2ANBA

Crystal structure of oligomeric e.coli guanylate kinase in complex with gmp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
206
Chain Sequence
AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 206
sequence length 206
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2anbA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2anbA01
4OQXA 1GM5A 2G3YA 4Q1EA 2C2HA 2QMHA 3KKMA 4MKFA 3HDTA 3GLIA 4JYCA 4WAUA 3NBYC 4KFTA 5DH9A 3TH5A 2VQSA 4CGZA 1R5NA 1SVOA 4LBWA 4V0ME 4BUJA 2IEYA 2UZ3A 3GLGA 2YOFA 2ZJ8A 2FFHA 4WOPA 2GAOA 2O0KA 1OH8A 1J70A 2Q3MA 1AN0A 2HYIC 2FF7A 2QEQA 1KI1A 1Z07A 4JLOA 3VNUA 5AJZA 1R2QA 1J8MF 1YZGA 1ZD1A 4MRVA 3W6PA 4BFWA 3LWNA 1XB2A 3ZVNA 4Q1CA 4TMVA 3ASYA 1E0SA 1YRBA 1TUIA 3IUYA 4LHXA 5L3RA 2ZE6A 1D9ZA 1G3IA 1OE0A 1U99A 1ZUHA 2PLFA 3MJHA 2D62A 1G8PA 3FYHA 1DAFA 1FQKA 3AF4A 4JL8A 2BM0A 4Q1DA 4QHYA 1GWNA 4LK2A 1ZU4A 4PZZA 1RRGA 4TYWA 1KI8A 5TY0A 1GNPA 2H7VA 4LJ7A 4Q4LA 2ZR9A 4DT1B 2Q3FA 5HCIA 3SNHA 4DC9A 3EZ7A 3EARA 1DAMA 5EXXA 1WBBA 4D4JA 3THXB 4R9UC 1CJTC 5JWOA 3ZQJA 2JA1A 4Q9JA 3VKHA 5GADl 2BMFA 4M1KA 3CLVA 2ONKA 2NO6A 3FKSA 1CKEA 2G0TA 3OHMA 4R2HA 1G5TA 5FUWA 4C2TA 3H84A 4DCUA 3BJIC 1NF3A 3GLHA 1XD2A 1X1RA 2I4IA 2H16A 2P3SA 4RD1A 4F4CA 2ONJA 1NLZA 3V4FA 3BFXA 3GPLA 2FNAA 4F38A 3GLFB 1KJYA 1H8EA 1PLLA 3AKCA 4QG7A 3UWKA 2Q21A 4HEJA 4AWXA 5J47A 4TZ0A 1K5DA 2W6JD 2MSEB 2QGNA 4HB3A 4ASUA 3A4NA 2RH5A 2ZRKA 3IQWA 1UKVY 3UMSA 3AVTA 1XX6A 4QJ5A 1VG0B 4QC2A 5D3QA 4N1AA 2NPIA 2I1VB 4UQOA 4UXIA 2ZI3A 2ZQ5A 5FR2A 1NN3A 1E1QA 3TGPA 1IOZA 3CF6R 5KO2A 1N0VC 5SZKB 4KO8A 1G1MA 1SKYB 2V6IA 1AZTA 3KKQA 4LWZA 1CRQA 3QKSB 2W2TA 5BW8A 1IQPA 5EUQB 3T12A 4E09A 1Q22A 4MKHA 3I72A 1N6IA 3PV0A 2J0UB 1HTWA 3L8ZA 3RWMB 3X1WA 4QNMA 5JECA 2QBYA 3IIKA 1I4DD 3QENA 2GA8A 3OIYA 1E1RD 2L0XA 3K0CA 3WYFA 3E5HA 1Q0UA 2FH5B 4KXFB 4QKQA 2QNRA 1RJ9A 5L3SB 3PEVA 1N6LA 1QHYA 1PV4A 4ZO4A 2WM9B 3RS4A 2P2LA 1Z3IX 4TT3D 4C0AC 2YWGA 1IN5A 3DMNA 2WSSA 1ANKA 4N3NA 1M8PA 4K81B 1G16A 1CJVC 1SVMA 1JALA 2R65A 2YJTD 4LYHA 1JEEA 4QBGB 4C0BA 1P73A 4KVGA 3RS7A 5DISB 1BKDR 1BO6A 1M6NA 3TIFA 3X1YA 2BCJQ 4AYTA 3U7FB 3EAQA 1N5JA 1Z2CA 2ZRDA 4LBYA 1BIFA 3C8UA 5J4VA 3RVBA 1QHXA 3K9GA 1KI4A 3MWKA 2QU8A 2P5TB 5EXPA 2FU5C 1XEXB 2V7QD 4QGHA 4ERNA 5C1BA 4PO9A 2B92A 4KFSA 2ODBA 1KSGA 2OCPA 5TB5A 2P0EA 2ZS7A 2R6CA 3R9XA 1SXJA 3ZH9B 4DIEA 2DB3A 4EUNA 2PJZA 3B1WA 4KLZA 1Z2AA 3U60B 3VKGA 5F98A 2O8EA 3OEED 4QJ4A 2VEDA 1AA9A 1CR1A 1OKKA 2WWIA 3H0KA 4HATA 2XEXA 2RAPA 4AD8A 4A6XA 4DLTA 3R9IA 1SVWA 1YR9A 3T5GA 2VH5R 4NCKA 2IXGA 3UKDA 1XTRA 3PVSA 3THWB 2ASEA 3QF4A 3ZZUA 5JS7A 1Z08A 3KB1A 5G3YA 1VKJA 4G5QA 2ZJZA 1ZUNB 1GKYA 3SU8A 1G17A 1EFHA 5G3ZA 4QBIA 1XXHE 4LV6A 4CIDA 3K70B 5CYPA 1OFHA 3ZLJA 1ZIOA 4ZCLA 4EJSA 3GFTA 4MUAA 2IK8A 4KHZA 1OFIA 3PJRA 4FCWA 2IUSA 1IN7A 3RC8A 1FX0B 3PEUA 4JSYA 3RANA 2GXSA 2OBLA 1PLJA 1A82A 4G01B 3ZD7A 1GOTA 4GZMA 1A4RA 4UNNA 2XGJA 3SBEA 4KI0A 2WWFA 3DVLA 4ZPXA 1KMQA 2VHUA 1KIMA 3H4MA 5DLQC 2CLCX 5DO9A 2DFTA 5EE9A 2IHYA 3TBKA 4DDUA 2UZIR 5CDFE 3EC2A 4M1WA 1OH6A 4M4SA 4GOKA 5FOTA 1RYHA 2B8TA 2ZR7A 3KJGA 3KTAB 4LHYA 5EP2A 4DKXA 2ZE8A 4KFUA 1JQLB 3LLUA 1NBME 1F2TB 1JAHA 4Q7LA 3E70C 4JBXA 2V9PA 2XOKA 4PANA 2H92A 1JXMA 1IN6A 3EX7C 1DAKA 1W1WA 4I99A 4IKEA 3IBYA 5FTLA 3VR3A 3VQTA 5J4HA 3I62A 3TSZA 2AD5A 1G6OA 3CPEA 4LJ5A 3NXSA 1Q1ZA 5EJEA 1K8RA 2ZJ2A 2F1HA 1AZSC 3P20A 4IXNA 4OK6A 3GJ0A 1ZM3A 2PCJA 1DO2A 4Q00A 2IUUA 4DLXA 1J90A 1GITA 3ZVMA 2XJ4A 1E3MA 2XZOA 1OFUX 4C0JA 5LBIA 4HUTA 2C78A 4UNQA 2RB4A 5AJYA 2A7QA 3W5IA 2P6RA 3JVVA 3CZPA 1OIVA 3LO5A 4URUR 1OHHD 3FDIA 2GCOA 2AR7A 3CWQA 3AF0A 1MABA 2YVUA 4MUBA 4BPBA 1EFTA 5FPHA 4Q4HB 1P9RA 3FVQA 3C5HA 4PC2A 4C7OB 4I1SA 4PQRA 3EWAA 1S4QA 1XBTA 2G1KA 1E96A 4JBWA 2IYZA 5TDHA 3V9PA 4PC7A 1GL9B 3VNVA 4O3MA 4FD2A 3UATA 5AJVB 1COWA 4IDNA 3PG5A 4NHOA 5EE1A 5IK2D 3PEYA 3WBJA 3QBTA 1OH7A 1B23P 2YHSA 4TSFA 3VMFA 5JLJA 2J7PA 3O8CA 1TF5A 2NIPA 1FW6A 1SVKA 2QORA 4MGZR 4WA7A 4KITB 4O2LA 5J4LA 2ECKA 2XJ9A 2DFKB 4IEEA 3RS0A 3W5JA 1EESA 4IOJA 2FOLA 4M2LA 2TMKA 2QGZA 4QBFA 3RYTC 3WNCA 5CM9C 3NHAA 1ZRHA 1II8A 2DPXA 1DAIA 4HZUB 3QPUA 4XTCS 1CF4A 3RS3A 1HT1E 3CIOA 2Q9AA 2CCGA 1NG1A 3LBHA 1EG7A 5FL7D 4DT1A 1G41A 3B9PA 3KKOA 4DUGA 1CXZA 1EFCA 1Q20A 4JLPA 4PPNA 3EXAA 2GETA 3SI7A 5J4KA 3PIRA 3C4JA 2CL6X 1T0JB 3ZZ0A 4O25A 1OW3B 3V00A 1FZQA 4TL9A 4JVSB 4BQSA 3B78A 2I3BA 4BGDA 4Y0VA 3QVUA 1G8FA 2C95A 3DOFA 4GT1A 3ZYCA 4IOMA 5EE0A 3GLFA 3T1OA 5E7JA 2CLDX 4HB4A 4D6PA 1MO3A 1S8FA 4R7ZA 4V03A 4CEJB 3WRYC 2IYWA 2OESA 2WIAA 1E2JA 3K8YA 4Q7JB 5FI0B 3RAPR 2ZR0A 3IKJA 3S1AA 4BLSA 3Q3JB 3A36A 3UANA 3AVVA 1C9KA 2GHIA 3J81k 1UBEA 1N6PA 1YVDA 3K53A 3UG7A 5JBQA 1P75A 1ZINA 1ZVQA 2H57A 3ADKA 3RC3A 2XB4A 4NE2A 5JJKA 3AKEA 1GTVA 2PLRA 1VCMA 2QAGB 3FPAA 2GF0A 3T61A 1Z0JA 2V7QA 1LVGA 1NVUQ 1EX6A 3BFVA 2YWEA 4ACAA 1E2FA 4B74A 4BZQA 1XF9A 2GZDA 3WRXC 2C77A 2J0UA 5C4MA 1QG2A 1F6BA 3NEYA 1NIPA 2DFLA 2GVZC 1JECA 2Y8EA 2ZE5A 1TF2A 3W34A 3I4LA 4BFSA 1NKSA 2DWPA 2QSZA 3OEEA 5F2EA 3DOEA 1QHNA 2NO1A 2OCYC 2P6NA 2WJHA 2VHQA 3E2IA 3Q5DA 4R2IA 4I81A 1P7CA 1E4VA 1IY2A 4TMKA 4TQUS 1W2HA 1Z6XA 1ZIPA 4KYIB 2WWGA 4LHZA 4Z8YA 1N25A 5L3SA 3AVXA 3GEHA 2J0QA 4H9GA 3QXHA 2QA5A 5TXGA 1CTQA 1TQ2A 2RHMA 3BFKA 2FSGA 3CPHA 2RHDA 4QNRA 2SHKA 4AIIA 2IS1A 1WB9A 1E79A 3FMOB 5JCZA 3SOPA 2A5YB 2WWYA 1OYWA 2OZEA 3LX5A 2YKGA 2WAXA 4JLMA 2ZANA 5BYKA 3F8TA 5JEDA 1AQUA 3PCRB 1HYQA 4AK9A 1EFRA 3I5YA 2PZEA 1UPTA 4M1OA 1SVSA 4DLRA 4RJLA 4EPXA 1ZJ6A 1U8AA 4BZPA 2R9VA 1Z83A 2DWOA 4G5SA 4GMXA 1XEXA 3QKRB 4JIMA 1A2KC 4OL0A 1XWIA 5DGXA 3RSLA 4TLEA 1WCV1 1KY3A 4ZCIA 5BWMA 4TWZA 1ZD8A 3CWZA 5DE3A 3VTKA 4DDVA 4PFSA 3A1WA 2OCBA 4GSYA 4XWAA 4JLAA 1Z0IA 1KI3A 4Q21A 1V5WA 3QPVA 3SJAA 2VP5A 4DLUA 4D2IA 1TNDA 4M9QA 1N6RA 2WICA 2R44A 2XTZA 2YC4C 3C7KA 4MKIA 4RVCA 4TN1A 3THWA 3EPJA 4PHFA 3ICEA 4EFNA 1G8YA 8OHMA 2CJWB 2ZYTX 1NN0A 4P4UA 3X1DA 1KDOA 5KSPA 2AHOA 5A5GA 1P6XA 421PA 3SYKA 5JEEA 3SJCA 2V4ZA 1Q1QA 2GJ9A 4TMZA 2CLSA 1T3HA 4Z8XA 2VP4A 1UKYA 3BH6A 5HR5A 3CPJB 2Z4RA 4YMWA 1FX0A 1UBFA 1UAAA 4L5BA 4OK5A 3JVUA 2C96A 4GL2A 1TQ6A 2ZU6A 2WTUA 4GBMA 1R0ZA 3NDBB 2EYQA 3LY5A 1O3YA 1VCIA 2A2ZA 4L15A 5FL3A 3KUCA 4KLNA 2C04A 4OYHA 3EZFA 3FKSD 4HYYA 4A4DA 3QY0A 1G21E 2X77A 3KTAA 3IDQA 1XTKA 2KSQA 1E6CA 2X8AA 2OFWA 4Y0AA 3MUFA 4W9MC 1PJRA 1H8ED 1N5LA 2VL7A 1F2TA 1IBRA 3B1ZA 3BGWA 1C1YA 4PHHA 1L4YA 2CHVA 1YU9A 3EZ9A 4P32A 4MRPA 3TW8B 5HZHA 1P2UA 2VPPA 1KO7A 4IDPA 2J59A 2D4HA 3OAAA 4ASUD 4FWIB 5ANRB 2WOJA 4C0HA 4TQ9A 1LW7A 1TADA 4A2WA 3LLMA 1Q44A 1BMFD 4YMUA 3X1XA 1DS6A 1WE2A 1TU3A 4LJYA 3TE6A 1N6HA 2D7CA 4JSTA 4AKEA 2IW3A 1W4CA 4QXAA 4C30A 5FH9A 1E1QD 1G3QA 2G83A 2FPMA 4TYPA 5C46F 2QN6A 3QKUA 4LV5B 4G5RA 1G3UA 2F1JA 5KOYA 1YR8A 1QHHB 3VHLB 1S2MA 1KSHA 3CF0A 4CT5A 2MMGA 2WIBA 4OQMA 2EYUA 3PENA 4HAZA 4IFBA 1U8ZA 5FBRB 2EW1A 1GNQA 2IC5A 3EIEA 5HTKA 3MWLA 3OF5A 3A1VA 1N6KA 2GDJA 4JVLA 5SZHB 4BFTA 3AUYA 3FMFA 1QHGA 4WIAA 1WP9A 3ZIAA 4A0RA 3NH6A 2HYDA 1IJFA 4TL8A 3IBGA 3TKLA 5KNDA 2QQEA 2GK7A 2VIIA 2FPKA 2D74A 2QTVB 3CNLA 2AD1A 2WJJA 3U61B 1V43A 4MYCA 2QROA 3HR8A 1KSFX 3LXXA 2WSSD 4JS0A 5JJLA 1S1CA 5CYOA 1QVRA 1XEFA 1DE0A 2JEOA 2PCLA 1OB2A 2F3TA 1JPNA 4D80A 1TTTA 4URZR 1LF0A 1ZC4A 1KKMA 4DCSA 3AKDA 1CJMA 2BMJA 3UWOA 3KQLA 4EIWA 3KQUA 4F93B 4HZUA 1U0JA 1HE1C 2YOGA 4BEBA 2R6GA 5HZKA 1AS3A 1CULC 4B2LA 2K5UA 2PH1A 1JJ7A 4MYTA 4PAMA 2O8CB 4JL5A 2CHGA 4B3DA 1E2QA 5FOXA 3QOFA 2NPFA 4A0GA 1SVIA 1AM4D 1KO4A 2V54A 4GNKA 4Q9HA 4NCIA 5KDLA 4LSGA 1SXJD 3SR0A 3ADCA 1LB1B 3TMKA 2KWIA 4UXHA 2Z4SA 2VHJA 3TR0A 1XZPA 4FW9A 5DIFA 1E32A 4OHYA 1Z5ZA 5JHHB 5GVSA 4BFXA 4D4LA 3U4QB 3CRMA 1JBKA 3TRFA 2GESA 4B2IA 1K6MA 1KSJA 1ZM4A 4EPRA 2JLWA 3K9LA 1T8UA 1WXQA 1FFHA 1XJCA 2HF8A 1JR3A 1VCNA 1A2BA 2ZSBA 4PO8A 3DO6A 4CEJA 3VX3A 5DHAA 1OLOA 1Z06A 2F43B 2F6RA 3L2OB 3Q7QA 5DN6D 1KO8A 2MSCB 5B57C 2VYFA 4JT4A 1OF1A 4B34A 4WBSA 3K9NA 4ZCMA 4LPKA 5FFMA 2VP6A 4IW3B 3LBIA 2NQ2C 5F9HA 4TYNA 2FA9A 4FI3C 2ZI6A 3W90A 3EIHA 3W6NA 1IY1A 1UM8A 4RZUA 4IOKA 1F2UA 4C4PA 2REBA 2BIFA 2JASA 2QAGA 3G82C 1HA3A 4PTLA 5AK0A 5DSZA 2MSDB 4MRNA 1DAHA 4B32A 1Z8FA 2JJ2A 4E07A 5P21A 4M53A 1AQYA 4KSCA 3GJ3A 3OIUA 2OCAA 5EXTA 2MMCA 1FMJA 1U9IC 3FMPB 1OB5A 1E99A 4ESHA 4US2R 4G3XA 4QM6A 3CB4A 4B76A 2VSFA 4A9AA 2XOKD 2ZAMA 3U3MA 1GFIA 4Q1AA 3QJYA 3MMPA 1KMHB 3U3RA 4BECA 2D06A 1U0HC 2ERYA 1ZNWA 1A1VA 4XSGA 2IYLD 4QHSA 4XSHA 3LFUA 4WW0A 2N46A 1ZAKA 4RFSB 1U81A 2GK6A 3ZS8A 1FOEB 3MGCA 4BEJA 4CF7A 3QG1A 1GILA 1OXVA 2EFCB 1U0LA 2R62A 4PZYA 1F5NA 1YJ5A 1XP8A 2B21A 3DZDA 2AWOA 2VSXA 4XVUA 3DKVA 1TUEA 3AB3A 1WBDA 1DBSA 1CEEA 4DCTA 3C41J 1ZNZA 1NMZA 3QEOA 1M2OB 2OFXA 3QKTA 2OHFA 1D2EA 5JCPA 3BC1A 1EXMA 2F7SA 3QKRA 2WWXA 2R6FA 1GUAA 2EFGA 4PPFA 1ZM2A 2B7BA 5KUTA 4CZ2A 3A1SA 2PZFA 1X86B 4K8OA 1COWD 4FCVA 4G1UC 1FPMA 5KU1A 1K5GA 5GJWC 3FWYA 1U90A 1S0UA 2QTFA 4Q48A 2BKEA 3K9HA 4DHEA 4PQYA 4TSFD 1KNQA 2GXQA 4XH9B 2J7PD 2ZRIA 2IA5A 2NOAA 2QM7A 1G7RA 1BMFA 1W36B 4WVFA 1Q1BA 2P5SA 3KKNA 4KSBA 2XTNA 5EP4A 1W5SA 1SHZA 4LC1A 4V0OA 5IF9A 3RWOA 5E3HA 3EG5A 1MR3F 5ELXA 3VKWA 3WNBA 4PHTA 3B60A 2NZJA 5GJBA 2G9NA 4BWYA 3AVUA 3FHTA 4JYBA 3TUZC 3SYNA 4PSVA 4DUGD 2ZS8A 1A5TA 2CBZA 3GLIE 4QJ3A 1QRAA 1R8SA 4XWOA 3EA0A 1Z6GA 3RABA 2A5JA 3FOZA 4RZ2A 2WJVA 3VU9B 5KSOA 3A4LA 2V8OA 2XZLA 3ZQ6A 2Z83A 6Q21A 1E69A 3EPHA 2ZI5A 2E87A 3GJ7A 2J5XA 1CR4A 1Z6AA 3GLGE 1E2HA 3JZAA 4M0LA 3KXKA 3D3QA 5TV2A 1BYIA 4MRRA 4GI7A 1KZ7B 5G53C 2PJRA 2JATA 3F5FA 3SHFA 4JLVA 2FEOA 3ASZA 1NG9A 5KSYA 3HU3A 3H86A 2LKCA 4A8JB 2QZ4A 5C18A 3B6EA 4F4IA 4WZ6A 2EQBA 4Q4AB 4LGMA 2F3RA 1HT2E 3CNNA 5IRCD 1VECA 1VYVA 1G5PA 3EIQA 2GBLC 1ELOA 1JPJA 3LQRA 2QI9C 4LI0A 3THYB 2C9OA 2NG1A 2V6JA 2I1QA 4K46A 4RFVA 5B2ZA 1N0WA 3N2IA 4NCNA 1JEDA 1T6NA 4OBEA 1QHHA 1KK1A 1RZ3A 1GRQA 2AL7A 3QPWA 1NNEA 1SVLA 1JXOA 4TLBA 3BH7A 4BE7B 2A5FA 4B3BA 2ZRLA 1ODFA 2O5VA 2AWNA 1XD8A 2YV5A 3HYTA 4PQFA 1FTNA 1T8TA 4WXPA 3DM5A 2XSZA 3CBQA 3KZ1E 3GLHE 1YRAA 3QI2A 1C4OA 1PZNA 1S96A 1VIAA 1NVWQ 4XTRA 3TJZA 4DLYA 2QT1A 1M7HA 1U98A 1KI6B 2WAYA 1HE8B 3R7WB 1YZUA 1IXSB 1FP6A 2OM2A 2VHCA 1M7GA 2ZRJA 5HCNA 1CBUA 5DN6A 4M8NE 4P4TA 5H8WA 4DCNA 1P72A 1YZNA 1LFDB 3JZMA 1E79D 2O8FB 1CR0A 1RE0A 1UFQA 1T91A 1ESMA 2HLDA 4IFEA 4NH0A 1XMSA 2HT6A 1L8QA 4N0EA 2VHTA 4U02A 5JRZA 4PHGA 3ADBA 1EFRD 3MWJA 5SZIA 4EPTA 4RZXA 3B1YA 2ZRMA 1SQ5A 2ATVA 4UJ3A 4R98A 3SC3A 4B44A 5DYIA 2IXFA 3LVQE 1E98A 4GPTA 4LJAA 3UK6A 3SHWA 1GAJA 2BV3A 3A1TA 2O8CA 1VG9B 1OH5A 2QM8A 4A82A 1P2TA 1DOAA 1KAGA 2JIZA 1X8JA 4IEIA 4U5XA 4C0SA 5G40A 2W0SA 1UKEA 4NP6A 4RD3A 4F92B 4B3XA 4EQ6B 5L8VA 3SQWA 5A4JA 4D25A 1NJGA 3CRQA 4CRWB 4OHVA 2GWHA 1FQJA 3FFAA 3SEAA 1NJFA 2J7KA 4IHQA 3U4QA 5EXSA 2ZRBA 2EFDB 1MRNA 2D7DA 1VG1A 4FIDA 4PR0A 3NIBA 1RIFA 2RKOA 1T5IA 3G5UA 2DCUA 1BH2A 3LAWA 2E9SA 1ZMXA 2F43A 4YMVA 1QF9A 5A0FA 3I73A 4IVQA 5G41A 3K09C 3L0SA 4JJZA 3K70D 4YXWA 1TQ4A 3X2SA 4E03A 3OEHD 2ZSDA 4XJXA 1TAGA 2J1LA 4DIDA 4DB4A 2GVDC 1KDRA 3SS8A 3W3ZB 1WDTA 4OQNA 1CIPA 5FI1B 4GP7A 4HDOB 1II0A 2IYTA 2JLXA 3IIMA 1R0XA 2KB0A 4YMSA 1PLKA 1CU1A 4NONA 4NZYA 5FTJA 2VF7A 3MAAC 2ERXA 3QBVA 4W5WA 3QE0A 3NC1C 1KOFA 2GCNA 2OE2A 1QHIA 2YWFA 3LNCA 1NLYA 1T4GA 1T9HA 2IYRA 2QRNA 1DG3A 5BYJA 4A92A 4NYMR 2ZJAA 4YDSA 2V1XA 4US0R 4TTPA 5AUQA 4NYJR 4TLAA 4ZKEA 2BEJA 3KJEA 3DEFA 4HLQB 5TARA 1E2MA 3MRSA 3NTUA 2IWHA 4E22A 4Q5IA 3VR5A 3DZ8A 2OAP1 2C9YA 2ZUCA 2EWVA 3D8BA 2VF8A 1GKUB 2EVWX 3TAHA 2FWRA 3B8HA 3FHOA 4GMDA 1KMHA 3AVWA 3OAAD 5L3QB 5AWFC 3LW8A 4XD7A 4UNRA 2BC9A 3LDAA 2FZLA 3MCAA 1I2DA 2W0MA 4MH0R 1HY3A 2W2VA 3FB4A 4Q19A 4RFSA 1KHTA 3A1UA 2GEUA 2QTHA 3AP3A 1NL3A 1U94A 1BOFA 1NLFA 2W58A 3TUJC 3BORA 5BQ5A 1CS4C 4XVQA 1YQTA 1R8QA 1YZTA 3IPXA 4NMMA 2X1VA 2ZTSA 4RD2A 4CW7A 3THXA 5BXQC 4NCJA 4TYQA 2GF9A 1MOZA 1MO6A 5FOSA 2PX3A 3RRZA 1DPFA 3SQXA 1SGWA 3VR1A 2QPOA 4PC1A 2RGNA 2EFHB 3ZIAD 4I4LA 3NDPA 3U7EB 1VPLA 2IYXA 4IVRA 2CL0X 3MJRA 2IYSA 1E9AA 4QM7A 3SJZA 2BMEA 4IDQA 4XWKA 5AR1A 2IWRA 3B13B 5JWRA 1LS1A 3AKYA 3ZZTA 1T3SA 1W0JA 1Y63A 4CVNA 1GL6A 2HXYA 4CYMA 1ZD9A 2ZYVX 4B6EA 4PAOA 4B3FX 5EE5B 2WWHA 1FNMA 3W9YA 3LQQA 4YDHB 2C5LA 4AYWA 4Z1MA 2A3RA 4RKFA 3NVAA 4DLVA 2H1LA 5CB6A 4XOIA 4UXJA 1XTQA 5KTYA 1P4SA 4ZKDA 4CEHB 3GCGA 2E1RA 3QKSA 4HAWA 4HLUA 4LYFA 2W00A 1UDXA 2XXAB 2JLUA 3DMDA 1RRCA 2A30A 2HJVA 3T1VA 1PUIA 1XMIA 1OXSC 1H65A 3K0CC 3ICQB 2R6AA 1KDPA 1DTSA 4IRUB 5FBWB 1ZM7A 4OQFA 1OPXA 3I8SA 3RRNA 1G5RA 3RDPA 3VU9A 3GP8A 5BN4A 4PO1A 3TNFA 3Q72A 2V1UA 2C99A 3PXGA 3RLFA 1YR6A 4QBHA 2JGNA 3RHFA 1PUJA 3GLIB 2WWWA 2FEMA 3U2QA 1KYIA 4P3YA 4LV8B 1TEXA 4DRZA 1JR3D 1E9BA 3CX6A 5KNCA 2RMKA 4V0NA 5E95A 4KV9A 4A8JA 2LCFA 4HB2A 4QOSA 4ABYA 1S9HA 1WF3A 4Q4AA 4Q9LA 3SDZA 2XB2A 1G64A 2FPLA 3MG9A 1XMJA 5H1YA 1Q57A 4IDOA 2ODEA 1KI2A 1W4BA 3T35A 1RC8A 1I4LD 3WXMA 3THYA 3TK1A 3R20A 3T34A 2GJAA 1ETUA 1G6HA 1SXJC 4TL6A 4PZLA 2ZJ5A 4J0QA 2FV8A 2BDTA 3L8YA 2VP2A 5EQTA 2Q0HA 2RGCA 3O47A 4P31A 4DWJA 4TYYA 2JJ2D 2ZSAA 2ZUDA 3DL0A 2OFOA 2WJIA 4L16A 5CJPA 5DYGA 4ZDKA 1XPRA 1E9EA 1KO1A 3OESA 5K8TA 3LX8A 2A9KA 3NBXX 2BBOA 1CLUA 4B35A 1N2CE 4BRWA 5KNBA 4O2RA 1UEIA 3GLFE 3WYGA 2ANBA 1VYTA 4HAUA 5DI9A 1G19A 2DR3A 1KI6A 4AKGA 5J4YA 2C8VA 2GEDA 2J9RA 3CX7A 4EJSC 3K0EA 1IHUA 3GLHB 4FXPA 3U3OA 2JLYA 4JVMA 3HP1A 4EPVA 4B47A 1L7VC 2ZJBA 4M21A 1AKEA 3GJ8A 5FUXA 5J5CA 2W2XA 3OEHA 2IYYA 4L9SA 2ATXA 4Z51A 2O8FA 1MO4A 1LNZA 2OBNA 1D2MA 2ZYWX 4ZI3A 4R71A 1SKYE 5M04A 1WMSA 3SFZA 2BBSA 4L8GA 4X8LA 2X2EA 1XXHB 1R7RA 4BRUA 3GFOA 2QUZA 3T5DA 2IX3A 1IN4A 1Q21A 1P9NA 4BLOA 2AK2A 2GJSA 1KO5A 2WBLC 5LB2A 3CKLA 1G8GA 1NVVR 1UADA 3HWSA 4V02A 1S1MA 2QQ0A 4W7SA 1OT3A 5IDVA 1J2JA 5B58C 1Z0DA 1II9A 1W4RA 5E4FA 1NSFA 3I92A 2Q9BA 4Q66C 2OEPA 4DZZA 1R10A 2OXCA 2HJGA 2WPDA 5LD2C 2PMDA 4GDFA 3NBFA 5IHPA 4GZLA 3C5CA 1N5IA 2CCKA 4I1UA 4LYJA 2ZI7A 4POAA 3T06B 1P2VA 1XPUA 2FFBA 1OIXA 4LBVA 1D5CA 2IYQA 3SN6A 5GJVC 1Y3AA 1IM2A 2PEZA 4LRWA 3P32A 4H1UA 1YZLA 1YR7A 1OXXK 3AP1A 1E9DA 2EFEB 2CDNA 3M1IA 1OV4A 4QGFA 2PL3A 3B2EA 3LBNA 2J0VA 2VP0A 1AKYA 2HUPA 3PUWA 5JHGB 1RRFA 4URVR 3HR7A 4FMBB 2FJUA 3GD7A 4Q4HA 4DLZA 4CEIB 4C7OA 3QG5A 1CR2A 1RYFA 2F9LA 2A5DA 4MGIR 1E2NA 2XNSA 2H8KA 1E9CA 1G20E 1E4YA 3L82B 1E0AA 4BLQA 5KDDA 4PC3A 2GZAA 1IXZA 1M1YE 3KDSE 2H18A 2BJWA 5FBLB 1I2MA 2G88A 2CVHA 4RD0A 4DJTA 2CK3A 1LTQA 5GVRA 3A4MA 2AFIE 2O8DB 1UJ2A 2GJ8A 3A6PC 5CB8A 1FL9A 5L3QA 2DFNA 5JI3E 2FGJA 4V0MA 4C2UA 5AUPB 3VFDA 4C0LA 5JRJA 3U3JA 1YKSA 3ZD6A 5K8UA 4KAXA 5IK2A 4D4KA 1NIJA 1Z6YA 3OZXA 4LHWA 4X8MA 4RCZA 4FCTA 2RGDA 4ARZB 3Q9LA 2LKDA 4RKEA 2ZM5A 1NY6A 1YZKA 3IO5A 1QG4A 3K0FB 1VIYA 1ZM9A 3BH0A 2ZSEA 1E2KA 2IF0A 4DEYA 3RSOA 1FUUA 3KQNA 4A0HA 4KYUA 1NSTA 2GXUA 4MGKR 4AI6A 1JJVA 2FE4A 3PITA 4RSGA 1LF5A 2KBFA 4JT2A 2XSZD 1LS6A 3AQ4A 1UEJA 2CVFA 4BLRA 4JKYA 3RS2A 3AP2A 3HU1A 1M34E 4Q4JB 5LPNA 5EZ5A 1IONA 2O8BB 1MRSA 3R8FA 4BFUA 3GMTA 1G4UR 4XVRA 2GTPA 3CNOA 1UKZA 3FMIA 5H68A 3QNUA 3KJIA 3B5JA 4G5GA 5H70A 1NVXQ 2AFHE 3NBZC 5FUVA 2BKUA 2ZITA 2GJKA 1W0KA 1W7AA 3ZS9A 2WZQA 2HLDD 3A37A 4DB2A 4HLUC 3R9WA 2BVNA 3E1SA 4LJ8A 4DVGA 2R8RA 1NN1A 2F1IA 4D0LB 5CK5A 2GZHA 4MGYR 4HUQB 1QDEA 4HSEA 2LWIA 2WMNB 4Q7MB 4OQLA 4CEHA 2XITA 3CO5A 4DXAA 1UDWA 5HPYB 1ZCAA 2XXAA 3VAAA 4URXR 1PVOA 1KY2A 3IEUA 4IOLA 1OSNA 3LD9A 5E7IA 1JQJC 2BJVA 2JIZD 4BZXA 1SZPA 2J87A 3AGPA 3L0OA 4JZKA 2PBRA 3BERA 1XRJA 3O8BA 4RY2A 4W5HA 3T1QA 3DHWC 1EGAA 2IF2A 4LJ6A 2HDNB 3EPKA 1NI3A 4NYMQ 1R0YA 2GCOB 2NGRA 2ZI9A 4HAYA 3B1VA 4NYJQ 4YC7A 3VX4A 1OYYA 4PSKA 3KXLA 1JR6A 1ZNYA 1VG8A 3GFPA 3GJ6A 1W44A 4EFLA 1XTJA 2OBMA 1KZGB 4LY6A 2IHBA 4TL7A 5HKKA 4OHXA 4TLCA 2QPTA 1US8B 3PUXA 4OJKA 3O8RA 4AG5A 1DARA 2JLQA 1TPZA 5FOUA 2VSOA 1WA5A 4PC6A 5EUMA 4LBZA 4YXWD 4Q47A 2AN9A 3REFA 2HF9A 1P2SA 3F3YA 3L43A 4IVPA 1XJ0A 1GVNB 1UF9A 3OIWA 2ZRHA 4KBGA 3WP0A 1J8YF 3WNDA 3IIJA 4EPYA 1G3RA 1T0HB 1N6NA 4LZZA 4C0QC 4D0NA 4DCVA 2IS6A 4AC9A 3MD0A 5E7MA 3U44B 4JLBA 4HI0E 3AVOA 4B2PA 2D2EA 2YOHA 1II8B 1TX4B 4II7A 1P62B 3BB4A 4M9ZA 4OJQA 3BRWD 3UG6A 4TQAA 4CT4B 1F60A 2AX4A 1MV5A 2WKRA 3DKPA 4I1OA 4XIGS 1AS2A 2DWQA 4L9WA 3U3KA 5JSZB 3CRW1 4PAQA 3BOSA 1U8YA 1S3SA 2OUKA 4GOJA 3WYAA 4FWTA 2ZEJA 3EW9A 3SE0A 4B75A 1JR3E 2CXXA 2OLJA 2QMUA 3K70C 3K0SA 1RKBA 1GP2A 3D7MA 1X8LA 3LV8A 4XD7D 1E9FA 1Q1EA 2A5GA 2C9CA 3C15C 3SZRA 621PA 1HQCA 4FMDF 3BAFA 2CJWA 5CITA 3DDCA 3T1TA 1LY1A 1E0KA 3QXCA 3P26A 1ZC3A 4A6PA 4Q02A 3U7HB 4JKIA 1H8HA 3FTQA 2WMOB 2QP9X 4PX9A 2OILA 2RGGA 4DLSA 5FPKA 3UMRA 1EX7A 3S1AB 1VCOA 4RZ3A 1RVDA 4BFZA 4EKDA 1L4UA 3QXJA 2ZU0C 2J0SA 4TMTA 1E94E 2VP9A 1Q12A 3T15A 2FDCA 1XXHA 2YYZA 4BFVA 4HAXA 4M22A 2GAAA 3GQBA 1D6JA 3BD9A 3VR2A 2FSFA 2AKYA 2G1JA 4NDZA 2YC2C 2C03A 3P1JA 4NYIR 1VYUA 4N0DA 1GZSA 521PA 2R6DA 3EPLA 1P3JA 1DG1G 2VBCA 3OIVA 4WXRA 3Q8XB 4UKDA 3CF2A 1W4AA 2J41A 3EA5A 3BK7A 1FTSA 3TSWA 4QGGA 1J99A 3CM0A 3TW4A 1DO0A 1W0JD 4AG6A 2QSYA 2ZXUA 1ONBA 2Q6TA 3CONA 5CDFA 2QP4A 5CIWA 1Z28A 3BB1A 4ZV4A 1KGDA 5SZJA 1NY5A 4EFMA 1W36D 4LDJA 1NBMA 1EK0A 4Z1MD 3IHWA 2REOA 3ONWA 2WOOA 3NHBA 3KQKA 3VR6A 1DAGA 2XNDA 1P9WA 3A8TA 1KK3A 1N0UA 2CHQA 3QUSA 1KK0A 3QVVA 4MQBA 2QP3A 4MITA 2ODWA 4KVAA 3KKPA 3HYRA 2JAQA 3I3SR 3OE7A 3SYLA 1F48A 4TLDA 2FSHA 1XCGB 5KSZA 2YWHA 4CEIA 5LDDC 1Z22A 5JI2E 4ON9A 3F0TA 3DM9B 3H1TA 3CW2A 4LPSA 4W5JA 1WQ1R 4OI1A 2HT1A 4AYXA 3PR1A 3VHXA 1OXUA 4ZIRB 4NTZA 4QFMA 5D3MB 2WJGA 1E9RA 2IL1A 4ZDWA 1P5ZB 2JJ8A 4X8OA 4TTRA 1GSIA 5JFGA 2JLRA 2CEAA 1R5BA 4O0MA 1E2DA 1BYUA 1KK2A 2QG6A 3RS5A 2ZRGA 5AJWA 5JMTA 4ACBA 1AGPA 2HCJB 2JDIA 5KPDA 3B1XA 4C0KA 2O8DA 2B7CA 4B6FA 2H5EA 2OAQ1 1GG2A 1OFTA 4FINA 1P60A 1XPOA 1HQYE 3CH5A 1LV7A 4U00A 1NN5A 1IJEA 2ZRCA 4MA4A 2NMVA 2FGKA 2AK3A 3ADDA 1XEWY 2W6ID 3KUDA 3WBKA 5FOWA 1EWQA 1QHSA 4P33A 5CLLA 4A0FA 3NC0C 4ARZA 4DBLC 2DBYA 3LVRE 3HPRA 4M1TA 3K0FA 4B3GA 3CZQA 1VHTA 3CR8A 5FUYA 2JCSA 3GJ4A 4PPGA 4LC0A 1Z0FA 5CIQA 4MRSA 2QE7D 2P6UA 1G9XA 3BE4A 1VDZA 3BB3A 3U6BA 3A58B 1XCPA 2WKQA 4G5OA 5FPTA 1G7TA 2ZRAA 3MLEA 1JI0A 2BBWA 1NVVQ 1R5OA 3TSOA 1QVAA 1MT0A 1XNJA 4Q4JA 2O8BA 1X8KA 3D31A 3M4YA 1GRNA 2OXRA 5HE9A 4F7WA 3K0AB 1ESNA 2ZI4A 5FPSA 1S9DA 1S3GA 5BN5A 1T5LA 3KL4A 2BOVA 5GJCA 3THOA 4JBYA 1ZUIA 4LYAA 3KB2A 3X1ZA 2QAGC 2DHRA 4Q9KA 4EPWA 4TMWA 5FTMA 2ZS9A 5K8LA 3LXRA 3QF7A 4HUQA 1I4TD 1GRRA 1R4AA 3AF2A 4JJKA 4M9XA 2VO1A 3WMFA 4LUCA 5C2JB 2A78A 3AVYA 1UBGA 1SXJE 1AS0A 2O52A 2EU8A 2RGEA 1DEKA 4Q1BA 4DSOA 2J46A 3IEVA 1XFAA 3REGA 3I61A 1KKLA 3ZVLA 3RRMA 3P27A 4V0KA 2X2FA 3W8RA 2CCJA 4D4MA 3ND8A 4MKGA 4KODA 3AV0B 1R0WA 2F55A 2BMDA 4KFRA 5FPYA 3I8XA 5AUNB 4ZI2A 2WPDD 3AGQA 1UBCA 3P4YA 3PFIA 4WZAE 3TR5A 1GL7A 1HURA 1O87A 3KFXA 2ORVA 2CL7X 3H2YA 3PUYA 3TQCA 1US8A 121PA 2DYKA 3Q5EA 3ECCA 1RW4A 5UKDA 1XEWX 2ORIA 2ZRFA 3PUZA 2IUTA 1XDBA 3FGNA 4HLCA 4YQFA 2W6JA 4US1R 4DDTA 3FHCB 5KYKA 4B73A 3U5ZB 2O0JA 3FE2A 3AH8A 1G8HA 1FUKA 3C16C 1Q3HA 2Z43A 3UPUA 2OG2A 4S35A 3UIEA 3U44A 4LJ9A 1ZBDA 4IDHA 5KHOC 2NTYC 2V55B 2OO7A 5TVKA 2ZIAA 2CE2X 3MSXA 2GEVA 4JLJA 4BLTA 2ANCA 2GRJA 4M9SA 3TVTA 2V3CC 1G7SA 2EWWA 4FN5A 4Q18A 5DHFA 5JSZA 4DEXA 4I1VA 2G77B 3KX2A 2CK3D 2FN4A 2ODNA 3I32A 4URYR 4M1MA 4A36A 1QZXA 1IAQA 4QRHA 1JB1A 1ZNXA 3ZGXA 1E1RA 3N70A 1DAEA 5CLQA 2P65A 3OFND 2DY1A 5DI3B 2X19A 3EWSA 1KI9A 2FG5A 1HEIA 4BASA 1RFLA 1D8TA 1G7CA 1KI7A 1XU4A 4TT3A 4NCHA 4EAQA 2CMKA 2JJ1D 4ZDIA 4ESVA 5BN3A 5EZ6B 1Z6TA 2WKPA 2NO9A 5F3WB 2QT0A 1HV8A 1XD9A 2PZGA 2PT7A 4B48A 5KDOA 3I5XA 1KDTA 721PA 1Z0KA 2P67A 3UXMA 1CP2A 4JLDA 2OLKA 1NRJB 3CUEF 3NG1A 4B43A 2YINC 4L4UA 4P4SB 4PXAA 4DSUA 3TUIC 1F2UB 2YZ2A 4C3ZA 4UNPA 5TMPA 3EZ2A 1G18A 1TF7A 1XMVA 2ZAOA 3IO3A 4ILEA 1EWRA 2CNWD 2GILA 4PPQA 5DNYB 4FMCB 1RPZA 1BS1A 2PX0A 4OI4A 3W6OA 1W5TA 4MDFA 3O8DA 3VR4A 4OI2A 2GNOA 1KTVA 4U7DA 2UKDA 3GLGB 3CR7A 3R8CA 3ZVRA 3WP1B 3WMGA 1W0KD 2D3WA 4LJ4A 4GRAA 3G0HA 2KJQA 1KJWA 1J7KA 1OIWA 1U9IA 2W6IA 1E2IA 3B7GA 5FBVB 4TTQA 1D9XA 3KXIA 3CX8A 5KPJA 3W8NA 4TMXA 4D0GA 1VMAA 3C14C 3CRRA 3ZJYA 1M74A 4NBSA 2UVQA 2W83A 5AJXA 3EC1A 4ITRC 2AKAB 1N6OA 2QE7A 3PEWA 4D82A 1Z0AA 2BHRA 3WHLA 2FSIA 2NZ8A 4UJ5A 4UNSA 5B30A 1E0JA 3CRVA 3U6KA 1NP6A 1P61B 3UMFA 1FNNA 4YLGA 4RD4A 3QIAA 3ZDQA 4ZIRA 5D3MA 1W47A 2XZPA 4LHVA 2IYVA 2FX3A 4NU0A 5B64A 2RGXA 1NMYA 3R7WA 2IEZA 2IS4A 1AGRA 2QMOA 3BBPA 3MWYW 4DDWA 4Z54A 4OK3A 5HKKD 2VRWA 1XD2B 3DPUA 2F1RA 2GCPA 2BM1A 3EASA 3D6TB 4BFYA 1ZCBA 1N5KA 3KJHA 4M1SA 5EP3A 2N42A 5FOVA 2PEYA 3M6AA 1XTIA 3Q85A 1Z63A 4B3CA 2KI5A 3IILA 3PQCA 5AUOB 3M0EA 5CK4A 3TAUA 4FMCF 1GNRA 3TQFA 5JWHA 1YE8A 2WSMA 4DLWA 4HDCA 2XX3A 2WHXA 2FMXA 2GKSA 5LB4A 4F4JA 1G4AE 1TQDA 2WJYA 3IHLA 1Q3TA 1GKIA 1MKYA 2G6BA 5FR1A 1T3LA 1OJLA 2WVJA 3W3AA 4IJMA 1QBKC 5CJ2A 1N3BA 5EP1A 3ND9A 2RCNA 4KCGA 1IY0A 2O0HA 4HB0A 4EQ6A 2NO7A 1KNXA 3QXSA 4LCBA 1OHHA 4D26A 2HCBA 3LH5A 2IYUA 1E9SA 1L2TA 2OV2A 3L0PA 3IPYA 1GDDA 4JVNA 4NYIQ 4AURA 4KBFA 1IN8A 4Q7KA 4E5UA 1AJEA 2QBYB 1E2EA 1W49A 4JMPA 2IXEA 1SKQA 4GFDA 2OT3B 1DELA 1X6VA 2ZROA 1A7JA 2BWJA 3K0AA 4GOXA 4BLPA 2NO0A 3QEJA 4DSNA 5JJIA 3AF3A 2JLSA 1RJ9B 2FZ4A 1ZYUA 4URWR 4WZBE 4CDGA 3WY9A 4A15A 4RCYA 2WV9A 5K8IA 1H8HD 1GIAA 1ZU5A 4D81A 4AY2A 2AXNA 4KJZA 2RGBA 5F9FA 1Z29A 2QY9A 3GEIA 2FFAA 4Q9IA 1KJZA 2HV8A 5CM8B 2OSBA 1XZQA 3ETLA 4Q01A 2IT1A 4H1VA 4Q03A 1U2RA 2QPAA 4MDEA 2ZSFA 4F91B 2GBLA 3V4RA 3LA6A 1KAOA 1X3SA 1TEVA 2J3EA 4MYHA 5FL7A 2PT5A 4DSTA 2PMKA 1OXTA 2ZETA 4A2PA 1W48A 2ZVQX 4NPHA 2XTMA 1F3OA 4JLKA 3RRYA 1SXJB 4P0TA 2IBMA 3Q7PA 5IT5A 2YNMA 2J45A 2AXPA 4LOAA 1ZW6A 3SJBA 4X8HA 3B9QA 1YZQA 3TVDA 1G291 2ZRNA 1AIPA 3K1JA 4A1FA 2Z0MA 2JLZA 2O8EB 1JAIA 3L0IB 3OFNA 2ZVPX 4ZDJA 3BS4A 2KBEA 4PSAA 1NBMD 3B82A 821PA 4JLNA 1Z47A 2ZE7A 3GJ5A 4IXMA 4JL6A 2QL6A 3QF4B 2JJ1A 5FBQB 4G0NA 3AUXA 4MYUA 4B33A 3U7GA 3I1FA 2XNDD 1NMXA 3GJXC 3B85A 1HUQA 1IXRC 3HPQA 2VA8A 3BXZA 4HZIA 2HXSA 1TMKA 1NKTA 2QRZA 2BBTA 1AK2A 3AVQA 3BIFA 3AM1A 2IS2A 2KE5A 4C9BA 2GXAA 3CH4B 2B8WA 3OE7D 2G0NA 3MFYA 4EJSB 1DADA 1VTKA 2N1BA 5JZVA 4YMTA 2QENA 1FP7A 1M7BA 1MH1A 1TU4A 2RGNC 2VTKA 2Q3HA 3QSYA 2Z5FA 2ZJOA 2R2AA 1CJKC 5C4GB 4HAVA 4A8JC 1TL7C 3AVPA 2C98A 1MO5A 221PA 4GP6A 4OKSA 3PUVA 1HH4A 1DVRA 2QAJA 2CNWA 1R6BX 2B6HA 4NL4H 3LW7A 3GEEA 2ZRPA 3LRPA 2BCGY 1ZP6A 1W36C 3WHKA 2CE7A 3AEZA 5FTKA 3HJNA 3NEJA 1X1SA 4QGAA 1VHLA 2JDID 4HDQB 2BEKA 3SFVA 3TLXA 4NKRA 2HEIA 2XAUA 1CJUC 1G3MA 2RGAA 3RNLA 3QQ5A 2JLVA 1SULA 2F9MA 1WRBA 3SBDA 1XJQA 1E2LA 1B0UA 1XTSA 2ZREA 3IQXA 4Q1FA 1XCMA 3HU2A 1OKKD 1JNYA 5DI3A 4AKIA 2ORWA 5JS8A 4V0LA 1YHNA 3N2EA 4QL3A 2VLIA 3KFVA 4OI0A 3KQHA 2H17A 2Q9CA 3QXXA 4OHWA 3N5CA 4A2QA 4TZ6A 1W46A 4RD6A 3FFBA 5J40A 3NH9A 2D2FA 1RRPA 2ZYUX 5LD2B 1CRPA 1FMLA 4B71A 2ZUBA 3NKVA 4KU4A 3BWDD 5FTNA 2QMEA 4QHTA 1EFUA 4LX0A 4M1YA 2FFQA 5EE3A 3IGFA 2ZPTX 5HE8A 3FKQA 2ZJYA 1E2PA 4FMDB 3EZ6A 3K09A 1SHKA 3NWJA 2Z6VA 4P4SA 1E2GA 4OHZA 4EDHA 1D2NA 1MABB 4HLDA 5L3VA 3P4XA 4AKHA 2REXB 4YONB 4S2EA 1W2GA 3WMEA 3AF1A
chains in the Genus database with same CATH superfamily
4TPKA 1NZFA 3SQMA 4MKFA 1AQ6A 2I7DA 1O03A 3HDTA 3K6KA 1TCAA 1WZIA 4G24A 3VAZA 4EUEA 1IQUA 1UP4A 1S8OA 3TH5A 3A26A 1T9CA 5JAOA 4JZYA 3AKZA 3ZXUB 2JFWA 4DWVA 4LBWA 3IV9A 4V0ME 4BUJA 2Q4TA 2Y93A 5TSDA 2QX6A 2FFHA 4F1KA 5HJEA 2DERA 1PL0A 1S3IA 3CNBA 1J70A 2Q3MA 1MA0A 3JATA 4I50B 4RA9B 1K88A 1KI1A 4OFZA 3TFQA 3ZY4A 4F2DA 5BW5A 4L78A 4U6NA 4EGQA 5AJZA 4X24A 4DCPA 4YCNA 3IEXA 2POQX 3OZCA 4MRVA 4F3KA 4D9BA 2PZKA 5IWCA 1JTVA 2PG3A 2R48A 2PDAA 3DEAA 1E0SA 3NGMA 3OCZA 2WMDA 4PRZA 4W6QA 2IDKA 2ZE6A 1D9ZA 1OE0A 1U99A 2R751 1FNCA 1VPEA 3HCFA 1Y6ZA 3NONA 5E9AA 3V4SA 1DDGA 3BMCB 4DGQA 4EW3A 2AI1A 2PYIA 7YASA 4NEGA 4NBWA 1G8PA 2W42A 2PIAA 3VC7A 1BN7A 4LK2A 1YMVA 1T6ZA 2C54A 1ZU4A 5CX1A 4BO8A 1RRGA 3ZE8A 4M1EA 5A6SA 3CUTA 1FTYA 3VGPA 3DAFA 2IFTA 1R4NA 2C94A 2Q3FA 4DT1B 3EZ7A 1E5QA 5EXXA 2IBSA 1KC3A 1JHZA 4D4JA 3THXB 2FEWB 4OP1A 4RIGA 1PHRA 1ZD2P 4NZMA 4O8CA 2WILA 1FMTA 3R5JA 3Q12A 2GFQA 4H77A 3MXOA 2C0PA 2C20A 3LFHA 4R2HA 1Q0LA 1ONNA 2ZR8A 3D4LA 4XJTA 2MINA 3BJIC 3ZVKA 1PJ3A 4J7UA 4KC0A 4RD1A 4BKQA 4F4CA 1VL5A 3CYFA 3GJYA 3K5PA 3G6WA 2GO7A 1OI4A 2XQJA 3S5JA 4RQUA 2DMRA 4F38A 1HZZC 1UK8A 3GPLA 1H8EA 1A9TA 5FORA 3AKCA 2XA2A 4QG7A 5JASA 1QTNA 1V45E 1UBKS 1TFRA 2L69A 2M1XA 3D3EA 4HEJA 4KW7A 4AWXA 1Y8QB 1H23A 4PSCA 3NWBA 4PIVA 5IMBA 3TL3A 4R7TA 5CFPA 4Y67A 2HMWA 1FXSA 3H6HA 3VRHA 3ZWMA 3MWEA 4BVJA 2X1MA 2ZRKA 2YXPX 4MW9A 3IQWA 1IWBB 2QRQA 4WNYA 4ZAZA 3ZQKA 3AVTA 1XX6A 3G9XA 5AKIA 3STYA 1VG0B 1FDUA 3D4NA 3CW8X 4JI8B 1OBVA 1F12A 2H2AA 2I1VB 2NPIA 3PYLA 4PYMA 3WFJA 1BHO1 4OSPA 1E1QA 4XDZA 2VK8A 1XHFA 5CDUA 3KSRA 2YJ4A 4OH7A 3FDJA 1N0VC 1RACA 2V6IA 3KKQA 4L51A 1LPNA 2ZDHA 2A4KA 2QN9A 4G26A 4HNUA 1EE9A 2ZT8A 3GJZA 4QEZA 1RKVA 4RY0A 3T12A 4UM9B 2AIRA 1F8YA 5LSAA 4E09A 3UPDA 4A23A 2PKCA 1VE6A 4E4YA 3PV0A 4CHTA 2IODA 1CUAA 4HPJB 5HJ5A 4KXQA 3L8ZA 4TRNA 2VK4A 3X1WA 3SLGA 5JECA 2QBYA 5EJ9A 4TWIA 5AW5A 4B40A 5FLXA 1VQ1A 4N3BA 1P0MA 1VKZA 1X1TA 2OCIA 3OIYA 3I6MA 1FQWA 3V4PB 3K0CA 4OHBA 3ZU5A 1XKXA 3OQJA 1ZLXA 2J33A 3O4GA 3J80A 3WYFA 1HDIA 3GGOA 1LVUA 2F8MA 1Q0UA 1YJXA 3IAUA 1P7ZA 3ZI7A 4QKQA 1HETA 3T54A 3HM9A 2XB9A 3PEVA 1N6LA 1PV4A 4INAA 2WM9B 3P9QA 2P2LA 1Z3IX 1UCFA 2HREA 4TSKA 5ITZB 2OQ2A 1CERA 2YWGA 4QOEA 3DV0B 2A1IA 2WSSA 5CIYA 1FC0A 1M8PA 1VJDA 2EATA 4PLTA 3MJSA 5JS2A 1G0NA 5CVEA 5IN4A 4DV7B 4OXIA 2VSQA 3EVNA 5SY9A 4Z1OA 2QUJA 2DUNA 2XNJA 3HCDA 2V45A 3OZIA 4KB5A 1P73A 4LYHA 2C7BA 2FPIB 3GNSA 1K75A 5FYQA 1BKDR 1DWOA 3F4LA 3DE6X 4MI6A 1N5JA 4LBYA 2ZRDA 5E6UA 3G7UA 4DLAA 5J4VA 4IFIA 2JEYA 3K9GA 3IR6A 2GSWA 2EFYA 4ZCSA 3KD3A 5IXSA 4GLOA 2D1YA 3MWKA 1TRHA 2P6PA 3R4CA 2AF4C 1V4BA 3CTPA 4ERNA 1EGVB 2XCUA 3HU5A 4PO9A 3RBVA 1RHRA 5E7QA 2B92A 3T3IA 3HS3A 5KYXA 2ODBA 3P0IA 1I7DA 2ZS7A 2PBZA 2DB3A 4YRSA 2UYQA 4BO2A 4EUNA 4OB8A 5IYZF 3UBMA 5DM60 2W2KB 1ENYA 1OGJA 3IERA 2O54A 2HWUA 4DL9A 1XEAA 1OKKA 4RTMA 4DZRA 4AD8A 1ZN9A 4E11A 2OHGA 5BR8B 2WY2D 1XKQA 3L0ZA 3K9QO 1OZGA 2A3NA 1WHTB 4LRUA 4NCKA 3T5GA 3TF5A 1XTRA 1K8YB 3PWKA 5SY6A 1J6UA 1C9EA 2ASEA 3MTAA 1ZOIA 3AM4A 3QITA 3KB1A 5JS7A 4G5QA 2FXIA 2ON6A 1KDVA 5EFZA 2FPRA 4WEOA 5D7NA 1B2LA 1E5LA 5G3ZA 2LD4A 3TQQA 1E7RA 2Q41A 4RSHA 1OFHA 3BXEA 4KR3A 4FEEA 4ALLA 1D0VA 3RVOA 3LWBA 3HG7A 3GFTA 1QHEA 1XQVA 3OPXA 3H11B 3U5TA 3VZDA 2KYRA 5IARA 4C4TA 2PTGA 4FB5A 3G6KA 1JHAA 1IN7A 1FX0B 4WFQA 3C85A 4FKMA 2I2WA 1JG6A 4IMIB 4JSYA 1T9BA 4KGVA 3EXEB 4QJBA 5F73A 5A05A 2XMZA 2X13A 2YWBA 1PEDA 3U9LA 1A4RA 5AW0A 1C80A 4CF3A 4WWHA 2XGJA 3ENQA 1GQFA 3FLEA 1MJHA 4IUCS 5DNVA 3EZGA 2K2WA 2WWFA 4IJKA 4ZPXA 2J9XB 4FYWA 5I7AA 4CM7A 3V4RA 2CLCX 5EE9A 4DLKA 4XWWA 4DDUA 2IP1A 3EC2A 1OH6A 1S2NA 3KKEA 2B8TA 4B8ZA 2J3IA 3DEHA 3KJGA 4LHYA 1KXJA 1XA4A 2ZE8A 1YRQA 5EIAA 2IV2X 4DKXA 5IWAB 1JQLB 5J3JA 1NBME 2ISCA 3DV9A 1DKLA 2YN2A 1OX4A 4ZXPA 3E70C 3TRJA 5C7YA 1QZ3A 4KTVE 3W5AA 2H92A 4NCBA 3L1UA 4WT7A 1EUDB 5ADUS 2PUEA 2R25B 3HADA 4YRFA 4I99A 2WJ6A 3IBYA 3VR3A 1UBUS 2WHPB 4R0NA 3VR4H 4D9CA 3NVKI 4UUOA 4GBGA 3AI7A 3GYBA 4IXNA 2ZJ2A 3D6HA 1HQKA 1FRVA 5JDIA 4M0EA 2Q1SA 4TUYF 3AETA 2GM9A 4CR8A 3T5CA 3V5NA 1QAOA 1GITA 5EUBA 2XJ4A 3W3AD 2XZOA 2OHJA 2V4MA 5TEWA 3FZQA 4GS5A 1FU4A 5LBIA 4FNAA 2RB4A 1HFKA 5IP5A 2P6RA 4WESB 1EHIA 2A94A 2G25A 3COVA 3TKYA 3WL7A 1GLVA 1RQNA 2GRUA 4ETNA 3JAWA 2R97A 3VPXA 4WLEA 4Z86A 3CX4A 2J85A 4FFDA 1MABA 2EBHX 2YVUA 4BPBA 2Q8NA 3HMQA 1EFTA 4ZRMA 1ZD3A 1OLXB 1QCCA 4H7JA 3FVQA 4Q4HB 3LHKA 3OX1A 4URFA 5FPHA 2Q0QA 4CLOB 1AMNA 2ZM6B 4C7OB 5CT4A 5EJ4A 2CZQA 2EBFX 2FG7C 1ACLA 2HZ7A 1S4QA 3EGCA 4I1SA 1XBTA 1R0LA 1E96A 3LCRA 2X0EA 2IYZA 3CH7A 1EFDN 5DBOA 4DV0B 4PC7A 1C0KA 2XXJA 1CUBA 2JNWA 3VNVA 1Q0ZA 2OHVA 4ND4A 1COWA 5ARDA 1QBGA 3I1JA 3IJPA 1E1CB 1BQEA 4IV8A 1TKAA 4JP8A 2ST1A 4JWKA 4NHOA 1QB8A 3WBJA 3QBTA 1YGYA 1Z6QA 5L4SA 1Z36A 1USWA 1EGQA 4DJDC 3VMFA 1RKQA 2GRAA 3JALB 2KX7A 2OZKA 4WX2B 4N18A 3I76A 1DBQA 2R7NA 4L95C 2NIPA 2O2GA 4L4SA 1R27A 4B17A 1IN1A 4V0RA 2QORA 1O6FA 5FTWA 4JCOA 3F74A 3RRFA 4DREA 5DNCA 2QR2A 1MBZA 2ZYHA 3OT1A 4C05A 1XK6A 2XJ9A 1EESA 2HA3A 1EH5A 1ZJWA 1CUUA 4M2LA 4NJEB 1UFVA 1IPEA 2YZMA 3G1WA 4FLMA 1FFEA 3RYTC 2QD2A 4UCXA 2G9ZA 4UTNA 3LRTA 3HO1A 1II8A 3NT4A 4IMJB 1T29A 2DH6A 4FYPA 4I3GA 1CEXA 5F2OA 3RS3A 1HT1E 1ZK4A 2I4NA 4YMGA 2Q9AA 1V7PC 3O1IC 4UDXX 5JSKA 3WIEA 1ISJA 1NG1A 3LBHA 1EG7A 1O8BA 4M1QA 3CG0A 3FHLA 4UUNA 5FL7D 4C4XA 3RADC 3F97A 5EHNA 2JFQA 2FR1A 1ZG3A 2WYIA 4CNBA 4DUGA 1EGMB 2YIMA 4KE7A 4BJ5A 5HIAA 5JAUA 2XCLA 4PPNA 3EXAA 3SI7A 3PIRA 3E2MA 2HMAA 3SXPA 5TT1A 1UK6A 2ZKLA 4GWGA 1OW3B 3NW9A 5CX4A 1A4XA 2CW5A 3AR5A 3PX3A 2CLFB 1BMTA 1EIZA 4K9DA 1O4WA 4PG5A 3TZQA 2COUA 2YXDA 2I3BA 1W8IA 3OTIA 3KKKA 4GLBA 1LUAA 2Z9DA 4Y0VA 4BS9A 2BHSA 2WINI 2C95A 4QG3A 1KMCA 3OOSA 1UAYA 3INTA 4IOMA 3H42B 1JU4A 1NF2A 3WGUA 2VDLB 4CKYA 2BFDB 1DXOA 4LE1A 3AERA 2OV8A 4PGGA 4ZXFA 2IYWA 3GPCA 2XUIA 2BI7A 3IKJA 4BLSA 1TZCA 3R5KA 4N39A 3DVAA 2W70A 1SBYA 1XDDA 3LGSA 4XX0A 5J59A 1JEQB 1ZWKA 3NR2A 3E3OA 2YWDA 4XIFA 2B4TO 3G3EA 2VF2A 5BPFA 1YVDA 1FFGA 1P75A 3W5HA 3JQ7A 1ZISA 2J3KA 3OUZA 5LYJB 1LC3A 1MEJA 4XDHA 5CP8A 4DNQA 1VGQA 5F33A 4KQFA 5JJKA 3HJHA 1MJGM 1RZUA 1EM6A 3TG8A 5FNVA 1CUEA 3UT0A 3PWTA 4AF8A 5DBEX 1VCMA 4BV2A 4DIBA 5KQGA 2NUAB 1Z0JA 3QGMA 1G2QA 1ZW1A 1DJNA 4I2VA 4PX3A 1YCFA 3O2NA 4MNTA 4YRRA 2YWEA 4LG1A 1E2FA 3JYLA 2MR6A 4LKOA 3ED5A 3WRXC 4B74A 1M5UA 5C4MA 4KRFA 2XW6A 2GVZC 3NEYA 1NIPA 1WTCA 2DFLA 1YB6A 2Y8EA 2Z30A 4KIUA 2ZE5A 1TF2A 4MWBA 1FNSA 4OYLA 3FM9A 3JY6A 3PFCA 1PQPA 1MP0A 5A4DA 3OEEA 5JNLA 4JMLA 2NO1A 1P1HA 2P6NA 2WJHA 3GO4A 3Q5DA 1U3GA 3PC6A 5A5FA 1IY2A 1Y6GA 3W7VA 3WGYA 3ZZMA 3H0EA 3ROGA 1BD3A 2YFYA 2WWGA 3NKFA 2YS6A 1YIDA 3D1LA 3EMVA 5B12A 5ALYA 1NZJA 3AFMA 3ZHQA 3KP1A 1FFYA 4J9UE 4X6XA 3T94A 1QGZA 3PDHA 1PYOA 1CQWA 4TZKA 1RABA 1TQ2A 1M76A 3TGLA 3BFKA 2FSGA 2IS1A 1WHSA 1SPXA 2CXSA 3LXMA 4IGAA 4KAAA 3OBBA 1VL8A 4IIJF 4L3VA 1UJBA 5B1SA 1TCCA 3F8TA 1EB8A 2BEUB 4CMEA 5IVKA 1AQUA 3JYHA 1BNCA 2BCEA 2WYOA 5DP2A 5KAMA 3VISA 4MV7A 2DF8A 4O4LB 1YR2A 5CRIA 4F5ZA 1QV7A 4O29A 3BA1A 1X39A 5L45A 1DIAA 2R8BA 4EPXA 3VNBA 4PZDA 2DWOA 4G5SA 1CUJA 1YA4A 3BUSA 1TVCA 2HJWA 1LQTA 1A2KC 1PDVA 1XDWA 2O4UX 3JQAB 3KZMA 4X7BA 4TLEA 1QIMA 2VT2A 4P36A 4ER5A 1V1MA 3ZU2A 5JRDS 1J00A 4G1EB 4RVNA 3UWMA 3UJ9A 5JS1A 1XMPA 5BWMA 4TWZA 1GZUA 2GPTA 4I1YA 3KTFA 4D56A 1L4LA 3VTKA 1CQIA 4UTZA 1DFGA 3A1WA 1LDYA 2NZUG 3QEMB 3K92A 1R8JA 3FBTA 4TUYA 3R3JA 1J49A 2CBXA 4J0EA 1V5WA 5L7TA 3SJAA 1KAMA 2QZ9A 2VP5A 5EUCA 2NVOA 4F2PA 3Q2KA 3GG9A 3ZTTA 3DCJA 3KS9A 2KMLA 2YC4C 5AKXA 5IX8A 1OLUB 2AFIA 2CVOA 3BCRA 4RVCA 2FUG1 4J0FA 1O5TA 3IKMB 3V1KA 4PAGA 3L01A 3G79A 1H2WA 5LZ4A 3S55A 3CF4G 3H8VA 5LM3A 1XVLA 3X1DA 2VQFB 2R2GA 5JZOA 4C7XA 3R0JA 1NDQA 3ZK8A 5HHTA 2BKXA 1NVMB 4NBKA 3G5MA 4I9NA 1U9YA 3OWHA 3QLTA 3RYFB 4W5TA 4G81A 2G71A 3AR4A 2V4ZA 4L07A 5ALXA 1Q1QA 2GJ9A 2FUKA 1B0AA 1E3TA 1NATA 2DGDA 3NO4A 1U0FA 3A27A 5LZ5A 4ZVMA 4NHEA 4ECAA 5HR5A 3L7AA 1UT5A 3HDQA 4LHSA 4L5BA 4Y1GA 3WQQA 3UOGA 4Y2HA 2C96A 3E9CA 2AUTA 2ZGVA 1O3YA 1VCIA 1OU0A 5FQOA 5JJBA 4X1IA 3TNDA 2C04A 3E03A 4OYHA 1VI2A 3QVKA 2GPYA 4H6VA 5FKJA 2C4KA 4RVHA 3FYUA 4RHFA 1BWQA 1YK0A 3QMWA 3GCXA 4ZI5A 1GPBA 3QY0A 3UAGA 1G21E 2X77A 5EESA 3BGIA 1K98A 1OTYA 1E6CA 2X8AA 3KSMA 1UPUA 3MUFA 4Y0AA 5DYNA 1PJRA 1H8ED 1N5LA 3A6HA 1IBRA 4OGFA 1M34A 3T5BA 4N6NA 4BNGA 5K6TA 5JV5A 1IPHA 1N2GA 2CHVA 5CDGA 1YU9A 4P32A 5HZHA 3H19A 4MRPA 1QH9A 1YS9A 4OBXA 4ZO9A 5TT0A 1CRWG 2D4HA 2IIVA 4ZMRA 3OAAA 3CNQS 5LWQA 2VDJA 2HV9A 5IAOA 5TPWB 2L2QA 2RB5A 3AHIA 3R7SA 4JJFA 1DS6A 2AFHA 1TU3A 1SOWA 1WW8A 2HQOA 2Q1WA 2Z58A 4MV5A 2IW3A 4FHCA 2HMTA 2F90A 4GOMD 1D4FA 4TVOA 3PFKA 5FWDA 1VHJA 2ZBRA 3B6MA 1P7YA 1E1QD 2BONA 3ND7A 5AJHA 4C4SA 1G3QA 4GGPA 3W1EA 1NWCA 5EYPA 2QN6A 3FAKA 3QKUA 4XEHA 2VDOB 2YCBA 4ZQBA 1YGPA 2PSHA 3VMMA 5I3CA 5KOYA 4J16A 4GSKA 3VHLB 5HZGA 2G8LA 3VHQA 3ZCPA 1VIMA 2CZGA 2ECQA 2P9QA 3O92A 1J5EB 1NM5C 2RK6A 3EK2A 4Q93A 2Z3VA 2FK8A 1W9HA 1TVKB 3IMKA 3WLIA 1X1EA 2VJKA 5FBRB 4RNCA 2HJSA 2ZIWB 4U7HA 4U63A 1RI5A 4IQ4A 3UCEA 3LC7O 4ZVQA 5HTKA 5U1PA 4PYQA 5CB4A 3ZGZA 1KQOA 3A1VA 4BFTA 4X97A 4D99A 3FPBA 1NJ8A 2I7VA 2OKCA 4H4EA 4P93A 4K9SA 2IU0A 3D02A 5KOJB 4ZYLA 3RSGA 2CXHA 4U3JB 3L1JA 4WLUA 4CQLB 4RCVA 4WFJA 3OLZA 3IVXA 4OJNA 4JY7A 2HFKA 2PMEA 2AMJA 1U9CA 4TL8A 5D3KA 5KNDA 4KDFA 4AZSA 4ZU1X 2D74A 3CNLA 4JU8A 1BHQ1 4RPGA 1UMDA 1V43A 3ZHYA 1Y1KE 3LXXA 1Z75A 2WSSD 4JS0A 5IH7A 2ZAIA 3ECAA 1BDMA 1DC7A 4PPYA 4EGAA 3GOQA 4DV6B 1QVRA 2O2YA 1XEFA 3OM8A 1PZXA 3QJ5A 3FJ1A 2F3TA 1TTTA 4URZR 1J09A 1V48A 1AV6A 3I4CA 1FRQA 2DT8A 1N5OX 3AKDA 3M49A 3VPFA 1J2EA 3FYSA 3JASA 4BN0A 3UWOA 4FILA 3DB1A 1XU9A 3GOHA 4EIWA 2D3TA 2FLVA 3T4PA 1H3NA 3QX9A 4HZUA 4RVOA 3KQUA 2R6GA 1ACMA 3GAMA 1AS3A 1CULC 2K5UA 4X1KA 1H5NA 2IYOA 4GUDA 4R8SA 4Y2JA 2B36A 5LCXA 3WFIA 3N2GB 4B3DA 5JJ5A 5CVJA 3KR9A 1PS8A 2K7ZA 1PT7A 4WY5A 1SVIA 1AM4D 1KO4A 4GNKA 3KBOA 4Q9HA 3WKCA 3ZY3A 1JKFA 4LSGA 3ISJA 3SR0A 4V1CI 1M1NB 2KPOA 1GXSA 1PKXA 1R6UA 4UXHA 3FWZA 4HNSA 3TMKA 2VHJA 3IESA 3TLJA 3WIDA 1XQ6A 5DIFA 2NU8A 3FIJA 5LKAA 3QVTA 3RTEA 2OCKA 3MLBA 1ST3A 5KVAA 5DFAA 3KJXA 1U9JA 1HE2A 3UWDA 3L8EA 5C37A 1IDN1 2C83A 1KPHA 3OZSA 4X94A 5EJFA 1KSJA 4B2IA 2HHJA 2JLWA 2HRQA 3AIOA 5AM4A 5CCXA 1I2AA 4JNCA 1JR3A 1VCNA 1A2BA 3CSUA 3OT5A 3V8NA 5LQMA 4RZQA 3DXFA 1K6JA 4CEJA 1T9ZA 2AZ4A 3AJ9A 3H4IA 1QLHA 1Z06A 3Q7QA 2F6RA 5SICE 2XBUA 5JXIA 3PGLA 4G63A 4CIAA 1JFTA 5KQSA 2N3ZA 4ZCMA 4LPKA 1ML3A 5FFMA 1NBWB 2NQ2C 1WNFA 4JQSA 4NMXB 4RXMA 4HO1X 4UZSA 1XWWA 2JI8A 1HLGA 1T9GS 2HRZA 2P2YA 5JNSA 4KJXA 4IOKA 1DKRA 2JIQA 2M6KA 5T67A 5ILOA 4C08A 2A9OA 4LDZA 3WIVA 2R79A 4HS4A 4RQBA 1ECPA 1VLVA 1Z2NX 4MRNA 5DSZA 5EN4A 3KEGA 2PUJA 3UBTA 4EFDA 3QOYA 2IHJA 2QL9A 2FZKA 3OT4A 4M7PA 2CJXA 4BNMA 3ZHCA 4J1NA 3ANNA 3CTMA 2JIPA 4WL0A 3USES 3R6WA 1FMJA 1N1MA 4KO3S 4AO7A 4HV4A 1C7ZA 1L7EA 5K09A 4ESHA 2EARA 3O2QB 1GPYA 4FFRA 4YASA 4GUAA 3A31A 2R47A 1VBFA 2FMUA 2XNHA 4G3XA 5E1DA 3CB4A 4QM6A 2A84A 3SS9X 2VSFA 5IM5A 4A9AA 1NTRA 2LDBA 1J23A 1GFIA 1YAJA 3RC2A 1DAPA 4R16A 3MMPA 4HQFA 2BFWA 3EGDA 5EXEA 1P80A 1L5MA 1U0HC 3VR3D 4RHEA 1ZN8A 3WI7A 3ZDYB 2C4VA 4HEQA 1A1VA 5ALKA 2PLAA 1IJKA 4QHSA 4RESA 4H4CA 1K6IA 2IP2A 2N46A 4TM7A 1LWOA 1VE3A 4BEJA 1FOEB 4N40A 5BRAA 3EIOA 4Z2AA 2BFFB 1H1TA 4RC9A 1KZ9A 3F3KA 4DMUB 3QQPA 5ELMA 3ZKWA 5A1JA 4KR6A 1UFKA 5AW4A 4BJ6A 4QQ8A 3DKVA 3AB7A 1QE5A 1XU7A 2FW9A 3C41J 4DCTA 5DCYA 4RTKA 3A7EA 1QLJA 1KORA 1ZNZA 1SZCA 2MR5A 4G4IA 4JB2A 3IL2A 4CM1A 2OFXA 4YJ3F 3ZW9A 2BMWA 1VM6A 2D2XA 2WWXA 4MKRA 1BS9A 2H3HA 3ADOA 1XR3A 1ZM2A 2B7BA 3LPAA 5FA5A 2RH4A 3UKOA 2FMKA 4MRMB 1VPDA 2QM0A 3AHFA 1TMYA 3T9DA 3WKDA 2CMFA 3RFCA 1NXWA 3A1SA 1V1RB 1COWD 3OJFA 4FCVA 5C5CA 1XZBA 2EOAA 1K5GA 1THMA 1XIVA 2VDNB 3FWYA 4QTYA 2AOUA 3RIYA 4CM4B 2Y1EA 2YW2A 3DBIA 4PQYA 2C57A 1KNQA 3NIDB 4HTFB 4IV5A 2GZSA 4JQOA 4XH9B 5INTA 3OMLA 3G8BA 3W77A 3WQBA 1PJZA 1TM4E 3QFCA 5GIOE 5CBKA 4S2EA 2HA5A 3PQ2A 2QLMA 2P5SA 3OQBA 1XCLA 1YDGA 4LWOA 2OB2A 1YVEI 1W5SA 1SHZA 5EP4A 2W4QA 1UPXA 3QP9A 4GM1A 1Y4DE 4PFJA 4V0OA 2CFRA 3SGLA 1XV5A 2ARKA 3DHVA 4QGSA 5IABA 4JEUA 1Y34E 3AZQA 2WT4A 4KWTA 3ZDRA 3STXA 3FVRA 3BA6A 2P3OA 2NZJA 4RVGA 1CW2B 1OXKB 2GZMA 5CFQA 5JC1A 2C3YA 1AKMA 1PU2A 3AV3A 2C82A 3FHTA 2QN7A 3TLEA 4W5NA 3TUZC 4PSVA 4DUGD 4X7RA 4KIGA 3X1JA 1XCOA 4BMCA 2O59A 4HQ6A 2IXTA 1IUOA 4D74A 3PC2A 1KQGA 1QRAA 3AT1A 1R8SA 4KNVA 4XWOA 4DCGA 3RABA 1I33A 2YR0A 2PYZA 4MR9B 4RZ2A 4WLNA 3KV1A 3VU9B 5IF9A 4RFLA 4X1YB 2EKLA 1MDFA 2X1HA 3FJOA 3ZQ6A 5KSOA 4GZ6A 2Z83A 4Y2TA 3FMVA 2GJ4A 1JLKA 1JNXX 3U3DA 1VMEA 3GJ7A 2R5FA 3E35A 3GLGE 1E2HA 2AQHA 4M0LA 5JYCA 5TV2A 5CXXA 4MRRA 3COJA 1NUQA 2PJRA 4C7BA 4X3PA 2FMFA 1ZK1A 3JW8A 4PO3X 3QWBA 4QZVA 4O1IA 3H86A 5DASA 2CLIB 4LISA 4A8JB 2YCLA 4GQIA 3ZHTA 5KTNA 1HDCA 4A8PA 3NWEA 1FJHA 2P2CA 4K9OA 3AI2A 4F4IA 4AUNA 3KQSA 3KWJA 4G36A 1FVOA 4ZTUB 2F3RA 1HT2E 1RT9A 2QYHA 3NT5A 3R3UA 3IRUA 4TLMB 2D5AA 4XARA 5B7NA 4GI5A 2JJMA 3P0EA 2GBLC 2GM4A 1YWGO 5BW4A 2ZTLA 3IUJA 2E6KA 1LSOA 2YIVX 3SMVA 2O3TA 3TMAA 1WPRA 1GM5A 2GNAA 3GDGA 1D03A 2V6JA 4G5FA 4J1TA 4R8VA 4RM2A 1JEDA 2B9EA 4WXYB 1RCTE 1T6NA 2YNMC 2PUTA 3MRVA 1M2WA 3HWRA 1KK1A 1MOPA 2AL7A 1M1XB 3QPWA 3RT7A 2B35A 2AW5A 4TLBA 4B85A 3DOJA 3VXKA 9LDBA 4BQNA 5I4BA 4MR7B 4R05A 1YFZA 4J2OA 5J2TA 4PQFA 2HJ9A 5CGQB 4IEFB 1CT9A 2VRCA 1NV8A 3T7IA 4B4DA 1TC2A 2WFLA 3DM5A 4BP8A 3CBQA 3KZ1E 3NNDA 3RUIA 2IOHA 3PHJA 1EP9A 3QI2A 1SY7A 1IEWA 3ON5A 2HSDA 3F9IA 1C4OA 3N3BC 4OKIA 5B2EA 1NVWQ 3L0DA 4XTRA 4XGIA 1U1GA 3UN1A 3VVMA 4GO1A 3K9WA 3R3YA 2RCYA 4L73A 1YZUA 4PCUA 4LIPD 3EDOA 3D7NA 5J1SB 2QTVA 1CBUA 4OA8A 3T7CA 3C98A 3K5WA 1XYYA 3LBFA 4M8NE 4B82A 1Y6JA 4Z6KA 1GAEO 1P72A 4DM4A 3B5IA 3AL0C 1DUVG 1WB5A 4XUGB 4QUKA 3GRRA 1T91A 1ESMA 2EW2A 5EPEA 2VHTA 2ZUVA 4U02A 2PZJA 3TLAA 4DAOA 4DRXA 2E3JA 4PHGA 5HK8A 5JRZA 3ADBA 5SZIA 1UR5A 4EPTA 3FUTA 2H7CA 2ATVA 5HFNA 3T0GA 4R98A 1PNTA 1MA3A 3SC3A 1HOXA 2JFYA 4NG5A 2JFUA 1QQ5A 4GPTA 3TMYA 1FSFA 3ZNNA 4WRRA 2QX4A 1TB4A 1ZQ9A 2QM8A 4A82A 4BNXA 4JKOA 1OZHA 4U5XA 4PX2A 5TVGA 1GGJA 3L6BA 4X92A 1QTIA 1UKEA 4YRCA 1DEOA 4EQ6B 1PJ2A 3CCCA 5A4JA 1N5MA 2FEPA 4CRWB 4XGQA 1IPFA 1PGJA 3WWDA 3FFAA 3R7DA 2OV1A 4W5JA 4HBGA 4OL9A 3JQDA 5T64A 4CKZA 2HU2A 2D2VA 1TI7A 3EXFA 2AEMA 1QR2A 2IHUA 4CR6A 3ZDXB 3NIBA 1RIFA 4DWOA 4FT4A 3G5UA 4FX5A 2DCUA 4P3OA 4RO0A 3KVYA 1M2GA 3LAWA 4HT3B 3RYIB 5GM2A 3KT3A 3PQDA 3K73O 4OLFA 5HIJA 5THXA 3TPZA 4B6QA 3I73A 5TR9A 2K87A 3SZUA 1BXKA 1NGSA 3D3WA 4JJZA 4O1HA 1TQ4A 1O95A 4E03A 4EA9A 3I2FA 4KVFA 3E4DA 2IPLA 1TAGA 4MVJF 2DT5A 2OG1A 3RGGA 1CVRA 1BWSA 2GVDC 3HB9A 1B4DA 1OLSA 2Z8YA 3MIIA 4IX9A 1YOBA 1CIPA 1QC5A 4KE6A 4OOFA 3FVWA 3LHFA 2Q0SA 4QU8A 3MT8A 4BFCA 4XZ3A 1BXRB 2IYTA 4NMLA 4F5YA 4M46A 4YMSA 4NZYA 1KBZA 2VF7A 4BVFA 4G4SP 1X7HA 1IIBA 3QBVA 3G1TA 5E38A 3IJEB 4LXXA 4W5WA 5JCOA 5BVHB 1MG5A 3QE0A 3X0DA 3U1BA 1Z4PX 1KOFA 2OE2A 3L1HA 2Y1XA 1BJTA 3MBKA 3NC1C 4OMDA 1DG3A 3I3OA 5GY7A 5K9ZA 4KREA 3PXXA 1K9VF 2I03A 2H65A 3EMBA 4OGLA 1EX1A 3OJ0A 4YDSA 3T7SA 5AVXA 1LRKA 4L76A 3DEFA 4HLQB 4QGBA 1ECLA 1EM8A 1JIXA 3B12A 3MRSA 4UBIA 2O4CA 1DWUA 1IEXA 2ZBGA 1CVIA 3Q1LA 3R0QA 1E1KA 2V59A 1A4UA 4Q5IA 2OAP1 5JTTA 2C9YA 4EO4A 4HXEB 2OBXA 4NH4A 3ZG6A 5JSZA 2VF8A 2YJZA 3KUXA 4P38A 4UVHA 4J3NA 2Q29A 3UTDA 2EVWX 5IULC 3TAHA 4BTEA 2PQMA 4TS4A 5F35A 3FHOA 4GMDA 4RV9A 4DS3A 3C3WA 3OAAD 3PVCA 5LA6F 5L3QB 5AWFC 4BN5A 4KRXA 3LW8A 4MUYA 2BFCB 5DNEA 2JHCA 3ZGYA 3MCAA 3SPXA 3ZDCA 1C1XB 1EBFA 4FZJA 4MH0R 1U3CA 2W2VA 1Y8AA 2OGWA 3LCUA 4Q19A 4RFSA 4AMBA 4KKVA 1JE0A 1BU5A 1W25A 2VUTA 4WVLA 4XLLA 5G02A 1M66A 3VNQA 7MHTA 4DOMA 4N5MA 2NU9A 3D2BA 4DG5A 3AP3A 5B1EA 3NP7A 1Q1AA 3QPAA 4JA2A 2ILVA 4MJLA 5GZ6A 3BORA 3TUJC 1QMGA 2FXVA 5BQ5A 3PL1A 4C7MA 2D1RA 2ZYSA 3ND5A 2B2CA 3OQIA 4FYKA 4NMMA 1PHPA 5AW9A 4LJRA 2X1VA 4I3HA 2QTZA 4NCJA 5IJWA 3GBVA 5JNUA 1M2HA 4TTIA 1MOZA 3ILHA 4LTNA 1H1LB 1FSPA 2PX3A 3R41A 2FSUA 2WC1A 1DPFA 1DJLA 3GLVA 3R8XA 1ZESA 3EUEA 3SQXA 4WCFB 5BSVA 2AG5A 2QPOA 4PC1A 2QX7A 5EZQA 2EFHB 2WDPA 4I4LA 3NDPA 4HGNA 4FFSA 4L4RA 4OAPA 5LUBA 5DHSA 5BQ3A 3TZHA 3IAAA 4QM7A 1ZGBA 3SJZA 4BMDA 4DA9A 4XWKA 1A97A 2IWRA 2ZIXB 2P2NA 1QIGA 1CEYA 3AKYA 3ZZTA 4CVNA 4L4XA 3KLNA 2H11A 4YLYA 1GUYA 4CYMA 1ZD9A 3TX2A 2ZYVX 1K86A 3ORFA 1ZVKA 4NFSA 4CLDA 2BR3A 4B3FX 3WGLA 3JWJA 1YL7A 2C61A 2FG6C 1CDOA 4RTJA 3I1IA 1NQVA 2JF0A 2XMBA 3RG8A 4H6WA 5HWSA 3EXIB 5J1TB 4AU1A 4HWPA 4R51A 1E4OA 1CWUA 3LY8A 1ESEA 2ZSHA 1PFWA 3GCZA 1SOUA 1ZRMA 2D0PB 2H1LA 1C1DB 3SVZA 1EKXA 2WLTA 1KF0A 1XZHA 1QQ6A 4UD2A 4UXJA 4I4CA 5LXTF 1XTQA 4BNKA 5KTYA 1P4SA 1QFSA 3O73A 3GCGA 2E1RA 3QKSA 4HAWA 4HLUA 4NPCA 1UDXA 4LNUA 4QUIA 1RRCA 2A30A 5A2GA 1PUIA 1RYYA 4JI3B 4F84A 4KZPA 3JRWA 3ZJTA 4ZREA 4PQGA 2F4VB 5BVGB 4X93A 3ICQB 2R6AA 1KDPA 4MUHA 2YTZA 3KSZO 1L1FA 3Q41A 4OQFA 1OPXA 2SKCA 2Q99A 3H9BA 4YJGB 3U7JA 3GP8A 5T6BA 1ZGGA 2JKYA 4IIUA 4F6CA 3R24A 2V1UA 2AXQA 3L5OA 2GSDA 4GPBA 3MB5A 1L8AA 3RLFA 4YYZA 1TJ4A 2G5PA 3JQPA 2JGNA 3SICE 3RHFA 1QH0A 2A9PA 3HKDB 1JDZA 2B30A 2ZXUA 1S89A 1V3VA 4A3SA 4DC1A 2P5YA 1XPJA 1YSCA 1TEXA 3C6BA 1JR3D 4DRZA 2XWPA 2PL9A 4FOTA 5I9IA 4RH3A 3OICA 1RWPA 2H52A 1E9VA 4X45A 4RTNA 3H5VA 4QOSA 3SMQA 2B2NA 2A0KA 1WF3A 3LT0A 4Q4AA 3SDZA 2XB2A 2FPLA 5CJJA 4DM7A 2YUTA 1WPXA 2ODEA 3R7LA 4RLQA 3T35A 2HNBA 3ZJVA 4OU4A 3W8RA 5HG0A 3H13A 3RV3A 5BV8A 4NEHB 4NWIA 3THYA 3V3KA 3T34A 4EZBA 3S4YA 3TTVA 4AWAA 1AQLA 1CX9B 4IINA 4F72A 4M49A 3MINA 4PYLA 3VTZA 3EVEA 2ZJ5A 3R3SA 4LOIA 1YOVA 2QV7A 2WM3A 3JQFC 1L3IA 1IU9A 1N3YA 3PP8A 4PGFA 3ZDDA 4EJFA 3STTA 5COAA 4P31A 3VYRB 3CUVA 2GMWA 1SXPA 1JHVA 2B9VA 4DWJA 5IDXA 4TYYA 2ZSAA 4L16A 3DL0A 5CJPA 1RHJA 1XPRA 2VHZA 3E7XA 2H0RA 2E89A 1R3UA 3GVHA 1C4XA 1ULUA 2XVAA 3AUUA 3DOHA 3NBXX 1N9KA 5TRTA 1CLUA 3I01M 3W2HA 1J0CA 1N2CE 3HDHA 2ZWOA 3IP8A 5E4YA 4MQ6A 4RMJA 3D7RA 3GEDA 3BFPA 4QDJA 2NVUA 4XGRA 3PIIA 4NU8X 1ZK3A 2ANBA 1VYTA 2EJVA 1EWVA 1KI6A 2XVYA 3OFKA 3IQZA 3ZQ4A 3LPDA 2HWXA 2GEDA 1PDOA 2J9RA 2MINB <