1CZRA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGNQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
total genus 57
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czrA00
3OX2A 4N65A 4J8PA 2B3DA 4Y9UA 2V9CA 4R81A 3U7IA 1RLJA 3EDOA 3LCMA 1AG9A 5LMCA 2RG1A 3NHUA 5ULLA 3NHLA 2QWXA 1RLIA 1TLLA 4ZVKA 1AKVA 3GFRA 2D5IA 1QR2A 3F2VA 2FCRA 4ICIA 3B6IA 4C14A 2FAXA 1C7EA 4FX2A 1AKRA 4NULA 3FVWA 5LLDA 3W79A 5LVAA 1I1OA 4M0CA 2M6SA 4LTDA 4H6PA 2Z9DA 1J9EA 2MTBA 4ZVLA 2R96A 3OJWA 4U7GA 3NHSA 5F12A 4ZVNA 1YKGA 3NHRA 1BU5A 1ZX1A 3L9XA 3QE2A 3QFCA 3RPEA 4S24A 2Q62A 4GR9A 4C76A 2Z9CA 1OBVA 2FLVA 2Q9UA 2W5UA 3NHYA 4HEQA 3TZBA 4XDGA 4QOGA 1AMOA 2QMZA 1AKQA 2BPOA 2KLBA 1KBOA 3NHKA 5EA2A 1SQSA 1DXQA 3OX1A 2FOXA 2FX2A 4PU0A 5B3KA 2OYSA 3TEMA 2XODA 1FLNA 3F6RA 3K20A 4F8YA 1BVYF 2QX9A 3NHJA 1T0IA 5FUQA 1FLAA 1AKTA 1SG0A 3N3BC 3F6SA 5LJIA 2QX8A 1FUEA 1H66A 2Z98A 3G5MA 4LTMA 4QOJA 2FZVA 3OVMA 4XDHA 3OWXA 5FA6A 1X77A 2KQUA 1YCHA 3SVLA 1KBQA 5LJLA 5EMNA 4FGLA 3GAMA 2Z9BA 4LTNA 2A5LA 5FX2A 1QBGA 4QOHA 5LBTA 1FLDA 4BMPB 2N1MA 1FLVA 4YAUA 1WSBA 1ZWLA 3GFQA 4N82A 4LAFA 4QODA 1CZKA 4LA4A 1CZUA 3NHPA 2GSWA 2X2PA 4NLLA 5NULA 4FGKA 2XOEA 1J8QA 3QFRA 3UXHA 3B6KA 3LT5A 1B1CA 3ESZA 5EAIA 4YAWA 1XYYA 2WC1A 4ZVMA 4YALA 1DXOA 2OHIA 4N9QA 1CZNA 3B6JA 2V5UA 5F4BA 2MT9A 1ZWKA 1OBOA 1XT6A 1AHNA 3KAPA 1OFVA 4DY4A 1H69A 3NHFA 3TE7A 4QOIA 4YAOA 4QOEA 5TGZA 1CZRA 4YQEA 4U7FA 3F90A 4BMOB 3ZHOA 4DILA 5BUCA 2ZKIA 2OHHA 1TIKA 1CZHA 1FTGA 1WSWA 2QX4A 1D4AA 3FNIA 2MWMA 3N39C 2FVXA 2HPVA 1QRDA 2MOKA 3R6WA 1YRHA 3NLLA 3NHWA 1RCFA 4H2DA 1J9GA 1D04A 3HA2A 4QOFA 4ESEA 4CF6A 3OWHA 1GG5A 3ESXA 3O73A 3KEGA 3OJXA 1AZLA 4Y7CA 1YCFA 2AMJA 5NLLA 4CETA 1DX9A 1XI2A 2QR2A 3JSXA 2HNBA 1AKUA 4C0WA 1XYVA 2M6RA 2BMVA 2FDXA 2BZSA 2OHJA 3W78A 3K1YA 4HS4A 3U7RA 5A4KA 4PTZA 3FW1A 4C0XA 3KAQA 1VMEA 3EYWA 4PTYA 1JA0A 3UXEA 4U7HA 2BF4A 1YOBA 3ESYA 4GI5A 3GFSA 3NFRA 3P0RA 1NNI1 4DIKA 1QHEA 1D03A 6NULA 5F51A 2HNAA 2FZ5A 1AKWA 3B6MA 1FX1A 3HLYA 3OX3A 1JA1A 2BN4A 3W77A 2R97A 3S2YA 4Y9RA 1T5BA 3FX2A 1RTTA 2ARKA 4GQIA 3W7AA 1YCGA 2F1OA 1CZOA 5JROA 2X2OA 2V5VA 3HR4A 4YAFA 5LBUA 1J9ZA 1F4PA 3FJOA 3O2NA 2QMYA 2QX6A 1E5DA 3D7NA 3ES9A 1C7FA 1FVXA 4OXXA 3L9WA 1YDGA 3KLBA 1V4BA 5B3LA 1CZLA 3N3AC 4FGJA 4D02A
chains in the Genus database with same CATH superfamily
4B47A 2REQA 3IBSA 4M86A 1PN3A 4CGZA 3TNLA 3B5IA 5JMTA 5D7NA 4RA9B 1EGMB 2TYSB 4I2VA 2I76A 4PFJA 4RZ2A 1OFUX 3EE6A 5BR7A 5ALKA 2HCRA 3GEIA 1G6OA 4KXWA 3UWMA 1SQGA 5A0VA 5ENDA 5AW5A 3I4CA 2ZT5A 4FUQA 4ILKA 2IPLA 4GKBA 1Y5LA 3U3MA 1F7VA 3QVLA 2F43B 4KPUA 5E0KB 2I99A 1BS2A 1OZAA 4R8SA 2V7BA 2ZJFA 4J90A 4FTWA 4KLNA 2OVBA 5TX7A 4KKXB 2WM9B 2RJOA 4RS3A 1JBQA 1XE3A 1GLVA 1H2BA 2YVKA 3LQKA 1NY6A 3ETNA 5H81A 5TF0A 1LKZA 3HJGA 5KQSA 4YHHB 4B75A 3ZDRA 2G80A 4NWIA 3ZX4A 2IOFK 2Q3DA 3KSDO 4JYAB 3UUFA 2H54A 2ZCVA 2DCUA 5DF1A 5ALFA 3WAKA 3COWA 3HP7A 3SSOA 2FAXA 4I55B 4ZT2A 3O4JA 3SHFA 3QUQA 5JBIA 5DHSA 2WHPB 4QGBA 4P31A 1GSIA 3SIRA 1K97A 1UPFA 2OGUA 4FS3A 3SC4A 4MH0R 3J7AC 5JRJA 3CVXA 4INAA 4UQLA 4TVSA 1IH8A 1MB4A 2QYTA 4EFDA 3PYLA 4MB2A 5LQMA 2JVJA 2GPTA 5E6SA 1MKYA 4OGGA 1X7ZA 2BONA 4AO8A 3O93A 4RHXA 4ZI7B 1N9GA 5BY2A 1SAYA 2JCYA 2HJRA 2VDNB 4QPJC 2C7OA 3GDHA 1TU4A 2WLSA 4K8OA 4ABTA 1N5IA 2F55A 4IKEA 1Y8QB 5K51A 3C6QA 4V38A 4M9UA 4EHIA 4N7MA 4CUKA 1P75A 1HFJA 4S1WA 4U7WA 3T41A 3DBRB 3LIIA 2IODA 4FMDB 4KEAA 4XJVA 4G4IA 4YT4A 3C70A 1RABA 2WF8A 2HQ1A 4J4HA 4JL8A 3HJNA 1MO5A 2VQSA 5IN4A 3PKZA 2PR2A 1J33A 3AWDA 2NXEA 3Q15C 4C87A 1GIAA 2ZSBA 3GK3A 3CHYA 1C0LA 3R5XA 4IO0A 2AJLI 2WAYA 1E2LA 2VK1A 5EYPA 1O9BA 3P4UA 4JLAA 3G9ZA 5DW0A 2ZB4A 3BHIA 1DGQA 4K9KA 1V1RA 3RVDA 3I2IA 4JB0A 2ZYDA 3UWSA 4D0SA 5A1JA 1FFDA 3OZRA 1YD7A 5AM3A 3RPEA 2AXEA 3ID6C 1U0OC 2FW7A 3RJMA 3EPLA 5EKTA 4GR9A 5BSHA 1TK3A 2Z8ZA 3B1WA 3RWBA 1TJNA 2CEKA 3Q6NA 3OJEA 1L5RA 1E3WA 3EPHA 2FLVA 3DWGA 2W5UA 4RD4A 4OQZA 4DCUA 4Y2SA 1Y5MA 1RR6A 2YJZA 4NFHA 4XDGA 1N2XA 1TT7A 2C0QA 1W4AA 2CE7A 3CQ9A 5GONF 1AMOA 1KJ9A 1N8NA 4K87A 1E79A 1ZEJA 1AQLA 2GN9A 1NYLA 1W36C 4O0MA 3GNTA 3QQPA 2GARA 4PZEA 3MIIA 1Z8DA 3L8GA 2TMYA 4H4DA 1ORVA 5IZ4A 4AMBA 4B31A 2BGTA 3GYGA 3OCXA 5EZSA 4R0VA 4BPRA 2ZIXA 1ZIXA 1D1TA 4BB6A 2JLWA 5IHPA 1R4ZA 2G9UA 4C9BA 5L3QB 4AFNA 1HOTA 2JJ2D 2PSSA 3IOEA 2XKKA 4M1ZA 3VNVA 1XTJA 1XN4A 221PA 3WMEA 1I6LA 1ICEA 4RJKA 2HF2A 1H1LA 1Z5GA 3UGJA 4HQRA 1RZ3A 1R6AA 4ZOAA 3AQ4A 1WZ2A 2D1TA 4J0JA 3I9LA 5T64A 1VCMA 1E96A 3UK2A 3F6RA 4FR2A 4DIMA 1QU2A 2CB0A 3K20A 2QY6A 1HYQA 2GKSA 2Z08A 3AL3A 2EERA 4F9EA 3HSKA 1BCSB 4JP3A 4OM7A 4K3UA 3ZGYA 4O29A 2IW1A 1XXHB 2Q6OA 3AVOA 2CXXA 2JHFA 1YNOA 1Z68A 3VH4A 1JPVA 4QDUA 2OG2A 1JSLA 2V98A 2FG6C 4ZGWA 4JZYA 1E89A 3LOQA 4MUMA 2VXCA 2H00A 4ZCSA 4BVLA 1VKOA 3MA0A 2CZCA 1DV2A 3MFQA 4W1SA 2JIPA 3P2YA 4II2A 1OH7A 1E4VA 4R7ZA 3UWKA 4R9SA 3W2TA 1NJ6A 4XUEA 1A4IA 3NRJA 3DE5X 5AQ1A 5FI5A 3IULA 4RHYA 4R2HA 3SYTA 3TR6A 2FP4B 3ACDA 1PYOA 2GZ1A 1M66A 3UPDA 3WOVA 3H1GA 4LXXA 4ZPXA 1V39A 4KH1A 4ENWA 3IR7A 3OEHA 4HYTA 1ZKMA 4DIOA 4BLTA 4QO8A 3GPBA 1M6HA 1Y5RA 1KA9H 2C2WA 5DT9A 1IY2A 2LGJA 5T57A 5CT5A 1Z5UA 4M1EA 1WLYA 4B2PA 1KDTA 3LY8A 2DMRA 4G5RA 1KDYA 4CMIA 4B6JA 1E0KA 3UMSA 3VTFA 3FI0A 4GM4A 3F5DA 4JUIA 4CM4B 1R0KA 3TOXA 3ZJ4A 1G63A 4RY9A 1B0PA 3BIFA 2R44A 1M2JA 2FPKA 4JU9A 5FL3A 3WJ1A 4LTNA 2GAAA 1SXJC 4AU1A 2GF9A 1R9MA 3EG9B 3HV2A 3LBNA 4MICA 3ZTYA 2WJYA 2BZGA 4BMPB 1T8YA 1FLVA 4B17A 1VXRA 2ZRCA 4LOJA 4OHXA 3DE4X 2W6NA 4YYEA 1ZN2A 2PXXA 2X3FA 4HMQA 1ZH4A 3DLIA 4ME6A 3WGUA 4RBNA 4BO1A 5HRAA 2L82A 3FNQA 2VTBB 2P4EA 2HLDD 1P1RA 1PNTA 1SRQA 3Q11A 3UKJA 2DFVA 1JALA 2D3TA 2VC2B 5BO5A 5FPKA 4JT8A 5JRZA 4UVDA 3ROGA 1M73E 4PXAA 2WJJA 5G0UA 4O4JF 3H2HA 2Z2KA 3JQAD 1A9XB 4ZEWA 2IITA 3QY0A 2RGGA 2XOEA 2G0NA 4RL6A 2WSLA 5DTMA 3B6KA 1U0FA 4WZBE 1YBVA 5CCDA 5GIPE 4Y1RB 2ZJ1A 3T4EA 1VIYA 2H57A 1GGFA 3CRW1 2VWPA 4PGFA 1NT4A 4Y2QA 5HMLA 5KSWB 1RWOA 4QICA 4ZV4A 2XZDA 3RV3A 4AECA 3GFBA 1Z7BA 1RLMA 1WO8A 4BY9E 2WJ4A 5C31A 1SG6A 1YQ9A 1T8UA 2P6PA 3GBVA 5TGTA 1L2TA 3AOEC 3TDKA 1YC5A 2AMLA 4KP7A 2DPHA 2WWYA 5HDQA 5I7FA 3OQNA 2VEDA 3I5AA 4F4FA 3QX9A 2Y27A 3ONNA 4O4HF 3MC1A 2A9OA 4HH0A 2GPNA 4EZIA 2D8MA 1NVDA 3HCDA 3ETDA 1R0RE 3JZIA 3OECA 2AD1A 2QZ9A 3BGWA 3A6HA 1DSSG 1NMSA 4Q1DA 2UXCB 1P9RA 3KEFA 1Z36A 4OOFA 4X1KA 3PYMA 3AF3A 3K96A 1F8YA 4QLAA 4LECA 2CD9A 4U4AA 2QDXA 3BXGA 2AOUA 1XT6A 1G64A 3GWGA 4UBNA 2DETA 2MR5A 3PNQA 4Z4FA 4EJFA 1V1MA 3KSAC 1EINA 2H7XA 2P40A 1H0HA 3FN4A 2QF7A 5ICFA 1T3LA 4TKUA 3RROA 1KEEA 3S8YA 5JYEA 4RADA 5E0OA 1ST3A 3PICA 4NBLA 4QYSA 3ZDYB 4FGZA 4N3GA 3P4XA 4XM0A 5K5EA 1T5OA 4PGGA 5MN4A 1J42A 2M32A 1N5DA 1K3UB 3I45A 3R3ZA 2R8RA 3CG0A 1P4SA 4PYJA 1DIHA 4MV4A 3KQUA 2BCEA 2HKIA 2OCKA 3MUFA 4CM5A 4K03A 1VJ1A 1H23A 3GMIA 3DHEA 3N8IA 3FSGA 1CVIA 4JU8A 1WDTA 5IAAA 5JMPA 5I8WA 5JANA 2NTYC 5EERA 7GPBA 1KTIA 1KRWA 4JJIA 5ALTA 2P8JA 2R68A 3IUEA 1GO2A 4S35A 5JCJA 3EF3A 1F6WA 3SYKA 1CZHA 1U0HC 1OGYA 3L49A 4KYVA 4O6VA 4CV3A 4F4UA 2QTCA 3PKIA 1IVNA 2F6RA 4RK4A 3VKGA 3KR0A 3KQPA 1SHTX 2ZRBA 2FJPA 3G2HA 3PFWO 1TFUA 1QIHA 2BJVA 1T36B 1AB5A 2BFOA 4KC0A 4CLHA 4MIYA 3R6WA 4NCHA 1BD3A 1UXKA 4X9XA 4BEJA 5EP2A 2OV2A 1DFGA 3QEMB 5JBNA 2FSPA 3VMMA 3WLIA 1KQFA 1FJXA 4O2AB 4YV1A 1L1EA 1R9JA 2OAGA 3C16C 5FNVF 3WTBA 3RU7A 2CFCA 1N6HA 3HA2A 3UCEA 2EKDA 4LQCA 5EHQA 4BO2A 3IPLA 3OWHA 4WADA 3AHHA 1QH1B 3GZJA 1G21E 1KEPA 2YWJA 3I92A 2JFWA 1QPBA 2R84A 3QNMA 4FYYA 4YRZA 1T2CA 1RBQA 1W93A 3HR8A 3RBXA 2QRVA 2ZBPA 3Q3HA 2PH1A 1RXCA 3AUKA 3O82A 4Y7CA 1ECFA 1VYVA 1YDFA 1Z08A 3PUJA 1YCFA 3F49S 2AMJA 1P1IA 4JOSA 4DCOA 3EHDA 1N6PA 3W6NA 2PXHA 2VAVA 3EQ9A 2OZLB 1QTIA 1VE5A 4H7HA 3GLHE 3I83A 4ENTA 6PFKA 3ADDA 5JY1A 1N25A 3BIOA 2QQEA 2IYOA 5IVKA 4H16A 3N2LA 2ZJ5A 4ZD6A 1FPMA 4TOIA 4JP1A 5CHEA 4ZIRA 4ZAZA 2EATA 3U7GA 5BN3A 1AQ6A 3NH6A 1CW2B 3EWIA 3SHWA 3TIVA 1ZH2A 4G0NA 4YLEA 4JI3B 5JJLA 1LNSA 3D64A 2Q0QA 4MKHA 4ZI5A 1ZCZA 2QD3A 1F5SA 1XTBA 3FBWA 3I2KA 4IX1A 3UA3A 2BGNA 4LK2A 3RIHA 2O5CA 2OHOA 1EP1B 1B0ZA 3CSSA 2N46A 3DDUA 2CJPA 4J94A 3ZWYA 3TG2A 3F7TA 1ZOPA 1BFKA 4RKQA 4TTJA 4D80A 5CYOA 1JXAA 1E2EA 3QVOA 2FFQA 2V6IA 1EG2A 1P7VA 2DR0A 1R0LA 5C3MA 1R3DA 1JHVA 1NLFA 1HE8B 2IFTA 2XI4A 1NXXA 1KP2A 2UZAA 3UNXA 4MW7A 1WY7A 2OECA 3QX3A 3IC5A 3K30A 4DV6B 2AJBA 3KQHA 1AS0A 2VAMA 2R6AA 2VPYA 4G0PA 4TLCA 2QAGA 2LE0A 5HW0A 3JRXA 2OD2A 5HTKA 4FYKA 1BE8A 3IJEB 3KZ1E 3AR5A 2XE8A 2RGNC 1KYWA 3DFIA 4DM4A 3IP5A 3C3YA 1U7OA 4HF7A 4I66A 4V3BA 3ZWWA 4EVQA 2HR1A 2OL4A 2BBWA 1G8JA 1THTA 4PPFA 2OPHA 3ZBTA 2PUBA 4YP5A 1V16A 4G4SO 1B6TA 3KEMA 3KWMA 4FYWA 1UAAA 2CXRA 3NIBA 4IOLA 3Q0EA 3ICCA 4QBIA 4YT2A 3PQ4A 1R5BA 2ZRNA 4XSVA 5AW2A 1HEUA 3Q7RA 1OTXA 3X1XA 1ECCA 4G8DA 1NMXA 4ZJUA 4UFPA 5IZCC 5A9SB 1YJ8A 4BE4A 4KR3A 1NI4B 4YJFB 1Y1TA 2X15A 1CB7A 3KPUA 3HDJA 1GD1O 2QK4A 2RGAA 1PYGA 5HKAA 4XLTA 1BC5A 3BGDA 2ZI7A 1JNYA 3D6TB 2OP1A 2Q9CA 3CRVA 3PXCX 4H08A 4XJSA 2Q21A 1RQGA 3GYBA 1ID1A 1VSUA 3DOCA 1CEYA 4G5QA 4MW5A 2XQIA 1KP9A 3GU3A 1U9JA 4RSHA 1I80A 1UDXA 2JBAB 1PLLA 4FI3F 4N0PA 4N18A 4DNPA 2PZAA 2GYYA 3ICWA 2FUKA 3D81A 5K4AA 5BN5A 3H5WA 4RF4A 2BY4A 3O7WA 5DO9A 4ZAFA 2XRFA 1SU7A 2G5CA 5ANRB 5B58T 4HOYA 1X7YA 4CCAA 1LZKA 1JHXA 4OB7A 1GAQA 1JI3A 1PJSA 3NHBA 2Q07A 2VJDA 1SPBS 3OA0A 4NMWA 3BHMA 5BOVA 4WKGA 1W44A 2BEVA 5HBRA 1T2UA 1OKKA 3TLJA 1Z2CA 3KE9A 3VZRA 1JXOA 3JQFA 2ISQA 4JVOA 4J7UA 4Z99A 5BSTA 2P5SA 3K1AB 4FFMA 3UT5A 1FRVA 2OBNA 3TNJA 3UICA 3LVFO 4TXMA 3U4MA 3C3AA 1YACA 1JDPA 1VRVA 2F3TA 2R25B 2P9QA 3F96A 4R54A 2VTVA 4ZHSA 1KPIA 3QXGA 2W2LA 5KI6A 1T1SA 4CUZA 3E3AA 4MYDA 3L7AA 2XSZA 4NABA 1T13A 3I64A 2HU2A 2VHQA 2PAFA 2Z83A 3NTXA 1JXMA 2V7XA 4G89A 5HIIA 3BE4A 2HRRA 3TNDA 4K0KB 2IP2A 3ZBUA 1CEXA 3Q9SA 3ZNPA 5DWVA 2HADA 2IC5A 2V59A 3QK7A 1TPYA 4JJ6A 5AVKA 5B3LA 4QRHA 4OEHA 4RGYA 4C4XA 2GPSA 1OFHA 4WZBA 2UZ4A 3PR1A 1Z45A 1PV1A 3DF9A 1ESEA 3R74A 3TPZA 4TMZA 3LLSA 4L5YA 5CP8A 3L93A 3SX2A 1H1DA 4MS1A 3CXUA 4ZYWA 1Z6QA 3UT6A 4S1OA 3DEFA 1CDDA 2B69A 2ADMA 5K2OA 2FWNA 3M6FA 2QI9C 5AKLA 4ZRDA 2XCQA 1UWLA 4GVXA 4XSGA 4B2IA 3SBXA 1VPVA 2RHOA 1UMDA 1G2PA 5FNZA 4L2IA 5A1TA 3AF1A 4DLYA 4COKA 3MS4A 3V1LA 1NVUQ 2AOTA 3PRYA 5B57C 3DVQX 4R5HA 4DM7A 1O97C 3E9DA 4ZOLA 4URXR 3DYIA 1JBKA 2OCXA 2IYLD 2A7XA 2XCSB 5H3CA 3RC8A 1WBDA 1BH6A 1GZ5A 5IT5A 4CEJA 5CVUA 1RVV1 3VJMA 1ONBA 1EUCB 2QAIA 1KMQA 3DEHA 4KLZA 1O5IA 3ZV4A 2PG3A 4DR7B 3VC1A 4NSNA 2WJ6A 2F1IA 1BDHA 5K3FA 4ZTZB 1G66A 1QKKA 2CHGA 2YCBA 4B48A 1QR2A 1MO6A 2DFNA 2FG7C 1U9CA 2H6EA 3QY9A 3K5HA 4J07A 4B8WA 5C1DA 3G17A 2GBGA 2O1SA 3OU7A 4RHTA 3UOAB 4IQ8A 4UBJA 1ZMTA 3GPCA 2NU9A 1Q3HA 5FWDA 1AHPA 1EZ4A 3KYJB 4D56A 3FSGD 3M3PA 5E4FA 1PHPA 2BCJQ 1YZTA 4B4WA 1Q7RA 2IYNA 1NBME 1BEZA 5JCJD 1NX6A 5HUJA 2QG9A 5ECYA 4NBWA 3MLAA 5M29A 3GNLA 1ONOA 5A5DA 4KNYA 3CWZA 1XEFA 3JALA 2V8OA 4I5EA 4NX2A 4UU1A 5DMHA 3Q10A 4G1FA 4WOJA 2XWPA 3WLSA 4M60A 4ECEA 1SCJA 2QTGA 4XWOA 3D5EA 5CDYA 3SHTA 1EGHA 3AU8A 2M1ZA 2HXSA 3PD7A 1U2DA 5HS4A 4WXEA 1P61B 4HLCA 4XA8A 5AVQA 1EDEA 1ZIPA 4EI9A 4N6NA 4E21A 3D8RA 1J8YF 3GA7A 2RI0A 3FGOA 1FSPA 3QU4A 4RO0A 2KB0A 3EODA 4PZ0A 5J63A 4NKRA 3PIDA 1NXTA 1XLUA 2PWYA 3F9CA 4JBLA 4EKDA 3TJZA 1DOZA 1EFTA 1XVAA 2JFOA 4A27A 2X58A 3FXAA 1GZSA 1P5RA 4BV3A 1RRCA 4X6LA 1PEYA 3GP8A 3HB9A 5JC8A 1D0IA 1TDJA 2QTRA 1KYYA 3IEVA 1M7BA 3GLFB 3HFSA 2PJDA 4IIBA 1R5NA 1G21A 4DG8A 4S24A 5G3YA 4CDGA 3B3QA 4L85A 2ZS9A 4INJA 3IT3A 5KQRA 1MRZA 4FWTA 3OTOB 4C76A 2I03A 4G9EA 4JSYA 2Z9CA 5H83A 3K2IA 5DYYA 3AKYA 1WBBA 2YC4C 3WYFA 1REQA 2PA0A 1NVAA 3GLHA 1W5FA 2X9NA 4A92A 4OHBA 1COWD 2GAOA 1HTWA 1D9ZA 3NP9A 1QZUA 2DJ5A 1ADGA 2AKAB 4J16C 2XDQB 5H4HA 5K3CA 4P35A 3H9QA 5GZ1A 3EVFA 4Q4AA 3IESA 2WNHA 5JO9A 2CLEB 3SJUA 2Q4DA 2ZJAA 4HVLA 2BUBA 2P3QA 2NP6A 4BLWA 3GJ7A 4DG5A 2EGHA 3GJSA 3L02A 4W7IA 4OP3A 3LX6A 4IJQA 4UXIA 2NX2A 2IS4A 3R09A 1SC3A 3UIEA 2VUUA 1E7QA 5SY4A 3SI7A 1F8GA 4WUVA 2FEXA 2J09A 4FINA 1FFGA 2YNMA 4JJFA 2R6ZA 1JBEA 3OPQA 2NZYA 3DJFA 4HP8A 2JIRA 1KE1A 5BWLA 1PJ8A 2QRNA 1S3GA 1ZU5A 4MV1A 3KWLA 4OYHA 2VDJA 5C7OO 5K0BA 1BXKA 4PX2A 1Z5VA 1MJGM 4ZAYA 2DOKA 1TEVA 4RFSB 5E1BA 1VJ0A 1ELOA 2TRSB 2WYWA 3WGKA 4TKZA 3WSTA 5L53A 4HG2A 2PKCA 5J2TA 1B8UA 1E69A 1V8ZA 3LXRA 4D4LA 4MYRA 4TLMB 2PEYA 2FRVA 3RC7A 4CTNA 3BD8A 1SZJG 1X7XB 5L3SB 3HBNA 1IM5A 1RYYA 3CRRA 3DZFA 3WK8A 4CM1A 1E5LA 3K9QO 2QN8A 5M34A 1RYHA 4TRRA 1XA4A 3EFEA 2IYAA 3GQVA 4ZHQB 1P0IA 3X1WA 3QIAA 4BGUA 4MRRA 5FYDA 5B4VA 2AOXA 1YB1A 4YXWA 3VI4B 1MC4A 2AA3A 4MYHA 3DUWA 1A5ZA 3H84A 2C4WA 4MHSA 4R2WA 4BMZA 3IERA 4R69A 3RKUA 4BO4A 1FUKA 2KQUA 2W11A 4KQMA 4MP3A 2Q6KA 3VJKA 1KBQA 3VPBA 3ZU2A 2KLHA 2DG2A 2QROA 4Z1OA 4HAUA 4PCVA 4ALJA 2I9KA 1U0NA 2OBMA 4I4CA 3S99A 2RMKA 4L3VA 4TRMA 3R23A 1C1YA 1H85A 1GTSA 5IG2A 3DB1A 1DRWA 1M2GA 3HDVA 2DHCA 5LBTA 5TC4A 1G0NA 3LGAA 2GPAA 1O96B 3G2IA 2DWUA 1GYPA 1RZUA 2FSGA 4KSBA 5D3ZA 3AY0A 1CB0A 1E3MA 1AK2A 1ZWLA 3LK7A 1NHWA 3O8OA 1PF7E 1R2QA 4OBXA 1FS4A 1EP3B 1P73A 1Q1AA 2IYSA 2PA3A 3E9NA 2WT8A 3FE2A 2DWCA 5IXYA 2VRCA 4LA4A 1CZUA 2X23A 4XTCS 4BLPA 1IHDA 2PFSA 3KBOA 3IUJA 4P34A 2G6BA 2YXNA 3DSRA 2FR8C 3F47A 3OCWA 4JB3A 2QD5A 4IHAA 4BX9A 4CQMA 1ACJA 1OKKD 2C7QA 1UBCA 1WOYA 3C5EA 3RO7A 4BX8A 3UPTA 2GOYA 4PRZA 3LQYA 3OZEA 4Q02A 2EP8A 1L7BA 3ESZA 3L0OA 2D1FA 3QTLA 2HHJA 1H9CA 1KEVA 1T4DA 1I36A 4LNHA 5EXXA 2OESA 4LV8B 3TZCA 5K8TA 2YN4A 4PPGA 1SUIA 1OJLA 4GGOA 4OUDA 3F1LA 1N6IA 1H2AS 3SE0A 1PFYA 1ZVJA 4RKEA 1QHNA 4E32A 4BFVA 1LDBA 3W04A 2OHIA 2BOVA 3BRCA 3GNQA 3IAAA 2R1VA 1EP2B 2QPOA 3P27A 4OJNA 3LUFA 2UU9B 4D97A 2V4MA 3FCYA 4DT1B 3MIZA 5FPPA 3CUUA 1KY2A 4RKFA 4G0UA 4NFSA 1NW9B 3Q3IA 1I3LA 1FUIA 3M34A 5J58A 4TM7A 5C4GB 2FPSA 3ZOKA 1C41A 2ZUUA 7REQB 1DNPA 1KYVA 4WK4B 2J31A 3OZXA 4EVSA 5KNDA 3CVJA 4X7PA 1F0PA 2B98A 3T4XA 1AO0A 4M22A 2IUSA 4X8HA 5GV8A 1O9HA 1H2FA 1EVLA 3LDAA 3SE7A 3DEKA 1JW9B 4E2ZA 1YV9A 3JS5A 4CM3A 4QDOA 2W98A 4L9SA 5TGZA 1XU4A 3PLNA 4G0WA 3IOCA 4TQUS 5DDIP 2FFRA 2J32A 3TO5A 3X43A 1RW4A 3MYRA 4KGVA 4PFSA 4U7FA 3X1ZA 3B2EA 1FB5A 3SXPA 2FQWA 3TLGA 5TS3A 1CDOA 2QRJA 2PNJA 3STXA 2ZSJA 4J6EA 4EUNA 2REXB 3JQ8A 2HMUA 1U65A 4QU5A 4YFYA 1TM7E 4MZDA 1VE1A 2D7JA 4DFDA 4MV8A 3QKRB 3SM3A 2I33A 2WYIA 1OJ7A 3QE0A 4MS3A 4MW2A 2IXBA 3EXFA 6CHYA 2HB6A 2RARA 3QMVA 1FBTA 4OHYA 4H3HB 5JQWA 1E92A 4K3VA 4EEZA 1MOSA 2QR5A 4PG4A 4MUBA 2RK3A 4BUJA 1HG0A 4J03A 3NBXX 4DWWA 1UJ6A 4P3PA 1K7EB 4OHUA 4TX1A 5E3IA 2I1VB 4O4IA 1G7RA 3TZLA 1FS6A 2NUPB 1N34B 3FDZA 4TT3A 5HPYB 1ZSVA 1SQ6A 1EFLA 1TYCA 2GEFA 4TVOA 2FX3A 1JKJB 1PP4A 3A6GA 3D6FA 3Q0IA 4DLKA 1R0ZA 1NBMA 2AWOA 1L6RA 3WJ7A 4FT4A 4NY1A 1ENYA 1UDCA 3MJTA 3N5KA 5ARBA 1K9SA 3E7XA 1F8FA 4ESEA 4WCDA 2P7HA 8AT1A 2ZM6B 4Q7MB 4B3CA 5JQGA 2J5QA 4BUCA 1TM3E 3QWHA 4R1QA 5B53A 9MHTA 3TFOA 3PPVA 1HE5A 5EIEA 4ZJZA 1L4LA 1YZUA 2LDXA 4Y9SA 1L5LA 1EFVA 3PUVA 4ZZ3A 2PJZA 2VUHB 4TLBA 3FYDA 1GU1A 3C7TA 2D5LA 2J7PD 3P0JA 3UGTA 1XRNA 1MX3A 5EY5B 2VT3A 2YV3A 3GA0A 2DPMA 4DGSA 1SCIA 1X7DA 4YMTA 1MV5A 1TVMA 4ZEOA 3HG7A 4EATA 5BMVF 1OZGA 2O2SA 3FOFC 2XTJA 1RJGA 1OVMA 1SUEA 5I7RA 4CG1A 3D7LA 2FUCA 1ZJZA 5G53C 3GJTA 1Z8FA 4DB4A 3IFSA 1OIXA 3KQOA 4G67A 1B23P 5KOJA 4KN6A 1I3OA 4K9SA 3EC2A 4G8JA 4IHJB 5FPQA 1HRDA 1UBUS 1LD3A 3P71T 2IPOA 2XXBA 3ELDA 3R5FA 4U0JA 4W9NC 3PKJA 4D8TA 1EDDA 4R2MA 3OZ7A 2I9PA 1VB3A 2GVNA 3IP1A 2FH5B 3VNSA 5I01A 1M1NA 1K5DA 3O21A 2P0EA 1K7XB 1E2NA 1D4OA 1KH1A 1THMA 2WM3A 3ZD9A 2W6CX 4JI2B 1ZMBA 2FZGA 1TJ3A 2FEKA 1A04A 1XOIA 3KLOA 2CUZA 1IJEA 4REOA 4YMWA 2JZNA 2C7RA 3VTAA 5BVGA 5FI0B 5HF6A 4Z4EA 1E1CB 4J4BA 3FW1A 3KOOA 1DAIA 3V97A 1QIKA 2ZS7A 3PEEA 1V71A 4PG7A 5JS7A 1FOEB 4HLDA 3B3JA 2FQXA 1M5TA 1VMEA 4EFNA 4HNQA 3ROEA 1HMYA 2GXUA 3L3BA 3RT9A 5K0EA 3KYDA 5BXQC 2R4UA 1RI3A 4ZV9A 4BEVA 4DV3B 3E7DA 1I14A 1I32A 4BV8A 4GU5A 5DXJA 1L1FA 4KDRA 2YNMD 2UZ1B 2I65A 3UB4A 1E18A 1K98A 3EEIA 3FROA 3TL3A 3L84A 4IDEA 2AZDA 4U39A 3VKHA 1OLXB 1IPFA 1TZJA 3WLAA 1A9YA 4I2NA 4EKNB 1JHRA 5K3DA 3JD3A 5CFOA 4L08A 5DM4A 3BWYA 4OHCA 1IN8A 1A8PA 3LLVA 2RONA 3NFRA 3KPWA 2BFDB 2FTKE 5DBOA 5T4FA 3RNLA 4BRZA 5E1OA 1NNI1 4PQFA 1KQNA 1M1UA 3NB0A 2BI4A 6NULA 4YJHB 2VL7A 2ODPA 5KKAA 4DC1A 1J97A 1H2EA 2FGKA 2Y6VA 4G8BA 4QARA 3S70A 3ZWMA 1YDMA 2I3DA 4IG9A 4W5HA 5IYZB 4MGKR 4I19A 3AWIA 4BAUA 3STUA 4CQNA 4ER6A 4BX2A 2CCJA 1IBLB 1SOWA 4XQCA 4M9SA 2WU3A 2AI2A 4ALKA 1ZITA 3SXUA 4GQBA 5C9ZA 3WA7A 3R9WA 1LSJA 4R83A 4CIBA 2VJKA 2B1IA 3RIYA 2EBHX 2QD4A 1KBZA 5TEVA 5SZHB 1XQXA 2OFOA 1US8B 4NBNA 3KT8A 4GOKA 1EDOA 4AMVA 1MA3A 4F7WA 5EWJA 4TTIA 1Y1RA 2PUVA 4P7GA 2C2OA 2C95A 4JGBA 2O2HA 3OETA 1K7CA 2WZBA 1C3JA 4LJ5A 1E2IA 2FWPA 3UAVA 2MSCB 1OVGA 4B34A 1T5TA 4WTOA 4AN1A 2P6RA 1E7SA 4A1OA 3REQB 4ND8A 5I7UA 1B74A 1Y7HA 3EGDB 4CKYA 4J0CA 4O3MA 2H7VA 3THYA 2JGEA 4K05A 1RMQA 4MQ6A 5TQ0A 3FG9A 2H8KA 3A27A 3LG2A 3VYVA 4F8EA 1J9ZA 4YJGB 2WT9A 5BT9A 6AT1A 3AETA 3ZYZA 3PFBA 1WNTA 4H9GA 2AF3C 5CXQA 4A2PA 2HA4A 1URPA 3DL0A 4CQMD 1IEWA 1J25A 3PCTA 2DF8A 4Q9AA 3SP1A 3KT0A 5KOHA 2OO3A 5AHXA 4YS6A 5A02A 1K1EA 3KB2A 2PLFA 4G9GA 3D3NA 5BSWA 5J2UA 4E5YA 3PNSA 2ZETA 4QXRA 1SQ0A 3R6LA 4DSTA 1QTRA 5KAPA 4YMIA 4Y2YA 3WWEA 4TMYA 4V2UA 5EEHA 2MINA 2HA6A 3EUFA 5DN6A 3ZUPA 3A4LA 5KCMA 4FHEA 3T99A 3EC1A 2OCDA 4QFBA 4WFQA 1GPWB 2B1GA 3PUHA 1JYSA 1WW2A 1ISSA 3A4NA 1GNQA 1PU2A 5DHTA 4HJXA 5I7EA 3FKSD 5E4JA 3T3NA 1EHCA 4BGVA 1H3FA 4PFQA 2QLTA 1CNFA 2RGRA 3U5ZB 3NTRA 2AN5A 4KAXA 1BE0A 2QN6A 5IULC 4BC1A 4QUKA 3CJTA 4IWNA 4MWSA 4KDFA 1Z6ZA 4ENQA 3RUEA 3TRFA 4P92A 4D41A 1HE1C 2AS0A 4YQFA 3ZDBA 3SGLA 5LYJA 1ULSA 3U7IA 5ABPA 1E99A 1I7PA 1G60A 3HY3A 5A6SB 3CUWA 3NH9A 3W8DA 5LQNA 2I7XA 2ZT7A 4JFRA 5AUPB 2ZTHA 3I32A 5ALMA 3RWMB 4EGQA 1P31A 1ECJA 2P8SA 3O2QB 4QU8A 2VWGA 1FP1D 1QAOA 2I1QA 1KQOA 4N7BA 2H65A 2OD9A 3OZVA 3ODGA 1C1XB 2B1RA 1JQBA 2HXYA 2J45A 3VU9A 4O1IA 1K63A 1OI7A 3SCZA 1QYRA 1NPTO 5CVEA 4ZVKA 3PUZA 2CV0A 4G97A 3RR2A 3H19A 2KM1A 2I8CA 2I4LA 4M8SA 3A11A 3RKSA 2C29D 2VN8A 2XV1A 4EI7A 5JNVA 3F9RA 5ETJA 1JT2A 1AX9A 4N5DA 3VR4D 4MWZA 4C14A 1WCXA 5T3YA 1F6DA 5G40A 1F6BA 1SOVA 1JWAB 1M8JA 1YHZA 5IW8A 2C5FA 2ADFA 1EVEA 1V2HE 3A9RA 2N47A 4GP7A 4YJFA 3L7BA 5DCYA 1NVVR 4JCOA 1Z7GA 1Q0ZA 1V4NA 3JYPA 3QU2A 1YF3A 5KNDH 4XGQA 4DQUA 4H3VA 1ILEA 1IMJA 3DWIA 5IX8A 5K8CA 4CV1A 1GEGA 4BNFA 3H2JA 1D6SA 2JLRA 4UMVA 1FDUA 4IVPA 4LTDA 3IEUA 2PH3A 8ATCA 2CVFA 3AFNA 2VP3A 1F7UA 3K2BA 4TT3D 1NATA 4DUYB 5FFMA 4ZVLA 1CQJA 3ZV5A 4HDOB 4UUAA 2C0PA 4PG8A 1H22A 2X0DA 2HHAA 1AZWA 1J5PA 3GH3A 3WKBA 2DBVO 2CHUA 4AY5A 1CF4A 4HWPA 2QB5A 1IUKA 2CLLB 2H07A 4QREA 3H2KA 1TF2A 3PGA1 3CUYA 1VMAA 3DKKA 5EJEA 4Q82A 2J3LA 3VSEA 4ZYTA 4LYEA 1Q7TA 3OPYA 4G24A 2AX4A 4BLUA 4FNMA 3USZA 1E3TA 1C29B 2HSDA 2MYTA 3I2GA 4QELA 3QU7A 3GAFA 3OLQA 1J00A 2QUAA 2QVYX 5CR9A 5DIFA 2P3LA 4D25A 3I6MA 1GNTA 2GMWA 2OO5C 1ESCA 4DA8A 1DEHA 4PSDA 5JTTA 3S81A 2H1VA 2B92A 1TYZA 2A9PA 4UVGA 1Q22A 1OFUA 1QQTA 4YAKA 3TSOA 1T9GR 1AY0A 2BRUC 4TTVA 1CUVA 5KYUA 1L5HB 1YBFA 1S8NA 4TT8A 2Z04A 4TXHA 5J4VA 4BU0A 2JVIA 5C8VA 1QANA 5LKAA 1KZHA 2O57A 5HX7A 4BQNA 4MVJD 1S2OA 2O3TA 4J0FA 1NIJA 3HBJA 2YQ5A 3HI6A 4BKQA 3CNNA 2ZK7A 3GV0A 3NIGB 1MFZA 1DWOA 3IR5A 3ZDEA 1CJMA 5DWDA 4C4AA 1KDVA 5CHYA 1NMQA 2ZATA 5F23A 5I7OA 2EJBA 2HF8A 3CMMA 1SZDA 3CWCA 4KX5A 2K2WA 2HL6A 3FYUC 4LWOA 4UNNA 3QLJA 2I4OA 3KLPX 2JA1A 1P29A 3AM4A 3C2QA 2XODA 4Y6GB 2JB9A 4NU0A 3U3JA 1XDSA 2G7MC 2VNSA 3BCSA 3FAZA 3GGDA 4EWLA 2H85A 1SG9A 2WWIA 3H9BA 3LL4A 5DTRA 2YWEA 2B7BA 1C81A 3A6EA 1EWTA 2YZNA 2EX4A 1JEQB 3DTTA 3QVWA 2L18A 4JEUA 3OP4A 2ERCA 3HVKA 2R48A 1XA0A 4RMHA 3N0WA 4BRWA 4MWGA 2N0SA 3CLHA 2Y0EA 1ZAYA 5F64A 3OHPA 2QL5A 2F48A 3LC2O 5C1PA 3E27A 3RVRA 1NJ5A 2G5PA 1QVRA 3GT4A 3NM5A 3TXYA 1IU9A 3A6DA 1EX6A 1MNQA 1I1QB 1QE0A 1HT3A 3RJTA 1KC3A 1HNWB 2JJMA 5AKEA 4OHVA 1D6MA 2QG4A 3NJ4A 2RHGB 3DULA 2Z98A 2Z2XA 1MJHA 3KSMA 2VDUE 2ZULA 3E0QA 4G5HA 4JLOA 4ARSA 1UBKS 5GJVC 4B6EA 5GP1A 1JTEA 2RKBA 2WIAA 2YFKA 3H5VA 1XNGA 3IIMA 2HA0A 2G07A 4MCHA 4MYTA 3KZNA 4P54A 4TRJA 1MF7A 1UIMA 4OJTA 5FA6A 4CLEA 4YRBA 3AF0A 3GEPA 3T7EA 4BKMA 1FXUA 2ZSKA 1KPHA 5FWYA 1C9NA 4GM1A 3CH7A 1ZEMA 1JPNA 3DVAB 2BHLA 1JB1A 4OFXA 1J8DA 2R6JA 2WQZA 2R00C 3JYNA 4UMFA 3PEUA 3GN2A 1KH2A 3HZHA 1QHFA 1OTHA 3PQ7A 1Z0ZA 3GO4A 4DBVO 5IS2A 3EPJA 1N0HA 2FF5A 1HZJA 2V7GA 2F3SA 5TNXA 4GPIB 4NCAA 3R3VA 3ZZUA 2IELA 3H4VA 2Q3HA 3TIFA 4NQZA 2IBSA 4HFJA 5MGBA 2NO1A 1Y81A 5LXTF 1ARZA 2Y66A 1RWNA 3HY6A 3UUWA 3HKDA 2EL9A 3R0IA 2WZDA 1VL2A 4KQJA 4JVNA 4E46A 3T7RA 2QQ0A 5FB3A 5JZ9A 1KJYA 1PL6A 1KI2A 3AIMA 4NC9A 2BHTA 3ZHBA 1YJXA 2P4QA 1FQWA 1WDKA 3M0EA 4PVCA 3VYTB 5HQ3A 2YR0A 2AR9A 4CFZA 2I8AA 2C92A 3O0TA 1J2TA 5FRDA 3EZFA 1YO6A 3PJFA 2KBFA 4KJZA 3M9LA 1CULC 1GZ3A 4QQFA 5EJ9A 1A5SB 2B30A 2EJVA 2BMWA 1BJKA 1DQPA 2VCEA 3H2IA 5ALDA 2RAVA 1ZJYA 2O8CB 4CNQA 3IT2A 4XIIA 5EZQA 3AP2A 3CO5A 1HT1E 3WL4A 2H0RA 4KX3A 4R3UC 2YWGA 2G09A 2CJYA 3CZ9A 3Q4GA 2GQ0A 3OJLA 1T24A 3OE5A 2C7BA 3M9XA 4J0EA 5HG0A 3SQDA 3ZE6A 4CKBA 4D5EA 4EYKA 3KTAA 1IQUA 1QGUA 4MLZA 4QT0A 4MI1A 4AUKA 1DXYA 1VIVA 2JGFA 4QWWA 3MJEA 3A1VA 2B4AA 1BXGA 2MT9A 3LCCA 2SBTA 1S2NA 5BNFA 1QC5A 3G5AA 5L7TA 1GG9A 3GZNA 2GCGA 2VZ0A 3HMQA 3LCUA 5E9QA 4B3HA 3ER9A 1P62B 2RGWA 1DFIA 1AHNA 1BFUA 3T5GA 1BAPA 1JFFA 1YHYA 1Z39A 5C1BA 3ADBA 1R5JA 2X8LA 3HPQA 5GVSA 1R64A 4F11A 4WESA 3SJ7A 1W88B 5ECWA 3LX5A 4AF6A 4PIPA 3VQTA 3L43A 4ODIA 4QOIA 1FY2A 2E4AA 4E88A 3DHYA 3G1TA 1Z34A 2QVLA 2ZZMA 1CZRA 3HRIA 3V7UA 2DB3A 2V7WA 3BFXA 2XOXA 4DDTA 1SULA 1C1DA 2F3QA 4HYYA 1FYEA 4KVZA 2RHTA 3AR6A 2ONCA 3GUCA 5C8YA 2BHSA 4OQEA 3IXLA 4FPXA 1L5MA 4UHHA 1LBHA 1X1AA 3OMWA 4HX9A 5DLDA 3F4KA 3G2JA 4GPZA 1WL8A 1U0SY 3ZY4A 1QBKC 4N47A 1N36B 2E9SA 5BUCA 3P2EA 1FNSA 1PV2A 2F8LA 3D2AA 3R0JA 1M54A 1MPXA 5F21A 4E5SA 1Q57A 1SHUX 2X0RA 3CS3A 4X7MA 5J2TF 3WYGA 1W59A 1I0LA 2HRDA 2ZXFA 4GICA 4KXFB 5HJEA 1KZ7B 1JFSA 2IBTA 2R7KA 1G8KA 4WZAB 3ZWNA 1CJBA 2VKQA 5LQCA 2ATCA 2V03A 3SFTA 3FOEC 2G0TA 1X7WB 2BMDA 3IV9A 3IVMA 5KJEA 4TWZA 1I8TA 4Z0PA 4OLAA 2AXNA 3IJRA 3DV9A 4L5JA 3WB1A 1P1CA 1Y6ZA 1XTRA 3T0GA 4EY7A 3ISVA 4BWYA 1ZZEA 1P77A 3PNYA 3A3PA 4BWFB 1QB8A 2NOAA 5DHUA 1ZJ6A 4ZU1X 3TH5A 1A69A 5ALHA 1RC8A 2F1KA 5A71A 1ZOSA 1KYIA 5DYGA 3ELYA 2DT8A 2E2WA 5FO1A 2QLNA 1UZAA 2WV7A 5F7JA 5TQ2A 2J5RA 2NVBA 2QORA 1FW8A 2IYWA 2A1TS 3R3WA 3G6KA 1XHFA 3BFVA 3OCUA 2MR6A 3PF9A 4XGRA 2PE5A 3N2ZB 4RD2A 2HV9A 3GVXA 3PL5A 1WJGA 2FEMA 3FLEA 3DKIA 3LGSA 3LP5A 4U6SA 3LPLA 4NYJR 4JT4A 2VF5X 5EPOA 1BNCA 1I7NA 2FEPA 1LUAA 3GMDA 4H35A 1CNEA 4W5WA 4ZTUB 2PX0A 4ZICA 1MO3A 2YWDA 1ADJA 4QXQA 2WKWA 3AGPA 3OQVA 1OI4A 3GF4A 4J7CA 4ZO8A 3UMVA 4C4RA 1XMOB 4QUGA 4IVRA 2GN1A 3L7MA 1B7GO 4DNOA 1X3SA 3L04A 4HDKA 3RSSA 4Q03A 4QHSA 5JXWA 4NBUA 4CV2A 1V9SA 1O8BA 5E9WA 5AM4A 1HK7A 4MQUA 2IZ1A 3KQTA 3UC9A 3P9RA 5HR5A 1C9DB 4UMEA 3NWBA 4XIFA 4R7TA 4C0WA 4DR5B 1QSGA 3EMVA 3ZKWB 2EDCA 1CJTC 2JIOA 4GMGA 4OJYA 1NC1A 1VCNA 1YRYE 3DCNA 2BF7A 2BZSA 2C2XA 3RHTA 2JLVA 4OAOA 1UXHA 1FFWA 3EMKA 1HYHA 3M5DA 3KQYA 3NBUA 3AFOA 3Q88A 4JNCA 1UPBA 2G77B 2A9RA 1QTQA 2WJVA 2B20A 2QXYA 3D8HA 3EGVA 1VXOA 2WAMA 1GDTA 1V26A 3ICVA 3EWAA 4G25A 4KVFA 4ND3A 1VGVA 4QHTA 4D74A 4NR0A 4YMVA 4QUBA 3RYHA 4GR4A 1A8QA 4L51A 4C4TA 2W2QA 3IAXA 3DE7X 2YHUA 5TQJA 5I7HA 2GXQA 3R5HA 3OKCA 4M0DA 3D8NA 2O3SA 2YL2A 4FMCB 4W1RA 5HMMA 1WKCA 2BJHA 4WBNA 4QU0A 2QBYB 1XO1A 1N4AA 2VP5A 4EJ0A 3O31A 4QTYA 1Z0AA 1HQKA 4TROA 1ZY2A 3DLPX 3MEQA 5CGQB 2JARA 3UFBA 1MZVA 1XVIA 2EJWA 5CLLA 3UOGA 1KYZA 1VI5A 5SYAA 4C7KA 1DAOA 1DZ3A 3QPCA 3ZH9B 1CJKC 2KX7A 4ZKDA 4YMGA 1G59A 1FRFS 4MR9A 4NZ9A 3SNHA 4IHKA 1DAGA 3O47A 5AVSA 3GLFA 1SHJA 3U4AA 1NGSA 2ZITA 3CKLA 5F3RA 4QT4A 3MJSA 1WXHA 3IDOA 1X94A 3K9BA 3NAMA 4TSKA 1Y7IA 4RV9A 4HN4B 3C8UA 4ZQHA 4XKJA 4ZC8A 3URKA 1U5BB 2CLHB 4DBLC 2JC3A 2IXFA 1I2MA 4FGWA 3DAPA 3EULA 3N1UA 4RQBA 3HKCB 3NDRA 4LDPA 2GBLA 4KQWA 4LOKA 4NE7A 3SF8A 3DM9B 4Z0NA 4YDRA 4ZYZA 4LKOA 1GXSA 2FPIB 1R4MB 2I54A 1UBOS 3I1JA 3D8TA 1IBMB 4M8LA 3M49A 4D0RA 1G42A 2BLLA 4GLFA 1YQWA 4Y3UA 4B4VA 1JEJA 1EGAA 4M83A 2ZUVA 621PA 2CDRA 5IAKA 4O4IF 3W7AA 2R7LA 4J0GA 1VJTA 3OQIA 1Z75A 3TTUA 4BBJA 4GL2A 2HAEA 4D4GA 1ZNXA 3LKDA 3RF7A 4LJAA 1GM5A 4W5JA 1HA3A 1VKRA 4S1TA 2A30A 3T61A 4POOA 2E4XA 2CNLA 4YAFA 1O9GA 1X0VA 2LW7A 2RAUA 3T6KA 1NVMB 1G8FA 1H6DA 5J4KA 5IFKA 2UXDB 1OLUA 1F3OA 2VATA 3HWSA 3VNAA 2N42A 3QG5A 3GFPA 4M0PA 3UB2A 4FB4A 5A7GA 5AESA 2FK8A 5LR6A 3CLRC 3ANTA 4OXXA 4IV0A 3W6ZA 4PYRA 3D6MA 1TJPB 5T4BA 3N59A 4YP1A 3JQPA 5K0FA 2JLXA 1MLDA 1RLTA 3QBJA 3DDWA 3BZWA 3WWOA 5H3LA 2GERA 4QQKA 1CERA 1WHTA 3EPKA 2GZDA 3CUSA 1QPGA 2ENUA 3EXHC 3ILSA 3JW8A 4MK4A 4NPHA 1FZTA 3IOBA 1R10A 2O7NA 3LLMA 3SXJA 4JOCA 4FGJA 5IUKC 1DKNA 4OQYA 1MVOA 4YACA 4D02A 1DAFA 2LUOA 2ZJ0A 1NUUA 3KHSA 1TD1A 4GYKA 2J3MA 5M3BA 4D57A 2QEQA 5K0SA 1G6KA 4OV6B 4EX6A 3DZIA 5F4ZA 4P82A 2NXCA 3C97A 1CT9A 3IAEA 1ACMA 4C03A 5CVTA 1EBUA 2GZRA 3FLBA 2ECPA 3U81A 4JQCA 1FK8A 1T3TA 3CNHA 4FOPA 2BR3A 2X5NA 1CQPA 5A3SA 5JDIA 4GRAA 1NXPA 3LCMA 2BFNA 3T0FA 3DD5A 2Q41A 1NBOA 1WRBA 3EAGA 5CB4A 1DDGA 3RUPA 4PLFA 4UUQA 3W7BA 3MJHA 1LPOA 3WDSA 1GLGA 3I8XA 2WMOB 3EWNA 3G8DA 3WR5A 5A5FA 1GV1A 1SBTA 2CFRA 1L4NA 2BMAA 4WEQA 4DLPA 2HX1A 4OQLA 2EZUA 3THOA 1S4MA 2GBCA 1QDUA 1FC0A 2OZEA 1SIWA 3UXMA 5KTRA 1IL0A 1NUHA 5B2FA 1EK0A 5C3UA 1LBIA 4X6XA 1K9VF 4FDMA 2VSXA 4CEIA 2J6BA 1DC7A 1PHRA 2L19A 4PC2A 3TVTA 4HQ0A 4PR3A 2WTUA 2VDWB 2WG0A 5K3OA 5I7VA 2CDAA 1NULA 2G71A 4UM9B 1Q83A 4I1YA 3RJ5A 4CI9A 2EX0A 3SHQA 3FRJA 1PGJA 4GQAA 1WD5A 2ZE7A 1ZJ5A 1G8PA 1JLRA 3A9WA 3G2KA 3PEVA 4M76B 2PL9A 4PYOA 3QOXA 3FA2A 2JI7A 4I3HA 3WGZA 5BV1A 3FPAA 4EAQA 1LXCA 5DNWA 2AJ8A 2JLAA 2HGSA 2OB2A 1T2DA 2UVQA 3GH1A 3OQHA 4QU9A 3A0RB 1EZZA 3QHAA 3V9AA 4KWEA 2G82A 2REBA 4NRDA 3I4FA 3UAXA 1V5EA 4L6IA 5D5PA 2R4QA 3V4FA 4G23A 5IBCA 3G2QA 3KPJA 1Z29A 2QMEA 4QC2A 4B7UA 1CIJA 1FDVA 1ZSYA 2DKOA 2PZKA 4MMXB 3K09C 1SC9A 3FLAA 4S05A 1SA0B 3OQOA 3A04A 3ERCA 2Q27A 3A9UA 1S3FA 1OFTA 3MLBA 2ZIFA 2NYRA 4KWIA 4TV8F 3NHRA 4CQJA 1A96A 1NVEA 2ACEA 4MO2A 2UUCB 2PWZA 2Q1UA 4G1VA 3LC0A 3A37A 1FDTA 3TKLA 4A9AA 1Q0RA 2CBXA 2YS7A 1WDMA 2ZJ8A 2APJA 4GX0A 1QK4A 1ZX1A 4X20A 1RVDA 5ES4B 3V4RA 3GJ4A 4PV7A 3WLKX 1H93A 1I30A 4FJ0A 4W1QA 5F2OA 1ATIA 4DNQA 2XECA 3QELB 4BO5A 5HKKA 4EFMA 1CUDA 1P3DA 3DV0A 1E1YA 1GQYA 1UXIA 2E6KA 1Y8RA 2JIBA 1E6KA 1XRLA 5JPIA 4E07A 4ESHA 5IDWA 2HREA 2R60A 2ZYTX 5CYPA 4DCMA 3F98A 3K0CA 1OBVA 1UFVA 1LU9A 2QQ5A 1Y6RA 3LO8A 4KCGA 1OXVA 5BMOA 4EL5A 5FHRA 5PGMA 4TMVA 3W2HA 4HZUB 1OH6A 5KSZA 2EAUA 1KEKA 1Z06A 1U8AA 3GFVA 4K2AA 4DCPA 2X42A 4PYKA 3EB9A 5FTKA 4Q47A 2CYBA 3VGPA 5J2UF 2GX6A 2JPDA 5COAA 5IM4A 1GSOA 4YLYA 3DP9A 3KVRA 3BORA 4KQ1A 1SXIA 4WXMA 4YMLA 2VHCA 2XF8A 3PDIB 4XD2A 4FN4A 4YONB 2ANCA 3QKTA 4BGIA 3JTMA 3QWAA 1E6CA 4JS0A 2O4UX 1PT8A 4GUDA 3MTQA 4LOLA 3S2UA 2BMEA 2ABWA 3RFXA 2ZB3A 5BXYA 5E1DA 1SHKA 2V9ZA 3DTVA 2BFMA 3BK2A 1E3SA 3EBOA 2AN9A 1DARA 1Y63A 4PPNA 1YQTA 4MJLA 2F3UA 1T0IA 3NHJA 5JLAA 4YCNA 2XCTB 1GL7A 2YMLA 4HNSA 3CONA 3H3JA 4JQSA 1QHSA 1X80A 2IL1A 2EZ4A 1U4OA 2JD1A 3HFGA 4ETNA 3BT7A 3L7LA 3R3JA 3H42B 1TIBA 4TSFD 3SDZA 4G0YA 4DLAA 2YZGA 3Q5DA 4G0VA 1JMYA 4L50A 4FXOA 1STOA 3QKSB 1N2CA 1EA7A 4IZHA 2OMEA 4BAGA 4QTZA 3IUPA 1CD5A 4NZMA 1DBVO 1ZINA 3L7YA 3KZCA 4QOJA 4D96A 1E5VA 2R9VA 2FFBA 5KNLA 1XDWA 3ESQA 4XCQA 1JGTA 5TJHA 2BFWA 2WJHA 2Z3VA 3FHJA 3GGJA 1KGDA 4AY6A 2YHBA 5SV2A 1DBPA 2FW1A 3CLTC 4JODA 16PKA 1OR8A 5IT4A 5A4IS 4MPDA 2IDZA 1OB5A 4UUBA 5CVVA 3ITDA 3L0CA 1X1RA 2KSQA 4COOA 3WYDA 3MAJA 4M1WA 5B5SA 3WQRA 4I1VA 3H1PA 5HJ7A 1NV8A 1P0CA 3ABOB 4BO9A 4L95C 3ND6A 4FGLA 4RVHA 4AS3A 1NUQA 3QYJA 4TGLA 3UYLA 3RIXA 3LTEA 1NZFA 1ZOLA 2BMFA 3L4BC 4JGGA 5BW4A 2PAAA 3V1TC 4I1PA 1LPPA 1XCOA 3GRFA 1T91A 4YAUA 2NUAA 4ZU3A 1TO1E 1LJ8A 2A0UA 3CKMA 4L22A 1J21A 4ZAGA 3TLBA 3DTYA 4M9CA 5AKHA 4A2CA 4BNHA 3TKAA 3QEKA 1MAVA 1Y7TA 5ALYA 3S1LA 4XEUA 3DPIA 1WWKA 5D86A 3UHJA 5JRDS 4YK7A 1OXXK 3V7FA 1UP4A 2X3YA 2A78A 1CFJA 1E1RA 1PVVA 2O3JA 2RGCA 3JZFA 4C0SA 1GG2A 4GPTA 1A2QA 4OK3A 4E5NA 5CFLA 1ZXLA 2Q6VA 2O7RA 2ZYGA 3DHWC 3DVSX 3UXHA 5AM5A 3TYXA 2IGTA 4GE0A 4NMXB 4HQKA 5IXJA 3RUHA 1KAOA 3NDJA 4EL0A 1DE0A 3LNTA 1PWHA 4A0SA 1KFCB 3B13B 1M74A 2J3JA 3IDQA 3VYUB 1Z0FA 2AKEA 3V8EA 2VNKA 3QUSA 4IFTA 5KOYA 2II6A 2ATEA 2Y1KA 3H05A 4PIMA 1H2XA 3S1AA 1G8AA 3C8MA 1KGSA 1JILA 3OOEA 3BWBA 3RUDA 3ZIAD 3AJRA 2GYVA 5G1PA 5LIPA 1Z07A 1EESA 3UPUA 1DXOA 2WWVD 5J1TB 2H08A 3JVDA 3VX4A 3QBVA 1E2BA 1HT0A 3HR7A 4WT7A 3N2EA 2WHPA 3SEAA 2C77A 1FFHA 1HBJA 1R16A 1DB3A 3DLCA 3HP1A 3O4VA 1JQKA 3D31A 2PMWB 2LNDA 4CMEA 5I7WA 1UPCA 4DQ0A 2QN3A 3VPSA 1Z2EA 4JJ7A 4MCAA 2CUTA 2YQ4A 3SX0A 2VDLB 4PF1A 5KMGB 2EGUA 3DAYA 4JA0A 4ZJYA 3X1YA 3NUQA 4KMRA 1KI1A 2H4WA 2QTVB 3AEYA 5HQJA 3ELUA 3FJYA 1C3OA 1OT3A 2VSQA 2Z57A 2R751 1ZA2A 4KIWA 1X9GA 4NCKA 4RXTA 5DMXA 4AJPA 4AZTA 1NSFA 3LUCA 1OXMA 1KSJA 4NMLA 1W1UA 2Y1WA 4IH1A 2D0DA 1AKMA 2FNAA 2P2SA 3Q7PA 1KO1A 4RZIA 4EECA 3S5UA 2WG2A 3L6UA 4KSCA 2Y92A 1H6CA 1DCMA 1EXMA 1GJRA 4G36A 4GNRA 5AVWA 5KNCD 2I6QA 4FUTA 2ONZA 1NW3A 2JEYA 3AEQB 3E6AA 4RPHA 4UOEA 2HDHA 3I39X 1G5PA 1PK8A 1T26A 1LF0A 2CL0X 4DPMA 5CA1A 3OQMA 2O2ZA 2XUZA 2ZB8A 3ESBA 2VA9A 3LP8A 4HCJA 1JQ5A 1DDIA 1FTGA 2GK3A 1OPRA 4RTOA 5CH5A 2V58A 1ZUHA 3ZDXB 4DLNA 4R8RA 4LHSA 3T9CA 4EP1A 2R8ZA 2RJ3A 3WWDA 3FHOA 1N2EA 4FWIB 1YAHA 3THRA 3BCUA 4WLFA 1OF1A 2C83A 2W37A 2JK1A 3N39C 3LGXA 4M87A 4CEIB 4LNUB 1QO9A 3M89A 3SZUA 4TUYB 2WUFA 4RD0A 1EJ0A 5EMLA 1EUDB 4GE3A 3NHWA 4Z4GA 4C0JA 3DONA 4PNPA 3KZOA 1CY4A 2BP7B 2R4TA 4GUAA 4A3SA 1TT5A 4IJWA 3KXKA 5F9MA 3A06A 2CDBA 2GS9A 3U4DA 3GLTA 4H17A 4FKZA 4NTZA 4Q21A 4QOFA 2GETA 2J33A 3NNDA 3ZVRA 3OH8A 1ZVQA 4KVGA 4IIJA 4NS4A 1KMMA 4DCVA 4YUWA 1M2NA 1WXFA 2ZWVA 3FYUB 3ORQA 1D1SA 4H1UA 3WYEA 4TZTA 1YB7A 2VP2A 3WNBA 3USES 3W1VA 1F9AA 4IINA 4D46A 2WIBA 4LCJA 3MWJA 1C0KA 3ZK9A 1GNLA 1LS6A 2JKZA 3QU9A 3BBLA 4TS3A 2RBEA 1PZHA 5HTOA 2NU8B 1DKQA 4N4AA 5DSTA 2RHWA 4U2KA 1M2VB 1NSYA 3LVBA 1ZGGA 2QN7A 3KVVA 5E4TA 3RVJA 4R71A 2GRUA 5I3ZA 3BBPA 2CJWB 1E98A 5D87A 4KOEC 4CKEA 5LQRA 4XD7A 1QOZA 3AIIA 3LOUA 4J1TC 4CM7A 3HHPA 3KKKA 2NZXA 2YXBA 2WD7B 2D62A 4WKPA 1B00A 1ZD1A 3EMBA 2QQGA 4U7TB 1BOOA 2NT4A 5CM2Z 5G3ZA 3STVA 5EQTA 4PWYA 3ZWBA 2BDUA 1BCSA 1BHSA 2B21A 3PJDA 1AKUA 4PNHA 4QYIB 5FOSA 3MWYW 3H83A 3H6GA 5BW6B 1UWVA 3N2GB 1VSQA 1Z4QA 2A86A 2YJ3A 3ZE8A 4ZYLA 1LVHA 5EOVA 1Y9ZA 3L7KA 4AWBA 5CG2A 5LL6P 1L5GB 4FQ7A 1S3IA 1YMVA 3HJFA 3OZSA 1WVGA 4MPRA 4YIKA 5K6AA 1CTQA 3GGPA 4GI1A 4CF7A 4HRXA 1VKJA 5BQ3A 4W5QA 3KTOA 3V8PA 1L5VA 2PK3A 3SYMA 1MB2A 1NI5A 3BGSA 5JSHA 4JI8B 4UD2A 5K0LA 3UK0A 2Y0PA 1J0XO 3B51X 4X61A 3C3CA 3THXA 4MRNA 4NJEB 2HSGA 1P17A 5C46F 1WEHA 3VYRB 2P4HX 1VSVA 2XADA 1CJCA 5UKDA 4N3NA 1PRYA 2ID4A 4FCTA 2JI6A 3RT1A 4GS5A 2I4RA 3D4NA 1E4EA 1LPNA 3RYTC 4MIKA 4UPDA 2QLBA 3QEOA 4KWHA 4ZVVA 4B45A 2IUYA 4Z3OA 4CM4A 2VLIA 3BAFA 4H7IA 2VYCA 4BO8A 2CB9A 2B6NA 2HBRA 1BXRA 3L1KA 5C7LO 4KG7A 3D2LA 4UULA 1HTBA 2WPDA 3RTCA 2ORVA 4UNPA 4YH1A 1E1DA 4D4JA 3B1XA 2QZSA 4ZQGA 1L7AA 3TCKA 1R5OA 2GN8A 2IJGX 3QUBA 3E9RA 5DNUA 1TKAA 1M2KA 3D6HA 3I9FA 421PA 4EB6A 2XNHA 1DIOB 4HAZA 5LMNB 1KFBB 1AC5A 1DC8A 1E1LA 1OGJA 1UODA 2UVPA 1CSEE 2Y05A 1N7JA 1DC6A 2PUHA 4EDHA 2F90A 3E1SA 5BURA 1YGYA 5KJCA 4YJ2A 2GRJA 2ZROA 2OGSA 1XCBA 2OLKA 3KK0A 3GGOA 2B0JA 5LIRA 3LHKA 3IUBA 3ZV7A 1ZONA 3C3WA 4RSGA 4ZZ0A 1JFRA 4C0KA 2IOQA 2J67A 3OEED 4CQLA 1FQOA 3N7UA 4CT4B 1U1EA 1BGVA 2WU1A 3DOOA 3GRPA 4RK6A 1OXTA 2ZTUA 3PQ8A 4BATA 1A8IA 3FTEA 3BUSA 3KZXA 1L3IA 1B76A 1GTMA 1QHHA 3NUGA 3BH0A 4F3KA 3ICQB 1ZH8A 4NOJA 2EFHB 1EHYA 1T5BA 2I2AA 1N8TA 1QYXA 3Q3GE 4JYMA 1KR5A 1WF6A 1AMNA 2WYUA 2YFQA 1RPAA 1KNQA 1GUDA 2O2EA 1JFVA 2AMFA 3N9IA 3PDHA 3H11A 3LFHA 3T7AA 1OMOA 4BJ3A 1DWPA 2F1OA 4WA7A 3TAHA 3JRWA 1B6GA 1NIPA 3BAZA 4IF4A 4OQDA 5FBLB 4YCLA 1LTQA 2RDMA 2IX3A 3D9QX 2RGYA 4HWRA 3GAZA 3L7IA 5EEGA 1RBYA 2BH9A 2QS9A 4AROA 2PJUA 5IM5A 3BXFA 4TPKA 5DBIA 3H3FA 4FHZA 3O2NA 2A5DA 4WRRA 3LHDA 3PDCA 5E3JA 4DQVA 4GVPA 4DM3A 4F86A 2H4ZA 4M38A 2QU8A 1SCUA 1CWUA 1ZSNA 2AW3A 1RE0A 3C3DA 3E8XA 3GRZA 5F77A 2BLNA 5G0WA 1K4KA 3WMGA 4EFKA 4PSUA 1FU7A 2KJQA 2ZYUX 3C14C 1XZNA 2W58A 4E6PA 3I01A 5D01A 1ZCAA 2YWBA 4YYZA 2H29A 4WNAB 5ALNA 5ITZA 2G76A 2BZ0A 1IUPA 3IX7A 2CNWD 1G16A 5JNRA 1UH5A 5FBRB 1P18A 3F6BX 3JYOA 3R1IA 1H2YA 3LPMA 1N6LA 1E3LA 4EJSB 3EBPA 3QUCA 4GYJA 4D9KA 3LDFA 1Z35A 2FGJA 3IUSA 4Z8YA 1SU8A 3LZCA 5ISMA 4ARUA 2BIFA 3CY6A 3HKBB 3K6JA 4QX6A 3HL4A 3GXBA 5T6BA 4ITVA 1Y5NA 3R7WB 1QG2A 1AIPA 1XNHA 2ZRAA 2CLOB 1S2MA 3KVYA 4YJ3B 3PSHA 3CF2A 3CV3A 1PDWA 1G20E 4OYLA 3ZQ4A 4BNZA 2X9GA 1JYEA 4R81A 5DOZA 5L3VA 4BECA 1IZYA 1L1RA 2D5BA 4R2JA 1Z47A 3ZI7A 4B6OA 1FTNA 3O84A 1VHDA 3IAM6 1R27A 4ZQFA 2CXPA 1SBHA 1I1HA 3B3AA 1Y7LA 1U3WA 3EDOA 3J81k 1VRWA 3FB1A 3BG5A 1X2BA 1GA6A 1ZXXA 1IK6A 3BA1A 3K8ZA 4N54A 3PFIA 2DGDA 4FONA 4D9FA 5JS6A 3N8GA 2Q8QA 4DJTA 2WHQA 3BSWA 5D3MB 2OQIA 3FNFA 3MSXA 1AKVA 3LY5A 4WGGA 1NFRA 3PDJA 3FMIA 3R9XB 4JSTA 3OJ0A 2ORIA 1DIRA 4RLSA 3GIWA 5EPEA 1MQSA 5EZYB 2AQKA 4WBNF 2OQRA 1H8ED 3I34X 4G41A 5EG5A 1CUYA 1WG8A 5CT6A 3U62A 3WBKA 4DSZA 3GAAA 4UEOA 2AG8A 2CK3A 4JEHA 3Q9NA 4BQSA 4EG4A 5IK2A 1QM5A 2QRUA 1K2VN 4NONA 1BROA 3RFVA 3K6SB 5DJ5A 5TSDA 4EA7A 4TYWA 5GVRA 5FFNA 3RU3A 2NV6A 13PKA 1YL5A 5JSFA 2C94A 4XVHA 4RTKA 1NVTA 1FSSA 3GP5A 5B1SA 4F56A 3U3RA 3E70C 2Q9AA 5JUWA 5CFPA 2BKLA 1HDOA 1T4BA 4LY9A 5A5VA 5JSQA 5JXGA 4II3A 3NKVA 4GP6A 4WJZA 3UW3A 5IJXA 1EXDA 2PGIA 4HLNA 4B6QA 4PLWA 2Q1XA 3QYPA 3QP9A 4LISA 3V6MA 5IAGA 3TNFA 1IQ0A 4CMKA 4LBVA 2VDQB 2ZTVA 1AUVA 1Y3IA 2VHXA 5EXDA 3ABZA 3JASB 3OP1A 4Y2VA 5H7XA 2WM8A 5EWLA 3V33A 2NV2B 5KTKA 4HR7A 4GBJA 1ZRHA 3A4YA 5JH7A 3IL2A 3DO6A 1EX1A 1YFLA 1HTTA 2HQRA 3NONA 1TAGA 3W7VA 5EHZA 4Y6LA 3QSYA 4AJHA 1CY8A 1QK3A 4JP8A 1Z2NX 3CZMA 2VG8A 3QVTA 4EZBA 5C2JB 5K9ZA 3VOTA 3COYA 2VBIA 1R8JA 1R1DA 2GPWA 3IP6A 5ESWA 3RLFA 5LNK6 1P80A 1PFGA 1VP9A 3H75A 4KPFC 1TTQB 3HJUA 1TCAA 2C3OA 2J5KA 3CRQA 3IT1A 1TU0A 3FB4A 4XX0A 4C0QC 3NIDB 1U11A 4YRNA 3LJKA 3WO1A 1XPOA 1IBCA 3WRXA 4XD7D 1CE8B 4ABYA 4JASB 3WIEA 4LEIA 4P4SA 3OCJA 4LDJA 2C9CA 2B9EA 2FRXA 3I2JA 4XGKA 1I2CA 1Q0HA 4DDKA 1Z5PA 5C5DA 1RYMA 3SZ3A 4FE3A 4IXDA 3R2JA 1ZM4A 3M3DA 3L0SA 3KKOA 2QNBA 3WXBA 5LA6A 1TZMA 2O6HA 1P2SA 1SQSA 3BK1A 4RQAA 2A4KA 3T1TA 2GD6A 3SJZA 4UM8B 1AV6A 1NY5A 4UCFA 3G0CA 2ORYA 2VH5R 3GRAA 1GPJA 3TAXA 4R6XA 4Q18A 3LX8A 3J81A 4ZGBA 5G4KA 3JATB 3HKEA 4AZWA 1JEEA 4YUYA 2YXDA 3CU5A 4LXYA 3VR3D 4R2XA 1TEZA 1V5FA 2XKAA 3QVXA 1NOIA 2IHYA 4M3NA 3ZDDA 3ZS9A 2Q1TA 1DPGA 1H5NA 2WFLB 4BRUA 1RMTA 3V7NA 2AN3A 2JATA 5BR4A 5BSKA 3FNHA 1W5SA 1ZM3A 4IH9A 5AW4A 1MA0A 3ND8A 1K5HA 4GPBA 2A92A 3LXXA 2YIVX 4N7JA 3ZHTA 2D1YA 3BWCA 4AVYA 2GDJA 2IHBA 2RG7A 4UHDA 5T8KC 2PZMA 1VA4A 1ZD9A 2WIKA 1BEEA 5G1NA 5CB4F 1IG0A 3OT1B 2OBXA 2WUEA 5B55A 2CMDA 1M6YA 2WPDD 2ZT8A 3VVCA 5DGDA 2QX8A 1ZCFA 2IEIA 4G4JA 2IPAB 4MJ7A 3U4HA 3QLUC 4KKVA 2Q5LA 2W6JA 5TPWA 2O7SA 3EPPA 2PKYX 4XYBA 4EVRA 3HWWA 1II0A 1O94C 1Y1QA 3OVMA 5KX5F 1AU9A 2GCIA 4JNKA 1D5CA 5JS2A 1BU8A 3OWXA 1DIBA 1L8LA 1PG5A 1ZD2P 3O8NA 5IFLA 1SY7A 4X3CA 3OEYA 3TW6A 2X0NA 3MSCA 1M0SA 1DWQA 3UV6A 3O4GA 1WSAA 2E0IA 3KIPA 4B9AA 2GAJA 3K94A 3HXTA 1YA8A 5JCXA 4FDAA 3HBLA 4EHBA 1Z88A 1UC8A 1BE6A 2ZRGA 2HDOA 3HJTA 2H5IA 4MQEA 3AUYA 1OBFO 2XQKA 1UMCB 2JIZA 5JVDB 5J4LA 4RJLA 2A5LA 2QIPA 2WINI 4HGPA 4QOHA 3D3EA 5B1DA 4ALMA 5U9CA 3LBHA 1FLDA 3TG8A 1RP1A 3BB3A 3T9DA 4UPVA 3PFHA 3Q7TA 1XDUA 2PZJA 3QBDA 2EARA 2X8JB 2ZRKA 4DMMA 1POXA 2IZZA 2WE8A 4UEQA 5KYWB 3EH2A 5F3WB 3T8YA 1GVHA 2JAPA 3KPVA 3P5BA 4JLVA 5JU6A 3RHZA 3WGHA 1LX7A 1HKHA 2C31A 2XD9A 4GSLA 1Z62A 4NOMA 2CJXA 5HFJA 3R7BA 4C7OB 2ZWMA 3AHDA 1ICIA 1TADA 5IMSA 1L4FA 4FBMA 3L0IB 4O4LA 2ETVA 4OTZA 2PBLA 3OQJA 2V9PA 3A1DA 4FBLA 4OHZA 3E2PA 3S0JA 3DZBA 4KWCA 1GN8A 4B33A 4YCSA 3K0AB 4OB8A 4NBSA 4YMHA 3WLJA 4L02A 1ZNWA 3AM5A 1HQYE 5CURA 4A82A 4RNDB 3M5PA 2Z2ZA 3L6CA 3NPMA 5C7IO 1QVAA 1DKMA 2HF9A 2J30A 3A10A 3AUFA 2QE7D 4ZVRA 5MFZA 2OFXA 2WC1A 5JSKA 1WCIA 4PSKA 3SR3A 1GL3A 1V11B 2D06A 4PLYA 1OAOC 2PTHA 2IYEA 3OZGA 3ORSA 2H7YA 2GJ9A 1SO8A 4ETMA 2HDWA 2IK8A 3B6JA 2V5UA 4XPIB 3RVSA 2GD1O 3OOSA 3KD2A 3E4CA 3IQFA 4KXQA 5TT0A 1IQRA 5E2AA 2R5FA 2Y71A 2PX2A 2HF7A 5DYWA 4BIIA 3B2NA 4Y1GA 5I9IA 1Z6GA 4YV0A 3FF4A 4Y6SA 2PZBA 4NYMR 4CR6A 3LYLA 2EZ8A 3TGPA 5AT1A 4CCYA 4HI0E 3COJA 1JL3A 3DNPA 1T8PA 3SVTA 2X9QA 3DUFA 1DBSA 3DAGA 4I4TB 3ZIDA 2C96A 4WFIA 3WMWA 3IURA 3TQQA 5JBQA 1GSAA 3CX8A 3NDBB 4YCDA 2QT1A 2CNKA 2JLQA 5CK5A 4AXBA 1P44A 1VI2A 1XD2B 3Q3VA 2VJMA 2GEJA 2RH8A 3U49A 1MXHA 4QA9A 2XBUA 5DNDA 5HBGA 3P5SA 3WGYA 1S5PA 3D3WB 4GKJB 4AKGA 5CXUA 1Y33E 1QZXA 1C7JA 1IZ0A 2DUUA 4ZCTA 5CB8A 2AH5A 2QAJA 2Y1XA 2C8JA 2OT3B 4G2NA 1L3BA 4L0DA 4XRGA 1QGYA 2WK1A 4K46A 5MHTA 2PD6A 1EXWA 1JDBC 1ORWA 2JH8A 2CNOA 3I0NA 3L0BA 4LJSA 4DILA 3EXEB 3E84A 5T7BA 4BNDB 3I9NA 2ZKIA 3U1TA 5JATA 1KHHA 2I6TA 3KS9A 1GPLA 3CUVA 4JB2A 2VJQA 4YASA 3RCBA 5HZKA 1RQRA 3VPDA 4QULA 3WRYA 4BBZA 1SNYA 1PV4A 3PNBA 4PO9A 1C9JA 1DC4A 2O1WA 1M2WA 2W6ID 4IXMA 2PRJA 1KXJA 2ILTA 3P9IA 1Y4UA 3KKLA 3C6BA 3N2KA 5E7MA 5SYMA 4KQ9A 3BIXA 3F6YA 1VHTA 2F3PA 4UBIA 3FCOA 2ZBEA 5GWXA 3DZHA 3ZE7A 3QTBA 4OF4A 4PCUA 3E5MA 3VAZA 2ICAA 2AFHE 5K6TA 3B3GA 3MGCA 4UFOA 3DHNA 1GZ6A 4P4GA 1OXBB 1E77A 1MIOA 3MQ4A 4CGYA 1E20A 1CRLA 1T3HA 1JDSA 2ZSHA 4GI7A 3UJBA 5AKZA 4IV5A 2IEZA 3FFAA 3DLAA 4RK1A 2XCOA 4X66B 1MQ8B 2ZJZA 4F5YA 2YIMA 2ZG6A 3H5NA 5AHOA 3RSQA 6REQB 3S29A 2FMKA 1FIUA 1XCPA 1HZZA 3H9EO 3U7QA 1Y48E 2Z58A 2IIPA 2OBFA 3EIFA 4LS3A 4QPNA 5CW1A 3M82A 5FBQB 1SXJE 4OJMX 3S7TA 4BQIA 3M6XA 5GZ6A 2GCOB 3OCZA 3HVUA 3ZU4A 2QRKA 4KHPB 4PC7A 1OWMA 5AI9A 5I8PA 3HN7A 5U1PA 1TU3A 4EF5A 1PKEA 4EGJA 5I9LA 2WKSA 1M1YB 4M6WA 1YBHA 3ADCA 4BXOA 2OAP1 4ZO4A 5PNTA 4HDQB 2OXTA 1YS7A 2JAXA 1P0PA 1R37A 1A9ZA 1IQPA 3W6OA 3DVLA 4X54A 1SRRA 3FVTA 3K70D 1N2JA 2NO4A 2ZYRA 3P9KA 2V6GA 4JAVC 4UM5A 4X97A 4YRPA 4W5NA 4ASUA 1E6MA 3PDWA 1W52X 4B3DA 2AKYA 3FCAA 5J43A 4H1TA 4URUR 4HYQA 2OR3A 3KT6A 1FMJA 1V8OA 2XUOA 1TO6A 4XTRA 1NZJA 2VYNA 1WPRA 2G6TA 3MMZA 1U3UA 5IJWA 1DKOA 3D7KA 4FIDA 5BWBA 5H1YA 2NNWB 2BGRA 2V1UA 1S7CA 3HRHA 1LDYA 1E5XA 1Q6ZA 4A0GA 4AM8A 4DRXB 5I51A 5L3SA 4DY6A 2GK7A 1PZXA 1RAFA 3L1HA 5CDFE 1XZFA 4B1FA 1PZFA 2X77A 4W99A 1T9KA 4EMTA 3TW8B 1AJEA 3W05A 1GFSA 3RK0A 2XJ9A 4BIMA 2ACWA 5JYCA 4HTFB 4J1SA 3AT1A 4TMKA 4KIGA 2WWWA 2G1AA 3IEXA 1EAYA 1ND5A 3PNPA 4OAPA 1N3IA 1NVBA 3WRVA 5IASA 1HYEA 2IYFA 4IM7A 2HZ7A 5E8JA 5IRCD 1DL5A 4LF8B 3UMRA 5DW3A 4I0WB 5E6UB 3PPIA 4XDYA 1FFXA 1W9HA 3KB1A 5DNYB 4DSAA 3MB5A 4Y2UA 5CVJA 1OI2A 3KJEA 1T2VA 4Y2TA 1O6FA 1Y0BA 2XIQA 4J2HA 1YOBA 5ARCA 4R1TA 3MW8A 1S2GA 5EE0A 1D8TA 3FHLA 4HEA6 5F5LA 4P38A 3SJAA 4QM7A 2AJTA 1XLVA 4JENA 3E5RA 1E9CA 3A2LA 4OXQA 5GONB 5GV7A 5BW5A 2DQKA 2E4ZA 2Q4RA 3B1KA 3D8BA 3NRCA 3DA8A 3KXLA 5BSEA 2P11A 1UZNA 5ALLA 3VSAA 4QDZA 1A50B 3ENNA 3K5WA 4V0ME 2AQIA 5H82A 4BNJA 1HSZA 3LBYA 1U0JA 4ARBA 2P2DA 4J7AA 2CFSA 2AE1A 5CCBA 2HJGA 2W6JD 1GUAA 1Y1KE 5AKJA 1YQQA 4FMDF 5FFFA 4ZCPA 2CMKA 3VO2A 4CKWB 4CU5A 5B7NA 5KYXA 4RS4A 1C9KA 3H9CA 5COQA 3JWIA 4P5DA 1Y8AA 2H4FA 1J5XA 4CLRA 1MW9X 3OOWA 3IH5A 5EKSA 5CA1F 5MF6A 1HT2E 1WZUA 3L7OA 4OCZA 3E22B 1SMKA 1VJDA 5DHAA 1N5MA 2ZBGA 2QX7A 3MRTA 3M3HA 4WOKA 2NUTB 1BYIA 4CKCA 5JAUA 1RS0A 2LD4A 2H1OA 1ZVMA 1EFHA 2F9FA 2VAXA 2ZSFA 2WYHA 3K4PA 4BLVA 3A6PC 2JIZD 3AESA 3DOFA 2FE1A 1AMUA 2AJDA 2HIGA 4OQPA 2JGMA 2AZTA 1KSHA 1P2BA 3SKVA 5DI3A 2G4CA 4EG6A 2B25A 3BGVA 3H4MA 3QPWA 4I6JA 1Z0SA 2EXXA 2QR3A 3I1IA 4KE7A 3HR4A 4K5QA 4YRFA 5DOVA 1WHSB 4YAEA 2FPPB 3FYTA 4M89A 1H8HA 2RH5A 3EVAA 5H4GA 1SWWA 3EVEA 4GPD1 5KWSA 3A3NA 3HFRA 3MB8A 4IIJF 3NCHA 4C6HA 3U09A 2HU7A 3E2IA 4BTLA 4X8LA 2OORA 4O8ZA 3CUKA 2ZCUA 2ZJ4A 1SN7A 3BTVA 3OHMA 4D81A 3RK1A 2R1TA 5CD9A 1EH5A 1KZ4A 4U8HA 3N74A 1GRNA 4QJBA 5KJFA 1UBHS 1XCMA 2CUKA 1Q50A 3I9V6 3AR9A 4UMDA 5DTEA 1QOPB 3D43A 4K86A 5EXSA 1PKXA 1QUFA 4NESA 3RUFA 3UGKA 1B93A 1XTUA 3MINB 4KO3S 4DPLA 2D1QA 1W1WA 4X94A 1JKIA 4MQ4A 1MAWA 5JO0A 1ZOIA 1YXMA 1XVTA 4KLAA 3BRWA 3K1ZA 4OH7A 5ILQA 3TRKA 4CF5A 1RYBA 2ONYA 2V8BA 3NATA 3QF4B 4URWR 1QGOA 1A97A 3G49A 5C1OA 9GPBA 4V1CB 1G8GA 4EYSA 4YO8A 3LSYA 2ZVDA 1HPLA 3EIUA 4Q1BA 1EJBA 2HK8A 5CM9C 4B6SA 3VNBA 4WK2B 1I2AA 1H5UA 1ST2A 1Y3HA 2WVHA 4DPKA 3MUEA 1MZPA 5LMCA 3E5HA 1A2BA 1WUJS 3ABIA 5KSPA 3WYNA 5AFSA 1B3BA 5AXAA 4AJJA 3O3MB 1TGYA 4O4JB 1IY1A 4KBYA 3IAM1 3S7ZA 1GUBA 2C7GA 2H2FA 2DHEA 4UKDA 2XQJA 3OQBA 4R1OA 1YVPA 3K0KA 2JW5A 4S2UA 3D5QA 1T5DX 2EBWA 2XWBF 4OMFG 1BHJA 5F7OA 2FWIA 3RVMA 4LSZA 2ZWOA 5D2CA 3WOHA 3NV7A 1I4OA 3V8MA 3TL2A 2JFUA 3H4TA 4FHCA 5CGZA 4OX9Y 1KH3A 8LDHA 4I9UA 4MUXA 5IMBA 1KMCA 3WGLA 4Q3OA 1FUUA 2AJCA 1AQYA 2HY7A 4HDMB 1K6JA 4QUDA 4O4HB 4AURA 3W79A 4N5MA 1CUJA 1E3EA 2QP9X 4NMHA 3GRRA 4UOQA 2DPXA 2BEUA 2C07A 2NPIA 2KWIA 1KMHA 3P0HA 4MNTA 4OYYA 2X9LA 3OC0A