2ANBA

Crystal structure of oligomeric e.coli guanylate kinase in complex with gmp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
206
Chain Sequence
b'AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 206
sequence length 206
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2anbA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2anbA01
1KSJA 3U61B 4AYTA 3C5CA 3FB4A 4NHOA 1Q1EA 4PC7A 4UXJA 4UNNA 1EGAA 1YZLA 1RC8A 2AL7A 1X1SA 2IYXA 5B57C 1G17A 4C0HA 3P32A 4FMDB 1VMAA 3RWMB 4V02A 4JJZA 1TUIA 5DSZA 4A1FA 1VYVA 3OEHA 1AM4D 5F2EA 5A0FA 3EIQA 3K09C 1TL7C 2O8DB 3THXB 2QORA 2IYLD 3QG5A 4Q1EA 2FG5A 2VHCA 1I4DD 3OZXA 4Z8YA 2W6ID 1UKYA 1VG8A 5JECA 1GL6A 1NMZA 2G83A 2WOJA 1NRJB 2B6HA 2ZJBA 2PEZA 2PL3A 4OQXA 2QNRA 1N0UA 3OAAD 2DFLA 4JMPA 4HB3A 2IYWA 3ZIAA 3EASA 4NBSA 5KSPA 1S96A 2W2TA 1IY1A 3B9QA 4YDHB 3CWQA 4RCZA 1GOTA 1IXSB 1M74A 2YNMA 1ZP6A 3B2EA 1G20E 2X1VA 1N5IA 1SVLA 4FCVA 1YU9A 2J3EA 4EFLA 3QEOA 5J5CA 1Q12A 3G82C 1E98A 2YWFA 5EP2A 3FMIA 1UBFA 1Z28A 2EFHB 3LBIA 3AVVA 2NQ2C 3ETLA 4LHXA 2R6AA 4NYJQ 3UMRA 4M8NE 5CJPA 5GJBA 3MFYA 4KHZA 2CVFA 3RS2A 5JS8A 3K70B 1KZ7B 1XNJA 1HEIA 3NC1C 1SULA 4RFSA 4KO8A 3GCGA 4TLDA 1CJTC 3KXIA 1FL9A 2WWGA 3KQNA 2FE4A 5AJVB 5EP3A 4V0MA 1IN7A 4AURA 4Q7LA 4XWKA 2GESA 2FZLA 1CTQA 5GJCA 1A7JA 4IVPA 4L4UA 1BOFA 4Q4HB 3M0EA 2A78A 4B3XA 8OHMA 2D7DA 2CCJA 2ODEA 1KK2A 1UKVY 2DHRA 2V54A 2ZSDA 2JIZA 2P2LA 1KI8A 3CH5A 3TH5A 3ICQB 1G8PA 5FPYA 3WMGA 3QF4B 3X1DA 4BFYA 1HE1C 4Q9KA 1Q3HA 4MYUA 1OSNA 3E70C 1Q22A 4FN5A 1YE8A 2XB4A 5E95A 1W2HA 4C2TA 1D2MA 1RRGA 2OT3B 4TLEA 3GFTA 4HUTA 4LBVA 3UPUA 3AUXA 1IM2A 4ZPXA 5AJYA 4PHTA 4MKGA 4D2IA 3CWZA 2G3YA 2OESA 3QQ5A 4DLRA 4QRHA 4NCHA 4M1WA 3K09A 4A15A 4BZQA 4WZAE 3TW8B 1NP6A 4EUNA 1EFCA 2C8VA 4NCIA 1Q21A 4GOKA 4XD7D 1KI2A 4DXAA 2XZPA 2HYIC 3AVWA 4MGYR 3PQCA 1XJQA 3AF1A 1Q3TA 2RB4A 2SHKA 3BAFA 2D3WA 2ZVQX 4PAMA 1HH4A 1BO6A 4Q18A 3FGNA 4GMXA 4GBMA 4Y0VA 3FTQA 3GLHA 5G41A 3W8NA 3AGQA 4JBWA 4TLBA 2O8EA 1ZC4A 4ERNA 4FMCF 4C3ZA 4RJLA 2DYKA 2OO7A 5D3MB 2A5GA 5DI3A 2O8BA 1KKMA 2JEOA 2J0VA 3IBGA 4UXHA 3QKRA 2OV2A 2ZSBA 1JQLB 1RIFA 3QKUA 4DCUA 1KYIA 2IA5A 1OIWA 3GLIA 1R0YA 3I1FA 1OXXK 3P1JA 1II0A 5JEDA 1K5DA 3R9IA 4G5QA 3EWAA 4JLAA 2EYUA 3LNCA 3U3KA 2EWVA 1AN0A 1SXJB 3A6PC 1P61B 2FMXA 1E99A 1ZU5A 4B6EA 3R8FA 5K8TA 1DO2A 2G1JA 4Q4AA 5ANRB 4OHXA 2ZUDA 1YVDA 3I73A 4B3CA 4C9BA 2AWNA 3KKQA 1A2BA 3NBFA 1IY2A 4ZIRB 1VG0B 2XZLA 1PLLA 1ESMA 4YXWD 1OXSC 2QRNA 2Y8EA 3ECCA 4HLUC 3P20A 4ZI2A 5AUOB 2IUTA 3A1UA 5B2ZA 4RZXA 3RYTC 3UANA 4DB4A 2QAGB 1LS6A 2IHBA 3LD9A 1NI3A 2GILA 2OXRA 5SZIA 3KTAA 3W5JA 4HI0E 4PHHA 3C14C 1E9EA 3GEHA 4JLNA 3THYA 3SDZA 1AA9A 2QTVB 1GL9B 1VTKA 4GPTA 4WXRA 1AKYA 3H0KA 3PV0A 3AF2A 1JAIA 3AF3A 4LHVA 3CRQA 3MUFA 5CB6A 2ZQ5A 2XTNA 1NKTA 1Z29A 2FF7A 1KY3A 2BV3A 3BJIC 4XSHA 2FPMA 3AVYA 4J0QA 1GZSA 2QM8A 2FU5C 1YR8A 3DEFA 3F8TA 4HATA 1DAIA 3EZ9A 1E2GA 2PZGA 2P6UA 1OW3B 1Z0FA 3SZRA 1T4GA 4JKIA 1ESNA 3CLVA 4CDGA 3TGPA 2ZI4A 1SZPA 4CEIB 2OAP1 1VG1A 1LV7A 2JLWA 3Q8XB 1CXZA 3AV0B 1L8QA 1EESA 2HLDD 2W83A 3KUDA 3GLGB 2FEMA 1MKYA 5FL7A 2CDNA 3BH7A 4HSEA 4OHWA 1HE8B 1NIPA 4P0TA 2GJ8A 1ZM4A 4WZBE 2C04A 3ADBA 4URZR 2O8DA 2Q0HA 4M21A 1R8SA 5E3HA 3THXA 1QG2A 2QAJA 1FX0A 4XWOA 4MH0R 1WQ1R 1FFHA 3AGPA 1AZTA 2IS6A 3AB3A 1A2KC 1UBEA 4QJ3A 2HF8A 1A1VA 1ZYUA 1U8ZA 3K9GA 2C78A 3U5ZB 1SVKA 3T1TA 1G3QA 2JAQA 1G4AE 1E79D 1G6OA 2WOOA 4LPSA 1CRPA 3W8RA 1AIPA 3TUZC 2ZYUX 2CEAA 4DCNA 4QJ5A 5HKKD 2C9OA 2WM9B 1SGWA 5HPYB 1E9FA 1DOAA 1F6BA 3ZQ6A 4LV8B 1IJFA 1XF9A 3WYFA 4JLPA 1ANKA 4B32A 2C77A 4GP6A 1CIPA 1IN6A 4YDSA 5KSZA 2Q9BA 3E5HA 1W4AA 1GTVA 1FMLA 4HLDA 3SBEA 3WHLA 5E4FA 1DADA 1GVNB 2JJ2A 4B3DA 1Z08A 5FPSA 1OH6A 4BFWA 2WV9A 4LV5B 2CL6X 5TXGA 1GNRA 3L82B 2GXQA 1U2RA 4IRUB 5EP1A 1SXJC 4HLUA 2BMJA 4PC3A 4A8JB 2BBOA 3EW9A 3JVUA 3PUZA 1W49A 1NVVR 2ZREA 2ZRPA 1S9DA 2FFQA 2A5DA 3TK1A 3QPWA 4GZLA 4HZUA 1KO5A 1W5SA 2BJVA 3N2IA 2ZETA 1JPNA 4IHQA 3Q72A 4LJ8A 4LY6A 4B2PA 1XTQA 4I1UA 3BFKA 5DGXA 1RZ3A 5DYGA 2GTPA 1T3HA 1YJ5A 5B30A 2G88A 4Q1AA 3QY0A 4NYMR 2BMDA 2FV8A 4S35A 1Z6XA 4QGGA 3J81k 1TF5A 4RKFA 2MMGA 3RS0A 3B7GA 3JZMA 4K8OA 6Q21A 5FL3A 1EFRA 3IQXA 1CKEA 4IJMA 4PSAA 5EXTA 1P5ZB 2Q3MA 4Q4HA 3RRMA 1L2TA 3LDAA 4BEBA 5JSZB 5C2JB 2PZFA 3QF4A 4RD6A 1Z8FA 3NHAA 4FMBB 3FWYA 2WJGA 1EFUA 4FXPA 3SJZA 4C4PA 1XWIA 2QPAA 3PUVA 5B64A 2ZE7A 1XBTA 5FPHA 4B35A 1KMHB 1E6CA 2LKDA 2Q3FA 3OESA 3A8TA 1GL7A 3HDTA 3HU1A 1GP2A 3A36A 1CJMA 2RGEA 1BKDR 2H18A 1KZGB 3IO3A 1N6KA 2GXSA 821PA 3FKQA 4RD1A 1N0WA 2QENA 2ZRKA 4TSFA 2J0SA 1UDWA 4GDFA 2WJVA 5IRCD 1DE0A 4PPQA 2WPDA 5JEEA 1E2FA 2O52A 4F7WA 1MO4A 2VP4A 2D2EA 2IL1A 1C1YA 4MYCA 3UATA 5EXPA 3D7MA 4QNMA 2O8CB 2PX3A 3QVUA 2NO7A 4Q48A 1YR6A 1AQUA 3PEWA 2N42A 4MUBA 1ZW6A 4JT2A 4KITB 1E1RD 2WWHA 1SHZA 3D3QA 3SFZA 2A7QA 1O3YA 3SNHA 4P4TA 1CR4A 3C16C 1KNXA 3DKPA 3VU9B 1UEIA 1JBKA 5JCZA 1NKSA 3WP1B 1GKUB 2ZI3A 1F5NA 3AVUA 1H8EA 1HA3A 1KNQA 1VCNA 3EA5A 5JHHB 1NJGA 4KVGA 1SXJA 4F4JA 1ZD1A 1E9DA 5FBVB 2QPTA 4R71A 4ZDJA 1U0JA 4DUGA 4US2R 4DVGA 3KJGA 2QSYA 2ZSEA 5TB5A 2XJ9A 2BM1A 1NVXQ 4LC0A 3DM9B 4PC1A 3EC1A 1NLZA 5KNCA 5DI9A 1E1QD 1JECA 3LFUA 3OE7D 4JZKA 3RABA 4CGZA 1XPUA 2PEYA 5AJXA 5LDDC 1KDOA 1WF3A 1NMYA 1IXZA 4DSNA 2VLIA 3PITA 2R6GA 4HDQB 5DLQC 2R2AA 2WWYA 1JR3E 3ZZ0A 1AGRA 4M9XA 4R98A 4M53A 1YKSA 4WA7A 4Z1MD 1XFAA 4A82A 4WOPA 1I2DA 2IK8A 1XTJA 4C7OA 1MABA 5P21A 1QBKC 1YZQA 3EZ2A 3ZS8A 1X8JA 2FFHA 1GKIA 1Y63A 3H86A 1CLUA 2QGNA 2A5YB 1QVAA 5HE8A 5FUXA 2C95A 2MSEB 2QZ4A 1SVSA 2F6RA 1M7GA 2BEKA 3RLFA 2O8FB 1AGPA 3I8SA 4A0HA 3U6BA 1ZUNB 4A92A 2D7CA 3VKHA 4W5JA 3THWA 2F9LA 1IONA 1J8MF 2OCYC 3FFAA 4BGDA 5L3SA 1NIJA 4RFSB 1PUJA 4Q9IA 4OI0A 3MWYW 4AG5A 1XEXA 5HE9A 4Q1CA 3IO5A 4AK9A 5BYKA 2W00A 4DEYA 4LBZA 721PA 2JLVA 4LOAA 4TMKA 1SKYE 3GLGA 3WRYC 2PX0A 1CP2A 3DOFA 4LJYA 3Q5DA 3T15A 1D5CA 4QBIA 3H4MA 2A2ZA 3RNLA 3UK6A 2C98A 4OQFA 4E09A 3HYTA 1QHYA 4QBFA 5BW8A 1KKLA 2CBZA 2ZU6A 1R8QA 5DHAA 1E9RA 4M4SA 1BYIA 2EFDB 1MV5A 3IDQA 1UKZA 3K9NA 4URXR 2ZJZA 4MRPA 2HJVA 2PH1A 1X8LA 1ZINA 4B76A 2ZRLA 3A4LA 3MWLA 4QGFA 4DBLC 2CL7X 4CF7A 4RY2A 2PCLA 5HR5A 5FOSA 3AKCA 4FWIB 3UMSA 3SQXA 3LLMA 4M1SA 2IUUA 2WJYA 2D4HA 5EUMA 1Z2AA 1G6HA 4TTPA 1JPJA 1E94E 1RVDA 4BUJA 1EG7A 5EJEA 3TAHA 1AZSC 3GJ5A 3GP8A 1T5IA 3K0SA 1DAHA 1DPFA 3BERA 1ETUA 2CK3A 2F1RA 4LBYA 3DKVA 1UPTA 1LVGA 3U7EB 2J59A 5EZ5A 3WYGA 4BRWA 4DDTA 4A2QA 3GLHB 2WIAA 2PZEA 2GZDA 2JJ8A 1EX7A 1J7KA 2O8EB 4MKHA 4UQOA 3Q3JB 3O8RA 2EVWX 3K0EA 5DI3B 2OSBA 2BIFA 4LGMA 1GM5A 2HDNB 4N0EA 1O87A 3QKRB 2UZIR 4Q03A 3RSLA 3VKWA 4YONB 1GKYA 3UWKA 3ICEA 2CLDX 2Z0MA 1A4RA 2ZE8A 4KVAA 4RVCA 3TQFA 3OHMA 5IK2A 3IEUA 3LAWA 1BS1A 3KKPA 4URVR 2PMDA 5KSYA 1CU1A 1Q1ZA 3GEIA 3QBTA 2D62A 3W34A 3DZDA 4C0SA 3DMDA 3CKLA 4C0LA 1G3UA 4YLGA 5JI3E 1I4LD 2VEDA 4YQFA 5AUQA 3HP1A 1XCPA 2CVHA 4GRAA 5JSZA 3PG5A 1QHIA 4Q4AB 1Q1QA 2OG2A 3ZVNA 3DHWC 1G5RA 2HCJB 2DFNA 2VIIA 4XOIA 2AFHE 4IDHA 1P9RA 2QEQA 1COWA 4TL7A 1P62B 1NN5A 3CF2A 3U3RA 3HR8A 3RHFA 1OH5A 1QVRA 1TQDA 2QSZA 4PZZA 3W5IA 4QHTA 1KMHA 3I5YA 1UJ2A 4W5WA 2BMEA 2RHDA 2XAUA 3T5GA 3ZLJA 4X8HA 3ADKA 4LK2A 3QKSB 4DJTA 5M04A 1G4UR 3B9PA 4CT5A 2AX4A 2OBMA 2DR3A 2ZXUA 5DISB 2ZRBA 2ANCA 1TUEA 2PCJA 3CNOA 3L0SA 3AH8A 4ZCIA 5EE9A 4CEHA 5J4HA 4Q5IA 2FFBA 4G5OA 3THOA 4UNSA 1UADA 1OHHA 2CNWD 4GT1A 2MSCB 2WSSD 4HB4A 4M9ZA 4Q19A 1CJVC 1KGDA 2H7VA 1E2NA 3AUYA 4RZUA 3VHLB 2BBTA 2VA8A 1N6LA 1YRAA 1C4OA 3QENA 2IC5A 4GL2A 4D0NA 2BCGY 5DNYB 5JCPA 3U3OA 3ZZUA 5JWHA 3EPLA 1OFHA 4MKIA 2ZRCA 4MQBA 4B43A 1JR3A 4NCKA 5KNBA 4ON9A 4YMVA 1ZC3A 1U90A 3QBVA 4TL9A 2FEOA 1BMFD 1M6NA 2ECKA 2G1KA 3PUWA 4II7A 4QGAA 2ZYTX 4BFZA 2ZI5A 3VU9A 3P26A 1Z6YA 2BJWA 1NVWQ 2EFGA 2QQEA 3KJEA 2PMKA 2QPOA 4AKEA 4IW3B 3B1ZA 4QM7A 5FPKA 1E0AA 2GEUA 4G1UC 1FX0B 2BM0A 1WRBA 4JLDA 4KYIB 2F1IA 1P9WA 4JL6A 5CITA 4QOSA 2IF2A 1OIXA 4B34A 4LJ9A 5JLJA 1IN8A 2NIPA 1T0HB 3RC8A 2W6IA 5TVKA 3FHCB 3SC3A 4GP7A 4CYMA 2QUZA 3QKTA 4D4LA 3K0AB 1ZJ6A 3UMFA 2R6DA 3O8BA 4DCVA 2DB3A 1N6RA 1NNEA 1QZXA 1VCOA 3OAAA 3FHTA 3CBQA 4TMZA 5TARA 3B60A 2ZAOA 2WTUA 2NOAA 2J1LA 4A6XA 4LPKA 1FNNA 1NG1A 2GK6A 3QIAA 1ZNWA 3JZAA 2OZEA 2WAXA 5BWMA 2HT1A 4AD8A 3SE0A 3TSZA 4DDWA 1XZPA 2GKSA 3X1XA 4AKIA 1OT3A 4ARZB 4URWR 1U94A 3BD9A 2ZS8A 2AKYA 3GLFA 1E9AA 2IEYA 4B2IA 2O8FA 4KYUA 3UG6A 2PJZA 4D0LB 1WP9A 4M9SA 3N2EA 2GJAA 4JYBA 2ZE6A 1K8RA 1XU4A 4U00A 1CEEA 2B7CA 3CUEF 1DAMA 4HZUB 3X1WA 2O0KA 1BH2A 1AK2A 1EFHA 2AXPA 3GJ8A 3GJXC 4DCTA 2C03A 3PUYA 1GG2A 2UKDA 3TNFA 4YMUA 1R2QA 4BLRA 1KI3A 2EWWA 1NN3A 1RPZA 4TWZA 1QHGA 1KK3A 4G01B 3ND8A 5H70A 5A5GA 2IT1A 2ZM5A 2FNAA 4GOJA 3W6PA 4AKGA 3FYHA 4RFVA 1XJ0A 3I5XA 1G1MA 1JALA 3CRRA 4NDZA 4NZYA 5KU1A 1TAGA 2FH5B 3QEJA 1NY5A 4A0FA 1HTWA 4LBWA 1E69A 3TMKA 1RRFA 3SS8A 4ZDIA 4F91B 3Q7PA 2L0XA 3NKVA 2XITA 1HURA 5LD2C 4JS0A 1ZNZA 2YWGA 4KFRA 5BYJA 3RRNA 5L8VA 1E3MA 5CDFE 4IOJA 4MDEA 1SVIA 2VH5R 4RSGA 1Q57A 2WIBA 2V9PA 1F3OA 1ZUHA 4LDJA 3KL4A 3K1JA 3AF4A 1KY2A 5FH9A 3CIOA 2H57A 2V6JA 1AS0A 4QC2A 2XX3A 3RANA 4C0KA 2KSQA 4ACBA 3PJRA 2QE7D 4TL8A 1KO1A 2C96A 2OILA 3B8HA 3Q5EA 5BXQC 2W0SA 4B75A 2Z4SA 1Z22A 2G77B 3IQWA 4RD4A 4OK6A 2R62A 5B58C 3LBNA 3FHOA 1KK0A 4XD7A 1KAGA 2HV8A 3VQTA 2ERYA 2ONKA 5L3QA 3R7WB 3I32A 3VTKA 1OXVA 3EAQA 2QP9X 4A0GA 5TMPA 3T5DA 4KCGA 1BIFA 1LNZA 2ZRDA 5DE3A 4PXAA 1Z06A 4QGHA 2ZE5A 3O8CA 3MJHA 4Q1BA 5FOXA 3EARA 1TEXA 4LJ7A 5E7MA 4QFMA 1S3SA 4OQNA 2RHMA 4V0NA 4ASUD 1Z83A 1KO7A 2BHRA 3VX3A 3CPEA 4EKDA 4KFSA 5K8IA 5JS7A 5EE5B 4OKSA 4D4JA 2B8WA 5DO9A 4DRZA 4EDHA 4U02A 2P67A 4TL6A 4B6FA 2WJIA 4WBSA 2OEPA 4TYNA 3LV8A 4EJSC 2ERXA 1R0ZA 4GSYA 3NWJA 1R5OA 2J0UA 1UAAA 1BYUA 2P5SA 4JL5A 4YMWA 2OCPA 4DB2A 3K0FA 4FMDF 2Z6VA 2AXNA 5CM9C 3HWSA 3FKSD 5FPTA 2XSZA 2GETA 2I3BA 2H8KA 4A4DA 4DDUA 5F3WB 1G41A 1N5KA 3IEVA 2ZUBA 3F0TA 4CW7A 3KQHA 1XMSA 1KO8A 2E87A 4YXWA 3EWSA 4JKYA 4LZZA 4M1TA 3ASYA 5KHOC 2V7QD 4OI1A 4UNQA 3QKSA 5DH9A 4CEJB 1IHUA 4XTRA 4H1VA 4WIAA 4DT1B 1TPZA 4X8LA 3U3JA 4Z51A 2OFXA 1WCV1 3D6TB 1Q0UA 2XTMA 1G19A 3NG1A 4AIIA 2H92A 4LI0A 4DKXA 4C7OB 1MABB 1KI6A 4HDOB 3LXXA 4Q02A 1L7VC 2WWIA 2ZYVX 3F3YA 1RW4A 3BS4A 2BKUA 2XEXA 4XVRA 2R6FA 4PPGA 1UF9A 3U4QA 3Q85A 1JB1A 3NBZC 4XH9B 4LX0A 3EXAA 1OFUX 2ZJ8A 4ABYA 1DAFA 5DN6D 1FP6A 2JLUA 1WBDA 1P7CA 4TN1A 4AYXA 3U7HB 2FWRA 3THWB 2ZRMA 4HZIA 4A6PA 4P4SA 2VTKA 4IEEA 4B3FX 3SYNA 4EIWA 5L3SB 3EPHA 3WMFA 1Z6GA 1OKKD 2KWIA 3HYRA 4B71A 4L9SA 1VCIA 3AVOA 3DDCA 3VR6A 4O3MA 1XB2A 2ZITA 1XEXB 3GJ7A 3C4JA 4HAWA 4CZ2A 1W4RA 1ZD9A 3W9YA 4AKHA 1P2UA 4ILEA 1YZTA 2KBEA 5CK5A 1QRAA 4MRVA 1U8YA 2Q21A 4NYIR 5C4GB 4F4CA 2HLDA 3EZFA 2FX3A 3KKOA 3SBDA 4I81A 3ZS9A 4NKRA 2H17A 2OLJA 2JLQA 2GVDC 3NBXX 1F2TB 5HCIA 1E2MA 4LJ4A 1SVMA 3A58B 5JJIA 3TUIC 2GJKA 3B6EA 1IOZA 2VP2A 4YMTA 1ZAKA 3IBYA 4UJ3A 4EQ6B 4M22A 3BOSA 4GFDA 1ZCAA 4LC1A 2CHVA 4Z54A 2JDID 4GNKA 4MYTA 4IVRA 1EXMA 2J7KA 3KDSE 1E79A 5KYKA 3LW7A 3QI2A 3K0AA 1TU4A 3K9HA 4W9MC 4N1AA 2ZSFA 2IS4A 1UBCA 3CX6A 4XJXA 5KDLA 5AUNB 3IKJA 4O0MA 1HT2E 2IXGA 5FR1A 5H1YA 2J7PD 4AC9A 4IDOA 4EJSA 3W3AA 4MDFA 1RRCA 4PANA 4TT3D 4FCTA 2HT6A 3ADCA 3VNVA 3HJNA 1XCGB 2IS2A 2CCKA 4PSVA 4WXPA 2E9SA 4TTRA 4JBYA 4K46A 3KQUA 4ARZA 4H1UA 2OBLA 1NSTA 5CDFA 3CR8A 2R44A 5CM8B 3TR0A 4PPFA 3REGA 3ZJYA 2Q9AA 1OH8A 2IYUA 3I61A 4TMTA 1KI7A 1II8A 4O25A 1XMVA 2QROA 3SHFA 4B3BA 1HQCA 1LW7A 3HR7A 4HLCA 1P2SA 4E22A 4GOXA 3VMFA 2P6RA 1MO3A 1G64A 2BVNA 2ZVPX 4TZ6A 3BBPA 5AWFC 2GAOA 2P3SA 4TQUS 2DFKB 4PAQA 4DWJA 4C0BA 4ZCLA 4OYHA 1X86B 3OIYA 1CULC 1E0KA 1JAHA 2W2VA 5G3YA 2J41A 1IY0A 3NVAA 1Z0DA 1VIAA 4PAOA 3K70D 1P2TA 2GF0A 2DWPA 3B1XA 2AD5A 2EFEB 3RAPR 4D0GA 3HU2A 4QJ4A 4W5HA 4BQSA 4NU0A 1E2PA 2AWOA 2HJGA 3B78A 3AQ4A 2BDTA 3NH9A 1R10A 2QL6A 1ONBA 3OIUA 1LS1A 5EP4A 3SYKA 4QM6A 2VHJA 2ZRAA 4AWXA 3H1TA 1GAJA 1QHHA 1ZNXA 2IYZA 2MMCA 4QL3A 4RCYA 3B82A 4MGZR 1Q44A 2OXCA 3ZD7A 2WMOB 5FUYA 4NYJR 3IIKA 1E0JA 1F2UA 1Z07A 2ZRFA 2ASEA 2GWHA 5CLLA 1T6NA 1MO5A 4XWAA 4OJKA 3P4YA 4FCWA 2RGDA 3HPRA 3SI7A 1G5PA 4CEHB 621PA 2VHTA 1QDEA 1CF4A 1FTSA 1H65A 1N5JA 2BOVA 2F9MA 2YC2C 3FMPB 3QOFA 2Z4RA 3IUYA 4OJQA 4E5UA 2IS1A 3R7WA 1S1MA 4Q4JB 2GDJA 1TF2A 3BH6A 1N6PA 2WICA 1PVOA 2JCSA 3I72A 2X8AA 4OBEA 4R2HA 4LJAA 4F92B 4QKQA 2JLSA 3WBJA 2QRZA 1Z0JA 4Q9HA 1GITA 1KDPA 3KXKA 4M1YA 1AS2A 4C0QC 3TSOA 1VHTA 4EPXA 2V1UA 5G53C 1YZUA 1G3MA 1J90A 2W6JD 3RS4A 4EPRA 4PTLA 5JJLA 3P27A 5TDHA 1LB1B 3OIVA 2VP6A 1J8YF 4F4IA 4MUAA 1D6JA 3AP3A 4V03A 3NC0C 3VFDA 3VKGA 3BE4A 2WZQA 4EAQA 4KV9A 2O5VA 3R8CA 2YWHA 3UXMA 4TYWA 1NVUQ 5CB8A 1FTNA 3EZ7A 4G5GA 1G8HA 5FOVA 1PLJA 1H8ED 1XDBA 4I1OA 4AI6A 4NCNA 1CS4C 3LH5A 1SXJD 1S9HA 4FW9A 1SKYB 2FSGA 1W36D 4DUGD 1XXHE 4EFMA 3KXLA 4OK5A 5IDVA 1YR7A 3IIMA 3T06B 4OQMA 1PUIA 1TNDA 4M0LA 1XEFA 2AD1A 2ZI6A 1NLFA 4DT1A 4CEJA 4BLOA 1XRJA 2R65A 4LHWA 1S2MA 2EYQA 5FOWA 3N5CA 4KXFB 4MRNA 1F48A 4Q7KA 2ODWA 2VF8A 4Z1MA 2IBMA 3ZGXA 3DL0A 3ZQJA 1DEKA 2RKOA 2GCNA 2NO1A 4KODA 4OI4A 1XZQA 2X2FA 1H8HD 2G6BA 4ITRC 3GLFB 1ELOA 3BH0A 4IFEA 4IVQA 2CLCX 3C15C 4EPVA 2EQBA 2JJ1D 4JLJA 1U0HC 1K5GA 4IFBA 3LRPA 2A5FA 2WMNB 4DLYA 2F1HA 4DLVA 5BN4A 3LXRA 2YINC 4NTZA 3VR3A 5D3QA 4IKEA 2REBA 3IPXA 5K8LA 1VECA 2CHQA 3EG5A 3EPJA 3QPVA 3EPKA 1XTRA 3WP0A 1U81A 1YZGA 2BBSA 2GCOA 2ZANA 1S3GA 1ZNYA 1GILA 2OM2A 1OLOA 3BWDD 3CM0A 4URUR 1XP8A 2RH5A 3KQKA 3OEEA 2ZR0A 2B21A 2D74A 2YWEA 2GEDA 4R7ZA 3BORA 2R9VA 2OE2A 1TX4B 5SZJA 1XPRA 1F2TA 3WHKA 1HYQA 3LQQA 3Q9LA 2FPLA 1VG9B 3ASZA 1Z2CA 1E32A 4BFVA 4EQ6A 3SQWA 2FGKA 5J4KA 2RAPA 1G7CA 3D8BA 1ZBDA 3FDIA 4I99A 2F55A 1MRNA 4BLSA 2VP9A 2VRWA 4LWZA 2ZS7A 3AVQA 2VP5A 1B23P 4P32A 4C0JA 1KTVA 2ATXA 1DELA 1DG3A 2JLYA 4W7SA 4PC6A 4UKDA 1QF9A 4ZKEA 2CL0X 4FD2A 1NSFA 1P9NA 2A5JA 2LKCA 2JGNA 5LB4A 4I4LA 5C46F 1E2LA 3GJ4A 1VYTA 5LB2A 3WBKA 5L3QB 2FZ4A 2PT7A 3WNDA 3SEAA 4D82A 3QXJA 3B1VA 1OFIA 2W2XA 2QMHA 3V4FA 3TRFA 1KI9A 3LX8A 2OHFA 3U44A 4ZI3A 1ZIPA 3CB4A 2GK7A 2IW3A 2GJSA 4ZV4A 3X2SA 3WNCA 4V0ME 1W46A 2CK3D 4KFTA 1W4BA 1JQJC 2NZ8A 3P4XA 1P75A 1DAEA 4B2LA 1DAGA 1P6XA 4UJ5A 1B0UA 1T91A 3NDBB 4F38A 4TQ9A 5JJKA 3SU8A 1IN5A 2YC4C 2F1JA 4EPWA 3DO6A 4DSUA 1NBMD 3SN6A 1N0VC 2HUPA 2J0UB 4TQAA 4JLVA 4V0KA 3ZD6A 1U9IC 5H68A 3VR1A 1TQ2A 2LCFA 2O0HA 1XD2A 3MLEA 5HZHA 3V9PA 3ND9A 5FUWA 1YR9A 3K0FB 4DHEA 4MRRA 5BN3A 2IYRA 2DCUA 2XTZA 4Q7JB 1KI4A 2RGGA 3L8YA 4JLMA 4PZLA 5SZHB 3KUCA 4RZ3A 3T35A 4U7DA 3CPJB 1R4AA 3CONA 2WVJA 4ACAA 4BLPA 2FSHA 3BB4A 3MMPA 3RS3A 3OFNA 1FQJA 4DCSA 2XNDD 4D80A 3CO5A 4TYPA 3BIFA 3TE6A 3I4LA 2GZHA 1KMQA 4QG7A 1W0KD 4I1SA 1P73A 2F43B 2XOKA 2DPXA 4NMMA 3I92A 2H1LA 5EZ6B 1TQ4A 3RRZA 2CE7A 5DIFA 1KDTA 1KI6B 4QNRA 2IYVA 2ZYWX 2XB2A 2CHGA 3QG1A 3IGFA 4MKFA 5LD2B 3U4QB 5F9FA 1N25A 4L15A 3CX8A 4LCBA 3V00A 3GEEA 1E2EA 3QF7A 4LUCA 3LVQE 4Q4JA 1G7TA 2QT0A 2PLFA 5JBQA 2ZR9A 4PX9A 4DLSA 3U7GA 1CRQA 3NH6A 4P4SB 3SYLA 4PZYA 2I1QA 5KSOA 2A9KA 2ZI9A 1E2QA 1W0JA 1YRBA 4H9GA 3AKDA 2VBCA 5AJWA 1XMIA 2VQSA 1X1RA 1LF0A 1V43A 4Z8XA 5FI1B 3TQCA 3TJZA 3GLIE 1XEWX 2AFIE 4URYR 3OF5A 1R5NA 3AF0A 5EXXA 2FPKA 4OL0A 2XXAB 4FMCB 3AVXA 3UG7A 3CNLA 3GFOA 1SQ5A 3W3ZB 1T9HA 5EE3A 1WXQA 2C9YA 4G3XA 3SFVA 2TMKA 1S0UA 2VHUA 1RE0A 4LRWA 1G7SA 3GJ3A 2VF7A 1QHSA 2KB0A 1OFTA 3CX7A 2IF0A 2NO0A 3A1VA 2BEJA 4L8GA 4QBGB 1TTTA 2QGZA 2CJWB 1AQYA 1WA5A 3AP2A 5FR2A 5FBRB 1KAOA 1CJKC 1VIYA 1V5WA 2AK2A 2EW1A 3CRVA 3X1YA 2O0JA 4NL4H 3PFIA 3NBYC 4C0AC 3OEHD 2REXB 3X1ZA 4PO1A 2GBLC 4BFTA 1GSIA 1E2JA 5E7IA 3V4RA 1DARA 4B3GA 2B8TA 1XX6A 2GXAA 3S1AA 3F5FA 1NVVQ 2WWWA 4LSGA 3WY9A 5L3RA 4P3YA 4MA4A 2V4ZA 1GRNA 4EJSB 1Z6TA 2IEZA 2FSIA 4BASA 2ANBA 2YOHA 4BPBA 2P0EA 1U9IA 2QN6A 5F98A 2Q9CA 4NYMQ 3UWOA 2NO6A 3DOEA 3B1WA 3ZIAD 1TQ6A 2VSXA 3M4YA 3W90A 3KFVA 2RGBA 3QJYA 2FJUA 4OHVA 1II8B 3PEVA 1G8FA 2WAYA 4M1OA 1G7RA 3AEZA 3G5UA 4DC9A 2OBNA 2VO1A 2KE5A 5FTMA 3T1OA 5J47A 2WWFA 3ZZTA 1G16A 3A1WA 3PVSA 1M1YE 2R6CA 2HXYA 3SJBA 5HZKA 3BK7A 2HYDA 3GQBA 4IDPA 3SHWA 2GHIA 2IWRA 4BLQA 1CJUC 1E96A 2I1VB 4G0NA 4Q01A 4TLCA 2JASA 1KSFX 2ZROA 4HEJA 3U6KA 2J87A 4RKEA 2NGRA 2GCPA 3QXXA 4PO8A 4RZ2A 2QA5A 4BLTA 2NMVA 1G5TA 3O8DA 1GNPA 4BFSA 4ESVA 1E2KA 2IXEA 3MGCA 5F9HA 2W58A 1KJZA 1MH1A 1Y3AA 5AUPB 4M1KA 1N6NA 2BKEA 2QBYA 1SVOA 3PCRB 4OQLA 2IXFA 1EWQA 2QY9A 521PA 1M7BA 2FFAA 1D2NA 1E2DA 3AKYA 1LTQA 1GRQA 2V6IA 1D8TA 1QHHB 4KFUA 3KX2A 1JXOA 2QP3A 5AR1A 2NPFA 3K8YA 3KKNA 1WE2A 3C8UA 2JIZD 2ORWA 4OK3A 4DSTA 2QBYB 1F2UB 2NZJA 4IXMA 4HYYA 2AN9A 3TW4A 3SJAA 3QXSA 3BRWD 2QE7A 3CNNA 4QHSA 5LBIA 4PR0A 2WSMA 1TEVA 1J2JA 4JBXA 2ZRIA 1N5LA 4NCJA 3ZYCA 5J4YA 4X8MA 3QSYA 5K8UA 2V3CC 5FUVA 3LBHA 4Q9JA 3WYAA 2RCNA 1XD9A 3TAUA 1I4TD 2YZ2A 3QXHA 4NH0A 4D25A 1Q20A 1UDXA 2GBLA 3MG9A 4V0OA 4XVQA 3PXGA 1FZQA 1E4YA 4ESHA 2OAQ1 3NTUA 4WW0A 1ZIOA 3LX5A 4JVSB 3D31A 2R8RA 2UVQA 4MGIR 2GNOA 1QHNA 3PEUA 1SKQA 4ASUA 3I8XA 4A2WA 4TMWA 4D6PA 5L3VA 1N2CE 1G3IA 4DLXA 3L0IB 3TR5A 3TVTA 3B1YA 4LV6A 3GD7A 4K81B 4Q7MB 2E1RA 4OHYA 2VSFA 3GJ0A 5G3ZA 3GJ6A 2N1BA 4BZPA 1CR1A 1FQKA 4EFNA 2JLZA 2C9CA 1EX6A 3EA0A 2J5XA 1FNMA 4M9QA 1S8FA 1U98A 5FOTA 4TLAA 3QVVA 3IIJA 1Z0AA 4AY2A 3TKLA 3L0OA 3REFA 4C30A 2PJRA 4O2LA 2OFWA 1ZM9A 3K53A 5BQ5A 1XJCA 3GMTA 3FKSA 3VR4A 3L43A 4US0R 2YJTD 4PSKA 4HLQB 4AYWA 5KUTA 1PZNA 3U60B 2GF9A 1KO4A 3CR7A 1W36B 1T0JB 2V7QA 2GRJA 1SHKA 2XSZD 1JXMA 1E9BA 1KIMA 1MOZA 1RFLA 1T3LA 2F43A 2FN4A 2NO9A 2OLKA 3K0CC 4TYQA 4LYFA 5J40A 4Q1DA 3SOPA 1NN0A 1OIVA 4E07A 2WKQA 4DIDA 1U8AA 2GXUA 4WZ6A 5GADl 3ZVMA 3PUXA 3MD0A 3TVDA 1DTSA 2V1XA 1EK0A 4HAXA 4IEIA 1R6BX 2P5TB 1GFIA 3HU3A 2C99A 4B44A 3K70C 3CPHA 2MSDB 1W44A 2QG6A 3AVTA 3KJIA 3H2YA 4HAUA 5DN6A 3CW2A 4BEJA 3IHWA 4GMDA 4LYAA 2WJHA 2ZJ2A 4LYHA 2H5EA 5CLQA 3L2OB 1YZNA 4FI3C 4D26A 1OKKA 3PEYA 5TY0A 2ODBA 1LFDB 4UNRA 4TZ0A 3VR2A 2CCGA 1P4SA 1TMKA 1RJ9A 4KLNA 4L5BA 4X8OA 4HB2A 5DYIA 2JA1A 4ZKDA 2XXAA 4DDVA 2GCOB 4RD2A 5IF9A 5JRZA 1SXJE 1KK1A 1UKEA 3PENA 2G0NA 3BB3A 1GNQA 2QTHA 1G8YA 1WMSA 4ZO4A 1FPMA 3Q7QA 3BB1A 2YOFA 5TV2A 5FTLA 1GDDA 3KKMA 1RRPA 3CF0A 3LQRA 3FFBA 1SVWA 2ZUCA 1VDZA 2CJWA 4NP6A 1JR6A 4TTQA 3RVBA 4GZMA 2JATA 4Q1FA 2DWOA 5FL7D 2RGCA 3AVPA 3MRSA 2DBYA 2RGNC 4KLZA 4WAUA 1ODFA 2AK3A 3SJCA 1JJ7A 4KBGA 3RSOA 3WMEA 2JDIA 1N6OA 1DG1G 2VYFA 1A5TA 1L4UA 4DIEA 1P2VA 1OJLA 4PQFA 5HKKA 2ATVA 1PV4A 4N3NA 4JVMA 1NJFA 4JT4A 1M7HA 4PFSA 1MRSA 4XIGS 2J7PA 4YMSA 2XGJA 1ZMXA 4TT3A 4BFUA 4B74A 2A30A 1G18A 4HUQB 1WB9A 5GVSA 2GEVA 1L4YA 5J4LA 2J46A 1E9CA 1RKBA 4ZDKA 5J4VA 2V8OA 1Z63A 2QTFA 1A82A 3BC1A 4L9WA 3U44B 5CK4A 4P4UA 1ZM3A 3T61A 5EE1A 3KFXA 2KJQA 2JJ2D 2I4IA 4EPTA 1XPOA 5JFGA 1YZKA 5E7JA 1T8UA 3NXSA 1D9ZA 4O2RA 3GLGE 3LA6A 3A4MA 2YKGA 1VCMA 1W2GA 4NPHA 3K0CA 4AG6A 2EFCB 4UNPA 2NTYC 4A0RA 4Q9LA 2VL7A 3RS5A 1IXRC 1S1CA 4KSCA 121PA 3UIEA 4BRUA 4CIDA 4E03A 5SZKB 1G21E 4R9UC 2GZAA 2ORIA 1Z0IA 2WKPA 2GAAA 4M1MA 4DLTA 1W36C 1OH7A 3B5JA 3I62A 3SR0A 4XSGA 1Z6AA 1ZU4A 4PPNA 1XD2B 1KI1A 3L8ZA 1FMJA 2ZAMA 2NG1A 2ZS9A 1TF7A 3NIBA 4KJZA 3T34A 5HTKA 1T5LA 1E4VA 1NN1A 2RGAA 5GJVC 1C9KA 1ZRHA 2QU8A 3ADDA 1EFRD 1Q1BA 4BE7B 3MWKA 4POAA 4B47A 2QAGC 5CYOA 4JLBA 3KB1A 5JHGB 4Q21A 3EZ6A 5GVRA 3LO5A 1AKEA 1JEEA 1VPLA 1NMXA 1OV4A 2HXSA 2ZRJA 5IT5A 5KPDA 1NF3A 1T3SA 1KJWA 1ZVQA 3DVLA 3PIRA 4BWYA 3EX7C 4IOMA 1XD8A 5H8WA 4JIMA 1LF5A 2WWXA 5FBLB 3ZH9B 2ZRHA 2QQ0A 1N6IA 2X19A 4HB0A 1G8GA 4JSTA 2ZPTX 3CZQA 4DEXA 5C18A 3VNUA 5G40A 1G3RA 2AKAB 2C5LA 4US1R 2XZOA 2VP0A 1US8B 2D2FA 4TMXA 2RGNA 1NBME 2BBWA 5FFMA 3RC3A 2DWQA 5AK0A 2FOLA 2A3RA 1G9XA 1FP7A 4JJKA 1AJEA 3C7KA 2ZJ5A 3R9WA 1XXHB 1M34E 3NEYA 1Z47A 2Z43A 3EIHA 3B85A 3FMOB 4TSFD 4TMVA 4ZDWA 2KBFA 1NL3A 1OPXA 4LJ5A 4MGKR 1YHNA 1W7AA 3DZ8A 3MCAA 4MRSA 4OHZA 1IN4A 2WPDD 1E0SA 1DO0A 1OXTA 3JVVA 4QXAA 3A4NA 4CRWB 3VX4A 3U7FB 1E1RA 1NLYA 1D2EA 2CXXA 2ZJAA 4DLUA 1M2OB 1OXUA 2F3RA 2W0MA 5CIQA 3W6OA 3OIWA 1RYFA 2LWIA 2ZRGA 4IXNA 1EWRA 1R0XA 2W6JA 2HCBA 4B33A 4KBFA 4JSYA 4V0LA 5FTNA 1FW6A 5JZVA 1FOEB 2ZTSA 3O47A 2J9RA 1UFQA 4P33A 1XTIA 4DSOA 2V55B 3BGWA 4PQRA 2IHYA 2UZ3A 5D3MA 2BC9A 2ONJA 1R5BA 4YC7A 4DZZA 4JVLA 1DS6A 3E2IA 3LWNA 1T8TA 1KJYA 1R7RA 1MT0A 2RMKA 4JVNA 2OCAA 2F7SA 2QMOA 4G5SA 1PLKA 3W6NA 1E1QA 1P72A 2XNSA 3CZPA 3LVRE 3OE7A 4A9AA 5KDOA 4KI0A 2J0QA 1D9XA 2B92A 3KZ1E 4I1VA 4A2PA 4G5RA 1X8KA 2YV5A 3ONWA 3S1AB 1Z0KA 1DAKA 4HAYA 5KDDA 3MJRA 4LYJA 4N0DA 4OI2A 4GI7A 2ZI7A 4KAXA 4MYHA 1OF1A 1RYHA 3LLUA 1S4QA 2CE2X 5KO2A 5JWOA 4RD0A 3RDPA 1ZM2A 4ZIRA 1Z5ZA 2IYTA 3DMNA 1M8PA 2WJJA 4A8JC 1NY6A 2G0TA 2ZJYA 2KI5A 3GPLA 2GVZC 2IX3A 3M6AA 4NE2A 1GRRA 2VPPA 1EFTA 1U0LA 2C2HA 2IYQA 4JYCA 2QAGA 2PLRA 1ZCBA 4JLOA 4FWTA 1H8HA 2AHOA 3QUSA 4PHGA 2IWHA 2WHXA 3T1VA 2OUKA 3AKEA 3EC2A 2JJ1A 5JMTA 1F60A 1KHTA 1XMJA 2IUSA 4TYYA 1ZM7A 3UKDA 1OYYA 1W47A 5FI0B 1JI0A 5C4MA 4WVFA 2BWJA 3A37A 4D81A 2K5UA 5C1BA 1TADA 2WBLC 2FDCA 4F93B 2VSOA 4M2LA 1XTSA 3WNBA 4A36A 1W48A 1GWNA 3NDPA 2IYSA 2BCJQ 5IHPA 3AP1A 1KDRA 4Q4LA 1P60A 1X6VA 4S2EA 3LW8A 2DFTA 1FUUA 2REOA 4R2IA 3FMFA 3IHLA 1W1WA 5FTJA 1CR0A 5KPJA 1VHLA 4XTCS 2FSFA 5FTKA 1YQTA 5FBWB 3EIEA 2D06A 3K9LA 5HCNA 2QI9C 2YHSA 2HEIA 2ZIAA 421PA 4CEIA 1IJEA 2X2EA 3R20A 4MITA 3KB2A 4HDCA 2ODNA 3ZVRA 3C41J 3IPYA 3QE0A 5KOYA 2GA8A 3N70A 3T1QA 3OEED 3I3SR 1KSGA 3TUJC 3A1SA 3FOZA 1HT1E 1HY3A 3WRXC 4C2UA 2YOGA 3AM1A 1XCMA 1E9SA 2ZU0C 3LY5A 1UBGA 2Q6TA 5CYPA 4NONA 1HUQA 3MWJA 4FINA 5JWRA 4EPYA 2PBRA 4D4MA 3FPAA 3CF6R 1WDTA 4U5XA 2P65A 5CJ2A 4CVNA 2ZJOA 2N46A 2OCBA 2JLRA 4QHYA 3TSWA 2QM7A 1IAQA 4KU4A 1KSHA 2ZEJA 4P31A 5KTYA 2NPIA 3G0HA 5A4JA 3GLFE 4HUQA 3R9XA 3QNUA 2JLXA 1GIAA 3BFXA 2YYZA 4Q66C 2P6NA 1UM8A 5EXSA 1E2HA 1TU3A 1PJRA 3ZDQA 1IBRA 1J99A 3VR5A 1OE0A 5UKDA 4JLKA 4IDQA 4PQYA 3MAAC 2Z5FA 5FOUA 2GJ9A 5EUQB 2BMFA 4DLWA 4UXIA 3TIFA 5JRJA 1II9A 4L16A 4B48A 3IILA 1HV8A 1OB5A 3DPUA 2QP4A 5BN5A 1VYUA 4PO9A 5DHFA 4A8JA 3ZVLA 1LY1A 3T12A 3VAAA 3TLXA 3KQLA 3L0PA 1DBSA 1NBMA 1P3JA 1W4CA 2FA9A 1DVRA 1OYWA 4BZXA 1ZD8A 1OB2A 2O8BB 3RS7A 2QT1A 1KOFA 2ORVA 2CMKA 5IK2D 1XEWY 4RD3A 1U99A 1IQPA 4B73A 1MR3F 3GLIB 1JNYA 2CLSA 1QHXA 2H16A 1W5TA 4BECA 5LPNA 221PA 1JJVA 2IYYA 4IOLA 2QMEA 2G9NA 1J70A 2YVUA 2HF9A 1AS3A 1UEJA 1WBBA 4Q47A 4Q00A 5FBQB 3KJHA 4LJ6A 2XNDA 3FE2A 2WKRA 1X3SA 2XJ4A 3U2QA 2ZSAA 1HQYE 1COWD 2DY1A 1N3BA 3A1TA 1W0KA 4LHYA 3C5HA 2AR7A 1CBUA 3BFVA 3NHBA 4Y0AA 1N6HA 3PR1A 3NEJA 2ZR7A 2OFOA 1R0WA 2ZRNA 3DM5A 3M1IA 3OFND 4ZCMA 3GLHE 1JEDA 4NYIQ 4DLZA 5GJWC 1NG9A 2FGJA 1K6MA 4PHFA 1US8A 4HAVA 5AJZA 5EE0A 4LHZA 3H84A 3CH4B 4XVUA 2CNWA 2EU8A 2XOKD 3GFPA 2RGXA 3KTAB 5ELXA 4FIDA 2QMUA 2WSSA 2PT5A 3THYB 3MSXA 3QPUA 1XXHA 3WXMA 1VKJA 3HPQA 4IDNA 4IOKA 2VHQA 4BFXA 1FUKA 3CRMA 2F3TA 4HAZA 1MO6A 1OHHD 1RJ9B 1G291 4KSBA 3TBKA 4CT4B 2B7BA 4D4KA 1XTKA 3U3MA 1Z3IX 2Z83A 1BMFA 1CR2A 1GUAA 5CIWA 3E1SA 1W0JD 2O8CA 4JL8A 1ZUIA 1QG4A 2Q3HA 3FVQA 2J45A 5EQTA 4QBHA 1JR3D 3RWOA 4PC2A 5JI2E 5KNDA 3VHXA 3CRW1 3RRYA 3BXZA 1I2MA 3B13B 2X77A 3QXCA 1E2IA
chains in the Genus database with same CATH superfamily
1KSJA 3O91A 5GTDA 3C5CA 3FB4A 3R4VA 5A5DA 1Q1EA 4PC7A 1OREA 2Q2VA 3RASA 1SBCA 1X1SA 4MRMA 4IQ4A 2QS9A 4YTEA 1L7EA 2AEEA 2JD2A 4D9GA 1RYBA 5B57C 3H5RA 1YZ3A 2JFFA 5CX4A 1EWVA 4JENA 2JI6A 3DVAB 1QDLB 2C5EA 3BT7A 3JAMA 5DSZA 2H52A 4A1FA 3U48A 3OEHA 1C3XA 2P3OA 3K09C 3KR1A 1J0EA 2DX7A 4OB7A 1RAIA 1C8VB 4EA7A 5BOSA 1MQSA 1T9CA 2X8BA 5CVTA 1KTIA 1Q2UA 2OVFA 2CXUA 2PUTA 3FHJA 3H16A 3AL2A 1YZFA 3H7IA 4IIUA 1QG6A 3LJKA 1GGKA 1I4DD 2JEZA 5G0WA 5P8WA 3RFUA 1FYDA 1JAZA 1XDGA 4EF6A 4Z8YA 1Q0LA 3NHKA 10MHA 1D6MA 2G83A 4BQPA 4TN5A 3UAXA 2WOJA 2F1KA 4D8YA 2ZJBA 2GZRA 1GYQA 2TYSB 3FG9A 4GPEA 3T1NA 2JGAA 1Y1LA 4EABA 5SYMA 4NZOA 1QAMA 4L76A 2OKCA 3E9NA 3WNVA 2DFLA 3FCXA 1P0QA 1JHOA 4Y2XA 1VCHA 1M75A 5BN1A 3LT1A 1IM8A 1WQ3A 2PQMA 3E18A 2XHZA 3F6CA 4RCZA 1RQRA 1A4UA 3OCWA 4F8JA 5I7OA 4R7GA 3LCJA 2E4VA 1PG2A 3PQ5A 3ORSA 5CX1B 1VLJA 4EMUA 3RVPA 2I6SA 1F6DA 2B2XA 5BNTA 2YWFA 2G08A 1UBFA 4QULA 3PC8C 3WLPA 5ITZA 2YTZA 3GEDA 4JB8A 3MJ4A 5CJPA 4WXMA 2R8PA 4XW2A 1C29B 3RS2A 2BR4A 2VUIB 4C06A 1Q91A 4MVJH 4MUFA 2G9UA 4RFSA 2WU4A 1SXGA 1FF9A 3OQBA 4OIMA 3O7MA 3UXHA 5KJ6A 2ZWAA 2DLDA 4FGSA 1FL9A 2JGEA 5EWJA 5BV1A 3PKZA 4OXYA 3I2YX 3WC4A 4MGHA 3DOIA 1OLXA 4V0MA 1E1YA 2D13A 3VVLA 4BNWA 4BRSA 1CYDA 1EIZA 2PPLA 2ZBFA 2EJBA 3K5PA 3OX3A 4QOFA 3S29A 1U8CB 4IVPA 3VPDA 4B8ZA 1YIDA 2NSYA 4DMRA 1KFBB 1KYYA 2A78A 3HBJA 3PUIA 2CCJA 3E8SA 1KK2A 1RTTA 4J8PA 4J16C 4V3BA 4WZZA 1Z5VA 1P9OA 1KI8A 4BMNA 3ICQB 1TAUA 1UBSB 4L6AA 5HGJA 4QGBA 1GUYA 1ZKDA 2Q0XA 3DQPA 1HE1C 4Q9KA 4P84A 1OSNA 1U0OC 2YJGA 4FJ1A 2HV9A 2RHTA 2PR2A 3HFSA 3ZEAA 1JHZA 4I4NA 2GN8A 5REQB 1KJJA 2YR0A 4JWKA 3OOHA 4KMRA 1D2MA 5L3ZA 4EG1A 3EJWA 3GFTA 3MS2A 2BKXA 1T6XA 4TS3A 4ETIA 1IM2A 5LLSA 4ZPXA 3M6VA 5AJYA 2P1ZA 2UYQA 4BKQA 4AG3A 5CA1B 4QBTA 1A5BB 1MXHA 2G3YA 2OESA 3FNFA 4RTNA 3IE2A 1LKZA 2O5CA 4ZQEA 3C1OA 2PH3A 3S2EA 2G4VA 5EMKA 1D5WA 2O7SA 1L7QA 2ZBRA 2XF8A 2NV0A 1G5IA 3E2PA 4ZAXA 3J81A 2YXDA 5IULC 5A03A 1R0BA 3ABIA 4K2AA 1GDHA 5JNVA 1DEAA 4XD7D 1I94B 4D4IA 3A31A 3R3WA 3CLSD 1J07A 3TTXA 3NCHA 4BO4A 5EJMA 4MGYR 3I37X 1J06A 3PQCA 1Q3TA 2SHKA 3BJMA 4YRQA 2NQ8A 1EGHA 4FCCA 2P11A 2J3JA 2ZVQX 4Q18A 1Y7IA 2OBXA 2XCOA 3UICA 1ONSA 4GBMA 1BD4A 1P29A 2P1DA 2WT4A 2UZAA 2IGTA 4GBGA 4XCVA 2IE0A 1G6KA 1MF7A 1TCBA 2JBHA 2P2SA 3COSA 3M1YA 3RVLA 4JBWA 2J6BA 3PRKE 3VC7A 1MAWA 4FMCF 4TKUB 4RJLA 2RG1A 2I6TA 5HBGA 4KO2S 4ZZ0A 5DI3A 2ODQA 5EESA 2DUUA 3K1AA 4YBZA 5EMMA 3IBGA 4P7FA 3SEFA 2HMSA 3RC7A 3VDXA 3CNHA 2ZGVA 3ABRB 3RJMA 4TTSA 2SCUB 1J42A 1I8TA 1TIBA 2JZCA 1OIWA 1XRPA 4LX8A 1RPTA 1Y8QA 5I8PA 1MLDA 5IF9A 1S8NA 4EP1A 4Z4FA 4OBWA 2Y77A 2E6UX 4G5QA 4PZ9A 2H6EA 2EYUA 1J9ZA 4ZEVA 3U3KA 1L8AA 3LK7A 4OUDA 3FYUB 1S3FA 1P61B 3FAZA 3KS9A 2FMXA 3I01A 1JDPA 1E99A 2QZ9A 3R5JA 4MV4A 3R8FA 3GWGA 3T9AA 2G1JA 4EFDA 4YRGA 2XQKA 4ZPJA 4FYYA 1YVDA 4GVPA 3WQSB 1CY0A 2AWNA 2VWQA 3NBFA 4J1TA 2HFJA 1TOAA 1R88A 1U31A 2XZLA 2HPHA 3GU3A 3H97A 1L4FA 1ESMA 4R9RA 1V1JA 3ECCA 4MDYA 4RKQA 4YXWD 3P20A 5B3JC 4R6WA 1U3VA 1N2IA 3NWPA 4RZXA 2WZBA 2WILA 2XUIA 4MVCA 1XWWA 2XW6A 3JRNA 1LS6A 1MH9A 3ITNA 3KT0A 2GYVA 4II3A 4BV2A 3HCPA 3NYQA 2GILA 5SZIA 1PKXA 3UMJA 4XM0A 4J4TA 3W5JA 1B0ZA 1XLVA 1YB2A 4PHHA 4WADA 5EVCA 4YDRA 5EJFA 2OK7A 3IEIA 3FOEC 3HKDA 3RBZA 4FUTA 4GPTA 1J97A 5TLSA 3F9IA 4WXRA 1XZBA 3AJ8A 1AKYA 4QXPA 1GNTA 2B4TO 3FNRA 3FDZA 3AF2A 1JAIA 3GVIA 4EJ0A 2WJ6A 1B42A 4LHVA 3MUFA 3TJRA 1BX3A 2Q49A 3GB9A 3WDLA 1VXOA 1ZUD1 4G0QA 4EHJA 1JGTA 1YR8A 4HAIA 4U6QA 1JQKA 5ALPA 4DGQA 3OWOA 2P6PA 2XBUA 3EFHA 5MN4A 3KSMA 3SZRA 1QNFA 2BLLA 1AOXA 3ZV4A 5K6AA 3CLVA 5ERXA 4FEYA 3VC3A 5AQEA 1ORVA 1PGNA 1UBLS 4RHTA 1VL1A 3TZQA 2CFSA 2ZT8A 1SR8A 1CXZA 2NU8A 3AV0B 1RRMA 5AKIA 2HLDD 2W83A 3MTJA 4G6ZA 1OI3A 3NGLA 2AOTB 1FLNA 3BZBA 4LQCA 1W73A 8GPBA 1E64A 5FL7A 2CDNA 3HFJA 1B14A 5CFMA 5BSEA 2WWVD 3T1HB 4HF7A 1TJ3A 4JK3A 4WDRA 4WZBE 1G21B 3TM5A 4URZR 3U3ZA 1KC1A 3AV3A 2CXQA 4HGQA 2Z3ZA 3G5MA 1WQ1R 1FFHA 1X7ZA 3AGPA 4GQAA 1Q5PA 3O2SB 3HH8A 1Y3IA 2JIRA 1CWUA 2WE8A 1JP7A 5F1OA 1HM5A 1U8ZA 3K9GA 4YWJA 2C78A 3MBKA 5T8KA 4UBJA 4NESA 3T1TA 1TUBA 3ELWA 2W71A 1FDOA 3H75A 4F2HA 1G6OA 2WQ6A 2WOOA 5IVHA 3WSVA 16PKA 3W8RA 3TUZC 2IXTA 3U16A 1CRPA 2ZYUX 1BDBA 2EEZA 2H4WA 1VIDA 1F8GA 4QJ5A 3SX2A 1B8PA 1ZD4A 3ZE7A 2V6MA 2C9OA 4QUJA 2QTMA 4WBNB 4LF4B 5FRDA 1Q14A 5KCZA 1OYOA 1PX0A 1ZIDA 4GI1A 3ZQ6A 1B2LA 4NE7A 3SFTA 3U3DA 2ZVDA 2ZUTA 3R75A 3GZTB 1ANKA 4JLPA 4GP6A 1GGJA 1OVMA 1WZNA 3QLEA 2I6XA 1GEEA 4I5EA 3P0JA 4YDSA 3E5HA 3WLLA 5BNZA 5BSWA 4GMKA 3DKRA 1SG0A 1WETA 1VJ5A 1DBIA 1JHMA 2CSUA 3BN3A 4G97A 1GVNB 3CUKA 4B3DA 4MWCA 1FVHA 3E23A 4KQEA 1I24A 1SIWA 3F7OA 3LHKA 2QN8A 5FPSA 1OH6A 4CWAA 2CL6X 3F8SA 5JSKA 3L82B 2AJCA 5BN5B 4C7XA 1KJ9A 4JA0A 3RV4A 3ZU5A 3X44A 4EECA 3HJUA 4OAOA 5BV7A 3SYRA 4M0MA 1PFVA 2ZP1A 2ZREA 3ZXSA 1S9DA 3BDAA 2VYNA 3QPWA 3WLIA 4PF1A 1VIVA 2ZETA 4AY6A 4LJ8A 2WTAA 3TTUA 3UAYA 1FRVA 1ZH2A 3EXHC 4LY6A 4OGWA 5DYGA 1X15A 4IP0A 5GMOA 2ZULA 4AX4A 3DFKA 3RU9A 4BLPA 4BWGA 1RXWA 1YJ5A 1CJSA 2XH8A 4S35A 3MT8A 4CV0A 1E6EA 2QLTA 1C41A 1TF5A 4RMHA 2MMGA 4XIYA 3B7GA 5IVIA 3RS0A 4KQGA 1Q1NA 2ECFA 1U6KA 3W2EA 4ED9A 1MJGM 4MV6A 3IQXA 4DBVO 2FI1A 1NM5C 3ROXA 1DJOA 1JRLA 3RRMA 4DFDA 2AXQA 4JUFA 3SCZA 1YQEA 1KEUA 2NVBA 3NTXA 5C2JB 5E1OA 5F7JA 2EOAA 3RT7A 4HWGA 3MMNA 4JI8B 1B6SA 4W7HA 4KQHA 1EPUA 5HOQA 5JXJA 3RAJA 3Q41A 3RIHA 2RJOA 3ZGOA 1V41E 3DE5X 1CW2B 2XB9A 3EIOA 3HSKA 3QPBA 3UUEA 3R0VA 4ZOLF 2QPAA 1Q50A 3OJEA 4I9NA 4NEQA 1P8AA 4JD5A 3BRQA 4B35A 1NW7A 3WQRA 3DBRA 2FWBA 3LWDA 4X1IA 1XRLA 4OXXA 2OO3A 3HU1A 1EUCA 5KVCA 1NONA 4FLFA 1SD5A 4L27A 3VGPA 1IN1A 2RHJA 3SOZA 5EIXA 1KQPA 4ZYLA 4H17A 3DJYA 2C3YA 4TX1A 4RWEA 1V3VA 1N0WA 3F47A 2QMZA 3N2GA 2HMVA 3NV7A 4D9EA 3W0LB 4GDFA 1EDBA 5IRCD 4CIAA 4LIPD 4DHWA 5HNKA 1E2FA 4U2GA 2EERA 1GYRA 3K9CA 5CA0F 1C1YA 4QFBA 1G60A 4IIJB 3PE4A 3DMYA 2DC1A 2PX3A 3H1FA 4OYLA 1CS0A 1SFRA 2NO7A 2YWCA 5JS6A 3B36A 3KT6A 1FDUA 1IB6A 2DQKA 1E89A 3HZZA 4MCAA 2YIJA 1PBNA 4YJHA 1I0LA 3WMRA 4O4JA 5CAEB 5BV2P 4JT2A 1UWCA 1E1RD 4RVDA 3ZJUA 2FRVA 2NUTA 2UUOA 2QVLA 3KRTA 4H3VA 2A7QA 4G9EA 1O3YA 4X54A 1GCOA 1X94A 1YRQA 1X80B 5AKKA 3CXRA 1CQXA 4KXUA 2EX4A 1CR4A 5A7GA 5A4DA 5KNLA 1UEIA 4DV1B 1PT8A 1UFKA 5D6OA 5FWYA 1KNQA 1TK3A 3Q8KA 1HMYA 2GHRA 3I64A 3E3AA 3A04A 1DRJA 1SXJA 3DBIA 2AMJA 3FVTA 3AIKA 1H3FA 3ROKA 3TXYA 4G2TA 1M5RA 4ZQIA 2QPTA 4ZDJA 2P9ZA 4WGFA 4US2R 4R16A 4H2DA 5TB5A 3L8MA 4AP6A 2XJ9A 3U4CA 1GPAA 4ER5A 5JG7A 1XEAA 2GNPA 1NVXQ 2IEDA 4NBUA 4PC1A 5C5EA 2XBLA 1JG4A 5KC9A 2V03A 1K88A 1QFJA 4FT4A 2WLTA 1PG0A 2WAAA 4CGZA 3HACA 1XK7A 1ZN8A 4M7RA 2I67A 2PEYA 1YCFA 1XPUA 1ESDA 2GTIA 1WXHA 1KDOA 2AN4A 4RVUA 2E5LB 2PWAA 3D6HA 1IXZA 2D2IA 4P58A 1Z5OA 4DSNA 2R8XA 3TSYA 1F14A 3ETCA 5C7YA 2WWRA 3ID6C 4HDQB 2R2AA 1M0EA 4DUPA 1Z45A 3P9ZA 4FB4A 1MG0A 2RH8A 5KYWA 3ZZ0A 2I7TA 4M9XA 5KJFA 2PANA 3BWYA 3KYDA 1VE7A 1YKSA 2CB0A 4KUGA 4WA7A 4Z1MD 1I2DA 1Z3CA 3PC2A 4ONEA 2IK8A 4UAJA 4F3CA 1XTJA 1M2EA 13PKA 1MABA 1OU4A 1X9GA 1YZQA 2E4UA 2PSDA 3ADOA 1AHNA 5P21A 5K3FB 1KQ3A 1X8JA 4PX2A 2ATCA 1OZAA 4LVCA 1GKIA 1KZ9A 4ZANA 3ED5A 4LOIA 2P4UA 4Q34A 3EVCA 5HE8A 5FUXA 4JBLA 3UXEA 4FYXA 1HDXA 2V7BA 2DH5A 3G0IA 1AGPA 3BPSA 3H11B 1ZMOA 3U6BA 4MWEA 1DNPA 2I55A 3ANLA 5DNCA 1ID1A 2HSWA 2F9LA 1IONA 1S4MA 3DHEA 4W5JA 4AWAA 3KJFA 2H1HA 4RVHA 3OTQA 5L3SA 4C6RA 4DJFC 4OI0A 1FFBA 5LQJA 4EY4A 5GV7A 3MWYW 3QNWA 4AG5A 4BVGA 3IEKA 5A04A 5HE9A 4ENQA 1THTA 5ESXA 4AK9A 5BYKA 2HIHA 4LBZA 2W42A 2XXBA 3HCNA 3NV9A 4JC8A 3K6KA 1OI7A 1N9KA 1SKYE 4F45A 1K0FA 3GLGA 3LPAA 1UMDB 2JEYA 1M1NA 3O6VA 3Q5DA 1A4IA 4I50F 2P9JA 5DBOA 4RJJA 3T15A 4QBIA 5I7UA 4LZLA 3VJRA 3LBFA 3D1LA 5T4BA 4HNTA 1YBFA 4LW8A 4JROA 1GGVA 1PYOA 5DM0A 4BX2A 1ODKA 5ILOA 1ZCJA 4PXSA 1E9RA 3N39C 1O95D 1BYIA 2EFDB 1MV5A 3N7UA 1UKZA 4FE3A 3SJUA 3AOEA 3SXUB 1U2GC 1J49A 1N4DA 3FPCA 3OJOA 1UP6A 5B3LA 3SKYA 3AHDA 1A98A 2PA3A 2CNBA 3H6KA 2DJ5A 2YWRA 3AQIA 4P7JA 1PL7A 3U17A 2QTAA 3ZBUA 4DJEC 4B76A 4EWLA 4KYTA 5KEIA 1NAIA 1MZPA 3JAKB 2CYAA 4RUKA 3B3AA 4CF7A 2HDHA 3PGJA 1UJBA 1WSAA 2PCLA 3ETEA 3L5KA 3PPWA 3EY9A 4QUDA 1I7NA 3M4XA 1REQA 4FWIB 4LY0A 1NT4A 1Z4MA 4YV2A 1R4ZA 4NE9A 4GKJB 2Z3VA 3NC4A 8AT1A 1B4DA 1VRVA 3IAS6 2D4HA 4FX5A 1Z2AA 3L1VA 4WLEA 1V4BA 1K75A 4KX3A 1LNSA 2OV1A 4BUJA 3CF4G 4OLBA 3ZQKA 1H2BA 1ZRNA 2EZ9A 3FPHA 1J6UA 3NVDA 3I23A 4UM9D 3MGGA 2XI4A 3FTNA 4QFCA 5EJEA 2A58A 4P0PB 1DPFA 2P7IA 4FZ5A 1A9SA 2H48A 4LMRA 8LDHA 3P9XA 3IOYA 2IYAA 1R0LA 4NENA 3BTUA 1UPTA 4H7HA 1ODTC 2EQAA 2QX9A 2OUIA 2J59A 2ZYRA 1E66A 3U7EB 3WYGA 3NHFA 3GUVA 1FP4B 3MYRA 1WKCA 3F71A 1PQUA 1RWWA 2B30A 1X7YA 2FPSA 5JSHA 3UJ8A 4JODA 1UOQA 2Y0PA 4MKHA 3R76A 3WQHA 2L19A 2I34A 3Q3JB 4I5FA 4RHUA 3O8RA 2HHHB 2GM9A 1SOUA 2EVWX 2IDMA 2Q8PA 6AT1A 2BIFA 2I9KA 3BCRA 1QOQB 3QLUA 3H2IA 4N0EA 3QKRB 1IXKA 5IG2A 2EGGA 1R4NB 4PM4A 3UWKA 1Z17A 2BFFB 2CLDX 3ICEA 1ND6A 4ENTA 4MR8B 5IZCA 4L4ZA 2PVSA 5IK2A 3L6EA 2JCBA 4U9HS 2AN1A 3OQPA 1NJ6A 3QWHA 2OV3A 3N2KA 1CU1A 3WJ1A 2VC2B 3W34A 3F7TA 2G72A 5EHXA 3DMDA 1FUEA 2AI3A 2JJYA 2DPLA 2PV0A 3FVRA 4YLGA 5IN5A 1Y9DA 3U62A 1DIAA 4OG2A 4NJMA 4YQFA 4ZVVA 5IKPA 1EJBA 1XCPA 3GNSA 3I0MA 1HTTA 4Q4AB 5LZ7A 2DPMA 1TVKB 4AZ3B 2Z9BA 3KT3A 2OG2A 4B31A 3A9WA 3ETJA 2HGZA 2YYAA 3NRJA 3T3MB 3AESB 1ISFA 4XOIA 2ZOSA 3ZJTA 1WCWA 2ZAGA 3CLRD 3TR6A 2PUCA 4C6TB 3HR8A 3RHFA 1OH5A 4C89A 1GTZA 1RRKA 3QMMA 4TKVB 1R37A 3W5IA 1KMHA 3E7DA 4KQ6A 3WNQA 1T2VA 2H9AA 1M76A 1XKQA 3ELYA 5I6DA 2EP8A 3I4CA 4BFLA 4JU8A 1JHQA 4LC9A 1KMCA 2XYHA 1G4UR 3NNSA 4WNAB 3HM2A 5K3EA 2X14A 3ESAA 1KE1A 4CT5A 3I76A 2WNIA 3JD2A 1QCDA 4J2OA 1ZGCA 3UHFA 1IWBB 4ZCIA 5EQFA 1ABFA 1IFXA 5KBYA 3G5AA 3DONA 1JVSA 2PZBA 3RJ9A 3GLVA 2EZTA 1JDBC 5J4HA 1X39A 4CKCB 4YJ2A 3AHIA 3WIEA 5KYVA 2COEA 1P4RA 3VVMA 3L06A 4HB4A 4Q19A 3OO0A 5DRTA 3WLQA 3SBOA 3FXAA 1AKQA 4R84A 4B3HA 4RTQA 4YRKA 1YRAA 2GN0A 3D6FA 2WRZA 2IC5A 3Q1LA 1QHFA 1SUWA 2XWSA 3A6LA 1SXIA 4MS3A 4NCXA 2QN7A 5T41A 1BDIA 4PYNA 5JCPA 3C2QA 3EPLA 1OFHA 3TLKA 3V7UA 4B43A 3WL6A 1JR3A 3FMVA 4R2WA 1MNQA 5HBRA 5FPPA 1FMFA 2ECKA 3UN1A 4RS4A 2J67A 4II7A 3KZMA 1M1YB 4BB5A 2UXCB 1PO7A 1AY0A 4ZAYA 1BROA 3DZFA 5I3CA 1Z6YA 2BJWA 5H5JA 3JYNA 1NVWQ 3B8EA 4PG5A 1U4OA 1NTRA 2UYGA 4IDBA 2FXIA 4QM7A 1A1SA 1OTHA 4WCFC 5NULA 3U7JA 4CM4A 4G1UC 1FX0B 2BM0A 1HZZA 4BU1A 3T5PA 4JLDA 2Q62A 4M6WB 4E7PA 3H9CA 3JD0A 3ZCTA 3LKDA 2IF2A 2P2YA 1OIXA 4LJ9A 4LZAA 1IN8A 3LP5A 2DHEA 1JQ3A 4ZCTA 3VSBA 1Q7EA 3RC8A 4RC9A 3UJCA 4G63A 4OHBA 5TVKA 3FHCB 1U0GA 3QFFA 2QUZA 4NC9A 1YBMA 2WAOA 1K4YA 1WZCA 1XTBA 1D6SA 3RI3A 3HCCA 4AF6A 4CQMB 1NNEA 2R85A 3BGVA 1SURA 4J1SA 4DNPA 2RDMA 2X58A 2RKWA 1F7VA 1LDGA 4HSGA 5A4MS 3B60A 2YZGA 4IQFA 4ZZ2A 1QOZA 3T52A 5CFPA 1FP2A 2NOAA 2J1LA 2C1EA 4A6XA 2ZPUA 3Q7SA 4RTPA 3UJNA 1G4HA 1KRHA 3GFRA 1D4OA 1A2QA 3GEPA 4U6SA 4RU1A 1ZNWA 2IV3A 2OZEA 3SKVA 4ECEA 4EZIA 4DDWA 2HT1A 1PGPA 3ZU4A 5D7BA 1XZPA 2GKSA 5C4IA 2XKKA 4XRGA 3G8DA 3FB1A 2PAAA 4ARZB 1JAXA 4URWR 5DSXA 2GLUA 3PXUA 3BD9A 2ZS8A 2XCTB 3PHHA 1JSXA 2G70A 2NU7B 1SCKA 2Q4RA 2X5XA 4BGIA 1POXA 1A9TA 1QGOA 4DA8A 2AGVA 4U00A 2NX2A 1XU4A 3T7EA 1CEEA 1IOWA 3KXDA 2X40A 3O82A 2O0KA 4K9RA 4NHEA 2ADFA 4F46A 3GJXC 4AIRA 4DCTA 4QAJA 3B3GA 4OL9A 1GG2A 4KN6A 5MGNA 3VC2A 1KI3A 2EWWA 2XEDA 1NN3A 3M6XA 2W98A 5F7ZA 1KK3A 5H70A 2J3MA 5A5GA 2IT1A 3M1AA 2ZM5A 4GOJA 1ADYA 4RK5A 4DNFA 4HQRA 4RFVA 1XJ0A 3UWPA 3O4FA 4WNCA 4D9IA 4DMFA 1G1MA 1WB4A 3CRRA 2EFJA 2O2CA 3MS7A 4OMCA 2YMPA 1QH1B 4FKZA 3RS9A 3UA4A 3VMMA 4W4TA 5CDTA 4QPJC 4LSZA 2BF4A 1XZIA 3IT2A 4MV5A 1BU8A 3PUKA 1E69A 4LBWA 1RRFA 4BV3A 5A4KA 4W8OA 3D4IA 3GLTA 2HA7A 2CMFA 2GN2A 3T6KA 1PJBA 5J5VA 4ZT4A 1XZJA 2XITA 5FOXA 2XVMA 5E2AA 3VO1A 4BN5A 2B9VA 4CM9A 2FPXA 5LD2C 1BX0A 1W19A 3LSTA 4PGAA 4KLAA 3Q40A 2H54A 2I0FA 3LSYA 2H07A 3DJFA 3CCFA 3KEQA 4FMPA 4IKOA 5AESA 3DTYA 5MN6A 4RSGA 1IATA 2LR0A 1F3OA 3MZ0A 2IE8A 1ZUHA 1GTSA 2YIDA 1HFKA 2FPPB 3AF4A 3K1JA 5HIMA 1NZDA 2WIGA 1K9SA 3CIOA 2OV4A 5ALZA 5FH9A 1QH9A 4QYSA 3ZJ5A 2MJLA 1WB9A 1OV6A 3HVRA 4TL8A 3EIXA 3H9GA 3B8HA 5CHYA 2WG1A 5AJTA 4IIGA 1DKRA 4UM8B 3R7BA 5HK9A 4AJNA 3IQWA 2IIQA 1Q6ZA 3H5NA 1ECLA 4I4IA 4C20A 4WKCA 5LDHA 3K6SA 1ODJA 1KK0A 1YB7A 2GD6A 4WOJA 1A5SB 1PEDA 4QYWA 1EYZA 3VQTA 4MTCA 4NJEB 3F98A 2QXTA 3R7WB 4RACA 1BRMA 1OXVA 2QP9X 4NZNA 2XYVA 2C5GA 1FFAA 1DIBA 4QGHA 2ZE5A 1E20A 1NR5A 5DE3A 3U80A 2Y1GA 4Q1BA 5DCYA 4RQAA 3VH3A 4EYQA 4LJ7A 4B4DA 1OILA 4WXEA 5HUHA 2AJTA 4PFJA 1Q95A 1YOBA 2JGJA 3JQAA 3GZNB 1GTMA 1S3SA 4OQNA 2BR5A 2RHMA 3FMGA 4ASUD 2NU6A 5DTQA 1WZIA 1CUSA 1XSEA 1KIFA 1Z83A 3GH3A 3MTDA 4YGYA 5BQOA 1MB3A 3U9LA 1XR3A 3P9YA 4ZXFA 4XB1A 2BEVB 3EG9A 4EKDA 4KFSA 3TX6A 3A28A 1JILA 1R74A 1KPGA 3GHYA 2Y1CA 1B8NA 4M0DA 3TXXA 4D79A 1RR6A 1UQRA 4DRZA 1N5OX 4U02A 2WNSA 2J3KA 4MDHA 4IXWA 2OEPA 1WEHA 2NNLD 1R5OA 4NG5A 4H08A 2PZJA 3NTOA 4O3FA 4XUCA 4WFKA 2BH9A 2IPMA 1FK8A 1QFSA 4JL5A 4H15A 1SG9A 1L9XA 4YMWA 4ZRDA 1YFLA 4FMDF 1EP9A 3VR4D 2WTEA 2XSZA 4MW7A 4DDUA 4RXMA 3DKKA 1H69A 4OU4A 2J9GA 4BVHA 1H6DA 2H5LA 2ZUBA 5JZSA 3DT8A 3DS8A 5JXHA 3F0TA 1PJLA 3A6DA 4MLPA 2Z09A 3EWSA 3HABA 3R5XA 4HOYA 4JKYA 1JVNA 5KX5B 1F9EA 1HDRA 4KNWA 5HGXA 3JR7A 1UMCB 3TZBA 2YY6A 5DH9A 4R81A 4H1VA 4WIAA 4C1NA 4Z51A 1CY7A 4WJKB 2RIPA 4GF5A 4WZBB 5FWDA 3U3JA 5HA5A 3AY6A 3EDRA 4BO7A 4YT4A 4H59A 4K86A 5D1HA 3I3OA 1B6TA 4E1VA 1Q0UA 1TK2A 1G19A 4TWBA 4FFNA 4UCQA 5K0FA 1RZRD 1ICIA 1NX6A 4HDOB 5FFFA 1L7VC 1S7CA 2JCYA 2OD7A 2OZLA 2VJPA 1G6Q1 3JZDA 3M5WA 4HRAA 1R8JA 3N0XA 2XEXA 3IMKA 3U4QA 1JHPA 3RAFC 3GI1A 1JB1A 1V16B 3E6AA 1CZLA 1TYAE 2LDBA 3L02A 1Y1SA 2N0SA 2QTZA 3KWLA 1OI4A 3FCYA 3F4BA 4ABYA 3W77A 1WBDA 2HMWA 4OA5A 2V6BA 3JYHA 5K0CA 2FWRA 3WV5A 3H9UA 4B3FX 1PGQA 4RVSA 2GLXA 1Z6GA 3OJXA 3V8NA 3RYCA 3HZHA 2YXNA 1TC2A 3AVOA 3DDCA 3VR6A 1YFJA 3VR2D 4JR0A 2ZITA 3WGYA 1TM2A 3CZMA 3UCXA 9MHTA 3C4JA 1NG9A 1PK8A 1ZD9A 3CE6A 3GNTA 4PV7A 5D51S 1C8LA 3IKVA 3M83A 1SZCA 1QIMA 2QUAA 1U8YA 2V5UA 4E32A 5CDGA 1G20A 4WN9A 5FUQA 2FX3A 1V1RA 2Q8QA 2MR5A 5K0TA 5E1MA 4NKRA 1L3BA 2OLJA 2JLQA 2R7KA 2XGSA 1N5RA 3K94A 4YAKA 1E2MA 5BO5A 3GJRA 5AOBA 1KWGA 4BNLA 2RE8A 5JJIA 2XMSA 4TM7A 1ZAKA 2TMDA 2ZQYA 3IBYA 2NVOA 5EKXA 4ZAVA 4EQ6B 1H1TA 4BATA 5LJIA 1Y42X 1UM9A 1WO8A 2YVQA 4OMDA 2QVZX 4GNKA 4IVRA 1EXMA 2XDAA 1HDYA 1E79A 5K6RA 1T9ZA 3LW7A 4BDTA 5DYNA 4L4SA 5CCEA 4W9MC 2IS4A 1UBCA 2EBWA 3CX6A 4YCSA 4XJXA 5FBHA 2JL1A 3TB6A 1L5VA 1QE5A 1AC5A 3FWHA 1FYEA 1EINA 4FDVA 4FFLA 4MI9A 3Q10A 5FR1A 1NYQA 3UHAA 3W3AA 2RK6A 4FGLA 4MDFA 2JW5A 2Z2XA 3GROA 3T3PB 1W75A 2Y4NA 1DRVA 4ZJZA 5BNIA 2WM2A 2XQIA 1E2UA 4MW4A 1LK7A 4X20B 3DLIA 4JCOA 3IP5A 2R1TB 4UM9B 5A4AA 3TOVA 2WFLA 3HP7A 4JBYA 3V80A 4K46A 4GYYA 1Y3FE 1PR9A 2QRPA 1WXFA 2R44A 2IP4A 2VSNA 3P9RA 4HEQA 2W5UA 5IMSA 1VDMA 1IDN1 5CT4A 2Q9AA 4G09A 1QTNA 1Z4PX 3DLCA 5DRYA 4HDRA 5E6SB 3UB4A 1GPNA 2QROA 1J1ZA 3HR7A 1WNTA 4DLLA 1OC4A 3JZFA 3PTLA 1GCUA 5T67A 4DM7A 4CIVA 1ZBQA 3L40A 2ZVPX 5CRIA 3FDFA 4WASA 4BZZA 5EMNA 2Q3DA 2W48A 4BJ3A 2P3SA 4D9MA 4F04A 3IAUA 3PUHA 1QS0A 4C0BA 4U2EA 5INTA 1ULHA 1LV8A 1P44A 2H2DA 1VSTA 2C4KA 1JEYB 1XZFA 2J41A 5ADWA 1IY0A 4M0PA 1Z0DA 3HI4A 4O4JF 5KMGB 3NT5A 1QP4A 4LXTA 2HJRA 4M98A 1XA0A 4UBLA 1IG3A 4C0XA 5ENZA 2EFEB 3EVTA 3NJ8A 3RC2A 3PIIA 4QJ4A 1CNFA 3TM4A 1S2OA 5H4GA 3MXTA 4GR9A 1FBTA 2R60A 4X66B 2BDTA 4BMXA 2WSYB 5FUBA 5U4QA 3PRJA 1ONBA 3CN9A 4HAOA 1LS1A 1N7GA 2FF5A 2YBDA 1VE3A 3HDQA 3IMFA 3IP6A 4RIIA 4KI7A 4XGIA 4BJ6A 2AFRA 1Z6ZA 4QM6A 2ZRAA 4XYEA 4AWXA 3H1TA 2GN9A 1QHHA 1ZNXA 2IYZA 2MMCA 4KPUA 4RCYA 2WD7B 5FBZA 1LD3A 3DVSX 1J2TA 2WMOB 1R5JA 3RFVA 1RQNA 1ORHA 1NI4A 1ZPDA 4XWYA 1GEGA 1H23A 2ZFUA 4HX2A 4FR5A 3NCTA 3BHIA 2H2GA 2XRMA 1ZQ9A 5CXXA 3UJ3X 2O7RA 2W6NA 2WR8A 3M49A 4NSNA 4BJ5A 4OJKA 2YVAA 3DLHA 3U37A 2W2PA 4DKJA 2GJ4A 1CRWG 5L7WA 3MB8A 1RCFA 4CEHB 2AC2A 5E8JA 3U7QA 2VHTA 2HRZA 1E6MA 4KDCA 1N5JA 2BOVA 2F9MA 5CJJA 3M2TA 2RC5A 3QOFA 3RWMB 1H2FA 2JLBA 2RKBA 3GD5A 3HCFA 4O4LB 4YO7A 5AM2A 1HT3A 2ZIXA 2DLCX 1E1LA 4I8XA 3AUTA 3CV3A 1S1MA 4LCEA 3WIBA 1E3IA 3RGGA 1U9YA 2C20A 4OF4A 1ODIA 1P1KA 3C74A 4K1LA 3B5EA 3TZHA 1PVOA 2KYRA 1YR3A 3G5TA 3H1EA 4OBEA 1E5TA 4Q9DA 4LJAA 4F92B 2OXTA 3RKUA 4IIFA 1U5CA 2JLSA 1U8TA 1LVUA 3COYA 4C5BA 1RC0A 2R86A 1V5EA 4CMBA 3KXKA 4M1YA 2X23A 5H3CA 4AJ9A 4DLAA 1HETA 4L7QA 5EZYB 5TC4A 3HVUA 4LDQA 4CIYA 1J90A 2YJ3A 2W6JD 3DXZA 4HGOA 3RS4A 4PTLA 4EUHA 1SH7A 1LB1B 3I1YA 1J8YF 1NW6A 2AQHA 4F4IA 4MUAA 1D6JA 1VL0A 3QPAA 3MPOA 3DE7X 4Y2JA 1DWOA 5KOJA 3LUAA 4M8SA 4Y6RA 4KV9A 2FQXA 3BL6A 2WIFA 4J91A 3O0DA 3R8CA 3UXMA 4H77A 2O07A 3IUNA 1DQYA 4XUDA 3CE9A 1DKNA 3QEMA 2YCBA 4FGKA 4QDTA 1PLJA 3B1JA 3IBSA 5TMDA 5C81A 3NKLA 3ACCA 2D7JA 5JALA 5TNXA 2C2MA 2DHCA 1CS4C 2O2IA 3ABOB 1SXJD 3ITEA 3PR2B 4JNCA 4ZC1A 1DC5A 3Q0TA 5K8VA 3OOYA 2WC1A 1SKYB 3HJCA 3PGKA 3SM3A 1BKSB 4EFMA 2FMTA 3BSFA 4AJLA 4E70A 2Z08A 1LBQA 1NLFA 4IQ0A 4DT1A 1WLYA 4LDZA 4BLOA 4CEJA 1YONA 1BDHA 3G1TA 4K03A 1S2MA 1C2YA 1LJ8A 4MQ6A 5FOWA 1SUEA 1XNQB 1LW6E 4MCJA 5EWLA 1QGUA 2CB9A 5JU6A 3MINA 2XT6A 4G1CA 3ZBPA 1AH2A 1XFDA 3B6IA 2A94A 4X9XA 3VZCA 3VH4A 1JT9A 4EUFA 1PG5A 1DEKA 1U8XX 3HUEA 5TEWA 2NO1A 3T5MA 1BG6A 3GNQA 2X2FA 3AJEA 1H8HD 4TV9B 4BE4A 3MN1A 5JANA 3DUFB 3D4NA 2CLCX 1XTUA 4IJVA 5AVUA 5IKXA 2QVXX 1FMCA 1K5GA 3LFTA 3ON5A 1H4VB 2XPCA 3LRPA 2XQGA 4IFBA 4Y6GB 3IE0A 4HWSA 4X63A 5FNVB 4AS2A 4DLYA 4DLVA 5BN4A 3HV0A 3LXRA 5HMMA 1Y9JA 1H05A 1K98A 2AOUB 3SNKA 3VU0A 2QX4A 4MK4A 5A3QA 3G13A 3BKXA 2GBCA 2I2BA 3EG5A 4G4GA 4IZHA 1ORRA 2FEXA 1BJKA 1ENPA 3UA3A 1BRTA 1P39A 2C31A 2PY6A 2HF7A 2ZIEA 3B6JA 3PHBE 3R7SA 4IHJA 3GVHA 4HZGA 2QB5A 5J3JA 5GINE 2RHBA 5ENDA 2GSDA 1GILA 1JDBB 2O1WA 3CUWA 2OM2A 1DXOA 3AO0B 1G5HA 1L7AA 3OIGA 3PNBA 5B5SA 2CXNA 1U3TA 2RH5A 1LBTA 2VAWA 2ZR0A 3OEEA 5TJHA 5K8JB 3D0OA 1J2YA 2OE2A 3OQ6A 3WLHA 1TXGA 2BISA 1V8DA 2P62A 1HFJA 4MR7B 4ZTBA 2VAXA 4GVXA 2CJYA 3K30A 2XVAA 4O1IA 5SZJA 1T4CB 3CA8A 1NVBA 4AN0A 1BFKA 4EW1A 5IKMA 1UJ5A 3INYA 3QE4A 3LECA 4NDAA 3VO9A 3O8LA 3FUTA 1Z2CA 1E32A