1N5DA

Crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
288
structure length
288
Chain Sequence
SSNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQGRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSDSTYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQFVTDKKVVEWGVPPESYPWVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porcine Carbonyl Reductase: Structural Basis for a Functional Monomer in Short-Chain Dehydrogenases/Reductases
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID DEHYDROGENASE
total genus 100
structure length 288
sequence length 288
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n5dA00
1C1DB 4DLAA 4CLDA 1LRKA 3LDHA 3O4RA 1Q7BA 1I3LA 5L3ZA 2IDZA 2OGUA 3UHAA 4BGUA 3EAGA 3FTNA 4FFRA 3DZFA 1R0KA 2Z1NA 3JQAA 2C2YA 3DAFA 2HK7A 5JE8A 3WYBA 1F8FA 1NX6A 3WR5A 1QYVA 2E82A 1Q7CA 3L4BC 4GLOA 2EIHA 2ZJ0A 1Y8QB 1UXIA 4HXYA 4BNFA 2GR9A 1E7MA 3OIDA 4WJZA 1P1KA 1MXHA 2NADA 4UVIA 4Y9DA 3BMQB 2A92A 5TC4A 1GEGA 3ZWNA 4DQXA 1ULUA 3WGQA 4GI2A 1UDCA 4Y8VA 3NT4A 4EYEA 3ZCXA 4AJJA 1KBZA 4LVCA 4CM7A 2UUOA 4NIMA 3NGLA 4RZHA 5JXWA 4INAA 3JYQA 3RFXA 1QYWA 3V2GA 1DFHA 3OH8A 4PLGA 2O4UX 4EUFA 4I5EA 4M55A 3COSA 4WGGA 4DWVA 2OBNA 3VPHA 3VH1A 4QT0A 3INTA 4H7PA 1DIAA 3IS3A 2O50A 3BMCA 4UUMA 1XQ1A 4RLHA 1B14A 5A03A 2YDXA 3AI2A 3N7UA 4OSPA 1C1XB 4GSKA 4Z9YA 2NU9A 4YCAA 3K31A 2R2GA 1GAEO 1EBUA 4XZ3A 5EIOA 4E4YA 1R0LA 4TWRA 1UDBA 4WLFA 1MG5A 4F3YA 4BMNA 3PXXA 1QV7A 1HDXA 1ZIDA 3LT0A 4XKJA 3CIFA 3CE6A 1N2SA 1DFGA 4UAGA 5H83A 1YH3A 2AG8A 2ZTMA 4P8RA 1X0VA 5A4DA 1ISGA 2BMAA 1AUPA 4I5GA 4O63O 3EVTA 2R00C 2CY0A 2IZ1A 3F47A 1KEVA 4U6SA 4MKXA 1FDVA 3JYPA 5G4KB 1JDJA 3F4LA 3TJRA 5A1TA 2TMGA 5JCJA 1M75A 3EVNA 2NU7A 4DLLA 3E18A 5KVCA 2Z5LA 3R3JA 4F45A 4JXKA 2FHSA 2DBRA 4O59O 3I9NA 3QVTA 4CPDA 2ZB8A 2QRKA 2UYYA 4OYRA 4XB1A 4WOKA 3WOHA 2EG9A 4J91A 4W9NC 4AG3A 4I5DA 4E2WA 3CEAA 1E7SA 2G0TA 2IYOA 4MVJH 1P9LA 3JQ7B 2HMWA 3ETDA 5G0WA 1U5CA 4CQLB 5EJ2A 3AFMA 4KWHA 1B8UA 4PLWA 3RSHA 1O6ZA 5BNIA 3GVCA 4DREA 4CM9A 5TLSA 1E7QA 2DBVO 3G1TA 4AVYA 5A06A 1SB8A 3OQ6A 3RC2A 1ONPA 4FFOA 1XU7A 1H94A 1DOHA 3KLMX 4PVCA 4FOSA 3GMSA 2ZQZA 1GL3A 3K6JA 4JP2A 1GCOA 2WM3A 2BFAA 4BGEA 3F6YA 1JKJA 1GADO 1YBVA 1PGNA 3SLGA 1SB9A 5FWNA 3BTUA 3HFGA 1O5IA 1SOWA 2ZIZA 4TMFA 1BXGA 4R16A 3GNTA 2GNAA 1YGYA 5JLAA 2R6JA 1A72A 4GL4A 4YT8A 3LT2A 3OETA 1FDWA 4BO5A 2PGDA 4ONEA 2DLDA 3QW2A 3EK2A 4I08A 4DL9A 3TN7A 2D3TA 1BXGB 4IZHA 2G5CA 4ZRNA 3T4EA 5A9SB 3DBLA 3DAGA 1OI7A 3C1TA 1T4DA 3I3OA 4OXYA 4TVBA 1I3MA 3CXRA 5JS6A 5L45A 1JW9B 3NT5A 4WNCA 3FD8A 4ZHSA 1D8AA 1XYGA 4QO8A 3GGOA 4R9SA 4UEOA 2YV1A 4ND2A 2AQKA 5HS4A 1P31A 4CM8B 1PJ4A 3TL3A 3QWAA 4HY3A 1HL3A 5K6AC 4PZCA 4AJHA 1ADGA 3MWDB 3RUFA 3UVEA 4PG7A 3X2EA 2P91A 4OXKA 3QWHA 3RIHA 1HKUA 3ZU2A 2BLLA 1KVQA 2C59A 2BD0A 1E3LA 2AEMA 3A1NA 4TZTA 5TJHA 5JYDA 4A73A 1DRVA 5DP2A 3BIOA 1HLDA 4E33A 1M6WA 3ZI0A 4MKZA 3C7DB 5THQA 2DKNA 1ISJA 4M87A 4YJFA 4AJLA 1YDWA 1N9GB 3HN2A 3FNGA 3N58A 4LSWA 1E5QA 3D64A 3ONFA 4P4NA 5A9RA 5EINA 2GZ1A 5HM8A 4YQZA 1KEPA 3H2SA 4HBGA 4D3SA 4NNJA 3A06A 1NAHA 4B79A 3DO5A 4B3IA 3PHHA 2VT3A 1JVSA 5H81A 4G5HA 1E92A 1PTJA 4IIUA 4KTVE 2X5JO 1PJ2A 3E9NA 2H6EA 4R1UA 4BO3A 2HKIA 3PGJA 3EHEA 3SEFA 2Q49A 2VUUA 1NVTA 5KIAA 4WEOA 1GYQA 3JQ9C 1B15A 3Q6IA 3I52A 3DTTA 3WXBA 2D8AA 2GUGA 1SOVA 2GPTA 2NQTA 5EQDA 1B3BA 4M8SA 2X23A 3RC9A 1WZIA 1ZXLA 1HSOA 1JWAB 1W6UA 3GG9A 2F00A 1BWSA 1YVEI 2I67A 2VQ3A 4CLEA 3NDRA 1KVRA 3W6UA 3MOIA 3CMMA 3PHJA 3Q3CA 4GKBA 1B8VA 4S1VA 2DFVA 4WECA 3RU9A 1X1TA 2VCYA 4XCVA 4ZU3A 1E77A 2FOIA 1PQPA 4OIMA 3UCFA 4RCVA 3ZV3A 1PEDA 3I9KA 3U4HA 1S6YA 3BMNA 3LT1A 1HZJA 4NQZA 1K0UA 4OXNA 1EUCA 3V2UA 3DHYA 3DZIA 3JYLA 4AJNA 3GUCA 4OOEA 4XYGA 1B3RA 4F6LA 5C3MA 4YT2A 3S8MA 1R12A 3UKOA 5A9SA 2GD1O 4D79A 1YB5A 1HXHA 5C7LO 1HLPA 2X9NA 3DFZA 3QRWA 1C14A 4CV3A 4RDHA 1NWHA 4H3VA 5T67A 5A5FA 3TQHA 1XA0A 1KY5A 2H63A 1BW9A 3NRCA 3B70A 3KETA 3CKYA 1ZVMA 5CDSA 4B3JA 2W8ZA 2CNBA 4RVGA 3QHAA 3WMXA 5DULA 5TQVA 1MX3A 4MPDA 4AJ4A 4XYBA 4EUHA 2CDBA 2DC1A 1KVSA 3JQ8B 3RKRA 1B7GO 5DZSA 3LC2O 3NTRA 3TL2A 5ITWA 1ADBA 2GN8A 4EEZA 4IJKA 1O9BA 3SX2A 2XXJA 1HRDA 4Z3DA 3OECA 4IBOA 1DAPA 4L0QA 4XRGA 1GR0A 5DN9A 4GMGA 3BHIA 3QWFA 5BSFA 2AEFA 3W4KA 1HYHA 2YHUA 3VVCA 4B4VA 2FPPA 4JP3A 2WYWA 5JCJD 4P38A 1EVYA 1IZ9A 1D1TA 4MVJE 2C5AA 4KDEA 1X7HA 3LU1A 4BO2A 4XRRA 5CPBA 3C85A 1DIHA 3P5SA 4CR8A 2X22A 5IAAA 5TIIA 2DUUA 4BKPA 3OHSX 4HNGA 4E12A 3ST7A 4R01A 1LX6A 2AW5A 2NNLD 3VC7A 5F21A 2X7HA 1NHGA 3PTZA 4LCJA 4YJHA 3VZSA 1PL8A 4HX5A 1UAYA 5FI3A 5DNAA 1GUYA 3L9XA 3FBGA 2CVZA 4BV8A 1E5LA 5ICSA 3EGOA 5CDTA 2YUTA 1F12A 4FW8A 3ITDA 4NG5A 4UEKA 3WJ7A 1N7GA 1A7KA 1T26A 3EY4A 5KJFA 1ZXBA 1ZO8A 1IUKA 1YJ8A 5FEUA 4J0FA 4IINA 4CLRA 4S3MA 1O94A 1RM0A 3PP8A 5JNLA 4ZQHA 4Z9FA 1U1IA 2O2SA 4WLUA 3U62A 3SXPA 5IN4A 4F6CA 1VSVA 1KY4A 2QIOA 3I5MA 2ZTUA 1KETA 4NI5A 1NR7A 1PR3A 1G1AA 4CV0A 4L9RA 1FMCA 5JC1A 3GUYA 1ZMOA 2WE7A 3WTBA 1ZSVA 1YKFA 1WP4A 3WDSA 1MG0A 1BDMA 3MCVA 4YJFB 3W4IA 1J49A 3LLVA 5I8ZA 3GDOA 1Z45A 2LDXA 3K30A 5IZCA 1B26A 3VDQA 2PK3A 3GN1A 1JTVA 4B3HA 2D5AA 5L51A 1PR9A 4UVDA 3I1JA 2X0IA 4B7UA 4NPCA 3RWBA 2EWMA 2Y0CA 4CLRB 4XQEA 1HDCA 2VHWA 3BTVA 3Q9UA 3FR7A 4YDRA 2R00A 4WOJA 1C1DA 5T8KA 2Z95A 3ONDA 5IDYA 4ALNA 2HU2A 4Z0TA 4EGFA 3LLSA 2FMUA 4J1QA 2JHFA 5TNXA 2Q2QA 1A4IA 4OQZA 3FNHA 1OAAA 1SEVA 1GZ6A 4CMBA 1YDEA 1U7TA 3WQQA 4EBFA 4R1NA 4AICA 3OEYA 4E0BA 4J4BA 1BXZA 5IZCC 2VYND 4W4TA 1M67A 2B4QA 4IJUA 3GGGA 2AHRA 5A02A 1AXEA 4OKIA 5LC1A 3ZNOA 3WGGA 4BNLA 4BNNA 1VL0A 2BGKA 5KTKA 3D4NA 1M6HA 4RZIA 4Z9XA 2HQ1A 3M2PA 2FN7A 1ZK0A 4ZVVA 4YA6A 5F3RA 8LDHA 2HJRA 5IG2A 3KSUA 3PJEA 3MJSA 2VOEA 4GGOA 4OM8A 3RCBA 1BTOA 4RO0A 3NTOA 1NR1A 3I83A 2Y68A 3ZWMA 3AW9A 4GH5A 3SC6A 4WLEA 3DWFA 3OJOA 4MVJD 3DMTC 3LF2A 3QWBA 1GD1O 1BG6A 3RU7A 4YAGA 1NPDA 2B4TO 4WEQA 3OM9A 2X8LA 4UUNA 3KYCB 4K6FA 4RV9A 3WIDA 1GU7A 5A3VA 2VRCA 3VPGA 1ZZEA 4WNIA 3NJ4A 1Z7EA 1LLUA 4FFMA 4NBRA 4BNZA 1PWZA 3QLJA 1TA4A 3AY6A 3L6EA 4R9RA 1XIVA 4CV1A 4ZICA 2HK9A 4GQAA 4RF4A 4CLHA 1VL6A 4YXFA 4U8GA 4DMMA 4HFRA 3LC1O 1E1KA 3GEGA 3JQBC 3ASVA 3H9UA 5EQFA 1M66A 3GEDA 1QRRA 3MTGA 1YOVB 4WKGA 4AJ2A 4DA9A 3SJUA 4RVHA 4BGVA 2EGGA 3GVHA 1QV6A 4YT4A 1RYDA 4B8ZA 4DBZA 5HWSA 1LA2A 2V65A 1R66A 1ULSA 2YJZA 3H7AA 1Z7BA 3NDIA 4NH4A 3RJ9A 4CMAA 1IL0A 3ROQA 4JJGA 1VKOA 2QZZA 3PYMA 2B5WA 3OMLA 3JQ7A 1WWKA 2C29D 4YVFA 2C5EA 1PJBA 2H1SA 1SMKA 1VI2A 3H9GA 1U8FO 4J3FA 2RH8A 2WD8A 1I3KA 2PA3A 1IPEA 4IQ0A 2O4CA 4J2OA 2IZ0A 4PRLA 1Y9AA 4W7HA 3RFVA 3H5NA 1A5ZA 1XU9A 4QECA 4CUJA 1BGVA 2LDBA 3HDJA 3IDSA 4YRDA 2HRZA 3RVDA 4G2NA 1K6XA 4LGVA 5ADHA 1VJ1A 1DIGA 3VH4A 2Y1OA 3QQPA 4DPMA 2FP4A 1BXKA 2EP5A 2RHRA 4CM3A 4IJWA 5EERA 1LDYA 3GZNA 4D45A 4DPKA 4WPGA 3FWZA 1OMOA 4BNMA 4AJIA 4CL3A 2JAPA 3EMKA 4AJ1A 4J1SA 5ENVA 1Q1NA 4XQ9A 3F4BA 5IXSA 1U8XX 3JQGA 4QEDA 1E3EA 2DBZA 2PGJA 1NVMB 1XDWA 5TSDA 4D3DA 2ZTLA 4BNKA 4UVGA 2AEJA 4EEXA 2BFOA 2W2LA 3ROPA 3OBBA 4DIOA 1K6JA 5JCXA 2POQX 1DPGA 3OICA 3I6QA 3QP9A 3RI3A 5DF1A 2NLOA 1C0IA 4E2YA 3AUAA 3L4BA 3PWZA 3D0OA 4FR5A 1W4ZA 3DTYA 4M49A 1UZMA 1HDYA 1JKFA 4II2A 3ETGA 2BHLA 4GMFA 1JAXA 1R37A 2HO5A 3TFQA 3UFXA 2WE8A 4Q9NA 3EDMA 5CFZA 3VAZA 1PL6A 4DQVA 1DRUA 1U2GA 3KYBA 2PGLA 2PD4A 4KTTE 4WLOA 3JQAB 5G0SA 2Y0EA 2O48X 5AYVA 5HS6A 4PG6A 4P4LA 2HMTA 1CDOA 3X2FA 1VRWA 2AQ8A 2X5OA 3W1VA 1OFGA 2OOSA 1ORRA 2Q2WA 4JJFA 3GVIA 1YS4A 2PH3A 1FDUA 1ZBQA 1WW8A 1NQTA 2A94A 2IEBA 4Q3BA 5HA5A 3AUSA 4Q3DA 2WDZA 1H2HA 1NFFA 2ZB4A 5T6BA 1CWUA 4BNYA 4FJ0A 4RDIA 3GQVA 2FSSA 2ZB3A 2PFGA 5BNTA 2A4KA 2EKLA 3KZVA 4FOOA 3VPFA 3B6ZA 3ZN2A 1WNTA 3QVOA 3WLFA 2WTBA 1MP0A 1QSGA 3U4IA 1DDOA 4FGWA 1LXCA 4J7UA 1UZNA 3ZHYA 4FC7A 1EUZA 3AUTA 3LK7A 4E2ZA 4MP6A 1I2CA 3BMQA 2X58A 3WYEA 3H9QA 1V0JA 2EJVA 3WJAA 2YV2A 3QJ5A 4R5HA 3Q0EA 4ALLA 1LEHA 3NEPX 1KERA 3WSWA 3H6KA 3ZZNA 1P44A 2VNAA 1N5DA 3H5RA 1PJTA 4YT5A 5KJEA 2GLXA 2ZTVA 2JAHA 3WFIA 4FS3A 2WD7B 4B4WA 3K2BA 4TRMA 1PJSA 3DZGA 3M1LA 4K26A 4PLFA 4U6QA 3DHNA 5FF9A 2PWZA 3NDJA 5JW6A 4YAKA 4K28A 5BT9A 3BHMA 3GHYA 4HFJA 3T7CA 1Q2XA 3F1LA 3KEQA 3FBTA 4E13A 1VJ0A 1WDMA 1GZ3A 2BH9A 3RKUA 4UEJA 1XSEA 2WSBA 4OQYA 1ZJZA 5JFOA 1P33A 4NBUA 2GN9A 5KJ6A 4XIYA 5GZ1A 3ICPA 3JQFC 3UN1A 4ND3A 4OKNA 1HDZA 2F1KA 2C54A 3KVOA 1GEEA 1PZHA 5GZ3A 3V8BA 3JTMA 1QYXA 5L7TA 3ZNPA 5LDGA 5KKAA 3DBRB 3G17A 4IDDA 4FCCA 3OJLA 4KP7A 5F1PA 1KIFA 3ENKA 3FWNA 4XJTA 1X7DA 3GRPA 4WLVA 3UGKA 4E21A 2DFDA 3PHLA 5H82A 3SVTA 2B69A 2JD0A 2BELA 2ZYAA 2YY7A 5I8WA 1HZZA 2JFGA 2V6FA 4J0EA 2ZYGA 1LDEA 4KOAA 3RUHA 3V5NA 2CD9A 1GPDG 3LF1A 1V8BA 1UP4A 3HZZA 1ZMTA 6ADHA 1HYEA 1SBYA 4PZDA 1EQ2A 2X0NA 4P22A 1V6AA 3DONA 3PWSA 3V1TC 3VTFA 4BKOA 4EJMA 2EERA 5TGDA 1YONA 2JD2A 2PZKA 4FIZA 3WG9A 4YTEA 2B37A 2P9EA 4MP8A 3L77A 4HADA 4WCFA 2FR8A 2I3AA 1NASA 1PZFA 4CMGA 4RF3A 1XCBA 1EVJA 3MJTA 4D46A 2GSDA 3WGTA 1TXGA 4IUYA 4EUEA 1NQ5A 1D3AA 1J5PA 4D3FA 3PIDA 1N8KA 1BHSA 4DC0A 3W8FA 4I9NA 4DC1A 3AM4A 5B37A 3HE3A 2Y1GA 1DC5A 1NQOA 1N1GA 2Y1FA 4LCEA 3LQFA 3OA0A 5AXBA 3RUDA 2TMDA 3TFOA 4KMSA 3MJ4A 1Z74A 5L4LA 1X15A 3F5SA 4J49A 2DPGA 2AA3A 3V1UA 2VZ9A 4Y6PA 4O0LA 3VZPA 4R3NA 1SEPA 4B4UA 1LDGA 1M76A 5DP1A 3O38A 3D3WA 4ND5A 3VDRA 4RGBA 3ZV6A 1QXSA 2P2SA 1XGKA 4DTIA 4RVSA 5JMWA 3SC4A 3O26A 3PQFA 4IGEA 4IMPA 3O8QA 1CQJA 2JKVA 1H5QA 5DDIP 5GZ6A 3D4OA 4RVUA 1PJQA 2J5RA 3TRIA 3DZBA 3TOXA 4PLTA 3DOJA 3IAHA 3MOGA 1UP6A 1MFPA 1R4MA 5ITVA 1CQIA 1O89A 1RPNA 2DTXA 3GHHA 2Q99A 4JJIA 3AOEC 2CDAA 2FZEA 4W7IA 4CL8A 4FC6A 3K8ZA 2EV9A 4NR0A 3RUAA 2RH4A 4NK5A 5L40A 3GDGA 3QSGA 1QP8A 5HBRA 4YACA 3HDQA 1UP7A 3HB5X 1HDGO 3AK4A 3H2ZA 2O3RA 3VKUA 1LI4A 2GCGA 3C3XA 4RPLA 2OO5A 3RD5A 1YWGO 2ZB7A 2YQ5A 1NNUA 1E0DA 1JVBA 2GF2A 1GQ2A 4MIYA 5C7OO 2PZJA 2YFHA 3DAPA 4BQRA 2VN8A 1TT5B 1EMDA 4A26A 4BUCA 2I9PA 1DFIA 3E1KA 2VT2A 1HT0A 2PKRA 3WBBA 3IKVA 3G1UA 4L4RA 1LLDA 1V3TA 2RAFA 1ENPA 1YBMA 3L6OO 2A9FA 1I32A 5A3JA 2C2XA 4BNWA 1BVRA 2AE1A 4WASA 3WMWA 5JYEA 3NGXA 3JQCA 5ENDA 3OJEA 4CMIA 1UXJA 1OZAA 1DHRA 1LQUA 4N54A 3HG7A 1U4SA 1EZ4A 3TSCA 1ZCJA 1LUAA 2AMFA 1CYDA 2QX7A 2W98A 4NBWA 3DBVO 4ALMA 1VKNA 3TPCA 5HTOA 3G0OA 2VWGA 1AN9A 1PSDA 4ND4A 3T4XA 2HLPA 4CMJA 1PGJA 4CMEA 4A10A 3FCOA 4OGWA 5I9NA 5A05A 2VNSA 2QG4A 4WCDA 4OJNA 3IIEA 1NPTO 4GVXA 2GDZA 1TT7A 1CRWG 2QYTA 3AOGA 4QQRA 4E5PA 4YYZA 2I99A 2W90A 2YW9A 3I9MA 4KWIA 2EKQA 1ZK3A 3WLEA 1ISMA 2FR0A 4XA8A 2X6TA 2CSUA 4NJMA 3WNVA 5IDQA 4JROA 5AXCA 1LDBA 2PKQP 2PV7A 3HN7A 4XGNA 2D59A 2J3HA 1WVGA 3L9WA 1YXMA 3IKTA 2OUIA 4R41A 4MVJF 5GMOA 5MDHA 4YJGA 3JSAA 4CM4B 1N7HA 1H0KA 2QQ5A 3PYLA 3PLRA 1HE5A 4LN1A 2HSDA 3R3SA 3OJFA 3DZHA 3IOYA 1ZEMA 3HNPA 2H9IA 3GAFA 1I24A 3DL2A 5EN4A 1AXGA 1J0XO 3VH3A 4PRKA 2FPGA 4XIJA 1U3VA 3E5RA 4J1TA 1MC4A 2X9GA 1I36A 1PQUA 3F5QA 4R1SA 3TZHA 1FDTA 1UXGA 2VYVA 2GYYA 3O8QB 4NU6A 5CHEA 2V7PA 4N18A 4RF2A 3QVWA 4KQWA 5G0TA 3FF4A 1DO8A 1HE4A 2J5QA 1MV8A 2P68A 1F0YA 4LRSB 4BKRA 5B4UA 5EPOA 2P5YA 5TJ9A 2ZKLA 4EI2A 1NBOA 1QMGA 5L95A 4XGIA 4O1MA 3DOCA 4MKRA 3TZQA 4CODB 4FFPA 1ISHA 2Y0DA 1XLTA 2OHXA 2DBQA 4A27A 1A9YA 2DQ4A 3INRA 3BHJA 2YHIA 2FR1A 3U4DA 1AHHA 4QFCA 1H6BA 1BVUA 4XWYA 2J5KA 4B4OA 1MC5A 4DQUA 5BSEA 4DPLA 1N92A 2EW8A 1Q0HA 5JDIA 4MVJI 4J9UE 4CMKA 5ILOA 1P3DA 3ANLA 4AL4A 5DCWA 1YBAA 5DT9A 1TT5A 4TRNA 5IN5A 1NHWA 1WPQA 1PZEA 1YOVA 2P4HX 2JFHA 4CM1A 5I7FA 2JJYA 4XEHA 4BNJA 1CIVA 3KYDA 3UCXA 4CUKA 3GR6A 2X86A 3JQAD 2B35A 4DUPA 2GASA 4YR9A 4DXHA 3GMDA 1HDRA 4K1LA 2NVWA 4BKQA 5CEJA 3IP3A 2H5LA 3LSYA 3PI7A 1T2CA 4CLXA 5BQFA 3VKVA 3S1LA 3GH3A 4CMHA 2QRLA 3ZWCA 1NFRA 2X9VA 4PZEA 4EJ0A 1NFQA 1W0CA 1W8DA 4UVHA 4TROA 1TLTA 5F1KA 3DC2A 3CH6A 2Q1SA 2V6BA 3KTDA 3ZWOA 3E9MA 1ZK1A 3K96A 3DOOA 4IMRA 4IPTA 1GDHA 3MJVA 3PIIA 3IUSA 4PVDA 4R51A 1GQQA 4E32A 5CDUA 1PGQA 3HWRA 4ZQFA 5KJCA 4BO7A 2NWQA 1SAYA 3GDFA 1VPDA 4IGFA 3I9OA 3ETEA 4RQUA 1RKXA 4OH1A 4P4GA 3R0IA 3KM0A 1DIRA 1NQAO 5CG1A 4LISA 1PS8A 2IEDA 1R16A 1B16A 5KVVA 1GCUA 3GF4A 4KUGA 1NP3A 2C07A 1GZ4A 2VUSA 3DBLB 4J43A 4NMHA 5G0VA 3ZW8A 1X7GA 3U4CA 1LBEA 5C5IA 2Q45A 4CLOB 3B20A 4MVJP 2PZLA 4H16A 4D42A 4DVJA 2YQ4A 4PLVA 4BHTA 1ARZA 1IPFA 4FFLA 1MUUA 3S2EA 2EW2A 2O23A 3C7AA 4R3WA 3D3EA 3GFBA 3UH1A 3H65A 2AE2A 4XDZA 1P0FA 2UUPA 5JY1A 4DYVA 5F5NA 3AM5A 1XG5A 1PIWA 1WDKA 4C4OA 2HDHA 4AJEA 1U3UA 1ZEJA 2I6TA 2B4RO 3JQ6A 1NAIA 3ZW9A 5U1PA 2E37A 1JN0A 3PDJA 2YHIB 1B2LA 4IDBA 2GRAA 4L8VA 5DBIA 1Y9EA 2XXBA 4H15A 3RUEA 5JC8A 4A5OA 1M2WA 4PG8A 1JU9A 5HRUA 2HMSA 3ZWPA 4WLNA 4MINA 3GPIA 2NM0A 1U5AA 3MEQA 1XELA 4LW8A 1V9LA 4W9NA 4J7XA 3ZWVA 4CM6A 1MXFA 2PZMA 1TVEA 1IY8A 4J9VA 1MFZA 3PLNA 4PFJA 2P4QA 3WICA 1ZKMA 1J4AA 1LLQA 2DTDA 4I5FA 1PGOA 2YYYA 2D4AA 3ZWYA 2VUTA 3P2YA 3GY0A 1K89A 3JQBA 4URFA 3IMFA 1I10A 2HRBA 1ZK2A 4DLBA 5L53A 1VSUA 3E03A 1T25A 3P7MA 2YV3A 3EZLA 1SO8A 3CUKA 1PU2A 1DB3A 4K6CA 2P9CA 3A9WA 2Q50A 3KO8A 4F46A 2RBEA 4W99A 4TZKA 5JO9A 3SJ7A 3ZGYA 2EXXA 2AG5A 3AU9A 4IS3A 4L73A 4ND1A 4KZPA 3I6IA 4MVJA 5L4NA 3ZHZA 5LDHA 1Y1PA 1E6WA 2W4QA 1R4NA 3JYNA 2VHZA 3L4SO 2EGHA 3I4FA 1DBVO 3U3XA 1E3WA 3K2EA 3DDNA 4PLYA 4J4HA 5KJ1A 3TOZA 2JCYA 4GX1A 3S2IA 2BI7A 4K9DA 2XAAA 1K2WA 2HK8A 1YL7A 3H5AA 2WEKA 5A04A 1IZ0A 1PJCA 2ET6A 1V35A 3NUGA 4JCOA 1MLDA 1K5HA 4KUHA 1O95A 3AFNA 5JAQA 4BNGA 3TF5A 3PZBA 1HDOA 4MVJM 1HTBA 4YRAA 1N9GA 3PWKA 4KDFA 2WWRA 4BVAA 4JIGA 3RUCA 4O6VA 1KYQA 4FBGA 3ZWXA 2J6IA 1IB6A 4ALKA 3HDYA 5KCZA 3GNSA 3LYLA 4ALJA 2DPHA 2OORA 4NHEA 5COBA 1E3IA 1PGPA 4ZQBA 3TWOA 1KC3A 1X13A 2E4AA 4IXTA 4DYDA 4U7WA 1FF9A 2WD7A 5C37A 4OAQA 3ASUA 3GC6A 2NU8A 3H9JA 4RQTA 5TT1A 1ZNQO 3DZJA 4A0SA 2HJSA 4RL6A 2O7QA 3ZH2A 4IIVA 4B8WA 3MTJA 3IQDB 4YAJA 3TZCA 1EE2A 2JL1A 5KVSA 2I5PO 2D0IA 3EUWA 4JGBA 1P77A 1Q0QA 2O3SA 4E5NA 1K3TA 3M6IA 2G82A 3D3WB 5AXAA 4J1NA 4DMLA 3VZRA 5CEFA 3UUWA 1EVZA 2NTVA 3U9LA 4QSMA 2CVOA 4GSLA 3H9EO 2GN4A 3RFTA 2NTJA 1HETA 3K9QO 4Z0HO 3GN2A 1R6DA 4BB5A 1GV1A 1DLIA 3KUXA 4RLSA 3D7LA 3NX4A 2NTNA 4J16A 4Q3AA 5JDCA 1WXDA 4M89A 4W82A 1DJQA 3ZV4A 1QYCA 5TT0A 4J90A 5C7IO 1TEHA 1FXSA 3P2OA 1DEHA 4KUEA 1T1RA 2C82A 4B7CA 3R1IA 2VYVD 5K9ZA 3LVFO 1DXYA 2DT5A 3QIVA 4CR6A 1ID1A 1QLJA 3RJ5A 3H8VA 5F1OA 2OBYA 4MIEA 1GFSA 4XQGA 4N5MA 1FJHA 2X5KO 3WWYA 4BB6A 4W6ZA 3V1YA 3ROMA 1H93A 3HSKA 4Y6SA 2Q4EA 2Q4BA 2HMUA 4R5MA 4CM9D 3MZ0A 3GA0A 1GQYA 5LCXA 1RJWA 1E7WA 3G49A 5T57A 1KC1A 3OP4A 1L7DA 3F3SA 4IQ8A 4J2HA 1GUZA 2GGSA 3L6DA 5JY6A 4HNHA 3PZRA 2O2YA 4RVFA 4GX5A 5CDYA 3VHRA 2NVUB 3F46A 3I9JA 4RVDA 3I9LA 3SLKA 3UF0A 4II3A 3HQ4O 1EQUA 1BRMA 1DSSG 5DBGA 1Y8QA 4GAEA 1EK6A 2IYPA 4E31A 5AQ1A 4HWKA 3VTZA 4Q3CA 3CZRA 2BF7A 1XWFA 1YE3A 3EYWA 4BNIA 3WGOA 2V6MA 2NVUA 3RAJA 4JQCA 1U4OA 2PD3A 1JKIA 1QKIA 3HJAA 4YJGB 2E49A 3WTCA 4MP3A 4GPD1 2DVMA 3PJGA 2PLAA 5KNLA 1DLJA 4FFNA 2NVBA 4I1IA 4BO9A 3DBHB 3HB4X 1UXHA 4D43A 1EE9A 4HUJA 4HKTA 4XYMA 4C7JA 4ZD6A 4E2XA 5JBIA 3IJRA 5TX7A 5BSHA 4NBVA 3JD2A 1ENZA 4LMPA 3QVXA 2OMEA 3PFFA 4FDAA 1UR5A 9LDTA 1LSOA 3JV7A 4TSKA 3AI3A 1L1FA 3G79A 2O3TA 2J3IA 5DCYA 1FK8A 2C0CA 5ICMA 3P19A 3W8DA 5BNFA 4LRTB 2G76A 3A4VA 3AI1A 1DC4A 1MA0A 4OHUA 3BXXA 4U5QA 1DRWA 1T2EA 1YRLA 4ID9A 4CV2A 3CTMA 4HV4A 3H3FA 3OQBA 3INGA 1YQGA 5FYDA 1Y8RB 2W2LD 4CUZA 2EEZA 1VC2A 3RQSA 2GN6A 4Z6KA 2WYVA 4I9HA 4B7XA 1F06A 3NV9A 1UDAA 1G0NA 3HUDA 4UVEA 3ZNQA 4PIVA 1PS0A 5I9LA 4GGPA 4L74A 1YB1A 4ZRMA 4IQGA 3C7CB 1C3VA 1OC2A 3OJ0A 3OIFA 3E6AA 4YJDA 3W6ZA 4ITUA 1OBFO 2ZK7A 3WSVA 1H6CA 4ZQEA 4YEDA 2RCYA 1LRLA 3FI9A 3D4PA 2JD1A 4IY1A 2AQHA 1X14A 4A7PA 3GPDG 1LU9A 2UDPA 2X4GA 3DQPA 1PJLA 3WWZA 1XHLA 2I76A 4MDHA 4E3ZA 4GX2A 2X1HA 3C24A 4ILKA 3FNFA 2VHXA 3ULKA 4I9UA 3AU8A 4N5NA 1LSSA 3EC7A 2ZQYA 3L07A 5L7WA 1U3WA 1E3JA 3KYCA 1Y8RA 4MJLA 5DBFA 2QW8A 2OP1A 2Y05A 4JLWA 4XYEA 2Q3EA 2VZ0A 2FPIA 3GRKA 1UAGA 5AVOA 1GYRA 5L7YA 2ILTA 1C0LA 2RIRA 3M2TA 3TZKA 1DJNA 2Q1TA 2Q1UA 3KB6A 5CEEA 3PJFA 1UJMA 4WE3A 3AY7A 4CMEC 3QVSA 1SZJG 3GG2A 4OL9A 3UCEA 1EEHA 2BFMA 4HFMA 1ZSNA 2Q46A 4NZ9A 4GVLA 1YQXA 1RYEA 4Y98A 2PH5A 3IUPA 4MOWA 3CZMA 2D5CA 4MO2A 3WQSB 2VHYA 3U49A 2PNFA 4D41A 3ZHXA 1YL6A 3KOUA 4MIOA 4JNKA 1C0PA 4ZN6A 5KKCA 1DHTA 1LC0A 4TRJA 1CF2O 4DIFA 3FRJA 1P1RA 1O8CA 4PLPA 1R0SA 5T5QA 5JAZA 4OO3A 5JDCC 2W2KB 1HE2A 3D5TA 3HFSA 2NSDA 2ZCVA 4G65A 2OFPA 1T2AA 2NU6A 2DTEA 3A28A 1GYPA 1VL8A 1YO6A 3AOEA 2DAPA 4CJXA 1PS9A 2DM6A 4CLOA 3VZQA 2AXQA 2OZPA 3I4CA 3JD4A 5COAA 1CERA 1EDOA 3BZUA 3S2GA 3C1OA 1IOLA 3CPSA 3FR8A 1T2FA 2RHCA 1YB4A 3ITKA 3PPIA 3WGIA 5IZ4A 3LT4A 3VOSA 1IE3A 2GO1A 3KBOA 1JAYA 1I30A 3GLQA 2A35A 5L4SA 1Y5RA 3ONEA 5A5EA 3A14A 4IDGA 1Q7GA 3RC1A 3WQRA 5JSFA 2O7SA 4OMUA 5L9AA 1E1LA 4L75A 3L0DA 2NACA 5T8KC 3ENNA 3PVZA 4XYLA 2EF1A 3KRTA 1EDZA 4D44A 1E7RA 4NJOA 1WDLA 1H9BA 1TB4A 4LVUA 1PZGA 4XR4A 1A27A 4BO1A 3GVXA 4PGFA 4U0KA 2WJPA 1NWCA 1PJ3A 2FY8A 4XX0A 5I7SA 3JQDA 2HAEA 1SPXA 2GZ2A 2NUAA 3VH2A 3ABIA 4NDNE 5JAMA 2QHXA 3WS7A 3UOGA 1ISIA 1U3TA 1KOLA 1A7AA 4YBZA 4DGSA 4YPOA 4IJVA 3UICA 3K92A 1P0CA 2J3KA 3DFUA 1D7OA 1LDNA 4BMVA 4J7CA 4XB2A 1O0SA 3JQGB 1NTOA 3JQFA 3BA1A 5COQA 4UUPA 4CQMB 2QRJA 1UUFA 4BKUA 1ONOA 1P1FA 1ZUD1 2IRWA 4TKMA 5IDWA 4AFNA 5IXYA 1I8TA 2XPCA 3JCZA 1DC6A 1OOEA 4WK6A 3CINA 5IJZA 4EZBA 2IXBA 4CQMA 1QYDA 3IL2A 3OA2A 1EUDA 4YRBA 2Y93A 1I0ZA 1ENYA 1ZSYA 2ZJ1A 2BFPA 4TVOA 1ZH8A 2Y66A 4ROSA 5GY7A 5I7EA 5DOVA 4FD3A 4BO6A 3TNLA 2DU8A 1KS9A 2Y1EA 2PY6A 3WB9A 2EJWA 3QWIA 2OL4A 3UAGA 4ESOA 1UH5A 2B83A 2JFFA 3ZNNA 4BS9A 1SNYA 4PN3A 5J23A 4FSHA 1KEUA 2JCVA 3ICCA 3GFGA 1KVTA 2CFCA 2Y1DA 3MJCA 5F5LA 4BOYA 1UZLA 1LTHR 4TKLA 3BAZA 4E5KA 3DZKA 5KVQA 1A9ZA 2UV8A 4PLHA 1YL5A 4Y6RA 1OC4A 1A71A 1U7HA 2J8ZA 3AY3A 1EFLA 3HHPA 4JBHA 4BQPA 5CG2A 3ZWWA 3NYWA 1L7EA 4OOFA 3IC5A 3EW7A 2YZ7A 1P1IA 1KVUA 1PQWA 4IDFA 1C0KA 2Y1CA 4N5LA 4UULA 6LDHA 5I9MA 5TS3A 4D0RA 1UXKA 1VE9A 3QA9A 2E6UX 4E30A 3QE3A 4FPXA 1LSUA 3IP1A 2FWMX 4IDEA 3ON5A 3C8MA 5G2OA 4RPJA 3K5PA 5KWEA 1R4NB 1Y5MA 1PX0A 3GAZA 4BL5A 2P9GA 2GERA 5CPFA 5ER9A 4E6PA 1Q0LA 1RM3A 3WYCA 2BKAA 1A4UA 1MB4A 5CDGA 3WGHA 1R4MB 1I2BA 2VZ8A 5U4QA 1GTMA 2CZCA 3ZWBA 4GX0A 1GUFA 4QO7A 1T4BA 3LZ6A 4XJSA 2BGLA 1XQ6A 2V6GA 3BMOA 3LC7O 3WBFA 3WFJA 3PQDA 3U0BA 1Y7TA 5K0ZA 3QV1A 1V3VA 2YFQA 4DRYA 3DR3A 2BI8A 3Q11A 1LSJA 4IDCA 3NTQA 3PRJA 3WX0A 1GPJA 4LSMA 4YWJA 4CMIB 4XD2A 2HMVA 1E3WB 3HDHA 3OFSA 3GOHA 3OF2A 4NU5A 4FJ2A 3D5QA 4ZGWA 3KLPX 2I65A 3ANNA 2VYNA 1B0AA 2ZYDA 4N7RA 4J6FA 1H9AA 2B5VA 4IZIA 4L76A 1VM6A 4L4XA 4O5OA 1VLLA 1JWBB 5DCUA 3S55A 3CSDA 3PFWO 2DUWA 1ZW1A 4U0JA 5A9TA 1HYGA 1AE1A 3DB2A 2VWHA 3FPCA 3JD1A 4IS2A 4BV9A 2VOJA 1I33A 1LLCA 3GNQA 3NJ8A 3VVBA 3S2FA 1DIBA 3Q9NA 3GZNB 4R54A 1RM4A 4NFYA 3Q2IA 4GKVA 4QXMA 2UVDA 2W2KA 5JDIC 2NQ8A 4IXWA 4M1QA 1X1EA 4PG5A 5TRTA 1K6IA 1LDMA 4ZQGA 5THKA 1T24A 2D2IA 3JQEA 4LK3A 3RASA 5CAEA 5K6AA 3KV3O 4CR7A 4CM8A 1W73A 5KOIA 1LRJA 5B4VA 3PDUA 4FQ8A 4M86A 1P74A 2PD6A 1T2DA 5T64A 5ER6A 3MJEA 3GEMA 1HSZA 1D1SA 3R6DA 4J4TA 1Y6JA 4GLLA 3O9ZA 5IF3A 2VWQA 2Y67A 1F17A 1AGNA 1I2ZA 3JQ9A 3KEOA 2X0RA 3NT2A 3WGYA 1S7CA 2OP0A 3AWDA 2G17A 2X0JA 4Z0PA 3KSZO 4HFNA 2Z1MA 4OSOA 4WCFC 5EESA 3ZHBA 5G0UA 1JLLA 2OXIA 1E3SA 1DC3A 3BTOA 4QUKA 5MGBA 1ONNA 5G4KA 4CMCA 4R68A 1EFKA 4NJMB 5FI5A 3G3EA 4RJTA 4JBIA 1G6KA 5ILGA 2WYUA 2VRCD 4E5YA 2EKPA 4EITA 4D7AA 3B1JA 4EJ6A 5DOZA 4Y67A 4MVJG 4NFSA 1NPYA 3RROA 1RWBA 3ZU3A 1JA9A 2YDYA 3W4JA 4ALIA 4R1TA 4NK4A 2J3JA 3JD0A 9LDBA 3ZWAA 3ADPA 3GT0A 1QORA 1CETA 1YJQA 1Z6ZA 2VHVA 4RORA 3DHEA 2Q1WA 4PG4A 1XR3A 3FNEA 3QY9A 5EMHA 3ZV5A 4DBVO 1E6UA 1QLHA 4PCVA 2G1UA 1VJTA 2C20A 4JX8A 3FHLA 1NM5A 3D1LA 4XGKA 3C1AA 3OQ1A 3E5MA 1F8GA 1SCUA 2IXAA 3F9IA 1HEUA 3GK3A 3PHGA 3GZ4A 4EW6A 4X54A 2XF8A 5JO0A 4G81A 4BNHA 1LC3A 2O3QA 3Q2KA 2GZ3A 1Z73A 1ZK4A 3TDKA 5BR7A 1R15A 4HP8A 4TRRA 4RPGA 3BTSA 1I01A 3V2HA 4AJOA 1BSVA 2QYSA 4XQCA 1WMBA 1IHYA 1E7YA 4FGSA 2CVQA 3RBXA 3FN4A 2C7GA 2CUKA 4BIIA 3KYDB 1FDSA 1B8PA 2Y99A 3EZYA 2VTDA 4XDYA 4ZA2A 2FSVA 3VPSA 4ZJUA 8ADHA 2QZ9A 1U2DA 3O03A 1WLYA 4RPKA 1EBFA 3PQEA 5AOVA 1E1MA 1Z82A 3B1KA 5B12A 4Q3EA 2BRUA 1LJ8A 5CP8A 3TZ6A 3ZU4A 1CEQA 2VRBA 2VWPA 2JHGA 3JD3A 2IODA 1KEWA 3PK0A 3KXDA 5I7VA 3JYOA 3E82A 5JPIA 1QG6A 2O3JA 1U28A 1J6UA 1CJCA 4FJ1A 5B4TA 1G0OA 2AQIA 1N1EA 2ZATA 2C7VA 1EVIA 3KSDO 5FFFA 4YB8A 1T1SA 4WCFB 1U9JA 3DBHA 3BMCB 4YJHB 3DEYX 3SBOA 5U9CA 3B1FA 1HF3A 1NXQA 3AUUA 3NAQA 4BO8A 3PGXA 3W8EA 2ZCUA 1HE3A 4GBJA 2B36A 1DAOA 1TI7A 3Q1LA 2FRDA 1D4FA 1HWYA 2CDCA 2SCUA 4QTZA 4XR9A 3UXYA 1I5RA 2NV6A 3BMOB 4YAIA 2JCXA 5TF4A 4A2CA 3OSUA 2CF5A 3GVPA 5IFLA 3FPLA 3ZDFA 3RC7A 1H2BA 4Z3KA 3WGZA 1F14A 4AJKA 3F1KA 2E48A 4YQYA 4Q39A 1SC6A 2HCTA 1P1HA 1ADCA 3DXFA 3STHA 2WMDA 3ADOA 1P45A 4BNUA 3BMNB 1E6EA 3RUIA 3BYZA 1IULA 3I23A 7ADHA 3E8XA 2CF6A 4BNXA 3U5TA 1H6AA 4BO0A 3MWEB 4EDFA 1IYZA 4R69A 2P5UA 4A03A 1EK5A 1XKQA 4L4SA 4UUOA 3ZU5A 4BNTA 3E48A 4NBTA 2I3GA 3WIEA 2D1YA 2PTGA 3ANMA 3H4VA 4YAEA 4I8XA 3WNQA 1JQBA 4IM7A 4LMRA 1ML3A 2PR2A 3DBRA 2B0JA 1LNQA 5EL0A 2IE0A 4CM5A 4M54A 4JK3A 2IZZA 3AM3A 1BW9B 3KHUA 5IDXA 4NFHA 1BDBA 2UAGA 1NYTA 4UREA 5G4LA 1AHIA 1GV0A 1QR6A 4R4JA 4CQLA 4TQGA 2EHDA 3PHIA 2BGMA 1IHXA 3UW3A 4E5MA 1Z75A 1PWXA 1X0XA 1WMAA 4C7KA 1WZEA 1MGOA 3OIGA 2CMDA 3AJRA 5B1YA 3FSRA 4WUVA 3K73O 4GWGA 1E1NA 4PLZA 4PLCA 1P1JA 1V3UA 4D0SA 1BMDA 4GWKA 3IJPA 2PKQO 2Q2VA 2FZWA 4BNVA 1RM5A 1YQDA 3FTPA 3DMYA 5ES3A 4BGIA 4RPHA 3ORFA 5AXDA 3M1AA 3NKLA 4RF5A 4CM4A 3PJDA 3RBVA 1Y81A 4FB5A 3N74A 1GY8A 1I3NA 3H3JA 3T7EA 4QX6A 1ENOA 4KQXA 2EP7A 1LQTA 1ADFA 4JN6B 5BSGA 3HADA 3JQ8A 3RBZA 4Q3NA 5JAIA 5JMPA 3E9QA 1PL7A 2O3UA 2HUNA 1ZJYA 3CMCO 3U09A 3VPXA 1NVGA 7MDHA 4AJPA 4CQMD 1H6DA 3DMTA 4BMSA 4DIBA 4BO4A 4FN4A 4QFDA 3OEWA 1C1XA 3GGPA 2XOXA 1WAMA 3ROKA 4IDAA 1ZFNA 2VTEA 3PYXA 3PEFA 4JBGA 2I66A 1XEAA 1ISFA
chains in the Genus database with same CATH superfamily
4P80A 3X0DA 5ICCA 1Q15A 3AX6A 4CLDA 5LU8A 1K27A 2CJWA 3RJZA 2GEBA 3EAGA 2E4YA 3L5KA 2G9QA 1FS5A 3E9EA 5BN5A 3IQIX 4PYIA 3DZFA 5L3VA 5M04A 3JQAA 3QK7A 2C2YA 5HXAA 2VK1A 3DAFA 1FPQA 1JKMA 4P2GA 4O33A 2F43A 4FNAA 1S9DA 3KT3A 3HU1A 1NX6A 5DM2A 4WINA 3SM9A 4Z7NB 2CL7X 2VDUE 3D3NA 5JJKA 1Q7CA 4YFVA 1WBJB 3HWX1 1GGVA 1R8QA 3I76A 1Y8QB 4JKIA 3UAZA 1UXIA 4ZHQB 3MWKA 3ZXUB 2G9ZA 5K8JB 1WBBA 2ZUVA 1E7MA 4LNAA 4LOLA 4WJZA 1ACLA 1X8LA 1LNSA 2RHWA 4CKBA 1QH8A 2NADA 3GRZA 3JWJA 5EXTA 2QL6A 1YT5A 3HBJA 3CNEA 3T9FA 4AYTA 1GZ5A 1GEGA 1MIOB 2FW1A 2WHQA 3LY5A 4G37A 4QLAA 5FWYB 1M2GA 5GONA 4NV1A 4DQXA 5EP2A 3FOZA 4NNPA 3C7TA 2PXAA 4Z4QA 1G8GA 1QGUA 1Y5IA 2KBEA 4BP8A 5KYYB 1XCLA 3FTQA 1FVOA 4YWHA 3KWLA 1APBA 2NZXA 2HV9A 4NIMA 1RCUA 3C6XA 1QQ5A 2FETA 3C16C 2PJUA 3H1GA 2A0UA 4EZIA 2BT4A 3VDXA 2HHAA 5BN3B 4MI6A 4DZTA 3VNAA 1HG1A 3FX2A 3V2GA 1DFHA 3OH8A 2W2QA 2J3EA 3PU6A 4DSTA 4PLGA 2WAMA 4D8YA 2O4UX 5BN5B 4EUFA 5BNZA 3DVQX 4MICA 4DWVA 2AVDA 4RKQA 4WGGA 5DCLA 4YMGA 3VH1A 4ZO9A 3G89A 1DIAA 3C6YA 3IS3A 5DTJA 1F20A 1PBTA 5TMDA 2CJXA 1XQ1A 4MHOA 4RLHA 2Q0HA 1SUCA 1EP2B 3AI2A 3Q85A 1J8QA 1R0YA 1SA0A 4RK5A 5EUBA 2XQGA 5E4YA 3K31A 4BFCA 2R2GA 3L7MA 4FFBA 1CUAA 5DSZA 4QXPA 1UIRA 1J42A 3F9RA 3FKJA 1LWOA 2QAGA 3IEKA 3PC7A 4E4YA 1BJKA 1SHJA 2F1JA 1WU7A 4TSRA 1TYBE 1MG5A 2ASVA 2Q3FA 5EP4A 2HU5A 1XHEA 5FI0B 1L8LA 5FORA 3Q3JB 1HDXA 1XZMA 4F84A 3GLGA 4XKJA 2NPOA 2XGGA 3CE6A 4RD2A 2H07A 1L8OA 4O4HF 3GPBA 1IY1A 1M10A 5L3SA 3LWNA 4GNRA 5M34A 1DQNA 1ISGA 2BMAA 3OZWA 4I5GA 4GQIA 3EVTA 3SK0A 5A4DA 5FV4A 3JVVA 3CPJB 2VTBB 2CY0A 3DEKA 5E7QA 3ME5A 1JFTA 4XM1A 4F04A 4EFKA 2ZUFA 3U3MA 3KOWA 5G4KB 5B58T 3TJRA 5A1TA 4PQYA 4MVCA 2WDPA 4E5VA 2QTHA 1AB5A 3GJ7A 4K3VA 5JCJA 1M75A 4EJFA 2OUKA 1E20A 2NU7A 1YS1X 4EB8A 1V1RB 4YUYA 2A5FA 4F45A 3M3HA 4JXKA 2DBRA 1QUEA 4DLNA 3I9NA 1H8EA 2ZB8A 4F3TA 4OYRA 5LQDA 4JGIA 3TCKA 1FTSA 1VHQA 2ILVA 3QEBZ 1OU0A 4R7GA 1L9XA 3PCXA 4PZPA 2VBFA 3FGZA 3WOHA 4JWKA 2BM0A 2X8AA 4IMJB 1Z62A 1BFUA 4KN6A 1QP4A 3M4YA 3ESZA 3JQ7B 2IW1A 4QTXA 1DAFA 1LZLA 2J7PD 4ZVTA 4HRXA 2MMGA 3T1OA 1NY5A 1YFLA 1IEVA 3QNMA 5KTOA 3WP0A 1QH8B 3DDOA 1Y5NA 5BNIA 5F9HA 3GVCA 1G5HA 2AYXA 5CW1A 1ZLXA 3G1TA 3P97A 5EVJA 4AVYA 3GRVA 1QMPA 1GLGA 2V55B 1ZD3A 3LUDA 1OX4B 3K8YA 3LYUA 3BGDA 1RLJA 2EARA 1C30A 4GD3Q 4XM2A 4YV1A 1XU7A 2MSDB 5AW9A 2FVXA 5DN6A 5JH7A 2F4VB 3QUSA 4PVCA 2ZQZA 3H2BA 4IHJB 4JP2A 3LOUA 1GCIA 4GYKA 4UFOA 1U9ZA 3RWMB 4BGEA 1JIIA 3VKGA 5FULA 2BHTA 2AVNA 1GADO 3E1GA 2OCDA 4GICA 1FJXA 3SLGA 2IGTA 3BTUA 4QNNA 1K7CA 4EPTA 1SOWA 2WZBA 1LH0A 2VJPA 1GNVA 5LR6A 3HJGA 5JZOA 4WFKA 3DEZA 4Q93A 5BURA 7AT1A 3E3AA 2R6JA 2AXNA 3P71T 3EFOB 2HW8A 1E3MA 1P5JA 1WKBA 4ZJPA 1PFWA 2P62A 2PGDA 3S8EA 1K92A 1MQ8B 2ZE5A 3TBFA 3UNXA 1NVDA 2P9JA 1AS0A 4CG0A 4CKWA 1QZXA 1GGJA 1TL7C 1U9IA 4IZHA 3EFHA 5H59A 4CU2A 1JXOA 1UMCA 1XLUA 1Y89A 2I4RA 3R5SA 4ZRNA 3T4EA 4A3SA 4AURA 4DCVA 5LMCA 1RAGA 1W0JA 4AMGA 1T4DA 1QKKA 3MOSA 4OXYA 3IE0A 1FZTA 3IQWA 2H52A 4B73A 4IVNA 1JW9B 3NT5A 3LKZA 1UT5A 2QVGA 5BQ5A 5AXBA 4UEOA 1DKPA 2YV1A 1CSEE 2G5GX 3WSTA 4C08A 4TV8F 5HS4A 1YFKA 3THYB 4CM8B 2DPLA 4X8HA 3LQ2A 2PZBA 1H8ED 2O2DA 1G7SA 3PPWA 1YD7A 2D2VA 4PZCA 2OYCA 4AJHA 3SBDA 4HGQA 4PG7A 5C7YA 3GYBA 1E94E 2CLSA 4UBOA 3EDYA 2WHYA 2WSYB 3ZU2A 1OFUA 3NS7A 4FTWA 4U7DA 3A1NA 1G9XA 1UFVA 4RIHA 4EGQA 2HXYA 4JC8A 5JYDA 1DRVA 4DLRA 4DHWA 2IHZA 3EIOA 1EZ1A 4IGIA 3E81A 3BIOA 1G19A 2C2MA 2VBIA 2Z04A 3RSLA 1ZL0A 2PSEA 4E33A 3E61A 3ORSA 1W2GA 3QVUA 3I92A 4N48A 3FOAA 4H4CA 5FIUA 4MKZA 1XVUA 2JJ2D 5THQA 4N3CA 4EYGA 1KWGA 1XE3A 1DAGA 2G08A 5E9AA 5TXGA 3R3VA 3CLHA 1N9GB 3VXKA 3IUJA 1TM5E 4ETNA 3ZBQA 1SZPA 1GPWB 3D64A 3ONFA 2GKGA 4XAQA 4WZZA 2VHQA 2QD1A 2Y2VA 2I3BA 5T41A 3H2SA 4HBGA 2CHGA 3SHQA 3BSWA 4NNJA 3GEHA 4HUTA 1YDHA 1YQQA 1VPEA 4TKVB 5EJ9A 5KWVA 1A9TA 3X1JA 4HL6A 4WZAA 1T5HX 1UMBA 3O91A 1M6NA 4KTVE 3B12A 3JWPA 4C14A 1YK0A 3GIDA 2Q9AA 5KREA 2C3UA 2O52A 1F2UB 4BO3A 2HKIA 4O4HA 2PUGA 2WSSA 3PGJA 3EHEA 4MEBA 1DE0A 4TV8B 2Q49A 3FCAA 2QY6A 1Y98A 3O8LA 4ASUA 5KIAA 1UPUA 3QPCA 4B4KA 4ZI2A 5HZMA 1DAHA 4DGQA 4DSNA 2NQTA 2VH5R 3LPCA 1B3BA 2A59A 3OTWA 3EWSA 5BN4A 2H31A 1WZIA 1Y3FE 2SHKA 1KH2A 3D31A 3GXOA 3RFCA 3GJ8A 1HTTA 1Y1SA 1YVEI 2I67A 1I4EB 2FW7A 4W9RA 2W83A 4C0WA 2ATVA 1T8YA 3MOIA 3O4IA 5L6MB 1E9BA 3BE5A 2W22A 4LJLA 1JHMA 1EVEA 4IRXA 1XTSA 4GUDA 2R86A 3QPWA 1MEOA 1FRZA 2V0GA 2A1IA 4CT0A 1EA5A 2J4FA 4ZU3A 1KARA 2FOIA 2D00A 5B1IA 4S04A 1E89A 1P4AA 3DO8A 1KHHA 3ZV3A 1PEDA 3SI7A 2I87A 1NKTA 4LYDA 1E9SA 3BWEA 1L7BA 3BMNA 4A6EA 2H7CA 1HZJA 4U2FA 3L7KA 2IYRA 3I2YX 4QBIA 3HFRA 1TKBA 1MX9A 1K0UA 3V2UA 4YUZA 4M8NE 3V33A 3G82C 1W85A 4DM4A 1F2DA 2XT0A 5DGDA 1R8XA 5IARA 4D3XA 2XTMA 4ZVUA 3NU1A 1B3RA 5CD1A 2P79A 1Y1LA 1YZQA 2IY9A 4QPCA 4HDSB 3HXTA 2OLJA 3F67A 3LC0A 3PWTA 3QKSA 3V1KA 1BCRB 4YMTA 3LV8A 3DFZA 1A2KC 1EJ0A 1A8QA 2X9NA 3AC0A 4NOLA 3O47A 4WBNA 1NWHA 3MNFA 1PV1A 2COEA 5KOHA 4GOJA 2D13A 1XA0A 1PWEA 2H63A 4MS1B 3IAM1 3UGJA 5FO1A 2XCOA 2FAXA 1ZVMA 4JXJA 2GYUA 4HK4A 2W8ZA 4K86A 4P3PA 5EAIA 2Y4NA 3AIIA 1ADJA 4Q05A 1P2TA 2EZ9A 1G21B 1DKUA 1RYBA 1N25A 2CL6X 2EYQA 2IQ5A 3KKEA 4FEEA 1JALA 3WLMA 4U63A 4AJ4A 1WF6A 4N3NA 1ZUNA 2CDBA 2DC1A 1KVSA 2FMIA 3GP5A 3O2JA 4IV0A 2EDCA 1ZH2A 3NTRA 4FUTA 1JMKC 3TIFA 1A0OA 3KVNA 4LWPA 2XCTB 4PRZA 3UMCA 4GZ6A 1C1HA 1OX5A 3IDZA 4PR3A 2EIXA 5EJ5A 3HO1A 1O9BA 3SX2A 4V0ME 2AFRA 1ST2A 3MAJA 3OECA 2G07A 4Z3DA 1VFNA 3RS4A 4LJRA 4HBZA 4AUEA 4MUEA 1H2WA 1DAPA 1NF8A 4JYCA 4A0GA 1RD4A 4Y0VA 2BGUA 3ZCQA 1GFWA 3QWFA 4DS3A 2YRWA 3I34X 4MWZA 3UM9A 1UK8A 5JCJD 3RARA 2FPPA 2G8LA 2RHTA 2WYWA 3BXPA 1TCAA 4JP3A 3U7QB 1Y80A 1D1TA 5E6RA 2QBYB 1SUIA 1FRVA 2G1PA 4MDEA 1RHJA 1JAIA 2GTPA 4A0RA 3RREA 4YUAA 2MMCA 4RKRA 4BO2A 5CA0A 1KMMA 4NOMA 5FR2A 2MTBA 4HXGA 3GYGA 4XIIA 5HBGA 2JAQA 2X22A 5GADl 4JLKA 2DUUA 2HUPA 3OHSX 5F98A 4E12A 4ZT3A 2GS9A 1CZKA 2WILA 1LX6A 3VSBA 4JOQA 2I7CA 2X7HA 1A1VA 4LCJA 4ZCRA 3ONWA 2IUYA 4DT1B 3L9XA 5TY0A 4NV0A 4LQDA 1A5BB 1EBBA 4U2EA 4FZ3A 3FNIA 5AM3A 1E5LA 3H6HA 2MINA 3KFXA 3WNZA 1P8AA 5ICSA 4DV1B 1N5KA 4C01A 1F12A 3BK1A 3ITDA 4NG5A 2FP3A 3WJ7A 4J7AA 1N7GA 4OLFA 5LWHA 4R2KA 4FWIB 1YR1A 5KJFA 3E35A 2X19A 2ZRIA 1CFZA 3WHLA 4RY8A 1X7WB 3PQ6A 1FFWA 2Q3LA 1KQNA 1O94A 1EAYA 1JG2A 1RAAA 4OJKA 4ZQHA 1CY8A 1X7XA 3LPNA 3WLAA 2FX2A 4CKCA 1NQXA 3WLQA 3LO8A 5I9SA 1Y4SA 1AHNA 1VHTA 3NAGA 4L5CA 3SXPA 1DOZA 5BSVA 1ZAYA 4HGOA 3K9HA 2VBGA 2ZYWX 1CJSA 1RZRD 1B1AA 4II7A 4DLUA 1JV2B 4B84A 3OZEA 2ID4A 3L7BA 2CCGA 4NI5A 4DWOA 2OEPA 1IK6A 1XRNA 4EG6A 3EDRA 4KVFA 4GPIB 3PXBA 1L4BA 3VYWA 1RTTA 2FLWA 3A3YA 5DRTA 4NMWA 3KL2A 4UMDA 5JC1A 3LSTA 2ZLBA 2WE7A 3OOSA 1PR0A 4XSHA 3NIGB 1WP4A 2CVHA 4YXWD 2E5LB 1MG0A 5CCDA 2OCAA 2JIZA 3UAVA 4KYTA 4K03A 1HX7A 1WDTA 1FLDA 1R88A 3LLVA 4OI4A 3RDPA 3GDOA 1GFZA 3BFKA 3K30A 1LY1A 3K9FC 1UC4B 1OH5A 3K72B 3P9CA 1JTVA 3O1LA 4B3HA 3OCJA 2H17A 4MQLA 4LRXA 3UUFA 4GF5A 1SUAA 1BIFA 4N9QA 5BNWA 4X63A 4F92B 3CLRC 5KYGA 1KSJA 5DRYA 2ZRHA 4CLRB 3BXEA 3BDAA 3H2KA 3ENQA 4JEHA 4YDRA 5IJ9B 1BKDR 2ZI9A 2ZI7A 1YASA 4WOJA 3WGKA 4D8WA 3GLIB 4X6XA 4QPJC 1K5DA 4E15A 1X3SA 3KJNA 4J1QA 4QXOA 2PX8A 5LU9A 3F3MA 1A4IA 5ALGA 3FNHA 4L02A 3DKVA 4YLYA 5C46F 2DEUA 2EHJA 1IIBA 1XAJA 1CKEA 2G9UA 3NBKA 4CMBA 5AH0A 1UBCA 3BH0A 4J3NA 4AICA 1YVRA 1BDIA 2FKNA 1BXZA 2FPMA 2K4MA 4RLQA 4RULA 5CA0B 4DM7A 4MA5A 4IJUA 5REQB 4MEAA 3GFVA 4X8MA 2CUTA 4C3OB 5CFRA 1AXEA 1JBKA 3FJ1A 3DV0A 4US0R 5LC1A 3WIVA 4C6RA 3HXMA 3CH7A 4UTZA 3LA8A 3BRWD 3OLZA 3QX7A 3AR7A 2KHZA 4RWEA 4LRUA 3F8TA 3QPBA 3EFBA 3EC2A 4L8WB 2XVXA 2HQ1A 1ZOIA 1ZK0A 2I1LA 4MR7A 2K6GA 1J7JA 1XTRA 4WXHA 5IG2A 3PQ4A 3PJEA 1E2LA 5CLQA 5BUSA 3MJSA 2VOEA 3C2QA 4ZAGA 4GGOA 3VR0A 5KX5B 4DRXB 4H7KA 2ZU6A 1MAUA 3CEHA 4J8PA 3NTOA 2RHHA 3GFFA 3MBIA 3T61A 3SX4A 4C7OB 1GPLA 2OM2A 3EVZA 4KV9A 2EDAA 3OJOA 4MVJD 2XWPA 4QL3A 3KV1A 3TDNA 1GD1O 1GRCA 1S02A 3AGQA 2B4TO 4WEQA 2X8LA 4ETWA 3UA4A 2Q3CA 5A3VA 1XU4A 2VRCA 3ESDA 2G5PA 1Z7EA 2A9VA 4BNZA 5EEGA 1TA4A 5A4FS 4R9RA 3OAAD 1XIVA 5C4IA 2FEOA 1O97C 1RWVA 4CV1A 4ZICA 1JHOA 5DH9A 1VL6A 3WLRA 2NUTA 3GRFA 4ZU6X 1ONBA 2HSWA 2LD4A 2OG2A 4P4TA 3UHOA 5FBVB 1E1KA 3MCAA 5FXMA 4AKTA 5CT9A 3JQBC 3ASVA 2BBWA 4WBSA 1W36B 1MNAA 4NBKA 1KI1A 3AUFA 4AJ2A 1F2VA 1JQ3A 3ROEA 4DA9A 1CUVA 3EF3A 4BGVA 4OP2A 4KK4A 4LHYA 3GVHA 4YT4A 5LP6C 2FSUA 3CR3C 2MYPA 2QTCA 5MN4A 5HWSA 4PM4A 4F60A 5CFOA 1V95A 3ZYCA 4Y7DA 3NDIA 3H7AA 5AD1A 5DI9A 2PL3A 1OV6A 1G6Q1 2XNDA 3RJ9A 3OZBA 1U8EA 1WOMA 1G63A 2W6NA 3K0AB 4QUGA 4AKGA 2PZFA 2QD3A 3LCCA 2J09A 1XDUA 3USCS 1ZX1A 4K7JA 4M1SA 3F6RA 4ARAA 4HQRA 1NP7A 3MT7A 5A7FA 3PGVA 1NM5C 1SMKA 1RBMA 2ZAGA 2XXAB 4MW9A 3A1UA 4OI0A 1RQPA 3EF0A 1IPEA 3EBPA 1CIJA 4CRWB 5JVDA 3UT0A 4RMNA 1YC2A 4J2OA 2IZ0A 1Y9AA 2IEYA 1TD1A 2XKBA 4W6QA 3TGPA 4KXWA 3TIGA 1PT6A 1BS1A 3OZRA 1RKVA 3FOBA 3TW6A 5HKKA 3PS9A 4V0QA 3IPXA 3OT1A 4CUJA 2O2GA 3CR7A 1Q21A 3F7MA 2IXGA 4XFDA 4YRDA 4P34A 1J2TA 1UEIA 4JR1A 3VSEA 4LY9A 4TM8A 1VJ1A 2D5BA 1C9YA 2FFJA 1U31A 3UQZA 2WG1A 3OP1A 4D4KA 1C3EA 2F6RA 1N0UA 2Y1OA 3HCRA 3WMEA 4DPMA 4Z7OB 1JLHA 3AEXA 5K4HA 2FP4A 1BXKA 2EP5A 1JQ5A 2OCIA 2P1ZA 2X1MA 3DMRA 3EMVA 1LDYA 2CHUA 3BKXA 2Q7DA 5G3YA 4G1VA 4DPKA 3ET5A 3ICEA 1FU4A 5EIWA 2FEAA 2QU7A 3U17A 1JH8A 5LJIA 5CMLA 5K8VA 1GKUB 1Q1NA 2ADOA 2RGXA 1FYDA 2R84A 3E1SA 4HYTA 5IXSA 4J0KA 5CJ2A 1U8XX 3JQGA 4QEDA 4NS1A 5D00A 1TYCA 3CCBA 1XDWA 3PFGA 1IPHA 2JAWA 3PL5A 5B6JA 4EY8A 1YTLA 2WHRA 2ZTLA 4BYMA 3ELYA 4DG8A 4UVGA 5DTRA 1ABFA 3E58A 1Q12A 1GZHB 2RHLA 4UHJA 4QYIA 4ITVA 4JEUA 2FUKA 3ZC3A 1OSNA 3FGNA 4GOND 5FRDA 2C9BA 3DE0X 4KBGA 3EXIB 3T54A 2ALJA 3Q8KA 2KI5A 5DF1A 3UHJA 2NLOA 2JGMA 3UFBA 5KWIA 3DJFA 5HF6A 1UZMA 1P4GA 2CYAA 1HDYA 4G85A 4I1YA 4II2A 4M0FA 4RE5A 2JIBA 3H8JA 1FYEA 1GNLA 3TLAA 4D3YA 3C7KA 3HUEA 2F1OA 4TUYA 2FN4A 1FY2A 2HO5A 4MWDA 3TFQA 4P83A 3OIUA 2WE8A 3B53X 1A5AB 4MUMA 5A62A 2ZE6A 4O4JB 4RD6A 5EUCA 2J0UB 3EDMA 4UHDA 2I6QA 3VAZA 4PNPA 5CYFA 4DQVA 2IX3A 5JNWA 3I2KA 2GZDA 4WLOA 1DC8A 3JQAB 1MO4A 1IH8A 5G0SA 4DR5B 3P45A 2ZRKA 3MSCA 4P4LA 1KK0A 3HCCA 1V7CA 2OFWA 2ROQA 5F9FA 3DPSA 4IXMA 3A10A 2G9NA 2C8KA 1KGSA 1FSSA 4P92A 3Q7PA 3UK0A 2REQA 1RLMA 3P2IA 1SBZA 2RBKA 5ICFA 3PENA 5JZMA 3AEQA 4BRSA 1NR5A 3V8RA 2PH3A 1ZBQA 4QOJA 4FLEA 4HQNA 5CDHA 1H2HA 3B3AA 4I36A 5HJ5A 2Q6KA 1QH1B 1CWUA 2JG3A 1RE0A 3K0KA 4J0IA 4BNYA 4D8XA 3RSZA 1E5TA 4FJ0A 4XSVA 3SKVA 5AIBA 1JT9A 3GPLA 2NG1A 4PYQA 5JQWA 3VZCA 1X87A 3QI7A 3X44A 3JTEA 2PFGA 2ZAYA 2JANA 1PW5A 2BFEB 4N47A 1Z3IX 3IO5A 3W3AD 3B6ZA 1QSGA 1OBCA 3VTAA 1GSIA 3CLTD 4KQ6A 4UE6A 3WZ2A 1KI6A 5F73A 1KK1A 1U8AA 2G0NA 2I3DA 1M74A 3LK7A 5C32A 1I2CA 1U94A 2R11A 2VXYA 3L1KA 2QZSA 2QTAA 3TE6A 4FNMA 2WU8A 1CVIA 1EP3B 3MRXA 4GDMA 3WJAA 2XZLA 2HY7A 2IZ6A 2D2EA 1Q1QA 4L5IA 1JNXX 3SS8A 2V6IA 1KZ4A 4KJXA 1ZJ5A 3I72A 1AQNA 4ZAVA 2CXQA 1J39A 2AXPA 4CBVA 2BHSA 4G0XA 4MHSA 5ALMA 3WKEA 5K05A 2P40A 1PJTA 4P2BA 5CGZA 3EZ2A 3TQQA 4BQSA 2YMMA 2J9RA 1PHRA 4FS3A 4ID3A 2NPFA 4AO6A 1T43A 2XRMA 4PSAA 3B6EA 4X61A 4TM7A 1PX2A 3A1FA 3DZGA 3M1LA 4PLFA 4S24A 5HPYB 2Z8YA 3NDJA 3DDWA 2KJQA 2NQ2C 3A36A 3LLUA 4I4IA 4K28A 4QYIB 2WSMA 5DYGA 3A1TA 4G97A 4N1AA 4YDSA 3SJZA 1B42A 3RABA 4GFDA 3ZVKA 4KRFA 1XZEA 1WDMA 2YZKA 3BJRA 2XUFA 3GA7A 1XD2A 4OHYA 3WDKA 1POWA 1SC3A 2IFTA 4GIBA 4S2EA 1MB3A 1V1MB 3UV6A 3GGJA 1U98A 3OOYA 1P33A 4NBUA 5IT4A 2GN9A 1BQ4A 4MXDA 3JQFC 3BHNA 2X1LA 2Y0PA 3C3WA 3IEPA 4R8SA 5DYYA 2R7LA 4INPA 4LBWA 3JY6A 3RR2A 1WCV1 3C5WP 2QJTA 5B5SA 2C54A 2J9GA 2OV3A 3KVOA 1GEEA 1Y9DA 3O94A 3Q3GE 1PNOA 4OM7A 2YZ2A 3RC3A 5GZ3A 2V7WA 3BKWA 1RI2A 5LDGA 4BLRA 4H3KB 4GWLA 3H0EA 4EG8A 3DBRB 4HTAA 4IDDA 3IVCA 2R1UA 1KIFA 3ENKA 3FWNA 3FFXA 4Q7EA 5IANA 2ACVA 4JLOA 5H82A 4YMVA 3U1BA 2B69A 1H4SA 1QG4A 3FFBA 4RIGA 2PUAA 2ZYAA 4DQKA 1HZZA 4KOAA 2V6FA 4J0EA 3FWPA 1WCIA 4L85A 4NZPA 3RUHA 3SJBA 3LF1A 4EAQA 1P17A 1AGYA 3G9XA 2AMYA 3AY0A 3USZA 1HYEA 3V97A 1I1QB 4FM9A 3VTFA 4EJMA 4H7DA 1V6AA 4YJ2F 3V1TC 4BKOA 3H4IA 4FEYA 4KN9S 3SOPA 5TGDA 2VP3A 4UBJA 1FVXA 2QMOA 4MVYA 4OBEA 4TKVA 3B6KA 2YMQA 2ID8A 2OCYC 4HDRA 4YI5A 1BDJA 1GNRA 4KFRA 1PSWA 2JJ1D 4MP8A 1T36B 4QVIA 2G5TA 4RIIA 3ZGNA 4EK9A 2I3AA 4UARA 5DN6D 4JI7B 4UAVA 2WJ4A 5EVCA 3TLCA 2PVPA 4XPZA 1L4HA 3MJTA 3LPLA 3DD5A 4D46A 2QVLA 2BFDB 2F3QA 3O4VA 1NG1A 4IHAA 2PAAA 3KHSA 4U7TB 4WRRA 4D3FA 2QLLA 5CD9A 3VO9A 2IYYA 1N8KA 1BHSA 3JASB 1QCYA 3W8FA 4RELA 2ZIXB 3TI7A 3ZBTA 4DC1A 1JS1X 4DC0A 2CWWA 4ZCMA 1QWOA 2Y1GA 2ZWPA 2Y1FA 1ZM3A 2EU8A 3HE3A 3OA0A 4LCEA 4R8RA 4RX1A 1ZI9A 1X80A 3F5SA 4O2BB 1XKXA 2DPGA 1C4WA 2BTOA 3ET4A 4B6RA 3V1UA 2VZ9A 5EUQB 1B1CA 2ID7A 4O0LA 1L6RA 4X94A 3VZPA 4R3NA 3SXJA 1M76A 1RI5A 2CLFB 3R6WA 5DP1A 1BE8A 5M29A 4FHGA 4UBKA 4Y6GB 5FHQA 1QXSA 3EH1A 5JMTA 4D4LA 4R6WA 4DTIA 2HCJB 3WK5A 2OHOA 3SC4A 3O26A 2GZAA 4P93A 3NKVA 1H5QA 5GZ6A 1EP9A 1O57A 1QHEA 3I8XA 4RVUA 4LVNA 5I4BA 3NH6A 1PJQA 2QUAA 3K70B 2F64A 4N01A 3V7NA 5HJEA 4TL9A 4W1QA 4CDGA 1N2CE 1VE5A 1O89A 1RPNA 1B74A 3U5ZB 3GHHA 2Y6UA 5KNCH 4K9OA 2YFKA 4WL0A 5TEWA 4LF6B 4FGZA 1DQRA 1WD7A 3AOEC 3DOFA 1NE2A 1USUA 2XKAA 4W7IA 1NRJB 2IYUA 3TQSA 1T2UA 2XQJA 5H4GA 4NR0A 1BJRE 1BOFA 4D4JA 3LFTA 4R84A 1WM1A 5B1EA 4TTIA 5BOSB 5L40A 3GDGA 1UFRA 2YJ6A 4JUCA 1MF7A 4BQOA 2XMRA 2CFTA 1OFUX 2YHBA 2P6RA 5K4AA 3D3KA 3RS5A 1HDGO 1SCKA 3OTHA 2QL7A 3RRBA 2J85A 3H2ZA 3VKUA 3ZQ6A 1FMFA 3TEMA 4IZOA 4RPLA 3RD5A 4CKYA 1YUBA 2QVCA 2PRIA 4G1UC 4YHHB 3OCUA 1QRDA 1YWGO 4PBTA 1K06A 2ZG6A 3EZNA 3VR4A 4Q7LA 4HG2A 2QD5A 6NULA 1XEXB 1YS9A 2OLKA 4OHXA 2GJKA 1KE2A 4MIYA 5AVJA 1VI6A 3S2YA 1A88A 4BQRA 5K7SA 2A1TS 3NFRA 3ZQUA 1EMDA 5K8CA 2IHTA 4YHBA 4ER6A 3LS2A 1RQ7A 4FSXA 1DQYA 5AW7A 3RTEA 3VDNB 1F5NA 1HT0A 2IC5A 2PKRA 3MHPA 3G1UA 1LLDA 1KI4A 2X2EA 1IHPA 1N1DA 1I32A 4FYVA 4PSUA 3QG5A 1ORTA 2BGGA 1DWPA 5KTMA 3LVRE 5JUWA 3WMWA 5JYEA 4MS4A 1NNI1 1ODSA 3GQBB 1FFYA 1FFHA 1LQUA 3HG7A 1U4SA 3HCAA 3EN0A 1ZCJA 5IMBA 2OA0A 5C5CA 2X13A 4G24A 4YCLA 3KSAC 4AY6A 2W98A 1EDBA 3PEWA 1CJUC 3RS7A 2YXBA 1XK7A 4K88A 2HJGA 4P3OA 4YCJA 3TPCA 3G0OA 1KK3A 3T5MA 2F1RA 1DBWA 2PL5A 1PSDA 4GLFA 2IS2A 2AFVA 2QTNA 1YIOA 1SUEA 1Y37A 2BBOA 4B6JA 4REOA 4OMCA 1SOMA 4ZVLA 4JL8A 5A05A 2GVZC 5JSZB 4JZKA 3GIWA 4ND6A 3O8RA 3LQYA 1SK8A 4JKYA 3A3OA 1CRWG 5FFMA 2C9YA 4QQRA 2OQVA 4AZWA 2NO4A 2GN1A 2NZWA 2YW9A 4KWIA 3ER9A 2Z4SA 1T13A 2EKQA 1OJLA 2D7JA 4JXZA 2H5IA 4TZ0A 5AKXA 1ZGHA 4MR9B 5FWAA 1N5RA 3A1VA 3C4JA 4N8EA 2BVNA 1Y4AE 4ZCIA 1YI1A 5CVDA 2F9FA 3AVOA 1K2VN 1T4CA 1LDBA 2PKQP 3JR3A 2PV7A 2ZJOA 3LAWA 3NHJA 3QUAA 4RKEA 4BQIA 1FFXB 2EBUA 4XGNA 3HYLA 1WVGA 4OLHA 1YXMA 2W8BA 3TCXB 3TR0A 3B2QA 3TTWA 3CA8A 2A86A 5GMOA 4MVJF 2R8PA 1O03A 4G56A 1N7HA 4MW6A 4PX2A 1H0KA 1YRQA 3C5EA 3D0RA 3M0EA 4CM4B 4ZO4A 1HE5A 2IU6A 3LWDA 1R7RA 4PO1A 4X93A 4PPQA 3OIWA 3GAFA 2XNHA 1I24A 4AMZA 5EN4A 1J0XO 4MYDA 4FBLA 1H4QA 1EDEA 2FPGA 2A3NA 2HSZA 3B3QA 3GELA 4J1TA 1CK4A 1MC4A 3PPYA 2X9GA 1I36A 4R1SA 3TE7A 3MS2A 4MMYB 3TZHA 4B2IA 1IQPA 1FDTA 3O8QB 5K3EA 2JHAA 3IJEB 4JLSA 1A97A 5CHEA 3P4UA 2PTHA 3EODA 2W9XA 4KQWA 4LQLA 2OSBA 5KNBA 2C8JA 1OREA 3OT4A 1H0SA 2CKDA 3SF0A 2X40A 4JC4A 3B85A 3LJKA 1ZJWA 5BVHA 3BBPA 1WUJS 4BKRA 2BCGY 5HGJA 1B2RA 4N5HX 5CXXA 3VZDA 3TIVA 3VV2A 5B4UA 2HIGA 4UATA 2P5YA 1WXXA 4I50F 3U61B 4GMKA 4BP3A 4IIEA 5L95A 4LOJA 3TZQA 2IGBA 5NLLA 4C2AA 2IOYA 3T95A 2DQ4A 3IFSA 4ZQCB 5F7ZA 5IYZA 3FCCA 2YHIA 1IN4A 2UUBB 4KLNA 4LX8A 1Y5LA 3SQMA 3VGJA 3CLKA 5HFJA 1N92A 1OILA 2YICA 3KDAA 5DGIA 3CNQS 1B6RA 4ZI5A 4MVJI 2ZROA 1X2EA 2F48A 3L0BA 1K0FA 1EM8B 1S2IA 2QTWB 1P3DA 2VR1A 4P7BA 3VSCA 3PXEA 4AL4A 4BFXA 3GBVA 5ALUA 4EPVA 3MMPA 1PZEA 3UJ7A 5CCXA 5TGTA 3BJEA 5KYNA 3UMMA 4XEHA 3KYDA 2H9AA 4JYMA 3N28A 2X86A 4X1YA 4URUR 4AMVA 4INJA 4YQEA 2MSNA 4LC1A 1RIFA 4XX0B 2QMQA 2I3ZA 2GASA 3L7NA 4YR9A 5JZ9A 3QEKA 4CTJA 4JX9A 5T3UA 2RGYA 3FLAA 2OHGA 3GMDA 4B3FX 3ZLJA 5BUZA 1DS6A 1JU3A 1X19A 2C3PA 2H5LA 4ZZ0A 5AFSA 1Z2OX 4CLXA 5CB0A 5J2UF 2VCEA 3VKVA 1SXHA 3GH3A 3ZWCA 4ON9A 1NFRA 5CLFA 1GL9B 5AW1A 4FMPA 3OPYB 4KN8A 3D7KA 4EJ0A 4HYEA 5GINE 4UVHA 3ZDAA 3DPIA 4R6XA 4TROA 1TLTA 4LX0A 5SZIA 1IB0A 5HUHA 3DC2A 2VAWA 2B61A 3AIMA 3KTDA 4MJXA 2YC2C 3VOBA 1TTPB 4CW7A 1X2BA 2WQ6A 2Q5IA 1GDHA 5LOVF 3ZGOA 4E32A 2J3DA 3C98A 1RTKA 3B13B 3OX1A 3IBGA 1PGQA 3HWRA 5BVHB 1KP3A 1E6LA 3UJBA 3DVAB 1R5OA 5G1OA 5ULLA 1JQKA 5HKOA 5FB3A 1V9SA 3DYIA 3HVJA 3WL8A 3EOZA 3GDFA 1FNSA 4K40A 4ZXFA 1ZZGA 5E6SA 1CS0A 4M6WB 4RQUA 4JZYA 3C41J 1E9VA 1A69A 4ERXA 5CG1A 5DHTA 1PS8A 3GLHA 3IPLA 5CX4A 5HQ3B 1B16A 5IM5A 5KVVA 4KUGA 3ZW8A 4O08A 1GZ4A 4D8TA 3G0HA 3NVAA 4PY2A 3ZHVA 2HH9A 4CDMA 1C80A 2AJ8A 1S0UA 2Q45A 2YZGA 5DHQA 1SOUA 1EFVA 3NWJA 2QVZX 4J94A 2B20A 2I6UA 4PLVA 4RDCA 3ZQJA 4BHTA 2V0NA 4AF7A 2JFNA 3GFQA 3S2EA 3QE9Y 2IPOA 2WD9A 2P4EA 1EUYA 4R3WA 3MTQA 4LDAA 1RFLA 1JHZA 2QM7A 3KPYA 2AE2A 3NP7A 4BBPA 1P0FA 2ID9A 5AJHA 1CY7A 5EG5A 5FCDA 4EVRA 1JEJA 3KWMA 1XRPA 2I6TA 5CLLA 3WMGA 1KI8A 3JQ6A 4NATA 5K8UA 1DBQA 1KP2A 1B2LA 1FC0A 2FK7A 2LWIA 1VG8A 1Y82A 4IDBA 4M7WA 5DBIA 1OLSB 2IEZA 1CUWA 4Q16A 5EQJB 4B87A 3EB9A 2X6RA 1SCDA 1M2WA 1VTKA 1N4AA 4D9IA 4PG8A 3ZWPA 1HLFA 4CEHB 1Y3DE 1T0BA 4MINA 3GPIA 3SWWA 4YGYA 3IO3A 3KVVA 4LW8A 2R1TA 5L3QB 2YOFA 5AP9A 3ZWVA 4ZYVA 1WE2A 2PZMA 1P3Y1 1SKYE 4TOIA 1WU8A 4OV6B 2IIPA 4PFJA 4AS1A 2ZYUX 2PWAA 5FTKA 3O82A 4ZVKA 1MAWA 1UBJS 3E05A 1MQ9A 5TQJA 2YQZA 3MINB 3RRNA 3BQNB 1AH2A 1JLMA 2DXIA 2Z5GA 5KSOA 2ZB2A 1UKZA 1ZK2A 1JG4A 3C8DA 3H17A 3R2JA 3E03A 3MC1A 2WPDD 4RYLA 2YV3A 3EZLA 4Q1BA 4B8YA 3GJ6A 4CKEA 3STVA 2JGAA 4NE2A 5FNVA 5I9BA 1E4YA 4H4EA 2FPSA 2XUPA 2WWFA 1EWKA 4I1SA 3DR5A 1U0JA 4IS3A 1WULS 2JKZA 4FE4A 4IDHA 3QF4A 4ND1A 1OH8A 3MBKA 1TKCA 4MVJA 4D3ZA 2ZPAA 4PGMA 3P9KA 1PBNA 2H2WA 3IAAA 1CB7A 3P0FA 5EOVA 4Z49A 1X1CA 1VI5A 4LE2A 4PV7A 4Y2TA 1LF5A 2CJPA 1AIPA 5KJ1A 3A3NA 2JCYA 1U80A 1RKUA 2Z9BA 3H8SA 1SC4A 4WY8A 1K63A 2RK3A 3U4QA 1N5JA 1K2WA 2YIDA 2HK8A 1DKLA 4YN3A 3PG5A 2BBTA 5A04A 2YXDA 1IZ0A 4P5EA 4WKPA 4ARUA 3Q4GA 3RK0A 4DJJA 1V35A 3C3DA 4F4FA 1MLDA 5TVGA 3M6FA 2D0OB 4KUHA 1AU9A 2ON6A 3ENZA 4GE3A 1RHKA 1HDOA 2PH1A 3KPVA 4MNTA 2CXOA 4UDOA 4A0FA 4EF4A 4NJEA 2AZXA 4ZKEA 3PWKA 1C29B 3E9ZA 3HSYA 1EFRA 3P32A 4JIGA 3TD6A 4FFVA 4QA9A 4FBGA 4Q4JB 4LXUA 1GQOA 1M2FA 2Z8XA 3JX9A 4RGYA 1XA3A 4ALKA 2C4TA 4ALJA 2DPHA 4NHEA 4PC2A 4PGHA 5FBKA 4WGFA 1NGSA 3TWOA 1CP3A 1M6VB 1E9RA 1JI3A 5CX1B 3D6FA 1H5NA 1T9KA 1D6NA 1CIPA 1Z4JA 2AMLA 2HZBA 1A9XA 1T5TA 3MERA 3PNOA 4U7WA 4XM0A 5BQOA 1TFUA 2P7IA 3PRYA 4TLMB 1WV1A 3AP3A 2WD7A 4QICA 4OAQA 4P33A 4MQFA 5CXQA 2CDRA 3KZCA 3ASUA 1CB0A 2K2WA 2CN1A 3DBIA 3H9JA 3QQ5A 4FHEA 5TT1A 5DK4A 5EGSA 3CVJA 1EK0A 2HJSA 1JQAA 2HPHA 1QR2A 3ZH2A 4B8WA 3FPHA 4TS9A 1MHTA 1P60A 4KLZA 1N32B 1HEYA 1T9CA 3AF1A 2JL1A 2I2WA 1Z5GA 2EF0A 4Q82A 1UPBA 3NKFA 1Q0QA 1SVUA 5BV1A 2O3SA 1K3TA 4YUWA 1GZDA 4K6OA 2ZWOA 3CVXA 3D2LA 1N1MA 4D5EA 5LXTA 3I5XA 4E03A 4J1NA 4DMLA 4ER7A 2K87A 1L5HA 1BMTA 3VZRA 3ADDA 1PRYA 1EVZA 3U9LA 4OLBA 2R6R1 5GGXA 3TUJC 4EABA 5I7RA 4QJ5A 1Z22A 2R85A 3UAXA 2NTJA 4BAZA 2PX6A 1K66A 1V48A 4KVGA 4Z0HO 3IVRA 3GN2A 1HNNA 2GAJA 5JRJA 4DAEA 3HA5A 3TX6A 4E2FA 3ANTA 4UBLA 3D7LA 5CX1A 3NX4A 4J16A 3EXAA 4YRIA 3JATA 4WZ6A 1RHRA 2Q3JA 3FDIA 1I4WA 1WXDA 1T6XA 4M89A 1S4QA 1DJQA 2VK8A 4W82A 1T36A 2J3LA 5D3ZA 5TT0A 1U0BB 5GJCA 1IN7A 1TEHA 4EA9A 4YMLA 2RGAA 4KUEA 2C82A 2OQIA 3B51X 1WPRA 4LNUA 4MROA 4XX1A 2VYVD 2Z2JA 1U3CA 1E2JA 1HBJA 5KOJB 1PZMA 4KODA 3ZYZA 3HP7A 3OLWA 3PGMA 2BFNA 2ECKA 4CR6A 3FIUA 5D6NA 1PI3A 2OBYA 2WIDA 4N5MA 1M9NA 2VPTA 1HYQA 2ZBUA 1H93A