1CZRA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGNQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 57
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czrA00
4D02A 1RLIA 1YCHA 1AHNA 4PTYA 3L9WA 4LA4A 5FX2A 4HEQA 1F4PA 1FLNA 1YRHA 3HR4A 1B1CA 2OYSA 5EMNA 4U7HA 3W79A 3N3BC 1H66A 2QX6A 2Z9CA 2FCRA 4YQEA 1J8QA 1FUEA 1QR2A 2MTBA 3TZBA 2FZVA 4ZVKA 3W77A 4LTMA 3W78A 2XODA 1FLDA 3B6JA 5A4KA 4C76A 3N3AC 4S24A 4YAWA 2FLVA 1TIKA 2R96A 4C0WA 2HPVA 2OHJA 3NHKA 3LT5A 4PTZA 4ZVNA 2BMVA 1JA0A 4CETA 3EYWA 2A5LA 5F4BA 4NULA 3FJOA 3NFRA 4FGKA 5F12A 5LVAA 1J9GA 2MT9A 1CZHA 4QODA 3G5MA 1BU5A 1E5DA 2RG1A 2M6RA 4LAFA 3U7IA 3FX2A 3KAPA 2AMJA 4F8YA 3OWHA 4LTDA 3GFQA 4YAOA 5LBUA 3TEMA 4DY4A 2F1OA 1OBOA 2QWXA 1GG5A 3F6RA 1H69A 1XI2A 1RLJA 3OX3A 4R81A 5FA6A 5ULLA 4BMPB 2Z9DA 5LJLA 1QHEA 1FLAA 1CZLA 3NLLA 3UXHA 4J8PA 2WC1A 1SG0A 4QOIA 3OVMA 4XDHA 1I1OA 4Y7CA 2BF4A 3B6MA 3OJXA 1RTTA 5LBTA 3LCMA 2HNAA 3ZHOA 1ZWKA 3NHSA 3O73A 1FTGA 3QFCA 1T0IA 3HA2A 4NLLA 3L9XA 3F2VA 3NHYA 1AKTA 3OJWA 1DXQA 1JA1A 3B6IA 3ESXA 4PU0A 3TE7A 4DIKA 1SQSA 1CZNA 1KBOA 1OBVA 5LLDA 2B3DA 4ZVLA 2QMZA 1XT6A 4Y9UA 2QX8A 2QR2A 3RPEA 2M6SA 1ZX1A 3GFSA 1CZKA 1VMEA 1DX9A 1QRDA 4N82A 4U7FA 1D03A 1J9ZA 1NNI1 1DXOA 1YCGA 4Y9RA 4C0XA 1XYYA 1YKGA 5LMCA 4YAFA 4YALA 1OFVA 3P0RA 3FVWA 1KBQA 1QBGA 3W7AA 4C14A 1CZUA 2R97A 2FDXA 1C7FA 2Z98A 4QOGA 4QOEA 2HNBA 1T5BA 3B6KA 2W5UA 1C7EA 3K1YA 4CF6A 4QOHA 1XYVA 4GR9A 1X77A 1YOBA 3UXEA 2V9CA 1ZWLA 1AMOA 4ZVMA 3HLYA 4GI5A 4QOJA 2Z9BA 3U7RA 2FAXA 3GAMA 5FUQA 1D4AA 4XDGA 3S2YA 1WSWA 1D04A 2FOXA 2X2OA 1FLVA 1V4BA 2FZ5A 2QX9A 3F6SA 4ESEA 5B3LA 5BUCA 4LTNA 2KQUA 3NHWA 2X2PA 3OWXA 5LJIA 1AKRA 3K20A 4N65A 5JROA 2BPOA 3D7NA 2KLBA 2QX4A 2BN4A 2FVXA 4FX2A 4GQIA 5F51A 3NHUA 3JSXA 3OX1A 1RCFA 1BVYF 1J9EA 1YDGA 2QMYA 2BZSA 3KEGA 5EA2A 5NLLA 5TGZA 2ARKA 2FX2A 4N9QA 3GFRA 3NHJA 1AG9A 3FNIA 3QE2A 1FX1A 1AKVA 2V5UA 4OXXA 2XOEA 4M0CA 3O2NA 1FVXA 1YCFA 4FGLA 1CZRA 5EAIA 6NULA 2OHIA 1WSBA 3N39C 3NHFA 3NHLA 2Q62A 3FW1A 5B3KA 1AKUA 3EDOA 3ES9A 3KLBA 3QFRA 2V5VA 4FGJA 4QOFA 2D5IA 2N1MA 3ESZA 3ESYA 2MOKA 4BMOB 3SVLA 2OHHA 1AKQA 3OX2A 2MWMA 4YAUA 1AZLA 1CZOA 2Q9UA 4ICIA 4H2DA 4H6PA 3R6WA 5NULA 3NHPA 3F90A 1AKWA 3NHRA 1TLLA 3KAQA 4U7GA 2ZKIA 4DILA 2GSWA 4HS4A
chains in the Genus database with same CATH superfamily
3AOEC 1P0PA 3H8JA 3MVEA 5DCUA 3X1JA 4XARA 4L3VA 4BFSA 4QU8A 1B1CA 2OYSA 4HWKA 4AU1A 5U9CA 1QF7A 3HCEA 4ZCRA 3E9NA 3ZDRA 5FWXB 4JLMA 2EGHA 3H16A 2ZATA 1UQUA 4BX2A 4B32A 3SHFA 5I51A 3W9BA 1KEEB 4YCBA 1M66A 1NSYA 5C31A 2VUIB 4HNHA 1G5FA 3UHAA 5FYDA 1DAMA 4WZBA 3IP3A 4FOPA 1D09A 1Y4UA 3HRIA 1QCYA 4NZYA 5EMJA 3TRIA 4D4LA 5MN4A 1D5CA 3MINB 3GEEA 5AMXA 2VDWB 1ZSNA 2ATIA 5BOSB 1PX0A 2ES4A 2FPRA 4LY3A 3IDZA 3SY8A 4A73A 4YXWD 3N8DA 3WL5A 2NQTA 4CIBA 1JX6A 3ZD8A 2ZGVA 3K2IA 2I3GA 5F7ZA 3N9IA 3TO5A 4BIIA 4RCZA 1CFZA 5HKLA 3G9XA 4NU5A 1MP0A 2ID8A 3ESCA 3ANSA 2ZIUB 4A26A 1R4MB 1KDVA 3AVTA 1W2HA 3L6DA 3M81A 3BSSA 5H0IA 4GDMA 3PHBE 1W581 4N7JA 5IJ9A 4N03A 1UANA 3WJ1A 3PDWA 1ZJ5A 3WGGA 2ZJ2A 1WZIA 1OLSB 3HXPA 1EK1A 1XNRB 1Q15A 3AHCA 5LOVA 5JS2A 2XSZA 4XIJA 2Z4SA 3EQ6A 4GE0A 1YV9A 2ZR7A 4N0QA 3CSDA 4MW1A 3WK8A 2PWYA 5J2UF 4XJTA 1KP9A 2CB9A 1N4AA 4P0PB 2PZ8A 1SEVA 1GNPA 3BWBA 1V4NA 3DTVD 1AKNA 4LNHA 5TR9A 2HFKA 1FFCA 4CF6A 1PP4A 1DAOA 2TYSB 4MSUA 1IJKA 1F12A 3KYIB 3VR2D 2JI7A 3PGKA 1Y6QA 1K8QA 2C2GA 1MOSA 1J0AA 4PE5B 4DUGD 1Z2DA 2DYKA 3AFGA 4H3VA 4HHEA 3PI6A 4C6HA 1RWKA 16PKA 1F0PA 4FD3A 1Z7WA 4TTJA 1WSWA 1N2OA 3O1IC 4LJSA 4WKBA 2Z3ZA 4Y9SA 1TZ2A 4JC5A 3F6SA 1F20A 1FTNA 2F8MA 3E4DA 4R2JA 4CLRA 3FOFC 1AE1A 5KX5F 3IT1A 2AJDA 1NW9B 4FDUA 2Q8PA 3AL3A 1U3VA 3ZKWB 2FUKA 2B6NA 1Z7YA 2HCBA 2FJUA 1GUFA 1AMNA 3U4MA 1JS1X 4N9QA 2C4MA 3K6KA 3TVDA 4HNVA 3ROFA 1OXVA 2Z4RA 4EL5A 3N59A 1W5BA 3VR5D 3VTAA 3CO0S 5EHZA 1CEYA 2CEKA 2QM3A 4H1UA 4TQAA 3L01A 1EP3B 2CXXA 5CM9C 5AHXA 4F92B 3OIGA 3CGWA 3RUFA 4BUJA 4WA8A 5CH8A 2Q9AA 2CC2A 2B83A 5EGNA 4MW6A 5E9AA 2HJHA 1UBUS 5K09A 1UOOA 5KYYB 1SVUA 4UVHA 5JPDA 2UZAA 2B9EA 1KO8A 2ZRFA 4XSGA 4ZOLA 2FRDC 5AVVA 2IS1A 2VIIA 4MV5A 1YCHA 4ZI7F 5CVCA 3FJ1A 2Z8XA 3AHDA 3OQHA 2VUTA 4L8GA 4TXNA 4UTPA 4EKEA 2DUMA 4ZT5A 1ENYA 1TU0A 5FULA 5IC5A 1QF6A 1Q5PA 4AN0A 3THWB 2JIRA 4X1IB 4AT1A 2A8YA 4C4PA 1EFKA 2QL5A 2FZVA 1PR2A 3CX8A 4MQ4A 1JHUA 3FI9A 3V1NA 4HX9A 1F9AA 1VIDA 4ND5A 5AJTA 4KI7A 2VJDA 4B6EA 1KR5A 4P32A 3F3SA 1LFAA 3HN6A 3EUAA 1XG5A 1NMXA 3IBSA 3MFQA 4QWWA 4GPTA 3JQBC 2GNPA 2R62A 2R8BA 3A32A 4ZAYA 3FF1A 5F4BA 3GJ5A 1IN8A 1XHFA 4RHEA 4IIJF 3G5MA 2G70A 4F56A 5JYBA 4LFAB 3UMGA 2LDXA 1UAYA 1MZPA 4R01A 5CTAA 3IPAA 3KTFA 4JWTA 2VL7A 4CMEC 4ZV7A 2C3MA 1ZOOA 2C82A 3LBFA 3TEJA 5SV2A 3DGFC 3R3WA 3WAKA 1XRQA 5LXTB 4FGZA 3K0EA 1UDBA 1HO3A 1NVGA 4MITA 3GT4A 5BSTA 1XK7A 4MIEA 5ER6A 5EWJB 2VPXA 1RHMA 3OOHA 1O5OA 2O5VA 1ZWKA 3H7IA 1VLZA 1JG7A 3OWOA 1IU9A 2Q2NA 1MJFA 1JA1A 1MC4A 2J9RA 3R0JA 1M83A 2FG5A 1VSUA 4LVCA 1L5NA 1QGUB 4J90A 3TEFA 1UJMA 2ZT7A 3TLCA 1IATA 1LZKA 1YDWA 2HMSA 5DRTA 4N82A 3WYFA 5A62A 2WFMA 5EGSA 2H07A 4LMAA 3TQHA 4KGXA 4HF7A 1OFVA 1C7QA 3KHSA 1IHUA 1ZMTA 1ORHA 3VYTB 1NE2A 4D0GA 5IEJA 1JUDA 5AJXA 5HQ3B 4RY0A 4Y1RA 1XMXA 2X22A 1GD1O 5FXMA 1DQNA 4EK9A 2YVAA 1NN0A 4MUEA 5C51B 1NVKA 1U3CA 1FNBA 2A84A 3KZXA 2XB2A 4KXWA 1CYEA 1H8HA 2JD0A 1ADGA 1SUIA 4KXNA 1HGXA 3VH2A 2GX6A 4H35A 1OU4A 4XDGA 5FLYA 3CE6A 2EF0A 4JY7A 1P1HA 4LXIA 4FYYA 4P6VF 5AHWA 5E3HA 4KREA 2NO1A 5KX5A 4JLDA 5EQTA 3MJVA 2E4VA 4FILA 5HMMA 3AHHA 1HT2E 1NFFA 2F6RA 2PGOA 2VP0A 3D7KA 4Y2JA 1VCNA 2PRYA 3CNNA 5AP9A 3OUZA 4PSAA 5K05A 4RGVA 1AO0A 1VJDA 1ZINA 2GNAA 3IDQA 4N1AA 1TIBA 2I3AA 4U7TB 5BW4A 5K2MA 1JZQA 3CXRA 3PPVA 5FL7A 3WAJA 1XTJA 3DDOA 3P2IA 4ZCPA 4EG6A 1KQ3A 2J0UB 1L1EA 1TZJA 4WY2A 3VR6D 1JVBA 1JQBA 4OH1A 3Q88A 4HJXA 5HSGA 1PS0A 5HCNA 4IUBS 5KQLA 1DAFA 1DG9A 3GU3A 1URPA 3BFJA 3DOJA 2CHGA 4BCBA 3MGBA 5B7QA 4YXFA 4PO8A 2A0XA 5T57A 4MRSA 1N6NA 1P1IA 1BC5A 1TLLA 3OQBA 4C6TA 2VWQA 1LPOA 2DR0A 4TKVB 4HSGA 4FIZA 4KE6A 1EUYA 2CKMA 1U28A 2VNKA 3GVCA 4N8DA 2R86A 1SU4A 4UM7A 1F4PA 5K0BA 1E1QA 2EL7A 1NHWA 4ROTA 2GN4A 1OAOA 4NMXB 2H52A 4Z9YA 4MQEA 4KGVA 3W5IA 1FQOA 1M0WA 2YKGA 1CUZA 2B4QA 2ZCUA 3L7BA 4KPUA 4IS3A 1US8B 2OFPA 4PYJA 2I5PO 2BEWA 4D9BA 8ADHA 1ZH6A 1MH9A 2AJLI 1RMQA 2ZBRA 3RFTA 2ZBFA 2Q1XA 2VWPA 1RMTA 2X41A 5DYYA 4EA8A 3ZU3A 2OORA 2YNMC 4WJZA 5JARA 4EUSA 1FSSA 4JVSB 2RAVA 1QANA 1HKHA 2VDRB 3LWZA 4GLLA 3ZW7A 3W6NA 3P7MA 4FDLA 4KO1S 3PE6A 5DXJA 5JHHB 4D3XA 1I7PA 2HY7A 3TJRA 3U60B 5AKZA 3W5DA 3D8SA 1NVWQ 3QXSA 4H6WA 3U3XA 1L8XA 4JC0A 4N5MA 4XM0A 3Q7TA 1OGYA 2OC4A 5G4LA 4QE3A 4GOND 2I78A 3E3NA 2QPOA 3SSAA 4B6PA 1NMZA 1ENZA 3ICVA 3L0BA 3AFIA 1K5PA 2OOKA 3DV2A 3MUEA 5ESXA 3RIEA 1T29A 1FQKA 4ZOLB 3FVTA 3V46A 3LMKA 4X92A 3GL9A 3NFYA 4YEDA 1L8OA 3NTQA 5GJCA 4TWJA 2Z56A 4IHKA 2X1VA 1DBRA 1SVMA 3WGOA 3REFA 1K7SN 5AVTA 4J3FA 2V3CC 2HDHA 2JBWA 1XCBA 3AP3A 3NR2A 4PF1A 2Q7OE 2WTMA 1XQ6A 3FF4A 1TU4A 5DHPA 1JSRA 1TQ8A 1ARZA 2OPBA 1PNOA 1KEEA 3CMMA 1EM8A 3TCNA 3M9WA 1GQQA 4KDEA 2P1DA 2ZRCA 5CYPA 3TK1A 3K30A 3QKIA 4RZSA 1WB9A 1JP7A 1N8TA 3CLUC 1GPWB 1S4MA 2OP0A 2VJKA 2ZB4A 2G83A 3EIQA 4GOXA 2D74A 3BCRA 3KSBC 2V7PA 1FUYB 2DPXA 3I5MA 4KYVA 3KU4A 2PZLA 4PZ0A 3I09A 1LSUA 5ALOA 4MP3A 2GWRA 2FSFA 3KKLA 4GX0A 1SC3A 4UEJA 3K9CA 1DKLA 1L5KA 3RVBA 4BMYA 4MUXA 1QFMA 2YJ5A 4DQXA 1U5CA 2QSZA 1K8ZB 2Z43A 1BAPA 1YC5A 3IPCA 1HL7A 2IZ1A 1U4SA 2COKA 3ZBPA 1B76A 1CRLA 1XDBA 5TMPA 2BEJA 5JS6A 4BQSA 2PUHA 2X9NA 2MYPA 3TIGA 4L4RA 1W46A 1JQ5A 2I80A 3QVUA 3VR0A 3NHJA 4DV1B 2JH8A 1I30A 2QR3A 2ACKA 5KYTA 3FWYA 4FT4A 2ZTMA 3G0IA 1LJUA 4L07A 1U9ZA 5EIBC 3S6JA 4UM5A 1JNYA 1CJSA 1YHZA 3R76A 3C0KA 1C0IA 1ISMA 4MA5A 1HRDA 3L1HA 5JBQA 3BMNA 3ZJTA 5SZIA 4I2NA 5K8VA 4I08A 3QUSA 4AMUA 1QB7A 4NONA 1E1LA 1FYDA 3INRA 3LDUA 2HYDA 1F60A 2QHXA 3OIFA 4LOAA 4M0DA 5F1YA 4GFDA 1G42A 1NQWA 2GZAA 2WF5A 1WR8A 3HABA 3HVHA 3W8RA 3ZGZA 1ZRSA 2QD3A 5EESA 5F2OA 1UZUA 5KNCD 2BRUC 2X9GA 3EG9B 2IWHA 1A8QA 2OUKA 2IBMA 1X1SA 3HEBA 4I3GA 3H2IA 3KQTA 4ZO8A 1GG8A 5GWXA 2PKWA 5KPDA 2ZAGA 1GFWA 4MKIA 5AI9A 1Z2NX 1HFEL 1FE8A 4C87A 3R9XA 2BFEB 3L1VA 3MPUA 1L9KA 5D3MB 1G6OA 4C9BA 4JI4B 2OT3B 1E1DA 1L1QA 1QH8A 1KETA 3FWZA 4ZARA 1RJFA 1MU0A 3HHPA 1SUFA 3S2GA 4IG9A 4CETA 2DCMA 3WL4A 4FBGA 1U1GA 1PJ4A 1PJRA 3RIHA 4I4CA 4WBNF 3DL7A 1E0KA 2XB6A 4B4UA 2JL1A 3FUTA 1E6KA 2VUHB 5GZ3A 3TEMA 4J43A 3W8EA 2X8WA 4HDRB 4HXEB 2OVBA 3D8HA 4IUDS 1ZMXA 1QWSA 3HVUA 4OXNA 1KO5A 3WBBA 2JGRA 4ZOQI 1X70A 4O3MA 1X8XA 4WH0A 1G9SA 4Y2HA 1VGQA 3UC5A 3D8TA 2HSEA 4BATA 3AKDA 1P2BA 1ZVKA 1FVHA 4EFMA 1P0IA 3DC7A 4OQXA 1C8BA 1KAGA 2BI7A 2JDIA 3H6HA 4GLBA 4MPRA 4OM7A 2TMYA 2XZPA 5DISB 3ZTWA 4YRKA 1TAUA 4OFXA 4LHSA 2JGNA 1TAHA 1XU9A 2YS6A 1P0CA 1EUDB 4XXHA 4ZOAA 4CGZA 3GQBA 3H5LA 4HQRA 4BGVA 3GT0A 1KO1A 2C78A 4XEHA 1KHTA 1NKSA 2GESA 2C2ZA 4PYIA 4EM6A 5HFNA 1KYZA 4DCPA 1QDLB 2R7KA 1JWAB 1UMDA 2O8BB 3M6XA 4CHTA 1PL7A 2W00A 3WKBA 1R66A 2OCLA 4KHPB 1IQ0A 2ZBPA 4YREA 3KYDA 1T5BA 1ELOA 3HKBA 1P1CA 1E79A 5T64A 4IXTA 4IJKA 1QB8A 4QDZA 3ZJVA 4H7IA 1H4QA 5KREA 4PX5A 3U7EB 5K4HA 3I8XA 4QOJA 4MYSA 2FAXA 4ZQHA 1XCJA 5FOSA 4UATA 4KE9A 2FK7A 3DAPA 3NT2A 4PZLA 3ZZ0A 4G5RA 1X1BA 3QVTA 1ZUWA 5AYVA 2HKIA 4NE9A 4Q4HA 3ER6A 3TLZA 3U4AA 2DF8A 1EB9A 2AYXA 3ZHSA 2OQRA 2JJ8A 1K27A 4B3DA 1I7QB 3ZDCA 2Q2OA 5AW4A 4WWHA 1M7HA 1X2BA 1C9EA 1GLVA 4X8MA 1E32A 4IOKA 4Z9XA 2PFGA 3S29A 4D9KA 3VR4A 2IHJA 3RU7A 2VF8A 1UJ4A 3GA7A 4MW4A 2GN0A 4U2KA 4CM7A 5HM8A 4TT3A 3VR3D 2Y05A 3EQ8A 4JGBA 4MICA 4MIOA 3TOSA 5K8TA 3QELA 1SVWA 4JLWA 4OFZA 3AETA 4WKGA 4Y8VA 4O6VA 4Y0VA 1HQCA 2PZAA 2WIAA 3PFWO 5K6TA 1D6SA 3T3MB 3MT0A 3PPWA 1MGOA 3NHRA 4P4UA 5CD9A 1BJKA 2BC9A 2GZ3A 3E0QA 4K9DA 1HSZA 3NWJA 3OTHA 4HGPA 2PD6A 4K9LA 2I9KA 3IOEA 3DMTA 3MZ0A 2JBAB 3MAAC 5F33A 2VNSA 5E6RA 1GQRA 3OMWA 1QHYA 4PLCA 3ZZUA 3UIEA 4B31A 1S1MA 1U2PA 4GO1A 4UUMA 2LCFA 2E5FA 3LGSA 1P0MA 4DIUA 3HKCA 2YFHA 2PK3A 4KPGA 3B1JA 4QSMA 1FDTA 1J4AA 1YC2A 5BR1A 2YJGA 5TEVA 3QJ5A 3CLHA 2GETA 4B87A 1O4VA 1LXCA 3ZV4A 4CM4A 4D0RA 1UM9A 4OB6A 4YDQA 3IVGA 2G4VA 3WRXA 3TF5A 4BQNA 1H9CA 3PRKE 1J2JA 4GRIA 3E2IA 4XSHA 3TKYA 2XYPA 1Z38A 4OREX 1SM4A 2FWMX 2VSFA 4JB8A 3K9LA 3FOZA 5D7BA 3WIDA 3KZOA 2PQ6A 4BRZA 3K9NA 1K9VF 3TLEA 1ZXLA 4Q18A 5EEGA 1XPOA 4L6AA 3GRCA 4JLAA 1Y6JA 2RHRA 2P75A 4IDBA 1T8WA 3A28A 4B1FA 1Z9BA 1AKTA 2AI2A 1F2UA 3W8NA 2ORVA 2JFBA 3IMEA 4DL9A 1RBMA 2XWBF 5K2OA 4V0OA 3RVJA 3L4KA 1OYWA 3AVXA 4G4SP 2JLBA 3RPEA 3X44A 1R4NB 4WY8A 2X7HA 4DCTA 4G1MB 4KUHA 5ES4B 1OT3A 3OZVA 4TYMA 4ZYZA 2QTHA 1Z6AA 4Y2GA 1PYOA 3PXCX 4ZPXA 1C0LA 1YA6A 2BZGA 4HUJA 4EGFA 4ZV4A 1LUAA 5GAJA 5KYXA 1L5QA 4JUAA 4MK4A 3UKDA 2D0OB 3MTQA 4RVGA 3T7RA 3GRAA 1L7AA 1KPIA 1PJTA 3TTVA 3FCOA 2AUMA 2A5FA 4V0NA 4MO2A 1UT5A 2EWMA 2RD2A 1VSQA 1KYYA 3LXMA 2K6GA 4LYAA 3C6KA 5H4GA 2HFJA 1T0BA 5ALTA 3TQQA 1V6CA 2NZYA 4IDNA 4OQLA 4BECA 1G21E 3G5TA 2AC4A 5IT9A 1UPUA 1P4SA 1XB2A 1I7NA 3W6PA 1FBTA 1NJGA 5ALVA 4DBLE 2CLKB 4LNUA 2H29A 5TQ2A 3IERA 4ETWA 4XX1A 3CLVA 2EGUA 1USIA 4EG5A 2AX4A 2JHFA 2VEDA 5CA1A 3PI7A 3E7PA 1MABB 2W4IA 2VR1A 3H84A 3OKCA 4MJLA 4CUKA 1XTTA 4MRMA 2BHNA 3UJ3X 1K4KA 3KSMA 2BGKA 5TQ0A 1SOAA 5BXYA 4JEMA 1ULAA 4BV9A 1KPHA 1BFDA 1IC6A 1U2ZA 2CNWA 3CC8A 3PIRA 1C14A 5TDHA 3RVOA 3FUXA 3G79A 4HVAA 5FP0A 4EI8A 1KDZA 4EX7A 4G9BA 3EODA 2OECA 5DSTA 3MEQA 5CGZA 5EWMB 1ULZA 721PA 5BMVF 2XR1A 7REQA 4OXYA 1G8MA 4ZHQF 5ARDA 3RR2A 1EVYA 3KAQA 2J4FA 4DWVA 2XTNA 4CMKA 1BYUA 1RLIA 3HZZA 1SKQA 2XTAA 2BLLA 1QMGA 1WW8A 3LT4A 3QLJA 3QV2A 1WP9A 4IIUA 4MP6A 4BIMA 2V03A 2OCGA 1DUVG 1L4BA 2GF0A 3DHWC 4GZLA 4MIYA 4BNVA 5LWQA 3IGFA 3ONEA 2J9FB 1C9YA 2XE4A 3OE5A 5DDIP 5JWHA 4C7KA 1EP1B 4WXRA 2R8XA 5IVKA 2ZWVA 2GCEA 4WADA 5BSHA 1E8MA 3CNLA 5GONB 1B41A 1IY0A 2H2DA 2XYGA 1J90A 3HPQA 3P45A 4LXTA 2Y0DA 4OKNA 4X7PA 4EHLA 4GZ6A 2ON6A 3N86A 2BKEA 3NMUF 1VTKA 1HDYA 1GPBA 1WKBA 3FRJA 2YCBA 2DRIA 1L5WA 1TMYA 1HTBA 1UBOS 2BHLA 3IV9A 2AMVA 2QRKA 5FAKA 3A9RA 4RPHA 1E96A 2O1WA 1PNRA 2QL9A 1ESDA 3K8YA 3PJDA 3THXA 3IQDB 3Q3CA 4FTWA 4O3FA 5DBGA 1JJ7A 4JIMA 3NTUA 2O3QA 3KHTA 4EY6A 2O54A 3H8VA 1U2GC 2ZRMA 2QN6A 2Z3VA 1WCIB 4PZPA 5FEUA 1RTTA 1E2HA 2I1LA 2E18A 1RQ2A 5EZYA 4MGHA 1H42A 1CT9A 2GN2A 2OAP1 2GWHA 3ZNQA 3WYAA 3LOPA 4ZMRA 4NXNB 4GVXA 3P20A 4OG2A 2H4JA 4KV7A 1WE2A 2PE5A 5AUNB 2XQGA 4G5YA 3P4UA 1Y6GA 4D9JA 3HWX1 4TKVA 1ZLXA 1ZJYA 1ZK2A 1MJ5A 1Y8QA 4AJ1A 2OP1A 2ZEJA 3PXXA 4RHYA 1K06A 5I7OA 3R4CA 2DGDA 4EVSA 1PEDA 4KVGA 4L8YA 1V96A 3GBSA 4OHFA 5G53C 1SAYA 4UTVA 3AL0C 1PR0A 3CRZA 4UU1A 1O94D 2Z98A 4D82A 3VNSA 3N2YA 4QG7A 2J9FA 1RAFA 2QL6A 2IYWA 4PYRA 4ER6A 4MMYB 5FTKA 4FDAA 1YGYA 4LC9A 3VVBA 1Y9EA 4R2HA 2RGEA 2R00A 4AO6A 1Z75A 2P2LA 4YRBA 2F48A 5CFZA 1PGOA 2XD4A 2GT1A 1V25A 4P0QB 4HLCA 5FFFA 2ZIEA 1OQAA 1NVVR 2P77A 3WQQA 4OP1A 2ZYUX 4BO0A 3ONWA 5FBWB 2TECE 1XXHB 2IUTA 3RUCA 1X7DA 4ZJPA 4FX2A 3SI7A 4MPJA 3W9UA 4P3YA 4OK5A 2QMHA 4LDZA 1HT0A 4S05A 3EAGA 2IQIA 2WJ6A 1ZBQA 3AOGA 2IL1A 5SYNA 1POXA 2X0FA 3RWBA 2I54A 3UHJA 1W25A 2VYVD 3ND9A 4PSCA 2XB9A 3ZWCA 4PY2A 8GPBA 4UFNA 1TUEA 4FOSA 3NT4A 3ZBTA 1OF1A 3IKTA 4M76B 1PDWA 4DZRA 3KQVA 2JKZA 2QD1A 1BN6A 4KZPA 4UTXA 3KEQA 1GPUA 1QVRA 4JBWA 1KJYA 5F35A 2V7BA 3MWLA 4KG7A 1DX4A 1DCMA 2J5BA 1QDUA 2F2TA 2L82A 3NJ8A 3O8NA 4ID3A 4OHVA 5E2IA 4BTEA 3PYLA 1WQ3A 1CW2B 4MJ7A 5GJVC 1MFPA 1T6BY 2B25A 1I3NA 4NAHA 2WBLC 4TVKA 3V7FA 5CVJA 3RU9A 2R0QC 2R6CA 3LCCA 4FE3A 5DP1A 3O95A 1Y3DE 5A3VA 3UAYA 4ZZ1A 4F9TA 2FY8A 1CCWA 4O2BF 3FPJA 4YBZA 4D25A 4DMLA 1MF7A 1YIAA 3NTVA 3SQDA 1BHQ1 1MEJA 1OWPA 3U6BA 1W9MA 5JC1A 3KPJA 4GMHA 1MRSA 3WISA 1V5FA 3L7JA 2YIJA 3OFVA 3MWGA 4RFSA 4ZO6A 2GILA 2X1HA 3HP4A 1OXMA 5C9ZA 1I1NA 4YAWA 5ECGC 5EE9A 5LD2B 1JLSA 2J45A 4MS4B 2OMKA 2YYYA 2Y71A 4J4BA 1M76A 3S0JA 4KX5A 3ET4A 3FETA 4QBIA 4XDYA 2H9YA 3AB3A 1SVKA 2AV6A 5EFZA 2I91A 4MIKA 3BWXA 3SHVA 4PQEA 3QBEA 4ZCIA 5BN3A 1CDOA 1V6AA 1M8FA 2JI4A 2JFGA 5F64A 5LYYA 1ATZA 1TYZA 3BIJA 5FADA 2ZM5A 3HM2A 4MRAA 2X5JO 3KUKA 2QZZA 1KYIA 4COOA 5B4TA 1I2MA 2ORYA 1EESA 2NYUA 3MUFA 3BJEA 1KMHA 2I67A 3DVAB 3LUGA 3VTKA 3QE0A 1FDUA 1N4DA 4R71A 2GF2A 1PT5A 3KWFA 1EHYA 4RVDA 2BF4A 2DTDA 2PRZA 4QDUA 3WIUA 1JR3D 4EIWA 3D0RA 5LM3A 4R40A 1EYZA 1CUUA 2CUNA 2PKCA 1KGSA 3PCXA 4NOJA 2CUTA 3U49A 4CMJA 2VF4X 4F96A 4XQ0A 3PNKA 3H42B 2JGLA 3EPPA 4LYDA 5IXSA 1EBUA 3TLBA 4HEHA 2WHEA 4MS4A 3NBMA 1H8ED 3RS7A 4OSOA 3HVRA 5JATA 3OC0A 2ZJFA 5K01A 2PPLA 4I2VA 1T8RA 4V0QA 3FE2A 4YCCA 4CFSA 1JLHA 1D03A 1OYOA 1H0SA 3MF4A 1LTQA 2REQA 2RHMA 4JP2A 4S1WA 1QV7A 3RUHA 3ZV7A 3NRCA 1LVGA 3WZLA 4CFYA 1K7YA 3O4JA 1C3EA 4CIYA 4OHUA 1II8A 1X7ZB 3EAFA 2W2NA 4P38A 2GD6A 1OX4B 2D2VA 2NTNA 4G09A 4IUYA 2EEPA 2P9BA 4R2LA 1VCHA 2QJOA 1SIBE 2OZLB 2RI0A 2YYZA 5D01A 2ORWA 3G6KA 4GZ3A 5THQA 1E2IA 4EMBA 3LY9A 1L7NA 5CIQA 3OETA 3OZDA 4N7BA 1SA0A 1ULUA 3QVMA 4Q6WA 5TF4A 4GX1A 1SUCA 2QI9F 3DTTA 1LZLA 2HAEA 3OQMA 3EWAA 1ND5A 3K8ZA 2QW0X 1YBVA 3ADBA 5COBA 1GEGA 3SE7A 3M4NA 1JIXA 2QX4A 4JEUA 4OQYA 3IP1A 4L74A 1ZCFA 3JZIA 3DYBA 1XR3A 1ENPA 4RNDB 5TY0A 3VHQA 1NW3A 1IL0A 1QZ3A 4CWAA 2QTLA 2OENG 3L46A 3LZCA 4B6FA 2F59A 2BWJA 3LPAA 1XDUA 3GJ0A 1U02A 3NYRA 4KACA 1G63A 1PAUA 3IR5A 2CDBA 4ENUA 3T3OA 2NN3C 2G40A 4I3FA 1T2NA 3I72A 2Q3DA 5I9BA 1BE1A 3TSAA 3MUOA 4PW0A 3DE2X 5IKMA 2D5IA 3N74A 3YASA 2AYZA 1N6HA 1P73A 4NDNE 5ALNA 4HDQB 4B5LA 2V3WA 2L69A 4IV5A 2IGTA 4CKXA 2CXRA 1SCBA 4WXHA 2QRNA 3EDCA 4R4JA 5T6MA 2XVAA 5GINE 3UH1A 3RHSA 1UR5A 2EKBA 1H2RS 2UVPA 1A27A 3F6EX 1GCGA 3PXBA 5CJPA 3RSFA 1TVKB 2PRIA 3K1TA 3UK1A 2J0QA 1S4QA 4U7DA 4F1KA 4HFMA 4YMTA 2B30A 5LP6C 3DOFA 4G65A 1EHIA 4AIIA 2G9VA 4MV6A 3DMPA 4BE4A 3BF8A 1C1XA 3GDFA 1DG3A 4P35A 4BV8A 2ODNA 3JWIA 2GPYA 4WFQA 5TMDA 3T5CA 5JALA 5ILOA 1MORA 1Y8QB 4HTFB 4B34A 2KBEA 3LFHA 4XOUA 1WHTB 1R5BA 2JFOA 2XEDA 3OZRA 2ZVDA 3EA5A 3WMFA 4B3RB 2ZXFA 1L4FA 3NEAA 4DA9A 1ILWA 2O7NA 5DGHA 3RV3A 4MB6A 1T25A 2RHWA 1LFDB 1KI8A 1LLDA 2GMWA 2XF8A 3BEDA 4HDCA 4EFDA 2O57A 3OJ0A 4M1EA 5EPEA 4KPEC 3T9AA 3PFCA 3BORA 2YFYA 4PZCA 4Z0HO 3QU7A 5JAIA 2ID7A 4CXMA 1CY0A 4AXBA 1J5EB 3WGQA 4TV9B 3B82A 3SBEA 2GZDA 4X90A 3TTXA 3SQLA 2DPHA 1Z22A 3MWDB 3P9XA 2WMOB 1TX4B 4QYXA 3A6PC 4RH3A 3W5VA 4OYHA 4YMLA 2VPTA 3DB1A 3I1IA 4M1ZA 2BMFA 3ZS9A 2A57A 3MELA 1CHNA 1CJMA 2HI0A 4KO4S 4R05A 5FO0A 5BT9A 5SZKB 3AESA 3R9WA 1PZHA 2C2YA 2ZKLA 2ZTHA 3UVEA 1W73A 2Q27A 4ESVA 1DS6A 4OO3A 3I0NA 2HZ7A 3QEKA 1LGYA 2CJFA 4NBUA 1CZNA 4RGQA 3GJ4A 3PNVA 1P39A 3IYLW 4CKCA 1G9XA 1S9HA 3U4HA 2IU3A 4BVKA 4YC7A 3DEJA 1QUFA 1JFFA 2DZDA 2A5YB 3LW7A 3CNOA 4KIGA 4M98A 3TKLA 5KNDD 5K5EA 1A4RA 5DGTA 2EBUA 1C3XA 5GVSA 4TWRA 1M1NB 2LCQA 3T3EA 2ZRDA 5DTIA 1JE0A 1XKLA 2PY6A 5HWSA 5B1SA 1ABBA 5FPPA 3BAFA 3ZWKA 1V1RA 1E18A 4BNKA 1T9AA 4NFYA 3RRZA 2XE7A 2VFAA 1R8JA 1R8SA 3RASA 1TQ6A 1YOBA 3ZY6A 2IV3A 1L4YA 4L02A 2Z5FA 3N2GA 5D3QA 2W6NA 3RWOA 3JYHA 3LGAA 1RAEA 2CW5A 4W1SA 3VNAA 2WJIA 1IIRA 3GUZA 2GZ1A 3WV5A 3Q3JB 4BO9A 4ZK2A 1Z3IX 3FVQA 2NM0A 3GJTA 1D7AA 1USGA 3RROA 1Z4LA 3AF4A 3AZPA 1JMVA 4LXYA 5EJ2A 4A6PA 1HG0A 2Y27A 5ITSA 5LDHA 4ATNA 3SQXA 5LQJA 1CDZA 4TGLA 1E62A 2GCPA 4L8WB 4ND1A 4I46A 1E99A 1E1YA 5AI4A 4MMZB 3BIOA 2OXTA 5DV9A 3K0FA 4CF4A 2GA9A 3PVCA 6GPBA 5EJ4A 1SZCA 4IFEA 4BC1A 4V38A 3S2IA 2WKPA 2GTHA 2EKDA 2HSZA 2VT2A 1KK0A 5KKAA 4DHEA 4BRUA 1YR7A 3K96A 3KTAA 2CT8A 1EHCA 1P75A 1YS6A 2GHRA 4O8ZA 4B84A 4DWJA 4HDMB 5ALJA 4LX0A 3UJNA 1MX9A 1AK9A 2OZPA 1NJ5A 2PZEA 4Q1CA 4V39A 1NVTA 1X74A 2HHAA 1SC1A 4TRRA 2QPTA 2N1BA 4UBIA 3JQ6A 1AUXA 3DV0B 3OZXA 4UW9A 3RNOA 1NONA 3MMNA 4E22A 5AKKA 1PNQA 2AXPA 4MDEA 2G82A 2ZAYA 4RY9A 1PF7E 1XFDA 1M2VB 2C9ZA 3BZBA 3D54D 1ACMA 3EYAA 4IDPA 5IZCC 4AF7A 1Z73A 2FN3A 3O1HB 5C5EA 1J8VA 2Q3BA 2NVWA 4UDOA 1M67A 4BEBA 4MJXA 2Q1SA 5TMEA 1BWPA 3T3GA 4E7OA 1IQRA 5KYXB 1XKQA 1JL3A 1OH6A 1WAMA 3WKDA 1H93A 5C32A 1GPAA 1GAQA 1E4VA 1JPUA 1UBTS 2B1QA 1JHPA 2KB0A 2N0SA 3OCJA 4GT1A 4URZR 3UWKA 3NI2A 3AR6A 1D8TA 3DO6A 3X0DA 3PNOA 1OXKB 4K87A 1CNEA 3ROXA 3ISJA 4A0FA 2VZEA 1YQDA 3HRHA 3UZUA 1TW3A 4OGGA 3JAWB 2AGVA 3S5UA 3THRA 4H7JA 3HO1A 1C9KA 2EX0A 1DU4A 3DW1X 4Z9AA 4HOYA 4A6EA 2LD4A 3WIEA 3PD0A 5HA5A 1Z56C 2IP4A 3HKBB 3DOHA 4FI3F 1VYTA 3AW8A 4LEIA 4ZDKA 2H1FA 4XVRA 4NOMA 4EW3A 1FYXA 2D6FA 5IJWA 3LBIA 4MRRA 1QFXA 1AQYA 3LKVA 3NRBA 5BYKA 3WK6A 3E1KA 3IAAA 3IRUA 3V8NA 3BQ9A 4HATA 4COKA 1QO0D 3CU5A 4ZYXA 2XLCA 3IMFA 1L5ZA 1NULA 1BXRA 3LFTA 4KVZA 3HU2A 3IPYA 5F7XA 4M83A 4EYQA 3I12A 1O87A 3P0FA 5LU9A 3AFHA 1EUDA 1NXWA 1EWTA 4LE1A 4Q3KA 4Z54A 2K5UA 5PNTA 1QG0A 2PLNA 3EJWA 2A58A 1IB0A 4B85A 4FHEA 2BTQA 2WHYA 1WS6A 1UBLS 3IQXA 4NNOA 1DWQA 3S99A 3PWZA 2HB6A 4D9GA 2FU5C 5HVNA 2C5AA 5E2BA 2A9FA 4M1YA 2JI9A 3C5CA 4HCJA 4LWZA 1T91A 2P6PA 2Q3LA 3AR4A 4YS6A 1O94C 1ZD8A 1K6XA 1T5LA 3P52A 1CZUA 2NXWA 1ZCZA 1T2VA 2ZRQA 5DNVA 3LX6A 3RM3A 4IGFA 1QJ4A 5T8KC 1FXWA 4UXHA 3EXAA 3R7DA 3AEQA 2BMDA 2WFZA 4PYQA 2GFIA 4C7OA 3IDFA 3N6RA 4OOEA 4JI7B 2D1RA 3VR3A 1G2PA 3I6MA 2BMJA 1NNUA 3B52X 2QXYA 2X2OA 2G5TA 4WCFC 4ZODA 5FRDA 2IS6A 1HE1C 2PKRA 1N6KA 2O48X 3NV9A 4H7DA 5E1MA 2IPMA 4LMPA 3G0CA 2GYYA 3L8FA 4JQSA 2BE7A 2XUHA 2PUGA 2FMKA 3HSYA 4YAJA 1NFQA 4I1UA 3LL7A 4XIIA 3R5SA 5CHEA 5IKPA 4MKXA 1GL9B 4FYVA 4NCJA 5F1KA 4D9IA 4EKNB 1E98A 3QU9A 1XTSA 2L17A 3LV8A 2YRWA 1SPXA 3KZKA 4L4UA 4CCYA 1VI5A 5H5JA 4CCAA 1DXYA 2YWFA 1LBTA 1XA4A 3D6UA 3PR2B 2PWBA 2E9SA 4GLFA 4MO9A 4TMYA 3KDAA 5AVKA 3TYXA 3MQ2A 4IGEA 2VOEA 4KVAA 3ZKAA 4XVHA 3IEIA 3EZNA 2CMKA 3QI7A 4I5DA 5EP2A 5B1HA 3WDMA 5D6OA 4OHCA 3JQFC 3VSEA 3W2FA 2A4KA 2MWMA 1QR6A 1ZZEA 2IS2A 2AKAB 4W63A 3R6WA 3O74A 4LHXA 4JASB 1FYFA 1CRQA 1G66A 1WVIA 3IOCA 3SYRA 4KLAA 2HUNA 4L9AA 2C5LA 3UA3A 4BL5A 1CIVA 1I33A 4BMZA 3AUFA 3OPMA 3SIPA 2ZE5A 4PO3X 4ARBA 4CQJA 3REGA 1TM4E 4HGYA 5I9IA 2ORIA 2QQEA 3HJBA 2OM6A 2ZRPA 4R69A 3PXAA 1QZTA 2EYUA 3T9BA 5JDIA 3D7LA 1T9GS 3WRWA 4P4SB 5IH3A 4Q9LA 3ZWNA 3NM5A 1DC5A 1LSSA 4YRNA 3DE7X 1Q7TA 3QFSA 4ZANA 1JA0A 3ED5A 4NL4H 1B8OA 1BHO1 1RWOA 2XAAA 1GUDA 3DAYA 3GX1A 3OP1A 4O5AA 4UMVA 1OJLA 3CKLA 1NWCA 1W4BA 2I3ZA 1Q7BA 3IKMB 3JAKB 4NCIA 1RWPA 1XTUA 2GBIA 5L3ZA 4DNFA 2IBSA 3GFPA 3RSQA 1DB3A 1VIAA 2HL6A 2R1VA 5K6RA 4BX9A 1RYFA 2H65A 2RHJA 5EHXA 1U2DC 1JYEA 1QHHB 3EC2A 3LLUA 1TMGE 3I30X 1Q0LA 3MBIA 3WLAA 5IYZA 1EFHA 2HJRA 5LYJF 1HEUA 2AFIB 3C8UA 5ALYA 5LUBA 4U9IS 2HF8A 4JXJA 4RSRA 2V6IA 4GMGA 4M9UA 3MK31 2EV9A 1L5RA 2Q4EA 4BTLA 2XNCA 2NW6A 2PS0A 1XCLA 3NDPA 3S3TA 2CE7A 5JAHA 5GADl 4D8UA 5IDWA 4I1OA 1Q83A 1W1WA 2OHGA 1Z25A 2ZB7A 1ZSVA 2CLHB 4FZVA 3BRSA 1NMEA 2HMUA 1M0TA 3G5LA 3H83A 3ITDA 3MCAA 4C78A 3R7WA 5F9FA 1AY0A 1TIPA 3B60A 1UFQA 3QXHA 4U7FA 3X2FA 1YR6A 2DTEA 2FP4B 5KCMA 4QT0A 5A9RA 4C3OB 1RACA 3OOJA 1JHZA 4ISBA 4ZDWA 4ZZIA 3A2KA 1PS8A 1F0YA 4YCNA 4WBXC 2VAXA 2WTNA 5B7GA 4RMIA 1Z29A 1SU7A 1GUBA 5LP6B 1NN5A 1I4WA 1B8PA 4ZMBA 1QHFA 3USZA 1I10A 2GVZC 4ZZ0A 4HNUA 3LK6A 3ZCSA 1GO2A 5DHFA 1E0DA 1JWLA 3WWEA 2VP3A 3LRPA 3WYBA 2PR7A 4YJ3A 2VH2A 3ORRA 3BGVA 5KBYA 4BB9A 3IAS6 2GAAA 1Y4ZA 4JCCA 5ABPA 1IG3A 2BEWB 3ZDFA 5FTWA 3Q4GA 4ZVQA 5TT1A 1F8YA 2WSSD 1MR3F 3QLTA 4HWTA 1PR1A 3BJZA 3WWDA 1YS7A 3L0ZA 4EJ6A 5BSMA 1TUIA 2QK4A 4YVFA 4Z5XA 5MGBA 2NU6A 2G5PA 3I23A 4BVEA 5H9WA 1J99A 1G8KA 1JEJA 3NBAA 2A0WA 3DUWA 4L2IA 3VTFA 1WSBA 4G85A 2P0EA 3GA0A 2XVMA 1GYQA 3JPWA 1FDVA 1NZDA 1E9DA 2RBGA 1PKEA 3ZHUA 2ZBUA 2MSNA 1X1TA 2QXTA 3PJEA 1M54A 2YN4A 1OPRA 2APJA 4V1CI 5CJ2A 4ZYVA 2UXDB 1FUKA 4H2DA 3VZRA 1BS2A 3COWA 3DEIA 3TRFA 4UCXA 3STYA 4Q4CA 2VXCA 2YRFA 5H81A 3SP1A 3D4IA 3RJTA 4M1WA 1JG3A 2ZVPX 5DN6A 4OI0A 1KYTA 1O7JA 1IZZA 1P7ZA 4ND6A 4JB0A 2V65A 1DQSA 1DV2A 3LW8A 1M6HA 4GGPA 4EG7A 5KNBA 1ZD3A 1SXHA 1ZKMA 2IYTA 4RYLA 5KJCA 2JZOA 3DLHA 1RYDA 4JD5A 5A4KA 2E2WA 2Z30A 1VHDA 4OUDB 2VT7A 4PXYA 1OZ0A 4RFLA 1VKRA 3T35A 1H3NA 1CHDA 3JCZA 1HE8B 1IVYA 1E59A 4WMLA 3TZKA 2BFMA 1R88A 1U3TA 2JFZA 4DM4A 3WSWA 3ELYA 4B6RA 5A0VA 3IP5A 3UQZA 4V1CB 2FW0A 1C4KA 6AT1A 1BKDR 3PC4A 2EFJA 2GM5A 4PLTA 2AR0A 1VYUA 2VUUA 4PGFA 1JSLA 2ZUWA 2V98A 5CCXA 5H70A 1RFGE 2F1KA 3C3BA 1JHVA 3V4OA 4ZEVA 4XJSA 2JLXA 2JNWA 4GAEA 3A26A 3NZEA 4PAOA 2HEIA 1ZN2A 4LKRA 4EF6A 2OV3A 2VDJA 2VYND 3OEHD 3VSBA 3QZUA 3BSFA 3K0CA 2OGZA 2PXAA 1IAVA 4NCNA 3KK0A 4N3BA 4ZT2A 4DSAA 1XZKA 5AW2A 3VZDA 3KKQA 4L6IA 3N0WA 2R8ZA 3QNMA 2WYUA 5IUNC 5DK6A 1Q74A 4DBZA 5LQNA 4H6VA 4MZDA 1W5SA 10MHA 4MVJI 4B7AA 1IHXA 1E1MA 1W4ZA 2HK8A 1EMDA 2J7PA 2VJAA 2R4TA 2F9LA 3EULA 4QUEA 4IYRA 4RIFA 4AZ3A 4YRMA 3LXRA 4R84A 4REMA 1BNCA 1ES9A 1QO7A 3I05A 3RHZA 4KK4A 5A03A 3BZUA 1S8FA 3OO1A 3AX6A 5KKNB 2P4SA 4UAUA 5LQKA 3NNNA 3O83A 4FZRA 4Z53A 4DMFA 1DCTA 1XMPA 1T5HX 2I7CA 5IF9A 2I2WA 3DNPA 4RBNA 1CY1A 3PE3A 4AY5A 1U7DA 1V3QE 2Q5FA 3DT8A 4GKJB 2X86A 3ST7A 1AS0A 1JFRA 3DMRA 4LYGA 3LPCA 4IFTA 1SCKA 3VUEA 5LL6P 1HQDA 5CEFA 2C1XA 2PTGA 3VDMA 4J0FA 1MG5A 1IXKA 1OWNA 9ABPA 1PV2A 2PN1A 2YHIA 1R00A 4D99A 1IH8A 4OQZA 4D9MA 1YL7A 3PEEA 1PZMA 4D4GA 4IDQA 2AE2A 1R4ZA 4JROA 1Z7EA 1KVTA 2W2LA 3C98A 3H2HA 4NU8X 4U2DA 3MJSA 4F21A 4NPCA 1M8PA 4EMTA 1JG4A 3E03A 5LQCA 2NPIA 2WYVA 2P2GA 4DLWA 1TTPB 1VQ1A 4OI1A 4R1MA 4ZQCB 4PM4A 4O33A 1J1UA 5DBOA 3NKVA 3D1LA 3MG9A 4DT1A 1RWQA 3LSTA 1G60A 3GFBA 3PNMA 2R6DA 3GN2A 2DY0A 3GP3A 4ZI7A 4FOLA 1ID1A 1Z36A 2VDOB 4WKOA 3ZZTA 1PL8A 2VXYA 5BSRA 2XA1A 1DBPA 1S3IA 3D3QA 1B3BA 3BG5A 2X4GA 3GRPA 4YMSA 3SU8A 4CG0A 4E2XA 1S8OA 4N7RA 4CPDA 3HCBA 3K2EA 4KH0A 4TROA 2QSUA 3DPSA 2P5SA 3GUHA 1WTCA 2TMGA 1EVLA 4X8LA 4Z2AA 4NU0A 5A4MS 1Q0UA 1X1RA 3ZIAD 3NEJA 1NPYA 2QX6A 4JUFA 4CF7A 1L7EA 1LY1A 3D6MA 1KQNA 1BDBA 1OAKA 2C4HA 5TIIA 4PPYA 3DMDA 3O7MA 1A04A 4JOSA 1VFNA 4BY9E 4YO7A 4HZUB 1E2FA 4HZUA 3VU1A 4PLFA 3CPEA 4CHGA 4ZU3A 2P0AA 3VH4A 2PRJA 3NAGA 5KDDA 3PGJA 3PQFA 1DEAA 1EE2A 3TUJC 3OFSA 1WZEA 5E4FA 4TUYF 2QT0A 1UCFA 3A11A 4ZOBA 1NHGA 2Y77A 3D4PA 2OBLA 4S2UA 1L5LA 3VBEA 5JZBA 2RC6A 3K1ZA 4KN5A 3QMVA 4XCVA 1K3UB 2HSDA 2Z2KA 2MSDB 4ZJUA 3T9FA 1UXGA 1E5VA 1LW7A 2EATA 2WR8A 4JITA 2AR9A 3CPJB 3WHKA 3MTAA 4Q1DA 5AD1A 1NRIA 3M34A 4XDHA 3MWEA 1I3MA 2D3TA 4RF5A 2V0CA 3JZDA 4E7PA 4KRXA 3KT6A 5C8DA 5LQUA 1C29B 2I33A 3H1TA 4AI6A 3NHSA 1GSIA 2AZTA 1UUFA 3U80A 4D74A 4UCWA 5TRTA 1FEZA 5B37A 2GRAA 2FZGA 3CZ5A 1BA2A 3VI4B 3UUEA 2R48A 5ALKA 1VLLA 2OESA 5AVZA 1CERA 4DQKA 5BR8B 3BDIA 3RSCA 2VI5A 2HV8A 5D2CA 4M22A 2IEIA 4HLUA 5BV1A 1JXAA 2GPJA 3GUUA 3TBHA 1KZYC 3ZGLA 5HW0A 3EFBA 4X1YB 2FSGA 1S2GA 4J2HA 4JFAA 3OQPA 4NE2A 3PWTA 3DKVA 3DE3X 4N18A 1RJEA 1YTUA 5L40A 2BHRA 2YXEA 1U8CB 1VG8A 1DC8A 3KHKA 3AW9A 2CFTA 3E05A 4MVWA 1IONA 1C80A 3KQLA 5KYVA 4JL8A 3KETA 1L2TA 2NU8A 3U7RA 2W6QA 4K3UA 1GKKA 4CJXA 1C3LA 1F51E 4M8NE 1AC5A 1JVNA 1VLQA 4N5NA 1EVEA 1APBA 1PTJA 2HJSA 1FVOA 4LSGA 4B47A 1QJCA 5E1DA 2GYVA 2O2JA 1JPJA 4CN8A 5KWVA 1NPTO 1UXHA 5F51A 1PSWA 3TS1A 1XZGA 3TXXA 3SEQA 3UAVA 3G2IA 2BFWA 4PX3A 4ZO9A 1K3TA 3AY0A 4J0DA 1I32A 3GOHA 4NX2A 1GPNA 2W8ZA 1KVRA 2X5KO 3KEMA 2QAGB 1MAUA 3I04M 5I5EA 3B38A 4WZZA 1WW3A 1C1DB 1KI1A 4UHHA 1L3BA 3OPYI 1PK9A 1T6NA 2FUEA 1T2FA 2O20A 1YJ5A 3L6CA 1SVLA 4GZMA 1RPNA 1E7SA 3K0BA 4M21A 4AXXA 2FRDA 3CPHA 4CL0A 3OJFA 5DLDA 2N1MA 1YACA 3ESZA 2IEZA 2PPVA 4GQAA 3RC7A 1OJ7A 4JX9A 1AQIA 3U1VA 2R11A 5HQTA 2VYNA 5JI3E 1N5IA 4ZVPA 1NM5A 2DFVA 3OCZA 4XVQA 5EHNA 1KEVA 5JQGA 2AI1A 2Z8ZA 4CM3A 3MYRA 1AHNA 1TMOA 1U0TA 1P7YA 4ZA2A 3GW8A 1F8GA 5DWQA 3N3BC 1N78A 2CL5A 1WDMA 3DZJA 5FQNA 3DCNA 2X2FA 2PT5A 3GC6A 4BJ1A 3E5RA 1TQ2A 2AOTA 4XVUA 4IQ8A 2Y1DA 4UBOA 3OFKA 2JRCA 1RAAA 1TXGA 1Z4OA 3EK2A 3TR6A 2XQKA 3WV4A 4YV2A 3QSYA 4TKUA 4PIMA 5B7PA 1LPBB 5E3JA 1U5AA 4CFZA 3U5ZB 5F23A 4DMUB 5A4DA 3EAQA 4WD3A 1QDEA 5L3VA 3W9YA 1DIGA 4JQZA 3U7IA 3T54A 1XJ0A 3OZBA 1QIDA 1Q22A 2EDAA 2I2BA 3L8MA 4JLKA 4IIJB 2BM0A 3ZWBA 1I5OA 3DQQA 2CJWB 3AUJB 2VHUA 3QWIA 4FYXA 4JQYA 4LECA 3OE7A 3NH6A 2QIPA 4LIPD 3NDBB 1A76A 2YFKA 4URUR 2W90A 3JQQA 1YUMA 1GG9A 1ZI9A 3PUHA 2QE7D 2QJFA 3QYPA 4D45A 4REQB 3P2EA 2BDTA 3EXHB 4AY3A 7YASA 4UTRA 4E21A 3EASA 1IN7A 1OH8A 4E5UA 5HKOA 1TKRA 4ZOCA 3QLVA 3GIDA 4P34A 1WXEA 4RJKA 4UCQA 5AXBA 3ZE1B 3HCFA 3FHOA 5AK5A 3ZX4A 1E3TA 2HUPA 4M46A 3HA5A 4ZZ2A 4HQKA 4TPKA 5KJFA 3BE5A 4G1FA 1YJQA 4UHCA 4U6QA 4CTKA 4HDNA 4EW1A 3V1MA 2KS6A 5HCIA 2GPSA 3FAKA 3KPUA 5EJ8A 1D1SA 1QS0B 2ZXEA 2P0YA 1D0VA 1ECBA 2Q21A 2G9UA 2B3TA 2REBA 1KSFX 4NIMA 5DWVA 4DXAA 2H1HA 2ZRKA 5ALMA 5FWYA 6LDHA 4H0FA 3AF6A 3ZDBA 3HJFA 3KYJB 3O1JC 5HZMA 2WG0A 3D59A 4C6SA 2AFHA 3GPIA 5AW8A 1CDDA 1QIIA 4K46A 4KWIA 4RS3A 1UPCA 4RLHA 2QRMA 3SX2A 3C24A 2WHRA 1E8NA 4G0WA 1AKRA 1PGNA 5DGCA 1TA0A 5DTRA 3T99A 4E30A 3PRJA 2D8AA 1TJPB 2YWJA 4DMRA 5K8UA 1OPXA 2HJWA 1S5PA 4NZOA 4D6YA 1ADJA 3PNYA 3A9TA 3PQEA 3PHLA 4JBIA 4HNQA 1X13A 1NSFA 4L73A 2QTFA 3TRJA 2PUDA 2YZGA 1GTG1 1GQ2A 1PLLA 3M4ZA 4S04A 3Q6MA 5EJIA 1GPMA 2V7TA 5TV2A 4BPRA 1YB6A 4DFDA 4OHYA 2NX2A 4X5OA 2AUTA 1EA5A 3EIUA 4CL8A 5T67A 1FTYA 4DV5B 3EOBI 3K7EA 2WAXA 1WCYA 1HZZC 2BGMA 4UAVA 5JE8A 3B85A 4EJSA 2P41A 4WKCA 5AW1A 1TGYA 1YRBA 3MJCA 2V6FA 4DEVA 1A7AA 3FPGA 3L8GA 5IW8A 3JAMA 4P93A 5CH5A 4MUIA 5ER9A 3E7DA 2AJBA 4QA9A 1IOWA 3LG2A 3RNLA 2YN2A 2LTAA 3R6DA 3GEMA 3AU8A 4DIFA 1WPXA 1N0IA 3VYVA 5MFZA 3GDOA 5JAMA 2IHZA 3SAJA 4FS3A 3EZGA 1D07A 4LA4A 3ROEA 2W2KA 4DN6A 4XH9B 5ADWA 1R8YA 2JGDB 2F43B 4FD2A 3RVQA 2IUEA 4F7DA 3I9KA 2HNKA 4BNNA 1DKPA 1Z28A 1XNHA 2YBEA 3BDVA 2VDVE 3C15C 5ALWA 4ML3A 3DFMA 3SDBA 1C4WA 1WV0A 1N25A 1EK0A 1K4YA 3QBVA 5GOTA 3GJZA 3WMRA 4EYGA 5KQRA 1GKIA 2ZAIA 2QTRA 2NUTB 3NHKA 4MVJP 3GGGA 1R15A 1DGQA 4P5PA 1SXJE 1PK7A 2OR3A 3E70C 1FX0A 1ODKA 3F74A 5DP2A 1JLRA 1NXVA 2PGIA 1EEXB 4GXRA 5CK5A 4C4RA 2H4YA 4PFJA 3UM9A 3COYA 1OFIA 4EA6A 2QP9X 4M55A 2VPZA 1PO7A 2FSVC 3NNSA 5HFAA 3DJYA 4ND2A 4R6WA 3TR5A 1UK7A 3QBDA 1E6MA 1TZCA 1D2AA 1QMPA 1IQPA 5AKLA 3RB8A 2AK2A 4GKVA 1QFZA 1B26A 1P1KA 1NVDA 1GKYA 1U9CA 2C5HA 3E82A 3R8XA 4M6WB 1E7YA 2ZSKA 1P74A 2Q1UA 4EKYA 1TEVA 2ZRJA 4WLEA 1W4AA 2J3MA 4JVOA 4Q19A 4M8KA 3JQAB 1UFKA 1GTRA 4C3ZA 3MD9A 4RETA 4XZ3A 3SJUA 5KNDH 3PJFA 5FB3A 1LLUA 1Y3BE 1Q3KA 1OBVA 2JCYA 1J06A 3HSKA 2GK3A 4IHJA 1LI5A 1HC7A 4MUYA 4PN7A 2IH2A 1PCXA 1IHDA 3DBRB 1Y4SA 4UNPA 5AR1A 4GMDA 5CFOA 2Z2JA 2PCJA 4FC6A 4KIWA 1F8XA 3BMXA 3MHPA 3E8SA 2PNJA 3FHCB 1E79D 1ZGJA 2J9GA 2P35A 1P4GA 3LAWA 1F2DA 3MTGA 1X8LA 4DDMA 4TQUS 3RFFA 2C2XA 1S2OA 1I4OA 2H0RA 2PA0A 3PQ6A 1UWLA 2VQFB 2PJRA 4NXMB 3HNOA 1R9GA 1JLLA 3EVDA 1U7PA 4DC9A 5CFNA 2H5JA 3KOWA 4QRHA 2BFEA 3DCYA 4L7QA 5ECYA 2V7QA 4DQUA 4G89A 1OA0A 3T3DA 4C7OB 2WHQA 4D4MA 4QYMA 1B8UA 1QGYA 3TI9A 3A7EA 5KVAA 3B70A 5E38A 2YNMA 2GF9A 2YZMA 1PQUA 3VYWA 5DXAA 1G3RA 5JROA 2JDID 4K3VA 1F6DA 2Z2YA 3H5WA 2E49A 1FOEB 2R1VB 5ECDA 2QUAA 2B2CA 3DPUA 1YI8A 3P2KA 4ARSA 3EZFA 4RDXA 5JXGA 5FI1B 3MWFA 4W6ZA 3AJRA 2X2EA 1JAXA 4FU0A 4MYTA 3WZMA 3ZYZA 3GFRA 4UARA 4B0PA 2JVJA 1TJ3A 3M82A 1ITZA 1YZHA 1WY7A 4IR7A 4OJTA 4BLPA 4EYSA 1VPWA 1I3OA 1O57A 1FVXA 4V0MA 4QJIA 4UM9B 5C2JB 3FWHA 3NBXX 5E6SB 3A3YA 5GZ1A 2ZU0C 4XPIB 2J0VA 1QVWA 3NYWA 2FW8A 3IE0A 5CT5A 1BXRB 3W2GA 2QD2A 5CITA 2HBZA 1DKQA 4QM7A 1CE8A 2ZITA 1NJ8A 1VLJA 3AXTA 3ZX5A 2PX2A 4R5HA 1LLFA 2BD0A 4U7GA 3D0QA 5LBTA 3COVA 3W9SA 1K63A 1GDDA 2Y4NA 4HS4A 4JJZA 4EZEA 3B2QA 4BQPA 3C3CA 5DHUA 5EUMA 4NV3A 5KSPA 5BURA 3BK1A 1KZ7B 3ETNA 2MHCA 3HNPA 3T1OA 4MEBA 2B5WA 1Z35A 1JEAA 1U81A 2D2IA 3A1VA 3AG6A 5CAEB 4EYKA 1CYDA 3QNUA 2Y1LA 5DM60 3BREA 2WWTA 3KBOA 3ZXSA 3AI3A 4W8GA 1CUDA 1XZBA 5IMSA 4UMDA 1UZAA 2A2ZA 4MR7B 2VJNA 3N0TA 4HXGA 3S70A 2JLVA 3F9IA 2YIDA 5ILGA 2R96A 4E1AA 1VCIA 1P2TA 3OLZA 2NUPA 3EEIA 1ZN8A 3OU6A 3H8WA 3RBXA 4CGYA 3OFNA 2P91A 2M1XA 4KO2S 4MP8A 5KWJA 5CCBA 5BUSA 4CLEA 2KWIA 1PJZA 3OTWA 4G07A 4QUAA 5C4IA 4TVBA 3THYB 4QEDA 2QJWA 4OGLA 2BF7A 3NWPA 5CEEA 4CEHB 4KH1A 4LXXA 3TW8B 2NO7A 4I55B 5DNWA 2RI1A 4N40A 1B6TA 4L8FA 2AFVA 5B3JC 2YJTD 2AN3A 3NHZA 2RHOA 4B9EA 1TJNA 5EKUA 3WGTA 4RTNA 3K92A 4H6XA 3C5WP 1G7CA 2D0DA 2O8EB 1OI7A 1TW2A 1LA2A 3L9XA 4CF5A 3A8TA 3AEQB 2HTFA 4BQIA 4AZWA 4RGYA 1G17A 3A1FA 2FX3A 3HL0A 5DFAA 4C07A 2V8OA 4E94A 1BXZA 1HDGO 1TUGA 3OCXA 3U7JA 1NX6A 2G4CA 3LYAA 1JAZA 1VOTA 1VLVA 3ANMA 3QE4A 3BD9A 3GJ8A 3VPHA 3KPYA 4NBRA 3WXMA 2LGJA 3IE1A 1VB5A 1XYYA 2COUA 3GB9A 1P1FA 4GSLA 2II6A 5B2EA 1N9GA 5M7EA 4DA6A 1E94E 2XYRA 4IJWA 3F73A 1M6YA 3CNHA 4FLMA 3S2EA 4ABTA 1GAJA 4PLYA 3O4VA 3N28A 4LBVA 2AG5A 2CWDA 4KIFA 3BQMB 1G3MA 2ZJ7A 3F3YA 3ZE2B 3KJXA 1TVMA 5AO9A 4F45A 4YIKA 1C30B 1P44A 3WIOA 3O8OA 4Q1VA 3U4CA 4NG5A 1DMSA 4DA8A 3E3OA 3QUAA 4M7RA 1ZSYA 4YRIA 4RVUA 5HYVA 5L8VA 5KVVA 4G0VA 1T9HA 3V32A 4KNYA 1JJIA 3WR5A 3VFDA 2KLBA 5ENZA 3NPAA 3QA3E 4OFWA 1GL7A 5I7EA 2C58A 3L1IA 1I4DD 4EY3A 1XCMA 4E4YA 2W4MA 2WU8A 3QOFA 3SYMA 1JIKA 4GE3A 3A3PA 3RABA 3WK9A 4DLTA 4MARA 4R9RA 1B1AA 1Y82A 3W7BA 2Q3EA 3TIVA 5FUMA 4BBPA 3P26A 5DI9A 3IL2A 2P78A 1OFUA 1T9KA 3ZWWA 3R9XB 1CULC 4NE7A 1CIJA 4P92A 4FB5A 3IXMA 2C7QA 1V39A 3SNHA 3MXTA 2QUHA 1NBIA 4CKBA 1EEHA 4DXHA 4UNSA 4RLFA 5IFKA 2FPPB 3WXBA 1GTVA 5G4KB 2AKEA 1E6WA 1YIDA 2GPBA 1LDYA 2IZOA 3K9HA 1GKLA 3JW8A 4BDTA 2I34A 3QEMA 4BMVA 2IYRA 2EQBA 2W48A 4PX2A 1YS2X 5FUYA 3ESDA 1KEZA 2VRCD 3D7MA 4EG0A 2ZYIA 3FLMA 4WESB 3KKOA 1JILA 1T0UA 2A14A 2ECPA 1ZGBA 3SZ3A 4BZQA 1O0BA 4QXMA 4AS1A 3FLAA 2OO5C 4N3NA 4NU6A 3GV0A 1Z0FA 1T8TA 4J0CA 1JQKA 4PRYA 3CJQA 5FOQA 4UQOA 2BH2A 3FY4A 4HQOA 2IW1A 2C9CA 1NVUQ 5LLSA 3AUUA 2W2QA 3QMPA 1Z82A 1N1EA 3QENA 2RSLA 2WAAA 3O5AA 4N5DA 4YJHB 5C1DA 1SXQA 1LJ8A 1Z5GA 4ZI2A 3C8ZA 4BO6A 3TLYA 2ZANA 4LZNA 4EATA 2EBFX 2HK6A 2YHIB 3UUWA 2XMPA 4DXDA 3RRJA 3MJ4A 3JWPA 1T35A 4RMHA 4MKZA 3CJTA 3IQZA 2AQHA 2VHWA 4CI0B 2B4AA 3EG5A 2C2BA 4BBZA 1PJLA 1RLJA 2HA7A 1TFRA 3B2EA 1FU4A 1GT6A 2ZJ8A 2O9JA 1U0GA 4OTZA 4FMBB 1TPYA 4H1TA 5AOBA 4KQ9A 4CKYA 4YUAA 4C4YA 5ES3A 1RXUA 3RYFB 1MVOA 4Y2XA 3JQ7B 5SZHB 3FM9A 1P60A 3K72B 1WMAA 3PWKA 3OJWA 3N70A 3TX6A 3P2MA 4JBLA 2ZAOA 4RA9A 4BP8A 5JS8A 2SNIE 3F3MA 5AVJA 2OBXA 4B3TB 4JB2A 3OT4A 1F8UA 3MMXA 1OX5A 5J23A 3DFZA 2ZYTX 1FW8A 2R751 5A0FA 3IAHA 3ONFA 1EK6A 5CIYA 2JLUA 1FP1D 2G1UA 3PLAE 1U4OA 1HDIA 2XDWA 3Q7QA 1Z45A 1BZYA 4Q39A 2P3QA 4EECA 1OB5A 4R2WA 2FFBA 3UUFA 1Y7HA 1VJTA 5JPCA 1XMIA 3WFZA 5KYGA 1CRZA 1L1RA 4OATA 2V74B 2W6PA 5DW3A 4B44A 4BLWA 5M5BA 1T1GA 5JSKA 4PHCA 5BN3B 4XD7A 1H3FA 5CLHA 4X64B 2ISCA 2ZJBA 1K0UA 2XHZA 4LOKA 1WVGA 2BGUA 3BCHA 4UVIA 3AR3A 4MWSA 3TTSA 1X7ZA 1SK9A 4MEJA 3RYFA 1F0NA 2JJ2A 4H77A 1II9A 3MWDA 2KQUA 4OI2A 4XDZA 5IP5A 1ZM2A 2R6HA 3W5SA 3VC2A 2XJ9A 3KUUA 3K73O 2YJ3A 1DC7A 1TZKA 2WSYB 4ER0A 1XBTA 5KYYA 1W35A 2VWHA 2GHTA 4MH0R 3IP8A 2Q3HA 4RHUA 1W75A 3HDQA 3L06A 4GWKA 2OAEA 2WV7A 1JLMA 3IHTA 3LHIA 3MGGA 4HUQB 1J20A 3QFHA 4R2IA 5TSDA 2QG9A 5D1HA 5JNUA 2BR3A 2C54A 2VK8A 4EZBA 3GQVA 5L45A 4RPJA 4BLUA 2QLNA 4UEKA 3TX2A 3IT0A 3NHFA 2ZBEA 1Z15A 2FI1A 1Z2OX 5COQA 5HTKA 5AK6A 1EJ6A 1WDWB 3GBVA 1RABA 3PU6A 4NH0A 3Q98A 3ACDA 1LEHA 2DBYA 2PXCA 2ZJOA 2FH5B 2R8RA 3B12A 3GGDA 3KB8A 5K45A 1SUPA 3DEKA 3BTVA 3ZV5A 2D7DA 5B3JA 2Z2XA 3QFTA 3TRHA 1J39A 3EVEA 4FGWA 3F46A 4LMBA 3ZDAA 5F7OA 4F3YA 2F1HA 1TO1E 1POWA 4B3JA 1XAJA 2A30A 2NV0A 1STOA 4UVGA 4HWRA 2QRPA 4G8JA 3G2HA 4RK6A 3ZNOA 4BRSA 1EG7A 3PYXA 1R4AA 2FCRA 2FX5A 3QEMB 3TSCA 2Q1YA 4Z0TA 3KXIA 3PL5A 5K6AC 2ACEA 3DMHA 1IXSB 1OI2A 3PFFA 2GEFA 2P2CA 1XXHA 4JJFA 2F3SA 6REQA 1K66A 2H17A 3VSAA 3HV0A 3CVVA 1H1LB 2ONKA 1G2IA 4DEYA 1LWNA 2J4DA 4FYMA 4PQYA 3FPSA 3RS0A 2I8CA 5CBPA 1GITA 4AC9A 5DYTA 1H1DA 1U8FO 1ZD4A 4BX8A 3C5EA 2VNIA 5CFLA 3HI4A 2CNDA 1YMVA 3L7KA 1OLSA 5ELLA 5DKFA 1XPJA 5ULLA 1LNSA 4RIIA 1U98A 4UREA 1V3TA 1BW9A 4PINA 3KXDA 1TVEA 1DO8A 4O1HA 4YJHA 4FHFA 1RXEA 1P5RA 2C7RA 1SH7A 3ZEIA 3WLQA 1RXIA 1Y7PA 5AKJA 3PNLA 4I6EA 4RTPA 5EZ5A 1V3UA 4GM0A 2NU9A 4TUYB 1M33A 1GQFA 3HJCA 3M8KA 4FYPA 2G72A 3RSHA 2IP1A 1ZAYA 4RD0A 5C8VA 3MSCA 2XCOA 2WHPB 1XT6A 2CMDA 4JR0A 4MQ5A 3RIYA 3T7IA 2QR2A 1CKEA 3R8FA 4BZZA 3MCVA 4FJ1A 5GVRA 3ROZA 3GFSA 1SKYE 4LFBB 4MGZR 4RD2A 2O3TA 1XROA 2YNMD 3OU7A 4YALA 2Q45A 3KQOA 3VU9B 5G4KA 2GB4A 2HN9A 2P30A 2J3LA 3IAS1 3TD9A 1C7FA 2OCXA 3A27A 5SICE 1TJ4A 4F1WA 2XE8A 2XCQA 1Q95A 1R12A 4LSMA 3O4RA 4C0LA 4V0SA 5YASA 1QK4A 1BOFA 2PSHA 2OOSA 2OQIA 2WY2D 4QXQA 2HQSA 3SC3A 1OZFA 5E9WA 1TFUA 2NLOA 4UUPA 1W36C 2R1ZA 3EPKA 1N2CB 1P6UA 3I28A 3NVMB 2XGJA 2XECA 4MR8B 4AMGA 1Z16A 2ZIXB 1WU8A 2OO5A 1I01A 2EP7A 2G25A 3P94A 4MKRA 2HLDD 1P1BA 1F38A 3ZJUA 4LBWA 1WDTA 2AG6A 2OMEA 4GOJA 2RH5A 4M87A 4CI9A 3C3DA 3HS3A 4TVOA 3HB5X 4N8SA 4ZQEA 3TZCA 1N6OA 3NVKI 4RA9B 5FR1A 1I4EB 2WW8A 5DM4A 1GSAA 4UQLA 4LI0A 5A9SB 3CLRD 5JSYA 1BQEA 1O4WA 1LI4A 1TEXA 2AEJA 5L4NA 3WB9A 3UB2A 1JBKA 2VP2A 3TIIA 2QUJA 4ER5A 3ZUPA 2V0GA 2VCYA 1GPJA 2CD7A 1JIQA 3OIUA 1ODLA 4YFVA 2V6JA 4YAUA 4KI0A 4IEIA 3I6ZA 1ENOA 2ISSD 5JCJD 4EHBA 4FE4A 5EIFA 4MUBA 2YTZA 5IM4A 1OV4A 2R8PA 1XLTC 2IVZA 5DEIA 3T5TA 1E3IA 1RQ7A 1E9FA 1OKKD 3F8SA 4M36A 3FRHA 3RVDA 5AVYA 5K8IA 4IYJA 4K9RA 1WSAA 2GRJA 2OD2A 4KQCA 1FSZA 3O31A 4X8HA 3QEOA 2J85A 1XU4A 3EEQA 3R77A 3RBVA 3KT3A 4BGUA 2YWDA 4NZPA 4HH3C 5LMZA 3P5SA 2AG0A 4IWYA 4OK3A 4PHGA 1ZRHA 3UBTA 1G18A 3QXGA 5F9MA 2VSNA 2G08A 4WKPA 2YOHA 3P32A 5BYAA 4HQLA 1U31A 2AWOA 3BSWA 4M9CA 4Z4HA 4YV1A 2FJ0A 3HEAA 3ZN2A 1CZHA 1HKUA 3IJRA 3PP8A 1JHXA 3TOCA 4AKSA 3ZU5A 3ZCVA 2WINI 2Y1OA 1WABA 3E6AA 1XRLA 1W96A 4ER7A 4XQCA 1E60A 1Q0RA 2CZQA 3OWHA 3QP9A 4P5EA 1ISFA 4A3SA 3M70A 6PFKA 4F4DA 2QTZA 3NOXA 1Y42X 3F4BA 5HUJA 4RA6B 4QATA 2WTAA 3ZU2A 3ZY5A 1N0VC 4QREA 3VZQA 4EJ2A 3COSA 5A0TA 2X7JA 4YJ3F 3P9IA 3TVYA 2PXXA 4M3NA 1LPSA 1UPTA 4ND7A 3JQBA 5DLYA 3UMJA 1U9YA 5HK9A 1EH5A 1K6EA 1T34A 2BP7B 1WWKA 1NXPA 3GVPA 4LG1A 4MWCA 5CMLA 5DNCA 2W71A 4RH0A 1ECJA 1ZQ9A 3ZZ1A 4YT2A 2RC5A 4BAUA 2LR0A 2WIDA 3CUYA 3P0JA 1Z0DA 4RZ2A 4YP0A 1UINA 5KSYA 1B00A 4J1QA 2WOJA 5MFPA 5MN5A 3WWCA 2IW3A 2JLQA 1CXZA 4RFVA 2O8DA 5T4EA 2G6TA 1M1YE 3JU3A 3KT8A 4DG5A 4C03A 3CLUD 3NEYA 3SJ7A 5EJFA 1J2TA 3UWSA 1CE8B 1J70A 1KI2A 2FDXA 2I7VA 2AMLA 2QTBA 2YMLA 3HVJA 3LUDA 3Q9NA 3GJXC 4PQRA 5AXCA 1NY6A 2HNBA 1MXHA 2Z1DA 4YPVA 3PYMA 4MUKA 2C9MA 5D86A 5EUCA 2XZOA 3QX9A 1ZD5A 2X3UA 1FP4B 4G24A 1QH1B 2R7MA 3FRIA 1J23A 4OIMA 4FNGA 4B45A 1SC4A 4E12A 2VZ0A 2Q4OA 3PJGA 1Y8AA 2DWQA 2NAFA 1P17A 2AC2A 3FNFA 3BHMA 3BN3A 4HN9A 3LECA 2XWSA 1FRNA 4TMWA 3JXEA 1NA5A 5DX8A 1LPNA 1WLSA 2WM2A 5ALRA 4BMNA 2H4WA 4KMRA 4TT8A 1XTRA 4Y18A 621PA 4BFLA 3BRQA 3KR2A 4G2NA 2P7IA 2HCFA 3SC2B 4D79A 3GDGA 3WGJA 5ICFA 2WZDA 4TYNA 2O19A 1AXGA 1RRKA 3GLHA 1T4DA 1E89A 3GMDA 5IABA 3HMQA 4CKEB 4DUGA 1CNMA 4NABA 4A8JA 5JIBA 1ZD2P 1P3DA 1GGMA 5JT1A 3EMBA 3UGQA 4A1FA 5JY6A 3ELWA 1E2KA 1Z6TA 1O95C 5L53A 2YX1A 5J43A 3F7TA 3ETJA 2C2MA 1JPVA 3X1WA 2AZDA 3PTZA 3AETB 4F72A 4YUXA 1MB9A 1Z3CA 2EZTA 1GILA 3GLGB 1WU7A 4X3PA 4AD8A 2XXJA 1I7SB 1VKJA 3OKAA 4NJMA 1Z0IA 4EF4A 4H1WA 4PZAA 4R9UC 4L8LA 2H85A 3RFVA 4DR3B 1TLTA 2HK9A 3PWSA 1QG2A 5A6SA 3QFFA 3EEYA 2CFRA 5A6VA 3N6VA 3HO8A 1TKAA 3ENQA 3DF9A 4M1QA 2FPIA 4X97A 3SZLA 5J2TB 3GXOA 1MXFA 1Y1RA 1ZM7A 1U99A 4EDHA 5IAAA 1IBLB 4N0PA 4PFKA 3QU4A 1QNLA 1VHLA 1OE0A 2H9IA 5JAUA 1XMVA 1QAQA 1YRWA 3NFRA 2JJMA 1IN4A 4MCJA 3ZCQA 4UBJA 5I7UA 3FOEC 1M1ZA 1OA1A 3DXXA 4Y2SA 1C1YA 3EVNA 4GMXA 4P4SA 4TSFA 1QQ6A 3PQCA 1N2CE 1OHHA 2BKUA 4Q01A 4LF6B 3GFQA 1FU8A 1DFHA 1PLJA 1R0RE 2RONA 4MQLA 3LCUA 4DILA 1FX0B 3CX7A 2GEKA 5KC9A 3CG4A 1VCOA 4HPXB 2HJGA 4L5YA 4WFKA 4YQZA 5LMNB 3E2PA 4CM5A 1Z0KA 3GFGA 1E1QD 3UMYA 5SZJA 2PUAA 3LSYA 2AA3A 2Q6OA 2VNAA 3FTDA 4DCCA 1PVVA 5B3AA 4E5DA 3FR7A 1ZO8A 1Z0AA 2B98A 2O07A 1H2XA 3HXTA 3TM5A 1TM3E 1KYXA 1O5IA 1UBMS 5AXDA 3R5KA 2LDBA 2OD9A 3GFOA 3R75A 1RZRD 1N9KA 1HURA 2BFDA 1Q7GA 2PGAA 4LZOA 4OJQA 1CQJA 2GRUA 4P0TA 5LUAA 3AWIA 4G84A 5BSKA 2QYOA 3EA4A 4QRIA 4LRXA 2QVXX 3OPYB 3GLIA 1J56A 3HXKA 2QKYA 2Z2IA 4S1OA 1XMQB 3TMYA 4KHZA 3PF9A 2WG2A 1UXOA 1R0LA 2RCYA 2C77A 1QYWA 3KCQA 2OYCA 5DOVA 3SHTA 5A5VA 5MGNA 4YY3B 2DC1A 3DONA 1XKXA 5EKDA 4NJMB 2RHGB 1GUZA 3FSGD 4J16C 2XGMA 4TL6A 4YUVA 2PUJA 2BUCA 1V2HE 4W9NA 3ROKA 3ESBA 1ZEMA 3UCFA 4C2AA 3UJHA 2WJHA 2H7YA 5FUQA 1G5QA 4UOEA 1RJ9B 3H2BA 4G0ZA 1XLTA 5ERYA 1QONA 3VHRA 2D7CA 1JWBB 2QVGA 1NTOA 2VLBA 1KMMA 4Y6OA 5CVUA 1DJNA 3QX3A 3OFND 4I14A 4EUHA 3KT0A 1JRLA 3UK0A 4AMBA 1ZOSA 2O23A 2IX9A 2B1JA 4IM7A 4EELA 2I2XB 3WZ2A 2I8LA 1PUJA 1VLHA 3PEVA 4FK8A 2NU7A 1JKMA 1NI5A 4ZQGA 3HCPA 3C1TA 3ZWMA 1JR2A 2XCUA 2MINB 3TMAA 2CLSA 5JPIA 4KV9A 3E8XA 1CB0A 4FFSA 5EHQA 4BX3A 2YYSA 5HIJA 3OU2A 4ZVOA 2IYUA 3IAEA 3DKPA 2B8TA 3P4YA 1YZQA 4CMBA 3MCWA 1CR0A 5JAOA 3G1WA 4IDAA 1OFHA 3X1ZA 4BMXA 4TMXA 2OD7A 2B20A 3EZLA 4EYOA 1KJ8A 2DBQA 2XMRA 3HDVA 4QGSA 5HKAA 5KPJA 2UVPB 1VB3A 2IOQA 4IVNA 3GAAA 3M3HA 1FNNA 3B1XA 4OHRA 4EHFA 2DPLA 1Y4DE 2DQZA 3N0VA 1T3ZA 3E4CA 1R5NA 3BRWD 1QK3A 2ZJ3A 4G1VA 4Y0AA 1ZRMA 1XEAA 1XOIA 1LPMA 3SPXA 1DPGA 2VH5R 5K7SA 3CG0A 5GOZA 4NCBA 4TLDA 1NLFA 3KOOA 4C05A 1D0IA 1UMKA 2NIPA 4NP6A 2FSUA 1RTKA 4RHCA 3G0HA 3VPGA 3UAOA 1N1DA 2Y9MB 3M0EA 4EZIA 1FK8A 3QVSA 5T5QA 5KNCH 1SU6A 2A1IA 2VHQA 2N47A 1Q0TA 4C6RA 4GKAA 1JHQA 5TPZA 2H00A 2RG1A 3JWGA 2RGCA 4G01B 3TQIA 2Z04A 2QVCA 4AJLA 4DLPA 5BNIA 3L7IA 3INYA 3U31A 5F2KA 1BE6A 4GL4A 1LSJA 1SHLA 4GSYA 3WLEA 2J3DA 2NP6A 1G9TA 1I8TA 5FHRA 1RXVA 4J2OA 2MYUA 3URMA 4KUGA 4L27A 1KQFA 1FLAA 1XHLA 3FDIA 3H18A 3I9NA 1V71A 2Y1FA 4JJ7A 5EJ5A 4NPAA 3BMNB 5I3ZA 5IT4A 2BGWA 2WYHA 2WWVD 3SDSA 4OLBA 1PL6A 3NUGA 3WJ2A 1THGA 3K4HA 3ZI7A 3AM1A 1U5BB 3A7DA 5GZ6A 2HRDA 1QQ7A 1YQXA 5KQSA 1ZM3A 5LWHA 1BHJA 1MEOA 3A0UA 3L7CA 4MVJF 1P3Y1 1KY2A 1C0EA 1OFTA 1R0XA 4WUVA 4DMCA 5ICMA 4GBMA 5CB4B 5EIWA 2WAYA 5H82A 4JI5B 1E5LA 1G59A 1EVKA 3W2TA 2V58A 4N5LA 4OYLA 3U5TA 2X9VA 1JSZA 1WQ1R 3K0SA 1W49A 2Y0EA 4GPBA 2QW8A 5KTOA 1TA9A 1BQ3A 2P9HA 3MWYW 5JNWA 2LIPA 1N92A 2BGTA 2C3YA 4A8JC 4B81A 2Q2VA 1ZY2A 2TMKA 2OKGA 2VP6A 3TPCA 3TW4A 4ADSG 1NFRA 5DBHX 4MUFA 3CT6A 1U0JA 2IY7A 1PIWA 4XYBA 1Z2AA 2BJVA 4JIGA 5DNEA 3IA7A 1IQUA 1ZH0A 5J63A 4A0RA 1QFSA 4QSHA 3CLKA 5SYAA 2PHZA 3DXZA 4JU9A 4LOIA 1RS0A 4O2BB 1EXWA 4ZC8A 4HDNB 2BSAA 3CVJA 1NL3A 4DMGA 5CUQA 2OB1A 421PA 1X14A 5A9SA 1UXIA 3D3KA 4DRYA 3W2IA 1A5AB 4Q7LA 4ZGGA 3A4TA 1I3KA 3M2TA 3UHFA 1Y7TA 3EARA 4QDOA 3M9LA 4NF2A 3DL2A 1FX1A 1VJ1A 5IASA 1YBAA 1XWIA 1CC1S 4YRJA 4AJ9A 4KFTA 5FOWA 3ZHBA 3ICQB 1V7CA 3EDOA 4PR3A 4Y6PA 2H2FA 5FBQB 3UFXB 4B09A 3EDQA 4RKFA 3QVGB 5CJJA 2IA5A 4ZOEA 2O2CA 4AY6A 3T7TA 3EH2A 3NKFA 3OP4A 3LQ1A 3MWJA 3SEZA 4BS9A 4XGRA 4PPQA 3A1WA 1ECGA 4PHHA 1Y89A 2HPAA 4NBNA 5T3UA 1JQJC 1U0SY 4BP3A 1H2BA 2V6MA 5ALDA 2Q0HA 1YBMA 3JQAD 3X1MA 4EQ6B 1HEYA 3JD4A 4R83A 5KSWB 2EGGA 2RAPA 1OU0A 1T4BA 4WXPA 2JGEA 3V42A 1NF3A 3QE9Y 3A4LA 4RH1A 2NSYA 1XALA 5IF3A 2X40A 3PHGA 2PUFA 5B6IA 1AF4A 8LDHA 5JG7A 5KNBD 1ECPA 3MIIA 3GLVA 3P2JA 4TX1A 1E2EA 1T24A 3QXJA 4YCJA 3J7AC 4EKDA 1N0HA 5BV7A 2WOOA 1FZTA 3BDAA 4B4WA 3CRW1 1IRXA 4JKIA 1ZCJA 4QULA 2EJTA 4MYCA 2YHBA 1SHUX 2CY0A 4ITVA 1N2GA 5ALFA 3UXYA 4CM1A 2DPYA 2XBUA 3LF2A 2BUBA 3MLBA 5IKOA 3RLFA 2OO3A 2R2GA 3N5CA 4R1LA 1KOGA 4Y1RB