2ANBA

Crystal structure of oligomeric e.coli guanylate kinase in complex with gmp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
206
Chain Sequence
AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Guanylate kinase
publication title Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
pubmed doi rcsb
source organism Escherichia coli
total genus 65
structure length 206
sequence length 206
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2anbA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2anbA01
3H0KA 2VHJA 1MABA 2BOVA 2ZSAA 4A6PA 4KXFB 3LRPA 4GBMA 4KJZA 3QF4B 2CHVA 2RGEA 4YLGA 3SHFA 4MH0R 4Q9IA 4AURA 1U94A 3ZZTA 3GJ0A 3T12A 2WWGA 4EFLA 2P6RA 4Q03A 3U3OA 3GLGA 2JEOA 5E7IA 3O47A 2GF9A 3V00A 2ECKA 2ZS9A 3GD7A 3CM0A 5H68A 4A0RA 3TAHA 4EPRA 2AR7A 4LZZA 4MGYR 3ZIAA 5DIFA 3DDCA 2DHRA 3ZIAD 2JDIA 1G7TA 3IHWA 4M1YA 3QKUA 3M6AA 3TH5A 4W5WA 4FIDA 5L3RA 3ZJYA 1U81A 5HKKA 5KDLA 3PJRA 4Q1EA 3HYTA 1D5CA 5JFGA 4II7A 5HKKD 2AX4A 2CL6X 2C04A 4PXAA 3LW8A 4DCSA 1Z0AA 1XTRA 2GJ9A 3A36A 3M0EA 3A58B 1I4TD 3UMFA 3X1XA 4C7OB 2H16A 1P7CA 2QAJA 2QSZA 1UM8A 3MMPA 4PPGA 2QAGA 3MLEA 3BIFA 4CZ2A 5IF9A 3U60B 3V4FA 1AQYA 5G41A 1MRSA 1KK0A 4TLBA 2C5LA 1I4DD 2QL6A 1GM5A 2ORIA 3CRVA 3IBGA 3GJ5A 4TTPA 2O8FA 3QPVA 1EFHA 1X86B 4Q4HA 3KFVA 3NKVA 3PUWA 3REFA 1XD9A 1OXTA 1XCMA 2J1LA 3OAAD 3AGPA 2JJ2A 4LY6A 4D4LA 1PLJA 5A0FA 1E6CA 4KLZA 1HUQA 3MUFA 4L16A 5AUQA 1TF5A 1XU4A 4LPKA 5TB5A 1FZQA 3MFYA 4EPVA 2DFTA 4BZXA 4XWKA 3HPRA 2H7VA 4OI4A 3ZD7A 1YZQA 1P2VA 521PA 1P2SA 1ZNYA 2CCJA 4CDGA 4BECA 1Z0FA 2ZSBA 3LD9A 4BFSA 2BIFA 2CNWA 3MG9A 2CNWD 2GAAA 4QXAA 1NP6A 3MGCA 4DDVA 2QN6A 3DMDA 3AVXA 4KFRA 2XXAB 4D0GA 4KYUA 1Q1BA 6Q21A 3GLFB 2CVFA 2DB3A 2GBLC 1IM2A 4DLYA 1JQJC 2R2AA 4AI6A 4HAWA 5L3SA 2WJIA 3KUDA 1XPRA 3TMKA 2ZYUX 2FN4A 4Q9HA 2H18A 2WWXA 5DLQC 1VDZA 2QA5A 3B5JA 3T5DA 3EZ7A 1G3UA 1HE8B 4IKEA 1P4SA 1DG1G 3GJ4A 3V4RA 3LA6A 1AKEA 5JWHA 1U2RA 3IKJA 3FYHA 4PO8A 2PEYA 3LAWA 2JAQA 5SZKB 2ZJZA 4K8OA 2QNRA 5DN6A 2CE7A 3KKPA 4C0QC 2ZROA 2V6JA 4PTLA 4Z8XA 5DN6D 2CVHA 2FSHA 1T0HB 2AK3A 4ZKEA 4RFSA 1Q21A 5B58C 1J8MF 5EP2A 3LH5A 2XTMA 4LK2A 5B30A 3OF5A 2J7KA 4JBWA 4QG7A 4D4KA 2QQEA 1GTVA 2W2XA 1JR3E 3ZQJA 4RD0A 5L3VA 2FPLA 1W2GA 3LDAA 2KJQA 4GDFA 1DVRA 3A4NA 3X1DA 1K6MA 3WMEA 2F1IA 4B3FX 1IHUA 1W0JA 1AGPA 1Z2AA 4WXRA 4LWZA 3NBXX 4BLPA 2EQBA 1W0JD 1F2UB 2XZPA 4D4JA 2ZI3A 3I1FA 1KIMA 3BE4A 3O8DA 4FD2A 4DB4A 2ZS8A 1A82A 2QAGC 5D3QA 3CF6R 4GZMA 2GEVA 3ZZ0A 1Z06A 2XSZD 3GCGA 4LHWA 3TNFA 1KNQA 2FSFA 2BMEA 3A4MA 2GXSA 4MRVA 4YQFA 1KDRA 2OAP1 2J45A 1XMSA 4JLKA 4HDCA 4RKEA 1S3SA 1XTSA 1KO1A 3CZQA 2IW3A 2VHCA 3Q3JB 2K5UA 2J59A 4ITRC 3CRMA 1GVNB 1TQ2A 1QHSA 2JA1A 4ASUA 4C0LA 3QKRB 2WWHA 1WB9A 1A2KC 4O2LA 3UG7A 3R9WA 2QMEA 1XEXB 1P9NA 4IEIA 4ACBA 1IN4A 1QHYA 4BLQA 3NH9A 3KQHA 3R8CA 4CF7A 1Z08A 1II8A 1Q57A 3VR5A 3ZVLA 3C8UA 1VHTA 2GK6A 1AJEA 5AJVB 4JSTA 2J0UA 2WMNB 4MRSA 3RVBA 4ARZA 4A15A 5FR2A 2VHUA 1ZJ6A 4UXHA 1ZUNB 1F2TB 4GP6A 4DSUA 2AHOA 4OI0A 1XD2B 3PITA 4PAOA 4EJSA 1VCMA 4EAQA 1ELOA 4NCHA 5EUMA 3NBYC 3GFPA 1COWD 1N6PA 4BQSA 1XBTA 2XNSA 3DM5A 3GEIA 2R65A 3SC3A 3AKYA 5FUVA 3QPUA 1N6LA 2H17A 4TL6A 3K0AA 2CLDX 4ZO4A 1TAGA 4PANA 3K70D 4HZUA 3C7KA 4PO9A 3RS5A 1CP2A 2RMKA 2C78A 2ORVA 2VTKA 5C2JB 2N42A 2R6GA 3TRFA 1IQPA 1Z83A 2IS2A 4MRPA 4GNKA 3T1QA 1AGRA 1YR8A 3TR5A 3G82C 1ZP6A 3ZD6A 3LLUA 3QF7A 4DC9A 4LHVA 1H8ED 1RZ3A 3IQXA 4TSFA 2ZR7A 4MKFA 5K8TA 3SJZA 5LBIA 2Q0HA 4M1OA 4LYAA 4TSFD 3DKVA 2PLRA 2QTVB 2ZJYA 2GZHA 2G77B 3AP1A 1QHHA 3RS4A 5C18A 2WAXA 1YU9A 2GCNA 1NMXA 5CM9C 1R0XA 3OIVA 2HT6A 2A5FA 1L2TA 1YR6A 3VR1A 3OHMA 4N0EA 2WIBA 3IPYA 3K0EA 1VHLA 3C15C 4OHXA 1NN5A 5IDVA 5H8WA 3CWZA 2XGJA 1AKYA 4M2LA 3P4YA 2RB4A 1S8FA 2QY9A 3B1YA 4OQFA 2BMFA 1F6BA 3THXA 5JRZA 2AD1A 2JLWA 5DHAA 1HQYE 1IN5A 1R5OA 1ETUA 3KXKA 4CEIB 2JASA 3WHKA 5F9HA 2ZREA 4XOIA 3NHBA 3TR0A 1DO2A 4TZ6A 2X8AA 1VECA 1Q3HA 3VX4A 1CR1A 3DO6A 1GNPA 5F3WB 2VO1A 5CLQA 2F1HA 1Q1ZA 5KUTA 1R6BX 1S9DA 1KI8A 1NMZA 1G6HA 2Q9CA 3THWB 3TSWA 4TMZA 4JYCA 4NYMQ 1OKKA 1NSTA 4LCBA 2HT1A 2IS4A 1OKKD 3RRMA 2X19A 4NKRA 3AKEA 1FL9A 1XTIA 1XWIA 5L8VA 2A3RA 2C95A 3KQNA 2H92A 2VP0A 3GLGB 3SI7A 1KDPA 3EZFA 1OE0A 2HYDA 2VA8A 1M1YE 2J9RA 2O52A 3N2EA 3OFNA 1LV7A 5EXXA 5BN4A 4HAYA 1LW7A 1U0JA 3OFND 3BXZA 1R5BA 5CIWA 5AJWA 3UIEA 4QJ3A 2DFLA 4FCVA 4KLNA 3VR6A 4M9SA 3SE0A 3SJBA 3IUYA 4DEXA 5B64A 5KSPA 3LV8A 3RRNA 3U7HB 4QM6A 2GZAA 1WXQA 1KO4A 3ONWA 2AK2A 2VBCA 1DAGA 1KI4A 3JZAA 4JJZA 1WDTA 1GKUB 4Q7KA 4GOKA 5KNBA 4OHZA 4DSOA 3CR8A 4A1FA 2HF8A 2J7PA 4WOPA 3QENA 2LCFA 3LY5A 4OQLA 4LC1A 2PL3A 1RRCA 5SZJA 3AVVA 1GL9B 2GRJA 2QAGB 2OESA 3W5IA 1IN7A 4Q21A 4F38A 2G1KA 3FWYA 2ZRCA 1P2TA 4U00A 4Y0AA 4MDFA 3D6TB 2RHDA 4YC7A 5FPHA 2ZANA 2O8FB 2QM7A 4Q4HB 3EA5A 2JJ1A 3EX7C 3C41J 2D06A 1FP6A 2GKSA 2ZRPA 4TMKA 2BVNA 1OYYA 2JJ1D 4HB2A 3VR4A 2FF7A 1FMLA 2WOOA 1Z6AA 3KDSE 5J47A 2O8BA 4DHEA 3EPHA 3UMRA 2OM2A 2VRWA 5FBQB 5GVRA 3W8NA 1UAAA 3AF1A 2ORWA 1IOZA 1AS2A 1T3HA 4UNSA 3AV0B 4BLOA 1KHTA 1KK3A 1UF9A 5J4VA 5DGXA 4HLDA 1JPNA 3KQUA 4F7WA 1JAIA 4KFUA 1XEWX 4AC9A 3CW2A 4IDPA 4NU0A 3SJAA 1ANKA 3CPEA 4HZIA 4RY2A 3PXGA 1QVRA 1N5JA 1ESNA 2EFDB 1KMQA 4RZ3A 1U90A 1PVOA 4QGHA 4NMMA 4CW7A 2GCPA 2WBLC 2PT5A 2XX3A 5FUWA 4L15A 2G9NA 1D9XA 1QHXA 1OH8A 1AS3A 5C4MA 3CBQA 4C2TA 1IONA 1GL6A 1NG1A 4FMBB 2FX3A 3FMPB 1J7KA 2O0JA 3UWKA 5L3SB 3K9HA 1UJ2A 4JLBA 2H8KA 3E70C 4LHZA 5JWOA 5M04A 1TTTA 3Q72A 4PAQA 4WBSA 4G5GA 3TW8B 1E0SA 3EZ6A 1NN0A 1E2LA 2Z5FA 3MWLA 4Q1CA 3X1ZA 1D6JA 3RS7A 3FOZA 2WAYA 1Q12A 5JBQA 4NYMR 4IDHA 3VHXA 1RFLA 1KOFA 3B6EA 2GETA 3K9GA 5FBLB 3T1VA 2QORA 4Q19A 4N1AA 2ZI5A 3S1AA 4LRWA 1TU3A 1G19A 1ZRHA 4UKDA 4XD7A 3W8RA 2IUSA 1E9RA 4GOJA 4D80A 3TSOA 4URXR 1OB5A 3B9PA 5EQTA 1KAGA 1BMFD 3P26A 1GSIA 1G9XA 1IAQA 2YHSA 3CRW1 3GLHE 4RFSB 4WZ6A 2AL7A 4BFTA 2Y8EA 2VHQA 3TVTA 2IUUA 2KBFA 3T1OA 3RWOA 4JVNA 2HUPA 4Q1BA 1A4RA 3FKSD 4HAZA 2B7BA 2NGRA 4JZKA 4A8JA 2RGGA 4B3DA 3LQQA 3UANA 5C4GB 2F3TA 2QP4A 3Q5DA 3N5CA 1ZINA 3AF2A 1OXVA 4XVUA 4DLZA 2ZM5A 4BFXA 4M1TA 4Q4AA 4EUNA 1NBMD 1G8YA 1N5KA 1R2QA 3OEHA 821PA 5EE9A 4DRZA 4QJ5A 3CF0A 3VAAA 5J4LA 4LYJA 3VR2A 2OXRA 3OEHD 3EC2A 1S0UA 1E9BA 3EWSA 2ZAMA 2PJRA 5FFMA 1LF0A 1JNYA 3UXMA 1Q1QA 4Q9KA 4YDHB 4M9QA 2IF0A 4IVRA 3V9PA 1Q22A 1OJLA 1NKSA 4D0LB 3H84A 4IW3B 1KI9A 2V7QA 2EFCB 2FNAA 1R5NA 1U9IA 5FPSA 2YWGA 3MWKA 4ACAA 3U2QA 2I1QA 2GAOA 1U8AA 4GPTA 4M8NE 4ZCMA 1EX7A 3IILA 3MJHA 3QI2A 1W0KD 5AK0A 5DNYB 4DT1A 3RSOA 2EYUA 2XB4A 3FHTA 2BKEA 4I1SA 4B48A 1E2MA 4PHTA 4XJXA 5FL3A 2Q9AA 3IO3A 3C4JA 2C96A 4JIMA 5JS7A 2WV9A 1CRPA 2BBWA 2QMHA 3B2EA 4KAXA 5FOUA 5JHHB 4Q66C 2ERXA 1YZLA 3I3SR 1Z6XA 5JCZA 5KPDA 1IXSB 3QNUA 3W6NA 3I5YA 1II8B 2H5EA 5CM8B 3FVQA 3ZH9B 3BB1A 4HAVA 1TUEA 2J0UB 4ARZB 4V0ME 2XEXA 3QSYA 3GJXC 3WYGA 4ZV4A 4ILEA 4GL2A 2P0EA 1V43A 1P9WA 2ZRDA 1FOEB 1E2NA 1G4UR 5HTKA 2F55A 4Q7LA 1DAFA 4MDEA 4EJSB 1P9RA 1KNXA 4B43A 3UPUA 3PUYA 3U44A 3PR1A 4Q00A 2AFHE 4KCGA 5TXGA 2XB2A 1LS6A 2DWQA 3FHCB 5HE8A 3KZ1E 1Z2CA 4ZCLA 3K70B 1VG9B 5J4YA 2ZI6A 3BD9A 5BYKA 1E0JA 4IDOA 1X3SA 4HZUB 2DPXA 3F3YA 3WP1B 4URVR 3QG5A 1XMJA 2FZLA 3F8TA 3U3KA 1KKMA 2WVJA 3THOA 5GJVC 3U3JA 3B9QA 1NVVR 1TEXA 5JEEA 4F92B 1UKEA 4CGZA 3MWJA 4H1VA 2DCUA 1BO6A 1DBSA 4JLAA 5HZHA 3DKPA 3IEUA 2EWWA 2KI5A 2R6CA 2FE4A 1YHNA 1E2GA 2OBLA 4M22A 1U8YA 5KDOA 5P21A 3DL0A 3TUZC 1QHHB 4XTRA 4DB2A 3KTAA 2ZYTX 2WJGA 3B85A 2W6IA 3CZPA 1SVSA 1GITA 3JZMA 5KHOC 1EFCA 2OFXA 3AUXA 1G5RA 2QSYA 3CO5A 3L0PA 3T35A 3VU9A 1VKJA 4DUGA 4C30A 3SQXA 4ON9A 4QGFA 4D6PA 4DUGD 3NC0C 1Z5ZA 2J0QA 3KX2A 3IGFA 1R10A 3LVRE 4KVGA 3THXB 4LBYA 2VP6A 4PC2A 3A1SA 1HYQA 2A78A 2FPMA 1KYIA 1ZNWA 2OFWA 2ZJAA 1E99A 1W36D 1T4GA 4UXIA 3TGPA 3EW9A 3EC1A 3RDPA 4QRHA 2F43A 3FMFA 2Q3MA 2RAPA 4PPNA 4A0FA 4B3XA 4G1UC 4B35A 1D9ZA 2ATVA 3DOEA 4B76A 2GJAA 1XJCA 1NY5A 1YZTA 4KV9A 4YMVA 3DMNA 2R6AA 3I73A 2HXYA 1GFIA 2HF9A 4R2HA 4OK5A 5E7JA 4DSNA 2NPFA 2VP9A 3NWJA 1F5NA 1OFUX 4CEHA 2WJJA 1PUJA 4CT4B 1GIAA 1H8HA 2NO0A 2WJYA 5EXTA 2BJWA 1H8HD 5DI9A 1CULC 4R71A 4URWR 4AK9A 3R9IA 4DLXA 3CRRA 5FOSA 1W44A 1E4VA 2HJGA 1ZVQA 2JDID 2OCYC 3QOFA 1SHZA 1KMHA 2YWFA 3KXLA 4FI3C 5FTKA 1FQKA 2IYVA 2Z83A 2P6NA 2ZR9A 3H2YA 4NPHA 4H1UA 5AWFC 4HDOB 1GOTA 4IDQA 2FFAA 4TMWA 1OSNA 1S1CA 1KI7A 1TMKA 2EFGA 5E4FA 2N1BA 3CF2A 4IVQA 2OXCA 4UNPA 5LB2A 4F93B 1U8ZA 3HU3A 2AFIE 2WHXA 4I81A 2OLKA 1HH4A 4Z54A 3K09C 3IQWA 2OCAA 3PENA 3W5JA 4C2UA 1DARA 5CB6A 1C9KA 5UKDA 3IHLA 4P4UA 1NJGA 4B2LA 1QBKC 4KFSA 1II9A 3P32A 3I4LA 5HPYB 1QRAA 1ZW6A 2A2ZA 1NI3A 2OV2A 2ZRGA 1UKZA 1BYIA 4ESVA 1VG8A 2G88A 2NTYC 4WAUA 3CUEF 3KXIA 4ZIRA 4OK6A 2JJ2D 2C98A 2IYYA 1KY3A 4QNMA 3QVUA 4UNNA 3VQTA 5JI2E 1NSFA 2ZSEA 5A4JA 4Q4LA 2YZ2A 4UJ3A 3W34A 3QUSA 1VPLA 1N6NA 4B34A 2REOA 5EXSA 1SVWA 1XZPA 4HLUC 1GRNA 1NJFA 5EXPA 4DSTA 3QG1A 2P5TB 3W6PA 4YMTA 1ZIPA 2YV5A 1GNRA 5C46F 1KSHA 4Q18A 1I2DA 4I1VA 5FBVB 5TARA 5J4HA 2KWIA 1T3LA 5AJXA 1I4LD 4XWOA 1WBBA 5EP4A 1G41A 2EVWX 2VSFA 1Z0DA 1RE0A 1S2MA 2RGNC 5CYPA 1XXHB 3H1TA 5G53C 1Z3IX 1W36C 3ND8A 2A5JA 4DCUA 5LPNA 3SU8A 1RW4A 4KITB 1H65A 1E2IA 3QXSA 5CJ2A 5B2ZA 3B1VA 1GWNA 2C03A 4OQNA 1KI1A 1JAHA 2IX3A 3ETLA 4PR0A 5AR1A 1YJ5A 3OIYA 4ZDWA 4JJKA 4M1WA 3PFIA 1QG2A 1NL3A 2UZ3A 1CJKC 1M2OB 2V6IA 1SKYB 1G3MA 2F1RA 5B57C 4A2QA 3B1ZA 4BE7B 4X8MA 5JEDA 4D2IA 4HEJA 2V55B 1JPJA 3SBDA 1K5DA 1DAKA 2IHBA 5D3MB 4AKEA 3S1AB 3EPLA 2AXNA 1E3MA 1CJVC 4QC2A 2DFKB 1UDXA 2PH1A 4RZUA 3TVDA 4MYHA 2OSBA 4PPQA 4URUR 2G1JA 2CCGA 1F3OA 1KI6A 2NIPA 4P4SA 4PX9A 3U7EB 2GXAA 3M4YA 1AIPA 1Z0JA 3NC1C 2VP4A 4JLNA 5KNDA 1OIVA 2ZR0A 3U6BA 3J81k 3Q7QA 1CEEA 4OQXA 3RRYA 1K8RA 2HYIC 4PZLA 2MSDB 4A8JB 3KKOA 2L0XA 5IRCD 1T0JB 4AWXA 2YOFA 4F4IA 4HB3A 4C0AC 2HXSA 1L8QA 1Z28A 2V54A 2IEYA 3FTQA 4LUCA 3LNCA 2RKOA 3IO5A 1QZXA 4BLSA 3BH0A 1TL7C 3BWDD 4Q4AB 4QHTA 2D2EA 2VF7A 3ECCA 1SGWA 1SXJA 2DWPA 5ANRB 1JXOA 2J0SA 4QGGA 1XD8A 2LWIA 1RIFA 1E1RA 2Q9BA 1ZU5A 1LVGA 2FZ4A 1SXJD 2VEDA 2XITA 2ZRKA 4IJMA 2HDNB 2CLSA 3HP1A 2QENA 1WBDA 3LQRA 4IOJA 4L8GA 4JL5A 3IBYA 1IJFA 3T5GA 2OT3B 4NCKA 1NLYA 4LDJA 1X8JA 1GP2A 3DHWC 3KJGA 3VNUA 2QTFA 1W46A 4PC7A 3AVTA 4OHVA 1KO7A 2YWEA 2QPTA 3RLFA 4TQUS 1JEDA 3ASYA 3K8YA 4HUTA 1P5ZB 4JVSB 2R6FA 1KZGB 5GJWC 3E1SA 4B32A 4ASUD 5AUOB 3NDPA 3ADDA 4LPSA 4DT1B 4MKHA 4Q9JA 1JB1A 2VP5A 1X6VA 2Z6VA 5CDFA 4BZPA 3PEVA 4A0HA 1OHHA 1MV5A 4JLDA 1Z8FA 3O8RA 4MA4A 1XEWY 2J3EA 3O8BA 1M8PA 2WKQA 1FX0A 2FPKA 5J5CA 2FFBA 3CLVA 3GLIA 4B3GA 2IUTA 1JECA 2R8RA 4GMXA 1KDTA 3IPXA 4HB4A 4DCNA 2YC4C 3SOPA 1S9HA 4LV6A 1KK2A 2H1LA 2WICA 3TQFA 5DISB 4EKDA 5DYIA 1Q0UA 1TEVA 2IBMA 3B60A 3PUXA 4LJAA 1DE0A 2ZUBA 1JI0A 3KUCA 3U44B 4Q9LA 2GA8A 1YR9A 3OEEA 4MGZR 4LSGA 5FL7A 1N6KA 3OEED 1G20E 5FL7D 5E3HA 3L82B 3DVLA 3N70A 4MITA 4YDSA 2XOKA 3W3AA 2BMJA 3W3ZB 1G7CA 3L43A 1LF5A 1CJMA 1XB2A 2XOKD 4A0GA 4TMXA 4B75A 4NL4H 4W5JA 4DIDA 1Q44A 3EARA 3ZYCA 2WSSA 1XPUA 2PEZA 1S1MA 2F6RA 3K0SA 3U4QA 3TUIC 4Q4JA 2PZGA 2WSSD 5EZ5A 1HE1C 4D4MA 4FINA 1KKLA 2C9OA 1E9FA 1SHKA 1OIXA 3L8ZA 1II0A 1XZQA 1DS6A 1X1RA 4IEEA 2ZU6A 1KTVA 1T8TA 1NF3A 1G18A 4JKIA 4E22A 4UJ5A 1WRBA 5FI1B 4Q47A 1TADA 3NHAA 4RSGA 2NG1A 3IIKA 3BC1A 4TL8A 5CLLA 3SYKA 3UKDA 3FGNA 1GRQA 4C3ZA 3VU9B 2X77A 1ZM3A 3GEEA 4QOSA 4JYBA 1OFHA 1Z0KA 4FCTA 4UXJA 3QBVA 2W6JA 3CX6A 1NNEA 2W6JD 4G5OA 2XTZA 1R0ZA 2AWOA 3L0IB 1UBGA 4TLCA 4XSGA 2FGJA 1W36B 1G3RA 1G6OA 4KHZA 4G5QA 2BEJA 1RPZA 1SXJC 2LKDA 4EQ6A 4KBGA 4MYCA 3MCAA 3F5FA 2RGXA 1Z6TA 3VHLB 1MABB 2IYZA 2ZRLA 3CX8A 3TKLA 5KDDA 1G291 4JLVA 3H4MA 3BFXA 3KB1A 1UBFA 2G3YA 4Q1FA 5BW8A 1FUUA 4XH9B 4FN5A 4C0BA 1NY6A 4EFNA 3QKTA 2YKGA 5K8UA 3P20A 2BM1A 4CEHB 1AQUA 5JZVA 2D7CA 2R44A 4V0MA 1X1SA 3FHOA 2YOGA 3GFOA 4IXMA 4WZAE 3R7WA 4C9BA 4ZI2A 4XWAA 1SZPA 2QE7A 2PMDA 5FUYA 1OIWA 2AWNA 3B13B 3BORA 5JWRA 2V1UA 4WVFA 4BEBA 1CRQA 2CLCX 3TIFA 4PQYA 3SFVA 4QHYA 5FTLA 4NONA 1ZNXA 4EJSC 2JLRA 4TT3A 2BBOA 2NOAA 2BC9A 2J0VA 2J7PD 4V0LA 1BH2A 1E2KA 2BMDA 2RCNA 4LYFA 4TLAA 8OHMA 3UATA 5FBRB 1VTKA 1KAOA 3K70C 2QPOA 1AN0A 1JQLB 4FWTA 1DELA 2B8TA 2IS6A 2CK3A 1R0WA 2VP2A 2VLIA 4TYWA 2CK3D 3OE7A 4MKIA 3KQLA 4NYJR 2Q6TA 1SULA 4BZQA 2FFHA 3OE7D 3PEYA 5AJYA 5KYKA 3QJYA 4FXPA 2G83A 5FPKA 1SVOA 4RCZA 4Q01A 3WRYC 4QBHA 3VKGA 4S35A 1DEKA 5FH9A 1GRRA 5JJLA 4QKQA 1NVWQ 1RYHA 421PA 3RC8A 1EG7A 1AZSC 4ZIRB 3LX8A 5JMTA 3ZVNA 1EFTA 1RC8A 3EZ2A 3KKQA 4AYXA 4R9UC 2IEZA 3LVQE 4IXNA 4B2IA 1R8SA 3I8SA 5TV2A 2QGZA 1T5LA 1GKIA 3ADBA 4D81A 2IWRA 1BS1A 5KNCA 1P6XA 4PHFA 1W4RA 1SVIA 5IHPA 1ODFA 3RSLA 1E4YA 1E9AA 1IBRA 5KTYA 4A9AA 1G3QA 2IYSA 3K0CA 1OPXA 1FP7A 4UNQA 4Z1MA 3AGQA 2JLQA 3AQ4A 3BH6A 1WCV1 4Z1MD 3RAPR 2W83A 2ZEJA 2MSEB 1HEIA 2BJVA 2HLDA 2OG2A 1KO8A 4LOAA 1A1VA 1M74A 3AVQA 4FMCF 2HLDD 1CF4A 1YE8A 2C9CA 2OCBA 1L4YA 3UMSA 2JLZA 2YVUA 1WMSA 3C5HA 4P33A 5IK2A 2BBSA 2OBMA 3QEOA 2A9KA 2W0SA 1E2FA 1IY1A 1E2HA 2WZQA 5FI0B 5FOWA 3ZLJA 4GZLA 3NEYA 1XMVA 2VYFA 2G6BA 2DBYA 1N6HA 1NVVQ 5FPYA 2GF0A 1V5WA 4PC1A 2QRZA 2RHMA 1SKQA 3HR8A 1IXRC 4K81B 1GAJA 1ZUHA 3F0TA 1NIJA 1M7HA 2BWJA 1CKEA 2A5YB 2FV8A 1MOZA 5G3YA 2FWRA 2GXUA 4TN1A 3NBZC 4GFDA 3BERA 2MMCA 2O0KA 2ZSDA 2QMUA 4DEYA 3NVAA 4XD7D 4PSKA 4JS0A 1OB2A 4PZYA 4TLDA 1U0HC 1PLLA 3QXHA 4XVRA 1J8YF 2YC2C 4DLTA 2O0HA 4HLCA 1OV4A 2CCKA 1FTSA 3C14C 1YVDA 4JBXA 2WM9B 4G3XA 2YNMA 2BCJQ 3ZGXA 1KI6B 3AKCA 4P4SB 4BFZA 4KU4A 4ZDJA 2PCJA 3JVUA 1RJ9A 1AM4D 1FUKA 4WXPA 1WP9A 4FMCB 4D82A 3SNHA 4US0R 5EJEA 2Q3FA 4US2R 3LW7A 2JLVA 3PEUA 2Q3HA 1SVMA 2QG6A 2C77A 2F9MA 2B92A 3WY9A 1ZUIA 4US1R 4CEJA 1G16A 3BRWD 5DI3A 2FU5C 1BIFA 2Q21A 2WWYA 4LYHA 4MKGA 1DG3A 1P72A 4LC0A 5FR1A 2OUKA 5EZ6B 1UFQA 1SXJB 3GFTA 4TQ9A 3LXXA 4BRUA 3GEHA 1DAHA 4M0LA 3VKWA 3AP3A 2XZOA 1G1MA 3U5ZB 2W2TA 4O25A 4MYUA 1N6RA 2HV8A 4DLWA 2B7CA 4EPWA 3FE2A 3K9LA 2V7QD 1E9CA 4JSYA 3SHWA 4LI0A 3HPQA 3SDZA 2PT7A 1E69A 3B8HA 3OZXA 4TTQA 4RCYA 4V02A 1S4QA 1A5TA 4ZI3A 1QDEA 2CXXA 1GUAA 3SYLA 3VNVA 1YRBA 2OHFA 1VIAA 4LBVA 5FOVA 4RD3A 3REGA 2ZITA 4XVQA 2HEIA 2WJHA 4BUJA 5KOYA 4DDWA 3WYAA 1RRGA 4HB0A 1ZM4A 2GJSA 1CR4A 3A1UA 1EK0A 2P2LA 2ONJA 2IYRA 3TSZA 1UDWA 2EW1A 3Q85A 2FH5B 1FX0B 1YZNA 1T8UA 1YZUA 1VMAA 4B2PA 1N5LA 3GLIB 4M21A 4Q02A 5L3QA 3SQWA 1CR0A 4NCIA 2IYWA 3NH6A 1TQ4A 2WMOB 4RKFA 1E79A 1CJTC 4V03A 1N0UA 3RANA 3KJIA 1E79D 2JIZA 3K0AB 4LJ9A 1XD2A 2X1VA 4KSBA 5JLJA 3TQCA 4RD1A 4MGKR 3ND9A 4BWYA 2XJ4A 3GQBA 2J41A 2YYZA 4TTRA 3DZ8A 5KSYA 4C0JA 2ZJ5A 5C1BA 1EFUA 1MH1A 1WF3A 1JR3A 3FKQA 5DE3A 1NMYA 1ZD8A 3C5CA 1MO5A 2GTPA 1JR3D 1E0AA 3PV0A 2ONKA 2A5DA 1G5TA 1VYUA 3WNBA 1NN1A 3ICEA 2ZRHA 3CB4A 4JMPA 4TWZA 2ZETA 3T06B 1CIPA 3U4QB 2J87A 4Q4JB 3HU1A 5FPTA 3SJCA 2ZVQX 2B21A 2IXFA 2J46A 3EWAA 4LJ6A 1PLKA 3GJ3A 2EWVA 2OEPA 2QZ4A 1JJVA 3WMGA 1XF9A 4M9XA 2W6ID 3PEWA 5HE9A 1HA3A 4B6EA 1IY0A 2BDTA 3U6KA 2NQ2C 1IXZA 4A8JC 3AF0A 2NMVA 2IYUA 1GNQA 1Z07A 1ZNZA 2GNOA 2ZYWX 3LLMA 3TLXA 3G5UA 4NYIQ 3RC3A 1C1YA 2P6UA 1E2EA 3B78A 1P61B 1ZCAA 3BAFA 3KJHA 3TJZA 3TE6A 5J4KA 2QBYA 2KB0A 5CK5A 4CYMA 3ADCA 4X8LA 4PC3A 2B8WA 1JJ7A 3WNCA 3L0OA 4MUAA 3U61B 4LJ7A 4IOKA 2ZRMA 1VCIA 4PHGA 3QXXA 2ATXA 1P3JA 1E2QA 3HJNA 2DWOA 4C0SA 1ZC4A 4EQ6B 4Q1AA 4B6FA 2E87A 2GBLA 2BHRA 5KSZA 2PCLA 2CL0X 3WBKA 1HURA 4M1KA 1U9IC 4NE2A 2IT1A 2JCSA 1A7JA 4X8OA 4YMUA 3GLFE 1UKVY 4AKIA 3THWA 4JLJA 4KODA 2PZFA 1TF7A 2GZDA 2IC5A 1XXHE 3CNOA 3WXMA 3L2OB 3AP2A 1MO4A 3VTKA 1ZD1A 3R8FA 1O87A 3AF4A 5HZKA 3BB3A 2BV3A 4J0QA 1XDBA 3A6PC 2EYQA 1TX4B 4M1SA 3QY0A 4BEJA 2UZIR 3R7WB 5F9FA 3AEZA 1ZIOA 1VCOA 1ZM7A 5JECA 1EX6A 5EE0A 2FA9A 2X2FA 2NO9A 1J90A 221PA 1F60A 2FJUA 1SKYE 3RYTC 4IOLA 2BBTA 1S3GA 5KPJA 2QQ0A 4PQFA 1JEEA 1HV8A 4RFVA 4WZBE 1KI3A 3W6OA 1PJRA 4LJ8A 3K0FA 4MUBA 5F98A 3ZS9A 4F4CA 4P0TA 1XP8A 2F7SA 1XCGB 4XSHA 1KJWA 5DH9A 2O8CA 2KE5A 3OESA 4QGAA 1YZKA 4A2PA 3QE0A 4O2RA 3MWYW 3H86A 2DY1A 5JSZA 5CB8A 3L8YA 3D3QA 4QM7A 1AS0A 1EGAA 1ESMA 1P75A 3FDIA 1DAMA 1E98A 2W00A 3BFVA 3I32A 4QBFA 3U3RA 5LDDC 1ZCBA 1LS1A 1KJYA 4UQOA 1DO0A 4A2WA 1UPTA 2ZIAA 1KJZA 1U0LA 4NH0A 4YMWA 2I4IA 2BM0A 2JLUA 1P62B 2MSCB 2CMKA 2UVQA 4ZPXA 1XJQA 3RHFA 2LKCA 2EU8A 2O8BB 2P3SA 4TLEA 2G0NA 4GT1A 1NBME 2ZJ8A 2Z4SA 3OAAA 1UBEA 1ZD9A 5FUXA 2REXB 2ODBA 3IDQA 4Y0VA 1DTSA 4OYHA 3U3MA 3I62A 3SBEA 3LXRA 3QXJA 3PQCA 2WJVA 1HT1E 1PZNA 1RKBA 2ZE8A 2ZJ2A 3MJRA 4LGMA 3A1VA 4P32A 1XEFA 2DR3A 3AVUA 1GKYA 3EG5A 2V1XA 5K8LA 2JLXA 5FTNA 4S2EA 4B74A 4P31A 4QBGB 5E7MA 1AA9A 121PA 2AN9A 2IYQA 2RGAA 4DDTA 5GADl 1OFIA 4NYIR 2FG5A 1QHGA 1YQTA 2E9SA 4LV5B 1R4AA 4QFMA 3A8TA 3RS0A 1JALA 3ZDQA 1RYFA 1VG0B 2KBEA 3PUVA 2P67A 4JLOA 2F3RA 1ZM9A 2VPPA 3QXCA 3B82A 5CJPA 4RD6A 2ZXUA 3A1TA 1W2HA 2PMKA 4G01B 4PPFA 4JL6A 4LHYA 4OI1A 3E5HA 2RGCA 1EWRA 1EXMA 3B1XA 1X8KA 1N0WA 4TMVA 5SZIA 1G7RA 5HCIA 1ZU4A 1CR2A 1NVXQ 2HCJB 2ZE6A 2ZPTX 5TDHA 2QT1A 4A82A 1N6OA 3O8CA 1OXXK 4KVAA 2WKRA 4CRWB 2MMGA 5BN3A 2GHIA 4A6XA 1E9DA 3HYRA 1G8HA 4DCVA 1CJUC 5BWMA 3GPLA 1FNNA 4B71A 4FW9A 4URZR 1MO3A 4OI2A 4MRNA 1T9HA 3ZVRA 2Z0MA 4B33A 1G5PA 1QHNA 3QVVA 4MYTA 4QJ4A 3L0SA 2VF8A 5JS8A 3QPWA 2CEAA 2PBRA 3SS8A 3EIQA 1FQJA 5LD2B 2XTNA 3QKSA 1YKSA 5TVKA 1OT3A 1E94E 1Y63A 3K53A 5JHGB 2C8VA 2JATA 3TUJC 3NBFA 3FFBA 2DFNA 4AKHA 5HR5A 1P73A 1FTNA 3VR3A 1P2UA 2D3WA 3KB2A 2FOLA 4R2IA 5EE1A 1QG4A 3DZDA 3N2IA 3RS3A 4AG5A 4NCNA 1CS4C 1RJ9B 2OAQ1 2C2HA 2OLJA 2R6DA 4X8HA 1B0UA 3P4XA 1DAIA 4B3CA 3I92A 3NG1A 3I8XA 1WA5A 1Z47A 4DLRA 1FW6A 4LJYA 1HQCA 3BJIC 3BS4A 2C9YA 4OKSA 2GXQA 2ZRJA 2NZJA 4P4TA 3KKMA 3NXSA 2D62A 4CEJB 1KSGA 5DI3B 4U02A 5BN5A 1D2NA 1E1RD 2WKPA 2D2FA 2QM8A 1OH7A 5LB4A 4OHYA 5JCPA 2I3BA 1P60A 1WE2A 1ZC3A 4RJLA 5GJCA 3K9NA 1KO5A 2CJWA 4JBYA 4DWJA 4ESHA 4GI7A 1S96A 1TUIA 2ZTSA 5TMPA 4O3MA 2XSZA 4NCJA 2VH5R 3NIBA 3HU2A 3LBIA 1T91A 1TPZA 3R20A 2NZ8A 3CPJB 4DBLC 4PQRA 2GDJA 2CHGA 1UEIA 4MGIR 5F2EA 4EPXA 2QMOA 3BOSA 4DDUA 3FB4A 1XJ0A 2A5GA 1Q3TA 1VYTA 4DXAA 4HSEA 3U7GA 5K8IA 1M34E 3QIAA 4HUQA 3QEJA 4PO1A 4TMTA 1NIPA 3AVWA 1HY3A 4HYYA 4TQAA 4B3BA 4ZDKA 5JRJA 3T34A 1OHHD 1TQ6A 1HTWA 4LX0A 1W5SA 4RD2A 2VL7A 3PCRB 2GCOA 4RVCA 1MRNA 1R0YA 3LFUA 5DO9A 4JVLA 4BFWA 5G3ZA 1R8QA 1FMJA 5FTJA 3ADKA 1E2PA 4M1MA 2JGNA 3P1JA 4V0KA 2W58A 5L3QB 4C0HA 3GLGE 1IY2A 1CLUA 4BFYA 621PA 2IK8A 1G3IA 4IDNA 5SZHB 3A1WA 4JT4A 4I99A 4NYJQ 2IYTA 3QQ5A 4QNRA 721PA 5KSOA 4W9MC 3AUYA 3LX5A 4WW0A 4TYPA 1FPMA 4KSCA 1COWA 1DAEA 1GDDA 2WSMA 4GMDA 3E2IA 1LFDB 3GLHA 4KI0A 3GJ6A 2BKUA 1OH5A 1Z0IA 2AKAB 3VKHA 4BFUA 2VSOA 2PX3A 2ZAOA 4Q7MB 3AM1A 2IWHA 1G4AE 2FMXA 2ANBA 4PC6A 4BLRA 2W2VA 2G0TA 2IA5A 5AUNB 3IIMA 1NVUQ 1NG9A 2VSXA 1Q20A 5A5GA 2FEOA 2H57A 3BFKA 1E0KA 1XX6A 3EIEA 1OH6A 4B73A 1H8EA 2ODEA 3RRZA 1T3SA 2IYXA 1N2CE 4E5UA 4JVMA 1US8A 3KJEA 3WHLA 4D26A 2O8EA 1QVAA 2ZRNA 2Z4RA 3WP0A 3KTAB 4DIEA 2R62A 5CIQA 2FDCA 4MQBA 4FMDF 4O0MA 1XCPA 3X1WA 2N46A 3D8BA 1JR6A 1XRJA 4F4JA 2NO1A 4NZYA 3QBTA 2V3CC 1CU1A 5FOTA 4AY2A 1OF1A 2NPIA 3C16C 3THYA 1K5GA 2RGBA 4AKGA 1XFAA 4DVGA 4YXWA 5TY0A 1N3BA 2XNDA 1MO6A 3EZ9A 4YXWD 3SEAA 4AIIA 2XNDD 5H1YA 2QBYB 3TAUA 1CXZA 1W4CA 4Q5IA 2O8DA 2IS1A 1VIYA 2IXEA 4CVNA 2ZI9A 2CL7X 4BPBA 3R9XA 4L9WA 3CR7A 4FWIB 3OIUA 4OQMA 3VFDA 3KKNA 2F43B 2B6HA 4BRWA 3RWMB 3PVSA 4F91B 2ODWA 2V8OA 4ERNA 1W48A 2OE2A 2YWHA 5BYJA 1YR7A 2Z43A 4CT5A 1OW3B 3TW4A 1RRFA 4PAMA 2WWIA 1OLOA 4HDQB 3BH7A 3FMOB 1NN3A 1M6NA 4FCWA 1N0VC 1C4OA 1MKYA 2X2EA 3QF4A 2NO7A 2IL1A 3WNDA 4UNRA 3IEVA 5H70A 5FBWB 3T15A 1OFTA 4HAXA 1LNZA 3RABA 4KFTA 1QHIA 2CDNA 2UKDA 1LB1B 2IXGA 1SVKA 4BFVA 4EIWA 4FMDB 4XTCS 5BQ5A 3U7FB 1EESA 1JBKA 2GVDC 4U7DA 4C0KA 5GVSA 1XMIA 1KMHB 2BCGY 4Q7JB 2VHTA 2QE7D 1X8LA 1KZ7B 4Z8YA 3DOFA 5KU1A 1ONBA 2QEQA 2GK7A 4Q48A 1L7VC 4I1UA 4OJQA 4KBFA 4W5HA 5DYGA 4WIAA 4TT3D 1GL7A 1IJEA 4TL9A 2R9VA 3MSXA 1FNMA 1U99A 3NEJA 4LJ4A 2JJ8A 5EP1A 3WMFA 2A30A 3VX3A 3DEFA 2O5VA 1KSJA 1R7RA 3WBJA 1Z6YA 2QROA 4ZDIA 1G7SA 1UADA 2FFQA 3K0FB 4JKYA 1SVLA 1RRPA 1OYWA 2FEMA 4GOXA 3AB3A 1RVDA 3TBKA 2D4HA 4C7OA 2O8CB 2WIAA 3NTUA 1D2EA 1Z29A 4TL7A 3EAQA 4IRUB 1ZYUA 2F1JA 1YZGA 1GG2A 1BYUA 4OL0A 5JSZB 1N5IA 3EASA 3M1IA 3HR7A 3DPUA 1A2BA 2XZLA 2ZRFA 4POAA 4W7SA 3SYNA 3FMIA 2E1RA 1W1WA 2WWWA 1QF9A 4V0OA 2ZS7A 4U5XA 3EPJA 2GESA 5CYOA 1I2MA 1IN8A 1NLZA 2XJ9A 4G5SA 3EXAA 1T6NA 4RZ2A 2ZYVX 1PV4A 5ELXA 2PX0A 3JVVA 1O3YA 4AG6A 2QTHA 1KDOA 2C99A 3BB4A 4A4DA 4QHSA 5J40A 1KSFX 1ZM2A 5CITA 4TYYA 1SXJE 2ZE7A 4DKXA 2ZUCA 5AUPB 3KQKA 3CNNA 3MAAC 1DPFA 4IOMA 4BASA 4LV8B 2GJ8A 3SZRA 4ZCIA 2VIIA 4CIDA 3GJ7A 2FSIA 3X2SA 4IHQA 1Z63A 1XTJA 4K46A 3A4LA 1NKTA 1XNJA 2IF2A 2QRNA 1KGDA 1E9EA 4OK3A 3SN6A 3ZZUA 3I5XA 1M7BA 1SQ5A 1G64A 3Q9LA 3UWOA 4C4PA 4NHOA 2OO7A 1BKDR 3AKDA 4RD4A 4HAUA 2W0MA 1D8TA 5IK2D 2XXAA 3GLFA 1OXUA 4TYNA 2ZRIA 3CH4B 4PZZA 3EPKA 3Q7PA 4MRRA 4DLSA 4YMSA 4NTZA 1XXHA 5CDFE 1YRAA 2YJTD 3CPHA 5EE5B 5BXQC 4NBSA 2SHKA 3HWSA 2AXPA 2GVZC 4PSVA 4L4UA 5FOXA 1XPOA 1U98A 4NDZA 3GLIE 5DSZA 1G8FA 4GP7A 4D25A 1DOAA 3CRQA 2JLYA 4ZKDA 4G5RA 2BEKA 3AVOA 4G0NA 3NDBB 5JJIA 2A7QA 1W4AA 3BBPA 2ZQ5A 4JLPA 4D0NA 1D2MA 2WTUA 1ZBDA 1UBCA 4BGDA 4Q1DA 3T1TA 3QKSB 4BLTA 2ZSFA 3A37A 2J5XA 4A36A 2OILA 5D3MA 2YINC 4PSAA 2GILA 2V4ZA 2OCPA 1BMFA 1VYVA 3CONA 1KI2A 2ASEA 1MT0A 3ZVMA 1W5TA 4HLQB 4DZZA 1L4UA 4DCTA 1KK1A 3IIJA 4EDHA 2P5SA 3LBHA 2QP9X 2XAUA 5JJKA 3FKSA 2YOHA 1UEJA 2CBZA 3PG5A 4KYIB 3CX7A 4R98A 4XIGS 1AK2A 3UK6A 1F2UA 2WPDA 4NP6A 2QU8A 1G21E 4KO8A 2PLFA 4N0DA 2ZI4A 2EFEB 5EE3A 2WOJA 2RGDA 2WPDD 2ZVPX 4LBZA 4OHWA 1EFRA 3FPAA 4LBWA 1E96A 1JXMA 1NBMA 2OBNA 3AH8A 1EFRD 4P3YA 4GRAA 1E2DA 1CTQA 2CJWB 2REBA 3LO5A 1KY2A 3WYFA 2F9LA 2I1VB 1Z22A 2ZE5A 1J70A 3OIWA 1Y3AA 2IYLD 3TK1A 1GZSA 3Q8XB 5EUQB 2PJZA 3K1JA 1TU4A 2FSGA 2QGNA 4EPYA 4M9ZA 4JT2A 2OZEA 4HATA 4A92A 4V0NA 4H9GA 4IFBA 4M4SA 3QKRA 1E1QA 2DYKA 2RH5A 3K0CC 3ASZA 4HUQB 1W0KA 3EIHA 1UKYA 4OJKA 4E07A 4IVPA 1XTQA 1E1QD 5EP3A 2AKYA 1XEXA 4DJTA 4WA7A 1F48A 1HT2E 4PFSA 4QBIA 2ANCA 2CE2X 4R7ZA 3GP8A 1MR3F 1BOFA 4DLVA 2GCOB 3GMTA 4DLUA 1EWQA 1W7AA 5HCNA 1ZAKA 4L5BA 4E03A 1XTKA 3BGWA 4EFMA 3CWQA 3P27A 4TYQA 1F2TA 2ZUDA 1W49A 3CNLA 2VQSA 4E09A 2JIZD 4LHXA 1TF2A 1WQ1R 2OFOA 2TMKA 2IHYA 4URYR 4Z51A 2AD5A 3G0HA 1J2JA 5IT5A 2ZJOA 3KL4A 1M7GA 1J99A 3BK7A 2V9PA 5FTMA 3WRXC 4B47A 2GJKA 2ZJBA 2ZRBA 1NRJB 2ZRAA 1E9SA 3FFAA 3K09A 3GLHB 3PIRA 3CIOA 5GJBA 2QT0A 1VG1A 1Z6GA 1LY1A 2D74A 2ODNA 2QUZA 3SFZA 3X1YA 1FFHA 1DADA 2PZEA 1T5IA 5KO2A 3MD0A 3DM9B 3LBNA 1E2JA 3CH5A 5LD2C 4B44A 2P65A 4JLMA 1N6IA 1E32A 4PHHA 2CHQA 2GEUA 4OBEA 2HJVA 5JI3E 1AZTA 5DHFA 3UG6A 2HCBA 1TNDA 1US8B 2O8EB 3CKLA 1TQDA 1G17A 3RNLA 4ABYA 3VMFA 2D7DA 3W9YA 4TZ0A 2EFHB 3AF3A 3AVYA 1W4BA 4I4LA 4EPTA 1B23P 3EA0A 5CK4A 3ICQB 4YONB 2QPAA 4HI0E 5G40A 1ZMXA 4HLUA 4JL8A 3THYB 4M53A 3I61A 1G8PA 3LWNA 2GEDA 4N3NA 3MRSA 3W90A 3GJ8A 3D7MA 5E95A 1N25A 3B7GA 4IFEA 1LTQA 1GILA 4LJ5A 2QP3A 2O8DB 3T61A 3SR0A 1CBUA 2ERYA 1W47A 3B1WA 3PUZA 4AYWA 4CEIA 2NO6A 1G8GA 2GWHA 3HDTA 4GSYA 4RZXA 2RGNA 2JLSA 2KSQA 3AVPA 1Q1EA 1OXSC 2ZU0C 3RS2A 4QL3A 4I1OA 3KFXA 3I72A 2FGKA 3Q5EA 2WWFA 4AYTA 4AD8A 1PUIA 3D31A 3ZS8A 3ZQ6A 5AJZA 2ZI7A 1IN6A 1NLFA 1VCNA 2QI9C 4L9SA
chains in the Genus database with same CATH superfamily
3BWCA 1JG2A 4AT1A 2VHJA 3F7NA 2BL4A 2BOVA 1EFVB 3EZLA 4KXFB 5EPOA 4ZOLB 4E46A 1VE6A 4OL9A 4P3PA 5DPMA 3R5KA 1KORA 4F3NA 1FZTA 2HLHA 3RSFA 5J9FA 3AK4A 5EIEA 5LQDA 1GUDA 2X5JO 5CVJA 3W2IA 1XDUA 4N65A 1U94A 3A2MA 3T12A 1YOBA 5LQMA 1KZYC 3T0FA 3DCYA 3RTBA 1ZJYA 2L2QA 4PONA 4CM4A 4MDYA 8ADHA 2JEOA 4ENSA 3O47A 2GF9A 3CH6A 1G8AA 1XLWA 3OZSA 3V00A 3CN9A 5H68A 2P8JA 4Z2YA 3ES9A 5B3AA 4A0RA 4BNIA 3ME5A 2OC4A 3DA8A 4CKWA 1GLVA 1PR9A 4MGYR 3VMMA 3HJFA 5HS6A 3V2HA 4GLBA 2JC3A 4RHEA 2EP5A 2XCOA 4CLOB 2IHKA 3MWEA 3KBBA 4XDZA 5BURA 2DHRA 3O9ZA 3CUUA 5KSWB 1UK8A 1Y9EA 3NHZA 3RAEC 4QOIA 1H2HA 3F7OA 4R2LA 4FIDA 1T1SA 1IWBB 5HKKA 4CIXA 3OU2A 5HKLA 4UEKA 5HKKD 2Q7DA 2VDRB 3N8IA 5MGNA 2N75A 2CL6X 3D6HA 2HC9A 3BQNB 1BRTA 1PGNA 1EP9A 1A4IA 3M0EA 2R1VA 4G4JA 3WTBA 3A58B 3UMFA 3X1XA 3N2KB 4F04A 1ND6A 3FNGA 5JQGB 4QM7A 3BK1A 1UM8A 1GCUA 1K5HA 1C2YA 1N9GB 4JX8A 3I5MA 3KLOA 1L7EA 2QW0X 4PPGA 3UWPA 2BGGA 5IF9A 3BIWA 4URFA 4ZEOA 3V4FA 1TMYA 4TM8A 1MP0A 4E7OA 4ESOA 2FW8A 2QL6A 4H0NA 1GM5A 2ORIA 4MW5A 3IBGA 4MCHA 4LYGA 3GJ5A 4DM7A 1W52X 3AZPA 3QPVA 3WICA 3O3NB 4A26A 3QIVA 2WG1A 1ZITA 3PUWA 4ZO7A 4YCSA 3K9FC 2JJ2A 3MB5A 2D1YA 1FLAA 1N5DA 1D2RA 4Q1BA 4UUBA 1FJXA 3HJAA 4DJEC 1E6CA 4UAVA 4PHCA 1XU4A 3L0DA 1FZQA 1R4NB 4KIJA 1Q83A 2VPTA 1Y33E 4PQGA 1NONA 2QVZX 3RU3A 1RRVA 1GXSA 1QO0A 2CNNA 4RANA 4KUHA 3YASA 2CCJA 1UK6A 2H2IA 1BXGA 2QLMA 2R97A 2XUDA 4YYZA 4F45A 1EHYA 2TYSB 2HWXA 4BFSA 4E5SA 2CNWA 3U4AA 2RHWA 4GRDA 4W5QA 2XT6A 3LC2O 2CNWD 3JQ9A 1GLGA 2V98A 4DDVA 3DMDA 4FDLA 2FMTA 2ZR8A 1MOQA 4D3DA 1HORA 3B3QA 3CR3C 4OEHA 4JN6B 2GPAA 2PSJA 4OAPA 1FLVA 3X1KA 5J43A 5EJGA 4KYUA 4D3FA 6Q21A 2DB3A 1MJHA 4WY5A 2KQUA 3QYJA 2GBLC 1QMGA 1IM2A 2NXEA 5T4FA 2JANA 4R9RA 4F84A 2IE8A 4IQGA 2ZW9A 3SLGA 3T3EA 4DLLA 4U0JA 1E3TA 1S89A 1UWKA 2H18A 2HMVA 2Z9BA 4KQXA 3VYWA 4Y30A 2IOFK 2QA5A 1P6QA 1UT5A 2WJZB 3PUHA 4OQ4A 2V5AA 1HE8B 1E5DA 1WP4A 1XNGA 2AYZA 3IERA 4IIVA 1L5RA 3SAJA 2FQ1A 1AKEA 1R0KA 4CUZA 3L6OO 1U2RA 3V8MA 1JIJA 3IKJA 5LZ8A 5D01A 3I04A 4M87A 3QYPA 4K8OA 3VVBA 1PRYA 2CE7A 1DO8A 2RKBA 4W1QA 1NV9A 1ZLXA 4OP1A 5JW6A 2PL1A 2V6JA 2PWBA 4KXVA 2CVHA 3B5EA 3CEJA 4L9RA 4X6UA 5COBA 4PG8A 3DBRB 2WTXA 3A9WA 5JR3A 2AEMA 1SRRA 4OGWA 1MG0A 5B30A 2WZDA 1TB4A 4EENA 2BUCA 2QD5A 1MG5A 1AE1A 2Q1YA 1M6VB 1U3TA 1XZDA 4G4GA 3ZQJA 1B8VA 1HBJA 1W2GA 1TVKA 2KJQA 3JZDA 3U31A 4DMCA 4IV8A 5FA5A 4C0XA 3LK7A 3X1DA 2SECE 2F1IA 3C3CA 3JWHA 1R50A 3CEPB 1M1XB 4WCFA 2EDAA 2UUCB 2P2GA 1E6LA 3CB2A 4LWZA 4OXRA 4IMIB 2XZPA 1SIUA 2ZGVA 2WKWA 4MUXA 4LQLA 5K0ZA 3RJTA 4BC1A 3A0UA 1IJKA 4HH3C 4MWDA 4LDPA 1IY9A 3V97A 4FD2A 3QHQA 4O3FA 2B6NA 4E4TA 5KYNA 5EWMA 3BRSA 1QKIA 4GZMA 4WN9A 1VSTA 3MMSA 4H59A 3OETA 1Z06A 5IKMA 4XYGA 5HDBB 3PR3A 1D2GA 3OQ6A 3O7MA 3FZQA 4FGSA 3R1IA 3A1NA 4YV7A 5K0TA 3F9RA 1KRWA 3H2IA 3PYXA 5LZ5A 3WK5A 2IY8A 3CVWA 1IPHA 3G1TA 4U7GA 5LFAA 1JFSA 3KZNA 1XXLA 3FETA 4HDNB 3ZHUA 3JALB 3JWIA 2Q7XA 5B4VA 2WNHA 2FEXA 1BAPA 3FVRA 1P45A 4ZJUA 3BM5A 3TJRA 3D4OA 3U80A 3TSCA 3W1WA 4L85A 2P1ZA 3DP9A 3QX7A 3C1TA 3PTAA 3N1UA 4O2LA 5BMOA 3UG7A 3LFTA 1RM3A 2I4OA 3HUEA 3G8CA 2H00A 2LCIA 4K6GA 3DUFB 2FWPA 1P9NA 3FYUB 4ACBA 4RPGA 1QHYA 1XIVA 2R8ZA 4FFLA 2EV9A 3NH9A 5CX1B 1JXQA 2R86A 1II8A 2B69A 4U2EA 2EWMA 2ODPA 5E9AA 2DT8A 4IIJF 4ZJZA 5E38A 4EM6A 5AJVB 1LI4A 3RVBA 4ARZA 4M6WA 4IPTA 1ZJ6A 3FKJA 4PLPA 4M1ZA 2XE7A 3UT5A 1KYXA 4GQIA 4GP6A 1BVUA 3GG9A 3OC0A 4GXNA 5CAEB 3R5TA 4YRDA 1CW2B 4PAOA 5L4SA 5GIPE 2FSPA 4DG9A 3EMKA 2OL4A 1JA1A 2HRQA 2RKWA 2XMPA 3NBYC 3O8OB 1UBHS 2FN9A 4MMXB 1NUQA 1N6LA 2BN4A 4TL6A 3F6PA 3K0AA 3QH4A 1TDJA 4DM3A 1QP7A 3QA9A 3DE7X 1KE1A 1KJIA 1TAGA 4PANA 5HVNA 3GP5A 3K70D 1V8FA 5DVZA 1CUYA 4PO9A 1CP2A 1VGQA 2YS6A 2ORVA 1AK1A 2NUBA 3RYHA 4V1CI 1AGXA 2DCMA 2JEZA 4X1IB 4YP5A 1ATIA 1IQPA 3B1JA 4BV2A 2J3HA 5DNDA 5KX5B 2A9PA 1RXIA 1I5EA 1V47A 4NBLA 3G82C 1ZP6A 2GPWA 1Z7YA 3QF7A 3L4EA 1XRMA 4ZYWA 2HY7A 1RZ3A 4IX9A 3OZIA 2ZR7A 4MKFA 4CM3A 4JI3B 2Q0HA 3ISTA 1QHEA 4M1OA 4MINA 1V5GA 1H6AA 3QLUA 7REQA 2IYOA 3ZYZA 3DE3X 1OCEA 3EB9A 2BEUB 2C0CA 3O38A 4CMBA 4YCNA 1CHNA 3AFOA 4F5DA 1H9BA 2AI1A 2R7LA 3DO5A 2LGJA 2AI3A 2PTHA 4V1CA 2WAXA 1YU9A 2WW8A 2VCEA 2FWAA 2OB2A 3C8ZA 1R0XA 3K5HA 4GI3A 2Q3CA 5KVSA 5HHTA 1L2TA 1YS7A 4GYYA 4PRKA 3VC1A 2P6OA 3GT0A 4RTLA 5LR6A 1RLOA 4YRIA 2C97A 3V7YA 2WIBA 3IPYA 2Q0QA 2YCBA 3C15C 4OHXA 1QP0A 3TKYA 3WYEA 1AKYA 2ENUA 1QOQB 2RB4A 3PQ2A 1TO2E 4DBLE 2BP7B 4YCLA 1CR6A 2F64A 3THXA 2O5EA 2ZUTA 4ZYVA 1AKUA 1A88A 2HX1A 1Z2PX 2GD0A 3O1LA 2XUKA 3PU6A 2G1PA 1RLUA 2AF3C 3ZV6A 4HTAA 3RYIA 1D0IA 1IMOA 3B1FA 3TR0A 1W34A 1WKCA 4TSKA 4ZICA 4TZ6A 4JAVC 3TTYA 3OQVA 5FWAA 1TI7A 5F3WB 1CR1A 1W88B 1Y82A 2VO1A 3UJ9A 4BQNA 3WB2A 1FRNA 1S9DA 1YQWA 4KR6A 3EPJA 3JQFC 2ZIXA 5LP6A 4EGAA 1G6HA 3WISA 4PIVA 4IUCS 4R5MA 3TSWA 6CHYA 2OB1A 2YYSA 4X91A 4BB9A 3VSCA 1NSTA 3OY2A 3GPDG 3S2FA 2Z9CA 1RYEA 1VLJA 3AKEA 4CCYA 3D5QA 2HA3A 3OA2A 2A3RA 4NG5A 2HK7A 3MEQA 1W9MA 3ZE2B 2O14A 5ICMA 2FQXA 5TT0A 1QE5A 1B6GA 3DF9A 1BGVA 4CM4B 3GLGB 2FPUA 4I1IA 4C2BA 2RD2A 3T3MB 4B6GA 1SEPA 2O52A 3OFNA 3AEXA 2P62A 4D44A 2Z1NA 1ZR4A 1CD5A 4MVJI 4CKWB 1LW7A 2A0YA 3P0FA 1ZK1A 3OFND 3URMA 4C06A 3UPDA 3E81A 1KP2A 4FBLA 3MWEB 3UIEA 5JZBA 1EXNA 2UZ1A 1SBHA 2E5FA 5DX1A 3QVMA 3JYNA 1AQJA 4MA0A 4C6SA 3NKLA 5GZ6A 4FDTA 3MPUA 4PR3A 2AK2A 4TS9A 5IANA 4B09A 1CYEA 5KTMA 1L5SA 1WUKS 3MGGA 3F5MA 2PD3A 1L5MA 6AT1A 4KE6A 1JHUA 2IZ5A 4MVJA 4AX4A 4DSOA 4A1FA 4WOPA 2PR7A 1ZH0A 1BCSA 1J2EA 2R1VB 1RHRA 1NUAA 2FKNA 3E5MA 3DLAA 2PTGA 4C14A 1X13A 3FNBA 3PCTA 3QMMA 2ZYDA 4M8SA 3RWBA 4DUPA 2FLWA 4YH1A 2H2WA 4PG7A 1OI2A 2GRJA 3GUHA 3R0JA 1MVLA 1T1IA 3WDSA 3QVXA 4JBHA 4OIMA 3NORA 4FS3A 4JUAA 3C97A 4KNVA 4F38A 1NURA 1C1XA 4E4YA 1P2TA 4QX6A 5CA1F 1DC3A 2YV1A 4J7AA 4G67A 3D9QX 2ZANA 3GWZA 2WUEA 4F6RA 3EA5A 2QS9A 2EEPA 5JPDA 4D9EA 1GGFA 1XQXA 3ORSA 1SPXA 1XLTA 1CJBA 1RABA 2Q50A 3JZFA 1OYYA 3ND5A 4LJKA 4HB2A 3D3WA 4TMKA 1GU7A 4BN5A 4D45A 5C8YA 2HU8A 3F6YA 5K3DA 5AI4A 3COVA 2WOOA 2O8BA 4XRGA 1YR1A 2YZMA 4DHEA 4FU0A 3ZI0A 3H9CA 5FBQB 3P9KA 5TLSA 1IBSA 1IOZA 3WVNA 3JW8A 2CBXA 4BX2A 2VPZA 4BLOA 4C3VA 1UF9A 4D7AA 1PYOA 1GXSB 2WYIA 4R1SA 1X38A 2XUOA 4YAWA 4DCJA 4O1IA 3BQ9A 1XEWX 1BXGB 3CW2A 3EBPA 3KHSA 4IDPA 3ON5A 1LA2A 1WCIA 3UGKA 3W5BA 3NUQA 1RIIA 1Y6GA 3SM3A 3R6DA 5HKAA 3SS7X 5JXIA 4EJ2A 3ZBTA 2H5LA 3VV2A 2ZYHA 3GFRA 2WU4A 1U90A 2PO7A 1QIHA 1PVOA 1B93A 4E33A 4CKEA 1LD3A 4HYQA 3QEBZ 3F5QA 2AUMA 4G2TA 2GCPA 4RE6A 5EUCA 2W2KA 4X7BA 4C4SA 4QUEA 3DJYA 4K1LA 1UZLA 4L15A 1WY5A 2VPXA 5C4MA 2P3LA 3LF2A 5T5QA 1NG1A 4FMBB 2Q5HA 4XFKA 3UWKA 4HEHA 4ECEA 1UJ2A 2RAUA 2H8KA 3E70C 4LHZA 5M04A 4KN8A 2PT6A 4WBSA 2GK4A 4C0WA 4EW1A 1HDEA 1ZX1A 3P9NA 1V6AA 4N82A 4UE3S 4HX9A 4Q1CA 1M2OA 4LMRA 5D3ZA 2YXPX 4TLMB 3X1ZA 4EUSA 2WAYA 1Q12A 3GOQA 3WRVA 1ZICA 5KTSA 5JY6A 3M6LA 1OI7A 1KOJA 2G72A 2R5FA 5IABA 3FI9A 1PAUA 4NS1A 2C9MA 3ZZ1A 3Q15C 4G25A 3W4JA 4N1AA 4GLLA 2QZJA 5JU6A 2ZKLA 2BZGA 4YAJA 3S1AA 2AXEA 4LRWA 1TU3A 3LZCA 3SF0A 4D80A 1OASA 4UVGA 2IUSA 2XQGA 4QO7A 3TSOA 4URXR 1OB5A 2IBTA 1V3QE 3B9PA 1ZG3A 1KAGA 4HRVA 1GSIA 1IHOA 1V8ZA 2P6MA 3FSJX 4IWYA 3IR7A 1O5IA 2Y8EA 4M76B 2VHQA 3TVTA 2KBFA 3T1OA 3I04M 3QWFA 3QPDA 1ZOOA 1TVKB 5ALHA 1J22A 2A4KA 1MAWA 1UBRS 1SG0A 4GE0A 4EJMA 4PICA 3G2KA 4WCFB 1LK5A 2XNKA 2D5BA 1RVV1 4NZ9A 1EWKA 3R75A 3Q5DA 4XVUA 3Q1KA 5FCDA 1LVHA 3E3OA 2B0JA 3ZKWA 1KMMA 2OO3A 4EUNA 1NBMD 1O57A 1G8YA 2ZBUA 3K2EA 1A9OA 5EE9A 5JCOC 4QJ5A 3RJMA 2JL1A 3VAAA 2PBFA 3DL7A 5EQFA 5EWMB 1P2GA 2BFDA 4M8KA 2NXJA 5AW0A 4ZAFA 4EABA 3IV9A 1IHYA 4WN9B 5FFMA 4HNTA 4CEHA 4E11A 1UM9A 5F7JA 3RH0A 3UXMA 1KVTA 3AF6A 3KJQA 4IVRA 3EQ7A 4UTNA 1YZHA 4RAQA 1AXRA 1C3VA 5KTKA 1E2UA 4NECA 4UNIA 3IT1A 3HCFA 3MSCA 3EXG1 4UBJA 4RMNA 4BO9A 1KI9A 2WRZA 4S1WA 3W77A 3BF8A 1Z75A 3PUIA 2XUIA 4TUYF 1U9IA 4ZCMA 1USKA 2CYCA 2WF8A 4GPTA 4G9BA 2C42A 4RO0A 2XB4A 2BJHA 2P77A 3LZ6A 4YUVA 1ONOA 4XJXA 3IO3A 1Y8AA 1CQWA 3I09A 1R6XA 5EIOA 3TDKA 3B2EA 4KAXA 2HCRA 4PPYA 4YRRA 5JHHB 3I28A 4RM2A 4YCMA 4GI2A 2H59A 3I3SR 1NVEA 1UJNA 5EWJB 2PZAA 5BORA 5JCZA 3HBJA 1IXSB 2C7VA 3MXOA 4AJEA 2YWBA 1FDWA 3OOYA 2RGRA 3NDIA 1II8B 1VXOA 2GI4A 1BMDA 3DE0X 4UHCA 1OX6A 2J6CA 1IQ0A 4KAFA 3FZNA 3PF9A 4V0ME 4ARZB 4M6WB 2QK4A 5AOVA 3GJXC 3WYGA 4UTPA 2MIIA 3R5FA 2P9JA 2WP0A 4TRJA 3C2QA 4CDRA 2P0EA 3QU7A 1K89A 4EEKA 2ZRDA 2R11A 2X0KA 3EQ9A 1J23A 2V8BA 1L3IA 1YB1A 3OE1A 2ZIZA 4REMA 2VCYA 3AF5A 1AV6A 1CX9B 1OAOC 3LUHA 2WZCA 1JLKA 1F17A 1WDWB 3PR1A 5TMBA 2AFHE 4KCGA 5D6NA 1Y8RA 2YBEA 4DV5B 2VJLA 1LS6A 1C3EA 3HB1A 2FG7C 2WD7A 3FCCA 3K70B 2K7FA 4YREA 5CJJA 4EKNB 5IJXA 3HKBA 4IDOA 3WLNA 1DHTA 3PKZA 3HLTA 3QE3A 1L5FA 3QG5A 4HDRA 2FZLA 3RYHB 3U3KA 3O1JC 4KREA 3PGMA 4K26A 3B9QA 4X95A 4DC1A 1TEXA 1JEQA 5JEEA 1UKEA 5AVTA 2JW5A 4AF6A 3H5TA 3IMGA 4H1VA 1DBSA 2KI5A 2PSFA 2CJYA 3KSDO 1P2DA 3KVRA 7REQB 4DWVA 1E2GA 1F0PA 1YR2A 2YQ5A 3RROA 5P21A 4OAOA 3H3JA 3MRTA 3SYTA 3ZHZA 2VQ3A 4V1CB 4XTRA 2HF7A 3A9SA 4OJTA 5DHSA 3B85A 2XUZA 1XDDA 1YJXA 3UOAB 4C7XA 3GNQA 4MI3A 3DXZA 4ZYYA 4WE3A 5KHOC 3ROPA 2OFXA 2GARA 3H05A 1WVMA 1O9BA 1UBTS 3TJMA 4N3AA 2WHEA 3THSA 1O6GA 5CEEA 3EW7A 2W4MA 2VK2A 4QGFA 1FDSA 4B3IA 4H7PA 5KWIA 1O4VA 1UPXA 2GN0A 2Q5JA 3U7QB 4G37A 2V96A 4YTEA 3CLRD 3IGFA 2XIQA 3C24A 4OHRA 4F6CA 4MW9A 3THXB 1FVOA 1AA6A 1RJEA 4XQEA 1HOXA 1SOUA 4I1PA 1IHXA 3CW8X 1U7WA 1ZAYA 3AKZA 1VGRA 5LU9A 5ICCA 1XMQB 2F3PA 1ZNWA 3RYIB 2BPOA 4Q9NA 4RHFA 1LDMA 3AETB 1OBOA 1U0FA 2AG0A 4UUQA 2R8OA 5LBTA 3EW9A 4NDNE 3U40A 2UZ0A 3EC1A 7MDHA 1SURA 2VYQA 4MQFA 4UHEA 2IXAA 2XRMA 4IMRA 1X92A 3OBIA 2GLUA 2X1LA 3N6RA 3TCNA 1EGHA 4KN5A 4QVKA 3VUFA 1E1DA 3KEGA 1L7PA 2W70A 2ZIXB 4ZYTA 2IX9A 4CTMA 4L02A 1ENYA 5LP6B 2CF6A 3RVDA 2WDPA 3DMNA 2GSDA 3H9QA 4FYWA 1SPBS 2OHVA 4QA9A 2O2HA 1EWVA 4CHTA 4NCXA 5AW5A 1UP4A 5ITSA 4D0SA 2VP9A 1Y7TA 3PEFA 5JVDF 3NWJA 1F5NA 1OFUX 4BNDA 2WJJA 5JAPA 1KDZA 1H8HA 1T2DA 2NO0A 3GJYA 3K92A 4REOA 3DT8A 9ABPA 1H8HD 1L9XA 4HEQA 1M1NA 1SK9A 5DI9A 1A4UA 3PXCX 5TF4A 5IW8A 4L4ZA 4AK9A 4DLXA 1W44A 1E4VA 2SKDA 4X65B 3DE1X 2WQZA 1W73A 2H1HA 3EEFA 1SHZA 4YRCA 1ORHA 2MOKA 2IOQA 3Q8WA 2G80A 5FTKA 4EB6A 2IYVA 2Z83A 2FMKA 1H6CA 2P6NA 4URHA 4CR7A 3DYBA 1GR1A 2UZ1B 4UU7A 2VDVE 1X7HA 3CYFA 3OH8A 1TMKA 3VSAA 3DNFA 5HM8A 1S6YA 1OOEA 3RVNA 2R4TA 4LFCB 1VLHA 4LMPA 2XYHA 1Z18A 4DIUA 2CJFA 2YW2A 5HP4A 2OLKA 1JBQA 1BCSB 3E7PA 1NJ6A 3IQWA 3SKYA 2OCAA 3PENA 1DARA 4B6PA 4BATA 4QLOA 3C1UA 3FVWA 3MGBA 3ORFA 2O57A 4MJ7A 5DHQA 5AVOA 3ZDYB 2VRBA 3VA7A 2DR2A 1WD5A 4CMJA 1QBKC 4XXHA 3W04A 1RXSA 1VBNA 1QRAA 3TRIA 1W4LA 3TL6A 2NTYC 1C9EA 1PE0A 3D6NB 1F8GA 1HDIA 4ML3A 1GADO 3DLPX 1RRKA 4BLUA 1KY3A 3GGDA 5FTWA 4F6RB 1ABBA 4NZPA 4BKOA 5JI2E 1NSFA 2ZVJA 4NMHA 1OR8A 5KS2A 1QIMA 2VKTA 1W59A 3DT9A 2ZBVA 2JGDA 5IT0A 5C8YB 1PZEA 1VPLA 3FR8A 4DCMA 2YY5A 2ZIEA 3RVMA 2AX3A 3ZD9A 1K0FA 1FFCA 3IESA 5EXSA 2IPMA 4X90A 1T5BA 2HHLA 3ZWAA 3LPDA 1KVQA 3KEFA 4HLUC 1XYGA 5KYTA 4QRDA 4O0LA 1KYZA 3I83A 4J7UA 4BRZA 4BV3A 3HH8A 3ZY5A 3IAM1 3QJ5A 4JMLA 1BQ4A 1MJ5A 3W6PA 1BU8A 5GM1A 2YV5A 6PFKA 2ACVA 3ZQKA 4OBBA 4Q18A 4H1TA 1JLHA 2HWKA 1FS4A 4E21A 2ZKIA 3NPAA 3PHIA 4B81A 2RAVA 1DXYA 1I4LD 1I6LA 3TXAA 2POCA 4XWOA 1G41A 1LBQA 1ZMOA 4JP8A 2OY0A 2ZT5A 2VBIA 3PD1A 1NSYA 3GAMA 3GJZA 2FVYA 5CDTA 3M8KA 1XXHB 3PC2A 4FFRA 4CKEB 3SC2A 5K8VA 1QE0A 4RQTA 2WJPA 5DGHA 1Z3IX 2W2KB 1W36C 2A5JA 4DCUA 5JAUA 3SU8A 3GLUA 1RW4A 2YXNA 4PZ9A 1H65A 4K6CA 1QHFA 1QYWA 5FPYA 5B2ZA 3KUXA 5A2QA 5AICA 2CFSA 2C03A 3OQHA 3DZJA 3IEMA 1BEUB 1YJ5A 2XI4A 1E59A 4ZDWA 1PS9A 4IUYA 5DNWA 2W6PA 2EKBA 3K4QA 1J0DA 2LZ0A 5EHZA 3GWGA 4TKLA 4G81A 1K8ZB 4K6FA 1AKTA 5IC4A 3AR2A 1NULA 1ZH8A 1M2OB 1AXEA 2O1XA 2VBFA 2WYOA 4KYVA 4A1OA 3SIXA 4UUPA 1NW6A 1G3MA 1E3WA 5B57C 3DLBA 2EIXA 5JEDA 2VI5A 2P91A 2OZLA 2PSDA 3H19A 3PHCA 3IKLA 4HEJA 4JQSA 5B3LA 5I6DA 3R0ZA 1IC6A 5T3UA 1W5FA 3VR4H 4EECA 1I0LA 4WCVA 2EX4A 1LH0A 2NSJA 2C2MA 4J16A 2AE2A 4YIKA 4ALLA 1H69A 3S1AB 3EPLA 4FHDA 1E77A 2AXNA 2G9UA 1ATZA 4NSNA 5C8XA 2AE1A 3OFVA 4KXYA 2O2DA 1I51A 1B74A 4K86A 2A9VA 2PH1A 4PRLA 3TVDA 4CG1A 4EVIA 4MVJP 1KZ6A 3RVOA 2QB5A 4PPQA 2QJTA 2V45A 3V4LA 1F3OA 1OGYA 2NIPA 3WLIA 2FR0A 2UYHA 1OFUA 3EGXA 3B6ZA 4RKRA 4BJ3A 1X15A 4UEOA 3OLWA 5IEBA 3W2HA 2GRUA 4JLNA 4TRNA 4EF5A 3O4FA 3ABZA 4LCEA 3J81k 3BGOS 3NYRA 4OQXA 3ZWVA 5JBIA 2HYIC 3FNHA 4PZLA 4RORA 1C50A 2YXBA 2VDPB 2BMAA 5IRCD 4NEQA 5BR4A 2ZDHA 5LKRA 4AS1A 1X3LA 2YOFA 1OZGA 3L7OA 4C0AC 4NICA 1RKUA 3ZI7A 3M6WA 3FTQA 2G8LA 2UZAA 4W6ZA 3GXOA 3EXFA 2I5PO 2ZB8A 1I2ZA 1TL7C 4JJEA 3ZKWB 4QHTA 1M33A 3KOYA 1SVUA 4ZTBA 5LZ2A 2WIDA 2DTXA 4RNCA 3FD8A 2SNIE 3ELWA 4LZNA 1ZL2A 3L02A 3M9WA 4PZPA 2D1FA 3I1IA 2E6KA 3UBTA 1SCIA 2VEDA 1JQEA 2XITA 4ZOAA 2BFDB 2X7HA 4HPXB 5B6IA 3HP1A 4RVFA 2NTVA 1F20A 3S2ZA 4MKZA 3L7JA 1MHTA 5D7NA 1TIKA 5MGBA 3FRIA 2ZB3A 2HHJA 4AY6A 2H1SA 2QUJA 1GP2A 1EGMB 2FPXA 5AKEA 3WGMA 3ZDAA 3VNUA 2D0IA 2PGOA 3G88A 2HIMA 1LBSA 1YFLA 5K45A 1ZOSA 3RJ9A 2KW5A 2X14A 5E6SA 5AVUA 3NGLA 1KZGB 4I19A 3CQ9A 4MW1A 1RLMA 3NDPA 3SFTA 1MAUA 3GUYA 1BDIA 4ZI7B 1KYQA 1XHFA 4MUIA 2RH8A 1OGJA 2YQ4A 1EHCA 8ATCA 1E4EA 3HKEA 1PFVA 2Z6VA 4BZPA 2ZBGA 3PEVA 3RYCA 3BWVA 5AI5A 4A0HA 1TTHA 4MUEA 2HCTA 4JQZA 5TGDA 2A9RA 1SD1A 3O5AA 1XEWY 3KD3A 2J3EA 4QQNA 1M8PA 1XAJA 2BD0A 4NDAA 1T34A 2P5UA 4BO5A 4YUYA 4B3GA 2FFBA 3WGNA 4DWOA 3GHYA 4OOEA 2RK3A 3I12A 3OEYA 2VNHA 3HSSA 1Y5LA 1CPYA 4CTJA 1JECA 4C21A 2R8RA 3IPXA 1QB7A 2NUAA 4KXNA 1M2VB 4RH3A 5LMNB 4CL8A 1S9HA 2QYSA 1KK2A 2WICA 3V8VA 1A9PA 3CZ9A 4EKDA 5DYIA 3PFGA 2OCXA 3O90A 4LMBA 1NF9A 1A5AB 1WULS 2X42A 3PUXA 2QRVB 3D1JA 5C81A 4Q9LA 2GA8A 1YR9A 3GH3A 1Y8RB 3IXMA 4KIUA 4AZVA 5B1YA 2C5EA 1FJ2A 4YLEA 3P2JA 5F5NA 1RRMA 2WD7B 3MPOA 3OJOA 3MMXA 1WB5A 4U9IS 2G9RA 2IDMA 3L82B 1RM5A 3HKBB 3I1JA 3N70A 1SHJA 3OUZA 1ZQ1A 4ER0A 4ESEA 1C9NA 4N7MA 1G7CA 4HDRB 1CJMA 3FTDA 4IDBA 4PY2A 4DA9A 4ZAGA 4DIDA 1M66A 1M2EA 2RCYA 3A9UA 1TYZA 3S1SA 1JEQB 2PS9A 3UYLA 5L7WA 2F6RA 4E2ZA 1N7GA 1MF7A 2PZGA 1HE1C 2ALJA 3CCBA 3RKRA 1KKLA 3KM0A 2C9OA 2ZTLA 3STVA 2H1VA 4XX1A 3DMGA 1MHPA 2J3JA 4IEEA 1RTTA 4EG0A 5IDWA 4JXZA 1RKVA 3IQDB 3EMBA 2DH5A 4JKIA 4OTZA 2I87A 1PR1A 3DEZA 1GZ6A 2W9XA 1DFIA 3I39X 1AURA 1MT3A 1WRBA 3QLEA 4UJ5A 1JKMA 5CURA 4MLCA 5TMDA 4RSGA 3UKDA 1X1QA 3SYKA 5LQJA 2XADA 3FGNA 4QD3A 1ZQ9A 5MN6A 4ENWA 3PC7A 4JYBA 4BWGA 1T10A 3WLQA 5CCEA 3F6SA 1IVNA 4TXJA 3NHKA 3NWBA 5DMHA 3RU9A 1AZWA 2JKYA 5C7YA 3CX6A 4OX9B 1PDWA 4L1KA 5LUBA 3BZUA 3H1PA 4OXQA 5HFNA 3L0IB 3LKVA 4MQMA 4MIEA 4UAGA 3FPJA 4DR4B 2EBWA 1C14A 1Z0ZA 3N3BC 3VPBA 4FB4A 4UPEA 3BTOA 1M34B 1G3RA 2D59A 4QUBA 4G5QA 5AKXA 1RPZA 2Z08A 1SXJC 3OLYA 3BT7A 2WJ3A 5JDIC 2H1OA 3GEBA 1U28A 1Z16A 3F5FA 1T36A 4YAUA 1B14A 1H85A 1Z6TA 1NZDA 1MABB 2PXXA 4MQ4A 5I4IA 1J56A 5KDDA 5F7XA 1MBZA 3H97A 4BGEA 2C29D 3BFXA 2PJUA 2CBGA 4INPA 2ATEA 4RQUA 2RHCA 1BU5A 3KB1A 1UBFA 2FZCA 5BW8A 4X66B 4XH9B 4ND2A 4KTTE 2HFJA 1OVGA 1NY6A 4L3OA 4P08A 1H42A 4WLUA 4EFNA 3OQOA 1WMAA 2YJ6A 2QG9A 4BNDB 1KZHA 1E3EA 1EVLA 1QIDA 4CV0A 3G6WA 2D7CA 2GHQA 3GUCA 4KIWA 4DG8A 1DDIA 1X1SA 3L07A 3PYLA 5EZYF 1BN6A 2GB4A 3ONFA 1M1NB 4R83A 4WZAE 2FB9A 1E5XA 3QOYA 2PWAA 1M0SA 1ZOPA 5FKJA 3R7WA 4G4SP 4XCVA 4WKOA 1RJWA 4XWAA 4YN3A 4ZU6X 1BDMA 2FR8A 4WUTA 5FUYA 5T3YA 5TPZD 1Z38A 3AC0A 4HWSA 3TLYA 2DPHA 3E7DA 3H2HA 1IBMB 1JQ3A 1F4PA 3QW4B 1ENPA 4EB6B 5JYEA 3DZKA 2FG6C 2ZWOA 5DWVA 5FTLA 4FSXA 1HYHA 1G55A 1SQ6A 1ZNXA 3HYLA 4NONA 2O07A 5ALIA 2BBOA 2AC4A 2NOAA 3L7IA 4G2NA 3W1EA 1GVHA 2AQ8A 2J7PD 5EJ8A 4MW7A 1RLTA 2BMDA 1NX9A 4LYFA 4D5EA 3I01A 4R5HA 3UATA 2JFWA 4XIIA 3VAYA 1TIBA 4ND5A 3FF1A 4L07A 3UFXA 2QPOA 4CQMA 4FWTA 3BA6A 2Z2XA 4JELA 4U2DA 1ZI6A 4E4RA 1FXWA 4KE9A 2QN9A 4LY9A 4LRSB 5THKA 3RGGA 3KQSA 4CQMD 2IXTA 1KQOA 4N40A 3R5JA 2SCUA 3C3KA 2Q6TA 4JZYA 1B8OA 4MW6A 3KQLA 1N33B 4P81A 2H54A 1PJCA 1H93A 3H5VA 4N03A 1SQFA 3TLKA 1CEQA 1JT2A 3OBBA 4RMGA 2G83A 4J3JA 4KQJA 4E2XA 3FZYA 4Q01A 4QBHA 3BTVA 4HPWA 1WDMA 1GRRA 5G1OA 4QODA 1C3LA 4QKQA 5DDIP 1LC0A 3M49A 5BNZA 3KV3O 5JRDS 3ZVNA 1ESCA 5ALTA 3E82A 3EZ2A 3KKQA 3KVNA 4R8RA 3STXA 2IEZA 1R8SA 5TV2A 2QGZA 1XRRA 4ZOBA 4HYEA 3O94A 1TYCA 2JGDB 5FT9A 3VO1A 4P5DA 1WLYA 3M3PA 4UUOA 4RF3A 5KWSA 1K86A 1R3DA 4R4JA 2EZUA 4WACA 3LYLA 4DJFC 3IX7A 2RHHA 3RSLA 7AT1A 1IBRA 4I2NA 3L40A 1PFGA 5KTYA 1G3QA 2V0NA 4O8CA 2ZB4A 3AUKA 4TWAA 4D3ZA 4JQOA 1DDOA 3ZLVA 2XGSA 2PPVA 3CNBA 1FP7A 3DT6A 5AHRA 5GONF 3AY7A 2HZ7A 3AQ4A 3UCXA 4D96A 3WGJA 2A9QA 3PDIA 1YH3A 4CKXA 5IWCA 2W83A 4XYLA 3W9UA 2ZEJA 2HGZA 1HEIA 2BJVA 2MSEB 3IBSA 4CR8A 2CFCA 2YDXA 5FWNA 2C4HA 1NU6A 1E7QA 4V24A 1CUAA 1Q11A 2XRFA 3PVCA 3UAXA 4ZAVA 4BVGA 5J23A 2OCBA 2V58A 1EDBA 1UBKS 2GFHA 2JKVA 3L4SO 4P7KA 3KQTA 4P33A 2OBMA 3QEOA 4LECA 2GKGA 2AFRA 3UJCA 2W0SA 4QDJA 5EMMA 3ITNA 3PKJA 2EKDA 5KC8A 2WZQA 4X60A 4PBSA 3DPSA 1GNTA 1XZIA 3AR9A 5AK6A 3F90A 1YIAA 3OQJA 4PYQA 3NHJA 2NXNA 5HILA 1HTTA 2ZSHA 2YVQA 1ZIXA 2ZQZA 3A27A 4JDPA 2E4VA 2EHJA 2BHSA 4EA9A 3HXMA 3WRXA 4K81B 1GAJA 1D6NA 2E0IA 3DAYA 4RGVA 3WIVA 3K9BA 1J00A 2P2ZA 4JUIA 4F91B 1QGED 5I48A 1M7HA 5KYVA 3SVLA 4U2FA 5K3SA 4DA8A 3HR4A 3EHDA 1HL3A 1E3WB 2A5YB 3ZWOA 1Y6QA 1DC4A 1GCIA 2ZLBA 4J0FA 4B2YA 2VDWA 3ABOB 2ET6A 2OZLB 3NBZC 1FYWA 3I4CA 4QU8A 5K0EA 1ULZA 1XTUA 2O0KA 2XQJA 3BERA 1Q0PA 2QMUA 4R3NA 4Q0MA 1BDHA 4XD7D 2O7VA 1TLTA 4PSKA 1Y4AE 4PZYA 1U11A 4TLDA 3G7SA 1OYVA 4XYMA 2M1ZA 4ROTA 1PLLA 1TE2A 5FUBA 4XVRA 4BVKA 4C78A 4I36A 2FSSA 2O0HA 5DOZA 1NC3A 1OV4A 3H9UA 3IP6A 5HK8A 1YVDA 2FCAA 1JV2B 4XB2A 2O2EA 2YNMA 1UBJS 4H31A 4BFZA 4K9MA 3UJAA 1MA3A 3EGXB 4ZDJA 4PF1A 3DEIA 3JVUA 2YNMD 1B15A 3DG9A 5AHKA 5D51S 1RJ9A 3PICA 1AM4D 1FUKA 4QXQA 4OIFA 3HA3A 4FMCB 1IOVA 1RXUA 2PAFA 1J0CA 3ID6C 1ZVKA 1T29A 2DFDA 4Q15A 3TPFA 4US0R 4OXYA 4CLHA 1L5QA 1SC1A 4R40A 1XK7A 2Q3FA 4FGWA 4US2R 1LBEA 3QFFA 4AQYB 2QG6A 3D5EA 4WASA 1Z2DA 1YC5A 2PR2A 3A4VA 1SEVA 1YQEA 3A0RB 1YS6A 2Q21A 4US1R 3SXJA 4IBOA 3T9FA 4E5KA 3EXFB 1DG3A 4XLZA 3W79A 3K2IA 1DKMA 4Y6GB 3GEHA 4MGEA 3M6UA 1DAHA