3OQPA

Crystal structure of a putative isochorismatase (bxe_a0706) from burkholderia xenovorans lb400 at 1.22 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
207
Chain Sequence
MTTPRRALIVIDVQNEYVTGDLPIEYPDVQSSLANIARAMDAARAAGVPVVIVQNFAPAGSPLFARGSNGAELHPVVSERARDHYVEKSLPSAFTGTDLAGWLAARQIDTLTVTGYMTHNDASTINHAVHSGLAVEFLHDATGSVPYENSAGFASAEEIHRVFSVVLQSRFAAVASTDEWIAAVQGGTPLARGNIYASNQKARARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative isochorismatase (Bxe_A0706) from BURKHOLDERIA XENOVORANS LB400 at 1.22 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Hydrolase
molecule keywords Putative isochorismatase
total genus 73
structure length 207
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3oqpA00
3TXYA 2H0RA 3UAOA 1IM5A 3O90A 3OQPA 1X9GA 3EEFA 1ILWA 3HU5A 3HB7A 1YZVA 2FQ1A 3S2SA 3O91A 1NF8A 1YACA 1NF9A 3O93A 1J2RA 3KL2A 2WTAA 3O92A 3V8EA 3TB4A 3LQYA 3MCWA 2B34A 1NBAA 4WH0A 3R77A 4L08A 3TG2A 2WT9A 4H17A 1XN4A 3PL1A 4L07A 2A67A 4WGFA 3O94A 3OT4A 3R2JA 3IRVA
chains in the Genus database with same CATH superfamily
4BCCA 3LQFA 2NT4A 1DQRA 1PSZA 3ZLBA 4C04A 1NJGA 3BSYA 4HWSA 4B48A 1U9JA 2DY0A 4Y2QA 4KITB 2ES4A 5EPOA 3AEXA 5BQPA 4NAHA 1PW7A 3L8HA 1W5SA 1P4AA 3PA8A 1SBQA 4ZU6X 3AP3A 3SKVA 2ID4A 2FSVC 2NXWA 5ALPA 5E8JA 4EYKA 1XEXB 1OJ7A 1SUCA 3TIXB 1LLCA 4PO8A 3RFXA 1UC4B 3PXBA 2RH8A 3ELBA 4X8HA 4YWHA 1SXJA 2CW5A 3B9RA 1K3UB 2Y1XA 4E14A 5KWEA 2QNRA 2XQIA 4U2FA 3GIWA 4S2UA 5AVSA 2CEKA 4AMGA 5I4BA 2PWAA 1N32B 3Q9LA 1C30A 5IYZB 4M3NA 4PVDA 4ENVA 2RK6A 4YCNA 1KVQA 3OQPA 4D8XA 3CNNA 1KI3A 1ENZA 3WE7A 3THXB 2JIMA 2WHRA 2XUPA 3OOSA 1WMFA 3KXKA 3WFZA 3I4CA 2L18A 3DAGA 1EFLA 2AD5A 1KY4A 3G7SA 5FOQA 3AM3A 1Z5NA 3H0CA 2QTBA 2GCIA 3VBCA 1PHRA 4PIPA 3RODA 4YRRA 3PFWO 4EW3A 1TA4A 1EQUA 2FPGB 2Y2VA 4Y6RA 2O54A 2FF5A 1UAAA 2WA1A 4AMBA 1QIEA 1X74A 3S2YA 1XNGA 3EA5A 3SNHA 3T99A 1A5AB 4WNIA 4QOGA 3RYCA 3X1DA 1P2BA 4WNYA 1MVNA 1L4KA 1GD1O 1VZ3A 2CHFA 3EC1A 2IZ1A 4CFYA 5GZ1A 2X6QA 2B98A 3SICE 1AZLA 2G77B 5KOIA 1CUCA 4W5HA 1U5BA 4IFEA 4NU5A 5EAIA 3F5QA 3IOMA 3DPSA 1I01A 2HQSA 2XWJI 5JYDA 3F8SA 4AWAA 1S3FA 4G97A 4TKLA 4ARBA 4OXRA 2ZI9A 2FPWA 2OCDA 1IG3A 5GONF 2VNKA 1ZINA 1LQ2A 3PYXA 2I3DA 4C1NA 4R1TA 3LLSA 3TKLA 2WQ7A 4S1PA 3EGVA 1J56A 4LX8A 2VNJA 4N7MA 1JR3A 1KXJA 1Z17A 2LKDA 4X1IA 2HHCA 5U4XA 4N3BA 4ML3A 4H1VA 3LCVB 4C22A 4TMVA 6REQB 3AGQA 1J20A 2B0CA 2FDXA 3PUYA 5DK6A 4IIEA 4L50A 2WSLA 3M89A 2QMZA 3RC1A 4M7OA 2ZI3A 4M9RA 2VZEA 4INZA 4IWYA 3PU6A 4Q1FA 3VHXA 5HKBA 4KV9A 1QORA 3HP1A 2H0RA 1ZN7A 1VL6A 3TVDA 3LXMA 3ZDXB 4ZTZB 2J0SA 3O4RA 3IMCA 3LDHA 1GG2A 1KPIA 2B5OA 1UP7A 1YQDA 5JD6A 1JLHA 3A2MA 5KDLA 4CLXA 3FW1A 1RYYA 1EP9A 1BWSA 1M8KA 2ZRAA 3U60B 1G3MA 5EP4A 1EHIA 1PUXA 2D2EA 1VXRA 3I9V6 3U0VA 4FYWA 1KJJA 2R7NA 3A1UA 5GP1A 4PR0A 3H9QA 2IU3A 4ZTBA 1K08A 3TOCA 1ZW6A 4G9EA 2I2AA 2VPZA 1WB4A 2EW1A 4BLOA 2IQIA 3HUDA 2C7RA 5COQA 1ZH6A 3OHSX 2DECA 3P9XA 5BUZA 1XRSB 3K0CC 5KAPA 2PEZA 4Z7NB 1JKIA 2AIRA 2BVNA 2RI1A 4AROA 1L4LA 3INGA 1U3DA 4EVIA 2BV3A 1H1LA 2OXRA 6NULA 5JBQA 2XXBA 4U7WA 5C0OE 4CM9D 2HA3A 2PUFA 3D6NB 1VMEA 4G0UA 1CR4A 2QY6A 4QT0A 5I47A 4WT7A 4HMOA 1W35A 1XVUA 3EXHA 3B8EA 3N0RA 4KTVE 2G5GX 4WECA 2R6JA 4FDMA 1F2DA 5FJIA 2HPZA 4MROA 3A1DA 2A84A 4EBBA 1XD2B 1JA9A 1VYTA 2Z8YM 4PO9A 3WL7A 1XPOA 1Z6QA 4F3TA 4HQ0A 3O8DA 2WSMA 2QJFA 4C0HA 3IH5A 4PLPA 5DGHA 1YJBA 4GOLD 4JI0B 3Q6IA 3UAXA 2RK3A 2VSOA 2FOLA 3L1HA 2I78A 3ISTA 2EC5A 1ZOLA 1V39A 3PA6A 2PMKA 4F2HA 2R86A 5IBQA 1UIMA 1GZ5A 1BGVA 4RQUA 2F64A 4TYYA 1YC5A 1AVTA 3CX8A 2NO4A 3VPXA 2ZK7A 4URXR 2E4YA 1WRBA 4RM2A 1FMJA 3QX8A 4JC8A 4OI1A 5E0OA 5A6SA 1RM3A 1IG0A 1EWYA 1MG0A 1WVMA 3D3EA 3NHJA 4K2AA 4LRXA 4R31A 4Y1GA 3ORYA 3UJNA 3KVOA 1EE2A 1NAIA 4MA4A 4WGGA 5AIBA 3THWA 4EUKA 2INGX 4JXXA 2IHTA 2EIHA 3KTDA 1EE1A 2JBAB 2QW1A 2QZJA 4Y6PA 3CZ4A 1XOIA 1GITA 1VYHA 3LUKA 3PWZA 5B58T 4KDFA 2JLUA 1JUDA 1FTYA 2D06A 3MGGA 4RGYA 1HYQA 3RARA 4BNVA 5ISMA 3GPLA 5FBWB 1G6Q1 2OXEA 3INYA 4O2BA 5JCJD 3WQRA 4NK4A 3K0BA 1E7SA 3MJFA 1SXJC 1R0RE 2FWMX 3F71A 1F2TB 3A9WA 5EKSA 4BMZA 2CVFA 3KB8A 4BZWA 2C7OA 2GESA 3ZXSA 3RVRA 2OP0A 1P2GA 2GAAA 2YWJA 2NIPA 4Z4QA 4XYEA 1PX0A 1PG2A 1Z0KA 2QSJA 4XX1A 4RTNA 3AGPA 5F33A 4Q3CA 4D4JA 2DKFA 2AD1A 2AL7A 4O4HA 4CPDA 2VF4X 3RTAA 1AC5A 4MV5A 4EA9A 1UDXA 1XEWX 3VMFA 4DQDA 4CEJB 1ZK2A 4XB2A 2Y68A 3KJGA 5JH7B 3W6PA 4IJQA 3KU4A 2PBZA 1E2FA 3P9YA 4MICA 3EYAA 3CF0A 3HJGA 3JXEA 5CA1A 2FW6A 1KFEB 3K09A 1LRKA 3NTVA 4KODA 4DR4B 4LZJA 2BSQA 5KO2A 5D7NA 4AK9A 3JWGA 1JZQA 3WK5A 1SRRA 1QRTA 5L4NA 1OBVA 1XZQA 4IS2A 5AXDA 2XJ4A 4D26A 1FXSA 1AGPA 1NUUA 1BQ4A 2V0NA 3LKDA 4Q1DA 2ZYDA 2PE5A 1ZXXA 4G5XA 3SZRA 1CDDA 1UQTA 1CPYA 5GONA 2O4UX 1HFJA 4QEZA 4B4VA 4WXPA 3MF4A 1LDYA 2NQ8A 1OT3A 2ZR7A 1N0WA 4MQLA 4E4TA 4QHSA 1ORRA 1KEWA 2OWEA 5DM4A 3I2KA 5EPEA 1E9BA 1ODKA 1DOAA 3I09A 3ZZ0A 5C53B 1NXWA 2LD4A 3QA9A 4MR7A 4O2AA 3A6PC 3AZPA 5DEIA 2J5QA 4B43A 4RPCA 2P5SA 4BAGA 3GIDA 4N3AA 3HB9A 1IQUA 1E1YA 4BFVA 4E1BA 4CIYA 5JAMA 1EFKA 1NLUA 3KXLA 5EFZA 1XQYA 2BRUC 1SU6A 3GLHA 3QG1A 4OEHA 2JIPA 2WAXA 4F92B 3CBQA 1KIMA 2HSJA 4EEZA 4ZZIA 5KQPA 1NXQA 3EA4A 3P1JA 3NRCA 1ZZEA 1YACA 4YQYA 3TW8B 1JHUA 4IWNA 5DNUA 1N36B 1UWLA 3I9LA 5AR1A 3V6LA 5AVKA 5L7TA 5J23A 3PHLA 2OLEA 4UQPA 4A15A 1R4MB 2YASA 4HJXA 1VECA 3R77A 2I66A 4GQBA 4WJKB 3FLAA 4C7VA 5DGIA 4NBNA 1FIUA 4OJNA 5E6RA 5G40A 3WNDA 1T10A 3IQDB 2C57A 1SHJA 3NHZA 1WMDA 5FI5A 1U3CA 2FVXA 4OLFA 5L3QA 2CB0A 4QUKA 3F4LA 4Q4DA 1CR2A 3L8CA 1OHHD 2IGBA 2REXB 3MUFA 4GP6A 4WX2B 1V5EA 2AOTA 4QVIA 3B2EA 1JHAA 4ZYVA 2XXAB 1ZN8A 3VI4B 4Z7OB 4ZVNA 2YR0A 1F2UB 1LPMA 1Y1SA 1QBKC 5EE9A 4JX9A 2IY7A 3ZDFA 5B7NA 3ANLA 4MQBA 3AT1A 3KEMA 3MWGA 4G0XA 1OIXA 3GP8A 1ZPDA 4GZLA 1CCWA 3WISA 1RDFA 3ECAA 4X9XA 3VPBA 5L3RA 3GRCA 1HE4A 1MB9A 2A94A 4I3HA 3RRZA 3TSOA 1C3OA 4JNCA 5L40A 4CEIA 4F9FA 3V7YA 2JFVA 2PSSA 3O8BA 4HZUB 3ZDDA 3AU8A 3NM5A 3EAGA 1SBCA 1QANA 2Q46A 3TTSA 3AEYA 3S1AB 3W4KA 3VZBA 1JYEA 1H2XA 4MB0A 3LCJA 4ND3A 3RSQA 3LCCA 1KGDA 4QM6A 3P9RA 4CMEC 3EJ6A 4XFJA 1H65A 5JJCA 5LR6A 2IBSA 3KSZO 4Q02A 1WV1A 2JFUA 1Y8RB 1YAHA 2P2GA 3M1AA 3NASA 2WWTA 3KJHA 2VHZA 1T3TA 3OPYI 5FPYA 121PA 2JEOA 1DIBA 5MF6A 2Q0HA 2JCXA 1OXUA 5CVCA 1T26A 5FI0B 3D8TA 4I5DA 5HW0A 2BR5A 4F4FA 3CUTA 2WQZA 3MCUA 1D2RA 2Q9BA 5GONB 3T1NA 1L5VA 4COKA 5BV2P 3KTAA 2COUA 3S7ZA 1DFGA 3AR3A 3EUWA 5LD2C 3IKMB 1ZI9A 2YIJA 3QTBA 5AJZA 4CEJA 3KAQA 3DOJA 3SVTA 5CP8A 2F1RA 4QXRA 4M1YA 1X1BA 4BKOA 2WD7A 1CJCA 3RTCA 4Q7EA 2PZBA 4CM6A 1H2ZA 3AFHA 3H8WA 3U49A 3UM9A 1N34B 1GHTA 3ICOA 2ZYGA 1BEZA 4ZC1A 4OQFA 1GZSA 2AFVA 5KS2A 2WU8A 3JU3A 3EVCA 2DH5A 4J9VA 3UWOA 3ZDRA 1R8XA 1UWKA 1VGQA 4TUYB 1XPRA 3IR5A 3TCXB 4FGZA 3ZE0B 1B0AA 5JEEA 1XQ9A 2DCMA 3QXHA 2FPIB 3T7EA 4RK4A 3NOXA 4X1YA 4I1VA 1F6DA 1Z6XA 2WB4A 3BXGA 4HLUA 3K8OE 1XLTA 1J70A 2K7FA 4MYUA 1F8UA 3RFFA 1PV1A 2WOJA 2ZJ4A 3MMZA 2B20A 3BULA 5I01A 4H16A 1NG9A 4JQYA 2DG2A 2D5LA 1WP4A 1ZNYA 1B2RA 2G09A 3A6EA 3G2HA 4HGOA 3RIXA 4R1UA 5D3ZA 4RABA 4H31A 2GNAA 4MW6A 5KSPA 3D7KA 5JNRA 1U6JA 1N6OA 2WIDA 4R68A 3H9GA 4XW2A 4GNKA 2DJIA 1PO7A 3GA5A 3LHDA 2ZYRA 1DI0A 1VPVA 4BLRA 4KFTA 2VXCA 4RD4A 2E1RA 2PKCA 3INRA 5IC5A 4C05A 2BIFA 3CNBA 1BYUA 2YBEA 4BP9A 1DX4A 3IKVA 1JS1X 4X6YA 2RHJA 5KWSA 3EFHA 4DADA 4V39A 2YHBA 4FJ1A 5H02A 3GAFA 4LXYA 1VRVA 4V2IA 5COAA 3SP1A 1KHTA 2PKEA 1QH0A 3I04M 3FI0A 3AFGA 4B46A 2HQOA 4UM7A 4JB2A 3WB9A 2YNMD 3QMWA 2XUHA 1Q92A 4JBYA 4PSVA 3V1KA 3ZBUA 4H4CA 1YK0A 1EBBA 3RS4A 3E27A 4YJ3A 3KQLA 1AM4D 3ROZA 4CKCB 3PLAE 2F3PA 4I1YA 3T4PA 3QJGA 4R9VA 3IHWA 4RF4A 1SKMA 1GAEO 4HPWA 3R9WA 1VHQA 2VRWA 4JSRA 4KUHA 1JE0A 2W9XA 4KQFA 4E5YA 4KN5A 3K4PA 4MR8A 5BN5A 1YFKA 3E35A 4TPKA 4D9IA 5JS1A 3C7TA 3N1UA 2BJHA 4TS3A 2ZIVB 1P0FA 2BEVA 3JARA 3EBLA 2DM6A 1RWXA 1LBSA 3ZHQA 2O52A 5FTNA 3VAZA 1IEXA 1MPTA 3EIOA 3N5KA 1YRQA 4HY3A 4HUJA 1NNSA 1U0HC 4KGZA 1EB8A 3R9IA 2WHXA 3G02A 4J6EA 4TM7A 5EZ6B 3NH6A 2PYDA 4EYSA 1ODCA 2J30A 4KBYA 3O21A 4P7FA 1WLSA 4XVUA 3PUWA 3KZCA 1PT6A 3OFND 5MN4A 1O5TA 3CCBA 3OVMA 3PTLA 5LYJF 4JLWA 1TO6A 3ZCRA 4ZTUB 4EJ6A 1TT5B 3DE1X 2VSFA 3M6VA 3BDVA 3LZ6A 1FDSA 1RPNA 5AM0A 3N7TA 2CN1A 4A8JA 2F3QA 1GG5A 1XU9A 2YJZA 3WGNA 1IQ0A 3TPZA 2WR8A 5C4MA 8GPBA 3KS9A 2RGWA 4NCAA 1PWZA 4JP3A 2CUTA 2VJNA 3W2HA 1FQJA 4LZNA 1R0WA 5EXTA 3L82B 4CLEA 4GMFA 1GZ3A 1D2MA 2J6CA 3G5TA 1GDTA 2QL9A 3IELA 4RH3A 1WXHA 1D9ZA 1UOOA 3HXPA 4U6NA 2VFAA 3U81A 2YOFA 1HKHA 4WWHA 4BRUA 2RAFA 4LDZA 4Q9KA 2VJMA 4TKVB 4KW7A 1PZHA 1VCIA 2YHIA 4CHTA 3I9KA 3LQRA 3NFRA 1ULBA 1P5ZB 5C5IA 1Z25A 1W36C 4UDNA 2IBMA 5U1PA 3V46A 3SLRA 1NSYA 3CY6A 5KOJB 2YBDA 2R6CA 3KPJA 3QV2A 3ZV7A 2WG0A 3VUEA 4CHGA 3BAFA 3JSXA 3KTOA 4E46A 5KKCA 1PEAA 4L28A 2A58A 3D4NA 4G0VA 2VDMB 1Z5VA 5KBYA 1YR6A 1XZIA 3T7IA 4AP6A 3I2GA 3MN1A 4H7EA 3QTLA 1TU3A 3UIEA 1FBNA 3ILYA 3HLYA 4O0MA 1JKMA 2ZT6A 3UV7A 4DM4A 3BMNB 2WEKA 3H05A 3RUPA 3H4TA 4W1PA 1I0IA 4QPZA 5D2CA 3N8NA 4DGQA 1RI5A 2GPSA 3K5WA 4E0BA 1WY5A 4RSRA 1ID8A 3OCZA 2BUBA 4FMDB 1I3LA 2BLLA 2JKVA 3VNQA 2UUBB 3M9WA 4MKFA 1C3JA 2H57A 1IFXA 3U9TA 1HG0A 1UDAA 1XWWA 4KQ1A 2IPLA 1JVNA 2BGLA 3TD6A 5D84A 2C9DA 1GL6A 4NE7A 4RHEA 3ZXXA 5BOSA 5IG2A 4WCVA 4Q7QA 4QTTB 2ANBA 4ESVA 1V16A 4DR6B 1LDEA 1YONA 4EHBA 3UJ3X 3C8HA 2A59A 2LIPA 3VR6H 2NNLD 3JQBC 4GMDA 1L7XA 1OB2A 3KOUA 5BN3A 1GL7A 3EFOA 4KK4A 5FUQA 5M34A 2Q9AA 4X6LA 4I8DA 3D0RA 1XMJA 3LWZA 2C2KA 1QZXA 1HC7A 4E2FA 4AJKA 2XMSA 4K28A 4XE5A 3TR5A 2DHEA 1D9XA 3HLTA 4LE0A 1L7VC 4NU0A 2PAFA 4P3KA 3THOA 5GY7A 1LZLA 1Z4OA 1OASA 1OTXA 2HSWA 2VPWA 4FZRA 4YUYA 1FZQA 2A5YB 3C0KA 4LYAA 1EEHA 3U7QA 3W5HA 1Z4NA 4YV2A 4NYMR 5BURA 4CM8A 1OGJA 2BMDA 4CF7A 5FJJA 2EZ8A 4CL2A 4F45A 3OX1A 3PHIA 4EVRA 5KTSA 4LCBA 3T9BA 4FVTA 3UUGA 1FVOA 1PJ4A 2I55A 4J0DA 2V7QD 1OUMA 1FOEB 2OD7A 2OO5A 2B4YA 4XEUA 2CXSA 2X5KO 1NNI1 1H8HD 4F4UA 2FLWA 5E7IA 4B7CA 4A8HA 4NBKA 1Z8FA 1DBSA 4PGHA 1TJPB 5D3MA 2Y1WA 2CLKB 1A0OA 1F17A 5IF9A 1NUTA 3UMVA 4H1TA 1P9WA 3M1IA 5LU8A 4CTOA 2CHUA 3PE3A 1OWNA 1X1CA 2W2LA 1V3QE 4TX1A 1IBSA 2WMDA 4EDHA 2O5EA 5DSXA 2VPXA 1YB4A 2IELA 4IOJA 2QZ9A 1VJGA 3IIIA 3JRXA 4G5QA 2I7DA 2WYIA 2BMAA 4E2YA 1JR3D 2XH8A 3E05A 3LSTA 4HYQA 5JAPA 1UK9A 5KQLA 4OB6A 1KZ7B 4MPRA 1HRKA 2B2NA 1R8SA 1VCNA 5FWAA 1Y8AA 4LHSA 1ACLA 1EMDA 1QIIA 1T2DA 3BK1A 2GBFA 4NZZA 3L8ZA 4FT2A 1LS6A 5T4EA 1OPXA 3WXBA 2VS1A 1IL0A 3VTAA 3HBJA 3BXHA 2VH2A 2Q4BA 1B00A 3ZWQA 4C2AA 2QN8A 3PIRA 1TTTA 5ERYA 2EGUA 2ZRQA 4L8GA 1P73A 3TTYA 4BYMA 4XJVA 2ZVPX 1QK3A 3NIFB 5FB3A 3Q5DA 4CETA 5HBRA 3GR6A 4WFQA 4C6TA 3CJQA 2Q2VA 3UPTA 1IEWA 1P7WA 3LYHA 5BSFA 1X9GA 2QRQA 2XWBF 3LA8A 2WM9B 3AETB 2HNAA 5EWLB 4BVEA 2Y0DA 6ABPA 1MAVA 2I1WA 1R00A 4UBMA 1XTKA 3T0FA 4XYMA 2QLNA 1WP9A 4M37A 1F20A 3A6LA 4HBGA 4KFUA 5BVHB 3GLIB 3UJPA 5CCDA 1CQJA 1LLQA 3UHJA 2UUCB 3QH4A 4LGCA 1D3AA 1XTIA 1NW4A 3U1VA 1CERA 3HJBA 2IZZA 5ALIA 1QV9A 1I7PA 2PRKA 2R84A 3QWFA 4KYTA 1C3LA 5DCUA 2HDNB 4D0RA 1MB2A 4QECA 3E22A 1X9IA 3HVIA 4JQZA 1Q0UA 5JFGA 3UEOA 2GYUA 3PDUA 4MHSA 1GZ7A 5CUQA 4EARA 3AV0B 3PL5A 2HUPA 1L5RA 4ARSA 1M0SA 2XZOA 4WDRA 1IXKA 1SQSA 1VXOA 3QE4A 3ILHA 5C8XA 4UXIA 4FOLA 3VYUB 4IKEA 1G5FA 3TI7A 3AB8A 1XGKA 1BRMA 3GD5A 5BT8A 1YR7A 5K09A 2ZYHA 3AF5A 4RY0A 3VHLB 3K71B 3GUCA 3AYXB 1V1MB 3UHAA 5AKIA 4MZDA 4NTZA 2EFYA 4U9IS 1WL8A 6AT1A 4AYTA 5L6LB 2G70A 1ZEMA 2QZPA 1FUEA 1IXRC 2QZSA 3WJ7A 2FN8A 1SU4A 2FF7A 5I7OA 3L79A 3FOWA 1QH8B 2D4HA 2W2PA 4Y2PA 2EP8A 3GF4A 1OBHA 1JDVA 1WX1A 3OQVA 2XB2A 4I8IA 3PQCA 4EUEA 2CXPA 3QSGA 4B8WA 1XVVA 3RAEC 1Y6JA 2A86A 3GDFA 1BKDR 2JBHA 2PBRA 4IDAA 1U2QA 2MMGA 1U94A 3F67A 3IQIX 5ER6A 2O7QA 4OCZA 3ICPA 2P3LA 3AHEA 1S96A 2AOUA 2HWYA 1TQ6A 1C2YA 3KB1A 2YXDA 4MW1A 1FDOA 4RHXA 5CT8A 1V41E 2P78A 5LOVA 1XTBA 1YQEA 3P71T 1U7TA 3A37A 5EXPA 3H5AA 1ECGA 1JXOA 2Y05A 2VXYA 3CO0S 3DS8A 3NGMA 1JJIA 1LH0A 1P1FA 1GPWB 2AJBA 2HCFA 3PQEA 4MUKA 2G0NA 1RZUA 1L7DA 1D09A 4EY3A 1CYDA 4WHMA 1MUUA 1G21B 5BV0A 5AVYA 4JD5A 4LYYA 1WABA 5ILQA 1VCMA 3FI9A 4AX4A 1C50A 1NXXA 3KZMA 1GPLA 5B1YA 3IE0A 1JHQA 1VSQA 1ZNQO 3C3JA 3K35A 4BVGA 1GFWA 3TWOA 5GZ3A 5BWCA 2VDRB 3TN7A 2CLSA 4RZUA 1PR0A 4JI6B 1FS5A 3FNIA 1SUFA 3W4IA 1NY5A 1KDZA 3SS7X 4IDBA 3M49A 4MLCA 3DT9A 4IGFA 3RG8A 5CDGA 3U7HB 4QL3A 1XZGA 2W0MA 4C43A 3KT3A 3QKIA 4F93B 4N54A 1SOUA 2EKDA 5K3CA 4DQVA 1F3OA 1TIKA 1KQOA 2JI6A 3OQOA 1H2AS 2V54A 4XD7A 4B6FA 3AHDA 2VHQA 1X1EA 3K20A 1ZA2A 2OFFA 1EK2A 1XFAA 1E3DA 3CWZA 2PGJA 1N0VC 2DKOA 2TRSB 3QBJA 5E1MA 3HCWA 3MLEA 3G2PA 1HNWB 2VP0A 1SD1A 3EDCA 3P4YA 4WA8A 1BS2A 1M1YE 4FZVA 1UBTS 1GXSB 1N2CE 2YWDA 3SDSA 3V34A 1I94B 4B74A 1TUBB 2FPLA 5K0EA 2C2WA 2GHRA 5ERXA 4LBYA 2ZUSA 3IP7A 3RW9A 3GUVA 1Q6ZA 3ZWOA 4BS9A 5IMSA 5JARA 4U7FA 4MUNA 1IEVA 4L4YA 1AV7A 1W29A 3EA0A 1LX7A 2FU5C 1G9TA 5CLFA 5FI3A 5LDGA 1DWQA 2RONA 4O4JB 5JVDB 3URMA 2WTAA 1MN6A 2Z1DA 5THXA 2I4NA 1TMKA 2OE2A 5LP6C 5J47A 4UTZA 1JIJA 1UFKA 3LV8A 2XKJE 2XMGA 1JG1A 1HXHA 2HJVA 2KHZA 1HE2A 1Z0IA 3F6EX 5CX1A 4ER5A 4RLSA 1AOXA 1V5IA 5BT9A 1DB3A 2NZJA 3AEQB 1WDWB 2R9VA 3N7UA 1E59A 2AVNA 1K7FB 3E1SA 3NTOA 4G1FA 4J16C 4ZOLB 4RZ2A 3TD9A 3CRRA 3OTHA 3UFXA 3UJBA 2I03A 6CHYA 3IR7A 2F90A 4H35A 5L8VA 3FWNA 2XCRB 1GOTA 1PCXA 1VKHA 4MAFA 4QFCA 3VVCA 4DDTA 1U98A 1NTRA 5IXYA 1CUDA 4UEKA 4DT1A 2FW9A 4PYJA 4JI2B 3RS2A 4G4JA 5I4CA 4BQIA 2OYSA 4B3RB 3IB3A 2VEOA 4X60A 3HJFA 3KQSA 5JC1A 2AXPA 3F6SA 3LVQE 3GLIE 4TQGA 1R18A 2DR0A 4QHYA 4RD1A 3Q7PA 4JEMA 5LQAA 3K5HA 4FE7A 1EDOA 2XOKA 4WOBA 4Y6SA 4AY3A 4Z54A 3SKYA 1O6ZA 2R1ZA 1WSBA 3PL1A 2O8BA 5I9IA 3FVTA 2I4RA 1N5IA 1VSUA 1NI5A 5BSHA 1Z7EA 3PGKA 4AN1A 3DP9A 2WE7A 5EIFA 5SY9A 1SKBA 2IT1A 2O3UA 4NU6A 2FFJA 1BXGA 5ALYA 2QTTA 2VI5A 4OVKA 2XUZA 2PH5A 4UQOA 1BS1A 2QG9A 3BERA 2PLAA 2Q7XA 4JDUA 3HPQA 1SJ9A 4EPVA 3PXUA 3GOHA 1IVYA 4ZHQF 2RARA 2VH1A 4OOFA 4C3OB 1ZJWA 4QNMA 1PR1A 5LP6F 4OQZA 2RMKA 2GKSA 3H5LA 1SG0A 3I1IA 2HU2A 4W6QA 5D86A 2E1PA 2FR8A 3DEIA 2OB1A 1Y82A 5SYAA 4BNNA 5GJBA 3R44A 2BGKA 4L0CA 4MARA 2PX2A 1E1RA 1ZMXA 5FO0A 1TM7E 3AF1A 2I4TA 1RHQA 2QN3A 3IOYA 1A9PA 1AUXA 3QKTA 1MO4A 1QMGA 4UC0A 1T9AA 3DDUA 3VRHA 4IDFA 4M0FA 4OGLA 3WKAA 4BAZA 1TEXA 4O6VA 2DSNA 3FMVA 2FPXA 1FFHA 5A3JA 2GDJA 3NDRA 5GADl 3E61A 3N2YA 1GGNA 2CFIA 3LUJA 3KELA 4PVCA 2HA6A 2WZDA 4LSWA 2OPHA 4RTPA 1P5JA 4BLPA 5KNDA 3ELDA 3DFKA 5A5FA 1MT0A 2PRSA 3JZIA 2YV3A 3SPXA 4F97A 3QFTA 5FBZA 1U6KA 3ROFA 4BNDA 1H94A 3E7DA 2CFCA 2C99A 3IEUA 3SC2B 4JUAA 1LC0A 3SYRA 3U16A 1GPAA 4E88A 4D8VA 1DBWA 3GD7A 3NVMB 4C0SA 4RF5A 3GFVA 1N8KA 2VNAA 5CNIA 3T7JA 3V8QA 4IRUB 4KLCA 3DOOA 2QUAA 4KQ9A 4LDRA 1FMCA 4FI3C 4A1FA 5DCWA 4KX3A 2PMWB 4DLPA 1SIBE 1AQYA 3NBAA 1G55A 2PO7A 2O2ZA 1G0NA 1MV5A 4NR0A 5TQVA 3TZBA 3HXMA 2JGAA 3TE6A 3V7WA 2P9EA 1K5HA 1NFQA 4XWTA 3S6JA 1DADA 1N1EA 2JDID 1SVWA 4IEEA 4TL7A 4FM9A 1O2DA 2GM4A 1F0KA 1DRJA 3IC5A 3LC1O 1BJTA 4TV8A 2HMAA 1DG3A 4WKCA 3WKEA 2GF2A 3HI6A 4LDPA 3FHTA 3U62A 4HOYA 4DIDA 4QRDA 5CU7A 3BFXA 1RQ7A 2D1TA 1GUBA 3K4QA 2A5DA 4R7GA 5LA6B 4K0KB 5LQDA 1WMEA 4OQMA 3LFHA 3DH0A 3ORHA 2HJRA 3R1IA 3QOWA 3ZDBA 4P58A 1UQUA 1SXIA 4J91A 4IX9A 5EIWA 3A8TA 3OKAA 2FPMA 4DJ5X 2TMGA 1F7VA 2W98A 3AUXA 1OKKA 1XHFA 5BQXA 4HZUA 1JR6A 4Y6GB 1R8JA 4B2YA 3HNRA 5CMLA 2BGGA 1AQUA 3BZUA 5HE8A 1DL5A 5CG2A 2H1SA 4F71A 1V7ZA 2AVDA 4G89A 2QDKA 1N9GA 2CL7X 4UKDA 5E6SB 5A1JA 3LT5A 4MQFB 1LWNA 3I2YX 4AD8A 4K9NA 2AH5A 2VBCA 2ZB7A 4HDRA 2HDHA 2GOYA 4PR3A 3BRQA 5WRFA 3RHFA 1Z2AA 3KOYA 1E2PA 2D5BA 4ZAVA 3VAAA 1G0OA 1UAGA 1BXRA 5IKMA 2MWMA 4ZO6A 4ZMBA 3BH6A 3EASA 4WK2B 1UXKA 2ZSKA 4LOKA 1I3CA 3TXAA 2GCPA 1WBJB 1DO0A 1NVWQ 2I6QA 1ZGHA 3I2IA 1OWLA 4LE2A 1PR5A 4LMAA 4ROTA 1DQPA 1DRVA 5BW6B 3ZHVA 1YRYE 1OI7A 4IIXA 2ZETA 1YXMA 3T9FA 1T9GR 4IQ0A 5CEFA 2BFBA 3SZGA 4ZIRB 1B6GA 4BNFA 3EXAA 1V47A 4JJIA 1R4MA 3B12A 2Z98A 3WP0A 4RY9A 2QBYB 4YT8A 2JVKA 3ZTYA 4POAA 5BYKA 5GV7A 3GJ7A 1PJRA 4CM8B 1U2ZA 3DVRX 4XZ3A 3RJ5A 4C7OA 3DL0A 2KB0A 3LQ2A 4RNCA 5SYNA 3WGQA 4ER7A 1JFVA 2O6HA 4PC7A 4AZTA 5F1PA 3FPEA 3IP5A 3OPYB 3TIFA 1XE3A 5BSEA 2J5BA 4U7HA 2A67A 2EGGA 1CY6A 1X7XB 1ISHA 1KZYC 3WIVA 2IEIA 3ONFA 5E9AA 1KYWA 1JB1A 4KYUA 4R4JA 1NATA 1SIUA 1VPDA 3TK1A 2EEZA 4CG0A 3AHJA 3IUBA 4JFRA 2A3NA 1CFZA 3LXXA 5J2TA 1Y1PA 2OM2A 4ROSA 5E3HA 2GM5A 1DT3A 8AT1A 1FX1A 3GJYA 1ISGA 3C1UA 4I5EA 4OV6B 4EJ0A 3QLUA 3R0XA 2YS7A 4CRWB 2HWWA 3M5WA 1E9AA 1OBFO 3ESAA 3M4ZA 5BOSB 4LVOA 4GOND 1E79A 3KU1A 1ABBA 2A92A 3CSUA 4N7RA 1T9BA 5AM1A 1I6WA 1FNCA 4MPTA 1M2KA 2YMQA 4HFRA 4PY2A 1WPQA 1XZPA 1V25A 1Z22A 2HPHA 2OORC 2D2XA 2Q6VA 5DISB 2FQXA 3H4MA 3MT9A 3SXJA 3B6KA 2P0AA 3P5BA 2FLVA 4OXKA 2C98A 3G7UA 5I7SA 1KH2A 2FX5A 4HO1X 1JXQA 2XB4A 1CRPA 3DE0X 4R2WA 1MR3F 4WKNA 1OZ0A 3BA1A 4LHVA 3JYPA 2Q62A 4MEAA 1GY8A 4WCFC 1AXGA 1UBUS 2WFZA 3CX3A 1PR4A 5IDYA 3T7CA 5DM2A 3EHDA 3LY9A 1MAHA 1QZZA 1S2LA 2G8LA 4ZOAA 4CF4A 2FWAA 2NADA 3R3WA 1SKUA 2BM0A 2PD4A 3KBOA 4BMSA 4RZSA 4M4SA 5CA1F 4CLOA 4MS4A 1RAAA 2CKMA 1W0JA 3SJBA 4D6XA 2XRZA 3NBUA 4JEHA 1BS9A 2DRIA 3FPFA 3TXXA 2E5FA 3TTVA 1OAKA 1ELOA 3CZMA 4O4HF 4TLBA 1AF4A 5DYNA 4AUNA 2PRJA 2A7QA 3OF5A 1YVUA 2RC5A 3EK2A 3H0KA 2O48X 3COVA 3L0SA 4J9UE 3VDNB 5IAEA 1L8AA 4KUEA 4WGFA 2GYVA 2XNJA 4WXYB 1K7SN 2GLUA 3ESRA 3SF8A 3TRDA 1Z18A 1N5DA 3C14C 1T29A 3DE3X 4ZVUA 1SC4A 3CH6A 1UBSB 4PYRA 3ZEIA 2ZTUA 3FYCA 1M6VA 1VKOA 5A5EA 3FF1A 1ZP6A 2C8VA 3RRXA 1O9GA 1U0SY 1XNHA 2C59A 3OCCA 4M1ZA 4CG2A 4LPKA 2O2JA 4MI1A 4D46A 3JASA 3ND5A 4B7XA 5BYAA 3LKVA 4FWIB 3CJRA 1ETUA 5LQNA 4HXFB 3DOIA 3TFQA 4YALA 2AG0A 2HGSA 3PPIA 5BVGA 1Z74A 3L0BA 3RD5A 1XSEA 2N75A 4TZKA 4X90A 4YCAA 1Y1KE 3FAZA 3FYSA 1RKBA 3O26A 4F4DA 4ZO7A 1UEJA 1M8JA 2HMUA 2BLNA 3AL3A 4OSOA 4J7CA 4EUHA 3EUFA 5KNLA 1GU0A 1P6UA 1QYVA 2CNWA 4KAJA 2BEVB 1SVNA 1HUQA 2X4DA 3AVPA 4LSGA 3R8CA 3SYLA 2VLBA 4NYIR 1RVDA 1NSFA 1SFRA 5H9VA 1Z75A 1ZHHA 5JD4A 3IA7A 4FR2A 1Z4PX 4TLAA 1FTQA 2J48A 4F38A 3QBDA 2Q6OA 4OX9B 3HQ4O 2N1MA 2FOIA 3OCWA 3W2IA 4BFZA 2ID9A 1Z2EA 5G4KA 4JBHA 1R9NA 2PPLA 4MVWA 5BXYA 3NPMA 1EXWA 2GCOB 3QXSA 4NJEB 2W37A 1TA9A 7YASA 2G4LA 3GWGA 5DHSA 1O54A 1JX6A 1QSGA 1RWWA 3O0DA 3SBDA 2H5EA 2J67A 2WWRA 1JAZA 1TYAE 3G6KA 2M32A 1MDBA 3L77A 2ZRIA 1ODSA 3ZWKA 1B43A 5DM70 3IP8A 4U9HS 3KSAC 3PUZA 3PK0A 1NOJA 1VLMA 3UOWA 1CVRA 4EX6A 5IM4F 1E8NA 5HKAA 3U4AA 1KU6A 3BE6A 3ANMA 3CKLA 4RE6A 4BVBA 3ACCA 4D3YA 3DJFA 3L1UA 1OH7A 1UPXA 5G0TA 2EV9A 4BLWA 1SCDA 3AP1A 5AP9A 2RGXA 2E89A 2XNHA 1TQ8A 2WK1A 2XODA 3AP2A 1ORVA 3U7FB 3IBCA 3HY6A 1A76A 1NVXQ 3EXG1 4XB6B 3VGPA 4L16A 5K6TA 2QTFA 3BOSA 4YA6A 4RKQA 3SJCA 1KMIY 2IHUA 2WIGA 3VR4H 4ZJUA 1VP9A 2H7VA 2PRYA 3R7LA 2BFBB 1HTTA 3WDKA 4KZKA 1BDJA 2NQ2C 4RSGA 2HRQA 1FUIA 2OO7A 4H60A 3JQ7A 5KNDD 2FPIA 4CM1A 2ILTA 3FPKA 3KDSE 4FXOA 3L7BA 4JJEA 4NC9A 3WHLA 2OC4A 1VLZA 2WC1A 5A1TA 2ZKIA 3PXCX 5CEEA 2YY7A 2CJWB 1BD3A 2DVMA 1LLFA 4EHAA 5ITSA 5LZ2A 4OQDA 4DUGA 5LNK6 3V32A 2J3QA 4WEOA 1TZCA 2BM1A 2JBWA 3RVSA 5ECYA 1M8PA 2IHBA 2BHTA 3DVSX 3IQXA 1GNRA 3BBLA 2GJSA 2AMJA 4OHFA 5EWJA 5K4AA 1M2VB 3VSBA 2FR0A 3MCAA 1VM6A 1ZJZA 3OZRA 2X9NA 3GEDA 2YMPA 1DC5A 2HHJA 3BGDA 3W78A 3ZDAA 4DEYA 4AS3A 4UHEA 1XCMA 4L5BA 3S27A 3PCTA 1V95A 1ZONA 2JLCA 2WVAA 3EJWA 3WLHA 2NT3A 3BEDA 3DF7A 4BHTA 4KHPB 4GZMA 3EOZA 1ZNXA 3M6FA 5AKJA 1GT91 1Y81A 2PUCA 1MQSA 2CJFA 1ORTA 1PUIA 2AJLI 4OY3A 1N0IA 3I6ZA 3R6DA 4NQRA 4WIAA 4ZAXA 3DWEX 1W49A 3E48A 4FJ2A 2H8GA 2FSFA 3LDUA 4GR5A 2BRUA 4TXJA 4DIEA 5I4IA 1RQRA 1S4MA 2DAPA 5ILGA 1G64A 2CMKA 3F9IA 3KE8A 4EY4A 5BW5A 4MYTA 1STOA 2WKPA 1U2EA 2AC7A 1UKVY 2WWFA 2IXBA 1NOKA 2X0KA 1OI3A 1OAOA 1G8MA 2QMUA 2VJAA 2KLHA 4MAMA 4WFIA 3ZHOA 2C8KA 2YVKA 1TZBA 2I6XA 4MVJP 1QUFA 1IZYA 1SBNE 2O1SA 3SR4A 3GMTA 2C4NA 4P3XA 2HLPA 5AJVB 1K2VN 1BE1A 2UZ1A 2V7XA 2DQZA 4JA2A 4U7JA 1O3YA 1O6BA 1EJ0A 4AS2A 2PS1A 3PV0A 4G86A 3WIUA 1IM8A 2PWYA 1CUHA 1A1VA 4D3XA 4MI9A 1TDJA 1PS8A 2QVGA 3DDOA 3SQMA 4DLLA 4V0MA 4X20B 1DKRA 1T1IA 2IXGA 4LQ4A 2BDEA 3IMFA 4WBSA 1DDIA 2GN8A 4JLNA 2CBZA 4PTYA 5KYGA 3ZGNA 4B0PA 2UXBB 3CPEA 1HYGA 1WXFA 2EQBA 1FPMA 4P22A 2VHXA 5ALVA 5J4LA 3ZD7A 1M0WA 2AEFA 1U8XX 3OWHA 2NZXA 5LZ4A 3F6PA 5HM8A 4R8LA 3GRAA 5DIFA 4EFLA 4EG3A 1OFVA 4M7WA 3WDMA 3V4VB 2EL7A 1RWNA 3FCXA 4CCYB 5C4IA 1Z3IX 2IP4A 2XVAA 2I1VB 5JCOC 2O8FB 3ROQA 1E18A 3PEYA 4MKXA 1U8CB 1WQ4A 3F6BX 5JH7F 2BW0A 4JOCA 1N5OX 4PYKA 3ED1A 3N39C 4UVIA 1A8HA 4PX5A 1T5BA 2DSTA 2VT3A 5AOAA 2WTUA 2XQFA 3GDHA 3NCTA 5GAJA 2HNKA 4YWJA 4PGGA 3JQ8A 3O7MA 2JHAA 1E63A 1Y42X 1NT4A 1W59A 3CEHA 3G8CA 5FOVA 2AJTA 2GFQA 4BWGA 2J9XB 3BZWA 3I39X 1TM2A 3WMWA 1WTAA 1VMDA 4OATA 3AM1A 2KS6A 1GZDA 1ZFNA 3MPUA 3PE4A 4HHEA 1QTRA 4UD6A 3VXKA 4QT4A 4YRAA 4JBXA 3V9PA 2O0LA 3QE3A 4UREA 2DFLA 4UM9D 4BB9A 3Q7QA 2QLBA 1QKIA 4W99A 3TLAA 1K7YA 2BEJA 1XWIA 3AM4A 3CTMA 1PK7A 4G1CA 3OQJA 4UMVA 3GN1A 3GLHE 5CK5A 4HC4A 2NN3C 3DTTA 1XDBA 3PXDA 5E7MA 5CH5A 3JW8A 5LYYA 1ISJA 2XQJA 1TJNA 2HSZA 2LCFA 2XA9A 3OG9A 4DYHA 1GLGA 4JCCA 4R2MA 1NVGA 1OKKD 4TKUB 3JATA 2JCYA 1I2MA 5E3JA 4QTYA 2P3SA 1REQB 3H84A 4I1RA 2MCFA 4G4SP 4DT1B 3HWWA 2FK7A 4QOHA 2O5VA 1SVKA 2I9PA 1EK1A 2RHRA 4IIHA 2WHPA 2BONA 1Q7GA 4QUEA 4UPDA 5UKDA 3T7AA 3VPHA 3AEZA 3NVKI 1TMYA 4KAAA 1OVMA 1Z56C 2REBA 2J9GA 3BILA 3QSYA 2BSAA 1DXQA 4PRYA 3UA3A 3PITA 3SE0A 2XZDA 3OZAA 3QRWA 2PX5A 1S89A 3KV3O 2HNBA 4P08A 3BE4A 4PANA 4Q01A 4DDKA 3LHFA 1RM5A 2JJMA 3PI7A 4YRZA 4AAYA 2HYIC 3H13A 4QQFA 4ARAA 1UPAA 3B7GA 3K9QO 1CJUC 4ZDWA 4BP8A 3AKZA 3NATA 3TLGB 1W46A 1IBCA 5JVDA 3HZRA 4PXYA 4X1OA 3D0QA 5I7UA 3I05A 4XYBA 1WPXA 1LI4A 1M1UA 5EZ5A 1J1UA 3LUDA 2BMFA 2RHBA 5CVUA 3P9KA 4BTEA 4G67A 4ZHQB 3GUHA 1B8PA 3MOSA 1WDTA 3TF5A 4PWYA 1S3IA 1ZITA 2RBGA 4OGWA 3G68A 2FMFA 1T8PA 1LF0A 1Y3BE 1BTOA 3EVAA 2GZHA 2J9YB 2P0EA 4F9EA 3MFQA 3OZWA 4RPJA 5LN1A 2OBFA 3C85A 3UTDA 2XE7A 2ZRLA 1PD1A 4GXNA 2QM7A 5JY6A 4YUAA 1M1NB 1TD9A 2Z5GA 3WJ1A 4G1VA 4KIUA 4YMWA 3R7NA 4NL4H 2BTOA 2QP3A 1F06A 2DLNA 2F43B 4DC9A 4ETMA 2YJGA 2FZVA 3H2YA 1WG8A 5CPFA 5LLDA 3CR7A 3M6MD 1VQ1A 4LYHA 2ZSEA 3C5VA 4YEDA 3NYRA 3L92A 4MYCA 1EEXB 3BE8A 3GJQA 3ZWYA 3WWEA 5E4JA 4OK3A 1M5RA 3F3KA 5FUWA 2YC4C 3IUQA 2ZIWB 3VC7A 2WVGA 1AB5A 1JXMA 3QQ5A 4JLKA 4LRSB 2BELA 2PYZA 3DZGA 1GPBA 2J0VA 4FT4A 1JQBA 3NBQA 2AQ8A 3D8RA 3RU7A 2R5WA 2JS7A 4GPBA 4QFDA 3OTQA 5TS3A 3Q6MA 3T3IA 2CVOA 4JQCA 1BE0A 3O73A 5HIIA 2WILA 4KXVA 4MVJA 3DZIA 5E38A 5HRUA 3RS9A 4WUTA 1G21A 2ISQA 2JGDB 3EEIA 2QAGB 3BB4A 4DR7B 3OEEA 5JYCA 2I2BA 2XW6A 2P7HA 2EG9A 3EXHB 1G7SA 1FA9A 2E6KA 3SHOA 1U2DC 3DOCA 1F6WA 2J7PA 1AGYA 2GJ8A 2O57A 2GN6A 4BUJA 3ETLA 4W5WA 3TO5A 5T7BA 1UUFA 2F43A 3HE3A 1SUSA 1UP4A 1FYFA 3I92A 3KUUA 1UXGA 4TT8A 2HF2A 4UEWA 2EZ4A 1VC2A 3UH1A 5I7HA 2V3WA 1M6YA 8MHTA 5LXTF 1YCGA 2E82A 3FDIA 3U7IA 3AUSA 2XUOA 4MJLA 2HMSA 5AICA 2Y3IA 3OSZA 3WB1A 1PGNA 1A2KC 3QYJA 3ZBTA 3HYLA 2IV3A 2ZCJA 2ZQYA 3CSSA 5ITWA 3RVNA 5JLJA 2IHVA 4A8TA 1HPLA 3R5TA 2FZ5A 2XIJA 2Q4OA 2P4HX 1QVRA 1XKLA 2X5OA 2Z08A 3C6ZA 3ETCA 3ITDA 4GOKA 5KHOC 3MJEA 3B6EA 1L5QA 1HWYA 3ZH9B 3M6LA 2JANA 5IKOA 2CLDX 2PANA 3DHNA 1C8KA 3L8FA 1G5PA 1Z0ZA 2C1EA 4Y67A 5FV4A 2KI5A 1GU7A 1UFOA 3W04A 2RG7A 5AKXA 2WVHA 5ALRA 3V48A 1RKUA 2PSDA 3BGVA 1BOFA 1NV8A 4HGQA 1TAQA 2IYEA 5SY4A 1CQIB 2AFIA 4DRYA 4AICA 2Y99A 4E70A 1ZI8A 3IV6A 3WYGA 4BZQA 7AT1A 1TKRA 2CXUA 3MINA 4HUQB 1YS6A 4U2CA 5ERGB 4EHKA 5L95A 3U7JA 2X13A 1NRIA 4ZWNA 3HKDA 2PFKA 4WVLA 5IVKA 3I76A 5FQOA 5I45A 1GGKA 2D74A 2RHDA 3TTWA 1HYHA 4QJ3A 3L9XA 1EUQA 1RXIA 3IFSA 1FSFA 1SOVA 3BXZA 4ZOLF 2HRCA 4EMTA 1DC4A 2PQ0A 4ZOCA 3SLGA 1U1CA 1I13A 4CYMA 3F7NA 2EX0A 4I1IA 2XTJA 3ENNA 2Z1MA 3ITEA 4QOEA 3UHFA 4ZJZA 1E58A 4N6OA 4PU0A 4DC1A 5HR5A 3WNCA 3MJVA 2XDQB 2QRPA 1WBDA 5CHEA 5AW3A 5KX5A 1L1RA 5K1ZA 3ER9A 2C4TA 1RPZA 1E2UA 3N2NA 3UWMA 2EFHB 3HJNA 5EP1A 4ZZ2A 3AFNA 4KQXA 4BNKA 3HUTA 4FHEA 5ALTA 4BIMA 2QPLA 2VSNA 4X54A 3GLGA 3IAS6 3GAAA 3DDZX 3MRTA 1FSZA 1VJTA 4G84A 3ZN2A 4P3YA 2QVLA 1YR9A 1ILWA 2I7VA 4RWZA 2BI7A 4WCDA 3C7KA 2AKAB 2NU6A 1Z35A 3DMHA 3F1LA 4U5QA 2C07A 1OYOA 5EQJB 3T41A 3TRFA 3GBVA 4FCWA 5EVJA 3ZDEA 4DMCA 4AO6A 3C3BA 1TM4E 1SH7A 1Q1ZA 3B1VA 3BWBA 3EEBA 4QODA 3CTPA 4N3NA 1I30A 2OO5C 2I4IA 2P90A 3QYPA 5DHUA 4EHDA 4ZZ0A 4AFNA 5AW6A 4OD0A 5KOHA 1HE1C 1DX6A 1RE0A 2LVBA 3D31A 3MIIA 3OA0A 3DLAA 1JEYA 5K0FA 2Z43A 3NM4A 2FK8A 2WNIA 5FBVB 4HDKA 4BQPA 4A0GA 1UM8A 2VYQA 2ZR0A 3ZH2A 3HFGA 4EG5A 1NJ5A 2XMRA 4FS3A 4LOLA 2VJCA 1EDBA 2PVSA 3G82C 2GWHA 3ETEA 4OM7A 4XSGA 1KL7A 4HFMA 1C80A 3QY0A 5ALMA 4DUPA 3RF7A 3S8EA 1QRSA 4WY2A 5B30A 1QG6A 1PP4A 1TCUA 3S1SA 1O89A 1AK1A 1QYXA 1XIVA 4Y7DA 2NU7B 4C0KA 3DHVA 1AKEA 2UVPB 3KQUA 1AKRA 3GFQA 1NXPA 5IVHA 2R3SA 2DHQA 4B40A 3P2JA 3PFCA 4YJFA 2WT9A 1FJ2A 3KLBA 4OGFA 1AA9A 1FRZA 3DUFA 2XGMA 2CLEB 2IBTA 3WO1A 3WQQA 2JEZA 2XYGA 4CLHA 2FN7A 3A9VA 3BM5A 4KQ6A 3BRWA 2ZR8A 3JD0A 3HHPA 1HX7A 4PGFA 1U8YA 1GRVA 2GXSA 2G9QA 4Q05A 5EKXA 3ZUPA 4EAAA 2XUKA 2FCAA 1DV1A 2A57A 5BN3B 2BFEB 1B3BA 4PLFA 5EXEA 1CJSA 3RU9A 4RO0A 4PYOA 1NW7A 1U8ZA 1OWOA 1XEAA 3EWSA 1QLHA 2OBBA 1V16B 1CZRA 1N75A 2EG5A 5F98A 1UMKA 1GUYA 3FGNA 4J3FA 3JZDA 1M33A 2NACA 2JLXA 1PZFA 4AKHA 1KA9H 1C1HA 5JO0A 5LJLA 1HYBA 1TD1A 3OURA 3SSAA 1N77A 4P93A 3HVHA 3QP9A 2MINA 2AOXA 4C87A 1HOXA 4D3ZA 4YIHA 5HKKA 1PNRA 5E2BA 4GSLA 4JUDX 4MX8A 3QX3A 2YJNA 3FR7A 3L1VA 3T3DA 3G0HA 4ARZA 3R40A 4Q48A 5HA5A 3LWDA 3B52X 4RVFA 2ZU6A 4HUQA 4JJFA 3A32A 5EJ7A 3SOPA 1UC8A 5K0JA 5F77A 4LY0A 2D7JA 1LDNA 2C3PA 3L1IA 2O7VA 3UQYS 2PCLA 1QXSA 1U4SA 3HI4A 4G41A 4BJHB 1A9XA 1GSIA 1LSSA 4KMOA 4KYIB 1JFFB 1LTHR 1P61B 4NVRA 5K8VA 4TL9A 3CKKA 4Z2AA 1JYSA 1SKYE 3PXAA 4ZANA 5AVJA 1N5LA 1Y1LA 4ONEA 4Q7KA 5DF1A 3UJ7A 5CTJA 4RK6A 2WKRA 1JIVA 4YASA 1IHUA 4LV6A 2OQ2A 1OSNA 1XZFA 1GCGA 1P9LA 4RGBA 4NPHA 4BZXA 4YT5A 2Z9DA 3OH8A 4MQEB 3TLYA 3WLOA 3G7NA 3TSYA 3P9NA 2PZFA 4P0PB 3DC2A 1QGAA 4IXWA 2W58A 2HZBA 3OM9A 3P9PA 4UASA 3KR2A 4DTIA 1NBIA 4AZ3A 4RIIA 4GX5A 2NZ2A 4W63A 1L4UA 3NU1A 3PXEA 4JR2A 3IP6A 4CDGA 1XMSA 1NHWA 5BSRA 1C8BA 2H7YA 3LBFA 2XE8A 4MCAA 4N41A 2VYVD 4P98A 3SY8A 4CMCA 5DLEA 3WGLA 1E2HA 2Z2KA 2NUAA 3DMTC 4HUTA 4Q3NA 5AUOB 1A4IA 1XJWA 2RGYA 1E62A 4OHRA 4QOSA 1HNNA 4C03A 7MDHA 2WTBA 1X8JA 3CEMA 2GCOA 1K8RA 3VVLA 4D99A 3E9DA 2RJNA 4UHDA 3GRRA 4XYLA 1OV4A 3NH9A 2YVAA 2CLFB 3PUKA 4LXHA 4S35A 5THQA 2FRDA 4RFLA 5EHQA 3A4NA 2FWRA 3SXUA 3LGSA 1JIIA 5BN5B 1HDRA 1TZ2A 2QTAA 4R1LA 4QGFA 3WBFA 2B8WA 2JGDA 3GX1A 2GCGA 5HIJA 2AUNA 5HJ2A 3H1GA 2ZBPA 4LY6A 2F8SA 3BMCA 2YWXA 2Z3VA 3M82A 3SQWA 1Z7WA 2WTXA 3EZ7A 3ZWWA 4LY9A 5HF8A 4MPPA 5AO9A 4Q1CA 2CBXA 3IQHX 4LMPA 2G80A 1NDHA 4EPWA 2ODBA 5GM2A 4N0QA 1YB2A 2ZTMA 1J5XA 4BVFA 4E2ZA 2O3RA 4IUBS 1MH9A 5DPMA 2PVCA 1AKNA 5LMZA 3ISJA 3LX4A 3FZEA 4UUOA 3I37X 4NECA 4D6YA 3KZKA 1WW2A 3NWJA 3QUCA 4EGJA 2HF7A 3Q88A 4JJGA 1IE3A 4OJQA 3PVCA 4R2JA 2VHYA 3PFKA 4R40A 1CT9A 2I76A 3A28A 2RGAA 3CZPA 3DC7A 3NDJA 4HB0A 3RHSA 3H7AA 3IJRA 4MP6A 3UJDA 4D0GA 4F2DA 1C1DA 1B23P 2PGOA 1L2TA 2XMBA 3WGOA 3AYZB 1LTQA 3FIJA 2G9VA 4YRLA 3DBVO 4IWXA 3JZMA 4GXQA 2XIQA 1JRLA 1SC6A 3CH4B 4Q1EA 1M1NA 4MW5A 5CJJA 4WKPA 4QXOA 3D7NA 2N9UA 4NZMA 4KR9A 4NPAA 3BHIA 2B37A 2EJVA 1PL8A 1EFCA 4YJGA 4KLRA 1AB6A 1FFWA 3FZQA 2PFSA 4X97A 3FXAA 2LXNA 4KPYA 3V7FA 4XUCA 3ZJTA 2Y4OA 1HMYA 2QN2A 2XF2A 1DIOB 4RVUA 5EIAA 4L78A 4PGMA 3QEMB 5MN6A 1NE2A 3QPBA 1N9ZA 2P9QA 4PYMA 1MNQA 1ONPA 4KACA 1CE8B 4C6RA 4EL0A 2CMDA 3SM3A 4IIJA 3OECA 4O08A 4KE6A 4D92A 1HFWA 3KDAA 3LNTA 4NBUA 3BIOA 3BAZA 4Z3KA 4QELA 4QICA 4IIGA 1VDZA 1X1AA 4CTJA 3ZGOA 2G40A 4J1TC 4NAUA 4MWZA 5DU2A 2A30A 2HO4A 2ZAYA 1N4AA 1SUDA 3H11B 5HMLA 2UKDA 5C4GB 5CDUA 2F9MA 5EJ5A 5F78A 4YRIA 3TZLA 3ZZUA 4DLNA 3U5ZB 1P39A 1MORA 4WBXC 2XOXA 1MCZA 5LZ7A 4J90A 4HL6A 4OL9A 4JDPA 1IZ9A 2PSJA 3M7IA 4UUMA 1JU3A 1RU3A 2MMCA 2O3SA 4ID3A 3QW2A 5DN9A 3VR5H 1ZNWA 2JCSA 4H7JA 4NCKA 3ZS9A 1FQWA 4L0MA 1P2FA 1QKJA 2AF4C 3KUXA 3NGXA 1X7YA 4TV9F 3DO5A 4OX9Y 4O29A 4JCOA 1OR8A 3DMPA 3DV9A 2EFJA 2UYQA 1NW3A 5F7JA 1W8DA 4P0TA 4C4OA 1H23A 1XYYA 3O2JA 5JS8A 4XWWA 4BLSA 4PZ0A 4RYLA 1NVBA 1L7RA 1X7XA 1E5QA 1Z4MA 5CB4A 5F5XA 2RGDA 4U02A 1M8FA 2ZCUA 5KJCA 4F0JA 1V11A 8ATCA 4RM3A 5CRIA 1C4OA 1J1IA 3RRFA 2O2CA 5FPQA 2ZYUX 2DPYA 1XK7A 1R50A 2W6ZA 2BKUA 4FLMA 4M0DA 3RVLA 2M98A 3WMFA 2I1LA 1HT3A 1U0OC 2UYHA 2J31A 1UCFA 4QBHA 1FFDA 5E1BA 3DEHA 2QUJA 2Y1OA 2E4ZA 3N59A 1ECBA 2PUGA 3JQPA 2CNWD 1OAAA 3NRJA 2HRRA 1NUPA 4NYJR 4EGCB 1I10A 1U2RA 3LT4A 1BJRE 1XHEA 1H8ED 2WJZB 4J0FA 3G6WA 1NL3A 4CM7A 1KBOA 2W6MA 2A5JA 3QKRA 3TH5A 3A1FA 1T91A 1AGRA 2PK3A 1TXGA 1GL9B 1I4OA 5I9MA 4F3YA 4YLYA 4B8ZA 2HU7A 3SJZA 1UC5B 3HJAA 3KVNA 1I5OA 4HDRB 4JA0A 2ZVJA 3N2KA 5ALLA 3DBIA 1DEXA 1QK4A 2RG1A 4LHYA 2ZI5A 3HJRA 1MBZA 3PPVA 4FFLA 2I2FA 3KNZA 1Y9JA 4RENA 2FZLA 1DMRA 4KPFC 4R3UC 2ZU0C 2FH5B 2ID7A 3NHAA 5CT9A 2ZJBA 4M0KA 3FCOA 4RDIA 1EFTA 1H5NA 2GPBA 1OXKB 3JQFA 5DK4A 5A7HA 1YF3A 3AHIA 2X2PA 2X0DA 5ILOA 1JWAB 3X1MA 1VLVA 3FUXA 1JQKA 3BWMA 3NGLA 4P4TA 2GEDA 4FQ7A 3LF2A 4PTZA 4ZRNA 1LW7A 3LKZA 4ZCLA 4AMZA 2ZIEA 3FOBA 3IO3A 2R7LA 4GE3A 2AW5A 4E22A 2BBWA 3OPNA 3WV4A 1DAKA 2PVPA 4FYKA 4MWOA 5REQB 3UXYA 1RYFA 2B25A 2EKZA 3AIMA 2GF0A 1NW5A 1GVNB 3IAM6 1SC1A 2WICA 5FPHA 3FWKA 4N47A 3ZWPA 3G2OA 1I3MA 3W5VA 1HDEA 3IXMA 4YROA 1AMUA 3WGIA 3WK7A 2MIIA 3WLNA 3PHGA 3F8WA 3GMDA 1R4AA 1U0BB 2FMXA 2GAOA 4MTCA 1JDZA 2ESRA 4L5IA 5AH0A 1G7TA 1YS9A 1OXMA 1P6XA 1S1CA 3ENZA 3KPWA 2RGRA 3TLJA 4S1VA 4YAUA 1IY9A 3BFJA 1IBMB 1FTSA 3PHJA 4TQ9A 3A9UA 3GG9A 2IVFA 1TFRA 3E3AA 1VHDA 3WGZA 1SAYA 2VBFA 1ZOOA 1SBTA 3GC6A 1Y7TA 2EQ5A 2UAGA 3L3BA 5DNCA 5G4LA 3RUFA 4IO0A 5JSKA 1PT9A 1J9ZA 1L4GA 3MZ0A 4IICA 5J5VA 2Q3MA 4N01A 4N49A 4UM8B 1S7GA 2AA3A 2OEPA 1JDPA 2H4HA 3AUUA 3B2QA 3P5SA 2FXIA 2E49A 1RPTA 1YB1A 3PC4A 1ZD1A 4LDNA 4MYRA 4XQ9A 4YCBA 3WHPA 5IDXA 5KJFA 2VHVA 2JIOA 4G0OA 2BY4A 4B3TB 1MQ8B 1P3JA 2E2WA 2MSLA 3QVSA 4QDKA 4RV4A 4NCNA 1PFYA 5DYYA 4EOGA 1EXVA 2JFHA 4PE5B 2JHCA 4GPAA 3KIPA 2VXOA 4DDVA 4HF7A 2QL5A 2E4UA 2H0QA 3MXTA 4GM4A 3ULKA 5MFPA 3R9XB 5EP2A 4M21A 1I4EB 1Z82A 1J2JA 4IO1A 4D0LB 3UATA 1DUVG 4PHCA 4D3DA 4UBJA 3Q3IA 3EZGA 4YRJA 1ZMRA 3CIFA 2YL2A 3HABA 3K2EA 3AK4A 1OFTA 4FKZA 1E2MA 4NZ9A 2K6GA 4ZAZA 5G0SA 3V6MA 4YHHB 2PZJA 5JJIA 4ZYXA 2GQ0A 2PT6A 4QUBA 1JU9A 4O3MA 2G9NA 5FORA 4MRAA 3IHTA 3ROKA 3SKXA 4K40A 4B33A 4CZ2A 2Q3BA 1CSEE 4Z4EA 3DLHA 3PNLA 2IZ6A 2EQAA 2YZGA 3JVUA 3I9OA 4BB0A 1OX4B 2WM3A 1FDIA 2QRMA 4PV7A 4ZHSA 2C9YA 3AOEC 2IDJA 3NAQA 1BU8A 4GWGA 4RUKA 4JI1B 4JLSA 4QGSA 5B6JA 2FN3A 2W7TA 4ETNA 3OLXA 2Y67A 3ADBA 1NJSA 2ZAIA 4UCXA 3COZA 1KVRA 3HU2A 3Q3VA 1K5GA 5LQSA 3RADC 3LXRA 4NV0A 4Q3DA 2Q7OE 3LZDA 4HDMA 4EG1A 2HV9A 2FRVA 4ZVPA 1XTPA 1ZGAA 3EGWA 2I71A 2JAPA 3B5EA 2D54A 3GH3A 1NW6A 4CG1A 3ZY4A 3D5EA 1O03A 4WCFA 5AK5A 3IUMA 2HDWA 3HKBA 1U99A 2QTRA 2OXFA 2EVWX 2VK8A 2FWPA 4HDNA 4IUYA 4OXXA 4ZV4A 4DLZA 2ODQA 4R8RA 2CC2A 2X40A 3IVMA 2XI4A 1Q0RA 1MG5A 2MYPA 3GQBA 3VU8A 5BWLA 5EHXA 1A9TA 1PR9A 1O77A 3HP7A 1V3TA 3WMEA 4AJPA 4BNZA 5CX1B 5HQJA 2CV2A 2W6IA 1SURA 2Z4SA 3S44A 2QR5A 4OHYA 1G9SA 2QN1A 1XZ8A 4GL4A 2HF9A 5KVSA 1J9GA 3DTVB 4GR4A 4EGFA 4RJTA 3HO1A 4J6FA 1KYTA 1S8FA 1SCUB 2YYYA 3FTDA 4L57A 3G1TA 2P6RA 3DAYA 3I5MA 4G8BA 4GO1A 4ALNA 4QWWA 4OHBA 1J06A 3RHZA 4ENWA 2CYCA 3ON5A 3FCAA 3CXRA 3W9SA 4ZRDA 1AKVA 3BD9A 2BGNA 3F97A 4J2OA 4OHCA 5AJTA 1EK0A 3D2CA 3LDAA 2O8CB 4MINA 2P9GA 1MLDA 3CM0A 2P0YA 4IGAA 5B1HA 1O58A 4MIKA 4S0ZA 2IYQA 2W22A 4PM4A 4DSAA 5L53A 1G20E 1TO1E 4AJEA 2I33A 3CX7A 3K1AB 1INLA 2IH5A 4KUGA 3W5CA 2JNWA 4TXNA 3ZQ6A 4F96A 1QF9A 4DXDA 3ENVA 3J81A 4K46A 2DFNA 4CIXA 1U2SA 3I64A 1KRHA 3FTPA 2QXTA 4R2XA 4ERXA 2R47A 3NBYC 2DB3A 3UOGA 2IYNA 2TMKA 4P53A 3AH8A 4M1EA 5KJ1A 1HSOA 4WVFA 4PAWA 2UUAB 1RTTA 2Q0QA 3QYAA 4EY6A 2Q4RA 5AM5A 1SKQA 3AB7A 1PT7A 1MT3A 3G5AA 4ZVKA 5AJXA 4C76A 5A6VA 2ZZMA 1UIRA 2MYNA 3KSMA 4GAEA 3HM2A 1SVSA 1OZAA 4PHFA 5KSYA 4YXFA 2P9FA 1UMBA 4JJ4A 3GZJA 2RKWA 4YAWA 4X6XA 2OZKA 3OIWA 2P2CA 4AJIA 2YH2A 1O9HA 4ZAWA 4GEKA 2XR1A 1RACA 3OPQA 2WMYA 3L6BA 3WDLA 1Y3AA 5JCXA 3JQAD 2RGBA 5E4YA 1JMKC 3LHSA 2E4WA 3GB9A 2QM3A 3KAPA 3EQZA 4AJ2A 5AESA 3EBOA 1RP1A 3UMSA 1QAOA 5HNKA 4DRXA 4KRXA 3RTGA 1SXHA 2JGKA 3LS2A 1EGAA 1JI3A 3PVZA 3C70A 1E0JA 2VAVA 2M6KA 3ZE8A 3GUZA 4I5GA 2QTMA 1URPA 5K0TA 4K81B 1JP7A 4CN9A 2AOUB 4IFBA 4QHTA 4IHJF 1EDZA 4KQMA 1OLXA 3SD7A 6LDHA 1E6EA 3AHCA 4KXNA 3VC1A 1PWHA 3OOHA 3ICWA 3HCCA 4QC2A 4AQYB 1BHSA 2KYRA 1I80A 3HKBB 3FNBA 3WLIA 3O0TA 2Q1TA 1Y7PA 3FHJA 4W9NC 3V4OA 3MTGA 4BV9A 1GU1A 1OA0A 4I1PA 4PQFA 2A35A 2JEYA 2BISA 5T8KA 1XL0A 2K4MA 3NC1C 3PWTA 1SCNE 4D80A 4Q6BA 4F3NA 1QTIA 2V6FA 2W2MA 3BUSA 3FNHA 1ZVQA 2QN9A 5ALEA 2NUAB 1AQNA 2VH5R 4UCFA 2F8TA 1ZIPA 1PYGA 3ACBA 1XLTC 1OGIA 3EE6A 3EF3A 4ZVSA 3ZQKA 1UK8A 5AVXA 3FGPA 1U0LA 1G7CA 1J07A 5BP7A 1SXPA 3CISA 4C7OB 3EH1A 1Z8DA 4L08A 3W8RA 2Q8QA 3CKMA 3CWCA 3VMMA 1TX4B 2O2SA 2ORIA 1VKRA 5JG7A 3CN9A 4N5NA 4PPYA 1BGWA 4EI7A 5JFOA 3SIWA 1IQPA 3KPUA 2VDUE 3VX4A 3AEKB 1SD5A 4R71A 3AOGA 3QK7A 5AKZA 3ZHYA 3ZKWB 5E1OA 3OLVA 4QTXA 5TQ0B 3ZX5A 2CDRA 4MPJA 5C1OA 4E5MA 1RQPA 5K4GA 1N5RA 1UXJA 5IXSA 5AOVA 2Q5HA 4WLUA 4D9FA 3HCOA 3F74A 4FYIA 1QPZA 1VJ0A 1ST2A 3CLHA 3U4CA 4OG2A 2WV7A 5JE8A 2RD2A 4FSXA 1EGMB 1NXSA 3E70C 3FFWA 5AJUA 4CKBB 5AVVA 3MERA 4Y2HA 3U3MA 1DJMA 1YS2X 1GTJ1 3R24A 1L5NA 3OZ7A 3TPCA 3WLLA 4ALMA 4BX8A 1I0LA 2JIQA 1P8AA 1E1KA 2POQX 4RADA 2J6IA 5HOEA 2IS4A 1VJRA 4Z9YA 5A03A 1GQFA 2QGNA 2WKSA 4BMPB 1R0LA 3T5PA 2JLBA 1T3SA 4N7JA 2NAFA 2R1TB 3QFSA 4MV9A 4UUAA 5ICSA 1J42A 1QYWA 4BASA 4YJ2F 3GLGE 2CD9A 2PQMA 2OC9A 3GA7A 5DX0A 4JYPA 3ZCSA 4CDRA 3OZTA 5B36A 1JPVA 3R6WA 1JYFA 2WPNA 2VTBB 1H6BA 2P9JA 1V6AA 2ZWVA 1KC3A 2IYPA 1L1FA 3TR6A 1RSZA 2PXCA 1JMYA 4WW0A 1Z6YA 4E94A 1VKJA 1ORWA 1P7CA 4IY1A 2C5FA 2VRCD 1G3UA 4Y2XA 5DIZA 1LVGA 1RHRA 2AB0A 3FYTA 5AT1A 2JCGA 3C15C 3LNCA 3QU4A 1BMFA 4WY8A 2UDPA 5B4UA 1NQUA 3NFYA 3GA0A 1D0IA 1KK1A 2BFEA 2OUKA 3WY9A 1ESZA 1JECA 2CXOA 2OOSA 4KWHA 5AD1A 5AW8A 4HVLA 1XZHA 1Z2DA 2OR3A 2P30A 4ILEA 4Q15A 3V1MA 4GECA 4C0XA 1DSSG 3DE4X 2AYYA 3BKWA 3KQQA 1TU0A 4I4IA 5EINA 1OXBB 1PZGA 4DVGA 2ZRJA 2I3BA 3AVXA 1P8JA 1UM9B 4GPIB 1CUFA 2GO1A 4CM5A 4MKZA 5ALUA 1XROA 4IGIA 2AX3A 3MWYW 3PJGA 3PUXA 3ABIA 4GC9A 4XLTA 2FMIA 4L85A 4QXAA 2PUWA 1T8YA 1U3VA 2WBLC 5CM8B 4OTZA 4DIKA 1XMXA 2VAMA 1R6BX 4OUDB 3I9FA 2VPPA 2ALJA 3IPAA 5C8YA 3GLKA 1JEEA 4EEXA 1ULAA 1T5IA 1KI8A 1VIVA 4EGAA 3EPKA 2WUEA 4MP3A 1MX1A 3HB7A 3O83A 1XJ5A 3N2KB 1GPDG 3QJ5A 3S1LA 3HNPA 2OK7A 2PX8A 2QEQA 3HGMA 4MVJM 4HDKB 3W5IA 1KHHA 2RH9B 2WJ4A 2NSLA 3HEBA 4RIHA 5ALJA 4DNXA 5L4SA 1DGQA 2JIZA 3SU8A 4JL8A 4JXJA 4LY3A 1U2PA 3AZOA 4Q24A 5F7ZA 3IODA 4BCBA 2NYAA 4NBWA 1Z33A 3BK7A 4KLNA 5CDHA 2ECOA 2H1FA 3RCBA 2HWUA 1PFUA 1ZVKA 3AUKA 2PG3A 5MHTA 2XKAA 4BNTA 4ZOBA 2IE8A 4RVDA 1QZUA 3T5DA 4DCUA 3HA5A 1U3TA 4K88A 5F9HA 2MSCB 1TFUA 1SEVA 2EYUA 1MVLA 3TFOA 3Q8KA 4RSMA 4Q1VA 1XD9A 3CLTD 3A3OA 4CR8A 4TLDA 2RH4A 2XNSA 1A2QA 3IHKA 1C7QA 3ZU2A 4MQMA 4TMTA 1CRLA 2ERXA 2GA8A 2XYHA 4JC5A 5A4IS 4BNJA 1JIUA 2BN4A 2V7PA 3K0HA 4YDQA 1KYQA 2E87A 2OG1A 3GVPA 4IP0A 3U3KA 4AZSA 2Y9MB 1CKEA 2R60A 4HWPA 2FPRA 2WM8A 4MV7A 3OQMA 2ZIAA 5JASA 4IQGA 2XDQA 3KOMA 3Q9UA 1HK7A 2J09A 3LRTA 4PC6A 5CJ2A 5B58C 3AO0B 4MGZR 2OCKA 3SIRA 1EP1B 4ZT3A 1UXHA 2GPNA 2XEDA 1DQSA 2GO7A 4LJ8A 4X45A 2ZS7A 1JXAA 2XUAA 2PT5A 4UW9A 1CWUA 1GV1A 2V4ZA 3JRNA 2AQIA 2PSFA 4FX2A 5K05A 2YWBA 2ZJ3A 3P0EA 2YINC 3DXYA 4X1KA 4CQNA 2G82A 3FM9A 1S2NA 4WLNA 2AF3C 2IWHA 2GRJA 5TXGA 1VJ1A 1EU1A 2FQ1A 3TQHA 4EHLA 4RH1A 3FY4A 5HIKA 5T4HA 3AFIA 1G4AE 2BWJA 3PQ3A 3MGBA 3STHA 4TS9A 5JSUA 3ONVA 5FHQA 4UHBA 4PBTA 2R6ZA 4INOA 3I6BA 2GBGA 3H11A 4RKRA 3HADA 5IAAA 1YA4A 4J0HA 4BO8A 1Z5GA 3QBVA 4FDUA 2F1OA 2IITA 2Z5LA 4F8EA 3I5YA 1OWPA 1HSZA 2CFTA 4D4IA 4A8JB 2OZLB 2B92A 2FN4A 3ZTWA 5LUBA 3ROMA 1BA2A 2GCNA 2YTZA 2P62A 3AI7A 4RJKA 3ZV3A 4ZT6A 3RRYA 5IJ0B 3ORRA 3NDIA 4BPBA 1K68A 2O20A 2YJTD 5HDQA 3U31A 1CE8A 2EJCA 4UNQA 4HRXA 4ZA2A 3U6BA 3K0AB 5HUJA 2PNJA 2K5UA 4DG5A 3OUUA 4HDQB 2DY1A 4LF6B 3JTEA 3VO1A 3N3AC 2GF9A 1M6WA 4ZRMA 3NETA 3DLTA 4GZ6A 4X41A 4LMBA 3B6MA 3SF0A 4PC1A 3V4PB 4CV2A 2XADA 3E9ZA 4NNJA 1V37A 1WB5A 1ZYUA 2Q1WA 3G2KA 4UBKA 3TIVA 5JROA 4R2LA 1R8YA 1SIWA 1HETA 3B3QA 5F4BA 4D4GA 3WYNA 1QIMA 2IYLD 2HIHA 4KFRA 4UHHA 4B32A 3S99A 2X0RA 1CLEA 3F5FA 1E5VA 4OYYA 5TPWB 1GADO 4N82A 3IIJA 4CXMA 4OK5A 2PS0A 3UMGA 2EKLA 3MB8A 3GGPA 2CNOA 4AULA 3B1JA 4AY2A 1J33A 1ZBDA 3UKDA 3DXFA 4QYWA 2R4UA 3LT1A 4K9DA 2GJAA 5ES4B 1GEGA 1ZXLA 2AXNA 2OZPA 1DJOA 3T3EA 3AR8A 3IDQA 1QOZA 5JJLA 2JASA 1NUSA 1RBZA 5KYTA 3EWIA 5F64A 4CL3A 2MSKA 2C5AA 4FFWA 1GPUA 2QJRA 2D3TA 3BIJA 4YUWA 4EGQA 4WZBE 1NXVA 5K3FA 1R3DA 1N2BA 1HDCA 1SG6A 1E1QA 4FEGA 3OOEA 4QFBA 1O0BA 3EXEA 4D9HA 2ATVA 4B1FA 3GZ4A 4G07A 2AFHA 4PN7A 3EDYA 3OMXA 5HFJA 2EBHX 2FAXA 2ZBGA 3DLPX 1L7PA 1S2OA 4WXHA 2YMMA 4MRMB 5LA6F 3D3KA 2WWVD 2ERCA 5F12A 2XYPA 5K3AA 1FB5A 1TUGA 2AMFA 1FP6A 3ASYA 2ODWA 3DAOA 1DAEA 3FCEA 3VOBA 2ZJFA 2BL4A 2LW7A 1W5TA 1YRLA 1B4DA 2JJ8A 4EW1A 2OHIA 2Q2NA 3TNFA 5IJ0A 4KDEA 3HCBA 5CNMA 4B4WA 4D79A 5CD1A 3G8DA 1BWPA 2X8LA 1QGED 1H2BA 1YR8A 3EISA 1TUIA 2O7RA 3LPAA 4WNAB 2R1UA 4TUYA 3ORFA 2D1YA 5G1PA 4LYGA 2BTQB 1SQ6A 3DOUA 4CCAA 1E2NA 4PN3A 4K6HA 3IUSA 4BO7A 1PZEA 1GPKA 3UMJA 2GFHA 1XV5A 1YASA 2ZQZA 4LN1A 2DBVO 5TRTA 3V2HA 1XXHA 4RS3A 2DPMA 3DEJA 1IM2A 2FP4A 4NMHA 1P1KA 2APJA 2B3DA 3NTRA 1SGWA 4RK5A 4WN9A 1DE0A 2CYAA 1CQJB 1FF9A 3BJRA 1Q0QA 3SXPA 4JENA 4E5NA 4BXOA 4UJ5A 1CIPA 5JI2E 4GM1A 1XXLA 4TTTS 3CH7A 4MWEA 4YH1A 2EFEB 5G1OA 4DMRA 3MTEA 1GDHA 3QXJA 1IB6A 4FCCA 3Q85A 5A0TA 3QEJA 1FLVA 4IJVA 4IZOA 2F1HA 3PNBA 2OHHA 3U4QB 1T4DA 1QNFA 4IEIA 3AVYA 2P1RA 4AZ0A 3NKFA 4KAXA 4NE2A 3M83A 4A10A 1O8CA 1R4ZA 2ADOA 2H17A 1TAHA 1DBVO 1E9FA 1MAAA 1W85B 2IYRA 3D3WB 3N2GA 2PX6A 1K4YA 4YO8A 3KSUA 2HHLA 1E89A 1ZGCA 3PVSA 1LNQA 1MO3A 1ZK3A 3ROGA 1RQ2A 4QYIA 4JLJA 1ZLYA 1KJZA 2IS6A 5K01A 4DJAA 4I1UA 3EPLA 3G2QA 3LTNC 3EGIA 3T7KA 5BOVA 3SAJA 2O2YA 2BZSA 3CHYA 3FDZB 2WP8J 4CMIA 3H5IA 1J6UA 1T36B 2DHRA 3LOQA 4B3BA 2X8JA 4GL2A 1ESNA 3T1VA 4ZVQA 5DHAA 3TEMA 4D5EA 5A4AA 3DV0B 4G0QA 5IZCC 2HRBA 5EIXA 2CUZA 2GB4A 4QLBA 1NQXA 1Z83A 4JYZA 2Z6AA 3L2OB 3ZHZA 1K0UA 3F3MA 4Z3OA 5BQFA 3ECSA 3SR3A 1ISIA 4DV0B 4EQ6B 4GDMA 2CXTA 2I2XB 4HPJB 3UH0A 4XRGA 1YS1X 3L8YA 4RCYA 1F5SA 4PS1A 3DAPA 2I6UA 4P9NA 1WEKA 4KMRA 4YJ2B 3DTNA 4MWCA 2QUHA 4WTOA 3E9QA 4FX5A 1XZKA 2BPOA 2QGZA 1FFCA 3UCFA 4IF4A 1NR7A 4JY7A 2UZ3A 3BQ9A 3N8GA 4LV8B 3VNUA 1N4DA 1VG9B 3EIWA 1D0SA 3GEHA 1EFDN 3RQIA 1KH1A 4YCDA 1YNSA 1CETA 2X1LA 3NBFA 4JJZA 4RELA 2JA2A 3R7WA 3A26A 2PH7A 1FUUA 2NU7A 2A9VA 3FMFA 4TKMA 4H7HA 5K6RA 5T6MA 1KY2A 4HYEA 5HG0A 3RC2A 1JDTA 5FL7D 1NZJA 1GCIA 5IC6A 4EKDA 4GYKA 3TW8A 1B0PA 1JQAA 3LIIA 3U7QB 4G5HA 4JASB 3PJRA 1OHHA 1UM9A 1NJ6A 1VPEA 2FX3A 2ZRCA 1BH2A 4CIWA 3LLVA 4BEBA 1TF2A 2CLIB 3C3EA 4HFJA 1QHXA 6YASA 2Q2OA 1AHIA 3QLJA 4MR7B 2GSWA 4LIPD 5TGTA 5TQJA 5C7YA 1UOQA 3EDRA 1SA0A 1DCTA 1W0JD 5SZKB 4OQYA 4ZI7A 3THSA 2REOA 3T35A 3H4VA 5DT9A 2VTVA 3IJ5A 4R84A 4XGQA 5IUKC 2P5YA 1FSPA 2GN1A 3CUUA 3ZD8A 3FSRA 3E2MA 1SVIA 1CQPA 3MGKA 4GQAA 1KERA 2EU8A 3KJEA 4UBLA 5EQTA 3PQ2A 2AKYA 2FP3A 3W2EA 1JVSA 2F4NA 4RDXA 1PAUA 4C5CA 1ZDMA 3IPRA 1JKJB 2C8JA 3E23A 1BEEA 1A8PA 2ZITA 3FFXA 4MKIA 4XIJA 3LBYA 3O82A 3GPBA 4E3WA 3PC6A 4EI8A 2YYSA 2Y71A 4ZV9A 2O8VA 4G0YA 4ISCA 4WA7A 1OH8A 1KZ1A 3LAWA 1GTG1 3IRVA 4DHWA 1U7ZA 3C3MA 3LK7A 4TVBA 3I9NA 1MPXA 1O57A 1Y6ZA 2G6BA 1TB4A 2FFAA 3JY6A 3QLVA 3UAOA 1DBQA 3PUVA 1GILA 2BKLA 1TAGA 3RVQA 1VKZA 5I7AA 4XOIA 3FTEA 1RABA 1WULS 3ZZNA 3BIXA 3CRNA 3T0GA 4WLFA 1M0TA 3LYLA 5NULA 4AC9A 1DKMA 3ASZA 1XRLA 4OQPA 1TYBE 3ELWA 2QMOA 2EFCB 3AXTA 1M34A 1TNDA 2W00A 2QMQA 2BHRA 3CONA 4KWTA 2BFMA 4UU7A 2AMLA 3JQBA 4KNWA 421PA 4UTNA 5GINE 4DPMA 2VZ8A 4ACBA 5MGNA 2H3EA 3V2UA 2RHTA 1ZCAA 3UZUA 1NQTA 1JLLB 4MRRA 3PX2A 4P33A 1EWTA 4JB0A 2MTBA 3NBZC 2ZP1A 1AHHA 1J99A 3LC0A 1CVLA 1H3FA 4XR4A 3FYUC 3OZDA 1MJFA 1PLJA 3CUKA 4F84A 3KT8A 5I7EA 3L8EA 1RXSA 2ASEA 4DEVA 4F1JA 2DWQA 2VJQA 4FWBA 1LA2A 4KYVA 4CF6A 2ZULA 2DEUA 4XUEA 5KNDH 5E95A 5F2OA 1FXWF 2CNLA 5JQGB 5C5CA 1XTRA 1F9AA 1UMCA 1IVNA 2VF8A 1O87A 3LA6A 2IYUA 4DILA 1Q3HA 3VSEA 1HDXA 1HMPA 1NBMA 3DNPA 1AHNA 4GOMD 3AR4A 4F1WA 3UY4A 5I9LA 2QLTA 1QRUA 4JXZA 2FG7C 2XDWA 3HZOA 1G20B 4UTOA 2F3RA 3C24A 1J90A 4V0KA 1EK5A 5JZ9A 4W5NA 2C04A 1QNLA 2IHJA 3GUUA 4BP1A 5IT4A 1K8QA 1MFZA 4UUNA 1RAFA 1VIAA 4LJRA 4A27A 4E6EA 2Z30A 3I4FA 3AF6A 1QRDA 2OBYA 2ZB3A 3KL2A 1KPHA 4EWLA 5EA2A 1KO7A 3EODA 4B3FX 1IZ8A 1VL2A 3HUUA 1TQDA 1PK8A 2P5UA 5FA5A 3K92A 1AHPA 2VJDA 4YRTA 2DETA 3AEUA 4HEHA 2CE2X 1VI2A 3DOHA 5HE9A 3T94A 3VNBA 1DT5A 5DM0A 1U0EA 2GEJA 1LGYA 1RQNA 2JGIA 1DRKA 3C7CB 3X1JA 2JIBA 2W2NA 3P9SA 2LKCA 1ZH8A 2A9PA 5EUQB 5IDQA 1XAGA 4DYDA 1SUWA 1XWFA 1ZISA 3B6JA 1P19A 4I08A 3IR6A 4BZPA 3GH1A 5HK9A 2RJOA 2FPPA 3KQTA 5F73A 3B1FA 3L6UA 4M8IA 1JJVA 1C14A 3C3CA 2GM9A 3NALA 4PZYA 4YP6A 1H8HA 1V71A 3L49A 4OIFA 5KKNB 4B85A 1JR2A 2J07A 3HBAA 4DLUA 1HORA 1ZJ5A 3BORA 3UOAB 4L9RA 1V48A 3VH2A 3WK6A 2YRFA 4EVSA 4WADA 1PUJA 1P18A 3AR7A 4E07A 2N0SA 3I8OA 2BR4A 3USCS 4EEKA 1OZFA 4KL8S 1GYRA 2DBYA 1EVKA 3WOHA 2V3CC 4NBRA 5TF4A 2ZWIA 4MWDA 4QDOA 4JN6B 4PCVA 3I8SA 3WK4A 4W5TA 4JVMA 5HZMA 3LX5A 2OV6A 2R4QA 3GGDA 3K05A 4G8CA 5KNBH 4NDAA 2PZKA 4HDOB 4IZHA 2GN4A 1AIPA 1HRDA 1NM5A 3TMAA 4Z51A 1P1RA 3I9V1 4L8YA 5HCIA 1VI5A 2OZVA 4L9SA 3QYFA 3LVFO 1E0AA 3EDQA 1C8VB 2MR6A 4AJHA 4BOYA 3JQ9A 3WL3A 4Q19A 2QM0A 2PT9A 4IJ6A 3UUEA 1I32A 3CQ9A 5HRCA 4ACAA 5KYNA 3H9UA 4RORA 1BEUB 1FMT