2Z5VA

Solution structure of the tir domain of human myd88
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
141
structure length
141
Chain Sequence
HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myeloid differentiation primary response protein MyD88
publication title Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 2z5vA01
2Z5VA 4LZPA 5H3CA 3H16A 2JS7A 3UB3A 4C7MA 4C6TB 3UB2A 4LQCA 4LQDA 4W8HA 4C6RA 4FZ5A 5FORA 5KU7A 1T3GA 1FYVA 3UB4A 1FYXA 2Y92A 3OZIA 4W8GA 2M1XA 4EO7A 4DOMA 1FYWA 3JRNA 4C6TA 2J67A 1O77A 4C6SA 4OM7A
chains in the Genus database with same CATH superfamily
1EE1A 3K9FC 1G8PA 1FP4A 3K7EA 1N3BA 4HQFA 5CBKA 4OTZA 4UXIA 4ZREA 4G1FA 2GDZA 4BQNA 4ZT7A 3I32A 3W4KA 3KOZA 1T0BA 4WK6A 3MM4A 5JISA 2P4HX 1V95A 3KOXA 2IE8A 3QSYA 2PNFA 3KSMA 4Q18A 3VDNB 2QLTA 4AF6A 1RZRD 2LD4A 2ON6A 3C6MA 1PE0A 2IU0A 4PG6A 1W5EA 3HKDB 2D1FA 1P75A 4KSYA 4M0KA 1F2UA 4G5XA 2PSDA 3E9YA 3GIDA 3N8IA 3SQWA 4XFJA 2O2GA 1OTXA 1W5TA 2C5FA 3QPCA 3F3SA 4FWIB 2UYCA 3ZDYB 1FUKA 3BORA 1JWLA 3M6MD 2WMYA 1VJTA 2XF2A 1QGUA 2DC1A 4RCVA 1QX3A 3DA8A 4A5OA 3UCFA 5HWSA 3CX3A 3O90A 5K01A 2P9CA 3KETA 2GNOA 3D59A 3MWEA 3OE7D 4QYWA 4AS2A 5KNCA 3NYWA 4L9AA 1Q7BA 4F71A 4ZAGA 5EKXA 2Q0SA 2CE7A 3CW8X 4ZI7F 1ICIA 1OE0A 3ROQA 2OKGA 4K2HA 3P19A 4ZHQA 2XBMA 1G66A 4RENA 4UHEA 3DE2X 3MXOA 4P98A 1YB4A 2X1LA 1PBNA 2CD9A 3Q5DA 1SBCA 3EZGA 3HSYA 4BMCA 5K8IA 2VQEB 1HPLA 2IK8A 3KV1A 3MD9A 3QW4B 5K05A 2JGFA 1U9ZA 1CQJA 3H1PA 5CDHA 1P81A 3MAAC 4XGNA 2R1VA 2CBXA 5EP3A 2OHHA 4QO8A 3U4QB 2GBIA 4V2IA 5HW0A 2VTEA 3IBGA 4D6PA 4JYBA 3OUUA 4CFYA 3AHHA 4MUFA 3KTFA 2Y2UA 5BSUA 2QQGA 3RADC 2B4TO 2Q1WA 1PNQA 2QN6A 1ZU4A 2YZKA 1TADA 1KEPA 3HDHA 3EWNA 1WP4A 1CQZA 3O92A 3L8FA 5KVSA 1OU4A 2JD2A 3DWGA 4ISBA 1IHDA 2Y9PB 3GLQA 3DZIA 3X1KA 4U0JA 4DPKA 1YRLA 2AOUA 2QM8A 4EYGA 1K06A 2FR8C 3C16C 2Q8NA 1THTA 2VZLA 4KC0A 4A1OA 2IXAA 1SKUA 4WN9A 3DLAA 3P7MA 4IGFA 1WRBA 4MA0A 4DMCA 4PTYA 5MGBA 4F84A 4XWKA 1JAZA 2QL9A 1OAAA 3BRWD 2OAGA 3JZFA 1U7HA 4RY9A 4DCGA 4DLYA 1Y0BA 4BJ1A 5C18A 2XWQA 3VISA 2DPGA 4LJYA 5BVGB 1SOWA 4EENA 3ASUA 4P0QB 2I0FA 1NUTA 5G4LA 3ITNA 2QP4A 4M9UA 3DZ8A 3WRWA 2EQAA 2W83A 1HWYA 3KZVA 4HS9A 4IIHA 4DJ5X 4F3TA 3HI4A 1E3SA 1KO7A 1WSBA 3CR7A 4M89A 4H7JA 4AS1A 3BF8A 4LS3A 5HKKD 1OBFO 4K6CA 1R16A 1EINA 1Z47A 3DBIA 1DJQA 2EJBA 5LA6B 3GGGA 3O47A 1ZINA 3OT1A 1C14A 1U0BB 2PUFA 3ORSA 1KK0A 4YJDA 5JOQA 4K8OA 5J2UF 3KVYA 4F7DA 3TR5A 2Z2KA 1X80A 2QL7A 1HDRA 4KBYA 5FL3A 4M7PA 2WHEA 1ODJA 1WQ4A 3E84A 4GOMD 1C1XB 3T3DA 4RKEA 1F8UA 3QYFA 3P45A 1TJPB 1TPZA 3H8JA 3I6YA 2FQXA 3IQZA 1ML3A 3A3KA 3OA0A 3PT9A 4RKYA 1Z25A 2BTQA 1MRNA 4ADSG 3ACDA 3NT4A 1KY5A 1J70A 1GZSA 1P9LA 2DBZA 2HBRA 4Q12A 4RBNA 4BWFB 3GZNB 4ND1A 1LWNA 1XDBA 3FWHA 1GL7A 1UBMS 3T94A 1QHYA 5C8XA 4TV8B 1YB7A 2P2NA 3N53A 3RIXA 2BSAA 5TDHA 3FVRA 1VPEA 3K4PA 3OU2A 4YAGA 3E7FA 3CC8A 4WZBB 1JEAA 3K1AA 2AV6A 4KK4A 1Z6TA 2VYVD 2ZQYA 4IX1A 3TOVA 5HNKA 1GPUA 1F4VA 1PG2A 3LD9A 4NBWA 4PINA 4FGZA 4QPJC 3U3XA 4GPAA 4O1HA 5DGTA 1EB9A 1RC8A 5HKAA 2V0CA 3BHNA 1E2FA 2F3RA 1W73A 3PNMA 5HYVA 4AG6A 4RVCA 1PFQA 4OGKA 1I2AA 2YZGA 2ZAGA 1E92A 3D54D 3LT0A 3OG9A 4FNAA 2P9QA 4M1ZA 3QVLA 5JAZA 1D07A 5KJ6A 4KMRA 1NJFA 3H9JA 3ZQ6A 5BV7A 3F0TA 2RHLA 3N3BC 3OM0A 1XTBA 1R5BA 1EYZA 4P34A 3AUTA 3K0AA 4LCEA 4WKGA 4BCDA 1JG2A 1K7CA 1U8TA 2C4VA 3HCRA 5I4IA 5KNDD 1T1EA 3FMOB 3GT3A 4XWTA 3L6EA 1EIZA 3DMFA 1AO0A 2H5IA 1UJNA 2ZITA 2JFNA 3NHFA 3IESA 4TQUS 3D81A 2J6IA 3LL4A 3BEOA 3HP4A 2YHIB 1G1MA 4O29A 3CLSD 4CETA 4YRDA 4CDRA 1L5WA 5ALTA 3HJAA 4HX9A 4ILEA 2A6PA 3UJ9A 3BBPA 1U2GA 1BC5A 2V98A 1ES9A 1GLGA 3O0TA 2IF2A 2JB9A 3K9WA 5L8VA 2B4AA 1HYEA 4PHCA 1M0SA 1C7FA 3BIOA 3GRYA 1FNCA 1EM6A 3FR7A 1PG0A 3H4TA 1EZ1A 3RODA 4ZGGA 3W5JA 4F6RB 1H8HD 3LG2A 1A82A 1DBPA 3P1JA 1IE3A 1SNYA 2BFCA 2PWZA 4RFVA 5I3CA 5ICEA 2WJWA 2JFPA 3I42A 4YI3A 1WKCA 4P2GA 4C2TA 3LX6A 2WHRA 4J6EA 2Q2QA 1R6DA 5AESA 3FWNA 2REXB 4D0LB 4FFPA 4GMXA 2OT3B 3NPAA 3WKAA 4ES6A 2G5TA 1B6GA 1EI9A 4QVGA 3RROA 4HWSA 1GR0A 3UHPA 5ELLA 1PGJA 4Y9DA 2DY1A 4B3MB 3ZCPA 2WZDA 2EKZA 1TUBA 2ADOA 1LS1A 2AUNA 1QAMA 3EOZA 4P7JA 2C58A 2IP2A 2WNIA 2MT9A 1HLDA 1PDVA 1NQXA 2HN9A 3G68A 4NECA 3JQBA 5JPDA 1U4SA 2ZJ3A 1DBIA 3A1DA 1S01A 3EISA 3LHFA 3O8NA 4FMBB 2WUFA 3JQ8B 4NZNA 3AY3A 2OOSA 5A62A 1E2MA 4U3JA 3VPCA 2XH8A 3ZCSA 5BN1A 2Q8PA 4Z0NA 5DHTA 2VPZA 4MEBA 4JKYA 4BBJA 2XPCA 1T5HX 2YIDA 3EOBI 3IT3A 2RH4A 3R5KA 4ZT2A 4E32A 4DSZA 3TW8B 3GLFB 1E99A 3FJYA 1RXCA 1P5HA 3DS8A 2OVBA 4WZAB 1Z6QA 3TBHA 1FZQA 3K0SA 4D5EA 1UPFA 2MR5A 3LW7A 1D3AA 3OPYA 4JFRA 4KUHA 1HURA 1RI4A 5H59A 1G8HA 3RBZA 3STWA 3UPUA 3CT4A 4IXTA 4BKUA 2YHUA 3LCUA 3OETA 5SY4A 3T4XA 4L4SA 4C14A 5K0CA 5LOVF 4DMMA 3MINB 3KTOA 3FOCA 1YR1A 1W4RA 5IAOA 4MYTA 3ZCVA 3AXTA 5AQEA 4O25A 4W5RA 1W96A 1TAQA 3OD1A 4TGLA 4RXUA 3DTVD 2XCUA 3EDQA 3HXPA 4CE6A 2IUEA 5BSFA 3KR0A 5G0VA 2H7VA 3FF4A 3F4LA 2W98A 1ESNA 2REQB 2HT6A 4DREA 1D2GA 3H5WA 3PJEA 4FFDA 1CUCA 3V1NA 4MEJA 1NMQA 2Y27A 1XPUA 2P79A 5CGQB 1TMKA 5AJWA 4KQWA 2ILTA 4JSYA 5HKBA 4H27A 3CLRC 1NXTA 3GCDA 4MQFA 1MB2A 3UMFA 2X1MA 4B3XA 1QLJA 1IOWA 3LP8A 2PLFA 5IAJA 1PJ3A 5LYJB 3PRJA 1QYVA 2Y1CA 3I12A 3OSZA 4HNQA 4MV6A 2Q1XA 2EBHX 4X6YA 5C8ZA 2WTUA 4A82A 3RYIA 3QVJA 1FQKA 1PFYA 1XZAA 3N5KA 3MUNA 1I2MA 4RPGA 5DHQA 2QUKA 5GOZA 1ISMA 2FQ1A 2RBGA 5IJAA 4OX9B 4LHYA 3IOEA 3CCBA 2CJFA 3DOCA 2HNBA 6Q21A 5JQWA 1KVQA 1XVLA 4AK9A 2OGSA 5JECA 1VM6A 3R41A 1JQAA 2JVJA 3AL0C 1TT7A 3JQ9A 1CQIB 2AMLA 3FDIA 3GOQA 3OF3A 4P1ZA 4JVMA 4DYHA 5AIAA 3ITKA 5L3SB 1UFKA 4E5MA 3KK0A 4A2WA 1TPYA 2GEBA 3KJZA 1C41A 1RU3A 3PUJA 4FBGA 5DHRA 3W8DA 1JHVA 3HVRA 3ELUA 1TAUA 1SU4A 1BD4A 1T3ZA 2DH5A 2Z2JA 5DT9A 2ZUFA 2LKCA 1G5IA 4ND4A 4KNWA 4Y2VA 2H2AA 3LKVA 4KLAA 1BA3A 3ABZA 4GL4A 4RTSA 4IIDA 2M6LA 4DSNA 2FFRA 2ZE8A 2GXUA 3FNGA 5CM2Z 1XRNA 1D2AA 4JVOA 2ETXA 3W5SA 1T5DX 2HIGA 2G77B 4LYDA 3RAPR 2WJIA 4C2BA 4C4AA 5CB8A 1DIBA 1NZJA 1X8KA 2QTWB 3IILA 1V37A 4WLFA 2XZOA 4RPIA 2FZ5A 2XB4A 3Q72A 4N0DA 3RFFA 5MFPA 1H6BA 3OOSA 1H2ZA 1NMYA 3CCFA 3IKLA 4KWIA 3M6XA 4EEXA 1JU9A 5KJ1A 2DBRA 3Q7SA 3PNLA 1HV8A 2VF8A 2CEKA 3NHSA 3C5VA 1QHSA 5DHUA 5AVTA 4OX9Y 5TV2A 4Q02A 2BEVA 3TBFA 1UK9A 4BQQA 4RY8A 5KC9A 1F4LA 1N2BA 2RCYA 4PO3X 3ZHOA 5IFLA 4NY1A 4CMCA 4E94A 4MI3A 2X8BA 3B1XA 4Z51A 3LM8A 4P22A 3QE9Y 3GPBA 1HDZA 2IU4A 2HPHA 1IMJA 1SHJA 1JVNA 5FV7A 1ZY2A 4YPFA 2QUHA 3WLJA 1Z4IA 2EX1A 5CNJA 2JFXA 4JLUA 5JQGF 3WJAA 3PHHA 5E1OA 4MH0R 4Y9RA 1IM8A 5DE3A 1OROA 1ZH4A 2HQOA 1KHTA 2XEXA 3T7JA 1Z5OA 3C6QA 1GRCA 2QTFA 1K6EA 2OEPA 4ZQEA 3O9ZA 3ZOZA 3T06B 1Z7GA 4X6UA 2ZPAA 3I2YX 4L22A 2XCLA 3EXG1 4KXVA 4OAPA 3ZWQA 1EFHA 2Z58A 3D2BA 4FMPA 3HR7A 4KXXA 4Z4FA 5KVQA 2X0NA 4RIEA 4H7IA 3PVSA 4ZPJA 3I2FA 1IY0A 2EJCA 3ZY3A 2DF8A 2ACWA 3DAPA 3QOFA 2LE0A 4P92A 4PNZA 2XIJA 1H23A 5FBZA 3KQHA 1FDVA 3MJFA 5DDIP 5I7HA 3G2LA 4BQOA 4K6MA 4C6HA 4PR3A 2C2BA 1SXJD 4OXIA 5JXHA 5KQMA 1IM5A 1D6NA 1SURA 2ZBUA 3F6SA 4GWKA 3IEIA 4BRWA 1GDHA 2YCBA 2GF0A 4OREX 4JT4A 4DS3A 1JWAB 2ECOA 4YRMA 2R5WA 1DTSA 3RS0A 1RPNA 1A2BA 3GMIA 3K09A 4JJFA 5ARCA 3TIIA 5DMHA 2ZUBA 3C8MA 1N6OA 1Z4MA 2HREA 2QI9F 1OLOA 5A4AA 3QEKA 3VKFA 2BGNA 4A8TA 1U6KA 3SQNA 1W9MA 3QEOA 4REMA 3RVDA 2FH5B 5B2FA 5C37A 3UGJA 2IOHA 1T5LA 1PR5A 2OV8A 2I2BA 3KKOA 5DTJA 3SQOA 3I34X 6ADHA 3D2LA 2ZJ5A 1COWA 2AMJA 3DMNA 4CQMB 2OCXA 4XUGB 3W5DA 4WKBA 1N0IA 2PL5A 4M1MA 4DLVA 3QVKA 2NV6A 4UHKA 3HRKA 3MZ0A 1YS2X 2G28A 3DHWC 2CNLA 4I8XA 3KT3A 4A6EA 1IK4A 5IASA 1EGVB 3T5CA 2YFKA 4ZJUA 5BNIA 4H9GA 2K7FA 2B4QA 4ZPXA 3HWRA 3VPFA 4L95C 3WKEA 1UFRA 3FPGA 3HDJA 2AQIA 2AWOA 1L6IA 4PX9A 1VRVA 3RTGA 3TZBA 4BIIA 3HH8A 1WEHA 4F5EA 2WWXA 7MHTA 4FT2A 1SVOA 3TZKA 3EW9A 4WFIA 1NTRA 2QZPA 3HVJA 3QHPA 1D1PA 1L3BA 2J9ZB 3GXBA 1JF8A 1KAMA 1Q7RA 1ZJJA 2OA0A 3RLFA 3UT0A 1IMOA 5EGSA 3DD1A 3NHJA 4D4HA 1GQQA 1NW3A 4AJ2A 2OD7A 3PHGA 3JD2A 5IP5A 3UMMA 1CWUA 1NATA 3KYDA 3WLEA 4CMIB 5KU1A 4ND7A 3RARA 1E59A 2W6JD 2ZREA 4ONEA 4EYSA 2H9YA 3ELBA 1HZZA 2OHIA 2V6JA 4GQBA 4ZKEA 4MLDA 4IXWA 5GMOA 1YTLA 1WG8A 2BJVA 1C9DB 4O4JA 4OU5A 4BLRA 3OBBA 4E5PA 4EMBA 1HLPA 1W5AA 2FZ4A 2VEOA 1OW3B 2Q07A 1Z3IX 3S68A 1W4ZA 5AH0A 1YRYE 3VJLA 3CRZA 3RYCA 4PXSA 5T67A 4Q4AA 3PEFA 4HB3A 4QXQA 1B76A 2VHZA 1LQ2A 1ORHA 1AQUA 2B8NA 2YXLA 3AOEA 3JD3A 3GFBA 4HJRA 3B78A 4C30A 2C78A 4RD4A 2W6OA 2GM4A 1T8TA 2Z2ZA 1YOVA 1ZJWA 3THYA 3H6KA 1M10A 2VK1A 3C8DA 3PLAE 2CV0A 1HEIA 4Q47A 2IYOA 4BAUA 3NTRA 4LNUB 4QJ5A 2IP1A 2QP3A 4AT1A 3CB4A 1GT91 4MGZR 1ZVQA 2O2IA 1KEWA 1GRVA 1QIFA 1ZIDA 2VH2A 2ZAOA 2JFYA 3LYUA 5AK5A 4C89A 2DAPA 4DG8A 4IIBA 4R8RA 1U8CB 3RVJA 2B0CA 2H18A 1OB2A 3EXIB 4WK2B 1EUQA 2YJGA 2PXXA 1KY4A 3KQKA 1E8NA 3CNQS 1V43A 5LXTB 1C81A 2PJZA 3MMXA 4KREA 3GFQA 1G291 1L4UA 1EHIA 1KJJA 1UXGA 1U9YA 2PWBA 2ZJZA 4RDIA 2WYVA 4DV5B 1QYDA 1FX0B 3AU9A 2WWFA 3VHXB 3R6LA 4AM8A 5IT0A 1LVUA 1UIRA 3M5WA 3P26A 3VO1A 3ZW9A 1R37A 2A84A 4OI2A 2GQ0A 4GKAA 5L3RA 3OLZA 4EHFA 1WHTA 1VL1A 2FRXA 2J5BA 5FULA 5AW9A 1JU4A 4KZKA 5AK3A 1LBSA 2FLKA 2LRHA 3NJ4A 4P6VF 5DISB 2GRAA 1SCUB 2FSIA 1BXGB 3G8AA 4LAFA 3GRUA 5AKEA 4EKGA 4F11A 3QG5A 1YFLA 2FUG1 1R3DA 4CFSA 4N47A 1O4WA 2A1UB 2TRSB 2JNWA 1YIAA 4OHXA 1YVDA 4J1TA 2PG3A 4IJWA 4OB6A 5G1NA 2WM9B 3TXXA 3FWZA 2HIHA 1FP4B 3STHA 4XFKA 5T64A 5KNDH 3BFXA 2PZEA 1YE5A 1NW6A 1MAWA 2ZDQA 2WSBA 3PFKA 1GUDA 3ZZTA 4U1RA 4D9HA 2BTEA 1YJQA 1N2CA 1XVTA 1HE2A 3WLKX 4JY7A 1DIRA 4PZZA 4Q7MB 4DIFA 3EQ2A 4HS4A 2LXNA 3C4VA 1TF5A 1E3TA 1HFKA 1H0SA 2JIOA 1UBTS 2HJSA 5FTJA 4CV1A 3DOJA 2JVIA 1F2UB 3ZGNA 1NE2A 4PICA 1SU8A 2NACA 4FT4A 5H9WA 1OH8A 1KYXA 1RBMA 5ILQA 4KBGA 4BGVA 1RQ2A 2C5HA 3DXZA 2ZS8A 4O08A 1QGUB 1E7WA 2B4RO 3EEFA 3MCWA 2QMZA 2OZPA 1H94A 3ORFA 4QRHA 1R64A 3DCYA 1IVSA 1JSCA 3MWEB 3SFVA 1NHWA 1MJGM 1NVMB 5KX5F 3GC6A 421PA 3AO0B 5K3DA 2O8CA 5KQRA 4RIHA 4HZUA 2QB5A 1MPXA 3BD7A 3F8TA 4FFBA 4TT8A 3O8CA 4XJVA 2KWIA 3I9JA 4UCWA 1J7JA 2KB0A 4IIVA 4Q37A 4PCAA 5L3ZA 1VC2A 1FLDA 5EC8A 1ZJZA 2IPAB 3O0DA 4F6LA 4QEDA 4Z3OA 4ERXA 1DBQA 2W8ZA 5FOUA 1I2DA 1WPXA 1SIUA 2XEDA 1TAGA 4J7AA 2WHXA 3AFNA 4UPDA 4P5PA 5JU6A 1XQ9A 4M87A 2ZT7A 1E6MA 4DIBA 1CIVA 1CQJB 2FE4A 4KGXA 4QDKA 1VL2A 3LCVB 1M66A 2FUNB 5HF5A 5C34B 1XDSA 1B43A 3L0IB 4HEQA 1GG2A 3K1YA 3JYLA 1UADA 3BWCA 1KH3A 2PS9A 3A3OA 5EFZA 3K6SA 3FMFA 3QX3A 3NETA 1CZOA 5ADWA 2XWBF 1JKFA 4C04A 1APBA 1Q0QA 4ZT4A 3WWEA 4QRDA 3N6XA 1ZGGA 4URUR 1WVMA 1Z2NX 4DW8A 1EJ2A 3RVMA 2QE7D 3HS3A 1ATIA 2IHVA 1L8AA 1YDWA 4GPD1 5EEHA 5GIOE 1J2JA 2AOUB 3CH6A 3PRYA 3PNBA 4PW0A 1WWKA 3UOGA 3DLCA 3V5NA 1C9EA 1C9YA 2PSHA 1H2EA 2Y1DA 4Q9LA 3HVKA 3OAAD 3SOPA 2GM9A 2JRLA 3EZ9A 3GHYA 4WN9B 1SXHA 4DTIA 1W9HA 1DQNA 4TTRA 1QHFA 1WQ1R 3TW4A 5JLAA 4ZI7A 5BN4A 5K4GA 1G9SA 2CXSA 4EG6A 4HLUC 3WLRA 1FYXA 2D59A 1PLLA 4HH4A 5FTKA 1DQZA 3FTFA 1OH5A 1MIHA 3MD0A 4WTOA 3AKYA 3HLYA 3ZTTA 2QR3A 3PA8A 3BL6A 4RHCA 4GC5A 4B80A 3PGLA 4IJ5A 3GJQA 3HYNA 3KYJB 2HU8A 5FEMA 3AY7A 3G13A 3KEGA 3W4IA 2MOKA 4NYIQ 4EI7A 5IWCA 3L3BA 4O0LA 5JZVA 1NT2A 1X14A 3I9V1 4EB6A 4I5GA 2MSDB 1YR6A 2HEIA 1YL7A 2IOFA 3GZTB 5DLPA 3FZQA 4RHTA 1QP7A 1HYQA 2AFRA 2QVBA 3PFIA 13PKA 1C4WA 4NEHB 4EI9A 2VHYA 1UT6A 2WJZB 4EK9A 1V39A 2O0KA 3OT1B 3ZKAA 4IMRA 4FZ5A 4D0NA 3RCBA 2JLBA 1SQGA 4X71A 1OLUB 3OOJA 3FVVA 2IHJA 3UICA 1WY5A 4JJZA 4C4OA 4DNOA 3FOFC 5JNLA 4NCAA 2RG7A 4X7PA 1X80B 2WJ6A 1VYTA 2W0MA 2PNJA 3ZIAA 3ODPA 2PBZA 2IZ7A 5DCYA 3JQFC 1MU0A 4CBVA 3RUDA 3TNFA 1WW3A 1TUGA 5MFZA 3VJKA 5CEJA 2GYVA 2H8GA 3FHLA 4WBXC 4F4IA 4PHFA 3PGKA 4PLWA 5EI5A 4AG5A 3SZOA 2BTQB 3BK7A 1RLUA 5ALKA 3C6BA 5EE5B 2OGUA 4PYJA 3RC8A 3O8QA 1QB8A 3KQOA 1EH5A 4OKNA 1KQNA 4BLPA 5AP9A 4YRIA 2A9JA 4E2FA 4ZVUA 1U5AA 2XD9A 4Q9NA 3NUQA 1F0YA 1F6BA 1G4UR 3F5MA 4PE5B 3WB0A 1O03A 2BBSA 1FFCA 1KC3A 3ANMA 4NABA 4D46A 4XOUA 1DT5A 4D4KA 1R0WA 2BGTA 2I6TA 3CKYA 1BHJA 2NO6A 4N7BA 2OB2A 3HNPA 2FR8A 5BXQC 1TD9A 3G5TA 1LY1A 2X2EA 2SECE 3TQHA 4BO7A 1KVSA 2BGUA 1KWKA 1SWWA 3AKEA 3DPUA 4LKOA 1DCKA 1FSPA 2NZ2A 5BWNA 3H3JA 3L6OO 1J0CA 4TS1A 3RT7A 3IPCA 3F5DA 3TECE 1KR2A 1JR4A 2Q0HA 3BAFA 4QDJA 4DLZA 1GN9A 4HDNA 1DADA 1W46A 1NONA 2BH9A 3AEUA 2QT0A 3IV9A 2FEWB 3GNLA 4DAEA 1AKWA 1L9KA 1P0CA 5COBA 3KZCA 4CCYA 4D79A 5K03A 3VYVA 4G0VA 3OZ7A 1WDWB 4TMZA 1TYZA 2M32A 3K0AB 3HL0A 3TBKA 2XWSA 3O7WA 1WSDA 1XIVA 3OC6A 3RGGA 3B5IA 4ARZA 2WTXA 4D4MA 1GZDA 1CUYA 3LHSA 2PXCA 2QRQA 1LS6A 2BMWA 2I6FA 3DZKA 3L7OA 1B8OA 3Q87B 3EDMA 4DC0A 3TCXB 4F04A 3I53A 3T99A 3QEMA 3VHRA 5BY2A 4P54A 3BIXA 2HF2A 5M34A 2CBZA 1ACMA 4G5GA 3FFAA 5FDFA 3IJ5A 1QTQA 1QBKC 5C7IO 1HI9A 2WOJA 4CM5A 3G1TA 4IV5A 2YVKA 1RBQA 2P2CA 2JGIA 4W1RA 4P3KA 2VT3A 1U9CA 1AURA 1DRUA 1ENPA 1K27A 4CLDA 2IYYA 3PUHA 2EFJA 2BFCB 2W6ZA 4UM9B 4C4YA 1XTZA 1JHYA 3O3NB 4KYUA 1AKVA 1N9KA 2FHPA 1WUKS 1AGYA 1NI4A 1W29A 5BW4A 5THQA 3V7YA 3TPFA 4FGLA 4F4CA 4LEIA 4E21A 1WABA 2F1IA 1P5JA 5CH5A 4REQA 3F1LA 5AYVA 1NLMA 2EJVA 3EJWA 5I9BA 4WJKB 1CRQA 1JJBA 1LC3A 4XD7A 4EGJA 2FR1A 1TUBB 1ISGA 2XUZA 2O3UA 2PKQO 2A30A 2ZW9A 5LQUA 1N5KA 4HQRA 2ZJOA 4CKXA 2LP4Y 3OFSA 3CLKA 4P0PB 4ZCIA 4EJSC 1R6TA 1I6WA 1P4HA 1ZXXA 2J85A 2EAUA 4I3HA 1DIOB 1CIPA 1E98A 3LBHA 4MR7A 2C5LA 3HP7A 5IJXA 1U8XX 2HBQA 5DW3A 5KPJA 4U3JB 4S35A 3VDQA 3AR4A 3VOBA 1MT3A 2R44A 3SSOA 3G2IA 1DFIA 1SB9A 1TZBA 2I3ZA 2WZQA 1GUFA 1ZGBA 4L73A 3KZXA 2I66A 2YIMA 4EF6A 4YP7A 1OZAA 1PR4A 3NAGA 3WOHA 3MCUA 4NENA 3RU9A 4WVLA 3PQFA 2NQ2C 2QOEA 2VUSA 1A0OA 1MC5A 3K5IA 4PYIA 3TINA 4HI0E 4HT3B 5B30A 3RYFA 3U0BA 2A33A 1YR7A 3MB8A 4J94A 4B32A 3VZRA 3IX7A 3EPLA 1X86B 4Y2TA 1M3SA 3OPYB 4PQYA 5HRAA 2IYAA 1X38A 3FIUA 5JCJD 5JLJA 3B5JA 1M2JA 1V3TA 3GN1A 3D7LA 4R31A 5DVZA 4UD2A 1JG3A 2HSJA 5C1DA 3V46A 2HZ7A 3DW1X 1VLMA 1W2HA 4KOEC 1CF2O 1GNQA 3I5AA 3D6MA 5C7OO 2IY7A 3WTBA 1AF7A 4AN4A 4IIJA 3M4XA 2ORYA 3E61A 3B7GA 4LJ9A 1QYRA 4F6CA 4G8CA 3NKFA 1HDEA 1WDLA 4NL4H 4R1MA 2QX9A 4UPVA 5IW8A 1X7XA 4BGDA 2ZYUX 4BZQA 2WB2A 2QJWA 1E64A 3FXAA 5DBGA 4NG4A 3ZNPA 5K8VA 5HR5A 3AJ8A 4CI0B 3IHWA 1Z35A 1LDBA 3PX2A 4ZEMA 4AUNA 3X1JA 2A9VA 3ZNNA 1ETUA 1NVKA 2A5LA 3TX6A 4MQFB 4FZ3A 4HX2A 2NO5A 1ADGA 2O5RA 1C8KA 2PX5A 3KJXA 4OY3A 5MN5A 5AUOB 3CPHA 1KARA 2NU9A 1O1YA 3AM4A 1CR1A 1VL8A 2P41A 3I28A 2G7ZA 2HCTA 1NF3A 1UP4A 1G60A 2FTKE 3O2NA 3QFSA 4FU0A 4O2AA 4ZQFA 1UJCA 1NRIA 3EC7A 1IQPA 2MCFA 4TMFA 4JP8A 3HCWA 1USVA 1DXYA 4NYIR 1UUFA 1IRXA 1SXPA 4GI7A 2I71A 1NN3A 1IBKB 4JR2A 5F1PA 3DQQA 1DFHA 1U8EA 4N3CA 5G1OA 4RM3A 4J2TA 1CUFA 3R76A 2Y1EA 1NHGA 2W6MA 3IP8A 4Z8XA 3CXRA 3TCKA 1TZCA 4IH1A 2PL9A 3EQ8A 4OA8A 4PO1A 4XWYA 5J9FA 1J0AA 3C1OA 5DNYB 5TF4A 4A8JC 4C06A 4C0AC 1KEEA 3R5JA 8AT1A 4DRZA 4EB3A 2CHFA 2VI5A 1GSOA 1XF9A 2P5YA 5EZQA 2QVGA 4BN0A 1R0ZA 4M53A 3PKJA 2EHDA 4MWTA 1KAGA 2LKDA 1AN0A 1IUPA 1J8MF 2WIKA 3DLPX 3IR6A 4IEEA 3ROEA 3DC7A 4B4DA 4E5VA 2E87A 2WT4A 1QU3A 2VJOA 3AEYA 2B1IA 3QW2A 3GPIA 1G7TA 3D6FA 3QFHA 4CCSA 1FJHA 2ODPA 2Z5VA 1KSGA 5HP4A 2G9ZA 4JU8A 5BWOA 3UXHA 1XU4A 3F7TA 4QQRA 3WLLA 5LVAA 3ZE8A 3AFIA 2CJPA 1RRKA 4N0QA 3HCDA 1S2MA 3K2BA 1DEOA 3MTBA 4MCIA 4Q93A 3FLAA 3TUJC 4P7GA 3Q8KA 1DCTA 1SG9A 2P3QA 4UKDA 2CZQA 1SBZA 3PCXA 4H59A 3COZA 1PSDA 2ZRIA 4KWTA 1NNLA 4QUAA 2WWYA 1X6VA 1C0EA 3T9DA 1OAKA 4R98A 4UNNA 1VLVA 1L7QA 1WXQA 1YQWA 3MRXA 2BEVB 3SJCA 4MHOA 3V1KA 2NIPA 2XUDA 4J0GA 3I9MA 4LY6A 4OGFA 3RVKA 4EHKA 2BFFA 2IDKA 3ZHTA 5HPYB 3THWA 5IXYA 2UYQA 5AKGA 2ROQA 1EUZA 3GFFA 1RHQA 5C5IA 1K0UA 2IEYA 3CGGA 4IIFA 5C32A 1IAVA 1ZUD1 2H51A 4FSDA 4MUBA 4C7MA 1GPJA 4U9IS 3ZU6A 5ILOA 3ZGOA 1FXWF 1P1BA 4XR9A 3HSSA 1WD5A 3WK6A 3F6PA 3OFKA 3SQLA 4JI4B 3FHTA 1NG1A 3LGXA 4UM7A 2FUEA 1T3SA 3VM6A 1G98A 1K8QA 2BGMA 2VXBA 1FRZA 1LPNA 1HTBA 1RIIA 3NJRA 1ZVJA 3JASA 5B1EA 1KH1A 1MDFA 2WYIA 2JIZD 4GLOA 3RV3A 1MH9A 1GAJA 3DB2A 4PC7A 1D2CA 2X3UA 4R2KA 1QFJA 5DGDA 2IV2X 4H4DA 4FLEA 2H29A 5EXDA 3G9XA 1MRZA 1MENA 2PZAA 2W6CX 3A6ZA 3CLUD 4N18A 3SYKA 3V34A 2ZRFA 4J0IA 4KZPA 4NATA 5IX8A 3ECAA 1X19A 2JW5A 1ZCAA 2OLJA 3V8MA 3AR3A 1NWCA 2OO7A 2OPHA 1Y8RA 4TL9A 5U4XA 3KUKA 5FWAA 3NTOA 3RYIB 4RACA 2A9QA 4DV1B 1OPXA 2AI2A 1G8YA 2DUUA 3Q4GA 1PQWA 4HF7A 3DVQX 4G9GA 3C1TA 3WWYA 1NNSA 4NBSA 3BG5A 2FEXA 3OZIA 3T3OA 4F60A 3OFVA 2QROA 3D5EA 3MT8A 1G3RA 4DFDA 2AWNA 2O5EA 4BMPB 3G1UA 3KT6A 1WKVA 1FFEA 3CZ9A 3ON5A 3QFRA 4JQCA 3TSOA 3E3AA 1P2DA 4RA9A 3G82C 4ZCTA 3AR5A 1LF5A 2XMBA 3PTAA 2X8LA 1S9HA 1Q17A 1N5IA 3RC9A 1RAIA 2AN4A 2BI7A 4DGQA 2ORVA 1H9BA 5BP7A 5FUMA 2FETA 4ALLA 4GX2A 1XNRB 4GT1A 3VPXA 1S4QA 2F3QA 3CQ9A 4HGYA 1QRRA 2ZAIA 3UKDA 2EDAA 2PS0A 2YXNA 3JW8A 1N7IA 3E5HA 2IZ0A 4TT3A 3VU0A 1PG5A 5EY5B 4CMGA 4DJAA 3E53A 5BQXA 2RCNA 3LXMA 1V0JA 1Z0FA 1YVRA 3MPUA 3OMWA 2RGXA 4X8HA 4Y6SA 5K8UA 2GK4A 3N7TA 5FJIA 4AWAA 1GKUB 4C0QC 1GITA 5GM2A 4G6ZA 2JLQA 3N0TA 2P75A 3HDGA 4PZYA 1N0UA 1KKUA 2CF6A 5EJ8A 2B94A 2P9BA 4CN9A 4TTSA 1FSGA 1TCUA 1TUIA 2BFPA 2EGHA 2PZLA 4JBIA 4YMHA 1YZQA 2BM1A 2B2NA 2H11A 3L1UA 1OXXK 4U7WA 2FHSA 1V2GA 5DXFA 4RTLA 2C5SA 3ESBA 3KKZA 4TM7A 4IKEA 3NDRA 3KYDB 4NCXA 4R1NA 1ORIA 2IGBA 3MBIA 4Q21A 4Y1EA 2FPLA 4XEHA 4ZOCA 5TC4A 1OX6A 4DIDA 1IBLB 4B3IA 4RCYA 3VYTB 1CUJA 1IZZA 4GZMA 1JR3A 5EJ6A 3QUSA 1L3IA 3RS3A 5EZ6B 4O4JB 1MUUA 5JSUA 2OB1A 1V8DA 4BASA 4H6PA 4O33A 1IY2A 1XX6A 2FMXA 3O9MA 2WWVD 4EGSA 4PYNA 3RYCB 1HE3A 2YWEA 4AZ3B 2FSVC 2JAQA 2Y1FA 3ID6C 2J1LA 1LK0A 4L3WA 1VKZA 2B78A 4Q4AB 4ZCQA 1RRGA 4MAFA 4BZXA 1QFMA 4QVIA 5G41A 2QTNA 2F55A 3Q3CA 1X9GA 1KK2A 4JBYA 5IAKA 4CF7A 1QG4A 1YKGA 1BS9A 4ZOLA 3F8SA 1THGA 1CUWA 3OIFA 4UUOA 3HRHA 4EG4A 1YOVB 2Q5IA 1IZ7A 3THYB 1N6KA 5KQLA 1P5RA 1FF9A 1OFIA 2PM8A 4WY5A 5I9NA 2IHTA 1SBIA 4WZ6A 3HU5A 2X0RA 4DA8A 3AUKA 3GUYA 3PVZA 4U8HA 1E62A 2PT5A 1QP0A 2O59A 1OI7A 1U7DA 2JGMA 2RHOA 3RYTC 1BQEA 4OQNA 2X4LA 1ABEA 4WD3A 1T6ZA 2WRZA 3BKXA 4UVGA 4YNBA 5HRUA 1TQHA 4D8UA 4NMHA 3FPBA 2W7TA 4IW3B 3C3JA 4HDAA 3K1TA 5G0SA 4G85A 1KVRA 2VNIA 2X6TA 2GJAA 4I9GA 4ZVVA 1Y3CE 2N1MA 3UKJA 5I4BA 2A67A 3GROA 2WEKA 4A15A 1UT8A 3SJBA 1JSRA 3E27A 4HLNA 4CKCA 4QASA 3J7AC 1ZOOA 1GLNA 2CD7A 2P6PA 1FS4A 5KHAA 4JKIA 2HFKA 3SIPA 1BJKA 2JBAA 1WHTB 3FDJA 5D2CA 1E1YA 2ZYTX 4M0EA 1E2DA 4MW6A 2PZ8A 3OC0A 4ENRA 1DKUA 2E6KA 2RH5A 3AF1A 3R9WA 4C07A 4L78A 4BNZA 4EOGA 2YX1A 2ODBA 2D6FA 2RGCA 3ZK9A 3K8ZA 4XVUA 3J81A 4C0KA 4CFZA 2XB8A 2EDCA 4D9EA 2Y6VA 3PEEA 1Z75A 1JIUA 1DFGA 1SCBA 3OUTA 5EHGA 1ECJA 5LLTA 1EA5A 3H8SA 2HF7A 2DLNA 1ZOLA 1SZPA 1SCDA 2E6UX 3B70A 3HU3A 1GQOA 5EHZA 5FNVA 4NBUA 1QHIA 1N2CB 1GKYA 5DN6A 2CFCA 5CTAA 5B1YA 1LTHR 3X1WA 4P4SB 1B2LA 2NPFA 3DFIA 4KMMA 3ZHZA 3UK0A 1OX4A 1XA3A 1TVEA 3CZ4A 5BSHA 2WIAA 4BMSA 4MRMB 2P30A 1M7GA 4LXUA 3ENWA 3VU9A 4GX5A 4FYJA 3S2GA 3VTZA 4B35A 2D1TA 3N2YA 3O8BA 3VC3A 4LYYA 1W8DA 2QL5A 1DDIA 4FP9A 2EIXA 3LP6A 1USIA 2XCQA 3VR0A 4P9NA 2WP0A 2HNKA 5CJJA 5FJJA 4B3DA 5JS1A 3A6HA 3ESZA 3TLEA 4CR7A 3PEWA 3FPCA 1F8XA 1I7LA 2JGKA 5CJPA 1CHNA 1ZU5A 1OZFA 4MW9A 5D1NA 1F0NA 5A3VA 2O8CB 1M73E 4H4EA 4HZUB 4FFBB 4XIFA 1VJGA 4A26A 3TMAA 4LPSA 2IODA 2QRLA 5DLDA 4AMVA 3MC1A 4IDQA 3AF0A 1BEUB 3WFZA 2XOXA 3CX8A 3GHHA 4ID9A 1Q0TA 3OUZA 1DBSA 1SVNA 4NMMA 3VOSA 1CJVC 1QFZA 1E7MA 1K3FA 2FXIA 4LDNA 5DCUA 3O4HA 5JQGA 4YUXA 2GN6A 3A6FA 3BCHA 1G6KA 2SHKA 3RJMA 2YY5A 4JENA 1T6BY 3ECCA 3UC5A 2GUWA 3UENA 1P8AA 2IXFA 5BT9A 4MVJG 3E4DA 1KQPA 1ABBA 4HN4B 4FN5A 1IHPA 3TD6A 4MW2A 3VSCA 4MWGA 3RAFC 4U4AA 5G0TA 3RGWS 3W6ZA 3OZVA 3Q2IA 1QTNA 2FEAA 4BJ6A 3R23A 4DCCA 1J49A 2FPMA 3LC2O 4YONB 3FCSB 2VUTA 5GV7A 3SEAA 3K6SB 4E4RA 1YKSA 4M0MA 4MICA 4TOIA 3QI7A 3N5CA 3HYCA 4UUMA 2AI1A 1BO6A 1XQVA 4NNOA 5JNUA 2P4EA 1USGA 1QR6A 3RSZA 1PVVA 4ME6A 3F5FA 4BQFA 1HDGO 1O95D 2QSYA 1UC8A 1GUAA 1M7BA 2IW3A 4DA9A 1BHQ1 1UBGA 1XMIA 2AR0A 4I4LA 4UBIA 3K32A 1JFRA 1QH8A 1ZFNA 3SK0A 2KM1A 4EY7A 4PGAA 2B8JA 1QIGA 2ECFA 4DLTA 2XHZA 5AW8A 1V4NA 2OZLA 4OSPA 4QUIA 1P2TA 3KKQA 1CJSA 2QUJA 4R6XA 2ZIFA 2V0NA 5EWLB 2YV5A 3WLNA 4CDNA 1MJGA 1QVVA 4KR2A 1H4VB 3P9YA 2G1AA 1X7GA 1RCTE 1IBRA 1TKRA 1UQRA 1A3CA 3E7DA 5FBWB 5FLKA 3TZCA 5C4MA 4CF5A 5TNXA 3AVWA 1AHHA 4N9QA 4A6PA 1C1DA 2AGVA 4NZOA 4AURA 4O2LA 4JB2A 1H85A 4EB6B 3ZE1B 4IS2A 2OCLA 4HNUA 4NCJA 3OX3A 4D8VA 5J4KA 5ALNA 5JCZA 2X13A 3LC7O 3NBFA 2X76A 4M8IA 2Z09A 4BZPA 3HABA 1XAIA 2PZBA 4P93A 4QM7A 3VNUA 4DRYA 4GECA 4IDHA 1JV2B 4BGEA 1ZBQA 3BFPA 3FSGD 1E8DA 4IDOA 3LRPA 1HFWA 5BSVA 5KHLB 1F3LA 3TE6A 9MHTA 1CFJA 4U6NA 3SR4A 1EM8B 5KDDA 1YNOA 4ZYYA 1ODKA 2K5UA 3BX1A 4IHJF 4YCCA 2N46A 4S3MA 4C2UA 4KLCA 1EGAA 3C41J 4Q1DA 3ZD9A 5IHPA 4EYQA 4K9KA 3WBJA 3MEQA 3LXRA 1HZJA 2JCYA 3HJRA 1WV1A 1FFXA 1PV1A 4IWXA 1VXOA 1NMSA 5EJMA 4MVCA 3JQGA 1FFBA 1M6HA 2JAUA 3O4RA 3MWLA 5KOHA 3P0EA 4NDZA 3R0XA 3EG5A 5C5DA 3LWDA 3OX1A 3WGZA 2VJCA 2X2FA 4JLPA 4DMFA 3PFWO 5C52B 1NQUA 1Z62A 3NCHA 2CXHA 5HVNA 2F8TA 2M2IA 3EZYA 1NC3A 3LUDA 3NEPX 4MA4A 4Q82A 1ODTC 1VHJA 3VVLA 4TUYA 3KTAA 1Y33E 5CDTA 3LHKA 4WLOA 2QSUA 2I7VA 4IJKA 4DDWA 1YRHA 2D8MA 1HQYE 1YUBA 3AZQA 3D64A 3GFVA 2R2AA 4HLUA 4XGQA 3RSHA 1RMYA 1W4LA 4BB6A 1KF0A 4LQDA 4HDNB 2ZUSA 1TGYA 2OGZA 2Y1OA 2A4KA 3IUEA 4LZZA 4CCYB 3GBPA 4FSHA 5KNBD 1PFKA 1RM0A 2CV1A 3E15A 1R88A 1LZLA 1R6XA 5LYYA 4NV3A 4W9RA 2F43A 1PWEA 3AVYA 2H0RA 2Q5CA 4AAYA 1YO6A 1I4DD 1Q16A 1YACA 3E58A 4G09A 1JZSA 1VYVA 1F1JA 4B7AA 3CLVA 3RVRA 5J23A 1HKUA 3EBOA 4UMFA 3QEMB 1ICEA 2IIPA 3NP9A 4GBED 3U7JA 2NZUG 4EB8A 3HJFA 1PZGA 1SUWA 2H52A 2JK1A 2PFGA 4XIIA 4DQLA 2H00A 3AR8A 3H2BA 1S3FA 3H3XA 4I14A 2OCYC 3RG2A 1P74A 3ZBUA 2BHLA 4RSGA 1H4TA 2JA2A 3ZDQA 4CM8A 4YFVA 1AZTA 4DR5B 1X0VA 1GZVA 4XRRA 4LRSB 4PN3A 1JZQA 2OXFA 3T41A 3PIRA 1E2PA 1KZ9A 2XWJI 3G2NA 3QLEA 1MAAA 2XRFA 3WZLA 1DXOA 2ZAYA 3G17A 5BMVF 4QPNA 4P4NA 1RBZA 3OE5A 4H0FA 5KDOA 3L1HA 3KAPA 4S1OA 1NI4B 4PC6A 4ZWNA 1E0KA 2H3EA 4XSHA 2WIGA 4F5YA 3BL5A 3QBEA 4M9QA 4REQB 1ZM7A 4WLVA 5AW7A 4PM4A 4OI1A 5K2MA 4D44A 3LMKA 3KKMA 4EX6A 2YMLA 3ZTWA 2FPIA 5CXUA 5TQVA 4YPOA 1UBCA 4B4VA 1OREA 4HAUA 3FOAA 1U0EA 1I94B 2GMWA 1H2WA 4KQHA 1IN8A 5K3OA 1S2NA 5JI2E 1ENZA 1WPQA 4MR7B 4DBLE 1S2OA 3PI7A 4FI3C 3ZGLA 3HDQA 1MO4A 4OCZA 4E70A 5KYYB 4BU0A 4YXFA 3WGUA 3TTXA 5A9SA 3OZWA 3EEBA 4HXGA 1WXDA 1IONA 1RFGE 1CUZA 1XEXA 1XRRA 3MG9A 2G63A 3GO4A 3KEOA 3T5AA 3R1IA 5JC1A 2HPZA 2F7SA 3SIXA 3ABOB 3JR3A 2JJ8A 4S04A 4NENB 1IEWA 1A5ZA 1SXJE 5KTRA 1W94A 2XUJA 4NI5A 2P0EA 4ZO9A 3DMGA 3TE7A 3RYFB 2ECKA 1PYGA 3T7TA 4C4RA 4LISA 4PNPA 2M6RA 3TEMA 2XQVA 5DI3A 3ULKA 1OXUA 3GP3A 1WMFA 3ESXA 2A0XA 2RJOA 3TTYA 5C5CA 2IF0A 1DUSA 2JBWA 1NUAA 2GA8A 1M2VB 2FE1A 4LN1A 1CCWA 1GQYA 1RC1A 3O3CA 4MSUA 1C7ZA 4UDXX 5A0FA 4XTRA 3SP1A 4AU1A 5A2QA 2C9BA 1LH0A 3WNZA 1XCOA 3IIIA 3L01A 4IJMA 4OYRA 5FHRA 3WRXC 4IIJB 1ZEMA 1B93A 3EVDA 4DDVA 1B0ZA 2XNHA 3FJ1A 3LUFA 4FJ2A 3LQKA 3BJEA 2PS1A 3L7BA 2DT5A 1K88A 3UM9A 3PITA 4Z0PA 2O4UX 5ALVA 1X7XB 2QG6A 2DSNA 2R4QA 5EZYF 5BR4A 3SCZA 3EMKA 3VJRA 4MYUA 1E1DA 3CRMA 1EXVA 5J4VA 2C1EA 2Z4TA 1PKEA 4RH1A 3L0OA 4N9WA 5IJWA 1QGAA 2Q1TA 2V4ZA 1UDBA 2CWDA 2A2ZA 2JGRA 3EXHB 3K1ZA 4ZMRA 3DOUA 4BE4A 3V55A 1EJ0A 4H31A 1FUEA 2JI9A 3A7DA 3L7KA 2YMQA 5LMNB 4HWPA 4WCFC 1R6AA 3MJ4A 1H1DA 4Z9YA 3T9BA 4D4GA 4EJSA 4D0RA 3E05A 1EWKA 5LM3A 4NOJA 2GB4A 2R8ZA 4ZRDA 1U2ZA 4NHOA 2NU9B 3IT2A 4CUJA 3N76A 2J3IA 4QXMA 2VHQA 5B58C 1XZCA 1AJEA 3L4EA 4PNEA 4R1OA 4B5KA 3NVKI 4EUFA 1T0HB 4PCUA 3MS2A 1IOZA 3BXHA 3GGDA 1F3OA 2JJ2D 1NNUA 4PZDA 3UB2A 3MILA 2PGIA 3H0KA 2L17A 4HKTA 4OAOA 5B4TA 4IM7A 1Q2XA 2I8LA 2O0JA 4XA8A 4BO0A 4CTJA 1G7RA 3MS4A 4NK4A 4NYJQ 1XKLA 3DM9B 5JHGB 3O91A 1BHO1 3I73A 2MHCA 3B51X 3N59A 4RPKA 4DLBA 1KEEB 2WNSA 4RADA 4M4SA 3S2IA 1VRWA 7ABPA 3CO0S 5ADHA 4Z2YA 3TQFA 4COKA 1I13A 2W2LD 4XVQA 4J0KA 4WOJA 3BMCA 2DPXA 3UYKA 1F9AA 1IXRC 1SG0A 1Z82A 2OHVA 2XYHA 3B2NA 4DM4A 1RJ9A 1L7MA 3IULA 1MG5A 1PBTA 1LB1B 2BKLA 4Q7KA 3U9LA 2R7KA 5LU9A 3GFSA 3ONNA 5CX4A 4J0FA 2PS3A 1A1SA 2Y68A 4Z9AA 3SSAA 5H1YA 5LQRA 2J7KA 3AHGA 4I1VA 3R9IA 2D2FA 1QE3A 4NZYA 1N3LA 4ZD6A 2OR3A 1X8JA 3FPKA 4PF1A 2AX3A 2PUDA 5CFOA 1G21E 2HI0A 1IDOA 1SPXA 4E4YA 4EI8A 4AQYB 4K9LA 3E5RA 5ISMA 3T7IA 3ZJUA 4Z9XA 1NF8A 1P1CA 4HRVA 1Y3DE 2VJDA 3EAQA 3WTCA 1DKQA 3IELA 1OFUA 1U2DC 3MNFA 3OIDA 4GOXA 5IDVA 2NWQA 4CU2A 4F2GA 5JSZA 2G0AA 3VO8A 2AJTA 3I2HA 1BD3A 4TMKA 1SU6A 2FOIA 3D4LA 4NJMA 4U7PB 1CUUA 1EBUA 1CJUC 3HGTA 1XD8A 1MX9A 3N9IA 2GO1A 1YCFA 3UB3A 2BFFB 4N1AA 1UWCA 2EFDB 4LY3A 3THWB 3OPQA 1YU9A 1BRMA 2V6FA 4P35A 4R81A 4RK1A 2C5AA 3OOWA 1B41A 3OT4A 1XL0A 4KBFA 3CZAA 4TLCA 2VZ8A 2NUPA 3M6FA 4KXQA 2QXYA 1GAEO 5CLFA 3KXKA 3D4BA 5ESDA 4OXRA 4QJ4A 4PX3A 1TTQB 2ZE5A 3FIJA 4UCFA 1LK5A 3UAVA 3ZX4A 1OIWA 4MB6A 2BZ1A 2FCAA 1W52X 4OLBA 1ZL2A 1DQRA 2JFWA 4DIEA 1VLLA 1K8ZB 3CEJA 1LV7A 3JASB 3PXAA 2CLCX 2FX2A 3H16A 4K6HA 3L2OB 4G84A 2G06A 4OXXA 2LUOA 2WAYA 1XTVA 4P31A 4O1MA 4TYQA 5EPEA 2DPMA 4JBNA 5B64A 2GJ9A 3SXPA 3DZBA 3N6VA 5EXXA 5CB4F 3TN7A 2AVNA 1OFGA 1W1IA 4ZVLA 1B6TA 4D3SA 1ISJA 5K09A 1QO0A 1RWVA 4MWDA 2C7RA 3QG1A 4RQAA 4X9XA 1NJSA 5TT1A 2O4CA 4CMHA 2JFBA 2C3PA 1TECE 2OKCA 4MKZA 1Y8RB 1QV9A 2OBNA 3S5JA 1OASA 2GN2A 3BD8A 2CDCA 3CF6R 3PE3A 3INTA 3QXJA 1XB2A 4K7JA 3S4YA 1P91A 3MELA 2TSYB 1U1DA 2AYYA 2H3HA 1QRDA 2NX2A 4KYIB 1YB1A 4FHZA 4LDJA 3WL3A 3EIOA 1PTJC 3LYHA 3RABA 3U40A 2QHXA 3EWAA 3UTDA 3PXXA 4RA9B 4IHAA 4YJ3A 2OP1A 2J46A 4UM5A 2KJQA 1J6UA 1JHDA 4L16A 4G8BA 1PZMA 4CU5A 3NBYC 4PO8A 3T0FA 3NS7A 2E4YA 2I6QA 1AKUA 1TI7A 1IRIA 1H2BA 2EKLA 3H2HA 3ICVA 3CJTA 4MGHA 1DC7A 3H1GA 5JMTA 1P4AA 3E81A 1THZA 1QCCA 3ACBA 4J7XA 4TWBA 3DZGA 5EIAA 3X44A 1MQ9A 1HK7A 5KWEA 4N5MA 3REGA 2DLCX 2G9VA 4CUZA 1HSOA 3L7LA 3DLBA 4KIUA 4R2WA 4NCHA 4AMYA 4JI0B 3NHPA 1V9SA 2NYAA 3PTZA 3LNCA 4HWTA 4L8VA 3DR5A 4NE2A 4TTJA 4YJGA 4AJKA 4S2UA 1SUDA 2QA5A 4IVPA 2BR3A 2HMTA 2B82A 3DTVA 4LHSA 4NRDA 2NUBA 4JEIA 3HADA 1ZGAA 4FZRA 4UUPA 1MO6A 3IVGA 1F6DA 2FSSA 4GBGA 4BRZA 1RRFA 4JWTA 3ILYA 2HHHB 5HJEA 2ANBA 2BKVA 2VXCA 2CT8A 1B6RA 3B1JA 1A5BB 4UNSA 1VI6A 3FETA 2J5KA 1F8YA 3B6EA 3MGBA 3EXEA 3QVWA 5E7IA 1JTFA 4C03A 1YRBA 1XTPA 3RFTA 1OXVA 2IH2A 3R5HA 4QGBA 3FVWA 4XDZA 1RSZA 3T38A 2GD1O 3OEWA 2RGBA 3EODA 5JAMA 2G25A 3BCUA 3L8ZA 4IDFA 4F91B 5B3LA 1HT1E 3TLAA 4C88A 2CK3D 3TLCA 4ZOLB 3OQPA 4YJHA 1IIBA 4BNTA 4N6OA 3X2SA 3ZLJA 3L4JA 5JSFA 5LQAA 2QT9A 5JO0A 2OE2A 2YUIA 1MNAA 1D1TA 5JH7A 2E48A 3QLVC 4JIGA 4NS1A 1MOSA 5TLSA 1A8PA 4QFBA 4FOTA 4MYRA 3HCPA 2PZJA 3KZOA 1G59A 2RGAA 1LV8A 1KZ4A 4MGKR 5F98A 4Q1BA 5KAPA 3ZNQA 3VR5A 2WYWA 1ESCA 4L3OA 1ZQ1A 4PZCA 3KE9A 3RTCA 4RZHA 1KA9H 4CIVA 5THXA 3PEUA 1ZH0A 3ZHUA 3MJHA 5DWDA 3GRFA 1UOEA 3ADKA 4YXWD 5LWQA 4BXOA 2AC4A 4IV0A 5K8TA 1Y1RA 2ODNA 3GFPA 4ZVRA 2W8BA 5CDFA 2ZRNA 4DV0B 1OF1A 3ZWPA 1XCMA 3EMDA 3GYBA 4CKCB 1WBBA 2DR3A 5IVHA 2I2XB 1MFPA 3H8WA 3X0DA 2OL4A 4LJ6A 4R0VA 5FBRB 1CF9A 3PEVA 1RWXA 4IRUB 3NI2A 1JBKA 2JBAB 4NR0A 4R0NA 4TSFA 5A9TA 1RZ3A 2GCOB 2CYBA 3B82A 3HXLA 4WSOA 2SKDA 3TTSA 3EIUA 3UMYA 4BNFA 2FEKA 3OJCA 3EIXA 1HLFA 2RHGB 2ZR7A 4HQKA 2DYKA 3ETNA 4MWBA 1EP2B 3BGWA 3OH8A 3P0HA 4N54A 1ORRA 3K20A 4W7SA 5F1YA 4CCAA 4D41A 3AUJB 3WS7A 5JYEA 4KQ9A 1YMVA 2AG1A 5KNBH 1HNZB 2JCSA 3ZV3A 1AKMA 4OHMA 1NBHA 1E7SA 3QU9A 4A36A 3G0HA 2FSVA 2GWHA 1BS2A 1II0A 4Q4JA 5FNVB 1SK8A 5KAMA 1US8A 4X1OA 5D51S 1NLZA 4RPHA 1CZHA 5BPHA 4B47A 1NM5C 4AMBA 3QVXA 5E8RA 4LGCA 3A9SA 1OX4B 5JATA 5DIFA 3GEPA 3IOYA 1KS2A 4R5HA 1JQJC 1JIJA 1W36C 2Y4OA 3GEHA 4JFAA 1KIFA 2HMAA 2WWGA 3IAEA 3VU9B 2VYFA 4GZLA 1DINA 3MCZA 1TM4E 1N5LA 4LDQA 1NXVA 2CDAA 3PQ8A 4GE3A 4PAQA 3F4KA 3FYUA 5EUCA 1TJ5A 4TLEA 4XPZA 2C2XA 3U7HB 2QU8A 4EATA 4HNAA 2Z8YA 5D1HA 5KIAA 4BFCA 1QRUA 4V03A 1MAUA 3LGSA 1A8HA 4RHEA 3ZI7A 3V9AA 3DEZA 2VZ0A 4KN8A 3ZD6A 3GRZA 2GJSA 4QQNA 1EFRD 4R9UC 3TQOA 3AJAA 5SYNA 1D4ZA 4C6RA 4DUPA 1SUBA 3ER6A 5CBPA 1Y9JA 4X7MA 3VR2D 2AJLI 3QVOA 2X7XA 5K6TA 3EH2A 1QG0A 2BGRA 5HFAA 1P29A 4KQCA 4ZQBA 3TW0A 4ZEVA 3EY9A 4MP3A 2GLXA 3PD7A 1EFAA 1U5BA 4ATNA 1ONBA 2AUMA 3BSSA 4QLAA 2V7WA 3HHPA 3V2UA 1NJ6A 1I14A 5TY0A 5JQGB 1M5RA 3PB3A 4YP1A 1N3IA 1CDEA 1NPTO 2C42A 1JJ7A 3BJZA 1JN0A 1L9XA 4MR9A 3Q3VA 3NEYA 4RZIA 2DR2A 3L1IA 1PGOA 1SKQA 1WUJS 2BJWA 2BKEA 4BMZA 4TTTS 3F73A 4N03A 1Z0KA 4GICA 4OGGA 2OGWA 4DQ0A 1XQWA 4UMVA 3NDPA 1V5IA 3CEHA 4HO1X 4PIMA 3ZS9A 1XTQA 3I6ZA 1KZHA 1G9XA 3I2IA 4OP1A 4JNCA 4CKZA 4JT2A 3GLTA 1RE1A 3OQ1A 2BKUA 1LZKA 3DXXA 5H8WA 1IXYA 1YK1A 1CY4A 1KJWA 4XWGA 4EABA 1PT5A 3D4PA 1G8SA 1HE8B 4G67A 1K5PA 3NNNA 2L42A 4LHWA 2DKFA 1SVIA 4C78A 4DA0A 2QSZA 1T26A 1K86A 2VA9A 1ODCA 3DL0A 2EL9A 3H18A 5JY6A 4W99A 3P9KA 3S0JA 1QH8B 2JEZA 2P62A 4H0NA 1G17A 3CH7A 4KP7A 4RO0A 4R1TA 1Q0PA 1P5FA 1MOQA 1TYAE 4FMCF 2IS1A 1T5IA 2OZLB 3H1AA 2NLOA 3PPYA 4V0NA 1I32A 4HNVA 3AWIA 1FE8A 4JA2A 1OZ0A 4G4SO 1J4AA 4F2HA 2P9JA 5KVCA 4YMLA 5EYPA 3HYLA 1E77A 5IC5A 4TWIA 3DBVO 4L8GA 4IZ6A 1GFZA 3HB9A 4OL0A 1C1DB 4YRLA 4X1YB 3WRYC 4GRAA 5H3LA 1NYQA 1VFPA 3JSXA 1GQSA 2W6JA 3A1UA 4MVJM 3WGYA 5AHKA 4TL6A 2ZYSA 3F2VA 1C9JA 1Z4KA 4V1CA 2F3PA 3AFMA 2P40A 1UXOA 5LNK1 3UPDA 4JL6A 3FCYA 1MABA 3R3HA 2ES4A 1QU2A 4ND6A 4JYPA 5SZIA 4EO9A 5JALA 1LNSA 2HMWA 2YOHA 3GOHA 4LOIA 1UBOS 4AMZA 3G9TA 4C3ZA 4H15A 1HYHA 4IFIA 4X93A 4GDFA 1A77A 5D84A 4B6OA 4Q34A 1Y9ZA 5FNZA 1ZJYA 3I30X 3K9CA 3R3YA 3OICA 2IFTA 1LBIA 4OK3A 1TOAA 1PS9A 1X15A 2QN8A 2XQJA 3Q0TA 4BTLA 1FFXB 3CMCO 1Q57A 5D01A 3ZK8A 1TJNA 4GC9A 5IN5A 4QPCA 4HQ6A 1NN1A 3HKCA 3LPLA 4XUCA 3ZR4B 1RXIA 5KOHB 1Y6FA 2JCVA 4B7ZA 1OAOC 1C30A 4BO4A 2J4FA 4P5DA 4ZZ2A 1D8TA 3WV5A 5AJZA 1TZ2A 1XE3A 4HB0A 3K9GA 3TM4A 2WUGA 2C31A 4QE3A 4CQMD 4DR2B 1DBRA 2EWMA 3L04A 2G6BA 4IDCA 3CH5A 3K35A 4PRKA 3KTAB 1XRJA 4TUYB 4XUEA 3OSUA 2Y6UA 1UC4B 3AOGA 3RWOA 2NNLD 5EVCA 1RJEA 2FN8A 3QUCA 5HK9A 2IITA 1KP2A 3E70C 1TEVA 1YRWA 4FXPA 1L4GA 4EMUA 1QHXA 2GCNA 1R4AA 1HXHA 2GT1A 4B6JA 4N7JA 1H3NA 4AECA 2CB0A 1NKTA 3GWGA 1DL5A 2F43B 1LCIA 3USCS 2FI1A 3DG9A 3IAM1 1DZ3A 2MIIA 4ALKA 4FYPA 4R3UC 1GYQA 4YAEA 1VBKA 4EYOA 1YA8A 2BSXA 4R9SA 4LGYA 4G25A 5BW5A 2ID8A 3B3GA 1UZAA 1UJ2A 1J39A 3KQWA 4PC1A 1CVLA 5CDUA 4E0BA 3HFRA 3MT9A 4HYQA 1V7QA 1J5EB 3WZMA 1C3VA 1NR1A 5SYMA 2E4XA 1RQXA 4I2VA 4BQEA 4ZK6A 5IPFA 2DUMA 3OJXA 4QWWA 3QU5A 5G02A 2FN3A 1LBHA 3W05A 1CY2A 1DJOA 1WS6A 4CM8B 3QVSA 4QU9A 4QJ3A 2OCAA 1MGPA 3MCTA 1XSEA 3NRBA 1O95C 3KPVA 4BO5A 4KXYA 4EIWA 5JBIA 3K4HA 4BJHB 1GUBA 4J90A 2WTNA 2H5LA 1H69A 1VPVA 1OGYA 2JI7A 2EFYA 3DZJA 1E79D 3BCSA 5ICCA 2CLMB 3DVSX 2IEAA 5CLGA 4F5WA 2J0UA 2I5PO 2C7VA 1JSXA 2F9FA 2GYWA 1UWLA 2QW0X 1HDYA 2REOA 1Q15A 3ZZUA 1LDEA 5L7YA 5KYXB 4YRAA 1B74A 5IJ0A 1U8FO 3A7EA 2IWHA 5CMLA 3BMNA 3TR0A 4QQFA 2FPIB 3C8UA 5AI9A 4XWAA 4Y2GA 1A9OA 2COKA 1Q74A 1VJRA 3SYMA 4NSNA 1X70A 1Z36A 5ER9A 4LZWA 4UFPA 1JPUA 5AICA 3D6NB 2FK7A 4G36A 1SK9A 3AONB 2C0QA 2C98A 2C2ZA 1MPTA 3KQTA 3PXDA 4GMFA 1BE0A 1I7PA 4IR7A 4G2NA 2FQYA 3M5DA 4JVLA 2XTZA 3PZRA 1PYDA 1JNYA 2CJYA 4J9UE 4BFLA 3HA5A 5A9SB 3L4SO 4PGGA 3IBTA 5BQOA 2I8CA 1XEXB 2YH2A 2C3OA 5I7AA 3FI9A 4TRMA 2EKBA 2G4VA 1M8JA 2OSVA 4GU5A 1OYWA 3JQPA 4AY5A 1TM1E 2XAAA 1P6QA 1FNNA 5EAIA 2VRNA 4ZAVA 2VA8A 1PUXA 2J09A 2ZRMA 2GSWA 4JT8A 5FLXA 2V03A 1GTG1 3C5CA 4R1PA 4QC2A 1KU0A 4A3SA 1NW4A 5LZ2A 1SUAA 2GXAA 2H1OA 4FGJA 1SVSA 5DI3B 5KQSA 2IRWA 1XFDA 1EWRA 5LZ8A 3ZV7A 4JX8A 4DSOA 1E2KA 3A36A 5CFMA 1W5SA 4Q5IA 3IVXA 2WFLA 1KOGA 3V8QA 2QE7A 1WB6A 3CSUA 3PUYA 4JXJA 3IALA 2OUKA 2W4QA 2W2KA 4F86A 1Z8DA 4LBZA 1QCDA 5K0GA 1I4LD 3I72A 1T29A 2HTEA 4PIPA 1KSJA 5CHEA 2R11A 3PFCA 4HL6A 4I1UA 3MGAA 1KK1A 3OAAA 2Q1UA 5I7FA 2N1BA 1GL3A 1KK3A 2MYUA 3GB9A 4RE6A 5HOEA 2V9CA 2F62A 2XR1A 1VIVA 2XMCA 3LQ4A 3O38A 3JVIA 1UOOA 3BE4A 2IYQA 1PFWA 4G26A 2PD4A 2EKQA 3MRVA 3OLWA 2CYAA 4K9SA 4RK6A 2WC1A 4LTDA 3IKMB 4PBTA 5FI3A 2PGNA 1UF9A 5DK4A 3AB3A 3D9QX 3BJIC 1YZHA 6AT1A 2YWJA 1NUQA 3N3AC 1J2YA 1O77A 2CNWD 3F74A 3PV0A 4HFNA 3V3KA 4AIIA 2ZATA 5FH9A 4C0LA 3RM3A 2J9FA 1E1LA 1QV7A 5KNCD 1W76A 3D7MA 3M4JA 4EJSB 1FDIA 4KX3A 5DX8A 3OJWA 2BEUA 4QOIA 2JGLA 4OG2A 4HDKA 3RR2A 3VVCA 4M7RA 3WMRA 3IH5A 3T9CA 4E7PA 3F78A 2CL6X 4ECEA 4DUGA 4Z7QB 2IEBA 1XUOA 2E4ZA 2QRMA 1VB5A 3I61A 5EWMA 3WO1A 1C1HA 1U7PA 3QBTA 4FDTA 4UZSA 4ZTBA 2BSQA 1N2GA 4GSKA 1KI4A 4YMUA 3TOSA 4B87A 2C9YA 1NZDA 4GRIA 1LEHA 1E61A 5BWCA 4Z4EA 1SZJG 4MVXA 4G5SA 2ZRGA 1XDZA 2QUBA 2VLBA 4RVSA 4EMSA 1VZ3A 2V8OA 5CXSA 3KHKA 4JC8A 2OZKA 4TWJA 1TK2A 4I46A 5DM4A 5HCNA 3IYLW 1SBNE 2BHRA 2GLUA 3UKOA 2E82A 5C1PA 3DBLA 1NVAA 2I4NA 3JWPA 1O5TA 4RIGA 1U5CA 1QMPA 1WZEA 4DHWA 4UJ3A 2B7LA 2PT9A 4L50A 3WRXA 5A02A 3JV7A 3GDWA 3CSDA 2PWYA 5T3YA 2C07A 4DA7A 1L7BA 3H5OA 2PT6A 2YRXA 4KDEA 3NASA 1L4LA 3WG9A 5IJZA 1YS7A 1C3OA 4DT1A 1NN5A 3M4ZA 4E33A 2FWAA 1PW5A 1R2QA 4JLBA 5LA6F 5PNTA 1YJ5A 3MAJA 1EGQA 1YU6A 3DNPA 5ALDA 1P61B 4D9IA 3A1CA 4WFJA 4HDCA 4TTAA 1W93A 4XVCA 1MQAA 2O2DA 1HDXA 5DSTA 4OL9A 1SRQA 1L5RA 2AOWA 5JSZB 4XCXA 1Y3BE 2D5BA 3GJ6A 3VKVA 3H7AA 3H2JA 4LOKA 3MFYA 4WCFA 2BUCA 4HUQA 1AGXA 1Y6QA 4JJ4A 4NJMB 4ICIA 5L6LB 4B6QA 4WESB 4AY6A 2P3OA 5A2GA 3S2UA 1U3GA 3FUVA 5F12A 3OKPA 2HHAA 5DM70 1L7RA 2DFVA 1RWOA 3M6VA 1WUTA 4US0R 3RJ9A 2IPMA 4F97A 1IM2A 3N2IA 4HD8A 2H1LA 5T41A 3ROGA 1BDHA 4JUIA 1QGOA 3E9DA 3B9BA 2DWPA 2NUPB 4IBOA 4JWKA 4IHKA 4TV8F 1Q7EA 1PT7A 1JDJA 1GUYA 4ED9A 3SYTA 3MF4A 1YRAA 3ANXA 2GK6A 4JL5A 4WXEA 2AF3C 4IFBA 4YRBA 3OF2A 5EMLA 3GMSA 2VBFA 3O75A 1PEAA 2NO7A 4GBJA 1JW9B 4RF2A 4MLPA 2R8XA 2BGKA 4RD2A 4I2NA 2HA3A 3IR5A 4QEKA 3VNAA 2AD5A 2XZLA 2QLJA 1N1GA 4FX2A 4A8JB 1G42A 4YJKA 2QQ0A 1GRQA 1ZA2A 1X1CA 3AI7A 1MJHA 4OAQA 3ANTA 4IJUA 5FFFA 1EXWA 3EARA 1EXMA 2G82A 1P7WA 1VCMA 3OFJA 1I4EB 2QX8A 2IHBA 3Q7RA 1TYBE 1OD6A 3F6BX 3G2OA 2FVXA 2FZEA 5FV4A 2W90A 4EKDA 3U7GA 3VKWA 1MRSA 4PYMA 3PUWA 1XLTC 3U26A 3HR8A 4BWYA 4BEJA 4CM1A 5J47A 2G5PA 1NW5A 4KVFA 5E9QA 2V3CC 1XK6A 5HE8A 3MAGA 2YZ7A 3DE6X 2FW1A 2RHDA 2PUGA 2A9OA 1BNCA 4FS3A 3TG2A 3QSGA 3FCUB 4AJ4A 4YUWA 2PDAA 2PWAA 1U2DA 3GEDA 1ORVA 3JYOA 4LJ5A 1C4XA 3P27A 4TWZA 4YJ3B 5FFMA 3SLGA 5IFKA 2R0QC 1ZR2A 3AUYA 3M33A 5LCXA 1HYGA 2Z5FA 2EW8A 1IJEA 2LCIA 3JD4A 1NOJA 3CZ5A 5DSXA 3VOAA 4BCCA 3MMZA 3LKZA 5MHTA 3V1TC 4TLDA 5L53A 1OIXA 2H2IA 1D09A 3GEEA 2ZRCA 3U4AA 4BNDA 3NM4A 3PKIA 2D2VA 5FL7A 2P77A 1OILA 3ZQJA 1VLQA 3OZRA 1L7PA 2DPHA 4KE6A 4ZDJA 1W7AA 1HMYA 3QIVA 3W04A 1L5YA 1IATA 1I8TA 4WE3A 2H1VA 3V8VA 1JXOA 3CNOA 4KQKA 4R83A 1MLDA 3M7IA 3LLCA 4OQ4A 1YTUA 4W4TA 1I1QB 3SNKA 1E9VA 5EXTA 3COVA 1THMA 1X3SA 5DGXA 3V1MA 2C88A 4F4HA 1V7PC 1VCOA 1N78A 4JLSA 3JYQA 3DTVB 2YYYA 1LGYA 4CLRA 1D2RA 1P7CA 5EWJA 3PHJA 2PGXA 2JKVA 2DRIA 2EZTA 3ZJ5A 5REQB 4EFMA 1C3LA 2DR0A 5ALYA 4DY4A 5KZMB 5LP6B 1MX3A 1ABFA 4L4YA 1PEKE 4UM9D 2ONYA 3UK7A 2XB9A 1DZIA 1SUPA 2AHRA 2H57A 2Q4RA 3B60A 1A9ZA 3OQJA 3WX0A 3URMA 1N4AA 4DPLA 1BCSA 1HTTA 2C00A 3DBHA 3SM3A 1PJBA 3EXEB 3DDUA 1ORDA 1ZK4A 4Q3DA 3LTNC 4FGWA 2EJTA 4KYTA 4OP3A 4AF7A 3PR1A 2R66A 2A5GA 3TQSA 4DCOA 1QOQB 4AX4A 1GA4A 1C1YA 3GVPA 2JD0A 3QYAA 4JUCA 4OV6B 4YCAA 3VTAA 2C8KA 3K92A 2C7OA 2O8FA 3TL3A 3BMOA 4YJHB 5HJ5A 2X5OA 2BR5A 1V2HE 3H9GA 2G67A 2R4UA 4MS4A 3S7ZA 2GPYA 4UFNA 1O94C 1PTJA 3U80A 1EDOA 1T4DA 5JH7B 4RJIA 4QXOA 3DHYA 4X84A 1KFCB 2VTVA 2C94A 1V11B 1XCLA 3QWHA 3Q5EA 5JG7A 2F59A 4RESA 1GTZA 3VC7A 3VZCA 4RXMA 2R87A 1CPYA 5KYWA 4TYNA 3OJ0A 3L7DA 2IZ6A 3DDNA 1PUIA 1A2QA 1VA4A 1UZLA 1WMBA 2PPVA 3KLNA 4JEUA 3GGJA 2OQ2A 3ENKA 4QOFA 3IL2A 2PVSA 5AVWA 5LQSA 2WAXA 3OTOB 5IS2A 1EEHA 4JLNA 4BXOB 1MO5A 1SVKA 1YI0A 3GELA 4ARIA 2HK7A 2VXOA 4HGNA 4OXYA 1AKYA 2W8BB 1M6VA 2ZSIA 3GA5A 1E3MA 1E1NA 3LC1O 1N2OA 3C7CB 3T4EA 1E2UA 5CYPA 4JBXA 1O5OA 4ZJPA 1SVLA 4NAUA 4KODA 5FUVA 2BYTA 2IYUA 3KKKA 4MJ3A 2XUPA 1TIKA 2Q3BA 2ORIA 4G9EA 2P68A 2VK2A 4MOWA 2CDRA 1ECBA 4FQ7A 4YRQA 3AM1A 1A7UA 1CDOA 2HJHA 2NT4A 2XUOA 3C3KA 4PZEA 5HBGA 1RYHA 4FEAA 4KWCA 3Q5GA 1X39A 1DKRA 2FRDA 1CZRA 2RJNA 4MJ7A 2X9QA 4L08A 3D3KA 1GJRA 3R5TA 4JB0A 5FBLB 1R5OA 5JWHA 4DY6A 3BTOA 2Q9CA 2OFFA 4ENPA 3ZE0B 1WDMA 4ZKDA 3ZY2A 2NXCA 2P35A 1Z6YA 2VOEA 3K2IA 2IXEA 4L1KA 3UA4A 2V7EA 3QLJA 1G2OA 3GDOA 5B1DA 4Q4JB 4RJTA 1POWA 1R10A 5CLHA 1US8B 3QX7A 3B13B 4MUXA 4UD6A 2DPYA 3TDNA 1MMFB 1NI5A 1OXKB 2FKNA 2D5IA 2DFPA 1XTSA 1PJLA 2VQDA 4X85A 3FZGA 1SOUA 1Q11A 2PSFA 1VBFA 4M0PA 4KWEA 4J0EA 5EMNA 1UKCA 2C7GA 3VPDA 3X3HA 2Z3WA 4XQGA 4KGVA 1XRLA 4QUJA 2Z1NA 4YRKA 2I7CA 1ZI6A 3ASVA 1JGTA 4MW1A 2H5JA 2OBMA 1L7EA 3QLVA 3FYUB 2BFEB 1UKVY 3OFNA 1Y9DA 4JZYA 4TKMA 3LUBA 1XZKA 4HNAB 1RM3A 2VVTA 5AKJA 3WB9A 4B0PA 3M82A 2H92A 4EF5A 3CX6A 3WSTA 2WKRA 3WIOA 4TQGA 4ZYWA 5LKAA 2JPDA 2ZBVA 3M6UA 5DM60 4P86A 4YLGA 1WEKA 4ZA2A 2YNMD 1BDMA 5CBPB 3EAFA 3UUWA 1I36A 2JIZA 2PLNA 5E7QA 5KS2A 2B4YA 3FCCA 5J43A 2H63A 4URWR 4KV7A 4LJAA 1YZGA 1T24A 3N07A 2AFHA 2C83A 1XJWA 1NP3A 1IJBA 1U5BB 4UBNA 1RM4A 2UAGA 4GH5A 1OBCA 3HUUA 4K86A 4WW0A 1PR6A 2HBZA 1SXJB 2Z08A 3KKPA 3Q15C 4J3JA 3MHTA 1SO8A 2H54A 3U4IA 3NUZA 5JO9A 3RKRA 2NU8A 5L51A 3TFQA 5DM2A 4NFSA 3HEMA 3O73A 3OZCA 4PONA 4JUFA 4MR9B 2IE0A 3GMDA 5AVRA 4L8LA 3QOWA 3UFBA 2UYYA 1W6UA 3CSSA 1HE4A 2C4UA 2VHXA 4RH0A 1O6CA 1K8RA 4CV0A 5KTNA 2WF6A 4JVSB 5F35A 3RV4A 4WOPA 2I22A 4D57A 4EWLA 1GEEA 4JXKA 3ZLVA 3MBOA 1WZ2A 2JFOA 5A6SA 2WQZA 4RL6A 2CHEA 1R0BA 3BA1A 4X54A 3K9NA 3VPGA 3DKVA 2J3JA 3ZYCA 1O7JA 1YVPA 4MV9A 3U3RA 1IBCA 1Q0ZA 1UBLS 3FLMA 1N32B 2QZZA 3OZBA 4GKBA 4ER5A 3J81k 4YRPA 3CXUA 3ZV6A 1XHFA 1NM5A 3BREA 3ZE9A 1O0BA 1JHMA 2Z1DA 3OPYI 5LP6F 3HUDA 2PSJA 2DFTA 1A50B 4R01A 4IOLA 1V71A 2DBVO 3DYIA 3KJIA 3HM9A 1P3JA 4GW3A 3RHTA 1JL3A 1NTOA 2G0NA 3LDAA 1N5OX 1PNTA 2FR0A 3C39A 3E7PA 4OP2A 1XBTA 1K6IA 2LV8A 2R6DA 3K8OE 4HZIA 5BNZA 5KNLA 2QN3A 1MVLA 4NKRA 1R3UA 3PXUA 4JQOA 2XXBA 3ORQA 3RUAA 5B4VA 4Y2SA 4BO2A 1U7XA 4DMRA 1Z63A 2TYSB 3EUWA 1GGKA 1TEXA 2FN7A 2TMKA 3C5HA 5EYPB 1HE1C 1SHUX 5DT2A 2B2XA 2OCGA 1MVNA 3AI2A 4GP7A 4LXYA 1I7NA 2HLNA 3DUFA 1UPBA 5ADUS 1EWVA 1RI2A 4ZI2A 3SXUA 1KERA 4GQIA 5DHAA 5A4MS 3M89A 3QPUA 4ZVPA 1AUPA 1NJGA 4KITB 2RK3A 2Q7OE 4V1CB 2B1RA 3GX1A 1BXRA 1P77A 2MINB 4LDZA 4LVUA 4P7KA 1K92A 1Z0UA 2R47A 3C48A 3DZDA 4HAVA 4M46A 1MABB 1Q12A 2FXVA 3UOWA 1RI1A 5CG2A 3TTTA 4YAUA 2PUCA 1Q7TA 4F72A 1Q22A 2F3TA 1QUFA 1IXSB 4RXTA 4TXLA 5KNCH 2PSEA 1NW8A 4LF7B 2NU6A 2PQ2A 5AI6A 5LJIA 5AKIA 1RJWA 2VH1A 1DC3A 1XTUA 2Z8ZA 2JI8A 4IDDA 3RI3A 5LPNA 1Y63A 3L7CA 3KEFA 5KCMA 3QBDA 5E38A 1FA9A 1KS9A 3X1MA 1OV6A 1WA5A 2Y2VA 3NYQA 4ESVA 2X0EA 1QHGA 3IXMA 3L6RA 1BHSA 2JKYA 4N40A 4NVRA 3HKCB 4OSOA 1UBRS 4IP0A 4L4RA 2EU8A 4Q9KA 3W3ZB 3RSGA 1USUA 3TMYA 5JWOA 1NT4A 1V8FA 1C30B 2PKWA 4EYEA 5JNTA 5KTPA 1DTWA 4DWOA 2DBYA 4IVRA 2R48A 2QGZA 1ZGZA 1COWD 1Y98A 2ZIWB 3L93A 3RK0A 1GFSA 3WYNA 5JJCA 1CYEA 4L28A 1IPFA 1G21B 2CUKA 1NDQA 1KSFX 2IYFA 5G4KA 3JZMA 5CYGA 2CUZA 2CNNA 3DMDA 2QP9X 2PUHA 4ZVOA 3T7DA 4PBRA 4RVOA 5AI4A 1G20A 2ZSEA 3FFTA 3R7BA 1WJGA 1AA6A 1CK4A 1EFDN 5JDIC 3RYHA 2VAVA 2ZYGA 2KLBA 2FZVA 4QLOA 1AMOA 1E9DA 3ZVMA 2RFLA 1A7AA 1PK9A 3AHDA 4C76A 3EH1A 4ZMSA 5K20A 4X61A 4DADA 4HAIA 3DBOB 1YIOA 1YB6A 2GJ8A 3QTBA 3R3ZA 2IOQA 3EOAI 4N0MA 1QNFA 3PC8C 4QUBA 4CLEA 3AILA 3ZWYA 3E3LA 3WRYA 4MVJA 1RHJA 1ZGHA 1VA5A 1HQDA 4E88A 1CVIA 2GWRA 3KJHA 2J3HA 2YW2A 1JAHA 3DHNA 4IDAA 5DNUA 2GXQA 2R97A 1ZUIA 1D04A 2Q2WA 2CXNA 3BHJA 1NBAA 1QXSA 1Q95A 1O9BA 1P72A 4JJ8A 3AXSA 2R68A 3P2YA 2WSIA 4CNQA 3ZHYA 4CUKA 2GM3A 1X9HA 1EWTA 3B48A 3ETHA 3M5CA 4JHXA 3CW9A 3DV9A 2RHCA 4H7EA 4E5SA 2WWWA 4LHXA 5EP4A 2YQZA 1SMKA 3OVMA 1OMOA 2GXSA 4KUEA 3RC1A 6GPBA 1QS0A 3VAAA 1DC4A 4BNYA 5LXTF 4PGHA 1NPYA 2DMRA 4DYVA 4ERNA 2RHWA 4KLNA 1P9RA 1OA0A 4LMAA 4JBWA 3NNDA 4TV9A 2J0UB 1P2UA 1E0JA 1VKJA 1KOJA 5ICMA 3OY7A 4INPA 3O7MA 1OAOA 2DU8A 1EJ6A 1B0UA 3DJYA 1UM8A 2Q1SA 5B58T 5IJ0B 4PLGA 4MQ4A 1ULZA 4DV6B 3BMNB 4P3YA 1DRKA 4YRZA 1AC5A 1LLUA 1PS8A 1R8XA 2Q7XA 4XDHA 1UL1X 3TVDA 3X1ZA 4J3FA 1S2LA 1EQAA 3CWQA 1LQTA 2WVAA 4DJEC 1ZH8A 3IEPA 4AZVA 2QW8A 1GCIA 1W0JA 4KO1S 4JYZA 2W2NA 2QK4A 3SWWA 1H5UA 2QRHA 3MTEA 3CIFA 3CINA 3DSRA 2HH9A 2OXIA 1K4KA 4IYJA 1T10A 2HIAA 3Q9NA 3ZDZB 4QXAA 2XTMA 3E9EA 4MTLA 4KFCA 5IAEA 2GYUA 4Q4LA 1DELA 1VOTA 3SD7A 4D4LA 2Y0CA 5K8LA 4DF3A 1QPBA 2CMFA 1I80A 2HR1A 1SOMA 2QBYA 4PNHA 3CMMA 2YFYA 4L9WA 2ZM6B 1BKSB 1JQBA 5ES3A 5TMBA 1KAOA 1SHZA 1IPHA 1KO1A 1O6BA 3I6BA 3OPXA 2P2YA 4S1NA 4QBFA 3TUIC 2VP2A 4UPEA 4FWTA 2RB4A 3PLRA 4KVGA 3GBSA 5IVIA 1LLCA 3ZHBA 1CT9A 1KGSA 1QIMA 4HNRA 1NVUQ 2EQ5A 3EWIA 5CPFA 6NULA 3TPCA 2FUG6 1M6EX 2WSSA 3H0EA 2VJAA 1SOVA 4ID3A 4NYMQ 2MSWA 4DIOA 3Q0EA 4Z1OA 2C4NA 4JV5B 2VJQA 1O95A 3L0CA 4MUKA 1NQTA 4NQZA 3L46A 4PWYA 5C2JB 2AQKA 4IEFB 3RVNA 3C45A 4Z6KA 2HRBA 1I7QB 2UXCB 1SCJA 4QWMA 1ZIPA 2V1XA 5LQNA 2IS2A 2F67A 4LF5B 2OYRA 4YDQA 4D9BA 3NTQA 1UKBA 3EVCA 1UMCA 2ATIA 3LFTA 5EXEA 4E5NA 4ZHQF 4N76A 1BN6A 2J5RA 3PFNA 5HXAA 5BR1A 2PV7A 1PDOA 1SQ6A 1UJMA 3K0BA 3R3UA 3Q3IA 3UJ3X 5FRDA 1Z4JA 3KSAC 3NHUA 2C2YA 4CR6A 2WP8J 2DETA 1E20A 5AVZA 1TM2A 1T4GA 2WKQA 5TRTA 2O8NA 2ZB8A 3ORHA 2C8LA 3FSEA 4HWOA 2DHDA 1SCQA 1TA0A 2IUYA 2SBTA 1TLLA 3KO8A 1PWYE 2C61A 2LDBA 4DCMA 1RRCA 5T5QA 5EIBC 3CN7A 2KQUA 3NTLA 1YL5A 4CIBA 2J9FB 3L05A 2P5TB 821PA 1OHHD 1ONPA 3R75A 5IULC 1I9GA 2I4RA 3NKVA 4JCCA 4M7WA 1P7VA 2BEUB 4CMBA 1CF4A 2D0PB 2XYPA 3AETA 1ZN7A 2GKGA 1JLLA 2CJWB 4HDKB 1OOEA 1MVOA 3CEPB 4KMOA 4C2AA 5L4SA 2ASEA 2Q6TA 3A2MA 1I6MA 3FTQA 3VZDA 1RLIA 3JRNA