1N7IA

The structure of phenylethanolamine n-methyltransferase in complex with s-adenosylhomocysteine and the inhibitor ly134046
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
261
structure length
261
Chain Sequence
AVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition of sub-micromolar inhibitors by the epinephrine-synthesizing enzyme phenylethanolamine N-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 87
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2002-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1n7iA00
3SX0A 1RJFA 4OBXA 2G71A 2OB1A 1NT2A 2PJDA 4GC5A 4KRGA 5LR6A 4YUZA 1OR8A 4RVGA 4CKCA 3LCUA 2I7CA 3E23A 2LD4A 3LHDA 4WVLA 4DKJA 4M36A 2OXTA 3THRA 3TM4A 1XDUA 1NW3A 5DSTA 3GCZA 3TLJA 3UJ8A 1L3IA 3VSEA 2B9EA 3Q7EA 4QTTB 4ER3A 1G8AA 3ERCA 4QDJA 4V0RA 2O05A 3DTNA 4P7GA 1JSZA 2PX8A 4GC9A 2VDVE 5DTMA 1KXZA 4HTFB 5LQJA 2P1DA 2ZWVA 3P71T 4RX1A 4E30A 5GINE 1VE3A 2PY6A 4RWZA 4V0QA 5EKXA 2XYVA 2EX4A 1P39A 2NXCA 5HIMA 3U81A 4ER5A 3B3FA 2ZSUA 3LECA 3G8AA 1XXLA 2NNWB 3P9NA 1IY9A 1EAMA 3HA3A 1RJGA 4HH4A 5HILA 4C4AA 2NXNA 3MGGA 3M33A 3ANXA 3TFWA 2VZ9A 8MHTA 1JQDA 2IDJA 3B3JA 3EGVA 3TQSA 5DX0A 3M6XA 3VC2A 4RTSA 1VP3A 5DRYA 2ESRA 4HRAA 5E9JA 5T64A 4PYOA 2NXEA 1NW8A 1M0EA 1N7IA 4PWYA 2H00A 3ELUA 5DTRA 4ATNA 5KVAA 1FP1D 2H11A 1FPQA 3LDGA 4MIKA 5KQSA 4RTRA 2QM3A 2BH2A 3PX3A 5CUQA 5DM4A 3UJ9A 4EKGA 5K0CA 1KYWA 2ZW9A 2ZCJA 1XDSA 1ORHA 5DT2A 2GPYA 1I1NA 2ZWAA 3RW9A 3KPJA 3M6UA 3NW9A 3KR2A 4GF5A 2FHPA 5K03A 3HVJA 5DRTA 4RTQA 5HEKA 3PFHA 4KW7A 2CWWA 3O7WA 4HSGA 2EFJA 2FPOA 2O57A 3DULA 2CL5A 4PGGA 4QQNA 1RJEA 2WK1A 5ERGB 5P8WA 3EMBA 5K01A 5LQCA 2IBSA 3ER8A 3BXOA 1EQAA 4GOOD 4AZTA 5BXYA 3LSTA 4RV9A 4KIGA 5DX1A 4IV8A 4QTUB 2AVDA 3DLIA 2XVAA 2PLWA 3SMQA 4MHTA 5EKUA 1QAQA 5FA5A 4GUAA 3I58A 3LKDA 4P7JA 3UZUA 4C03A 3BWMA 1EG2A 4YMGA 2ZZMA 3ID6C 3NDJA 3NDIA 4X1OA 1XDZA 1ZQ9A 5D1NA 5E2AA 3G2OA 3LCCA 5EC8A 5K8VA 5GIPE 1KIAA 1AF7A 4OA8A 4GEKA 1QYRA 4K6MA 3GRYA 2C7PA 1I9GA 3EVDA 1NW6A 1SUSA 5U4XA 4DZRA 3GGDA 2JHPA 1G55A 1AQJA 2P7HA 1ZHFA 5E1DA 2IIPA 4P7FA 3GNLA 3NJRA 3OZRA 3EVFA 3VC1A 3HM2A 3FUVA 4C05A 4RYLA 3PFGA 3M4XA 2O07A 3R9XB 3MHTA 3BWCA 5E9QA 2VDUE 5F2OA 1T43A 4FR0A 2PVCA 4C06A 4OQDA 3SXJA 3SSMA 3M6WA 3BZBA 2IBTA 1R8XA 4EK9A 3P9CA 4QDKA 4EVIA 2PBFA 3EVAA 3O31A 4EMSA 2IGTA 1JG1A 1R8YA 1L9KA 5EGSA 2C7OA 3GXOA 1VP9A 5E8RA 2ZFUA 2PSSA 3IV6A 4O29A 1EIZA 4OX9Y 3OZSA 3JWJA 4PIPA 4U7PB 2ONZA 4C08A 3OPNA 4DF3A 2ZTHA 3OE4A 4X61A 4XUCA 5IKMA 3HCEA 4YUWA 2AOUA 1QZZA 3NWBA 4E32A 4Y2HA 1P1BA 2VS1A 3M6VA 3OCJA 4R8RA 4YUXA 2FK7A 3SSOA 5GP1A 5FHRA 3FTDA 4ER6A 1DL5A 1QAMA 1SQFA 3NWEA 2A14A 2QRVA 1SVUA 3LGAA 3R24A 4IKPA 5D1HA 5DPMA 5E2BA 1L3BA 5EZQA 3BGIA 5T6BA 3TRKA 1XCJA 3UJCA 3I9FA 5BW5A 5GIOE 2B78A 5B1SA 2FCAA 3B5IA 1Y8CA 1TW2A 5DXAA 4OA5A 5HIKA 3FPHA 3MAGA 1M6YA 2N47A 2P3QA 3NTVA 3G7UA 4LG1A 5F2KA 4LWPA 4E31A 5GOZA 4CWAA 3OE5A 3HP7A 3BWBA 4P7KA 2ZULA 2BM8A 3L8DA 4KIFA 3IYLW 3LDUA 3FPFA 3LX6A 2PWPA 5E9WA 1I4WA 3DOUA 5G02A 2OBFA 5HIIA 3FUUA 4E2XA 4DA4A 2JHAA 3FPEA 1L3CA 1MHTA 5EIWA 3UWPA 2R3SA 3FTCA 2GAFA 3HCFA 3C0KA 3JWIA 4YUYA 3K6RA 3DH0A 5BW4A 1IM8A 4FP9A 4RTMA 4CTKA 3DXXA 2YUIA 2JHCA 3LL7A 1R00A 4PONA 2ADMA 4HG2A 3SVZA 4E2YA 2IDKA 3T7RA 3DP7A 1JTEA 3LCVB 1HMYA 1YZ3A 2VP3A 1D2CA 3A26A 3HVHA 3OU2A 5K05A 2YTZA 5T67A 2IPXA 4AUKA 2GH1A 4QPNA 3A25A 4FGZA 4RVDA 4GOMD 4CKBA 1JG2A 2ZVJA 4AZVA 1ZKDA 4BP1A 4FSXA 1Q0TA 2Q41A 3MERA 1YZHA 4QQKA 1X19A 3E7PA 3UJBA 2ZIGA 3PT9A 5DXJA 1VPTA 2OO3A 2P35A 3Q87B 2K4MA 1D2GA 1NE2A 4PCAA 1JSXA 5CM2Z 3G89A 5CVEA 5EOVA 4YV1A 3TR6A 5HIJA 2DPMA 1V39A 2P7IA 1YB2A 5K09A 2YXEA 5KS2A 4R6WA 2XBMA 3PX2A 4L7VA 4GOLD 4C04A 1H1DA 2PT9A 3DMHA 2FK8A 2HNKA 4BLUA 1NV9A 2AOUB 3B89A 5EVJA 2PX5A 1VIDA 4MQ4A 4RTNA 1UWVA 4M38A 4R8SA 2ONYA 3TMAA 3FYDA 3MQ2A 3G2MA 3AWIA 2PX2A 5LQNA 3LPMA 4A6EA 5C9ZA 1ZG3A 2AVNA 3KHKA 1NBIA 3KQPA 3OZTA 4R6XA 1G6Q1 2GS9A 5JUWA 5K0FA 2H1RA 1FBNA 5KQRA 2PGXA 3GJYA 4HC4A 3SGLA 2BR4A 4F86A 3A7EA 1N7JA 2VDWA 3P97A 4AX8A 5LQKA 1F38A 3EPPA 3JWGA 3UJAA 3DLCA 4X63A 1XJ5A 4PYLA 3NVMB 3ORHA 3X0DA 4B17A 2EG5A 4XCXA 1TW3A 3KR1A 4FZVA 2BZGA 3H2BA 4CXMA 5BP7A 1NKVA 5CVDA 3G8BA 5FADA 3TKYA 4AZWA 1NW7A 2B3TA 2YXDA 2AZTA 1JTFA 3B7PA 4PYMA 4RTKA 3BUSA 3C3YA 4H0NA 1RI5A 3ELYA 4ER7A 1WG8A 4EQZA 2XVMA 3PLAE 5H02A 3HVIA 3MTIA 5IH3A 1HNNA 3BKXA 3KPWA 3KQMA 1WY7A 5K0BA 4P58A 3NVKI 1X1DA 3A7DA 2AOWA 3OFJA 5EMMA 3VYWA 3OFKA 3UJ6A 4KDRA 1EJ0A 1NW5A 3TM5A 1R6AA 3MCTA 4PYJA 4IWNA 1G38A 2OY0A 5FWAA 1FJXA 4FSDA 4QVGA 1INLA 3KR9A 4XUDA 3EVEA 3EVZA 4HGYA 5DTQA 2Z6AA 3DXZA 1IXKA 4RTJA 3K0BA 4F84A 2AN3A 2PXCA 3HEMA 5FQOA 4CKEA 5FA8A 4BY9E 3GO4A 1X1AA 3GDHA 4OQEA 3OU6A 2ZBQA 2BR5A 3FPGA 3SM3A 5HFJA 3FTEA 2UYQA 2P3OA 5GWXA 1BKYA 3GWZA 3QV2A 4BLVA 2B25A 5FUBA 5FCDA 3GRZA 1KR5A 4DQ0A 1JG4A 4HGZA 3BGVA 3EGEA 5EEGA 1JQEA 3CCFA 4GOND 3C3PA 4PGHA 1XTPA 2NP7A 2BM9A 3DMFA 1QANA 4C07A 1D2HA 1Z3CA 4LECA 3ME5A 4HTFA 4BLWA 5ICCA 1O54A 3LKZA 3UBTA 2IH5A 3OU7A 3GU3A 4IV0A 2AS0A 3KKZA 2BR3A 4PYIA 2CMHA 2ZZKA 2GLUA 3D2LA 5DLYA 5EEHA 5CVUA 2Z6QA 1RJDA 3MCZA 3SR4A 4PCLA 1N2XA 2G8NA 3FYCA 2YQZA 1YF3A 1VQ1A 3CBGA 3PS9A 2O0LA 2CMGA 3V97A 2AOTB 2YXLA 2KW5A 2UYOA 3UJDA 4FS8A 3E05A 3FUTA 3HCDA 1UFKA 4PINA 3G88A 5FHQA 5F2NA 5GM2A 2Z6UA 3EMDA 2I9KA 4E33A 2NP6A 4EKIA 2QE6A 3KQQA 2UYHA 3CJTA 3JWHA 2NYUA 3HVKA 1SQGA 3G5TA 1R74A 3KQYA 5JR3A 3I64A 4GBED 4MTLA 1YFJA 2QYOA 4MWZA 5EHGA 3P2IA 3RODA 5K0GA 10MHA 4BP3A 3GRVA 2IH2A 3KU1A 5E8JA 5EQJB 4A6DA 3GRUA 2IH4A 1G60A 1BHJA 3R6TA 3P9KA 5HZMA 1WS6A 5FULA 2G70A 3HA7A 1JQ3A 2UZ4A 4X41A 3ELWA 3SSNA 3CJQA 4OBWA 4ZTBA 3KPYA 1EJ6A 1RI3A 1DCTA 3KQTA 1YFLA 1ORIA 3BKWA 4GQBA 1QAOA 5EIFA 2UYCA 3G5LA 5LQUA 1YUBA 5C1IA 2DULA 4QPPA 3EVGA 3HCAA 3UA4A 4YMHA 1VBFA 3UJ7A 3LDFA 3EEOA 3FTFA 1P91A 4F85A 3AXTA 3G2PA 3MB5A 5CD1A 5EMKA 5DSXA 3V8VA 1UIRA 4M37A 2IP2A 2ORED 5K0LA 3DR5A 3KQWA 3T7SA 2G72A 5GM1A 4KWCA 5FQNA 3CGGA 2PXXA 1MJFA 2F8LA 3GRRA 3EVCA 1WXXA 1ZGAA 2GB4A 1B42A 5KYGA 1PRYA 2HV9A 3EVBA 3F4KA 1RI1A 4DM3A 3M70A 4PYQA 5EMLA 4Z2YA 3C6MA 3T0IA 3BGDA 4M7RA 1G8SA 4R05A 4E70A 9MHTA 3RIEA 3T7TA 2PXAA 2E5WA 4NECA 5EZSA 2JG3A 4FT2A 4ER0A 2AOVA 3KQVA 5DM2A 2HR1A 3EGIA 4QVKA 4JXJA 2R6ZA 5CVVA 3FPJA 2ZBRA 5CCXA 3PTAA 2ZZNA 2YVLA 3KQOA 3R3HA 1U2ZA 5FTWA 2Y1XA 1SG9A 3KPVA 1JR4A 3C6KA 3P8ZA 2OYRA 2I6GA 3EEYA 4RTLA 5K0EA 5LQRA 3ER9A 3FZGA 3I5UA 2OB2A 4POOA 2PX4A 4YV0A 1SUIA 5CVJA 2PWYA 3HNRA 2YR0A 4PIMA 3O4FA 4YUVA 3A4TA 2Y1WA 1L1EA 2AN4A 3QOWA 4YV2A 2P41A 2ZIFA 1AV6A 3P9IA 2JJQA 2AR0A 2ZBPA 5E1MA 4PNEA 3G2QA 1Q0SA 3S68A 5LSAA 3A27A 2ZLBA 2P8JA 3MTEA 2OPBA 1X1BA 2AOXA 3AXSA 1XVAA 3AY0A 3CKKA 2PKWA 2V7EA 4CTJA 5M5BA 4PYKA 5HOQA 1ZGJA 3CVOA 3B3GA 1BOOA 1XCLA 5K0JA 1NV8A 3FRIA 5MHTA 1PJZA 5LQAA 1TPYA 5E1BA 3FUWA 2WA2A 1O9GA 3TOSA 5EMJA 2HWKA 2FRXA 1KHHA 3P2KA 2P40A 2JH8A 5DX8A 2P3LA 2QRVB 3LBYA 1NBHA 3FRHA 5DM1A 5EPEA 4G56A 2NXJA 1AQIA 4DCMA 2XYQA 3E8SA 2HTEA 5E1OA 5EHIA 4ISCA 1X1CA 1SKMA 4RTOA 3NMUF 3DXYA 1DUSA 3HA5A 3REOA 3TKAA 4AZSA 3BT7A 4FT4A 5CIYA 3HCBA 3HCCA 4PYNA 2OZVA 4RVFA 4WXHA 2YX1A 4KDCA 2CKDA 2AN5A 2B2CA 1O9HA 3ELDA 2QY6A 5C0OE 2AOTA 4Y30A 2FYTA 3R0QA 5ICFA 4U7TB 1RI2A 2O06A 3AJDA 3WSTA 2C7RA 3CJRA 4RVHA 4E2ZA 2IFTA 2WA1A 3LBFA 3QOXA 3TPZA 1WZNA 5FWDA 1F3LA 4E2WA 1R18A 5ICGA 5DWQA 2XYRA 5CCBA 4RTPA 4XUEA 1RI4A 1WXWA 4DCGA 3GIWA 3KQSA 4LWOA 2PV0A 2V74B 2I62A 3DUWA 5DM0A 5EG5A 4UOEA 3PB3A 3PVCA 2ZIEA 4KVZA 1KPGA 2C7QA 3P2EA 1KPHA 1M6EX 2OKCA 2HMYB 2EJUA 2ERCA 2PT6A 2EJTA 3CC8A 3THSA 3HTXA 2G1PA 1KP9A 1JG3A 2JH9A 3FUXA 4RSRA 1FP2A 1KPIA 1VL5A 3BWYA 3KPUA 3DMGA 3UFBA 4DMGA 3KR0A 4X60A 2GA9A 5K0NA 1KYZA 1VLMA 1BC5A 1P1CA 3I53A 3IEIA 3IHTA 3UA3A 5ICEA 7MHTA
chains in the Genus database with same CATH superfamily
3C4QA 1Z7YA 2Z2KA 2EQBA 4F9FA 4DJEC 1FFXB 4QPZA 4C6TB 1OR8A 4RTNA 1J8YF 3MRVA 3KL2A 5FOUA 1ID8A 3T54A 1GZUA 2LD4A 2XXAB 2OGWA 2BFCB 4XOUA 3THRA 4ZJUA 3PQFA 4K6GA 2C20A 1Z15A 1T5TA 3SWWA 4OQMA 4ENPA 1FX0B 1V1RA 3NBQA 3VR1A 4L6IA 1PD0A 2CYCA 2EKZA 5ESXA 5ARDA 4WL0A 4V0RA 3GFBA 1DOAA 1O97C 3T8YA 4RQUA 4O4LA 4KWEA 4G37A 1ZUNA 4CLOA 5JTTA 2V3CC 1WDKA 1CC1S 2XKBA 1SPXA 5TEVA 4Z4GA 1L6RA 3K31A 4WERA 3SYNA 1UM8A 1XXLA 5KINB 1VE1A 5E3IA 2IEBA 3E9MA 5LMZA 1RJGA 2Y27A 1UJ2A 1RPJA 2QM7A 1KO8A 3M33A 3SEZA 1BS2A 2O14A 2YJZA 1VI6A 1FXSA 2OO5A 4MVWA 1QC5A 4FHCA 1FVOA 5DTRA 1CFZA 3ZWMA 1F3OA 3N0RA 3TUJC 1A7AA 3PYLA 2B8JA 2X6RA 5JRZA 2OCPA 3HUEA 5KMGA 4IDEA 4BO1A 4L5BA 2BFDA 3AB7A 4O1MA 3KZCA 4XQEA 1LD3A 2GTHA 2XOEA 1OLXA 2F55A 3UUGA 1AMUA 4B4DA 1S9HA 3KPJA 1B26A 1U2DC 3QVWA 2I2DA 3X1JA 2XNKA 2FUG6 4CFYA 1OA0A 3ENVA 1RRCA 1Z7GA 1OFUX 1E1LA 3VOSA 2Y1LA 1PEKE 1BVYF 3VU9A 1YL6A 5C31A 5CCEA 2JBAA 4ZHSA 4N0QA 3LY5A 1J0AA 4JNCA 1SUPA 2FPGB 4FDVA 3WGLA 1AKRA 1JQAA 2ZAIA 5L6LB 4C03A 3KDPA 3MGKA 4KYIB 4EA6A 1KU6A 1U8FO 3PPVA 4HDNA 1YAHA 2EGHA 1MCZA 3QE0A 1W36B 1XGKA 5CDFA 1T3HA 1KZ1A 4WCFB 1Q20A 5LYJA 1YO6A 1TXGA 3QXXA 1CUBA 2A58A 4RC9A 1F0PA 3QQ5A 4LS3A 3TLZA 5E7JA 4EG8A 1NW6A 1SUSA 5U4XA 5J58A 4NMXB 1LK0A 2V6FA 1U9CA 4TXJA 1T9GS 2Z8YA 5DXFA 1OX4B 1XU7A 2MU1A 3WQSB 2WUFA 1USKA 1GO2A 3EMVA 3FFWA 2IEDA 4K03A 1UODA 3FVWA 2ZJ0A 1KFCB 4F8EA 2CF6A 4DLZA 3COPA 4OFWA 4U00A 2EYQA 3BWCA 4IY1A 4EKDA 3KZKA 1HYEA 1DRUA 1V5GA 3LVQE 2ZWMA 4MS4A 2C29D 1CY4A 4N8SA 1T36A 3SXJA 2PMCA 2YINC 5JIBA 3AQIA 4DN6A 1KE1A 1ZM9A 3L0BA 5B30A 1ISJA 1RRKA 3L1JA 3MINA 2OBMA 3A3NA 2IGTA 2QNIA 4YUAA 1QNLA 1US8A 3G1TA 4ZO8A 1W0CA 2IX9A 4NIMA 1BX3A 2BEVB 3C3CA 1VG9B 4DMHA 3QU5A 3W2TA 4LV5B 2IYRA 1SBTA 1Z0KA 3A6JA 4AC9A 3JVEA 2HMSA 4L0QA 2ZTHA 3VHXA 4Z49A 2DFTA 3ZDZB 4D02A 5IKMA 4QZVA 1QG4A 1NNUA 1R3DA 2ZB3A 3CF2A 3HCEA 4JROA 4P4SB 3R3JA 1KQOA 4YRPA 2VS1A 1FFBA 1W88B 2H5IA 3U4HA 2IITA 5EZYB 4YRZA 1XMSA 3OQPA 4NE2A 5L3QB 4RD0A 3H2HA 4BIMA 1YS1X 5T6BA 4U2KA 3GAFA 5GIOE 3D81A 3KUCA 4US1R 1RHMA 1G20E 1JIVA 3VDNB 4BZWA 4DWOA 4F1WA 4YAKA 2OXEA 4UTNA 5KU1A 2FCAA 2PFSA 1MJ5A 3ULKA 5KSWB 1K06A 4NFYA 1CJVC 1EK1A 4BFUA 3VISA 3EXHC 3JR7A 4URYR 1HEUA 3G85A 3VZSA 1QHIA 3K0KA 1PVDA 4KNYA 3V5NA 1Y1PA 3N39C 4E15A 3LDUA 3BIXA 4OAPA 3TL2A 4FBLA 1ZM7A 1EBUA 4HTAA 1A5AB 5HIIA 2EKBA 2O3SA 3G0OA 4OO3A 1OB5A 4BXOB 1QX4A 3K1JA 4R5HA 4S1VA 2XRYA 3ND5A 1Z6TA 3KKKA 5TSDA 1KMMA 3K73O 1KH1A 3OQHA 2H18A 1E32A 1IM8A 5KVSA 4ZI7F 2BTEA 1RLTA 1GNQA 2QLTA 5A06A 3PEVA 2H17A 2AHRA 1V16B 1GN9A 2WG0A 4ARZA 3DP7A 1GT6A 4CBVA 2IQ5A 3ZHUA 4NU6A 3HVHA 4HWTA 3V8QA 4CG2A 3A1SA 3JQGA 1SJ9A 4F96A 5T67A 1UAYA 2C3YA 1JEQB 2P27A 4UE2A 2HDHA 2AA3A 2FHSA 3P9PA 4GD3Q 2DEUA 4AZVA 5K3FA 4FE3A 5E6SA 1I7LA 4ZOLA 3ZD6A 2ZAGA 5KTNA 3A9WA 3PGLA 2J3HA 2AG0A 1W4RA 3R8XA 4CIYA 4A1OA 3IHLA 2VNJA 1SUWA 2QT9A 3NHSA 3DSRA 5EOVA 1RQPA 5J5AA 1L8XA 3RARA 1V39A 2CD9A 2Q49A 3ASUA 3DZCA 3ZVNA 3B9RA 1ST2A 3PXUA 4TMFA 4C4SA 4BEBA 3C5VA 4UKDA 4XB1A 3CURA 3I32A 2YWDA 4CEHB 1NOJA 3MA0A 5KOIA 5E7IA 1HK7A 3V4PB 2ECFA 3B3QA 1DC7A 4K8RB 2ORIA 3DMNA 4ABTA 1WIWA 3GEIA 3WNVA 4Z4HA 3AF6A 3LKBA 1HTWA 2QYTA 2GM9A 1FQWA 1MB9A 4B9EA 1D6SA 5DDIP 5IEJA 1QO0A 2AZDA 2HRBA 3L8HA 3SZLA 4ADSG 1T2VA 1U2EA 4L5YA 5JUWA 3NH9A 1NXSA 5JNWA 3C3JA 2AJCA 5BO5A 4OBEA 1FFHA 4JY7A 1W25A 4J7XA 3SGLA 2CC2A 4AJLA 3GBPA 4LGCA 5JVDF 3GYBA 1PK8A 4EVQA 4BJ3A 1XN4A 2W6ZA 4WK4B 1I1OA 4N0MA 3GDGA 3P26A 3KR1A 1P73A 3MWDB 1JHPA 4EARA 1O8CA 2O8DB 3BMOA 4BCBA 3LAWA 5AW0A 1VJ5A 3DP9A 4RA6A 2B3TA 3S5UA 3B7PA 4PNPA 2QORA 4JJAA 5KX5F 3PFNA 4PG5A 2VK1A 2AE2A 1CWUA 4Z9FA 3T3HA 5A9RA 1XIVA 3EF0A 3RTCA 1X38A 2PUJA 5H02A 4EJ2A 2CDRA 3LCJA 1ODIA 1THZA 3MEQA 5DW0A 4REOA 3PXDA 2FPPA 4DDKA 2CJPA 4U3JA 1Y0BA 3SFZA 1I4OA 1E96A 2H1LA 3FSGA 3H9BA 3D4LA 3UJ6A 3V6MA 4RVOA 2VK8A 3KIPA 3M0EA 4PYJA 4IWNA 1G38A 3HB7A 2E49A 2R00C 4CNQA 1INLA 1BX1A 3J80A 1KWGA 1P5HA 2A84A 5FEUA 4Q19A 5HUQA 1POXA 3Q6IA 2PUCA 1KAGA 2WLSA 4GZ6A 4IS3A 1CY0A 1WZIA 3HLKA 5FA8A 4EHFA 3BH7A 1BEEA 2WNSA 3OJLA 3HKEA 1AXRA 1GGNA 1SRQA 1PL7A 4KO1S 1CJTC 1U1DA 2FMFA 1JH8A 3FTPA 1YCFA 4D2IA 2E3JA 4E21A 1CHNA 2Q1UA 3QV2A 3EZLA 3H5AA 4IZHA 2W37A 1KF0A 3R7AA 1KR5A 1UM9A 2X3UA 2ZUWA 4QDZA 4HGZA 3VU8A 4O4JF 3UHOA 5LBIA 2K7ZA 3WA7A 4K2HA 421PA 3WJ1A 3DBHA 3TBFA 1QANA 5IPFA 2IUEA 3UCXA 2WJ4A 1JMYA 1MZVA 4XIFA 5JS8A 4OQYA 3ME5A 4M1TA 3WLAA 3G6WA 3T9EA 5EE9A 4EYKA 3THWB 1SVKA 1QF7A 2WMOB 4AK9A 4DY6A 1T6ZA 1OW3B 3VPGA 2NU9B 1VJTA 4YPFA 4DCCA 1R10A 3G6KA 5H70A 1ZOLA 1CDEA 3IX7A 3E8XA 4KRYA 4BKRA 1P17A 1YJAA 4BWGA 3ZY5A 2PSDA 1TQHA 1UANA 4ZHQA 3HKEB 2YXLA 2Q29A 3O74A 2UYOA 4M3NA 5EE0A 3WDSA 4BVHA 1CR0A 2HI0A 1H2EA 4FS8A 1PZGA 3RUPA 3E9QA 4I55B 3W3ZB 1R0YA 3KT6A 4AUMA 5FHQA 2VUSA 1NM5A 5T5QA 2V5AA 1YA6A 1RWPA 2FSVA 3N2LA 2WPNA 3H9JA 3FE2A 1AXEA 4LDNA 1NI5A 4R98A 4KR7A 1YI8A 3F2IA 1XA0A 4CGYA 1TO2E 5LA6A 1VM6A 2V65A 1T10A 3VVMA 4ZQFA 5HXAA 5DNWA 3KWJA 4BP3A 1V8PA 4URFA 5C32A 3WL4A 1SC6A 2LZ0A 3K2IA 3SQOA 3JQQA 3ENKA 3IE0A 3KKNA 2GJKA 1BROA 2Q1YA 2I22A 3MS2A 1L4KA 3RS3A 1XTTA 1OGYA 3HA7A 5A5DA 2RH8A 2PRKA 2Z98A 1T1JA 2BMJA 2UZ4A 2GKSA 4ZCSA 5G0SA 1LRKA 4OBWA 1V8ZA 4GO1A 4PX3A 3WV5A 3HE3A 1JWAB 1T29A 3ESCA 1U7DA 2QQFA 4AN4A 1QAOA 3I9MA 2BEJA 3GUZA 1X2EA 4C4RA 3UA4A 3W77A 5BV8A 5GZ1A 4DC1A 3GLQA 1KQNA 3FTFA 3WYAA 2HFKA 2D7CA 4COOA 4GNKA 3UH1A 1CCWA 4CTOA 4Q7KA 4TKZA 2G80A 3WVNA 2Q0XA 3VR6A 4FD3A 3L6RA 1OTHA 2B94A 1N1MA 4FK8A 3SS8A 4YPVA 5U1PA 3Q11A 3I1FA 3Q5GA 5ECWA 4E4YA 2F9LA 3O82A 3GLFE 1QGYA 2Q5EA 4DRXA 1N6IA 1TLFA 2F8LA 1Q16A 5TF4A 1WZUA 2J3DA 3VA7A 1X7DA 1PRYA 4EHDA 3TLGA 5JXGA 4Q4HB 1KMHA 3VKFA 1C30A 2JIZA 4NBRA 3W9UA 4R05A 1XNRB 2YN0A 4WZBA 3T7TA 1N5DA 2WJWA 1JHRA 3QVTA 3I61A 2FMTA 2I9PA 2XQFA 4K40A 2QPTA 3AG6A 2QAJA 2XV1A 1LQTA 2HYDA 3AUFA 3I05A 4NBKA 3ILSA 4JXJA 4PICA 2IW1A 4JITA 5JW6A 1YVPA 1BFDA 4UNIA 1LBIA 1WNTA 2D3TA 5LDDC 2ZRLA 1JX6A 1S3SA 3RYCB 2B4RO 2J33A 4FD2A 3NIDB 1JP7A 5AVUA 4MLDA 2CUZA 3KPVA 3L6BA 4ZCRA 1U80A 5DU2A 2YYZA 1GUYA 1Y9EA 2FSHA 3C48A 5EUMA 3JATA 2VSYA 5FPHA 4NMLA 2P0EA 1Z73A 2W4QA 3TZEA 4ARZB 2DFPA 1V25A 2FMIA 3HSSA 1XKQA 5C7LO 3M1YA 3KVOA 5EJEA 1PFGA 4QEDA 3T1NA 1RC0A 1Z5PA 3DG9A 3SF8B 4C3UA 4YJGB 1MO6A 1IZYA 1NULA 3IIIA 3PSAA 4ZN6A 5LXTB 2JGFA 5CFLA 5T41A 1CERA 4NCHA 5BN3B 4BNGA 4BV9A 5HS4A 1CUAA 4RHTA 1Y80A 3W9BA 1M7BA 4D1YA 1H6BA 2CD7A 5EJ5A 4Y2VA 3CYFA 5BW8A 4INAA 1EZ1A 2BM0A 3KXIA 2OTCA 1M2NA 3AHGA 3F5DA 2Z4TA 3FOWA 3MUOA 3CXUA 4FGWA 5HCUA 1X8XA 3N7TA 4ZQBA 1U9IA 2FFRA 2JI9A 2PPVA 3FCXA 5E1BA 2NACA 3EIWA 1Z2DA 2WA2A 3EASA 4FDMA 5D7BA 5KQLA 1KHHA 1P2DA 2C7RA 2JH8A 4R1LA 4AP5A 3HYTA 3OZXA 2JRLA 4DJJA 4QDTA 1LBEA 3FR8A 3ST7A 2X4LA 3KVRA 2XOKD 5AXBA 3RHTA 5IN5A 2R8ZA 4DCOA 5LD2B 1L6IA 2BP7A 3PCRB 4LMPA 4C0JA 1XRSB 2JLQA 3EE6A 1KI7A 2RAPA 3AGQA 4J16A 5BN5A 5EYPA 1PT5A 2VP4A 1GPJA 3HCCA 1GLVA 1J0EA 2LKDA 1P80A 2W93A 3GFQA 3H17A 4XDGA 2B2CA 4PEVA 2HWYA 4URUR 4IOJA 3PX7A 2B4QA 1RCTE 4FZ5A 3TVDA 3MJSA 4NZPA 1CQJB 4DIDA 2JHGA 4M0EA 3GLFB 1PL0A 3ZCTA 2ID7A 2JFWA 4JKYA 5WRFA 1MV8A 4XYMA 5HRCA 4RPGA 1Z4JA 1F9AA 4TYMA 3OA2A 2PH1A 1WZNA 3ZEAA 1GGFA 3WLSA 5BSKA 3S3TA 2ZJZA 4JGGA 3IT1A 2H2DA 3AM4A 4WLFA 4B31A 2SNIE 3UMVA 1FVHA 1I33A 1U7XA 3NAGA 2J4CA 5COQA 1DBRA 5EG5A 2FH5B 1CZRA 4OGKA 4RADA 4RY0A 1QZUA 5ICMA 2OVFA 1XZBA 1P5FA 1Z6XA 3L82B 4KR9A 2HMYB 2PT6A 4YRGA 1PEAA 2WWHA 3C6ZA 4FYYA 3SC6A 1YL7A 2PH3A 2ZJBA 3KKQA 4OUDB 2KI5A 2RJNA 4ZAXA 1UZLA 4MGKR 2HIGA 3LBNA 3UFBA 4JBLA 2XGGA 2QVYX 2MSWA 3C14C 1RZUA 4J2HA 1RAEA 4OHCA 4ZV7A 3LF2A 1VLQA 4N0EA 5JY1A 4MUEA 3B1VA 3GY0A 3H2ZA 4MJLA 1EDDA 4LYEA 2MIIA 4CKCA 1E9EA 3LCUA 1Z4OA 3D4BA 1XFDA 1ONNA 2AJ8A 2G17A 1NRIA 4EB8A 3LCRA 2AB0A 3G68A 2WYOA 1B2LA 2ODAA 5CEJA 4CM6A 1DAHA 2C4NA 3HN2A 4MVJP 1X15A 4PC1A 5KTSA 3O4IA 4XIYA 1HC7A 4IGAA 3PDIA 2QT1A 4MV8A 2BGTA 2Y6VA 1XCGB 4REMA 4DCJA 1RXVA 2C78A 4XYBA 1E1DA 1MRZA 3L9WA 3N1UA 4CL8A 2R6R1 9ABPA 2DWCA 3ICVA 2WB2A 2A4MA 2NSLA 4RWZA 3X2FA 1OU0A 3L0CA 4L08A 3A4IA 3G2JA 3ZV6A 5TEWA 5JWOA 4BGEA 3O8CA 1RZ3A 2RSLA 2PUAA 1LPBB 3JAKB 3LPLA 2H06A 1O3YA 1KIMA 5K1ZA 1WUKS 3TLXA 2DSTA 8MHTA 3AIKA 2RMKA 2VJLA 3DDSA 4QBHA 4CEJA 4NZNA 721PA 1R66A 2HWWA 3A9CA 3P4UA 4XASA 4BUJA 2NADA 1WDMA 2XMZA 2HRQA 3KKEA 2FQ1A 4INPA 4QXMA 3PD0A 2O3JA 5D87A 1KERA 1DJMA 1N8SA 2QD5A 1USVA 2R85A 3DBOB 4MR9A 2GZ3A 2ZCJA 4N8DA 1Y82A 3L18A 1UXOA 2GPYA 2NU6B 3D3EA 3W2EA 3WO1A 3DZFA 5E4FA 4TRMA 1A2KC 2NMVA 2VF4X 3A9RA 1RBYA 2P9GA 4QFDA 3TIVA 5EIBC 1JKXA 3V1NA 3RWBA 4UPEA 2XA1A 1BCRA 5DHSA 5P8WA 2WK1A 3ZYCA 4QWWA 4D0SA 3SLKA 1TZBA 4G8JA 3EG9B 1G8PA 1G2IA 1RBQA 5BXYA 5ALGA 1GGKA 1FSFA 1OKKD 1SCQA 1S96A 3HKCB 4CDNA 2FQQA 4M2LA 1SY7A 3I58A 3N8GA 2PFGA 3HPRA 4I7EA 1CEQA 4I9UA 4J0JA 2YKGA 5D1NA 3LG2A 1GTG1 1J07A 2QL9A 4LY0A 3DBIA 1SCIA 2V6IA 1NLMA 2FR1A 1ENOA 3P20A 3B1XA 3WHIA 1V6CA 2FZCA 3DZBA 3PICA 5TJHA 4XCVA 3OOEA 2C2XA 2GNOA 3B78A 1DCFA 1MG5A 2G63A 3MBKA 1ZW6A 5EVCA 2WSMA 3RAEC 1LF5A 2JGDA 4MW6A 1LTHR 4NESA 3O2NA 1P1IA 1QMPA 1NZFA 3GD7A 4HRVA 4I19A 1A50B 4AYWA 3PFGA 3O9VA 3I6MA 2VDUE 2LIPA 3RK0A 2XECA 3C7CB 2OV1A 3VPAA 2ZCVA 3VZCA 4ZFNA 1T5BA 3MYYA 2PTHA 4K86A 5FX2A 3E22B 3AVUA 4MRVA 4Z6KA 3E9RA 1J5XA 3F5MA 4JJ4A 1KTIA 1LLCA 4Y9RA 8ABPA 1SO8A 5EQFA 2NVOA 2V59A 4BVGA 2ZYVX 1QGOA 4PGFA 4PRKA 1Z37A 4GAEA 3E3AA 1WDTA 5C34B 3CLSC 4EYGA 1CVRA 4D4HA 1ISFA 4EGJA 4CIAA 2JLCA 4CMAA 1N5RA 1PAUA 2EHJA 2GN1A 4OSOA 5F77A 4OX9Y 5CB4F 4UQLA 4M86A 3A1EA 2GBCA 4GPAA 3OPNA 4YI5A 3JD2A 1QRRA 2A0WA 1Z26A 1OMOA 1L5SA 2ISCA 4RZXA 4MR9B 1LKZA 4Y2HA 1YASA 3VZRA 5AKHA 4AG5A 5J43A 4TKUB 3UXHA 1L2TA 3FI9A 3TRFA 1SQFA 3TOCA 4YP9A 4QBGB 4OAQA 5ELLA 2I87A 3JQBA 1MW9X 3B38A 5D3KA 1JE1A 2ZAYA 4YN3A 5IEBA 3CZAA 4OK6A 1KSHA 5BPHA 1E7QA 5FTMA 2EFCB 1RAIA 1X6VA 1PG5A 2QRMA 1OOEA 4OP3A 3M8KA 2VHYA 1IY2A 2RC6A 4W8GA 1B4DA 4ND7A 1R16A 4PGAA 3VR4A 3ZJUA 4UNPA 1FJ2A 1JJVA 2CJFA 2HJ9A 1JKJA 4LNHA 2WHPB 2GAFA 4DT1A 3F6BX 2O2YA 3LT1A 3BJRA 5DISB 5BW4A 4FP9A 4KV9A 3SI7A 3R6WA 1HYGA 1L4BA 2I99A 4UARA 1Z2OX 3WK5A 4M8SA 3TGWA 2C03A 4Z9BA 3SVZA 1FYFA 2EZ8A 4HVTA 5CLFA 1RQLA 1R2QA 5TQJA 4HOYA 1XF9A 1JTEA 2QXTA 3T94A 1VXRA 3IQZA 4M89A 1NA5A 3UV7A 3QEBZ 1M34B 4YRKA 4F4UA 1S6YA 4LJSA 5KQMA 2QAGA 2QN2A 1BD3A 2FPUA 2Q9UA 1WB6A 3ENZA 4G5GA 2DGDA 1CY6A 4GR5A 4FSXA 3HFSA 4QQKA 1V43A 2FWBA 2P77A 1W8IA 3RM3A 3SHWA 4JP2A 3AH8A 1YE5A 2ZBDA 3ND7A 4YRNA 1YI0A 2MSNA 2IL1A 2XA2A 1S4QA 1VGRA 3GFSA 3KB8A 3NBMA 4IVNA 2D2IA 2ZR9A 4L2IA 4TYPA 2XWJI 1M8GA 1RQGA 5B3JA 2O8EA 5C1DA 4C04A 1H1DA 3QJGA 2BUBA 4FDLA 2CL7X 3SP1A 1P0IA 3K6SA 1MH1A 3QHAA 3QXHA 3UHJA 5JALA 3TSCA 1A04A 3Q9UA 1OC4A 4C7MA 1EGAA 4MB2A 4WCDA 4ZCLA 4OQZA 2JS7A 1YR8A 1J2EA 3PLRA 4QQ8A 4CJXA 4NZ9A 4XUGB 1BJTA 2V54A 3KHKA 3BK7A 5E3JA 5IXYA 1RYNA 2A5JA 3FMOB 1UOPA 2BR4A 1VYTA 3ZHBA 1VIYA 3D7KA 2R5WA 3PNMA 4H6XA 4R8LA 5T8KA 3UJNA 1IBLB 4RY9A 2BGGA 1D03A 4QNRA 3TCNA 2GCPA 2FZ5A 2RK3A 4IWXA 4X7BA 1NKVA 4XWOA 3ON5A 4CEIB 2ZQYA 2X1MA 5DGXA 1JHYA 2VH2A 4JUIA 1OAAA 3TUIC 1EQUA 2RB4A 1L5NA 4RTKA 3C3YA 1Q92A 3B9QA 2E4WA 4EQZA 1IUOA 3T1OA 1USIA 1E18A 4ZVVA 3JQ7A 4MUGA 3GI1A 1F06A 4FZJA 1DV2A 5IBRA 5LA6B 4B71A 3E8MA 2XR1A 2G4CA 3QOFA 3U4IA 4HSEA 1ULTA 1X7ZA 5LP1A 1W75A 5FO1A 5IM5A 1X9GA 4JU9A 2GD1O 3BC1A 3ZHRA 3R3ZA 4R81A 3NCHA 5G0TA 1VCHA 1MF7A 3AF0A 4PLPA 4CRWB 3JVVA 4IYJA 3F5QA 3TTUA 3EVEA 2G8LA 1NOIA 2XF8A 4NOLA 5EXPA 3BYZA 6PFKA 2J6HA 2J8ZA 4AY3A 1JFFA 1UPAA 3N6RA 4Y6SA 1NDQA 1C80A 1CJSA 1L7AA 1N25A 2YJ4A 3NT2A 1TA4A 5B6PA 1EK2A 4DXDA 4DUYB 4KL8S 3VFDA 4DMLA 2QSZA 4V0NA 2UYQA 4Z2AA 5BWLA 1ZOIA 3MCVA 5A5FA 2GHIA 4MQFB 4HR7A 2JCGA 4KE8A 4RH1A 4DQUA 5FCDA 2FPKA 1E3JA 1GG5A 2HA2A 3VUEA 5EQDA 2EW8A 5I7FA 2ZJ8A 3VHRA 3INRA 3WNQA 4H77A 2D13A 1XT6A 5CW2A 1DVRA 3BF8A 5ENVA 1DKOA 2BFFA 2PZLA 3GAZA 2WWIA 3IP9A 4IILA 2QZPA 4L9SA 4QXRA 4YQEA 1MHPA 4BE7B 2IS2A 1QCCA 2Q1WA 2AN1A 1KSJA 3B13B 3BIFA 4UM9B 4B82A 3BZUA 3BMNB 3ZCUA 3TB4A 3TL6A 4JQZA 1WBBA 2NOAA 1UBSB 1LNQA 5BR7A 3K1AA 1MN6A 1KYXA 3OVMA 1Z25A 4BUZA 1RAAA 4ZDWA 1PFWA 2CVFA 1GQOA 1P44A 1Y1TA 2WIDA 3PC2A 2NPIA 2B21A 2COEA 2ALJA 1ZH8A 3Q9SA 3G82C 4G5YA 2V7PA 1G8GA 1UZMA 1U3TA 3L6EA 4YRRA 4EAQA 5BSHA 4QRHA 5AW9A 2JIOA 4WN9A 4KR3A 5J47A 1I7PA 2HMVA 2I9KA 1KJQA 3NB0A 2BGJA 1BYIA 2Q5CA 1ORTA 1JB9A 2VF5X 4ANFA 2IXAA 3OHMA 2QW8A 5CCDA 2ODQA 2PANA 3EFEA 2QYOA 4R9NA 2VLBA 2L2QA 1RR6A 3NWPA 1ZI8A 1FXWA 2L42A 3JSXA 1NVEA 4L5JA 5GJWC 4WBNA 1VECA 2IH2A 2EV9A 3AHJA 3E5NA 4RZUA 2ZS9A 4JKIA 1DNPA 1HDRA 3A2NA 4R84A 5FULA 4Q34A 3RAGA 2Q50A 4DBVO 5F21A 4YT8A 5H4HA 2XB6A 1NSTA 4A8JB 2V6JA 1G4UR 4XR4A 3T5CA 3T1TA 4N65A 1EM8A 1CUYA 2RAVA 3RYIB 4NPAA 4UD6A 3KQTA 4ZPJA 3IIJA 4KFTA 1PR0A 3DE1X 3G5LA 3RTDA 3DFFA 2XI4A 2Q6TA 1CR2A 1TK2A 3GG2A 1XDBA 4RZHA 1P4HA 4GX1A 4F85A 4JLDA 5KYYA 5JDCC 2A33A 1ZCJA 3SE7A 3LVBA 2XYPA 1YK0A 1CR6A 4B45A 1ATZA 4S1WA 1OWLA 4RK1A 1YZFA 4Q3KA 2P69A 3SZUA 3EXFA 4QYWA 3LRPA 5D86A 3IEVA 2OILA 1HZZC 3FZEA 1JAZA 1OI2A 3MAJA 1CJCA 2OV2A 3NNSA 5SZJA 1P45A 1B42A 4EJSB 4G5RA 2IUFA 3WICA 3GLSA 4YCCA 5KX5B 2RHHA 1GCAA 2WAXA 5D00A 1SA0A 4QWMA 2QENA 3A9SA 1U0TA 2OLEA 4BS9A 3IUYA 5KJ6A 2C9ZA 3K70D 2BPOA 1XMOB 5ECGC 3RUDA 3SJBA 5JATA 2FZKA 1RCFA 1KDOA 1XQYA 2OMKA 3SN6A 4IHKA 1UAAA 2JG3A 5DM2A 3KQVA 3KP1A 1DFGA 1T2UA 2OECA 2ZBRA 3DVLA 4KQCA 4LVUA 4MVJE 3PTAA 4O0LA 4JU8A 1W2GA 1PJRA 4NMWA 1QQTA 2B0CA 3HJRA 5ERYA 2E5LB 3FYUB 1I01A 1ZN2A 4RIEA 2W2QA 1E7RA 3B7WA 3PPXA 3PUZA 4G5HA 4GM1A 4XDZA 2WU0A 1CNMA 3VPBA 4FYPA 3N2IA 3BTUA 1T4MA 1IZ0A 3HNRA 1F2UB 3TDKA 1G2PA 2C58A 2FRDA 3H86A 5A4FS 2VVTA 5KNCD 3DGFC 3IKTA 2GM4A 4EPRA 3D6TB 3P9IA 1H9AA 2JJQA 1I2BA 1PFQA 2A1IA 3PFCA 4NU0A 3ZKWB 4A5OA 2RH9B 3AERA 3T7JA 5B7QA 1G5FA 5T4FA 1LEHA 3QVGA 3GEEA 2FXVA 1E0AA 4X54A 1VKJA 5L4NA 2IBMA 1W85A 1JQLB 1MRSA 2C9YA 1RQ2A 1BHO1 3PE6A 4B34A 5FBVB 5KYXA 3THXA 4PYKA 3OMXA 1VZ3A 3PG5A 2DERA 5K0JA 1KYTA 3TW8B 2Z4RA 3WLEA 1HLDA 2XD9A 2F3RA 2VTKA 1GPKA 4LF9B 3COYA 4NARA 4NEHB 1TPYA 2XB8A 3W6NA 4IHJF 4ZANA 3WGMA 4EKYA 3PEUA 2LCIA 3DA8A 3MJCA 3UAZA 2M1ZA 2NQ2C 2CJYA 1J24A 3P2KA 5DX8A 5ADUS 2VXBA 5FTNA 3W6UA 4YJ2B 1KXJA 4ND1A 5ENDA 1YA4A 1DG3A 3KC2A 3W4IA 5HFNA 2RBEA 2C2MA 4TRNA 1EBFA 1DB3A 1WHTA 1WZEA 2IOFA 1NJSA 2A67A 3AFGA 1IYZA 2WVGA 4KG7A 3ZWOA 2ZKIA 4EQ6B 5KTMA 2O19A 2W6JD 3TH5A 3SIRA 2GZ1A 2EATA 1QYWA 4HS4A 3KCNA 4EIWA 1R4MA 3NOXA 1E64A 2IZ1A 5GMOA 4LA4A 3GEHA 4R0VA 3U0VA 3OX1A 4MYTA 3UFXB 5JZSA 2C97A 5JDIC 5L3SB 4UUMA 1LZKA 2PWAA 1YMVA 3K05A 3ANLA 1ZMTA 3LYLA 4BRZA 2XNDA 2RD2A 4U5QA 2A9PA 2BZ1A 3IXMA 3NHWA 4YMUA 1GFSA 2XJ4A 3WNCA 3W8FA 3D6HA 2OGUA 2PU7A 2PUWA 4U7HA 4OHRA 1N2CB 5J2TA 2VIIA 2A9VA 3BRWD 2AD1A 3JD0A 4KR6A 3P9YA 4IO0A 4WSOA 1KVSA 3WV4A 5E6RB 3IL2A 1M6EX 3CC8A 2NVBA 3EXIB 2XUGA 2VL7A 3MLEA 3PC3A 4Q5IA 5FWXA 3LP8A 3FF4A 1WUHS 4NAUA 1DDGA 2BFAA 3BTSA 3V8MA 1L4FA 1ZK3A 4EY3A 4HX5A 5F52A 2B1QA 4O02B 1VE7A 2JFBA 3GGJA 2CBXA 3NR2A 4LSWA 4OL0A 3F7NA 1VGVA 3O92A 4RBNA 4X1KB 4BQFA 3PFIA 3U3KA 4J43A 3FXAA 3RT1A 1FCJA 2OCAA 3IVXA 4G1BA 1ZJZA 3HXTA 3IB3A 3KTOA 4UTRA 4OBXA 4YECA 3U3OA 1DXOA 5AXCA 2BFNA 3C2QA 3WWEA 4AJIA 4DBZA 1QRAA 3NEYA 1PX0A 2O2ZA 4C0HA 1SKBA 1U02A 2XMQA 4WN9B 2ZRAA 3HYRA 5GONA 4EL5A 5JC1A 1RYYA 2VYCA 1XDUA 3R3YA 1J8FA 5ALKA 1JFLA 2ZI6A 1D4OA 4D8VA 1BDHA 3IHKA 2YQ4A 3MWLA 4KE6A 2HV8A 3D3WB 3GJ6A 4WLNA 1T13A 4C0KA 4TYWA 1OLXB 3PFBA 3DZHA 4HDCA 4IH9A 2PO5A 1QU2A 3REQA 3BBPA 4HTFB 4OTZA 3ZIDA 1MP0A 2ZWVA 3L4BA 3RS9A 1P4GA 4UUBA 1M1XB 2FPWA 2JD2A 2O7NA 3KFVA 3I9V6 1Q0LA 4U02A 1QZ3A 3QH4A 4B0PA 2JIQA 1XCMA 4TWIA 4BN0A 2IF2A 2D7DA 2QGFA 3PEYA 3BH0A 3IBTA 4F7WA 1H66A 4S0XA 4EYQA 3NTOA 4WBXC 5E6SB 3U44A 1EAMA 4I4IA 1ARZA 3PNVA 3H18A 4EHJA 1A2OA 5CU7A 4HHEA 2IDJA 4PZCA 4AJKA 2O23A 4GPTA 5CURA 1K2VN 2FUNB 1YHZA 2ET6A 1BHSA 4JT2A 3BORA 2FOXA 1QG0A 4Q9AA 1E6EA 1LSOA 2KMLA 3LH5A 5JZVA 3JVUA 2CDBA 2IXFA 4G8DA 1Y7LA 3PR1A 4RW0A 4PSAA 6LDHA 3AV3A 1Y3CE 1SUFA 4LVNA 4NBLA 4GZLA 4LZOA 3REFA 4RDXA 1RLJA 3EOBI 2BEWA 2X9GA 4ZAZA 1X3LA 4PHGA 2FWPA 3M6UA 2OYSA 3NW9A 4G23A 1AKEA 1RRVA 4GF5A 1V5EA 3EGXA 2WDPA 3UWKA 1PR5A 5DI3A 1CS4C 1ZVVA 5IAJA 3RSOA 3HBAA 1G6OA 2BGLA 2FKNA 2RONA 3C7DB 1F6WA 4LRUA 1QH9A 4UBMA 2XTNA 1KOFA 1G59A 3ET5A 1DO2A 3RSGA 3CHYA 5LIRA 1AKQA 5AXDA 1T9KA 1IDOA 3DTVD 3MINB 3K96A 5DX1A 2P2DA 4O63O 1RIFA 1GU0A 2Z43A 3DAOA 3KZVA 5KYWA 4WXRA 2F8TA 1XE3A 3RWOA 2AIRA 2EJBA 5ILQA 2EZTA 4YMTA 1ZQ9A 1H1LB 1M74A 4Y8VA 4ZMSA 1OBFO 4WH0A 2CE7A 1E9VA 4MKIA 2O54A 3DDZX 3WLFA 5KC8A 5JSFA 3DL7A 2X5XA 1D7AA 1NQXA 3UMJA 2JDIA 3NLLA 1G55A 4G0XA 1S2MA 5E1DA 3TDMA 4FMDF 4P7FA 3VHXB 1ZRMA 1RZRD 3WB2A 4JBNA 3EC7A 4OXQA 3AONB 3MHTA 2EOAA 3HDGA 4C01A 4HQOA 1W93A 5F2OA 2WF6A 4FKBA 1TYAE 3AU8A 1ZOOA 2MDTA 1B3RA 4D44A 1VXOA 5KJEA 3DKIA 2BDTA 3PC8A 4MCAA 2GWRA 2W8BB 2CLOB 2CZCA 3EXAA 4ND5A 2JFZA 1IZZA 3ONDA 4W5TA 1HXHA 1U0HC 3QF4A 1ZA2A 3JALB 2VHEA 1QPGA 4NSNA 4K6HA 1JEAA 5G53C 3T52A 4DARA 1VP9A 5HUHA 3WKBA 1EUCA 1H22A 5EMNA 1QHSA 3FYSA 1MB4A 3GDWA 4IBOA 1IQPA 1SCAA 3SVLA 3OZSA 3UGJA 4E3WA 4Q1FA 2V96A 3J7AC 5EJGA 1E0JA 3H0CA 3I01A 3WIEA 1E1MA 2PWZA 5I5EA 5BSGA 3EEFA 1ZUD1 3RK4A 1CYEA 2IPOA 1TKRA 2QQGA 4ZV4A 5FPPA 1Y7HA 1MIHA 1TTTA 1OBOA 1U2DA 3MTBA 2DC1A 1NUAA 4MCIA 3LS2A 3OJFA 5AJUA 4P32A 5A62A 1NVVR 1Q0ZA 1X86B 1MX3A 2G9VA 5EERA 5DPMA 3W5AA 2Q4EA 4XM0A 2FN3A 4TUYA 2J46A 3AVQA 5DLPA 2JFVA 3CW9A 4ZT4A 3TRKA 1SG6A 2QAGB 3NHMA 4Q9IA 1JEYA 1AGNA 3AEUB 3I6IA 3NXKA 3WGYA 4JR1A 4A6PA 4KLAA 5FB3A 4PN7A 1V6SA 3EG9A 1J7JA 1UDWA 4Z7OB 1E6CA 3ZQKA 4DC9A 5I7RA 3MLBA 2IVZA 3B82A 3NTVA 4M7WA 1T0JB 3WWYA 5IDXA 4JI8B 1V48A 4KBGA 1NIJA 1UCFA 2VJYA 3H4MA 3IEPA 1Z56C 3PHHA 4FC6A 2P9TA 5D51S 3LW7A 4KQ2A 1GT91 3GBSA 5G02A 2PWPA 1YACA 3AVTA 5BRNA 2RGWA 4E2XA 1YB7A 1UBLS 3QU9A 1VBMA 1CNEA 5EIWA 3T06B 3RREA 1BFUA 3JWIA 4L8LA 2LNDA 3EHEA 4XFDA 4O2BF 1FMCA 2DPGA 4I1PA 1EFLA 1RBZA 1Z6QA 3PWZA 4CKWB 3FVTA 2CHUA 5DHAA 3U4MA 1Q6YA 1R00A 3EJ6A 1O6ZA 1QR6A 2I2WA 3D3KA 3NJ4A 4O4JA 5JJLA 4QU8A 4E4TA 3BMNA 4EA9A 1P3Y1 2PSJA 2YY7A 3GAMA 3GJXC 2X2FA 4KGXA 2PZEA 3VR2D 3DXFA 5A1JA 2FW9A 2YTZA 4FGSA 5AMXA 1TLTA 1ZD3A 1RRPA 1UPTA 4FGZA 4B3IA 4WY8A 1ORVA 2O5RA 4B6GA 1Z3IX 2CJWB 2Q41A 3T34A 2JAWA 1X19A 4NHEA 3I8OA 4QHYA 3SMVA 3W5UA 4M0PA 1N6HA 4MA0A 1N32B 2QN8A 1MW8X 4P35A 3A36A 4WFKA 4HEJA 5EP1A 1IPEA 1NKSA 2ZJ1A 2PS3A 3NKFA 1OGIA 2ETXA 2HDNB 3ENQA 5K09A 4LOJA 3CLUC 2Z57A 3WRYC 1JHZA 1MRNA 3CSSA 3F6PA 4JI6B 4BLRA 3LW8A 4PQRA 1M0TA 3W6OA 1CTQA 2EWVA 3IP7A 1LSUA 1FFCA 1N1GA 3L7LA 3QPBA 2DOKA 4QHSA 2CMKA 5HWSA 1QH8A 3A6KA 1J8DA 4L3OA 2ZRCA 2GN2A 1QTRA 2XUJA 3OPXA 3OSUA 4IIGA 4KR0A 3DVSX 4JS0A 1W73A 3FYDA 1NC3A 3EVNA 3CZPA 3K0AB 3MPOA 4IAOA 4Z99A 1QUEA 5F51A 4XRRA 4UBKA 3S28A 1EWKA 3SZOA 1N6KA 4J8PA 4B3SB 3R74A 4EBBA 3PU6A 1KKUA 2GPSA 3FYTA 1E3TA 1LSJA 1L5HA 1ECCA 2VRNA 5D6OA 5K6AC 1YOVA 3TINA 1FS4A 2JDID 4BNKA 3DLCA 2HQSA 5AM4A 4DILA 3E82A 2CZGA 3GIDA 2YWBA 4S3MA 4CT4B 3QXJA 2C7BA 3HC7A 4FZVA 1WMAA 5A1TA 1G21E 2C3UA 1J0DA 1QDLB 1Z2PX 5CDHA 1U1FA 1Y7TA 2DQ4A 3BMXA 4TTTS 5FKJA 2OHFA 4TRRA 4BECA 2OENG 3PDUA 3ZBTA 5MGNA 1YS6A 1RHJA 1E2HA 4H0NA 4TQAA 5BUCA 3ONWA 2GF9A 4D0GA 3A37A 1FYEA 4WNCA 1HNNA 3UGTA 4AF6A 1R0LA 4KQKA 4WD3A 2YZ7A 4G85A 4TXMA 5LZ2A 3UYKA 4LVCA 1ZMXA 2ORVA 3Q0TA 3H99A 4GFDA 4D9BA 1XLUA 5JU6A 1YJQA 3ZHTA 2HUPA 4ESOA 3ZEIA 4OI0A 1XZDA 2PRIA 2OLJA 4QD3A 1QGUA 2OVBA 1U3CA 4LGMA 2OHJA 3DE7X 5AKGA 3ZE2B 1HOXA 3GP3A 4TZ0A 2VG8A 4L0MA 3GO4A 3U62A 5ALPA 3DR3A 1RP1A 2VQ3A 3TW6A 3OU6A 3DB1A 2LWIA 1PYGA 3H8VA 2B1RA 3F71A 3D8NA 4ZU6X 5L53A 3PL1A 3SG0A 1H1LA 5AVWA 1EVJA 1KZ9A 1OPRA 3GCDA 1SULA 5D8DA 4P2GA 1H2WA 4AY4A 5KMGB 5DMHA 3VYSB 1M8FA 1RAGA 3HDVA 2VPXA 3ROKA 3A3KA 1SXJB 4H4DA 3S81A 1RRGA 2XD4A 1WPRA 4W6QA 2J9GA 3SZ3A 4K2AA 4ROSA 2I34A 4P84A 1NVVQ 4O4JB 4Q1AA 3DZJA 4BLWA 1KL7A 3AUTA 3JQBC 3OEHA 3PC4A 5JPCA 2INGX 3K8ZA 5IDVA 5B2FA 1XDDA 2DFNA 3KKZA 1YK1A 2VHTA 2CMHA 4PYIA 2I8AA 4HVLA 1EQ2A 3DL0A 3VSDA 1I32A 3C3MA 4F92B 1FDVA 2KLHA 4IDPA 1EP1B 2XUDA 4RHFA 1XVLA 1J97A 1N2XA 2X6TA 3E9EA 5HZKA 2AYZA 1UC4B 1B00A 1DBSA 1QE3A 2PNFA 5DNYB 1ECGA 4BP9A 5JO0A 2O0LA 1OY1A 5LIPA 5IM4A 3TRIA 2Y0DA 1GPWB 3HCDA 3NH6A 2RI1A 5JJIA 4PS0A 2Z6UA 1E6KA 4XJTA 1Z83A 1FRFS 1Q1GA 2AXPA 2BFCA 2C07A 2JAXA 1UH5A 2DBZA 2REOA 2V97A 1P3DA 4EKIA 4BRUA 2UYHA 5SZHB 3UB4A 1E9FA 1KZ7B 1NONA 2IYAA 4CHTA 3G5TA 3JS5A 1SXJA 2CXRA 4HFNA 3RUFA 1GPH1 3OLYA 3VNQA 4EELA 4KQWA 4YI3A 1Y34E 1U8ZA 1PTJA 2WF9A 4JI4B 1QIMA 1ZL0A 1G291 2HJSA 2M6LA 4QUJA 2ZT8A 3CZ9A 3WDKA 5C8XA 1BHJA 1JHVA 4RD1A 4U63A 3SF8A 5IT9A 2G70A 3LLSA 3FMFA 1C3EA 3GCGA 3TLGB 2E89A 2WJVA 4DLAA 4RVCA 4CMJA 2JI6A 2X8AA 4FHDA 4HPJB 3WP0A 2ZRDA 4E46A 4BJ6A 1TFUA 1WP9A 2Q3HA 3R5XA 4Y1RA 4KXFB 2QRUA 4NEQA 3URMA 2CYAA 3AKCA 3ZWBA 2RGRA 1AS3A 4UNNA 1MEEA 3PNBA 4CM4A 1DTEA 1P2BA 3A9TA 4B83A 2B35A 3FKSA 3H2JA 1MT0A 2B1GA 4KPUB 3EIXA 4AUEA 4IQ8A 3V8VA 2NUPB 5B64A 4KRFA 1ORDA 1SKQA 3EQZA 3T7SA 3PXEA 1DQPA 3PD1A 4FYJA 3D4PA 4JZYA 1WMSA 1TJNA 4RJTA 2PXXA 1HZZA 5BVGA 3I2FA 1SB8A 1FE8A 1HFJA 2H57A 3G2NA 4TSFA 3OFND 5EMHA 4QUKA 5F7ZA 3ZGZA 2H6EA 3V1UA 1MX5A 5CH8A 4ZQEA 1OH6A 3QY9A 4HNGA 4I50A 4YP5A 4IH4A 1C5KA 4QJIA 1EFAA 4MUYA 2DLDA 4W8OA 3GVIA 3UK2A 2Q0SA 4BGIA 5CHYA 4BNWA 4IRUB 5BYKA 2HFJA 4FT2A 3EGIA 4DSNA 3JD3A 1NFFA 3NDRA 1ZI9A 3DOOA 3P9XA 5J2UB 1GVNB 4R4JA 1XROA 4BC0A 2FSFA 4ZKEA 4HEA1 2O59A 3CLHA 2WMNB 2VUTA 3MOSA 2HLDD 2FG6C 5IAEA 2O5EA 1XP8A 4PZ9A 1GLNA 2C2YA 3L41A 2LRHA 2OB2A 3MRTA 4MQEA 1M1YA 4AKEA 3SEAA 1JYEA 1BA2A 2J0UB 2FSSA 3EFOA 1AU9A 2YR0A 2NUTA 3ZTTA 4PAMA 5LWQA 3Q5DA 2Q8QA 2XUHA 4OJYA 1B23P 3ZHVA 2AJLI 4G26A 4F5YA 3T7DA 1R1DA 5AW6A 4XVUA 1DIGA 4GSLA 2PH7A 1GKLA 4H7DA 3VO2A 1PG2A 3EC2A 4FDUA 1BVUA 1J2JA 1EX1A 1WTAA 3MJVA 1EFRD 4F93B 4F3KA 3OIYA 1ZN7A 2H1FA 2YICA 1W5BA 1GNPA 2PQ2A 1SBCA 1ND6A 2OSVA 2ZYIA 3QPCA 3CKKA 3V2UA 4OV6B 3AY0A 4GR4A 2GR9A 3NTUA 3AUUA 2D5LA 3KQNA 3UC9A 1D0SA 2VQDA 3MJDA 1O87A 2VPTA 4H7FA 3OZGA 4F3YA 3UANA 2MOKA 1Z7WA 1E60A 2B8NA 3F78A 2A9KA 3AI7A 3ZW7A 2DVMA 5BYBA 4ZGWA 4W5QA 4K9NA 5K4AA 4YDRA 3LT4A 5CM9C 1H85A 4ENQA 2JGLA 4KWIA 5DI3B 3ZQJA 2RHTA 3REQB 1NRJB 4G56A 5CVCA 1YRLA 2QUHA 4JJ8A 2CY0A 4DTCA 2H7CA 3M1LA 3BDAA 1I2AA 2YUTA 2EX0A 5L7WA 2R8XA 4QUIA 2NU9A 1JU4A 3OQBA 1G8KA 1NMSA 2JJYA 1SHKA 2REXB 3RC2A 1X9IA 3CBQA 1XTSA 2YOHA 4ND2A 2RJ3A 4BQEA 3GLGA 4KDCA 5JD6A 1XPUA 4R3UC 2G4LA 3THOA 2D1SA 1H3FA 5FOQA 1IAVA 1ZC3A 3RTBA 3W5CA 5FPTA 1YONA 5C0OE 3ZDAA 2XWPA 1TF5A 4ZT7A 1J4AA 2OD2A 3AJDA 3GLKA 1RYHA 1SUAA 2W9XA 1TM3E 2WINI 1ZHOA 1JILA 5F76A 1RC8A 2JIPA 3JYOA 5FWDA 3NP9A 3CKYA 3GA7A 2LR0A 4H6VA 2SHKA 3D0OA 3OQNA 4UM5A 4PPNA 4Y2XA 1U7WA 4QX6A 2EG9A 1GN8A 3KSUA 3ZV4A 1FVFA 3U4CA 5AK6A 2C8VA 4N7MA 2VJMA 4NBSA 1SVNA 2PUTA 4NCNA 1P0PA 4X95A 3CUUA 3LIIA 3A6EA 1VL5A 1Z4LA 4LE0A 1UJ6A 5EIAA 3BM5A 3CEPB 1KOJA 3KPUA 1DOHA 4MS3A 5DBIA 3ZE6A 4B73A 4RPLA 1SHUX 1EXNA 2XCUA 4HNTA 4RJ2A 5AVSA 5KNBD 3CVWA 3CISA 1BAPA 1QFJA 1REQA 2R6DA 4RGBA 3UENA 1E66A 4TVBA 1CNFA 1NI4B 3IP1A 2XDQA 2PT5A 4FONA 1NUSA 1PSWA 3AVYA 4RVGA 2DHRA 1KRWA 1N1DA 1JG6A 1CEYA 2QJTA 4MOWA 3VH2A 4BVKA 2BRUC 1JTVA 2GD0A 2PE5A 1DEKA 2NO4A 3KOXA 3PIRA 1YB5A 3TQOA 4B3BA 1EZZA 2FOLA 3NEAA 1JSCA 3TTYA 1W29A 3B6JA 3GEBA 1YDGA 4DSTA 1Z9BA 1VG0B 1N2CA 2A8YA 1SGWA 2Z2YA 4GC9A 2DAPA 4JJKA 4HFJA 2AKYA 2DPLA 3QBEA 3K0CA 4FFLA 4XJXA 4A10A 2XCSB 2Q4TA 2CNBA 5BT8A 3A32A 2MYTA 3KOUA 4H6WA 5SYNA 1E59A 4CGZA 1XO1A 2BVNA 3HBNA 2IUYA 1GQRA 2NNWB 2Y77A 4MKFA 4QJ5A 4REQB 2HYIC 2BHRA 2H4HA 3EG5A 4WNAB 5G41A 4YCNA 3ET4A 4MYSA 3I76A 4DWJA 1V7ZA 4OHBA 3G9XA 4NV1A 4OP1A 4O4IB 3QGMA 4LY3A 4FYWA 4MPPA 5IJAA 1U94A 3OT1A 2P4SA 1I24A 5IMBA 3ZK8A 4URVR 3BRSA 2E18A 2ZUCA 2WRZA 5JDIA 2P62A 5DE3A 3IPLA 2P2GA 1N5KA 2PQ0A 1JPVA 3F47A 4H1HA 1ISPA 4LHXA 5L6MB 1G5TA 2JGNA 5IU6A 4BLSA 4NX2A 2VK4A 4L85A 3I2JA 4CM9A 1PZHA 1ZGGA 5DT2A 1KSFX 4B7UA 2BFOA 4PSVA 5A4JA 4OXXA 2DFDA 5KNDA 3HY3A 1Y8AA 1F2UA 3Q72A 1ENYA 1HT0A 3NASA 5FTKA 5HSGA 2O7VA 1ZCBA 3I2HA 3IBCA 4PGGA 1S7GA 3UJPA 3FCYA 5K01A 3R8CA 4YREA 1GHTA 1QVWA 1VBKA 2ATIA 3L9XA 2NSDA 4Q9LA 3MWJA 4P82A 2A5LA 1E7WA 4FUQA 4GYKA 3SYTA 4BMSA 1NF9A 1HE1C 2WAYA 2BBWA 1SD1A 4TV8A 3UKDA 4GSKA 1Q7BA 1V3UA 5CB6A 5FA5A 1FXUA 3EZFA 3O1IC 3ID6C 1M2HA 3K0FA 1W5EA 3FKQA 4EFNA 1AKUA 2R7AA 3R5FA 5K8VA 2O7RA 2IS4A 2WHPA 4UUPA 3SOZA 1ZESA 2BEKA 1VTKA 4BO5A 1NBMD 3H42B 2FUCA 4DIUA 4DXHA 5BOSB 2C7PA 5TPWA 4WK0B 5JCOA 4HWOA 2ENWA 3K5IA 2M6KA 1VCNA 4B2LA 1Q83A 4EJ0A 3FNRA 1E3LA 2PKYX 4G41A 1JFRA 2GZ2A 4MQEB 3FUVA 3A3PA 4GMHA 5LBUA 1PWXA 2XGOA 4XEHA 2RGAA 2VP5A 3O0DA 5ERXA 4BE4A 1QCZA 1Y8ZA 4FFRA 3GJQA 4QPJC 1L4UA 3TWOA 1X3SA 2GKOA 4MV9A 5JYDA 3ETNA 1JDJA 4OMDA 1RFLA 2VSQA 4X20A 4M1KA 3NALA 5DEOA 4D4MA 4ZD6A 3OLCX 4HNRA 4UUAA 3WNZA 1PJSA 3KT0A 2ZTVA 3RUIA 4N6OA 3JQAB 4EG4A 1QRSA 3DL2A 2PSSA 1IWBB 3AFIA 1CRLA 2IWHA 3DE4X 1OAKA 1ZK2A 4MLZA 3CX7A 3PXGA 4ZVMA 2FR8C 3PNOA 4U7PB 4BEVA 3A1DA 4Q3NA 4C08A 3IPXA 2J9YB 4KN9S 3I0NA 4DTIA 3UICA 3Q3CA 4JJ7A 4L1KA 4CV0A 5JWRA 5JVDA 2XCIA 1HFWA 4DQXA 2P5SA 4HO1X 4P38A 4XWYA 2EFEB 2FK7A 5CH3A 1ZBQA 3B2QA 1KQFA 3ZQ4A 1J90A 1PQUA 3L8EA 1TAGA 1C81A 3L5OA 1JEQA 1J8MF 1Z0IA 5L7TA 4ZO9A 4RWEA 2P8SA 3B60A 2CB9A 1FUEA 4DLYA 5HZGA 4C2TA 4H15A 3TX2A 3FI0A 4IIJF 4LOHA 4A2PA 1LC0A 1RKXA 4MS3B 3KOZA 3AC0A 1QB7A 4JBHA 1W1UA 1OI3A 4KRXA 5CFZA 2IPNA 1EDEA 1VIAA 1XAHA 2W43A 5GOZA 2BAGA 4ZQHA 4CKXA 4TSKA 3FWKA 2AKAB 2W98A 4TZTA 3RYIA 2XKKA 4RAOA 5BR4A 5TMPA 3NWOA 3EAGA 4R71A 2WIGA 2VLIA 2HCJB 3CEJA 3NS7A 4Q12A 5AW5A 4DCPA 1GR0A 4U7DA 1O95D 4EHHA 1LJUA 2V55B 2N1MA 3LT0A 3VOTA 4EG6A 4RTMA 4X45A 2YUIA 2NUPA 2VZ0A 1V6AA 4KI0A 1T8UA 5I47A 1N33B 2C5HA 3WWCA 2BKVA 3G9TA 3RRYA 3SHOA 4QOHA 3T4EA 2HHAA 1M8JA 5TB5A 3T4XA 4UOZA 4QUBA 2JLYA 1G8FA 1THGA 4J3JA 4LAFA 2X5JO 4HMOA 4R1TA 4W9MC 2R68A 2AXEA 1K7CA 4MP6A 4F4FA 2LDXA 2DPHA 3GJ3A 3U5ZB 1O08A 1Y3AA 2X0NA 4WPGA 1ZKDA 2ZSDA 4FC7A 5AVVA 1NVGA 3KSZO 4AXXA 2DBYA 2ZWOA 3ABOB 1BYUA 2QD3A 4YP0A 2GM3A 4G0UA 1KNQA 1T6XA 2OO5C 4KK3A 4KP7A 1ENZA 3JAWA 3NNDA 1YQQA 1K27A 1LDMA 4CMEC 1L7XA 2VJCA 3H7IA 2WPDA 4Q9JA 2AMLA 4F2WA 3PX2A 2QDXA 3RJZA 3GARA 3CV3A 3IFSA 2PT9A 3EPRA 5JJ5A 1OYWA 1K3FA 1Q84A 3DW1X 2Y6UA 2RKBA 5LUBA 3QPAA 3ODPA 5BQXA 3EIHA 4PO9A 1UL1X 4D9FA 2BE7A 4K9LA 1XMJA 1CIPA 2OORA 2H8GA 4LJKA 4P6VF 1LI4A 4G1CA 1LJLA 2GK7A 1ZG3A 3A4MA 5HA5A 3S2GA 2RAUA 1CULC 2YHUA 2WJAA 1TM7E 5AKZA 2UVPB 3HGQA 1G5PA 3PQ2A 4V39A 5IKPA 2UUAB 5JEDA 5LQKA 4OX9B 3DBLB 2VQSA 4PYLA 4ZI5A 1NQWA 1HNWB 1P9NA 3ICPA 3D4OA 1Z33A 2J9FA 4R0NA 1I4DD 2IYNA 2QOEA 2BKAA 3EWIA 3HP4A 2YYSA 3QOYA 1ZUIA 4NK4A 4NYMR 4AZWA 4F91B 1XRQA 4BIIA 4I5DA 3CH6A 3HCNA 3UH0A 4PYMA 1MC1A 1OLUB 2ZB2A 1IQRA 3UAVA 4U0KA 2D2XA 3V1YA 1TTQB 1V41E 5IH3A 1I94B 1EWTA 2DKOA 4B3MB 4BB0A 5L8VA 3HG7A 3LGSA 5TVKA 4A0HA 1ISRA 2ZUBA 2CHGA 2GYUA 3A7DA 3BD6A 3GH1A 4NYIR 4OGGA 2Y99A 4OM7A 5SV2A 1PZNA 3IOBA 1OFHA 2QP9X 4FSDA 4QVGA 3VU9B 1Z2EA 4ZEWA 1QLHA 1XAGA 1ZM4A 3JD1A 1G0OA 3X1WA 4ASUD 5IHPA 3UGKA 3A28A 2VUHB 4DJTA 3PUVA 3VHQA 3RFVA 4BNLA 2Q2NA 1TT5A 1XR3A 3GDHA 3UUFA 4DV1B 2QUIA 2BSXA 3N7UA 2TSYB 3QWBA 3WKDA 3OPMA 2XCTB 3FPGA 3UXMA 1ZGCA 1GPMA 2QL7A 3GQVA 1CJMA 1BKYA 1WW8A 1RACA 2JGMA 2PKXA 2WF8A 3IQWA 2G4VA 4OI4A 5ALHA 5TC4A 5CB0A 4ARIA 1H4SA 4PZLA 3ECSA 2ADFA 4AMGA 2QPAA 3RVSA 1GYQA 4EW1A 4P3XA 3RT9A 1EH5A 3DF9A 1K98A 2J6IA 3VI4B 2OG1A 5C8DA 1D2HA 1T5IA 1VJGA 2HPAA 5CXQA 3QVLA 5BWOA 3WIVA 2CLIB 1IHOA 1UK6A 1D2RA 3GDOA 3GUYA 3O21A 1XYYA 2IH5A 5CBPB 1L4NA 4AYTA 2D5CA 2QI9C 3M3DA 2P4UA 4UEOA 3D8UA 1PFYA 3EUAA 3V8RA 4AKSA 2Z1MA 1OWNA 2QTCA 3CH5A 4LSZA 3F3SA 3R6LA 2H5JA 2YVUA 4BDTA 5JBNA 4UEWA 4ZDJA 1VQ1A 4FNGA 1GG8A 3R40A 3CBGA 5K3SA 3IIMA 4NNPA 5JXWA 1NMZA 2Q3FA 5BURA 5FI1B 4YQFA 3QTLA 3D43A 4IGKA 1X2BA 3E05A 4ZMBA 2XXAA 1XJ0A 2R1VA 2REQB 2XUOA 3DC7A 4RYDA 1WSBA 3CVXA 3EMDA 1HDCA 5T4EA 2YMMA 1EFPB 3IP3A 1O4WA 2WFLB 3TZKA 1UEIA 4WA8A 2D7JA 5MN4A 3FVVA 3IJ5A 4RD3A 5HCNA 1W1WA 4ODIA 1B41A 4I08A 3EZXA 2H9AA 1JAYA 1WSWA 3EGXB 3OI7A 3NAQA 5KSPA 2F8SA 1C1XA 3P2IA 5JXIA 5K0GA 1QHFA 3GT4A 4LJYA 2AEJA 1I7NA 2YIJA 4HYYA 4A6DA 2IP4A 1Z0DA 3ORQA 2YZGA 4CKYA 3LUPA 3OOYA 1Z34A 4UUOA 1KEEA 1Y6RA 3WL7A 1KVQA 2SBTA 3NBAA 1G42A 4HDSA 4X41A 4ZU3A 4JFAA 1O94C 1SIOA 1X1TA 2AG5A 2IOYA 3B1YA 5DOZA 4XRGA 1JJBA 8ADHA 3D9QX 1NJ2A 4GI2A 1YUBA 4YMHA 3RYCA 3OZUA 2QU7A 2HF2A 2HNBA 3U1BA 1EFPA 1K86A 2ZUDA 5DNVA 2QX8A 4RDIA 2NQTA 1G17A 821PA 4L9AA 4AJ1A 2JAUA 3TL3A 3WLTA 5CD9A 4JLNA 4YASA 4KWTA 2HO5A 1GV0A 1KH3A 2VZLA 4DW8A 4M37A 2ORED 4XTRA 2XXBA 1F8XA 2DPXA 4YP7A 2NUAB 1QR2A 4YONB 3K2EA 4G3XA 1YQTA 4E09A 1EDZA 1Y42X 5C5DA 3K9CA 4JJGA 4BPRA 1JKMA 2GB4A 1SC4A 3LZ6A 4Q9DA 3LHFA 2CHVA 4EJMA 5BUSA 3BHJA 5IANA 1IN4A 1GZDA 3LZDA 4ZEOA 2NZXA 4PYQA 3QE2A 3F5SA 1R6TA 2VJDA 3D6FA 3F8TA 4PS1A 4N49A 2YFKA 3C6MA 3ISVA 4QATA 4M7RA 1ZM2A 4OXYA 4Z5XA 5GADl 2GWHA 2L18A 3U6BA 3QF4B 1MJGM 1YBAA 3B36A 3AFMA 1ZINA 3IQDB 4N3CA 2CLDX 4OQLA 5CT9A 3TLKA 3WS7A 3KKMA 2C5GA 1VLLA 2CVPA 3LFTA 4UFNA 1RWOA 1ENPA 3QG5A 5E7QA 3PUWA 4E51A 4I9GA 5DVZA 3KJGA 4EI9A 5CDTA 2IRWA 1L7PA 2C0CA 1VE5A 1G7RA 1N7HA 3R3HA 5K3BA 3AOGA 3EARA 1UPUA 4I6EA 1SQ5A 3KU4A 1LA2A 4OG2A 5KIAA 1P9LA 3H83A 4M83A 3FN4A 4KU4A 3O4VA 1YDEA 3QSGA 3LC0A 1N9GA 5A02A 3K6SB 5AM2A 3ND9A 2VYVA 4N47A 4YAFA 1YR7A 4NZZA 1SD2A 2UUBB 1RNLA 5A03A 4CPDA 5I7HA 2WYHA 1ZZEA 2AN4A 3DFKA 4RDCA 1R5BA 4E03A 4YV2A 5MN6A 1TM4E 4YAGA 3D7LA 3T3NA 2BV3A 5IT4A 1VOTA 2AR0A 1E1RD 1LQ2A 5H5JA 3QE9Y 1XTKA 5IF9A 2EFHB 3ITNA 2J7PD 4JC4A 5JYCA 5EP3A 3LLCA 4IJ6A 4WJLA 4HAIA 5COAA 4A3SA 3EDQA 1NXVA 2O9JA 4J3NA 3WLMA 2H59A 4V0SA 4X90A 3I9LA 2NT4A 4ZI3A 2RH5A 3W3AA 2GJ9A 4D9KA 4EGCB 1FMLA 1ZGJA 4EH1A 1BOOA 4PLZA 1VL0A 4YMLA 3AJRA 3WYFA 1QTQA 5IC4A 1QWSA 4HYEA 4N3AA 5DBOA 1OLUA 4C22A 1EK6A 5CAEB 3UCEA 3P0JA 1H8HD 5A0FA 3DHYA 2BFMA 4DIKA 3L0YA 2HWKA 4TYYA 2YRWA 2OFOA 3N3AC 1DFHA 3FRHA 2POCA 2QR2A 4UVGA 5DM1A 3IV7A 1ZAKA 4YV7A 3W78A 2PUFA 2P65A 4DCMA 1HQKA 2GQ0A 4OHZA 4FJ1A 4I1SA 2ZJOA 1UZUA 4L57A 4MK4A 4M0MA 3HXPA 1USUA 1BDMA 1X8LA 3LUAA 4XW2A 1Y3BE 5DTJA 3DYBA 2CXPA 2ATEA 5CFRA 5CIYA 1CDOA 3HCBA 4X6LA 1E6WA 2I65A 5JNRA 1RP7A 2G25A 4BMXA 3UAYA 4AIRA 2KS6A 1VJDA 1G8YA 4ZC8A 5IJ0A 3AP3A 1Q21A 5REQB 4EA8A 1BA3A 4ENRA 1QIFA 3SNKA 3H5RA 4IFEA 1IJFA 2E4VA 3KNZA 4PBTA 2Q6IA 2WT4A 1ZJ5A 3STVA 2NTNA 2Q0HA 3EA4A 1P77A 1U3GA 1WLSA 1Q50A 1YVDA 1ZN9A 2FQWA 4UVIA 1VKZA 2ZTMA 4KSCA 3KYCB 2PZAA 3DEHA 2BEWB 3LYHA 2RHMA 1JR3A 3Q0EA 1ONSA 3RSCA 1SXJC 1UKEA 1QS0B 1ZNXA 3QVSA 1E79A 2F64A 2P5TB 3KG2A 1UP6A 3PDIB 4JLPA 4WOCA 5EGNA 5KVCA 3GA5A 4GBMA 1T8YA 1PJAA 1XMIA 1E6UA 4DB2A 3R3VA 4RJIA 3FUXA 1ZR4A 1FX1A 5FA6A 4JSYA 3E5RA 1DGQA 4M0DA 4REQA 1GQSA 1Q74A 1QYDA 2HSEA 2XZTA 3JRNA 3KR0A 2NPFA 4CUJA 2IHUA 1BVRA 1QRDA 4FB4A 3WWDA 4KITB 2OXFA 2VBCA 1VBNA 5C4IA 3KYBA 1SUBA 5IFKA 3RVRA 4QBFA 1JXMA 1N9KA 3SX0A 2JC3A 4M53A 1NRXA 4LJ5A 4R7GA 1OZGA 1G20A 3TQCA 4OFZA 2H2WA 3H16A 3CONA 1RMTA 1Y3FE 3AEXA 3GHYA 4RFLA 3N87A 4BN5A 3AZPA 3E7XA 1G8MA 5EXTA 4F0JA 2GA8A 3C3EA 2ROQA 1VJ1A 3QBVA 1GKKA 2OC4A 3STXA 3V6LA 5B1HA 1DRKA 3EYWA 4UM7A 3HP1A 2BN4A 4KK4A 4OATA 3SQLA 1DG9A 2WYUA 3TFOA 3HYCA 3DTNA 4PLCA 4S04A 2GXUA 2H65A 3WL5A 1TVEA 2P1DA 1K7XB 3ONVA 4MYCA 4L8FA 5EIHA 4AU1A 1M2EA 2ANCA 4EUSA 5BQ3A 1BH2A 3H5LA 4NCJA 4ZIRA 1K4KA 3U81A 5CFPA 5JH7F 1QHNA 2HMAA 3MGCA 2FSPA 3H1EA 3WAJA 1UJBA 3SFTA 3H5VA 3MGGA 5KC9A 4DLPA 3QIVA 5TMDA 4BU0A 1A8QA 1B3BA 3B1JA 5J5CA 3CFYA 2IKQA 5J4YA 1QO0D 3REGA 3S5JA 1P6QA 1YQ9A 1H2BA 5DZSA 3RNLA 1BWRA 1GKUB 2AEMA 1OLSB 2VSFA 2Z2ZA 3QUBA 1FP1D 4EY5A 1KRXA 4QYSA 3LDGA 2X4IA 2WTAA 4HDRB 4L73A 5FUMA 1PBNA 2GPWA 1TZKA 1D5WA 1VSBA 3CPJB 4GMDA 5BQPA 1HDGO 3R3UA 2JA2A 2QS9A 5TXGA 2BHTA 1SQ0A 2I71A 3F3YA 3I9NA 3PFHA 4X8OA 1RKVA 4XCQA 3H6KA 5ALMA 3SIXA 3THWA 1ADYA 4JIMA 4YEDA 1SAYA 2ZUEA 1MAUA 4GPD1 5ERGB 5KCZA 2IBSA 3HJHA 4J0GA 4MRMB 4Q1VA 4N3NA 3JV7A 3T5TA 1YKFA 4UD2A 4Z0TA 4GLBA 2NSJA 2C3OA 3CX6A 3AETA 5JT1A 4QELA 5D5QA 2YZKA 4RJJA 1N9ZA 5E7MA 4MJXA 1K4YA 5G0WA 3NDJA 4TSRA 4ND3A 3MQ4A 3G2OA 3PWSA 3GLIB 5A9SA 4P54A 3SKXA 4EO9A 5CTAA 5KZMB 3SHTA 1UXGA 5LN1A 4YO8A 3TJRA 1LDNA 1DOZA 1DX9A 1V8BA 2ODEA 3ZN2A 4U39A 2IXTA 5JCPA 2ZIWB 2OC9A 3VPCA 4DABA 4LRQA 3NJRA 4HN2A 1IB6A 3FOAA 4DSZA 3LY7A 3NVDA 3QKRB 3OZRA 1T2CA 4NP6A 1C9EA 4XEUA 1VCIA 4O5OA 4OF4A 1ZH6A 4DRXB 5F1YA 5LJLA 2DKFA 2E6KA 2QRJA 1CY2A 1U4NA 1VSTA 4NE7A 3OM8A 1DMSA 1T5DX 2HPHA 1JL3A 3LKVA 4LUCA 4MR7B 3RV4A 4ES6A 2PVCA 5TVGA 4BMCA 1L1RA 1T9AA 2W6OA 5K4HA 3L1KA 1ZD8A 3M6WA 2GILA 4E07A 4JYBA 4U2EA 1BO6A 3H6HA 4N39A 3A70A 1E4YA 4I5FA 1LDBA 2R6JA 1P0QA 1IY1A 4IIUA 1TQDA 4GBJA 1CS0B 3I01M 5EGSA 1P0CA 2VJKA 3HLYA 4TYQA 3V4VB 4RA6B 4YT2A 1YGPA 2AYXA 2FKAA 2VAXA 1TK9A 3GJ7A 3OEED 3QV1A 4HDQB 4L74A 4XGKA 4LGYA 3K3PA 2GRAA 2EJVA 3E9NA 3GFFA 5F5XA 2XUKA 4S35A 3SBOA 1NPYA 5H59A 3UPDA 3AM3A 1KMQA 3Q6NA 1FTWA 5BUZA 3SS7X 5KYKA 5HKAA 4BPBA 3N2ZB 3M6VA 2VDJA 4C4YA 2P5UA 4UE6A 3FTDA 1UIMA 2I1QA 5E2BA 1MQ8B 1J1ZA 1SVUA 4R16A 4RENA 3TTTA 4MS4B 3WKEA 1XBTA 1W44A 5GZ3A 3A8TA 5ANRB 3C87A 4I5IA 1MLDA 4PC2A 3F98A 1OWOA 2XMSA 1UP7A 2Z8XA 2WZCA 4RE5A 2JVJA 4C89A 1NYRA 1AS2A 3PJGA 1M6YA 2X42A 3ZW9A 4QOSA 4LG1A 4E31A 3NOVA 2VQEB 5FV7A 3EZ9A 2AFHA 4HLDA 3V4ZA 2CCGA 4KIFA 2MR5A 1T5SA 5HJ2A 2WIJA 3IRVA 4X6YA 1B6SA 1KHTA 1C29B