1N5DA

Crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
288
structure length
288
Chain Sequence
SSNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQGRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSDSTYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQFVTDKKVVEWGVPPESYPWVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID DEHYDROGENASE
publication title Porcine Carbonyl Reductase: Structural Basis for a Functional Monomer in Short-Chain Dehydrogenases/Reductases
pubmed doi rcsb
total genus 100
structure length 288
sequence length 288
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n5dA00
4CM5A 4CV1A 3B1FA 3AU8A 4KQXA 1XEAA 1ZKMA 4QQRA 1HE4A 3WBFA 4AJOA 1YKFA 3IAHA 2VZ9A 3IL2A 3R6DA 1CJCA 3ICPA 3RC7A 1SMKA 1LDNA 2ZYGA 3ANMA 3DBRB 3ST7A 3ZV4A 1A9ZA 3H6KA 2BMAA 2JCXA 4XWYA 4IBOA 1QXSA 2VWHA 4E31A 5COBA 1NVTA 4GI2A 3HADA 1ENYA 4K6CA 3VH1A 1XG5A 4RQUA 5L7YA 3TF5A 1PGJA 2EIHA 4LSMA 2C7VA 2V6MA 5B4TA 4BNJA 2H6EA 1LDGA 4MPDA 3M2TA 2ZJ1A 4BNVA 5HA5A 3DBRA 3MJTA 2QQ5A 3X2FA 5U1PA 6LDHA 1R12A 4CUJA 1Q7GA 2PY6A 4R3WA 4PG5A 1T2CA 4JN6B 3IKVA 4J7XA 2TMDA 3WMWA 2FR8A 2WM3A 1CETA 3ASVA 3WFIA 1GUZA 5JCXA 1H9BA 1OC2A 1WDKA 4OSPA 3NGLA 3DHEA 4DL9A 2OO5A 1BSVA 1LDEA 5JAQA 4TKLA 1PIWA 1JKJA 3KSZO 2DBRA 4CMIB 1KETA 4I5DA 4L4RA 3OJOA 3KBOA 4HWKA 5JFOA 2GF2A 3KEQA 1GL3A 1PL8A 3GVIA 1SO8A 4DUPA 4E33A 2CF5A 4J1TA 2PGDA 5JNLA 4D3FA 4BKRA 2E49A 1A4UA 4TRRA 5ILGA 1HTBA 3D3WA 1TA4A 2JFGA 3KYCB 5G4LA 4CMIA 2IXAA 3RD5A 2DBQA 2BH9A 1YVEI 3MOIA 5AOVA 3AI3A 4WOKA 3EK2A 1FMCA 1GPJA 2OHXA 3E82A 1XA0A 4ZQEA 3CH6A 1YJQA 1K6JA 3TNLA 1U3TA 4B3IA 4R9SA 3QWBA 4OQYA 3GN2A 3KYCA 4RL6A 5G0TA 2C7GA 2VYND 2V6FA 3AY7A 1PZEA 3VH2A 1X7HA 2FPIA 4QECA 4RVUA 3ZWBA 3OF2A 5A03A 1LJ8A 5DN9A 3PRJA 3INRA 1LEHA 4MVJH 2ZB8A 4CM4B 2P9EA 4FPXA 3UAGA 2BGLA 4QUKA 2DTEA 2HMSA 3INTA 5FI3A 4E3ZA 1IOLA 4D3DA 3HDYA 3U4IA 4I9HA 1XCBA 5TNXA 4HFMA 5A3VA 1FDSA 3K8ZA 4EGFA 3PJEA 3VDQA 3DHNA 4TRJA 1B3BA 3C7CB 4U8GA 4FN4A 4ZGWA 4NQZA 4BNMA 2NVBA 1HDXA 1C0LA 3FI9A 4CM4A 4AJPA 4PVCA 4PLHA 3I6QA 3ZH2A 1KEWA 1YDEA 1M75A 3CXRA 2GD1O 1BXZA 3ZWWA 4D45A 2P91A 3Q2KA 3DONA 2LDBA 4QFCA 4PZCA 3RAJA 4CL3A 3JQBC 4E5YA 4NBRA 4GBJA 1RWBA 3F4LA 3GDFA 4QEDA 2Q1TA 4A26A 1JTVA 1ZBQA 2I99A 3I5MA 4CMHA 2W4QA 1FDTA 4YACA 5JY6A 3KEOA 1H94A 3PDJA 1JAXA 4BNTA 3M6IA 3F4BA 4YT2A 1E1NA 4BNXA 3UCFA 1DOHA 2RAFA 3AUUA 4P22A 1E3JA 1FJHA 1X15A 1ZSNA 4I5EA 4I9UA 3O8QB 4MO2A 2X0JA 1L1FA 3ADOA 2X1HA 1AE1A 2VNSA 4CMAA 1PJBA 4EITA 3LT2A 4KDEA 5IFLA 1HE2A 3HN2A 2HMTA 1MP0A 2D5AA 3GQVA 4GMFA 4JK3A 4Q39A 5IDQA 4IDFA 3I4CA 1B3RA 5ES3A 4PLCA 2A35A 4P38A 4ND2A 2BFAA 1YS4A 2CFCA 3DBLB 4WUVA 3O8QA 2QX7A 4F3YA 3HJAA 2PZLA 1ISIA 4GLOA 4WE3A 4B4UA 4DC1A 3PHHA 2RH4A 1Z73A 3MTJA 4J2OA 4NZ9A 3ZNPA 1ZK0A 3KRTA 3SJUA 1IUKA 1CWUA 4I8XA 5L4NA 3MWDB 3ZDFA 3ZHXA 5I8ZA 1Y5MA 4LW8A 3SX2A 4OXNA 3NKLA 2EF1A 1M6HA 3HFSA 3NDJA 4WGGA 2GDZA 3JQBA 2H9IA 3DBLA 2QRJA 3ZZNA 2Q4BA 2J5RA 4IDAA 4ZN6A 1Y81A 1DJQA 5A5FA 3WGIA 1T1RA 1JKIA 3VH3A 2X0RA 2DUUA 3ITKA 1JKFA 2POQX 3OJ0A 1T1SA 5A04A 4OH1A 1SCUA 3GGGA 1EUZA 3WWYA 2W2LD 5FF9A 2EWMA 3Q9NA 2Z1MA 3PIIA 3EYWA 3GVPA 4RV9A 4CLEA 4BNNA 3RBVA 4AJ1A 2QZ9A 3U4DA 3O03A 5KKCA 3PYMA 2CVQA 5KJFA 4E2XA 1VM6A 2NTJA 4E5NA 4EEXA 1PEDA 4J1SA 3OBBA 2D4AA 3MJEA 5IDXA 2XPCA 3LF2A 3L6DA 5U4QA 2ZCVA 4J2HA 3QIVA 2JHFA 3QSGA 2G0TA 4J0FA 1ULSA 5F1OA 3FR8A 3C3XA 4ZQGA 3D1LA 4U6SA 4W7IA 3EHEA 4BS9A 4BNKA 4WNIA 3IKTA 5A05A 1JU9A 2BI8A 2PGLA 3S2IA 4BO7A 1B26A 1OOEA 3H5AA 4TZTA 1I5RA 4DBZA 2J3IA 1YL6A 3E03A 3RC9A 3K92A 3GF4A 4BQPA 5IXYA 1G0OA 4N7RA 2O3QA 3VVBA 4HV4A 1PZFA 2JD2A 4HX5A 3S2GA 2Q46A 4Y6SA 2QYSA 1YQGA 5C3MA 1Z82A 2YV1A 4UEKA 2NVWA 4IGFA 3ORFA 1U7TA 1V35A 3DFUA 2VWQA 1MUUA 3PZRA 3LT4A 4AFNA 1HDCA 4E2ZA 2GZ3A 2NVUB 1VKNA 3WYBA 3DAGA 3GH3A 4P4NA 4K1LA 4R3NA 1LDMA 4CL8A 1NVMB 4ZA2A 1PR9A 2D8AA 4TRNA 2YUTA 4H16A 4JXKA 3UKOA 2IEBA 4J4HA 2I66A 5T67A 1P45A 2B4QA 4E6PA 1W73A 1X14A 2R00C 3Q0EA 1B8UA 2O48X 2EKQA 4M8SA 3SC4A 4MDHA 3I3OA 4F45A 3FNHA 3NGXA 4PRKA 3ZWYA 1LRKA 2EP7A 4FS3A 3ETEA 3F5SA 2NVUA 1E5LA 1U1IA 4KUEA 5CEEA 2OP1A 3GGOA 2W90A 4IJWA 2P4HX 4PG8A 3RBXA 2OMEA 5TRTA 3H3JA 4YT5A 3AOEA 1Y6JA 4GSLA 2PWZA 1BVRA 5IN5A 2VYVD 2J5KA 1YBAA 1MB4A 1NNUA 3ONEA 3FF4A 1IZ9A 4L76A 2VN8A 1WNTA 5A5EA 2FRDA 3ETDA 2Z5LA 2V7PA 2HJRA 4DLLA 3ZV6A 4BNFA 5BQFA 4J1NA 1WW8A 2NU8A 3TN7A 3W4KA 1NHWA 1PJSA 5I7SA 2XOXA 1E7SA 3QY9A 1QV7A 4TROA 4KUGA 3UVEA 3DOOA 4YXFA 3OIFA 4HP8A 5ILOA 1YQXA 1SZJG 1ZK2A 1UZLA 2AEJA 3IQDB 1LBEA 1OAAA 3OM9A 2PTGA 1Z45A 4HY3A 3DFZA 1EVYA 4NJMB 3CE6A 1XSEA 1ZJZA 2BHLA 3CIFA 3JQ7B 4TWRA 2X23A 3Q3CA 3WG9A 2FY8A 2VUTA 3TFQA 2ZQZA 3IJPA 4HKTA 4AJLA 3U09A 5KVVA 3GNSA 4IZIA 2YV3A 3RSHA 1DLIA 1CDOA 2HRZA 1H93A 4W9NC 3EY4A 1DAOA 5U9CA 4JJFA 1VL6A 1Z7BA 2DPHA 5L45A 4NJMA 1J0XO 3OECA 1NTOA 3JQ7A 1Y8RB 3P7MA 2SCUA 3HQ4O 3DZJA 1MG5A 3A4VA 2JKVA 2OBYA 3K6JA 3E1KA 4NJOA 3TPCA 3GLQA 4MVJA 1SEPA 1ML3A 3BHMA 2Y93A 4A27A 2O7QA 1NQOA 2DKNA 2C59A 1BGVA 4FSHA 5GY7A 1M76A 5C7OO 4J4TA 2Q2QA 1F0YA 4AJHA 3W4JA 5KVCA 1MX3A 4QSMA 4ZICA 3ROQA 2DT5A 2EHDA 1Z75A 2IYOA 1A7AA 5EERA 2B5WA 1PU2A 2W2KB 4B8ZA 4HFRA 2YW9A 2ZB7A 3ZCXA 4WLFA 3GMSA 1T25A 2DTXA 1GU7A 3JQ6A 4ZRMA 1E6EA 4KDFA 3QWAA 1XDWA 5HWSA 3PP8A 3UF0A 4NFHA 1I24A 4RDIA 3H5RA 5IG2A 1WVGA 4DBVO 1EVIA 1O0SA 1Q0LA 1Z6ZA 3FNFA 4OKIA 5DDIP 2Y05A 1IZ0A 4E32A 3U4CA 3LC2O 4QTZA 2VYNA 3GG9A 3O4RA 3PVZA 4KTTE 4LRTB 5KVQA 3RKUA 2W2KA 4CLRB 3ZN2A 2PR2A 3KSUA 2IYPA 2BELA 4NPCA 3UICA 3C8MA 1WLYA 1PL7A 1A9YA 2X0NA 4ALKA 3BTVA 2R6JA 3QQPA 4OIMA 1YBMA 4E21A 5DCUA 4URFA 4L73A 1E92A 2C2XA 1DFHA 5AXAA 2QW8A 5EL0A 1RM5A 2BLLA 3KB6A 2AA3A 3NT5A 3GZNB 1O8CA 4LVUA 1U2GA 5JAIA 3Q11A 3QJ5A 4BV9A 4CLRA 1KEVA 4IDBA 3LC7O 4ESOA 1HSZA 1DRUA 4IPTA 1ZK4A 3H8VA 3WTCA 4ZRNA 2BKAA 3Q9UA 1EFLA 3SLKA 5JC1A 1YQDA 1Y1PA 2Q1SA 1KOLA 3AK4A 4W82A 4LN1A 1PGOA 4RPKA 1U5AA 2C29D 3H2ZA 4UULA 1E6WA 1DIGA 2G5CA 3F46A 3AM5A 4D42A 2FR1A 3BHJA 3GUYA 3JQDA 2FPGA 1QYWA 3DL2A 1N5DA 2XXJA 3GZNA 3O38A 4RPLA 1ADGA 3WICA 1P31A 4ALMA 1XQ6A 1WWKA 1MV8A 2UDPA 1RPNA 4A10A 2PK3A 4XJTA 1MXHA 2BGMA 5TSDA 1P1FA 4F46A 2ZB3A 2C2YA 5EMHA 4QX6A 1YB1A 4DIFA 2GUGA 1ZXBA 4RLHA 3MJCA 1O89A 2HK9A 2Q2WA 4ITUA 3D4OA 4CV2A 2CUKA 5I7FA 2VUUA 5KCZA 4OXYA 1C1XB 3N74A 1U9JA 2I9PA 5C37A 3I6IA 1HEUA 4NBWA 5L4LA 4LVCA 3LC1O 1KIFA 1D1TA 5C7LO 3A9WA 4AJ2A 5BNTA 3AUSA 2AG5A 3JQ9A 4U5QA 3KXDA 1UP4A 5CP8A 1QRRA 1YL5A 4RQTA 5F3RA 1LSUA 4IS2A 5L3ZA 4BKUA 3IJRA 1F8GA 1K0UA 4OOEA 4FC7A 1GEEA 4QXMA 1N8KA 4KP7A 1UP7A 1EVZA 4XGIA 3TSCA 4DIOA 4RZHA 1C1XA 1O6ZA 2O3UA 5HS6A 2IRWA 2NU9A 2UAGA 3RASA 3TJRA 3DMTA 1C14A 2AG8A 4EUEA 1CEQA 1I2CA 1NQ5A 5IDWA 2RCYA 1V3UA 4QO7A 3VPXA 3KSDO 2X9VA 4CMCA 3PWZA 4UUNA 2J3JA 1X1EA 4PLVA 2I65A 4XRGA 1R0SA 4JBHA 3EZLA 3PQFA 1U7HA 4R01A 5KJ1A 2WTBA 3ZHYA 1X13A 4GX1A 4DMLA 3JQ8B 1YOVB 4GWKA 4XJSA 1JVBA 1C3VA 1B0AA 4IIUA 4O0LA 5KIAA 2UYYA 3SBOA 4BHTA 4RGBA 3GDGA 1XU9A 3GAZA 2VNAA 2HRBA 3ANLA 4NMHA 1DEHA 1KEUA 4BMSA 1DIRA 4DTIA 4Y67A 4BGEA 1BHSA 1I33A 1KC3A 4EZBA 4GLLA 4HBGA 1XWFA 3NDRA 4WPGA 3ASUA 1C1DB 2TMGA 3I52A 1ADBA 3JQ8A 1YOVA 4LGVA 2HMVA 4B3HA 3WMXA 3DOJA 2A9FA 4D0RA 4BNIA 2ZK7A 1A7KA 4N18A 3ZW9A 4C4OA 2ZYAA 1LLCA 2PD6A 2V6GA 3G1UA 4Q3CA 3U3XA 3UH1A 4DMMA 1N7HA 3VPSA 4EEZA 3ZHZA 4JJGA 1LC3A 3H5NA 3OIDA 1C1DA 2VWPA 1D1SA 2FZWA 1GUFA 1NFRA 7ADHA 4D44A 4N54A 5DNAA 4AICA 2HK8A 3COSA 3BTUA 4QFDA 1WDMA 2CDAA 3B6ZA 3AFMA 3W4IA 4YPOA 2FN7A 2X0IA 4BO8A 3KLPX 2Q4EA 2PNFA 2VHVA 1I3LA 4BNHA 5I9NA 3DTYA 1HKUA 1MFZA 2Y0DA 1LDYA 2BFPA 1GYRA 4PLZA 1TI7A 2NU7A 3DQPA 2I3GA 4GX5A 3IP3A 3QHAA 5ENVA 3R1IA 3WGQA 1H6DA 3VC7A 4BGIA 4HFJA 2JD0A 3NT2A 4M49A 3RCBA 4CJXA 5JAMA 2NQTA 5COAA 1PQWA 1YXMA 1NBOA 2PZJA 4GGPA 2WYVA 3OQ1A 3HHPA 1X0VA 4BV8A 4E12A 1HDGO 1PQPA 1LNQA 2Y1CA 4CM7A 2VZ8A 5IZCC 4Z9FA 3VAZA 3ZU5A 5AXCA 3RUIA 5T5QA 4J7CA 1VL8A 4R9RA 2WD7B 2C82A 4IJVA 3RUDA 2GERA 2Q45A 3PHLA 2P68A 3OETA 2PKQP 3FNGA 4YBZA 5IDYA 2EG9A 1DDOA 5COQA 3BTOA 3NTQA 3T4XA 2D0IA 3ROPA 4RVSA 4Z6KA 3DAFA 5L7TA 1RYDA 3PK0A 3NYWA 5H81A 3HZZA 1XR3A 3BXXA 3E6AA 1L7EA 2HK7A 3HDJA 3T4EA 1DB3A 4XZ3A 2WD7A 2O3JA 4CM9A 4ZQBA 5ITWA 3PZBA 3I23A 3S8MA 1Q0HA 1LLDA 4KMSA 4KOAA 1H6CA 4GAEA 1UDBA 5ER9A 5L53A 1MC4A 3OA0A 3UUWA 2GZ1A 1KY5A 2JHGA 4TKMA 2JFFA 4GKVA 4KTVE 3PXXA 5FYDA 1A4IA 3VZRA 1UAYA 3N7UA 2W98A 2O4CA 1BDMA 5JDCC 4GWGA 5IZCA 3P2OA 4OQZA 1ENOA 3F9IA 4DGSA 4NG5A 1SB9A 3ZWVA 3PI7A 4UREA 5DCYA 3NT4A 2IZ1A 1NPDA 3CMMA 2HDHA 1NFQA 4N5NA 1G0NA 2NLOA 1NM5A 4NH4A 5K6AC 1P0CA 3FPLA 4XR4A 1L7DA 3HG7A 4NBUA 2UUOA 3OP4A 2NNLD 3FD8A 2ZJ0A 3PEFA 4Z0PA 3E9QA 3PHJA 1A71A 3HE3A 4R1NA 2HKIA 3RFTA 4CQMB 1EFKA 5EQFA 4EJ0A 3D64A 1KYQA 5L9AA 3W6ZA 1DPGA 4R5HA 5ITVA 1EK5A 4BMVA 1LA2A 5TF4A 5ADHA 2V65A 2Y1FA 4JBGA 1PQUA 4AJ4A 4MVJF 3GVXA 1IPFA 4XX0A 1Q0QA 1X1TA 4A0SA 4EUFA 2OXIA 1FXSA 4C7JA 1UDCA 1ZXLA 4JIGA 4WLNA 1JLLA 5DBGA 4LRSB 1XYGA 4CQMA 2GN9A 3DB2A 3H65A 3OEWA 1T2AA 2D1YA 1B15A 5HBRA 4EJMA 1QYDA 1AGNA 3VZSA 5T57A 1DO8A 2CSUA 4ONEA 4NK4A 2OP0A 4BUCA 5L4SA 1U4OA 1A27A 2QHXA 1EVJA 1YB4A 4J0EA 5A9TA 5MGBA 3EVNA 1HWYA 4GH5A 4IGEA 1GTMA 3KM0A 5H83A 3GT0A 3LSYA 4WCFC 5KJEA 1ADCA 1P44A 4KQWA 5DCWA 1LI4A 3ON5A 4ZD6A 2EV9A 4Z3DA 4D79A 3LF1A 4BOYA 1HSOA 3DZBA 4KUHA 4XYEA 3DC2A 1GV1A 1ORRA 3VPFA 1ONOA 2D2IA 3OICA 3W1VA 4F6CA 1N1EA 5TT0A 5JCJD 2O3SA 3FN4A 4L75A 4XB1A 3S1LA 4G2NA 2BF7A 3QP9A 5F5NA 1QLJA 4J1QA 1H9AA 2PA3A 1N7GA 5KTKA 1OC4A 4GGOA 1HZZA 3UCXA 3WIEA 1LX6A 1U4SA 3V5NA 5L40A 5FEUA 2RBEA 3AI2A 1RKXA 3RU7A 1UDAA 1IY8A 1RM3A 2PZMA 3BYZA 4WCFB 1NR1A 1RJWA 2JJYA 1FDWA 1I32A 4XA8A 4CR6A 2FSVA 3UFXA 5L95A 3FSRA 1NQTA 3HNPA 1EBUA 4Z0HO 5CDYA 4AJJA 2YY7A 1ZEMA 3TDKA 1D7OA 2EERA 4RORA 4IDDA 4L8VA 1DHRA 1YB5A 4U7WA 3GMDA 5G0SA 4OL9A 3FR7A 4ALJA 5EESA 2G1UA 5IF3A 2RIRA 1XGKA 5GMOA 3JQFC 3CZRA 1WXDA 2VRCA 4JCOA 4IXWA 1ZZEA 1DFIA 1KVTA 3K73O 3A28A 5CDTA 3KETA 4WCFA 2ZKLA 3I9MA 3I9LA 1LRLA 1BTOA 2C5AA 4FD3A 3CEAA 3GPIA 5IZ4A 4IIVA 2O4UX 2OGUA 4LCEA 3HDQA 3ZWOA 2RH8A 3LT1A 4XYGA 2R2GA 2UVDA 1MC5A 1E7YA 1YL7A 4ZVVA 2DU8A 4IDGA 3VDRA 3QWHA 2XF8A 4II2A 3EVTA 4I5GA 1W6UA 1PTJA 3OSUA 4FIZA 1N1GA 3FNEA 4TRMA 1DJNA 4M55A 2H5LA 3RROA 3QE3A 2NTVA 2O3TA 5AXDA 3IDSA 4R68A 1I3NA 2VHWA 3GDOA 3RBZA 2QRKA 5KVSA 1MG0A 3MJSA 1E6UA 1LUAA 2JD1A 3HUDA 3NDIA 2NUAA 3PWKA 5IJZA 4BNUA 3E5RA 4DLAA 4MIEA 1EQUA 1V3VA 4JGBA 5KOIA 4ND5A 3WJAA 4YT8A 5CG2A 5JY1A 5GZ1A 3H9QA 5JS6A 2ZIZA 1J6UA 4TSKA 9LDBA 1PZHA 3BMQB 1RM0A 3RIHA 5CAEA 1Q1NA 5LDHA 1O94A 3DEYX 4JLWA 1A5ZA 3ICCA 2QZZA 4MOWA 4Y8VA 3PLRA 3LDHA 2F1KA 1V3TA 2DQ4A 5G2OA 4PG7A 3RWBA 2B37A 2Q50A 1HLPA 1SB8A 1NWHA 3QLJA 4BMNA 2E82A 3JSAA 4YAEA 3BMQA 3A06A 3WTBA 4UVDA 3EZYA 2Y1DA 4FFMA 1T26A 1AHIA 5T64A 1ISGA 1ZK3A 4IXTA 4PLTA 1E0DA 2NM0A 3RUCA 4P4LA 2I76A 4M1QA 4PFJA 1PR3A 4CMKA 4RVHA 1T2DA 3A1NA 1CERA 5FI5A 3HB5X 4DLBA 3RJ5A 2O7SA 4IJUA 1GV0A 1DC3A 3I83A 5BSGA 5KJCA 1IB6A 2Q2VA 4W7HA 1E1KA 1EUCA 1HF3A 1EMDA 1O5IA 3GA0A 4DWVA 1V8BA 3NAQA 5B4UA 1Y7TA 4ZHSA 4PLGA 4MVJI 4ALNA 3K9QO 4CMEC 5A3JA 4O1MA 1KY4A 4ND4A 4YQZA 3GZ4A 1RYEA 4PLYA 4II3A 5KNLA 1S7CA 3WSVA 2V6BA 2P5UA 2E37A 3VHRA 4FFOA 1P1IA 1C0KA 3F1LA 1AXEA 4DXHA 1D4FA 2OZPA 2WDZA 2WE8A 2Q49A 3G3EA 4UEOA 3AJRA 2WYWA 3SEFA 4BVAA 4XD2A 1V9LA 1HXHA 3RUAA 1X7GA 1EE2A 1LLUA 2FWMX 1EZ4A 2HU2A 4ND3A 3QA9A 3JYPA 1ZUD1 3BMNB 3OJLA 2VOJA 4M87A 4Z3KA 1I36A 2EEZA 1EQ2A 2R00A 4JNKA 4BB5A 2HLPA 4XCVA 1PGNA 1YJ8A 3PWSA 4YRDA 1N2SA 3CMCO 2GGSA 3DO5A 3G0OA 3DWFA 2GZ2A 4WLOA 3V1UA 3DZHA 3GY0A 4N5MA 4ZU3A 1V0JA 1U3WA 1GYPA 2AQHA 4NHEA 4JP2A 5T6BA 4NDNE 1U5CA 3S2EA 1I2ZA 2B83A 3ENNA 2CVZA 3GNQA 4UVIA 1G6KA 3BMCB 3WB9A 2A4KA 3BMNA 1IL0A 2YYYA 3F47A 3X2EA 1SC6A 3NRCA 2IDZA 3KYBA 3WS7A 5F1PA 4CMEA 3GAFA 4FJ0A 3GRPA 2VUSA 3G49A 2CNBA 4K9DA 4E13A 1GUYA 1LTHR 2YHIB 3DXFA 4Q3DA 2CY0A 4UEJA 5LC1A 1PX0A 4O63O 2HSDA 4FFRA 3BMCA 4BO6A 3AM4A 3AWDA 3WX0A 2Y1GA 1O95A 4UAGA 4IZHA 5ICSA 3VTZA 3L4SO 3T7EA 1UXKA 2GN4A 5TJ9A 2EXXA 2BD0A 4UUMA 1Y8RA 2JFHA 5KJ6A 1UZNA 1K5HA 1DSSG 4RCVA 2YHIA 1P1KA 4FFNA 4MVJP 3C1TA 1R4MB 1TB4A 5EINA 1FDVA 1VC2A 4MP3A 5JO0A 1IHXA 1N92A 3WQQA 2WWRA 3AUTA 1QR6A 3BZUA 3H9GA 4MKRA 2VZ0A 3ZV5A 5B1YA 1U2DA 3ZU2A 1IHYA 1XQ1A 4B4WA 1VJTA 8LDHA 2AQIA 5LCXA 1C0PA 3IIEA 3GK3A 1U28A 1BVUA 2VHZA 1B2LA 4IQGA 3UW3A 1DBVO 1QG6A 1LLQA 1PJ3A 4NK5A 3WQSB 1R4MA 3CUKA 1VJ0A 4GX0A 1TEHA 4W9NA 1HDYA 3DZFA 5EPOA 3OMLA 3R3JA 1W0CA 3TL3A 4CV3A 3ROMA 3L9WA 4GVXA 2C20A 2VTEA 4IMPA 5JPIA 1DIHA 4Z0TA 2EJWA 2BRUA 2Q99A 4BO2A 3GEGA 3P2YA 1GCUA 1CRWG 2Y99A 4J7UA 4IINA 3TZ6A 4FOSA 1XLTA 4PN3A 3Q1LA 3CZMA 4PCVA 4UUPA 1ZFNA 1JAYA 3RU9A 1Y5RA 3BA1A 1F12A 4H15A 2EGGA 1SPXA 3IOYA 3FBTA 4K28A 5JAZA 3DDNA 2A94A 2B4TO 2D5CA 4RVGA 4YT4A 1ZEJA 5CHEA 3V2GA 3KOUA 3L6EA 4FCCA 4Q3BA 3TZKA 4B7UA 4O5OA 4Y6PA 5H82A 4E30A 1OBFO 5DF1A 2JCVA 4CM6A 1ZIDA 3PJGA 4XGKA 3RUHA 1VI2A 3HB4X 1FK8A 4LMPA 4DVJA 3H2SA 3PPIA 4M54A 4MIOA 4EI2A 4XQCA 1ISJA 3WQRA 4CLDA 1ARZA 4DA9A 3RI3A 2GYYA 1R0KA 2P5YA 3L6OO 3WIDA 4EW6A 4WJZA 1SOVA 3GEMA 3JQEA 4IQ0A 5TIIA 3FWNA 4GQAA 4U0KA 2B69A 3D0OA 3MEQA 1K6IA 2J6IA 3NX4A 2GSDA 3H9JA 1WMBA 1EDZA 1ZK1A 2HJSA 4IY1A 1ZW1A 2VOEA 3S55A 1WPQA 2VTDA 2JCYA 1NXQA 1DLJA 5T8KC 4LSWA 3CTMA 2C54A 3OEYA 4R1SA 4XYLA 7MDHA 1OI7A 3AY6A 4ZQFA 1B8VA 1T2EA 4B7CA 3VH4A 1TVEA 3DTTA 1AXGA 1CQIA 4DQXA 4AVYA 4RF3A 4FR5A 4BKOA 4KWIA 2FSSA 1QYXA 1R0LA 4PLFA 1NAHA 3C7AA 3NUGA 1MXFA 1NQAO 4D7AA 1UH5A 3U4HA 1E7QA 3V8BA 4BO1A 4NR0A 2PH5A 1Y9EA 3KLMX 5TJHA 4IS3A 1Q7BA 5CPBA 4H7PA 1YBVA 3LU1A 4J3FA 4AJIA 1BW9B 2Q3EA 4GMGA 3RFXA 4MP8A 1X7DA 3CINA 4FJ2A 1HT0A 2PFGA 2WE7A 4J6FA 4OMUA 2HUNA 2NV6A 3AUAA 1TLTA 1K2WA 3GEDA 3A14A 3ZU4A 1V6AA 4IM7A 3WGZA 4E4YA 3ENKA 4R54A 3PTZA 4MIYA 4DPMA 3JYOA 5JYDA 4CV0A 2W2LA 2ZTLA 4E5KA 2DTDA 4I9NA 1BW9A 1PJCA 3RC2A 3DBVO 5HM8A 4OJNA 1M6WA 3W6UA 3ZU3A 4RVDA 1GZ4A 4I08A 2B36A 4BNZA 1YRLA 4YWJA 1XHLA 1YONA 4MP6A 3VPHA 4CMGA 4FFPA 3RVDA 3C85A 4AG3A 3V1TC 2CF6A 2PGJA 3TZCA 4D46A 1W8DA 4Z9YA 4CR7A 3F3SA 3OJEA 4CUZA 1PJ4A 1S6YA 3JQCA 3JYLA 4CLHA 2EKLA 5F1KA 3K96A 5G0UA 1HLDA 3AU9A 3QVSA 3V2HA 3GN1A 3WOHA 3QWFA 4Y6RA 3GG2A 3QWIA 4D41A 4GVLA 1IULA 4Q3EA 3JCZA 2WMDA 1LXCA 1XKQA 4RPJA 3AW9A 1J5PA 3W8EA 3SVTA 4HADA 3JD0A 5TQVA 4KWHA 3QV1A 4JP3A 4IDEA 3MCVA 4N5LA 5C7IO 4WEOA 5DP2A 4QT0A 4A2CA 2NWQA 3H9EO 4NI5A 4PLPA 3HDHA 5DOZA 1K6XA 4RPHA 5CDGA 3DAPA 3E48A 1HE5A 4IMRA 3TZQA 2VT2A 2RHRA 2UV8A 3GC6A 1QMGA 2WYUA 4TZKA 4YAKA 3L77A 3AM3A 2YDXA 2GRAA 1BXGB 1RM4A 2H1SA 2Q1UA 1HYGA 1WZIA 2ZQYA 5THKA 2Y67A 2PD4A 5A4DA 2YHUA 4TVBA 1ADFA 3RC1A 2O2YA 3U49A 2PV7A 3UXYA 3GHHA 3WJ7A 3EDMA 3NTOA 4MINA 1NHGA 2D3TA 2GNAA 2FOIA 2J3HA 2EW2A 4IQ8A 4X54A 1I30A 1PGPA 4EBFA 1GAEO 2X7HA 1KVUA 1ZMTA 1HDRA 2AEFA 2CDCA 3O26A 4G81A 5BSEA 1BXGA 5IXSA 1ISHA 2BFMA 1VJ1A 2HO5A 1YWGO 3DZGA 2J3KA 4WOJA 1IE3A 1R66A 1NASA 3G79A 1YGYA 4JBIA 4BO9A 2OORA 4W4TA 5CPFA 5ENDA 5A1TA 1OFGA 2O50A 1ZSYA 2Z95A 3LVFO 5THQA 3WNVA 2VYVA 1P9LA 3WLEA 5I7VA 9LDTA 1I10A 1M67A 1I0ZA 3F5QA 3TL2A 3ULKA 2BI7A 4FBGA 1PWXA 4JX8A 3TOXA 3OA2A 3WGYA 4CUKA 3D3WB 3PYLA 4MVJG 4FOOA 1U8FO 3I9OA 4A5OA 4CLXA 1PGQA 4MVJD 5A06A 4A03A 2X58A 1DFGA 2WEKA 1JWAB 5JLAA 2YZ7A 1KS9A 1WMAA 4BL5A 3ETGA 5DOVA 1LQTA 2JAPA 3JQAD 3JQGB 3ZW8A 3KYDB 3WYCA 1DHTA 4Y98A 1NAIA 5HS4A 2Y1OA 3WYEA 4E5PA 3EGOA 5GZ6A 2DC1A 4K26A 2Q1WA 3BIOA 2FP4A 5AQ1A 2NQ8A 3WDSA 4W99A 1QORA 3ZWCA 3D3EA 4S1VA 1DXYA 8ADHA 2X8LA 3ONFA 4PIVA 1P3DA 1DRWA 3AFNA 3BTSA 3JQGA 1H6AA 4ID9A 3KYDA 1LU9A 4G5HA 1HETA 1R4NB 2IZZA 1BDBA 1E1LA 3FTPA 1BWSA 4RF2A 3DHYA 3WGTA 3ZWNA 3P19A 1PS0A 5JW6A 3FTNA 4E2YA 3C1AA 1ISFA 2G17A 3K5PA 1QP8A 1HYEA 1KEPA 1YH3A 3DMYA 5JC8A 3PFFA 2VHXA 2VCYA 3JV7A 4DYVA 3KV3O 4AJNA 2AE2A 2AXQA 4CPDA 1DAPA 1R4NA 1WDLA 1U3UA 1H2BA 3I4FA 1UP6A 3BMOB 3L9XA 4AL4A 4NBTA 4M86A 1SAYA 1ONPA 1OZAA 2ZTVA 3DR3A 3JYQA 4LMRA 3TWOA 2X22A 1NP3A 1PJTA 1P33A 3GR6A 4O6VA 3E5MA 3W8FA 4HNHA 1Z74A 3AY3A 4MVJM 4LK3A 1LRJA 1NPTO 5JDCA 2FHSA 4TQGA 2EP5A 4I5FA 3PGXA 2DAPA 3PDUA 1R15A 4U6QA 2YJZA 3H3FA 1TT7A 3BMOA 3IUSA 1ENZA 3H4VA 3VZQA 5K6AA 1TT5B 5FFFA 1ENPA 5AVOA 3IP1A 3HWRA 5I9MA 1ZH8A 2IXBA 5BSHA 4OAQA 2J5QA 1KBZA 5JSFA 2B4RO 4PG6A 2W8ZA 3E8XA 4XKJA 2X9NA 3N58A 5L51A 3ONDA 3IUPA 1HDZA 4CM1A 3B20A 4RF5A 4D43A 3TOZA 4MVJE 4J16A 1P1HA 2UUPA 2ZB4A 3EMKA 5ER6A 5F5LA 4B4OA 3BHIA 3GPDG 4OKNA 3TQHA 5BNIA 1TT5A 3BAZA 3VPGA 3OFSA 3TRIA 2RHCA 5FWNA 4RVFA 4YAJA 4BB6A 2YQ5A 4XDZA 2X9GA 1BRMA 4OGWA 5CG1A 3WNQA 3F1KA 3QVWA 3PLNA 4R1UA 1ISMA 4YDRA 3D5TA 3VKUA 4E0BA 1JWBB 2O23A 3MJVA 2DLDA 4OSOA 1H2HA 4PG4A 4DRYA 3RKRA 4WEQA 2FR0A 1K89A 2QG4A 4XB2A 4INAA 4XRRA 5JE8A 2HMUA 3E9NA 3HFGA 3LLSA 3Q2IA 2QYTA 1B14A 4LCJA 4WCDA 4RO0A 4YJGB 2Y68A 3IMFA 1GQ2A 5TT1A 2GLXA 1GADO 1I3MA 3VTFA 4R41A 4L74A 4R4JA 5CFZA 2E6UX 4Q9NA 4YTEA 4CLOB 1KVRA 1UAGA 5EIOA 4C7KA 3MJ4A 3RUEA 2VHYA 3VVCA 4CR8A 3UOGA 4L4XA 4R5MA 3JD3A 4FB5A 5KKAA 4DREA 1FDUA 4YJGA 3P5SA 4YAIA 1VPDA 5AYVA 3WXBA 3NEPX 3B1KA 3RQSA 5ICMA 1IYZA 4CLOA 3TFOA 3E9MA 4R1TA 4KZPA 3EAGA 2YQ4A 3OH8A 1ULUA 3DBHB 2ZATA 3UGKA 3GFBA 3JD4A 1EK6A 2EW8A 4B7XA 5IAAA 2FPPA 1PS8A 3JTMA 5CEJA 1SOWA 2QRLA 3ITDA 4RZIA 4XQGA 4XYMA 1WAMA 3JD1A 1I3KA 4B4VA 3LQFA 4RPGA 4BGVA 2AEMA 3WSWA 1EE9A 4OYRA 4EDFA 1YO6A 1MLDA 3G17A 4BIIA 1XU7A 3PQDA 5DULA 4BNWA 4CMBA 4YJFB 2GN6A 1T4BA 3DBHA 5HRUA 3JQFA 4XEHA 2JAHA 3UN1A 3RFVA 3AOEC 2YV2A 3IS3A 3V2UA 1H6BA 2PKRA 1E7RA 1VL0A 3ABIA 2DBZA 1D8AA 4WECA 1B8PA 1M66A 1X0XA 1O9BA 3LT0A 4BO0A 1B16A 3GVHA 1HDOA 1HYHA 1WZEA 4D3SA 1E3EA 1UXHA 3FPCA 1H5QA 1ZVMA 2IZ0A 3D7LA 2BFOA 3ZWAA 2XAAA 4BO3A 5IN4A 1PJLA 3DZIA 4YJFA 3ZGYA 4RF4A 3W8DA 1NPYA 1YE3A 3JYNA 1VLLA 1QYVA 1LDBA 1A72A 1ZNQO 3L07A 2GPTA 1GYQA 4BKQA 4NBVA 4GSKA 3EW7A 4RDHA 5G0WA 4OXKA 2GO1A 2Y0CA 4XR9A 5JXWA 3KZVA 4AJKA 1PJ2A 1VSUA 1MGOA 1HRDA 2CMDA 2X5OA 2ZTUA 5GZ3A 4J90A 1LSOA 2VWGA 3OHSX 4TVOA 1SEVA 1T2FA 4M89A 1R6DA 3B70A 3Q6IA 1Y9AA 4RJTA 4CMJA 1NVGA 4IUYA 3ZWMA 4Y9DA 3CPSA 3D4PA 1QYCA 1NR7A 4Q3NA 3KUXA 2WD8A 1DC6A 3M2PA 2CVOA 5DP1A 3WWZA 4DQVA 1T24A 1GY8A 2PKQO 4WK6A 3PJFA 4E5MA 4AJEA 3CSDA 1MFPA 3FCOA 3U9LA 4DPKA 3H7AA 4ALLA 4OOFA 4NU6A 4PLWA 1U8XX 1Y8QB 2Y1EA 1CIVA 4EUHA 1P77A 4XGNA 4BNYA 5I7EA 4YA6A 1YDWA 4FC6A 2DFVA 3I9KA 4R69A 4XQEA 3VKVA 4B79A 3ZNQA 4WASA 2OOSA 1LQUA 3G1TA 2NADA 4CM9D 2AQKA 3L4BC 4XYBA 1B7GO 3D5QA 2Y0EA 3C24A 3MZ0A 3QRWA 3D4NA 5JO9A 4CM3A 2HCTA 2P9CA 3OJFA 1T4DA 1DRVA 1NFFA 1Y8QA 3EUWA 1CF2O 2DVMA 2B5VA 5DT9A 1VSVA 1CQJA 1E5QA 3WGHA 1EBFA 4NIMA 1HL3A 1GQQA 2B0JA 3ZWPA 2WJPA 2XXBA 1PL6A 5C5IA 4MKZA 1M2WA 2ILTA 4DYDA 1AN9A 2OUIA 2YFQA 3SJ7A 2OFPA 3U62A 4PGFA 4PRLA 3MOGA 3NJ4A 2NSDA 3R0IA 1EDOA 4BO5A 2EKPA 2PLAA 4R51A 4H3VA 3GVCA 3FHLA 3FBGA 4F6LA 5CDSA 2AHRA 1U3VA 3C7DB 2EGHA 4XQ9A 1J4AA 3MWEB 3M1LA 4Z9XA 4UVHA 3PFWO 1W4ZA 2C5EA 4WKGA 2HMWA 3CKYA 2ZCUA 4R16A 3TZHA 1PSDA 1GPDG 1UR5A 1ZJYA 3KHUA 1QSGA 4UUOA 2P2SA 4UVGA 4YB8A 3K2BA 2AE1A 3U5TA 3PJDA 5DBFA 1XIVA 3I1JA 4YQYA 3VOSA 3JQAB 3QVOA 4FJ1A 4HUJA 1ONNA 1GQYA 3QVXA 4EJ6A 5LDGA 4YYZA 4HNGA 4ILKA 2OL4A 1PJQA 4HFNA 4B8WA 4IJKA 2YDYA 4E2WA 2WSBA 1JDJA 3V1YA 5I9LA 3L4BA 1JVSA 1E3IA 5EN4A 4CODB 5TLSA 2AMFA 3FRJA 3WR5A 3ZV3A 1J49A 1VRWA 1KVQA 5F21A 5BT9A 2C07A 1TXGA 4J9VA 1JN0A 4W6ZA 1SBYA 3JQAA 4XIJA 5BSFA 1HE3A 4CQMD 1WP4A 4DC0A 4ND1A 1I01A 1ZSVA 4GL4A 5K0ZA 1E1MA 3GGPA 2BGKA 3ZHBA 4HXYA 2AQ8A 2P9GA 4FW8A 3DOCA 3OIGA 3I9NA 1E3LA 1QV6A 5AXBA 4BQRA 2NACA 4DPLA 1E77A 1BXKA 2I3AA 5B4VA 4JQCA 2NTNA 3O9ZA 4JJIA 2D59A 3PYXA 1LSSA 2I6TA 4PVDA 5I8WA 4XIYA 2NU6A 3PHGA 3UCEA 1GZ3A 3EC7A 1F06A 4ROSA 5A9RA 5JDIC 2J8ZA 3FWZA 2X86A 4NFSA 4RLSA 1LC0A 3WGGA 4BNLA 3E18A 3JD2A 3QVTA 3HSKA 4GPD1 1DC4A 5MDHA 1E7WA 1K3TA 5A9SB 3C1OA 2DBVO 4J9UE 2IEDA 1H0KA 1AUPA 2DPGA 3GHYA 4J4BA 3S2FA 1BG6A 3WLFA 3JQ9C 3ZNNA 1EEHA 2C0CA 4MKXA 4J49A 3U0BA 2VRBA 1GZ6A 1F14A 2HAEA 3WBBA 2G76A 2GASA 3WGOA 1N9GB 1IPEA 3LYLA 2GCGA 4CQLB 2Y66A 4YRAA 5TGDA 2YFHA 4TMFA 2O3RA 5A02A 2O2SA 2AW5A 4LISA 4DIBA 1VE9A 1GCOA 4Q3AA 5B12A 2QIOA 1I2BA 5A9SA 3DMTC 3GFGA 1UXIA 1UZMA 4UVEA 4XDYA 3UHAA 2I67A 4NU5A 2DFDA 2HQ1A 3ROKA 3NJ8A 1VKOA 3GRKA 4PZDA 3QW2A 2VRCD 4WLVA 5EJ2A 5G4KB 1N9GA 4YRBA 5JBIA 1KC1A 4CM8B 4NNJA 4CQLA 1I8TA 1NX6A 4JROA 2A92A 3AOGA 4EYEA 4WLUA 1ZMOA 4MJLA 3HN7A 2JL1A 5JCJA 5J23A 5B37A 4YJHB 2ZTMA 3GUCA 4YAGA 1GFSA 4U0JA 5TS3A 4P4GA 5JDIA 1JQBA 3T7CA 1JW9B 3ZI0A 4YVFA 2DUWA 1AHHA 1GR0A 3OQBA 3IC5A 5G0VA 5G4KA 4CM8A 1MA0A 3M1AA 4ZQHA 1DC5A 2PD3A 2X5KO 2B35A 1ID1A 4K6FA 5JMWA 1Q2XA 2OBNA 4PZEA 1NWCA 4J91A 4B3JA 1UXJA 2FZEA 1E3WB 1R16A 2ET6A 5JMPA 5KWEA 2CDBA 3LK7A 3R3SA 4FQ8A 3SXPA 1D3AA 4DQUA 1PS9A 2X5JO 4YJHA 4BGUA 1P0FA 1Z7EA 2Z1NA 4G65A 3OQ6A 4IDCA 4YEDA 1QLHA 2EJVA 4A7PA 1NYTA 3MTGA 1KVSA 2P4QA 3LLVA 6ADHA 5CDUA 2CZCA 3PQEA 4J43A 3GOHA 5BNFA 3SLGA 4FGWA 4WNCA 3NTRA 5DBIA 4P8RA 3WFJA 1XELA 1E3WA 2I5PO 3SC6A 3DZKA 4OO3A 4BKPA 3KVOA 5JYEA 4BO4A 3KTDA 3RJ9A 1Q7CA 4GX2A 2FMUA 1CYDA 5K9ZA 1EUDA 5BR7A 2G82A 4S3MA 1ZO8A 3LZ6A 1P1JA 1E7MA 3I9JA 4YCAA 1G1AA 1UUFA 3ADPA 1GDHA 3K30A 5DZSA 2F00A 1GD1O 1R37A 1C0IA 2X6TA 4FFLA 4L4SA 5T8KA 4YR9A 1DIAA 2GN8A 3ANNA 3H9UA 1BMDA 1FF9A 4I1IA 4NFYA 4O59O 5CEFA 4ZJUA 1P1RA 1PZGA 3L0DA 5L7WA 4L9RA 1KERA 3VZPA 3F6YA 2VQ3A 2DM6A 3NV9A 4BNGA 5HTOA 2GR9A 2E48A 2PH3A 2IE0A 2ZYDA 4FDAA 1E3SA 4WLEA 4YJDA 1DIBA 2IODA 3RUFA 3STHA 3PIDA 4FGSA 1F8FA 2LDXA 1F17A 2CD9A 3B1JA 4L0QA 1GEGA 1HZJA 2H63A 1PWZA 3K2EA 4GKBA 4OHUA 4OM8A 3AI1A 5EQDA 3ZNOA 4A73A 5TX7A 1QKIA 1JA9A 1P74A 3PGJA 3GNTA 2VT3A 2X4GA 1SNYA 3K31A 1LSJA 3ZWXA 2E4AA 1ZCJA 1OMOA 4QO8A 3INGA 1UXGA 4ALIA 1UJMA 2PZKA 4D0SA 3KO8A 3PHIA 5TC4A
chains in the Genus database with same CATH superfamily
2GBCA 5J5VA 1RXYA 3B1FA 3HCFA 4CE6A 3AU8A 4P2GA 3WBFA 4O4JA 4AJOA 3NUQA 1KMNA 1T43A 1G291 1Y6QA 3IAHA 1T5TA 4XSHA 5LQRA 2MWMA 3IL2A 4EQ6A 1KYXA 4WUTA 2ZJ8A 3ZK7A 3HXOA 2V7TA 3GLSA 3D6JA 1IOVA 3HVIA 3SZMA 1A9PA 3O8DA 1QXSA 4RIGA 3GXBA 5FIUA 4HAXA 1QIHA 2IUEA 1HURA 4LTNA 5AR1A 2FW9A 3HADA 4MEAA 4XWGA 2XGMA 2YS7A 3CXUA 3DL4A 3U7RA 3UMMA 1LNSA 1XD8A 1XG5A 2NO7A 2XTAA 3TE7A 1LPAB 4NZOA 4EHBA 5HRCA 4JL8A 3ZJVA 4ZVTA 2WV9A 3LL4A 5G3YA 3U3ZA 5AVZA 3W5CA 3IVMA 2H6EA 2GN2A 2WIJA 621PA 2A88A 4HWOA 4P93A 4ZQCB 1QHIA 2ISCA 3OD5A 5HCNA 4P3YA 4BNVA 5HA5A 3DBRA 3MJTA 3T52A 3B8EA 3F7NA 3LGSA 2PGXA 3CPJB 1UM9A 3EVBA 1RI5A 2PTHA 4R3WA 3IUQA 5TQ0B 4JN6B 1E9CA 2MSWA 2XYPA 2WMOB 3MVEA 3DE4X 3IOBA 2TMDA 4I50F 4MEBA 4Q3KA 3WMWA 4Z51A 1DCTA 2XITA 1G6OA 4EHIA 2Q7DA 3AERA 4C5CA 5HM6A 1GUZA 2FUG1 4X44A 3S40A 2ZFUA 5HFAA 3V7WA 5EWJB 1AN0A 2OO5A 2PUHA 3ETCA 4INPA 1LDEA 5JAQA 2HNBA 2JH9A 4HHEA 3D9QX 2LE0A 3FDFA 3V4SA 1ECGA 5F2NA 4HAYA 3TGWA 3HL4A 3UT5B 2C9BA 1KQ3A 5AUNB 1JP7A 2QN8A 3PA6A 3ASYA 3RE1A 2VO1A 2RBGA 3ZE8A 1N5MA 3IUNA 1V5FA 4NBKA 1SC4A 5I9SA 4D82A 1WTAA 1WZNA 4KQMA 3R77A 1SELA 2PX4A 1O95D 1XNHA 3NNSA 4IZOA 2EX1A 3ONNA 5BWNA 2FH5B 2PGDA 2YS6A 4EL5A 5JNLA 1RXWA 3NNNA 3HU1A 4Z86A 2VSFA 3G13A 5C8YB 2FW7A 2WINI 2QJTA 5ILGA 1MMFB 4F7DA 4C5BA 1IB0A 1TA4A 3D3WA 4LE0A 1WS6A 2VTKA 3V4LA 1CW2B 3KKQA 4IG9A 4IZ6A 1MR3F 5J1TB 5BQOA 3KVRA 2P9FA 4CMIA 1M8JA 5INTA 4FYYA 1ZRMA 5LMNB 1VP9A 1CS0B 1R4AA 3IQZA 1FX0A 4PTZA 2A9PA 1C3JA 4WOKA 1KIAA 2QZSA 3UT0A 2QDXA 5AQEA 3HCDA 4E22A 3E82A 1B0ZA 2FSPA 1DIOB 1V3QE 2PAAA 3CH6A 5I48A 1YJQA 3D7SA 1AKVA 4BEJA 4KE8A 3TNLA 1M1UA 2QUBA 3DCYA 4B3IA 4R9SA 2IV2X 1N4AA 4OQYA 1P0PA 3FOBA 1NDHA 2C7GA 1MHTA 1OXTA 3L0OA 2GBLA 1B00A 4BMCA 3TNFA 3T06B 1YF3A 1XALA 4REMA 4F3RA 1XOIA 2QU7A 3OF2A 3CX8A 4NCJA 1YJ5A 3LXRA 5SYAA 3OQNA 2HW8A 1Z17A 5DN9A 1D6MA 3DCIA 3SM9A 4EYKA 1A9QA 3DO6A 2ZB8A 2P9EA 3KQVA 4FGJA 2CZQA 3I9FA 2BCGY 4FPXA 3WK5A 4XWKA 1MTOA 2YH2A 4JR2A 1NG9A 3GFQA 3V1LA 3AKYA 3IAUA 1E2EA 1V8OA 3INTA 3QE9Y 1X1QA 4B3FX 4Z4FA 4WA7A 2JI4A 2WZQA 3LOQA 2HHLA 1GA1A 4I9HA 1K0FA 3IHKA 4HFMA 5JEDA 2IBMA 2ZPAA 3K8ZA 4EH1A 3R24A 3CKKA 3ECCA 3PJEA 4FD2A 5TS2A 5CFLA 2YINC 5AM1A 1U2QA 2REXB 3B9QA 3DHNA 3K0FB 1FFHA 3MGKA 3LM8A 1Z4PX 2HIMA 1B6GA 4NQZA 4BNMA 1X7WB 2BR5A 5LXTF 3VNVA 3RYHB 1X7ZA 3D54D 3FI9A 2X7XA 4AJPA 4CM4A 4HVTA 5EXDA 4F97A 1KEWA 3R23A 2WJGA 4J8PA 3EXFB 5ETJA 2ADFA 1X42A 3CXRA 3DDCA 1MH9A 3VNAA 4HAWA 4RH3A 4B6PA 1L4NA 2HZ7A 2QUJA 2REQA 1E32A 4RELA 2NTEA 1CEEA 3BL5A 3OCYA 3PG5A 1OCEA 2ZYTX 3DP9A 4CL3A 3RAJA 2NG1A 3AR7A 2OCDA 3JQBC 5JCPA 4QEDA 4P34A 5HK8A 1CJBA 4QAQA 4A26A 3G88A 1EHCA 4WK2B 3TX6A 4CMHA 4YACA 1PE0A 3PDJA 1JAXA 3EW9A 4BNTA 4L8GA 3PEYA 2AOUA 1Z5OA 4M0MA 4IHAA 1DOHA 4Q1FA 5IMBA 4CFSA 1L4KA 2FKAA 4CXMA 2HOQA 5CLGA 1DG1G 1I1OA 1YHNA 3E23A 3R6WA 4I9UA 2X4DA 5LQMA 3QKSA 1E2BA 1FFBA 3ANSA 1KAOA 1PJBA 3QYFA 4G5XA 5H1YA 2V3VA 4HTFA 4CMAA 1FFYA 5DB4A 4KDEA 3VSCA 3AB7A 5DLEA 3FNQA 1EVKA 1FFAA 2IZ6A 3KQQA 4UBIA 5F4BA 1XMQB 3KR0A 3ZIDA 1MP0A 1T29A 2YBEA 3KT8A 3PNOA 4JK3A 5IDQA 4IDFA 5FP0A 3I4CA 4PLCA 5JTTA 1GGJA 1MQ8B 1Q95A 2RKOA 3ESAA 3C8UA 2AI2A 5FLXA 2X19A 1R2QA 4R2HA 3FYTA 1FA9A 2NT3A 2F3TA 4KAXA 4WFIA 4ZYYA 3NIBA 3RDPA 5ESRA 3WIVA 3OE4A 3GW8A 4GLOA 2C78A 2F3PA 5K8IA 4GPAA 4J2OA 3OZ7A 3RTEA 3ZNPA 2VSXA 1ZK0A 3DCJA 1OTYA 5KQMA 1DTSA 4DR3B 1HRKA 2Y3IA 1IUKA 3MF4A 1JE1A 1YFJA 2ZWVA 3RGGA 3ASZA 1R0XA 3FPKA 1AKMA 3MHPA 3JVEA 4LW8A 1SCUB 3SX2A 4C0KA 5K7SA 4FBLA 2L0XA 3SBXA 1HLGA 1KZ9A 2GDZA 3L8YA 3EQ9A 3T7IA 3DBLA 2QRJA 1WETA 3FDIA 5CK5A 4B3MB 4IDAA 4KXXA 1TNDA 1EGVB 5KHOC 2OO3A 2O2GA 1N5IA 3BD8A 5ARBA 2WKSA 1BMFD 3NOQA 2IYTA 2RKWA 3LUJA 4M22A 4R9UC 4F2DA 3WGIA 1OI4A 1I4OA 1UFRA 1F2TA 4NZNA 4YJ3B 2WPDD 3ZLUA 3VH3A 4Z4QA 4BCBA 2B34A 2P75A 1Q1EA 4M99A 3A9CA 4X92A 3C74A 2O19A 2JDIA 1L6IA 4F38A 1P62B 3C3MA 4J07A 1EUZA 1KL7A 1BRTA 4K0RA 1QTQA 1H2WA 2EWMA 4KO3S 1NYLA 5EXEA 3PIIA 4ZEVA 4NSNA 4CLEA 4MV6A 2LTAA 1R0BA 3D3KA 4GHWA 1LPMA 2QZ9A 3O03A 4GLFA 5C53B 1RABA 2XH8A 2OTCA 3HLKA 3FTFA 3OAAD 2LD4A 2E2WA 4E2XA 3PF9A 4DRZA 3EEQA 3E7DA 3K0CA 4X45A 3T4UA 2OCLA 4L1KA 2QA5A 3LPAA 4PPYA 3DLBA 1P8AA 1CZOA 2AOTB 1B4DA 1BYUA 1DEXA 2D4AA 2DPXA 4JA2A 4Q48A 4Z4HA 1Z4IA 5U4QA 2IXGA 1NMYA 2WABA 2O0MA 3QSGA 2GZDA 4V0MA 5LU9A 1X86B 1AU9A 3GA5A 4FXOA 5HQJA 2BHTA 3D1LA 2ZDHA 4TS9A 4W7IA 3WMRA 4BS9A 4WNIA 3WLKX 1SVMA 3FPGA 3AG5A 1DBSA 5IT9A 3BL8A 3QI2A 1I5RA 4DBZA 1YL6A 3PQ2A 3HCAA 1M1YE 3EAFA 2XCUA 3PD1A 3T34A 3B85A 3GF4A 1LH0A 1CUIA 2IELA 1VYHA 3A4LA 3O84A 4TS4A 1N5OX 4N47A 1PZFA 1QX4A 3EGXB 4M9XA 3S2GA 1YHYA 2MR6A 1T4GA 2VJQA 2QYSA 1N25A 1XDDA 5C3MA 2GX6A 2YV1A 1U6KA 3CVWA 3A1SA 4N3GA 1P81A 3BEOA 5FA8A 3I1FA 3ORFA 1Z34A 1V35A 2GF0A 4D6PA 4RV4A 2VWQA 1A9SA 2PZBA 2VDLB 2WU4A 3AIKA 4F9GA 2BZSA 1F9EA 3AGQA 3EGWA 1U0SY 3DAGA 2KI5A 2D8AA 5CD9A 3QI7A 1RQXA 3TQQA 1RYHA 2IEBA 2QVXX 2PYIA 2I66A 4M1EA 2VR1A 3PWTA 1P45A 1FC0A 3P5BA 4BU1A 2O48X 3AHEA 3TG2A 3VFDA 4M8SA 1QUEA 4KIUA 4Q66C 5DW3A 5FO1A 1ZD8A 3C0KA 3B6EA 2JC3A 4MDHA 5YASA 5EJEA 1EHIA 3FNHA 3HJNA 1RJGA 3LIIA 1HNXB 4U2KA 4M76B 2GSWA 3ZC3A 3SYNA 2GXQA 2W93A 1ND5A 1U9ZA 3T7AA 4C6TA 4KREA 1UFOA 1XF1A 3LBNA 4QOIA 3GGOA 4UTPA 2W90A 1H0RA 1XTIA 4IJWA 4ZCRA 3RVLA 2BV3A 1QYRA 4QRDA 3ADKA 2J4FA 4WGFA 1TJ4A 4PZUA 3CX6A 5TRTA 2FGJA 1M1ZA 4KR0A 1XNQB 1YCDA 1GXSA 1KDPA 4GSLA 2PWZA 5LQAA 4IUBS 5NULA 3U16A 3QMMA 1YBAA 3JVIA 3EG9B 3ONEA 2GWHA 1G2OA 2ZT5A 1Z63A 2VUHB 1IZ9A 1WZUA 2A0WA 2F1OA 3H2JA 1BX3A 2IDKA 3ZQ6A 4EO9A 3Q0TA 4DAEA 1JYSA 4I8DA 3BWEA 2V7PA 4UFPA 4X41A 1VG9B 1W25A 2WJZB 1VFPA 4TM8A 5JJBA 1KMHB 1LFDB 4QNMA 4J0KA 2ZRCA 3QLUC 3WYNA 3ODGA 3TD6A 3W4KA 3W2GA 4LFBB 3W77A 3VU9A 1PJSA 4C2BA 5BY2A 2QN1A 1UKCA 2TMYA 3QY9A 2RHLA 3PF8A 4TROA 5EHGA 4KUGA 3U7GA 2VSYA 3DOOA 5CT9A 1HK7A 3JWHA 3DAOA 4KAJA 4AF6A 1R50A 1RP1A 1SZJG 1M2FA 4HAVA 4MUYA 3V2UA 3IQDB 3ICVA 4D80A 1LBEA 1QHGA 4FEEA 3DFMA 1RQ7A 2PTGA 4CNBA 1T9BA 2VQ6A 2JIPA 1Z28A 1Z0UA 2JEZA 1KBOA 4MDFA 5LQUA 1GL9B 1KI9A 1R6TA 3FYSA 2B1JA 4V1CI 5HQTA 2BHLA 3SZOA 3CIFA 1E4EA 1E1DA 1U2PA 1Z0ZA 3L2OB 4YAUA 3HUFA 3P9PA 3TFQA 2Z5FA 4ND8A 5FPSA 4EKGA 5BW4A 1H3EA 3H87A 3IJPA 3MINB 3NKVA 5IK2D 5LOVA 1KZ6A 2Q5QA 4LGMA 1U9CA 1J07A 2IHKA 4Y2RA 1BWQA 1MB0A 3NEAA 2QRNA 3MXOA 9ATCA 2J6HA 1UM8A 1DLIA 1E59A 1XZCA 4DR7B 2HRZA 2CDRA 2JGRA 3V1MA 1DAMA 4I1OA 1U2TA 4HGRA 4Y1RB 4B3GA 5CM2Z 1H93A 5EHNA 4W9NC 1QQTA 4JJFA 2ORED 3RSFA 1UXOA 5IXJA 3L0IB 5EVJA 1VYTA 2BWJA 1IN4A 2QKYA 2WAOA 1DUIA 5BV2P 1EP9A 2QTAA 4KQJA 1QMPA 4DN6A 3A4VA 4V03A 4O4IB 1GNRA 2GZAA 1AGPA 4BJ3A 1G60A 4D8XA 4X3PA 4JB2A 2GDJA 1QC5A 1RXSA 1A2QA 4C0XA 4YMGA 3DLAA 4HS9A 4RACA 5A7GA 3CN7A 1IHPA 1BGVA 3TCNA 3NWPA 4FSHA 3UEOA 4TKUA 2ECPA 2JFVA 1F6WA 3KOXA 4D0GA 3FRIA 4W5TA 4FM9A 2ZR0A 4EAAA 5REQB 3TSOA 4G84A 5A6VA 4YRLA 4AJHA 1CNMA 4TQUS 3W7VA 1IBRA 4QSMA 2YWFA 2C3MA 3VDNB 4LOLA 4OV6B 3R7NA 2EHDA 3K6SA 4PZYA 3E3NA 3GJRA 1A7AA 2QTGA 1U02A 2B5WA 1NJ6A 4DRYA 4HFRA 1OHHD 1VGRA 3GJ5A 2BBWA 2VJDA 3D5EA 5HJ7A 3GMSA 3TLAA 2DTXA 1E6EA 3PD0A 3CIOA 2FGKA 3S28A 2CXRA 2E4XA 3PP8A 2QZJA 5DSTA 4RDIA 4UTZA 2Z0MA 3H5RA 5IG2A 1KSHA 1WVGA 3ZE7A 5FTJA 2HO4A 2F3UA 5DDIP 5LWQA 3SEZA 2JKZA 3FNFA 4YRJA 2DHDA 1HI9A 1J7JA 4EFNA 4Z5XA 4MWBA 1TKAA 1ZAYA 3RFFA 1UOPA 2JBWA 5KVQA 3RSZA 3RKUA 4EG5A 2W2KA 2QPOA 4GIBA 4L8WB 4CLRB 2IYNA 2NO1A 3ELDA 1XEWX 1QH8A 3KSUA 1EFCA 3DDOA 4O2BF 3P2JA 4WVLA 3TPFA 2PWAA 5JMTA 5SY9A 3HXQA 4MXDA 5CVCA 1UKZA 3FSGD 4ALKA 3R0XA 3QQPA 1TPZA 1KSGA 3PSHA 1RXEA 4URFA 3VR0A 1Z47A 3BXZA 1DT5A 1L5HA 3HR7A 1IXRC 1OZHA 1R8SA 1VFNA 4RMGA 4CKCB 3FFBA 3GCXA 1RM5A 4IOLA 4XD7D 3R7FA 3KB6A 3TIXB 5EJ4A 3CS3A 2FPGB 3JZDA 1QGDA 1Y4ZA 4NEQA 5FUQA 5JAIA 3M9WA 3Q11A 3QJ5A 1KQPA 2A14A 3EOZA 3P9ZA 4II7A 4IPTA 1J0AA 1UBJS 2FEWB 2I80A 2XHEA 3D8TA 3H8VA 2BKAA 3PNYA 4WACA 2Y71A 3PJRA 5JC1A 3CW9A 1KXZA 3AK4A 3K09A 4NV3A 1TK9A 4RPKA 5FOSA 4UULA 1EWKA 3RVQA 3SPXA 4M9ZA 3UQZA 3B3AA 4B7AA 3F46A 4AN4A 2CNKA 3JRXA 3PUVA 1ZM3A 3BHJA 3GUYA 1GDTA 1WP9A 1TCVA 1DE0A 5JCZA 3GZNA 3MT8A 1Y5IA 5DIFA 5IS2A 1JXAA 4ALMA 4PCUA 3L04A 1SQFA 3AVOA 4A10A 2CMGA 1EGQA 4XJTA 4P35A 3HDTA 4JQZA 4IDOA 5JYBA 5TSDA 3TNDA 3UWKA 1P1FA 1RIIA 4MGYR 1SHLA 4F46A 2ZB3A 2EFDB 3EVDA 4QX6A 2JA2A 3B3QA 5EIBC 1UK8A 2Q5LA 3VYWA 4U2BA 3WKBA 1XVUA 3L05A 4QULA 1ORIA 3EXG1 3NIWA 3K9GA 4MJ7A 4WDQA 1D5CA 4ITUA 1Q2UA 3ABRB 1V2GA 3JYHA 2RAVA 1FVHA 1J8YF 1KYWA 1UIMA 1ZGJA 3AIOA 4OXYA 1S4MA 3WWOA 1C1XB 5IVKA 4UU1A 3N74A 3HO1A 3KK0A 1U9JA 2WF6A 5KAMA 3O93A 5B7PA 2Z2IA 4KCGA 3LLUA 5FWYA 2ASVA 3HN6A 2FRVA 1R9NA 4LVCA 4ARUA 1D0SA 1D4ZA 1TQHA 5I45A 1CZLA 1T5SA 5BNTA 2RGDA 3JQ9A 1BU8A 4MUMA 4U5QA 3S3TA 3Q72A 3KXDA 3VSBA 3TGLA 1WOMA 3VKWA 1YL5A 4BKUA 5A62A 3COJA 1AA6A 1F8GA 1K0UA 3IE0A 2WJIA 3FOCA 1ZCBA 4P4UA 4ZEXA 1E0JA 1JWLA 1EVZA 3D8UA 1WD5A 1HQYE 5IT0A 3GGDA 1Z88A 2BFFB 3KKMA 1MVLA 2FZ4A 2ZT6A 3OU2A 3V32A 1U8UA 2P3SA 3AEYA 1O6ZA 3PI6A 2O3UA 4NTZA 4XWAA 2NU9A 3ZWDA 3FGOA 2HXYA 4QDZA 4OFWA 4MW2A 2AFHA 4QBKA 4MPJA 4KFTA 1ICEA 1NQ5A 1M0TA 2B8EA 2WA1A 3AEQA 1YK0A 4JYBA 5FQOA 4B17A 5IDWA 1V3UA 5H3LA 1Y98A 1KO1A 3LCJA 3KSDO 3VPXA 5LNK1 3NYIA 1S3FA 3R3YA 4MW7A 3QXXA 4LGCA 2QRQA 4MJXA 4KQEA 4PLVA 4XRGA 1R0SA 3TBFA 4ZO8A 3EZLA 4Y2YA 3ZHYA 4DOMA 3ZI4A 1X13A 3KAQA 2HLHA 3N86A 3EDRA 4HH4A 3COWA 3MAAC 1C3VA 3A10A 2QL6A 5DYNA 5KIAA 5E6UA 2UYYA 4Z7OB 2ZRLA 2CL7X 1XU9A 1T13A 4RFSA 1JQDA 1Z6PA 4FTWA 5EJ7A 5JBNA 1Q7TA 1KEUA 1IZ7A 4DTIA 4IJ5A 4QGSA 4L9WA 3SQNA 5BSTA 4BGEA 4MITA 1HL7A 1E1RD 4R84A 4PR0A 4QDXA 4HNQA 4BAUA 4EZBA 4LXIA 3AVPA 4AJ9A 1DAGA 3IXQA 4DEXA 4EZEA 5GJBA 2QMOA 4RXMA 5E1MA 3EQ6A 4CT0A 1U8TA 3D6NB 4KXVA 2VAWA 2H1FA 4E51A 2DHRA 3CRW1 1C7ZA 1E6MA 1JJAA 3ZDEA 2V7EA 2WUGA 2BKLA 1M6VA 3VX4A 1DAHA 5KTNA 3C45A 1LLCA 221PA 2HFKA 4QA9A 4WK0B 1N7HA 2BFCA 3LECA 3VPSA 2R751 4PAOA 3TTVA 2Z6AA 2RHHA 3MAGA 4PTLA 4F85A 1GNPA 2HF8A 1WXXA 2X1LA 4WOPA 5F78A 4DNXA 4N54A 3K2QA 4IUDS 3QFCA 4RD3A 3S70A 1JIXA 4F60A 4I3GA 1A3CA 1UADA 2FEPA 3E3OA 4QFDA 1WDMA 3M4JA 3SQOA 1DMRA 1U0OC 1X39A 2P6NA 1OI3A 2GEUA 1DG9A 2FN7A 4X6UA 1RTTA 3FAZA 1EFTA 1CJUC 4N0MA 1LTQA 2C1ZA 1S2NA 3QV2A 3T9DA 1HTTA 2OCBA 2VHVA 1LKZA 3H9CA 3PR3A 2ZBEA 5EHIA 3KWMA 3R8XA 1XYVA 1U80A 5BVHA 5CIQA 2MT9A 3ZDXB 1MFZA 1N7JA 3UHFA 3QZUA 3A6FA 4PLZA 3GNLA 1MVNA 2FOLA 4HLDA 4UE2A 4HYQA 1TI7A 4ZVNA 3R9XB 3HM2A 1A8PA 1F6DA 4N39A 2NU7A 1J7KA 1P2FA 1Y8AA 2IHBA 3GELA 4WOBA 3LMKA 3UENA 1ANKA 1RPAA 3CZCA 4GX5A 4MZDA 1TGYA 1A2BA 4TUYB 3R1IA 4ZREA 4NCKA 3RNLA 1W0JA 5BVGA 4BGIA 1LPPA 1ZD4A 3NC1C 1A88A 4AKHA 1DTWB 2JD0A 4Z1OA 1DI0A 3NC0C 4TMYA 3DSRA 2NGRA 2ORWA 1CU1A 3MLEA 3NAZA 2P1RA 1YXMA 1NBOA 1RRFA 1HPLA 3DDSA 1TZKA 4AY3A 3HHPA 3V8PA 5B3LA 2VZEA 1HYBA 4KE9A 4E12A 5CFRA 1CCWA 2YXBA 3VOTA 5AD1A 1TYZA 1NRWA 3OTQA 4J3NA 3VAZA 4ND7A 3ZU5A 2QRUA 1MQ9A 3RUIA 3ABOB 4F06A 1Q77A 2WT8A 5SZIA 2JIZA 2AUMA 3ZR4B 4RETA 5KX5F 1EXDA 1OYVA 3KLOA 4K6MA 5JI2E 1HORA 3JQPA 4ZZ0A 4HH0A 1Y82A 4YLEA 4WY8A 4UHJA 2IT1A 2XD4A 3RFCA 3WLTA 4K81B 5JAUA 1CR0A 1DDOA 3BTOA 3NTQA 4L4YA 1T4CA 3F7MA 1OIXA 5ITZB 2XGSA 4RVSA 4TS1A 1LS6A 4POAA 5DX1A 3RNOA 3GYGA 4Z6KA 2I8LA 2OSBA 2PAFA 3NYWA 4ZV7A 5H81A 3HZZA 3W9UA 3LWZA 3BXXA 3HDJA 3KB8A 1IUPA 1QIIA 1MORA 3T3OA 1RKQA 3LBAA 2O3JA 4DLNA 4CM9A 1EJ0A 1P91A 2RGBA 4QGFA 3GFOA 5LIRA 3S8MA 2AN5A 1L3IA 1ZM4A 3LDFA 4GAEA 4RSHA 1TO1E 1QE5A 1T5LA 3OA0A 2JBAA 1PNVA 3OEED 5FTWA 1KY5A 3VM6A 3T1HB 4EI7A 4GBGA 1C7EA 1W19A 3A2MA 1D07A 4P08A 4KTVE 4YMUA 2P2NA 3O1HB 1WVIA 2J6CA 4LK2A 4KWCA 4W8GA 1A4IA 4BKMA 3LPDA 2CC2A 1UDRA 2GD6A 4R0NA 4M4SA 1IMJA 4HWGA 3G2IA 2QL7A 5EZ5A 5AW9A 4KL8S 1CT9A 1CKEA 4GPIB 1DPFA 1JG6A 3I28A 2NUPB 4GWGA 4OQZA 1FYWA 2HT6A 4NG5A 5KNBA 2XWPA 3PI7A 4E4TA 5AK6A 2W6JD 2OQIA 2X3YA 3A9UA 2FCRA 2BUAA 3HJCA 5L6MB 1ESCA 1G0NA 1NM5A 1YS2X 3FI0A 1FRFS 3FPLA 2ZREA 1L7DA 3HG7A 2CK3D 2WHRA 3AVUA 1W47A 1JIKA 1USGA 4YCNA 1JQAA 1TUEA 2VDOB 1NX9A 1VIMA 3EBPA 3FD8A 2P3LA 1Q6YA 2P27A 3CJRA 3IP7A 1SG9A 4PPNA 3MHTA 4PZ0A 3E9QA 2O2XA 2OV2A 3PGMA 3SK0A 2Q3BA 4R3UC 1JBEA 3HZRA 1JLLB 2D1FA 5BQPA 3GD7A 2NO6A 3OPXA 5EQFA 4AB1A 3FLAA 3D64A 1KYQA 3F6CA 1HQKA 1DPGA 1ULBA 5LQKA 4BMVA 3HO6A 4BN0A 3RG8A 1F38A 2PT5A 3ACCA 4FLFA 2IUFA 4WXPA 3UJ9A 1IWPB 5ADHA 2LXNA 2C2GA 4AJ4A 2HU7A 2IYLD 2QMUA 5CVDA 3PQ5A 2CNDA 1P2SA 4TV8A 1X1TA 4XX0A 2OXIA 4MUKA 3TR0A 2MYUA 3LG2A 3GLFA 2HV8A 4Y2XA 1EYZA 2IYVA 2ZIGA 3JRNA 4PRYA 4UU7A 1ZXLA 3CUTA 4WLNA 1V43A 2WJVA 5DBGA 1DEAA 4RZ3A 2ARKA 4CQMA 2G25A 1RKVA 3H65A 3R20A 2HJHA 4IHJF 2DRIA 2CSUA 4PO8A 4G1BA 1VHLA 2HA7A 3H0KA 1LCIA 4BUCA 4OQPA 1CNEA 1U4OA 3OM0A 1I51A 1A27A 2QHXA 1GGHA 2GCPA 1YB4A 3NG1A 3QBJA 2WNHA 2WPNA 5D87A 4GH5A 3BOSA 3F78A 2J08A 3KM0A 3SFVA 4WCFC 3D43A 3UKJA 1ADCA 1P44A 4KQWA 3I62A 4MULA 2FKNA 4CEJB 3ZGZA 1RHRA 4YONB 1LI4A 3ON5A 1XDBA 2CKDA 3CUUA 5DSXA 1EBBA 4XCQA 3LS2A 3UMGA 4BX8A 4D79A 1ZESA 5L3SA 3HHEA 1VYVA 2EZUA 3WYDA 3JWJA 4BOYA 3I64A 2XTJA 5B6PA 3IBYA 2EKDA 3Q6MA 4XYEA 5TEWA 2NZXA 4JBNA 4BQNA 1GV1A 1ONOA 3C39A 1V5EA 4XDGA 2QU8A 4BBJA 1RIFA 4PZLA 2CMFA 2VT6A 2O3SA 2VSNA 5JCJD 1XZMA 2B7BA 3EN0A 2WJJA 4CDRA 3EZ9A 2RHWA 3COYA 2AH5A 4B87A 3R5JA 3UGJA 1IM2A 1ETUA 4LDZA 5C3UA 1EIZA 3B7WA 1KRXA 4O1IA 1W9HA 3UATA 2V6IA 1O77A 1K2VN 3WIEA 3K9WA 1Y3HA 2OV6A 3C1UA 1F7VA 2R1VA 2OV3A 2XUKA 2C2HA 3DTVA 1IY8A 2PQ0A 1ABFA 1EGAA 1RNLA 3GLHE 3HRIA 4LBZA 2GRUA 3HCPA 3KX2A 4L0CA 4WCFB 1RJWA 2BFDB 4UPEA 7ABPA 3ID6C 5H8WA 3UFXA 2SECE 2WFMA 2XUFA 4PSUA 3N0RA 4EHHA 5TE9A 5GIOE 1NQTA 3HNPA 2XGJA 3B52X 3WLRA 1P7YA 1ZEMA 2YY7A 4IO1A 4YH1A 1CR6A 1D7OA 3G02A 4UHDA 3U44B 1XMPA 4YR7A 3GJ4A 1FMFA 3S2YA 1L1QA 5F35A 3ZK9A 1MU0A 3CBGA 2A4MA 3IO3A 2YVLA 4OL9A 3ZHCA 4ALJA 3GLTA 2WWWA 3GAMA 4UD2A 2V54A 3L1UA 5IF3A 5KZMB 5FL7A 1J1ZA 2BKEA 2VRCA 5LMUB 3N5CA 10MHA 5I7RA 5CDTA 3QU7A 1F8UA 1J97A 3GDHA 2VF5X 2JS7A 3R3VA 4NCBA 3I9LA 1MABA 2W6MA 2X3UA 1FBTA 1T5HX 4FD3A 3CEAA 4V38A 1L8XA 1GPBA 2I7TA 4TMZA 2QT9A 3QELA 4GC5A 3UXEA 4OHPA 4JC8A 3ZCPA 3CRQA 4YJ2B 4EG0A 2VAPA 4X6XA 3L6UA 3K8OE 3PDHA 3PDWA 3KP1A 2R2GA 5BW6B 3RM3A 3ZWOA 3VO2A 5A4KA 3I37X 1U0FA 4KWEA 1WY5A 3QTLA 3VDRA 2CT8A 2CXUA 1WXEA 4G25A 4HDKB 2A0XA 5KNCA 2XF8A 4UXIA 3NATA 1P9WA 3EZNA 4TL6A 1G18A 1H0HA 3V00A 4H1HA 2YR0A 4EHAA 4TZ0A 3LFTA 4TRMA 3B1YA 4A23A 1T8WA 3R3HA 3I01M 4GP7A 4RM3A 4HZUB 4J76A 4PFKA 4U02A 1UF9A 3MJSA 4JL5A 3ZIAD 1LUAA 4Q19A 1KQFA 2JD1A 4EY7A 1DUSA 3THSA 4BNUA 4COOA 2VUIB 2PV0A 5AM5A 5EUCA 4ZI7F 4TTAA 5KYTA 3DBOB 2PJDA 4J29A 3WHKA 5DX8A 3G8BA 4XGRA 1V3VA 1BE1A 3EFOB 1JIJA 2EKBA 4JGBA 3PTLA 1USWA 3H1EA 4JR1A 4WXEA 4OQEA 5T3YA 4HG2A 4YT8A 1VLVA 3CURA 1XKLA 1VZ3A 2ZIZA 3CZ5A 3GWGA 3H9QA 5J2UB 2FFBA 2ZUVA 5JS6A 3LKBA 3CTPA 4QL3A 2HFJA 4MYDA 4C88A 4ZVUA 1YS9A 1UBMS 4JLWA 4PS1A 3B9BA 5H9VA 1A5ZA 1SOMA 1GSAA 4S0XA 1HH4A 3H7IA 2Q21A 4D74A 2GBIA 2WWIA 2F1KA 1V3TA 5KTTA 4A8HA 3F5DA 1N77A 4JB3A 1BCSB 4PG7A 1WCIA 4ZARA 3RWBA 3EPLA 1DKUA 1OWLA 3EEIA 3OOJA 2X41A 3LUDA 1OB5A 2IYXA 1BXRA 1SB8A 3B5IA 3VKGA 3SZGA 1RXCA 4FIDA 4QWMA 3UC9A 1N57A 1X70A 4BMNA 2Q6IA 2E82A 4AECA 2DHQA 3JSAA 3BMQA 3WTBA 2GQ0A 4FFMA 2ZJ5A 1EA7A 4EF5A 1AHIA 1TM2A 1R8QA 2YHBA 4UBKA 4DCTA 1ML4A 1CR2A 4M9UA 2VBCA 5JQGB 4S1NA 4P4LA 3RUCA 2XE7A 4M1QA 3A05A 2VLIA 3L8CA 4BFWA 3KBBA 4MWDA 1CB7A 1T2DA 3I42A 1CERA 1Z13A 4RVHA 4CG3A 1MC1A 2R86A 3AF4A 1A5TA 1NDUA 2P2GA 3B38A 3I83A 3SEAA 5BSGA 2IP2A 2XCIA 3NP7A 1IB6A 2Q2VA 1Q14A 4XPIB 2VYFA 1T9DA 2WOJA 3EHDA 3F4KA 2F43B 1EUCA 3N07A 1EMDA 4NNOA 4ZOLA 4B7ZA 4ZXFA 1V8BA 1JIUA 3NAQA 4ZHSA 1PFWA 4PLGA 1YR7A 4MVJI 2OESA 3K9QO 3TTXA 1M2OA 2ZYUX 2QEQA 1W1IA 4CMEC 5A3JA 3RS7A 5C8VA 1JHQA 1KY4A 4LAFA 6Q21A 1E2HA 1P3JA 1ZAKA 2PGAA 3GZ4A 3SBDA 5ELLA 1QWSA 1H2FA 2GK7A 5HJEA 4I6GA 2HCBA 4R98A 2XBUA 2J9RA 3OPYI 4ZIRB 2PHZA 4FFOA 1P1IA 1C0KA 4AF8A 2XQGA 4ZGBA 1JR3A 1JDBB 1AXEA 3UJPA 1PR0A 3A6GA 2WE8A 2D2XA 1VIYA 4D4GA 2NQ2C 5JFTA 1L7MA 1S8FA 3QVMA 3EZGA 1WV0A 5AW1A 3GLIB 1Z06A 2FUKA 3H5OA 2WIFA 4QHTA 3VJLA 3RUAA 1X7GA 2WSIA 4HUQA 4KHZA 2NAFA 3R9IA 1EWVA 1V7CA 3RPEA 4AURA 2XTZA 4L7QA 5KWJA 5DVZA 4OJQA 2PR7A 3LD9A 1M2VB 1RJDA 4YC7A 4C1NA 3T3DA 3U3KA 3Q3VA 3R40A 4G1EB 1F1BA 4FYHA 1O87A 2VOJA 4M87A 3CZAA 1TD1A 1I36A 1KMHA 2EEZA 4H1TA 4G85A 4BB5A 2HLPA 1PVOA 1IRIA 3OOEA 4PXYA 1E2GA 4YRDA 1DAIA 2Q9CA 2GGSA 2XB2A 5JZVA 3DO5A 1K1EA 2GZ2A 4WINA 4NJEB 1NMEA 1WR8A 2HJWA 3MMXA 2V6JA 4JP2A 4K9PA 5T6BA 2VL7A 5LLDA 1Y34E 1U28C 1VL5A 2CVZA 3GNQA 4EO4A 4ZTBA 4I46A 1QFYA 2GM9A 3C4QA 5DI9A 3UMSA 3W34A 3WB9A 2A4KA 1D0IA 2OBMA 3BMNA 3F47A 3JALB 4PXSA 3X2EA 3GFSA 4JLNA 4Q5IA 5B3KA 2PXAA 2WHPA 2YXPX 3Q12A 2OZEA 2YXNA 5K0TA 1A7JA 4UBJA 5F1PA 1E1YA 1T36A 1GPAA 2WM2A 4QBTA 1HFJA 3D2BA 3AR3A 4G0VA 3WL5A 5IBRA 4E13A 5CM9C 4XVCA 3KOZA 1E3MA 1U9IC 2IFTA 4Q3DA 2ZRDA 1W5TA 4DXDA 1J56A 3M89A 2A5YB 4MYTA 1BN6A 2HSDA 3DEAA 3QLUA 2GPNA 3TZLA 3BMCA 4BO6A 1TKCA 3R44A 2NYUA 3UWDA 2PL1A 2X3FA 5EJ6A 1TCAA 4FSXA 3TRKA 2ZSBA 3QW4B 2I6SA 4MI6A 1XLTC 4G1UC 5TARA 3V42A 6REQB 3JR7A 2PZAA 4CN9A 3G85A 3U48A 4M98A 3CLSD 5AW4A 1NDQA 2GN4A 2FEXA 4P7KA 4IIJF 4Y7DA 2OKGA 3SE0A 5IULC 3KAKA 1FYVA 3WAJA 2JFHA 4UXJA 1OLUA 1DSSG 1MJFA 2A9VA 5B1SA 2ZUBA 1TYEB 4MHOA 5EPEA 1KPIA 1R4MB 4EK9A 1TB4A 1FDVA 4JAVC 2F3RA 4CYMA 1UZUA 4FGLA 3RRYA 1K7YA 3C16C 3WQQA 4EA9A 1JEYB 3ZD6A 4MKRA 1GCGA 1U2DA 4LC0A 3ZU2A 3ICOA 3UY4A 4AMVA 2PSDA 4CW7A 2G6BA 3B36A 5AJZA 3RHSA 4B4WA 3LVRE 4UNRA 2AQIA 4PAMA 4DR2B 1C0PA 3HA5A 5ARDA 3DE0X 3GK3A 5HFJA 1IN8A 3HCCA 2GD0A 5CVEA 3QVJA 1BVUA 3URKA 3EE6A 5LQJA 1VG8A 3Q7TA 5KKNB 5ED4A 4OSEA 5C7LO 4LJLA 3V2IA 4E5UA 3SP1A 1PJ3A 1X1DA 2FVXA 4PNEA 1ZIPA 1ITZA 5GOZA 4JUAA 1VJ0A 4MX8A 3IMKA 1TEHA 4W9NA 4LF7B 3VR6A 2IPLA 3DZFA 3I04M 3U4QA 3RS4A 2OHOA 1FW8A 1W0CA 2R5WA 2PYDA 3ROMA 3MXTA 3DMHA 2EDAA 1AQUA 1T8PA 2WF5A 3EWAA 1WUHS 1W88B 5ERYA 1O03A 2IU4A 1DIHA 1XEWY 3CFYA 2JASA 3R09A 2E3JA 2XR1A 1YJAA 4WBNB 2BP7A 3IPAA 1XLUA 1TOAA 3ODPA 3EXAA 1YR6A 1VQ1A 1V5WA 1WM1A 2CMHA 2VHJA 2BCJQ 3FVQA 1PQ4A 2JFOA 2RAUA 4IIYA 4FZRA 1E9DA 3TK1A 3G5AA 4FOSA 4R2JA 4IVPA 3I9V1 4KQKA 1Z0SA 4UUPA 2HIHA 2XT9A 3TTYA 5BWOA 3RTGA 3WP0A 1QIJA 1F7UA 1X19A 4HGZA 2CV2A 4LDNA 1VBKA 3BA1A 1GT6A 2ZAGA 2FMFA 3SWWA 1CUXA 3THWA 4WW0A 2WTNA 1QP7A 3ZXSA 1NVWQ 1N3LA 3HA7A 3IODA 2O1EA 2EGGA 1SPXA 1SU6A 1AQJA 3FBTA 4K28A 2DWOA 1ZG3A 1JLMA 2QI9C 3M7IA 2WP0A 3DTNA 4V0OA 4FI3F 5CHEA 3V2GA 3D8HA 3KOUA 1IEVA 4FCCA 4BAGA 4LYJA 2V0GA 5T4HA 4Q3BA 4RA6A 3BAFA 2XNJA 2JEYA 4E30A 1PR5A 3NU1A 1II8A 1S96A 1XN1A 5JNSA 4I1RA 4C0SA 4BECA 4QPJC 1SURA 2HCRA 5HK9A 3TZEA 3L84A 3ZY5A 4HYTA 2DCUA 4EY8A 4KYTA 2ECOA 3QUBA 4XQCA 3IR5A 5LP6F 2E6KA 4JGIA 3D6FA 2YY6A 2R6FA 3OLVA 1BCRA 1V25A 2OC9A 4X6LA 3B6MA 5DHFA 5IBQA 3ENZA 3WQRA 1IU9A 2BEVA 4AW9A 3RYCB 1ARZA 5FEMA 4DA9A 4E08A 4KO4S 4LXXA 3CISA 4XLZA 3THXA 1R0KA 4DSTA 4CEHB 1UMBA 4P3XA 2IGBA 3KZKA 1SOVA 4IQ0A 3JQEA 1XVAA 4WJZA 4EW6A 2ATIA 3JWGA 1L4UA 4U0KA 1YZHA 3ESQA 1CQIB 1DBPA 1L7NA 1AQYA 2C2ZA 2AFIE 2JDID 3JARA 4WZZA 4X8OA 4B3XA 2C7PA 2XDQA 2FQWA 4E5DA 2GSDA 3DXZA 1SIWA 2HC9A 1TFRA 2HJSA 3VMFA 1A1VA 3WI7A 3C3AA 5EZYA 3S55A 3HM9A 2PX2A 4Z0NA 1M3SA 3VU8A 1OREA 1VZ2A 2DFLA 3IAXA 2E89A 1DLJA 5G41A 4LSWA 5T8KC 3ZOZA 4A6DA 4QM7A 2C54A 1TIBA 2QXUA 3OEYA 2HXGA 3KT3A 4OA5A 2HF7A 3U81A 3ZVKA 4I1SA 1PR6A 1VG0B 1FS5A 1PFUA 2KHZA 2BMEA 1FRVA 2DCMA 3AX6A 2I1VB 2YC4C 4HXGA 4INJA 1W2HA 3ADBA 3DTTA 1HMYA 4BE4A 2O1WA 1GPNA 4PHTA 4DQXA 2I2BA 4AVYA 1L4EA 1JT2A 1OXXK 4GR5A 3GPCA 4G5QA 4KWIA 2P11A 4Q3LA 3V7NA