3OQPA

Crystal structure of a putative isochorismatase (bxe_a0706) from burkholderia xenovorans lb400 at 1.22 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
207
Chain Sequence
b'MTTPRRALIVIDVQNEYVTGDLPIEYPDVQSSLANIARAMDAARAAGVPVVIVQNFAPAGSPLFARGSNGAELHPVVSERARDHYVEKSLPSAFTGTDLAGWLAARQIDTLTVTGYMTHNDASTINHAVHSGLAVEFLHDATGSVPYENSAGFASAEEIHRVFSVVLQSRFAAVASTDEWIAAVQGGTPLARGNIYASNQKARARRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative isochorismatase
publication title Crystal structure of a putative isochorismatase (Bxe_A0706) from BURKHOLDERIA XENOVORANS LB400 at 1.22 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Hydrolase
total genus 73
structure length 207
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3oqpA00
3TG2A 1NBAA 1YZVA 3EEFA 3OT4A 3TB4A 2H0RA 3MCWA 1ILWA 3HB7A 3TXYA 4L08A 2WT9A 1XN4A 3OQPA 3O91A 3R2JA 3O94A 3O93A 3V8EA 3O90A 2B34A 2FQ1A 1NF9A 1IM5A 3R77A 4WH0A 3HU5A 3PL1A 1NF8A 2A67A 1J2RA 3UAOA 4WGFA 3KL2A 3O92A 3S2SA 4L07A 4H17A 2WTAA 3IRVA 1YACA 1X9GA 3LQYA
chains in the Genus database with same CATH superfamily
1JJVA 4LGYA 3HKEB 5DJ5A 5EUCA 4DV2B 4XPIB 1Z2DA 2PLAA 2O2GA 3EUFA 1FFGA 1ZEJA 5BW6B 3WLLA 4C14A 4Z0PA 1V25A 1G8HA 1DKOA 4WY5A 1J2TA 3OPVA 4QAQA 3QSYA 1N2XA 3RBAA 1VPTA 3L7DA 3OA0A 3C6QA 1E9SA 1AGYA 2DBVO 3WGMA 1IHPA 5I7WA 2YW9A 4KO3S 4PAOA 1E3SA 4DPKA 4EW1A 1C7ZA 2W0SA 3E70C 3EBPA 3GRPA 1CJSA 3LF2A 2YYAA 1G41A 2BEJA 2G77B 4UHKA 3DM9B 5F3WB 1J0BA 2JKVA 1DX6A 3C45A 3I52A 4JEUA 3B9RA 3PITA 5KDOA 1JNYA 3N6XA 4W5WA 3LFHA 2JHGA 1W2GA 4CKYA 1E2IA 4PXYA 1C9NA 3LDFA 3UCEA 1S7CA 3KOUA 3PCXA 4EELA 1GGHA 3L40A 3TOVA 5DSZA 1TA9A 4AY4A 3LW8A 2P2CA 1U80A 3NH6A 3X0DA 3MF4A 4ZGGA 5EPOA 1UDWA 3G3EA 3WIUA 1L1EA 2FGJA 2JD0A 2YN0A 3HCDA 4AMZA 3B3AA 4L02A 1C1YA 3UHFA 4RZUA 5JS2A 4QYIA 3QFRA 5A4IS 5DP1A 2XWPA 3OIDA 4AO6A 5EL0A 2CN1A 2DY0A 3SS7X 1YUBA 2ZB7A 4FYMA 1I7DA 1ZCZA 1L8OA 4R0VA 1LRKA 1DG3A 1XQ6A 4Y6LA 5A05A 3SS8A 4RK5A 4EQ6A 2GF9A 4FLFA 4LKRA 4OB7A 5CCBA 2ACVA 3DTVD 1OB2A 4C87A 1XYGA 1OXXK 3F6RA 3F6PA 3GP3A 3H11A 1G9TA 2CD9A 1H6AA 4UOQA 5FOWA 4ETMA 2PAFA 4NYIR 2WJHA 1NP6A 3DKKA 3CJQA 5KHAA 1E1RD 2VJMA 4P2GA 5I3ZA 2VNIA 5LVAA 2XOKA 3I9MA 4M53A 4XQCA 1H22A 1I7SB 4G24A 3GNSA 1TMKA 2O57A 1UT8A 1F6WA 3H97A 4RCVA 3T9EA 3VAZA 2P9JA 4PCUA 4CM7A 4GOJA 1CUDA 3KOYA 1G8AA 4Y6SA 2AK2A 3IQGX 5CNKA 1OKKA 1Z2OX 4QJIA 4FZJA 4JGGA 1CZRA 2R7NA 3QLTA 3MT7A 4OGKA 3SBEA 2VSOA 3IX7A 2OBBA 1N1DA 3V3KA 1OE0A 2O3UA 3GFGA 4C2TA 4V1CI 2R9VA 2UZ3A 3HCEA 1DAEA 1Y5LA 2WU1A 4GYJA 3KWJA 3RRMA 3UV7A 3UATA 3BWYA 3PTZA 4IS3A 3ZD9A 3VO2A 3J7AC 3NBAA 1NC3A 1DC6A 1QKIA 2VNSA 4OHKA 3UBMA 5C1PA 5LP1A 2QM0A 3ZWVA 4WBNB 2FQ1A 4B3TB 3TN7A 3O0DA 2OORA 2PMCA 4LGMA 5ICGA 1MB4A 1CB7A 3WRXC 2GSDA 3BORA 1AQYA 3DMFA 3HNRA 4L3OA 1O9HA 1U4OA 3AHFA 2VCHA 4TVBA 5EINA 4F3NA 2FY8A 3UJAA 3VVBA 1ZMOA 4EGJA 3I6ZA 3SXJA 3P0IA 2X0NA 1Y5NA 1VKHA 2Y6UA 4Q18A 1CG6A 1BKSB 3I39X 5IMBA 3D3WB 4TT3A 3NPMA 4UTNA 4Q01A 2PZMA 2BLLA 3HRIA 2VH1A 3W4JA 4HY3A 3GQBA 1UBEA 5FUVA 3TO5A 4NFLA 1E2MA 2CBGA 1JBKA 3N87A 1O96B 3ZHZA 3H9GA 3S28A 1I3CA 4D82A 3H4TA 4DM4A 3QOYA 2WSYB 3A2MA 2OHIA 3FUVA 5EJ8A 1GKLA 3GEPA 1SA0A 2FMIA 4E94A 1ZD4A 3VR4A 5ALJA 5LQAA 5LWQA 4OK3A 4TTSA 1JFVA 1BU8A 4OK5A 1SZDA 5J2TB 4CLRB 4YRFA 2VAWA 2XMPA 4R1SA 1Z07A 4UPVA 2C78A 2Z56A 3TGLA 2GVDC 4LYDA 3JYQA 2I8AA 3EXEB 4ZOLA 4ZI3A 2X8LA 3FVRA 5TARA 5HX7A 1OH7A 4DB2A 2YINC 2PSHA 3OY7A 1FEZA 4Z51A 4YHBA 4B34A 2R7MA 1W19A 1JFRA 2CLEB 2X8BA 3T7RA 1ZK1A 4TWBA 5TVGA 3RS0A 3CC8A 3F5SA 1B0UA 3WK5A 2A9KA 2OV8A 3QW2A 1EFTA 4L5CA 1XO1A 3A14A 3N39C 1QP7A 4BS9A 3EAFA 2JANA 2QGNA 4L28A 4YJ3F 2RHTA 3PC7A 4N9WA 1MIHA 3W0LB 2W7TA 2JGJA 4WOKA 3X44A 1QUFA 2Y3IA 4MV0A 2JFOA 1GCUA 4IRUB 2DEUA 1DJMA 2GD1O 2NPOA 5M04A 1SWVA 1M2OB 2C20A 1JNXX 2FCAA 2QLBA 1DRJA 3HN7A 3PGJA 3PNYA 4HRYA 4L5YA 1NBAA 2EBFX 3SIWA 2IZ1A 4Q7QA 5B4TA 3ST7A 3FY4A 4TS1A 2Z2IA 1OYWA 4RIFA 1YB1A 4TLBA 3FMVA 3GCZA 5KVQA 2PX3A 4LXGA 4REMA 2XD4A 4UTXA 3FPKA 3NJRA 5DNAA 1JECA 2ZT5A 1UPAA 2JPDA 2IX3A 1ORRA 5TX7A 3GLIE 4FCWA 4MYCA 1AD2A 1W46A 4GO1A 3MWKA 1YR7A 5C3MA 2XSZA 3KTDA 2XIQA 2VJAA 5EPUA 5I51A 1EA5A 2VPTA 3MTEA 4L16A 3R7FA 3U0VA 1Q20A 3DAOA 1Q1QA 2VJBA 3OH8A 3W8FA 2D5IA 3EDRA 3P26A 4B17A 2BKEA 3IVCA 4FX2A 2F4VB 2HUPA 3QWFA 2BONA 3HL0A 5ALMA 4EKIA 1N2HA 2ZEJA 4GGMX 1JEQA 1OFHA 1WDWB 3PT5A 4CMEC 5M29A 4G1BA 1E7QA 3CW8X 3T3DA 2WC1A 5CX1A 1B6RA 5JNWA 2K87A 3K70D 1PNVA 3KPWA 4PS0A 5GONA 2TMYA 2AZXA 3QU2A 5AKGA 2OLKA 2NV6A 3QUAA 4PQGA 3TLGA 5HVNA 1SRQA 1MA3A 5EEGA 3DMYA 1BD4A 4RFSB 2CNWD 4WJKB 2P9QA 3AIKA 5L53A 4FXOA 1FRVA 1Q0QA 1SVMA 2VJNA 4BNTA 1PT5A 4IPTA 3EFEA 3V7WA 5K6TA 3PLRA 4L3WA 3TPZA 4JYAB 3UAVA 4ROTA 3Q0EA 4U8HA 1E20A 1GR0A 4KUGA 4XM2A 4TMWA 1T0HB 1U8ZA 2JATA 2P6UA 3IRVA 2OHOA 4ZOBA 5FAXA 1IHDA 3SQXA 2HIHA 4MI3A 2ONKA 1V6AA 1U02A 4KOAA 2PPVA 4KAJA 2DBRA 3P71T 4I5EA 4WKPA 3ZLBA 1EVIA 4WNYA 4DEXA 2HA4A 1ISPA 2PT6A 5KZMB 1H2BA 4FC6A 2WKPA 4FHGA 3U9TA 5IF3A 3O8RA 2ID4A 5FNZA 4A16A 3ZG6A 2O1SA 2HWUA 3NHSA 1ETUA 5IAGA 2CKMA 3ZHSA 4RLQA 1QFMA 3C41J 1K5GA 3NHKA 3PA8A 4Q15A 2OILA 2FWRA 2VJLA 3ASVA 4DLBA 5IJ9B 2EZ4A 1E0JA 3EWIA 2PK3A 1GNPA 4X20B 3NP7A 2ZWIA 3L41A 3T7EA 2IODA 3KJZA 1JR3A 4X85A 1FRQA 2WNSA 4M60A 3D7SA 3B60A 1EVEA 2QL7A 2ZIAA 4MJ7A 3KLOA 5C52B 3COPA 4K6CA 4LHVA 1R1DA 1OLUA 2HR1A 3CUVA 2MINA 4WBXC 4DQDA 2XMBA 1E3WA 3LKDA 3LT2A 3RJ5A 2FWIA 3ADPA 4S2EA 3RPEA 4M6WB 1Y34E 2DPXA 3EDCA 4JA0A 5A0VA 3DHVA 1UPBA 1JFFB 1AKEA 5CDFA 4QZVA 4PBTA 2VI5A 2VHXA 3EPHA 1Z8FA 3LBNA 3F97A 4QQRA 5A2GA 2LD4A 1C9JA 3EH1A 4X6XA 5H59A 5IDYA 3RS3A 5EJ5A 2XCIA 3MJDA 3O84A 4R2LA 1ZR2A 1NVBA 1Z6ZA 3SHWA 5T4EA 2HWYA 5AM0A 1XZHA 1YL7A 5EE0A 3C8HA 2FQYA 3QMPA 1EVZA 4I6GA 1P8AA 3A2KA 4JJ7A 1KNXA 1B16A 1W34A 2P4QA 3KXDA 4HEQA 4U6SA 5I7FA 2C2XA 2DBYA 3ETNA 1UJNA 1SBTA 1FDVA 2WF5A 2IT1A 3T5TA 4D0LB 2I62A 2P9BA 4LFCB 3UUFA 1DCKA 4NS1A 4BFUA 2GDZA 4YJDA 2ZJZA 3OZWA 1GADO 2G28A 1ZK4A 1IH8A 1TM7E 3QHAA 4M76B 4BNLA 1J6UA 1P1HA 1RBMA 2YIDA 3AM3A 3EEQA 2VJDA 1N6KA 3UXYA 1O4WA 1HG0A 2AX3A 2AFHA 2EGUA 2J3QA 3E4DA 1NURA 1W4LA 2QRKA 2FPPB 3FKSA 2ZB2A 4ZXPA 1TLFA 4C0WA 2AOWA 1WS6A 1E9EA 4HDNB 1ODIA 2WAMA 4QRDA 3UENA 3AETA 4HGPA 4HEA1 4EFDA 1VMIA 4EVSA 1CFZA 2P1ZA 4ZWNA 1YVRA 4FOSA 5AW5A 4E12A 5ADVA 3OG9A 1TZJA 4ID9A 4WCVA 3RFUA 4LF6B 4QVIA 1D2CA 2Z6AA 1U8AA 1XLUA 2TS1A 1U6IA 3RU7A 1RHUA 5L95A 1WNTA 1CQXA 1R8YA 2OGUA 3M6LA 1GNLA 5KQPA 1YUNA 2VQ3A 3HA3A 4G5XA 4N5DA 3SXUB 5G0WA 1DQRA 4BQOA 5HF6A 4C01A 2NSHA 4EABA 2XXAA 2HX1A 1QQ6A 1WD7A 2WG0A 4MGIR 4UASA 1TJ5A 3ISVA 1JI3A 1TYAE 2BJWA 1IMOA 4JDUA 3GNLA 1W0KA 4PS1A 4XFKA 1Z0ZA 2BM9A 1RACA 2Z57A 4GFDA 1QQAA 1KEUA 4R2MA 3VVCA 4BJ6A 1E59A 2FSPA 4J0FA 4N8DA 3VO1A 3QVXA 3MMSA 4Q4JB 3RD5A 4BZWA 1PQYA 3DBHB 3H8SA 3BJIC 3D4IA 4B3CA 1A8QA 1K6EA 5D5QA 4EFKA 2FSVA 4AJ1A 5JNUA 1TJ4A 4M9SA 1Z0IA 1M1YB 5HWSA 2FMTA 2BFCA 3DC2A 1RAIA 2KSQA 3KPVA 5DW0A 1RQ7A 3OBIA 2CJYA 1GTG1 1E77A 2OAGA 5F9MA 1A97A 1PYOA 1SIUA 2X9VA 1USUA 1KSJA 1WLSA 3CUEF 3CW2A 3HJAA 4HLCA 5JCJA 4X1KA 3KKQA 4DJDC 4M0PA 4MRNA 4QXMA 3VPFA 1V1MB 1DQNA 2ZRHA 1XMXA 3EB9A 4D4KA 2B8EA 3G1UA 2VAXA 1FS4A 3CE9A 3N0TA 1C7IA 2ZRBA 4LBWA 3U9SA 3F9CA 2H4HA 4RHYA 1JDSA 2G72A 4MPRA 4U0JA 1K3UB 1NZDA 2V7VA 2X0JA 4Q47A 5I8WA 1XCPA 4Y2QA 5JDIC 1QH0A 4ZAWA 3PQCA 1DC4A 1ZISA 1ZU4A 2QBYB 1ULTA 3WMXA 1FP2A 3GFFA 1EFPB 4XJTA 2N75A 2FRDC 4AC9A 3R6GA 4GVXA 5D8DA 1GD1O 4O2BA 1BIFA 3ZHCA 5JAZA 5I8PA 3GPIA 3TR5A 2YWFA 5CDFE 3R6WA 4C08A 4FHCA 1JFLA 3K6SA 3KQQA 3LT1A 5JWOA 3O03A 3B2QA 2ODBA 1AXEA 1HE1C 2CYAA 3MZ0A 3F7MA 2C2YA 2WJVA 2ZSBA 3OUZA 2AZMA 4U1RA 4ZALA 1UBTS 1NC1A 4ATNA 2VSFA 2B5OA 2XF2A 5CB4A 1O94C 1OWOA 2CJWB 1JPJA 2WFMA 5IAOA 2V03A 4BCCA 3CMCO 4Q4CA 3UKOA 3EXG1 4U7GA 2NP6A 3JR7A 4BIIA 1XQ1A 1I7PA 3SZGA 2H1WA 2O3QA 2LDBA 5K0EA 3RVDA 3AOEC 2QSJA 1NQTA 1M8GA 1FSGA 221PA 1XDUA 3Q98A 5ESWA 2PT9A 4UPEA 2UZ0A 3VTAA 4D9CA 5JUWA 3ZU3A 4HB2A 4NCJA 3LT4A 3ZBUA 3I9V6 1N1EA 5JXJA 1L7PA 3SSOA 3UK1A 2C0QA 2GM5A 2XNHA 3JRWA 4BMSA 2Q45A 3DCIA 3R6DA 4MDYA 4CDNA 1SCAA 4YRJA 1TEHA 3G5TA 4URYR 2BUAA 1T4DA 2XE8A 2G5CA 1A9PA 3KZVA 4MCIA 2LRHA 3H9CA 2IS2A 4LF5B 5DMXA 2PA3A 1A9SA 3FTQA 4J7UA 4IG9A 3F4BA 3VC7A 3W6PA 4C7XA 4F5DA 5KYXA 3HXQA 1TUIA 2REQA 1J00A 4FT4A 1X80B 1RAEA 2RGEA 3AHHA 1XCGB 2HSEA 2RGDA 4FDUA 1P1KA 2DPHA 1A9YA 4HMPA 2B1QA 3NHFA 2VPXA 3BSSA 3C6ZA 5K3BA 3WWYA 4J4BA 4X6LA 2AWOA 2F4NA 1LJLA 4K8OA 2RI1A 1L5LA 3WB1A 2BFAA 5JATA 3NNDA 4RCYA 4F60A 2CNBA 2VHUA 1BFDA 4MVJH 4CUZA 1U2RA 2H63A 4RIIA 3VQTA 2AEFA 3TQCA 4F11A 1B93A 5TF4A 1TTTA 4XJVA 3HCAA 3ENZA 3ZCQA 3GLVA 2XA1A 3UK7A 1SU4A 3AVYA 2YOGA 3FG9A 2ORYA 1CHNA 1Z3CA 1EU1A 2ZCVA 4H35A 3MB8A 5G02A 3SYTA 2J1LA 1QCCA 4XA8A 4IEFB 1M9NA 4MV5A 3PX2A 3X1YA 4UEOA 1UXJA 4F5WA 4ACAA 1TD9A 4RA6B 2FFAA 5GZ1A 3BWCA 4WCFB 4IFTA 2XRZA 4MUYA 1IN5A 4IJ6A 5HMLA 3RS8A 3UQZA 4C03A 4RTOA 2Q27A 4IXMA 2F8MA 2HU5A 1R6BX 3KSZO 3M82A 3TXYA 3ZY4A 3JWEA 3ZV4A 1PR4A 1UJMA 1Y7IA 4MVJA 1PVVA 3WL4A 3UJDA 4CG3A 4QXPA 1SUIA 5IJ0A 5JS6A 2F9LA 5LBIA 2JCVA 5A6SB 3V9PA 2FN8A 2JJ1D 2WSSD 3GEIA 4CQLB 1FYDA 4NZOA 1BN7A 2P2LA 2H7XA 1Z62A 5AM3A 2BGWA 1PEDA 3ICOA 4UKDA 4ZREA 4D4JA 2WM3A 4QUIA 4HNUA 3KLNA 3OX3A 1QLWA 3LX4A 3QSGA 3X1ZA 4A8HA 1DAHA 1K92A 3OQHA 2F64A 3SZUA 1SD2A 3CX8A 3FYUA 3ILHA 3CF2A 3ANNA 3D7MA 1UWKA 1E8MA 3MCZA 1RQXA 3K7EA 5EWJA 1IQ0A 1YBMA 4ZI2A 2X5OA 3G5UA 1ZD9A 3O1IC 3VH1A 1JDBC 1SXIA 2YHAA 4N65A 3TIIA 5K0LA 4AX8A 1SQFA 1V1RB 4FWIB 1UZNA 3A36A 4FFPA 1HXHA 3NWOA 4A0FA 1L7VC 4EHNA 2FWJA 1FYXA 1NDQA 2FK7A 3G2NA 4OQFA 5DBOA 2CLSA 2D1RA 4OXRA 1LS1A 2HW8A 2EFEB 5CFOA 3H5OA 4IBOA 1ZESA 3CCFA 4AMUA 3NUGA 2WDZA 4JUBA 5ICSA 4QTXA 1PJ2A 3HMQA 4BO8A 5ED0A 4ZAZA 4RF4A 4GZMA 4JCOA 2GCPA 4NZ9A 1D4FA 1NRJB 1VYUA 3NR2A 3QXJA 5IN4A 1CSEE 1P7WA 1F8YA 1Q1AA 3R5JA 4I1YA 3TG2A 5ENDA 5BQFA 2O5VA 4P38A 4RLFA 5GV8A 5BP7A 3SHFA 4KR9A 1S2IA 1TA4A 2GNOA 4XIYA 1CUIA 1H66A 1NW7A 1U3WA 2XTNA 3I42A 4DXDA 2QTRA 1E3IA 2VCYA 2DZDA 4X1OA 3JYHA 3BDAA 2J07A 4W7HA 5TY0A 5TXGA 4DMGA 2HRQA 4P4LA 3OQMA 2GLTA 4JOSA 2BGNA 1O97C 3OJCA 2I3AA 4LRWA 2HSWA 2IXGA 1QGAA 3FOBA 4MWBA 4XWAA 4EGFA 2CWDA 2CMGA 2XWQA 3OSZA 5AKXA 4DN6A 5AW2A 1CS4C 3MJEA 2XMRA 1CWUA 2PDAA 3EHDA 1SCNE 2AMYA 2ZUCA 1EWQA 3WLKX 4W63A 1VA5A 1ZIDA 2OO3A 2Q4EA 2WIAA 2WIGA 3L6DA 4NYMR 1H6BA 4M8IA 4BYMA 2R1VA 3NX4A 1MKYA 3D02A 3QJYA 4LWOA 1T5HX 3UOWA 1NQVA 4XGQA 4JB2A 2BOVA 4EFLA 1DWQA 4ZVRA 1DTWB 1AJEA 4BNNA 2GOYA 4AIIA 4OB8A 4BNGA 1YZLA 2CXNA 3NOQA 4YV0A 4GG1A 5B3JC 2BBWA 4MYRA 3OX2A 5FORA 1OYOA 1US8A 1FW6A 3QVGB 1LX6A 2DTXA 3T3HA 3NM6B 5A5DA 1KSFX 3OEEA 2A5YB 2B5WA 4TN1A 2YFQA 4ZT7A 1WPGA 3U4DA 1P77A 4AXXA 5LNK6 1FB5A 4PQYA 1N5LA 1RAFA 1E9DA 1KK2A 3I28A 3ZCUA 1NYQA 3ELDA 4P9NA 4RSHA 4N7MA 3FUXA 1WSWA 3D59A 1GKUB 2H2HA 3V46A 3C1OA 2GZSA 4XWTA 1TO6A 4O1MA 3T9DA 4AU1A 5L3QA 3GPLA 4D56A 2WAYA 1P62B 2CZGA 1FU4A 3IESA 3SVZA 2CL7X 4BNJA 5HK9A 1XRSB 3GPDG 1WNFA 2AXNA 5CYPA 5EJMA 1DC8A 3P0JA 4B6PA 2YCLA 3GJ0A 3GX1A 3R0IA 3TTYA 1N36B 5I4KA 1EP9A 1NLFA 1Z28A 2VHTA 2YVQA 3P19A 1CETA 1I1QB 2L42A 1HQDA 4LTDA 3A6LA 4NS4A 3WVNA 1Z4PX 2QE7A 2B37A 1L4NA 1PVOA 1J8QA 4II3A 1NUUA 4GGOA 3ZW9A 2DE0X 5E3HA 3UMMA 1N0IA 1QGUB 2EAUA 1R4ZA 1YVUA 5ALGA 3FNRA 1AQJA 4D43A 2WHRA 8ATCA 2RD2A 1YZVA 2ECKA 2ZKLA 1U5BB 1DC5A 4MSUA 3VR1A 1BGWA 5DYNA 3UVEA 4C0JA 3OZGA 4R71A 4BRZA 5EXXA 3AI2A 3VZPA 1PNQA 2DFDA 2EEZA 3LQKA 3JAKB 3DOHA 1BX0A 3WQQA 3TCKA 2XYHA 1HA3A 1DBRA 1QHYA 4INAA 4TMXA 3DE0X 1ZK0A 3ROZA 3TLKA 1ZJWA 2FTKE 4NNOA 3RIMA 2XDQA 5B1SA 2CBXA 2GK3A 4U7FA 5AR1A 1EIWA 1NUAA 3L4EA 4FFRA 4CKBA 4KQ9A 4K0RA 3BXHA 2AT1A 2ECOA 1G8PA 2HF2A 2VH2A 3HADA 3GF4A 2FW9A 2P1DA 3Q5EA 5BNTA 2Y8EA 1JDNA 4NBKA 5LA6F 2JGAA 4CHTA 3QOFA 4E1VA 4MR9A 1OW3B 1Q77A 3P52A 3ENKA 4JUIA 5CNMA 3VNUA 2AFRA 2D7JA 4BKMA 1G59A 4BGVA 1X7ZB 2D62A 4XUCA 3B8EA 4C05A 1RC8A 3CLKA 4XW2A 4ALLA 2Y0BA 4E32A 3RVQA 1OFUX 1U0HC 5LMCA 3TW0A 1FC0A 1YQUA 4ZZ3A 1XLTC 3LI2A 3MMPA 3DF7A 3QELB 4KV7A 4E2FA 5KHOC 2IRWA 3A32A 3JD4A 4D6XA 5KNLA 1OU0A 1AY0A 4W5HA 4NX2A 4JJ4A 4GMHA 1QKKA 3A25A 2P5TB 1G5FA 4G5YA 4MHSA 3ZWMA 1LS6A 1C1DB 4ESEA 3GLQA 4ER3A 2C7QA 3GCDA 3QUCA 4BXOB 1DOZA 1Z68A 3NAMA 1SUFA 5H68A 1UPTA 5AW6A 4DV3B 1ZOLA 3IPLA 4YDRA 1IHXA 2R1TA 1W5FA 3GFBA 3MIIA 1NW9B 3Q0TA 4KDRA 5AJWA 1C7FA 2BI7A 3KJGA 4Z99A 1MMFB 4E14A 5FKJA 1XRLA 1Q1EA 1NLZA 2LP4Y 2HBYA 2VT2A 2L82A 3I01M 4QFCA 4K03A 5CT5A 1B8OA 4YP1A 3S55A 2YS6A 4FGSA 3QBVA 1U1FA 2UXCB 2BFOA 2ONJA 2AFIA 1DWPA 2D4HA 4YAJA 3DYBA 4IQGA 1F9EA 3IPRA 4UXIA 1SURA 3U7RA 5LP6F 1K8ZB 1E63A 2H31A 5FFMA 3O8QA 1ZITA 5DMHA 4MVJI 4QBKA 1ZI6A 2JH3A 2P4UA 2I4MA 1JKMA 1NPDA 3GJ7A 3IVXA 2JIBA 1P0PA 2FFHA 3FWHA 4G1EB 2CK3D 3EVNA 4QOJA 1G21B 4EG0A 2AFVA 3MB5A 1OT3A 1P2BA 4GX1A 4IFEA 5JH7F 3FDIA 5FL7D 1UKVY 4PPGA 3ZZ1A 2MOKA 3F6SA 4U7TB 4DXAA 2XDYA 5AVQA 2F1IA 1HL7A 1Y3CE 3GRUA 2PWPA 4L9RA 3KAPA 1KF0A 3AERA 4RGVA 1FQOA 3M5DA 3Q9SA 4WLVA 3PG5A 3FW1A 4CM6A 1TX4B 2W71A 3ZZNA 2O0JA 1H65A 2XE4A 4MI6A 2WA2A 4UM5A 3FVQA 4YIKA 1H4QA 4CV1A 2R8ZA 2IXEA 1AHHA 8AT1A 2OYCA 1WPQA 3LHDA 5BWMA 1FE8A 1KJWA 3DL0A 1G17A 5IC6A 4DR5B 1GPMA 2JB9A 1WDMA 1P4AA 2EQ5A 1JDVA 4WQMA 1IY2A 2WVJA 3O4HA 3K1AA 3K9LA 3IELA 1ZJ6A 1ZC3A 5KO2A 4EYKA 3IBYA 3WKEA 4LXHA 4HRAA 4H17A 3HCRA 4AZ3A 4I3HA 1OQAA 3M3HA 1BVHA 4PZ9A 4U7PB 4ZEOA 3NXKA 1MTZA 3DD1A 3LNTA 4LKOA 1DAOA 4KQEA 2HNAA 3QI7A 2ZIZA 2MYUA 2QAGB 3TW8B 1UIRA 3DYVA 3EIQA 3C3BA 1XXHE 4I4TB 4JYPA 2P41A 1I6LA 3UMGA 4FEGA 5CVVA 1WHTA 2JNWA 3FD8A 4BVJA 4K9OA 2D13A 2EWMA 2R8OA 1U98A 2C5BA 4ZDJA 2J87A 5E3IA 3IEMA 1KZ1A 3QYPA 4H4DA 4KQWA 4X63A 4PCLA 3WYBA 2VTDA 5JHHB 3GRVA 4YJ2A 3MNFA 2P90A 3UMFA 4W4TA 1UXOA 2YOFA 5CYOA 3ZJVA 4YR7A 1U31A 2QW0X 4MB6A 1HF3A 4K05A 1FXWA 1KZGB 2C9BA 2KQUA 1QFXA 3B51X 3OZBA 3RRNA 1QV6A 2V58A 1QRUA 2YZGA 3KKOA 1B2LA 1JWBB 5BWLA 2ZCJA 4K9SA 2AG5A 3JD2A 1RLIA 2P77A 3L6CA 4JD5A 4FKZA 3W1WA 1SUWA 3M4JA 5FTMA 4HFJA 5CA0B 1CZLA 3DE3X 5KOIA 3EVEA 6ADHA 3U16A 2XCSB 2Q9UA 2WOOA 3PJEA 3PUKA 3DVLA 1E69A 3HA7A 4UULA 4YFVA 2ZAGA 4ZKEA 4Y9DA 1YDWA 4ETNA 2WU8A 2Z2YA 3DA8A 2WU3A 2NYAA 3G6KA 3NBUA 1AV6A 4NLLA 5IXYA 4UU0A 2NTYC 4KP7A 4CM1A 3LBHA 2NT4A 4HUQB 4KQCA 4B4WA 5KBYA 2WWYA 4DV0B 5DYTA 1T8PA 1SELA 4HS9A 3HR4A 5CFZA 2PVSA 2OAP1 3RGWS 2UXBB 3B89A 1OLSA 3ABIA 1A4UA 1F6BA 1GAQA 1GTZA 3CA8A 4K6OA 3UK0A 3KTOA 1HDYA 2COKA 2AI1A 4V3BA 5MN6A 5LLDA 1BVRA 4DNQA 5DX0A 1TM1E 4OLBA 1QOZA 5JD3A 3GPBA 4M9ZA 4OGWA 3B5IA 3IC5A 3IUNA 2QUJA 4IIJB 3VUEA 4C7VA 3CTMA 4Q3BA 5BUSA 3GVCA 5I45A 3LHSA 4EPTA 4QM6A 1QVRA 2VRWA 5KJCA 1V11A 4ECEA 4D4IA 2BZSA 2Q50A 3ETHA 4NV3A 2G9ZA 4HGQA 3HDTA 4RPIA 1VIAA 3IOEA 4KQMA 5FPTA 2ZBEA 4PAMA 4IF6A 3JPYA 1KI6A 4RQAA 2NU7B 3E15A 5EZSA 2FW1A 1C4WA 1Q1GA 1YJQA 3D4OA 3FR7A 1E7SA 1YB2A 3PICA 3RSGA 2CE7A 2DKFA 2FX5A 3MXOA 4ZK2A 2NO5A 2WLTA 4OJYA 3STTA 2H3EA 5AXDA 1O03A 3VPBA 4ZJPA 2AW5A 2HEGA 3ZE9A 2YNMD 1LRLA 1H8HD 3L0CA 1X9IA 1Y3FE 1KSHA 2B0JA 2WWRA 3NDJA 1ORDA 1Z2CA 5DI9A 2AG0A 3KXIA 3RWMB 2GTHA 4N0QA 2WNHA 4KO1S 3VYTB 1AO3A 2AVDA 1SKBA 4HGOA 4YLGA 3CX6A 4LX8A 1X77A 2ST1A 5A7HA 4AIRA 5CT6A 4YCLA 1I2AA 3KQKA 3H5VA 2IXTA 1SFRA 5KYWA 2GCOB 1AURA 1J8FA 2XV1A 2R65A 2HIMA 1GPNA 3D4PA 3DL7A 2GPTA 2CLDX 2CMFA 3GDFA 3JQAB 3LMKA 3OA2A 4P7GA 4ZYYA 4BPBA 4MYSA 1C5KA 4XVCA 3OQOA 4GZ5A 3M34A 1ZBQA 4I8IA 3O1LA 1XJCA 4UARA 1ISSA 1E6LA 1HLFA 2X13A 5CK5A 3VZBA 2PUEA 2WJYA 4HADA 1ISJA 4PX5A 2QNBA 5BT9A 3KTFA 5HK8A 1NQWA 2N47A 4OHOA 4PN7A 4GMDA 1KYTA 4IQ8A 5K45A 3BCUA 1UFRA 5KOJB 1EAMA 4DUZB 3LGXA 1UC9A 3IYLW 4OXXA 4Q00A 1WJGA 4G85A 3N70A 1JX6A 4EB6A 4Q7JB 1NUHA 2QT9A 5GZ6A 2Y2VA 4A1FA 3ZQJA 1QYRA 2V65A 3EFBA 3UFXA 5DDIP 1B26A 1V3UA 4KXWA 5JVDB 2Q5QA 3TLJA 1HBJA 2AX4A 4M4SA 1P45A 4GYKA 3RK1A 3IVRA 4FMPA 4DEYA 5HKKA 4LF4B 3CIOA 1FFEA 2OORC 3K3PA 3PLNA 1NSYA 4RM2A 4MGHA 4MJLA 1RWXA 1JYFA 5HE9A 1FDIA 3V4PB 5FL3A 1P4GA 1YQXA 4QARA 3QKSA 4FSDA 1L5KA 4CM4B 3CUUA 4OTZA 4CLOB 2UAGA 1G6Q1 4OI2A 1E1MA 4HXGA 3K8QA 4U9UA 4CN8A 4UUPA 1A1SA 2H29A 2X5NA 4MMZB 3U3JA 3FHCB 4YJGA 3ZCPA 5IF9A 3T61A 5ITWA 1G98A 3OTGA 3NYQA 3EFOB 4ZVOA 1PNRA 4LOHA 4MV9A 4BZPA 5C4IA 2MIIA 5FA5A 2VDUE 1YK0A 4JQYA 4DDMA 3KJXA 5J2UB 3ZDAA 3BL5A 3H86A 4N3GA 1WD5A 4NHEA 1F4PA 2F90A 4UATA 5A0TA 1FMLA 1PYDA 2QSYA 1JLKA 4BCDA 2H1FA 1DBIA 4YCSA 3AJEA 4JCCA 4J91A 4ZD6A 1F2TA 3TRFA 2ETXA 1O57A 4N76A 1KR5A 1DINA 3A6ZA 2IKSA 2QU7A 3MWEA 2HT6A 4Q7MB 3GDOA 2ZR0A 4G65A 7ADHA 2FPRA 4EW2A 1UWVA 1TCVA 1EINA 1AVTA 4UAJA 3VX3A 1PNOA 3JR3A 3JWGA 3KSAC 3EZLA 1Q7TA 5AJYA 2CLHB 3EGDB 3OZUA 5K9ZA 4G1CA 3V55A 4HWRA 1ZXLA 5CPFA 3EEBA 1CS0B 1G9XA 1P1IA 1HPLA 4DZRA 1UFVA 2RCYA 1RABA 3NONA 1JJIA 3TINA 4MPPA 1Q1BA 1JBEA 2PHZA 5BRJA 4Z53A 4HQLA 1ZGGA 1NW4A 2O7NA 1C3LA 1M6VA 3R3JA 5KX5B 3LY8A 2C5FA 2R84A 2ZJAA 4QYTA 3HVJA 4MQ4A 1ZVMA 4G1MB 2RHJA 4HP8A 3OCWA 3PXDA 2JAUA 4JI4B 2HXGA 1LSUA 4MV6A 4ZVPA 1EM8B 4O4HF 3TIXB 4YP5A 1YJ5A 3GB9A 1RWPA 5KCMA 1OBCA 3DKIA 1D0SA 1ST2A 3GDHA 4UCXA 3H2SA 5B36A 4HPWA 1SCUB 1XN4A 2IUEA 4RMNA 2OOSA 1AUPA 3LYLA 3L3BA 4R3UC 1Q7RA 3QLUC 2X1LA 4AY3A 1W30A 4OKIA 3WNZA 1XTQA 2VK1A 5AKIA 3SKYA 3LQ2A 1O97D 4YJ3A 1AKVA 2QUKA 3TZLA 4QGSA 4MWSA 3K15A 3RTAA 4E5PA 4TV8A 2QPTA 2Y0DA 2CLMB 2ORED 4Z9YA 1ECLA 1T25A 1XFDA 3FMFA 3CWCA 1KFCB 5JRJA 4PY2A 4ENPA 721PA 1G16A 2PKQP 3Q72A 1S9HA 1W4AA 5C1BA 4GYYA 5KNBD 1W4ZA 2F2TA 3PQ8A 1AV7A 1SXJB 2P2GA 1WBBA 2J5QA 2ZBDA 2XZOA 2JKYA 2CFSA 5B4VA 2YWCA 4YHHB 2B1GA 1XYYA 3HCCA 1NW6A 2A8YA 3NUZA 1B6TA 4GT1A 3Q3JB 5KJEA 3KYCA 3NV9A 1T6XA 3O7MA 2CDBA 1JE0A 2JF0A 3QHPA 5DM0A 3VR5H 1IXYA 2Q99A 1RBZA 2J3EA 2W48A 3W9UA 2M32A 3G8BA 4PIVA 4O59O 2PX0A 4ZXFA 2AC7A 2QNIA 4HBGA 4L1KA 3HBLA 3MT9A 3JQ7A 4HLDA 1AHPA 2H16A 2OZKA 2PWYA 2VLBA 3HM2A 3KUCA 1AA9A 1EWTA 4LSGA 2UKDA 1FXSA 2GEUA 3LWNA 5CJJA 1MJFA 1A77A 1K27A 1WXEA 4RC9A 1XRJA 3GY0A 5A9SA 2E0IA 1RHJA 1Y63A 4XX0A 3SVTA 2J5XA 1UBCA 1JIQA 1DJLA 3WJ2A 1OGIA 2PGJA 3LJKA 3RF6A 1ZIYA 2I5PO 4BL5A 2ADMA 5DN9A 1ZCAA 2WIBA 1H3FA 5ALNA 3H7AA 4N8EA 3NW9A 1D4ZA 3EEIA 5GJCA 2BFWA 2LBPA 2R44A 1EFDN 5KEIA 3ESQA 4YGYA 3F5MA 3HSKA 2BELA 2XXBA 3JSXA 3DEZA 4IZOA 4KUEA 4YRPA 3AY3A 3ET5A 1LV8A 4EWLA 1N33B 2YXLA 5G0SA 2MSLA 3P8ZA 1OI3A 1P73A 4WY2A 13PKA 2WM9B 2XUDA 3I9KA 2PS1A 4ETIA 4MW7A 1HKHA 2XB4A 5EWMB 4R3NA 1GTL1 1FDWA 4R8MA 3Q15C 5CP8A 5DHSA 5E2AA 3EULA 1Y4AE 4EOGA 2D2EA 2AA3A 1X7HA 1YJAA 2QN7A 4NBNA 1D8AA 2YV1A 3EDMA 3HO8A 1A7JA 3K73O 5HF5A 2I33A 5B3AA 4S2UA 3WKDA 2OHHA 3GBVA 1RJ9B 1QR6A 2IK8A 2OXTA 4GPZA 2V97A 1YIOA 1Z6AA 2VEDA 1Z36A 4H4CA 4B1FA 2QQFA 2NOAA 3TNLA 2JJMA 5CFNA 5JE8A 3G17A 1TXGA 1YRAA 3HPRA 5CUQA 4R31A 4UVIA 4X92A 4REQA 5J63A 3PC2A 2V7XA 2FJ0A 3Q8XB 2NNWB 1TQHA 4NC9A 2B7BA 5EA2A 2VJYA 1XAHA 2I4NA 2WUWE 4P84A 4F85A 1J9EA 5JDCC 3OJFA 4IDEA 1YKGA 2CDNA 1KVUA 1G7RA 3W3AH 1N9KA 3PPWA 2FWBA 4QGBA 2I91A 1G5QA 1YHYA 1GXSB 1DCTA 1WDTA 2YV2A 3LVBA 3OT5A 5BN5A 2BSXA 1HDGO 1W36C 2YMQA 1RZRD 1XE3A 3W6NA 1XZLA 2Z83A 5DLEA 5I9TA 3WK9A 5COBA 2Y77A 3KOXA 5E9JA 3A3PA 3LQFA 3T99A 1R6TA 1AZLA 4I2NA 3GJ4A 4M89A 4ZQFA 4KITB 3RBVA 1P2GA 2FXIA 2XUKA 4NY1A 4KZPA 4EUEA 2HK7A 2TMGA 1VDZA 4QNRA 5EJ4A 3FB1A 4H2DA 1ZM4A 4B74A 4C07A 4OLAA 5MF6A 4BFWA 2MMGA 1N7IA 3H0KA 3I4LA 2I87A 3C5VA 5AK4A 2LKDA 1SGWA 1T26A 4RZQA 4OD0A 4MW5A 2YFHA 3WQRA 3DZHA 1U9IC 1FP7A 2WFLA 3CUSA 4LDZA 2E37A 2ZAOA 3JZFA 4IICA 4M1SA 3WGGA 1R10A 3E05A 3IAM1 5FYDA 3EIHA 1FF9A 1FQWA 4YJFB 3QLVA 2XCTB 1RP1A 1H6CA 3RS9A 4QOGA 1EDDA 4DJEC 2BZGA 4EMBA 4JLMA 5BVGB 3CZ9A 5HFJA 2PWZA 5JD6A 2O8DA 3TB6A 2IHVA 2IY8A 4XH9B 1Z56C 1M7HA 1NN0A 4UMFA 4YPVA 1BXGB 1SC1A 3OOHA 2C59A 4IIVA 1H8ED 1GOTA 3WTCA 4OM7A 4B6GA 2X4GA 2ZJ0A 4JJ6A 3DPUA 2E3JA 4DLYA 5FP0A 1REQA 2ZTMA 4YDHB 1L3IA 1P61B 1UJ6A 4WERA 5ALIA 3WLRA 3JASA 4NCHA 3CLRC 1ESEA 3I2YX 4UZSA 4G63A 2JARA 2W6JD 1FX0A 2RGAA 3LCVB 3B20A 4L3VA 4PHTA 3OQNA 1TQ6A 3IE0A 3NTOA 4TOIA 2IHUA 1VGRA 3IURA 4HAXA 5H83A 2XHEA 3NCHA 4LSWA 3EIXA 4JIGA 5IT0A 3DEJA 3U3ZA 3GGOA 2OXRA 2VJCA 1RWVA 1UADA 2GEKA 3QUTA 2PL1A 4JEIA 5CLLA 5ANRB 3S2SA 1W6RA 1YMQA 2BR3A 5LOVB 4WY8A 4D99A 1HM5A 2AN5A 1Q1ZA 5DT2A 1GL7A 5JZBA 4CEJA 4UM7A 4F2HA 1B8UA 3R41A 2AR9A 5BNFA 1OXMA 4NPAA 1M34E 1W4CA 4S1PA 4EVQA 4DTIA 4FS8A 3W6UA 1ITZA 2SCUA 3NNSA 4UE2A 1L7AA 3BGDA 4JLVA 3AY6A 3MCUA 5EVCA 2NACA 3L1UA 2XLCA 3NJ4A 3CU5A 1EUYA 3H5RA 1FK8A 5B37A 2OK8A 2HPHA 4YJHA 4DV6B 5KSZA 4IDFA 1E98A 4PYKA 4YRCA 1WXDA 1SCBA 5LMUB 4I5IA 1QIJA 4YVFA 5ADUS 3I83A 3JARA 4F2DA 2HF9A 3K16A 4WN3A 5DYYA 3S1SA 3HXTA 2AL7A 2CNLA 4B83A 3M1AA 5DBIA 4KRGA 4ZPJA 3HH8A 1K3FA 5B53A 4AF7A 4X0EA 1RE1A 4TQUS 3UK6A 1ZGZA 2WSMA 3CJRA 2W37A 3ZCTA 1KDRA 1KJJA 2G6BA 4O33A 1R5OA 1E6MA 1V8FA 3RAJA 4KXYA 1D4OA 4Q7EA 7REQA 1M2HA 1RW4A 2WIDA 1UMKA 2WSBA 3IUBA 4GPBA 3QEJA 3HVKA 4QRHA 4H7EA 3V1NA 1PFGA 1KI3A 3IJRA 1WVIA 1XC7A 3QWBA 2SICE 3ZE6A 1NX9A 4TVOA 1TIKA 3UKDA 2NVOA 4RADA 1B2RA 1SOUA 2QRMA 2ZXEA 5CD9A 4H1HA 5TF0A 4QOFA 2SECE 1NNEA 3HFJA 1XMSA 1E32A 2Q0QA 3AWIA 1LGYA 1G4AE 3VKGA 3LP8A 2Y9MB 3SKXA 4BQNA 1HE4A 3J81A 1G20B 4MIKA 4WZAA 4EKDA 4S3MA 1UM9B 4NMXB 3T5GA 2CWWA 4Z54A 4Z6KA 3D8RA 4Y1EA 1U81A 3K9GA 3JZAA 2OBXA 4GZ3A 2E82A 2OZEA 3AUKA 3HKCB 4IHQA 4WOCA 1Z8HA 1LQ2A 2GF0A 1KZ9A 2OHJA 4GOKA 4NZNA 2GHTA 3UCFA 2YS7A 4UDXX 5THQA 4B46A 1KMCA 4DJTA 4UBMA 5FDFA 4CEHA 1KIMA 2YKGA 4FIDA 4J3JA 3PVCA 4PG5A 1GAJA 4BTLA 4V3CA 3CNEA 1XXLA 1YA8A 2A86A 2JBHA 4QYSA 2JD1A 3A3YA 3UAYA 1WKCA 2Q4BA 3T38A 1NVEA 3DFUA 2P35A 2NADA 3DEAA 4KLAA 4EI2A 4B3DA 1CE8A 1FLAA 4K88A 2YXDA 1NQXA 1GPUA 4CUKA 3A1UA 4ILKA 4RD4A 1O6CA 1EDOA 4PG6A 1SQ5A 2FP3A 3K5WA 5EZ6B 1G4UR 2FPSA 1P5HA 4JVNA 4ML3A 1EB8A 3D6MA 2L18A 2HWKA 5G3ZA 1BA2A 5IM5A 1WEHA 5LDGA 2PUHA 4AMYA 3C1AA 3CUTA 5A04A 1JIIA 3QOXA 1GSAA 1B15A 3L84A 1XUOA 4QD3A 3KYDA 4CGYA 2W6CX 3AESA 4J2OA 4PZUA 5ALDA 4YP6A 1FYEA 1BHSA 1XNQB 3CUWA 3G8YA 3P94A 5IKPA 2W11A 4FOPA 4EUNA 2XOKD 1PSZA 2EQAA 5BSTA 2AWNA 3O2JA 4RJLA 3PGA1 4F3RA 1NI3A 3LGSA 5LD2C 1PUJA 4A15A 2XA2A 3SYRA 4BO2A 5DNDA 2C58A 2GN1A 2MSEB 4R7GA 2H4ZA 4XVHA 3UMJA 1V4NA 1OKKD 3ZK8A 2BF4A 1T2UA 1BQ4A 4HWSA 2FR1A 3G0DA 4MWGA 4O4JA 4R8KA 1Z16A 1ORWA 3FLMA 1Z0KA 3FYUC 4YWHA 3P20A 3D31A 3RI3A 2DLNA 2C2BA 3ND8A 1VSVA 4K6FA 4NCIA 1U8YA 2P3SA 4H1WA 2VT3A 1YVEI 4EHBA 3S0JA 3QVTA 1W29A 3C8DA 4URWR 5HUQA 2O8VA 1XCLA 4ZCRA 4URFA 2LIVA 1S3IA 3WV4A 2D5AA 2VJKA 3Q85A 1ZUNA 2QENA 3M2PA 3ZC3A 1KAEA 2VYCA 2G82A 1QX4A 5CT4A 5HF9A 4HBZA 2VDLB 2D1QA 4KPUB 1GO2A 2ZIXB 3FNHA 2BFBA 4GS5A 4F1KA 1KGSA 3SOZA 3JX9A 4DSUA 3PC4A 1EAYA 3Q7QA 1L8LA 3JVVA 1J2YA 4V24A 4EX6A 1KJYA 2RHGB 2A78A 3T5CA 3N8KA 2VSYA 5EJ9A 2FXVA 1FDUA 1WRBA 3AIOA 3R9XA 3TK1A 3U4CA 1FJGB 2IYRA 1IB6A 2IF2A 2WW8A 5GWXA 4MVJG 2NVUB 1Y7HA 4TT3D 3I6MA 5EFZA 2ZRLA 4KWTA 1RIIA 1PQ4A 1SCKA 4RKEA 5COQA 4OHZA 2IKQA 2A9QA 1YL6A 4LMRA 1EFCA 3D7LA 1CUGA 5BRNA 3KQNA 1DEHA 1C8LA 1ONOA 3Q9LA 3TL3A 4G6ZA 1ULUA 5K0JA 5EIHA 2DVMA 2VDOB 3RB8A 3V34A 1UDCA 4B6JA 2ZUDA 1JIXA 3HU2A 1I7QB 2AYYA 3MYRA 3KUUA 2CFRA 3MTIA 4OQMA 5C4GB 5JCXA 5LKAA 4OY3A 2PL9A 4WZAE 3NORA 3VR4D 4BFYA 4JSYA 4HXYA 3A6JA 3C8MA 3G2MA 3FOWA 4KVGA 1GTMA 3ZHUA 4UNPA 1ZQ9A 4M7PA 4MUJA 1MJGM 4D9MA 3HCBA 4DCVA 1NXSA 2FZ5A 1AQUA 5G0VA 1Z8NA 3LWDA 4RD6A 1AKWA 2H2AA 5IVHA 3PFWO 3B1YA 3AR6A 5K3CA 2XZPA 2QDXA 1TU3A 3BRWA 3AF4A 1Y3HA 4BP8A 1JHZA 3DXZA 2IEZA 4ILEA 1GDTA 1WOYA 3GZ4A 3O47A 1A9OA 6AT1A 4ZHQF 2WWXA 1RDFA 4DKXA 4QPNA 1WUKS 1NM5A 2PD3A 5K8VA 3FSEA 5IASA 2Y1DA 4PG4A 2H54A 2G9QA 2V7UA 2D3WA 2ZIVB 4INOA 4QDXA 4DV7B 5JMTA 3X2EA 2ZUUA 4QHTA 4G9BA 1BQEA 3PEFA 4U4AA 4EPVA 4IQ4A 3GAMA 3NIBA 3KDPA 3V4ZA 5EYPB 2FW6A 3M83A 4FYWA 3BTUA 1P5ZB 1I30A 2E5LB 2LIPA 1L5RA 2W5UA 3DVRX 4IR7A 3KYBA 4WIAA 4XCXA 5ARBA 1U7WA 3NCTA 2PD4A 4V03A 4B35A 3DXXA 1BWPA 3BFPA 2D2FA 4UU7A 1V41E 2WU4A 3K96A 4JJ8A 2H1IA 3AVXA 2P5UA 3AF0A 1HL3A 2PH7A 5DASA 3ULKA 3LECA 4ZEMA 1QMPA 3WNCA 1WXQA 1IOVA 4M7WA 1V39A 2PUBA 3N7UA 2FRVA 4C6SA 5EJ7A 2XSZD 1U99A 4MR8B 3BMXA 3AUXA 4J1SA 4OAOA 5IJXA 4GI7A 2LE0A 4B44A 1DKRA 3HB7A 5I7RA 3AHGA 3V4SA 4MKXA 1C0EA 3BJMA 4AKGA 1CC1S 5L9AA 2EZTA 5HS4A 1GA4A 4CFSA 1I2MA 5CLIA 3WX0A 4CT4B 3W05A 4DJFC 1ZWKA 4LSMA 5C8ZA 3PGVA 4G8JA 5JANA 1CYEA 1LVGA 5ELMA 4PEVA 1RU3A 1TRHA 5DTEA 5KCZA 3DZJA 3D8HA 4FHDA 4B2IA 4X3PA 4RHUA 1JALA 4TTQA 2F1HA 2RGWA 2P6OA 3M81A 3HV2A 1S0UA 1QVWA 2XMGA 1AGRA 5JYEA 2HPZA 2R97A 3FBGA 1PGOA 3I2HA 3U44B 1SN7A 1Z5UA 2WJPA 2VHCA 1VL1A 4DANA 1M72A 3ROGA 4TVSA 3ZOKA 2PUDA 1ICIA 3DAHA 4GI3A 4MVJP 5ER9A 2WF7A 3DW3X 2CHFA 3VHRA 3AJDA 3R7LA 5ES4B 4F38A 2GKGA 3DHNA 1XNRB 1K7YA 4RZHA 4Y9TA 1SY7A 4CJXA 2C29D 3BTVA 3OFSA 1R88A 1PBTA 1T35A 1XAIA 3EZ6A 1GPBA 3LRPA 5E1MA 3WSVA 1SK9A 2AQKA 2JGDA 3BDVA 3FFBA 3GRFA 2VDJA 2RHRA 3KOMA 1SU6A 2ADFA 3L82B 5AI6A 3T3OA 1F7UA 4ZYLA 1QHHA 2HBZA 3QGMA 4AKSA 3NXSA 1RI5A 3G2PA 1G8KA 1O89A 3QNMA 4R1MA 3M9XA 1I0ZA 3KKPA 1M6EX 5LA6A 5FBVB 1APBA 2CSXA 3ZTYA 4NJMB 5MDHA 2QORA 4R8VA 3ZXSA 1L5ZA 3WR5A 4L15A 1R15A 3BMNA 5K8JB 4OEHA 1JR3D 2OENG 4C20A 3WA7A 1PU2A 3K1JA 3ME5A 3IBCA 4FFOA 4FMCF 4K8RB 1E2GA 1RZUA 1ZS9A 4QHYA 4PRLA 2GZ3A 1N4AA 3FE2A 4KQIA 1CEEA 4P3PA 3ND7A 1P33A 4D02A 1BE6A 2INGX 1Y8AA 3BIJA 4LRQA 3X1DA 4DWVA 3LFUA 3G5AA 3OCVA 4Q93A 5AP9A 1JRLA 2FKNA 4HX9A 3WNQA 2PFSA 1TM2A 2RHDA 5FTLA 1DDIA 2ODWA 3GXOA 3OD1A 4N0PA 4EFMA 4OLJA 3CSUA 1HRDA 2ZIFA 3MERA 2QTFA 1JF8A 4Z9AA 1NBMA 3A1SA 2AIRA 2EJBA 3JRXA 3MSXA 1XK6A 1Y9DA 5C35A 2R6R1 3RHSA 4TL6A 1FSZA 3AEQA 3WO0A 3HZZA 4DIOA 4MROA 4U6NA 3S1AB 4EY3A 3BXZA 4J90A 1GM5A 5GVSA 2I1QA 4X3CA 5E2IA 3PPXA 1DVRA 1G5TA 4L5JA 4Z7OB 1QGYA 2EJCA 1U5CA 1XDGA 2OXCA 2XJ9A 1PBNA 2YWEA 4ME6A 4BFTA 5LP6A 2CXHA 4I9NA 3AMVA 1HQKA 1EX1A 2W6NA 3SJ7A 1SUPA 5B6PA 5CDUA 1AO0A 3JALA 5T7BA 5CVEA 2Q5OA 3UB2A 1W25A 1AGNA 1TCUA 4UOEA 1VBMA 3OPYA 5JH7A 4N6GA 1KI4A 4EKNB 3H8JA 1TK9A 2CUKA 2E4WA 5SV2A 4NK5A 1Q6ZA 2XGSA 3FKSD 1KPGA 2FPOA 2GFIA 3IUSA 5LC1A 3IQIX 3LUFA 3S3TA 3IO3A 3OQ1A 4OL0A 3OU2A 3MVEA 3O4GA 4QDUA 2HJGA 3EQ9A 4ZDWA 1E1KA 3IE1A 5JU6A 1PS9A 2BYTA 2LR0A 3W5SA 1L7DA 5K3DA 2DB3A 1ZOPA 3NBYC 4I1UA 3FPFA 4NE7A 5DGDA 4IH9A 2QR5A 1H9BA 1YCHA 3KQHA 4TTVA 10MHA 2AV6A 2ZE8A 3OY2A 2VPPA 5LM3A 4GP6A 3TNFA 4BAGA 5IX8A 1PD0A 1C8BA 4L8FA 1GUZA 1S4QA 1ZLXA 3IHKA 3LCMA 4FGJA 4BNHA 5KKAA 4YUWA 4FZRA 1HQCA 3ZDRA 1CP2A 1WMAA 2HMAA 2NT3A 2NUBA 4QREA 4WT7A 3THYA 2BMVA 2FP4A 3H11B 1BMDA 4HN9A 4I99A 2AKEA 1W0KD 2NXJA 4MITA 1SPBS 2ZYHA 2HUNA 4D9IA 2R2AA 4DAEA 3P9IA 3KOZA 3L8EA 4PSUA 4FZ3A 4DR2B 2YQZA 3B78A 1XPOA 1I2BA 3OHSX 3LX5A 4E4TA 2X8JA 3E9RA 3NBFA 4QJ3A 4RELA 3NH9A 2YR0A 3QPDA 3GLIB 3A70A 4NJEB 1VPLA 1X9HA 3JWJA 4G0PA 2GJ8A 3DT6A 3M6WA 2JKZA 4L9AA 1GHTA 2GFHA 3EGEA 3FR8A 1NKVA 1BFUA 1W93A 2IPOA 4P92A 4CTNA 4RVGA 2WYUA 3UJ8A 5JCJD 4OHRA 1GZ3A 2WHXA 2C7PA 1EXNA 4HGRA 4B7AA 2MT9A 1W52X 2OFXA 2DFNA 4ER7A 2QTCA 4O8ZA 2PJDA 1TJYA 2GBPA 3HBNA 3Q9UA 1XPJA 5EHNA 4BE9A 3D6FA 3K53A 4YCAA 5KU1A 4FJ0A 5EERA 1VL0A 1OU4A 2ZDGA 3IDAA 3UUEA 5TJHA 1E9FA 2BFEB 4X90A 1U0JA 2CXSA 4LYJA 2FWAA 2XD9A 3H1EA 4GDFA 1OZ0A 2C97A 3P2YA 1Z2NX 3DTTA 3HHEA 5KTPA 4DMCA 3I6BA 2C9YA 3I8SA 2VLIA 3K8ZA 3ZU5A 4TKVA 1H4VB 4G4GA 2Q7XA 3L6RA 4DE5A 1Y9EA 4MMXB 5GOZA 5C4MA 2OXIA 2GCGA 4OFXA 3LHFA 3O8CA 4XB6B 4PYOA 4P32A 5IH7A 2HDNB 1QAMA 2G7MC 1WX1A 1DXQA 1STOA 2X7JA 3CO0S 4JB0A 4EGQA 4HVAA 3RG8A 3AHCA 3L06A 3PF8A 1VGVA 4R1OA 3SMQA 2QMZA 5CLGA 3TVTA 1IN6A 2D54A 2D7CA 1NXTA 4YBRA 1IMJA 1EDEA 3NFYA 3PU6A 1LCIA 4M2LA 4OA8A 4TTJA 2DFVA 1L8AA 2I2XB 2VCEA 1QYVA 2G17A 4MKFA 2XUIA 4N6OA 4P80A 4U2DA 3WRVA 4G84A 4FU0A 2N46A 2P9HA 4DADA 4M9CA 5BSKA 1KZ7B 5B1EA 3LUAA 3NHUA 4U2GA 4YLEA 3HLKA 4CU2A 1GRCA 2G25A 5J59A 1J8YF 3L8ZA 5EP1A 3IP7A 1SA0B 1WMSA 4KQXA 1L7RA 4HDKB 3WIOA 4D2IA 1P44A 1M1NB 2UVPA 3R40A 4BMOB 2HADA 5B64A 1JEYB 1FA9A 4B32A 4Z4CA 1ISMA 1OAAA 1EG2A 5AK5A 5BNZA 4EJSC 5E4FA 2X4LA 2O0HA 2X2OA 5E7JA 4A2WA 1EFUA 3LX6A 1KE2A 3QE2A 3FWZA 4NG4A 4AUKA 4DAOA 1SEVA 3KE9A 3NHWA 4RMHA 4QATA 1RI1A 4NV0A 2EFDB 3OQ6A 1PR9A 1KIAA 1VYVA 1RXVA 2VUUA 4M0LA 5ITZB 5KWVA 1XKQA 4YCMA 5LQRA 4P3YA 1ZMXA 3T3NA 3FRIA 4PLZA 3R4CA 3HGQA 4Q05A 2BN4A 1PJBA 2C3YA 2R85A 3I6QA 4NU0A 4J9VA 3D3KA 2POCA 3LA8A 2NYUA 3QEMA 1J8VA 1WMEA 1ISIA 2I8CA 1YHNA 1P9OA 3W2IA 2RCNA 1DCFA 1BWSA 2JAXA 3KQWA 1M2JA 1O3YA 4TV9F 4UUOA 4YC7A 1UP4A 3SM9A 3VPXA 3RT1A 3DFKA 4J03A 3THWB 2WIJA 4Q12A 2FVXA 4W8HA 5CAEB 1MO5A 3HDHA 1Z7GA 2Q6IA 1FJ2A 1B42A 5FR1A 4GI1A 1G8GA 1JVBA 2QB5A 5HCNA 3EAGA 1ZL2A 2FUKA 2PT7A 1B0PA 3CT6A 3OTHA 5CA1B 3PENA 4OFWA 3WJAA 2CHGA 5TGZA 2H9AA 3WIEA 3H87A 1ND5A 2X8WA 2OFFA 1O2DA 2XCLA 3RT7A 4KYTA 2HIGA 3NU1A 1YA6A 1CDZA 1IAQA 3A9VA 3K0CA 4Y7DA 5C80A 1M6WA 1GPKA 1WF6A 4X6UA 2HFJA 4IUBS 3GT3A 5F52A 4MEAA 3U7QB 2OG1A 3OHPA 3KU4A 4MVJD 2ZI4A 3UKJA 4CV2A 2JAWA 4C9BA 3E27A 3FSRA 2W0MA 1OA1A 3C6YA 3PDJA 2J6IA 3L07A 2HN9A 2GH1A 3L8FA 2Q07A 2WJIA 4KRXA 5HOEA 2PR2A 3B6MA 1SVLA 5JY1A 1D07A 3IKJA 3LLMA 5EJIA 5B1HA 4GOND 3RRJA 3QIAA 5A7FA 2GZDA 2KLHA 1VKNA 5EXSA 1KERA 4FGZA 4YUYA 4XUGB 1DG9A 2R6GA 3MCWA 4HT3B 4ZYTA 4DYDA 4YV7A 5L7TA 1MB2A 3FDZA 4MQFB 2RIPA 4EATA 4IIYA 1XZ8A 3ZCSA 4M22A 1YS4A 1L7BA 4J0CA 1FTWA 1DQSA 1TECE 3AHDA 4TUYB 2EW1A 2I1LA 4LCBA 2WG2A 2F9FA 1Z06A 4FE4A 3VZQA 1KL7A 1XEWX 3HJBA 5JS1A 1RYMA 3VU3A 3GFQA 5HIJA 3W1EA 3W1VA 4NXNB 3JZDA 4KWCA 2A0FA 4XRGA 4FN4A 2PH1A 4CLHA 5J4YA 2OXFA 3CEJA 4FQ5A 2EGGA 1RC0A 2MSWA 3NDPA 1KAGA 1I36A 2CXQA 2HCTA 1RXSA 3CZMA 3OPYI 3HY4A 4L8VA 3HM9A 3DMPA 1Q16A 1V2HE 1O0BA 4ABYA 5IS2A 2O54A 1JJ7A 1W2WB 1PZFA 3VDQA 3VR6A 4HAIA 1Q2XA 4IIDA 4BN5A 2R6AA 3MCVA 3O7WA 4WN9A 3UTDA 3NZEA 3EDQA 4FZVA 3W5JA 5IG2A 2YYYA 1GGFA 1XU9A 5A3JA 4O5AA 3LVRE 4J9UE 5REQA 5BT8A 2DR3A 1X39A 2IYLD 4RMJA 3EQ7A 2C3OA 5LCXA 3QA3E 4JSRA 1M1XB 4K6MA 2IWHA 4PZAA 1ZRMA 4DUYB 2CNKA 1RADA 4PZPA 3T7JA 3H6HA 2JLUA 2H5EA 2WD8A 2H2DA 3LS2A 4ZMRA 2ZRQA 2X5KO 4O4HA 4CLRA 1JHMA 2NWQA 2X5JO 2D8MA 4QX6A 4R40A 1C81A 2RSLA 3UHOA 3C7AA 5FOUA 4ANFA 1PK7A 5IXSA 1Y4SA 1ZL0A 2GHIA 1GAEO 3OIFA 4EG1A 4HN4B 2XBLA 1JB1A 4OH7A 3VSEA 1WV0A 1USKA 1NFRA 1OAKA 3NGLA 1T5OA 1P1CA 4ZO7A 3W3ZB 4D0RA 1QAOA 3T4UA 1ST3A 1ZONA 3HHPA 2QI9C 1SK8A 1EK6A 5M5BA 1KOLA 5T57A 2BHLA 2Z3ZA 2QU8A 4ND7A 1A9XA 4JQOA 1WHSB 2Z1DA 5HUJA 3DDOA 1T4CA 3A2NA 5HFAA 3IILA 1BVUA 4Z9BA 2X1VA 4GXQA 3K2EA 4BO0A 5FFFA 1EFRA 4G4IA 4GZLA 1AXGA 4M86A 3RAPR 3OEED 1ZD1A 1BXZA 1N32B 1GJRA 4W6ZA 2ZYAA 4ZAFA 1VKOA 2GVNA 3C39A 1E6UA 4MVYA 1ESDA 1KP3A 3BWVA 4M1ZA 2GN9A 2CUTA 5KQGA 1BS1A 2QVZX 4BB9A 3RSCA 4D8WA 1KEKA 4PZZA 4QC2A 2ZUEA 1O8CA 1R9MA 1TF5A 2QL5A 2XLBA 4H0FA 1KDTA 1PEYA 4GLOA 3IP9A 3F5DA 2UUBB 3FSJX 3Q11A 1CUBA 4JC4A 3D9QX 1TJPB 3JYOA 3OMLA 1P3Y1 2ZPTX 2VO1A 4E6PA 3WYDA 3HJTA 4RSGA 1JAYA 4MIEA 3RASA 1TRKA 1YVDA 5DEOA 1G38A 3A58B 5FBKA 2RONA 3FOFC 3JXEA 3QITA 3EXHA 1M1ZA 2NXWA 3JQ8A 4BO5A 5FNVF 5BW8A 1E94E 3ZV3A 2QE7D 2X42A 3UWOA 2NUPB 3R7WA 3KSBC 4L4ZA 1G8JA 1XMIA 5EKXA 5DHPA 4YX9A 2WUGA 3PPIA 5U9CA 2Z5LA 3LOPA 2PSDA 1NUPA 1QQ7A 3RVSA 1U0BB 4D5EA 5DV9A 2ZJ2A 2BM0A 3OKCA 4I8XA 3L7JA 4KQHA 4DG8A 1Y33E 3DFFA 1TNDA 3EC1A 3IEPA 3IQXA 4ND3A 4HNHA 4ITRC 4UQPA 3IVMA 5D5PA 2ZRIA 3E0XA 4I14A 3UXMA 2WIKA 4HFNA 5CM8B 4F72A 3DE2X 3P0RA 2AZ4A 5M7EA 1IXRC 3QQ5A 2G70A 4KQJA 3ZZMA 2BFCB 2JLVA 1BEUB 1XR3A 3CRVA 4LDJA 2QMEA 2F3TA 1CBUA 4CQMA 4UZEA 4CIYA 5LUAA 1FP4A 4X1KB 1HV8A 3JQBA 2C82A 3HDQA 4HDMB 2W8ZA 3SIXA 5C34B 1YBVA 2GYUA 3KKMA 1MEEA 4XM1A 2VF2A 4DQXA 1EEXB 1L5FA 4DMLA 2RHOA 2PKEA 5D5HA 3BM5A 4BLPA 4B0OA 1JLRA 1UP7A 3TL6A 2A33A 1V0JA 4P3KA 3UV6A 1Y3DE 3Q3GE 4MK4A 3UCXA 4XB1A 4DLRA 5BWBA 1TQ8A 4Z4HA 4O2LA 2AMJA 4F2GA 5K0BA 4F3YA 3NKVA 1BKYA 2IZOA 3KSDO 4IHKA 3T12A 1XTUA 3JS5A 1KEVA 2EWWA 4G25A 1I6WA 4HH0A 1TAQA 3SC2A 3R0QA 4LVNA 4RE6A 4X6YA 5EMHA 2V4ZA 5IAAA 3HFSA 1YJCA 1VI5A 1LPBB 2W9XA 5DWVA 5AD1A 1S01A 3OLWA 4H31A 3O3OB 2DHDA 4HWTA 1GUDA 1LWNA 2G9VA 1SHLA 1W88B 2XXJA 2XR1A 3CH5A 4GSYA 5KDLA 1EXDA 4ZO8A 1N2JA 2NSJA 2ZCUA 3EGOA 1MUUA 3IUQA 4NQZA 5AQEA 3DWGA 2GLXA 1P1JA 5D01A 3HP1A 3WMRA 4A23A 5AJZA 4I9GA 3GG2A 2YDXA 2BFFB 3IDOA 1M76A 4O0MA 2O23A 1OJ7A 3K5IA 5DWDA 5FPPA 3WQHA 5MHTA 2GEJA 4I2VA 4FTWA 1NVDA 3ZD6A 2RB5A 3L79A 4C1NA 3MRTA 3CR7A 1JAZA 5DM1A 3K92A 1WXGA 2QPLA 1EFVB 3WLJA 2Q9AA 3FCCA 2DX7A 5KTOA 5F78A 3MMZA 3NWPA 4N6NA 4ZI5A 2P40A 1NJ1A 3P9RA 1LDBA 1WQ4A 1C4XA 5HW0A 1P0CA 3FSGA 1MAAA 4HO1X 2A1UB 5EMLA 3G7NA 4EY8A 4Q9IA 4ZT6A 3R7SA 3E9NA 4BMNA 4C4PA 3DVAA 2OO7A 1R5NA 4I0WB 4L8LA 1BOOA 2AD1A 1L4KA 1GFSA 4C4AA 5AW0A 4DV4B 3E82A 3FLAA 5JBNA 1M2FA 1U2TA 2JLSA 1YS6A 3LK6A 4DMFA 2J4CA 2NU6B 1DDGA 1GNSA 1T5DX 3N6RA 1TUGA 1Z17A 2PCLA 2AOUB 3CX7A 3QUQA 5EIBD 4W9RA 3I9LA 1HYHA 2JGMA 3W7VA 2NU8B 3LT0A 1H2WA 4CDGA 1PUXA 4B3GA 5EWLB 3P9QA 5AM5A 1ORVA 3LPDA 3TZEA 2PN1A 2BMWA 1UDBA 3OQJA 1T8RA 3AR3A 3L0DA 4JNKA 5DISB 2C54A 4MYTA 1I2CA 1V5EA 2C00A 3SR3A 4Q3LA 1E2BA 3QF4A 4Z3OA 3EZGA 1NU8A 1T5BA 3Q5DA 1U1EA 4GBED 3GEEA 2PEZA 3PIRA 3W7AA 4MOWA 2PKWA 1EUQA 2YV5A 3ZHTA 2IBSA 1M8PA 3N2IA 1T8UA 3E9ZA 3SJAA 4F0JA 3PE3A 1E1YA 4L50A 4W5QA 3MINB 4JVLA 3QA9A 4UUQA 4CEIB 3IMKA 3RJZA 3V42A 1DGQA 4QBFA 4X65B 1NASA 1PDVA 3JD1A 1HT1E 3Q6IA 3G9XA 4C6HA 4CM8B 2A58A 2EW8A 4DWJA 2QF7A 1VSTA 1G3QA 1RXYA 1RLJA 4RY9A 1Z33A 2ODPA 4PG7A 2J6HA 5LXTB 4Z0TA 2MCFA 2NZYA 3MA0A 4WINA 4WSOA 2VP2A 1UPCA 1DU4A 4BBPA 3C48A 1I9CA 2O0KA 4ZOAA 3UUGA 1KOGA 1AKYA 4HWOA 3ERCA 3CH6A 4UCQA 1X2EA 1RLMA 2BMDA 1ETHA 3G82C 3M4NA 4ZPXA 3SLGA 2QUIA 4ENVA 1Z4JA 1C41A 4A6PA 2BGUA 5K3FB 4JROA 4CR8A 2HREA 1E0SA 1FRZA 3FLEA 1KMHA 1VKZA 2WSLA 3IPXA 3REGA 3TDKA 1GZSA 4LQLA 1KFJB 1N9ZA 2VQFB 1J25A 1EGAA 2ES4A 4OQLA 1XP5A 3AUAA 4YRTA 1E1LA 5D3MB 3SKVA 1ACMA 4B6FA 3AF6A 4YDSA 3CY6A 4HNAA 3WDKA 4K6HA 4LJ6A 5I48A 1X1TA 3OQBA 3QUBA 5GGXA 3T5MA 4OXYA 1TGVA 1TPZA 1UBRS 4PPYA 4LOAA 2BHTA 1VYTA 3O4FA 4XLLA 5DYGA 5NLLA 3BHNA 3E23A 1M5TA 1ZVKA 3ETLA 4BCBA 5JFOA 3U3OA 4XDHA 2V5AA 1P19A 1PNTA 4D7AA 2XMQA 5BOSA 4HAYA 4G4SP 3ZI4A 2A1TR 1V16A 2EZ8A 5FUBA 5JH7B 4M7RA 1XRQA 2AUNA 3QBDA 1TMGE 1XU7A 4Z9XA 4CE6A 3F6EX 4F46A 1JTFA 2XUFA 2F43A 4I1VA 4QULA 5CGZA 4DHEA 1AMOA 2AYZA 1XNJA 1D2MA 2YWRA 4AUMA 2RAFA 4DREA 5JXGA 3I05A 4ZZ1A 1Z4OA 1F20A 3QX3A 4B84A 3KPYA 2JK0A 1PRYA 3L0SA 4Z7QB 2FW0A 4CV3A 5JSUA 4E5NA 1VXRA 2H1RA 2P3OA 5TPWA 1MOPA 3OM9A 3PFGA 4IO1A 1HTBA 3AFNA 4X8HA 3VKFA 2ZXFA 3TNDA 4GQIA 2OQIA 3CNHA 1VOTA 1V4VA 2R86A 5NULA 4YPFA 2FPIB 4HAOA 3HI6A 4L73A 4J3NA 1Q14A 2HHJA 3FPGA 1XKTA 3AHEA 3EG9A 3TIGA 5LSAA 1D0IA 3OZRA 4YY3B 2C99A 4N0DA 2HMVA 2VWPA 1QCZA 4RY8A 5TGDA 5ICMA 2JDIA 3ICEA 2F9MA 4G41A 4I9HA 3VZRA 1YT5A 3C43A 1MO6A 3G2HA 1OTHA 1DMRA 3V7UA 3VPHA 3HJHA 1QJ4A 2QVYX 3CLUD 5BR8B 4V0MA 1TYDE 4I3GA 1SXGA 3D2BA 5AW1A 2BGJA 4AVYA 5GV7A 3DDSA 2R48A 2C57A 1UQTA 3RVOA 2JGLA 1CJCA 5E6SB 3WLEA 4BQFA 3MJCA 1KJQA 3V8BA 3CZPA 1QHFA 4UXHA 4YUXA 3D7RA 4XTCS 1Q7BA 1RMQA 2BBSA 1EWYA 4DIDA 4K40A 4FNOA 4BX0A 1JE1A 5K6AA 5ILQA 3HLYA 2PX2A 3IAS6 1A7KA 1XJ0A 1YDGA 3PR3A 3AGPA 4LISA 1P9RA 3RIEA 5BQXA 5FBRB 1QZTA 1TVEA 4N7JA 1JL3A 3ILSA 3KXPA 2F3SA 1KR2A 3JQRA 4P36A 1W87A 1NVVQ 1I3NA 2RB4A 2WUVA 3NTVA 2X9LA 5JO9A 3RTBA 1RJGA 4LZPA 4MAFA 2BF7A 3I34X 5HKKD 2X6TA 2D5CA 4R4JA 3KV3O 4KXVA 4KK4A 4M9XA 3WY9A 1CF2O 2EKZA 4I8DA 1KDOA 1SUSA 4OSPA 2HH9A 3UTCA 5JC1A 3O8LA 4Y8VA 1AK2A 1V7QA 2ZUVA 4LRUA 2BUCA 1FX1A 4RLHA 3SNKA 4C0HA 3NHBA 1M5UA 4YMHA 2QD3A 3FCEA 4ER5A 1Y82A 4PIMA 1VZ3A 3TE7A 1QONA 1N7GA 4L5BA 1ISGA 3M33A 3H3FA 16PKA 4K9DA 1NQ5A 2FDXA 5K51A 1P2FA 3OFVA 1JVNA 1CQIA 1RAHA 2ZAYA 3R9WA 2IELA 1XXHB 4LA4A 4BOYA 3V1KA 1DKNA 1QTRA 1U11A 1EJ6A 3OIWA 2JRLA 2IA5A 3PBKA 4G1VA 3D3JA 2XB2A 1SD1A 2R8RA 1YS7A 3W5DA 1SZJG 2Q9BA 3M49A 4RDHA 1DXYA 1HLDA 1WABA 3SI7A 1P8JA 4JEHA 3UJBA 1L7MA 2C4NA 2FPMA 3HZHA 2WWHA 1VB3A 2OFPA 1PG0A 5HS6A 1NG1A 3HSSA 3I12A 1VRCA 4KKVA 3QPVA 4EA6A 4IIEA 3W04A 5JAIA 1QRRA 4ND8B 1K08A 2OESA 2WABA 5E9AA 3SIPA 4BC0A 1NXPA 3LL4A 2R47A 1ULBA 3QZUA 1GUYA 3QVJA 3N3BC 4OBXA 1L5SA 3QFSA 4BKPA 5DNCA 4PYJA 2FPGA 1MBZA 2YXEA 3CWQA 3GK3A 3TQQA 1SBZA 3N2NA 3CNLA 3N2GB 4X60A 1TYBE 3OF5A 5AI4A 4O4IF 1QORA 3FZQA 2Q0SA 2WKRA 2F1OA 1YZUA 2JIMA 2P8SA 5ALKA 5JECA 1GL9B 1JQ5A 1Y9AA 4R05A 4ASUA 4QXQA 2CV1A 1WXIA 4U02A 4C22A 1ZU5A 3L6OO 1D2NA 3F90A 1XZFA 2OA0A 3ZDQA 1NI4A 1Z6PA 3AVQA 2O2SA 3K1YA 5CXUA 1XZDA 1OI4A 4ZHQA 1Q5PA 2JGFA 3U7IA 4GR4A 2MYTA 4TWIA 4MR7A 1VLHA 2I4RA 5K20A 1R0CA 1NRXA 5I9NA 4QUBA 1EZ4A 5LQMA 3PHCA 2PZFA 4PLGA 4V0ME 3KU1A 4BEJA 4EJ0A 2A94A 1SG0A 1NTRA 4Y6OA 3UXHA 3CWZA 3CZAA 4Q0MA 1RC1A 4RXUA 4CMJA 2QVBA 4P5PA 1FTGA 4B2YA 1RRCA 1USIA 4F4HA 3PKJA 3M1IA 4DVGA 5HUHA 1MB0A 5CW2A 3LLUA 4HCJA 2ZRCA 4HI0E 4TZTA 4JLAA 3HB0A 1KTIA 4O29A 2DR2A 3S6JA 3ESAA 5T4FA 2RAVA 4L22A 3MWDB 4E15A 4IDGA 3H0EA 4CMKA 4UU8A 4F4CA 1NR1A 2JIRA 3A4MA 3H5NA 5EKTA 4LDAA 1F2UA 1LDMA 3PUVA 3ZGYA 4LF9B 4AS2A 2HTEA 3MGAA 1ZX1A 1BNCA 1E0DA 4UFNA 1L9XA 5CNIA 2VF8A 2G63A 1XZGA 4AP6A 1PJAA 2CFTA 4ZT2A 1S2MA 1JXAA 4MV4A 2JBWA 5DIFA 6REQB 4RGQA 4RK6A 5E0KB 1K2WA 1ZHHA 1T6ZA 4LPSA 1IQUA 1JDZA 4RQUA 4LTNA 4H6VA 5BSVA 1IHOA 3T5PA 2E6KA 3K4PA 3OCJA 3DBRB 2W2TA 2X8AA 4QRIA 1E2DA 2CXRA 4DLZA 4YWJA 5K0NA 3WBJA 2ZE6A 4H60A 1KU0A 2DJ5A 3R3UA 5K7SA 2NUAB 4V39A 4AZ3B 2XADA 4A03A 1VE3A 1W2HA 2V9PA 4Y0NA 2A59A 3AFOA 4XXHA 3R5FA 1Z0DA 3C7DB 4JYZA 3GNQA 4LJSA 4URXR 2CXXA 1B0ZA 4LPKA 1OLXB 4RA9A 4F71A 1LU9A 2HJ9A 5I4IA 1QXSA 3WB2A 5HPYB 3KVYA 1TT5B 2Y0CA 4R8SA 5KWIA 2AEMA 2PJZA 4HQ0A 2WG1A 3PI7A 4GUAA 1UKYA 1R3UA 4M9UA 4E2ZA 2VBFA 3GMIA 1XMQB 3EHEA 2LXNA 2GDJA 2C1XA 4X41A 2A67A 1PW7A 4ISBA 4JNCA 2QKYA 2WQZA 1DSSG 2EJTA 1PAUA 3CG4A 3EZFA 1LSSA 1YH3A 3CPSA 1SCJA 2MSDB 1GDDA 1A27A 1QG0A 1KVTA 1RRMA 4R1QA 4TXJA 2A0WA 3A2LA 5H4GA 4WBNF 2IX9A 3HKDB 1B3BA 5CXXA 2WZQA 4RABA 3ROXA 4EA9A 2Q29A 1XDZA 5FJIA 3RNLA 2FOLA 3B1JA 3KFVA 2O8CB 4GKAA 3CVVA 2PMEA 1N2CE 3EIWA 5DHTA 1ULHA 4C2UA 1PL8A 5BSEA 3P4XA 4Q9HA 4TXMA 4G9GA 1DO2A 3W6OA 2FWNA 2FHPA 1AN9A 4L4XA 4X8MA 1VCHA 4I1OA 2MYNA 4YMUA 1T5IA 4UFOA 3THXA 5I9SA 3DOIA 5CG2A 4E5YA 1YTLA 4ZDIA 4K87A 1SZPA 2OB1A 2YY6A 2Q4TA 3CZ4A 3UJ7A 2CB9A 2UZ1A 3KZXA 1RRKA 4Y9SA 3U7HB 1KMMA 2D2VA 3ORYA 4NMWA 3TZHA 4BIMA 4TYYA 2P91A 1OX5A 1U3VA 3LUDA 4YT5A 2XYVA 2P4SA 3BE4A 4Q4AB 3TW4A 1O77A 4IRXA 1OT5A 3U37A 3UMSA 2WMYA 3VNAA 1ORHA 2A88A 5JPIA 3OZVA 4U3JB 3UB3A 4RJIA 1X94A 1DOAA 1UMDB 2PS9A 4B0PA 5FF9A 4F84A 3H9EO 4IWXA 2OOKA 1WIWA 2Z98A 3FYDA 1JHPA 3EEYA 3K6KA 3L0BA 4NU5A 2CXUA 1AKMA 4Q5IA 1U0SY 3VSDA 2B9EA 2GASA 1M3SA 4R0MA 2GLUA 2RHLA 5J2TF 1VHLA 2ID9A 3W79A 4HGZA 1FP6A 1OX4A 1KI7A 3HYCA 1PZXA 5DIZA 1X6VA 4NU8X 1BU5A 3NAQA 1QQTA 4TKUB 5CBPB 1VIDA 4OQEA 3QWAA 3IALA 2EG9A 5IUJC 3PEYA 4LV6A 4BN0A 3Q8LA 3V8NA 3EUAA 1FU7A 2LKCA 4HQNA 4CF5A 2HMTA 5E8RA 1LB1B 4ZVQA 1QF9A 1TO2E 2GYVA 3AFGA 5FBLB 5LZ2A 2ZAIA 3FFAA 5AXCA 3L6EA 3ESBA 2IVZA 1R12A 4NZMA 3E9DA 3K32A 2V74B 4MS1A 1GU0A 1ICEA 1X8XA 3DUFA 1B41A 1KAQA 2WZCA 4IKOA 2P9YA 3G5MA 3ACDA 3VJLA 5JRZA 4KXLA 1GAXA 4L5IA 4RK0A 1E2NA 1RLOA 3ZY2A 1QRAA 1DPGA 1E8DA 2AB0A 1J90A 1MABB 4TTTS 4GRDA 3ZGNA 4NPHA 5EMMA 5JQWA 1WE2A 1WP4A 1E8NA 2DC1A 2EOAA 4GLLA 1K9VF 4KFRA 4OXIA 1T9ZA 3ER6A 1R6VA 4MAAA 4PNEA 3GVXA 1NRWA 3ZY3A 5BNWA 3WGJA 2Z4SA 4RAQA 1UQRA 1LWOA 1V47A 3GJTA 3GXBA 3LC2O 1KY2A 1PR0A 1DTEA 3CSDA 4JWKA 2IYZA 3W5IA 1QH8B 2ZU0C 3MMNA 2ZJYA 4QG7A 2J0UB 4DT1B 2VN8A 4QUHA 2I6GA 1POWA 3A4VA 3L92A 3FPBA 4BBAA 3NHMA 4KLCA 4JJZA 4BEBA 1NE7A 2GCNA 2AG8A 2BSQA 2GJKA 1O95A 1QGED 5KQLA 1AS2A 1A5SB 1SVWA 2Z0MA 3RSSA 2XT6A 4GX2A 1K6MA 3VNSA 2IHJA 3I9JA 4Y2HA 1A7UA 4KU4A 3WB9A 1FUIA 2PGIA 3QKRA 4HZUA 2SKCA 3ICPA 1QDEA 1VPEA 5AI9A 2NNLD 3COZA 3DE6X 5LUBA 3SU8A 4C88A 5E95A 4RVDA 1V6CA 2C8VA 3RWOA 4ARZB 2YHIA 3M5CA 4UEJA 2V6GA 1XFAA 4XCVA 4K2AA 2WZDA 4QYWA 2C2WA 1JYEA 4ZK6A 1RJWA 2TMDA 1ZD2P 3ZCVA 2BJVA 3DLTA 3HRHA 1ZYUA 4NKRA 2LGJA 4UJ3A 4ITUA 1M0TA 3FUCA 5HYVA 1ZM7A 4P0QB 3THSA 1PR6A 4FNMA 2IPXA 2FDCA 4Q7KA 1WUJS 3L4KA 2IOHA 2VYVA 5CCDA 4CUJA 1L3BA 2P6PA 2PG3A 3ZLJA 3PJDA 1NHGA 2PUVA 2SNIE 3K8OE 1MX1A 4TWRA 2YICA 4DA8A 5C5DA 2IVFA 3SZ3A 4FWBA 5LYYA 1HC7A 4BX8A 1XZCA 2HA6A 2F59A 2VZLA 4FR2A 3GAZA 2AR7A 5GY7A 3QW4B 2PU7A 5LU9A 1NG9A 5DM4A 5K5EA 4TRRA 1SMKA 2M9MA 1N5DA 4DDHA 1RXEA 2XOEA 2A5DA 3KUKA 3WGZA 3ZWKA 1XTIA 2J41A 1C1XB 2P8JA 2EKPA 1PL6A 3DLIA 1RT9A 2LPMA 2VBIA 1GCOA 2HZBA 2ZR9A 1BJKA 3BWEA 3TOSA 3K0AB 3V1UA 4MV8A 1AS0A 4ED9A 4TKMA 2PAAA 1G2IA 1X86B 4NCKA 2UXDB 2QQEA 3PNOA 3BA6A 5BUCA 3IP8A 4CPDA 3CBGA 4OO3A 1T9DA 3VZCA 3KS9A 2Z95A 3LYAA 1T6YA 1A50B 3FNGA 3BL6A 3CRW1 4REOA 4TTRA 4FFMA 3T95A 1J5PA 2FU5C 3SQNA 3DMGA 6PFKA 1SULA 2FEPA 2C3PA 5DYIA 3WMEA 3S8MA 2XIJA 3C70A 3H99A 5DM2A 2I03A 3VPAA 3NC1C 2H1VA 3PQDA 2LDXA 2B99A 4KLZA 4PNPA 5DZSA 4EYSA 1ZOSA 1AZSC 1VB5A 3IAXA 1FVXA 5I6DA 1XB2A 3F3SA 5FBZA 3DZDA 1YI8A 3HP4A 3LXXA 4TV9A 4NOMA 4X8OA 4ZQBA 3SLRA 5KTTA 4UHCA 1E4EA 3O82A 4X95A 4QDZA 2ZPAA 3SGLA 2FZ4A 3RAEC 1N75A 3JQFA 4OHBA 4J6FA 3TKYA 4A5SA 4CF7A 1E89A 3PQ5A 5FOXA 3C74A 3O2NA 4HHEA 2PX8A 3O9MA 1VKRA 3WYNA 2HQSA 1T36A 1KARA 2XE6A 4YAWA 4YYEA 1H23A 2ZJ4A 4FBMA 2RK3A 2W2KA 4R16A 3S27A 4BASA 2EJVA 3REQA 1JB9A 4RVHA 5JEDA 4PHFA 1HG1A 4GWKA 2J5RA 2QG6A 4HGYA 3RVLA 1KQNA 3F7TA 3GA5A 3QKTA 3LU1A 3FPAA 2FE1A 4N5IX 2XCRB 4NAHA 2ODQA 2YV3A 1UK8A 4QGHA 3R77A 1RYFA 3JQGB 3QVLA 5DE3A 3TZQA 1UAYA 3GZTB 4E5VA 3SEAA 1E7MA 2H3HA 2XE7A 4FS3A 5DTIA 2ZB8A 2YVKA 4IXWA 5J4VA 4IIFA 3DQZA 1FNNA 2EF1A 2V0CA 4CL0A 421PA 5JSHA 4OKSA 3IAHA 4H6PA 3LBIA 4O1IA 4U7HA 3V7FA 1OILA