1CZRA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGNQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
total genus 57
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czrA00
4FGKA 3TEMA 5EAIA 4C0XA 1T0IA 3NHPA 3N3BC 4C0WA 2M6RA 1YDGA 1CZOA 4GI5A 5F12A 3ZHOA 3W79A 4U7FA 2A5LA 3UXEA 2QMZA 3NHYA 6NULA 4S24A 2FZ5A 2XODA 1D04A 4J8PA 2R96A 3B6IA 3P0RA 2MWMA 3QFCA 3L9XA 3N39C 1DX9A 1KBQA 5LMCA 2RG1A 2ZKIA 4N82A 3HLYA 4ZVNA 4XDGA 2N1MA 2FCRA 4PTZA 4YALA 1ZWKA 1CZRA 4ZVKA 2FOXA 3EDOA 4LTMA 1J9ZA 1GG5A 1RLIA 4C76A 4LTDA 1E5DA 1FLDA 2HPVA 1AKRA 2BZSA 1F4PA 2XOEA 1OFVA 4HEQA 1TIKA 3EYWA 1XI2A 5A4KA 3U7RA 1YKGA 2KLBA 4FX2A 4QOGA 1NNI1 1D03A 2FZVA 1AMOA 3NHUA 2OHIA 1AHNA 2QR2A 4C14A 4NLLA 4M0CA 3GFSA 4PU0A 4HS4A 3N3AC 5NLLA 1AKQA 5FUQA 3NHRA 1AKVA 3G5MA 4LAFA 1AG9A 3TZBA 5LJIA 3NHJA 3F90A 3OJXA 2FX2A 1BVYF 1FTGA 1FVXA 5NULA 1ZWLA 2AMJA 4QOIA 4OXXA 1J8QA 4H2DA 4YAWA 4LTNA 3O73A 1SG0A 1QR2A 3NHSA 5FX2A 3SVLA 1FLVA 4NULA 4D02A 1QRDA 1CZNA 3K1YA 1J9EA 2OHJA 3FNIA 3NHKA 1T5BA 5BUCA 2Z9DA 5F51A 3KLBA 3S2YA 3U7IA 5JROA 4DILA 1AKTA 4XDHA 3W78A 3JSXA 1FUEA 4N9QA 1C7FA 3B6MA 4H6PA 3NFRA 1CZUA 3OWHA 4LA4A 1H66A 2V9CA 4GQIA 4YAOA 1AKWA 4Y9RA 3OWXA 2BF4A 2HNBA 2KQUA 2QX9A 2HNAA 1WSWA 2FAXA 1YCFA 4U7GA 3HA2A 2FDXA 3UXHA 2FLVA 3GFRA 2OHHA 4R81A 3KEGA 1FLAA 3D7NA 1TLLA 5LJLA 1AKUA 1YCHA 3QFRA 2MOKA 3GFQA 4YAFA 1V4BA 4F8YA 1D4AA 1DXOA 4FGJA 5TGZA 1FX1A 1KBOA 2ARKA 2WC1A 3OX1A 5EA2A 2R97A 4BMOB 2B3DA 4QOEA 4DY4A 3ESXA 3ESZA 3FW1A 4ESEA 3R6WA 5EMNA 5B3LA 3OJWA 2MT9A 3ES9A 1CZHA 3NHFA 5LBTA 3NLLA 1X77A 2Z9BA 3F2VA 1H69A 2BPOA 3FJOA 4QODA 4Y7CA 4BMPB 3OX2A 1XYVA 1QBGA 3W7AA 2QX8A 3KAQA 1JA0A 2Z98A 4CF6A 1C7EA 2M6SA 1BU5A 5F4BA 3QE2A 3F6SA 4ZVLA 1AZLA 3B6KA 3FX2A 2V5UA 4ICIA 5ULLA 4QOJA 1OBVA 2BN4A 1RTTA 3O2NA 2Q62A 4ZVMA 5FA6A 2Q9UA 3NHWA 2F1OA 1VMEA 1ZX1A 2OYSA 2QMYA 4CETA 2QX4A 1RCFA 4FGLA 5LLDA 3LCMA 3RPEA 3HR4A 4QOHA 1SQSA 3NHLA 3KAPA 2V5VA 1XYYA 1WSBA 3F6RA 4GR9A 2Z9CA 2MTBA 1YCGA 2FVXA 1XT6A 1RLJA 4PTYA 5B3KA 1CZLA 4N65A 3W77A 2X2OA 3GAMA 2GSWA 4U7HA 4YAUA 4DIKA 2X2PA 3L9WA 5LVAA 1FLNA 3K20A 1DXQA 1B1CA 1YOBA 1QHEA 1OBOA 1YRHA 4QOFA 5LBUA 2QWXA 1I1OA 2QX6A 3B6JA 4YQEA 3OVMA 3FVWA 1JA1A 2W5UA 2D5IA 1J9GA 2BMVA 3OX3A 3ESYA 3TE7A 1CZKA 4Y9UA 3LT5A
chains in the Genus database with same CATH superfamily
1SN7A 4PZAA 3UGQA 1U2DC 2OHFA 2YW2A 3UJBA 1M6EX 3AYZB 5F5NA 5HFJA 5T64A 3MCWA 3DH0A 4WERA 2ANCA 1Q1ZA 3ILVA 3OFKA 1I0IA 5G3ZA 4FNAA 5EQJB 4QXAA 2XRZA 1J90A 1JG1A 2CDBA 1N57A 1JZSA 1V35A 2XNHA 4Q1CA 4TTQA 1P1CA 1TVEA 2UVPB 8LDHA 1P91A 3UAXA 1J2EA 1K63A 3TKLA 4OQLA 1Y98A 2XGMA 1JQKA 2MYTA 1YE3A 1PV1A 2QRLA 3PXCX 4RGYA 5F12A 4HDSB 2V45A 4XJSA 1PR9A 1RFLA 4WLEA 2PUAA 2DQYA 5UKDA 3PXAA 1VC2A 3KWLA 3JS5A 1XQ1A 3OQ1A 4R6WA 4D8TA 3ADBA 1MJGM 2WPDA 2ZYTX 1VLLA 4U7FA 3TEFA 1KARA 1QPGA 4AWAA 4DDTA 1FDTA 2QMZA 2O9JA 3G0DA 2PZEA 4JI1B 2ZLBA 4HRYA 5K03A 2A14A 1WHSB 1XTBA 1YE5A 2QD3A 3KKKA 4N03A 1CVLA 1RI1A 3TPCA 3TCXB 3EIEA 1XL1A 5EJIA 2OR3A 3WLIA 3VKGA 1Z5PA 1DWUA 1NFRA 3UGJA 2JLXA 2OZPA 1ODJA 4CKEA 5ALXA 1ECFA 4AROA 4OHOA 1HZJA 1T15A 5E7MA 3U61B 5JJIA 2BLLA 3A4NA 4MV8A 1Q22A 3K9LA 4ZALA 2HWXA 3MVEA 1SCJA 2INGX 1GAEO 4HEA6 4Y7DA 5T57A 2FWNA 3W8DA 1MCZA 4HDAA 2YC2C 3OEHD 4EB6B 2HOQA 3PUWA 3ZIDA 2I33A 1AA6A 5IAAA 4IMPA 3VJMA 1I4DD 1T3GA 1ZH8A 2JLCA 5HQTA 5KTRA 2GPTA 4OHUA 3LI2A 4B6OA 2KHZA 4MPRA 4U9HS 3ZX5A 4WIAA 5BSFA 4DDVA 2NQ2C 2Z5VA 3KB1A 1Y1SA 4Q4HB 3B89A 3D6JA 3KYJB 4L0CA 1JHVA 1SVWA 3MINB 3ZEAA 4ZHQF 3ZZNA 1MO5A 2WSYB 3AZPA 2PX0A 3D43A 4RZSA 3V4OA 1P1JA 5B37A 3IBCA 1WUJS 3GJ4A 1SCDA 3K0FA 3JW8A 1IUOA 4KRGA 2C94A 3UHOA 2XKKA 3WYNA 5EJAA 1ZICA 3AR4A 5BV1A 4RFSB 1C30B 2BE9A 4NICA 1OIXA 1ZI6A 3K96A 4E1AA 4M1YA 5BOVA 3FYCA 1H85A 3OQBA 1DXHA 2PGIA 1LJUA 4XDYA 3GP8A 4QLOA 5ESXA 3AWIA 3ECCA 2RD2A 2VA9A 2NO0A 1QAMA 1XP5A 4AJNA 5BSRA 3MWLA 4MP6A 3I1FA 1M2OA 3LGXA 3FSRA 3LKBA 1IUKA 1NZJA 3E7XA 2O2ZA 4M37A 2WT4A 3RHFA 3KHSA 1ZM7A 4V2IA 1ZD2P 3FMGA 4LGMA 2IWRA 2VK4A 4BE4A 5C8VA 3DNPA 3D4BA 5HRCA 3RVMA 5TQJA 2J3DA 2VPPA 2J4CA 3H04A 1DB3A 3DQZA 4W5NA 3WQSB 4M49A 3KCNA 2WK1A 4GF5A 4TKVB 1A8UA 4V0KA 1HDIA 4GOLD 3WMRA 3A9CA 4Q3KA 2J09A 4MHSA 1KYVA 4FDMA 2JGLA 5EWLA 3WP0A 1R0CA 1E6KA 1K8XB 1PR2A 4B3RB 3A1FA 1EFUA 3NJ4A 4QGGA 4D8VA 5BPHA 1P7PA 2J8ZA 4W6QA 2Y0DA 1NV9A 2WTAA 4BUCA 4BQPA 2O2GA 2AN3A 5AVVA 4W5QA 3T9BA 3UAOA 3UFXA 2H2HA 4MUEA 5JVDB 3BJIC 3VM6A 1NJFA 1L3IA 1MNQA 1W2GA 3IUYA 3ZCSA 1KH1A 1CUIA 3E7DA 1ISSA 3GRAA 1GRRA 1QC5A 1C1XA 5AJUA 3BMQA 2WE8A 3PWKA 3VR1A 4Q1DA 2O54A 9LDTA 3B7PA 1XGKA 4WN3A 3UEOA 2ZZMA 1UF9A 2DBQA 1TE2A 4INZA 1G8HA 2JASA 4JUDX 4I81A 2ZYAA 1ZK0A 3L46A 2ZE8A 5NULA 3HJUA 1N0IA 1ZAYA 2CL5A 4QOIA 5HM6A 3E35A 1K8RA 1M83A 4V24A 2VYVA 4OHWA 3QA3E 4OJMX 2AFHA 4R51A 1TYBE 2B8TA 3DO5A 3PXXA 4KAFA 4KQ6A 4LY3A 4D9CA 2F6RA 1TTQB 4LTNA 3IMGA 3KYBA 3TNJA 5L45A 2FEMA 3Q2KA 4PC7A 3ZW9A 4KB5A 5KWSA 1LPNA 4GUDA 4PPGA 5JT1A 4K9MA 2OFOA 4EHHA 2JEZA 2QRGA 4FNOA 1K7YA 4YCDA 5DHTA 4FFVA 1HK7A 4HEA1 4ERNA 2DLCX 1JLKA 1BKDR 1Z6ZA 3P9KA 2A59A 2EKDA 2G1KA 4RD2A 2O4CA 1A9YA 3RHSA 2OMEA 4FZ5A 1JUDA 4X1IB 4KE9A 1YAJA 2A9OA 1OVMA 2AMLA 3RTDA 1PW5A 1JU4A 1W2HA 4UULA 4ZDIA 3LXRA 3OZXA 5A4IS 3U44B 2G3YA 3PC6A 4HDKA 3T06B 2IF2A 3ISJA 1OE0A 2XT0A 1JSCA 1IH8A 2FZLA 3G6KA 3ZW7A 1X13A 1DWQA 3OX4A 4LGYA 4RVUA 4WCDA 4XCXA 2TMDA 1P7VA 4XDHA 3H1EA 4HSGA 4YVFA 1RHKA 1O08A 3QV2A 1MFPA 1C8LA 2DR3A 2HPAA 4MKZA 4YMTA 2IF0A 4EW1A 1N2CE 3MMZA 2C03A 4U3JB 3ABRB 3S4YA 3B6MA 4DW8A 1K89A 1EDBA 2IUFA 4DADA 5IWAB 5CFNA 1R6XA 5B4VA 3TUJC 5EKUA 4ZN6A 4Z6KA 3JPWA 4A27A 4TT8A 3AEKB 5CCEA 1Q0RA 3OETA 4YEDA 3AHJA 3G49A 2PHZA 2QZPA 3W90A 2WQZA 2BTOA 1N0WA 3AHCA 2E82A 5EHNA 2FQXA 1LNZA 3ZI0A 1C4WA 1NWHA 5J4KA 3OWHA 4KXFB 2ZRHA 3ZZ1A 3EEOA 3EXIB 4JFRA 1E1RA 1GL3A 4JLWA 4OXYA 5FO1A 1HDYA 2I4RA 2VZEA 3H83A 5EC8A 4FDAA 3LQKA 2WKRA 3A27A 4K2AA 2OPBA 3RKUA 4M1WA 2Q6OA 1Q11A 2ZAIA 2G28A 1NG9A 2FW9A 2JHPA 2NUBA 4MUAA 1Q77A 2PKRA 3KT0A 4F5YA 2RHLA 3MERA 1N5OX 5A3SA 2ZOSA 5TMBA 3DLTA 1KK2A 3TX6A 4O4JA 3UHAA 1DEXA 4GLBA 3EW9A 4R8KA 1PWZA 3OTGA 2D00A 4CI9A 4IPTA 2OD9A 4DV4B 2JGDB 5KYKA 3HFSA 1E1CB 2MSCB 5LDGA 3GFRA 2OCBA 4GLLA 4NBTA 5K2OA 5CXXA 3V4LA 4EKNB 4HN2A 4U2CA 1VM6A 1OLSA 2ZR9A 5IXJA 2LCFA 4HGNA 3WLLA 5EJ6A 4Y9DA 5AR1A 5G40A 3RYFB 1O0CA 3HTXA 1I1HA 2ACVA 4C7VA 5KX5B 4BB9A 3MUFA 3AI7A 2AG0A 3QEKA 2D0PB 4Z0HO 2B82A 3MUOA 5CLQA 1E7YA 1GAWA 2OWEA 3GR6A 3QVTA 5TPZA 4NS4A 4HV4A 1XTVA 3PBKA 1JDUA 1ZYUA 2APJA 2EW1A 2EC5A 2NXEA 2X8JB 2ARKA 4PHHA 5U4QA 1QK3A 1HZZA 4L78A 2WJ4A 3PFBA 3I6ZA 3SFVA 1QH1B 3ZPXA 4JR1A 5EA2A 4NNJA 1IG3A 3EUEA 4UBIA 2H51A 2L17A 1UM9A 3VU1A 2VF5X 1OROA 4MV6A 5AVUA 4HJRA 3GNTA 5F1OA 3QG5A 5IC4A 1O8BA 1SPXA 4YRFA 1WU7A 3UB2A 3OCUA 1FDOA 2WHEA 3LD9A 2WKWA 3FUTA 2A0UA 2FZWA 4C0QC 4LWQA 3K1ZA 3FVRA 4K6CA 5K7SA 4OU4A 3Q9LA 1N6NA 1KGDA 3S3TA 5LA6F 1NLZA 4Q48A 5D00A 2PG3A 5KVQA 2RHDA 3WOHA 2E3JA 3LTNC 1HV8A 1L8XA 5JYEA 5F9FA 5CX4A 4X3CA 1R3DA 5IVDA 5EHQA 1UBUS 1DKQA 1PL8A 3AU8A 3WL8A 3WKDA 1ZK4A 2GT1A 3CLUC 4MW0A 4S0XA 4X85A 4DNFA 4KMSA 4EL5A 1J56A 3W4JA 2IA5A 3R0XA 2X0FA 1H23A 5C8YF 4JT2A 5KEIA 4KQJA 4RPIA 3RSOA 3HDQA 3A9UA 3TNDA 1DE0A 3FJOA 4EPXA 3O8BA 1P9WA 4IXNA 2HHLA 1KC1A 1XXHA 3DOJA 1KPGA 1L9KA 4BX8A 5KCZA 1VE6A 4H7EA 5JZMA 3FSJX 1ES9A 8OHMA 4XARA 5CB4B 5F2EA 3DUFB 4KLNA 2AZTA 3RAGA 1DCMA 2GKSA 3WO1A 5ABPA 2PL3A 3G02A 1NI5A 3A0UA 4YCLA 3ZLJA 3DXZA 2QRVB 2ASEA 1E4EB 1RYHA 1V7QA 1GTG1 2E4VA 2QGNA 4LFCB 3UOAB 1Z74A 2C7PA 4YASA 1T6ZA 2CLHB 3MLAA 5HIMA 3T5BA 3A1CA 4RHXA 3ZZMA 1KTIA 1A8QA 4MS4A 1G59A 5E38A 1E59A 1E58A 4V39A 3QHPA 3ICPA 2OC4A 2O2DA 4XIGS 2RGEA 2VQDA 4DCJA 4RPLA 1GR0A 5KWJA 1AO0A 1QP4A 1QHXA 3E2MA 3B6KA 3H2HA 3M6UA 3ND5A 4TKUB 4P2GA 3WL6A 4DDWA 4HBZA 4KKXB 1YR9A 3DKRA 1X15A 2OM6A 2PKEA 3MRSA 4G81A 3HNOA 5JSUA 3K8YA 1CDZA 2VJAA 4P32A 4Q7EA 3OF2A 3QF7A 4NZZA 5B7QA 5FV7A 1AGXA 2Q3EA 1F8XA 5LBIA 3IDOA 3IYLW 1WSAA 1SKYE 4KXNA 4LF5B 4KQWA 5K3DA 1U02A 2PGOA 4AIIA 4R5HA 1P5FA 5IJ0A 1CG6A 3KLPX 4U5XA 1GDTA 2PMFA 3QX7A 4YRCA 1GYRA 3LZ6A 2FW7A 4W5RA 1YJCA 2ZE5A 4R1OA 3DZHA 1KFKB 4Z53A 2JGKA 1ODTC 2FSVA 2QN3A 4ND4A 4CR6A 4JXXA 4YAJA 3KXKA 3SLKA 1VMEA 3MLBA 4Q3CA 3PCRB 3C43A 2G0NA 3NBKA 1LV8A 3FKQA 3G2HA 4BLPA 1UK9A 4F3YA 2DERA 1Q0ZA 4LXQA 1HGXA 5DTEA 1CVIA 5BVGA 2Q3MA 2J0QA 3TL2A 3O94A 3VPCA 4BFCA 3ILHA 5KVAA 1M6NA 3IJ5A 4DKXA 3VNUA 1BEEA 1H1LB 3G2MA 1KL7A 1Y7IA 3NPMA 1ICEA 4PPQA 3O8DA 3VZPA 3I64A 4GECA 1VMAA 5GZ1A 5JBQA 5F98A 3B1KA 4CLOB 4NYJQ 4H1TA 1F3OA 1JKFA 4ECEA 5K0CA 4TZ6A 1SBHA 4QOHA 3IE1A 3S8MA 4MDYA 1ESCA 2UYYA 5ALOA 3K0AA 4C1NA 2NVOA 1F7VA 3HRIA 4EW6A 3KK0A 1GLNA 1PIWA 2BGKA 3JVVA 3PX3A 4GRDA 2V5VA 1VFPA 2HLHA 4ZDKA 3G7UA 2UZIR 4BX3A 2CKDA 1N6RA 1OBHA 5FWYA 1ZCBA 4G56A 1GZ4A 4X64B 4OJQA 1L7QA 3KQTA 2H4ZA 2V9ZA 1PWYE 4PO3X 3U3JA 3V1KA 2IOYA 1R16A 2BDTA 3FUWA 1ONBA 3ENVA 4BEJA 2GJAA 4JBIA 4ZVRA 3SJBA 3JZIA 1N7GA 1UQRA 1XT6A 4N1AA 5U9CA 1R8QA 4LYJA 3DE6X 3L02A 2ZVPX 3LA8A 4C6TA 1RLJA 1Y1LA 5A0TA 4HQFA 4JBYA 4OSPA 1PG2A 4Q03A 4GOXA 4OL0A 4P9NA 1W5TA 5AW9A 3CC8A 5JNUA 3GD7A 3A04A 1ZL0A 3I2GA 5CJPA 2DC1A 2M98A 4Q3BA 1NLMA 3HJNA 5IT0A 4H7FA 1JEQB 4L27A 1CNMA 3QKSA 2EX1A 5EGSA 3LKZA 3T7TA 2QM7A 3L6EA 1LXCA 5TGDA 3WBFA 1HR0B 3O3NB 2AUNA 2PR2A 5JRDS 3LT2A 2FRVA 2CYBA 2VJNA 5L4NA 4LUCA 4XLTA 5CVTA 1KERA 2DHCA 2CUTA 1E3WA 2FUNB 4N12A 4OCZA 3ZHVA 3B82A 4F1KA 1XSEA 2ZM5A 4OQZA 1ADYA 1OXBB 5BN3B 1JWAB 1E92A 1JQ3A 3PSHA 5HUQA 2E4AA 2QM0A 3F78A 4HWPA 3BMOA 1WLYA 2G0TA 2AH5A 4DYHA 1ZK2A 4G1MB 1XBTA 5ITSA 3I52A 4HGOA 3WV5A 1GNTA 4GVPA 2A9VA 4GOJA 4KOAA 3MOSA 4QOFA 1EFAA 2JL1A 2DZDA 2OCPA 2NU7B 3RTCA 3HVRA 1ZI9A 3L7KA 3UBTA 3TS1A 4I55A 2QX6A 1ZSNA 4ASUD 2XBUA 4TYMA 3FFBA 5JIBA 1X94A 2HL6A 2PLNA 3A32A 3D3KA 1P2BA 1YQDA 4JJKA 4FZVA 3RIHA 3RS8A 2Q6IA 4Z9BA 4D0GA 1KRWA 4EJSB 1HNNA 2AOTB 1DG3A 3DBHA 2XT6A 4C5AA 1BDIA 1CR6A 1KAGA 3OX3A 4KQKA 4AYXA 1V8OA 4BZPA 2VXBA 4Q4LA 3UJ9A 3NWPA 4XLZA 2MHCA 2C57A 3QIVA 1CUDA 1QP8A 5GOTA 2QIPA 2GK4A 1TJ4A 4K86A 3BSSA 2NUTA 5DX0A 4AZTA 4MNTA 3DCJA 4N5LA 2FMXA 2YYSA 1GU0A 4E4RA 2DKFA 3K09A 3L4SO 4YAGA 2VCHA 1PL7A 5HKOA 1G55A 3O95A 2G1AA 3BH6A 4PGHA 4YJDA 4PCAA 5EAIA 4DLSA 5FWNA 2O57A 3IQDB 1R6VA 2E48A 2VP6A 1RYDA 3FFWA 1EGVB 5B53A 5LUBA 4CKXA 3WLJA 4Y2UA 4UNQA 5HFAA 3LRTA 5ES4B 1WKCA 5EFOA 3CKLA 5FOXA 1MG5A 1Q20A 4I5GA 3RJZA 5TY0A 3ZU5A 3AO0B 1AXRA 4CQLA 4LXHA 3ZHOA 2C5HA 3BJZA 3CY6A 1VDZA 5CXSA 4QD3A 3WGNA 1LPOA 3LKDA 4F5WA 3WSTA 4XQGA 2OE2A 3BL5A 4TKMA 1TFUA 1WMAA 2XWJI 2VIIA 1OU0A 4L4XA 2IH2A 3UXEA 2Q6KA 3EY9A 5DGCA 1YTUA 4JXZA 3PD1A 4C0AC 2OCKA 1XFDA 2IEZA 4BN4A 5BUSA 5D6NA 3K2BA 3ESCA 1CPYA 1US8A 4AXXA 1VYTA 1GWNA 1K66A 4X8LA 4URXR 5JWHA 1KO5A 2OO5C 3LZDA 1OJLA 4JOQA 3L4JA 1CV2A 4Y8VA 5LD2C 3IR6A 1T8YA 2WMNB 3DW1X 1KPIA 1ZHFA 2V6IA 4F9FA 4Y6LA 3Q9UA 3E27A 1CRQA 2CXQA 1GFSA 1UKYA 3ET5A 5GJVC 4QT0A 3VZBA 3C7KA 8GPBA 2QSJA 2Z30A 2GF0A 2DP4E 3PQEA 3PQFA 4ILEA 4HSEA 4N82A 3P5BA 3R7WA 4AJKA 2QOEA 1E60A 1G1MA 4W1PA 2PBFA 1WKBA 4UVIA 5FTLA 1JHAA 1HT0A 2YWEA 2I34A 2EQAA 4R2WA 2UUAB 3M6AA 4EJFA 3ZDCA 3A4VA 2X1MA 5F21A 3WDLA 1RCTE 4QYIA 2BSXA 2KI5A 3RROA 3WYDA 3D8UA 4CM6A 5AM3A 1WTCA 1E3SA 1XD2B 2C8VA 1SXIA 4BDTA 1M8PA 4YRLA 2VJCA 3AUYA 5D3MB 2OHOA 2IUYA 1LLFA 2QTFA 2RGDA 1EM8A 3DEYX 3F3KA 3AF3A 3KSRA 1GGKA 1T6YA 4QDJA 1XTZA 3EIOA 4TLDA 3DVRX 5BNZA 3QHQA 5HUJA 4HDCA 1Z7BA 1AKRA 3PPWA 1BA3A 4HDMA 4PHCA 1JAHA 1PX0A 1RJ9B 1TEXA 1C50A 1EU1A 1UBNA 2R8ZA 4WKCA 3SIXA 4MS1A 2FB9A 2I4OA 1BCRB 3PHCA 4D8WA 1RWKA 1LA2A 4CFYA 3R7AA 4Z54A 1LH0A 1MH9A 3FFAA 2AQHA 3U3KA 2WSBA 3OJ0A 1AKNA 1J2YA 1VJDA 4MV9A 4FR0A 4N8SA 3AHHA 4MV3A 3MJTA 4P7FA 4X6LA 4LJSA 4JVLA 2F1IA 2R3SA 1OXXK 1PK9A 4H7JA 4M89A 1ISRA 2DQKA 4J9UE 3PZBA 1AHPA 1EDEA 3S1AA 5LMUB 1H9BA 1OZFA 4UVHA 1QV7A 5JPIA 3L5OA 4EW2A 2Z04A 3V9PA 2GTIA 3ZU6A 1DL5A 2YWHA 1OFHA 1TZKA 1I0ZA 1VJRA 4M0FA 4UC0A 3VYUB 1KJWA 1G7SA 4KK3A 4BL5A 2F1HA 4B3GA 4C7JA 4N5HX 1L3CA 4PG6A 3DOUA 5F33A 1CULC 2D0DA 2W8ZA 3Q7SA 1DWPA 2Q0QA 5EMJA 4NLLA 2FLWA 2HK8A 2XMCA 3A9SA 4FE4A 3SJZA 3EJ6A 4DZRA 1KEEB 1CKEA 2G5PA 4D5EA 4JWKA 1WS6A 1E8MA 2ZP1A 3E03A 1C5KA 2AL7A 4K46A 1URPA 1L7MA 1KJQA 3KPVA 1Q6YA 2XITA 3RC2A 4JLPA 3W3AH 3WISA 3CR3C 4MR9A 3C6BA 3NYRA 4INJA 3U9LA 4EI9A 4NYIR 1QG2A 3O4VA 3T4XA 1K6JA 1VSTA 1DDOA 2AOWA 3SE0A 4BNKA 5KNCH 4B4WA 1H6BA 4DLPA 1AHHA 4OAOA 4QUAA 2GN9A 1I9GA 5HNKA 3UV6A 4HNAB 4MZDA 3ZJ4A 2VRWA 4AB1A 3M1IA 3NEYA 4MR8A 4AS2A 3CZ9A 2I0FA 4JVSB 2C7GA 2HQOA 1NM5C 2OAQ1 4K9NA 4R9UC 4CMGA 3S55A 2KJQA 2I6XA 1RC0A 4QPDA 2O1EA 1KNXA 5T4FA 4H2DA 4ENRA 5JALA 1H3FA 3FPJA 5DFAA 2WM3A 4G4SP 1TTTA 1K9VF 3T9AA 4CIVA 3VR6D 4RF5A 1VIMA 3F6CA 3QBVA 3G17A 3H9BA 4DC0A 1NRWA 1UC9A 3S28A 3ZCVA 1FFEA 1MORA 4LHVA 4JYMA 4QQNA 1I5OA 3NYIA 2QF7A 1PUIA 1QOQB 4TMVA 3VH3A 5JEDA 2O19A 1AKEA 5L6LB 1ECJA 2P1RA 2HWWA 2DJ5A 3L8DA 4HX5A 2PSSA 2CB0A 4RKFA 4UBOA 4X7RA 3Q3HA 5G0WA 3QPDA 4O2BB 4H3VA 4P93A 4ZVOA 2I54A 3WTCA 4CCWA 4WFKA 1A0OA 1RPAA 5JYCA 2GLXA 5L8VA 3QEAZ 3H97A 3N75A 3ORSA 1VFNA 2PKXA 2AEEA 5B1EA 1W1UA 1N8KA 4ESVA 4DILA 3P96A 4NENB 3AMVA 1T9DA 1Z82A 2QI9F 1W4LA 3MPUA 4GMFA 5FH9A 1SBCA 2Q21A 4I3HA 3U81A 1G4UR 2VN8A 3SC3A 4B45A 2G9QA 1E2UA 3NM6B 4RF4A 1N3BA 3PFGA 2KE5A 1Z4LA 4N9QA 1B74A 2JANA 2CVHA 2PANA 1SQ0A 2NO5A 3PIIA 4JLSA 5AHXA 1IHUA 2BDEA 1ECLA 2HF8A 2B1QA 5EMHA 3I4FA 1O54A 3A1NA 1RWXA 4CG3A 4EHNA 1ZLXA 5CFMA 1KY5A 2J46A 5KNDD 3ZDDA 4CFSA 5I7EA 1IZ7A 2DCUA 5F2NA 1K08A 1XZCA 3S2FA 2IE0A 4CV1A 1K75A 1VPEA 1G66A 4X24A 2BZGA 3IP1A 4KYIB 3AONB 2ET6A 3NRCA 4KIUA 5IJXA 4FFBA 1DQNA 2PRJA 2RHRA 2AHOA 1FNNA 5ALMA 2PCJA 4UDXX 4YRZA 5IZCC 5HQJA 4FD3A 3OF5A 5KWVA 1GARA 2QX9A 2RG7A 1IHOA 2HNAA 2J32A 3EIWA 1D1PA 4DLWA 2PEYA 2V58A 3AR6A 4U39A 4F3NA 1CTQA 1XQ9A 3D8RA 4US2R 3JQGA 1IBKB 4P7GA 4J3FA 1XTJA 3GCXA 5I01A 4CI0B 1W36C 3QNMA 3F4LA 2Y1FA 4AG3A 3R24A 2BELA 3CZ5A 3ZK7A 4XD2A 1GHTA 1DGQA 2GK6A 4JOSA 3WRYC 3FWKA 1BDMA 1YV9A 2JA2A 1UJBA 2R1VB 1DPFA 3BD7A 3WRWA 1WQ3A 1V1JA 4YTEA 4ZWNA 5IABA 1KZGB 5M29A 1A4RA 4IGKA 3SYRA 1USUA 4Z4EA 3T9CA 5EKTA 4EELA 4F6CA 1VE9A 3E22A 3PIDA 1KDYA 4J16C 4LE0A 4OBEA 3VV3A 4MWGA 3O75A 1Y6GA 2ID7A 1Y80A 4J0KA 3MUEA 3IXMA 2PGDA 5BRNA 3KZ1E 3SHVA 3ELDA 1V96A 1LLQA 1DXOA 2OCDA 2QY9A 2VPYA 1D9XA 3AY3A 4KDRA 4KXYA 1NU8A 1A5BB 3R23A 2O07A 5CT6A 1CUGA 2TECE 5FB3A 1J5XA 2WIAA 4BFUA 1DUIA 4OHFA 1E9AA 4A03A 3EXHC 2IPOA 2ALJA 2Q5JA 4WT7A 2JHFA 3L77A 4KE6A 4RKEA 3R9IA 1YJQA 2P4QA 2ZTLA 2FX5A 2AEFA 2IWHA 4P4LA 2XX3A 2X5XA 1PZGA 5BMVB 1ZA2A 3ZTWA 4DF3A 4S04A 1REQA 2F3TA 2H4FA 4C4XA 1Q0TA 3AF2A 1ONSA 1KI8A 1JDZA 3CLKA 4AG5A 2DB3A 1VI5A 5EZYB 1XZHA 2QE7A 3R3JA 3AETB 5DXFA 3BMNB 4L5BA 4EEZA 2I4TA 2QPTA 3R5HA 1ZIPA 2MT9A 1TC1A 1XLVA 1ZMRA 1CUFA 5ALHA 3UYLA 3JRWA 2EJTA 3TL3A 3GEMA 3LK6A 1MO6A 5J2TF 3HXOA 2ILTA 1ZZGA 5EWMB 2B2CA 5COQA 1JDVA 2GCOB 1QIKA 3GPDG 3FMVA 3K6JA 5I4KA 5A3QA 3FOAA 1JBEA 3FI0A 2CFIA 2H2GA 1B42A 4EEXA 3EAFA 2HTFA 1LPSA 3K0KA 4Z2YA 3UGKA 1G41A 3RUAA 4DQDA 2VAXA 1SZCA 4Z7QB 3NWOA 1RLOA 3V46A 3H18A 4KQ9A 3CN9A 1EP2B 3D6NB 3HFJA 2NQ8A 3KG2A 1XXLA 3O4GA 3R41A 4L16A 4D1YA 3KFVA 5A9RA 5BQFA 1MGPA 2HA4A 3DAGA 5B7PA 3JASA 4L0QA 1HH4A 1S02A 3SYNA 3V8PA 4QHYA 4EZBA 5F4BA 1E79D 2Z83A 2ODPA 3STYA 3VYSB 3OZAA 4OP3A 4IWYA 4HZUB 5TS2A 4ZOEA 4YUAA 2PUWA 4DCTA 3PGJA 3GDHA 2JGFA 4HFNA 1F2VA 1FDVA 1TB4A 4BMZA 5BXQC 2A6PA 3ANSA 1VI2A 1KC3A 5FKJA 5HJ7A 4KMRA 3L01A 3NM5A 1G63A 5H83A 1WZCA 2JCGA 3WBBA 5IAOA 3TZHA 4DS3A 4LXIA 3CNNA 4DXAA 1FS5A 3CRZA 5CBPA 2YJ5A 5M5BA 3LWZA 3RDPA 1J0AA 1NVUQ 3EJWA 2D59A 5SZJA 3H0EA 3ML1A 4L9SA 5FR1A 1UBJS 3VX3A 1VPWA 5ERYA 4NMLA 3VH2A 1MJFA 3T5DA 1YDEA 5HHTA 4TWBA 3E2IA 3SZGA 1ZA1A 3H9GA 3N1UA 4JZYA 3SQWA 3JYHA 3ZQJA 4DMCA 2ISQA 3I5AA 4Y1EA 4XFJA 1WL8A 2ZJ4A 1XFAA 4YCMA 5A6VA 2B6NA 5KJEA 4AO8A 1ESNA 3H8WA 1IZ9A 2C42A 5J58A 3WB2A 1P60A 3P8ZA 2FTKE 3GZTB 3DS8A 1SBQA 2PT5A 1PJRA 2WUEA 1VI6A 2X4IA 3KR0A 3L8GA 3HUUA 4M8LA 3ZV5A 5BNTA 3W1EA 5IT4A 3T3HA 1RYZA 3OZTA 4TWIA 4GOKA 3C7DB 3CINA 1V7PC 3ZWPA 2P8JA 4OHZA 4KR0A 2WBLC 4PO8A 1NUUA 1R2QA 3LCMA 1NJGA 3EMBA 4HB0A 4A0HA 4J7XA 4XQCA 5ELMA 2FSUA 3LUCA 3MRXA 1P4HA 2F1JA 3OJEA 1QV9A 3ZKAA 1Q19A 1GCIA 1SU8A 1BH6A 1RRVA 2AI3A 3N2LA 5SZIA 1U9IC 4V0NA 2Q1UA 3GZNB 4MYHA 2CY0A 1G9XA 2XCLA 3F6RA 3CUYA 3VV2A 3RH0A 1JNYA 3OZIA 3WL3A 4OI2A 1DQPA 3H2ZA 3WLKX 4Q0MA 4UARA 3CRVA 4MW7A 3ZHUA 2HRBA 4C04A 1R0WA 4CKEB 4R3WA 4HN4B 4RIGA 4R8VA 1E2IA 3PFNA 3U3OA 2NO1A 1I4OA 3ZNOA 1NNSA 4DYDA 3UHPA 1YA4A 4OBWA 2X3UA 2QTBA 3NNNA 5CT5A 5HRUA 1MDFA 4DSUA 2Z4TA 4MYSA 1PWHA 4PTYA 4S35A 1XMOB 4F9EA 3NH9A 1T2VA 3RREA 1BRTA 5JDCC 5IF9A 1OV6A 1V1RA 4XA8A 5FBKA 5CB8A 2I6UA 3DE4X 5E3HA 2QAGC 3N2ZB 1LVHA 2HX1A 2Q5QA 4HQRA 4IDAA 4E6EA 4F6RA 3MYYA 2XWSA 2BBTA 1FW6A 4P4NA 4L28A 4UU7A 3DEKA 1RLMA 1TD9A 2YC4C 3VO2A 2I7DA 3KOUA 1NBMD 3ZVNA 1C1YA 3MBOA 3TQSA 4KPEC 4WN9A 2JC3A 3MGCA 2ZDGA 2WJHA 4CRWB 4O08A 1PR3A 1MB9A 3AJRA 4HUTA 1QG0A 2PVCA 2Z8ZA 3I73A 4JLMA 2H4WA 5AKGA 4LVNA 2GA9A 3K0FB 5EQFA 2QRKA 3HXPA 3OEHA 2QM3A 4V0SA 1U2GC 2A9QA 3DSRA 1QHEA 5C80A 5JXWA 5DM1A 2JDID 2R8OA 4HGQA 4CQMD 2B8EA 2VP0A 3LQ1A 2ESRA 3SFTA 3DOCA 2MSWA 4Y2PA 1FSSA 4DSZA 2QQEA 3UUFA 4MVJF 4D5GA 3L8FA 5IJ9A 1M2OB 4H7DA 5K3EA 4FSDA 4CHGA 3GB9A 3N87A 4R8MA 4I50A 1TCCA 2OV2A 1YC2A 5CHEA 5DE3A 1YF3A 3IJEB 4YJKA 3PHGA 5ES3A 3CVYA 1P7ZA 4RF3A 3GXBA 1IEQA 3IRUA 1U8CB 3A9WA 3S7ZA 4B7ZA 3L0OA 1GPJA 3DGEC 1ZNXA 4WL0A 2ZBDA 4YCJA 2UU9B 1Y8ZA 2GHQA 2PNJA 3O9MA 1TA0A 3FDZA 4RAOA 1NOJA 4ZQGA 3G8AA 5TF0A 4US1R 1S1CA 1U9JA 5EWLB 3PDIA 4AS1A 4K1XA 4WKGA 2D1TA 3VR3D 2XF8A 2FKNA 1U8ZA 3DDZX 2IEIA 3C1TA 4KGVA 4PV7A 4Y2JA 3RF6A 2C7QA 3UATA 3EZXA 4ZAGA 1TADA 1OXMA 1YZGA 3ABIA 1HT2E 1MOPA 5M34A 4HXFB 4XB6B 4D3SA 3UFXB 1G5TA 4C0WA 4KR3A 3WKCA 1U7XA 3IEXA 1N2JA 2VJMA 1HLDA 2V1XA 4Q16A 1EIZA 4KG7A 3AY7A 3E5MA 5JPDA 2CT8A 1EK6A 2IU0A 5H82A 1C1XB 1B6GA 2IYAA 3BMQB 4B6PA 4XVUA 2WOJA 3DMTC 2BR5A 3OUZA 4M83A 2V7PA 1ZN9A 5DNVA 5B1IA 4G9BA 4JIGA 4C4ZA 4ND5A 3SDSA 3TOVA 1KYQA 4P5EA 1JDJA 3A3OA 2BKXA 1XC7A 1QQBA 3ON5A 1NN0A 5IHPA 4G24A 1PT8A 3PENA 4KWEA 4S24A 2Q46A 2AFHB 4LZWA 2P5TB 4R0VA 1IVSA 3ZOZA 1VL0A 3EC7A 4DIBA 3LQRA 5JS2A 4RPGA 2I2WA 3AF6A 1QHIA 3NCTA 4C3VA 4LYAA 5I5GA 1HUQA 4RCYA 2P0AA 3ZTTA 2HUNA 1CQIA 4KZKA 4XWTA 5JCOC 2QAIA 1VPDA 3D0QA 3DLPX 4DG5A 5DYTA 4CCSA 5EE5B 4Y2GA 1L4HA 3O3CA 1YDFA 1TQHA 4RM2A 5E8JA 5HCNA 2V4ZA 3VISA 1V2GA 1STOA 1QXSA 2ZITA 5ALNA 2EVWX 4FQ5A 4ACAA 3L6CA 3IV6A 4HDKB 2RK6A 2GCNA 1ZESA 4PF1A 5FWDA 3QVJA 1VP3A 4E7OA 5IVPA 1X87A 1U8YA 2HY7A 3CKMA 4BLWA 1AVTA 2HWUA 1ECGA 4QG7A 2HSWA 2AN9A 1H2FA 2EQBA 2YXDA 3CJRA 4L85A 1EPUA 3TDMA 4N01A 1VE1A 1KI4A 2R86A 3ADKA 3MQ4A 4YRQA 2QQ0A 2FFHA 2F55A 3OD1A 2Y3IA 2Z3ZA 4L07A 3U56A 2ZS9A 4CF7A 4QO7A 4URUR 3BTSA 1Q0PA 2JFGA 1QVRA 2M1ZA 3M7IA 1YZUA 2ZSUA 1Y7TA 2P41A 3HRHA 4HYYA 2XZLA 3L7OA 3TFQA 5ETJA 6YASA 5JH7A 1L4FA 2GN1A 2N3ZA 3T1TA 4HB2A 1FTWA 4YRBA 4HS9A 4WZAE 2CGEA 2VF2A 2JAQA 2VP2A 2CLOB 4UDYX 3NU1A 5DHSA 3WE7A 1E6UA 2C4KA 5B3AA 2X0NA 2YICA 2OBLA 1QGUA 1E6WA 3JQQA 5DT2A 2WIFA 1J8YF 1L1RA 2ZXUA 4FYJA 4KKVA 4PY2A 3B70A 5C7IO 4IOMA 2JGMA 1FUYB 2C5AA 2VPIA 3A6LA 5AJVB 4RK6A 3KUUA 2R44A 3G1WA 3GEBA 5JMTA 4OMFG 2K2WA 4O4JB 7MDHA 3OP1A 4GX5A 2JFYA 1F38A 4WNCA 2XB2A 3PLNA 1P45A 1QH0A 1TYZA 3MMSA 3QU4A 4B7XA 1QMPA 1VMIA 3GN1A 2GK3A 8ABPA 3G68A 3QXHA 3C97A 4JI4B 2PL9A 3IOYA 3RSGA 3V4PB 2PQMA 1RWBA 1IWBB 3EXAA 1VPVA 5KB3A 4XGIA 1ENYA 3EEBA 1EB9A 1OLSB 1XNRB 4HYEA 3IOBA 1UQUA 4OGGA 4UNIA 2VZ0A 2O8FA 5B12A 1JIJA 1FDSA 1JKJA 1AKVA 3GLGE 4IDGA 4TWRA 2IY9A 1SB9A 2C54A 2QSZA 4MK4A 2J30A 1R37A 3L05A 4GAEA 4WXHA 1USVA 3AV3A 2CXUA 1EK5A 2IXEA 3IVRA 4IXWA 3I0NA 4JLJA 3UKOA 4D98A 1X8JA 3BH0A 1Z35A 4M99A 1EKXA 2AJ8A 1GRCA 4LEIA 1YDHA 1YACA 5KYWA 3L06A 4OOFA 4Q7MB 4X5OA 1TM5E 3SEAA 3TXAA 1E8DA 1ZINA 2I8AA 2QL6A 2ETVA 2PUJA 1UM9B 1GNRA 3DVQX 3K1JA 4TLLB 4HLUC 1Z0UA 3WWZA 3I8SA 2GPAA 2IV7A 1IDOA 1UKAA 2PKQP 3OPQA 4PICA 3EZ7A 5JJBA 2AMYA 3HYCA 3WL7A 2XMZA 2OXRA 2VSQA 5FL7D 4B4KA 4ZI7A 4CIWA 3SIWA 1ZU4A 1Z4KA 1ZRSA 4QPPA 5FX2A 1KEKA 1PFKA 4BQQA 1OA1A 1KRXA 4ARUA 3TB6A 3GFFA 1FLVA 2IUSA 4I4NA 4M53A 3E5NA 4NULA 1Q0LA 4LSGA 5F73A 1YB7A 1OPXA 3FUXA 1O6CA 1XKQA 3KRTA 3MCZA 4HJXA 4P3OA 3LDUA 4CM4A 1C9MA 3FPEA 1XELA 3OJCA 1WULS 3U3ZA 1HLPA 4HADA 4IDEA 2AGVA 2O8NA 2ZUWA 4LXTA 1PUJA 4PX5A 3UWMA 4BU1A 1QHSA 4E46A 2Z2ZA 3KTAA 2R60A 4G67A 1IXYA 1SUBA 1BQ4A 4MGKR 1G17A 1HE4A 3WXMA 3I9KA 2YY7A 1XXHB 1N2CA 1QK4A 5KO2A 4D26A 3FLEA 2IPXA 3N7AA 4J0FA 2IDKA 1ZJWA 1CYEA 3DVAA 1WOMA 1Z15A 5IT9A 1GTRA 1O3YA 2DUUA 5EEGA 2ORWA 3B2NA 4N0PA 4CMBA 3SQOA 1JKMA 1JLMA 5E6UA 5GQSA 3SJCA 2ZIUB 4ND2A 2WAMA 3AKCA 1R9MA 4J03A 4FWBA 3ROZA 3WMGA 2JS7A 1PW7A 3EEYA 4IIJA 2YMLA 5KOJA 3I2JA 1HWYA 3KKOA 2OILA 1OF1A 2AD1A 4MS4B 1ZL2A 2PX6A 4KU4A 1YB4A 4QLBA 4FW8A 4RTPA 1UWVA 3C4QA 4BJ6A 1UMDA 2WP8J 1ORVA 3OA0A 3FOZA 2JG3A 2NVUA 2VXYA 5AIBA 2PTHA 1EWKA 1A7AA 1ZUNA 2JGEA 1RHUA 3HMQA 4AMYA 5JCXA 5ICMA 2EEZA 3SVZA 5JR3A 1E2LA 1AA9A 3OICA 1FRQA 4QEDA 1X1CA 1V8PA 4LX0A 5DYWA 3HGMA 1HE5A 2XZTA 2Y68A 3PZRA 3TYXA 3I05A 1OX4A 1TRHA 2YINC 3FTPA 4O6VA 2IZ6A 5FJJA 4YRIA 3EVZA 3O03A 1VKHA 3OE5A 4OKSA 5AVSA 4QYSA 2GESA 3INGA 5ICSA 5IJ0B 1IWOA 3AR8A 3SR3A 3EODA 3DTVD 1U5AA 1TLTA 4ND8A 2ABWA 3OQMA 3HU5A 1EG2A 2OY0A 3L6RA 5FOTA 4RGVA 3RUFA 1C4KA 1XQXA 3O8QA 3UG7A 3WWPA 3HA2A 4JI3B 1GZDA 3GDGA 4J94A 1D4ZA 1Z8HA 2BKUA 4MXDA 4JHLA 3KD3A 2CLIB 2OAEA 3CF2A 2FW0A 4GG1A 2W6ZA 3UXHA 3V8RA 3OOYA 2REQA 5DGHA 3VVMA 2G6BA 4PNPA 2FMHA 5FTNA 5TLSA 5BVGB 1ULHA 3QLVA 3ORQA 2GQ0A 3R1IA 1U9CA 3DBRA 4D81A 5I7FA 5KDDA 4MWCA 4DEXA 2VNSA 3QEJA 3U3DA 2D2FA 3IVXA 3IV9A 3ZV6A 4OGFA 3JQBC 1PSWA 4PSCA 1NX6A 3K09C 1XKXA 2F4VB 1CRLA 1XAIA 2RGYA 3II6X 3V1LA 1TU3A 3I39X 3K0AB 4I6JA 1M8KA 5I9NA 1H3EA 2DBRA 4CDGA 5TGZA 5DM2A 1TXGA 4G8BA 3SDBA 4ZIRB 1I01A 1RYBA 4DCPA 3T8YA 5MFZA 4TT3D 3HO1A 5HE9A 3FGNA 5FWYB 3ANTA 1B8VA 5LYYA 1FXWA 3KUKA 3IUPA 3ET4A 2G4LA 3I8XA 3Q3IA 4D0NA 1MB4A 3Q3VA 1DIOB 1CFZA 3ORFA 3QTLA 2Q9BA 4JLOA 1K8QA 3TLGA 3KR9A 4C6TB 3QLJA 4ESEA 3HLKA 4H35A 3EIHA 5EMNA 3GXOA 2PPLA 4NJEA 3JWEA 5G02A 3WGLA 1R8YA 4IS3A 1J09A 5AJXA 3RVDA 1JIUA 4NPHA 4L9AA 2WJ6A 2ZBUA 1VZ3A 2I3AA 4QVGA 4LFAB 2WJZB 5THXA 3QKSB 1CZHA 1ONNA 3MGGA 4N5NA 4QFDA 3B3AA 2BPOA 2VHCA 3M3PA 1E3WB 1V5IA 5DMHA 3PFKA 5A62A 4HQKA 1WPRA 1T0BA 1XZBA 2QX8A 1IEXA 3BMOB 4JEMA 5DWVA 4BAZA 4DMGA 3ETJA 2A7QA 4U7DA 3PX7A 3OTQA 3UHJA 3Q3EA 2JIOA 1OYWA 4C4RA 2FUEA 1OGJA 4NESA 2C1EA 4WZBE 3SM3A 3H2BA 4V3BA 3BF8A 4QX6A 3G9ZA 1PFGA 1SO8A 1SD5A 1YOVA 2ZETA 1E62A 3PHIA 1R88A 1SY7A 2TMYA 2P69A 3DR3A 4GP9A 4HR7A 4I55B 1HDZA 1QTNA 4IQ8A 2FPMA 4JEUA 4PQRA 1AOXA 1WUYA 1CJKC 2B4RO 5IG2A 3EQ8A 4JLBA 1OAKA 4BVLA 1I3KA 5A04A 4IGIA 5EJ5A 3DYBA 1JLSA 3IAS6 2KBEA 2V0NA 3LVFO 3TDNA 5DGTA 5G3YA 2UYQA 1NTOA 2V0CA 1CQXA 3DBHB 2FE4A 4Q9HA 3AHGA 3LUAA 4BZXA 4G09A 1Q3KA 4H27A 1S7CA 2AV6A 2DPYA 1N5RA 5A5FA 1DSSG 2YWFA 4FFNA 4NCIA 1YKSA 1V8FA 2R7KA 1JI0A 1KFEB 2NUTB 3CKYA 4UHFA 3AUFA 2QI9C 5FA6A 5EIBC 4ISBA 2JGJA 4ASUA 1YA6A 2ZYWX 3HU3A 1EFVA 4X7BA 2PGNA 4AF8A 1EESA 2H1IA 5ALKA 3KELA 3W1VA 2B4TO 5FTMA 2CWDA 3JWHA 3TPZA 3VMMA 1ZD9A 3VTKA 2WHRA 3R4VA 4NEHB 3ZWBA 1SZJG 3LIIA 3H5OA 4AZVA 2GBFA 4PBTA 4C5BA 2ZM6B 4BZZA 1OH7A 3MTDA 5U1PA 3T3OA 4RSGA 5EJFA 1IK6A 2R6HA 1SC3A 4Q1BA 5AKKA 5BQXA 1PR5A 1VL6A 1XF9A 2NXWA 3IQWA 5JNLA 2XR1A 2CFCA 3OP4A 1KAOA 4GR4A 1G3QA 4OJYA 4CQLB 3DE3X 3D6VA 4BFLA 4DM3A 1WG8A 2IYOA 2ONZA 3ZLUA 3RSCA 3P9QA 1QGDA 3G9QA 1GQ2A 3JQFA 4ITVA 1NNUA 1HYHA 3LQ4A 3WFZA 4N47A 3VDQA 3OJFA 3VR2D 3MWDA 4HUQA 3TQQA 5DTJA 3MAAC 4LMAA 5GADl 1BMTA 4QU8A 3FA2A 4RPCA 4IDHA 2CEAA 4MAMA 1CJMA 2C5LA 3LE8A 3KJNA 4FSHA 1N2XA 2FWBA 3L49A 4JZKA 3VZDA 1US8B 3KYCA 4QNMA 2GF9A 2W2XA 1ZJ5A 3IAFA 4PQFA 5HIIA 1ZGBA 1W36D 4GI3A 4AY3A 4Q47A 1U0EA 4C89A 1XF1A 2C2YA 1W4BA 4L08A 2V7GA 2JI9A 3GPBA 5TT1A 2VYQA 4DNPA 1Z4MA 4Q3LA 1B16A 1WCIA 2N9UA 2Y4NA 2EHDA 3DYVA 5DZSA 4M1TA 3R7WB 4I5EA 4PSDA 4DYVA 5H9VA 2V74B 5TQ0A 1XIVA 3F7OA 3MTGA 4FIZA 121PA 3R9XA 3J81A 1QIIA 1WPGA 4KXUA 3FVTA 2GDJA 3NVDA 2HRRA 4A6EA 4BNDA 1A5TA 4G0WA 1C9YA 1S4MA 3T3MB 4QYIB 4NFHA 2DSTA 4WPGA 3GJSA 5LXTA 2OAP1 1APBA 5I7OA 1X8KA 3A0RB 4MDEA 1FP2A 3W4IA 4DIKA 2C2HA 2QN6A 2FE1A 3MT7A 4HNRA 2WWHA 3BXZA 2FVYA 1EM8B 3F3YA 4W1QA 4RSRA 4ARBA 1ZVKA 3K92A 4OA5A 4UE2A 2H17A 3N70A 3PRYA 3CZMA 1U7DA 1IVYA 3GT3A 1YR7A 2VLIA 4HDMB 4KIFA 4OQXA 4YIKA 4YMWA 5AT1A 1J1IA 5FYQA 2PGJA 3F9IA 4J90A 4LWPA 1K92A 2YH2A 4MS1B 2A9FA 1FMFA 1BDBA 1QDEA 3AESA 4WGFA 1TTPB 2Y1CA 3IAS1 3OLZA 3PNBA 3WWYA 5KJCA 5AXCA 5KTKA 2XEDA 3FF4A 3ORYA 4DCSA 5GY7A 2G4CA 2R6DA 3EMVA 3HA5A 5BN5A 4KX3A 4LVCA 1B4DA 2H85A 2O0HA 4KN5A 4NI5A 4F21A 3I09A 3S1AB 4PRLA 2BUBA 1TU0A 2CXSA 1XD9A 4UU0A 5AK5A 1CXZA 2PWAA 4ZU3A 3MJVA 3UYKA 2X8AA 3A1EA 3OEWA 3WGGA 4Q00A 2JB9A 2W6PA 3CUKA 3NDJA 2E2WA 1GL6A 4HF7A 1EMDA 1J07A 3FWZA 3HCRA 1NDHA 2J9XB 3ILYA 5B2ZA 3L7JA 3CGGA 1H05A 1LVUA 1VGVA 1HTWA 4MRVA 4NHEA 4OPMA 2QJOA 3SM9A 1GTJ1 2VSXA 4JBNA 3CUUA 1MC1A 4IIGA 4LRUA 1X38A 1B8PA 3IV7A 3E4CA 2Q3BA 1UINA 2QUJA 1JT2A 1K7SN 4IDFA 2CBGA 2EBWA 3VA7A 2FUCA 3G8DA 2IOFK 3O9ZA 2AXEA 3EEFA 4G5XA 5K6RA 4JYBA 4S2UA 5GV8A 1X3LA 5DBIA 2BGMA 3UT6A 2ZIXA 3W7VA 3PX2A 5K8LA 1KP2A 4YMGA 4C07A 3MRVA 4XX1A 1PV2A 1DOZA 4MR9B 4A10A 3WNCA 3RBAA 1KO7A 3IT2A 4Y98A 2FR8C 2X4DA 5AHWA 5ALPA 3REFA 2W58A 3BKWA 3T3PB 3E70C 1RBYA 4JHXA 1XTKA 1R4ZA 2ZSEA 3U9SA 3WXBA 2ADOA 1I2AA 3DL4A 3QHAA 2JARA 3BXFA 4L8VA 4LNHA 4MR8B 3SP1A 4A8JC 3O8CA 5ISMA 1CW2B 3BSWA 3HB7A 4MB2A 4W5OA 1RXSA 2QROA 5KKCA 2I7CA 2GFHA 2WNSA 1TQ6A 4GDFA 4M76B 2ES4A 4NRDA 4H59A 1KEUA 4IIXA 4ZEMA 3A9VA 4Q6BA 4WXEA 1CU1A 2R96A 1UEIA 3O2SB 2D2VA 2L82A 2MWMA 2XMGA 4LXXA 4JP5A 1FP1D 3N58A 1UXGA 4YJ2F 1WHTA 4JLUA 2W2VA 2RH8A 1MGOA 3N39C 3RVSA 1W44A 1XZJA 2GHTA 4G23A 3D7MA 2R84A 1T25A 1B6TA 2P62A 1NQ5A 2FPRA 5L40A 2VDNB 3C24A 1UQTA 3FAKA 4PGGA 4WK0B 1E96A 4WVFA 4KFCA 3THSA 3S2ZA 5J1SB 2XAUA 1CRZA 4XDGA 1U2DA 4IR7A 5A4JA 2OHVA 2DFKB 4L3OA 1TAGA 1EX7A 3U6KA 3SPXA 2FCRA 1WLSA 1B93A 4PTZA 5JC1A 1V4NA 2P9ZA 1MB2A 5DM4A 1Z29A 3VR6A 3W2TA 3ZBQA 1Z4IA 1EM6A 2OV6A 1E2NA 4BBJA 1GA6A 1CUWA 4KX5A 5M2QA 2EDCA 5LIRA 5MGNA 2PX8A 2OZLA 2QORA 1H6AA 1SD2A 3REOA 1Y3BE 2EEPA 3QXJA 2FN3A 4TUYA 4Q4AA 4WI1A 4DLRA 2PRKA 4LTDA 5BV7A 2F64A 2B83A 2TMKA 3SXJA 4EMTA 4ARIA 3AIOA 2HPVA 3R0VA 5F76A 4NDZA 2O0JA 2JLAA 1G21B 1RM3A 5FR2A 1Q15A 2BV3A 2DFDA 2FWRA 2QRJA 3C6ZA 4B71A 1U8TA 3TQCA 4JI0B 4IP0A 4KJXA 1TIKA 1JHOA 2VOEA 3UN1A 3UA4A 1QO9A 3GNSA 1FFSA 1UP4A 4NOLA 3COWA 1WRBA 3B60A 2PQ2A 4N48A 4X20A 3DOIA 1KRHA 2Q1SA 1RRPA 2OFXA 2R66A 3HP1A 3P1JA 3OSUA 2WWWA 2EZTA 1MOZA 4L22A 4UEJA 3RRJA 2JZCA 2Y99A 1GRQA 4FX2A 1LTQA 1WEHA 1ZAKA 4CU2A 2CCKA 3QWAA 4J4BA 4ZGWA 3IAM6 3HK2A 3WNDA 1PGJA 4NMHA 4Z1MD 5KNDA 2FZVA 1IM8A 2NU9A 2H3EA 1GPUA 2XH8A 3JQGB 4IZ6A 5C35A 3B8HA 3LW8A 9GPBA 1NAIA 1BJKA 5AKLA 2NSDA 4CT5A 3RHZA 2Z6AA 1UT8A 2POQX 3KOWA 3L82B 1BVRA 1R0SA 3F96A 3U17A 1L5OA 4G9EA 3TBHA 2DT8A 4OB8A 2CN1A 5IU6A 2YJ6A 2D1SA 4DREA 3PC3A 2O2YA 1WSDA 3LKVA 3GAZA 4Q9LA 4LJ4A 1JH8A 1Z22A 4L8WB 1WF6A 4LPKA 1ZH4A 4H15A 3DAHA 3D4OA 4IDPA 3D3NA 521PA 1FXUA 3JQRA 3N8IA 3E22B 5H02A 7YASA 4AVYA 1GILA 3IBTA 1R4MA 4EK9A 2NO9A 5HZHA 4JYZA 2ATXA 1FMCA 2ZJ5A 4PM4A 3L7LA 2NWQA 4AKTA 1ZFNA 1JPJA 2CMFA 2ATCA 4EGSA 2ZSFA 4KV9A 4TKZA 4K9LA 4PWYA 4ZI7B 4M9RA 4TV8A 4EKDA 2G17A 2LIVA 1CFJA 1MV5A 3IMKA 2BJWA 4FMPA 4E3WA 4E6PA 1OVGA 4RJJA 3ONVA 4PG8A 4IMRA 5M7EA 4HX2A 4O8CA 3FG9A 2QLTA 1DO8A 2ZTUA 4BX0A 5A4MS 5IAGA 4CR8A 3C6XA 1LVGA 1NUSA 2V7XA 3GGCA 4KFSA 1EAMA 1LLUA 4QNRA 4ZT5A 3G8CA 721PA 1WABA 3G7NA 1PJAA 4XEUA 1REQB 2V65A 3EVTA 4LQ4A 5A3JA 3H1PA 2XMPA 2DAPA 4QXOA 3O1HB 3AVXA 3BZBA 3GDFA 3CLTC 5H4HA 5C8DA 1UZUA 1KWKA 4GPD1 2YHSA 4B35A 1TK2A 1Q0QA 1USGA 5JRZA 3G0OA 2FN9A 1LPBB 1T3LA 5HOEA 3OZCA 3S2UA 5IEJA 2IYUA 3NP7A 4O2AF 1DO0A 4V3CA 1ZXBA 2E6UX 4N39A 3ZWQA 4D3XA 2J5BA 4H08A 1C0EA 1XG5A 1ZOOA 2XHEA 3W5HA 4X8HA 4KOEC 1VXRA 3L04A 4KTVE 4RF2A 4G97A 5LSAA 4FC6A 4UCQA 1P0IA 3EIXA 3HU2A 5KQRA 3F97A 2GCPA 2WWRA 1Z8NA 4HAWA 4K8OA 2DLNA 4ABTA 2A2ZA 2PK3A 1V5WA 4AFNA 5COBA 2EBFX 3CVUA 4NC9A 3W9YA 1WY7A 3BFVA 3JASB 4L72A 2Z3WA 4MCHA 4I4TA 1JE1A 2DFNA 5JTTA 3HYNA 1ZRNA 1WDLA 5FIUA 5BWOA 1I4EB 1FVFA 2OGUA 4R01A 2WJAA 4ZT3A 2DTDA 3IQEA 1RYYA 3PC8C 3SQNA 3KQUA 1NUPA 1LKZA 4OHKA 1E7RA 4BFSA 4OY3A 4BFZA 4INOA 5JASA 2V9CA 2VYND 4WCFC 3U80A 5CBPB 3KDPA 1YQ9A 2VEOA 1M2EA 3RS5A 4MA5A 3MJEA 4NY1A 1E79A 2HJWA 5CIQA 4CM8A 1TZBA 2JHCA 2PSFA 2CYCA 2HK6A 1PT6A 2C5BA 3JD2A 5DCYA 4YJ3F 4UHKA 2D7CA 2P7HA 1YB6A 4C22A 5BSMA 4M1KA 3ZDYB 4EX7A 1Q74A 2XMSA 5JCZA 1YCFA 2ZT8A 4LJKA 3P94A 4L8FA 4C03A 3HY4A 1QIFA 1JDSA 4UNNA 4WKNA 2EBUA 1R50A 4TXLA 4D44A 1X1DA 2FPKA 4N0EA 1I7QB 3ZWXA 2D5BA 2ZSJA 3PNLA 5AI9A 2R8PA 3PHBE 4JV5B 1X1AA 4AJHA 4IQFA 3L1HA 3EN0A 1W0KD 4R5MA 1KQNA 1V4VA 3HM2A 1CX9B 5AM4A 4C4TA 1V11A 4Z1OA 3NRJA 5JADA 3BGVA 2GAFA 5LJLA 2PX2A 3GD5A 2O8CA 2IJGX 3VO8A 5KSZA 1IEWA 3OLXA 3R8FA 2VPTA 1RXVA 4CW7A 3AF1A 2VDWA 3ASUA 1MX1A 4Q66C 3TRJA 1J24A 4EG3A 4M0EA 4O4HA 3WADA 1UBLS 4B7AA 4EOGA 9LDBA 5JAPA 3OQ6A 3EVDA 3W6PA 1FNSA 2JI7A 3B52X 3UW3A 1JTEA 4REMA 3ZHRA 4UTRA 5B6PA 4O1HA 4DB4A 1MB0A 3E1GA 4G5SA 4GMKA 3G0GA 4RIHA 5EXTA 5D87A 2ZQZA 3CNQS 1B00A 2HMAA 4KH0A 1RPJA 4NR0A 3DE2X 1VYHA 4I5DA 3AW9A 1JH9A 1J2UA 2R97A 5C7YA 1O5OA 1YJ8A 3CKKA 3C3DA 3PL1A 3G6WA 1ZD1A 1ZITA 2IYQA 1DDGA 1OZAA 5AK6A 3E61A 1Q2UA 4LOLA 4B2IA 4LMBA 4O5OA 5CITA 3EB9A 3NDRA 1KDRA 4JX9A 3FNQA 5FEMA 4D8UA 1UJ6A 3GCWA 4QBTA 1T91A 1DQYA 4U7JA 1YVUA 5K05A 2Z2YA 4BZWA 1WXWA 5DTIA 4KXWA 3WQQA 1VDMA 2DECA 2ZATA 2QW0X 4WXRA 3MS2A 1V1RB 4LJ9A 3G7SA 2QN8A 3GJRA 4L3WA 4RGQA 4IDNA 4IKOA 4EX6A 5K1ZA 2WMOB 1T8TA 1WZ2A 1VL8A 4QAQA 4WFIA 4I5FA 3H4IA 4E5VA 2IU3A 4P3XA 1C1DA 2CHEA 1RI3A 2IU4A 2HA2A 2VNAA 2DU8A 3DNFA 2I3DA 5YASA 1QIMA 5B2FA 4FKBA 4WN9B 4WZZA 2W2MA 4K6FA 1M54A 2C84A 2O5CA 1XR3A 4URWR 3RABA 1UAGA 2HN9A 3D54D 5K3AA 1Q16A 4DLLA 1CRPA 3NHBA 1LBEA 3BHIA 4M88A 1B41A 2FZEA 3RNOA 1R6BX 2WUFA 3CRW1 3P2MA 4FPXA 1BHSA 2VDUE 4Q4JA 2B0CA 5ENZA 5JFGA 1CY8A 1KJYA 3QMWA 3SFZA 1IU9A 2MYPA 4JVMA 1A5AB 1LFDB 3D2LA 1K98A 2WV9A 4ATNA 3TLCA 1NBMA 3QI7A 4IQGA 1DC7A 1YBFA 1CDDA 2JH9A 4E5MA 1GPLA 1NVMB 2G1UA 5LLSA 4BQRA 5J59A 5IJ9B 2ZI7A 2I2AA 4NU0A 5CRIA 4EENA 2VUTA 5GVSA 4I6GA 4LSZA 4I50B 5K0GA 4NKRA 4X93A 1WEKA 1FFWA 5K99A 4TV9A 1MTZA 3K1AA 2DT5A 2JDIA 1DQZA 1NE7A 2VJLA 3TRFA 4CQMA 4F4UA 3ONDA 1AQNA 3EEIA 5H0IA 2CJPA 3FPGA 3N6RA 3NBUA 3W6NA 3D0RA 1JHPA 4MKRA 4U6QA 1VJ1A 1V41E 3FDZB 1H2RS 3MCVA 3UJ7A 3WX0A 1RIIA 3O2NA 3NHZA 2Q62A 4IYRA 3NFYA 3Q2OA 1MQAA 3V8MA 2I7TA 3PDIB 1QRRA 1M8FA 1JS1X 1T5HX 2NG1A 1XD8A 1S3GA 2BGLA 2ZJ0A 4ZTBA 1T0HB 5LDHA 4IG9A 1LF5A 3TBFA 4BNFA 1QWSA 4FDUA 1J0CA 1YRQA 2W43A 2WSSD 4L5YA 4LBVA 1CR1A 4W1RA 2RGXA 3I37X 3KJEA 3PVSA 5P8WA 5BV8A 1NBIA 2FMFA 3V7WA 5KOIA 3JZDA 3GO4A 1TT7A 3AH8A 1MBZA 1B14A 1FFAA 2VJMB 4XM0A 5EXDA 1XZQA 2IU6A 3OZUA 4WNIA 1SZPA 4L2IA 4HNUA 1ZVVA 4NG5A 1PBNA 1SAYA 1Y3AA 4R8SA 4YN3A 3UFBA 3GOHA 3VR3A 2ZIFA 4IJ6A 4RMGA 1CBUA 4B46A 3FMFA 3PYLA 4YT4A 1SRRA 3TNFA 2VJQA 3DTTA 2VWPA 2XWBF 3M1YA 5EN4A 1MP0A 3B7WA 2Q4BA 2Y2UA 1Y8QA 3GHYA 1ZD4A 3KVOA 3DPIA 1QPZA 1QYXA 3L0YA 4Y1RA 4RMNA 5K20A 3FDFA 1BCSA 2GAAA 2GRUA 4BVJA 2VI5A 1FFCA 3MTEA 1QDUA 1P5ZB 5CD9A 1IBMB 3G0CA 5WRFA 1P2TA 5KKAA 1OWOA 2B5WA 1CQIB 4U2KA 3KJFA 4C0BA 5GGYA 4UOEA 3X1KA 1ZEMA 4NH4A 2FVXA 1UANA 2I8CA 3WDMA 4U0JA 4G85A 3AZOA 2ACKA 2P67A 1O2DA 2OT3B 1VG9B 3GQVA 4JR2A 4Y2XA 3WK6A 3THWB 3RS4A 4AMGA 3RYHA 2JAXA 3G2KA 3TBKA 4OGLA 2BTEA 3H7AA 1XQYA 4OMUA 1A9QA 5IBRA 4MV1A 1X19A 1Z34A 3PRHA 3VSCA 3OIFA 3F8TA 1KWGA 3VSDA 4NYIQ 3H6KA 4FI3F 3SZUA 3JQ7A 3C41J 1TM3E 2GN2A 1UZNA 1WZEA 3DMDA 4OGKA 5DASA 3VPGA 5BR4A 1S2IA 5FORA 4IFEA 3GUCA 3N5CA 1MIHA 5EHXA 2XOKD 2WDPA 3EW7A 1MJ5A 1GPKA 2MMGA 1U28C 2YOGA 2HJHA 4IXMA 1MV8A 2QT0A 4AX8A 5LVAA 3FTEA 3UJHA 5KNBH 3ODGA 2CL6X 2E89A 2PUCA 1SR8A 5AI8A 1CE8A 1P0FA 3FIJA 2Q6VA 3GW8A 1BZYA 4YAIA 4PYQA 1DXQA 2FSPA 3I2FA 2DWCA 3SS9X 5IMBA 3U09A 4ZRDA 5JH7B 4B3DA 4PLGA 2CUZA 1TVMA 2VHYA 4GYWA 4OJKA 1CT9A 3MK31 4LY6A 4EKIA 2MCFA 1EVZA 1EK2A 4IGFA 3PR1A 2IS6A 4DMFA 1BFUA 4B3BA 3T6KA 1XRPA 3SKVA 1NF8A 2H6EA 2QN7A 3MZ0A 4K5QA 2IUUA 3TKYA 4F5DA 1QGUB 1E1DA 1NU6A 3SGLA 3OESA 3U4GA 3VZQA 3I6QA 5CX1A 1RAHA 2BMVA 2PN1A 2KYRA 2P2DA 3ENQA 3GN2A 3LF1A 2ST1A 3DYIA 4UKDA 4A16A 2HB6A 1BSVA 4K6KA 1P9OA 3CVJA 5A3RA 1SHTX 2HSEA 4DJ5X 3P19A 2EZUA 2V3WA 2ATVA 1JFRA 1EJ0A 2RGCA 2HT1A 2B2NA 1J2JA 2GPNA 4J1TC 2YN2A 3C7TA 2I3GA 4RZHA 3Q8WA 5CEJA 3GH3A 1V71A 3MWFA 2HEGA 3IDFA 2Y0EA 4IEFB 3MQFA 4OQPA 2UKDA 3ZR4B 1N6OA 1KZHA 4BNZA 2O8FB 1JKJB 4GPEA 2EZ8A 1UWKA 3JQ8A 1ZI8A 4MGYR 2DGDA 2E55A 5DW0A 1A8SA 1L5SA 1U2SA 2HKIA 4PVDA 4EGQA 4FR5A 3QXCA 2PMDA 4HKTA 2PQ6A 2W2PA 4R9NA 2XI4A 2FWMX 4XM2A 5TNXA 5FBVB 1RQ2A 4QPNA 2O7RA 3UJ8A 1HEUA 1OV4A 1CF2O 5FCDA 5KYWB 4EFDA 1OI2A 1A9XA 1O57A 2A30A 3KOYA 1XHLA 2C7RA 2ZGVA 8AT1A 2ZZKA 5A4DA 4HXGA 5LC1A 3C7CB 1WCXA 3BTUA 4PZCA 1DAGA 3I2HA 5EIBD 4BJHB 2GN6A 3AIIA 2A0WA 1ATZA 2HHAA 2J0EA 3BJEA 3CIOA 4ODIA 4HLCA 4RWZA 2LUOA 1U2RA 4TN5A 3BWDD 5IH7A 2AF4C 1AXEA 3T4UA 1MIOA 2QMHA 1IPFA 3X2EA 5HZGA 3ERCA 3KT3A 1KSGA 3D81A 3KUCA 5HCIA 2GX6A 4PFKA 2MSDB 2R1UA 4OLBA 5AVWA 5E8RA 4RVFA 3R3WA 1A77A 4L76A 4MTLA 1E6MA 1N2IA 1DX9A 1HURA 1LNQA 2C96A 3E2PA 2V5AA 3LVRE 4CLRA 1DIGA 3MS4A 3QA9A 1EX6A 2JRLA 4CM4B 1TVKA 4F4IA 1DJMA 2BHTA 4R0MA 2JH8A 4PLWA 4ZVNA 3TZLA 1A4IA 3KTAB 3RAPR 1S5PA 4AUNA 4CHTA 1QYDA 2AW5A 2WLSA 1QYVA 1QHYA 2YIMA 3P71T 1N2CB 5FL7A 3VVCA 3K73O 3ASYA 4P1ZA 1FJHA 3UY4A 3P2JA 5I5EA 1TM7E 2YZ7A 3GWZA 1OLUA 3DVAB 5M3BA 4URFA 1DQRA 1M34E 1D2EA 2AMFA 4F3CA 1Z63A 1Z45A 5BRAA 3A1DA 4QM6A 2EIHA 5EMKA 2NIPA 4OATA 4YCAA 3QBTA 5CCXA 2XNJA 1A50B 2JFQA 2YS6A 3GQBA 5CEEA 5E6UB 3RV4A 4B6RA 3E53A 1XAGA 4OP1A 1X39A 1I6WA 2W6JD 5THQA 5F7JA 1VKRA 1PR4A 3DXYA 3I9JA 4H31A 1P0PA 4IIJB 4DMKA 5KOJB 1I7DA 2HDHA 3BFKA 2BT4A 1O96A 2EYUA 4QM7A 4PS1A 3JQEA 5T4HA 1QGOA 2J59A 3LUKA 1K4KA 1UMDB 1WE2A 4TGLA 3TZ6A 5GONA 2CXPA 4D8XA 2XCSB 2NVUB 2WF7A 1MMFB 1ZUNB 3EYWA 3S8YA 1ZMBA 1UPCA 3TSAA 2HA7A 1QFZA 4K9OA 3SZOA 1UK8A 2OO5A 4HPXB 1JKIA 3HZHA 1G8SA 1OX4B 4LISA 2IP2A 4TMYA 2CDCA 1SVOA 2PUGA 3BA6A 3DC2A 4FKZA 1EWRA 4CTJA 1OPRA 1PZXA 4DR6B 3JAWA 4ND8B 5ITZA 1ZLYA 3OC0A 4G84A 5AOVA 3RRXA 3I9MA 2GEDA 4U6SA 1CYDA 3HBLA 4KQMA 5CVJA 1SD1A 2HJRA 2IEAA 2NO4A 3O8QB 2VT7A 4L9RA 5AMXA 2EWWA 4KWTA 1N7HA 2ZBPA 4BNYA 2HYIC 4IO1A 1LFAA 2O2IA 3GFPA 2JJ8A 3EZNA 3KLNA 3U0BA 1YH3A 2REQB 4OOEA 5JD4A 2B8NA 4KQIA 3RUEA 2JAHA 2LKCA 3VUFA 1QZUA 1K5GA 2K6GA 4F06A 3PXBA 3FDIA 3DBRB 1C2TA 3DTVA 3HB1A 3H1TA 1DBQA 1QLJA 1R6UA 1YS2X 2IUEA 2NLOA 4ND6A 2D1RA 3JVUA 2ZRIA 3BIWA 1PNRA 3R40A 1P2VA 3GLFA 2HADA 2WPNA 3OQNA 2QTAA 3FTNA 4OQQA 4YK7A 3LDAA 2C1XA 1BO6A 1RMYA 1AF7A 2HNKA 1GYPA 4Y1FA 3CMCO 3HUTA 4PN7A 3F6BX 4XYGA 2NZUG 2ZT7A 2X22A 4CWAA 3LXXA 1RQPA 5DGDA 3MA0A 5DBOA 3ZE1B 1N36B 4I4CA 2WD7A 3LPLA 3EMDA 4ZI3A 3WHIA 3OMLA 3H6GA 3DT6A 1BVYF 4LXUA 1Z73A 4LQLA 4REQA 5E7JA 3F5QA 5I4CA 3L6DA 3L4KA 2JJ2A 3SOZA 3LBYA 2AC2A 3VKWA 2X76A 3QVUA 4ZAZA 4CZ2A 2HT6A 3WRXC 1GJRA 4AMBA 4DJFC 3DO6A 3YASA 1SBIA 4R1MA 3TLGB 2GM4A 3CPSA 3VPBA 1MVLA 3KZXA 1IAQA 1T9KA 5DM0A 1GDHA 1GRNA 2OYRA 1VGQA 3O8LA 4EAQA 6ADHA 3NHSA 1DIRA 4Q18A 4TTIA 1GGMA 4NJEB 5JLAA 4TT3A 3UMCA 2JKYA 3CQ9A 3HR7A 2YWCA 4RU1A 3LO5A 1F2UA 5AM5A 3IAEA 4JKYA 1ONOA 2VSYA 1J9EA 4Z7NB 3W05A 1A7KA 1XRJA 3MSXA 4J75A 4KHPB 1KMQA 3WDSA 1MH1A 3TTUA 3UO8B 2X0JA 4DLZA 5IM4F 1YRYE 4EVRA 4U7TB 2JFFA 3A7EA 4I8IA 1NPDA 1GGVA 4RQAA 1KAEA 2PEZA 4H6XA 4EGAA 1Q7TA 1X3SA 5LLTA 4R1TA 3FI9A 1K8YB 5LZ5A 4GZ6A 3T15A 3EAGA 3H2SA 4B74A 1KDOA 3B2EA 1A95A 2CJXA 1EP1B 4YLGA 1HE2A 4GMXA 4GVLA 3TG8A 4FCCA 2I91A 3UJCA 3TCKA 5CG1A 2XT9A 5JXJA 2P8SA 4D80A 5JAUA 3O5AA 5TX7A 3LHIA 1YOVB 2XKAA 5DRTA 1FPQA 1PFUA 1CB7A 3WMFA 4MVJE 2LIPA 3X1WA 1H94A 3WQHA 4M54A 2ECFA 4LBWA 2EV9A 3OHPA 2C2GA 1GSHA 4LJ5A 5HA5A 3B3JA 1NM5A 1FRZA 3EGOA 5EJ2A 3GIWA 4DIDA 5HYVA 1KZYC 5KYGA 1T2FA 4EUEA 2P3LA 4AP9A 1SKYB 5I7UA 3CCBA 3FNHA 4QJ5A 1MKYA 1CY4A 2P9FA 2A5GA 4H0FA 3LGAA 3AC0A 1NHGA 4FP9A 1XZPA 5HP4A 1Y9DA 3C3PA 3INRA 2C3UA 2VDQB 3G5TA 5H3LA 1IBRA 2KS6A 5HIKA 4DKJA 2DBVO 3U7GA 2H29A 3SMQA 1PZFA 3VNBA 5CM8B 3I5XA 3BZUA 1FXSA 2EJBA 3BREA 1EFVB 4HMQA 5ITWA 5K9ZA 3NGXA 3O26A 1GFIA 2J7PA 2VTEA 2DY0A 1DG1G 1N5DA 1W5SA 4MI9A 4O2BF 1UAAA 4IJ5A 3TTXA 2PD6A 3LQFA 4QT4A 3QQPA 4RTSA 1KDTA 2EQ5A 3VR4D 3TFWA 1H8HA 1C9NA 2ETXA 5HKAA 1H6CA 5BN1A 5AVXA 2PIDA 1QYWA 3CGWA 1BHJA 2R4UA 5DK4A 4K8RB 5T6MA 1TLLA 1VSBA 2OKGA 3PXGA 2YIJA 4B4VA 5AVOA 2ZUSA 3LOQA 2H1OA 4PXAA 3B13B 3F9CA 4H7HA 5E9WA 1F2DA 2ECQA 2W37A 5DCWA 3ZE8A 4ITUA 4P0PB 3MWDB 4FONA 4HUQB 4GKJB 5DBFA 4WKPA 4BWGA 1V2HE 3R3VA 2DFVA 1SA0A 2IEDA 2KPOA 5I9BA 3ZJ5A 2QGFA 1BHO1 1P77A 1Z39A 3OO1A 3VC2A 1ISGA 5A2QA 4PS0A 3ULKA 2WNIA 1F6BA 2D5AA 4Y2YA 4WKOA 5F7OA 2BZ0A 3HM9A 2NMVA 3KYCB 2D7JA 1KNQA 3DDOA 3DKKA 3ORHA 1WMDA 4Y18A 2WWXA 3CPEA 2WHPA 2Q4EA 2VT2A 1V6AA 3ZLTA 1JW9B 3R7NA 1G60A 1DEKA 2WA1A 4JSRA 3TQRA 1SUFA 2JCSA 2DFTA 2LBPA 1VCIA 2DJIA 1WCIB 3CSUA 1YZHA 2AQ8A 3VR2A 1L5VA 3WZMA 2H8GA 5HBGA 5IZCA 1EWVA 3ESXA 3F67A 5HK9A 4AQDA 2G9VA 2YHIA 3AUTA 1WX1A 2XVXA 2Z4SA 1DC6A 2PUVA 3DC7A 3BX1A 1PX2A 1RYEA 1U7TA 2GRJA 3E1SA 4QREA 3ZOKA 1NN3A 3R9XB 1P74A 1TK9A 1L5LA 5FWXA 2X1LA 4MIOA 4MVJD 1QDLB 4BNDB 4BP9A 3FF1A 1Z7EA 1GKLA 4R2JA 4IW3B 2A4MA 5LXTB 3WRYA 1RTKA 1XCMA 1YAHA 2VDKB 4GYYA 4DQLA 4X7MA 2PWZA 2PL1A 3K70B 3TSOA 4LBYA 4XRGA 1J7KA 4WINA 4MQBA 1H69A 1BKYA 5JNRA 3QXGA 5EE1A 2C4WA 3JXEA 3I45A 4OX9B 3L7IA 4YV0A 2V8OA 4FEGA 4J16A 4WZBA 4BP3A 3PDJA 1LY1A 4TRMA 5JSYA 2QV7A 4BAUA 4MLZA 1PVOA 1FU7A 4HY3A 1IHDA 1GNSA 3HCFA 1IG0A 3EQ2A 5JS1A 3MTAA 1E98A 3AESB 3EIQA 1ULTA 3CLTD 4G0YA 3OFVA 2JRCA 2QZSA 5J2UF 2VT3A 4BJ5A 2R8RA 2ZRDA 4KO4S 1L4NA 2QRMA 5BN5B 1QRAA 2PPVA 3CS3A 3EIFA 3PQ5A 4X91A 2GN8A 3EXHA 5DP1A 4D3FA 3SQXA 2Q99A 2RAPA 2WYHA 4BNUA 3QEBZ 1KZ7B 1UBHS 3FXAA 5SZHB 2H7YA 4ZPJA 2ZVJA 3NAGA 1N1DA 2Q0XA 4OH7A 2PNFA 4K9RA 5LP6F 3QW2A 4DWVA 1VHDA 2BFNA 4MUMA 2AVDA 1Y4SA 2B35A 4IO0A 4JP3A 1L1FA 1RWVA 2VRCD 4ZVMA 2FF5A 4B44A 1Q0SA 3QFTA 1I33A 1H2WA 4G2TA 1K6MA 1XCPA 2F3SA 2QVLA 1QUEA 3KQWA 4Y1GA 5CU7A 3WNBA 1L4YA 4JODA 1P2UA 1U98A 4YMIA 3SU8A 4MWZA 3D5EA 1S8OA 2DQZA 3WR5A 1ML3A 3AJAA 1XVVA 2WIDA 1QVAA 1O95C 3LUDA 3KTOA 2Z5GA 2ZIXB 2VWHA 3EGXA 4HLQB 1KU0A 3BILA 4WNAA 4FM9A 4YDHB 2EWVA 1TKBA 2C97A 4C0HA 2J0SA 2EZ4A 1Y1RA 4Q3EA 1BAPA 1Y9EA 3H5TA 1KOGA 1X9HA 1GPDG 2NADA 1P39A 2P0YA 3QF4A 3A6DA 3VH4A 4ZOBA 5JI2E 1PJZA 5BR8B 3FGPA 3P27A 2J4FA 5DB4A 4URHA 1DHTA 2B7LA 4J0EA 5IFLA 2GXQA 2V3VA 2W90A 3UMMA 4JLAA 2XQVA 3NW9A 4KWCA 4O2LA 2OP1A 1EFLA 2I2FA 3H87A 3JYOA 4PX2A 3SF8A 1BS2A 2IXBA 3HRKA 4ZVTA 3HBFA 1Q1QA 2YV2A 4OAPA 4E88A 4WV3A 1UBGA 3ONFA 1YZYA 2A9RA 4DGQA 1RJDA 5FL3A 5SICE 4ER0A 1WHTB 2XW6A 3NNSA 1EXMA 1L7AA 2XXBA 1SHKA 3IOEA 3HJAA 1P2SA 2EX0A 3QU7A 4NQRA 1K3TA 4S2EA 4D9JA 1RI5A 4LF4B 4FB5A 3LY5A 4OGWA 2IYPA 2V0GA 1YR3A 2XQFA 3IMFA 3OHSX 4E33A 1D5CA 1U3DA 1D2NA 3NJ8A 2GZ2A 4IZIA 4Q7QA 1ZNQO 4GMGA 1BD3A 2VPWA 3TJZA 5CJ2A 3U39A 3VXKA 5IJZA 1C9DB 2JHGA 4LRQA 3T0IA 1NRXA 4KSYA 3VQTA 2J3IA 2B78A 1W49A 3KKEA 1S9HA 1A82A 1Z6AA 2CNDA 1Z0KA 2PUTA 5DJ5A 5EWJA 3T9DA 5HZMA 4HQNA 2PH7A 4X84A 2J3LA 4OEHA 3IMEA 2GSWA 2ZJ3A 4PSAA 3X43A 4UMEA 2OCAA 1U11A 2BEVA 4RZQA 5G0UA 4AJIA 1IE3A 4RK0A 2XGJA 3JAMA 5CUQA 2VNKA 4TUYB 3T3EA 4XTRA 5GPBA 3RF7A 4KREA 2DUNA 2ZZNA 3SIPA 2C88A 5KOYA 2VVTA 4P0TA 1BHQ1 2R85A 1YRWA 3AUAA 3KBBA 4OLJA 5HQ3B 5ER6A 1VSVA 2OUIA 4DV6B 1B1CA 2ISCA 3CUSA 4PYMA 1FFYA 3I01A 5D7NA 1MAWA 1SBZA 3ZK9A 2VNJA 2HIHA 3VHXA 4Y6QA 5KSWB 3CVVA 1Q1AA 1U9IA 2ECKA 2H5EA 2PRYA 2VK8A 2ZXEA 5B36A 4CKZA 5KPJA 4CQNA 4OHCA 2DHQA 3LQ2A 5HTKA 1GTSA 2QTMA 3QKUA 4J07A 1Z0FA 4C4PA 4M60A 4X20B 1K68A 3PQDA 2POCA 3IQIX 3QH4A 1LTKA 1VJ0A 3PJEA 1TCBA 4YJGA 4GR5A 1FW8A 1U5CA 1IUNA 2YNMC 3WSVA 2Z08A 3ENNA 3HG7A 3LP5A 4MKHA 4QTTB 5TB5A 2C2ZA 2H11A 4MRNA 4R31A 3HA7A 4UQOA 1UBFA 4NIMA 2P91A 1E9BA 2BCGY 2NU9B 1XN4A 5BWBA 5JZVA 3I1YA 1AN9A 1FMJA 4LS3A 4IJUA 2V03A 3CCFA 4F0JA 3VKFA 5AESA 3GJTA 5GOZA 4FW9A 3IT0A 5D5PA 4MQ4A 1PJ3A 5JDCA 3GH1A 3ZCTA 3T5TA 5JHGB 4ID3A 3VNRA 1HMPA 2BMJA 2QAGA 1B6RA 3KL4A 3A4TA 1YHYA 3RJ5A 1O8CA 2R4TA 3BWEA 5DOZA 1E9FA 2GAJA 3OPVA 4Z1MA 4EMUA 3N3BC 3LFUA 5FP0A 3QVKA 4MYTA 3MTJA 1R4MB 4A0QA 1YHNA 4AJ4A 3NAMA 2CXXA 2QX7A 4GO1A 421PA 3TEJA 4DCOA 4NYMR 4ZYZA 2GI4A 1E1YA 4M6WA 3V3KA 1TT5A 2VP5A 2QTVA 2V7EA 3K7EA 1BS1A 3K9GA 1U2GA 3NWJA 4TV8B 1QB8A 3K31A 5ECYA 1KXJA 3WTBA 3ZW8A 4BEBA 3AVVA 3PJRA 5JYBA 2O3QA 3GGGA 4OTZA 4OXNA 5DNYB 3G9UA 5EG5A 4X97A 3ZQKA 1VBFA