4LZPA

Structure of the tir domain of the immunosuppressor btpa from brucella
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
162
Chain Sequence
QAVKKVAQEQKRLSDERTKHEAFIKQSLSSMRTTEEYDFFISHASEDKEAFVQDLVAALRDLGAKIFYDAYTLKVGDSLRRKIDQGLANSKFGIVVLSEHFFSKQWPARELDGLTQTRILPIWHKVSYDEVRRFSPSLADKVALNTSLKSVEEIAKELHSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Putative uncharacterized protein
publication title Structure of the Toll/interleukin 1 receptor (TIR) domain of the immunosuppressive Brucella effector BtpA/Btp1/TcpB
pubmed doi rcsb
source organism Brucella melitensis
total genus 57
structure length 162
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4lzpA00
4C6TB 2JS7A 3UB3A 2M1XA 4LQCA 2J67A 4LQDA 4C7MA 4W8GA 1FYVA 4W8HA 1O77A 4EO7A 4OM7A 4C6RA 1FYXA 4FZ5A 1FYWA 5KU7A 3JRNA 4C6SA 2Z5VA 3UB2A 4DOMA 4C6TA 2Y92A 3H16A 5H3CA 4LZPA 3UB4A 1T3GA 5FORA 3OZIA
chains in the Genus database with same CATH superfamily
1SFRA 2XMDA 5JNWA 4QYXA 1EDBA 3AM1A 4ARSA 3DC7A 2QW8A 5E38A 2PWYA 2ZVJA 1XXHB 2FW0A 3CLKA 3JQCA 1QC5B 3PE6A 3E22A 3IERA 2GNOA 1QKKA 4RABA 3WLIA 5F9HA 4B3GA 2TMKA 3F4KA 3MN1A 1BE8A 1CY4A 1Z26A 4PICA 4URHA 3WMFA 1GGMA 1TF5A 2FMTA 3U6KA 1I7DA 4OI4A 1J8FA 1H5UA 2G4CA 1KYQA 1C9YA 1M6YA 1DDIA 4RBNA 1QP4A 2X0NA 4ZCLA 4GZ5A 1RYDA 3KWLA 2REQA 5JRZA 2YOHA 3QX9A 3HWRA 3U60B 1E18A 1JKMA 2XW6A 3R6GA 4LGMA 3TOXA 3WE7A 1RPNA 2A3NA 3JALB 3WQRA 3GP8A 1CWUA 3JQBA 3TIGA 1DLJA 2I29A 1SWWA 3F71A 1T3HA 3FYUB 4OMDA 5KB3A 4D4JA 3ZI4A 1P0QA 4QJBA 1CZRA 2CNWD 3G6KA 3ZJ4A 2OP0A 2UVPA 3IEKA 4IH9A 2BAGA 2F43A 1VIYA 4YMIA 5ALQA 1ZQ1A 3ZY5A 4HL6A 5IAAA 1FC0A 3R3UA 1M3SA 1FFGA 3ZV3A 3TR6A 1I4EB 5BQ3A 1IBRA 4CMBA 1UOPA 2G70A 1KQOA 4MMXB 5LWQA 4JUBA 4RS4A 1FBTA 4G0XA 4UREA 3R5TA 1JH8A 1F0YA 2QN1A 1X87A 3OTGA 3AJEA 4IDBA 4NZYA 4S0ZA 2A94A 5IBRA 3EXIA 3G82C 4NSNA 4B87A 3ZVKA 3AUTA 5IC5A 1BKSB 1Q6YA 5DMXA 1TB4A 4IQGA 4RSRA 2FF5A 3W9UA 2W6IA 4M46A 2AL7A 4S1VA 3D6FA 1IZ9A 1C3OB 1TYAE 1LK5A 1QZTA 3P9QA 4LY6A 2OUKA 1H2BA 5AM3A 1QWOA 1BKYA 8ABPA 2ENWA 5AH0A 4YVFA 4L08A 2AXQA 4AJKA 1LEHA 2DWPA 3D7SA 4IIYA 2VYFA 4ZRMA 5H1YA 2O8BB 2NZUG 3LKVA 3L7JA 3OZSA 1VHTA 1KJNA 4EY5A 3OM1A 5F78A 2B8WA 3D3QA 3HJUA 3KQKA 3UY4A 1NX9A 2HQBA 4B6FA 1AZTA 4BP1A 3DYIA 2BWJA 2Q6LA 1G4HA 1X1SA 3DSRA 3UCXA 5CEEA 2O5EA 1N3YA 1V96A 2HEGA 5EIHA 3WQBA 3LS2A 3DHEA 2PTHA 3HR4A 2WWHA 3F3MA 4D79A 1XD8A 2XQVA 2DLNA 3THYA 2O3UA 1DBPA 3E9EA 3P97A 3QK7A 3VMFA 5HRCA 2W2TA 3SS7X 4EECA 1OJ7A 3DDSA 2JGIA 2PRKA 3EIOA 2DPXA 5JAUA 1DIHA 1H4VB 1LNQA 1U0RA 2A1TR 2L18A 2YHUA 3QXHA 5JW6A 5BRJA 3SU8A 4RH3A 3F9CA 4L0QA 2C2XA 1U8UA 2QTLA 1NBAA 3BL5A 5DXAA 2ZB8A 1E9FA 4HNHA 4A6XA 5EKXA 1V7PC 4WL0A 1OFTA 2CJWB 3NC0C 1KZ7B 4Q3OA 2BE7A 2YHIB 3H0EA 1S3GA 1WS6A 2Y1WA 3BUSA 4P08A 1LVHA 1RYMA 3U80A 2YBEA 4NWIA 3FVQA 4TXNA 5EL0A 3RBXA 4EA9A 1VJ5A 1WU7A 1U7HA 3UK1A 4G0VA 1RABA 3NEPX 3RHTA 4AJPA 3OE7A 2ID4A 2Z2KA 3EYAA 5MFZA 1FZTA 1J23A 1LPNA 4QOJA 4YLGA 3JWGA 4WKCA 1ZH6A 3PDIB 4KYVA 2CJXA 4FFSA 4KDRA 1H5QA 3PHHA 4J76A 2WA1A 3TX2A 4RD6A 1SXHA 3VV2A 2Q3BA 1R3DA 1YBHA 4Q47A 4H0NA 4XRRA 3U4QA 4FYPA 2MOKA 1CY2A 4HGNA 4XTRA 5FO1A 1L5QA 1FDOA 1E4EA 5KOJB 5KYWB 3GNTA 4AMYA 2OGWA 2EW2A 1MA3A 5BVGB 4BVLA 1WJGA 3BBPA 2WB2A 3JQFC 1LKZA 2NXJA 2JI4A 2W8BA 2VL7A 2G8NA 2IOFK 3PQ6A 4RPGA 3WLEA 2BUCA 4LIPD 4OPMA 3G85A 3Q8WA 5KYTA 4JC8A 1XD2A 5B7GA 3RI3A 1QS0A 2OBXA 2IHUA 3EODA 4FZRA 4NQRA 5G53C 1CJCA 1IM5A 4CDMA 3W9SA 1DQYA 3KM0A 4OIMA 3WK5A 3LO8A 3F1KA 4LOAA 5B64A 3B9BA 3DE0X 1SELA 2AW5A 5L7WA 2GJ4A 1JHZA 3A2MA 1OH6A 1GD1O 3E03A 4TV8A 3ZD7A 1L7MA 1Y0BA 2PU7A 1SCUA 3F90A 4MCIA 3RJZA 2VHUA 3V8RA 3EFOB 3VNUA 1GSIA 1P6UA 2NM0A 2WUWE 2XIJA 4OXXA 3V55A 4CL0A 1TTQB 1N6KA 1XF9A 2HU2A 3U0VA 1IH8A 1HM5A 2IZ0A 2XOKD 3EASA 4UAGA 3S1AB 5KOHB 5CIYA 4CG1A 2FPMA 5IMSA 4AO6A 5A4IS 1SKYE 2CLSA 2FPXA 1DAGA 1VI5A 3AY7A 4GOJA 4WRRA 3HHPA 4XD2A 1L3IA 2YIVX 3QA3E 4QXOA 4H1UA 4M49A 4F1KA 1QR6A 4A9AA 4ND4A 2B4QA 5KTRA 3D6TB 3U56A 3IQHX 4CZ2A 1PJ2A 3OFSA 1ZVVA 1WKVA 4Z53A 4GQIA 5FUMA 1LVUA 1VMIA 3KK0A 3GYBA 4RWEA 4MQMA 5ERGB 5TMDA 1SAYA 4EH1A 1MEOA 4XYGA 2F9FA 3L0YA 1MCZA 3I2YX 2J46A 3LNTA 4ALNA 2NUAA 4D4GA 2ZI9A 1EUDB 1W44A 1GP2A 2HXGA 3A3YA 4N5DA 1CNMA 1S2IA 1WHTA 3T5PA 4PX5A 1YQWA 3H8JA 2QMEA 4PYOA 4PPNA 1RZVA 3KDAA 4DQVA 3TZCA 1C0KA 3VDNB 4F9EA 4CQLB 1L1QA 1M34A 5E1OA 1CRLA 5BN5A 1MHTA 1FRNA 1ZVKA 4LYHA 3SZOA 4LA4A 3AFNA 4J4BA 4ZT5A 3RF7A 2JKZA 4QT0A 4RV4A 1QV6A 4F45A 2P90A 2QE7A 5D5QA 2WE7A 4LRTB 3E0QA 3VTKA 1T3GA 1G0OA 3L8GA 4FI3F 3IDAA 1EQAA 1WY7A 4RGYA 4U7TB 2Z04A 4FSDA 3O26A 2PV0A 1E64A 1YJCA 4J6FA 4WSOA 4PYMA 3ANNA 4OQEA 4K28A 2E21A 1HTTA 1ZOPA 1RLMA 1T5IA 5K20A 3DZHA 2W98A 3E5MA 5G3ZA 2W00A 8LDHA 4N6GA 4ZK2A 3QXCA 1E92A 3RR2A 1B0ZA 3LHIA 4PO8A 2QL7A 2JA2A 2PYDA 3G5LA 4ADSG 1ZSVA 4GE0A 4F4FA 1OX6A 2YZGA 4GPEA 4ARIA 2FZ5A 4D6YA 4YMWA 4GKJB 4Z86A 2BLLA 5FV4A 4L4RA 5DHRA 3JQGA 3AOEA 3S2UA 2XXAA 3GRKA 4LZPA 4EA6A 2QD5A 3WVNA 3VVCA 5FDFA 3LV8A 1YACA 2FUKA 2EV9A 3PIDA 4R2WA 5CH5A 4U5QA 5FT9A 3CO0S 3O1IC 1F17A 3SJBA 4E51A 5JCOC 3U19A 2RHOA 4FK8A 3G9XA 4C78A 2V4ZA 3C8ZA 3GJ5A 2XY4A 4RDIA 1QGED 2X6QA 1X1AA 3UW3A 1JKFA 1CIPA 2OAEA 1NTRA 3CNEA 3PCRB 3CG4A 3KT6A 1ULTA 2AJDA 4DLUA 1OI4A 1T91A 1U2EA 3HVHA 3OPVA 3I8OA 4MWSA 5KYUA 4BJHB 4U2KA 1RFGE 3WGVA 1D03A 4HH0A 1QHEA 1FS5A 1NNSA 3LYUA 1ZY2A 4G23A 3BRWA 4FMDB 4GI3A 4GP6A 5EIFA 3ZWAA 4BEWA 4ZJUA 5KTOA 2G76A 4E03A 4HWOA 2FY8A 4K40A 4LF6B 3RJ9A 1LPAB 3K73O 1NPDA 2QUKA 3QTTA 3GFFA 2HO5A 4YRAA 2AN3A 3AMVA 3DZDA 4ESHA 4W9MC 1HZJA 2O7QA 4BLOA 2ATEA 2BTQA 5MGBA 4MYHA 3D4LA 3HDTA 2HJWA 1ECPA 5F4BA 5BN4B 2AGVA 4RY9A 2ZEJA 3D8UA 1IN5A 4NCIA 3E15A 4JXKA 1EB8A 2CB0A 4DLTA 4RW0A 4ZZ1A 1Z8FA 2EJUA 1ZA2A 1F2DA 1TK3A 4MW7A 4OK5A 2OZVA 2XSZD 2CFCA 1BMFD 3QMMA 2VVTA 3RUHA 2I7XA 1BHQ1 3ZQ4A 4P0QB 3QKSB 3OOYA 4Q4CA 4LYEA 4PSVA 2YV3A 2Q2OA 3JQ7A 4MSUA 3VVMA 4W5OA 1DC6A 2VNSA 4PO3X 3CEAA 3HKDB 4BLRA 1FX0A 3O4GA 4JLPA 3UJ7A 1YR6A 5DNAA 4QVKA 3FETA 2W9XA 3DAOA 1R0WA 2Z43A 5ILGA 2PXXA 2RJ3A 2BD0A 3FBWA 1TUIA 4UE3S 4CM9A 4PLCA 3D59A 1AE1A 3L7LA 3EEOA 4YJ3B 3GFVA 4R7TA 1VP3A 5AW9A 4AIRA 3H5LA 1E9EA 2XNJA 4KMMA 2EIXA 4MUFA 3ZY4A 3PJGA 2IUEA 2PQ2A 4JZYA 2PJRA 1TQ8A 1FRFS 3MMSA 1NWCA 1H22A 1GEEA 2OV2A 3W79A 4TGLA 3I01A 2NU6B 4ZO4A 5GJWC 3TH5A 1WTCA 1HYQA 3NXSA 5HK9A 4DLLA 4YMSA 3DG9A 5B36A 2ZRDA 3IHLA 2OB1A 1V3UA 3A9RA 3LMKA 4AS3A 4EHNA 4X00A 4HNVA 3R7WB 2HSWA 4YHBA 5JFTA 3D4PA 4BGVA 5EMJA 1LX7A 1PX2A 5BY2A 1KXJA 5CURA 1H2HA 3BXGA 3LFUA 4NZ9A 2ENUA 2QHXA 4G56A 2J3MA 1PJ4A 2IY9A 2WPDA 3HVJA 2UZ3A 2X0KA 3IUYA 4K9PA 5HTKA 3TJZA 2HWYA 4YCLA 5IHXA 2QVZX 1PW5A 1MU0A 2BM0A 3MAJA 4Q4DA 3FSEA 3A3PA 4JWKA 2JI7A 1K92A 3EDRA 2ZRKA 3FMVA 4C4TA 3HP1A 1RLOA 4OLJA 4M7PA 3TTWA 2NYUA 1EFPB 2HBZA 4POAA 4L3WA 2HTFA 1PZXA 2PN1A 3NORA 4R98A 3C5HA 3I2HA 3U1TA 1PHPA 4PHCA 4DL9A 5A5FA 4RSHA 1V7ZA 3I1IA 1SRQA 4N5LA 3VBEA 1Y3CE 1PS8A 4WBXC 2NVUB 2NO9A 2HWUA 5AVRA 3WFZA 1N1GA 3ZU4A 5AKGA 3V8EA 3ZW8A 5DM4A 3UH0A 4E2YA 3DZBA 3W78A 3I9V6 3FMFA 1H0KA 2Z98A 3AB8A 5DBOA 4F4JA 4ITUA 2QTVA 1HUQA 3PUHA 4OMCA 1Y4AE 4A8PA 4JV5B 3RC2A 4RJJA 3NHRA 3O03A 1GXSA 4IR7A 1A9XA 4FU0A 4LPKA 3OTWA 5GONF 4F5WA 2X3FA 3IBYA 3AEYA 5J3JA 3UAXA 1RKQA 1PR6A 1P3Y1 2ZB4A 1D4AA 5CLGA 5HZHA 4EJSA 2YWRA 4OL9A 5DK4A 2X6TA 4JCCA 2X40A 3I01M 4AB1A 1PJTA 5I4KA 2A30A 2WFLB 5P21A 1V35A 3LHSA 1EFHA 3AF1A 4WFJA 2VZLA 3VHLB 3MJ4A 2ZT8A 4O6VA 1KYWA 2QNIA 3OJ0A 4JZKA 3MTIA 3DBLB 4G84A 4Q0MA 3LZCA 4ARAA 5D7BA 1JIIA 7YASA 1J0CA 4IH1A 1G5PA 2D2XA 5JCJA 1RI5A 1D9ZA 2PKQP 5EYPA 3S7ZA 5HF8A 2COUA 4TKLA 4BEVA 1KQ3A 2PEYA 3LD9A 5JHHB 1ACJA 1QVZA 1ZGHA 2J3EA 4FVTA 4NCXA 4DCNA 2BJWA 4F7DA 4MR9B 5J2TA 5IZCA 4A0SA 3IAM1 3T4EA 3TJRA 1PHRA 5DULA 4KR0A 3LWNA 1XTZA 2UUPA 5TEVA 1ETHA 1VE5A 2H8KA 1EWRA 1G5QA 4RPIA 1K98A 5K0CA 2QL9A 4LWPA 1WXWA 2KLBA 1E0KA 3OIWA 4D9CA 2Z6AA 2N42A 2JIBA 4XA8A 2OM6A 4MRMA 1CUCA 1QTIA 4WBNA 5DP1A 1GAEO 1PJZA 3A2KA 3V1NA 2UYOA 2XECA 5EG5A 5ES3A 1EGQA 2X1LA 4LE1A 3TS1A 4B3XA 1A5SB 2O8NA 2NTYC 2WY2D 1F06A 4OXKA 4FYVA 4L50A 4M1SA 2CUTA 4YJFA 1TDJA 2AZTA 2IHBA 3GCZA 3M9XA 1R4ZA 2ZI3A 5CFOA 1L8AA 3ELWA 3QU9A 4IW3B 1E69A 4PZUA 1YHYA 3ZTWA 4ZT3A 3HB7A 1M34E 4G1VA 4JC0A 1PF7E 2JJQA 1ZOIA 2CXQA 1CS4C 4DIKA 3KXDA 4KFCA 1NMQA 3L41A 1ONOA 2QSYA 2X5OA 2M6RA 3EIXA 4RJIA 3BYZA 5EMLA 1I9GA 1E3LA 2WFZA 1X7WA 3NIGB 4AC9A 1ZLYA 1FMFA 2PS9A 5LA6F 2NW6A 2JEOA 3DT9A 3HYNA 4TKUB 1W4AA 3HKEB 3LBNA 1MO6A 2J59A 4MI9A 4O4HF 1L4GA 1TQ2A 1JAXA 2X7HA 4XUCA 4F3NA 2PRIA 3WXMA 5IXJA 1XA3A 3F8SA 2O1WA 4QPDA 1M5TA 4EW2A 2IXTA 1YIAA 1KKUA 3QPVA 1QB7A 4N1AA 3PITA 3FYHA 4UBKA 2HTEA 4UTXA 4YO7A 3C87A 5MFPA 2PRYA 4MWCA 1YZFA 2B8EA 2FFQA 3CZRA 3M4NA 5KWJA 3BBLA 3QE3A 1Y6FA 1IBLB 4N48A 2O8DA 3FOCA 2HCTA 1VKNA 2NO6A 5E6RB 2FEAA 4C03A 4LY9A 4YMLA 4AROA 3U7QB 1AU9A 2O4CA 3FZYA 4RU1A 1PR2A 2YY7A 4M0KA 4YROA 3TL3A 2XCTB 1OVGA 3P19A 3SBXA 4OJTA 4O8CA 5GJCA 4QPPA 1SBZA 3MPOA 3K6SB 4X7RA 1Q95A 5DXJA 3H42B 5JH7F 3GJSA 4E1AA 4Q24A 3QX3A 2P1RA 5J2UF 2Y1DA 3AJ9A 3CNBA 3FHOA 2Z57A 4TSFD 4RD4A 3MOIA 5DGTA 3M6AA 4OU5A 5ER6A 3CVOA 3H18A 3AVWA 3ZWBA 1UXGA 3FWYA 4DY6A 3QEKA 4S2EA 1QO9A 1OE0A 3L7MA 1G1MA 3PJDA 1L7DA 3L07A 4N9WA 4UNSA 1LBSA 3DVAB 3TDNA 1TJ4A 2QRLA 5BYBA 1EFVA 2QD4A 2VRCA 3LPDA 3ZCQA 4NAVA 1MBZA 3FPSA 1JYSA 1E6UA 2FZCA 3T94A 2DVMA 1P9WA 3MPUA 3IEMA 3IMCA 1OT3A 3ECCA 1V5GA 2O05A 4HQ0A 3GDGA 3D4IA 2P77A 3KZ1E 4TSRA 1HBJA 4IMRA 5T8KC 3NTVA 4DJ5X 1FSGA 2QUBA 3BHNA 1OAKA 2FOIA 3K5PA 3UV7A 4EZBA 5B4VA 3EZXA 2OGSA 2VDJA 3CH5A 1CY1A 3MCWA 4FWIB 4X1KA 5TRTA 3ZGZA 3KQUA 2YV5A 4M0DA 4F3KA 3DLCA 2LUOA 2P9ZA 2E7ZA 1JDZA 2W2MA 5DN6D 1EWVA 3IIMA 3GFGA 3PNQA 5IULC 2E6UX 1EG7A 3QG5A 1N78A 3JQDA 4UKDA 3LUPA 4EFMA 1LJ8A 4J1TC 4LDRA 1X1EA 4RACA 5HSGA 4D0NA 1PT9A 3KV3O 1Z4MA 2CXUA 2PSEA 1NBMD 4O2AF 2RJOA 4BZXA 1XROA 2QRVB 3P52A 4RVSA 4ACBA 4CQNA 1N4DA 2GPWA 4NOLA 1E7SA 4HXFB 3T1HB 2GZRA 2WJPA 2AMVA 1YU6A 3CUKA 3PF8A 3SHWA 1XEXA 3EH2A 4EJMA 2EF1A 3U5TA 1JA1A 4MW5A 2YW2A 3K1JA 1KTVA 1VXRA 4DA8A 3GPIA 2XCLA 4S1PA 4P4UA 5COBA 1JHXA 3X43A 1P7VA 1OI7A 1XK7A 4LEIA 4DUZB 5GWXA 1ISPA 5IJ0B 4WKNA 2ID8A 1BDBA 1V5FA 1FMJA 5F5NA 1NHWA 5C32A 4RXTA 3STYA 4XVCA 2NU7B 4HATA 3KTDA 1CFJA 2HBRA 4DV0B 1DZIA 4QIHA 2I6XA 4EY6A 1PZHA 2NQTA 3GDWA 4ZU6X 1YBAA 2J5XA 4WVLA 4OYHA 1NJ8A 1C0LA 1RQRA 1O6FA 3IKVA 4I36A 5K03A 1WETA 2REXB 1VLZA 2VDLB 2DTEA 5EHZA 2PX8A 3H8VA 5FBVB 1NF8A 4AWBA 3WLPA 1JR3A 1MC8A 3EC1A 4KLNA 1DUVG 3AI3A 4NENA 1U3WA 4F6LA 4L6CA 2C7GA 3MRVA 1GNVA 4UM5A 3VKVA 1XDGA 3ZE7A 1QF7A 2G80A 4G01B 4CU2A 2D00A 3HCAA 3P5BA 1OXVA 5DWVA 2WJJA 1ZD9A 3CV3A 3B3AA 4AECA 3UK6A 3KVRA 5BYAA 2PUBA 3DOHA 3QI7A 4Z51A 1W36C 4MNTA 1N0IA 1LTHR 1P2DA 2EGGA 4Q4JB 3RNLA 2BGNA 3AUSA 1J00A 3OEED 3RUIA 3D3KA 4C0KA 2PUAA 3ZWCA 5KDOA 5DBGA 3G0CA 4JLDA 3SN6A 2ARKA 121PA 2ZTMA 3GEHA 1N75A 3BFJA 3OE4A 1E79A 5AKJA 3IULA 4NV1A 4LJ4A 3TMKA 3ZWPA 1BFUA 5M2QA 1F48A 2PUWA 3MT0A 4KSYA 4EW6A 5LU8A 1G8YA 1YMQA 3QH4A 4MWZA 4TVOA 4W9NC 4F3CA 1VSQA 1SOWA 1IJEA 1RWPA 1MNAA 2H4XA 3WMEA 3C5EA 4RPHA 4DS3A 4U5XA 4L8WB 5IPFA 1RRFA 3F7NA 5BXQC 1F6DA 2GMWA 1ECGA 3H4IA 4YMUA 1JSCA 3IB6A 4X8MA 4EX6A 5CCBA 2A5LA 3JASB 1QHYA 1ZCBA 1OTXA 4Q4AB 2R8OA 1WKBA 2ETVA 2EWWA 2M6KA 1RXEA 1N0VC 3ZZ1A 1GYQA 4YMHA 3KQNA 1XMOB 4GG1A 3PYLA 4OD0A 5BUSA 1ITZA 3KZNA 4R51A 2ZB3A 4NR0A 3CF4G 2HPAA 5EP3A 4PG7A 1R3UA 3I9FA 1M0EA 3UBTA 3ICOA 5AOBA 1U90A 4LYGA 1ZMOA 4FTWA 4QASA 5CCXA 3JX9A 1A97A 2NP7A 2PUJA 3C3WA 4I9GA 3GA7A 5FA5A 1YVPA 4FMBB 1UPBA 1QG4A 4LZAA 1V11A 3OZBA 4J0JA 1QMGA 1WXIA 1MIOB 1XCMA 3KVYA 2IV2X 4DCVA 5LP1A 1EP1B 2OYCA 4CLOB 1N34B 1M5UA 4LSMA 2GD6A 4DJFC 4AZSA 2YHBA 3JTMA 1RI2A 1Y9DA 4I50A 1BN6A 3C15C 3COZA 4UVGA 4XQEA 4RV9A 3DFKA 2X0EA 1TNDA 4PANA 2EBUA 5DM2A 4F86A 2BTEA 4GS5A 3KUKA 2JBHA 1XLTA 2VCEA 1YOVA 1OXMA 2P1ZA 1XRPA 3MIZA 1QHXA 4QU5A 2V7TA 2OK8A 2NVBA 2ZG6A 2BV3A 4PINA 1K8YB 1CUYA 2RD2A 1I94B 1T1JA 3GYGA 1XA4A 3OU7A 3Q12A 4M1TA 5HJ5A 1S96A 3UHOA 1CHNA 3B1JA 1JPNA 4HGZA 2IUUA 1SKBA 1XHEA 2HBYA 2J32A 1CQPA 1YOBA 2TMDA 2IVZA 2ZQYA 3BAFA 3F8WA 1KY5A 1SPBS 4KV9A 3PVZA 1E96A 2GO7A 1T3LA 1XTRA 1P1FA 2QAIA 3KXIA 1N2CA 2XA1A 3IDSA 1JZTA 2W37A 5C4IA 4OHZA 2W2OA 2WWWA 3DEZA 4RTMA 1NBMA 1GAWA 2YC4C 3FGZA 4PG4A 4MDEA 1NQUA 3NQ41 1PZMA 1EJ2A 2IXBA 4ETMA 2YKGA 1V3TA 5ISMA 1H2YA 4F2PA 4JJ8A 4PR0A 2NQ2C 4GEGA 3ESDA 2P2CA 3NJ8A 3UAYA 1G3RA 1IM2A 5EJ7A 1M6NA 1FDWA 4COKA 1JAZA 2QJFA 1MRZA 2EZ9A 5F76A 4EI9A 3VPBA 2FA9A 2BFCB 3QG1A 1O96B 3T15A 4BNVA 2BKLA 2XKAA 4K81B 5F7XA 1MW8X 4LWZA 1Z5ZA 1BIFA 2HSJA 3JS5A 3HDHA 3F5DA 3KYJB 4HWSA 4B4WA 4UM8B 3HXPA 1ZDMA 4XWKA 4A36A 3P2JA 3V4FA 3NVKI 1NGSA 4YASA 2WF7A 1E9CA 5AW8A 1TX4B 4BY9E 1RTKA 1EFLA 3AR2A 3GNSA 1H8EA 5DEIA 4CLRB 1IDN1 1W19A 1E5DA 1W6RA 1XO1A 2CYAA 2EBWA 2XOEA 1TADA 1NOKA 2HMSA 4GD3Q 4GL4A 4YT5A 4U2DA 5FFMA 1WUTA 3ABZA 2MT9A 2I33A 3GLUA 4RZSA 4RIGA 1R64A 5BSFA 5ALIA 3WL5A 1JXOA 2B0JA 2CD9A 2W70A 3KEMA 4YFYA 5BWOA 5C8XA 1NG9A 2JIZA 4WESA 2BF7A 5FL3A 2PQ6A 2PS1A 2ZI6A 4AF6A 4U02A 2BJVA 3HCWA 1CUVA 3O95A 3LWZA 5JVDF 5IAKA 4B4KA 4R3WA 4X1IA 1MC5A 3N58A 3D5TA 3JQBC 3NHPA 1R5OA 4UHCA 4WCDA 5K3FA 4QTYA 5TDHA 2GXSA 4XCQA 1WE2A 2EYQA 2AZ4A 4HNGA 5DI3A 4CMGA 5DKFA 3V2IA 1ENPA 3FLEA 4IOKA 5IKEA 2GD0A 1OD6A 4YJ2A 2I1LA 2XWQA 1UMCB 3EX7C 3Q1LA 2ODWA 4ER3A 2YCLA 1N2IA 3AP3A 3WKEA 2ZKLA 4OXQA 3LQRA 2J3DA 4LW8A 3RU7A 1N2ZA 2HPVA 2W2KB 1AA9A 5AXBA 5KQRA 4XSVA 1SQ0A 4MYCA 3KAKA 3L93A 4ZK6A 4M1YA 4JT9A 5FNZA 5KNDD 4OY3A 1I36A 3HYSA 1GQ2A 1CR2A 3IBGA 3ZLBA 1KDPA 1ISHA 4MJXA 4HGYA 5IDXA 4KUHA 1F1BA 4Z4IA 2M32A 3C39A 1MG0A 4OHKA 4TTVA 1JVSA 2VDQB 3SBEA 1EJ0A 3D2BA 2HD4A 4Q3BA 3NWPA 1GQOA 3MC1A 1BMTA 1E9AA 1K4MA 3A6FA 3LY8A 5P8WA 5L45A 1LU9A 3IP1A 4EUHA 2NQ8A 1VLMA 4FJ2A 5EMMA 1XAIA 2I3ZA 2C58A 2I4MA 1KPHA 1TMYA 1W4ZA 1XYVA 3BCHA 4ZZ2A 4X8OA 5B55A 2J5KA 3WL4A 3JTEA 3M3PA 4B6RA 2QDXA 2ZYIA 3HEMA 4DPLA 1KBZA 1RYBA 4CCYA 1XWIA 1G20A 2VPXA 4YIHA 2C4MA 2RHMA 3H2HA 3VR6D 1FNNA 1PFQA 5IUNC 1E6LA 1P1CA 2VDWA 3BTSA 1JSZA 3HLKA 2HV8A 4KXQA 1KZGB 4V24A 4WE3A 5G1OA 1EI9A 1C8BA 2KHZA 3ETCA 1WCXA 3GEGA 2BMVA 5E9WA 1VLVA 2A86A 2HMVA 4Q9LA 2IWRA 4QJ3A 5FOQA 1JLLB 3MXOA 2I7CA 4HX2A 1UBSB 2HJRA 4Q00A 3UB2A 4EVQA 3OAAA 4BNTA 1L3BA 3RHSA 3BILA 4EABA 1NJFA 3EIHA 4RANA 4CMHA 1NDUA 3FB4A 4NHOA 2DFKB 1GUZA 4GPIB 1A8IA 1PR5A 4DF3A 5GJVC 4ZVMA 3UOWA 5K01A 2V8BA 3KHTA 5DTEA 1C7JA 5KSZA 2A0KA 1HNZB 3QXXA 1YFJA 4D0RA 1JR3E 3MSCA 2GA9A 3JQPA 2IS1A 5KNCA 3IBTA 3M1AA 2ZSEA 1V47A 2YBDA 4MCJA 2YY6A 2ONJA 4QGBA 2WTAA 3DDZX 5EEHA 3ZD9A 9LDBA 2JVKA 2QRKA 4GPBA 3L5KA 1J97A 5E7QA 1E8DA 4AX8A 3DBHB 1NXQA 3OD5A 2IJGX 3LSYA 4NNPA 2PX4A 4RYLA 1EDOA 4KFUA 3CEJA 4U7HA 5B58T 3WYGA 3WQQA 3C1UA 1M2NA 1YZKA 4OQFA 3CNLA 1NC1A 3ADPA 3R1IA 4GWLA 1ONPA 5JPIA 2B9EA 4YB8A 5FYDA 1NYLA 2QDKA 2Z4SA 3F7TA 2LGJA 1ZGAA 2B7BA 3GZ4A 2QX4A 1HE8B 4HFMA 1NVFA 5G4KA 2REOA 3CR7A 3HBNA 3VPXA 5KZMB 4ZN6A 3KYCB 1IHXA 1U0SY 2ZJYA 5I5EA 2QSUA 3I6ZA 1VHDA 3BIJA 4PC2A 2GHRA 4LUCA 1U1IA 2Q6KA 1DRKA 1TA9A 1TZCA 1J0XO 1F60A 3CBQA 3I6QA 4WZAB 1QFZA 3U81A 4EUEA 1QWSA 1QF9A 4YMVA 5BQ5A 1FUUA 2YWBA 2VBCA 1I01A 3AF2A 3EQ2A 2FZ4A 4CETA 1N5OX 4A23A 2AYXA 4HPWA 2JFGA 5EZSA 2X4GA 4EPVA 3DAPA 4IG9A 1PNVA 3A1VA 2J6IA 4I4TA 3FG9A 4YP0A 4KMSA 2V74B 2QORA 2ZE5A 3CLUD 1LK0A 2DU8A 1U11A 1VJ0A 2GBFA 3TB4A 1E6KA 1A2QA 1VKZA 3B52X 3PPYA 4I2NA 5EZYA 2HQSA 3CVWA 4RQTA 1S3SA 3TSOA 2OT3B 5EIXA 2R5NA 4UUAA 1NXSA 2P69A 1LI5A 3DOIA 4D4KA 2JAWA 2V97A 1P0MA 2KLHA 3KLMX 3DBRB 1TUBB 3KUDA 1P9NA 1XRMA 2VDOB 4IQ8A 1KBOA 2WTMA 4ZHQA 3EIWA 4ZJYA 1JF8A 3R7LA 5I9NA 1G8JA 1YQDA 2H59A 1A2KC 3L0BA 1YFLA 2Q1YA 4P5DA 3VDXA 1A8UA 2QPTA 3AB7A 3MQFA 5G41A 2FRXA 3IAHA 3OY7A 5F7OA 2HFKA 4KIGA 5EVCA 3DE2X 2ONCA 1FQOA 4ZALA 1TW2A 1GTG1 3EIUA 3RYHB 1N4AA 4YPFA 2ADFA 4Y2YA 2A88A 2J9GA 1U4OA 3DEKA 3HUEA 5BSTA 3WGUA 2DECA 3DAYA 5HKLA 3ZV7A 2GEJA 2I78A 4V2UA 5SZIA 3WLOA 3GLRA 2VQEB 5DLDA 2HDHA 3EQ7A 4BNJA 5JS8A 3R9XA 3AL2A 4Z9AA 4QFCA 1DG3A 2C5LA 3HYRA 3TFOA 4JOQA 1UXIA 4UM9B 4MIKA 4MLZA 3PDCA 3TLMA 4LSZA 3HCPA 1IK6A 3ZY2A 1M33A 3M8KA 1F2TB 1UP7A 1R4AA 1Y8RB 3CE6A 3T1NA 1IE3A 4NCHA 2VRWA 5FQNA 1KDYA 3UAVA 1XDBA 4EP1A 4H08A 1GAJA 3R75A 3LLCA 1EA7A 3JR3A 4JX8A 3CE9A 3TM4A 3IE2A 3ADKA 3VGJA 5BWNA 4BE4A 3QOXA 4GR5A 5E4TA 1KQPA 1K4YA 4JOCA 2D13A 1LD3A 1OSNA 3PXCX 5ALLA 3VVBA 3STHA 2AOUA 2Z1MA 1NBME 4I99A 4L51A 4QOGA 4DARA 4EAQA 1FLVA 1GFWA 2HSGA 1QDLB 1YO6A 3AOEC 2VQSA 4P93A 3PUXA 1FFBA 2FFBA 5AJUA 1KPIA 1THZA 3PUKA 2B2NA 1ZIDA 2RHLA 3AB3A 4HR7A 4WZBB 5BR1A 2CK3D 4RH0A 1QK3A 3CX4A 1CC1S 4BO8A 2H00A 2P2LA 3A27A 2D0OB 1Y7LA 1RMQA 1J2EA 2GPYA 3R0IA 4MS1B 1IMJA 1W96A 3SVTA 4F12A 4KIFA 5U1PA 521PA 3M0EA 3FA2A 3QEMB 1SM4A 3EDQA 3PD1A 1OBCA 3FOZA 1MDBA 2XTMA 3B6EA 3BCSA 4HB4A 4RIFA 5M3BA 4E09A 1KAQA 3VSDA 3WGZA 1C1XB 1Q14A 3R44A 4K87A 4EQ6A 1D2CA 4LCJA 3QLUA 1LLFA 1JLMA 1XNHA 5JCXA 2HYDA 3GHHA 3ZQJA 2JHAA 4M0EA 4OAQA 4YUVA 5KKNB 3DTVB 3VO8A 4HF7A 3I9KA 3CLTD 5HKKA 3IT0A 3WSVA 3LWBA 4DDWA 3FPEA 4EZEA 4ZZ0A 2CGEA 3P2EA 1Y8QA 2ZFUA 3CXRA 4RKEA 5HFJA 3TIFA 2C7QA 3OQVA 3UATA 3L49A 1PR3A 1AB5A 2E4UA 3ND8A 4FBGA 4JSTA 1N0WA 5C7OO 3F97A 1HDYA 4RK7A 1YR9A 2X8BA 2BFFB 4ZCMA 3QU7A 1XZDA 1TXGA 3AW9A 2A1UA 2DPYA 3KKKA 4QJ4A 1TT7A 1OXXK 2P5TB 4GOKA 3GJ3A 4B84A 2R44A 1IJBA 2ZVPX 1EIWA 3GGJA 4F5DA 1DUIA 2P9JA 1IPFA 4MS3B 4F60A 4DKXA 2WQ6A 5D3QA 3KNZA 1DKRA 3NDIA 3OF5A 1CR1A 3PKZA 3ESYA 3GJTA 3QLEA 4OLAA 3OY2A 4Z0TA 4DMKA 3NLLA 4J91A 2HSDA 1DC3A 1FFDA 5CYPA 3G2JA 1ABEA 2YMLA 5IRCD 1FFXA 1QVRA 4YRSA 1E2FA 1G8PA 3QWIA 4C7OB 1CR6A 3G2QA 2I4RA 1MH1A 4WXMA 2PL3A 2Z9CA 4GKAA 5FH9A 1NBOA 3W3AA 3VZCA 1TKAA 1SXQA 3BIFA 4R8VA 3SYKA 1UADA 2PGOA 4OHRA 3DLBA 4R1NA 4MUYA 3SC2B 4XWAA 4MQ4A 1LXCA 2W6PA 5A06A 3OU6A 3EOAI 3I0MA 4BN5A 2QKYA 5JDCA 4G4IA 4H1TA 4E46A 5L9AA 4M53A 1RHRA 2RHHA 4JS0A 5LZ9A 3U44A 1HFWA 2XQGA 1EFCA 1K86A 1GLGA 1GUFA 3RC1A 1THGA 4UFNA 5G0VA 4HEA6 4AKGA 1PO7A 3DOOA 4Q37A 4D3ZA 3H2JA 1SCJA 3HNOA 3UJ3X 4MQ6A 1IWPB 2B37A 3EJ6A 1BE0A 2XRYA 4IV8A 1NBHA 1Z74A 2CXRA 3BA6A 1DIAA 3EDOA 3JYNA 3R40A 1LPSA 2RBKA 1PJ8A 5CA1A 4MPPA 4BJ1A 4AUKA 1G20E 1R0LA 5D3KA 4BECA 4JI8B 3GLIA 2GEFA 5L3SB 4WINA 3KC2A 5CX1A 4MGHA 3V1TC 3O4IA 4EY3A 4D41A 3GLHA 1JJVA 2P7IA 2OXEA 3ITEA 4CT0A 2R9VA 4LC9A 5EA2A 2CMFA 1SHUX 1MOZA 3M1YA 4OSPA 5F33A 4LI3X 1KFJB 4B7UA 3B13B 3BORA 1YJQA 4IXWA 1ZCJA 2OZLB 4HWKA 3L6EA 4M99A 3QU4A 4GLBA 3O3OB 2AQIA 2C92A 5AHWA 3TSYA 2MMGA 5GAJA 2XGSA 4L3VA 2C4VA 3BMQA 3IAEA 3OG9A 4FXOA 4P84A 5KOIA 4NH0A 1UDXA 1JFFB 2G5PA 2G4LA 3OC6A 3QMPA 3JWHA 4QO8A 2GN8A 4OHMA 2VPIA 3PQ3A 3SQMA 4TKMA 5J40A 1OWMA 1P61B 4BKMA 4DCMA 4JH0A 1C3XA 2X5XA 3IVGA 4OQNA 2X23A 4N4AA 1FJHA 3QUSA 4KYUA 1XTQA 3QYAA 1MHPA 1IBKB 1TW3A 4FM9A 1I4DD 1Z2CA 1RRPA 1NJ2A 4N7MA 1YB2A 5AJHA 3OSZA 1Z12A 2R85A 4N0PA 1ZK0A 5EWLB 1QDUA 1JYEA 2FI1A 3LBHA 4NOJA 3SJUA 4E14A 3J81k 2HCRA 3I0NA 5DK6A 4EJSC 4ZEVA 2N9UA 3NT2A 4B3MB 3T7IA 1SHLA 1S89A 5EQFA 3T9EA 3BB1A 4HLNA 3A0RB 1NZJA 2H2FA 4G4SP 4H7HA 1ZEJA 1FA9A 4PZAA 2X2FA 3WB1A 4YCDA 4BC0A 2R6FA 4MP6A 4HQNA 4P35A 5K2OA 3GFRA 1YC2A 1L7OA 4IOLA 4RH1A 1ZI9A 3KZXA 3ZXUB 4AN4A 1HQCA 4YRGA 4A2CA 4Q3NA 1KYXA 4D97A 4F1JA 1KXZA 1VKJA 4MLPA 3QZUA 3KPJA 4FINA 2PHZA 3N1UA 1V7QA 2ZZKA 4YQEA 3FNIA 5LBTA 1PJCA 3ILYA 2RAUA 4XH9B 5IBQA 1GQSA 1MAWA 3I30X 4JBXA 5EP2A 3ZGNA 2BMAA 5IZCC 4HH3C 4C7VA 1C8LA 2M1ZA 4AICA 4EG0A 2JI6A 2BFDB 2HBQA 4JFRA 3II6X 3DB1A 3L9WA 4XRGA 3BDVA 5CCDA 1Q3TA 1CSEE 3THSA 4OQQA 1R8SA 1AH2A 1CUHA 3ACDA 5F2OA 2IHNA 1XXHA 4B3CA 2O59A 1QC5A 2XDAA 1EH5A 4ASUA 4C0HA 4L16A 3DMFA 3BE8A 1CIVA 4YAEA 1EVKA 4XUDA 1DSSG 3TG8A 2ZUWA 4BS9A 3Q7TA 2WMDA 2NTJA 2VH1A 2WT4A 2IPLA 5IKMA 2CJFA 1PWZA 1ZJYA 4Y9RA 4EIWA 2SKCA 1NUSA 1L4UA 1YRWA 4ZOLF 5JSQA 3L0PA 2OXCA 2P9CA 3LPCA 3HYLA 4MA0A 2VUHB 4X62B 2IYZA 2WZCA 4DDHA 4RVCA 3ZXXA 2Y1LA 4PFJA 4Z9YA 1O77A 1P1HA 3PXEA 1YAJA 1ZW1A 3UO8B 3W5JA 3QW4B 2YWGA 3WYCA 4E5NA 1CUFA 2XQKA 1WEKA 4M60A 4EL5A 3HTXA 1QDEA 3JALA 3MMXA 4UULA 2RHCA 4NFLA 3WS7A 3ROXA 4P2BA 2BMWA 2Y1OA 3RTAA 4BNMA 2B82A 3KPUA 4DIMA 4XJTA 2Y2UA 2R4TA 4RLHA 2OLJA 3JQEA 1W9HA 2ZBEA 4KR9A 4BLUA 4EJ2A 9MHTA 2EF0A 1F4LA 4EG1A 4Q15A 1TD1A 2WG0A 3NDJA 1GSHA 3LDAA 4B7CA 1IPEA 2PTGA 4OJYA 4TWAA 4YMGA 5BWCA 4KYTA 3KJEA 4CODB 5IDWA 2GCNA 3PRHA 3INTA 3UUEA 5ALKA 1MQ8B 2YCBA 3RDPA 1CDEA 3NTOA 1AKVA 5AICA 1BZYA 1N6OA 1SBNE 3S5UA 1NYRA 4N6NA 2O5CA 4XIFA 5TVGA 4BHTA 2AMJA 4ED9A 1PUXA 2NSLA 2VPYA 3FUUA 3IJ5A 4CMIA 3CC8A 1N77A 4ETIA 4WASA 2XGJA 2ZRPA 4JBWA 1W52X 3DZKA 3GR6A 1ICIA 2H1SA 1J06A 3TMYA 3W5SA 1UXHA 4GHWA 4C9BA 5CVJA 4D96A 3K9LA 3AI1A 2I71A 3HGQA 3RYCB 1VHLA 3AF5A 3DTYA 4DQKA 2J6BA 1JN0A 1NJ5A 1K89A 4KQKA 3TLXA 3KPWA 4XGRA 1V1RA 2A5FA 3FPLA 1LWNA 3VTFA 1UBNA 2KBEA 1NN1A 1ZAKA 3NYRA 3LM8A 4I4LA 1P2BA 1OLSB 3BJRA 3ZD6A 1T5BA 3I9JA 4GBED 3VTZA 1QU3A 4C0XA 3L0DA 2O14A 2ORIA 3CRNA 3R5HA 4BP9A 1X7GA 2UYGA 2B36A 3MEQA 4ZQEA 8ATCA 1YDMA 1R6DA 5ALSA 4OYRA 4AJEA 3KUXA 1R0CA 4IILA 4EHHA 1Z88A 2FSVA 2EG9A 5JASA 1XVLA 3K1YA 4ZAFA 1XTKA 2AR9A 3MUEA 5TJ9A 3I64A 3P8ZA 3KR2A 5ALNA 2NZ2A 3W6PA 2B83A 3MF4A 3BRQA 3MXTA 1FRQA 4HI0E 4P3YA 4WFIA 2F1OA 4QFMA 3TQQA 1HKUA 4GMKA 3G68A 2CJWA 3CLHA 3PGVA 4J0HA 2YHIA 2NADA 2ZRGA 1XKXA 3JV7A 4IQ0A 4CMCA 1YQXA 1QAMA 4Y2HA 2YOFA 1CQXA 4JP8A 2OQRA 4YEDA 4OL0A 3HWSA 3J7TA 4FBMA 1Q3HA 5EKTA 4IFBA 2WHPB 2NZYA 4KK3A 3I05A 1L7QA 4KQXA 5FI3A 1S2GA 1JDVA 3HADA 1JHQA 1QHNA 2H7YA 2ZRHA 4MQLA 4UJ5A 4LOHA 1GKLA 5F23A 2GHIA 2BHLA 4QOEA 4WEQA 1W29A 1MT0A 4ERNA 4IUBS 5KHLB 3G2MA 5KOJA 3EIEA 3CKKA 4BNHA 1BJTA 2CBXA 3CB4A 3KEFA 3D8NA 5BVGA 3FZGA 4OHOA 4W8GA 4FNGA 1W46A 2PGLA 4H1VA 1YK0A 2JGFA 1TCAA 1YL6A 2I5PO 5BVHB 1A7UA 1FNDA 4L0DA 3FGPA 1Z37A 2E5WA 4ZV4A 4MV6A 2YRXA 4P4LA 2Y0PA 3X1WA 5T5QA 2EOAA 4CM6A 4F0JA 1R8JA 4Y6PA 5F2NA 3ZXIA 3T3OA 2QPAA 3GDHA 4CR8A 2OGUA 2W5UA 3AFGA 4HAUA 2QM7A 2I80A 2V7PA 3TRFA 4MZXA 1JL3A 3S44A 1OXKB 3UMGA 1AMUA 2GKSA 1B76A 3ZX5A 3EFOA 4MDFA 1Y1TA 2WM3A 1IXZA 2DWOA 1VE9A 2EFJA 3RD5A 4P7GA 1VI2A 2QG9A 5KOHA 2IHZA 3UWDA 3ZVRA 2DQZA 3CA8A 4NPHA 4DJTA 3GLHE 3GH3A 1OI3A 1RM0A 3P9NA 1MDFA 1RMYA 1RYYA 3A32A 3W8EA 5JALA 3F6EX 2H7CA 3IYLW 3ADDA 2F67A 2MU1A 2YVUA 2OBMA 2JLVA 3L0IB 2EG5A 2PR7A 3R74A 1DAEA 3JPWA 3M6WA 3IE0A 1EAYA 2PJDA 2K5UA 4XQGA 4YONB 1GSOA 1L5VA 1DDGA 3B9PA 1WOMA 3T7TA 1V6AA 1T8YA 2C9DA 4M2LA 4HNSA 4KE6A 3VR4D 4LF9B 1E2JA 3JZAA 4PBRA 3V1LA 3ZJ5A 2PAAA 4BLSA 2ZRQA 1UWVA 3FRJA 5JD5A 1C30A 3SM3A 1QH8B 4CQLA 2CMDA 4M1WA 1GNLA 4M37A 3KVNA 3ZNNA 4Q3EA 3I34X 4W5QA 4MKRA 3D4BA 4PLYA 3EN0A 1O57A 3IL2A 4N01A 5CK5A 4BV3A 1FP7A 2JLCA 1XZNA 3DEYX 3I4LA 1N3LA 3LI2A 4ZCPA 1YT5A 5THXA 3CVUA 3UGQA 3U7EB 3KSUA 4TSKA 4L2IB 1G6OA 3ZHBA 3DE3X 4MW9A 3VYWA 2YINC 2C3MA 4QHTA 3ZIDA 2B1RA 2XCIA 3DKVA 3CRW1 1MOQA 4MROA 3EVNA 1DMSA 2ZTLA 3WBFA 4F3YA 4WGFA 3F7OA 1E2DA 3WTBA 4JUCA 4A1FA 3VKWA 2HLDA 5TQVA 1Z0KA 2B2XA 2QL5A 3EUFA 4CTNA 3BZBA 1MP0A 3LQ2A 3O2SB 5DM1A 5EN4A 4BNGA 4B3SB 1XA0A 2XMCA 3CX3A 3BHIA 5EJ8A 5KPDA 4ZHSA 3AILA 3EFBA 4HLCA 1P4AA 1O8CA 2FQYA 3MW8A 4P5PA 4FB4A 2E1PA 1RPTA 4KVZA 1QPBA 3BJIC 4XM0A 3RYIB 4FWTA 2AOTB 4ZO8A 5DW0A 1I4OA 2B4YA 3PX7A 3FHTA 1HLGA 2H18A 4PQRA 2V54A 3CW9A 4L8GA 4PPYA 1X80A 4IFIA 3I9MA 4DZZA 2PL9A 1V8OA 4LISA 2FR0A 1WAMA 3BD6A 4MW4A 2EATA 4OO3A 3RG8A 3T5TA 1XL1A 3NKVA 2P6OA 3DT8A 1FVHA 4K6GA 4AY3A 1ZJ4A 1K6IA 1XLTC 3WLLA 3FUCA 1F0KA 1YI0A 1F1JA 4P82A 3VGPA 1CU1A 1B74A 2QAGA 4G8JA 5HZMA 5IM4F 4CUZA 1BTOA 3C6YA 3DV2A 3HMKA 1L3CA 1NYQA 1XXHE 3M4ZA 4JLNA 2FDRA 2IZ6A 4GXQA 2FPRA 5L40A 1X77A 2FN7A 1PK8A 1Y3AA 2MSNA 3E9MA 3C43A 4JYBA 5C1IA 1G7CA 1CULC 4G41A 1QGUA 3AHFA 3OM9A 3JVEA 3TEMA 1OV4A 2WT9A 4I2VA 1TMOA 3FHCB 1BX1A 4OLHA 5JFGA 1EHYA 3FDZB 1AKUA 4D8VA 5MN4A 4IGFA 4LHYA 2KE5A 5BN4A 4MUIA 1P9LA 3JZIA 1NSFA 2W2PA 1W48A 2EZUA 4HTFB 2HA3A 4CIYA 1MLDA 1V16B 3FB1A 2OBNA 1CNEA 3IQGX 4FFOA 1AQJA 1QZ3A 2WHEA 4WIAA 1PGJA 4X66B 4BE9A 3FDJA 1KEEB 2P5UA 3L8CA 3B7PA 1KY4A 3FWKA 4IUCS 1YVEI 2QLFA 4L6IA 1BEUB 2GERA 4MV5A 5IXSA 2P5SA 2V7WA 3DR5A 3QKSA 4O2BF 2AE1A 1O1YA 2N75A 2G0TA 4MVJA 4I6JA 1AK9A 4QGAA 1ZJ6A 1XKQA 1FL9A 1W87A 4ISBA 3ND5A 2JAUA 3GLVA 3CLSD 1D2GA 2W22A 3CONA 5D84A 4HQOA 2VK2A 1CQJB 4XYBA 1ZRSA 5LNK1 1H0HA 1N0UA 4Z9BA 3UH1A 2EJWA 4MEJA 3SLGA 3UAZA 1PWHA 4YJ3A 2W6QA 4BFCA 5I47A 3HEAA 2J30A 3DA8A 4IZHA 4CKXA 1IZ7A 3MM4A 2HDWA 3BWVA 3PDHA 5SY9A 3T7RA 5EJ4A 4QVIA 1ESDA 1Z33A 1BAPA 1WZCA 3I37X 4ZPJA 1CY6A 2FR8A 5GM2A 2YS6A 1GM5A 5SZKB 2XRFA 4UZFA 4LV8B 3FOWA 3ZHYA 1IZ0A 2VDVE 1HDIA 2ZS9A 4Y2RA 4IS3A 1M8GA 2NU6A 4G1BA 3DLPX 3UMBA 3FPJA 2UAGA 3M7IA 4JLVA 1N5RA 2ZSFA 4MGKR 4RPCA 1Z5PA 3PRJA 2AJCA 3TDMA 1QANA 2XNHA 1FFWA 3R7WA 4REQA 5LVAA 3D1VA 5JMPA 4ZCQA 4AUNA 4LZLA 4B40A 3N2NA 2QLLA 2B99A 2VNIA 4HLDA 4NICA 3OHMA 3QP9A 1US8A 3AUYA 4J0FA 1RQGA 5DBIA 5KAMA 1L5HA 4TUYF 4HD8A 1Q7TA 3WC4A 3OZDA 2ODTX 3PLNA 3BD7A 3C4VA 4GWKA 1BVYF 4QJIA 2QYTA 3SZMA 2CXSA 2G9UA 1G8MA 1EVEA 2OOKA 1U9IA 1ZSYA 3KR1A 1OIVA 1XRSB 3R0ZA 4LXYA 4OK3A 1P19A 4RLFA 3RVPA 2F9LA 2IH5A 1WZUA 1EFPA 4BNDA 4CLHA 2ZBFA 4FLFA 1ADJA 1U2GA 2PK3A 1Q0PA 3GPBA 3IIIA 5LXTF 4MVJM 4L9AA 4NFYA 1IRXA 4PF1A 1D4ZA 4J03A 3BSYA 4DDVA 3MJDA 4H59A 2MJLA 1LRJA 4R71A 1W88B 2EARA 1V37A 5HKOA 1K2VN 2NVUA 3O82A 2ZT5A 2FWBA 3DONA 4LGCA 4ODIA 5K1ZA 1NRIA 5C5DA 1W8DA 3A26A 2CHEA 4TS9A 2WB4A 1E1CB 1W1WA 3KQVA 3OBIA 4MVWA 3OJXA 4NEHB 1CHDA 3DDNA 1TE2A 5BSRA 3KQHA 5CVEA 6ADHA 3BWDD 1P7YA 3NNSA 5KYGA 1A9SA 3RVDA 1BQ3A 4R16A 4KOEC 1SBTA 2D4HA 3ZIAD 4KWIA 3TEFA 3NBZC 3DPIA 2BGIA 2H1HA 1UKBA 1PEYA 1BHJA 1NTOA 1MXFA 2BFEB 2W2XA 4I81A 3NALA 4FIDA 4QX6A 3SXUA 1XXLA 3L79A 4OFWA 2DFDA 3U9TA 3I61A 3GCXA 4IUYA 3NIWA 3CTMA 2Q0XA 3C7DB 3KQWA 3EEIA 4QRIA 3ZY3A 2WFLA 2PVCA 1CUBA 4MGZR 1P0IA 2GK7A 3JPYA 1PVOA 1G6KA 2EFDB 3I8SA 3QVJA 2H0AA 2I0FA 3VO9A 3QUCA 4QUBA 1KEKA 1FPQA 5EWMA 4BFUA 4XVQA 2JD1A 3SR3A 3RRBA 3WL8A 4BLTA 2A9FA 3MTEA 1RWKA 3DBLA 4BB5A 1SVLA 1C3VA 1YJ8A 4C30A 1J1ZA 2OR3A 3OLZA 4KPUB 3RAEC 1DEAA 2X5NA 2JARA 2O7SA 3M82A 5AW7A 1LX6A 2R8PA 3VZSA 3C8HA 5IKOA 4PAQA 2N47A 4XE5A 4YRMA 1RHMA 5SICE 1CJVC 3B1WA 3U5ZB 2AVDA 1IN7A 3DYVA 3PE4A 5HPYB 2DPLA 2XCQA 4QQNA 4W6QA 5JNRA 4CF7A 4W99A 3O8DA 1UF9A 2DLCX 1RZUA 3ESBA 3DWGA 3I4CA 1XL0A 4IZOA 4PV7A 4KQGA 3V7NA 2KSQA 3ZDEA 3RREA 5F3DA 2B78A 1FJ2A 2C3UA 4JBYA 2WHRA 4MUKA 3GRYA 3VU8A 2PSSA 3I4FA 1S7CA 4EB6B 4O63O 4OB8A 1NI5A 3P9KA 3KQTA 2JIPA 3OTIA 3PFHA 4RM3A 2OFFA 2LIPA 4G0NA 3OTOB 2JLBA 4FYMA 4EVRA 3OQBA 4MOWA 5DGIA 3WL7A 3K2BA 4EO7A 3RRXA 5CJ2A 3H99A 2BKAA 1UBKS 3U3KA 2I6TA 5K6TA 1G60A 1S2OA 4JA0A 4D57A 4FHEA 1P4RA 1E9BA 4OAOA 1CQZA 1XAGA 5PGMA 1K5GA 3VA7A 4JJKA 2Z8XA 2ZIXB 3H5AA 2H9YA 3FPHA 3OO0A 1HDXA 1N1MA 1G38A 2O3SA 2AFHA 1SIWA 2DLDA 2C8LA 3D4OA 5I7EA 2GQ0A 2HM7A 1D4FA 3H83A 3WA7A 1QP7A 3G5MA 3HKEA 3RBAA 2D1FA 1TJ5A 2W48A 4QWWA 1G5FA 1YI1A 2X9NA 3BXPA 4YAKA 1UDRA 3IUBA 3FN4A 3RVMA 3W5UA 1B16A 1T4CB 4R0VA 3HJGA 4HRVA 3IBFA 4CKEA 1D1PA 1EX6A 4KPGA 5CRIA 5BURA 3N3AC 3WGQA 3NANA 2Y3IA 1KI4A 3D7MA 2JCBA 1Z7GA 4LFCB 3HU5A 3ZV6A 5E6RA 4F5EA 4WKGA 5BV2P 1TCBA 3U7QA 4E5PA 2XUAA 3KKMA 2IPAB 3C3AA 3A25A 3Q1KA 2EHJA 3E3LA 5EXXA 1GZHB 2FSSA 5H5JA 1OASA 3A8TA 4KV7A 3C7TA 3VU1A 4C0AC 4ZAVA 3RKSA 4ER5A 3VSAA 1L8XA 3K6SA 4FYIA 3FKSD 4ETNA 2YZKA 3ZHTA 4HRXA 4FYKA 5FPPA 2FDCA 1VKHA 2CN1A 3H6HA 4DFDA 1KY2A 1M0SA 1PP4A 3PB3A 3SSOA 3D8RA 2XHEA 3O8BA 2XZOA 2ZM6B 1EG2A 4HUQB 1H8HA 1QAQA 1ZOOA 4ZAZA 2EL9A 1Z17A 3FX2A 4FIZA 3IX7A 4NBSA 4ARZB 1JBQA 1PT5A 3IILA 2AEMA 5E6UB 5I3CA 3T1YB 1G3UA 3VKFA 2AJLI 1T5SA 1Q17A 2E87A 2I99A 1VA5A 2DUJA 2EVWX 3T5DA 5BR4A 1T8TA 2BKUA 5IJAA 5ARCA 4TLBA 2E89A 4XOUA 5JO0A 2Z8ZA 4US0R 3OMXA 1RM3A 3PQEA 1QE3A 3A10A 3BXEA 4JELA 5JLAA 2A0FA 4H4DA 1PV2A 2I4LA 2II6A 4MAMA 2Z5GA 1JUDA 4DC1A 2FMIA 1TPZA 2TMGA 4MV3A 2F3UA 4RULA 3VR2D 3DXYA 1SVKA 4EY4A 3LLMA 3W1EA 2Q7XA 3COYA 2GETA 4DZTA 2PZBA 1TF2A 1JEJA 5LQDA 1WVIA 2HX1A 3KWJA 2FPUA 2WOJA 4UHHA 2XWJI 3S4YA 3VC2A 3VUEA 4AJ1A 1OWNA 1QHHB 1FSSA 4IY1A 3EVDA 4C6RA 3NEAA 1SU8A 3B36A 3V2HA 4I5FA 1JU3A 5LPNA 4QUKA 1C80A 1USVA 2F62A 3MMPA 3AL3A 4EG3A 3MWEB 1LQUA 4FHFA 3EMKA 1JW9B 1PT8A 2HRCA 3JZMA 3ILHA 4MVJE 4C14A 3WRYA 4BKQA 4WY8A 2RGNA 3OO1A 5H02A 3KUUA 1PT6A 1OIXA 5AOCA 3KSAC 2QRVA 1OZHA 1PU2A 2C9BA 3FYSA 3IVAA 4XD7A 4X3OA 4ZA2A 4I4CA 1EWYA 3HI4A 5K0BA 1K8RA 5KNCH 1C9DB 3OBBA 5BNFA 3WYDA 5K8LA 2OWDA 4AU1A 3QLUC 3AETA 3B53X 4X3PA 4F38A 3SX4A 1GG2A 5HM6A 4YRBA 1TM3E 2IXGA 1Z0UA 3HJCA 4U0KA 2FB9A 3UA3A 5IJ0A 1EZ4A 1G41A 3WYBA 1M9NA 3UC9A 1DTSA 1K7YA 4D3DA 4D42A 1H2AS 2NU7A 1H9AA 2V7BA 3GCGA 4MKZA 5E0KB 5T4HA 3VO1A 3ONNA 3B5EA 4B3BA 3TIVA 3PGA1 5CB4B 3E61A 3LKZA 3QIAA 3SK0A 3T7EA 2XB2A 1O4VA 1RWMA 1K97A 2ISCA 1R0XA 3MS2A 3H65A 3LZ6A 3L7BA 2QTBA 3CZAA 1LZKA 4ZCTA 1BCSA 2XCOA 1X7ZB 4ZVRA 2V45A 4H27A 3A05A 1ZH0A 2GEBA 1DX9A 4E5YA 3BZWA 4NZOA 4LPSA 5JXHA 5EZQA 5I5GA 3STWA 5AK0A 1M2VA 3IDOA 1IU9A 2FEKA 2HH9A 3BPSA 4WXRA 3X2EA 3AUFA 3IQFA 2QTNA 3GQBA 2I03A 4A92A 2X3UA 4GPTA 2NXNA 4OJMX 4KQHA 1KMQA 2G9VA 3HH8A 1VJ1A 3HY3A 5B7QA 5EAIA 6REQB 2I91A 3HDYA 4NP6A 1FTWA 2WM8A 4LS3A 1EK5A 4Q4JA 4UBOA 4G0WA 1Z6AA 1N8NA 3SJAA 3T9CA 1NMXA 2PIAA 2QX8A 3BXZA 1F9AA 1FXSA 3PXAA 3QV2A 3X1MA 1H1TA 1VPTA 2FUNB 4QNNA 1TVCA 3NEYA 2F3PA 2ZYSA 1XDZA 5FOUA 5JDCC 3ZLUA 1C4WA 2FETA 1U5AA 2IYPA 3MCUA 4U63A 3OQOA 2WU4A 1Z0AA 2L69A 2ZRJA 1S8OA 3JD3A 1OZFA 2BBWA 4PW0A 4B1FA 3EZFA 4CTMA 2R5WA 2O3TA 4D8XA 1ZN7A 4AG6A 2XDQB 3TQFA 2W6MA 3X3HA 4W1QA 1Y9EA 3A1NA 2XUQA 1H3FA 5B30A 3AVUA 2NMVA 2Z83A 1UFRA 1Y37A 4K6FA 1AS3A 4TROA 3LKBA 3PJFA 3W7BA 1ZA1A 2REBA 1MENA 1CLUA 1GQRA 2H5EA 2FVXA 4LYDA 5CB6A 3ZVNA 3SOZA 1A9OA 4CEIB 1RS0A 1IIBA 5IAGA 3PQFA 4D9MA 1U5CA 2V98A 4JUAA 4MVJI 4EEXA 4C7KA 3RFCA 5LQUA 2OXFA 5B7NA 1XDUA 2IIQA 2Y1GA 3H9JA 1MA0A 1H6DA 3PQ8A 3ZV5A 2R8YA 4KBGA 3V46A 4R8MA 1UK9A 3F67A 1LWOA 1GQYA 1HLDA 2MR5A 1YL5A 1CE8A 2HWWA 2ZDQA 3Q40A 4RE6A 4ND7A 2Z9DA 3NONA 3LPAA 2LR0A 1VL1A 4HDMB 4TS4A 4TPKA 4WNYA 4YRQA 1X1RA 1UPCA 2AUTA 3H87A 2JD0A 3CIFA 5SY6A 4OQ4A 4ZOLB 3A6PC 4KAFA 4DIFA 2O0KA 1T9DA 4G8BA 1MIOA 1G18A 1V2GA 2ZBGA 4JQOA 3HU3A 2DR0A 3HJAA 5FCDA 1F4PA 2WK1A 1UQRA 4GI5A 4E08A 3EPPA 5AKYA 4UVHA 3TZ6A 3AEQB 3GFOA 1NDHA 2WD7A 3CKMA 4ZVTA 3OF3A 3TXAA 4Q1EA 2IX9A 3QJ5A 4BLWA 4AS1A 1ZXLA 1GL6A 1QB8A 3KQLA 1ORDA 3OZRA 3PHCA 2GN4A 3B2EA 3W2FA 4AF7A 3PXDA 1X94A 1O4WA 1SVMA 4NJEA 3BH7A 3DF9A 1IB6A 1N8TA 3IP6A 4NARA 5TPZA 1TVEA 4B8WA 1NNLA 1FDIA 4G63A 4INZA 4JIGA 4PGHA 1UZUA 4KLCA 1GRCA 2QZZA 3BWMA 1XVTA 2OKGA 1SD5A 2QUZA 4TYQA 2JEZA 2Q4DA 2WIJA 3AYXB 1U2PA 2COKA 5J4YA 5KWEA 1A88A 1Y5IA 4QEDA 5TT1A 2A5GA 5T4FA 3VR5D 2YY5A 3W9YA 4A10A 5FEUA 3RKUA 4WACA 2X0FA 1Q2XA 4HNTA 5KQMA 4HAZA 1SBYA 5TC4A 2JH8A 3IAXA 3WAGA 1KKLA 2X9QA 2PT9A 5EGNA 2Q5JA 2IGBA 2VDPB 2BEKA 5JUWA 3BJEA 4DYVA 1MOSA 3CZ5A 4AJ4A 1UMBB 1KAOA 4DLZA 1Z4IA 3D7NA 2VJCA 4KODA 4C7JA 4M0MA 5I4CA 2J3IA 3EBLA 4PAWA 4GPAA 2GN9A 1SEVA 2XUIA 4KTVE 3B89A 2UZIR 2DX7A 4PQFA 3AIMA 3UEOA 4CM8B 2WINI 2DWQA 3W2TA 3G9TA 3K6JA 1QKIA 2VXCA 5FBWB 5AI6A 4MRPA 4KHZA 3KKZA 2BFCA 5JISA 1AB6A 1EUYA 1NF9A 3H84A 2VP6A 4GLLA 3RK4A 4PRLA 4DLWA 4B76A 1R0SA 1QUEA 4FKZA 1Y7TA 4TM8A 4L8YA 4G0YA 3CNOA 5LC1A 3DE5X 3ENZA 4EYOA 2A9RA 3P0HA 4KIWA 1KRHA 2EFEB 2P3QA 2FPPB 2I3DA 4GMHA 4UNIA 4XJXA 5DHAA 3SIWA 3MD0A 3HRKA 1JGTA 4WOCA 1EXNA 1YQTA 3ORHA 4KDFA 4ZT2A 3B9RA 1J9GA 4CLRA 1XJ5A 4N76A 3B6JA 3W3AH 4HXYA 2GBCA 4Y98A 3GLGA 2BGGA 2ZRAA 2A14A 2QIPA 4Y7CA 2AUMA 2LBPA 1RKUA 1RMTA 4PBTA 3UXHA 5ALOA 2G4VA 2OPBA 5HIMA 3PNOA 3QUBA 4J3JA 4CNBA 1YE8A 1I5EA 1Z75A 3DQQA 4YO8A 4HPJB 2AV6A 1DCFA 4XIIA 1YZGA 5FA6A 3K8QA 4UOEA 2P75A 1KO1A 1L4HA 2F3QA 2YH2A 3NDBB 3RYFA 2A9KA 3U7RA 1H65A 5T57A 4DDMA 4MQ5A 5JJBA 1PNRA 1KS2A 4DR2B 3QF4B 4E7OA 5ADUS 2PMKA 3EF1A 3Q72A 5B1IA 4CQMD 3IE1A 1TKCA 1PSDA 5I9LA 3QKIA 3CJTA 4UM9D 3QVUA 1SQ5A 5BRAA 3NIBA 2PKXA 1KOJA 1UMCA 3OJOA 1T29A 4LBZA 1O95D 3TE7A 4TQGA 1RXIA 4A0QA 4UE6A 5BWMA 4DIUA 4C6SA 3ER9A 4GSLA 3R7DA 1XTUA 2X13A 5DRYA 2B5VA 2XYVA 2ZATA 3SG0A 3KJFA 2WUDA 2C5BA 4UMFA 3NW9A 1UFOA 5ELLA 3REGA 1KGDA 3OHSX 1CDZA 3OMWA 1FW6A 4H7PA 4G89A 1GCOA 2NUTB 5C53B 4HV4A 1K0UA 3H97A 3E3MA 1Z3CA 3IP5A 2XAAA 3SYNA 4B79A 4JJ7A 2P9YA 4GMFA 4CM4B 1DWUA 1JRLA 2JFBA 3HCBA 2FUG6 1I2AA 1FVOA 2VAMA 4DR1B 2ECKA 2ZR7A 3MERA 4US1R 3DKKA 3V4SA 1ST3A 2BEVB 4KNVA 3RRZA 1A4RA 2CXOA 4FDUA 2OC9A 2Y77A 3ZI7A 3VDRA 2K7ZA 4P7BA 1GTJ1 1SIOA 3GFSA 4Q1AA 4ENPA 3M33A 1Y6RA 4JD5A 1PR0A 3AQIA 3WNBA 1QHGA 9ATCA 4RTJA 1AJEA 4QUEA 3R3YA 3HU1A 3AP2A 4A91A 3HDVA 2RONA 4DCSA 3GWGA 4ZOAA 3IR5A 4FFNA 2Z58A 3I04A 1WV1A 1O87A 1F7VA 2FSVC 3I9V1 3CS3A 5L7TA 1L7RA 4CIBA 3QVMA 5AJWA 2JVJA 1FUEA 5IAJA 2ZBDA 1DU4A 1L4EA 3NGLA 3F47A 3K1TA 4FJ0A 4QGGA 4EKNB 2EZTA 4GVLA 3K9WA 2ONKA 3MB5A 4R1PA 5FLEX 4F8EA 3VSEA 3DTVD 1XP8A 2JAOA 2LDXA 4RF3A 2D0DA 1MAVA 1NURA 3EW7A 2DTDA 4XI9A 3SEAA 4C6TA 3JYLA 5JG7A 3UT6A 5EQDA 3CVXA 4KHPB 1B6RA 7ABPA 2QRHA 3MBKA 1G6HA 1XBTA 2PVPA 3NRCA 2GYWA 5FORA 1HTWA 4ON9A 1NXVA 1T1GA 1R4NA 2YMPA 5JRJA 3CX6A 4W5HA 5A6SB 3UAOA 1JKXA 3DUWA 3K09A 4RVOA 4RD1A 3T61A 3O7MA 1UBFA 4I55F 5HMMA 3PHIA 1GCIA 1PQYA 3IAM6 1SVUA 4IX1A 1PL0A 5ELXA 3AWDA 3KLPX 4R84A 3U4HA 5LJIA 1ZW6A 1JDPA 1KARA 3OZGA 2I8AA 4M7OA 3WYNA 5DNCA 1JTEA 3KSRA 2V1XA 4FZ5A 4MUHA 1UZMA 3ZCSA 3PKIA 1KDRA 1I6WA 2PO5A 2OM2A 2VJDA 3KYCA 4W8OA 2QQGA 1DP4A 1J8DA 1RYNA 5L3ZA 4G5XA 1TA4A 2ZROA 3V9PA 2CSXA 4D0LB 3BWYA 4FS8A 3CFYA 5C8VA 2DBZA 2RGWA 4RHCA 4KTTE 4L22A 2IHKA 3JVDA 3PNVA 4CIWA 1HE2A 4RAOA 2QSZA 3DQPA 1QRRA 2HA4A 3TR5A 2OBLA 4MVCA 3CW2A 1HWYA 1KJWA 2GAIA 2H51A 2YJGA 2FRVA 3FNFA 3I04M 1Z5UA 4EELA 2NWQA 2WKQA 3WADA 2GPNA 4Q4HA 2VYND 1DXQA 2I22A 3DKIA 3DL7A 1KK3A 2IY7A 2UVQA 2VJNA 1Y7PA 3AHGA 5KTSA 1LQ2A 3OD1A 1PK9A 1VLLA 4GE3A 3UAWA 3NGXA 5HFNA 2QRQA 4CV1A 3QNMA 1S0UA 1Q1AA 3MNFA 1WP4A 3UK2A 1IOVA 1HY3A 5JNVA 2H06A 1QQ5A 1SY7A 2CZCA 1TUBA 4GIBA 1E5LA 2W2LA 3DMDA 3P2KA 3Q85A 4YP7A 4QLOA 1Z6GA 3GVHA 4CMAA 1H42A 2C88A 3LP6A 4Y1GA 1F8UA 5KYNA 4X6XA 1J8YF 1WDWB 5C8DA 3T1TA 2WU8A 3EPKA 2C00A 3PFNA 2DQYA 2B0CA 1QK5A 3NCHA 1L5YA 3LUKA 2JLAA 2GRUA 4L27A 3BTUA 4UNPA 2AFVA 3WK4A 4H77A 4GP7A 1NWHA 2CT8A 1VIMA 3D31A 2PL5A 3L0ZA 3UQYS 3U4MA 3HUTA 5TT0A 5FF9A 3IS3A 2EFHB 3NUGA 1XZPA 4WLVA 4II3A 5A2QA 3UHFA 4LK3A 1K5PA 3WB2A 1N0HA 3AR3A 3STXA 5AXDA 2W2QA 4QODA 4FOLA 3TI7A 1F2TA 4U2CA 2Q41A 1Y8RA 4KXFB 3HB5X 4M86A 3DZCA 1QG6A 5FNVF 3EGIA 2EFCB 4ZZ3A 2X77A 1N7IA 4N18A 2K2WA 2FNAA 5F9MA 3EXIB 4FJ1A 1Q22A 4UTZA 4F46A 2H29A 2DPGA 1Y9AA 1O2DA 5LOVF 1ZWKA 1IXKA 1H05A 5KHAA 1TQHA 3KV1A 3P4UA 4MEBA 4ALJA 5BT9A 2W6ZA 3AR7A 4IINA 2GNPA 2H0QA 3SSAA 5DX1A 2PUFA 2WR8A 3BZUA 1NW8A 3IUEA 1IBMB 2Z4RA 1FDTA 4Z9FA 3VX4A 3NO4A 2HA5A 1HYHA 3L7AA 3H9BA 4MUEA 2Z1DA 1XVVA 5KCZA 3MUFA 1XG5A 4QECA 5DCWA 2IZZA 1JHYA 2P78A 2Q0SA 1KI7A 3EUEA 2QG4A 2ZREA 3L01A 4TWJA 4WZBA 5D8DA 4WERA 2ZW9A 1TTTA 2CUNA 1FOEB 1T10A 4FEEA 1EJBA 1YB1A 3BS4A 4OAPA 3BMOA 2IYSA 2Q1XA 4JSYA 4MS1A 4X95A 5G02A 5B6PA 1PZGA 3LYLA 1Z5GA 2OHVA 1SQGA 4N5HX 2WAAA 3TVYA 1VMEA 3GLKA 2HC9A 3DYBA 4J2OA 5LFAA 1VYUA 4KMOA 4TXJA 1L5WA 3SLKA 1ZS9A 4YUXA 3THYB 1N9GA 2QAGC 4L15A 4OGLA 1C3JA 5HF9A 1C1XA 1DI0A 4FNOA 5ICFA 2GF9A 3ID6C 4FZ3A 1V8ZA 2ESRA 3ZCXA 1YS9A 4QYTA 1UINA 3HXKA 1PLKA 4E31A 3A04A 2J6HA 1BH2A 1PD1A 1UANA 1LJUA 4OUKX 1GGEA 3N9IA 3B82A 3DV9A 4CU5A 2H2DA 5CLIA 3JWEA 1G8KA 4EBFA 1WWKA 3M49A 4IDDA 3NBFA 2JFNA 1UPUA 4LJAA 4KXYA 4MULA 3RSQA 3WK6A 3LXMA 5EPEA 1C4XA 4LNUA 3IEUA 4W9RA 1WQ4A 3IFSA 4J3FA 1DO0A 1LPMA 4L73A 4OJKA 4ZZIA 3SX0A 1Y4UA 2OAQ1 2RK4A 4F2DA 5B2EA 3BN3A 3ENNA 4FGUA 3VPHA 4P3PA 1BFDA 3EGVA 4ZFNA 1YIDA 4JI7B 1DWPA 4TWIA 5A1TA 4JQYA 4HDOB 2VUUA 1REQB 3ZV4A 1UJ2A 3B7WA 2PSJA 3U4QB 3K8OE 4JOBA 1U8TA 3WICA 3NDRA 4KE7A 3RSHA 4XWYA 3WGHA 4Z1MD 1E4EB 3AEUA 4XCXA 2P9QA 3HNRA 4UU0A 4KXLA 5DBEX 1U7OA 2DH6A 3FWPA 4IOMA 4Z2YA 4N41A 1TAGA 4WTOA 2V9ZA 2W8BB 2G07A 1ZUD1 5CIQA 4DILA 3ZOZA 5KNBA 5LP6B 3ZK9A 5JWRA 1OXUA 1RI1A 4R1QA 2I9KA 4XTCS 2V55B 2VSYA 4Z54A 3PR1A 3CWCA 4QKQA 3ZGXA 5JO9A 4NV0A 2AQHA 5FLYA 1ZM3A 3SC2A 1JQKA 1NXPA 4D9FA 3LX6A 1CEQA 1U3FA 4P0TA 4RY2A 1G9XA 1LZLA 1YDGA 2ID9A 2YIJA 2C61A 2ZYAA 2ZUUA 4WJZA 5CVCA 3SYLA 2FR8C 4LI0A 1SOUA 1DWQA 3C7KA 4L07A 4UVEA 2H07A 5BW5A 2WJZB 3Q6IA 4Y2PA 3O8OB 4MHTA 4C5CA 4FW9A 3DM9B 1PFKA 1T8WA 1A9TA 4YAOA 3ZTTA 1NQTA 2XNDD 2ZSBA 3AKEA 2DKOA 3KAPA 1P4SA 3T99A 2IEZA 3RTDA 3UN1A 4RGQA 1F8GA 1XZGA 2P27A 3RSZA 5FAKA 3F5QA 4DBLE 3KZKA 2QOEA 4XZ3A 1YVDA 2Y66A 2ISSD 8AT1A 3T7SA 1NMSA 2X0JA 4M8KA 4KC0A 4NXNB 1E3DA 3M1LA 4CWAA 4IMIB 2VP0A 4K1XA 1UT5A 1PQWA 1Q1NA 5HEKA 1U9IC 3C14C 5HJ7A 4ZDWA 3L1VA 2OZLA 2Y6VA 4NI5A 2VTEA 4U6SA 4ES6A 3P0RA 1NXWA 1U2GC 4MRSA 1KI8A 4Q6BA 5BN5B 5D1HA 3AF6A 4RK4A 3PFBA 1JFFA 3EZ9A 1EFUA 3ASVA 4RYDA 3PWSA 1XIVA 3A31A 1T2DA 4RETA 3EVZA 5AVTA 3PE3A 4L0CA 5JZBA 2HL6A 1BWPA 1ORHA 1T0HB 1G8AA 1LFDB 2F3SA 2ZR0A 4OHVA 5JARA 1YFKA 2V6BA 3E3NA 4B0OA 1E6EA 1P18A 2TECE 4B8ZA 1FDSA 4DIDA 2FLKA 4D25A 3K20A 3ML1A 1U9CA 3RRJA 1BMDA 3CHYA 5CGQB 3EA0A 2DMRA 4UEQA 4RHFA 1T5DX 2FUCA 4MMZB 4O4IF 5EWLA 1L8OA 2JIOA 3NOQA 4EKDA 3ZZ0A 2R6DA 3NFRA 5HTOA 1J8QA 1DJQA 3RK0A 4CRWB 2AC2A 3A3KA 4IV5A 2ZU6A 4JLOA 4WA7A 3O9VA 1PE0A 3TE6A 4R4JA 5CXQA 1UQTA 4EUFA 1V4NA 1GKKA 3CNQS 4WGGA 3SF8B 1YRQA 1D3AA 1QIKA 1CVLA 2JJ2A 3JQGB 2IH2A 1RPJA 1YUBA 2XXAB 4I46A 3PPIA 1JR2A 1C7EA 2R6GA 2ANBA 4WZAE 4HRAA 1EQUA 1VPDA 4Q48A 5EI5A 3I52A 2WF5A 4N54A 5AI0A 3ZWWA 3E7XA 5CM8B 1BXGB 4QBHA 2GPTA 4DNOA 3L1IA 4BYGA 5ERYA 4L3OA 3ZDBA 2H54A 3ZK8A 5J2UA 4DQDA 3NBYC 3BEOA 4PZDA 5IK2D 3NBQA 4XGKA 1NU8A 1ZBDA 2B3DA 3AHEA 3VOBA 2XXJA 3RRMA 4C2AA 4DMGA 3HFSA 4ZVOA 4A03A 4IDNA 4D0SA 4DKJA 4Y1RA 1JT9A 2O3JA 2SKDA 4E6PA 4LOLA 2R5FA 2VLIA 1F6WA 3NX4A 1CUXA 3OSUA 4O1IA 2ZZMA 3KQMA 3RT9A 1R27A 5AK6A 4CYMA 4I3FA 5JAQA 1RAAA 4EYGA 6ABPA 2WAMA 5BMVB 2D2VA 2W6JD 3FM9A 1GGHA 3LP5A 4MVJH 1UMDB 2BTQB 2IIBA 1ZO8A 3H1EA 3GGGA 3LQFA 3SF0A 3W06A 4BLPA 1A8SA 1P3JA 1A9ZA 4HUTA 2ZQZA 2PS0A 2GDJA 3OU2A 1CJMA 3OEHA 1K08A 1P2VA 1ZYUA 1E4OA 2K87A 2QJRA 2ZAYA 3GUYA 3R09A 1NQVA 3WRWA 2O5RA 2J87A 4I9UA 4F9FA 3A4VA 1ODFA 2XNCA 3N8HA 4M36A 2WRZA 1Y81A 4PNZA 4QOFA 3W2GA 2RHDA 4LC1A 5I01A 4DNXA 2KMLA 3U1VA 3Q87B 3L8ZA 1L7XA 3RHZA 3V33A 3JQ7B 4TT3D 3WBKA 2FTKE 4M1OA 1TI7A 1TM4E 4YP1A 3GAAA 1FX0B 5A9RA 3CLSC 1O6BA 3R3VA 4QOSA 3V9AA 3UMMA 4HMOA 3OZVA 1VE6A 4ZYYA 4URZR 2AOXA 1F5SA 1ILWA 1RJ9B 1X7DA 4N3NA 3FPGA 3THWB 5ALJA 4OMFG 1AGXA 4O2AA 1YUMA 1XRQA 4EY7A 2LZ0A 1P2FA 4EGCB 2VNHA 3C6KA 3KSZO 4ZOQI 3ZDDA 2C78A 5JC8A 1ADGA 1TVKA 1WSBA 2XMZA 5AIBA 2ZSHA 2AEEA 3EAQA 4ZARA 4F4DA 5EJ2A 1YXMA 3VJRA 3DEIA 2BBSA 2H1IA 4UBJA 3UJ6A 5TLSA 2PX6A 2ZR8A 1DOZA 3EF3A 4CR7A 2BKEA 2EAUA 4KLRA 2FZWA 2P6UA 1D0SA 2Q6TA 2OFPA 3N8GA 5E7IA 4BO6A 1IRIA 1JMYA 4B9AA 4F9GA 4BGIA 3DL2A 3D43A 4WOBA 1ABFA 1UBMS 3IQWA 4Z3DA 1L5NA 1WCV1 5GP1A 3SNKA 3SE7A 4PPGA 4DXHA 1BYIA 1P8JA 1BROA 3ORQA 4YDSA 4W5NA 5LQNA 1BGVA 1C0EA 3CR3C 1L5MA 3DZIA 2WDZA 1HSOA 2QT1A 3BGSA 3JD2A 4J0GA 4RELA 3ZZUA 4BFXA 3RYCA 5DXFA 5IXYA 4WLOA 1RAIA 4PVCA 4EUNA 3SLRA 1EK2A 1M2HA 1XZ8A 2V6MA 4PSUA 1TYDE 5IJ9B 4UEWA 4N9QA 4PWYA 1BXKA 4C89A 3GCWA 4F04A 5IS2A 1RWOA 3FUVA 1SCKA 2JKYA 4LHXA 5ESRA 4E4TA 2XB8A 2X2EA 2SHKA 4YXWD 5K8VA 4S0XA 1WU8A 5B1DA 2I7VA 4BAGA 2RC5A 3M3HA 5AO9A 4OA8A 1KWKA 3T9FA 4LVNA 1L9KA 3H5TA 3NB0A 4MJ3A 4TQ9A 3T7JA 1OOEA 4XEUA 5JI2E 1HFEL 3K6KA 2LVBA 4IIFA 3SBOA 3IOCA 2PA3A 5AKKA 1XTPA 5GTDA 3NKLA 1VL8A 4OYLA 4X8HA 5DYTA 5FUYA 3P2IA 3F7MA 3OPMA 5I51A 1JIKA 5ICCA 2P6RA 4QTXA 1DJOA 4D98A 1EE2A 1FYWA 2F9MA 4EHLA 5CD9A 4JLSA 1G5RA 1TK9A 2JAXA 1QOZA 1MB2A 2IUSA 2ZYVX 3HL4A 1JILA 4I6GA 1FXUA 4MS4B 4YXFA 5IEJA 1J33A 3ZCPA 3F6YA 2XITA 3GJXC 2GN2A 2HZ7A 2QTVB 1EP3B 3ESQA 4XQCA 4LYFA 3UJPA 1D8AA 4GGPA 1YHNA 1KSFX 2WP8J 4RVGA 1ADBA 1Y42X 4P6VF 4AJHA 1GXSB 3DVQX 3ISTA 2B4AA 2XRMA 3QOFA 1I3CA 1N2HA 1G63A 1EGMB 5A4AA 1Q50A 5IANA 2WYVA 2DFVA 3ELBA 3WRYC 4EJSB 3KE8A 2RGNC 4C0QC 5DZSA 1CIJA 1D1QA 2NV2B 1YKFA 1K3FA 1KU6A 2OA0A 2XE4A 3E6AA 2QD1A 1JDNA 1NJ6A 4FEAA 1I5RA 2OEPA 3T06B 5AJTA 4DCOA 3THXB 1N1DA 1U3TA 3PNBA 4AJIA 2BSXA 2JFUA 4CUKA 1SZCA 5K8IA 4OX9Y 1GA6A 4YAIA 2O3RA 3NBXX 1GNSA 1UCFA 2BN4A 2HN9A 2VHTA 3F73A 5KSPA 1ODSA 2GCEA 2PZFA 3FVTA 5GJBA 4FZJA 3SICE 5DP2A 5GZ1A 1TU0A 4OQLA 5IC4A 4KMRA 2VP9A 2C9CA 3QVXA 1B7GO 3LQQA 5BVHA 5TS2A 5AKEA 2YRWA 3KFLA 1Q19A 3U2QA 3X1JA 4G5HA 2BF4A 1ACLA 1PAUA 2NTVA 2C9OA 3K0FA 3Q6MA 3FPAA 4F06A 2I6SA 1ZC3A 4ZYLA 5HKAA 3S5JA 2GD2A 1Y1RA 1GEGA 721PA 3MGKA 3RAPR 3DR3A 1HURA 4CL3A 3NVMB 2WDPA 4MVYA 1RC8A 1NLUA 2HREA 2Y1CA 3MINA 3MQ2A 4TMKA 1IDOA 4NBLA 3UICA 4DSNA 1YKGA 1GA1A 3F6PA 3TD2A 3ZTYA 1IY2A 3ETHA 1V1JA 4POOA 2FJUA 5AW3A 2QZPA 3TRJA 4CF6A 4ENUA 1JQLB 3GA5A 5JRDS 3RVSA 3BFXA 2PSFA 3A4TA 3E9ZA 3FIUA 5U4XA 2ZSJA 4K1LA 4BLVA 2H85A 2J6CA 1VJRA 4KWCA 4U2FA 4XLZA 3TB6A 5DWDA 4IIHA 5B1SA 3CWQA 1WSDA 2WW8A 3B2NA 3OECA 1YL7A 3GGOA 4AF8A 4LXQA 3H2IA 1KVQA 1ZH8A 2FN9A 1U3VA 5CDGA 1TCVA 4MJLA 2XIQA 3BFPA 5E1BA 1O5TA 2OO5A 1FYDA 4BASA 1X7WB 3G8CA 1MRSA 2UZAA 3FRIA 4KQIA 4EB0A 3AJRA 5DTJA 1T2FA 2H11A 3RIMA 1DQPA 4DMLA 1NE2A 1WEHA 2NZWA 2GYUA 2FHSA 4L5CA 1GNQA 1RKXA 3CZ9A 1BE1A 2IF2A 3IMFA 3X44A 2HK9A 1EXVA 3H0CA 4WK4B 3ICWA 1ECLA 3WDLA 1IIRA 4RHEA 2XTJA 5JS6A 1TC2A 3OESA