1N5DA

Crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
288
structure length
288
Chain Sequence
b'SSNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQGRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSDSTYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQFVTDKKVVEWGVPPESYPWVNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID DEHYDROGENASE
publication title Porcine Carbonyl Reductase: Structural Basis for a Functional Monomer in Short-Chain Dehydrogenases/Reductases
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 100
structure length 288
sequence length 288
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n5dA00
3GDFA 1NYTA 2Y1OA 3B20A 5A02A 1WWKA 1LI4A 5JMWA 3L4BA 4IDFA 1V3VA 2GRAA 3SLGA 1C0KA 1B8VA 2PK3A 4KWIA 3KETA 4AJHA 1N8KA 4YWJA 1OMOA 3GF4A 4P38A 2FOIA 3C1AA 2DUWA 4ZD6A 2GZ1A 3RKRA 4GLLA 4CLRA 3WYBA 4NH4A 1C0PA 3A9WA 1SZJG 4K6FA 1QV7A 1Q7GA 2WDZA 3D4NA 8ADHA 4PLGA 1LJ8A 1DLJA 2ZYGA 4EEXA 1J4AA 5TSDA 3OIDA 4NK4A 4WCFB 5J23A 4IMRA 1T2EA 2WSBA 4CLOA 2FZEA 5IG2A 3GN1A 4DXHA 5JW6A 5HS6A 4OXNA 4CQLB 4YJHA 1TT5B 4CV0A 1GPDG 1M2WA 3BTUA 4GL4A 4QEDA 4F6LA 4Z0HO 4BNJA 3VDQA 3IMFA 2NNLD 1A4UA 4E2ZA 5COBA 4D3DA 3FPCA 3GT0A 3G0OA 2YZ7A 2GZ3A 3BHMA 3KZVA 3ULKA 4S3MA 4UUPA 4IUYA 4OL9A 4BVAA 2AHRA 4NFYA 1DIGA 1WVGA 5EINA 2PD6A 2O23A 3O9ZA 5U1PA 1ENYA 3GG2A 3R3SA 3N7UA 4HADA 2DTEA 1YBMA 1AN9A 2O3JA 4BKQA 4EBFA 3HG7A 1NQAO 1B8UA 1DLIA 3OEYA 2Q45A 4J0EA 4UVEA 1GR0A 4WPGA 4CL8A 1YB5A 3OJ0A 2VNSA 1FK8A 1SNYA 4RDHA 1EVYA 5AOVA 1K6IA 2CF6A 4IQ0A 5B1YA 2QRJA 1G0NA 4E0BA 3V2UA 5LDGA 4KUHA 3ZU5A 3U4CA 4BKPA 2I99A 2VUSA 1WZEA 2PH3A 3A4VA 4M86A 5G4KA 1ZEJA 2Y0DA 4XGKA 2VZ9A 5A06A 1N7HA 1EUCA 1QLHA 1WP4A 3ONDA 2A4KA 2GCGA 4YEDA 1H6DA 2NTNA 3BYZA 1EQUA 3NTOA 4QT0A 1WPQA 1I32A 1KC3A 3JQ7A 1QMGA 1YOVA 3FCOA 3MJ4A 3E82A 4IGFA 5EN4A 3PFWO 2EKLA 4AJ2A 3TOXA 1VL8A 1WDKA 1SOVA 1DIBA 2YHUA 1LDYA 1XG5A 3D5TA 5AYVA 3DAPA 1CWUA 4IDCA 4II3A 1QR6A 4CUZA 1P33A 1XU9A 1C1DB 5JMPA 2HQ1A 2AQHA 3WMXA 1M6WA 3AUUA 2PA3A 5EERA 5EPOA 4J4BA 2P91A 2GO1A 3DHYA 2X23A 4KQWA 2EP7A 4HV4A 4RPKA 3WS7A 3P2YA 4XYEA 3AFMA 1X1TA 1ZCJA 5T64A 2IYOA 2V7PA 5H81A 1MB4A 3C3XA 1JKJA 2CUKA 4D41A 4PLFA 4XKJA 4PCVA 3VZRA 2WEKA 3E1KA 3FSRA 1HF3A 3F47A 5IXYA 1F0YA 5A3JA 1A7AA 5BSFA 5MDHA 3S8MA 3AUSA 4R16A 3GEGA 1LLQA 1BG6A 1KC1A 2CY0A 2GZ2A 2QYSA 3F5QA 3GLQA 5DZSA 4U6QA 3VTZA 4DLBA 5B4UA 4BNIA 4Q3BA 4I5GA 1Y6JA 3IAHA 1ZK3A 3PDUA 3EW7A 4QX6A 2QZ9A 4YRBA 3GAFA 1K3TA 2A9FA 5K6AA 4WOJA 3JQAB 4J4HA 1MXHA 4R1TA 3ROPA 9LDTA 3TDKA 4R9SA 4NQZA 3L9XA 3LYLA 4H3VA 1ZIDA 2ET6A 2RIRA 3WBBA 2VZ8A 2OP0A 3IUSA 3RUEA 4RV9A 1HE3A 3ONEA 3V1TC 3UN1A 4D7AA 2NM0A 2I3GA 2X0IA 3KM0A 3FTPA 3L4SO 5L4NA 1N2SA 2V6GA 1AXEA 1H9BA 4E31A 4XCVA 5DT9A 3CMMA 3W4IA 1ZK0A 1PQPA 1KEVA 2PTGA 3LC2O 3FD8A 5LCXA 5TJ9A 1KEUA 1I36A 4C7KA 3WG9A 1W73A 3JQFA 4GLOA 4QTZA 1DC5A 3JQ9A 1T1SA 3QW2A 4XDZA 2GLXA 4XGIA 3U62A 1P0FA 2PKRA 3MJVA 3ZW9A 4QO7A 4DYDA 3RUIA 5HM8A 3AI1A 1Q2XA 1R4NA 2C54A 1PZHA 4J3FA 4UVGA 4KDEA 4RF3A 3TZQA 2AEMA 5ICSA 5G0UA 4BGIA 1R66A 1XLTA 3ZU3A 3HDQA 5L7WA 2B36A 5AXAA 1ZH8A 2DBVO 4WE3A 3BZUA 2GR9A 2AE1A 4A03A 2P4HX 4EUHA 5IDYA 1QXSA 1NBOA 1QORA 3AW9A 2J5QA 3GC6A 4CMKA 2OXIA 4XB1A 5BT9A 4GX5A 2IE0A 1E3JA 3MTGA 4PFJA 4BB5A 2Q1UA 2G5CA 1Y5RA 1BXGB 3CUKA 5BSEA 4RQUA 4WCFA 4R3WA 1R16A 1PL8A 1U1IA 4PG4A 1MGOA 2YHIA 2NV6A 5LC1A 4CQLA 1TT5A 1I5RA 1MFPA 2PZLA 2I6TA 4OQZA 4UUMA 4AFNA 1I3NA 2BFMA 4I5DA 4D42A 2O7SA 4OXYA 1MV8A 1YH3A 4HFMA 4FFOA 2E49A 5CPBA 3WYEA 4BNMA 5KVCA 1V3TA 2CZCA 4IZIA 3PLRA 1QSGA 2D2IA 4NBTA 5KJ6A 3R0IA 1U8XX 2DKNA 1PWXA 1Y81A 2O48X 5I8WA 3IL2A 4RLSA 2FPIA 4XWYA 1LQUA 4CMIB 4CODB 4QQRA 5IDXA 1QYXA 3C7CB 3CINA 3DZJA 1H6BA 4FSHA 3WGQA 2X7HA 1V6AA 3EYWA 3K96A 1HDRA 3BMCA 4TSKA 2VYND 5CFZA 4TVBA 2J6IA 3WGHA 3D1LA 4BNNA 4FFMA 2R6JA 4YJFA 1CEQA 4JQCA 3DXFA 1W0CA 1ZSVA 1HYGA 2QYTA 4ALNA 3FR7A 3CZMA 1BSVA 5T8KA 3SJ7A 4CLDA 4FGSA 5IZCA 1KVQA 1VJ1A 1IL0A 2PGLA 3CXRA 3RBXA 1KOLA 1C1DA 1IHYA 4J90A 3H3JA 3VZPA 3UGKA 5IZ4A 4E21A 3PQDA 2P68A 4W7IA 3INRA 1I3LA 4XD2A 3V5NA 4OAQA 3SEFA 1TI7A 1BMDA 3TZHA 1GQYA 1IOLA 2AW5A 3STHA 2WYWA 5AQ1A 3ZHBA 2DFDA 1PGQA 4W9NC 4XEHA 3TRIA 4DL9A 1H93A 1ZXBA 4CM7A 2ZIZA 1D1SA 1RWBA 3RD5A 1RJWA 1X7DA 4YDRA 1Q7BA 4BO7A 4J7CA 4QUKA 1U9JA 2P5UA 4CMJA 1LRLA 3DBRB 2IZ0A 1PGPA 4BO0A 1MXFA 5C3MA 5KJ1A 2B0JA 1LRKA 3ZH2A 4A5OA 1KBZA 1PWZA 1W4ZA 4BMVA 4DGSA 5FFFA 4M1QA 5JDIC 1WNTA 4OSPA 3SJUA 4I9UA 2JFGA 1PZEA 1A5ZA 4HWKA 4ILKA 4B7CA 3ADPA 4HFNA 1OBFO 3PIIA 3RVDA 5JNLA 2E37A 2H5LA 4FW8A 3WNQA 1N5DA 4MPDA 4EEZA 1ENOA 2PY6A 2X5OA 4XYLA 4OO3A 5KKCA 1I2ZA 2NU9A 1VLLA 3WDSA 3JQBA 3ZCXA 3I4FA 5A4DA 1NR1A 1MC4A 1X14A 2AEFA 3MJSA 3HE3A 4XDYA 3AOEA 4CQMB 1BXKA 4G81A 4FB5A 1K6XA 1RM0A 2HMUA 2E6UX 1G1AA 1G0OA 1UP6A 4O0LA 2Q4BA 2E4AA 4ZQFA 5F1KA 4J2HA 1E1NA 4YRDA 4LRSB 1SMKA 3DONA 4XQCA 5TQVA 1NAIA 4NR0A 2Y68A 4R51A 3JQDA 4G5HA 4CM9A 2YDXA 1K6JA 1ZUD1 2DM6A 4WNIA 3BA1A 1MC5A 5HBRA 3ZW8A 3PYLA 1PEDA 3C1TA 3IQDB 1GY8A 4J49A 5G0SA 2NLOA 5I7EA 1YQDA 4IJVA 2UYYA 1QYDA 4IJUA 1GQ2A 2ZYAA 1HZJA 4ND2A 3GGPA 4D0SA 2ZTUA 3WWYA 3DHNA 4BL5A 4E5KA 2Q46A 1R37A 3GPIA 3GR6A 1YRLA 2FMUA 3ZU4A 2NVWA 2R00C 4ND3A 3WTBA 4GX1A 1HXHA 1DAOA 2YFHA 3DBLA 4E4YA 5KJFA 3NJ8A 2JL1A 1X1EA 3LSYA 2PWZA 4MDHA 1E3WB 1CQJA 2I3AA 1U3WA 2HK7A 1BXGA 3ZNPA 4BOYA 2W2LA 2P2SA 2QW8A 2G17A 4P4LA 5GMOA 4CR6A 4D3FA 4BV9A 1BTOA 2HMTA 5BNIA 4BNXA 5FYDA 3W1VA 3ZN2A 1NTOA 1GYRA 2JJYA 1OI7A 4TQGA 3GMSA 1C1XB 5C7LO 1MUUA 3TZ6A 1NM5A 1QYVA 4BNLA 1LEHA 1BGVA 3GUYA 5EJ2A 5JDIA 5KCZA 3NT5A 5KWEA 5ER9A 4P22A 4B3HA 3NAQA 3ZNOA 4HXYA 1N1GA 5K9ZA 3TJRA 4P4NA 3FN4A 1UXJA 4BS9A 4E33A 2GNAA 3OMLA 5TGDA 4DPLA 1EE9A 4XRRA 3COSA 1MG5A 2EGGA 3RBVA 4NFSA 2B4QA 4XR4A 2JD2A 4AVYA 3Q11A 4D3SA 1LBEA 3E6AA 4HNHA 4N5MA 3WJAA 2C07A 3NT2A 4CLOB 4CMIA 4OJNA 3GOHA 2LDXA 3KEOA 1U7HA 3CPSA 2VHZA 4NNJA 2BLLA 3M6IA 5KIAA 1PJSA 4IXTA 3D4OA 3ETGA 3TQHA 4RVGA 3MEQA 2OO5A 2EV9A 3DBVO 2EHDA 3RFTA 2Y99A 4E5NA 4MP8A 3VKUA 3LZ6A 3NGLA 4DC0A 1UXIA 4J7UA 1VM6A 2BF7A 5KVVA 1PGJA 1QV6A 5JPIA 4UVDA 2NUAA 2BFAA 3HB4X 5F5LA 1EUZA 1PJ4A 4BKRA 1BDMA 2RH8A 3UW3A 1YO6A 1GV0A 3KTDA 1N7GA 5L40A 4MVJF 5G0VA 3F4LA 1U3UA 1ML3A 2Q1WA 4H7PA 2DFVA 2CSUA 3FTNA 1YBAA 5CEJA 5U4QA 3FWZA 3DOOA 4Q3CA 1ISJA 4KTVE 3C7DB 1M75A 5TF4A 3RUAA 3UICA 3ZNNA 3GRPA 3GN2A 4Y6RA 3KSZO 1DFGA 4JP3A 1GUFA 3RUHA 5FI3A 2PZKA 4OHUA 5CEFA 3QQPA 3D64A 4OOFA 5CG2A 1DPGA 3G79A 3I6IA 2JHFA 4H16A 2RBEA 1NVTA 1TVEA 4YJGA 4BGUA 5ITVA 2EG9A 3FBGA 3GDGA 3ORFA 4QFCA 2PKQO 1YL7A 3QRWA 5JCJA 4F6CA 2ZB7A 2X0JA 3GQVA 3I9KA 4PN3A 3VH1A 5IAAA 5JAZA 4IJWA 3GA0A 3QLJA 4CM6A 1A27A 1XELA 3K31A 4DPKA 2YY7A 1KIFA 1DHTA 3D7LA 3NT4A 1Z6ZA 1HKUA 4ALLA 4Z9YA 2EJVA 3PXXA 1FF9A 1U2GA 1E1LA 2IDZA 1TA4A 4J1NA 3V2HA 3WQRA 4II2A 2BFOA 3VC7A 4XYGA 1GTMA 4XIYA 3QVTA 4I8XA 1U28A 1GYPA 3DHEA 3O8QB 4ZVVA 1HE2A 3VPSA 3H8VA 2HMWA 3H2ZA 3G3EA 5ILOA 3HN7A 3SXPA 3ZU2A 1Q0LA 3R6DA 4ESOA 1DEHA 2Q1TA 1MX3A 3PHGA 5T5QA 4CQMA 1ZJYA 3DDNA 3PGJA 3NX4A 1P74A 1B3RA 1LDGA 2P4QA 1R6DA 2NVBA 4ZGWA 4WLUA 4LGVA 2HMSA 3PDJA 2NACA 3WMWA 3OP4A 1PX0A 5BQFA 2XOXA 3JV7A 3M2PA 4TRRA 4U0JA 4XX0A 3TN7A 2VRCD 4LMRA 2AMFA 2H9IA 1PJBA 1HDZA 1NR7A 5A3VA 4E32A 3ROQA 1UXHA 1MP0A 5G0TA 1O5IA 1B16A 3KYBA 3BMOB 4JLWA 3INTA 1DJQA 1EK5A 2HK9A 1CERA 1U5AA 2FR1A 3MWEB 4NIMA 4R5HA 1RM3A 1W6UA 1UDBA 4O63O 3U0BA 3WLFA 2HUNA 3GFBA 5L9AA 5L53A 2W2KA 3UVEA 1L7EA 5HA5A 4Q39A 1HRDA 3ZI0A 1QG6A 4U7WA 3VH2A 1ADCA 4ZQEA 1JW9B 1V0JA 4AL4A 3RUFA 5A1TA 2Q4EA 4AJKA 4B3JA 4NDNE 2D5CA 3G49A 1L7DA 3A14A 4OIMA 3ANLA 4BV8A 1LSSA 5TIIA 4L0QA 2FR0A 3OHSX 3ZWPA 3A06A 1I3MA 3GDOA 3I5MA 2ZCUA 1Y1PA 2PGDA 3OSUA 4I9HA 3CSDA 1TLTA 5G4LA 5KVQA 3W8FA 2O4CA 3LT0A 1CETA 4GH5A 1P1KA 1F8FA 3QA9A 1GD1O 1R4NB 4KZPA 1H2HA 5DOZA 4B4UA 2UUOA 5JAQA 1HL3A 3RC9A 5BR7A 3NKLA 3ZV6A 1Y7TA 1C1XA 2VT3A 3D5QA 1EVJA 4HP8A 4RZHA 3FNEA 2YQ4A 4UULA 3BHIA 1K0UA 4DREA 3VZSA 4LVUA 4Z6KA 4N7RA 4N5LA 4Q3AA 1SCUA 4J91A 4PVCA 3JQEA 1CIVA 3KEQA 4XZ3A 2AG5A 1HSOA 1E3IA 5TT1A 4BO3A 4D44A 1VC2A 4YBZA 3WNVA 4ALKA 3EZYA 4BNFA 1U2DA 4M89A 3JQGA 3PGXA 3PI7A 2DPGA 3HFGA 4HNGA 4NK5A 4YQYA 1P45A 3T7CA 3L07A 2YHIB 1HEUA 1LA2A 2D0IA 3PJDA 3WOHA 4K9DA 3I52A 1IPEA 1E3SA 1DSSG 2BD0A 3IUPA 4WNCA 4PG7A 4ZJUA 4YB8A 4FC7A 4U6SA 3T7EA 4R1NA 3VDRA 2J5RA 2CFCA 1BWSA 1T2DA 3LK7A 1O94A 1WLYA 4RCVA 4EUFA 2AEJA 3WGZA 5F21A 2J8ZA 2V6BA 5THQA 3WGGA 2IEDA 3DZIA 3QWFA 1HETA 4J1SA 1DAPA 3LT1A 4B4VA 4ND4A 2XPCA 4XIJA 3S2IA 2VQ3A 3VH4A 1JVSA 1SB9A 1WXDA 3ZWBA 1UZLA 5KVSA 3TF5A 3RFVA 2FZWA 2Y1FA 1DXYA 4FFNA 4ZRMA 4Z3KA 5DCUA 2NQTA 3PHJA 4XRGA 3RC7A 2X22A 3BMCB 1ZMOA 4IY1A 1DRUA 3GHYA 3SC4A 2BKAA 1J0XO 4OKIA 1XR3A 4YJFB 1R0SA 1LRJA 1Q7CA 3HB5X 3JYOA 4IDAA 3EVNA 3VHRA 4DWVA 4I5FA 4MIEA 3IOYA 4B8ZA 3WXBA 1KEPA 1GL3A 4UAGA 3ETEA 2GERA 3E5RA 2WE7A 3VKVA 3K8ZA 1EUDA 1AUPA 1TB4A 1FDUA 1U4SA 1JKFA 4KQXA 3K92A 3LVFO 5T67A 3I4CA 3HQ4O 3ENNA 1QYCA 4GVLA 3WQSB 3WJ7A 3M2TA 4JCOA 3D4PA 3UCEA 2EERA 1PIWA 2FRDA 1JWAB 1HYEA 3QIVA 5DF1A 3JCZA 3JD0A 4JGBA 3VZQA 3DZGA 4E6PA 1T2CA 4YTEA 1R15A 2HO5A 1C0LA 3DZBA 2C7VA 3TZCA 3O8QA 1LSOA 4L73A 1UUFA 1LLCA 2VTDA 3PYXA 2VYVD 3Q0EA 4HFJA 3A1NA 1ZMTA 3CTMA 4NJMB 4Q3DA 3RWBA 3R1IA 4LMPA 3OJOA 1E77A 2AQKA 3SVTA 1BVRA 1B3BA 1G6KA 3U9LA 4A0SA 4IZHA 4DBZA 4GKBA 4LRTB 4CM3A 1LLDA 2B4RO 5L4SA 4W7HA 1B7GO 1XCBA 1LC3A 4O6VA 3Q6IA 2DBZA 4WLNA 3DWFA 1ZK2A 2ZQYA 1J49A 1D1TA 3S55A 3ZV3A 4FQ8A 4PZEA 2BI8A 3TFQA 3DTYA 3OQBA 2O3UA 5IDWA 4FD3A 1FDSA 3BMOA 3PHIA 2Q99A 1CJCA 4J2OA 4NU5A 1N1EA 3SBOA 3MJEA 3E03A 4LVCA 1H6CA 2JCXA 3IJRA 2B35A 3Q3CA 1KERA 2QX7A 3FWNA 1YGYA 5HS4A 1ONNA 4RF4A 4P4GA 3PFFA 1X15A 5A04A 1GCOA 4M87A 2QRKA 1VL0A 2O2SA 2YYYA 5CPFA 1WMBA 5L95A 4FDAA 1J5PA 4LISA 4AJPA 4JNKA 2CVOA 2Y05A 2PR2A 3T4XA 1LXCA 2VUUA 4B79A 5HRUA 1VKOA 1WAMA 3H9QA 2V6MA 1NWCA 3MOGA 1PJ2A 2O7QA 1LDEA 3FNFA 3K2EA 3IP1A 4BNVA 4E2YA 2DUUA 1P1RA 1WW8A 2UV8A 1KVTA 1ONPA 3DZHA 1NHWA 3OM9A 3VPGA 2DBRA 1I30A 4XYMA 4PLTA 3ROMA 1YQGA 4BB6A 3ZZNA 1ADBA 2R2GA 1S6YA 3SLKA 5JY1A 1DDOA 2DTDA 2PFGA 4BNYA 4DRYA 2X9NA 6LDHA 3WSVA 2DVMA 3TZKA 2ZB4A 2P9CA 2A92A 4NJOA 1BRMA 5C5IA 3TFOA 1EEHA 3DBLB 4UEKA 5IN4A 2HJSA 5EL0A 2ILTA 2OZPA 2O3QA 1XGKA 4R41A 3FR8A 5JYDA 2C5EA 4FOOA 3Q1LA 3GG9A 3AUAA 4YT2A 2D1YA 3F3SA 3WR5A 4YQZA 5IFLA 3H2SA 2Y66A 4B3IA 1NP3A 2H6EA 5IF3A 1WDLA 1GDHA 4TVOA 2VNAA 1EFLA 3FHLA 2VZ0A 1PJQA 3M1LA 3E9QA 2F00A 5I7FA 1R4MB 4EUEA 1ZXLA 3MOIA 3V1YA 1A9YA 1P3DA 2AE2A 2QRLA 2VYNA 1XU7A 3OF2A 5GY7A 5L7TA 4JXKA 4LK3A 3HDJA 1KS9A 4RQTA 3UAGA 5G2OA 3L6DA 2OOSA 2X8LA 3LDHA 3ONFA 4Y67A 4AJNA 4YRAA 1A72A 4S1VA 5JFOA 5B37A 1DIAA 1HSZA 4WGGA 4YAEA 1Y5MA 2ZQZA 4TROA 5JS6A 4GX2A 2SCUA 5TRTA 5IXSA 1LDMA 4FFPA 3Q9UA 4R1UA 1LNQA 4FFLA 1DIRA 3U4HA 1ZFNA 2Y0EA 4IDBA 1N92A 5GZ1A 2EW2A 2WD8A 3AU8A 3MJCA 5CDTA 1EDZA 1ULUA 2PGJA 5BNTA 1RKXA 4R9RA 4NU6A 3AY6A 1E7QA 2HRZA 5BSGA 4YT4A 5LDHA 1GU7A 4YAIA 3KYCB 3F5SA 5A05A 4E2XA 3PK0A 2CDAA 5IN5A 3ZHYA 4NG5A 4CMBA 3VPXA 2DT5A 3BMNB 3L77A 2Y1CA 2OMEA 4ID9A 4RLHA 4Z9FA 3H7AA 1LUAA 3OIGA 4RJTA 3M1AA 1JDJA 4IXWA 4ZA2A 2ZB3A 1ZEMA 4JX8A 1BW9A 2G0TA 1GCUA 1ZJZA 4L4SA 3K73O 3PQFA 4J1QA 3AUTA 4E13A 4WCDA 5F1OA 2C2XA 4BHTA 4MVJG 4MVJD 1GV1A 1ULSA 3WX0A 2XAAA 4NJMA 4CL3A 3T4EA 5ENVA 4EYEA 1ZNQO 3FI9A 2OFPA 4JJIA 5BNFA 1KY4A 1IB6A 2GN6A 3K30A 4HUJA 4PG5A 4B7XA 2VUTA 5COAA 3DFZA 1Z73A 4WLFA 1ISFA 1KY5A 4U5QA 1PL7A 2H1SA 4YJGB 3I9MA 3GGGA 2OBYA 1OFGA 5COQA 3DBHA 5JY6A 3V1UA 4A2CA 2QHXA 3NDJA 3TNLA 3H5NA 3RUCA 2V65A 1YJQA 2VN8A 2EIHA 1U3TA 4GPD1 4RVSA 4CLXA 1ARZA 2UDPA 4BNZA 2BGKA 3NRCA 3QSGA 2G82A 3IP3A 5G0WA 3S2EA 1UXKA 2P5YA 3FPLA 3GVPA 3O26A 3ICPA 2WWRA 1X0XA 3P19A 4JIGA 4QSMA 3K2BA 5F1PA 5IDQA 4LSMA 3UUWA 4GWGA 4ZQBA 5DOVA 1E6EA 5A9TA 4GI2A 4J7XA 2C7GA 2JKVA 4DQUA 2I9PA 4YPOA 2GN9A 3JSAA 4BO2A 1UR5A 4GBJA 3E9MA 1YB1A 5TT0A 1YDWA 4EJMA 5I7VA 1U5CA 4ALIA 4PRKA 3H4VA 1CRWG 1IZ9A 1V3UA 3JQ8B 3PWSA 4TRMA 2YFQA 3H6KA 3WIDA 5ADHA 3ZWXA 3RU9A 1NPYA 1UAYA 4UVIA 3L6EA 2YV3A 1NXQA 3LC1O 3PZRA 5ES3A 4BNKA 5JXWA 4PLVA 2C82A 2HJRA 3IC5A 3LU1A 3CZRA 4KP7A 4DBVO 4A26A 1GEEA 1OAAA 3WYCA 1LLUA 2D8AA 3PRJA 5CDYA 4EJ6A 1F06A 2BELA 2VWGA 4BO5A 2JD0A 3C85A 2W2KB 1F17A 2AXQA 4WLEA 1JU9A 3W4KA 3JQAD 1PQWA 3H65A 1P1IA 3GEMA 1QLJA 2FP4A 4RDIA 5CEEA 1HT0A 1Z7BA 3W6UA 1WMAA 1N9GA 4RPGA 5C37A 2EF1A 4IBOA 1AE1A 3VOSA 3WWZA 1EQ2A 3F6YA 5L4LA 5CDUA 4FOSA 4UREA 4MP3A 3U3XA 4FJ0A 4BGVA 4W9NA 2EKPA 4BO4A 1GPJA 2VHYA 1EVIA 1E1KA 3AM3A 2JAPA 1LTHR 4CMAA 4BO9A 4QECA 4INAA 5TNXA 4B8WA 2IZ1A 2WYVA 4L8VA 1T4BA 4TRJA 1O6ZA 2FPGA 4ZN6A 1UZMA 3CH6A 2O4UX 2Y93A 5FWNA 1GQQA 1Z7EA 4KUEA 4XR9A 1JWBB 1IE3A 3PLNA 1HTBA 3I1JA 1I2CA 2EW8A 3P2OA 4PLWA 3QWIA 2LDBA 5DCWA 4J0FA 3IDSA 4MVJI 3MTJA 1S7CA 1R4MA 1M6HA 1Y9AA 2E48A 4CMEC 1VJTA 4D46A 5AXCA 5L51A 1YBVA 4EJ0A 1WDMA 2IODA 1D8AA 2FPPA 4GQAA 4TMFA 1DC3A 1YXMA 3H9EO 3MCVA 4M54A 1UDAA 1R12A 3ZWVA 1O9BA 3AK4A 2EJWA 5THKA 4FR5A 3JQGB 1EK6A 1UZNA 2XF8A 3QVXA 4TKMA 3QHAA 4OQYA 1FMCA 5A9RA 2ZB8A 3EZLA 4W4TA 6ADHA 4AJIA 2Z1MA 3I9LA 3K5PA 2P9EA 2VOJA 3PWKA 3QVWA 1AHIA 3PVZA 5DNAA 1I2BA 4DA9A 1CF2O 2RHRA 2POQX 4PVDA 3V2GA 1VI2A 3PQEA 3O38A 3DEYX 1PTJA 4BQRA 1UJMA 4J9UE 2QZZA 2XXBA 3UFXA 3OJFA 2YJZA 3KYCA 1UAGA 3BMNA 4DIBA 5C7OO 3Q9NA 4L4RA 1DHRA 2GGSA 2HKIA 4JBHA 4OXKA 2Q1SA 3RCBA 1VKNA 4YCAA 2QG4A 4LCEA 3HSKA 4A10A 1O89A 2R00A 1PR9A 1HDXA 2FN7A 4J1TA 1B2LA 3N58A 3F4BA 5AXDA 4ZQGA 4UUNA 2WD7B 1KEWA 4D79A 4J9VA 4MVJH 4HBGA 4GGPA 3RROA 4MINA 3B1FA 4WUVA 3CIFA 4HX5A 5EESA 3H5RA 3E5MA 5ENDA 4I1IA 3UH1A 4BKUA 5JAMA 4IDDA 2HRBA 3NUGA 4U0KA 3RKUA 5JDCC 1JKIA 3AY7A 3OH8A 2XXJA 3H9UA 3SX2A 3U4DA 2ZTLA 4BKOA 3DL2A 3OQ6A 2ZJ0A 3GY0A 2RCYA 1X13A 2B37A 2HU2A 4R4JA 4DMLA 1XDWA 2Z95A 4J4TA 4O59O 4EW6A 2JCVA 3GMDA 2QIOA 1NFRA 3B1KA 5L45A 3NGXA 2O2YA 3DMTC 3WICA 1XIVA 3EAGA 3OECA 1VSVA 1H9AA 4LSWA 1A4IA 1DC4A 3H3FA 1HE4A 2Q2WA 1P1HA 2VRCA 2Z1NA 4RF2A 3L4BC 1YDEA 3QWAA 2O3TA 4CLEA 1YJ8A 4CV3A 1PJ3A 3GH3A 4IJKA 1PL6A 2CF5A 1Y8RB 4K6CA 4CUJA 2CMDA 3ZWNA 3JQ8A 2V6FA 1KVSA 3JYQA 1E92A 3ADOA 4C4OA 1E7RA 5CG1A 4WLVA 4IDEA 3QWBA 3EUWA 1B26A 4WKGA 3X2FA 3RASA 3DQPA 1DRVA 3EY4A 4GSLA 5L7YA 1LQTA 1XQ6A 7ADHA 4GMFA 1E5LA 1B14A 1Y9EA 4BNHA 1P31A 1CYDA 3GK3A 2C20A 3EC7A 1E5QA 3KSDO 3Q2IA 3G17A 3F46A 4R68A 4YVFA 1U7TA 3UCFA 1E3LA 2A35A 2ZCVA 4MKRA 5DBGA 1QYWA 3KYDA 3GZNB 1AGNA 1SBYA 3DMYA 4DC1A 4DIOA 5F3RA 4I5EA 2J3KA 5KJCA 1HDOA 3R3JA 2IXBA 3ASUA 4CQMD 2X6TA 3QWHA 3Q2KA 4AICA 4CM8A 1M66A 4TWRA 1NWHA 2BHLA 1DFHA 4R5MA 1BVUA 3QV1A 2PH5A 4D0RA 2D5AA 1KETA 4UEOA 4IDGA 1GAEO 5IJZA 1U3VA 3PJGA 3AY3A 1EMDA 1T1RA 4IGEA 1BXZA 3PJEA 5B4VA 5HWSA 1ZVMA 1RM5A 3BTSA 4F3YA 4IQ8A 3WIEA 5JDCA 1GUZA 2NU8A 2DBQA 4RPHA 5AXBA 1PR3A 1P77A 3D3WB 4B4WA 1XYGA 2VWHA 3DB2A 1CQIA 5EQDA 4CM4B 5JC1A 1ENPA 1VJ0A 3DOJA 4CJXA 1NQ5A 1Q0QA 4MOWA 2YQ5A 3ZWMA 1PSDA 3QVSA 4LCJA 4Q9NA 4Y98A 3ZV4A 4ROSA 2RHCA 4M8SA 1EVZA 4R01A 2AQIA 4JROA 3RIHA 4RVFA 1XHLA 3KHUA 1V35A 3QVOA 5KTKA 3U49A 3S1LA 4NBUA 5JO9A 2D59A 2ZATA 1GZ4A 3GFGA 4ZU3A 2JFFA 4NMHA 4AJOA 3GGOA 3H9GA 1PJTA 9LDBA 1Y8QB 5GZ3A 3OETA 1PS8A 1YS4A 3QE3A 3W8DA 1EE2A 4MVJM 4TZKA 1PJCA 1M67A 1XKQA 1FDTA 1HZZA 3AJRA 2X4GA 1M76A 1TEHA 4W99A 1PZGA 1V9LA 2JCYA 5H83A 1BHSA 3RQSA 3A28A 2E82A 3AWDA 5A5EA 2FHSA 1R0LA 2GYYA 4IM7A 3FRJA 4NFHA 2FY8A 2J3IA 2HLPA 4WASA 3WGOA 3GVXA 4L75A 4XQGA 3VVCA 4FBGA 4GGOA 5K6AC 1DC6A 4OYRA 4Z9XA 4BIIA 2EXXA 4JJFA 4Z0PA 2B83A 2UAGA 3C8MA 1LC0A 4RO0A 3CE6A 4L4XA 1B8PA 1I10A 1ISIA 1GUYA 5I8ZA 4HY3A 2WD7A 4XQ9A 2VOEA 1IYZA 3HDHA 3NV9A 7MDHA 2GF2A 1SC6A 4AJEA 1T4DA 2VT2A 2VTEA 3W8EA 1NAHA 2CVZA 3NDRA 5KJEA 3O4RA 1ISHA 1EBUA 3RJ9A 2I76A 1RPNA 3DZFA 2NVUA 1PS9A 2C2YA 2VYVA 3PZBA 3FNGA 4GMGA 4Y8VA 2UVDA 1UH5A 2HAEA 3JQFC 4FGWA 1V8BA 3JQ9C 4BMNA 1SO8A 3OQ1A 4ZICA 4PZDA 4IPTA 1X0VA 4K26A 3RAJA 1BW9B 3OJEA 3UXYA 1MLDA 5CDSA 3QP9A 3ASVA 3I83A 1U4OA 5T57A 5ER6A 1VRWA 2YV2A 3K9QO 3KRTA 4W6ZA 2PZMA 4Y6PA 5JCXA 3EMKA 1JAXA 2DPHA 3RJ5A 3JYLA 2FR8A 2IEBA 4L74A 4Q3EA 2Y1GA 4B7UA 3ABIA 3JYNA 1DO8A 1Y8RA 4WLOA 5ITWA 4PLCA 4TRNA 4NBRA 2GSDA 1DFIA 3DBHB 1UP4A 5TS3A 4B4OA 1HYHA 2CDCA 3ZWYA 1MFZA 4YXFA 4DYVA 4WCFC 2ZJ1A 2YDYA 1IZ0A 1K5HA 2BI7A 1E6UA 1H0KA 1RYDA 5DBFA 1NFFA 1ID1A 1O8CA 1ISMA 1SEVA 2NTVA 4A73A 1YONA 2X9VA 4WEQA 3WLEA 4DMMA 3UOGA 2FWMX 3ZWWA 3PYMA 3ANNA 3GZNA 2EEZA 4YAKA 5EIOA 4J16A 2IXAA 4CM1A 4GKVA 5BSHA 1YL6A 2WMDA 1K89A 4WOKA 4CLHA 2JHGA 2B5WA 3K6JA 4BO8A 5TLSA 2VHVA 1TXGA 1HDYA 1VSUA 2Q50A 3AOGA 1YVEI 4PG6A 3LLVA 3OEWA 3I6QA 2D4AA 1LSJA 5DULA 1UXGA 3HN2A 2GDZA 3S2FA 3W4JA 3NEPX 3E18A 1DRWA 1E7SA 3I3OA 4YACA 4RZIA 3ICCA 3DAFA 5KOIA 4D43A 2YV1A 3SC6A 3GUCA 4FPXA 1MG0A 4RVDA 2B4TO 1PZFA 2B69A 3HZZA 1PGOA 4LW8A 4MVJE 4BNUA 1YB4A 2C29D 4J43A 3D3WA 4FS3A 4ND5A 2WM3A 4CM4A 4MIYA 4CPDA 2OL4A 4N18A 1PGNA 1N9GB 2DQ4A 5A9SB 5TX7A 5JAIA 5T8KC 3TOZA 3VH3A 1HE5A 5IZCC 3OBBA 1D3AA 3AI3A 4FN4A 1KYQA 3LC7O 4G2NA 4K28A 4A7PA 1ZO8A 2NSDA 2BGLA 3OA0A 3DAGA 3VAZA 2J3HA 4H15A 3ITKA 3KV3O 4GX0A 2O3RA 1ADFA 1O95A 4YAGA 3TL3A 1D4FA 4R3NA 3WTCA 1Y8QA 5JSFA 8LDHA 3PIDA 1ZK1A 2G1UA 5AVOA 1UDCA 4DQVA 2DLDA 3ANMA 1KVUA 5GZ6A 2X1HA 5EMHA 4YT5A 4ALJA 3FBTA 4IS3A 1VE9A 3VTFA 2HK8A 3RC2A 4Q3NA 1C3VA 1JAYA 1NHGA 2I67A 4NHEA 3DFUA 3WGIA 3AU9A 4PGFA 3HHPA 1NQOA 2FSVA 3WGTA 2JFHA 4EI2A 2CD9A 4W82A 1AXGA 5JE8A 4XJSA 2UUPA 2NTJA 3CKYA 1LX6A 4QO8A 3BMQB 4M55A 3D0OA 1XQ1A 1RM4A 1EBFA 1T2FA 3TSCA 3BTVA 1F8GA 1E7YA 3UKOA 4CM5A 1DOHA 2C0CA 4OMUA 4FFRA 4JP2A 3JQBC 1P44A 1MA0A 3KLMX 1C14A 1LSUA 5JYEA 3RI3A 2X0RA 3AOEC 2YW9A 1GEGA 2GASA 5JC8A 2WYUA 4KDFA 4IIUA 4IQGA 4BMSA 1GZ3A 4MVJA 4XYBA 3WBFA 3JD4A 5H82A 5FI5A 4GWKA 1ISGA 1H94A 2W90A 2GD1O 2TMGA 1O0SA 3DR3A 3IKTA 2BFPA 2PZJA 4DTIA 3RU7A 1L1FA 2DU8A 3EK2A 2PLAA 4WECA 1FXSA 2NQ8A 5FF9A 4IMPA 5B12A 4WEOA 4EZBA 3VPHA 3D3EA 5CP8A 4RF5A 4OM8A 2OHXA 2OP1A 4XJTA 2WTBA 3BIOA 1ZK4A 3G1UA 2Y67A 4R69A 4FJ1A 3ZHXA 4Y9DA 3WGYA 1AHHA 4ND1A 4PZCA 1I8TA 3GVIA 2HSDA 3JYPA 1I0ZA 4C7JA 2W4QA 3FNHA 1SEPA 3WB9A 1RYEA 1HLPA 4DVJA 1FDVA 2X0NA 4E5YA 4GVXA 5EQFA 3RSHA 1QKIA 2EWMA 2H63A 3AM4A 4E12A 3MJTA 3JQCA 4OKNA 1HDCA 1ZSNA 3NTQA 2CDBA 5B4TA 3MWDB 1A71A 1PQUA 5A5FA 3E48A 1HLDA 4M49A 1IPFA 4KUGA 3PP8A 1ENZA 4JK3A 1T25A 1Z75A 2X86A 1ZBQA 1HWYA 1OC4A 2ZTMA 3KLPX 1NVMB 2VHXA 2HDHA 3P5SA 1NPDA 3VPFA 1T26A 1QP8A 3EGOA 4FIZA 4RVUA 4RL6A 5JLAA 4NPCA 3TWOA 3PTZA 4BNTA 3F1KA 1P9LA 2PV7A 5L3ZA 3JQAA 2Z5LA 2IZZA 5I7SA 3GVHA 5I9MA 3LLSA 1I24A 4XGNA 3ZWAA 2CVQA 1I01A 2Y0CA 4RVHA 4DIFA 5I9NA 3GRKA 1JVBA 2B5VA 3I9JA 4IIVA 3HJAA 3MZ0A 1OOEA 3IJPA 1IY8A 1I33A 2O50A 3IIEA 1XA0A 3UF0A 3ZHZA 3OJLA 4E2WA 5FEUA 4HFRA 2PKQP 3I9NA 4ITUA 4OSOA 4BUCA 1IULA 3GVCA 2X9GA 1GFSA 3KXDA 1SOWA 3CMCO 4AJJA 1X7HA 4FC6A 1CDOA 2Y1DA 4NI5A 4AG3A 4BO6A 1NFQA 1B15A 2BH9A 3O03A 5DDIP 1ZSYA 1Q1NA 1P0CA 1E0DA 4DPMA 3KYDB 4KTTE 2FSSA 4E3ZA 3B6ZA 5CDGA 2F1KA 5A9SA 3CEAA 3KBOA 3JD3A 3VVBA 3KVOA 3I9OA 4MP6A 2X58A 1HDGO 3L0DA 4RORA 1WZIA 2YUTA 1JQBA 5I9LA 1E7MA 4CM8B 1DIHA 4D45A 1VL6A 2BMAA 4MJLA 2D3TA 3F1LA 4YR9A 2GUGA 4P8RA 3KOUA 2J3JA 4UVHA 3PHLA 3BHJA 1IHXA 4JN6B 2BRUA 4Z0TA 4PLHA 4XA8A 4MIOA 1FJHA 1E1MA 1ZW1A 2IRWA 3LT2A 1E3EA 4XB2A 1T2AA 1Z74A 3LQFA 4CM9D 2Q2VA 3WFJA 3C7AA 3UCXA 4R1SA 4GAEA 2W8ZA 3TPCA 1D7OA 1J6UA 2BGMA 3U09A 4URFA 4A27A 1C0IA 2Q49A 1ZZEA 2JD1A 2OGUA 1NX6A 2C5AA 4K1LA 1T24A 2Y1EA 4O1MA 1UP7A 5K0ZA 2I66A 5JBIA 3N74A 2DTXA 3EVTA 3WFIA 1YWGO 3E9NA 3X2EA 3ST7A 2RH4A 2AQ8A 3RBZA 2G76A 3GEDA 1Z82A 1OC2A 3BMQA 4KOAA 3TL2A 1F14A 1NASA 4UEJA 2W2LD 4WK6A 3L9WA 3W6ZA 4NZ9A 3AI2A 4CLRB 3OA2A 3KSUA 4BGEA 4CV1A 5C7IO 4YA6A 3GNSA 1YL5A 5T6BA 3OFSA 2AA3A 4FCCA 5DBIA 3C1OA 3PPIA 3WSWA 4BNGA 4G65A 2DAPA 2OORA 4F45A 2TMDA 3BXXA 4CR8A 4EDFA 4NBVA 3ETDA 1DJNA 4YJHB 2GPTA 3IS3A 2Q3EA 2A94A 2WE8A 1YQXA 3DOCA 4CMCA 1GZ6A 1XSEA 5DN9A 2NWQA 5HTOA 1X7GA 1ONOA 1XEAA 1K2WA 1I3KA 1H6AA 3GAZA 4Z3DA 4AJLA 3RFXA 4R54A 2GN4A 4Y6SA 4X54A 3AM5A 5JO0A 4MKZA 4CUKA 3ZWOA 2IYPA 4XQEA 4FJ2A 3P7MA 5KNLA 4HKTA 4F46A 4MKXA 3RUDA 1DB3A 2QQ5A 1JLLA 4OGWA 1VPDA 2PD3A 1OZAA 5A03A 1EFKA 2VWQA 2J5KA 3ROKA 4JBGA 3RC1A 4DUPA 4CMHA 1BDBA 1NNUA 1JA9A 1PS0A 3E8XA 3H9JA 5DP2A 4YT8A 3LF2A 2I5PO 4J6FA 3ZNQA 3ZV5A 3FF4A 3U5TA 4YAJA 5G4KB 2NVUB 4RPJA 3HUDA 4OH1A 2PNFA 1SB8A 3GPDG 3H5AA 1SPXA 1IUKA 1H5QA 5MGBA 1ORRA 1PU2A 3C24A 4PG8A 3JQ7B 3NTRA 1YOVB 5ILGA 1DBVO 2OUIA 4I9NA 4QXMA 3PHHA 2EP5A 3HNPA 3ON5A 4CMEA 1H2BA 1Z45A 4PIVA 1E6WA 3BTOA 3EHEA 3DBRA 3NDIA 1A9ZA 3PEFA 2VHWA 4JJGA 3PJFA 3QY9A 3GNTA 3JQ6A 2VWPA 3DO5A 3HADA 3IKVA 4YYZA 1EZ4A 4ZHSA 2ZKLA 1NQTA 1XWFA 4KMSA 3DC2A 2X5KO 5TJHA 3UHAA 4DQXA 4NBWA 4RGBA 1P1JA 4PRLA 2EGHA 3ZDFA 1FDWA 3WQQA 3INGA 3NJ4A 4PLPA 4ALMA 1B0AA 3U4IA 1NVGA 2AG8A 4U8GA 4CR7A 1SAYA 2WJPA 4ZRNA 4BO1A 4I08A 2C59A 3F9IA 3ENKA 5KKAA 1P1FA 1F12A 4N54A 5JCJD 4ZQHA 1ADGA 1LDBA 3JD1A 1Q0HA 2ZYDA 3B1JA 3BAZA 4YJDA 5CAEA 3KO8A 1YE3A 2I65A 5CHEA 2W98A 1W8DA 3G1TA 1JN0A 4CV2A 3LT4A 3V8BA 4GSKA 4L76A 2NU6A 1A7KA 1JTVA 4AJ1A 3ITDA 4IS2A 4UUOA 1KVRA 2OBNA 2VRBA 2ZK7A 3JD2A 4WJZA 2VCYA 4E5MA 2HCTA 1QRRA 4N5NA 5TC4A 3ZWCA 4E30A 3LF1A 2EKQA 2DC1A 3AFNA 3KB6A 3QJ5A 1LU9A 1YKFA 2O3SA 5ICMA 1GADO 5F5NA 4MVJP 2NU7A 4L9RA 1PJLA 4DLAA 3GNQA 3PWZA 4O5OA 3S2GA 3B70A 1EDOA 2JAHA 2GN8A 4IINA 3DZKA 2X5JO 4TKLA 4ONEA 3ZGYA 2HMVA 2CNBA 3L6OO 3GZ4A 1E7WA 1NPTO 3I23A 4DLLA 3HDYA 3OIFA 2Q2QA 4PLYA 4MO2A 2PD4A 3DTTA 3KUXA 1R0KA 5DP1A 4KWHA 1LDNA 4PLZA 2RAFA 4QFDA 4TZTA 1E3WA 5U9CA 5DCYA 1ZKMA 2ZTVA 3NYWA 3EDMA 4BQPA 4JBIA 3OICA 1U8FO 4OOEA 1TT7A 3HFSA 4LN1A 4RPLA 3DMTA 3GHHA 2P9GA 2NADA 4CMGA 3HWRA 4EGFA 4BNWA 1GYQA 3JTMA 4EITA 4E5PA 4AJ4A
chains in the Genus database with same CATH superfamily
3Q3JB 3SIWA 3N70A 4BBAA 2VP3A 1VP3A 1WWKA 4HLNA 4BYGA 4YRIA 2A9RA 1G2PA 2HLNA 1GNSA 2X4IA 2AI3A 2X3FA 4KWIA 1AF4A 4JLBA 2FRDC 4L3OA 3HDTA 3N2NA 3RR2A 3RRFA 3KETA 1N8KA 1CY4A 3GF4A 2FOIA 2EHJA 3C1AA 3CSUA 2DUWA 7ABPA 2GZ1A 2NYRA 4N41A 4GLLA 1ZNXA 4CLRA 4M6WB 1WZNA 1C0PA 3VSAA 3V46A 1ABFA 2PUFA 4K6FA 1QV7A 1TMOA 1Q7GA 1X7XB 2WDZA 4P3OA 4DIMA 1OXTA 2V0CA 1AMNA 1GN8A 5KYUA 3O73A 4A82A 5LJIA 4TZ6A 3NIGB 4Y1GA 1J4AA 4NYMQ 5BNZA 4DNQA 5HQTA 4HWOA 2CVHA 1LWNA 3NM5A 3I4LA 4O08A 2LTAA 3N5CA 2CYBA 1T5LA 4CLOA 5BSWA 3K4HA 3GN1A 5IBQA 1E66A 4CV0A 4CKYA 3P4XA 1VB3A 3QKWA 4F1JA 3OM8A 3ZTYA 1JSCA 5C8DA 3UJCA 4AK9A 3VDQA 1KQOA 5COBA 2Z30A 3LT5A 4V1CB 2R85A 3FPCA 3CUYA 1VYHA 3BHMA 3G0OA 4KQCA 4I1PA 4XD7A 1XTSA 3JATB 4OL9A 4KR3A 3L8MA 3M4JA 5EINA 2PD6A 1XALA 3I42A 2O23A 3O9ZA 1Y6ZA 1ENYA 1QVVA 5H3LA 3R3SA 4NS4A 2VO1A 1OXSC 1UJ5A 2DTEA 4GP6A 2C2HA 1ADYA 2HB6A 2TECE 2O3JA 3GEBA 3I45A 4BKQA 3T1YB 5H8WA 1L4GA 4JJKA 2I9KA 3WBKA 4J0EA 3L7NA 1XPJA 4CL8A 4EI8A 2OM6A 4AMZA 1ACLA 3ORQA 2H2WA 2PL1A 2ZBVA 4NCHA 4DCUA 2FX3A 2V0GA 4JL8A 1KL7A 3MC1A 4XFKA 1P7PA 1K6IA 5AOVA 4C4TA 4D8TA 2FPIB 2D5LA 2O0LA 2BH2A 1RMTA 1XNRB 1IXKA 5FH9A 3CKMA 3W78A 3ZU5A 4BKPA 1U7DA 2I99A 2P9JA 1UJCA 3ADBA 1C0EA 2IP2A 4KWEA 4QUIA 1FNNA 4YI5A 1PFWA 1SC3A 1T3ZA 2A4KA 4BP3A 3W04A 3BYZA 3A4NA 4L6IA 5ALJA 4QT0A 3K1JA 3PBKA 4AULA 1I32A 1CQPA 2QI9F 3AHCA 4B74A 5LXTA 3FCOA 3H5LA 3E7XA 2AL7A 3GLKA 1KZHA 4KH1A 3SK0A 4HLUC 2WJGA 3PFWO 1M1XB 2EKLA 3H9CA 4RZ3A 3ZY2A 2XJ9A 4S35A 1UPAA 2C77A 5FL7A 2QRZA 4WT7A 1DIBA 3D1JA 2WBLC 1LDYA 2ZITA 3D5TA 4GW3A 5LNK1 1GLNA 1FYXA 3PX2A 4IDCA 4Y1EA 5JPDA 1YR1A 1QR6A 1T8TA 1P33A 1XU9A 1C1DB 5JMPA 3NVKI 2C95A 4F4FA 4JBXA 4JLOA 2CNKA 3HU1A 1XMJA 4HYYA 5CNMA 2DSTA 1WZUA 2ZEJA 3HXKA 3IKLA 3DHYA 2H3EA 3RRZA 4YRMA 1T15A 3MERA 4DA8A 1WCIB 3MIIA 5EJ8A 3TINA 2FGKA 4RPKA 1Z28A 4U63A 2DR0A 2LIPA 3CCFA 4EUSA 2XZOA 1F7VA 1H4TA 1ZLYA 2JIRA 3PGVA 1P5ZB 4DIUA 1PFGA 4EPYA 4L15A 4JOCA 1RS0A 1XRMA 1CJMA 2IHUA 3GI1A 3RT7A 5LZ9A 1B8OA 3X0DA 2IYOA 4TN5A 4FEYA 5H81A 3PLAE 1Z8DA 4GM4A 1Z0SA 2CCGA 4PCVA 4LC9A 3FSRA 4L28A 1KYWA 3QX7A 4AMYA 3G0HA 3VJLA 2V98A 5F4BA 1F0YA 4CFSA 1C2TA 1S2OA 2PKYX 4BZXA 5BSFA 3B2NA 3KUCA 2GHRA 3IT2A 3R7AA 7REQA 4TTVA 1M8GA 1R5BA 1XKXA 3F6RA 5CK4A 4KSYA 3RSZA 1UT6A 3UMVA 9ATCA 2H2DA 5K0NA 1NT2A 2QYSA 5B4UA 2W2PA 1E1CB 4BNIA 1K8RA 3HZOA 5T4BA 2GILA 3IAHA 5KPDA 4G84A 2X8BA 4M7WA 4LMAA 1Q1ZA 2GAIA 3KP1A 4JA2A 3EISA 3T1OA 2IOQA 2VDPB 4C0SA 3EW7A 2JH8A 1O9HA 1WETA 13PKA 2NUPA 3FB4A 3FCUB 3H16A 3V8VA 1OVMA 1PKEA 4WOJA 2E0IA 2XMCA 1MXHA 3A1FA 1XP8A 4J4HA 4JLSA 1CZLA 2JBHA 4UFNA 3K1AB 4K2AA 4R9SA 3H17A 4H3VA 2XOKD 1ZIDA 2ET6A 2RIRA 3WBBA 4TKZA 3BD6A 1N8NA 3RUEA 4YQEA 4C78A 2V97A 2AK2A 3ONEA 4GU5A 4P4UA 4LE1A 2NM0A 2BFNA 4FWIB 1NJFA 1UMCB 3B85A 1T9GR 4CWAA 4LXYA 4UE6A 1N6OA 5K05A 1ODKA 3H6GA 4HZGA 5EEHA 3JZFA 3DQQA 4PAMA 2GBLA 4J94A 4E31A 4YT4A 3BILA 1WA5A 2XD4A 5IMBA 3HKEA 2VRNA 3HMQA 1ZK0A 4IICA 4RHFA 4MCIA 2PTGA 5DLEA 3FD8A 4RENA 1W88A 3BFKA 4O4IF 3UK6A 3B5EA 4HTAA 3WG9A 1R1DA 5BN3B 1RBYA 5EG5A 2OVBA 3LGXA 5ENZA 4MS4B 5CR9A 3ZW9A 4LZPA 1O1YA 5DHRA 3RUIA 3FOAA 5HM8A 4K8RB 5FBRB 3GFVA 3PX7A 2FWBA 3CUEF 3QPCA 2JFPA 1Q2XA 1PZHA 4B75A 3NEAA 5C31A 4KEAA 4KAXA 4HEA6 3ZV7A 4BLOA 3TW8A 4LZOA 2P7IA 4ZV9A 1XLTA 4C6HA 3HDQA 1ZH8A 2I71A 5JG7A 1LKZA 4WE3A 1EINA 3V7NA 3SMVA 3UMBA 2GR9A 1J8FA 4YUWA 3N53A 1FBTA 3CXUA 2AE1A 1ZWLA 1WSBA 2ZYHA 3MTEA 4HRXA 4EUHA 1QXSA 1FUIA 1RZ3A 3AW9A 1VYUA 3FZGA 3NM6B 4WGFA 1EX9A 2HA5A 4OCZA 4NCAA 1GCGA 3ZHSA 4Z8XA 2VQEB 1JEQB 1MT0A 1NRJB 1TU3A 2VATA 2DJIA 5IJWA 3F7MA 1COWD 1Y3AA 2J45A 3D2CA 2QAIA 4NYIR 4HR7A 3CUKA 3RS3A 1EK0A 5JAUA 4EQ6A 3QUQA 4A6DA 1Q1GA 3FDJA 3GIWA 1R16A 1Z7WA 1EVLA 4R3WA 4MJXA 1U0SY 4MK4A 3JVIA 4Q3LA 3W5UA 4MW1A 4RGYA 1G3RA 2QU7A 5T4EA 3VX3A 5AVVA 2XA1A 1L4NA 3IMKA 1KDZA 4CTJA 3HU5A 1J8VA 2NV6A 5AM1A 2PBLA 1TT5A 5C4IA 4MCJA 1I5RA 1CUDA 3USCS 4UTVA 1CZNA 2DHEA 2P41A 3C41J 4IW3B 4REMA 5WRFA 5MHTA 1PZXA 1UC5B 2WJJA 4OXYA 1SQ0A 1FUKA 1MV8A 3N7AA 2VJAA 5B3LA 2XCIA 4GM1A 2IS6A 2UXDB 1JHZA 3LY7A 2NZ2A 2E49A 2XQIA 1VMEA 1GL7A 3BSSA 5CPBA 1JG1A 1MC8A 3EPHA 5KVCA 1TO6A 3H1EA 1WHTB 5EKSA 2VBIA 5CFQA 2UUAB 3LPCA 1I13A 1TRKA 3AVQA 4LECA 5C1IA 2OCBA 5KJ6A 3BE8A 2FEPA 3BGOS 4PCLA 4Q7LA 3SEZA 1KJYA 4R2XA 4EPWA 2JFZA 1Z0AA 2AJCA 4PPYA 1OH6A 1M73E 1MIOB 4JJ8A 4MGYR 1IY2A 2ZULA 3EGVA 3N87A 4LKRA 5BMVB 4I81A 4ECAA 3X1YA 2HH9A 4QQRA 4BB0A 1DKUA 1QYXA 3AFGA 3SGLA 4A23A 3GFFA 4FBMA 1Y8CA 4EHAA 4Q4CA 1JHPA 1GLVA 3WGQA 1ZD1A 4U9HS 2OGTA 5I7HA 2BR3A 3K96A 4P84A 4UARA 3HKDB 1EDBA 1BEEA 2VYND 3MAGA 4TSKA 2G0NA 2HEGA 2O8BB 1UADA 1ZA1A 1AGYA 3LC0A 4FTWA 2PGIA 5BVGA 5EFZA 4ZEVA 5EKTA 3G1WA 4MW0A 4JQCA 1RZRD 2IU4A 2W00A 3B6MA 1ZSVA 1TZ2A 5E1MA 3PC6A 3I64A 1A96A 4Q12A 1RI2A 5DM1A 1UKEA 3SDBA 1UM9A 1SXGA 3KEGA 3M4YA 1E89A 4FGSA 1PUIA 2VP6A 1XXHA 4CGYA 3U7GA 1VJ1A 1IL0A 2PGLA 2ORIA 1A95A 4WA8A 2CXNA 4DKJA 3MCTA 1EJ0A 4JJ7A 4E21A 4KHPB 1X87A 3FWPA 2QMOA 2OQRA 4FQ5A 4U02A 4C2TA 3EH1A 4AN4A 4MR8A 1MVLA 2XE8A 2Y92A 5IVHA 5CCDA 3STHA 2AV6A 4P7FA 2JIBA 2DFDA 1PGQA 2BCGY 2L17A 3LGSA 4FR0A 1SQ6A 4W9NC 2DHRA 4B6OA 1KEEA 3PTLA 3R0VA 3ETHA 3OU2A 4QQKA 4ZZ3A 2JIZD 3QVJA 3RK1A 3THOA 4TZ0A 4DL9A 1P7ZA 1O58A 2VPPA 1CDEA 1MVNA 2W2XA 1V5IA 1I4WA 2HREA 2YVKA 2OR3A 3MS2A 4IXNA 4LE2A 4RZXA 4YGYA 4OHRA 2DEUA 2KM1A 1WS6A 1PR2A 2G09A 4J7CA 2G1JA 1GPKA 2JI4A 3DBRB 2XT6A 1N8TA 3ILXA 1SQSA 1M54A 2JEZA 1BO6A 5C3MA 1RAGA 3FYUA 3DDHA 1KBZA 2PMFA 4KPUB 4A5OA 4BMVA 5FFFA 3M5WA 4HDNB 4H3HB 5CB8A 3C3JA 3KZCA 4UXJA 3ITEA 4KR6A 2QL5A 4ZDKA 5CIYA 4H6VA 3EMVA 5C8YF 5KTSA 1J0DA 1QBKC 4HQ0A 3BXPA 1QC5A 4ILKA 4KQHA 4HFNA 3QU5A 4LJ6A 2CB9A 1OBFO 1RXEA 3DEIA 4H3KB 4FW8A 1YRHA 1N5DA 4ZJZA 1OAOC 3FYDA 4MPDA 1Q7TA 2JEYA 3KD2A 4EEZA 2PY6A 1LBHA 4U2BA 3Q10A 4L8FA 1I2ZA 5A62A 1XTVA 3JQBA 4DUZB 1XEXA 4TV9A 4AWXA 4JSRA 1NR1A 4P4SA 3TNYA 1AG9A 1RDFA 3EEIA 3HE3A 3VO2A 4MA5A 1TD9A 3A31A 1YQ9A 1NI3A 1ZONA 3H3XA 4JLNA 4A3SA 1K6XA 4J07A 1H1LB 1BJKA 1G0OA 1G1AA 2Y2UA 3OTIA 4ER6A 5EMMA 2ZIXB 5F1KA 4G4JA 3DM5A 2XCLA 2PUJA 4IHQA 1DAMA 4JA0A 4M0CA 3L4EA 3ZDBA 1W0JD 5K8UA 4F6RB 3HABA 1NONA 1SMKA 2PUHA 3DONA 4QYXA 3RBAA 4XQCA 5TQVA 2QWXA 4PX9A 1CY1A 4UM7A 3T3DA 2DB3A 2Y68A 3JQDA 4G5HA 2AHOA 1K6JA 3L8DA 1PVDA 2E21A 4XPIB 1WUHS 3PYLA 4DG5A 4J49A 3O8DA 4RMGA 5AM5A 4TVSA 1QFXA 2VBGA 3DUFA 1K4YA 5GOZA 4YJ3F 2CBZA 4YCNA 1GQ2A 3SNKA 3BDIA 4EL5A 1X7ZB 4XWGA 3SJBA 1EJ2A 1HLFA 2WR8A 2XY4A 2ZTUA 2GD2A 2OD9A 2Q46A 4GHWA 4YLGA 3VISA 4D57A 4MIKA 2W0SA 3RJZA 6PFKA 4YAFA 3CBQA 3PGA1 3ROZA 1R6TA 3WLMA 3KFVA 4CI0B 1LGYA 5P8WA 4HO1X 4J1TC 3WTBA 4GX1A 1HXHA 3BT7A 1DAOA 1Y4SA 1QG0A 3KXLA 4ZOCA 4GXRA 2RC5A 1E1RA 3W5AA 5KOYA 2Y9MB 5G3YA 1JHYA 4ZOLF 1NE2A 4EHFA 4PZUA 4ZOQI 2KYRA 1GTG1 2I3AA 1U3WA 3NG1A 3EGDB 4FFDA 2YASA 1BQ4A 3OD5A 3FETA 2H2IA 3PA6A 1WSDA 4PINA 2P2SA 4L51A 3A6EA 2WMNB 4IGAA 1J0AA 4P4LA 4RKEA 5GMOA 1L7XA 1O2DA 4CR6A 5B2ZA 4D3FA 2OLKA 1BTOA 3NHAA 3LW8A 5ALLA 4J3JA 5A4FS 2PZBA 4BNXA 3H1PA 5DLPA 1OI7A 1U11A 4REQB 4TQGA 1C1XB 3ISVA 4WOPA 5AVUA 2H7CA 5F1YA 3WLKX 4QTTB 2ZRKA 2WVGA 3D4LA 3MUOA 2H1FA 3IUYA 3LAWA 3QBJA 3ECSA 4YBRA 3QKUA 1S1CA 4B3HA 1ODCA 3NAQA 2C4MA 4PAGA 1SVIA 1N5OX 5JNSA 2ZYWX 3KHSA 4HEHA 4PO3X 1KHHA 4P4NA 4BS9A 5FJJA 1QOQB 2O8FA 1HMYA 1BQEA 2BM0A 2R66A 4MPJA 5TGDA 4DPLA 5JXJA 1YR3A 3OE4A 4G4SP 3G5AA 3QKRB 3S1SA 2B4QA 3FZEA 4G37A 5AHOA 4D4IA 3Q11A 5B1DA 3NHRA 4WACA 4ZANA 4HNHA 1M8FA 2CNWD 3NT2A 4CLOB 4QXRA 3KQSA 1E1DA 5CT5A 1U7HA 4KAAA 4M0LA 1QWOA 3LI2A 5IJ9B 3PPXA 3V7WA 3LPDA 3CLHA 5K0FA 1PJSA 1QGED 1TVKB 3ETGA 4IXTA 2J30A 3TRJA 1HORA 1CJUC 1HA3A 1P9RA 1TKRA 4G8BA 2EV9A 2GLTA 3OO0A 2O14A 3FNQA 1GNVA 1F4LA 2EHDA 2IZ7A 5HVNA 3Q9SA 4QXQA 1ZGCA 4U2DA 5KWSA 1UXIA 4J7UA 4MCAA 5DLDA 5TMPA 3GOQA 1EX1A 1PGJA 2VNJA 4B6QA 4WCVA 3VFDA 3RS0A 4B6RA 1DTSA 4D4HA 5JPIA 2WZDA 4BNDB 3QFRA 3KR9A 3VRHA 3HY6A 4BKRA 4DQ0A 3MWLA 3T7DA 3U7RA 1EIZA 3KTDA 3FIJA 5L40A 1A77A 5G0VA 3D2BA 3F4LA 4HMOA 1U3UA 5KAMA 2NUBA 4S0ZA 3HCOA 1GGMA 2EATA 3HCCA 4W63A 5IANA 3HTXA 2CSUA 3FTNA 4OGGA 2FSIA 3F2VA 4RFSB 1IEVA 2HLDA 1T3HA 2VUIB 3DOOA 1ISJA 1OFIA 3C7DB 3EZ6A 1RXUA 3RUAA 3GUZA 3QEMB 2ZUSA 3RREA 1RBQA 1F2UB 2ZSUA 3GN2A 3OTGA 5J4LA 5CLIA 1DFGA 4JDPA 2GNOA 4YRPA 2RONA 1SELA 3OAAA 5DJ5A 4M1KA 4DILA 4N0QA 5T4FA 3QQPA 1FXWA 2Q3HA 3OCYA 3FDZB 4G1FA 3I6IA 1QCYA 5CB4A 2D8MA 2H59A 1TVEA 3FWYA 3H99A 5EWJA 4BGUA 4DMHA 2NSHA 2PKQO 3BMXA 2GKOA 5JCJA 3SE0A 1T4MA 4KQ1A 4A16A 4H7KA 2Z3WA 3ONNA 2CL6X 2H7VA 2R68A 3F5MA 4HVAA 4PFSA 2JFWA 5LLDA 2IBSA 1PT7A 3WL6A 4DPKA 1KIFA 2IPOA 4S2UA 1O6CA 2C2WA 5A4JA 1MOQA 3MBKA 1APBA 4OBWA 3HB0A 1NMEA 1V5GA 2EC5A 3VR6D 4FQ7A 1E1LA 5K3OA 2QN3A 4J1NA 1AS0A 1VCIA 2H65A 3T5AA 3M5PA 3GLRA 2IHYA 4URZR 1GYPA 1OASA 3DHEA 3KFXA 1ZD4A 1HE2A 1G63A 3DEZA 2HMWA 3KVRA 4LA4A 3G3EA 4P34A 4AZTA 4D0NA 3SXPA 5ILOA 1Q0LA 2MMCA 4HTFA 1A76A 5ALOA 1KU0A 4UNRA 1LBIA 4IIJA 5T5QA 1XMXA 2GH1A 3R24A 2XTJA 4ZU1X 1ZJYA 2GAAA 4CQMA 2QKYA 2VP9A 1B3RA 5K3AA 5LWHA 4C2BA 2P4QA 3KDSE 1EXDA 4PWYA 4NNOA 2UXCB 2VJQA 1U1DA 3H2HA 1XPUA 2E4UA 3DOHA 4TRRA 2YMLA 1H0SA 3WNZA 1II8A 3SF8A 1UM8A 4G5OA 1ZIYA 2QTMA 3MXTA 2YOHA 1KQNA 5CLLA 1CB7A 2H9IA 1PJBA 2ZSEA 1WSAA 4NECA 4RTLA 1HZZC 1XVIA 4QATA 5A3VA 1EUYA 1XU4A 2NUPB 1NVVR 5G0TA 1MP0A 1R9NA 2QX9A 1WD7A 2RGAA 3ZQ6A 4AO6A 4JLWA 3INTA 5EHNA 1DJQA 5JSYA 1VHLA 5HSGA 1JUDA 2FR1A 4NIMA 4R2WA 1J90A 3V7FA 4O63O 3U0BA 4B82A 3IAM1 1I6KA 1TKCA 2HUNA 5AW3A 2PKEA 8OHMA 3SEAA 4KX3A 1L7EA 1PNVA 2JARA 5HA5A 5ARBA 2A5JA 2AR7A 1HRDA 1W35A 3KZKA 3QELA 4XVQA 2GAOA 4JQSA 4LZNA 4G8CA 1FFHA 1QG6A 3PUVA 4U7WA 1PT8A 1P2BA 2UZAA 1LFDB 3W2IA 4BE7B 4HAXA 4MEAA 2YOFA 1SBCA 1QNFA 4Z1OA 2Q6KA 2Q4EA 4AJKA 5A1TA 3G2IA 2VA8A 3I2JA 4ZZ0A 1SC1A 1L7DA 4P58A 1SG0A 2E1RA 3P9XA 4LYDA 4OXIA 1DQRA 3L41A 5ALDA 2VAXA 1N36B 3CONA 3V80A 4I7EA 4LJKA 5DHSA 3ZK9A 5I3ZA 4HGOA 3QKIA 1WJGA 1ZD8A 3GDOA 1ZIOA 2ZCUA 3L7JA 4Q9LA 3CSDA 2J6BA 4PQEA 1KOFA 2X6RA 2VLBA 2YXLA 3A04A 1Z6AA 3HA7A 3IT1A 1DRJA 1W5EA 4N1AA 4G0QA 4PAOA 3T5TA 5DNVA 3U7EB 5DOZA 3I32A 2AJBA 3QBVA 5JAQA 4DV1B 4XLTA 1W4RA 3KLBA 1FP2A 4GLBA 1AMUA 2PA0A 5CH8A 4WK4B 4M0FA 2VT3A 3D5QA 2QZJA 1CUAA 4UULA 5JSHA 5BW6B 3T9EA 1QOPB 1Z0JA 3UUGA 1T9HA 3M33A 4HS9A 5EVJA 5E7MA 1KXZA 4ARBA 4CEIA 4K1XA 2HO4A 1DG3A 4GPZA 4DW8A 1S02A 1XAHA 3IQEA 3JTEA 5K4AA 4X85A 1RC1A 5CBPA 2OHHA 3TGLA 4GUAA 1OLXA 2D13A 2JGEA 1PQ4A 4YBZA 3G8YA 1IONA 2B8JA 3JQGA 4EPRA 1CPYA 1K6MA 4NS1A 4E2FA 3Q8MA 4YQYA 3F6CA 1YS2X 3W06A 5EUCA 3WKAA 1XDDA 4TS4A 1Q3TA 5FOSA 3U3ZA 1LA2A 4L9SA 1SD2A 4B3DA 3NW9A 3PJDA 3WOHA 5SY6A 1G4HA 4K9DA 4BX8A 5J43A 4EBBA 1DDGA 1W4CA 3F71A 4BQQA 3K1TA 3ZCTA 3AT1A 1VLJA 2J9GA 3EDCA 3REQA 3LXUX 2PN1A 4YB8A 3T7EA 3W0LB 1BWSA 1UPXA 1O94A 1PYOA 3C1UA 4MUGA 2PX0A 5CX1A 2HCRA 1YZHA 1VL5A 2OV8A 2QTBA 3EGEA 3ES9A 4RANA 3G0IA 5E9JA 1XZPA 5THQA 3WGGA 5ADWA 4I66A 2QXUA 4B4KA 2FFBA 3DBIA 4LVNA 1YHNA 1II0A 4OYHA 5CHYA 3SM9A 1GL6A 3H2IA 2XUAA 3ODPA 3S2IA 3AWIA 1EQAA 2LCIA 2YJNA 1SB9A 4TTSA 2HD4A 1T8UA 4D0SA 2BJHA 2HJWA 2ZJAA 1PFVA 5K99A 1E3DA 2B8WA 3BWCA 3NBXX 4DGQA 5ITSA 3RYIB 1H8HD 4XRGA 1JBKA 4UASA 4CIBA 1ECJA 3A26A 4MLDA 1T2NA 1DRUA 1KU6A 2HRQA 3CH5A 4JB2A 4WV3A 2ZU6A 1KFJB 3CNOA 3U6BA 3TW4A 4ZEWA 3FSGD 5KU1A 3PICA 1XR3A 3KCQA 4OKIA 1Q7CA 3I5UA 2GXSA 3EVNA 4MIEA 4XB6B 5REQA 1XK6A 1IG3A 1CLEA 2BKVA 5DX8A 3VU1A 5FV4A 1GL3A 5CH5A 1TRHA 4LJAA 1OH5A 3O1HB 4S12A 2OCPA 1O8BA 1EUDA 3AQIA 3AR7A 4BCBA 5JATA 5AJHA 1QGUB 1X9HA 2RDMA 2RH5A 4DR1B 3K92A 4RJIA 1SPBS 3EIFA 3P26A 2DKOA 4OVKA 5T67A 3UY4A 2A9VA 1QYCA 4GVLA 2P6MA 4GP9A 3MWJA 4JCOA 4NJEA 2A7QA 2XBUA 5AKXA 3RVSA 4RXMA 5K8CA 3NPMA 2ZIWB 3G5MA 2EERA 2WHPA 3I30X 2ZS8A 1JWAB 1AZWA 2A33A 4IDOA 3U39A 3UKJA 1C9DB 3UB4A 3IB6A 3OBIA 1Y9JA 1SBNE 1T6YA 3OM0A 4K6OA 1R15A 3B9BA 1C0LA 1M0SA 1MEJA 2PAFA 5KSPA 2DQYA 1OA0A 3JU3A 3O7MA 3TZCA 3Q3VA 3W2HA 2WKRA 5FPSA 5I3CA 4L73A 1W75A 1PNOA 1LLCA 2VTDA 4GSYA 1ZMTA 2P6NA 1DKNA 3A8TA 3SZRA 3SVTA 5K1ZA 1FS6A 2CDRA 1SBTA 3SQDA 1T9AA 2X19A 1ZH6A 4IZHA 4Q9DA 3A36A 3GLUA 4XPZA 1LLDA 3KQQA 4LJLA 2B4RO 1F2DA 3AERA 4R1PA 1BOOA 1RKUA 4WLNA 5C2JB 2ZQYA 3OQOA 3IOCA 1J49A 2WZQA 1CY7A 3I8SA 4RAOA 2ASEA 4R2JA 5A0FA 1SCNE 4UHEA 5SZIA 2QZPA 4CRWB 5IABA 1QC5B 3TFQA 3OQBA 5A6SA 2V6IA 2GHQA 4JMPA 4X0EA 5F35A 4RKWA 4FD3A 3TM4A 5IDWA 4BLTA 4LTNA 1XN1A 3OLCX 5DHUA 4J2OA 4DHEA 1KZYC 3KB2A 2G07A 4LUCA 4CF4A 4DDUA 2OXCA 5IJ0B 1TAHA 1ZI6A 3MJEA 2VKTA 3H4MA 4LVCA 2ZPTX 1GNRA 4LY3A 4PBSA 4Q9JA 5CJ2A 1XEXB 2NN3C 3AUJB 4TV9B 1CUEA 4E09A 3LTNC 5I5EA 1NSYA 1KERA 2VQFB 3VA7A 2QX7A 1CP3A 2WM8A 3FPSA 3A2KA 1ONNA 2FPMA 2ZRGA 2H07A 3QYPA 3WWPA 1XQVA 2TMYA 3V9AA 1UT5A 1VHJA 3ZWPA 1GSAA 3DVSX 3GLVA 3PFFA 1JIUA 1X15A 2IWRA 5A04A 4ZO6A 1WE2A 4I4NA 1GCOA 2QRKA 4XUCA 2OCKA 4F5YA 1U0OC 5CPFA 4CG2A 2YZKA 1F38A 5LIRA 4I1VA 2GKGA 5HW0A 2Z9DA 5BT8A 3HCEA 3DF9A 5KYYB 2VTKA 4JWKA 3T4XA 4YAOA 2VUUA 4PXYA 1GOTA 3U44A 3TLZA 1JDVA 1M2VA 1OFUA 4GYWA 4JI2B 1UQRA 2DUUA 2HRCA 5JD6A 2DYKA 5ED4A 1KYTA 1SUPA 3DZHA 1EVEA 5A5VA 3I1YA 5IWAB 1IZ7A 3ZX4A 5GADl 3HMKA 4BB6A 5F4ZA 3ZZNA 1JE1A 4DEYA 4IIGA 1VIMA 3CVUA 1JWLA 1NIPA 4GDMA 2DTDA 3R4CA 3VZDA 4N3NA 2XXAB 4C2AA 1PW7A 3EYAA 1NQUA 2I3DA 2Q0HA 3ETLA 5AMXA 4YXWA 3TZKA 4BQOA 1K06A 2A92A 3UB3A 3EF1A 4BCCA 1BRMA 2FZ4A 2H11A 3N05A 1A82A 1HTWA 1QIJA 2YYAA 1C7IA 1GGKA 4EYQA 1VE6A 1XRRA 4YP5A 2GI4A 5TGZA 4ZPXA 2OZPA 1R4AA 3HEAA 5JV5A 4QDTA 4MHTA 4MI6A 3EGCA 2UYCA 5SICE 2YXPX 5BWCA 4ZO8A 4DJFC 1QFSA 4P6VF 3VV2A 5FOWA 3FR8A 4EB3A 4F9EA 3W5IA 4E5SA 4ENUA 4R6WA 3GG9A 1XZBA 3AUAA 3AVPA 4MXDA 4YT2A 3WR5A 1CF9A 2F2TA 1NOKA 2Y66A 4RH0A 1IUOA 3PCTA 5CB6A 1KJNA 2OYSA 2JDID 2H6EA 4DLKA 1Y80A 3QM1A 4JASB 5BVHA 1WDLA 3JALA 3G85A 4TVOA 4KYIB 1EFLA 4CF6A 3SBXA 4ZYWA 3EIQA 1UBRS 1WX1A 3FY4A 3G2NA 3HV2A 3UA3A 3L82B 2AZXA 2FX5A 1FPQA 1H42A 4G9BA 2QVZX 3DGFC 3TLYA 3MOIA 4GBMA 1A9YA 3RFUA 2OO7A 1GRQA 1MC1A 1O95D 3C6KA 3LIIA 2QP3A 1T9BA 4O02B 5FB3A 3DCJA 2VVTA 3UAGA 2ODBA 1DX4A 2O8FB 1MTOA 3LHSA 1WCYA 2CNNA 2VJYA 3U4GA 3JS5A 3LDHA 5DK6A 4ER5A 1U65A 2BTQB 2VG8A 4X65B 1KORA 5JALA 2P8JA 3R09A 2XV1A 4C9BA 3F9CA 4EARA 1J99A 2J08A 4YRAA 1QHGA 2Q07A 1O5TA 1SUWA 4RJKA 1E96A 1HSZA 2AJDA 4C03A 5HJ7A 2OAGA 1QHFA 1Y5MA 2ZQZA 2HBYA 5JS6A 2XR1A 1XO1A 2SCUA 1T8WA 1LDMA 2J7KA 2DBYA 1P4GA 2OCGA 3DYVA 1NU6A 3CJTA 3PGLA 4IKEA 1DIRA 2HXGA 2LUOA 4NBKA 5LYJA 3E53A 1KTVA 2ID4A 2HM7A 3U4HA 4K9PA 4HNTA 3FCAA 5SZHB 1ZD3A 4AKGA 4PANA 3H2KA 5AVXA 4JXZA 1N92A 1PJAA 5JROA 4G1EB 3TQSA 1RW4A 5E6UA 3D6FA 3SS8A 3AX6A 5LZ7A 4BFYA 2PGJA 5BNTA 2J0UA 4R9RA 2A86A 3NCHA 4NU6A 3RANA 2HRZA 4ARZA 3LL4A 5BSGA 3FF1A 5LQJA 3O8LA 3EWIA 3DB1A 3EVDA 3TKAA 1ND5A 3KYCB 3OJWA 1O9GA 4R1LA 1F3LA 2YXBA 4NG5A 1DIOB 1TDJA 3E8SA 3L77A 4Z54A 1NF8A 3H7AA 2N46A 3FI0A 4IIYA 3UXEA 3M1AA 5EZ6B 5F12A 4CYMA 2PZGA 1TC1A 1ZJZA 3ZQUA 4J1QA 2WKSA 5ALQA 1ESCA 2YVAA 2ZJ8A 3AJDA 5F1OA 4EA6A 1BWQA 4MVJG 1LS6A 4HNAA 5LXTF 5T4HA 4K3UA 1BX1A 1JJ7A 1US8B 2I3BA 1KAMA 4TYYA 2BRUC 1ZNQO 1Y98A 1OGJA 3FI9A 1C8LA 2G25A 4K9LA 4XM1A 3VHQA 5KQRA 4RD0A 1QBGA 3GAMA 2OBMA 3F6PA 1KY4A 2NXNA 4DT1A 4FVTA 4PG5A 5CM2Z 4B7XA 5B2EA 3ZBQA 5DTRA 3BJIC 5H4GA 2JC3A 5CB4B 2GPSA 3UMMA 1KY5A 3WQHA 2FB9A 3F8TA 4PQRA 5EWJB 2NSLA 1FPMA 4F6CA 3WV4A 3ZHVA 1P4SA 1OFGA 2OBYA 3LW7A 5COQA 2VYCA 4RU1A 4MVCA 5JY6A 5L6LB 2REOA 3GYBA 5HJ5A 3H5NA 1SOAA 2G0AA 2V65A 4YO8A 4N82A 1DTWB 4CKEA 3HXTA 4RVSA 1OX6A 4IDHA 4Q1AA 5FYQA 2G82A 5G0WA 3M81A 1UXKA 2CXUA 2XVXA 5D3MA 5E6SA 5IKOA 1Q1BA 4EENA 3QEAZ 4A36A 2YL2A 5B6JA 3P19A 4NY1A 4W5TA 2HQOA 4QSMA 4MWBA 4S24A 5F1PA 5IDQA 2C5SA 4LSMA 5K0TA 4FBLA 1M1YA 1ES9A 3IAEA 4IFBA 1ID8A 2X8AA 4GWGA 4ZQBA 4PRZA 5JRZA 4U4AA 4PIMA 2C7GA 1CRQA 2EX1A 2GARA 2JKVA 3P0EA 3GJ7A 1NW5A 4MTLA 4IIJB 5H59A 2XCRB 2P2NA 2P4SA 3E9MA 2G67A 1H2XA 1YCGA 4UBMA 4C4RA 4UD2A 3NP7A 3L7YA 3RTGA 1CRWG 4FS8A 1HEYA 3M0EA 4KNWA 3GJ5A 2GOYA 1MB3A 2YFQA 4S1OA 3WIDA 3COYA 4CETA 2XVMA 4A1FA 1QPBA 3ND9A 3RU9A 5EIEA 2VNKA 2NSYA 4M21A 5KS2A 2YV3A 4OHZA 3ZHOA 5KYNA 3KQNA 1AJEA 1RQNA 4DAEA 1U0TA 2JPDA 1MORA 2W11A 1JQAA 1VCMA 2GZAA 2V45A 3BBPA 3GJ0A 3IC5A 2X76A 4PLVA 3ZCUA 4EGQA 1JECA 2DMRA 3HKCB 1GEEA 4YWHA 2GK3A 3WYCA 5CDYA 1NUPA 3F0TA 4PBRA 1NMQA 1U8UA 2IT1A 1L5KA 1RWQA 3LKBA 2L2QA 5AJYA 4Q15A 2ADFA 4FKMA 2JD0A 2A9PA 4WNAA 5FTMA 5HE8A 2O54A 3CJRA 2A5GA 4RX1A 1OKKD 3QELB 5AICA 4UFPA 3TO5A 3ZPXA 3GEMA 1QLJA 5CEEA 4RDIA 1HT0A 2BEWA 2IYEA 3W6UA 4ZCSA 4RA6B 1UK8A 2X77A 3F6YA 4JFRA 5L4LA 2AFVA 3G8DA 4P33A 2R8EA 3HDVA 4C0KA 4UREA 3U3XA 4BGVA 1JFVA 3C74A 5AVJA 3VXKA 1H22A 3DP7A 3TEFA 5BNWA 3OE7D 1G5PA 1NJ6A 3FCYA 1EVIA 4WBXC 5FUBA 2ERYA 3OEEA 1Y9ZA 2LGJA 1XTJA 4INAA 2WYVA 4LMBA 2DWPA 3FLEA 4L8VA 1ZUHA 1N5RA 2R8BA 1I51A 1VB5A 2NO7A 4R31A 2RK3A 2Q6IA 4UATA 1QU2A 4QOIA 3T99A 4PGAA 4RQBA 3FG9A 1O5OA 3OKAA 4HB0A 2IYNA 2NU8B 1BRTA 4KUEA 2J85A 4EPXA 3EH2A 3LA8A 5KDDA 1WMFA 2C0PA 2LPMA 2WKQA 3SG0A 2B30A 1HTBA 1X2BA 3CNLA 2WTXA 1X8JA 2BHTA 3DQZA 4RTPA 1RAEA 2ZUUA 1Z07A 2LDBA 3OZEA 3D7SA 1S7CA 1Y9AA 1PR1A 3MTJA 4P08A 4PPGA 4CEIB 4YP1A 3UMJA 1YBVA 5CBPB 5IEBA 3TOSA 1YR2A 4QNNA 3T3OA 2FPPA 3VOTA 3LX4A 2J3DA 6REQA 4OB6A 1UDAA 4G0ZA 4NMWA 4FR5A 3QGMA 2ABWA 2CHGA 3JQGB 4CT4B 4KXUA 1EK6A 3GCZA 1J2RA 1CUFA 3Q9LA 4GPEA 1JG2A 4TKMA 4TT3A 1NW7A 2FE4A 3S6JA 3WWOA 4J0HA 3EUAA 5ANRB 4G41A 5KTYA 3M4ZA 2Z6VA 3DC7A 4IDPA 4BMXA 5C1PA 1NP6A 5JAOA 5CLGA 1OJ7A 2R6ZA 4GKAA 1GA1A 1MT3A 3IMGA 2X9QA 4KDCA 1YQUA 3FZNA 3K5PA 3E3MA 2P9EA 3ZDRA 4B8YA 1MNQA 2JKZA 4NYMR 2ZJFA 3D7RA 3HSSA 3F6EX 4NE7A 5DNAA 4CU5A 1UK6A 3KZMA 1FVFA 1OU4A 4MGEA 1MIHA 1K68A 3C6YA 1G8AA 3IOMA 1H3FA 4KHZA 3UJHA 5CX1B 3V2GA 1QHXA 2JJ2D 2ZRNA 4B31A 1VI2A 1CS4C 1QQTA 2WDPA 3MXOA 1ZGGA 3R9KA 3WOVA 2EARA 1RI1A 4NG4A 2E18A 1AGXA 2XXBA 3OCZA 2JH9A 3OJFA 1T9ZA 2A2ZA 4QOGA 4UNQA 4UDNA 2VCHA 4MQ6A 1TZJA 4L4UA 5H3CA 3BMNA 1U6KA 5C7OO 4ME6A 4L4RA 3T7IA 3CNEA 4TMXA 4YO7A 1A8QA 4FYVA 1VKNA 2ACKA 4YCAA 4AZVA 2AUNA 2QJRA 1HDXA 1Z06A 3I1IA 1YUBA 5AXDA 2R86A 4LRYA 3TLXA 4ENQA 1KEWA 4NX2A 3N0XA 2AMVA 4P53A 1VMAA 2QUIA 4GGPA 4MINA 2W4IA 4L7QA 3I2FA 3B1FA 5CYGA 4WX2B 5KX5A 2N3ZA 2IV2X 3PEEA 3FTQA 5JD5A 2HF2A 2XUZA 3H5RA 3UH1A 2DWCA 2DF8A 3T3PB 2HRBA 3DMGA 3NUGA 4AYXA 5JDCC 5HNKA 3QPDA 1JJVA 3FLBA 4Q1FA 4RW0A 1EUDB 1KSHA 3SX2A 5ELXA 1I14A 2GN0A 3GY0A 3VKFA 5EWLB 2FCRA 5BORA 4D4GA 2XVYA 4MQFA 3F5DA 5EPEA 1DBSA 3T9FA 4ZEXA 3BE4A 1D2EA 4EW6A 1LPPA 5E8RA 2RGEA 3N6VA 3S3TA 2CXTA 4HQ6A 1KMHA 3ZOKA 3MWKA 1KO4A 2HOQA 1YZGA 2WHPB 3DMTC 1JV2B 1WEKA 3P9RA 1UWLA 1EWYA 2BCEA 2A67A 1XIVA 3D6MA 3FYSA 1THMA 3DUWA 2A5DA 3K7EA 1C3XA 4TT8A 5BUSA 3MWDA 2IPMA 2QUAA 3Q8KA 4JKYA 4Z4GA 3NHJA 1P1HA 4KE8A 1S8FA 4XM0A 3H1TA 4TLLB 2AFRA 4UC0A 2Z1NA 4RF2A 5JCPA 1NUSA 2EJUA 1H8EA 5EUMA 2QV0A 1PJ3A 2GZSA 4Q02A 1JJAA 3JQQA 3DLAA 4J29A 3A1SA 4N40A 1JA1A 2I6FA 4IJKA 2RI0A 2P2CA 3LECA 5BUQA 1GZUA 4G4IA 1JDPA 4JYMA 3UAWA 3EEOA 3JQ8A 3TNJA 5JSUA 2YXNA 2I80A 4S04A 1ZA2A 3C5WP 4OA8A 3W3AD 3WKEA 4KNYA 1T0UA 3TG2A 1E61A 4FR2A 1W5AA 1K8XB 4WLVA 3IP8A 2FLWA 4IDEA 4KSBA 1ZP6A 3QI7A 4WKGA 5LJLA 1XTPA 1KEZA 3RG2A 4S0XA 1BD3A 5JH7A 1W0KD 1XQ6A 3TGPA 1U9IC 4MRMB 2X14A 4QQ8A 2BE9A 3QLTA 1TQ6A 1F3OA 4TV9F 3KG2A 3WB1A 3ANXA 4L85A 3LOPA 1FYDA 3DFMA 1E5QA 1BKSB 4DLPA 4HMQA 3ASZA 3IXQA 3K2QA 4PGMA 1J8YF 4HDOB 4Q7KA 1N6RA 1N3YA 2CLDX 4ZAZA 4JLJA 3WL4A 3ZIAA 4R8SA 4DC1A 2BDUA 2H4JA 1PK7A 4PZ9A 4QOJA 3UT6A 5L6MB 1KI6B 1E1QA 1L4EA 3DWIA 5NLLA 2JG3A 2JLRA 2XTAA 3NEJA