4LZPA

Structure of the tir domain of the immunosuppressor btpa from brucella
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
162
Chain Sequence
QAVKKVAQEQKRLSDERTKHEAFIKQSLSSMRTTEEYDFFISHASEDKEAFVQDLVAALRDLGAKIFYDAYTLKVGDSLRRKIDQGLANSKFGIVVLSEHFFSKQWPARELDGLTQTRILPIWHKVSYDEVRRFSPSLADKVALNTSLKSVEEIAKELHSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure of the Toll/interleukin 1 receptor (TIR) domain of the immunosuppressive Brucella effector BtpA/Btp1/TcpB
pubmed doi rcsb
source organism Brucella melitensis
molecule tags Immune system
total genus 57
structure length 162
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4lzpA00
5FORA 1FYVA 4W8GA 2M1XA 5KU7A 5H3CA 1FYXA 3UB2A 4FZ5A 2Y92A 4C6TA 3OZIA 3JRNA 4W8HA 2J67A 3UB3A 4LQDA 4C7MA 3UB4A 4C6TB 1O77A 3H16A 4LQCA 4EO7A 4DOMA 4C6SA 1T3GA 2JS7A 4OM7A 4LZPA 4C6RA 2Z5VA 1FYWA
chains in the Genus database with same CATH superfamily
1KVTA 3K0KA 5FUMA 3P2KA 3BRWA 1XP5A 5GM2A 2AT1A 3PQ2A 5JV5A 1NTRA 3LQYA 1MJFA 4YRQA 3HSYA 3MT7A 3VYSB 1BX3A 4CIAA 4BX0A 4GPAA 4I8DA 5ALYA 8LDHA 2C96A 2WZBA 2E85A 5HIKA 3WWEA 3IDZA 3P4UA 1DZ3A 3F8WA 3T34A 4MKXA 4K1XA 1XF1A 2AJLI 4WZBE 1WZEA 2EKDA 2I2AA 2IVZA 1LZLA 3AG5A 3QLVA 3E23A 4JT2A 4TYNA 4URZR 5J2TB 2QTAA 1N57A 5J2UB 3EDOA 1M6VB 1CV2A 1FDIA 3PS9A 2FUG1 4FLFA 4FJ1A 4YQYA 5DP2A 2PXHA 1U98A 4FFBA 4D0GA 5KQRA 1FVOA 1UPXA 5M2QA 2GK6A 2X9NA 1KI4A 2GVZC 2FG6C 3ZGXA 3CZQA 1QQ5A 4R9UC 3ZW9A 3WZ2A 4DLVA 3QUQA 3O1JC 3RS0A 3BREA 3HWRA 2C9BA 3F5DA 4K9QA 4QU9A 4CF7A 5JZBA 4KPFC 1N7GA 2G1UA 2ZUFA 3ZK7A 2R6ZA 2VRBA 4N3NA 4RMJA 4ENUA 4YP0A 2AOUB 5K01A 5EE5B 1Z2NX 2DFKB 5AHRA 3G5UA 4HDKB 1QGOA 2E1PA 4BFXA 1GD1O 1XTIA 2P40A 4HAIA 5DU2A 3VKWA 4PVCA 6NULA 4QE3A 4Y9TA 3LFHA 3ZGYA 1QGED 1CNEA 3HABA 1U2SA 4Q1CA 5LZ9A 5IJAA 4URFA 3K73O 4KRGA 4XW2A 1H22A 3ONDA 3TNYA 3QUSA 4BVEA 1WXQA 2FFBA 2H59A 4L78A 3T3OA 2QGFA 1EGHA 1VJCA 5E7QA 3B85A 3LX8A 4DLLA 3HA2A 4F97A 3H2YA 4RETA 4Y1EA 1YA8A 4JQOA 4YJGA 5F1OA 1G8JA 1TIKA 1ZSYA 3ABIA 3EGVA 5BWOA 3TFOA 4A3SA 1JB9A 1LNZA 3SKVA 3MHTA 3KKKA 4Z2AA 2A7XA 5BOSA 2R66A 4HATA 2TMGA 4RGVA 1SK9A 3JQAA 3VAAA 5BSEA 1XAHA 1CS0A 2CHQA 2IBSA 4TKMA 4RQUA 1TRHA 5I9SA 3E27A 5ERGB 3MBOA 3A4NA 1UBNA 4ZI3A 1FFGA 1MDBA 2EJCA 3L8EA 3V4OA 2Z08A 4GXRA 1XQVA 4HDMB 5JPIA 3U7FB 2AMFA 2W6NA 5DLEA 2WTXA 3ADOA 2NP7A 1FS6A 2BGRA 2MYTA 2RBKA 4MV4A 1UBJS 2RJOA 3RVQA 5JZSA 2OT3B 3ESXA 5AI8A 1AS3A 2VSOA 4P4TA 1LVHA 4YUWA 1VGQA 3TFWA 1ZM4A 1PEDA 3RF7A 2XWPA 3LGXA 1E2KA 1J21A 2RKOA 3M4ZA 5AKLA 4BMYA 4CTOA 3KCQA 2G36A 3I5AA 1G38A 4OHYA 2CV0A 1VSTA 2VZ9A 2Y1DA 2C03A 4M7RA 2Q5OA 5J1TB 3HO1A 1IRIA 1LGYA 1SKBA 4RD6A 2PSDA 1SHLA 4KLNA 2Y1XA 4J1TA 1Z5NA 2HSDA 4RL4A 4FCVA 4WLVA 5FWYB 1Y6RA 4UU7A 1G6KA 1EB9A 3K7EA 3RKSA 4DCMA 4WKCA 5C5IA 3KYCB 5BSKA 2WUDA 2JFPA 2X0IA 4XWGA 4CU2A 1ZK4A 3I5YA 5TPWB 3NDRA 1PWXA 4GMFA 4I2VA 3U6KA 1GPKA 3EE6A 5GJWC 5IMSA 2WG0A 3WLEA 2YWFA 5HF8A 2ZTHA 2PUTA 2EX0A 1QG2A 3OKCA 3L49A 3QPBA 4XFKA 4QUKA 3JWHA 2AFRA 1M6EX 4Z99A 1Y4AE 2PYDA 3INYA 5LQUA 4IZOA 1KJIA 4BNZA 1MDFA 3I4LA 1IG0A 5A5VA 2FJUA 2VDVE 1OXTA 4FS3A 3RSGA 4EHAA 3KZCA 5G3YA 2AQKA 1HT0A 2IYTA 4IFIA 2I22A 4DIKA 3PJRA 3G89A 2E37A 4OSEA 2CLDX 4LF4B 3ET5A 4I19A 4NNPA 1YJAA 5G0TA 3O8CA 5AVJA 1Z0JA 5KB3A 1ZC3A 3JASA 4FDVA 1T36A 1LV7A 1ZPDA 1O6GA 3CN9A 4JUBA 2H2GA 5AK3A 5B2EA 3DJFA 5TMPA 2ZBRA 3B3QA 1XCPA 4K2HA 2FGJA 2XF8A 2J33A 2F4VB 4ZHQB 2HU2A 5LBUA 4DMUB 2ERYA 1A0OA 1SUFA 4HAXA 4UJ3A 2AFIE 2WF8A 4ZT3A 4CV2A 4ZGGA 1PQWA 2VHQA 3GNTA 1ID8A 1LEHA 3EVTA 3F1LA 4FLEA 4TUYB 3VNQA 2WD9A 3OQ1A 4KPGA 4DYHA 4M83A 2PUFA 4MV7A 1RBZA 2WKRA 4W99A 3Q6IA 1GZUA 5ENDA 3ZJVA 3L2OB 3OHSX 5EUQB 1NX9A 3MWYW 4XIIA 3ZVKA 4LECA 4V38A 3A1SA 4Y2TA 1V9SA 3UAGA 4BMOB 1N6OA 3FI9A 3URMA 3RYIB 1AKTA 3VDNB 4FFBB 2PU5A 3O1LA 3EW9A 5G41A 1W25A 1U04A 2C8VA 2P2CA 2CFRA 2TMDA 2WM2A 2YZ2A 4CPDA 1FE8A 4JNKA 1AKYA 4NU8X 3PFNA 1RCFA 5HE8A 2VZEA 4MVJF 4LRSB 3D1VA 3R74A 4GD3Q 2XWJI 1K97A 5A5EA 4QXQA 5FNVF 2BOVA 5IEBA 3QP9A 1KDPA 2XB9A 3KELA 4ABYA 4C2UA 1U63A 2C4KA 1ZRSA 3COWA 3DZDA 3JZDA 4DR2B 1SKAA 1T1RA 1TCUA 4N0MA 4Y30A 3TZBA 2QLLA 2HDWA 4KIGA 2OFOA 1FDOA 3D6MA 5ANRB 5BSWA 3V6LA 2R1ZA 3IKTA 1EUCA 3GAMA 3Q7TA 1W9MA 3PNOA 1XRRA 2BIFA 5K03A 1DGQA 1ONPA 2C0CA 3B9BA 3MS7A 4PZZA 2HA5A 3RC2A 4RPCA 3W2TA 3TLJA 3EZ9A 3TK1A 2E4VA 2BF7A 5K0FA 3PEWA 3BH0A 1N2XA 1DDIA 1ZVMA 1ZN8A 2IUSA 4XD2A 4ENPA 5LM3A 1OWLA 4U7DA 3EOZA 3ADKA 3D6HA 3EDMA 2C4UA 4PHHA 2ECFA 4Z54A 2FYTA 4N7JA 5TMEA 3TE7A 1F0YA 1SBCA 4IH1A 3LMKA 1MZVA 2VHVA 1ETUA 2Q27A 4HYQA 3R8XA 3SKXA 4C6HA 2JZCA 4QKQA 1V9CA 2HHLA 3TLZA 1DG9A 5KJ1A 3Q7RA 1DAGA 3UHOA 4DJFC 1JJ7A 3K70D 3NOQA 1I6MA 1QZZA 3DTVA 3JQAB 5AJUA 3BB4A 2I4RA 4Q9NA 2LKDA 2L17A 3QE0A 3PCTA 4KTTE 4Q6WA 3KTAA 4HEJA 4HHEA 1G60A 4AN1A 1KEEA 3SR0A 3PC7A 4B4VA 2ATIA 4PS0A 3KC2A 4HAVA 4MKHA 4DBLC 5CDFE 3FHOA 4LDZA 5ICFA 2GCIA 3AM5A 4X1IA 4EG8A 5HIJA 4CL2A 2BMVA 4MRSA 3VUEA 1L5SA 3AYXB 1IN6A 1CHDA 3CUSA 4MITA 3ZQ6A 4AJ4A 1HDEA 5AHWA 1BXRA 4KFTA 4GXQA 1NVUQ 4DAOA 1ZS9A 3MG9A 1Y89A 2IXBA 4WKBA 4F0JA 1ZNQO 3OU2A 4HDAA 1E32A 1UINA 3QFRA 1HE2A 1Z5UA 3PLAE 1AK2A 1NNUA 5KYUA 1L6RA 4DLNA 2QORA 4N6GA 4RIHA 2X5KO 1I7PA 2R5NA 3HCEA 1G42A 1RCUA 1UMDA 3EDCA 3U7GA 1VGVA 3THXA 1NFFA 1KRXA 5IC5A 1LBQA 2G4VA 2GK3A 3FKJA 3KQMA 4B6JA 1M7BA 2JLCA 3BB3A 4R54A 5JI3E 1F4PA 3DZBA 3EZ7A 2DVMA 2W6OA 1WCV1 1YD7A 2GBLC 2IYSA 2OAP1 3HC7A 3MCZA 4HN4B 1V25A 5DNEA 4W5OA 1G8SA 3LVBA 2O14A 3NKLA 2JKZA 5BV2P 4MQUA 2I9PA 1B00A 1GNRA 3E3LA 5D5HA 1YZGA 2DFLA 1YQXA 2EBFX 2CSUA 4ZVKA 5FQNA 6ADHA 2OVBA 1WABA 3CUYA 5INTA 4B47A 4MGIR 3B48A 1NU8A 2XNDD 4EZEA 2P9FA 4IXNA 4UVGA 4NCBA 1LC0A 3R20A 1YU6A 1DO0A 4Q16A 3P26A 1T36B 3BKWA 2WWFA 4DLRA 2GXQA 2FR1A 1NFRA 2VDLB 2ZJ8A 3JQFC 1PTJC 1QO0A 3BJMA 4WESA 2HWYA 1T0HB 3IP1A 4NYMR 3VPCA 1I3NA 4MVWA 1GKYA 1MH1A 3DUWA 1DELA 3F71A 3QVJA 4CQMB 5JD6A 2DZDA 4JEUA 3WL3A 1PW5A 2BFAA 2NPFA 3JYOA 1MF7A 1OSNA 2BHRA 1C3OA 2DFNA 1QZ3A 1L1QA 1DKLA 1U4NA 2A84A 1HE1C 1D07A 1DQYA 2ACEA 2NO0A 3L6DA 1B3BA 1RQLA 1CKEA 2O05A 3NBQA 3LNCA 4X45A 3TXAA 3UUFA 4LRYA 4BE7B 1U5BA 4QOHA 3OPXA 4DR3B 3N6VA 5ARBA 3FTFA 4W1PA 3MWFA 2ZR7A 4AURA 3M6MD 3U3KA 4CQJA 2CGEA 4TTSA 3SNKA 2XITA 3UBMA 3TKYA 2JEZA 4OATA 4DSOA 4R8SA 4YQZA 1FYWA 4J0JA 4OQDA 2I2BA 3PXDA 3TIGA 3DAFA 1POWA 1YUNA 1G63A 4LNUA 1SVKA 4CCWA 1RFGE 1K7CA 2NN3C 1QDUA 4OYLA 2L82A 5DEOA 4IX9A 1N8SA 3R7SA 1E2HA 2GK4A 4B4KA 4BP9A 1QSGA 1C7ZA 1PQYA 3RGWS 2IHTA 1U1DA 2UXBB 1DJLA 5H3LA 2HDOA 2WJPA 1CQPA 3IERA 3QK7A 2FSIA 4KNVA 3V1TC 2AB0A 1THGA 3BOSA 3CLRD 4MULA 3VHRA 4E5VA 1EFRD 1XN1A 1PG5A 3KD2A 3PUVA 4MWEA 1EUCB 2AXEA 2JKVA 3WKDA 1U7DA 4CLEA 1NBWB 4JMLA 2GK7A 2OM6A 3QBVA 3NIBA 2C2YA 1SC1A 1Y7TA 4F91B 2B3TA 3FNGA 2COUA 4RCZA 2GD6A 4WK2B 3WOHA 1EUYA 1NBEA 2JIZD 2Q9UA 3R0QA 4RDXA 4YRIA 2RJ3A 5ALMA 1WMSA 1DJPA 4X3OA 3PWTA 1AN9A 1AY0A 1O54A 2NZ8A 2ZXEA 4KLRA 4RESA 1OBVA 1V7PC 3FDXA 5TS3A 5EUBA 1H93A 3UTDA 4DJDC 1QK4A 3VPAA 4FEGA 2SHKA 3UWPA 4NCNA 1ZOSA 1P2DA 1KPIA 1E3SA 1Z5OA 4HL6A 3QMVA 3OJLA 4CE6A 1F1JA 1T3TA 3DTVB 3IV9A 1FDTA 3EWAA 3ZEAA 5KOHA 3IMEA 4FP9A 3MRSA 4R6XA 1LI5A 1UR5A 2LPMA 3KTAB 4IYRA 1DG1G 1B0PA 4P08A 2FXVA 4N4AA 4TL6A 1D0VA 5F5NA 4C5BA 2YMQA 1KEEB 2P9GA 2YWDA 2AI3A 2Q0XA 3AZQA 3DEJA 7MDHA 1CJSA 2IUEA 3HLTA 4BKOA 1K5GA 5F23A 4D3ZA 5H59A 5LVAA 5HNKA 2Z5LA 4LOJA 4MYHA 4X1IB 5E6SB 4LSWA 4UREA 5IASA 1Y4UA 4MR9A 2WQ7A 4FDUA 4PNPA 4RK6A 2XB4A 3T4PA 1I1NA 1KHTA 1VL1A 2FPGA 4YAEA 5FHQA 4DKJA 2J4CA 2VDRB 1BXRB 1ZQ9A 2ZCUA 3W1EA 1T2UA 3GUHA 3L1HA 3P2JA 4QOEA 4BUCA 1QR6A 3SXJA 3L7OA 3ZWBA 3JSAA 1WXWA 4EF4A 3AUJB 3WLLA 1DLJA 3GL9A 4EY6A 2QQFA 4DDTA 4MI1A 1T3LA 4FE3A 3W9BA 3HNRA 1FXWA 5HMLA 1GTRA 1VCNA 2QSJA 4C87A 1UWVA 2OQRA 1PYGA 4CGZA 3KKNA 4ZCPA 3UWMA 1UMDB 3THXB 1QQBA 1M2EA 4HY3A 3E70C 2VTKA 3JAMA 2WJHA 3UO8B 4ESVA 1X8LA 3G8AA 3NBAA 4UXHA 5FL7A 2W6PA 1CJMA 2JI8A 1FSPA 4BJ1A 2Q6OA 3KEFA 3E0QA 3OZFA 1ORWA 3ZBUA 3R41A 4A8JC 1NAHA 2PJDA 3HL0A 2HBRA 1JTVA 3L8MA 3OKAA 1NXQA 1JR2A 2ZB3A 1DT5A 3HA3A 2GBIA 3L8FA 3Q87B 3H17A 4KOAA 4QVKA 5DN6A 3IDSA 4Q01A 4BO0A 4EUSA 2MYUA 1E1CA 3R3JA 4KNWA 3UMFA 4C0AC 1ZK0A 1GY8A 1HLGA 3H1GA 3CLUD 4O4IF 5F12A 1GR0A 3GCWA 3PFFA 2GLXA 4BNDA 2R3SA 2YNMD 2V9PA 5A9SA 3QA3E 4FJ0A 4G5XA 3K0SA 2IHJA 4H15A 3D43A 1YS7A 2VF7A 1RLIA 3OMXA 3TE6A 1P61B 1ORHA 4IIEA 1QNFA 4WESB 3HB4X 3UH0A 4DCPA 2WVJA 2Q8PA 4HNSA 3DWGA 3FOWA 4ZAGA 4CMAA 4OHPA 1P2GA 2P62A 3E7FA 1E5DA 2UVQA 2ZLBA 2ZYGA 1MG0A 4FGZA 4YVFA 4NOLA 5H4HA 3KZOA 5T3YA 2R8OA 2ATEA 1VJ5A 5GIPE 1C3OB 2QL9A 3SSMA 3V34A 3UMSA 5KYNA 3NPMA 4MA4A 4WVFA 2GF0A 3ZIUA 3GH1A 4ES6A 1UK6A 4Z51A 5C18A 1NDHA 1U5BB 3I6MA 5GMOA 3DAYA 4RANA 1QP8A 4GR5A 3W3ZB 3BFPA 1C9NA 5JS2A 1RC1A 2R7NA 2XXJA 3SM9A 3LQFA 3TVYA 3O8RA 5C1PA 2H57A 4KE6A 3FAKA 2M6RA 4BZPA 2DT5A 1M0EA 1ECJA 2JAXA 1N9KA 4LNUB 3IDQA 3ROXA 2BFEB 4G85A 1NQUA 4F9EA 3HNPA 2JHPA 2PGDA 4MHOA 3NX4A 1NT4A 2Q4DA 3SP1A 1JR3D 4JB0A 2EF1A 1J8FA 2D1FA 2XDAA 3QWBA 3TM4A 4Z4EA 3EXHA 2FZCA 3OO0A 3S2UA 1R5BA 1H2XA 1KL7A 2X3UA 3MYYA 2J5XA 5I7FA 4UM5A 3EF0A 1CDEA 1NIPA 5ECWA 4YMGA 3E9RA 1DKOA 4C7XA 5I4IA 2RG7A 2D74A 4M8LA 2XCIA 2Z98A 2HK7A 4OLJA 4E2XA 1EFPA 4OFBA 3KQKA 4WJKB 2F8LA 5G0SA 1Z22A 4HUQB 5KAMA 1NBAA 1UM9A 3OD1A 3UAYA 1NPYA 3MJ4A 2HO4A 1I51A 4IINA 3ZI7A 3RC9A 1E9FA 1FTWA 1BYUA 2I4TA 2WJ3A 2V9ZA 3CR8A 3G68A 4HRAA 4RVGA 1M8GA 1PDVA 4QDKA 1SQSA 4JLUA 4M1SA 3VAYA 5IWAB 1VIDA 1FTNA 1Q7TA 2IOHA 2Q21A 1L4NA 3OFKA 4I5GA 1P72A 2FKNA 5IT5A 4URXR 5KQSA 2GBCA 3KKLA 2C2OA 2PSHA 2UUPA 3E84A 4ZYZA 1EBFA 4E33A 3J80A 5KOHB 3KV3O 1CB0A 4FFWA 2CNDA 4PFQA 2YHAA 1SVUA 3QBJA 5HBGA 3RVRA 1NBIA 1IBLB 4LNAA 1RIIA 5SY9A 2NO9A 2DLNA 5I7SA 1CIJA 4NBKA 2BFBA 2I67A 2ZTSA 4XEUA 3KR2A 3LH5A 1GNVA 1GVNB 3M33A 4FFMA 4YO8A 3WNVA 1GGEA 1QYIA 1J2EA 2QP3A 1RMTA 2Q29A 3SHVA 2OHFA 2OXTA 2WF9A 5KDOA 3IVMA 4FYVA 3LHIA 1QORA 1N1DA 3PZBA 2V4MA 4RSGA 5DNAA 3VPDA 2IUTA 4ZD6A 4D4HA 4MR9B 1N78A 1KBOA 2IS6A 5HF9A 4IDCA 1D2CA 3UOAB 3L7MA 1KIAA 2OQIA 1I1QB 2FPGB 2WSBA 4QPPA 3PYXA 4WFIA 4W1RA 5IHPA 5HGJA 5B58T 1SUWA 1ACJA 4IUBS 1KY3A 4L85A 4E7PA 1VKHA 2Z1NA 2HL6A 3DWFA 5ENZA 1HYBA 2Z30A 4LJ6A 3ESBA 2J08A 4DYDA 3TLKA 6Q21A 3PE3A 2PUCA 1Y3HA 3GZJA 5LN1A 1TE2A 4NYJR 3QXCA 1NE2A 1Y1RA 2YC4C 2RAPA 3KALA 3PZRA 4R31A 3HDQA 1C8KA 1W0JD 1WV0A 3BL5A 1K3TA 2ONKA 2H4YA 3NGXA 4BTLA 3MT0A 4WA8A 3BIJA 4KSCA 1WULS 1CP2A 2IZZA 3NHYA 4U63A 1YS9A 3W5VA 1O77A 2LGJA 3KQLA 2QZZA 1Q14A 5IXJA 2VJDA 1VG1A 4YV2A 2BJWA 4GECA 1NRIA 3UG7A 4DAEA 4M1OA 3UBTA 1TO1E 2G70A 1AGPA 1QB8A 2Z8XA 3JZAA 4ZVSA 4RMHA 2HIHA 3W6PA 1Z35A 2X15A 4EKEA 3GRAA 4K86A 1NLFA 2YHIB 3CW9A 1W2HA 2VP5A 1Z0SA 3QENA 1PV4A 2IWHA 2VZ0A 1E1CB 5BORA 1ECCA 2GD0A 1JFRA 4JJFA 2VYCA 1WB9A 4O4JF 1U2GC 4BNDB 3ZN2A 2FF7A 5A4DA 5FTNA 1OFVA 5IAGA 2VQFB 5AVZA 1I4TD 5CDUA 2G25A 2QG6A 3I9V1 1VHJA 4LDJA 4LXGA 1UP4A 4I6EA 4YYEA 1Q1ZA 1MR3F 1F12A 1G21E 1WXHA 2LVBA 3JWJA 4MP8A 5IHXA 1YR6A 2R86A 5HZHA 5KEIA 1MOQA 3HBLA 4EQZA 2WP8J 5F76A 3QJGA 5DM60 2RAFA 5ABPA 3WYCA 1PN3A 4DVJA 1UEXC 5IZCC 2NVOA 1EBBA 1ZGCA 3JQ9A 3NOOA 3ONNA 4I50A 2VJYA 4PFKA 3MTAA 3N8KA 3EIFA 1VE3A 1KOLA 3RFXA 5GZ3A 2IH5A 3BWYA 1TB4A 2PQ2A 1U3UA 1F4LA 5KU1A 1H6BA 5EP2A 3H9CA 1TA0A 2Z1DA 2GHRA 2XIJA 4GXTA 1N8NA 2XZLA 4D56A 1RPJA 4GH5A 1TYCA 2Y1KA 5K4AA 2QS9A 3DQZA 4QDTA 2WFZA 4Z9FA 1K63A 1U3GA 4C3UA 4RHYA 5ARDA 1NC3A 4X66B 1WDLA 4H60A 4UUNA 2W2NA 3N87A 3N8GA 4WLUA 4EMSA 2NTNA 4I3GA 1P1CA 1PZGA 4H4EA 4C4RA 3JCZA 5CM9C 1PT7A 4X3PA 3LIPA 5FLYA 5HS4A 1G17A 3SE0A 5MGNA 3BF8A 3R76A 5BR8B 4BNMA 5JJKA 1ZIOA 1U0SY 4LCJA 5C5CA 1ZLYA 3JTMA 4YMLA 2GEDA 3EGIA 3TRHA 4X24A 3EXHB 4H3SA 3LQKA 5I7UA 3CB4A 4BNFA 2X2PA 4ATNA 1BA3A 4TLMB 5JNWA 1PR4A 1T9BA 2O7NA 1EFPB 3OZGA 3ABQB 5IJ0A 4A16A 1QX3A 1UM9B 4DOMA 4LGYA 3WYAA 5GJCA 2C61A 3W05A 1CUSA 4HX5A 3GFGA 4GYJA 4ER0A 1HQYE 2IP4A 1VJ0A 3H9UA 1RI4A 2P7IA 3EPRA 1IXZA 3G5AA 3VRHA 1MT3A 2UV8A 3PNPA 3OUTA 2B8WA 4N5DA 3HV2A 1A4IA 1C14A 1S3IA 2R7MA 3GVXA 4URHA 4UUOA 1YZTA 3S2SA 3X1WA 1PZXA 4C2TA 3EPPA 4JGBA 3TDMA 4FS8A 1I33A 1C7FA 5DBHX 1UBMS 4UHBA 1KORA 5H9WA 2XZTA 4Q93A 4AJ2A 1YRAA 4FFLA 4OYHA 4DLYA 3O73A 2BFBB 1ZZGA 2MSCB 2C0QA 4NFLA 4O4LF 4Y2XA 4ZVVA 5EJ5A 1E1RD 5I7WA 4BGEA 1FFBA 1KU6A 1MNQA 5E9QA 1CY8A 3H5WA 5EHZA 1XELA 2H8GA 2JGJA 4ZEVA 3CO0S 1TAUA 3C41J 5H0IA 2GN0A 5HFJA 1G7SA 2PMBA 4Q3AA 5FBKA 4Y3UA 4DRXA 1HFKA 3DO8A 1NWHA 1WNFA 1MRNA 2CLCX 1OWNA 1PJBA 4PGHA 3EX7C 2BZGA 4J6FA 4PQYA 3HACA 1PNQA 2OV4A 3KXLA 4TQUS 1P0FA 2QXYA 1A8HA 1Y3BE 5KTKA 1J0EA 4QULA 5DOZA 3K71B 1SUDA 2JLUA 1BMDA 2II6A 3KZNA 1F3LA 2EW1A 1H1TA 3G0GA 1P73A 2R1TA 3F7OA 4RF2A 4P86A 4ZMRA 2HCBA 5I5GA 4DQKA 3KSRA 5MF6A 5JWOA 2RONA 1RAHA 3SVLA 4AECA 1UDXA 4MGKR 1C0EA 1KEZA 1UMCA 4GKVA 1YJ8A 4WK0B 3RV3A 5CA0A 3WQBA 4CMEC 4J0IA 4B8WA 4YXWD 4HMPA 2CNNA 3I1YA 3VPXA 2J3LA 3FPLA 3ENKA 4H08A 1QWSA 1E1YA 3NHRA 3WISA 2HBZA 1XTPA 3SF0A 1I9GA 5AVQA 5ALIA 4RY0A 2NO1A 1P2BA 5JD4A 4JX9A 3BWMA 1K4MA 1O5IA 4LK3A 4ZRMA 3TOZA 2A2ZA 1DO8A 2UUAB 1DTWA 2A5YB 3KL4A 1ZUWA 5KWIA 2WTAA 4ZO8A 1Q0RA 1S8FA 4QFMA 4C7VA 2YFQA 3KO8A 1E7MA 1JHMA 3HRHA 1PNVA 1YU9A 4OB6A 1L5QA 1VLZA 2J07A 4WCFC 4R1UA 3EXAA 2YIJA 4ITUA 4B74A 2QU7A 5AVXA 1T0IA 3FLEA 3P5SA 1IOLA 3H9GA 2YL2A 2Z2YA 1JU9A 4KO4S 4PYKA 2P9CA 4F4HA 2C29D 3IOBA 1EX7A 4RF5A 3SJBA 3P96A 2JGEA 3ROGA 4Z7QB 5LL6P 3NHWA 4FJ2A 4AMBA 1NUTA 4BLUA 3EH2A 3LQRA 1SBTA 2H3HA 3BEOA 4FZ5A 1B6SA 1OHHD 4D0SA 1ZAKA 1ONBA 5LMZA 1RWNA 1ZEMA 1B6TA 3FWNA 4BWVA 1Z38A 1VHWA 5GZ6A 2R87A 5JW6A 4I50B 2YX1A 5HKKD 4JLPA 3EBLA 3OCUA 3I5MA 2A88A 3QU4A 2NU8A 4BPRA 1XTSA 1E66A 2VWHA 3PP8A 4C4XA 2XKKA 3KWJA 4UHJA 4WXEA 4GYWA 5A7GA 1H05A 5BNZA 4DYVA 3GFQA 3PXBA 1A88A 1S2GA 1SCJA 3JR7A 3RO7A 3WNZA 4BVFA 2NNLD 3I04M 2J6BA 4IWYA 3D3EA 3ZR4B 3PIDA 4F5WA 4WZ6A 3QE2A 5EYPA 5I9TA 4BCCA 1K3FA 4FYXA 3UHAA 2PTHA 1G6HA 4QDZA 3VX3A 4I4TA 2YYSA 3CEHA 5GPBA 5T6MA 3OM9A 4E14A 3ST7A 1XZBA 2IZ0A 2YR0A 3QXHA 5HK8A 2ZSHA 4TXNA 3NRJA 4JWTA 3ML1A 2XA9A 1HI9A 2NV0A 5LMNB 4OVKA 2Y76A 2H1LA 1ZSVA 5EPOA 3DEFA 2C8KA 5EINA 2NQTA 3I39X 1O96A 4M38A 1GV1A 4YRLA 4CEJA 4OXKA 5CYOA 3PXGA 3RPEA 4HLUC 3GYGA 1RYFA 5IJ0B 4JZKA 5JMWA 1HTTA 1JIIA 1PIWA 4Q7MB 4BAGA 2HDHA 3I05A 3NG1A 1Q0TA 1PJCA 5DNVA 4K6MA 2GJKA 4MKIA 4RV9A 5HFNA 4GIBA 3M49A 2D5CA 2UZ1A 1YVRA 1Q77A 3N0WA 2DB3A 2VXBA 4WINA 2E18A 4X00A 1V43A 4ZYWA 1A7KA 1Y9AA 3LHFA 1XKQA 1G6OA 2B37A 1EM8A 3DV9A 1E9BA 2HQSA 4CRWB 2ROQA 4POAA 2ECPA 4FMDB 2I3AA 1F20A 4GMDA 3HSSA 4LOHA 2J3QA 2NSJA 4FCCA 2P9QA 2D00A 5E1OA 5ED0A 4YWHA 3KJNA 1R0BA 2E4AA 2FPMA 4IY1A 5C3MA 1BGVA 2LTAA 4GE3A 3COYA 5CFNA 2PWZA 2WIJA 3B1FA 3N9IA 4KAFA 4EVRA 4FKZA 3QBEA 4BL5A 2V6BA 1IJKA 2WYIA 4RFLA 4A23A 2ZTUA 2Q9AA 2QYTA 3MGKA 4ZAYA 4F5EA 4ZQBA 2E7ZA 4ALKA 3PVSA 2EQ5A 2ESRA 3GRKA 1P39A 2YDXA 4AJ9A 1NV8A 3OCXA 3ORFA 3HUEA 2DECA 4C7OA 2PRZA 3RUIA 2PBLA 3QW2A 4HQFA 4KO3S 2IEZA 4O6VA 3TSAA 5A1TA 2HN9A 2GRJA 1O6ZA 1HSZA 4K26A 5A7FA 1O94D 4K28A 4MB2A 4WXRA 1RZRD 1JUDA 1KEWA 1XNJA 1VMAA 3A6ZA 1C3EA 3NVKI 4ENWA 1PG2A 1DRJA 3ISJA 1RYZA 3C3CA 1K8ZB 2NIPA 2WKWA 1S5PA 2JF0A 4L2IA 3FTCA 3CLKA 5AO9A 3ZY4A 5JVDF 2ONCA 3MSXA 4N39A 2R1TB 4PE5B 5CHEA 4XPIA 4G01B 3A4VA 3I23A 4LOKA 2OWEA 3UJ8A 1UMCB 5IDQA 1IZZA 1YI8A 2GHQA 1GAQA 2LWIA 4DIDA 5CA0B 2QMUA 5I51A 4A0HA 3K4HA 5EJ8A 1VGRA 2P41A 2RKBA 2YJNA 4UQOA 4URUR 1IJEA 4LZAA 3VZRA 5LNK6 1D9XA 2FLKA 3M9LA 4MP3A 4R9RA 5IDYA 3KJFA 3ANYB 5L4NA 4J94A 1DTWB 2QLMA 1GGFA 3ADCA 2IC5A 1T0JB 2B35A 1AUOA 3I5UA 3MPUA 1L5VA 1GRNA 3LUPA 1RM5A 3LK6A 3QG1A 2QVBA 5CVJA 1QIKA 4L0DA 4X20A 2ZB2A 4F1WA 4C43A 2FPPA 5BV7A 1JN0A 1W36D 4LZNA 2A7QA 3CJTA 1DAIA 3N7AA 4ENSA 3G2IA 4O8CA 4IKPA 2K7FA 1F0KA 1LQUA 2P2DA 3DONA 3FYTA 3M0EA 3MJDA 3MQ2A 4QPDA 5EIFA 5FQOA 3VQTA 1VQ1A 4CI9A 2GF2A 4OK6A 4BJ3A 3L3BA 5HCNA 3O38A 5LDGA 5DTEA 1G5RA 2G83A 3SHWA 4EHBA 4EJ0A 1I2AA 1RWQA 2WIAA 3EC7A 4CDGA 4CIVA 3JATA 1XZLA 2CHEA 2J30A 2TECE 4G1MB 5JCJA 4BYGA 1KDOA 2KYRA 3L7DA 4CLXA 5B1HA 1A50B 1CZKA 1AHHA 1YZQA 4BGIA 1UPUA 5F3WB 1MXFA 1ORDA 2VDNB 1EFRA 4KLZA 3KSDO 5EQDA 1QGAA 1LLUA 3KWLA 2YRXA 2XWSA 3CZMA 5NULA 2NU8B 4CMBA 2XMCA 5J23A 3LDAA 4XH9B 2J3KA 2V58A 4KSYA 4A0SA 4DZRA 2C5AA 3E7WA 2JIZA 1KK1A 2PHZA 3BC1A 1AX9A 4QUJA 3TINA 1VRWA 2B25A 2XLCA 1Q50A 721PA 4BQEA 3I2KA 4UW9A 1WBDA 3E1GA 3W8NA 1UP7A 3PGKA 2XCSB 1Z4QA 1Z7WA 3KXKA 4JXJA 4L5CA 2GPNA 3SU8A 5BMVA 2Q62A 3U4IA 4FMCF 2PUHA 2GNPA 1AZTA 3FPBA 1BFDA 2Q1XA 5D2CA 5ALOA 5EYPB 1EJ2A 1YDFA 2JAOA 2ANBA 4CM6A 3JQ7A 3MA0A 4F72A 5AR1A 3WQSB 4I4TB 3NHKA 2G63A 1MXHA 3MRVA 4YFVA 5DO9A 3IAS6 1N2BA 3A1EA 3I5XA 3SFVA 3FCYA 1I32A 1IHOA 4KXYA 1Y4DE 3QXSA 5KJFA 1Q83A 4AP9A 4M0MA 4CUJA 1ND6A 5DISB 1HKHA 2H7VA 3T7AA 3DB2A 4H9GA 1K3UB 4X6UA 1VL6A 3LCUA 4BVKA 3P9SA 3ETDA 4CEJB 1O96B 2P7HA 1ES9A 3H3FA 2ZT8A 4KRFA 4NP6A 4PFSA 1IJBA 1P6UA 1UPCA 4I46A 3ZDXB 4V02A 1FNSA 5ALFA 2D6FA 2OL4A 3TJZA 2YMPA 1GPYA 5JTTA 1J8QA 4IMIB 3ZCSA 2ZBUA 2IKSA 9MHTA 3D7RA 4W5RA 1QHEA 2UZ1B 2HB6A 4U7PB 1FP6A 5F2KA 3M9XA 3N5CA 4ZO7A 3EGCA 4GEGA 1EM8B 4AMVA 1KGSA 4O2AF 1HF3A 2YIDA 2ZRPA 3DM5A 4DA8A 1KO5A 1LPOA 2GD2A 4JH0A 3DDZX 3EXEA 1E7QA 1RLOA 3DLTA 1S89A 4HNHA 4Y6SA 5KS2A 3SCZA 1QP4A 2CSXA 4BNJA 3UNXA 4F92B 2C92A 1VMEA 2Y2UA 1XDGA 2A5DA 2GASA 4EB3A 5BWMA 2QZSA 2ZP1A 3E7PA 5LYJF 2IDKA 4QGSA 4DNFA 1CTQA 1IY0A 2K4MA 1N92A 4TXJA 3RAFC 1PR5A 3K6SA 3G49A 4YASA 3MBIA 1VPEA 3KVRA 1ZJWA 3CF4A 1DQPA 3EB9A 3AY0A 3FMVA 4FBGA 1PYOA 2WNIA 1FY2A 2I54A 4KN8A 4ENTA 3EVAA 2PV0A 3USCS 3BEDA 3E7DA 2XJ4A 3ETEA 4A36A 5TGTA 1DVRA 3KLOA 4ZQEA 4QXMA 5EQTA 1K7SN 2HLHA 2E6KA 2FLVA 3DOIA 1M7GA 3EEIA 4ZI2A 3BXFA 1DI0A 4JOCA 2YNMA 4L2IB 5E9AA 2LDXA 1AK9A 4YH1A 4CETA 3DLAA 1UFKA 4DQXA 2VAMA 3MB5A 1NBHA 4LQDA 1N5OX 5SICE 2DBVO 1A69A 1U0LA 1JAIA 2DUUA 1IB0A 1V4NA 1AKWA 1U9CA 3LVRE 3UA4A 2UYQA 4TXHA 5D1NA 3TG8A 1S3SA 2JS7A 3WGLA 3VKGA 1DBWA 4LZPA 3WQHA 2XXAA 2JGMA 3E8MA 4IVRA 3X43A 4GPD1 4L72A 5IMBA 3O82A 3SJCA 4B3FX 4CG1A 3L1IA 2W43A 3HO6A 1UUFA 2RH9B 5D5QA 1JTFA 4KEAA 2NO4A 2XYHA 4RAQA 2W2TA 1CHNA 3BIFA 3GEHA 1G1AA 2QAGA 3V1LA 1Y8AA 4X20B 1ISFA 3O03A 4AY2A 4KXVA 1Q6ZA 1BKSB 1TFRA 2AN4A 2ZUDA 4QU8A 4A73A 4DLXA 1MJGM 4CN8A 5HKAA 4Q12A 3AYZB 2GGSA 3QIVA 4G1CA 1M66A 1CEXA 3L6UA 4P6VF 3STWA 3VMMA 1NF2A 1KEPA 5BNFA 4D9FA 3EEOA 3C5HA 3TTUA 5CITA 3PF9A 4RZHA 3LFUA 3P9NA 4UUQA 3AOEC 4YYZA 9LDTA 4M1WA 4OY3A 1D6JA 3IE2A 2R8ZA 3FPKA 3GPIA 3NIWA 3PC6A 2YUIA 4II2A 4GICA 4Q48A 4AF8A 3LRXA 1EGMB 3FOCA 5KCZA 4UTOA 4WUVA 3VU8A 3GV0A 2C8JA 2WM3A 4ASUA 4D9CA 1KTVA 2HJRA 1VYVA 2HCRA 1NJGA 1VMIA 1NVAA 3C43A 3SYLA 3TN7A 1S2MA 3L9WA 3ID6C 4IQFA 1XGKA 3HR7A 3JATB 5E4TA 1L5MA 2H51A 2FFHA 3GRFA 1JR3A 4HF7A 1P1JA 4DXDA 2C04A 3DYIA 3SGLA 5HW0A 3NW9A 2X1MA 1JEDA 4DSZA 4B6EA 2HBQA 4G41A 2Q6KA 1MB4A 5AH0A 3GJ8A 5CW2A 2WTBA 2ZRMA 3SICE 4EWLA 1RHMA 3BH7A 1P1BA 1E3QA 3WL5A 4FONA 3FOEC 2WZCA 3TX2A 3MAAC 1WMAA 1QPGA 2CMKA 2OMEA 2D5BA 2K7ZA 4KDEA 3BMCA 3HG7A 3H05A 1I4WA 2ACKA 2W2KA 4CG3A 4F6RA 1CUYA 3NXSA 1TO2E 1VJ1A 3OZEA 4QXOA 2B82A 4D9KA 3Q88A 5IF9A 3KJZA 4OYRA 3MRXA 3SHQA 1GFZA 1JMYA 4C4AA 4UOQA 2E1RA 3AMVA 1EK2A 4DABA 5LKRA 3NEJA 3IPAA 3R0VA 4TMWA 4OI0A 4MPRA 1OC4A 3WYFA 1KKLA 3DD1A 2HCFA 1XEXA 3JQ7B 3ORSA 1TEZA 3GJ3A 2PWAA 4F46A 1MO3A 3CYFA 3VJMA 4QVGA 3CWZA 1GA6A 1VHDA 3BH6A 1UMKA 1BQEA 4AMGA 1O87A 1QWOA 2PIDA 4Y2RA 3LG2A 2L0XA 3F46A 4R1LA 1IHDA 2J6HA 3E3AA 4FIDA 1OGYA 3HGTA 4PR0A 3KV1A 1VP3A 3PL5A 5DXFA 4LBZA 2MR5A 1CNFA 3TLEA 4ZGWA 1JHDA 2HF9A 1NBMD 1RPTA 2BRUA 1CUCA 5G0VA 2IZOA 2FFRA 5BN3B 4EEKA 2BDTA 3I04A 5BN5B 3VJLA 3L43A 3OE7D 5HS6A 5CCDA 4EATA 2DKFA 4OJNA 3ZWXA 3ISVA 4OYYA 5ALZA 4YJ3B 3G2QA 5LU8A 2PLNA 2A0UA 2SICE 2ZSKA 3M2TA 4LMAA 4BMVA 2KB0A 3QELB 2IS1A 2OB2A 3HXTA 3NGMA 1W88A 3J7TA 3LLVA 2BM1A 3VZSA 3M6UA 2IWRA 2Z2ZA 2PSFA 3BMOA 3EXEB 2OHJA 4LY6A 4J0CA 4MRNA 4JQCA 2OAEA 1W0JA 3H18A 2OCXA 4AMZA 4F3NA 3ZWQA 4WY8A 1U8AA 2HLPA 3H86A 3MERA 2EYUA 4Q4JA 1I10A 1PNRA 3GRYA 3PDUA 1VLQA 3AQIA 2J5BA 5DBOA 1MTOA 1NR7A 3DG9A 5ALXA 2HT1A 3K6SB 1EE2A 4Q6BA 3LBFA 1F7VA 2YWRA 2ZJ0A 3V4PB 1UKCA 1XEWY 1JYSA 3AWIA 3SHOA 2IZ7A 2R6AA 5LQNA 4REQB 4H7EA 4ZCRA 2VP9A 2EEPA 3VDXA 4B82A 4IH4A 3AZOA 3P94A 5LA6F 1AUQA 5CXXA 3PFHA 4ECEA 3D64A 4TSFD 3QKSA 5CEJA 1XEAA 3EIWA 4M7WA 4WASA 3LM8A 4PBTA 4UAVA 3KIPA 5DGCA 3H6GA 4QT0A 3RASA 5CH8A 3HLYA 1PJ2A 1F6BA 1NG1A 1WMEA 4HX2A 2BN4A 1KS2A 4IHKA 3HYRA 4PLTA 4H7DA 2C7RA 1U2PA 3BMXA 1FP2A 4WVLA 1LC3A 1BOOA 3WLJA 1RLUA 4CR8A 3BWXA 3I3SR 5BV8A 1R10A 3AILA 3ANMA 1OE0A 4IYJA 4QPNA 1MJHA 1Q6YA 3PC8C 3WKEA 1TJ3A 3DZIA 3DS8A 4LCEA 4BP3A 4YR7A 5AVUA 4MH0R 1J97A 2NYRA 1BJTA 1AZSC 3RLIA 4AP6A 4EVIA 4X65B 4DPLA 2XXAB 1KU0A 1W5TA 2ZI4A 1JVSA 1PHRA 2EGGA 4ZQCB 5C7IO 4C3OB 2FX5A 1GQQA 3F0TA 5TVKA 1ZIXA 2ORWA 4CDNA 1FUIA 5GONB 2WHXA 3W9UA 1QFMA 4M9RA 2XYRA 1NN5A 4IDHA 2QD2A 1ZI6A 2IE8A 2PL9A 2QAGB 2LCQA 3W8EA 2VSFA 3F3YA 3ZV3A 1N1EA 4JSTA 2DULA 3K16A 4KQFA 1F2TA 5TEVA 1GZDA 3R5JA 1MLDA 3AFMA 1F8UA 4MPPA 2QMHA 1RKXA 3CBGA 4F2GA 1E9RA 1YONA 2J1LA 1OGJA 1KY5A 1VFPA 5KCMA 1HL7A 2IJGX 2IHBA 1XZNA 2W37A 1MFZA 3HI4A 3IO5A 2AW3A 1Y9JA 5KU7A 1USGA 5CGQB 4CN9A 2PQ6A 3IJRA 3SD7A 2L19A 2FETA 4LK2A 1ZCZA 3M5CA 1W96A 3IP3A 4YMHA 1EX9A 1EWVA 2D1RA 2XTAA 3E9EA 1HZZC 4IZHA 4W8HA 2A1TR 3L6RA 4LWQA 3KBOA 5TS2A 1XPJA 4KVGA 2M6KA 3JYNA 1U5AA 4QQFA 2F1HA 4ARVA 4ND4A 4R9SA 4F9FA 4G37A 4B43A 4KKVA 4OK5A 4CM4A 3ZK8A 1BTOA 3DL7A 4N48A 1HDCA 2PJRA 1OTXA 1COWA 5HJ7A 2ZANA 1NA5A 1TM2A 1ABFA 1ABEA 3L0YA 5JAZA 2ONYA 1J7JA 1OYOA 1U7PA 4L7VA 3BMCB 5G4LA 4F6RB 2W2KB 3FVWA 1EEXB 3CGGA 3PDCA 3SYTA 4AY5A 4F04A 3D6NB 1GUYA 1R4AA 4NBRA 4RS3A 5LP6F 1Y6ZA 4DM7A 1RZVA 4FR2A 2IPXA 1V8DA 4WXMA 1ULUA 1XMQB 4K9LA 2RHJA 5B55A 5CLLA 1YBMA 4QECA 3VR4D 2AZ4A 1RYYA 3UJCA 1JAYA 4W5JA 1HMPA 3ASYA 2Y05A 2EFHB 3IH5A 4OLAA 2JFUA 2OLEA 3A9TA 4RHCA 4D43A 3K1YA 3AG6A 3NVMB 4L8FA 1E1RA 4AY4A 3AVOA 1RU3A 4ZU1X 3V9AA 4C4PA 4CKEB 2J4FA 4DR1B 1NG9A 2OQVA 1PP4A 1JHUA 1WUKS 2ZBQA 3SJZA 5IFKA 4TWZA 1RIFA 1SY7A 4A2QA 3G2MA 3H2HA 1SIUA 2W58A 2BI8A 1QB7A 4LXIA 3A1CA 4ESEA 3UUEA 1NR5A 4FT4A 4B34A 3H83A 5IAEA 4KBFA 5CDHA 4OHBA 3A3NA 4X1YA 4OJQA 5ECGC 1SHZA 2J7KA 1C9DB 4ACBA 5KOYA 1TFUA 2O5CA 1EA7A 3QVSA 2CK3A 1C4WA 3L4JA 4OTZA 5GOTA 2C94A 1G8HA 1XLTC 2JCYA 5BWCA 2AC4A 3RSFA 1F51E 4WBXC 3T7SA 5BURA 1W88B 2JRCA 3HN6A 1VZ2A 2X1VA 4Q9IA 4YC7A 3IT1A 3BMOB 4G4IA 4LTDA 3UATA 1CZRA 4CCSA 1OZHA 2V98A 2Z2IA 3RI3A 1UIRA 2P5SA 4S1OA 1TCBA 1QQ6A 2WW8A 3LXXA 4Q4JB 4AMUA 4ZVTA 1EHIA 4YONB 3C6YA 4H27A 4MZDA 3KHTA 1C7IA 2G5TA 4YXWA 4EF5A 3OZIA 3C7TA 3P7MA 1EM6A 3U3OA 4BLSA 1OB2A 1JEQA 1XRNA 3KZMA 1QPBA 4LZOA 1KTIA 1Z18A 4MPJA 4DT1A 2F3TA 1CUVA 5T64A 4CL0A 2FDXA 1YZFA 4GUDA 2BY4A 5AOAA 3DVAA 2NUTA 4OHRA 1MKYA 2O7QA 1LI7A 4WKPA 3ENNA 5KKNB 1MV5A 2HJVA 2C7VA 2I62A 3QKSB 1RXEA 2ZUSA 2FN3A 1X0VA 3LA8A 3DPSA 3F9IA 3FOZA 3RUDA 2QPAA 4DKXA 1PNTA 1MIHA 1IBCA 1QCZA 4V24A 4WUTA 1ZP6A 1FYXA 3GG2A 4YMVA 1PT8A 2H52A 3THOA 4BJHB 2JB9A 4WRRA 1ZSNA 3JZIA 1KK0A 1Z6ZA 3ND6A 1VDZA 4KAAA 3LY7A 2KHZA 2CXNA 3PEVA 3KPYA 1Z9BA 3ZDEA 3OTOB 4EG1A 2VCEA 3IODA 2M98A 2ZITA 3CUEF 3NM6B 4HH1A 4RK7A 5JYDA 3RTCA 2EKPA 2VQ3A 2QTWB 2XQKA 3GY0A 4X91A 5JATA 1CPYA 2QT9A 5IKXA 3AI1A 1FC0A 1VB3A 2NTJA 3LY5A 4TLBA 2DCMA 5JWRA 3JAWA 2BELA 4UMFA 3TZKA 4EW3A 5G53C 3NDBB 4DL9A 1W4LA 2PWBA 3MWJA 1ST3A 1BROA 4YJKA 3D3JA 2JI9A 5CJ2A 2F17A 1NYTA 1F2TB 3CH4B 4AMYA 4IWXA 4R98A 1DRVA 1K9SA 2ZZMA 3C2QA 4O1HA 5KSOA 2F1IA 4D44A 4R1SA 3VVCA 2WSSD 2R68A 1U1CA 3LP6A 1CY6A 2R8PA 1N32B 1USWA 2IDZA 2VI5A 4PF1A 2AR0A 2HK9A 1H6AA 4FK8A 4AJNA 5B6IA 4FFDA 3DD5A 4PZEA 1JVBA 4XYBA 2BCEA 4JVMA 1QIHA 3BXEA 3ZTYA 5IG2A 3THWB 3WYBA 1KQOA 3C4VA 1U6IA 4RU1A 4NULA 3CWCA 1XV5A 3GLUA 4IJVA 5K4GA 4PLVA 4HRYA 4JASB 1RI3A 5PGMA 3QU2A 1IZ0A 1V37A 2QTNA 4HWKA 3A2NA 1TZCA 1JILA 3AJ8A 1GSAA 2VAXA 1F9EA 3T7EA 3TL6A 1IEWA 1JE1A 3FRJA 4HEQA 3RT1A 1E59A 1T8PA 4FW8A 3DOOA 2NXNA 2YH2A 2E5FA 1SKMA 2VUUA 4NHEA 4B7AA 2FSVA 4P9NA 1K6MA 2ZT6A 2NSDA 1E2NA 3RUCA 5JPCA 1MJGA 4CR7A 1KI1A 4U0KA 4INOA 1L3BA 2YV5A 1T2VA 3DMTC 4YS6A 3K1AA 4BLOA 5ADWA 4UUAA 2XYPA 1JG1A 2PUAA 2VSQA 4GWGA 3AF3A 4OAQA 2F1JA 5SY4A 2EKQA 4B6RA 2X3YA 5CJJA 3PDJA 2X3FA 2FX2A 3IAM1 4W7HA 5FULA 1LJLA 1FFDA 2BGKA 2D7CA 3DR3A 5CRIA 5CXQA 4JCCA 4J4TA 4CHTA 1HDXA 2IUFA 3VM6A 1DKUA 4FB4A 2H63A 4O2RA 2DQZA 3I83A 4P33A 3EH1A 3WK4A 5BYJA 4NONA 1IULA 1OKKD 3QBDA 5CX4A 1H4TA 1KYWA 3EXIA 1M7HA 3BGIA 4YCCA 4ZEMA 4NMLA 2C78A 1Z8FA 1O0CA 3NM4A 4UD6A 4OSOA 1QUEA 3C74A 3VR2A 2BKEA 2A9VA 1K8XB 2CE2X 1G5HA 1QGUB 1UKYA 1WPXA 2FZWA 2J3IA 2V55B 3DBRA 3H2GA 2FFAA 2VJKA 3TOXA 2QL6A 3FR7A 4Y6QA 1P62B 1Q20A 4TYQA 3TOSA 4JC5A 3X1KA 1IDOA 4MW5A 3JD1A 4UZEA 2DFVA 2X6QA 4X1YB 2O8CA 2EHJA 3CSUA 1ULHA 3RSHA 3TIIA 3VOSA 1R5JA 2VPXA 3LC2O 3IPRA 2SBTA 1XIVA 3ZCTA 4KN9S 4UOZA 5EXDA 1OROA 5BVHA 1JSZA 1DIAA 2JHFA 3DAOA 1NSYA 3OU7A 4HYYA 1E7YA 4EBFA 5LR6A 1WXXA 4GX2A 2A9FA 4HYTA 1MEJA 3I8OA 2FQWA 2GBLA 4MVCA 3VNUA 2B92A 4JL8A 3SQOA 1TU0A 5DYNA 1FXUA 1Y6FA 3I09A 5DI3A 1PR9A 3RABA 4Q4HA 3X1XA 3GNLA 3ZX4A 3QEOA 6AT1A 4MV5A 1G8KA 1B8VA 1JEQB 2Z8YA 1SCDA 4ARBA 4Q4CA 5IM4A 1XD8A 5HIAA 5DWQA 5FOTA 3ENZA 4NBVA 2J31A 5TPZA 1CX9B 1Y9ZA 1OXMA 2JIRA 3KKZA 5EP1A 3EARA 3QPCA 1UFVA 1XTUA 3DVAB 3AUTA 2NUTB 5DTIA 5F51A 4GYKA 4BE9A 1HZJA 2HSGA 2WWGA 3V33A 2ZUEA 2JJ8A 3H3XA 4RDCA 3JQFA 1XD9A 4NESA 3RYFA 1KA9H 1PTJA 4MVJD 3TLYA 1B2RA 3VSAA 4BO9A 4ZYLA 3SIPA 5KWEA 3I6QA 3O83A 4PCUA 5EXXA 3SDSA 4HEA1 3A70A 4RS4A 3U4GA 2CZGA 3IB6A 3OTIA 1YI1A 4RTJA 2HMYB 4X94A 2XX3A 2F3QA 1QJCA 2PUEA 3GCXA 1FDRA 2VTBA 4TYWA 4L76A 4DWWA 2ZU6A 3T3EA 1TTHA 3OCWA 4BHTA 3KDAA 5KNCH 1K7FB 1PI3A 1ZM2A 3LPDA 5AXCA 3RS2A 4JBGA 3W77A 1UKZA 1Y3AA 3F7MA 1L5ZA 1R6VA 1T3SA 1XZEA 2PX6A 1T9ZA 1U9ZA 1ZWKA 3GHYA 3R6GA 4YJ2F 1W19A 3U0VA 1G3UA 2HNAA 4G4JA 2F1RA 3WAKA 1D09A 2IXTA 3O9ZA 2OMKA 3OX3A 1XZQA 4IOJA 3USZA 3JAWB 2E4ZA 4X85A 2C7PA 5ADVA 1IHPA 2O07A 4E5YA 5IKPA 2XW6A 3VR0A 4O29A 3P52A 2B4AA 1M2JA 1D04A 1RFLA 4TS9A 2JBAA 2VT6A 5C51B 4RKQA 2JHAA 4GLOA 2PG3A 1SUAA 3KR0A 3TSZA 4CVNA 3OKFA 3GAAA 4EK9A 1XJQA 4P7FA 4AB1A 2H7YA 2WHPA 1NASA 3KRTA 4ID3A 1II8A 2DQYA 4KPEC 2TS1A 4BTVA 4II7A 1W0CA 2FWMX 3WQQA 4DDUA 1TC2A 4XEHA 4BJ6A 2YIVX 3FUXA 1Y7IA 2Q3MA 4ZU6X 1Z2PX 2ZRNA 3KBBA 4IRMA 2ZDQA 3E03A 5KJEA 1Q3KA 1BHSA 4QAQA 4K9NA 4C6TA 4QT4A 5KNBH 3C5VA 1CUDA 3P2EA 4R2JA 1WW2A 1FVXA 2FP4A 1WF3A 3O31A 1Y6JA 4I1IA 5DTMA 5JDCC 1E9CA 5CB0A 2ZJ7A 4PIPA 1RC8A 5DN9A 2IS2A 4R05A 4DILA 3DP7A 1O9HA 4TZKA 4KR2A 5GOZA 2F7SA 4G5QA 4RV4A 3QF4A 4UEOA 1J2JA 1JV2B 3ESYA 4NABA 2HMTA 4NKRA 1JWBB 3FH0A 1YL5A 4QQKA 2YV3A 1GPWB 3GRCA 4AKHA 3WA6A 1JAHA 1JKMA 1QRSA 1U0BB 3WWOA 4P53A 3PT9A 3ADPA 2P0EA 1V5IA 5FBLB 2CXHA 3QU7A 4YB8A 3LZCA 4FC7A 2C2MA 2DKOA 2GR9A 2AZMA 3AUKA 3NRCA 5TGDA 5THQA 3RT9A 1KI3A 3FTDA 3TEMA 4P81A 3V8VA 1KK3A 3ZJ4A 3ZGNA 4UTPA 1UXGA 1WVIA 1OAKA 5LD2C 1JNYA 2Z5FA 5HCUA 1O1YA 3L4KA 4LJ5A 3KHSA 1QTQA 2QIPA 2BE7A 1L8LA 2P8SA 2G9ZA 2HREA 4DLTA 3H2SA 2H4WA 3K5PA 3MTDA 1E2MA 2DQKA 1ICIA 3EXIB 3H0EA 5IBQA 5A4MS 4BWYA 1O4WA 2OHHA 2DERA 1Q5PA 1J49A 2IGBA 1QVRA 4FWTA 4A2WA 3UGKA 1U0NA 2DBRA 2N42A 3QMMA 4C0LA 1XU4A 1X7WA 4FDTA 5FJJA 8GPBA 2QX8A 4H7KA 2ZWIA 4NDAA 4P4SA 2OSBA 4KPYA 1PL0A 1J00A 4MEJA 3C16C 1FP4B 1VB5A 2CFSA 1WMDA 2B61A 3EULA 2C9CA 5EJIA 3NTQA 2XEDA 2O8CB 4B3HA 1BE8A 1R9GA 2K2WA 3NCHA 4V03A 4R8MA 1EDOA 2Y1EA 5FR1A 1DCFA 4G1VA 2D1SA 3NYRA 4GZ3A 4P84A 1UF9A 3ESAA 4DADA 4ZJYA 4B44A 2E89A 2EKBA 3NYIA 2I3DA 2Z1MA 5BVHB 1LDMA 3PYMA 3L1UA 2FOXA 4UXIA 1GZ6A 2VRWA 1GDDA 1GPNA 3CIOA 4A8JA 2Q3EA 3GQBA 2P3OA 4N82A 3H7IA 3Q9SA 4PPNA 5DI3B 1J7KA 1KRHA 4PSUA 4Q4HB 2IV3A 3TI7A 2P3SA 3NHFA 2JRLA 4FEAA 2ABWA 2Y1GA 2EJVA 3TMAA 3D8UA 4MS1A 4Y7DA 4P3XA 4TLDA 2QLJA 2QR3A 2VSYA 4I5EA 4KYUA 5LWQA 1WF6A 2QPOA 1JT9A 1FU8A 1QVVA 3RREA 3G88A 1E98A 4I55F 5BOVA 4DV2B 3SBXA 2C4WA 3DHEA 2I3BA 1DWPA 4YRCA 4HGQA 3ZBPA 1X86B 3SY8A 1RTTA 4R3UC 2VPIA 5G02A 5SYMA 1ZXLA 1G64A 3ON5A 4MKRA 3UENA 1P4SA 4C0XA 1RABA 3E5MA 3DLHA 3ZIAD 4GOOD 4RMIA 3I62A 4K40A 2PEYA 4WNAA 2ZZNA 1ZW6A 3C5CA 3GVHA 1XA0A 3W7AA 1F0PA 2JDID 4UOEA 3NTRA 2IHKA 4MNTA 3IQFA 1X1CA 2PSSA 1B0ZA 1QLHA 4QFBA 3ANTA 1NVXQ 2VTBB 4AS2A 1L8AA 1UL1X 3WP0A 2LBPA 1N25A 2MSWA 5IU6A 1T1SA 3G23A 4HVTA 2YYZA 4JT8A 4MA0A 1REQB 3IKVA 4FWBA 1O6CA 3W3AD 4DIFA 4RK5A 5BYAA 3J81k 1D1SA 4XXHA 4JQSA 4G5FA 5KOIA 1EU1A 3DKVA 3FETA 3IR5A 4FQ7A 2XUQA 4KPUA 4X95A 2EQBA 4R4JA 2G06A 1Q7EA 2C5FA 3IO3A 4IQ0A 1KR5A 4NECA 1N8TA 3GMTA 5HEKA 2PXXA 4N5IX 3EQ8A 2JAUA 4OU4A 4NF2A 4RIIA 4FNMA 4C5CA 2JBAB 4FM9A 1YRBA 3AR3A 4DV1B 1DADA 2R5FA 2AXPA 4PSAA 2BR3A 3DH0A 1UOOA 4ARZA 1JG7A 5SYNA 1II8B 2OUKA 3GMDA 1LI4A 3RYHB 1JIXA 3KVNA 1BX1A 2J87A 2YWEA 3MINA 2QW0X 2XUDA 3HY3A 5JNLA 1TU4A 1G291 4RVUA 1A9PA 4C6TB 3NUGA 3MEQA 1H8ED 5KDLA 2RHRA 1YMQA 2NSLA 4M46A 4B6SA 4TMXA 4W1QA 2RSLA 1KPHA 2FP4B 2NZXA 2O06A 3ICPA 5FFNA 3U4AA 1SJ9A 5CT6A 3ODPA 2QUHA 4NBTA 3C87A 4B2LA 2FN9A 4RZSA 4OJKA 2H92A 5L3QA 1PUXA 2LNDA 3VH4A 2QX4A 3GJ5A 3B82A 2XNCA 1W4ZA 3SQNA 2MMCA 3ZKAA 1ZUHA 2GRAA 4RULA 3R9XB 1YIOA 2NXEA 3QU9A 2JFXA 1E4VA 5DRYA 4CCYA 4JDPA 1UQRA 2W00A 1YDMA 2ONJA 3O9MA 5FBRB 3OE7A 1E69A 3U4HA 1BOFA 4KQ1A 3GFVA 3ENVA 3GC6A 4GBJA 3TEJA 3A1VA 4NFHA 4AROA 4UQLA 3R3VA 1Q1NA 5HUJA 3N3AC 3NO4A 1SXJE 3OQOA 1XRSB 1U94A 2F3SA 2XA1A 2D2FA 1RYNA 2VVTA 2QQEA 4WBSA 5DCYA 1DC7A 1CY1A 3FYHA 1C0LA 1WP4A 4K3VA 4O2LA 1X2EA 2HJGA 3B9PA 3OM1A 1CB7A 3F6SA 4X8LA 4PAMA 3QSGA 1PE0A 1UZMA 3ZCVA 1SN7A 4D8TA 4F2PA 2G7ZA 3OQJA 5DX8A 2AC2A 4Y2HA 4B8YA 4EKYA 4L4SA 3KUDA 5TF0A 4N8EA 4AF7A 4DBLE 2WF5A 3KT6A 4JFAA 2JBHA 2Y0DA 1N2IA 3VR5D 1X7WB 1YA6A 3KUXA 3O3CA 4NZMA 5M3BA 3FIUA 2MSDB 4P4SB 2EC5A 2R65A 1N5KA 2WZDA 3WBJA 3WAJA 3RB8A 4OCZA 4INJA 1N6KA 2ILTA 1WS6A 2ZRKA 1YS2X 3L4SO 4I9NA 2RH5A 4HQ6A 2I03A 5B3JC 3UKOA 1JHQA 3KQNA 1DAEA 5B64A 3M83A 2X22A 4RZ3A 4BV2A 3ZWCA 4EX7A 4LYJA 3NWEA 5TE9A 1RJ9A 5DGTA 5E7JA 1TIBA 4DR5B 3FPGA 3LE8A 1QHXA 2JGLA 3HCPA 4K8OA 4QNRA 1GPMA 2NU6A 4BO8A 3A6JA 4A8JB 3GQBB 3DTNA 1YDHA 2I6QA 3HEAA 3ROKA 1E1LA 1B93A 1Q95A 1U8TA 2N9UA 1QZUA 3EZXA 1OC2A 3Q98A 1XEFA 4QOSA 1ZD3A 1I4DD 3OAAD 3S68A 3KJXA 4LF5B 3PDIA 5EZQA 1FU4A 5CG2A 2ZR0A 4E30A 3W5SA 2NV6A 4I0WB 4KX5A 3RS3A 3G2NA 3UPUA 1Z5GA 4B6QA 1U2GA 5ESWA 1Q7CA 4LRTB 4A03A 1HPLA 1EINA 1QH9A 2SKEA 4XWOA 2I2XB 4IMRA 2KM1A 4KWIA 3CG4A 4LCBA 1CJUC 2AD5A 2W2MA 4JP8A 1KKMA 2HA4A 3MTIA 5EQFA 1HNNA 3GW8A 4GSLA 4UAUA 3FKQA 5AYVA 3K3PA 3UC9A 5JEEA 1NJFA 1FZTA 2QENA 2BFWA 1HNXB 1E1QD 4UZSA 1C2TA 3DE4X 1ZRNA 3JRNA 4WNAB 4B33A 4YUXA 5T4HA 3WY9A 1NHGA 2BI4A 5GWXA 3T7JA 2QP4A 3MAGA 3UTCA 2R44A 2I6UA 2GLTA 3Q3GE 4PO8A 4WBNF 1HGXA 1NP7A 2IDJA 3CISA 3O2QB 3UXHA 1SD2A 4PNHA 2AUMA 2BHSA 2VK8A 3ZNNA 4WW0A 2JK1A 2ZE7A 2CNLA 3UT5A 2ZS9A 2QE7D 3K8QA 3RQSA 3O8QA 2O59A 3TTSA 3OEED 3HADA 1N0HA 1GG8A 2HPHA 2O2ZA 4RZXA 5DT9A 3T0FA 1HBJA 1DMRA 4JJ4A 3TQCA 1Y4ZA 4KPUB 3VISA 5ITWA 5CIQA 3HXQA 4TLLB 1G7RA 5COBA 4ZU3A 4B3RB 1PSWA 1PBTA 1XNGA 1H9BA 4R1PA 1NKSA 1ZCFA 3KZXA 3BN3A 1HFEL 1SUPA 3OQIA 2ID4A 3EZYA 3RARA 4Q03A 4IIJB 3EBOA 1K4YA 4DZTA 2OPBA 1SCAA 4F06A 2VWQA 2RK3A 1NYRA 2GMWA 1KZ7B 4MB6A 4ARZB 2P2YA 2BLLA 3FW1A 3VNRA 4TTTS 4KVZA 4DTIA 4WLEA 4YCMA 5JXGA 4OP3A 4CYMA 4E1BA 1L5GB 5A3RA 1SUIA 1ZESA 3WMRA 2C3PA 2VOEA 4ZVMA 3MINB 5AW5A 2CL0X 2IGTA 2I78A 4OHZA 3H13A 3VR4A 2H1HA 2BW0A 2PVSA 2C5GA 4DCSA 3B3FA 3T1HB 1OR8A 4N3CA 4Q3EA 3UYLA 3VU3A 4C03A 3FNFA 3A1WA 2Y0CA 5JHHB 2AJTA 2O2XA 3FNHA 3BXOA 4GOJA 3A2MA 3MJTA 3WGOA 4KR7A 1DU4A 5K0LA 3VNAA 4U8HA 1AA9A 3ER8A 1IBRA 5BQFA 3WBKA 3VNSA 4K6KA 2F55A 3M4YA 1COZA 4K9MA 1FJGB 2CEKA 2QTHA 3G9UA 4MICA 1P4JA 1SOMA 4REOA 3X2SA 5L3QB 4R83A 1HRKA 2W6JD 1QBGA 4L5BA 2QY6A 4A2CA 3DAHA 5AQEA 2H5JA 1N2SA 4J4HA 3FUCA 3OT1A 1EVYA 4Z86A 3VO2A 1UODA 2QW8A 4D82A 1E6WA 3IKLA 2O2GA 4JITA 2RGGA 2V0CA 3GRVA 1P1IA 3FPJA 4Z7NB 2NT4A 2HMSA 5B4UA 4O4HA 4D9JA 4UE6A 2PKCA 1P75A 3AJEA 1DTEA 3WGTA 2Q5EA 4MI3A 5DKFA 1H3NA 2JD2A 4HLNA 4TL7A 4ZJZA 4QSHA 1LW6E 2PS3A 3KU1A 1FRNA 4ZI7A 2BZ1A 3I01M 5CT5A 3VXKA 2I33A 1FQWA 3JYHA 4CM9D 1P17A 3KQHA 1IHYA 2IPAB 4CEHA 3X0DA 3H0KA 4WECA 1OPXA 1WKCA 1VFNA 1ZCAA 4BQSA 1EFKA 5SYAA 3K09C 4OJYA 1E3DA 2VNSA 1GT91 2Z95A 3BDVA 3EZ2A 2ZJ1A 3CKMA 4EGCB 1R9JA 2AN1A 4Z6KA 4F3RA 3O47A 4GC9A 1T6XA 3GOHA 1RNLA 3QOXA 4TKUA 3PWKA 3ZYCA 4IMPA 2SNIE 3ROFA 1NWCA 4MZXA 3C3BA 2Z3VA 4FSDA 1EX1A 3ONFA 4DEYA 1BEEA 1A9QA 4I1SA 4P34A 1ZXBA 3L5OA 4R7ZA 3WYGA 1Q12A 4BCBA 1JFSA 5B12A 2XQGA 1KI7A 1X70A 4L0MA 2QJRA 4BQFA 1M2WA 1Z07A 2A94A 5HR5A 5I47A 1K92A 2WTMA 4JYBA 4LJYA 4P4UA 4RGQA 3JS5A 2POCA 3QWFA 3D2AA 4CMEA 3UIEA 3X1JA 3GBPA 3ECSA 2FJPA 1DBQA 1BQ4A 3L84A 5A0FA 3AVYA 2BFMA 4Y9SA 3L8YA 1RJ9B 4IIUA 4CT0A 3WL8A 4V2UA 1MVOA 2WYUA 1WD5A 1M76A 3WB2A 4LNHA 2NU6B 1L8OA 1X7DA 4XAQA 5FA5A 4AM8A 2WPDA 1GPDG 4ZTBA 1X39A 4DSAA 4A0RA 5CB6A 1TAGA 1B6RA 1Y1SA 4JLDA 3UT0A 1JKJB 1X1EA 3R3SA 4S24A 2EDCA 2H11A 2OV3A 1YQUA 3H2BA 2GDJA 4RKEA 1EAMA 1ZINA 2IYWA 2UXDB 3T4EA 3PDIB 2IA5A 2UZAA 4QTZA 4JT9A 2A58A 4IDFA 4YRJA 3ZTTA 3WO0A 3ORYA 3SC6A 1R00A 3W2FA 5DCUA 3AR2A 5F35A 5A03A 5A5GA 4P4NA 3ZCQA 1H9AA 3KYIB 4YCAA 2PKRA 3EXG2 4YA6A 3CT6A 2Q6VA 1ZNXA 3ZQJA 1XBTA 3BWDD 4EW6A 4MA5A 5BNTA 5C1OA 3DPIA 4YUAA 4XPZA 1S7CA 5ELLA 2W2LA 1AHIA 1XB2A 4PZDA 1BFUA 1Y0BA 3RC7A 1SUBA 1FB5A 1L4LA 2WSSA 3EEQA 3LOQA 1I1OA 4KFSA 3RVSA 3RSOA 4URYR 2WJIA 3IT0A 2NUBA 3STVA 4E5NA 4MRMA 2CXTA 1PK8A 3LQ1A 4PYMA 2QVLA 2IITA 1FBNA 3BCSA 1BE6A 3D54D 4P3YA 1JT2A 5JJLA 2Q8QA 4QJ3A 1YVDA 3ZXSA 2OORC 4GR4A 4AS3A 4XR4A 1Z7BA 3MWKA 1QHNA 3OLQA 4YBZA 3U2QA 1U0JA 3M6XA 3A8TA 5J63A 1V8PA 3VZPA 4OBBA 3OTGA 1YACA 2P6RA 2H1RA 1R4ZA 1H66A 3EMKA 4HQOA 4J1TC 4WFJA 5SZHB 3IGFA 3SSNA 3V6MA 2YHUA 4C4YA 1JHRA 2B8TA 2C1ZA 4OAPA 5TQ0A 4TM8A 4YDQA 4E08A 2VNIA 1P5HA 4YRZA 2WRZA 2ZWVA 3C1AA 4NL4H 3SS7X 3GDHA 5LB2A 3KKOA 4QJ4A 2XT9A 1VCMA 1HL3A 1HT3A 3VJKA 2DFDA 4IOKA 4IHJA 3ZNPA 1X9IA 1ZFNA 1FFHA 5A2QA 1XJ5A 1YGPA 2CDAA 1Q15A 4JKIA 1J24A 1EDDA 2OAQ1 2WU0A 1NRWA 1U7UA 2Q1YA 4E5SA 5CX1A 3CS3A 2JIOA 2Q5HA 4TXLA 2FUNB 4H1WA 4XRRA 2IQIA 2ALJA 3AIKA 3D7KA 3H2ZA 1QV6A 4V39A 1IU9A 1BO6A 1NLMA 5FI3A 4ZP1A 4YQFA 2FB9A 4HLUA 5C34B 2HI0A 2OQ2A 3M89A 4PNEA 3R4VA 1J9EA 2IXGA 4ZT4A 1OKKA 2CYAA 4PPFA 5I9BA 2HSEA 3IOMA 4B75A 2JLAA 2FPIA 1K27A 1EGAA 1AV7A 1LBTA 3AC0A 3JVUA 3N8NA 4JQZA 5IJXA 2WDZA 4ED9A 3CTPA 4KQJA 4XDZA 2O3JA 3BHMA 3RG8A 4Z0HO 2Z6AA 1U3DA 3L6BA 3IPLA 1A71A 4UCXA 2XRZA 3RSCA 5CFQA 2GZSA 1NQAO 1NLYA 1MORA 4DJTA 5F7OA 2P65A 3FA2A 1YJQA 5EMHA 4RF4A 1U0FA 1YQQA 4FPXA 3ZHRA 4EPTA 3NEYA 2XT0A 3OZSA 4J6EA 4PX2A 4C1NA 1F4VA 1P2SA 1DEHA 4O63O 2DR2A 1ZH2A 4O4HB 4OLFA 1FNNA 3EK2A 1NU6A 3V4FA 2WKPA 2QTRA 1NKTA 3AI2A 2XBMA 3STXA 1CQIB 4QQRA 3D2BA 3TYXA 5JAQA 2XGMA 4ZI7B 1BC5A 1NRXA 2D1TA 3ZK9A 1KZ9A 3NDPA 2I2CA 1TW3A 4D26A 1ZVJA 3QKIA 3HY6A 2OHOA 1C3JA 4BMNA 1WO8A 2O9JA 5DMHA 3N2GA 4GKBA 4KHPB 4DUGD 4QNMA 1VKZA 3PXXA 1N3BA 5CM2Z 2PWPA 2RHGB 1Z34A 2Y77A 1I2MA 1DTSA 1VI6A 4OXRA 4JI6B 4TKUB 1QU2A 4JBWA 4B76A 1EK5A 1E64A 2GB4A 1B8NA 2MU1A 3ODGA 4KYIB 1XMXA 2VHJA 1SZCA 1EZ4A 1HEYA 2CXXA 2EFDB 3EUWA 4LJKA 3SYNA 4MYDA 4NNOA 3JALA 1MPXA 4FINA 4B3IA 2ZPTX 4DNOA 3EAGA 3FM9A 4KCGA 4XLLA 1VPWA 3SI7A 1DOHA 1C0KA 2DM6A 1OY1A 2Q3LA 2VWGA 1OFHA 1SC6A 2GZHA 2Y99A 3NB0A 4K7JA 4OGGA 5AM5A 1N2EA 5FPQA 5KQLA 5JD5A 2GFQA 2HCJB 4PYIA 1IC6A 1G41A 1V4VA 1VOTA 2FH5B 5EUMA 4DBZA 2F6RA 4ARAA 5CB4F 1BH2A 4EB8A 1AXRA 4KP7A 3OPQA 1P9LA 2NVBA 4ZOCA 3NWJA 3OSUA 5BSTA 3UCFA 4RTMA 2ACWA 1R0XA 2AVNA 1GAXA 1JL3A 1XJWA 4X1KA 1U1IA 3QXGA 5DOVA 5A9TA 4QHSA 5EVCA 3ASZA 1MO6A 2FKAA 2ZBVA 1IEQA 3L1VA 4IX1A 4YCJA 4TN5A 2Q7XA 4WCFB 5E9WA 3UAVA 3UPDA 7GPBA 1A5ZA 2B5OA 2C97A 1ZUNA 3A0UA 2QUKA 3MMSA 1X14A 2E4XA 4TVSA 4L15A 4DREA 3GARA 2EVWX 4HVCA 1E7RA 5E1MA 1NVTA 1MX1A 4XASA 1YS1X 3PJGA 4IUDS 2GX6A 4WADA 5GTDA 5JNSA 3TNDA 3G6WA 4XR9A 2HRQA 1RWBA 2D8AA 1OFGA 3O0TA 4JEIA 3X44A 1G5IA 4CMGA 3ES9A 4TKZA 5E7MA 2AC7A 4C4SA 3FCEA 4Z0NA 3TDNA 1WETA 3AIIA 3MWDA 4OSPA 4MRMB 4BV8A 4D5GA 1Z28A 1ZJ6A 3FAZA 2AFHA 4WZAA 3R44A 4LGMA 2ATVA 3WLOA 3SJUA 1QH8A 4QLBA 1G16A 5BT8A 4BEJA 3T5DA 1KQGA 5HCIA 3MYRA 2D59A 1A1SA 3A9RA 3G7NA 4CL8A 4HXYA 1H5QA 1HE8B 1WPRA 1PR3A 1VRVA 1XEWX 4FHDA 1MPTA 4MUBA 4LPSA 3S7TA 2Q6IA 1EFLA 3ZDAA 2H4HA 3FNEA 1RRGA 1NDUA 3HDJA 3I2YX 4DQDA 3D3KA 5ILGA 2P9TA 1SHTX 4D45A 3R3ZA 4A8PA 5TQ0B 2PRJA 3IE1A 1TCCA 3BPSA 1JJIA 3P27A 1E2JA 2CXQA 3RFTA 5I4CA 2J9YB 2FEXA 5SZKB 4E03A 2WICA 5EOVA 1J39A 2HCTA 2Q28A 3DL2A 4LJ9A 4HDQB 4IHJB 2B5WA 4ZVQA 4GO1A 2DCUA 3KDPA 4DA4A 3RU9A 3QFTA 4OIMA 1DXYA 3SZUA 1QFJA 3D31A 3KQSA 2JFWA 2FEPA 5CX1B 3WLNA 4YLYA 2IBTA 1KQNA 1DAOA 4L28A 2CEAA 4QTTB 4BZWA 4LISA 3H1EA 1YFLA 3QYPA 4P82A 3FFAA 1OTYA 2WSYB 3K2EA 2FOLA 4NPCA 2VCYA 1KK2A 1HYGA 4KUHA 1QHGA 4TMKA 2PH5A 1P4GA 5FORA 5M34A 1RWWA 1L7BA 2O1XA 5AK5A 2FPIB 2F3RA 2A4MA 3BFJA 3KB2A 4MCHA 3TZ6A 3EC2A 1BS1A 3M4XA 4RJTA 4PQEA 1E62A 1BCSA 3T38A 3W2IA 2Q2QA 1D2NA 3Q3CA 4OOFA 3VSBA 1E58A 2V5UA 3KETA 1OXUA 5BSFA 1KI9A 1OGIA 2DYKA 3SJ7A 3CVUA 1ML4A 3O8DA 1Z37A 4P3PA 2HUNA 4KUEA 2YJ4A 5CM8B 2JIBA 1SQ5A 4RQBA 1NKVA 3C8UA 5FPYA 1UKEA 2H7XA 1HDGO 3C3DA 3KYDA 1H3FA 1PK7A 4MRVA 4WOCA 4C0WA 1ZJYA 5K2MA 2FWPA 1T8YA 1WU7A 1DFHA 4MMZB 5CFLA 1S9HA 3O4JA 5LIRA 4B71A 1Q74A 3P8ZA 2WUVA 4UTNA 5EHXA 5C53B 4EY5A 4EHHA 4AJLA 1KH3A 3ECAA 4D57A 3PTZA 1QZTA 4X62B 1R64A 1JDVA 3N2GB 2BF4A 1EFDN 3RVLA 3PU6A 2OFWA 4ALIA 4H59A 3A11A 4D3SA 2O0LA 2WDPA 2YZNA 5J1SB 3ZZNA 2QRVA 1L7DA 4XFDA 2H1WA 3OC0A 2DAPA 3QI7A 1QRAA 2G40A 2ISCA 3W06A 5JMOA 3LBIA 1Y9DA 1JS1X 2J7PA 2YQZA 2ZRJA 2IX3A 3CINA 3V8NA 3FMIA 3CXUA 3REQB 4B6PA 3L6OO 2UUCB 3RH0A 5KJCA 3TSYA 1KF0A 1O2DA 1E3LA 1GRQA 3JALB 4P2GA 3K8OE 1C7QA 4D1YA 3B53X 3H0CA 4R2HA 4TTVA 3K2QA 3ZC3A 3LQQA 1Z2OX 1L1FA 4D99A 3GB9A 5J2TF 5J2UF 2JHCA 1YVUA 4M9ZA 2JDIA 3I01A 4NU6A 4ALLA 3N7UA 3KP1A 4RDHA 4XTCS 1VG0B 2JEYA 1US8A 3BL6A 4QUHA 3ZWYA 1TZKA 4I1RA 1I6LA 3LCMA 2PMFA 4X1KB 3BGOS 2HXYA 4XLZA 2F1KA 1E2GA 2OBFA 3W3AA 2IV7A 3RV4A 3ZPXA 3DZGA 5IK2D 4FEYA 2V3CC 3C85A 3Q11A 3W8DA 3RFFA 1KR2A 1JSRA 1RAFA 1KY4A 1CULC 1KERA 3ZZTA 1ZUNB 3NBXX 5AI6A 1JHYA 3ZYZA 5BYBA 1ORIA 4MUAA 3S2FA 1V1JA 4C07A 3AOEA 3DDWA 4MGHA 3KKPA 4INZA 4DDHA 3MGBA 3ROTA 3TMYA 1P60A 4D2IA 1ZONA 3TNJA 4OI1A 3TRIA 3HR8A 1XDSA 2W6ID 4I3HA 3IOEA 2P0AA 4IV5A 4Y0VA 4Z0PA 1GNTA 4BQQA 5KIAA 5ALWA 3I92A 2GEBA 1T9DA 2BR4A 5HJEA 3MWDB 3PKJA 3DB1A 4IHAA 5B37A 2QRGA 4WZAB 2AFHB 3FUVA 1RBYA 4KK3A 4AUMA 3RVJA 4TROA 4W9RA 4LVCA 3CNNA 2FDRA 2HY7A 3F97A 1Y3IA 2PSEA 2VQSA 2XUAA 4QJ5A 3OIFA 1H8EA 1MP0A 2X9GA 1CF9A 3ECCA 4NOKA 4ITVA 2OUIA 3E2IA 3BGDA 1BQ3A 1NMYA 3WC4A 1E6MA 1GWNA 1H85A 1PJLA 5LU9A 2CVFA 3VHQA 2B8EA 2B4QA 2I1WA 1XCJA 2VAPA 3AEZA 3DLPX 3QE3A 3R6DA 4IIXA 3WR5A 1L2TA 1Y6QA 3A6DA 3V32A 4AZ0A 2FSUA 5JO0A 5K20A 3LHDA 3R75A 4K0KB 5JTUA 3GQVA 4EPXA 4KVFA 4XYLA 5CA1A 4JD5A 2GN6A 3BMQA 4BEWA 1XPRA 3SYMA 4LXQA 3MWEB 1MG5A 3JTEA 3L7BA 4WOJA 5KQPA 3NI2A 1RMYA 3PEEA 5ER6A 3P5BA 4FE4A 4BB5A 1E96A 4HWRA 4IJQA 1GGMA 3MWLA 2EX1A 2X0NA 4IKEA 4IDQA 4FYPA 1XAJA 5E3IA 5DSTA 2PZKA 2C7QA 5KSPA 4B8ZA 2C2XA 2BBOA 3LTEA 1CZOA 2A33A 1DX4A 2RC6A 2OV2A 3OJFA 5LBIA 2CZQA 3EPHA 3CZ4A 2Q0HA 2P6MA 2BMDA 4TVBA 4B85A 4MO2A 1AGNA 2XE7A 2FY8A 1VMKA 3MQFA 1E5TA 1WXDA 4PSVA 3NBMA 5JAIA 5KTPA 3R5KA 1N2GA 2DR0A 2VSXA 3ROQA 3A1NA 4M89A 2VBGA 1ZKDA 3CLHA 3ZHZA 3FFBA 5C0OE 3FJOA 5LOVA 5J47A 3VR5A 1UM8A 1ODTC 4NE9A 1RKVA 1BCSB 1ND5A 2XTZA 2HLDD 3GWZA 3PNBA 2YVUA 4ICIA 3TCNA 5IAAA 4AS1A 4AN4A 1OT3A 3I30X 3MK31 2B8JA 2DR3A 4PO1A 5KVQA 3WLQA 1GDHA 1BHQ1 1ZHOA 2GAIA 2GPSA 3A25A 5JS6A 5KX5A 1F5NA 1UZAA 2B4TO 2WIKA 1UEJA 2Y71A 2FW0A 2QM3A 2DBZA 5EAIA 1HEIA 3P9XA 4DCVA 5CHYA 3KYDB 3WE7A 4A27A 4JJGA 1G7TA 4U2BA 1SWWA 1R0WA 1K2WA 2ZJ4A 3UJPA 4MUGA 3S28A 1X7HA 4QXRA 3BRSA 2Z6VA 4J0EA 4BB6A 5I01A 3RIMA 4QO8A 1SXHA 2UYOA 1T34A 3K9WA 2QT0A 4MRRA 1YBFA 4YP6A 2G0AA 2NSYA 5LQAA 2ZYHA 4WN3A 4EBBA 4QFCA 4DMLA 1ECFA 1JQEA 4N6OA 3UKJA 1RW4A 1QO9A 3G17A 3KQOA 4HN9A 2XKJE 3TH5A 1I2BA 3C1UA 2NUPA 3NEAA 3ELDA 1SQFA 2QRVB 3LC7O 4JX8A 1JJBA 4BLRA 4AG6A 4AWXA 5BW5A 4RLHA 3NMUF 4ZHQF 2G80A 2RHBA 1DOAA 1SQGA 3LA6A 4FYMA 2JW5A 4MWTA 1GSOA 2HTEA 2VCHA 5CLGA 4Z5XA 3WSVA 4DHEA 1BDMA 4Q19A 4NMHA 2P91A 3K9NA 5D5PA 3LHKA 3WO1A 4D3FA 4TUYF 1Z73A 2RMKA 1WMFA 2Z8ZA 1W5EA 3CPSA 1FL9A 1N0IA 4GVPA 3V1MA 4EY4A 5EIEA 4GF5A 3QVWA 3LC1O 1C9YA 3RBXA 1ZR2A 3GT3A 4JP2A 4RVSA 4PNZA 4Q7JB 2H4JA 5PNTA 3PC8A 1N3IA 3GUZA 3WZLA 2XSZD 5HP4A 3VPBA 1GU0A 3B3AA 3DTYA 2FPKA 4E4YA 3HDYA 4EYGA 3G6KA 1HO3A 5TVGA 5HIMA 1AOXA 1Z82A 1US8B 2ZYIA 5CW1A 3UK7A 4AJOA 1BNCA 4XCVA 1RRVA 1YQTA 3AFHA 3GJ0A 4ZZ1A 1P3JA 1IQ0A 2EL7A 3PHIA 1GLVA 2X4DA 1B8PA 2QE7A 2BEJA 4HB3A 4A6DA 4P54A 1IBSA 2ZFUA 3H8JA 1I7QB 3R9WA 3OEEA 3FTPA 3L18A 1PJ3A 1E9DA 2XVAA 2JFBA 3B8EA 2RHWA 3IEXA 3O8NA 4FXPA 4WACA 4E21A 4J90A 4B46A 1N7IA 4MCIA 5J4KA 1DAMA 3ORRA 2F67A 2XV1A 4QUDA 1S2NA 5A4IS 1XZPA 2XODA 3UK2A 1N9GA 1LRKA 4XCQA 4EZBA 4GMGA 3K0BA 3AGPA 4ERNA 4CF4A 1OLSB 1C80A 4G0ZA 2OGWA 3LL7A 2J3EA 4XSHA 3JQPA 3F9CA 1DUSA 3H11A 5J5AA 1W76A 4LF7B 2ON6A 1E2PA 2X2FA 3G1UA 4KXUA 1L4GA 4QYXA 1HZZA 4XQ0A 2BP7A 2H18A 5DYGA 3WGZA 1JXOA 2A78A 3N3BC 4B4UA 1HQDA 3K92A 1ODLA 2ZTMA 4QRIA 2DHEA 4R1TA 4UM7A 3SQDA 3U49A 3UW1A 4AWAA