1N5DA

Crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
288
structure length
288
Chain Sequence
SSNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQGRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSDSTYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQFVTDKKVVEWGVPPESYPWVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porcine Carbonyl Reductase: Structural Basis for a Functional Monomer in Short-Chain Dehydrogenases/Reductases
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID DEHYDROGENASE
total genus 100
structure length 288
sequence length 288
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n5dA00
2NTNA 4Y6RA 4Z9YA 4R69A 2Q4BA 3RWBA 4BKOA 2Y1EA 4ND5A 2RH8A 4BO4A 1B8UA 2Y1GA 3VPGA 3QVTA 4QFCA 2B4QA 3OJLA 3STHA 4CPDA 4OQZA 1Q0HA 3ZHBA 1ZK0A 4PLHA 3JTMA 4DLAA 3ZNPA 5JO0A 1E1MA 3Q0EA 5F3RA 3ZV5A 3TZQA 5F5NA 3JQAB 3PDJA 4J9VA 2JL1A 1PJTA 3VH1A 2O50A 3ZHYA 1GPJA 3GC6A 1FDSA 1LI4A 3QVOA 3NEPX 2C0CA 1M66A 2VNSA 1VC2A 3H3JA 4U6QA 5JYEA 2WYUA 3QVXA 3H5AA 3KHUA 2Y66A 1ISIA 1DC6A 3PQFA 5G0TA 4BO3A 4BO5A 2BGLA 4NR0A 1P3DA 2NVUA 3H3FA 2Y93A 4NZ9A 4BNWA 3PJFA 4FGSA 3OIDA 4TQGA 4KUEA 4Y6SA 1DFHA 1DB3A 3TSCA 1YONA 3AI2A 3ROPA 4M1QA 1LDMA 1ULSA 1ZH8A 4DLBA 4CMBA 4XRRA 1E3WA 2GZ2A 3DZJA 4JP3A 4XZ3A 4QECA 4XQEA 3O03A 1OZAA 1EQUA 1JW9B 1TXGA 2I6TA 4TVOA 4AJIA 4GQAA 1NM5A 1WNTA 1Y8RB 4TRNA 3UOGA 1MA0A 4ID9A 1I3MA 3FWNA 2VTEA 3JQ8A 1P1JA 4A27A 1O0SA 1UUFA 2YJZA 1KVUA 4AJJA 5DCUA 4CQMA 2HRZA 3H7AA 1DLIA 2BFOA 2EHDA 3AM5A 1CJCA 4EUHA 1R0LA 5BNTA 1PZEA 2PH5A 3BTSA 4HBGA 3W8FA 3F46A 5LC1A 3L6OO 2HU2A 1C0LA 1LDEA 2BRUA 4ZQGA 4J7XA 4P38A 4DGSA 4GBJA 2WD8A 3PPIA 3WG9A 4DQUA 1N7HA 1TI7A 1GEEA 2DPHA 4IZIA 4KWIA 3WQRA 4CM4B 2X9GA 3D0OA 4ND4A 2DC1A 1PZFA 3ZWYA 4HFRA 4RPLA 2J5QA 4I9HA 3GPDG 4URFA 4MKRA 3TQHA 3LVFO 3V1YA 4GGPA 3RUDA 2E82A 4CM8A 2X6TA 3IKVA 1WWKA 4OSOA 5KTKA 2W90A 3O26A 5JO9A 3DTYA 3I6QA 5KJCA 3S2GA 3WNQA 2HMUA 1YB4A 2V7PA 4KOAA 4JBGA 3ORFA 5JDCC 3RQSA 1E3EA 2A94A 2WEKA 2CY0A 2JFGA 1YB1A 2OMEA 4ITUA 2Q99A 3X2EA 1X1EA 4GVXA 2VQ3A 2J5KA 4UVIA 3GY0A 2ZB8A 1DAPA 2J3HA 3AFMA 3U4IA 1LA2A 4IS3A 3OQBA 1GL3A 3FNEA 3F6YA 5DBGA 1OC4A 2CZCA 2HMVA 1LX6A 1XGKA 3LT1A 5THKA 1AXEA 2B36A 4B8ZA 2EGHA 1VJ1A 5IG2A 1LC3A 4U5QA 2VZ0A 2NADA 1WLYA 4CV0A 5JXWA 2DUUA 3VKVA 3WMXA 3N7UA 3PLRA 3QWIA 2GNAA 4UVHA 1Y9AA 2HMTA 2X9VA 1L7EA 3HB4X 4E6PA 1IE3A 1M2WA 5A4DA 3VH4A 3RUHA 3O8QB 4J1SA 4K9DA 2PD3A 3VAZA 4KTTE 3BA1A 2RH4A 1XKQA 4MVJE 1Y9EA 2AEMA 4FFMA 4CQLA 1ZK2A 1DIGA 1HETA 4YRBA 1YJ8A 1KBZA 3ZNNA 2D5CA 4AFNA 1HSOA 3RFTA 1HLDA 3JQ9A 4CMGA 1ZK4A 4R3WA 3K73O 4H3VA 4CMCA 4D3FA 4W9NC 3WSWA 1DBVO 2C7GA 2X7HA 3QVWA 1BDBA 4NDNE 3DBLA 3IS3A 1PSDA 1FDUA 4OAQA 3IC5A 4OGWA 3F1KA 2DVMA 2X0NA 1JVBA 3BTVA 1NNUA 2IXAA 3DZBA 3EVTA 1N7GA 3H65A 4BGEA 1D1TA 4CR7A 5A03A 4NHEA 1ZFNA 4CMEA 1SCUA 1C1DB 5FEUA 2JCVA 3SC4A 5IN5A 1YJQA 4ALJA 1ZXLA 1QYXA 1M76A 1CRWG 3V1TC 1JDJA 2LDBA 1CEQA 3INRA 2PK3A 3F3SA 2OL4A 4NJOA 1K2WA 3B1KA 4EITA 3NUGA 4CQMB 3HADA 1EMDA 2CDAA 3IP1A 4QSMA 4BNMA 2PZMA 3KYDB 3L6EA 1C3VA 1Z45A 3NKLA 3IDSA 5BNIA 4QT0A 3ZN2A 1LDGA 2ZQZA 5CHEA 1YB5A 4RL6A 3WTCA 5HRUA 1B8PA 1HE4A 5T5QA 4CMEC 1LQUA 4BUCA 5IZCC 2OZPA 4O63O 1HXHA 1GDHA 1LSOA 5ITWA 3MOGA 2NACA 3E1KA 4MVJP 5B1YA 4WUVA 1E3WB 3UCEA 2W2LA 4YCAA 2YFQA 4FN4A 1CQIA 3R1IA 4W9NA 3EAGA 4FFPA 3ZWAA 3ITKA 3ITDA 3WDSA 5IFLA 4CMKA 1RYDA 1LRKA 1NTOA 3MWEB 5KIAA 5IAAA 3NRCA 1HDGO 2C29D 3D5QA 1WDMA 2Q49A 2XXBA 2V65A 2W4QA 3OMLA 1IZ9A 4RPGA 1K89A 2I3AA 3RKUA 1HKUA 2CVZA 1HDOA 1DJNA 3TZKA 1BMDA 4DYVA 2ZTVA 4EBFA 1RPNA 1KEPA 3EY4A 3MTJA 4UUMA 3CPSA 3GDOA 3GRKA 1SB9A 3L0DA 4J2OA 3RBVA 1Y81A 4ZJUA 1RKXA 4FFRA 5CDSA 5AOVA 3VKUA 2DU8A 3WJAA 4IQ8A 2WE8A 1V0JA 3DQPA 1GR0A 1V3VA 3NTOA 2YDYA 3GNTA 2NVBA 2QQ5A 1EE9A 2FOIA 1F0YA 1K6IA 3HFSA 3FTPA 1PGQA 1C0PA 3EMKA 2A4KA 2WSBA 3FD8A 1HDXA 3JYQA 1U28A 2B69A 1KETA 3OEWA 4JN6B 4MVJD 1IULA 5FI5A 5DBIA 4EJMA 2AQKA 5ILGA 4GX5A 4NJMA 2RCYA 1E1NA 2NU6A 1J49A 3PYLA 3LT4A 1Y8QA 2UAGA 2ZTLA 3K8ZA 1FF9A 4ROSA 3RASA 3GZ4A 4D43A 1EVYA 4PFJA 4NNJA 1VM6A 4U6SA 3UGKA 3GK3A 2R00C 2YQ4A 5C7LO 3IP3A 4Y67A 1H6DA 4RVSA 4BV9A 1B3RA 1HRDA 2EG9A 3C24A 3U3XA 3AY3A 1GADO 3IUPA 3JQDA 3E8XA 4NG5A 4C7JA 5CAEA 3HUDA 4WLOA 5AQ1A 2ILTA 2VCYA 2VUSA 3T4XA 4CLOB 2GUGA 3ICCA 3ETDA 1O95A 4XWYA 4D7AA 3QA9A 1K5HA 4BB5A 3HB5X 4BQPA 4CV2A 1BG6A 4KDFA 1ONPA 2RHRA 3VPXA 3OH8A 4A7PA 1M75A 3DO5A 2OGUA 1NQAO 1N92A 4H16A 1U7TA 2HRBA 1DC5A 3VZQA 3ZGYA 5IN4A 4WE3A 3IOYA 1LQTA 1ONOA 3WGZA 3I9KA 3PTZA 3WIEA 3HG7A 1HYGA 3M1LA 1ZEMA 1HEUA 2SCUA 1ONNA 5C7OO 3BMQA 2BFMA 2FMUA 1HYHA 3ICPA 4IM7A 4QUKA 3H9GA 4TSKA 1A9ZA 4IDFA 4GVLA 4D0SA 1XQ6A 3DC2A 1KEWA 2IRWA 4GLOA 5TC4A 1C1XA 1VL8A 4FOSA 9LDTA 3OHSX 4N5MA 4B4OA 1GYPA 5JFOA 3HDHA 3GGOA 5H81A 4XB2A 3OIFA 1PJLA 3DXFA 1DEHA 2VYVD 4IDGA 5KVCA 3ZDFA 3D4PA 1BRMA 3QWFA 2FR0A 4WLVA 1B3BA 4ND1A 1DC4A 1FDTA 1T4DA 3OA0A 3ZWCA 4IJVA 1WPQA 4J6FA 3HHPA 4MOWA 3AUTA 2IZ0A 1QYWA 2BF7A 1NQOA 1OMOA 4RPHA 4CMAA 4IQGA 3HZZA 4RGBA 4LCJA 1KVQA 2G5CA 4J2HA 5A9SB 2OBYA 4CLEA 1A27A 2D2IA 3C7DB 3C7AA 3KYCA 3LT2A 3QSGA 4RDIA 5A9TA 3PI7A 1X7HA 1I33A 5ADHA 4J4HA 4UEJA 3L77A 2BMAA 3NDRA 3W4IA 3NJ4A 4DIFA 4BOYA 1P1IA 2ZTMA 5IZCA 3WYCA 1QV7A 3VHRA 5A9RA 1VSVA 3PGXA 4CLXA 1WDLA 4BNZA 3RBZA 2P9GA 3DHNA 5DP2A 4EUEA 4ONEA 2VT3A 4RVDA 3DDNA 3WICA 1CETA 2X9NA 4I8XA 2I66A 2GLXA 1BSVA 1CIVA 1V6AA 1KIFA 2CVQA 3GVXA 3OM9A 2ET6A 2JAHA 3TDKA 2DQ4A 4M55A 3IMFA 3W8DA 4FFLA 4XR9A 2AE1A 3SX2A 2PR2A 4GX0A 4DIOA 3O38A 3KETA 1P44A 1AE1A 1KEUA 4Y6PA 2ZB7A 3GHYA 1BXKA 5TNXA 3W1VA 5JC1A 3PYMA 3OF2A 1SOWA 1OFGA 3ONEA 3MJCA 1XLTA 3VTZA 5JBIA 1XR3A 3QP9A 1NFQA 4WLFA 2WD7A 4RVUA 2X5OA 2A35A 5T67A 3VZPA 5I9LA 4RDHA 3GNQA 1IOLA 3D4NA 2XAAA 4IUYA 4MVJI 5EERA 1XU9A 1UXHA 1S7CA 1OI7A 1DSSG 1A5ZA 1U7HA 3INGA 4UEOA 4F46A 4FFNA 3M2TA 3NT2A 4J3FA 3TL3A 2W2LD 4RPKA 1VI2A 5A05A 5EPOA 1L7DA 4PLGA 5HA5A 3ONFA 3K9QO 5T57A 4NK4A 3R3JA 3I23A 1MB4A 5FYDA 4YJFB 2B5WA 4XJTA 1U4OA 3Q3CA 4ILKA 3WWYA 5I8WA 4R1UA 4WCFA 5KJFA 3FWZA 1HE2A 3I83A 3IAHA 4B3JA 2VHZA 3SLGA 3LQFA 4NH4A 1YL7A 1NR1A 3JSAA 5FFFA 2GO1A 7ADHA 4OSPA 1LNQA 4RQUA 5CEEA 3KO8A 5C7IO 1KY5A 5JDIA 2GSDA 4XQCA 1LTHR 2VUTA 3OP4A 3FF4A 1W73A 4PLZA 4YAEA 4EDFA 1NVTA 1HDZA 4BNXA 4DUPA 3WGTA 4ALNA 2V6MA 4JJIA 1QRRA 4RVHA 1UXJA 2BLLA 2JD1A 1PU2A 1YXMA 5BQFA 2DBZA 3FPCA 1LEHA 1GFSA 4P8RA 4S3MA 3RAJA 2O4UX 1R6DA 1GYRA 2Q45A 4DA9A 4I5GA 2W98A 3KLMX 2FWMX 2O4CA 4YQYA 4CM9A 5IDXA 3GN2A 1E1LA 2E49A 1FJHA 4OXNA 1G6KA 1PJ2A 4K28A 4TRMA 3JQ7B 1JAYA 1CF2O 1MFZA 2X4GA 4UVEA 3JD1A 4U8GA 2OBNA 4WGGA 3KLPX 2VTDA 4JROA 5K6AC 4NBTA 3HDYA 1ZJYA 1U3TA 5CPBA 2FRDA 3HJAA 1UDBA 4W7IA 2VHXA 5EIOA 1E5LA 5L95A 1N2SA 3WR5A 1YBVA 3ENNA 1V3TA 3EZLA 1PJCA 3GF4A 3Q9UA 5L3ZA 3ST7A 4Q9NA 2WD7B 4RVGA 1U2GA 4G81A 4G2NA 2FZEA 1ZK1A 2O2SA 4II3A 3TF5A 3DAPA 1PWXA 4E0BA 3X2FA 4NU6A 4PG6A 1B7GO 4TMFA 1IUKA 1U8XX 4OQYA 2QZZA 1Z7BA 4L0QA 5TIIA 2ZQYA 2C54A 1HTBA 3KSZO 1PGOA 2G1UA 1KVSA 2UUPA 1NPYA 3ON5A 1I24A 2YHUA 4HFJA 5ENVA 2GGSA 3I6IA 5JCJA 3SJ7A 1U5CA 3OJFA 3DR3A 1EQ2A 3B6ZA 2D0IA 3MTGA 2EF1A 4IXTA 3GVCA 4PCVA 5G0UA 1SO8A 4CV3A 1JWAB 4C7KA 3GFBA 1TEHA 2QRJA 5KKCA 3LT0A 1Y8RA 4MPDA 5A02A 2EJVA 1W8DA 4CLRA 3E5RA 3ETGA 1R4NA 5EINA 1ADCA 2D8AA 3RVDA 1NASA 1U3VA 1EUCA 2PNFA 1IPFA 1DOHA 2H1SA 3GDGA 4YVFA 5I9MA 1PGJA 1B14A 5CG1A 4UAGA 1NAIA 4XA8A 3C7CB 3HN2A 4EJ6A 4GL4A 1ZUD1 4WEQA 5HS6A 1DXYA 2YDXA 4YB8A 3A9WA 2W2KB 4JNKA 3WGOA 1ZKMA 3P5SA 3HFGA 1NQTA 4BGVA 4AJLA 4KTVE 3WMWA 2OP0A 2AQIA 3OBBA 2DLDA 2PGJA 2I76A 1LDNA 4RVFA 1XU7A 5G0WA 2BI7A 2AEJA 3EUWA 2I3GA 3AJRA 2O23A 3DBRB 3WFJA 4DVJA 5BSEA 2WMDA 1ENPA 4GAEA 5K6AA 4A10A 3F9IA 1HSZA 1RWBA 2BI8A 4XD2A 1K3TA 2QZ9A 3IQDB 3RUCA 3ZHZA 2IZ1A 3AI1A 3E48A 4QQRA 4UUPA 5LCXA 3AOEA 4BNYA 5L7WA 3JQ6A 3QWAA 1PL8A 1WW8A 3L4BC 3PYXA 3UH1A 5I8ZA 4MKZA 4YA6A 2GD1O 3HN7A 2BGMA 3SJUA 2B35A 2IYPA 1XELA 3FPLA 1BTOA 1I8TA 5CFZA 1QV6A 4MINA 5DOZA 1YE3A 4I1IA 1ZO8A 1H0KA 2PWZA 3KOUA 1YDWA 4JBHA 2BGKA 3WQQA 3DBHA 1LSJA 2PKQP 3TZ6A 5DOVA 2PFGA 3WXBA 3QHAA 1AHIA 2Q1SA 5JY1A 1YQDA 4XYMA 3UFXA 3U9LA 3L9WA 1JWBB 3U4CA 3KSDO 4MP6A 4HNGA 3Q2KA 4WECA 1RM3A 5GMOA 4K6FA 3N74A 2CF6A 1WVGA 4E5KA 2QIOA 4DPKA 4FJ1A 4R1TA 1MC5A 1ZCJA 2XOXA 3JYLA 3IUSA 2GYYA 2O3TA 2WYWA 4R54A 4XIYA 3UKOA 1LJ8A 1P74A 1SEVA 2FZWA 4C4OA 1LRLA 4BO1A 5DBFA 2NQTA 4NI5A 1T2AA 1R12A 4BMSA 1PQWA 1I01A 3OQ1A 3JCZA 2DTDA 2JAPA 3A1NA 3JQ7A 3JD2A 4I5EA 2O3RA 3VZRA 1C0KA 4A0SA 1DRUA 1VPDA 3AOGA 3CKYA 3EYWA 4J7UA 4E21A 1UDCA 3MJSA 3UCFA 1XA0A 1E7SA 1UH5A 3B70A 4K6CA 5LDGA 1SEPA 1SZJG 4BNUA 1M6WA 1KEVA 4M49A 5KVQA 4WPGA 1SMKA 4CQLB 4YAIA 3F4LA 3E5MA 3L9XA 3DMYA 5KWEA 5IF3A 2FSSA 1LSSA 4NFYA 4R3NA 4GSLA 4E4YA 4E33A 3WBFA 3ZHXA 5FI3A 2OOSA 3M1AA 1UZNA 5MDHA 1T25A 3KUXA 4IIUA 5U9CA 2VWGA 1Z82A 2NNLD 1BXGB 2B0JA 3DZKA 2E37A 4J1QA 2Z1NA 3DMTA 4RF3A 2NVWA 3NGXA 3G3EA 3PXXA 1YQXA 1KERA 4WASA 3BMNA 2P5UA 5HTOA 2ZATA 2ZB4A 1GV0A 4XGIA 3U4HA 2VYND 3GNSA 3LLSA 2HO5A 2QG4A 1R66A 4YDRA 3K31A 3TWOA 2CSUA 2QRKA 1EUDA 4IBOA 4XEHA 3RCBA 2Y1FA 4E2XA 5ILOA 1PTJA 3NJ8A 4ESOA 1TVEA 2O48X 1ISHA 1DIAA 1XCBA 4MKXA 1HDRA 1E3LA 4LMRA 3WB9A 4Y98A 1X13A 4WLUA 3CH6A 4ZU3A 4OOFA 4A26A 4OH1A 4CM8B 1P31A 4FS3A 4NFHA 2Y0EA 3COSA 4CUZA 4Y9DA 4D46A 3RJ5A 2RBEA 1CERA 1R4MB 4J1TA 1LLDA 3RFXA 1H6AA 1H6BA 4PLPA 2B4TO 4CM4A 2XF8A 4B4WA 1BWSA 2R2GA 1ZNQO 1E7RA 4GSKA 1LDBA 4ZA2A 4RPJA 4HFNA 4MVJM 4XGNA 4PG4A 1GPDG 1NVMB 2GZ3A 2VRBA 3E82A 4TZTA 1PZGA 2FPPA 4J16A 2BELA 3ANNA 3JD3A 3H9EO 4RQTA 3RC9A 4KMSA 3RI3A 1P0FA 5IDWA 4HFMA 1KC1A 3NTRA 1P1HA 5A3VA 3BXXA 5JYDA 1J5PA 5DZSA 4ALKA 4BQRA 1C1DA 2O3UA 3OIGA 1IPEA 1WXDA 4ZVVA 5B12A 2DPGA 1HLPA 1NFFA 3V5NA 1TT5A 3JQBC 4OL9A 3HQ4O 3AU8A 1R0SA 2HK8A 2Y1DA 4Z0HO 3ZV4A 1H9BA 1DO8A 5L7TA 2QRLA 2FP4A 3V2GA 5U4QA 4B7XA 5GZ3A 1LLQA 4RLSA 4DMLA 1I3NA 1Q0LA 1DJQA 1ZBQA 2WE7A 4FPXA 3QW2A 3MJEA 4PZCA 3CSDA 3EC7A 1QORA 1MUUA 4ND3A 1SOVA 3DL2A 3FBTA 3UF0A 1RM0A 5TGDA 1BW9A 4NU5A 3FRJA 2IEBA 1GEGA 3LC2O 3ZH2A 4EEZA 5CPFA 2Y68A 2GRAA 4IMRA 4Y8VA 5DDIP 3DEYX 3TRIA 1HZZA 3UN1A 1PR9A 1YL6A 3VDQA 3I9NA 2Y05A 4W82A 2Q4EA 2DAPA 2PD6A 3ZNOA 1GTMA 2Q2QA 1YO6A 3OA2A 5TQVA 4IJWA 3OJOA 5ICSA 3LC1O 3TFQA 4LRSB 3FR7A 4KDEA 2TMDA 4AVYA 3OJ0A 3RU7A 3T7CA 4R16A 2POQX 1JKFA 5T8KA 4BKRA 3QWHA 2Q2VA 3TFOA 3GLQA 2H6EA 4PRLA 1A7AA 3VPHA 1YGYA 1W0CA 1ORRA 3IL2A 2AE2A 4CL3A 1EFKA 5KOIA 1I10A 4YT2A 4CJXA 1E6WA 3I4CA 4MP8A 1Y1PA 4PVCA 3A06A 2P9EA 3RUAA 5I7SA 5KNLA 1F06A 1PWZA 3FNHA 1NAHA 2Z1MA 1R16A 2O7SA 3R0IA 4OKIA 5DCYA 4Z3DA 3WS7A 5T64A 3S8MA 1DAOA 2AW5A 3K30A 9LDBA 2YYYA 3H2SA 1G1AA 1OAAA 3WIDA 5BR7A 2X5JO 5L9AA 3SVTA 2P5YA 1UDAA 5EQFA 5ER9A 1U3WA 5JMPA 4RO0A 4O6VA 3RUFA 4E12A 2Q50A 1FK8A 3JQAD 4KZPA 5COQA 3ZU4A 1KC3A 4CM3A 5MGBA 1AUPA 4CQMD 3U0BA 4TZKA 2ZYAA 1DIBA 2VYNA 1Y6JA 3EZYA 1GQQA 3H9UA 3AM4A 4JP2A 1X0VA 1P1RA 1KVTA 4YPOA 4JBIA 4JXKA 1EE2A 1YOVA 4RCVA 4L8VA 3WFIA 2JJYA 5BNFA 3GMDA 3BIOA 1T4BA 2B37A 1HZJA 1LXCA 2EKPA 2R6JA 4B4UA 5B4VA 4W7HA 4J4BA 1E92A 1DRWA 4AJ1A 1R37A 4FIZA 1ULUA 2CF5A 1UXIA 4B7UA 3KZVA 3B1FA 5G0SA 4CL8A 5AXCA 2H9IA 2C59A 1DHRA 3PHHA 3BAZA 3L4BA 5G4KB 1XSEA 5A1TA 4YJDA 5JCJD 2ZTUA 4IGFA 1NQ5A 1N8KA 2DFVA 4Z3KA 4XRGA 4UEKA 2OP1A 5COAA 4QO8A 3DOJA 1JKJA 3Q6IA 1HDCA 1D8AA 2AHRA 2YV2A 2CUKA 4YJHA 3RIHA 2WWRA 3TOZA 3GQVA 4AL4A 4J7CA 1Q7CA 1NR7A 4BNIA 5JC8A 2PV7A 4CLDA 4FBGA 5CEJA 4INAA 4YAGA 1D3AA 3G0OA 5L7YA 5I7VA 1PR3A 1A7KA 1QP8A 4HP8A 3KM0A 1DFGA 4L73A 4YAKA 4DLLA 4XYLA 1CWUA 3WGHA 3CZMA 1V9LA 1GCOA 3QVSA 3PJDA 3A4VA 2NU9A 1ZSYA 1SBYA 2JFFA 3ULKA 4WCDA 2W2KA 1QYVA 1JQBA 3G17A 5FF9A 1ZSVA 2PZLA 1O5IA 1Q7GA 2VHWA 3EDMA 1U9JA 3BMOB 4YTEA 2RIRA 3GGPA 3U49A 4XYBA 1J4AA 1N1EA 1ZK3A 1UXGA 1EVJA 3ZW8A 3PJEA 2AEFA 1I2ZA 3G79A 3PLNA 2DFDA 3VC7A 2AG5A 4FR5A 5G4LA 3RSHA 3OSUA 3S2IA 1PS0A 3C3XA 2I99A 3F1LA 1W6UA 4EI2A 3MJVA 4CR8A 3B1JA 3MWDB 3RKRA 3LYLA 3ZU2A 4IIVA 2EW2A 4FOOA 4EEXA 2WDZA 1O89A 5B37A 2P9CA 4WEOA 5A5EA 3PDUA 5JSFA 4CLRB 2C5EA 3IKTA 1MG5A 1BW9B 1D4FA 2YUTA 4YXFA 4IDCA 3V1UA 2ZJ0A 4BNJA 1VL0A 2EGGA 2NU7A 1KY4A 2OORA 5ER6A 2NU8A 4I5DA 1Z75A 5L51A 2IYOA 3AW9A 3C85A 4XQGA 4HADA 1ZMTA 3JQBA 2G76A 3GEGA 2J3KA 5L40A 1LUAA 4YRDA 3NAQA 3TZCA 4YWJA 3BHJA 2RHCA 1HE5A 4XCVA 1YH3A 3S2FA 1PS9A 1T24A 2A92A 3AI3A 2GASA 4IINA 4KUGA 3CUKA 1GYQA 2NWQA 4MVJF 1N9GB 2B4RO 3JQGB 3QJ5A 4WNIA 2DKNA 4TRRA 4BHTA 4O1MA 1BXZA 4ND2A 3GH3A 4NBRA 4R5MA 2B5VA 3FNGA 2RAFA 3E6AA 3PP8A 2UUOA 1G0OA 1QR6A 2G82A 2HCTA 4BVAA 5CDTA 1R15A 1YOVB 1VKNA 3CTMA 4R1NA 5C3MA 2YV3A 4FSHA 2X0JA 4NIMA 4PLVA 1LLCA 3E9NA 2ZK7A 3ETEA 2VRCA 5JLAA 5DCWA 5ITVA 2VOJA 3L4SO 2FR8A 1C14A 5TT0A 1TA4A 2E4AA 3LF1A 5TJ9A 3HWRA 3BHIA 4TKMA 2HJSA 3SC6A 5TJHA 4J90A 4PRKA 5JE8A 4RF4A 1XQ1A 1P45A 4EUFA 3AM3A 3KRTA 2EEZA 2Q1UA 4E13A 4FFOA 2NQ8A 3L07A 3I52A 3Q2IA 3BTUA 4XB1A 3VPSA 1JN0A 4B7CA 3OICA 4J91A 5KVSA 1PQPA 2FSVA 2GZ1A 2WYVA 3G1UA 4FC7A 1VRWA 1MC4A 4QXMA 4DMMA 4NQZA 3QLJA 5JDIC 1I5RA 4FW8A 3WYEA 1UXKA 1T1SA 3D3EA 3W6UA 3GAZA 4CM1A 7MDHA 2H5LA 4WLNA 4BNKA 4IY1A 1GZ6A 1IYZA 4TRJA 5A06A 3CZRA 1LBEA 3SBOA 4FDAA 3QE3A 3R3SA 1RJWA 4JJFA 5F5LA 3NYWA 2LDXA 2EKQA 4JLWA 4L4XA 5JW6A 5EQDA 3ZI0A 3PFFA 1WMAA 2G17A 5AXBA 4D41A 1WAMA 4MO2A 3PQEA 4DTIA 1DHTA 5DULA 4GWGA 4A2CA 4CV1A 2ZKLA 1BGVA 1T2DA 3JYPA 4H15A 5TF4A 3LDHA 4WCFB 3PHLA 2PH3A 2YV1A 3GHHA 5DNAA 4ALMA 4R5HA 4ZD6A 3V2UA 3RBXA 3JD4A 4YT5A 4AJEA 3GN1A 1GD1O 4BKQA 3DZHA 1DFIA 3ONDA 3WX0A 2VYVA 2YHIA 1NYTA 5IDQA 3PHIA 1UAGA 2EV9A 3TN7A 1SNYA 2Q1TA 1WMBA 1MFPA 2Q46A 4QTZA 4MDHA 4R68A 4OJNA 5T6BA 5JAMA 3QY9A 2FY8A 2FPGA 4Q3NA 1UJMA 4RF2A 4PLTA 4GX1A 1D1SA 2VWPA 3GUYA 2WM3A 4MJLA 3BMCA 1CDOA 1T26A 4KQWA 3WWZA 4F3YA 2GCGA 3PFWO 3U5TA 2GERA 3CMMA 3DBHB 5IZ4A 1A71A 1E3JA 2H63A 3V2HA 5COBA 1NX6A 4YBZA 1Q7BA 2HK7A 4TVBA 2HMWA 3W4JA 1CYDA 1ADFA 3KTDA 4GMGA 5C5IA 3H9JA 1VL6A 3HE3A 1ZW1A 3ASUA 2X0IA 4QO7A 3MOIA 3MEQA 2Q1WA 1ZXBA 5CG2A 4BNNA 2O3QA 1E7QA 4B8WA 1PJ3A 1IY8A 2Z95A 4PGFA 4II2A 2JHFA 2NSDA 4M54A 5EL0A 4DL9A 4E30A 6ADHA 4Z6KA 1TLTA 1C0IA 4PG5A 4M86A 3OQ6A 2ZCVA 4OO3A 4Q3BA 5G2OA 1XIVA 1YKFA 3NX4A 4JK3A 1HWYA 2EW8A 3WJ7A 3D5TA 3GVPA 3E9QA 3UICA 3KYCB 1ISMA 2CMDA 4E5NA 3NGLA 3W6ZA 3ZWOA 2VZ9A 1Q2XA 1LU9A 2VZ8A 4K1LA 3UHAA 3ROMA 1K0UA 4OOEA 2X23A 3MJTA 4GKVA 5AVOA 3MZ0A 1VSUA 1N1GA 1Z74A 4D0RA 2HAEA 4PLFA 1DIHA 3JV7A 4CMIA 5A3JA 4RLHA 3C1TA 3HNPA 3BMOA 5CDYA 2NM0A 1YQGA 3GRPA 2PGDA 3K2BA 4CMIB 1QKIA 1J0XO 4ZQBA 3R6DA 3DOCA 2GF2A 4IDAA 3WBBA 4BKPA 2AMFA 1C1XB 2PZKA 2BFAA 2F1KA 4IZHA 4WK6A 2O3JA 2D4AA 5L4LA 4P22A 5AXAA 3BMQB 2FR1A 1T2FA 3L6DA 4OHUA 4H7PA 5EMHA 2OUIA 2GN4A 1JU9A 5CDGA 4TKLA 4AJKA 2ZCUA 1QMGA 3H4VA 4I08A 3ZZNA 4WOKA 3WNVA 2VWQA 4ZRMA 2HQ1A 5FWNA 1ZMOA 3LF2A 5JAZA 1B26A 4IDDA 1A72A 3VH2A 3VH3A 1Y5MA 1H9AA 3U62A 3GDFA 1I3KA 2GN6A 4HKTA 1KS9A 3KYDA 4B3HA 4BNFA 3I9MA 4DC0A 5G0VA 3OFSA 2PKQO 2D5AA 1YVEI 2AQHA 4IXWA 3S55A 4UVGA 3KYBA 3PK0A 1ZVMA 3KVOA 4D3SA 1A4UA 1GV1A 1B0AA 1YL5A 2TMGA 4BO0A 2NTVA 4E2WA 5JDCA 3FNFA 3DTTA 1UP7A 1ZEJA 3INTA 4FGWA 3PZRA 1GAEO 5GZ1A 2VOEA 1ISFA 3PWSA 5H82A 4B3IA 4CUKA 1Z6ZA 4PIVA 4DQVA 4F6CA 1QG6A 3D7LA 3G1TA 2OXIA 1YBAA 4HUJA 4Q3AA 3GOHA 2AXQA 4GMFA 2IZZA 5EJ2A 1Y8QB 1LLUA 4BMNA 5F1KA 2Y0CA 4LW8A 3UAGA 3A14A 1M6HA 4P4GA 3KEOA 2ZYDA 3P2YA 3PIIA 4NJMB 1EVIA 2J3IA 3EVNA 1AGNA 3AWDA 1WP4A 3K96A 4M89A 4UULA 2J8ZA 1F14A 3KB6A 3WGGA 4D44A 3BHMA 3P2OA 1E7MA 3NDIA 2HKIA 3E03A 2CD9A 5HBRA 4DBZA 4EYEA 1ZJZA 3WQSB 3JQFC 4FJ0A 1T2CA 1XYGA 1F8FA 3JYOA 3DZGA 2CDCA 1V8BA 1VE9A 3AU9A 5EN4A 4DYDA 3RUIA 1EBFA 1K6XA 3LLVA 3NDJA 2VHVA 4A5OA 1EEHA 1EBUA 1PJQA 4YJGA 3F5SA 5HS4A 1EDOA 1PX0A 5ES3A 1U2DA 3ADPA 5H83A 3WSVA 5HM8A 3I9OA 1NHGA 3UW3A 5BSHA 4FCCA 2IXBA 2VRCD 1EFLA 4IPTA 3OECA 3BZUA 2NV6A 3JQCA 5IXSA 4MIYA 3TPCA 4LSWA 4R9RA 3ASVA 2YFHA 1NFRA 4XGKA 3T4EA 1JAXA 3W4KA 2VWHA 1ENOA 4AJ2A 1PL6A 1K6JA 3GPIA 2OO5A 1E0DA 3FR8A 4OKNA 3F4BA 4TWRA 4RZIA 5EESA 2HJRA 3RC7A 3DBVO 3VDRA 1DRVA 2CNBA 4HV4A 1GZ3A 3S2EA 1GUZA 3ZWMA 4ZN6A 1GQYA 2PLAA 1UP6A 3KEQA 4FJ2A 4GH5A 1N5DA 4WLEA 5DP1A 1PZHA 4DPLA 4MVJA 2Q2WA 3ZWWA 4B4VA 3ANLA 1I32A 2ZYGA 2ZIZA 4J1NA 4R01A 2WTBA 2PY6A 3MJ4A 3DHEA 3VOSA 5JNLA 2W8ZA 5L45A 4D45A 1ML3A 1SB8A 2F00A 1DLJA 3PIDA 3ROQA 4BNVA 1P0CA 2C07A 1QYCA 3FCOA 4AJOA 3ZW9A 2BKAA 4Z9XA 1ARZA 4IDEA 4DPMA 4Q39A 2HK9A 3GMSA 1B2LA 1I36A 1E7WA 1PJSA 3GG9A 4E3ZA 4QEDA 2PA3A 3AUSA 1XDWA 4NK5A 2VNAA 4G65A 4ZQEA 3SXPA 5CP8A 4JIGA 2EWMA 4S1VA 2EIHA 3I3OA 3D64A 4R1SA 3OETA 1GUFA 1WZIA 2DTEA 3I4FA 4O59O 3PHJA 4I9NA 2D3TA 2AG8A 3JQ8B 1JVSA 1MP0A 4EW6A 2EP7A 4CLHA 3AK4A 3UUWA 3DBLB 2C5AA 3RU9A 3LSYA 4XKJA 2V6GA 3DWFA 5DT9A 4J49A 4DWVA 3QQPA 4UUOA 2P91A 2P68A 2YHIB 5JAIA 1SC6A 1L1FA 4KWHA 4Q3CA 5TT1A 4MP3A 1G0NA 1I0ZA 3O9ZA 4BKUA 4AJ4A 3RC1A 3BMNB 3KV3O 4KP7A 3TOXA 3G49A 3M2PA 1S6YA 2DBVO 2ZJ1A 1E3SA 1EK6A 1AN9A 2YZ7A 2P2SA 3VZSA 3GVIA 3Q1LA 1NWCA 5B4TA 4EJ0A 4F45A 3ZU3A 1MXFA 4EGFA 1H2BA 1TT7A 4AG3A 1F12A 3RC2A 4BO7A 1UP4A 1H6CA 3PWZA 2GPTA 2Y67A 1P77A 3LU1A 4BNHA 2CDBA 4LVCA 1DC3A 1VJTA 3GVHA 1XG5A 1OOEA 2NLOA 1YDEA 2JFHA 3CMCO 4GI2A 1B15A 4JGBA 4YRAA 1IHXA 4M8SA 3K92A 1EVZA 4HY3A 3FN4A 4ZGWA 5KJEA 1W4ZA 3ZU5A 1JLLA 3DOOA 3DZIA 4QFDA 5C37A 1X7GA 5A5FA 4NBWA 1HL3A 3CEAA 5JAQA 4JCOA 5I7FA 3EW7A 1QXSA 1LDYA 3GG2A 4Q3EA 2I65A 4LISA 1P1FA 4IJUA 5JMWA 3EHEA 3JD0A 4DC1A 4YJHB 4DXHA 5HWSA 3F47A 3GA0A 1IL0A 3HDQA 3WGYA 3VPFA 3K6JA 3ZWXA 2I9PA 4CMJA 4IJKA 1ZZEA 1D7OA 5I7EA 2VHYA 5KCZA 2BFPA 4XX0A 3AY6A 1PGNA 2BHLA 4W4TA 4GKBA 3PJGA 1MGOA 2A9FA 1J6UA 1HE3A 4RF5A 1BVRA 5I9NA 1MXHA 2QYTA 3ZWNA 4BGUA 5TLSA 4U0KA 4AJHA 1E3IA 4FQ8A 2PZJA 4OMUA 4FB5A 1FXSA 4PLCA 1WDKA 3H8VA 3TZHA 3GAFA 4XDZA 1N9GA 3DAGA 4YEDA 3PRJA 3RUEA 3K5PA 1UAYA 4Q3DA 1NPTO 2X1HA 2P4HX 1VLLA 1KVRA 3PZBA 3JQGA 1NPDA 4DBVO 2PTGA 4OM8A 1Z7EA 5TS3A 3D3WB 2P4QA 1U8FO 2X8LA 3PVZA 3BYZA 1ENZA 4BO8A 3CE6A 4NBUA 5T8KC 2C7VA 4LCEA 3P7MA 1HYEA 5LDHA 2HUNA 1UZLA 1ADBA 3ZCXA 1FMCA 2C2YA 2JD2A 3CIFA 4BMVA 2Y99A 4ALIA 2PD4A 5K0ZA 4BNGA 3Q11A 4YAJA 4CM6A 6LDHA 2Q3EA 4LVUA 1NHWA 2O3SA 4WCFC 4Z0TA 3PGJA 1YRLA 4ZQHA 1MG0A 2X58A 4GPD1 5A9SA 2JCXA 1ENYA 1A9YA 1XHLA 4CMHA 2CFCA 3DBRA 3QRWA 4WKGA 4J0FA 4XJSA 1GY8A 1JKIA 2X86A 4I9UA 4D79A 3C1AA 4FC6A 1I2BA 4ZHSA 2C82A 5ENDA 1KOLA 2X0RA 5KKAA 3AUUA 4ALLA 5THQA 3WYBA 2UYYA 3WLEA 2DUWA 4L4SA 5KJ1A 1EK5A 2YY7A 1NBOA 4CM5A 1PGPA 4BNLA 4BS9A 4N7RA 1Y7TA 4KUHA 1WZEA 1X7DA 2G0TA 4WOJA 4ZRNA 4BO9A 4E2YA 2EXXA 4CUJA 1XWFA 3WGIA 1RYEA 2EP5A 3OJEA 4DRYA 1E7YA 2JCYA 3I1JA 3O4RA 4LGVA 2J6IA 4E5MA 3DB2A 3GEMA 5IDYA 3ZWVA 4ZICA 2FN7A 1LRJA 4JJGA 4LRTB 1NP3A 4UREA 3DMTC 3ADOA 4F6LA 8LDHA 3LK7A 4OXKA 1Q0QA 1YS4A 2Y1CA 4CM9D 3B20A 1BVUA 2OHXA 3ABIA 4UUNA 2B83A 3FTNA 1NVGA 3H2ZA 1TT5B 4KQXA 2C2XA 3H9QA 1F8GA 2GN8A 2UVDA 4J0EA 1MLDA 4LSMA 3Q9NA 1LSUA 5IJZA 4JX8A 5G4KA 4HXYA 1I2CA 1GQ2A 2DTXA 4W6ZA 5JS6A 3D3WA 1B16A 2V6FA 1FDVA 3AOEC 5ICMA 1GU7A 2JD0A 4CLOA 2QHXA 2E48A 5TSDA 2DBQA 1IB6A 4MVJG 2XPCA 4RORA 1TB4A 3VVCA 5AYVA 1EUZA 1DIRA 1HF3A 5JCXA 2I67A 8ADHA 1O9BA 1I3LA 2BH9A 3D4OA 2HMSA 4UVDA 3QV1A 3H6KA 1OC2A 2UDPA 4N54A 3RFVA 1QSGA 1UR5A 3ZV3A 4QX6A 4PG8A 1QYDA 1AHHA 1QLJA 4L4RA 3JQEA 1EZ4A 2PGLA 1X15A 3AY7A 4TROA 1PEDA 1M67A 3AUAA 3ROKA 5L4NA 1H2HA 2FPIA 1O8CA 1AXGA 2DM6A 3ZWPA 2AQ8A 4XR4A 2QX7A 5F21A 4PVDA 1KYQA 4YACA 4J9UE 4AJNA 3C8MA 4GX2A 4D3DA 4W99A 1DDOA 1O6ZA 1YBMA 3O8QA 4JQCA 3H5RA 1F17A 4IQ0A 4R41A 2R00A 4WJZA 2HDHA 4PLWA 2IE0A 3UVEA 4CODB 3FSRA 1BXGA 4BNTA 1U1IA 2EKLA 3D1LA 3E9MA 4N18A 5DN9A 4K26A 4BIIA 4J4TA 3DFUA 3CXRA 3T7EA 4YR9A 4HWKA 1PS8A 3GR6A 4E5PA 4U7WA 2AA3A 3LC7O 4XYEA 4P4NA 4YT8A 1E6UA 5B4UA 2NUAA 3GGGA 4GLLA 4RZHA 4YJFA 3ZV6A 3OEYA 5U1PA 4XIJA 5BT9A 4MVJH 3PEFA 4LN1A 2VUUA 4YQZA 3GZNB 4Z9FA 1GUYA 2Z5LA 1NWHA 3K2EA 1FDWA 3EGOA 1V35A 3H5NA 3UCXA 4RV9A 2QYSA 3HDJA 1T1RA 3WOHA 5K9ZA 2Y1OA 4O5OA 4RJTA 1T2EA 1U4SA 3NV9A 3I5MA 2GN9A 1X1TA 1IHYA 2FHSA 3BTOA 2VN8A 4BB6A 1E5QA 3A28A 5J23A 3KBOA 4L74A 4A73A 1U5AA 2C20A 3SLKA 3C1OA 1ISJA 1VJ0A 5TX7A 3I9LA 2DBRA 5TRTA 4XDYA 1HT0A 4J43A 4A03A 4L75A 1R0KA 2YQ5A 5F1OA 2V6BA 3DAFA 3GEDA 1SAYA 4DREA 3UXYA 4X54A 5JY6A 1I30A 1RM4A 1EDZA 3BMCB 2OFPA 2ZB3A 3ENKA 3JQFA 5CDUA 3TNLA 3E18A 3DZFA 5CEFA 3N58A 1V3UA 3PQDA 2PKRA 5GY7A 3HSKA 1NXQA 3RJ9A 1P9LA 2BD0A 4BO2A 2IODA 5IXYA 2JKVA 1QLHA 1PJBA 1SPXA 3CINA 2JHGA 2HSDA 1R4MA 4L9RA 4EZBA 3PHGA 3W8EA 1ISGA 3GT0A 4Z0PA 3EK2A 3U4DA 3TJRA 4L76A 2E6UX 4E32A 4PN3A 1XEAA 3GZNA 3WGQA 2CVOA 4LK3A 4NPCA 4BGIA 1BHSA 4BO6A 1OBFO 4LMPA 1ZIDA 2VT2A 4AICA 3ANMA 3JQ9C 1PQUA 4DIBA 1Y5RA 5KJ6A 2NTJA 2HLPA 3M6IA 5L4SA 3VVBA 1U3UA 5AXDA 3KXDA 1ADGA 3F5QA 5JPIA 1X0XA 4WNCA 4D42A 4CM7A 4XQ9A 2NVUB 2EJWA 4HX5A 3MCVA 3GFGA 3VTFA 5BSGA 5A04A 2D1YA 4OYRA 1MV8A 4N5NA 1HDYA 3IIEA 3RD5A 4YJGB 2Y0DA 4PZDA 5GZ6A 1BDMA 2XXJA 3S1LA 2YW9A 4MIOA 1B8VA 4YT4A 1CQJA 1UZMA 3IJPA 2O2YA 4BV8A 3FI9A 4NBVA 4M87A 2X22A 1R4NB 4I5FA 5L53A 4OXYA 3FHLA 3RROA 4BL5A 1P33A 4PG7A 4E5YA 1YWGO 1Z73A 3JQAA 1IZ0A 2DT5A 1RM5A 4MIEA 1Q1NA 4E2ZA 1E1KA 4GGOA 1H5QA 4NFSA 1LC0A 5BSFA 4PLYA 4IS2A 4NMHA 4B79A 2J5RA 4G5HA 3JYNA 1ZSNA 1PIWA 4OIMA 5KVVA 3SEFA 3NT4A 1PJ4A 4YYZA 2D59A 2IDZA 3AFNA 4XYGA 1X14A 2QW8A 2GR9A 3DHYA 1ID1A 1A4IA 2I5PO 3NT5A 2WJPA 4E31A 3QIVA 4PZEA 2EERA 3PWKA 2O7QA 4DQXA 2X5KO 3LZ6A 4IDBA 1GZ4A 2IEDA 3ZNQA 3ZWBA 1P1KA 1MX3A 1O94A 2UV8A 2GDZA 4R51A 4AJPA 5DF1A 3WLFA 3U09A 4HNHA 1H93A 1E77A 4FD3A 3QWBA 4ZQFA 4GWKA 1E6EA 3WTBA 3DFZA 3KSUA 4P4LA 4U0JA 3IJRA 4R4JA 4CR6A 2J3JA 1JTVA 3NTQA 1H94A 3TL2A 3DONA 1DPGA 3I9JA 1PL7A 3V8BA 3P19A 1JA9A 1GCUA 1VKOA 4N5LA 5F1PA 4IMPA 4IGEA 3GUCA 4R9SA 3FBGA 4O0LA
chains in the Genus database with same CATH superfamily
2B82A 4ER0A 1NP7A 2QRUA 4W7SA 3S44A 1WPGA 2GN2A 4POAA 4BKOA 3FCSB 1QZUA 2RH8A 4ND5A 1YE5A 3I8XA 4ER6A 3DD5A 3G5MA 4DV6B 2ZZKA 3T3DA 3QVTA 4QFCA 1UKYA 3STHA 3TG2A 2H2HA 3VSCA 3EJWA 4YMUA 3KE8A 4AYXA 5FWXB 2M1XA 5DNYB 3ZNPA 3A70A 2O07A 1WMDA 5DHPA 1T3SA 1EM8B 1Z35A 3OJCA 3Q0EA 3MF4A 3WNDA 3WLOA 3N75A 2IKSA 1SG6A 4G24A 4GP9A 3ZV5A 2IX3A 3EDQA 1KJWA 5HFJA 1IM2A 1NOJA 2VLBA 1DO2A 3WK9A 3C41J 1DBQA 3O2QB 1XMVA 4TV8A 3SM9A 1J0BA 3PNQA 3KKZA 3ZHYA 5CB4F 2O8DB 1NG9A 1GPJA 3GC6A 1BA3A 2IYZA 2YJGA 3U31A 2OV4A 2OY0A 3QYFA 5KAPA 4EKNB 1GU1A 5LZ2A 2GARA 4RJJA 2I4NA 1DWUA 4MV7A 5SYMA 4G26A 5B53A 1MT0A 1W44A 1JV2B 3R44A 3K1ZA 2E18A 4L15A 2P8SA 4BO5A 1DOAA 2LV8A 1SZDA 4YAWA 1QS0B 2GJAA 1IN7A 2Y93A 4G0WA 2XODA 2GCOB 3D6AA 3SSMA 4DIEA 4TQGA 4KUEA 4ZI2A 4JVSB 4ZI7F 3GAAA 4YMLA 3JAMA 4GZ6A 3TSCA 3W5SA 4DQKA 3NBKA 2IEIA 3P9PA 3K09A 4NBNA 1EJ0A 1JG1A 3HGTA 2OXRA 2HHCA 2VIIA 3RUPA 4CMBA 2GBCA 2GZ2A 2FEAA 2XVXA 1G21A 1QRTA 5T6MA 1HX7A 3CPHA 2XYQA 2CNWD 4WA7A 2R7AA 4NYMR 5HMMA 5DISB 4KC0A 1K63A 4QBIA 3IQIX 5FOQA 4ZOBA 1Y8RB 1FLAA 2D54A 2GD0A 3LIIA 4EB6B 4QUEA 4MHTA 1I3MA 2GEJA 3LM8A 2ZXUA 1O87A 1XMQB 2GA8A 1KEZA 4G0YA 2EKBA 3C0KA 4RM3A 2IYVA 5D00A 1H4TA 1FJXA 5C5CA 2JAOA 1XJCA 5JSUA 2PE5A 3H2YA 5DCUA 2I7VA 5GAJA 1X8JA 1EJ6A 2EHDA 1JG2A 2B7CA 4H1VA 1MHTA 1R0LA 2H0RA 3V1KA 2AI1A 2TMYA 5FQNA 1ZINA 5AESA 4P33A 4X5OA 4A0QA 1SBCA 1YS2X 2WR8A 1C0LA 1G16A 1TKRA 5AKKA 1M2EA 4ZQGA 4P38A 4RIEA 3SMQA 4GBJA 2WD8A 4Q3LA 1K7YA 3QLTA 1N33B 5IT4A 4WZAA 1M2FA 4P0TA 2FUNB 1NUPA 1O9GA 3N76A 4YNBA 4CM4B 1L5MA 2BHNA 2X9GA 1YE8A 3EC2A 4ND4A 4EVSA 2FRDC 4URFA 2G07A 5HMLA 1FVHA 3RUDA 2FPKA 4HG2A 4RACA 5AKLA 3AKCA 5J58A 2C9BA 1QIHA 4M60A 1EX1A 5ALGA 2AC7A 2GETA 3I6QA 2FK8A 1EFHA 1U9IA 2RKWA 5ED0A 1YB4A 2V7PA 3FCAA 4PFSA 5EMKA 2FZKA 2Q6KA 3G9ZA 1QKJA 3NORA 1NYLA 1XTJA 4ZRDA 1GOTA 4IIBA 1YB1A 3N87A 4QJ4A 1D6JA 3KG2A 3WLSA 1XPUA 4V0SA 3NOOA 3NO4A 4LSGA 1MQSA 2VQ3A 2XTNA 4MPJA 2J5KA 3AERA 2O0MA 4FWIB 4TXLA 4KX3A 3BAFA 4OHFA 5K0TA 3N6VA 4X63A 1DS6A 4H1HA 1ZA1A 3R7LA 5CA1F 1TCCA 2CXSA 3TKAA 3ROFA 3FNEA 4RKEA 1KZ6A 1LK7A 2D7DA 2G70A 1OFIA 1TW2A 1LVHA 3BXEA 1LX6A 3GLHE 1AXEA 1W96A 3QE2A 5AK0A 2DBYA 4EG5A 4JLBA 2VZ0A 1ND5A 1CUXA 3LYAA 1BMTA 3OIVA 4QAQA 5JXWA 3L7NA 2O1XA 2WVJA 3N7UA 1DCFA 2DSTA 3QITA 3V7YA 3HYNA 1VMDA 1OX4A 5D3MB 1QCYA 3WYNA 2G71A 1IE3A 1M2WA 3ELBA 3VH4A 3RUHA 3WLTA 3O8QB 2YIJA 2J0EA 2PD3A 2CNLA 4J1SA 4P35A 3GUZA 3L92A 3GGDA 1Y9EA 2OWDA 3GYBA 4RLFA 4Q12A 1NIJA 1Q3TA 2QUBA 1LQ2A 4HH1A 2FGJA 3GGCA 3QF4B 1HETA 2C4VA 1U1DA 2E0IA 4AF7A 2ZU6A 1P62B 1KBZA 3IUNA 5CDFA 2ZBRA 4EP1A 4C7OB 3TAXA 4AFNA 4BFSA 4LFBB 3FI0A 2LCIA 1BQ3A 3EGEA 4NNPA 5DM1A 2OAQ1 2IUTA 1HEYA 3HKCB 4C76A 3PT9A 5C8DA 2X4DA 3K73O 2XD4A 3FWYA 1NXPA 4N1AA 3ZXYA 5CD9A 4D3FA 1I3CA 2AOTB 3KJIA 1MO3A 4TKZA 1Z5WA 3QPVA 2R4UA 4EATA 1RXSA 3V8MA 2G5TA 1H2EA 4ZAWA 5FOWA 1PSDA 4HDRB 1JFFB 1EBBA 3FFTA 1E5DA 4NP6A 2EBWA 2DVMA 2FUCA 2XBMA 3V7FA 2W2NA 3FPKA 1R10A 2B61A 2IYXA 2PZAA 3GFFA 5AI8A 3U1BA 2ZVDA 1N7GA 5DI3B 3I61A 5A03A 1QPGA 4NHEA 4DT1A 3SC4A 1NRWA 2A1IA 3GXBA 3W34A 1OZFA 4I6JA 2Q3LA 5AR1A 1R5BA 3PX7A 3EOZA 4H7EA 1JIKA 1M76A 2HU8A 1KJ9A 1JDJA 4S2EA 4WY2A 3V1TC 4OLBA 1AIPA 1FB5A 1QGDA 2JZOA 3B3JA 5EQJB 3R9WA 2FPWA 3MS7A 4GXNA 3IH5A 4AMGA 3HADA 2QVYX 2REQA 1JE0A 521PA 3WYFA 2PKWA 1E3DA 1BS2A 2QOEA 3K16A 1DL5A 2PZMA 4YMWA 4V0RA 1N6KA 3THWB 3EAFA 3IDSA 3CN9A 3NKLA 3P4YA 4QT0A 5AHRA 2IJGX 2FVXA 5CHEA 4B32A 4TLEA 4RL6A 5HRUA 3AEKA 1VRVA 2A5DA 3L4EA 3VR4H 3W5BA 1CUUA 2DUMA 1DO0A 1X1AA 2XCUA 1QQ5A 3T1OA 4A8PA 3UPUA 2XTAA 3FW1A 4LUCA 3EWIA 1Z06A 4B2IA 2J59A 3E3NA 3MOGA 3IOBA 5AP9A 3E1KA 2QL5A 1AM4D 1W36D 4WUVA 1V5EA 4LDAA 3LNTA 1T4CB 4LIPD 1FYFA 2IWRA 1EFUA 4MICA 1V16A 5KJFA 1O5TA 4YCAA 4NYJQ 2C9MA 3V42A 4YJ3B 1M1XB 5HCNA 4FN4A 3R1IA 4PX9A 3IAS6 3H84A 3ZK7A 4LXHA 5A4IS 4M9XA 3ITKA 1D2NA 3ITDA 1E2FA 4LWQA 4P92A 4RIIA 3WDSA 3UV7A 1RYDA 3PIRA 1Z4JA 5KIAA 1TNDA 1VHWA 1W76A 2YZ2A 2Z58A 3D5QA 3PXEA 4JBWA 2IY8A 2G28A 1KZHA 2CSXA 2F4VB 1EE1A 3RKUA 3PEYA 1PFWA 1K89A 2I3AA 1ZCFA 4O4JF 1ZX1A 2ZYVX 3OTHA 4DCSA 3E9DA 2EOAA 4EGAA 1RE0A 3BFKA 2W2TA 1PDOA 2WHQA 2ZTVA 3UMVA 4UUMA 2O7RA 4D8TA 3CPSA 3GDOA 3GRKA 1SBQA 1SB9A 2I7CA 4J2OA 1Y81A 3KZXA 5J4LA 1ORWA 3VU0A 3KQNA 4NF2A 1B1AA 4J0CA 3IAM1 4IV0A 3FKQA 3X3HA 2G4CA 2WE8A 1JEYB 5KSYA 1IN4A 3GNTA 5AM0A 4HNAA 2R6ZA 2CN1A 1QF9A 1N36B 3FTPA 2JG3A 2ZWOA 4JP1A 3I04A 2BZGA 1PGQA 2GWRA 4JASB 1KF0A 2QQGA 4D8UA 3HVIA 3WRVA 5KWVA 1SUEA 1U02A 1Q21A 2BP7B 1ECPA 2FX3A 3PRHA 5IMBA 2HYIC 2HEIA 4NL4H 2B30A 3GEIA 1IULA 1OLXB 2XNSA 3X44A 4KCGA 5C8YF 1H4VB 2HMAA 3SZGA 3IE0A 4NJMA 4X60A 4LXGA 1E9BA 2EU8A 2RCYA 4B6QA 4YJKA 1E1NA 3H4TA 3GJ6A 3VX4A 3GLFB 2CL6X 3LT4A 2UAGA 3K8ZA 1FF9A 2MJLA 3N59A 3GZ4A 3NNSA 1EAMA 4IOMA 1PWEA 4TL7A 3RASA 1JHOA 4HPXB 1VM6A 2HT6A 2HHAA 2XWSA 3CVOA 5A0FA 2H54A 1YS1X 1T91A 5EPUA 4Y67A 4ZT6A 2Q6VA 1Z3CA 3AY3A 3LOQA 5FTMA 1CE8B 2OCAA 3E8XA 2EG5A 4JBXA 4B2PA 2SKCA 4FYJA 5C4GB 4TTRA 1UK7A 1T13A 2PAFA 1PR1A 3A2LA 4QNNA 1QTNA 2XITA 3MINA 1F38A 2C9YA 3T4XA 4DABA 4MWOA 1P73A 1DWPA 3IIMA 3L06A 4PFKA 4UBKA 4YFYA 1J09A 4KDFA 5K3SA 2BM8A 1FQWA 1WXQA 4JNCA 2PKXA 3SSAA 1X9IA 4F1JA 3CQ9A 2JLWA 3QEMB 4Q19A 3NRJA 2EWWA 2WIJA 1NUSA 3C74A 1RR6A 3AR9A 4O4JB 4X65B 1CQWA 1N92A 3INYA 3Q15C 3SC2A 4B7ZA 1G6HA 3CB2A 3WLRA 2X8JB 3FNBA 3IBYA 2CNOA 5SY9A 2PTHA 3AZPA 1R6TA 5ALLA 3ZGYA 1LQTA 1KBOA 3QHQA 1WD7A 1VMKA 5JAHA 1ODFA 2DETA 3IAEA 2AN3A 3R09A 3G13A 3V4VB 3GT3A 4UM5A 3U2QA 3W5CA 2OGSA 4CEJB 1X8KA 2B5OA 2GTHA 3ETJA 3TD9A 3L2OB 2HHJA 4MWZA 1A1SA 3CH4B 2O6LA 1YQQA 2FV8A 2BP7A 1S3IA 1JIIA 3M5WA 2DFNA 1HYHA 1XD8A 2Q07A 3Q7QA 4IM7A 3OWOA 4JH0A 5FOXA 4DEVA 1KQNA 3MLBA 3EIXA 1I1NA 4D9KA 1AS2A 4RHYA 4NMLA 2IRWA 2EARA 4K6HA 1OV4A 1C1XA 5TC4A 3PQ7A 1GG5A 4M0PA 4R8RA 4Q9KA 4CWAA 1OXMA 1S0UA 2VQDA 2GYVA 4FOSA 2QT0A 4JWTA 1FLNA 5K3AA 3TFWA 4B4OA 1GYPA 5JS1A 5JFOA 3HPRA 5H81A 4ROTA 1O6GA 8OHMA 2PX0A 4OYYA 1G59A 2Q2OA 3D7MA 2VYVD 1BD3A 2AF3C 4GKAA 1BRMA 1P60A 1IDOA 3QWFA 1BA2A 2FR0A 4XW2A 3VJLA 5EJ4A 5LB4A 2XUHA 3HLYA 4ND1A 3QI7A 3HSSA 2YWEA 4LGCA 1IY9A 1VB5A 4HOYA 2G40A 2R6DA 3O9VA 4OBEA 3O8LA 2F48A 3W0LB 1I6WA 2GXAA 1M2KA 4KAFA 1G8KA 1QYWA 2BF7A 4WAUA 4X0EA 1K7FB 1VE3A 4KNVA 4LHEA 5JD4A 1FJ2A 3L93A 4RPHA 4IQGA 3PR3A 1HO3A 4W9RA 1KVQA 2CVHA 2DZDA 3AI7A 3BEOA 2EC5A 3CR3C 4IHQA 5HKOA 2D2IA 3C7AA 3KYCA 4C7VA 2R1VB 1F20A 3PI7A 4PHTA 4BU1A 3K20A 5ADHA 5M3BA 3B3AA 4UEJA 1XQYA 1FE8A 1ATIA 3NDRA 2BKUA 4MWEA 3E3AA 1P1IA 4IIGA 1AQUA 1N5IA 3VHRA 3WYCA 3P0FA 3PGXA 4QPPA 2QJFA 1P8AA 2IGBA 4M88A 3DPSA 4QYSA 5DP2A 1B8OA 1Q7RA 3MTIA 2Y1XA 1POWA 3T4PA 3X0DA 2ZUEA 3MRVA 4ILEA 4P2GA 3AEYA 1AD2A 4OAOA 2I66A 1GTZA 1CY0A 5KTYA 3NOXA 3TINA 3DV0B 1KAEA 1CIVA 2Q3BA 2WJJA 1XEXB 3FGZA 5L3QA 5J3JA 2YWDA 3R0XA 5HDQA 4M55A 4FFLA 4KJZA 2AE1A 3ZGZA 3EVCA 2ZRAA 4GX0A 4DBLC 2ATVA 1H8HA 2H18A 3F2VA 1DZIA 3O4JA 1GFZA 4NS4A 4Y6PA 2GZSA 5TARA 1A95A 5TNXA 3ICVA 3WGUA 3BWCA 2L19A 4BV2A 5JC1A 3M70A 3RT1A 1KP9A 1JI0A 3MJCA 3K32A 1XLTA 2MYUA 3CIOA 5EKTA 5JBIA 1XR3A 1NFQA 1L4YA 2O0JA 2H4ZA 4DR3B 4QGGA 1QR2A 2IYLD 3L82B 4WLFA 4ZOLB 3VHLB 2OFWA 2WD7A 3TX2A 2A35A 2QTZA 1NVVQ 5IKPA 3OZWA 4Y30A 4IUYA 2GUWA 2XAAA 3Q7RA 4Q21A 1Y4AE 3IBTA 4FDMA 2NU8B 2JGDA 4Z2AA 3I1FA 1XU9A 3MAGA 2G6BA 4V3CA 4G1CA 4DEYA 4UTRA 1DSSG 1A5ZA 1GZDA 1XKTA 3INGA 1NBWB 1KQPA 2JIDA 3GLTA 3VR5A 2FQQA 4F46A 1BHQ1 1RFGE 2P6OA 6Q21A 1YZUA 4WJLA 2ASVA 1Z5PA 2W2LD 3G8DA 4YK7A 5LZ8A 4F92B 2HQRA 4E4RA 5EPOA 4DJAA 3M9XA 2QU7A 3DFIA 1QBKC 1I4DD 2RHHA 5HA5A 5AJZA 3K9QO 3KD2A 5IT5A 3KWJA 4NK4A 1C7IA 2GPWA 2PV0A 2PG3A 1WY5A 1MB4A 5FYDA 1E0SA 2EATA 3GJSA 3MGCA 4L9WA 4X84A 4XJTA 1U4OA 3Q3CA 3HVJA 2JIZA 1NJ5A 4ILKA 4R1UA 3HGQA 1XZJA 3GT7A 5GOTA 1G5FA 3IAHA 3UT5B 4B3JA 3SLGA 1QP7A 3LQFA 3R0VA 1U4NA 5FFFA 4YXWA 3SIXA 4IICA 1V1MA 1V11A 1SBHA 1II8A 3SGLA 2QLJA 2PGXA 5F2KA 1RYBA 3BA6A 4RGYA 2X40A 3ENWA 4XQCA 3SIPA 5C0OE 3THYB 3L18A 4QOIA 2L42A 1NVTA 2C7QA 2C5GA 4TXJA 5HQ3A 1Z07A 3QU7A 5REQA 1TCBA 3QYAA 5AHXA 4N3GA 3T1QA 3DYIA 4RY9A 3WGTA 5E8JA 1UXJA 2BLLA 4RELA 5EIBD 3WLQA 4EG3A 4GEKA 1PBNA 4HLNA 3NGMA 3FPCA 5LMNB 2ENUA 4P8RA 4ZIRB 1OZGA 4JC5A 3LBFA 1OGYA 4P5EA 3G2IA 3T3NA 2OQIA 3H2HA 4RMNA 1GYRA 2Q45A 3BJZA 1Z5NA 1L4LA 1GPKA 2B7LA 3LGAA 3NBXX 3NFYA 2ERYA 3I42A 2FWMX 2X2EA 5NLLA 1C9YA 3EPPA 5IDXA 3WGJA 3ZDCA 2QZPA 3E1GA 4I55B 4HAXA 3MTAA 3RE1A 3BRCA 2OPHA 3KEGA 4R8SA 1ZWKA 4D56A 3ROEA 1LVUA 1XFAA 1L4FA 3UV3A 3H83A 2G9RA 1KAMA 1LX7A 1A7UA 1W581 3OJWA 4RAOA 4OATA 1D6NA 5D3ZA 5EWMB 1N8NA 2HM7A 1RHRA 4AZSA 3CLTD 1ZJYA 1YRQA 2DF8A 3DYBA 5CPBA 2C2ZA 2JKYA 4L8YA 4NSNA 1LTKA 5CD1A 1E5LA 1RYMA 4QJ5A 3L7AA 3BIWA 2CJPA 4D92A 4ZAYA 1TEZA 1ZU5A 3Q9UA 4Q7LA 3ST7A 3A58B 4RYDA 1QDLB 1U0HC 1GPWB 2ZSDA 1G21E 4IKPA 1I3OA 3U3DA 4MV4A 2L2QA 1P0PA 2AXPA 4LZOA 1OASA 4MJ3A 4TL9A 1KQOA 5J1TB 4F12A 3X2FA 1IZYA 3EZ9A 2ID7A 4UOQA 4CT0A 3C3AA 2VDLB 2WT9A 5HG0A 3TQSA 1P2FA 3KOMA 4L0QA 4O2AF 5TIIA 2ZQYA 2INGX 2C54A 1O03A 4GICA 5EG5A 1KVSA 3C6MA 2UUPA 1NPYA 3NKVA 1HQKA 1I24A 1W1WA 3A26A 2YHUA 3N8GA 4HRAA 4L0CA 3WJ2A 2ABWA 2PHZA 4HFJA 2CBXA 2ZJOA 5JAMA 3W79A 3C6QA 3CC8A 3BB1A 2P2CA 3B6ZA 1FUKA 2EF1A 2YHAA 1DXOA 4IXTA 2HCRA 2P79A 5UKDA 5K5EA 2AMJA 4BFYA 2XW6A 3L1KA 1JQ5A 4JP8A 1JWAB 2FCAA 4MK4A 1TEHA 5EQTA 2GZHA 1Q74A 1GQSA 5AKYA 3ZZ1A 3LT0A 1Y8RA 4HNAB 2JRCA 2EJVA 3WWCA 3S81A 1NMQA 1VLHA 2ZAYA 5AUNB 1JDBB 4FHCA 2Z6QA 1KZ9A 3C97A 3E5RA 3IV6A 1R4NA 5BUCA 5EINA 4Z2YA 2D8AA 2WIFA 1XMSA 4COOA 1IPFA 2XUDA 3GDGA 4YVFA 5I9MA 3T9FA 4RZQA 2BW0A 2IXFA 4EB3A 1B14A 3DMDA 4PGGA 3GLGB 2CWWA 4JEMA 4LTNA 5DBEX 3RVMA 3EGWA 4IVRA 4QQ8A 3J81k 1G3UA 3TMYA 1YK1A 2FEKA 2X3YA 2JK0A 2YDXA 1A9XB 4FYWA 3NVDA 4OYLA 4WEQA 3A9WA 1C29B 1D9XA 5BMVA 4JNKA 4DSNA 4GE3A 3HFGA 5IYZB 1NQTA 1GPAA 1A8QA 2DY0A 4BGVA 4AJLA 3C8UA 4UXJA 2JFPA 4YJ2F 1MZVA 1WBDA 3GJYA 1BO6A 4MUMA 3D4LA 1MORA 1EGMB 2A30A 2E5LB 3PBKA 2EZUA 4YLEA 2BI7A 5G0WA 4EG4A 5DTJA 2AEJA 3LQYA 3QKIA 4TMYA 2AW3A 5AW3A 2O23A 3DBRB 2BIFA 1HT2E 1OFUX 4DVJA 1I5EA 4CKBA 3MCUA 4WXRA 5D8DA 3W06A 1ENPA 3ZY3A 5F5XA 5ALSA 4JI8B 2ODTX 1RWQA 1VLVA 4A10A 4IKEA 3CT6A 4AAYA 1EPUA 2WHEA 4MQ5A 4BPBA 2CFSA 2ORIA 1ZVJA 2QZ9A 2VXBA 3OFND 4GZ5A 2IZ1A 4JU9A 1MNQA 3AI1A 3RUCA 3ZHZA 4TVKA 3UV6A 1J7JA 1VECA 1ZC3A 2FZ4A 4UUPA 2CMHA 4EY4A 1VIMA 2BR3A 4KAJA 4Q6WA 5IK2A 3K6RA 2WT8A 3EF0A 3ZI7A 1WHTA 4Q9IA 3O47A 4Z54A 4MR9A 5I8ZA 3LCMA 2QLFA 3HN7A 2BGMA 1C2YA 2VAVA 4MINA 3L6CA 4U3JA 5JZ9A 4PINA 4E5DA 1H0KA 2C92A 3FMOB 3TRFA 1QPZA 3OFVA 2VNIA 1AS3A 1J39A 4EECA 5C5DA 2IVFA 4YHBA 2H4YA 3TZ6A 4R0NA 5DOVA 5DW3A 4P4SA 3WXBA 5BXQC 1AHIA 4WJKB 1XFDA 5JY1A 5EUCA 2J09A 1YQDA 4HS9A 3SDBA 4RHXA 1BJTA 1SA0B 3UFXA 1GZSA 3LWBA 1SIBE 2EQAA 2VHCA 2W43A 4MP6A 3U4CA 3NHRA 2C78A 4YRJA 3HP1A 3U60B 2BUAA 5EXDA 5GMOA 5B7PA 1ZD4A 3N74A 1UT5A 1WVGA 2X3UA 4FJ1A 4R1TA 1DNPA 4B6SA 2XOXA 5CH8A 1VPVA 5IJAA 1LJ8A 4GMXA 1H05A 1U1EA 2JIZD 3EZFA 2QUZA 4KK3A 1TKAA 4TYPA 4Z8XA 1X2EA 4RULA 2VDWB 3VR5H 4RHCA 2XRMA 1K3FA 1T2AA 4FDVA 4KVAA 1ZMBA 4X44A 5AJUA 4ZZ3A 1OB2A 2PXAA 3OIWA 1PFKA 1MO2A 3NC4A 3JD2A 1W87A 2GEUA 1JSCA 2OCGA 3VKWA 2RARA 3MLEA 1M33A 3A1UA 4P58A 1DRUA 1VPDA 3VZRA 1QGOA 4E21A 5KWSA 5DLPA 1YS7A 2DPYA 4Y2GA 1FSFA 1E7SA 5CA1A 1ZHFA 2BY4A 1SEPA 4Q3OA 1H2AS 4M49A 4P7GA 4XDHA 3KJQA 4M1EA 3V6MA 3C8ZA 4QDKA 1SMKA 4CQLB 2ZU0C 5GINE 3ZDXB 4YAIA 2ZRQA 2I9KA 3F4LA 3AGPA 1K8XB 3H13A 3DE6X 5KWEA 5IF3A 1LSSA 4RZSA 4JC8A 4PAGA 4UNNA 4C4YA 1K7XB 4WT7A 3ZHXA 5DO9A 3WWOA 3GRUA 1SXPA 1XX6A 4D9FA 1IIBA 3M1AA 4EY5A 4RQAA 1KI8A 1UZNA 3WRXA 5FPQA 4I66A 1JPUA 2J6CA 4KIUA 4UQLA 3ZU6A 2VWGA 2A57A 2VSXA 3N2YA 4GMDA 5EE0A 5B2EA 2GNOA 2B0JA 3DZKA 4MHOA 2BMWA 5FKJA 1IY1A 2Z1NA 1XMIA 4C6SA 2FKNA 1EZZA 5C53B 2HN9A 3NGXA 4CG3A 1S2MA 2CHFA 4F9EA 2P5UA 4XGIA 2ZB4A 1GV0A 5IEBA 3U4HA 2QMZA 1VL5A 2VBFA 3X1XA 4YRIA 4CEHA 2JHPA 1P7VA 4CNQA 2ZXFA 1X38A 3H0EA 3LIPA 2QRKA 2AMLA 3RCBA 2Q4DA 3HUFA 1X74A 2HHLA 2NT4A 2PZFA 4QICA 2QAIA 4ESOA 3K70D 1Z18A 1CFJA 2O48X 5IRCD 1DKOA 1HDRA 3A1CA 4GP7A 3WB9A 4F6RB 3BXHA 5BY2A 3MD0A 5JFGA 1JBQA 2D74A 4CDRA 1C4OA 4ZU3A 3MCZA 4OOFA 3QYPA 1P31A 1R8SA 1ORHA 2Y0EA 2HJ9A 1KJQA 4D46A 3IAUA 1CERA 4J1TA 3U3JA 2FF7A 3WMGA 3RFXA 2C0PA 1H6AA 4D82A 1ADJA 3KQYA 3N5CA 2B4TO 4PLPA 4TSFA 4CM4A 1TGVA 2XF8A 4LNUA 3OOYA 1QIKA 5KOHA 1NNLA 3NHBA 2JGDB 3RTGA 2UZ1A 4ZA2A 1M1NB 1IWBB 1G55A 3NWOA 4LYGA 3E82A 4I0WB 4G85A 1PZGA 2ODQA 3KXIA 4OI1A 2FPPA 2YWBA 4J16A 2UXBB 3CUEF 2BELA 2YMQA 5H5JA 5JS8A 4IOJA 3TJMA 3VKGA 3CNEA 1YJBA 3MFQA 1JBKA 1QZ3A 4WZAE 1L5LA 2QX9A 2OZKA 4HDMB 5KSWB 2RG7A 3QEOA 4D9NA 1W34A 4CKWA 3C43A 3UJNA 3JWJA 2XEXA 3F0TA 3IB6A 4MUFA 4FILA 1TC1A 3GO4A 5CDFE 4ALKA 4XWOA 5K3EA 4OHWA 1C1DA 2O3UA 5B58T 4L02A 5LQSA 4MVYA 4ZVVA 4C89A 1HLPA 3JQBC 3R4VA 1M8GA 4DRXA 2ZSJA 1R0SA 1V8ZA 2Y1DA 3F6BX 1UFKA 1KO7A 2CXXA 5EP4A 3VOAA 3W78A 1H9BA 1HNXB 3E2IA 3RTCA 3R9XB 2NYUA 4YMVA 4B7XA 2CD7A 3NEJA 5GZ3A 4KLZA 1F7VA 1N0IA 3DEKA 2C00A 1A2OA 1DJQA 3GJ8A 5EXSA 5MFZA 3QW2A 3MCWA 4TTQA 4O0MA 4W1SA 3LDUA 4JVMA 2HU5A 4ND3A 3RS3A 2VT6A 1QVWA 4RE5A 2VAMA 4RY2A 4FSDA 5TGDA 1BW9A 3FRJA 2IEBA 4HLDA 1GEGA 1R9GA 2ZR9A 5CPFA 4Y8VA 2XUJA 1BN6A 2EZ9A 3R5JA 4IEFB 5DDIP 3BG5A 3WC4A 4H7JA 2XIJA 3KBBA 4W6QA 5TQ2A 3UHFA 1NTRA 3HU5A 3GQBA 2QL6A 1DTSA 3IAXA 2UZ3A 1RAEA 2Y05A 3MSXA 3VDQA 5DHAA 3WO1A 3ZBQA 1QZXA 2Q4EA 2GSWA 4XSVA 4PSVA 3ZVMA 2XSZD 2PD6A 3S2YA 2WF5A 3AHFA 3ZNOA 4BJHB 1GTMA 3OA2A 1DPFA 4FZRA 2W6IA 5F73A 5BMVB 5TQVA 1TF5A 3OJOA 2PIAA 4F04A 3TFQA 1FS4A 3L8FA 3TGPA 2I4IA 4BQOA 1WM1A 1DWQA 2TMDA 3IP9A 3Q1KA 4AVYA 5IH7A 1A9SA 4R81A 4MPRA 3UK1A 3QE4A 4EG7A 3T7CA 1KYIA 5BN5A 1WB9A 2POQX 3L7IA 4O4HF 4OIFA 4WN9A 5T8KA 4BKRA 2Q2VA 1U28C 3TFOA 1AHNA 2FW1A 2HRQA 1ORRA 5EMLA 3GFRA 1I4OA 1E9SA 4CL3A 4B35A 2VK8A 1OLUB 1V95A 1BU8A 4PZZA 5EZYA 4YT2A 1E6WA 1ZG3A 2FLVA 2M2IA 1ND6A 3H1TA 4MP8A 2XGSA 4MQEA 4MVXA 1P4SA 5CB6A 2I78A 5KNLA 3QLEA 1F06A 1AKYA 3FNHA 2CUNA 2O7SA 5AUQA 2ID8A 4FP9A 3AILA 1H69A 1KFEB 4Z3DA 3SEQA 3WS7A 3U6KA 4KDCA 9LDBA 4OXIA 3E27A 4BLPA 5K6TA 1Z28A 2WQ7A 1RQPA 2P5YA 4GOND 1CQXA 4M38A 2GJSA 5IEJA 4RO0A 4O6VA 2KLBA 4MLDA 4E12A 3BXPA 1NKSA 1F3LA 4TYMA 3UMCA 1FZQA 3ZU4A 3D0QA 1OAKA 3NFRA 4B9EA 1DJLA 4QFBA 4CQMD 4DJFC 4R40A 1DEXA 4X93A 1NU8A 3WLMA 5CT8A 3V8QA 1WHSA 1Y6JA 4XD7A 2CV2A 4NAHA 1AXRA 1ZOLA 3BB4A 2XWQA 1R6UA 3KVYA 3D2AA 1P1RA 4L5CA 3RAGA 4YPOA 1KYTA 5DHUA 4L07A 4FONA 2XV1A 3OLCX 4KGXA 2R8ZA 4L0MA 5JNWA 4UNSA 3HCOA 3K2IA 5B3LA 2O1WA 2WJWA 3FZQA 4M7RA 4MTLA 5DNCA 2J33A 1ECFA 4BUZA 1N78A 3GJZA 1T4BA 2B37A 4PRYA 2EKPA 2I6UA 5DJ5A 4B9AA 2NP7A 4J4BA 3MQFA 3RFFA 5JCOC 2IXDA 1E92A 3HA5A 4AJ1A 1SXJC 4FIZA 1ULUA 1JPJA 1VE5A 2C95A 3HZOA 3DVAA 2QG6A 4IRUB 4X66B 4K6KA 3B1FA 1W59A 4Y2UA 5C8YB 3NYRA 3ZLBA 4CL8A 1NDHA 4HC4A 4DSZA 4GKKB 1A5BB 2Z8YM 2DPMA 3U9TA 3GWZA 3L4BA 3OQJA 1XSEA 3OU7A 1IJEA 3HACA 4OLJA 4IGFA 3G0IA 5JANA 1YCGA 4P93A 1N5JA 4XVRA 2JAWA 1VCHA 2OP1A 2VHTA 4JGIA 4R8KA 4ME6A 1HDCA 2ZRHA 4KIWA 4ZCMA 1D8AA 3HB7A 2CUKA 4TV9F 4ZV9A 4MV1A 3TOZA 3HKDA 2HU7A 3A6GA 3GJTA 3OEEA 2J4FA 1UPCA 2JIPA 3BRSA 3EVGA 1KO8A 2PV7A 4CLDA 4CKBB 3WFIA 4BEBA 1BCRA 3HDTA 4UXIA 1U9YA 5L7YA 1VGRA 1V8DA 1PR3A 1A7KA 1Z13A 1XAJA 2NSJA 3KM0A 4NJEA 3VZBA 1CWUA 5CM8B 3WGHA 1PAUA 3AP1A 4ARAA 1ZNYA 3KJEA 5LYJA 3PJDA 3GPLA 4F5ZA 1H3NA 3A4VA 5JECA 2NU9A 2P6MA 4UEQA 3RVRA 1GL9B 1SBYA 1Z2AA 3PT5A 4QQKA 16PKA 3H5OA 1P61B 1ZGCA 3OC0A 1JQBA 4IDPA 5FUBA 1ZSVA 3W9YA 2C4UA 2PWYA 5EUQB 2VHWA 3EDMA 5A3SA 3BMOB 4YTEA 3JWGA 2Q4TA 2X9LA 3GGPA 4DMUB 2IYFA 3U49A 2DHEA 1DWOA 4XYBA 2PDAA 5BWMA 3P97A 3LW8A 4UAVA 1ECLA 5DNVA 4QVIA 2D1SA 2AEFA 2ZRFA 5ALOA 3G79A 1OROA 1UPAA 1BX1A 2DFDA 2ORED 1C0EA 2AG5A 5G4LA 3RSHA 4O08A 4ZMRA 2J31A 2UYGA 4V03A 4AZVA 3M6LA 3F1LA 3MJVA 2RDMA 4HGZA 3B1JA 1QV9A 1UDRA 4LOIA 4P84A 4P7FA 3EBOA 4QHYA 4UU7A 5DTQA 1IJFA 1ZUNB 2HCJB 4FOOA 3ZU2A 3AGQA 3AH8A 4EEXA 2YWCA 1Q83A 1O89A 3RRYA 5B37A 2Z3ZA 1K75A 2C31A 4FYIA 5AO9A 5KHLB 2VDQB 4R1LA 2C5EA 5LKRA 2H4FA 4QU5A 3IKTA 3GLSA 2CT8A 4FTWA 5HFNA 5CJPA 5J4VA 4A9AA 3K1AB 1XPRA 1VL0A 4LJKA 2DR0A 1KY4A 2NU8A 4GO1A 3QUCA 4I5DA 3ZHOA 4IXMA 3M4ZA 1CNMA 2WFZA 2ZAGA 3JQBA 3O1HB 3ZTWA 4Q4LA 2A9VA 4UE6A 2X1LA 4B75A 4YWJA 2EBFX 2ZBFA 4OXQA 3BHJA 1HOXA 4XCVA 1YKSA 2RGEA 3S2FA 2GN0A 3KB8A 5TDHA 1PS9A 3RGWS 3PRKE 4KUGA 4M4SA 1NRXA 4DEXA 4JLNA 4MVJF 2BM0A 5C8YA 4DNQA 2JLQA 1J8VA 1N9GB 1S9HA 5DRTA 1X1SA 3EVBA 4UEWA 3HVKA 5TPZA 3VNVA 2XT9A 1JG4A 2W7TA 2QPLA 2WRZA 4OL0A 5L3QB 3GH3A 1ZZGA 3PKIA 2B5VA 3FNGA 1A3CA 3WSTA 1XQ9A 2RAFA 4GXTA 1FSSA 3TW8A 3DE4X 1WXFA 2LTAA 2UUOA 3OZIA 3OZTA 1QR6A 1SBZA 2HCTA 4HSEA 4H1TA 2G08A 1NVBA 2Q0QA 2H4XA 3CTMA 2BBWA 4R1NA 3GEEA 3ABOB 4MR8A 2N46A 2Q7OE 4RTOA 4ARIA 1Q84A 2X0JA 3HL0A 3PXBA 4FSHA 2QGFA 4Q6BA 4WGFA 5FL7A 2WKRA 3A6LA 3E9NA 4ZWNA 4A6XA 4E51A 4E94A 3JZIA 1TTQB 4AY2A 1FOEB 4PX3A 1UBCA 2WIDA 1L5HB 3DBOB 5DCWA 1J2TA 1H1LB 4DMFA 2VOJA 5ITVA 5H8WA 1PFQA 2R7KA 3HKBA 2RHDA 1SUSA 3B1VA 3GDHA 5DHQA 3K5HA 4I81A 1UEIA 1I6KA 3EC1A 3EVAA 4RKFA 4BJ5A 2QM8A 2PJZA 4TKMA 4Y1RB 2I54A 3SC6A 4XX1A 1UMBA 1HKHA 2PRJA 3A0UA 4J90A 2A0XA 4RF4A 4DLRA 4E3WA 5A7FA 3GLIE 1ZJJA 3HY4A 3O8OB 4N3NA 3OG9A 2O2CA 3I52A 3VPSA 1GKYA 2W11A 4MUEA 5HJEA 2HTEA 2QP9X 2QY6A 2YJ4A 5KVSA 3FOEC 2G04A 2WYVA 3GV0A 3K2QA 3U16A 1T0BA 1VRWA 3CJRA 4FW8A 4V02A 1TCUA 3FUWA 2ZM5A 2GO7A 2X76A 3DL0A 4CIDA 3FMIA 4Q02A 7MDHA 4WN9B 2H5LA 3AKDA 8AT1A 4IY1A 4IDOA 4BWGA 1GZ6A 1V11B 5A06A 3K6KA 4ZZ0A 5TXGA 3R3SA 4YP1A 1N2BA 1MF7A 1MMFB 2J30A 3NYWA 1V3QE 3UGTA 1RHJA 1RI5A 3IQEA 2NGRA 1CVRA 2JFOA 1WAMA 1Q1AA 4BVBA 5C2JB 4IVNA 3LY5A 1DHTA 5DULA 4AMBA 4IV8A 4CV1A 3CHYA 4DXDA 4EFDA 3A2MA 1BGVA 5AJVB 1T2DA 5K01A 2ZPAA 2IP4A 4RH0A 1T8PA 3AEQA 3U13A 4HB0A 1OYVA 2JJ2A 4XB6B 1EFTA 3STWA 4R5HA 5CB4B 2XMBA 3HKBB 1FW8A 1TE2A 3AHEA 2LUOA 1IONA 4N7BA 3RBXA 1M6YA 3JASB 3T9EA 1VMIA 3JD4A 5JS7A 2XCLA 4YT5A 4P2BA 3D4IA 4G9GA 1Z4PX 3V1NA 4UTPA 1IVSA 2R62A 1GD1O 4XCXA 2R44A 2ZJAA 3OX2A 2VYVA 2YHIA 1XROA 3FNRA 5DWQA 4G5XA 2GA9A 5I4BA 3WJ1A 4G5GA 1UAGA 4GQBA 3OCCA 5ILQA 3R9XA 3TN7A 1JB9A 3ND8A 2WZQA 4F8JA 2C99A 1WMBA 1YUMA 1L5QA 2QT9A 721PA 2IL1A 4HAOA 4QTZA 1C9MA 1NURA 4R68A 4CVNA 2FY8A 4DRXB 3KEMA 2Z8ZA 1UJMA 4RF2A 4WN3A 4DV0B 1N5KA 1D1SA 2FNAA 2VWPA 2YJNA 3AJEA 2G7MC 3JZDA 2P4UA 3SR4A 4ARVA 4AF8A 3NONA 2ZP1A 5ALEA 2QTWB 2CL0X 1CDOA 3WWZA 4ASUA 5BOSB 5JAUA 5MN6A 2C1ZA 3PFWO 1G5HA 2GERA 3MWGA 4YDSA 5D86A 2HA3A 3CMMA 4ZARA 4FKBA 3A9RA 1A71A 3LZCA 1RC0A 3HMKA 4HDMA 4GE0A 1JGTA 2VJLA 3V2HA 4ZT4A 4YV7A 2XDWA 3L7BA 3HJFA 4QSHA 3H75A 4EKYA 1SOAA 5EHXA 3W8NA 2HMWA 4G86A 5EIEA 2NYVA 2QN6A 3KTDA 3U7FB 5C5IA 1M1ZA 1IXYA 4BIMA 4ZMBA 5JHHB 4EUSA 1O96A 1XTZA 2BYTA 1AKQA 1BH6A 1GIAA 1N5OX 1XCGB 3BGOS 2R6GA 1P29A 2DUNA 1L4BA 4Z7NB 2Q1WA 4H9GA 2JLCA 2A9RA 2BEWB 5JJCA 3N6RA 3Q7EA 2R9VA 3NDBB 1GQFA 2JFXA 4OEHA 5AICA 1IY8A 3IILA 5I9BA 5C3UA 4PGFA 3EPLA 2FKAA 4II2A 4YIHA 2QP4A 1REQB 1VG1A 1N57A 5AJTA 4HNRA 3EDYA 1A8PA 5CM9C 4IXNA 2G9UA 3PUVA 3BFVA 3KXKA 1OUMA 3JZAA 3N0XA 4KYIB 2F3QA 2IU0A 3PFIA 4E30A 3OZRA 4LFCB 1VCNA 3TCXB 2ZCVA 2V7XA 4QDXA 4BP8A 5F78A 4ZYYA 1ABBA 1YZYA 1HWYA 3M33A 2NO5A 2QTVA 3E9QA 1V48A 2ANBA 3EGCA 3GVPA 3L46A 3NBMA 3FPAA 3SQLA 4AKSA 3VDNB 5IUNC 3SQWA 1Q2XA 1LU9A 2VZ8A 2WP8J 2C9DA 2YXDA 1H0HA 4K1LA 3UHAA 4ERXA 1K0UA 1JZQA 3AKZA 2E6KA 4PGMA 3MJTA 2Y71A 1M6EX 1V1RA 3MZ0A 5AVXA 3CKMA 1N1GA 2W2QA 4INOA 5ALRA 1DZ3A 4PLFA 5A3JA 3FPBA 4NDZA 3QNWA 1AGXA 3C1TA 3HNPA