2Z5VA

Solution structure of the tir domain of human myd88
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
141
structure length
141
Chain Sequence
b'HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myeloid differentiation primary response protein MyD88
publication title Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 2z5vA01
1FYXA 1T3GA 4DOMA 4LQDA 1O77A 5H3CA 3OZIA 4FZ5A 4C6RA 3UB2A 1FYVA 1FYWA 2JS7A 3H16A 4LQCA 2Y92A 4W8GA 4LZPA 3UB4A 3UB3A 4C6TA 4C6TB 4W8HA 2J67A 4C6SA 4OM7A 5KU7A 3JRNA 2Z5VA 5FORA 2M1XA 4EO7A 4C7MA
chains in the Genus database with same CATH superfamily
5LM3A 3ZJTA 2MYTA 1MRZA 2B4AA 3PHCA 3SP1A 4BMOB 5GJBA 3L8ZA 3JAKB 1RI3A 2P7HA 1UBNA 4AICA 3KBBA 3GUUA 5LMCA 3QLVA 4WCVA 1FDTA 2BD0A 5J5CA 1ZINA 3DUWA 2A0KA 3VPDA 3L7MA 1P0CA 3OWXA 3AYXB 5DNAA 3OIVA 1R15A 1LDBA 5I7SA 1Z0JA 3IUJA 3L1KA 3E9QA 3IGFA 2FX2A 4IXTA 4EY6A 3ELDA 2C2WA 3UT5B 4FM9A 3R7DA 1GV0A 1HQYE 1T2VA 2OGZA 3B5IA 4L8LA 3VTZA 3PL5A 4E4TA 2HIGA 4PO9A 3QLTA 3RSQA 3PGXA 2BGLA 2B4KA 3OA2A 2Q27A 4D98A 3F1KA 1J8VA 3KOUA 4K6MA 1PLLA 1IM5A 4QQFA 2NSHA 3V8EA 1Y9DA 2C58A 3R2JA 1CVLA 4HD8A 1EMDA 1IL0A 4I1SA 4US0R 5DK6A 1Y3IA 1GA6A 1TF7A 4OQPA 2QN7A 1CUEA 1XDWA 5G4LA 4ILKA 3ROKA 4OBWA 1YE3A 3VKFA 4QXQA 2I3GA 2ZJAA 5DBHX 1E7MA 221PA 2H85A 3AEXA 3AH8A 4U2KA 4WA7A 2BGWA 5DBIA 3KU1A 4K46A 2HGZA 2J08A 1ECFA 2Q1WA 4C7BA 4EHDA 1OY1A 4LBWA 1RWVA 3HFGA 3K6SB 1NJ1A 2C7RA 4AX4A 4DCPA 3ZIUA 4RSRA 4AMZA 4X6UA 2VATA 3QHQA 4MS3B 3FGPA 1Y34E 4Q3KA 1P80A 4GI2A 3AWIA 3G13A 1FRZA 3A9CA 3BH6A 4JJZA 3WGOA 4X6YA 1M2NA 4EGJA 5KC8A 1IQPA 4KR3A 1UBHS 1JWBB 2EZ8A 2QTLA 1P33A 3IVMA 4WLNA 4WOCA 1NAIA 3WL8A 2AZXA 2W11A 1OQAA 1SAYA 3QYFA 4HEQA 5C5EA 5IYZA 1OILA 1YZQA 3H6KA 4UEKA 3AUKA 3BXEA 1KOGA 1Z4LA 4LZNA 1T43A 2CFIA 2CHVA 3C3CA 3N6XA 5BR4A 3GZJA 4Q9DA 3IAUA 2VA8A 5CLLA 5B30A 1HM5A 4TXNA 4BFYA 2ASVA 4P4LA 2INGX 1FXSA 4D0GA 2V96A 4M7RA 1U8UA 4IX9A 1RWOA 4QXOA 3ZWQA 3A1FA 1P2FA 1TO6A 4YWHA 4PLVA 3AM5A 5H59A 4MW9A 3U17A 3H0EA 4KEAA 3VR1A 1WSBA 3FYSA 5LYJF 4W6QA 4IYRA 2JJ2A 2QMQA 1WVGA 1LLDA 2O7SA 3F8SA 1FP2A 1LFDB 4TSFA 1IHUA 2BFPA 2LDXA 3FPAA 5AKIA 2D00A 5G2OA 1TMGE 1JQ5A 3I5UA 1USIA 4GZLA 4TKUB 3VU3A 5CB4F 2IBMA 1IJFA 3U3JA 2Y3IA 2AG1A 4BPRA 1ZGZA 3KB1A 2FMHA 4JZKA 1UBUS 5DWQA 2VYVD 4G9BA 4C0HA 2Y1CA 3FSRA 1D2RA 2ZUBA 3R41A 3EVCA 1IOVA 2C2HA 2ZJ7A 3AI2A 3OFKA 4HVAA 4TXHA 5EMMA 4MZDA 1R0YA 2HCJB 1VE9A 1CK4A 1E79A 1XELA 3QVGB 3R4CA 3IB6A 3LF2A 4RZUA 3B3AA 3HXKA 3NCTA 4XQGA 5DX0A 3IMEA 1JNYA 1ZMTA 3LFUA 3FNRA 4H9GA 4N7RA 3V1UA 4BFSA 1IG0A 1CRPA 2Q0HA 1GGJA 3MWFA 4X5OA 4F06A 4PSDA 1ZBDA 2ZTUA 3BMQB 2ZM5A 1Z4OA 2FFQA 3RJ9A 4O2BA 4XFJA 4TTTS 1CQZA 2HRBA 2J3IA 3GX1A 1KERA 4NR0A 4XZ3A 1H93A 1XHEA 3SS9X 5B3LA 3VVBA 3N2LA 5KCZA 4RAOA 4Q16A 4NC9A 3TYXA 1N6HA 3VGPA 1YJXA 4CKZA 3PK0A 4CFSA 1C3XA 5ESXA 1R9NA 2WFLB 2DR3A 1YJCA 4XYMA 1Q3KA 1UJ5A 1KMQA 1BQ4A 1SOUA 3JQAD 5FWXB 1ZOPA 2FR8C 4NFSA 5DT9A 4YEDA 5LYJB 1BOFA 3CVOA 1WXWA 2I9KA 2NYRA 4YROA 4EPRA 1M2HA 2IUYA 1I36A 4KUHA 1SBZA 5CB4B 5BNTA 3O74A 1Q15A 3HLYA 1QLJA 2J30A 1EK0A 4DVJA 1Q3TA 2XDYA 5ILQA 4D42A 1NUHA 1R4NA 3OD1A 2P4EA 3CVXA 1NX6A 3FNEA 5IEJA 1D4ZA 4BB9A 4W5RA 1VA5A 2LXNA 3KWMA 4JC0A 1RZ3A 2B36A 4IDAA 4LBVA 3BJEA 4CV0A 3DTVD 3ECSA 1NV9A 1V6AA 1EBBA 4MUIA 1B7GO 1MKYA 3TM5A 3PJDA 1SXQA 1J70A 1SVMA 4YBRA 3BWYA 5EJ2A 4CM8B 3FZQA 5BNWA 2CMDA 1Z34A 3D7SA 4NBVA 2AWOA 3PTZA 3RARA 1ZCJA 4IKPA 3ZQJA 2JCVA 3ZZ0A 5KMGA 3SLKA 5CBKA 1WB4A 2RONA 3CNHA 4XLTA 1GUAA 3ZV3A 4KPYA 4S1VA 3ZDRA 4QASA 4W99A 1IHPA 2P0EA 3LKDA 3VNUA 3BWCA 2Z08A 3NG1A 4EYKA 1TT7A 2KJQA 2WM2A 4PONA 4E5DA 3L49A 2FZLA 1WCV1 3GGOA 2QMEA 2PUHA 4FBMA 3W6UA 4EFKA 1M2VB 3H04A 1K6IA 3TVYA 4FHCA 5DT2A 3O4FA 4RTPA 2QR2A 1M8GA 3CG4A 3CTMA 4WADA 5DM4A 2R48A 4G5GA 1JZSA 1W8IA 4O3MA 1NOIA 1VMEA 3AONB 2HD4A 4FFOA 3ZZMA 1P2SA 4RM3A 1Y3AA 4YIKA 3U6KA 2VF5X 1R0ZA 2VAMA 4ZTBA 2OHVA 2RJOA 4RF5A 1FQKA 2G6BA 3BHJA 3VR5A 2NU9A 2J7KA 4Q01A 1N6OA 4X1YB 2BGIA 5DN9A 5I9NA 4JMPA 4EB6B 1WZ2A 5D1NA 3R5XA 1DKNA 2FE4A 1ENYA 5CG1A 2ZTSA 3FYCA 1M5UA 5A3QA 3UJHA 1SXJC 1H2FA 2QE7A 3OAAD 4FFMA 4P38A 2NSLA 4PCUA 3H9CA 3RUAA 3DM5A 3UOAB 5HKOA 1DRWA 1YCHA 5DGCA 3MTGA 1XR3A 2YZKA 1Z6XA 4J76A 4RKFA 4F5WA 2X6QA 1NMYA 3SS8A 4QNRA 5LB4A 5C1DA 4MKXA 2VHQA 3VH1A 4EFNA 3CVWA 2HLHA 2LRHA 2WWFA 4BYMA 4DDHA 4MW2A 3F0TA 3EPPA 3OOSA 4HWRA 2XXBA 3BERA 2Z04A 3IRUA 4INZA 1J5EB 3IMFA 2HK6A 2IITA 1PFKA 3TSOA 3LGAA 3ME5A 1A7KA 5EJEA 3RLIA 1LK7A 1LTQA 1EFKA 4GOKA 4ZRNA 5AVTA 3VAYA 3GLIA 1I24A 4OYLA 2QEQA 4DA7A 3E53A 1DKRA 1CV2A 2WF5A 4JB0A 3EX7C 3R0XA 1N7JA 1ISJA 3SF0A 3OZXA 2IEIA 1U0NA 4WECA 1R74A 1E3WB 1ZNXA 2AFIB 2X7XA 2XWQA 5FA5A 3F6RA 2EJTA 1H1TA 3C7DB 4F9GA 1RKXA 1B73A 1LXCA 1UMBB 2P3OA 2L42A 4MPRA 3PXEA 4U7FA 3ZUPA 2OOKA 2J9YB 4XGIA 4KBYA 2NUAA 2XCIA 1R6TA 1UFRA 1KMMA 4IX1A 3KSRA 4YJDA 4U2CA 4YP5A 4CKEB 1IUOA 1PS8A 1D6NA 1JLRA 1X0VA 2PR2A 1P2DA 2WUVA 3G79A 4NPAA 5FPTA 3SU8A 4CMAA 4BVJA 2JZNA 1HNZB 3EFOB 3F9CA 2QL6A 2XSZD 4F2HA 1WQ1R 3M9XA 3UWDA 2ZI6A 3ZJYA 1L6IA 2RGRA 3HK2A 1JVBA 1EDBA 4R2JA 3NDIA 1XJQA 3HJUA 2FFHA 1FSGA 3NONA 4JX8A 1HO3A 4GVXA 3FSEA 1NVVR 1U0FA 2J1LA 4U2FA 2I54A 5DMHA 1V1RB 1MB9A 1BS9A 3FCAA 4RFSA 4X45A 1MUUA 3WX0A 1R0RE 1Z13A 1UM9A 1FUIA 2JJQA 2WOJA 3M5PA 1G59A 3QFCA 3QVUA 4UAGA 3JQ8A 4IHAA 4IZHA 3GJ3A 4B3MB 1CUDA 3TB4A 2ZWVA 2VUIB 2AN3A 3T0GA 1C1XB 1PX2A 1EX9A 4WERA 3SMQA 3TNYA 4IWYA 1AKRA 2KS6A 3D6JA 3KELA 3JQCA 3KYCB 1W76A 1KO8A 4GQAA 2R0QC 3U60B 4IHKA 1BCRB 3R3ZA 3I9KA 1CP3A 5NLLA 5HKKD 3DEFA 3WRWA 3HC7A 1QPGA 2BI8A 2M9MA 5KPJA 3S2IA 3PEUA 5AOBA 2HSWA 4B75A 2I2WA 1EFPB 1Y3FE 2IZ6A 2VWPA 3NNNA 2OKGA 4MGEA 5IBPA 2V1UA 4KAFA 5HILA 4DN6A 3THWB 2FPKA 2IUSA 1GG9A 6NULA 3LUCA 4ALKA 1LCIA 5A4IS 3C43A 1SBNE 1ORVA 3L7JA 2E55A 4R1TA 4EX7A 4P98A 1MXHA 2PO5A 3EASA 3FB1A 4JLBA 3G1TA 1ES9A 1GHTA 3FVRA 1YS4A 3FCCA 1W5BA 2EP7A 2FWRA 3FA2A 4MKHA 4ZRDA 5IKPA 1UJ6A 1X8XA 2GRUA 4F45A 4OI2A 3M5DA 8OHMA 5DN6A 3K4QA 3CT6A 3M34A 3U3ZA 4FEAA 3EG9A 2Y9MB 4RADA 3L4BA 3WBFA 1CZUA 3KQPA 3C3JA 2VBGA 3MD9A 3SF8B 4FDAA 4KK3A 1ZD2P 2CLIB 5HOEA 2ZE6A 4WDRA 1JALA 2EJCA 1JFFB 1C9NA 1JZQA 3GGSA 3OJLA 4FEYA 1HYBA 4LXUA 2EWWA 4F92B 1ZVKA 1SUCA 5HIAA 3ZW8A 2D06A 3E3LA 4AWXA 5ALTA 1KE2A 1JVNA 4FHDA 2CYCA 3TOVA 1SUBA 2QF7A 1Y7PA 2GBCA 4I5IA 1WVMA 4MPTA 1M1NA 3CW2A 4DUPA 2VYND 5KVQA 2AYXA 4HDQB 4Q00A 2CXNA 4BX3A 4CQMB 1AS3A 5HP4A 4CUZA 4PVCA 3KJIA 4N3NA 3TJRA 4YAFA 4YFVA 5FI5A 4DW8A 4YP9A 3B3FA 1T15A 3IL2A 1EXDA 1JHUA 1O3YA 2G09A 1K4YA 2X2FA 2XVYA 2DFNA 3STTA 4C7KA 1CRLA 1U3GA 5KVCA 4E07A 4GXQA 5K9ZA 3LPAA 2HSJA 1EXWA 2FPLA 4YH1A 4TV8F 5IFLA 1OH5A 5HBRA 4KGVA 4KR9A 4F96A 1MO6A 2JLVA 3T7EA 1VKRA 2VBCA 3D3KA 3O94A 3C0KA 5SYAA 5KU1A 1PFGA 4GXRA 3WGTA 2V6IA 2AQHA 3E7DA 3W5AA 3ESRA 1KQFA 4JI2B 1G64A 2IOHA 3RROA 4PG8A 3IDAA 2CVPA 2Q45A 4LJAA 4LV5B 3VR6H 3WG9A 3WQBA 1KU0A 1XWFA 4FGSA 4QT4A 5BXQC 5EWLB 2GCIA 4JBIA 1MFPA 3QIAA 4JP2A 2F6RA 3C97A 4MI3A 4PNZA 4C0XA 1P19A 4UNIA 5KO2A 4RD3A 3C3MA 3IVRA 1I7PA 3QJ5A 1CY0A 4HKTA 1HC7A 2CFOA 3INTA 4CMHA 3PCRB 4Q9IA 1S4MA 4PLZA 2RKOA 3B8HA 2X3FA 4EYGA 2ZJYA 3UBMA 3E9YA 3UK1A 4UQLA 1N6NA 3BJMA 1BSVA 2AG0A 3NAGA 1NBHA 2G36A 2QR3A 3C6KA 4P80A 3V1NA 3GJ0A 4GYWA 4ZZ3A 1S01A 3O03A 3EB9A 2CZGA 3U4CA 2J5BA 1OLXA 3AKZA 2RC6A 5A7FA 4Q24A 1LKZA 2PKQO 3FCYA 5CFZA 4YACA 5LNK1 2CL6X 2HC9A 4K40A 3PDIB 1N34B 3E1GA 2GN8A 4MV4A 5BNIA 4DMCA 4HGNA 1X87A 2QTAA 1Z7EA 2FPRA 1UM8A 2WSBA 3BQNB 3HEMA 3IUNA 1T0PA 4IG9A 5G1NA 1QFSA 5JJKA 1V2HE 4CV3A 4EP1A 4HTFB 1GQYA 2QRPA 4FI3C 3PQFA 4G41A 4TV8B 2ODQA 5JD4A 2VDOB 2CCGA 2FEPA 3U31A 1EM8B 1R7RA 3KJEA 4PRYA 5K99A 1KYWA 2J0UA 2OO5A 2C92A 5EHXA 2QI9C 1UPBA 1E89A 3U9TA 3WYNA 4KSYA 3DWIA 4XGRA 1KAEA 4DILA 3AR3A 5KTMA 5IMBA 1JR2A 5EY5B 4MRAA 1KY3A 2NLOA 3F7TA 3PUKA 4M9XA 5AKZA 3ZI0A 4YY3B 2C8LA 1JDPA 2Q2NA 1T36B 3O90A 4JL6A 4HV4A 4OHBA 4RC9A 1SKMA 1MVLA 3O83A 3SLRA 1T26A 1SQ0A 4JJAA 1XTVA 5DNEA 3TJZA 5DXJA 5KJCA 3PFBA 3A3KA 4WBSA 1CUCA 3NZEA 4M7OA 2GVNA 1IONA 4H18A 2X6TA 1L1FA 3GWGA 4BNVA 4JL8A 4MRMA 4DADA 5COQA 1Q0PA 1UBSB 2J5RA 2GKSA 2KLBA 3I45A 2CC2A 3WLEA 4WZBA 4YXWA 1UUFA 2NTEA 3BD6A 3Q2IA 3T3EA 1TK9A 1RRCA 4BASA 3AV3A 3DKRA 2BZ0A 3B9BA 1Q3HA 2GBFA 3Q0TA 1WTCA 2WU1A 3KOYA 3QNWA 3B6IA 3P2KA 4NH4A 3IE1A 1TE2A 4ZT7A 5DNWA 3HU5A 5PGMA 3WMGA 1KDVA 4K6CA 5HE8A 1ZUD1 2BHSA 2FMKA 4ZZIA 1VL5A 3AP2A 1UIMA 2QIPA 3HBFA 4RWZA 2ZRHA 4C4PA 3R3HA 3ABRB 5K6TA 3ZHRA 3K0FA 3M6MD 1K9SA 5A5DA 3O7MA 2EBUA 4C3UA 3CSSA 3D3WB 1HYHA 3KOWA 2DPYA 5CGQB 3KPJA 2WT8A 3TUJC 1V5FA 1FPQA 2IW1A 4MROA 4Q4LA 4RVNA 4DR2B 3GQBB 5C34B 4KE6A 2X0DA 3T9CA 3MINA 3DQQA 1XQWA 4O0LA 2FPUA 5ULLA 4ZHQA 1DLIA 5GIOE 3P9PA 2WHPB 1AKYA 1X70A 3EVFA 1G63A 1N9KA 1PZFA 2J3KA 1R4ZA 4NZYA 4DJAA 2F4VB 3BAFA 3C3DA 2NZ2A 2XQKA 2PUBA 3LKZA 4H0CA 4ON9A 2POCA 5CA0A 5HZGA 4KACA 1LVUA 1QWOA 1DQSA 2IS2A 2ZRDA 3DBOB 2Z57A 1ZS9A 3OU7A 3PHJA 4QU0A 4EAQA 5KB3A 1CX9B 4ZO8A 1VJCA 2IYVA 3MELA 1CDZA 2VQEB 3LWNA 2G28A 2P3SA 1AZTA 3V4ZA 4RFVA 5E4YA 4D80A 2B9VA 2FCAA 1DKPA 3EF3A 4MR7A 4OKNA 1KS9A 4AN1A 4I1UA 4GO1A 2HWWA 3EGVA 1H22A 3QY9A 4GWLA 3EGEA 1WPXA 1KDZA 4BVKA 4NZNA 3T35A 5AHWA 4DUGA 1G8YA 5KYWA 2XKAA 4L2IB 5JMWA 1YHNA 5CNJA 4RHUA 2Z9CA 3G0OA 3MHPA 4OKIA 4H1WA 4IJMA 2KHZA 4CN8A 4PIMA 1XZFA 3AW8A 4U39A 4R2IA 1BXRB 2A4MA 2H5LA 3ZK9A 3KHKA 5KJ6A 1ZOLA 2W43A 3TE6A 1XEXB 2QG6A 4YJ3F 1KP9A 1UZLA 3AEZA 3IQEA 5H80A 1PEKE 5C32A 1CPYA 4D0LB 3BCHA 1X7HA 2YHSA 1USVA 1IUNA 3U26A 3ZLTA 1KHTA 2VOJA 4YCJA 3DYBA 1W5TA 5G4KB 2AH5A 4I2VA 5AKHA 5F77A 1KTVA 2OBYA 3PNYA 4HOYA 5FPHA 4B8YA 2OBNA 1DS6A 1GPH1 4PR0A 4EKDA 1XCOA 2LIPA 3Q2OA 3B85A 4MI9A 1W35A 4DGQA 2O0JA 2XECA 3D8UA 4KAXA 3WV4A 2JVIA 5FBVB 2MR5A 4BE9A 4LRWA 3HG7A 1OWPA 3H4IA 2AHOA 4LIPD 4V1CI 5C7YA 5DTIA 3Q41A 1QH1A 2CNDA 1K7YA 2GHRA 2PX8A 1OBCA 2XT0A 3ZY5A 4CG3A 5E6SA 4RE6A 1RE0A 2ZCVA 4B0OA 1RBQA 1GFIA 3EZXA 4KOEC 4YCCA 2YH2A 4LF5B 3PD7A 1E6WA 1OT5A 3BKXA 4GBED 3R7LA 4CYMA 4AZTA 1N2CE 3D81A 1IY9A 4HAZA 3U44B 3K72B 2H7XA 2QQ0A 1ZL2A 2BDUA 4HQ6A 2BTOA 2O5EA 2OG2A 3I6IA 3LH5A 2P35A 1BFKA 1TU3A 1JA9A 3L07A 3O26A 2YVQA 4OYRA 4CKBA 4ZJUA 4CF3A 1XAJA 4QG3A 4OI4A 2C5EA 1HT0A 1KVRA 4DQVA 4YJ3B 1ISPA 4P33A 3ZBTA 1EWYA 2BF7A 2SHKA 2VCEA 1LS6A 3DG9A 1IJEA 4WX2B 3RFTA 5C1OA 3L6UA 3C5HA 1SVNA 1XT6A 3M6XA 3R8CA 2BFFA 2WIAA 2HYDA 4C03A 8ABPA 1QRUA 2NO7A 4GM1A 3UBTA 2I22A 1RIFA 1QB7A 1OR8A 1GNQA 2V4ZA 4J16A 2A3NA 2GK6A 4ZC1A 2ZITA 2H2IA 1TQHA 3H87A 1WLYA 4JASB 3HZRA 4WCFB 3CM0A 4IXWA 1SBCA 1SA0A 1ZRNA 3BXFA 2BSQA 4CLHA 3SCZA 4DWWA 1XDDA 3MXTA 1VCIA 1G1MA 3FFTA 4R81A 4W1RA 3TSZA 4MO9A 2YYYA 4YRIA 4I55A 4Z4QA 2C9ZA 2PLWA 3ZKAA 3OFND 3X1DA 3E8MA 3S7ZA 3O4GA 1KZGB 2J09A 4CWAA 1UDRA 4WW0A 2I7TA 1A82A 3R0JA 2PE5A 3FFAA 1QP8A 4KN8A 4A03A 5LIRA 4YT4A 4AS1A 3ZXUB 1JW9B 4GBMA 4ID9A 4TQGA 4YGYA 3A06A 3B9PA 5KQRA 3T5GA 5JZVA 2E18A 5KWIA 4WESB 3AMVA 2JGDA 3BGVA 2BBOA 3AFMA 2BBSA 2BR5A 2JGNA 5DBGA 3OQJA 5EI5A 2ONCA 5CX1A 3LUJA 4DQLA 4EMUA 1VCHA 2ZBRA 3D02A 3LYHA 3HLTA 5J3JA 2QX7A 3OPXA 3UB3A 2O59A 2FW7A 1P60A 1WQ4A 1JHVA 2LV8A 4JX9A 4LDJA 4PXYA 2B94A 1WQ3A 2KM1A 4CCSA 1MFZA 3KKKA 1U1EA 2R1UA 3KVYA 5J4LA 2HREA 2Z6VA 5K0SA 2HNKA 4V3CA 3FHLA 4GI5A 4DFDA 1AUXA 4KIJA 4FI3F 3KQTA 4NP6A 3AR8A 2XD4A 3FCSB 4CLOB 4L1KA 1F8FA 2OCGA 4P32A 4FMDF 2Q3DA 1F4PA 3NM4A 1Z2PX 1QRRA 2CK3D 4ER7A 5HS4A 2YFYA 2AJLI 2NXWA 3HV0A 2PRZA 3OLXA 4H4EA 5EP2A 2JBHA 3B3JA 3U4HA 3F5MA 3LC7O 5L6MB 4Q15A 1XNQB 2VJOA 4QBGB 2ZVJA 5J2UB 5LP6A 3V8QA 1BHJA 3ZWNA 2X76A 2QLFA 3M6FA 1RHQA 4AJHA 3O2JA 4YRRA 4F71A 4DMGA 3GEBA 1FP1D 1PTJA 5DHAA 4XW2A 2WILA 5ALZA 3S3TA 1UJNA 2PMEA 1IVNA 4TKUA 1VLJA 3R1IA 3ZD7A 3FBWA 3SM3A 2WC1A 1N6PA 3BQ9A 4G5XA 4YGXB 1BXGB 3AEYA 1GDHA 2I4TA 2IPXA 2SKEA 3H11B 4CF4A 4L4RA 4RMJA 3MAAC 3SYTA 3PUJA 1YBFA 4KXFB 2AHRA 4TS1A 1M2WA 3RS5A 2HA6A 5CJPA 1EYZA 2J07A 2O0HA 3FTEA 3WL4A 4ALNA 1Y37A 1Q0SA 1EVKA 1DC6A 2OFXA 1DBIA 3H5TA 2P79A 2ZUTA 5LA6A 1NXOA 4AN4A 1KPIA 4ZVUA 4ND4A 4J1TC 5D87A 4DJDC 1P44A 1XXHB 1Z18A 3L01A 3LDGA 4GSYA 4KIWA 3VPCA 1TQ8A 5DM70 1QGED 3BMQA 3BRSA 1NXWA 3U81A 4V1CB 3CLKA 2AD5A 4GVPA 3W5HA 1U7UA 1RJ9B 3UEOA 4BFWA 1L7DA 1S8OA 4PHCA 1N4AA 3PNVA 5A03A 4FMDB 4TT3A 1JPNA 1L6RA 1QIMA 1U6JA 1W85B 4MUGA 2HAEA 3ELBA 3GWZA 2IBSA 1X8JA 1TUEA 1Z6TA 4MVJP 4QX6A 1K88A 5F7XA 3MD0A 2QX8A 3G8YA 4B2LA 1WUTA 1WZNA 1IHOA 3I9OA 4BNFA 4CUJA 2FU5C 2IIVA 2NZ8A 4FSHA 4B2IA 4HGYA 4PGFA 3CF0A 1DJQA 3B82A 3OOJA 4LECA 3OQIB 5ALRA 1WRBA 3ASYA 3QYJA 5CDUA 5TMBA 3HE3A 4JVNA 1Y5RA 1XHFA 1JG4A 4Q3NA 1P9OA 2OPBA 3LBHA 3VNRA 2XDAA 3WMWA 1AX9A 4QYTA 3NRCA 1ZR2A 4EL5A 1XTZA 4DSTA 2PDAA 5BQ3A 3B12A 2JD0A 1YACA 4B6OA 4PN7A 4P22A 3BKWA 2J7PD 3Q1LA 3RYCA 2R6ZA 3IP8A 2OD9A 1KYQA 3OLVA 3L8GA 5FO1A 1JS1X 1G8MA 1V5EA 1G8SA 1VM6A 2BEWA 4W1SA 2HZ7A 4PAGA 4RLQA 2YHIA 4BDTA 4EFDA 4X64B 1KHHA 2EFGA 2J5KA 2QYSA 1F9EA 2Q5LA 5FLEX 2I3ZA 2GJKA 2GZ1A 2RB4A 2IF0A 3VC2A 1XZMA 3EGOA 2IYUA 1UDAA 3G88A 3UJ3X 3ZTYA 3FUWA 4C29A 3ECCA 4ETMA 1A69A 3COYA 4RO0A 3KAJA 1BQ3A 2XRFA 2SICE 3ONNA 4M8NE 5HTKA 3WXMA 3IT1A 5CW2A 3TJMA 3RIYA 4MRPA 3UH0A 3VHXB 1FA9A 3WWZA 5B3JC 4TLMB 1QGDA 3HJRA 1MAAA 3JAWA 4FEEA 4AB1A 4CF7A 2GCOB 4C87A 5M29A 4PYMA 3CKMA 4TUYA 1QV6A 4ATNA 3E7PA 4U6QA 3S55A 1GA4A 2I33A 2JLRA 3I4CA 1QDLB 3K9BA 2XNCA 1SKAA 3PFFA 2R87A 3A6GA 2Q4BA 3SC2B 5JPCA 5KOYA 4I4NA 3I5XA 1P9NA 1YDFA 3PFWO 2ID9A 4HDNA 3DCNA 5J5AA 3SIPA 3ZTWA 3A1UA 1G8HA 3HJAA 1X7XA 1PSWA 1Q1QA 3NC4A 3ZE7A 3T1NA 5AVQA 2X2OA 4F8JA 4PZLA 2FETA 1MW8X 13PKA 5ICEA 1V8BA 5IKOA 5EE0A 1GVHA 2ECQA 3PQEA 2Z4RA 2NYAA 3JRNA 1J09A 1CUFA 1T6YA 2NO6A 4FXPA 1YVRA 4QPZA 3WRYC 3ZY3A 1QAQA 2CCJA 2WEKA 3KPUA 3MGKA 4LRQA 4NABA 3T38A 4EB6A 4CT5A 5J4YA 3FF1A 1UK6A 2HOQA 2P6RA 5ALNA 1QZ3A 3FMIA 1N9GA 4GPD1 1ESNA 2REQB 3W3AD 1K27A 4O8ZA 4EW1A 3COWA 4D3DA 2C54A 1G18A 5J4HA 1BMDA 1OKKD 3BIWA 1L5YA 3E9MA 4I6JA 3H5RA 3CE9A 4YALA 2FEOA 3TPFA 2O7NA 3IXLA 4B45A 3OEWA 5KJ1A 2W6ID 3FW1A 3ROGA 4YAUA 1QZUA 4IJVA 2V97A 4GGOA 4N6NA 3B6JA 1U0LA 4RTNA 3KXPA 4Y2GA 5F64A 2RHDA 5KKAA 2IKQA 1YV9A 2FKAA 4N12A 1J8FA 1HMPA 2BGKA 2XQJA 2Y99A 1O94D 3N87A 1ENOA 1M33A 2P1ZA 2XZTA 3R24A 2WKQA 2IHVA 1C3VA 1DX9A 1HZJA 3LQ2A 1E2IA 3MERA 4CE6A 3MTBA 4G84A 5JWOA 3OHSX 1JNXX 1Q19A 4QDKA 4CV1A 1USUA 4DG8A 2AGVA 1G17A 3CSUA 3N0VA 2VYCA 4Q9KA 1XTQA 4AECA 3ROFA 1EEXB 4LVUA 2YXBA 5ECGC 4ZCPA 1HFWA 4HDRA 1N2ZA 4OMUA 1V41E 2I2CA 1KGSA 4DHWA 2GX6A 1BROA 1Q0ZA 4C0JA 1ADYA 2AFIA 5AUNB 3D0QA 1QUFA 4TV9B 4X94A 4L73A 4BTEA 2DR2A 1OBOA 4W5OA 1E5TA 3IBTA 3PKIA 2CDRA 4G23A 4NEHB 3RQSA 1UMBA 1FUUA 4GLJA 3QVLA 2UXCB 1WHSB 1DKOA 3DVRX 1RXSA 2V5UA 1OI3A 4M0KA 3SI7A 2H4YA 3KD2A 2HJWA 2X19A 2QNBA 3DM9B 4ND6A 3L7YA 3ORHA 4DAOA 4TWRA 4NH0A 3EFOA 4KI0A 3OCCA 4F5DA 3DBIA 5EZQA 1C7EA 2Q3BA 3NJRA 3ZQUA 3A2MA 1WJGA 2GEBA 3LLVA 5TPWB 4WNAA 1JHMA 1V1RA 2BGMA 1JEAA 3QRWA 4E11A 1Z5NA 5C2JB 2IDZA 2LGJA 1NKSA 2AXQA 3PE6A 2FMTA 3Q10A 4ZO4A 2I3AA 3QE4A 4NL4H 3HDHA 4MYRA 3CH5A 1EZ4A 5D3QA 1G2IA 5TMDA 4KPGA 2FEXA 1A9OA 3KZKA 3VRHA 4WXHA 2AT1A 5JXHA 4LCBA 5KU7A 3BL8A 1G5FA 1NVWQ 3N2IA 1MO5A 3R77A 2C20A 4G4GA 4LRTB 3WK6A 4E33A 3I23A 1INLA 1P0PA 3BRWA 2V7WA 2VPYA 3PGMA 4RVFA 3ZHOA 4P35A 4EKNB 3IQWA 3O4RA 1PDWA 4UCWA 3GFPA 4ZQIA 3HO1A 5HCIA 5KHLB 1QYDA 4ZYWA 1L5HB 4PLHA 2WM9B 2E4ZA 1U5CA 5BMOA 4EI8A 2WHRA 5TPZD 4R6WA 2JD1A 3B1YA 2PT6A 4RVDA 1Y42X 4ZANA 2Y1OA 4AD8A 4BQFA 5KSPA 3UPDA 1UEXC 1NJFA 1OZ0A 2AMVA 4KZPA 4PQRA 5F4BA 4ABYA 2ODTX 1DQRA 3QVTA 4EG8A 2YWCA 3L6DA 4HNGA 3ANXA 1ADBA 1JIKA 2CVZA 2C04A 2JIZD 3QWHA 4IEIA 2REBA 3LS2A 1BFDA 1NYLA 1QPBA 4QIHA 5E9QA 4ZYXA 2PUTA 4YX9A 3AGQA 4G0NA 1PAUA 3VV3A 1L9KA 2DUUA 1BS1A 2GZ3A 3KR0A 1VYUA 4Y9TA 2ZUVA 1HE2A 1IHYA 1BEUB 2H1OA 3EVDA 1NYQA 5JEEA 3DDOA 1SXHA 3NIBA 3PRJA 5H16A 1WBBA 5JCZA 4LV6A 3COPA 4JLVA 2OL4A 4JIMA 2BAGA 3AYZB 4B87A 3THXA 1XG5A 4ACBA 1V1MB 4YMIA 1ISHA 2YJTD 3W1WA 2ZANA 1U02A 2PA0A 1XDZA 1JI0A 1IE3A 4X8HA 2X0RA 1X9GA 2ZJOA 4R5HA 3NORA 4V2UA 3PQ2A 3ZE9A 2J0QA 3AI7A 4PO3X 1IEXA 4OXNA 1KO7A 1ZXLA 2R25B 3ORSA 1CY7A 3QUTA 4DJEC 4F93B 3LKBA 5EVJA 4PLCA 2XCOA 3TXYA 1AMOA 2FRDC 2NNWB 2W98A 2CEAA 1DC5A 1X15A 2DF8A 3LX6A 4D97A 1L3BA 2VHYA 2Y2VA 3QX7A 4BQRA 1HDGO 4RK1A 2O2CA 4COOA 3KUDA 3T7SA 3SYMA 3OQMA 2Q7OE 2Z2IA 1YBHA 4FGUA 2WAXA 1O9HA 4EPXA 2KB0A 2JPDA 5AM4A 4XQ0A 4EGFA 2IHBA 2RK4A 2X8BA 1LI4A 3PF8A 2J0SA 3MA0A 3AW9A 5EWMB 5F7OA 2IYWA 2QN9A 2YWRA 4PAOA 3PT9A 3O31A 4HFNA 4HXGA 1EKXA 4D96A 2QJOA 3B1ZA 4L5YA 1SRRA 2QV0A 5DOVA 4DMFA 4EUKA 3IJ5A 4KRYA 4E30A 1C9DB 1X13A 3I52A 1RLIA 1VSTA 3MGBA 3N0RA 1PX0A 2V7PA 1XCBA 2Q0XA 5BWCA 2JLQA 1DG9A 2C9YA 2Q49A 1KWGA 2XWJI 5KOIA 4H16A 3RK0A 5AYVA 3IUPA 1HMYA 3ZWWA 4MLCA 3SHOA 3VTKA 1N6LA 4OB8A 3V46A 4Y7DA 3VJLA 2Z5LA 3F3YA 5EIWA 1ZZGA 1NF3A 1NW3A 4GD3Q 1QV7A 3MAGA 5AW1A 3PD0A 3PDIA 2XIJA 2CT8A 1CVIA 2YVKA 2ZBDA 3A2LA 3DFFA 2FR8A 1H6AA 2W6OA 1OLUB 4XR9A 2WJGA 1R12A 5FP0A 1AXRA 2Q7DA 4BKMA 2P2YA 4LISA 1WPRA 4DABA 4ZIRB 4LFAB 3NC1C 4OP1A 1OGIA 2WSMA 3H5WA 4UUMA 4Y0NA 3TRFA 5T41A 2W83A 2O5VA 1RZRD 3G6WA 3QYPA 4M6WB 7YASA 3CQ9A 4OA8A 3C6ZA 5JTTA 1ZCAA 1L7BA 2D4HA 1Y8QB 4JBHA 1YL6A 3WJ1A 3SQWA 4BWGA 1JG7A 5BQPA 1I6KA 5AIBA 1GILA 3RS3A 5I7HA 1CZLA 5JSQA 3NM5A 1RWMA 4ZCIA 2CVQA 1F7UA 3BCUA 1RI2A 3ISTA 1ZESA 3IE0A 1POWA 3TPZA 3G68A 3Q3VA 4MS4A 5REQB 3EW7A 5LQKA 3BICA 2EX4A 4LHSA 4A16A 4RIHA 3VZSA 1WPGA 1Y5LA 1E4YA 3V8BA 4Q9AA 3TRJA 1T8PA 2AKAB 4PANA 1L4GA 1NPYA 1VA4A 2HJVA 3LHKA 3K6RA 1RHMA 3GRAA 2BM9A 2H9IA 4FU0A 1G3IA 3ZCRA 4DANA 2AN4A 3EQ2A 1MD9A 1PZEA 2RGWA 3E05A 3WYFA 4KL8S 2GR9A 2WJ3A 5D3KA 2DHQA 1HDRA 2XIQA 3RVDA 3VOSA 4JSYA 3SKYA 3FUUA 3JARA 3TLKA 1L4YA 4G4SP 4KGXA 4GPAA 2BUAA 4S2EA 2PQ6A 2B34A 4RYDA 4YBZA 1G5QA 1E3LA 4M8IA 2ZR8A 1ZSNA 2QMOA 2YVLA 3FLBA 3PFCA 4I08A 2ZBEA 4IZIA 1TF5A 1H1LA 3A6JA 4MQBA 4C14A 4HNAA 2QXTA 2NNLD 3UC9A 2GLTA 4B40A 4MR8A 5I7OA 1HETA 4BUZA 1IFXA 5MF6A 1GZUA 3G2IA 5BV8A 1G8KA 4DC0A 5L4NA 2RHBA 3FVWA 4AP5A 5DWDA 4UPEA 4S24A 2EU8A 1L7AA 4KXWA 4KDFA 1QDEA 1TX4B 3GVIA 3OM9A 2ZIEA 1SRQA 2F64A 1MT3A 1BMQA 2QLMA 2WWWA 4KGZA 2O2YA 1WKBA 1UAAA 3ZBUA 4AVYA 1DT5A 4EUEA 1BVUA 1JIVA 4QE3A 3KQUA 1SXJA 3JVVA 4BUJA 1O97C 4XX1A 1CUZA 4U7GA 4YRZA 2IXTA 2YXDA 4YMGA 5H9WA 4WKGA 1N1GA 4YPVA 1V11B 4U4AA 5K03A 2BEUA 4FZ3A 3WAGA 5F3WB 4FNGA 2R7LA 4F9TA 3KOOA 3BMNB 3W8RA 4P3NA 1SVUA 4XYGA 3JX9A 1M54A 4N3GA 1P74A 3K1AA 2ZJ0A 3LLMA 3KQNA 5A71A 2QW0X 1KI1A 3IH5A 3LQRA 4Q3CA 4BFVA 4EO9A 4F84A 2Y0EA 3B6EA 4MXDA 5AICA 4PFKA 1XZPA 4RVCA 4NZ9A 2J3MA 1IEVA 5FPQA 4MUHA 3OA0A 5KSYA 1WCIB 3DEZA 1XEAA 3GJQA 4ZVNA 721PA 4RHTA 1F5NA 3MJ4A 3A3NA 4Q1AA 2FUG6 1X80A 1IOZA 5KNDH 1CE8B 1QXSA 1EWKA 3AHJA 3OY2A 2WMOB 3DOUA 4ZVMA 4CL2A 4XA8A 5HGJA 4G8DA 1N2XA 5K0NA 2WJPA 4MTCA 2ZI5A 4JLPA 4N7JA 2ZATA 2FUG1 2OXFA 2HU2A 1QGOA 3G49A 2FXIA 4I6GA 2HIAA 4AO7A 4XOUA 3LBYA 4FX2A 1ESMA 2WINI 3P5SA 2HF8A 1W36B 1Y6JA 2V74B 1KXZA 4UQPA 2IXEA 5DTRA 4YQYA 4EI9A 5CFPA 1JXQA 1U04A 1XTPA 4RY9A 1ZQ1A 2X58A 5A4FS 5IFKA 621PA 2K2QB 3F49S 1U2DC 3K2BA 4BLQA 1GWNA 2YWEA 3LUHA 4I0WB 4MUNA 5G0SA 1C1YA 3DF9A 4AWBA 3CISA 3CLHA 4DZTA 3WO0A 4RDXA 3AIKA 3L7CA 3CJRA 4H17A 1CXZA 2ANBA 2X5NA 3FYUC 5KJFA 4DMLA 3C85A 4LX0A 2ZJ5A 5EXDA 3K05A 2HW8A 4WA8A 1AF4A 4ZV7A 1B8OA 3IPAA 4XR4A 4EHNA 3MPOA 4BE4A 4INOA 3M4ZA 3HYSA 2FZ5A 1X7YB 3TZEA 4W7SA 3L6BA 4OGFA 4F8YA 5E6UB 4LYAA 3TDKA 3LQFA 3GH1A 4WLEA 4ILEA 4CKCA 1I4LD 3RVLA 2I6SA 4JLJA 1JU4A 1S5PA 1IHDA 2VYQA 3A37A 3DXXA 3HGMA 3W9UA 3LRXA 1ENZA 4G0ZA 4ZAXA 4YQZA 3GDOA 2PX6A 4NYMR 3IAM6 3ZCQA 2QORA 1EE1A 1L4NA 3S44A 4BAZA 3CVYA 1C1HA 2A0UA 2FLWA 2FSIA 3WSWA 3ULKA 4E08A 4ER5A 4HGRA 4JB2A 1EP2B 5KTRA 2VAWA 2E6UX 3TX2A 5I4KA 5JH7A 1AC5A 2VH2A 3ZU4A 5I47A 2G4VA 1S8FA 1W46A 4FOTA 1WMBA 3KKQA 1LY1A 1U8XX 2B98A 2FPSA 2F3SA 4MYUA 3ZWPA 2AUNA 2ZAGA 7MHTA 3EVGA 3Q8WA 3LVRE 5TE9A 3W2FA 2VC2B 5L3SA 4N5LA 1XCLA 1N0IA 5M04A 1DAHA 1GUFA 3IP5A 1T5BA 4ENTA 1VFPA 3LBFA 4ARCA 1U0EA 1F2VA 2HEGA 1I7NA 1LK0A 3C6YA 2EBFX 2HHAA 3H0KA 1V16B 3HVUA 3OUUA 5HDQA 3RGWS 5CLJA 5C52B 4HVLA 2YR0A 1Z2EA 3ANSA 4LYFA 4CF6A 3O8DA 4MR9A 5SZHB 1KMCA 1PYDA 2O5CA 4U7JA 2JFGA 4AW9A 2Q6KA 1GT6A 1IIRA 1NFRA 4AMBA 2B92A 4UPVA 5IABA 3VA7A 4UOEA 3I39X 3AHEA 3NASA 4HPWA 1SHJA 1Z08A 3KKMA 4RJLA 4XAQA 5HFJA 1JAXA 3LF1A 2H52A 3BIJA 5FFFA 4DV3B 3AUJB 1EDOA 1V25A 1U28C 2QU7A 4EA9A 5IVPA 3HCDA 4ZT2A 3N2GB 4J1SA 3R75A 3VPXA 5IHXA 1NXPA 4OFBA 5JQGF 1RKVA 2D1SA 2P2CA 3CX3A 3FVTA 2J6IA 5DNYB 4WWHA 2NW6A 3HEBA 1D2GA 2OLKA 1HH4A 5FYQA 3ORRA 3CJQA 3ESZA 1YB1A 3QVVA 3FKQA 4NX2A 4PLFA 1YFZA 1T1GA 2PVSA 3FVQA 2O3QA 4FE4A 3R7WB 4YJ2A 1HE3A 3HUUA 3NI2A 3FMPB 2QZ4A 4XX0A 1N92A 2B99A 3CPEA 3ZU3A 4BO1A 3KR9A 2GAIA 2EARA 4UBLA 4LE2A 2ZTVA 2QRVB 3GVCA 2WDPA 4KCGA 4YRFA 3IIEA 3EZ7A 2HXYA 4X8OA 2WTMA 4WN3A 3EMKA 4TKLA 4X97A 5FR2A 4Z1MD 1UH5A 2BLNA 2QYHA 3UYLA 3T0IA 1JJBA 5INTA 4EG1A 1V26A 3ESDA 1D0VA 1UC8A 2VQFB 1E2DA 4LVNA 3ICWA 1J8QA 1H66A 1K7CA 4BS9A 1K97A 2QTRA 1JLLA 3GJ6A 2DSNA 4U9UA 1J42A 1Y1SA 1QC5A 2R1VA 1TTQB 3G9ZA 3HI6A 4U8HA 4F4CA 1I1QB 4RQBA 1LRLA 2VDWA 2UZ1B 3UTCA 4UUPA 2EQ5A 2GKOA 4FIZA 2QPOA 3INGA 5AM3A 3WLQA 2AKYA 1TUIA 4U9IS 4ZJYA 1Y5IA 5JE8A 2W6JD 2JH9A 2IHJA 5JWHA 5LBTA 1K8RA 3KJFA 3KKPA 3O3OB 3TR0A 2F59A 5E9JA 1ZLXA 2NSJA 3EZNA 1CP2A 2ZP1A 4IV5A 4R1UA 3SN6A 1GNLA 2F17A 3RD5A 1NQVA 5ES4B 3ZW9A 5AT1A 1IOWA 4J2TA 3FCUB 4MEBA 4LY3A 5CHYA 3JQQA 3GUYA 5DX8A 3T7AA 1CNFA 4BUCA 4U7TB 1AUOA 5JCJD 3QEAZ 1EVJA 1PZHA 2CLLB 4G1VA 2BTQA 1LC3A 2CVHA 4O4JA 5CB6A 5FBWB 4L9AA 3JWPA 2OHGA 1GL9B 1JDZA 4B81A 5A4JA 3PRKE 3C3BA 4J7UA 5IKXA 2VTVA 3F46A 2P30A 4NCAA 1GV1A 3AESB 3NAMA 3CUVA 1SUDA 3FDJA 1ZCFA 4PC6A 4WZAA 1Z06A 4DDMA 3SQXA 4GYKA 1US8A 4DYVA 4Z4GA 4S0XA 3QTLA 2VJMB 3C24A 1T6NA 3I9V1 2ZWAA 4L0CA 2JH3A 3NT5A 2IDMA 4HGZA 4C06A 1X1AA 4JI8B 2Z5GA 3I53A 2QRKA 2XA1A 4HRYA 3IESA 4UE6A 4F91B 4FS3A 4PPQA 1LBEA 2FW0A 3N2ZB 4XJVA 4P36A 3G0CA 1IRIA 1BGXT 2QUBA 2JZCA 4ZQEA 5J2TF 3L1HA 4ASUD 3OQIA 1YU6A 2EKBA 4DCUA 2I4LA 2BW0A 5BSEA 1XIVA 1ACMA 1VLLA 2DRIA 2QA5A 4IGKA 5AHKA 1FEZA 5EXEA 4NJMB 4RIFA 2QGFA 1BRTA 2IXGA 2WIKA 2XUQA 3G1WA 3KDAA 4I4TF 4JYBA 4ROTA 4YCDA 3NDBB 2XV1A 5H4GA 3ZZ1A 4YO8A 4ZVTA 4DY6A 1XZHA 1MIOA 3ETHA 1WY7A 4MQLA 2P27A 2QM8A 4R1MA 3TS1A 4KYVA 2GBPA 1DC8A 3PITA 1OFTA 3QVKA 2O7RA 1K2VN 2ZZMA 2RGCA 3IURA 3QLEA 4X20A 3MC1A 4X90A 4L8GA 2HO4A 3ZLBA 1WW2A 2AR7A 4IMRA 5JATA 3RREA 4AKGA 3ZNNA 2CLCX 3SXJA 3N2KB 1GU0A 1SPBS 2FQQA 1E98A 1M6VA 2V8BA 2W2LD 3PNQA 3FJOA 2R47A 4PR3A 3QF7A 3RYFA 6YASA 5EYPA 4QOHA 2PUEA 3QWIA 3H19A 5IAKA 1Z6AA 3G89A 2Q3FA 3URKA 1M5TA 2XEDA 3JR3A 5HIJA 4N41A 2PXHA 4QRHA 1CG6A 2WJVA 4WXYB 1RJGA 4A15A 1UCFA 4UATA 3P0FA 4E12A 4N5HX 2Z6AA 3R7NA 2QRMA 3C14C 2GHTA 5JSHA 4GLFA 3G0BA 1NG1A 1TW2A 3FN4A 4IM7A 3AEUB 4K9DA 4AJ9A 4DJFC 5J9FA 3BEOA 1XNGA 2Y67A 2MSCB 1CVRA 3OFVA 3HUFA 2ZUWA 4OK6A 4KR0A 2Q6LA 4XWOA 5JC1A 3DHNA 2NXJA 4QUDA 1THZA 4EO4A 3CLTD 5J2TB 3T7JA 2R96A 5EZSA 4DA9A 1KXJA 5JNUA 2XE8A 4QTTB 1EIWA 4N8SA 2VFAA 3R3WA 4X6LA 4JU9A 2QRJA 4CMBA 4I4TB 5HUQA 3CZQA 5TVGA 2WPNA 1WF3A 2UKDA 1MT0A 1QTNA 4JC5A 3DOCA 3TLGA 1ZC3A 1QIIA 3ACBA 4OQNA 2PFKA 1H8HA 2MSWA 1XK7A 2HMWA 3L7OA 2IL1A 4RS4A 4FILA 2LCIA 3UUFA 4CTKA 4JLWA 2WF8A 2XUGA 4HK4A 1E9RA 5EUQB 1VQ1A 1PDOA 2YFKA 2REQA 1LVGA 5DYYA 1PFQA 5GQSA 1TUBA 5KWSA 4OSOA 3ZGNA 1X0XA 5F9MA 1EVLA 3AXTA 5JD3A 1PJTA 1OH7A 1K66A 1EAYA 1M7BA 4AL4A 5F2NA 1NHGA 1NNI1 4PZ9A 3EIFA 4WH0A 4TS9A 4O2AF 4PQFA 2DQ4A 4BFXA 4MV3A 3R40A 4GKAA 3FOZA 1F3OA 3FH0A 2RAFA 4LCJA 2AFHE 4XASA 3ANYB 3U4QB 4OSPA 1Z4QA 3LY7A 3O21A 3WGVA 2A88A 4PAQA 3EXFA 5ALVA 5K2OA 3AHFA 3OE1A 1RXIA 2IYYA 1YRHA 3CKKA 4TVSA 1G19A 2DKFA 1N77A 3I76A 3MMSA 1OV6A 3QKTA 2YKGA 2NP6A 3L1VA 2XAUA 4KTTE 5SZIA 4DLAA 1V48A 1U63A 2QD1A 1B0AA 4R0MA 3NNDA 3AB3A 4P0TA 1SCBA 4TRRA 4BNIA 5CHEA 2VJDA 1LBTA 1QO9A 3ER8A 3BSFA 2V9ZA 3HBLA 3PFKA 4HVCA 1Y63A 4XPZA 5G0TA 2E82A 2RHHA 3IULA 4R9VA 5KSOA 2O9JA 1VJGA 1KOLA 3DF7A 3IQFA 4QUHA 3SJBA 2BGRA 1EG2A 1GCIA 3Q72A 4DSNA 2HLPA 4RTRA 4LRXA 1Z2NX 1YDGA 4MV1A 2A9OA 2FQYA 4WPGA 3H84A 2R8OA 1YQQA 2VNAA 2XCLA 1KE1A 5B2FA 2FVYA 4CMIB 1CJTC 1MEEA 1T24A 2CUNA 3ZNQA 1E9VA 1YONA 1L7PA 2CLDX 1YR2A 1P18A 4UEWA 1TTPB 5IP5A 3UFBA 2PFGA 3TKAA 2WD7B 1NUAA 4RVHA 3QI2A 2Z30A 2H6EA 4N0PA 4FHGA 2GO7A 1M0WA 1Z0SA 3EXAA 4YASA 5D00A 2YQ4A 4DV5B 4O2AB 2CSXA 1P5HA 2J6BA 2VPTA 3CRNA 5KS2A 3IODA 3CGGA 1KMNA 1GZ7A 1TM7E 2GPNA 4L8YA 3NV9A 2ZXEA 1XZIA 2NU7A 2IWHA 4FTWA 4ZCTA 1E62A 3ZE0B 1SQ6A 1TT5A 3LHFA 2ZRQA 3ND8A 2D59A 4DG5A 4E14A 3CUSA 7ADHA 5FPSA 1W59A 4JS0A 4JWTA 2GVZC 5TSDA 5JG7A 1QCZA 2XJ9A 2H2FA 3W9BA 1CZOA 3P9CA 1K89A 3VR4D 1IZZA 2BTEA 1RBZA 3GDWA 3AEQA 2R00C 2XTMA 1E66A 2ZLBA 4R2KA 4Z53A 3EY9A 1UQUA 3WB9A 5B53A 4MLZA 2WVHA 1U0SY 1J56A 1Z7GA 2DH6A 4YCAA 5DIFA 3NP7A 1FP7A 3ZH2A 4G5HA 3ZQKA 3NHSA 3SXUB 4OLBA 3VR0A 3FG9A 2IGBA 1U94A 4YHBA 2FF5A 4DBLE 5JC8A 2IXAA 3U0VA 1ECJA 1TM1E 2W2MA 3N58A 4GDFA 2O3TA 1WP4A 4J49A 3WV5A 4MVJD 1DFHA 3ZV7A 4KVAA 1HDYA 1XZNA 3OFJA 1R0SA 1KMHA 2GN0A 1Q44A 1GP2A 3CIFA 3HPQA 5AKYA 4IUDS 3BL6A 3N28A 4Z3KA 3C5EA 4YR7A 2BZ1A 2XB9A 1BW9B 2C61A 4X7RA 3CPHA 5AXDA 3KZCA 2Q1YA 5DDIP 3HFRA 3ANLA 1FX0A 1ZI8A 1P5FA 3CLSC 1Z75A 5BN3B 3CBGA 3EHDA 3ZR4B 2FX5A 1U81A 1Y4UA 2XGOA 1HA3A 5BORA 1FU8A 1G4UR 3GY0A 4TXJA 2ODPA 1V1MA 4OJTA 3VVMA 2YJ6A 1ZEMA 1VKNA 4ESEA 4JB3A 2ZB8A 2OBBA 2P91A 3BBPA 2GYUA 2FOXA 2PIAA 2D5AA 3ABOB 5AP9A 4NXNB 1MC4A 2VSFA 3AWDA 2OK7A 3FTQA 3D7NA 2PEZA 4BOYA 5BWOA 3GDGA 3IQGX 1LV7A 3N0WA 1T0JB 1U4OA 1U9ZA 1LNQA 3H1PA 2G5GX 4GE3A 4K81B 2Q4EA 3PFNA 4PG4A 4CDGA 4EW3A 1H2AS 1JDBB 3D7RA 1ZCZA 1N3BA 2BM1A 2C4MA 3KZOA 2L0XA 3QOXA 3H3FA 5EHIA 1QX4A 3LLSA 3O2SB 1YKGA 2MJLA 2WIDA 2VTBB 2GGSA 3GPDG 2JANA 3K6JA 3VYTB 1J2TA 3WFZA 2W4MA 1AMNA 3P4UA 1XOIA 1YB6A 3DTNA 4X63A 1LW6E 2EF1A 2Q1UA 2ENUA 1RWXA 3Q3GE 4OQFA 4M1SA 4QU8A 4RTKA 2UYHA 2ZBQA 3H4MA 3OBIA 2IYXA 3QWBA 4JBWA 1RAAA 4Z8YA 5F1OA 4LHEA 3ENQA 3SE7A 4QGHA 5CW1A 2VCHA 5FT9A 3HBJA 4RNCA 3W5BA 4UW9A 4J1TA 3K2QA 3NQ41 3DVAB 3PPXA 3GNSA 4V0LA 4D8WA 1Z74A 1KARA 2XITA 4U6NA 4XE5A 5SZKB 5AVVA 1GAEO 2O8BA 3IE2A 4FZ5A 4HH3C 3VR2A 1RT9A 1QYIA 2OO7A 3MF4A 4WLFA 2H3HA 4Y1RA 3BE8A 5HHTA 6Q21A 1D2EA 1TZJA 1ZN7A 3K35A 4NIMA 4IW3B 3K9WA 2A1IA 4RHFA 4BNUA 1TNDA 1M66A 1NKVA 1NVEA 4LSGA 4JJ4A 4IIUA 1JG2A 1EUCA 3JQGA 4HPJB 3EPHA 4HBZA 4MGKR 1YS1X 4FC6A 3FX2A 2YICA 4QL3A 1R6XA 5FWYA 3GLQA 1SQFA 1CEYA 4QBKA 1BX1A 3JSXA 3BVPA 5DYTA 1JEEA 1I6WA 1O03A 4A5SA 5IG2A 2PBZA 4ZIRA 4RNDB 2VRCD 3K5PA 1F2UB 1Y9ZA 4GR9A 5EEGA 3MCTA 1RXUA 4CIDA 3SHFA 4J0EA 3CKLA 5KNCH 4F46A 4OH7A 3AINA 2H2GA 3M33A 2XE6A 1R5JA 1UZNA 3AL3A 4JZYA 3RWBA 1TPZA 4GF5A 1ISIA 1S7CA 3VJRA 3H16A 1RJWA 4OLFA 3GU3A 1V7CA 2OV6A 2YXNA 2ZAYA 3UJCA 3WAJA 3NJ4A 3RVKA 2E2WA 1DZIA 1J5PA 3GFRA 4JYCA 5F98A 2GWHA 1G9SA 3U5ZB 2FPIB 1BDMA 2ANCA 3A10A 4ZVVA 3HU1A 2V6GA 1BDJA 1XCGB 4XSGA 5LZ8A 2GHQA 4HBGA 2XCSB 3NOXA 4PLPA 3IUBA 3P4YA 1KI6B 5FTJA 3KETA 3CS3A 3QE9Y 4I3GA 1Z0DA 1TADA 2J46A 3ADKA 1OSNA 3ONEA 4TRJA 1E3MA 1C8BA 1Z5OA 2G83A 2A58A 3BZBA 3L0CA 4QELA 4QKQA 1M8KA 4MPDA 4QU5A 4UKDA 4RMGA 2FWIA 2DFKB 4V0OA 5HKLA 3TSAA 5B3JA 2W42A 3IEVA 1QQ6A 3LL4A 4C3VA 3DEYX 4IIYA 4XLLA 1PF7E 1GTRA 2COEA 1LQTA 2AXNA 4KE8A 4MVXA 3HXMA 2HDNB 3AY6A 4J2OA 1L3CA 4AK9A 2QW8A 4OAPA 3BH0A 4URVR 2RCNA 3T7CA 2P4HX 1QHEA 4S2UA 1K6MA 3SAJA 3IPLA 1VPWA 3ENVA 5EL0A 3J7TA 4YT8A 2HN9A 1BN6A 4HB4A 4NMWA 1A9XB 1B1AA 4PPFA 5BUQA 2GM4A 2CJWA 2QUIA 2VJNA 1ZN9A 4XGKA 2NUBA 5JFTA 1PHPA 3PVCA 1ND5A 3WJAA 3DGEC 4OTZA 3ZZTA 1E8MA 2EKLA 1K68A 2MOKA 2VBIA 2PANA 4N0DA 5BN4B 4UPDA 2ZRMA 3PE4A 2ESRA 3R8XA 4YAKA 1DUIA 1GYPA 1XWWA 2C2GA 4NZOA 3M83A 5CXSA 3SHTA 1UKZA 3RVQA 5JOQA 3DVSX 3WRYA 1UFQA 1CHDA 3CKYA 4GH5A 3CUKA 9ABPA 3O2QB 2ZUFA 2A1UB 2IZOA 3PQ4A 3C87A 3OE5A 16PKA 3N2NA 5A3JA 4DF3A 3ZDYB 1OXTA 3MWDA 3JV7A 4BZZA 4EFLA 4KQ9A 2MU1A 1RTKA 3VSCA 4JI4B 1FPMA 4IL5A 4GMFA 3TQCA 1C4OA 1WZCA 2YIMA 4WUVA 1J7JA 1F2TB 3REGA 5LFAA 4TXLA 1QVWA 2VH1A 3D0RA 4MA5A 2PRJA 3I9JA 1SXIA 4YIHA 5FAKA 3HDJA 3RJZA 1K8XB 1I1HA 2NZVG 1T0BA 2N0SA 2HQOA 4XTRA 5ALSA 4L4YA 3LYAA 3TLYA 1KVSA 3JAMA 4R5MA 1GPNA 3PSAA 3OTQA 2Z95A 3PWTA 3UPUA 4QVGA 2XWSA 3UHFA 4ZEVA 4MUEA 1YO6A 3TTTA 3PKJA 3VU1A 1HY3A 4MWSA 2QW1A 3AR5A 3CR7A 1N2GA 3LC2O 3WBKA 1RMQA 1SG9A 2ZPTX 2WHQA 1QGZA 3JQEA 4H7HA 5CIQA 3V1LA 2X77A 4BQNA 3WQRA 1N6KA 5C8DA 1ULBA 2JFVA 4FWBA 4IFBA 5I6DA 4V38A 4EBFA 1B15A 1Z47A 4DYDA 3Q3EA 1E2EA 4AZ0B 3VZRA 3WGLA 2BE9A 4B34A 1OAOC 1I5OA 1CR4A 4WASA 4X65B 3AR7A 4BLSA 3R7BA 1OBHA 2H1FA 1PWHA 3KV3O 4MIKA 3GLGE 3PQ7A 2WMNB 3K94A 1TUGA 4DM4A 1VPEA 3QX3A 5IXYA 4EVSA 1XO1A 1FMFA 2HLDD 1QHFA 4WBNA 7REQB 2Q9AA 2V7UA 3PNOA 4WEOA 4RF2A 1YAJA 2VSQA 4OQLA 2XYRA 4M7PA 4PVDA 3WB0A 1RSZA 1OXXK 3GJZA 4EMSA 2FR0A 3TWOA 5DHPA 4AUEA 1Z26A 2NXCA 4ZVQA 2BSAA 2OZEA 4DV2B 1ZDMA 3K8ZA 2EZ9A 4D4IA 4B76A 5BWBA 2NUTA 3REQA 4DXDA 5IM4A 3QBEA 4QDXA 1RKBA 5CB0A 1DIBA 5HIIA 3DDHA 4IJWA 3ER6A 5IC6A 2NAPA 4CCYB 5EIEA 2OFFA 1SCNE 3GGJA 2XODA 1GTZA 4OD0A 5IPFA 3FNGA 1KFJB 2H16A 2ZXFA 5FF9A 3UXMA 4D8UA 1P0FA 4IMPA 4CFYA 3PUHA 5JD5A 2QSUA 2IT1A 3A31A 3M6WA 4BECA 1FTQA 3I64A 4L4XA 1KY2A 1JFRA 3AETB 3CZAA 3IO3A 1U11A 1O4VA 1TJ4A 1A7JA 1NJ2A 2ECPA 4JVOA 4FFPA 4EY5A 4MKFA 1CF2O 1U8TA 1QONA 1OJ7A 1Y8RB 2PWBA 4UC0A 2R6GA 1SEVA 3UXHA 1CUIA 3QOFA 4C6HA 4JITA 2VJPA 4N0EA 1WP9A 3OPYB 1HSZA 2YDXA 4MUMA 3T7RA 4MRVA 5GY7A 5IT5A 3L1IA 1ISFA 1XPRA 1RRKA 3OCVA 2Q2QA 1G0NA 1N0HA 5C8YA 1ZJZA 3KD3A 1QKJA 4RH1A 4IIXA 4FZJA 2BM0A 4REQB 1ZUWA 2GPWA 3WK8A 3KLBA 1JWAB 1FMLA 2GPJA 1NRWA 2CKMA 3H75A 5COBA 2MYUA 3QVXA 4QWWA 3ZKWB 3W4JA 4OGWA 4EH1A 1EFRA 2MMCA 2VDLB 2O8DB 5LD2B 4HATA 2CWDA 2H7CA 2ZT8A 1ZD1A 1PJZA 1TLFA 2FFAA 2VPWA 1XRPA 1P7ZA 3CZMA 1QP7A 2JG3A 2AF3C 3L7BA 4R05A 3MT9A 4Q18A 1SIUA 3EEYA 3CX4A 1RWKA 4B6JA 5ALXA 2XTZA 2RGEA 4FJ2A 5J23A 3VR5H 4ZAGA 1FDIA 3T3GA 3DKKA 3UMVA 1JLSA 2H7VA 3LCJA 3EOBI 3VNSA 3T95A 3TF5A 1CEQA 5ENDA 1M5RA 2C9BA 3BJRA 2XI4A 4MUFA 3GPCA 3RVBA 5SZJA 2NIPA 3E2MA 4JN6B 3LI2A 4P86A 4Y2PA 5FBRB 3AB7A 3T5MA 4Q1VA 4E5VA 1J39A 1KAOA 1WM1A 3NHBA 3P2IA 3SR0A 5A3VA 3R5JA 2FQWA 3N76A 4I7EA 1XKQA 3R7WA 3CRW1 1KKUA 3B7GA 3BFKA 1RD4A 2FRDA 3W34A 4ERNA 1OJLA 3G82C 3W04A 4BYGA 3L6RA 2HSZA 3QZUA 1TKBA 4K2AA 3P2EA 4IBOA 1QO0D 3FD8A 5D3MA 2PZKA 1ZIPA 2MSEB 1ECCA 2RGUA 1G4AE 1R4MB 3E7WA 4B2YA 2YHUA 4X54A 3DOFA 4WE3A 3UHPA 1ZIOA 1G8GA 3F7OA 3NAZA 1PJBA 5CGZA 2XNHA 3OZEA 3WNQA 2EHJA 1B14A 5H83A 3OX4A 5GJVC 3RU3A 5FPPA 1EUYA 1WZEA 1J0XO 4L7VA 1L8AA 2D5IA 2HU8A 5C8VA 4IMJB 1HR0B 3DOJA 4G0OA 4I5FA 4QA9A 1LPNA 5GAJA 3NCHA 1FFXB 1XJ0A 1T0IA 1RR6A 1CUVA 2FRXA 2XNSA 3Q3CA 1OI7A 4KGDA 3DAPA 4M38A 3HKDA 3KOMA 2G0NA 1Z63A 1NWCA 5LMNB 5FL7A 1DQYA 3NU1A 1P3DA 3ZYZA 5HF9A 5C4IA 3FPCA 1L7XA 5IZ4A 1UAGA 4V0KA 4P4TA 3WR5A 1A27A 2DERA 1ZK0A 2C3YA 4TKZA 3QQ5A 3N0TA 4K86A 3IIJA 1SBIA 1WKCA 3RUHA 3HGQA 4L51A 4ZQGA 3SVLA 5JQGA 1ECLA 3P5BA 3WWOA 2AG5A 2G9VA 3L0BA 1SUSA 2E4VA 3NTXA 4EA8A 4ZMBA 1ZOIA 5A6SA 4LE0A 3FTFA 2I8LA 4PNHA 4YMTA 4DIMA 1OYWA 3E22B 4R84A 4UMFA 3UWMA 2GN1A 4G1CA 5D2CA 4Q7QA 4FNMA 4YRGA 2BEVB 4RTQA 3FYDA 3N7TA 2FPOA 4KPUB 1T5LA 5KNBA 1PDVA 3GJ4A 4GYYA 1GCUA 1FDSA 4NNPA 1R4AA 3AESA 1GSHA 1SQ5A 3ZHYA 3M1IA 2IIBA 3CR8A 1Y1RA 3O1HB 2P68A 2Q3LA 5EZ6B 3UOWA 1BS2A 2QTVB 1X1SA 1OREA 3A1TA 2W6PA 1EXMA 4LQDA 2X9GA 4ZT4A 2Z2ZA 3A58B 4NFYA 4NVRA 2WPDA 1ZW1A 2O7VA 1U7OA 3C3AA 1Q50A 1DBWA 3NIFB 2BMEA 3ODGA 2R8BA 1QO7A 1L4EA 2CYBA 1GRVA 4IF6A 4KLZA 2MDTA 3U9LA 2IEYA 3HWWA 2NU8B 3BXZA 3QTBA 1W88A 3RYIB 1Q83A 2D1TA 2YWDA 1TPYA 3DZBA 1KIAA 1K4MA 1XVIA 3IJPA 4NJMA 1KGDA 2O19A 2V6JA 4ED9A 2IHZA 1CLEA 3H2IA 3C8UA 4ZZ1A 5SY9A 3FTPA 2Q5CA 4AU1A 2PUJA 3NWOA 1JMKC 1YQUA 4EQ6B 3WK5A 2FXVA 4IVQA 5KYXA 5DSXA 1MC1A 2EOAA 1C0IA 4UHHA 3OT1B 2V7QA 4DPLA 3OU6A 2JB9A 1KSGA 1JTVA 2C84A 1UPXA 2NWQA 2BONA 1TO2E 5ITWA 1VIVA 5E2BA 1Y33E 1GZ3A 3QOWA 1DVRA 2H4XA 3FDIA 4KTVE 2K6GA 3X1XA 2RAPA 4H7JA 2BDTA 4RZXA 5E7MA 2EXXA 4YTEA 3ZY2A 1P2VA 3LU1A 4DV4B 1CRWG 1NPTO 1HYQA 3TPCA 1A5TA 1XMJA 3F3KA 2E85A 1ISMA 2BH2A 1YZTA 3WLOA 2QM0A 2AC2A 4E2ZA 1T2DA 2XNKA 1TVKA 2AC4A 3JD1A 4HH4A 4O5AA 4UUNA 3KUCA 1Z39A 2C9CA 3FDZB 5I4IA 4MW0A 1DBPA 2GLXA 3UAVA 3TBKA 1JR4A 1MRNA 1Z6PA 1KJNA 3HA2A 4KE9A 4HQFA 5EFOA 5DM60 1E5VA 1DC4A 1OV4A 1V1JA 2GTIA 2PKXA 2BHRA 3EOAI 4NZMA 4FC7A 4OQZA 3RVOA 3T99A 3TIIA 3W0LB 3WGZA 2IBTA 4IFEA 3R3VA 4I19A 2W6QA 2XTAA 4PQYA 3IV7A 1DQZA 1HG0A 1QHHB 1ADGA 1D0IA 4RJJA 4BKUA 2CN1A 2ZYWX 4P3KA 4HQKA 4PHHA 4X0EA 3ZWYA 3V5NA 4C21A 4FONA 1BE1A 2BJVA 1WVIA 4Q47A 1UPTA 4I46A 3RUFA 4B71A 1AZSC 4D4JA 3CU5A 4CLRA 3NBAA 4UTPA 1FDUA 4KC0A 3LKVA 3KXDA 2GXQA 4O4LF 4H2DA 5C7OO 3IQHX 1FRNA 4BXOB 1ZN2A 3OY7A 1HI9A 5FNVA 5IAJA 4MAMA 1NNEA 1ZNQO 4E5KA 1LDYA 3GA5A 3L7KA 2R66A 2FPXA 2X0JA 1P2UA 4H0FA 2ATEA 5E1OA 1K92A 2OFWA 4ARAA 4AY4A 3DLHA 4MYCA 3JQAB 3QWFA 4M1MA 4OHPA 1E2GA 2IEGA 2BL4A 4LV8B 4U7PB 5EKDA 2IY7A 5DBEX 2PSDA 2IOFA 3HADA 4AKHA 5CFNA 1W87A 4DL9A 2BOVA 3N5KA 1D7OA 3VOTA 3EH1A 4LZLA 4FYIA 5ETJA 4FKZA 4EEXA 2YVAA 3D6FA 1M0EA 2D1FA 1L5FA 4KSCA 2BFCA 4G1FA 1RDFA 1BH2A 2HA0A 2TMYA 3N8KA 4RANA 3CLUC 4DTCA 1U2DA 1YRAA 3B2NA 1DWOA 2ORYA 4LOLA 4NKRA 4C7JA 4H3VA 2I6FA 3V34A 3RTAA 1O96A 3TTUA 1OAKA 4CDRA 1IN1A 1S6YA 3FYUA 3BULA 5DHSA 1X1TA 5E95A 1P1FA 2I91A 3VJMA 5G1OA 3ZX4A 4GMHA 1ORWA 3D31A 4L74A 2AYYA 5K6RA 3EHEA 3EIUA 5DH9A 5HUHA 5JQWA 4Z2YA 4R9SA 1ACLA 3EEBA 3OESA 2QVGA 1XC7A 2YV5A 3EZ2A 1OXSC 1BA2A 1KU6A 4O4LB 5FOVA 5KNLA 2J33A 3EDQA 4EELA 4JT8A 2JJ2D 2ZJBA 2I1LA 2CXXA 2CWWA 1M6YA 1XRRA 2W2QA 4I8XA 4TSFD 5IM5A 5IW8A 4E31A 2GA8A 4WK0B 1SK8A 1M1YB 4TPKA 4YLGA 4HQOA 5CK5A 2LIVA 1VMKA 3LYLA 4OG2A 4BFUA 1N2IA 3G2HA 1HLFA 4HGOA 1BYIA 4HLDA 3E2IA 2EZUA 2V3VA 3WDKA 2N46A 4J9VA 1QVAA 2PL9A 2CD9A 3EH2A 5I7RA 2VDUE 3AV0B 2CMFA 1DWQA 1E79D 2ZB2A 1UWKA 1WO8A 4XKJA 2F8LA 3LBIA 4YB8A 3UIEA 4WFJA 4XRGA 2DU8A 2R4QA 4OJQA 3TZKA 2O8FA 1S8NA 1H5QA 1V5WA 1GUDA 5IVIA 3SM9A 4A0QA 1XRJA 2C59A 1GARA 2WFMA 3HB9A 4HAVA 5DW0A 5KAPA 5I4CA 2X86A 1M34E 4N9WA 3JQ6A 4AQ7A 1JEQA 6ABPA 2ZREA 1QHYA 3RS4A 1BC5A 5HRAA 1BJTA 4ML3A 1I2AA 3N3AC 1KDYA 2OSBA 3H9GA 3PTAA 2A30A 1E2UA 1Y7LA 5B2ZA 3PNBA 4B3SB 3NUQA 1NBME 4DLPA 3H6GA 5BMVA 4IYJA 2QTZA 4FYXA 1R10A 4MUAA 1E4EA 3L1JA 1PQ4A 4KQWA 4NG4A 5G53C 5GONF 4YMVA 1FNMA 4Y6LA 1MB2A 1IQRA 3ZU5A 2AZTA 2GWRA 2G88A 1NAHA 2R7MA 1X2EA 4IS3A 1MU0A 5A9SB 1VP9A 5HZMA 2CY0A 3DBVO 1FFEA 3TI9A 4NDNE 3UICA 1I3LA 2JBAA 2D74A 3WB2A 1CUXA 2Y1EA 4Z7JA 5KTYA 2QBYA 2XZLA 4DDVA 1NOKA 5I8WA 1DLJA 2QVBA 2IK8A 4KI7A 5CDGA 1EFLA 2H4WA 3NT4A 3QSGA 4GSLA 3VPSA 5C4GB 2PX5A 4MUKA 2VJBA 1PGNA 2VPQA 4YJKA 4HUQB 2AZMA 1BXKA 4NONA 4FEGA 3DMRA 5JT1A 2QD5A 1CF4A 4HG2A 3G7UA 3HKEB 2SKDA 1ZA1A 3Q0EA 5DGHA 3ENKA 4KRGA 1TA0A 2RB5A 4M0LA 1W73A 4YREA 4B0PA 5IDXA 1QTQA 4NFLA 2AR0A 3P0HA 2Z9DA 5FULA 4B3GA 1WPQA 1DIGA 1YC5A 2HX1A 3G2MA 4FYHA 1G3UA 2PXXA 5IC5A 1XVUA 4LGYA 4WKPA 4JI3B 3QUQA 4YJFB 1CY4A 4ZN6A 4IF4A 3WIUA 1U0RA 1N2CB 1GNRA 1IJKA 1DARA 1UT8A 1YRYE 3KP1A 1OFUA 2JAQA 3DULA 1MOQA 2PUCA 1IXYA 5DYNA 3QITA 2RHLA 1C7RA 1TEXA 3OKFA 1RQ2A 3O2NA 3LA6A 2DWQA 2BFEB 1CYDA 2A1TS 4IJQA 1F14A 1NHWA 5GONB 5KYYB 2G1UA 4X24A 3TNFA 3V7WA 4B32A 3CRMA 2ZGVA 2BIFA 3TIVA 1QQTA 5D6OA 4L5JA 1XZAA 3LUFA 4IQ8A 2POQX 2JCBA 3H7IA 2H1SA 3O8QB 3SKVA 2I55A 1OTXA 3IAS6 4P5PA 1NNLA 2HWKA 3CUWA 4NARA 4OFZA 3U4IA 4WQMA 3WLRA 4UTRA 4OXRA 1G38A 2H0RA 2EWMA 1E2LA 1FLAA 1M2KA 1NVDA 2C42A 2JFZA 3VR5D 3RFUA 3OI7A 3EZLA 3PZRA 4M1ZA 1A77A 1FLNA 2CXQA 4WVFA 3CX8A 4H7IA 2WV9A 1QR6A 1M1UA 1XZ8A 1U2GC 3E9NA 1YRBA 3IAS1 2IE0A 4GOMD 4LTMA 4RDHA 3VZQA 4DCNA 4DS3A 3C39A 3T1VA 2DOKA 3O4HA 1I4DD 3RLFA 4TKVB 4AKSA 5JPIA 4OFXA 1BN7A 2QE7D 1Y1KE 4LK3A 2XT9A 5CLIA 2YFQA 4LFBB 2Q1TA 2X8LA 4I9NA 4KXQA 4Q9LA 3RBAA 3LIIA 2C0PA 4JXJA 4EW2A 5KWEA 4GT1A 5G40A 2NP7A 4J0HA 4L4ZA 1CNMA 4UD2A 1T1EA 2UYGA 2M6RA 1I2ZA 2IPOA 2GNAA 3VKWA 3KCNA 2ZZNA 1X9IA 2Y8EA 4UDNA 3KXLA 2AEJA 1EE2A 1E7YA 4GSKA 4AULA 2DMRA 2QLNA 3R3XA 1QH9A 4TL6A 3T3DA 5C5CA 1MBZA 1AGYA 3LHSA 4DLTA 4ALMA 5C81A 1HNXB 4YYZA 1J24A 3U9SA 2EJBA 1Z29A 1FP4B 4FYPA 5E1BA 1C3OA 3FUVA 2AOUA 3NHKA 1O58A 5TEWA 2F7SA 2R2GA 3DH0A 2O2ZA 1USKA 1NQXA 2FW9A 1T25A 3UENA 4DLBA 1PJSA 3NEJA 3B3QA 3EXEA 2ZI9A 4ENUA 2GDZA 1RPJA 1VSUA 2PN1A 2XB8A 1ZP6A 2D1QA 1ZA2A 2WT9A 1YZ3A 1P6QA 4RY8A 4URWR 4KQ6A 5K3BA 4BCBA 4CMGA 4G0VA 2PVCA 2V98A 4FOSA 3S40A 4C6TB 5JLAA 2WJ4A 2QENA 3QU5A 3JSAA 4JFAA 4DY4A 2VP9A 3TG2A 3D2LA 4PQEA 5JS2A 3KTAB 2YZ7A 4GX1A 1YUBA 2VT2A 4EDFA 3KQKA 3PA8A 2GRJA 3DNPA 2AI3A 4LYYA 3CINA 2CF5A 1E2HA 1NP6A 1UPFA 3B60A 1YKFA 2KI5A 2QUZA 3C3WA 3CZ9A 2RKWA 1V7QA 3LZDA 3BA1A 4PLGA 2JGAA 4UEQA 5LUBA 3VAAA 1ARZA 5HUJA 2ZKLA 5F1YA 3C5VA 4KREA 1QIDA 1XTBA 4MYSA 2ZIFA 5JNTA 1C2TA 2NSYA 2OKCA 3C5CA 5JS6A 2FQ1A 3DBLA 1OI2A 2PH1A 3T3PB 1BTOA 1YZLA 1FRQA 3I2IA 4EW6A 5FOTA 5B7PA 2ZU0C 1WF6A 1OYYA 2HY7A 5EJMA 3C4JA 1ZAKA 4HDKB 4K6GA 4OEHA 3C41J 3AFNA 2NVUA 4JVSB 1CULC 1X86B 2P11A 3B1JA 2QD4A 2ILTA 3UZUA 2VZ8A 3P32A 4MVYA 3M3DA 4KNWA 3DO6A 5HZHA 1SK9A 1A9XA 3HABA 4IIEA 5CDYA 4ND8B 4OXIA 1EHCA 2IFTA 5JIBA 3ZD6A 4B4UA 1CNEA 3OCZA 1M83A 3D6NB 1NLFA 4QJIA 3ZU6A 4BO4A 5BN4A 5L6LB 1FMTA 4L78A 2OV8A 3Q15C 1NW4A 5CVEA 5DSZA 1LW7A 2VJAA 1UWLA 1V8ZA 5C1IA 5G0WA 3BT7A 1E1MA 1RP1A 2AUMA 1FL9A 3DZHA 4P4SA 5FA6A 2QMZA 4DIKA 3EVAA 3VX4A 1W4AA 4YNBA 2OYSA 4EG6A 1KAQA 1W34A 4TLAA 2REXB 5FL3A 4E2FA 4YRMA 3JYQA 5FLKA 2PWPA 3H9JA 4QDOA 2H5IA 5AVSA 3C8ZA 3WLJA 3FNFA 3ZXXA 4X1IA 1T4MA 2CE7A 2DCUA 1C0KA 2JAHA 1V4VA 4NECA 4Z0PA 4RPGA 4HWOA 2QZPA 1LLQA 5DPMA 2PNJA 2P9EA 4K9SA 4L6CA 1H0SA 4D9FA 4XDGA 4W1PA 2WFZA 1D4AA 4G1EB 1WW3A 1F17A 4ANFA 2HXSA 1JPJA 4KH1A 3R9KA 1XD8A 1FYVA 2XRZA 4M8SA 2YMMA 1VL8A 2GZ2A 1T5OA 5GVSA 3WDMA 4TMVA 2F3TA 5DN6D 3H9EO 1L5GB 4CEHB 1YZNA 3GMIA 4FOLA 4U0KA 1YGPA 4UNSA 4AMVA 1SQGA 3EDMA 4OY3A 1I0LA 1N3IA 1ETUA 3EMBA 1UC4B 4JK3A 3WGGA 3DGFC 4B3FX 5AVYA 1EA7A 4TTJA 1VSVA 1XVLA 1P7VA 4GEGA 4AZ0A 1Y6GA 2QAGB 1P0QA 1TCAA 3FFWA 1XXHE 1Q77A 2LE0A 3DB1A 3UV6A 5M5BA 2Z4TA 3MJDA 4IQ0A 2R1ZA 5LXTF 5DI3B 3ETCA 2QSJA 1I2CA 3LWZA 5EMJA 4P3PA 3G85A 5D84A 4ZOCA 5BV1A 4UU8A 5AHXA 2HUPA 5FBHA 1VKOA 3CT4A 1V0JA 2BP7B 1EI9A 1FRVA 3WL7A 5HQTA 4YAGA 4FLFA 2E4YA 1K98A 1MG0A 2XA2A 2W2NA 3T54A 4EGQA 3N8DA 1V3VA 3DCJA 1GIAA 4L0QA 1R88A 2HRCA 4PX5A 1Q12A 3QFTA 4A8HA 2AFVA 3DQZA 3PZBA 1A3CA 2ZYTX 3BBLA 3GCDA 5KTPA 4C2AA 2QP4A 2A94A 2QY9A 1TZCA 1QK5A 1Y7TA 3AIOA 3R0IA 2C88A 3IBCA 2Z3ZA 5A05A 3RRJA 4HCJA 1PK9A 4H7FA 1AD2A 1NMQA 3O4VA 3FOAA 4A0HA 1ODLA 2PD6A 1JQJC 2GTPA 3HLKA 4HH1A 4MITA 4CCYA 2XF2A 3STXA 3A25A 3STVA 4DRXA 2CLHB 1VJ5A 4K6OA 2OWDA 1Q22A 3DYVA 4RJKA 3L8HA 3COZA 2C5FA 1U2RA 4PTYA 4TYQA 1NQTA 2D2IA 4K6HA 1TIBA 1KEUA 2BFDB 2JIMA 4TYPA 4WKBA 4EB0A 1CIPA 4IDPA 5DJ5A 4J07A 5AWFC 1QFXA 2OLEA 3PHHA 4D44A 4LJRA 4MDFA 2R00A 1NF8A 4EG4A 2O57A 3ZV5A 2C4WA 2WIFA 1YFLA 4GOJA 1X74A 2B1QA 2H1CA 2OZLA 4LY0A 4B6FA 2R4TA 1GR0A 2A5DA 4Q1EA 5GGXA 3V1KA 5NULA 3ZG6A 3AUYA 2CB9A 1WIWA 3G0HA 5T4FA 2R6CA 3PEEA 3M70A 4AF6A 4UXIA 1D6JA 4REQA 1P1IA 2GJAA 4ZYYA 2Y4NA 1MGOA 5TQ2B 2I71A 5BP7A 2WABA 2WA2A 3LUBA 3VHQA 2FSHA 3GLFB 2EZTA 4TTIA 4GPIB 3TR5A 3UB4A 3EOZA 2QMUA 4BVAA 1PGOA 4KMMA 4PC3A 4POOA 2O8DA 1FXUA 2B8NA 2FAXA 4JLNA 3TQTA 4P0QB 4CKYA 3T7DA 3ELUA 4XH9B 1ZG3A 3ONFA 4C05A 3QIVA 1Z0UA 1W49A 5JYDA 4AJEA 1JEDA 4ALJA 1HKHA 2EEZA 4RK0A 2W9XA 4ETWA 4N5MA 3LW7A 4UXHA 2D4AA 2GETA 2GEVA 4NAUA 2YJNA 2YOGA 2Z8YM 3IVAA 1IZ7A 1GPJA 1KYIA 3ANNA 5CJJA 5BVHB 5JALA 3E27A 3FAZA 1W8DA 3H1AA 3TZBA 2B8JA 2BI4A 4N76A 1U0BB 1NI3A 5JY1A 1F8XA 5AJUA 1FCJA 3LUDA 3QV2A 1JYEA 4G0PA 4URZR 5JS7A 1Z2AA 2F1OA 3Q40A 2XMGA 4JENA 5DNCA 4M1KA 5DCLA 4PSUA 4ZWNA 4OHMA 1KYYA 3W5UA 4RV5A 4BLOA 2WD8A 3FDFA 2ZYDA 4YXWD 3AZQA 1PWXA 2R8RA 1V7PC 1SHLA 2YW9A 3BMCA 5K0TA 4M98A 4TS4A 1TZKA 3S2EA 1EJBA 4WY2A 5CEJA 3ZS8A 3QPDA 1XNJA 4U1RA 5TT0A 3TFWA 1KWKA 1B74A 4OJMX 4O25A 2CE2X 4DMUB 5EIBC 2JIDA 3PBKA 1K75A 2LDBA 3G2KA 3Q98A 2UZ0A 3ZOZA 2IX3A 4D3SA 2I4NA 1GTVA 3E1KA 3QFSA 5FLXA 1FNNA 1SOAA 2XQIA 1OZAA 4G85A 2QR5A 4Q6WA 5CT4A 4C22A 1YRWA 4DCMA 4NENA 3V1TC 2ZYRA 1HFJA 1QF6A 2GMWA 3CPJB 5CIYA 4QDUA 2GERA 3INRA 4M49A 3L5KA 4NS1A 1OXBB 2BEKA 4E5PA 1REQB 4CKWB 1RZUA 4RZHA 3NBKA 2YNMC 3EQ7A 2VVTA 4RCZA 4F85A 4DJJA 4HS4A 5BR7A 3BSYA 4KX5A 2IU6A 3DA8A 3GJTA 3I0MA 4L4UA 2JHPA 4N5IX 5BOSB 4E22A 4R68A 1NONA 1XBTA 1DRKA 2Q21A 3BK2A 1Z4NA 1WMSA 4WL0A 6AT1A 2G7ZA 3M8KA 1H0HA 4GBJA 3ET5A 4EHFA 4XFDA 5H7XA 2JKZA 4QLBA 1UJ4A 2V6MA 3PT5A 3G0GA 1CDEA 3G2OA 1ONOA 2BKLA 2P1RA 1PK8A 2R6AA 4GL4A 1YD7A 4QYWA 2G63A 1TMOA 3C48A 4TGLA 5JJBA 2O3SA 1MLDA 2DSTA 3T9FA 5HFAA 2Y92A 4EFMA 5EESA 2GBIA 4WN9B 2FJUA 4H7DA 2BEVA 4RQAA 5T4EA 3H7AA 4DUGD 1NVKA 2C7GA 2VNKA 4KQ2A 4UJ5A 2HH9A 1KKMA 3JQPA 4GP7A 4NOLA 3U7QB 1QPZA 1I9GA 2GN6A 1WBDA 4HLQB 5AI5A 2JGIA 2QNIA 4PYKA 1ZKDA 2BWJA 3C16C 2ADMA 4RS3A 4Y3UA 1GAQA 5ITZB 2IS6A 1RLOA 4NRDA 1YE8A 4TWIA 1FFSA 5A04A 1JMVA 1X7ZB 5JBQA 5B7NA