2Z5VA

Solution structure of the tir domain of human myd88
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
141
structure length
141
Chain Sequence
HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myeloid differentiation primary response protein MyD88
publication title Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 2z5vA01
1O77A 3UB4A 4W8HA 3UB3A 5KU7A 3OZIA 2Y92A 4C6RA 3JRNA 4C7MA 1FYVA 1FYXA 4LZPA 5FORA 1FYWA 4C6SA 5H3CA 3H16A 4W8GA 3UB2A 2M1XA 1T3GA 4LQCA 4FZ5A 2J67A 2Z5VA 4EO7A 4DOMA 4C6TA 4LQDA 2JS7A 4OM7A 4C6TB
chains in the Genus database with same CATH superfamily
3QV2A 4V0ME 2IE0A 4OFZA 1XK7A 2SBTA 3AUJB 1UKBA 2WEKA 3EGVA 1IULA 2JLCA 1DIAA 4HRYA 4PHHA 1FXWA 3FR8A 4N3CA 2YVKA 4BVLA 1ZU5A 2XMCA 1KOFA 1SKAA 3A2NA 3PEVA 4KQ2A 5DN6D 1VMEA 1O94C 2OB1A 3OEED 2XBLA 3DG9A 3ELBA 3KAQA 4U39A 3K09C 1U3WA 2ERYA 2RDMA 1QH8A 2IPNA 4MYUA 3SXUA 3T4PA 4UPDA 2WYUA 2I5PO 3EPLA 4BFZA 5AVWA 2Q5LA 3DR3A 3HWX1 3CRQA 2VP0A 4TSRA 3ASZA 2WZDA 2BGUA 4NECA 5KX5A 2R68A 5IBPA 5AVZA 3OLQA 4AIRA 1DV2A 1C0PA 4BQSA 3DF9A 2QTRA 1TQ8A 1UXIA 2HSGA 3N05A 1XF9A 2H65A 2YR0A 5AVUA 2OECA 4NP6A 2TS1A 4LF8B 5GGXA 4DSAA 2YYZA 2YBEA 2QZ9A 5AKGA 1XD2A 5HCIA 1LH0A 2Z8YM 1E8MA 4HOYA 4PG4A 1EFLA 4A8JA 1ZS9A 4WFQA 4WI1A 4CODB 3UHFA 3AVTA 1PR3A 1N2CB 5C31A 1CUVA 2BKXA 3M6MD 4QBTA 4AKTA 2XCTB 2LIPA 1EKXA 4HGQA 1BMTA 4MV0A 1ISMA 3DLHA 2WJIA 3EXFA 4TUYF 3EGOA 4NOKA 3ZYZA 4X45A 5CFNA 3U39A 1TCAA 4D44A 4PSCA 3VR2A 1QANA 3FTEA 2Q6OA 2WU1A 3HDQA 5LXTA 5EMHA 3SZ3A 1WVIA 4L9SA 4ASUA 1KNQA 5SYAA 1K97A 3AUKA 4LFBB 4V3BA 5FKJA 2J7PD 4RXTA 3LL4A 1ZCAA 2GPAA 2PG3A 1X7WA 2W0SA 1OFTA 5KS2A 5DCYA 1AK1A 2DULA 3ESAA 1M33A 3H6KA 4HQ6A 1U8TA 3B3FA 3G79A 3L4KA 1NVVR 4WZBE 1SXQA 3VR4A 4TMVA 3UHPA 4AW9A 4TSKA 1LTKA 4MWGA 4DXAA 3E27A 1ZP6A 2DY0A 1LDBA 4LRXA 4CBVA 4MRMB 5LQSA 5K3OA 3MB5A 3M1LA 5ALQA 2CL6X 5COAA 1JV2B 2Y0BA 2ZBQA 2D3TA 1CVIA 4J07A 5IH3A 1I7PA 1NY5A 3P4YA 5EJFA 1G21E 5CX1B 3T99A 2P2SA 1HQYE 1UZNA 3INTA 4GXQA 3W8FA 5I8WA 3CB2A 3UB4A 3IDAA 3IURA 1PBNA 3WGYA 1PVOA 1M10A 1DUVG 5LZ8A 4DDWA 1GEEA 1H69A 2YCLA 1Y34E 4H7EA 6LDHA 1YRAA 1W59A 4S2UA 3L8FA 1LWOA 3JR7A 4TMZA 4CKXA 2EZUA 4GI5A 3ZUPA 5C1PA 3FTFA 1JKJA 5KWVA 2B61A 4JI0B 3MCZA 1QDUA 4WOPA 2IYXA 3LSTA 1PQWA 1QRRA 2Q7XA 3DE2X 4CM6A 1P45A 5K6RA 4EF4A 4KMRA 5HILA 1UJ4A 3IUBA 1D2MA 3DEAA 3L7IA 4KZPA 4Y6PA 4XJXA 2ZRAA 1JKMA 3PFWO 1EB8A 5LZ2A 3B2EA 2QN7A 1F3OA 2DLNA 3U16A 4COOA 4CPDA 2B25A 3PENA 3ICOA 2R65A 5T7BA 1XRSB 2ZGVA 2GJ4A 3IOMA 3T94A 4CKCB 1E0KA 2D5IA 4ALLA 3AVYA 4RHEA 4OXNA 2NO6A 1E0DA 4MVJP 1ZJ6A 3VR3D 5ES4B 1ZHOA 1W87A 2R4TA 3R1IA 1PNRA 1E2NA 4XI9A 3IJRA 3LP8A 1Q0LA 2IS6A 4LBVA 2QG6A 1J90A 1Z4NA 3S2YA 3RSSA 1KYZA 4LYJA 4JJ8A 2AZMA 1WY7A 1X7XA 3TQFA 3EB9A 2HMVA 4EJMA 1XTZA 1UPUA 4MROA 1FRZA 1ZFNA 1OWMA 4Q1DA 1ADYA 3VNBA 3OZGA 2JW5A 3MWGA 2D5AA 1WMEA 2XUZA 3OE7A 1MG0A 4CF6A 3BWVA 4NNOA 1STOA 1K0FA 4NAHA 1V0JA 2H5IA 2Z2XA 4HNUA 1KO5A 1UEJA 1XYGA 3LC2O 5EZSA 3ZD8A 1FFBA 1EI9A 2A2ZA 3WK4A 1TKAA 3LLCA 4JI7B 1Z2NX 1R3DA 1F5SA 2HC9A 2F4NA 3Q3IA 3UENA 2XZOA 3D6AA 4C7MA 1RXUA 1QQBA 3GRVA 4G23A 2QX8A 2HF8A 3IHTA 4D8VA 2ZTSA 4UNRA 1D8TA 4D9IA 3G9XA 2QMQA 3AJDA 1DXYA 3PIIA 1QIIA 2C9OA 5AOAA 4G5XA 1NFQA 4YX9A 2Z83A 1EUDB 4RY8A 4CTMA 1F6BA 3J81A 1RC1A 2JAQA 2XTAA 3G2IA 2IYNA 1YRHA 4YO8A 10MHA 1S1CA 3OOYA 5DNVA 4W6ZA 4LBWA 1FFCA 5K8VA 2CW5A 1HTTA 1DJLA 5EMKA 2XUQA 2Z98A 1F6WA 1XRQA 4INAA 1T9DA 1T91A 1QHHA 2G82A 4I55F 4DY4A 1A72A 4X44A 3R5HA 1AMOA 2FSUA 1AHNA 4JP5A 1NI4B 1FJHA 1TJNA 3ABSB 4CV3A 2C82A 1CZLA 3BCRA 3STHA 1SCNE 4RPLA 3TNJA 5EEGA 2WJAA 3CKMA 5CM9C 3LCUA 1VFPA 4PLPA 3K6JA 5C7IO 4JU9A 1RKUA 1XP5A 1N7JA 1C3OA 2CBXA 1NV9A 1W5FA 2P1ZA 3DAGA 3FFBA 1L4BA 3FAZA 2FLVA 2YY7A 3GVIA 5ICFA 4DC9A 2PPLA 1POWA 1WD7A 4FDTA 1Z62A 4UUMA 4NICA 4M1TA 3U13A 3EK2A 3ZBUA 5K0ZA 1DEXA 2IY9A 2OV3A 4C7VA 4XR9A 5ECDA 3OH8A 4WBXC 3HN2A 4TRMA 3PRYA 2P4HX 1CZUA 3DL0A 1C4WA 1F2VA 2OORA 3NS7A 4XCQA 5BQ3A 5FX2A 1RPJA 2HO4A 2JRCA 4JKYA 1E1NA 4JLJA 4KDEA 4B79A 3O21A 3N70A 4J0DA 4PC1A 2C2WA 1WQ4A 2E5FA 5SYMA 2IY7A 1U1CA 4YMHA 1G60A 2EV9A 2PL3A 2PZAA 3GZTB 2WIGA 3BD8A 3KNZA 4DJ5X 1CJSA 2Z56A 4U0KA 5AKYA 4WH0A 3FB4A 3W2GA 2P79A 5DBGA 2VPYA 1R0SA 1T6YA 3NAGA 2OHHA 1ZW6A 1AGPA 3ADOA 1D2EA 3DM9B 2JJ2D 3EODA 4MTCA 3KYJB 4Q82A 2I4TA 4CRWB 5MN4A 4IX1A 3CNOA 2W2PA 3AX6A 1IWBB 4PTYA 5LQRA 4HB2A 3BILA 3O94A 4ESHA 3EAGA 2ZE5A 1LI5A 1AQIA 2FEOA 2YZNA 2I7DA 4KQJA 3K6SB 3E8SA 4ESOA 3H05A 2ESRA 3JASB 4Y2XA 1BX1A 2BD0A 1C1XA 2ECQA 4YLEA 4CLEA 1X3SA 3TD9A 5EZYA 5KPDA 1LLFA 1UJMA 1ZD3A 3TLAA 4OQFA 1PZEA 3B6ZA 4HFJA 2XLBA 1AV6A 1W88A 3G2JA 4NK5A 2FKAA 1VXOA 2IXEA 1DZ3A 2ZJ2A 3NUZA 4EG6A 1ECPA 1HE2A 4OL0A 4F2PA 4ZP1A 1GSHA 4PHFA 4WKCA 5DMHA 5BN1A 2ACWA 1SXJE 3MM4A 3JQ6A 1T6NA 5CVJA 5KNBH 1M2VB 3TW8B 2G25A 2JAUA 2VPIA 3M9LA 3IBYA 5EOVA 3HXTA 2JZCA 1UPXA 1WUKS 4ZCPA 5HF5A 4FYHA 4YCNA 4EI9A 5T57A 3HBLA 3S2EA 1P9OA 1Z88A 1UBTS 1PFKA 2R00A 4C04A 5GZ6A 3PR2B 4AO6A 5AKJA 5ENZA 5J9FA 3K1AB 5JYDA 2G1JA 2C2ZA 4IFTA 3E53A 3TNLA 1EIZA 4GOKA 2LE0A 3UMBA 2XB4A 5AH0A 5EQDA 4NU6A 2YHUA 1ORWA 4U0JA 2FV8A 3OZVA 3USCS 3PXBA 3DEFA 5DT2A 3WLJA 2CDBA 3K0CC 2OBMA 1V48A 2V4MA 4BQOA 3SS8A 1M67A 3KKQA 3HN7A 1E99A 1LVUA 1R74A 2FSPA 4INOA 4MKIA 2IEAA 4GLLA 1G5FA 4QSHA 5FL7D 4AVYA 5K6AA 1SA0B 3ERCA 4X66B 1RM0A 3IJPA 4HNAB 5D5HA 3U4IA 3DE4X 3CNEA 1WM1A 1EGQA 2XOKD 3O8QB 1ISPA 4MP6A 5TGDA 1G64A 1JJIA 1LK0A 3I6IA 4AM8A 1KSGA 4XZ3A 4CXMA 4YY3B 3HA3A 1MW9X 1CQJB 3AETA 1OGIA 4K9RA 4JK3A 5THKA 2B2CA 3A9CA 2P3OA 1EUDA 3SQDA 1CHNA 1V9CA 2PXCA 4N82A 1O8CA 4S1OA 1RXVA 3AEQB 1NPTO 2HEIA 1S8NA 3N74A 4CGYA 5T8KA 1LPNA 5HBRA 2XNSA 1H5NA 5FO1A 2G3YA 3EXHB 2VT3A 2EZTA 5D86A 4ZVOA 1LC0A 1MXHA 5H68A 2WA1A 3C1AA 5IAEA 1E5LA 1I5OA 4M54A 2XE7A 4N8SA 3DCYA 2F3TA 3EY4A 2HIGA 1WXEA 4B7CA 1ATIA 4X1YA 2OHFA 1J99A 1RP1A 2ZE8A 4Z8XA 5IN5A 4R2KA 1UZAA 3N7AA 3NU1A 3DXXA 1GPAA 3LKVA 4FFBB 4P7BA 4Q93A 3JVVA 2FR8C 2PUVA 4F86A 3OIFA 4TXNA 4H60A 3G1TA 4JA0A 3FHCB 4GZMA 4EB0A 1NOIA 3PTZA 3X1JA 1AQYA 5AM2A 1PT6A 4GRIA 3GL9A 1R1DA 2PO5A 5L51A 1TA4A 5BQOA 4QYXA 4DT1A 2GF2A 3U1TA 2JFPA 3IIMA 1IWOA 4KH0A 5J2UB 3WJ7A 3V33A 3AXTA 1U2PA 1TRKA 4OSOA 1P7YA 3CF6R 4DCVA 4B73A 2QL7A 2F7SA 4OHMA 4ENTA 4UVIA 2UUPA 1FNNA 3A9VA 3KS9A 3HR8A 3R3HA 1G6HA 5MHTA 3NETA 3GJ6A 3H11B 4AKGA 2YIDA 2JBHA 1NU8A 4ZXFA 5L6LB 3VNUA 4FONA 3MUNA 2EBHX 3WB0A 1AF7A 1SK8A 1P75A 2J5RA 1R2QA 4GVLA 4AWBA 5KJCA 4KH1A 1M6NA 1PJQA 1TLTA 4BBAA 3AONB 3D3QA 2IGTA 4JT9A 5BWNA 1Z0JA 4Y2QA 2JARA 2V74B 6Q21A 2H4HA 5AJZA 5EXDA 3WLHA 1ISGA 3V8BA 3CVUA 1Z5WA 2WG2A 3HDTA 3EAFA 1EVQA 2WJWA 3HK2A 1CQWA 2A5DA 3MJCA 2W6OA 1ZEMA 3QFFA 3QPVA 5CDUA 2QJRA 5BW8A 2WWRA 1YR8A 1EG7A 1QHFA 4OQPA 4B34A 4HJXA 4QVKA 2B3TA 2BBTA 2C03A 3F3MA 4I4TA 5FOTA 1ZR4A 1OLUB 1BWQA 1C7QA 1SKQA 4HX5A 4EJFA 5EJ9A 1FBTA 5E1DA 5CK4A 4GU5A 1SVOA 1RLIA 4PWYA 4RTRA 4PC6A 2PFKA 3PUIA 3GG9A 4UULA 5DIFA 3SLGA 2CUZA 2FWRA 2WUVA 2ZBRA 1FUYB 3ZD7A 4FXPA 2Y99A 4GWKA 4ZRNA 4MARA 2LIVA 3EY9A 5T41A 3ZTWA 4EFLA 5BY2A 2RK4A 1WCWA 2ZJ4A 3O8OA 3H2SA 4MP3A 4O8ZA 4BNDB 2I9KA 4KPUA 5FEUA 1M3SA 2W4QA 4GPD1 2GZ1A 3O83A 2CV2A 1V4NA 2MHCA 2ZVPX 2D8MA 5J5VA 3DZJA 2M6KA 3REQA 3NM4A 5CJPA 5JAZA 3LUHA 4MPTA 3N0WA 4XVQA 3PDJA 4CMKA 5HCNA 1BOFA 3K1AA 3L1VA 4FD2A 4BX2A 3KYDA 2F8SA 3P0IA 1PYOA 1KDYA 3B1XA 5JAIA 1E94E 2E5LB 2X5NA 1LLUA 1W1IA 3IA2A 1O08A 5HKAA 5CG2A 4LXUA 4LNUB 2BMAA 2WTXA 3GVXA 5IFLA 1BE1A 5GPBA 1OC2A 1FTNA 1O54A 3MMZA 2ZXUA 1YCDA 1P0CA 1UJBA 4OHKA 3WY9A 1WNTA 1SUWA 4IDBA 2PMKA 4MUJA 3T3MB 5JY6A 2O20A 3AIKA 1RDFA 4W9NC 1X1AA 2DLCX 2PLRA 4ZYUA 1SOAA 4TZTA 1T35A 3OY2A 1SC3A 4KQ6A 5GWXA 1TUEA 4D74A 4EZIA 1ZGZA 3C24A 3TKAA 3RVBA 5AUOB 3T8YA 1MT3A 4ZCTA 1VB5A 1QX3A 5KMGB 3I6MA 5FNZA 2Q4TA 1WUYA 3MT7A 1F14A 1BRTA 3COWA 3O91A 1XI2A 4RD3A 4EJ6A 4N48A 1KFKB 5BMOA 5KREA 4NJOA 2AS0A 4R69A 4RE5A 4HDNA 1RXWA 4HDKA 4HBZA 1VZ2A 4GQBA 4YXWA 3RYCA 4NHEA 1PZHA 4N5LA 1PNVA 3EMDA 3O3OB 3WNCA 4AS1A 3D0RA 4L85A 4O4IF 1JLRA 1JR3A 3B1YA 4LZJA 1WQ3A 3P32A 1ENYA 5CJJA 1WMDA 2UUBB 1O1YA 2Q8PA 3WP1B 2DUJA 2IUYA 4ICIA 3W3ZB 4X0EA 5AMXA 4JHLA 4R81A 4QPNA 1P2VA 2HU7A 3PGMA 5B3KA 3I2JA 3DBHA 2C5GA 1P6UA 2I4NA 2OV2A 3O03A 1H0KA 4L3VA 2YJZA 1PSWA 1ZH6A 4ZTBA 2B1GA 2JIBA 2ZRNA 2PUJA 2B5OA 4R3WA 4KX5A 3TQCA 2QS9A 3U4HA 4B48A 5IU6A 2JFVA 2RMKA 4C88A 4F2WA 2AI1A 3O92A 3A9RA 2C8VA 3B89A 1E9AA 5E0OA 2JGKA 2VDWA 2ZAMA 1CT9A 4RNCA 5DWVA 4OQXA 4EECA 1E4OA 1QNLA 4AKHA 2H5LA 2H51A 4KLZA 4L4UA 1OBOA 1C9EA 4KI7A 2C2OA 4UM7A 3TLGB 4D8WA 1H6BA 3JQFA 1OOEA 3C0KA 3E22A 4RIIA 4CVNA 4CKWA 3H11A 4E5NA 5TT0A 2JAWA 2H08A 5A0VA 2CD7A 4GX1A 2BEWB 5IF3A 4J9UE 4W63A 2NACA 4G5YA 4UQOA 4AJ9A 5C52B 3EC1A 3MUOA 5BW4A 4ZA2A 4WXMA 4PHGA 2QN1A 1ZAYA 2IY8A 1KYIA 1NP7A 4FWBA 4GX2A 4W9RA 2WD7A 1F0PA 1EP9A 4A6DA 3AF5A 3JQBA 2WHPB 4BKQA 1HLFA 4EHKA 5KQRA 4KXQA 4QJ4A 1Z39A 1GVHA 4L9WA 4TUYB 5BSVA 4LF4B 4NYIQ 1BCRA 2MDTA 2E4AA 1E3EA 1E9DA 2VHVA 1KH2A 2YVLA 2ZIXB 1RFLA 3OEYA 3ETDA 1N9GA 4D9MA 5AUNB 2AZXA 4KW7A 4A27A 1K0UA 2C97A 2C2HA 5FBHA 3GFRA 3EGDB 4LKOA 3QPDA 4YRTA 4NKRA 2W9XA 5JUWA 2G4LA 4JENA 3SZRA 5BWBA 4ZOQI 4JVNA 1ZK1A 2OG2A 3GNSA 2MYTA 1UK7A 3VR1A 1GITA 4LCBA 4Q4JA 1E2HA 5AR1A 3S2ZA 3VO8A 3OX3A 5TF4A 2KYRA 2YKGA 4MX8A 1A5AB 1CE8B 1VHTA 2C7VA 2GWHA 1AUQA 2J3QA 2VJYA 3QUQA 4L8YA 3ACDA 4IIUA 4LF5B 3UG7A 4F71A 5IT9A 3AT1A 4EJ2A 1I2MA 2OHVA 4D4KA 3C1OA 4EGJA 2BM0A 2KBFA 3R76A 1QZ3A 3TAHA 1TO2E 3GFSA 3PXEA 2EX4A 3IVRA 5DHSA 3ZJTA 2WWVD 4IO0A 4OJYA 4K86A 5GZ3A 3K8YA 1DZIA 1RYMA 2VDRB 3MTEA 3FROA 1EQAA 4AX4A 2Z2YA 3DTVA 3GN2A 2Q3EA 1Y7HA 2GFHA 1Y8ZA 4PPNA 2VAMA 1DX6A 1JR6A 4EG4A 1J0XO 4KPYA 2VK8A 4L7QA 5JWRA 4A2QA 2AE1A 3K3PA 4JODA 1HE8B 5CU7A 4NFHA 2J9ZB 4YT8A 2BH9A 2FAXA 1PTKA 2J3IA 3KUXA 3LQQA 3Q7PA 4RV9A 4DUYB 1IBRA 3K6KA 5KKAA 3VGJA 5EGSA 3ZQ6A 1X0VA 3PPYA 3FFXA 4FM9A 3X2EA 1YQUA 5FADA 1R6VA 5LSAA 2GA9A 4DV2B 5A2GA 1E6MA 2XUPA 1XAHA 2BE7A 3G0OA 5KMGA 4UCXA 4GECA 3G7UA 4UHDA 3OZAA 3AKZA 4JEUA 1ELOA 1NVAA 2OEPA 3BQMB 5LJIA 3F3SA 1NLUA 3O9ZA 3TD2A 1DWPA 2FQ1A 4I6EA 3SS7X 4HYTA 1ODFA 4MWCA 1UEIA 4UVHA 5D51S 1NBME 4EUKA 4YBZA 2I8CA 3OE1A 3VISA 3HFRA 2OCYC 3VU8A 4CMIB 5DX0A 3QH4A 3OQMA 4YJFB 2C42A 3NEJA 4TMYA 4F6RB 5DCWA 5A04A 3DWIA 3IVMA 2IEDA 3N0VA 2EJWA 1FFXA 2XEDA 5BYAA 2IXFA 3KJFA 4HDMB 4Q7KA 1CG6A 1UCFA 1T9KA 1C29B 3VYWA 1RKBA 2RHWA 1REQA 5JD6A 4NWIA 5F12A 1X8LA 5C4MA 1MRSA 3A6PC 3CCCA 1FBNA 4FN5A 4C4XA 2I8AA 2JK1A 3ELUA 4G0PA 1SRQA 3ZHXA 1R8XA 4O6VA 3LKDA 3B7WA 4TLEA 3LFUA 4BZXA 1CLEA 4WY5A 5A3VA 4DJFC 2G8NA 1DARA 1K7YA 3LLUA 1Z4KA 2YUIA 1Z7WA 1KK3A 2N46A 3TRDA 2B2XA 4FYVA 4N01A 2WVAA 1R15A 5FWYA 3C3YA 1KMCA 1VL0A 1OFGA 3I0ZA 4QGHA 5I8ZA 4Z4HA 1UKAA 2B8WA 3IBFA 4HDRA 4JOCA 4RVOA 2RH4A 1U7WA 1C5KA 2HA6A 4C0AC 4Z4GA 4BAGA 1Z8NA 5KSZA 4P4SA 2ETXA 2AOXA 2EZ8A 3RCBA 3SFTA 3O0DA 3HL4A 1YQTA 1V1JA 3MBOA 3QIVA 1SBQA 1WEHA 3K7EA 1F0KA 1YS9A 4QOGA 5KYWA 3QZUA 4D4GA 2JI4A 4LJ8A 5E6SB 1JLHA 4I55B 2CXTA 1A50B 4FDVA 1RZRD 1J5EB 2GETA 3PWTA 1DJNA 1YJ5A 3DZKA 2QX6A 4BGVA 4KIJA 2NZ8A 5FFMA 1JLKA 3Q3GE 1IJFA 1GPWB 2O7SA 3QU5A 3KJXA 1K6IA 5FLXA 3K35A 2DJ5A 4TUYA 4YRMA 4XIJA 2R7LA 4MP8A 4R7ZA 3R40A 4QICA 2QPTA 5AICA 2PSDA 1A1SA 3BKWA 1MO3A 4RX1A 4B40A 2VA8A 3ADPA 5KOJA 2O8BB 4IFBA 1ML3A 3BIJA 3VDMA 4LRUA 3FGPA 4Y2TA 3I05A 1IIBA 1DXHA 2C96A 3DDUA 5EPUA 1LK7A 3UNXA 4ER3A 3FDIA 5HIKA 1H2RS 1YE3A 2VZ8A 4FHZA 5H3LA 1KE1A 1X7YB 2IYRA 3H2KA 1U1FA 2GZSA 5BVHA 1UMCA 3ZWMA 2CNBA 4G41A 5HJEA 5FR2A 1HE1C 2J48A 4D02A 5ITSA 4C7JA 3V1NA 2QZ4A 3L04A 3F7TA 1Z5UA 2RJOA 3CUVA 1OFHA 1QB8A 2R25B 2ZJFA 1MEJA 3HVIA 1W36C 1MDFA 1OFUX 2CMGA 2YZKA 1FF9A 3DE0X 3LD9A 4PY2A 2W11A 5IT0A 5AJHA 4YAFA 3A6DA 1KQFA 4CV2A 4HEHA 3UM9A 1HDRA 3ZWNA 3DVLA 1EUYA 1L8XA 3WDKA 4KC0A 2IPLA 4U2EA 1QONA 2FVXA 2GUGA 3I2FA 1YI8A 2JFOA 2I87A 4J1SA 4TV9F 1IN5A 4NE9A 3DO8A 3FZQA 4KX3A 3KBOA 2VVTA 4Q9HA 4EO9A 2BFAA 3CNQS 1P4JA 2YJ6A 1BFDA 4NNJA 5IHPA 4XWWA 1Q57A 2ZOSA 1NJ6A 1LB1B 2C5BA 2GFQA 2JGAA 2WKRA 1QFSA 3BWMA 3M83A 1A2OA 2H0RA 1PS9A 3GARA 3CVVA 2Y1WA 2VG8A 3CIOA 2W7TA 2IZZA 1IY9A 3NYIA 3R4VA 3HVRA 2JD0A 2PQ6A 2QD2A 4J4BA 3KHKA 1XG5A 2UVDA 3C14C 1YVDA 3RTDA 3VTZA 2JFHA 1BS2A 4X97A 2VHZA 1ABEA 1YMQA 1X0XA 3V8RA 1D2AA 1Z5NA 4N6GA 2E18A 4NV0A 2HHCA 2A9JA 3KAKA 2Z1DA 3T38A 4R01A 4TLMB 2JAXA 2R9VA 4NY1A 4BO1A 4F5EA 4XJVA 1E9FA 1MABB 1Y6ZA 4URZR 3NNNA 1ZN7A 3BMCB 4L57A 3JV7A 3LCCA 1UDBA 5IJ9A 2Q8NA 1KDPA 4WCVA 4K7JA 3ESYA 1U28A 1U7UA 2XVZA 1UIRA 4JN6B 3PTAA 3C4JA 1D7AA 4D0GA 1DSSG 1JMYA 4UAJA 3I92A 4PN7A 1FZTA 4CTNA 3NJ4A 4O4HA 3FR7A 1IZ9A 5CH3A 1FQOA 2XEXA 4OGKA 2ZQ5A 5KPJA 4DWVA 4YV1A 1ABBA 1FFAA 2AMVA 3GW8A 1EBBA 5CLHA 1NF2A 1EZZA 4N1AA 3PF9A 3E2MA 2MSEB 4DGQA 4KZKA 4FEAA 2QW1A 3K0BA 5JTTA 3PQDA 1B2RA 1VLLA 3H19A 4IIVA 2ZBEA 1V11A 4CKEA 4KQWA 2X6TA 4V38A 3QOWA 4WOJA 1LY1A 2V58A 4FLMA 4CI9A 1T5OA 1D03A 2WWHA 5AQ1A 1X1TA 4GVPA 5JEDA 1YRWA 4OXYA 3U3MA 4J3JA 2PZ8A 1OGJA 4BVKA 4RV5A 1UXHA 3M34A 4TVOA 1SG9A 2ZW9A 2WIBA 3Q12A 4NCKA 4L78A 3RC9A 1M75A 1N6IA 1UBLS 3PL5A 1KEVA 4AG6A 2WY2D 1PEDA 1QR6A 1UM9A 2HRZA 1OX4B 1S7CA 1XTRA 1XAIA 1GZ6A 1JR3E 2DT5A 2IPOA 1S2IA 2ZYGA 4I5DA 5DV9A 1KMHA 2MU1A 4UHFA 3FSGD 4GKBA 2HQSA 1GQOA 4MQLA 3FDZB 2D00A 4F4JA 1TK3A 1ZO8A 3C97A 4FFMA 3WGHA 1EXWA 1EAYA 2ZYUX 4XTCS 5AIAA 1EWRA 4AMUA 1T9ZA 1IL0A 5U9CA 2DU8A 1BE6A 1PUIA 1PFUA 2G4VA 2SHKA 4ILKA 4S1WA 5TQ0B 2CLSA 4R3UC 3W6NA 4YMUA 2WFLA 2I6FA 3X1XA 4P7FA 5AW0A 2NQ8A 5IUJC 4U2DA 3T0GA 2FUKA 4DEXA 1OSNA 4KEAA 2PU7A 3THOA 3FOFC 1UZUA 5EJMA 1VSTA 4IOKA 1DPFA 4YGXB 4JI2B 1O9HA 2C94A 1A5TA 3PP8A 2NU8B 2JC3A 3UA4A 3NTOA 3RRBA 3B1JA 1N6NA 4LFAB 2BGGA 2H07A 4OHPA 1D4AA 4JMLA 5BYJA 2XWQA 2WF9A 1FY2A 4X1IA 5HJ2A 4ZI5A 1XU4A 3UA3A 1JEYB 2H18A 3ZPXA 1PR9A 1UAGA 2CHUA 2GBLA 4GICA 4HFMA 3A1NA 3UMYA 1JS1X 4QREA 1ZN2A 1NNEA 1ACMA 4ISBA 2CLFB 5HSGA 5TEVA 3FPEA 3WLAA 3WOVA 5CDHA 1XXLA 4YV0A 1UFKA 3QUBA 3PCTA 4QOSA 3BFPA 1NWHA 3U3XA 1E3JA 1PDVA 5HQJA 1GUBA 1ZIPA 1H1DA 1QX4A 3G17A 4FZJA 4IIHA 4ZALA 2CL0X 1N0UA 4BBZA 1ZINA 4YCCA 2X76A 5JPDA 5DF1A 3K15A 4YQZA 3WK6A 1GNTA 4MB6A 2ODAA 1U8YA 4X94A 3S68A 4EM6A 5F5LA 2YW2A 1NR7A 4DLUA 3VHXB 4FQ5A 5DSXA 2AJDA 2V55B 3A3KA 1K08A 3IVGA 4B6OA 1ECLA 3HYSA 3QFTA 2AD5A 3QGMA 2QN8A 4QUGA 3TINA 4C0HA 1H0SA 4HPJB 2C54A 2G80A 3OEWA 5HRUA 3OZTA 1ZCFA 3CWCA 3LT4A 5JD3A 3SLRA 4B9EA 3W5IA 1C9MA 1O96B 1CJKC 5F77A 1GNQA 2OBNA 1JG3A 2GKGA 5REQA 1OFUA 3B9RA 5JT1A 4YONB 5TGZA 2FEAA 1N2EA 4C0WA 1JHXA 3IP3A 1BKSB 3UB2A 3V32A 1I10A 3KJIA 3AYXB 2TSYB 2GZHA 2IYPA 2OV4A 1KVSA 3P9QA 4CG1A 3CUTA 2CVFA 5EMNA 4ZI2A 1LEHA 3KQNA 3RS4A 4XOUA 3K70C 3S5UA 1Q5PA 3AW8A 4TKZA 3WWPA 1G4HA 4DY6A 3D2CA 5BSRA 1QH1B 2V6BA 5D3KA 5FA5A 4NE7A 3MINA 2NPOA 2GWRA 1QG2A 2GDJA 5JSFA 1Q7CA 5EJGA 1NRXA 5D85A 4MA5A 2GZDA 2F43A 4Q16A 1KK2A 2BDTA 4LGMA 5FJIA 2EGHA 4CHGA 1LK5A 5JS6A 5LD2B 1NUAA 2PUDA 4O2BA 4TZ0A 1EJ0A 4XLZA 4O1HA 3RS2A 2H4ZA 1U5AA 3KJEA 3T1HB 1XALA 2FOLA 3HDGA 2YZ7A 2XRMA 2VDKB 2UAGA 3QG1A 3KKPA 4ROSA 2P9FA 2FG5A 1BWPA 3KLBA 2ZJYA 4GP7A 1WLSA 1SUBA 1YZLA 2RHMA 3LCMA 2FN7A 3TPFA 3NV9A 3UWOA 4HQOA 3LI2A 3OF3A 1NMEA 1K89A 3L7OA 4B1FA 1RM3A 3EZYA 2DT8A 4ZXPA 3GEBA 1MX3A 1YHYA 3QEMB 2HKIA 4E22A 2IHUA 4NAVA 4ND6A 4RLFA 1YIDA 4E33A 4C29A 1AQUA 3DHEA 2VS1A 3ZWOA 1NWCA 1R0KA 1QPZA 1MEEA 3G0DA 1LFDB 2FX3A 4G65A 2GI4A 3FMVA 3LLSA 5JNLA 5KYGA 1G16A 1JYSA 3SHWA 4FB5A 1LJ8A 3OLZA 1P39A 2IU4A 3BXOA 3DH0A 2DH5A 2AWNA 1AU9A 2QUIA 2R5WA 3II6X 1H2FA 3LA8A 2FE4A 4HUJA 4EVSA 4W5RA 4BJHB 4PGFA 1ODTC 2D0PB 4XSGA 2JS7A 4E08A 1LA2A 4PPFA 2GEBA 3EZXA 5TQ2A 1DQRA 2D13A 1PT7A 2Z1NA 3DL4A 4HP8A 2ANBA 4G4GA 1M2KA 3OCUA 1E2GA 1JYFA 1RAIA 4BNFA 4O4IB 2EKBA 3F5DA 4S0ZA 1PR2A 4BCCA 2FFJA 3HUEA 2AK3A 3M6IA 4WSOA 3F6BX 3RWBA 1SJ9A 4YJGB 2GVZC 4NDNE 4W5WA 5E3HA 1AQJA 5DGIA 3IDFA 3LVBA 3ADBA 5ADHA 2WLSA 2JCGA 3IE1A 3I8OA 5CDGA 3WLKX 1V1MB 2IEZA 3BEDA 1NW6A 3EFOA 1K68A 4NPHA 1PWYE 1XLUA 2QQEA 5KYXB 4W5TA 2VZEA 2XJ4A 2IHVA 4IIDA 5CLLA 3ZCPA 1TJPB 1Y9JA 2DUNA 2Q0QA 2NVUB 3IKTA 3W1VA 2CVHA 1VLVA 1OBFO 2ISSD 4TKUA 4U2CA 2WUGA 4YJ3A 3U37A 3CFYA 5G53C 2O2XA 4W5NA 4BKUA 1DEKA 1ADJA 3FMPB 2WBLC 3LPNA 5HKKD 2J6CA 2PH5A 2JLWA 2F9LA 3C3KA 5AK4A 3JAMA 3O4VA 2GPJA 2PAAA 1M1ZA 3B6KA 3EEBA 3FKSA 1R6TA 1WMSA 3VH2A 3GZNA 1J1UA 2ZPUA 3S99A 1WMBA 3P45A 4HFRA 4U8HA 5C7OO 4EYEA 2ZI7A 3GIDA 4TV8F 1W7AA 1GTSA 4RIHA 2FK7A 2HK9A 3I52A 1GGMA 1N1EA 3AHDA 3E3LA 3LTNC 3DXYA 4NZ9A 4DJDC 3Q8KA 1SUEA 3RFFA 4NBWA 1KQPA 4OFWA 4YAGA 1PFYA 1NUHA 2PZKA 4IJMA 5JW6A 1BX3A 2P2ZA 4M2LA 4K03A 4IRMA 1Y37A 3QBDA 4OG2A 5KYUB 3IR7A 1DRKA 4BO8A 4TS1A 2CJXA 4C21A 1C3LA 4JDUA 3ZX4A 2ZRJA 4MEJA 4Y0VA 3N2NA 2GYYA 3AUUA 4EB6B 2C2YA 4O1IA 3F73A 3F1LA 4PF1A 4UD2A 1H94A 4TTPA 5AJVB 3LFTA 2SKEA 2NO0A 4AJPA 4CUZA 4P80A 4AMZA 3B38A 5KTTA 1VCOA 3PLNA 1NVWQ 2GSDA 2VL7A 1Y5MA 2KS6A 3AM4A 5CEJA 4RTKA 1JIQA 4F3TA 4EY3A 4D25A 1AN9A 2HJGA 1M8FA 1FL9A 3QF4A 4QXAA 4W1PA 4YI5A 1TT5A 5ALOA 4EWLA 5ICSA 1V35A 3D6TB 1TD9A 5TPZD 3FOBA 5CVDA 2FZEA 4HPWA 1EHIA 4UFOA 3UB3A 1WSBA 3MJVA 4LE1A 4DSNA 4AY4A 3FFWA 4QA9A 2BP7A 3A9UA 5AI6A 4H9GA 5DWDA 4E4TA 4D45A 3A4MA 3IT0A 1PEAA 1BG6A 1ISFA 3GT3A 3KM0A 3PWKA 5KSWB 4JR0A 3LQ4A 1WWKA 2Y1OA 4MIKA 5KJ6A 3D6NB 1IM8A 2MR6A 3HYLA 1GUAA 2PMDA 1G8SA 1HNZB 5ICEA 1Y3DE 1XMIA 3C48A 1USGA 1SPBS 5JYCA 3TSZA 1QUFA 4E13A 2O23A 4RPKA 1Y98A 3ZGVA 4RD6A 3V8QA 4KAXA 3SC3A 4N8DA 1KDOA 2Z6VA 3RJMA 1E1CB 2BR3A 1ESNA 3IQEA 1KDZA 3SYLA 4CIAA 2AQIA 2JGIA 1E64A 2OCGA 1E2DA 1CXZA 3NP7A 5I7FA 5BN3B 2HA7A 1OD6A 3GUVA 1C1HA 1KSFX 2IYSA 3ELDA 4J7XA 3BHMA 4CI0B 1ODKA 4E5DA 2E87A 1PJTA 1VGVA 2Z6QA 1JVNA 1CC1S 1R0ZA 4B0OA 3HB5X 1GQSA 1VJ1A 4IDNA 3CJRA 1RC8A 3KUKA 1CEEA 1H6DA 3PEEA 1JTEA 2FG6C 1B26A 4X7BA 1DL5A 3WLRA 4J4HA 2WZCA 1WULS 2EJTA 5E0KB 5I9NA 1RP7A 1JWAB 5NULA 3ZDYB 1TI7A 2NV2B 1CNFA 3P1JA 3F7OA 1T2VA 2FTKE 3EDOA 4DXHA 2XYVA 2CEAA 5ARCA 1EXMA 2RI6A 3K2QA 2DQZA 2AOWA 4RYLA 5T4HA 1RBQA 5KNDD 1G18A 3UY4A 3R5TA 4PG6A 1JHYA 1FP2A 3KX2A 2VO1A 4AJNA 3BGOS 4OJQA 1LWNA 2C0PA 4DIUA 1X38A 3E5MA 5CEFA 2VXBA 1Q1QA 5EIOA 1OFVA 5I7OA 2Q3FA 4I46A 1UPTA 2BGIA 2QY6A 3KJHA 4OFXA 4EG7A 3O7WA 1R0BA 4GPIB 1WBJB 1L6RA 2EIXA 1AX9A 5K0GA 4AKSA 1G55A 3SE0A 2IUTA 4O0MA 1JDNA 1EM8A 3BF8A 3D8NA 5HIIA 4M1EA 4B8ZA 5CT6A 1AKRA 1IXYA 4XDGA 4TT8A 4F84A 3E9ZA 4HNHA 1H05A 1EPUA 4RUKA 5DE3A 3UXEA 4BNJA 2VSFA 3LZDA 1FFYA 3N9IA 4D57A 2QUKA 1EX7A 3BZWA 5HDQA 3VKUA 4L74A 3LYAA 3TOCA 3BCSA 4I66A 2QTWB 4QXQA 1E1KA 3AHJA 2CDAA 1IUKA 2L17A 1P44A 3SVTA 2OCDA 4PVCA 2QBYB 2Y1FA 4FW8A 3BVPA 2DB3A 3S7TA 2OK8A 4QPPA 1T9HA 5IUKC 3UV3A 2PUFA 4G1EB 2CF6A 2A0KA 1P5HA 4JEIA 3LBHA 4GAEA 5FA6A 1E4YA 3V00A 3E6AA 5EHNA 3GFPA 2BBOA 2DUMA 2IZ1A 2Q5EA 3PITA 4HLQB 1F1JA 2NUTB 3WK8A 3T5PA 2B82A 4MA0A 1ZJ5A 1Z0KA 2ZUDA 1AD2A 2HCJB 1GL3A 3NRJA 3OUUA 2KQUA 4H7KA 4HYQA 1XROA 1JU3A 1QU2A 4G0WA 2L18A 4NC9A 4IZHA 4IOJA 4GOMD 4Z4QA 4EB6A 5F51A 2CXXA 5ALVA 1L7OA 4M49A 4PLVA 4XCVA 4L5YA 2RBGA 3HEAA 2VPPA 1HO3A 3H5TA 1EXDA 2QRHA 3PXCX 3AC0A 4CIXA 3MJEA 1SMKA 4X6UA 1SUDA 3G9ZA 2FMTA 1CRLA 1M7BA 1ZHHA 3L4JA 2X58A 5F23A 3WGGA 3IEUA 8ABPA 4I5GA 3E70C 4PSAA 1B2LA 5HRCA 4BMYA 4R6XA 2C7PA 1ECJA 3NBXX 4FNGA 1THZA 2AXEA 2AZTA 2YXDA 4ML3A 4OQYA 1PSDA 4GC5A 3U7FB 4P0PB 3LY5A 4CKBA 4QDZA 3ZK8A 4CWAA 4V0RA 2GXSA 2NT4A 1WMFA 4KIGA 4LI0A 4E2WA 4GZLA 5TMDA 2R8PA 2QMYA 4IQFA 4TV9B 1CD5A 4ZFNA 4RTMA 3OG9A 1TTHA 3GVPA 4G86A 4TRJA 2P6NA 4GYJA 5GY7A 4P86A 5ELMA 5LP6F 2AYYA 4JJGA 5JBQA 1QF6A 2J30A 3AF4A 4YNBA 2CUKA 4MYDA 5CYOA 2HV8A 2MINA 4J0CA 5CFQA 1AHIA 2G6TA 4PGGA 1TGYA 3EVGA 1B8NA 1Q14A 4ZEVA 4KN6A 4QAQA 1XZKA 4CR7A 5JCXA 1JGTA 3HKCB 1P2DA 1VIVA 4US1R 3QI7A 4RF4A 3BTVA 5KKCA 3PVCA 2B0CA 3HACA 1Q11A 4G5QA 1MB0A 4GGPA 4I5FA 4Q15A 4QQ8A 4LYGA 1LPMA 4QXMA 1E1CA 3GRYA 4KQEA 1GG5A 1MGOA 4G8DA 4PQRA 1LFAA 3WYCA 1P1HA 4ENVA 4D8XA 2F8MA 4DR6B 2VYQA 5A1JA 4J2TA 1J23A 1EFRA 3MS4A 3Q15C 3WWZA 1ESZA 3WG9A 2OAQ1 3L8MA 1UPAA 1ESDA 2QG9A 4MTLA 4FMBB 4UCQA 5BOSA 3M5DA 4GUDA 2O5CA 3T7TA 4X6LA 2WKSA 1FXUA 3LNCA 4J6FA 5J5CA 5DM70 5F76A 1Z5GA 5ALDA 4JUCA 4D3DA 4RWZA 2PMEA 2O2DA 1TCBA 2YHIB 1DUIA 1YUNA 4FBLA 4F38A 1GKKA 4BMCA 3PUXA 1JAIA 4EPRA 4KQGA 2XKJE 1SXJC 1EFVA 4HWTA 4KMSA 2NAFA 4Q66C 3F3KA 1OIXA 4OHXA 1ONNA 2BMJA 3WQSB 4ZEOA 5HIAA 1Z6TA 3KOMA 1XBTA 4R1NA 4EG1A 3QIAA 4YRBA 1GVNB 4P3KA 1A5BB 2XWBF 4FUQA 4L8VA 5FO0A 5AWFC 1NF8A 1KU6A 4XQ9A 4KWEA 4HRVA 4IJ5A 3RWMB 4EG5A 4WESA 4LY9A 4LPSA 2A6PA 3PKIA 3MWEB 3R7WA 1W4LA 1OXUA 4LXQA 4MR8A 2BDEA 5DLPA 4UUAA 1CUSA 4UXJA 4C6SA 3LPMA 3U26A 1NSYA 2HQBA 4R2WA 3T3DA 4PFQA 5BMVA 3OLXA 2RHTA 1HL3A 2PKEA 4IUYA 1SBIA 5M34A 2BHLA 1XTKA 3DWFA 5AXBA 5IAAA 5SICE 1BAPA 4UAGA 2RHHA 3SEAA 1IUNA 1YOVA 3AVPA 2FUG1 3A06A 2HDOA 2QF7A 4HNGA 1WCXA 2C4KA 1NBAA 5DW3A 1ULBA 4P5DA 4R1MA 1EK1A 4O2RA 1DT5A 4MUFA 1J97A 4UPEA 4W7HA 4WECA 4Y1FA 1VL5A 2Q29A 5KU1A 2I6SA 1E3LA 4GR9A 4JSRA 4Q3BA 3I01A 2H1WA 5DK4A 2D7JA 4HB0A 1JBKA 2VRCD 3TMKA 1YQDA 4Y1RB 4Q9AA 3UAVA 3B3JA 4JQYA 4TTQA 4M9SA 4R5MA 4DIFA 1ZU4A 4IKPA 4XXHA 2I91A 4JVOA 3X3HA 3D3JA 4X90A 3VR5A 1EZ1A 1HT2E 1I3CA 3AF0A 4MWZA 4BKMA 1PJAA 3MYRA 3MTJA 5TMEA 4HWPA 4EK9A 1AKEA 1GG2A 1C2YA 4UJ3A 4F4CA 3EQ8A 1M7GA 1E79A 4K9SA 5KC8A 3TLXA 2J0UB 3JWGA 5LQMA 1FLNA 3V8PA 4CLHA 3LC1O 1EDDA 2C4HA 3B12A 3KPWA 5EIAA 1QTQA 1IXRC 2NYVA 3QNUA 4S35A 2D2VA 4A5SA 4MRRA 3CN9A 3M4ZA 2FFBA 4M7WA 5B2ZA 4QT4A 1DTWB 1ES9A 3I3SR 3Q7RA 1OX6A 3BWBA 1YUBA 3P27A 3UC9A 1SVMA 1K5PA 4Y6SA 5LOVF 3RSCA 3FF1A 2PSHA 3DDHA 5D84A 2BKVA 4N76A 2CHQA 3MCVA 2IIQA 3USES 2XDQA 1OYVA 1MQAA 4FFOA 1ZUHA 3V3KA 4F5WA 4KLAA 5C51B 2A9QA 2GCOB 1LRLA 3CZ5A 4V1CA 3OFNA 3FNHA 4G97A 5JCJA 1ZA2A 4A6PA 5J4YA 4Z54A 3JVEA 3MWJA 1PK7A 1V8PA 3A36A 3R5KA 5EZ5A 1O03A 4NZMA 4A8JC 1G9TA 2EL9A 1TEVA 1PQUA 5E6RA 1KVUA 4C3OB 1XJQA 3MQ2A 4CMCA 4WA8A 5CCEA 5DRYA 3G2HA 2VAVA 4TZKA 1ZXBA 3UMVA 3F8TA 3I9LA 4N03A 4L28A 1RJGA 2ECFA 4U4AA 3DNPA 1WHTB 4WAUA 4X64B 1DCFA 2G7ZA 2I4IA 2B99A 3RROA 3L1IA 1R37A 1XJ0A 3Q6MA 4C0BA 4F1WA 2QTTA 4ZEXA 5BSMA 1DBVO 3HKCA 4FYWA 3NOQA 1TB4A 3ZWDA 2H1IA 1HOXA 3Q98A 4MEAA 5DTMA 5EXPA 1GXSA 1HM5A 3V6MA 3ZX5A 1J1ZA 1MZVA 1GGKA 3BWEA 1AOXA 3LW7A 2OP1A 4KQMA 5IMBA 1YQEA 4C4SA 4RTSA 1P8JA 4BKRA 2DP4E 4KR3A 1S8OA 1LZLA 3UAXA 4H3VA 1RAAA 1HY3A 1PUXA 1R12A 3B52X 3OO1A 3QHAA 4M46A 4NU0A 1IY0A 4HUQA 4RVUA 1JZSA 2R8YA 3M6VA 4L0DA 4WKBA 3ZBPA 4IDCA 4KR0A 1T1SA 5EWMA 4TTIA 4O25A 2CV1A 3ADCA 3DLTA 2HL6A 2I76A 3DC7A 4OQNA 3PWSA 3RUFA 5M04A 4RA6A 1OB2A 1P5FA 2XE6A 1PNTA 3ZS8A 2WOJA 2X13A 1IATA 1YVEI 3J7AC 1VYTA 3SFVA 5BNIA 3MCTA 3LWZA 5F64A 4IDAA 1JFLA 3WGLA 3L8HA 1QOQB 4AQYB 3PVSA 5EPEA 2FPWA 5AXAA 4DQVA 3OCJA 2O0LA 3HCFA 2OXTA 4MKRA 5THQA 2PL9A 1A82A 1AKTA 1FSFA 3PS9A 4NMHA 3RKRA 4BMDA 3WDSA 2E4UA 1JEEA 1PJ2A 2XDWA 2EDAA 3IDZA 3GLQA 1QHIA 1QSGA 4FFSA 4JC0A 3O84A 4DV5B 1F7UA 4NYJR 2H31A 2GESA 3I2YX 3Q2KA 3GJYA 4DPMA 3RS5A 3NGXA 3RV4A 3I0MA 3RYIA 3STWA 4KQCA 4EA7A 3WRYA 5JS8A 4GYYA 4CM8A 2C2KA 4PXAA 4FW9A 2VNSA 5FBQB 4YRSA 4K81B 1IRXA 3JQRA 4DTIA 2MMCA 3QVVA 1RLUA 1WDKA 4MQFB 4BYGA 4O4JF 2HREA 4OYLA 1IAVA 3X1DA 4NATA 1KJIA 2PY6A 3M8KA 3LX4A 4S1VA 3UJ8A 3WFZA 4EHFA 2I62A 5IKPA 3BWDD 2M1XA 3KPVA 3AEUB 1ZIYA 4FDUA 4EYGA 3T5MA 3HB9A 3NTXA 3EH1A 4CM1A 1NT4A 2QAGB 2P2CA 3D8HA 1O97D 3RSHA 3E1KA 1QHGA 3H1FA 3VZDA 1NMQA 3CU5A 1Z56C 3RVKA 1QXSA 3GA5A 4MCHA 3TLCA 1EGMB 4I8IA 4I3GA 4PHTA 3CY6A 2XJ9A 3VYUB 2OZVA 4D0SA 3ZU6A 4QTZA 1BHSA 3RTEA 1PUJA 5L40A 4M0EA 1FMJA 2OSBA 3AI2A 1O8BA 2ZJ7A 4Y1RA 1ARZA 1DAFA 4WA7A 4V39A 1NVEA 1YCFA 1YVUA 2B8TA 4TVKA 1QK5A 5AW8A 1RJ9B 2QLLA 3HGQA 4BP8A 4CFZA 5FF9A 3MTAA 3LQ2A 4OQLA 3UHJA 4AUMA 3LUGA 2R6R1 3BQ9A 3EF3A 4HEJA 4CCYA 1YB7A 1G8KA 3H8WA 5EZ6B 5AK6A 4MH0R 3F1KA 3BERA 3KOWA 4AS2A 2HMAA 3FLAA 2I3DA 1DQNA 1KJJA 1TU3A 3IPCA 2W4IA 3RAEC 4YP7A 4LYYA 2VH5R 5FFFA 3SSNA 2KSQA 5DIZA 4RIFA 2A5YB 4L9RA 3W7BA 1HDOA 3EGIA 5TGTA 3C8UA 2VAPA 4F0JA 1M8GA 4J1QA 3DAYA 4G5RA 2II6A 4WN9A 4UAVA 4ZRMA 4QJ5A 5AVYA 5ITZB 3BJIC 3OX2A 4HQ0A 4M0CA 5M7EA 2C7RA 1RWBA 5LLSA 2JFQA 5EYPA 2V7QA 4JJKA 5JJ5A 2IS4A 2FX5A 2FETA 2O8CB 2E89A 2AN9A 2JIQA 2YC2C 4G85A 4R5HA 5GV7A 3VZCA 3U4QA 4J94A 1QKJA 1T4BA 4EFKA 1VRCA 4JOSA 3WGIA 4UUBA 1TZCA 3FVVA 1NQUA 3C5WP 2XA9A 4TV8B 3INYA 3SBEA 2JVKA 2QLJA 3IRUA 3WRVA 3KXLA 3D81A 1P17A 1BGXT 3TO5A 1VBFA 3OJOA 3V48A 3H2BA 1NIJA 2FCAA 5B4UA 5JSHA 1TEXA 1XAGA 4KMMA 1KZ1A 1UXJA 2XTMA 3PFFA 5L9AA 4WIAA 5JH7A 5LFAA 1HXHA 2JIMA 1MB4A 3QVUA 3W4IA 2HWXA 5FAKA 5L7TA 4NDAA 1JB9A 1T1RA 2ZCJA 4JI8B 2JBAA 4M88A 1GZUA 1S96A 3KDAA 5D3QA 5EJ8A 2WT9A 3MMPA 1JJAA 1BW9A 4YQYA 1J9ZA 5AKZA 1UBJS 4Q7JB 4UBKA 3OBBA 1J49A 3JQGA 2GZMA 3L8CA 2OORC 4Y2VA 4CM3A 2FZGA 1O6BA 1N6HA 4KGZA 1W2HA 4OTZA 1MZPA 5BUQA 4D46A 4BZZA 3WGKA 4DN6A 1L4YA 5JSYA 2P40A 2QXTA 3PNMA 2Q49A 4EX6A 3QITA 3O90A 4NCAA 1K8RA 3MYYA 3H0KA 1N2BA 3AW9A 5JY1A 2XBMA 1Y4SA 4Y2UA 3CYFA 4AUKA 4H6WA 4RPIA 4YMVA 1FVOA 1U0OC 3Q41A 2FW9A 2M6SA 5DISB 5LMZA 2WICA 1Y48E 3UG6A 5CXXA 5H70A 3BWCA 1OFIA 4C6TA 3I4LA 1I2ZA 4JUBA 4XGRA 4UEQA 3QSGA 4UDNA 1AT1A 3DMYA 5I9BA 3T5AA 1XFAA 4HBGA 3COSA 1NNI1 3VC2A 1U65A 4BO9A 4ENQA 1FFEA 1PNQA 5CCXA 3CVXA 3G2OA 2FWJA 2GPTA 2W37A 5ADUS 2P4EA 4WV3A 5I3ZA 1J6UA 4BUJA 1Y5LA 2BHSA 3DDZX 3GIWA 1D2RA 4DV4B 4ZEMA 2P6RA 2O6HA 4RK4A 4IGFA 1XO1A 2QW0X 1XU9A 1L1FA 4I5EA 1XNRB 1XVTA 4XRRA 3O73A 1BWSA 4BP9A 3B1ZA 3HVKA 5F7OA 2W2KB 5JNVA 3NRCA 2HQ1A 2O2JA 1BA2A 1M76A 2XNJA 3MW8A 3QHPA 4PR0A 3NANA 4EELA 3HHPA 4WINA 2W6IA 1QGUA 4ZJUA 4TWIA 4UNSA 2BTQA 3C7CB 3TLMA 1MOSA 1NG9A 1ODSA 2IUFA 1NPYA 3LT2A 2RKWA 3DOFA 2OTCA 3QUSA 2ZATA 3F6YA 2ZUTA 1TTQB 2YNMA 2R00C 3KPJA 3VU1A 1CQZA 4KFCA 1BKDR 1AMUA 1HDGO 3KDPA 2XD9A 1BJRE 3L9XA 2CJYA 4ZGBA 3T3HA 5C5CA 3RM3A 1QAMA 3R3VA 4A0GA 4KYIB 4BO3A 1W9HA 1U7TA 4EPTA 1NE2A 3Q5DA 5GOZA 2ZM6B 5GAJA 2B6HA 1O95D 2XKAA 4XD7A 1JRLA 4YMLA 5HOEA 2DWUA 1XDBA 2W71A 3Q0TA 1KR5A 4J2HA 5DHTA 1H93A 5DTJA 4RK6A 3W8RA 4GXRA 3T12A 1F2UA 3EBLA 5CTAA 4BFWA 3PHBE 3WL3A 1VCNA 1UFRA 1IPHA 1C4OA 1PG2A 4RFSA 1YZTA 1SC9A 3BGSA 1JAHA 3DO5A 5HDBB 1RU3A 2A0XA 4JEHA 5FOWA 5HGXA 5K6AC 2QVCA 1K6JA 1SOVA 2CCGA 3HLTA 3LUKA 4QT0A 1I9GA 3ETJA 1M1NA 1DE0A 1QH9A 2WWYA 3BGVA 2A9OA 4ND8A 2HFJA 3A25A 3L4EA 4EY4A 2BR4A 2WNHA 4P2GA 1WW2A 4C2AA 3GPIA 1PJ3A 3I01M 3LO8A 3WXMA 2GR9A 4AROA 3H1EA 2NP7A 1V9SA 3A1UA 3RSQA 2JHFA 2O06A 3GUUA 3KR2A 7AT1A 3ORHA 1UT5A 4ROTA 3SZMA 1P62B 4MULA 1JLLB 5T8KC 1BA3A 2C4NA 2VYNA 2CVZA 5B1HA 5F1OA 4YEDA 1GPUA 1KC1A 2C29D 3HLKA 3I28A 2EG9A 2ZWPA 1DBPA 5FXMA 3CX6A 3ZI0A 1IBKB 4R9RA 4JB0A 3EA4A 2HUNA 2XT6A 4JNCA 3RG8A 2IP2A 3SF8B 2QP3A 3QEKA 4A15A 3Q6IA 3GPDG 3QTLA 4URYR 4EKEA 3AU8A 5JCPA 2IV2X 5ELXA 3HVUA 3I9JA 1YMVA 2FOIA 4OH1A 2AI3A 3SD7A 4H6PA 2J9YB 3VSEA 5BSFA 1AKVA 3HBMA 3UV7A 5BWCA 4PLWA 4WXYB 4ZYLA 2FXVA 2XB9A 1Q15A 1RBZA 1TE2A 1H2YA 1H65A 1Q0SA 1R4NA 3OECA 3AB7A 4NESA 4QXPA 5DYTA 4EPXA 4F11A 3DL7A 5EY5B 5HNKA 1EUCA 4HS4A 4LXYA 1P80A 2FMFA 4Z51A 4MUNA 4TVBA 5AHRA 4ALMA 8ATCA 4KYVA 3CLKA 1GRQA 1V5EA 2BFDA 1DXQA 1VP3A 5DBFA 3L6RA 4YT5A 3AVWA 3FUTA 2X9GA 2IHZA 1C9DB 3AEXA 2R1ZA 1GDHA 3AMVA 5E2BA 1EAMA 2B4AA 2G5GX 3LOUA 1LCIA 3I1FA 4B76A 5K5EA 1VHDA 1JR4A 2AMYA 2Q2VA 4OBEA 1OU0A 2HDWA 1IE3A 1P5ZB 5BUSA 1GL7A 3N2KA 2QAIA 4Y2HA 1YB6A 3IEMA 1Q19A 4CL8A 1XKQA 3UT6A 1C3XA 2JD1A 4C4AA 1UOOA 4B3RB 1RHKA 2C4VA 3OCWA 3O95A 4TLLB 3BXXA 1I7SB 3BXPA 1ZQ9A 4NS1A 3H16A 5JVDA 4M8IA 5LP6B 1H2HA 4UUOA 1DV1A 4J1TA 4PXYA 1DRJA 3HVJA 2H85A 4GI3A 1FVFA 2E1PA 4W5OA 2BMVA 3V2UA 1SD2A 2BGMA 3L4SO 4GMHA 5EN4A 2BUCA 4K9MA 4PO9A 4TZ6A 2D2IA 3H42B 5CW2A 2IT1A 1SEVA 4N39A 5I01A 4D3SA 3DLBA 1VB3A 5DM1A 4G1FA 5LVAA 8AT1A 1DS6A 4B47A 4CU2A 3HEMA 2QTLA 1Y8AA 4LV8B 4W1QA 2FGKA 5NLLA 5JYEA 1KI8A 1MR3F 1PR4A 1CDOA 1FVHA 5JPCA 1PJLA 1XX6A 2PQ0A 4Q34A 4B3HA 4ERXA 4XE5A 1YNSA 4ZOCA 5AESA 3IKVA 2PE5A 3TTSA 3Q7TA 4B3XA 1C50A 1FTGA 2NV6A 1T10A 1QORA 1R4MB 4S1NA 5E8JA 1H5UA 2F62A 1I3NA 2IODA 2C5AA 1W5SA 3GEDA 2ZWAA 1M6YA 4FT2A 4BNVA 1XIVA 1XTIA 2COEA 3A4YA 4M0DA 3VR4H 3RBVA 3CKLA 2NZVG 1Y63A 3IVXA 3H0EA 2OCAA 2AFHB 1E2QA 1PL7A 4AY2A 1NDQA 2GJSA 3L0SA 3W05A 3F5MA 4RD4A 3H5VA 1PLKA 1Q74A 2IHJA 1YKGA 3JD3A 4XFJA 3S4YA 3WSTA 3ZS9A 2DRIA 3RVDA 1O87A 4M8LA 1GIAA 1RI2A 1YI1A 5HG0A 1VG8A 3GCXA 1NXVA 2PRJA 1FTQA 4JI6B 3NBQA 1I1QB 4DNPA 1QFXA 1Z68A 1TM4E 2YCBA 3AHEA 4NENB 1SGWA 1ULSA 1M6VA 3IBGA 4HAWA 1T9GR 5DCLA 3HJTA 1OR8A 5JSZB 3T4EA 1SKBA 2O14A 2H00A 3C7AA 2H3EA 5ERYA 2Y1LA 4IDQA 1E3MA 1XRJA 5G1PA 2ZLBA 1P9LA 5DX1A 1YJ8A 2ZRIA 3UK0A 2H2GA 5E3IA 4UDYX 1JPNA 2VNKA 6YASA 3CXRA 3EQZA 1R6AA 4HYEA 4NBVA 3WOHA 5B12A 5IKXA 2VQ3A 4RKEA 1E1RA 1H9BA 1KEPA 3ZV6A 1S3FA 4G01B 4L2IA 1XSEA 3QVWA 4PX9A 3ISJA 4LGVA 1T2DA 4ZANA 1QKIA 1HF3A 3RAFC 3T9CA 2GTPA 2GX6A 2R8BA 2Z0MA 4EYSA 5F1YA 3U9TA 5JCOC 1JDSA 1Q0TA 1AVTA 1MB2A 2A9RA 1DELA 1IUOA 4K88A 2HWUA 3MOSA 1JFFB 2FPPA 4HMQA 4EG0A 1TCUA 4X41A 3K0EA 4BZWA 1NVDA 1D9ZA 3C98A 4BO6A 1TAHA 2UVPA 3EXHC 1SG0A 4DMKA 4E7OA 4M9XA 3U3OA 4J76A 2ZIWB 2FW8A 2DBYA 3P2IA 4J91A 4W6QA 4J0EA 1O6CA 1ZNZA 3HUTA 1LF0A 2MYUA 3S8YA 1Q0PA 3ANYB 3P2KA 3OHPA 4R9SA 4RQBA 3SF8A 3IHKA 3TX6A 4J0JA 2XCRB 2HYIC 3EOAI 3KZ1E 4EY6A 4J3NA 3PEWA 2JFYA 2ZXEA 5CIQA 1NOKA 1TK9A 2IEIA 1J2EA 4XB1A 4C22A 4EVQA 1CIPA 3JATA 3W4JA 2AFRA 5E4YA 2EARA 2A57A 5AW1A 1NHGA 4DSUA 4ECEA 5JANA 4M83A 3V8VA 1OLXA 1F0YA 1Q7EA 3MTGA 3QK7A 3QWFA 4GLBA 4YVFA 4ZPXA 3IOEA 2PUWA 3JQ8A 4UCFA 3T15A 5TMPA 2UUCB 2VF5X 3GJ4A 1ORIA 3HO8A 1H1LA 1VYUA 4ETWA 5HF9A 4EQZA 5J63A 2FQQA 4B6QA 3HI4A 1U7XA 5LOVB 4TL9A 4LF7B 2VTBA 3RS9A 4N9WA 2XVYA 2QX7A 2R44A 3JQFC 2YJ5A 3U7QB 3VR4D 4E6EA 5BPFA 5CFPA 5CVEA 4AF6A 4X65B 4ZYTA 1M1YB 2R8OA 3ZZ0A 1EM6A 2X2EA 2BV3A 1XEXB 4QE3A 1OXKB 4ZT4A 5FUWA 4I9GA 4N41A 2B69A 3A0RB 3NDRA 4BVJA 3KO8A 4D5GA 2VUUA 1PJRA 1K4YA 1ENPA 1RPTA 2ZU0C 5EJ2A 2BTOA 2XRFA 2NU9B 4AK9A 3GAAA 1WABA 1OXVA 5CYFA 1XHEA 4MQ5A 2DPYA 3JQBC 5AKEA 3WGOA 4CQLA 2XIJA 4NCIA 1E8DA 5G41A 2WAYA 1MCZA 3FTCA 3TL6A 1UWKA 4ZDKA 4PU0A 1JW9B 1UC5B 3AESA 3WKAA 5L6MB 1PWEA 3Q3JB 2NMVA 1QGDA 3OIDA 3NFYA 4KQIA 1XR3A 2C83A 2VEDA 2G08A 3A70A 4MS3A 4TKMA 5DNCA 4O29A 4CDMA 2HAEA 4CMJA 1EX1A 1MA3A 2HTFA 4XWKA 2HH9A 2HA0A 1IVNA 3DOOA 4OQMA 4QTXA 1UDAA 4JLSA 2BUBA 2V5AA 3GGSA 4MPRA 3VMFA 1E3DA 4XGKA 2H2WA 1ESCA 2QENA 3AIIA 3QU9A 3TE6A 2E48A 2OV8A 4NR0A 4ABYA 1L8AA 4TMKA 2Q3CA 3QKIA 5HFNA 4ED9A 3PRKE 2BEVB 3GLTA 1GCAA 4DLKA 4HATA 2UZ3A 3B36A 3RVRA 3ORYA 3QI2A 1P7VA 4K9OA 4ZI7F 5FAXA 1IJKA 3NKFA 1JDPA 1UMDB 3U1BA 3L0DA 3CW9A 2XF2A 3UUWA 1THGA 4ZIRB 3EEOA 1WP9A 3V4LA 3GP3A 2NUBA 4ETMA 5J23A 1TJ5A 3C7TA 3R24A 4C2BA 2PSEA 2R8RA 2CEKA 1GOTA 2YFHA 3IO5A 2C0CA 3PSAA 4OQ4A 3WIDA 5K3FB 5KO2A 3H1GA 2IWHA 4BLQA 1XEWY 2WMYA 1GTG1 3AR2A 4RZUA 4WERA 1PL0A 3E81A 2ZSDA 1RAEA 2EERA 3PYLA 3AEKA 4IMPA 4NENA 5AI9A 1N2IA 3PPIA 1F8UA 5JLAA 4DSOA 3AFOA 3SQLA 3OQPA 2BAGA 3A4LA 5E1OA 1ZM3A 1NMSA 2PVCA 4P33A 5JSZA 4KQXA 4MWOA 3JYNA 4LRSB 4C87A 2J87A 4O4JB 1XDGA 3HFJA 2W6PA 1O94A 4GPTA 4OY3A 5JZMA 2FEXA 5HIJA 3K09A 3UMRA 3EH2A 1NDUA 5BN5A 5DP1A 4F8YA 4RM2A 4WADA 2GD1O 3A2MA 4BKOA 2LNDA 3RJZA 4A10A 1AZWA 3HNPA 3C3XA 3THYA 4GRDA 4AJEA 5AVVA 5TLSA 1P5RA 1V43A 3LIPA 2CNDA 2GFIA 4EY5A 1GTJ1 1JF8A 5FI1B 4FK8A 2OD9A 4OA5A 2CLMB 3K73O 1BOOA 1E7RA 3QLVA 4L7VA 2HPZA 3VV3A 1NUQA 3TJZA 3IUPA 1IHPA 1WSWA 3GLIB 2FK8A 3NDBB 4GMXA 1GFSA 4O2LA 4B45A 5J4KA 4KBGA 4M53A 1BXZA 2X41A 3FMIA 4BLPA 2QUZA 5KBYA 3KTDA 4ARIA 1E3SA 1VI5A 3HCEA 5BYBA 1A04A 4K0KB 3UVEA 1ZOLA 4PQFA 4QGFA 3ROFA 5HXAA 1CNMA 1N8SA 2Z5GA 1R88A 3BOSA 3HKDA 1XLVA 1CJVC 1RKXA 2F8LA 4LYAA 2AXNA 3ZUGA 2X7JA 1HFEL 1U8ZA 3MVEA 4COKA 4ZJZA 3GEHA 2JRLA 4FEEA 2AEFA 4ZRDA 2B6NA 4BV3A 2AA3A 1ORVA 3DZ8A 3V9AA 3WMRA 1YI0A 1V7PC 4EABA 1X7HA 1K2WA 4I8XA 5ITVA 2DR2A 3K9FC 2IP4A 4GHWA 1UMBA 6ABPA 1KJYA 3KD2A 2G1AA 3TKYA 3A14A 1CUJA 4BFTA 5C81A 3OVMA 4IDPA 2BEKA 4K9QA 5BN4B 2QN6A 5EIBC 1AZSC 3S1AA 5KWJA 5L4NA 1TO1E 2BGNA 1R7RA 3L84A 2GD0A 5ESRA 3UWMA 1QLWA 4WXRA 4OJNA 3ENVA 1ZICA 3AXSA 5JMPA 2W6JD 3IPAA 3KL2A 1GQFA 3AERB 4AZ3B 4C0QC 4OHYA 3HCBA 3W5UA 2PD3A 2CLCX 2N0SA 2QV0A 4HAVA 4Z4CA 2YX1A 4A92A 3ESQA 5TT1A 3ZIAA 2QRZA 1AUOA 4QO8A 5H81A 1ZD1A 2QN9A 3UXHA 3ZDXB 3WAGA 2H3HA 1U0TA 2VP3A 1B73A 2QP9X 2PDAA 3RQIA 3KQWA 3I37X 1VQ1A 3R0IA 4DVJA 1FNDA 3DZBA 2A3RA 2WG1A 3NBFA 4G9EA 4H0CA 3WSVA 4MITA 4DLTA 3VSDA 1J8MF 2P0YA 1VDMA 4GZ5A 5H9VA 3S6JA 2P67A 4UTRA 1E1QA 4B3IA 2AL7A 1FMCA 3I42A 2GBCA 4PO8A 4AP9A 1P0PA 2IZ5A 3VC7A 3WK5A 2IIPA 3ZDBA 1QWOA 3F74A 1E1LA 2VP6A 2UYGA 2R7AA 2P27A 2JIOA 1COWA 2UV8A 1ZMXA 3VUEA 2HPHA 1DIOB 2Z2ZA 1YDEA 3R0VA 4LTDA 5CFMA 5DEIA 5JFGA 3SQOA 4RULA 1SUSA 3L06A 3ZHCA 4AZTA 1CRPA 5A3RA 1U2ZA 1VPEA 3MQ4A 4CF7A 5FPYA 1OAOA 3WB1A 4H1VA 5KYYB 3T1YB 4CYMA 1BGVA 3Q9UA 1WETA 1CIJA 1XMVA 3WICA 3VI4B 4BQRA 1RVV1 3T1OA 3PX3A 3PDUA 4J75A 4DA6A 1NYRA 2WA2A 4E30A 3JZIA 1RXCA 1D5WA 1U98A 5T5QA 1SZCA 1BXRB 1D8AA 4ZPJA 3PDCA 3NP9A 3IOYA 3QU2A 5JI3E 3T9FA 1UOEA 1VM6A 4N3GA 1Q1NA 1QM5A 3LECA 1QDEA 5B30A 2BFMA 3BMNA 4OGFA 3MILA 4G5OA 2RC6A 1W4ZA 3P9NA 4RJ2A 3ZVRA 5CB4F 2RKOA 3BTSA 1TEZA 4I4LA 1RYDA 2ADOA 3DOIA 1H2AS 2I7VA 1Z06A 1QIKA 5G02A 3WV5A 3ITKA 4FWTA 2EBFX 3ZXIA 1W0JA 2VDJA 2X6QA 1JH9A 1NYLA 3RI3A 1WB4A 2DGDA 3BE8A 1KKMA 1Q0ZA 1CVRA 2J4CA 3CGGA 3A6EA 3RR2A 5AKXA 1UBCA 2TMDA 1ML4A 4XAQA 3OIUA 5C1BA 3Q3VA 3RKSA 3E7FA 3PQ7A 3U3KA 3AVVA 5BSHA 1V37A 4II2A 4PFJA 3KR0A 1U28C 2CVOA 2QVGA 4YDSA 1CRQA 1E0SA 2Y1XA 3IV6A 1DJQA 2AX4A 3HBAA 4S2EA 5DTRA 3IDQA 5B4VA 2ZS7A 1DQZA 1IMOA 3EVFA 3PBKA 1D2HA 3MMSA 4GLJA 3SJUA 3WL5A 3WYDA 4AJOA 4HPXB 1I6LA 2XBUA 3F0TA 3BE4A 2ERXA 4XWTA 1OZFA 2FSHA 1OIVA 4B32A 4MI3A 3AWIA 5EXTA 1RMTA 1KMIY 4E5SA 1L1RA 5CFZA 5D3MB 4BVBA 3NWJA 1A5SB 3CEJA 4P4UA 3M3HA 3T9AA 1GR1A 4U2KA 2CF5A 5JFTA 3QVSA 2ANCA 1V8FA 4GL4A 5HKBA 3JARB 4YRFA 1E9EA 5CPFA 3T3EA 3W5VA 4ZZIA 1FNCA 1Z6XA 1Y1TA 2JLSA 4D6YA 3H4VA 5DO9A 5C3MA 3ZDQA 4BLVA 2AD1A 1Y82A 2C4TA 4K2HA 5HPYB 1BS1A 3BBLA 3HSKA 3LCRA 3M5PA 4XGQA 2I2CA 1VBKA 2Q9BA 4DREA 5B6JA 3I64A 2PL1A 3K20A 5DI9A 2IYZA 2WZQA 1GPH1 2BDUA 4IS3A 2RJNA 4GX5A 5HVNA 3K31A 4UTZA 4WDQA 1F20A 4Q1EA 2Q27A 1PR6A 5F2EA 3LQ1A 3W8EA 1VGRA 2QTCA 4JI3B 2ZTVA 3U7EB 1Z36A 3OETA 3N07A 9LDTA 1YHNA 1BMFA 1TF7A 3WYFA 1NM5A 3HI6A 2PS0A 4I50F 2ZWIA 4UKDA 5EHQA 1RQ2A 4CF5A 4LQLA 2NGRA 2JNWA 2QYHA 3SC6A 4B8WA 4BWFB 2ODQA 2IEYA 2J6HA 2WSLA 4B35A 4BNMA 4OREX 5HUJA 1N3YA 1OVGA 4DJAA 4XUCA 2PS3A 2JLAA 1M8JA 1MIHA 3GWGA 4HO1X 1KOJA 3E7DA 1BHO1 2G09A 2B5WA 3WHKA 1E32A 4A1FA 4BLRA 4F3YA 5K8CA 3G6KA 3IXQA 3ZD9A 3X2FA 4TT3D 5EZQA 3JW8A 1Z0IA 1PGOA 1UWLA 2DSTA 1A69A 2C5LA 5KCMA 5K0SA 4F3CA 2NTJA 2FZLA 2PR2A 2ZB2A 3STVA 2GN4A 4WLFA 1W30A 5JJBA 3FD8A 1Y8RB 2J67A 3H04A 2BJWA 1NG1A 1P9NA 3L7JA 4P22A 4H18A 4TN1A 4UHHA 2GBLC 1Z0AA 5E4JA 4HQNA 5ILGA 3ASUA 4L08A 5BSKA 1E62A 1UBMS 1KJQA 2GRUA 3QVKA 4P0TA 4OYRA 3ZW9A 1LSUA 1OLOA 4HK4A 5A4MS 3UH0A 5FLEX 3CT6A 3VX4A 4CJXA 2H17A 1YZGA 2V0CA 5JD4A 4ZAVA 3ZJYA 3QKUA 2XCSB 4KV7A 4TTJA 5G40A 3OWHA 1T8TA 2IHYA 1SB9A 4Q39A 9ATCA 3LQKA 1KBQA 1P0IA 2MSKA 1O6GA 3D8SA 3BMOA 2O3TA 4U3JB 1LBQA 4DV7B 4XYEA 3CLUD 3CX8A 4RSRA 3GLRA 2XGOA 4G1CA 4JELA 2H1VA 3PE4A 3KR1A 3CR3C 4LJ6A 2HZBA 4LS3A 3TXYA 3EC7A 3IVAA 1CJBA 2OC9A 2Z30A 1I0LA 1T8UA 2ZSEA 4IGEA 4R2LA 1HNWB 2GILA 4MJLA 1TQ2A 1RYBA 1WUIS 2GT1A 3KVVA 5DN9A 1GPKA 2VNIA 1JA0A 3GRPA 3TSAA 1E2BA 4II7A 2PX6A 5DGXA 2AKYA 2QQFA 3IMEA 3QVTA 5C18A 4KWHA 2BFEA 3D7LA 4ZHQA 1JHZA 1QGED 2ZAGA 3HABA 3ONEA 2X8LA 4LTMA 1SQ0A 3AEYA 1C41A 4H6VA 5EVCA 4JGIA 4QYSA 4YRGA 3AKDA 1EIWA 8LDHA 2G28A 2CFRA 3DV9A 2DY1A 4YIHA 2E7ZA 1ZCBA 2WHQA 1T1GA 3BRSA 3CWQA 1NIPA 1P3JA 3EMKA 4LDQA 4BIMA 5BVGB 1L5OA 1AGNA 1F60A 2D0IA 5JWHA 2D06A 4IJUA 4JHXA 3PPVA 5GJVC 4R0MA 2FNAA 2X1MA 1T9GS 3KIPA 3VJLA 1A2BA 1S3IA 3LLVA 4I81A 1C7ZA 2XODA 2G8LA 1XL1A 1I4WA 4L4XA 3UN1A 3SYMA 3VM6A 1IPFA 5IS2A 1U80A 5JRJA 4D9JA 1YQXA 1K2VN 1JEOA 1PJ8A 1UXOA 2P9BA 1RYEA 1NRWA 4XVHA 3LKZA 5SZIA 3ZV4A 5EJAA 1ADGA 2YIMA 1X15A 2IS1A 1M66A 1DOHA 1RMQA 3I3OA 2DF8A 5GQSA 2F1HA 3D43A 5D00A 1R10A 4GPZA 4A23A 4B5LA 4CV0A 1VZ3A 2I2BA 1Y6GA 5TPWB 3H87A 5JCZA 2JF0A 1Q83A 3DHYA 3S2IA 3ZIUA 5KNCA 2QRPA 5A9SA 4IIYA 3G5AA 3TQHA 1J2JA 1VKZA 3UAZA 2WQ7A 1QO0A 2B7CA 2IIBA 5EE5B 4EITA 4MW0A 4W5HA 1SUAA 1JEQB 1Y4AE 3R7FA 4Z5XA 4GI1A 4Q12A 3P5SA 2GAIA 4TKVA 1DPGA 1RJFA 3GRAA 4EMTA 5KWIA 1TX4B 4LOAA 3KD3A 4QEDA 4HSGA 5HTKA 3QPWA 1U3CA 3ELWA 5EKDA 1GRVA 3ZW8A 1KO8A 4JXXA 2FDCA 2AKEA 2YJGA 3FTDA 5DCUA 2DQKA 4LYFA 1ZKDA 4EP1A 3EVTA 2IJGX 3FPFA 3QFSA 1HYQA 1WPXA 2ZT7A 1Y6QA 1JXAA 1AN0A 2E4XA 3D7KA 1TM5E 4DFDA 4E5VA 5FP0A 4A26A 2SCUA 1US8A 3DMTA 3R3ZA 4QDUA 4UU1A 5KSPA 5CCDA 2HM7A 4CQMB 5KTOA 4CQNA 2ZDGA 1IU9A 2I66A 3RC7A 1NZJA 3WLPA 1P9WA 1TF5A 1QHXA 1K92A 3NXSA 1LKZA 2EQAA 3MJ4A 4HNRA 4BVEA 4Z3KA 2VWGA 1Q7TA 2QRMA 2EF0A 5LNK6 3ROEA 1QFYA 3ELYA 1IN7A 2CBGA 3GFTA 1ZXXA 3VR6A 2IXBA 4PYRA 3RHZA 1XA0A 3NTLA 3ETHA 1W46A 4PLHA 3ROTA 3UCEA 1RJEA 4IKEA 1F4LA 1M0SA 1DTSA 2Q6TA 2OHJA 1JMKC 4ZQIA 2HOQA 4G0NA 2NO9A 2KHZA 2R6CA 2YBDA 3W8NA 2JASA 2ATEA 3H3FA 4BQQA 4NK4A 1OY1A 1R66A 3IA7A 4REMA 3HZZA 5ESXA 3W5BA 3BMQA 3SCZA 2R6DA 1RQRA 4KACA 2CL7X 5EWLB 1NZDA 3GFQA 5EE0A 3CISA 4D1YA 4U7FA 2FWNA 1B7GO 3KUDA 4WVFA 2W2TA 3GCDA 4KXYA 3TQIA 1BXKA 4PLTA 5T6MA 1E18A 2C58A 2YL2A 5IH7A 3FOZA 1GAXA 3M2PA 1ECCA 2VHTA 3WQQA 2ZDHA 4FIDA 4DZRA 3M9WA 3GAFA 3ML1A 5DSTA 4XSHA 3ZKWA 3K8QA 3Q2IA 2QMUA 2I4RA 3JU3A 5PGMA 1FXSA 5CT9A 4BNWA 1NF9A 1RJWA 4MYRA 3C3WA 3FYSA 5DGHA 5AKIA 1KPGA 4UVGA 3Q4GA 3IPLA 4R0VA 3OTOB 2JIDA 4EO4A 4JL8A 2Q0XA 2GLTA 5BR7A 2RG1A 2VZLA 4R9NA 5AVKA 3OJFA 3SIPA 2PGDA 1I2CA 4FBMA 3NC0C 4M9RA 1YCGA 4MS4B 4HMOA 1NVTA 3IQFA 4UNNA 2Q50A 4R6WA 3IQDB 2OA0A 3B5JA 4HDOB 4LEIA 4FCCA 4BNGA 3CUWA 4QJBA 3EE6A 1TFRA 1HDCA 2XMSA 3FNIA 1UBFA 2KJQA 4Q4HB 5F3DA 5KYNA 1ORRA 3QMPA 1W35A 5F7JA 2W22A 3NASA 4PYJA 2O2CA 3CSDA 4NHOA 3ZIDA 3DEHA 1U2RA 4IP0A 3ZLBA 5ESWA 2R6JA 5CVVA 2AUNA 5LUBA 3VDQA 4UMVA 3MQFA 4TLBA 4ARUA 4BFCA 1EE2A 4J4TA 4MK4A 4ARZB 4BXOB 3QE4A 3U6KA 3JAWA 2CJWA 1KU0A 2WQZA 4NPCA 4ZYZA 3J7TA 3LO5A 1ZVVA 2YHSA 1GUZA 4DRYA 2O8CA 4OP2A 5B1SA 4ZI7B 2XXAA 1GCUA 1RLMA 4UNPA 2HD4A 3NX4A 2ZRGA 5AM5A 3EFHA 3RFVA 1ZLXA 4X1OA 2OQIA 4MVJA 4MPPA 3U6BA 3Q88A 2X0KA 1C8VB 4RGVA 1H2WA 4NX2A 4F9FA 4IF6A 4DG8A 3HXLA 2E6UX 4NCHA 4Q1FA 3ZH2A 4CG0A 3PNSA 4WBNF 1QCDA 2O5RA 1V7ZA 1IK4A 1P7WA 2CLDX 2ZK7A 3PHLA 1Y3HA 2QOEA 4MUYA 4G8CA 3H18A 4WCFB 4B43A 1MOZA 4U7TB 1QIHA 2HMYB 1D1QA 3EZLA 1Q77A 1T4GA 2ZRDA 4DV1B 4TTRA 3COZA 1POXA 1A88A 2HQRA 1AM4D 1WY5A 1FPQA 5ALRA 5ALXA 2PBLA 5ED0A 1ESEA 5TJ9A 3GHYA 5TPWA 3NHSA 1ZEJA 2GBFA 2WSBA 4MCAA 4O2AF 4PBTA 1O89A 2R1TA 3FCXA 1G17A 3SX2A 5IJZA 4B3TB 4JX9A 1E9VA 3IJ5A 2ZS8A 2LD4A 3GXBA 4G1UC 3B9PA 2X8WA 3GBVA 3KTAA 1C3JA 3ZZNA 3U7GA 3LVQE 2QTGA 3CZAA 3EDYA 4HAXA 4ND5A 6REQB 1UEXC 4HQFA 1X9IA 5DZSA 3GLIE 1Y1KE 2G7MC 4FCWA 3FNRA 4FI3F 4Q1AA 4RKFA 5I7RA 1APBA 1G2QA 3SI7A 4DSTA 3TM4A 1YFKA 1VXRA 2PXHA 1M1XB 1SU4A 3JRNA 2VUSA 4AWXA 1JP7A 1VSVA 1O57A 4WK4B 2DTXA 2AUMA 4DUGD 2QRKA 3QUAA 3A7EA 3OWXA 3IESA 1RLJA 3P9CA 5DHUA 3HEBA 5LQCA 2XR1A 2AV6A 3FPAA 1Y0BA 3Q8MA 2W48A 5CXQA 1Z6AA 1Q3KA 3F98A 4P1ZA 1BFKA 5CFRA 2J08A 2JGRA 2I1QA 4LX0A 4YRLA 2BUAA 1D6MA 4AQDA 1IDN1 2RB5A 2V7VA 3WS7A 5KTKA 4GE0A 4REQB 4WDRA 5I4KA 1ZGBA 1PQ4A 1JZTA 4WK6A 1KZ6A 3NGMA 1N3BA 3V8MA 1FNMA 1ENZA 1YZFA 5ABPA 1AUVA 5DNYB 3LBFA 1PK9A 1AE1A 4CMBA 1EX6A 2R2AA 3TLEA 4BGIA 4ZVTA 1OTHA 2X9QA 4AP6A 3MCWA 5KVVA 1SVSA 2PD6A 4U2GA 5JHHB 5JU6A 3VKGA 4LTNA 3IEPA 3GLHB 4JBYA 3KLNA 2FN8A 2XKBA 1GCIA 5A9SB 1RBYA 5FHRA 2HT6A 2HLDA 3KSRA 4R8KA 4D80A 1BDJA 1FJXA 4RZ2A 3ONWA 2YZMA 5EWLA 2JH3A 4TLCA 4JBXA 1P4HA 1X77A 2IHKA 2MR5A 2OGTA 4U00A 1S2OA 4E46A 2CVPA 4ZJPA 1BTOA 3R9XA 2FEKA 5ESDA 3LXUX 3O9VA 3ON5A 4LBYA 4EIWA 1OWLA 2BGTA 2PRYA 1VBMA 3QFHA 2P9HA 4KR7A 3O3CA 3CF0A 3V4FA 1D0SA 2H4JA 4FPXA 4Y2YA 3FG9A 3W9UA 1SXGA 3OIWA 2BGLA 4Q9LA 5C5DA 2YVUA 1P3DA 3ZVLA 5ICGA 1EFPA 2BBSA 3HJHA 2WFMA 4DAEA 5B1IA 1EFUA 1GP2A 4FLFA 1NVGA 3WLIA 3UWSA 5ALEA 4Z9FA 1T8SA 3R6DA 2OZPA 4UUQA 5C8VA 3FUUA 4H7IA 4FZVA 4QXOA 3GC6A 4KPGA 4Y9DA 3RYFB 2BN4A 3LHKA 4YXFA 3AM5A 4JI5B 1USIA 3PR3A 3D54D 4YAWA 3NAQA 2W2LD 3DNFA 4YDHB 5L3RA 3RRZA 2NNLD 3UHAA 1BCSA 1E2JA 4ZZ2A 1U04A 4MYSA 3SP1A 3Q8XB 3KOYA 4AZSA 2WABA 3B2QA 3V1MA 4AL4A 3E2IA 4Y0NA 1G3QA 4DV0B 2GK4A 1UBKS 3B9BA 1XVLA 1K06A 2CL5A 3IX7A 2I54A 3ZEIA 1R4AA 2X0NA 3CWZA 3WADA 3CNNA 4BXOA 5SY9A 3TTVA 2GRAA 3BSFA 1XXHA 3IKJA 2O3JA 1KMQA 2JIZD 5BRNA 3ICWA 1RM5A 3K1JA 2EG5A 1QE0A 1N7GA 5LJLA 1B43A 5L3QB 3AOEA 1P1JA 3LWDA 4CEIA 1SD1A 2CV0A 4JZKA 4G24A 4IIFA 3QELB 4NQRA 4Y9SA 2Z57A 2LWIA 2DWPA 3W2HA 2YN4A 1RHRA 3KEMA 3UT5A 4B2YA 3K05A 3SNHA 5KWSA 4CEHB 4OV6B 1X3LA 1K6EA 1TC2A 4U2BA 4MOWA 5KAMA 4BMNA 4OJTA 1QP8A 3FNEA 1SC1A 4TL8A 5LB2A 4DLRA 4CIWA 1MAHA 5ALHA 4P7KA 3L0IB 1ABFA 3WIBA 2X3FA 4DJJA 2YYYA 4IQGA 3PFKA 2CJFA 4J0IA 4MSUA 2OCBA 3AF3A 3ICCA 3MJHA 4YRAA 5KHLB 4ER6A 4AJ2A