3GJRA

Caspase-3 binds diverse p4 residues in peptides
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
141
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-3 subunit p17
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 51
structure length 141
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gjrA00
4JQYA 4QUIA 3V3KA 4QUJA 4NBLA 4NOMA 2QL7A 1KMCA 4QUHA 3GJSA 5JFTA 2CJYA 1GFWA 1RWOA 3D6HA 4PS1A 2QLBA 4EJFA 2J30A 1PAUA 1QTNA 1IBCA 3IBCA 4N6NA 5IANA 2CDRA 4HQ0A 3NR2A 3R7BA 3H11B 2XYPA 3DEKA 4ZVQA 2C2ZA 3R7SA 1PYOA 1K88A 3PD0A 2XZDA 2Y1LA 4JR1A 2CNKA 3NS7A 4EHLA 4ZVUA 3PCXA 4PS0A 2CNNA 4QTYA 1RWKA 5IC6A 2QL5A 2AR9A 5H0IA 4D3ZA 4NBKA 2C2KA 1NMSA 3GJTA 2J33A 3UOAB 3H1PA 4I1RA 5I9TA 5IAEA 5LUAA 5I9BA 1RHJA 1SHJA 4N7MA 4QUBA 3ITNA 4HQRA 3V4LA 2K7ZA 2FP3A 3PD1A 4NOLA 4AWAA 1BMQA 5LU8A 1RWWA 2QLJA 2C1EA 4PRYA 1RWXA 3V6MA 2H5JA 4EHAA 2XYHA 3S8EA 5IBPA 4DCJA 4LSZA 4QU8A 4N5DA 3V55A 4N7JA 1RWNA 2P2CA 1RHMA 2XYGA 4IYRA 4QUAA 5LUBA 1CP3A 4EHFA 3BIJA 5IAGA 4ZVSA 2QLFA 3KJNA 4JJ7A 5IABA 3DEJA 4NOJA 1I51A 1SC3A 3P45A 1I4EB 3GJRA 4EHHA 2HBYA 2H54A 2FUNB 4QU0A 3OD5A 4AWBA 1SC4A 4QU5A 1NMEA 3R5JA 1F1JA 1I4OA 1CVRA 2QL9A 1RWPA 3DEHA 4QU9A 5IAJA 1RHKA 1F9EA 2C2MA 4ZVPA 2CNLA 3P4UA 4FGUA 5IASA 2CNOA 4NOKA 4QULA 1NW9B 2XZTA 4EHNA 4I1PA 2H5IA 4JJ8A 1SHLA 3SIRA 4JQZA 1M72A 3NKFA 4ZVRA 4AW9A 4EHKA 5IBCA 3R7NA 3H13A 4FXOA 4ZVTA 4D3YA 3RJMA 1RHQA 5IC4A 2WDPA 1JXQA 1K86A 4DCOA 2H48A 1RWVA 2CJXA 4PRZA 1RE1A 2H51A 4ZVOA 1ICEA 3V6LA 4FDLA 3KJFA 4N6OA 1QX3A 5IAKA 5IARA 3V4OA 4HVAA 4JJEA 4M9RA 4DCPA 3S70A 2HBZA 4IEFB 4JR0A 3SIPA 3DEIA 3D6FA 1RHUA 2HBRA 5IBRA 2H65A 3IBFA 3K7EA 4JB8A 3H11A 2Y0BA 4NBNA 3UO8B 3E4CA 4JR2A 4QTXA 3GJQA 4EHDA 4D3XA 2C2OA 4QUEA 2H4YA 2J31A 2J32A 1QDUA 2HBQA 3R5KA 1I3OA 2NN3C 3H0EA 4QUGA 1SC1A 2FQQA 3KJQA 3R6LA 3QNWA 4FEAA 2H4WA 3EDQA 1GQFA 3R6GA 4N6GA 4QUDA 3D6MA 1RWMA 1NMQA 3EDRA 1RHRA 2DKOA 5K20A 5LU9A
chains in the Genus database with same CATH superfamily
2R8RA 3KNZA 1P3Y1 3SHVA 1SVSA 1LK7A 3MQ2A 4LG1A 4LECA 4KYUA 4PWYA 3T7AA 4DV5B 2H2DA 1WXGA 3AVYA 2A88A 5THQA 4LDNA 3AERB 1ZD2P 4AJKA 1ZIDA 2DTEA 2FEOA 2FPIA 3UYLA 3VVMA 5CFRA 5M7EA 4G8CA 1J9EA 1Y5MA 2O3UA 2D8AA 1HDXA 4NZOA 5JXWA 4R05A 3DL2A 4IKPA 1DOZA 4TXNA 5JRJA 3C4VA 1XU9A 1F20A 3L7NA 1G9TA 1G2QA 2BMWA 3GT4A 4H6WA 4CQNA 3S28A 3NEYA 2AL7A 2EG9A 4HD8A 4IV0A 1DFIA 5HCUA 3ZXUB 1LFAA 4KQXA 1UODA 3THWA 4BBZA 4ZN6A 4BVHA 2ZCJA 2GEJA 3GLSA 5ER9A 1NR5A 4INAA 4UZSA 3LSTA 3GUUA 4PZPA 2PO7A 5ERYA 2W6JA 3TSOA 1Z0JA 4CL8A 1EK5A 3LBIA 2R1TA 3EXHB 3LW8A 2PZKA 1YIDA 2JVJA 2HF9A 1G8KA 4JROA 4KRGA 5AQEA 4UHDA 3WI7A 2UKDA 2P35A 2A7XA 2E9SA 3Q6IA 4Z9XA 1J24A 1Q16A 1S8AA 1DT5A 3B1JA 1W2WB 1GKLA 2Q5IA 2ZR9A 3OLXA 4FCTA 4IIDA 1U2PA 1XTPA 2BGRA 2R48A 2HNKA 1O54A 1KFCB 4V0QA 1RI5A 1YRBA 3KKLA 1SIOA 5EJ4A 1LFDB 4YP7A 2QB5A 5KWIA 3AIIA 2PRZA 4OOEA 5DNAA 2ZYVX 1UIMA 3ZWYA 4NPHA 2HKIA 2GM5A 3OOSA 1NR1A 3PDUA 1C4OA 4TLBA 3O92A 4FGUA 2PWZA 1RIIA 3L4JA 3U61B 3FMIA 1ZEJA 4AYXA 1F14A 2IHZA 1MNQA 1QHIA 1QK3A 3P9RA 1SUWA 1FFHA 4FYVA 4IJQA 4TL8A 5H4HA 4EAAA 1I0LA 1GPH1 3VXKA 1OH7A 1C4KA 3WJ7A 1PE0A 3BL6A 3CUEF 1YB6A 2OLEA 4R0NA 3UOGA 2IT1A 3ZLBA 4CGZA 4CWAA 2PZEA 2RK4A 1GPMA 5IDXA 1OV4A 1FP1D 2RC5A 1SH7A 2J9YB 1XP8A 1Q0UA 1R8QA 3ZHOA 1DQZA 3E82A 5I8WA 1GZSA 4KQIA 4F8EA 3DQPA 4N0EA 2E0IA 4CQJA 4L08A 1YRYE 1PF7E 5ALLA 4J3NA 1GVNB 3RS0A 1NU8A 3WJ2A 4US1R 3ONFA 2MYTA 4JD5A 1FIUA 1B0ZA 1UJ5A 3OPNA 1GN9A 3U37A 5KNDD 1ZU4A 4BO8A 1Q7TA 1M5TA 4L02A 2LIPA 3ZW8A 4LDPA 2ZVQX 4Q3NA 3PX7A 4Y0VA 4Q48A 5KYKA 3WA7A 1T3HA 1EFRA 5FA8A 1NIPA 3HDTA 2BFFB 4EB6B 5KOYA 2X4IA 4D3FA 4Z7JA 1VG8A 4K9RA 4F12A 3MS7A 3HCDA 3Q87B 4P58A 1INLA 3ETGA 5FOVA 2BKLA 2WSSD 4I4TB 4BN4A 4ZRNA 4D2IA 1SG9A 5HKLA 3OO1A 1FSGA 4BVJA 5MN5A 2LWIA 1LI7A 1ULZA 2M1XA 3DYVA 3AJEA 4AZ3B 3QYJA 1C7ZA 1G6HA 1JFLA 2B37A 4MKGA 4C0HA 2GO7A 1F60A 4QGHA 3GAFA 5FF9A 3UKOA 4C7VA 4ER6A 4ZCRA 4WESA 3O0DA 4GLFA 4P4NA 5L4SA 2L2QA 2J0SA 5L3VA 5A4AA 5NULA 2D1TA 5LDGA 4C6SA 1T91A 4QREA 2AN4A 4F3YA 2C7PA 4EO7A 3HB9A 4BNFA 2TMYA 1LTQA 2AFIE 2C57A 2UYGA 1D2AA 1R15A 3IURA 1Z5GA 3SQNA 2WM8A 3M9WA 1JR3D 1CY7A 2O2YA 1BW9B 3HZHA 4HXGA 3WKDA 1EWTA 3V48A 2R84A 1TJPB 4TQGA 3UMMA 1Z08A 3ZZNA 4ENRA 3I9V1 2P78A 1E2PA 2X2PA 3R09A 2K5UA 4GUAA 4NBVA 1PG2A 1DS6A 3DB2A 3EJ6A 4QOEA 5DLPA 5LN1A 1DKUA 3ZN2A 5JASA 2UUAB 2BFBA 3DZ8A 4ISCA 5DFAA 3T7IA 4IUDS 3WGUA 1QE0A 1XHEA 4ZC8A 5BR4A 3U6BA 1EVIA 1NQ5A 2GBLC 3LT4A 4AWXA 4Z4IA 3NFYA 1NYLA 3FYDA 2ATXA 1N9GB 4L95C 5I8PA 1MC4A 3H87A 2O8NA 5J63A 3EZGA 1NFQA 4N9WA 3NLLA 4GXQA 4IEEA 3AQ4A 2PUBA 1YC2A 3S8YA 1Q0HA 3P2JA 1BH2A 1HK7A 1LV7A 3DVAB 1W4LA 2ZDHA 1B8UA 1RRPA 3MAJA 4M53A 4REQB 1D6JA 2JATA 1XTJA 1BMFA 2J09A 2Q9AA 5BRJA 1MIOB 3BDAA 4E88A 3IQGX 2JJQA 4MI3A 2J0UB 5EKUA 5FWNA 4HWKA 2BM9A 2J8ZA 5DYWA 1A8HA 2Y66A 2NSHA 1PJCA 2ZIWB 4E09A 1Y4ZA 3FLEA 1S1CA 1LGYA 1V9LA 3GARA 4N3CA 1BZYA 1LPNA 3QVMA 1L4KA 3HN6A 4G0YA 5CCEA 1M7GA 2RHTA 2WHPA 5H83A 3FBGA 3BA6A 3AR4A 1R4NA 3DDNA 3PIIA 2DT8A 4QSMA 5ALTA 5AD1A 1ZG3A 1FU8A 3IAHA 3CF2A 2QR2A 3CR7A 4FXOA 2G76A 3WP1B 4A5OA 3L4BA 2ID9A 4IJ5A 3GUCA 4JSYA 4KSYA 4Q12A 3IAEA 1YB5A 4U0KA 4ZOLF 1SCDA 1S6YA 2Q6KA 2Z04A 8LDHA 2R4UA 5IVHA 5JY6A 2PBRA 2BCGY 4CEIA 2PUCA 2PKWA 5ELLA 1E5QA 4OLFA 4YDHB 1FA9A 3VFDA 4PGMA 4EFKA 4D26A 3V97A 3WGQA 4Q7KA 2WUDA 2VKTA 4BKPA 1FTGA 1XP5A 2OAGA 2QM8A 4PFSA 4F5EA 1ORVA 4YUXA 5HKAA 1B41A 2PPVA 3HR4A 4NCIA 3S0JA 4AB1A 5JI2E 3SR4A 4F04A 3TB6A 3FVQA 4KPUA 4MLCA 5BR1A 3SMVA 4K9PA 2WNSA 4OBWA 3NFRA 1IXKA 1UDRA 3PFBA 2R8ZA 4JNKA 4RF5A 1VP3A 5FA5A 3DCJA 2C0QA 3HNRA 3L4SO 4LMAA 4B3GA 1NIJA 1Z7EA 3U4QB 1Y3HA 2V6MA 2R8BA 4XWGA 5FQNA 1IZ7A 5DLQC 3UKDA 4NKRA 1IN5A 2VA9A 3P0FA 1GEGA 1J1UA 4OBBA 4X1IA 2C7VA 2W83A 1PU2A 4J0EA 3M5CA 1A3CA 2GBFA 4RHYA 4RY0A 1C9JA 2XCOA 5ILGA 4YCLA 4RLQA 2B4AA 4F2DA 3EBLA 4YBRA 4Y2VA 3ZK7A 2DHCA 4LHVA 3OQ6A 4CNQA 4XRRA 4E4RA 5C1OA 2IBTA 1VIVA 5K0TA 1SIWA 3H17A 4EHIA 3HUEA 2O8EB 2DUWA 3WZLA 1RQGA 3UUGA 3RTGA 4P8RA 2C83A 1U9ZA 3QTBA 2MDTA 2ZJ7A 2A84A 2PMEA 1ISSA 1Z88A 2XVZA 2W8BA 3N59A 1S2DA 2GGSA 2FLKA 4GW3A 3IP1A 3FROA 1NDHA 1U8AA 3U09A 4Z7NB 4UNRA 2Z9DA 3MHTA 3GC6A 4RPKA 1ZH0A 3TQRA 3R5SA 3ZHZA 5BVHB 3RYFB 1N33B 4NCKA 1M54A 2O5VA 1RM0A 4ZAVA 2I6QA 2NM0A 4KU4A 3UK0A 3COSA 2HV8A 2IOHA 2O4UX 2M6SA 4RHEA 4LS3A 3TRJA 1J8VA 2I9PA 3LDGA 5E8JA 1QPBA 4BVLA 3S4YA 3FNFA 3K9NA 3HCOA 5K3FA 3IE0A 3N07A 3NRJA 2P5TB 2H2GA 3VO2A 3S2YA 3ENZA 1OFHA 5AI6A 1UJBA 3H4MA 3C3KA 4BLUA 3PRHA 2JFXA 2WSYB 4MWDA 5DGDA 1UF9A 5FPPA 1UZMA 4PNPA 4DC9A 2DFTA 3PNMA 121PA 4J2TA 1J8YF 4PG4A 5DK4A 5AKGA 5LDHA 2FPIB 3V4VB 4MUKA 3VU0A 1SXJB 3ETHA 3ZR4B 2B4KA 2FMUA 2PD6A 1ZGZA 1MTOA 3NEJA 1NBMD 4HPXB 4OKSA 4O0MA 5TY0A 2XAAA 4EKDA 3GAMA 2Z5LA 3RREA 1RXVA 3IIIA 1G5RA 5AM1A 3C5WP 1YTUA 1K4YA 5DGTA 1EWQA 4I6JA 4DLBA 3P5SA 3F5SA 4TKMA 4KR6A 2BDUA 5H59A 2WWRA 3HXMA 1R0YA 1I9GA 4GNKA 5A9SA 4JNCA 1M8JA 4OAPA 3THWB 4E5UA 4CLEA 4DDKA 4EPYA 3WNVA 3D4NA 4FR5A 3H83A 4WLFA 1LPAB 1SXJC 2WPDA 3BHJA 2VK2A 4KJZA 4X0EA 4BX8A 1LVUA 3UKJA 4KIWA 4A2WA 2HJ9A 1YS2X 4LTMA 4AJPA 4F84A 4V3BA 2SNIE 4J4HA 4FVTA 2R1TB 4UBKA 1IEWA 4PRKA 3JWJA 1SFRA 2V5AA 4DZRA 1UT5A 4UE6A 3TSWA 5AI4A 4B2IA 5KWSA 4WXMA 5I7EA 5T4FA 3IVMA 1KOFA 2QN9A 3Q11A 5BW5A 1XG5A 5F12A 4N5NA 3DFKA 1ZK1A 3OURA 4U4AA 1KVUA 1GDTA 3RUHA 1L5VA 1PFVA 1NQAO 2O1WA 5ENZA 4RDXA 1N6RA 3T4XA 2QW1A 3KYBA 5ICCA 3TFWA 1R2QA 4NV3A 4NONA 3WGOA 4X94A 2Y68A 5JCZA 2ZFUA 5AJUA 3GBPA 4QQNA 5JMWA 4Q93A 4A0FA 2CXOA 1RC1A 5C46F 1Z25A 4UD6A 5LWQA 3KJXA 3QXCA 3NDIA 1VI5A 3VM6A 1WR8A 4JYMA 4R9UC 2XZPA 2ODPA 3M6WA 3NCHA 3O9VA 4I55F 2HGSA 4OB7A 5EXPA 2RKWA 2PMDA 2EFCB 1QP7A 1LEHA 2VSOA 3PEVA 2FWBA 3PNYA 5J9FA 1NPTO 3LDAA 2ZJ5A 3EWAA 1YCDA 2QA5A 3L7LA 2VATA 4LMBA 5P8WA 4X95A 2Q49A 3RG8A 2YN2A 3TKAA 1ZA1A 2ZE5A 2X8JA 3FF4A 5GV8A 3RI3A 2HF2A 3OFND 1C7JA 2C97A 2FDXA 2G4CA 3C3PA 3D4BA 3I04M 3QLJA 1NRXA 1P7ZA 4JT2A 4XDZA 4ZVLA 4DA9A 5BUQA 2HWWA 1JE1A 4G9BA 4HN9A 4B43A 5CK4A 1E60A 2JEYA 4NH0A 4OX9B 3AF5A 3H2YA 3M4NA 3E84A 1ZD5A 3IR7A 4PHGA 4BO5A 3OLYA 1WB9A 3B6KA 3O8RA 2EFEB 5KTKA 2GNOA 1N7GA 3ZV5A 2Q50A 3BWEA 3R6WA 2ILTA 4P83A 2F8TA 1BNCA 3L9XA 4FSDA 2HTEA 1Y0BA 4Y9TA 2OHIA 4Q3DA 4AP5A 4QFDA 2R4TA 3DFMA 4CKZA 1UBSB 3C3YA 3ZKAA 4KNVA 2PRYA 1PTKA 1W49A 3PDIA 4OQXA 4ER3A 4L4RA 2Z2KA 1QG0A 4KFSA 1YKSA 3G02A 2W00A 2YWJA 3L7OA 2YMMA 3E7DA 1BX0A 3RW9A 3OIYA 3FOZA 1E4YA 1G42A 1T9BA 4MUMA 4E14A 2XF8A 4RA9A 3TBFA 2J48A 3D8SA 4B5KA 1ZI9A 4PRYA 4ZMRA 1JDVA 4MNTA 4WESB 9MHTA 4ZT7A 3BH0A 4GOOD 3SZLA 3GA0A 2D4HA 2ET6A 5SYNA 5FV7A 4CM9D 1TZ2A 1ZOSA 2MSCB 4O33A 1ZEMA 4O1MA 5E7QA 2A30A 4NYJQ 3KZCA 1JI3A 3QKTA 5J1TB 1ZUIA 3GDFA 5IFLA 3RYCB 4LHEA 4URFA 3AZPA 1M3SA 1R64A 3IODA 4J3FA 5BSMA 5JI3E 3KSAC 4PGGA 5CHYA 5JARA 1C3VA 2P9FA 3Q8KA 2ZBPA 4KO2S 1KMIY 2MSWA 2IYWA 1PQYA 2QXUA 4IQ8A 2JK0A 3FX2A 1CEXA 4GI1A 2YCLA 3BD8A 1F9EA 2BISA 1FTNA 1DARA 2BE7A 1MVNA 2ZYRA 1H0RA 4RFSB 5AXBA 5AIBA 5IASA 4RA6A 3ADKA 3SX2A 2PTHA 4D8WA 3ER8A 4NJEA 2XZTA 1JHYA 3TTUA 3W7VA 1NI4A 4K0KB 2P9ZA 2TS1A 1E9AA 3H9UA 1OIXA 3DC2A 1V1MA 3HUTA 3EZXA 3MSCA 1IZYA 4IVNA 4HAZA 4BKQA 2FHSA 1DRWA 1JQDA 1PVOA 4KUGA 1NXVA 3OF5A 4DCUA 1H6BA 5CT9A 1WZ2A 1PUJA 2EZTA 3U13A 2DQKA 2FSIA 2QUAA 2Z95A 4ZJUA 3FVWA 4RVFA 2WOOA 4I1VA 4OXNA 3MCTA 4Z54A 2XWQA 4O4JF 3FA2A 2VRNA 2C9DA 4K81B 3OHMA 4QDZA 4B6FA 3CSSA 3RS4A 4S0ZA 1KC3A 2HRDA 3IQFA 4HFNA 4KOAA 2NTYC 4OGWA 4MYCA 1QTIA 4QLOA 3RO7A 3PPIA 4RVGA 1NY5A 3NUZA 4TROA 1QWOA 3UAWA 1HMYA 1TVCA 5DCLA 2IGBA 2QTFA 4PSCA 3WLLA 2CDAA 4C14A 2Q1WA 4YBZA 2XGSA 1XQYA 1X8JA 4EQ6A 5BSFA 1O6ZA 4KWIA 1AK2A 1FMTA 1GNVA 1ZONA 2FN9A 2GEDA 2ZR0A 1O89A 1XZEA 2Z8YA 4RCVA 4ZMBA 1U0BB 3LCVB 3L92A 1TC1A 1SC1A 2ADFA 3MM4A 3H0KA 4NQZA 4EPVA 2C7QA 1UZUA 2G6TA 2WHPB 1R4NB 4ND5A 1TF7A 4OHXA 3W8RA 1CF9A 1TD9A 2PD4A 3JYOA 5IK2D 3R24A 3IKJA 4IO0A 3TRDA 3DO8A 1A1VA 3I1IA 2ORYA 3WL3A 1LSUA 3PNLA 1BHJA 1JPUA 2ID8A 1QF7A 4CEIB 2J7PD 2R7NA 1G7TA 3HRKA 2AXEA 2MWMA 5IG2A 1VJGA 2JLQA 5J4HA 5D87A 1HM5A 3M8KA 1U90A 3GGOA 2XDWA 4QARA 1AS2A 3FNQA 3VGJA 1NJ2A 4K40A 4RZ3A 4Z4CA 2ZU6A 1T0JB 1YDHA 3RB8A 4JVLA 2NXCA 3GRRA 1U8FO 4MX8A 4AMVA 1ZNXA 3U5ZB 1AVTA 1ULHA 3NHSA 4PTZA 3H1FA 3FVTA 2XCRB 2DWPA 1PLLA 4KPUB 4BVKA 1ZGAA 3QMMA 3TEMA 3UWSA 5C7IO 2GDZA 3BMNA 3JZMA 3L4BC 1C3JA 2IX9A 3W05A 4U02A 3DAHA 2DYKA 3GMSA 4FE4A 2GCEA 1XI2A 1T3TA 1FYXA 2MYNA 4ND2A 4ZODA 4DWVA 1HZJA 1PZNA 4ROSA 1ADFA 1DAHA 1JI0A 2I1VB 3ZTTA 1IHXA 1EXMA 2JHCA 3Q3CA 2MYUA 1XOIA 3NVAA 4L7VA 5IEJA 4C2UA 1RT9A 4DIDA 1F5NA 5JNTA 5KNBH 3LO5A 2HI0A 4C2AA 4DLXA 5KTYA 4XIFA 3V7UA 3TLXA 4RFSA 4QUBA 5EN4A 4EFDA 1KRXA 4ZZ3A 1CS0A 2J3QA 1G291 2ZVJA 3KEFA 2WUWE 5EE9A 1IHUA 1RCTE 4XUDA 4C7MA 4I4IA 4KIUA 4IMPA 4HXYA 3E22A 2J7KA 4N7JA 1EIZA 2WWVD 3SLGA 4IYRA 5JDCA 1L7NA 2QL6A 3IIKA 3MERA 5JJLA 3OQJA 2C3UA 1N2BA 5EQDA 5JD3A 4LWPA 3H4TA 1X77A 2EW1A 1L4MA 1SZJG 4HWPA 4M22A 3OUZA 1KY5A 5K9ZA 3MINA 1T5DX 1F8GA 3HCCA 1YKGA 2NGRA 4G1EB 3VYWA 1IUKA 2H1CA 2P41A 3LP5A 3OD5A 2F3PA 1ZK2A 3KOMA 4P7JA 1I4OA 1QZUA 3ETDA 3FOAA 3KTAB 3L7IA 4NS4A 3TZKA 2GZHA 3F3KA 2HTFA 5ESDA 1IG0A 4PCVA 5DN6A 3ML1A 4LSWA 2PUJA 4DYVA 5EJGA 1ZAKA 4B3HA 4XQEA 4W1SA 2OBFA 2QE6A 2NYVA 1D7OA 3GRUA 2ZIGA 3EF1A 1YB7A 1N2CA 2ZXFA 3W04A 4IIVA 1UQUA 2IEYA 2YIJA 4HB3A 1MV5A 4BX0A 3I9V6 1JALA 1K3FA 2OQRA 4IINA 3DZCA 1BJRE 1DNPA 1V3VA 2FMFA 2IUSA 3PFGA 3OJWA 4MINA 3B1VA 3OWHA 5ADHA 3U5TA 1NQWA 1ZOLA 3UWKA 3BGDA 4FN5A 1LK5A 1OJ7A 3L6DA 1P62B 5A3JA 4N01A 1KRWA 2DPLA 1TNDA 3LA8A 1QH8A 4HGPA 4WN9A 1BS9A 2ZT5A 2KYRA 3RUFA 2Y0BA 5DLYA 4NBNA 4MVJG 2PUDA 1OUMA 1RLTA 3GJQA 5A9SB 1ZN9A 3KEGA 4RCYA 3WIUA 1SNYA 3MSXA 3OCJA 1OX5A 1SVOA 3HCRA 3N7TA 1A9OA 5FUVA 1W36C 1J39A 5SZJA 2RFLA 4GBMA 4B7ZA 3BE6A 3GMIA 2WVHA 3HWX1 4V0SA 2ZE7A 3VOBA 4NZYA 2FSFA 5J4VA 4PX5A 3A0RB 3COPA 5TJHA 1TZCA 4FGSA 2Z30A 2F6RA 4TSKA 3TJRA 3I09A 1QDEA 2AVDA 5DTQA 5AR1A 1HL7A 3QE0A 4ZV9A 3D7RA 4WZAA 4NENA 1MW8X 2WYVA 2X8LA 3DXZA 1B1CA 1N3IA 3PV0A 1OXUA 2QTHA 3ANMA 3F1LA 4IFEA 3MMPA 3WX0A 3ZVMA 4YAIA 3K2QA 1VMEA 3TWOA 2CDRA 4M1SA 4O1IA 3EVAA 4CF4A 2PKRA 2JG3A 1Z2CA 3AUUA 4RIGA 3TBKA 2DAPA 5DF1A 3BEDA 1JA9A 1UDWA 5FHQA 4D44A 4Y2TA 3LQFA 5CDTA 2XGMA 2R6AA 1E4EA 5THXA 4MKHA 3T52A 4BWFB 2DLCX 4UTVA 1GPJA 1AOXA 4YPVA 4Q9LA 2O1XA 2VT6A 4MJ7A 4B4OA 1B26A 3GCXA 5DNVA 3ILHA 3U81A 1QB8A 2G1UA 721PA 4A8JA 1H2XA 2HT6A 4LSMA 3VKFA 4HFJA 2VHQA 4IRXA 3FNBA 4B83A 4AQYB 4NHOA 4AYTA 3M83A 5A4FS 1HNXB 3FDXA 4HQFA 3AG5A 1FRVA 1KZ9A 1YZVA 1R0XA 2X8JB 1DXHA 3QIAA 4H4EA 4NV1A 1EFAA 1OWPA 1EU1A 1DU4A 3V6MA 3FKSA 3K5PA 3SGLA 1ORIA 3CFYA 2Z6UA 3QEJA 4G0ZA 4I9NA 3BBPA 3OLCX 5AHWA 5PGMA 1Z0AA 4NMHA 5IMBA 3HFJA 5IXYA 5TMPA 1XALA 4F5ZA 1F0YA 2X4GA 2O3SA 3L1HA 4TXLA 4YALA 5AKLA 3U4DA 4ZYUA 1OFTA 4M9SA 5T4BA 1P60A 5E2AA 1P4JA 3G8YA 3DGFC 3L8GA 3TG2A 1JSXA 1IPFA 1T4DA 4IGKA 3MAGA 1KJZA 3JQ7A 3CT4A 3SC6A 3MJCA 3X0DA 3WKBA 4C5CA 5HX7A 2EZ8A 1MRNA 2C7RA 3PDIB 1MABA 5IWCA 1RIFA 4XGKA 2IHVA 2ZB8A 3HVKA 3SYKA 4MW0A 3VPDA 2JFZA 1WXEA 3ZUGA 4C6TA 5JT1A 3L41A 4KC0A 4MICA 4LE1A 1Q83A 2GN8A 2HUNA 5AW1A 1DCTA 2NUBA 1U4NA 3GFSA 2OECA 4RA9B 4TQUS 1N2SA 1W75A 2X4LA 4L4SA 3G0DA 5KYXA 4J90A 3JARA 4I9UA 4GMHA 4H59A 4DMCA 4XB6B 5CB8A 3FHLA 3H75A 4YNBA 4YV2A 4B8YA 3FVVA 4O02B 4UDXX 5G1NA 1XQWA 1T4CB 5DI9A 2ZBGA 1OYVA 1SCBA 1JXOA 2CHQA 1OYOA 2KX7A 4U7FA 3WG9A 1VYUA 2GF9A 1JF8A 2QX8A 2VNAA 3HY3A 4NBTA 1P33A 4LA4A 4YAEA 2IHKA 4IV8A 3RIGA 5LM3A 1VKHA 4X1YA 4PQFA 4YQEA 2HJVA 3HU1A 1KRHA 1LJ8A 1P91A 2V54A 3GJZA 3HBNA 3DOCA 3PENA 3KT8A 4LMRA 1KIAA 5AM0A 5IJXA 4GZ5A 4HNTA 1V5WA 3QVUA 1DUVG 1QC5A 1IN8A 4S2EA 4FHCA 3ONNA 4LZLA 4NJEB 1X1QA 2Q6VA 4OQEA 2E4ZA 4G0QA 1MJ5A 4HF7A 3WK7A 4C03A 2OHVA 2Q6TA 4XYEA 3H4IA 3JQDA 3BB4A 3AVOA 5TDHA 2P6PA 2Q27A 4IOLA 3UYKA 3IR6A 4JQOA 3ONVA 1NJ1A 4Y2XA 3S2ZA 3WLKX 3X2SA 1LJLA 3QWBA 2V7GA 2K6GA 3T41A 3V3KA 4B6QA 1SU7A 1KJJA 1J8QA 1CVIA 5CAEA 2PWAA 1K89A 2L17A 5IZCC 1VYHA 4L3WA 4E31A 2PMFA 3PXCX 3SVTA 1D0VA 4MI6A 4JIGA 2JIQA 4NDNE 4D4LA 1Y9DA 3LAWA 3QNUA 4E5KA 5CBPB 4PONA 3CX4A 1U9IC 3H2SA 3FCXA 2OHHA 1Z4OA 3TVDA 2ZT7A 3GP5A 3I9KA 1MVOA 1JLHA 2K2QB 3VC1A 3DE4X 3CF4G 4EQ6B 1CYDA 1E89A 1Z7BA 5KIAA 4YCAA 4LY6A 3AB3A 3I01A 4U8GA 3CEPB 5FI0B 2RGEA 3N2LA 3MTGA 3KQNA 1J0AA 4GQBA 4OK3A 2CDBA 1L8LA 3P9YA 3PXEA 3NYQA 4WJZA 2PRIA 2ATCA 1X70A 2WABA 4R1NA 2BRUC 1SCUA 3ET4A 2LCQA 4FFRA 3FETA 3PRKE 2YMPA 4RY8A 1DAEA 4LGVA 4WASA 3ZZUA 4AU1A 2HO4A 3TNLA 1MXFA 3VOTA 4BMCA 3GX1A 1P2UA 2EBHX 3BMQB 3FPBA 4MCHA 1MLDA 1MBZA 1OC2A 1XAGA 2COEA 4BLRA 4CTOA 2QRVA 1QG6A 3IILA 3IVRA 1NN1A 1ISFA 3NALA 1Z2NX 4LF7B 1JV2B 2GXUA 2AW5A 2J3HA 3N58A 1BEZA 3H5OA 4HVCA 5M2QA 1RRGA 3FOCA 2WP8J 3NBQA 4K9SA 2W2KA 4OBEA 1T1JA 1TXGA 3KU1A 4BUZA 4BLPA 4ZTZB 4I19A 3E0XA 3MFYA 2OCKA 4RJJA 4JITA 3GK3A 4D0LB 3CR3C 5E4TA 1WXHA 1WE2A 5TVKA 3ZHSA 1ESDA 1UPBA 3L0DA 2MR5A 3BRCA 1JU9A 2OCYC 1OTYA 1WCWA 2WG2A 3D3QA 1QKJA 3NNNA 3FPJA 1XD8A 2FOXA 2JBHA 1LDMA 1QOZA 1W94A 4OQDA 5JALA 1AQNA 3UAOA 5DK6A 9ABPA 4Q7LA 4ZEWA 2C1XA 3H04A 1ZVVA 2B34A 3K0FA 3VHXB 2WJWA 5FPKA 3KQHA 4DB2A 3PRJA 4TPKA 1X80B 5HF9A 4Q01A 2XVXA 1F06A 3K53A 2ZUSA 3GDHA 2AFRA 1ZCJA 3RJZA 2IPOA 4FD2A 2AEJA 3HWSA 3P9IA 4J0IA 1CS0B 4BFCA 3O8QA 2PHZA 4WOCA 4D1YA 4OUDA 3T8YA 1AX9A 1L7QA 3IRUA 4PLCA 3E22B 5CTJA 3U60B 2H1FA 3LRXA 4DA6A 1G21A 1V48A 3WRYA 5B3KA 1T6XA 3IUSA 4FT2A 3V4OA 1H2EA 1RAEA 1NVVQ 2Y0CA 3NX4A 3TZBA 1EQ2A 2VF5X 1JHDA 2YN0A 2YY6A 4JV5B 2IYSA 1K3UB 1QONA 4C88A 1SBNE 4IW3B 4Q37A 3UHOA 2O7VA 1US8A 4HNGA 5HA5A 3DW1X 1T9DA 2VH1A 4GQAA 1WD5A 2RBEA 5HHTA 1ZL0A 3HJNA 1A2OA 4JT4A 4Q00A 5J2TF 4DXHA 4EPXA 3GOHA 2X2OA 3CF0A 1WDMA 3HDJA 1RXCA 2KLHA 3A8TA 4L73A 5CVCA 4YAGA 1G41A 4YMVA 2O59A 3C6XA 1Y6QA 4QUGA 5DIFA 1SR8A 3MT9A 3AETB 5DT2A 5HG0A 2BLNA 4FEAA 4A6XA 3L82B 1T9CA 2JLZA 2X8AA 1N2CB 1SCNE 4IIYA 3TK1A 3ACCA 3D0OA 3S2SA 4BRZA 1HYBA 4DBLC 2H3HA 3X2FA 1RYFA 1LI4A 1AGXA 1Y3AA 2HR1A 3UMYA 1ZM3A 4AFNA 2LNDA 5KQSA 5TQ0A 5KTOA 4FGLA 3GXOA 3TI9A 4TWRA 3KC2A 1DFGA 3P2EA 4MR9A 3UMFA 3U0BA 3L8ZA 3CPHA 4EI8A 4KBFA 5BQ5A 4YRQA 3EBOA 3ORHA 3IBCA 4FYHA 5IVPA 3W3AH 1N2IA 2A9RA 3GP3A 4WN9B 1JR4A 5DHQA 3GLFA 3G49A 4ND4A 5IKXA 5G3ZA 4RNCA 5I7WA 2IUTA 3ENVA 5E4JA 6ABPA 5C5DA 5JJIA 3PC6A 5K3BA 2DUJA 1R0ZA 3TG8A 1SKUA 1AQIA 1WTAA 2WU8A 4KE7A 4R3UC 2G9ZA 2NUAA 3R8CA 3O7WA 1ZHFA 1VRVA 2YNMC 5BW6B 3ZWCA 1DV2A 3L0YA 5K6RA 1T2UA 1MDFA 5HF5A 1NE2A 4G0NA 3CUSA 3MJFA 3LSYA 3FCSB 1AUQA 2WVAA 3FRJA 4PFKA 1W2HA 1LNQA 1AHIA 2J5RA 4HR7A 3VBEA 2XUAA 3OMLA 1ZRMA 1PSDA 2BFWA 2FP3A 3CLKA 4NENB 3IHTA 1TCCA 1JE0A 4WZAB 5AKZA 3CLUC 2XXJA 2VP0A 3MZ0A 9GPBA 3V1KA 3AI7A 3EE6A 3SFTA 4C6HA 4O2AB 1T29A 4G8BA 4LQ4A 1TMYA 1VBFA 5HIIA 5LUBA 1EFVA 1VGVA 5JNWA 1OWOA 3QOXA 4H0NA 2A9QA 2ZIFA 2IEDA 3RTBA 3F6BX 4WA7A 2NT4A 3TMAA 2CHFA 1ZUWA 3VOSA 3TTVA 4E7PA 1G8AA 3OCCA 4DRYA 2GK7A 3NGLA 1YS7A 4JDPA 3O47A 3NIWA 1KO4A 4CIBA 1HE8B 3L01A 3NYIA 1NZFA 2ZIEA 3WB2A 1E4EB 1Z6GA 1UZAA 3JS5A 4IGFA 3KSZO 4TRNA 1GNTA 3O4GA 1BDBA 3A6PC 4P3PA 5H80A 1A27A 1Q74A 1SIUA 3LV8A 5EKSA 1OH8A 4AN4A 2ZB2A 4QPDA 1Y89A 3AV3A 4YASA 2QXTA 1UWCA 5A1TA 2HJSA 3A26A 1QRSA 2JJMA 5HCNA 4YJGA 3TR0A 1KOGA 5DZSA 1QP8A 3IQWA 2IF2A 2CT8A 3L6CA 5K0JA 3T9BA 2G08A 3H13A 3SYMA 3UT5A 2JLSA 1BFKA 3R75A 1D2EA 2QNIA 2BZGA 1EP2B 1KJQA 4B8WA 4LYAA 4JI6B 5DOVA 1JTVA 4AYWA 2GXSA 4FI3C 5CJ2A 5JQGF 5TSDA 1WCIA 3BULA 4CR7A 2XMSA 4HQOA 4UNSA 4JJEA 2PT5A 3ETNA 4KQMA 1RYHA 1QZXA 4KQFA 1XD2A 1R0BA 4L78A 4UMEA 2JK1A 4J1SA 4G36A 1CDZA 1YHNA 1OHHA 3DPIA 4AG6A 3UHAA 4LGCA 5AHXA 5AM3A 5E9JA 4KWCA 4XR4A 3ZY5A 3FUUA 1C3EA 2AMFA 6ADHA 1CEYA 1KYZA 2C5SA 1K7XB 1P77A 2CXSA 3G2LA 4TV9A 5G0UA 3SKVA 1NKVA 2BF4A 2V65A 3JQ7B 4HQLA 2J31A 1U0TA 4G84A 1WCXA 1B3RA 3IMEA 1MABB 1V4VA 2IIBA 2HYIC 5TQ2B 3ZX4A 5TPZA 4C6TB 4B9AA 1LLFA 1SXJD 1ZK4A 1NJ8A 5G1OA 2OV8A 3O6VA 3UJ3X 4RANA 3IP3A 5JSUA 5ICGA 2DP4E 3VR5H 1I7QB 5DCUA 3GDGA 2GZMA 4BZQA 4FBGA 4F96A 3ZZTA 5KYXB 3JARB 1XJWA 4IP0A 1JIUA 2WHYA 5HNKA 3TQOA 3L1UA 2N0SA 2W22A 3PVSA 1E6UA 1G8GA 3IE2A 4JB0A 5EZQA 4QNRA 3WTBA 4UEJA 2XMBA 3CF4A 1JQ3A 4KXFB 1S4MA 2E49A 1ITZA 1V39A 3G2JA 1NI5A 5EE5B 1J06A 3MXOA 1HDGO 3ICPA 4X1YB 5JANA 2OGTA 1A5TA 4AP9A 3EVDA 2D2IA 1QIJA 7REQA 2PKXA 1QC5B 3FSEA 2GKOA 1QHNA 1DKQA 2YHIA 3CNHA 1QR2A 2KMLA 3F9IA 1N7HA 1MRSA 3IULA 2JIMA 2QROA 4XR9A 1DTWB 4EH1A 2YMLA 3D43A 4MI9A 4AM8A 1UL1X 1OX6A 4JI1B 3PFFA 3LTEA 3EWNA 1QANA 3IERA 1B00A 4I1RA 4RD6A 5BSTA 1VIYA 3K0SA 1A5SB 5CAEB 3C16C 5DLEA 2OPHA 4K9DA 5FLEX 1TEXA 2XECA 4QTTB 3DMPA 2M1ZA 2W2LA 2P30A 2HIMA 3OWXA 1WO8A 1DAPA 1Y3FE 1PKEA 3EVCA 1RJDA 5SICE 5ICSA 3OUTA 1UBFA 4OXQA 3W4JA 4DEVA 5C5EA 2Z3ZA 4MUIA 3N8HA 1I30A 1ES9A 2QLFA 2YW9A 2VJDA 2ACEA 3P94A 4PHTA 3THSA 4XJXA 1XRPA 1T8TA 3GVPA 3ST7A 3QLTA 2VCEA 4V3CA 3WBKA 4ZOQI 2F48A 1SQSA 3I39X 4FK8A 4EW1A 1DZIA 1SD5A 4KMMA 3ZGYA 4X6XA 4F4HA 3HV2A 1SCUB 3L1VA 2IYZA 4MPDA 1SUPA 1VGQA 4Y2JA 3RHFA 2VHXA 4YH1A 3AHFA 1H6CA 1YUMA 4FYKA 4RD3A 2OFWA 5LQUA 5T64A 1HF3A 4PU0A 4OI2A 4B33A 3RIEA 3COJA 1T2CA 3ISJA 1LDEA 1M1XB 1BU8A 1BRMA 1HDZA 3LUCA 4QPCA 1ZRSA 1BE8A 4MGZR 3ZH9B 3JRWA 1WXXA 4C0AC 5JFGA 3C39A 1NLYA 3M7IA 2CLDX 1KERA 3KV3O 5EE0A 1KZ6A 3BGOS 1KAEA 3EQ8A 5MHTA 4KLCA 3HI4A 1EFRD 3BKWA 5K8LA 2PQMA 4GSYA 1WNFA 2RHHA 3L8HA 4US2R 3TOXA 1GPWB 1UJ4A 3E7WA 1RKQA 1ZA2A 4NFYA 4BO0A 2WQZA 2VAWA 1T9GS 4Y2HA 5JDIC 5KO2A 1T34A 2O8BB 2GTIA 5E3JA 3T7JA 5E4YA 3O8OB 3RU9A 1FW8A 3CZPA 4W8OA 3DH0A 4RPHA 3EZ7A 1IOLA 3HCNA 2C3MA 1UPUA 2D7CA 2ZPAA 3K0FB 3RFXA 3TFQA 1YJAA 4E46A 3IESA 5E95A 1NVXQ 4WL0A 4CDRA 3TVYA 4G1VA 3MUOA 3ZGLA 3R0ZA 3LK6A 1RAAA 2ZUFA 2QQFA 3GD5A 3N0VA 1TU4A 4ENSA 3O8QB 4JUIA 4OUDB 4Q5IA 1HQYE 3FDZB 4CIVA 2B4TO 3OPYA 3E9DA 1GKUB 4OFXA 2EGHA 5LR6A 1G21B 3DZJA 3EEFA 1CRZA 3RAPR 2VCYA 5J40A 2OKCA 1E0JA 2G0AA 4U7PB 2JI8A 1WA5A 2R2AA 3B6MA 2DFNA 1IONA 1JLRA 2JGDA 4DDWA 3UPTA 2NP6A 1Z38A 1US8B 3KHSA 1YNSA 3DEKA 2WT4A 3QJYA 4IOKA 1T6BY 1K88A 4LVNA 4EM6A 4TTVA 1DAGA 4PPGA 4UE3S 1GZ7A 4D41A 1BA3A 1OXVA 3HKBA 4WY2A 4R1QA 5GAJA 4MJ3A 2FNAA 2GUWA 1Z83A 2G63A 3DG9A 3ZG6A 3DLCA 2BCEA 5FJJA 5IC6A 1I4TD 4A73A 4AKTA 2CFTA 4D9CA 1NUQA 1DLJA 4UJ5A 4AIIA 4DV6B 4CG1A 1YJXA 2GSWA 5AVVA 4FHDA 3FZGA 2O06A 5CVDA 4DC0A 1BMFD 2G8NA 4UU1A 1PJZA 5TQ0B 2W98A 3N8DA 1KWGA 1JIXA 5F3WB 5DM60 4HQRA 3CV3A 4MR9B 2EP5A 4R8SA 2BMEA 2HJRA 3ER9A 3K9WA 3QUCA 4HATA 2IU6A 2DF8A 3TXYA 5ABPA 3KR2A 1ICIA 4ZV4A 2ZTUA 1OBFO 3U19A 2H4JA 3GLFB 1GPNA 3ROGA 1N0UA 3E9YA 1BHSA 2G07A 2F62A 1TO2E 1V7PC 1CJTC 2C3OA 1JFVA 4AKSA 5BV1A 4KXXA 4FZJA 2NO4A 2OHXA 2V3VA 4L16A 3IBSA 1I5OA 3LFHA 2C9YA 2NQ2C 1M1NA 2WU0A 2X6TA 3IOEA 4UMFA 4EVRA 1AK1A 1T26A 3LNTA 4TMZA 1VMIA 2NZWA 2ID7A 2NUAB 1UT6A 4CCYA 3JR3A 5ARDA 1VG1A 5BN4B 5EP1A 5A71A 4Q4HA 4BDTA 4WKGA 3NHPA 4P9NA 5HGXA 1C9KA 1UPCA 2W6NA 3GCWA 2QZJA 2YIDA 1QGUA 3PD7A 4URYR 5J59A 5G3YA 5JG7A 4TYPA 2PNJA 1E3MA 3WYAA 1L4FA 2JLVA 3ADDA 2QV7A 1PT7A 4IDBA 1L9KA 2QLNA 1EWRA 2VC2B 4PSKA 4FKZA 2L18A 3AU9A 3ZY3A 4YRFA 1G38A 1R88A 2I2WA 4A36A 3E0QA 2E4YA 3OJOA 1P1CA 2CNWA 2YFKA 1KK1A 4R2LA 2VF2A 4TSRA 3ON5A 1P44A 4M9RA 4B48A 3FNGA 4DDUA 1E2KA 2OBLA 1IDOA 1QE5A 4FZVA 4OXRA 1EVQA 2IE0A 3AG6A 2YKGA 3KE9A 5JNLA 2XCSB 2HSZA 4GF5A 4F71A 4LZWA 5DU2A 5K0SA 5T5QA 5AVTA 3FUVA 1FRFS 2RGDA 4PR3A 3B20A 3IELA 2FEWB 1JG7A 1XEWX 3LTNC 2OG2A 3V42A 4ZANA 2YL2A 4MEAA 1JZQA 4LXIA 4IWYA 2P2ZA 4MHSA 2GN1A 2B8WA 4LYFA 4MV6A 4CW7A 5CH3A 4MVJI 5AMXA 3P97A 2POQX 2BTQB 4INJA 3A25A 4I1IA 4YJGB 1RADA 3BXFA 1U0EA 2CY0A 2I3GA 3W5BA 4QQ8A 3UT5B 5C0OE 4LK3A 1FMFA 2VQEB 1CD5A 4NFHA 2WP0A 1R8XA 3K9QO 3M5PA 4MUFA 3AC0A 1EIWA 3ZLJA 3QEBZ 4HV4A 3ETEA 1WCIB 2QL7A 2Z4SA 1QHSA 5TQJA 1EK0A 3G0IA 3TOCA 3R9XA 4FINA 3PFCA 3CB2A 3PQ8A 3A1SA 4BJ1A 5IDYA 2CYBA 4C4SA 5JWRA 1SHUX 4Y2GA 4JI8B 5FL7D 1YBFA 3AGQA 4ZAWA 1JPVA 2V7QD 1EX6A 4GE0A 1XFAA 4C04A 2F9MA 1Y6RA 5B58T 2HDNB 4PO3X 3AKZA 1VBKA 2W2XA 1OT3A 3CUWA 3K8OE 4TV9B 2W2QA 1WETA 1IQ0A 1KAMA 3GN1A 3BWXA 4U2KA 3TPFA 1KGDA 1YB4A 3LG2A 4ZV7A 3BF7A 4TL7A 1C5KA 4D9KA 1FL9A 4ZXPA 2G1AA 3RVSA 4QNNA 1BHO1 5CHEA 1VHJA 1F4LA 1P61B 2WNIA 3GEGA 3T3GA 1W36D 3G5LA 3ROMA 3WLQA 1OI2A 2AR9A 2X41A 4I5DA 3LRTA 4QASA 3H99A 4YAWA 5AOAA 3RC1A 4BTEA 5C1BA 1EUCA 2ZUEA 3HKEA 5J58A 4CG0A 3I61A 2DHRA 1PVVA 3HCPA 1NUPA 1D1PA 3KOXA 5LU8A 3B3FA 5JWOA 1IK4A 2A3RA 1ZGGA 4KN9S 3D7NA 3VX3A 4NYJR 4I36A 2NPIA 4JKIA 3BGVA 1PTJA 3OQVA 3L8EA 3T5BA 1QJ4A 3R3UA 5EMJA 4DCNA 5AI5A 5L4LA 3CXUA 1KQGA 3VSBA 5AW9A 1E7MA 1N0WA 3C1UA 3TRFA 3CZMA 4QPZA 5LYYA 5G0VA 4EHFA 2PUWA 4Z4FA 2QI9C 4FGKA 4EGSA 1CU1A 4QXAA 1TQHA 2O3JA 4IJKA 1V6CA 2HBYA 2IOFA 5LP1A 4PYQA 5HZGA 3VAYA 4AP6A 2OO5A 5SY6A 4AWBA 2YHIB 4NNPA 2PV7A 3QXSA 4WLVA 2CC2A 3GEBA 3M4XA 4WKPA 1FFXA 3MWGA 1CQJA 2OT3B 4JLWA 2RHBA 2HZBA 3H9CA 2ZKLA 3QUQA 2QYOA 3NP9A 4L0MA 2XUOA 3LIIA 4Q1AA 4Q6WA 5DGIA 1KC1A 4YRPA 4E32A 5EXDA 2VHZA 1S2LA 3F3YA 4D5EA 1RXEA 4HX9A 1NNI1 3O8NA 4A6EA 1E6KA 2BH2A 2QMUA 3KUCA 3WVNA 4F6RA 4HUTA 1XRMA 1MOQA 2AK2A 2NO5A 3OLQA 4BXOA 1QS0B 2XXAA 5MN6A 4R0VA 2VYVD 3Q9LA 3WMGA 5IC4A 1G8JA 2Q3EA 3BCSA 4IXWA 2QTGA 5BXQC 2HMYB 3VR0A 4IYJA 1E9FA 5DGCA 5IUJC 5IAKA 4LHWA 4HO1X 4IWNA 3AF4A 4N8DA 1KI1A 2ZKIA 4KQEA 4OHRA 3UXMA 5HMLA 3HY6A 1NBOA 4LOLA 3OA0A 3BM5A 4C7BA 1Z4JA 2EF1A 3ESCA 3U44B 1GCGA 1GP2A 1XLUA 3PYXA 3PF8A 3QMPA 4ZO7A 5EESA 2BGKA 1KI6A 4N82A 1T15A 3VZQA 4YAUA 3WYNA 3M2PA 1KVTA 5ERXA 4GGMX 2F8MA 1RBZA 1XAIA 5L6MB 3BREA 3EEQA 2HN9A 4G97A 3GRKA 4NU6A 4UREA 1IHDA 1O4VA 3V7FA 5IPFA 4DMRA 1B73A 1BYUA 4Q66C 1Z5OA 4CIWA 5I7UA 3R4CA 1GR1A 4GHWA 4MW2A 3G2PA 4JJKA 3T1QA 3PUHA 2CYCA 2Q5OA 2V7EA 2NW6A 3AHEA 4OBXA 4AS1A 2H0AA 4C7OA 3DMNA 3AYXB 4R54A 5KNCH 3PEEA 3KDAA 2IBSA 2P2NA 4P0QB 1JDTA 2HK6A 2X2EA 2LCIA 1S7GA 3RC3A 2ABWA 1TQ4A 4MDYA 2IVZA 3NKLA 1DAOA 1HNNA 2EHJA 2IXEA 2ZUCA 3MB8A 4TZKA 5HMMA 3U4IA 2X1HA 5HRAA 3A6LA 4EY6A 1RD4A 4PSVA 1T8RA 1OQAA 4LYDA 4CIAA 2E6UX 4DXAA 1EGHA 5HF8A 1RBYA 3JAKB 5BW4A 2SCUA 2D74A 4DSOA 2OV1A 4LJ9A 2YWEA 5KYYA 5BN5A 4TSFA 1N77A 2H52A 3LCRA 4HRXA 1USWA 4U39A 4CTMA 3B70A 4PZEA 4UD2A 5DMHA 1KVSA 3ENKA 4BZXA 3OF2A 3DOUA 5AJHA 2ZULA 4DUGD 4MAFA 1FTQA 5G0WA 5B30A 4EYEA 4GWKA 3BK1A 3DHVA 1SCQA 3H42B 1O4WA 2Y05A 3FAKA 4RL6A 1O9GA 1SOWA 2XMZA 3QPBA 1C7RA 1FDRA 2FKNA 4W6ZA 3X1YA 4XYGA 5ITVA 3IT1A 4EIWA 4PINA 4S1OA 4R1UA 2X9NA 2XYHA 3KPWA 5JSZA 4B85A 2IZ6A 2W2MA 5HP4A 2M98A 1UJ6A 4TLMB 5JSFA 4NEQA 1FFSA 1T9ZA 3BIJA 4I8XA 3KWJA 1CY6A 2AK3A 3KOUA 3QQ5A 5LKRA 3C5VA 4PC7A 2DQSA 1H2RS 3AFIA 3HKBB 3K4QA 4JLBA 3AFHA 2MMGA 4G07A 4EJ6A 3ONWA 2VQ6A 4OA5A 5JS1A 1IN7A 3DT9A 3O93A 1J0XO 1DTEA 3TZHA 4LE2A 3J7AC 3C7KA 3VSCA 1GPYA 3JD4A 1GNPA 3ZV6A 2QD2A 2V9CA 3BXXA 1W44A 1GT6A 1Y7IA 1RKBA 2B1IA 4NFLA 1MTZA 5F76A 3PQCA 1XA4A 1WXFA 2X0EA 1SQ6A 1Z0SA 2ILVA 4LNHA 4R5HA 3RTDA 4BRSA 1ARZA 1SMKA 1ZZEA 1ZBQA 2WDPA 5KNBA 2IP4A 2A86A 2XCLA 3WAGA 2ZRGA 5IDQA 4IM7A 3N8NA 3MVEA 4XJVA 1T36A 1U1GA 2BMDA 2IZ0A 3EPPA 4R98A 5CPFA 1SAYA 2BZ0A 5TMBA 3LCUA 1P9WA 2P0EA 3DF9A 1K5HA 3EG5A 2BUAA 3G2OA 2Y1EA 4CT5A 3AJ8A 3CJRA 3R3WA 2VXYA 4GP9A 4OXXA 3RJTA 3W78A 4MQBA 3UATA 1ZD9A 2DY1A 3MJHA 1V7ZA 5JNSA 2OD7A 1FUUA 1C4WA 4CFSA 3HB5X 4OF4A 4CTKA 3EW9A 2WNHA 2V6IA 1TW2A 4CCYB 1CUCA 1FCJA 4MWSA 4L22A 1Z2AA 4UPVA 3GLIE 4EGAA 2HBQA 2EZUA 2C8VA 4XDYA 1BYIA 3GZNA 3OIUA 3SBOA 4U2DA 5I9LA 1D8TA 1QGUB 4MB0A 3R6GA 1PJ2A 3ZWOA 5F9HA 1X38A 4A0HA 4Q3LA 1Y5RA 2QMZA 2EX0A 2G06A 1ZIXA 3WLPA 1NYQA 3T1VA 4BRUA 1LBTA 4E94A 1U2RA 2LE0A 4OIFA 4GZMA 4Q24A 3HK2A 2B98A 1UKCA 2VWPA 2D3WA 2O19A 3R2JA 5BP7A 3SP1A 1UBOS 3KLPX 1H2HA 2HPHA 3RSHA 3OFKA 1DIBA 2VIIA 2R62A 3QKRA 4WNYA 4AZWA 1E0KA 3HQ4O 4TTIA 5ETJA 4B6JA 4Y0NA 1MJNA 1XMOB 2I4NA 1UCFA 2WTMA 1JBQA 4RVOA 4MWEA 2FW6A 3GRFA 3CEAA 4IFTA 3M1AA 3RC8A 1NLMA 2Y1LA 4JS0A 1OREA 1W1WA 2WAXA 2BI8A 3AUAA 2CNKA 3LFTA 3OHSX 3NGMA 3PXGA 5GIOE 1ZVMA 3R0QA 3OEYA 4BKOA 1L5HA 3SQWA 3KSMA 1KDVA 1OZGA 1QV7A 2IOYA 2BGUA 1BDHA 3C6BA 2WSMA 3VJKA 3WFZA 4A6PA 1E7YA 3IAFA 4NPCA 3LHFA 5IEBA 1J0BA 5AM2A 5B1YA 3A4YA 1V5FA 3H1PA 2P2GA 4FDUA 5EHIA 3PEWA 3DWEX 3I37X 1PLJA 4B3JA 4S35A 3BBLA 1TM2A 4PVDA 3CZQA 4XWYA 4D9BA 3R9XB 5ICEA 1VKNA 1YBAA 3THOA 1B74A 3V8PA 3S2GA 5KQPA 1IHYA 5A0VA 1RWNA 3BQMB 3WLSA 4AN1A 3M3PA 1M1YE 3KEOA 4F7DA 2F1OA 2VXOA 2CVQA 2XTJA 2PK3A 1JYFA 3BQNB 3ZGNA 4ZJZA 3PDJA 4KB5A 3B82A 3PL1A 1X1RA 3A37A 2R65A 1Y7HA 1U7DA 1I2ZA 4EO9A 2C92A 2O57A 3BL5A 1IMJA 1O6GA 4URUR 4JL8A 5DX0A 5KC8A 4EX6A 2CB0A 3O2QB 4U7JA 2CJPA 5KX5B 1V7QA 1RMYA 2QW8A 2ZB3A 3GGSA 3ZWKA 2YC2C 1EKXA 1R5OA 1EUCB 2BMJA 2PCJA 1ZLYA 2YNMD 4WY5A 1UK6A 5JHHB 3N2EA 4D9NA 3AFOA 1ML4A 4LQDA 3KJZA 2Y6UA 3DFUA 1OXSC 2GLUA 4HEJA 4BO9A 5KQMA 3I4CA 1CR0A 3GRPA 3JWHA 1ZJ4A 4YK7A 2EF0A 2XNJA 1JYSA 1MA0A 2VRBA 2YOGA 3CLUD 3QTTA 4KQ2A 4P7BA 2VBCA 1I1NA 1QX3A 4TMWA 3JRNA 5BOVA 3UM9A 2GAOA 4E7OA 2PZ8A 2BR4A 2RHJA 1Z47A 1C0IA 3FGZA 4KODA 3DYBA 3TQTA 4JJZA 3CGGA 3DFIA 1M5RA 3BWDD 3EPRA 3ORRA 1QAOA 2FAXA 3IEUA 1FDUA 3IP6A 3LOPA 1VB5A 2PGXA 3AILA 1V6AA 4W99A 1FFXB 1CQJB 5HXAA 3BRWA 1EJ6A 4FNMA 4YCCA 2FQXA 1IRXA 3B1ZA 4FB5A 1NVAA 5CDGA 3UZUA 4W5OA 3UCEA 2I3DA 3LQKA 3W6PA 4BLTA 3EAQA 4V24A 4C7XA 5FIUA 4CM6A 3QFHA 1JAIA 1SUEA 2AFIA 2ERYA 1ZMRA 2VPIA 4GVXA 3U3RA 4GLLA 4F6RB 5ES4B 4GBJA 2XV1A 2ONZA 1XUOA 3JQPA 5D01A 5JTUA 3MBOA 3MRXA 1Z15A 2A57A 2GCOA 5JS7A 2I6SA 1KEVA 1Y8RA 5CMLA 3NWJA 3SF0A 3QHPA 4BOYA 5FUMA 1OBHA 4YCSA 1N3BA 1WG8A 2FKAA 1EQUA 5E38A 4C05A 1FU4A 4NAUA 1NV9A 2AS0A 2IOFK 2RBGA 3HBAA 4KMSA 3DD1A 3S1LA 4AO7A 3QJ5A 2NMVA 4ZQBA 1S89A 1X2EA 2V74B 5LP6C 3IPCA 2PGLA 1G3MA 2ZBRA 4EEXA 1C8LA 2H08A 3EA4A 1NULA 4IIJB 5D3QA 5FLKA 2NYUA 3WISA 5B7GA 4BLWA 1QGDA 5TRTA 1RMTA 4D4HA 5JYDA 1SBZA 2D8MA 1ZI8A 4E4TA 1NQUA 4X90A 3BFXA 1A5AB 1R0KA 1WXQA 2IL1A 3ELWA 4G0OA 2WPNA 3RFCA 4LF4B 1Z4KA 3G0HA 3ZJTA 1TI7A 1E3WA 4MQEA 4RYLA 3AKEA 3TX6A 3U7FB 1T1RA 4LX0A 3KAKA 4YN3A 1XRQA 1NSFA 4II2A 3SZGA 3F4BA 1I6WA 1W4BA 1TTQB 3N76A 3T6KA 3F73A 1ZMXA 5F5NA 3H5WA 3L6UA 4N5DA 4ZQEA 1FYWA 3JWPA 2LTAA 4D9EA 3ZIDA 1UFVA 4MWTA 1YU9A 3CZAA 1O94C 2YUIA 4AY3A 2OAP1 4UDOA 4F8YA 2H9YA 1XTUA 3OE4A 1IVSA 4DNFA 2F3QA 4JYPA 1QOQB 2A8YA 3ZXIA 3ZDRA 2HCBA 5B1HA 3R0XA 4TOIA 1KYXA 1SXGA 5BN5B 5JPDA 5KYYB 5LQDA 3M2TA 1AGRA 1L3BA 3RLFA 3EGXA 1Z8FA 1WIWA 2QSYA 2XW6A 4BMVA 2FMHA 1XPRA 3ANYB 1JP7A 3H7IA 5FBKA 4D74A 2DT5A 4KTVE 4BMSA 4EQZA 5KOIA 1G64A 2CMDA 1CG6A 1WP9A 1ZGBA 2GXQA 4MP6A 4D42A 3W1VA 5AESA 1MT0A 3AHGA 4ZA2A 4ZVRA 5JBNA 4DDVA 1PWXA 4YRSA 1UT8A 2WWFA 2X5XA 1WXIA 4TLDA 5AJTA 1D9ZA 2UU9B 1GUYA 4OHOA 1NVVR 2O9JA 3NBUA 5FJIA 1H94A 1T5HX 4CHTA 5HM6A 4DQLA 2CLKB 2DBYA 5JSZB 1W5BA 2C8KA 4BPRA 3WLFA 1D9XA 2PS3A 3UHFA 4DQ0A 4E1VA 1IM2A 1EESA 5IF9A 1FFBA 2NZUG 2YRXA 3OM1A 4TMVA 2HA0A 5D86A 2R751 2X86A 1JKJA 3FSJX 3NC1C 4W63A 3CN9A 4YJ3F 2WUEA 4PPQA 4QODA 4XQCA 1DEHA 2FTKE 3E7PA 3K5IA 4QAQA 3RYTC 1PEAA 2VRWA 3HA3A 1XMIA 4JB8A 4O2RA 3C4QA 5IJ0A 4IF6A 1FXWF 1Y4SA 5HF6A 4DB4A 3VR3D 2NZYA 5E7IA 3RT7A 4BO7A 1JWLA 1XWIA 4G8DA 4GX5A 1EHYA 1JZTA 1A98A 3LUFA 1U9YA 5DKFA 5LOVA 3GPDG 4JUDX 1CR4A 1QH9A 3W4IA 3AGPA 4MYRA 3R7AA 1HE3A 2G80A 1IAQA 4M8IA 3A28A 4Z2AA 1XFDA 2FXIA 3HFGA 5JVDB 4MGEA 3GEPA 3K15A 1LPOA 2OR3A 1QFSA 4XE5A 5IDWA 4QUJA 3IPRA 1AKEA 4FGZA 1JDPA 1Q3TA 1N3LA 1T36B 2WM2A 3JWIA 4LI0A 4EUSA 1KY2A 2QRHA 2HL6A 4H7PA 4XQ9A 2QUIA 2YWGA 5E2IA 4EAQA 5BPHA 4EMUA 1A9YA 1TUBA 1IBCA 5IANA 1NJ5A 3SHTA 1AA9A 2H7VA 4QFCA 3O5AA 1Y8CA 4F86A 1A72A 3CN7A 1J8FA 2QD4A 3HPQA 3BWVA 3PQDA 2YIVX 1XL0A 4KUHA 3WK5A 3DAYA 5FUBA 4IH9A 1H2AS 3TLGA 5JH7A 4JYZA 1B2RA 2E4XA 1U81A 4FOPA 1GM5A 2Q5EA 1U9JA 4YRRA 3R6TA 4PN3A 1XWWA 3ZI7A 3GZNB 1DE0A 2POCA 4EW6A 1YDMA 3KP1A 1JKFA 4MRVA 1SXPA 1TQ6A 3IGFA 521PA 5FUQA 3GB9A 1L7XA 3H2HA 4UDNA 3HVRA 2IZ1A 4LCJA 1TKBA 4N8SA 1JSRA 2WV7A 2NZ2A 3DGEC 4WAUA 3S1AB 1A8SA 1SHKA 2ODAA 1VJCA 3HSSA 3ITNA 4HKTA 3JQ8A 4L50A 4TUYB 3RK1A 3TTSA 3UXEA 3WL5A 1MO2A 1OYYA 3LDHA 4P6VF 4B3CA 4MCIA 1N7JA 4L4UA 4UKDA 2H4HA 3PLNA 1CJCA 3K09C 1K63A 3QKRB 2C95A 3RVOA 4BQRA 2FJPA 4HNUA 4ZYYA 3O9ZA 1JEQB 5DNCA 3DTVB 3FPLA 3IP8A 3ZWQA 2O5EA 3U1BA 3LA6A 3TUIC 1DQYA 3L79A 4PYIA 4Q9IA 3ZE8A 1R3UA 3R20A 3W3AA 1VJRA 1GG9A 1WNTA 2FUNB 2PE5A 4D3SA 3D59A 4EJ2A 5EJFA 2VXBA 2P79A 1RC0A 4CLXA 4CDGA 2LP4Y 3SEQA 4K6CA 2OGSA 1I1OA 2QUBA 3SR3A 1VYTA 4B76A 3K0AA 2QJTA 1NVUQ 3ZHQA 1TK3A 2HK8A 1EVJA 1XNJA 1ULAA 3AZOA 3I1YA 2P75A 3WLHA 5K0ZA 2F90A 1BKYA 4BEBA 4EG5A 1G7RA 1FYVA 2SICE 3U7JA 1WSBA 1F6WA 4MVJD 3ZQJA 4BN0A 2V0GA 3PJFA 5EI5A 2QTZA 3PQEA 1CQWA 2AYYA 2GH1A 3QOWA 4GUDA 5LMUB 1EXVA 2QTBA 3ELYA 1EK1A 3KKPA 1H5QA 4FLFA 2WFMA 1RWVA 4YP6A 5C8YA 1YVPA 3T9FA 4OLHA 3DDZX 5D3KA 3Q3EA 1I1QB 3CF6R 4DCSA 4S0XA 1BVUA 1YRHA 2Z1MA 2YV3A 3GG9A 3OZSA 2PZAA 5DLDA 1Y4AE 2H1SA 5B53A 1T6ZA 1NL3A 4Q3AA 2E48A 1JTFA 2B2CA 3T35A 3UPUA 1RRMA 3DEIA 4BYMA 3FPEA 4PCUA 1K2WA 1KSJA 3PWTA 5DPMA 2P6OA 5EIBC 4A26A 3MGGA 4R9VA 4BFLA 2W0MA 1QQBA 2XVMA 1GRCA 4JC4A 3L43A 1JHXA 3ADBA 1WP4A 2GBGA 2DKFA 1JVSA 1PEKE 3J7TA 4RJLA 1XZGA 4UHHA 4YJHA 4DLRA 2IPAB 2R3SA 4FS3A 1MAAA 4CM7A 3FD8A 3C7CB 2DQYA 2YY5A 1OR8A 3EIEA 2OBXA 1EG7A 3OEEA 1ZP6A 3KTDA 4ECAA 3NBYC 5E9AA 5ECGC 1W19A 4XWAA 1WABA 1ODKA 3D6UA 3FTNA 4ARSA 5K20A 5C51B 4HNAA 3OM8A 3I23A 1KK0A 3GYBA 2PZMA 2DBQA 3NRBA 3NTRA 1YHZA 4M7PA 2QM0A 4NG5A 4NE2A 4LJLA 2BWJA 2BR3A 3W5DA 2EOAA 3DMTA 1TRKA 1GZHB 1SCIA 1C29B 5GZ6A 1GFWA 4Z3DA 4DZZA 3TDMA 3KE8A 4YUWA 4CR8A 3C7AA 4BAUA 4QO8A 5TXGA 1M6EX 5C81A 5I4BA 1L2TA 1CF4A 1XDBA 2XPCA 3QFRA 3AYZB 2XOKA 4L8YA 3IR5A 4IDNA 1X7WA 5LZ8A 4BMZA 4GKJB 4EVQA 1WMDA 5CYFA 3PRYA 2XIQA 3OX2A 1C50A 4D99A 2OOSA 1LRKA 2F3SA 5I5EA 3NWPA 4M0UA 3PQ5A 2OLJA 4V0ME 4U5XA 4DY4A 2NVUA 2AFIB 1XLVA 4A15A 2PKEA 2UYYA 3WQRA 1ZD8A 3RU2A 4G63A 4CL0A 4F3NA 1HPLA 1NMSA 2C58A 4NAHA 3IUMA 2P9CA 3I5MA 3OC6A 5C34B 4Z49A 2GCOB 3K1TA 1EE9A 1B8PA 1Y8RB 3LPMA 4D9JA 2P3QA 3VR5A 4TXHA 3FLBA 3OZWA 1HH4A 2CVHA 5AYVA 3LRPA 1LC3A 5BYBA 2IWRA 3GA5A 4B82A 10MHA 1FUKA 4YX9A 4NICA 1PR0A 4A0QA 4ENTA 4X3CA 3E3AA 3ED1A 3DUFB 1UJ2A 2ECKA 2WRZA 3ULKA 1K27A 5FDFA 1PL7A 1QFMA 4W5RA 4UBMA 4ND8A 4G4SP 3R7LA 3ZU3A 5AW2A 5AW8A 1N5DA 1PJQA 1X87A 3DBIA 2VNSA 3LJKA 4P5EA 2QENA 3AUJB 5I9IA 1Q7BA 4UTZA 2A67A 2NACA 3L0CA 1XQ1A 3AFGA 3JWEA 1J70A 2NX2A 3FTCA 3MFQA 2W4MA 4OHFA 5DHRA 4EFMA 3KKEA 5JBQA 1J49A 5H82A 1DIHA 3W9UA 2IGTA 2XMCA 3QHAA 1J00A 1XT6A 1JTEA 2WZDA 4LPKA 3VO1A 3WKAA 4ZDWA 1X9IA 2EYQA 5KU7A 1D04A 3SQXA 4HG2A 3KU4A 4RD2A 1WW3A 3WL7A 1GKYA 5SZKB 2GYWA 4PBTA 1Y48E 1NQOA 3MJSA 5EIEA 4DV7B 4ZT3A 1AJEA 4Z4EA 5BWLA 2WMNB 1ONSA 1DWOA 3OPMA 3MJDA 1RNLA 2XT6A 1ACMA 5A5EA 2XE4A 4I5EA 3DP7A 1OV6A 2ZWMA 3OT1B 4Q9HA 4UOZA 3R3HA 1Q7GA 1IWBB 4RADA 4IIUA 2J3MA 4LOHA 1ZN7A 2VP3A 1E3IA 5FAXA 1XSEA 2EEZA 4LWZA 2D4AA 5TPZD 2B7CA 3P9SA 5AXAA 5IYZA 3PTLA 3A1WA 1HORA 4S3MA 1HYEA 1E99A 4D4IA 1C4XA 1RQLA 3LLVA 3GJ4A 3EGXB 3K0BA 1MB9A 3R0JA 3UO8B 4DNQA 1A4UA 4K03A 5I3ZA 4X8LA 1V11A 3I04A 1S3IA 4B44A 4BGEA 4I50A 1MU0A 4KAXA 1U8YA 4CRWB 5IT0A 4GKKB 5EEGA 3IVXA 4D46A 4LZPA 5HIAA 2ZG6A 2YIMA 4O29A 3V7YA 1USKA 1TM7E 1XEFA 4GI3A 4QOJA 3SKYA 3L8MA 3Q9UA 3UV3A 3ZE0B 2CXHA 3UK1A 1XEWY 2VSFA 3ESBA 2AMJA 2VWQA 5FP0A 1Z5NA 1FYEA 2C31A 1SZPA 3FPHA 4JBNA 1VIDA 1TTHA 4QECA 4O3FA 3PKIA 3D7KA 1DL5A 4ZCTA 4J76A 4OK5A 4PYOA 4QUHA 2HCRA 5ALPA 1R4MB 4PS1A 3AR9A 5HW0A 4H1VA 3EIXA 3C74A 4KW7A 4YLYA 1QGOA 5CIWA 1W76A 1ZH6A 2BKVA 2GK6A 2KE5A 3R41A 4S12A 2PSHA 5GOTA 5IJ0B 2I78A 3H1TA 3NOQA 1FW6A 3PC8A 2PO5A 1X9GA 2R8XA 4FUTA 1KE1A 3HRHA 3VPSA 6NULA 2Y1CA 5LOVB 3PCXA 4Y1RA 2O0HA 1X74A 1KPIA 3G3EA 2YFHA 3RIYA 3UJ8A 5E0OA 3BK7A 4QGGA 1UMBA 4Q4LA 3A1DA 4RZSA 5ALIA 1UPFA 3RPEA 8OHMA 3SM3A 4JZYA 4DSTA 1G17A 4DCCA 5A1JA 3I9OA 4BNGA 4IIBA 2P1RA 3CRRA 4HZGA 1N4AA 2EP7A 3KHKA 3UMRA 2ZXEA 1PQPA 4PBRA 4YDQA 3HADA 4OB8A 2SBTA 3GYGA 1R1DA 3NEPX 4IAOA 1T4GA 4QYXA 4FHEA 5BQFA 4ZKDA 3LDFA 2CKDA 5EIWA 2B20A 4ZGGA 3AEKA 1JX6A 1TMOA 5CVUA 3VJLA 5MGNA 3K92A 1WF6A 1QF6A 2G70A 4ER5A 2WMYA 4ZYLA 1DWUA 1FJHA 2AN9A 3HP4A 3WQHA 4ATNA 2BSXA 4HLQB 5EUMA 4DYHA 3K1YA 3CPEA 2I9KA 2BEUB 4LC1A 4OGFA 4QDJA 2W90A 1SUBA 3OH8A 2C59A 1L4BA 1OT5A 3EGCA 3C1AA 4P54A 1MB2A 1V43A 3F6PA 2OA0A 3I6ZA 2RK6A 3MTQA 1UK8A 1WZIA 4JA0A 2Q9CA 5GJCA 2B3DA 3ND7A 4E5VA 2C5HA 3JQEA 2NYRA 3EZNA 2F4VB 5BV0A 2QX7A 4M0MA 1EM8A 2UYOA 3JD0A 1FNBA 3FWHA 3V3TA 1D03A 1LS1A 5JUWA 4YACA 4PYMA 4ASUA 1CP2A 3SQOA 4IXTA 3MJTA 4NECA 3OQNA 2P77A 4YMWA 2WE8A 1M76A 1D5CA 3D8NA 4FGJA 1VMAA 5CW1A 3HPRA 3QEKA 3O8LA 4O4HA 5HTKA 3VPHA 3M0EA 3W8DA 4LIPD 4PYNA 5B1IA 1NVGA 4LXXA 2JJ8A 1WS6A 1UAAA 3K5HA 4BNIA 2HK7A 3EVZA 4B0OA 2GCPA 3CM0A 3AWIA 3MOSA 1JLLA 4KKXB 1L7PA 4XD7A 4ALLA 2AWNA 3ZGXA 3GHYA 1KEKA 3HWWA 5A5DA 1ZO8A 3LPNA 1PV1A 4UOEA 3DNFA 3HKCA 2IS4A 2PR7A 2Y1GA 3K0AB 2ARKA 4RZUA 5A9RA 2E4WA 2WFZA 4BO1A 2AX4A 4TMYA 4YMLA 3HJGA 4LRTB 4XCXA 4LPSA 4BNNA 2WUFA 2BEWA 2OXCA 3K8QA 5IVKA 1IN1A 3P1JA 2OAQ1 4R1MA 3WDSA 3DV0A 3KYCA 4BGUA 1F5SA 5GOZA 3DKRA 5B1EA 3N8IA 2R97A 4J7AA 5TLSA 3NTUA 1B0PA 4KHZA 5C8YB 1DX6A 1P1RA 3UCFA 1GR0A 5I4CA 1C1HA 1F38A 1ZJYA 4KE9A 1QV9A 4F9GA 5ERGB 1N9ZA 1Z6XA 2P9TA 5AOCA 4WERA 3DDWA 3NTXA 4D5GA 3KG2A 4AUKA 1ECLA 2I0FA 1H8EA 2JH9A 1V6SA 3PQ4A 1H3FA 4OREX 3VU3A 1M9NA 3QFTA 5LD2B 2AXPA 1VLHA 2FN8A 2YJGA 3GFVA 4BNLA 5D5QA 4ZAFA 1NV8A 2R66A 3IDQA 1B3BA 4HPJB 4OGGA 1NY6A 2ZW9A 5B64A 1VE3A 1G5TA 2VS1A 1G5FA 5J3JA 5T3UA 2FH5B 2XB9A 3MUNA 4LRUA 4TTQA 2I87A 4YJHB 3OIDA 1RM4A 4UCWA 1XMQB 4BMDA 2NU8A 4J16C 2EERA 5ES3A 1GRVA 2PM8A 4C43A 4YDRA 1W5FA 3THYA 2C5BA 1B16A 2OVFA 4JJIA 5DEIA 1FQKA 3GT0A 1G5PA 5BMVF 5BQXA 5FNZA 2I2XB 2QN7A 3G7SA 1OIVA 5JIBA 3I42A 4IXMA 2OCDA 4C3UA 1Q7CA 2JFNA 4TN5A 1P1IA 3IOBA 1N2OA 3EH2A 1H5NA 4YJ2F 3HH8A 3AOGA 2XF2A 4LCBA 2WTBA 4RMGA 4MQMA 1K6EA 2H7YA 4OM8A 4BUJA 2ZU0C 4GI7A 3TW6A 1GTG1 2D5LA 4HHEA 2C4UA 1ODLA 3V55A 2NSJA 4FHFA 2JFBA 1FX1A 3AJDA 1E96A 1VXOA 1R27A 3C6YA 1HDOA 3A27A 3GBVA 3ROXA 3VR2D 5EINA 3VR4H 4BVBA 3OKPA 3V4SA 1X7WB 2ISSD 2ZRIA 4K8RB 1AKRA 2PAFA 1B42A 3E27A 3EGWA 4K6KA 2AC7A 5FPYA 4ZZIA 4JKOA 4C4RA 4K9OA 3ZHUA 3HM9A 2DWCA 4HDRB 1IJEA 1MC5A 1Q1QA 2FOIA 3DKIA 3QVJA 3WGHA 1ABBA 3NT5A 4OK6A 1KBZA 1OLSB 3DEHA 3GGGA 2NVUB 3A32A 1PDVA 2B4RO 4IHKA 4JLDA 2GILA 1GFZA 3D0RA 3DAOA 4HDMA 3AHHA 3TZCA 4ABTA 2YQ4A 2IZ5A 4MYDA 5M3BA 2Z56A 3K73O 2MCFA 3EFOA 3ID6C 2OHGA 4PPYA 4OFZA 3AI3A 3ZWVA 4PLGA 2P3OA 5AK0A 5DX8A 5LFAA 1FLVA 5EUBA 3DDCA 4KXQA 3A4TA 1QIGA 1AF7A 1ECCA 2VPWA 3TX2A 4A0SA 3DLTA 3PNQA 1CV2A 4WD3A 1YS1X 3NWEA 1Q91A 1B15A 1IHPA 1XA3A 3CLHA 2JH8A 3FMPB 5K3AA 3UW3A 3WP0A 4EB0A 5LQRA 3NYRA 2ATIA 2H0QA 4RIHA 3HLYA 3ZPXA 4F7WA 5ICMA 3U7HB 2FWNA 1STOA 1UIRA 1G66A 1GWNA 1U0GA 4MVXA 4ND8B 4X61A 3RTEA 2QYSA 4PLHA 4PAOA 3Q4GA 4IX1A 3ND9A 4ACBA 1MEEA 2H5EA 3DD5A 1EDEA 4YY3B 1X1TA 2C3YA 2XQGA 3KD3A 2PWPA 4AXBA 4R8LA 5L40A 4KPEC 1NONA 1Z0ZA 4BNVA 1KO5A 3SFVA 3C7TA 4NP6A 4L57A 2J4DA 2YVLA 4Y6GB 3AX6A 1DQRA 3UMVA 4TVOA 1ORHA 1ZH2A 2ZE8A 4E21A 3KK0A 3TGWA 3FCOA 5I45A 3N2ZB 1Q84A 4UARA 1W52X 3I4LA 5LBTA 2DECA 4KQ9A 4QRDA 5BNFA 5A9TA 2OK7A 4J0QA 3LZ6A 1BQ4A 1QYIA 2HIGA 5ALHA 3T99A 1E8DA 5LA6A 4DOMA 1RWOA 2AD1A 5I4KA 2A0WA 5EHXA 5JAQA 1BS1A 2YQZA 4QBKA 3H3XA 2RHOA 5LIPA 3U40A 5IYZB 2G25A 3G23A 4BNTA 1MB0A 3KPUA 2UZ1A 3VDRA 3VO8A 4Z7OB 5A02A 3PT9A 3SYLA 2WF8A 3FWNA 4E4YA 2ZBDA 3EDMA 2OHOA 3FGOA 3B1WA 4EB8A 4MLZA 2QN3A 4NR0A 1Q17A 4Q9KA 1O0BA 4IDGA 4I50B 3PNVA 4CL2A 2C20A 1XF9A 4ME6A 1V45E 4G4SO 4QRIA 4XWOA 2WJAA 4J1TC 2WD7A 2XKBA 3UFBA 2FA9A 3ZBQA 2EDCA 4KRYA 2GKGA 4K28A 2DPGA 4M1QA 3OX3A 4IDOA 3BG5A 1LWNA 3O2SB 2OB2A 4I66A 4MDEA 1HKUA 3JVEA 3C4JA 3T7KA 1JFRA 1FFAA 1UFQA 2B4QA 2Q62A 3TLMA 4GZ6A 1LLDA 5JOQA 1EVYA 2H1VA 1NR7A 2TMGA 2BFDB 2ZWOA 5KNCA 1RI3A 4GLOA 4CNBA 2H9IA 3DXFA 3ACDA 1JQJC 1T0PA 5BUCA 3RSGA 3TN7A 4X92A 3TB4A 2QTCA 7ADHA 3QEOA 1NW7A 1HT0A 1VTKA 3RRMA 5C3UA 4TQ9A 4CQMA 5HUJA 3VOAA 1WSAA 1CETA 3RBAA 1A71A 4GMGA 2IH2A 1OASA 3M3DA 3ESRA 5FT9A 3LVFO 4L1KA 1VCIA 3SC4A 3TCKA 4Y1RB 1F1JA 1RM3A 3PXUA 5ARBA 1P2TA 3ADCA 2FK8A 1UXGA 3B3JA 3C5EA 4LYJA 1UMBB 1O6BA 1YQEA 4OSOA 3QE4A 2FG5A 4ALJA 4Q3BA 1M66A 3UT6A 2GZDA 1U9CA 1EAMA 4WFIA 2A58A 3SJUA 4RUKA 1MCZA 5H5JA 1GGNA 1XRNA 3E8XA 3R1IA 4M0CA 2FV8A 2J0QA 4NF2A 1XL1A 2DSTA 2GPTA 1CUZA 2WM3A 5E9QA 2FEAA 1SXQA 1QV6A 5DHAA 2VSQA 2QBYA 4YO8A 1G55A 3AEKB 1ADGA 5EP3A 3V6LA 2ZI7A 3V8BA 3UK6A 1CJMA 1K5GA 2J3EA 5C31A 2Q2NA 4XJSA 3OZBA 4A4DA 1CUJA 2EW8A 4FMCF 4BATA 4JEIA 4ZDIA 1O94D 2BONA 4XQ0A 1U7PA 1TLLA 4RV9A 2PSDA 4HUQA 1PJSA 2H7CA 4DMMA 4NHEA 1JR3E 1GILA 5HM8A 1IBRA 3U1VA 1Z2EA 2EBUA 2WVGA 3OO0A 4EP1A 2X15A 1NXWA 4YMUA 4LC0A 1E6LA 1L6RA 1ZISA 3EIWA 3PA8A 5C1DA 1CXZA 4QOFA 1YDGA 1QTRA 1GL6A 2EP8A 1EM8B 3BHMA 2FR1A 3HJHA 5JD5A 3WSTA 2X8WA 4JU9A 3GEDA 1SIBE 3D8HA 3OKAA 4MITA 2BMAA 4BFZA 4GDFA 3F71A 3AKYA 3G2KA 3QLEA 4MRPA 1RQRA 4N18A 3FTQA 2VHCA 2PGIA 2JAXA 4UUAA 4O4HB 1E18A 3L6RA 2PZJA 4REOA 2XEXA 2QX9A 1G9SA 3ORQA 4N3BA 2UXDB 3D6HA 5KC9A 4TSFD 3PGXA 3RF6A 4J0HA 1TCAA 2D1QA 2D1SA 4YS6A 3STUA 4PO1A 3X3HA 4DIMA 1GEEA 3DEAA 4W7HA 1YRQA 1JS1X 1WLYA 4GWGA 3T12A 4XSHA 1R5JA 2IYVA 1YO6A 4EITA 3C85A 1AHHA 3AESA 1ZJWA 4OIMA 1HZZA 2A1TR 4R2KA 1F8FA 1RYMA 1NYRA 1XJCA 2PKCA 3HKCB 3I6MA 3IUBA 4ND7A 4GPEA 4ZI7B 4DR5B 2QRJA 5K3DA 3KAJA 1A82A 5KJCA 2CF6A 3AF0A 3JVVA 3LM8A 5FWXA 1AQJA 2HRQA 2OD9A 4P3YA 1Z63A 4JBWA 2BEWB 1RABA 3O75A 2YYZA 3M4JA 1RWKA 2OCPA 3W6UA 4DVGA 2ZANA 3H3JA 4DRXA 2JB9A 1U2DA 2JGNA 3DV0B 3KYCB 4KREA 1I9CA 5CVTA 2XOXA 3KT6A 2D1FA 4C06A 3TZEA 3EVBA 3WAKA 3HXOA 2D2VA 3CBQA 4QUKA 1RHJA 2P8JA 3JTMA 5EZYF 2K7ZA 1VL1A 3UA4A 2C5EA 4WTOA 3H2GA 3KIPA 3ZK8A 2F43A 3GO4A 4LTNA 1WVGA 2IV7A 3KOYA 2PA0A 4M76B 3TD9A 4RF4A 1ONPA 3UMSA 3V1YA 2J46A 2ISQA 2AR0A 3ZZ0A 1PWEA 3AB7A 5K0GA 5SYAA 3Q1KA 2YBEA 3H2KA 1K66A 5KJ1A 2VTDA 3QF7A 2WB4A 4RGYA 2JC3A 4E5PA 2KB0A 1KPGA 3K6KA 1ZSYA 2EFGA 4CF7A 4X8OA 3MA0A 2NU8B 2IU4A 5T4HA 3OZRA 2XMQA 1AUOA 4AJLA 1QDLB 3TR6A 1XPOA 1K92A 2X7XA 4Z9YA 4FW9A 5L8VA 3THYB 3Q85A 3PFIA 4HDSA 1BD3A 4WNIA 4YRLA 4FMDF 3FOBA 3HE3A 5A3RA 2ZWPA 1L4UA 1XRSB 1LNSA 1QQ7A 1X8KA 2H29A 4IXNA 5EJ5A 4FEYA 4BMPB 2RIPA 1G8PA 4N3AA 4RJKA 2DFKB 4B32A 4NEHB 4RLSA 1W36B 1MPTA 5DNWA 1C1DA 1U28A 1C2YA 1PJ4A 1QH1A 3HA5A 4FKBA 4HNRA 4AZ0A 4OLBA 3GUYA 2H48A 3C8MA 4EJMA 3PC2A 5JS2A 2Q7XA 3L8FA 1W4ZA 5E1DA 4B3BA 4JT8A 1GAQA 3HZZA 2GM4A 1UUFA 4Z99A 4D45A 4M46A 3DVSX 1AKMA 1UDXA 4Q7QA 4X85A 5IFKA 2WIAA 1R6XA 1NPYA 2AG1A 2EJBA 4MUHA 1Y8QA 2FWAA 4P32A 3VU9A 4FR0A 3ZCVA 4KL8S 5CIYA 2FMTA 4TRMA 4Q34A 4UTPA 2GUGA 3SSAA 5FR1A 5JSYA 2WYHA 3ZJ5A 1S3GA 2CE7A 3HB1A 4AMYA 1UXOA 1Y98A 3JPWA 4FKMA 2TECE 4FX2A 4QUEA 4BO2A 4MWZA 4M55A 3MMXA 1OOEA 4NBWA 2J32A 5EKXA 4HDMB 3A1TA 3K0HA 2J9GA 4JBLA 1I3OA 3AW9A 2CDNA 5EA2A 4C0JA 3EFOB 4DF3A 4TRJA 4D0GA 3ODPA 1MHPA 4EG3A 2H4WA 1FS6A 3EIFA 3NBFA 5F33A 2NZVG 3TIVA 5JHGB 4WXPA 2GWHA 3SBDA 3W8FA 2V3CC 1XVTA 3DTVD 4P3KA 4G26A 3PE3A 1MF7A 3BTUA 2R8EA 3GH1A 3ZE1B 2EKPA 4I1SA 3TNYA 2NWQA 3A7DA 1L4HA <