1N7IA

The structure of phenylethanolamine n-methyltransferase in complex with s-adenosylhomocysteine and the inhibitor ly134046
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
261
structure length
261
Chain Sequence
b'AVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Molecular recognition of sub-micromolar inhibitors by the epinephrine-synthesizing enzyme phenylethanolamine N-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2002-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1n7iA00
2OB1A 4QTUB 2CL5A 4PGHA 2GB4A 2FPOA 2PKWA 4PYOA 4PYLA 3MCTA 2ZTHA 4LG1A 4C4AA 3EEYA 4IKPA 5DX0A 3LKDA 3HCCA 3BZBA 1JSXA 4RYLA 2ESRA 3B3FA 3TOSA 2Z6QA 1T43A 4LECA 5HIJA 3MGGA 4L7VA 1AQIA 2ZZNA 3FPJA 4GOMD 3FUTA 3OZRA 3PFHA 3IEIA 4RTJA 2PXCA 2VDUE 2Y1XA 1M6EX 3TMAA 3HCBA 3LCUA 1L3CA 3EPPA 9MHTA 5EZQA 5K05A 4M7RA 2BR3A 4E30A 2HNKA 3LHDA 1YFLA 3HVIA 3DLCA 2AOUB 8MHTA 3GJYA 4YUXA 2C7OA 1F3LA 3LGAA 2DPMA 5CCXA 3KPVA 4BLVA 5K0EA 2ZZMA 1OR8A 3SGLA 2GLUA 1VBFA 5K0BA 1SKMA 4GUAA 3M4XA 4HC4A 5FWDA 3SX0A 5GIOE 1XTPA 3TKYA 3GWZA 5LQKA 4E2WA 1BHJA 2IBTA 2Z6UA 1EJ6A 4B17A 2ONZA 1H1DA 3FPHA 5K0FA 4DCGA 3P8ZA 4Y30A 4P58A 4QTTB 5EKUA 5GM1A 4BP3A 2PT6A 4CKBA 3GIWA 4ER7A 4PGGA 3KQSA 5CVUA 5D1HA 2EG5A 3OFKA 1R00A 4OX9Y 3EVEA 3FPEA 1SQFA 4PYKA 5BP7A 2ZIEA 3EMDA 2AOUA 3SMQA 2BH2A 5K0GA 4QQKA 1MHTA 4Y2HA 1RI1A 1DUSA 2NXEA 2OYRA 5EHGA 4YV0A 1JQDA 2DULA 2IFTA 1XXLA 2ZIFA 3UFBA 2EJTA 4X1OA 3A27A 4RSRA 2IDKA 3EVBA 4E31A 2ERCA 4C03A 1QANA 2H00A 4QVGA 2ZBRA 3C6MA 5EMKA 5C1IA 1O9HA 1NBHA 2ZBPA 1JTFA 4OA8A 1Z3CA 3I58A 5DSTA 4E33A 4AZVA 4P7JA 5FHQA 2OXTA 2ZWAA 2JHPA 3ELYA 2PWPA 1QZZA 3CGGA 3UJAA 5EVJA 4OQEA 5EIFA 5GOZA 2Q41A 3P71T 5KQRA 2NP7A 1N7IA 2AOWA 1PJZA 3HCEA 5E1OA 3BT7A 3S68A 3NJRA 3GCZA 5LSAA 3P9KA 2PX8A 3B3GA 5E9QA 3T0IA 3TLJA 2AN3A 2V7EA 4BP1A 4IV8A 1BOOA 2AOVA 2IPXA 5DM0A 5IKMA 4U7PB 5E1BA 2FK7A 4DA4A 4FP9A 5HFJA 4CWAA 3I5UA 4U7TB 3QOWA 5GP1A 5U4XA 2FK8A 5ICCA 5GWXA 3GRZA 3EMBA 3LDGA 1VLMA 2PV0A 3IV6A 4QPNA 2JHAA 1NKVA 3ID6C 1TW2A 2NXJA 3GRYA 5C0OE 1NV9A 3X0DA 3GU3A 5HIMA 3C3PA 5LQUA 3LDFA 5DX1A 5ERGB 3HM2A 4CTJA 4YV1A 1JG3A 5T67A 1AV6A 3HCDA 1XDZA 1XJ5A 3C0KA 3LBFA 7MHTA 3LSTA 1L3IA 5EG5A 5BW4A 3G2PA 1WY7A 4FT4A 3SVZA 3HCFA 3FPFA 2P8JA 4GOND 5K0NA 4IWNA 1RJDA 5K03A 5DM1A 1JG1A 3FUVA 3TPZA 4RTQA 5KYGA 2A14A 3UA3A 1G55A 5EHIA 4YUVA 2O05A 3KPJA 2ZW9A 4KWCA 5CCBA 3CVOA 3DMFA 4HRAA 2UYCA 3NWEA 4PCAA 5FWAA 1L9KA 2ZFUA 3FUWA 4AX8A 3UBTA 3LX6A 1P91A 3FYCA 2ORED 3BWMA 1ZKDA 3P9NA 3MCZA 4YV2A 3MQ2A 5HOQA 2BR5A 1R8YA 4GF5A 5FTWA 5T64A 1UFKA 3OPNA 3THSA 2P41A 4AUKA 5ICEA 1M6YA 3KHKA 2JJQA 3KU1A 4XUCA 5DTQA 5LQCA 5C9ZA 5CD1A 3CBGA 3FTFA 3NDJA 1KYZA 2H11A 2YUIA 3HNRA 5K0JA 3PTAA 2IH4A 1AQJA 2V74B 3ELUA 5DLYA 3G88A 1ZG3A 4P7FA 1IY9A 2KW5A 2K4MA 3KR1A 2E5WA 2VP3A 1EIZA 3KQYA 4PYMA 3R9XB 2QY6A 3BGIA 1KPHA 1R6AA 3IYLW 3NMUF 1TPYA 4PNEA 2GA9A 4V0RA 2I6GA 3FUXA 3G5TA 3B89A 3HVJA 5P8WA 2CWWA 2ONYA 4E2XA 5K8VA 2I9KA 2XVAA 4HSGA 3A7EA 2FYTA 2XYQA 2ZVJA 1R74A 1KYWA 3T7TA 1AF7A 5FHRA 4GQBA 4F85A 5K01A 1EQAA 2G1PA 5LQNA 2CMHA 2P7HA 1P39A 3NVKI 2QYOA 3DOUA 3FZGA 3KQVA 3PB3A 1V39A 5GIPE 2QM3A 3LPMA 2NXCA 4MTLA 5CVJA 1G60A 4YUYA 5EMLA 1RJGA 3FTDA 4LWPA 3G7UA 5HEKA 2B2CA 3HA3A 4RTOA 2WK1A 3G5LA 2ZLBA 3R0QA 3DXXA 4HGYA 5DPMA 1X19A 1FP1D 1X1DA 2F8LA 2P40A 5KQSA 1G8AA 5EOVA 1FPQA 1WG8A 4FSXA 2XVMA 3EVDA 3EVCA 1VP3A 1JQ3A 2BR4A 3O31A 1VIDA 4HTFB 5G02A 3UJ9A 2PWYA 3CC8A 3BWBA 3ELDA 4MHTA 2CKDA 3EEOA 3OZTA 3JWJA 1EG2A 1YZ3A 3KR0A 2LD4A 3NW9A 4BLUA 4DCMA 1IM8A 4F84A 3LCVB 5DTRA 3KQMA 4FT2A 4GOOD 5FA8A 3E23A 5DT2A 3THRA 5JR3A 4HH4A 4KRGA 1YFJA 3DMGA 4CKEA 1R8XA 3P97A 4RVHA 3NDIA 3GXOA 1Y8CA 2CMGA 4KVZA 4ER5A 4P7GA 3JWIA 3I53A 5FCDA 4X61A 4RTKA 3B5IA 2GPYA 1SVUA 2FHPA 1JQEA 5ICGA 3LDUA 1WXWA 5H02A 2HMYB 5CIYA 1VPTA 4M37A 3V8VA 5LQAA 1Q0TA 4HTFA 2UZ4A 4C04A 3FRHA 2G70A 5GM2A 4PWYA 5MHTA 3FTCA 2AN4A 3KR2A 4PCLA 4PIPA 5BXYA 2NYUA 1RI3A 1O54A 2YTZA 2PX4A 3OFJA 2VDVE 4M38A 3NVMB 5DXAA 1X1CA 4RVDA 2IH5A 2FRXA 4WXHA 4XCXA 2PXXA 4EKIA 1RI4A 4X60A 5LQRA 3SSMA 3AXSA 4YUZA 2ZWVA 4KDRA 5K0LA 3DH0A 3DR5A 5EIWA 5GINE 3P2EA 2N47A 1ZGJA 3LBYA 4OBXA 3BGVA 3TM5A 2O06A 1QAMA 3ER9A 5EQJB 4AZSA 3TQSA 1KR5A 2IP2A 3BKWA 3JWGA 2P3LA 4MIKA 5LR6A 2O07A 3C6KA 2UYOA 4C05A 1JG2A 4FZVA 5DSXA 4R6WA 3HTXA 4DF3A 2AN5A 3FRIA 3M33A 3JWHA 1KIAA 3C3YA 3R3HA 2H1RA 3UJ8A 3O7WA 1NW6A 4E70A 2AVDA 2BZGA 2YXLA 4NECA 2O0LA 4WVLA 5FQNA 3REOA 4DQ0A 2PX2A 5ICFA 1XVAA 4DMGA 4GEKA 2P1DA 4KW7A 5EMMA 5F2KA 1DL5A 2JH9A 4ER0A 3ERCA 4KIGA 2Z6AA 4PIMA 2OY0A 2R6ZA 3EGIA 2IDJA 4RVGA 3KQPA 1VL5A 2R3SA 2EFJA 4QDJA 2IH2A 2EJUA 4PYJA 1WS6A 3OCJA 4C07A 1XCLA 1NW3A 4RTLA 3AY0A 3BWYA 2AS0A 1FP2A 3KQTA 4RV9A 1NW5A 5DTMA 5E8RA 2OPBA 1XCJA 4K6MA 3DXYA 5CVDA 3M6XA 2GAFA 1RJFA 3DUWA 2P3QA 2P7IA 4M36A 1RI2A 1KXZA 4RTMA 4PYNA 4PONA 4GC5A 3VSEA 5DWQA 3KQQA 3UZUA 4C08A 4E32A 5E9JA 5EKXA 3KQOA 3KQWA 5BW5A 2ADMA 2AOTB 1D2GA 2PVCA 4ER6A 2YXEA 1VE3A 1NW7A 4ATNA 1Q0SA 3R6TA 3PX3A 5E2BA 4OA5A 3R24A 3RIEA 1EJ0A 1XDUA 3A25A 4FR0A 1QAOA 2B25A 3GGDA 4X63A 1KPGA 1QYRA 5FQOA 2C7QA 3BKXA 10MHA 3H2BA 3HEMA 3A7DA 2NXNA 2QRVB 3CJRA 3FYDA 4XUEA 3TKAA 3GO4A 3AXTA 3NWBA 2B78A 2B9EA 2P35A 2PT9A 4RVFA 3B3JA 4C06A 3PFGA 2PLWA 4POOA 3GRUA 2WA1A 4EMSA 3TR6A 4PYQA 4FGZA 5CM2Z 2O57A 4O29A 3I64A 3PVCA 3MB5A 3ME5A 2GS9A 4CXMA 1B42A 4QVKA 4IV0A 1HMYA 2IIPA 4AZWA 2Y1WA 3F4KA 2AOTA 5DM2A 2HV9A 4CTKA 3KPUA 3NTVA 5DRTA 3EGVA 5FUBA 4KDCA 3P2KA 1I9GA 3MERA 5CUQA 3AJDA 2NNWB 3GNLA 3OE4A 2PXAA 3UJDA 1RJEA 2QRVA 3DXZA 3HA7A 4BY9E 1X1AA 2GH1A 2OO3A 4R8SA 5E8JA 3K6RA 5EGSA 3P9IA 3OE5A 2ZZKA 3HA5A 3K0BA 5T6BA 4RTPA 4X41A 1MJFA 5DRYA 2G71A 1SG9A 3E05A 5B1SA 1JG4A 5F2NA 4R05A 1VQ1A 2JG3A 5CVEA 1NBIA 4XUDA 3PS9A 2ZIGA 5EEGA 4G56A 3L8DA 4R8RA 4A6DA 4ER3A 1FBNA 2UYHA 5DXJA 3FTEA 3LL7A 4UOEA 2XYRA 3GRVA 5FADA 3OZSA 2G8NA 4OQDA 5EPEA 3SR4A 2C7RA 3ELWA 5KVAA 4V0QA 3LKZA 1TW3A 1D2CA 1RI5A 1L3BA 4ZTBA 1SQGA 1G8SA 4GC9A 3CJQA 3G89A 3TM4A 1INLA 4YMHA 5HIIA 4P7KA 4DM3A 5HZMA 2JHCA 3SM3A 1PRYA 2FCAA 5HIKA 2PY6A 3G2OA 2PGXA 3ER8A 1HNNA 1F38A 5M5BA 3SSNA 3OU7A 2AOXA 1EAMA 1SUSA 2OZVA 2PSSA 3LECA 1U2ZA 1BKYA 1IXKA 1ORHA 5CVVA 3QV2A 2AR0A 4GOLD 3CCFA 4AZTA 5E1DA 2QE6A 1P1BA 2HTEA 3G8AA 1ZHFA 1WXXA 3MTEA 5E9WA 4F86A 2BM9A 3OU2A 3T7SA 2B3TA 2I7CA 3Q7EA 1VP9A 3PX2A 1YF3A 4DKJA 4MWZA 2XYVA 3G8BA 3M6VA 1ZQ9A 4RTSA 1WZNA 3B7PA 4R6XA 3UJBA 3KPYA 3KR9A 3SXJA 3CJTA 2PX5A 1KPIA 1L1EA 4RX1A 2YQZA 3MTIA 2I62A 1G6Q1 1SUIA 3EVZA 5E2AA 3VC1A 5DX8A 1KP9A 5FA5A 1O9GA 2AVNA 2OBFA 3DMHA 2G72A 4DZRA 3ORHA 3UJCA 3DLIA 4QDKA 2IBSA 2OB2A 5HILA 4FSDA 1P1CA 1JR4A 4PYIA 4KIFA 4FS8A 1DCTA 5EEHA 4RWZA 1I4WA 2HWKA 1R18A 3AWIA 3EGEA 1N2XA 1YB2A 3KKZA 3M6UA 3MAGA 4CKCA 2ZSUA 3TRKA 5KS2A 4RTNA 2VDWA 2OKCA 5E1MA 1NT2A 5LQJA 4OBWA 3E7PA 5FULA 2BM8A 3BWCA 3GRRA 1BC5A 3UJ7A 4EK9A 3DTNA 3DULA 4HGZA 3FPGA 5EZSA 4BLWA 3PLAE 4QPPA 2VZ9A 2YR0A 4ISCA 2VS1A 1XDSA 2WA2A 5D1NA 3IHTA 2IGTA 3ANXA 1ORIA 1JSZA 2YXDA 3EVAA 5DM4A 1KHHA 1X1BA 3Q87B 1I1NA 1NV8A 1QAQA 4PINA 3G2MA 5EMJA 3HVHA 4EVIA 2HR1A 3M70A 3P9CA 5K0CA 4MQ4A 4JXJA 3M6WA 3UA4A 3T7RA 3D2LA 3I9FA 4H0NA 5F2OA 1G38A 2PBFA 3FUUA 5EC8A 5K09A 3WSTA 1YZHA 2YX1A 4QQNA 4HG2A 3QOXA 3DP7A 3RODA 4RTRA 3GDHA 2UYQA 1ZGAA 3LCCA 1N7JA 3BUSA 3KPWA 2ZBQA 1FJXA 3PT9A 3BGDA 3P2IA 3V97A 2NP6A 1NE2A 4EKGA 1D2HA 3VC2A 3TFWA 3G2QA 4A6EA 4E2YA 2C7PA 2ZCJA 2JH8A 4Z2YA 3UJ6A 4LWOA 4YUWA 1YUBA 3E8SA 1JTEA 3BXOA 2EX4A 2YVLA 5JUWA 3EVFA 3OU6A 1NW8A 2ZULA 3A4TA 3HVKA 1UWVA 2P3OA 3SSOA 4E2ZA 4EQZA 4YMGA 1M0EA 3CKKA 3A26A 3EVGA 3O4FA 3HP7A 2XBMA 2AZTA 3UWPA 4GBED 2PJDA 3MHTA 1UIRA 3RW9A 3U81A 3HCAA 5IH3A 3VYWA
chains in the Genus database with same CATH superfamily
3IULA 2I33A 4GEGA 4PGHA 1UBLS 1C0LA 3DEAA 2IOYA 4IZIA 4KNYA 2IOQA 1FTQA 3KE8A 3IERA 2JLSA 4PZYA 1YK0A 1IUPA 5CG1A 1PT6A 5EI5A 3ANLA 5JD6A 1ONNA 4O5AA 1G1AA 4O2BA 3WL7A 4ZOQI 3K9BA 1T24A 1W0KD 3MFYA 2GETA 1Z16A 3IAM1 1F0KA 4GRDA 1T13A 4ZI7F 4CEIB 3CR7A 4WESB 1UT6A 1YQEA 4EY3A 4C4TA 2CJXA 5LD2B 1BW9B 1L4MA 4AG3A 4D9BA 2HF9A 6REQB 1G5HA 2AX4A 1MQAA 1OIWA 2C2BA 4INZA 4MLZA 3D3WA 1KJ8A 3F6YA 1NBME 2R5WA 4KL8S 2NPFA 1HSZA 2QTLA 3STTA 3FIJA 1GVNB 4R1MA 3NFYA 5FEMA 2C2WA 3L01A 2Q2NA 4TXNA 4HC4A 4AECA 4CMAA 1XTPA 1GL3A 1YFKA 2W8ZA 3CBQA 3R3XA 4C0QC 2LV8A 5BQ5A 3BXZA 1AE1A 3AHDA 4ZT6A 1EJ6A 3JSXA 3TXAA 5ISMA 3O3CA 1VRWA 1TNDA 2PBRA 2FSPA 3PNQA 3QY0A 4RDIA 5AKGA 1Q7CA 1W581 4I1UA 4K1LA 5A4AA 5I6DA 1XA4A 1TUIA 2QSUA 3C15C 3PQ3A 1G8YA 2O8FB 4AL4A 2E48A 2J5BA 3NM5A 4JVOA 1R0XA 2HC9A 5FI1B 1V47A 2IP4A 2HU5A 2DULA 4TQ9A 4GE0A 2YNMC 1Q6ZA 3T9AA 2I4TA 1TYBE 2DF8A 2JC3A 3RQIA 2O23A 4QBTA 2OE2A 2EF0A 3WTBA 3O95A 1F2DA 5AJWA 1DWQA 1NRIA 3BBPA 4V0NA 3A2LA 3K72B 1FMJA 4RLSA 5EMKA 4CDMA 2RB4A 2WOOA 4ZREA 1Z3CA 4WXEA 2CXSA 3RGWS 4AYXA 3O8DA 2O7QA 4UVDA 4DGSA 4PPFA 4XWAA 5FNVB 3UMSA 1QGDA 5SV2A 1XNHA 1XO1A 1O2DA 1N7IA 3GFQA 2NP7A 1EU1A 5EXDA 1T3ZA 2ENWA 2ZIXB 5JS1A 2LVBA 1I36A 2ZBDA 3ESBA 1EB9A 2GPNA 1E59A 3R5HA 3T0IA 1RXVA 4J03A 1QTRA 2JLBA 5GV8A 4EA7A 2JFHA 4PZCA 4B09A 3JPWA 3MAJA 1QYWA 3GI1A 1FVXA 4KU4A 4YALA 3AJAA 4FD2A 4L8WB 5T3YA 1B6GA 4DBLC 3HWWA 4BVAA 4QICA 2MSCB 2FU5C 3IAM6 2R6CA 1HQDA 2UAGA 2V6BA 3JQDA 4IZOA 2O50A 3LF2A 1P7YA 3RYFB 2C5AA 4JZYA 2Q9CA 1KQOA 2NO1A 1DAFA 3SP1A 3U0BA 3ADDA 5JFTA 4W5TA 2WAMA 1VL8A 2WPDA 4L4RA 4OLJA 5ALHA 5ERGB 2OFWA 3RRFA 1VE7A 1JG3A 1XTZA 2UZ3A 2XITA 2WF9A 1WOMA 2WILA 4UUBA 3A9VA 2CNLA 4CT4B 3C2QA 1IVSA 3MM4A 5DYWA 3R5XA 3WLSA 3A11A 1FTWA 2P8JA 1Z83A 2ZJ6A 1S2DA 2XCSB 5DXFA 1J42A 4O4HA 1XJQA 3R5KA 3OBIA 1FW8A 4N7BA 4ZWNA 3S2SA 4TGLA 2A14A 3J81A 1X14A 1G55A 2J33A 2V6IA 2CE7A 3JQ6A 4WFKA 1XD2A 3IQDB 1BWQA 5KWSA 3G2NA 2NX2A 4PCAA 3N7TA 3ZWMA 5H3CA 3PGKA 2C04A 4YXWD 1D4FA 4O25A 3VVMA 3QV1A 4MARA 1IDN1 1R8YA 1R8SA 2I3DA 2PA0A 3DWEX 4S1NA 1CETA 5CAEB 3UWDA 3L6CA 1T1RA 5BUZA 4PGFA 1WABA 2AE1A 2DBZA 3HSYA 1X38A 1RWVA 3H83A 4ZRMA 4LKRA 2CJFA 2YJNA 1PBTA 3PXEA 1TZCA 4ALMA 3E48A 3KBBA 1LI4A 4BRSA 1AQJA 4EP1A 3SLKA 2XJ9A 1GQSA 5K0SA 4JLDA 1JAZA 2Q4TA 3TSZA 4W1PA 3KR1A 4BO5A 1N2SA 2BFBB 3IILA 5H3LA 4X54A 5KREA 4S1TA 4J2TA 4JLJA 2YFHA 1T0JB 1TLLA 3TD6A 1ZVQA 3NUZA 2KS6A 1YIOA 3IYLW 4YQZA 2X19A 1JFFB 3T35A 3I6IA 3M6IA 1YT5A 1ZL0A 4HAIA 2CXNA 1USUA 2FWAA 1XDGA 2W2PA 3GLIA 1HT2E 1O6ZA 3F71A 3AZPA 5AVQA 4QXAA 2CKMA 2C1XA 4J0DA 5LU9A 2GD1O 2NSHA 2GUWA 4ZAYA 3E53A 5TEVA 2B5WA 2EIXA 4LYHA 1U63A 1F2VA 3KZ1E 2BGMA 2CMKA 4MMZB 1VHLA 2L2QA 1C0KA 2VYQA 1E6UA 1OTHA 1XZMA 2P9JA 4OBBA 3DEJA 2PH3A 1DJNA 3ESCA 1V8PA 2KMLA 5TPWA 4IOJA 4DRZA 4ZO6A 1B8UA 4TYYA 3PNYA 1R0CA 4KLNA 4XQ9A 4DA8A 1IVNA 1CJMA 3PI7A 4IDEA 3DYVA 2DJIA 3PUKA 3B5EA 4NCKA 2CLFB 3NTRA 3R0XA 1XUOA 1JQ3A 1I3NA 2PEZA 2CVPA 4MZDA 2YWBA 4YTEA 5KTMA 2OHOA 1X0XA 3ELDA 4WXYB 3ISTA 4NNPA 4NMMA 2E7ZA 4HQOA 4KACA 1KEEA 2YHBA 1CRWG 5AKXA 1NXWA 3LCVB 4OLFA 1Y3AA 3CHYA 3DMNA 3FWNA 5DT2A 2BMWA 3RS8A 4CFZA 5IYZA 1UC8A 1PJ4A 4UAUA 2O48X 3V32A 3BL8A 3CUEF 4RA6A 1Y8CA 5F64A 4F2WA 5DYTA 4F8EA 3EFEA 4YCAA 3S70A 4C7KA 3J7TA 3IESA 2W4IA 4BDTA 1PEKE 5JH7F 3FDXA 4JKIA 5KQLA 1A1VA 1EX1A 4TS4A 1SUAA 2HF2A 2RHHA 4KE8A 4L0MA 1L7EA 1PR0A 3KZKA 1U6IA 5AKHA 3U9SA 4DAEA 3GLFE 2P2ZA 1WXIA 3N9IA 4DLRA 3IB6A 3FHLA 2A1IA 1CZLA 4B5LA 1C9YA 4I5EA 5A71A 1LDGA 3L8FA 2G70A 2K2WA 3FNFA 1GNVA 2DSNA 1TYAE 3FTCA 1MT3A 2H2DA 4H77A 4A3SA 1RKXA 3YASA 1HM5A 3OQVA 3RVPA 5DNUA 2CMDA 1STOA 3UCEA 1LK7A 1WXHA 3BK2A 2X8JB 1VE6A 3CRMA 4M38A 3HB0A 1IULA 2Q8NA 3NVMB 4LAFA 1YQWA 3KK0A 4WZBB 4EMBA 1JHUA 1XRSB 1OXTA 1T9HA 2I3BA 2NOAA 1K08A 4KHPB 4KTTE 2QM7A 3UV7A 1ZJ5A 1ZC4A 5CG2A 3AXSA 4JITA 3TLGB 4R0VA 3BJEA 3V4OA 1FDWA 4AM8A 4M7OA 1IRXA 1M2JA 1Q0ZA 2Y1OA 4TT3D 2A7XA 1WRBA 4D1YA 1DXHA 4F9GA 1N6IA 1QZ3A 1R0RE 2AKAB 3OIUA 1Q77A 3VNRA 3TXYA 2WIDA 4F4UA 2IP2A 3P96A 2HZBA 3I6YA 2QZ4A 1DQZA 4IM7A 5CX1B 1MG5A 1BEEA 5AR1A 2BIFA 5F9MA 3VPFA 5AM2A 1J0BA 1GR0A 1Z0FA 4TLMB 2XMSA 3HI6A 2V0GA 1G5RA 2CF6A 4LCEA 2BGWA 5AJHA 5H8WA 1OROA 1AXEA 1VHWA 1XTIA 1SKUA 1F8FA 3KCNA 1Y1LA 3HPRA 3L8HA 3Q7QA 3UICA 4HS4A 1WV1A 4IKEA 5JXHA 1C4KA 2EARA 3D31A 2BTEA 4A10A 2H6EA 4HQFA 4BJ1A 3N3BC 3G0IA 3BOSA 4H7EA 1LQUA 1ZU4A 2ZXEA 4YN3A 3PHBE 4AP5A 3NIWA 3BCRA 2BISA 2DFPA 2HLDA 2JATA 4PBRA 2C5LA 3C8ZA 4I4TF 3RSLA 4EZIA 1P75A 1B1CA 3P2YA 3KVNA 4HVAA 4PHGA 2GD2A 3BJMA 1JEDA 4YRTA 1IBLB 2GFQA 1BXKA 4LRTB 4RPKA 2W2MA 1JDSA 2JZOA 4B3MB 4EW2A 2GDJA 3L6RA 1L4LA 4I55F 4Q4DA 5EYPB 2EWMA 2IPOA 3W5SA 4FWBA 5F98A 1SQSA 3ISJA 3LX4A 4MS1A 2VBFA 3R1IA 2D0IA 3PIRA 2W43A 1ECLA 4LBVA 5EKXA 4WLOA 3T06B 3DYIA 1UXKA 3KYCB 4BB9A 1LI5A 2NZ2A 3DJFA 4PQGA 1CQJB 1NW4A 1U0HC 4WA8A 1XAIA 2IV2X 2ZPUA 2NO5A 2AQ8A 1QFZA 4HH3C 4Z1OA 5JH7B 4OQYA 3HB7A 1ULBA 1BU8A 2QTWB 4EPTA 4L85A 4CMBA 2D1SA 1W5FA 4J3FA 1K8QA 2HIHA 1NBEA 2P35A 3CO0S 4UEJA 3DEYX 5LN1A 1KJJA 1WF6A 1PN3A 1KDOA 1WB4A 2DKFA 4UTRA 5AVTA 2ZJ1A 2XTAA 4UUMA 3KL4A 5DLEA 1VJ5A 2HCBA 1YS4A 1AUVA 3OZVA 2I22A 1W48A 2XD4A 2YDYA 4P1ZA 2A30A 3PZRA 3MOGA 1L5LA 2EW8A 3TX2A 3TW4A 2QX6A 1ZD3A 3QYAA 2P4SA 1BQ3A 3FR8A 4BX9A 4H1TA 2V9CA 4AKHA 1XAHA 5CU7A 3R9WA 1FFHA 3PSHA 2ZUSA 4IICA 5KJFA 1EVEA 5JZOA 2GTIA 1XK7A 2ONCA 4FGUA 4PC2A 5A04A 4URXR 1LPAB 1NX9A 1E2DA 3A32A 4WN9B 1E69A 1NR7A 3QELB 1ZJYA 3AESA 1UBGA 4WGGA 1Z37A 4MRMB 3DM5A 4UBMA 1O4VA 3I2HA 4FGLA 4YJ2A 1FFXB 1PV4A 2WG0A 4FW8A 3BMOA 3NHBA 2HA4A 4BO3A 3R7BA 1Z5WA 4R51A 1DBRA 3EFOA 5KCMA 3DHVA 1JZSA 1TJYA 4N6OA 4NFHA 4BRWA 5AM1A 2VA8A 4YASA 5KKAA 1X2EA 2VPYA 5FUQA 1E0JA 4MYRA 2ZIGA 1M1YA 3SZRA 2JI8A 2OV2A 2ZKIA 4G56A 1U0BB 4S1PA 5GQSA 5JNLA 2UYHA 2DQZA 5ABPA 1BWSA 3LL7A 4LXIA 3VZCA 2BTOA 4IXMA 2B0CA 3T7IA 5DEOA 2JNWA 1DKRA 1EQ2A 3E27A 2NU7B 3B36A 4B3DA 1WBDA 4HYEA 3ZWCA 1QUEA 3TEFA 5HM6A 3LKZA 5FUWA 1KIFA 4FI3F 3D7KA 4HDRB 4KO8A 2HXYA 4NAUA 5IKEA 4WK6A 4B48A 4DNQA 5J4VA 1SUCA 4I4TB 2QQEA 4AJKA 2H7CA 3FJYA 1A88A 1R0BA 3MJDA 2FAXA 5B7QA 2V7TA 3BH6A 5HIIA 4AJNA 3FKSD 1ZJZA 1SRQA 3MWDA 4UDXX 1DIGA 2CWDA 4I55B 3IUPA 4IMRA 1F38A 3TPCA 3NTUA 1RKQA 1IHPA 3ER6A 2CNWD 3IP1A 5BUSA 1Y5LA 3O8CA 4RZSA 1CF9A 1CS0B 1IWOA 1RM3A 3EC1A 3LECA 1QCDA 1BKYA 3P4YA 4JVMA 4N65A 4BV2A 3HJNA 1XP8A 5AW4A 3DB2A 3KQLA 3RVNA 3ZJUA 4YAKA 1ZHFA 3MTEA 4V0MA 2OQIA 2O3SA 2V98A 3T1VA 1B15A 3V1TC 3W9SA 1GPAA 3DDWA 4JB0A 4COOA 3T6KA 4H7HA 3SBEA 3WADA 6Q21A 4RMIA 1EXWA 2BGIA 1U2GA 2P5UA 3TEJA 3QLVA 1CT9A 2O8CB 4K2HA 1U0JA 3B7PA 1D4AA 1XF1A 1T9GR 2KE5A 3R77A 4N40A 1ZHHA 5TSDA 1OBCA 1H93A 1E1NA 3A1WA 3QKRA 5E2AA 2R96A 4F1KA 1H65A 1EFVA 2AVNA 1W5TA 4PAOA 4FCTA 5HILA 4OP3A 3A14A 3IMCA 1RP7A 1VZ3A 4HV4A 2Q3CA 2UVPB 1XZJA 2WVJA 4FFMA 4JWKA 2A78A 3KKZA 3KU4A 3COJA 1IQUA 1Z0ZA 4KH1A 3HACA 4OBEA 5KNLA 1E9DA 5C37A 3PC3A 1V9SA 2G07A 2JLYA 1QX3A 2F48A 1P3JA 2A5FA 5LXTF 3UJHA 3TNLA 2FWIA 3QEOA 5K3FB 2WDPA 4HN4B 1OC4A 1RMYA 2ZIWB 4C20A 4IPTA 4HAWA 3WLOA 3D1LA 5D01A 4EK9A 2GNAA 4ZYXA 4BAGA 1D1TA 2WA2A 5DM4A 5DEIA 4MCAA 4XDGA 2XNJA 1IBSA 2HQSA 2V6GA 3DKKA 3H1PA 2OC9A 3WIBA 4XD2A 2NTEA 1U1DA 4XVUA 1HMPA 3MTGA 5DBFA 2FPKA 2XPCA 1UXJA 3AI3A 3GA7A 2Q5IA 3GG2A 3FOAA 1YU6A 3WNVA 1FFGA 3LY5A 3X3HA 4B47A 2YHIA 2J9FA 3AGQA 3DQQA 3T34A 4QQNA 2RHJA 3NHKA 2R2GA 3LCCA 1KJZA 2HEGA 3BB3A 2NO0A 4EG7A 3A2KA 2FEAA 3S2YA 3V1MA 4UOZA 2DR0A 4G9GA 3PJFA 1OZAA 3AEQA 5AUQA 2J7PD 1A3CA 3JALA 1JJBA 1JQJC 2FMTA 5I5EA 4FSHA 5BR4A 1JTEA 3BXOA 3VSDA 4MWDA 2WM9B 4OHFA 5BWNA 3HDYA 2ZULA 3AF6A 3T3NA 4M6WA 3O4HA 3DLPX 1EVKA 3OIDA 4KR6A 4GMFA 1MQSA 2WYVA 1JI0A 4LJKA 2VXBA 2P5TB 1GA1A 2IWHA 1TRHA 4NAHA 2ASEA 4KQJA 1GRRA 4TVKA 3T5TA 2WJAA 4KBYA 5JAUA 1JDVA 4XD7A 1Y9JA 1KF0A 4PYLA 4PLVA 3S99A 4Q15A 1U2GC 3B85A 4MRVA 4NRDA 3LKDA 1ESMA 3WA6A 4RU1A 3PE3A 3ZWNA 4EGSA 3LV8A 1DADA 2OCAA 4JLSA 3QQPA 4EHFA 4WECA 4W5NA 4ZVTA 5TB5A 1DAPA 1CE8B 4WWHA 3IIEA 4WJLA 1TB4A 3PFHA 3EVTA 2D13A 4RTJA 4LW8A 1B2LA 4ZRDA 1CD5A 5CNKA 4Z9FA 4CM5A 2YY7A 4DLTA 3IAUA 5C8ZA 4NYJR 4L2IB 4Q93A 3LHDA 1XK6A 4YBRA 1E64A 4MI6A 5FBQB 3OUUA 1WLSA 3SYTA 1XZQA 5HW0A 1YO6A 2J5RA 1MENA 1PEYA 1NMZA 1BVRA 2QUHA 3PWKA 4PY2A 4WTOA 3A04A 4Z8YA 4E46A 1G21B 1RYHA 4JODA 5BN3A 1MEEA 1BZYA 3GFOA 1FMFA 1GSOA 1DEXA 4KGDA 4QDTA 3RANA 1QRTA 3AEXA 2WIBA 4L9SA 5LXTB 2D1RA 1NVEA 2PWAA 4TWZA 1X3LA 3BX1A 1KY2A 1V96A 1JX6A 2EW2A 1PAUA 2AG6A 3FZNA 4KO3S 4PVCA 2O8EA 4NENB 1HYBA 1QORA 1BVHA 4EI2A 3V6MA 1TYCA 3E7DA 2OHHA 3WDMA 2IZ0A 4KB5A 3DDSA 5JPIA 1I10A 2AGVA 5K45A 2BFNA 3H9QA 4H9GA 3IBGA 1QQ5A 3CA8A 3MINA 4IS3A 4MO2A 3K5WA 3NXSA 3OCWA 1GKIA 4KLZA 4QQKA 3HZHA 1P9NA 4NFYA 1XU9A 3W4KA 3OZEA 2P5SA 4B4WA 1N57A 3JW8A 5KYWA 3DZKA 4I9NA 3OFND 4IFEA 4EL0A 2GEUA 3FRJA 4C03A 1QANA 3BXHA 1Q0QA 4KXNA 3ZWAA 4U2GA 3PC2A 3C24A 4LJ5A 4KAXA 5HMMA 3KFXA 3DSRA 3NWJA 1W4BA 1ND5A 2LIVA 3NH9A 5DSTA 1OIXA 1WR8A 3I2GA 5ESDA 1TLFA 1WU8A 3WHIA 4ZT3A 4BAUA 5IABA 2EKZA 1VJ1A 3I6QA 4YI5A 4MUAA 5DASA 3K20A 2A9OA 2ATIA 1I2CA 3KB8A 5HJ5A 1PJAA 4YRCA 5FKJA 3ZDZB 2JIMA 3QY9A 2OWEA 2C4MA 5K6RA 1K68A 3V4RA 4INPA 5TQ0B 3U4QA 4ILKA 4IV8A 3O4GA 1PL6A 3EFHA 2EQBA 1UKAA 5GGYA 1K5PA 2XCUA 1SAYA 4FYIA 2Q1UA 4QLOA 4V0SA 3LUKA 4MS4B 1SR8A 5ARDA 1QHNA 1CY2A 3RKSA 1WCIA 4PQYA 3A6HA 5E6RB 1RAHA 3RS4A 2QP9X 3T61A 5DCYA 5AHRA 4A26A 2MCFA 1F06A 4RK7A 2L18A 5C0OE 2NXJA 4K05A 2IXFA 1W85B 4RANA 3UJCA 2WTUA 2XOEA 2ROQA 4ZA2A 2XXAA 4Y7DA 3O4VA 4UREA 3TZEA 3KKNA 1NYTA 3OZAA 4A8TA 3T7JA 4Q48A 4FNGA 4FBMA 4R4JA 1H0RA 3MCVA 1MJHA 3LSTA 5EG5A 4IIXA 1QIDA 2YXNA 1NN1A 1Q5PA 2ZR7A 4QPCA 2HF7A 1LKZA 5K0NA 1EFAA 1R0SA 1KKLA 5ED4A 2Q6OA 3M2PA 3SJ7A 3SVTA 3KHSA 5EHIA 4AJ1A 2C0PA 4WVFA 4C5AA 2A5YB 3KALA 3EPHA 2CNKA 3DMFA 3TRIA 1FDOA 3GQVA 4WSOA 4RH3A 5CLGA 4Z9XA 1DVRA 3ZHVA 3M5CA 3SYLA 4ZYUA 2QJFA 2J07A 5CT6A 1C7ZA 2BR5A 3HFRA 5I8ZA 4BPBA 4MRSA 3NC4A 5LB4A 5TVKA 3R7AA 3UV3A 1SHLA 1M6YA 1N25A 1TIKA 1L5GB 5LQCA 3FVWA 4R9NA 2HTFA 5GV7A 4D42A 1E96A 2YUIA 3PPIA 3TXXA 1JPUA 4OUKX 2F1HA 1A97A 2FLKA 3ZE6A 4H7DA 3EEBA 3EDCA 4MV3A 2ECPA 5D2CA 3TSOA 2VDJA 3TNDA 4QUGA 1H6DA 5EFZA 1QJCA 4NNJA 2JFGA 4K3VA 2QY6A 5H7XA 2RI1A 1R6AA 1Z0IA 3KJIA 4BMPB 1DAEA 3GEMA 3PGA1 3QU5A 3D4PA 4Z0PA 3AF3A 4TN5A 2ONYA 4E2XA 4EO7A 1NFFA 3STUA 1MQ9A 3OJOA 4UTZA 4LYAA 1FFYA 3CYFA 5FORA 4MB2A 4PO1A 4P2BA 4JBHA 2FXVA 5LQNA 5CURA 2B6HA 1LTQA 3H6KA 3C85A 1FS4A 3PB3A 3IE2A 4XM2A 4G63A 4RE6A 4A0FA 1B1AA 1RM0A 2PLFA 1T4MA 3B1XA 4DLAA 4C4YA 5AW5A 4Z3OA 1NMSA 4ZVPA 5I7HA 4HGYA 1A5ZA 1P81A 1SHZA 3GJ0A 3WIVA 1FSPA 4CNBA 2D7CA 2GQ0A 1NSYA 1Z17A 2GEBA 4NATA 2FN4A 3OZCA 1V71A 1Z0AA 1NRJB 4G2NA 1HDXA 3KJQA 3VUEA 4C1BA 2GJ4A 2AJCA 3LOQA 5IBPA 3AL0C 2EQ5A 1RQRA 3CZ4A 4LHXA 5HBRA 1LRJA 4DCMA 4JJGA 3WL3A 4QXRA 1UBKS 4OSEA 1YRBA 4NQZA 4MK4A 4RFVA 1E2EA 2I4RA 1CUCA 3AEUB 2WZQA 3ILYA 4WZAB 5BV8A 1KGDA 1L7QA 2AUNA 4YRIA 4Q34A 2EGUA 4I46A 4OYHA 1LDMA 2B9VA 4J0GA 3TDKA 4QAQA 4ER5A 3KQNA 4IF6A 1SVOA 3DQZA 2Q5EA 2B21A 2BFDA 3PHCA 3PFFA 2BI4A 1V5FA 1ZC3A 1GRQA 1GG2A 4HGRA 1EFPB 1EKXA 3MCAA 4NHOA 2HMYB 4NWIA 3RYIB 3HGMA 3SBOA 5DGTA 1THZA 2UZ4A 1YHNA 4C04A 2NU9B 1UR5A 4IX9A 4MS3B 1A8QA 4LCBA 5JC1A 4BNDA 1KO7A 2HFKA 3PUWA 2H5EA 2R84A 2VHXA 4NYMQ 4OUDA 5H3HA 5L3ZA 5LYJA 5LOVB 3GVXA 1T2NA 4MEAA 2VDVE 3WO1A 2XB2A 3H8SA 5DNDA 3MMPA 3CVVA 4LDRA 4DSUA 4JP3A 4G86A 1L5KA 2G0NA 4XWKA 3QKWA 4MR9A 4Q4CA 1NM5A 3GJQA 3M5DA 3PD1A 2WLTA 3SSMA 1PNQA 1M1YE 2PRJA 5K0LA 4LDPA 4LRWA 4J49A 3DL4A 3TYXA 1GRVA 1E66A 1Z73A 1QIJA 3WDSA 3BGVA 1LI7A 1W88A 3KSUA 3MSCA 4Q1BA 1RLTA 5BQPA 3LJKA 5EHNA 3NNSA 2V4ZA 4M1MA 5HRAA 1G18A 1BMFA 2IC5A 2JAUA 4IIVA 4MQEB 5LA6F 1AQ6A 4ZQEA 5ENVA 3RTGA 2UYOA 1E98A 3K9HA 1I9CA 4FYJA 5JCPA 2DQKA 4CLOB 2EW1A 5AP9A 1P9WA 1RZRD 2F3UA 4UHEA 4MP8A 1G7TA 4EEXA 2IOFK 1A2BA 1K1EA 3CX6A 5LLSA 3M89A 4ZVRA 3LFUA 3QIAA 4WVLA 1RKBA 3SIXA 4JOBA 4NU8X 5FOWA 3TO5A 2N1MA 1H4QA 2QR5A 2IPLA 3B1KA 1I1OA 3F9RA 2OXIA 4HNVA 3TSYA 2VT3A 4OXRA 2O0MA 1W0JD 2WUFA 1QOPB 2P4QA 1JR3D 3E9QA 3QEMB 4G5GA 3V4VB 4XFDA 4WOKA 3ZJTA 2Y4NA 3EGIA 5EP4A 4G5RA 4AU1A 1W5BA 3NAZA 1WS6A 3QH4A 4K88A 3REQB 3ZCXA 4MO9A 4BMCA 4CIYA 1DQRA 1W5AA 2C07A 4V0ME 3TQTA 4R41A 3JATB 2ZQ5A 3KQTA 3L0ZA 1UXOA 5D6OA 2XDYA 4TV8F 2B30A 4K6HA 2I8CA 3T7AA 3TH5A 5F1YA 2C54A 1IZ0A 2X9QA 3IDAA 2NTNA 2W6JA 2Y2UA 3L4SO 3BQMB 4RMNA 5IT5A 1L4GA 2WHPA 4GC5A 5TF4A 3QE9Y 4IV5A 1Y6JA 4GQIA 1UBMS 4D9NA 1KS2A 5HUQA 1C14A 1UT8A 5FI5A 5IAKA 3EASA 3AHJA 1JKXA 4S04A 3ROGA 1SQ5A 5E2BA 2AG5A 3WMWA 1KJWA 3FZYA 4A15A 4RY9A 5IHPA 3ZXIA 1Z0JA 1M1NA 1F8YA 3B51X 4PW0A 2C7QA 1IQPA 3FF1A 3IKMB 2HRQA 1E2IA 3QQ5A 1E4VA 2PT7A 4O5OA 1ODIA 4H3KB 1UM9B 4TLEA 3UCXA 1FK8A 1Z4PX 1AKTA 5E6UA 1NVTA 2PNFA 3V4PB 2PLWA 2WU8A 2FPIA 3OY2A 4EJSB 4F6RA 2EZTA 1MVNA 5F52A 1UBRS 4FCWA 4Y0VA 5IARA 1I1QB 2QW0X 3TJZA 2D5BA 4MMYB 4BMYA 4H6XA 5C8XA 4BRUA 1BDBA 5JADA 1RHRA 1N2GA 5JE8A 2H1HA 1FX0B 1V11B 2Y1WA 1NM5C 3QXSA 3F1LA 4ODIA 4ZQGA 2YIJA 2GNOA 1X1SA 2VRNA 3IKLA 4WFIA 4XH9B 4KPFC 1WSAA 4U00A 4CCSA 4CLHA 1GQYA 2NZUG 4WD3A 4BO2A 3AMVA 3RADC 1G19A 4WLVA 4IIEA 1OKKD 3NRJA 4EGCB 2ORVA 4QAJA 1VIMA 1N2CA 1IK4A 1B74A 2IEZA 3MPUA 4S2UA 5EGSA 3TW8B 3A36A 4NI5A 2VP4A 2OFPA 1X7WB 1ZX1A 2QN6A 4MGZR 2ZZKA 4Q37A 2D74A 5A6SB 3Q40A 4D98A 2JGIA 4G84A 5EJ7A 3BD8A 1M8JA 1TDJA 4LXGA 2OCBA 3MWGA 5ILQA 1K97A 2XT6A 3RK4A 1IPFA 1RAIA 4IGFA 4Q66C 1KFCB 1UBNA 5CVEA 2JG3A 4ZYWA 5BQXA 2Q6KA 2PU7A 4MAAA 4FFDA 4AVYA 2Z5VA 4JR0A 4PX9A 5BSGA 5JNSA 3C8UA 1XL0A 3K1TA 4R9RA 3SJZA 1E8DA 2YASA 4ND8A 5FA6A 1NI4A 3UMFA 4G81A 1QIEA 1SCIA 4Q1AA 6ABPA 3ZDQA 3TINA 4TTQA 1DJPA 2WF8A 3KYIB 4JNKA 1M8KA 2PL1A 2AJTA 1Y37A 2VAPA 1A69A 4UAVA 2X4DA 4V0QA 3ZN2A 4OFBA 2GUGA 2QQGA 1Q20A 2RHTA 3R6WA 3THWB 3LHIA 1Y5RA 3INRA 1A1SA 1I5EA 1YTLA 2J7KA 2QTHA 3CJQA 4YCLA 3MS4A 5FTLA 4AY3A 3IOYA 4TV8B 4LMPA 3PR2B 4P4UA 1XHLA 3HH8A 4JJZA 4A0GA 3TDNA 3TRJA 4HGOA 1FVFA 1P6QA 1UIMA 4B1FA 1HZJA 1ADGA 4BVJA 4JI1B 1BE8A 4YX9A 2PXHA 1HYEA 1TMKA 3TRHA 3VU9B 4HH1A 2FMIA 3MUEA 4I5DA 3HP4A 2GN8A 2RGEA 4JH0A 3EODA 4QXOA 2EP7A 4UW9A 4YACA 3WNZA 4B79A 2RAVA 4D44A 4MDFA 3SEZA 5LKRA 1WXXA 3K1AA 1N6RA 4ETIA 1KOLA 4O0LA 3WTCA 1PX0A 1RW4A 2QDXA 1DWOA 3PRYA 3L7CA 3NASA 3Q7EA 5EWLA 3SAJA 3LNCA 2JRLA 4ZCRA 5CT8A 5FOQA 1BCRB 3PC8A 4BE4A 2ZIAA 4CG2A 4DDMA 3VR3D 3AIIA 1IL0A 1KE1A 2E5FA 3P45A 2ZAIA 1KRWA 1TM1E 3H0KA 2YHUA 4FLMA 4L8GA 5CEFA 2I62A 4FYXA 3FYUB 4KUEA 3VX3A 2EKLA 4JEIA 5FPQA 2MSWA 3RVRA 1K7XB 5F12A 3MMXA 4KPYA 1W4LA 2NO6A 5DNWA 1OXVA 1FYDA 1V8DA 2XB6A 4XGNA 5AHXA 2G25A 2HWKA 1PTJA 4FXPA 3GVIA 3TGPA 3IOEA 5ELMA 1LLCA 2EYUA 4LSMA 4V3BA 3TRKA 4D8WA 4CKZA 5KS2A 1L4FA 1Y0BA 4YDHB 1IN8A 2H0RA 4YCSA 4NVRA 1KHTA 1VSQA 3Q0IA 2H1VA 2A88A 3QRWA 5CXSA 3GRRA 1ZH8A 4LY6A 4HGZA 4ZOEA 3RIGA 2Q5CA 1AK9A 1W76A 3K1JA 4XR4A 5CA0B 3I9OA 5LIPA 2PR7A 3OPYI 3IAFA 3H8JA 2IGTA 4ZCMA 3E5NA 1WCV1 1E3EA 1AKRA 1KHHA 3AEZA 4WLNA 4BFZA 4KXVA 1J20A 5FV4A 4M1QA 2NZXA 1GXSB 4OD0A 4FTWA 4KAAA 2LCFA 3PICA 4ZC1A 5JNUA 1TEZA 3PYLA 1OJLA 1OLUA 4QEDA 4BB5A 3D81A 4EKEA 4DB4A 1Z2PX 3A1CA 2ZT8A 3DCIA 3JQ8B 3V4LA 2YFYA 2QL6A 3P2IA 3VDQA 2JW5A 1EDZA 4BRZA 1H2YA 5HTOA 4N5LA 1VXOA 2XI4A 2M6KA 4I2VA 1JDUA 4I08A 1VBKA 3L1KA 4JMPA 4UDNA 2DWCA 1R4NA 2GBIA 2QPLA 4KITB 4OX9B 1JEOA 2XRZA 2YVLA 5DHUA 2WI8A 3EVFA 1KO5A 1MZVA 1RXYA 3HVKA 4LC1A 2AR7A 4KOAA 4U02A 1J9GA 2QR2A 2YJ6A 1OPXA 3PQEA 4Y98A 5EMHA 4Z4EA 1EJBA 2FETA 2H1WA 3O4FA 2I6XA 1E89A 3KEOA 3NU1A 3WGJA 4D3FA 5AW3A 4DG8A 2JGKA 4CUKA 3FWYA 3RW9A 2F62A 3OHPA 3VH4A 2C4TA 1FDTA 2BAGA 3Q7RA 4IYJA 5CFPA 1Y34E 5H59A 2FPOA 3WNCA 3I1YA 2X0JA 1Q74A 3EEYA 5IVPA 1IWBB 3PC8C 4YFYA 3G0GA 4MV8A 3CLUD 5EESA 2CDBA 3WQQA 3OQ6A 1TKCA 1GFSA 5MDHA 3TL2A 5L3SA 1ZU5A 4YJGA 1LPPA 1E6LA 1XCBA 2PZMA 4N18A 3U44B 3TMAA 4BNKA 1OH6A 1EDDA 3EJ6A 3E4DA 3ETGA 4MW9A 5JAMA 3DEZA 4EVSA 3NAMA 2GN2A 3BSYA 1DKQA 1ZK0A 1V6SA 3JQAA 3Q85A 4OHRA 4X1YB 4QWMA 3SSAA 5BWCA 8OHMA 1R0ZA 1PTJC 2WWVD 1CK4A 3UENA 2C7OA 1TJ3A 2WV7A 1VSTA 3UQZA 1W36B 5LMNB 5TT0A 1CEEA 3TFQA 1KAMA 2EFHB 3MTQA 4ZARA 2RARA 4CU5A 4KXUA 3S2UA 4IDGA 3OCVA 3D64A 1NYRA 2ZS9A 3KOMA 2ZDGA 3AUKA 3LLMA 2X8LA 3F73A 1T0UA 3AO0B 1ZIOA 1ULTA 3L77A 4YEDA 4Z3KA 1IZYA 2ZOSA 1JG7A 2PT6A 1UZNA 1FZQA 1NMXA 4BO7A 1USWA 2B82A 3HUUA 1C50A 1SVMA 2XKJE 2ZITA 3UATA 1JIUA 3A1TA 3OIWA 5CA0F 3E84A 4EG8A 3H2ZA 3UV6A 4B3XA 4BEBA 4NU0A 5CH5A 4WJKB 4J75A 5D3MA 1J70A 2B4KA 4YIHA 1ZRHA 3VVLA 5THQA 1SB8A 2NO9A 4KPUA 1G59A 4LF7B 4ENTA 1HG1A 4R71A 2I6SA 3GB9A 4GP9A 1SU6A 2ODQA 4KHZA 3AY3A 2CXQA 3W04A 3OQIB 5GONA 1OFTA 2OHGA 4PXSA 2OZEA 4EHHA 2QJTA 4XR9A 3WGIA 2ZS8A 4ZT2A 4MPDA 2N75A 1D1QA 2X5OA 1YVUA 2NAFA 4JD5A 3T0GA 1RQXA 5BOSA 2ODAA 4OJKA 1JBKA 1PEDA 4IJKA 1HXHA 3HR7A 3D8SA 5HDBB 2B8WA 3TR0A 1DAHA 3GAZA 3PU6A 3WLJA 3NJRA 1HETA 5K4GA 1OX6A 5J47A 1FFCA 1H05A 1KNXA 1ZI6A 5DYGA 3LQ1A 4FM9A 5IJ0B 3E0QA 2H1FA 5DM0A 1DV2A 1HE8B 2UDPA 2QNIA 3G6WA 3D6MA 4JFRA 4E21A 5EHZA 2IEIA 3V7UA 3CQ9A 2PQMA 1J0AA 1TK9A 1KS9A 1A50B 5BV0A 821PA 1KA9H 3JQFA 1VM6A 1Z4JA 5AVJA 1CR1A 2IKSA 4AUMA 1UF9A 2PD3A 3TJMA 3L3BA 1VLMA 5K8IA 1I24A 1C3JA 1F9AA 1ABBA 2GRJA 1CUXA 2VYVD 4GFDA 1C4XA 4I19A 3S5JA 4U0KA 3H4MA 1HL3A 2IU3A 1FRQA 4QL3A 1RWKA 4MV6A 5JCZA 2AJLI 2YQ5A 4MWEA 2NUBA 3IBTA 4P35A 4OREX 1Z6QA 4WCFB 1WHSB 4HX9A 1V7QA 3HCPA 2I03A 3O9MA 1OUMA 5JQGB 1Z7EA 5IC5A 4JA2A 5IMBA 3PL5A 4IVPA 3OHMA 3VYSB 3FTNA 1WVGA 5A5VA 2HSGA 4KQEA 2FV8A 3LGSA 3HMKA 5HBGA 1T6XA 4LDNA 3TPZA 4WIAA 4YJ3B 1FS6A 2C92A 2BE9A 2ZP1A 3AT1A 3H9UA 4YUVA 1TF2A 3CW2A 3I2KA 4P80A 4RHCA 1KH1A 3HY6A 3MCUA 1CQIB 1OFUX 4NH4A 4C7VA 4DV1B 3BAFA 2NO4A 4A91A 2R86A 3RT7A 4N7JA 4B9AA 4D4MA 2H7XA 1CZRA 1K8XB 1L4KA 4E5UA 4AUKA 5ICEA 2XGJA 3RT9A 3VH2A 1US8B 5AHOA 2D4HA 2H4FA 1YCDA 2VJOA 3C39A 4C0JA 2Y1EA 4UCWA 4UUOA 4IIYA 3CRRA 4TTIA 2J3EA 1A2KC 1ADCA 1S2IA 2OFOA 1HK7A 3SPXA 3UG6A 1TMGE 3FCOA 3KRTA 4KKVA 4MOWA 4D9KA 5FL7D 5IPFA 2P9ZA 2IEDA 1Z88A 1PSWA 4XLTA 1TAQA 2JFUA 1U7TA 3QU4A 3VISA 1K6MA 4MUIA 4W5OA 2O2EA 4LZJA 4UZSA 3I9V6 4MR8B 1A5BB 5KAMA 2VNJA 3NTLA 1KYWA 1OZHA 5KINB 3K9WA 3O1JC 2G9ZA 3AR3A 1P73A 1VCOA 4I8XA 5EIOA 4ZAVA 2Z2KA 5FHRA 1UDAA 5AW1A 2FZ4A 3O90A 4KSYA 3UHFA 3IHLA 1I5OA 2W48A 3EE6A 1HC7A 5F4BA 3CIOA 3JQFC 4KN6A 5DF1A 2JFNA 4A2WA 4TZTA 2RGUA 1Y8RB 4YFVA 2PQ2A 1C1XA 1UKZA 3FTDA 5G1OA 1R0YA 6NULA 4XPIA 3P27A 4MB0A 2WY2D 4ZVLA 2F8LA 1QH1B 1YIDA 4TV9A 1G8AA 1K86A 4NEQA 1QLWA 4LYDA 2BR4A 2R66A 5IF9A 4DQXA 3HFJA 1SVKA 1GU0A 5D8DA 1GZHB 5A03A 2A33A 3H9EO 1AZSC 3L2OB 4RJ2A 2DPXA 4JQZA 1Y1PA 3T5DA 1WMSA 3C97A 1XA3A 2IZ6A 3MWJA 3O75A 2MTBA 3LZ6A 2FCRA 1FTGA 2ODNA 1UP7A 2QMEA 3GAMA 3ESDA 2X8WA 1KQNA 3FNEA 2R6GA 3GXOA 4Y1FA 5BMVF 3B9BA 3C8MA 1XTJA 1I6LA 1I0IA 1OYWA 2JBAB 3D0KA 1PD1A 4KVZA 4XYGA 5FCDA 3M34A 3F6PA 3IIIA 1M0SA 1DIAA 3DHWC 3ODGA 4NCAA 2G4VA 2G5GX 1VGRA 1P2FA 3U7QA 2BC9A 3MGCA 4DYHA 1G4UR 4MQ6A 5CTJA 3IT0A 1XZNA 2ZJ5A 5LPNA 4R1SA 4D0RA 1EUQA 2GOYA 3L8EA 4C2BA 1RQPA 3RRNA 4IUYA 1MFZA 4RMJA 4I7EA 3MJCA 3K1YA 1U6KA 4ZT5A 4PWYA 1N2CE 4KYTA 3VR6D 1BOFA 1U8ZA 4PCLA 1V41E 2V3WA 4I6EA 4HNQA 4UBJA 1XQ9A 5D7BA 3RIHA 3WZ2A 4C7XA 3DO8A 2ZUDA 1R8JA 3BDVA 4URZR 3KDAA 2OV8A 1LS1A 1E5QA 1VL6A 3HBLA 4E0BA 5B36A 1P61B 4I1IA 4JBYA 2IH5A 2XDQB 5BORA 2I3GA 1N78A 3HEBA 2ZS7A 4PZ9A 5BRNA 3IAXA 3RFVA 3WWDA 1PTKA 5BWOA 1QU3A 3VVCA 1GSAA 1OLOA 3P5BA 4D5GA 2AXNA 1X6VA 1RMQA 421PA 4B3GA 3OM0A 1D09A 1OU4A 2GZ2A 4ARAA 3M7IA 4B6JA 5BN4B 4N9QA 3VAYA 4GM0A 4TLAA 1Y3CE 2PZGA 3MPOA 5H68A 3SN6A 2O52A 5FFNA 2O07A 4RV5A 2Z5GA 4K9QA 2FX3A 4GI7A 5DSXA 3T7DA 3CX4A 3M4NA 2R68A 4OJTA 3FHTA 3SM9A 1ODCA 3EQ8A 1ONOA 5ALZA 5FTJA 5IW8A 4TL9A 4NICA 1WPXA 2C00A 1IN7A 2O5VA 4YP0A 4YAEA 5EMMA 3I0NA 2XADA 3QX9A 4LE2A 2G17A 1DL5A 3AETA 3N0WA 3NBFA 1YR9A 4JX8A 2HMAA 1CRPA 3U7FB 1NTOA 3EY4A 3KQPA 4R54A 1FYVA 4KWIA 4QDJA 1K5DA 4MDHA 5DCWA 4OI1A 1F48A 3VR0A 1XCLA 5BSFA 2EHDA 4TKMA 4BX0A 4HWSA 1WHTB 4PSKA 5DHRA 5C1PA 3TZCA 3QHPA 1K7EB 5DHTA 1I3MA 3GPIA 1Y6GA 4F2HA 1U11A 1A77A 1OAKA 3I09A 1TZ2A 1R16A 4HHEA 4F45A 2A4KA 1S8NA 1NNI1 1NQVA 2WMNB 2Y0CA 3MBIA 3F5DA 4HJRA 1DIBA 3FVRA 1N2JA 5FIUA 1O96B 3ABZA 1E2PA 1ZW1A 3V4FA 5K4AA 3EA0A 2QAGA 1NLFA 4ZCLA 621PA 1RJ9B 1U8FO 5IDWA 1DO2A 3E7FA 4OA5A 3R24A 2B1JA 3PJGA 5BMVB 2WSMA 5BVGB 1KRHA 2CXRA 1F7VA 1GGEA 4LJRA 4W7HA 2EF1A 3GO4A 4N0EA 5AJZA 1V3UA 2QRUA 3HKCB 4OKIA 4DADA 1QV9A 3MT0A 3DMPA 4RVSA 3T3MB 4POOA 1FUYB 1TT5B 4O4IA 3VR5H 5I7VA 1HLDA 2CLCX 3HYRA 4MWTA 1UH5A 4HF7A 4F3CA 3QKIA 1EHCA 3KQUA 4D41A 1T6ZA 4GAEA 2W8BA 3ONFA 4HTAA 3R5TA 1PSZA 3RI3A 3ZNNA 1OMOA 1BKDR 5KYYA 2AOTA 3IEMA 1S3FA 2HV9A 2NVUA 2RG1A 1VSUA 2YHAA 1U90A 1U0LA 3ZCQA 1RMTA 5JVDB 1PS9A 3P2KA 4P3YA 2HSJA 2Y6UA 1PLLA 1XZHA 5CUQA 1HDZA 1XPUA 3B12A 4UNRA 3SQWA 2E6KA 2PXAA 3UJDA 1E5VA 1EDBA 4D9JA 2Q2OA 3GJ3A 5A1JA 1YR2A 1CULC 1YJXA 2GZSA 4UQOA 5GVRA 1UPCA 2C5EA 5AYVA 3N2YA 1UFVA 1E7YA 1L7MA 2E85A 1ZR4A 1JDNA 5T6BA 1AMNA 1BS1A 1C3LA 2WAYA 1MRZA 1JAHA 1FU8A 1J5PA 1M76A 1SG9A 2GZDA 3HDTA 4QOHA 2RB5A 4UUAA 4L0CA 3HYTA 1I0ZA 2AHRA 2HRZA 3ICVA 1V3TA 2OLJA 2XCQA 2XUFA 3ZU3A 5A2QA 1SG6A 1UKYA 3HKDB 4R8RA 3W8EA 1H3EA 3K70C 2ZRDA 4UOEA 1E77A 3FCCA 3UW1A 3A6DA 1W30A 2JJ8A 4MCHA 3RHTA 1ES9A 4P0PB 1PZGA 3PNSA 1Q15A 2YJGA 1IBCA 4GZ6A 1E5DA 1VG1A 1F2TB 4YMVA 2ST1A 3ITEA 1KQGA 3NJ4A 1NN5A 4D9IA 1IUOA 1L3BA 1MA3A 2JDID 1MH9A 4GL2A 1R5OA 2QTRA 4LTDA 3H1GA 4AP6A 3DFMA 4YMHA 1MVOA 3OJEA 4OQPA 1N3IA 3QTLA 1Z9BA 1OF1A 1CIPA 2R1ZA 3DXFA 1E3TA 3D0OA 4BMXA 1FRZA 2VJMA 2VRCA 3AF5A 4N3NA 5D5PA 1JEJA 2QAGC 2I2FA 3I01A 3O03A 5AQEA 3KT0A 5KYUB 3TTWA 3SJAA 4HLQB 3T3IA 4GSLA 3A0RB 2X4IA 4BNXA 1U1EA 1NVVR 3G5AA 4L75A 3PQFA 1DAOA 2GX6A 1CZOA 1O5OA 5HCIA 1O57A 3OIVA 3ZE1B 3SQOA 1N0HA 2W70A 1R0KA 1AJEA 4RXTA 2ECFA 5FEUA 2I7VA 2EJWA 2PZEA 5CA1A 2GXAA 2AW5A 4DQLA 2BKEA 3NT2A 1T36A 2VQSA 3H2SA 4M8LA 1PWZA 3RNLA 1OZGA 1WLYA 4I9UA 3CEAA 5AKKA 1MORA 3NOQA 1RLIA 1W75A 4YAIA 4Q9KA 4DPMA 2J7PA 1E1RD 1O9GA 1IY8A 4MA4A 3LQ4A 1EE1A 1SXJB 1LQTA 2O2YA 3UT5B 3MRVA 1KI8A 1CRQA 1YDMA 1IUKA 3L6DA 5DW0A 3CUUA 1Q6YA 3M6UA 1GPMA 4C5CA 1B73A 4HUQA 5T4EA 1IXYA 5FJJA 3GNQA 1V2HE 3VR4D 4F04A 1CJTC 4QBGB 3C3XA 2XE7A 4K28A 4J8PA 2WWYA 3PD0A 1I4TD 2JVJA 2NT4A 3G2LA 4Q1VA 1TEVA 4BLTA 3C1TA 4GMXA 1CUSA 2VAVA 3KWFA 2P9TA 3TMKA 1CZNA 5T5QA 2ACVA 3ORQA 4F3TA 4MHOA 4BJ5A 4A0QA 3GPLA 3RUFA 2POQX 1W36D 4LWZA 4UBNA 4XB2A 5JRZA 2GASA 3OUTA 1EK5A 3M70A 3L8CA 1MRNA 1ZUNA 2H07A 3EJWA 3ZWOA 1Z7GA 3A6KA 4MPTA 5DMXA 5EE1A 3ZW8A 1V6CA 3CH5A 4GGPA 2AZMA 4JNCA 2FZVA 3F8TA 5HKBA 1UC4B 3I0MA 4HMQA 4B2PA 3BL6A 3GDHA 4Q4LA 3JVVA 2WIFA 4GPAA 4EG1A 3I34X 1FXSA 4PO3X 1V95A 3U3JA 3TCNA 3V97A 2YMLA 1YA8A 2JANA 3UJ6A 3U3OA 2X1HA 1E62A 2DTDA 3KOYA 4O4JA 1ACMA 5I45A 2W2XA 1CYEA 4FEYA 4OHBA 4GPIB 4FQ7A 5HQ3B 1C7FA 1NF3A 1QQ7A 3ZWQA 1LDNA 3KHTA 1QF9A 1QDEA 4N8DA 4PSUA 1M0EA 4RK1A 5A0TA 2AZTA 4CN8A 3O8QB 2R87A 1LK5A 1IE3A 3GP5A 4HQ6A 2XQGA 5L3QA 3F7OA 4V1CB 1RRKA 2WFZA 3CZMA 2BSQA 1EGMB 3AVYA 1LLFA 3FSEA 1RWBA 4YRKA 2QRQA 3OFNA 3L7JA 1JSXA 4FZRA 3EVNA 2QYTA 5A4JA 1EWVA 1YQGA 1V16B 1T43A 3MGGA 3RRYA 3I3OA 1KJYA 4GOMD 4E12A 4MVJM 4B3IA 1JIVA 4NJMA 2YVUA 2X7HA 4E1AA 1YUMA 4B2YA 1YQDA 2EFDB 3K53A 3KJNA 1RABA 4BQIA 1YZYA 3GJSA 2WTXA 9MHTA 1VE1A 5EZQA 3EXEB 4BUZA 3CX7A 1IQ0A 4BGVA 3VH1A 5CDTA 1MEJA 3K4PA 1E79D 4UULA 2DCUA 2I54A 4J07A 1TFUA 5TMDA 2HNBA 1KDZA 2J0UA 1KYQA 3FW1A 3CUKA 3KZNA 4KJZA 4NG4A 2DR2A 3HY3A 3IA7A 4MPRA 2BGGA 4TVBA 3JR3A 4FCCA 1A9YA 2Y1LA 3GHHA 2E1RA 5AW7A 1ZL2A 3G7NA 2X3YA 4L4XA 1NQXA 5FPKA 1ZHOA 2VJYA 4E2WA 2N0SA 5EKDA 1A8IA 3U7RA 1U5AA 1EUCB 1W93A 1SUWA 1XR3A 4ZHSA 4C43A 1FC0A 1GCOA 2EG5A 3ZZNA 1N5IA 1VC2A 3DVAA 3KLMX 4M0KA 1HGXA 1OFVA 4TOIA 3WL8A 2RKOA 2DM6A 5BP7A 1KZ7B 3ND9A 2RBEA 3W9YA 2OYRA 4NOMA 3RU9A 1WPQA 1EHYA 2QRMA 4KGZA 1V2GA 1YL7A 4IZ6A 4L0DA 1ML4A 2GN0A 4WDRA 4X1OA 1K4YA 3FZEA 1XIVA 1IHUA 3EVBA 1HKHA 3FPSA 3LUHA 1OX4B 3HL0A 2X5NA 4X3OA 3AUXA 3U9TA 4FR2A 5D3KA 2YN0A 2ZR9A 4R8VA 3LBIA 3ZJYA 3NHPA 1NWHA 1HYGA 1T0BA 3DZBA 5CHYA 3W7BA 4MVJF 3NGLA 2ORIA 2JHPA 1DS6A 1T8RA 2ZWAA 4GE3A 5AKZA 1M34E 5A9SA 3NPAA 2R1TA 2Q5FA 1GZ7A 2I9PA 2I7XA 3LQYA 4N6NA 1KDVA 2W6CX 3DAFA 2H4ZA 4DWVA 2RI0A 4PZEA 4JR1A 3UOAB 2IV3A 2XGGA 1VXRA 5LBIA 2PZKA 4PTLA 4YVFA 4U7PB 2I6UA 3AVXA 1Z4OA 4OVKA 4ZYZA 4RPIA 2Q7XA 3GLVA 1WPRA 2FSUA 2XGMA 1OB5A 5HFJA 4A8JB 2VTVA 3I5UA 4JU8A 2FK8A 3DE3X 1SU4A 4E5NA 2X0DA 2VH5R 1C41A 3T9EA 1MCZA 2AG8A 2IA5A 1E9SA 1WPGA 4EPXA 5AVKA 3ETLA 3O0DA 3JQBA 3BXGA 1T2AA 1WVMA 3IB3A 1NDHA 2ZJOA 5LQUA 2GKSA 1ILWA 2NTVA 2FZWA 1Z7WA 4TWRA 3WGNA 1F0NA 2H29A 3KKMA 3JZMA 2FQYA 4WA7A 4TRMA 4PXYA 3LNTA 4GR9A 2VPTA 3R6LA 1ZH2A 4OYYA 4D9FA 4N5DA 2JFPA 2HSDA 2HQBA 2GESA 2BJVA 4JY7A 3GT0A 2FFJA 1BH2A 1CY7A 1JIXA 1EBFA 1OLSB 2FZCA 2QRZA 3FPFA 3B48A 4MYUA 4BNUA 3ZV5A 2G09A 4EJ0A 1XNQB 2VYND 4FDTA 4PNHA 4KXLA 5AVSA 4RIEA 1LA2A 1GG9A 2G1UA 2O05A 2I7TA 2UUOA 1K8ZB 2AN9A 1ZOOA 2Y4OA 2Z5LA 3GN1A 1SC9A 3NWEA 4UEQA 5A3JA 3ZVMA 5FPPA 5B1YA 3IE0A 4MWOA 3RSFA 5B1EA 3IVXA 1KMMA 5LR6A 4XFKA 3NT4A 1CR6A 1UAAA 2P41A 3HLYA 3VU3A 3W3AA 2B5VA 2RK4A 3W7VA 2G7MC 4H0CA 5CFLA 4GP6A 1XKXA 4DJJA 2CJWB 3I3SR 4D4IA 1G2PA 2GPBA 3CO5A 1EWKA 2IXGA 4ZODA 2IU6A 3SIRA 1U7UA 3LBAA 5A0VA 4BNMA 2X0IA 1DX6A 1HFEL 3HSSA 3CWCA 5DTIA 3AFOA 2B99A 3NDBB 3AHFA 4FHFA 5C4MA 2Q5JA 3R3UA 4HYTA 4D8XA 2QRGA 3RC3A 4IRXA 1MC1A 2B37A 3HJCA 4M1SA 1KGSA 5TMPA 1HWYA 3LY8A 5A0FA 3WLAA 2IYZA 1P62B 2JZCA 3H87A 4KI7A 2W90A 3I1JA 5FWYB 4A1OA 4EI7A 1MAHA 2OMEA 3QKTA 3D3JA 4BZPA 4FHGA 2VNAA 5ALVA 1H8HD 5TJHA 1G42A 4MYCA 3ZD6A 1VKNA 3WNDA 1M2OB 3F47A 1ISSA 1NU6A 3NBUA 2HNAA 1ZUIA 3HBMA 3O2SB 4L4ZA 3TTYA 5KWJA 2XY4A 3FZGA 3HHEA 3SYRA 2HK8A 2QM3A 4QLBA 1NATA 5IX8A 2IHBA 1EPUA 4WXMA 2Q3FA 4HLNA 1Y6QA 1AGRA 1RJGA 4LY9A 3G7UA 3KJXA 1B8NA 4QDZA 3DXXA 1T10A 2PJRA 2F59A 4DLWA 1I6MA 3JQBC 5C1DA 2PUDA 2JBHA 1PNRA 1T0HB 1FPQA 3DLTA 3FPKA 2EZUA 2I2AA 1GZSA 3EVDA 2JHGA 4XOIA 4GHWA 4EI8A 1GAQA 1N4DA 1Z28A 4I1VA 3HN7A 3RM3A 1KEZA 2CKDA 1U4NA 4E4RA 1M3SA 4BLUA 2G80A 2LD4A 4N82A 1GEEA 3WRXA 2ZSAA 4D43A 4LOLA 4F84A 4LGCA 1T8PA 2I91A 3C7AA 4JP1A 4PLFA 4QU9A 1RWMA 1EFTA 3EXHB 4S35A 3VC3A 2IWRA 2GN6A 4BGDA 4XASA 4FFOA 4NMWA 3FI9A 3GUHA 3W6OA 3K0HA 1SH7A 4N0QA 1JV2B 3RAPR 4RTKA 4FYMA 3P9PA 4JVSB 1YS2X 3EFBA 4MRMA 4MUGA 3IX7A 5ICGA 1KZ1A 5BVHA 2GN9A 1A4RA 5IANA 1ELOA 5FR1A 3BN3A 3KLOA 2LBPA 2ZI7A 1A71A 3BTOA 3HABA 4HTFA 2E87A 4HBGA 4Q47A 4EUHA 3WWYA 3QXGA 2D0OB 4C0AC 1ZO8A 4IJ5A 4NXMB 1XN1A 4Y2JA 2YBEA 4JOQA 3VTKA 4A5OA 2LDBA 4DR4B 4MIYA 3ETNA 3HKBB 4M9XA 2UZIR 4M0MA 3F2IA 3WRVA 3IVCA 1DGQA 1QVAA 1RWOA 5DXAA 4ASUD 3DPIA 1AOXA 2AL7A 2ZB3A 3KG2A 3G0CA 2QU7A 3G0BA 3KQHA 3MJ4A 4JLUA 1MC4A 4P83A 4UE2A 5HGJA 4BFCA 1VDMA 2IS4A 2ZYTX 2O3TA 1A2QA 2IU4A 2UVDA 3ESZA 4BGIA 3S5UA 3RBVA 1D9XA 5JY1A 1Z34A 4FFNA 4UXHA 1I94B 1WTAA 3R3ZA 4ABTA 3L43A 2E3JA 3SF8A 1JG2A 4PO9A 2V1XA 3Q1KA 4CF5A 2W2KA 3FRIA 2XGOA 4JLWA 5BT9A 4Q9IA 1SU8A 3C3YA 3R3YA 3WHKA 5IT9A 2PL9A 2SECE 4YECA 1C81A 4Q7KA 2Z08A 4CQMB 4AO6A 4KX5A 2V65A 4C7OB 4L8LA 5GZ3A 4XJVA 4GPTA 4KBGA 1SC4A 4NBLA 1QFJA 3NALA 3WFJA 2HU8A 1O1YA 4IFTA 4RVGA 1FLDA 3VBCA 4J4TA 3WBKA 3CLTD 2QTCA 3LOUA 3WYNA 1LY1A 3H1EA 3ZV4A 1NW3A 2OCXA 4C4ZA 1NNEA 1WXEA 1TVCA 3TNJA 3ZY5A 4JS0A 3DLAA 4EA9A 5G3ZA 5CVDA 4AZ3B 3WI7A 2X40A 1F0PA 1ZD8A 2BT4A 1TKBA 3WRXC 3PC6A 2O2JA 2B8EA 2IUSA 1M2HA 3WYGA 4JL5A 1I7NA 1KR2A 1M7HA 2C8VA 3K09A 5D51S 3AX6A 4JXXA 3CNEA 1TT7A 2AX3A 2UVPA 2HGZA 5BW5A 2GCOA 1R4AA 1YSCA 2DETA 1G7CA 2HSZA 1OAOA 3R6TA 3VBEA 1G66A 5CNIA 4DMUB 1LC3A 3OLXA 5DNAA 1QM5A 2IYVA 4KAJA 1QXSA 3R3WA 4MUKA 1LPBB 2FMXA 2K7ZA 3H1AA 3AUUA 4MKHA 2H5LA 3VNQA 5ADUS 1YKSA 4RDCA 5SZIA 2Y9MB 4ZYLA 4GRAA 1IZ8A 3E1KA 1EVQA 4EABA 4K46A 4QD3A 4OGWA 1F8UA 1S4QA 3M9LA 4K3UA 4AMBA 2FSSA 3TQCA 4FDUA 3ZWYA 2NU8B 4QXQA 2QTVA 1MG0A 2ARKA 2IIQA 4MQFA 3ZWDA 1I14A 1MB4A 3QBEA 5REQB 3R7NA 1RBQA 3T9DA 5HK8A 3OLYA 4IXWA 1MA0A 2XRYA 4LS3A 4M0FA 4M1KA 4ZPXA 1ND6A 1GU7A 5JC8A 1ID8A 4D92A 3WYEA 4GLFA 3LBNA 3KVYA 5CMLA 3IXMA 4D45A 1UPTA 2NUPA 1QHXA 4Y1RA 2BELA 1NR5A 1VG8A 2ACWA 5CGZA 3HWRA 3WB1A 4EIWA 3A4LA 1HEUA 1MIOB 3NHAA 5ELLA 1NU8A 1WZCA 1JB1A 2ZJAA 4MYTA 1MC5A 3DD5A 4R16A 1SXJD 4XI9A 2VHEA 2COEA 1C4OA 1UC9A 2R751 2DP4E 3JASA 4NL4H 4MPPA 2AKYA 1XEXA 3VU9A 4RZHA 2BJHA 3OIYA 1ZNZA 1E5LA 3BQ9A 2HGSA 4J9UE 5AI9A 3UFXB 2RHGB 4A6DA 1W2HA 2I7DA 2X0RA 1Z8HA 5CT4A 2ANCA 3RRZA 3V1KA 4H1VA 1GPDG 3GRVA 1J00A 5CRIA 4F46A 1WVIA 5SY4A 2JFWA 2R44A 4DUGD 4JI4B 4EGAA 2GM4A 5LVAA 1UDWA 3HCOA 4I5IA 1KEKA 5G1NA 4IWYA 1ZY2A 1D2CA 4O2BF 3CT6A 5J2TA 1CE8A 1UPFA 2W6PA 4FK8A 2VF8A 3D6UA 4GC9A 4RYDA 4EAQA 4DMHA 1RBZA 4JYAB 5DOZA 2HN9A 4KMRA 2AWNA 4DR3B 2W2NA 1R4ZA 4K2AA 3OQOA 4L2IA 2I6FA 4KIUA 5I4KA 1TX4B 5JFOA 3MBKA 1J2YA 2QI9C 1IM2A 4ALLA 5IKPA 3GEIA 5DP2A 1OAOC 3MB8A 4EY8A 1NXXA 4FFVA 4N49A 1MZPA 3G1UA 1H9CA 1N75A 5K99A 1U0RA 1VCMA 4WUVA 4CKCB 2HTEA 1NUTA 2XIQA 3DDNA 2QW1A 2V0CA 1UOEA 2XNCA 3PUHA 4H4CA 4I1RA 4ZOLA 5E9WA 3SOZA 2B3TA 4BZZA 3T4PA 3U7EB 1EI9A 3GRCA 4GXRA 4JV5B 3FUCA 3OKPA 1DAKA 2FP3A 1J9EA 3M6VA 4Z8XA 4ZHQA 3EDOA 4TMYA 3I9MA 3B1YA 5EWMB 3AKZA 3R7WB 4Z9BA 3O2NA 3JPYA 4J90A 2B94A 3QFFA 4RHUA 1G6Q1 7MHTA 3W8RA 1R9JA 2AE2A 1ZM7A 4DW8A 3DLIA 2ZAMA 3F6RA 1B7GO 1ZMRA 2CUKA 4FSDA 1EINA 3N76A 4OK6A 1RAFA 3ZTYA 4FS8A 5L51A 2C61A 5EEHA 2AQKA 3G9XA 2GBLA 2IQIA 2WKPA 4HFRA 2VDNB 4E03A 4LRSB 3G9TA 3WK5A 4FMDF 1WZIA 2I3ZA 1JYFA 1YQXA 2Q3MA 2PV7A 1GFIA 4N03A 2VL7A 3QMPA 5IVKA 3IPYA 4B7XA 3LQQA 2PIDA 2J31A 1KZYC 1AUQA 3WLTA 1S2MA 1BDIA 1P7CA 2O6HA 2YINC 3Q3CA 5KNBD 4GWKA 5KOIA 2BFMA 1APBA 1OZFA 1JHRA 5FI0B 1P19A 2OXEA 5PGMA 2XB4A 3E2PA 1EE2A 1XVLA 3BDAA 1ORWA 1X80A 3ANXA 3B7WA 3IRVA 4ENPA 2PYIA 1J7JA 4AY4A 3D8NA 3IKJA 4ZCTA 2HAEA 3ESAA 4OGGA 4LCJA 3TS1A 4J29A 4I2NA 2VDQB 1KOJA 4QQ8A 1ADFA 4FB5A 3JD3A 3T7RA 2F1RA 1KAEA 3I9FA 4MWGA 5AESA 2QIOA 4MS4A 3T52A 3TRDA 1VBNA 3FUUA 4OATA 5BOVA 3BMNA 3C14C 1N1MA 3DUFA 2YX1A 3M2TA 3VPHA 2VSNA 1GUYA 5E6RA 3U61B 2XLCA 1B43A 1QGOA 1LV8A 3WICA 4AS2A 1X3SA 3IDSA 4PG6A 2E4XA 3E9ZA 4O2BB 2QN2A 4TPKA 2J6IA 1M6WA 3OTWA 4U7WA 5JBQA 1PR9A 1ZJJA 2B7LA 4RADA 5HR5A 4ZVVA 3SI7A 4NFSA 2A4MA 1Z6XA 4UU0A 4D56A 1MV5A 2Q46A 1FF9A 3OU6A 2NPOA 4ND3A 4JC5A 3DVLA 4OI0A 2AEJA 2GGSA 4XKJA 1HO3A 1WSBA 3LO8A 2VHQA 3T7KA 4GBED 2E4VA 1T9DA 2AT1A 1SPXA 1IEXA 2GK7A 5TT1A 4JEUA 3VGPA 3VHXA 2C2OA 4XWOA 1ONPA 1EXNA 4IH4A 3OJLA 1E20A 1K3UB 3MRXA 1KEPA 4O4HF 1HFJA 3C8DA 3GUUA 4IKPA 4OCZA 2RBKA 5AI8A 4OHMA 4RYLA 4F1WA 1H2ZA 4JQCA 4ND5A 4NS1A 5AO9A 5ALQA 4EG6A 2ZZNA 1TPZA 2FW6A 2GHTA 2PSEA 2VSOA 1VFNA 1ARZA 3C98A 1W4CA 2HH9A 3DA8A 4ICIA 4BLQA 3X1JA 3GNTA 3ICEA 3U4MA 3AVWA 2P5YA 2QGFA 3L4JA 5DCLA 4P3KA 5IASA 1YAJA 2C59A 4ACBA 5G0TA 4DNXA 2VF2A 5CD9A 3DG9A 2B34A 2FE1A 4NZMA 1Z6ZA 1UC5B 5JATA 2WUWE 3BS4A 5ITWA 3LGAA 1G17A 2QZZA 3K6SA 1U7ZA 4C76A 5ALLA 4TKLA 5FT9A 1GGFA 2B3DA 2BGNA 2BWJA 3MBOA 3NHZA 1GDTA 1Y1TA 2QX7A 5CNMA 2R8BA 4B3TB 4E3ZA 5GIOE 4ZMRA 1XVUA 3DHYA 4AN1A 4QBKA 1EWQA 4ZQFA 3LVRE 2GRUA 2IBTA 4FJ2A 1MOZA 3NVAA 1M2VA 1NBMD 1SXHA 4GPBA 2ZR8A 4NBRA 5IJ9A 2QLLA 4MYSA 3LW8A 3OESA 1P4HA 3D7NA 2IF0A 1U8TA 4MVJG 5CVUA 1R00A 3AR4A 1ZH6A 3MWFA 2W6ID 5EKTA 3LXMA 2H17A 4N01A 2VHYA 1FSSA 2AOUA 1CEXA 2YV4A 5FBHA 3FB4A 4IJMA 4RHYA 1UK6A 4G5SA 1T4BA 2ZIFA 1FY2A 2AJDA 4QGBA 4C6TB 3V9PA 2Q28A 1EB8A 2J0QA 2FWNA 1P4GA 1VOTA 3X1ZA 3G79A 3ETCA 1FYEA 1BDMA 3P2JA 1G8MA 1MDBA 2POCA 2ZBPA 4AKTA 2OECA 2WSIA 3QK7A 2B2XA 1QGZA 4P7JA 4AZVA 1Z5ZA 1FFSA 1M2WA 4BECA 2BHSA 1J5XA 2QUJA 1QCZA 2DHQA 2QY9A 3F7MA 3L0YA 3O3MB 2MT9A 2NN3C 2OV1A 4D4LA 1GSIA 1SQ0A 1A9ZA 3ZD8A 3S68A 1L8AA 5KTRA 2H2WA 1SGWA 1JIQA 1FNBA 2JIPA 3LA6A 3ZI4A 5IYZF 2P6MA 1HLFA 4I1YA 2AN3A 3TLJA 4P6VF 5CDSA 1GNLA 3WLHA 4F92B 3K8ZA 3GJ4A 4GM4A 2Y66A 3IHWA 4P4GA 4B8WA 4RD1A 3UT6A 1K75A 3QXHA 1IG3A 3AY7A 3EOBI 4KODA 3V8EA 3OZGA 4MVJD 4O4HB 1O94A 2QUBA 2YQ4A 4YRSA 1JR2A 1KI1A 3C7DB 4K9KA 5E4YA 3ZDRA 1FZTA 1XD2B 4DC1A 2QYHA 2ZTSA 3GDWA 3MT9A 3H6GA 3QVLA 4PG5A 4POAA 3TBHA 3ZYCA 3WKAA 1SOVA 2X86A 1JR3E 4PICA 3WWCA 1FEZA 3UMBA 1AKEA 4KXMA 4ECAA 2YDXA 3LAWA 5D7NA 3I23A 3IR6A 2W6MA 3GQBB 1XCOA 1QOZA 1DBPA 1DU4A 2PLRA 2JGNA 2V5AA 2V6FA 2V7QD 3CF0A 2H0AA 3DV9A 4LHSA 5K0TA 2IHTA 2Q29A 3B38A 3MXTA 4FKZA 5JZSA 1GN8A 5B7GA 4JC4A 3HCFA 1OASA 2BBTA 2C3MA 4N7RA 4CT5A 3LVFO 1L4NA 3F7TA 1E2FA 3PTLA 4FFLA 4PXAA 2WAXA 4UM8B 1WKVA 4BLSA 3HGTA 3CY6A 4DVJA 3PZBA 3FCAA 3QKSB 5ALUA 5BSWA 2Q3EA 4CDRA 1KZ4A 4YLGA 1QF6A 5FF9A 5LP6A 3LWZA 4FFBA 3MMNA 1I8TA 5ES3A 5KNCD 2Z43A 4DEVA 3LQ2A 3FGPA 4O6VA 3GLIB 2C9ZA 4YT5A 3ZCSA 3A6EA 1HT1E 3MK31 2JJMA 2P6OA 3KAQA 2DHCA 3QEMA 2G3YA 4TN1A 4YMIA 2ETVA 1DEKA 2DMRA 3ABIA 1OLXB 1EH5A 4MV1A 3AL3A 1YE5A 1KOFA 3PPVA 2K4MA 1L1FA 3REQA 4EBFA 1IB6A 4YP5A 4JDUA 3F5QA 1SVWA 3TSCA 4L74A 2GEJA 1EIZA 3JATA 3KOXA 2NYRA 1MQ8B 2QD2A 5TPWB 2C3UA 3EZNA 3JVDA 5A2GA 1JXOA 4ZDKA 1OYVA 1SOUA 3R0JA 5HYVA 2KM1A 3G5TA 4ZT4A 3V80A 4I1SA 4CM9D 3K2IA 2BM0A 3H16A 3DBLA 4HDCA 4I99A 4TL7A 3RPEA 1KEEB 1FDIA 4N8SA 4PLYA 5H9WA 4O3FA 3E9CA 2AV6A 1DEOA 2QYOA 2AMFA 4LSZA 4NV1A 1T34A 4JSYA 3DV2A 1P2SA 3L9XA 2EBWA 3EG9A 4IHJA 4II2A 5IYZB 3VTAA 4ZZIA 3H05A 4FX5A 2I1QA 4MTLA 4RA6B 1O94C 3A4NA 3N70A 3G17A 4HFNA 4DREA 4RTOA 4EO9A 1QB7A 1O0SA 1P0QA 2JL1A 2V54A 4WEQA 2FEOA