2Z5VA

Solution structure of the tir domain of human myd88
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
141
structure length
141
Chain Sequence
HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Myeloid differentiation primary response protein MyD88
total genus 23
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 2z5vA01
5FORA 3H16A 4LQCA 4OM7A 2M1XA 1T3GA 4C6TA 4LQDA 2Z5VA 1FYWA 5H3CA 3UB3A 4C6TB 4W8GA 3UB4A 4EO7A 3UB2A 1O77A 4C6RA 2Y92A 1FYVA 4DOMA 4FZ5A 2JS7A 2J67A 5KU7A 4C6SA 3OZIA 3JRNA 1FYXA 4W8HA 4LZPA 4C7MA
chains in the Genus database with same CATH superfamily
1XZHA 3HGQA 4MPDA 4N54A 4FXOA 2QT1A 4IGAA 1IAQA 3A6KA 3RJ5A 1ZM4A 4EW2A 1NXXA 3OJLA 1HFEL 2AL7A 3UH0A 3L40A 2YY6A 5C4IA 4D4JA 4QD3A 3HZHA 4YCSA 5K0NA 2ZAMA 4KPEC 4S04A 4PPQA 1XMXA 1XTBA 2Q5EA 2CVPA 3RRYA 3T0IA 1GPJA 4K1LA 1KSHA 3JQEA 4L9SA 3ED5A 4HGYA 1LGYA 3DE2X 4KODA 4MJXA 4E15A 2WD8A 1JLLB 1T36A 4XGRA 2QZ4A 5EQDA 3RRXA 3H11A 3DCYA 3CW8X 2HI0A 5DE3A 4C30A 2ZIXB 3SKVA 4JP8A 1J39A 2Y67A 3G9UA 2ISCA 1WL8A 1VJ5A 2OAP1 3OOYA 4D43A 4BNIA 3SOZA 1VLZA 2PT9A 2LVBA 5H3LA 4NOJA 1WW2A 4YROA 1I2BA 2DFPA 3LYAA 4Q7LA 2M32A 4I7EA 2HDWA 4N0QA 3DC7A 4MVJM 2CDNA 2XYQA 1QO0A 3L41A 3P9IA 1KR5A 1ZK3A 4U7HA 4IIEA 1VE3A 1KAMA 1VB3A 3SJUA 4BLVA 2A14A 3B8HA 2DUMA 3JD2A 5AUNB 1DP4A 3JD3A 3QP9A 5EJ5A 2EW1A 4X3OA 5JJCA 2FFBA 2OCIA 3O95A 4KYVA 1TMOA 4MRMB 2O6LA 1PJSA 3VZPA 4FZVA 3SSAA 3ESXA 1TZ2A 2QAJA 4AJ4A 4M9SA 1IXSB 1JJBA 1FS4A 2KLBA 3RF6A 3UENA 2ET6A 1U8ZA 3FDZA 3L4BC 4UU1A 4P80A 1SWWA 1WPXA 3FGNA 2FPSA 4JQCA 2X0FA 4QPDA 2VTKA 5IANA 5K0JA 3HSKA 5BPFA 4CGYA 3NCTA 2HLHA 1W34A 2Z8YM 4L4SA 2NV0A 3Q15C 4HS4A 4OBEA 5AVQA 4KDEA 4F9FA 2GEFA 3OO1A 3IP1A 4RSMA 1PG5A 1I9CA 1ZP6A 4GD3Q 3NONA 2WV7A 4UNNA 4W5TA 5M5BA 3S2IA 3ZQ6A 3JQ6A 3I4CA 4YJHA 4S2UA 2FRDC 1EFRD 2NWQA 3M9WA 3EAGA 3I6YA 2ZPUA 4MUHA 1SKQA 3LA6A 5EEHA 3VO9A 2SKCA 2PT7A 3FMIA 5CGQB 5CB4B 1QU3A 3GD5A 1A88A 3C6BA 4M7WA 2YC4C 3PA8A 4LMBA 1VLHA 4PYMA 2I99A 2QTZA 2Z2ZA 3ZHQA 2FWPA 3KB6A 3EEOA 2WSMA 1XFAA 4Y9SA 1PFWA 2FRVA 5FFFA 2VLIA 1K5GA 4L9RA 3A2LA 2XH8A 3CLTC 1T6XA 2I78A 4L1KA 4RPLA 2XUOA 3CG4A 5E1OA 5LC1A 3UAZA 1WXIA 3QU2A 1P7VA 3CN9A 3AIIA 3LOUA 3W2EA 5HGXA 1QP0A 3DMYA 2ES4A 5FHRA 2F8TA 5I8ZA 3T52A 2VJQA 2WKSA 1AX9A 3N2YA 4O8ZA 2Q29A 1T0UA 4US1R 3HUDA 4NDAA 3NMUF 2NTJA 1XZKA 3RM3A 1DAOA 3PA6A 4RLHA 3WMXA 4DCTA 2V5AA 2PO5A 3V3TA 4DR3B 1QG4A 3AI1A 2V98A 3UFXA 5ALZA 3G0OA 3FKSD 2GBLA 3V7FA 2O5CA 3WGZA 5CXQA 3IYLW 2IHJA 5DHQA 5LOVB 3M2PA 3L4KA 3LJKA 3NO4A 1A5TA 2QJWA 3C6QA 3GR6A 2P40A 4EY5A 4KUEA 3GPCA 3KAKA 4BMNA 2OD7A 1KP3A 1ATIA 1N9GA 1K4YA 1TM5E 3P9XA 3Q10A 1HNWB 4EBFA 2L19A 5AMXA 3FTCA 4DTCA 1YQDA 2WYOA 1NQWA 3MRTA 5EP4A 1P17A 4MQMA 4UOQA 3OOSA 3U4QA 1HZZA 2QT9A 3NC0C 1JFVA 2REQA 1FFYA 5KNDH 1P4SA 3ONFA 1D8TA 3MCUA 4BEVA 1INLA 4Q3OA 1E7YA 3HP4A 1T5HX 4DHWA 4F5ZA 1YA4A 2AMFA 3DZHA 2OVFA 1XU7A 3OC0A 5KYVA 1JEJA 4WL0A 1KP2A 1PR2A 4KYUA 1HNNA 1A7AA 4MVJD 2G88A 1V0JA 3O92A 4JDUA 4RM3A 4KREA 2H8KA 1V47A 3DEYX 3SY8A 1UBUS 4ITUA 3ZDRA 2I4NA 3BSSA 1CB7A 1Z6PA 3GOQA 3WB1A 4KQMA 3WO1A 4AN0A 1XAHA 1E69A 1FF9A 1P1JA 3MLBA 3RR2A 1FZTA 1MTOA 3VZCA 4CHTA 2H2DA 3C6ZA 1R0CA 3CVOA 3I4FA 5CJ2A 1JI3A 3F4KA 2DGDA 3COSA 2E2WA 1SK8A 1GFSA 1SD5A 1BNCA 2I29A 4OLFA 1Y5MA 1QKIA 3IQDB 3RGGA 5LNK1 2WMNB 4XEHA 2DBVO 3UT6A 1UJMA 1SUFA 4NCKA 1WJGA 1ZH0A 2H2AA 1W29A 4IS3A 4O2BB 4EYGA 5AVVA 3QKRB 4IHJB 4LTMA 4EJSC 2BJHA 2GPJA 3K8ZA 3ONDA 2XD9A 1DV1A 3OCCA 1BE1A 1HO3A 4I2NA 2OFOA 3GT7A 2X2PA 4UBKA 1NPTO 5F7OA 4ZALA 4CFSA 3OTGA 5AO9A 2WYUA 1L6RA 1LW6E 4IDFA 3T1VA 4ZDIA 4WNAB 2PQ6A 2C4NA 2WUEA 5BQOA 4CL2A 2O14A 3JPWA 1MOQA 4TSFA 2LZ0A 4RFLA 4NZ9A 3EDQA 3HA3A 3KKOA 3U7RA 1MPXA 3L8MA 4F3TA 4CI9A 2XUDA 1PNTA 1ISGA 4BB5A 4DUYB 1Y8RB 3V46A 4C4SA 1EUDB 2HA6A 3NOXA 1ZVJA 4Y2TA 3WWCA 2FE1A 1D5WA 3FYCA 2BFNA 2GN2A 5ALEA 3IL2A 5GONB 2PH7A 1PU2A 3PG5A 1Q6YA 5KCMA 1OT5A 2YJ3A 2JLXA 2DUWA 1O9GA 4AJEA 4CKZA 4A0FA 5CIYA 2WU8A 3WLAA 2BGJA 2ZROA 2E1PA 4B31A 5HF6A 2GXAA 3NRCA 4BJ1A 3OECA 2WZCA 3E6AA 2CJWA 5HYVA 4Y3UA 3EH1A 3AY7A 2J3KA 2P77A 1YJQA 2P9BA 3EQ2A 3N7TA 4JJGA 4TWBA 1G21E 4KXYA 5IJ9B 2OL4A 2PGOA 5IUJC 4H3SA 2AD5A 3FBTA 4V1CB 4K6CA 1VBFA 3JV7A 2JKZA 2B5VA 3CX8A 2HPHA 5FUVA 1NRWA 4YRCA 1KC1A 1TUEA 2ZSJA 2EZ4A 1G2IA 2J09A 1KWKA 2B0CA 2PH5A 2QRHA 4DADA 1KOJA 1TQDA 1XD2A 3DZGA 2IPMA 4EF5A 4LFBB 2IYAA 2C95A 2WHQA 4HATA 5F77A 4BB6A 2WVAA 4JS0A 4KGXA 2UYOA 3ZD6A 3JQFA 4G23A 2ZBUA 2QK4A 1R4NA 4WVFA 1FUYB 3R0VA 3R40A 3NLLA 1KH1A 1XTTA 1YZNA 2Q8QA 3CZQA 3ICPA 1WU8A 3IUEA 4G1BA 4S1OA 2Y2UA 3WB0A 4BE7B 1A1VA 3H1TA 4LC0A 4X41A 5HE9A 3Q7TA 2CXNA 2BMDA 2GOYA 3M1AA 3B3FA 1JJAA 3M82A 1J0CA 1G3IA 3VR5H 3NASA 1V3TA 3IEMA 2P30A 2Q6LA 4JQYA 3KETA 4IJ5A 2Z08A 3TXXA 5JMTA 1X1SA 2J4CA 3PNOA 1OA1A 3HUEA 5D5HA 2CSXA 3U7IA 1ULSA 2BTOA 3GDHA 2P35A 2X14A 2G5CA 1TPZA 1U2ZA 3BEDA 3HXLA 5ALXA 4E2YA 4UXHA 4KDFA 2FRDA 2IJGX 2IITA 3G2HA 1SVOA 2EL9A 1JKXA 4QFDA 1QRDA 4RD3A 1K2VN 4ER5A 2WK1A 4BVHA 2O8DA 1M6WA 1YUNA 3N9IA 2F64A 3PFNA 3PCRB 2B99A 4Q7QA 1QZUA 1OY1A 1UWVA 1P2VA 4QRHA 2ILTA 2WZDA 4F3RA 5AW3A 2AXQA 2PL3A 1M7BA 2F4NA 4PQRA 1JXQA 3DTVB 2OQVA 5KYKA 1R8QA 2X9LA 3FVWA 1GD1O 2GZSA 4M1EA 4Q7JB 3C5CA 2H1FA 4HZIA 5EZYB 2PLWA 1F8YA 1Z74A 4JU8A 4OXNA 1R88A 5FAXA 3U60B 3D4NA 4AMZA 4XIJA 1OXSC 1Y37A 1BS2A 4C87A 4DNQA 4RPCA 3EBPA 4KLRA 5SZHB 5EMKA 1IN4A 5CA1B 3N2NA 4PC3A 1MRZA 4W8OA 3BC1A 4MHSA 7REQA 4JFAA 1OAKA 3WMWA 2G82A 3FPCA 2J6HA 1TXGA 2QTWB 1BA2A 2QKYA 2ZTMA 1DO0A 4TVOA 1RVV1 2G40A 5PGMA 4QQNA 3GLTA 4ZRNA 1U7XA 1PVDA 3TE6A 2Q0HA 1C8BA 4EL5A 3T1TA 5T5QA 2XMDA 4ED9A 4BGDA 1TYDE 3DOJA 2XUZA 3R24A 2GEJA 4N3GA 4ZMSA 2VP2A 1KORA 2NP6A 3VKWA 4Y2JA 3UUWA 4ENQA 1GGKA 3RFCA 3KUUA 4ZHQF 2D3TA 4KLNA 4V1CI 1VKZA 5MGBA 2II6A 2QRGA 2XY4A 2ADMA 3AR6A 6PFKA 1OAOA 1GRVA 1EFHA 2QTNA 3ZV6A 4EKNB 3AESA 3JQAA 2ARKA 2CXSA 1WCWA 2D7DA 3Q0TA 1DIRA 1DVRA 4KGZA 3P2KA 1CY6A 4BFWA 2PL9A 2PBLA 4KJZA 4TTSA 3ETNA 3C8MA 3HABA 3LWZA 2GVDC 4OXIA 3WHPA 5HIKA 5AM2A 3OQ6A 1YRHA 4KXFB 1EFPB 2R2GA 4H7IA 3MQFA 4YP7A 3UT5B 1PSDA 2HCRA 2OCGA 2ZWPA 3LZ6A 4B3XA 1J56A 1YMQA 1JDNA 2EZ8A 2PYIA 3AETA 3KT0A 4HDSB 4RMNA 2HRQA 3EMBA 3IOMA 4ERNA 1T6ZA 4B4UA 3J81k 2DOKA 1MG0A 3FFAA 3D4IA 4YO8A 1ZINA 3AF1A 4RCZA 4LWPA 4RPHA 2C9CA 4Y0NA 3H2SA 4MCJA 4PG5A 3FIJA 2JD1A 2FPPA 4BECA 2QSUA 3KQHA 1KJ9A 1XZNA 4PCLA 2G07A 3HBFA 1ADFA 2AQIA 2O1EA 4NDZA 5IYZA 4RAOA 4BLQA 2DFLA 3F0TA 2W90A 5FBLB 1WZ2A 3DE0X 4HVAA 1WP9A 1J1UA 5DTRA 3ZX5A 5I9NA 5E6SA 2R6R1 1UZMA 1D4FA 2CLHB 2Q3MA 4KMRA 2OV8A 2O48X 2N9UA 4XQCA 2CYCA 3WI7A 2JFNA 1XV5A 3AEUB 2D1YA 4OATA 4C05A 1NVBA 2GZRA 2JLAA 3CUWA 5BUZA 4CI0B 4K9PA 4DKJA 4XTRA 3CNQS 3JRNA 3F9CA 1D6JA 1F7VA 4F4JA 4H0CA 4IL5A 1QIJA 2R8XA 4JOCA 2FN3A 5ALUA 4E33A 2PANA 4NPCA 5FQOA 1Q0PA 1Z33A 2GPYA 3GUUA 3T3PB 4ZOQI 1CY8A 1OLXB 3G7SA 3PX3A 1WO8A 3A1CA 3KPYA 3QBVA 3UXEA 3RKRA 1RYMA 3WWEA 4X5OA 4KO8A 3KKMA 3Q3EA 1W47A 3PRHA 2XB2A 2WJVA 2Q6KA 3L4BA 1WUIS 1VHJA 2VIIA 5T57A 5EKDA 3WHIA 1RC8A 3O84A 4H59A 2G04A 3V8NA 4D98A 3K70B 4HC4A 2IY8A 2BEWA 4QJ5A 2ZUUA 2D59A 1T34A 5DWDA 1DKLA 1USVA 4R68A 4A16A 1YJAA 3P0JA 1JVSA 4EKEA 3NANA 4PBSA 1NPYA 2FE4A 2WTNA 3HI6A 4KZKA 4OYLA 1LV7A 4UULA 1I32A 5K4GA 5F1PA 1HLFA 2BDUA 3BJRA 4TLBA 2J9FA 3MK31 3PNKA 3UWSA 3ANTA 4RKRA 3F3YA 2OXIA 3WZ2A 4DCJA 2JLZA 1U31A 1KZGB 3KAQA 1FNNA 1M2OB 2F67A 3FOAA 4C6TA 1CXZA 1MAWA 3PE4A 2WJ6A 2XMPA 1BDBA 1SVWA 1XAGA 3DZKA 4MZDA 4UM5A 1LNQA 1IEQA 4N5MA 4J1QA 1T5LA 3EZ9A 3WRWA 5IAOA 2ZBPA 3ASVA 3B48A 5A05A 2PY6A 3ZQUA 3T8YA 4AN4A 4WHMA 2VDWA 4RTMA 4JL5A 3H3XA 5KPJA 3I0NA 4GX1A 3NIBA 4P8RA 5CLJA 2IYRA 1TYCA 3FYHA 2FX2A 1OYWA 3V1YA 2V7GA 3GBVA 4EKGA 1S4QA 3MCAA 2F1HA 2CHGA 5BURA 4FFLA 5JXWA 3CXUA 5BN5B 4E0BA 5LZ2A 1CJMA 2KQUA 5CFLA 5FEUA 2BV3A 1QSGA 3I28A 4GLOA 5EKSA 4ZJPA 4NMXB 2WDZA 3KEOA 3R3VA 1JYEA 2CLOB 2W6JD 5DBEX 4K0RA 4QXRA 2R6HA 4FLMA 5COQA 2GD0A 2QROA 1SD2A 2Y68A 1T8TA 1D6NA 4FNGA 4TMXA 2CXXA 5T64A 3JPYA 1D9XA 4EJ0A 3SD7A 2VP4A 3DTVA 4G89A 3EHEA 1C4XA 3VPHA 4RHUA 3ET4A 1QX3A 3P19A 1QDEA 1SY7A 5LZ5A 3BF8A 2OYCA 2BCGY 3CO0S 1ULTA 2YZNA 4DR4B 5L95A 1YVRA 3IMFA 4JC0A 1WOMA 2VI5A 4M3NA 2B20A 4K7JA 1NSFA 2HK9A 4GC9A 4OI4A 3WTBA 4JI2B 3V1LA 1W4BA 3QEJA 5A71A 3QE9Y 5L8VA 3AHJA 4B76A 4FOLA 1Y98A 2AB0A 1QG2A 1GKUB 3FJOA 3K72B 1DXYA 5DP2A 8AT1A 4S1WA 1M2FA 1V3QE 4ZDWA 3H18A 3SZMA 4TMVA 4YV0A 1UJCA 1GPBA 2OO3A 4PLHA 1U8FO 1TKCA 2PSEA 4GVLA 2ZWIA 3HKCB 4KUHA 3GLGB 2R6ZA 1UPXA 5IZCC 2X1HA 2ZYGA 1K86A 1VSUA 2C2OA 1UBHS 3DR5A 3N70A 3TB6A 3V3KA 1UP6A 2Q6VA 1IY0A 2VOEA 2ZAGA 5I5EA 2C58A 3H9BA 2XQGA 4ML3A 2PQMA 3FHJA 1W59A 2NX2A 5FFNA 1YZLA 1GQSA 3DUFA 3ZOZA 4E2WA 1A50B 1DX6A 1L5VA 3NOQA 1U8CB 4FN4A 2WD9A 4RMIA 2W42A 2BTQB 1XU9A 3HJNA 3P4XA 4I50A 4L3WA 4QUJA 1DU4A 1XZQA 3R75A 4Z4EA 1JYSA 3AEXA 5ILQA 1MVOA 1BEUB 3QI2A 4PCAA 4ZQEA 4UDNA 1DGQA 2RG1A 4RHYA 3V7WA 3MHTA 4N76A 1SZCA 1E3JA 1B2LA 3C3PA 4RTKA 3KYBA 1GPYA 2DERA 5DJ5A 4HLCA 4AZ0B 4RZ3A 2P0AA 2P4HX 3HJHA 5K0FA 2QHXA 1BTOA 4BXOB 2WSSA 1NVWQ 3PPWA 4B7ZA 1PUIA 5KNDA 4M0DA 3U4MA 3T5PA 2WSBA 3JQRA 1Z45A 3HYSA 3V8VA 1M2EA 2CNWD 3P94A 3RLIA 4L22A 4HAYA 4YUZA 2OXCA 3SHWA 2IYVA 2APJA 3OZTA 4LRQA 3L7MA 3ABIA 4NVRA 2CL6X 2IH2A 4WLFA 3EXHC 3CX7A 4ACAA 1C29B 3EODA 3GRKA 3GA0A 1GQOA 3PUIA 1Y9AA 1GNLA 1GUYA 1VYVA 4BCCA 2C78A 2OGSA 3UGJA 3H5VA 4B3TB 4GX0A 1U2SA 1M2WA 1LW7A 1M6VA 3M6AA 4E09A 2Y66A 4YMVA 2ZBDA 5GVSA 3G9ZA 1QP4A 2JBWA 4YJGA 2EL7A 2V96A 1CIPA 3GGSA 3HNPA 4EUKA 6REQB 2O5EA 3BXHA 5L3SB 3DKVA 2WWWA 5EKXA 1V7ZA 1PK8A 1PQ4A 1UAGA 4ZZIA 1DSSG 2O2EA 4KR2A 2GSWA 4GKJB 3Q7EA 4OXRA 4MHTA 3R8XA 5LUBA 3PXGA 5A4JA 1RYFA 3BGDA 3NC1C 4LOLA 1LBIA 3WK6A 2PD6A 4P84A 1AKQA 3DWGA 3JARA 1Y8RA 2FPGB 3T41A 4Q19A 3G0IA 4PS0A 3IDQA 3L7CA 1GG9A 2EX1A 2OQIA 5J5CA 4X8MA 2G63A 4F92B 1Z7EA 1QQ6A 3BFXA 4TZ0A 3KSUA 1ECGA 2G67A 2OBXA 1U3VA 4CLXA 2OFPA 5B2FA 2I91A 1B1CA 4R2IA 1FUEA 2GHRA 2R44A 4YK7A 3G82C 2XIJA 1DWOA 2LRHA 2TRSB 1Q0SA 1RZUA 3OO0A 4P83A 1E2MA 2I8AA 3BFKA 4HFJA 4X1YA 5BNFA 2NVWA 1EU1A 1JDBB 4MIEA 4DA4A 1TK2A 1CFJA 1GNSA 3RRFA 3SHQA 4YB8A 1J9ZA 1H2HA 4QYSA 2G4LA 1P81A 1IWOA 4JXXA 3A3PA 4HQFA 3EIEA 4Z53A 3PWKA 4X3CA 1UAYA 4EHIA 4UUBA 4YJ2B 3V6LA 3L43A 4IVNA 2DC1A 4LISA 4IKPA 4LJ9A 3UQYS 5FWXB 5LDHA 5JYBA 1CS4C 4LJAA 5EZSA 3CCCA 5JD3A 2QYTA 3OUZA 5KVQA 3SC2A 3VX3A 1L4UA 1OC2A 1J7JA 1V39A 5HS6A 1GGVA 1H2WA 1QNFA 3MJVA 3NP9A 4K6GA 4LYFA 2CFSA 4PGAA 3IA7A 5A6SB 1KJQA 4BMSA 3F6YA 4URVR 3AK4A 3TQQA 5BVHB 5BWMA 3ACDA 2DX7A 3WP1B 2W2KB 3PRKE 5JTTA 1PFGA 5EIOA 1E99A 1L9KA 1WUJS 3NBFA 5DBHX 1DDOA 2CSUA 5IH3A 2WU4A 3QE2A 4L5IA 1KDYA 1P5FA 2NQ2C 1CZOA 5KVAA 1T9BA 4B40A 3TDNA 3AXSA 1YD7A 3LIPA 3T1HB 2BGKA 1ZNYA 2JDID 3BH7A 4WD3A 5LSAA 3U16A 3CG0A 4WZAA 4YJFB 3R8FA 1T24A 3MMNA 4POAA 1EHCA 3W90A 1QBGA 2FWMX 4FDTA 4ZDJA 4CM9D 3CONA 4D0NA 5SY9A 2X8WA 3PQ7A 4CJXA 4OX9Y 4TZ6A 1ACLA 1IY1A 2OUIA 2W6CX 3K1AB 3OD5A 1IQRA 2H07A 5MHTA 3LI2A 2ZPTX 3O03A 1TU3A 4Y0AA 5D1NA 1C30B 2FG6C 5DU2A 2CMFA 2AIRA 4RO0A 1DAHA 1L5MA 5L7YA 1T5BA 4OB7A 4EARA 1QV6A 1L5KA 3K0BA 1GXSB 2UV8A 3V55A 2QUAA 4IG9A 5DI9A 5AOCA 4AW9A 1YFJA 1W75A 1Z5PA 4ZYZA 1JPUA 5FI3A 3CMMA 5KYXA 4RTNA 3O91A 5ALHA 3W77A 2X8JA 3EGWA 3JX9A 3E84A 5MDHA 3D3WA 4KJXA 4NBUA 4ZVSA 4KC0A 4FGKA 4UXIA 5HMLA 1EIWA 2PV7A 4FFVA 3V2GA 5K4HA 2A8YA 5ICFA 3ROQA 5CR9A 2IVFA 3C16C 4RK1A 3RUEA 1DDGA 1EFCA 2ZUDA 3KOXA 2Z2YA 1A2KC 2YJGA 1THGA 4MR8A 8ABPA 4M7RA 5KVVA 4AVYA 1D4AA 1PFUA 3ONWA 2XXJA 1VIAA 4C06A 4JVNA 2A0UA 4M54A 5AI6A 1R64A 4I4TA 5BRAA 4ZA2A 3TRFA 5JQGB 2BZ0A 1KNQA 2JBAB 1HY3A 1WEKA 2HSJA 3LKZA 2A4MA 3P9QA 4GYKA 4DM4A 5EOVA 4N41A 2BGWA 4F3CA 5D01A 4AY3A 3DEKA 2XGJA 2WWYA 5HGJA 4HX9A 1BXRB 2R1ZA 3RV4A 1O5IA 4Y1FA 4FT4A 1CLEA 5ES3A 4I5EA 1VG0B 1YS1X 1G2PA 1UFRA 3I61A 1ETHA 1EP2B 1NBMA 3KZ1E 4RTLA 1NFRA 4CU2A 1B0AA 1ZG3A 1DDIA 3OQIB 2ODPA 2Q07A 2DKOA 4P3XA 5DV9A 3UB3A 1PD0A 1P0IA 4WNYA 3ZKWB 3N1UA 1N6HA 5JATA 3U7FB 1WXEA 2RCYA 1XNJA 3GJSA 2QYHA 5IKEA 3OG9A 2E9SA 5DW0A 1SKUA 5AW8A 1JHPA 3NH6A 1KFJB 3GJ6A 3O83A 1KP9A 5AJZA 4L4ZA 2IUSA 1E4EB 3UAXA 1L7EA 1WQ4A 4GGMX 1A7KA 3FDZB 1G17A 1M8KA 4Z6KA 5JXGA 1J99A 2BRUC 2DUUA 2YV2A 2QG4A 3TWOA 2WF6A 5E8JA 3VVBA 4CN8A 2GNPA 4CKCB 4ENSA 4FU0A 4Q4DA 1JHRA 4UHJA 1UBGA 4DLUA 4P2BA 2NXNA 4F1JA 1CNEA 1R12A 1N2IA 4QWMA 5CX1A 3VAAA 2HIMA 4J2OA 3GT0A 4FC7A 4PRKA 4DC0A 1TIKA 2IZ0A 3ZV7A 2QMUA 2FLKA 4CEJA 4E5MA 2I65A 2ZJBA 2N0SA 4WXEA 2JASA 2NPOA 4EO9A 2B8JA 3LO8A 1WF6A 4HP8A 1PV2A 1KJNA 3QYAA 3FZNA 4A8JA 3CPHA 2HQOA 1W6RA 3C3BA 1Z0FA 3ZHCA 3FJ1A 5FD8A 3FPKA 3BWXA 5BORA 2XUKA 1IHOA 1RAGA 3E9YA 4LOAA 4QGSA 2HF7A 4LZAA 4DDMA 5KTSA 4OFWA 2PMWB 2FPGA 2XUIA 2XT6A 4GR9A 3BMCA 3JALB 3W5JA 1MA0A 4OLHA 2G1JA 3JZFA 4OHFA 2BKEA 1ZR2A 1XTUA 4G1EB 4FYHA 2ZJAA 3GNQA 1P29A 1THTA 4O4JA 3LSTA 3LHDA 1O6ZA 5JAUA 5HJ5A 4EX7A 3CH4B 4DDTA 3D2LA 1UUFA 1NKVA 2GJ8A 2VNHA 3B1ZA 4D0GA 1H0KA 4H3KB 3SJBA 1NLYA 3W9YA 4DMKA 1BC5A 3K05A 1HXHA 1RXSA 2VDRB 3PUJA 3T4EA 3CX3A 2PUBA 1HC7A 1EJ2A 1GTMA 1R1DA 1JIJA 1WRBA 2GFHA 3AB3A 3MRSA 4LXYA 3X3HA 4HRAA 3U62A 3RCBA 1EWVA 3FBWA 4PTYA 2JA1A 3IQFA 5K09A 2AC2A 2NO1A 1TAHA 2VSOA 5MN4A 1COWA 4RJTA 4HDMB 2XKJE 2XRMA 5JJIA 2Y0DA 1YH3A 1BE0A 3IBTA 1HOXA 4K40A 1ESNA 4RV5A 1Y4AE 4U7GA 4FHFA 2CY0A 4UVEA 5HKKD 3R0JA 4LBVA 1DKQA 3EF3A 2RGNA 3HYLA 4DG5A 4EJSA 1H6DA 5KEIA 4G97A 1DIOB 1O94A 3DPIA 4JEMA 2OESA 4RZUA 5AQ1A 2EGUA 1LC3A 3WIDA 3TEJA 1MC8A 4MKIA 1PV1A 2AR0A 1B1AA 4ON9A 4DLWA 1YOBA 2XE7A 1NF9A 4X66B 2DXIA 1JGTA 4AM8A 1Z5VA 2YNMA 3HU3A 1I5RA 3ON5A 4K87A 1J0AA 3D2AA 2BFBB 3TBKA 4DSAA 1KI1A 2AMVA 3FHTA 4U5XA 3LXRA 4TZTA 1HH4A 3QMPA 3LCCA 3B2EA 1K9VF 4JHXA 3UG7A 1J5XA 3K4QA 3L01A 3W5HA 3HEAA 2ONCA 3EGXA 1BWRA 1FU4A 2EW2A 2JD0A 1I1QB 4CBVA 5AVZA 5TJHA 1OV6A 4H7PA 3FSEA 2FI1A 3K30A 1YHZA 5HF9A 3U4CA 4BLWA 2H06A 2OV1A 4Q00A 1P39A 2JJ2A 3FAZA 4MINA 3TIIA 4GPBA 1CUWA 3RHZA 3ZCVA 4BMDA 5FUQA 5F3WB 2Y1GA 1I0ZA 2JRCA 3KXKA 3LDAA 3PQ3A 3R0ZA 1YKFA 3GY0A 3NUZA 4XX1A 5ALKA 3O2QB 4RY2A 2PUTA 1BD4A 4FFNA 1PDOA 4GBED 3JQ9C 4QG3A 1N0WA 2ERXA 2ODTX 1GQQA 3GEPA 2JJ2D 2W2NA 4KYIB 4AICA 2Q8NA 3E48A 1REQA 1OFUX 2VXBA 4R1SA 1DRKA 1HEUA 5JCJD 4B74A 3STHA 1U1EA 5FAKA 3TD9A 3OHPA 1ULZA 3L1IA 1Q22A 5EJMA 1G291 3F9RA 3JRWA 3NC4A 4GMXA 5HRAA 4M8KA 4QHYA 4M1YA 3O8CA 3O21A 3GPLA 1GP2A 2O1SA 2X19A 3P9ZA 3SBEA 3WFZA 1R9NA 3ZWVA 1N6RA 1BEZA 1ZW6A 5EWMA 2Y2VA 4IXMA 2XB4A 1G8AA 3BGIA 3GUHA 1EZZA 4K8RB 5T6MA 1OD6A 1KJIA 3WKEA 1J9EA 3C4QA 1G2QA 5CDGA 5G1OA 3N39C 4CDNA 1PZXA 2P9FA 2IRWA 1F6WA 2RGAA 4FEGA 3ODGA 2H4ZA 3GZJA 3TTWA 1VLLA 2L42A 1QFSA 2HZ7A 3EIOA 4UUMA 2JHCA 4DQVA 4HNGA 1B4DA 1W581 3FRIA 2X0RA 5FORA 4Y1GA 1FXWF 1Z25A 1LX6A 1PFKA 3AI7A 3MTDA 1JTEA 3QX3A 4N6NA 4BLOA 1SQ6A 3OM0A 4PN3A 3FPEA 3T35A 5DT9A 4AY2A 4FOOA 1KFCB 4QSHA 4C43A 4DY4A 3RVPA 2QMQA 1ZA2A 4Q9DA 4K9MA 2W48A 3NUQA 3QVSA 3TGWA 1XSEA 4LZWA 1Z73A 4FMPA 4MYDA 4YEDA 1U0BB 1NAHA 5C35A 1QYIA 1SHUX 4G5RA 5IKPA 2RCNA 2PA3A 1GPLA 3VKGA 1BX0A 1E4EA 2FN7A 4AYTA 2P6NA 2HBRA 3CHYA 5AIAA 4AWXA 8LDHA 3IPLA 4BQQA 1ZCZA 2HH9A 2YMLA 5KJEA 1GYRA 2VEDA 4A91A 3ZR4B 1UKZA 3D3NA 5EVJA 1NBIA 4DA0A 1NURA 4XARA 1AKEA 4CG3A 4KAJA 2XBLA 2RAFA 3LHFA 2ATEA 3IQIX 3TW8B 5KWSA 4JBHA 3VXKA 4UU7A 3RVRA 1RXWA 2UXCB 1X13A 4IIDA 4D0RA 1E2BA 1GN8A 4QGBA 2IPNA 5C18A 3JYOA 4ZQIA 2WVHA 5FFMA 3HJAA 3WGMA 4CQMD 2VPZA 3QM1A 3H5LA 1AKTA 4D4MA 4I1YA 2J6CA 4HVLA 4Z4GA 2VTVA 1QF6A 3FAKA 4OFXA 1QDLB 3OIVA 2YXLA 1ELOA 5AR1A 4XWGA 4EA6A 3B1VA 4CQLA 1U7WA 3TQIA 2ZKIA 4WBNA 1XJ0A 1GDDA 1F3LA 1RT9A 4R71A 1MNQA 2XHEA 3THXB 2EWMA 3ANNA 5BMVB 1L5WA 1TAQA 1MMFB 4LXUA 1VHDA 5FULA 5JPCA 3AR8A 1UBCA 4OP1A 5AP9A 1SVIA 4IQ8A 3KTFA 3ZLBA 5CAEA 4HNAB 3H4MA 2I2XB 3OCXA 5D3MB 2VH5R 1GCOA 2XYRA 2Z2KA 1W6UA 3IUPA 2Y1XA 4X6YA 2P5SA 1FTQA 3DKPA 4RXMA 3KK0A 3FHLA 4ZT5A 4C6RA 5F33A 1YQ9A 4KRFA 3ZDQA 3VC1A 2EJBA 2YQ4A 4XRRA 3EYWA 5H7XA 3EGDA 2P8SA 1GEGA 3BRWD 2ERCA 1EHYA 2NZ2A 3IVRA 2PX5A 1FYXA 5ICSA 4I8DA 1TJ4A 5ITZB 3LHSA 2GAIA 521PA 2WM3A 5HKAA 4U3JB 1E2KA 4HLQB 3O47A 1X1QA 3GGPA 3QFSA 1IPFA 1IY2A 2JGEA 4MUMA 3ZXYA 4B2LA 3Q85A 3A05A 1Z4JA 3LRXA 4I0WB 5HKBA 5JI3E 4R1NA 2YCLA 3CE6A 4EA8A 2YOFA 2PGJA 4CUZA 4YJDA 1R7RA 4Z3KA 3ADKA 4MYUA 3QFFA 3FZGA 1U8XX 5KQPA 3KYDB 2OVBA 2RJNA 2H2FA 4TS9A 4L7VA 1OWNA 2VWGA 3C8DA 2VZ8A 1JLLA 1T36B 3AETB 3IKVA 4HDSA 3A9WA 1ZK2A 4YPVA 3G8BA 3C8ZA 4DDHA 4AUEA 3Q98A 1TI7A 4ZP1A 3SQLA 3U3MA 2AWNA 4BLPA 4RTOA 421PA 1P1FA 1QZXA 5E6UB 5FT9A 2HHCA 4WQMA 2VT7A 3CVWA 1ZBDA 2IYZA 2AF3C 3WNZA 4Z0NA 2X76A 2EP5A 3MWLA 5IVHA 5EJ8A 8OHMA 5BRNA 1J2TA 2DHRA 3AGPA 3TKAA 4AS3A 4B4KA 4FWTA 2PXXA 4IXDA 1DWQA 4DBLC 4UVHA 1B42A 1Z4MA 2E5WA 3WGNA 2Y6VA 4GMKA 4LQ4A 4AZ3B 1VE6A 3KZOA 1XL0A 4M1TA 5EINA 4GZ5A 4HH0A 1C1YA 1EUDA 2XVAA 4ZI7B 2Z58A 5IDWA 2DFDA 2JEOA 2R6AA 2O3SA 5DHAA 5J63A 4C14A 5TS2A 1GL3A 2X40A 4QVKA 4FD2A 1S2MA 2EBHX 1ZJ4A 2B9VA 5HZGA 5L45A 4N0MA 4L51A 1UJ6A 1PJCA 1TYZA 2O2SA 3DA8A 1E4YA 3DKRA 4OLBA 4U4AA 5JXHA 5CPFA 4NPAA 2NOAA 4FGJA 4H31A 3RYTC 1NVDA 1RSZA 2C2XA 2YZGA 4JYCA 5ALQA 1Y8CA 1Y1RA 3H17A 4CTNA 1H3EA 2W6ZA 1G4HA 3R5SA 4QQKA 1RRMA 1IQ0A 5C8ZA 5JCPA 3C3MA 4C89A 2ZE7A 5H80A 2VRWA 2W2VA 1A04A 1JEOA 1XMVA 2C7QA 2QAGB 3VYWA 1QG0A 5ESWA 5CM9C 3P4UA 4WFIA 2IEBA 2C98A 3I92A 4BUZA 4F6LA 1NBEA 5L4LA 4YP5A 2OBYA 5LQDA 4PXAA 4DLVA 5TGTA 4IY1A 1ZRHA 2WIFA 4Y2SA 1JIVA 1OVMA 1FDUA 4EI7A 4RZXA 1NVXQ 2HTFA 1JT9A 3QLJA 1MAHA 1F6BA 3BH6A 3MC1A 3LBIA 3R6DA 4LE0A 3EH2A 2C4VA 1YS6A 2GF0A 1E2UA 1ZUWA 4LI3X 2VJLA 3LUKA 2A84A 5FIUA 4YQEA 5E6SB 4MGHA 3U9SA 2BFDA 3E9QA 4NRDA 5DLYA 3QX9A 4AU1A 1BWSA 2CNNA 1A71A 1XZJA 1XDUA 3JQ7A 1YMVA 2AWOA 4MWBA 3AJ8A 5EE5B 5LP6C 3UW3A 3ZI0A 4BVFA 3H13A 3P71T 5TF4A 1Z9BA 2A92A 3AR9A 4OL0A 4OQXA 4CKBB 4KR7A 1E2NA 1VPVA 4G8JA 2VJPA 2H7VA 2XYGA 5KU7A 2K4MA 1WSAA 3SM9A 4WACA 1P0CA 3HBLA 1ZGCA 2O5RA 3MERA 4MYCA 5EJAA 4CCAA 1MEJA 2C0QA 4I9UA 2ZUEA 1JEAA 3LP6A 1HFJA 4TWAA 3GLGE 1XO1A 1Y3HA 2FUKA 4KBFA 4ODIA 4Y6LA 2FPIA 4H6VA 1Y5LA 5DM70 3ZHTA 4NE9A 3DZFA 4RD0A 5JZVA 4TT8A 5T8KC 2GXUA 1P72A 5ER9A 4B4DA 4D46A 4ER6A 2PJDA 5EJ6A 1CDDA 2GMWA 2Q4EA 3NBKA 5ETJA 4M1SA 1EK2A 3ND5A 4UATA 4C88A 2PVPA 2QWXA 2O8EA 1TA0A 1ISIA 1RJDA 2C9ZA 1WS6A 3KUKA 4FILA 5BOVA 1KEKA 4L8FA 4UZSA 3DE3X 1C9YA 1QIGA 1TVKB 3AZOA 1QO9A 1JRLA 2CDCA 1XR3A 3K5IA 4QU0A 5C5IA 5IJ9A 2AN3A 3WDMA 1G5TA 3FI0A 2ZRIA 2VJYA 4JY7A 1E1QA 4QDTA 4XDZA 2B25A 3R7WA 1RR6A 3E1SA 3USZA 4HPXB 1N2CB 3JWPA 2FA9A 4OUKX 5GJBA 2O2JA 2WIDA 2H1SA 3ESBA 3M6FA 5CT6A 4HVTA 3UAOA 3IR6A 3V4LA 2J3QA 3KU1A 4DTIA 2IFTA 2YW2A 3N2KB 3E5MA 4HGRA 3LBAA 1G6Q1 3L84A 4JFRA 4KR9A 2OC4A 4KQFA 5BN4B 1EWRA 3SEAA 3WXBA 3ZY5A 1DC6A 1M74A 1E89A 1KQ3A 1HEYA 2DB3A 1PHPA 3CNNA 3NETA 1FTWA 3F96A 2AQKA 4IJVA 3WQSB 2YRFA 5A3VA 4BFUA 1FP6A 1QTRA 5D87A 2RGEA 3EDMA 4EYKA 2CLFB 2JB9A 1H8EA 2J4FA 3CKMA 2YHSA 1S1CA 4LGVA 5KMGB 5JTUA 1GSOA 2EOAA 4OBBA 4TKVB 4UAGA 1TJ3A 3SNHA 4BEJA 5DRTA 4CMAA 3T4PA 4DZRA 3EEFA 4I1VA 1GZ4A 3SSMA 4TL8A 4WXPA 4TTQA 4UHEA 4Y9UA 2PXHA 4HFNA 2WFZA 6ABPA 2IOYA 3TW4A 3U6KA 4PZZA 3EDYA 1YQQA 1YB6A 1DARA 1S8FA 3U7GA 3DLBA 4AS1A 4AKGA 1E3LA 1VE7A 3O0TA 1EX1A 3U4HA 4BXOA 4OKIA 1ZHHA 4ZI7A 2WINI 1FY2A 2VUUA 3IKTA 1LSOA 4C07A 1K97A 1QLJA 2RHCA 5GADl 2IU6A 3AF6A 4ZTZB 1ZJWA 1VZ3A 4ND5A 1AGPA 3ELWA 4F21A 1EQ2A 1CUSA 3H4VA 3LYUA 3OU2A 3G5LA 3OF5A 3D6FA 5I01A 2FW6A 3PKJA 4MIOA 4BB0A 4BO0A 4M9XA 3TZQA 4AJNA 3OZVA 2XWJI 10MHA 5FF9A 1LBHA 2Z5GA 4UAVA 4EHBA 3WQHA 4RA6B 1Q0UA 3CXRA 3ZZMA 1CYDA 4BFTA 4ZV4A 3WXMA 2C5GA 3KQNA 2BELA 4I08A 4PYQA 1FUIA 3IV7A 1EX6A 1MR3F 1WVIA 3A7EA 3K4HA 5FLYA 5L3ZA 3SHTA 3UV3A 5JRZA 1DMSA 3PFHA 2LCQA 1NHGA 1VIDA 4EJMA 4IVPA 3F6EX 1CT9A 2AI1A 2R48A 4KQKA 4XM1A 1KRXA 1CD5A 2F00A 3N0TA 3VR3A 2OOKA 2BEUA 4HEJA 1BWQA 2MHCA 2P6PA 2V8BA 4QDKA 4CQNA 2GYUA 2G76A 5ESRA 1RYEA 3ENNA 4MWDA 3NATA 4EGCB 4HZGA 1P3JA 3IQWA 3SZRA 5BWOA 5KOHA 4I1PA 2CZCA 5I51A 4ZOCA 4GLJA 4MLCA 3QIVA 4RDCA 2KSQA 1I4OA 5IUNC 2QEQA 1DX4A 4DHEA 1Z6AA 4IKOA 4KXWA 3CNEA 4MQUA 5EKTA 4D9KA 2C29D 2PX8A 3HG7A 4KIWA 3K6SB 4BVJA 2VPQA 4JLBA 1K89A 2JJ1A 3ICWA 1FCJA 3DEHA 4ZCMA 4EITA 4BY9E 3E22A 3TZBA 1NBMD 2EBFX 1R2QA 3SAJA 4O2AA 2FOLA 5J9FA 2XYPA 2ZI6A 2R97A 1QC5B 5C46F 2GK4A 2IZ7A 2RB5A 4LOIA 3RC2A 1IB6A 1SU4A 3ENZA 2DEUA 3VR1A 1P7ZA 1T8SA 1E9AA 2YFKA 3HNRA 1KDRA 2Q5IA 2YYZA 3I6ZA 4IQGA 3HS3A 4ZVQA 3WOVA 2ZB3A 3DLCA 3RSQA 4R0MA 1QPBA 1VKNA 4KACA 4WDRA 1XXLA 4LEIA 1T8RA 2N42A 3R9KA 2G6BA 5GJWC 3T3GA 3DVAB 1TK9A 1QCDA 5M3BA 2NVUB 4DIOA 4E94A 1JA1A 1N5KA 1UK7A 4MAAA 4WKBA 3DF7A 1G5QA 4REQA 1MABB 3L7IA 4NH0A 1W0CA 1XYYA 4TS1A 1QVAA 3N7AA 5ED4A 3REGA 1PR4A 2JIOA 3G5TA 3LHKA 4MRMA 5JZSA 4FYKA 2FUCA 4YT4A 1T3LA 2CLIB 3N2EA 3ZYZA 4B87A 2J9FB 3BWYA 1BKSB 4F2WA 4Y2RA 1LF5A 3PXUA 3BKXA 3C5VA 2DTEA 3GVHA 4BJ6A 1ODKA 1EK5A 4RM2A 1JWLA 1LDBA 3DMPA 4GF5A 4HB0A 3CNHA 2VOJA 2HQBA 2HIAA 3N8GA 3DF9A 2I03A 1OT3A 1RI1A 2CC2A 4L16A 5E3HA 4BEWA 2GF2A 4NFSA 1YA6A 3QBTA 3RF7A 3MXOA 2ZTHA 4YQYA 4E51A 3RE1A 1TRHA 4RVUA 3QEBZ 3FUTA 1WE2A 4JV5B 3E3NA 1XDSA 4ZJYA 3AHDA 2PSHA 2FMXA 3U4QB 1UKAA 3MJTA 4LKOA 4N82A 2FZEA 3I9V6 2CYBA 2RHLA 3W3AD 5LZ8A 1JKFA 3NAMA 2F3SA 1M2VB 1R0XA 1X80B 4WINA 4EJFA 1ZGHA 4ILEA 3N0XA 5EXSA 1KAEA 4C20A 1W49A 1XWWA 1CZLA 3NH9A 1PFQA 2AI3A 3G9XA 4QRIA 2PZKA 5CD9A 5IG2A 2LDXA 3LLUA 2RH9B 1KY4A 4AO6A 4W5JA 4CIAA 4Z1MA 2OK8A 3TSAA 3F3SA 4QSMA 4E7PA 3DE4X 2DY1A 2CL5A 1I6WA 2NXEA 4CKEB 4A6DA 1JKJB 2JCSA 3FLEA 4CF5A 4UHHA 4D3ZA 2CZQA 4L4XA 3LDGA 2MYNA 3FTFA 2CB9A 5ESXA 2WAMA 5ITWA 3E03A 3ZE6A 1QYDA 4TTAA 4XB6B 4ZEMA 3OTOB 2CNKA 2GEDA 3N87A 4YXFA 5I7EA 3HRHA 5CA1F 2IXFA 4LY6A 4H1UA 2BEKA 4J75A 5JS7A 2W4QA 1ZISA 3K6RA 3DO8A 4M9QA 5BT9A 3L0OA 1UPTA 3I4LA 3QLUC 4FEYA 4WCVA 1GNVA 4FQ5A 4LXXA 3ZQKA 4YRBA 5C4MA 5CJPA 2GZAA 4QDXA 3SJ7A 4EG5A 3PXEA 4Z0TA 2NU7B 3HU2A 4JQOA 3X1JA 4ARZB 3L07A 2D8MA 5AJYA 5SY6A 3GRFA 3KJQA 3WLIA 4CPDA 1NR5A 1DXOA 3O0DA 2NZYA 5KDDA 4CCYA 5LB4A 5KNBH 4XSHA 4P38A 3A14A 5DP1A 1Y5IA 3FR7A 2KWIA 4Q1BA 5AKJA 4YFVA 2AI2A 4B17A 4BO7A 5IF9A 4IZOA 3EXIA 5EHIA 4AY6A 2FMHA 3NIDB 5GV7A 3DVLA 5IK2A 4QGHA 5CHYA 1N5JA 1V71A 2KLHA 4LRYA 5HK9A 2F43A 1N1GA 4G3XA 2OD2A 4TXNA 2HJWA 3RRBA 2PK3A 4LIPD 2EQBA 3C1TA 1BHSA 3VR0A 2H6EA 4YJ3B 2ID9A 4B8ZA 1Y8QB 4IYRA 1FX0B 4NBSA 1YDMA 3CLUD 3QWHA 1CUBA 4AWBA 4QQRA 3KQPA 2PYDA 2P6UA 3I6MA 4JLKA 1JQDA 4Q0MA 4C76A 3NYQA 1NUTA 3EUWA 3DE7X 2EQAA 1BMTA 3ZBTA 3ANSA 3NORA 2YV3A 7ADHA 4R0NA 4F8JA 2YV5A 4REOA 1L1QA 1F2UA 1WABA 2INGX 1Z6GA 2IYFA 4FS3A 3TW0A 5KYGA 2A9KA 1T1SA 2IUFA 1FFXB 3DMTA 4KU4A 5AKYA 1LPPA 2VQ3A 1OX4A 3TOVA 4D3DA 5J43A 5KTKA 4MRVA 5F64A 5LPNA 5M29A 3H9JA 1M8JA 1VHWA 4EMUA 3EFEA 3PUHA 2B4TO 3LZCA 5I7RA 3HKDA 5IF3A 5JSZA 4A92A 1T1EA 4W7SA 3Q9UA 4CXMA 5GONA 5L6LB 1S1MA 2HSGA 2YV1A 4LFCB 4CMCA 1TTTA 3PUYA 1RJGA 5AJUA 4NJEA 2QTVA 4XOUA 3SMVA 1M6HA 1N25A 3DOCA 2FF5A 1PX0A 3G0GA 4UDOA 4PPYA 3U40A 1GVNB 1QLWA 2GERA 5CP8A 3B6ZA 4P22A 1J2RA 2DPMA 3ZDXB 1OXBB 1K5HA 1G6KA 1SELA 2GZMA 2H4WA 3WDLA 3D7SA 3PTZA 4WLUA 3T7DA 2IV2X 5A2QA 2BLLA 2HU8A 4AJ1A 3I2GA 4OJKA 2XB9A 4CIBA 1IHYA 1Z5ZA 3OTWA 5EA2A 1YBHA 4HMQA 4H0NA 4H7FA 2FSSA 1WV1A 5CBPA 5KWVA 2ZR8A 3ETDA 1N2JA 4DQLA 1NN5A 2HJVA 2HRBA 3HWX1 4X45A 4ZT6A 5A06A 1L7RA 2LTAA 3D5TA 3GC6A 4MVJH 3K3PA 4JKIA 2B6HA 2DRIA 2EBWA 3NDIA 4GSYA 3NVKI 2WP0A 1G8MA 5DN6A 5GY7A 5ALJA 4FWBA 5IDXA 4CQMA 4JKOA 3GFTA 1OA0A 3M9LA 4PX3A 3K70C 1MHTA 1Q44A 4HGPA 3W1EA 4BU1A 4D57A 1UK8A 1ZJ5A 2WF7A 4OHOA 3L6BA 4MCAA 4W9NA 3SBDA 1E6KA 3GFRA 4Q4HB 2PUVA 5F4BA 1ZBQA 1AKWA 1EZ4A 3IEIA 4DMLA 3M5CA 1BVRA 2AW3A 4RHEA 3WDKA 4DA6A 5JS1A 2CJPA 3IT0A 2Q4RA 2XTNA 3BA6A 3BL5A 3PEEA 4C0KA 1HDGO 3WKBA 4US2R 3OZDA 3JQ8A 2J0QA 4F5YA 5DYYA 3DBVO 4HUQB 4IFBA 1HI9A 3TTSA 3NTQA 4DXHA 4B44A 3DFFA 1IK4A 3GUCA 1TU0A 3PX2A 5AM4A 4PCUA 3LQ1A 1Q1AA 3ESCA 3JVEA 3R7FA 3I5YA 4CEJB 1DRWA 3LBYA 5ENZA 4NK4A 1WZUA 2HN9A 1VPEA 1G5HA 1O5OA 4D2IA 4U00A 2FMIA 3TD6A 4Q4CA 1KKUA 4EZEA 4JVOA 3LPAA 2DKNA 4RS3A 1DG3A 1Q16A 3CX6A 1DG9A 3AR2A 5IJXA 2JHFA 1Z88A 4LC1A 3SYKA 3UV7A 2J5RA 5DNUA 2IBSA 1A5AB 3QRWA 2HV9A 4NFYA 3S44A 1CYEA 2CEAA 2ZSEA 1YR9A 2YYAA 4MLPA 4RGYA 3X1ZA 4B6SA 4O8CA 4ESEA 4MQFA 1P7YA 4BZPA 5LIPA 2YQZA 5CDUA 3NM4A 1NVAA 2OG2A 1PN3A 3KSRA 1N0VC 1RI3A 1THZA 3O3MB 1ACMA 5TB5A 3ZWCA 1NSYA 4CMKA 5BSVA 3O26A 3RJTA 1XTPA 3NIGB 5SY4A 5K6AA 3HCWA 2JKYA 1G9TA 2GPAA 3CZPA 1EWTA 2H4YA 2BMWA 1RHKA 2Q5FA 4ZVUA 1WXWA 1KFEB 2P3OA 2WW8A 1WLYA 2R25B 4IJWA 1HDOA 2CCKA 2Q0XA 2HPAA 3K32A 4CL0A 4Z4HA 5E6RB 4Q3CA 1UBNA 2W6ID 2RGWA 3NAZA 3QUSA 1V5IA 4N49A 4Y2PA 3MTQA 4I1OA 1COWD 4NOKA 4R5MA 4ZAYA 3SC4A 3W8EA 2AOUB 2PUCA 2G3YA 3ESDA 2JH8A 1FMTA 3E9EA 4RIIA 5KNBA 3SCZA 4YR7A 4HNTA 4OGLA 2O06A 5LMCA 3BE5A 1NP7A 4HD8A 2A0FA 5EQTA 3OTIA 4P3KA 3HB4X 3C6YA 1CQZA 4NE7A 4WRRA 5EWLB 5AXCA 2W6IA 3CGGA 3MD9A 2Q7DA 3RTAA 3VH1A 5JNTA 5DOVA 1XGKA 1K63A 2Y76A 1A9PA 3EA4A 4LK2A 2ZT5A 3TZLA 3MTBA 1HE2A 1N1DA 3GDGA 2IF2A 4FDMA 1HUQA 4LJYA 1UXGA 1L7NA 1QIEA 4NONA 4QWWA 4ZOLB 3U7QB 4ENPA 4XLTA 1OGIA 2WUVA 2H4FA 2Q7OE 4BFCA 1W5TA 4JK3A 2WJ3A 4D4HA 4YDQA 2GD1O 1IONA 1BO6A 3RVKA 2OM6A 3DVAA 2QLNA 1VE9A 4H6XA 4I9HA 1N57A 3FKJA 1YXMA 5TPZD 3TOCA 1SXJA 3O38A 1Z36A 1C0KA 1XCMA 2A9VA 3GRVA 1F12A 2W6MA 4P58A 5JC1A 2KYRA 1MQ8B 2DLDA 2ODAA 2X1MA 3R0XA 1QFYA 4S35A 1V5FA 1ZUNB 1IIRA 1JLSA 2Z4SA 1T1IA 1QR2A 2CMHA 3ETLA 1RNLA 4K28A 5CM8B 3KL2A 5JQGF 1W36D 3CTMA 1PX2A 1VRCA 3MAGA 1Z62A 4OQFA 4UNRA 2VTBB 2FQQA 2CV1A 2OLKA 2QRNA 3AB7A 2OKCA 1SB8A 1FW8A 3HB5X 2B92A 3I04A 3LYLA 3U19A 1PDVA 4HAVA 2YMQA 1UDXA 1KXJA 2N3ZA 5FNZA 2VC2B 1GR0A 3PWTA 1OF1A 1UC5B 3Q3HA 3O94A 3E2PA 2LKDA 4NC9A 1T8UA 4O59O 3VOBA 5AUPB 3E9NA 5GINE 3WICA 2XKAA 5DNYB 1P7WA 3RADC 4IUYA 4BB9A 5KS2A 2C5SA 4P93A 4QOGA 1WVGA 4WA7A 4XUEA 2JG3A 1H1TA 3NHPA 2DAPA 2VDQB 1WW3A 3KVVA 3K0KA 3M5DA 1U0LA 3RLFA 2H8GA 4G0NA 3LGSA 2QX4A 5FWAA 3N74A 1YJXA 3G1WA 4FSDA 1FW6A 2OHXA 4PSCA 3ZDEA 1A9XB 5B58T 1SWVA 4F1KA 1QFXA 4R84A 2GZDA 3L82B 2MSCB 2Z4TA 1ZRMA 3NM5A 5EE1A 4OVKA 5C8XA 5FLEX 1TYEB 5C0OE 4A2WA 2ILVA 1W8IA 1MGOA 3I53A 5FOQA 1EDEA 4KNWA 3FMGA 4Z7JA 1SUAA 2X4LA 1JDZA 2YFYA 4NNJA 2P2ZA 4HRVA 4PVDA 5HIMA 2K7FA 3B6EA 1KI4A 1RMYA 2I34A 4MZXA 4QATA 2Y1KA 5F9MA 2NTYC 1STOA 4KBYA 1QHFA 3E9RA 4PAQA 5H70A 2Q5JA 1QHHB 3DBLA 3V80A 4C9BA 3WL4A 3MWEB 1KZ9A 3LXXA 2RHWA 3M4ZA 4FMDB 4A15A 3GPBA 4DV7B 4RVNA 3WP0A 1TA4A 1II8A 1J00A 1X1RA 1RLJA 2WJWA 9ATCA 4N5IX 6LDHA 4EELA 3FPSA 2I0FA 2XGGA 1HE4A 4BVAA 4CFZA 2FXIA 1VKRA 2ACVA 1EP3B 2P5YA 1ESMA 2OCPA 1SMKA 3L7BA 5H16A 4JUIA 1WNFA 3LKBA 3K2BA 5LWHA 1EEHA 4K86A 4PYIA 3CZAA 3TL2A 2CYAA 3LPMA 1P2UA 4FIDA 3H8VA 2BI7A 2X3UA 3KQSA 3PDIA 4Z51A 1W0KD 2XR1A 1DQRA 3EZLA 1NYQA 1ZAKA 1AB6A 2VXCA 1BCSA 1S3SA 1U5BB 3D5QA 3H5OA 2PUHA 5CRIA 3ZHVA 5J4LA 2QMYA 3PJGA 5HZHA 2RGGA 1TTPB 3VZDA 5AW4A 4JL8A 4RYDA 5HWSA 1NDUA 2JI7A 4Z1OA 3CE9A 3KV1A 1AOXA 1LJ8A 1BQEA 4Y1RB 1G42A 3RGWS 3ELUA 5DGCA 3ODPA 3X2FA 4F3YA 4JVMA 1YE5A 1TJPB 4ESOA 2IEZA 3DH0A 1Z07A 3HB9A 1S3IA 1YFZA 2GFIA 4Y1EA 1KQGA 4LPKA 2P2YA 3IOYA 3GCZA 1XEAA 1F14A 3LSYA 5BYKA 4CM5A 2QN9A 3OEHD 5JBIA 3OM8A 3QPUA 3HN7A 1IVNA 1L7BA 1PZGA 1HFWA 1WZIA 1IE3A 3ORFA 5DK4A 1GRCA 3TGPA 2RH5A 1C1HA 1ULAA 3EZXA 4RYLA 1JPVA 3IR5A 3FYUB 2C9DA 2GZ3A 3WNDA 5IC6A 2P3QA 3THYA 3KIPA 1LUAA 2C4HA 4NATA 5G4KB 2HLPA 3AXTA 3E35A 5DYWA 5CPBA 4B4OA 4G37A 3BCRA 4C78A 1AGXA 4D9NA 3JATB 2WJ4A 2Y1FA 4ND6A 3HVIA 5K2OA 1H2YA 1K8XB 2QI9C 3LCUA 4QQ8A 3ZK9A 4JN6B 2PMCA 2NGRA 3VISA 4ZI7F 2DJ5A 4YRJA 3ZI4A 3LWDA 3UYKA 1DC5A 2P3SA 3E8XA 1MB2A 2FEWB 4N40A 5CH5A 1C1XB 3C39A 2IY7A 3BJMA 3EXEB 1I3KA 5TV2A 4UZEA 3PI7A 4TV8A 3J80A 1EXMA 5DI3B 2YS7A 4CVNA 4DT1B 4EVRA 5JAIA 1OX5A 3IBSA 4B3IA 1TQHA 1PGQA 4ZZ1A 3PNYA 4UBNA 1P80A 4B9EA 4LWOA 2PZBA 5B36A 1P4GA 3R7DA 3K9CA 4FJ2A 1FYVA 4PF1A 2QAIA 4LYAA 4LS3A 5BW5A 1IWPB 3LLCA 3PQDA 2C88A 2BGMA 2J5KA 1NW3A 2B94A 4CDMA 4R2HA 3MT8A 4LI0A 4OL9A 3X43A 4DLLA 3RSCA 2VZLA 5DOZA 4DJAA 3A11A 1VJDA 4OI2A 4FQ7A 4LBWA 3VRHA 5LXTF 3VYSB 3UMSA 2ST1A 3NT4A 6AT1A 4B33A 5LZ4A 3ADPA 4JJKA 1T9DA 3AJAA 1WOYA 4Y6RA 2GQ0A 1UMKA 4MITA 4HDCA 1TL7C 1GAEO 5EPEA 2FLVA 1KMHB 4WNCA 5JWRA 1JIKA 3AVVA 3REQA 4L78A 1Z18A 3ZWWA 3N3BC 3JQDA 3HXMA 1ZKDA 3TJRA 1XELA 2JCGA 1JHOA 3BDAA 4WFKA 1GZ6A 2VDPB 2FR1A 2O9JA 4V0QA 2JAXA 2N1MA 3SLRA 4BMYA 3FUXA 2CJFA 2VDWB 1IYZA 1KHHA 2OO5C 1IHDA 3GPDG 3JYNA 4I3FA 1CUYA 2XMSA 5IC5A 1Y6ZA 2Q1WA 3JD4A 3B7GA 4I1RA 4ZCPA 1BJTA 1O94C 4UEWA 1GGNA 3LT1A 1N6KA 4DCVA 3HY4A 2YWXA 1YCFA 4P4UA 3DP9A 3HO6A 5A3SA 4BN4A 1XRLA 4ZTUB 2CFCA 2JJMA 4OHXA 2ICAA 3ORSA 5TXGA 4XH9B 3RSSA 1UCFA 4HUTA 1J90A 2VNJA 2Q3LA 5F76A 1N92A 3TLJA 1OAOC 1UBOS 4KXXA 4BGVA 4G4GA 1V7QA 3DMFA 1QIIA 4L27A 1HDYA 5F5LA 2EJUA 4RGQA 4BQNA 3A26A 4DQXA 3FTEA 3MTGA 1DS6A 3KAPA 4YP9A 1X8XA 1J0DA 4CODB 3QW4B 2AXPA 4G0YA 1KDZA 3VU0A 3HCFA 4EATA 2B1RA 3NEAA 4NFHA 4DCSA 4Y2HA 2AK3A 1QDUA 5E1DA 1Z6ZA 1B8VA 2XXAA 3NV7A 3KG2A 4YRQA 3B9BA 3LH5A 2IEDA 3FGPA 3VR3D 5I7HA 3MTIA 5LA6F 3RROA 1ZLYA 3R6TA 5TARA 4J8PA 3CVXA 4XLZA 5F2NA 3CZCA 3R9IA 1G8FA 3ZCTA 4B3CA 3R3WA 3BTOA 2VWQA 4B6PA 1B8NA 4DNOA 3QVWA 1IJEA 1LB1B 1U7UA 3QPCA 4PNHA 2HPZA 1XCGB 1H2EA 1XC7A 4BVGA 3HN2A 4B2YA 2JLSA 2HLNA 3LDUA 1SD1A 2VYVA 3NAGA 2ZSKA 3FCUB 3PNSA 3GCGA 4QREA 3SZOA 4ECEA 3D6MA 1FXSA 1T1RA 1CZUA 3GUVA 3QHPA 4WY2A 5TQ2B 3ZN2A 3NX4A 3PC7A 4PG6A 2XCSB 3R4VA 3MGAA 2RGYA 1MP0A 2IS4A 2FZGA 1R3DA 1VYTA 3L8YA 2DHQA 1ORVA 1KGDA 1TMYA 4I50B 1HDZA 1SRRA 3HSSA 4JUDX 4PXYA 1U0GA 2X5OA 3CUVA 1R0KA 3LUDA 2Y93A 5HRCA 3REQB 2CLEB 1P2GA 1L5OA 2GN4A 3CF4A 2A33A 4L8VA 2XQJA 2HC9A 2RD2A 4XR9A 4ENVA 4EFDA 4I19A 4BNNA 2ZIFA 5EQJB 2VNSA 1YI0A 3T9AA 4C0JA 2UYHA 1WG8A 2VBFA 1UAAA 4KXNA 4Q4HA 3GFFA 4NK5A 3W5UA 1KVQA 1BJKA 4EGJA 3BXXA 3NNSA 4J3FA 3GEGA 1CIVA 1NRIA 3NVDA 1XVTA 4QICA 4Y18A 4XX0A 1XRRA 3FSGD 4MS4A 4C7VA 3WQBA 4JYMA 3RYHA 4D99A 1X7ZB 1TQ4A 2AZMA 4Q82A 1YR6A 3TW6A 3SC6A 3D0KA 2C3OA 1VJ1A 3EVZA 4C29A 4B3GA 4ZRMA 1AKYA 5KYTA 1W87A 1PQUA 1U1FA 3BWDD 2A30A 3KSBC 4NJOA 4D5EA 4QM6A 2XMQA 1BE6A 2QUHA 2RC6A 1JTFA 4QYIA 1MC1A 1I51A 1WB5A 4MJ3A 3EJWA 2JL1A 3OOJA 2WNIA 2QG9A 1A8QA 1XK7A 2FPWA 1AUOA 1V4BA 1X9GA 5DFAA 4ZVRA 1IVYA 3LOQA 2OV3A 1N8KA 4XUGB 1W0KA 4NMHA 2A9JA 2ZYSA 4PGFA 4N48A 4X8OA 1WNTA 3QWBA 4LV8B 3CKKA 5D3QA 3FCYA 2E89A 2ZYRA 4PR0A 4V2IA 4E6PA 3LQYA 2OY0A 1XG5A 2YOGA 1Z38A 2VHUA 3DZDA 3RUCA 4ZRDA 5LDDC 3N0WA 2NYUA 5ISMA 2OGWA 3EIWA 3ESZA 3ZCRA 4GKAA 4CM4A 1OZAA 3EFOB 2NM0A 4B3SB 121PA 3DZ8A 1RWWA 4A0RA 3KTAA 2Z9BA 1MEOA 1BCRB 1T1JA 2FCRA 3H2HA 3MJEA 4FKBA 4N65A 5FTWA 4YRMA 2HD4A 1T5TA 4N8DA 4OMUA 2WWFA 1POWA 3QUTA 3UO8B 1M0SA 3H05A 3S28A 4HT3B 3A6DA 2RMKA 4MIYA 3T3NA 3TAHA 4LCEA 5JNWA 1KYXA 1U0NA 4A0SA 1GRQA 5C7YA 1PV4A 1I6MA 1MAUA 3IOEA 4RLSA 3ZWOA 2RE8A 1O08A 2YJTD 3I8SA 4LSGA 1C9EA 1Y3FE 1CUEA 3DMGA 3JQ8B 2FU5C 2JHAA 1Y1KE 5DM2A 5IX8A 1BGVA 1YQEA 3HP1A 3AF0A 4F93B 3M6LA 2QAGC 3D7LA 5DBFA 4B6OA 1ZIXA 2ZI5A 4YAEA 2IZOA 3PYLA 1TYBE 5BQFA 4NCJA 4B84A 3C3DA 3CUUA 2XGSA 3AUFA 2FEAA 4Q24A 5J2TF 4YLYA 1Q1BA 1GTZA 3RO7A 1LBSA 4WMLA 1TF5A 5K8LA 1YV9A 1HNXB 4OFZA 4CQMB 1ZGZA 2MYPA 4DR7B 3IP8A 5LCXA 4CKYA 3DDZX 1Z7GA 2CLMB 1P1RA 2RKBA 3WJAA 2GK7A 1WDMA 4OJQA 5FNVF 3RRJA 4EKIA 2O3UA 1II8B 2Q2OA 5ITVA 4JYPA 5A7GA 1G0OA 3UFBA 4B32A 5JANA 1EUZA 3R5HA 2GT1A 3OMXA 1QIFA 1RYNA 4QU9A 4IGIA 1QZ3A 2IXDA 1NBWB 4X94A 3E8SA 3EGIA 4C21A 1YAHA 1XXHB 4TYYA 3UMYA 1XZPA 3ZGNA 3NHLA 4RVDA 2HMUA 3VV3A 1ZJYA 1IHPA 2CXOA 3D6UA 4GPZA 5H82A 4ECAA 2QJFA 4GWKA 3L2OB 4YMSA 1AKVA 1G19A 3C3AA 2B1GA 2FAXA 3FNRA 3F1KA 1F2DA 3IC5A 4G2NA 4UREA 1UPUA 3T7CA 3WLSA 1AQNA 5C1IA 3REFA 4C2UA 1A0OA 1GGMA 1J8QA 5AW6A 1A72A 1U0FA 5DASA 3MPOA 2WOJA 1T2CA 1G98A 3N6XA 2YFHA 5T4FA 1PNOA 3SNKA 5DX8A 4YYZA 1M73E 3BKWA 1VGRA 5E8RA 1S3GA 4M4SA 1DHTA 1ZCBA 2FWJA 4FNOA 4WK6A 3NHKA 4XOIA 3LQ4A 2XYHA 1J7KA 9ABPA 1W5EA 1U8UA 2MSLA 1EX9A 3DPSA 3TBFA 1V6CA 3TRJA 3RVSA 1TVKA 3UUFA 1WKVA 5ABPA 2WPDD 5DLEA 1ZRSA 1SXPA 3FG9A 2OECA 1DAKA 2C4WA 4EHHA 1TZMA 2HLDA 1JA9A 4KHZA 2HYIC 1CCWA 2GO1A 2N1BA 2N47A 4AWAA 5L6MB 2QRPA 2Z2IA 3DGEC 5SZIA 4O63O 1C9JA 2WPDA 2F48A 4IM7A 5IRCD 3JAKA 1XRNA 4PX5A 3EXHB 3AP3A 2QJOA 3K92A 5FI0B 1XYVA 4YAKA 1PG2A 1BFKA 1KZYC 2EARA 2EKLA 2X7JA 1RZ3A 4PLGA 1Z7YA 3DLHA 4N0EA 4URYR 3DCIA 3NFYA 2H1IA 1P5JA 1USUA 2W71A 2EVWX 2EEPA 3IKMB 5CYOA 3DTTA 3WAKA 1P9RA 1S9HA 3MYYA 3ZWNA 3P52A 3WBKA 5A4KA 4UCXA 3GH3A 5JCXA 5JMPA 1PLJA 2FP4A 4B5LA 4FUQA 1X38A 2JARA 1UKEA 3VGJA 1YS7A 5T67A 7YASA 3EXIB 4HDRB 4CDGA 1UEJA 1A5ZA 4UJ3A 2F1KA 4BO6A 1T2EA 1QWSA 2OGZA 3Q9LA 3ZG6A 1WTCA 4JI3B 1E3SA 3Q0EA 1KMIY 1SUBA 2V3VA 2HHHB 4COKA 1SC3A 3WGYA 1CU1A 1AB5A 1S2IA 3RS7A 1KDPA 2X3FA 1GZVA 4DABA 5LXTB 4MI3A 1ZD2P 4YRZA 4QVIA 4IRXA 2RI6A 13PKA 3PQ2A 4D3YA 3TRKA 1XPRA 1ZNWA 2B1JA 1KKMA 1LH0A 3PEUA 3PNQA 4XLLA 2O1WA 3GYGA 1NMEA 1NYRA 3TNDA 1ZI8A 3GVIA 1NA5A 3G2LA 2YV4A 3OX4A 4R1PA 4WH0A 1MAVA 1Y7IA 3MQ2A 4AYXA 1H1LB 2Y6UA 4KRXA 3AFHA 4N6GA 2Z0MA 4LRUA 5AYVA 4R9VA 3KB2A 3GJ8A 4OO3A 5HG0A 3H87A 1FDRA 5BUCA 1QGDA 1WXGA 3GJTA 1IY9A 2PX3A 3QSGA 4L50A 4MOWA 4MS1B 1D2CA 3H84A 1DQZA 2D1FA 2O2XA 2PZ8A 3CPSA 3D4BA 1J8DA 1WMFA 2B98A 3EVNA 3Q6NA 1G18A 1C8KA 4RJKA 5EN4A 4ASUD 4RKEA 1VG9B 1N4DA 4P2GA 5K0GA 3FOCA 3ROPA 1QC5A 3FCOA 3BWMA 2LPMA 2QY9A 1Z5WA 2NU9B 3CW2A 2JBAA 1NLFA 1L5RA 2JIZD 1X80A 3GEDA 5GGXA 4V03A 3WNBA 4ZYLA 3BMQB 4CMIB 2VATA 2OZEA 2WTBA 2ZB7A 3V34A 2VQEB 1SKYB 5AW9A 4YV1A 1UZNA 1LK5A 4HNSA 5T4EA 1VL5A 2UXBB 4IGFA 2FQYA 2JIZA 4Q6BA 3D3QA 5JW6A 1OUMA 4BMCA 3UF0A 1Y1QA 1P44A 3FN4A 1UOEA 2B2CA 4XJTA 5CX1B 2ZU0C 2JZOA 3RBVA 3WWDA 5A4IS 3GLIA 2J32A 3OURA 4ESHA 2GJ4A 1LBQA 1M34A 4MWCA 4X9XA 4ZZ2A 5KC9A 2M1ZA 2JJ8A 4YREA 1IAVA 4BWGA 2ZG6A 2LW7A 3B6KA 4IEIA 3OCJA 4C4OA 3N76A 4HBGA 4PFJA 4RWEA 4MKGA 3RUIA 1YDFA 3KHTA 3ZVLA 221PA 2B83A 3NI2A 3URMA 4V0MA 3C2QA 2GH1A 1YL7A 3DB2A 2XV1A 3BIFA 2EBUA 2EP7A 4F56A 1DLIA 1MJHA 3FBGA 2AN5A 3IQEA 1U7HA 3ASYA 4L07A 3D8NA 2LWIA 2OV6A 4R69A 1FPMA 4QOEA 1GNRA 1DQNA 4O5OA 3U7EB 3Q1LA 3F67A 3E58A 4KWHA 4EYQA 1JHUA 1L5YA 3AJRA 3GEMA 2B36A 4GZMA 2LUOA 1GG5A 2D7CA 2WSYB 2BI4A 4C0XA 2Y71A 3D7KA 1I4EB 1ZDMA 3AEQA 3PC2A 4EBBA 3A04A 4PGGA 5WRFA 3CUKA 1I10A 2D4AA 4XDHA 1R5OA 2DCMA 4DKXA 2PKRA 4XVRA 4D9BA 3N2GB 2GI4A 1RPTA 1LSSA 3VVMA 1R00A 1NI5A 4BZQA 1GNQA 2FN9A 5GGYA 3DTVD 3LM8A 1C0EA 4Z9FA 4RTJA 2QGZA 1E3IA 5H9VA 5BNTA 1CY0A 3OIUA 4DC1A 5CFPA 2F1RA 4ZQBA 5H1YA 4KK4A 1NV8A 1NBOA 1H9AA 2HA7A 2AOXA 3PR2B 4BE9A 5AVWA 1ISJA 1AF7A 2IIVA 3A06A 1GTL1 4G0OA 5B53A 1GTJ1 1PR5A 3JAWB 4HAWA 3HFGA 1JR3D 1BS9A 1UP4A 2R8EA 4NNPA 4C04A 1OZGA 1Z2EA 2GD6A 1SB9A 2PSFA 4M37A 2WVGA 1R8SA 4YUAA 5BWLA 2MSNA 1D2GA 3MCVA 4X1IA 2AEFA 5CCXA 2RI0A 2PYZA 3ENKA 4JD5A 4OH7A 3RHSA 4DSNA 3TECE 1ILWA 1PR1A 1FU7A 1E9BA 1NUUA 1SQGA 1BX1A 1VE1A 1XZ8A 1DRJA 1Z37A 2GLXA 2I9PA 2H08A 2XHZA 1FFHA 1MENA 3AM3A 1WTAA 9LDBA 4LVNA 3HXOA 4P5DA 1XK6A 5LM3A 3OP4A 4AQYB 1N7GA 1UBFA 3IE1A 2CLCX 5C80A 2BE9A 2AFHA 3DKKA 3KJIA 4FX2A 3FFBA 4KV9A 3MWKA 1A96A 4CV0A 4DLKA 5JO0A 1QGUA 4RNDB 5KYXB 1XI2A 1LU9A 1NLMA 2HRDA 4L15A 3QPAA 1EUQA 1Z4NA 1RBQA 4XCXA 1OQAA 5HIIA 4I55A 5EP2A 5K05A 3IPRA 3UWKA 2F59A 2IYEA 2W2MA 1T6YA 2DM6A 2WYWA 3GB9A 3C98A 3GJ0A 4HEHA 3VSCA 3W5DA 4HR7A 4MS3B 2YFQA 1E0AA 3AF2A 3JTMA 5KJCA 2IYQA 2I6XA 1GT6A 1T0BA 3VR5A 3ESAA 1LJLA 4H27A 1HBJA 1EE9A 1M3SA 4OQQA 2HDOA 2IK8A 2C5FA 2RKOA 4LZZA 5SICE 4B8YA 2PKWA 3OQIA 1TQ8A 1KAGA 4B47A 4BJ3A 5CDFE 1ZMBA 2B9EA 3GFPA 3RD5A 2A7XA 3HN6A 5ITZA 4PZPA 5I7SA 3RU3A 4J07A 3WA6A 2WM8A 2PWPA 3ORRA 4LMRA 4CWAA 3HLKA 3PFBA 2WDPA 3OLVA 3BJEA 1NUSA 5DN9A 1KDVA 1EUCB 1E6MA 2H63A 2GYWA 5AHRA 3DEFA 4PAMA 3DD1A 5JJLA 3B1YA 4ZICA 2AA3A 2IX3A 4TUYB 1B0UA 4Q9AA 2E5LB 2JFGA 2QP4A 1IHXA 1AZSC 2JVIA 2JW5A 2W4IA 2AJCA 1P9OA 4B73A 2J0VA 3MAJA 1G60A 2BVNA 1H4TA 1PDWA 5KOIA 1GA4A 3O1JC 1ZH8A 3V00A 1OAAA 1KYIA 2O2HA 3NHSA 1BMFA 2XKBA 2C83A 5FNVA 1CUJA 4BNMA 1AMUA 4X62B 4DV6B 1EVEA 4N6OA 1UEXC 2AYZA 5FADA 2GDJA 4EUSA 2FZWA 1NX6A 1KBQA 4PC6A 5LYJF 4J0KA 3S1LA 1GAWA 3QVUA 2C4TA 1E9FA 5BN3A 2OORC 2ZJZA 1NNLA 1HSZA 1BCRA 4P4SB 3CEJA 1NC3A 1NNSA 1U3WA 1WPRA 2PX2A 2VLBA 4NZZA 4RBNA 1LQUA 3ER8A 2P5TB 3H16A 3QKWA 5BSRA 4MB0A 3PXDA 1B6SA 1SUEA 1YTLA 5GM2A 3BYZA 3NNDA 2GWHA 2H7YA 3SP1A 1A7JA 1DUIA 2QVCA 3BIWA 3DT8A 1R6XA 3RVOA 4QYMA 4ZWNA 3OF2A 3AYZB 5F5XA 5JH7F 3I73A 4XIIA 3LCJA 5BVGB 3EEYA 3D3EA 3TJZA 3OJ0A 1L3CA 1WBJB 3ZWBA 1G4UR 2DWCA 3OUUA 3B1KA 1NMZA 2DPYA 1TO6A 4LRTB 3UUGA 3K15A 3GUZA 1R4MB 2VZEA 3EPRA 4C7BA 1UPCA 5U9CA 1GRNA 1HT3A 3NEJA 2J59A 4NZOA 3IDFA 1JEEA 3KHUA 5EXDA 1XAIA 4ZT2A 5CT8A 4EPYA 4DV2B 3UJCA 1RPZA 3KSAC 1LF0A 2D5AA 3IMGA 4EABA 2D2XA 4O1IA 2Z8ZA 2Z1MA 4YRGA 5LQCA 2ZT6A 1G0NA 1NSTA 3AVYA 1VCNA 2AZ4A 5ERGB 4II2A 3T1QA 2CHUA 3L0SA 5CXUA 4UU8A 3IHWA 5FOSA 1QO0D 4BFSA 1UXJA 4GWGA 1KI2A 3BL6A 2OV2A 1VSQA 1ECCA 3GDWA 1GZHB 3HUFA 5EXEA 2WMOB 3CYFA 3G1UA 3ADOA 3AX6A 2WI8A 3I05A 4GYJA 2NUAB 2PR2A 3TB4A 3DLAA 3GJ7A 5KSZA 1GLNA 3A1SA 3HZOA 3QOFA 4KO1S 4JJ6A 3BXGA 5DNWA 4QM7A 3C8HA 3HJBA 1VIMA 4PFQA 4RWZA 3USCS 2F3RA 2HRRA 5A9SA 1WEHA 2Q2VA 4DUGA 1EBUA 3MN1A 3MMXA 4QXQA 2WKWA 3C5EA 1RAEA 4N01A 5TRTA 3FPJA 2P1ZA 4CM8A 2HQ1A 3SQWA 5PNTA 2HUPA 3NBZC 4M9ZA 2E3JA 5LYJA 3TEFA 4LF5B 5M34A 1WUHS 1DKNA 1RRKA 2D13A 3E61A 3NHUA 3VKUA 4B7CA 4BAZA 1NXPA 3AW8A 3IGFA 3S29A 3VPXA 3LXMA 4Z4CA 3GBSA 4K6MA 1UT6A 1EAYA 4WPGA 4TRNA 4E5NA 2YJ4A 3WZMA 4M89A 4BO9A 1P73A 3HCEA 3PUWA 4G1CA 4H4EA 1X1CA 5ELXA 2DECA 3PUXA 4QGFA 5TT1A 1X77A 2LR0A 4I8IA 1P0PA 4Y9TA 2C96A 5DHTA 1JFRA 1FP1D 2PRSA 3ABZA 1G38A 1GV1A 3G2OA 2K87A 5FO0A 5K8CA 3JWGA 1Z29A 3DJFA 4OJTA 3WLJA 3EBLA 4Z0PA 3RREA 3T3OA 1ODJA 4OSEA 2V3CC 1EBFA 4PSDA 4HTFB 1E3QA 1EGVB 3HUUA 4PYLA 4D97A 4AJPA 3SIPA 3IHLA 3PHHA 4NBLA 4AD8A 4EFLA 5IHPA 4NEHB 5KTPA 2PKEA 3ZW7A 1ONOA 3O8QA 1IOZA 3NJRA 1JXOA 3OBIA 3FPAA 5IWAB 1EXNA 2R7KA 1PZEA 2X6TA 1CZRA 2B37A 3HDVA 4L4RA 4P86A 4RJLA 5AOBA 1M8FA 2ZPAA 3UPDA 1ZU5A 2JJ1D 3PPIA 1U0OC 2VR1A 2CVZA 2CV0A 4FFPA 3HMKA 1MW9X 5J3JA 2A1UA 3RQIA 2D5BA 3FYTA 4GL4A 4ZEWA 2NUTA 4QL3A 4X6UA 1E6UA 1R66A 3H42B 2PU5A 2F3UA 2COEA 4P9NA 3UWDA 5JISA 4UPEA 3PHIA 1RMTA 3GU3A 5EJ4A 4INAA 2VUHB 4K3UA 3WQQA 2JK0A 4HHEA 2DZDA 3KOUA 3RS4A 4GICA 1U90A 2I4RA 1E1DA 2Z6AA 1HT2E 4EHKA 2IUTA 2VHZA 4FOTA 4UNQA 3KTAB 4PNEA 3S1SA 2NSHA 4TWIA 3CF2A 3U5ZB 2XNKA 2E37A 1KBOA 2ODNA 1XDWA 4Q1VA 4YALA 1L1FA 2IELA 2QQEA 1HRDA 1W85A 2VJKA 4G85A 3RK1A 4YHBA 1UXOA 1QIDA 4JJIA 5DM0A 4B6EA 1NASA 4JT9A 2ZR0A 3OZGA 2D4HA 1W96A 1DI0A 1ADBA 4LF4B 4G5YA 3UNXA 4PWZA 2QGFA 3ABOB 4OJNA 4FI3C 5K3OA 1UKVY 4MUKA 2PKQO 4RY9A 1D4ZA 2V7TA 4R40A 3ROTA 1OGJA 3VDNB 2IEIA 4KGDA 4NG5A 4MPRA 5ALDA 2UVPB 3L06A 3H86A 2DQKA 3WR5A 2RIRA 4AZWA 2PMFA 4WKPA 4YCCA 2C2YA 2VAMA 5KJ1A 4QHSA 2AN4A 2ECOA 2PWAA 2Y1OA 3G79A 4NZNA 5D8DA 2BGGA 3OCVA 1YI1A 2JAPA 1KI3A 1T4DA 5JH7A 4XGQA 3RBZA 4CTOA 2VDJA 1TF2A 1T0IA 4LCBA 1XMOB 4CM3A 4LXTA 3CJRA 4G26A 5FR2A 2QVZX 3WBBA 5D7NA 1MTZA 1S8NA 3DZJA 1NI3A 3ZHSA 1M8PA 4R2JA 3H65A 1OBOA 3U0VA 4BEBA 1NVMB 1ZZEA 1EFUA 1WZNA 1R5JA 3HO8A 3PRYA 2NPFA 3ULKA 4DRXB 1MXFA 2AS0A 4NCBA 4ES6A 2EKQA 3UAVA 1DJMA 1N5RA 1SOUA 2EFHB 2FSIA 4F5WA 3SFZA 1KVTA 3BAFA 3O1HB 1HYQA 1UQTA 4DF3A 1OX6A 4MWSA 1GPWB 2WWIA 1MV8A 4M0EA 1UC9A 2VF4X 5IJAA 3WQRA 1IEWA 1V9LA 3T5GA 1CUGA 1PHRA 4L5BA 2F4VB 3A6PC 4QHTA 1ZR4A 4RK0A 3A6EA 4KI7A 3F4LA 1S4MA 5GP1A 4OV6B 5A04A 2BMFA 5B1IA 4D25A 2NUTB 3HVUA 4NF2A 4R7ZA 2CLLB 5EJ9A 1PGPA 4QU8A 4F06A 3AY0A 2SICE 3KEGA 4M9CA 4YUYA 1U5BA 1CY1A 5CLIA 2B3TA 2GAFA 3HZRA 2VDOB 4I8XA 4HQNA 1KQOA 1GZ3A 2W43A 1OB5A 3ZIDA 5IUKC 2JI4A 2EFGA 2XQIA 1SBQA 3ISJA 4P36A 4X44A 4C5BA 2GPNA 2OV4A 3IULA 1D04A 1P75A 3PF9A 5E0OA 3SXJA 4FDLA 1AK2A 1GYQA 2BKVA 2ZRFA 4GPEA 4J0IA 4MXDA 3AU8A 4J0DA 1LDNA 1SGWA 3SEZA 4CUJA 1C81A 3KZCA 4RELA 2HEGA 5C8YB 3QI7A 1NN0A 3BHNA 4DIKA 1KEUA 1JIQA 1ZO8A 4FOSA 2XAUA 1PL7A 3JAMA 5EJFA 1SXJE 2ODEA 4ZHQB 3GGCA 4ZI5A 2PM8A 4ZOBA 1OV4A 1VCIA 3N5CA 3TKLA 4GOKA 3BMQA 1A5SB 1RPJA 1N2HA 2EATA 5KSYA 3HXPA 2ZUVA 3DHWC 1CNFA 5EIEA 2A5DA 4EAAA 4RA9B 1ISPA 3ZZTA 5KO2A 4F86A 5E4JA 1BU5A 4KHPB 5AKXA 1VE5A 4AKHA 3N2KA 2R7MA 4QFCA 4RK6A 5JAQA 4Q3AA 4CU5A 3LBNA 4ZMRA 4BZXA 4BMXA 5BSMA 2BBSA 2GCEA 4GFDA 4BQPA 2VK1A 3PFKA 4R8KA 3AG6A 3FRHA 4KN8A 1PNVA 1P1IA 1QHNA 2YN4A 1LDEA 2E5FA 2HA0A 1E5XA 3C5HA 3L92A 4EB6B 1XTIA 4F2DA 4RKQA 2J5XA 4PLYA 4EPVA 2MDTA 1Y3CE 2GNOA 1Q7GA 3DDUA 2I87A 4DMGA 1BYUA 4UFOA 1C4OA 4QXPA 2GN9A 4NV0A 4RPIA 4YY3B 3LC2O 2P2LA 1N34B 1QHGA 5J1SB 1N3LA 4AKIA 1G41A 2JI8A 2O8EB 2XX3A 4Y6OA 4RHFA 1SUSA 3CLUC 4QOFA 2V97A 2FSPA 1E66A 1GCUA 1VZ2A 4OQYA 1RC1A 3MIIA 1VFPA 2LXNA 4TWJA 3BD8A 2IHNA 5JJKA 4GZ3A 2M6SA 5JDCA 2YRWA 1PZNA 3B1WA 1V95A 2FDRA 3OPYB 1Z06A 2IE8A 1G3RA 1LX7A 3A9SA 2ZB8A 3SC2B 4L75A 1CJTC 4Q7EA 1SXIA 3TR6A 3UTDA 1E8MA 4XTCS 1EVLA 2NVOA 3H0CA 2FWRA 1X7GA 3LX4A 2DMRA 4O08A 2P79A 4MARA 3ZGZA 2D5IA 3NZEA 2ZCJA 2C07A 4MYTA 1LLDA 2Q4TA 2WIBA 5JDCC 3EVBA 3HYRA 6Q21A 1QJCA 1TC1A</