1N7IA

The structure of phenylethanolamine n-methyltransferase in complex with s-adenosylhomocysteine and the inhibitor ly134046
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
261
structure length
261
Chain Sequence
AVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Molecular recognition of sub-micromolar inhibitors by the epinephrine-synthesizing enzyme phenylethanolamine N-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2002-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1n7iA00
3PVCA 3KQQA 3NMUF 5B1SA 1AV6A 3CJQA 4QQNA 1R74A 1SQGA 2Z6QA 1G8SA 3S68A 4GEKA 4R6WA 2N47A 2P7HA 2OBFA 1XVAA 4Z2YA 3EEYA 3PS9A 2AVDA 4OBWA 3HVIA 2P3LA 3LCCA 2AOTB 2PWPA 4NECA 4E2ZA 5T6BA 4YUYA 4QTTB 5DRTA 3MTIA 2ZZMA 4CTKA 2AVNA 2PT9A 1BKYA 3K0BA 4RX1A 3G5TA 3TKYA 5CD1A 3B3GA 3MB5A 4LECA 1JG3A 4HGZA 2Q41A 2H00A 2JHPA 3IEIA 4GOND 3UJ7A 4ER6A 2P35A 3ER9A 1D2CA 1FJXA 4BP3A 3E7PA 3GRYA 1XCJA 2OB2A 5FA5A 4C05A 1YF3A 3OE5A 5DXJA 3OU7A 3ID6C 2V7EA 3V8VA 4POOA 3BGIA 3SGLA 4RV9A 3KR0A 1RI3A 2QRVB 3P2EA 4YUVA 4AZWA 3TLJA 5LQUA 1KR5A 2GAFA 3UBTA 5CM2Z 3ORHA 3G88A 1N7IA 3GDHA 3OPNA 3LCVB 3O4FA 4RVHA 4FP9A 3GU3A 3C3PA 2PLWA 2XYQA 2ZIFA 4XUDA 5EGSA 2K4MA 5EZQA 4HTFA 5ICEA 3JWHA 2BM8A 3GGDA 3HVJA 1JQ3A 3H2BA 3EVDA 1FP2A 1NV9A 3FRHA 3NVMB 3MHTA 2O07A 2YXLA 3A7EA 1JTFA 3HM2A 2UYHA 5HILA 2I62A 3KKZA 5E8JA 3U81A 3UJ8A 4ER0A 4L7VA 4DQ0A 5DM0A 4HRAA 3G5LA 2P3OA 4OQEA 4EMSA 4P7FA 5M5BA 2XBMA 4PIPA 3ER8A 1N7JA 4FSXA 5LQNA 1M6YA 3HCEA 3RIEA 5LR6A 4MQ4A 3G2PA 2ADMA 1KPIA 1P39A 2ZIGA 4PYOA 1L9KA 4MTLA 2HWKA 3PLAE 3AXTA 2ZLBA 4WXHA 2C7PA 5DX0A 1RJFA 4GF5A 3T7SA 2G70A 3BWYA 4HG2A 2G72A 2ZWVA 4M7RA 3P2KA 5C9ZA 1QAQA 3KQVA 2P8JA 5E1DA 1VPTA 1DUSA 3EVGA 3UJCA 3C0KA 2G1PA 4EKIA 2G71A 2CMHA 4UOEA 2JG3A 5F2OA 3OFJA 4E33A 2V74B 1XDUA 1YZ3A 4BP1A 2I7CA 3KQOA 3QV2A 5E1MA 1L1EA 5KVAA 2GH1A 4KIGA 3R3HA 4R8RA 2PXXA 3G89A 1P1CA 2BM9A 4PYIA 5EPEA 5G02A 4AX8A 3EGEA 3HCFA 2IH2A 1WXXA 2BR4A 5P8WA 4X63A 4F86A 1D2GA 2PBFA 3FYCA 3SSOA 1Q0SA 3FRIA 3UJDA 4CWAA 5GWXA 3UZUA 4C04A 4QDKA 1F3LA 1BOOA 1RJEA 3BGVA 2Y1WA 5EQJB 3JWIA 3GCZA 1R00A 3GRRA 4P7JA 2OKCA 3QOWA 3QOXA 2AZTA 4B17A 2AN3A 4FT2A 1MJFA 1X1CA 3T7TA 1G6Q1 1NV8A 3UA3A 2HTEA 3UJBA 5JR3A 1FBNA 2XVAA 2YXEA 3FTEA 1KPGA 2IP2A 2AOUB 5D1NA 4CTJA 4C06A 4ZTBA 4X1OA 2OYRA 2EX4A 3LDGA 4M37A 4QVGA 1KXZA 4PYNA 3A4TA 4RVGA 3B7PA 3DP7A 3DR5A 2HV9A 3LECA 1ORHA 3EEOA 1L3IA 3E23A 3P9IA 1RJGA 4LWPA 4DZRA 3ELUA 3NWBA 5FWDA 4CKEA 3BT7A 3F4KA 2VZ9A 4AZVA 3HTXA 3UJ9A 5CCXA 5K03A 4YUXA 4BLUA 2ZIEA 5K0BA 3HCAA 3DXZA 3NTVA 5EVJA 1RI2A 2C7QA 4MHTA 3SMQA 4G56A 4HGYA 5DM1A 5DSXA 3G2OA 2UZ4A 3ELYA 2JHCA 3BWMA 3G8BA 5BXYA 5FA8A 4E2XA 1L3CA 3NDIA 1VP3A 5E9WA 4ATNA 4YV2A 2ERCA 4GUAA 2JHAA 3EMBA 3SX0A 5JUWA 1YUBA 1FPQA 5K05A 2AN4A 3DMHA 2AOWA 4GOOD 4X60A 2ONYA 3HA7A 4OQDA 1U2ZA 1UIRA 4A6EA 3SM3A 4EQZA 1NW7A 3BKWA 5E1OA 1JR4A 3A27A 3FUUA 3LSTA 1VBFA 5EZSA 2FK8A 4FGZA 1HNNA 3C3YA 2B3TA 5BW5A 3CCFA 1I4WA 1XJ5A 5E1BA 3M33A 5EMMA 1I1NA 3EVBA 4RTNA 4XUCA 2VDVE 2UYCA 3A7DA 2YR0A 2P7IA 2IBTA 3L8DA 3NJRA 4CKBA 4YUZA 2ESRA 2QE6A 3PFHA 2WA1A 7MHTA 4BLVA 4RTJA 2NXEA 1RI5A 2QM3A 4M36A 5GP1A 5EIWA 1XTPA 4ER3A 3HP7A 2DPMA 3AY0A 3T0IA 1YFLA 3SXJA 4RYLA 5CVUA 2AOXA 5EEHA 3FUXA 1SG9A 3TMAA 2IIPA 2IDKA 2IGTA 3DLIA 4C03A 1QANA 1B42A 2Z6UA 1D2HA 1QAOA 1QZZA 2PJDA 2XYVA 2FRXA 3BWCA 3PT9A 4FT4A 2BR5A 1N2XA 5KQSA 1O9HA 5H02A 5ICFA 1ZHFA 4PONA 3P2IA 4E2YA 3FYDA 5DX1A 3BZBA 3DUWA 2OXTA 3NWEA 1Y8CA 3HVKA 5F2KA 2HR1A 4HSGA 5DLYA 4DF3A 3FPEA 2F8LA 3BKXA 5E2AA 5T67A 1R18A 3O31A 3Q87B 2PXCA 3R9XB 3GRZA 5E9JA 1Q0TA 2FHPA 1H1DA 3LDFA 3KHKA 1JQEA 1JQDA 2YXDA 3LX6A 3HCCA 3CBGA 1KYWA 2JJQA 5HIIA 2IH5A 2WK1A 1EJ6A 3MAGA 2ONZA 3KQMA 5FULA 2PWYA 2YQZA 4KIFA 4FSDA 1O54A 3TKAA 4HTFB 4PCLA 5KS2A 2NXCA 3FTDA 4E30A 2VDWA 3P97A 1G60A 2A14A 3ANXA 2GB4A 3DMFA 3EPPA 3TOSA 3OU6A 5EG5A 3WSTA 4F84A 5HOQA 4PYKA 1P1BA 5E9QA 2VP3A 5DRYA 5U4XA 1I9GA 3NDJA 3RW9A 2ZZNA 5LQRA 2HNKA 4YMHA 4OA8A 1G55A 1XXLA 4QPNA 2P1DA 1SUIA 4R05A 3I64A 1YZHA 2CL5A 2GA9A 1SQFA 1X1BA 1INLA 2PX8A 4LWOA 3C6KA 4IWNA 3FUVA 3TFWA 2NNWB 4QTUB 5DTMA 2B2CA 4QDJA 5KYGA 3FTFA 2ZSUA 4HC4A 1L3BA 1NW8A 5IH3A 4RVDA 2P40A 2EJTA 2EJUA 1ZG3A 3HVHA 5BP7A 1ORIA 1JG2A 4DM3A 3HCBA 1WS6A 5EMJA 4KDRA 3R6TA 4PWYA 3TM4A 1DCTA 2PXAA 2KW5A 1NW5A 2IFTA 3LDUA 3FTCA 5FWAA 4DCMA 3OZTA 3B89A 3BWBA 3A26A 3Q7EA 2NXJA 3THRA 2IPXA 2QYOA 3PX2A 4RVFA 1O9GA 5LQAA 4RTRA 3HNRA 4IKPA 5EC8A 5DSTA 2NYUA 3CKKA 5DM4A 3TQSA 1NW3A 5GM2A 3FPGA 3GIWA 1IXKA 1R8YA 3AJDA 4OBXA 5GIOE 1ZGJA 4IV8A 5HZMA 2PT6A 2BR3A 3REOA 3HEMA 5MHTA 2PKWA 4U7TB 3TM5A 4BY9E 4GOMD 3EMDA 3I58A 2OO3A 2PX2A 3MCTA 5CVJA 3KR9A 3THSA 5K0NA 1VP9A 5K0JA 2UYOA 4M38A 5FCDA 4ISCA 1JTEA 5K09A 4KVZA 3SR4A 4P58A 5EMLA 3KQYA 5CCBA 4GBED 3VC2A 9MHTA 1JSZA 1TPYA 1SKMA 1PJZA 3EVEA 3HA3A 4RSRA 5DT2A 3OFKA 5DXAA 4E32A 4GC5A 4ER5A 5HIMA 5KQRA 5HFJA 1XCLA 3C6MA 3GRVA 4QQKA 2EFJA 5EEGA 1EJ0A 2YVLA 3UJ6A 3LKDA 2OZVA 3R0QA 1QYRA 3ERCA 1OR8A 4MWZA 4MIKA 4PYLA 4E31A 1G8AA 3ME5A 5FTWA 2QY6A 4RWZA 3UA4A 5DPMA 2IBSA 2BH2A 3GXOA 3DLCA 1BHJA 3P8ZA 3TRKA 3IYLW 1YFJA 4OA5A 5EKUA 4RTQA 5K0LA 5CVVA 3OZRA 1TW2A 3CJTA 3GO4A 4V0RA 3KQSA 3KR1A 3LGAA 4RTMA 5T64A 4F85A 3DMGA 3DXXA 3ELDA 3K6RA 3MTEA 3P9NA 2FPOA 1ZQ9A 3EVZA 1PRYA 3JWGA 4GQBA 4ER7A 2Z6AA 2B9EA 2NP6A 2JH9A 2YX1A 5GM1A 5K0EA 4EVIA 1SVUA 2AN5A 4KDCA 5IKMA 1KP9A 3M6XA 5K8VA 5LQCA 1XDSA 5GOZA 2O06A 5HIJA 1AF7A 2ZZKA 4E2WA 4PGHA 1NKVA 2ZWAA 3M6VA 2YUIA 3EVFA 1NBHA 3HCDA 4BLWA 2AOTA 1X1AA 2FYTA 4PYQA 3MERA 2NP7A 2XYRA 3UFBA 5FQNA 2PX5A 4U7PB 3MGGA 5ERGB 4JXJA 4KWCA 3T7RA 4PYMA 3DULA 4DKJA 10MHA 5K0GA 2GLUA 3D2LA 4YV1A 5ICGA 1QAMA 1KPHA 2ZVJA 5CVEA 4DCGA 2WA2A 1JG4A 2AR0A 4XCXA 5DM2A 4AZSA 3FPHA 5ICCA 3SSNA 2ZBRA 1VLMA 4RTSA 2QRVA 3KQPA 3RODA 5FADA 2ZW9A 4KRGA 2ZTHA 1DL5A 4RTLA 3DOUA 4QPPA 4EKGA 4RTPA 3CGGA 1WY7A 1WG8A 1RJDA 2B78A 3OZSA 1YB2A 3AWIA 4X41A 5FHRA 3PTAA 3JWJA 5E8RA 3CJRA 3SSMA 2VS1A 3FPJA 3KPJA 3E05A 5EHGA 3KQWA 3CC8A 2H1RA 2IDJA 5CUQA 5FUBA 2FCAA 2R6ZA 3PX3A 3LL7A 3FUTA 2PX4A 4P7GA 4RTOA 2B25A 3BUSA 1T43A 1KYZA 3CVOA 3PB3A 3X0DA 3B5IA 5DTRA 5HIKA 5F2NA 4E70A 1NE2A 4FR0A 4P7KA 3DTNA 4XUEA 4AZTA 1X1DA 5FHQA 2YTZA 4C08A 2PV0A 5LQKA 5EHIA 4Y2HA 5EIFA 1X19A 2I6GA 2PY6A 3B3FA 2NXNA 4GOLD 4EK9A 4R6XA 5K0FA 2XVMA 1JG1A 1M6EX 5D1HA 3O7WA 4WVLA 1ZGAA 3P9CA 3VC1A 5LQJA 4DA4A 2IH4A 3IV6A 4YV0A 1UFKA 4RTKA 3SVZA 2GPYA 3DXYA 3GJYA 4IV0A 1G38A 8MHTA 3LPMA 3M6UA 2PGXA 2I9KA 3GWZA 1EIZA 4PCAA 5CIYA 2VDUE 3EVAA 4PYJA 5LSAA 4A6DA 3KR2A 2OB1A 3HA5A 2ZBPA 2CKDA 2HMYB 3FUWA 3A25A 1NBIA 2DULA 1WXWA 1EQAA 2ZFUA 1MHTA 3VSEA 2CMGA 4H0NA 3GNLA 5DX8A 2O05A 4X61A 3G2QA 4PGGA 1RI4A 5HEKA 2G8NA 5K01A 4FS8A 2O0LA 2JH8A 2PSSA 3NVKI 4Y30A 5EOVA 4YUWA 2P41A 3B3JA 4YMGA 3BGDA 4O29A 5CVDA 1EAMA 2AOVA 3M6WA 3OU2A 5EKXA 4C07A 4DMGA 3MCZA 1IM8A 2EG5A 3FPFA 3G8AA 1AQJA 2AS0A 2CWWA 3MQ2A 1BC5A 5C0OE 1VQ1A 2AOUA 1UWVA 3IHTA 3KPWA 4V0QA 1AQIA 2GS9A 4FZVA 3E8SA 3VYWA 3AXSA 1JSXA 2OPBA 3G2MA 1XDZA 3NW9A 5K0CA 1SUSA 1NT2A 3M70A 1EG2A 4PINA 2BZGA 3OCJA 3BXOA 3KU1A 3LHDA 4GC9A 4LG1A 5FQOA 3M4XA 3ELWA 2ZULA 3I5UA 3KPUA 2O57A 3PFGA 5GIPE 1FP1D 1R8XA 3UJAA 3KPYA 2LD4A 3LBFA 2FK7A 3FZGA 4R8SA 3G7UA 3P9KA 5DWQA 5C1IA 2ZCJA 1IY9A 3EGVA 1WZNA 4CKCA 5E2BA 1V39A 2Y1XA 5BW4A 4OX9Y 1P91A 3EVCA 4HH4A 3TR6A 3LCUA 3EGIA 4KW7A 1ZKDA 5DTQA 2C7OA 3V97A 2ZBQA 4CXMA 3OE4A 4PIMA 1M0EA 2OY0A 3P71T 2H11A 2R3SA 1VIDA 1VE3A 4PNEA 1KIAA 1HMYA 1TW3A 4QVKA 2UYQA 3UWPA 2E5WA 1RI1A 3KPVA 3I9FA 2P3QA 1F38A 5EMKA 1Z3CA 4AUKA 1R6AA 3LKZA 3GRUA 3TPZA 1NW6A 2ORED 3DH0A 1KHHA 2PVCA 3I53A 4K6MA 5GINE 3KQTA 2C7RA 4C4AA 3R24A 1VL5A 3LBYA
chains in the Genus database with same CATH superfamily
1PSWA 2FGKA 2C57A 2B4AA 4CQMA 2C3UA 4ZHQB 1CF4A 2C8JA 1ESZA 1ECFA 2IUFA 1H8HA 4CQLB 1W36C 4LGCA 1IN5A 1EP2B 4M54A 3S27A 2ZYTX 3PBKA 2FI1A 4PQFA 1OZHA 4WACA 5CPFA 4A91A 4EFNA 5LWHA 4QRIA 3U48A 2G7ZA 2JLAA 1AKUA 2PZGA 2OGSA 3NOOA 4QUDA 2W2KA 2AVNA 2HFJA 1B76A 2RI0A 5KYKA 3SQWA 3MB5A 2AFIA 1TMKA 3H9JA 4FKMA 5FL3A 3RVMA 3K3PA 4KO4S 4KX3A 3WLIA 5HK8A 5JG7A 1BG6A 4GOND 1XEAA 2HBQA 2P35A 3ER9A 4GLBA 4UUMA 5ADVA 4IV5A 1M1YE 2JATA 4TYNA 4OBBA 4AO7A 4HYTA 2FU5C 1WXFA 4LV5B 3DCIA 2G08A 5JNTA 2O6HA 1T5OA 1E0SA 1TA9A 4WZBE 5F9MA 1JHAA 1UBGA 3O9MA 3ROXA 3IAEA 2QRVB 1K7EB 3IAHA 1N6PA 2O3QA 3AERA 3K30A 3OIFA 5BYJA 3ORHA 2I71A 4RETA 1LDMA 2VAWA 3U61B 4CTMA 4BX8A 1QV6A 4D8TA 3W8FA 3HRIA 2NSYA 1LBQA 3IAM1 3THYA 2HPZA 3FETA 1ZCBA 5H4HA 3MJHA 1A96A 1NRWA 3GGDA 3M6AA 1LI5A 5BOSB 5T41A 1AQLA 3BH7A 1Y9EA 2J3DA 3Q8XB 1CEQA 1HC7A 1YDFA 2O07A 1N2OA 2VVTA 4ZT7A 4G5SA 4BO8A 1Z37A 4N5LA 1EFKA 1D6SA 2V7GA 2XBMA 2ZUWA 5M5BA 4J49A 4TKLA 2HQ1A 3AYXB 2DOKA 3AFHA 1AKNA 5F1OA 3KUUA 3OJOA 4GPTA 3U6BA 2IX3A 1VSBA 4MQ4A 3TEFA 5EMNA 3NHLA 2RGYA 3AMVA 5AXDA 4BNWA 4Z7NB 1RE1A 3BXPA 3HS3A 3AEUA 3B13B 2LIVA 4ZI2A 1P45A 5I4BA 1NMXA 1W46A 3D54D 3QX8A 4IJWA 4NFSA 4O4HA 4LGMA 4WGFA 3BIXA 3MGCA 1GT91 1KNQA 4QGSA 3QPUA 4LOHA 3P9PA 2A1TS 1OZFA 2ODPA 2QDKA 3EAGA 4NCXA 1CPYA 1RHUA 4N3AA 4RDHA 4KR6A 3EVGA 4LWZA 3SBXA 1E1QA 1OAKA 3O3CA 1U0GA 5IT4A 1PWZA 4FW9A 3H04A 1Q17A 1MO5A 4L0CA 4GWGA 4M21A 1FOEB 4BO6A 1G3RA 1GKLA 2QTWB 4C0KA 4G1UC 4HQ0A 2GH1A 2AI3A 3FCAA 4W7IA 5BN4A 4EMBA 2P1ZA 3PHCA 5AJYA 1S7CA 2HIGA 5KNLA 3HL4A 4LXIA 1TIPA 5JZVA 4I6EA 3PGA1 1JHRA 1I0IA 5KWVA 3D1LA 1EVYA 3TE6A 2CDBA 2IKSA 2R6JA 4Q12A 3ZDZB 3UJDA 1FF9A 2A9PA 3PNYA 4V0KA 2IZ0A 1M2EA 2NU7B 3ADDA 4I4TB 4EFLA 2G0TA 2EAUA 1QQBA 4UQOA 3QFRA 2CNWD 3GRRA 4IVNA 2GN1A 1CV2A 1FDIA 5DULA 4E46A 2AZTA 1WU8A 3ZUPA 4X1KA 5K6RA 3TL3A 3JQFA 4HJXA 2XZLA 4QGGA 4NU0A 3O2SB 3KHTA 3UKDA 4EFKA 4XX1A 1XQ1A 2VQ3A 2VQSA 3A14A 3ZEIA 4MUIA 3CUTA 3AT1A 1ZD8A 5H81A 3JCZA 1E77A 3IUYA 4A6XA 2GDJA 2E49A 3DYBA 3P19A 4X93A 3KAQA 1JU3A 4EHHA 3JSXA 1KXZA 3AB7A 3CMMA 3OZAA 1DG9A 1K3UB 2JCBA 3UYKA 4AKIA 3S55A 5DK4A 2QUBA 3K32A 3CEJA 1JBQA 5BWNA 5C5EA 2GN4A 2XW6A 3RTDA 3WAGA 5ICMA 2M32A 2MT9A 2FZLA 2PU5A 5AI0A 2EGUA 1QE0A 4L2IB 4CI0B 5I45A 5FPKA 2W2MA 5TGDA 1PU2A 1RP1A 1WUTA 1PQUA 3C7TA 3BEOA 2AWNA 5ILGA 3TFQA 4AZ3A 3DXZA 4Z8YA 1Z6XA 2WG1A 5EVJA 3GLUA 4OP2A 5DNCA 2O3JA 2VT3A 4QUAA 4ENVA 3RVJA 1V6CA 3KLPX 3UV6A 2FV8A 3WMEA 1LLFA 4PZPA 2CHEA 1KIMA 1ATZA 1VP3A 4DG5A 2H9AA 1BVUA 3HXKA 1ANKA 3KQUA 4XKJA 1KZ6A 3WAKA 3TJMA 4QT4A 4HN9A 3VI3B 1QFJA 4NJMB 5E2IA 1QG4A 5EZYA 3GHYA 3ZGXA 1FDWA 1KY3A 3RM3A 1A7AA 2HU2A 1F2TA 4KR0A 1X15A 3FRJA 4JKOA 3WJAA 1JJVA 1SC9A 3L8EA 3L8CA 4NFLA 3AWDA 1I4WA 3A58B 3PENA 1K8QA 1QYXA 2QUAA 4LRUA 3HL0A 2FSVA 1D03A 2WE8A 1LFDB 2XDQB 4O3FA 4QPJC 4BQRA 4D3SA 5BSUA 4QBKA 4UTNA 4W5QA 3LYAA 1JJIA 4IIVA 3UMYA 3WOHA 4DILA 1SRRA 1WQ3A 2WHPA 4PAOA 1PT8A 3VVBA 4TL6A 3T3NA 1N3BA 1HM5A 3EMKA 4ZMSA 4B82A 3GUVA 3W8DA 3B2EA 3F5SA 4AY4A 1EJBA 2C5AA 1HYEA 4RFSA 2ZT7A 1RYEA 3C3KA 3CHYA 3THWA 2QROA 2GETA 1YQEA 2XQKA 1TVEA 2JEOA 1YDEA 3DUWA 3HXPA 4IYJA 4EVRA 3N53A 3ISTA 4Z6KA 1DVRA 5B53A 2FMTA 5EXDA 4YJFA 3B53X 4D7AA 1LV8A 1P77A 4DQXA 4P33A 1M0SA 3D31A 1S3FA 2H1FA 4N49A 4GLJA 4RPIA 4UD6A 3PLRA 4KN9S 3RS2A 1NVKA 2VDMB 2C29D 1TYCA 1P2UA 3KT6A 1PGJA 2VJDA 4NCNA 1DGQA 2JGRA 3LJKA 3T5MA 1YE8A 3FSEA 4JI7B 1L4EA 2I55A 2XUZA 3PDIB 4O1MA 3F73A 2A9QA 1WY5A 2HI0A 3QW2A 4HTFB 3HJUA 4EY6A 2ZUEA 1OGJA 1QJCA 1LTKA 1ISFA 2R7KA 5TB5A 3P1JA 2CLOB 3P97A 3IIEA 3TSYA 3FM9A 3WSTA 2QV7A 3V9AA 4DDWA 3VR2D 4G5GA 4E4TA 2IXTA 1XXHA 4KXXA 1NE7A 4KV7A 2R9VA 4IIBA 2W90A 5AKJA 5JD4A 1Y4ZA 3R74A 3S28A 1RLUA 1SHKA 1I3LA 1X6VA 3PFWO 3QXJA 4DV0B 1SQFA 1WMAA 4P6VF 5LYJB 1XJCA 3A0UA 1GCIA 3NGXA 3M89A 3DVQX 2BMAA 3OJWA 5SZHB 4C4PA 5AM3A 2PFGA 1V48A 1AC5A 1OAOC 3IOBA 3OLVA 3WDKA 3R3ZA 1EFLA 4P82A 2PSJA 2QNBA 4EOGA 1CQIB 2FLWA 2V5AA 1E6UA 2WIGA 3R6TA 2ZS9A 2VOJA 4KBFA 1V8BA 1YACA 1ZD3A 3ITKA 1IN6A 3L7OA 5DV9A 2Q6VA 1RZ3A 5EJMA 3MMPA 4NBKA 4OOEA 5SZIA 3NT4A 2NXJA 1GL7A 4L4ZA 3PJRA 4TN5A 1UJBA 1WJGA 2VPWA 2O4UX 4OKNA 4X45A 5REQB 2OE2A 1MH1A 2BZ0A 4G5YA 2JRCA 1NP7A 3EMVA 5EY5B 5FO1A 4D0RA 4C6SA 5AESA 2NSDA 2GX6A 4LVOA 1Q1GA 2OM2A 1L7BA 2MU1A 4ZGBA 2QVBA 3H2KA 4U2EA 1PV1A 3TM5A 4PC6A 5AXAA 1E66A 4B1FA 1JAZA 4MLDA 4M38A 5IEJA 4FOSA 4IUYA 1N7HA 2GJKA 4RKEA 1OX4B 2ODWA 3DE1X 3L7YA 2XXBA 4GBED 1EE2A 1HG1A 1Z74A 2CUKA 2FEXA 3B9PA 4PZ9A 2JIMA 2M1ZA 4G1VA 1B4DA 1IPHA 4UMDA 4QE3A 3D3WB 4KQGA 1G0OA 5F77A 4YPFA 3RTAA 4Z4IA 4FR2A 4RMIA 2P5UA 3ZJ4A 4AUNA 1J06A 4DR6B 3LD9A 4ZCPA 1XCLA 1KO7A 1MAWA 2GCNA 3GRVA 5KNCA 4FEYA 2JGKA 4AKEA 2Q5LA 1P9OA 3K0FA 1N6OA 3LKDA 5TQ0B 2P9ZA 3FX2A 5A7HA 5TE9A 3VPBA 5B3KA 1HE3A 1H9AA 1M8FA 3LQQA 5I8WA 3ERCA 4PYLA 2CYCA 1AZTA 4X62B 3UK7A 3IOCA 4Q1EA 4J76A 2AYYA 3ULKA 3BZUA 1S8NA 3BXZA 3VR6H 3ZKAA 4LRXA 1QMGA 2NAPA 5LZ4A 2PQ2A 3HU1A 1A2OA 4ZO4A 3MLAA 5J59A 2QZJA 5KNCH 4KACA 2POQX 1XC7A 3FPBA 5F35A 2VAVA 3SZUA 1ID8A 3KQSA 3LGAA 4JAVC 1NL3A 2QLMA 3ETCA 4G09A 1FXWA 4B3BA 4C0JA 2I9PA 4CM8A 1Z5WA 2XNDA 1VG0B 4AP9A 2WLTA 2EFYA 4Y67A 2BPOA 4QUJA 1XZNA 1YSCA 4W5HA 2LCQA 5ABPA 4B32A 4UNSA 5CNKA 3C5HA 4ZT3A 4DLZA 5K8VA 1FNNA 4PFJA 2XUFA 3CISA 3DMTA 2ACVA 5BN5B 5KKAA 1I2BA 4GIBA 4I8IA 1IM2A 3NDRA 3OZEA 3RJTA 2YUIA 1W73A 1FY2A 2JCSA 3V3KA 1G291 4BLWA 1EUQA 2DPLA 1ZVVA 3ZCRA 2VBGA 2DETA 2F8SA 1LLCA 1WU7A 2PX5A 2QTBA 3H5IA 3I12A 3QKSB 3JQAA 5TX7A 2BBTA 1IH8A 2IUEA 4ALMA 5A0FA 3U3OA 1CEXA 3FR8A 2YFHA 3HJCA 4GXRA 1NFRA 3NUQA 1YBHA 2ZIWB 5FWYA 2C5LA 3ISJA 1QAMA 1X9IA 5IPFA 2YWEA 4YREA 4RC9A 2IZ1A 3QXCA 4IDGA 2O2SA 1QK5A 2QD5A 3OP1A 4MV1A 4BB6A 4N8SA 1N6LA 4DJFC 3AVTA 3TQFA 4RANA 1ISGA 1NLYA 3U7JA 1A9TA 2Y67A 4Y1RB 2QB5A 3SQOA 4RTLA 1CUBA 4RF4A 2B4TO 2XUHA 2VQ6A 3FHCB 3CF6R 1T6NA 1I3OA 5I8PA 4OIFA 1N2CE 5DCWA 4ML3A 2PGDA 2WJGA 2M9MA 2YYSA 1I7PA 3JWJA 5M3BA 4A73A 3GT7A 4D3DA 3HNPA 3WGLA 1D4OA 1VJTA 1KAGA 3HHPA 4X90A 4MMXB 3Q3VA 2ERXA 3IJPA 2I4LA 3T38A 2P6MA 1Q11A 1VRVA 4IMJB 1KY5A 1TEVA 3GAFA 4IJ5A 2E4WA 2C07A 5CJ2A 5DLDA 2D2EA 4WFQA 4B7CA 3X0DA 2DPYA 5FPHA 2GM3A 1QFZA 3DEKA 3S8MA 4FK8A 1YI0A 1EA5A 1YR8A 1QLJA 3COPA 3E5MA 3I04M 3P32A 4QX6A 5B1EA 1K27A 1NM5A 1M2VA 1RHQA 2PV0A 5F51A 1JVBA 4PSKA 3VQTA 5BRJA 4R69A 4YAJA 5LL6P 1VIAA 4J0DA 4YT8A 2V58A 1KR2A 1XMQB 4FMBB 4N76A 1R0CA 2QPOA 2IXBA 1Z4IA 1M6EX 1S4QA 1SUAA 1T4MA 2YRXA 3EXIB 1FTQA 1DAGA 2HAEA 3CRQA 2OV3A 2FPGB 5HHTA 1B1CA 4L74A 3L82B 1YCGA 2C4HA 2ZATA 1KDPA 1YASA 4NESA 5ENDA 3VTAA 4EPRA 3SYTA 2O8DA 4NYIR 1NVVR 1G38A 3M6UA 2PGXA 3PC3A 2ANCA 2J4DA 3AF5A 4QRHA 1ESMA 1E6MA 1BQEA 2MYTA 2VDUE 3ZK9A 4COOA 5CIYA 1XP5A 1T2CA 3PNSA 2WHQA 1N4AA 1FK8A 1W5BA 1MEJA 3TD6A 3A25A 1Z25A 1PT7A 1RMQA 2BMFA 5TR9A 5INTA 3BICA 3OWHA 4LI3X 1HFKA 3GNLA 3ESQA 3VTKA 4F92B 3C5CA 1MO3A 3G2QA 4IH4A 1Z2OX 3RG8A 4C76A 1V5EA 3MELA 4NS4A 4JC5A 3QLJA 2PYIA 4I66A 4OGLA 1WHSA 2DUUA 1QRUA 2Q3EA 4P3YA 3TQQA 3G6KA 2FQ1A 4TYPA 2PE5A 2NYVA 2XCOA 4KH0A 1G3IA 3ND7A 3W3AD 1UXKA 4O29A 2ZROA 1YTUA 2OLKA 4OYHA 4DS3A 3AF3A 3G8AA 4Q4JB 2J9FA 2Y76A 1ZJ6A 3VRHA 4J1TC 1UWVA 1NP3A 2OZLB 3TMYA 2UAGA 3IQXA 2CJFA 2HIMA 1F8FA 4IICA 3RRBA 3OX4A 4C0QC 4CG2A 4RF5A 2QN2A 4Y2QA 3TNLA 4DEVA 4D9BA 1XDZA 4U5QA 4IXMA 1SUSA 4O2AA 3UXHA 3LPLA 1QS0A 4HNVA 3B2QA 2Y0DA 3QLUC 4UBLA 3RS4A 3M4XA 2C3YA 1PG0A 4WJLA 3JR7A 4WCVA 3VZQA 1U2PA 3FLMA 2E6KA 1QE5A 3KPUA 3KRTA 4EYQA 4FB4A 5C35A 2OEPA 1VJRA 1L4LA 5DGIA 1RWOA 4LGVA 6YASA 5K6AA 2GBPA 4MP8A 2JDID 4RD2A 2RBKA 1IEXA 2YN4A 4ETWA 4WUVA 2I3BA 1N36B 2ROQA 3VYTB 13PKA 3FSGD 4KUHA 3OSZA 2OXFA 5DWQA 4JI5B 1A82A 4GS5A 5HKAA 1Y3HA 3EZ2A 3OM0A 4B7XA 2XQVA 2XQIA 3I01A 4H15A 4K3VA 4CEIA 3OCCA 1WVGA 2RHJA 2VP4A 1OBHA 4O2RA 4YRZA 2PS9A 2P3SA 3P71T 4UM5A 2DSNA 3B20A 3U6KA 1G0NA 1NVUQ 1IPEA 4IR7A 4ZOLB 5E6UA 2I8LA 1H3FA 2I34A 4LNHA 5BSMA 3U49A 5I7SA 4KUGA 2ZIVB 5AJHA 4Q9HA 3KPVA 3V4RA 4FIZA 4C5CA 4HR7A 3WGYA 5K8UA 5JY1A 1FDRA 4FFWA 4BEJA 1BTOA 1NW6A 1PZXA 4MGHA 3OA2A 3BREA 4DRZA 3G0OA 1UH5A 3JS5A 3KQTA 2J0SA 3UFXA 2LP4Y 3VNVA 1GZ5A 2DR3A 3EC1A 3UT5B 4ME6A 1QKIA 3C3JA 1J33A 1QXSA 3D3KA 3NHAA 4HGPA 4OQLA 4FDMA 3TNYA 5IHPA 2FW1A 2RBGA 5DFAA 3OCVA 5EXSA 2VYVD 3PNOA 4WESA 1C7EA 4E2ZA 1QFSA 2L2QA 5FBWB 2B7BA 4GI7A 3VPCA 3W5UA 5CT5A 5K3DA 4F1KA 1BMFA 3KKNA 4FGJA 4MR9A 4AS2A 1QSGA 5K8IA 4KNVA 1P0PA 2ZAGA 1GTVA 4N65A 2J0QA 2QSZA 3U7QB 5A62A 2NUTB 4BP3A 5HF9A 1G59A 2H0RA 2G63A 1SKYB 3VBEA 1GU7A 3A6GA 4DJTA 1JPVA 3ID6C 1UFRA 2FAXA 1P4AA 2DJIA 2OCIA 3L49A 4ITRC 4RV9A 4LF5B 2X7XA 1QG2A 3TFOA 3ETEA 4PVDA 1KR5A 1RE0A 3G88A 1A4XA 4DJJA 4GO1A 4JNKA 3OTOB 3GU3A 3DYIA 1P33A 4EM6A 1EH5A 4CE6A 2KE5A 5EGSA 3KBBA 1I9CA 1D5WA 4H0FA 4GX2A 4GYJA 3IT1A 4PHTA 5AVSA 1DAEA 3ZJUA 1JECA 3QIVA 3GEDA 3HHEA 1SZPA 4BXOA 1XAHA 1UXGA 2MSCB 5HILA 3A9VA 3U81A 1KDYA 3OLQA 3F90A 4MW9A 5CA1F 3KVOA 2R8BA 4IJ6A 3SHVA 3KEOA 2MSNA 5C7LO 1KEZA 1SOUA 4CGYA 5F23A 3GOQA 4H6WA 3EOZA 3V1UA 1NR7A 4RY9A 4ZT5A 3ASUA 4GNKA 4X7MA 2NZUG 4S1OA 1T2UA 1HFEL 4S24A 3W9SA 4Y9UA 4MDEA 1RMTA 1JG6A 5HJ5A 2GBLA 3L6UA 1F48A 4LHVA 3ZGLA 1AQNA 4JX9A 4RYDA 1VSVA 3D2CA 4EB3A 3ROTA 5E1DA 2R1VB 1EEHA 4A2WA 4EKIA 1CJTC 4R0MA 4RULA 4S1NA 2LGJA 2YJTD 1EFCA 1TU3A 1ZW6A 1NZJA 4ZEOA 3VR5D 4YR7A 1QKJA 3O3OB 3O94A 3OTIA 1TKRA 3O8OB 1RXIA 4YRCA 1GGVA 1NOIA 4NDAA 4O4IA 2P9QA 2VI5A 5J40A 3TEJA 2D1TA 2DHQA 2ZSBA 3UCEA 5MGNA 3VH4A 1Y3FE 2OFXA 2OZEA 3KT8A 1G21B 4H1HA 3ROMA 2BR4A 4J9UE 5BYAA 3FYCA 2EHDA 4ZI7F 2WILA 4U02A 1UWKA 4OK5A 4AJ4A 1ILWA 3EZFA 4YASA 3V42A 2IS4A 3P7MA 1HDEA 3B1WA 5IXSA 821PA 4QDKA 3CLVA 4P3NA 5KX5A 1PR0A 2WFZA 2YICA 1GITA 2QRHA 4PZZA 5DBEX 4ZDKA 3GCZA 1CUXA 4KJXA 4CLRB 1ULBA 4PX2A 2J7PA 4S35A 1TDJA 3PXEA 1BWPA 4NBNA 3RVOA 2FPMA 3RT7A 2YV4A 2QMHA 4TMZA 1YS1X 1SRQA 1BDJA 4D80A 1XPOA 5EYPA 3HZRA 1G6Q1 1XYGA 3VTFA 2C7VA 2FR8C 2IP2A 1QIFA 3LOQA 1NXSA 2FSPA 3LUHA 4PNHA 3NTLA 1YGPA 1AKQA 1D5CA 4V2UA 2AJTA 3TZEA 4D5GA 5B6IA 1AJEA 2ZI3A 4WNYA 4W5JA 1JFLA 3A4MA 3L5OA 4OF4A 3H84A 4X65B 3AEYA 4KLNA 1EUCB 1ORHA 2LDXA 4PRYA 4M9SA 1EGHA 1BQ4A 4J7UA 5JDCA 3O4GA 1T26A 3ML1A 4CKEA 3OIVA 2Q1UA 1CS0B 3AR8A 1LW6E 4H7DA 1CUYA 3F4KA 4YP7A 3KELA 2RHWA 1IZ8A 4BMDA 1IWPB 2WP0A 2ZIEA 3A1NA 3TO5A 4GRDA 1U02A 4R8KA 3T15A 1C9MA 3SMQA 3A6JA 2WIBA 2C4TA 1KZ1A 3VOAA 4I99A 1D04A 3H2ZA 4P2GA 5G0TA 4OB7A 4YRAA 3TGWA 2GVZC 3LM8A 3UWOA 3HP4A 2UZAA 2YHAA 1XTQA 4FZJA 3ZGVA 1HLPA 1SUPA 1BXRB 1SXJD 1UBCA 2EYUA 2PKXA 1GG9A 2JFZA 4LYHA 2FUG6 4OXXA 4G0WA 2CFRA 1EM6A 2I87A 3C6YA 2PUFA 3D6UA 2F3QA 3ZY3A 4FOPA 4KR3A 3J81k 1QO9A 2DFNA 2CLSA 2Z1NA 1E59A 4F72A 1KI6B 4JT8A 4H2DA 2PL9A 4N0EA 2E7ZA 2VDVE 3VO2A 4Q01A 3WMXA 2K87A 2AFHA 3B2NA 3WBJA 2A3RA 3ZE7A 4Q7QA 4ZVRA 2JFNA 4UCFA 2VZLA 4CQMB 3FNFA 4F8EA 3BE5A 1DWOA 5AHXA 4YLYA 1YFLA 2Y3IA 1P5JA 1NN1A 2OD9A 5KOJA 3NHMA 5C5DA 1HL7A 4UTZA 3W4IA 1U90A 4BNIA 2I2FA 4EEZA 4UVDA 1E20A 4C3VA 5CB6A 2WTUA 1J24A 5K4AA 4BQPA 1B42A 1D2HA 4A8JA 5IZCC 2W2KB 2Q3JA 3GYGA 2GCGA 1CDOA 4YRRA 1SHTX 2X8WA 3UKOA 4CKWB 5KQSA 3HSYA 3W2HA 3P2IA 2AFIB 2QA5A 3NWEA 4FDLA 1J5XA 1MD9A 2MSEB 1A5BB 4MLCA 1QCZA 4R9UC 5JEEA 3U39A 1MENA 1XMSA 2O5VA 4GMHA 3LO5A 2QIPA 1RKBA 1R5JA 3EPRA 5IBPA 3QY9A 3NS7A 1SVOA 1FDOA 4MSUA 5B64A 3AERB 4ENPA 3GCXA 4XPIA 2YCLA 3AU8A 1LC3A 3GFSA 3ZLBA 4HAYA 1FUEA 1G8KA 3THYB 1ES9A 3TKAA 4D46A 3PU6A 1ZH4A 3C7DB 4II3A 3EN0A 1DIRA 1TT5A 2QS9A 1GTMA 1YHNA 2R1TA 1PKXA 2IOQA 4G5OA 3REGA 1SUWA 3BX1A 2D4AA 3NOXA 5GPBA 2NWQA 1OA0A 3EPPA 1ADCA 5JXWA 1VCMA 5KWSA 1T9GR 1D2EA 4GMGA 2PRSA 4HQLA 4JKIA 1QK4A 5TS3A 2W42A 1SPXA 2NW6A 2GNOA 4C7OA 3W1EA 1E3DA 1EWRA 1XF9A 1YNSA 4FQ5A 1F12A 4N3BA 4LYAA 2YJ3A 3WHLA 3QEBZ 4IOJA 1XA0A 4DV3B 2QUHA 3AEUB 4OXKA 2GCEA 3A6KA 3ORSA 4B6PA 4D6XA 1JEQA 2P40A 4O4HB 4KNYA 4N18A 5COAA 4F91B 1JDUA 1I3NA 3HO8A 4KOAA 3W8RA 5HXAA 2E2WA 2HU8A 2V65A 3IB6A 4KDRA 4Z9FA 5G3ZA 1RWKA 3NCHA 3O9ZA 5K99A 5A4DA 3FTCA 1OWMA 2F6RA 2QL7A 3OZTA 3BCUA 3EFHA 2X8JA 1MQSA 4OK6A 5EZ6B 1NYTA 1M2KA 1I7SB 2O54A 2NXWA 1WZEA 3JALA 3JASA 3UQYS 5B1DA 5BN4B 3ZR4B 4AICA 2HDOA 3TQSA 4AVYA 2Q6KA 4XWWA 1SXGA 5IK2A 3LUGA 4WLOA 2Q5IA 2VUHB 4TS3A 1OH8A 5GIOE 3ZZ0A 1LVGA 2WBLC 3MQ4A 1ZJ5A 5ECYA 2BMVA 2X2OA 3VPSA 3CXUA 3WFJA 1HWYA 3TIFA 4BY9E 2RJ3A 1ILEA 4BDTA 2J3JA 1NXOA 1DIAA 1FXUA 1E9FA 2HMAA 2X5OA 3PUZA 3PR3A 5FCDA 1JTEA 1Z0FA 2PUHA 1AZLA 1VKOA 2PG3A 3JQDA 4NJOA 3JQPA 4JLMA 4JJ8A 4KVZA 4X1KB 1OMOA 3KYCB 2RAFA 1SMKA 1X1TA 1LBSA 3IJEB 3IP7A 1PJZA 2A2ZA 2J3LA 3WI7A 4F4CA 2Q1WA 1YRQA 3IBTA 5IASA 5ALKA 1DZ3A 5L40A 1DAOA 1WMFA 3OQJA 4B71A 2JCVA 3GGCA 3HLTA 4C3OB 5KAMA 1OGIA 4OJNA 3D6VA 5HIMA 3ZY4A 4MYCA 4F5DA 4O4JF 2NVWA 1KZGB 2DTXA 4CTNA 3VA7A 4A0GA 5HJEA 3FGZA 2GBIA 3V2IA 3VYVA 1VL2A 3JVIA 3DNFA 4MIKA 4RJJA 3VUFA 1ABFA 1NKTA 1NQXA 2G1KA 3PXAA 2VKTA 4BL5A 1TIBA 2O52A 2VUSA 2XMGA 2R1ZA 4RWZA 5D5QA 5F5LA 3MJCA 3KYDA 4AZ3B 4J2OA 2Z5FA 4R51A 3WGIA 4W9NA 5AI8A 3BSFA 3BA1A 3ECSA 3EODA 3EGWA 5KWJA 2JLUA 4LVUA 3JQ9A 5DGTA 4HAIA 4GSYA 5CFQA 5JS7A 4QATA 3PNVA 3RANA 4L4RA 5BORA 4LJ6A 3VH2A 5FWNA 3AUKA 4MRRA 2N3ZA 2GEVA 4IIGA 5LZ8A 5SY6A 1YH3A 3EIOA 5JPIA 4DZTA 1RAEA 3STYA 1KO4A 2WVGA 3O47A 4WJKB 3MD0A 3P27A 4FFNA 2ZI9A 3X1YA 2MSDB 2W2OA 4MV9A 4A5OA 4YAKA 4JELA 1HTTA 3KJEA 1Q3TA 1QQ6A 2NSLA 2BSQA 3DAYA 4JLDA 3GOHA 1HTWA 1Y5LA 3IT2A 2CXRA 1QF7A 3VFDA 4AT1A 1SVUA 5IKMA 1F2TB 3QOFA 3AEXA 3SR3A 4DBZA 1AUXA 1NVAA 3ZU4A 3EC2A 5ALHA 2JBHA 3QUCA 5J2UF 4ON9A 1VL0A 2Y0CA 5AR1A 4MW4A 1KDZA 2EWMA 2HHAA 4H35A 2VJCA 2VDPB 3KTAA 4NZPA 4JBNA 4UU7A 5KU7A 2VF5X 5IDWA 3E2IA 1UMKA 2WHPB 3CLTD 1M5TA 4FSHA 1DI0A 1XVUA 2NUBA 3E9QA 3GLSA 1T2DA 4DLVA 4ZVPA 5DYNA 3U3DA 4TKZA 1CRWG 1K7FB 5EUBA 2CMFA 5E4YA 1U8FO 1JIKA 1W48A 2RHMA 5F4ZA 5FPSA 2OHFA 4OB8A 4RFSB 3AJRA 1XIVA 3UJ3X 4ALJA 2QTLA 4B34A 4HB0A 4BWFB 4KH1A 3H65A 2ID8A 2A4KA 2P4HX 4ZJPA 2Z3ZA 1YKSA 5EP3A 3TD9A 3BB1A 1DL5A 3ZX5A 1ZM4A 2FZCA 4AJNA 4RD3A 3G13A 2AH5A 4RTPA 3CGGA 3PTZA 1CZRA 4XD7D 4UPEA 3ZCSA 2VK1A 3PV0A 4JP2A 4MZDA 2AG1A 4R2XA 4YJFB 5AYVA 3SSMA 4B9AA 2PWZA 2Y8EA 3H1PA 2E3JA 4MCHA 2IDJA 5FUBA 1L6IA 3GPIA 2RGGA 1B3BA 3WJ1A 2JJ8A 1HLFA 1VHWA 2JHGA 3EA0A 3LY5A 4TPKA 5BNTA 1PFKA 1ZWKA 3BXEA 4DLKA 5IX8A 5KTKA 1LW7A 1KYZA 1JDBB 3NPMA 2PS1A 3OMLA 4OJQA 3QKWA 4Q9DA 1KQ3A 4KXYA 4Y0VA 3U7EB 2BFPA 2GRUA 3KE8A 2Y0EA 4K03A 1C9DB 2NIPA 2O6LA 3CN9A 4KXMA 4C08A 4CF4A 4F8JA 1IVYA 1VL1A 2AZ4A 2G7MC 3K15A 3UAYA 4BVFA 4BGDA 1CY1A 2I6GA 4CFZA 1BE1A 1GAEO 4GW3A 5K0FA 4O33A 1M1UA 4C4OA 1H4QA 1XXHB 1JG1A 5JSZB 5JBNA 2AXNA 4TYYA 1UANA 1MGPA 1U6IA 1XROA 2BMWA 3F2VA 3HKBA 4DLUA 2VYFA 4DA4A 5FAKA 4LQLA 2Q5QA 2VXOA 2CDCA 4OX9B 4R1OA 1OLUA 2NQ2C 1YZFA 4NEQA 4PCAA 3PEYA 4CM4A 2G07A 3W5VA 4WASA 2LCFA 2CVPA 3G5UA 1XOIA 4I1UA 4PYJA 1UAGA 2IYOA 4XYGA 3SIRA 1IN1A 3T9CA 3H3JA 3GUZA 4EATA 1L5LA 5CG1A 2MIIA 2ONCA 2HBRA 3LBIA 4JP1A 1W4BA 1ORDA 2A9OA 4ITVA 1N3LA 1AZWA 3Q8MA 5JD6A 1R5BA 2QTNA 1U0HC 1Z4NA 3GV0A 1BJRE 5I48A 5BW6B 2FMUA 2QTHA 1CUGA 1Y9ZA 2V7WA 3LWZA 1E79D 3RCBA 4JSYA 4A03A 2Z04A 4J2TA 2JD1A 2EP7A 1OBOA 2J33A 3ILSA 1YMQA 1GUFA 1Q5PA 2I4MA 5EKXA 4LJ4A 2AOVA 3TINA 2NTJA 1AQJA 2H2FA 3OZ7A 3N5CA 2IITA 3EFOA 2VRCD 3F6EX 4JIGA 3W8EA 4A26A 3SIXA 3G8DA 1AQIA 2EBFX 4TLEA 3IR7A 3ED1A 5T4HA 3ESBA 4KYTA 4CUKA 2WTAA 3C1OA 1VKHA 2EV9A 2XLCA 1DTEA 1KSGA 2QX8A 3QVUA 3I9LA 4PINA 1ST3A 3AEKA 1HT1E 1XWWA 3ABZA 4LG1A 5AKIA 5FQOA 3W6OA 3LUFA 5F76A 1L4KA 2EKPA 1G4AE 1LDYA 1UMBA 2ZULA 5TY0A 1YI1A 3LLSA 3UG7A 4HJRA 1YIDA 4FOTA 3H2JA 3IURA 4ND7A 5L7WA 1DBVO 2IEAA 3HUEA 4MW6A 2HY7A 5TF4A 3DBIA 2JIQA 4BWVA 2IEIA 1RWMA 3K0FB 1TM5E 1IY9A 1SC3A 4X44A 3UWMA 1ZICA 2PBZA 3EGDA 1ZIOA 3I9OA 4ZT6A 5L3ZA 4BC1A 4KV9A 1TMYA 2QXTA 3AJEA 2L17A 2R6DA 3E9CA 2DT8A 4OKSA 2C7OA 5AO9A 3K71B 5JRJA 4CXMA 4NAUA 1V2GA 4U6NA 4EYSA 3QPAA 5C3UA 3UTDA 1QHNA 4D4HA 4NE9A 2GSDA 3ZC3A 2H59A 1EPUA 1TW3A 4Y1FA 4EUFA 2HQSA 2OYCA 3V6LA 3A1WA 1T8TA 4ZYWA 4HAOA 2XODA 2WOOA 1PN3A 1SAYA 2NUAA 4RPJA 4CCWA 4CMEA 2COUA 1AGXA 1YC2A 4I9NA 3R24A 1VL5A 2X7HA 5KYWA 1QOQB 3BCHA 3P0HA 2R5FA 3S68A 5HUQA 2C58A 2FSHA 2N47A 1PO7A 2X9LA 2W2TA 4CM3A 1C9JA 2PWBA 1U0EA 2QUJA 1X87A 2LR0A 3HVIA 2RGAA 2QI9F 4B74A 1JJFA 3NIDB 5JCZA 2A1TR 1H8ED 2IYRA 3AHHA 1M75A 1D4FA 1BKYA 1M1NA 3B6JA 3G5MA 3HI4A 3JQAB 3MF4A 4FKZA 1YBAA 3QXXA 4TLDA 4D41A 4YRGA 2Q41A 1E1NA 2WJVA 3D2BA 1WCXA 1EUDB 5FWYB 1KFKB 1MMFB 2J3KA 1ZXBA 4JBXA 2W58A 4PG5A 5F21A 1DBPA 4BEVA 2F9MA 2WUGA 4BRWA 3PVSA 3ZJVA 3WLTA 2JAXA 3AJ8A 3LUJA 2Q4EA 1ZMOA 2YZ7A 2V7EA 5DHFA 2P2CA 1JZTA 3BHJA 3SEZA 3RYCA 1I2CA 2WVHA 2NVOA 3HYTA 4HB2A 3GLFE 3ZHRA 4MIEA 2F62A 4QDTA 1SOWA 2Q8PA 5ALYA 2V0GA 4G9GA 3QOYA 2WTNA 4WXEA 4M9XA 3DT6A 1KEVA 3BIOA 3RROA 4JVSB 4RVOA 5ITVA 1VG9B 3GJ5A 3USCS 2Y92A 1JQ3A 2HEGA 4TVKA 1W581 1S2DA 5K3EA 4HDQB 1SKBA 2YXLA 5KYVA 4UMEA 1KOFA 3EF1A 4WLVA 5ALXA 4ZI3A 5IABA 4V0OA 4ER0A 1FMFA 3UMVA 3B36A 4YRDA 4D0SA 4P7FA 1P5RA 3GDGA 2IOFA 5BR1A 2W6ID 5TF0A 4HNAA 4JI6B 3L0BA 2HH9A 1NQVA 1F1BA 4I1IA 1Z5UA 3ETLA 4W8HA 5D87A 4D9NA 1LWOA 2KB0A 3OIUA 1MZVA 1SCDA 2W71A 3BMNA 4Y1EA 1RW4A 5CYPA 4NPHA 1GDDA 4RWEA 4TYMA 2F3PA 1LLUA 5ALEA 5EXEA 3TVDA 4BB0A 4DSAA 1ESDA 2DQYA 4ZCTA 4EARA 2P8JA 4QO7A 4TTQA 4RD4A 2UUPA 2F7SA 2OGUA 4LOLA 1K6MA 1T0PA 3PF9A 1TYAE 1NUUA 2J1LA 3CRMA 3HBFA 3LOPA 1HNZB 4PO9A 4D1YA 1YVEI 3CZ9A 4H4EA 2VCYA 2FF5A 3R3HA 5G02A 3DA8A 1JKMA 4XZ3A 1KQOA 1TCCA 2WJHA 3T6KA 3B1FA 1GCAA 1U65A 2I03A 2Q3MA 4JLUA 2DYKA 1T1GA 3DWGA 2AFVA 3FRIA 6PFKA 4ZVTA 1YNOA 3FDXA 2XB4A 3PHIA 1J0DA 2NACA 1WTCA 5TQJA 2BTOA 4XR4A 1J5EB 3RYIA 5IJAA 3DEZA 3QOWA 4RGVA 4XI9A 4TSFA 2NOAA 3SJAA 3ZNPA 3W90A 2SICE 2QBYA 2FFJA 1SQ6A 3KS9A 3QLTA 1VGRA 1OUMA 2F2TA 4QJBA 1NVFA 4R1PA 4G0VA 3NEAA 3OLWA 1DCMA 2HTEA 1CJCA 4Y7CA 1IBSA 1F0YA 2J9FB 2PUVA 2W22A 5LP6B 1RWPA 1ZJ4A 4D9IA 4ZRNA 2XUGA 3ZWOA 2QQEA 2EL7A 3EJ6A 1LJLA 4UFNA 2UV8A 2CF6A 3E0QA 4CDRA 3OVMA 5JSUA 2SHKA 2BGLA 4JMPA 4LWPA 4WH0A 2G28A 3BXFA 3NWBA 3GHHA 1EM8A 2ZEJA 4LHEA 4LEIA 3GJSA 4GSKA 1LQ2A 2EIHA 2QRLA 3WGMA 3HTXA 3CVVA 3CE9A 3L4BA 4QM6A 4N5MA 3PYMA 3TBHA 3UHPA 3ZLTA 2X1VA 3ZIAA 3NTVA 4PAGA 4EA6A 3GWGA 1J2EA 4HO1X 2XVYA 4NOJA 4PXYA 1M5RA 3GJQA 4JP3A 3DOJA 4CT0A 2UZ4A 1C7IA 2W8BA 3H11A 4D6YA 3LBNA 2LVBA 4PLPA 3TDNA 3D2AA 3HFRA 4A27A 2VDQB 3I2IA 2GYYA 4FE3A 4KHZA 1YXMA 3RSSA 5CHYA 4KQ9A 2ADFA 2AD1A 4RL4A 4CEIB 2IYUA 5LJIA 2IJGX 4L9AA 1E4VA 1I33A 4RVUA 3CT4A 4L08A 4EL5A 1LPSA 3HU5A 4MQMA 1B8NA 4PEVA 2FEOA 4LBWA 2OHGA 5E6UB 3KEQA 2W6QA 3N3AC 4D5EA 3I32A 5FP0A 1E9VA 3RYHA 3T52A 3CGWA 3CZQA 3STXA 3EIXA 1Z15A 4OFWA 3BYZA 4CUZA 5CT6A 1TCVA 3DFUA 3LPNA 4MWTA 1E7YA 1UC9A 4WFIA 2DBVO 2G5GX 3M6IA 3UFXB 4MEAA 2GARA 1Z12A 4L15A 1VMDA 2PWAA 3H1BA 2ODAA 2NXEA 3EW7A 1T8YA 4HZUA 2H1CA 2JKYA 4M36A 5GP1A 4MUMA 4WXPA 5AKYA 5HE8A 3WNVA 3PHLA 3K0EA 3VO8A 3QU9A 4KR7A 3AFMA 3ZCUA 4P0QB 1A1SA 2PGNA 5K0ZA 1BMQA 3RUIA 3D6HA 3E48A 1UC5B 4M0FA 2MYUA 1PTKA 3G23A 4WESB 3WMFA 1IEWA 1U1CA 4ZT4A 2IGTA 1QQ7A 4P0TA 2CXTA 2YDYA 2ZYIA 4I55A 4E03A 3NXSA 4MV0A 2G80A 2PR2A 4MR9B 4RQTA 5A2QA 4CM9A 1CZLA 2FNAA 3EEIA 4EBBA 2FQQA 4XIYA 1F2VA 1UDBA 1UL1X 3DW1X 3HFGA 3B78A 4Q4LA 5CA0F 3SLRA 3UOWA 1PS0A 2DY0A 3AP3A 4L8WB 3OIDA 3TTWA 1PHPA 4HS9A 4JQCA 2OQIA 3BAFA 5E2AA 4U3JA 3SFZA 4GYYA 3USES 3AKDA 4DCNA 1PLJA 3NTOA 4LISA 4DMMA 4IWXA 1NQWA 5KTOA 2YXPX 1POWA 3CMCO 3WNQA 1I2DA 4D3XA 4M60A 1MAAA 1KNXA 3CBGA 3OQPA 3R5XA 4IMRA 3T7IA 1LPBB 4HN4B 2C4MA 3GF4A 4PG7A 3WKAA 2YXNA 4MIOA 3HLKA 1GUAA 3KWJA 5FR2A 3QU7A 1ISJA 3HYRA 3IPYA 3U5TA 2J0VA 2JBWA 3NIBA 4CQJA 1DFIA 4AY2A 2H48A 1N92A 4DJEC 3OU6A 4PRLA 3K2EA 4MS1A 4BXOB 4HXEB 4PYKA 3QLVA 2F4VB 3N05A 4UKDA 5DRYA 4EGCB 3SF8A 1SCKA 3NDJA 3Q3CA 2C59A 1H4TA 1QIHA 3O0TA 1WDLA 4ARZA 4CBVA 4OA8A 1G55A 5JHHB 5LQRA 4BX2A 2HK8A 1I4TD 2JGMA 3FVRA 3IC5A 3M7IA 4P93A 4BIIA 2QRZA 2P27A 1JEJA 2Z5VA 5D7NA 1ZJJA 1UBOS 3PPYA 2V6IA 4AYWA 5C5IA 4L0DA 1A9QA 5FOTA 3BJEA 2GZ3A 1J2RA 4J91A 4MWDA 1HDOA 1L3BA 5KDOA 2EJUA 1FFEA 3DVAA 4QXRA 3AW8A 2YHIA 4ESOA 5H9WA 3THOA 4KITB 1ZGCA 3KE9A 1OY1A 5B1HA 1ENYA 4FEEA 4YBRA 5CCEA 2HQBA 3BWBA 1D09A 1ZOIA 4WA8A 2C5EA 4LMBA 2C2HA 3I23A 1VMEA 4O4IB 4G8JA 3QWIA 3E2PA 4ZQCB 4P1ZA 4TL8A 5EKTA 1ADFA 4D02A 4HQNA 3H9BA 4V38A 4QOHA 1SBHA 4M1YA 4HDAA 3U9SA 1KO8A 2WU0A 4MB6A 5AHWA 2OQRA 2X4GA 1U9IC 4FX2A 5KX5B 2B34A 5IAOA 4CEJB 1DRJA 5CVJA 2DKOA 2FSFA 5KYNA 2Q0QA 4EG7A 5M2QA 1G2IA 2FEWB 1PV2A 5D6OA 1PYOA 2IXDA 2JC3A 1KSFX 4HH1A 3RBAA 5CCBA 1C7FA 4IL5A 5EYPB 5KYUB 3P0EA 5KTTA 3CUUA 1X7ZA 5JZMA 2B5VA 1UWLA 1WUIS 4LZNA 3NLLA 2QPLA 3ETJA 4XJSA 3I0NA 1IOWA 2VK2A 4KQMA 4AJIA 3IH5A 1Q57A 1LS1A 4QTYA 5KSWB 3DBRA 4W1RA 3UWDA 4Z9AA 1LF0A 4H77A 5F5NA 3HEAA 3RC1A 2WG0A 2ZBEA 1Y1QA 4X24A 3WRXA 4LJ8A 1OR8A 1A8SA 1YONA 3B82A 1E8DA 4CKEB 1ISSA 3KTDA 4JA2A 4MJLA 3HM9A 2CHUA 4H3HB 3T94A 1E1DA 1XMJA 5CLJA 3P9RA 5CH5A 4G63A 1MW9X 1YFJA 4OA5A 1A8IA 3SNKA 2J6IA 3OZRA 3MWEA 3KZCA 1QVWA 4F21A 1RWXA 2ZANA 4V0RA 3U7GA 1OB2A 2BCJQ 4DNOA 4I19A 4WKCA 3X2FA 5I9IA 1ZY2A 1O58A 3LXXA 1EIWA 1TZBA 3FNBA 3EUFA 2QL5A 4F4UA 3NDPA 1NR5A 3IDOA 3WB2A 3WJ7A 4ZVOA 2VUTA 3ZXSA 3SY8A 1MB9A 1WXHA 5IU6A 3BE4A 3WDLA 2WE7A 3FPLA 1OI2A 1KP9A 4UUPA 3BH0A 1XDSA 1GEEA 5ECGC 5AW9A 3BFXA 5MFPA 2GZAA 3RVPA 3GP8A 2C88A 2RH8A 3NM5A 4G1MB 4TYQA 4UDOA 4UFOA 4XQGA 4C7VA 5BXQC 1B3RA 2NP7A 2AFHB 3SPXA 3RG2A 1SB9A 3I0MA 5FPQA 2IYSA 4M1MA 1H93A 4KWCA 5TVGA 4LTNA 3T7RA 4AULA 5K8TA 3EW9A 3KFVA 1NVDA 3E3MA 1KY4A 4RM3A 1RWNA 1NATA 4UZFA 1ZD2P 2BGUA 4DCGA 1NAHA 4KRXA 3NIFB 5DISB 5KOJB 1YA6A 1M6NA 2LZ0A 2WA2A 4O63O 5HQTA 1CQJA 3I04A 1M6HA 3FPAA 2I65A 2YQ5A 3KOOA 4FXPA 2Z09A 4ZJZA 4A8JB 3EJWA 3W2TA 2VHVA 3NP7A 4ZOAA 1GJRA 3HK2A 1VHJA 4K86A 2JS7A 4R31A 1MAUA 4AJPA 1VSTA 1WHTA 4M1EA 4B7UA 2JLXA 1U8YA 1QOZA 1DO2A 4TWRA 3FY4A 4BLRA 1WY7A 1WG8A 1RJDA 5EAIA 5DNWA 3ODPA 4R9NA 4ZO9A 1WLSA 2H6EA 1P1HA 5B55A 4I4NA 5AJUA 1GLVA 2SKCA 4KIWA 2IZZA 3ICCA 5KOHA 3N8NA 1ABBA 4KFRA 4XPIB 4BLQA 1DWPA 4H7JA 3PB3A 1D0VA 1QGUA 4MDYA 4CLXA 2VTDA 5BQOA 2JFQA 1NE2A 4C78A 1M7GA 1RCTE 2ZM5A 2FQYA 4MARA 1IJEA 1TT5B 1BEEA 2R1TB 2XA9A 4OHMA 5G0WA 1IUPA 1Q15A 2V9CA 4R83A 1TAHA 2ISCA 3VI4B 2RKOA 1OXBB 4PQGA 4DMFA 3QW4B 5DB4A 3GP5A 2OZKA 2Y77A 5FEMA 3VC1A 2JK1A 1TJNA 5IJ0A 4BKUA 3PC8A 3COVA 5F3DA 3GJYA 1OYWA 2FPSA 2WT8A 1K7SN 3NG1A 3U3ZA 1Z2PX 2DTEA 2C61A 5FI1B 3ASYA 5I6DA 2HSZA 1K9SA 3W9YA 4E5VA 5AW3A 4BPBA 4O1IA 2IL1A 1JEQB 1J90A 1KRHA 2CFTA 1S1MA 1XD8A 1XFAA 3CW9A 3ISVA 2ZBPA 3MMSA 1JG7A 2HMYB 2WSIA 4A4DA 2R4QA 3C8HA 3A6HA 3CH4B 2V1UA 1BEZA 2Q0XA 1R9GA 4FVTA 2HWXA 2AG0A 1ZWLA 1EKXA 2X8JB 4YRQA 4H7EA 1ZRSA 4I5EA 1ZR4A 5LDGA 3JALB 3JASB 3SXPA 1VCOA 1XF1A 4ZOQI 3G0BA 2J08A 3O6VA 4V0NA 1LWNA 4Z7JA 1SC1A 3AKCA 1A9PA 1S4MA 1CVIA 1IXZA 1UOEA 2GTPA 3DBOB 1F14A 1W8IA 3E3AA 2OL4A 4DOMA 5JNWA 3C8ZA 3OU2A 4FILA 1E2MA 3QJGA 2ZUSA 2EG5A 5CLIA 3L01A 4IOMA 2AS0A 2OP1A 1E5QA 2DUNA 1H6AA 3CLRC 3RBVA 2YN0A 4IDAA 4YRKA 1N3IA 1OYOA 1EFTA 1UEJA 2OA0A 3WGJA 3E5RA 1YMVA 4NOKA 4QYXA 3C3WA 3E9MA 3JQ7A 3VV3A 2AK3A 2BZGA 2C78A 4PBSA 3CUEF 1T4CA 2BMDA 4DC0A 1EWYA 1GYRA 2R4TA 1U7WA 2PAAA 4U2BA 2R25B 3ZE8A 1D4ZA 3LQ4A 4NCJA 3H1GA 4BP8A 3HPRA 4OHOA 2RHBA 3LBAA 1N6RA 5K20A 4N7MA 4TM7A 1C3JA 5GOTA 4A3SA 3EVNA 2PMEA 2C9MA 4JLJA 3JQ8A 5FUVA 2ZCJA 1QORA 5C1IA 1S7GA 3AESA 4XVHA 4D81A 3OEED 3HVUA 3S2ZA 1K7XB 1ZKDA 1NN3A 3KYDB 5EJFA 3VNQA 3K35A 3WP1B 4PIMA 4Z0NA 4F0JA 1V3VA 4DC1A 1M0EA 4G36A 4KVFA 4WK6A 5AVOA 1P8AA 1E61A 2RGEA 1W9HA 2W2NA 5J47A 1CNEA 2UYQA 3K1YA 4OGWA 2AUTA 2E5WA 1O8BA 1RI1A 2WWTA 3S2IA 2X40A 2ISSD 1Z3CA 4AUKA 3NU1A 1DAKA 2AXEA 2WDZA 4XFDA 3RLIA 5JQGB 2ZJ2A 2VIIA 1HA3A 2DP4E 2BL4A 3IX7A 3FCXA 4OGGA 3RK4A 4OGKA 2W93A 2JA1A 2X5NA 3KQQA 3RS9A 3DEIA 3H8JA 1AV6A 1X2BA 1BVRA 3M5CA 1O57A 4QAQA 3LOUA 1G19A 1UINA 4KFUA 1JDZA 1GZVA 4UREA 3RAGA 4F3KA 2XKJE 4F3TA 3DTTA 3WYFA 1A9XA 4U7HA 1Y1LA 3HR8A 4UBOA 2OBNA 3FSJX 4MRAA 4QTTB 1EXDA 1MF7A 1J20A 3WG9A 4DYDA 2PMFA 4KTVE 2QLNA 4QXOA 3TKYA 3G5TA 1DARA 2O2XA 5JDIC 2BD0A 2C77A 4KRYA 1RT9A 4GUDA 3WIOA 1L7VC 4BHTA 1U7TA 4OXYA 3DDSA 1U3TA 1VDMA 2HQOA 4X92A 4IDPA 3K92A 1CYDA 4AYTA 1MJ5A 3H9UA 5C4MA 1BRTA 2MDTA 4WOCA 4Y3UA 5SYMA 3SIPA 4C05A 3WWZA 3C85A 3L5KA 1FW6A 3CR8A 3KAKA 1H5QA 1BMDA 1EVLA 1U2EA 3PNMA 4WOKA 3T9BA 3V8QA 1IZ7A 3V1KA 2OV8A 1GKKA 5JMTA 1XHFA 3EPKA 1E3IA 4DR1B 4JV5B 4ZXPA 3LS2A 3LT0A 2BKAA 4A0SA 3RBXA 3I45A 4JNCA 2J9YB 2XGOA 4RNDB 1K66A 2QX6A 3B3AA 1PDVA 3L3BA 2O20A 3MJRA 1AHPA 1CR4A 1PLKA 3VO1A 3VJRA 3A7EA 1YRAA 5JXJA 1DCFA 2I62A 1CQWA 3RS5A 3ZHZA 1IBKB 2FR1A 1FJGB 3EFBA 1ZMTA 2QEQA 2FCRA 2RK3A 5H5JA 2G6TA 2JFYA 1OREA 2I1LA 1HFJA 2AXQA 4HMPA 4QLAA 5DK6A 4II7A 6CHYA 1ZW1A 3AHGA 4NAHA 2X4LA 3WMWA 3EIFA 4PZUA 3ETGA 1LGYA 3BWYA 5B36A 4LHSA 3ZKWA 5ISMA 2D0DA 3HKBB 2Y1DA 4R7GA 1VGVA 1Q0RA 4CU5A 1E2HA 2GGSA 4UOEA 1KYQA 1OLUB 2DUMA 1RQ7A 2V74B 1AS0A 1TUEA 3KUDA 4BP1A 1GDTA 2I7CA 2BZ1A 2OSBA 3JYOA 2IXFA 3MINA 5E1MA 1J4AA 3ZV3A 1T3LA 1N5RA 4AKTA 3QVXA 2B2XA 4KIGA 3F47A 4QNRA 1CDZA 4YH1A 1LK5A 3HWSA 1ECPA 2YJZA 1ZESA 3ZYZA 4GR5A 1D2GA 3B1KA 1EP1B 5GV7A 1I7DA 4CV1A 5AK6A 4B3JA 1GPLA 3O1HB 1W5EA 2PN1A 2VSXA 5EQJB 2JB9A 2YOFA 4D92A 2D7DA 2VDOB 4FXOA 3U37A 1XMXA 3MAJA 4GWKA 4REOA 3P5BA 4C20A 4HNSA 4TTVA 4L07A 5BRNA 4UD2A 1K8ZB 1MJFA 3E18A 3UUFA 4BO9A 3O8RA 3GYBA 2JFUA 4B6QA 2IHKA 3OO1A 4R9VA 2XGGA 3UJBA 3L7IA 1SU4A 2GERA 3EFOB 3GRCA 4OLHA 3NIGB 2JLBA 4QTXA 2YH2A 4DUGD 1VI6A 1AUOA 2C42A 2PH7A 4FMPA 4IX1A 4X7BA 2O8FB 4QPZA 4RVGA 3DP7A 1SOMA 2HV9A 5DP2A 1I0LA 3MWGA 5A03A 3A70A 3Q85A 1CUVA 1RJGA 1X7XA 1X7WA 3FD8A 4MINA 2KS6A 5H80A 4BE7B 1P29A 1GUZA 4ID3A 4AO8A 1PJ3A 5BT9A 1P2BA 3FFWA 5EHQA 3DO8A 3CV3A 1E9CA 4ALLA 2ZRKA 5FOQA 1R15A 1E6WA 3WNZA 3L92A 1E69A 4G56A 2HYIC 4N1AA 1PQPA 1Z2EA 3MYRA 3HQ4O 2DPXA 3EGDB 1XV5A 4KUEA 4Z7QB 3I5AA 3PUHA 2C54A 5AVVA 1XRRA 4C4YA 1FB5A 2AOWA 2C97A 2RH4A 3NV9A 3HA7A 5FIUA 3THWB 4GPD1 2BKLA 3BKWA 4BJHB 1NURA 3RRJA 5C3MA 4ZQGA 3GMTA 5IYZA 3MBKA 3UJNA 2WFAA 4N8DA 4ZEXA 4B43A 4BQSA 1V1MA 3LYHA 1NJSA 1K9VF 2JVKA 4F6LA 3UAWA 1W36B 4C0BA 1PS8A 1P73A 5FBKA 3R2JA 5B3JA 3A7DA 4PGMA 1M67A 3QVKA 4J2HA 3FFBA 1II0A 3PI6A 1E7RA 1T3ZA 1UJ5A 4WNCA 2IEGA 5HVNA 1UJMA 5KYWB 1I5OA 4C4XA 5AVXA 2FEMA 3OX2A 4NOLA 1W5FA 3COJA 1NC1A 2DPMA 5CX4A 3T0IA 3STWA 1BIFA 1TGVA 4RYLA 4FR5A 4TWZA 5FKJA 2G9VA 3TQCA 3KSBC 4KXWA 1SG9A 3UICA 2PUCA 4M9QA 2IDKA 4B4VA 1RPZA 3E15A 2J3HA 3P20A 2NGRA 1RNLA 4IDQA 1Z68A 1LSUA 1TM4E 3LFHA 3GJXC 1M1NB 3ZWNA 2RHCA 3O75A 1ZJWA 1DIOB 4QUHA 3E9RA 2XCTB 2BONA 3M1IA 1YULA 5F2KA 4YAGA 1JQBA 2OCPA 5DLYA 5A6VA 1C2TA 2VJPA 3OETA 3BKXA 1SEPA 1R18A 1B93A 3T06B 3LHIA 3RU3A 4BZZA 1B1AA 1Y63A 1NHGA 2G1JA 2OK8A 2PANA 2QOEA 3RYCB 2QMQA 3KVRA 3G0CA 2WYIA 3J7AC 5KC8A 1VJ5A 2ZWIA 2PLAA 2NZVG 1CZUA 2OMKA 2NO9A 1EJ6A 2YFKA 4PY2A 2Z1DA 4XWGA 2A5LA 2X6RA 3THXA 4FSDA 4JUAA 2DR2A 4D9GA 4B6SA 3ZHOA 2GK6A 4D8WA 3E81A 2I4RA 4Q3OA 2A14A 5K2OA 2NX2A 1MU0A 4F2PA 4EECA 3NI2A 3P0FA 2HUPA 1ULTA 3DW3X 4AFNA 3ZHTA 3K0KA 4KWIA 1YS6A 3DCJA 2ZZNA 1DV2A 1V16A 1XXLA 4OM8A 4BB9A 3GLGA 2H7VA 2PK3A 2BUAA 4FQ8A 3BSWA 4HNAB 1Z33A 5CDTA 1JEYA 1IWOA 4E14A 4CGZA 1Q0LA 3GGGA 4IWNA 3SK0A 1H2RS 1U2GC 2OUKA 2VSNA 4XQ9A 3V46A 5JIBA 5KJCA 2BLNA 2Z8YA 4N47A 1UPFA 3VM6A 4OI2A 3IT3A 1U7UA 5IH3A 1Y6FA 4LE0A 3S2YA 3L7KA 1TTTA 5JS8A 1TKCA 1ODSA 1MXFA 1Y34E 4WINA 1OXMA 1Z2NX 3ZJ5A 4D9MA 3MOIA 4IOKA 1VI2A 3VR4D 5E6SA 1JIUA 1DX4A 3E70C 4JB0A 2WJPA 2UZ1B 2EIXA 5DZSA 3GFBA 3NALA 5FB3A 4DGSA 3H6HA 3PIDA 5I9SA 5LQAA 1KTVA 4IO0A 2BW0A 4BNXA 2VEOA 3L9WA 3WK4A 5AKEA 4FOOA 2XITA 1AUQA 3GJZA 3W04A 3OE7D 2R00C 3WYGA 5L51A 4CM5A 1AKMA 1QC5B 1VIMA 3B7GA 2FSUA 1AKVA 2V98A 1DV1A 1H3NA 1LQUA 5ALFA 3ZBUA 2WD9A 2OCYC 1IONA 3L7AA 1JPNA 3D4IA 3RYIB 1NONA 3C5VA 3SHFA 1QV7A 3OPYI 2VN8A 4FI3F 5HNKA 3U31A 2GILA 4K88A 5K09A 3BRWA 4RENA 3EVTA 4WJZA 4L95C 5SYNA 4H17A 5KNBD 3WLSA 4W4TA 2F1OA 7ABPA 1ZHOA 1JSZA 4NXNB 1GFSA 1DSSG 3EVEA 1SEVA 1M2GA 5ECWA 4DVGA 1C7ZA 1EU1A 4HWSA 4FINA 4QLOA 5DH9A 3SYNA 5C8DA 1LS6A 1IQ0A 2NO4A 4AMUA 3T1QA 2Z4SA 1RBMA 3EBPA 3UXYA 3U56A 2VAXA 3C3AA 3NAGA 5KHAA 2BHTA 4HPXB 1AIPA 4P38A 3MILA 2ZRGA 3M49A 1SFRA 1EM8B 1OTHA 3FCCA 1SKYE 5EWMA 5IKOA 3RKUA 4ENSA 4YMLA 3UA4A 1XPJA 5HKBA 2ZXUA 3ICEA 2WSBA 4HDCA 3KTFA 1H1LB 2FSSA 3G79A 3OO0A 1GNRA 5KJ1A 2FN9A 3E82A 4I3FA 3VSAA 3A1TA 4TRJA 5KYTA 2ZRPA 2CLLB 3PFFA 2PA0A 4NU6A 4YWJA 3IDZA 2D0IA 1P6XA 2W8BB 3H11B 4JI3B 5ECDA 3DWEX 3B1XA 5EXTA 1NGSA 3MTEA 1R6XA 2DMRA 2XUDA 2ZIAA 3FDJA 4IDDA 4LQ4A 2IELA 1FVXA 2YX1A 4KODA 5GM1A 3S2SA 4DLPA 1VPVA 2BDUA 1OXUA 1Z38A 2KLHA 4C9BA 3S4YA 2PVSA 3SKXA 1W2HA 5JS6A 2W2LA 3HRKA 1MNQA 4BKOA 4GE0A 4HEA6 3UY4A 3K2QA 2N42A 3B1ZA 1WXGA 4NU8X 3I39X 4TMFA 5FORA 2FYTA 1FTWA 3JU3A 4IKEA 1IAVA 1DX6A 2QG6A 5AHRA 1JT9A 2G0NA 3KZVA 3PC2A 2MWMA 3HBNA 4HZUB 3FTEA 1H6DA 1NNUA 1ETUA 1P2VA 1WUKS 2FZGA 4GPBA 4I5IA 4JASB 5CVEA 1DAIA 5IARA 3U4QA 1RLJA 2W43A 2AR0A 1E3EA 3FB1A 3WLFA 3IXQA 5FV4A 1E3JA 4IW3B 1RD4A 5EE5B 4G97A 3QTLA 1Z7BA 4I55B 2N1BA 2EW2A 3RUPA 1RXUA 4JI2B 5DBIA 3H2IA 3Q2KA 4F7DA 1YJQA 3L8ZA 3K0CA 1KVUA 3AG5A 3SJZA 4OMFG 1G21E 4XXHA 2D54A 5EGNA 1CY0A 4U3JB 1N2SA 4LPKA 1Z5NA 1V5WA 4AROA 3KPJA 1YJ5A 4AXXA 1LSSA 3X2SA 2PXHA 4E09A 3F71A 1Q2XA 2DLCX 3C3BA 1OVGA 2QUZA 3K9HA 1XPRA 5GJBA 1P2TA 3BWEA 4MEBA 2V97A 1G66A 2WIDA 3KV1A 2PZLA 3CVOA 4FD2A 1DG1G 1EVEA 1CY8A 5ANRB 4ZGWA 3CVWA 5FFNA 2Y1EA 5DTRA 2BKUA 1BKDR 4BVEA 4EENA 5B2EA 5F2NA 5HIKA 1Z8DA 2BAGA 4QRDA 5H16A 1EVIA 1KMIY 3CEPB 1Y7IA 2Y27A 4EG3A 4PLCA 3MLBA 2FOXA 3A4YA 3DONA 4Z9BA 4B6OA 3LA6A 4MS1B 1Y1PA 2P75A 3DDOA 4N0QA 4ZU3A 1YVRA 2GKSA 3SF8B 5FNVF 1HX7A 4MPTA 4MW1A 1NUSA 4ARZB 4UBMA 3T4UA 1ZGAA 2ZWMA 4WSOA 1X42A 2PMWB 4QT0A 1G8HA 2Y9MB 3W3AA 4ED9A 5K8CA 4IV0A 2X77A 5E0KB 3ZLVA 5JCOC 1WZUA 3DD1A 4O4LB 4R0NA 5DHSA 1NDHA 1WKVA 4AJEA 4L0QA 4LDZA 3EVAA 1CUJA 3H0KA 1HEUA 1SCNE 3Q7QA 1Y33E 3WB0A 4D82A 4EHFA 2ODBA 1R88A 3DVAB 3KYIB 5LNK6 3F8WA 1I7QB 3U7HB 1WF6A 1T0JB 2YHIB 3O93A 4IQ8A 4V24A 4ZQFA 1L7QA 5GADl 3T3IA 4DIEA 3N59A 1TZKA 3P94A 4L5JA 4MWCA 3W3AH 1H94A 2XHEA 3DFFA 4HB3A 4QNNA 4B81A 1HE5A 5FJJA 3FBTA 2R8YA 4TLAA 1Z08A 2CHVA 1G8FA 5HEKA 2QJTA 3GUUA 4MQBA 3ZH9B 5K4HA 1ULHA 5C1PA 3EQ6A 4YHHB 2ENUA 3IIKA 1NX9A 3PFNA 2PGIA 5A02A 2ZYRA 3B3QA 2JDIA 3M81A 1NQOA 4RIHA 2PUWA 2QW1A 2XMBA 3M6WA 5FPYA 3Q7PA 4F4JA 3FPFA 4W8GA 3A9TA 3UHJA 2CWWA 4BFTA 2XT6A 3JQQA 3T3OA 5LQSA 3TW8A 1SH7A 1OI4A 1CT9A 2B1GA 2GPWA 5K3BA 4EJ6A 2I67A 1JKJA 2WF9A 4HPWA 4CUJA 1Z7EA 1USGA 3DEHA 3IQIX 4HVCA 5K3CA 5JCXA 1C30B 3IKMB 5K0CA 5LOVA 4L0MA 1EFRD 2JH3A 4K46A 5DCYA 1R3UA 3PEVA 4Y9RA 4HT3B 3FOFC 1X7ZB 1W4LA 1XKLA 3ELWA 4UDNA 3M5WA 2PM8A 5KMGA 3N39C 4Q1AA 2VOEA 3D9QX 1MB2A 2CMKA 3NP9A 1P0FA 2FJ0A 3SBOA 3DBRB 1NJFA 1C0EA 5EWLA 5BVGA 1L5OA 1Z0AA 1GTJ1 2GJ9A 2FSGA 4TRNA 2FK7A 3I1JA 2GPTA 1PSZA 2X2FA 3AVOA 2AFIE 2Y9PB 4M89A 1L1FA 3GA5A 4Q24A 1XNHA 5IDXA 4DMLA 5T4FA 3M1LA 2Q4TA 1XX6A 2I80A 4OD0A 2F17A 3EWIA 2AYZA 2OO5A 2QTGA 2ORWA 2J32A 2O0HA 3Q1LA 2VYVA 4RXTA 3VO9A 1XCBA 5TPZD 4JEMA 1JYFA 3AY7A 3OUUA 2NO1A 3QX7A 4NLLA 5DN6D 2KJQA 5AH0A 2HSJA 3OPXA 4HDRA 3CKMA 3U4DA 1HMYA 2E55A 1NN5A 2FJUA 3IPCA 3LRTA 3FMPB 3N75A 4Y2RA 3SS9X 4N7RA 1KK0A 3H5RA 4IIFA 2R8RA 7REQA 2V7QD 2VPIA 3PNBA 2P0EA 2FEAA 4TT8A 2QY6A 2GLTA 4PBTA 1A88A 2YVQA 4Y2JA 3LT2A 2FWAA 1G8SA 3DHYA 2YJNA 3H83A 1GZHB 3O90A 4WY5A 5K45A 1UT6A 3PKIA 3C24A 3L0OA 4ZOLF 4Z2YA 4G0NA 3NHWA 3PUVA 3RTGA 1FNBA 4YUYA 5JI3E 1R0LA 1S2LA 1P0CA 3CLUC 4RHYA 3K09A 3STTA 4DRXB 2FQXA 3HSSA 3OA0A 3K0BA 2JLCA 4CTKA 2WABA 1XZBA 4DEXA 2H5EA 2QRQA 4D9FA 1HLDA 1RTKA 2V6JA 3O92A 3N87A 1ENOA 2ON6A 3CWZA 3QE0A 4A2QA 1Y1KE 4QYMA 4BNZA 1ZMBA 1TC2A 1TU0A 3TLMA 3LL4A 2WP8J 4D96A 1GPWB 2VYQA 5BV2P 1CQJB 1ZOLA 3MUFA 3BDAA 4TKVA 2IKQA 3OU7A 2ORIA 3QVOA 4FMCB 3H0CA 4LSMA 2QTCA 1AMUA 1PJAA 2G06A 1IY1A 4WCFA 3IL2A 4AZWA 4YUVA 4EPYA 2LDBA 2Q5FA 1U80A 2WHXA 1M2HA 1WHTB 2GAFA 4R54A 2ILVA 4D57A 2CEKA 4NBTA 4YCDA 1GPYA 2AIRA 5KEIA 1KH2A 2X5KO 2OT3B 1Q1NA 2JEZA 3B51X 4B3CA 4JI1B 3WL6A 5FOXA 4RO0A 1ISPA 3PE4A 1SHZA 2H1IA 3DV9A 3HU3A 1GP2A 4L4UA 1FEZA 4RJIA 3VPAA 721PA 3Q72A 5KNDD 1T24A 4LW8A 1RJWA 1PIWA 1Y6JA 3OZUA 1EGAA 2EFGA 2RONA 4Q34A 5KOHB 2J48A 1JXQA 1MC1A 1HTBA 5DM0A 2O8NA 3D6MA 2P3OA 5BOVA 3ZHXA 4YCSA 1SO8A 2G9QA 1LNZA 1T5HX 3Q7SA 1QUEA 1U2DA 2YRFA 3EIUA 3PQ7A 4MPPA 3QX9A 1G41A 2UYGA 5BNWA 5LR6A 4AK9A 2O0MA 1N0HA 2IQIA 4QYWA 4EH1A 1L9KA 2VT2A 1EXMA 4FZ5A 3B70A 3IE2A 4M9CA 4CU2A 3WQRA 3VR5H 3P4UA 4G5HA 4XH9B 3C7CB 4YNBA 4BNFA 1Y48E 1KFBB 2G72A 3ZE0B 2DWCA 2PA3A 3FVVA 3WZ2A 2H3HA 4JQSA 4EKEA 1Z8HA 4IDFA 2QTFA 1YK0A 1DUSA 5IJ0B 4PWZA 1GYQA 4LXGA 4JENA 1PHRA 5F2OA 1VE5A 4G9BA 1W4CA 4XAQA 1NKSA 2RGXA 1WV0A 3VH3A 1EFAA 3PRYA 3OQ6A 1O9BA 1ULAA 4KXNA 4EQ6A 2COKA 1Z0JA 4IEIA 4JP5A 5P8WA 3G82C 1YC5A 2JJYA 4HVAA 4X63A 3K9QO 3ZCQA 5KHLB 1JIIA 4KXUA 3AM4A 1RCUA 2QVGA 3FNIA 2O8BB 2HK7A 1YRLA 5DCUA 1LC0A 3BDIA 5FI3A 1FMJA 1F8GA 3KLNA 4HH3C 2NN3C 5D00A 2BJWA 2H5LA 2YZNA 2HLDD 1PBTA 3HJBA 1PZHA 1I30A 3TAHA 4KMRA 3QKIA 3CNQS 4JVOA 2A94A 4BJ1A 1DPFA 3T7TA 3TOXA 5GGXA 3UC5A 2GXUA 1W19A 3E5HA 5IJ9A 3AVPA 5JEDA 4WDRA 2FP4A 3GPCA 3LDGA 3LPDA 1E1RD 2FXVA 3EXHA 3JQ7B 1SXJA 2DH6A 1KC3A 2NO0A 1DB3A 1EBUA 3LECA 4J7CA 5LXTA 4N5HX 3IMFA 1TU4A 3K73O 3U60B 3GUHA 3EHDA 2QM0A 2M6RA 1LD3A 1L7OA 4PM4A 3U3MA 2DBZA 4WERA 3RU9A 1O89A 3AHJA