3OQPA

Crystal structure of a putative isochorismatase (bxe_a0706) from burkholderia xenovorans lb400 at 1.22 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
207
Chain Sequence
MTTPRRALIVIDVQNEYVTGDLPIEYPDVQSSLANIARAMDAARAAGVPVVIVQNFAPAGSPLFARGSNGAELHPVVSERARDHYVEKSLPSAFTGTDLAGWLAARQIDTLTVTGYMTHNDASTINHAVHSGLAVEFLHDATGSVPYENSAGFASAEEIHRVFSVVLQSRFAAVASTDEWIAAVQGGTPLARGNIYASNQKARARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative isochorismatase
publication title Crystal structure of a putative isochorismatase (Bxe_A0706) from BURKHOLDERIA XENOVORANS LB400 at 1.22 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Hydrolase
total genus 73
structure length 207
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3oqpA00
4H17A 3V8EA 3TXYA 1XN4A 2WTAA 1YACA 3HU5A 3O91A 2WT9A 1X9GA 1IM5A 1ILWA 2A67A 3KL2A 3OQPA 3PL1A 3R77A 2B34A 3O93A 3S2SA 3TG2A 3EEFA 4L08A 3MCWA 2FQ1A 3O92A 1NBAA 1NF8A 1NF9A 3OT4A 1YZVA 3TB4A 3UAOA 3LQYA 1J2RA 4WH0A 3R2JA 3O90A 4WGFA 3IRVA 3O94A 3HB7A 4L07A 2H0RA
chains in the Genus database with same CATH superfamily
3JPWA 5GQSA 4KR3A 4OQPA 1K3TA 2QD1A 4AZ3B 1FMJA 2AXNA 2P5TB 5H81A 3K0KA 1RACA 2ZVPX 3MTEA 1WXGA 1TQ8A 3PUXA 5DMXA 1G7CA 3KYDA 3V7FA 1TU3A 2EP7A 2WKQA 3ZDXB 4OP2A 4OHBA 4P8RA 4Y9DA 3RS2A 2BGNA 2YVKA 4N5IX 2PUVA 1NULA 4HTFB 1CJCA 1ULHA 2QIPA 3L46A 3KZXA 4IUBS 2W0MA 4XE5A 5IRCD 1EWQA 2V55B 3H84A 4L5AA 3VPAA 4GZ5A 3CF4A 5AUQA 3ZCUA 5JCPA 1KIAA 5C1IA 1JH9A 4FUQA 3UANA 3C5HA 3MM4A 5HIIA 1PSDA 3D8UA 3CO5A 4EVSA 2PL9A 3L40A 2HA2A 4I4NA 1IEWA 3IV7A 1GGFA 4V03A 5B58C 1RCFA 3AHHA 1GITA 4FYIA 4M0KA 1KK2A 5CYGA 2I4TA 2QL7A 3GNQA 3ODPA 4N6GA 4P86A 4LJKA 3LVQE 5IAEA 1VKOA 4OXXA 3MLEA 3CJRA 3NLLA 4MVJM 1VGVA 2GGSA 3PFCA 4L6CA 3DEZA 4XARA 5AM3A 1SD5A 2UZ3A 3RUCA 4XAQA 1EM6A 4WCFC 4XJXA 1XHEA 3HM9A 2OLEA 2IXDA 1E18A 3PFBA 4B1FA 4DDMA 1YHYA 5CD1A 3AEYA 1JP7A 3B1WA 1PR0A 1TCCA 4BU1A 1X7ZB 3C5WP 3ROZA 5HZHA 5KOJA 1Y9JA 5J43A 2WTEA 4RIEA 2C98A 2HMYB 4QGHA 5GJVC 2BH2A 2K7FA 2JAQA 4KE7A 2W6NA 3S70A 4LW8A 5EIAA 1JIJA 1MNQA 3B85A 1IQUA 2Q3DA 1H23A 4HYTA 5MHTA 1V1RB 3O4HA 3L01A 4UJ3A 4IOKA 3FTDA 2FW0A 4KH0A 5ISMA 1ZR4A 4HDSB 3QI7A 4YP0A 2HWWA 3AERB 1W2GA 1NR7A 1VIAA 4NE2A 5JAPA 1N34B 1P7PA 3AIIA 1U2SA 3LZDA 1F0NA 4PYMA 2YIMA 3FR7A 2WOOA 2WWHA 1QQBA 5CCEA 5D87A 2AWOA 1ZGBA 3DXZA 3OAAA 3RYIB 2XVXA 2DAPA 5FEMA 2HLNA 3S2GA 1QQAA 4QREA 1XG5A 4HNGA 1C81A 4BAUA 4BGDA 4PX9A 4XR4A 4L1KA 2Y2VA 1NUPA 3ET5A 1C1DB 1MV8A 2IHVA 4GFDA 2CVZA 3UT6A 3LX4A 3F46A 3DV0B 2D1SA 5ILGA 4GMGA 2RK6A 1ZN8A 2NN3C 4IUDS 2DQYA 4GS5A 1ZK0A 4OFBA 4B3TB 3OOWA 4O29A 3ZY2A 1FZQA 1L4NA 2HHHB 3GFRA 4WXPA 2NO1A 4Q39A 1PR6A 1AUQA 1UBLS 2Q3EA 4O3FA 1UKBA 1OC4A 1WD5A 2VQEB 1QF6A 2XCIA 4IDDA 4PFSA 2IV3A 5JJCA 4JJ4A 2FWAA 3BGVA 3EQ7A 1AGNA 1NQAO 1RQPA 1ZMRA 4NU0A 5TVGA 2ADOA 3BQNB 1OBOA 4XASA 3MCAA 3GWGA 3ZTWA 2OVFA 1Y5IA 3U40A 3M1AA 1SOAA 2DTEA 3WK8A 4PZPA 3ZZ1A 5I7AA 3MBKA 1P72A 4IMJB 2Z0MA 1HK7A 3ABOB 1HT3A 1W93A 1FDIA 2PL3A 1ZJ4A 1MXFA 3HKEB 4UUMA 2OZLB 4GL2A 3GLFA 2VNHA 4Q1AA 4WKOA 1RKVA 2XLCA 5LDDC 2DWUA 3EA5A 4A10A 4FOSA 2FPIA 5D5PA 2GPSA 1UPTA 2AG5A 3FYSA 3R9KA 3A37A 4AZ3A 1FSFA 5LWHA 2O8CB 3IO3A 5I9TA 4KP7A 2QLTA 1YV9A 3G0OA 1GPDG 4ZAYA 3H2SA 5J4LA 2R66A 1CK4A 5JBIA 4JKIA 1GILA 4MKHA 4BMPB 4KRXA 4O2BA 1GZHB 4OF4A 4U0KA 2PFKA 1XIVA 4REQA 2OQRA 3BXEA 5F1YA 4G56A 5IJ9A 1RBZA 2XLBA 4MRRA 2H1FA 2CBXA 5KVSA 4P4LA 3VU3A 3FPCA 4B6EA 1KY4A 4H7PA 1YZGA 5A9RA 1P1JA 2A0UA 1Z4LA 5JO0A 4IXTA 1PBTA 3KTAA 2EFGA 3NIWA 2JNWA 1TYCA 2DUUA 1EP1B 3K71B 2AN4A 2FPUA 5ICGA 2VLBA 4INJA 3ZV7A 3PQEA 4TTJA 4HWGA 2ST1A 4S1WA 3D7SA 1LX6A 2CL0X 3HKDA 4PHCA 3EAGA 1Q17A 5TQ2A 3TF5A 2VQSA 2C94A 1L5WA 1J8VA 3BKXA 3FVWA 4F3RA 2R00A 1IBSA 2ZR7A 4Z7NB 3AOGA 5CM9C 1GQQA 2O3JA 4Q3CA 1L8QA 1YZUA 5IUJC 2OAQ1 1HETA 5CAEA 3HE3A 5BVHA 2IEDA 4OO3A 4WY5A 4BJ5A 1P7WA 2TMYA 2Z30A 3JYLA 1NBEA 1P0PA 1U98A 2ZTHA 1D6SA 3LE8A 5SZHB 4NSNA 1G8AA 4CKXA 1G20E 2XGOA 3OM0A 3ZVKA 1XT6A 1ZVVA 1LPNA 4R2WA 4DMFA 3H7IA 1IRXA 1VL2A 2IZZA 4TL8A 1FW6A 4KNYA 2PRIA 3LQ2A 4RVHA 4LAFA 2H5JA 2W0SA 4RANA 3F90A 3A1DA 5CDGA 1E5VA 1SPXA 3IPRA 3PKZA 4K05A 1ZD3A 2GO1A 1V1RA 2BM0A 3H3FA 1XCPA 2XYHA 3CC8A 3NWJA 5TGDA 4BQPA 4CQNA 5KVQA 3OUZA 2FJUA 4RHYA 4F0JA 3U7EB 1QKKA 2D2IA 2ZBQA 4PNZA 5FOQA 1FYVA 2RCYA 1HBJA 4FLEA 4Z4FA 1BMQA 1RTTA 4RK4A 3T94A 4AECA 3FOEC 4X9XA 2YN2A 3Q8XB 1Y6QA 3RYIA 3RC1A 5EIOA 4EJ6A 1R74A 2JDID 3DWGA 1QCDA 2ENUA 1PW7A 2C92A 2WIBA 3OSZA 4DZRA 4DDUA 3KP1A 4OI4A 1DOAA 3NHZA 3TX6A 2C3YA 1H8EA 2XUHA 2ZIVB 1GU1A 4MWCA 1E3EA 3RIYA 3DV0A 1G8MA 1F6BA 1E2IA 3DTVA 4GSKA 4HAXA 1DIBA 4NMLA 1Y8RA 4ZEMA 5IWAB 3MGBA 1DTSA 3T9CA 4D96A 3U44B 1KJWA 3HO8A 3A9UA 4F12A 1XZKA 1ZNYA 1DRJA 1AU9A 2CWWA 4DNXA 1FSZA 1IXKA 3HQ4O 1Q15A 2ZLBA 3ND7A 4WVLA 2XHEA 1A98A 4FGZA 4JNCA 5KNDD 4PGMA 2IRWA 3FMIA 4Y9SA 1T15A 3VH4A 4HGYA 1P8JA 2ZUVA 4QFMA 2IDZA 4X62B 4IHJB 4OQFA 3M5WA 3PR2B 3RRYA 1ZMBA 1FUKA 3VDQA 2VK1A 1NT4A 4EGSA 3JVUA 2PKCA 2NZVG 5AKJA 1K7YA 4GXRA 4Q02A 4TWIA 1QF9A 1C3VA 3RRBA 3RU9A 2NT3A 5EWJB 3CLVA 5J5CA 1SVNA 2O8VA 3MMXA 1ORRA 4HVTA 3HKEA 4KQHA 4MHSA 5L6MB 4XTCS 2HU5A 1FQWA 4PAQA 5L3RA 1N8TA 3PDIB 2SECE 4EDFA 3UOAB 1UMCA 2PTGA 2XMRA 4D8XA 1X1SA 4S12A 1YS7A 2X9VA 4H1TA 1RWKA 2XYQA 1A9TA 5H3LA 5THXA 3ICQB 2DR2A 2C54A 2CXHA 1XKLA 2J0EA 3PHBE 3MXOA 3UXEA 4CQJA 5EHQA 4E2ZA 1KF0A 2ASEA 2IQ5A 2FI1A 4FDUA 3OE1A 4KWTA 3RKRA 2P9FA 3N7AA 1IFXA 3AI2A 3GVCA 1KDZA 1VL0A 4GYKA 5ALWA 4AMYA 5C18A 3LY9A 2P9EA 3UG6A 1QH8A 1VBKA 1ZH6A 2BEJA 4Q1DA 4UDOA 3IE1A 1VXOA 4QKQA 1HE4A 2YV3A 2JJ1D 2OHFA 5D8DA 2JBWA 1JEEA 3OZEA 4I1YA 4KI0A 4G97A 5DYYA 2AQIA 4BV2A 4CFYA 1E0JA 2C7QA 1YCGA 5ETJA 5KINB 1GGKA 4JBLA 1Y63A 2ZJ7A 1VLLA 3GN1A 1WZUA 4NG4A 5DN6A 1Q1EA 4GBED 1CS0A 2JAOA 2AKAB 3P9KA 2R6CA 2YICA 3K09A 4WNAA 4KTVE 3VR5H 2Z4SA 5B6IA 3H1EA 1W5AA 1CFZA 5JC8A 1ZD8A 3QVVA 5BV2P 3VJRA 3TUJC 4N7JA 4QOEA 1LBIA 3U3XA 2WAXA 4RDIA 3Q7SA 4UUOA 1KKMA 3PENA 3SQMA 3KM0A 3TKAA 1CUGA 2F55A 4GR5A 1U7ZA 2OKGA 3NHWA 3OT1B 5HIKA 4AKGA 2QXUA 1XLWA 1XD9A 3GDFA 4QASA 1DS6A 1X7DA 2C2HA 2OOSA 1WCIB 3LECA 4PX5A 2GCGA 3NTQA 5CW1A 1XJ5A 5CB0A 4TWRA 3GCZA 1ZEMA 4Y2TA 1EJ2A 3JD3A 2AFVA 3BOSA 1LXCA 4MP3A 5BVGB 1HFEL 2JKZA 3A9VA 1YE8A 3F3SA 1XTUA 5TT1A 3TB4A 3PJGA 3M4JA 2A86A 4D9GA 4TM8A 4ZZ1A 3DMDA 5JW6A 5K01A 2VF8A 3QF4B 4OLAA 4ZI5A 1X3SA 3TFOA 4MWDA 1YI1A 3K70D 3DO8A 3MW8A 2XYPA 3OKCA 1ES9A 1WX1A 4JHLA 4JROA 1U8UA 3WWYA 1N8SA 4UUAA 3BFVA 2C20A 2IW1A 1EVJA 4NDAA 5F23A 4EO7A 2F2TA 5JZSA 1E4OA 1AS3A 3CR3C 2CJXA 2BR4A 2FPPA 2XTJA 3GEHA 4KMRA 3WNZA 2FZVA 3AI7A 3ET4A 1U9IA 1XEWX 3KWFA 1W48A 2FB9A 2OMKA 1R16A 1E62A 1T24A 3QI2A 1RZUA 3OPVA 3R5HA 5B3LA 4HLUA 4MKFA 1NJ5A 4KQKA 3ZWBA 1OLOA 2H4HA 2W58A 4O4IF 1YUMA 2W93A 1IY0A 3FFXA 4LHEA 4QFCA 4J9UE 4WFQA 3DOEA 4AK9A 4EHFA 1QO7A 2CLDX 5IF3A 1BOOA 4BFSA 4ZMBA 2G6TA 2DTDA 4YH1A 5JEEA 4ZAZA 2GPBA 5CGZA 1RE1A 2D5AA 4B31A 1DX4A 4JXZA 1DUVG 2GTPA 4N82A 2CYAA 3WGQA 4OUDB 4UMFA 3GD7A 5T6BA 1T10A 1FNDA 3WOHA 4KQFA 3P2KA 1JHMA 3AF0A 3E9NA 3GFBA 3BWCA 3LYUA 1V9LA 1J5EB 2JEOA 1DUSA 2IYFA 1T25A 4JC0A 4HAOA 4O4HA 4PNHA 2AN1A 4X1OA 3V3TA 2VHEA 3Q9UA 5L7WA 5JU6A 2C4KA 4X20B 4KEAA 1PX0A 1XRLA 1ZM7A 1IUPA 1NSTA 2Q4TA 2J6CA 2QY6A 3QMPA 4QBFA 4KYIB 1ODFA 3SXJA 3U2QA 4DCMA 3D6HA 5J59A 4AJIA 5CITA 2Q8NA 1Y8CA 3PA8A 4DR3B 2C0CA 1HDIA 3N3AC 5AW9A 2TRSB 4JEIA 5DWQA 3NHUA 4R1OA 1JU9A 3GROA 1UOOA 1PFWA 2I1QA 2A84A 2IHBA 3VKUA 4DZTA 3UAGA 2REQB 4IQ0A 4EG8A 3UHJA 3C3EA 1YRQA 3MSCA 5LSAA 4C20A 3KR9A 1SC4A 2GYWA 3AVYA 2RKBA 3K9WA 3ANNA 1NBME 2DLNA 2OFXA 2Q1YA 4QLOA 2BN4A 5CDFE 5IHXA 2IS2A 3JZMA 1RWNA 2IU4A 1FDOA 4OJMX 3FI9A 4P32A 1QORA 1XMPA 5ENDA 1HM5A 3WIOA 3IGFA 2CNLA 2VWPA 3AOEA 3HPQA 3QUBA 4HZIA 1XVVA 4QGBA 2PWYA 3CLTC 2OV1A 4BE7B 3U1BA 1WUYA 2C4UA 3UWSA 1PWYE 1U2ZA 1YRBA 2D3WA 3WLIA 4DDTA 1GSIA 4KNWA 3QVMA 2AXPA 5DM70 1L7DA 4EMSA 4LFAB 1G8JA 3H2KA 1N9KA 2H4WA 5KREA 2F1HA 1K0FA 2DWPA 2JFVA 2Z8XA 1VRWA 4HH0A 4L5YA 3GJ5A 3ZXYA 5LIPA 2J9FA 5GONF 1X1DA 4FCCA 5HXAA 1YS2X 4KQJA 1YVPA 3C24A 2BISA 1CF2O 3RRNA 2GM3A 5BSEA 1IZ8A 1OAOC 3ZWMA 1AQJA 2O5CA 4YHBA 3AFOA 2OKCA 1K88A 2XNJA 3VMFA 3OMLA 2C8LA 2MMCA 4HO1X 4QXMA 3GH3A 4WFJA 4ZYZA 2Q8QA 5IJAA 4FKZA 4BNUA 1DE0A 4HDKA 4M98A 1EH5A 3MBOA 1WR8A 1H2AS 4LXTA 1E9VA 1KVRA 4MS3B 2PU5A 4Y1RA 4J49A 1Q16A 5IAJA 2YHSA 3ZX4A 2X9NA 4EATA 1F51E 4AMVA 3LUFA 1HYBA 4UUNA 1YRYE 3FGNA 4QUGA 4QUBA 1OH5A 4GX2A 1FNNA 4QGFA 4M0CA 4MP8A 2VYCA 4YMHA 5LZ7A 3DAFA 5KI6A 1NNLA 5HG0A 3P2IA 1SPBS 5L4NA 3UGKA 1QKIA 1XNJA 2I7DA 5DM60 2HQOA 4EI8A 2C61A 2XB2A 1ZWLA 5FL7D 1JE0A 2A67A 5C9ZA 5FWXA 1Z7BA 2GKSA 5FR2A 4D4GA 2AD5A 3SYNA 1Y1KE 1UBEA 3KALA 1T5HX 2PSDA 3DT6A 4L9WA 3NRJA 4P81A 1GNLA 2X0RA 5EKSA 2RK4A 1A8PA 1OX5A 5AI6A 2HZ7A 4M0EA 1BXRA 2JFWA 1DIHA 3BZBA 3IUYA 2BSQA 2JFYA 3FYUC 1ZWKA 2P11A 1CUYA 3I72A 4G0YA 3TS1A 4L16A 4HEJA 3I6QA 2IYWA 4EEKA 5BXYA 3SBDA 5AVQA 5JRZA 4NPCA 2I2WA 3MJHA 3SHWA 1AC5A 2B6HA 2PH5A 5ALDA 3MLBA 2YZ2A 3ZHYA 3ELYA 1AN0A 3IH5A 2Y05A 1K6MA 3B1XA 5H83A 1LV8A 1XZDA 2ZWVA 4HXYA 1RXWA 4MUXA 4C2BA 3W5AA 3KV1A 1GQOA 1X2EA 2PJDA 4GECA 4HPJB 2I6QA 3SQWA 2DTXA 2RGEA 4QPPA 1T0PA 2NSDA 4EPVA 3UPUA 4ZQIA 1YIOA 2BEUA 1CW2B 4XYMA 2PWPA 2JCSA 1Q0LA 3AGQA 3PRKE 2VPXA 4EHIA 4I5FA 3ZWKA 1Y7HA 2BDEA 4OI2A 5AXDA 1UBCA 2H2AA 4NQZA 4TZKA 3BMNA 5KPJA 3G88A 1P7VA 1L4HA 1BMDA 1Q74A 1DIOB 2DG2A 4MAAA 2RGGA 3B3JA 3BMXA 1QBKC 3OEED 2PGLA 4NABA 4ZRNA 4BO1A 5KU7A 1KP9A 2FQWA 2OCKA 4EG1A 1QOQB 3BD9A 3FX2A 4A2CA 5LQDA 1CY6A 5K7SA 1VL5A 2DSNA 1Z5PA 3LX6A 1DJPA 5A3SA 4G8BA 5AIBA 3ZGZA 1LPPA 1BYIA 421PA 1FYDA 1W0KD 3CX4A 3WS7A 5BSKA 4TLMB 5GWXA 3ZBQA 2AUTA 2GJ4A 1MU0A 1RS0A 2GS9A 4OBBA 2QENA 2ZWIA 3VX3A 4YAIA 4PFJA 5CX1A 3NUQA 4D3FA 1T9GR 2REQA 1WCWA 5DASA 3WQSB 2VYVD 3G85A 1V35A 1Z8HA 3HI4A 1DEOA 4WGGA 4YJGB 4UNRA 2F6RA 3HBLA 2V7BA 1QK4A 3QUSA 1CP3A 2Y93A 4FMCF 5KYWB 1G3MA 5IASA 1Z5NA 4MRMA 4A8JA 3P7MA 4HUTA 1C3OB 2O5RA 1XJQA 3SIXA 2FPGA 4F5ZA 4KVFA 1IONA 5TMDA 2ZJ2A 2J9XB 3CF6R 2IA5A 2WPDD 4KITB 5LBIA 3HACA 4CM4B 3ZOKA 4AY5A 1X9GA 4H3HB 3PP8A 2X0DA 2IP2A 2G17A 2IEAA 1EUCB 2YYZA 5FWYA 3TOXA 4U2CA 3HXQA 3B53X 3KUDA 1YD7A 4RY8A 4JOSA 4RH3A 1YB5A 1T43A 1YMUA 4EITA 3AL0C 4C5BA 2FFQA 3DT8A 4RVFA 1PJLA 3V7NA 3I5YA 5I8WA 1OXKB 2IX9A 3ZWVA 3LU1A 4LZZA 3UICA 3OA2A 3AG5A 5A03A 3OD5A 1JI3A 2FDRA 1CRWG 1LVUA 2RIPA 4CKZA 4NAUA 3ANSA 3IKMB 3K5WA 3PGA1 4KXYA 5CVCA 3UKOA 5B4TA 1V7CA 2GEFA 4KDEA 1UAYA 4NBUA 5CX4A 2YQ4A 3RR2A 2JCBA 2C5FA 3S1AA 1FDTA 1T0UA 4TGLA 2AKEA 1DQRA 3ECAA 4QULA 2QVCA 3B5IA 3HMKA 3WDKA 4EKDA 5IHPA 2BUCA 1VKJA 2FEOA 2E2WA 2FFBA 3CNEA 4JIGA 4Y1EA 1JYSA 2YZMA 2RHMA 3CKKA 1UPUA 3BHIA 1M1YA 1BJTA 2VDRB 4R54A 3W5JA 2DT8A 4JL8A 3V2GA 1FVXA 4UAGA 5EZSA 1SGWA 4OHPA 2Z5GA 4I1VA 3A1TA 4FFNA 3I8SA 1HYGA 3U3KA 1X74A 2V0GA 3D8BA 2PZFA 2Z57A 3IUQA 1P39A 4L4SA 2JDIA 2ZB4A 1M8FA 2IOFA 4NCIA 2OFFA 2G5CA 4WOPA 2PBRA 1CZUA 2F1KA 5IMBA 1NYLA 1OGJA 2A88A 3IB6A 1RI5A 4JLUA 4CCSA 1R8SA 4HAVA 5DGCA 1DAMA 1T9CA 2OGSA 5E4JA 4OA8A 3OO0A 1EPUA 5DNEA 1H4VB 3OOHA 4ZOBA 2MT9A 2FKNA 3NBAA 4RAOA 5K99A 2GFIA 5DLYA 4HGPA 3HZHA 3RAGA 1P2BA 2C58A 5HK9A 5KNDA 3QBTA 3R3HA 2WSYB 4LZJA 4FC7A 5E6SA 3V1MA 4YMLA 1I8TA 4QAQA 4FBLA 4L0QA 4UNPA 5BV8A 5LMZA 1G5TA 3D7MA 3OU2A 4ZJYA 2EG9A 1L8XA 3COSA 2RFLA 3S3TA 1GPAA 4DY6A 5G02A 3NX4A 2R62A 3KU4A 1G9SA 4PTZA 5FNVA 2FR8C 1I0LA 3MOSA 3JYHA 1RQNA 1YRAA 4IDNA 3REGA 3VM6A 2DRIA 2OCGA 1JFRA 2CF5A 2XXAA 1KK0A 4TV8B 2A6PA 2M2IA 3OT4A 5BWCA 4TS3A 4JT8A 3EFOB 4S1PA 1JHZA 1J2TA 1Q91A 1R9GA 2D0PB 1JG1A 4XEUA 1RWWA 5HBGA 3W3AH 5FPKA 2HD4A 4FX5A 2D06A 2FMIA 3FB1A 3AHJA 3G2MA 4D6XA 2JG3A 3A2KA 1O97D 4HC4A 1T91A 1Y6GA 4RTMA 5FTMA 3VR5D 5AVXA 1ZZGA 2QTHA 5DB4A 1NC1A 1N8KA 5AP9A 5KWVA 1DBWA 5TVKA 2CFSA 2JJ1A 3CUSA 4QDTA 3V7WA 3C1AA 4PG6A 1QOZA 3H6GA 1G3UA 2PJZA 3FMPB 4BFCA 2H8KA 4MUBA 1BA2A 3AU8A 1N77A 2Z3ZA 3GPDG 1TZKA 1QPGA 2CXOA 2XCOA 1RXIA 3PPWA 4WESB 2B4AA 3G17A 4Q3NA 2B1IA 2C8JA 3VC3A 4M88A 3ZHSA 3UWMA 4J3NA 2ZRKA 4IWNA 4QUJA 2OCYC 1X1EA 4DILA 1ONSA 4OXNA 4X7MA 3E9EA 1FS5A 5LZ8A 1VI5A 1E3TA 5ADUS 2VI5A 3P45A 1WZEA 1XF9A 1YBVA 2HB6A 2B94A 2QX9A 3M6IA 4RX1A 4XB1A 3Q72A 5HSGA 2QBYA 3I8XA 3T7SA 3NTLA 4GH5A 1DTWA 5KUTA 3IVAA 2VYFA 3OQVA 3ZY3A 4K5QA 4CQLB 2B1GA 3VPXA 1ZRSA 1OJ7A 4PAMA 3THYA 1PX2A 3Q3JB 3JQFC 5IS2A 4E5VA 1DWOA 4GZ6A 3T3GA 4TVSA 1YL5A 2ODPA 4Y0VA 2J09A 1Q1QA 1AZLA 2PCLA 5K0BA 2X9GA 3DDSA 3REFA 3WQQA 3T7EA 521PA 3EUFA 1A5TA 2EWMA 2Q1UA 2WICA 4ZRMA 4B45A 5TJHA 2WW8A 3V1NA 3GDOA 1JIIA 3E9YA 2PWBA 2I1VB 4I4LA 3TAXA 2VHWA 2QG4A 3A1WA 3O91A 3TJRA 3SQXA 2WT8A 1VPWA 2VHJA 3PFGA 4M9SA 3J80A 1L1QA 2B98A 2R65A 3L6RA 4C06A 3WMRA 4ES6A 3OZXA 4Q3BA 2QUKA 2WM3A 3TW8B 4Z53A 4P3OA 1RBQA 2PN1A 3OZGA 3DDWA 4IMRA 4MQBA 4V0QA 3ZC3A 4BRZA 4P92A 3RTEA 2GF9A 1N3BA 2E5WA 1YDWA 4NS1A 4RQUA 1CBUA 2VBCA 1UIRA 3RRZA 3KT3A 1I80A 4YA6A 3DV2A 1B3RA 1A9ZA 2FQYA 4PLYA 2AOUA 3NBZC 1GUBA 2OUIA 3O4GA 4FFBB 2HGSA 3C3PA 4NCBA 1QC5B 2E4WA 3WTBA 3EMKA 2RONA 5IJ0B 1LX7A 2E55A 2FMUA 3U37A 2QVBA 2YXPX 5C1PA 5KDOA 2AN9A 5GOZA 4YCLA 2A1IA 2CKMA 3FUTA 3DKVA 5ES4B 1CEQA 2N1BA 1YRWA 4U6NA 3N2LA 4KXQA 2HTEA 4P53A 1H4QA 1K4MA 2M6RA 3CXRA 4MW2A 2AVNA 1EUDA 5DTJA 5FUXA 4G0VA 4JR2A 4G3XA 5D5QA 1IJFA 1ZRMA 2QQEA 2YYYA 2QPOA 3GAZA 3JAWA 4DLUA 3WIVA 3OQMA 5A9TA 3FOZA 4EJFA 1ISIA 5JCOA 1RI2A 4BNJA 1A0OA 4ZN6A 1L1RA 1G3RA 1MN6A 3L8DA 4IQFA 2QMEA 3C15C 4MUFA 5FNZA 2X15A 2FPMA 2HIAA 1DDGA 1E7SA 1I7LA 1R5JA 4J1QA 1RW4A 4LQ4A 4NDNE 5AI0A 5C32A 2FN4A 2YH2A 3N8IA 1EBFA 3DXXA 4TTIA 3LLMA 4PO3X 3X1WA 4DPLA 1NXTA 2BJHA 1M2HA 3FBGA 4YJHB 2CSUA 3EFOA 1N4AA 4WEQA 1TAUA 2OBLA 4UNQA 4MI6A 3ZBTA 4F92B 2WMYA 2P0YA 4HUQB 5MGBA 1HNWB 2QRZA 1GGNA 4PX3A 2CD9A 4PINA 1AKWA 2P3OA 4OBXA 2IYLD 4BNMA 1G9TA 1QS0B 5BSHA 5HDQA 2HHJA 1E2NA 2E48A 1G17A 3CXUA 1QMPA 1R4MB 4WOBA 3S5UA 4DL9A 3ORYA 3V4RA 5JWRA 2GZAA 1Z2AA 3H2GA 4ZVSA 1GLGA 1R4AA 4ZCRA 1HE8B 2O19A 4MYHA 3H5IA 2DXIA 1E2EA 4X97A 4I19A 1W9HA 4LTNA 1RYZA 4WNCA 3L7LA 3WADA 1HGXA 1R3DA 4TYWA 1YQWA 4Q05A 4C07A 3ZZUA 5EHIA 2FFHA 2ZVDA 4KVGA 3AHEA 4W6ZA 2I76A 4J29A 4X92A 1KNXA 4G85A 4JJGA 2NZ2A 1MO5A 3HGMA 3FHCB 5H70A 1SHZA 1BD3A 2H5EA 2A0XA 3ABIA 3D3NA 4RHTA 4DRZA 9LDBA 3I5MA 3SJAA 3AKDA 4JMPA 1UXHA 4OYHA 2EVWX 1P80A 1WW8A 4TXHA 3U62A 1U3TA 2JI6A 4RKYA 4CLDA 3KUKA 4LJ4A 2NZUG 2CLOB 4LY0A 6LDHA 5MDHA 4ZCMA 3QVLA 1PE0A 1Z06A 5J23A 3AJ9A 3BJMA 3KR0A 3R7BA 5JHHB 3UXYA 1NN5A 1YZLA 5A6SA 5F3WB 2DERA 2JLVA 1LKZA 1T4GA 2XKBA 3OLWA 1ZQ1A 3H19A 3PC3A 2BH9A 3BA1A 1QIKA 4ZV9A 3CF4G 2VO1A 2FZ5A 1NDHA 3KQYA 3NCTA 4QVKA 5FL7A 3AVTA 1DWUA 3WLTA 2IPAB 5EWMB 5TXGA 1X1AA 5K6AA 1WPQA 3C2QA 3ONEA 3NCHA 4OKIA 2OHHA 1TUIA 3I8OA 2P90A 4F5DA 1W76A 2AQHA 2MSWA 3M6VA 5J47A 2QIOA 5J4HA 4U2KA 1IQPA 2E0IA 3L41A 5HF5A 1AQ6A 1W30A 2WABA 3QPWA 3DCJA 1J0DA 1DTEA 4MLZA 4BX3A 5BMVB 1OYVA 1MNAA 4HMQA 1R2QA 3ANMA 4RE6A 1SO8A 2ZBGA 1NFFA 2AKYA 4P6VF 3B8EA 5DXFA 2X4LA 5JROA 5I51A 4LZLA 2GCOB 5AVOA 4UFNA 1ZKMA 4RZSA 4BBZA 4AQDA 4HGOA 2YW2A 2SKCA 3FN4A 3DVAB 3RSZA 3AEUB 1M6VA 2E87A 3W79A 2J4CA 4UCWA 2OB2A 3ESYA 1COZA 2IYSA 1N5JA 4R68A 3WP1B 2JANA 1DQZA 1NZDA 3IS3A 4QTUB 4PLTA 2OC4A 3HO1A 4PZ9A 5FTNA 2NT4A 5ERGB 5CTAA 2ZTLA 3WA6A 3WGUA 4LBYA 1HOXA 4TV9B 1FJ2A 3BWEA 5KX5B 4UZSA 3GLIE 1T1IA 4JZYA 3DMYA 4NATA 2XMBA 2J6IA 3CR7A 5F7ZA 5C8YB 3OEEA 2Q5EA 2O6HA 1EFPB 4XXHA 5DP2A 1A72A 3N7TA 1YZNA 5DLEA 3KR2A 1CSEE 1BZYA 1Y80A 2VSXA 5ICCA 2DOKA 2FA9A 4E5KA 1MMFB 4OB6A 2ECKA 1G38A 1WETA 2XI4A 4BLPA 2IBTA 3L6OO 1LBHA 1WXDA 2OCIA 3EGOA 2XTMA 3K32A 1W0KA 1KMMA 4FFVA 1BD4A 1OB2A 3DQQA 3PTLA 4AU1A 1IZYA 3O2NA 3OWOA 2OORA 2C5GA 2NSYA 4Z3KA 1YOVB 4BUZA 1ZUWA 4WACA 4A6DA 2NXJA 3H4VA 4EECA 4F3CA 5A3RA 2VYVA 5BUZA 1IYZA 3VPGA 5CA0B 4M38A 2IXAA 3V2HA 1N5IA 4P3YA 1PKEA 2WC1A 4N18A 3F6BX 1JQEA 4A9AA 5ITZB 4AY3A 1L7PA 3P4YA 2OG1A 1P6XA 2PWAA 3HJTA 2WPDA 4Q6BA 1MV5A 4ZQGA 2HJHA 2ZE5A 2F00A 2F9FA 1HYQA 3O03A 4H4DA 3OLCX 1TT5B 3OTIA 4G5GA 4UAJA 4URUR 3E2MA 4M8NE 3AJDA 5CJPA 1E9AA 1OHHD 1QVAA 1XQ1A 2J3IA 2WJHA 2YNMC 3B20A 4IDEA 4QQNA 4U7TB 5DBIA 3FVQA 4G0PA 1DMRA 4TKVB 1U8CB 3DYBA 1J8QA 3AR3A 4YUXA 5KDLA 2H31A 2Z2XA 1KDPA 2ACVA 2A58A 2YFQA 1HQYE 3CNQS 4RJJA 4QO7A 1PEKE 4V0SA 4UTXA 5HE8A 4CF6A 1H6BA 1JR4A 3Q10A 4MS4A 3A4NA 5HF9A 5BXQC 3U56A 1Y3HA 4LC9A 4FJ2A 3BGDA 5CPFA 1MT3A 2PFSA 3C8HA 4ALJA 4CDGA 4F2WA 5TQ0A 4JUAA 4B80A 4LBZA 5KTMA 1IEVA 2I6FA 4G0QA 3ZQ6A 1W46A 3KEGA 3O38A 3PL1A 1BTOA 3ACBA 2J5BA 4Q9NA 3EIFA 1NFRA 2B4YA 3H3XA 4PZDA 3LHDA 1I6KA 2GA9A 1HSZA 5C4IA 1IN4A 3MIZA 1KDYA 3DNFA 4DLNA 4BE9A 4RD3A 1BO6A 4A0HA 5A4MS 1XKQA 5TGTA 4EJ2A 3IAHA 3NKFA 1MGOA 4UE3S 2I2BA 3SIPA 1R37A 4XUDA 2KS6A 2XCUA 1BE6A 3WQBA 5AIAA 4EPXA 2ODEA 2WYIA 3TPFA 1SUWA 3UKJA 4EH1A 1I1QB 3IHWA 4ZDWA 4C1NA 5KMGB 1OBCA 2CHEA 2PBLA 3NORA 1T2FA 2VUIB 1VMAA 1H0RA 3HVJA 1YNOA 4RS4A 4JBGA 5JAQA 4KE9A 2ORYA 2G0TA 4AJHA 3IP1A 4Y6RA 3K2QA 4A2WA 3ZWNA 2XTNA 1ZEJA 2FHSA 3LOUA 4U7HA 1E1QD 1AX9A 1JLMA 1USWA 1VB5A 1Z7YA 2MYUA 2ZJZA 4JZKA 4OOFA 4CM7A 5JAOA 1J5XA 3HO6A 3I4CA 4Q7KA 3QIVA 2HGZA 4IINA 4JBWA 4JJ6A 4HS9A 1P4AA 4YFYA 5EJFA 1WHSA 1KA9H 3GFSA 3WLLA 1L4KA 3LRXA 4B2YA 3DVAA 2V1UA 2C00A 3PC8C 1YQUA 3R0ZA 4DLZA 2OCAA 3IT1A 5EIHA 1EWYA 1X39A 3E1KA 4GX0A 2WY2D 3KKOA 5GIPE 1JFLA 1GGEA 3H5NA 1E99A 1EWVA 1ZNQO 3ISTA 3W3AD 4RSGA 4M7RA 5HQJA 3L02A 5C2JB 1Y81A 2FJ0A 2OXEA 1Z6TA 2E7ZA 1L6RA 3AWIA 4NJEA 4B7XA 2SBTA 3EEFA 3BIJA 3F3MA 4W4TA 7MHTA 1A5SB 5GJCA 2RB5A 3CX8A 1X8JA 3C8DA 3ECSA 1B1CA 1GKKA 1ZW6A 4UEOA 1GL7A 3HXKA 4XGIA 1TIPA 4FW9A 1W6UA 2QDXA 4HZUB 4UU8A 4YRTA 5IW8A 1RWPA 3WK4A 5FTLA 1II8B 4XOIA 1QLJA 3GCWA 3ROGA 3ID6C 1T35A 4E33A 4BX0A 3KQWA 2DBYA 2IVZA 2FPWA 3L7BA 4YYZA 3GRZA 2GSDA 4EB3A 3IEXA 3EPHA 4UE6A 1AV7A 1CZHA 1JR2A 2FEPA 2P9YA 1GL9B 1K08A 3IRUA 4AZ0B 1T6YA 1S02A 3CUKA 3C4QA 4CLEA 1OJLA 5BNWA 2DFNA 3V6LA 5AOAA 2VFAA 3O1HB 1ZXLA 3N2GB 4Y6LA 3VR5A 5HJEA 4XWWA 2RHLA 4WPGA 3WI7A 3GC6A 1WP9A 4IGFA 3LFTA 3EGIA 4PSKA 5AUPB 3FA2A 3CWCA 4MYCA 4Y2UA 1FJGB 1K75A 1PJCA 1XK6A 3O31A 4C6RA 3NIDB 4CN9A 5BSWA 3R3UA 1H69A 4P3PA 3WWDA 2PZ8A 3BF7A 3G02A 3RKUA 4AI6A 4E03A 3GQBA 3L6DA 3DNPA 1CPYA 3OCCA 4WY8A 1KEUA 3H8SA 1W29A 5B3AA 3SZMA 1UXJA 1Y5LA 2R68A 2ZSDA 4RTRA 2P5YA 2PDAA 3D4NA 2WFLB 1NDUA 5AVUA 5I3ZA 3VU1A 1N9GB 3ZNQA 3HRKA 4NEHB 2QTVB 1XTZA 3JD2A 2INGX 2QT0A 1Z22A 3RKSA 3COPA 1ZC3A 1HC7A 5CDTA 2PX6A 3ADDA 4L7VA 3LK6A 1ZU5A 3SJ7A 3P71T 4MEAA 4ND5A 3TJMA 3EZYA 4EJSB 4C0WA 4ZYXA 2ZUBA 3RC8A 2RJNA 1DRKA 1RZRD 1OFVA 2GVDC 5JZBA 4L3OA 4OVKA 2J9GA 1U8AA 3JQBA 1KQFA 1ZHFA 1P4JA 2YDYA 4LXXA 2RHWA 1CFJA 2ZRLA 1KI6A 2CC2A 2Q6KA 4JV5B 1GT91 1ONOA 1QYVA 2H1OA 1QHFA 2VXYA 2ZUSA 4MV8A 3K94A 5ECWA 1KH2A 1V5WA 4GPTA 4TLDA 3IQDB 5EIFA 1D07A 2AF4C 4X41A 4O5AA 3CE6A 1SY7A 4EI7A 4IYJA 2EFHB 2FTKE 2B69A 2X2PA 3LHIA 1OYYA 4FXPA 4XDHA 1H42A 3U16A 5I5GA 2BLNA 4J0QA 2L69A 3B70A 3KAKA 1YB6A 2WD9A 1TFRA 4GKKB 2VXBA 3EWAA 1YZHA 1RXCA 1Q0QA 1Z13A 2RIRA 5A7FA 5AKGA 4JI5B 3B51X 3ETJA 3RVSA 2WSMA 3A2LA 3KSDO 2GK4A 5EKXA 5FRDA 1B93A 3HDQA 1V16B 7REQB 4QGAA 1C1XB 1GFSA 2IHUA 3DYIA 3AF5A 4UPVA 3DDZX 3HFGA 1E20A 2J5RA 3HNRA 4NBWA 1GOTA 4MYSA 4QNMA 4RGVA 3NOVA 4WLEA 3O8DA 3WFJA 2H7YA 4GPBA 2BRUC 4B8YA 3EXHA 3F2IA 3OFJA 1C0KA 4QDXA 5IYZB 1I2ZA 1MO4A 4QDZA 4WN3A 5DI3A 5HIJA 1U2PA 3WLPA 1JG7A 3WHIA 4CBVA 1WRBA 2ZKIA 4YJFA 1G41A 4OIMA 1C7IA 2PXHA 3DZHA 5FUYA 2D2XA 1JEAA 4RKQA 1ZHHA 2DPXA 1OV6A 2W6PA 1Y1PA 4MQEA 5CB4A 3P2YA 1M74A 1XFDA 4TTAA 3T3HA 3UMMA 1I4DD 2ZQZA 3O8QA 1IM2A 4ZOCA 1FTSA 1WL8A 3DBRA 3G13A 4YP7A 4AMBA 3UTDA 3Q1LA 2D8MA 4H1WA 5C8XA 3FNIA 2F64A 4K3VA 4R7ZA 3WRYA 4WFKA 2NUTA 4EL0A 4DR7B 4Q21A 1IY8A 5ALXA 2W6QA 1M7HA 3VH3A 1HY3A 4RXMA 2IYRA 1A7KA 1L3CA 1R0KA 3GU3A 1FSPA 1FDRA 3DUFA 4UHJA 5EXPA 5F3DA 3DYVA 1UOQA 2XUOA 1FP4B 3AEQB 3AM5A 3C7KA 4KDCA 3R7WA 2O0HA 3T06B 1FDSA 3TW4A 2UZ1A 3A6FA 3BG5A 4RGQA 1QU2A 1BXKA 1DBVO 1YU6A 2A9KA 3K0FB 2JBAA 3QFRA 4NCXA 4HZUA 3RK0A 1HRDA 1GNTA 1AF7A 2TYSB 4X1YB 4EABA 2A5LA 2FSIA 4I9GA 3EPKA 3BWYA 3TRHA 5FOWA 1GTVA 4IKPA 5LUAA 1U0BB 1O96A 1Y1TA 3V32A 3KHSA 1AHIA 4MUIA 5DSZA 2AE1A 4GKVA 4DA0A 4BO4A 5K8VA 1RWQA 1XXHA 3FOCA 1OT3A 3QEMA 1QWOA 1KP2A 2R6GA 4G24A 4IIJA 2M6SA 3C7TA 2QVXX 4A8HA 2BGGA 3J7AC 2BVNA 4YXFA 1QJ4A 4RA6A 4MHTA 2JEYA 3UB4A 3QMWA 3VMMA 1E66A 1AB6A 1K1EA 3PEYA 1EWTA 1AKEA 1AUVA 3OJLA 4LDZA 1T36A 2C88A 5JQGA 5IVDA 2LUOA 2CMDA 2NXEA 1DQNA 4N4AA 1REQB 4H0NA 2PKEA 3RRFA 1VJRA 2ONYA 2RAPA 2GM9A 2VATA 2WAYA 3GVXA 3DWFA 1VE9A 4MGIR 4CKYA 2PKXA 4EPRA 1QRUA 3VKHA 4GLJA 4F85A 2O3TA 4MPTA 3FTQA 3T3IA 3L0BA 5EC8A 1DOHA 1MG5A 3VH2A 4RV5A 4PYJA 1E1CB 1Q11A 2BJWA 1U5CA 3EG9B 3HLTA 2XEXA 3IBGA 3F5QA 4TL7A 1VJ5A 2CDCA 4TTQA 3TZBA 2EJUA 4DUGD 4YRJA 1M2VA 1NAIA 4GZLA 1AJEA 2AZMA 3D54D 2AX4A 1UKVY 3Q5GA 4CQMD 1H2BA 2BFEA 2C2WA 3P0IA 4OREX 4EJSA 1JIQA 1ZA2A 1XN4A 2BV3A 4ZYLA 2CJWB 4W5OA 3WXMA 4WKCA 1RVDA 2IEIA 5TQVA 3VQTA 3MMPA 4NICA 2CXTA 3D02A 1D2CA 2NZXA 5K2MA 4DSTA 1KY3A 4QXRA 2B20A 4QDUA 3QXGA 5H16A 4FMPA 4IDOA 5ALOA 3TLGB 3TTWA 3WC4A 1P62B 4EUSA 5CHYA 4GI3A 2QP4A 3UH0A 3OQJA 5LMCA 3IC5A 3O4IA 3MUEA 4I3FA 4AZTA 1G7SA 4Q4AB 1ICEA 4WBNB 9MHTA 2ZE8A 2XECA 4ZALA 1QMGA 2ZRPA 3PEEA 3RVLA 2AW3A 4BQSA 2XE8A 3D2AA 4AP6A 2ZRFA 4BVHA 3THRA 5D1NA 1HTTA 2ID9A 3A4IA 3I9MA 3NWPA 4R31A 2O23A 3P26A 5F78A 3ZD6A 2VT7A 2DHRA 3GJ8A 4XH9B 1ZSVA 3SZGA 1DAPA 1US8A 2Z83A 4ILKA 1QE3A 1QQTA 4ZC8A 3ZW9A 2W2TA 3LSTA 5KQRA 3PA6A 4N8SA 5EMKA 4UPEA 3EDCA 4XDZA 1ZJZA 2AFHA 4J4HA 2BFCB 4WLFA 2LTAA 4RA9A 3B2EA 1C1XA 1G8SA 2OFWA 2I4NA 2Z08A 1NX6A 3T7KA 2I66A 3LCJA 3G2KA 3R4VA 4IEFB 4RDHA 4BFXA 4B3GA 5IYZA 4OYYA 6CHYA 3S28A 1BQEA 2OZVA 3LY7A 5KSOA 3CPEA 4DIDA 4Z54A 1ZONA 1HT1E 2NZ8A 4IDBA 4I9HA 1EGHA 1N2IA 5LMNB 1TK2A 1XRSB 3AEKA 1IOWA 2GD0A 2KB0A 2X13A 3QW4B 3JWPA 3C4JA 3NYQA 3A0RB 5EZ6B 4ZI7F 3TPCA 4FC6A 2LPMA 1RAGA 4CL8A 2PT9A 3SZ3A 1NMXA 1TW2A 2ZAYA 5GZ3A 1J8YF 3NTOA 2R6R1 1T5BA 2ZRMA 2XYGA 2F3RA 1KK3A 4LIPD 2FRDA 3RUDA 3O6VA 4C4AA 5ECYA 3ZK9A 2ZSIA 3KUCA 1NVMB 1ENOA 3QTLA 4LKOA 4N54A 4YO7A 4CKEB 3FJ1A 2AJBA 4Q3EA 2Y1FA 3U17A 2BONA 2HNKA 3W06A 5FO1A 1DBRA 4ZK2A 3N75A 5KC9A 4GM0A 4HXGA 3JW8A 4OH1A 2VHVA 4QPZA 4DIUA 1TMGE 3AHGA 4Q4HB 1YS6A 3K0FA 3ZEAA 1TQHA 3ZE2B 4B71A 2ZJ3A 5AKYA 4YQFA 2IX3A 1ZH8A 2CN1A 4M21A 2G08A 3FZGA 3NAZA 1S3FA 2GOYA 2QRUA 4A7PA 4J16A 3TLCA 2GXSA 1P7ZA 3N6RA 2H06A 3ESDA 1ZXXA 3Q2OA 3OFND 4GQIA 1IMJA 4JEUA 1TVEA 2D2FA 1CQJB 3DAHA 4M49A 4TMWA 5FUQA 4Y2HA 5E8RA 5JNUA 1F4VA 3COYA 3H3JA 3VGPA 5JJLA 2XVZA 1OHHA 1TOAA 1Y3BE 2BKVA 2O5VA 2VPIA 2AJCA 4MI3A 4BKUA 1JJFA 5KTRA 4BATA 4YAFA 5HDBB 2X5NA 3QVGA 4WDQA 2X9QA 3HEAA 3SXUA 3UHOA 2PMFA 3ILXA 1Q12A 1NGSA 3QX8A 1ONBA 3WJ1A 3TIFA 3D3EA 3IA2A 1R88A 4GX1A 1YB2A 2D1QA 1NR1A 3LUKA 3GUCA 2ORWA 4GXNA 2BBOA 3I53A 2VR1A 1NKVA 2C2GA 5FL3A 1KOGA 2TMKA 4TZ0A 4H7KA 4X3OA 1OXXK 4MR9B 1FA9A 2WJPA 1YA6A 1PL7A 4KACA 4MRPA 5DHQA 3TD9A 1TC2A 4OKNA 1M67A 4WSOA 2AZXA 3LDGA 2C9DA 1JQDA 4Q0MA 4MEJA 1NW7A 1H94A 2JD1A 3EVZA 4HHEA 2G1UA 3VYTB 3FPFA 1KO4A 4YMVA 1UPXA 4ZFNA 2HSWA 2ZIGA 3BIWA 3DBVO 4TVOA 2HK9A 3M1LA 3RROA 1MABB 3MERA 5J5AA 3WSVA 5CFRA 3NXSA 1G21A 4MO9A 1JVSA 4RD2A 2CJWA 4C9BA 4PWZA 5LXTB 1NJFA 3F1LA 1LK5A 3QWFA 1SIOA 2KX7A 2Z1DA 4FZ3A 4YDHB 1POXA 5LIRA 2PBZA 5TSDA 3GFOA 1KSHA 1RBMA 3T41A 4Z4EA 1X1CA 5HUQA 5K03A 2OTCA 1P7CA 1B6GA 1T2AA 1XEAA 3PI6A 1NVWQ 3GAFA 3TKYA 1VYTA 1MW9X 3JRXA 3T7TA 1MB0A 3BSFA 1U4OA 4Q4AA 3V8MA 5IZCC 2VN8A 3A6HA 4FMBB 5LOVB 2QXTA 2VJOA 4O2AB 2FX2A 3ABQB 5KTPA 2WV7A 1JQAA 1CY7A 2BKXA 4OQEA 4FYVA 4NK5A 1V26A 5FJJA 4EK9A 1P91A 4IDQA 4OFZA 1DADA 4ALLA 7GPBA 2G06A 3BEOA 5AUOB 1E1QA 4RQAA 4KFRA 4MEBA 5I48A 5JD3A 3IJRA 3B7GA 4Z1OA 1K3FA 3AY7A 1YU9A 3ISVA 4HZGA 1JALA 1GDDA 3O1JC 3TRKA 3BT7A 2BFCA 3OTOB 1WZ2A 1B15A 3ETLA 3I37X 5DE3A 1B3BA 1H9AA 1W1WA 4HH4A 2MMGA 5ELMA 2PL5A 3DVSX 3H2JA 4KFTA 5JH7A 1VOTA 2BELA 2WVJA 3I3OA 4E09A 2J87A 1ZGAA 2E1PA 1JDSA 1X92A 2VVTA 3W3AA 4ZQBA 3C1OA 1TFUA 3ZYCA 5B6PA 1VC2A 4N0MA 1KYQA 1V9SA 1GXSA 1NC3A 4PZLA 1B43A 3AR9A 3OIUA 4XUGB 3CY6A 3G0HA 3KB8A 1SQSA 1SB8A 2J0UB 2R6HA 2X6TA 4XQ9A 1S9HA 3CUUA 1Y4UA 3EH1A 3T1HB 2CKDA 5DBGA 1TQDA 1OFHA 2I6UA 1NYTA 4NAVA 3PXEA 1XROA 5FPSA 1I3NA 1ZOLA 3CX7A 3GEPA 3ZLBA 2PO7A 4ALIA 2NYUA 1ELOA 3PHLA 2B30A 4H27A 1O6GA 3H86A 3PQ7A 2UYHA 3BBLA 2HTFA 2EFCB 1YDHA 2GWRA 4HAWA 1J4AA 1E64A 3BMQA 3FCCA 4QC2A 1GN8A 1IM8A 2QUBA 3HB4X 1KXJA 1GAEO 2R7LA 1HG0A 1CE8B 1GQ2A 3GMDA 3SY8A 3TLXA 4KR7A 1XBTA 1PR4A 2ZTSA 3SYTA 4HF7A 1RHRA 1ZMOA 1R0RE 1UC4B 5JNTA 1HSOA 3R9WA 1X7XB 4Q4HA 5BSRA 3GNLA 1PD0A 1UUFA 3PR1A 2EZ4A 1USGA 2QZSA 3T38A 3QE3A 1F17A 4FR0A 1O54A 1QF7A 5DBOA 4RD1A 1KTVA 1Q1AA 2B5WA 2P2LA 2WSIA 2J4DA 3AV3A 4WY2A 2I4MA 4NCJA 3VI4B 4DBLE 1WS6A 3K0SA 4JODA 2X14A 3ZJYA 4C14A 1Z0DA 5IKOA 3DAYA 3W8RA 3FWPA 2B1JA 4Y2GA 3ILYA 4S1VA 3F5MA 4KE8A 1OASA 4K9LA 1A4UA 1ZCFA 3JVEA 4W82A 1Z38A 3I1FA 1C30A 1C4KA 3O9VA 5G40A 1MPTA 4LZWA 1U8XX 4ZCPA 3EFEA 3LI2A 4UW9A 5LB2A 4NTZA 2FOIA 2IHJA 3QF7A 3WBJA 4CQMB 1O1YA 2CK3D 3BS4A 2CGEA 3HUFA 4LGMA 4IH4A 4PXYA 3UYKA 3USZA 5AK5A 1UM9B 4GD3Q 4K6FA 3WJ7A 1RZRA 1SC6A 2XYVA 5D3ZA 1MC4A 2Z58A 4RTPA 2UVQA 4HDCA 1E0SA 4UHCA 3GGPA 3JASA 2GX6A 3W7BA 4YBRA 4H15A 1TEXA 2CUNA 2V58A 3HC7A 4YQZA 4K40A 5LA6B 3OIYA 3N2YA 1KI2A 2EATA 2AK2A 2VL7A 1Y42X 3IAEA 3LUDA 1BG6A 3E8SA 1BWQA 1E9DA 1PSZA 2ZRCA 3QU4A 4GDMA 3PEVA 4NS4A 3W90A 1JAHA 1PR1A 1VIVA 2G7ZA 3Q0EA 4OL0A 3CRQA 3W5HA 2SKEA 1RYBA 1S4MA 4XLTA 5CCBA 3U4IA 3Q15C 3R3SA 1C80A 2ZAMA 4QRHA 1MABA 3WYDA 1WNTA 4ZYYA 4V1CI 2JVKA 1W25A 4FSDA 1WXIA 4FFPA 2EYQA 5ESXA 3T4PA 2JH3A 3HN7A 1QP4A 4NFYA 3EEOA 3EVAA 4GSYA 2VUTA 3A2MA 1BN6A 2OBFA 5AKZA 1T4DA 2GKOA 2Y1GA 2QW8A 3VAYA 4C4RA 4R5MA 2NVBA 3ZU4A 4B81A 2HZBA 1K68A 3CKYA 3FJOA 2VJDA 5F35A 3SFVA 3L4JA 5F77A 1LA2A 4AS1A 3ZVLA 3K6SA 3KBOA 4BVBA 1CF9A 3NO4A 4N5DA 2YMPA 3ZWWA 2Y9PB 1G16A 3L7NA 4RZIA 3BRQA 3WHLA 1H2RS 3RSHA 1GPH1 3JQCA 3RWBA 4M1MA 4EHBA 1JFFB 1WTAA 2B36A 5FJIA 1CQIB 4MUYA 2PGXA 4W9MC 5BR8B 3L8GA 3WIEA 4FN5A 1LS1A 5EJ7A 1ZIOA 4A82A 4WEOA 2B92A 3Q40A 4RNCA 3I6BA 3GGCA 2D74A 3IT2A 3HK2A 3FFTA 4N7MA 5IVPA 1Q57A 2E37A 4Y0NA 3AR7A 3M6XA 3LBHA 1QSGA 5EJGA 1YFJA 1TD9A 4RYDA 1KBOA 4M76B 3BA6A 3MWEB 3WL5A 2VRCD 3HBFA 1RABA 1KJZA 1VKNA 4R6WA 2EL7A 3LPNA 7AT1A 4R69A 1YASA 3G6KA 1E6LA 4YRGA 3G2NA 3RVDA 4EQZA 1QLHA 4PV7A 1HTWA 3EGDA 2NM0A 1RC0A 3O8OA 3ZS9A 3PYLA 3BYZA 4IHJF 2ZZMA 2GAJA 4H6XA 3SWWA 1HH4A 2FR0A 2Z2YA 3MJCA 2Y3IA 2PZBA 2FFRA 3D3WB 5KYNA 1QP7A 3DEHA 3OHSX 4TLCA 1Y4ZA 1KAOA 4N5LA 2G82A 4YCMA 2I6SA 1E4VA 4G9EA 4QM7A 1VJTA 1M0EA 1UFOA 1MQSA 1EK6A 4LRQA 4PAOA 4JUBA 4D8UA 1JDVA 5KIAA 1IZ7A 3IVMA 1TJ3A 1G7RA 4ER7A 4PQFA 3TLMA 1HL3A 5DTQA 5LB4A 3R24A 1CE8A 1Z2NX 3E81A 4GVXA 4HYYA 1I2MA 1Z6ZA 4H7EA 5DYWA 1IM5A 2QU8A 3PHJA 2EU8A 1X8XA 2WHPA 4CV1A 5JAIA 4YLEA 3GF4A 1N8NA 2FMTA 2GLUA 3H1TA 3GJ0A 1ULZA 1Z0KA 3UBTA 1LLQA 2PX3A 3CYFA 4N5NA 1VPEA 3OH8A 2FVYA 5EHZA 1R10A 4LHVA 5JS8A 4KQGA 4N6NA 2E1RA 2P2DA 3HY3A 3GPBA 4NNOA 9ABPA 3PJDA 1Y6FA 4C0SA 2CCJA 1NVKA 1XNGA 2P6OA 3M5DA 4EM6A 4LJYA 1M72A 3ZGVA 2QD3A 3E3AA 3WGHA 4JB2A 3BXHA 1JUDA 4DUGA 1O94D 3T9BA 2EJWA 3Q8MA 5JMPA 4CQMA 2DBRA 4MKRA 3FKSD 3R6DA 3GRPA 3CUWA 3NHAA 5LZ5A 2RBGA 3CVOA 4OXQA 3FPHA 3ZCRA 4I55A 2BBSA 1EXMA 4JK3A 4OCZA 3P0JA 1CDEA 4M0PA 2PZAA 3MELA 3TD2A 1KMNA 4DLVA 4XJTA 5EZ5A 3V9PA 3L4EA 3LCCA 3NFRA 1JA0A 3BTSA 3HHPA 1I24A 5K0EA 4ILEA 2RGNC 2YWFA 2XKJE 1R7RA 5TNXA 2EWVA 2QZ9A 4MV7A 3EXFB 4NWIA 2JZCA 3W34A 3EF1A 4HY3A 1HTBA 1YC5A 3CHYA 2ZRHA 1D2AA 2JHPA 2YN0A 4IFIA 4F97A 4M9RA 3O4RA 1GQFA 1VSTA 2PS9A 1WW3A 3VHXA 3WLAA 1MFPA 4ITVA 4KWCA 5BP7A 3V8BA 1YRLA 4JIMA 3RIXA 3IEUA 4H35A 1E61A 1JG6A 2ILTA 2OHVA 2Q1SA 4QOJA 3WYFA 4C01A 1D6JA 2JBHA 2VPWA 3MEQA 3NI2A 3U5ZB 3KT8A 5SYNA 5E6UA 5KJ6A 1QVZA 3C3AA 3IKTA 3B3FA 1IN8A 2M32A 3MCWA 4CLRB 1RR6A 3DW1X 1NBAA 2JD0A 2QRQA 3E22A 1RZVA 3RJMA 4JLOA 1SXPA 4KCGA 1PEYA 2CXRA 2O2JA 5EESA 2FV8A 5IK2D 1N6IA 4GL4A 3VISA 3RPEA 1Z5VA 1RQ2A 4C4SA 2GJKA 1B8VA 2D0OB 3ME5A 4Q16A 3SF0A 3ZZTA 1QG2A 4I81A 4BO8A 1XRMA 4BWYA 3RBAA 3RK4A 1ZW1A 1ZK2A 2CMGA 4S24A 4TWAA 3R74A 2QLJA 2W83A 4EFLA 4DMLA 1GPYA 4DVGA 5F64A 5FV7A 1P0FA 2OSBA 2YJ3A 4L51A 1AIPA 2IUFA 4NE7A 3FTCA 1K97A 3WWPA 3IKLA 4YDQA 1VA5A 1ZM4A 4IG9A 1WWKA 3DE1X 1JTFA 4B76A 1O58A 4F2DA 4Q3OA 3SEAA 4CIVA 2BFNA 1YVUA 1JQ5A 1L3BA 4XB2A 1KI4A 3EX7C 1ST2A 1W88A 1GUAA 4KHZA 5BQOA 4JBNA 1C3XA 4PIVA 5D85A 2DEUA 2QT1A 1V6SA 3F4BA 1V4BA 1XMIA 2YJGA 2HWKA 1II0A 4JFAA 1WXHA 3H2ZA 4YONB 2OGUA 3TGWA 1HMYA 4OJYA 1ISPA 3VPBA 2D5LA 4Q9JA 5CIQA 1M2WA 3DMPA 3DHNA 1ZN9A 4GOJA 1YR9A 1EDEA 4KRYA 4AP9A 4C7OA 3G2IA 4ZU1X 5KDDA 1X14A 4B2IA 3P9SA 1EB8A 4PRLA 3INRA 3NQ41 5FI5A 1U3VA 5DCLA 1FFGA 2QE6A 3GT0A 3GJYA 3K3PA 4P0PB 2HSGA 3OFNA 1V5GA 2XITA 4HDOB 3O1LA 4I9FA 4MMYB 5ES3A 5BORA 7MDHA 4JLMA 3X2FA 5CUQA 3GBPA 1F60A 3AP3A 4MQ4A 4Q24A 1R6DA 3A05A 3LS2A 3M1IA 4LE0A 3NAQA 4UVEA 1EQUA 5EE0A 3NPAA 3QA3E 4G65A 4G1MB 3OF5A 1W19A 2GEVA 2NUPA 1W4ZA 2ZS8A 1E6CA 1XLUA 1I1HA 1ZH0A 2BJVA 1RT9A 1SHTX 3PI7A 4MULA 5JSYA 1L5FA 1C7QA 2MSKA 1DC6A 2JGEA 2OHXA 5KJEA 2FRXA 4OFXA 5DGTA 4E4YA 3MG9A 1AQYA 4DANA 1O9GA 3CO0S 4C0LA 2GRJA 2QDKA 1YTLA 3KJHA 1G5PA 5AKEA 4R1UA 1K63A 1OLUA 3HS3A 4HL6A 1KHTA 3ESXA 1FLNA 4G26A 4ZCLA 1Y34E 3OFSA 1PKXA 1E60A 1OI7A 4HWSA 4RVCA 3TEMA 4F6RB 4IR7A 1K7FB 5J4VA 1AK9A 3EMDA 4IWXA 3W9BA 3HU2A 1BDHA 4D9KA 1QGZA 3IAS1 1G6HA 4QYMA 3BGSA 5LL6P 1P17A 2EKBA 3I6ZA 4OP1A 2C1EA 3CUTA 4WQMA 1T6ZA 4QOIA 1DG3A 4NL4H 1IB6A 2HSEA 2QGFA 3AZQA 3KE9A 2BEKA 3CLUC 3DDCA 3IAFA 3OKPA 1N2JA 1QQ6A 4GBMA 4HNQA 2P7HA 4QTXA 2HL6A 4U2FA 3BZUA 2MCFA 2C42A 2YHUA 4BV8A 3EFHA 1H0SA 3O9MA 3ELDA 1GN9A 1QV7A 2AN5A 3MQFA 1E3SA 2EW8A 5CK5A 4FXOA 2OBYA 5GMOA 1II9A 1V11B 1TJ4A 1ZUNA 4CNBA 1CERA 4K6GA 2GA8A 1UMBB 4X6XA 1BFKA 2HN9A 3PUVA 4MVJI 4J75A 3OHMA 3BCRA 3P9RA 4X60A 5LP6C 2PIAA 1UT8A 1BQ3A 1YT5A 2I34A 4XX0B 1CLEA 2XQVA 3QEBZ 3C45A 4P7KA 3EIOA 3PNMA 4JGGA 2XT0A 2K6GA 1E3QA 5CDSA 5M34A 4H6PA 5K2OA 4TXJA 1TLLA 1AS0A 3QKTA 2BHNA 1A2OA 2JGMA 3N2KB 3UWDA 2D13A 4IH1A 2F3TA 1Q6YA 3AIMA 1TUEA 4AWXA 3LLSA 4C0JA 2CV1A 4UVHA 2QK4A 3KOUA 1UC5B 2ZPTX 1UP7A 3B3QA 4GQBA 3RUEA 1L5LA 5AW6A 4U9UA 3AKCA 4K6KA 4OLHA 3WRXC 5IAAA 4AXXA 4JR0A 1MA3A 2BP7A 2K5UA 1ABBA 4QNNA 1SXHA 3GDWA 4FI3C 4PZUA 3WGYA 4IJQA 2R97A 1AHNA 4A8PA 4EARA 2B34A 4I4CA 1JFVA 4FJ0A 4IJKA 2CUZA 5IPFA 2PZMA 4RXTA 4HGQA 3R6TA 1Z88A 2H2IA 1X80B 2FOXA 4US0R 4JSRA 4US2R 2NV2B 5JXGA 1QH0A 1YB7A 4TWJA 1H5QA 1ZK1A 4AO8A 5HOEA 3AETA 2Y0BA 3R2JA 4RW0A 4NNPA 3DSRA 4K0RA 2WTNA 1XAGA 3ML1A 1QB8A 2LP4Y 4QM6A 2I87A 1SVLA 3E7DA 2C9BA 1BFUA 1CU1A 4JXJA 1GPMA 4P31A 4W1QA 4A5SA 3PD7A 2CLKB 5CNIA 5GPBA 3J81A 4ZYTA 3VNRA 3JTEA 1KXZA 1N2BA 3A25A 3IQXA 1FDUA 4AICA 4QJ3A 2PTHA 4O4JB 4Q00A 4DCSA 1E94E 5TQJA 5DXJA 4D9EA 4DPKA 1P31A 2CE7A 1G55A 1T5IA 1YGYA 4HQFA 2QM8A 3H9QA 4F3YA 5B7GA 4ZYUA 1R4NB 2I2XB 4N0QA 5HA5A 2PUWA 3VU0A 5L3VA 2Q4DA 4QYXA 4X8OA 3DDNA 1NBHA 1CNMA 3GNTA 5DULA 5IH3A 2X2FA 3DQPA 1YK0A 3PNKA 1RTKA 1N6LA 1JDPA 2NO0A 2HLHA 1MORA 4IV5A 4YMWA 13PKA 3D6JA 4D42A 1R4ZA 1GPNA 1RKXA 5ED0A 1XCOA 5A0VA 4KQEA 2X2OA 3GEDA 1QGUA 2KJQA 2P4QA 3KKKA 4LA4A 3RVPA 4Q9KA 1GNRA 5AD1A 5BN4A 4PS1A 3DBHB 2HCJB 2A5YB 4G5RA 3VSEA 3BWVA 5LOVF 4NXNB 1P61B 1V3UA 3I2YX 2VJNA 3F5SA 4JB8A 4CF3A 3SQLA 4PC1A 4CI0B 3RADC 2ZQ5A 4M0MA 4FE4A 4OHUA 1TM2A 3TVDA 2JAHA 1DXOA 1DFHA 3DW3X 3V55A 1KFKB 4ZKEA 1CB0A 4MB6A 1KQGA 2HU2A 4N3BA 3IXMA 4HQKA 4A73A 1IAQA 5K8UA 4IHAA 3RT1A 3T7IA 4WKPA 4D26A 1VLMA 3EBPA 1MRSA 4QEKA 1A2QA 3NNSA 2CXSA 2CK3A 2QAGA 4IUYA 2OHOA 4KMMA 3ZCSA 3S27A 3SBXA 1CQZA 3WBFA 2WWRA 3M8KA 2H2DA 3EIQA 1MAUA 1CEXA 4PC2A 4B3BA 4DRXA 3N87A 2FG5A 1DCMA 4FD3A 4HXFB 2VEOA 4HWTA 4RTJA 5ALIA 5G0WA 4E4RA 1F14A 1Y1QA 3C6KA 2WJVA 3FFAA 1G6OA 1ECPA 2Q41A 1PNRA 3ZHZA 3C4VA 3L8EA 2RJ3A 3NVDA 3M6AA 2H2FA 4TN5A 5INTA 3OPNA 2ZI6A 4BB9A 3V7UA 1XCBA 1J7JA 4KR2A 1A5BB 3ELWA 4GGMX 2I9PA 2GLXA 2QUAA 2HMAA 1WPRA 4CKCA 1Y9EA 2V5AA 1GZSA 4K9NA 3DKRA 3QIAA 2MTBA 4XX1A 1EM8B 1GRRA 4C4TA 1G9XA 1B2RA 1O4WA 4LS3A 4QTYA 4XJVA 4RTSA 3O8CA 1Y8AA 4JVNA 2GTHA 1C9KA 2XE6A 1QQ5A 4WLOA 1ODJA 3IDQA 4J7CA 4E3WA 3T6KA 4KR0A 5JDIC 5EUQB 1R15A 1U04A 2QPLA 2VK4A 3HCBA 2FDCA 2EARA 2ZT8A 2B4QA 2HRDA 2P0EA 3QFSA 3EIUA 2H65A 4FDMA 5JHGB 1QCYA 3PCXA 2NPIA 2XBLA 4FSXA 4K6OA 4YRDA 3ZV5A 1D4ZA 2RGUA 4I14A 1R5OA 4X63A 1SXJC 2IY8A 4MB0A 4N49A 3TCNA 1S8OA 4Q93A 1Q7RA 2GN4A 3F9CA 3VSBA 4D2IA 2HA7A 3FDZB 4UFPA 2AG8A 2YZKA 3MUOA 3NAMA 3TNDA 3U5TA 4RLSA 3VYUB 4WCFB 4Z3DA 4E5UA 1UQRA 1QZ3A 4LPKA 4M1QA 5B1HA 1F1BA 1JEJA 4NMMA 2OQIA 1Z2CA 2ZU6A 1D09A 4P7GA 4NAHA 1Z6PA 4DDKA 2HHCA 1TYDE 2C2YA 4CEIB 3ZJVA 1J33A 1U5BA 1X80A 1PO7A 4M4SA 1PYGA 2VRCA 1KEEB 2W8BA 4HNTA 1CRPA 1SBCA 2Z1MA 1JBKA 4KQ6A 2ZU0C 4MRAA 1KQNA 5B36A 2AMYA 2Q07A 2R8EA 3ABSB 5AH0A 2Q0HA 4TQGA 1SVIA 4PO8A 4L6IA 4N40A 4CG3A 4W5TA 3AKZA 1W4AA 2VCHA 4K6CA 5KYGA 1EZZA 4BLRA 3GZJA 2WVHA 1QRTA 2JFZA 1OLXA 2GR9A 1KH3A 1LNSA 5GV8A 1PR3A 3K2BA 2WZQA 4JL6A 4MQMA 2PJUA 4WK2B 3CCBA 5EL0A 4URXR 3RSSA 2DUNA 4MDFA 4QYWA 4P7JA 1CCWA 1VECA 1NQTA 4L4ZA 5D7BA 2VPTA 1E5QA 3EUEA 4TV8F 3BD8A 4MB2A 4RXUA 4GOXA 4LC1A 3RABA 3WSTA 4RPJA 3EPLA 1I9CA 3VO1A 1GL3A 1HE5A 2G77B 3TH5A 5C1DA 3HL0A 1N5KA 3KQQA 1NQUA 1JX6A 3RSQA 4HQRA 4W99A 3QNUA 2IHNA 2FPKA 3HDHA 5C3UA 3T9FA 1NQ5A 4M99A 3I2GA 4XCVA 1TVCA 3R75A 5E95A 1RNLA 3LFHA 4QAJA 4QU9A 2H4XA 4W7IA 4CKWA 5LN1A 5G2OA 4DV2B 3M5PA 3V2IA 3RVOA 4D4MA 4RH1A 3LT2A 5HTOA 1K6EA 2FP4B 3JX9A 2PEZA 4QUKA 3QKSA 3VDXA 4BKMA 4HPWA 1T5LA 2Y76A 1GDTA 3HBMA 4EY7A 5LZ2A 3IMEA 1Z7GA 5T4FA 4TTRA 5G53C 3MINB 1KAQA 1O94A 1RM5A 3PRHA 4L95C 4ZU6X 1T4MA 3EN0A 3RC9A 3ONDA 1KFEB 3R8XA 3FKSA 3VTZA 1ZJYA 2VDPB 3BE6A 4R3UC 3ABZA 2PS1A 2PU7A 4HXEB 4OQMA 4OV6B 1CDDA 4IHKA 4JI2B 1J8FA 5KQSA 2OYCA 1OX6A 1DEHA 3V8VA 1JR3D 2YHIA 4FBGA 3A04A 4XDYA 1WUHS 1QNFA 4GVPA 4KX3A 4E1BA 3HJRA 1HG1A 2HO4A 4I1SA 3ETGA 1PHRA 1XNQB 1HT0A 5BN3B 1GSAA 5IXSA 4MPJA 5JIBA 5ICMA 4R9UC 5LBTA 4F1JA 1Y6RA 2Z9DA 3KKLA 4D5GA 2JLAA 5KSWB 1ENZA 1R6UA 2Q5CA 3F8SA 2UZAA 4FDVA 1SZJG 2YASA 3R0XA 4D3XA 5CLFA 5BNZA 1JEDA 3L1IA 4YY3B 2HAEA 4LVUA 4RFVA 4DM3A 2X1MA 4WJZA 1V47A 1WW2A 221PA 1MVOA 2C9CA 2WKWA 3IIIA 3K0CA 1UJ6A 3EVFA 1JHXA 4NONA 5ADVA 1I32A 1ZU4A 2ZBVA 5EAIA 5TEVA 4RJTA 4JI7B 3V1YA 1LK0A 2PKWA 2NWQA 2HA3A 2UZ0A 4BZWA 1HE1C 2IUEA 3T61A 3NHBA 5AKKA 5IK2A 4K9OA 2BR5A 1BJKA 4PBRA 3X0DA 4CM5A 4D74A 1Z0JA 3OJEA 4RF3A 4AULA 1Z0IA 1NRJB 1OXBB 3DOIA 3TIVA 2A57A 4RHUA 1PK9A 1SG0A 4KSBA 5KOHB 1EP9A 1CR1A 1JIXA 1JMYA 3CGWA 1O6CA 2QQFA 1JI0A 1XZLA 2VPZA 2ZI7A 2ZIXB 3CNOA 3D4IA 4EQ6B 4URVR 4M7WA 3TTUA 4MUJA 4L27A 3PHGA 3R7NA 1V45E 4OP3A 5A9SA 2FQ1A 4BNXA 1GCOA 2QV0A 1XRQA 1XU7A 2POQX 3T54A 3CEAA 5CM8B 4MW4A 1QDUA 4ETIA 4MQFA 5ARCA 5KAPA 2GXAA 3KOWA 1SOVA 4CEIA 3ER8A 1SKYE 3L93A 4B6QA 2ECQA 4JT4A 1JTEA 2PX8A 4RCZA 1RC1A 4GICA 4FW8A 4W9NC 3S1LA 3ONFA 1E4EB 3BMCB 4QQRA 1A96A 1GEGA 3JQAD 3MGGA 2YZGA 1OI4A 1NVXQ 1GZUA 2VAPA 2VAVA 4K86A 1EXWA 1KZ9A 2BFBA 3BL5A 3ZWCA 1SVSA 3HV2A 3R44A 4HX9A 1ZC4A 3R5TA 3I30X 2C2KA 1I01A 1Z4JA 4JD5A 1DKUA 3ZDQA 2NQ2C 3NBKA 5ALLA 4EUEA 3KSBC 1BS2A 4WJLA 4I5GA 4YUYA 3KT6A 4ER5A 3NHLA 4ZT7A 4JJIA 4IIXA 1M83A 2EKLA 1ID1A 3V4OA 3OOSA 3PT5A 1UMDA 4Z2YA 2RBKA 2VHXA 2C7VA 3RNLA 5E3HA 1T6XA 4ZAVA 4JUIA 4L2IB 3UFXB 5AM5A 1JIUA 4ZJPA 5AHRA 4G23A 1Y9DA 1MJNA 1XCGB 4K9RA 4IAOA 3TXYA 2HBQA 1UF9A 1WCXA 2H92A 1E96A 1OREA 2QJFA 1KY5A 4ML3A 5L45A 3A1NA 2AOTA 2ZATA 2EXXA 2BFDB 1MCZA 3VSCA 4BNNA 1GTJ1 4ZVPA 3T5PA 1FNMA 1XPUA 2B7BA 3VJMA 2IF0A 1OIVA 4NPAA 3SLKA 4IIEA 3H6HA 4KIJA 3VVMA 1T5OA 3OQ6A 2V8BA 1IVSA 3LCRA 4X95A 3I0ZA 3AJAA 1DSSG 1FNBA 1GG2A 4NULA 5EKUA 3NONA 2DB3A 2L17A 4BO7A 3DR5A 5BNFA 2HIGA 2V5UA 2BKAA 4K0KB 2FP4A 3L77A 4F4DA 4PX2A 1KVQA 3B6KA 1QVVA 1E3JA 1GTZA 2E82A 2O8NA 4MW5A 4BP9A 2FRVA 4NCKA 3W2IA 4JQCA 4JFRA 1Z39A 3K6KA 3MINA 3I4FA 5B53A 4OI1A 5TPWB 1M33A 4XPIB 4K87A 4JI6B 2V9CA 2GYYA 3P5SA 5DW0A 4KQIA 4YREA 1W34A 4ZOEA 5J5VA 2HJGA 4Y7DA 2WUFA 2VNKA 2HT6A 1EUZA 3CLUD 3JSAA 1XDDA 4PPNA 3TDMA 4A0FA 3PUHA 1PJAA 3ZX5A 4EYEA 4H7JA 3TQIA 1SQ5A 4BFTA 3JQEA 4D98A 3L1KA 2G71A 3Q2KA 4HG2A 1RHUA 4DADA 2OMEA 2C99A 1ZNXA 2WINI 1P18A 2A33A 1VPTA 4IJ6A 1JEQB 2R1TA 2CL6X 2JKVA 3G5LA 3Q3GE 4V39A 5FFMA 3JZFA 5FUWA 4AO6A 4FB4A 5CBPB 4HN2A 3RS4A 4MR7B 2QX4A 3LX5A 1R0YA 1K8QA 3GJ7A 3GMIA 4WXYB 1O6BA 5EVJA 1XMXA 2EG5A 5IDWA 5JMWA 1C8BA 1SIBE 3U3RA 4ZV4A 1EX6A 2MYNA 1QIMA 5F9MA 5A7HA 1XU4A 3EVEA 3UPTA 2DWOA 2R8XA 3FYTA 4S04A 2ZXUA 3ELUA 5FV4A 3GLHA 4UARA 4FIDA 3U4QB 3PX2A 2Y6UA 3OESA 4D9IA 5BMVF 1Y3AA 2HSZA 4MIEA 2EHDA 5C0OE 1IJEA 2JFGA 4LOHA 1HZZC 4E2FA 3VDMA 3L8ZA 3RSGA 3SR0A 4OX9B 2D2VA 2VHZA 5JV5A 2NU9A 4QRIA 4J0JA 5EYPB 3TEFA 1WAMA 4KR9A 3ZTTA 1RRCA 4YAOA 3BFXA 2O0LA 3EB9A 3RSCA 4FR5A 4XJSA 3ZDRA 4G0MA 4O4IB 2QQGA 2ZWMA 4V2UA 1GCUA 1QYDA 2I4LA 2OBMA 1O9HA 4ZJZA 1R0WA 3K9GA 4QJ4A 5SYAA 4TTSA 1MGPA 1RAEA 3BERA 4R6XA 5M29A 3KRTA 3KYIB 2ZUFA 1C3JA 1UCFA 1UPBA 2ATIA 3G1TA 1D3AA 1E9BA 1M0TA 1YVDA 2MU1A 2W2MA 2ZT7A 3KG2A 4JJFA 4XI9A 5EP4A 3VFDA 3X43A 4CTMA 1N78A 1HV8A 2G70A 2WKSA 3EIWA 3FVTA 2F9MA 3H1FA 1OA1A 1JAXA 4RLHA 4TV9F 3RE1A 4CMJA 4F4IA 2XUIA 5KX5F 3WFIA 3RS8A 2ZYDA 2UVDA 5EZQA 2YRFA 4HQOA 4LYGA 5I4BA 3QKRB 2REXB 1E4EA 4IEEA 1WQ4A 4G5QA 4YPOA 1QG0A 2EZTA 4ISCA 4EA8A 2WMDA 5C8YF 4OSOA 3B1YA 3PZBA 1D2GA 3O2QB 4RK1A 4YCJA 1IHOA 3AHCA 2BMJA 3WMEA 3R5XA 3RNOA 2QX8A 4F46A 4F84A 4DEYA 1E0AA 2QTMA 4CM8B 1NUAA 2PUBA 2V6FA 4BRWA 5HGJA 1P8AA 4I2NA 3VHQA 4IJMA 3AZPA 3IXLA 3KZVA 3JQ8A 1WF6A 1MFZA 2BZSA 2DY1A 2C7RA 1JT2A 1SJ9A 1VGQA 2D00A 2I7XA 2D5CA 1TLFA 5LFAA 3GY0A 3P9CA 2QN7A 1MHTA 4G1UC 3TIGA 4D3YA 3VR2D 2WU0A 4HNSA 3PL5A 4MPRA 4MWEA 4PYRA 3HMQA 5CA0F 2GPYA 4X85A 1I33A 1L8AA 3W1EA 3LVBA 4L2IA 4MWBA 3WK6A 4F9TA 4O1HA 4X00A 1Y3DE 2GARA 3HCAA 1FY2A 1MEJA 2H4YA 3B6ZA 2DUMA 1S8AA 1EEXB 1TAHA 4BGVA 1DC4A 3ND9A 4FT4A 3TBFA 1UKCA 3H0CA 1GD1O 4B85A 2W70A 1LV7A 1ORWA 1NBIA 1KJ8A 1VG9B 3PF8A 5ALPA 2O3UA 3BWXA 3KTOA 5LA6F 1DARA 1YGPA 4EJMA 4FM9A 1B8OA 4KUHA 4QHSA 5A1JA 1F6WA 2ZI9A 2X8JB 3ETHA 3KOMA 4UUBA 2WT9A 4MV4A 2BGUA 2PAFA 4BQFA 1SU6A 3ENQA 1UR5A 3KVNA 3NOXA 5ECDA 1F2UB 2GD2A 3LY8A 4DA4A 2AFIE 1WXEA 1WMSA 2ZSKA 3F71A 2ZRGA 3OPYA 3TNFA 4BCCA 4MRVA 4RL4A 1Z7WA 5F21A 3FCUB 2ODNA 4M8LA 4LVCA 2A0YA 2CLIB 2YW9A 4TX1A 1JPJA 3CZ5A 4CDNA 2P4EA 4BPRA 4EY6A 5FH9A 1FMCA 1E5DA 2C8KA 5H59A 3ZCXA 3HVHA 3QVKA 4TSKA 2ONZA 2WF5A 3CN9A 5K8LA 2XUJA 2BZ0A 4B9AA 3VYWA 4OQLA 1AT1A 4BFVA 5AHXA 2WWGA 4FNAA 3JY6A 2W4MA 3UGJA 3G8BA 5AW1A 2ZJ0A 3ICCA 2FWRA 1KMCA 2RJOA 4R1PA 4R8KA 5LD2C 5HKAA 1P4SA 3VBCA 3SF8A 3BAZA 2E4XA 2CNKA 3N7UA 1T8YA 2QYOA 2UYYA 3ZY6A 2PRZA 4MR7A 3AY6A 5BY2A 1CIJA 2HQSA 4P98A 5I4KA 3DOJA 4EYQA 1F2TA 1FYFA 1MH1A 4NX2A 4KFUA 3ETDA 1NOIA 1ECLA 1YJQA 4FEGA 2HT1A 2H6EA 3U4MA 3ZE1B 5IXJA 1DKLA 4JLSA 3R9XB 3E70C 1SAYA 3F2VA 2Z98A 3EOBI 1HRKA 1UFKA 3VC7A 1BFDA 2VJYA 1DBQA 3EXEB 3IBCA 4OLJA 4ETNA 4RIHA 2IU6A 5EKDA 1ZLXA 4AUKA 2YWCA 2X1VA 3JATA 3RASA 4JQZA 1LBQA 5FI3A 3HKCA 4RWEA 4XQGA 4DKXA 3SX2A 4L8WB 1P3JA 4Q1BA 5FTWA 2WE7A 3G9XA 4L8GA 4DW8A 1KRHA 2IELA 4XVCA 5AM2A 4WASA 1T1GA 4AJOA 4W1RA 5EYPA 3UUFA 1HFJA 4P0TA 3CT4A 4BE4A 5LQKA 1NMEA 3OM8A 3N2ZB 4YRQA 3DTTA 1DCFA 1KOFA 2QZZA 4X7PA 2I29A 4IX1A 3QRWA 2Y66A 4O4IA 5B3JA 1WIWA 4EOGA 1B23P 1R66A 1JHUA 1X7WB 4WRRA 5IF9A 4TS4A 5JO9A 4RNDB 4I3GA 3UT0A 3HHEA 1EBBA 3ZHUA 3LDFA 3O75A 1L7QA 4UEWA 3CN7A 3Q3VA 2KW5A 3HYTA 3SQNA 2AN3A 1M2OA 1V3QE 4R84A 2JW5A 4RMNA 5GAJA 5T3YA 3TINA 4KREA 1TL7C 1WBDA 4AY4A 1KS2A 4XSHA 1E7QA 1L4EA 2XMZA 2YC2C 1U7TA 3D6UA 2ZZKA 3DDUA 2ZJ6A 3V4VB 2IQIA 2VP6A 1KMIY 2ET6A 3MFYA 2GBIA 2XX3A 3PFIA 4FNOA 3Q7TA 2OUKA 2HUNA 4IFEA 4UREA 3RVRA 3CZ4A 1BHSA 5KHOC 3DXFA 2Y1WA 2WF8A 4NFHA 2ZBDA 3I39X 3JD1A 3FYUB 3OIFA 4YS6A 4Z0TA 1HNZB 2IYUA 4RWZA 1O08A 2G0NA 3KDAA 1VDMA 1OI3A 2EV9A 2P4UA 4GZ3A 5DCUA 5EJ5A 5JRJA 5JSUA 1I3KA 4NH4A 3AGPA 3AVOA 3WAKA 5KSZA 2ICAA 3QLVA 4CUJA 5FAKA 2K4MA 2G88A 4FYYA 1KDOA 4PLVA 4GKAA 2Q7OE 2P2SA 2IYPA 3AFHA 3OVMA 3NM6B 2PT7A 3TDKA 2ZTUA 2QTTA 5DHFA 2B3TA 3V97A 1K5DA 5TY0A 1KYWA 1HNXB 2PR7A 1U0FA 2MINA 4HJXA 5CFPA 1NQOA 5EI5A 2C04A 1TYEB 2F62A 2Q5OA 5D86A 2XB6A 5SZKB 1L7XA 3R5KA 2XE7A 1MOPA 2AEMA 3AHDA 3IQEA 3D5QA 1J8DA 3U7JA 3WB0A 8ADHA 4I6GA 1U9ZA 1QFYA 1BGXT 2ROQA 3NWBA 1YAJA 4LDQA 4V0OA 4N0DA 3C8ZA 3UWKA 5K8TA 4CMIB 3OF3A 1S2MA 5GONA 2FX3A 3LL7A 4PPYA 5DZSA 3LHFA 4QG3A 3CPSA 3KSUA 3RRXA 5F4ZA 3R23A 4Q7MB 1FMFA 1PFGA 1HWYA 1MB4A 3IOMA 4KBGA 1ILWA 2HXYA 3FWHA 1X86B 3QTBA 3N5KA 1ABFA 3HBAA 1TECE 5TS2A 3DLIA 2V54A 1JHYA 4G0WA 1H2XA 4OSEA 4HAUA 1C41A 1VM6A 4ETWA 5KO2A 1DBPA 1BHJA 3C7AA 1W0CA 4YN3A 4B8ZA 3TYXA 4F72A 3I92A 5K3FB 1I30A 4GDFA 1NPTO 2Q5LA 2FEXA 4M87A 1UK8A 2D2EA 3ST7A 5CH5A 3VR4H 4GX5A 4NC9A 2I62A 2PX0A 3STXA 1DL5A 2VJCA 4P4SA 3RTDA 5A7GA 1CJSA 5LNK1 2VNJA 4HOYA 3E7XA 3UV3A 4DXHA 5B12A 4YJ2F 4M0UA 2WJ3A 4JI1B 2Z6VA 2WM2A 3NC4A 1F38A 3JARA 2GJSA 4K46A 2DCMA 5K6TA 5HCNA 2CXQA 4CMBA 1SIUA 2QXYA 4A92A 1SHKA 4C4XA 2EQ5A 3LDAA 3MCTA 1SB9A 3LAWA 4I50B 5EA2A 4FTWA 1T9HA 2Y1KA 4Y9TA 1A9XB 1M6YA 9LDTA 3PUWA 4Z1MD 5H9WA 5L95A 3OC0A 2QL9A 1Z25A 3MILA 4EB8A 3NAGA 4DRYA 2R1VA 2PMDA 4LOLA 4EIWA 3G59A 1RQLA 2QTCA 5GVRA 2H07A 3QKWA 4JXKA 4MLDA 1K6JA 1X87A 4PG5A 1SHJA 4DSAA 2CNNA 3PR3A 4J3FA 2O7QA 4R1MA 2D54A