2Z5VA

Solution structure of the tir domain of human myd88
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
141
structure length
141
Chain Sequence
HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Myeloid differentiation primary response protein MyD88
total genus 23
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 2z5vA01
1FYVA 4FZ5A 4C6RA 4EO7A 4OM7A 3JRNA 2Z5VA 3UB4A 2M1XA 5KU7A 2JS7A 4LQDA 4C6SA 3H16A 2Y92A 4C7MA 5H3CA 3OZIA 4C6TA 4W8GA 1T3GA 3UB3A 4LQCA 1FYXA 4W8HA 4DOMA 1O77A 4C6TB 5FORA 2J67A 3UB2A 4LZPA 1FYWA
chains in the Genus database with same CATH superfamily
3VX3A 1P0FA 1QV9A 3PU6A 3IAAA 1W5AA 1C29B 2P90A 2QJTA 3OIVA 4GPD1 3V1UA 2H11A 3UHPA 2J9RA 3ELBA 3MOIA 3KAPA 1A96A 1DINA 1KI6B 2OV8A 3GEHA 3QF4A 4O2BB 3TK1A 5UKDA 2VAVA 3AMVA 4C88A 3W5DA 3GMDA 4XQ9A 5C52B 3F8TA 5B30A 4LGMA 1FYFA 4EUEA 1V0JA 4JGIA 4HZUA 3UHJA 4LDQA 4QBIA 2BZ0A 2KQUA 2QRLA 5BQ5A 1CS0A 3T7IA 4ESEA 3WOHA 4POOA 1KQFA 3IIMA 2P8JA 2IH5A 4HN2A 2AN3A 1XDGA 1V95A 2X8AA 5CD1A 3EQ9A 4LEIA 4L72A 3KKOA 5B6PA 1AO0A 5DP1A 2HFJA 2R7LA 2W9XA 4NHEA 1T3SA 3ZR4B 4KE6A 3ZOKA 821PA 4RCZA 2P0EA 4HPJB 1X3SA 3A11A 3BKWA 4IUDS 4ZD6A 2O7VA 3LPCA 3ZWPA 1UKEA 1H8EA 3QUTA 3HNPA 1TM3E 1KBQA 3L8YA 4FDVA 2OILA 4JVNA 1F48A 1O3YA 1NUHA 1OXUA 1IIBA 2W58A 3EZ9A 1KDVA 4KYUA 1B73A 4DIKA 3PG5A 5C37A 4RTSA 1CYEA 4DV0B 2BTQB 1JG2A 3KJGA 1Z4MA 3LZCA 4KXVA 4OHVA 4YS6A 2DWOA 5TMEA 2OC9A 3HP1A 1NJ6A 1B16A 2I6TA 3GYBA 1Z4JA 4TVKA 1ZX1A 3BFKA 1JHYA 1JWAB 1NSTA 5TNXA 5FWNA 4IH9A 3FCOA 4G4GA 4P34A 2B1IA 3WISA 1ZU5A 5IT4A 3ZZUA 1KRWA 4H16A 2AF4C 1N0UA 3OX4A 4OSOA 2ZRMA 3KLBA 5K3OA 2WINI 3DR3A 1SQ0A 3CUWA 2ZE7A 4N0PA 1W5TA 4ZMRA 4LHWA 3TPCA 3B7PA 4RW0A 2GWHA 3RC3A 1KP3A 2R65A 3B9QA 2YFHA 1WF6A 4E4YA 2BMWA 3AI3A 2O59A 3SVZA 5H7XA 4ON9A 3HADA 3VRHA 1NJGA 4BBPA 2C7GA 1SC3A 5CH8A 1SCAA 3GR6A 1USVA 3TIVA 1E7RA 1DSSG 1QPGA 1IIRA 2FEWB 2WD7B 7ADHA 2D8AA 1LEHA 2Q3BA 3TZBA 1XA4A 4UKDA 2C3UA 2YV2A 3EE6A 4RKYA 5F4ZA 1Z73A 1A2BA 3PC8A 4IRUB 4F4IA 2AQ8A 2V54A 2VUSA 1QJCA 3AF6A 3QPCA 2GPYA 4ZYLA 3Q85A 4BZWA 1CUSA 1V45E 2E48A 3WVNA 3C6ZA 4K1LA 4BBAA 1LW7A 4UTNA 4KFCA 1PAUA 1Z5PA 4EA7A 4EK9A 1GZSA 4GMKA 1U7DA 2I99A 4YCDA 5JDIA 4RWZA 1FP6A 2JHFA 1EWKA 2AMJA 3AJAA 3T41A 4JC0A 3O82A 2WWWA 3MS7A 3RSCA 4M0LA 4PXYA 5T3YA 3F6CA 3WGOA 5E1DA 1B1AA 2ZQZA 2YOHA 3FKQA 1P19A 1ORWA 3K0KA 4DB4A 3THYA 4CEHB 4I50A 3K1YA 1E20A 1S9HA 2B6HA 4P5EA 1AXRA 4Q3NA 4HXEB 5ALGA 1FU8A 3TNYA 1RAHA 4FT4A 5KOHB 4XARA 1XK7A 3TQSA 3DMFA 2UVPB 4M87A 1NW5A 3GPDG 3EIWA 4CLOB 3UKDA 5KTPA 3PGVA 4YWHA 2XCQA 2XH8A 2C8KA 2PL9A 2YR0A 2D1TA 5CX4A 5CFOA 2OGUA 3IVXA 3AFMA 3HGMA 2PSHA 3H97A 3DAHA 1HQCA 5K3FB 1C9DB 1ZOIA 1Z0SA 2VPTA 1U2ZA 3F6SA 4B87A 4BBJA 2F8SA 5IWCA 3CZCA 5HA5A 1OUMA 1UK9A 3IE1A 2ICAA 4M1SA 1GEEA 1N3YA 4BRUA 3O1IC 1M2EA 1UPUA 1X7GA 4HQKA 1XMJA 1T8UA 5KYWB 4IHQA 3KFVA 3HGTA 3L40A 3CVVA 4LXGA 4YFYA 4BYMA 1JZSA 4CKEA 4X97A 3ZGXA 5KIAA 1YRWA 4Q1AA 1RXCA 3GAFA 3MWJA 1CB0A 4DHWA 2JF0A 3ZUGA 2HA0A 1UOOA 2ZS7A 3VQTA 3F7OA 1BGVA 2P2SA 5B2EA 4UDOA 5JH7A 1JIKA 2JZCA 2RONA 5JLJA 4D7AA 2QM0A 5EE9A 2JASA 3WLSA 3R8FA 3VYWA 3NCHA 4RESA 1SQGA 2BPOA 5SY4A 3NOOA 1GG8A 2ZVQX 3HSSA 3P9ZA 1W76A 2BMEA 3OQIA 1I0IA 5B58T 4BYGA 3FPGA 2QG9A 1PT6A 4H9GA 3K09C 2GZRA 4IDHA 4UMEA 4X8MA 1AU9A 1VB5A 1XD9A 4XIFA 1K8RA 3UAVA 2IYLD 3ADBA 4ZAVA 1SMKA 4AO6A 3F5QA 4L78A 4YRJA 5I48A 1M34E 1J22A 3F71A 1L7PA 3LQYA 4DG5A 4D0LB 4GXQA 1KJ9A 3JD0A 4ISCA 3U7EB 1Q12A 2C20A 2XQVA 4ER5A 2DX7A 3GJSA 2X42A 3TJMA 1MO3A 2FQYA 4N76A 3K1TA 1AGXA 2PAAA 1RE0A 3O4VA 4M9RA 1NQAO 5IDXA 2E21A 2TRSB 3ZGLA 5EY5B 3HYSA 1EP2B 3R5HA 4WUTA 4U7FA 3T9FA 3ZWAA 3K5HA 4CJXA 2WNIA 1HE5A 4FUTA 3TSYA 3VAZA 1SCNE 4C03A 5IVHA 2IFTA 2AMFA 4US2R 1VRVA 4L57A 4MI6A 4DMFA 3P9IA 3FTDA 3C8HA 3F5MA 4PCLA 4QD3A 3ZDBA 2F6RA 3R3UA 4WKGA 1Z2PX 2A9JA 1TC2A 3DE7X 2ZYTX 1EA5A 2JGMA 2OAQ1 5A3QA 4R1LA 4GMXA 2RB4A 3A6KA 3R4CA 4AF8A 2HMAA 4EG0A 4R2KA 1JG3A 1O97C 3WJ2A 3ZY3A 2ZJBA 2GBCA 2AN5A 3A25A 3FNRA 3KQTA 3A0UA 2QI9C 3E15A 3OM0A 1XZQA 5L6LB 2C7OA 2FSVC 3S28A 3EFOA 1HTBA 2VJCA 3WL5A 4L27A 2IQIA 1KSHA 1Y8QB 5F12A 2NU7B 5FBZA 3EK2A 4KR6A 2A1TS 2XTZA 2D7DA 3PGKA 1YTLA 4XPIB 2IBTA 1I0LA 2JIDA 4MS3A 5FUVA 4EFMA 1R4MB 1DEXA 5T64A 1YS9A 4C9BA 3BWBA 1MW8X 3HEMA 4DKJA 2QYTA 1QYVA 2I6XA 4G2TA 5LQRA 1B8OA 3ETGA 3U0BA 3OESA 2YFKA 4AKTA 4BLWA 4J3NA 2XUIA 4W1PA 1YJCA 2B83A 1JB1A 1N0VC 3ICOA 2XWQA 4P5PA 4WK4B 3WG9A 4CEJB 5HKKD 2C5BA 4KE7A 3HM2A 5LDGA 3SXPA 4B5KA 1FB5A 4FFBA 3VKUA 4MPJA 1NYLA 1OTHA 4Q39A 4EF4A 3KZKA 3T4UA 2P2YA 3RKRA 1CUHA 4TTIA 2WU1A 1XZEA 1JT2A 2VJDA 2YC2C 3DDOA 3KLOA 3G88A 1H8ED 1LZKA 2Q5IA 2BTQA 2XIJA 4FN5A 1A7UA 4U5XA 1Z63A 4CCYB 3AB7A 4MH0R 4ZKDA 4DMCA 3GJ7A 2CLIB 5ITSA 2WKRA 3M6XA 1QK4A 2VF5X 4ARZA 1H85A 1FFEA 4AB1A 2GEFA 3CB2A 3PQ2A 5KJ6A 5LLDA 2O8BA 4Y18A 4QJ3A 2ZIGA 2HK6A 1Y5MA 3H2IA 4EY7A 3FNFA 1ODJA 3DZHA 3OE7D 4CIXA 4GZLA 4HNAB 3BWEA 4IQ8A 1NN0A 1LDYA 3R75A 4E6EA 1NQWA 3GP3A 4TMZA 4B17A 3HDYA 2EL9A 5LFAA 1KQPA 1SVIA 3GW8A 3FNQA 3C5WP 4OGLA 5EXDA 1ESDA 1WNFA 2Q4DA 4RELA 3EZNA 4JB2A 3L8HA 1EK6A 1XB2A 3BCSA 2WD8A 4JK3A 5GM1A 3PGA1 3C8DA 3SHFA 1U0GA 2ZRDA 1KXJA 2I03A 3N2ZB 4FDUA 3DDWA 4HNGA 4Y9UA 4TV9B 5EZ6B 3K8OE 5IXYA 1IM5A 2JNWA 2XXAB 4AMYA 4B74A 2PFSA 1MXHA 3GFVA 2RIRA 3IESA 4NYJQ 3S6JA 1SKYE 2J45A 3NYIA 3BGWA 3H5RA 5H3HA 1TUEA 4N0MA 3Q2OA 1U6JA 3BORA 5ALXA 3UWMA 4KMSA 4OXRA 1DUVG 4W8HA 3ZVMA 3O9VA 3FVTA 3T7JA 3D43A 2P41A 2R68A 4DQVA 3OLZA 4E2XA 1JT9A 4ZOBA 2IYUA 4CF6A 1U0RA 5A3RA 3ZE1B 3KUUA 3PQ5A 1U1FA 2BFDA 2PTGA 4HH0A 1G5HA 1XZJA 3BB3A 3BXFA 1E7MA 1T5SA 3D7LA 3ZWNA 2B0CA 2VSQA 5E7IA 5FFMA 4ZREA 1RM5A 4OHCA 1X92A 1LV7A 5KINB 3WDLA 3M1IA 2C7VA 4D0NA 3RAPR 1G7RA 2EATA 2RE8A 2A3NA 1SULA 4X8LA 3QLUA 2C29D 2N42A 3F8SA 5G0UA 2YHBA 3IVMA 3LOPA 3VR2A 1O94D 2F64A 2BCGY 1NDUA 2GYWA 3KAJA 2BRUA 2YIDA 1CUBA 1H4TA 1XNGA 3H2SA 2ZYDA 3T9CA 4C1NA 3TSWA 1G1AA 3BE8A 5BSGA 1P9RA 3HV0A 4ITRC 3N2YA 3RVBA 5C51B 2ZZMA 1PT8A 1UBSB 3W8RA 1HL7A 4Q18A 3A4MA 3IV6A 4C2BA 3TBKA 2VYCA 4FEAA 2Q3LA 5CCBA 3TZQA 5CFMA 1BVYF 2ZJ5A 1KNQA 2XSZD 4WZBA 1M6VA 5EXEA 3DMGA 1T9DA 3PFHA 2OXIA 3UQYS 1DKOA 1COWA 1A2OA 3LBYA 4DILA 2P2DA 2I4TA 2GDJA 3PR1A 5HKLA 2OCXA 1T13A 4NCAA 3SIRA 1FIUA 3BMQB 3F3KA 1E7SA 4RQAA 1VM6A 3DM5A 4FBGA 5KSYA 4WBXC 4Q9DA 4OHBA 1VA5A 2I3ZA 3QU4A 1DQNA 4WA8A 2OUIA 4PV7A 4UHEA 2PKYX 3DNPA 2P1DA 5GONB 4B6RA 1JEEA 1G64A 2DERA 4FOSA 4IG4A 4NJOA 5HGJA 5BOSA 1UOPA 4KSBA 4ZCQA 3M7IA 2Q6LA 4CN9A 3FB4A 5KEIA 1I80A 1VTKA 4WESA 3O8QA 1AO3A 2YV4A 3LT0A 2HXGA 4PCUA 5AKXA 2EP5A 3IQWA 2F3QA 3WDSA 1GUAA 1D6MA 2LTAA 5L4NA 1KZ9A 2OLKA 4D1YA 4RQUA 1PT5A 3L0PA 1PYDA 2P2GA 3GAAA 4DIUA 3O3NB 2QTHA 4I9FA 4MA4A 1TKCA 1M5TA 4RLHA 4LJYA 1T24A 2IX3A 4DR5B 3ETCA 3ZTTA 3FCSB 3GL9A 1JKMA 4REMA 3W7AA 4F84A 2R8RA 3FTFA 4B6SA 4LMRA 2FH5B 1D8AA 1GSAA 2Q1UA 2R44A 3C5CA 3G9ZA 3PICA 2DWPA 3Q12A 3QK7A 4IM7A 3SEZA 5E3HA 4EMSA 2GHQA 3JALB 4FFNA 5BSTA 2Q7XA 5LA6B 5H83A 5BN1A 3EC2A 1VIMA 2CVQA 2O57A 4YGYA 3TLEA 3SQOA 2VDVE 2C7PA 1UPXA 2BISA 1HZZC 2PMKA 1NYTA 3HI4A 2PYDA 3MT7A 4FWIB 2B3DA 4MDFA 2AHOA 5DRYA 2JLUA 1L5GB 2E4VA 3WDKA 4LJLA 4WKNA 3TLAA 4PSVA 4AZ3A 3O4FA 3PFNA 3WNVA 5B4VA 3A9WA 1U9YA 2FB9A 3F97A 4ZTUB 1Q0ZA 2XUDA 2NZXA 3L0DA 4CETA 2ZKLA 2QY9A 1VBFA 2ODQA 2WHXA 1BCRB 4A0QA 3R0JA 2C2ZA 2MU1A 4I4TF 3CLTC 4LJKA 3IA2A 1FDSA 4IFTA 3GXBA 4MITA 4QX6A 3JQ9C 3PVCA 1XEWY 2TSYB 1YDFA 4IZHA 3GJ6A 4L5YA 1U2EA 3STXA 3S7TA 2W8BB 2ZAGA 4P80A 3A36A 2ATXA 4XX1A 4NPAA 1F0YA 4FR0A 4AMUA 4C04A 1QYCA 2QX8A 3BS4A 1XDDA 1ADGA 4OLHA 2RH5A 2A5LA 1V39A 5LQJA 2O6LA 2DVMA 4FYVA 4QEKA 3GPLA 1JDPA 5K51A 3AV0B 2PXHA 3LGXA 4R51A 2H07A 3ZWWA 2WU0A 5EZYB 2GK7A 4HHEA 3DBOB 3I8OA 4CMJA 3GFQA 1VP3A 4XWOA 1SPXA 4YRTA 4XQEA 2C5LA 1T9KA 3H3FA 1TQ8A 4LFCB 2ZUWA 3PQCA 1CR4A 3ZLUA 5SZJA 1X15A 3I09A 1HYHA 3I42A 1RQLA 3QBDA 4M1OA 4MTCA 3EEIA 4P3XA 4A2QA 3QE9Y 9LDBA 3JATB 3TTYA 4D9HA 2QD4A 2VA8A 4MVYA 3GFRA 4ZV4A 3DEIA 2QR5A 1WW3A 5KNDA 1DQYA 2B1QA 2PD4A 3CT4A 4MAAA 4WXHA 3QOXA 1EFRA 1ODFA 3PFFA 1G5QA 5CA1B 5AJTA 2J07A 3A1FA 1N5RA 1L1QA 1CDZA 2NYAA 3FPJA 3LS2A 4H7PA 1ZMTA 5TS2A 1SC4A 4CPDA 4IXDA 3UM9A 3ETEA 2F1JA 5L51A 2BM0A 4GSKA 1WRBA 4OG2A 5C1PA 1J6UA 4I0WB 1VMKA 3NKFA 3C24A 1P31A 4IUYA 4CCAA 2V3VA 4G5GA 4A6EA 1BMQA 2A30A 1H1DA 1PL8A 2Q5CA 5CB8A 5J1SB 2FPKA 3ZIUA 2X0FA 1XVUA 1EZ4A 1Z8HA 4ZOQI 3O21A 1M5UA 3QVKA 1NIJA 2ZUDA 5T4FA 1FJHA 3UJHA 5EUMA 3LFTA 3KWMA 4MWZA 1P18A 1XL0A 1J49A 1Q6ZA 4IDEA 4GU5A 1KVTA 5BVHA 1DQZA 2LKCA 2PUJA 3DD1A 4QPDA 3NZEA 4BE7B 4EJMA 5I7EA 1XJ0A 4RTMA 1JDNA 2XUQA 2ZEJA 3IP1A 2VS1A 4MP6A 3QNWA 5CXQA 2XQJA 1LNQA 2ZAOA 3LMKA 4TSKA 4JYMA 4FDLA 1Q19A 3E81A 3CINA 3ZQUA 2G09A 2GK6A 1JAIA 1MVOA 4FKBA 4DT1A 3AIMA 3PDIA 3I5XA 3ILYA 3RYHA 5B4TA 2PZBA 2DWUA 2AYXA 2FPOA 2HY7A 3E3LA 2V55B 4IVRA 1Z2OX 5JY6A 2O1EA 4DY4A 3GZNB 3I9NA 3JZIA 4DWOA 5LPNA 1NI5A 4TSFA 1KU0A 2O2CA 2D0PB 1Y9ZA 2QTTA 3CTPA 3KOXA 1WOYA 3P9KA 4TWZA 5EIBD 6Q21A 1FMCA 4N7RA 3GCGA 5E9QA 1UQRA 1O89A 2HDOA 4I08A 2IUYA 1WA5A 4A1OA 1RBMA 4JUCA 1VE7A 1M2KA 4AVYA 1XWIA 4PHFA 2SKEA 1DI0A 3Q9NA 4R54A 3D3KA 2GAOA 2EGUA 3OURA 5FTJA 4AQ7A 3CBGA 1IQ0A 1O08A 5CIWA 1ACMA 1TMOA 8ADHA 2E4AA 1L4BA 1RP7A 3ZZNA 4BOYA 5BQFA 2Z6QA 3A4TA 5IFLA 4DV2B 1T0PA 2H51A 3OEHA 3A3OA 1MC8A 1WB6A 4V39A 4ZDIA 4LWQA 3WIDA 3BK2A 4UTRA 3ZCPA 1DC6A 3HN2A 1QH9A 3KQVA 2ZP1A 5EWMB 4TMKA 4UNQA 1SBZA 2Y05A 1WKBA 4Q4JB 3S27A 3UV3A 4BCDA 2B35A 2WKPA 4QHYA 4HNUA 5EGSA 2FG6C 4HB4A 2B9EA 7AT1A 2I7CA 4MKIA 3KLPX 1O5IA 5B3AA 3LPAA 1LPBB 1JE0A 3ZKAA 4LF4B 4F93B 1EDOA 1HEUA 2XXJA 2OCYC 1H66A 2PWBA 3AUXA 1GUYA 2B8JA 3EDYA 2IOYA 1KR5A 4IIYA 5ECGC 4Z2YA 4DA9A 1JXOA 2BC9A 4N0DA 2HEGA 3CE6A 4JIGA 2YRWA 4YV7A 1YFJA 621PA 4QPNA 1CXZA 1FSFA 1M67A 2EG9A 2EZUA 3FM9A 4OAQA 1MNAA 4LC9A 5BRJA 5C5CA 2AFIA 2RJNA 4TRRA 3B8EA 2GPSA 4UHFA 2OBMA 2R00A 3GLHA 1LPPA 4H1TA 3KEQA 4P32A 4ROTA 3V8QA 2H9IA 5F5NA 1PD1A 4BV2A 2NQTA 1EESA 2NZ2A 1W30A 1G60A 1SXJB 2LE0A 2QG4A 4G89A 2R6R1 4TMXA 5BSKA 3EBLA 5AJHA 1I6LA 3E2MA 3HDGA 1TOAA 1CHNA 3DCIA 5LA6F 2BHRA 3PNBA 3DXXA 3EA0A 3MYRA 4G56A 4I5DA 4XQCA 2HIMA 1WPXA 3WBKA 2IIQA 2CVZA 3CRZA 3L93A 3LQ1A 4QDUA 4I9HA 1CNEA 3ZV3A 3V1KA 3OE7A 1CW2B 2B3TA 2FPWA 5M3BA 2I7VA 3GY0A 4FNGA 2ZE8A 4KZKA 1MTOA 2PRIA 1T25A 3N86A 4MVJD 4DLVA 2O2YA 4EHIA 4MUXA 4QQRA 4XX0A 3TIFA 3ZDRA 4BVEA 8ABPA 1B93A 1GNSA 2R5FA 3GNTA 4Y3UA 5B53A 1WM1A 1MB9A 4US0R 1FNSA 2X2OA 3HP7A 1RIFA 5K09A 4V0NA 5KQPA 2V0GA 5HRAA 3C3XA 3VKWA 2QN9A 4RHEA 1XDSA 2D00A 3LYAA 3PPVA 1C9EA 2CZGA 3L7IA 3NLLA 4MRRA 1UXIA 4U0KA 3UT6A 5JJBA 2YUIA 3L92A 3CX4A 2BZGA 1ISPA 3MS2A 2XECA 1C0LA 1HOTA 4L0DA 4TKMA 3HABA 1V3TA 3KJZA 3MERA 2F8TA 1QIKA 4Q6BA 1Y9DA 4AU1A 5JADA 2AKYA 1ZGGA 2ES4A 3COWA 4H77A 4ILEA 2CLEB 2J3EA 3JASA 4BB0A 3LO5A 3SJ7A 5KDOA 1TK2A 3IUMA 3NDIA 1NL3A 1SELA 4IKPA 1QV7A 3K5IA 1DAKA 1OZGA 4M3NA 5H0IA 4CV2A 4JC4A 1DKPA 2RHOA 3WFZA 6LDHA 2B4QA 4Q48A 1ZAYA 4PHCA 4LJ8A 2B2CA 3CEAA 3ZWXA 4DJ5X 4R16A 1GGFA 1YIDA 3OFJA 3X1WA 2DUJA 2H8GA 3BXPA 5CH3A 3T38A 1NW9B 2EOAA 3FLAA 1SVLA 1N5DA 1BG6A 1ZH6A 3LUGA 5CYOA 1BMDA 2OZLA 1E89A 1N6OA 1N78A 4DCJA 1EWTA 4KN8A 1PS0A 3C41J 1W35A 3VR6A 1N0HA 2QNRA 3W1WA 4F97A 1FFGA 1RCFA 2OBLA 5LUBA 3P94A 2NYVA 5A4FS 2I8LA 1DAHA 4HFNA 4D57A 2CJPA 3P20A 2H7YA 3AX6A 4J3FA 1MB0A 4B79A 2ZAYA 3MJDA 2A9RA 3IR6A 2CHUA 4P81A 3V8MA 2RHGB 1RBYA 2YFQA 1TLFA 4DJAA 1A5ZA 2DY1A 4LYGA 5DHRA 4U2EA 1FVOA 1E3QA 2M2IA 3O1JC 4YQZA 4R6WA 3DKVA 1WHSB 3IQFA 4OKSA 4BGVA 3KQHA 5FX2A 2OHIA 1E1NA 1SQFA 3TRDA 5B6JA 1KL7A 2WWFA 1IONA 3B82A 4JJZA 1ISIA 1REQB 5FWYB 4A8JB 1MOPA 4DA0A 2PLFA 5CDFA 2Z2ZA 2IYTA 2DY0A 5EFOA 2WK1A 4PIPA 5FA8A 1BE8A 2VJMB 2FJ0A 3Q11A 2H2FA 2RCNA 2IOFK 3C48A 3NKLA 1YFZA 4IYJA 3NHBA 3JQ7B 4N3AA 3U3DA 2REOA 4HDCA 3VR2D 2Z8YA 4DR3B 4F1KA 4JODA 1V71A 1C4OA 3QU7A 4H7JA 1S2IA 3E58A 4TYQA 2MSLA 3WP1B 1WXQA 5EIWA 4BKMA 1MBZA 3YASA 5MGBA 4EB3A 5B3JA 3N8NA 2P1ZA 5F51A 3PCXA 4O0MA 3WMRA 2FNAA 4ZDKA 2QIOA 2OMKA 3D8BA 4XCXA 5ESDA 1M54A 3UN1A 4DLSA 3UMGA 3QUQA 4MUJA 4OM8A 4XYEA 4KQ9A 4RFVA 3NTOA 5AUPB 4RVOA 1NR1A 1NW4A 1RRMA 2X1LA 3BSYA 2CW5A 1QBKC 1QGAA 2YICA 2YWGA 3AM4A 1MRNA 4TMTA 2JBHA 5B58C 5IYZA 2XSZA 3U37A 2V7WA 3V2UA 1Z2EA 3FMGA 2JGEA 3ECAA 3A4LA 1O0SA 3BD7A 3UMSA 3DW3X 1E99A 1QHIA 1NLZA 2NSDA 4E2FA 1ZSNA 4R40A 3RYCA 2VP9A 4YMUA 3A3KA 1F17A 3OU2A 2I34A 1XRRA 2FMIA 2Q0XA 3Q7TA 2XHZA 1KI6A 5IJ9B 1RXSA 2B37A 4GHWA 3LCVB 4J0DA 2WB4A 5EIFA 5CB4B 5JYCA 1T3HA 1V7PC 1XBTA 1K8ZB 2VH1A 3UB2A 3UG7A 2DBVO 3VR1A 3I6BA 8ATCA 1OGYA 3HCAA 5KNCH 4KBFA 5AI4A 1UPBA 3RU7A 2IHBA 3P0JA 5HHTA 4KTTE 4XFJA 3TL3A 3ZNNA 2HU8A 2FE1A 4J1TC 4BVLA 3RSFA 3AZOA 1K92A 3TX6A 1MO6A 3EGEA 2O23A 5B1DA 2E5FA 1UBFA 1VPTA 4PLPA 4QRDA 3OLYA 2WF8A 4HS9A 5IARA 4YCMA 3OZEA 1FJGB 3H2HA 1R4ZA 3IT3A 4LC0A 2NXCA 2QL6A 3OJFA 2CXXA 2Z3WA 3FUCA 3UPTA 2Z95A 4X9XA 4DXAA 1DG9A 1PT7A 5JBQA 3JWIA 2JGKA 1Y7TA 3D6VA 4XEHA 3DOCA 4FKMA 1N2HA 1DRJA 1PQPA 5CURA 3B2NA 3RWMB 3T7KA 2D59A 5CJJA 4ND4A 4P08A 1VA4A 2JLCA 2GEKA 2C98A 2QMOA 4PCVA 1VGVA 3NNNA 2Q2VA 1NBMD 1PJ4A 2FPSA 4DIDA 2Y0CA 1AURA 1CRQA 1FFBA 3N2LA 2X41A 4OMDA 3PJRA 2VPYA 5CNIA 1KO1A 1W9HA 4WY2A 3SEFA 4PS0A 2I2WA 2B36A 1D6NA 5ALEA 1ZK3A 1WSWA 1YJ5A 1Y5NA 4CTNA 1X1SA 5AR1A 5FRDA 4C05A 4UZEA 1T6XA 3NHAA 4QRHA 2C4UA 1QB7A 2N1MA 2OCAA 1K97A 2OBYA 4IFEA 5C8VA 3FR7A 5JFGA 2WF9A 5F35A 4K81B 1UFOA 3NEYA 1BEZA 1D7OA 2VNIA 5JTUA 1FP4B 1S3IA 2FI1A 3OQ1A 4NI5A 4UBKA 3ZCQA 1B0ZA 4D5GA 3HXOA 3L6UA 1T4MA 4JELA 4RXMA 4ZQIA 2IODA 3AL2A 3MW8A 1RYDA 2EHDA 4B0OA 2HA4A 1RDFA 3R6LA 5TF4A 2XNDA 3UOWA 3QSGA 5GTDA 3JW8A 4AJPA 4FPXA 4D4LA 4YV0A 2RHHA 4IUBS 3FF4A 3KLMX 4QBFA 3RVKA 1PJ2A 5I9MA 2XWPA 1E1DA 1IN7A 1R6UA 1QSGA 3JWPA 1FEZA 2JEOA 5GV8A 5JHHB 3DCNA 4Z4IA 1YUNA 1R9GA 1UJ2A 4JP8A 1YQXA 1G8HA 4UBMA 1AVTA 3PUYA 4ZI3A 3UF0A 4RKFA 2OY0A 2SCUA 3BJEA 4ZALA 2DF8A 3BMNB 1YIOA 1EK1A 2WAAA 4ZO7A 3V8BA 1KAOA 1PUXA 3SP1A 1K1EA 4YRNA 2J67A 1KI9A 2Q5FA 3DXZA 5B1SA 4W9NA 1Y63A 3GVXA 4L8FA 2M6KA 2NN3C 3IHWA 5C46F 3P4YA 2MYTA 2PBRA 3I53A 3TG8A 5AKHA 4TYPA 1DX4A 5J3JA 3RAEC 3ETLA 5FOXA 4I81A 5E38A 3PFBA 1E6UA 4DMGA 1YUMA 4HGZA 1U1DA 5EJIA 4EJ0A 1Z0JA 2V6GA 4Q7LA 4QU0A 2AC4A 2NUAA 5H16A 4QC2A 4MJXA 5ECYA 5FAXA 3TS1A 1TJ3A 1LK7A 3I3SR 3O47A 1WUKS 2CYBA 2Z6UA 4KQWA 4HUQB 5BVGB 1E9BA 1M75A 1HO3A 3ICCA 3K15A 1T4GA 2H31A 2JGIA 3KR9A 4JT4A 4ZT5A 1P5FA 2P9GA 1FNDA 3WKDA 4EGJA 5L7WA 4I66A 2QTBA 4MQ5A 4GPEA 2DBZA 2ZYIA 2BFEB 2FEKA 4JJEA 1H2YA 4TXLA 3UHAA 3N75A 1PYOA 4HBZA 1CZRA 3RW9A 4CF7A 4ZARA 2FR1A 2QVCA 4FBLA 1JDTA 4RK1A 1JA9A 5ITVA 5JRDS 2F1KA 4J6FA 3MUNA 1E2MA 3OSZA 2IH2A 1VGRA 3VDMA 3I23A 4GS5A 5CLQA 5FO1A 3LVBA 4U00A 2DR3A 4DRXB 3NVKI 2VATA 2PRSA 3BH6A 5I4BA 3EPHA 1PQWA 3A1UA 2PUDA 1GL9B 3KYIB 4Y9TA 4WACA 5IVIA 1LLQA 3KSAC 5IZCA 1QF6A 4OY3A 4ZYZA 4QO8A 4QSHA 2FW7A 4HOYA 5H81A 3KXLA 3C87A 4DJFC 1ILEA 2QVYX 2XXBA 1ZMRA 2ZRKA 4RIEA 5DW0A 2C9DA 3JXEA 2FMHA 3R3JA 4IFIA 1PGQA 3T7RA 2OXTA 1L6IA 3KR1A 3SGLA 2AOXA 2NYRA 3NBKA 4DIEA 3I04A 3SIXA 2QD2A 5IJ9A 3D7RA 3G2HA 3MQFA 3SZGA 1XLVA 5B36A 5KWVA 5EI5A 3QG1A 2VWPA 2AFHE 3WQSB 2O3TA 5AMXA 4NZ9A 1KAMA 2IBMA 2YDYA 3HB7A 1MIOA 2GD2A 1OYWA 2SNIE 3GGOA 3GRRA 3H0EA 4WLNA 5IXJA 3KEOA 3R5XA 1P9NA 2IDZA 3WMFA 2FN8A 4G5SA 5GQSA 1H9CA 1AUQA 3WIOA 1KJJA 3AR7A 2R9VA 3DDSA 1LU9A 3U4MA 4LXXA 3V7WA 2PAFA 2W7TA 1VPDA 2REBA 1MW9X 4P84A 1LVHA 4AECA 2LGJA 2GJ8A 3WMGA 5JCZA 2HMSA 5BYJA 4URVR 1EHYA 1I36A 3GMTA 3L4EA 2N9UA 3DD5A 5ER6A 3GFTA 1E64A 2EW1A 5M2QA 2W2LD 4DRXA 4N3BA 2OWEA 2PXCA 1II9A 1RRCA 2B5OA 4K6OA 1J07A 1NI4A 2CV2A 2BJHA 3PQEA 4DVGA 2DULA 3LCMA 1XZPA 3NBQA 4Q05A 3QXSA 4UAVA 4X1KA 1JQ3A 2YIJA 4JJKA 3ZVRA 1I1OA 3BA6A 4DSUA 4XRRA 3AEKB 3C3MA 5K3FA 2ZCVA 1Z6YA 3ET5A 4IZIA 2ZM6B 3W5BA 3HO1A 3COZA 3D6AA 4HAOA 1RMTA 1S5PA 4MS4A 2QKYA 4JP3A 4CG1A 2ECKA 1KVUA 2DH5A 2P4EA 3UWPA 2CMKA 1CR0A 1BJTA 1VL2A 2DEUA 2GBFA 4TMFA 1YTUA 3VNSA 1Q7TA 2Q6VA 4MGKR 1BDMA 1AGNA 1QRDA 1WWKA 3CKKA 1GY8A 3BULA 2NUAB 1BDIA 1M1XB 5JCOC 4NS1A 2PIDA 3JQPA 4WKBA 4ZQBA 1TQ2A 1VLLA 1XXHE 1ZR4A 2PKCA 4X61A 2A92A 2WI8A 4Y7DA 5DBOA 4PPYA 2ZI7A 1P7VA 4YDSA 4UJ5A 1ZK0A 3HZZA 3NTXA 4GP9A 4CT0A 2ZPTX 4IHJF 5REQA 1ZIOA 1ZONA 1QZ3A 2X7XA 3FTCA 4R1TA 1Q2UA 2PZMA 1XDBA 1EB8A 3MF4A 4MS1B 4C1BA 4CUZA 3OSUA 5JCPA 3TB4A 4KNYA 2Y1GA 5JY1A 1C8VB 5JUWA 3BRWD 4OQEA 1NXWA 1ZM7A 3OCCA 4N9QA 5U1PA 3JD1A 3ZHCA 4Q7KA 1FTGA 3IOYA 1FL9A 1IATA 2YMMA 4H0CA 5C9ZA 3EPKA 1MFZA 3HCOA 3P2KA 3PFCA 5T4BA 4I3FA 3W2TA 1T1EA 2EFYA 1GTMA 4JMLA 4MINA 4BX9A 4L51A 5EPEA 1M6WA 1WO8A 2WD7A 1ZH4A 5A2QA 5TPZA 5IM5A 4I4IA 4O4HB 2E87A 4N54A 4QU9A 2WW8A 3KALA 1VL6A 4DC1A 5BSHA 3RNOA 3CLRC 3QLEA 4OA8A 1VPWA 1C80A 2AOTA 3EGXA 2XRMA 4KPUB 2IZOA 2XI4A 3EF1A 1SZCA 3RK4A 1YB5A 3E7WA 1ZYUA 3VVMA 5F1KA 3RWOA 2J0QA 2FZGA 4DEXA 3MJ4A 3TJRA 3LIIA 3MXOA 5C3MA 3ZDDA 1UUFA 5DB4A 4DMHA 3QVGB 2HF9A 1SIWA 1ZRMA 1ZBQA 3IJEB 3HVRA 8LDHA 5FBVB 3MFYA 2WHEA 3EAQA 3WLPA 3JQRA 2RHJA 3MMZA 5A1JA 3UUFA 5AKZA 3W05A 2SECE 1QH0A 2WKWA 1JA0A 1I7NA 1PJ8A 2Q9BA 3FVRA 4PLCA 4YREA 4DSZA 1N1MA 1M2VA 1CPYA 2OCDA 4KQIA 2PU5A 3NH6A 1P8AA 2Y1DA 3K31A 4RVFA 2DT5A 1GUBA 4BNMA 1ZJYA 1Y7LA 3IERA 4FDAA 4I6EA 4D80A 1RZUA 4QUIA 2BGGA 2W6ID 3SQWA 3Q9SA 1R5BA 4JI5B 3PNOA 2JFOA 1FC0A 3UQZA 1L7MA 2WUDA 2N75A 1KMMA 2XKJE 3GCDA 5A9TA 1Z4NA 3ZQ4A 2I2DA 1EXMA 3H6KA 5HQJA 5HR5A 5BP7A 3A4VA 2RGDA 1DAEA 5AM1A 1TE2A 1VKOA 2AWNA 1E4EB 1JX6A 2ATIA 2PL1A 3MTJA 2WYOA 3U26A 4JUAA 2C9YA 5FADA 4LOLA 1SBCA 1KOGA 3L4BA 1TXGA 2R4TA 2XOEA 3MAAC 3SZOA 4EA9A 3ROQA 5K8IA 3W2EA 3W9BA 4RKQA 3QVUA 2W2MA 2X0RA 2O2SA 4YJKA 1CY1A 1KO4A 2QZJA 4H3KB 4RLQA 4MUFA 4WXPA 4JJ4A 4YI5A 3AUFA 2PUGA 2EXXA 4LNAA 1GTSA 4JBGA 1IYZA 1XA0A 4M0PA 4RJTA 1T3ZA 3T12A 1PDOA 1UT6A 2NO0A 2AI1A 1SU4A 3E9MA 1VL8A 3QUSA 3USZA 3EFBA 4QHTA 2ZLBA 1WDWB 1ZP6A 2O7NA 2QW1A 3ASZA 2AW5A 2Q6KA 3IMFA 1B76A 4ER3A 3R6GA 5AT1A 1ENYA 4ZCPA 3ZDCA 3QU9A 5LLSA 2YN2A 4ZEOA 4BZQA 4ZVUA 4UM5A 5IN5A 1YOVB 4TTAA 4KFUA 2H1RA 1FS4A 2VHTA 4CHTA 2BHNA 2QJRA 2XUJA 1MG5A 4OYYA 2B21A 5JPDA 3AG6A 4J0EA 3EGIA 3TGPA 2RSLA 2EAUA 2HQRA 3CRNA 2IV3A 1YAHA 2WPNA 1FFSA 2O5RA 2GH1A 3RR2A 1G9XA 4A23A 5AJVB 3GZJA 3C45A 1QWSA 1D1QA 3UAYA 1IRIA 1ACJA 2CL5A 4QOEA 5KQRA 4B7ZA 2FRDC 1C3EA 4HNQA 5ALSA 1WCIA 1NLMA 5TLSA 1Q0TA 2GB4A 1N5MA 3LNTA 1V4NA 4PYQA 6REQB 2EFJA 4JEIA 2Z9CA 1WCXA 1ORHA 1EDDA 1X7ZA 2O2GA 2VJQA 2XYRA 3ED5A 4K03A 2X9GA 4KXWA 4N5MA 3TKLA 4JI4B 1QX3A 4ABTA 3LTNC 5D00A 1MN6A 3AR8A 3UICA 1FZQA 1UAAA 2ARKA 2QUZA 5HZMA 3KT0A 4E2WA 5I4CA 1ZRSA 5CVUA 1R8SA 4DLAA 3GI1A 1YA6A 1KS2A 4RD2A 4AY4A 5D7BA 1CUZA 4JYCA 4RSMA 3I32A 1K7FB 4YLEA 2AWOA 3A6DA 1W4CA 5LOVF 3M6FA 4O4IF 1FFCA 2XMGA 2F3UA 1DVRA 4AX4A 1LI4A 4BFUA 4REQB 1EGAA 4WNYA 2L2QA 1ONPA 3CKYA 1MFPA 3LHFA 2VPWA 3ZGVA 2FR8C 1V16B 3QV1A 4ENTA 4R1PA 1E2LA 1ZK4A 2CCKA 1MB3A 1SUSA 3IP9A 1WD5A 2H3HA 4G5FA 4EF5A 5BR8B 3HU3A 4R81A 1PFUA 3IJ5A 1U11A 3OA0A 1SZDA 2DBRA 3RASA 5CDTA 4GICA 3QW2A 4FONA 4RETA 2JHAA 4WMLA 1RQNA 3ICWA 4AWBA 3CW9A 3RLIA 2WIJA 2FFRA 2PKWA 3DVQX 2CUNA 3ORSA 1IOWA 1BN7A 2VCHA 1TYZA 4GECA 4BX2A 1TYAE 3HDQA 1XNRB 3NPMA 2PN1A 4DAOA 3AEUA 1WDKA 3EHDA 1L4GA 1XYVA 4FJ0A 3VUEA 3WADA 4LGYA 2FAXA 1Y1QA 4AUMA 1GUZA 2GM5A 3CRMA 3N6VA 3WYAA 4EYEA 4J0HA 4QJ5A 5JT1A 2V4UA 1Y8ZA 4KK3A 4ARAA 1L7XA 3E4DA 3RK0A 1LZLA 1YRYE 2EJTA 3GFOA 2CNNA 2YL2A 2Y67A 3W5SA 4Q1CA 4I6JA 4J7CA 3BOSA 2KHZA 5E9WA 4JI8B 1NMYA 2FLVA 2AXNA 4HUJA 3UMVA 1D2MA 3WGHA 1HLDA 4EVSA 5JANA 5KBYA 3U1VA 3P27A 1Y98A 2BMFA 2W37A 3AHGA 3FCEA 1PIWA 1UBNA 3VOSA 4MPDA 1CU1A 2ADOA 1J8VA 2HYDA 4AUKA 2Y1WA 4QU5A 4JLOA 2BGRA 2IEDA 5EERA 5E9JA 1QE5A 4E13A 1XD2B 2K4MA 4IIUA 4AROA 4ZV9A 3BQNB 2WTMA 1YZKA 4ZTBA 1LDGA 4HFJA 1VIDA 5L3SA 1MQSA 2P5TB 2GZHA 4XM1A 1E62A 2EX0A 5HWSA 1GWNA 3DPSA 3QFRA 4F4HA 2BDEA 5KX5B 2CC2A 5JZVA 4X64B 2VJOA 5CVTA 5BMVA 4L9RA 1Z06A 3KDAA 4JQOA 3QVGA 4N6GA 5JJIA 4R05A 4A2CA 3LBFA 1OAKA 5LYJA 4XWYA 1XQ1A 1TGYA 3KPUA 3GVCA 4WI1A 2I65A 1NMZA 2AOUB 5E1OA 3V8EA 3WWOA 4LFBB 1G8AA 1NBME 4FYPA 5JXGA 4DUGD 3EFOB 4TTSA 4UZFA 4DTCA 4Z1OA 1BW9A 4WDRA 5FA5A 4P3NA 2YXDA 4O4HA 2PUHA 2F1HA 2XDAA 3G3EA 4ICIA 4KI7A 2WAOA 1IMJA 1HDZA 1WSAA 3IDFA 4LHZA 5FLYA 5C7OO 5KTMA 3D2CA 4ETNA 3AEUB 4TWJA 2Q21A 2WJYA 1RZVA 1T2NA 3GB9A 3HB5X 3WB1A 1HURA 2G40A 2OBBA 1RAIA 5CVCA 1N75A 2WG0A 5ICFA 4R2IA 4GGMX 5FUBA 4UFNA 5DHFA 5JARA 4M54A 5KUTA 4Q1EA 3HZOA 2B2NA 3OZSA 3PWKA 3P2EA 4Z2AA 2D54A 1QF9A 3UJAA 4B32A 3ADKA 1K9SA 2H7VA 10MHA 3GLSA 2C8LA 5CNKA 4GPTA 2WLTA 3D4LA 1J06A 1YC2A 2YY5A 4XQ0A 1NULA 1SXIA 2X1VA 2IYQA 5F2OA 3N07A 1DC3A 4LY0A 1SKMA 2PMBA 4KIFA 3ZYZA 4JAVC 5AKEA 1YR7A 2V5AA 3AONB 4BV3A 5IH3A 2L0XA 3L6EA 4BL5A 3DHWC 5J5VA 3ZDXB 1KI1A 3ONEA 3PLNA 1ZNYA 2OO5C 4RH3A 5FL7A 1W75A 2PNJA 3X1DA 4ZJYA 5DKFA 4GRAA 3HXMA 2GT1A 4J29A 3BL5A 5FOTA 5A4DA 4M9XA 3PX7A 2A7XA 3S2GA 3PNYA 3MOSA 2AD5A 4J43A 5D8DA 3TW4A 5L3QB 5LNK6 4U3JB 4MQEB 3THOA 4C3ZA 2R6ZA 1VPLA 2LUOA 4XRGA 4PZAA 1SCBA 2VUHB 3NEJA 1GT91 4BCBA 5BPHA 1E1RA 3VU8A 1XRLA 1OA0A 3HN6A 4QICA 3W2GA 5D5HA 2HHAA 3HPQA 4Z4HA 2RH8A 3IBFA 4G0QA 1J8MF 1MPXA 2CNWA 2E1PA 2ZR9A 3PC6A 2HIHA 1J23A 3I5UA 2JAPA 4X6UA 4YH1A 3ZBTA 1NV9A 2X1HA 2A57A 4B3CA 4EZBA 1CX9B 4YUVA 2O7QA 4UNPA 2IQ5A 1JN0A 1N2GA 1UK7A 1U2RA 2ETVA 2WWTA 1K4KA 1UBRS 5BQ3A 1ZLYA 4K6FA 5FR2A 3I8XA 1KO5A 4QGFA 4HFMA 4II3A 1LSJA 3KKPA 2PX8A 3TNJA 1OXBB 2R6AA 1NVFA 1NVMB 5BNIA 1JPVA 3HQ4O 4HG2A 3TQIA 3DC7A 4G26A 1HLFA 1UPFA 4JASB 1ZJJA 3GAZA 3PHJA 4Z3OA 3UFBA 4F85A 2YS7A 1FP1D 1YJ8A 3LXXA 4HRVA 4JHXA 4KQKA 3FCXA 3OO1A 3W2FA 3GARA 2EJUA 3OT4A 2Y2UA 3PF9A 3HFRA 2F9LA 1VJTA 4KNVA 3TZHA 3MWDA 4L76A 4X94A 5HCNA 2WIFA 1EEHA 3CLHA 1ZD2P 4LNUA 4R1OA 2GCIA 1DJPA 1BVUA 3JATA 1IWOA 1H8HA 4BXOB 2VJLA 3DT6A 3LCRA 2IUUA 1N5LA 2ZXEA 1MDFA 4GWGA 4OO3A 5EXSA 4DCVA 3THYB 5HF5A 1HI9A 4ARBA 4AI6A 3GLRA 4HKTA 4RD4A 4ROSA 2ZE6A 4K6KA 4KXYA 1XMIA 1QFJA 4ERXA 3DEHA 5P21A 3UK6A 4AKHA 3OICA 3VYRB 2W2KA 3G9XA 1FDRA 2O8NA 3CLUC 5BN5A 4WJLA 5J43A 2ZWPA 1VJ5A 3T3PB 4M2LA 4BQEA 5G1OA 4LXQA 3V7NA 4PZ9A 4R8KA 1OY1A 4GFDA 1IXKA 3GFGA 4TL8A 1Z83A 4TXJA 4ML3A 3T99A 1XTIA 4LGCA 5EZSA 1PJQA 4BFLA 5CT5A 4TLDA 3VDQA 4CCWA 5IDWA 4G0WA 3GP5A 4KE9A 2O6HA 1EUDA 3WK5A 3A14A 4DMRA 5FOVA 2WC1A 4WNCA 3JQCA 1Y81A 1EUYA 3KPYA 4TV9A 1GCUA 3FHOA 2F9MA 2IEGA 4M8NE 4BQNA 4BO4A 2JGDA 3WGTA 2V58A 1DJMA 1XD8A 5HP4A 3N7TA 3Q7RA 2PVCA 3QNMA 4NCHA 4R9VA 5FORA 3O2QB 3G89A 1QUFA 1GFSA 4RC9A 3AO0B 1QO0D 2YBEA 5I4KA 2XB2A 2GVDC 3RANA 3WLMA 1WE2A 4RZUA 3RARA 3OIDA 1UJCA 3AR5A 1WVIA 4CMHA 1PZGA 2WSBA 3E7DA 4QYWA 1D2AA 2AR9A 1ZUHA 1T5BA 3KB2A 2JATA 1M0TA 2AOTB 1QU2A 3RF6A 3UW1A 3NANA 1YDEA 3QEBZ 1YV9A 1Z17A 1ULHA 2CKMA 1BYUA 1CUDA 5BR7A 4OI0A 1RHJA 1DUIA 1PJTA 4HSEA 4Z1MD 4EG5A 1UT8A 1HRKA 3K0FB 3PT9A 4TQGA 3GELA 4GOLD 3VC7A 5IF9A 1RKUA 4X1IA 3QX9A 1F5NA 2QGNA 4PNZA 1S8NA 2QMUA 1TIBA 2PJRA 3WB0A 4ZP1A 3TI9A 2VPXA 1LK5A 3KVYA 4PYIA 5A03A 5GIOE 2XR1A 4KQXA 4G4SO 1FNBA 3GZTB 4J3JA 3WY9A 1Z15A 4EYOA 2BDTA 5C7YA 5CDGA 4PGAA 2BJVA 2B8NA 5MN4A 4H08A 1PDWA 3P9QA 2G1UA 1X80A 4E15A 3N59A 2BEJA 5DK6A 5HILA 2VJKA 3G7SA 1L7QA 2JGJA 2HRZA 2XZTA 1W88B 2JI8A 1I24A 2QJFA 3CNLA 2ZIVB 3IURA 5IFKA 2QENA 1THZA 1V7ZA 1E0DA 1RQ7A 3BTUA 2HF7A 2N3ZA 1UJ6A 2MSEB 2JFVA 5IEBA 3K0AA 3RAGA 4RH1A 5DHSA 2IW1A 3OPQA 3Q3EA 1XU4A 3TKAA 4HXYA 4F2DA 1OT5A 1GSOA 1FYWA 3D7KA 5TQJA 3MQ4A 4RDXA 5D5QA 1R0SA 1QCDA 2EF1A 4OUDA 5DGDA 5KYUA 4F46A 4PCAA 1ZG3A 2QN6A 3R7LA 1CY0A 3JWGA 4YAIA 1V5EA 4KO3S 4RZSA 1LI7A 1E58A 1E3DA 1CS0B 2P7IA 1ES9A 3DLTA 3AYZB 2OPBA 2DWCA 2FA9A 1PW5A 1Q0UA 1HDEA 3EDRA 3DBVO 1C2YA 2HC9A 3EGDA 4NMWA 4RIHA 1PSZA 5FNVB 3HCBA 5C5DA 5IC4A 2ENUA 4W6QA 2PWYA 1KEPA 5AQ1A 4ND7A 5AI9A 4I4TA 2P69A 2YUTA 4RHUA 1NA5A 1U5BB 4BLUA 2DLNA 3BE4A 5FQNA 1O4WA 2ODPA 1E3IA 2RHRA 1IQPA 3FDZA 3MTQA 1EFUA 3TINA 1OXSC 5JV5A 2ZIXA 4X7PA 2IF0A 3CLKA 1GYRA 4XDZA 2C9BA 4D92A 2WJ6A 1KYYA 3HY4A 3GPCA 3E9DA 4PM4A 2CLKB 1UBUS 4D3YA 4R8SA 4KFTA 1A95A 5LJLA 5A0VA 1QE0A 2C2GA 2VQ3A 1E2PA 3BX1A 3NHPA 3PX3A 3R5FA 4HMQA 4ZPXA 1U9IA 4ZRDA 5KKAA 3WL6A 3ZV6A 2W90A 4BO7A 4ETIA 5K4GA 2GYVA 1OT3A 2J31A 1FBTA 2B5VA 4LJ5A 1JS1X 2C4MA 4ZV7A 3H9GA 1S9DA 1VJDA 4ZAWA 4CDNA 4DMKA 4R8RA 4RDHA 4DW8A 3KEMA 2OQVA 3BMOB 5DVZA 4DUGA 3C4QA 3AETA 1ZVVA 5F78A 2J9GA 2XTMA 4DLWA 2CNBA 1C9NA 2J3LA 4ADSG 1HXHA 5JMOA 3CW8X 2JK0A 2OL4A 3TQTA 1DADA 2R47A 2C2XA 3HACA 3W8NA 3FROA 4TQ9A 1OFVA 1T0HB 2QLBA 2QOEA 1CJCA 1VZ2A 2FUEA 3THWB 2H59A 3DOJA 5L45A 2YS6A 4C4PA 4QOJA 2Z56A 5HDQA 4D3SA 4AJJA 3W9UA 1R9JA 1SA0A 1J42A 2PK3A 4EY5A 1NVXQ 3FSGA 3UJ7A 3VJRA 3CCBA 4DVJA 3NC1C 3RD5A 5FTNA 4CEHA 1BFKA 2CSUA 4P31A 2I2BA 1J70A 2WG1A 3AHJA 2GD0A 2XMZA 4AJOA 2UUBB 3PVSA 1KI7A 3JVDA 4MHOA 3E4CA 5ELLA 3QITA 4KHPB 1U3FA 2QL9A 4NCKA 3Q8LA 1YI0A 1F7UA 1KH1A 2N1BA 3TW8A 5BW6B 2YJ3A 1E0JA 4YGXB 3HRIA 3W34A 2OHOA 1E4VA 2SCUB 2PZ8A 2RKOA 3N2EA 2HQOA 4OU4A 5DASA 2V7BA 2VAMA 4DLUA 1Q21A 1FY2A 2RFLA 1KAGA 2OKCA 4ZQFA 1VIAA 2O0KA 4LX8A 4HNTA 3L7DA 4M6WA 1E0SA 2WM3A 4DHEA 2HR1A 3JARA 3GRAA 1YE5A 2FXIA 2HLPA 4UOZA 3ZQKA 1EUQA 1UXGA 4JSRA 1RQXA 2HCTA 4RO0A 4WASA 5AKJA 3K0FA 4LCJA 6PFKA 1N9ZA 1U0HC 4IOJA 3RS0A 2FOIA 1GSIA 1VLMA 1X86B 1ZJZA 2QPOA 4JYPA 3NT4A 3ROTA 1KPIA 3WO0A 3I1IA 1PTKA 4B8ZA 2CMGA 2PCLA 1DHRA 1NRXA 3GNSA 3O9ZA 3Q7QA 2IF2A 5AW9A 3GGCA 4YQYA 2H48A 1P4RA 4LWPA 1C8BA 1WUTA 3ODPA 5C8YB 2VAPA 5ENDA 4X85A 3V8RA 4MDHA 3RRNA 2NACA 3HKBA 3GDGA 4NDZA 5WRFA 4ZYTA 3PHHA 3IAS6 2E4ZA 1K2VN 3A0RB 4IHJB 2VQFB 3C7AA 3OPYB 1FFWA 5JXHA 1PZEA 1CY2A 2XHEA 3EY9A 4YMVA 3GQVA 2HXSA 5AVQA 4HQLA 1KEEA 1PVOA 4RLSA 2AGVA 1U6KA 3BEDA 5K8JB 4YPOA 1DBIA 4JA2A 1GRCA 4YPFA 3ZUPA 2VP6A 2VTEA 1JILA 5TGTA 3G2PA 3HVIA 4DLBA 5I9LA 1XJWA 2J5QA 3UO8B 2CHVA 4G0MA 2CXQA 3MGCA 1OLXA 2ON6A 4WVLA 1G2PA 3NRJA 1GQOA 1ZSVA 4E32A 4BO1A 1S2OA 3FCCA 3EC7A 1II8B 1M8FA 3HTXA 1XCOA 4EKIA 2GAFA 1U80A 2VUUA 3MTGA 3MZ0A 3DE2X 3ITNA 1UEJA 2NZ8A 2ZM5A 2D3WA 3WK7A 1J5XA 2QT0A 5EMHA 1W1UA 3LECA 3K32A 2FY8A 4HNRA 3WIUA 4AQDA 1M34A 3LWNA 4RMGA 1UKYA 1F1BA 2JJ2A 4N0EA 4CLXA 1WULS 4Y2TA 2AEMA 3FN4A 3BCHA 2CLSA 3KL2A 1OBVA 4V0OA 3C7CB 4N6OA 1EXWA 3PWZA 2FE4A 4OYLA 4QYTA 3V32A 2ZWVA 2PQ0A 4FS3A 4PYLA 1NV8A 1QIHA 1N2CE 1XT6A 3QBJA 4FMCF 1D0SA 4KDRA 1TA4A 4MB0A 1DWOA 1OZHA 1XZNA 1L5QA 2C59A 4GM1A 1V96A 4F0JA 5JZMA 4AS2A 1UAGA 5EMJA 1M1ZA 3I9OA 3RF7A 4C6TB 5L4SA 3KKKA 3V4PB 3VJLA 2GN4A 4RE5A 4B3XA 4LNUB 1UP7A 3LIPA 4B75A 1RTTA 4EI9A 5A71A 4GEGA 2B4KA 4RD3A 5AVOA 1I2DA 4MDEA 3ESRA 2CJYA 2R4QA 1A97A 4CG2A 1L2TA 3SXUA 4DLKA 3SJUA 1QP8A 3LPNA 5JAZA 1VCHA 3ZLTA 1MGPA 3H11A 5TQ2A 3WNQA 1HZZA 2E4WA 2P8SA 1K3FA 3OPVA 1U0BB 2J09A 4DV7B 2HPAA 4A82A 2VJBA 3LBAA 1NVGA 3OZTA 3U3OA 1OXMA 4G09A 5JYDA 3TI7A 5IYZB 3IEVA 4O2BA 1JLRA 3FIUA 1RAAA 4S2EA 4TRNA 4DS3A 3KPWA 1OZ0A 1RC8A 2NGRA 3WYGA 1QRRA 3RV3A 1CUCA 4LWZA 5CNJA 5DBFA 5EOVA 1BZYA 3RTAA 4AYXA 4EY6A 4ENSA 5JCOA 5IF3A 2JA1A 3A26A 3EQ8A 3PTZA 3EUFA 1VCIA 1VYTA 2E9SA 5T6MA 1R88A 2PEZA 4C0QC 2NU6A 3Q5EA 1O6FA 3U7FB 1E7QA 1TFRA 2AOWA 2VK2A 3THSA 2MMGA 1PCXA 5CUQA 1QANA 4A36A 4Q12A 1Z38A 3SMVA 4OQFA 1Z07A 4B48A 2CNWD 4NG5A 4DNQA 4EAAA 2HWUA 5DF1A 1CQJB 3A6PC 1FRNA 2VT2A 3AP1A 3EIOA 3KTAB 4R1SA 1IHPA 1RJ9A 3NJ8A 4PLVA 4PANA 1SHJA 3RIMA 1DIGA 1GAQA 1VKRA 4L3OA 4U2FA 4CFYA 4RHFA 5LB2A 1PLKA 2YXBA 3MRTA 4YR7A 1YMVA 4TVBA 2DPGA 2JPDA 1K6JA 3L02A 4QTYA 4CM8A 4R98A 2YXPX 4V0SA 3OWHA 1B1CA 4M1QA 2JFUA 2G1JA 5JSHA 1IVSA 4TQUS 1FX1A 2P3OA 4MJ7A 3RUPA 3U3MA 4M8IA 3JQAA 5FL7D 1U81A 4IOLA 3W6NA 1N2BA 3K4HA 4FFLA 3ZGYA 2ZRIA 4HX5A 3T1HB 1RXEA 5JO0A 1SVSA 5CFPA 1VSVA 2KI5A 1EBFA 5KU7A 1YJAA 3KOMA 2HADA 2Y2VA 3DFZA 4WFKA 1NBHA 3ACCA 5ALQA 5KKCA 3QMPA 3UIEA 3HCCA 5KSZA 1YU6A 2WIBA 3KO8A 4PIVA 5IANA 3ZX5A 2YRXA 1DPGA 1V7QA 3LHIA 1IN1A 4N7JA 4NMHA 4NV3A 2AXPA 5IAKA 3UH0A 4C7KA 5K0TA 2Y76A 4B47A 4TZTA 2E4UA 5DTQA 3R8XA 1KZGB 3IUSA 3PNSA 2BRUC 2FPUA 5CHEA 3HSYA 1IOLA 1C0EA 1GTJ1 2WQ6A 3D02A 3Q6NA 3FI9A 2P9ZA 4D9MA 3F7TA 5A6SB 2JLXA 4GW3A 3WLOA 1LRKA 1LUAA 5IZCC 4P3OA 3NM6B 4PTYA 4YMWA 1TMKA 3EB9A 4WL0A 4GYYA 4C2UA 5HJ7A 1FS6A 3BWDD 3SYKA 2DCMA 2RK4A 2XQIA 3KKQA 4XLZA 1TK3A 4AURA 3OZIA 4F92B 2XUGA 3RAFC 4F60A 4OQ4A 2ZI5A 3C43A 1WQ1R 4YRMA 3B6ZA 4PS1A 1GU7A 1ORDA 4RTRA 1ID1A 2QV7A 3C7DB 4GBGA 4ZYWA 4IEFB 2PT5A 1VP9A 2F4VB 5EJMA 1UBHS 4ZT3A 4LE2A 4PINA 1RI1A 1C3OA 2VK8A 3CPEA 2JCYA 3QOYA 4FTWA 5K0JA 5E3IA 1X3LA 3BRSA 1SXJD 4IVQA 4LSMA 3TCNA 4R9NA 1KK1A 2JLZA 2GEUA 1MA0A 3U7QA 2O2EA 5CLFA 1JZTA 1KQNA 1JNXX 2JVIA 2MSKA 3Q87B 2WHYA 2R8XA 2ZKIA 5ED0A 4CMEA 2NXWA 2VC2B 3C8MA 3VHQA 2OD9A 2QS9A 1GJRA 1EFVB 5ED4A 1Z4IA 4GLFA 1O5TA 5CCDA 4B6QA 5SYMA 3EGVA 5FDFA 2VO1A 4Y6RA 2QTVB 1XQYA 3OKPA 3LFUA 4BB9A 2CF5A 3ES9A 3WBBA 2XE4A 3D3QA 3WE7A 3GRUA 1FLDA 1EI9A 1SZPA 3CE9A 4W9NC 4YFVA 3WWYA 5KB3A 3H5OA 5DTMA 3ML1A 1M10A 1KMCA 3FZEA 4OMFG 3EXFB 4ITVA 5GOZA 5BNFA 3QP9A 4D56A 2A78A 3VHRA 4S05A 4AULA 3OHPA 1TL7C 1X1CA 1L8AA 2ENWA 1JEDA 3B52X 1UDAA 2A67A 1JPJA 2IHZA 4A6XA 2QE7A 3D64A 1TIKA 2RG7A 4BNWA 1PWHA 5IBCA 4H18A 1AHIA 3H75A 4FCWA 1HDRA 1P75A 4XYBA 1EIZA 4CMIA 4CBVA 4KQEA 3CWCA 2IV7A 3FR8A 2XA1A 3G13A 4FI3F 2Z04A 3JAKA 4V0LA 1IBCA 2OD2A 2QN8A 4RHTA 4WX2B 3A9SA 2Q2WA 3O75A 4YCCA 3D54D 2GESA 2RAVA 3NHMA 2CLLB 4YCAA 1L5OA 3PC4A 3O0DA 4OJMX 2X5XA 2DUUA 1GL6A 1UDRA 2XUHA 5DGTA 4AT1A 2ORIA 4U7GA 2ZRFA 3N6RA 2RGAA 3I9KA 4ZFNA 4O6VA 2W2PA 4CLHA 2XY4A 4FX5A 1IPFA 1TLLA 3IELA 5DLEA 4EVQA 2FSVA 3OIUA 2GXQA 1AZTA 1HNNA 4FFMA 4LQDA 3Q8KA 3TAXA 3F1KA 3NFRA 1XCPA 1MVLA 4CE6A 5LOVB 1TZMA 3WHPA 1N7GA 1NZDA 3UMFA 3L07A 4RULA 3CNOA 4DDTA 2VRWA 2IELA 4XASA 1GNLA 3HI6A 4CT4B 3U3JA 4DIBA 5KU1A 5KYTA 2ZTUA 1J5PA 3IDAA 4NAUA 4B09A 2IVFA 1G6KA 3OOWA 1SURA 1R37A 3EDOA 1B0UA 2FMXA 3FOCA 5JMWA 2BN4A 1S3FA 5F5LA 1Y9EA 1ZCJA 2CFOA 1TUBB 1ZO8A 2OAGA 2VHXA 3CS3A 3LHSA 3WZLA 1U5AA 2ZSEA 4K9OA 5C8XA 5JU6A 3IPLA 4MI1A 1LPMA 4NBLA 3T7DA 2L82A 3GGGA 4WN9A 4QUHA 1VLHA 4DDUA 2ZYGA 4L74A 3O4RA 3JQBC 1RU3A 4NATA 3WXBA 1XTKA 4FQ7A 3ELUA 4J1QA 4YUYA 3GRZA 2ZAIA 3DEAA 3PXAA 1H5UA 2R84A 4PLWA 3V3TA 3ZE2B 3HKDA 3FOWA 3Q72A 3ZGZA 2D62A 1NTRA 4FDTA 2OPHA 2FW8A 1PJLA 3LGAA 1U3VA 4EF6A 1AXGA 1H1TA 3GEBA 3TWOA 4F4FA 4U7HA 3FLEA 2C2MA 4EI7A 3D9QX 2NU9B 3DVLA 3N2GB 3QKUA 4B7CA 4GZ6A 1NR7A 1E7YA 1JU4A 3B6IA 1XE3A 2PANA 3OX1A 2FLKA 4Q4LA 3BMQA 4QELA 5KYGA 5LKRA 1DV1A 4LFAB 5AK6A 1OFTA 1UOQA 1OBCA 1NXQA 4F6LA 2FU5C 4H59A 3RS5A 5INTA 3GRKA 4K6GA 2HHLA 2JGRA 3AK4A 3GZNA 5ALNA 4OHXA 5IKOA 4EKGA 2HLNA 2ZSHA 3H65A 1I8TA 4Q9LA 1LQUA 3PFGA 1JIJA 3DTVB 1VMAA 3IS3A 3TQCA 4AKSA 1CE8B 3OU7A 3H1TA 1WPQA 3O3CA 4H6XA 3DZDA 1W0CA 1W47A 1RYHA 2FSSA 4XJSA 3SQMA 4IHJA 5JEDA 4G0XA 3P9SA 1DXOA 3RFFA 4CKBB 3Q7EA 5B3LA 5AHWA 3MS4A 1WJGA 1RFLA 4CMAA 2C2HA 2RDMA 1V5WA 4IXNA 3U1TA 2WSYB 4BMSA 2E5WA 1L5SA 4NECA 3HB0A 5JLAA 4NAVA 4PW0A 5EXTA 4R31A 2WLSA 1Y8RA 2UUCB 3B5EA 2DJIA 1UJBA 4QDKA 5CEFA 1NLFA 4RFSA 5A05A 3EEBA 5BN3B 4UMVA 4MVJH 4ZA2A 1D0IA 1MO2A 2XYVA 1F0KA 1M6EX 1N6HA 2H57A 2OYSA 1NPTO 2RGUA 1ZIYA 1M66A 1OFIA 2WWRA 1EUZA 1RYZA 3B3FA 3Q3HA 4C14A 5CDUA 5BSFA 4LVOA 3CUVA 4RA6B 3F6EX 2JIZD 4CKCB 2H92A 2ZT6A 4XI9A 4CU2A 4B7AA 4DWJA 3NOXA 2IXAA 1TZBA 2VTKA 4Q9HA 3KV1A 3OQJA 2AC7A 4O4JA 3Q3VA 2TMKA 4AWAA 1IPHA 1DAGA 4O5OA 3G0HA 4LC1A 1XUOA 1X70A 4PPQA 4D9BA 1IMOA 1Y6ZA 3CNQS 4DG9A 1W87A 3NBUA 1GPJA 2AA3A 1QGED 3K9BA 3TUZC 3PXXA 2QTMA 5BQPA 1HNXB 3MINA 2X3FA 4AG5A 1SC9A 5JQGA 2HMUA 1BWPA 2B1RA 2ORVA 2HBYA 2WE7A 1I2MA 4K86A 4MAMA 4RVGA 3PSHA 4ARCA 2H2AA 3LLSA 1MAUA 3ER6A 1RXIA 4FSHA 5G40A 3R6WA 4L95C 3FNHA 4PPGA 2GCOA 4MIOA 5EZYA 1A8UA 1ZR2A 3C3PA 3ND5A 1T36A 1NQUA 2D2FA 2YNMA 1UF9A 4M88A 2CCJA 5DWQA 3QHPA 1MHTA 3HMKA 4FP9A 4XW2A 3F6PA 1TAHA 3CX7A 4JT2A 1W2WB 4WFJA 5DM1A 3PE3A 5G02A 1QCYA 2BFBA 2J3KA 2ATVA 3FYUB 1RADA 3N8IA 3KJNA 4FYHA 3HSKA 4DADA 2M6RA 1AKTA 2B8TA 1ZKMA 3K8YA 4EMUA 4Q02A 1LPOA 1ENZA 3PC8C 1KYQA 2V6BA 4P4SB 1NQTA 2GBPA 3O8LA 4YIKA 4LMPA 5IZ4A 3I4LA 4EUSA 2DPLA 1OVGA 3G0BA 4CHGA 5F7JA 4QO7A 4CTKA 2XYQA 4NOJA 2ZCJA 2RH4A 4NBTA 3T9BA 4MMXB 3A1TA 1RKQA 1U8FO 5IS2A 1PP4A 3BMCA 3LT2A 4FKZA 5IUKC 4F9EA 4ARVA 1OWPA 1O2DA 2NW6A 1ZDMA 3G9QA 2Y66A 2P2CA 1TCVA 3HDJA 3VYVA 4DA6A 2Q4EA 4B43A 1O94C 1PUJA 2K7ZA 4FYKA 4MS1A 4N82A 4BDSA 4R71A 4ZIRA 3F7MA 2JANA 1UOEA 4QT0A 4ZN6A 1P4AA 2G3YA 5CXUA 3COJA 4BECA 2FWPA 4XM0A 1NMSA 1F6WA 5IK2A 4L16A 3G0CA 4A03A 4Z9FA 1UBCA 3AYXB 5DO9A 1PU2A 1YBAA 3G5LA 3ZX4A 2GHIA 3OZBA 4PHGA 4I36A 1UFQA 2JHCA 1AF4A 1ML4A 2L18A 4D6PA 5EJ9A 1UBLS 4KAJA 2E3JA 3PRJA 4FN4A 1IZ9A 3WGLA 3FTEA 3U16A 1YL6A 1E94E 3R0IA 2X5OA 4E22A 4HI0E 4F3CA 1LVUA 4TSFD 3HK2A 1S6YA 1P45A 2BKAA 2JAQA 4TS9A 5D3KA 3SKXA 1EP9A 1ODIA 1HQDA 3NHUA 1WEHA 3GO4A 2H5EA 4Q66C 4S1PA 4YROA 3BEOA 1F1JA 3ILHA 3JQAD 4X20B 4YB8A 4ZO6A 5LLTA 2W5UA 3OZ7A 4QU8A 4HYTA 2I8CA 2XGSA 1XIVA 1J0DA 3IQEA 3NOQA 4CI0B 4BFZA 1U63A 4M1EA 3NBXX 4OAOA 3NH9A 3ITDA 5BSWA 4ZRNA 4EJSC 1N8NA 5E8JA 3ROFA 1E79D 4PAQA 4D4IA 1VDMA 1P4JA 3ILSA 4OB8A 3T5GA 1A4XA 3MTEA 2V9CA 4FCCA 4BBZA 3M6IA 1BWQA 4Z9XA 5KWJA 3B1YA 2Q07A 2R85A 4H3VA 1GGEA 1PV1A 3FWYA 4REOA 5ISMA 3THXB 2IP2A 2P75A 1CP2A 1D4ZA 1Z08A 3DQQA 2PSJA 3OMXA 3T4EA 8MHTA 4HB2A 4IH1A 1HNZB 2I62A 3DE4X 3BSFA 3FTNA 4HGOA 4OJQA 3TRFA 2K7FA 3LM8A 1ZXBA 3GGDA 3JVUA 4V2UA 4QGAA 5K2OA 3AR2A 3RTBA 1XMSA 2A0KA 3BYZA 4R1QA 3WMXA 1E2NA 1U0FA 1WDMA 2VYVD 1G98A 2Z09A 1P5RA 2X4IA 3NQ41 4Z0TA 1RQGA 3MRSA 2GUGA 1EFCA 2LCFA 4UUOA 4IMRA 1VI2A 2W71A 3CB4A 4KYVA 3BRCA 5HDBB 1T5OA 1H2EA 2COUA 2Z30A 4NU5A 2JH8A 3M83A 3ZJ5A 1KK0A 2GA9A 1ZJWA 4LRSB 5KSOA 3T3OA 2PX4A 5EMLA 4L5CA 1CJUC 1Z47A 4PHHA 4RD1A 1B6GA 1JV2B 3OZRA 4IQ0A 4UCQA 4ZCSA 1R6VA 4A8JC 4BNTA 2QROA 1ETHA 3EIXA 1KDOA 3O83A 2JBAA 3K9FC 2C0CA 4ALNA 2LWIA 5SZIA 2NMVA 2Z1MA 1A8HA 1YRBA 3MWYW 1UKCA 3U81A 3ANLA 3A6HA 1XHLA 3GGSA 3IT0A 4XIYA 1FXSA 1OILA 3R6DA 3E7XA 2IU0A 2ZJ4A 4FC7A 5KI6A 3TZ6A 1KI8A 2HPVA 2O3UA 2GO1A 2XYPA 3K2QA 3ZLVA 5IT0A 2O2DA 1C3VA 1OFHA 3CLUD 2UUPA 3ZS9A 4EGFA 5BY2A 4JJAA 1GPDG 4C4TA 4R9SA 1XAIA 2DKFA 4DMUB 5BORA 1UJMA 2CLOB 5A4JA 2Q5QA 3MMNA 5GJVC 1YA8A 4J07A 4KAXA 3G8CA 5DPMA 3SI7A 2W6ZA 4JJ6A 2CFIA 2IU3A 3DM9B 3C6XA 1VMEA 3N8HA 4UEJA 2A14A 3RS9A 1IBRA 3GDFA 4MP8A 1XAHA 3ZHZA 1WUIS 5HMMA 2F7SA 4D0RA 4FD3A 3WL8A 4PAMA 3ZGNA 1XZCA 5BSUA 4NRDA 4FOLA 1VHWA 2O4CA 3QI2A 3WZ2A 3T7AA 1Z56C 2ONZA 3EPLA 1YVUA 1YS4A 3ESQA 1PKEA 2WM9B 1CFJA 2QZPA 4IZOA 5LQSA 5YASA 1TYBE 5EKDA 2QZ4A 3ZIAA 1QRUA 3NHWA 4NYMR 3ESCA 3WQRA 2WR8A 3H1FA 3JTEA 5E7JA 3U4CA 3P9PA 3EFHA 1U2SA 1LBHA 1R0RE 2G4LA 4HQRA 4P7FA 2UYCA 5J1TB 1N2ZA 4EG3A 1LLFA 1PR3A 3ITKA 1FDOA 2XCLA 4C4OA 4O1IA 3N28A 4TT3D 1Q7CA 2YWFA 3TFOA 2VT3A 1XZBA 2WTBA 2H17A 1RKVA 1G66A 1NAHA 2O2XA 3G68A 1Z16A 3LUJA 3AM1A 3P97A 3FSRA 3MHPA 4MGYR 1QRAA 3BXOA 1YL5A 1U7ZA 2IPMA 3CSUA 4FCVA 1NW8A 2XT6A 3UCEA 4DYDA 3SPXA 1ZUIA 3F2IA 1J8FA 1T2DA 1VE5A 4F3NA 3TR0A 1B26A 3UAZA 3O74A 1Q7GA 1ZGZA 2XWBF 2MOKA 1P60A 1NMQA 5B12A 2DU8A 3ANXA 1OCEA 3C3CA 4EUFA 1A8QA 2FZKA 4NEHB 5H80A 2JFWA 1JRLA 2FGKA 2PGLA 3EVCA 4O4IA 1Z5UA 3S55A 1XNQB 3AHHA 5HNKA 1DQSA 3SYRA 2VWGA 3UMBA 1JQKA 2DRIA 1AK1A 2VDLB 1E3WA 4MRMB 1DNPA 3IOBA 4Z9AA 2VH2A 1GZHB 4XPIA 1HX7A 4E07A 4ER7A 1FDTA 4I4CA 4IGFA 5HUQA 5L95A 2ZETA 1YO6A 4JBNA 5CTJA 3KE9A 4F8YA 4QE3A 3JVIA 3EVGA 4ND8B 4X00A 5IU6A 4RGBA 2IYZA 2WD9A 1GTVA 2D2IA 1CE8A 1ZVQA 3GX1A 3LBIA 5FUXA 4UHJA 3CHYA 3ZCXA 1D9XA 3O4IA 1UXKA 4WCDA 1JZQA 3RSOA 5CG1A 2DHRA 3ROXA 1F60A 2E89A 3PDUA 1H3FA 1TZ2A 3OG9A 1KC3A 4IIVA 3LGSA 1L4FA 3WP0A 2W6MA 2ZRQA 3K9NA 4LPKA 3AB3A 3KPJA 3VNVA 3KPVA 1X7DA 2RBKA 3KVVA 4Z54A 5JAOA 2E6KA 1XPRA 3KKMA 4EHLA 1P1BA 1G9TA 4KQFA 3MIIA 1U1GA 1WTCA 4L4XA 2JAHA 5H4HA 1XALA 2CFRA 4R3WA 3T34A 4F86A 4RORA 1S01A 2C42A 1FU7A 2H2HA 2NO4A 1W93A 5SZHB 3REQB 4QT4A 3S70A 5F23A 4M36A 2BSXA 2HA2A 1XEAA 1UODA 4KQ1A 1W19A 3DOOA 3INRA 1I1HA 3HA2A 2WP8J 1U4OA 2DFPA 3IRVA 3TKYA 4Y6PA 2JLRA 2Z1DA 3BTSA 1T35A 3JPWA 2RI6A 3CXUA 4KDCA 4X7BA 4RY8A 4A0GA 2XDWA 1Y6FA 1NBOA 3D31A 1YVDA 1PZHA 1QZZA 2J41A 5EWJA 4BEWA 1CZOA 1SJ9A 5DNWA 1KFJB 3ESDA 1TZKA 1TUBA 2GBLA 4EFKA 1Z6GA 4ZGGA 2ZBPA 1TYDE 3TW6A 2F1OA 1ADYA 3AR9A 4PRLA 4N65A 1B6SA 3I39X 5BQXA 1YS2X 2GZ1A 3OQIB 5LMNB 2IP1A 4MA0A 3L04A 5EE1A 2NOAA 5T5QA 1CVLA 4HMPA 3UB3A 4C4SA 4RK0A 2XE8A 3M9LA 5A3SA 2P2ZA 2J3MA 2BFNA 5IUJC 3FOEC 1ESEA 1QR6A 1U8YA 3WLRA 1KK2A 1U0SY 2YNMD 3BGSA 4FFPA 3WWPA 4CMCA 5TQ0B 1N32B 4ZU6X 4WZAB 1XQ9A 2ZU6A 1SHZA 1T36B 3VMFA 4ZCTA 1X1BA 1JLKA 2NTNA 3PC3A 4BN0A 3A1WA 4LBVA 5BUZA 4YJ2A 4QM7A 4BLPA 3ILXA 4V1CB 1VHLA 4JKOA 2KE5A 1SCKA 4O2AB 4UE2A 3DE3X 2X6RA 3P1JA 3B1WA 4YXFA 1RHRA 2OO7A 3LE8A 3UK0A 1QP4A 2NIPA 3G2NA 4BQRA 1Q74A 4QREA 1T3GA 1JJBA 1WPRA 1BVHA 3JWEA 1AE1A 1P80A 1XZAA 1Y1TA 1CTQA 5CNMA 3VR4H 4YUAA 3ZXXA 3NWEA 3ZHQA 4BJ1A 2FVYA 2IY9A 3OKCA 2PGJA 3PEYA 4LBZA 3OF5A 4DQKA 1DARA 4TTVA 5E6SB 3HUDA 4B6JA 4K6MA 4YRGA 1JNYA 3F6BX 3V33A 2C2BA 1T1JA 2GARA 3G82C 1T2AA 2IY8A 1YIAA 4HATA 1IBSA 1WW8A 4UAUA 4A27A 3ZDZB 3RC2A 4JOCA 2AXQA 2IUTA 2Q6IA 4KK4A 1C9KA 2I55A 3G85A 2WTNA 1EH5A 2B4AA 1WAMA 3HU2A 1B8UA 3UYKA 1KI2A 4MGZR 2P9EA 2OHJA 3MILA 4NIMA 1Q1AA 1Z7BA 2GK3A 4QDOA 4U6NA 4UXHA 3GPIA 4E5NA 4I50B 3EVEA 1J7KA 3FZYA 4YRLA 1SQ5A 2PGAA 3HS3A 4LZOA 3C1OA 2XEDA 3D8UA 3F5FA 2VEOA 2AUNA 3LL7A 1SK9A 2VA9A 5CRIA 5IMSA 1QYRA 2HK8A 3CPSA 4TYYA 1FUUA 1JSXA 3NIWA 3N0XA 5T7BA 2ZB7A 4FQ8A 4G23A 1BHSA 3L8FA 1J99A 1YZQA 4X8HA 1XRQA 1J8YF 1E3EA 1HWYA 1YQWA 5ALZA 5DYYA 4B4WA 1TJPB 2JZNA 3R5TA 2ZRPA 4CF5A 2DPXA 2I6QA 4TM7A 1UC5B 2G1PA 1NU6A 3AI7A 3FBGA 2GXAA 1F38A 3U48A 2I4IA 3I2KA 1OX4A 1RJDA 3FPAA 4E7PA 2VDJA 4W5RA 3JPYA 3UWOA 2XB6A 5J2TA 1WIWA 4K88A 1SBYA 3U7IA 2B8EA 1D2RA 3ORYA 1DKUA 5KOJB 1O95A 1SWWA 1JMKC 1ATZA 2N47A 1RQRA 1AKQA 1PJBA 2Q46A 1DG3A 5EP3A 4IAOA 4N3GA 1EG7A 2ZVPX 1P2SA 2FGJA 1A9RA 4FR2A 3BF8A 4UNSA 2BT4A 2HRDA 5IX8A 4XCVA 4BLVA 1VJCA 3CH6A 5IJAA 5CX1A 4JOSA 4JC8A 2P9TA 4L8LA 4BATA 4M0KA 5HZHA 1BHO1 4B35A 3BAZA 3OD5A 3UJDA 4DCTA 3AVTA 4CDMA 4QNNA 2HF8A 4JCCA 5IVKA 3DC2A 1WMSA 3HJCA 1VG1A 1QIDA 3HBLA 1C1YA 4D2IA 2XNDD 4RMNA 5TT1A 4TYWA 5F98A 4C0BA 3R24A 4FGKA 5JYEA 1D2CA 1UWVA 3TE6A 1NPYA 3OFNA 2D0OB 4MGEA 3WHKA 2ZUSA 1G8MA 3BFPA 7REQB 3VH4A 1KMIY 2WUEA 1NTOA 4KW7A 2IYVA 1WBBA 3DO8A 1T9BA 2H06A 3M6VA 4Y30A 4BFTA 4GM4A 4EJ6A 2YN0A 3FYSA 1PLJA 4G1UC 5ALJA 2V97A 4LYHA 3L7NA 2P65A 1FUKA 4G0OA 4R2XA 1VHDA 3SWWA 1XTQA 3EULA 2BR5A 2DUNA 4KOAA 3C4VA 5LU8A 2FF7A 1Y1LA 1XZHA 2HFKA 2VDQB 3A9VA 2W2VA 4HAUA 2VP0A 4MYDA 4XH9B 5COQA 2XQKA 4L4YA 1A8IA 3WGYA 4AF7A 1BROA 2P7HA 1JHAA 4I9GA 2TMDA 5DHTA 1RABA 3T6KA 5JCXA 4HDMB 5KSWB 2DHQA 2P11A 2ZS9A 3SCZA 4K05A 1XXHB 2C7RA 4UAGA 4A6DA 2Q29A 4JQSA 3DH0A 3KEGA 3A4NA 3BHNA 4IG9A 1L7DA 1NBMA 3L0IB 4FB4A 1SXPA 2RBGA 2EKBA 3DZCA 3ZQJA 1LXCA 4L28A 2GPJA 1GXSA 2XE6A 3QU2A 4HDKB 3AUKA 1EGVB 1ZD9A 4YRRA 2HRQA 1QTQA 5H9WA 4G65A 2NVBA 3IAUA 2QIPA 4PXAA 1A5SB 3ZPXA 1O94A 5EPUA 5KWSA 2RK3A 1YFLA 4RPLA 4KMMA 4LYFA 5I7UA 1A5BB 1NVDA 3O5AA 5F3WB 3GLQA 1JTFA 2FKNA 1AKUA 3BHIA 3NNSA 4DRYA 4TV8B 1V1RB 3G0IA 2C00A 4LYDA 3MJHA 4R2JA 3S2EA 2MINB 3CC8A 5KTYA 1TNDA 2IEAA 2QVLA 2H2GA 3GAMA 2JAWA 4L73A 1DRVA 1A7JA 1WLSA 4HDKA 4CTMA 4HQNA 4OXXA 1X2EA 2N46A 1H5NA 2QF7A 3QX8A 4UTPA 2NUTB 1XNJA 1HV8A 1J2JA 4EARA 1G4AE 1NG9A 4GBED 1QZUA 3UJNA 5JFOA 3WLEA 1KETA 4KJZA 2UUOA 4W4TA 3IVCA 4RK4A 1PBNA 4A0SA 3DUFA 4K1XA 3TX2A 3AXSA 4BNZA 4JROA 3CNEA 2W98A 4URXR 3Q1LA 3CZAA 4GOKA 1LY1A 1OI2A 1P9OA 1QHNA 4KGZA 3L8ZA 2HU7A 3OQ6A 5E6RB 2V6IA 2LNDA 4L85A 4QXPA 4HR7A 1E8NA 4M9SA 4M0EA 1GZ5A 3T4XA 3LFHA 2AEEA 1ZM9A 2C9MA 2OCGA 2ZBUA 2BSQA 2PSDA 1OZAA 1NVEA 1Q16A 2R79A 3N05A 2G7ZA 1I2AA 2ID9A 3L18A 3R3SA 1B15A 3E1KA 4LOJA 4S12A 4MUKA 1WUYA 2WA2A 2ABWA 3GLFB 3U4QA 1FYXA 2OESA 2E1RA 1T6ZA 2C4NA 4L2IB 1ZD3A 3OKAA 3HN7A 4MVCA 1QYIA 5DNEA 2OV2A 4HLQB 4FYXA 4C0SA 1F8FA 1K89A 4FK8A 1NKTA 4R84A 1ZA1A 4BNUA 4ME6A 2I4OA 4U2DA 5IEJA 1N2IA 4RY9A 3WNBA 3DZGA 3D81A 1R0CA 4L3WA 2Y4OA 2YFYA 3OJ0A 1Z0AA 2GRAA 2VHZA 2GHRA 2V3WA 4DEVA 4WW0A 5C8YA 3Q10A 5MHTA 3PB3A 1X8JA 3PE4A 3V7FA 1GTG1 4JKIA 3TLBA 5EESA 4X66B 2F67A 2ZT8A 2GCEA 3OQHA 4JZKA 1E4OA 1G8PA 5EN4A 2Z2YA 1IZZA 1TAUA 1NNUA 1SK8A 1WCV1 3E5MA 4YRFA 3U80A 1U02A 1K9VF 3X2EA 4WPGA 1Y3AA 4FCTA 4MUYA 3JARB 3LAWA 4OHPA 3SHOA 4LN1A 1L5KA 3WBFA 4HXGA 3WRXC 1YDGA 3WRYA 2GUWA 1ORRA 1X74A 1BX3A 3LDGA 1GTL1 3OJLA 5AJXA 4GC5A 3ASVA 4IEEA 2IBSA 1L7BA 3AF1A 4M1KA 3UG6A 3NX4A 4BUCA 2RMKA 1YMUA 3OOYA 1FRZA 1Z3IX 4IGAA 4BLTA 4KGVA 1K6XA 2CVPA 2YZ2A 5IM4A 2IWRA 1YCHA 1PHPA 4NLLA 4QOHA 2QX7A 5H4GA 1P5JA 4YJFB 1DAMA 2H4YA 2X5KO 3SF8A 2F17A 2P4HX 5DGXA 1SXJE 5DGCA 1NVBA 1KJZA 5B57C 4AWXA 3WX0A 1B2LA 1JH8A 4GDMA 4TLMB 4GL2A 2W2TA 5F1PA 1H4VB 2XADA 4B5LA 3B12A 5K4HA 5I9SA 3B13B 3I5MA 2XDQB 3NO4A 4JBWA 4Z4EA 4E5YA 1PZXA 4KX3A 2ZRJA 2X6QA 4H7KA 4AZSA 1GPYA 4FYJA 1F2TA 1NP6A 3UOAB 4DCUA 3PZRA 1IOZA 3JRNA 5E4JA 4P4UA 2PS0A 3Q8MA 4P3KA 4CIDA 3ZJYA 5IAAA 3DWFA 4KXFB 5JDIC 3KRTA 4KKVA 2OKGA 5JNRA 2R48A</