1N5DA

Crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
288
structure length
288
Chain Sequence
SSNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQGRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSDSTYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQFVTDKKVVEWGVPPESYPWVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porcine Carbonyl Reductase: Structural Basis for a Functional Monomer in Short-Chain Dehydrogenases/Reductases
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID DEHYDROGENASE
total genus 100
structure length 288
sequence length 288
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n5dA00
2RIRA 1MXFA 4OM8A 5DOVA 3WFIA 3TL3A 2QZ9A 1SCUA 3I9JA 4NJMA 4R69A 1GYPA 1UAYA 3IDSA 2JHFA 3IUSA 3LU1A 4RZHA 5IDYA 4EJMA 1BGVA 5F5LA 1H6DA 2I6TA 2Y67A 4MVJG 4BB5A 2UVDA 2A4KA 1DIRA 4PZDA 1WAMA 3B1JA 4E30A 1FK8A 4R4JA 4MP8A 1XWFA 3P5SA 3PWKA 4J0EA 4XYEA 1E3LA 1P9LA 4R01A 1N5DA 2Q1UA 4CLEA 4YRBA 3PEFA 2Q50A 2PY6A 4DRYA 5L45A 3GMSA 2P9GA 4ZQEA 3UUWA 3E18A 1ZIDA 1E3EA 3KV3O 4ZQGA 5JC1A 5BSEA 3TL2A 1Y9AA 1ISMA 3HB4X 3W4KA 4GLOA 5IN4A 4GKVA 4GSLA 3LQFA 1MX3A 2IYPA 2YQ4A 3L6DA 2JAHA 4B8WA 4B7UA 1I3KA 1C0PA 2DLDA 3STHA 3HB5X 4J4BA 4ID9A 5F1PA 3GA0A 4JGBA 2ZTVA 5F1OA 3OP4A 1VJTA 1NFQA 4Q3EA 4QO8A 4FJ2A 5C37A 2VZ8A 3OJEA 4OSOA 2HMSA 5TNXA 4JN6B 2B0JA 4D0SA 4OYRA 3AWDA 1B8UA 3F1KA 3TOXA 3AUUA 3BTOA 5JAQA 4CMIB 1LLUA 2IZ1A 3WQSB 4ND5A 5CPFA 1BVUA 2HAEA 3F47A 3D7LA 2PKRA 2JCXA 2GD1O 4A5OA 1N92A 2DTEA 1B8VA 4BGIA 4EDFA 4CLXA 3PDUA 3KSUA 4UUNA 4UREA 4E5YA 3JQAD 4GSKA 4XQEA 1BXZA 3WGTA 1U1IA 4BO5A 4XGKA 3L4BC 5AXAA 2GUGA 2X8LA 3WGYA 4YWJA 1F17A 5TX7A 4GX0A 2NWQA 1QKIA 4P4NA 1PTJA 4D42A 3MTGA 5HS6A 2PV7A 3I6IA 4UVDA 3AJRA 5IF3A 2UV8A 2NUAA 4RGBA 3VH2A 2DVMA 4OQZA 1T4BA 1P1IA 1BMDA 1YWGO 3AOEC 1DC6A 1JKFA 2YV3A 4MDHA 4WK6A 4KQWA 4ZQBA 4L4SA 2FN7A 3JQAA 1IHYA 4DC1A 2QYSA 3VVBA 4LN1A 5ICMA 2AG8A 3V1TC 3TZKA 3DQPA 2VTEA 4FN4A 4RLHA 2PZMA 5FF9A 2YQ5A 1I8TA 1SOVA 4PG5A 4BNTA 4W7IA 1XKQA 1YBAA 4Y67A 3DZGA 5C7LO 3GN2A 1M76A 4PLWA 2AG5A 3N74A 4D46A 2ZJ0A 1PGOA 3UXYA 2E37A 1PZEA 4NU6A 5IFLA 1ZUD1 5EINA 3GZNA 3OETA 4GMFA 4BMVA 4J4TA 2OXIA 4P4GA 3SLGA 4W6ZA 3L9XA 1HDRA 3CTMA 5ENVA 2EXXA 5I7EA 1B3RA 1P1FA 2HK9A 4MP6A 3NTQA 1ZJZA 3C1AA 1XQ1A 1AE1A 2FR1A 3GGGA 4ZRNA 5HA5A 1PS8A 3WYCA 1A4UA 4M55A 3K96A 3DBVO 4Z9FA 1GUFA 1YL7A 3MJCA 3MWDB 2FPIA 3H3JA 1GYRA 3E82A 1E1NA 4Z6KA 4IBOA 3K5PA 1A4IA 4TROA 2GF2A 1KVUA 2WWRA 4OXNA 3BHJA 1J6UA 4O59O 3WTBA 1NQAO 3R6DA 4IJKA 4XR9A 1TT5A 2ZKLA 4GL4A 4E32A 1DIBA 1A71A 3JQDA 3KTDA 4ZRMA 4F45A 1LRLA 3FTNA 3RJ9A 1PJTA 3EY4A 3QVSA 4ROSA 5JBIA 2EG9A 1L7DA 4MIOA 3DMTA 2NVWA 4J49A 3FPLA 3H9UA 4L4RA 4GGPA 4D79A 2I99A 3MJ4A 2VNSA 3DBRB 4B4OA 1UZNA 3RFTA 2EP5A 3PP8A 1NWHA 3BYZA 1Y8QA 1CF2O 1LXCA 3GVHA 4TZKA 5IDWA 1YONA 4CM8A 1ZNQO 1ZSYA 3IMFA 2VUSA 3QWAA 4XQGA 3C7AA 4B4WA 1Y1PA 1PL8A 2O3RA 4WASA 5BNFA 3ONFA 3PYLA 1O0SA 4OO3A 3OHSX 3KYBA 2C0CA 1RM3A 3V5NA 4AL4A 3O26A 1EDOA 4K6FA 3X2FA 2AEFA 1Q7GA 2SCUA 3ZV4A 1FF9A 1E3JA 2BGKA 3GF4A 4FB5A 2G76A 3NDIA 3RBZA 1IE3A 1E6EA 4OAQA 1GQQA 1GTMA 4EITA 2YHUA 5L7WA 2D3TA 3FHLA 2I5PO 3PQEA 1CYDA 1VSUA 1Y7TA 2GNAA 3VOSA 4WCFA 1OC2A 4IJVA 2GDZA 2P9CA 3RBXA 1XDWA 4E31A 5BNTA 2EEZA 2V65A 4U6SA 1LSUA 1GL3A 1JWBB 4XQCA 5KKAA 3M1AA 5BSHA 1NPTO 4PZCA 1BHSA 1PR3A 2F00A 3KM0A 3ZNPA 3DOCA 4TKMA 2BFMA 2HUNA 1PGJA 1PEDA 4HFMA 4YBZA 2YW9A 4GBJA 3ZHYA 3LF2A 4EW6A 4BGUA 3C8MA 4DMMA 1U3VA 4R3NA 4QFCA 2LDXA 1KEPA 2PGDA 1SEPA 3KBOA 3TZCA 1MB4A 4PLTA 2PGJA 1CIVA 4J6FA 4ESOA 2PKQO 4HV4A 1QV7A 1XR3A 3V2UA 3WG9A 4S1VA 5COBA 2V6GA 2DFDA 1ZH8A 4FFNA 5KJ6A 4CM1A 4CM4A 3IP1A 3PTZA 1DJQA 5TSDA 4PLGA 1PJ3A 3M2TA 4J16A 3PJDA 3CZMA 2XOXA 4DMLA 1HE4A 2NVBA 5KJFA 4M49A 4B4UA 4LCJA 2J5QA 3H3FA 4RVUA 2ZQYA 4I8XA 4IS3A 5JS6A 3PHJA 4HFNA 5TJHA 3D3WA 3UW3A 3HWRA 4XR4A 4EJ6A 5I9LA 1PQPA 4EEZA 1QYWA 2DTXA 5A04A 1XU7A 1UDBA 3VZRA 1LLCA 1QLHA 4RPGA 5EIOA 4YT8A 4NH4A 3FWNA 3UOGA 2D4AA 1I5RA 3GPIA 4WLUA 3QVXA 4DTIA 2GZ2A 3H7AA 3ANMA 1E3SA 1TB4A 4L75A 3V2GA 3UKOA 1FDTA 3DZBA 1XEAA 1XYGA 4XWYA 5TIIA 3ETGA 4J7UA 4RO0A 5CG1A 2EKLA 4J0FA 5CHEA 3DOOA 1U4SA 2TMDA 3NT2A 4Y98A 5EMHA 1Y6JA 3GNQA 4JK3A 4DQXA 3GH3A 4FGWA 3LC2O 1B8PA 2OP0A 5KJEA 4ZGWA 3F4LA 3PHHA 4YQZA 5TS3A 4YEDA 7MDHA 3LVFO 5DZSA 4DQUA 3D4PA 1ORRA 5BR7A 1M66A 2DBRA 5DCYA 4NJMB 4A0SA 4E13A 2Y68A 3IS3A 1CEQA 3DWFA 2ZYDA 3OA2A 3QA9A 4I5EA 4AVYA 4CLDA 2DPHA 2YHIB 5ILOA 1G0NA 4FJ0A 5MDHA 3BTUA 1ID1A 1KVRA 3W8EA 3WQQA 3G0OA 1YDWA 4XD2A 3SBOA 1WLYA 5IXYA 4IS2A 1WVGA 2NACA 4JIGA 4WOJA 4ZA2A 2VZ9A 1LDEA 3KB6A 2DTDA 1U8XX 5T6BA 1PJ4A 5F21A 1E92A 3I83A 4BO6A 1ZK2A 4AJIA 1PX0A 2NSDA 1T2DA 3B70A 3DZJA 3QE3A 1C1DB 3PQFA 5JO0A 1DAPA 2JCVA 2G0TA 4I9UA 3QRWA 4UVHA 2X22A 5HM8A 2C54A 2H5LA 3L9WA 1LC3A 3U3XA 5CP8A 2VYND 3I23A 3GR6A 1R6DA 2Q99A 2DUWA 3ZWMA 3P7MA 3NTRA 1GZ4A 4YR9A 3GNSA 1P77A 2BFPA 4U0JA 3SJUA 2VYVD 3UN1A 3PJEA 1IL0A 1R37A 1T2EA 2EGGA 4MVJA 5GZ1A 3VTFA 4M87A 1EUZA 2NVUA 3LSYA 5A5EA 3VDQA 3G3EA 4WKGA 1U2GA 2ZJ1A 3KLMX 2B4TO 3H4VA 2HK8A 3OEWA 5EQDA 1W0CA 3BZUA 4ZICA 3C85A 4D0RA 1P33A 3HHPA 9LDBA 1P0FA 2VRBA 4R1UA 1UDCA 4U6QA 3AY7A 4NU5A 4XGIA 3OEYA 4XJTA 4LW8A 5ITVA 2DBVO 3RWBA 3CH6A 1C1XB 1KVSA 1Y81A 4PN3A 1B0AA 3AY6A 5DNAA 3S2GA 4JP2A 1H0KA 2D0IA 3VZSA 3UCXA 2P9EA 1HYHA 3GMDA 1MG5A 2CZCA 4BO7A 1GEGA 4CL3A 4PFJA 1GPJA 2D1YA 1PSDA 3HN2A 5AOVA 9LDTA 4Y9DA 5IN5A 3WYBA 1J0XO 1BXGB 4XIYA 1H9BA 3DBLA 2O7QA 5TF4A 2FWMX 1J49A 1LUAA 4A26A 3H65A 3WBBA 5IJZA 4ALMA 4WLOA 4AJPA 3BA1A 4NBVA 4I5FA 2DUUA 2W4QA 5JYDA 3QP9A 4O5OA 3RC7A 4ONEA 3F9IA 1AUPA 4KP7A 1HDCA 2BI7A 4BNIA 5BSFA 4TQGA 2PD3A 3QHAA 3E9QA 4AJLA 1PL7A 1ENOA 3ZWNA 1I2ZA 1LU9A 4ZHSA 2RBEA 1F14A 2VHVA 4WJZA 1LQTA 3ANNA 2P91A 4F6LA 4YJHA 3OECA 4Z0HO 2Y66A 2IEDA 3LLSA 4MINA 1ZEMA 1LJ8A 4WNCA 2JFGA 3INRA 2X58A 1X7HA 2ZB8A 4RDHA 4R68A 4LK3A 2WE8A 2FSSA 2B35A 2CNBA 2R00A 4E5PA 1U7TA 4JXKA 5AQ1A 4A27A 4WE3A 1BTOA 4CM3A 1NYTA 2O2YA 1ZBQA 2R00C 3HSKA 3OMLA 1U7HA 4NNJA 5AVOA 4L8VA 3FNGA 4RORA 2AE2A 2JJYA 2X9VA 2BD0A 4ND1A 2YDXA 4Q3DA 3GN1A 3ZWYA 4J4HA 3ZU5A 4BNJA 1VI2A 3D1LA 3NKLA 3RU7A 4CR8A 1SB8A 4UVIA 4FGSA 3GVIA 4XYGA 4LVCA 5KJCA 1RJWA 3GG9A 3UH1A 1H6CA 4KQXA 3D4NA 3HUDA 1N8KA 4NFYA 4NPCA 3TPCA 1RM0A 4DQVA 2P5UA 3Q6IA 2PNFA 1OAAA 2X6TA 1KEUA 2HLPA 4XZ3A 1E7YA 3FNEA 4GGOA 5T57A 4KWIA 1N1EA 1YBVA 4IXWA 1I3MA 4B7XA 3OQ1A 3Q9NA 4BKUA 1SBYA 1PJ2A 2QIOA 2UYYA 2JCYA 1GQ2A 1ENZA 2ZIZA 4XCVA 1SB9A 4B3JA 1ADBA 1DJNA 2GERA 1DC5A 2EWMA 2EERA 2HJRA 3HDJA 4RLSA 1AHHA 5JE8A 1C0IA 3MWEB 1JVSA 1VJ0A 2O48X 3O38A 1YRLA 2Q4EA 2Y0EA 1DIAA 4TWRA 5FI5A 4PG4A 4JBHA 4YJGB 1JW9B 3CKYA 5JCJA 1VPDA 3VPFA 3RBVA 3VTZA 5DCUA 2V6MA 1NXQA 3QWIA 4KTVE 1QMGA 4H15A 1XELA 2Y0CA 1LRJA 4KZPA 1LDMA 1A7KA 5C3MA 2PK3A 3U4CA 1LX6A 1P1HA 5JDCC 1A9YA 1VRWA 5KTKA 3WWZA 5A05A 3L4SO 1YGYA 2PD4A 1K5HA 5JLAA 3S2EA 4KTTE 4BGEA 1WDKA 3RUFA 4DIOA 1DIGA 3KVOA 5L3ZA 2AQIA 1FXSA 3R1IA 4TVOA 3UICA 3AI1A 4UAGA 3COSA 4PZEA 2I9PA 3TOZA 3Q1LA 3FD8A 2UDPA 3CXRA 2E6UX 1NVMB 1O89A 2A9FA 3IUPA 4J1TA 1IB6A 2WSBA 4LRSB 1ML3A 4NIMA 2DFVA 5HBRA 5KVQA 5JCJD 4IMPA 1PWXA 1JQBA 4DPLA 5GY7A 1PZFA 3K92A 2Q49A 4OKNA 2QRLA 1UDAA 1B14A 5LDGA 1DAOA 2NQ8A 2RCYA 3AY3A 4Q9NA 1JDJA 3JQEA 2GO1A 3U49A 4M8SA 1K3TA 2RAFA 1EBUA 5CEJA 4XX0A 3I52A 4WLFA 4CV3A 4D43A 3DO5A 1ZMOA 4UEKA 4HNGA 4CUZA 5G0SA 1YS4A 1W8DA 1AHIA 5FYDA 2J5KA 4XRRA 2HK7A 5IZ4A 3FBTA 1CQIA 5L40A 1Z7EA 4I5GA 4BVAA 1BVRA 4B3IA 4E0BA 1YQGA 4A73A 4R41A 4C4OA 3F6YA 1PIWA 3ZI0A 4HBGA 1NFFA 1X13A 3EZYA 3INTA 4NBTA 3D4OA 3RKUA 1I24A 3FPCA 3ZDFA 2YV2A 1M2WA 4Z0PA 4EZBA 4KUHA 4GPD1 5L4SA 1KS9A 2CD9A 3I6QA 4RL6A 4IJUA 3BHIA 4R16A 3E5MA 1B7GO 2JAPA 4UUPA 1HE3A 4INAA 3F5SA 4YDRA 3W4IA 3JD2A 4XEHA 3X2EA 3RD5A 3E9MA 4BKOA 4I08A 1U9JA 3EZLA 3LC7O 1LNQA 2C07A 4U0KA 4BO8A 4YAEA 3PLRA 4W82A 3WIDA 1NVTA 2O3JA 2OO5A 1GUZA 1BSVA 3A1NA 1EE2A 1ZKMA 3DBRA 3DZKA 2EJVA 1NM5A 3FCOA 3TZHA 3ZH2A 3LZ6A 3BMQA 1VL6A 3E5RA 2JD1A 2PR2A 3EDMA 4KUEA 1IHXA 2FZWA 3ZWWA 1VE9A 2QRJA 5AXBA 1O5IA 1AXGA 1ADFA 1HE5A 3AOGA 4BNUA 4DLAA 5CDTA 3QIVA 1EEHA 3VPSA 3JYPA 4DVJA 3VVCA 4RVSA 4TKLA 1X14A 1N2SA 2BH9A 2YHIA 1FDWA 4OSPA 3NEPX 3CIFA 3OQ6A 4E21A 4PLZA 2W90A 4G65A 3MCVA 3PGXA 3OFSA 3OJOA 3ZWXA 1PS9A 2EJWA 1GCOA 2LDBA 1M67A 2VYNA 4CM5A 1XA0A 1JLLA 1JTVA 4WLVA 2YYYA 4OOFA 3AFMA 2EW2A 4DLBA 1M6HA 2QHXA 3ZCXA 3FI9A 1KEVA 3PZBA 2PWZA 3WQRA 1UR5A 1PL6A 2X5OA 1GQYA 3RKRA 4L9RA 1ZK1A 3NUGA 1OFGA 3NX4A 2DT5A 5A4DA 1ONOA 1NQ5A 1QXSA 1YE3A 2HKIA 4CR7A 2J6IA 5COAA 4KWHA 3B1KA 3K31A 5EQFA 3BTSA 4EYEA 1W73A 2ZB3A 3I3OA 5K0ZA 4CM9D 1C3VA 2OFPA 4MVJM 2HMUA 1SEVA 4AJOA 4F6CA 4MJLA 2HRZA 4IGEA 1ZK0A 1ISGA 5BNIA 4ALKA 2NVUB 2EKQA 1MGOA 4EJ0A 2I76A 1LRKA 1TEHA 4RQUA 1KY4A 3RAJA 3JYLA 5LCXA 5KNLA 2Q2VA 2ZCVA 3JD3A 2I65A 2RH8A 3IKVA 4B7CA 3OICA 5THKA 2Y1CA 3FTPA 2OP1A 1A27A 1T2CA 4RPLA 1RYDA 3HNPA 1E1LA 2YY7A 3GEGA 3PWSA 4PG6A 3W1VA 1Z75A 3OM9A 1PJQA 1NP3A 2BHLA 1QP8A 2YDYA 4CM7A 1LBEA 4J2HA 4IQGA 1EVYA 1SOWA 3E03A 3WOHA 1LEHA 3KLPX 5I8ZA 1E6WA 5C7IO 1J5PA 5L95A 3EMKA 3D0OA 1IZ9A 4M54A 4Z3DA 3ZZNA 4BMNA 4CQMB 4O6VA 1RKXA 1ZCJA 1NAIA 2IZZA 2AW5A 3WDSA 2ZTMA 5KVSA 4NQZA 2GZ1A 4BO3A 2YFHA 4IY1A 4PGFA 4URFA 3R0IA 1HKUA 3M1LA 3Q2IA 5B37A 4R5HA 1LDGA 2NM0A 3H9QA 3PYMA 4PLCA 5DP2A 2H6EA 4YT5A 3DC2A 1JKJA 3GG2A 4NBWA 4CODB 4Z0TA 4Z3KA 1YVEI 3LF1A 4E2WA 2X0RA 4NFSA 2IDZA 3KXDA 1K2WA 5IZCC 4E33A 1ZEJA 1BRMA 1WDLA 1EUDA 2XPCA 5AXDA 5HS4A 4GLLA 1U3TA 4OXYA 5DP1A 2J3JA 3PZRA 1ZXLA 2XXBA 5LC1A 4ND2A 4W7HA 1GCUA 5KVCA 2GCGA 3TQHA 3GT0A 3RUDA 4BO1A 2J3IA 1KY5A 2O3UA 4G2NA 4R1NA 2HRBA 3U09A 3GFGA 3O03A 4FW8A 3K2EA 2PZLA 1BXGA 1ONNA 1VJ1A 2QYTA 3JSAA 3PK0A 2V6FA 4MVJD 1Z6ZA 1HT0A 3JQ8A 3GPDG 4AJ2A 4MO2A 2PFGA 3RU9A 4LMRA 1E7MA 5L4NA 2D8AA 2DQ4A 4J1QA 1DEHA 2CF5A 3WS7A 4E5MA 3RJ5A 1TXGA 3PRJA 5U4QA 3JQGA 1NNUA 3WSWA 1ZJYA 1DXYA 3BMNA 4MVJE 4JQCA 3DFUA 3ZNOA 5I9NA 3GAFA 2DKNA 1DRWA 4IPTA 4XDZA 1P44A 1L1FA 3K2BA 2ZB7A 1B26A 3HADA 3GNTA 2VRCD 2YJZA 3B20A 2HU2A 4YJHB 4DUPA 4F46A 3TF5A 3WGIA 2VT2A 4YTEA 1EUCA 2Z95A 3PWZA 1PGQA 3GGOA 4DGSA 1PJCA 3NTOA 3IJPA 3EVTA 3RVDA 2PTGA 1DRVA 2AHRA 3GVPA 1LDYA 3WBFA 2D2IA 1DC4A 2D5CA 3H8VA 1V9LA 4CMAA 3DBHB 3NT5A 3PFWO 2C2XA 3I9LA 1ZMTA 1HDOA 3GUYA 1U3UA 1XGKA 2J3HA 1WXDA 4FJ1A 5TJ9A 1YJQA 3OQBA 5J23A 3GAZA 3K30A 2I66A 4NHEA 3DB2A 3RASA 2AQKA 4ILKA 3TFOA 1X1EA 3AM5A 4LMPA 3ADOA 2EW8A 1ZSNA 4Z9YA 4XKJA 5EN4A 4QX6A 3A14A 5G4LA 1XSEA 2PH5A 4FBGA 2QW8A 1EVZA 1D3AA 1R15A 4FCCA 1BG6A 3I9NA 3KYCB 1ZK3A 4DL9A 2FPGA 1EZ4A 1QORA 4BQRA 5K6AA 2VUTA 5DBGA 2JD0A 2EF1A 3E8XA 4D7AA 4B79A 1R4NA 3MJSA 1X0VA 1E7RA 4J7XA 3MOIA 2B37A 1CDOA 5GZ3A 4XIJA 3WGOA 2YFQA 5GZ6A 3U4HA 2CMDA 4CLOB 1YKFA 1GDHA 4CUKA 4LSWA 1LLQA 3JQBA 2AQHA 2AEMA 3F46A 3H6KA 3HG7A 4IGFA 1NASA 4GVLA 3VH1A 5DULA 4Q3NA 4DPMA 5FEUA 2GSDA 4FR5A 1R12A 4FOSA 3ST7A 1Q0LA 4FFLA 5JDIC 3CE6A 1ZSVA 3AOEA 3DFZA 4U8GA 2W2KA 4MPDA 5ENDA 2EIHA 3C24A 3EUWA 4CR6A 3ZWAA 6ADHA 1HE2A 1QYVA 3IKTA 1U4OA 4RF5A 4W4TA 3A4VA 3NAQA 1E7QA 3LT1A 3C7DB 1K0UA 5JY6A 4XQ9A 3EC7A 3N7UA 3JQFA 5ADHA 3QVWA 4LRTB 1AN9A 5ER6A 1YB4A 3P2YA 5DDIP 1PQWA 3RUIA 4BNZA 1C0LA 4CLRB 3L07A 2IXBA 3JQ7A 3S8MA 1LLDA 4EUEA 4ZN6A 4IINA 3WX0A 5ILGA 1K6IA 1HL3A 1X0XA 3V1UA 3UHAA 5JW6A 4GWGA 4IDCA 2QZZA 4QFDA 2CUKA 5G0TA 2Y93A 3ZV5A 3ZN2A 4E5NA 4NK5A 2PGLA 1SMKA 3PXXA 2EKPA 1KVQA 4AJNA 2NU9A 1SAYA 3WGQA 3NJ8A 3IOYA 3HDHA 4NBUA 3D5QA 2C20A 4TSKA 3SC6A 5MGBA 4CM6A 5KWEA 5JCXA 3WTCA 4L74A 2G5CA 5L9AA 4KDEA 2QG4A 1ZZEA 4ZJUA 4PLFA 4EI2A 4QECA 3DL2A 1FDSA 1A9ZA 1I0ZA 1BDMA 1MG0A 1Q7BA 2J5RA 3INGA 1P1JA 3WLEA 3ZU2A 2DBQA 1PJSA 1ZXBA 4YYZA 3T7EA 2FR8A 2GN6A 1EVJA 4O63O 4J9UE 1ONPA 3KHUA 3QVOA 4UUMA 4K1LA 2VWQA 2FZEA 1KC1A 3ENNA 1WZEA 2VN8A 4IDFA 5KIAA 3RFVA 4PCVA 4NZ9A 3MJTA 3T4XA 3UFXA 3BAZA 4J2OA 3EGOA 4TRNA 4YQYA 2ET6A 3NDRA 3L4BA 1LC0A 1LTHR 4HFJA 4BL5A 2E49A 3AU9A 4ALLA 4CJXA 3VPXA 4WNIA 1B15A 2HO5A 1Q0QA 3Q2KA 4N54A 3BMCA 4CMEA 5JAMA 4CMIA 4J91A 3CSDA 3EYWA 1KOLA 4FFPA 1I33A 1NFRA 1TT5B 3JD4A 1RPNA 3KEOA 1XLTA 1Y8RB 3ZHZA 3S2IA 1CWUA 4OXKA 2W2LD 4W9NA 1U3WA 4ITUA 1V8BA 4E2YA 2CVQA 5CDGA 2NNLD 1DBVO 4G5HA 5JXWA 1EE9A 2W98A 8LDHA 1YQXA 3IIEA 4GQAA 3BMOA 1NQOA 1UH5A 1PGNA 2A92A 2OL4A 3PVZA 3BIOA 3NV9A 4RVFA 3RUEA 3T7CA 3E48A 2OUIA 1BW9B 4PRLA 2G17A 1DLIA 2DPGA 1Z82A 1D4FA 4MIYA 3DZFA 2HMVA 3ULKA 1PJBA 2G1UA 3L6OO 3JV7A 4IDGA 1I3LA 5ER9A 5KCZA 5H82A 4HY3A 1P45A 4L76A 5CDUA 1WZIA 2ZTLA 4BKQA 3RC2A 5G0VA 1Z73A 1UXHA 2NU7A 5TQVA 3OJLA 3TNLA 3DOJA 3M2PA 4RPKA 4YAGA 4GX5A 4JLWA 1O9BA 4DIFA 1NWCA 3QSGA 1MUUA 4IJWA 2JKVA 4ZU3A 3WYEA 3DHYA 4XRGA 3QQPA 5JMWA 1C0KA 2IXAA 2PZJA 4RVDA 4EGFA 3ANLA 2IZ0A 3IJRA 4GX1A 4AJHA 5B4TA 2AA3A 2Y1FA 2ZTUA 1HXHA 3G17A 4IQ8A 5L51A 1FMCA 4G81A 2GPTA 3EK2A 2BELA 4GVXA 3RUAA 2FHSA 2DAPA 3ROKA 5H83A 3ZWPA 1LDNA 2FY8A 3DZIA 2O2SA 3KZVA 3PPIA 1T26A 4N5LA 2Q1WA 3FR7A 4WEQA 2QRKA 3AUTA 4LVUA 4OL9A 4BO4A 1DFGA 4EUFA 2WM3A 4RF2A 3WLFA 5I7FA 5T67A 4BHTA 3FNHA 3IAHA 3H9GA 4NBRA 3NDJA 1HF3A 1QRRA 1YDEA 2R6JA 1UP6A 1QYCA 4QQRA 1H2BA 3AI3A 4MOWA 1NX6A 2RH4A 4WOKA 4L0QA 5F5NA 1ADGA 1P1RA 3U4IA 4XB2A 1IOLA 3ROQA 1NVGA 1R0LA 1O94A 3RFXA 1Z7BA 4NFHA 5JNLA 2AQ8A 1JKIA 5T64A 5I7VA 1MFZA 1SNYA 2X23A 3M6IA 2TMGA 2GR9A 5I9MA 2B5WA 3QVTA 3PI7A 1CETA 2B69A 4CQMA 2VYVA 4BV9A 1GEEA 3PJGA 5CDSA 1ARZA 4OGWA 3RROA 4EEXA 4WLNA 4ALIA 3DMYA 3GEDA 3FNFA 3QY9A 2B4RO 3JQ9A 2C82A 5BQFA 2FR0A 2OGUA 4M1QA 5C5IA 3SJ7A 3MEQA 4CMBA 4YCAA 1KETA 2GLXA 5CEFA 4DBZA 3ZW9A 2BLLA 5K6AC 3UCFA 2ZB4A 2JFHA 4AJKA 4JJIA 2RHCA 3G1UA 2OORA 2A94A 1Y8RA 3TN7A 1HDYA 2CVOA 1R66A 3GFBA 1NHWA 1VKNA 4FFOA 2I67A 3UAGA 3TJRA 1GR0A 4WCFB 4D44A 4X54A 5CFZA 4YRDA 5F1KA 5B4VA 4YRAA 1UXIA 3B6ZA 3OIFA 2ZATA 2PKQP 1B16A 1ULUA 5FI3A 4YXFA 4WEOA 1GADO 1V3TA 3LK7A 5FFFA 5U1PA 4NJOA 3ASVA 5A1TA 3LT2A 1F06A 3S55A 3ZV6A 1MV8A 3KSZO 4WGGA 4WLEA 3SX2A 1HDGO 3DTTA 3HE3A 3JQ8B 2E82A 1LQUA 1N1GA 1JWAB 3PHGA 3QWHA 7ADHA 4RVGA 1B3BA 3IP3A 1NQTA 4J90A 4JP3A 3DZHA 2CSUA 4P8RA 2Q1TA 1MP0A 5L53A 1YJ8A 4PRKA 5A03A 2X9NA 2Q3EA 2OOSA 3I4FA 2NU8A 1XIVA 3TSCA 1NBOA 4B8ZA 4DYVA 4DXHA 1EVIA 4L4XA 1H6AA 4WCFC 1X7DA 4C7KA 3KEQA 4C7JA 4FC7A 5T8KA 4HKTA 4LSMA 5B1YA 3RCBA 1DOHA 1KEWA 3GDFA 1H6BA 4D3DA 2EV9A 5JC8A 1ADCA 5G4KA 3U9LA 1R4NB 2J3KA 4A10A 1VKOA 1N7GA 2C7VA 4CQLA 1A5ZA 5DCWA 3EVNA 1MLDA 3DBHA 5TT1A 2GN8A 1NAHA 3ZV3A 1IYZA 1HEUA 3JQ6A 3U5TA 4UULA 4N7RA 4NR0A 5HRUA 2XAAA 2OZPA 3GHHA 1JA9A 1GFSA 3O4RA 3WR5A 2X86A 4J1NA 4OQYA 3R3JA 4CM8B 1TA4A 4CV2A 2EHDA 2C59A 4D41A 1NPDA 2QX7A 4FDAA 4BNGA 4MP3A 4N5MA 1G1AA 3KRTA 4DWVA 1CQJA 3A06A 2BGMA 2NTNA 3OBBA 2O50A 4ND3A 3KYCA 3L77A 4BUCA 3JQBC 2HJSA 3GEMA 1SC6A 2B4QA 3GHYA 3HQ4O 3MZ0A 5JSFA 4HP8A 4Q3AA 4UEOA 3RUHA 1HDXA 4B3HA 4BGVA 4BMSA 3GRPA 4OH1A 3NGXA 1GAEO 5A3JA 1UUFA 5DT9A 2UUPA 3F4BA 4LCEA 1YH3A 5A3VA 4E5KA 1T24A 1PQUA 3H2ZA 5IDQA 1S7CA 4LISA 4CLOA 3ZU3A 1AXEA 3EW7A 3GZ4A 4UEJA 3IL2A 1Q1NA 4QXMA 1PU2A 5B4UA 4DIBA 1IUKA 4GKBA 2AXQA 3ROMA 2JL1A 1YQDA 3H5NA 3TRIA 2Q2WA 2X5KO 2C29D 5JPIA 4B4VA 1F8GA 3K9QO 5A02A 5HTOA 2PD6A 3DAFA 4J1SA 4JBGA 4MKRA 4R9SA 1DC3A 4DREA 4E6PA 1EFKA 3ZU4A 3JCZA 2FOIA 1QV6A 4MVJF 3OIDA 3TWOA 3U62A 5G0UA 4BNMA 1R16A 1YOVB 1ISHA 1PGPA 2NQTA 3VAZA 2C7GA 1N9GA 2B5VA 4GAEA 4IQ0A 1JAXA 2VHWA 1GUYA 2H1SA 3W4JA 2I3AA 2WMDA 3FN4A 5DBIA 3JQ9C 4CUJA 4OOEA 3GVXA 3V1YA 3VDRA 4HX5A 2ZCUA 1OI7A 3FWZA 2G82A 3WJAA 4QTZA 4R54A 2GYYA 3B1FA 3D3EA 1GYQA 1I01A 2CDBA 3C7CB 1VM6A 4ND4A 5CDYA 4FPXA 4FOOA 4CV0A 3AK4A 3RC1A 1DPGA 2Q45A 4D45A 2CFCA 4E2XA 3VH4A 1PWZA 3WFJA 1OMOA 2P68A 2CDAA 4Q3BA 4MVJP 1B2LA 1YXMA 2OHXA 4H3VA 3OJFA 4MKXA 1HRDA 1VC2A 1O95A 4O0LA 3ZHBA 4UUOA 1NR7A 4HADA 1Z45A 1WNTA 3D5TA 4BNKA 4BKPA 2O23A 2ZYGA 4QT0A 3PFFA 4AFNA 2BGLA 2Q1SA 1T1SA 4BB6A 4GH5A 1HLDA 2WEKA 1LDBA 1V3UA 1MC4A 1MA0A 2GZ3A 2RHRA 1ISJA 3VZQA 5KOIA 5TGDA 4A2CA 2WD7A 3LT0A 1PS0A 4YJFB 3UCEA 3D64A 1DHTA 1UXJA 3OH8A 1W4ZA 1YBMA 1A72A 1U8FO 1HDZA 5EESA 3DBLB 1YL5A 5TLSA 1R0KA 4XA8A 3WMWA 2E48A 3BMQB 4YAKA 5I8WA 3PQDA 1QLJA 3DEYX 2NADA 2IRWA 2VT3A 1XQ6A 2VWGA 3ADPA 3DONA 4E3ZA 5ICSA 1E0DA 1KC3A 4HXYA 4I9HA 4CMEC 3BMCB 1EK5A 3ZNQA 3L6EA 5L4LA 3QLJA 2VCYA 5H81A 3W8FA 1GZ3A 4NDNE 1WPQA 2WD8A 3BTVA 3IQDB 3P2OA 2VQ3A 1VL0A 4FFRA 4QUKA 4Q3CA 1D8AA 3OF2A 2VRCA 4RPJA 1NR1A 4BNHA 1N7HA 4CMCA 1FDUA 1WP4A 4N5NA 2X9GA 3ONDA 2FP4A 3ITKA 4BNYA 1E3WB 4AJ1A 4YAJA 1S6YA 2OMEA 3VKVA 2DM6A 1TI7A 2X0IA 3KYDB 4XYBA 3KOUA 5DN9A 5IG2A 3W6ZA 1O8CA 5IAAA 3ZWVA 4S3MA 3WNQA 4R1SA 1EQUA 2D5AA 4RCVA 3WXBA 1FJHA 2W2LA 1IULA 2PA3A 2VZ0A 5ITWA 3W8DA 2CF6A 1FDVA 3S2FA 3NRCA 1ISIA 1I3NA 1DFHA 3KSDO 2Y1GA 3GLQA 4WECA 3KO8A 2IODA 3G1TA 1WWKA 1LSSA 2Y99A 3PDJA 1VLLA 4IM7A 1P74A 3EHEA 3AUAA 3PHLA 4U7WA 4R9RA 4I9NA 3K8ZA 3NYWA 4XYLA 4II2A 1IPEA 3E6AA 3LDHA 1M75A 1X7GA 2WE7A 2X7HA 3HFSA 4BS9A 4RJTA 8ADHA 1T1RA 3SLKA 2CVZA 1R4MA 1LI4A 3AW9A 2VHXA 4I5DA 3T4EA 5TT0A 3UVEA 4LGVA 4YB8A 4BNVA 5B12A 1ENPA 3MOGA 1E6UA 5G4KB 5KKCA 1YB1A 2W8ZA 2IYOA 3L0DA 4KMSA 3TZQA 1I10A 3WNVA 3NGLA 3PHIA 4FD3A 1IY8A 3JQFC 3U0BA 1DHRA 3KUXA 3MJVA 1K6JA 4QSMA 5U9CA 4D3SA 4R51A 2X0JA 2PH3A 3WICA 4P38A 3WGZA 2JFFA 2V7PA 4YJGA 1M6WA 1U2DA 2WYVA 2VNAA 1PR9A 4P4LA 4RF3A 3OIGA 3RIHA 4CMJA 1NTOA 3PIIA 4R5MA 1AGNA 4XJSA 4CV1A 4AG3A 4KOAA 2OBYA 3OSUA 1QYDA 3ABIA 5EERA 4N18A 3I4CA 4RDIA 1V35A 2IE0A 3GC6A 2XF8A 4MVJI 4BNWA 1BW9A 3Q3CA 1D1TA 4FS3A 4PVCA 3TZ6A 1E5QA 4KDFA 4E12A 3DR3A 4JNKA 5G2OA 1K89A 4DBVO 4IDAA 3ASUA 3ON5A 2ILTA 4HWKA 1NHGA 1LSJA 4PIVA 1T4DA 3K73O 1BWSA 1OOEA 2Q46A 5A9SB 1E1MA 1I2BA 3PLNA 3V2HA 4AJEA 4A03A 3CZRA 5JFOA 1OBFO 4BO2A 3HJAA 2X4GA 1Y5MA 3QV1A 3ZWCA 4YJDA 3TDKA 1GD1O 3AUSA 2VWPA 4CM9A 3ORFA 2DBZA 2VOJA 3JQCA 3GQVA 3GOHA 4RZIA 4J7CA 5EJ2A 5JDCA 3BHMA 1D1SA 1MC5A 1SZJG 4CQMD 1U5AA 4NI5A 5GMOA 1YO6A 2HSDA 2FSVA 1ZK4A 3GY0A 4FSHA 1DO8A 3JQAB 1LSOA 1PJLA 2WTBA 1KERA 1GPDG 3MTJA 4YACA 5EPOA 1Y5RA 4BNLA 4PLPA 3JYQA 3RI3A 5A9RA 5DBFA 2O3TA 4Y6SA 1RWBA 3CMMA 1WW8A 3FBGA 5JAIA 3QWBA 2Y1OA 2X5JO 4IIVA 2VWHA 1E77A 2D59A 3JD1A 2C5AA 3LT4A 4RVHA 4BOYA 4K6CA 3JYOA 2UUOA 3H9EO 5AXCA 4UVGA 2Z1MA 3JYNA 4J43A 4JJFA 4J3FA 1BDBA 4NMHA 1U28A 1ZVMA 2OBNA 3QW2A 1QR6A 4TRJA 1XG5A 3O8QB 4GX2A 3ZW8A 4CPDA 1EDZA 2A35A 4U5QA 1DIHA 5A5FA 3ROPA 2DC1A 3I5MA 4PLVA 3CINA 3DAGA 2P2SA 3IC5A 2R2GA 4XYMA 4MIEA 4Q39A 2NV6A 4MKZA 1Y9EA 3FRJA 4OJNA 1C1XA 3HDQA 3G79A 4R3WA 6LDHA 3FSRA 3C3XA 2YUTA 1TT7A 1JU9A 4W99A 5I7SA 4TMFA 2ZYAA 5KJ1A 2Y1DA 3PGJA 4OIMA 1I36A 1WDMA 4J9VA 4DPKA 3SC4A 1R4MB 2HQ1A 2BFAA 2QQ5A 5EL0A 2BI8A 2JHGA 3ICCA 3NJ4A 3G49A 3I1JA 3ZNNA 1Q0HA 1QG6A 4CQLB 2NLOA 2Q2QA 3HDYA 3MJEA 4RF4A 4BKRA 1DFIA 2V6BA 1P0CA 1ZW1A 2YV1A 3WMXA 4MVJH 4CLHA 3PYXA 4BNFA 4DYDA 3GK3A 4CMHA 3VPGA 5C7OO 2H63A 1EK6A 4GI2A 2FPPA 3DTYA 4JJGA 1YL6A 2PZKA 4QEDA 4Y6RA 3RUCA 1DSSG 1WMBA 4WUVA 3ZWBA 3WWYA 1GZ6A 3ITDA 3K6JA 2WJPA 3VPHA 1C14A 3VC7A 4DA9A 2ZQZA 4H16A 1R0SA 4I1IA 1DB3A 5ES3A 3F3SA 4XGNA 2X0NA 3WIEA 4M86A 3JD0A 2VTDA 1RM5A 2GGSA 3DAPA 1UP7A 3Q0EA 4IDBA 2HDHA 2C5EA 4R1TA 1L7EA 1HWYA 3ZHXA 2J8ZA 4ALNA 3ZGYA 1UAGA 1BXKA 2IEBA 1TVEA 1RM4A 4IMRA 1H2HA 2I3GA 3LLVA 4II3A 4PLYA 4A7PA 4CMKA 3RQSA 1P3DA 4K26A 4IZHA 5A9SA 1P1KA 1ZFNA 4E4YA 3KYDA 4CLRA 1UZLA 3E9NA 2F1KA 5IDXA 1HSOA 2EP7A 3QJ5A 2PLAA 3RSHA 4BO0A 3ETEA 1OC4A 1E3IA 1P31A 1SO8A 1H94A 4GMGA 4YVFA 5HWSA 4WCDA 3QWFA 1MFPA 3UGKA 4EUHA 4K28A 5JMPA 2NTJA 4Z9XA 1T2FA 5IZCA 4YT2A 4AICA 4OHUA 4IDDA 1IZ0A 4D3FA 4BQPA 2JD2A 1RYEA 4JROA 5CPBA 2EGHA 1K6XA 1CERA 4F3YA 1F8FA 1T2AA 3ZWOA 1ISFA 4CMGA 4YPOA 4PG8A 2GASA 1EBFA 3TFQA 4RV9A 1JVBA 3I9MA 5KVVA 2CDCA 4TRMA 2WD7B 4YJFA 1HZJA 3ETDA 1VL8A 4ALJA 1F12A 4PVDA 2GN9A 4HUJA 2P4HX 3EAGA 3NT4A 3VKUA 3DMTC 4NG5A 3O8QA 5JAZA 4FIZA 1VSVA 1NPYA 4BO9A 5K9ZA 4Y6PA 3I9OA 1O6ZA 1UXKA 1U5CA 1HETA 3AI2A 3N58A 3Q11A 1TLTA 1G0OA 2BKAA 4IDEA 1ULSA 4XDYA 1H93A 1UJMA 2XXJA 3SXPA 3O9ZA 4P22A 4WPGA 4RQTA 3VZPA 4NK4A 4TVBA 2HCTA 2HMWA 3WB9A 5CG2A 1I30A 1Z74A 4QO7A 1MXHA 5JY1A 2O4UX 5IXSA 4W9NC 2Z5LA 3Q9UA 1IPFA 1ENYA 3A28A 4ZQHA 1QYXA 3BXXA 3BMOB 4E2ZA 3LC1O 4CL8A 5DOZA 1UP4A 3JTMA 2O4CA 4RPHA 5T8KC 2GN4A 1T25A 2Y0DA 5CAEA 1DDOA 2GRAA 3V8BA 1V0JA 1EQ2A 3R3SA 2VOEA 4IZIA 5FWNA 1QSGA 1YOVA 4HFRA 3WGHA 1H5QA 1X1TA 3BMNB 2HMTA 1V6AA 2WDZA 1DRUA 1JAYA 1N9GB 1HZZA 3LYLA 5LDHA 1PZHA 4M89A 1ZO8A 1SPXA 1XHLA 2BFOA 4DC0A 2UAGA 1CJCA 5JYEA 2AE1A 3ICPA 4PLHA 1GY8A 2BRUA 2X1HA 3SEFA 2Y05A 2Z1NA 1Q2XA 3UF0A 1CRWG 5A9TA 4AJ4A 1E5LA 3DDNA 3GVCA 1G6KA 1GV0A 3CUKA 3GGPA 3GZNB 2C2YA 1E3WA 3CPSA 3GDOA 1DLJA 1E7SA 3CMCO 1PZGA 2BMAA 1C1DA 4O1MA 4OMUA 4CM4B 5TRTA 3AM3A 3U4DA 1JN0A 2BF7A 3DXFA 3JQ7B 3OA0A 4GWKA 4ZVVA 5T5QA 2WYWA 4IUYA 5THQA 4JX8A 3CEAA 1KIFA 3FF4A 4JBIA 4OKIA 1LA2A 3C1TA 2CY0A 3S1LA 1HSZA 3WJ7A 1J4AA 1KBZA 3HFGA 1EMDA 1HTBA 1YB5A 4IIUA 3VH3A 3D3WB 5L7YA 1GU7A 2VHYA 3RC9A 2B83A 2H9IA 4TZTA 3HN7A 4UVEA 4EBFA 4DLLA 5AYVA 3DHEA 1OZAA 3P19A 4YT4A 3I9KA 2AMFA 4K9DA 5BSGA 3GUCA 1E7WA 3OJ0A 4XB1A 1I2CA 2E4AA 1F0YA 2O7SA 3H9JA 5JDIA 3H5AA 4KUGA 1XCBA 2Q4BA 4ZQFA 1E1KA 3GRKA 2VHZA 2FMUA 3H5RA 3W6UA 4YA6A 1HLPA 1KVTA 4TRRA 1UZMA 3WSVA 2WYUA 3ENKA 3C1OA 4FQ8A 2NU6A 3PIDA 1Y8QB 3WGGA 5BT9A 2P4QA 4AJJA 4IXTA 4BIIA 3GDGA 2FRDA 4PG7A 4BNXA 3PJFA 1XU9A 1HYEA 1Q7CA 5COQA 4YAIA 1V3VA 1KYQA 2POQX 3A9WA 3H2SA 4H7PA 3AU8A 4BNNA 4L73A 1X15A 2AEJA 1W6UA 3F5QA 2W2KB 1A7AA 5G0WA 5F3RA 5TC4A 1GV1A 3SVTA 1D7OA 2P5YA 3F1LA 3FR8A 4Y8VA 5CEEA 3ONEA 3JQGB 2O3SA 2YZ7A 5JO9A 2NTVA 4ZD6A 5A06A 3KETA 2B36A 4BV8A 2O3QA 2VUUA 3E1KA 5DF1A 1HYGA 2DU8A 3HZZA 1UXGA 1WMAA 3AFNA 4JCOA 3AM4A 2Y1EA 1H9AA 3DHNA 1EFLA 2ZK7A 1I32A 4FC6A 4FFMA 4HNHA 3VHRA 5L7TA
chains in the Genus database with same CATH superfamily
1QOZA 5ALYA 4RKWA 4PSKA 3WFIA 4MJ3A 5LMCA 4D57A 4AJ9A 1YDGA 2VKTA 5JANA 1XZEA 3WLKX 5EMMA 2AFHB 1IEXA 3EQZA 1EFRD 2FGJA 3C3WA 1DBQA 1R3UA 1UAYA 4JT4A 5FO1A 4OHYA 4FOPA 3IUSA 4BX3A 3ICWA 3OZEA 4M1YA 4NPHA 5EEHA 2QRPA 2A33A 3ZZMA 4HVLA 2QX8A 3RYHA 4ZVKA 2QP3A 5F5LA 1LNZA 5EGSA 4MVJG 5CK5A 3TB6A 2ETXA 3RS3A 3A10A 3EXG2 4LYGA 1PCXA 2A4KA 1GGVA 2B7LA 5ALHA 1QG4A 5IUKC 3CLRD 4E30A 1VCMA 4V38A 2ZU0C 4BNDA 4L57A 2Q0QA 4GU5A 1I6WA 4KKXB 1F1BA 5FULA 2QRZA 3PWKA 2QEQA 2VTVA 1Z0SA 3HCNA 4R01A 4CLEA 4YRBA 2E55A 4WZBA 3U4MA 1B73A 1UFOA 1N3YA 2G6TA 2Q50A 3HYSA 4V39A 2BMFA 3U1VA 4AURA 3NORA 3OG9A 4MDFA 1RAAA 5DWQA 4C30A 3UM9A 4X7MA 4C4RA 5BV2P 1GU1A 5IH3A 2AMYA 3LCCA 5B1HA 1XMJA 2IW1A 5D5PA 3KV3O 3S0JA 4I6JA 1A9RA 4A23A 3SPXA 4DMUB 1O58A 5AJWA 4JLSA 3RYIA 5DEOA 5BSEA 4LXXA 3A6DA 5H0IA 1ISMA 3STVA 1CUIA 4AY2A 3LJKA 1EA7A 1XZLA 2ZWVA 2IUUA 4GSLA 5IJWA 2JGIA 2EJUA 3LQFA 2UKDA 2GCOB 3GUHA 3EISA 4MGEA 1ZM2A 1T0HB 2FTKE 4B8WA 2B78A 4NECA 1I3KA 1X9HA 1LPNA 2A5GA 5DWDA 1GRCA 3STHA 1ZWLA 1FPQA 4WAUA 5FWYA 2G70A 2X7JA 4WDRA 2JHAA 4KXYA 3SXJA 5ERXA 2SECE 3AIMA 4QC2A 2R6CA 4TMYA 5F1PA 5HUQA 3ONVA 2ZTVA 7REQA 2IS2A 3BPSA 4PC1A 5F1OA 1S2OA 1VJTA 1E98A 2C2WA 1FXUA 5J2TF 2IV3A 3EGXA 1NULA 5ALWA 5K3CA 5B58C 2VZ8A 3OJEA 5C37A 4OSOA 3U26A 2HMSA 4PHHA 4JN6B 2B0JA 3NW9A 4QA9A 2Q0HA 4G5SA 2PT7A 4KU4A 3UMRA 3OOWA 4ZV9A 2FDXA 1P6UA 3NBZC 5CLQA 1T8UA 2BGNA 3UMVA 5LZ7A 4I3FA 4ND5A 4YYEA 3QX3A 8MHTA 3K0KA 1NU6A 4WADA 1JEJA 1EB9A 1SWWA 4R2MA 4COOA 4C0KA 4KHZA 3RTAA 4F9EA 3QXXA 4AXXA 1RLOA 1U3GA 3TRDA 1QO0D 1R5NA 2HA6A 4ACBA 1RZRA 5BQXA 1VDZA 3CEHA 2VTKA 4BASA 4EPVA 4ER6A 5ITSA 1DCKA 4P4UA 3SIWA 4YQEA 1W87A 3EJWA 1LBHA 4HC4A 5G40A 5AVQA 4XGKA 2REQA 1YJCA 2GUGA 3RHFA 2YMQA 3B13B 4IFTA 1F17A 3I73A 3UW1A 2NWQA 1QKIA 3P9IA 1PTJA 5DM4A 3MTGA 1NDQA 2PV7A 1IZ8A 5CH5A 1G20E 5HS6A 5IF3A 1J2EA 2XCUA 2GK7A 3CRW1 3PENA 4PY2A 1FRVA 1LGYA 2Y9MB 4BV3A 3C4QA 1TZCA 2ZJOA 1SBQA 3G89A 3IQWA 3IRVA 3AUJB 2QN3A 4JYCA 4JT2A 3EH2A 1M1ZA 1QVZA 3GFPA 3LUGA 4OSEA 1B23P 5IBRA 2FSFA 4KQWA 1WV1A 2FCAA 1Z4NA 4TM8A 2QYSA 3EA5A 2AUTA 5ICMA 4KQ9A 4MRRA 2AG8A 3SEQA 3WOVA 2ZS9A 3NKFA 1Y4ZA 1YFKA 1CZKA 1K9VF 4M8NE 2YYAA 4BNTA 3K9FC 4Y67A 1YBAA 4ZQCB 5C7LO 3GO4A 3K9BA 1X1AA 5D3ZA 3CVYA 4JZKA 5DSTA 4B40A 4X44A 4LRYA 4K6OA 3NBFA 1ZUD1 5BOSA 5CA1F 5M2QA 1E1CB 3UJPA 2ZRLA 2FRXA 3SX0A 3SS9X 2P67A 3BE6A 4R98A 4RKYA 2OXIA 3U80A 3ZGOA 3JRXA 4P4GA 4PQRA 3SLGA 4W6ZA 3VXKA 3WWCA 4WACA 3RV3A 1DX9A 5B6JA 1JEDA 1V16B 2HK9A 2QT1A 3NTQA 1ZJZA 4YAUA 3BFXA 4N0DA 4QGAA 2AN9A 1AE1A 3BFPA 2PO7A 2WWTA 1PZXA 3DE3X 3OQJA 4JITA 1D4ZA 3OX3A 4WN9B 4Z4FA 1A4UA 4NESA 4W1RA 4E5KA 3PLAE 4WV3A 4XWTA 4IIJB 4AW9A 5ADVA 4XAQA 1FDOA 1VYVA 1GYRA 2JW5A 1E1NA 3C5VA 3D7KA 3E82A 4PYKA 4ZCPA 4MRMA 4WZBE 2PUAA 2V7VA 1BNCA 2O54A 2UXBB 1WOYA 4C7BA 4M22A 3T6KA 1NQAO 3LPDA 3QBEA 3VC3A 3R6DA 1F8XA 2OAP1 1TT5A 4GL4A 1T4GA 1YZTA 2AB0A 1U4NA 4MS3B 3KEMA 5ALEA 2AJCA 2CNDA 4TLEA 3UHOA 1TYEB 3JQDA 1W2HA 1EFTA 2O8BA 2QLNA 3FTNA 2I4TA 1PJTA 2QUIA 3VBCA 5I45A 1OYOA 5JBIA 2WFLA 3FUTA 1DGQA 1MX9A 3AVUA 4HTAA 2EG9A 4MHSA 4TUYB 4F5YA 1XAGA 4AKTA 4UTNA 2Q5FA 4D79A 1JLMA 3D8RA 1EXVA 2VNSA 2P0YA 4PNPA 2EP5A 2DHRA 4GR4A 5FBVB 3M34A 4U2DA 1V7QA 4A91A 1K7XB 4M9UA 1EXMA 5AKIA 3FVQA 1O7JA 1YONA 3WLRA 3LHSA 3LGXA 4XQGA 5EIEA 3DTVB 4PQYA 2V03A 4M9XA 3C3KA 1OAKA 4X8LA 2JS7A 1DU4A 1FNCA 5I9IA 4F2HA 2Z5FA 3PYLA 1V26A 5IWAB 1DOZA 1Z88A 2C0CA 3V5NA 1ZD8A 4AL4A 5KPDA 4ME6A 3PEWA 4BGDA 2NXWA 1Q7GA 2YJ3A 4OQQA 1UMBB 2R8EA 1FF9A 3ZV4A 4NCHA 5ALQA 4FB5A 2G76A 1Z0AA 3LO8A 1JJ7A 2D1SA 4U00A 4JUDX 1E6EA 4OAQA 5JALA 2O19A 5IANA 4MRNA 2VJPA 2YHUA 3ICEA 4QKQA 3R0VA 2D3TA 2XJ4A 3N1UA 2JIPA 2I5PO 5AJHA 3PQEA 1CYDA 1VSUA 4TV8F 3EPPA 5CT6A 3VOSA 4WCFA 2XMCA 4ZJYA 1JIQA 2LIPA 1BMFD 2P9CA 2QUAA 3DLCA 2ONYA 2RC5A 3L0SA 1FP2A 3H87A 3RBXA 4E31A 4X41A 4G5QA 2V65A 4UCFA 1G7CA 4KJZA 4IV5A 1J99A 3TPZA 2JAUA 1XZNA 2BMVA 5JAUA 2Z2JA 2ZKIA 2IZOA 2HOQA 2P6RA 3KELA 1CDZA 4BXOA 2G4LA 2I71A 2NQ2C 2QLTA 3DOCA 1O6CA 3JASA 1VBKA 4XM2A 1X3SA 1MW8X 1EVQA 5IHXA 5C51B 1W48A 3B5EA 3C3JA 3IE0A 4PYOA 1ZIXA 4PHCA 2XUAA 3CVOA 4P3YA 1AUQA 2VJBA 3MMXA 3MSCA 5B6IA 2GFQA 5CA1A 3QEMA 1S4QA 1JJAA 1KZ6A 3AFIA 4QFCA 1G3RA 1I5OA 2R6HA 1JZSA 2LDXA 5F76A 4IFBA 3ABSB 3FPHA 3UAZA 5CBKA 3UWKA 2O1EA 3KBOA 2I2CA 1CIVA 2WWXA 1ZUNB 2ADMA 2JEOA 3BWYA 3DPUA 2H31A 3FF1A 2DG2A 4KJXA 3P0RA 4BLRA 2C99A 2ZOSA 3O21A 1KAEA 2IK8A 3WG9A 4DKXA 1FSZA 4LF6B 2D3WA 3T0GA 1MQ8B 3AEKA 5COBA 4Y3UA 3RRXA 4MLCA 2RJ3A 1ZH8A 2YXEA 3T3GA 4LY9A 4Q4DA 5TSDA 3HWSA 3KKLA 4HNAA 4MCHA 3PJDA 4D0NA 4DMLA 2AG1A 1AHNA 1MB3A 3ESRA 5KJFA 1C7EA 4PEVA 3Q9LA 1ND6A 2RHHA 5SZHB 1IVYA 3FWYA 3GJ0A 1UANA 3TAHA 5TJHA 3DMNA 3IP6A 1M10A 5D2CA 2FW7A 4GPAA 4XR4A 4EJ6A 2QMYA 2XSZA 2YVAA 3CZ5A 1DAIA 2DTXA 5DTRA 5I9LA 4DXDA 3AVYA 4ZEMA 4HQFA 3U7HB 4DR6B 1QLHA 4AT1A 5EHIA 1CS0A 4EHFA 4K2HA 4NH4A 4YT8A 4B1FA 1JR6A 3TH5A 4A6EA 4DR2B 3DVQX 5LQUA 1R0ZA 4MPPA 3GPIA 4WLUA 2HGZA 1XCOA 4JJKA 2ZDGA 3X1WA 2Q2NA 2RFLA 3HJBA 4DTIA 4L75A 1I14A 4ZOLA 1K66A 1Z6QA 3UKOA 4FYHA 1FDTA 1WUHS 3ETGA 2PRIA 1N2OA 1OA0A 4J7UA 2ZI6A 4OHBA 3H5IA 2RKBA 4RO0A 1U2RA 4RY2A 3ZJYA 4DARA 5I3ZA 3OJCA 3OOHA 3U4QB 1O87A 4EX6A 1XN4A 2TMDA 4MWZA 1N6OA 2QSYA 1C7ZA 1CHNA 3DNFA 1VXRA 2ECFA 3AEQB 3LUAA 3OU7A 5FV7A 1M54A 1N3IA 2HWKA 4DQXA 3U6KA 3COJA 3AH8A 1JA1A 2AG6A 1JMKC 2J0VA 2OP0A 3EZ7A 5KJEA 4ZGWA 5JR3A 4YCBA 4X64B 2YZ2A 2ZYUX 7MDHA 2PKXA 5DZSA 2BGUA 3KQTA 3LQRA 4DQUA 1JYEA 1Y6QA 1L4FA 4H60A 1ORRA 1U0EA 1W35A 1KAMA 2DBRA 3HCEA 1SCUB 5DCYA 4BBJA 4D97A 1U9ZA 2MT9A 3QUCA 3EXHB 2LWIA 2IY9A 3BVPA 2OV8A 2PWAA 2YN2A 2ZYDA 3OA2A 3PWTA 2DPHA 2AVNA 2YHIB 5ALTA 4AVYA 2OGZA 4Q1VA 2QM7A 5CMLA 3SU8A 1ECPA 1UKYA 3PEUA 5FLEX 5HFAA 5LQSA 3G0OA 3AJ9A 1J2UA 3TBFA 2X4DA 4E15A 3SBOA 5J2TB 1WLYA 4U3JB 1WVGA 2NACA 1A82A 2FMXA 3DEAA 1UKEA 2P5TB 3KB6A 4BVLA 1U8XX 1EE1A 4WWHA 1PJ4A 1IBSA 4IH9A 1PBNA 2Q6VA 2WHPA 3W5IA 5IVKA 2PS0A 3BWCA 3FLEA 2Q3DA 4AJIA 1PX0A 5HW0A 3U3KA 1T2DA 3B70A 5KTSA 2II6A 1C1DB 2ZG6A 1REQA 2ZU6A 3L7BA 3NZEA 3PQFA 4IF4A 1QGDA 2C5LA 3TAUA 4CT4B 1UADA 4AO7A 4EABA 3M7IA 3QRWA 1UPAA 2FQYA 2I4MA 4P82A 4I1RA 2C54A 2P2GA 4JBXA 4EF6A 5K8CA 3WA7A 3LRPA 3PL1A 4B44A 1M0SA 4J2TA 3SBXA 3W3ZB 3FVVA 1J0AA 2DECA 4LJ4A 1WCYA 1ZD2P 4EPRA 2DUWA 1V8PA 2G80A 4UZEA 3SOPA 3NTRA 2BTQB 4YR9A 1IEQA 5E1MA 5CJ2A 2XTMA 3QOYA 2YWBA 3UN1A 2VYVD 1Q1QA 3G59A 3MA0A 1IL0A 3MMNA 2F1JA 3ASZA 3E81A 5KHAA 2P9JA 5A5EA 3VDQA 2RAUA 1IHPA 1Z56C 2ZJ1A 1LF0A 4JFRA 4PE5B 3OEWA 2C3PA 4G0OA 1MO4A 3EIQA 1Y98A 3CPJB 4MMYB 5GIPE 2I3BA 1E66A 4MW4A 4TT8A 3DVLA 4V0NA 1QK5A 1AHPA 2WWYA 1E2GA 2O06A 3HHPA 5K0CA 3E58A 4R1UA 3WV5A 4NU5A 4F6RA 1D07A 3OPNA 4OGGA 3CLTC 4GEGA 1ZVQA 1FX0B 2DBVO 4XJTA 4HDAA 4U2EA 5E8JA 1Z6AA 5CM8B 5GV8A 3T1NA 3EC2A 4EPTA 2CLDX 4ZI3A 3CEJA 1Y81A 3H6GA 3AY6A 3IAS1 2EQBA 1B74A 1RT9A 4CTNA 4F4HA 1FLNA 3KPWA 4PYNA 1SM4A 2P9EA 4EJSA 2F55A 3B3JA 1MG5A 4R6XA 1U9IA 3MD0A 5FUMA 2WJVA 5FTMA 1GEGA 1KYVA 3G68A 2FYTA 4PFJA 4CL3A 4DV7B 2CHEA 5HX7A 3OTOB 1VCOA 2W6CX 3IPLA 4ZVLA 2BMWA 3F71A 4P7GA 2CEAA 4OHMA 4Q0MA 1MB2A 1Z8DA 9LDTA 5BT8A 2AR7A 1YR9A 1QAOA 1FYDA 3Q8XB 1T9GR 2PG3A 4RMGA 4R0MA 4LE0A 1NRWA 3CLKA 1EG2A 3VYWA 4HGNA 3PC8C 1AS0A 2FWMX 3G8CA 4OB8A 4PPQA 1F4LA 1LUAA 1M5RA 3H65A 3KUUA 5IJZA 3DYBA 2O2XA 1SH7A 4G2TA 3P2MA 1TO6A 3BA1A 4XVHA 2Q8NA 2HU8A 4JUBA 10MHA 4YLGA 3OEEA 4ONEA 3RC7A 3UAXA 3F9IA 1UJ2A 2E4VA 3WDMA 4MCAA 4KP7A 4YRTA 1H5NA 1HDCA 4BNIA 4CKBA 1WB9A 2PRZA 1JIXA 3V34A 3FYTA 3PQ8A 2GYVA 3QHAA 1TYBE 2C31A 1C8LA 2WNSA 2I91A 3E9QA 3OC0A 1G5TA 5AK4A 3BWBA 3FX2A 2IXTA 1WZCA 5BWMA 1TPYA 2JB9A 1JHPA 3HCOA 1YK1A 2Q5CA 4XX0B 1LQTA 3I2FA 4M0KA 3G2KA 3F3YA 4FFVA 4YJHA 3RFUA 4L7VA 2IEDA 1IQUA 2LD4A 4EG6A 4ZAXA 2GD6A 4LC0A 3L4JA 4D8UA 2GKOA 4EPXA 1TCUA 1FJ2A 3R5TA 1CE8B 1S3IA 2ZB8A 4ZALA 2QW1A 1IH8A 2A9OA 1UK9A 2YWEA 3NYQA 4HSGA 4RDHA 1VJGA 5DLDA 3NC4A 5LLSA 3EVBA 1IAQA 2R00A 2VL7A 5LZ2A 3HVRA 2P7HA 2AFIA 2OXCA 4E5PA 1SOAA 1U7TA 2BR4A 4RBNA 5AH0A 2W6IA 1EK1A 3P9YA 5EJGA 5KYGA 2OY0A 4G56A 1BTOA 3LSTA 4QNRA 5LVAA 1G64A 2R00C 2XOKD 3L7LA 3OMLA 1GKKA 3G0BA 2Q5HA 3KWFA 4WW0A 2YDXA 4Q3DA 3H2KA 3HACA 2MWMA 2DJIA 3FIUA 3QE0A 4J4HA 1MN6A 1VJDA 1XVUA 2GN2A 3LGSA 1VI2A 4WDQA 5CLGA 5GWXA 3OT4A 5ELXA 4CR8A 1KU0A 5IBQA 1SB8A 4UVIA 1FSPA 3O9VA 4Y0VA 2RHLA 1DBRA 5TE9A 3OTQA 4LVCA 1M1YE 4HB3A 1YJ5A 2OK7A 1PK8A 2DPMA 3D4NA 2BFBA 3HUDA 3LMKA 2ATIA 2C4VA 3QKSB 2Y2VA 3DTNA 3TQTA 1I6MA 3HMQA 3LOUA 3H1BA 3TPCA 1R6XA 3MN1A 2JGDA 1LK7A 3JW8A 5DX0A 3Q6IA 2PNFA 2HLPA 1J90A 4GGOA 3FNEA 3B5IA 4JR0A 4KN9S 3UEOA 2V4ZA 2PUGA 3UB3A 2IEGA 4KWIA 1U0BB 3H05A 2HHLA 4JJEA 2A86A 3LUFA 4BKUA 4G8JA 1PJ2A 2UYYA 4IEFB 4EFKA 4OH7A 4CG0A 1NXOA 4LNAA 2EQ5A 1G19A 3D4LA 3OE7A 1GGEA 1SB9A 4MR7A 4OIFA 2FW0A 1P5HA 1MVOA 2HQRA 4B3JA 3K6RA 3HI6A 1ADBA 2DPYA 3WIDA 1DC5A 2EWMA 2X9QA 3HDJA 4EGAA 3J81k 3QM1A 1P7CA 3LDGA 1C0IA 3T7KA 2CJWA 1VJ0A 3MJHA 2GZRA 3HVHA 1SHTX 1R7RA 3O38A 1JDPA 3GLGE 1YRLA 2GRJA 4PG4A 2XQFA 3EIUA 3M3DA 3RF7A 4UQLA 2QVGA 3NBUA 3LZCA 4YJGB 1W0KD 5WRFA 1MNQA 2JFNA 2AI2A 3S29A 3HGTA 1HRKA 1IY2A 2HSJA 4AUEA 4PW0A 3UK1A 2SCUB 2J0EA 1JXAA 5FTWA 3V7UA 1UEIA 2JVJA 5JAOA 3NPMA 4G89A 3W1EA 2QYHA 1ZVJA 3NHRA 1FS4A 2Y0CA 1LRJA 1EGVB 4HWSA 4KNVA 3U3OA 4BVBA 1LDMA 4IGKA 2C4HA 4Q4LA 2GN0A 5HCUA 1JHYA 2J48A 2QLLA 5JDCC 4Y2RA 2JJ8A 1ABEA 5CB4B 3KU4A 3SG0A 2PD4A 3BD6A 3EUEA 2ODAA 1JJBA 3K1AA 3T9FA 4KC0A 5K2OA 3L8ZA 4AS1A 1I4TD 1X9IA 2IYTA 3K0FB 3R1IA 3FGPA 4TVOA 3KJEA 3IHLA 3MMZA 3UICA 3COSA 3VV3A 4F5EA 3CONA 1K8RA 2G09A 4HEHA 2I7XA 4PZEA 9GPBA 1KH1A 2P3SA 1G17A 3VPAA 5C4IA 1HNZB 1E94E 1TUBB 1DAEA 5L3SB 3IRUA 2E6UX 4H6XA 5AW2A 1SBZA 1NVMB 3IUPA 1FSSA 3L0ZA 3Q1KA 4LOHA 3GMTA 1L5KA 4KQMA 2FUEA 2IUTA 3P71T 3KJIA 4FGJA 5D3MB 5JCJD 1JQBA 1VDMA 5TPWA 1N78A 1VJCA 5GY7A 1PZFA 2WM9B 1D1QA 1USGA 1GQRA 3PUHA 1J06A 4UBLA 2Q49A 3VNSA 5BWLA 4DUGA 5KPJA 4OKNA 4YRFA 3L49A 4HZUA 2NQ8A 3L2OB 4NV3A 3AVQA 5SZJA 1NZFA 1CRPA 2XE7A 1XZHA 5JCPA 1HYQA 4MS4A 5J2UB 2Q9UA 1HMPA 1NN3A 4JOBA 1EBUA 4RK5A 4BQFA 4F8JA 1PEYA 1V4NA 5CEJA 3EXAA 4WLFA 1UJ5A 1T3HA 2XVZA 4CZ2A 4ZI7B 5ECGC 4JB8A 1MC8A 4PGHA 4RA9A 4N76A 3UA4A 3MBKA 3DG9A 3BHNA 1BKYA 1DV1A 1QYIA 1W46A 1W8DA 4TGLA 3QBJA 4LC1A 1AHIA 4AZTA 4I19A 2WHEA 4F72A 1KI1A 3VAYA 2GO7A 4AD8A 1WABA 2WSIA 4R1QA 1FU7A 2WUFA 3KTOA 5L40A 2VJMB 1E2JA 1ADJA 3ILYA 4I5GA 4E7OA 1COWA 4BVAA 1HZZC 1BVRA 4D5GA 4EELA 3T7RA 3V1LA 4NXMB 1Z5ZA 2Q8QA 4R41A 1C7QA 3F6YA 2PLFA 1PIWA 2BTQA 2XB2A 1N5IA 2V7TA 3C70A 1NFFA 4EPWA 3EZYA 5LP6C 2ZJ2A 3I12A 4URYR 1I24A 1Y9JA 1TKBA 3ENWA 3ZDCA 4B81A 3BGVA 2QDXA 2NXEA 3ZG6A 4NZMA 4H9GA 3E5MA 2WP0A 1NT4A 4RY0A 2Z2XA 4HGYA 3W4IA 3B6IA 5DWVA 3N8DA 4XEHA 5JTTA 1A9QA 4JEHA 4AU1A 2O8DB 3TNDA 5IK2A 1JR3E 4RTOA 3CJQA 3E9MA 4BKOA 3U4QA 1PQYA 4GXRA 2C07A 4HVAA 1RXCA 4QUJA 5E3HA 3IAUA 3PLRA 1SHJA 1UBJS 13PKA 1OLUA 5FHRA 2RE8A 4IJ5A 5I4BA 4P5EA 4C08A 3AHDA 5K1ZA 1ZKMA 1P0PA 2E5WA 4E4TA 4QIHA 3OQMA 2GPWA 3PTAA 3N2ZB 3EEQA 3DM9B 4UDXX 5KTNA 5MN4A 1R00A 2FZWA 4GPEA 1E2BA 1VE9A 4QJ5A 3I39X 1S3FA 5CT8A 5IBPA 2EL9A 5KC9A 3CLUC 2GAAA 4CW7A 2JCSA 1NATA 2IF2A 2FOLA 2WICA 5H1YA 3VPSA 4OJMX 3ZCVA 4DVJA 2JAXA 4LJ9A 1N2SA 2ZSEA 4F11A 2ZS8A 2BH9A 3TRHA 2YHIA 1FDWA 3HR8A 4OSPA 4PYQA 1MPTA 5KSPA 2OHIA 3DV2A 2WHQA 5DGDA 3NEPX 2YWXA 2Z58A 3NALA 4P31A 4COKA 4REOA 4CIYA 3FYCA 2PQMA 5JEDA 1MRNA 3D8BA 4PLZA 4Q4HA 4D8TA 4E21A 3I61A 3AETB 5CVCA 3KAQA 3PGXA 1GN9A 3OFSA 2JH8A 3OJOA 4QUGA 1Z68A 3V80A 4RHCA 4F2WA 2QPAA 4PPNA 3SICE 3WL3A 2VYNA 5FL7D 1JLLA 2XZPA 1YVDA 1OREA 4M0PA 3NH6A 3AFMA 4Q12A 1M2VB 1GZVA 2XYGA 3FI9A 4LHWA 1KEVA 2HNKA 2YCLA 4LHVA 2XVXA 3W2HA 5JU6A 5HF5A 4G0UA 1UR5A 1PL6A 3HZRA 1VHJA 4C0JA 2VA8A 1IG0A 2IDJA 3L1KA 3ZXYA 5TARA 2K6GA 4CDGA 5A4DA 4FBLA 4QHSA 4DM3A 2M6RA 4LRUA 5HMLA 4O4JB 3ZK9A 2HKIA 4BZXA 5BVHB 1Q5PA 3MBOA 4NOLA 3K31A 1L2TA 1JG7A 2V98A 1W73A 2VP6A 5CAEB 4EGQA 4EQZA 4WHMA 3I3OA 2CHVA 4X84A 2OFPA 4MVJM 1OWMA 5UKDA 5EJ5A 3VA7A 1EP2B 1RYZA 1N5RA 4GLFA 1KORA 3WL8A 4MUKA 3QMMA 4B3BA 2XCSB 4ALKA 2YVQA 1RXYA 5G1NA 5JJ5A 1ZM9A 4FHDA 2EKQA 2H4WA 2J5XA 5ALGA 1DPFA 1Y6ZA 3RAJA 4XLTA 3JYLA 1K98A 1S8FA 1CUFA 4I8IA 3BIFA 4ROTA 4BEVA 1BDIA 4XARA 1WDTA 1RJ9B 2P7IA 2Y1CA 3ELWA 3G2NA 4OA8A 3VDXA 1NW4A 1CY2A 5IFKA 1RYDA 3HNPA 3I2HA 3H0EA 1EU1A 1MJFA 1Y1TA 2XVAA 3CBGA 5D7NA 3W1VA 1Z75A 4HNAB 1X7WA 1CD5A 1PJQA 1W93A 3RG8A 1HI9A 1N34B 5D1NA 3RS8A 3EEBA 1QP8A 2YDYA 2WZQA 1Z38A 1JECA 1LBEA 2IYYA 3ZCSA 4UHHA 1H2EA 4L5IA 3OFVA 2IIQA 2HXSA 3WOHA 1KPGA 1UXOA 4DF3A 4TVKA 4C05A 3D0OA 2ZE5A 4KR9A 4Z3DA 5BSTA 1YZFA 2HTFA 4CQMB 1TMYA 3NBKA 1RKXA 1ZCJA 2NT3A 1G8GA 4RJJA 3RWMB 2NNWB 2C4WA 1O9HA 4I55A 2H3EA 2Y92A 1XXHA 3KT6A 1DXHA 1VKZA 2QV7A 2YFHA 1ESEA 1RRFA 2NUPB 3ASYA 1QHXA 3I4LA 4HN4B 4H31A 1PDVA 1OXSC 3JARA 1FMLA 3Q12A 3WHIA 2W42A 3FZEA 2GAJA 3E61A 4X90A 3Q5DA 3M3HA 2NM0A 4QXAA 1LLFA 2N0SA 3R0ZA 4YT5A 3JX9A 3GG2A 5JRDS 4NBWA 2VXCA 4Z0TA 1YVEI 1W49A 3MWEA 4IH4A 4NFSA 1RFGE 2AXPA 3KXDA 4L16A 2OORC 2VNKA 4MPTA 1ZEJA 1BRMA 5ICFA 3WI7A 3ZYCA 1LFAA 1Y7HA 3I32A 2UXCB 5MGNA 5AXDA 1Q84A 3BF7A 3LHFA 4R8VA 5DP1A 4FTWA 2D4HA 5BYJA 4CG1A 3UBTA 2XXBA 3K4PA 3WL4A 2ZBGA 4BJ6A 1L5VA 1YAJA 4L8LA 4CKXA 3UJ7A 4IZ6A 1KY5A 1HQDA 1L7AA 1SK8A 3LYHA 5T4HA 3GV0A 4UJ3A 4D3XA 1RRPA 3SYMA 3ND6A 1M2OA 1U6JA 4CQNA 4FW8A 1P81A 3B1YA 4MS1A 4ZK2A 5HZMA 1JMYA 1ONNA 2QYTA 3D6TB 3H9CA 1BAPA 1UM8A 3PK0A 5BR8B 3EGDA 3E23A 1YKGA 2PFGA 3QUAA 2J09A 2H07A 3EJ6A 1JFFB 2PIDA 4AUKA 2DQ4A 2V45A 1O96B 1DEHA 5ALDA 2NT4A 5B1IA 3WS7A 2WWVD 2DP4E 2YC2C 3FOBA 5FNVA 1UBFA 2VJLA 2YVUA 2JFYA 1FFSA 3PRJA 5F5XA 1KZ7B 3C6YA 4U2FA 4AZWA 1XQXA 1ZJYA 2QD2A 4OFWA 5AKJA 3UJ6A 4OLBA 4JQCA 4ZIRA 3MUEA 4DAOA 3GAFA 4JU9A 3ZCTA 5HQ3B 4KX3A 3GJ5A 1W76A 3NR2A 1DRWA 4IPTA 4FMPA 4GG1A 4X71A 2JFVA 3O84A 1FUKA 1JBQA 1NBEA 1ORHA 3I42A 3K2BA 3GLTA 2OB2A 1HE8B 5H02A 1B26A 4E7PA 3HADA 2W0SA 3H2YA 3AKZA 2FZLA 3KK0A 5B7GA 1L1EA 2VRCD 2X76A 2J4FA 2HU2A 3TF5A 5JBNA 4F46A 5AW4A 5CNMA 2IH5A 2LNDA 4DSOA 3A1EA 3R75A 1ZNWA 4ZTZB 3JQPA 4OUDA 1SCKA 4RL4A 4XJVA 3UZUA 4RIGA 1TGVA 3GGOA 4LTDA 5ELLA 2GA9A 1PJCA 1G16A 2WJAA 3LWNA 4JLPA 4DGSA 3FYUB 3NTOA 1K6EA 1CP3A 1UCFA 2ZJFA 3JWHA 5BOSB 5EJ9A 3OLZA 1SVKA 1XK7A 1LDYA 1NBIA 2GJSA 2RKOA 3IOCA 3PF9A 4GM1A 3WBFA 4AF7A 4CMAA 5LNK1 5LQKA 3S8YA 1XMSA 2C2XA 1Y33E 2D5IA 3I9LA 3PFWO 3MINA 2EX0A 4PZZA 4X8OA 5HE8A 1NN1A 2J3HA 2IOHA 3GLHB 4FJ1A 3OQBA 3MGGA 5CCBA 4RCZA 2I66A 4WXHA 2FUCA 2M1XA 3BH6A 2AQKA 2ZPUA 4J0KA 4W5TA 2PMCA 2FETA 2PUTA 5EMKA 1T2VA 3QYFA 3G82C 3COYA 3ADOA 5JZBA 4HJXA 1V1MB 3FFXA 2EW8A 2AZTA 1KDRA 1S89A 3IDOA 1OILA 4GYJA 4XKJA 5EN4A 2H1LA 3ZK8A 4OQNA 3EAFA 1P2VA 3REFA 3EZGA 4ENPA 1R0RE 2M9MA 3A1CA 2I2WA 4RHXA 1EVZA 4FCCA 1R15A 5DU2A 5JLJA 1CUCA 1YVRA 1KS2A 2HU5A 1ZRSA 4RK0A 2VUTA 4V1CI 3ZI4A 2EF1A 3A6JA 3MERA 2BDUA 4D7AA 4RZXA 1X0VA 4ZK6A 4RKFA 4JLBA 1E7RA 2PCJA 3LHDA 4MS3A 1CY0A 3E22A 5DSZA 1QO9A 2R65A 1R0XA 3R3HA 1D2HA 3N8IA 5HF8A 3UNXA 3B51X 4I55B 4FDUA 2ONZA 1YE8A 5AVKA 4BBZA 1EESA 2YFQA 2XHZA 5GZ6A 4FT4A 1SKBA 5HF6A 3KS9A 2C96A 2ZFUA 3THOA 1H4QA 4I1VA 2VF5X 3NVDA 5BSVA 3ECCA 2QX4A 2E2WA 1R8QA 2X14A 3H1FA 2RH5A 4TUYA 1U7UA 4CUKA 4DCPA 1ZAKA 2AQHA 3V4FA 3P0JA 4Q19A 1NASA 3H17A 5DULA 2AF4C 3DJYA 4DPMA 3ENQA 2GSDA 4FR5A 1II8B 4ESVA 2JAWA 2PEYA 4M37A 2OUKA 4FFLA 4KIFA 1KP9A 1GNSA 2GCNA 1MJHA 5BV8A 3CE6A 3DZCA 5FP0A 1SVMA 2I6QA 4L9SA 1R3DA 5EFOA 1F8UA 4PFSA 1EGHA 4QSHA 7ABPA 2JLUA 4ZT3A 2IELA 3C24A 3TSZA 4QYMA 5A5VA 1U7WA 3ZWAA 1QYVA 3UWOA 4CCWA 4ENRA 1SK9A 2PAFA 5TPZA 3K53A 5EIWA 1XDZA 2XDQB 4YHBA 3SKYA 1FC0A 3LT1A 5KDLA 4QTXA 1XEFA 3EC7A 2CFIA 3K1ZA 1NW5A 4NDAA 1G3QA 5E9JA 4CEHB 5JS2A 1AN9A 4N8DA 5IEJA 3ESXA 4TS1A 5CT5A 3W06A 3LO5A 4XPIB 1XJ0A 2AKAB 4I4CA 4W5RA 3IV7A 3IUMA 2VP9A 2WYIA 2GPAA 3L07A 3RIMA 4LZNA 3T7DA 4B6OA 1U2DC 3JQ7A 2GAFA 4A92A 6ABPA 3CX8A 2XDAA 4IINA 3UTDA 2OESA 3QYJA 5ILGA 1K6IA 1S2IA 3WX0A 4YUZA 2WJIA 5C53B 4YRMA 2AI1A 4OI0A 3FDZA 4GWGA 1JPNA 2ZTSA 1M34E 2CUKA 2JK0A 4LAFA 4QFDA 3WNZA 1JHQA 4E5NA 5SYAA 3PXXA 4ZT4A 3V9PA 2HJGA 2Q6OA 4Z4EA 3NC1C 4AN0A 4AJNA 4MKGA 2PX2A 1SAYA 4LGYA 4KOEC 3WGQA 2JLSA 1PNRA 4RK6A 2RD2A 1OFHA 1R18A 2Y77A 4QM7A 4GDFA 4TSKA 3HM2A 4H77A 3G9QA 5C2JB 3KWMA 4ETIA 5LYJF 3EGIA 2QAGA 2G5CA 4PAWA 4UE2A 1OFVA 1V5IA 2QP9X 5CIYA 3FTFA 1PSZA 5J5VA 1P17A 2MYPA 2YBEA 3PGVA 1FDSA 4PGAA 1BDMA 1VLQA 2QV0A 2FWBA 1X7ZA 4LV6A 4R2LA 3R7SA 3TSYA 4BCBA 4JU8A 4UJ5A 4XB6B 3I45A 4NQRA 3T7EA 5JEEA 3AV0B 3H6HA 3WLHA 1EVJA 1RPTA 2HV8A 2XSZD 2OYSA 4UUMA 1GTG1 3TGLA 3A2LA 1WZEA 3ENNA 1XNRB 1WETA 1B0ZA 3QKTA 1YK0A 1QG0A 4YRSA 4IDFA 2O52A 4DM4A 3CCBA 5LNK6 1J24A 3UFXA 1I7NA 4EBBA 2YXBA 4KAXA 4BN5A 4DBLC 3OY2A 3ZD6A 1N2CB 5GOZA 3WLTA 3E3NA 5ADUS 5CLHA 4FZVA 1HQYE 1KI3A 1UPXA 5LA6A 3SZ3A 3IO3A 3NB0A 3C14C 2HRQA 4KYUA 2HO5A 2L69A 1O08A 2FE1A 4IKEA 1FTSA 3Q2KA 4L85A 4LOLA 1ECBA 3QFFA 3RSQA 2WMOB 4N54A 3V97A 3SFTA 5FX2A 3O6VA 5JAMA 4J91A 1FFAA 2R5WA 1RHRA 1T8TA 4PXSA 3OPMA 2GNOA 5TQ0B 4OXKA 1HQKA 4XM1A 3GT4A 5DK4A 2R751 3L0IB 3T1TA 1QS0B 1U3WA 3NTUA 4ITUA 3ZCRA 1IG3A 4OHXA 3IIKA 3B8HA 1R0WA 1C9KA 1LPAB 2CD7A 4ZREA 4M9SA 5ERGB 2RB5A 2WVJA 4GQAA 4BQOA 1AKVA 1UWLA 3KQYA 1NQOA 4PQGA 3VX3A 1VBMA 1BE1A 1PGNA 1QZZA 2CJPA 4EQ6A 1QHIA 5EE5B 4RVFA 5HILA 1JTEA 1K88A 3UHFA 1YBFA 1QYRA 2FRVA 1FSFA 4BN4A 2A8YA 2Z8YM 1TIPA 3LY7A 4JELA 2GILA 3LT5A 2BBTA 2DPGA 3A1WA 3WQQA 2HMVA 3IODA 3ULKA 1V4VA 4ADSG 4P5PA 4CTKA 4IDGA 2WOJA 5KCZA 2NPIA 2HBRA 1UMDB 4HY3A 5CDUA 1WZIA 3RC2A 1B41A 5IKEA 1S1MA 5G0VA 4OXIA 1Z73A 1UXHA 1AO3A 5TQVA 2ZSAA 4BX9A 5BXQC 3OI7A 3M2PA 4RPKA 2JZOA 4DMFA 4TTIA 4DR5B 1NWCA 1RLIA 3IBTA 2Z98A 1NC3A 5KYNA 1MUUA 2G6BA 3DHYA 2YWHA 5JMWA 1QQBA 1QWOA 3EX7C 4RVDA 4EGFA 2JA1A 2W6JD 2HZ7A 3B9BA 1RRGA 3IJRA 2LGJA 3KJZA 5HG0A 4AJHA 4DCNA 3MHPA 2ZTUA 4FCVA 2WILA 3G17A 4YALA 2AC7A 3GOQA 2B82A 2PHZA 4Y6OA 4G81A 3EK2A 2JZCA 2BELA 4DZRA 1CUVA 1R8JA 1SZPA 1YI0A 2IIBA 4O4JA 1E32A 2VJMA 2XV1A 3ROKA 5H83A 2GLTA 1TYCA 1I4LD 2IGTA 2O2SA 4YLEA 4MUFA 5AICA 4N5LA 1YCHA 5IAEA 3WIUA 3HV2A 3A4IA 4H4CA 3OIVA 4XWKA 1WHTB 1RYNA 2CLMB 2FI1A 2GEKA 1PD1A 4ZXPA 4KE8A 3SMVA 3TL6A 2ZIXB 5T67A 1N1DA 2AKEA 5DNDA 3TI7A 2VSNA 1G66A 1CJVC 3IAHA 4D5EA 4RAQA 3H9GA 3H5VA 1GPWB 3ORHA 4N3BA 4J7AA 1Q50A 1H2BA 3RYTC 7YASA 3HRKA 4LPSA 1BGWA 2QN6A 4AQDA 1NQXA 1NIPA 2CL0X 3Q7PA 4QRIA 2RH4A 3C3AA 3PQ7A 4WOKA 5F5NA 1YNSA 3GLFA 1P1RA 4MHTA 4V03A 3BWVA 2CE2X 2PEZA 3SYLA 2F64A 1NVGA 1R0LA 3JZFA 1NJGA 4NDZA 3H4IA 1GZSA 5DNWA 3Q3JB 1GXSA 1R4ZA 2BGJA 2GM4A 1LFDB 5LA6F 3K6SB 1J21A 3HR7A 4M9QA 2GR9A 3G7SA 3ZDYB 2R79A 3ESDA 3DLIA 3WB1A 4UPEA 1IHOA 1PWHA 3B2QA 2R8BA 3LIIA 3TNJA 5JD4A 4GRAA 3IYLW 1VIVA 5KHOC 5LIPA 1G1MA 1NNI1 5EXXA 1PFUA 2BVNA 2IOQA 1JIIA 1G18A 1L5NA 4DQKA 1VZ2A 2ZBFA 3GEDA 3O90A 4ZKEA 5C8YA 3RADC 4B3RB 2B4RO 1N6LA 2C82A 3EN0A 2FR0A 2OGUA 4YH1A 3ZR4B 3CSUA 4BO3A 3DDOA 1TNDA 2IBMA 2ZXFA 1JQAA 3DV9A 3OPVA 3ZW9A 4DBZA 3AVXA 5K6AC 2ZB4A 5AVTA 1CUGA 3HB0A 2JFHA 4E51A 2P6PA 4AJKA 4JJIA 1MKYA 5HJEA 3FCCA 3I6BA 3G1UA 2GJAA 4MI9A 4RK1A 4F60A 1G55A 2OORA 3WADA 3RM3A 1NVXQ 4W63A 3NASA 2ZAIA 2H00A 4KQKA 4YUVA 4C7MA 5F51A 1HDYA 5LP6B 4EIWA 4KN6A 1NKTA 1K7EB 1Z34A 3FPGA 1VKNA 4FFOA 2H4FA 3UAGA 3TJRA 5DM60 5CB0A 4JLJA 5EP2A 2P9BA 3QI2A 4HRXA 1H69A 4D6XA 3EZXA 1TAGA 1U80A 2XZDA 3OIFA 1CUZA 4O8ZA 2LP4Y 1FDIA 1XJQA 1B16A 1ULUA 1YC2A 3KUDA 1G8AA 3A9CA 4IIXA 4IVNA 1OA1A 4ZT6A 5JXGA 4BMOB 3LK7A 4FDTA 5DYIA 4NJOA 5DIZA