 1HRKA 4BRSA 3RFTA 2P1DA 3KPVA 1MQ8B 4BLWA 4WESA 3CPEA 3OTWA 3WKCA 5TY0A 5K8TA 4IL5A 2A9PA 2JI8A 3R9IA 2X8LA 3RARA 1ATIA 1N9GA 1USKA 3L01A 3R0IA 4QRIA 2FSGA 1OXVA 2VJCA 4L9WA 2OXCA 2ZBEA 3RS7A 3UJCA 3I39X 3WO0A 1VQ1A 4F86A 4WBNA 2I3BA 3OJLA 2NNWB 3KSUA 3H3JA 1X7WB 2J3HA 4EJ0A 3AVVA 1KMMA 1CJTC 2DHEA 2H4YA 2FVYA 2R62A 3HDHA 4YEDA 1YXMA 2PLNA 5LPNA 2W6JD 1NVMB 1EK0A 3ONFA 4QUKA 4TXLA 4D9CA 2FY8A 3OFNA 1WRBA 2QTLA 1ZESA 4AYWA 2FQQA 2AMLA 2ZRJA 1X8XA 4BFVA 4TMYA 4HAUA 3I2JA 5ALWA 4KQWA 2FUG1 4P9NA 5E6UB 4ETIA 4MV9A 3GDWA 1M2EA 2I1VB 1IBCA 5HW0A 3EZ2A 3E8MA 4XYLA 3MTJA 1X7XA 1Q92A 3GFOA 3LC2O 4K40A 4DPLA 3IVXA 2P4SA 5D6OA 4PAMA 4E2XA 1JXMA 3CQ9A 3HFRA 2FI1A 2XSZA 4MDFA 2FFAA 3C8HA 1DG3A 4W5WA 4TOIA 4X7MA 3V1KA 1JX6A 3GLTA 3BE8A 3VNQA 2FEXA 5F76A 2P0YA 3TB6A 4LMBA 1J21A 2B4YA 1YQXA 3JXEA 3L2OB 1SXJC 4HX9A 1LBEA 4OM8A 4E5SA 1QZ3A 4X8OA 2CXUA 4C6TA 3PX7A 5FA6A 5AW8A 3ZHCA 1FC0A 2P4QA 3UJHA 3AEZA 3DNPA 3LDFA 3O75A 4YYEA 1QH1B 3ZGYA 3MLBA 4MS3A 2OE2A 2X2EA 4LW8A 2CFRA 1SHJA 1Y6ZA 3LHKA 2VUUA 4URYR 3WGNA 3BF8A 3P71T 4C03A 1QDUA 2C9YA 1HQDA 4LOJA 3D6HA 4EQ6B 2ZIGA 3PUHA 3HYCA 2O8BB 4QU8A 1IG3A 5JAMA 1I7SB 5DM4A 3L05A 3M8KA 2REXB 2MOKA 4RIEA 2DF8A 1M10A 3DV9A 2BEKA 2G8NA 2AN1A 3NFRA 5EMKA 5I9BA 2O3TA 3C6YA 3OBBA 5EZSA 4AJEA 1TZ2A 4AZVA 4US0R 3ZQJA 3VJRA 3EN0A 1BW9A 1JIXA 2C07A 4R41A 2YICA 4EW3A 1WCV1 2NP6A 1ADCA 1MQAA 3B3AA 1SCUA 1PR2A 5JVDA 2FW0A 3L8CA 3OF3A 1HKUA 1TMKA 2ZXEA 4U2BA 1G19A 2VT6A 5FBRB 3ERCA 4QM6A 1JN0A 1S4QA 3HUUA 5KJ6A 4YT2A 1O4WA 1UPTA 4KDEA 4R8SA 4PYNA 1GN9A 2P30A 1MC1A 1FCJA 2ZYDA 1E4EA 4QOIA 1JPNA 3GLHB 4FDUA 2QU8A 3VYSB 2ZGVA 3ILXA 5HILA 5DHRA 3ZDDA 4RK1A 1PLJA 4GZ5A 3LGXA 1N2ZA 2DUNA 5MFZA 3AP1A 2C04A 4XYMA 1UJMA 2AE1A 4CFYA 4JDUA 1QJCA 3DZBA 2OBNA 1XCGB 3VSEA 4KQCA 5FV4A 3EEYA 1ONSA 2WYVA 3LJKA 4G0ZA 2HRRA 4XQ9A 5HRAA 1VJTA 3NWBA 2NN3C 3E05A 3GFSA 4RM3A 2O2GA 2IHNA 3H9UA 1QQ5A 3GO4A 3R5TA 4FT4A 3C5HA 1NI4A 1T36B 2H16A 1P3JA 4LRSB 4DBVO 4CQMA 2W43A 3DC2A 3NALA 1L0BA 4BCDA 3GVHA 1X7YB 3TMKA 1JHMA 2JLRA 2I67A 2PFGA 3AKYA 4HDNB 3ADOA 3BXEA 3DUWA 3HCNA 1OU0A 1YAJA 4H1TA 3WK6A 1VPWA 4L4RA 1C7JA 1L7AA 4PY2A 4ASUD 4CWAA 4RQBA 2QBYB 3C70A 5C4MA 3DF9A 2BSAA 1HT1E 2Z5VA 2JCSA 4LVNA 1H94A 4Z0NA 3MG9A 1BDMA 4R7TA 1TYBE 4JI4B 4P7KA 3MTIA 2P79A 3A4NA 1XJQA 4FB4A 3H5AA 5LZ8A 1I0ZA 1FFXA 2BKLA 3BZWA 4LWOA 1N2CB 2VUIB 4P4SA 1OMOA 4PG4A 2V65A 3TTVA 3UK2A 4ZYXA 2NU7A 3CS3A 4LHYA 2EZ4A 4O08A 4YDSA 3KUCA 4JL6A 2BGKA 3H0EA 4DUGD 4BEWA 2WSBA 3WICA 3D43A 3BK2A 8OHMA 5A3VA 5GONF 4LDQA 3GPBA 4D41A 2AEJA 1PJQA 3FNEA 3LK7A 1OI4A 1JAHA 1SZCA 5L3RA 3TFOA 2EVWX 3KJQA 1XKTA 5HDBB 4X8HA 4Q5IA 5HIIA 3U3DA 5CPFA 1BKYA 5JQGF 1UXOA 3SQMA 4WERA 2GK7A 4E3WA 2ZIEA 2X5XA 3AR5A 5AHRA 2ZVPX 4I0WB 4OKIA 4QELA 1KBOA 4WXPA 2QYSA 3L0CA 4LQ4A 1JBEA 2QLBA 3ZKWA 1N2EA 3OFSA 3GLIA 2LR0A 3E1GA 1J2EA 1WWKA 3VR3D 4MPJA 3F49S 1Z0FA 1H0SA 2FG5A 3SJCA 4JP8A 3RSCA 2BCGY 2PZMA 4BE4A 3MCZA 3ET4A 3TWOA 4J91A 5AM2A 4JJZA 1YCDA 3DE5X 4CM6A 3O21A 4MVJM 3LH5A 4ZVPA 4R5HA 1RIFA 4M86A 2PS1A 1XZKA 3QV2A 1EM8B 3QMMA 4TVOA 5H82A 3R0VA 2FWAA 4DY4A 2BKEA 4RZQA 5K9ZA 2E48A 4LS3A 1O97D 4PFJA 1AG9A 3DKIA 4LE1A 4E13A 4LBZA 1XZFA 1F2VA 3HJRA 4QDKA 3WKBA 4BO0A 1QVWA 1X42A 2YYSA 5AWFC 4KXFB 2ZJ0A 4L2IA 4FNOA 4JLWA 5E6UA 2P3SA 4QYIA 1S2DA 4IFEA 3VR6A 4J16C 2TS1A 3PWTA 4NVRA 4BMDA 3V5NA 2XZOA 4ZO6A 2BTOA 5BW6B 1LBHA 2E1PA 2ZUEA 2O0HA 1H2RS 1EFPA 1P6XA 1SBNE 1C4WA 2I7CA 3HNPA 3C48A 1U7HA 3D0RA 5EWMA 3T5BA 3WHKA 4AJKA 4IJVA 4QGSA 1VE7A 1ZC3A 1L1FA 4TS9A 2R44A 1TADA 1K2WA 3GLFA 2XWSA 2YFQA 4KO8A 4FHEA 2WB4A 1GRQA 4QUEA 4RA6B 2ODPA 4V0LA 4JAVC 4MGHA 1DRWA 3C3JA 4EA7A 1QF6A 5KVVA 3CRNA 5HCIA 4GXTA 5BNIA 4FP9A 2A67A 4R2JA 1JSZA 4LHZA 1AA6A 1KEKA 1F7UA 2GNOA 3EQZA 3KR1A 2GXAA 1CFJA 4NV3A 4UXHA 3L7MA 3ISVA 3ZGOA 1WPRA 4PO3X 2VXOA 1RIIA 4R8VA 1FRFS 1ZA2A 1JG6A 1N1DA 2YBEA 5AXCA 5EJ4A 4DDKA 2H08A 4U7WA 5FT9A 3CRW1 1SQ0A 3P9CA 1M8PA 4JVLA 4HDRB 5A0FA 4KVZA 4WQMA 4LSMA 1DJLA 2JJ2D 2C3PA 4FLEA 4E4YA 4LYYA 3MW8A 3DM5A 4MVXA 1MNAA 3S27A 4DLVA 4HDOB 1PFVA 4MQ4A 4B7AA 2EV9A 4TKZA 1FQJA 5JC1A 1YK1A 2B8JA 1PEYA 1PG0A 1U2DC 2VF4X 3K73O 4TMTA 1H2FA 3CEJA 1QRAA 1MAAA 4DEXA 5BN3B 1FTYA 2BY4A 1M73E 1VGRA 4ZRMA 1GAQA 4NU5A 4QA9A 3VXKA 3B7PA 4GI5A 2FFJA 5MGNA 5HK9A 4JEIA 1V4BA 2JDID 2PQ6A 2YWBA 1QRSA 2P7IA 4C4TA 4AJOA 1XQ1A 4KWIA 2I2BA 1EK1A 5EXDA 1GPUA 4WXEA 3K2BA 1NVWQ 1T8TA 2VPZA 1GZSA 3D6AA 5ENVA 1KPHA 3BQMB 3IIMA 3UTCA 2X2PA 1S89A 2WV9A 5C7YA 1ISGA 3GGDA 4M0PA 5FHRA 3RIHA 2PUGA 1KMIY 4ZODA 2AI2A 4F45A 3W8NA 4BJ3A 2J4CA 4GOXA 4DRZA 2EGGA 1G9SA 3SJUA 2Q3CA 1L5ZA 3L3BA 3K35A 2ZXUA 5CLGA 3OJFA 3TPZA 3TRKA 4CF6A 3ED1A 1NMEA 1K97A 3GJYA 5G1PA 4X1IA 3T7EA 4FQ8A 4MVJE 2OA0A 3BXPA 5FBKA 4REOA 4WZBA 1F17A 4EG6A 4J0HA 2QMZA 1XQ9A 1A98A 2ZM6B 2WI8A 3PENA 2B99A 1O8BA 1HSOA 3O7WA 3VZRA 1UADA 1AS0A 5BSMA 1ZW1A 3OF5A 4OQFA 4E08A 2OMEA 1ODJA 4YCDA 3ORYA 3HS3A 1S5PA 1WZIA 5DNEA 3RTEA 4MA5A 4OBWA 4Y2XA 4IDQA 4W1QA 5K4HA 3IMFA 4DV5B 3IIEA 3FFXA 1XLTC 4DMGA 2DETA 2QRZA 4DQ0A 1O6FA 1LF0A 4HCJA 4JOCA 1LF5A 2XYVA 3JQ8A 4WBSA 4MW6A 3IA7A 4IVNA 4QTZA 5ALMA 4XSVA 5KNBD 4KJZA 2O4UX 2I71A 4R2LA 1AQNA 2B34A 1RWQA 2F17A 3JZDA 3KL2A 2GVDC 1RBZA 3T61A 2NQ8A 3ZXUB 1N2HA 2O52A 4UUBA 1JR3E 2JH3A 1BHQ1 2ZSAA 4GOJA 4K9RA 4BKUA 1HBJA 1L5SA 3N7AA 1Q7BA 3C87A 4N8DA 4YRAA 5FHQA 3EF0A 1N7IA 4WKCA 1JHVA 1YZHA 4ND8A 2GZRA 3K72B 4HKTA 3RABA 3RWBA 4OYYA 3ADKA 1DHRA 4EW6A 2M6KA 3K31A 3PR1A 3HN2A 4R2IA 2RHBA 4HDSA 3UBTA 1AS3A 5EWMB 4LRWA 3CX7A 3OLYA 3S2EA 3C24A 3JZAA 2G07A 4KH0A 3SZUA 1I6KA 1ZICA 4CMEA 1K8RA 4HK4A 2GO1A 1TU3A 5DN9A 3WHIA 2Q3JA 3G02A 1FBTA 2YJ6A 3WIDA 5DCYA 2F43B 5IVKA 2HD4A 3F98A 5AMXA 3F96A 3QG1A 3C6XA 3JTEA 3K3PA 3NANA 3NOVA 3QJYA 4GAEA 4XX1A 5KNBA 3TEFA 4AXXA 2PMKA 4B44A 1N5DA 1DKQA 3H9QA 3LC7O 3LT4A 4QHSA 4OVKA 5DU2A 3WFZA 1J42A 4LK3A 5A7GA 2OYSA 4CIWA 4TQUS 2X9GA 3JWHA 3I3SR 1ZMRA 3KWJA 3LY8A 2HXSA 1PJLA 5LA6F 5EWLB 3UAYA 2QJWA 2CFIA 3NMUF 3QHAA 3H11B 1T3TA 4KUEA 3ASVA 1U0EA 4DLUA 3TG2A 1DFGA 2Z0MA 3FI9A 3KJZA 4XX0A 5CVVA 5F4BA 5ALLA 2NVWA 4ER7A 2BSXA 4EAQA 2YJTD 3ND7A 3HJHA 5B53A 3SBXA 1HYHA 1LPSA 3E5NA 1QIDA 2XDYA 3O1LA 4L51A 3DHYA 5ICFA 3VR1A 4C4RA 2W4IA 5L4SA 2NNLD 5EZQA 1NBME 1G1AA 3H8SA 1DBVO 2R1VB 3AOEC 4PRYA 1ZN8A 5BUZA 1QWSA 2M32A 1A0OA 1P19A 4FMPA 4A10A 3PEUA 1N6IA 3B1JA 2GCNA 2H7YA 4UNQA 3VR4D 2GKSA 2PA0A 3GRUA 3SHFA 2ZBFA 1TAHA 2PE5A 1FTGA 1PSDA 1IQPA 2IW3A 3LWNA 4M21A 2RD2A 3JATA 3EEFA 3VSCA 3CR7A 3PRJA 5SYNA 2EQBA 4OQYA 5FULA 4DLYA 3OBIA 3FZEA 1YS6A 4B71A 1OIVA 2VQFB 1CC1S 3KKNA 3CSSA 4QUBA 3RS8A 4YLEA 2XZDA 3BRQA 3IP7A 2HRQA 4X90A 3ZWYA 5FFNA 4L50A 3U56A 2YFYA 4EKYA 3CZQA 4AZWA 3WYDA 3TK1A 2XNCA 2JVKA 2B3TA 4YMVA 4K6GA 3G0BA 5AK0A 2JL1A 3JYPA 1QYRA 3GRZA 5K6AA 2ONJA 4E30A 2PM8A 3N3AC 2XHZA 3N2ZB 3W1WA 3CX6A 2QKYA 1F2TA 1ULBA 3WB1A 1XTVA 3AEKA 3HZOA 4QDJA 3ZHVA 1CRZA 4NV1A 2HHLA 3TTSA 5JD4A 1EM6A 4B74A 1GEGA 2JZOA 2RGUA 4JOSA 4KQHA 4MRVA 3ZE0B 4F3TA 1TZBA 2PT7A 3IV9A 1XUOA 2XUOA 4EA9A 4GBED 5IJZA 4Q05A 2F9MA 1JILA 1H6DA 5JMWA 3KAJA 1DBQA 2ZI9A 4WN9A 4WZAE 3T4UA 3NIWA 1JAXA 1SVLA 3EFOB 4PINA 4QOSA 4P3KA 4M8SA 3T7JA 4HAVA 4W1SA 3SYLA 1DI0A 4JKYA 5DSZA 3NIFB 2O2DA 4MGZR 3B1ZA 1XO1A 2OOSA 5FRDA 4QU0A 3ZHYA 3P9ZA 4DQXA 3LCCA 5LA6A 4KK3A 1N32B 2C2WA 5ILQA 1SWWA 3ROXA 3TQOA 4ZI5A 3BTVA 2WYOA 5BV1A 8LDHA 3WP1B 1XD8A 4UTZA 3G8CA 2BGNA 4MWTA 1OTYA 3GGOA 2SKDA 1DC8A 4QXAA 1DC5A 1OTXA 2HGZA 3PXBA 4OGGA 2ZEJA 4EPRA 2AJTA 3PGVA 2YQZA 4CM3A 4J7XA 4P5PA 2H57A 5TS3A 5KYWA 5K2MA 1FVFA 2GEKA 4OQNA 1DQPA 2YZ7A 2BFFB 4MYDA 1JRLA 2F3PA 4JI6B 4J0DA 5AJHA 4HTFA 4BBJA 1A4UA 3EEQA 4JP2A 3I1JA 3LGAA 2H18A 3GZ4A 1RHMA 3VNSA 1I01A 4C0JA 1Z6TA 4ZEOA 2O2JA 5AK5A 4AK9A 4TTTS 2WWYA 1B73A 1O9GA 4MZXA 5IDVA 3WO1A 4TROA 1NP3A 2I6GA 3QU9A 2IS4A 1CIPA 4A7PA 4F5YA 1W7AA 2VWHA 5T8KC 3VR3A 5C8YF 5TPWB 3WLQA 3PJRA 1T5BA 2FW6A 4UUPA 5K03A 3H5IA 1D4OA 1PFKA 3GG2A 4RY2A 5SZKB 2Y05A 1ODIA 2DFTA 3H9BA 3UUGA 1PJTA 1TJYA 1TMGE 2BDUA 1RJDA 2UYQA 2F3RA 3DAPA 1UBOS 1DWUA 3DHVA 3IEIA 3QWIA 3S40A 1CRLA 1Y5NA 3N9IA 2Y0CA 5HKKA 5CXSA 5DXFA 4OFZA 3U5TA 1R8XA 5KHLB 2AQIA 4ZREA 3WTCA 1KC3A 3EGIA 4XXHA 1A5SB 4RKFA 1O94D 3NYWA 4HATA 4JXJA 4P4NA 4PZAA 2HQSA 2GYYA 3RVSA 3TQHA 1Y4AE 1GL7A 3IBGA 2OCAA 4CMAA 2X19A 1ULUA 1DKNA 5T4HA 1TO1E 2ZS9A 1PNVA 4WKOA 2D4HA 2J46A 1RACA 2IWRA 3T9BA 4FFOA 4MWZA 3GLIB 3N3BC 4FEYA 4LBWA 4HG2A 2PWAA 4DV0B 3UHOA 2HK7A 1LQUA 2XTZA 1LSJA 3JWGA 3N2GA 2JLZA 1MHTA 2PN1A 2PRYA 2QNIA 1KYIA 1N36B 1UJ6A 2N3ZA 2AXPA 5GOZA 4LXYA 4FSXA 2I9PA 5F5XA 1NSFA 1MX5A 4WASA 1XEFA 3SVLA 2FZ5A 3H2JA 2P4UA 4R5MA 3FUUA 1N4DA 4UZFA 1G7RA 1M6VA 1RM5A 3B60A 3I52A 4E15A 4J2OA 4F2HA 3KQTA 1U4SA 3RRMA 3MTDA 4NK5A 4WZBB 3EAFA 5BVGA 4WOPA 1V3UA 2OV1A 3R5KA 2WMYA 4NZMA 1LCIA 2Z5LA 3OQIB 2QYTA 2VRCD 4I2NA 3QMPA 3K70D 4RDXA 4HL6A 1H23A 2ZANA 1ZH0A 4MKFA 4D44A 3T8YA 3UKDA 2I54A 2VWQA 4PU0A 5AOAA 1QGAA 3JQQA 3MNFA 4Q9AA 3VR5A 4I1OA 1L1EA 1UAGA 3QOXA 3UY4A 4GFDA 4Q1BA 2QX7A 2AK3A 1F12A 2E3JA 5D5QA 5GMOA 4ZICA 3SJBA 1C3XA 1KI9A 3QXSA 1XQYA 3U4HA 4PANA 5IRCD 3SKXA 1RXEA 4L15A 3HKBB 4NJEA 2ASVA 3PT5A 4KODA 1U3CA 4LYEA 3WRXA 5KSPA 2YZGA 1TU0A 3L1VA 5KUTA 4XYGA 5H68A 4FN5A 4DWJA 3MWEA 2CK3D 2J32A 2PIDA 4IKOA 5D3MA 5AHOA 2UUAB 3ASYA 4Z3OA 5AKZA 3NYRA 3DFZA 4W8HA 3X44A 1QIGA 2II6A 4Z1OA 3NBUA 3NIBA 1RXCA 5DBFA 3AUJB 3ACDA 1I5EA 2UZ3A 3LKBA 1HRDA 1M1NA 4Q21A 4K6MA 4CTKA 4XDZA 1A76A 3HN7A 5CEFA 1ISMA 1E5XA 4S12A 2D1RA 4RSGA 1DO0A 3DNMA 3PBKA 1GU0A 1J8DA 2R8BA 2XGOA 3N39C 1U6JA 4DMFA 4ZAFA 3R7FA 1TEXA 1C2TA 2XY4A 2Y99A 2ETVA 2L2QA 3EQ9A 5ULLA 5CA0F 5JZBA 5LD2B 2CD9A 2V8BA 4A1FA 5KDOA 4FKZA 2R2GA 4M87A 3BMXA 1W8DA 1TA9A 2BM0A 4JR2A 3MVEA 2DG2A 4LYFA 1IIBA 3K32A 4NU6A 1QONA 3IX7A 1VSVA 3ODGA 2CVOA 5E1OA 2C9OA 3OT1B 3HA3A 4C06A 2QRKA 3EUFA 1RADA 1AZWA 3HHPA 3PTLA 4C2AA 1DAMA 2PK3A 1O03A 3LG2A 1RAFA 4JROA 4NYIR 2F48A 4V2UA 3RK4A 5FTLA 2TECE 1L3IA 1COWD 2VHVA 3I6YA 3K9NA 4NCHA 5IJ9A 4QFBA 4RY8A 3OOSA 5EIHA 2LCFA 4Y18A 2NLOA 4CM1A 4NXNB 1JWAB 1TEVA 4GMDA 1XT6A 4KB5A 1VJCA 4MJLA 3WGJA 4B1FA 2NV6A 5AJUA 3NTVA 3QX3A 1ZRNA 5K45A 2AI3A 1Z5PA 3FJ1A 5EHNA 2B1GA 1JJFA 1NTRA 3ZQUA 2V55B 1Z39A 1ECGA 1VLQA 2I1WA 2WNHA 4C7BA 5IWCA 3MS2A 4IQ0A 1EVKA 4MAMA 3OESA 2H2FA 4RCVA 2P9JA 4KVAA 4WNIA 3B1YA 1FL9A 1T0UA 1SC1A 1A69A 1G291 3HU5A 4M9CA 3VHXA 2AOXA 4CRWB 3CRVA 1XVUA 2QXUA 3L4JA 3DQPA 1IHPA 2VC2B 4BAUA 5LKRA 3GL9A 4PTYA 5I47A 3QJGA 3IKVA 2ZE7A 4TXHA 1HT2E 2G6BA 1U0LA 4Y8VA 3TOSA 1N1GA 5DV9A 1POWA 1PQUA 5BWBA 2EWMA 5CEJA 1AMUA 3JD1A 4QBGB 4DWWA 4YMTA 4A9AA 1TAGA 3VZCA 5A5FA 2A6PA 3DT9A 5ECDA 3WMXA 3VBEA 3P5SA 2WKQA 1CYDA 3EISA 5JD5A 2DFNA 3GEBA 3ROPA 5FBVB 5KC8A 4K6HA 2DLDA 4X6UA 4Y1RB 3V4RA 2D0OB 3NGMA 1Y42X 3DD1A 2C92A 4YBZA 5FOXA 1FSSA 3G7NA 2A84A 4G09A 2LXNA 3D4PA 2NW6A 3ENZA 2A9FA 4YFVA 4L5CA 2V97A 3QP9A 2HDWA 2CL5A 3U80A 3BREA 1TKRA 1XCJA 1UJCA 2JHFA 3PA6A 1UBTS 3UMYA 2OK7A 3JZFA 3ZNNA 3G9XA 3RC1A 4DDMA 1JQKA 4D6YA 2AN4A 4MW2A 1KARA 1NI3A 2HJHA 4MCHA 4D98A 2D2XA 3RO7A 1OH8A 1XNJA 2Z4SA 1KRWA 4G0MA 3DEIA 3NHLA 2HWKA 3H4MA 3STYA 3QEJA 2GPJA 2WA1A 4F8JA 2P6NA 1EUYA 1FNCA 3CISA 1CJSA 2LUOA 3BORA 2J5BA 2Q4TA 4Q9LA 2C3UA 2G63A 5T5QA 2P3OA 4P98A 2V4MA 5AXAA 5TNXA 4O3MA 2DFLA 2JK1A 3EGXA 1XK7A 3L92A 1VYVA 2IXGA 4PZPA 4AG6A 5B3KA 4JI0B 3P2KA 5KYXA 1RYNA 3E9QA 4YPFA 3SN6A 4GIBA 5IM4F 3PXAA 3R24A 4Z7OB 1GPWB 3HBLA 5D6NA 3T9DA 1AKMA 1FFBA 1CERA 4UHDA 2PRZA 3X1YA 2RGRA 1C41A 3FPCA 2J87A 1KK2A 1YMQA 3JYOA 4LRTB 4LJRA 2V5UA 1M9NA 1UZUA 3BN3A 3CH7A 1CZNA 1GUAA 1WSAA 2B1RA 3HYTA 4BMSA 1NRIA 5HJ5A 3AB3A 2IHKA 1SHTX 2V74B 4UCWA 1IHXA 4CKWB 1KAQA 1ORRA 2CXPA 1BRMA 3KR2A 3GAMA 2AX3A 3PPIA 3PXDA 2DQKA 2UUPA 1I2CA 4LXXA 2YJNA 3HLTA 4PS1A 4HH1A 3VDXA 3I4CA 1ZZGA 2CNKA 3O9VA 5BT8A 3EMBA 1CLEA 2L0XA 3QLVA 4QVIA 4DQUA 3HRHA 5AVVA 3SQDA 5HP4A 1I1QB 4H18A 1VKOA 4IUYA 1UZNA 4QAQA 2JIPA 2XQIA 2FUCA 2QK4A 3KUXA 4OQEA 5CRIA 2X3FA 1KBQA 2BHNA 4H7HA 4MPDA 1IHOA 4JUCA 5FWXB 1W48A 1GKLA 1D6MA 4FGWA 1FDUA 5C31A 1MZVA 1WHTB 3V1MA 3TAUA 1E3DA 4ZI7B 3ZWMA 3Q7IA 1PV4A 2WFZA 3WRYC 2FA9A 2J6HA 2R8YA 2BMVA 1B0ZA 3M0EA 4D9IA 1EXDA 1H8HA 1Z0AA 2O5VA 1I7NA 1JDZA 4J6FA 2FPKA 1GWNA 3EWIA 4O0LA 4BQPA 3C39A 3L6RA 3FZGA 1EFKA 3ITEA 4KQFA 2R85A 2GESA 1QLHA 4TXNA 2DR0A 2CHQA 3M6VA 3PHBE 4MR9B 1INLA 1HDIA 2ZRQA 3K5IA 3P4UA 2JGEA 1ZOPA 1QK5A 1T43A 3AF5A 3CIFA 3W05A 4LMAA 3ZE1B 3GXOA 1S8NA 4A0GA 4JV5B 3J7TA 4CG0A 1KI3A 4POAA 5A5DA 2Z6UA 4F12A 2JKZA 3PGXA 3MQFA 3QNUA 4ZAGA 4R2HA 2JJQA 4DA7A 1DIGA 3ZU2A 1DXHA 2CGEA 1AGNA 3EULA 4U39A 5C8ZA 5KNCA 4R2XA 1V5EA 4HH0A 1QIKA 1DQZA 2I76A 2VTDA 4OHUA 4RHEA 1KEVA 3IPRA 4WLNA 3LLCA 2PT5A 3K1YA 4WXMA 1DO2A 3LBIA 3MYRA 4ZT3A 5JNSA 4ND4A 1A9OA 1Q44A 3GA0A 5H9WA 4HB2A 3ZV7A 2OLKA 3Q12A 5A4JA 2AR7A 3U0VA 4FWBA 4BX0A 2B1IA 1SBZA 4DM4A 2GCOA 1SCUB 3SQXA 1QHYA 4M1YA 2O8CB 1W4CA 3D6JA 1J8VA 2FPRA 2GPSA 3Q1KA 3BB3A 3PVZA 4FHDA 4HWPA 4G2NA 4HLNA 3QI7A 1VKHA 2W6ZA 2E1RA 4HFJA 3V4LA 1FX1A 3CB4A 3ZG6A 2HF8A 1P29A 3EC1A 3PNVA 2EFEB 2GF0A 3ZHSA 3VPXA 5CT6A 4DB2A 3TR0A 3SMVA 1ZJWA 4JS0A 5JALA 3ZWPA 1FRVA 2P11A 2Y67A 5AI6A 3MGKA 5BR7A 4N6NA 3G0GA 1PR4A 2QL6A 4RETA 1ZMBA 3FZYA 2BCJQ 2C3MA 3LT0A 2BKAA 4GP6A 1DRKA 2OR3A 3RK1A 4LYJA 2FP3A 2P91A 5IVDA 1DSSG 3M6AA 4ZQHA 5FIUA 2GEFA 1GNTA 2GSWA 3STTA 2VTEA 2X77A 2GZSA 2GK4A 4RFSB 4A6XA 2FDRA 3K2QA 3RLIA 3NEYA 2M6SA 4H6XA 1E58A 3BIFA 3L79A 2OBXA 1C7IA 2QLLA 1ILEA 4HHEA 3VR4H 4DMKA 1S1MA 1YE8A 1NW6A 4P33A 2PUFA 2QD3A 1DOZA 1EP1B 3BS4A 4ONEA 3RTAA 5B3JC 4DJFC 4XIIA 5FEMA 2CLCX 4I55B 3TL3A 5HFJA 3TIVA 3DCIA 2BBSA 1SPXA 4QQRA 1RFLA 3ZD6A 1RYZA 2JH9A 2R8XA 5LQRA 2GHTA 3ONEA 3HXPA 4D80A 4QHTA 4MYHA 1S8FA 1SZJG 4N5IX 3W2FA 3SE7A 1EDDA 5LKAA 1VG0B 4N48A 3CJRA 3CJQA 3TDKA 3VKHA 3WDKA 1KDRA 1XKQA 2YWFA 4QTTB 1JHXA 3KZOA 3MJFA 3VJMA 3D6FA 1JIIA 1JU3A 1R7RA 2XMDA 4LRXA 2LGJA 5M2QA 3FUXA 1KDTA 3V3KA 2HX1A 4R1NA 4M0CA 1ISJA 5YASA 5CFMA 3AHIA 3PUIA 2YCLA 2HO4A 3PU6A 1H0HA 2ZUSA 1USGA 3HR8A 4JLDA 1W46A 3TN7A 3K0FA 4LBYA 4DJJA 2X5NA 3F2IA 3DAGA 2W2PA 5DI9A 5EXTA 3NYQA 3TSOA 2KSQA 3DDHA 3JU3A 2FOXA 2P6PA 4KYTA 5BO5A 4BEJA 2PAAA 1YIDA 4LI3X 3TQTA 5HZHA 4DA6A 1KORA 1MX9A 4NY1A 5DBOA 4GM1A 3L06A 1YZLA 4NNPA 2FNAA 1TU4A 2FVXA 2EARA 2I1QA 3FTNA 2VNIA 3KT0A 1SUBA 3V4ZA 2NUAB 1IONA 1OI3A 3NU1A 4AS1A 4BWFB 3UJ6A 2OFWA 4KZPA 1Z3IX 3D6MA 3P52A 5CTJA 4CHTA 1JT2A 2WUGA 1IY9A 3HL4A 4QXQA 3PIRA 4ZARA 2AWOA 3EGXB 4UTRA 1U0SY 4BVFA 1N92A 3G2MA 1XF1A 4G0OA 4MQEB 4CMIB 3LKDA 3UB2A 1UM9B 1WZNA 1AGPA 2VP5A 2OBMA 2WVGA 4GWGA 5J47A 4OYLA 1UINA 4ZVMA 4LRQA 4HWTA 3WXBA 2ZR7A 1YS1X 2FW8A 4HNSA 3KS9A 4C14A 3H9CA 5KOJB 1OA1A 4UBOA 3AQ4A 5IM5A 3TEJA 3D8HA 3UJ9A 3MMZA 1SURA 2P0EA 3PZRA 3WZLA 1IBRA 1YJ5A 3BRWA 1JAYA 4KGDA 1NW8A 4ZVUA 4ZYVA