4LZPA

Structure of the tir domain of the immunosuppressor btpa from brucella
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
162
Chain Sequence
b'QAVKKVAQEQKRLSDERTKHEAFIKQSLSSMRTTEEYDFFISHASEDKEAFVQDLVAALRDLGAKIFYDAYTLKVGDSLRRKIDQGLANSKFGIVVLSEHFFSKQWPARELDGLTQTRILPIWHKVSYDEVRRFSPSLADKVALNTSLKSVEEIAKELHSLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
molecule tags Immune system
source organism Brucella melitensis
publication title Structure of the Toll/interleukin 1 receptor (TIR) domain of the immunosuppressive Brucella effector BtpA/Btp1/TcpB
pubmed doi rcsb
total genus 57
structure length 162
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4lzpA00
4W8HA 4W8GA 2Y92A 3UB3A 2J67A 4C6TA 3H16A 1FYWA 2JS7A 5H3CA 4C6RA 4FZ5A 1FYVA 4C6SA 4C7MA 2M1XA 3JRNA 1O77A 1FYXA 5FORA 3UB2A 4C6TB 2Z5VA 4OM7A 1T3GA 4DOMA 5KU7A 4LZPA 4EO7A 3OZIA 4LQDA 4LQCA 3UB4A
chains in the Genus database with same CATH superfamily
1XWFA 3OIDA 3TTYA 3CH4B 1EE2A 4ZCPA 1H2BA 2XGJA 3UV6A 3RIXA 3FE2A 2QR3A 2H1SA 2RHWA 3IVCA 1CTQA 5AI6A 2BOVA 1HDRA 3TL3A 4MV3A 4BRZA 4C6SA 5JD4A 2G7ZA 1AVTA 5JAMA 3Q88A 4QNRA 2XOKD 1WTAA 2QD2A 2Y1FA 4Z6KA 5KNBH 1QOQB 1ACMA 4JC8A 2W93A 3HYSA 4AK9A 5FWNA 2FR0A 3C4QA 3M1LA 4WFIA 1SKYE 5C7YA 2ZXUA 1IB0A 3NYWA 1JU4A 4OHKA 2IEBA 1N3YA 1A2QA 1CUCA 5EJEA 4WVLA 4ZAWA 1YONA 2E6KA 2C4VA 1VSBA 2D2FA 3MRTA 1LDMA 1V5EA 4ND8A 1Y82A 2Q7OE 4A27A 2VAVA 4KR7A 1R8QA 4RJLA 4X8OA 3H5VA 4LMAA 4Y2PA 1FW6A 4BEJA 3ZKWA 1MGOA 1HE8B 2X1MA 3MUEA 3W9BA 4D8YA 5BRAA 1NVFA 1HF3A 3CNOA 1DKQA 2RHMA 1NMSA 2HZBA 2OV8A 5F2KA 4BJHB 1Q16A 5CLJA 2R8BA 2IK8A 3VGJA 5CK5A 4ZN6A 3DTVD 3HG7A 1DTSA 1GQFA 1ZJZA 1NPTO 1XRSB 3MWKA 3OOJA 5D3ZA 1E2KA 4BFUA 5JROA 4Y0NA 3K9GA 1UMCB 4PCUA 3IHLA 4MS4B 4DR3B 3OEEA 4JLSA 5NLLA 4DQ0A 4ZZ3A 3GLGA 4LRXA 1M6NA 2BMJA 2B4QA 4EDHA 3WIVA 1HLFA 4HXYA 4IIXA 4EW1A 5FQNA 1I36A 1A9SA 2PRYA 4PICA 3HDGA 4F9FA 3PFFA 4BPRA 1UBSB 2JCBA 5AJUA 2JZOA 3FRHA 4GYKA 3AZQA 4DHWA 3IPCA 3FLEA 4UM8B 1ZIYA 3GCXA 3ZY4A 2GN9A 3V9PA 5EWMB 2QTRA 3LTEA 5DBEX 3PXUA 5FUBA 2H2AA 2R1VA 4IZHA 3V4FA 3INYA 4ILKA 1VMKA 4NECA 4X7MA 1J70A 1Z39A 4PM4A 4FZJA 2AJ8A 5JJKA 2BJVA 3TMYA 4EJMA 4GR9A 4JFRA 2ODPA 4Z53A 2FW0A 3MG9A 4ZDWA 2QAGA 2WG0A 4KO8A 3BXOA 4G8CA 1Y6FA 1MX5A 2QN1A 3RG2A 1KJ8A 1P2TA 1U9YA 3GP5A 1RI1A 3L7OA 4IFIA 3VVMA 3TLKA 4YMTA 5BMVB 5L7TA 2X5KO 1JJBA 4AZTA 4UHDA 1VHDA 2R62A 2OQ2A 4L8YA 4GG1A 5LL6P 4EY6A 2WWYA 4KHPB 2WF9A 5CDTA 3RC2A 2R0QC 2CL6X 1O9HA 1HNXB 1FU4A 2IHKA 1EZ1A 2JJYA 3OOWA 4DG9A 3AVWA 1T3HA 1EDBA 2IUFA 4ZOAA 2W2XA 1O5OA 4UHJA 1RRVA 2GMWA 1NQ5A 2R8PA 3CQ9A 1KIFA 1QJCA 1G17A 4B8WA 3T3IA 1CRLA 1ZM7A 4IXDA 4Y1EA 1SIBE 1XROA 3L0SA 2ZYTX 1WW3A 3WRWA 2YOGA 5AKGA 3TRDA 1OH7A 1X77A 3CZAA 1KXZA 3BGOS 4D4KA 1GZ4A 1SCUB 2R7MA 2WJGA 2ZTUA 4Y67A 1JUDA 1RQNA 3NM6B 5DMHA 2AEJA 1GIAA 5GV8A 1PE0A 2SKDA 4RSHA 4L4UA 1HUQA 1U8EA 2FGJA 4XWGA 5T64A 2BZGA 2GBPA 1OYVA 4D9IA 2CJPA 2F8LA 1Y1TA 2I9PA 2JG3A 3H2YA 2EG9A 4N40A 5C4IA 621PA 4IGFA 2NZWA 3ZE8A 1QZTA 1KQPA 1NRIA 1F2UA 1LJUA 2QP9X 4LY0A 4PHGA 5JCOC 1F5SA 2FOIA 4E2ZA 2FEOA 1YU6A 3JRWA 1UDXA 3K8ZA 1JWAB 5JSYA 2CUKA 3TK1A 2O3SA 4QDXA 1V8ZA 1W36D 3PLAE 1N36B 2K5UA 3IS3A 4ND3A 3ZU5A 1MB4A 3E5NA 2YJ5A 4ZC1A 1RC8A 2ZUCA 4GAEA 2JL1A 3O38A 1F4LA 4DJAA 3W05A 4N03A 4ND2A 3WMXA 2NZVG 4L27A 1UXGA 3L5KA 5GOZA 1JX6A 1NP3A 4B1FA 2CSXA 2C20A 2ID9A 4YCJA 4B84A 2I54A 3IYLW 3FOBA 2YXLA 4JXZA 1WHTB 1NWHA 5AW7A 3TMAA 2I4OA 2XDQA 3LP5A 3DR3A 5DI9A 1M7GA 3RT1A 5HVNA 1RYFA 4D3DA 3I6ZA 4OX9B 3KWLA 1FC0A 5EWLB 4NVRA 4OHWA 1ZKDA 5K3AA 5M5BA 4QBFA 1RM3A 3KS9A 3W6PA 1I1OA 3BGIA 1H0RA 3THWB 4HRVA 3H42B 1P1IA 2NTNA 2R68A 3IURA 4II2A 4N3GA 4RCZA 4WX2B 1KVSA 5IJ9A 2WINI 2HO4A 2W2KA 2EP7A 3OAAA 3ENVA 3R6GA 5AI4A 3V4VB 221PA 4Q4JB 4F72A 1W9HA 2YWRA 1ULHA 4G8DA 4PN7A 2NO1A 3R8XA 5J2TA 4MNTA 1FS6A 1E4EB 5I5GA 3BRQA 4LZOA 1HI9A 3TNLA 4DDVA 2BKAA 4C2BA 1D0VA 4RANA 2BWJA 4WLNA 5B4UA 3LX8A 3O8OA 2V7QD 3TLJA 5DYIA 4AZ3B 2VNJA 3K20A 3JYQA 1ZK3A 2OCBA 3M89A 3RIEA 4HTFA 3MS7A 1NOKA 4OGKA 1QB7A 2EX4A 1K8ZB 1PV2A 2JI6A 2XITA 3EDMA 3NYIA 4RA9A 4RZXA 4L4ZA 4ER7A 4ZDKA 3TUZC 5F35A 5KB3A 2ISCA 2CD7A 3GD5A 2O8EB 1KK3A 1YI0A 1XD2B 2GKOA 3HUDA 3PIRA 3LDUA 3VNRA 4E15A 821PA 1K4YA 1SOWA 5AKLA 7MHTA 1TTHA 3G5UA 4RD3A 2W4MA 3BF8A 1DDOA 5AUOB 5D01A 5ALFA 2HXGA 2QYTA 3B51X 3VNVA 3U31A 3IAS1 3AF2A 3WLKX 3QUTA 2X7HA 1FSGA 4YRDA 3LY5A 4RTKA 1UADA 2PWPA 1DWUA 1SMKA 3E70C 5HMMA 3O90A 1R27A 3ZJ4A 3LBHA 2EGGA 2X9LA 3U40A 2LR0A 3FIUA 3FX2A 3S5UA 4L74A 4D0LB 4G0VA 2ACKA 1J8VA 1VLMA 5FPSA 3WI7A 2XCQA 3DUFB 3C7AA 2HO5A 4HWPA 3K0AA 3L49A 5JNRA 1E92A 3HA7A 4DCUA 3CUVA 3PEWA 4RJTA 2ZJ1A 1GTZA 4L95C 5ECGC 2XCSB 3C15C 1T5OA 3EMVA 3I2HA 2HLPA 3GMDA 5EPEA 4YN3A 1Z8HA 4MYCA 2O8DB 4ZWNA 1MOQA 1Z0IA 2BM8A 4F5WA 1KYZA 2NX2A 3GGPA 3T8YA 2AQHA 1FFWA 4DT1A 3GGGA 1FXSA 1N3IA 3PFGA 3IPXA 2F3SA 4NH0A 3S1AA 2O07A 3CBGA 2Q9CA 4XSHA 5A62A 2QUKA 3TRFA 2J6BA 1JIKA 1FFBA 1JA0A 1ORIA 1TU0A 4JCCA 4IOMA 2BGUA 2V03A 4UNSA 3FHTA 4DQDA 2FHPA 4BN0A 1C3VA 3AF5A 4TTRA 2G6TA 3W77A 2VC2B 1OBCA 4HAVA 3RBXA 2NP7A 2D0DA 5L9AA 1G4UR 3C48A 1OH8A 1YDHA 2IEAA 3QVSA 1RWOA 2B7BA 4HUQB 3VOTA 2YHIB 1JA1A 2ZZKA 5KPJA 2JA1A 2VSFA 3EMKA 2OWEA 3OC6A 4JI1B 5EIBD 1FFYA 1AT1A 1L7PA 3QJ5A 4JDUA 1W9MA 2AWNA 3KOOA 2JCSA 3A6FA 1LLDA 1XF9A 2J6IA 3H16A 4MULA 1FVOA 4CQMD 5I7HA 4H7KA 3FBWA 3GJ7A 4D4MA 4IFBA 5HUQA 3NBUA 1TJ3A 2WY2D 2AYXA 4GP7A 5HFJA 2QRGA 1PFGA 2CXOA 2O0KA 3AONB 3MFYA 2CLSA 5CPFA 5DBGA 4ZVPA 4JBNA 1W7AA 2PO5A 1C3LA 1U9CA 4JJIA 4LE2A 4E03A 2G17A 3E9RA 4MCHA 1H42A 2IHNA 1MPXA 1QR6A 2BV3A 3GN2A 4D0GA 4D0NA 3RRYA 2DAPA 5A7GA 1NDQA 3PDIB 1I4EB 1VKZA 1YZNA 3AG6A 3W6UA 4BIIA 4Q5IA 3ZX4A 2DLNA 3K0CA 4R4JA 4DBZA 4NJEB 4QHSA 3WNQA 4L0MA 2I3ZA 4XVQA 5D7BA 3B8HA 1XXHB 4CR7A 5KNCD 5L3QB 2C7PA 3E9MA 4OX9Y 3NDBB 2YOHA 1QH1A 1YA8A 2JJQA 4NBVA 4R0NA 3UXYA 5L40A 4BFZA 2XMRA 5L7WA 3MBKA 2XIJA 1K0FA 3RGGA 3TQTA 1Z4LA 2QTNA 2A94A 4EVRA 1RVDA 4PGGA 5JT1A 5EIAA 4PLYA 1BCRB 5IC5A 5GPBA 4RV4A 3I6MA 3PX3A 3V33A 2MYTA 2Z5VA 3FPCA 4ABTA 2XRZA 3OSUA 2CVQA 2P0YA 2QUBA 2D06A 3O8CA 4V2IA 2A5LA 3MCUA 1GTG1 1PL6A 2P77A 4XM1A 5KJEA 5JJIA 3M3PA 3KQHA 5CBPB 4HWOA 1AKWA 3DV0A 3GEGA 3AR6A 1CQZA 4OFZA 5L3VA 4EHDA 3PQ7A 2FEAA 1Q0QA 3LZDA 3OZVA 3T7IA 2NSDA 4HYEA 2JFGA 3J80A 1A69A 2V8OA 2AC7A 2LCFA 4PZ0A 1G8YA 1E4YA 1M2VB 1XTQA 4DV4B 4ARZA 1NXWA 1BWPA 2W37A 4URWR 1VPLA 2VAWA 2Q0XA 4RHEA 1E5VA 1BCSA 3MSXA 2QPAA 2QUJA 5KTNA 1IQPA 1LSSA 3BFKA 3GAZA 3DWIA 1MJNA 2ATCA 1M0TA 3JQAD 4LNHA 5CIYA 4P98A 2C4HA 1XA0A 1Z62A 3L02A 4KTVE 2EZ8A 5HYVA 3FOEC 1M2GA 4JI8B 4FBMA 2CMHA 4G09A 2GLUA 1WM1A 1PUIA 2LXNA 4GR5A 2XZLA 1QM5A 1NVAA 1VGQA 4AJHA 2D2VA 3T3MB 3PNSA 1XRQA 3G0IA 5JH7F 3VSCA 3C41J 4HNHA 1T6BY 2H0RA 4G1VA 3U4AA 4GOMD 2B4TO 2I33A 4YJHA 1C4WA 1TJNA 4QGSA 5IDXA 3N5CA 2B20A 3EZGA 3PVCA 3LPDA 1IBLB 3G0CA 3QA9A 2HMUA 3BB1A 4OXKA 1T43A 4KIUA 1UPCA 1YXMA 1SG0A 1K86A 3N3BC 1WAMA 1ESNA 3OCUA 4DBLE 4JLBA 4PO3X 1G6OA 3ZOKA 4ZHQA 5BUZA 4FM9A 5BURA 2QSYA 2XR1A 3G2NA 1QFMA 3KTFA 3TTTA 1C0LA 4N5NA 5IDYA 3T34A 4AWXA 3GCZA 5ESRA 3IBYA 4NULA 4EB0A 4XR4A 5JPDA 2YKGA 1I7NA 3OECA 1ODCA 2JKVA 2UZIR 3K71B 4KCGA 3GW8A 5AHWA 4TS3A 1GL9B 3WHKA 4KGDA 2PQ0A 4KJXA 1U9IC 3ZX5A 2IY7A 2WU1A 5DN9A 1F2TB 5EZQA 4HC4A 6NULA 4DA4A 3VYTB 1LNSA 3GA0A 4URVR 3AVUA 4J6EA 1GDDA 2G5CA 4LISA 2HSEA 5J4YA 2F1RA 3QYJA 2ZJAA 4M37A 4BNDB 1B42A 3T1YB 2BMVA 3MRXA 1I3NA 1L4HA 3CXUA 1MB9A 5FX2A 4PBTA 1R6UA 1U0HC 2X42A 3D3WA 3KU1A 3IUJA 3D6VA 2B1JA 3S3TA 1JEJA 5FR1A 4TTTS 2WQZA 3ZKWB 3SC3A 3CUWA 4HG2A 2QQFA 4W8HA 3VU3A 2GBLA 2BFWA 1PJ8A 2XDYA 3LOPA 3GQVA 2QQGA 1PO7A 1X1DA 4N3AA 3VM6A 1AY0A 3DW1X 3BSFA 2BEJA 5F76A 1BWRA 2YCBA 1XDUA 3D3KA 2IE8A 3THOA 5FBRB 4R1SA 3REOA 2H31A 5BT9A 1Y3FE 4ARBA 1T9GS 4ZU6X 2VQEB 2O7VA 1W0KA 1CR1A 1WS6A 3K72B 3H3JA 1NF3A 3Q3JB 4PC7A 3W2FA 1A97A 3PLNA 5DBOA 4N5DA 4UW9A 1MC5A 5EKSA 4YJFA 2JKZA 5CVTA 1W5AA 3PNQA 3RRXA 3TZBA 1JL3A 5HEKA 2BFFA 2QENA 3R7WB 5EIEA 3DE7X 3PENA 3EIHA 2I76A 3FYUA 1OTHA 1DHTA 4M87A 2H65A 3A1CA 3A1UA 3K9HA 2GN8A 4H77A 5AKEA 5KZMB 1BOOA 2B2CA 5DLQC 4XIYA 2R7NA 3IVAA 5JZBA 4H0FA 2HL6A 1L4MA 3W3AA 3RTDA 2QL5A 1NUAA 2D1RA 4B3RB 1KPGA 3KR9A 2VSQA 2GVDC 1UINA 3AVPA 3I6BA 1MQSA 4KRFA 1U3WA 3HDJA 4ZT6A 1GGKA 4N4AA 1T8PA 1FTQA 2Z83A 4QPNA 5CFQA 1D2AA 3NG1A 4AECA 4W1QA 2DHRA 4KGVA 3T3HA 2EKZA 6ABPA 5B2EA 2CVHA 5DI3B 3T9FA 4FWTA 5LKRA 2APJA 3ELDA 7REQB 4R9SA 3HJBA 1Z5WA 1CZKA 5J58A 5LQDA 4MB2A 5LJIA 3IO5A 3WWCA 5EPOA 4H0NA 3AB7A 5EJAA 4UREA 3WGGA 1BHJA 1BDMA 1QBKC 2IKQA 2VH1A 5AKIA 3ORQA 1ETHA 2PNJA 4MVJE 5JWOA 4CMEC 5BYBA 2QT0A 3ZYCA 3TE7A 1X3SA 1HBJA 3FI9A 1OQAA 1TNDA 4WXYB 2C83A 5I9MA 2FX2A 3EFBA 1SCUA 2R6AA 5ICCA 3NTQA 5KREA 1DAOA 2DHCA 1CQJB 2VUSA 1QK3A 3NVMB 2NU6A 4JLPA 5IJ0B 1DBPA 2CKMA 4V0ME 2I7DA 1JAYA 2MSWA 2X8AA 1ISFA 3AEKA 2OSVA 4NOLA 4E3ZA 4N65A 1E98A 5I48A 2Z2KA 3CONA 3ZGYA 2CBGA 5ED4A 4L16A 2XWBF 3L7AA 1H8ED 4AD8A 2NPIA 5E6RA 2OAQ1 4X7RA 2RBGA 3LQFA 4KO4S 4CE6A 5GQSA 5KVVA 3W2HA 3PFKA 5J23A 5G1PA 1SRQA 2R4UA 1XTUA 3MGGA 3GUVA 3SM3A 3OT4A 2XH8A 3FYUC 4QHYA 5AK0A 3EXHB 2IZZA 3A1EA 3PA8A 4NESA 1MVLA 3IA2A 1Z34A 1MO6A 2CYCA 1JVNA 1KMIY 3OCWA 4JBXA 2YWFA 3DZFA 2D1YA 3QFCA 1W1WA 4Q3OA 4ZYXA 1SCJA 1QHGA 4UCWA 2H2FA 5F1PA 4ZCSA 5JEEA 1GFIA 3TOCA 2QTWB 4F5ZA 7YASA 3F96A 1Q6ZA 2Y2VA 1CT9A 1QQ6A 2X8WA 5HKOA 1YZYA 4E5UA 2HF2A 1VOTA 2A7QA 3ER6A 3SI7A 1PWYE 1Y3IA 4LY6A 4YRGA 5BV7A 1GXSB 5ES3A 1L5LA 4OQXA 5FWYA 2OXFA 2A0WA 2MHCA 3ODPA 2I2BA 3OIUA 5C53B 2CVOA 5B1EA 3LLSA 4OK5A 2IOQA 3FNBA 5EVCA 3WK4A 4EPXA 1IZ9A 2VHQA 5DJ5A 3GJZA 2FUEA 1E61A 1SFRA 2EKDA 4XYGA 3VMMA 4HB3A 1Z0SA 1R00A 3WL3A 1ZD1A 1SULA 2BUBA 3NKLA 4RSRA 2IYFA 3CF4A 4UM9B 1NNUA 4RX1A 3T5AA 1EUYA 1N8TA 2JPDA 3MMZA 4GZ3A 3THRA 1LPMA 2NU7B 4HNTA 4PC3A 4TSRA 5A4FS 2QLMA 4M89A 4HDQB 2UZ1B 1BTOA 4V02A 1FQJA 4AY6A 3O92A 3VU9B 1BE6A 3ASYA 3R0XA 5KC8A 4BV9A 1IDOA 4DR6B 4QGBA 1BG6A 4IKEA 4RELA 1X74A 3MAGA 3DKIA 1SVSA 4MTCA 1SXJC 3WGMA 3CWZA 5HRAA 4US2R 1HMYA 1C7IA 4XI9A 3NPMA 4PXAA 2QSJA 4S1WA 1X1RA 2H1LA 3BL8A 4PZPA 2HSDA 4PLVA 3AY7A 3B53X 3CY6A 1BWSA 3HUTA 4ICIA 3B9RA 3VTKA 2A6PA 2PXXA 1RP1A 3PJRA 1O0BA 1RQ7A 4FX5A 2O8BA 1O6FA 4EHLA 3SQWA 1VRVA 3DHYA 3KPJA 2ZSJA 2QEQA 1U3GA 1XT6A 2X22A 4YBZA 1XQWA 4UEOA 1BEEA 3WO1A 1EIZA 5HIIA 1RMYA 4TRJA 2VYVA 4IV0A 2NNWB 5AHXA 4CEIB 2C54A 2PH1A 3LXMA 3B36A 1XLTC 1NBMA 3P2KA 5IXYA 1N2SA 3WAKA 5KYYA 2PUAA 2PKCA 4WKPA 4WACA 5AW4A 5AXDA 4KX3A 3Q7EA 3TQFA 1HDOA 3WWOA 2C2XA 2XUAA 2Q07A 2PUHA 1A9PA 1YZVA 1XZMA 3EF3A 3GWZA 3PFBA 1P45A 4V0LA 4A2WA 4NPCA 1W6UA 1AN9A 1IE3A 1D2NA 2C04A 3N0XA 5F2EA 3VTAA 2OK7A 1BH6A 4RL6A 1PL8A 4OAOA 1YAJA 1X7ZB 2YJ6A 1OBFO 4ZODA 5FD8A 4UBKA 1SCKA 4F4HA 2HWYA 4L6AA 4PLHA 2ONYA 3E3NA 1E0JA 4G5SA 4JVMA 4MRPA 3S2EA 3HXKA 3S1AB 4B35A 1I0LA 2BCEA 4WY5A 4TM8A 5TVKA 3O8QA 2R2GA 3DOJA 5HBRA 2NQ8A 2P2DA 3AXSA 3TPCA 2E3JA 4YAWA 4QUGA 2ENWA 3E3MA 5IANA 1ZCBA 2C8VA 3BT7A 2W2TA 1XU4A 3IQGX 4JP2A 1NASA 2G8NA 2O2GA 3DL2A 4X54A 4ZQGA 5JALA 3LVQE 3T1TA 5HTOA 4C9BA 1GNRA 4WN3A 4BLQA 3DWEX 4UHKA 3LW8A 4P38A 4CM9D 2DBYA 2Q9BA 4MWBA 1G19A 4YMUA 1VHQA 3EVCA 5B1DA 3ZZ0A 4GKJB 1RQ2A 3WC4A 2JVIA 3H11A 4BATA 4E1VA 1KO4A 1I13A 1P5ZB 2VXBA 5KU7A 1KDYA 2CNDA 4H18A 1JR3E 3TZKA 1FUYB 3DDSA 4JX9A 1P2DA 3UJDA 5F7XA 1CETA 1ESEA 1GVHA 1S01A 2HYDA 4IH1A 3RLIA 5ENZA 3PPIA 1F9EA 3A9RA 4IAOA 3G2QA 2WDPA 2H16A 2VUTA 4RTLA 4REMA 3NANA 4B31A 3I01M 1U5AA 1GQOA 5CRIA 4B6OA 4RTSA 4NV0A 2Q5LA 2O2CA 2P27A 3EDYA 2QDKA 2L2QA 1YJCA 2PSDA 3RU9A 1Z0FA 1EDZA 1X1EA 2K2WA 2X9GA 3IT3A 1WB6A 5G3ZA 5FUMA 3TEJA 2YHBA 3LPLA 5CXQA 1AKYA 3O31A 1BVHA 2WG2A 2X8LA 3N0RA 3DBRA 4E2XA 4MI1A 1JP7A 3ZBQA 5J5AA 2F43B 3O2NA 4NE9A 4ZIRA 5I8ZA 4HS9A 4F9TA 4R1NA 4UQPA 4BYMA 4PY2A 2I9KA 1WZUA 3SQXA 1XCGB 2Q3HA 2OYRA 5KWIA 3CZCA 1XDGA 3SJCA 1JR4A 4JLUA 3N74A 4HNSA 5ESWA 4BKQA 2EKLA 1FL9A 1GKUB 1UKVY 2ZDGA 3G9XA 1BRMA 4IMJB 1E1CB 1IHPA 4GI2A 4RZ2A 4X3PA 3V4ZA 4CQLB 1HDGO 4PPNA 1P60A 3L8GA 5KHOC 4UUAA 2ZYDA 3RASA 1YIOA 4Z2YA 5KUTA 1PWEA 3D7RA 4F06A 4ZVTA 4AJ2A 2GXQA 3NTOA 4UVIA 2E7ZA 1M6EX 1R4AA 3GCDA 3NOVA 4MQLA 3ROEA 2Y1GA 3SSOA 2CNKA 4HVLA 2C3YA 4BB6A 3CW8X 3HYRA 3I1JA 3Q0IA 4PLFA 1I30A 5EP4A 3VV2A 3D81A 1APBA 5K2OA 1WJGA 1DC6A 2P9YA 3C98A 1YFJA 1HT3A 1LFAA 3L3BA 5CCDA 4QLBA 4M99A 1THTA 5MFPA 2QTHA 1ISMA 2JIPA 2ZB7A 2ZXFA 1DOZA 3HDVA 4IJQA 4OREX 5LB4A 1WULS 5J1SB 1YRYE 2H1IA 4BVAA 1PJSA 1SXPA 1F8FA 4V24A 1KZYC 2FN4A 3R7FA 2GPBA 3EVGA 3U62A 3UB3A 1WZCA 1E3WA 4LYYA 2WYWA 2CZQA 3VKUA 3C87A 2GM3A 2V0CA 5TVGA 2JLSA 3HCRA 1DTWB 3DMTA 1CK4A 1DKPA 4NMXB 4WINA 4E3WA 4WEOA 5D1HA 1G18A 3GH1A 3IOMA 5E9AA 1QG0A 4U3JB 1SCQA 2VJOA 3N6VA 4F91B 1M5TA 1GNTA 4TLBA 1NZFA 3PC8C 4IGIA 2C95A 2Z9BA 3B7WA 3CX3A 5HFAA 3HR7A 3KBOA 5B7QA 2V7QA 3RM3A 2QUIA 1GZ6A 3Q9SA 2IUTA 4IH9A 3H8JA 1YKFA 5H59A 1H65A 3RBZA 4F3NA 5K6TA 2ZW9A 4L5YA 1DRKA 3VDQA 5FO0A 1ZR2A 4HFRA 1GADO 5ALUA 5AM2A 1QQ5A 3AERB 1FLDA 2WJ3A 3LIPA 5C7IO 1E79D 2CBXA 1QIEA 3GNTA 3BRCA 3HUEA 4V1CI 5EP1A 2D1TA 3QMVA 4IOJA 5KBYA 1Y6ZA 5AKXA 4N5LA 2R6R1 2JH9A 3AB3A 4YJ2B 3KB2A 4GPBA 3I83A 2PQMA 3NIBA 1CUIA 4WA8A 2IP4A 3M49A 1IK4A 5JPIA 3IGFA 4OEHA 5H3LA 2OYCA 1YZKA 3SEQA 2RBKA 1JHDA 2EWWA 3KXPA 1KPHA 3RHFA 4G01B 1MCZA 2ZTMA 1HTTA 1FX1A 1TVMA 1ZX1A 2DU8A 1DAPA 2RARA 2CXNA 1WBJB 2I3BA 1E2NA 2Y6UA 2H1FA 2IW3A 1C3OB 2R79A 4PRZA 4E94A 3GPLA 1YR3A 2F3TA 2H4ZA 1M2NA 3WWDA 2IYTA 1FP2A 4KFCA 1W46A 1XE3A 1ZOPA 1JEQA 1M8KA 4O59O 5L45A 1Y6RA 4LUCA 1KR5A 1R0KA 1U4SA 5H80A 3ZNOA 2EP8A 2RGUA 3DVLA 1JAXA 1E8DA 4BLWA 4IWXA 1WCIA 2JEOA 5JSUA 4G0UA 3FYDA 4GLOA 2GS9A 4BZWA 1HLGA 3HBNA 2R2AA 5DXAA 2DFVA 2FMHA 1V4NA 4Q9HA 4TWZA 5GJCA 2EFHB 3ZWXA 3LPMA 1E2DA 3H2GA 3VDRA 2IBSA 1R12A 2QRUA 3AP2A 4AJOA 2DKOA 2NT3A 2QLLA 1JAZA 3WBJA 1BX3A 1B41A 1MW9X 1OZHA 1S2IA 3EVBA 1TPYA 3FVQA 4W7HA 4ND6A 5GZ6A 3RRZA 5HPYB 1FMFA 5KKNB 1W34A 3QNMA 4MQFA 2B6NA 1SG9A 1ECLA 4DJJA 3NMUF 4TT3A 2NAPA 5LWQA 4PTLA 1FJGB 5GM1A 1LQ2A 3F47A 1MQ8B 2FVYA 4ZGGA 1EEXB 2J0SA 1AX9A 3HE3A 3PHIA 5DGIA 2GZRA 1XXHE 2AFHA 4R3UC 1ZVKA 2B8WA 4RVHA 2Q8NA 4KQ9A 2B9EA 1U2SA 2AG0A 3AEUA 3FSJX 3WY9A 3A3KA 4EF6A 1JFRA 1L5GB 4AICA 3ZTTA 3G7SA 1SC4A 1TTPB 1U0BB 3BEOA 4EUHA 4ARIA 4M0CA 2YRWA 4QJIA 3LYAA 4RF2A 1VHJA 3BHIA 1KY3A 5AVJA 4CHTA 1I2CA 4A8JB 1XEXA 1WIWA 4TL6A 1V3TA 1ZGGA 2NUTB 3BIFA 4DMMA 2R8XA 5IARA 3PF9A 5KAPA 1KDVA 2PCLA 4TKVB 5IW8A 4Y9UA 3SWWA 5H8WA 1M3SA 4HTAA 4WHMA 1R0YA 4N6OA 4F71A 5DHTA 4LSGA 1DC3A 4BNVA 3UY4A 3EPLA 2V7GA 3KTAB 4B6GA 2WVJA 3ZHYA 2PIAA 1NQUA 4MMZB 1G3MA 2IS6A 1V9LA 1SVKA 5JI3E 1QC5A 4JNCA 3E48A 3D0QA 3SKXA 3U6BA 2BIFA 4FVTA 3CZ5A 1ZNZA 4WOKA 4C20A 3R7BA 4AY4A 4LA4A 2XYPA 4GKBA 4GQIA 5A5DA 2I03A 2EQ5A 2I7TA 2J3MA 3OSZA 4G85A 3UCXA 3R8CA 3WRYA 5KQPA 4HGRA 5LMUB 4H6XA 1NR7A 3O2JA 1A27A 1A4RA 2EJWA 4TTSA 3PYXA 1QRTA 1DARA 1VPTA 2A5YB 4IVPA 2YW9A 2IYNA 2ORED 4Q03A 5ERGB 1MOZA 1UJCA 2K2QB 3H5LA 4AN1A 1VJRA 2H29A 4EHNA 1YMQA 1CEXA 1RWNA 2EBWA 2X7XA 2VHCA 4MKIA 2CWWA 1IN6A 3AVOA 2FZ5A 3KKKA 1JILA 1Z0AA 4O4LA 5C7OO 3VSAA 2XAUA 1NSYA 2CXQA 3K16A 3WHLA 3BGSA 2YNMD 3ZCPA 1NVUQ 3U7RA 1OI2A 3IPYA 4C0WA 2BD0A 5FAKA 2FV8A 4LC0A 5AJWA 5DTIA 5FO1A 2IHJA 3FPBA 1NBAA 4PYIA 1PGJA 4CODB 3A2MA 3HC7A 3K05A 4BHTA 1V4VA 1ONNA 2PXCA 2FZ4A 2WIFA 3B9BA 3Q5DA 2ECKA 3IIMA 4CCSA 5BSWA 3U60B 2QZ9A 3L8ZA 4N7RA 4JLMA 3ZIAD 1FEZA 4PQFA 2YV5A 3I0ZA 2H52A 2Y4OA 2CUZA 3CVVA 2HCTA 1V16A 4DW8A 4PC6A 3TG8A 1MGPA 2FWJA 3OQPA 2R1TA 3K9LA 4NBUA 4TMTA 4YAJA 1DFGA 3ZEAA 3BDIA 3MWYW 4C0BA 5KTTA 3C6MA 4HQFA 3FFTA 4AF8A 4RH1A 3L79A 3KKPA 3RT7A 3DJYA 5B3KA 5IHXA 2Q3MA 1IQRA 4GNKA 3VHXA 1N1EA 1GPUA 5JECA 4HDOB 5AI5A 1R10A 2GK4A 3VO9A 4ENQA 5K6AC 1DIAA 3JQPA 3LQQA 5HWSA 2H2GA 5B30A 2FN8A 5E7IA 4GSYA 4MUGA 4AX4A 4L4YA 4RLFA 4JOBA 4TVBA 1K9VF 5M29A 4J1TA 4QPJC 1YACA 2EW2A 1TLFA 2C31A 2F90A 4R54A 1CDOA 1KJJA 1RLIA 2B61A 3IJRA 4IVQA 4OXRA 4P83A 3CC8A 5IPFA 3SXUA 5BVGB 1GV1A 4BKUA 1MJFA 3DB2A 4D5EA 4KC0A 4FFSA 4YCMA 5A4KA 1EXWA 4AT1A 5HQ3B 3EMBA 1L1QA 3OHPA 4GI7A 3O4JA 4RTOA 2OQRA 4FLEA 2XNDD 3C5EA 3DDOA 4CMBA 1DAFA 2DPYA 1ZXBA 1N57A 5C5CA 2HNBA 5JAQA 4RK7A 1H2XA 1YU9A 2PVCA 3KWFA 1TYBE 3Q72A 5IJAA 3EGXA 4BJ6A 5JJ5A 1ZAYA 1W35A 4CTNA 3RF7A 4WN9B 4OQMA 3BS4A 1II8A 1TCCA 4KI7A 4BZPA 3G17A 5TRTA 1RHRA 4CMEA 3CVUA 1CUFA 4BNNA 4YK7A 3U7JA 5ITSA 1CRZA 2N1BA 3TTWA 1VMEA 1ZQ1A 2DULA 4CMHA 4XD2A 1QG2A 3C3WA 1HETA 4JOQA 2JIZA 3B1FA 2YZKA 2HSZA 4DDHA 1GTVA 5CFZA 1E1LA 3T0FA 1VBKA 3ZXIA 4UOEA 2POQX 1SZCA 3UMBA 5CJJA 1WXWA 2ID4A 3Q85A 1FNCA 1EU1A 5KSPA 5MF6A 4QOSA 5KOHB 3C3PA 4Z9FA 1UXIA 5AJXA 3V42A 1HEUA 3DMDA 3FGOA 2VJMA 1K3TA 1H2AS 4C05A 3HJTA 1WA5A 4MVJD 3F4KA 4KPYA 3EBLA 3FKSA 1P2BA 4A6EA 3C74A 4B4WA 5LOVA 3UK1A 2H00A 4FT4A 2QROA 1N5IA 4WNIA 5LP6C 1QVAA 3NHKA 4FEGA 2NQTA 2B5OA 3EF1A 5FNZA 2GN6A 2BEKA 9LDTA 3EUFA 4OQDA 1YCFA 3VR2D 2CL0X 1C7RA 2RCNA 4HWGA 4WFKA 3VR2A 4DA8A 4LZAA 3G9TA 1T8SA 5AW6A 1M0EA 1AB5A 2QYHA 2ZK7A 4KIJA 4MKFA 3ROQA 2XADA 5CVEA 1P1BA 1XMVA 2A9OA 4YECA 1LBIA 5JSZA 3EYWA 3D7NA 4MS4A 2XCTB 1G8HA 4MO2A 1V5WA 1CYEA 2ZSUA 3HCPA 3PNMA 3LP8A 1SHTX 2IDJA 1TCVA 1TDJA 1HTBA 1M0SA 1QFJA 3JQ7A 3U2QA 3B1KA 1XO1A 2X5JO 2GZSA 3GMTA 4Q3EA 5REQB 4YROA 5EXEA 4B6PA 1XD8A 4PCVA 2PMEA 4BBJA 2IC5A 2JLUA 3DOCA 3BE8A 5CA0A 4RF5A 1WF3A 4TTVA 5FA8A 3HB0A 2OV2A 5KYXB 5H9VA 4DVGA 3RH0A 1EB8A 1QE0A 4YRRA 4R81A 5JJCA 3MJEA 1O8BA 2WM8A 4M7PA 3E35A 4D25A 1S9HA 2QAJA 5AKJA 4P4LA 2YFYA 3D4PA 1HXHA 5EESA 4MB0A 2VNKA 3LLUA 4IJWA 2JHPA 1ADFA 3WGLA 2C4TA 5GOTA 3DNPA 4FYJA 4LXYA 3PG5A 1ZAKA 2PMWB 2AI1A 2IX9A 3OZWA 4Q0MA 2WWGA 4MKRA 4TX1A 1HA3A 2NWQA 5JSKA 5FFNA 3OJXA 5LZ5A 2E4YA 3U26A 4XB1A 3FLBA 1M2OB 1KEZA 2OZPA 2WHYA 3LLCA 1BMTA 3E8SA 3DZBA 4MQUA 3SS9X 1RBZA 2NO7A 4M76B 3WHPA 1CUSA 3O6VA 2CK3A 1E7SA 1CUEA 3KUKA 4G1BA 1XKXA 1AB6A 4O25A 4P7FA 4WKOA 1LDBA 5DVZA 2EJTA 4DIEA 4R16A 4DL9A 4NCKA 1T2EA 3BSYA 1JDUA 3HVRA 1QB8A 1EAYA 2G70A 2ZYAA 1SCAA 3EGVA 1ORVA 3CPHA 3LK7A 3N07A 4G0OA 2F43A 1RLOA 4ZGBA 1F06A 2BRUC 5IYZF 1NJGA 4KW7A 3NOOA 4LDRA 3LT2A 3SS7X 3OJLA 4DLAA 3IPLA 4EPTA 4OL0A 4OK3A 1AUOA 1QLHA 2AQIA 3O1IC 1IVNA 4DFDA 4D79A 4R41A 3KZXA 1JYFA 3GFSA 1AQUA 5J5VA 1K27A 4IDQA 1Z35A 2IU0A 4UEQA 3ZV4A 1I4LD 1DOAA 4GP9A 2VAPA 4Y3UA 3OU7A 1Z47A 2AD1A 2DETA 3PE4A 2P0EA 3CZMA 2RG7A 3PWKA 2VYVD 5AI8A 2JA2A 4KACA 1OC2A 3MCVA 3ONDA 1AG9A 3LA8A 4O3FA 5THKA 3A11A 3OWXA 3K2QA 4RWEA 3C5WP 5A71A 4IX1A 4O2LA 4Q48A 3VQTA 4DA7A 1QU3A 2YHUA 4YCAA 4E31A 5DIFA 1T5DX 2EARA 2OFOA 4LVOA 4MP6A 4WCFB 1QR2A 4ZMBA 3B3QA 4M9CA 1HFEL 4U2FA 4BIMA 4MQ6A 1JEYA 3RS4A 4RDCA 4DDWA 1Y7TA 1G5IA 1MA3A 4JNKA 1UFKA 4QHTA 1VXOA 1ZCAA 2PWAA 5DCUA 5B57C 4Z3KA 3BE5A 3DMGA 2OFFA 2E18A 4EMUA 2CFTA 1KOGA 1ZSVA 1YK1A 2DFLA 1Q17A 3NWEA 3PC8A 3HGTA 3IV6A 4BLRA 1KDOA 3AY0A 5C7LO 1TI7A 4RUKA 1Y4SA 2HLDA 4QT4A 2IPNA 4ZAVA 4X6LA 1P5HA 1FZTA 1QH9A 1HM5A 1J2JA 2DF8A 4UFPA 1QGDA 1OAOC 1V1JA 5IT4A 1JVBA 2OBFA 2R00C 2XQJA 5JH7B 4CDRA 4PFQA 5B58T 1K08A 1JFTA 4HN2A 5DNYB 1VLQA 2W6JA 4MP8A 4ROSA 1E60A 5J2TB 4ER5A 2GSDA 2ZR9A 3JQGB 5I9IA 3ANMA 5I5EA 1E99A 1Q92A 1R3UA 3KEFA 4J8PA 1WZIA 4RY8A 4ARZB 1ZK1A 1B15A 1NP6A 4Y1RA 3VR1A 3AERA 3FZQA 1S02A 3VSEA 3IHKA 1KQGA 1DIOB 1SC1A 3S8MA 5DX8A 4MVJM 3ABOB 3N3AC 4RA9B 1NT4A 4DRXB 1GNQA 1KJZA 3CZQA 4JVLA 1OSNA 1IEWA 2YZNA 5EQJB 1FPQA 4M53A 3U0VA 5BWCA 2RHBA 1NQXA 1T5LA 3MJSA 2O7QA 1OE0A 2OVFA 3A06A 3EULA 1DX6A 4KBFA 2TRSB 4QTXA 4X85A 5LNK1 3LD9A 1G6Q1 1V95A 5L4NA 3H5WA 2QY9A 2F6RA 3D8HA 3WIDA 4MW4A 3RNLA 1PGOA 1PFWA 4RACA 1IUPA 1KYIA 4ZANA 2AFIE 5DN6A 1KYQA 4KXUA 4B76A 4KWIA 2G6BA 3I1FA 3KSMA 4R8SA 2W8BA 3T1QA 3TZCA 4A5SA 4EGQA 4EUFA 5CA1B 4QM6A 2HLNA 1U90A 1A8SA 4NYIQ 1NN5A 1UDRA 2HMAA 2HPAA 2O2HA 4M9SA 4ZO8A 1PWXA 2XUOA 1K6EA 4BNUA 2QM0A 3HKBA 4IM7A 5B3LA 3GBSA 3D8BA 1A2BA 4OJMX 5DSTA 3WYBA 1M66A 1VC2A 4OQLA 4BAGA 4N8DA 5DM1A 1U11A 4LAFA 4QQKA 1GZVA 2CB0A 2VZ0A 2XGMA 4HGNA 3UN1A 4CG3A 4CU2A 2IHVA 1ZKMA 1BXGA 1D6SA 4HLDA 5I9SA 3G5AA 3W5UA 5C8XA 4ZAYA 3GPCA 1A9XB 1ES9A 4ZVLA 3HTXA 4EGCB 5ISMA 4NZOA 4B46A 1CKEA 3H2HA 5MN6A 4OHUA 2AUMA 2Q46A 4RLQA 2JLYA 3PC7A 1UBUS 4M8IA 4TV9F 1KSGA 2WRZA 3ORRA 2ZRBA 4QXPA 2PV7A 2I71A 3REQA 2ZT5A 1FDOA 2DX7A 3E27A 4J49A 4N18A 1CUGA 4ALNA 3R76A 2WJHA 4FZ3A 3P52A 3RSOA 4BLOA 1OU4A 4L5JA 1ZM4A 2GWHA 3RLFA 4H35A 3RWBA 4PZZA 1D5CA 2IYVA 4QL3A 4BNGA 1E1QA 2XF8A 3D4OA 2O0LA 4B3HA 3DPSA 3K15A 4TTPA 1TM4E 3V4SA 4TKVA 3WDMA 3JARA 3D3QA 5BV8A 3PD7A 3L6BA 4HFMA 3IA7A 3ZGOA 5THQA 3TZHA 2YZ2A 1V5FA 5FYQA 3ZE0B 2R8ZA 3Q10A 1ZOLA 2B7LA 3FUWA 3QYAA 3R5SA 1LDGA 1PR9A 4Q4LA 5L95A 5TGTA 3OF3A 4RORA 4XUDA 2WMOB 2NSLA 4D4JA 3GNSA 1Q0SA 3LS2A 1A0OA 2WK1A 3KVOA 1E9SA 4F2GA 4YCBA 2MSNA 4IMPA 4XRGA 4BNMA 4FYIA 3DL7A 3C39A 3K7EA 2E1PA 1EDOA 2E6UX 2DECA 2R7AA 3T7TA 4J4TA 3LYUA 1V96A 5BR8B 4IQ4A 1SC9A 3BGDA 3KSUA 4M0EA 1FSPA 3HR4A 3EZ9A 5DCWA 1E1DA 4R83A 4N82A 3LX5A 4E32A 3AHJA 3AHIA 2X4DA 4IUCS 4UFNA 5D6NA 2ZE8A 5CG1A 2SECE 4RVGA 3AR7A 3SSNA 4K6KA 4X41A 2YX1A 4G0MA 1NONA 5DNVA 4KXQA 2QVXX 3WZMA 1TCAA 3FR8A 1QDLB 1WCXA 3H4TA 1YV9A 1J2EA 1SCIA 2ZWAA 1JIJA 3PUHA 3S0JA 1CQIA 3JATB 5C8YF 5IVIA 4GVLA 4DR7B 2ZROA 2J5RA 4TLMB 1Q6YA 3C3YA 3FF4A 3IKLA 4A0SA 2V59A 2X2EA 2YRXA 2X0IA 2ZJ2A 3OPVA 2HEGA 3LJKA 1HRKA 1VE5A 2AVDA 2AKYA 4MJXA 4Z51A 7REQA 1ZVMA 3LHDA 1WHSA 3GAAA 3IEKA 4YVFA 4XM2A 1ADBA 4HJXA 4MOWA 2JD0A 3QOXA 2O2EA 3TQSA 4JJ7A 4YC7A 3ZDZB 3EZFA 5LPNA 5IWAB 3QPAA 3DLIA 3MM4A 4G07A 5EJ4A 4JWKA 4MI6A 1ZGZA 2BFAA 3FAKA 2QE6A 3BXGA 3F1LA 2XECA 4CFZA 2GAIA 3D02A 4ZCRA 5TIIA 1OH6A 1JG2A 4JLWA 3V7WA 3KK0A 2QT9A 4KE8A 4QASA 5TJHA 4DNPA 3PUKA 4FOLA 5BSMA 5SZIA 3LH5A 4FDAA 4P58A 1NUQA 3ZE9A 1P7VA 4UAUA 4TZ0A 4M0KA 5D6OA 5E6SB 5JVDB 2HDNB 3HA3A 1OY1A 4BQPA 4ASUD 4MJ3A 5JQWA 3O7WA 3PXAA 1CF2O 1ACLA 4Z1MA 3RJMA 3JVEA 4YFYA 1E7YA 3TE6A 3ISJA 3I01A 2M1XA 3PXCX 5KINB 3S6JA 5FPKA 1G38A 4QBGB 1D2HA 4LJLA 1DBIA 3ZY2A 2BBSA 4XD7D 1CZUA 2I2CA 1EP2B 1B16A 2TS1A 2Z4RA 3E53A 3W5AA 2AH5A 3RVDA 4C0JA 3IIKA 3Q7QA 1LSUA 3SYTA 4R6XA 4YJHB 1N8SA 2WT4A 1X7YA 4K0KB 2E4AA 5EE0A 2AGVA 2QN9A 2XQIA 3DZGA 1G9SA 1KK0A 1F2DA 1EYZA 2WZBA 3EGXB 3THXB 3AR2A 3KYDB 1E9VA 1PUXA 5JDCC 1F0YA 1JPJA 4CWAA 1KTIA 2C2BA 1Z2DA 5JO9A 4EVQA 1VGVA 4A0RA 3I28A 1T0HB 2EEZA 2ZE5A 1MZVA 2L18A 3TPZA 3ZHXA 1D1QA 2PAAA 3R4VA 4YO7A 1N5DA 2IIPA 2YMPA 2A0YA 3R20A 5PGMA 4RK0A 2J1LA 2FP3A 2PZJA 2HJRA 4MMYB 5CCBA 1JRLA 1LDEA 1OPXA 3U1VA 2Y0DA 2PSSA 4AB1A 1LPOA 1N5OX 2ZIUB 5I8WA 1ONPA 1NTRA 1I3OA 2TECE 3K94A 4GGPA 2FPIA 5ES4B 1M6WA 2R7KA 3NASA 3JSAA 1ONOA 3C5HA 1A5ZA 1TM7E 1ORDA 2Z98A 3DZ8A 5AESA 3MWJA 1Q7EA 3ZQ6A 2BJHA 4OQEA 1NQTA 3SKYA 5KHLB 1JYSA 1JHXA 3EASA 3P71T 5I7OA 4LI3X 4IIBA 2MT9A 2OCKA 1N1MA 4ZVOA 2E89A 1WBBA 1CJMA 3QBDA 1G7RA 2R66A 4TXMA 2P9CA 1GARA 1VECA 2I6SA 2VJLA 3E81A 4HX2A 4TSKA 3T7CA 1B4DA 4RDHA 4F84A 2FQ1A 1VIMA 2VR1A 3TGPA 1U28C 4PIPA 3BWYA 4GI5A 4JXJA 4Y0AA 2QRKA 4BO7A 4F3KA 2WM3A 1UH5A 4MARA 1N7GA 1RWVA 3IUEA 2QVYX 4XUGB 4UC0A 3I45A 1YQGA 1A4XA 4ZVKA 3GLIE 3AOEA 2FPOA 2PUWA 3QX8A 1WOYA 3V2HA 3NWOA 4CL0A 5D3MA 5B6PA 2AXEA 2QGFA 2QNBA 4E30A 3T3OA 3ZZUA 2H1OA 5EEGA 4M3NA 3ZZNA 4BLVA 1RRPA 3VUEA 1QFZA 1DNPA 5DW0A 3LVFO 5LZ9A 3FNFA 1TOAA 3CR8A 5REQA 2Q5QA 1EQAA 1T3GA 1K5HA 2H4WA 3A3PA 2OCDA 4FFVA 5J47A 4D8WA 3UENA 2JCXA 3EXFB 1KC3A 3CJTA 3HEAA 2WYUA 2YWXA 3PQFA 4YB8A 2WPDD 1D2RA 2WPDA 4KYTA 3WZLA 3KAPA 4EHJA 3L7MA 2FR1A 5KTPA 3L1UA 1HKHA 1R15A 5FBQB 2DYKA 3UW3A 3WKBA 4DAEA 4QT0A 1NJ6A 5MN4A 1FBNA 3KOWA 1ESZA 3HVKA 1LSJA 3P8ZA 2RCYA 1DB3A 3KVRA 5JJBA 2ZWVA 3UYKA 4IXTA 1VIAA 3DOOA 2YIJA 1MU0A 3DEYX 1E4VA 1Z2OX 2CNWA 2GJKA 3H1FA 3KEQA 3ZXYA 4B4UA 4EUSA 1YFLA 4GBGA 3BCHA 1P73A 3KYCA 1CE8B 2WTXA 4KQJA 4P35A 1LI4A 3QI7A 1C50A 2WV7A 4QODA 4AYXA 1XXHA 2AFHE 3HA5A 3CURA 3O2SB 4K2HA 3IUBA 5L3QA 1XMQB 4V03A 1AGRA 2MSLA 3WLFA 4RKEA 1R7RA 2FSUA 4LNAA 1XEFA 3V1LA 1AN0A 2BGKA 2F3PA 5F4ZA 1Z7GA 4PXSA 2DM6A 1DEHA 1L8OA 3GNLA 4OA8A 1ZRSA 1QP8A 4RAQA 5KU1A 1HFWA 1U4NA 4LJ4A 4JBWA 4L75A 3HK2A 3AWIA 3K35A 3QY0A 4J0GA 1AZTA 4N3CA 4O4IF 1BCRA 2P9ZA 4CM7A 1SR8A 5BYAA 2WNSA 1T2CA 3CLUC 2XZOA 1E6WA 1KYWA 4PYQA 3TI9A 4N6NA 1I3KA 4NK4A 4QU8A 4DYDA 5IXSA 3AT1A 1I9CA 4N54A 2CLMB 2QRLA 1IRXA 3DL4A 3HBAA 4TQAA 4ZOLB 1J6UA 4C78A 2PZMA 4B82A 4NDNE 2FR8C 2R97A 3SQOA 4RZSA 3OKAA 4BQNA 4EYGA 4JP1A 2EFEB 1BDBA 2WIJA 3JQAA 5TS3A 3BJEA 3DAHA 3LMKA 3BWVA 4LDPA 4CKBB 4DF3A 6YASA 5JYEA 1IULA 4BNJA 2EKQA 4K3VA 4LDJA 3KKNA 3N7AA 1W4CA 3T5CA 1MDBA 2QSUA 3OEHD 3W8FA 1CUAA 3R9XA 2YXNA 3U44B 3KU4A 3N5KA 2VK4A 4MJ7A 1D2EA 3DBRB 4OQFA 3DDHA 5T6BA 1PGPA 5KYVA 4YUZA 4CIDA 1YC2A 1WVIA 1MVNA 1DDIA 2JBWA 3F74A 2GHRA 1TAHA 1IMJA 3EA0A 1VKJA 3RDPA 4OYYA 4EELA 3NJ8A 4U8GA 2WKQA 4B47A 5IT9A 2QRVB 3QYPA 4LFBB 1LPBB 4EB8A 4JQCA 4AVYA 1O8CA 3ZCXA 5JSQA 5KNDH 3NC1C 2W42A 2CDRA 3QTBA 1NFQA 3GGCA 5K3DA 5B1SA 3WXBA 3D31A 1B8UA 1Y3CE 5F21A 3H19A 1KRXA 2NN3C 2G0AA 4Q3NA 4Q05A 1V71A 1Z06A 3L9WA 4HQKA 1HYQA 4LSMA 1IPEA 4TMYA 3TKLA 3V1UA 1JKMA 3W7VA 5HNKA 1J0DA 1SHKA 2VBGA 1JG4A 3B5EA 5CX1A 4BNFA 1EGHA 1KERA 1KH2A 2YVKA 5C32A 1U8CB 1O9BA 1WZEA 1Y6JA 4MYSA 4BAZA 4D46A 5LU9A 4RV5A 3CTPA 3HEBA 1I6WA 3OOEA 2BDEA 3MA0A 1PVVA 3KDAA 4ES6A 4UQLA 1M75A 1XC7A 5EJ8A 2J48A 2D8MA 2ZSEA 2RGRA 3K4QA 1N8NA 4F5YA 1SKQA 4R2KA 1R8SA 3HPRA 4NYJQ 3FUXA 4P34A 1U3CA 3ZU6A 3OE5A 3A10A 5IM4F 2PBFA 4FDMA 4FOSA 3F6PA 4YWJA 2A8YA 2AMJA 3JQGA 3E05A 3R5JA 5GM2A 1QU2A 1JNXX 4EW2A 1GG2A 1J00A 2PYDA 3DULA 1AA6A 1Z8NA 2W43A 4LDZA 2XXAB 1CX9B 4ZVRA 5B1IA 2GZAA 3QMPA 1ZL2A 1BGWA 4IDPA 4QD3A 1F2TA 5A7FA 2OKGA 3R3XA 4W9NA 4F8YA 3FVWA 2WTMA 5A3JA 5LNK6 3VJKA 2JJ2A 2BMFA 1DEXA 4GM4A 3RFUA 3SICE 1OWNA 5B4VA 4E5DA 1ISSA 2JD1A 2EDCA 2GAAA 1UJBA 1VCMA 1VL2A 3OZCA 2YUTA 4IIDA 3NB0A 4S1TA 3TJMA 2GZ2A 3D3WB 4JWTA 4HVCA 4URXR 1CDZA 2HHCA 3L05A 2HHJA 3HJCA 2I66A 4PXYA 4B6RA 1RP7A 4D74A 3S2UA 4MGYR 1ORRA 4EW6A 2Q0HA 1PW7A 3V7UA 1J0XO 2C0PA 2W2QA 3HN7A 4UVHA 4DLXA 4ZI2A 2XV1A 3NBYC 1E1YA 3VNQA 4R71A 4YJ2A 3F73A 5F3WB 1UMDA 2XLBA 5C8YB 2AEFA 4H1TA 2XA2A 5AXBA 2BTEA 2Y27A 7GPBA 1NAIA 3E7WA 2A9VA 1CRWG 3Q3HA 3T4UA 5F3DA 1OJLA 3IQDB 3LUDA 1AD2A 3EA5A 2JFPA 4QSMA 3EEQA 4G1UC 1B6RA 4MIEA 4LHYA 1L5NA 4YT5A 1E2GA 3FNHA 1B00A 3Q5EA 4TYMA 4CV3A 1QUEA 4BQSA 1ONBA 4R5MA 2CKDA 4OFWA 4UTOA 3TUJC 4BO0A 3SHOA 1I33A 2ATVA 2ILTA 1O96A 3BQNB 1JQ5A 3QLUC 5TX7A 3VPDA 2AMLA 1XZDA 3VPAA 3X0DA 3EZ7A 1P8AA 4G8BA 2VWHA 3CR3C 4BAUA 2K7ZA 4IHJA 1SBIA 5TQ2B 5I7RA 2Q1SA 3CVJA 3MINA 1G2OA 3A31A 4LRQA 4Z0TA 3RFVA 4CCYA 2V3WA 5HZKA 1FXWF 4KE6A 1NVVQ 1CEEA 1J9ZA 2QJFA 1MTZA 3EZXA 3SXPA 1NN1A 1XMOB 4YACA 4KQGA 1AUQA 3GRYA 3I9LA 3W06A 4M9UA 1MRSA 1R37A 1NNLA 3NBXX 1TZJA 3H1AA 4OMUA 4YY3B 1A77A 3LECA 5AK6A 3RHTA 3D7MA 1NXOA 3K0SA 2GCOA 3ND9A 2GJ8A 1WUHS 3IR5A 4PO8A 4XYLA 1OBVA 1XRMA 3AF0A 2PFSA 3K53A 3PPYA 2HA7A 2YS7A 4RA6B 3JARB 4NXMB 5EIXA 3CGGA 1GUDA 3DE5X 4TWAA 4JVSB 3ZBTA 2BHRA 5I7FA 2A86A 4RHTA 2I6UA 3NLLA 4R2XA 2AXQA 3EGEA 5TQ0B 3X1JA 4M38A 1GOTA 2EFGA 4A91A 4D8TA 2EGHA 4IO0A 4BO6A 2OCYC 3OZIA 5JMWA 3MBOA 1NI5A 1YQQA 4HH4A 3CX7A 4BMOB 4UTXA 1AV6A 1K2VN 1FUEA 1W6RA 1SBCA 4FPXA 4S2EA 5CD9A 5DEOA 3WP0A 3LCRA 2WF5A 3FWZA 1NP7A 2HIHA 3EE6A 2GPTA 3T7KA 3ZE6A 4BNIA 3OMLA 4E13A 3TFOA 2VLBA 2DFKB 4IDGA 3KZCA 4YJDA 1C2TA 5KMGB 4JJKA 3A14A 1NTOA 5CH3A 4D1YA 1MLDA 1XMXA 3RAPR 2YWJA 5EWJB 3RS7A 2R5FA 2J0QA 1OW3B 4IIUA 2W58A 3LO8A 3MT9A 3ANNA 4JT2A 2FFRA 2CBZA 3H9UA 1BS9A 3PFNA 1P0FA 2V6FA 2DRIA 1QHYA 2XEXA 4J0EA 4NEQA 4S1OA 5EP3A 3TRKA 3VR5D 2VYNA 5CYGA 4H2DA 4HDRA 5KO2A 2BCGY 4XZ3A 5K0LA 2VHWA 4TMFA 1MEEA 4PX2A 2ZJBA 2C7GA 1PTJC 1UBJS 4B79A 3RV3A 3BC1A 3QXHA 3DYBA 3S2SA 2IIQA 3NM4A 4WRRA 1YT5A 2B37A 2FKNA 5B6JA 2O3JA 4I4NA 1UODA 5KS2A 5FOWA 3T5PA 1GUBA 2P4QA 3AH8A 3D6MA 2IA5A 4PGHA 2V4MA 3CLTD 4P33A 3S5JA 5IABA 4BP8A 3WG9A 1X7WB 1KC1A 2QP4A 3A6LA 3L4BC 3PFHA 5EJ2A 4RVSA 4M6WB 2MU1A 2GZ3A 3GBVA 1TK2A 2PYZA 4JUIA 1MHTA 1L5HB 1VE1A 3AEXA 4P5DA 3RIMA 4MCIA 1ESDA 1ODFA 5F9MA 1KDTA 1KP3A 1RQPA 4AP6A 4EI9A 4NE2A 2VXOA 1R6VA 4NV3A 3P9PA 1FTGA 2IUYA 1EVEA 5E6SA 2NADA 4JJFA 4RXTA 1N9KA 1UT6A 4XTRA 4DUZB 2C7QA 2HQ1A 3VR0A 3D4LA 4KUGA 4JI0B 1SXIA 3BQMB 3OTGA 3T06B 5BW4A 5E38A 1N0UA 4WCFC 4DMFA 4XWWA 1GDTA 5FADA 1RKBA 2ERYA 4IIFA 2VT3A 3INGA 4LC9A 3RUDA 1Y7IA 4XWKA 1L4BA 2GEFA 1QGOA 4OGGA 4I6EA 3TOXA 2ACWA 3AINA 2PKEA 3T0GA 4M88A 2D7CA 3FUTA 4YO8A 3VU9A 3GB9A 3AVXA 3DHVA 2CMKA 3AUKA 2WWXA 4EG8A 3D43A 2EFJA 2AD5A 2B0CA 3ABSB 2I2DA 5T4HA 2AFRA 1EUDB 4G0QA 2PRZA 4UD2A 2FXVA 3ZV7A 4MUHA 1A96A 1R4MB 3G79A 2G07A 1U98A 3H9QA 5DM4A 3W7AA 4BO9A 3IUSA 5CTJA 5D51S 2PT9A 1HZJA 4Q93A 4X5OA 1XZIA 4V0QA 3EG9B 1C7ZA 1TM2A 3K8YA 4QVGA 5BYJA 4I9FA 2VQDA 2B4RO 1CNEA 2DBRA 2FZLA 2P9TA 1WY7A 4PO9A 1UXJA 1WMAA 2WYOA 4M1TA 4C4OA 4B43A 1SURA 2LWIA 2ZCVA 4P4UA 2BTOA 5BQPA 1B1CA 4JJ6A 4QULA 4XRRA 3DFFA 2X0FA 5B7GA 4E6EA 4MEBA 4D0SA 1LS6A 3ENNA 2DEUA 4ZDJA 2OG2A 4B85A 4EI8A 2OVBA 2W9XA 4EPRA 4DIDA 2P35A 1L4NA 1DG3A 1GGVA 1MOSA 3TB6A 3OQVA 4KEAA 4M0DA 4KQIA 1QGUB 2AJCA 3PBKA 4XQ9A 3C1UA 3OD1A 4B75A 1A8IA 4Y8VA 5C18A 2F55A 3TIIA 2EZUA 4HQRA 4DCCA 5JS7A 4C2UA 5JRZA 3RYCA 4MW2A 2YCLA 4RPLA 5AVOA 2X41A 4P08A 5COBA 3AUJB 7MDHA 2NGRA 2ZXEA 3WMFA 3BG5A 2DSTA 2ZI9A 3FFWA 3DE6X 1TQ8A 4XASA 2JRCA 5K6RA 1PNRA 4Q7MB 3UFBA 4MQ4A 1KBQA 4IJ5A 2JFVA 3AL0C 4Y6RA 3NV7A 3SDZA 4LJ8A 3FYCA 2J0UB 2V7EA 3QF4B 4MR9A 2OO5C 1PFVA 2NVWA 3EBOA 5KHAA 4AJ1A 4P7KA 1BFUA 4B3MB 3QEKA 5HQJA 3TRJA 4C7OA 3UV3A 3EDQA 1NRWA 2PMDA 2X6TA 1EFVB 3L6EA 4KFUA 2DR2A 3DM9B 3FIJA 3M9XA 4LPKA 2WSBA 2Q1WA 4FHDA 2ZR7A 4KFTA 4MCAA 4E5PA 3BXPA 4ZO4A 1WBDA 3U39A 1SUDA 5KNLA 2VVTA 2J9GA 2OV6A 4YCDA 5EP2A 3CSSA 4EMTA 3LRTA 4LK2A 5JLAA 5C3MA 4MDEA 5AK3A 4KH0A 3ZVRA 4GICA 1P1CA 2OCLA 5CFNA 4JB3A 1J1UA 3TSCA 3M4XA 1RC1A 1ZICA 3WQQA 4XFJA 5G1NA 5FOQA 3NAQA 2PX3A 2CXRA 2QDXA 3IT1A 3WBFA 2A1TS 4DZZA 5JSZB 4EUKA 1I1HA 1EXNA 2CVZA 2UUOA 3ANTA 3W90A 3C43A 4QJ5A 4G97A 2QW8A 2ZIFA 4C4TA 1H2FA 4RGVA 4YP9A 4KWHA 4LV8B 2IV7A 3G68A 4YTEA 2PQ2A 3OBIA 4B0PA 2RGDA 1SVMA 3HLKA 3PQCA 4CKCA 1TA4A 3H1EA 4E5SA 2WG1A 4NJMA 2MSKA 1AS3A 5CFOA 1U2GA 2QG4A 2AR7A 1N5RA 4M8SA 5FA6A 3VPSA 5TLSA 4K03A 4RF3A 4BNWA 4X7PA 3PUIA 1Q1AA 2ZKLA 2IL1A 3WSVA 4C4RA 5DISB 3O4RA 4A03A 3FOCA 1KTVA 1AHIA 3IDAA 3LBIA 3MJCA 4BPBA 3A1WA 1G7TA 3KD2A 3TVTA 4CM8A 4RQUA 4AJJA 4CLRA 5LR6A 3HWX1 5I9NA 1DV2A 2R6HA 4RKYA 2FSHA 4QLAA 2V7TA 1LC0A 4RPIA 2HHHB 1USVA 1VTKA 5EKUA 3VPBA 3N2EA 4RMNA 1XN1A 1KVQA 3B8EA 2HMYB 3FNQA 4UHFA 2XT0A 2GF9A 3ZKAA 2IX3A 1OA1A 2PUGA 4XSVA 3DA8A 3LKBA 1UWCA 2FW7A 3DD5A 3ESCA 3HZZA 2YHSA 4LYFA 3GVCA 3Q2OA 1UKBA 4N0DA 1JDJA 4Q1DA 3GVXA 1EK1A 1G4AE 3HSSA 3UJPA 3PNVA 4F45A 4TT8A 1C1XA 4DS3A 3C8ZA 4C7KA 5J4LA 3EVFA 3MD0A 3UV7A 1DAIA 1TM5E 2ZTHA 1UJ5A 3S55A 2YXPX 3QP9A 2PH3A 3W8DA 4YT4A 2Y1OA 4OHCA 5KC9A 4YAOA 3BWDD 2VYND 2FPSA 3NOXA 4OQNA 4RD0A 4UOQA 4K3UA 5ARBA 3N76A 4F96A 2QOEA 4HO1X 2DQKA 1QZUA 1Z6YA 5A5VA 1AXRA 1XNHA 2JS7A 4CIXA 2PXHA 5GMOA 4QUEA 1KAGA 2GRUA 2QU7A 2RK4A 4OHVA 1CULC 2QIOA 2H7YA 4H3VA 4GPZA 2J7KA 2MSEB 2H5LA 4X00A 2Q3EA 1AKMA 4IICA 3PEEA 1O5IA 1YRBA 5JS6A 3IRUA 4JU8A 4CL2A 4U02A 1N2CA 3DAYA 1PGQA 4MV8A 1ZINA 2VDWA 3JVDA 2XMCA 1KIAA 1SA0B 4LQCA 2WABA 3P5SA 4V0MA 3V6LA 5K3FB 3TIGA 3WGYA 1CS4C 2QTMA 4Q9IA 1RZUA 3QE4A 4W8GA 2HJGA 2C4NA 2AI3A 2WTBA 1JS1X 1DP4A 4OP3A 4UEKA 3OQBA 4BZQA 5FFMA 2HA2A 5KYGA 1J7JA 4MWCA 1YO6A 4Y9DA 2H4JA 1EP9A 1J9GA 1PYOA 3M6IA 3QPCA 5F7JA 3DGFC 4CNQA 4NNJA 2UUAB 3F9CA 1ZWKA 2QMQA 3L8DA 1R8YA 1RJ9A 4LJ5A 3TWOA 3WL8A 4JLDA 4TV8A 4NC9A 3L7JA 3LYHA 1I6KA 4ON9A 5CB8A 3ZCUA 2HMSA 1Z7WA 3ADOA 3SFTA 1YF3A 2ZP1A 2WILA 4B2PA 4UBMA 2JHCA 4DA9A 1LK7A 1VLZA 2X0EA 5K5EA 1IAVA 1CY1A 2ZETA 1CB0A 1O4VA 1MEOA 2C57A 2FA9A 2GTHA 2GYYA 2HCRA 2QVCA 3HNOA 3LSYA 1DL5A 2AL7A 3NIWA 2NYRA 4NBRA 4EMBA 3O3OB 3UG6A 3T3NA 1R8XA 4LY3A 5BWNA 4BRUA 3AHFA 1Q14A 2GCPA 3I2FA 4H1HA 2ADFA 5D8DA 1JR2A 1YI8A 3GJ3A 4HGOA 4TOIA 3CJRA 5CFRA 1X6VA 4C5BA 1H66A 4KSBA 5KOJB 4JI7B 2AW5A 2OGWA 4W5RA 3QW2A 1J8YF 2B4YA 3HXTA 1CY4A 4FW8A 3S2GA 1M6YA 3H0KA 2GEBA 2XE6A 3MWEB 4EZBA 1XZJA 4MKZA 5ED0A 4B7AA 1JSRA 3EZNA 3MAJA 5H68A 3JW8A 4DQUA 1DMRA 2RHLA 3QYFA 3VSDA 3I61A 1DQNA 5BNFA 3G0OA 4AG5A 1QJ4A 5IS2A 3IJ5A 1QIFA 3AQ4A 4GXTA 4CEJA 2JFBA 4OGFA 4Z4FA 2I0FA 1VPVA 4HLQB 3JD1A 4M86A 3N8IA 3HRIA 5T4FA 4URUR 2IYZA 4BB9A 1GP2A 2X1HA 2AR0A 2J3HA 3JQDA 1AIPA 1YRWA 1WZNA 5CP8A 3TR0A 3EEYA 2C5GA 3HKBB 2Y9PB 4ERXA 3MINB 5IBRA 2Q3CA 3USCS 1C3XA 2OESA 3F3YA 4Q3CA 2FRDA 3PS9A 5K1ZA 1QPZA 3EXHC 2Y66A 3LCJA 2Y68A 1PT5A 2YDXA 4DC1A 5DCLA 3WLMA 4URHA 1JXMA 3EAQA 2PN1A 1YS6A 2P1ZA 5E2BA 1A9XA 3FLMA 4YRMA 3E61A 1Z2EA 4BRWA 4C43A 3GJ6A 2F3RA 3VGPA 3FA2A 4QLOA 4DNOA 5BY2A 3D6AA 4NARA 3NCHA 1TMYA 4INJA 3DVSX 5K3EA 2P2ZA 3LT0A 4JX8A 1P4JA 4Y2JA 2V1UA 2R5NA 4OI1A 2WIKA 4IUBS 5HZMA 4IR7A 3QEJA 3TVYA 4HF7A 4W9RA 3VU1A 5K99A 3DMNA 3NHUA 3T0IA 1U9ZA 5LZ4A 5KQSA 3WXMA 1UBLS 3UMVA 4I1PA 2ZSDA 1L7BA 3AZOA 4XWAA 1VFNA 1AF4A 3D5TA 4IILA 4TVKA 5E0OA 4I08A 2Z57A 4NBKA 3WGJA 2HLDD 3C70A 4O08A 2C5SA 5DHPA 4DYVA 1L5KA 1D3AA 5KJCA 2FQYA 4ZI7A 2ZIEA 3I2YX 1ZOIA 1A9OA 4IYRA 3PCXA 3WRVA 1THZA 4A4DA 2ZBVA 3UB4A 2NYVA 3RJ9A 1LX7A 4FYXA 3BMNA 1VM6A 4Q4HB 3ADCA 2XWSA 4FYMA 3OCCA 1BD3A 3L0YA 2IE0A 1I01A 4O0LA 4KOEC 1C9JA 4CW7A 3UPTA 2XAAA 1S0UA 3SG0A 4D9EA 1P5FA 1D6NA 2XNHA 1V37A 5CNIA 1CP2A 3P32A 2IJGX 3C8UA 3QE0A 5AJVB 3QSYA 3L7DA 2P3QA 4CG2A 1SVIA 1U94A 1CR4A 3CRQA 1VYTA 2WT8A 4TMWA 1BKYA 1KYYA 3ET5A 1JA9A 3QVGA 2WIGA 4O2BF 1ADGA 2JLRA 2PZAA 1I7SB 3VJRA 2VT7A 1JH9A 4ER6A 1TC2A 2Q2NA 3JXEA 4HXGA 2Q1XA 3CPSA 4KMRA 3QFHA 4L6IA 4LXHA 2XLCA 3OESA 4Z8YA 2I8CA 2YV1A 3RHSA 2PUDA 1EP1B 5GIOE 1E3LA 3R0QA 3GIWA 5AKKA 1EM6A 2YY5A 4Y2GA 5DSXA 1QUFA 1YKGA 2A1UB 3HS3A 4GXQA 4M7OA 4MROA 4MW9A 4REOA 1YJBA 2I6GA 2W6OA 5ENDA 1T3ZA 3ITDA 4AKEA 5ILQA 1MNAA 1GAWA 1TYDE 1J39A 1SOAA 1TW3A 4NAUA 1YWGO 1EHIA 1IM8A 3FMIA 4N0PA 1AQIA 4LWOA 2FWBA 4GVXA 2VNHA 1ESCA 4KQ6A 4MPPA 5AJZA 1DRWA 3HUUA 3WLNA 3UAZA 4EVSA 5M2QA 4XEUA 5IF9A 1IXYA 4BKOA 4JJ4A 4DEXA 1LA2A 2Q45A 4E5KA 4CQMB 4EJ2A 4TXHA 1WXHA 1Z4PX 2IYRA 1V1MB 1XNGA 4FGUA 3PGJA 4WERA 1BMQA 2C3PA 4WZBB 4NFSA 4RK1A 3UJ9A 1P81A 3G6WA 3TXXA 1UL1X 3RUCA 2V6GA 4JJAA 4Q9NA 3VR4D 5BR1A 1FCJA 1E3SA 1KP9A 3GJRA 4G4JA 4OI2A 3SXJA 4ZCMA 4G67A 1C7QA 1PX0A 4WESB 2IIVA 1I2MA 2HMVA 3R9IA 3HO6A 4UDYX 2I6XA 4Y9TA 1VA4A 5DIZA 4INOA 3L2OB 4Y1RB 3S40A 1A2KC 2WUGA 3SZUA 1GY8A 3QUCA 4YQZA 3PXGA 1YCHA 4P93A 1WXEA 3RF6A 5FTLA 1NR5A 1GTJ1 3IT2A 2YN4A 4UDXX 3MSCA 3RE1A 1XLUA 5BSVA 2DFTA 4B6QA 4LRYA 1GN8A 3I53A 2YWEA 3P4UA 1K7YA 1W0KD 1T4BA 4MRRA 4CEIA 4JJEA 2C3MA 4EGSA 1P91A 3UAWA 3AKEA 4A6XA 3SJ7A 3VOBA 1H2HA 5AXAA 4EG0A 3ZVKA 3EB9A 3W5DA 1Q22A 1B7GO 4KQFA 2OUIA 2LDXA 4W6ZA 3IEMA 3HUFA 3QKSA 4EITA 4O2AF 4R1TA 1WD5A 2LUOA 1EHCA 1OXKB 2PH7A 1TUIA 3P27A 3ZZ1A 2Q2OA 3VYSB 3ZIAA 1PQWA 4FB5A 2KQUA 3QUSA 4CDMA 3AI3A 1LGYA 1V26A 1XJWA 2OGTA 3DLAA 1SU4A 4EYQA 4BFWA 4LMRA 3C3JA 5AP9A 1DKUA 4UARA 3PPVA 3OU2A 4RLSA 3JTMA 1GSOA 1UBHS 2MCFA 3RRBA 2A58A 3COPA 3E58A 1XOIA 3HB9A 4FE3A 4L5BA 2J9FB 5IEJA 1XZAA 2OP1A 3OO1A 3IQZA 3NIGB 4OF4A 4JDPA 3O0TA 4BJ3A 2FRXA 1N2JA 1SQGA 4M0LA 4NONA 5FPHA 1R2QA 2I4LA 2HCJB 4C6RA 3AVQA 4D9KA 1OGYA 5E2IA 4IJ6A 3LI2A 3C14C 2ZUBA 4Z99A 2EG5A 3QF4A 4J0KA 1W0JA 3REQB 3VR6D 4YJ3B 2ECOA 1QS0B 2GRAA 3HZRA 1JB1A 3RK1A 1GLVA 1RCFA 2AR9A 4A6PA 3A37A 1Q0LA 5LZ2A 5HS6A 3DP9A 3UW1A 1VB5A 1TQDA 3L40A 1VFPA 5THXA 3DF9A 1U6JA 2FZKA 1IHXA 1IATA 2A4KA 4I14A 2BRUA 2AHOA 3R6DA 4XVRA 2I80A 4LE0A 2KYRA 2EYQA 2Y1WA 3AFIA 1L5FA 1YJAA 4KI0A 1ACJA 1ZRNA 3PDHA 3W6ZA 3RW9A 3WSWA 3RT9A 4LXXA 1II0A 3R40A 1RI2A 5EYPA 2V7VA 3ECCA 2HYIC 3SHQA 3DZDA 3BA1A 2HBYA 1X7XB 1EVZA 3A9VA 4S1VA 4BFLA 4DSOA 2Q5JA 4G65A 2AW3A 4HS4A 4QYSA 3EVNA 5DP2A 3SE0A 3UHPA 1OFUA 1U5BA 4ZC8A 3V8PA 4WOBA 4FDLA 2W7TA 1CUUA 1SBHA 4ZT3A 5I51A 5BQ5A 1OX5A 2XYGA 4LY9A 4YI3A 5BVHB 4LHVA 5ALEA 2GEUA 4GQBA 3RREA 1REQB 4Z0NA 4KZPA 3WICA 1EUCA 1MTOA 1L6IA 2PWBA 5EUQB 4YLEA 3DZCA 1GCAA 3RVQA 1QVVA 1C30A 2X9VA 5ARDA 5HJ5A 4KJZA 1P4AA 3TXYA 2G9QA 5G41A 1I24A 4QOIA 2ZJFA 3CE6A 4NX2A 1M2KA 5KX5B 1P18A 1CQIB 3KKOA 4XDZA 4FGKA 2IEDA 2WTAA 1UJMA 2F2TA 3UB2A 2BP7A 4F4UA 5ILGA 3ONEA 4JYZA 1E63A 3LOUA 1M7HA 4ITRC 3LPNA 1QF9A 1Q2XA 3ELUA 4I99A 1MB2A 4QC2A 3TIXB 2P1RA 3MUOA 4QUHA 3VJMA 2CHGA 3EOZA 3OFVA 5DHSA 1NRJB 1W2GA 3G2KA 4G5QA 1JFLA 2V65A 3P0RA 3PC4A 4KZKA 4LYJA 4XYMA 3N2KA 4AKHA 1KI2A 3V8BA 3B70A 1JEYB 1H5UA 1Q2UA 4NEGA 4KL8S 4ZEWA 5C80A 1TM1E 5ANRB 5TE9A 1L3CA 2GPSA 1PJTA 1FP1D 3D5QA 2P8JA 1JEOA 2WU8A 2X3YA 1PDVA 3GQBA 4HZUA 4K28A 1GYPA 1KZHA 4BEVA 1OZGA 3GJQA 4S04A 4WLVA 4EA9A 3IV7A 1AMOA 4C21A 3B85A 4I5EA 2G4VA 1J07A 3BRWA 5JVDA 4AJPA 3HDHA 2IGTA 4IVRA 5E7JA 1B73A 1O7JA 2JEZA 2FEMA 1YB4A 3LHKA 2EJBA 5IKEA 1WO8A 4TSFA 3PNPA 1JWBB 1R6DA 1V1RA 2AX4A 2GVNA 3DR5A 3LU1A 1RBMA 2JEYA 3OLWA 2CB9A 2G28A 2ZLBA 4U8HA 5HDBB 2OT3B 3MGBA 2LD4A 5TQVA 1LFDB 4BLUA 2HU7A 1CY2A 1P80A 1NLYA 1NXSA 2CF5A 3PRYA 4BVLA 1UFVA 4UNRA 4BNHA 4MA5A 4RY2A 3WYFA 2A67A 1PR2A 2ORVA 3BJRA 4QX6A 3W34A 4ED9A 3JZDA 2NVBA 1X7YB 3VU8A 2I6TA 1OLUB 1W4LA 3VO8A 3WKDA 4J9UE 2CLDX 3ZBUA 1ZPDA 1E7RA 4D99A 2CK3D 4HEJA 4DRXA 5K3FA 1VJ5A 1M8GA 1V0JA 2VBCA 3RVJA 3A6JA 2ACEA 1EHYA 1TE2A 2E49A 3NWBA 4FWIB 4EPVA 2VDLB 4XGQA 3S7TA 2REXB 4DIBA 4EJ0A 8ADHA 1TLTA 1XMIA 4RK4A 1J99A 3QEMB 1KXJA 3U4GA 4U7TB 3O84A 2Z4TA 4JSTA 4L9SA 1XNJA 2JIOA 2EZ4A 4AW9A 3RFFA 2R6FA 3AUTA 3E0QA 3NOQA 3WK5A 5EHZA 1FDVA 4HWRA 2PX4A 4G5FA 4HUJA 3QE2A 3O82A 3GUYA 3I9OA 5EWLA 2QRHA 2ATEA 5LD2C 2C2ZA 1BFDA 2QMOA 1GV0A 3UKOA 5HM8A 1QYWA 4HB2A 1EQUA 5DH9A 1GU0A 1SXJA 2ZI6A 1RPNA 1KRWA 1Z6GA 4GOJA 2ORYA 4E21A 2GFHA 2YMMA 3VH4A 4MK4A 4D3SA 3UHAA 2WZQA 1Q7RA 2G9UA 5CGZA 3V4PB 3VO2A 3PJFA 5DWQA 1HQKA 3OZEA 4IG9A 4YONB 3NRCA 4PYLA 4CN8A 1XK7A 3KWMA 1E4EA 1IJBA 5ELXA 3EVAA 3WYNA 4B6EA 1JLMA 5EUMA 4INPA 3OCVA 2D5AA 2UVQA 4MR7B 1R0ZA 3CBQA 1YVPA 4UTNA 3WTCA 1Q0ZA 3QG1A 1HEIA 4I1YA 2IVZA 2PZKA 1IL0A 3CLRC 4QGGA 2P69A 3OJWA 4L22A 3JAKA 2QX8A 4KIGA 5C1OA 2VTEA 1XVTA 3Q15C 1A50B 1UZAA 3TG2A 3OQNA 2QZJA 4HPXB 1SQ6A 4PQYA 1GQQA 1UZNA 3FPHA 4LTDA 4DLVA 1T2DA 2GLXA 3CWCA 3H5RA 4DILA 3A6KA 3WDLA 1JR3D 2F62A 2TMGA 3FMOB 3UBTA 3PX2A 3P0FA 3EQ2A 1CHDA 1VJCA 3L6RA 1SWWA 4KR2A 1J21A 4HGZA 4W7IA 1U0JA 2W2LA 4EGAA 3OX4A 1QYRA 1BVUA 3I04A 4D9FA 4WUVA 3NQ41 4E4TA 2J5QA 2ID7A 4EA8A 3L4BA 2ZM6B 2FUG1 2WI8A 1ZCJA 5L4SA 1UDBA 1ZCZA 3INRA 4FN4A 2XGGA 4IRXA 3I62A 3BMXA 1AGXA 2VTVA 4GYWA 4A1FA 1VCHA 3IUQA 3EXFA 2HWKA 3KZMA 5FUXA 5IUKC 4B17A 2FMKA 2JFNA 3HADA 3R3ZA 3UJAA 2RAVA 4WXEA 5LXTF 1K3UB 5AO9A 3FCUB 3GH3A 4JJZA 5CT5A 4CG1A 2DOKA 3BICA 2YN2A 5IAAA 5C4GB 3U3KA 1V6SA 3AHGA 3F5MA 2Z95A 2BHTA 3GLGB 3H87A 4W99A 5DT9A 3JQ8B 1PG2A 2VHYA 2D00A 1HT2E 3AR5A 4MIOA 3B89A 4MS3A 2VDOB 4IWYA 4OL9A 4ZARA 4OJYA 1R66A 2HNKA 2IP2A 2PZGA 2QM8A 2RJNA 3P0JA 2NO6A 3FZGA 2AOXA 5TQ2A 1VQ1A 2FFJA 2OV3A 4DMUB 1EFUA 1XQYA 3JQ9A 1Y7HA 4GL4A 3IHTA 3USZA 3R24A 4LEIA 5PNTA 1PYGA 4PAOA 2WKWA 3R5XA 5AI9A 1FSFA 1G7SA 3H5TA 5KSWB 4P1ZA 1FMJA 2YQZA 3GR6A 1MJHA 1HT0A 1WL8A 4F2DA 5GONA 2QAGB 1L5VA 3D59A 3AU8A 3GC6A 4JELA 2G1PA 2OLKA 1PG0A 3QWFA 4RGYA 3CCFA 3SK0A 4CV1A 3KR0A 1NPYA 4E4YA 3BMNB 3QIVA 2VH2A 2Y4NA 2X86A 2AK2A 2Z5LA 4MITA 4ODIA 4UCQA 1LWNA 1NGSA 3DBLA 3LRPA 3OCYA 4IIJA 4S3MA 4DAOA 2PUFA 4NZMA 4GKKB 3ZE7A 5A9SA 3ZN2A 1L3BA 1T9KA 3HFSA 3B9PA 2V45A 3BKWA 1U0LA 3QWBA 1FB5A 1V48A 3JQBA 1NJ5A 1TMGE 1FVHA 3H83A 3EY4A 4M8KA 4P9NA 5ESDA 5IX8A 3JD4A 3ZY6A 4RSMA 3LYLA 5GJBA 2XMBA 3QLVC 2Q27A 1ZIOA 4UBOA 2DUWA 3U3JA 3AUYA 3ZY5A 1D9XA 4CV0A 2ZRQA 3E3OA 3QVOA 4QJ3A 5LCXA 8ABPA 4MR7A 1YL6A 1XL1A 3NAZA 1JF8A 3O9ZA 2GF0A 2BSXA 2GA8A 2P7IA 1MAVA 2DQ4A 3K32A 1E69A 4BMVA 1R5NA 2FW6A 3IAXA 2IBTA 3UMRA 4ZTZB 3VU0A 2CNBA 2P78A 2UYCA 1U8XX 2IPOA 2D13A 1YQ9A 2CE2X 3DD1A 4JVOA 1U0TA 1G3UA 1QVZA 1LV8A 1ZGBA 3RU2A 3GEIA 2XE4A 3H05A 3WFZA 2G5TA 1AU9A 1FYVA 1LK5A 1DAEA 1NA5A 2FP4A 3EXG2 4GR4A 4GWGA 5HF8A 3H1BA 4LV6A 3IKTA 3KDPA 1ZUWA 3IBCA 1XTJA 1FP4B 3MJVA 4XB6B 1DBQA 2RHGB 5CB0A 2ZT6A 3OFKA 2OAEA 3W5HA 4C2AA 1V1MA 4CUZA 2AX3A 1AHPA 3C3CA 3ZCSA 3CO5A 5EKXA 3THYB 1T8UA 1X7WA 3KYDA 1E9AA 4BUCA 2VSNA 3W2GA 5BN5A 1XU7A 3V7NA 1AF7A 1R9JA 2PX6A 4FQ7A 4I9GA 3NXKA 1VHWA 3F2VA 3U7QA 4DHEA 1JEDA 3QX9A 4UOZA 5KQMA 2ONKA 2J3KA 2P90A 2WYIA 4RZUA 1D0IA 3GHYA 3I73A 3PFCA 4MH0R 1CJUC 3HP7A 1PW5A 1KZGB 3RI3A 4W9NC 4FMPA 3THWA 2SKCA 2WD9A 2W2KB 5FBKA 1JV2B 1L2TA 1P5RA 4FGJA 4JMLA 3IP1A 4UCXA 3ZHTA 2UXDB 1NL3A 3PC2A 1RRFA 1PV1A 4L72A 2P9JA 3HXMA 2Z5GA 1ZMRA 1Y3AA 4QWWA 4B2IA 2Z08A 5CVDA 3QPBA 1QGYA 4OQZA 2F4VB 1SVUA 3FHCB 1ZN9A 3LCCA 4BV8A 4DNFA 3NWPA 1SJ9A 2GCIA 4KMMA 4UULA 3QVLA 4IMRA 4CIVA 4N6GA 3KVYA 3D8SA 2DY0A 1KKMA 1RHUA 3DUWA 1ZS9A 5H83A 1AQJA 5JMPA 5A3SA 1R4MA 5BQOA 3GRVA 4EAQA 1UKCA 2AXNA 2AN4A 2O1XA 1BROA 2QWXA 1O9GA 2VYFA 5C8VA 2O8EA 4UNPA 1DQYA 4QFCA 4FHFA 1YRAA 2RHHA 4HEQA 1Y1SA 4OP2A 1JB9A 3SSMA 1NI4B 2PUVA 3MWFA 4WAUA 5JDCA 2ASEA 3HI6A 3PHGA 2Q4BA 3TNDA 1J22A 2J9FA 4B6JA 1MG0A 3QHQA 1B76A 5LYYA 2DPHA 4J76A 4PF1A 5K6AA 4NQRA 2RKWA 2JI4A 4NIMA 2Q5HA 3EIQA 4IIYA 3FCSB 3JALA 5KX5F 4CVNA 5I3CA 1AOXA 1P31A 2AN1A 1G5FA 1PBNA 4HNRA 3QM1A 4LDAA 2P5UA 3WS7A 1POXA 1W5SA 3WGKA 3AHEA 1KMMA 5DWVA 4FEAA 1P75A 2ADMA