3OU2A

Dhpi-sah complex structure
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
216
structure length
204
Chain Sequence
TSHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRPGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SAM-dependent methyltransferase
publication title Characterization and structure of DhpI, a phosphonate O-methyltransferase involved in dehydrophos biosynthesis.
pubmed doi rcsb
source organism Streptomyces luridus
total genus 65
structure length 204
sequence length 216
ec nomenclature
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ou2A00
5K0EA 1YUBA 1KP9A 2HMYB 1EJ0A 4G56A 2ZFUA 2V7EA 2R3SA 4FGZA 4R6XA 3BGIA 3F4KA 3G88A 3SR4A 1ZKDA 2NXJA 2OXTA 1WS6A 3KPJA 2YQZA 3GRUA 4Y2HA 2E5WA 5E1DA 2HNKA 3KQVA 3QOWA 4FT4A 3KQQA 5EGSA 5EKUA 4E2ZA 1I1NA 3EEYA 4AZVA 5K8VA 1SUIA 4RVGA 4C07A 1NT2A 3WSTA 2O06A 4GOLD 3G2OA 3G2MA 5HIKA 5E9QA 2P41A 3A7DA 1L3IA 2ZWAA 3K0BA 3LDGA 4C05A 5H02A 1JR4A 1RI3A 4EQZA 5ICCA 1VE3A 2BM8A 3TPZA 4DCMA 3BGDA 2Z6QA 1NE2A 1KPHA 4MWZA 4PYKA 5DM4A 1UWVA 5DX8A 2PLWA 1AV6A 3EGIA 4ER5A 4X63A 3BWBA 3BWCA 1G60A 4UOEA 2LD4A 3IV6A 3P8ZA 3UWPA 2YXLA 1VP3A 4RTJA 3SSNA 2EJUA 2OB2A 3FYCA 2PV0A 4GBED 3PVCA 5E8JA 1RJFA 1TW3A 2JJQA 3DLIA 1JSZA 5EHIA 2AOWA 2I7CA 2ORED 3NJRA 1KHHA 4OBXA 1FPQA 3T0IA 4PONA 2Q41A 4KIGA 5CVDA 3LCVB 4DF3A 2C7RA 1KYWA 2P1DA 4QTUB 3ERCA 3PT9A 4KIFA 5LQJA 3R9XB 5T64A 5ICGA 2UYQA 2IBTA 5EC8A 3P9NA 3UJ7A 3SSMA 2PGXA 4R6WA 3GRZA 3BKXA 2DPMA 3SVZA 1AQIA 5FULA 2P35A 1SQFA 2PXAA 2GA9A 4KDRA 4PINA 1R18A 4ER6A 5T6BA 3DR5A 4IV8A 4RTSA 3TQSA 2O05A 2NP7A 3GDHA 1M6EX 3EGEA 3RW9A 1G8SA 1JQDA 3P2IA 4RWZA 3TFWA 3GRVA 4RTPA 1PJZA 3FPGA 4RYLA 3MTIA 4YUWA 4EMSA 1R6AA 1I4WA 2PWYA 3DXXA 5DRTA 4P7KA 2GS9A 2ZVJA 3KPVA 4CKCA 3BGVA 1JTEA 4KRGA 4A6DA 5CVVA 3PLAE 4AZSA 1KPIA 3H2BA 4HRAA 4BP1A 3OU6A 3T7TA 3TLJA 1RI4A 1HNNA 3HVJA 4DA4A 2KW5A 5FUBA 5DXAA 5FTWA 3R3HA 3KQYA 5CVUA 3HCDA 1I9GA 3KR0A 4XCXA 3E23A 1JG2A 2IP2A 1SG9A 1XJ5A 3DMGA 5GIPE 2I62A 2IFTA 3ELDA 5LQRA 4R8RA 2WA2A 3UJCA 1QAQA 2YVLA 2QYOA 1FP2A 2PX2A 3B3JA 3OE5A 4IV0A 2IH4A 1NKVA 2AOUA 2QE6A 4QVGA 4ER7A 3IEIA 5E1MA 2IH5A 3SMQA 2BR3A 5F2OA 4K6MA 5D1NA 4PCLA 2CMGA 4OQEA 2YTZA 1N7IA 2I9KA 1RJDA 1U2ZA 2AN5A 2K4MA 4GC5A 2PX5A 3PB3A 4Z2YA 3REOA 3TR6A 4RTMA 3K6RA 5LQUA 1Y8CA 3DMFA 5KYGA 1ZG3A 3CC8A 3ELWA 3LSTA 3R24A 2JHPA 4BLUA 4O29A 1G38A 3KHKA 2NXCA 3B5IA 3LDUA 2B3TA 2ZLBA 1M6YA 5K0JA 2AN4A 3EMDA 4ER3A 5DXJA 1D2CA 3MGGA 2ADMA 2H1RA 4HH4A 3BZBA 2OYRA 1R74A 3NTVA 3UJDA 5M5BA 3LCCA 2YR0A 1YF3A 4KDCA 4V0QA 3HNRA 5LQAA 1N7JA 2AOUB 1D2GA 4RVFA 5KVAA 2FPOA 4F84A 5LQNA 1P39A 2PVCA 3FYDA 2ZULA 3L8DA 4CKBA 4F85A 2Z6UA 4YUYA 1VQ1A 3QV2A 2ZTHA 3GRYA 3FUXA 1VIDA 2IBSA 2ZIFA 4BP3A 3PTAA 1RI2A 1INLA 2F8LA 1NBIA 3TM4A 2CWWA 3KQSA 3EPPA 3U81A 2CMHA 2EX4A 4QPNA 5K0BA 3FTEA 1KXZA 4QDJA 3PX3A 4HGZA 5EEGA 4YV2A 1P1CA 4QQNA 3DLCA 2VDUE 1UFKA 2VDVE 5DPMA 5E2BA 2ESRA 2CKDA 2XYRA 2IDKA 3FTCA 1WY7A 4R8SA 5HILA 1DCTA 2ZZNA 4DCGA 2YX1A 4LECA 3OFJA 1SKMA 4M7RA 4WXHA 3GXOA 2PJDA 5EMKA 3MQ2A 5HFJA 4YUVA 5BW5A 4DMGA 1KIAA 3LECA 3P9IA 3AY0A 2ZBRA 1QANA 3AXTA 3Q87B 3CCFA 2H11A 5DM0A 4B17A 2YXDA 3FUWA 2PT6A 4GQBA 3VC1A 1P1BA 3CVOA 4U7PB 4FSDA 3MCZA 1IM8A 4LG1A 1O9HA 3MAGA 3DXYA 3V8VA 2PX8A 3TOSA 4M37A 3HVHA 5FWAA 5LQCA 1NBHA 4QDKA 3AXSA 5GP1A 3B89A 4HTFA 2HWKA 1X1AA 1DUSA 3EVFA 3HCFA 4PYIA 3EVZA 4RSRA 1Z3CA 2ZZKA 4KVZA 4RTRA 3DMHA 1WZNA 3HP7A 2WK1A 5C0OE 4P7JA 2G71A 1JSXA 2AOVA 4MTLA 3OPNA 2G1PA 5E2AA 3I5UA 5FA8A 3EVAA 2IPXA 3EVBA 1EAMA 3CBGA 4FT2A 3KQWA 3KPUA 5HEKA 4P58A 1X1BA 1WG8A 3OE4A 5E1BA 1YZHA 4CTKA 5ICEA 2CL5A 3FUVA 1ZQ9A 2PXXA 3CJTA 3I53A 4YV0A 4GEKA 2GLUA 4YUZA 5U4XA 4ATNA 4GUAA 3JWHA 2ZW9A 3ELYA 5EKXA 3JWGA 1XCLA 2ONZA 3MERA 3NDJA 4GF5A 3M6XA 2JHAA 1YZ3A 1KPGA 4FP9A 4H0NA 1EJ6A 4HTFB 5CVJA 3OU2A 3UJ6A 5JR3A 2ERCA 4POOA 3ELUA 3DXZA 2FHPA 3BKWA 4EK9A 1AQJA 3UA3A 1X19A 3LPMA 2AZTA 5GWXA 3GCZA 3O7WA 4E32A 4RTKA 1XDUA 4U7TB 5MHTA 9MHTA 1QAMA 2GAFA 3A7EA 2DULA 4MQ4A 1O54A 5EZQA 5FQOA 1YB2A 5CM2Z 4A6EA 1M0EA 4YV1A 3DTNA 4DQ0A 3OZSA 1XXLA 2C7PA 4M36A 2IIPA 3T7RA 3NVKI 4E33A 3OZRA 4HSGA 4IWNA 4AZWA 4BLWA 3I9FA 3M6VA 3SGLA 1DL5A 4V0RA 4C4AA 5BP7A 2PY6A 1BKYA 2UYOA 3B3FA 1MJFA 2QRVA 4C06A 5DRYA 2AOTA 2G8NA 4OQDA 4OBWA 3UFBA 3DH0A 4PNEA 2HR1A 5IKMA 4CXMA 2FK7A 5EPEA 4DM3A 3AWIA 5DM2A 2QM3A 3NWEA 4C04A 4HGYA 2Z6AA 2EFJA 3P9CA 4QQKA 2O07A 2VDWA 3HCEA 5HOQA 5GINE 4M38A 5DTQA 3DULA 5CCXA 5DM1A 2BR4A 3P2KA 4DKJA 3PFHA 3C3YA 3KR2A 4AX8A 2B25A 4E31A 3NDIA 5FHRA 3GU3A 2PX4A 2BM9A 2IGTA 3P2EA 2NNWB 1TW2A 3NVMB 3P9KA 3R6TA 4IKPA 4P7FA 5GOZA 5CUQA 1SUSA 2V74B 4RTLA 1F3LA 2B78A 3C3PA 5DX1A 3PFGA 2QRVB 4C08A 2P40A 3E7PA 2G70A 4RTQA 2GB4A 2I6GA 2NP6A 1L1EA 5K0LA 1R8XA 4Y30A 1N2XA 2OO3A 3BXOA 4BLVA 4BY9E 4OA5A 2VS1A 4QVKA 4F86A 5K09A 4EKIA 4FS8A 5G02A 5K0FA 2FCAA 3M33A 2AOXA 4HC4A 4X60A 1V39A 4CWAA 5CVEA 1RJGA 1Q0TA 2XBMA 2UYCA 5DTMA 1VP9A 1P91A 5KQRA 3KPWA 5LSAA 1IXKA 1MHTA 3NWBA 5BXYA 3KKZA 4FR0A 4GC9A 3HA3A 1L9KA 5ERGB 5KS2A 3LKZA 5DLYA 2WA1A 3FUTA 4MIKA 5HIMA 3C0KA 1QAOA 1X1DA 3VSEA 2XVMA 4GOND 2O57A 5HIIA 1Q0SA 3KQPA 1QZZA 1G55A 4WVLA 5CCBA 4AUKA 5EEHA 5P8WA 3HTXA 3MTEA 2ZWVA 3EVEA 1F38A 3HEMA 2BR5A 2VZ9A 5DWQA 5IH3A 1JG4A 3EGVA 4LWOA 5LR6A 3SXJA 2NYUA 3HM2A 1UIRA 1XDZA 5F2NA 2N47A 4X61A 1SVUA 3EVCA 3G89A 3PX2A 3FPHA 3AJDA 3HCAA 4XUDA 4AZTA 4RX1A 1RJEA 1EQAA 2AVDA 5C9ZA 4E30A 4OX9Y 3G8BA 5DT2A 3EMBA 2ZSUA 5E8RA 3FPFA 3M70A 1OR8A 1XDSA 3CJRA 5BW4A 2A14A 1ZHFA 1KYZA 2B9EA 1FJXA 1FP1D 2YXEA 5DTRA 5E1OA 4GOOD 4RVHA 4E2XA 1ZGAA 3A25A 2YUIA 1WXXA 5D1HA 5ICFA 3A27A 3O31A 3O4FA 3OU7A 1AF7A 3VC2A 2XYVA 3ER8A 1EG2A 4RVDA 1ORIA 3NMUF 2PSSA 1T43A 3EVDA 3G2QA 3S68A 4E70A 1KR5A 3B7PA 5EG5A 1VL5A 5B1SA 2R6ZA 2GH1A 3GIWA 3PS9A 3G8AA 3QOXA 2JHCA 3SX0A 3LGAA 5K05A 1JTFA 1XTPA 2ZIGA 3HCBA 2HV9A 2XYQA 2BZGA 2H00A 3T7SA 3KR1A 3HVIA 1R8YA 5FA5A 5EVJA 2XVAA 1TPYA 3NW9A 3P97A 2EG5A 3CJQA 3M6WA 2UYHA 2VP3A 3GNLA 4QPPA 2P3OA 3LCUA 1BHJA 1NW5A 1VPTA 5HZMA 4E2YA 4PYOA 1NV9A 4XUEA 3KQTA 2P3LA 2AVNA 3C6KA 5GIOE 3MHTA 2P3QA 3UZUA 4EVIA 3KU1A 4YMHA 4MHTA 4PGGA 1FBNA 3UJ9A 1B42A 3M4XA 3M6UA 3OZTA 4R05A 4RV9A 5EMMA 3VYWA 4C03A 5K01A 3EEOA 5FHQA 1SQGA 4ER0A 5EMJA 3ER9A 4CTJA 4GOMD 1G6Q1 3GJYA 1L3CA 4PYQA 2PWPA 3JWJA 2FK8A 3I58A 4PYMA 1HMYA 4X41A 3B3GA 3E05A 1XCJA 4XUCA 4PIPA 5FCDA 1ORHA 3THRA 3TMAA 4YMGA 3BT7A 3LL7A 4HG2A 5E9JA 2P8JA 4EKGA 1RI1A 3HCCA 2HTEA 2OB1A 3SSOA 3E8SA 5EZSA 3CKKA 4X1OA 5CD1A 1JQ3A 2FRXA 3FTDA 2Y1WA 5GM2A 3RODA 2C7OA 3KPYA 2JH9A 2Y1XA 1YFJA 4FSXA 1L3BA 2PXCA 3G5LA 3UA4A 2PT9A 3UBTA 3OFKA 4YUXA 3A26A 2QY6A 3SM3A 2UZ4A 3IHTA 2OPBA 2OZVA 3RIEA 5E9WA 2AS0A 5C1IA 2ZBPA 3LBFA 1R00A 3V97A 3Q7EA 3A4TA 1NW8A 3MB5A 4E2WA 2ZCJA 1BC5A 5CIYA 3BUSA 5JUWA 3TKYA 2ZZMA 5GM1A 3HA5A 3D2LA 3KQOA 3THSA 2JG3A 2NXEA 2G72A 3DP7A 3HVKA 3EVGA 2GPYA 2PKWA 1QYRA 3C6MA 3BWYA 1XVAA 5EIWA 2IH2A 2OY0A 3JWIA 4KWCA 5K0GA 1NW7A 1JQEA 2AOTB 4ZTBA 3LHDA 3TKAA 5LQKA 1EIZA 3UJ8A 3GO4A 3GGDA 2B2CA 3X0DA 8MHTA 4ISCA 2FYTA 3R0QA 4KW7A 7MHTA 4QTTB 3I64A 3OCJA 2ONYA 5FQNA 1PRYA 3DUWA 3GRRA 5KQSA 2BH2A 1G8AA 1JG3A 1WXWA 3G2PA 3ORHA 2O0LA 3CGGA 2IDJA 3G7UA 2OBFA 5EQJB 5HIJA 4DZRA 1YFLA 1RI5A 1VLMA 3BWMA 3LX6A 4P7GA 3TRKA 4OA8A 5DX0A 4RTOA 2ZBQA 4FZVA 3KR9A 5EMLA 5FWDA 3MCTA 5EOVA 5K0NA 3TM5A 5DSTA 5EIFA 1X1CA 2EJTA 2PBFA 1IY9A 3DOUA 3FPJA 3IYLW 3P71T 4JXJA 4PIMA 5T67A 1NW6A 2JH8A 3FZGA 1ZGJA 4CKEA 4PYJA 10MHA 2ZIEA 2AN3A 3LKDA 2P7HA 5K0CA 1NW3A 1BOOA 4NECA 2P7IA 3FTFA 3FRHA 3KQMA 4PCAA 4PYNA 3FPEA 4PYLA 5EHGA 2AR0A 2C7QA 3HA7A 1JG1A 4LWPA 5F2KA 3UJAA 1H1DA 3LDFA 3FRIA 3ID6C 3ME5A 1NV8A 5K03A 3GWZA 4RTNA 4PWYA 2OKCA 3LBYA 3ANXA 1O9GA 4L7VA 3FUUA 1D2HA 3G5TA 4PGHA 1VBFA 3UJBA 5DSXA 2NXNA 5FADA
chains in the Genus database with same CATH superfamily
2NSYA 3HRIA 4BMDA 4ADSG 1MAAA 3OPYI 1I01A 4PAWA 3IL2A 1NC3A 3HDTA 5KOIA 3EGDA 4E03A 1U65A 3TZKA 3UWDA 3HB4X 1GZ6A 5FLEX 2G7ZA 1QTIA 3U7QA 1F0PA 2NXJA 1FUUA 1H65A 3QK7A 3C5WP 4HDSB 5KBYA 1O6CA 3R40A 5AK6A 1TO2E 2JH3A 8ATCA 1I1NA 1L4EA 1IPEA 1Q22A 2O0KA 3HKEA 3U5ZB 3HI6A 4LF5B 3QELA 4MI6A 3M1IA 4BO8A 1R6DA 4IVNA 3GUUA 4XI9A 4HYTA 3PDCA 5DHAA 4IDDA 5H02A 4IHKA 5HRCA 3B9RA 1X7HA 1XHLA 3BGDA 3FNIA 2HIGA 3WHIA 1K75A 1MV5A 1P1RA 3BQMB 3Q7IA 1EA7A 2ZB2A 3CNBA 4B5LA 2OTCA 1FNCA 2CFCA 1RAIA 4X63A 4A3SA 4EHAA 1P77A 1K8ZB 1VLHA 4MCIA 3N2YA 3O75A 4N9WA 3A9RA 4G0QA 1L1FA 1Z82A 5IJXA 2Z4TA 4G26A 1DAPA 2QR3A 5AK4A 4E5YA 4JFRA 1ZD1A 1JT2A 5T5QA 1JDZA 3IXQA 6Q21A 2QHXA 4TS1A 4KO1S 3MGBA 2P75A 3K53A 2C7RA 1TYCA 2I3ZA 2HQOA 1BXRB 3O8NA 1N9GB 1VIMA 2C4HA 3HUFA 5DN6A 1ADJA 2ZI9A 5M29A 2L0XA 4WKBA 4OMDA 2C2WA 4ZVSA 1MF7A 3UJ7A 1ZNXA 4XYMA 4JSYA 4Y6RA 4K9OA 3U80A 1LLCA 1UBKS 3TDMA 5HSGA 2IVZA 2AUNA 4JJ7A 2Y9MB 3ANSA 1STOA 1WMSA 3DTYA 4ER6A 4FYKA 3K31A 1J2RA 3NBXX 3RUAA 1YV9A 2HTFA 4FFVA 1KO4A 1TJ4A 3VU9B 3C6QA 3CPEA 4EARA 4MRNA 4RJTA 4RWZA 4FZJA 1P45A 4JOBA 1BD3A 1R6AA 1P2DA 3T7KA 3EFHA 3T1NA 4BL5A 1GPJA 1D5WA 4FFLA 3K0CC 4DREA 3ZWBA 4JIMA 1ORVA 1XEAA 3S5JA 4WJLA 1D2MA 2LE0A 3VR4A 3JQAA 1V6AA 3NCHA 3I9V1 3SFVA 5IT9A 2DQKA 1Z36A 3QX8A 3T7DA 4DDKA 3D8TA 1UK9A 2XMDA 4BWYA 4REQB 3WY9A 1CJKC 1T9AA 3HCDA 2PFGA 4B7CA 9LDBA 4BP8A 1SG9A 5JCJA 4M60A 1R1DA 4FR5A 1HT0A 1PQPA 1TEXA 1KU6A 3GHHA 3HJFA 4B7AA 4TYNA 4IRUB 2I91A 3OE5A 4E09A 1MB0A 5KKNB 1K92A 1E4VA 3C7KA 3MIIA 4ZVLA 1BJRE 4LTDA 5IKEA 3PFFA 3TCNA 3KSAC 1XRMA 1M72A 2HHLA 1K6IA 1V1RA 1Y3FE 3INNA 1JLHA 1CC1S 2D2EA 3L6BA 1X7ZB 2O3QA 2J7PD 2SICE 3R0VA 4RADA 4YPFA 5TGDA 3WLPA 3J7TA 1P5FA 3AETA 2BW0A 3O8BA 2PMWB 4Q3AA 2OM2A 4R69A 2VAMA 2WIAA 4M9UA 1NF3A 1B0PA 3CEAA 2FEPA 2YWGA 3MWJA 4RL6A 3SZGA 2V6IA 3UWKA 3NS7A 3ZDXB 3PGA1 1SBQA 2TRSB 4IZ6A 3HDJA 5TMEA 4F97A 5BOSA 1YCGA 3RRNA 2CK3D 4JBLA 3RU2A 4PZUA 2Q62A 1NBMA 1VKHA 3S2IA 5DZSA 3GLIE 1CUHA 4V0QA 2B99A 1PDWA 1JPUA 4LJ6A 2TECE 1DBVO 5KVAA 2BHLA 1DRVA 2FEWB 2FPOA 4KO8A 4F84A 3EY9A 3R41A 4LJSA 1IN1A 3DZBA 3K9BA 4Q6BA 4S1PA 1UXKA 2AJ8A 4MRVA 3HSSA 2R1TB 2FN4A 2JW5A 4B8YA 5ELXA 1DOAA 2YIMA 3QTTA 1K97A 4CGYA 1FU8A 2CVZA 1NULA 3KC2A 4E5KA 3DOOA 5KC9A 3TCXB 3TWOA 3LL4A 5FT9A 4H3VA 3QEAZ 4BWVA 4RDCA 2JIPA 3KL4A 1AXEA 1M8GA 3FPSA 3FDJA 3GLIB 3DMDA 3RU9A 3G0BA 1WM1A 3HBAA 3KAJA 3VHQA 2VF4X 7REQA 3HJTA 4RUKA 4C0BA 3MJTA 1WNFA 4MPTA 3U3KA 4MV1A 5ALGA 3IESA 4WXHA 3N6VA 4DSAA 3RS4A 4AW9A 2WINI 1L5VA 5FH9A 4MJ7A 1KIAA 4B3GA 1T0JB 5TMDA 1AM4D 4AJNA 3Q87B 1GAWA 2PKQP 3MINA 4D4LA 2L17A 3FETA 3D5TA 3W2FA 2PT6A 2PMBA 5ED0A 3LBIA 2Q2NA 4R2IA 5K6TA 4MB2A 1N78A 1Q1GA 1KOFA 1RAHA 3FFXA 1FLVA 1XSEA 4HD8A 4BV2A 4E11A 1Z38A 5BWNA 3FTQA 4LOHA 2GBPA 4RULA 3CKMA 5JANA 1PGQA 2YW2A 1U7ZA 3E9CA 3K1TA 1LS1A 4G5QA 1XD2A 1SU8A 3QFHA 3VZSA 1Z4OA 2OO5A 2A0YA 1JBQA 3IAHA 3AMVA 2OFFA 7ABPA 2NV6A 3PR1A 4GRIA 4XX1A 4KSYA 1Z5ZA 6PFKA 3E15A 1W5BA 5SYAA 2WFLA 4B6OA 5JCOC 4KVZA 1AK1A 1ZMRA 2A1UA 3M49A 1JQ5A 3OH8A 1H2RS 4K3VA 4P7JA 2I76A 4ESHA 2ZP1A 3M89A 4XDYA 3WLAA 4A1FA 5J4KA 4INOA 1HFEL 5H83A 2O1EA 1M6VB 2IPXA 4NPCA 4A0FA 5KZMB 4UBJA 4D97A 2VJPA 4KO3S 1MNAA 2ZIUB 4BGIA 3NM4A 1UBUS 3BXGA 1EGHA 4I50A 5FUXA 2AG8A 2KWIA 1H5NA 1LI5A 2H08A 1I2MA 3PENA 4RDXA 3K6SA 3TSZA 1ANKA 2D5AA 2ZE6A 4X9XA 1K4KA 3OIFA 4MEJA 4PFSA 5DMHA 5FI0B 3VUEA 3JWGA 4RETA 4XGNA 5I5GA 5J63A 1W30A 5SYMA 5AVWA 4NZYA 1USKA 2QVGA 4IOLA 1QG6A 3NOXA 2E7ZA 5FWXB 1QLJA 4C5BA 1ATIA 1Z4PX 3IPLA 3S2FA 3IEPA 1E3QA 4I50F 4Z5XA 5ALSA 4LZOA 2ZRMA 3MT0A 3L4KA 1KZYC 1OFIA 2LPMA 1XDUA 2WTAA 4GOJA 5MHTA 1P0QA 1PNQA 2DWUA 2XMCA 4X44A 1KBOA 1WPXA 2F9LA 2OBNA 3BTVA 3ORQA 3RUPA 5CM2Z 4UMVA 3WQQA 1DTEA 3DTNA 3GVHA 2YV2A 4ALIA 1MO5A 1YVPA 1VSUA 4CR7A 3VM6A 2VPXA 5HTOA 4F9EA 2HDHA 4F9GA 1XKQA 3QVTA 4RIEA 3NDBB 8AT1A 1K6XA 1BKSB 3GJ5A 4LVNA 5DW0A 1FQOA 4D8XA 1Y63A 3DD5A 3TBHA 3ZD7A 1QUFA 1G3UA 4RWEA 3KUXA 3EA4A 2DWOA 2EWMA 4JBIA 4M1SA 2Z6AA 4PX9A 4IUBS 3HNOA 1CQIB 1NF9A 4XWTA 3U16A 5ALDA 1GCAA 1NJFA 3X3HA 4D43A 3IV7A 1DIOB 3ABSB 621PA 2IZZA 3K8YA 3GT3A 4FCVA 5AXCA 1GZDA 1L7XA 4X64B 4A2QA 1C4KA 3IOCA 3NOQA 2DFNA 4OQNA 3ZZUA 1YB6A 3IPXA 4KEAA 4WK2B 1EWTA 1HLPA 2XIQA 3WRYA 2I7VA 2BM0A 2C83A 2CF6A 3C3EA 3FOAA 5ER9A 2AT1A 1NZFA 3HKDB 3OPXA 1E9VA 1VRCA 4CMIA 3C3PA 3L92A 1ZNQO 4RH1A 1SJ9A 4P3NA 3UMCA 4WCVA 1SELA 3TGPA 4ZC1A 5TR9A 1GPUA 2AL7A 1QX3A 4HPJB 1L1EA 4OHKA 3BWEA 3TRIA 3JD4A 1HNZB 3NDRA 3O9ZA 2VAWA 3V42A 3A0UA 5F1KA 3E3MA 1V3VA 5AI0A 3SVTA 3A28A 3D0QA 2HY7A 4I1RA 1Z75A 5EP2A 1YVDA 2YRXA 3E0QA 5DBIA 5CVEA 4LF7B 1O6FA 5KNLA 1BDIA 3A6JA 3DL4A 2WSSA 4EQ6A 3NV9A 1AD2A 5TT0A 2NO7A 1L5QA 4P82A 1JWAB 1GTRA 2WFMA 1MB3A 5CK5A 1TQ2A 1T8UA 3RKRA 4LPSA 4Q1DA 3HA3A 2H5LA 2P78A 1X3SA 1XCOA 2P0YA 1E8DA 3G9ZA 1UM8A 2IC5A 1QAOA 3Q3GE 4NOJA 1B93A 3WXMA 4BKPA 1DADA 4QLBA 2FPUA 2HWXA 3MGCA 4KODA 4R1TA 4R0MA 1FK8A 1OD6A 4Y0NA 4YT5A 4AUKA 1J2EA 5K3DA 1MU0A 3V1KA 4XYEA 3E4CA 4FOLA 5D86A 1A50B 1ZM7A 1XDBA 2BKAA 1QFXA 1Q16A 4L9SA 2VBGA 4PNHA 4H0FA 1ARZA 4WOKA 2HOQA 3STYA 1DQSA 1MNQA 2HSEA 4IIJF 1FYFA 1T2AA 2WQ7A 3IAXA 3G89A 4LI3X 2QPAA 5CDUA 2PS9A 1NDHA 1TZMA 2EG9A 4AZ0B 2GBFA 3Q3CA 1ETUA 5A5VA 4ZARA 3LBHA 1H2WA 2DUNA 4LPKA 3AL0C 5K4GA 4A91A 3E5NA 3DZDA 1KZ6A 2J09A 1JFRA 3QUCA 1JPJA 3EYWA 3X1WA 2ODPA 3QLJA 4DCUA 2X4GA 2RHLA 3CMMA 3IPYA 1ITZA 3IQHX 4LMAA 4R9UC 4ZCMA 5KAPA 1PVVA 1ZSVA 1A1VA 3RVPA 2Q2WA 3PQDA 4TN1A 4FZ3A 1VG9B 5IAKA 4UU8A 1C1DA 1IXYA 1ECLA 4GPBA 2OCXA 3IP6A 3P0RA 2JD1A 3HYSA 3RO7A 3SX0A 1EUDB 1MC5A 1M1NB 4AO8A 1SBZA 2YNMA 5KJ1A 2QD5A 3MCUA 4DJTA 3JZFA 4FFDA 3KJFA 1HETA 2P6OA 3OURA 4K3UA 2LVBA 1WUIS 4I5EA 2NU6A 5EUQB 1LQTA 2UYHA 2CB0A 3WLNA 2WWHA 1O94D 1Z39A 2VF8A 5ALOA 5CH5A 3QX3A 1XYVA 3MTGA 1QH1B 1HQDA 1T8PA 2XMQA 1PJSA 3MAAC 4WOJA 4ZCLA 3ZDYB 2YJGA 1HDGO 3WYCA 2VYND 3CSDA 4L75A 1PV2A 2ZRFA 4OU4A 3GNQA 4RD2A 3W2GA 4TYMA 3LAWA 1AV6A 3EXFA 1QP4A 3MHTA 3HWRA 3TI7A 5B6JA 4HDKA 3PWTA 2ZWPA 4O2BA 4XOUA 4AJHA 4B46A 1S7CA 4BQFA 1YWGO 3PGLA 5K6RA 3EXIB 1Q84A 2BFBB 1ZGBA 2RHMA 3G85A 1KS2A 1AGYA 1G21E 3IRUA 3O0TA 4Y9UA 2FK8A 4UHHA 4XVRA 4O2BF 3GLHB 3C4QA 1JAHA 2G07A 3Q5GA 4BS9A 2FLVA 1VKRA 4DR5B 4CM3A 2JJ2A 1PFQA 3M81A 3OLVA 2FV8A 3NHBA 2WUWE 2VQSA 5PGMA 5JI3E 2AQ8A 1RPAA 3CB2A 1UR5A 2X86A 5IBCA 3VBCA 3L1HA 1X0VA 4EY4A 13PKA 2FPIA 4YMTA 3KHSA 121PA 2QY6A 3T4UA 4NS1A 1E5LA 4G37A 4QUAA 4UMEA 1Z68A 5C1IA 4YMIA 3NKFA 4ARIA 3TDNA 1HZZA 3VR5H 1NW8A 4P08A 1MO2A 1EWQA 3FFTA 1U8EA 1IQUA 2V9PA 3N3AC 1Z8DA 4RLHA 2Q27A 2C5BA 3D2LA 2PXHA 3X2FA 3KP1A 3IOMA 1X7XA 4CF6A 3FYTA 3WL4A 1XVAA 4ZZ0A 2HMSA 4Z86A 5EE9A 2B98A 3LHDA 4L7QA 5HGXA 1GO2A 2ZJ4A 1Z06A 2C88A 1L7QA 4ND4A 1Z2DA 3X0DA 1NTOA 4Y2XA 3RYCA 3BIFA 3SFZA 3ZBQA 4QYMA 3CT6A 3W2IA 2ID4A 1ZD3A 1JG3A 3RFCA 5E0KB 4JH0A 4RVSA 1JQAA 5JQGA 3R7WB 2DG2A 5CYOA 4DARA 1KL7A 5JAQA 4N0MA 3THYA 2VP9A 1OY1A 2YW9A 4Q9NA 4N40A 1SG6A 3D6AA 2JBAB 1G2IA 2GN1A 3JALB 2RGDA 3WGZA 1NW6A 3GQBA 2ZBEA 3OLCX 3KG2A 3CLTC 3KWFA 4FJ0A 2B4KA 2XA1A 1OASA 1U7HA 5EN4A 4E07A 5I7RA 5JQGF 5ALZA 4ALLA 2GCOB 3HYNA 5LFAA 2WIFA 1FU7A 1QKKA 1U28A 4O4IB 3VSBA 1E1QA 2YINC 4GR9A 4QICA 3QIAA 4QODA 3IAFA 4V02A 1ISIA 3A6DA 4MUXA 4YBZA 1SOAA 3RR2A 4EUNA 5K3OA 2FR1A 2OWEA 4L7VA 3EOAI 3I6ZA 4QUKA 3KD2A 3HXTA 3JQQA 4X6LA 2MSWA 3BAFA 4JL6A 4Z6KA 5L3ZA 4BLRA 4HH0A 1J20A 5HRAA 1YUBA 2B35A 3H5LA 3QPCA 4FOOA 3RHFA 4QUHA 4W6ZA 2ZIXB 4MQBA 3ODGA 4NKRA 4ARBA 5ADWA 1DKPA 1KJQA 4RD3A 3WMFA 1P2GA 3QUSA 1DIAA 3DEKA 4D82A 1CW2B 1G42A 1L8LA 2ZCUA 2R65A 3FR7A 4JEHA 4FIZA 4M0FA 4LYAA 2AFRA 2BFWA 2X4DA 3WDSA 1ML4A 1TX4B 3H9BA 3T3HA 4S24A 1EZ4A 1T8SA 1DBPA 5BOVA 1CS0A 1JVSA 1L1QA 1YFZA 1A8HA 1DC7A 2WFAA 2XKJE 3CXUA 2WPDA 4G5SA 4ZVOA 2AJLI 3D6HA 3BCSA 3VR3A 1JU4A 3FCOA 3KXKA 4X3OA 5G0WA 2QRJA 1N5LA 3CUKA 1SH7A 4EATA 2VJOA 1JXMA 1J23A 1YDMA 1SBYA 2O2IA 3PD7A 4EHKA 2PN1A 2YN4A 4F4CA 1TVKB 2QT9A 3G2HA 4O25A 3RDPA 3GEGA 4YBRA 3UPTA 1BE1A 2H17A 2HGSA 3GJXC 2ZRIA 4KOEC 3P8ZA 1Q21A 4DXHA 4ZHQB 2QG6A 3B2QA 4CEJB 3IAUA 3RNOA 4B75A 1O4WA 4R3NA 5CXUA 4RFLA 3RAEC 4CDMA 1W0KD 2DHDA 2ZBUA 3ZCPA 1EAYA 2GHTA 3QXGA 1NNEA 1FTQA 5SZJA 4URUR 5BSRA 4EZIA 2HF8A 3JVUA 5LYYA 3T0IA 4EKDA 1ZWKA 3UJHA 2VCYA 2PIDA 4RA6A 3D5QA 1QE0A 2Q7DA 1UDAA 1RQPA 2PKXA 4LSGA 1C9KA 3NKLA 4EG6A 5T3YA 1G64A 3LTNC 1MQ8B 2IV2X 3HWX1 4GI5A 1OFGA 1YAHA 1GZ3A 3WL5A 1L5ZA 3A1SA 3DCYA 4FC6A 1N2SA 3AUAA 4TSRA 3M6IA 2H1LA 1TM7E 1FQWA 1QIMA 4JQYA 4K2HA 4ZCQA 5JMOA 4WNCA 4DDTA 4QO7A 2DPMA 5JRZA 3SVZA 2G5GX 2J59A 5FULA 2LIPA 5CJ2A 3C85A 3SX4A 1YL6A 2J5RA 3DTVA 2GAAA 4MGZR 3QPAA 3KZOA 5EFZA 4BMPB 1XC7A 1X7DA 2DLDA 1TZ2A 3EGEA 3PNBA 1XL1A 1YZLA 3ACBA 4NARA 5AMXA 1PCXA 2YXBA 1NAIA 3ZLVA 2QLTA 4B09A 1P2UA 2INGX 2I2BA 4UHBA 5KDOA 1LBTA 2EIXA 5KVSA 1L6IA 1H6CA 5CFZA 4C6HA 2YYSA 3OIYA 3CUTA 5E6UA 1T6XA 4MJXA 4AG5A 4BMYA 1E2BA 1XCBA 3UT5B 1HA3A 3LUHA 4BNDA 5BQXA 8ADHA 2QSUA 3ASYA 4CCSA 1D03A 4UC0A 5FUBA 3HP1A 4FMPA 3W7VA 1X14A 3S55A 4O5AA 4QDUA 4RM3A 2SBTA 4Z99A 3ZQ6A 3CTPA 1QAQA 3G2KA 1NQXA 2PZMA 4MV0A 4LNUB 4OI1A 4AT1A 2AOUA 5EHNA 3K73O 5D84A 4Q4JB 3EPLA 1Q1ZA 1BSVA 1TKCA 2F48A 2VI5A 5EWJA 5F2OA 1N33B 4R0NA 3FKSD 3OT5A 4YACA 2FJ0A 1OZGA 1RBZA 1U0LA 2FUG6 3WLMA 4KI7A 1KWKA 3IB6A 1FXUA 2VKTA 1OX4B 1GKIA 3K6RA 4UUAA 1JHUA 5FBVB 3IUJA 3KS9A 2IYLD 3CC8A 4JI1B 3H75A 1M8FA 5HFNA 2ZJYA 4ZO8A 1N5KA 4M0KA 4Z54A 2Q6KA 721PA 2PE5A 3NALA 3A36A 3EZYA 4WVFA 2ZAOA 2I0FA 1KU0A 5CLHA 1NQTA 1RP1A 4ZO6A 1WB6A 3UJDA 5IT5A 4R8MA 1NBWB 3BA6A 1N8SA 3CWQA 4YCLA 5CM9C 4DT1B 3PC4A 4RJ2A 1NKTA 4Q9AA 1B43A 2RH5A 1OIWA 1P19A 3Q12A 4CKWA 3TNJA 4HADA 4JZKA 1LI4A 1QRSA 2BMVA 5HUQA 1KE2A 5CDTA 4RPLA 4YUYA 2W42A 2IZ5A 2Z3WA 1KFBB 3DKKA 4KGVA 4B3RB 1SG0A 3PTAA 1E98A 1AOXA 1XB2A 2E3JA 2RKWA 4MUAA 1ODLA 1OF1A 3IUYA 3T9BA 3G5AA 2C7GA 3DPSA 3TZBA 1Z17A 1ECFA 1KXZA 1T2CA 2PTGA 2R5NA 1P4HA 2CV1A 1C1HA 1XWWA 3S1AA 2IS6A 3RVQA 1EFPB 1D7AA 3KV1A 4XD2A 5H3LA 3W34A 2GVDC 2CKDA 3E7WA 4Q4AA 2A3RA 2ZAGA 1TJNA 2BOVA 2LDBA 4HUQA 4HS4A 1RTTA 3MMNA 1TT7A 2YJ5A 5CDFE 2OBXA 4JKOA 1E20A 2WF5A 1GQQA 3MQ2A 3KVVA 1UMKA 4MAMA 4AJ4A 1SHLA 3DDCA 4JI6B 3SEFA 4KYVA 1Z6GA 2YXDA 2G82A 1II9A 2PLAA 3PRKE 4KXYA 3VAYA 1T0BA 1KGDA 2LCIA 5CJPA 2O8CA 2ACKA 3ENNA 2R6CA 3GPBA 4ISBA 4KWHA 5ITWA 5LWHA 2AX3A 4V3BA 4IM7A 3V1LA 4UAVA 1FYEA 1O95D 3OIGA 4Y9DA 4YCNA 1ZW1A 3WAKA 3GCXA 2D0IA 2PDAA 4G0UA 9GPBA 4ZEWA 4ZT3A 4K26A 1IHXA 4R1MA 1PFKA 4IQFA 2C2ZA 4AKGA 4PBSA 1URPA 3PC6A 1W96A 1I7QB 1JKMA 1OBFO 3L82B 5I4KA 3IAS1 4KIJA 4XUGB 4Y9TA 1T36A 4H7KA 5ECYA 3UHFA 4A4DA 4H7FA 3E22B 2HIAA 1MX1A 2HEGA 2G1PA 5HOEA 4HQKA 2C97A 5F4BA 3AFGA 1DKUA 1K5GA 2JA1A 3KQWA 3KV3O 4X6XA 5E3JA 3U7IA 1C1YA 3WV5A 5BSKA 3VZQA 4DR7B 4N8EA 1WULS 2XDQB 2L42A 3CJTA 2AYZA 3I09A 3M82A 3RB8A 1Y3IA 5BN3B 2QRHA 5GTDA 2DEUA 4EYQA 5AW8A 3GEBA 1B8OA 1WY5A 2C99A 5E4TA 4BNZA 4TZKA 1XTBA 1WD7A 3B12A 1PT7A 4MKGA 1YZ3A 5HA5A 4AX4A 4HTFB 4D9MA 3I3OA 4HJRA 4I55F 2JFGA 2C31A 1HRKA 1NJ2A 2PZ8A 4ILEA 4MVJE 1WW3A 1LPPA 1ZM4A 4JODA 4JL8A 4G5FA 3FNHA 2CYCA 2OVFA 3JR3A 2X15A 4U7TB 3MJEA 1HEUA 4NNPA 3L7AA 4AYTA 4C7KA 3MUOA 2FLWA 3ETJA 1D4AA 3O5AA 4RJLA 3A2LA 2EJVA 2ZBVA 2HQ1A 1QO7A 5TF4A 2NVUB 3T7RA 4BFTA 4N47A 2AC2A 1HSZA 2QA5A 4QQFA 4JB3A 3AUXA 3I2KA 4ZK6A 5IG2A 1KR2A 2GN2A 4JA0A 1ACLA 1QH0A 1AB5A 2ZKLA 3LP5A 3NIFB 3GJTA 3WIDA 2POCA 4NOKA 3IQWA 3JS5A 5ALXA 2QXTA 4J3NA 1R9NA 4XE5A 4CXMA 2FK7A 4DSZA 1JEQA 1FX0A 1DO2A 1WZIA 2QTGA 1FUKA 3I2IA 1T2UA 3OOSA 4YQYA 2AMFA 2BEJA 4MWGA 4PLZA 4QQKA 2G77B 3AG6A 4IJUA 3DKRA 1XRRA 3WLIA 3DULA 2FOIA 3F2VA 1KI2A 4OFXA 4FQ7A 4R83A 2OFOA 4R68A 2X4LA 3E35A 1CJCA 3H8SA 4MR9B 2QVBA 4AF8A 4BMSA 1YASA 3RK4A 3WZLA 1HE1C 2EJBA 4NH4A 3EEQA 5CT5A 3VHXB 1ZA2A 2PZEA 2ST1A 3B7GA 1FEZA 4NU8X 4R9VA 2C9BA 4B5KA 4EGQA 3DZGA 1T5SA 3U26A 4B85A 2OENG 3IC5A 4MA4A 4RTLA 3AT1A 4EMTA 5ER6A 1HC7A 1KH2A 5AESA 3W5AA 1R12A 2JLRA 1U2DA 3D1VA 4HZUA 4GSYA 1YR7A 3BRSA 4QLOA 2QBYB 2V7TA 1R5JA 2OOSA 4CDGA 1XX6A 1NQUA 2OO3A 4O63O 4QEZA 5DHSA 1T5HX 4JX8A 4EKIA 4F86A 4DOMA 1E0JA 3EN0A 3QKRB 1W8IA 1WCWA 4TLEA 1MLDA 5BSTA 5DBEX 4MWOA 3ZWWA 3DE3X 4DDHA 1W36C 1F12A 5A0FA 1JJAA 3RC1A 3ZE8A 2POQX 1R6TA 1U3GA 2C2MA 4HQRA 2FPGB 2WWGA 2PGLA 4ZTZB 5FOUA 4PLPA 3A2KA 3CLRD 4N7MA 2XUFA 2QIOA 3OX1A 1YJCA 3CX7A 3IP7A 4WESB 1HNXB 4WBNF 3JD3A 3O47A 4GOND 1PDVA 3DC7A 4NENA 1JX6A 2OSBA 4RANA 5D6OA 5D01A 3ZBPA 1QPGA 2P9EA 2ZWVA 3H6KA 3VRHA 1BCSA 4OH1A 2NUAB 3H4MA 4V1CA 1QS0B 2DKOA 5ALPA 4I1YA 4LWOA 4LY3A 4OQYA 3FCEA 4EHJA 2P69A 1P7YA 1MVOA 2O8EA 3NPMA 1XDZA 3HY4A 1IPFA 1Q6YA 1WPGA 2J48A 3GC6A 3M6AA 3PCXA 4XUDA 1DC5A 3HCAA 2GAJA 2P2NA 4HVTA 4EHHA 1XL0A 5E8RA 1HTTA 3S70A 2BI4A 2IYAA 1DEXA 1XDSA 3CJRA 1E9DA 3PQCA 5AKXA 1UUFA 2A14A 3D0OA 4QULA 3A4YA 4CR8A 3GPCA 1HZZC 3AK4A 3R5FA 5DBFA 4ZRDA 4HQOA 3EWSA 3IMEA 5DTRA 5CFRA 1KJYA 1O4VA 4QPDA 1GPBA 1SU4A 3A25A 2YOFA 3WAJA 2SCUA 4OHFA 3CX8A 2I4OA 4TMYA 3OP1A 1QV6A 3E2MA 4NPAA 3IT1A 5GZ6A 1P5HA 1CQJA 5J5VA 3SEQA 3J81k 5AKZA 3AI2A 3MWEB 4AY3A 3AHJA 5ISMA 1I5OA 1NVDA 4O4LB 1VKJA 3GFTA 1PGJA 4E70A 3OIVA 2HHCA 1VL5A 2W2TA 3R6GA 3P32A 1AV7A 4WTOA 1LLUA 3QMVA 1GSIA 2BZGA 4JGBA 2O3SA 5HF8A 1MR3F 1TJ5A 3VYTB 3GD7A 4NICA 1UQRA 2PT7A 2VXOA 3VO9A 1U11A 3ZLUA 2HI0A 2ZPUA 2X19A 2H2AA 4YLGA 2ZTUA 4YO8A 1WSDA 2VP3A 3TQOA 2AV6A 4GECA 2CEAA 4FGJA 1OZAA 2HWYA 1PDOA 3HJUA 3B38A 2RGYA 4IHJF 5K8LA 1NV9A 3A8TA 3F6RA 1E3DA 4QRHA 4JYZA 2ZYHA 2AVNA 4KWIA 1JPNA 3BX1A 3UZUA 2QJWA 5I7FA 1ZK0A 2AMLA 3I4FA 3U0VA 5I48A 5BN4B 4GOKA 1AGNA 1FBNA 1EP1B 1G0OA 5MF6A 4ALJA 2GK7A 5EIBC 3RKUA 3S40A 2GDZA 2MJLA 3B13B 3C3MA 2WSBA 3KQLA 1LXCA 4Z4CA 2GZ1A 2NUTB 5GJWC 1XKLA 1GCIA 1EUCA 4PPGA 2A9JA 3QNUA 3TE7A 5IU6A 3AU8A 3IEXA 3FDIA 4K03A 4S2UA 4BMXA 5JS7A 1PTJA 4CM4B 1MKYA 1LNQA 3JWEA 1A4IA 1RI1A 4G8JA 4PWZA 3E82A 2HTEA 3HLYA 4I66A 1YMUA 5K3BA 1QH8B 3JQPA 1KQFA 1UFQA 3E8SA 3A4LA 5EZSA 4DIEA 2F3SA 4TXJA 3RODA 4YHBA 3ILSA 4CMBA 5H3HA 2VWGA 1YFJA 3G5LA 2IY7A 3PIDA 1UC4B 3JYOA 2LV8A 4GU5A 4LX8A 4ZO4A 4YJDA 5I8ZA 2PEZA 4QBGB 1IB6A 1RYNA 2I2DA 3GLGA 3MZ0A 2MTBA 4IDAA 5IAAA 3AP1A 4IBOA 1VL1A 2AZ4A 3ZCXA 1U0OC 2I6UA 3I8XA 3MB5A 4ND5A 2BHSA 1AK9A 1NA5A 2UZIR 3TKYA 1H6DA 2PIAA 2QKYA 4AIRA 4IFIA 4DKXA 1XTUA 2FRVA 4QGSA 3BMQB 3MW8A 2IH2A 4BAGA 5K0GA 3D5EA 3O8LA 2RKOA 5DKFA 1QVWA 4ZTBA 2B4QA 1DQPA 4TUYB 3WKEA 2CSXA 4YTEA 3ROMA 5KKAA 2XQKA 2I78A 3QQ5A 3ZLTA 4BNUA 4DG9A 5IK2D 2QJTA 1QKIA 4BX2A 4DB2A 3HCPA 5EJEA 1YFLA 1MB9A 5H3CA 4DZRA 3WGQA 3TRKA 4DGSA 5E4JA 2R47A 2I4MA 1LTKA 4AWAA 1ZR2A 3W3AH 4AO6A 2GM4A 2A7XA 5EOVA 3VTAA 3PX7A 1XPJA 3KT8A 4D4MA 3LYLA 1T6YA 3RUEA 3ONWA 1YS4A 1X1CA 2DBVO 5FXMA 4XFDA 1Z6QA 2AN9A 4CLOA 5DN9A 2R9VA 1EHCA 1SCNE 5K51A 4PZYA 1I6LA 1VSTA 4HXYA 5KYUB 1SQ6A 3ZNOA 3KQMA 4HF7A 3T5AA 1DX9A 5CT8A 5A6SB 3PUJA 3UXYA 1JKXA 1NRXA 1RMTA 1ZVKA 3PXBA 4MA5A 4HNVA 4RTNA 2NPIA 3CRNA 4ZOLF 3T7IA 3MCAA 3RRFA 2C5AA 4WI1A 3T0GA 1N34B 1JTVA 1GPAA 4ZA2A 2O2GA 5AM5A 1VBFA 2O0JA 5LOVA 4X95A 3W5BA 5GJVC 4CTOA 2IL1A 3VR2A 1FMFA 1ZIYA 1S2GA 1DC4A 1UWKA 3FNGA 3KEOA 4NJMA 5AW5A 5AVVA 3RVRA 1LWNA 2A4KA 4MV9A 2J85A 1YGYA 2FMIA 1DU4A 1M10A 4R8KA 5DBOA 3VNQA 3VDRA 1CJUC 3GJZA 3ESZA 3BRWD 4JLVA 2B21A 1E6CA 3MJFA 3U4QA 1EPUA 4JC0A 4FMDB 2OD7A 4W7HA 2IUFA 4W8GA 2C1XA 4X6YA 3WBKA 4C07A 2HBZA 5JNUA 4M6WB 2AD5A 2H85A 3FYHA 5ITVA 2GA8A 3EGOA 5E9QA 4LBWA 1GGKA 3MD9A 1CEXA 3ET5A 1Q91A 2HRDA 3T3GA 3VR1A 1ODFA 4KI0A 4MWZA 4PLHA 2HWWA 5EIOA 2I87A 5G4LA 4KR2A 4ARCA 3G2LA 4CF5A 5DHRA 3EGIA 5LBUA 3NIBA 4MWTA 2O5RA 4TM7A 1MABA 4F7DA 3N05A 2O19A 1IJKA 2ZSAA 1KFJB 1VE9A 1J33A 2HMTA 4NAVA 4DR1B 4PZ9A 3K2EA 4Q4DA 1E3MA 5LP6B 3INGA 4G81A 4F8YA 3TKLA 5HUHA 3P9SA 1Z0KA 2FX3A 3WB0A 4AKHA 1EVYA 1N5OX 2VAXA 1EDZA 1T6BY 2ZK7A 4NL4H 3KK0A 3LZDA 4DWOA 3FBGA 4GPEA 5JSYA 3RWBA 2PH1A 1E9BA 1KJWA 1QIDA 3MUFA 4WIAA 4LDJA 5FFNA 2BEVA 1TVCA 3RSHA 3R9XB 1H4QA 4F12A 3N8NA 2JIDA 3BJRA 4OUDB 2YBEA 2H2DA 5KJEA 2QQEA 3GEDA 1VMEA 3GHYA 2FZWA 3BHNA 1XZNA 3UGTA 2W71A 1RYEA 3TN7A 3EOZA 2R7AA 4M83A 5J2UA 2OGSA 4LMBA 1N9KA 3PUVA 4PY2A 1E6MA 3KZXA 4OM7A 5K6AA 1Y6JA 2J6BA 2IF2A 3F7TA 4L9AA 4TV9B 1BQEA 3WADA 1DAEA 1PJZA 1XD8A 3NETA 1PEDA 2WPNA 5FPHA 5C46F 1EXVA 3GL9A 1U6KA 3MC1A 1ABBA 1OHHD 1TJPB 1W5FA 3KVRA 3HGTA 1P1FA 3A6ZA 5I45A 1LK7A 1N5MA 4MVJD 3VNVA 5LZ5A 3BE5A 5E2IA 1YZQA 1RMQA 3R3HA 5JCZA 1JG2A 4MDHA 2DX7A 3ELDA 1H2HA 4RK6A 3QBVA 5KSOA 2WA2A 1SIOA 1NE7A 2GD6A 2BKEA 3KNZA 4H59A 3S0JA 3ZOKA 3HV2A 2ZUVA 1AHPA 2ZS9A 1E58A 4LYJA 4BCDA 3TIGA 3TLKA 3N75A 1DBRA 1FRFS 2G09A 2QL6A 4QA9A 1UBRS 1EUQA 5E1MA 2DHQA 4I2NA 4MQEA 3KSUA 4EUSA 3V3TA 3SQXA 1B3RA 4QGFA 1C2TA 2O48X 2WWTA 3LC1O 3LWZA 5F9FA 5EKDA 1X15A 1HYEA 2AN5A 3U19A 4OREX 1F1JA 2RAUA 3OUTA 2EKLA 3PFNA 4NMMA 4PM4A 2I29A 3VAZA 4HVLA 1OIXA 1O5IA 1JVNA 2JHPA 4KZPA 1BMFA 1TKBA 3LDUA 1JDPA 3IVGA 4MYHA 3ZU3A 4S2EA 3OVMA 5KMGA 1Q1QA 5EMHA 1M7HA 1E0AA 3W77A 2VK1A 3I04A 2I7XA 2V6FA 4YWJA 2WC1A 3ZCQA 3WXBA 1E2GA 2WM2A 3EC1A 4HVAA 2Z4RA 3TTUA 1J9GA 3UCFA 3L7IA 4IDGA 2LBPA 1D2GA 2H51A 2QI9C 4G41A 5AOVA 1I7SB 4EB6B 3TF5A 2BAGA 1UFVA 1UBHS 2VJMB 5EJGA 1EP3B 4PZEA 1K66A 5LYJB 2P6NA 1TZBA 4XCQA 4J4HA 1GLVA 5CFQA 2KBEA 2VDJA 4CMKA 1K8XB 2ISSD 2IBSA 4XOIA 3OCZA 4J0CA 4V24A 1FMLA 3FWKA 2OCGA 4S05A 2CMHA 3Q4GA 2EHJA 2PRYA 4MRSA 5DEIA 1T2NA 2PFKA 4CMEA 4HGZA 4B9EA 2VHWA 2KHZA 3EF0A 2EFYA 5MDHA 5DTJA 1CD5A 4CV0A 4K0KB 2JS7A 2A9RA 1OLUB 2VRWA 3I45A 5DK4A 1XUOA 1QRDA 2H0AA 5C31A 5IC5A 4BQNA 1RAFA 1H1TA 4BE9A 2FWPA 1SKMA 4CQLB 1T4MA 4BO0A 3RS9A 1TKRA 3T38A 3BPSA 4HN4B 3SC6A 5KQGA 3BZWA 3BTOA 5BW5A 4IZIA 1KEPA 4P4SB 3TMKA 2AFIE 2B4YA 2R7KA 1E3WB 4B17A 3S81A 4BXOA 3GI1A 3PYLA 3V2GA 4GQBA 3SHFA 1J0CA 4LBYA 1V43A 4PN7A 5AVQA 1P1KA 1W6UA 1EK5A 5J59A 2ZM6B 2DYKA 1J8VA 2IY9A 2AHOA 4Q39A 3RVSA 3ZHBA 1IN4A 1BE6A 4BAUA 4BO6A 4D4IA 1M5RA 1EJ2A 2Q3MA 3HFJA 4OXXA 1WDKA 1FUIA 2XE8A 3JQRA 1N2EA 2BFNA 4QDKA 3UBMA 1BHSA 5L3RA 2ZYIA 2ZUDA 1T4CB 2VJDA 1XGKA 3THWA 3N07A 1OCEA 5E7MA 1NZDA 3RYFB 1YHYA 1C3EA 4MHOA 3V4RA 1CZOA 3GRCA 1Z3CA 2H4HA 4HXFB 1GPNA 4PZ0A 1XYGA 1U2DC 3WL7A 1Q7TA 1UDBA 5HQ3B 2X0EA 1PLJA 4FI3F 3ZZ0A 4R7GA 9ATCA 1PFGA 4NZPA 3FF1A 1JAXA 4OD0A 1W93A 1QOZA 3GZJA 2B6NA 3FB4A 4RQAA 4YEDA 3KPUA 2G9RA 1GXSB 2Z8ZA 4LHVA 1A77A 3RYHB 1FRVA 2IEZA 3HSKA 4B81A 4MLZA 4KU4A 5JCXA 3PWZA 2EL7A 1EP2B 2NU9A 3NTQA 4V0KA 4FXOA 3O73A 1P9LA 3CY6A 3ELYA 3TZEA 4MQ5A 5LZ2A 3QLEA 4HWKA 3MERA 1UDCA 3I2HA 4ENVA 2XRMA 4H3HB 4HO1X 3T3DA 3OU2A 1IZZA 3SJ7A 4BC0A 3LVRE 4F5EA 2YWCA 2PUGA 1JDNA 4D5EA 1U90A 4GIBA 2GASA 3V8NA 4P3XA 3CQ9A 1M9NA 5A2QA 2Q2QA 1W4BA 2Q1SA 2DPLA 2IPAB 2XBUA 4D9CA 1I80A 1CUSA 3FLAA 2MSEB 3EWIA 5UKDA 1CDDA 3RQIA 4QXAA 3G6KA 2NU7A 2QX6A 3MEQA 4LJ7A 3NCTA 5EE1A 1L2TA 1J97A 3OZFA 3B6EA 4UXIA 2BMEA 1W0JA 1MX5A 4ARVA 4LCJA 3S2SA 3NVKI 4J90A 1PR3A 3RFUA 3COJA 2DLNA 3ZHSA 3CE9A 1A8IA 2IHYA 4FYWA 3V9AA 4B4VA 4JSRA 4HDQB 1JKJB 4YLEA 1G6OA 3AEQA 1Z63A 3FG9A 3KJNA 1NW9B 4R40A 3GA7A 2R7NA 1U6JA 2CMFA 4OQDA 4CW7A 1ZVMA 4PLVA 5IKMA 3NX4A 4LE2A 3ZLBA 5LZ9A 4BNLA 1M2GA 1RIIA 5JQWA 1J9ZA 4RM2A 4DSTA 5AQ1A 1WIWA 2PR2A 1KF0A 4YAJA 2A2ZA 4G8DA 4PZZA 2FZGA 2GR9A 3PL5A 3WVNA 2TS1A 4M38A 2QGNA 1I1OA 2GXQA 2H29A 4XTCS 4RF5A 2JRCA 5G1NA 3LT5A 3W2EA 1FMJA 5LCXA 4M1ZA 4YP7A 5GOTA 4AZ3A 4P22A 4QM7A 1FW6A 5DGIA 3QF4A 1GOTA 4IIEA 4DLZA 3DEIA 3BG5A 1S01A 3LH5A 3D7KA 4OBEA 1LPMA 3LLCA 4ICIA 4GKBA 2W8BB 5IKPA 2G83A 3DT8A 2AR7A 3KYDB 4A73A 5I8PA 1D4FA 3T4EA 4E08A 3A1EA 2WKWA 2YIVX 1DAKA 1X80A 4FHEA 1AN0A 3B53X 3C6BA 1KDZA 3VSCA 2NUPB 4E3WA 3BXFA 4YQZA 1KETA 5K09A 5ITZA 4RPGA 1JLKA 2OZPA 2WZDA 4FS8A 4DWWA 5JALA 5K0FA 4W5RA 1FFXA 1A7AA 3G7NA 4EABA 1XXHB 3ORSA 4Y7DA 2YH2A 3QYAA 4X60A 5DFAA 4CWAA 2MSCB 2PKYX 5DTMA 4AQDA 1ZIPA 3QXCA 3TPCA 4JP2A 3INTA 1MHTA 4X1KA 4OVKA 4DR3B 4L0QA 1YZTA 4HGOA 1Q1BA 3OPMA 4KP7A 4FNOA 3V4FA 4UQLA 1NURA 4YV7A 1YOVB 3D7RA 5DHUA 2ANCA 3DWFA 4OMFG 3T7AA 3AL2A 3GELA 2HC9A 4TWBA 2B0JA 3LF1A 2V96A 1WTCA 3PNLA 5JJIA 3B6KA 1YR9A 2FJPA 3D6UA 3W6ZA 4B3HA 5HNKA 1PTJC 3PEWA 1OLXB 4B4OA 1F38A 1SN7A 2BFAA 3AVPA 4LI0A 1Z6XA 5J4HA 2CY0A 4JUFA 2PAFA 3FXAA 5LU9A 5K2MA 3L04A 1VHLA 2X8JB 1RABA 1KY5A 5JXIA 3BULA 4BO7A 4TWZA 2HQSA 3UGJA 3PDWA 1CETA 1FFEA 1SHJA 2CZGA 3OO0A 3PDUA 4FW8A 3DBHA 3FOBA 3R9IA 4DJDC 4YRNA 1S2MA 2V1UA 4LX0A 1K5DA 4P35A 4DAEA 5IHXA 5EIXA 4BX3A 1DFHA 1AKNA 1YQXA 2O7RA 3G9TA 1KBQA 1OZ0A 1H0KA 2D1SA 5F78A 5JU6A 3L49A 4U3JB 5E95A 4BBJA 5L8VA 2AW5A 4TS4A 1P18A 4NYMR 5H9VA 2RHHA 4QJ4A 2B7BA 1Y9ZA 3I12A 3MSCA 5BSWA 1TI7A 2KX7A 2Y68A 4RVDA 3VOBA 4JB8A 4D0NA 1H8EA 3T1QA 3EG9B 3LK6A 4MS1B 1CY2A 1H8HD 1GZHB 1PJCA 2M1ZA 1TYEB 2QM0A 2R6ZA 3PS9A 4PICA 1WP4A 3VZPA 3GLQA 4YALA 4MDFA 1W73A 1FLNA 1EK0A 2NZWA 2ZIGA 1E1MA 1LDNA 4IFTA 3PIRA 1Z7EA 4DA8A 1JDTA 3PHJA 4V38A 5AT1A 1VC2A 4DYHA 4XGKA 2V7XA 1B23P 4IIHA 3CZ5A 4NE7A 1NSYA 5KQLA 3DR3A 1XTZA 1GPH1 1XWIA 4FR2A 3ZV7A 3F5FA 2V3VA 1IOWA 2TMYA 4YWHA 4NCJA 2B20A 3NEPX 4J6FA 1EVLA 1NF8A 2PA0A 4PSKA 5FYDA 5G4KA 1CQPA 3V2HA 2W43A 4K81B 5FWYB 3RTCA 3VC3A 5BV2P 1CYEA 2AUTA 3L06A 3ZDRA 4CI9A 1AH2A 3L84A 1TYBE 4N0QA 3LGXA 2VG8A 3PEVA 3CR3C 1SQ5A 3FSEA 1YO6A 4IYRA 2CNNA 2CLOB 1T35A 1L3CA 1QHSA 1I30A 4BNJA 4PYMA 4QVIA 2R87A 3PE4A 4Y2GA 3VA7A 2VRCD 1DUIA 2OV2A 4WFIA 1XF1A 1Q7RA 2WF8A 4YRQA 5B1HA 1XRQA 5AVRA 2MWMA 4IEFB 1P31A 3IOEA 3PNPA 1WL8A 5A2GA 3SS9X 2R44A 2MDTA 4UNPA 3NNNA 2B7CA 3KPYA 1NI4A 2BMFA 4L74A 3EBPA 1A88A 1SRRA 2G1UA 1LBSA 1M5UA 4ZPJA 1OVMA 1S96A 1G5RA 4O4HA 4UTXA 4F4DA 5TQJA 4YUXA 2OPBA 4F5WA 4CHGA 3OZUA 3RAJA 5IF9A 5AW4A 1DTWB 2BHTA 5BNWA 2ZEJA 3HO8A 1ADYA 5EFOA 2CF5A 4Q37A 4U7FA 1LDEA 5IMBA 5FPKA 4DR4B 3EBLA 4F2DA 1CVLA 1T4DA 1TTPB 2F8SA 1SKYE 5AHRA 2W83A 3HA5A 5TPWA 2RGNA 3SS8A 5JNVA 1U6IA 2X8BA 3W04A 3HVKA 1OZHA 2W00A 3P52A 1N9ZA 1N0IA 3PGXA 4B45A 4FU0A 3FDFA 2F59A 2HCRA 4BKUA 2ZRCA 3R9WA 4B6EA 5I7EA 4PV7A 3LKBA 1F0NA 5JAUA 1VL8A 2CZCA 1OVGA 3OJCA 1M8JA 1V26A 4L6AA 1AQ6A 1A4RA 1RWOA 2J4FA 3I64A 1N8TA 3KTAB 3NEJA 2ONYA 4HHEA 4XLLA 4OJYA 2BH2A 3NUGA 1DIBA 3VYVA 2BY4A 1LDYA 3OQIB 4PLCA 2IDJA 4EYGA 2HW8A 1SKYB 5KJFA 4FZVA 5J1TB 3I1FA 3VVBA 4MULA 4NU6A 3FPCA 4KWTA 4WEQA 3TM5A 2QP9X 4M9XA 3K09A 3OD1A 3OLZA 5EIFA 1R0WA 1NVAA 2BEWB 1IY9A 1Y4UA 4MCAA 1KMHA 2HSDA 4RAQA 5KNBD 2RC5A 1VSVA 3EVTA 3FZGA 2YASA 3X1YA 3ICWA 2WJZB 4RFSB 5DWVA 4KGXA 1NBME 1U9JA 5EXDA 1ZY2A 4F2HA 5K6AC 4PWYA 2VEOA 5GZ1A 4YY3B 3TECE 3BJMA 4ZQBA 3IQEA 2B1QA 1MXHA 2OAGA 2VYCA 3CLKA 4C0KA 4OUKX 5HGJA 1CDOA 1C7RA 2JGIA 3D0RA 1O6GA 5TQVA 1KP9A 2O1SA 2XD9A 5FBQB 2HLDA 1ZPDA 1F2TA 1HTWA 4G56A 3FB1A 4EJ6A 1FNMA 1ABEA 5C53B 4J4BA 1T8WA 3JAKB 2A4MA 3FOWA 1ZIDA 4AJKA 2CUTA 3VPGA 5D00A 5T4EA 5ILOA 1A72A 4GM1A 2E5WA 4ARZB 3I2FA 4DW8A 1R4MB 1TRHA 4Y6OA 5SZIA 1SPXA 4G4IA 3U4IA 1W49A 4G97A 3VNAA 2A30A 3EEYA 2XZPA 3LHFA 1XJWA 1G9TA 1NDQA 3HB9A 3RT9A 3ECCA 4A8JC 2O06A 4DJFC 4UPVA 2R8OA 3FPBA 4MVJP 2GFIA 4EW1A 2D3WA 3FPLA 1P6UA 2ZJAA 4YYZA 2ORWA 3BD8A 4HKTA 2EL9A 4U1RA 1OH6A 1JVBA 2BFDB 3ESBA 4IOJA 4PYKA 1E0SA 4LOIA 4ASUD 1GSOA 3W5IA 1P9RA 3OPYB 3G0HA 2C61A 2W2OA 1EHIA 4EG5A 3BOSA 5ALTA 2XADA 1RKVA 1ULAA 1HDEA 2W4IA 5JZVA 4RIFA 1GWNA 1T0HB 5A4KA 3DHNA 3SSNA 1V1MB 4U9IS 4JCOA 3MNFA 3WMGA 1QHHA 2W2KA 4ZOCA 1KO7A 5SYNA 1RJFA 4Q7KA 2WKQA 2D1YA 1JZSA 1TW3A 2ZRJA 5FPTA 4B3DA 1CXZA 2Q41A 3DDNA 1Z16A 2G4VA 2X9NA 4RZXA 3WLOA 3Q3IA 3HHEA 3ZZMA 4DJEC 4KLCA 1QP7A 1RE1A 3ETNA 1CUUA 1UBTS 2JIRA 3GOQA 4Q4HB 3V1UA 5EC8A 1B7GO 1U1FA 2RIRA 3P9NA 4PX3A 1TJ3A 4PLGA 3EW9A 2GF9A 4L8LA 3QVUA 3A2NA 2PX6A 3G17A 3U09A 3K9HA 4RCYA 5CYGA 2HJHA 3I32A 1AQIA 2Y77A 5C5CA 3D6JA 3GUCA 4PZDA 5DV9A 5L3QB 2ACWA 2C3UA 3NT5A 4K6KA 3RTGA 3H2KA 3GA5A 1QC5A 2FPRA 2G1AA 4DFDA 2VDMB 2QR5A 5F7JA 3IS3A 3NVDA 4Y1FA 3QVVA 5EJ8A 1SCBA 2D1FA 1WQ4A 2OD2A 2ZG6A 1C8BA 5TS3A 3DNPA 1YGPA 2WJYA 3DXXA 4RMGA 4ILKA 2DMRA 4OB8A 3W8DA 2EOAA 3MJDA 3ZWMA 1FU4A 1RYDA 3B5EA 4CKCA 1A9XA 5CA1A 3CVUA 1VI2A 5KCZA 4GWKA 2KM1A 5AM1A 4A6DA 2I1WA 2I8CA 3FOCA 3IQGX 3OQPA 2D2IA 3PEYA 3M1LA 1J22A 5C1PA 3AR7A 1U3TA 2HSZA 3OEHA 1NJ8A 2QD4A 1R3UA 4P2GA 4U2EA 3GJ0A 4F6RA 1QYDA 4A16A 1K8QA 3NB0A 2O4CA 4N12A 5LQRA 5D3QA 4Z8YA 3U56A 2BL4A 1Y5LA 3NXSA 5A6VA 1XHFA 4I1IA 3TRFA 1EDEA 2BGMA 2GEBA 3OICA 2BC9A 5JMWA 4FI3C 3PXGA 3RS8A 2R86A 2J3MA 4CEIA 1IWPB 3R7AA 3SMQA 1VIAA 2EP5A 4EAAA 4CG3A 2YDXA 2QY9A 3FMOB 1CRLA 2MYTA 4NBRA 3REOA 4AF6A 4CM5A 1BXGA 2EKZA 3HFGA 2NWQA 2WVGA 2ZU0C 4G8BA 4XR4A 3F9IA 2H4WA 3VBEA 1V5IA 1WLSA 4I8XA 1AKEA 4YJ3B 4WECA 1LPBB 1Y37A 1WCYA 3LVQE 4HDMB 2H31A 2DWPA 2N9UA 3S2ZA 1M6WA 4KWEA 4P33A 3O3OB 3WS7A 4BCCA 4ND1A 3GDGA 1RAGA 1D2CA 1XZ8A 4GP7A 2JLYA 4MZXA 1ZJWA 1G6HA 2HU8A 3K6KA 4PZPA 1RYFA 3BWXA 3EODA 4Q3KA 3I6YA 5CURA 4AUEA 3ICPA 3R74A 3THOA 2AD1A 4DZZA 1ZIXA 3NRBA 2I33A 3TSWA 5K3CA 1HNWB 2B92A 3AF2A 4BYGA 2ZS7A 1S3FA 1IJBA 1OLOA 2QRLA 1XMPA 3ABZA 4NAHA 4RU1A 3JVEA 3Q10A 5EYPB 3WTCA 4F85A 5KYYA 4FEGA 2Z6UA 1M0WA 3FUXA 1YR6A 3OKPA 5AVZA 4MB0A 1W48A 4F8EA 3PDJA 4YRFA 2EX4A 1ZAYA 4MUGA 3MT7A 2V4UA 1JHQA 3QKSB 1XVVA 4OH7A 1OTXA 3PX3A 2IUUA 4AF7A 2JBHA 2X4IA 3VNSA 3V4ZA 2AQIA 5JIBA 4NP6A 1WBBA 2CNOA 1QK5A 3ANYB 1KOJA 1FFHA 1VA5A 3N7UA 4BQEA 1Q1AA 4DCGA 3TG8A 4WLVA 4JOQA 1BGWA 2CN1A 1XKXA 4ACBA 3OECA 4TKVB 3W5SA 1WX1A 2ZI5A 4N39A 3RT1A 3T5BA 3C1OA 2X2EA 2YMLA 3NBAA 1KORA 1QFYA 3O82A 2C20A 1YB4A 2R6R1 2WABA 4JENA 2HDOA 4LIPD 1VHQA 5AUNB 1XEWY 4HNAA 1PZFA 2WM8A 2V6BA 3MAGA 4GKAA 1US8A 1UOQA 2A3NA 4UCFA 2DUJA 2GJSA 1SK9A 4ZVVA 3TD9A 3V8VA 1WB9A 2VPWA 3O1JC 3R8XA 4M37A 4A5SA 3G8YA 4PVDA 4NXNB 2AFHA 4IIJB 3BILA 2IYUA 4IWYA 4K9DA 1ZYUA 3TE6A 2XXBA 3V6MA 5F7XA 5A62A 3BMOB 1EBBA 4JP5A 1SVWA 2OZEA 2ZZKA 4TL7A 3V3KA 3HK2A 5DSZA 3MMSA 2WK1A 1ULUA 4Q16A 1LVHA 3FVQA 3Q8MA 3MRSA 5EERA 4DVGA 1E2IA 3R5XA 1L4HA 3PEUA 4UULA 1E5DA 3BK7A 1WXFA 2VK4A 4MPJA 4FT2A 1DAGA 4R1SA 3TJZA 1HOXA 2WWVD 1QWOA 1KFCB 5JYDA 5AXBA 1RPTA 4O8CA 4LJYA 4WCFB 1JR3A 3VR6A 3E5HA 1CK4A 3ZHTA 4DBLC 4H1WA 2HCTA 3KLBA 3LPLA 2IWHA 2NQ2C 4GP9A 4YI5A 1Q3HA 1JEJA 4IFBA 1Z4NA 3LC0A 1U8YA 1XQYA 3NTUA 4Z1OA 5JXHA 1Y33E 3BKWA 4QYSA 5KAMA 1P6XA 3M0EA 3S6JA 4MO2A 3J80A 1GNPA 2ZAYA 2C9CA 4GR5A 1PR9A 1C4XA 3FTNA 4MQ4A 4MLCA 2JVIA 1AZWA 1SUBA 3N86A 1NSTA 4B3JA 1AX9A 3IDOA 5FQOA 1Q77A 1H66A 4G5YA 1R8QA 2QTMA 4ITVA 2YFYA 3K1AA 3ZOZA 4Q1BA 3FR8A 4Q24A 4HDOB 1B4DA 2V59A 4HX9A 3TLGA 3WGGA 2C7PA 1IAVA 1I3KA 2E89A 4M3NA 2GN4A 2WDZA 4IWNA 3SSAA 2NZXA 4FIDA 3W0LB 1XCGB 1RZUA 1ISHA 1T2VA 2GGSA 2X0IA 2CC2A 3LQYA 4LK2A 2QRVA 3S29A 3OZ7A 4BO9A 1GNTA 2WKSA 3FI9A 1IQ0A 3PC7A 5FOVA 3NC1C 1VLVA 4YASA 1BHQ1 4EUHA 4IQ0A 3USZA 5DN6D 5H9WA 2HNBA 2QM3A 3NWEA 1XTRA 1Q7CA 2CNWA 1P8JA 4V3CA 3IBCA 4XDHA 4C2UA 3P9CA 2JJMA 2O07A 2FRDA 2VDWA 3A3PA 3ZIDA 1CR1A 2GLXA 2YRWA 1U7WA 2XNHA 3P2KA 5BUSA 3CLTD 4KK3A 4QNRA 1U3UA 3C3YA 3O2QB 3PRJA 5LC1A 3UQYS 4AP5A 4AX8A 1PWXA 5AM3A 5FHRA 4H17A 3GFPA 4Z9BA 3VZBA 1P2VA 1T29A 2IZOA 2ZS8A 3ABOB 3SF8A 1CB7A 5LLTA 1DRJA 2E4UA 2QNBA 1L4FA 1W29A 1XZFA 1J5PA 3BK1A 4F8JA 5DX1A 4E21A 4E3ZA 3RD5A 5F4ZA 3UC5A 1LBHA 1W4CA 3TJRA 5KSPA 2GB4A 4MXDA 4RJIA 2NP6A 4N65A 1YHNA 3INRA 3X43A 1N2XA 1K8YB 2ZE8A 1CZKA 3GYGA 3R09A 3JQAD 1YRQA 4PRZA 3U1VA 2JDIA 3GG2A 4C9BA 1Z7GA 4EYSA 4M8IA 4K8OA 1SURA 3AUYA 1HYQA 2VXBA 3WIBA 2BFFB 1CHNA 1K5PA 3PKJA 1RXEA 4TTPA 5C7IO 4RXUA 4GAEA 3MUEA 4GH5A 3VKFA 2JGJA 3IFSA 3ZW7A 5JCJD 3EZLA 2UYCA 3JAWA 2ZOSA 3Q0IA 5BUZA 5AW1A 1KAGA 1RRCA 1IBMB 3WE7A 3IULA 3JSAA 4I14A 4TKUB 3GVXA 4PANA 3WWCA 2JLWA 5EJ2A 4BRZA 2NSDA 4ENRA 1BAPA 2HXGA 3B6JA 1SOMA 5A9SA 1SOWA 3IEUA 4JX9A 4MI9A 4CIXA 3ZY2A 1KJIA 4I0WB 2WUEA 2BI7A 3K8ZA 4RCVA 4ZFNA 3CNOA 2FDRA 5ALVA 5DULA 1L5WA 2A94A 2P2LA 1C50A 4L3WA 4MV8A 2NM0A 3DDWA 1KYYA 1Z0IA 3HYRA 3WRWA 4GXTA 3SKXA 3HTXA 1DEAA 4YJFB 2PGDA 4X1YA 3ROTA 2P9BA 2WUDA 1TLTA 1SCIA 1RT9A 4WNAA 3UT0A 1Q1EA 1V71A 4F4IA 2UYGA 3DDHA 4CETA 1PLLA 3DNMA 1J21A 1TM2A 5ALJA 4BZXA 2HF7A 2F3RA 1J24A 4DGQA 4DPLA 3O9MA 1DAMA 4AJ1A 5KIAA 1SWVA 2VF7A 4CQMA 3WHLA 1P60A 2XI4A 4ZDIA 1NBMD 1Z8NA 4PF1A 1CDZA 4EFDA 3ETCA 4US2R 2XUJA 2YJZA 4Q12A 1FVOA 1D6JA 1TMKA 2GD0A 2WHRA 2FKNA 2QL5A 3O4RA 2Q4EA 1KERA 4NWIA 3CURA 1W35A 4LN1A 2CGEA 2Q5EA 2V54A 3T7EA 2RGNC 1UJMA 2EZ8A 1UMCB 3LSYA 2A9KA 1T5TA 3K4QA 5TV2A 4B4UA 1BZYA 1T43A 1PFUA 7AT1A 4MW6A 4PLYA 1XMJA 1EK6A 4FFRA 1C9DB 4DMUB 5BQFA 5LUBA 4PSDA 1XJCA 1Z5GA 2NSJA 3BFXA 2Z3ZA 3O8QA 4URHA 4CFZA 5K20A 3QKUA 4N0DA 2R85A 4MITA 3B1JA 2XMGA 3R5TA 2ZJ2A 3HCBA 2Z09A 3H0EA 3RHZA 2V7PA 1WDMA 2JAPA 5KTTA 3RG8A 3G2NA 1X8XA 1P7WA 4PZCA 1TFRA 4ZO9A 1U4NA 5IJ0B 1NJ5A 4II7A 4OQQA 1P80A 1L9XA 1CZLA 1H94A 4HNHA 1GVNB 1SBIA 3V00A 2R6AA 3GJ7A 4CPDA 2MCFA 4DV7B 3KAKA 4LCEA 4UEQA 3NRCA 2YZKA 3FWHA 2DPXA 2PVSA 2YV4A 3G7SA 4BUJA 5A04A 2A58A 5GIOE 1TECE 16PKA 3AHCA 5KJ6A 1T1SA 1GNVA 3QE2A 5C1OA 5KPJA 4AY6A 3F8WA 1F14A 3C41J 4BTLA 3EEIA 4UDOA 4A0HA 1OWLA 4BMOB 2EZTA 5EJIA 4NH0A 4ESVA 3THXA 4QTXA 1GYRA 2O7VA 3JQGB 4WZBA 3RSFA 2HYIC 4F71A 1VSQA 1CQWA 2N42A 2VP5A 3MB8A 3THRA 3VXKA 1XV5A 3X1MA 4TVOA 1KIMA 1EBUA 3TZ6A 1TLFA 5KVCA 4XPIA 1QGYA 3IKVA 2CFIA 2AE2A 1DEKA 1R66A 1XZJA 3EMKA 2OB1A 4NFSA 3SSOA 1OQAA 2FRXA 5ESWA 2PL3A 1VKNA 2BE9A 2DBYA 1LBIA 3FA2A 3FNFA 3RK0A 4HQFA 3X1ZA 4KQCA 3UA4A 3DGFC 2WSYB 1YDWA 4B47A 3WA6A 1XCPA 5BSFA 2CDAA 2C82A 2C0QA 1VCIA 1YIAA 1Z33A 3IBFA 2Q2OA 3MWFA 1L0BA 5THQA 2YHAA 1FTNA 3RIEA 1Q0LA 3VTKA 3ZVKA 3N9IA 3R3JA 4A2CA 1AUVA 4W63A 2EZ4A 1CY7A 4F4UA 1N3BA 2WHQA 1I6WA 4JUIA 3FWZA 4G0NA 1V8FA 2CBXA 2EVWX 1UPCA 3BUSA 3QF7A 4TV8A 1PV1A 3M2PA 4MRAA 3KQOA 1DIHA 5JRJA 4FNAA 1Q19A 2JLSA 3FNBA 2C4KA 4NOMA 3R44A 5JBIA 2J0UA 1QYRA 3IP8A 4CG2A 2OY0A 5AI5A 4RPJA 5DHQA 4EPVA 1GTJ1 3EC7A 1GCGA 1EQUA 2AK2A 4JAVC 3RSOA 4L57A 2JKVA 3CLUC 2FYTA 4IDNA 3B1KA 2HL6A 1D1SA 4ZVKA 4OHZA 3QKTA 4B2PA 4GZ3A 3OZIA 1ODKA 2WD8A 1N1MA 3C3KA 3O1HB 1T9BA 2CXUA 2F3QA 1PE0A 4PG4A 2FKAA 2OCLA 4I6EA 2DSTA 4Y3UA 4JKIA 1XAIA 1T1IA 2ZXUA 2VYFA 1W5AA 1R5BA 3H3XA 4AN1A 4NMLA 1ZU4A 1GUBA 5DSTA 3L7BA 3ZHOA 4WKGA 3UJNA 1EVIA 5HCUA 4HDSA 4AECA 1ZGJA 4LA4A 4LFCB 1IG0A 4D46A 2AN3A 5AUOB 4QG3A 2H1WA 4MMZB 4MUJA 1JLLB 1QJCA 4EFKA 2ZBGA 1ODJA 3DM9B 3HJBA 4IINA 3JV7A 5IX8A 5ABPA 3ILVA 1E2LA 2BSXA 3I30X 4AO7A 4F92B 4DV5B 2A9PA 3OOJA 3L1UA 4QBKA 1P0CA 1CUWA 3KWLA 2HCJB 3H5RA 4UD2A 5LBIA 1W76A 2HCFA 4RD6A 2XNJA 4HS9A 2P5SA 2YQ4A 5FADA 5K0EA 4AQ7A 3NBUA 2HMYB 2XDWA 1AKTA 2Q07A 4I19A 4ZDKA 1IEVA 1AO0A 3UATA 4B6RA 3EXG1 3SS7X 1OROA 3TOCA 3RG2A 1UK6A 1ZKDA 3O92A 2WKRA 5L4LA 2JLXA 3UJPA 5A4MS 1S2LA 2PD4A 5IJWA 1XAJA 2C5LA 5CFPA 4JT9A 3KQQA 2CNDA 5KX5F 3GDOA 4KXUA 3OTQA 4IJ5A 1SUIA 4RK1A 2WSSD 5BQOA 2ZYUX 2GX6A 4JLWA 3FOFC 1E1CB 2E18A 2P41A 2V4ZA 3I34X 4RMIA 4WY5A 1N9GA 3H2YA 3R23A 3ZXXA 4AAYA 3R4CA 5DEOA 3V4VB 3RUIA 2FWJA 5DM4A 5BV1A 1FYWA 3V55A 1CWUA 1RYBA 2QJRA 4KYTA 4C1NA 1X9IA 3K0FB 2C8KA 5G0VA 1RRVA 3C8DA 4JDPA 4D3XA 1DFIA 1BVHA 2IVFA 3FZQA 1G60A 4FFMA 2GN6A 5I51A 1P3JA 2GZ2A 4MPDA 2NXWA 2WMYA 1C3JA 3OTHA 5F9MA 4EEZA 2EJUA 5DOZA 2X0RA 1JU9A 2PL1A 3FYCA 3K8QA 3PXEA 4FCWA 4RPIA 2X0KA 3I37X 4Z8XA 3VU9A 2R6GA 4D7AA 2A86A 4F7WA 1JSZA 1M5TA 2BFCB 2V3WA 2XGSA 3ANNA 5LUAA 3EQZA 4II2A 4PONA 3LCVB 5HBGA 2H9IA 1CUGA 3ERCA 1G1MA 1KMIY 2PR7A 2HA6A 3VNRA 4MS3B 2FP4B 3F2IA 4II3A 3LG2A 1Y8QB 2GTPA 2UYQA 3VH3A 4DDMA 2RAVA 3QITA 2CDRA 1DHRA 5KNDH 2ZCVA 1OJ7A 5LJLA 2OLKA 4WASA 1NJSA 4LJLA 2JIMA 3W3ZB 1E5VA 1LRLA 4REQA 1JV2B 1QKJA 3BK2A 4BFUA 4EW6A 1Z7BA 2UVDA 2QZPA 4PQYA 4D98A 3N7AA 4JI5B 2IDZA 5A0VA 1Q0RA 2NYRA 2GA9A 3HS3A 2NV0A 3HYTA 4KDRA 4PINA 3WFZA 2ZVQX 3ZXIA 1Z0SA 2QL7A 1XA3A 1Z13A 3PK0A 5B4VA 4RTSA 4W5TA 2JEOA 3LUJA 4L72A 2RJOA 3RW9A 1XZHA 1G8SA 3IBSA 2IT1A 2ONKA 3MTIA 3DAGA 3EPRA 3CF4A 2PWYA 4KO4S 5DRTA 2PKRA 1KP2A 4JBYA 4BQRA 1TA0A 3O4GA 3EUFA 3KPVA 2FX5A 3P2JA 2V6MA 4NDZA 5H16A 1X7ZA 2P9TA 1E7QA 5TSDA 3MOSA 4I55B 1XTIA 5K7SA 1V3TA 3WHPA 1HNNA 2I22A 1T9CA 1W0CA 5EIAA 4DDWA 2VHZA 3VR5A 4YT2A 3ZJVA 4EG8A 4I1VA 3W1WA 2QP3A 3NC0C 4MTCA 4XCXA 2VPYA 2FPXA 1SMKA 2PQ6A 4UAGA 1TDJA 4MZDA 4YRRA 4FGUA 3TIVA 2HN9A 4B8ZA 2CXHA 5KC8A 1W36D 1NPDA 1U1CA 2FSVA 2DWQA 1DO0A 1E94E 1GVHA 3HYLA 3NHUA 2QLFA 4HXEB 2PX2A 4FGKA 5A5GA 3RVDA 5I7WA 1D8TA 3TGLA 4DC9A 4EG7A 5ALYA 3H1AA 4RABA 5CDSA 2I9KA 3B9BA 5HJEA 1A7UA 4N5NA 2R1TA 2GF0A 4WLOA 1L4KA 1PYDA 3E3OA 4Y2UA 5HMLA 2ES4A 3QRWA 2JRLA 2HT6A 1RM0A 1ZG3A 3HBJA 3ELWA 3OZEA 1J5XA 2C3YA 2JJ2D 2O9JA 3P0EA 2WYWA 1QYCA 3PT5A 2KLBA 4PHGA 4R2WA 5HX7A 1A9PA 3EMDA 3GLIA 1KJ9A 5F35A 1ZUHA 3GDFA 5AKIA 2DBRA 2C8LA 3OPVA 1PHPA 1Y4ZA 3PJDA 2HK7A 5EUBA 1QQAA 1RAAA 5KOJB 4FKZA 3IURA 3FRJA 1E1KA 2VK8A 4WGFA 3ETLA 3EISA 1RHJA 3L4SO 1WQ1R 1TM3E 3F67A 3FYUC 5COBA 3UCXA 3IT0A 3WRVA 2W8ZA 4ML3A 4DYDA 1D3AA 1KYQA 1NGSA 1OGIA 4QPCA 1EFKA 5CA0B 5IFLA 3IALA 4GYJA 4E51A 1SCUA 3O9VA 1SC9A 3HB1A 3URKA 4D6XA 2JFVA 4JBGA 4QPNA 4C6SA 3ZY3A 1OOEA 3PQ7A 2PJUA 5CK4A 1M0SA 1VBKA 4NDAA 4J7AA 5FTLA 1A2KC 1C9JA 1SHUX 1UFKA 1ZISA 3A6GA 3AYZB 4QO8A 3RUDA 4P0QB 2QPOA 4D3SA 2ESRA 2R4QA 1TD9A 4UZSA 2ID7A 1DCTA 3MAJA 1EQ2A 1ZGHA 3KTDA 2PZFA 1OAOC 1T6NA 3DVAB 1GPWB 1EP9A 4ZIRB 1T6ZA 4QXQA 2ZUSA 1YB1A 2PS3A 3H3JA 1ZK2A 4C3UA 5FB3A 1FVXA 2XTZA 5H8WA 1EX9A 4EDFA 3H5OA 3KKKA 4UJ3A 1M6VA 1SU6A 5ALWA 3T7CA 1K89A 3GT4A 3HUUA 5SY4A 4LXIA 4R98A 5DLEA 2XNSA 1JDBB 1EGAA 3D7NA 4YQEA 1GT6A 4GKKB 3DXYA 3H05A 2CKMA 3HJGA 2EFGA 1CJSA 2UZ0A 1EEXB 3LUAA 2OZKA 1NBHA 2QROA 4US0R 3QEMB 5DB4A 5EIBD 2X5NA