2ANBA

Crystal structure of oligomeric e.coli guanylate kinase in complex with gmp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
206
Chain Sequence
b'AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
molecule tags Transferase
source organism Escherichia coli
publication title Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
pubmed doi rcsb
total genus 65
structure length 206
sequence length 206
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2anbA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2anbA01
5J4HA 4D0LB 3I8XA 4HAZA 4DLYA 4XVUA 3CPJB 4FI3C 4JBXA 4L4UA 5DIFA 1CRPA 1IQPA 1SVMA 1N6KA 2PMKA 2ZJBA 2IS1A 2BM0A 4B3CA 1Q20A 1S1MA 2AHOA 5A0FA 1FQKA 1P75A 2FSHA 1KI8A 2W0MA 3E2IA 1ZNZA 1W49A 3K53A 4IVPA 5SZJA 1KDOA 4CGZA 3FMPB 1ZW6A 4GT1A 5C4MA 1P2UA 2A7QA 3LO5A 4MH0R 3U3KA 1HV8A 1F2UA 4OHYA 2DCUA 3K0CA 2ZE8A 4EKDA 1DPFA 1OW3B 4GBMA 4B34A 3QQ5A 4OHWA 2ODEA 1G8FA 3ZD7A 2OFWA 2AX4A 2REBA 2QSZA 4XVQA 4OQNA 1Z22A 2H5EA 4Q21A 3A1TA 3V4RA 2YWHA 1AS0A 1R0YA 2E1RA 3EZ9A 4L15A 3WBJA 1NP6A 3REGA 1CXZA 2X2EA 5JS8A 1Z6GA 3LLUA 2D06A 3TIFA 1NN0A 2YOFA 4OQXA 2XX3A 3A4LA 2A5GA 3HU2A 3KDSE 4NYMR 1E2FA 5CYPA 2PBRA 2Q21A 3LRPA 3LX8A 1CTQA 3AP3A 1RPZA 3RSOA 3L82B 1GIAA 2TMKA 1J70A 2ATXA 4Q9IA 3HPQA 3RVBA 3DMDA 3W8RA 1V43A 1YR7A 1HT2E 1Z6YA 2VTKA 4K8OA 1G7RA 1TAGA 1W0KD 2ZE5A 3B82A 1OIXA 2JDID 1VIYA 4IOKA 4Q00A 1EESA 2JEOA 1P73A 4QHTA 1T3LA 2RAPA 1XTQA 5C2JB 4W5WA 1S3GA 4M1WA 3SNHA 2QPAA 3ZIAA 4LBWA 4ABYA 2BM1A 4GNKA 4JVNA 1M2OB 2IYVA 2FFBA 4MA4A 1NBMA 4F7WA 3LD9A 1CS4C 4YXWA 3K0SA 1WBBA 4US0R 2FWRA 3WXMA 2CCKA 1Q12A 3FTQA 2QMUA 3SE0A 3W9YA 3RRMA 2I3BA 1XPUA 5D3QA 4DCTA 3PVSA 3Q72A 2WSSD 1KO8A 2QAGC 3QKRB 2VLIA 3KFXA 3JZAA 2OCYC 2BBOA 3V9PA 1U9IC 1Z08A 1ZNYA 1TEXA 3Q5EA 4HLCA 1OH8A 3P20A 4HAWA 3IIKA 2WWGA 1IXZA 1WA5A 3GLFB 3Q8XB 2F3RA 1T4GA 5IRCD 4M0LA 1GUAA 3NEJA 3BE4A 1E2PA 2XAUA 3GLIE 3C7KA 4PZYA 1HQCA 1WP9A 1US8A 2G1KA 4E09A 2J46A 4LJ6A 1IOZA 1RC8A 4AURA 1E1QA 4Q47A 4XSHA 2IX3A 2HV8A 5IDVA 1E9FA 3PV0A 4LBYA 4ASUD 2ZI5A 3OFNA 2YOHA 2IXGA 5EXTA 2X1VA 2FGJA 2J0UA 4CVNA 3CIOA 2FPLA 1IN7A 3K0EA 3D8BA 5KDOA 1QG2A 2J7PD 4BFVA 4K81B 1KI9A 2WMNB 4CT5A 2AL7A 2ZI6A 2ZRNA 2ZYVX 3FB4A 4BFXA 5B57C 5JS7A 2JJ1D 2IYQA 1MRNA 2HEIA 4KLZA 3PUVA 4US1R 4B35A 3QOFA 3AVUA 1KI2A 3TMKA 2O8EB 3UPUA 1W0JA 3WMEA 4A6PA 1WRBA 3FHCB 4V0KA 4YXWD 3AVTA 5P21A 4QKQA 4HAVA 4DT1B 3JVVA 4UKDA 3P1JA 4WZBE 1K5GA 5EUMA 3ONWA 4B2PA 1Z0DA 1KMHB 2HJVA 5G40A 3B60A 1U0HC 2D4HA 1W4AA 4X8OA 5EP3A 4BUJA 4B73A 4P31A 3CRVA 4NCKA 1PLJA 1COWD 1XCPA 4B33A 1Y63A 4C7OA 1HE8B 2FA9A 4NL4H 2JJ1A 5LPNA 4QGGA 3CRMA 5JJIA 1NSTA 2QP9X 1ANKA 3RRNA 2RGNC 1SXJB 1HEIA 3VHXA 3RABA 1GAJA 2ASEA 4BPBA 1KK1A 5AJYA 3LBHA 2QP4A 3MSXA 4C0JA 4PXAA 4UNQA 1KSFX 1VG9B 4DCUA 3KQUA 2HCJB 3PEUA 1IN6A 4HZIA 4PC6A 4BLTA 1AKYA 1XRJA 4F4IA 4ZCIA 2G83A 4A8JB 3T34A 3LDAA 5D3MA 2YYZA 2EQBA 1ONBA 5DNYB 2GXUA 3NVAA 4F92B 5JWRA 1DAMA 1LW7A 5J4VA 4W5JA 4MKIA 5H70A 5JMTA 3EC1A 5HCIA 5G53C 1FX0B 2Z6VA 1G20E 1W47A 4YMWA 5AK0A 4LCBA 4PC1A 1X6VA 2WAXA 4DUGD 3QXHA 3O8CA 4DBLC 5G3ZA 2CCJA 1KIMA 1QHGA 4C7OB 5K8IA 3PENA 1D2EA 2WM9B 5LD2B 2YKGA 4GOKA 5GJWC 1GFIA 2G9NA 4DIDA 2KBFA 3MWLA 4PC2A 1XTKA 3VMFA 1FL9A 5CITA 3A1VA 1XWIA 5CDFA 1J2JA 2BBTA 3PFIA 1KOFA 2REOA 2O52A 4QNRA 4E22A 4ZI2A 1G7CA 5FOSA 5DHAA 5DHFA 1ODFA 4JVLA 2FDCA 2QPTA 1IJFA 1JXMA 3VR2A 5TVKA 4I4LA 3FMFA 3R8CA 1MRSA 3LH5A 3DPUA 4UNNA 4KV9A 4R98A 4DB2A 1HQYE 1P61B 2NO9A 2GJ8A 1E2DA 3H84A 3H4MA 1ESNA 2QAJA 2QE7D 4JLNA 4LYHA 4UXIA 1KSGA 3KZ1E 5E3HA 3SQXA 1HA3A 4XIGS 2I4IA 4OYHA 4DUGA 1WQ1R 2FPMA 2JLUA 4HDQB 3E1SA 2A5JA 1CR0A 4RSGA 4B76A 1YZUA 1Z8FA 2AWNA 3NEYA 1G291 4UNSA 3GFPA 1JJVA 3RDPA 4Q4AB 2ZJ8A 1E32A 1QBKC 2WWYA 2AXNA 3FKSD 4L16A 3PUXA 5TXGA 3TVDA 4GL2A 4W9MC 1H8ED 1X3SA 4EJSC 2B8WA 4YDHB 4KFUA 4PHHA 2O0KA 3BK7A 3RHFA 4PAOA 2FFHA 3CF6R 2ZPTX 4NYIR 3CWQA 3PXGA 3AGPA 4AG5A 3VU9A 1EWRA 1JQLB 3L2OB 3Q7PA 3RS7A 5GVSA 2B8TA 2VP5A 1E2KA 4HB3A 3EW9A 2ONKA 4P4SB 5H68A 3B7GA 5HE8A 1OFIA 1VHLA 1VTKA 2YZ2A 2GA8A 3PEVA 3BH6A 3BAFA 3K9LA 3WYGA 4R71A 3UG6A 3UATA 4WZAE 4JKIA 5JSZB 1TEVA 1XBTA 4NP6A 4EPTA 1RRCA 5AJZA 3UMFA 1Z07A 3ZGXA 2IUSA 4ZDJA 4DCNA 4A0GA 1OH7A 1R8QA 4JT2A 3C41J 3IEUA 4MRPA 2GZHA 3B1WA 2B7CA 4U00A 4CEJA 2IYUA 1KK3A 2ZRHA 1DAGA 2IXFA 4NKRA 5GJBA 1E2LA 5DN6D 1LTQA 3I92A 3DEFA 1EFTA 3U7EB 1NVWQ 1QHNA 2XTZA 4XWKA 1NN3A 2DFKB 4HUQA 1NN5A 2EFDB 2RH5A 5C4GB 5M04A 2BV3A 5TB5A 3THXB 4DSTA 4GZMA 3J81k 1MO5A 3EPHA 1KI4A 5JWHA 1VMAA 2JA1A 5EP2A 2OCPA 3PJRA 5F9FA 2FZLA 2OLKA 4MKHA 2Q0HA 2ODWA 5EQTA 4TQUS 2RGCA 1S0UA 2VHCA 3ZZUA 2UKDA 2CE2X 2WJYA 4M9QA 4N0DA 3CNLA 4RD2A 1BKDR 2A30A 2GJSA 5HE9A 2JLQA 2R6CA 1T3SA 3ZZTA 4D0GA 2MMCA 4ASUA 5CIQA 3M6AA 4EDHA 2OESA 3AF1A 1J90A 3K8YA 5F9HA 3UG7A 5FBRB 4US2R 1N0VC 4URYR 3IQXA 4JL6A 3HPRA 2OHFA 3NBZC 4Q01A 1G6OA 4Q7JB 2V3CC 2I1QA 4O2LA 2RGDA 5KDLA 2C04A 2OFOA 5IT5A 2VBCA 1RW4A 3I1FA 4V0ME 1DG1G 3DDCA 2AXPA 3MAAC 4JBYA 2OV2A 3M1IA 1W4CA 1G3UA 2IYZA 2R2AA 4B2IA 3TUZC 3QPVA 1ZD1A 3C15C 3FVQA 3L8YA 1G3MA 4D2IA 2ZSEA 1Q1EA 2I1VB 5KNCA 4AK9A 1Z47A 3KJHA 4NZYA 4DIEA 4M1KA 4KYIB 3KXLA 2Z4RA 4UXJA 3CBQA 4OBEA 3UXMA 2QT0A 1L2TA 2N42A 2RHDA 3K0FB 4EAQA 2REXB 1BYIA 1GKIA 3LW8A 1ZU5A 1VKJA 4BFYA 4LHVA 4QFMA 3W8NA 1GDDA 1DADA 2J59A 1OXUA 2ZE7A 4ILEA 5BW8A 4P32A 4LPSA 4TLCA 5F98A 2YV5A 2D62A 4LHYA 3OF5A 5TDHA 3F0TA 2JLYA 1M6NA 2MSDB 3MWYW 1W2HA 1PZNA 2HJGA 3IO5A 1P9WA 2X77A 4KLNA 1CULC 1XTSA 3PCRB 3EXAA 4D0NA 2W58A 3EAQA 5TARA 3WHLA 1IY2A 2O0JA 1YZNA 3AF0A 1OLOA 1UEIA 2DYKA 4LYJA 5LB4A 3SZRA 4A0FA 4WXPA 4TYYA 2ZUCA 1CKEA 2QGNA 4HAYA 1LF5A 3TSZA 4DEYA 4C2UA 4NH0A 5ANRB 1X8KA 5E4FA 3KXIA 4MRNA 3D6TB 3VR3A 2F1HA 4KU4A 1T8UA 3G82C 3E5HA 4A2QA 2DHRA 1Q44A 5AJWA 1C1YA 2PEYA 5CLLA 3C8UA 3ICEA 2VHUA 4TL8A 2IYSA 1OXVA 2HLDA 2AR7A 4IFEA 1ZD8A 3ASZA 2NZ8A 5CK5A 1G18A 2WHXA 4ARZA 1KHTA 4Q66C 3I5XA 1JQJC 1GL9B 3C5HA 4IW3B 3MMPA 4D4MA 5GJVC 4B3DA 5AR1A 4R2HA 3U7FB 4HB2A 1H8HD 4FWTA 2PH1A 1L4UA 2FJUA 3SDZA 1GNRA 4A4DA 2V4ZA 1CEEA 5A5GA 1F6BA 4C0LA 4BZXA 2VSXA 4QRHA 2OZEA 1UKEA 4LJYA 2WIBA 5JFGA 2C9CA 4NCHA 3GLIB 2O8CB 1TADA 2CEAA 2ZI9A 1C9KA 5L3SA 4I1UA 1JPNA 4OQLA 3RNLA 2MSCB 1CBUA 1TMKA 1N25A 3HDTA 1N2CE 3LXRA 3TKLA 3K70B 4O2RA 1KY3A 2EWWA 2QNRA 5LB2A 3LNCA 2D2FA 1QVAA 1W5SA 4QL3A 5CIWA 3THOA 5L3RA 4C0AC 4A2WA 1FPMA 1XEFA 4PC7A 4LJ7A 1MV5A 3LQRA 1M1YE 1OKKA 4Q4HB 4AD8A 1DAEA 3BH0A 2V7QA 1XEWX 3AVQA 1LS1A 3OEED 5CYOA 3SU8A 3SYNA 4W5HA 4RZ2A 2JJ8A 5EXXA 2ODBA 5FPTA 5JI2E 4N1AA 2BEJA 2J0QA 3QIAA 4OHZA 1EFHA 4HZUB 1GRQA 3REFA 2NPIA 2P6RA 1Q3HA 1A4RA 1CJTC 3RLFA 2BOVA 1G4AE 2ZS9A 4BRUA 1RVDA 4OK5A 4P3YA 2GJKA 2IYXA 2GCNA 1YZTA 3TNFA 1T8TA 1PJRA 3BFKA 1P3JA 3C4JA 4Q9LA 4Q19A 3SJAA 3VNUA 4RJLA 1WDTA 1ZUNB 2BCJQ 1DO0A 1N6RA 3QKSA 4CF7A 2EU8A 4MGKR 2JJ2D 1KY2A 1IJEA 2V1XA 3SYLA 3Q5DA 4ERNA 4BFSA 5FPKA 1XJQA 1ZVQA 3C16C 4HATA 4DCVA 4XWOA 2GNOA 1NKSA 1N6IA 1WXQA 2OG2A 3OAAD 4B47A 4Z1MD 4TTRA 2CBZA 1RJ9B 1CF4A 1SKQA 2QRZA 1YKSA 3QG5A 1E1RD 3T1OA 4OI1A 5DISB 3U3MA 4IEEA 2ZTSA 4S35A 2ZR9A 2ZSDA 3AP2A 2B6HA 4TYNA 4TTQA 3EPJA 3H2YA 2RGBA 4HYYA 5FL3A 2XZLA 4TMTA 1MO3A 3A1SA 4JL8A 3GEHA 2ZS7A 3W3ZB 4MDEA 5FI0B 1Z5ZA 2RHMA 2E9SA 2BEKA 5F2EA 1G1MA 3EARA 1AQYA 4ZIRA 1Q57A 2AKYA 3CONA 2IYRA 3T5DA 1NG1A 3TW8B 4UJ3A 2W2XA 1EFUA 4F93B 4RD4A 1ZM7A 3IHWA 5JJLA 4L9WA 3QVVA 2FMXA 4D6PA 4M22A 4D81A 1I2DA 1KMHA 2YJTD 1SKYE 2J0VA 1KK0A 1A7JA 3W5JA 1J8YF 4JLDA 5EE0A 5J47A 3CRW1 4G1UC 1W0KA 4I1VA 2KSQA 3KQHA 5FPYA 1FUUA 1Q3TA 1CJMA 1UADA 3QF4B 3T15A 2Q9AA 3DKVA 1ZM3A 1G41A 4NCJA 3IDQA 2ZR0A 5AUNB 2AK3A 1AIPA 3GJ8A 1UJ2A 3HR7A 3CX6A 5L3QB 1IONA 1G21E 2PT7A 3CO5A 2DWPA 3W34A 2BDTA 2IC5A 3U2QA 4CT4B 4DSOA 1EX7A 4DLXA 4JSTA 3OEEA 2ZJAA 4PQFA 4TZ0A 1OF1A 4ZIRB 3I5YA 4N3NA 2ZRFA 3NTUA 1GL7A 2R44A 1WMSA 4QGHA 3X1DA 1F5NA 4Q4LA 1FUKA 2Q3FA 2CLSA 3NBFA 4IOJA 2ZRBA 1JAHA 2GRJA 3EZ2A 1S2MA 4NCNA 4MRVA 4HLQB 2JLRA 3KKNA 2HF9A 4MRRA 3VR1A 2XTMA 2LWIA 2NZJA 3PEWA 3MCAA 1E3MA 4WOPA 2CCGA 3DO6A 3GJ6A 2DBYA 3RYTC 1YRBA 2QY9A 3L8ZA 4MUAA 3H86A 3AV0B 3UKDA 3MG9A 1PLLA 4BGDA 1N5KA 2WZQA 2QTFA 2CNWD 4EQ6A 1KI3A 4CYMA 2WWXA 1NY5A 2WJHA 3BS4A 5FTMA 1IM2A 4A8JA 4RKFA 5KTYA 3SC3A 2GEDA 4DXAA 4AYTA 2PLFA 2OAP1 3EZ6A 4JBWA 2J87A 3EX7C 2WJGA 1O3YA 2ZRMA 2VO1A 4WBSA 2OAQ1 3TSWA 3RS4A 2XJ4A 2ERXA 3SOPA 3FPAA 5FOXA 1R6BX 2ZQ5A 3AVPA 1R10A 2GEVA 3GEIA 4ESHA 5A4JA 1Z6TA 3L0IB 1CP2A 1ZBDA 3X2SA 4C3ZA 2FV8A 1CJUC 4BASA 2WWIA 4PX9A 3B2EA 3JZMA 1P5ZB 3NXSA 2FZ4A 2RGGA 1G3QA 1XP8A 4MITA 4TLEA 3ZVRA 3FOZA 4HI0E 3W5IA 4LBVA 1ZIPA 1NJFA 1EFRD 5EE1A 4KFSA 4JJKA 2PCJA 1ZMXA 4AKEA 3QBTA 3NDPA 2PEZA 2DFNA 3EWSA 2YC4C 3VX4A 5F3WB 2VL7A 1RRPA 2VSFA 2ZRCA 2W6JD 3HR8A 1Z0IA 3CW2A 3Q7QA 2R8RA 4EFLA 4DSUA 4DDTA 1UBGA 4DLTA 4M8NE 1PLKA 1Q0UA 3RC8A 4IDHA 3RC3A 3AH8A 4FMCF 5KNBA 1E2IA 2GF0A 2XB2A 5EXSA 4NMMA 1E9BA 4PAQA 1UPTA 2QRNA 1TF7A 3SQWA 3K1JA 1MABA 1B0UA 1XMIA 2PJZA 4TN1A 4A8JC 4A0RA 4C4PA 3ADBA 2P65A 4BWYA 1GNPA 1SVIA 4AY2A 4KVAA 2BCGY 3ZD6A 1R8SA 2YWEA 4JIMA 2IK8A 2JCSA 1J99A 4LC0A 1HTWA 4PAMA 5EXPA 3TUIC 1FP7A 4R7ZA 3X1ZA 2MSEB 2XNSA 2V1UA 1EFRA 1E1QD 2G3YA 1LF0A 3ADDA 2IS2A 1IAQA 2FU5C 4LHXA 1G5TA 3L0PA 3V00A 3MRSA 4ZKDA 3Q9LA 4LK2A 3BB3A 5FUVA 1RFLA 4JLMA 1KSHA 4TZ6A 1FMLA 2CJWA 2H1LA 4HB0A 1BS1A 5CJ2A 1JPJA 4AI6A 2QM7A 2GWHA 5HTKA 4WAUA 1XJ0A 1E0KA 1MT0A 1YR6A 1C4OA 5HKKA 1NSFA 1SHKA 1XMSA 1VCIA 2VIIA 3OE7A 3OEHA 4YMVA 2QM8A 1OB2A 4P0TA 5JRJA 1NLYA 3IO3A 5DYGA 5BYJA 4E03A 3GLGE 1SGWA 4A92A 2JJ2A 1Q1ZA 1Z28A 1ZAKA 4QM7A 3U7HB 1WE2A 1G8GA 3U61B 4LHWA 3SFVA 4CEHB 4EPXA 4EQ6B 4OJQA 3GJ4A 3T5GA 2OILA 3KQNA 1BYUA 2DWQA 2WOJA 2ORIA 3NBXX 2GAOA 4LV5B 3TUJC 1ZM9A 1TUIA 2JDIA 2GAAA 4DT1A 4XD7D 2NG1A 1CR2A 4GSYA 5E95A 3NH6A 1LVGA 2OXCA 2WPDA 3IKJA 3BGWA 5FOUA 1JB1A 4HAXA 1G5PA 2CDNA 1TNDA 4H9GA 4MYTA 4GP6A 4Q4JA 3ZLJA 2IL1A 5C18A 2VRWA 1E79A 4PC3A 3AVXA 2Q3HA 1B23P 2A5FA 1DVRA 1VG1A 3WYFA 1UKYA 3LV8A 4Q9JA 1KSJA 2NOAA 1YU9A 3QXJA 1KGDA 1TX4B 2IUTA 4C0BA 2RGXA 1K6MA 2GBLA 2GVDC 2ATVA 2O8BA 1D6JA 1DEKA 1XXHE 2BHRA 3F3YA 1A1VA 1E96A 4Q18A 3NDBB 2D3WA 3WNBA 1SHZA 4BLSA 5EP1A 3OHMA 5FUXA 4PQRA 5BQ5A 2WKRA 3X1YA 3SHFA 4DKXA 5J5CA 4TMZA 1E0SA 1OIWA 2DY1A 4LWZA 4WIAA 4ZO4A 3EPLA 1Z3IX 4FD2A 4IJMA 2EFEB 3TW4A 1FX0A 1G8PA 3A37A 1QF9A 4MRSA 4KCGA 4ACAA 4TL6A 5EE3A 2HT1A 2WBLC 2QPOA 2R6FA 4TQ9A 1NY6A 5HCNA 1KDRA 3PUYA 3VHLB 3QI2A 3BBPA 4EPWA 2XZPA 4V0NA 3QKUA 1RJ9A 5BWMA 3Q85A 2CL0X 2KI5A 3AF2A 4UNRA 1G8YA 4Z8XA 4B3GA 3V4FA 2FE4A 2OUKA 4II7A 3QG1A 1S9HA 1KKLA 4OHVA 1R5NA 2VP4A 4RKEA 4TLBA 4OQMA 4B48A 4DDUA 121PA 2OBMA 4S2EA 5FL7A 2HLDD 4TLDA 2GILA 1UBCA 4X8LA 3W6PA 4IVRA 5AJVB 4BECA 2HXYA 1NG9A 3H1TA 2P0EA 5KUTA 4I81A 4TSFA 3SJCA 2BJWA 3DM5A 3DZDA 3HJNA 3IGFA 1N5LA 1N6LA 3SJBA 3TK1A 5LBIA 4IRUB 1OYYA 1RKBA 3MFYA 3NG1A 1AJEA 1HY3A 1OFUX 4LGMA 2IWRA 2O8DA 4M1TA 2GXQA 2ZSAA 3DZ8A 2WV9A 4G5SA 2WOOA 1AQUA 3I73A 4PPGA 3MJHA 1DELA 2SHKA 4RZUA 3SBDA 2H18A 2OXRA 1P62B 1Z6AA 3IIJA 1OXXK 1SVOA 1UKZA 2C9YA 2PL3A 4GFDA 3T35A 3B6EA 4RD3A 3TJZA 1Z0JA 4M1YA 1UEJA 1LS6A 1VPLA 1AKEA 3B85A 1AM4D 1OHHD 2R6AA 1ZNXA 1MO6A 4A9AA 721PA 3MLEA 2D7DA 3IPYA 3LX5A 1RYHA 3G0HA 2FX3A 2F9LA 5FPHA 1S3SA 4XTRA 1II8A 1NBMD 2F43A 2VSOA 5FTLA 4E07A 5FI1B 1TF5A 1NJGA 3RWMB 2A2ZA 1XXHB 3WY9A 1P4SA 3AP1A 2QROA 3CH5A 1RRFA 1JBKA 1L4YA 2ZVQX 2WAYA 3U60B 2N1BA 1XZQA 1FFHA 3T12A 3EC2A 1JECA 1QG4A 3K0CC 5CK4A 3P4YA 2ZR7A 5LDDC 3FYHA 3RSLA 3RRYA 5G41A 1E79D 1KO5A 1KTVA 4D4JA 1W2GA 3AF3A 4HUQB 1R0XA 4Z51A 3TAUA 2VH5R 3H0KA 3QE0A 1R5BA 1VHTA 1XEXA 3QF4A 1FOEB 4KITB 1CJKC 2RKOA 3B1ZA 3TQFA 3ZQJA 4F38A 3D31A 5EE5B 3B9PA 5DYIA 3AM1A 1G9XA 1P60A 4MDFA 4M2LA 5DGXA 2ZU6A 2VHJA 4CDGA 4QJ3A 1I4TD 2DFTA 1A2KC 4D26A 1LFDB 1HH4A 4IDQA 4PO1A 3CZQA 2YWFA 5BYKA 1DG3A 4TT3A 4FMDF 2IF0A 2BC9A 1AA9A 3ZVNA 1BH2A 1JR3D 1L7VC 1GOTA 4TTPA 5E7MA 4GPTA 4GRAA 1UF9A 1XMJA 3OEHD 3ZQ6A 3GLHA 3CKLA 1XU4A 1U94A 3U7GA 2CK3D 2IW3A 2HCBA 3UIEA 2GBLC 1NN1A 3F5FA 1SZPA 1N6HA 2C8VA 2Q3MA 2GXSA 1MO4A 2P5TB 4URUR 5E7IA 5B2ZA 2PLRA 4RCYA 4ZI3A 1K8RA 2G6BA 2V7QD 2XJ9A 2YOGA 5FH9A 1VCMA 2YINC 2ZS8A 1YJ5A 2Z43A 1NVVR 2WKQA 3SI7A 1U0JA 1FQJA 3WHKA 2O8FB 3N2EA 1KNQA 2AKAB 2QMOA 3GPLA 4XOIA 2ZRGA 3OIVA 4FW9A 1JR3A 1CJVC 4PQYA 4HUTA 3LAWA 1T91A 1R4AA 2FPKA 4V03A 2QBYA 4TL9A 2F55A 2CLDX 1X1SA 2P5SA 4DLSA 3NH9A 3CM0A 4AKHA 4ZV4A 4WW0A 2JIZA 3IHLA 3KJEA 4WA7A 1Z29A 2F1JA 5FBVB 2ZSFA 1ZIOA 2OT3B 3LBNA 3K9HA 2GK7A 3GD7A 3X1WA 4JT4A 4URVR 2UZIR 2ZYUX 3TR5A 5FTNA 5KSPA 1OFHA 3W6NA 4A15A 3IBYA 1TQ4A 1N3BA 1Z6XA 1VYTA 4KXFB 4R9UC 4C9BA 1ETUA 1W4BA 2C96A 2C2HA 2YHSA 1KDPA 5BXQC 4G5RA 1OH5A 1TU3A 2GHIA 1SVKA 4IXNA 5JRZA 2KB0A 1QHIA 2GZDA 5AUQA 3K70D 4C2TA 1UDXA 4CEIB 2RGNA 4KVGA 3EIEA 3AGQA 1U2RA 4LI0A 5J4LA 1A5TA 1Z0KA 2WPDD 1OXSC 3EA0A 5EJEA 2A5YB 3WNCA 2ZI3A 1NF3A 2JLZA 3PG5A 1YR8A 3KJGA 4RCZA 3WP1B 4C0KA 2BMEA 1ELOA 1XD2A 2J7KA 3RS0A 1XCGB 1Z2AA 1U0LA 3U44A 2O8CA 4BFUA 1AGRA 1KZGB 3FE2A 5JBQA 1Z63A 1U8YA 1AS3A 2VEDA 3AKYA 1EX6A 1W44A 4F4JA 4IOMA 1PUJA 821PA 4A82A 3DKPA 1DARA 3GLGB 1SVLA 2IYWA 2H57A 2FN4A 2P6UA 1G4UR 1TU4A 1U90A 4JVSB 4A1FA 1E2HA 4Z1MA 3LW7A 2R6DA 3RS5A 2CHVA 3UMSA 2ZJ5A 3WP0A 1W36D 1TUEA 4LHZA 4EIWA 2FNAA 3A8TA 3ASYA 3ETLA 5CB6A 2CHGA 5JECA 1KYIA 2ZRDA 5JI3E 1ZM4A 1D5CA 2FG5A 4XSGA 4ZCMA 2HXSA 5FTJA 5FBLB 3PITA 1FMJA 1XD2B 3EG5A 421PA 2BIFA 4PPNA 1U98A 3QXSA 4BEBA 4PHGA 2ZJZA 3RRZA 3UANA 1FNMA 2WWHA 3LY5A 2O5VA 3U6BA 1RE0A 1CU1A 1UBFA 4FN5A 2VP6A 4IXMA 2NO0A 2IEYA 1GWNA 2VF7A 2C9OA 3WYAA 2DR3A 2OBNA 4DLUA 3TBKA 3AVYA 1Q1QA 4BLRA 4NYIQ 1KJYA 2G0NA 1LB1B 2WICA 2ZYWX 4PR0A 4LJ9A 2JAQA 3IPXA 1NL3A 3FFBA 4BE7B 5EZ6B 4TMWA 2F1IA 3CLVA 3CF0A 3FMIA 5K8LA 1VCOA 4TYPA 3CX8A 5DH9A 2RGAA 1W48A 3U3JA 3QF7A 4GMXA 1IBRA 1KO7A 1MABB 4KBGA 3TLXA 1SULA 3I61A 5IHPA 1XPOA 3TAHA 2IXEA 1G7SA 2PCLA 3ECCA 4FMDB 1W5TA 2ZE6A 4TMKA 3THWA 1E4VA 5GJCA 1E98A 1QHSA 3LWNA 1UAAA 1SXJD 2ZJ2A 3U4QA 3RAPR 2OO7A 2ZJYA 2QENA 4NYJR 5AJXA 4EFNA 1OJLA 4TL7A 4YC7A 3OESA 4C30A 3R9WA 1E2NA 1E4YA 1ZU4A 3T1QA 1YRAA 2ZU0C 4KO8A 4QXAA 4O0MA 2HF8A 1KKMA 4H1VA 4B6EA 4DDWA 4NONA 2XITA 2CL6X 1GSIA 3CX7A 4GOXA 3QEJA 2NMVA 4ITRC 2C78A 2GEUA 1S96A 2XXAA 5DLQC 5HKKD 5HZHA 3PUWA 1KZ7B 4GP7A 4BLOA 2H17A 1Z2CA 1EK0A 2GCPA 3EIQA 4JLVA 1VECA 2Z5FA 4MGYR 4OQFA 1YZKA 3IQWA 1NLZA 3LBIA 4CIDA 1HE1C 1V5WA 2FF7A 4IFBA 4BFTA 4DEXA 1KDTA 2R6GA 3QPWA 4B6FA 1T0JB 2WSMA 2BBSA 2Y8EA 3NC1C 4PSAA 1CR1A 2ZSBA 2GJ9A 3L43A 4M53A 4URZR 4DLZA 4QBHA 2Q9BA 2P67A 3CNNA 4PPFA 1MR3F 2QZ4A 1KAGA 3FKSA 3GFTA 2ZANA 4LY6A 3PQCA 2C77A 3VKGA 4KFTA 2EYQA 3THYB 3CRQA 2IS6A 4RD6A 4P33A 2PZEA 1VYVA 1WBDA 1YQTA 2QAGA 3GLFA 4DB4A 4GMDA 4XD7A 4XWAA 1FW6A 4KYUA 1R2QA 1IXSB 2QORA 1LY1A 3O8DA 4QBGB 5L8VA 1ZC3A 5HR5A 3W6OA 1XB2A 1OFTA 4Q1EA 2J41A 1PUIA 2W83A 5FL7D 1U99A 3U44B 1W0JD 3BC1A 2ORWA 1OSNA 2EVWX 1DTSA 2CVHA 2NPFA 3GJ3A 4X8MA 4FINA 4AKGA 3R8FA 2JATA 4IEIA 3IEVA 1Q22A 4LBZA 1GL6A 1XTRA 4POAA 1XNJA 3B8HA 1KK2A 1J7KA 4FCWA 2ZUBA 1XFAA 3B1VA 1XMVA 2O8DB 3DM9B 3QXCA 2VQSA 1GILA 2R9VA 3CPEA 1XJCA 5AUPB 1GG2A 1NBME 1W46A 2GF9A 4DLRA 2A78A 3T1TA 1K5DA 1NVVQ 2UZ3A 2QE7A 3K0AB 2HDNB 3QEOA 3R9IA 5JCPA 1E69A 2IHBA 4JMPA 3KB1A 3M4YA 1YZLA 1T5IA 2ZI7A 4AG6A 4HLUA 4JS0A 1YZGA 5J4YA 2ZITA 1EGAA 1NVUQ 4KAXA 3FKQA 2QTVB 3CPHA 3UMRA 1WCV1 4O3MA 2GCOA 1QZXA 3P4XA 1P6XA 3KTAB 2V8OA 1KO4A 3NKVA 1T3HA 1ZCBA 3CH4B 4LDJA 2IEZA 2PZGA 2ZIAA 1DAKA 2G0TA 4MGZR 1XX6A 5G3YA 4X8HA 3BIFA 1JI0A 1SXJE 2BMFA 2F9MA 4RD1A 2QMEA 2BKUA 3ICQB 2X8AA 3EPKA 1DO2A 1XZPA 4G0NA 4A36A 1M7GA 4BLPA 5BN4A 1G19A 4CRWB 1A2BA 1SKYB 1TQ2A 2CK3A 3GQBA 5FOTA 2ZAOA 2FGKA 3O47A 4A2PA 1EG7A 4F4CA 3N70A 4TSFD 4L9SA 2O8FA 1SQ5A 3KX2A 5H8WA 1G3RA 1JR3E 2A5DA 3KQLA 1SXJA 1QHXA 2R65A 4Q02A 4TYQA 1YE8A 2CXXA 1YR9A 4JSYA 1XEXB 5FTKA 3CNOA 3CR7A 1QDEA 3GEEA 4JLBA 4ZDWA 2FSFA 1MOZA 2OBLA 4QJ5A 3U3RA 4F91B 4Q9HA 3AEZA 1P2SA 1A82A 4U7DA 3ADKA 2ZI4A 2D2EA 3TH5A 4UJ5A 4UNPA 5GADl 4FCTA 2KE5A 3B1XA 1JALA 5KNDA 1T6NA 2FSGA 2C99A 3KJIA 1AS2A 2QU8A 5CJPA 5JJKA 2AK2A 3CF2A 4FMCB 2NTYC 3QSYA 4IVQA 2QI9C 4A0HA 1OH6A 2DWOA 2OSBA 3QKSB 3B5JA 4GOJA 521PA 4TMVA 2VF8A 2RMKA 4XH9B 5EP4A 1WF3A 4OJKA 2K5UA 3GLHB 4FWIB 4EJSA 1RRGA 4LSGA 3CUEF 4M9SA 4YMTA 1S9DA 2O8EA 2W2TA 1E9DA 3QUSA 2ODNA 1E9EA 2OFXA 1IHUA 2CLCX 3EWAA 4DHEA 3NWJA 4GDFA 3L0OA 3EA5A 3FWYA 3GP8A 1TQ6A 2P2LA 4RY2A 2XZOA 1G6HA 1U81A 1Y3AA 4LV6A 1D8TA 1D9ZA 3KFVA 2L0XA 1DAIA 1WB9A 3KQKA 4AIIA 3GLIA 2ZAMA 4Q1FA 4YONB 3IUYA 3MJRA 5TV2A 4LYAA 2IF2A 3I72A 3B13B 4GI7A 1E6CA 4Q4HA 5JEEA 2QBYB 1XDBA 2E87A 1KJWA 3OZXA 4DVGA 5DE3A 221PA 1ZUIA 2OE2A 3B78A 4J0QA 4HLUC 2ANCA 4BZPA 2BMDA 4RFSA 4JLAA 5LD2C 1JEDA 4B75A 1R0ZA 2ERYA 4HSEA 2ZRIA 1FNNA 4P4SA 3VR4A 5JEDA 2CHQA 2IBMA 5JHGB 2LCFA 3IBGA 4LJ4A 1NKTA 2OCBA 2B92A 1OE0A 2FEMA 3LVRE 5FR1A 2QUZA 3PUZA 4PANA 2MMGA 2VA8A 3B1YA 4C0HA 1OHHA 3T06B 3BXZA 4QC2A 3N5CA 4PO8A 3ZS8A 8OHMA 4MYUA 4XTCS 4HB4A 4HZUA 4QHYA 2QP3A 3I3SR 3NC0C 1N6OA 5HPYB 3QBVA 3I62A 4YDSA 3WMFA 2ZYTX 3CZPA 4CW7A 1R5OA 2WKPA 4PHFA 3WRYC 4YLGA 4RZ3A 3G5UA 1TL7C 1R0WA 1JNYA 3BOSA 3TRFA 4QHSA 3U5ZB 2W00A 1P9NA 4YQFA 4LRWA 1VG0B 3C5CA 1DOAA 4Y0AA 2IS4A 4JZKA 2CMKA 1X8LA 4D80A 3K09A 3ADCA 2GDJA 2LKCA 5AUOB 2ZRPA 4AKIA 3FHOA 2XEXA 4JKYA 3HYRA 5JHHB 5KPJA 1X1RA 3BRWD 2ZRJA 3ZDQA 3NHBA 1OB5A 4JL5A 1N6NA 3AQ4A 4PPQA 4Q7MB 1R7RA 3QVUA 2WJJA 4KJZA 4QNMA 1UKVY 2PX3A 3B9QA 1N5IA 3QY0A 4JYBA 3JVUA 4NE2A 3VU9B 1U9IA 3VKHA 4ESVA 1Z06A 4KODA 2DFLA 1AN0A 3DHWC 3THWB 2X2FA 3DOFA 2KJQA 3OAAA 1XPRA 1COWA 1BMFD 2UVQA 3IILA 5JSZA 4L5BA 1XCMA 1E1RA 1G16A 2XNDA 1X86B 3SEAA 4QGAA 2EFGA 2OM2A 1QHYA 3CB4A 1UM8A 4UQOA 2J1LA 5KSYA 4BRWA 1JXOA 3RS2A 4Z8YA 2IHYA 2W6ID 2B21A 5DO9A 1LNZA 1ZINA 1W1WA 3TQCA 1G8HA 2ZXUA 4LJ5A 4OHXA 2Z83A 4V0OA 2AD1A 2ZREA 3SHWA 3VAAA 4ON9A 2QQEA 4KSCA 1TTTA 4W7SA 2GESA 2G88A 1N6PA 1E99A 4GZLA 1E2MA 1GKUB 1VG8A 4BQSA 3U4QB 1E9RA 2EFHB 3MGCA 1Z0AA 3R7WB 2J7PA 2H16A 2WJIA 1M74A 1OYWA 2GK6A 1BOFA 4MYHA 4WVFA 1I2MA 4LJ8A 1GRRA 3PEYA 5JZVA 4JYCA 3K9GA 2QSYA 3RANA 3E70C 3KKPA 3TGPA 1S1CA 4EPVA 3A4MA 2QAGB 1GM5A 3CWZA 2KWIA 3BJIC 1AZTA 1NMZA 1VYUA 4Q03A 2PX0A 3ZIAD 4C0SA 4RFSB 4OI4A 2RB4A 1TF2A 4DZZA 2EW1A 1DAFA 2NO1A 621PA 2ORVA 4OI0A 4EPRA 3VFDA 5BN5A 3SFZA 5JLJA 3QNUA 4XJXA 3VR6A 1LV7A 3ZH9B 3GCGA 2PJRA 3VQTA 4IHQA 2VHTA 2AD5A 3DVLA 4NYJQ 2CL7X 3BERA 5GVRA 1E2GA 6Q21A 3K09C 1D2NA 3OE7D 2WTUA 1N0UA 5HZKA 2WVJA 1JAIA 4DSNA 3N2IA 1CIPA 1IN8A 1XF9A 4DWJA 2ZRLA 1H8HA 3PR1A 2XGJA 1IN4A 4KSBA 2AN9A 2GCOB 4URXR 2YWGA 1RYFA 3QKTA 4M1OA 1GTVA 4B43A 4D82A 4Q1DA 4DDVA 3KTAA 2JIZD 4PO9A 4AYXA 5FUYA 3FHTA 3K0FA 4ZDKA 4TYWA 5DI3B 4ACBA 3I32A 5FR2A 4BLQA 4D25A 4PZZA 4OK3A 1CLUA 4ZDIA 1KO1A 4D4LA 2JLWA 4IOLA 4JLOA 1D9XA 1T5LA 1KI6A 2ZVPX 3DMNA 3ZS9A 5FFMA 4B44A 5SZIA 2WMOB 4Q1BA 3KKQA 3PIRA 2AFHE 1OT3A 3EASA 5FBWB 2V55B 1F3OA 1T9HA 1CR4A 4HDCA 5IK2D 1II9A 1FTSA 1XEWY 2DPXA 4RZXA 5CM8B 3F8TA 2QG6A 2QA5A 2BKEA 3KKMA 5H1YA 2HYIC 4IDPA 4DRZA 1P9RA 2XXAB 2IYYA 3QPUA 3TR0A 2O8BB 1NIPA 4FXPA 3A6PC 1ZCAA 4I1SA 2GJAA 1RIFA 2AWOA 2A3RA 2F6RA 2ECKA 3OIYA 2JLVA 1TPZA 5EE9A 2XTNA 4RVCA 4N0EA 1H8EA 1F2TA 2Q6TA 2VPPA 2W6JA 3BORA 2FFAA 3QENA 5SZHB 1QHHA 4EUNA 4Q1AA 5L3VA 4G3XA 4M1MA 5K8TA 3RS3A 1UBEA 2XOKA 2YC2C 3OIWA 3T61A 3ZVLA 1P2TA 2VP9A 3QKRA 1EFCA 3WRXC 1D2MA 1CRQA 2BJVA 5B58C 2W0SA 4JJZA 3I4LA 4BFZA 2FH5B 2PZFA 1AK2A 2V9PA 4LJAA 3SS8A 5KO2A 2VP0A 5SZKB 1BO6A 2CJWB 1AGPA 4G5OA 4G01B 4QBFA 2JASA 2FEOA 4B32A 4QOSA 3ZVMA 1E0AA 1FZQA 3VTKA 1YZQA 1F2UB 1NI3A 3GJ5A 1Q21A 3THYA 1AZSC 4YMSA 4FMBB 2FOLA 1GZSA 4BZQA 2BMJA 2V6JA 1GRNA 1ZJ6A 1S8FA 4Q4JB 1J8MF 4LPKA 2GVZC 5KU1A 4Q4AA 4Y0VA 1RZ3A 1JJ7A 3TVTA 1W4RA 3QJYA 3UK6A 1W36B 1F2TB 2JLXA 5JCZA 2Q9CA 4IKEA 1II0A 3K9NA 1NMXA 2XOKD 4M9XA 2YVUA 4PHTA 2QT1A 1Q1BA 4MQBA 2LKDA 4B2LA 3DOEA 2QEQA 5FBQB 4UXHA 4QGFA 4CEJB 2J3EA 2Z4SA 4BFWA 3GLGA 1OPXA 2H7VA 2N46A 5JWOA 4A6XA 5KPDA 5CLQA 2VP2A 3ND8A 3SBEA 4B3BA 4BEJA 3SR0A 3BWDD 3IIMA 3OIUA 3ZYCA 4Q7KA 2IA5A 1DS6A 4DLVA 3BB4A 1BMFA 3GFOA 4R2IA 2EYUA 3HP1A 4OKSA 2WWFA 3FFAA 1E2JA 3LFUA 1VDZA 4FCVA 4MKFA 2IYLD 4IDOA 4KI0A 4M1SA 1KI6B 2W2VA 3SN6A 1SVWA 1E2QA 5L3QA 2NGRA 3GJ7A 3ZJYA 1II8B 2W6IA 4DJTA 3MWKA 5B64A 3LQQA 2CNWA 3AKDA 3LLMA 3LA6A 2BVNA 2ZEJA 4OI2A 1PVOA 3AUXA 1EWQA 2G1JA 2WJVA 2HT6A 5DI9A 3K70C 1DAHA 3U3OA 4AYWA 4Z54A 1GVNB 3EIHA 3KUCA 4YMUA 1ZRHA 4LC1A 2WIAA 4RD0A 4EFMA 2GETA 1XD8A 3A58B 5KSOA 3KUDA 3AB3A 2PT5A 1IY1A 4PFSA 1E0JA 1UFQA 2IT1A 3I8SA 1NLFA 4P4TA 3AVOA 1N5JA 1KAOA 3GLFE 2Z0MA 3WNDA 1S4QA 2O0HA 2ZROA 3MUFA 3U6KA 2BBWA 5CB8A 5AWFC 2NO6A 1KI1A 1Z83A 4NPHA 1DE0A 3VX3A 4V0LA 1QRAA 2P6NA 3UWOA 2WWWA 1BIFA 1T0HB 1UDWA 2EWVA 5CM9C 1I4DD 2RCNA 2EFCB 5KDDA 5FPSA 3P26A 3ZZ0A 1FP6A 4QJ4A 4TWZA 4MUBA 2IWHA 1P2VA 5D3MB 2ANBA 1MH1A 1NRJB 1GKYA 1ZM2A 2AFIE 2C5LA 1U8ZA 3UWKA 4EPYA 3OFND 5B30A 4G5GA 4HDOB 1NNEA 1NMYA 1P72A 3A1WA 1OV4A 1ZD9A 4WZ6A 4B74A 2CE7A 5KOYA 1I4LD 1SVSA 4Q7LA 1IXRC 1HUQA 3GLHE 2JGNA 5TMPA 4IDNA 3HYTA 3X1XA 4Q1CA 1US8B 4MYCA 2J5XA 5CDFE 3RWOA 2ZRAA 2F43B 4EJSB 1ZNWA 3ND9A 2X19A 3L0SA 3TE6A 4URWR 3VR5A 4KFRA 4TMXA 3S1AA 2OCAA 3KL4A 4NDZA 1OIVA 4K46A 1OKKD 3HU3A 3FMOB 4LOAA 3SJZA 1E9AA 2XSZD 3FGNA 3VKWA 3NIBA 1GITA 4PSKA 2PMDA 3KXKA 3GMTA 3LXXA 2G77B 1E9CA 1KMQA 4HEJA 3BB1A 1H65A 3TSOA 3CRRA 1ZP6A 1VCNA 1GNQA 2IYTA 2OEPA 4M4SA 4DCSA 3BFVA 4MKGA 2VYFA 1XTJA 4XVRA 2B7BA 1XXHA 4LZZA 3W90A 1XTIA 4ARZB 1M7BA 5E7JA 5UKDA 4V0MA 3HU1A 4V02A 2R62A 2J0UB 2H92A 4RFVA 1E2EA 1E94E 1E9SA 2D7CA 1M8PA 2KBEA 1EXMA 4NCIA 3GJ0A 3AVWA 1G5RA 3VNVA 1W7AA 1NVXQ 3C14C 5FOWA 2HYDA 1KNXA 4L8GA 2F1RA 3D3QA 4KBFA 5L3SB 2QGZA 2XSZA 3A36A 2GXAA 2P3SA 2J0SA 1GP2A 5ELXA 2GTPA 2WSSA 5EZ5A 4D4KA 5IF9A 3A4NA 4Q9KA 3T1VA 4PSVA 1F60A 2C03A 2JLSA 2BWJA 3KKOA 3AKEA 4JLJA 4O25A 2FSIA 2IUUA 4B3XA 2GZAA 3A1UA 3MD0A 4AWXA 3FDIA 1JEEA 4TLAA 4TT3D 4M21A 4I99A 4AC9A 1X8JA 5DI3A 5IK2A 3K0AA 3LVQE 4MGIR 3THXA 5C1BA 4CEIA 4QM6A 3QXXA 2QL6A 4ZPXA 1F48A 3P32A 3R20A 3MWJA 2V54A 3GJXC 3EZFA 3AVVA 2RGEA 1HURA 1KJZA 4H1UA 2F7SA 1NIJA 1ESMA 3EZ7A 4JLKA 1M7HA 4CEHA 2C98A 4NTZA 5K8UA 2ZRKA 4LYFA 2F3TA 2J45A 1U8AA 2OLJA 2FFQA 4PTLA 2HUPA 5FUWA 4OK6A 3BD9A 3KB2A 4DC9A 4ZCLA 1ZC4A 3D7MA 2D74A 3Q3JB 4KHZA 2H8KA 5DSZA 2ONJA 4LV8B 3DL0A 4U5XA 4HLDA 1HYQA 4JLPA 2V6IA 4OL0A 3NHAA 2C95A 3BFXA 1QHHB 4QG7A 5KYKA 1IN5A 1MKYA 4I1OA 3R9XA 2NQ2C 1W36C 4C0QC 4WXRA 4M9ZA 3NBYC 4U02A 4LUCA 5KSZA 3BH7A 4TQAA 3M0EA 3WBKA 1VIAA 4LX0A 1XD9A 3AF4A 4HAUA 4NBSA 1L8QA 2XB4A 2ZUDA 1SXJC 2ZJOA 2QTHA 1G7TA 2ZETA 2J9RA 5KHOC 4NU0A 1IY0A 1ZYUA 1TQDA 4NHOA 5EUQB 2A9KA 2CVFA 4DLWA 2VHQA 1QVRA 2GKSA 3W3AA 4B71A 3AUYA 4G5QA 4JVMA 3S1AB 2NO7A 1YHNA 3P27A 3SYKA 4CZ2A 4P4UA 5C46F 2QN6A 1JR6A 1ZUHA 4QBIA 2QQ0A 1G3IA 1OXTA 3HWSA 3WMGA 4B3FX 1O87A 4NYMQ 2QMHA 4PZLA 1N0WA 1FTNA 1G64A 3CR8A 1Z0FA 1G17A 3O8RA 5TY0A 5J40A 4FIDA 1HT1E 1KI7A 4Q48A 4E5UA 3R7WA 2DB3A 1M34E 4ZKEA 5DN6A 3AKCA 2ZM5A 5FOVA 3O8BA 1YVDA 1PV4A 5J4KA 5BN3A 1DBSA 1P7CA 4Q5IA 2NIPA 2YNMA 2XNDD
chains in the Genus database with same CATH superfamily
2IVZA 13PKA 1XL0A 4HAZA 4LOKA 4DLYA 4ER3A 2J08A 2OD7A 3CPJB 4FI3C 1D6SA 3ZK9A 2JAOA 1SVMA 4J1QA 5L40A 3G2NA 2IU4A 4HGNA 3QTLA 1J97A 3I5MA 1CB7A 5A0FA 4L1KA 4K3VA 1UT8A 1KI8A 2W0MA 3ZDAA 1QIHA 3P7MA 3E5MA 4PLFA 4R2JA 4WCDA 4B0PA 3FMPB 1O9GA 4UE6A 4CDMA 4LDQA 1T1RA 3S27A 3HKDA 3PU6A 4FHEA 1HV8A 1F2UA 3AU8A 2DCUA 3ED1A 3TW6A 4OHYA 1L8AA 5AOAA 1HWYA 1C7IA 2XUAA 1THGA 1S2GA 5A9SA 2YXPX 5IM5A 2H2GA 4B34A 4O8CA 1I2AA 2WT4A 4UU8A 1G8FA 3I9V6 4C2BA 1LZKA 2REBA 4NZPA 1P8JA 2QSZA 4JU9A 4ZPJA 5B3JC 2YVAA 3KPVA 4C06A 5IVHA 3RU7A 1NOKA 1BX3A 5IJ9A 4NWIA 4Q21A 2ZAYA 3OTQA 3V4RA 4E30A 4NABA 4OXNA 2B36A 1AS0A 2YWHA 5C3MA 4RJKA 4BXOA 1CUGA 2BFFA 2QX9A 3EDMA 3WBJA 3UK1A 1U1GA 4LQ4A 3REGA 1IBSA 1NW5A 3A9VA 1S2DA 3UB3A 2XX3A 2WTNA 3A4LA 3AUTA 3HU2A 3PEEA 1GTZA 4NYMR 2Q21A 3L7KA 3FXAA 3G7UA 5CYPA 3TXXA 4MPJA 3NNDA 3CUTA 4CQJA 4F2GA 3OP1A 1R8JA 1WY5A 3A4IA 3LL4A 3UJ9A 4EKYA 1QRDA 3O95A 5C34B 4AJ4A 5CDUA 5A1TA 1V43A 4FNAA 4OBWA 4CE6A 3JXEA 3IBTA 1YR7A 4HGRA 1HT2E 3FOAA 5ER9A 3K2BA 1UFKA 1JJBA 5D01A 2VTKA 5F76A 4FZRA 3LRXA 4CV2A 1PS9A 4CM4A 4UUQA 1W0KD 4E6PA 4UASA 4Y6LA 4KO3S 4IOKA 1XLWA 3D3KA 5ALZA 3E81A 1L5WA 2HRDA 5HUJA 4MHTA 2FJ0A 2DQSA 4H31A 2HCRA 2ORED 1P73A 1K6IA 4L9AA 1WU7A 4BX0A 1XTQA 2NU9B 5LXTA 4W5WA 2FPWA 2Y1DA 8MHTA 3IP7A 2IDJA 2ZUWA 3L18A 2WG1A 2J3HA 1DC7A 4GNKA 4OUDA 1A8IA 2WWTA 2IYVA 4JQCA 4BO3A 4FFRA 4ND1A 1CZOA 3SJUA 5IBCA 1RXSA 1PG2A 1E4EA 1YO6A 2QRKA 3KR0A 3ICPA 4NV1A 4BBAA 4US0R 1Q7CA 3F49S 4HY3A 3DMHA 1WBBA 2PGDA 3QFRA 5GONF 2CCKA 4EKIA 1JEYA 3SE0A 5JV5A 4QDXA 3WKAA 1RCTE 3FZYA 1RXYA 3HZHA 3IEPA 1NRXA 4NG5A 2GPNA 2QAGC 4JJAA 3QKRB 3R3XA 2WQ6A 2IBTA 3KFXA 1AT1A 1U2GA 2WDZA 5FJIA 2B0JA 3EXHB 4CKYA 4IDGA 5B2EA 3JZAA 1WQ4A 2X23A 2OCYC 2BBOA 3N05A 3TKAA 2BI4A 3V9PA 4OKNA 1TI7A 5KOHA 3AI7A 5KWIA 2VRCD 3IKTA 4KGVA 3ESBA 3DTVA 1TEXA 1F8FA 3FUTA 3PNYA 3R77A 3U9SA 4K3UA 2WJ3A 2LDXA 4K5QA 2WWGA 3HZZA 2ZBQA 1IXZA 1GGHA 3Q8XB 3GLFB 3KYDA 1YASA 4M0LA 4NPAA 3ENZA 2RK4A 2V7VA 1Y4SA 3NEJA 3RJZA 1X9HA 2NTNA 3RJTA 1UCFA 2W4IA 4Q9AA 1KEWA 1V8BA 4HQRA 4QODA 4Z2YA 10MHA 2WEKA 4PZYA 1YKGA 3RVQA 5JARA 1NX9A 2VSNA 1NXWA 3QH4A 4PGHA 2H0RA 1J8QA 5JYCA 4O59O 5DX0A 1WHTA 4EDFA 1IOZA 1W35A 4OQ4A 2PUBA 4XSHA 5K45A 2X5XA 3ANSA 2WYHA 1VI6A 5BR4A 1NQWA 2DKNA 1ZSYA 3GZNA 3OFNA 4XRRA 3VR4H 1OLUA 3GUHA 3K5PA 3DVRX 3P94A 5EXTA 5LA6F 2FGJA 2RKWA 5T64A 2J0UA 2JI7A 4H3SA 2R4QA 3V1KA 4BFVA 3AY6A 4GVXA 3KWJA 4BMSA 3RB8A 2ZI6A 1L5KA 3FB4A 5B57C 4FYXA 3LP8A 1JS1X 3R6TA 3VTFA 2O6HA 4AMBA 3P97A 3DHEA 3LPCA 3PUVA 4KLZA 4B35A 1P74A 4LF8B 2LP4Y 3IQDB 2GAFA 2LGJA 2X58A 4BOYA 1V37A 1WRBA 5DCYA 3AQIA 2QN2A 5DHTA 4KPUB 1Z4LA 2POQX 5ESRA 3T7RA 4ENPA 2JIDA 3FNBA 4GI5A 4UKDA 1K5GA 4WZBE 5EUMA 3PT5A 1ICIA 4J49A 4WMLA 5I9SA 4CG1A 5C8DA 5FWYA 2OECA 3C45A 5FUBA 2VPZA 3OOEA 4OQEA 5G40A 1KS9A 1O58A 1WM1A 3GRKA 4Q3KA 4RFLA 4YRPA 1UPBA 5ED4A 1A7UA 1D5WA 3RYIA 1J8VA 2R00C 4WFJA 4XR9A 4H7DA 4OEHA 1RAFA 4KDEA 3F71A 1COWD 1XCPA 2LXNA 3WIEA 1P39A 4GWLA 4NL4H 5LPNA 2I7VA 2JJ1A 2RI1A 5JJIA 1C50A 4Z4EA 2Q28A 2ILTA 2QP9X 3S99A 3V4VB 3DD1A 3QE3A 2GBGA 5KS2A 4DV7B 1J22A 1IPHA 1SXJB 1Y5NA 3LQKA 4G9BA 1GAJA 2Z5GA 4EYQA 3DVQX 2WIGA 4QTYA 4FFLA 4CQMD 4UNQA 2WC1A 1KSFX 1RZVA 1VG9B 2YXBA 2J4DA 3SYTA 2QGFA 4R2KA 5G4KA 4DCUA 1Z5UA 4Z7JA 4CDRA 1IN6A 5GOZA 4PC6A 4REQA 2VYNA 3ZIDA 2O1XA 2UYOA 4QUBA 4F4IA 5JVDF 2HRZA 3PRHA 5JAOA 3AI2A 1V3QE 4PN7A 3LDAA 5D3MA 1XT6A 1LVHA 1ONBA 1OTYA 4OHPA 5DNYB 4MPDA 1MHTA 5MHTA 1WLSA 1HZJA 1V1RB 3OPYB 2YZGA 2PQMA 3K4QA 4NARA 2PTGA 4S12A 5D5QA 5CEJA 5JMTA 3I42A 4UTOA 2C4UA 1SQSA 4ZVNA 4YPFA 2Z6VA 4UFPA 1RXUA 1G20E 2OSVA 1UMCB 4OB8A 3HBMA 2EDCA 4MI6A 3ECAA 2ST1A 2XUIA 4PZDA 2PDAA 3JAKB 4DBLC 4HDMB 3WG9A 3OZWA 1VL0A 1BH6A 5BW4A 4IFIA 4EKGA 1FB5A 3IVAA 1PNQA 1QHGA 1ZMRA 3W5AA 5K8IA 3UWSA 3LUAA 2WM9B 3QQPA 4GOKA 5GJWC 1GFIA 3Q0IA 3T7JA 1DRKA 2KBFA 3FRIA 4CCYB 5C8VA 5CITA 1ZZEA 2J9GA 2O2XA 2H52A 4M0UA 4RF2A 1A4IA 5DOVA 1XWIA 4P7GA 4BQEA 4DZRA 3T5PA 1F8XA 3PFIA 3TJRA 2IEGA 4DV2B 1IC6A 4KWHA 2GLTA 4BBJA 1E5VA 5FOSA 3UH1A 5DHAA 5DHFA 3W6ZA 2ZTHA 1ND6A 3HSKA 1RTKA 2J67A 4L95C 4BLWA 3IPLA 2C42A 3Q4GA 4GS5A 3VOTA 1MRSA 4KQ6A 1E5TA 3TOVA 1JXQA 5TGZA 3WA6A 1NVTA 3FDZB 4XUEA 1P1FA 4K1LA 2V6GA 1Y9EA 2IZZA 2HIMA 3GOQA 1P61B 4DB2A 2ARKA 4A8HA 2OBXA 2RHWA 3HJUA 4GUAA 5ITZB 1ESNA 4KPYA 1W5AA 1U65A 3HL0A 4MMXB 5PGMA 3FIUA 4HDKA 5T41A 2IIQA 4F5EA 3WL3A 1SNYA 1B26A 4NMXB 2RD2A 1CEQA 3SQXA 2AXQA 3SIWA 3IT3A 4XDHA 4B4KA 2JLUA 1LKZA 1MOQA 2OV6A 3WJ1A 4B76A 1YZUA 4QUHA 4OL9A 2QWXA 3NEYA 1KZ1A 1XDDA 3FF4A 1JJVA 1X3LA 3GFPA 4Q4AB 3JQGA 3GT7A 2ZJ8A 4Q34A 2VF4X 5FFFA 3VR5H 1E32A 1QBKC 3O92A 4PU0A 2GZSA 2CJFA 2ZYIA 5I9MA 1HEYA 2B1GA 1X3SA 2VUHB 3ZPXA 4PHHA 3GEPA 4Y9UA 4XJTA 2CXUA 2XVZA 4PAOA 3S44A 1V2HE 1HLFA 2KHZA 4DIOA 1BXRA 1XYYA 2GNPA 4P4NA 2C20A 2QN1A 4DR3B 3CTMA 3AF5A 3IKVA 3MZ0A 4P3XA 3RS7A 5GVSA 4ZGBA 2VP5A 2IYAA 3ABZA 4MW2A 2ZYSA 1GKKA 3L6BA 2VJYA 5HE8A 3RVNA 4C14A 3PHCA 1VHLA 2PYDA 1X2BA 2QX7A 4NQRA 1RWXA 5F5NA 3PEVA 4C4ZA 1E6EA 3K9LA 4R71A 3UG6A 1IBCA 1YFJA 5HDQA 1PO7A 1L5QA 3TOSA 3R0ZA 5EXDA 1FLAA 5AJZA 1Z07A 4DQLA 1Z25A 4DCNA 1OH7A 4HWPA 1G8SA 1FJGB 4UDYX 3MJSA 5K01A 4CEJA 1V5IA 2ZZKA 1KK3A 2ZRHA 4KWEA 4E11A 2WIKA 1DAGA 4GBGA 1A50B 2WP8J 3I92A 4CPDA 2FN3A 2Y4NA 2G1AA 4LXYA 3TMYA 2NO5A 3JQDA 4YYZA 4CIVA 3U7EB 1VBMA 2FP4B 2DBVO 2VCEA 3IDZA 1NQOA 3O2JA 4FYYA 1AK9A 2XA9A 3S2UA 1D6MA 4X1IA 4QTZA 4N41A 2BV3A 3YASA 4BLUA 1IUPA 1MJGM 2QRLA 2H31A 1UZUA 3H17A 1JZQA 3NP9A 3PC2A 2IZ6A 5EP2A 2OCPA 6GPBA 4MKHA 4A0QA 2WE7A 1QH8A 1M6EX 1GN8A 1Y9JA 4GECA 4M8LA 4R41A 3EVNA 4ZRDA 3RSSA 4EG8A 4M9QA 4R1NA 3CNLA 2A30A 1SQ0A 1JQAA 5DNEA 3LX6A 3HCPA 3I09A 1T3SA 3ZZTA 4BJ6A 4HJRA 1P0IA 1DWQA 1KMIY 5ALHA 3JRXA 4L6IA 4EDHA 4QYWA 1IEXA 1I3LA 5AVSA 4QYIB 5HCUA 1U2PA 3X2FA 3D5QA 3K6SA 1FYDA 3W4JA 3C8DA 3UJCA 1P1KA 3UG7A 3JQFA 2ZXFA 3EMBA 1M76A 1N0VC 1ORHA 1TCBA 4GKAA 4HAIA 3E18A 4BP8A 3H2KA 4DLKA 3HPRA 4YLYA 3WLKX 4Q7JB 1G21A 2C5SA 1SXGA 3KBBA 5DKFA 2C04A 1KEPA 5K0NA 4EQZA 2RHRA 5IT5A 2FI1A 2VXYA 1HO3A 1RW4A 4V0ME 1DG1G 3DLPX 3I01M 1NAHA 4XWGA 3WWEA 3MAAC 2PG3A 3AM5A 2OV2A 3KJQA 4HHEA 2R2AA 4ZI7F 4Q3LA 4YRTA 3JD0A 3CUKA 2CNBA 1C7FA 1V8OA 3L8YA 1JH8A 3ABSB 2HA7A 1M6HA 1XLVA 2RGWA 2ZSEA 3G9UA 4MSUA 3VPAA 3M9WA 4CKBA 5IMSA 3BXFA 4RNCA 1DXYA 4AK9A 5KNCA 2K2WA 1QOZA 4DIEA 2VJAA 4FD3A 1VLMA 2PTHA 1GAEO 2FR1A 3SFTA 1TM4E 1IULA 4F1KA 1W85A 2RHDA 1L2TA 2H2FA 3V7UA 2ID9A 2REXB 1BYIA 1LDBA 2HAEA 4I9GA 5TEWA 1K27A 3TZHA 3RTDA 4DYDA 1RM3A 1E1KA 5BQFA 4QFMA 4X91A 4FOSA 5T4BA 1WSBA 1PGQA 2XF8A 4Y2YA 5JO0A 1DADA 3E9QA 3KQOA 2X0IA 4H7IA 3F4KA 1Y8RA 3N8KA 4G1VA 2VJBA 4I1IA 1L3CA 1NPYA 1U4SA 4Z9XA 2W6ZA 5F98A 1SQFA 2HSEA 3F0TA 3G88A 1M5TA 1M6NA 3MWYW 1W2HA 1O97D 2PUJA 2Q6OA 3O4IA 4KLNA 3OMXA 2X77A 4P53A 2H54A 4K0KB 3P2EA 1GTJ1 3IURA 3N2KA 3QK7A 3DCNA 2PA3A 2C3OA 2SNIE 3KD2A 5TARA 2O4CA 3WHLA 3CZRA 5A5EA 5LZ4A 1YZNA 4GKJB 1IMOA 2HLPA 4LRYA 1RYYA 3G17A 3OHPA 3PFCA 3WJ2A 5K99A 2DR2A 1YOVB 2MTBA 3ICOA 4TYYA 4WWHA 1TECE 2ZUCA 2ZT5A 1B8OA 4IX9A 3ZDRA 4C2UA 2NW6A 1IRXA 1XCOA 5ANRB 2PWPA 4EX7A 1FS6A 3UPTA 1W4ZA 1J1UA 1DRUA 2RGYA 3D6TB 4EK9A 3VPDA 1CRZA 2DUMA 1I1NA 1VA5A 3G82C 5IDYA 3E8MA 5BQOA 3W06A 1ZI9A 3E5HA 4AY5A 1Z5PA 2EL7A 4J9VA 2DHRA 3FWZA 1SD1A 2IYPA 1P5JA 2EP7A 1O7JA 3NEPX 3Q88A 2IDMA 5CG1A 4OF4A 3L7DA 3VVLA 3VZCA 5JATA 2IYSA 3BJRA 7ABPA 4MVJE 5JD5A 1SIOA 5ALNA 1S8OA 3D4LA 3LUKA 2WHXA 4RVDA 1KHTA 3WB2A 4RVHA 2R1VB 5E0OA 4PSCA 2P3OA 3B53X 4B3DA 4R2HA 1H4VB 2PFGA 2V45A 2PH1A 2PNFA 1FP4B 3QLJA 3SQMA 2V4ZA 4ZOCA 3DUFA 3P9NA 4NMHA 1DWPA 2F3SA 4JEMA 4FFSA 1F6BA 1SC4A 3LE8A 3I9V1 3SMQA 4BZXA 3PWTA 2Q4DA 2OZEA 4PXYA 1UKEA 2GQ0A 4PTZA 5IX8A 1W0CA 4DABA 1TAQA 3OICA 5JNSA 4NCHA 4IIUA 2CEAA 1S4MA 3FWHA 4DQ0A 3HZRA 1E1LA 1P18A 2IY9A 1VRWA 3LG2A 1IHOA 1D8AA 3ZBQA 4CN8A 2ON6A 3RFVA 4ZZ0A 1JQBA 2MSCB 3C8ZA 3I28A 1LC0A 1T2VA 1E2BA 3TKLA 5DHQA 1PDOA 2A9FA 4QULA 1LTHR 3E6AA 3MINB 5HM6A 4XUDA 2D0OB 1R4ZA 2WMDA 4IGIA 3X1JA 4UM9D 3HA5A 3MRXA 4Q4CA 4DGSA 1LUAA 4R9RA 5L3RA 5IKMA 4HS9A 3NIFB 4HS4A 3AR3A 4A2WA 1B93A 2YJGA 1IWPB 3H9JA 1XEFA 4LJ7A 1GA4A 3GWZA 1M1YE 4Q4HB 5I7VA 2E0IA 3AHJA 1OFGA 4ERNA 1IJBA 2BZSA 2PO7A 4R69A 1XEWX 1B42A 1XZ8A 2BTOA 4EG3A 1EHYA 2VI5A 1Z15A 3IVXA 3ER9A 1I5RA 2FPXA 4W5HA 2B1JA 1CF2O 3IDFA 1EJBA 3ZWWA 5IXJA 3STXA 1V45E 3OX1A 2OCDA 4I8XA 4KI7A 4QEZA 5REQA 4JUCA 4N1AA 4W9RA 5DBHX 2J0QA 4HQ6A 1H9BA 2FWJA 1GTL1 2XRYA 1GRQA 4BNLA 5KZMB 1VQ1A 2VH2A 1BDJA 1W6RA 2DGDA 2XECA 2P6RA 1EQ2A 4ZRMA 4ZFNA 2BHLA 4MRMB 4ZQCB 2IYXA 1KYZA 2FAXA 1OBVA 4RPCA 3GT4A 3KTOA 1YFZA 2OZPA 2O1SA 3HCOA 3PXDA 1WXDA 3R9KA 3C4JA 4K6KA 4QYTA 1DZIA 2FCRA 4QXQA 2RH8A 2BUAA 3WICA 1ILEA 3JQQA 1NBIA 1WDTA 4RMHA 1XKQA 1DO0A 3GUZA 2ZIEA 4RTSA 2JJ2D 1UPXA 2EJVA 4L8FA 1U31A 4AMZA 5I9NA 3PRJA 4BFSA 2HK6A 1XJQA 4N6GA 3IQIX 4HATA 1J2TA 2I87A 3WLAA 1NKSA 1N6IA 1RLTA 4CMIA 1P7VA 3O0TA 2P11A 4RGVA 3VRHA 2VH1A 3W1EA 3RYHB 1ORRA 3ISTA 2QRZA 1V8ZA 1B14A 1E1RD 2Y66A 4JT8A 3EVFA 4OI1A 4B8YA 5EJ7A 4YRNA 5DISB 1FXWA 4BWVA 2JLAA 2J0EA 3U3MA 4C1NA 4EF6A 5AVQA 1FXWF 1XQYA 2ZSDA 4AZ0A 5B7QA 1P4JA 2VPWA 2H2HA 2K7ZA 2B6HA 3JAWA 3JY6A 1I4OA 4MQEA 4RGBA 3EPJA 3I45A 3HDHA 2C0QA 4HYYA 4JD5A 4OHCA 1EI9A 4TMTA 5K0CA 4TM8A 1EP1B 4ENRA 2ZS7A 4C7BA 4FYIA 2A9RA 4HEA6 2P62A 2V7PA 4FCCA 2RHMA 3MC1A 2E9SA 2HCFA 1JSZA 1USUA 4FILA 4GKVA 1ZWKA 3M6UA 2BEKA 3Q2OA 5K1ZA 1R6TA 1ACLA 3ZNNA 1AQYA 4GPEA 5ESWA 5HMLA 1YL5A 4ZIRA 1DX9A 2BP7B 3ZD8A 1N33B 4UJ3A 3WWDA 1EFUA 3QFTA 1LDMA 3IHWA 4UAGA 3DDHA 4H3VA 2R751 4N7JA 1HKUA 2OCLA 5CVCA 3ZHSA 2PVPA 3D6JA 2QQ5A 1SKYE 5DTRA 1A7JA 2QXTA 3W5JA 3D6NB 5EE0A 3BKXA 3DOHA 1R4MB 4JLSA 2CXNA 4G1UC 1FX1A 4LY9A 4TXNA 3AUJB 3TZQA 1FUUA 1Q3TA 1CD5A 2Q0SA 1UADA 3T15A 1IATA 3BMCA 1WOMA 3UCXA 1G41A 1U6IA 4NCJA 3IDQA 1IFXA 4P08A 1J0AA 5AUNB 1AIPA 3M6XA 3CX6A 1UJBA 3F7TA 3CO5A 2J31A 3P5BA 1Q3KA 2GAJA 3CEAA 5IC5A 2XA1A 5CVUA 4FHFA 1HG0A 2IC5A 3AI1A 4ETNA 3GLKA 3CU5A 1X7YA 1WY7A 4Y2JA 1U3CA 3CCBA 1VBKA 2Q7XA 2QE6A 1OBFO 4EY6A 3D7RA 3F5QA 3I9MA 4PQFA 4RLQA 1FSSA 4U2EA 1XRMA 4N3NA 3HHPA 2R44A 1XI2A 1F5NA 1EGMB 4NBNA 1OLSA 2Y77A 5HOEA 4WKNA 5CD1A 4Y6PA 4MRVA 4HLQB 3C1AA 2JLRA 4MRRA 1GDHA 3M5DA 5CU7A 2XTMA 1XJWA 3IAEA 1EZ1A 4WCVA 5AKHA 2HFJA 4ZJUA 3PEWA 2QDXA 4NSNA 4WOPA 4Z9FA 1K8XB 2CCGA 1UC4B 2QY9A 1HNXB 3P9QA 2PKEA 5LC1A 3UKDA 3MG9A 3Q8WA 4S04A 1FK8A 1JT2A 3FOFC 2DPYA 1B6TA 3F2VA 1WMEA 2CNWD 3D7NA 4UUBA 5FTMA 5ALFA 5KTYA 2BFDA 3LBYA 4NF2A 2GEDA 4IDAA 4IXTA 4ER5A 2PLFA 3WB0A 4JBWA 2J87A 3NTQA 3JTEA 2ZRMA 3C8HA 3KAJA 5JSQA 2OAQ1 4ZVPA 2NADA 3OZ7A 4GBJA 2ERXA 1UT5A 5CX1B 3SOPA 5GIOE 3AHEA 2R7NA 4ARUA 1NX6A 2ZQ5A 2R84A 3GEIA 2FUEA 3E0XA 4HDRB 1T26A 2AEFA 3KOWA 3L0IB 4QPCA 4RSRA 5LYJA 3UT5A 1CP2A 4C3ZA 4UCXA 3TLYA 1GAXA 3OECA 1TD9A 1YRQA 1QPZA 4PX9A 3B2EA 1F9EA 1L7QA 2ODQA 3JZMA 1MTOA 4MITA 4AY3A 3FOZA 1JILA 1A9SA 1QCCA 1YL7A 2C3UA 2BRUC 3PPXA 3OU7A 4HI0E 4MLDA 3W5IA 1GPLA 1Z6QA 2P9GA 1ZIPA 1ACMA 1NJFA 1Z4PX 2Q4BA 4XUCA 4Y3UA 5EE1A 2JA2A 2NU9A 1L3BA 2ZB4A 3D2AA 3QBTA 3I0MA 3BSYA 3FZEA 4BEWA 2O4UX 4C43A 3C4QA 1T24A 2Q2VA 2BGJA 2HO5A 2IPAB 3C3KA 4QOIA 4CV1A 2PMWB 1KOLA 3Q7SA 5CA0F 1RKUA 5KTRA 2VL7A 2DT8A 2P2CA 2VSFA 2ZWIA 4KYVA 3LVFO 4P3OA 4QQFA 3WLPA 3G49A 2I6FA 1QQ5A 1TMYA 5D5HA 4C6TB 2X14A 4NMLA 4DLTA 3QI7A 1NXOA 1FFXA 3JVEA 4V2IA 1PLKA 2Z2YA 4KP7A 3RC8A 3RC3A 3AH8A 3W7AA 1NWCA 3CTPA 2AI3A 3DFZA 4CKBB 2XB2A 1WPRA 3KP1A 5E9JA 1ZJYA 4RHCA 3IOMA 2UZ1A 2NU6A 1GR0A 1MFPA 2P2NA 3IV7A 3Q3HA 4WXMA 1UPTA 4UHKA 1TF7A 1W87A 4X71A 1DAOA 1MABA 1PR1A 2BFNA 2FWAA 1ZONA 2PJZA 4QREA 4WK0B 2P65A 4KIGA 2CWWA 1XVUA 3AONB 1J49A 3LY7A 1SVIA 3C6YA 4YGXB 5FYDA 1A9XA 1R8SA 2CDAA 3PGKA 2QL9A 3ZD6A 1J99A 1YR2A 3BL6A 5C31A 4BO0A 4C4YA 4GWKA 4HNGA 5JY1A 2QLLA 1UXKA 1T15A 3GMIA 3FMGA 4X64B 1C1DA 1Q17A 4GH5A 3A9WA 2Z1MA 4LHXA 3DS8A 4KQJA 1H23A 3WLSA 3PVCA 4ZKDA 3Q9LA 2ZCVA 2H4HA 1RQXA 3TD6A 5ICCA 3KQQA 2OXIA 2BFPA 3JQBA 3RWBA 1L9XA 1C30B 3O8QB 4P9NA 3LUFA 1KSHA 3PDCA 4TZ6A 3WR5A 1FMLA 2CJWA 3IMEA 3O4VA 3SX0A 1BS1A 2HQ1A 4OAPA 5CJ2A 2QM7A 3GZNB 3I05A 4J0EA 5HTKA 1BW9A 4ZREA 1XJ0A 5FQOA 1SCUB 4V1CA 1E0KA 4YAGA 4P4GA 1Q0HA 4CTOA 5KQRA 1SHKA 1XMSA 1GPWB 1ARZA 4YMVA 3OZTA 1FJ2A 4QYXA 6LDHA 4HEQA 1OAKA 1PEAA 1U7TA 2M2IA 3G7NA 4HWGA 1RMQA 3COWA 1SBTA 4QUJA 5FWYB 4A92A 2JJ2A 3I01A 1ZAKA 1MP0A 3PX3A 4V3CA 4CLDA 3U7HB 1G8GA 1MDFA 2DFVA 3F4BA 3N2GA 4JJGA 4CEHB 1QH8B 4S1NA 4BDTA 4CQNA 1SIWA 3F78A 4JOCA 3OP4A 3T5GA 1Y37A 3MCUA 2OILA 3QJGA 1G2QA 4ZAGA 1BYUA 3HNOA 2DWQA 1A2OA 3ADPA 2IY7A 5J5VA 4AVYA 1TUIA 3O9ZA 1NBHA 2NG1A 1PJTA 4ND5A 2Q1UA 3VR4D 3NH6A 3IKJA 4J94A 5FOUA 4QOEA 4WK6A 2D8AA 4IKOA 2CDNA 2CUZA 1TNDA 5J2TF 2AN5A 1W2WB 1MBZA 4CLRB 1HX7A 1SOWA 4G9EA 3HV0A 1E79A 1VP9A 1ISSA 1AHIA 1BW9B 1GN9A 1UWVA 3FR8A 4LXIA 3T5MA 4V1CB 1ZOPA 4F4UA 1XQXA 5AQEA 3WLIA 2G72A 4Q9JA 4WY5A 2NO4A 2PZJA 4OSOA 1QHFA 1TX4B 1Z26A 4QSMA 4MVJF 4EB3A 5KKNB 1J56A 2V7UA 1K6MA 1JYSA 4QFDA 3E8XA 5EN4A 3H6KA 1XXHE 2SKEA 3IVRA 2F90A 2PWZA 1RQGA 3K5WA 1G60A 3E1GA 1EFPB 2D3WA 3N9IA 2GD2A 3MWEB 1UKAA 1FEZA 4UAUA 3UK7A 5EP1A 4BNYA 4X66B 1YJ8A 5AJUA 3VPHA 3G02A 2ZP1A 1IG0A 2JNWA 4PQRA 2VBFA 5K8UA 1AB5A 2EZTA 4I1RA 4BNFA 2IUFA 4BV8A 2KS6A 5AVTA 2AMLA 1OTHA 1OIWA 1PK7A 4TMZA 5EIHA 1RFGE 4RV4A 1SUBA 3TRIA 1DQZA 1U9YA 3QOXA 2I3GA 4IJMA 4G8CA 2NUAB 1EVLA 3BGDA 3EVZA 1G8PA 2C9MA 1K2VN 1WUTA 2WIDA 1Q50A 4WZAA 4PR3A 4EH1A 5LWQA 2HDWA 1X15A 2OY0A 4ACAA 2EIHA 4ZYVA 2DR0A 3K6JA 3KFLA 4KMSA 3DMTA 4UW9A 4MS3A 4KQHA 3ZQUA 2CB9A 2HT1A 2WBLC 5CFNA 1NY6A 5HCNA 1W88A 2CMDA 4X84A 2JGDB 2VPXA 5BSKA 5BWMA 3QKUA 3EPPA 4D3FA 4B8WA 1KFEB 1DV2A 3BULA 4Q3OA 4UNRA 2OHHA 3DDSA 1G8YA 1JIVA 4HBGA 3R8XA 1KF0A 2WYOA 4DBZA 5AIBA 3V4FA 2BMAA 3PE6A 4II7A 2IP1A 1VMIA 5KNBD 1NXVA 1K3TA 3ILXA 4J76A 3RC1A 1PE0A 2IU3A 1HG1A 1QIKA 3QUCA 1Y8CA 1LDEA 1ZRNA 4G81A 1EAYA 3NJRA 3DYVA 3JQ8B 3Q15C 4LA4A 5FL7A 2HLDD 4TLDA 3CLSD 2W6PA 4H08A 1HE2A 4X8LA 5DW3A 1DCTA 1J2YA 2BT4A 4FJ2A 4IJKA 4IVRA 2CMGA 4U7PB 5AJVB 1RYDA 1XMXA 3DO8A 3JARB 1Z73A 4O63O 5CYFA 4TSFA 3WDKA 5KUTA 1ESDA 3DZDA 2CEKA 3UKJA 3NFRA 4A7PA 3NOVA 1PQYA 3DE7X 3EGXB 3H5OA 1RKBA 3MFYA 2ZVJA 3FYCA 1AJEA 1OFUX 4LGMA 3ZHQA 1RWNA 2PO5A 2DQZA 1YDMA 3L06A 3HK2A 2GX6A 2MINA 1L6RA 2GXQA 1MAVA 2PAAA 4MS3B 4G5SA 4KXMA 2WV9A 3ZI4A 3IVMA 4I55B 1UOPA 1JEAA 4E4TA 3LMKA 5A03A 5JC8A 4OXIA 1DELA 1BNCA 3INNA 2I2XB 2SHKA 3NPAA 4ICIA 5E6RB 1AGYA 2OXRA 4UMVA 3K96A 1QE5A 5I8PA 1N9GA 1OXXK 2R79A 4D3YA 4J1TA 5AT1A 4GFDA 3T35A 1Y0BA 3AHCA 2FFJA 1Z0JA 2BI8A 2M32A 2C5HA 3L6UA 3DGFC 4GOMD 4MAMA 1DQRA 1LRJA 3PBKA 4I5IA 1EFLA 3WDMA 3WLOA 1JG1A 4IX1A 1RLJA 5A4MS 1IQ0A 1ZISA 1MO6A 4WLOA 4EF4A 721PA 1ZHOA 4OD0A 2P5YA 3D6UA 5T8KC 1NT2A 2XE8A 4L0CA 2IYNA 1IU9A 4Z0HO 2W6OA 3H5NA 3DAFA 2FMTA 3BE5A 3F6PA 3NB0A 1VMKA 2QZSA 5JNVA 1II8A 1MJFA 4HGPA 1JXAA 4DADA 1LNQA 4TV9A 3IESA 4KK4A 4E07A 3I0NA 5BUZA 2XCQA 1CQXA 1XKTA 2GPAA 5CW2A 1XXHB 4HXYA 4DRXB 4G36A 1HTTA 1QBGA 5KYWB 3H4VA 1C1HA 3L8HA 4FFBA 3C43A 4JR2A 4BTLA 1P1RA 5FV4A 1FU8A 3DLIA 3NKLA 4J7XA 3U60B 1A5AB 1XZQA 4IIXA 5ILOA 2Z6QA 3EC2A 2GBCA 3OSUA 1GCIA 1VJ1A 4J2HA 2VS1A 5EXEA 1B4DA 5HZGA 1HDYA 3ENVA 3PJDA 3ICCA 5H82A 2JH3A 1KJNA 2ZR7A 3GDOA 2E55A 2GFHA 1XR3A 3I2IA 5E4YA 1T1JA 3WBFA 5FEUA 2Z58A 1XAGA 3RRYA 1LJUA 2B9EA 1VE7A 4IIHA 4PYRA 2HCTA 4BP3A 5IAOA 1KTVA 3EGEA 1OXBB 2NUPB 1W2GA 3Q5GA 3ETJA 3AF3A 4Z51A 3TAUA 1T2CA 3QF4A 2AW3A 2HJWA 3TE7A 3A6JA 5EE5B 3CXRA 1XU9A 2QYOA 2IW1A 3B9PA 3DXXA 5DYIA 3AM1A 1G9XA 3A14A 5F5LA 5JD3A 3RO7A 5M5BA 1T9GS 2LCIA 2YVLA 1FTGA 4ZCRA 5BWOA 1DLIA 1KYQA 4IYJA 2Q4RA 1U02A 5HKBA 2CV0A 2CLIB 1DCFA 4ND2A 1Z5VA 2P90A 4QDZA 1I4TD 2BFDB 5FLXA 1H2RS 5FAKA 3H9QA 1LFDB 4LYDA 1HH4A 1RXWA 1PNVA 1RAGA 1YUNA 1ZXLA 1JG4A 2D2IA 1L8OA 1I9CA 2O50A 2YWFA 3ZDZB 5BWBA 4FMDF 4QASA 5IUNC 1AA9A 3CKYA 3ZVNA 1BH2A 1K88A 1SWWA 4IQ4A 4E1VA 3OT4A 3C3YA 3B1JA 3BWEA 4TTPA 2PXHA 4FYKA 4JC4A 1CYDA 3OEHD 2PT9A 1KEEB 3CKLA 2ACWA 4M1ZA 4M87A 4QARA 2ZUTA 3MYRA 2D6FA 1XU4A 1ZN8A 5LYJB 2QZZA 2FSPA 4KUHA 1J07A 1YQGA 1IK6A 1MB9A 2GBLC 1Y6ZA 1SZPA 2P9JA 2Q1XA 2QUHA 3F5FA 3OJ0A 1XZNA 2JFWA 1MO4A 2A6PA 2NUPA 5E7IA 1F2VA 2JIRA 3RIEA 4ZI3A 1JLLA 1XFDA 2YOGA 1X74A 2WJZB 2XUZA 2P8SA 1M10A 1X94A 1YJ5A 2ZS8A 2XMSA 3FPCA 5J2UF 1NVVR 2WKQA 1U2EA 1Y4ZA 1T2AA 1U0JA 2IOFK 5LIPA 4ALNA 2GN4A 1I7DA 1PT8A 1I1HA 2ZT7A 1RWVA 1JR3A 2AC7A 2E49A 3CSSA 3K72B 1EG2A 1U0NA 3L8FA 1NT4A 4PQYA 4WFQA 4PEVA 2W22A 4HUTA 2D4AA 1VE5A 1R4AA 3EEIA 5H5JA 2XCTB 4DV0B 4FOLA 1WKVA 4ZVMA 3GRVA 5ALXA 1LPMA 1R9JA 4DLSA 1NUTA 2VDMB 3EEFA 5GZ3A 3UJ7A 4X00A 5AXCA 4AF7A 4ZV4A 5JQGF 1CLEA 3FI0A 4WW0A 3T0IA 3ELDA 3EPRA 4BEVA 2DBZA 1QFMA 2QZ9A 3IHLA 3KJEA 3Q87B 5IBQA 5FBVB 2AMFA 1SO8A 2OT3B 2BZGA 1YRLA 3K9HA 4CIYA 3AFOA 3GD7A 4AO7A 3PIIA 4H2DA 1WV1A 4DL9A 1N8KA 1J23A 1E63A 5C32A 3AR2A 2X5NA 1OFHA 1NNI1 1NI4B 4UOQA 3W6NA 2EJUA 5F7OA 2WF6A 2DERA 4OP2A 5BVGB 4KXFB 4R9UC 4C9BA 5LYJF 1PYGA 3KQVA 1KDPA 2JZCA 2P7HA 2XPCA 3U49A 1SVKA 4IXNA 1JHAA 2KB0A 3BMNB 2R8BA 5AUQA 3PPVA 2VQDA 1UDXA 2BFCA 5FRDA 2RGNA 5JZOA 5F35A 1H3EA 3MIZA 3U7JA 2WFLB 1U2RA 4WKCA 2NZUG 1A5TA 5KX5A 2K2QB 2WPDD 3ZHBA 3IUSA 2A5YB 4PYNA 3W8FA 4WKOA 2WFAA 4UULA 2V6MA 4KXLA 1E61A 1NF3A 1WDWB 1YR8A 3EUEA 4FX5A 4R4JA 4RCZA 2BMEA 4V1CI 2DSTA 3RS0A 1NBEA 1N2IA 1S2IA 1K5PA 1Z2DA 2YV3A 3G0IA 3VU0A 1NXPA 4WHMA 4YJDA 5EESA 3NWOA 5H7XA 5TR9A 3R7FA 4BFUA 1AGRA 5DGHA 1U8YA 2NZWA 1KL7A 2ZT6A 3CXUA 2VEDA 3WADA 1W44A 2RKBA 4F4JA 4RV5A 1WXWA 3DBVO 821PA 4A82A 2WHPB 4E2FA 1O97C 4OLAA 2WU4A 3DULA 4RF3A 4INJA 3DMYA 4OHRA 1Q0RA 3TS1A 1N36B 3D2CA 1E2HA 1UMDB 4Z1MA 3UMCA 3WP0A 1W36D 5C7YA 3P9IA 5AVKA 4ZGWA 5C7LO 2IP4A 1VJGA 3A8TA 5JOQA 5G02A 4I9HA 5JDCC 4D8TA 1KYIA 3NETA 4IGFA 3KLBA 3KKZA 3VZRA 3V8MA 1AHNA 2HH9A 3BMQB 5JI3E 1C9YA 4ZYWA 2X8JA 2WM2A 4XSGA 3VXKA 5A0TA 3UAOA 1RQ7A 3FNRA 3LKBA 4MS4B 2WHYA 1QZUA 1Y7PA 3JAKA 1BEEA 3OZGA 1XOIA 2O19A 1C2TA 4RVSA 3ILYA