3GJRA

Caspase-3 binds diverse p4 residues in peptides
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
141
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Caspase-3 subunit p17
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 141
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gjrA00
4EHDA 4PS1A 4EHFA 5I9BA 1F9EA 3D6FA 4FXOA 4ZVOA 2FQQA 1RHJA 3P45A 3PD0A 4QU0A 4EHAA 3UOAB 4ZVSA 4JJ8A 3R7NA 2H65A 4QUBA 1PYOA 4DCPA 2CNOA 2HBQA 2XYGA 4PRZA 4HQ0A 4NBLA 5K20A 3R6LA 4N7JA 4EHKA 5IAJA 3RJMA 2C1EA 4HVAA 1I4EB 4JQYA 4NBKA 3IBCA 1I3OA 2C2KA 4LSZA 5IAKA 3KJQA 1SHLA 4HQRA 1I51A 2CDRA 3KJNA 1NMQA 3V6MA 3H11B 1QTNA 1SC1A 4I1RA 4DCJA 2Y0BA 4QUEA 3GJSA 4JB8A 5IBPA 1RE1A 4QUAA 2FP3A 4PRYA 3NS7A 2P2CA 4QTYA 1ICEA 3IBFA 3K7EA 4NOKA 4QUIA 3H0EA 5LU9A 2QL7A 4QUDA 3GJQA 3PCXA 3OD5A 3P4UA 2DKOA 4NOMA 2HBRA 5IBRA 1RHUA 5JFTA 3ITNA 3KJFA 4JJ7A 2J30A 3NKFA 1RWOA 3DEKA 3UO8B 3V6LA 1RWNA 2QL5A 3R5JA 1K88A 2XZDA 1RWMA 2K7ZA 1RHRA 5IC6A 4QUHA 1RWXA 4AWAA 2CNNA 4FGUA 2H5IA 2Y1LA 1RHMA 1RHQA 3GJTA 1IBCA 4QUJA 5IBCA 4D3ZA 3PD1A 4N6NA 5IAGA 1GQFA 1SHJA 4NOJA 5LUBA 2H54A 3R7BA 2H51A 2CJXA 1SC4A 1NMEA 3DEHA 2H4YA 4ZVQA 2QLFA 4JR2A 4ZVPA 3V4LA 5LUAA 1M72A 4QU8A 1RWPA 1NW9B 2C2MA 1K86A 5H0IA 4NBNA 3DEIA 2QLBA 4EHLA 4JR1A 4ZVRA 3QNWA 1QDUA 1F1JA 5LU8A 1I4OA 1NMSA 3H13A 4FDLA 4NOLA 3SIRA 4ZVTA 4EHHA 1CVRA 5IABA 2CJYA 3R5KA 1RWVA 2XYPA 3EDQA 5IC4A 2J32A 3E4CA 1GFWA 4N5DA 3D6MA 2NN3C 4ZVUA 4JJEA 2CNLA 1BMQA 2C2OA 5IASA 3V55A 2FUNB 3DEJA 3V3KA 4M9RA 5I9TA 3EDRA 4D3YA 2HBZA 4QUGA 4QTXA 3S70A 4AWBA 1RWKA 1QX3A 2WDPA 2XZTA 4EHNA 1KMCA 1PAUA 4JR0A 4PS0A 5IAEA 3R6GA 2J31A 2H48A 5IARA 4AW9A 3V4OA 4IEFB 3BIJA 3H1PA 2QL9A 4JQZA 2CNKA 2C2ZA 2H4WA 4N6OA 4N7MA 1JXQA 4IYRA 4DCOA 4D3XA 3SIPA 3S8EA 4QU9A 2J33A 2QLJA 5IANA 4EJFA 3H11A 4N6GA 4QULA 2XYHA 4QU5A 3R7SA 4I1PA 2HBYA 3D6HA 1RWWA 1RHKA 3GJRA 3NR2A 4FEAA 1CP3A 2AR9A 2H5JA 1SC3A
chains in the Genus database with same CATH superfamily
5JS7A 5EJFA 3MILA 3E58A 4MOWA 2BWJA 1IZ0A 2I6SA 1P2UA 1Z18A 1B6SA 4A6PA 1XYVA 3RUCA 4LY0A 4MW6A 5K3FB 2WTUA 3SJZA 2ZYVX 3JU3A 4DWVA 1RP7A 2QPOA 4JSRA 4D0RA 3V8NA 5C4IA 3CR7A 4G1VA 3CF6R 5B7QA 5IAJA 2FKNA 4RTKA 1OLUB 4Z2AA 2VWQA 4ZHQF 2FRVA 5B6JA 2DTEA 4X1IB 4V0RA 2B94A 1FQWA 3WS7A 5B1SA 3IHKA 2ALJA 2BISA 1SC1A 5K3CA 5AJUA 1VYUA 1GNTA 1S6YA 2VK1A 3F6EX 5C8VA 3SKXA 4KSBA 4TOIA 3IP5A 3O1IC 5FLYA 2BFDB 3BZBA 4R98A 1CUUA 1WBDA 1N6IA 2FWJA 2NZWA 2CFIA 2XAAA 3C3AA 2BTEA 2HSZA 4X3PA 1TFRA 1JFFA 2ZB3A 5EHZA 5LC1A 1P5HA 3DCNA 4ENTA 3IKJA 2PWAA 2X5NA 2RB5A 2RFLA 2MSWA 2AQ8A 3FFWA 4HPWA 5J4VA 1E9DA 2ILTA 1Q15A 3OCXA 2A35A 3R5JA 4UHKA 4YAGA 5FOXA 1SU8A 4ZZ2A 4H6VA 2NUTA 2W2LA 1J6UA 2R97A 1C7ZA 3B5JA 1I2DA 3H2IA 3PWZA 1SXJA 4B40A 4AMUA 2VDUE 4KV7A 5LLTA 2W6PA 3LA8A 3PX7A 5CW2A 3CGGA 4XRRA 2P6OA 3RT7A 4E07A 1DINA 4NE7A 4FYYA 2GVZC 2W4MA 2PTHA 3PUIA 1E3DA 1XOIA 4AROA 2OD2A 4YQYA 2QLFA 1EQAA 2ZIVB 4EP1A 2ZE5A 4U9IS 3U0VA 3VR0A 4C6HA 5JJKA 3MPOA 3VUFA 4KWIA 3L0IB 5DN6A 2P8SA 3BWVA 4AJNA 1CVIA 1DJNA 4ZOLB 5FORA 2FQWA 1M34E 1TA9A 4RC9A 4YJDA 1JA0A 2ZAOA 4RH3A 3TQFA 2HB6A 3EC7A 3S1AB 4Y6QA 2Q50A 1G5TA 1WXFA 4OJYA 3GRKA 1CQJB 1D2CA 2QY6A 2OHJA 3RT9A 1ENZA 4TMYA 4URVR 1NURA 1OV6A 3PQDA 4H60A 3N28A 3LZ6A 1YIAA 4QHTA 1AF4A 2ODBA 1GTJ1 1DSSG 3A32A 3MQ4A 2VBIA 3LKZA 4R31A 4Q3OA 4RSMA 2HIHA 1SHTX 5JVDF 5L3SA 3FF1A 3B9PA 2FAXA 3PTZA 3CS3A 4DEVA 1LF0A 3KOYA 1G42A 2QUIA 1NOJA 4MRSA 5CA0B 5K03A 3VC7A 5A0FA 3GJXC 4GOXA 5PNTA 1S9HA 1MX5A 2G9VA 1PSWA 3VVBA 1YU6A 1PEAA 4RADA 1VDZA 1I7LA 1UWVA 1WXEA 2BFBA 3HDHA 4UUMA 5JY6A 3JSXA 4PPGA 3VPAA 4UTVA 4A0QA 1U3GA 4DQUA 5L7TA 2P6RA 2W2XA 1MIOB 1DCFA 3HN7A 1FUYB 1ISIA 3MLBA 3BRQA 3HEMA 4NI5A 1ZINA 3FYTA 3R3UA 4IKPA 3QBDA 3U48A 4ZYZA 1XTPA 4LHSA 2I54A 1XL0A 1KFKB 2QAIA 4TRRA 2V0CA 3CXRA 3O73A 1L5QA 1KY2A 4HDRA 1V41E 3AILA 4M55A 2Q8NA 4H7IA 4PCLA 3FDXA 4RH0A 2XKBA 1N6PA 2AJBA 2ZI9A 4PS1A 4AL4A 1TIKA 3K5PA 4HCJA 4HEQA 2D4HA 2CLSA 2Z2KA 3B6MA 3LVRE 1LX6A 3AG6A 3NAMA 1OWPA 4JLDA 4LVUA 4NAUA 5EUBA 4DIOA 2P6NA 3JZFA 2R2AA 2IYSA 1IDOA 2ASVA 4PZDA 4R1LA 4W99A 2FZWA 5G53C 1ADCA 3TRHA 4CF3A 3BFVA 5CGZA 4A2QA 3ZE7A 4WH0A 1G20B 1LLFA 4MS1B 5DT2A 2Z5GA 2WF7A 5KHAA 4JJGA 3RSFA 1CF9A 4L76A 1KJWA 3LH5A 1NUPA 5DB4A 2PZEA 1B74A 3L7KA 5DGTA 1NSYA 2OP1A 3NBUA 2D8MA 4ZRMA 1GPNA 3EQ2A 3A8TA 1UK9A 4MS4A 1CDEA 4GWLA 1A7AA 1BN6A 1KVUA 1JQ3A 2X2OA 3G82C 1OXXK 1E1QA 2K6GA 4PLTA 3GLIB 1G3QA 1F8UA 4CMBA 3MRXA 4WBSA 3F2VA 2F1RA 2ORWA 4NARA 3LT5A 1YXMA 2IJGX 5M29A 3REQA 1D0SA 2V7QD 1JEYB 1FNMA 2CB9A 5J2UA 1J0CA 5K4HA 5KCZA 1BD3A 3WP0A 4QBTA 2PMFA 1VKHA 1MB9A 2YCBA 3MCUA 4YAWA 4RMGA 1ZA2A 2XKJE 3AJDA 2FPWA 2XA1A 3KXPA 5EKUA 2A5LA 4K9DA 3GGJA 5JFOA 5KTPA 3INYA 2WJWA 3OZAA 4D45A 1U2EA 3TXXA 3ZOZA 4IVNA 3QEJA 4RD2A 2YWGA 3CUVA 1LPPA 1CYDA 1R5JA 4CM3A 4E5PA 1PWZA 4UARA 3LP8A 1CUFA 3SXUA 1EIZA 3QWHA 3TK1A 2PFKA 1TAHA 2GEJA 3S8YA 5AICA 4OSEA 2MMCA 1FFDA 3HKCA 1EUCA 4MUYA 3I61A 1AQ6A 1NJ8A 2Y76A 4Q9HA 3R5HA 4D43A 3EEBA 2XW6A 3GMDA 5IMSA 5KQRA 2TMKA 3A04A 3H1FA 1EX7A 3MJEA 3OZTA 5F78A 1OC2A 3U7QA 1XRRA 4EBFA 3H86A 3DV0A 1T6YA 4JUBA 3H84A 4R8VA 4AJHA 1SCAA 2CJFA 4GC9A 5CW1A 3HFRA 4OLJA 2GERA 4LECA 3SQNA 3ZK7A 5TV2A 1K8RA 3DFIA 2H9AA 5AVRA 1VBFA 5KVAA 4TPKA 2EW2A 4ESOA 5BR8B 1CR6A 4R7ZA 3A4MA 1UDRA 4GGPA 4P7FA 1V8PA 4P32A 2ONJA 1I1QB 3ZE1B 3FZQA 4P86A 1RR6A 1QGAA 4FCVA 4I6EA 3WXMA 4JJAA 2OQ2A 4M49A 5LYJB 2J4CA 4Q3NA 3LXRA 1Q17A 2OE2A 2X86A 2GPSA 3HYRA 5AT1A 1HL7A 1ZK4A 2QM7A 5I3CA 1K2VN 2I22A 3G7UA 4OSPA 4BO2A 4TMZA 4MIEA 1NE2A 2ZIZA 3H6KA 3SQOA 3WMGA 5KTRA 3CF2A 1WF3A 3CUEF 3HKBA 2BR3A 1C0KA 3QSGA 1GT6A 1UK8A 3ZVNA 5D86A 4EKNB 1BW9B 3GZNB 1KDPA 3PQ4A 1RJ9A 2FPIB 3G2OA 2WUFA 3D5TA 3E1SA 4UVGA 4HYTA 1KPHA 3N2EA 4I2NA 3LW7A 4XYMA 1B26A 1ABBA 5NLLA 3U81A 1CY6A 3MOSA 4FGKA 2WWWA 2H7XA 4DXDA 4Q0MA 4BFTA 3RFVA 3SBEA 1U7OA 3HVRA 1PX0A 5JMOA 3FMGA 4QNRA 4D5GA 4GMFA 1AHHA 4G0YA 3TPFA 3VSCA 4LF9B 2Q2VA 3NXSA 1K8QA 5DULA 2O3UA 3N58A 1UBKS 2TRSB 3C3JA 4BMOB 2X5OA 1CY1A 1LB1B 2EFDB 5ALPA 5J43A 1I8TA 4IDEA 1M7HA 3AT1A 1AZWA 5JTUA 2I2BA 2ZXUA 2Q9AA 1Y6ZA 5JATA 1XALA 1VLHA 3T9BA 2QQEA 2W8ZA 5IC5A 4TLDA 3A14A 4MO9A 1QONA 5IJ9A 2GM5A 1NY5A 1OTHA 1OX4A 3I34X 2VQFB 4HAWA 4MARA 2V45A 2PGNA 1HE5A 4G0PA 3UQYS 3DL0A 3OP4A 2YQ4A 3QF4A 2E49A 3KLBA 4QTZA 4KIGA 4JSTA 4Z7OB 3AO0B 3URKA 3MSCA 3C6YA 4G0XA 4UEKA 4J3NA 3TUJC 1VZ3A 2XE4A 4OGLA 5DXJA 3IE2A 2PRSA 2ZB2A 3N07A 4WA7A 1E4VA 1TO2E 4I9HA 5HHTA 3RVPA 5CA1F 1LSUA 2ZAYA 1KEUA 3NEYA 2TMYA 3F4LA 4CR7A 5ICCA 4DZTA 3ZWCA 1B2LA 4NBRA 4BQRA 4OG2A 2LWIA 3RIEA 3RVSA 4HGRA 2ZS8A 4RZ3A 3LFTA 3OO0A 2BFFB 1YZUA 2N1MA 3F4KA 3PA8A 4JDUA 2JK1A 4ECEA 1ZK2A 1ZUIA 1XI2A 2Q5EA 3N3AC 4RKEA 5FB3A 2DHRA 1FOEB 1PJLA 2JA2A 1OC4A 3ONEA 3OZWA 4DMHA 4Z6KA 5HCUA 2GEUA 5B1EA 3LAWA 4C0AC 5AVSA 1B0UA 2I3ZA 1G8GA 5F3RA 3L01A 5HQJA 3A6DA 5EZYF 4XVRA 3OMLA 4PCVA 3TCKA 3TJZA 4TV9F 1EJ0A 3PRKE 4WGFA 1NIJA 2FPOA 4CM8A 4EPRA 4CLOA 5B2ZA 3BWEA 3D2LA 2HNKA 2IPOA 4O8ZA 4BVGA 2C3MA 2ZBQA 3D2BA 5TS2A 2ZGVA 2AKEA 1Y48E 5JNSA 4OX9Y 2GETA 2EJBA 1H3NA 3RBXA 1U2GA 4LRWA 2A1UA 2C77A 3I2YX 2XYRA 2C98A 4ETNA 2AG1A 1MD9A 5MFZA 4P2BA 1NXWA 3IIIA 4UUBA 5AK0A 3U4AA 4F2HA 3HM9A 1NBMD 1VE5A 1GO2A 1ZUD1 2CEAA 4L8WB 1MCZA 3F8TA 4IUYA 4M9RA 4B6OA 1KEWA 2G1KA 3ED5A 1T9BA 2ZJ6A 3DTVD 3AFMA 1EHCA 3R7WB 4HZGA 1GL3A 3GN1A 3IAS6 2DQKA 5B3JA 4BO9A 3BMXA 1E1RD 2GKGA 3ASZA 4DVGA 1XA4A 3K15A 1Q0QA 1TVKA 5F1OA 2DBRA 4BXOB 3I83A 3TRKA 3VH2A 2PKRA 2Q5FA 3DLBA 1ULBA 2PRJA 4EZBA 3MXTA 1G4HA 1YA4A 1NQVA 1YZNA 3M1LA 1RXEA 4PYIA 4S1VA 3ZTWA 4EHIA 1NPYA 3K2BA 1BXZA 4IIJA 5TVKA 3KUXA 3RTEA 1X7GA 1GKUB 4Z99A 1K27A 1P6XA 1T5IA 2UZAA 1N4AA 4CJXA 2BCGY 1BXKA 1HQCA 2P4EA 4WNCA 3UW3A 4BNZA 2NU6A 5JPDA 1FU8A 2Q1YA 3KSUA 2UUBB 3IAFA 3A37A 1O94A 1XMVA 2GFIA 1TD9A 4JY7A 3KQVA 1F6WA 1OAKA 3VC2A 2GF2A 1WE2A 4O4LB 1XPOA 5F5LA 4YC7A 3OETA 3JVDA 2O2DA 3BMOB 3CSUA 3G68A 4O2AF 5D85A 4K9OA 2JIZD 5KAMA 4TMVA 5AHXA 3U7FB 2CV1A 3JX9A 3QYPA 5GP1A 4PVDA 1DKPA 4GRDA 4MQFA 2P2DA 3RYHA 3T06B 4BS9A 3G9QA 3IAXA 2I4MA 3O4HA 4HDMA 4F45A 5C32A 3UBTA 4NBKA 3RTBA 1GKYA 1L1QA 2WWHA 5B1IA 3SF8A 3LPLA 1CQXA 4WESA 3S1SA 2PNFA 2MDTA 1GTVA 3C15C 1QQTA 3EQ7A 2GN8A 2PU5A 4G25A 4HBZA 2ZIFA 1O95A 1H2HA 3VPXA 4EAAA 1RE1A 1FFXA 1I2AA 5B6IA 1JX6A 5E8JA 3BK7A 3AF2A 1L7NA 2XWSA 5G3YA 3K09C 5CXSA 3D1JA 5CT8A 1T4GA 2X7XA 3AOGA 3B7PA 1PEDA 5EKSA 1VSTA 1UZLA 1FLDA 2HC9A 1ODKA 1UT6A 4DUZB 3K72B 3WFJA 5EMNA 1Y6QA 4F9GA 5FWDA 4JYBA 1BE1A 2ZRLA 3ZLUA 3UO8B 1V95A 2GILA 5BN3B 5H68A 4TL8A 2BFOA 2HN9A 1LTQA 3DOEA 4R2XA 2I8AA 1PVVA 1WX1A 3CEPB 4ZOBA 3FHTA 1T1SA 4KU4A 4UBJA 1FDVA 3LKVA 1LSOA 4EGSA 5H9WA 1CFZA 4WZAB 2BBSA 4KWTA 4WKGA 1U0TA 2G4CA 4TS9A 3DEZA 1EFUA 2O23A 3LQKA 3Q7TA 3NIDB 4DYVA 5B64A 1JG4A 2ZPAA 2IIVA 4QLBA 3UT0A 1Y98A 4RTNA 4KQJA 3L79A 3DE7X 4N48A 1HT3A 3BTUA 1EFTA 2C2MA 1FBNA 2RAPA 2RHJA 3H2BA 1C7RA 1VZ2A 5BYBA 1WB9A 3WYCA 1L7XA 1LK7A 2B4AA 1L4GA 4KXQA 3ICWA 4Z51A 4HKTA 2QQ5A 2I2FA 5K4AA 4IFTA 2EDAA 2P2NA 5LDGA 3IQGX 4B34A 5DBGA 5G0SA 4S05A 4HH4A 4IIUA 4QJBA 4XD7A 3JYLA 5U4XA 1TADA 2CK3A 4AJPA 4CF4A 3QOXA 1Z2DA 2HUPA 2FN9A 3KOZA 2HO4A 4XQEA 4BNXA 1TMKA 2WICA 2G09A 2NN3C 3EEFA 3S2EA 1CZOA 4L9AA 1B93A 3GRVA 1AF7A 1HTTA 4OAQA 5I8WA 3KKOA 3PUWA 3CF4A 2ZR8A 5AKKA 1L4FA 1VIAA 2I4NA 1OOEA 1UQUA 3ZY4A 3ZV7A 4OLAA 2JB9A 3AZPA 2O3SA 3DKIA 4TSRA 3R6GA 1E6LA 1R12A 2EARA 1TW3A 3KQWA 1HFKA 3K3PA 3C3YA 3ZYCA 4WCFB 2P77A 2J09A 1AHIA 3CH4B 4GPBA 4LJSA 4M87A 3ZDXB 4EQ6A 4LYJA 3W3AH 1P4HA 3H05A 4IW3B 4RE6A 1LWOA 4FEEA 2PLWA 3VBCA 3UMSA 4KFSA 1KJJA 4CIDA 1JSLA 1NR7A 3CIFA 2DY1A 1ZUNA 2LKCA 4B32A 3TSZA 1OU0A 4P7JA 5IP5A 1XL1A 1JALA 1V2GA 1RDFA 2Z8YA 1Z63A 1J56A 4TV8B 2ODEA 3L3BA 5IHXA 3BULA 4CEJB 2YINC 4II7A 1EFVB 2GF9A 3DW3X 1JNXX 2PBFA 1U8AA 4YV7A 4LNUB 3RV4A 2BL4A 1A4UA 4OMDA 4B09A 4PCUA 1P4RA 3WI7A 5B7GA 1BHO1 3TECE 2L0XA 3OM0A 4IJQA 1NN5A 1HDXA 4ODIA 4WK4B 4DT1B 2DWUA 4P0TA 1DBSA 2YV4A 3FCSB 4BNDB 2V3VA 4YAEA 3W9UA 2VTKA 2NAPA 1P5FA 2HZBA 2QVYX 2R60A 3E48A 4YTEA 5BQOA 3RFCA 4EUEA 2RJOA 2V97A 2ZE7A 1JG1A 1JQKA 3U49A 1D6JA 2D2XA 2QX4A 2YJ3A 1XTUA 4J7AA 1P1HA 1YKGA 1CIPA 3GEHA 5J2TF 1QLJA 1E6KA 1QRRA 2XUHA 4LTNA 5H4HA 2Y3IA 4BV3A 4WBNF 2Q4DA 1KJ8A 3C4QA 3DWIA 1XKXA 2VF4X 3GMTA 4AFNA 1IZ8A 2YZNA 3ZLBA 2B69A 2XWJI 3RYTC 2RI6A 1NZJA 4OQEA 2I62A 1AKWA 1I80A 2V7XA 2ZJFA 3DKRA 2ZWMA 4RJ2A 7ABPA 4QOIA 4DR1B 3C7KA 3VH1A 2F8TA 3MUOA 5HG0A 1PG5A 3NOQA 3AJRA 1R10A 4DCUA 3ZGNA 4IGKA 1C7EA 1SBIA 3OZSA 1NVVR 1U04A 4MJLA 2ANCA 4IGFA 3OQOA 2VPYA 1OWNA 3BWYA 1A9YA 5KQGA 1XTIA 1XPRA 1GR0A 3H8SA 2W6JD 5LUBA 5BY2A 3KZCA 2D0IA 2H51A 3TRDA 2DFVA 4LDJA 2PVSA 3V1NA 1RQXA 1XA0A 5ENVA 1NVXQ 4Q19A 2WKRA 3BXPA 1KYIA 5CJ2A 3SC6A 4BRWA 4Q7QA 4H6WA 1QWOA 1JJIA 2XOKD 4M1OA 2CBGA 2N42A 3FYSA 4HK4A 2GZ3A 1Y1KE 1U1FA 3BXGA 3LT1A 4MWSA 4MVJF 5CM2Z 5JNRA 4MJ7A 4NNPA 4YFYA 3M7IA 1E5LA 5C7IO 2AXPA 2BC9A 3GUYA 1QRAA 5KKNB 1E5TA 4AJEA 4FN4A 1P60A 4I14A 4MB6A 1YS9A 2BE7A 4HR7A 1J1IA 1RWVA 3D0QA 1UDAA 1TQ2A 2J32A 3I01M 4HGOA 5KYKA 1ZCBA 4YRMA 1GFWA 3UF0A 1GPWB 2F1IA 3JAWB 1FP4A 3LC1O 3X3HA 1JAIA 1L7VC 2O2YA 3SZ3A 1FIUA 3W8FA 3T4PA 3VM6A 1THZA 1C9NA 3P7MA 4AWXA 3GRPA 1LDMA 1AKTA 3LSYA 4MUJA 1RI1A 2ZJOA 2ZYHA 3C5VA 3BD9A 2POQX 3WFIA 1CB7A 3EGWA 5CDFE 1CR0A 5I7VA 2QK4A 3C6QA 2GWRA 3DEAA 3ONNA 1J2YA 2OK8A 5EN4A 5K3FA 2VSYA 3N9IA 2Y2VA 3FJ1A 2DFTA 2IXTA 2QLNA 1FJXA 5E38A 3DS8A 1X39A 4E4YA 5CDUA 1J2TA 2R85A 3O7WA 1OLUA 1ZAYA 4K0KB 4IYRA 4X1IA 3AY0A 5K3OA 4HWTA 4MYRA 3M70A 5U4QA 1GCAA 2B3DA 4E30A 1W7AA 3SOPA 4LBYA 1YC5A 4IMPA 1YVEI 4BN0A 1L7QA 1R8YA 1RM5A 3ZZMA 3L46A 3HCNA 1YQEA 2ZJBA 5CGQB 2BFDA 2VUHB 4CMKA 3LJKA 1BQ4A 1SQ0A 3PRJA 4IDOA 3LX6A 4L73A 2YH2A 1PS0A 1PEKE 1EZ4A 4XWKA 1PYDA 2VXYA 1YUBA 1RBZA 1GL6A 2PRYA 4OKNA 5AJZA 5HE9A 3RR2A 5DNCA 3B1ZA 1ZUHA 1UPCA 2P2LA 2D0OB 3HXTA 1NBHA 2ADMA 2YZGA 3CUYA 3H9GA 1WB6A 4BFSA 4EHAA 3H5OA 3OTQA 3F9IA 5K8IA 4C78A 2QMUA 4Y18A 3IAAA 1RPAA 2FEOA 1FXUA 5C8DA 4O2BF 2F2TA 5FPSA 1LPOA 1Z6PA 2I9PA 2WK1A 3D4IA 3DWEX 1UMDA 2VZEA 2M6KA 4B84A 2I6QA 3DHVA 2O2EA 3ET4A 4IILA 1R6UA 1P18A 1J8FA 1S1MA 2J07A 5I8ZA 3RS4A 4R71A 2VUTA 2XGOA 2YW9A 3SYTA 4IUCS 2O2JA 4LJ6A 3PC7A 1DKMA 4M83A 1XNQB 4U7HA 1HG0A 4ZEVA 1ZI6A 3ZYZA 4V2IA 2X1LA 4R2IA 4CF5A 4LBZA 4GBJA 2JCBA 3GWGA 4OD0A 4CRWB 4WCFC 5EIBD 3ZU6A 1U6JA 5TQJA 3GLFE 4L15A 4FMCB 2REXB 5IKEA 1HO3A 3RS9A 4ZOLA 4EPVA 3COSA 4IQGA 3IEXA 4OHZA 1AV6A 2KYRA 4CE6A 4RS3A 2ZVDA 1KSHA 3H1EA 5BWNA 3T94A 1CQJA 3DMHA 4DBZA 3NM4A 1F2UB 5EFZA 5ALJA 4C4RA 1FDRA 4I4NA 2ISQA 4L0CA 3CZAA 4M9CA 3DLIA 5AW6A 1CJMA 1JHQA 1WV0A 2QJOA 4GR9A 3BCRA 3UXHA 3ZY5A 2ZJ8A 5AVZA 4F04A 3LNCA 2I71A 3PHGA 2OOKA 4CTNA 4H15A 5FOQA 3MW8A 1YZFA 3OEED 4JVNA 3Q8LA 1J09A 1E1CB 2YXEA 1G5FA 1ZK0A 3MT0A 4XGQA 2XGGA 4EYEA 5CA0A 1B00A 1JHXA 2UV8A 4AZ0B 3BF8A 2JCXA 3G0BA 2EQAA 3LT2A 1OBVA 1CNFA 5LLDA 5LU8A 4IO1A 1RI5A 3ZHVA 1J9ZA 2ZRBA 1MIOA 4ALJA 3ZHBA 1EPUA 1K3TA 4JDPA 2EX1A 3O83A 5BSTA 4BL5A 2CVPA 5IVKA 1KO1A 1TTPB 1UBTS 5JZSA 4CUKA 2J0EA 4HJRA 1AZTA 1V4VA 4RAOA 4X8MA 2LP4Y 4YRFA 2G04A 2Q1TA 3H7IA 3VISA 4B3IA 5AQ1A 1G55A 1K92A 2FH5B 2QA5A 3H8JA 3L82B 1KNXA 3C45A 3QKWA 4OKSA 2FW8A 4HFNA 1NRIA 3JQRA 2X19A 2C5LA 5EIFA 3ELYA 2DWCA 1HNXB 4RVFA 1TJ5A 4U7PB 2DPMA 1MMFB 2Z4SA 2RGNC 4HEA6 1RAIA 3GJ3A 3NHWA 1G20A 5EWLB 4MS1A 3ZZUA 5AW7A 2PGXA 3HJHA 4RZUA 3M1YA 1W46A 4Q6WA 4DEXA 4IRMA 1DKOA 2QLJA 3GUHA 1AS3A 2G1JA 4U2GA 3O8QB 1EXMA 1BX0A 3GWZA 3PXXA 4EL5A 3D3WA 3WHKA 3FD8A 2F1OA 4LZPA 2BMDA 3A4TA 5C2JB 2BR5A 2Q3FA 3GA0A 4YP0A 2FA9A 1Y7HA 2JJ1D 2PFSA 2G08A 2J85A 2ZBPA 3PHIA 1YZVA 1QIDA 2D7JA 4OL0A 3GDGA 4MX8A 4XR4A 1H22A 5F35A 3GYBA 2OMEA 1GV0A 3GT4A 3IAHA 2GM3A 4ZQIA 4C0QC 1D1QA 3PEEA 4DUPA 4CIWA 1JEYA 1PO7A 4JP2A 3IT1A 1BCRB 1NDQA 1WTCA 2W90A 4O4IB 3V7UA 3OZBA 4NVRA 4UHFA 1JVNA 2CCKA 2W00A 5TJ9A 1DAOA 3HJAA 1XVUA 4AKIA 3IUQA 1R5NA 2XTAA 1OPRA 2IY8A 3WDKA 2F1JA 4DA0A 1ZA1A 3ZWXA 3PSAA 2AXNA 3KYIB 1UBHS 3ZIAD 1LS1A 2R1ZA 4YPOA 3ZJTA 2IPAB 2ANBA 3EASA 1GNPA 2F7SA 2O2ZA 3I12A 3LQ4A 1OGYA 3VU1A 2H4JA 1ICEA 1CDOA 1Y9DA 3U2QA 3KBBA 4UCFA 4BVEA 1IXYA 2YVUA 3O2SB 5D1HA 4JFAA 5KQLA 4EF5A 1PZGA 2ID9A 3GJ8A 3LGAA 3BK1A 3HZHA 2JCVA 5C8XA 3O7MA 1J2EA 3PDWA 4RKFA 5HW0A 3CEHA 4X91A 4PSKA 1RWNA 4K6KA 4JCCA 4EDFA 4R9VA 3DYIA 1Z88A 4ZC8A 1EI9A 2P3OA 5HXAA 4A6XA 2WYVA 1X8LA 3AKCA 4IJKA 5HF5A 1YQ9A 5G0TA 2W6ID 1SGWA 4RQUA 1OCEA 1VYHA 3W6PA 5EIBC 5IDVA 4BNVA 3GNTA 1E2MA 2LNDA 4FUQA 4EG6A 3I64A 5KWVA 1KZHA 2H08A 1WAMA 2QP9X 4P3YA 3PICA 1FUKA 1Y3BE 3H4TA 5FP0A 3WNCA 3V2IA 1D04A 2EGGA 2R79A 5BV1A 1YQXA 3ROFA 1A50B 4OOFA 1PJ4A 2CUNA 4RQTA 2JIPA 2GO1A 2VRWA 3TG8A 2ZUWA 2I9KA 3BCHA 1F0NA 1H2EA 4GSYA 3E2PA 1IAQA 4ME6A 2HH9A 4OQDA 1BW9A 4H9GA 1NNI1 5EERA 4Z9FA 5GJWC 4ZHQB 5JH7B 3VR3D 4NYIQ 1W73A 2FPIA 1E0KA 2IYEA 1P91A 2ODPA 1L4BA 4KREA 2PX5A 1H0KA 1V8FA 3ESRA 4X6LA 3FDIA 1ZCJA 5KYGA 1QGDA 4TLBA 2G9QA 3PHLA 5KNCH 1YQQA 2FG6C 2WYOA 3IKMB 5GMOA 1L1FA 2W6CX 2GK7A 3M6AA 1SXPA 2RC5A 2PZKA 1ZAKA 4Q1AA 3S70A 3WLPA 2J9ZB 3ESXA 4H3SA 3PHJA 2PLFA 4KSCA 3THSA 5LXTA 1TF2A 4DCSA 4DV4B 5LQDA 1L7PA 4MSUA 3ZXIA 1X77A 3F74A 1RCTE 2OG1A 3MHTA 4K9KA 4IDDA 2IEAA 1O97D 2HQBA 1XCLA 3EIWA 5CCEA 3V9PA 3VSEA 1L6RA 5FBKA 3IH5A 6REQB 2ZS9A 4MGEA 3AK4A 3P0HA 3LWDA 4NZNA 4WOPA 5GOTA 2J3QA 5IH7A 1MGPA 3VV2A 1Q3HA 3KL4A 3N8HA 5IJXA 4EA6A 4YV1A 1OH5A 3JQCA 3EMVA 3DUFA 3IAS1 5FLXA 3JY6A 4L9WA 4OXNA 4N5NA 2P3LA 2XSZA 4F56A 1E3TA 1SK8A 3HGMA 4R1TA 2AI1A 5CM8B 3HUUA 4AURA 2P1RA 5T4EA 4F2GA 8OHMA 1DV2A 3FAKA 5BUQA 4LZNA 4JGGA 3TLXA 1PUIA 2PX6A 2D6FA 2Q9UA 3UCXA 5HIAA 3UFXB 2GBFA 4E88A 4W9MC 2QX7A 2FPKA 1OZAA 2OHVA 2CLEB 4B1FA 4GPTA 4ENWA 3FMFA 1FSPA 4BFXA 3IQHX 2D5CA 1K8ZB 1NSTA 2XWQA 2BFFA 2UZIR 1U98A 1NBMA 1X38A 2IYPA 2VSFA 3C4VA 3QXSA 4MI6A 4S35A 3UWPA 4FSXA 5J1SB 4QE3A 2DR0A 2HU5A 1B8VA 2QP4A 2Y0BA 3MXOA 4H7EA 5JVDB 1XZGA 3M5DA 5JS2A 1CD5A 4FOTA 3DTVA 3QVJA 2O57A 4PQRA 4V0MA 3R76A 1LSJA 2YMLA 4UBMA 4P35A 3UB2A 4Z0PA 1E1RA 1PT9A 1TJYA 3MNFA 3T3DA 4EA9A 4IFEA 4WXEA 3HFJA 1ZDMA 4M1TA 1Q7TA 1DOZA 1V2HE 2C95A 1Y0BA 2GZ2A 2PMBA 1KZYC 3CEMA 1RWOA 2K87A 4KXVA 3R3JA 4XR9A 4JH0A 3AINA 3ZLJA 2XD9A 2O1WA 2CLHB 2IXEA 2XH8A 4DCVA 1GPJA 2KW5A 2LW7A 2R86A 3DFKA 2UYGA 4G81A 4EVIA 2HU8A 2VZLA 3H87A 3H9CA 4GM0A 5T4BA 1WU7A 4KVZA 3QFTA 3VAZA 1NU8A 4NOJA 5CBPB 2FVXA 2XHZA 4IINA 1GN8A 5TF4A 4M98A 2PHZA 1CQZA 4WN3A 4FTWA 1QKIA 3LQRA 3R7WA 5FNVF 2YBEA 5J5VA 3B89A 3OE1A 1A27A 2ADFA 1JHZA 1F14A 4LMAA 4ZGGA 4WRRA 3TFWA 3RU7A 1YR6A 2I55A 4HUQA 4G97A 2GXSA 1KMIY 2VP0A 1XNGA 5AI0A 1OZFA 2XQJA 4KI0A 5LP6F 1QP8A 1QHXA 3WO1A 1OB5A 3QI7A 3PGVA 3H42B 3OECA 4FYVA 4XJXA 3G9ZA 4LDZA 2WIBA 3HC7A 4O3FA 2CYAA 5CJJA 3A9VA 4DR3B 4D9GA 3KFXA 3FCYA 3WGKA 5LJIA 3T5DA 4XLTA 4CXMA 2XGMA 3MJCA 2CNLA 2X1MA 3L0ZA 1Z5WA 3F8WA 4K7JA 4A0RA 4C2AA 3HCOA 4EEZA 1OTXA 2DJIA 3BGIA 5DNVA 1YL5A 3HRKA 4UVHA 3IC5A 5G0WA 4OU5A 1GTL1 1S0UA 4RDIA 5AUNB 4DMMA 4BVKA 1DLJA 4A1FA 2QRVB 3PC6A 4O4LA 1MEEA 1VBMA 1IRXA 1ISHA 1GAXA 5JYCA 3I4CA 5GADl 1LH0A 5DBHX 4AJ2A 3IT3A 3VAAA 2RCNA 3KLNA 2KM1A 3WJ2A 1WUKS 1FB5A 4QREA 3U3ZA 1N78A 4UQOA 3DOCA 3TB6A 4KR9A 1F8YA 3PNMA 5B2FA 3GDFA 4AULA 5EQDA 2V54A 1O9GA 2XIJA 5LM3A 2E55A 5KSOA 2OYRA 3VJRA 4AP6A 3FPSA 3PC3A 3RC2A 5CFOA 3ENWA 3LHKA 4NY1A 1J0XO 1JPJA 1N2GA 3KC2A 3MWJA 3WGZA 1VPDA 2BT4A 3BGOS 5KVVA 5L8VA 4YYEA 1FVOA 1RACA 1LFDB 3TLBA 1BWRA 4RWZA 1HLPA 2NT4A 2GPBA 3C48A 3WNVA 4I5GA 4BNYA 2V5VA 2VCHA 2W98A 1LW6E 1XDGA 1YRWA 2EWWA 2RMKA 5BN3A 4FNMA 3RREA 1D07A 1ML4A 4CMIA 4GHWA 4D82A 2VHYA 1E4YA 1OH6A 1S5PA 1KYXA 5KJCA 2UUCB 1J0AA 5KDDA 1TNDA 1UBSB 3Q2IA 4L5CA 1Q83A 4AIIA 4WZAA 3ASYA 4O0LA 5JCOA 3C8UA 1ZSYA 1VP9A 4L9RA 5FBHA 5BW6B 2PT7A 3WYFA 3OF5A 2BVNA 4BC1A 1N2JA 4G26A 4JWKA 1KJ9A 1KQFA 3I76A 2Z2IA 4YVFA 1MO3A 1KGSA 4YROA 2PBRA 1JR3D 3DBOB 4RJTA 4E5NA 1LBSA 1W59A 2O4CA 4DTIA 1VM6A 3SI7A 1C1XB 3PENA 3M6UA 2FYTA 4CCAA 1PUXA 1BHSA 3LHFA 3ZUPA 3K1TA 4UFOA 4M88A 1YBVA 2OFPA 4WY5A 4TXHA 3VR5H 1WSDA 2C7BA 1Z08A 3IMCA 4GMGA 4NENB 5L53A 5DMXA 3ZTYA 3VC3A 1RXWA 2PQ0A 1IBMB 1IL0A 2ONZA 4CNQA 1X1TA 4L0DA 1EBBA 1L5HB 2DH5A 2NU8A 2D2IA 2Y1LA 5A3QA 1GNQA 4D02A 4JJZA 2CXNA 2XUFA 4NBUA 5K8VA 2GWHA 2GN9A 1XTQA 5B1HA 1UC8A 4WPGA 1KU0A 2PL5A 4PZ9A 2C8LA 1DTSA 4RIGA 1Q11A 3QVMA 1G41A 2H8GA 2Y4OA 3DSRA 3ZJYA 3T1YB 3MS7A 4WCFA 1NJ1A 1CPYA 2VDWB 5T8KC 5AW1A 1BD4A 2DPYA 2QM8A 1M6HA 2O8DB 4GICA 4GOJA 1RYBA 1JLRA 3WRYA 4NOLA 5KYYB 3RRFA 1F8GA 4I55F 4YRLA 1VFPA 1UDWA 4BE9A 2ZBFA 3SR4A 2GMWA 3CE6A 3DQPA 1E2QA 4R01A 3PA6A 1GGKA 2GLXA 2JBAB 1NVBA 3ISJA 2QV7A 4MWZA 1WPRA 2YMQA 4D46A 4TV8A 4OATA 1F06A 1TZMA 4DV5B 3QPDA 3SHVA 1EFVA 3IV9A 1U7WA 3I92A 1A71A 4TYWA 1U31A 1S4QA 3O8DA 3ME5A 1MENA 4LNUA 3UK0A 5DNAA 4DCNA 1AXEA 3LK7A 3MCWA 3RHZA 1TAUA 2HEGA 4D5EA 1S3SA 3R24A 4R3UC 3TW0A 4DT1A 4X85A 4WA8A 4C87A 5CA1B 2XB6A 5KNCA 3RK4A 2J3JA 4JQSA 4FKBA 4BNDA 3OFJA 4LG1A 3BERA 4FT2A 1VPTA 5DBEX 4DUYB 2LPMA 3ICOA 1IAVA 3TLEA 1Q44A 5EXEA 2FCAA 3JW8A 2W6JA 1R8SA 3BMCA 5TX7A 1UP4A 4Z49A 2SHKA 4QU5A 5DHSA 5TEVA 5A9SB 4C2TA 4TSFD 3TS1A 3HR7A 4ZO9A 2XNKA 1AXRA 2EX4A 3P9NA 4DDMA 1XZNA 3EE6A 5ANRB 3VSBA 2C2XA 5BVHA 1P72A 2W8BA 2XOKA 4DKXA 7MDHA 3RSLA 1YB7A 1ZMXA 1OIVA 1WSBA 1XZIA 4XTCS 2ST1A 2H8KA 3DGFC 3KU4A 4TV9B 5EZYB 3T4XA 3WV4A 4AN1A 3ZI4A 4ENQA 1NBEA 4J3FA 2FHPA 3PF9A 3L06A 1U8FO 1GLGA 5K1ZA 3CEJA 3U4MA 5DWDA 5M3BA 1CLUA 3ROMA 6ADHA 2DCUA 3ND6A 3PWTA 3FROA 3LF2A 1CE8B 1YBHA 3GCXA 5EI5A 3IMKA 2WEKA 2VT7A 1RKQA 2G88A 2OV6A 4JV5B 4R3WA 4BNHA 1TCUA 4NYJQ 3DHYA 3HGQA 3L84A 4FLFA 1HA3A 1YJ5A 4Q3KA 1IBKB 3RWBA 2ZWAA 2VYND 2WIAA 1OB2A 1E9SA 1J4AA 2WBLC 4MEJA 5U1PA 5JXHA 1BJTA 3KQSA 1RKXA 4AO6A 1XTBA 5FQOA 4IGEA 1XF9A 2AEJA 3FLAA 2O5VA 3ZV4A 3KFVA 4G8JA 2CZCA 3P0JA 3THWB 5AKHA 2ECOA 3GCGA 4BEBA 3FY4A 2AL7A 4Z5XA 2QJWA 1ZGHA 3P4UA 4IAOA 4TZ6A 1BX3A 3SNKA 2RI0A 3AHIA 4FSDA 3KJFA 3TIXB 1W94A 3AUUA 3LPNA 4JJ6A 3WLRA 4UFPA 2Z58A 1PNOA 3LCCA 3Q0IA 3AMVA 4UM5A 3K71B 1N9GA 1ICIA 2GTIA 3Q98A 4TWZA 2E48A 2NZUG 3GJ6A 5D6OA 4DJJA 3RANA 3UWSA 3TRIA 13PKA 2XMSA 1EFLA 3G9TA 1I33A 1XQXA 3NP7A 4OFBA 2Z5LA 1GPBA 1MAHA 4WXRA 1LRJA 3RTGA 5TJHA 4B7ZA 1H1DA 3PQ8A 5FA6A 2Z56A 1F12A 1HG1A 1HXHA 4M8IA 4UASA 3SWWA 4PW0A 1QH8B 1ORHA 4TLEA 4PAQA 1DDIA 4NCNA 1SN7A 3CZRA 3LYUA 3AHCA 3CW2A 1YV9A 1TK9A 1ONPA 3N39C 5HJ2A 5T4FA 3SVTA 1L4MA 2NZ2A 1TYAE 3W6NA 2XX3A 2WUEA 2GHRA 4JUCA 4RYDA 4O2AB 2FRXA 3C3PA 2JLWA 5A3RA 1GFZA 3ZDEA 4LI0A 3OC0A 4LZJA 3QX9A 4PBSA 1XU4A 2Q41A 2QR2A 5F2KA 1Q1BA 2NYUA 3O74A 2C00A 4ZI2A 5KREA 2VP3A 2XT0A 3OOEA 3QVXA 4HDAA 4HF7A 1IJEA 2JAXA 2JEYA 2ZJZA 1SCQA 1DKUA 1T13A 4K88A 3SQDA 3BGWA 2NO5A 1P31A 1OAAA 2QJFA 3EFBA 3BE8A 2CNDA 1Z5OA 5ECWA 3DO6A 1XHFA 3CRMA 5KOIA 3VPBA 5JSHA 4RTRA 4G67A 4L16A 1R27A 3ZE6A 3IUJA 3MIZA 3ZHXA 3DYVA 2VAPA 1SC9A 1U3TA 3AY6A 4LJKA 3S68A 4F84A 4HOYA 2CNKA 2HLPA 3ZLTA 2D7CA 3A26A 1X6VA 5AM5A 4ZU3A 3W05A 1MRZA 2PKWA 1M6EX 5FTJA 3UATA 2HRRA 3WBBA 3O4VA 3A11A 3QVGB 4A9AA 3K9NA 3DDOA 5I4CA 2P75A 3I4FA 4D3FA 5M7EA 5CT4A 3OEEA 4TLAA 4D44A 4QXOA 1BHQ1 4XWWA 4HEA1 1SKUA 3CEAA 2AR9A 2GSDA 3A9SA 3NDRA 3PV0A 3T7TA 1XVAA 3VO1A 1TUBB 4WY2A 1N9ZA 1L5VA 1DUSA 1OBOA 3EG5A 4GR4A 4Q47A 4R40A 4ZQHA 3DC2A 4PLHA 3CT6A 1DO0A 2XB9A 4I8XA 3TLAA 1FJ2A 4LE1A 4CIBA 1F2UA 1Z34A 3FB1A 1MAUA 1GXSA 3AUXA 3LK6A 4TLCA 4C05A 1ZH0A 4BAZA 5IVDA 1MB4A 4JP8A 3PQFA 1FRFS 1TE2A 3NO4A 3JR7A 1VQ1A 4LRYA 2XTJA 3CX4A 4GIBA 1ZHFA 1UJ2A 2OQIA 2CLDX 3HDTA 5EJ9A 3NCHA 1NFQA 4YRAA 5KS2A 1DI0A 5E7MA 1D2EA 1WEKA 1YK1A 3RG2A 1E1CA 1EUYA 3WLKX 3B60A 3QBEA 1JAXA 1BGWA 3OCWA 2VSNA 2OFFA 4DMRA 1A7UA 3QU7A 4RW0A 4AZ0A 5AJWA 4AX4A 5K3EA 2CSXA 2NWQA 1EWRA 3AM3A 4I1SA 5DDIP 1ZIOA 1VGQA 1CERA 2FMIA 2HDNB 4URZR 1O6GA 4EI9A 4B3GA 3RSZA 1KZ7B 2AFVA 4QICA 5E2BA 4GOMD 4HS9A 3OQPA 3SBDA 3W77A 4UBOA 3CCBA 2HNBA 3STYA 4KRYA 1Z37A 1FMJA 2WZDA 3NI2A 3RIXA 3MGAA 4OHKA 3ETNA 4D7AA 1QG4A 2PUJA 4MH0R 3EIUA 5K05A 2D7DA 3IXMA 1M2VB 4KH1A 3O0DA 4A23A 4ZALA 3S2IA 1D2NA 2PEZA 5ADVA 4E5UA 1CRPA 3QKRB 1OLXB 2JJ1A 1BXGB 2ATCA 1E18A 3PI7A 1PS9A 1M1YB 3NALA 1W93A 2INGX 2R6DA 5CLIA 3S3TA 2VT3A 2R3SA 1S89A 1XN1A 3CHYA 3LY8A 2WVHA 3GEBA 1ORTA 5C4MA 5EWLA 5HOEA 1S8OA 3TQIA 1DXOA 2Z2XA 2CZQA 2GM4A 4Y67A 2HQSA 3VVCA 1F0PA 2CN1A 4OH1A 2FW9A 2YWXA 4F71A 2RHLA 4BKPA 3O8QA 3OU2A 3EDQA 3QLJA 2JFGA 2ZJ4A 1VHQA 1CEYA 1EESA 2ZI3A 2AMVA 5EJ2A 2DERA 2NVWA 4KAFA 1VL6A 1AX9A 4JASB 3O8CA 4MXDA 2KLHA 3CX8A 4LXTA 2FPPB 5J2TB 3NIGB 2O8CB 2O2SA 3V3KA 3HA2A 4WBNB 4GKKB 1EH5A 5H9VA 2GPWA 2TECE 4NPCA 3RTCA 5IK2D 2BUAA 3DDUA 2VA9A 3FFBA 4ARUA 4MGYR 3TAUA 1M67A 2P0YA 3QXCA 3PTAA 4DJEC 2D1RA 3AVQA 1BCRA 3PYMA 2CXPA 2EIXA 3KWLA 4GI1A 2HCJB 3GGGA 5JD4A 2QW1A 2CLIB 1X7YA 5E4JA 2W2KA 5E9QA 4ZV4A 4JQZA 3PUHA 1GARA 3QHQA 3L40A 2AGVA 4FMDF 2DHDA 4N7MA 2W6IA 1TF5A 4NU8X 2R6HA 4BVAA 3HLYA 4LPKA 4C9BA 1BFDA 4P5DA 1NQOA 3WKCA 4XEUA 1LJLA 1PT8A 2J7KA 3LQYA 4UDXX 3WQRA 4B0PA 5ADWA 3W5VA 1MVOA 2AEMA 4YH1A 1Z0KA 3KD2A 1V35A 3U4GA 2C92A 3M5CA 1NATA 3AR6A 1CT9A 2WM3A 4RY0A 1U3WA 1PG0A 4UDYX 4BNTA 3TQTA 1UBGA 3AVOA 3LYHA 4MGIR 1F20A 1NOKA 1W9MA 3TRJA 4QWWA 4P58A 4NU6A 3GFGA 1J7JA 4K9SA 4P93A 5BP7A 2QVCA 2BN4A 4FHFA 4Q7EA 3VR3A 1M1NB 1WUIS 5E6SA 1P19A 4B6FA 3FZEA 3QEAZ 2QRQA 2ZTVA 2IYOA 3GIDA 2X8LA 3FYHA 3FGPA 5G1PA 1TKBA 2QDXA 4WECA 3EQ6A 3NUZA 2BMJA 1IXSB 1PZXA 2CD9A 2GGSA 1YHZA 5AW4A 1GA1A 2BONA 1TU0A 4U9UA 3WX0A 4GKBA 1ODLA 1R6AA 5C35A 2RE8A 4BN5A 2NVUB 1MZVA 3QITA 4L4ZA 5DP2A 2FMUA 3FCOA 2BGLA 5CVDA 4E2FA 1SBHA 1THMA 3I2JA 3NDIA 3T99A 3WTBA 3WYNA 4ZCSA 4MV3A 2C2YA 5I4BA 2EW1A 2OLJA 3U1VA 2B20A 4AY5A 2X0RA 2NV6A 5SZKB 5AO9A 4GLFA 4CNBA 5DSTA 5KJEA 4MK4A 3UMGA 2R8OA 4XRGA 4AS3A 2JJMA 5JH7A 4ZHQA 3BF7A 1KI9A 3PRHA 3AH8A 4HGZA 3T9EA 4N41A 1LDNA 1DWQA 2HV8A 2WJ3A 2PT9A 3QTTA 4N8EA 2PUCA 3SAJA 1HQKA 1U3VA 1IPHA 1CUEA 2J4DA 1IPFA 2CJWA 9GPBA 2WVAA 4HGNA 3OTWA 1UKVY 4HMOA 5TVGA 2QGNA 4QARA 1SIBE 4W5NA 1KIMA 4MV7A 2B4YA 2DAPA 2CL5A 5JCJD 3LHSA 5LQMA 2VBCA 3O8RA 5FWYA 4XUDA 4DLYA 1N6OA 3PJEA 2A0KA 3S1LA 4AY6A 3QUAA 4R2LA 4BV2A 3JQ7B 3FE2A 1KZ4A 2EJVA 3JWHA 3LCVB 1USGA 4XB6B 2REBA 4MQMA 3OZFA 3ZU3A 4DCMA 2VQEB 1G8PA 4OB8A 2VUUA 3SR0A 1ZM9A 4TZ0A 1SG0A 2FKAA 3BHNA 1EVKA 4O2BB 1HOXA 4KGZA 3H97A 3JYQA 6REQA 2M6SA 1CKEA 4GBMA 2GHTA 1UWKA 1UFKA 4RD6A 1KL7A 4JLWA 3GC6A 1WUHS 4RXMA 4FS3A 1WCXA 4KQHA 4BO0A 1AQYA 4NABA 4J49A 2V6IA 1HMYA 4TYQA 1X8JA 3ANNA 3SPXA 1ZHOA 4OXRA 3K1ZA 1K75A 2R6AA 1ZD8A 2G6BA 2H0AA 4YLGA 2H9IA 4K9QA 1TM1E 2BDTA 2GJ4A 1ZX1A 1ZKDA 1QUEA 1Y4SA 2GK3A 4QPCA 2WDPA 3AV3A 4AZVA 3IUEA 4NE9A 1JKJB 5EJAA 4HLCA 3PSHA 3Q3GE 1JVSA 3UFXA 3HCPA 3B13B 4WAUA 4CCWA 2W7TA 2R84A 3HJNA 4B6QA 3AYXB 5T8KA 1GWNA 1VB5A 3A3KA 3F7TA 3PWSA 2V0NA 1LDYA 1FY2A 1KNQA 2VNJA 3IILA 2I2AA 4G5HA 1VC2A 4I36A 5AI9A 3ZGZA 3P2EA 1HDEA 1UIRA 3U9TA 1XZAA 3M4YA 5ALFA 5KC8A 4ZAVA 1PZNA 3F3SA 3WLFA 3B5IA 5I7OA 4QPNA 2WHYA 2P4UA 2V59A 4U0JA 5EAIA 1W76A 1FLAA 3OCZA 5EYPA 3UCFA 3UY4A 1GHTA 3RADC 3GFRA 3VVMA 4LCBA 5HP4A 4PGFA 4D42A 3GEGA 2YIJA 4ZQGA 1LDBA 2O8EB 2HA7A 1INLA 1G21E 4IHKA 3PNVA 2BF4A 4OHFA 1KFBB 3V4FA 5C7YA 3VI4B 1I94B 1H5QA 3H65A 3TW4A 4GOOD 4YCMA 1H5NA 1H69A 1TJ3A 2QN1A 4XCVA 1N57A 4HG2A 2HYIC 5DWVA 4H7FA 4UVEA 1Y1TA 4RMJA 1GPKA 3VBEA 4NIMA 4DIKA 3ZQJA 3RIHA 2K4MA 3RUFA 2EGHA 3NBZC 3PXEA 4WNAB 1SIWA 2Y99A 3DB1A 3H18A 3NGXA 4TROA 4EH1A 1AKQA 2CMDA 4ECAA 4B4UA 1FVXA 3RS3A 5C18A 5KYXB 4HVTA 1AUOA 5BPHA 4N0QA 1DAKA 1T8TA 5HRCA 4LKRA 2CY0A 3JZAA 5F3DA 3IBFA 3G1TA 3C70A 4QQRA 4R16A 4UTXA 3AP3A 1Z5UA 2FU5C 5EJ4A 5HKBA 2QIOA 5EXXA 1TCVA 1C3OB 1JFLA 1W8DA 2GNAA 3BTVA 4LUCA 4XDYA 3TZLA 3GFOA 1TW2A 1A8HA 1USVA 3TCXB 4BNNA 5JSZB 3HV0A 4FOSA 4L4RA 3IDOA 4GOLD 1MEJA 1L4YA 2VJBA 1ZYUA 2EL9A 4QEDA 2R4UA 4CZ2A 1PVOA 4QOJA 1WUYA 3T0GA 3QVKA 4BMSA 4DSAA 1UWCA 1V7ZA 2VRBA 2YKGA 1CIVA 4TKVB 3FCUB 4MYHA 3T5TA 4QFBA 1OXUA 1RLMA 3REFA 4G24A 1MO4A 4D8YA 5IT5A 3SJBA 2O6LA 1IBCA 4JP5A 3LS2A 5IF3A 4Y2RA 2V74B 5AJVB 4UTNA 4F11A 2H54A 2HOQA 3HEBA 4OP3A 3ZHQA 4YRKA 4KJZA 2V6FA 3P20A 3QKTA 3UK7A 1UT8A 3GEMA 3GDOA 2J3IA 1KETA 3NJRA 1N5OX 4I6GA 4K46A 5ALQA 4D57A 3H0CA 5C5CA 3ZDRA 2NXCA 5EESA 3UYLA 1WA5A 3D2AA 2QEQA 3L0OA 5CB8A 1EKXA 1OJ7A 3E15A 1OVMA 3TL2A 2FOLA 5BOVA 3WG9A 4DXAA 2H92A 1TKCA 2C57A 1EVJA 1T3LA 1WXQA 3CF0A 4HSGA 2VG8A 4LNHA 4MQ4A 4ZD6A 5BSWA 1W5SA 1GGNA 3VSAA 1QHFA 4KWEA 2GEKA 1AG9A 3EVAA 1QAQA 2LDXA 5G02A 5DM60 2JLUA 4I50F 2BOVA 1SOVA 1DDOA 1QC5B 4MV5A 3F5FA 4MS3B 5ALYA 5CPBA 1BMQA 1BA2A 1YHNA 3MTBA 1HDCA 4GD3Q 1YVUA 4R2JA 2IXGA 2RHDA 2PRIA 1KIAA 2ZYSA 3CM0A 3HYSA 3SLGA 4NV3A 2VA8A 4FJ0A 2HFKA 3A1VA 4QPDA 1EWKA 1GD1O 4QVIA 4KO2S 2QXUA 2ZRIA 3BWCA 4DV7B 4Y0NA 2RK6A 1AA6A 1IY2A 1YS7A 2QX9A 4LRTB 1DAEA 1W25A 4N3AA 4RD3A 3STWA 3ORSA 1YI0A 1WMEA 4ETIA 4N6OA 5DKFA 4YRCA 2X9QA 3VNQA 1SU7A 3UGJA 1I1NA 2ORIA 3ODGA 4JUIA 5K3BA 4GKAA 4LV5B 1E99A 2RHWA 2VC2B 4UNQA 2Q3LA 5FUVA 3QUCA 1BNCA 4CMJA 2ES4A 1OBHA 2C5FA 2X23A 4XJSA 5C1PA 4DNFA 3IUBA 3NPAA 4DR5B 3W5DA 2WFZA 3Q9UA 3ULKA 2XZLA 2FPUA 4ZEOA 1C1XA 3VNVA 1KO8A 5HKKA 2IU4A 3TWOA 2XE6A 1HEYA 1UH5A 3BFJA 1F9EA 2HTEA 1JDJA 1G1MA 3K0CC 4M0PA 1Z68A 4FE7A 1ZS9A 4NENA 3D8NA 1ZRMA 3LYLA 5B3AA 4AUKA 3AQIA 1GM5A 4BP1A 4D9CA 1TAQA 4ZFNA 3OUZA 5JNTA 4MVXA 1GZSA 1X92A 3FMOB 3KQOA 4OH7A 2AFHB 1L5HA 1GDTA 1D6NA 1GG8A 4X62B 1C0IA 1Z0IA 4JC4A 3KYDB 5JCPA 1U0OC 2VBFA 2Z43A 5THQA 3WGNA 1QB7A 2WQ7A 2CW5A 4B8ZA 4GO1A 1OV4A 1KI1A 2J4FA 1JTFA 1W47A 2H31A 2YDYA 2WA2A 4QUAA 1L4NA 4AMGA 1W5TA 1R8QA 1S9DA 2GPTA 1R9JA 2VDWA 1J00A 3FTQA 4Z8XA 1H2FA 1P7VA 2G1UA 3E61A 1EAMA 4N49A 3SJCA 4OGGA 3TQCA 3S44A 2JLBA 2HWYA 5KYYA 1DBWA 4U2EA 4G0MA 6CHYA 2GK4A 1DS6A 1ZL0A 3IULA 3FNFA 3REOA 2QDKA 3F67A 2JBAA 4EF4A 2ORED 5A62A 2XF8A 4TSFA 2IHJA 1QWSA 3OJFA 4FHCA 3VR4D 4A3SA 1ZU4A 3S2ZA 4DYDA 1FNSA 5SYNA 1WDTA 3E84A 1YJQA 4B33A 2ID4A 1MOSA 5ITVA 5DYYA 2IHNA 2IV7A 2RBEA 3PQ2A 3SLRA 1TEVA 5A0TA 1ZI9A 2Q1WA 1TAGA 4J3JA 2GZ1A 3OOHA 4XIYA 4HYQA 4J03A 4BJ5A 2J6HA 5E7QA 3TZBA 1NFFA 3KZNA 4C4AA 4CFZA 4S12A 3T5MA 3V7NA 4MRVA 4R8MA 5ADUS 2PRKA 3KT0A 1W6RA 1Z0AA 3M81A 4OFZA 5CA1A 1XZBA 4EYQA 1NT4A 4Y1EA 1TTQB 2W6MA 2I66A 2YFKA 2FPLA 4LDAA 3VU9A 3ZKWB 4ZYUA 2B92A 5JJ5A 4KGDA 4MVJH 4YJHB 1NNEA 1E2KA 2HW8A 1EFRD 2N47A 3OCVA 5A9SA 4NPAA 1DC6A 1E62A 4RA9A 1VLLA 4PRLA 2H3HA 3OQIB 3DMGA 4U2BA 3S2UA 1KAQA 2QRKA 3PWKA 4UFNA 3HI6A 1TOAA 2BTQB 3JRNA 3X1WA 4ZI7F 5EZYA 3INTA 1HNWB 1T36B 3FWHA 3BPSA 4TV9A 4DLNA 1XQVA 2R6JA 3Q6NA 1AUQA 1HZJA 2QRPA 4IIXA 3VRHA 3UHFA 4DC0A 2JA1A 4WLUA 2HL6A 3PT5A 3BAFA 4WXPA 3NC4A 1HDIA 3UB3A 3FKJA 1FYDA 2ZWIA 3WDLA 3X1MA 2AXEA 1CE8A 2Y1GA 5TY0A 2YYSA 2XBMA 5DHAA 1D3AA 4K8OA 3AXTA 4BTVA 1G2OA 3D0KA 2CV0A 2BE9A 4UOZA 3FPFA 3N2GB 4XUGB 3T1QA 3TM4A 5K7SA 3N5KA 2ZS7A 4QYWA 3TSOA 1JDVA 2FXIA 3PHCA 5BOSB 1JDBB 3UNXA 3AR5A 2FN3A 3G2LA 5HILA 9ATCA 1Y1SA 1GT91 3M89A 3O5AA 1ZUWA 2YOGA 4KAJA 1B73A 4B3BA 4LTMA 5AW8A 3THWA 4FEAA 2H1OA 3MWEB 2ZI6A 4RELA 3B2QA 4G5QA 5FNVB 1H2YA 4B3XA 3PZRA 3OESA 3RQIA 3OJEA 4MP6A 3UAYA 2WHPB 1O0CA 4X97A 3E5HA 1A95A 4KXFB 3UTDA 3I0NA 2A0XA 1P45A 5JBQA 1N75A 4BWYA 3DOOA 1HC7A 1KI8A 5LP6B 1OZHA 4KUGA 3FRJA 1FP1D 4GLLA 4JL5A 3VJKA 5HUJA 4IIFA 1QIIA 1MF7A 1P77A 1EP9A 1EWQA 3NIWA 3FOWA 5C80A 3RJMA 5BQ3A 2C0CA 1R0ZA 2CCJA 4B85A 2I03A 1G9SA 1O89A 4EJ2A 4EB0A 2FP4B 3KAPA 1Q0SA 1QH8A 1HL3A 3HBFA 3SEAA 1UC9A 5LMNB 1SKQA 4ZRNA 1GPDG 4UKDA 3CJTA 5MN4A 4QTYA 1SIUA 2WW8A 3K2QA 4INAA 1TZKA 2XCUA 2YWJA 1DOAA 3IP7A 3NUQA 3V1MA 2HMTA 1UJBA 1KFJB 3ETCA 1D6SA 2Q3MA 4E2XA 5D51S 3VU8A 2XQVA 5AVYA 1WY7A 1DXHA 2QS9A 4QVKA 5LIPA 2FRDC 1U3FA 8MHTA 1A2KC 5KTMA 1U6KA 3CLUD 2XXAA 1GSOA 1SY7A 4P3NA 2OO7A 3ZK9A 5FOWA 3TX6A 3NVAA 2IYWA 4QXMA 4BJ1A 2PCLA 1AGXA 4D3ZA 3REGA 4K05A 1E9AA 3ONVA 3H2HA 3LLUA 3O9VA 2PMDA 1VXOA 2GZRA 1KJNA 3EDYA 4X0EA 4UJ5A 5JASA 2EBHX 3EAFA 1YQWA 5SYMA 1FS6A 1OH8A 3S99A 3J81k 2PZJA 3IDSA 3VZBA 1JLHA 3FUTA 3C16C 4M4SA 5FYDA 2CKDA 2YJ4A 3UICA 3DCJA 3KSZO 4UD6A 1W1UA 3WIEA 4GE3A 1YR1A 5ALLA 4FFRA 3ZU5A 5KTNA 2WFAA 3X1KA 1XSEA 1E2DA 5TC4A 3B48A 4DJ5X 1ISPA 4NFYA 4ZOEA 1L5WA 5HF9A 3WDSA 1Q91A 4G1FA 3EBOA 3O82A 2R1TB 3ELDA 4I46A 1Z7GA 1U5AA 4JI6B 4P0QB 5HJEA 2DH6A 1PWHA 1HFWA 2FZ5A 3VKHA 4EPWA 1P4AA 2KLBA 3CU5A 5JAIA 1JN0A 2ZDGA 2J8ZA 1R4NB 4Q4AB 5DRYA 1ZOLA 2QGFA 1J33A 1UBOS 4YCCA 4OQZA 4A8HA 3IOCA 4LHVA 4CBVA 3AR2A 2EZ4A 2J87A 1P1JA 2PA0A 4FKZA 3GFFA 4FZ5A 4H4DA 4AWBA 4BTLA 3N7UA 3OJ0A 2N1BA 5JISA 3GN2A 4BLRA 1UPFA 4U5XA 2YC2C 3JQ8B 1NC1A 4DQLA 4I99A 4WKOA 4EW2A 4LQ4A 1H65A 5FUMA 4ALLA 3H1PA 5ICMA 1LXCA 3CNBA 1DAFA 2TSYB 3THXA 4G5OA 4ZAGA 4MQ5A 4K6MA 1U3UA 1FTWA 4RZSA 4KIJA 1T8UA 3R6TA 3HP4A 2X15A 1OXTA 4KCGA 3GEEA 4J6EA 2FDCA 1Y7LA 1GKKA 2YIMA 2JLZA 5JEEA 5CPFA 4URHA 2NXEA 4KYUA 3GP8A 2RH9B 3RKSA 3D6HA 2DUJA 1T0HB 2YDXA 5FL7D 3T12A 5EPEA 2WWVD 4ZZ0A 1C3XA 4EG3A 2C8KA 2SKEA 1L6IA 1TLLA 4HP8A 1IRIA 3DA8A 3KAJA 3MWDB 5C8ZA 3NDBB 1H5UA 3EGXB 2IUYA 4HC4A 5T4HA 1R8JA 2JZNA 2QYHA 3BZWA 1MAAA 1SUEA 1L5SA 2OGUA 4D41A 5ARCA 4PF1A 4MPJA 2RAVA 1XCJA 1Y3AA 4JYMA 4E5MA 4I55B 3PNBA 2J5BA 4V39A 5JYEA 1TJPB 3JZMA 4PZUA 4RVCA 4Y2GA 5B1DA 4KI7A 1QCYA 3BD7A 1FA9A 2Z6AA 1DE0A 2R6FA 1H1TA 2FZLA 3PEYA 4HRVA 1J21A 3QKRA 1OLXA 1VPVA 1BXGA 1XXHE 5B4VA 2YY7A 1O1YA 3HN6A 3CXUA 1W8IA 1M1YA 3SDZA 5FUQA 1US8B 4QPPA 4HXFB 4WCDA 1LPMA 5AW0A 3BCSA 5TARA 4CKEB 4LCEA 3ZS9A 3HY4A 1ZVMA 3Q6MA 4GM4A 4YRPA 5JMTA 4A82A 4S04A 4Q16A 1GZUA 1H23A 1ZLXA 5AUQA 3WL7A 5JC8A 4NV1A 2EKZA 3HP1A 3T5BA 5FUXA 5D1NA 3LUFA 3I6YA 4ZT7A 3GP3A 1JEOA 2O59A 4U7DA 2G67A 5C31A 1C7FA 1Y1RA 1W44A 2ZWVA 4DJTA 1AS0A 1TCCA 1DEHA 3EYAA 1T4CB 1NGSA 5F2EA 3ZNQA 1XEAA 2JGFA 2MSCB 2QUAA 4X61A 5BQPA 3WNDA 2FPPA 4BZXA 4KYTA 6GPBA 3NHRA 5J2TA 2IUEA 2O8CA 5FF9A 4RE5A 4WBNA 5EXTA 4LV6A 2BI8A 4LGVA 3HABA 3WL8A 3QNMA 4JI5B 3K92A 5B36A 3IOBA 1ODTC 4XSHA 4PNHA 5IJ0B 4EG0A 1MRSA 1PDVA 3DYBA 3S7TA 2J9YB 2VJQA 3NETA 4ND8B 2DPGA 3C8MA 4YGYA 1PWEA 3CLUC 3Q9NA 1RTTA 4NP6A 821PA 2Q27A 3NORA 5TMPA 5L6LB 5CK5A 1YFKA 3K9WA 4IG4A 2Z09A 5C8YA 5BW5A 5JPCA 5FL3A 1Z8FA 1DX6A 3OU7A 5K0TA 3MZ0A 4BUCA 2AFIB 2X40A 2XRZA 3UJBA 2PS0A 2GAJA 5A02A 2B21A 3AI1A 3H3XA 1X87A 4S1PA 5TQVA 5IC4A 3LC2O 2CXXA 1RXUA 2VJPA 1XZDA 3FH0A 2FW1A 1BS1A 1RXIA 2DUUA 3F90A 3OZVA 4I4CA 1WD5A 1CJSA 3WK8A 3UT5A 2YZ7A 3JZDA 3SZUA 2VWHA 3CBQA 4Z8YA 3MMNA 1OR8A 5IDXA 2RSLA 3MTIA 4MVJA 2HK6A 3DOJA 3G88A 4X7MA 1TO6A 1DIHA 1JBEA 4EI8A 4IY1A 4EHNA 2ZATA 1FSZA 4INJA 1HYQA 1FTNA 3HUEA 1Z36A 4I9GA 4DLZA 1M1NA 4LJ5A 2CDNA 2E4WA 2OBXA 1IPEA 3EARA 4IOKA 4OUKX 4PBRA 1NXTA 3QSYA 1XEFA 4B7UA 4KE7A 5JSQA 4AG6A 3R9XB 3QWAA 4HDCA 2VYVA 4M9SA 2CVFA 4DCOA 4WFJA 5G1OA 1TYBE 2JFXA 4LNAA 3A1WA 3T95A 5JCJA 3P0RA 3ND7A 4CKYA 1RLUA 1ZRNA 1Q57A 4LOKA 5DX8A 1NI4A 4M0DA 3QLTA 1M6NA 2VEOA 1DOHA 2LD4A 1M2GA 3FOBA 1RT9A 2GJSA 3RE1A 5I9MA 3TDMA 2QX6A 4ESVA 1ZNZA 4FHGA 4RFVA 1CRWG 3KKNA 4AP5A 1BVYF 1NJ6A 2FQQA 4C7JA 1NAIA 4HDSB 4YMLA 2QPLA 4TWBA 5JPIA 1GKLA 1IHXA 2R5NA 4MB2A 5ERYA 4A2CA 2WB4A 2PGJA 1T4MA 2QAGC 1S3GA 3QMVA 3PLRA 3DV2A 3SJAA 4ER6A 3QXXA 4JYCA 4JC5A 3WV5A 2B25A 1CS0B 3HVKA 5IAKA 3DE1X 4D6XA 5A4AA 1EINA 2GM9A 1YB4A 1PTJC 1SXGA 2PDAA 3FFAA 3H9EO 4NF2A 5D3QA 5KTYA 1G38A 1KFEB 4V03A 5HQ3B 3IP3A 4F46A 2OCLA 1J5PA 3E9RA 3JQ7A 1ZCFA 3JD4A 4MQUA 1DHTA 3EUWA 4HNGA 2MT9A 2FTKE 3CNQS 4D4GA 3Q1LA 2YJZA 4L78A 2A5DA 2YTZA 1CUIA 2LE0A 4OQMA 5LIRA 3K6SB 4DPLA 4LX8A 4LFAB 3ORYA 2QSJA 2UVQA 5EJIA 3COJA 1I5RA 4RY8A 4US1R 1IOZA 4Y2TA 2G3YA 3K0CA 2Q21A 3GCZA 4YI3A 5KKAA 2ZI7A 4RTOA 1QTQA 3C1UA 4GOND 1T6BY 4RWEA 5HZGA 1MAWA 3DLHA 5DK6A 1XCMA 3P8ZA 1L7MA 2EX0A 2ZJ5A 3QPUA 3G0DA 4Q21A 5FOUA 4JA0A 4F5YA 1FQKA 3JQQA 3EUFA 2W58A 4DQXA 1JYFA 2FR8A 3MRSA 2OXIA 1R0WA 1JQJC 2H2IA 4NQRA 4CG2A 2J3DA 1QSGA 3LXUX 5IKMA 2HJ9A 3PDJA 3AI7A 3STUA 4WEOA 4MVJI 5CU7A 1CUDA 3WY9A 3KCQA 4Z1MA 5LUAA 2XYQA 5B1YA 5CDYA 3G59A 2F43B 4EFDA 3KELA 4UZSA 4Z0HO 3SZOA 4I7EA 1IHPA 1YRBA 4EL0A 2GDZA 1HUQA 3G23A 2W6OA 3WYBA 2FE1A 4DSOA 4IV0A 3QJYA 4UNNA 5JLJA 1EGVB 2QTFA 3C87A 2G82A 1FW6A 3VDNB 3ESBA 2HIGA 3L7IA 1W581 4HRXA 2HLDD 3D8HA 4L9SA 4D9FA 2OAEA 1NLYA 3E5NA 3WHPA 1P3Y1 3NOXA 2CFCA 3T0IA 3VX4A 3X1XA 3TDNA 2IT1A 2J0QA 1YJXA 4G8DA 3WMWA 4AUEA 4H7HA 2F62A 2IDMA 4LGMA 3W06A 2ZSUA 3N7TA 2F59A 5GGXA 3ROKA 1ZO8A 3RYCA 1E3LA 2IRWA 3KP1A 4FZ3A 3GNLA 4QPZA 4IIBA 5EEGA 3GLKA 2D2EA 3A6ZA 2RK4A 2O2XA 4AC9A 1GU7A 1TZCA 4G0NA 4KQ6A 3TQSA 4CDNA 2IP2A 5I47A 3RAFC 3KO8A 4BVBA 2QD1A 2Z1MA 2H48A 4YASA 3FMIA 3ON5A 4MVJM 5D5PA 4E15A 4N82A 2CXUA 3B78A 4CL8A 1P2DA 3I39X 2QXYA 1E0JA 3AYZB 1NJ2A 2VT6A 1SXIA 3F6SA 1FRQA 1DT3A 4XSVA 3U60B 4UC0A 1A2QA 1T2VA 2DULA 2NO1A 4PAMA 3KS9A 1JB9A 4JL6A 2E5FA 5EXPA 4ACAA 3KE8A 4DLRA 2PANA 4IHAA 2Q3BA 4YREA 1LY1A 3J80A 4EYGA 5DTRA 3FOEC 2DQZA 3LX8A 1DUIA 1NJGA 5INTA 1IATA 1L7DA 4XIFA 2IF0A 3OTIA 4KACA 4XPIB 4ZPJA 1U7DA 1NVGA 3SC3A 3DZ8A 1CTQA 2OCDA 1F2TB 3QKUA 4NMXB 1EK6A 2PWBA 3HLTA 1C3OA 1PW5A 1ZVJA 3ID6C 4TLMB 4V0LA 4YRSA 5FV4A 4PANA 1LLCA 5KIAA 4JB2A 1QP7A 3T54A 3FNQA 4HWPA 4CL3A 4NYMR 2G8LA 1CLEA 2P90A 3IBGA 1EHIA 1QPGA 4ZJYA 1SBCA 3KSBC 3P0FA 5GZ1A 3P1JA 4JELA 3VYSB 5ECYA 1C1HA 1U65A 1S7GA 3KAKA 3FSRA 1VMKA 4LE2A 1FBTA 2D2FA 4ZC1A 1J5XA 1KEEA 3WSTA 5B55A 1JXOA 2NP7A 4M7WA 1FTGA 3TFQA 2Q29A 4BYGA 5I4KA 1Z4NA 3OJCA 2XIQA 1BEZA 2ADOA 1TU3A 2V7VA 3W6UA 5K0NA 1JGTA 3CNOA 4HQKA 3TMAA 3WLSA 2C3OA 2B8WA 1SG9A 4DPMA 1PL8A 3CE9A 1L5RA 4GYJA 4PPNA 1NBOA 3PPIA 1BCSB 5HDBB 3HKDB 1K66A 2H2WA 3EG9A 1YE3A 3FKSD 4QGFA 4CV2A 3MAAC 1K6IA 2VWPA 4FILA 3GT7A 2JBHA 2GSWA 4FMDB 3MD9A 1RM0A 4AJJA 4B7XA 2R6CA 1ESMA 4XEHA 1UMBA 3WQHA 1D7OA 1I4DD 3EYWA 4AN0A 1QC5A 2HK9A 2ASEA 2VP5A 4MS3A 4QOGA 1KE1A 3UBMA 4HQOA 1UOOA 2OO3A 1H0SA 4GQAA 3GRAA 1BE6A 3LIIA 1RCFA 4C6RA 4FFOA 4ETMA 3FPKA 1NP7A 1CETA 1BE0A 2V9CA 2WR8A 3KOXA 1Z6AA 5AXAA 3KE9A 4DNXA 3CKMA 3GHYA 4JR2A 3T1HB 3MG9A 3JXEA 2XXJA 1UL1X 3D8UA 3O1HB 3OUTA 4HN9A 1GN9A 2XUKA 1G9XA 4BQSA 3R3HA 5JECA 2XECA 3DV9A 3BBLA 3DNMA 2RGRA 3KQNA 5ES4B 4HVLA 1WZEA 4Y9SA 4J0QA 4LAFA 4EHHA 4ASUD 2R0QC 4ZTUB 5EHGA 4ZOAA 2V0GA 1ESCA 3H5LA 4RVGA 3UAXA 1KI4A 4NESA 4A6DA 2C4UA 5L3QB 3CKKA 3WZLA 3A1DA 4Q4JB 2BKXA 4S1TA 3FNGA 4DBVO 4L4SA 4PYJA 3WGIA 1NUQA 2IXAA 2RIPA 1PNQA 2QG6A 3I52A 3KUCA 2XUZA 2QVBA 1C3LA 5I9TA 3S2YA 4KO3S 5FPPA 2W6ZA 3KIPA 3FUXA 2CE2X 4UDOA 5DF1A 1PLLA 4RXTA 1UEXC 2QD4A 2BFEA 3D02A 2DSTA 3DW1X 1NM5C 3P52A 3GY0A 1VLQA 4HAXA 1UKZA 1SJ9A 1V9CA 2AFHA 2NGRA 3M3HA 1H2RS 1J2UA 3NHFA 4JXJA 3U44B 2FSGA 5GGYA 3KYDA 2UYQA 4X90A 2JJ8A 3UUEA 1C9YA 2I2XB 4HD8A 2AG8A 4B3MB 1AE1A 1W4AA 2Y1KA 5JMPA 2ZUDA 3ISVA 2GCOA 4JYPA 4YDRA 3SZGA 4AAYA 3DC7A 4D2IA 3D4OA 1BXRB 2VP6A 4YJFB 1OYVA 3I3OA 2HNAA 1HE8B 1N6RA 3FPCA 4EO9A 1V9LA 3QRWA 1JR6A 1YDWA 3QVSA 4OV6B 3AHEA 3QTBA 4RENA 5EHQA 5I7HA 2F55A 1YJAA 1S2IA 1QIJA 4L2IB 4J90A 5CHEA 5FNZA 5AVJA 3MMZA 5JD3A 2PZBA 1I7PA 1XTVA 4N76A 2A1TR 1CRZA 3ESZA 5JR3A 4DG5A 2CHUA 4JNKA 4MKRA 1EFRA 1R0KA 1NW4A 4I8DA 1G5IA 1ABFA 2V8BA 1NW6A 3WOVA 3KT6A 1N3IA 1F2DA 1SZPA 1YF3A 4Q93A 1K7SN 2I6GA 3PYXA 5BR4A 3SYLA 1SWVA 1E69A 3TZEA 4X1OA 3ZV3A 1P9WA 4UAVA 2O8BB 2R7AA 3RVNA 2VSXA 4MB0A 1OROA 1KS2A 1W29A 4GYYA 3NS7A 4E5DA 4FZVA 4MICA 2J6CA 5TPWB 2KHZA 5BRAA 3KWFA 5ALSA 2PUWA 2WUVA 3MUNA 2ZVPX 4RPIA 1XNJA 1GGHA 1I01A 1NDUA 2F00A 1OWOA 4JLUA 2PH1A 1RRPA 2I78A 3QIAA 2BTOA 5B7PA 1I14A 2FWAA 3WGLA 4F9TA 1DEXA 2JGRA 4TL7A 4YJHA 3T3HA 5HVNA 1A2OA 3FBGA 2JASA 1WW3A 4I1UA 4UEOA 3Q1KA 1WVIA 2PT6A 1V1RB 4QUHA 2WJZB 5JQWA 3FSGA 1WNTA 3OQIA 1TMGE 2Y0EA 1MN6A 3BWMA 3WVNA 3MMXA 3PHBE 1QE3A 1C1DA 3IA2A 1ID8A 1XO1A 4UNRA 2GBIA 1KK2A 4IIJF 5DX0A 2YHAA 5HZHA 4FYPA 1X80B 3ZU4A 2HSEA 2I4OA 2G0NA 2VCEA 4EVSA 5K8CA 5EC8A 4QM6A 3KXLA 5E0KB 3BRSA 1BFUA 1DAIA 2XRYA 2B83A 1VSVA 2WVGA 3G0GA 3JD1A 5H0IA 2BKAA 3HS3A 4XLZA 1JZSA 4YALA 4PZEA 5B12A 3IGFA 3FBWA 5ESXA 2EEPA 1KI6B 1WWKA 2QQFA 2R4QA 3DOFA 4FB5A 4I9FA 5BOSA 2IDKA 4IQ0A 4R8RA 4FLEA 2HGSA 4ACBA 4ER5A 1O4WA 4L72A 3TPZA 1E2EA 2W2QA 3RFFA 2WUDA 4CT4B 5FBZA 5HK9A 4RTJA 3AVXA 1E1YA 3MWEA 4MUAA 5FNVA 1HX7A 3QPVA 2C0QA 2OB1A 2PSJA 3H6HA 1TA0A 4DLLA 1Z5ZA 3O90A 2WHPA 1XROA 1IBRA 2HBZA 1U7PA 3R3VA 4NBWA 5CT9A 4W7IA 4OBXA 4IEEA 5ERGB 5K2MA 2BZGA 4DJFC 1BDHA 1KVQA 1PP4A 2ZCVA 1I3KA 4IIDA 4AQYB 1IG0A 3ZNNA 4QBIA 3KHUA 3G5AA 2R9VA 2PH7A 2R44A 2WD8A 3ZY2A 3EFHA 1Y8RB 5DI9A 4EYOA 2EKLA 4PYNA 3WP1B 3QLUC 4D4MA 1UFRA 3M4JA 4DZZA 3H75A 2FP4A 4KP7A 1DBQA 3VGJA 2J33A 1V96A 2EZ8A 2WOOA 1D7AA 1E3JA 3BMQB 4D9BA 2IZ7A 1EA5A 3EK2A 4RMHA 4FFLA 1A5BB 3CUWA 2X5XA 2K5UA 3ORFA 1ND6A 2HRZA 2WVJA 1G6HA 3R23A 5DBFA 1HYHA 1LPSA 4N3BA 2VATA 1V7QA 1RM4A 4WLEA 3G79A 1KY4A 1L5MA 3RVOA 1Q1ZA 2A0WA 2JGDB 4WLNA 2WP0A 2C5GA 4O2RA 1XZMA 3NHJA 2FI1A 3ZQ6A 3CRW1 2R65A 4AJKA 4ARIA 2VQSA 2VLIA 3NEJA 1HKHA 4OJKA 1U1EA 3SN6A 1KP3A 2I3AA 2ZTHA 3QU9A 4EHKA 4JI0B 2YFHA 2PKQP 3AJ8A 3Q9LA 4I50B 5C1BA 2ZAGA 3UEOA 1U99A 3C3BA 1HFJA 4B6SA 1ZZGA 1Q0RA 4XDZA 1NKSA 3T3GA 2A0YA 3S8MA 3Q7RA 1BYUA 3JQFA 1RQ7A 3V42A 3O4JA 1E1DA 1QGUB 1R0BA 2XUGA 4UULA 5IUJC 2XQIA 4WACA 5ALNA 1H4VB 1BDMA 1PJCA 3QW4B 1T3TA 3ADOA 1V25A 4MEBA 4R7TA 1J2RA 1QHYA 3LPCA 2F3RA 4RHYA 1V43A 2WNSA 5JFTA 1LPAB 4FOPA 1U0SY 4JVLA 5HM8A 1KKLA 5EWMB 4L08A 2R1TA 3KDSE 2PBZA 1LZLA 4BYMA 4YUZA 4BE7B 3HDQA 4JAVC 2X0JA 3OPMA 2VR1A 1SK9A 3I5UA 3ZZTA 2QAGA 1E3SA 3RRZA 4DHWA 3CV3A 1BVHA 2E9SA 1QNLA 1R4NA 2JI8A 3HYTA 4Q4AA 2SNIE 5IBCA 2HA6A 3Q87B 4LZOA 1Z7YA 4O59O 5CH8A 3SVZA 4ENPA 4BU0A 5EIOA 3WMRA 1KYQA 1PTJA 5JFGA 2A7QA 4KSYA 4DMLA 1HURA 4F6RB 1DMRA 4G3XA 3D3QA 3PGMA 3OEHD 3S28A 4CMEC 5IYZB 3JQ8A 2J41A 3RVDA 1L5NA 4IBOA 1XZKA 4YT4A 2XDWA 1EG7A 2C07A 3QBTA 2W6NA 4LJ9A 4PFQA 3T9CA 3UXEA 1ONOA 3LUBA 4QO7A 1XJ0A 1I4TD 1OSNA 2IVFA 5ERXA 4QECA 4UM9B 1GVNB 2BEWB 1SVKA 2A1IA 1II8B 5EMLA 4OQNA 5CG2A 1BHJA 1XZEA 4TRNA 1DQZA 1ISMA 4DANA 5KNDH 2D3WA 3CR3C 4PLCA 1A9PA 4INZA 1NVUQ 1JDNA 2DUMA 1UC4B 2ZQYA 2Z3WA 1UXKA 1GPLA 1IY9A 3X2EA 3MWFA 3GGCA 2P5UA 3MPUA 2P7IA 3B1WA 1SUWA 3MWDA 1WXIA 3NDJA 4PPFA 3G7NA 4TQAA 1E32A 2PNJA 5A9RA 1GITA 1H42A 3J7TA 1AKEA 3DD5A 1CUVA 3BRWD 3ESDA 4R69A 2PV7A 4XWAA 4EPTA 2PX8A 5I7SA 3WLOA 4QQNA 2NV2B 3CONA 4I55A 1YUNA 1BS2A 3EIXA 3R4CA 5THKA 1L4UA 4X71A 4FDVA 4PNZA 2AJCA 4UM9D 5EUQB 1DDGA 1KDVA 1QVZA 5ISMA 3COZA 4UEQA 2DXIA 1YI8A 2ZWOA 1L7BA 4NC9A 4HS4A 1B16A 3ZW7A 3UGQA 1E79D 1US8A 3I9JA 1YONA 1A76A 4KX5A 1IVSA 1XHEA 1ZJ4A 3DMTA 5AUPB 3CURA 4KDCA 1QYDA 4O1HA 2YBDA 5DGCA 4YPFA 5B2EA 3NHKA 2YX1A 3TDKA 2ZRMA 4EM6A 2PWPA 2IXFA 4ZVMA 1O87A 3CC8A 1V6SA 3KHSA 1T9DA 3G5LA 1I6WA 2G71A 5A3VA 4CCSA 1PZEA 1Z8HA 1NV9A 3PNKA 1YE8A 3FPAA 3G6KA 4LRUA 1GJRA 3IALA 3JQ6A 3HZZA 1T4CA 3OZ7A 5AKZA 3TSWA 5YASA 2PCJA 4M8NE 1AUPA 1D4FA 5B6PA 1DAHA 1PLKA 1LVHA 1FZTA 1DBIA 1R88A 2Q3DA 3ZCXA 4D74A 2D00A 3VR6H 4J7UA 4NU5A 3RARA 4BRUA 4ZI7B 2DBQA 3GEDA 2YFYA 3P9QA 5JRDS 2WTEA 1YRYE 1PJAA 2HWWA 2WIDA 2D2VA 2HFJA 2WF8A 2WT9A 3HL0A 4N8SA 5REQA 2DFKB 4ND8A 2WTXA 3WK6A 4ITVA