1N5DA

Crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
288
structure length
288
Chain Sequence
SSNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQGRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSDSTYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQFVTDKKVVEWGVPPESYPWVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID DEHYDROGENASE
publication title Porcine Carbonyl Reductase: Structural Basis for a Functional Monomer in Short-Chain Dehydrogenases/Reductases
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 100
structure length 288
sequence length 288
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n5dA00
1E7SA 3BMQA 1E0DA 2P9CA 4BKRA 2EG9A 4RF3A 3BMNA 2BI8A 4ND1A 3WGOA 5JY1A 1D7OA 1I33A 4NMHA 4D3DA 4ZJUA 1E3EA 1U7TA 2VUUA 2BKAA 4F6LA 3S2IA 2B4TO 1W8DA 1G0NA 2Y1OA 1AXEA 1GV0A 2JJYA 2ILTA 1PQUA 1PEDA 2CF6A 3EMKA 4BO6A 1O95A 4D45A 5CDSA 3MJSA 4YACA 4TSKA 2OBYA 2ZJ1A 1A7AA 1DC5A 3F1LA 2EKPA 4K28A 4AJKA 3L9WA 4DRYA 5HTOA 1TLTA 1K2WA 1KOLA 1SO8A 2NQ8A 1PJTA 4R1SA 1B15A 1A4UA 3WMWA 2PGJA 4FCCA 3X2FA 3LT0A 1P1HA 1KVUA 4YJHB 3S2FA 3PQEA 3UAGA 1I2ZA 2NTNA 2Y0EA 2R00C 3UHAA 3FN4A 3A14A 5TS3A 1JTVA 2GO1A 3JYOA 3W6UA 1Y6JA 2JKVA 2BGKA 1HDCA 1U3WA 3R6DA 5ILOA 5HM8A 4FGWA 3CPSA 1HE4A 3PPIA 4WNIA 3V1TC 1IPEA 1K6JA 2Q1SA 2E82A 2YV1A 2BGMA 2X9NA 3KYDB 1UUFA 1NX6A 5TSDA 3G79A 4I08A 1P0CA 3WIEA 3ASVA 4HFMA 5C37A 5G2OA 2AXQA 4B7CA 2FR0A 4BNUA 3DBHB 3IAHA 1MP0A 4BO7A 3GDFA 3TSCA 3C24A 3P2YA 1PZGA 5G4KA 1M6WA 4H15A 2R6JA 4R1TA 5DULA 4ALLA 4RL6A 1GAEO 3UXYA 4RPLA 1AN9A 3DEYX 2BHLA 3QIVA 4EGFA 2GERA 3AM5A 5EQDA 2VHZA 4JP2A 3GGPA 4A2CA 1JW9B 4XYGA 1DC3A 1KVQA 1E5LA 1B8UA 4P38A 3KUXA 4FBGA 3ZGYA 2I65A 4XYMA 3BMOB 3P7MA 2X5OA 4J1TA 3PJFA 4Q39A 4PLFA 3NDRA 3K31A 1NQTA 2HJRA 3QWIA 1B0AA 2HAEA 4IZHA 5DP2A 4E12A 4E5YA 5JBIA 4HWKA 5U4QA 2P4QA 4E5NA 3JD4A 4UEJA 4FGSA 1R16A 4CUKA 1NQ5A 5CEFA 2H1SA 3EVTA 1P77A 3H9JA 1U9JA 3U4DA 4YAEA 4B79A 3SXPA 3H2SA 1YQXA 1EDOA 3MTJA 1E1LA 4NQZA 3DAPA 1HZJA 1B16A 3I23A 1SZJG 3OQBA 2O3SA 2D2IA 1R6DA 2I76A 4J91A 2C7VA 5A9RA 2C5AA 1GYPA 2I3GA 3WSVA 3K8ZA 2X5JO 1EFLA 1VJTA 2VOJA 1I3LA 3TZKA 1U7HA 3IJRA 3Q3CA 4IDBA 2X9VA 1ZK0A 4W99A 2CUKA 2B36A 3IUPA 3JQAD 1TT5A 1MV8A 1DOHA 3LLVA 4BIIA 1OOEA 1TA4A 4P4LA 3ZV4A 2OZPA 4AJNA 5AOVA 3LF1A 3UFXA 5KJ6A 4IDDA 1EE2A 4HFJA 1BW9A 3FI9A 4BNWA 3H9QA 3BZUA 1SB9A 4PZCA 1PJCA 2PZLA 3OA0A 4Z9FA 3NJ8A 5GZ6A 3IDSA 3RWBA 2BI7A 4EJMA 5A1TA 5C7LO 5KIAA 2CSUA 3P19A 5KVVA 3MTGA 1EQ2A 1HE3A 1PJ3A 4OYRA 4A5OA 4FD3A 1HYGA 4ND4A 4XRRA 1RM0A 3WGZA 3M2TA 3ONDA 4WASA 2O3QA 5L40A 1QYDA 1RM5A 1P1RA 1T1RA 3EVNA 1XIVA 1I32A 4IQGA 5IN5A 1KEVA 3AK4A 3RFXA 1T4BA 3ZWAA 3C7DB 3PQDA 4L76A 4WEQA 4CUZA 4NDNE 3OQ1A 3U09A 5JAIA 3AOEC 3I9JA 4M1QA 2W2KB 4BKQA 4EYEA 5JY6A 3GNTA 3GRPA 4BNYA 2EF1A 3KVOA 4GQAA 4RQTA 1U4OA 3DMYA 3FR8A 4QEDA 1M75A 1O5IA 3GEMA 5B1YA 2B5VA 4E4YA 2QG4A 3KZVA 3C3XA 1BMDA 1ZK1A 1IHYA 4ROSA 4TRJA 4J90A 1KEPA 4CM3A 4CLRB 2VQ3A 3DHNA 4MP3A 5BNFA 3BMCB 4CLDA 1Q7GA 4ZHSA 5DT9A 1ZIDA 1YJQA 1XU7A 3DFZA 3HFGA 1TB4A 1XWFA 5JE8A 1YL7A 2O7QA 1P45A 3PP8A 3WLEA 3V1UA 3W8EA 4E2WA 3TOXA 2PR2A 1DXYA 3MJ4A 1N1GA 2WD7B 4JBIA 3W4JA 4IMRA 1A4IA 5DBIA 1UDAA 3K2BA 1DJNA 4WEOA 1RM3A 2HMTA 4EJ6A 2X5KO 1PSDA 4JROA 1PGNA 1T2EA 4D3FA 4YT4A 1QRRA 1IB6A 2HRZA 4MJLA 4YAGA 4BOYA 4KTTE 3OQ6A 3DDNA 1HWYA 1IPFA 2ZTMA 2YUTA 3DL2A 1DDOA 3DZFA 3SJUA 1V0JA 1N5DA 1NVTA 4WCFB 1JWBB 4A03A 5I7VA 4NK5A 3QLJA 3PIIA 4R16A 1UXHA 2PGLA 3G49A 5L95A 1NFQA 1C1XB 1GZ4A 1C3VA 1X1EA 4YQYA 1CDOA 3F6YA 4CM8A 1TVEA 2AG8A 5JFOA 1A27A 3ZWCA 1XYGA 3T7CA 4RVHA 4FIZA 4J6FA 4ZQFA 3ZHBA 5KJ1A 1WAMA 4GH5A 2OORA 5JO9A 4WNCA 2X86A 3C1TA 3JQBA 4KQXA 4FPXA 3ZWMA 3GG2A 1WW8A 5JMWA 4I5EA 2DTEA 2ZQZA 1LDMA 1LLUA 1YXMA 4WLFA 2J5KA 2UV8A 2Y68A 3KLPX 3PGJA 1BXZA 3VZQA 3GN2A 2ZIZA 3CUKA 4BUCA 3CZMA 4RVDA 2G5CA 1UZNA 1MA0A 5I7SA 1J49A 4EITA 4AJ2A 1Y5MA 1HDRA 2HSDA 2GR9A 2GRAA 4XD2A 2Y1GA 4CMEC 1DRUA 3VKUA 1V9LA 1GTMA 2WYWA 3TL2A 4YJGA 4IDAA 1BXGB 3MWEB 4YT2A 1OZAA 3OECA 1LSUA 5KJCA 5F5LA 3L6EA 1JAXA 1VSUA 1VM6A 1MFZA 1YL5A 1DIHA 3FBGA 1R15A 4BNMA 4OXKA 3B1KA 5BT9A 1WMBA 1DC6A 1MLDA 4IXTA 5T57A 1N2SA 1F17A 3JYQA 5C5IA 3MJTA 4CM4B 3SBOA 1ISHA 4DA9A 1MXHA 2DVMA 1DAOA 4MP8A 4KQWA 3AU9A 3UGKA 4CJXA 3ROQA 3QA9A 4NPCA 3EY4A 3KBOA 3T4XA 4HUJA 1IUKA 2VRCD 4ILKA 2RHRA 4DPKA 1G1AA 8ADHA 5JXWA 4AVYA 5J23A 4FOSA 3JQCA 3QHAA 3E1KA 1NQAO 2VHWA 4FFLA 3ZU5A 4YT5A 3H65A 3LT1A 1B2LA 3DBRB 5A5FA 1EVJA 3DMTC 3GPDG 4NU6A 4IDFA 2EKLA 2O50A 2YV3A 5JC1A 1OMOA 1BG6A 1BXKA 3IS3A 4IIVA 4DREA 4CLXA 3FPCA 3OEYA 4BHTA 1X13A 2CVOA 2LDXA 2I66A 2BF7A 3C7AA 4KDEA 4CLOA 1NTOA 3A06A 5FEUA 3VTFA 1T25A 3PDUA 4LMPA 4W7HA 1EBUA 4R9RA 4C7KA 1DRWA 3NUGA 4ZRNA 5T8KA 3WICA 4QUKA 1EVYA 2DLDA 4CR6A 4OQZA 4DL9A 3G17A 4O59O 5F1PA 2GN8A 8LDHA 2O3TA 1XU9A 1SBYA 5JDIC 3I3OA 4NBVA 4DBZA 2UYYA 2ZQYA 4R3NA 4RORA 4EUEA 3G3EA 3AUTA 3JYNA 3UUWA 3TZ6A 3WR5A 4CMBA 1F14A 1PWZA 1GCOA 1H9AA 4M86A 4Y98A 3DOJA 2ZB4A 1NWCA 3GAFA 4Y9DA 2VWQA 3FR7A 4GGOA 3GQVA 1V3UA 3U3XA 4EEZA 3OIGA 4O6VA 1DLIA 2AW5A 5AXBA 2I67A 1E6EA 3TZQA 1PJ4A 1I30A 3PDJA 3TNLA 2A4KA 3GH3A 4WLUA 5IDQA 1R4NB 3JD1A 4FFPA 4DLBA 4RVSA 3JQ8B 2DQ4A 2PH5A 3UCFA 1QXSA 4B8WA 3I9NA 1TEHA 3JD0A 5IFLA 3GHYA 5AXDA 3VHRA 3RJ9A 5L51A 4YA6A 4NU5A 3KTDA 2JCYA 4J4BA 3WYBA 1U5AA 4KUHA 3U62A 1DHRA 1PWXA 2GZ3A 2ZKLA 3ENNA 4U0KA 4RPGA 3N7UA 4PLWA 1N1EA 3M6IA 1SMKA 1DRVA 2O2YA 5I7FA 1O0SA 1C0IA 2E48A 1Y8QA 5GMOA 1E7RA 4HXYA 3ORFA 1G0OA 1GEEA 3H5RA 1LX6A 4FQ8A 1L7DA 4YB8A 4O63O 1V8BA 4GKVA 2D0IA 1Z7EA 3PYXA 1U4SA 3OHSX 4L73A 4RZIA 4Y67A 5JDCC 3GY0A 4DYVA 1P0FA 1LDBA 5EIOA 3LC2O 2QX7A 4I5DA 3B6ZA 3V1YA 4BKOA 1Q1NA 3OJ0A 5I7EA 3WXBA 4J43A 2VTEA 4IGEA 1O8CA 1YRLA 4XB1A 1HDZA 3BTVA 2HDHA 1FMCA 5L7YA 4E32A 4N5LA 4QT0A 3WQQA 4R9SA 3V8BA 2AQKA 2FSVA 1YBMA 3JQDA 3E9QA 2CDCA 3GF4A 4IDGA 4IJWA 4B8ZA 4G5HA 4LW8A 4MIOA 5CDYA 2AQIA 2O4CA 1L1FA 3WIDA 3ANLA 4DIBA 9LDTA 2IODA 4BNFA 1R66A 4ZU3A 3E82A 5DCWA 1ZNQO 2VWGA 5CDGA 3RBXA 5A03A 1A71A 2B69A 5AYVA 2AEFA 3AFNA 2GDZA 3D4NA 3CMMA 3ZU2A 2QW8A 1PR3A 1YONA 2Y93A 3HG7A 4W9NA 3T7EA 1BGVA 1HE5A 4GVXA 2DPHA 4WOKA 3INTA 1NQOA 1OI7A 5KNLA 3WWYA 5JMPA 3L9XA 4DVJA 3WQRA 1Y9EA 4DQXA 3G1UA 3QVXA 4TRNA 3KEQA 4BO4A 4EUHA 4J1NA 4JBHA 1ADBA 2XXJA 3WSWA 4JLWA 3X2EA 3JQ9A 2JHFA 4GWKA 1L7EA 2W2LA 3W4IA 1JDJA 1WDLA 3GDOA 3JQ7B 3WFIA 4FFNA 2GPTA 1I3KA 4L4XA 5FI5A 2PWZA 4IXWA 2DT5A 4DC0A 2C29D 2QRJA 1GYQA 2X7HA 3H2ZA 4B7XA 5CPFA 2FSSA 3FSRA 1KY5A 4KTVE 2OXIA 5KCZA 4XYEA 4L9RA 3ADPA 1O6ZA 3VH3A 4BO0A 4PVDA 3U9LA 4R4JA 2GGSA 3BA1A 4R68A 5EESA 4OXNA 4E33A 1H6DA 4YCAA 3VVBA 1MGOA 3JQFA 4NBTA 3QWBA 3I5MA 5ADHA 1AE1A 2BELA 2GZ1A 2AE2A 3PHIA 4JJIA 3KSZO 3D5QA 3N74A 3GNQA 1I01A 1RWBA 2YYYA 4BNHA 3ZWWA 5IDYA 4XR9A 3E18A 1E1NA 2ZCUA 1VI2A 4U8GA 4KUGA 1VL8A 1KY4A 1I2CA 2WE8A 4ITUA 4QQRA 1JU9A 1JVBA 3ICPA 4B4OA 1CERA 5F5NA 3TWOA 3W1VA 2G0TA 1QMGA 1XR3A 3Q11A 4FDAA 4J3FA 4YVFA 3HADA 3WJ7A 2NTVA 4WLOA 5IJZA 2CY0A 4BO2A 3IL2A 4IZIA 3E9NA 5JCXA 2DAPA 4JBGA 2BFPA 4WCFC 4HNGA 2VNSA 3KYCB 2BFAA 2VYVA 3R3SA 3TOZA 1XA0A 2P91A 2B83A 4CMKA 4DLAA 4JNKA 1LTHR 5IXYA 1MUUA 2D1YA 5L45A 1XQ6A 5JNLA 4C4OA 5TT0A 4P4NA 3RUHA 1GPDG 1K6IA 2RHCA 2NU6A 1NAIA 3IQDB 1QORA 2A94A 4LN1A 3BAZA 2GSDA 1XGKA 1GEGA 2B37A 4DMMA 3QWHA 1JKJA 2YY7A 5G0TA 4G2NA 3ZV3A 4RO0A 2NU9A 4E5MA 5JLAA 3PGXA 3EZLA 4PG6A 4ZVVA 1ZBQA 5U1PA 3RROA 4FS3A 3TPCA 5IXSA 3ONFA 5KTKA 4OJNA 4DIOA 2A92A 3GDGA 4TRRA 4CQMB 2Y67A 1CQJA 3QJ5A 2GUGA 4QTZA 4CLEA 2X22A 4GSKA 2W4QA 2BMAA 3PZRA 1YOVA 4R3WA 1P31A 1VPDA 4G81A 4LVCA 4CM7A 4AJPA 1Y8RB 1ZSNA 4QO7A 3WTBA 4YQZA 1K5HA 3GA0A 4BNVA 4XGIA 4MVJG 5T67A 4CMIB 3GVIA 3OEWA 5DN9A 3VOSA 4KDFA 1LEHA 4BO3A 3O8QB 4AJLA 2ZTLA 1SOVA 2PGDA 2EXXA 4PGFA 4GX5A 4BGUA 3RUIA 5HS6A 4BNLA 4R1NA 3I83A 3DR3A 3JD2A 1H6CA 4FC6A 1K6XA 1S7CA 4BMVA 3UCEA 1UP4A 1T2DA 4IQ0A 1IY8A 2Q99A 4BV9A 3OICA 3EUWA 1P3DA 3BMQB 1PJBA 5DCUA 3B70A 4CM9D 3BMNB 2NVBA 4I1IA 4CM6A 1EQUA 1RM4A 3NEPX 3NX4A 4WPGA 1EFKA 3KM0A 3ADOA 3JQ6A 3WGIA 3C8MA 4E5KA 1T24A 1IULA 1UXKA 3GPIA 3RC1A 4D0RA 2IZ1A 2VT3A 1YS4A 1H94A 1X7DA 2O23A 3SEFA 2FY8A 1NP3A 4MPDA 5JSFA 3KYBA 3GUCA 1GR0A 4Z0HO 3CINA 1KC1A 2B5WA 2OHXA 1PZHA 1LU9A 1H0KA 1HYEA 2V6GA 4UVHA 1A72A 4L75A 3JQAB 3LU1A 2W98A 2G76A 2QYTA 1T4DA 4E3ZA 4CQMD 5TC4A 1FDUA 1PU2A 2P9GA 4J7XA 3GFGA 3VC7A 2C7GA 4LSWA 2C07A 3RC2A 4XEHA 2YFHA 3GHHA 1ORRA 3LC7O 5B4UA 4J2OA 2WYUA 5JO0A 2PD6A 1YBAA 3V2UA 1LI4A 1GPJA 3WGHA 3I9LA 2HMUA 5B37A 1SAYA 4NNJA 4M89A 4OMUA 4Z0PA 4YAJA 5G4KB 5CFZA 2HLPA 1DB3A 5DF1A 3RKUA 1F06A 4B4VA 1ZKMA 2P9EA 2PKRA 1HF3A 3ANMA 3ICCA 4IPTA 3VZSA 3AM4A 2JFHA 2WM3A 3LQFA 1E6UA 3BXXA 1NBOA 2OMEA 4BO5A 1NVMB 3HB4X 3IKTA 3DBVO 3U4IA 4I5FA 4FFMA 4O5OA 1GQYA 3KSDO 3OSUA 4XJTA 3S55A 1DBVO 1E3JA 1DHTA 3JCZA 3RC9A 3NRCA 3L4BC 1I5RA 4IS2A 4NJMB 2ZATA 5A3VA 4BB5A 1K0UA 2E37A 4JXKA 1PS8A 1GD1O 1P1KA 2WWRA 3W6ZA 1ZW1A 1CIVA 4RCVA 2QHXA 3C1AA 5BSFA 1ZO8A 1Q0LA 1QV6A 2PV7A 4NBRA 3M1LA 4DC1A 3AM3A 3AY3A 3JTMA 2VUSA 4RF2A 4IJVA 4TMFA 2O2SA 3W4KA 1ISMA 2GN4A 4ZD6A 4BS9A 3NT4A 5DBGA 3PYLA 4E0BA 3V2HA 1UXGA 3DZIA 2C82A 4L0QA 3JQGA 4MKRA 4II2A 1QLJA 3COSA 1RYEA 3DFUA 3KSUA 3PVZA 3QP9A 1NR1A 3R0IA 3LT4A 1LLCA 1XELA 1ZJZA 2YHIB 5JAQA 3WNQA 3CZRA 3AY7A 5ICSA 5JC8A 4Y6SA 5KVCA 3F46A 3FRJA 1J0XO 3KHUA 4BKUA 1WP4A 5L4SA 3IUSA 1TT5B 1ULUA 4YJDA 5FF9A 3AI1A 3T4EA 1XG5A 1E3WA 2VWHA 2Q50A 2W8ZA 2NU7A 2JD2A 4FJ2A 5AQ1A 3RUFA 3B20A 3HNPA 1BW9B 1NYTA 4DUPA 2WE7A 3INGA 1E7YA 3BTOA 1H93A 4LRSB 3ZWYA 3OJFA 4Q3DA 1Z74A 1B3RA 2ZCVA 4XX0A 1DEHA 3PQFA 4D42A 3WOHA 5KOIA 1WNTA 5ILGA 3JYLA 1I10A 2VZ8A 5TRTA 2CZCA 3RBZA 4WE3A 1VKNA 2IZ0A 2I3AA 2YV2A 5DNAA 1JWAB 2V6BA 1C14A 2Q2VA 1I3NA 1DFHA 1R4MA 4Z0TA 2IEDA 3MWDB 1SCUA 2VZ9A 3NGXA 3UOGA 3EZYA 3LF2A 1ZK3A 2CVQA 4I5GA 2XF8A 1ENOA 5KKCA 4ZA2A 5B4TA 4D0SA 2VYNA 2AQHA 2NADA 4OAQA 2Q1TA 3QV1A 2FZWA 2FP4A 1JAYA 1M2WA 5LDGA 3ON5A 2Y1FA 3GG9A 2G1UA 4A10A 1YKFA 2E4AA 3WGYA 3I4FA 4J9UE 1Q2XA 5DZSA 2X23A 4L4RA 1YBVA 1WWKA 3WGTA 1CEQA 1PGJA 5JCJA 3WLFA 3PEFA 3A1NA 4XDYA 4BGEA 4I9UA 2A9FA 3GT0A 3K30A 3H3FA 4UVDA 2H6EA 2IYPA 3WGQA 4II3A 1B3BA 3ZNNA 2Q46A 3VPFA 1LSSA 3BTUA 3VZRA 2HK9A 4RVUA 2PD3A 4UEKA 5EN4A 2YDXA 2J5QA 1J4AA 3Q2KA 4GLLA 2VHYA 3F5SA 2H9IA 1ZFNA 1QR6A 3KOUA 2DU8A 4RLHA 3H5NA 4R54A 3QW2A 5IZCA 5CP8A 1U2DA 1U1IA 3BTSA 3EK2A 1GUZA 2CD9A 3ENKA 3RI3A 3QRWA 3GGGA 3F4BA 3FNFA 2IXBA 4RPJA 3BIOA 3TZCA 3WYCA 5A9SA 1P9LA 2Q4BA 3Q1LA 3KETA 4FSHA 1PQPA 5A4DA 1HDXA 1ZXBA 2VNAA 4IGFA 1Y81A 4BKPA 2GYYA 3RU9A 3Q9NA 2J3IA 3GFBA 4M8SA 3R3JA 3F9IA 2Y05A 2QRLA 5A3JA 1DO8A 1PIWA 4RF5A 3ZU3A 1XHLA 4PG4A 3JYPA 4EDFA 4XDZA 1ZXLA 2EV9A 4Q3EA 3DTYA 4QECA 5DBFA 3S2GA 4PG8A 1U3TA 1MC5A 3D3EA 3ETDA 2EP7A 2Z5LA 4LMRA 4OOFA 3EYWA 4D79A 5L4NA 1D1SA 2IRWA 4ZGWA 5CPBA 2XXBA 1I24A 4J7CA 1UDCA 3ZNOA 3NTQA 1XQ1A 1ZCJA 3O38A 4NHEA 4WUVA 3WQSB 4K26A 4MDHA 2F00A 3O9ZA 2OUIA 2VTDA 3DOOA 1EK6A 3DC2A 1AHIA 1JKFA 5FYDA 2EERA 2GN9A 4RLSA 2C5EA 4PG7A 4CV0A 1HKUA 1QYCA 4WECA 2B4RO 2PKQP 2JAHA 3VPXA 3QWFA 1ISIA 2UAGA 4YJGB 4OQYA 4RGBA 3DWFA 1DPGA 3EAGA 3EC7A 4F45A 2BFMA 3E9MA 3IJPA 4CMHA 5AVOA 3LLSA 3CEAA 3WTCA 1P33A 1WZEA 1UAYA 3GN1A 3IP1A 4EJ0A 3GEGA 2J3JA 4DMLA 2HQ1A 3SLGA 3PXXA 2YZ7A 5A9TA 2DFDA 2R00A 1M6HA 1FF9A 1PS9A 3AY6A 1N8KA 5JCJD 4DLLA 1SEVA 1YQDA 3GMDA 4FFRA 2UUPA 4O1MA 2J6IA 2QZZA 3IC5A 3C85A 2OL4A 2BGLA 3E48A 3V2GA 4HX5A 2DM6A 4NH4A 2X8LA 2JFGA 2R2GA 1BDBA 3NDJA 1CWUA 3P2OA 1ARZA 3STHA 1DAPA 2NNLD 4XWYA 1BWSA 4CLOB 1DLJA 3BHIA 4N5NA 4Z9YA 3U4CA 2QIOA 1YB5A 1YO6A 2BFOA 5A06A 3ZWNA 3F47A 5IAAA 2WSBA 3M1AA 1T2CA 3ETGA 3I9KA 3OMLA 4B7UA 2DKNA 2EKQA 3DZHA 2POQX 3FHLA 4RV9A 1HTBA 4F6CA 1RPNA 5JS6A 5IF3A 3K9QO 4LSMA 4YXFA 4W82A 4A73A 5L53A 2CF5A 3KLMX 4IMPA 4ALNA 1YB1A 3OJEA 4LK3A 1FDVA 3ZI0A 4J9VA 1W4ZA 1V6AA 4CLHA 4MO2A 2HK8A 1Z45A 4GX0A 5G4LA 5HWSA 4GLOA 4PLPA 3DHEA 1CETA 3N58A 3NKLA 1Y5RA 1KIFA 3C1OA 4M49A 1DJQA 4UREA 4XQGA 4MVJP 1P1JA 3PRJA 2OP1A 3K5PA 1FJHA 4OO3A 1GY8A 6LDHA 4GGPA 5KVQA 4ZQEA 3BHJA 3VZPA 1NM5A 3E03A 4DPLA 4KMSA 2ZTVA 5TX7A 4RF4A 2PFGA 4JCOA 1D1TA 2EW2A 4KP7A 1AHHA 4CMJA 3MOGA 2Q4EA 1HDOA 3I1JA 4JP3A 3PJGA 4Y6PA 5FWNA 2FMUA 3GK3A 4I8XA 5EJ2A 5BNTA 1PQWA 1MXFA 1PJLA 1ISFA 3WFJA 2JCVA 3TJRA 4OHUA 1VKOA 1C0LA 4PIVA 4BNGA 1ZMOA 4ZRMA 5EQFA 1VRWA 2PNFA 4AJ1A 4MP6A 4XZ3A 2NQTA 2Z1NA 1Y9AA 3DZGA 3RSHA 2FWMX 1Y1PA 1NFRA 5KKAA 4XB2A 5DOVA 4HNHA 4BO8A 2RH4A 4QSMA 3CE6A 3LC1O 1YGYA 4FOOA 4P4GA 1E7WA 3DTTA 3OA2A 5I9NA 1Y8QB 1LRKA 3CH6A 4E30A 4AJEA 4N54A 3OH8A 1J6UA 1N7GA 3ZN2A 4P22A 4UULA 3GZNA 4CQLA 4ALMA 1UAGA 2V6MA 4HY3A 2JD0A 3EW7A 2C59A 1SEPA 1P44A 2IXAA 4BB6A 1XLTA 5IDWA 4BMSA 3HDYA 4J2HA 3A9WA 4YRAA 3VAZA 1QV7A 4K9DA 4BO9A 3KO8A 4BGVA 1UXJA 4B3HA 3NYWA 2C54A 4J1QA 4UUPA 3TF5A 3EHEA 3ASUA 4OKIA 1I0ZA 1HYHA 2OOSA 3DAGA 4FW8A 2EW8A 2QYSA 3IIEA 4DPMA 5A04A 4E6PA 5COAA 3TFQA 5AXCA 4R5MA 2XAAA 2NTJA 1GYRA 1DSSG 4MVJA 3AOEA 2GD1O 4TQGA 5KWEA 4I9HA 4Z3DA 1M67A 3DZJA 4E2ZA 2EHDA 1HT0A 1NVGA 3MJCA 3Q2IA 3FNEA 4YAKA 3D3WA 1PX0A 3K73O 3NJ4A 1P1IA 3D1LA 3SX2A 5L7TA 2PA3A 1KEUA 3PI7A 1C1DA 1EE9A 4CR7A 1WPQA 2O7SA 3ROPA 1BVUA 1VL0A 4CR8A 2BH9A 4HBGA 1WDKA 1EUCA 4JIGA 1UZMA 1GUYA 2Q2WA 5L4LA 1K3TA 5JYDA 1NR7A 3GVHA 3K92A 3AU8A 2IZZA 5C3MA 1GV1A 1QLHA 3D0OA 3DBLA 4RPHA 1KVRA 2HMVA 1ADCA 1W0CA 3ITKA 2QQ5A 4J7UA 5TF4A 4OIMA 3WNVA 1QG6A 3DONA 1XSEA 4EEXA 3DHYA 2PZKA 4GWGA 3S1LA 5MGBA 1PL6A 3CKYA 1E7MA 2XPCA 2PZJA 2FN7A 3HN7A 4NFYA 4PZEA 2PK3A 4GX1A 4HADA 4BQPA 4FR5A 4Z3KA 3WGGA 5GZ1A 1WMAA 2QRKA 3KRTA 4XGNA 3HDHA 4WKGA 3FPLA 1HETA 1E3LA 3OP4A 4XQ9A 3ZU4A 4BO1A 5FFFA 2P2SA 2PZMA 3ZH2A 3MOIA 2GN6A 1JN0A 2J3KA 3GNSA 1U8XX 2I99A 3ZW9A 4UAGA 3VDRA 5CG2A 3FCOA 3PLRA 4KOAA 2JD1A 4IUYA 1UZLA 2NVUA 3IMFA 2RAFA 4OH1A 4BNJA 3WWZA 3OM9A 2Y0DA 2FOIA 3HHPA 4TZKA 7MDHA 3W8DA 3E6AA 1V3TA 1HXHA 2HCTA 2I9PA 2J3HA 1WXDA 4W7IA 3HZZA 2VT2A 2BRUA 1I8TA 3FBTA 4CMEA 3C7CB 4QX6A 2NM0A 4ZQHA 1SOWA 4GL4A 3HJAA 3ZWXA 2HKIA 4CV2A 1E3SA 1BHSA 1N9GB 2GZ2A 2F1KA 4YJFA 3WYEA 1A5ZA 3OFSA 3EDMA 1KETA 4U5QA 2D3TA 5LC1A 1GL3A 3AWDA 1FDTA 3AFMA 3ZDFA 1NHWA 3HDQA 3M2PA 4ND5A 3VKVA 5TLSA 4QFDA 4HKTA 3Q6IA 2NVWA 2W2LD 5CHEA 4ID9A 3LSYA 1H2BA 4B4UA 5EINA 2CNBA 1PJQA 3QVTA 3AI3A 3TQHA 3JQBC 4PRKA 4WLEA 4BNKA 1PL7A 3FWZA 1Z6ZA 4IS3A 4XYLA 2X6TA 4UEOA 1LUAA 1P74A 2OBNA 4CMGA 1WLYA 3TL3A 4MKZA 3A4VA 1VSVA 2WJPA 3DMTA 1YL6A 3B1FA 3JSAA 1Q0QA 4S3MA 5EPOA 4B3IA 4ND2A 4EZBA 1LQTA 5TJ9A 3WX0A 3INRA 2PTGA 1H6BA 1LLDA 5L3ZA 4OGWA 3HUDA 1B14A 4LISA 1ZVMA 2DPGA 5AXAA 1I3MA 2FR8A 4GVLA 3WG9A 5G0WA 2FRDA 4TZTA 4RJTA 3FWNA 3AUUA 1LLQA 3CIFA 3H9GA 4D3SA 1LQUA 3WBFA 1YOVB 3H9UA 1ZZEA 4JJFA 2VZ0A 4OOEA 3HB5X 2VHXA 1VL6A 1U2GA 2P4HX 4YJHA 4YAIA 3WBBA 4E2YA 1NFFA 1D3AA 1OC4A 3L6OO 4U7WA 4XA8A 1O94A 1P1FA 1UP6A 1YB4A 2AHRA 2CDAA 2DBRA 2O3RA 2ZB7A 4M55A 4NBUA 4HV4A 3NGLA 3PIDA 4N5MA 5ICMA 5JDIA 5THQA 1LSOA 5TIIA 4PN3A 3ANNA 1NPYA 5COBA 1EDZA 2GCGA 3HDJA 1E92A 3PHJA 3KYDA 1T1SA 3VPHA 3PWZA 5T5QA 2YFQA 1PGOA 1ZJYA 3ST7A 3L07A 3PFFA 3UN1A 1GCUA 3I9OA 4JGBA 3K6JA 4MIYA 3DBHA 3RUAA 3JQAA 4PLHA 2FPPA 4YDRA 2HMSA 3L0DA 1JQBA 2X0NA 2VYVD 1IE3A 2VUTA 3DOCA 4PRLA 3RIHA 2Z95A 2JFFA 4NK4A 4XKJA 1YDEA 3OBBA 5ES3A 1Q7CA 2C0CA 3PYMA 4MVJH 4XIYA 5ER6A 5T8KC 3UF0A 1X0XA 1U3UA 1EUZA 4ESOA 5IZ4A 3D4PA 2Q45A 1EVIA 3B1JA 2FZEA 5LDHA 2WTBA 1HLDA 4RVFA 1E7QA 1ENZA 2ZJ0A 2Y99A 4NI5A 2YQ5A 4Q3BA 3A28A 5H82A 3BMOA 1LDGA 4ZN6A 3ETEA 3FTPA 4PG5A 4R1UA 3VH1A 1E3IA 2Y1DA 2D59A 4OKNA 2VWPA 3GC6A 4YRDA 4ALJA 2GLXA 3BHMA 3LVFO 3U0BA 5JYEA 1E6WA 5CG1A 3JD3A 3PLNA 1SC6A 2AEMA 3O4RA 1QYWA 3RCBA 3ZW8A 5I9LA 1JKIA 1YH3A 4F46A 1PGQA 3F5QA 5JDCA 2NSDA 4CV1A 1OFGA 5ENVA 1ENPA 3H4VA 5HRUA 1ZUD1 4I9NA 5H83A 1GQ2A 3RVDA 3QE3A 2EWMA 2JL1A 4NJMA 1Q0HA 2DTXA 4CODB 1GZ3A 2E6UX 1SNYA 3LDHA 3UCXA 3UH1A 2IE0A 4AJJA 1B26A 1IZ9A 2P5UA 4JX8A 7ADHA 2AQ8A 2YHUA 4FFOA 1M66A 1VC2A 4H16A 2TMDA 3H5AA 4TKMA 1Z82A 3VH4A 1K89A 1KEWA 4U6QA 4XQCA 2VRBA 1MFPA 4TWRA 4XCVA 3FF4A 4XR4A 4L4SA 4QXMA 1KERA 3VVCA 3U49A 2EIHA 2JCXA 4E31A 2OFPA 1PR9A 2J5RA 4CL3A 1X1TA 1MC4A 2YHIA 3I9MA 4Q3CA 3TDKA 1QP8A 5BSHA 4ALIA 2PKQO 1ONNA 4PLGA 3HN2A 3AUAA 5KVSA 5L7WA 3WJAA 3GRKA 2DTDA 4RDIA 3DO5A 4LRTB 4TROA 5CDUA 4E21A 1U28A 5IN4A 3ROMA 3L6DA 3D7LA 1YQGA 4GMGA 4YTEA 1JVSA 3K2EA 1Z7BA 3P5SA 3ZZNA 3SJ7A 4J0FA 2D5CA 3RKRA 3TN7A 2PLAA 3JQGB 4IDCA 3ULKA 1YE3A 2CDBA 1BDMA 1CF2O 3JQEA 4K1LA 4NR0A 3NV9A 5B12A 1U5CA 2D8AA 2EGGA 2J8ZA 3OIDA 2NWQA 4BNNA 4WCDA 2W2KA 2Q3EA 1NPTO 2WMDA 1GU7A 1V3VA 4WGGA 4NFSA 1I2BA 1OC2A 1HEUA 3U5TA 1IHXA 3UW3A 1ONPA 1LDNA 2X4GA 1ID1A 4Z9XA 4FN4A 2FR1A 5IG2A 4W9NC 1OBFO 4AJOA 3L77A 4IM7A 5I9MA 2YQ4A 1T2AA 3QQPA 3QVWA 3RFVA 1E3WB 2D4AA 2ZK7A 4AFNA 1CJCA 1E5QA 2X0JA 2V65A 4CLRA 2AA3A 5K6AA 3BMCA 2NLOA 1IOLA 1ZK2A 2O48X 2ZYDA 1HDYA 4O0LA 1C0KA 3L4SO 1FDSA 1UR5A 1ENYA 4X54A 2CVZA 3PHHA 1QSGA 3JQ9C 4XQEA 2QZ9A 4QFCA 3NT2A 3PWKA 2C20A 3MCVA 4J4HA 4J1SA 2WD7A 5JW6A 2JHGA 1H9BA 4JQCA 4ALKA 2HO5A 3GLQA 5TQVA 5IDXA 4CPDA 2VRCA 4UUOA 1VJ0A 3I52A 1MB4A 1KBZA 2E49A 1WVGA 1MX3A 1CRWG 3ZHZA 1C0PA 4RDHA 3O03A 1R4MB 4J49A 4BNXA 3GVPA 1XDWA 3IOYA 4RVGA 3ZHXA 1R0LA 1H6AA 1LDEA 2ZB8A 3EGOA 5TJHA 3PJEA 2UUOA 4YT8A 2WYVA 3RFTA 4WCFA 4DQVA 4IINA 2B4QA 5BSEA 4Q9NA 1C1XA 1GZ6A 1HDGO 2X9GA 3JQFC 3PK0A 1ML3A 4CM1A 3KXDA 1VLLA 3H8VA 1VE9A 2OP0A 2EGHA 1FXSA 5TNXA 1J5PA 4MVJF 4YRBA 1RJWA 1EMDA 5B4VA 1ULSA 4NJOA 1IZ0A 4XGKA 2DBZA 2Y66A 3HFSA 1E1KA 5F3RA 4BVAA 3F3SA 3NTRA 1TI7A 4FC7A 3RQSA 3G0OA 4WLNA 3OIFA 4PFJA 1KS9A 4XJSA 1LJ8A 5JPIA 1R12A 5ITVA 5GZ3A 3ZWBA 2ZTUA 1HRDA 5BR7A 4YEDA 5BNIA 2ZYGA 3AI2A 4N7RA 3HWRA 1BXGA 3RUDA 1DIGA 4CM8B 3RJ5A 5HA5A 2HRBA 4LCJA 4EBFA 4BNIA 5K0ZA 2G17A 1ADFA 4OM8A 5EL0A 5T6BA 4DGSA 4WOJA 4IIUA 4WJZA 5A9SB 3GOHA 3D64A 2TMGA 2I5PO 4PZDA 4CM4A 5JAMA 2C2XA 1HSZA 2WDZA 1NXQA 3OJOA 3QWAA 4DIFA 5HS4A 3GVCA 4FJ0A 4P8RA 4TVBA 2BLLA 1HSOA 3RBVA 1B7GO 3GUYA 1RKXA 2RIRA 3FNGA 1GFSA 3E5RA 1IL0A 1LDYA 1MG5A 3CXRA 1I36A 2X58A 2FPGA 4PLYA 4D7AA 1Q7BA 4MOWA 3LYLA 3RASA 3ITDA 4AL4A 1CQIA 3DBRA 4BL5A 4EUFA 5A02A 4PLVA 3S8MA 4AJHA 3DZKA 3OF2A 1ZSVA 3ABIA 3D4OA 5L9AA 2VYND 5F1OA 4WK6A 1HE2A 3PWSA 4UUMA 4NFHA 5ITWA 1X0VA 2DUWA 1A9YA 3VTZA 1NNUA 1KVTA 1R0SA 2Z1MA 4KWIA 4RPKA 3DAFA 4LCEA 3H6KA 4IJKA 1XEAA 4D46A 4K6CA 2ET6A 4BGIA 3GZ4A 4GI2A 1PL8A 1LXCA 4DYDA 1LC3A 1BTOA 2HJSA 2UVDA 5DP1A 4INAA 2AEJA 1BVRA 1FK8A 1LA2A 3MJEA 4Q3NA 9LDBA 4FB5A 1PGPA 3RUEA 2B35A 4CMAA 3CMCO 1MG0A 1QYVA 4BNZA 4NG5A 4EI2A 1R0KA 3CTMA 4G65A 1KVSA 4D41A 5DOZA 1WZIA 4OSOA 3SVTA 1N7HA 3SLKA 4UVEA 4YPOA 3GVXA 3ONEA 3VPGA 4WLVA 1AXGA 4GAEA 3RAJA 1A7KA 5C7OO 3DXFA 2B0JA 4F3YA 1HZZA 1NAHA 4XRGA 4Z6KA 3D5TA 1BSVA 5TGDA 1JA9A 1DIBA 4RZHA 1ISJA 2D5AA 4ZQBA 4U0JA 2X1HA 1R4NA 4JJGA 1D8AA 4URFA 5THKA 3JQ8A 4RQUA 1T26A 3GMSA 4NBWA 1AUPA 1GQQA 5CEEA 1O9BA 2BD0A 3QY9A 2DFVA 4PVCA 2YW9A 2P5YA 3W8FA 4BMNA 1EZ4A 5K9ZA 1X14A 2EP5A 2HMWA 3CSDA 4YBZA 5I8WA 1PZEA 1WDMA 5DCYA 3FNHA 3FTNA 1NHGA 1NPDA 3AUSA 4MIEA 5C7IO 5BSGA 4XIJA 4DQUA 3TRIA 3ZV5A 3K96A 4DXHA 3PTZA 1ZMTA 4GSLA 1GADO 1KYQA 4R41A 5HBRA 2V7PA 4FJ1A 5LCXA 3NT5A 4DWVA 4JN6B 4MVJI 2HK7A 3L4BA 5COQA 4ZQGA 5TT1A 4Y6RA 5EMHA 4C7JA 1F12A 4GMFA 1SPXA 4W4TA 4GBJA 1LRJA 2VHVA 2VN8A 5CDTA 1X7GA 1X15A 2W90A 1Z73A 4CV3A 3VPSA 2DBQA 2UDPA 3PHGA 3GEDA 4L74A 4PLTA 5H81A 3UICA 3ZWVA 1B8PA 1GDHA 4AG3A 2Y0CA 5F1KA 4IQ8A 4AICA 3HSKA 4R01A 3KEOA 3UVEA 1E77A 4PCVA 3ZNPA 1DFGA 4HFNA 3GAZA 1ONOA 1YDWA 4R5HA 1EVZA 3PZBA 1UH5A 1E1MA 1ZK4A 1DFIA 3IKVA 3MJVA 3WMXA 3F1KA 4E13A 2Q49A 3AJRA 4D43A 4J16A 3DQPA 4PLZA 1X7HA 1B8VA 6ADHA 2H5LA 1LSJA 1D4FA 4EW6A 1U3VA 2YDYA 3H9EO 4KZPA 5EERA 3PHLA 1ZEMA 4B4WA 4OXYA 3HQ4O 1TT7A 2H63A 1TXGA 1ZSYA 2IYOA 1PJ2A 3QVSA 1PS0A 4BNTA 4YYZA 5JAZA 3O26A 1YVEI 3WDSA 3QSGA 1UDBA 4LVUA 1KC3A 3E8XA 4MINA 3RUCA 4CM5A 3GZNB 4GX2A 5G0VA 4E2XA 4ZICA 3KB6A 3Q9UA 4CQLB 4IDEA 3QVOA 1RYDA 1OAAA 3VDQA 1W73A 3RU7A 3JQ7A 3LT2A 2P68A 1T2FA 4DTIA 4M87A 3LZ6A 2Y1CA 3ZV6A 2GF2A 5U9CA 3BYZA 5G0SA 1ZEJA 1ZH8A 3ZNQA 4IBOA 3FD8A 1XCBA 2ZB3A 3OETA 1O89A 4H7PA 1PJSA 2WEKA 3I6IA 3KV3O 3TFOA 1EK5A 1JLLA 3GR6A 1LBEA 4YWJA 4PLCA 3DB2A 4HP8A 1CYDA 3ROKA 1YJ8A 2OGUA 1EEHA 3JV7A 4LGVA 5GY7A 2AMFA 3R1IA 2FPIA 2EJVA 2NV6A 3UKOA 1M76A 1S6YA 4UUNA 4AJIA 4TKLA 2WD8A 5FI3A 2O4UX 3DZBA 4QO8A 4K6FA 3ZHYA 3I6QA 1Z75A 1EUDA 3D3WB 1F0YA 1H2HA 3V5NA 4MVJE 2SCUA 1F8GA 4HFRA 1C1DB 1XKQA 1NASA 2C2YA 2XOXA 2PY6A 1W6UA 3IP3A 5CAEA 1Y7TA 1IYZA 4OSPA 4Y8VA 4GPD1 2DC1A 5I8ZA 4Q3AA 3ZCXA 2X0RA 4DBVO 2VCYA 1AGNA 2RCYA 1HL3A 5F21A 2O3JA 4UVIA 2NACA 2I6TA 1SB8A 2IDZA 1UP7A 1EBFA 4S1VA 2DUUA 2GASA 3Q0EA 3DBLB 2AG5A 5K6AC 1UJMA 1F8FA 5T64A 2HUNA 3F4LA 1YWGO 2VOEA 5MDHA 5ER9A 3E5MA 4MKXA 4TVOA 3G1TA 1A9ZA 3NTOA 4R51A 3KYCA 4W6ZA 3PJDA 1HLPA 1LNQA 4XYBA 2Q1UA 4CM9A 3WB9A 2NUAA 1QKIA 2AE1A 2V6FA 2CMDA 5DDIP 4A27A 2EEZA 4A0SA 4BQRA 4NIMA 2NU8A 2RH8A 4CUJA 3PFWO 2EJWA 2X0IA 2PD4A 2FHSA 2G82A 1PTJA 4UVGA 4BV8A 3GGOA 1H5QA 2RBEA 1N9GA 1ADGA 4KWHA 5CEJA 3AW9A 4CL8A 5A5EA 5KJFA 5G0UA 3VH2A 2HU2A 4AJ4A 4IY1A 1DC4A 1DIAA 3MZ0A 4JK3A 1VJ1A 1R37A 4R69A 1G6KA 1LC0A 4KUEA 4IJUA 5ENDA 4TRMA 4GKBA 2NVUB 3MEQA 3S2EA 4MVJD 4NZ9A 4CQMA 5IZCC 2LDBA 4MVJM 2ZYAA 4E5PA 2Y1EA 2YJZA 1UXIA 1LRLA 2DBVO 3AOGA 2O3UA 3NAQA 2GNAA 1Y8RA 4L8VA 3ZWOA 1DIRA 4J0EA 4U6SA 5BQFA 2Q2QA 3TZHA 4D44A 3HE3A 5KJEA 1FDWA 3I4CA 4CMIA 1QYXA 4YJFB 3U4HA 3RD5A 4A26A 2IEBA 2JAPA 1N92A 3ZWPA 3H7AA 4OL9A 1BRMA 3O8QA 4H3VA 4A7PA 3SC6A 4YR9A 4ONEA 4B3JA 4CMCA 3NDIA 3RC7A 2CFCA 4M54A 3SC4A 3WS7A 2Q1WA 1GUFA 4ND3A 2A35A 1V35A 4J4TA 5A05A 1U8FO 2PH3A 1ISGA 1NWHA 2OO5A 3LK7A 1PZFA 3H3JA 3OJLA 4N18A
chains in the Genus database with same CATH superfamily
1E7SA 2VDNB 4ZOEA 2P9CA 4EEKA 4BKRA 4RF3A 1SKUA 1AS0A 1CHDA 3WGNA 3JAMA 3NWJA 3OE4A 1U31A 5BUCA 1PK8A 2D5BA 1NUQA 2ZPAA 3UH0A 1UKBA 5LU9A 1C8BA 1F3OA 1U0NA 4ZZ2A 3N2IA 5CRIA 1FUKA 1QIIA 1WZCA 1U7TA 2H1RA 3IIKA 2IUEA 2VUUA 3KJQA 2BKAA 4MKHA 4C0BA 4F6LA 2BI4A 1Y42X 3AIIA 2Y1OA 1AKEA 3KT6A 1AXEA 1GV0A 4UATA 5GM2A 1X8XA 4REQA 2Z09A 3LL7A 3HZHA 2CVHA 3L8YA 2XDQB 1GG8A 1WV1A 4BO6A 1O95A 1A1VA 1DU4A 3G0GA 4D45A 1FMFA 3COJA 2ZJ1A 1TUGA 1WO8A 2MYPA 4ITVA 3O8NA 4ID3A 3QHQA 1BROA 1FUEA 4Q9JA 1KP3A 1IG3A 1TLTA 3M70A 1KOLA 4K9SA 1L8AA 2NQ8A 4PSVA 4R1SA 3M6VA 1B15A 4UDOA 4FCCA 3MCTA 4YXWA 4EKDA 4AKIA 1Q19A 3I04M 3F6PA 4MUNA 2XMBA 5B2EA 4PQEA 3LX5A 4S1TA 4YV2A 5TS3A 4KN9S 2GO1A 2P4UA 4RMGA 4X66B 1I3CA 3RGGA 3W6UA 3HYNA 2BGKA 1HDCA 1U3WA 4A6DA 3D0QA 4WQMA 3CPSA 2BCEA 3PPIA 4K88A 4LZNA 3HO1A 4DQ0A 2E82A 3FUUA 2YV1A 3KYDB 4NVRA 1RVV1 2C0PA 3OIWA 3WA6A 2JGAA 5F73A 3G79A 5LP1A 1VA5A 4KWTA 4QYMA 4BMPB 1MAAA 3ASVA 3I01M 3ZJ4A 4B7CA 2AXQA 4N49A 3AHEA 3O0DA 4J0QA 4BNUA 3C97A 3DBHB 4FSXA 2WD9A 3KC2A 1T9GS 4BO7A 3GDFA 4RK6A 1R6BX 2FPPB 3TSCA 3P2YA 4BJ6A 3HP1A 2QGZA 4JSYA 3VPAA 2R6JA 3A10A 3C16C 4R1TA 5DULA 5JSZB 2BZGA 2X6QA 4RL6A 1GAEO 4Q24A 1B0PA 3W9BA 5BOSA 2VFAA 2P0AA 2KQUA 1RMYA 4Z5XA 5EWMA 1HZZC 2IYVA 3QIVA 2W6MA 2WMOB 4JOQA 1T6YA 4EGFA 4LAFA 1NR5A 1O6CA 4GICA 2IPOA 2VHZA 5FB3A 3AEUA 5D7BA 3V8RA 1JW9B 3PNVA 4DLPA 5SYNA 5JYBA 4G0XA 3KUXA 3PKZA 4FBGA 3EZ9A 1JILA 4F60A 1F8UA 3H5LA 1HYBA 1C29B 5K8JB 3ICQB 3DTVA 2FPLA 1EB8A 3BMOB 2BFEB 3PJFA 4MUHA 4TMWA 4PZAA 1QYRA 1RNLA 2HLHA 4EHAA 1O2DA 1QFMA 1R1DA 1SC9A 3QWIA 3GBPA 4ZI5A 4TLAA 4Q9LA 2HQRA 3W9UA 3OX2A 1T3ZA 4HWKA 5U4QA 4B4KA 3F73A 4N01A 4UEJA 1M6EX 2ZRJA 2WOOA 2FKAA 2F2TA 2H1SA 2GPAA 3D6UA 1E4YA 5JAHA 3DL7A 3MYRA 3OX1A 3EVTA 1V96A 1P77A 3CONA 2Y1KA 3EDRA 3AEYA 3RYFA 3TNDA 3U4DA 4F96A 3KHTA 4YAEA 5G53C 2IOHA 1F9EA 5CLIA 1J42A 1Z0DA 4A9AA 2O1EA 2VK1A 3SXPA 1OLUB 3G8DA 3GEPA 1PV4A 1Y33E 4KN5A 2W2VA 3NIWA 1WW2A 3AGPA 5CM8B 1SZJG 2O3SA 4MI9A 4QBIA 4Y2TA 3AVXA 2PXXA 4LK2A 2I76A 1ZN9A 3N7TA 4J91A 2C7VA 4JITA 3CLRD 1HTTA 3QM1A 4I50B 4MKGA 5CA1A 3U3KA 2X5JO 5BYBA 1O95D 5KCMA 4DNFA 3D6NB 4AKTA 2D06A 3BT7A 3W5JA 2BUBA 2XNCA 2VHJA 1E2NA 1X7XA 2XWSA 3EFOA 2ID4A 4HUTA 3JAWB 3F5DA 3IEUA 3IUPA 1FDRA 1TT5A 4E4TA 2GB4A 4YXWD 4LV5B 1UFRA 4N8EA 4RUKA 4TXJA 1OOEA 1TA4A 4BIIA 4AZ3B 1J22A 4NV3A 3UFXA 2B82A 5KJ6A 1UFQA 3UBTA 1EE2A 2ORIA 2HU8A 3H9QA 2HNAA 4FR2A 1SB9A 3D4LA 4PZCA 2PZLA 3OA0A 5J43A 2FFJA 2OB2A 2R79A 1K68A 5K3FA 1PUJA 2IHBA 1WRBA 5ALNA 1SHZA 2JI9A 3QU5A 2GAJA 2BI7A 4PE5B 1Q6YA 3D5EA 4I55F 1OCEA 1XLTC 1SQSA 4GM1A 1VCMA 2Q6IA 3EFHA 5KYVA 3IV6A 5JJCA 1EQ2A 4LHWA 2RIPA 3HYRA 4K6HA 2WINI 3SQMA 4M36A 1EWTA 2B61A 2RJNA 3BA6A 4ND4A 4RDXA 3MRVA 3G9UA 5JSKA 1C7ZA 4Q4AA 1W0KA 1E60A 1NC3A 3ONDA 5L40A 1IC6A 5F4BA 3UYLA 4OX9Y 2CDNA 4RKWA 4KR0A 2JRLA 4S24A 4AW9A 1P1RA 2DLCX 1JDBC 1NNSA 3CH7A 3TXAA 3CRVA 1V26A 2ODTX 1XIVA 1E59A 1Z2DA 1IZYA 1ZM4A 2LR0A 3C7TA 4G5SA 4IQGA 4RHFA 1DUIA 3MGAA 3RFXA 4EMSA 4AM8A 5B30A 4M3NA 1FE8A 3C7DB 3PQDA 3ZXSA 1BCSA 1ZS9A 1CJMA 4CUZA 1V8DA 5BQ3A 3U09A 5JAIA 1P18A 3AOEC 4JJKA 4M1QA 4QFMA 4DCTA 2W2KB 2Y3IA 5AKGA 4ZVOA 4AROA 3GNTA 4BKQA 4PQRA 5EXDA 4BNYA 4KO1S 1O96B 1XKXA 2CHFA 1AC5A 3CF6R 3IDOA 1FQOA 2EF1A 5AK6A 2R8EA 5A7HA 3DTVD 2VAWA 3JASA 3DMYA 4I1YA 1O5IA 4HVCA 2CLOB 3T5MA 1RCFA 5AUNB 1X1DA 5DV9A 5JJBA 2BFDA 3LPAA 4AB1A 4MS3A 4YRSA 4UBMA 5E9AA 4D96A 1SM4A 5LZ7A 1ZQ1A 3RS9A 1G66A 1RKVA 4H60A 4CLRB 4GI1A 3I64A 2GT1A 1WEHA 2VQ3A 4MP3A 1NE2A 5LA6F 1IUPA 3ZGVA 4LQ4A 4ZHSA 2B3TA 1DQYA 2QVYX 2OPBA 2HF7A 5JH7F 3DFZA 1TB4A 2W5UA 1VLVA 4PHCA 4MUEA 3UV7A 3PP8A 3FUXA 3J7TA 3WLEA 4E2WA 3EUFA 5EWLB 5AHKA 1L5OA 4ZZIA 5LQKA 2QPLA 3TOXA 3ZD6A 1Y5NA 3FH0A 3P0JA 2PLFA 1MGPA 3L06A 1DXHA 1GQRA 3GRUA 4H2DA 4G0WA 1N5OX 1VLJA 2GTPA 3QPUA 4IMRA 3AHDA 4JNCA 2WKWA 4QATA 3SJZA 3AF4A 1ZJ6A 4EJ6A 4EB6A 2HMTA 2X5KO 1AGYA 1SPBS 1TECE 2WF8A 4N41A 1PGNA 2ENWA 3FFTA 4JLUA 1ZA2A 1XPJA 4KLCA 4Q7QA 1QRRA 4ZHQB 4HTFB 1IB6A 2IEZA 3R74A 4MJLA 4EG1A 4YAGA 2RARA 3LHKA 2DFTA 1LWOA 1TUBB 2UYGA 2YXNA 3DDNA 3HBLA 4QLOA 5HBGA 3WHLA 1EUYA 2YUTA 3DL2A 3DZFA 2HYIC 1B8OA 3L6CA 2AG0A 2HRRA 1NLUA 4IAOA 3NALA 2GO7A 4Q7JB 3VQTA 5I4CA 4WCFB 4HDMA 4Q9IA 5I7VA 1U0OC 4NK5A 5DH9A 1NZDA 3PIIA 3G49A 1NFQA 2K7FA 2XCIA 4F5EA 1JTEA 4CM8A 2GH1A 2AG8A 5KI6A 4E2FA 1VB3A 4J6EA 2NUBA 1WAMA 1QYIA 4GH5A 5JO9A 5HMMA 5KNCA 1SU4A 4LY9A 4MYCA 2ZQ5A 3V46A 3ZWMA 2V8OA 2H18A 1GPAA 1R8YA 3ZY6A 5MGNA 1AA6A 3ND9A 4I5EA 2F17A 2ZQZA 4ZYVA 1LLUA 1YXMA 5DYNA 2UV8A 3A25A 1UFVA 2YRXA 3KLPX 3VZQA 1EUQA 3AR5A 1UWCA 3DBOB 3V4VB 4E11A 2FFQA 5K0JA 4JC8A 3CZMA 5AKJA 1K1EA 4JLSA 1SG0A 1V1MB 5I7SA 2EFYA 2HQBA 1PQ4A 2JF0A 4Y2HA 4ZAXA 3BEOA 1EJ0A 2WTUA 1Y5MA 4XD2A 3ABZA 1DRUA 2QL6A 2B9EA 1CQWA 1ZIXA 3SCZA 4U9HS 1V9LA 3WLSA 3F0TA 4XPIB 2IBSA 4YT2A 1T91A 1CNEA 2XEDA 1LSUA 4FYHA 4GKKB 3CKKA 1SKAA 3KJXA 3PQ5A 2K7ZA 3R8XA 4FXOA 4KRGA 1CJBA 1DIHA 1KK0A 3IMGA 2E89A 3CLTD 3FJ1A 4NPAA 4BNMA 5K45A 4OXKA 1WNFA 3B1KA 5M34A 5BT9A 2C88A 1BU8A 4R2WA 4A0GA 1XWIA 4EI9A 4QJBA 5J2UB 3MJTA 1RWPA 4DA9A 1KQ3A 4YRMA 5AJUA 2A57A 1H0HA 5JJ5A 1TVKA 1DAOA 2F64A 2VPTA 5E0KB 1CS4C 1TD9A 3BWVA 3FJOA 4B7ZA 2CJWB 1T8PA 5IVKA 1VDMA 4LJ9A 3QA9A 3ZS8A 1VMEA 2VJKA 4P98A 5CB0A 1J9EA 2PRZA 4NJEB 3N5CA 3IYLW 4JV5B 1G1AA 3KZOA 4JKIA 3M1IA 4Y9SA 3LDFA 4MLPA 5J23A 2GKOA 3JQCA 3QHAA 4HN2A 4CIBA 3CISA 2XRMA 4FFLA 3ZDQA 2G7MC 2H5IA 2WU4A 3R8CA 5KWIA 1W19A 2XZDA 3UAVA 2PQ0A 3A3PA 1KJIA 5A5FA 2FJPA 3DMTC 3GPDG 4NU6A 4IDFA 2EKLA 2IUFA 4KH1A 1GQSA 5T4FA 1RHKA 3AB7A 2KI5A 3EIXA 3GLHB 1OMOA 1YNOA 4DB2A 5A62A 4DREA 4BQIA 3AJEA 3K20A 3OEYA 1X13A 2CVOA 2LDXA 2XWPA 2IVFA 3RKSA 3HWX1 3C7AA 4CLOA 3R7LA 1NTOA 3CS3A 1J00A 4O8ZA 5JWHA 3PDUA 3VTFA 4ZDIA 5FEUA 2PUVA 3E70C 2PYIA 3D6JA 3NHBA 3AZOA 3TUIC 3HRIA 5P8WA 5K3SA 1FRVA 2R7LA 3HXLA 2MR5A 1E96A 5K0EA 3TDNA 2BFCA 1JLMA 3UGQA 3RANA 3KQOA 1CX9B 1REQA 2BKLA 2EZUA 3B78A 3IE0A 4FU0A 3V4OA 4G8BA 1HA3A 1FX0B 1OI2A 5EJ5A 3OPMA 3I3OA 2HCRA 2UZ1A 2ZQYA 4JQZA 4EUEA 3K32A 1NSFA 3O4JA 4XSHA 3ZTTA 3ZVRA 1PZNA 1N2CE 4QYIB 2Q3LA 4OHMA 4CMBA 3QPBA 1GCOA 5T3UA 4M1WA 2DJ5A 1TLFA 2F1RA 2ZAIA 1TOAA 3K0EA 3WTCA 2CC2A 2IH4A 4NMLA 2CFIA 1YASA 2ZB4A 3QK7A 4PYQA 1NWCA 4RANA 3UUGA 4KR2A 1SA0A 2VWQA 3G8CA 4GGOA 1F2UA 3U7QB 2H9AA 3GQVA 4CHGA 1V3UA 4X3PA 3ZZ1A 1TRHA 4FDLA 4O6VA 2JW5A 3ZZMA 1EIZA 2I67A 4DAOA 1PJ4A 4WXMA 4EHKA 2RGNA 4ENTA 2C4NA 3DBIA 3GH3A 5FUXA 3H1EA 4X85A 1QCZA 3D2LA 5BRNA 1JAHA 1K7XB 3DO6A 4KYUA 4DLBA 4Q16A 1KZ4A 4OXIA 4RTPA 4Z4QA 4JXZA 1UDRA 1MO4A 2PH5A 1OB2A 4ZQCB 4PXAA 3IQWA 4JELA 1NXVA 3I9NA 1BHO1 3O1HB 4L6AA 1G38A 2FMIA 3TXXA 3G5LA 3K05A 2FE4A 2BONA 3NXKA 4LZAA 3RJ9A 2XGOA 3KTDA 5IFKA 3WYBA 4HDNA 1U5AA 4KUHA 1NVUQ 4FMPA 3U62A 5BWLA 5K6RA 1QTNA 5JZSA 2QDXA 3MUNA 5KPDA 4UBKA 4DV1B 4TLEA 3P96A 4NCXA 4RA9A 1YU6A 4KRYA 3TBKA 1GL6A 4MO9A 2GXQA 5IWAB 1NXPA 2ZI7A 4OQMA 2ZDGA 5C8VA 1GZ5A 2PJRA 1NRXA 2E48A 1C0IA 2JK1A 1Y8QA 1VP9A 3BFXA 5GMOA 1G9SA 1KP2A 2I4OA 2FSHA 1Y8AA 3EXHC 3GP5A 3JATA 4NV0A 1BVHA 1SFRA 4JU9A 3LYAA 1GSOA 2AYZA 2QXUA 2NT3A 4FQ8A 1EFUA 3UQZA 1TFUA 2VSNA 4A23A 3T7TA 3PC4A 2GD0A 4DIDA 1CZNA 2QUIA 3KTAA 1U4SA 3OHSX 4JR0A 1HRKA 4L73A 2JATA 4PM4A 4Y67A 5JDCC 5E4YA 3GY0A 4G8DA 1IN8A 5FOVA 3EN0A 1LDBA 1I7LA 1GPKA 2D8MA 2HSWA 3LC2O 3B6ZA 3V1YA 1Q1NA 2I0FA 4Z1MA 1CFZA 3HA5A 4J1TC 3CM0A 5FHRA 2IYLD 2VTEA 2AG1A 5SY9A 3ST7A 3TBFA 3W3AA 4IGEA 5B58C 2YZNA 4DCOA 5C80A 3LW7A 2ZPUA 2CJYA 3H2JA 4FMBB 4J0GA 4KQCA 4B9AA 5EPUA 1XFDA 2JLZA 3SP1A 5A4AA 5AVRA 4X60A 1T4MA 2CXNA 3FMGA 3I32A 4YDSA 2Q3CA 5D2CA 4Y2YA 3NP9A 3V8BA 2IPXA 2R1VB 2CDCA 1G3RA 2PDAA 5FNVA 4G5HA 2XD9A 4M9CA 5IDVA 2MSDB 5LLDA 2BL4A 1ZKDA 1SY7A 2ECOA 2O4CA 1FP4B 3ZPXA 3KLNA 2IODA 1J9GA 4BNFA 1XRLA 2VP3A 3AVYA 2H1CA 2VQDA 1R50A 3VNQA 4LNUB 4KPUB 1EA5A 5TMDA 4J3NA 2Y76A 4EZIA 5A03A 2BN4A 3PFKA 5EXTA 4OA8A 5SZHB 5EYPA 2AEFA 2EFDB 2VF8A 2X8JA 1YONA 4A4DA 4RD0A 4V0LA 1H2FA 3T35A 2I29A 5CVEA 1BX3A 3IEVA 2PLWA 1DINA 1IVYA 4X41A 1NQOA 1OI7A 5ALZA 5JMPA 2C57A 2VTKA 3JVIA 3VR0A 4FCWA 4URHA 3G1UA 4DQXA 1MKYA 1YQ9A 1Y3DE 2ZXEA 4JBHA 3WYAA 3HN6A 3WL6A 3CHYA 1W2WB 3B6MA 4P3XA 4ZDJA 2YWDA 5ICGA 5BVHB 2ECPA 2FX3A 2YICA 3ADKA 121PA 1IY0A 1NY5A 2APJA 2KW5A 5AHWA 5CYOA 2AWOA 1WDLA 2N47A 2XMQA 3GDOA 421PA 1QP0A 2MYUA 3I42A 1RD4A 1TQ8A 2GPTA 5F7XA 4ZCLA 2HRDA 1PD0A 4OI1A 2JFOA 1M73E 4IXWA 3AVWA 1G20A 1E2UA 1UBSB 3GLFB 4MVXA 2C29D 5IMBA 4E03A 4LS3A 4U7GA 2ETXA 1XCGB 1L5NA 2NYUA 4Z4EA 2QLJA 4L9RA 4INJA 3ADPA 1JLLB 5AHRA 4PSCA 4EW3A 2DR2A 2A9QA 1O97D 2ZCJA 1EEXB 5E9WA 5KNDA 3LOUA 2H7YA 2XNSA 1JJIA 2Q7XA 2R4UA 4R68A 4V1CB 5EG5A 1EUCB 1OUMA 3D02A 3LBYA 3NPMA 4QTUB 4UTZA 4WBNA 4ZK6A 2XA1A 5I5GA 5EJFA 4Q1DA 2IYWA 3I5MA 2SECE 1FYVA 1Z2AA 2AE2A 3FY4A 2HPAA 1N3IA 3PHIA 3VC1A 4CTKA 3HCWA 4B83A 4G3XA 1O7JA 4CGYA 3SBEA 2UXCB 1RWBA 2XBMA 5HGJA 4NV1A 4K9KA 5BSUA 2GDJA 3LVQE 2G7ZA 5CAEB 4YP5A 3ROGA 1SQ0A 4B76A 4DRXA 4U8GA 5CBKA 4KUGA 4ITUA 2IITA 1JVBA 4GYKA 1CERA 1QO9A 1FQJA 4G0OA 4X64B 4N7JA 1WSBA 2G5GX 3ETCA 1YBFA 4LY6A 1W4RA 4CCYA 3OO1A 4HH1A 3HJCA 3HADA 1KFBB 5C4GB 1NXWA 5CFLA 3IL2A 1PWEA 1YE8A 2Z4SA 2EKZA 2V0GA 4BMYA 2FMKA 2PRYA 1WUIS 3K4PA 4EF5A 2F1JA 4M46A 3MMXA 3SHFA 2A7QA 3EGEA 1R0YA 3EIQA 3LZDA 4H35A 2BFPA 4QGSA 5AUQA 3A9TA 3TW6A 3MBIA 2W58A 1QHEA 4CQNA 3WBKA 1PAUA 4YN3A 4ZI7A 3QPAA 3RVNA 4ES6A 1OYWA 2VNSA 5ECDA 3WLNA 3R3SA 3B2QA 1AUVA 1V37A 1MZVA 1TZMA 2QLTA 3BQ9A 2NUAB 1MUUA 4B6EA 1E8NA 4KQMA 4GMHA 4PO3X 4ZT6A 4EG6A 5JNLA 3KSRA 5FT9A 3KZXA 4C3OB 3FGOA 4C4OA 4EJSC 3VZBA 2PBRA 2VCEA 4P4NA 2P0YA 2IV3A 1CNMA 1GPDG 1K6IA 5AW0A 1NAIA 3ZIAD 3KSAC 3BAZA 3SJBA 3B1XA 1W36C 1R88A 2N3ZA 1OV4A 4TV9F 1Q91A 2QTHA 1G41A 2QZPA 1QB8A 1N4DA 2ZRDA 5HILA 2HA4A 4CEJB 4FT2A 5JLAA 4JL5A 2IPNA 2F62A 3ENVA 3VMFA 4JVNA 3F97A 4GBGA 4M1ZA 4RAQA 1DBPA 4FS3A 5U1PA 4F7DA 2JJMA 1CR1A 5FFMA 5KVAA 2VQFB 1Z15A 2Z98A 2CLHB 1P5HA 3ZS9A 3AUYA 2YTZA 4X1OA 3V8VA 4P5EA 2K87A 4DIOA 2EBFX 3VYRB 2PS1A 4MK4A 4RKQA 2JFZA 4TRRA 1BE1A 2Y67A 3Q9LA 2GRJA 5B1DA 2IIPA 4KREA 1CQJA 2DQZA 3MT7A 3GPLA 1JJ7A 1U3CA 2V96A 1LTQA 4P08A 4J76A 3KD2A 1YJ5A 5ELLA 1Q1GA 1YOVA 2ZI9A 4OJQA 4S2UA 5F7ZA 1ZMBA 2G0NA 2R4TA 4CM7A 3U7IA 4ZT7A 3FLEA 4RIGA 4K2AA 5ESRA 4AJPA 4ETMA 1AQJA 2QTVB 1WMEA 4NPHA 3R77A 1GTRA 1CZKA 3O8LA 2JHPA 4PSDA 3VU3A 2ATXA 4CMIB 3OEWA 4L50A 5DN9A 3SE0A 3THRA 3VOSA 2G88A 4KDFA 2OA0A 5FV4A 3TECE 5AI6A 2WICA 4ZAVA 2IDJA 3PXDA 4NEHB 2CV2A 4X65B 5DHUA 4GD3Q 4R71A 2ZIAA 4UC0A 4CI9A 1JT9A 4NEQA 1XD8A 4PGFA 4BGUA 1PRYA 5DHTA 3P45A 1T8RA 1Y5IA 3ZGOA 4H7DA 4ARAA 2BSXA 4BNLA 1U2RA 1G4AE 3NWOA 5HR5A 4CKBB 1ETHA 2I2FA 1LZLA 2PKXA 2OCBA 3Q88A 1A9RA 2PMEA 4C4TA 4ZMBA 4KN8A 2O8VA 1T2DA 4KQIA 4Y9TA 5D01A 1T0IA 5HMLA 3UT5A 1U6JA 3VX3A 3BRCA 2A9VA 3T5DA 2WHPA 3GJSA 4IFIA 2X4LA 1W29A 4BBAA 4CM9D 3Q0TA 2GVDC 1IMOA 4MPRA 3TM5A 2BBWA 4I1IA 4CM6A 5CFNA 4UXJA 4HHEA 1EFDN 1GPYA 2KWIA 3KM0A 3VFDA 3C8MA 4R2LA 1JUDA 1KSJA 3I05A 5LP6A 3EXFA 4D0RA 5C52B 1FVHA 2IZ1A 4CIYA 4PAWA 3ITEA 4WKOA 4CDRA 4EYGA 2O23A 4REQB 4RTQA 5HOEA 4QDXA 2JKYA 4EH1A 1P60A 1UPCA 4MPDA 1E9EA 2GWRA 3KYBA 4HAXA 2J59A 3DEJA 4BYGA 2Z04A 4ND6A 2H65A 2OHXA 3D7MA 4OG2A 4U00A 1H0KA 3TQOA 4OK3A 2B4YA 3TX6A 3T9CA 3VR5H 1TF7A 2RHTA 3KVYA 4H0FA 2VG8A 5JAUA 1BU5A 4JJ8A 2DJIA 2D2XA 2QYTA 1OXSC 1NJ8A 2KLHA 2LIVA 5I47A 3F8SA 5IAEA 1TM1E 4E3ZA 1DZ3A 5D5PA 2A1TS 2I6SA 1RPJA 2CE7A 1E5DA 1FPQA 3FZYA 3GFGA 1GRNA 1VE6A 3PD0A 2C7GA 3VC7A 5E9QA 1IUOA 2R4QA 2PUBA 1OLXA 3RC2A 2AD1A 4XEHA 1P0QA 1UF9A 2FUCA 3LC7O 4B2LA 2W43A 4JP1A 5IAOA 1CY1A 4Q34A 4J2OA 5AVXA 5AMXA 1YBAA 3SVLA 1LI4A 1S02A 1SHKA 2R7AA 3NBZC 3VU0A 1OU0A 5LWHA 1JL3A 3OT5A 3OC6A 4MXDA 1MPXA 3CLSC 3ILYA 1KRHA 2QRHA 1H5UA 3G7SA 3IESA 3CG4A 3IXLA 4J0CA 2V9PA 5DW3A 5B37A 3RJZA 4D5EA 4UHCA 5TPZA 4B5LA 1SHJA 5CFZA 5DK4A 3ZDEA 1AKMA 1SELA 4JFRA 3RKUA 5HYVA 4EP1A 1VL2A 1F06A 5BOSB 1HF3A 1KFJB 2WZCA 5EWMB 4E09A 5F2NA 2WM3A 1FS5A 1L4HA 3UHFA 1Z26A 2P41A 5D3QA 1TF2A 3BXXA 1NBOA 3CR3C 4BO5A 3K70B 4X7MA 3KPUA 3IQFA 4OQ4A 5DEIA 3NKFA 5E4FA 4TKVA 3AEUB 4Q21A 4KW7A 1D9XA 3ND8A 3RJTA 3U4IA 4PO8A 4O5OA 1U1EA 1GQYA 4N65A 2HIGA 1M5RA 1XMOB 1YI8A 1DBVO 4EB3A 3QSYA 2E5FA 1N6IA 3DTVB 4UQOA 1OWPA 3NRCA 4UQPA 1I5RA 4WY5A 5CTAA 2ZATA 5FHQA 5A3VA 3KAKA 1C7IA 4UAUA 1K0UA 3DGFC 5DYWA 2N42A 2QN3A 4Q1VA 3BGSA 3G89A 3F74A 2VO1A 4P80A 2B25A 3RTBA 4DMGA 1JG6A 2Y0BA 3N2KA 4JLNA 1S2IA 2JH3A 1LVHA 1N9ZA 4NBRA 3AM3A 4OUDA 5KDDA 4AWAA 1YE5A 3KV1A 4IJVA 3PCRB 1OTYA 3E3NA 1E2QA 1HUQA 4W5TA 3IEMA 5KWSA 2FQYA 2J08A 1NKTA 2JGDA 3A3KA 3GRYA 5GONF 3COVA 3G6WA 4EYQA 4Q9HA 2C9YA 4BVKA 2V7BA 3RYFB 4OQNA 4UTPA 2P6MA 4IIHA 3T7SA 1E1QA 4FQ5A 2JFNA 4I66A 4JLOA 3JQGA 4PZLA 4MKRA 4B6RA 3W3ZB 1P9WA 3L8DA 3UWMA 1RYEA 2RGWA 3OFNA 3V80A 5K01A 1P4GA 4W5OA 4KFCA 1XXHA 1DBRA 3LT4A 1LLCA 4QUGA 1YZYA 4J16C 4IHKA 5BR8B 2JLSA 3VVMA 1BFUA 1YVRA 3CZRA 1IY1A 2PVCA 3ECSA 5C1OA 3DE4X 3FCEA 1O6FA 4QQKA 2XWQA 2OHHA 1TZCA 1LZKA 3C5EA 3EARA 3F46A 3OF3A 1VLQA 1Y1SA 3QVGA 4QPDA 4WERA 3P2IA 4P6VF 4G24A 1WP4A 3OZEA 3IUSA 1TT5B 4B3SB 3FCAA 4NNOA 5EJ7A 1CTQA 3E3AA 4R98A 3RSZA 1FDIA 3AI1A 1CUCA 5DASA 2FN4A 3T7IA 3TNJA 2CT8A 3OMWA 5D3KA 3W7BA 2W8ZA 3A4TA 4FJ2A 2C77A 1UANA 1IZZA 2JD2A 1NVVQ 3B20A 4LJSA 3UFXB 1I7QB 4IV0A 1KTIA 4JOBA 4B80A 4DUPA 2DR3A 3GLKA 3AF3A 4V02A 4CEIA 1JZQA 4BJHB 2HHJA 2YYAA 3BFPA 4Z86A 1NI5A 1PI3A 4MHOA 4ZVUA 4D26A 5K3FB 3LQ2A 5K7SA 1LH0A 2JA1A 3FB1A 5FL7A 2ZCVA 5SV2A 1PYGA 3WOHA 1X80A 1G17A 2P9JA 4QUIA 4EG4A 5LYYA 2QRNA 1BCRA 3JYLA 2XCRB 3DCYA 5C1BA 1AY0A 2VZ8A 1P3JA 2CDRA 4GBED 4UOQA 1Z7GA 2UXBB 4TYMA 1HLFA 4Q4AB 2YNMC 2F90A 3PNYA 1RQ2A 3FSGA 4F84A 1DTEA 2ZYRA 1CR0A 1IDN1 1KY3A 4RSHA 1FYEA 2OKCA 2HYDA 4U5XA 1DFHA 4ARCA 3LUFA 3I2JA 2WIFA 5J40A 3MSCA 3UOGA 3EZYA 3RRXA 2R47A 1JAIA 2QRGA 1ZK3A 3BXFA 1I3OA 3LF2A 4EFKA 2CVQA 5BV2P 3KHSA 3UJNA 2XF8A 1F4PA 4QUDA 1OQAA 3IR6A 4ZA2A 1OYYA 1J8DA 3PS9A 2PQ6A 1BCSB 1JSZA 1LI5A 1X38A 2NADA 3R76A 4BV2A 3ZLUA 1JAYA 2Q8QA 5LDGA 2IK8A 1LS1A 3ON5A 5YASA 4EOGA 3GG9A 3O2SB 5IC5A 3UOWA 2QR2A 2E4AA 2B1IA 2J6CA 4J9UE 2IF0A 1Q2XA 3A1TA 4NMWA 1MMFB 2PVSA 1MO3A 1FSSA 4UCWA 1LBQA 4D99A 4LFAB 4BVEA 3ABRB 4TMXA 3AL0C 2GBLC 3JASB 3PEFA 2YX1A 3A1NA 1R4ZA 4JS0A 2XVZA 2IA5A 4G0NA 1XTJA 1KO4A 2YWGA 3ZV7A 1X87A 2B0CA 2B3DA 2BFDB 4LJRA 4I9UA 4RHUA 1N32B 2BMEA 4OD0A 2O8DA 2C9CA 3K30A 4GC9A 3H3FA 4UVDA 3W9SA 2IYPA 4MROA 2O9JA 2NXJA 3JAKA 4II3A 1EI9A 3OM8A 3UJAA 1M0EA 3JZMA 3VPFA 1LSSA 1NQWA 2VJMA 2C4HA 1KYWA 2BFBA 2WR8A 1DKQA 3M9XA 4LOHA 2X3YA 4MWBA 5DNEA 2YN4A 4AO6A 5CFRA 4GLLA 1N34B 3F5SA 2H9IA 1W52X 4AQ7A 1ORDA 2DU8A 2PUTA 3KKNA 4AI6A 3DUWA 1IHPA 5CP8A 2VHEA 5F51A 1U2DA 2VF2A 4WXPA 3W1WA 4EPWA 2WTMA 3D7RA 3EK2A 3RI3A 3GJ8A 3GIDA 4M9SA 3E81A 4MPPA 4D5GA 1H4TA 1QR2A 5JS2A 3KL4A 4EB6B 1IG0A 1JEJA 1JDZA 3HJNA 4CXMA 3PE6A 1J2RA 1XEWX 1P9LA 4DMCA 2AOWA 1U0BB 3WGUA 1WHTA 3ABOB 2QS9A 1WCWA 1ZXBA 4IGFA 5JS7A 1J1IA 4BKPA 3RU9A 1SQ6A 2XTMA 4L5BA 3WKDA 3ZY4A 2A5GA 3FVRA 3BB3A 4IL5A 4P5DA 3W5CA 2WWHA 3H1AA 2FQXA 1DO8A 4GYJA 4HDMB 1TX4B 1L7PA 4RF5A 1LW7A 2ES4A 3DVQX 2P4EA 4BN4A 1ZXLA 2CHVA 3WZLA 3DTYA 4PG8A 3LAWA 1DKNA 1U3TA 3D3EA 4C0AC 3IR7A 4OOFA 4RPCA 4H27A 3RRJA 5L4NA 1OGIA 2XGMA 3P2KA 4PPGA 3RC3A 5CPBA 3GQBA 2C8LA 1J24A 9GPBA 5HZHA 2D1SA 3GFPA 2VAXA 3KQPA 2BAGA 3ZNOA 4D2IA 2P9QA 4EGQA 4FUTA 6CHYA 3IUNA 4PZZA 3VYUB 3ZLVA 4RNCA 2O2GA 4MDHA 4PGMA 5H70A 4ZI2A 4FVTA 4EA6A 4RTJA 4HMOA 2C83A 1JKFA 3PICA 3THWA 1K3UB 2R68A 2FE1A 4OQLA 2C5EA 4PG7A 3VR6H 4CV0A 4JUFA 2HWKA 4ERNA 1EX1A 1K7SN 1FQKA 2B4RO 2FB9A 4YRPA 1XDGA 3HPQA 3LO5A 4IV5A 1XZIA 2GM3A 1JSRA 3QLVC 4PYIA 5CIQA 5HQTA 2GJ4A 1JR4A 4MLZA 2VSYA 3TQRA 4BQOA 4BB0A 1DPGA 4KH0A 1YDHA 1Y1RA 3NYQA 3ZYZA 5DN6D 3E9MA 2Z8YM 4OLHA 5AVOA 2XRZA 2QY6A 3V4SA 1L3BA 5PGMA 4FM9A 1NRJB 3IP1A 1UAYA 4EJ0A 5FTLA 2EQBA 3GEGA 2HA6A 1D03A 2HQ1A 3DYVA 4NENA 1DKMA 1Q20A 3PXXA 4JEHA 1W35A 4IRMA 4MAFA 3RS2A 1TVKB 3L7LA 4G5RA 2IP1A 4YJKA 2P27A 1EG2A 2DWCA 1NVKA 5KNBH 1N8KA 4X94A 1VTKA 4R9VA 2RI0A 2OO7A 2ERXA 3W5SA 3IH5A 4MJXA 5FO0A 1WMFA 3S27A 1FJXA 1I6KA 2HT1A 1ZRNA 1YULA 3EEBA 1G64A 2BGLA 1LW6E 1HPLA 4HX5A 2DH6A 2ZXFA 3KQMA 4HDKA 4OGLA 1L5GB 2I2WA 2X42A 3IKLA 3FWHA 2X8LA 4F3CA 4LNHA 2ZM6B 3B48A 1XTKA 3NDJA 3FPGA 5LWQA 4UCXA 3Q7IA 2H07A 4RY2A 4L02A 2QSZA 4DC9A 1ARZA 1JYSA 1ULTA 4RADA 5FUWA 2DRIA 4XAQA 4CLOB 1P9RA 1DLJA 1KFEB 1R0XA 1ZD3A 2I55A 4G37A 5ANRB 4Z9YA 1JG3A 1YB5A 2EATA 1YO6A 4NAHA 4WACA 3ZWNA 4CTNA 1QIKA 4WMLA 4BZPA 2Z56A 3DZHA 1XLWA 4QPNA 1XMSA 2PBFA 3A0UA 3MTEA 5EI5A 2I03A 5ALIA 2Q5IA 5FKJA 3AFGA 4B47A 2XSZD 3C3PA 2BFCB 1MOZA 1IAVA 4A73A 1N8SA 1KFKB 1REQB 3B82A 1G8KA 5T4EA 5LQUA 4MJ3A 1SRQA 1WB5A 3I76A 4LC1A 1FDVA 4LK3A 4QXOA 4OHBA 5AM3A 4G5GA 2QK4A 2UZ1B 3RB8A 3WK7A 1EXVA 2CXXA 4B44A 3UEOA 4CLHA 5MHTA 1OFTA 5HIKA 3A11A 1SC4A 3KQYA 5ALTA 5G4LA 3STWA 5HWSA 4GLOA 4KGDA 2QTMA 5IULC 4PLPA 1PT8A 2M1XA 4LSGA 4EG7A 3NKLA 1Y5RA 2Q8NA 3UJ3X 3INNA 4M49A 1AB5A 1HQCA 2ADFA 2FSPA 2GEDA 3P0IA 4UREA 4EF4A 1FS6A 1JJFA 4MVJP 5ALLA 1SCKA 3UKDA 1SA0B 2LZ0A 3T3MB 5I4IA 4O25A 3UHPA 5K3AA 3C8DA 3DMGA 4AN4A 4D02A 1SVSA 4U9UA 2GPBA 3O2NA 3VZPA 2JAUA 4DIEA 3E03A 4DPLA 2ZTVA 2VNIA 4D9IA 1TQDA 3OTIA 2YWRA 4JCOA 1W25A 2D7CA 3BOSA 4KP7A 1KDTA 4IH9A 2PV0A 4F1JA 3PJGA 2QRMA 2C7QA 4I8XA 5KUTA 1E5VA 4LDAA 5EJ2A 2VJOA 4Y30A 1YTLA 3MRSA 2UVPA 3R0JA 3C8UA 1YIOA 3D7KA 4R6WA 4U1RA 2EU8A 3TOVA 3WFJA 5LN1A 2JCVA 3TJRA 3LIIA 2BGJA 2GLTA 2LCIA 2ZT6A 3K15A 4KXXA 4ZRMA 1VRWA 2ZJYA 2PNFA 2ZWMA 4HDNB 3K1YA 1IVNA 1E1RA 4MP6A 2ZJ8A 2JVIA 3RSHA 1Y1PA 3U31A 1VIDA 2GFQA 3SY8A 3MOSA 1BN7A 5DOVA 4HNHA 4PO1A 4DLRA 4E08A 2CNKA 4ZKDA 3MT0A 2VPXA 4RA9B 5FTNA 4WFJA 1V11B 1WETA 3WWOA 3HCCA 4WOCA 1XWWA 1E7WA 5JD6A 4RIEA 4E46A 2Z3ZA 2AN3A 2ODPA 1Y8QB 3CH6A 2IVZA 2PUHA 2W70A 4PGAA 1TTHA 4Z99A 1KZ1A 5F77A 4D3YA 2VDLB 4ITRC 4UULA 1Y3BE 4AC9A 1L4YA 2XKJE 4YMHA 2XB9A 1DT3A 5FPYA 1VRVA 3EW7A 2GHQA 3DCNA 3IAS1 1SEPA 2H0RA 2QTFA 3KTAB 2IXAA 3DG9A 1Y7LA 1XLTA 4CG0A 1HYQA 2W2NA 4BMSA 2AZTA 3A9WA 2NSLA 3H6GA 4KVFA 4LE2A 1UADA 4TT3A 1RQNA 1UCFA 1QV7A 1U2EA 2Q5QA 3LLUA 4LJKA 1MAVA 4V0OA 1H1DA 3T99A 4BO9A 3ER6A 5EKTA 5FTKA 4ZPXA 1G8SA 4B3HA 1V8PA 2JC3A 3FSEA 2YV4A 3DDUA 3E7XA 3DDCA 4J1QA 2QBYA 3BJEA 4UUPA 5K8VA 3TF5A 1EESA 1A9TA 3ASUA 1HYHA 2XTZA 4RBNA 4BE9A 1IQUA 3KT0A 4AY3A 1QKJA 2PIAA 4DPMA 4KKXB 1N0IA 1AHNA 4WKCA 5AXCA 3G2KA 1CIJA 2QMEA 5GOTA 3SVZA 5KC9A 3HYTA 4KLNA 5FNVB 2QAIA 1V5FA 4AURA 4JI2B 1GYRA 2XNDA 3IUEA 1UPFA 1DSSG 2ODNA 5I7AA 3ZY2A 4CYMA 4MVJA 3BKXA 3AOEA 5F4ZA 4GECA 3AILA 1FMLA 3H8JA 3DZJA 4HGPA 1MJ5A 2ZRCA 5B1IA 2R7KA 4COOA 3Q2IA 4L5CA 1IAQA 2FUNB 3FNEA 3GW8A 1PX0A 3HU1A 4PONA 3K73O 4QJIA 3NJ4A 1P1IA 2ZWAA 5EYPB 1XK7A 2Z9CA 3X1KA 5L7TA 1C1DA 1EE9A 5KREA 3ZD9A 4D8VA 2W6IA 2X8JB 3B38A 4HDOB 4OLAA 1BVUA 1E69A 3QI2A 4DMUB 3PGLA 2EC5A 3T1TA 1MCZA 1Y4DE 1EHYA 1VP3A 4I50F 4E4RA 1ZD2P 1GUYA 4YUAA 5L4LA 1YFZA 3D6MA 4DJJA 3NVKI 2CLSA 1NR7A 3K92A 2B8JA 2BH2A 4RC9A 2YY6A 3DBLA 5CW1A 1KVRA 2OHGA 1ADCA 1W0CA 1JAZA 4GNRA 1R9GA 1XZFA 3GCXA 4OIMA 1P6XA 2X13A 3K8OE 3RWMB 3DONA 1QPZA 2WB2A 1DXOA 1NGSA 1G20B 3T3NA 1ACJA 1E4OA 1GPLA 2RI6A 1QRAA 1T9BA 4KXUA 4TTIA 3H0KA 5BVGA 4CTMA 5MGBA 4W5WA 4RU1A 5HKKA 3HN7A 5DLYA 4OP2A 2IIVA 1G7CA 4BQPA 2WU1A 4HZIA 4Z3KA 5DX8A 1PFVA 1Z16A 2B8NA 1EWQA 4AY2A 4IIJA 1WMAA 4OY3A 4AZTA 5D85A 2FEMA 4EW2A 4KPYA 2AB0A 1QU2A 4WKGA 1OSNA 3MT9A 5EIBC 1E3LA 3OP4A 4WBNB 2A9PA 2VQEB 3P94A 4R2HA 4B09A 1JA0