3GJRA

Caspase-3 binds diverse p4 residues in peptides
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
141
Chain Sequence
b'DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-3 subunit p17
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 51
structure length 141
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gjrA00
4N7MA 4JQYA 4JJEA 4EHNA 2C2MA 1F1JA 2CDRA 3SIPA 1I51A 2XZDA 2C2ZA 4D3XA 3V6MA 3V4OA 1JXQA 4PRYA 3QNWA 3P4UA 1GQFA 1SHLA 1CP3A 3H1PA 2C2OA 5IABA 4QTXA 2CNOA 1SC4A 5IAGA 1RHJA 1QTNA 4NOKA 3DEKA 5LU8A 2H54A 4HQ0A 1IBCA 2QL5A 5IBCA 4JR0A 4PS1A 5K20A 4EHAA 2AR9A 1RHMA 4AWAA 2H65A 2XYGA 3D6MA 4QUGA 4QULA 3KJQA 5JFTA 1PAUA 5IAKA 2CJXA 1RHRA 2CNNA 4FXOA 1RWWA 3UO8B 1CVRA 1NMSA 1RHQA 2J32A 2Y1LA 2HBYA 2CJYA 4JJ7A 1RHKA 3S8EA 3V6LA 3GJRA 2FQQA 3R7NA 3R5KA 4ZVSA 3V3KA 1RWNA 5IAJA 4EHFA 1GFWA 4FDLA 5LUAA 1RWVA 4QU0A 2NN3C 2P2CA 4I1RA 2CNLA 3PD0A 3E4CA 2XZTA 3H11A 5IARA 2H51A 4QU8A 1PYOA 1RWPA 3S70A 2HBRA 3OD5A 3GJSA 4HVAA 4PRZA 1I3OA 5H0IA 2J33A 3P45A 1K86A 4JQZA 2HBZA 2HBQA 4ZVQA 4QTYA 2C2KA 2H48A 5IBRA 4AWBA 4IEFB 3DEJA 4EHDA 2CNKA 2QLFA 4FEAA 4QU5A 2H4WA 4EJFA 1BMQA 3ITNA 4QUJA 5IAEA 2XYHA 4EHHA 4JB8A 5IANA 4N6GA 3IBFA 1RE1A 2H5JA 1K88A 1KMCA 2QL9A 2Y0BA 3V4LA 3K7EA 3BIJA 3H0EA 1NW9B 4QUIA 4ZVTA 4DCOA 4ZVUA 3H11B 2XYPA 4NBLA 4I1PA 3DEHA 4JR1A 3R7SA 4QUEA 3KJFA 2QLJA 5LUBA 2FP3A 4N5DA 4D3ZA 3UOAB 1RHUA 2WDPA 4HQRA 2QL7A 3NKFA 1M72A 1QX3A 2FUNB 3PD1A 4N7JA 4NOLA 4PS0A 1SC3A 3GJQA 2J30A 3SIRA 4QUAA 4QUBA 4NBNA 2K7ZA 1I4OA 4DCJA 3NS7A 5LU9A 1F9EA 4FGUA 4NOJA 1NMEA 2H4YA 3EDRA 4DCPA 4N6OA 5IBPA 1SHJA 2C1EA 3R7BA 3H13A 4JR2A 1RWKA 2J31A 3KJNA 1QDUA 3R6GA 3EDQA 3NR2A 4NOMA 4N6NA 1RWMA 4QU9A 1I4EB 3R5JA 1RWOA 1NMQA 4LSZA 4IYRA 4M9RA 1SC1A 3R6LA 2H5IA 4QUHA 3V55A 3RJMA 1ICEA 4EHLA 4EHKA 4ZVPA 1RWXA 2QLBA 3GJTA 3D6FA 4JJ8A 4NBKA 4QUDA 4ZVOA 3DEIA 4D3YA 5IASA 5IC6A 3IBCA 5I9TA 5I9BA 2DKOA 5IC4A 3D6HA 3PCXA 4ZVRA 4AW9A
chains in the Genus database with same CATH superfamily
1JDSA 2WJHA 4LNHA 4I46A 5IM4F 1Q74A 4DJEC 5IT9A 5FYQA 1DJNA 1EX1A 2XDWA 3AHDA 1BWQA 4IJUA 4ASUA 3ZE1B 4IINA 4FYVA 2A1IA 1HYHA 1JEDA 2G5TA 3ZD9A 3IELA 4DT1B 3LV8A 4RKRA 4EMUA 2GN9A 2CVHA 2W00A 1K8ZB 4LGYA 1KR2A 1Z6QA 2J8ZA 5G02A 1GYPA 3GRRA 5CFZA 5C9ZA 2HA5A 3LUCA 3HP1A 2J9XB 1EINA 1J7JA 1E1QD 3FPFA 4CU2A 2AH5A 1KTVA 1X7YA 5JARA 2ES4A 1OCEA 2AWNA 3D64A 4HP8A 3SF0A 1XZBA 4EA7A 4NZNA 1D03A 4DY4A 1AGPA 4U7FA 4UDNA 1LCIA 3PXBA 2O8NA 4HPWA 4B43A 1W19A 1W73A 3KJQA 1J06A 4II3A 3TQHA 5TLSA 4DC1A 1SVKA 3VZDA 1E9DA 4GWKA 4F8YA 4OB7A 4DQUA 4QGSA 2G0AA 3KZOA 3OZUA 5JXWA 4J0QA 2EAUA 2GAAA 1IULA 3ND5A 4E14A 3RVBA 5TVGA 4GXQA 3K96A 2FI1A 1TZJA 1CY1A 4P3YA 1CQJB 1J97A 4X1IA 3SBXA 2UVQA 1BHO1 2O7RA 4ZO8A 5B1EA 2JFOA 1AS0A 2HXGA 1MHPA 1D2GA 2IE0A 2JRCA 2L0XA 3ASUA 4U5QA 4OHVA 1PZHA 4URWR 1GGMA 1ISJA 1QQ5A 3H9UA 2JPDA 4O4HB 2V7QD 2C1ZA 3FNRA 4QYMA 1PNVA 4CUJA 3THXB 3GLIB 3PUHA 2BMFA 5ER9A 3K5IA 3Q3VA 4Y0NA 4GE3A 3ZD8A 4FEAA 4MS3B 4D56A 4C05A 4H18A 4K9PA 4YRTA 1ORHA 4JB8A 3TG8A 1EA7A 3EAQA 3DUFB 3UAXA 1K8XB 4MI6A 4IM7A 1SGWA 1X3SA 3ETEA 3IQIX 1T1GA 1SU8A 3EIOA 3II6X 1SWWA 2VP6A 2IZ0A 2R6R1 1T6NA 3EFEA 1RC0A 2FPIB 2HK9A 1G8YA 1LU9A 5J63A 3BKWA 3NOXA 3FOZA 1KBQA 4GIBA 3QLEA 3PENA 5J1SB 1FTYA 2D1YA 4EFNA 4ZT3A 4B75A 2BV3A 2JGFA 4FW8A 1SH7A 3F8TA 3GCGA 3OIDA 4ITRC 3DXYA 5AM3A 1FJGB 1BXGA 4NJMA 4TV9F 3GA7A 1LC3A 1TE2A 4B6FA 4ZYWA 3D7LA 1PO7A 5DT2A 2KWIA 1B6RA 3NLLA 4H7KA 3QQPA 3RFTA 3N3BC 1G38A 3HDHA 2AC7A 3WHKA 4ENQA 2J09A 4F1KA 1KR5A 3BD7A 2AJCA 2CK3A 2DT5A 4INOA 4KXUA 1JNYA 1N4AA 4B7CA 2PBRA 5AD1A 4ZHQF 1B14A 3CNQS 3HLYA 1EFHA 4P7FA 2BM0A 3AINA 3OZ7A 2X7JA 2CKMA 4QOGA 3ES9A 2WTAA 3KNZA 1P2BA 2DQSA 3BCUA 3RTGA 4CWAA 2C04A 2JW5A 1KXJA 2VF7A 1E79A 3L0OA 2O2IA 1Q1EA 3PRHA 1LS6A 4DLWA 4L3OA 5COBA 1XTBA 3KQVA 3O83A 3A6DA 2ZSUA 2IT1A 2LGJA 4L8GA 1KDRA 4PRKA 2C88A 3RDPA 3U9TA 3OC0A 2ZXEA 3EB9A 1OAOC 1LRKA 4E1VA 1BJTA 3N07A 3ET4A 4BTEA 3IEMA 2JIBA 3R3HA 1OVGA 5KQGA 5J43A 2VHUA 5FYDA 3AKDA 3PKZA 3BMQB 1DL5A 1WCXA 3LK6A 1FLAA 1RYNA 4DLZA 3EUEA 3EY4A 4CKZA 1AKYA 1EP3B 3DBRA 2YYZA 5EJ7A 1GU7A 2ON6A 4P4SA 5DX1A 3NH9A 3N9IA 4WA7A 4HAIA 3IDQA 3RT7A 1GCAA 4J3JA 5EMNA 3VTZA 2ECFA 2IX3A 3I58A 3TKYA 2XYGA 5H80A 1FS5A 1HZZA 3VR3A 4AURA 2CFTA 2O8DB 4RHFA 4H9GA 4MP8A 2NYAA 1DEKA 2ZBVA 1MQAA 2DUNA 4HNGA 1T2FA 4CTOA 4L3WA 2ZQ5A 4QC2A 2OGWA 2ZSJA 2XB9A 5TNXA 2XQIA 5FJIA 4AKSA 2J9FA 4CN8A 6YASA 1GFWA 4AS3A 4URYR 2Q46A 5EP3A 3TOVA 1E20A 3IP5A 4LHEA 3EASA 1JSXA 1C4KA 2GZAA 3C7KA 3Q7RA 4YDSA 5BP7A 4Z49A 4AY5A 1J0BA 2O1SA 5DM1A 1A9RA 4LOIA 4YC7A 1NULA 2GNOA 4B3HA 4ENTA 1KMHA 4RF3A 4DMMA 2IH4A 1AMNA 4P4UA 1U9CA 3PIDA 1WJGA 2Z09A 3PZRA 4KSCA 1LLCA 3WE7A 1XRQA 3MWDB 2OCLA 5E6UB 3R8CA 4PNZA 4DV5B 2RJNA 1HUQA 3NTRA 5FBQB 1ID8A 3CT6A 5B5SA 4JS0A 1MC4A 5AK5A 4B6SA 1U0NA 3IP7A 1JDBB 3ONDA 4AMZA 5LB4A 2BN4A 2GYYA 4NCHA 1E3TA 2A0WA 3OT4A 3RAJA 1Z45A 3JWJA 2Q8QA 3ZJTA 3DLBA 3FLAA 5CB0A 1ZU4A 2B78A 2PV7A 2YFQA 3I04A 1DUSA 3OOEA 3RIXA 5EIHA 3H7AA 3U44A 1E9VA 5BN5A 2WWYA 2FSVC 2IYUA 5ERYA 1Z35A 4ZDWA 1UKZA 2WM9B 1KL7A 1FP7A 1PJLA 1QRAA 1TQ6A 3DDCA 4KKVA 3ZX5A 1H8EA 2PWZA 4BPBA 4PTZA 1UADA 4GMXA 2X0EA 4DQLA 2JGJA 3FBWA 2ORWA 2AEMA 1G98A 2YJZA 3AEKB 3RTBA 4PO3X 1ZKMA 1LQUA 1RW4A 3AHJA 1JWBB 2REQA 1XQWA 2WYUA 1QP8A 4IJ6A 2WNIA 2JLQA 3LWBA 3IURA 2WWXA 3W05A 1ZDMA 3U9LA 2R7LA 3N7AA 2WM2A 4Y8VA 2WYOA 1DKLA 2D0PB 2X0RA 3TEJA 2PBFA 3Q5GA 1KJYA 3TSCA 3A2MA 2VDOB 3WLIA 1ZD5A 3UWOA 3EF0A 3VZQA 2W2KA 3ICWA 4MR8B 1PBNA 2QRMA 3CX6A 3M9LA 2G9VA 2YXPX 4QPNA 2PEZA 1KERA 1BO6A 1P61B 2MYTA 5JO0A 4F4HA 2R4TA 3GI1A 2XX3A 2QYOA 2VAVA 2GX6A 1V26A 2Z3ZA 5I9BA 4ZI7F 5CW2A 5IC4A 5IN4A 1P3DA 4MUJA 4C4PA 1FRZA 4DQ0A 3LBFA 4DMGA 3WK5A 4XZ3A 2J1LA 2XXJA 1FFCA 1GNQA 1I7PA 5HG0A 3A1EA 2PH1A 1U3TA 3BE8A 5ALRA 3KZNA 3BFKA 4CYMA 3JVIA 4JH0A 2QVCA 3R7DA 1EHCA 3RYHB 5LLDA 5HKOA 1TNDA 2JBAB 5DXAA 4Y1EA 3CO0S 4ZARA 2GEFA 5CA0A 1O0BA 3BXXA 3SBDA 3PWSA 4BQSA 1ZNXA 3AC0A 4NBUA 3DW1X 3C3JA 3O9VA 4UBIA 5CJJA 2XQKA 3G5UA 4RD6A 3Q88A 4M89A 5BUSA 2NZWA 2FKNA 3BIOA 3D7NA 3ANLA 3VXKA 2FCRA 3AI1A 1BKSB 2PRSA 3D7RA 3ZDAA 2FSGA 4QRDA 3LCJA 4U6QA 1IHYA 1V71A 1PW5A 1KK3A 4IQGA 2RI0A 3TZBA 1W4RA 4IJVA 1RS0A 3NIBA 3AY6A 1NM5C 3KB8A 4KGVA 3JWEA 3CV3A 4OAOA 3TQFA 4WESB 3HADA 4K6HA 1ACMA 3B7PA 4BBZA 5LB2A 3K94A 2R47A 4PSUA 4HAXA 4V24A 3DE2X 3ENNA 4DANA 4DHEA 1TEHA 5K8CA 3ICPA 2CE2X 4KC0A 4IIGA 3SJ7A 1M9NA 5A9TA 3UJPA 3I61A 2RHJA 2C3OA 1XROA 3EGIA 3CUKA 4NU8X 3ZZ1A 4FCVA 2ZKIA 3OIUA 1QSGA 3AEYA 1GR0A 3K2IA 2O23A 5IARA 1SHKA 2I1QA 5LPNA 1Y8ZA 2EW1A 4YXFA 4LHYA 4CLOB 3CG0A 3MGBA 1A2KC 1SY7A 4RF5A 1E8NA 2RCYA 5B37A 4CQLA 1D1PA 1XCBA 2A59A 2H4HA 4HZGA 5FKJA 4BEWA 4F72A 3ETHA 4F56A 1M8PA 3ILVA 2VJLA 5I7WA 1ZCBA 3NVDA 3RT9A 1OYVA 4GPZA 4IJMA 4M0MA 3QA9A 1K3TA 1KEUA 3KD2A 5IVDA 1P2FA 1ZJYA 4U6SA 3S55A 3G8DA 5GADl 4CI9A 3U3RA 3AFOA 3GLHA 2QUJA 3OO0A 4IR7A 1WD5A 3K7EA 5IK2D 4EY5A 2ANCA 1JS1X 2DRIA 3PUIA 4IIJA 4LZLA 4O4IA 3ZWVA 4C7KA 1PLKA 1DG1G 3HXLA 4N8EA 5DDIP 4BGUA 1FMFA 4G4JA 5EFOA 3GXOA 4G01B 4UAUA 4RPKA 3IIMA 2GAFA 2C59A 3W4KA 4Y30A 2Q4TA 2I4IA 3QG1A 4BRWA 3K70B 1RYMA 2PUBA 1F4VA 3RBAA 2GHRA 5TDHA 2H5EA 3IB3A 1GT6A 4URFA 3RAPR 1PQYA 3HCOA 3I2HA 4L4XA 2NPFA 2ZIFA 4A0QA 1JTFA 1GTRA 3ZE7A 1Q7RA 2P79A 1BS1A 2ZYUX 3N05A 4HWOA 4CUKA 3KB6A 4X24A 2W70A 5AIBA 3ML1A 5LMZA 1ZOLA 2YN2A 1AT1A 1NZDA 3X1XA 2QMOA 3ECCA 2ZYWX 4HJXA 2AZ4A 2VPPA 1NUAA 2J59A 2INGX 4KH1A 5THQA 3ZHXA 2XOKA 4I99A 3TLCA 5EPUA 1W49A 4NF2A 2ZRJA 3GLFE 1E3JA 3GHHA 1VKZA 2QW8A 2I62A 2F48A 4NH0A 1FRQA 3PFIA 1Z83A 1EWRA 3PNQA 5A5EA 5A4AA 2P9CA 1D04A 3MEQA 3K70D 2DPHA 4A8PA 5CMLA 3X1DA 4CEIA 2VHJA 2P67A 2BRUC 3D6JA 3FZNA 1GDHA 3LSTA 4MV0A 3DLIA 4OOEA 4XWOA 4QFMA 1XQYA 4Y1GA 3D8SA 1PWXA 5ECDA 2XA2A 1P7VA 3D3EA 3PT9A 4B3RB 4F38A 4PRYA 3T7KA 2CLSA 2ZGVA 3COSA 4LVOA 1T4CA 3OLQA 3QELB 3SN6A 3TW6A 1PD0A 2W2LD 1L7VC 2OSVA 3I3OA 4DCGA 3V9AA 4RO0A 3AGPA 4IRMA 4WV3A 4EPRA 4BXOA 2R97A 1HMYA 1GCUA 1A9XB 4YGYA 1QTNA 3A7DA 4J90A 3WRVA 3OCZA 3HVJA 2NIPA 3D8HA 1UBOS 3MAAC 3AGQA 4C29A 4NXNB 3KSUA 1X9IA 1ID1A 1O94D 4JLVA 1ZKDA 3QEKA 4MS4B 4NMLA 4ZEOA 5KYWA 3R9XB 1QTIA 2SKEA 1K6IA 1LDMA 2I3BA 3LKBA 1PAUA 3GWZA 1U0HC 3TS1A 1RRFA 5CB4A 1XU9A 3IVXA 3STUA 3MUFA 5KSZA 3KHTA 4JYBA 3FDZA 1RLUA 2Z43A 1YMUA 4G0XA 1BKYA 2GWRA 2BKAA 1QFSA 1LJUA 1SU7A 1N5OX 3BULA 3FX2A 4ZAGA 3PFNA 4K2HA 2PZAA 1AQIA 3SZMA 2VUIB 4EW3A 1BMTA 1KEZA 1IDN1 1UPTA 1Z6PA 5HDBB 5C18A 2ZRPA 2QTZA 2O48X 2ZB4A 1LBQA 1SD2A 3EC7A 4UATA 3RARA 3OF5A 3AWDA 1QFJA 4D79A 4B8ZA 1N5LA 2BR4A 1IBSA 1U7TA 4KLRA 1KFCB 4KMRA 3VKUA 4PIVA 2V3CC 4JELA 3Q87B 1XT6A 5HILA 4AWBA 1ZHHA 1FLVA 2VT2A 4NE7A 2X5NA 4LY9A 1VE5A 4KNWA 4KLAA 5KYVA 4HZIA 3L3BA 2IYTA 2HCFA 3A1UA 1SBNE 2P0AA 3LX8A 3DKIA 2O0JA 3EIWA 2NVUA 3LYLA 4IJ5A 5KYNA 5ICGA 3FUXA 5LDHA 1YB2A 3ZJ4A 3G02A 1GTG1 3PL1A 1DAOA 4NWIA 1GZ3A 4IILA 4RXUA 2SNIE 3PEWA 4WX2B 5I4CA 4W4TA 5C80A 3VKGA 3IVRA 3CUEF 1WNTA 1G20A 1VL0A 5ALJA 5CDHA 1RSZA 2HSEA 1B93A 4BGVA 3HCPA 1OLSB 3P19A 3S5UA 2Z2ZA 3OT5A 3WO0A 1KY2A 3CKYA 2PVPA 3PL5A 1ZI8A 3K6KA 3ZIUA 3LBHA 2JJ1D 5F52A 3V32A 4GOXA 3FKSD 3WZLA 2FSIA 2EERA 3K5HA 5T57A 4EG1A 3QE2A 3TLEA 2PS3A 2PX0A 2RK6A 3CEAA 3ODGA 2ODTX 1YRAA 3MMPA 4RIGA 1NP7A 4RIIA 2XKKA 3QVUA 3EJWA 3OC6A 3RTAA 1M34E 3L1VA 4LCJA 1U63A 2FZLA 1LSUA 1XP5A 2QTWB 4QUHA 3HSYA 3A2NA 2VNAA 2G7MC 1WX1A 4L28A 3B20A 3GBPA 3MCTA 5A7GA 2P5TB 3HXPA 4OBWA 3LP6A 3IT2A 2QVYX 3LUBA 1CYDA 3MT0A 3GELA 4RNCA 1CEQA 1E3WA 1OB2A 4JQYA 2XVMA 4TSKA 2RI6A 4P93A 3I6YA 3MRSA 4B5LA 5C7IO 1ADBA 4JB2A 5A4MS 4KTTE 5TPZA 3VISA 4BQFA 3ET5A 2QUZA 3TMYA 3OETA 4KOEC 5FOSA 3W2TA 2J3MA 1GZUA 4J43A 4GPBA 1CYEA 3P52A 1OGYA 1TB4A 2R79A 5LXTF 2W2PA 2WVGA 2FN9A 4MZXA 4UC0A 3N7UA 1ZRNA 3P4XA 1KZYC 2XWQA 3CM0A 3OPXA 3ZS9A 2ZVPX 4HYTA 3GP3A 2WEKA 1NV8A 1E4OA 1YBFA 2QD5A 2QN6A 3T9AA 4F2HA 4IV5A 3HCRA 1E1NA 5F5LA 3W06A 3U4GA 1MT0A 1K7XB 2VH1A 3P2EA 2QVLA 2F1JA 3IIKA 3PNSA 1FNNA 3ORFA 1UBKS 2IXFA 2PR2A 1O95A 4F96A 2GEJA 2VOJA 3E7XA 2BDTA 3G2QA 2IE8A 3IP3A 7MHTA 2BEWB 5CAEA 1YVDA 4YBRA 2Y1LA 1WZEA 4ZMBA 1LXCA 2VAPA 1QANA 3DEZA 4LYEA 5P21A 3TZEA 4Z4EA 2HHAA 4R2JA 3Q3IA 1XHEA 3UAVA 5GTDA 2H2DA 4FS3A 3WTCA 3SJBA 5H4GA 2GAJA 5IH3A 4E2WA 4PR0A 4I1RA 1QGOA 5BW5A 2CUZA 1UOQA 4RE5A 3ONVA 4RZ3A 4JJFA 4L3VA 2O2XA 3OFKA 1CJKC 4BKOA 1F60A 2K4MA 2HA2A 2IC5A 2JD0A 3RQIA 2YDYA 4WBXC 1Z0DA 5CLLA 3UICA 2J3KA 4I55B 4MB2A 4ND3A 4OFBA 2GCOA 1P7WA 5JQGB 5KJCA 2Y6UA 1D1TA 4KXMA 2OBXA 3HEAA 1JHQA 1N75A 4I50A 4J0DA 2WJ4A 4PYOA 2X9NA 2Y77A 1UBFA 3TTVA 4HGQA 1EG7A 4LMAA 4DV0B 2H5JA 1JMYA 2WU8A 5L9AA 4RL6A 2XE8A 3NOVA 4FJ0A 2Y0PA 3SSOA 2I2FA 1TCCA 2Y0EA 3E70C 4YAGA 3BHJA 2X86A 4TT3D 2O54A 2YV2A 5LVAA 2Z1NA 3KT0A 1NIPA 2I2DA 2DFLA 3WICA 1VJTA 3KOWA 2FHSA 4Y67A 3K1AA 2EQAA 3SFZA 2XLBA 3P5BA 3TZKA 4GXNA 4MDHA 4XPIA 4O4JA 4B2IA 3DYBA 1YB6A 3HB9A 2I8LA 4KW7A 1NQUA 5DW0A 1JJFA 4FONA 3PUXA 3ZKAA 1Z18A 1QHEA 4N03A 1MB2A 4E4YA 5IXJA 1DCKA 1E32A 1A9PA 2VXCA 4LWPA 2RB5A 3GCDA 5JEEA 3WMWA 1FFSA 1EX7A 2JDID 4BX0A 5EY5B 3H5NA 5HQ3B 2W4IA 3T94A 1A7KA 4O2RA 1TRKA 2OGSA 4IHJA 4X92A 1KI6B 1DQSA 1VL5A 4NJEB 2JGEA 3BWYA 3RS9A 5JRJA 4AL4A 4XLZA 2Y68A 2LVBA 2OCXA 3HI4A 3LX5A 4TQGA 5DI3A 3VPCA 2WSSA 1MJGM 4JNCA 4WJKB 2DZDA 4UKDA 4C07A 2FUG1 2ST1A 3E15A 3K6SB 4BQOA 4GOKA 5DPMA 1S4QA 4Z0NA 2PS0A 3TOXA 2IYWA 1IPFA 5AJXA 3EX7C 4J7CA 3W6NA 3COJA 3FMIA 1XWWA 2CHEA 1ZG3A 3KPYA 2OBBA 4WHMA 1F20A 9MHTA 1QC5A 2Z5LA 4W5WA 2Q5JA 3QOXA 3TCKA 1UJ4A 1SC9A 2XMPA 4JXZA 4GRIA 1T5SA 3SM3A 2Z4TA 1NW6A 2KSQA 4A2PA 1YDMA 4JK3A 1JDTA 1EP1B 1GVHA 2Y9PB 3SD7A 3TLBA 3RSSA 4AT1A 1X0VA 3KQWA 4FBLA 7GPBA 4HGPA 1O9GA 3VZCA 4DCMA 3ND6A 1KDZA 2REOA 1IN6A 1YDHA 3LVBA 5MFPA 4F11A 3QF4B 1E1RA 4Y6SA 1DKQA 2VJOA 1DZIA 3CYFA 2WG0A 2NSYA 4GLFA 1XJ5A 2B9VA 4N0DA 1SJ9A 2R8PA 3ZWMA 1A4IA 1P4SA 3ITDA 3E18A 4V0LA 4PS1A 3SK0A 5EJGA 3LRTA 2OOSA 4NTZA 2H65A 2QJWA 3BHMA 1C3VA 3VNBA 5JI2E 3S2EA 5DE3A 3INRA 3B52X 3VDQA 5FUQA 4EKDA 3B1ZA 3KKMA 3Q3EA 5JI3E 1NHWA 1T2EA 1T3HA 1GSOA 2J3EA 4RD3A 3HB4X 4KFTA 2RKOA 3IDOA 5LYYA 2EFCB 1E9SA 4NESA 4DLUA 5KTSA 5EYPB 1N2ZA 3FBGA 3OCXA 1H05A 4JOSA 3LT0A 1BEEA 2I7VA 2NN3C 4CGYA 2I87A 2QW1A 3EULA 3E35A 1WWKA 5BMVB 4F60A 3F9CA 2MU1A 3R76A 3VO1A 4BEJA 2FF7A 4R8RA 4V3CA 3AVWA 2PMFA 1JKFA 1LH0A 1P9WA 1JFSA 4BNKA 3AF2A 3T3HA 3HJGA 3HVUA 2GQ0A 4IEEA 4MCHA 4EL5A 2QNRA 3UJNA 4GQBA 5D1HA 4OK3A 1YB5A 1JLRA 2JFPA 1C1DA 2ZR7A 2YWRA 3BS4A 1ZCAA 2A9VA 5U1PA 4AI6A 1DTSA 2CLLB 3HP4A 3OAAA 4JP3A 3T99A 1SB8A 3KKLA 4I1UA 4QGHA 5CT6A 1JV2B 1MEEA 1AZWA 4FD2A 1KGSA 4RZUA 1FW6A 2Z56A 3B78A 4FGWA 4JWKA 2LTAA 2IDKA 5FI0B 3ZCXA 1B1CA 3L7BA 2JI9A 1T5IA 1Y3IA 2CJFA 2QM0A 3UUGA 3LKZA 1UT5A 1RAHA 4JOQA 5BMOA 3V5NA 1H2WA 4D8XA 2O8EA 3AR3A 4QM7A 3OZGA 3FFWA 4M6WB 3DFIA 4UU0A 1IXZA 1G6HA 4J3NA 2ESRA 2R48A 3AVOA 3OY2A 5H59A 1IL0A 2GEKA 5AI9A 3T9BA 1M8GA 1ESDA 2CZQA 5AI5A 1UR5A 3DEFA 4CE6A 1UDBA 2IHTA 5IMSA 1W88A 1WQ3A 4L72A 4BNJA 4Y2YA 5JWHA 1E5LA 3ZV4A 2HLDA 2RONA 1JA1A 2ZIZA 5BYAA 3C8HA 4R83A 3AMVA 4UULA 3T7TA 3ICVA 1LLDA 4YNBA 1SOUA 3D1LA 2X0KA 4QQKA 1QWSA 4X71A 1S8AA 5L7TA 2X8JA 4QJBA 2GZ1A 3SS8A 1SD5A 4IYJA 3DZDA 4MCJA 2PUVA 3DDHA 4TVSA 5GJWC 1P5FA 2PQ0A 3ZXIA 5BWNA 2VKTA 2MINB 4HDCA 2DKOA 4YRJA 4PANA 5C8VA 1J9GA 3ADOA 1VPWA 3T5MA 1D9ZA 3DC2A 3RVSA 1VYHA 2JAXA 2NYVA 4F3YA 2P9EA 2Y8EA 1SUWA 4RZ2A 1TX4B 5ALUA 2CDCA 3PA6A 1NBOA 2BFAA 5HUJA 1KK1A 4XQEA 1JPNA 1W87A 3T3MB 3CF0A 5T64A 4YMTA 1JZSA 1YASA 3EXFA 3M4JA 4E08A 4FHFA 5IKPA 1NW8A 2BVNA 3W0LB 4EITA 2ZS8A 1DDIA 3IAUA 4O2BF 1IBRA 3FMOB 4TROA 4R0VA 4G8DA 4M49A 4KYTA 1N5DA 4BVAA 4CR8A 3UQYS 3GJZA 4Q82A 3F6CA 5IHXA 3G8CA 3IT0A 2H1FA 2BEUA 4FUTA 2X40A 1U0FA 4KLNA 4HMOA 4M86A 2D06A 2NZJA 2ZI6A 4MDYA 4MUIA 4TM8A 4KIUA 4DIMA 1EM8B 1WW8A 1CY6A 3HKEB 4EDHA 3F73A 3HA5A 4TTTS 2QRZA 3HNPA 5SV2A 1AKVA 1TVKB 1X7XB 1XU4A 2QMUA 5FHRA 4I5FA 3UMRA 4UFPA 2WG1A 4TL9A 1MAUA 2J32A 2H2IA 2JJ8A 1V1MB 2BUBA 5HTKA 3KOUA 4RIHA 3AIKA 3SHWA 1F12A 1SR8A 5HIKA 3I92A 4ANFA 4ADSG 5I7SA 3ADPA 3BAFA 4UM5A 3AP3A 4JLOA 4CM8A 3NRCA 4KQCA 4LNUB 1U9ZA 4M8IA 1K8QA 4NQRA 1XMQB 1EB9A 2WD8A 1UEXC 2C31A 1AKTA 3DBRB 4QU8A 3QTTA 4HTAA 2QAIA 4P4SB 3GFRA 1C0PA 5EXSA 4LZAA 5A04A 2PQ6A 1GUDA 1HBJA 1UUFA 3AFMA 1NZFA 2RAVA 2YMQA 1JJ7A 1XVAA 3OEHD 3QLVA 1YZUA 2FMXA 2XB4A 4NBRA 4X1YA 3ADDA 4DAOA 4IIDA 4N48A 2DQZA 5HOQA 3NTQA 4RMIA 4TTVA 2QHXA 1V5EA 3OU6A 1R9GA 4Q4AB 4UMEA 2G17A 3MOSA 4U5XA 4ZRMA 4RLQA 4ZO9A 4E2ZA 2ZYTX 4OLAA 3GRPA 5A6VA 3QMWA 4DEXA 4LC0A 8AT1A 4WD3A 4HT3B 3I28A 1GPWB 5E1DA 1X94A 2NO4A 3LPDA 4C9BA 1YVRA 1LX6A 3ZDYB 1I3LA 5DSZA 2JC3A 4BFTA 2JFYA 3DMYA 2BGWA 1Y6ZA 3CLVA 1YFZA 4ZC1A 3LZDA 4C7OA 3LQFA 1EFPA 4FDMA 3VKFA 3QPDA 2V4MA 3MWEB 3ESXA 5DM4A 5FWDA 1A5BB 4JLDA 4C4OA 4MW1A 2WJVA 4EI9A 2IL1A 2CCJA 3CO5A 1SCBA 1W76A 3LH5A 3NT2A 3RC9A 4DLYA 4TVOA 4CLXA 4G5OA 4DG5A 4EZEA 2GM9A 4E09A 5BQXA 1SBZA 2NAPA 3BORA 3IA7A 1OBCA 5BN3A 1OHHA 3F5DA 4PZCA 2AG8A 1JALA 1HT3A 5JG7A 1XLUA 3WWPA 1NMEA 1GOTA 4X7BA 3NC0C 4K1LA 4DCPA 5K6AA 3DW3X 4WH0A 4A6XA 5IM4A 2G9UA 2GB4A 1NI5A 3W79A 2ZJ2A 3PNMA 5A4FS 2Z5GA 1WUTA 3V7FA 5C1DA 4FYYA 2OT3B 1PZNA 2YCLA 1KZ4A 3JZAA 3VOBA 1G0OA 5KQPA 2FFRA 4H08A 4WZZA 2PFGA 1S3SA 2LE0A 3BIFA 4IGIA 3B1FA 1TU0A 2LV8A 4UJ5A 1PDOA 4JSYA 3N0RA 1U9JA 1XGKA 2JLCA 1R64A 4O59O 2WMNB 1ZH8A 2ZJ7A 5HRCA 5JBIA 3IMFA 1PJTA 4DIOA 4EHNA 1KJNA 1IPHA 1BGWA 3KBOA 3KSBC 3PC6A 4GGOA 3DZJA 3G1TA 4ZDJA 3CF4A 1PEKE 5EQDA 1QHXA 2IHUA 1HDYA 5CX1B 4M46A 4YXWD 4FWIB 1TW3A 3G2MA 3BUSA 4M83A 3E3NA 3GZJA 3UXHA 5CLFA 3EZ7A 3W5JA 2Z98A 1DO2A 1VE9A 3CMMA 3KM0A 5KNLA 1PT6A 2JB9A 1P39A 2X2OA 3CX4A 3K92A 1G3QA 5KAMA 5HHTA 1PQUA 3PEVA 1PVOA 1EXMA 1U8CB 1YD7A 4FEEA 1T9ZA 4OQFA 4RA9B 3UKOA 4KR7A 1KYQA 1QIJA 4XIYA 4ZQIA 1NPDA 1A9YA 1RQGA 1BWSA 4FEYA 2VYVD 5A7FA 2JGRA 2VAWA 2AN5A 2ZUFA 2FX5A 2P5YA 1ISHA 3NWPA 5AH0A 4ZKEA 4AF7A 5I3ZA 2DUUA 2PAAA 5LZ7A 4AVYA 4ZI3A 1QYCA 4EB3A 2AFRA 1WAMA 4LDNA 3MYRA 4PC6A 3O2NA 4BFCA 5B7NA 2VKQA 3ENWA 3BSYA 1JR3A 1KPGA 4NCNA 4DSZA 1RJGA 2RIPA 2HZ7A 4DV3B 1C8KA 2CLCX 2COKA 2ZRIA 1L7OA 2YY5A 3FWKA 4FZ3A 5AW5A 3X2FA 1WLYA 2RMKA 3IVCA 4MPRA 4F92B 5CM2Z 2A1UB 4OFXA 3ZWOA 3PU6A 4FFBA 3NUGA 1J0XO 1RYFA 3N6XA 4FYJA 1S3GA 1ULBA 2I6SA 2JCGA 3OFVA 1AGNA 4HWTA 4RV9A 2CMHA 3K15A 3Q4GA 4UXHA 5EE5B 4HV4A 2ORED 4NR0A 4H7DA 3RS7A 1UPFA 3B3GA 4BB6A 2ISSD 2LUOA 1A5SB 1M7BA 1UBMS 4NE9A 1VKNA 4TV9A 1JLLA 1KRXA 2J87A 2YZNA 1ZIYA 3QWIA 4F2PA 1OXVA 1Q15A 3TXAA 3NW9A 1JKJA 3HRIA 1I7QB 3KB2A 2HHHB 2X76A 2PLRA 2YZ7A 3TW8A 4CQLB 1P1HA 1NATA 5BY2A 1ADCA 1MOPA 5FOXA 5HF9A 2NZUG 5BV1A 1ZNWA 1SQFA 5A6SA 2PX6A 5I5EA 5IPFA 1YRHA 4ZO6A 1GRCA 2WA2A 4ZHQA 5AM2A 4WZBE 4LE1A 4OYLA 1YJ5A 3GRKA 5B4VA 1PT7A 3V42A 4NYIR 3WK9A 4Z9FA 3TNFA 2JFFA 3OLCX 1H2FA 3DDZX 4RWEA 1U3UA 4BQRA 4FFRA 2FZCA 2V7EA 2H1RA 3LUFA 3SM9A 1BWRA 3W8EA 4NRDA 1N2CA 1XQ9A 3PHCA 2LKCA 4KO1S 3UG7A 4IIJB 3PHHA 4D5GA 5BOSA 1AD2A 2IX9A 4ID9A 4QNRA 2GK3A 2CHVA 2I66A 1BD4A 1KZGB 4AWXA 4IIXA 4AXBA 3O93A 2LKDA 1PZMA 2BBWA 3WAKA 3WYGA 2J3QA 721PA 3PEFA 4NU0A 3GQBB 1MT3A 1UZLA 1NVVR 2PL9A 2ZIAA 4DIFA 1DWQA 3EVBA 3T34A 2Q6VA 3Q12A 2J0EA 3C3KA 4H6XA 4ROSA 5F21A 1RLIA 3Q9NA 2ACKA 1THZA 2PMCA 3IP8A 4R98A 4Y6LA 2R00C 4XYMA 4H60A 3NVKI 3F1LA 5CDFE 4LTDA 3G2KA 4PG6A 1ZW6A 2N47A 3PSHA 3QU9A 1SXJE 4X84A 2AMYA 3K2BA 3TL3A 3ZBPA 4FT2A 3O8CA 1XQVA 3O0TA 3MTDA 4AUEA 1K5HA 3UENA 5AHRA 3U7HB 1T8WA 4BRUA 3JZFA 3BDVA 1XLTA 3GZNA 1KEPA 3DDSA 3GNTA 5JECA 1ONPA 1RBMA 4WRRA 3U3OA 4AJNA 7YASA 4D7AA 5KYTA 2OC4A 3ABOB 3ED5A 4GECA 1KSJA 1DHTA 1UF9A 1E2NA 2A35A 3TAUA 4NZZA 4RH3A 2FDXA 5CH5A 3Q3CA 4G89A 4M7OA 4D98A 1J2EA 4EVQA 1GARA 1FA9A 1N7IA 1VHJA 2F00A 3KHKA 4ND1A 3L2OB 4C7MA 2EEZA 2ZRKA 5D3KA 1E1KA 3A3PA 1ZIOA 4LZNA 4OL0A 1Y6GA 4KHPB 2Z6QA 3OQOA 2ZRGA 3OZWA 2OKCA 5E3IA 1B41A 1MVNA 3FOAA 3MUEA 1MB0A 3R4VA 5FB3A 1IONA 2OVFA 4LDJA 1FEZA 1YZGA 4ZRNA 2FQQA 2EFYA 3PIRA 3RBZA 4G4GA 1U81A 1JYSA 1G60A 3D6NB 3ZQ4A 2EF0A 2H00A 2UZAA 2LDBA 3UB2A 1J70A 2G70A 2GJAA 3NYQA 3PZBA 5EWMB 1PUXA 5C8DA 1P1JA 4EO9A 4JP2A 3W3ZB 2BFEB 2GK6A 2A9OA 2HBQA 3DH0A 2C2KA 2D2IA 3TMKA 3OWHA 4H6PA 4MR9B 2VK1A 3COVA 1DT5A 1Z0JA 5JZ9A 1RPNA 5CB4B 1V16A 3VR4A 4DIBA 1AUPA 5JSKA 1DPFA 4R8SA 5KS2A 1EP2B 3NP9A 1G5QA 3ZDRA 4CIVA 2BPOA 1FDTA 4D1YA 2Z1MA 1VHWA 2FSUA 2HIHA 2QL9A 2YJ6A 1KMMA 2FZVA 3QUQA 4HH4A 3C45A 4N18A 4TMXA 4K9LA 5A5VA 3QFRA 4WLNA 1BU5A 1SPXA 2BY4A 1VSTA 1RYBA 1R7RA 1L4MA 4QSMA 5G0TA 4E2FA 2XHEA 1LBIA 3BZUA 1UJMA 3P2KA 4LX0A 4YJDA 3X0DA 4ONEA 1RI1A 2BHSA 2HY7A 3DPSA 4U8HA 3ZTWA 4N76A 1K97A 4GP7A 2JK0A 3TJZA 1P6QA 1RYHA 3W1VA 4BO8A 2C29D 1RZRA 2C5EA 3PDCA 2VDNB 2JJ2D 4EPYA 2G9NA 1J56A 1M76A 2P2SA 2WOJA 3GRUA 3FRJA 3C5WP 3OOJA 3B53X 1B8NA 4NXMB 4I9HA 1IH8A 4IL5A 4LMPA 4EFLA 1W5EA 3IAAA 2XOXA 5IULC 2BEJA 3BEDA 4ZI7A 3SEZA 4V1CA 3REOA 4OGGA 2NUPA 4Q9HA 1PYDA 2IS4A 1Z16A 2JVIA 5EJIA 4C21A 4G07A 2VRCA 4BUZA 1SVWA 4KTVE 4L1KA 5I7EA 2LBPA 3PDWA 3NYRA 5ES4B 3FDXA 3NU1A 1HFJA 1T3GA 2C0CA 3AEUB 3HHEA 2WB4A 3ANTA 4JYCA 4RZQA 1X2EA 1H2RS 3C6YA 1TA0A 3IOMA 4TZKA 4L4ZA 1HURA 4Q9LA 3RC3A 4UW9A 1SXQA 1CHNA 1DIAA 2ZI7A 3MT9A 3NM4A 2B6HA 1RWXA 4G26A 4NMHA 3D6FA 4Z0TA 2IH5A 3EPRA 1WCWA 3QENA 4KYVA 1A50B 3RREA 4OXXA 5F5NA 2E6UX 3FCAA 3FCXA 3KD3A 2ZTMA 4MLPA 1EFAA 1SZDA 2G1PA 2PV0A 1INLA 4I4TB 3D0OA 5C8YB 1TUIA 1ZFNA 4Q9JA 2ZE6A 4RKFA 4TTJA 3RV3A 3O03A 3NG1A 2D7DA 1JFVA 5FTWA 4BCDA 1KC3A 3CWQA 4G0QA 4XFKA 4NBWA 1CUJA 1TPYA 1G18A 1KVTA 1UFVA 3AXSA 4FMCF 3HG7A 4K3UA 4D3XA 2IXGA 5L6MB 1MA3A 3D0RA 3RVKA 3KG2A 2VT3A 2O3UA 2Q6OA 1CRZA 2IBMA 1VMIA 2B4QA 3E0QA 2BHRA 3ONWA 3ROPA 4MGHA 4UNQA 1BD3A 4OMFG 1F2UB 4QG7A 3SHTA 3I6BA 2CF6A 3A9CA 3KC2A 2XCUA 2YRFA 2M1ZA 3GXBA 3VHRA 4OQPA 2Y66A 4QO7A 1MW8X 1EFRA 3B2QA 1B8PA 2XTNA 4LJRA 4BNLA 1VIDA 1KMQA 4L4YA 1L5LA 2FEKA 2PO5A 2DCMA 4WINA 1JH8A 4B80A 1E3WB 3RF7A 4TTPA 4MHSA 4EVIA 3PJGA 5TT1A 4J4BA 3KS9A 1X7GA 4KUEA 3F0TA 1FVHA 1FNMA 1PEYA 2D0IA 2ZYRA 3R75A 3AOEA 4JITA 5FAKA 2XF2A 3EY9A 1JDNA 1RLTA 4OQYA 1F3LA 4QXMA 3HB0A 5AO9A 1Q22A 3B9QA 4BLWA 3T5PA 2B7LA 4LOHA 2J4DA 2AFHE 2DFPA 4DDTA 3HV0A 3RI3A 4WCFB 4ZVLA 3TLGA 1H0SA 4QGFA 4XFDA 5F98A 3JQCA 4LRTB 3UJ8A 4GYKA 2H5LA 5DX8A 3S27A 3WKBA 4PYJA 3FUCA 2A67A 4Y9TA 2GM4A 3C3BA 4D9BA 3I0NA 4YPOA 1ZD9A 2E4AA 2ZBUA 4MYUA 3R9WA 4B6QA 1T8RA 4TQAA 5JNRA 2W90A 4OD0A 1YQXA 5DRTA 1N36B 2PLAA 2GPJA 3CSSA 3NNNA 1FRNA 1THGA 1QS0A 3KKQA 4YJKA 5F4ZA 3U0BA 4PLPA 5CAEB 1AZSC 1N34B 3MWYW 2E5LB 4M4SA 3BB1A 1HRKA 3G5TA 1RYYA 1E69A 2A88A 3ZZUA 3MW8A 4E5NA 3DTTA 4R5MA 3P2MA 3GFOA 2RGYA 4QUKA 3F3MA 2C82A 3ZIAD 2HJ9A 3DG9A 3QEJA 4EWLA 1YJQA 4MGIR 1MNAA 1KE1A 3SX2A 3E48A 4WJLA 5KSYA 1N33B 3EPLA 5ITSA 4BLUA 3CQ9A 3L7MA 1X1TA 3L1UA 3WYAA 2XSZD 4D97A 5TC4A 1DZ3A 4OXYA 1L8LA 1EWKA 3ZVLA 3BICA 1YZ3A 2OXTA 1XHFA 2Z9BA 4K05A 2VJDA 5ANRB 2Y0CA 4I4LA 4I50B 1FFYA 2ZQYA 4TS4A 3JD2A 3LA6A 3NDPA 4Q9KA 3BWBA 1D6MA 3I12A 1SAYA 4YALA 2Q6TA 4AULA 1YQTA 5KVCA 1MCZA 4BWYA 1GNSA 4BN0A 3FZQA 2GCGA 3EYAA 4JQCA 5JSZA 3SJZA 3L84A 4U39A 4W1PA 1ZITA 3JD4A 4MQLA 2B5OA 2EDCA 4JR2A 4X91A 4KB5A 4C20A 1MAAA 1ZR2A 5KQSA 3K0CA 1VLZA 4JXXA 1GU1A 2BTQB 4AZ0B 3P20A 3QPCA 5BSUA 1TZMA 1K9SA 1RI5A 4O4JB 4Z2YA 3TTUA 4JI8B 1LQTA 1PLJA 3RFCA 3CEPB 4DZRA 3TBKA 1VYUA 4YRSA 4LF5B 1QNFA 1YHNA 1X7WB 4ZVKA 1M83A 3E9EA 1ONBA 1DKRA 3EH2A 3WWZA 3GEEA 1VFPA 4AJJA 1UC8A 3NRBA 2AI1A 5JATA 2OO3A 3R3WA 2OCYC 4U0KA 1F0PA 2CDRA 2RGUA 3MWGA 1XRRA 2XZDA 4P3NA 4MAMA 1AUVA 2EX0A 3NUQA 4EG8A 1ZRSA 2C5LA 1Q0SA 3A25A 4CCAA 1K5PA 4RGVA 5JAQA 1XZMA 2ATEA 2XUPA 3GCXA 1RCFA 4OLJA 4XWTA 1RAFA 1NVGA 2GVZC 4ZV7A 4DSOA 3JAKB 1BU8A 2J7PD 2H07A 2YXBA 2OGTA 3LVRE 1O58A 4V39A 3ZW7A 1UM8A 1FPMA 1RHJA 3I9MA 4KEAA 13PKA 3K5PA 3QRWA 4OYHA 4UEOA 3NO4A 1NX9A 2H4XA 3F7OA 4MUFA 1W0KA 4PZ0A 3IV9A 3P9IA 3PNKA 4KK3A 4AKGA 2VLIA 1QIEA 1W5BA 3AWIA 4F97A 4UTNA 3WK6A 1XJQA 5EP4A 3AHGA 3UO8B 5JJKA 1Y80A 1T3TA 5IXYA 3DNFA 3NATA 1R0YA 5EWLB 4BVHA 2FKAA 1C1HA 1QYRA 1DDOA 3SQLA 2CJYA 4GZLA 3WWCA 1QYXA 4Q7QA 4QRHA 1CF2O 2ZBPA 3G23A 3UN1A 1MQ8B 1Z8FA 2E89A 2O2EA 1NNLA 4DC9A 1ZHOA 3QV2A 4J4HA 4M0KA 4DUPA 1C7RA 1AHNA 1DAIA 1VJRA 1TA9A 4EGCB 2V8OA 3GPLA 4QNMA 4PLTA 3AKZA 3FE2A 1SCKA 1CJVC 1R2QA 3IAS6 3L4BC 4HH3C 4I6GA 4JJAA 5ICCA 2ZJBA 4KIJA 5F7ZA 1QRSA 1NVEA 3EYWA 4UCQA 5FI1B 3DEJA 4B9EA 4RFLA 4S1VA 4HDQB 4UM8B 4ZU1X 4CM4A 5ALWA 5AKJA 3SBOA 5ICSA 1XEAA 3ITNA 4MJ3A 3WYFA 1BX1A 1FQOA 2Z2KA 3NXKA 5DMHA 4YO7A 2DLNA 5FPSA 5H83A 3UBMA 3AR9A 4MO2A 4Y6QA 5E9AA 1JHUA 1FNDA 2PYZA 5SY4A 2DBRA 2EKDA 4GM4A 4B8YA 1KE2A 1J2YA 2R87A 4A1OA 1PR4A 2QY6A 4Y98A 5K8VA 1GPAA 3PX3A 3QVGB 4MRVA 4XQ9A 3WWOA 1OYWA 2EEPA 3K9BA 4ZVUA 3U40A 1CUDA 4DCUA 5K0NA 1US8B 1BCSA 4EK9A 3WB9A 1VP3A 1NRJB 2I9PA 2QK4A 1MVOA 5L3QA 5JJLA 4NULA 4JASB 3OLXA 4GPD1 1PX2A 1U8XX 3LYUA 2WTBA 1ADYA 1TLTA 1M0TA 3R7LA 1CCWA 1EUYA 1KDTA 1L4EA 2PT9A 5DSTA 1W59A 5CU7A 1ZJ4A 1VBKA 2ZJ0A 1XZGA 3AV0B 3LFUA 4FNGA 4D42A 5C5DA 5F73A 5AK4A 4HX2A 4A8JC 4Z4IA 2OC9A 3RU2A 1JKXA 3NWBA 4UQPA 3B12A 3Q8LA 2AXNA 5HCIA 1JXAA 1RJ9B 4PIPA 4QREA 1Y6FA 2YHAA 4GS5A 4YIKA 3QE3A 1H9CA 1LI7A 4PSAA 3SZOA 4ND8A 3L4JA 3CWZA 3A27A 1XZAA 3I76A 4GNKA 5ARDA 1ZD4A 1U1DA 5DWQA 3OIVA 3R3JA 4EGAA 4D3YA 1YVPA 2HRDA 5LXTA 1CY4A 2A58A 4IV8A 4RW0A 3ZI4A 4AMBA 3T61A 3HPQA 1BW9B 1H1DA 1S2NA 1BC5A 3B48A 3GOHA 4HAZA 4MW2A 1G1AA 1GKYA 1QVWA 1W88B 3OFND 4TT8A 4DJTA 5BR7A 2B82A 4MHTA 4EB6A 3IE2A 4XIIA 3FXAA 1OXSC 2OORA 2DY0A 3NYIA 3N86A 2FQ1A 1ZD2P 3ORHA 5DNDA 2IOYA 3RYIA 2RD2A 2BLLA 1CUVA 4EG7A 2DQKA 2GN2A 3X2SA 1FX1A 1OFVA 1JA9A 2XNJA 2YFHA 2UUAB 4X20B 2QZ9A 4ASUD 5MGBA 1KNQA 2DFKB 1E64A 1G21B 1L5OA 3I8SA 3O74A 2B34A 3HRKA 4RENA 3UAWA 2GASA 4OP1A 4O2AF 3VH3A 5JASA 5LMUB 2WKSA 1VGVA 3IKMB 2VJBA 5C4MA 1X1AA 1X1EA 1WB4A 2O3TA 3JASA 1NUSA 2ZRNA 1KIFA 2OCKA 3GEMA 4KN9S 2G25A 4MRRA 3AVQA 4QQNA 1IN1A 2G80A 3IGFA 3O3NB 1PYGA 5IUKC 3GGJA 2FUCA 3NP7A 4LHVA 4R7TA 1P7CA 1U2EA 2WM3A 2ZJ4A 4ALIA 1R5BA 4MB6A 3FOWA 3V4FA 2VQFB 2ZR8A 3SSNA 5K8LA 1YZYA 4LYFA 2PKQP 1PNOA 3A32A 3N7TA 3BWXA 2FPRA 3TNLA 1Y33E 3ZHQA 3VSCA 1KRWA 4BQIA 1NRXA 3WWEA 3DVAB 4QD3A 5ERXA 4ZU6X 2BGKA 1R8YA 5FBHA 3TCNA 4RTOA 2GEVA 3L7IA 4NI5A 4LEIA 6AT1A 5FOVA 1YK1A 3EHDA 4N47A 3X43A 1YHZA 5FPYA 3S8YA 3RBXA 1ZK0A 1G59A 1TRHA 4CEJA 4NCKA 3HBJA 4QNNA 1DBWA 4PLHA 2WJIA 5ICMA 4QT4A 1IJFA 4GU5A 1SKBA 4N3NA 4NE2A 3DMHA 4Q6WA 4QAJA 5D7BA 3T5DA 5J58A 2QRVB 1FFAA 1SVIA 2AMLA 4MVYA 4TXMA 1N6IA 3QJYA 1X87A 3LTEA 4U6NA 3SSMA 4EHHA 1KAOA 3ID6C 1JIVA 3KTOA 4GRAA 1IZYA 1GIAA 2YRXA 5HIMA 4PGAA 3H3JA 3ILSA 4K3VA 1CEXA 2JIDA 4J7AA 1J1UA 3TEMA 1QJCA 3W9YA 3IPYA 2YDXA 1JQKA 1Q83A 1NRWA 1PT8A 4BGEA 1KPIA 5JVDB 3IA2A 1TIPA 4G56A 1P0QA 5U4XA 4G0YA 4JI1B 2OXEA 5BRJA 4OLFA 5IDVA 3O1HB 2JA1A 1CERA 2FRDC 3B5JA 2QL7A 4KSYA 4W9NA 1Y9JA 4EMBA 3KQSA 2PMDA 5C52B 3OPMA 4U00A 1Z3IX 4IJKA 3L7CA 4HRXA 5A4DA 2P9QA 3UAGA 1PR9A 2VCYA 3RQSA 1WCYA 3QXCA 3U39A 9LDBA 3OD1A 3ZNPA 4F9EA 4EFDA 1MR3F 1BH2A 1R66A 1LZLA 1FDSA 5DT9A 2VSNA 3EQ6A 4BJ3A 1H2BA 2Q49A 2YW2A 1D5CA 4PC7A 5TMBA 3SZUA 3LWDA 3KVYA 4TLLB 5AKXA 4TWAA 1ZINA 4C76A 2DF8A 3R8FA 3JQ8A 3RU7A 2FSSA 4AK9A 1ZBQA 4CIWA 1Z88A 4JJ8A 1YQEA 4GQAA 3HH8A 4XI9A 1HOTA 5THXA 5CA1B 3NTOA 4M36A 2EKPA 2G5GX 3A3KA 4LE0A 4B3BA 2RG7A 1WO8A 2FY8A 2PKXA 4OIFA 3OE7A 5C3UA 1NR5A 3UW1A 3VTKA 3KR9A 3M6UA 2AJ8A 2WJ3A 3CNNA 5BN3B 3LQ2A 2WQ7A 2ERYA 4B35A 4YMGA 2PUDA 1IY8A 3RVJA 1I51A 2FSPA 4D4LA 4EGJA 5E3JA 1MZVA 1YZHA 4O8CA 4COKA 4CVNA 3HXOA 1E79D 3PDIA 4UNSA 4ER0A 2BD0A 1LB1B 2X3FA 3V46A 3WISA 1QDEA 3LUDA 2QV0A 2VYND 2Y1EA 3LQ1A 5CNJA 1GITA 2BMVA 3NBAA 4DMFA 2Q2VA 2WV7A 4H0NA 3TD2A 3GT0A 4PYRA 4AS2A 4MQUA 3B6EA 1CDZA 5JYCA 5HFNA 3PQ3A 3ZY6A 2W37A 3WG9A 1Q84A 3AHCA 2EYUA 4YT2A 3MSXA 3M82A 3NIFB 4UNNA 4B82A 3PNYA 4F3CA 1G66A 1KZ1A 3W8DA 3UJHA 1EFDN 1NOKA 2I3DA 4HX5A 2IKSA 2C0QA 3C39A 4QQ8A 2NP6A 4AJ9A 1JQBA 3WADA 3FPKA 1ZLXA 1ZOOA 4PCUA 3S6JA 4YCNA 2VYFA 3SBEA 3VR3D 1MJFA 1NQ5A 4N5MA 1RWNA 4EHFA 3E81A 2W93A 4DWWA 3K31A 3ZGYA 1UP4A 4FCTA 4P92A 1M1NA 1FYEA 2A5LA 4HNQA 1CWUA 1YR8A 3BK2A 1CNMA 1Z7YA 4D8WA 3GC6A 1PK8A 4GC5A 4P6VF 4MKIA 5KUTA 1QQ7A 3E9YA 4PRZA 3T1QA 4MIYA 5E8RA 3T52A 3EPJA 2QRGA 2PWBA 1B16A 4OJNA 4NEHB 3CSDA 1TADA 4YR7A 2A1TR 4V2IA 3WK8A 1TYZA 1VTKA 1ECFA 2VTDA 1WUJS 3C6XA 4GG1A 1JECA 3K53A 3REFA 4XX0A 2YKGA 3P9CA 2WU0A 3QJ5A 1SUDA 3VAAA 1P2UA 3IE1A 4Z4CA 3AJEA 4R9NA 2QEQA 3A1SA 3IDAA 4PSCA 5IANA 4EJSC 2AZMA 2B8TA 3WMFA 2FWAA 4PFQA 4ZAYA 3JX9A 3ZLBA 4MGZR 1R4MA 1Z8DA 4BO9A 1P4AA 2Q1YA 4E5YA 1QIGA 4WZAA 3QQ5A 4DCOA 1JHXA 4YRFA 3I62A 3HJCA 1FUUA 2VDWB 1RKBA 1KK0A 2JFVA 2SKDA 5CG1A 3G6KA 1LNZA 2O1XA 3KJFA 5BV8A 4I81A 1FQKA 2DC1A 3QF7A 1HEIA 5IJ0B 3BWEA 4XIGS 5F7JA 1KK2A 1GZVA 4RIEA 3HY4A 1V7ZA 1DMSA 3PR1A 4QBGB 4CT0A 5LQRA 1LEHA 4UUBA 1V7CA 3CLTD 3PUWA 1MF7A 2QTFA 3HO1A 3PEUA 1GG9A 2GERA 4XXHA 1TQHA 2R1TA 1QPZA 3NNDA 3STXA 1H8ED 2VJQA 3WRWA 4FEGA 2UYGA 1SPBS 4KR2A 1EGAA 4R2KA 1J49A 2PZEA 3LYAA 4YV7A 3KK0A 2GJ9A 3LUKA 4L85A 3NHWA 3S2YA 3ZGOA 2QSZA 2VYCA 4DJJA 4I9FA 1K6JA 1XVLA 1XMVA 2HTFA 3HCDA 2FJ0A 4MW4A 4IQ4A 3GJ6A 1ZM2A 2CDNA 5DB4A 1Q3TA 1KJ9A 4ND4A 1A9ZA 2FDRA 4O2BA 5CURA 1QF6A 2P65A 2XMCA 3M4YA 1YZQA 5KYKA 4MQFA 3DCIA 3FUWA 3TZCA 2FLVA 5AVSA 2NSHA 1G5HA 1LK5A 2WSMA 4LBVA 4H7JA 1KA9H 2IODA 3T7EA 4DILA 2IFTA 3D8BA 3NOOA 1WV1A 5CX4A 4KPUB 4PLZA 5C7OO 3WLLA 1HEUA 1UJ2A 1HE5A 4Q19A 3ZXUB 2D5CA 1RQLA 2QVGA 4ITVA 5D01A 1K4MA 2NUAA 4LDQA 4JB3A 4DL9A 1KC1A 4KIGA 3PNVA 3RYFA 1W5TA 3CFYA 3SX0A 4OL9A 3DXXA 4URZR 5ALOA 2Z83A 1IYZA 2EP8A 1OAOA 2H7XA 1PV1A 1JHOA 1W4AA 2Q2WA 2XWBF 2E2WA 3CF6R 3FHOA 4HQ0A 4M0LA 4U2CA 1NXWA 2P9TA 4BFVA 1AKRA 2V6IA 1R8QA 3G79A 1LPAB 4OHBA 5AXBA 3VV3A 4G0VA 3QFHA 5AVOA 4REMA 3OKFA 4URUR 1Y48E 4RA6A 3PPVA 5F1YA 5J2UF 2ZCVA 3ZS8A 4AD8A 1RWWA 3CY6A 3UJ7A 5AW3A 5HFAA 1OLOA 1U28A 1IZ0A 3PNPA 4XH9B 1CUUA 1Q0ZA 5IX8A 1LNQA 3LGSA 4B74A 1PNRA 1K7FB 1UPXA 2JI8A 1E2DA 3VMFA 1OX6A 2OYSA 2WSIA 3U3ZA 4A82A 4HVCA 5BT9A 4B45A 4EX7A 2ZVDA 2QLLA 2XAAA 3V4VB 4AAYA 4ZZ1A 2H51A 3FTQA 3PWKA 1DMRA 4DNXA 4IKOA 4EX6A 2HBRA 4XYBA 4A6EA 2GXAA 2H3EA 3GLSA 3EWSA 3RSZA 1HZJA 1PS9A 2OA0A 1JW9B 1J09A 1KFBB 1XDBA 3SXJA 3ZWQA 1CTQA 2QV7A 2YBDA 3S2ZA 3ERCA 2BJHA 2O19A 5IM5A 3GMIA 1VE1A 3E5HA 3GEHA 3HFJA 3LVQE 1U8FO 3PD7A 3SC2B 3UVEA 4EMSA 4DB2A 1MRNA 2GFQA 1OREA 1SK8A 3CISA 1RE1A 4J2TA 5AJYA 1E2GA 1PSZA 2GTIA 2OHGA 1EB8A 1YJAA 3OPQA 4UUOA 1KH1A 1WUIS 2V6GA 5AKEA 4AKIA 4ATNA 3Q40A 1KO8A 3QK7A 4MINA 3F5QA 4P53A 4CQNA 5E9QA 3DEHA 4KRGA 3A7EA 1NI4B 3OJWA 4KWTA 2QSUA 3NBYC 1K3FA 4REQA 3Q9SA 3LOUA 4A16A 1XKXA 2OCDA 3D8UA 2FF5A 2COUA 3JARA 4A1FA 2FZ4A 4W7SA 4HLUC 4AQDA 1CETA 1E1CA 4MWGA 2ZM5A 1NE7A 2GXUA 1XCLA 5JNUA 1KZ9A 1MXHA 2ZE7A 1XAJA 1ZJZA 4X00A 4Q01A 2OV8A 4B84A 1LD3A 3JTMA 3IAHA 3UK6A 4BATA 4BL5A 3UMYA 1X7ZA 3TAXA 2RHWA 3CRMA 4F04A 5DASA 2P3LA 5J3JA 4GYJA 1MORA 4BECA 4EPXA 5HTOA 4GKJB 4GMDA 1S2OA 3KPUA 2B3TA 1ZQ1A 2BFPA 3CLSD 4X1KA 2RHBA 4ZOAA 1JHVA 4HADA 4MVJP 4YGXB 1U98A 3BKXA 3U3MA 1A5AB 4DA7A 5LKAA 1KQGA 4YCAA 1S8NA 3G7SA 3NDRA 4Q00A 3THRA 3TN7A 4EIWA 2LDXA 2B4YA 4XJVA 5KTTA 1QG0A 3KOOA 3FVTA 3DL0A 3E2PA 3O4HA 3OM8A 2Z95A 4XB6B 3V7NA 4AUNA 5AVJA 1A7UA 1D0SA 4HNSA 2R8YA 3E0XA 1YBAA 3ZDFA 3KLOA 4DIKA 4RTMA 1VCIA 2TMYA 4INZA 1FZTA 1QZUA 1HFWA 1B4DA 4FYWA 2Z6VA 1V8PA 4Q93A 4A0RA 2GN8A 4KXYA 1GFIA 1MOQA 2PH3A 1WCV1 1E6MA 2CWDA 3U4IA 5F4BA 3WQQA 3ZNNA 4CL0A 5B2EA 4ZVNA 2JLYA 2WHQA 4UNPA 4E33A 2IXTA 2V58A 5IC5A 3MIIA 2Z8ZA 1H22A 4QXOA 4YRPA 3ZQUA 5K0FA 5DP2A 2HT1A 3AJ9A 4KO4S 4AN0A 1XTTA 4UAGA 4ZC8A 2C54A 5KJ1A 3CUYA 2VT6A 4KR9A 1R4NA 1ANKA 1M2FA 1XV5A 1YR9A 3EXEA 3NEAA 2FH5B 4IG9A 4LBZA 3NHMA 1IIRA 3NVAA 4XR9A 2GCPA 3MT8A 2HYDA 2LRHA 1MG0A 1IHUA 1KARA 6REQA 3B3QA 2EW2A 3B60A 2FEOA 1QFMA 1XRNA 2VF4X 3G1UA 3TRKA 2C83A 3IVMA 4YAIA 3CW9A 2BFCB 3BZBA 2CD9A 5EZ5A 4BYMA 5B3JC 1KAGA 4EG4A 4RETA 3B3AA 2DEUA 5FBLB 4NICA 1FX0B 2P0EA 4Z7JA 2R3SA 1SKYB 1JSCA 2IW3A 1ZY2A 2Q3LA 2A9QA 3MINA 4G1CA 4L27A 4NENA 3TVDA 1QH8A 1HX7A 1N2HA 1L1RA 4FYMA 4R5HA 2YQ5A 3PLNA 2F8SA 1UWKA 5HJ5A 3WB0A 4AJIA 5DIFA 4BLRA 1P0CA 3HU3A 3JVUA 3FYSA 2GBLC 3ESQA 1P1CA 4DLVA 1XLWA 4U7JA 4B3XA 1JEEA 2FR8C 2X9VA 5CT9A 2G28A 4H77A 1II8B 5CEFA 1IZZA 2QX8A 2C7BA 2JFZA 1PNQA 1UPUA 1FNBA 2OV3A 5THKA 3ZWPA 1PGOA 2JCXA 4B1FA 2VF2A 2ZULA 3DV0B 1OZFA 3K0KA 3GEGA 3GMDA 3KKKA 3LAWA 3OHMA 1CR0A 3WWYA 3C6ZA 3U4DA 4HFNA 1H9AA 4NC9A 4YA6A 4QUEA 3U0VA 2VVTA 4W82A 1L8AA 1OFHA 4YT4A 4RABA 4IGKA 4ZZ3A 2GPSA 1T36B 3EG9A 4KHZA 4LDZA 1B26A 1VKHA 3JYHA 4C4AA 4DY6A 2XZLA 1C30B 2ZYDA 2AJBA 3MMZA 4C06A 1JUDA 4WPGA 3A1CA 1R8XA 3OX1A 3P9KA 5CYPA 4EW6A 3GLFA 3Q3JB 3KBBA 4YP5A 3AXTA 1GDTA 4DCJA 3BILA 1VI6A 1SUSA 3HRHA 4YQZA 4KQHA 3SSAA 3HFSA 4KDRA 2CHGA 5FOTA 3ZQ6A 3WGMA 1QDLB 1YRQA 2J31A 4JSTA 3EOBI 4CM9D 2XRMA 4FT4A 3QLJA 1QIHA 3OEWA 4PZEA 4ZOEA 4YP9A 1NP3A 2CMDA 3ZDDA 2BFDA 4BC1A 1YE5A 3NMUF 2GWHA 1CUYA 1ZJJA 1MV5A 3DWEX 4KQXA 1I7LA 1JTEA 2XOEA 3RHSA 2WW8A 4BAGA 5IASA 2OQVA 4DN6A 3RSOA 1GXSB 3MS7A 4F86A 4UD2A 4JL8A 3FJ1A 3ADBA 5LL6P 3QTBA 8GPBA 3NZEA 1J1IA 4RK6A 1R6XA 4GMHA 1XYYA 2H52A 5CK4A 5E6RA 4D74A 5JZMA 2Q5IA 3DWGA 4LZPA 2C4NA 4YMIA 4DTIA 1E2FA 5LQAA 1KGDA 1TECE 2AF4C 1XX6A 2BONA 4MVWA 3TINA 2NVBA 2FOLA 4X90A 5IDQA 5K6TA 1HE8B 5A0VA 1GGNA 3ZPXA 2BRUA 5NLLA 3IXQA 1JAIA 1K68A 3FY4A 3FLMA 2JI6A 3QMVA 1EK6A 1HETA 2PZMA 4BNDB 1Y5MA 4CLRB 1NY6A 5LA6F 1QVRA 1NF2A 2O05A 5FWYA 1E7WA 3GJ8A 4BMZA 3JQAB 4QWMA 3ZWKA 4OHXA 5LP6B 4H4CA 1ZMTA 3DD5A 3JAWB 3Q7EA 4DA4A 1DRWA 5JUWA 3LA8A 3LF1A 1EEHA 1H0RA 1HY3A 4OFWA 1CX9B 3RRJA 3FMFA 4BVJA 4RTPA 3HDQA 1JILA 3L0DA 3W7BA 4E3WA 4XD7D 3UYKA 4CDRA 3D4OA 2HPAA 2ZU0C 3CRRA 3P0IA 1VCOA 1SCAA 1Z28A 3Q6MA 3FCYA 4V0RA 2ZB3A 2IVFA 2NQ2C 2ECOA 1MJNA 3Q0EA 4H59A 1GGVA 5GZ3A 1T9BA 2Z2JA 1WHTA 1C3OA 4D8TA 3A6ZA 2YWJA 1PK9A 2FFAA 4RDHA 1BX0A 2QTHA 3JY6A 4GICA 4GSKA 5EIAA 3VZRA 2I6QA 4PC1A 3FHTA 3SLGA 1VPEA 2I99A 1P5ZB 2Q1UA 2RARA 2PUTA 5G3ZA 2P3SA 3AJAA 3V2IA 1GO2A 1YGPA 4PPGA 4BNVA 4BP8A 5JH7B 2D59A 2XW6A 5KBYA 4YAOA 2EU8A 1UWVA 4YT8A 2EKQA 3ZXXA 5HRUA 2QMYA 1Q0RA 1XD9A 2V55B 2YH2A 4ZMSA 3F3KA 1JA0A 5T67A 4BX8A 4B3JA 4K86A 3AUUA 5CD1A 4WUVA 5K05A 1P3Y1 1Q0QA 4UU8A 1SZJG 1HDRA 3IIIA 5LIPA 3I8XA 5JCJA 2IY7A 3VR6H 2H06A 2DSTA 1JG1A 2ZS9A 5FLYA 4CF6A 2X5XA 2VWGA 2ZYHA 4ER3A 4Z3KA 3DYIA 5LUBA 4HMPA 2ZSKA 2IYEA 2B21A 1G9XA 2D62A 2VJPA 3QVTA 1QCCA 4C88A 1FFDA 1Z8HA 2VQDA 1WVMA 1M34A 2GA8A 2O2JA 4TKUA 4LZZA 3RYTC 4BBPA 2HUNA 3BMNA 3NHSA 2XUIA 1W25A 3EFOA 4XRGA 2GDJA 3QKRB 5B6JA 3JQGA 2YWFA 1O4WA 4GZ6A 4XCQA 5E2BA 3RC7A 5JJ5A 2VK4A 3OQBA 1YRLA 1HLGA 3MILA 2CN1A 1P44A 1R6TA 2FJPA 1NXXA 2C2BA 1M54A 2R86A 1HWYA 3Q7PA 4UJ3A 3GAFA 5DTMA 4N7BA 2HKIA 4G0MA 4Q47A 1Q11A 1CUGA 1BCSB 2HK8A 4W1RA 2YASA 1H2YA 1Z62A 4HN2A 4IGFA 1DQRA 1HZZC 4IVRA 1U7UA 4RTNA 5JY6A 4DMUB 3CZ5A 3KJIA 4AYWA 3AONB 1ICEA 2ZP1A 3N0VA 5H81A 3GJTA 3WLSA 4ALKA 4FNAA 2WSSD 3KZKA 4MJLA 5DIZA 5B7GA 3UMMA 3DHVA 4LPSA 1E5TA 2ASVA 2C42A 2VJAA 4FIDA 1DV2A 4PCVA 2VHVA 3RH0A 4AMVA 1W46A 5EJFA 4DW8A 1SCQA 3NONA 1KVSA 4WKOA 3LS2A 4K6CA 3ZC3A 1D8AA 2A6PA 2AUMA 2ZJ3A 3AERB 3MOIA 2H2FA 2BI7A 4DLAA 4DSNA 2GRJA 2OLKA 4H3SA 4JA0A 1TGYA 3EWNA 1A4RA 2G5CA 3NBKA 5CXQA 4Z9BA 4MUKA 2FR0A 2G8LA 2NO9A 1Z15A 2WIKA 2YNMD 2YXNA 3I9OA 3IP9A 3PSAA 4ND8B 3RJZA 4RSMA 4KRFA 3CGWA 3ABZA 3F74A 1DI0A 4WXYB 2PWYA 1T9GR 3D3JA 1DOZA 2WC1A 4DRYA 4BZQA 1PG0A 4XM1A 1QAMA 4TZ0A 1E1RD 2NLOA 5LOVB 3B5IA 1KS9A 3ZVNA 2RDMA 1H0HA 4X3PA 1WMDA 3GMTA 1CB0A 2FYTA 5DM2A 4F91B 3FNBA 3G59A 4EB6B 1DOAA 1MAVA 1U8TA 2FPXA 2YWCA 3JQQA 4L4RA 1Q3KA 1JG7A 1QR6A 4KQIA 3UWSA 5A4IS 2FMIA 2Q7OE 2O2HA 1DAHA 2LD4A 4F46A 3B85A 2QU8A 4X64B 2D4AA 2HH9A 5JAOA 4BO6A 3K8QA 3QWHA 1U3FA 4G3XA 5K0LA 3SMQA 1QTQA 3HCAA 1EG2A 5ALDA 1L5MA 2ET6A 4WFIA 3U7RA 3JASB 1AXEA 2QTNA 3A0RB 3RUCA 4MRMA 1XMSA 4Z7NB 3IXLA 1Z5PA 4XVRA 3TR6A 3VGJA 1O97C 5ADHA 2I3GA 4EGFA 3W6OA 1HDEA 1G16A 3BF8A 4ZQHA 3LOPA 5ALFA 4PTYA 1ZEJA 2KQUA 4L6IA 4WI1A 4ZEWA 1ECBA 4MS1A 1JU9A 5K0GA 1QKIA 1V4BA 1RJEA 5WRFA 3E7DA 3RJ5A 2Q6LA 5J40A 1P0PA 2AXEA 4E07A 2QQ5A 2V7GA 3AL3A 2ZUBA 5CCBA 3UK0A 3M6AA 1UINA 3M7IA 5FORA 1Z74A 4ER6A 4OA8A 1S6YA 1MO5A 1O6GA 2VPTA 4YJHB 2PFSA 4NU6A 2RAFA 3RJTA 2XKAA 5BXYA 2VQ6A 5JSHA 2J5XA 1TC1A 1TUGA 3B2EA 3H16A 2DWUA 3KXDA 3OECA 4IXTA 4UMDA 3A0UA 4NZMA 2IWHA 3BBPA 3OPYI 5B55A 1N5RA 4CMJA 1VGQA 5BQPA 3S2IA 1U31A 1OMOA 3ZWCA 4G5QA 4GOMD 1Z08A 3E9CA 1XDGA 3HN2A 4RQAA 1DU4A 3ILYA 1AZLA 3JRXA 7REQA 1K66A 1X42A 2BGMA 5FA5A 1GA1A 1RYZA 2EYQA 3F3SA 4ZT6A 1U6KA 1ZH6A 4OI1A 3SKVA 1JFFB 2VTBB 2P4UA 2WD7B 3PFGA 4LSZA 5KNBH 4NKRA 4MTCA 2PMEA 2YWGA 4PQYA 1U9IA 3SIWA 1Y1RA 1B0UA 3OESA 2FPPA 1S96A 2J4CA 2YJNA 3JYNA 4QGAA 3O4VA 2AMJA 4YRCA 1DBQA 3ND8A 5B2ZA 5ICEA 3GBVA 3O8RA 1CFZA 3P2IA 1ILEA 4ABYA 2IS6A 3RHFA 1H6BA 3TIIA 5DK4A 3SR3A 4US2R 3H2YA 1ESMA 3M6LA 1U5CA 1XMXA 3VI4B 4LJLA 1DNPA 1O7JA 4OXQA 4ZT2A 3SXUB 1E7MA 3AQ4A 2F9LA 1HM5A 2V03A 3LYHA 3TSZA 1XI2A 5DVZA 2QTVA 3JQ8B 1Q44A 1EH5A 1KDVA 3O84A 3BN3A 2YZ2A 3VNUA 2BP7B 5H82A 4AJPA 1TEXA 1MVLA 4GDMA 3N0TA 4P38A 1AQUA 1GL6A 1PZXA 3BGSA 3V4PB 1A3CA 4DCVA 1IY9A 3QKSB 4L78A 1PL0A 2RK4A 3OCUA 2K2QB 1PJCA 2N9UA 1S7GA 3G7NA 1OC2A 5CLJA 4GR9A 3TMAA 1TK9A 3EAGA 1HPLA 3HXMA 5K0BA 4GPEA 3KFLA 2PRIA 2H7VA 3R3SA 2TSYB 1W9HA 4YAEA 3LWNA 4Q7JB 4Y2RA 3C7CB 5ENDA 2A14A 4HDNB 1BVUA 4MRAA 3TTYA 3WNDA 3TAHA 3AR8A 3FI0A 3ILHA 4DKXA 4CEHA 1USGA 1VBMA 2N75A 4Q9IA 5FTJA 4BCCA 4PFJA 4LJ6A 2FJUA 3NHPA 1OPXA 3EMKA 1C9MA 4Y0VA 5BO5A 1EBUA 1X92A 3DMRA 3MRXA 3H6KA 4U9IS 5HYVA 1L5KA 1AE1A 1PL6A 2QDKA 3ESAA 1CZKA 2VBFA 4MIEA 3AESA 2WIBA 1XF1A 3G9TA 5AIAA 1QR2A 1KU0A 4JC0A 4QJ5A 3IJEB 2AVNA 5FFNA 2OWEA 3AU8A 4CCSA 5AUQA 1PJRA 4RFVA 2ECQA 3ZHCA 4FKZA 1ZHFA 3UJBA 4A91A 2F3RA 4K9SA 3F5SA 1T1EA 1G5PA 4YMSA 3AF6A 1U0GA 1KHHA 1KI3A 4CKCA 4Z99A 2ZT5A 3D3KA 2XGJA 1X8KA 5KPJA 1XPRA 2QTRA 1AS3A 1L2TA 1SBYA 2ZYGA 1N0UA 2IHVA 3CNLA 4QJ3A 5E7MA 4DE5A 2PGDA 4TWRA 1W1WA 2EWMA 2O5CA 1TD1A 4Q4DA 1ORTA 2J6BA 5ITVA 1XAGA 1C9EA 4EL0A 1Z26A 4HQRA 4I9GA 4I9UA 4F4JA 5IG2A 3ER6A 2B25A 2CFRA 3N5KA 3I0MA 4LOAA 1NF9A 4ZAFA 3IJ5A 4J0CA 4AYTA 1QHIA 3SEFA 4ZGWA 5FX2A 3HUDA 5LIRA 1UXJA 2BTEA 2EJUA 5HWSA 5F64A 3ZI0A 3DTYA 2IEDA 3A6EA 4FN5A 1T6ZA 4JT8A 1RZUA 3VMMA 1G2PA 4I2NA 4R9RA 5EC8A 4NQZA 3UGKA 4D02A 4F5ZA 2PRKA 3IUJA 1BSVA 4KODA 1HSZA 2OHJA 3OO1A 4WKCA 1I4EB 2AFIE 3EPKA 3HE3A 4C6TA 2QG6A 5DLPA 2FG6C 2Q6KA 5L3SB 3HZHA 3HFRA 1E59A 2FN7A 1Z7EA 5YASA 5B12A 3PJEA 1TF2A 3TQCA 3V33A 2H11A 4O2AA 1WXEA 5BW4A 4AF6A 1TVCA 2VN8A 2XADA 3BMOB 4GQIA 4QBKA 4XVQA 5FBVB 3T1OA 1M73E 2QA5A 1H85A 2WQZA 4ZVRA 4YMHA 2R1TB 4BVFA 1YA6A 4QASA 4JI2B 3EZGA 4ZN6A 3KAPA 5DYWA 1HF3A 1W85B 3QXHA 3KWFA 4JC5A 3SQNA 3ZBUA 4O0MA 1RKQA 3L8DA 5IU6A 1P2DA 1IAQA 3S7ZA 2YJTD 3CONA 3GVXA 5K01A 1M66A 4FYPA 4D4HA 5JS8A 5UKDA 4BTLA 3TL6A 3ZQJA 3RLIA 1I3CA 4KN8A 5KNBD 2PRYA 5I48A 4UASA 3ROKA 4YRNA 1XPJA 2QMHA 2MWMA 1Z07A 1ULHA 3BA1A 1JEOA 5CXSA 4FN4A 1Y3DE 5EUBA 4MQFB 4TKLA 1JR2A 2X1HA 2O0KA 1A97A 4U2DA 4Q9AA 2JK1A 4QVKA 2Y05A 3K0HA 5BQ5A 3ZU5A 1Z4PX 1VIVA 1YOBA 3DL2A 4J6EA 3T5BA 4DUGD 3VPBA 3F98A 2HIAA 3AFGA 4JGBA 3HR7A 4HAWA 8MHTA 2F43B 1V8DA 4YJ3B 1HE4A 3FWPA 1UPAA 2JFUA 4IZOA 4RKEA 1VL1A 3R5KA 4PGHA 2ODWA 2HFJA 1QNLA 1KI9A 4G8JA 1LDNA 1VHLA 4QG3A 3USES 3AFIA 3GJ0A 1JRLA 4PHGA 4BNTA 4ENRA 1TQ8A 4Y2JA 1J5PA 2Y3IA 4M7WA 2JFGA 3O38A 1IUOA 2WAAA 3S2FA 4B9AA 3NDBB 1YBVA 1E3SA 4TSRA 1UC9A 3WKEA 4D43A 1M6YA 2MOKA 2JEYA 1JR3D 2HLNA 1KEEB 2OAGA 2H2HA 4MMZB 5EXXA 4C7JA 2VPIA 3L0BA 2CNKA 3CH4B 1UBGA 1YR3A 3PC3A 1A8SA 2XV1A 1JEYB 1HQKA 1YO6A 3ER9A 5GWXA 1VQ1A 3ZDZB 2PJUA 1DWOA 4QLBA 2QAJA 1K88A 2Q3HA 3R09A 4MGKR 3RBVA 3VSBA 3QYJA 2GGSA 4U2GA 5DRYA 1GNRA 3OCWA 4MUAA 4RSHA 4ZOLB 3AX6A 3BJMA 4DJFC 5BSKA 4I1PA 2ZIEA 4M0PA 2D74A 3M4NA 4ZAVA 2WIFA 1OH6A 4LZJA 1EUQA 3ANSA 1J24A 4WCVA 4F1JA 4PQRA 3GMSA 2ERXA 2XKJE 3EMDA 3GGOA 3HABA 4ZK6A 3BRWA 4M1EA 3IAS1 2XUGA 1WXGA 3FDFA 2OSBA 1VYVA 3TIXB 3VPSA 4IWNA 4KXVA 2PAFA 1X77A 1IN4A 4JU8A 1XTIA 4J91A 1BROA 1ZGHA 2GN0A 3ZOKA 2CVPA 4X65B 3H5TA 4YMWA 4FINA 2JA2A 2YFKA 4XTRA 1GQ2A 1IE3A 3CR3C 3OX3A 3O2QB 3WRYC 4C2BA 1DXQA 4QU9A 3T6KA 2GLXA 3PS9A 2I65A 2X6RA 3I1YA 1O95C 5G1NA 4CMIA 1GTVA 4HGYA 4P54A 4V0SA 4O0LA 3RW9A 1HQYE 1LJ8A 1SKUA 3KHUA 3M6FA 4L9RA 4NV3A 3VX4A 4UEJA 2EFDB 3V8NA 4D4KA 5HMMA 2VHXA 1GTSA 2OZVA 1OBOA 4CKWA 3ESCA 2HEGA 3KEMA 3LY9A 4OKIA 1G2QA 3GU3A 3P2JA 2NVOA 3JWPA 4Y1RA 2P62A 2F3UA 2IHNA 1X7ZB 3FCCA 4ER5A 5T7BA 1JXQA 1KYZA 5HOEA 2DR0A 3S1LA 2YV4A 5DISB 4Y6OA 4IKEA 4Z0PA 5HQJA 1XNQB 4WK4B 2LZ0A 2XXAB 1JG3A 3JRNA 3UA3A 3WGQA 4FMDF 1MMFB 1C0IA 1NKTA 1F8YA 3L43A 3MLAA 5FBKA 1CVLA 1NW7A 3WX0A 2OE2A 3LKDA 2PLNA 1WEHA 1CNFA 4HR7A 1C7JA 3A1DA 5BN5B 4YV0A 2ZG6A 5K20A 1LPSA 3AFHA 1EE2A 1F5SA 2C57A 3VRHA 4AWAA 2Y4NA 4EM6A 1WXHA 4RHYA 1R50A 4IJQA 5JFTA 4MI3A 4F12A 2FWBA 1T4BA 3QPBA 5AVQA 1LPBB 5A62A 2XI4A 4RTQA 3GUVA 2VRNA 1OJ7A 5LZ2A 1PWZA 4A2WA 4ALMA 1IQ0A 1WLSA 5D00A 2HMSA 2UKDA 4P34A 4QEZA 2FPGA 2HF8A 5BVGA 4CMAA 3RO7A 1IJEA 2PHZA 1E7QA 2FTKE 3TIGA 1WOYA 1QFXA 3MJHA 3DE3X 4XVUA 3WGYA 1TAHA 2FP4A 3PUKA 2OPHA 3F67A 2FFJA 2UZ1B 3FLBA 4JLWA 1WP9A 2H1VA 5KNDH 1BCRA 2AF3C 3HO6A 2QRPA 5EJ2A 3WMGA 3IAFA 5ALLA 1R4NB 3E53A 1GTL1 2NYRA 3OZTA 5ALTA 3O8DA 5FCDA 1ZAKA 2CMFA 5IP5A 5EIFA 3HWRA 3ISVA 6REQB 1PKXA 4P84A 5AVKA 4QXPA 1KH3A 2P90A 3VUFA 1KYYA 1H6CA 1ISFA 1LBEA 4E46A 4HZUB 3FYUC 3FHLA 4DCNA 2Y0BA 1GTMA 1Z5OA 2HO5A 3JWGA 3NT5A 4PO9A 4WZBA 5FI5A 3BIJA 1KO1A 1LW7A 2AQHA 2CJWB 3PTLA 3FI9A 4M8NE 2CBGA 4G85A 2FWIA 3T95A 3DA8A 3MINB 3QFSA 4R01A 3EXG2 4NENB 4KH0A 1QH8B 2MJLA 4YI5A 3WO1A 1MKYA 4E4RA 2VK8A 2L2QA 1UQUA 3QNMA 1V8FA 2AOUA 3NEYA 2X0FA 1GV0A 1YBHA 3DE1X 2DKFA 3DDUA 1XOIA 3H8WA 3RRZA 2V0CA 4NFSA 1ODIA 1TL7C 1D9XA 1GAQA 2WTEA 3KR1A 3IDFA 1SEPA 4D0RA 2PX2A 1QGDA 4D8UA 3GUYA 1M7GA 3F49S 2EHJA 1DQYA 4K40A 5AI8A 4TLCA 3UTDA 3WYNA 2E4WA 5AW9A 5AQ1A 3FF4A 1MX3A 3R41A 1OAAA 4K6GA 4BWGA 1MIOB 3E9RA 4O3MA 2QI9F 4QTZA 2GZHA 1QG6A 4LRUA 1FYDA 1YOVA 2HFKA 4PLCA 3DAYA 5AW6A 3EIFA 1G7CA 1ZSNA 2XNSA 5TGDA 1BRMA 2FX2A 4A0GA 3W3AA 1MB3A 4WN9A 3FAKA 1PVDA 2P2ZA 3VO2A 1Y7PA 3G8BA 1CZHA 1V1RA 5EHZA 4UHCA 5EWJB 5CDFA 3M2PA 3RUFA 3MC1A 1SXJA 1VECA 2CNWD 2H57A 2HQ1A 4NBKA 4L02A 2R7MA 4LW8A 5ALNA 3RUEA 1ZI9A 2OO7A 3N2GA 4QOEA 5EJMA 4NAVA 1NV9A 3NGXA 4IH9A 3HY3A 2KYRA 1K9VF 3LQKA 4IDAA 2O9JA 4KXQA 2GXQA 2HRZA 3DVLA 3GA5A 4WKBA 5AMXA 1Q1AA 5GMOA 5CDSA 3K35A 2G82A 1OI2A 3Q0TA 3PXGA 5A4JA 3UCEA 1TUBA 3JQ7A 3V2HA 2JLAA 4WT7A 2R1VA 3H4IA 5J2UA 1ZXXA 4BNGA 3L6DA 5LN1A 1B15A 2HT6A 3MA0A 3ZUGA 5DF1A 3RRXA 4LKRA 1SIBE 1TFUA 4YJFA 4LVNA 1E0DA 2AHOA 4AY4A 1ZWLA 3VPDA 2R00A 2BFDB 1U4NA 3A6LA 5CVVA 1NNSA 8OHMA 2MSEB 2PZKA 3Q7IA 1VC2A 1DJLA 1Y4ZA 2KMLA 4ZCSA 5E9WA 1WB9A 1HT1E 5DH9A 1BVRA 1E2UA 1LVHA 4GVXA 1V35A 4IDGA 1RRCA 3CLRD 4AICA 4JC8A 2C97A 1NBMD 2NU7A 1ZVKA 3L4SO 1WXWA 2O50A 4HDKA 4U4AA 2EZ4A 3DWFA</