3OU2A

Dhpi-sah complex structure
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
216
structure length
204
Chain Sequence
TSHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRPGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Characterization and structure of DhpI, a phosphonate O-methyltransferase involved in dehydrophos biosynthesis.
pubmed doi rcsb
source organism Streptomyces luridus
molecule tags Transferase
total genus 65
structure length 204
sequence length 216
ec nomenclature
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ou2A00
1SUIA 4LG1A 4RTOA 1SVUA 3EGEA 5EIWA 4CTKA 3S68A 1F3LA 1AF7A 4DMGA 1YF3A 3O4FA 4KW7A 2ONYA 2I9KA 3P97A 3E23A 3I9FA 2FPOA 3LGAA 3LPMA 4EVIA 1RI3A 3G89A 4YUXA 1X1CA 2AOXA 1I4WA 4XUEA 2IH4A 4PIPA 5IH3A 1JG2A 1KHHA 3SVZA 3TKAA 2AN3A 3BGVA 4GBED 2JG3A 3NWEA 3KKZA 1U2ZA 2ZSUA 1VBFA 3GIWA 5EKXA 4BLWA 4YV2A 3R0QA 3EGVA 3LCCA 3ELWA 3SSNA 1D2CA 3E05A 5EHIA 2ZWAA 4QQNA 4PNEA 4PYOA 3CCFA 3I58A 2AN4A 1WS6A 2GPYA 3FTCA 4F84A 2BR5A 1X1BA 4OA5A 4V0RA 1FP1D 1L3BA 2R6ZA 4AZTA 3EEOA 3HCCA 2XBMA 1NV9A 1FBNA 3HVJA 2O0LA 1VL5A 1HNNA 4KRGA 4DZRA 3VC1A 3UJ6A 3TMAA 2O06A 3FTEA 1TPYA 2NXNA 1SKMA 3SMQA 3OCJA 4GOMD 5EPEA 1RI4A 2OO3A 3NVMB 3I64A 4GF5A 3GU3A 2OYRA 4YUWA 2AR0A 3D2LA 4BY9E 2WA1A 3CJTA 2AOUA 1H1DA 1NW6A 5F2OA 4X63A 3UZUA 5H02A 2EFJA 3AJDA 1T43A 5CVUA 1XVAA 5E1BA 5FQNA 2ZZKA 2JJQA 3FTFA 4ER7A 2QYOA 4Z2YA 4RTSA 1YFLA 5CVDA 4P58A 3SXJA 3FUUA 3T7RA 2GH1A 1IXKA 3B3JA 4K6MA 4E2YA 3MCTA 3EGIA 2UYQA 3OU2A 4PYIA 5K0CA 3UJ7A 3OFJA 1RJFA 3HCEA 3KQPA 5HEKA 5K0LA 3THSA 1EJ6A 4ER6A 3NJRA 3BGDA 3TOSA 2ZTHA 1KPHA 3T0IA 4C4AA 3KU1A 4PYJA 2ONZA 1L3IA 2QE6A 3DP7A 3JWHA 3R6TA 3OE5A 4BLVA 4DKJA 2ZULA 3PVCA 5DX0A 1XDUA 4EKIA 4DF3A 5ICEA 5ERGB 5E2AA 3GRUA 9MHTA 3BGIA 2HNKA 2PX4A 4QVKA 4QDJA 3T7TA 4CKBA 5E2BA 5P8WA 4PYLA 2PWPA 2HR1A 2OXTA 4R05A 3P2EA 5LQCA 2P8JA 4BP3A 4E2XA 1NBHA 5GIPE 5FUBA 1M0EA 1JQDA 1INLA 3G88A 5EKUA 4DQ0A 5GIOE 2G1PA 3HM2A 1G38A 5FADA 3H2BA 2QRVA 1SQGA 2O07A 3M70A 3TR6A 5FULA 3KR0A 3LDFA 3OE4A 4R6XA 2IH2A 2BZGA 2HV9A 1X1AA 3BWBA 3IHTA 2B2CA 3MAGA 5GM1A 3HA5A 1RJDA 1KYZA 2PLWA 3B5IA 3EVDA 3EVGA 3LDGA 4GQBA 5FWDA 2O57A 3GJYA 3FPFA 1XTPA 4P7GA 1ZGJA 2PXXA 3OFKA 3SGLA 1L1EA 4ZTBA 2FK8A 3EVAA 5B1SA 4KDCA 4FGZA 4X41A 4RTQA 3NDIA 1N2XA 3FPHA 4A6DA 1RI2A 2PKWA 3RODA 2ESRA 1KXZA 2NXJA 3A26A 3R3HA 4GC5A 5LQAA 5F2KA 1HMYA 1RJEA 3MQ2A 3I53A 4PCAA 3G8BA 3LX6A 3C3YA 3B7PA 3P2KA 4OQDA 3TLJA 2Z6UA 5FWAA 3HVIA 4H0NA 2JHCA 2YUIA 4Y30A 2IDKA 2C7PA 3ELYA 3G8AA 3LHDA 3P9IA 5HFJA 3V8VA 2QM3A 3EMDA 5EEHA 1YZ3A 4RVGA 5EC8A 4E2WA 1KP9A 3DMFA 4MHTA 2NXEA 4E32A 1YZHA 1G8SA 2FYTA 3ORHA 3LKDA 5DWQA 3TFWA 5LR6A 1KPGA 1SG9A 4WVLA 1NW7A 1R74A 3FUWA 8MHTA 5LQRA 4G56A 1VQ1A 4ATNA 2XVAA 2O05A 1Y8CA 2Y1XA 3O7WA 4FZVA 3IV6A 2ZFUA 4RTKA 2E5WA 2B3TA 4MTLA 3DLIA 4YMHA 3C6MA 1NW5A 1JTEA 2XYRA 4RTJA 1WXWA 3HCDA 4X1OA 3EVBA 3DXXA 4KDRA 4YUYA 4DA4A 4FT2A 3T7SA 4QVGA 3REOA 2UZ4A 10MHA 4PGHA 1PRYA 3PT9A 2PV0A 3DLCA 3G2MA 2JH8A 4YUVA 1X1DA 3M6UA 1AQIA 1VE3A 2NP6A 2OBFA 3A4TA 1NW3A 3HA7A 5BP7A 4R6WA 3RW9A 2NP7A 4E33A 4MQ4A 1O9HA 5DM2A 4ER0A 3G5LA 2B25A 4QDKA 4QPPA 4F86A 4CKCA 3NMUF 3FUXA 3FPGA 4OQEA 3NWBA 5LQUA 5DTQA 4HTFB 3BWYA 4C05A 1ZKDA 1JSZA 1R6AA 3BXOA 3A25A 5FA8A 1NE2A 2DPMA 5BW4A 3MTEA 5DRYA 2PSSA 1JQEA 1ZQ9A 5E1DA 4PONA 3A7EA 5K0JA 5ICGA 1QAOA 4C04A 4E31A 3C0KA 5MHTA 1BHJA 1XDZA 3PLAE 4M36A 1YFJA 2AVDA 2HWKA 4PYNA 5DM0A 3VSEA 4C06A 5M5BA 4XUCA 1SQFA 3KPVA 3TM5A 1WY7A 2PX5A 2EJTA 4GUAA 2PY6A 5K0NA 3M33A 1I9GA 3OZRA 3UWPA 1QANA 2LD4A 3CKKA 5DRTA 2YX1A 3TPZA 4DCGA 4RYLA 1XXLA 3GCZA 4E2ZA 2YQZA 3DOUA 1NBIA 4HGZA 2OY0A 5FCDA 2KW5A 1P91A 1VP3A 3JWGA 1XJ5A 2A14A 5GP1A 4RVFA 5GINE 3A27A 4FT4A 1DCTA 4DM3A 2YXLA 4RTMA 2GS9A 3GRZA 4P7JA 1DL5A 3UJ8A 4ER5A 4RTNA 2PVCA 3B89A 3G5TA 3MB5A 4U7PB 4IV0A 2C7RA 5DTMA 2P3QA 4IWNA 5G02A 5HZMA 5KQSA 5HIMA 1SUSA 2HMYB 5EZSA 3HVKA 1VP9A 5LQJA 5JR3A 1P39A 3FYDA 1G60A 1JR4A 3VC2A 1R00A 2AN5A 3KQMA 4FSXA 4IV8A 3MCZA 5EZQA 4EQZA 2F8LA 2UYHA 3SR4A 3NW9A 3M6VA 5HOQA 2IGTA 3NVKI 2PXAA 2ZZNA 3TKYA 3MERA 3FTDA 4POOA 3PX3A 4MWZA 5EG5A 3A7DA 1MJFA 2FRXA 3BT7A 2JH9A 4MIKA 2R3SA 1G6Q1 5DTRA 4LECA 2CMGA 3FRIA 3PFGA 4HSGA 4P7FA 4GC9A 4PGGA 2ERCA 2YTZA 1MHTA 3K6RA 1XCLA 3UBTA 1O9GA 5E8JA 2OB2A 2P3LA 3GDHA 3GWZA 2PWYA 2ZW9A 5D1NA 5C0OE 4E70A 5HIKA 3NTVA 2PT9A 3UJCA 5ICCA 5CIYA 3P71T 2G70A 5CCXA 5HIIA 5GOZA 3AXSA 3BWMA 3OZSA 4YV1A 4ISCA 5K0GA 1JQ3A 2GA9A 3GNLA 3QOWA 3EMBA 4OX9Y 4GOOD 5F2NA 2PGXA 3HA3A 4RX1A 5KQRA 2PX8A 3UJAA 3LKZA 4RTPA 2I7CA 3OU7A 4XCXA 2P40A 5CCBA 3UA4A 1Q0TA 1AQJA 2NXCA 4PINA 3JWIA 2UYCA 4RTRA 1FPQA 3KQOA 2C7OA 2VDVE 2GLUA 1M6EX 1NV8A 2Y1WA 3PS9A 3WSTA 3ER9A 4QQKA 2P35A 1WZNA 1G55A 1M6YA 1ZHFA 2YR0A 2FCAA 2K4MA 4AZWA 2PX2A 3P9KA 4PIMA 4V0QA 1JG1A 3FRHA 3BKXA 3HCFA 3ME5A 2AOTB 3EVFA 3ANXA 3I5UA 5EQJB 1BKYA 4RV9A 3KQVA 3AXTA 2N47A 5U4XA 2V74B 1UWVA 3BZBA 2P41A 3SM3A 2ZLBA 5DM4A 3FPEA 3K0BA 5K09A 4HH4A 1PJZA 1JTFA 3L8DA 1Q0SA 1TW2A 2IP2A 5EVJA 5DX8A 3KPUA 4BLUA 2PXCA 5EMMA 4AX8A 3EVCA 3KPWA 2ZBPA 1RI5A 3FYCA 3KQTA 3Q87B 3HCAA 4PYKA 5CVEA 5DPMA 5FHRA 3GGDA 4HC4A 2XYQA 4A6EA 4PYMA 5DLYA 2EG5A 3LCVB 5E1MA 5EEGA 5BXYA 5C9ZA 3CJQA 2G8NA 3GRYA 3KR2A 1ZGAA 1QZZA 2H1RA 1JG3A 4M38A 4UOEA 3SSMA 1EQAA 2ZVJA 2WA2A 3ER8A 2YXDA 3PTAA 2B78A 4R8SA 4M37A 5E9WA 3CC8A 1D2HA 5EMJA 5CD1A 3ELUA 1JSXA 5BW5A 2JHPA 5K0BA 4HTFA 1WXXA 2QY6A 3C3PA 4YUZA 2IPXA 3UFBA 5CVJA 4RVDA 4KIFA 3MHTA 5EIFA 2Z6QA 3P2IA 3CBGA 2P1DA 3IYLW 5EMLA 3GRVA 4B17A 5K01A 4FS8A 1G8AA 4RSRA 1V39A 1KIAA 3OPNA 5EMKA 2Z6AA 2H00A 1VLMA 3LCUA 3MTIA 2BR4A 4P7KA 1JG4A 4RWZA 2AZTA 5DSXA 5GWXA 2I6GA 1FP2A 3UJ9A 3G2QA 3CGGA 2XVMA 3PB3A 4FR0A 1BC5A 5KS2A 4OA8A 4JXJA 1IY9A 5DXAA 1QYRA 5D1HA 1NKVA 2IIPA 5K03A 3V97A 3VYWA 5K0FA 2EX4A 2AS0A 3QV2A 4NECA 1Z3CA 4WXHA 5EOVA 3P9CA 4Y2HA 1R8YA 3KQYA 1EAMA 2ZBRA 3M6XA 4R8RA 3RIEA 2PT6A 3M4XA 3HVHA 3BUSA 3GXOA 4HRAA 4ER3A 3R9XB 3LDUA 2G71A 7MHTA 2NYUA 3C6KA 5E8RA 2ORED 3P8ZA 3BKWA 3M6WA 2ZIFA 3FUTA 4KIGA 4DCMA 2ZBQA 1X19A 4OBWA 3EVEA 3OU6A 3KHKA 2OB1A 5EHGA 3HTXA 1F38A 1ZG3A 5K0EA 2ZIGA 1KYWA 3ID6C 2AVNA 4RVHA 1YUBA 2P7HA 3CJRA 3KQQA 3E7PA 1BOOA 2V7EA 2B9EA 5T67A 4BP1A 1XDSA 5JUWA 5DT2A 1D2GA 5CVVA 4EKGA 3ERCA 4CTJA 3BWCA 1ORHA 3GRRA 3O31A 5LQKA 1QAQA 3JWJA 3LBFA 1QAMA 5T64A 3TRKA 2AOUB 2ZIEA 3UJBA 4YV0A 3KPYA 5IKMA 1NT2A 3P9NA 3B3FA 4GOLD 3DXZA 1VPTA 3DMHA 3LSTA 2OPBA 4IKPA 2I62A 4HG2A 4U7TB 1EJ0A 1P1BA 2OZVA 2XYVA 1RJGA 4GOND 1N7IA 4QPNA 4EMSA 3HP7A 2HTEA 3UJDA 5LQNA 2CKDA 2PBFA 5DX1A 3DUWA 1I1NA 2H11A 3LBYA 3PX2A 3EVZA 3SX0A 4AUKA 4F85A 2IH5A 4X61A 3G2OA 4FP9A 3DH0A 5KYGA 2ADMA 4HGYA 1NW8A 3DXYA 5DM1A 1XCJA 2IBSA 2CWWA 1L3CA 5GM2A 2C7QA 2OKCA 3AWIA 3Q7EA 3KQWA 4X60A 1VIDA 2ZCJA 2YVLA 3KR9A 1R8XA 5E9JA 2VZ9A 4C08A 2CMHA 5ICFA 1L9KA 5FTWA 4KWCA 3IEIA 2Q41A 4YMGA 3HCBA 3PFHA 2NNWB 2AOVA 4QTTB 5HIJA 4FSDA 5CM2Z 3U81A 2FHPA 2P7IA 3EPPA 3HNRA 2BH2A 2AOTA 3SSOA 5DXJA 4AZVA 2VP3A 5FQOA 3THRA 4EK9A 3B3GA 4RTLA 2IFTA 2VDWA 1OR8A 3F4KA 5E1OA 5K05A 4XUDA 2BM9A 3FUVA 1KPIA 3NDJA 4C03A 5E9QA 5HILA 2CL5A 4CKEA 3AY0A 1KR5A 1ORIA 2BR3A 1UFKA 1N7JA 3TM4A 3KQSA 3QOXA 3LL7A 2PJDA 2QRVB 3CVOA 3ELDA 2P3OA 5K8VA 1IM8A 2G72A 4L7VA 3DTNA 2YXEA 3GO4A 1AV6A 5FA5A 2AOWA 3DR5A 4PYQA 3TQSA 5LSAA 2JHAA 4CWAA 3KPJA 4LWOA 4CXMA 4KVZA 4O29A 2IBTA 4PCLA 4E30A 1YB2A 3MGGA 4M7RA 1EG2A 4GEKA 3X0DA 4C07A 2WK1A 2UYOA 5EGSA 3EEYA 2FK7A 1EIZA 2ZWVA 4OBXA 2GB4A 2ZZMA 5C1IA 3DULA 3KR1A 1WG8A 5FHQA 3UA3A 1FJXA 3FPJA 3OZTA 1P1CA 1B42A 2EJUA 2VS1A 3LECA 3G7UA 5DSTA 1O54A 3R24A 5CUQA 3G2PA 3HEMA 2GAFA 1RI1A 4PWYA 5T6BA 4AZSA 2BM8A 5KVAA 2IDJA 2VDUE 1R18A 2DULA 1TW3A 3DMGA 3E8SA 1UIRA 3FZGA 4QTUB 4LWPA 1DUSA
chains in the Genus database with same CATH superfamily
2JCGA 2Y8EA 4JGGA 3CF6R 4E13A 4ED9A 5DHQA 1PYGA 4YQEA 1GLGA 1N2BA 1PLJA 3SQDA 3TN7A 4FBMA 4XOUA 1BWPA 4N65A 1PJSA 2XMZA 4DREA 4K03A 4YUXA 4Y9TA 2P5UA 3CH4B 3JARB 3W5JA 3OCWA 4TYMA 3VUFA 2OMEA 2HJ9A 3UW3A 4FYXA 4JUFA 1GZUA 2PK3A 4MGZR 2CNNA 3N2YA 2BY4A 3H7IA 1YVRA 1WKBA 2CBZA 2XUDA 1GTZA 3FTPA 2G4LA 4FMDB 2GK4A 3DO8A 4I55A 4TLAA 5A3QA 1BO6A 2QVXX 3M82A 2GPAA 4WUTA 4QXOA 5K7SA 4OLBA 3BZWA 5LDGA 3WRWA 1RQLA 3OFND 1E9AA 1OA0A 1QVWA 1KEKA 3KDPA 3ZPXA 1DAMA 4OA5A 4RZXA 4KXQA 2UV8A 1QFZA 2VJCA 3ENWA 3TS1A 4C0LA 1PR3A 1HNWB 3FPKA 3EQ7A 2Q6LA 3IMEA 4HZGA 2UZ0A 2AFIE 4JQZA 4PY2A 1FP4A 3BBLA 3SEAA 5BRNA 3ZE0B 4S12A 4HN2A 4B76A 4JVMA 1UXOA 2CVZA 3NT4A 1F9AA 1QRDA 3DWIA 3LF2A 5L9AA 3PENA 2QL5A 1VJ0A 4IEFB 1QGUB 2PGAA 2NO0A 2BVNA 2PH1A 1ECFA 1XROA 2Y77A 3CJTA 3MGAA 5BSWA 1YJBA 2X5NA 4YECA 2P2NA 2WJZB 1MVNA 1Z6ZA 3LYLA 4GNKA 4I46A 3BXHA 4X63A 1A9TA 3TINA 4DFDA 4WBNF 6YASA 4IOKA 3FZNA 2FE4A 2WFAA 5ALGA 2XDQA 1Z12A 3NALA 3L4KA 3CVWA 1CUHA 4DSTA 4BEWA 1MC8A 2BTOA 4GZ6A 4Z2YA 3URKA 4M0EA 1MH1A 2ZDHA 4LDPA 3SXJA 4KE6A 3AFMA 3H5VA 4HRXA 2C29D 1K98A 4OREX 5ALHA 3ND5A 2HUNA 4DMCA 3JQRA 5IC4A 5IYZA 5FLXA 4QM6A 4EB6B 4QASA 4WQMA 2BFOA 2F1RA 3RAJA 3VR5D 2Z2ZA 4NYMR 1TC2A 2FMTA 3UJ7A 2QMHA 4I8DA 4E6EA 2DJ5A 1A2QA 1GTVA 3R4VA 2W0SA 4ID9A 2FWMX 3D5TA 1T2EA 4I4TA 1JKFA 4KIJA 2QIOA 4TQAA 4ARIA 2Q4BA 4DDUA 1QDEA 1GDDA 2A5JA 2YOFA 3FNEA 5DN9A 1WSWA 1N32B 5C1BA 5IXYA 4XIIA 4TUYF 1BS9A 2VBCA 2ZIWB 3OZBA 7MDHA 1J0AA 1MZVA 1OF1A 1JQAA 4W7IA 1EUZA 1HQKA 3MWJA 4JMLA 4BVFA 4G9EA 3LYAA 3ZJTA 2FPUA 3Q9LA 2ZJ0A 3HBLA 1RMYA 4NG5A 3T7TA 1BVHA 1R9MA 1ZBQA 1YHNA 4PYLA 5P8WA 3ZJ5A 4EHDA 4CMCA 4IG9A 4R05A 2OA0A 3ZWNA 2BSQA 3AESB 2X77A 1TRKA 2AJCA 2C78A 2CHFA 1XZQA 4M49A 3QXHA 4JI8B 1XHEA 1SC4A 1INLA 4LC0A 2ZKIA 5LPNA 3ND6A 3UUFA 3TJZA 1JAZA 2EDAA 3JR7A 3HEAA 4CEIB 1B3RA 3M4JA 4JLSA 1YBAA 1DADA 2HQOA 3PHLA 4A4DA 1ODFA 1E4OA 1Q0RA 5GM1A 3JQ9C 4HDNA 2CF5A 3NTLA 4OMUA 3MNFA 4EGJA 5FWDA 4DUGD 4LE1A 2UVPB 4O2BF 4G4GA 3E35A 3FLBA 5EXEA 4OBBA 5MF6A 4KXFB 2ZIAA 1UJCA 4UAUA 5DHAA 4MR7A 1RAHA 3IBCA 3QVTA 1FQOA 3L92A 4F2WA 2ZETA 5T3YA 5JJLA 1ODSA 4P4NA 3KWMA 3V42A 4Y2PA 1DBIA 2I8CA 2C7VA 1HMYA 4LXXA 4TV8A 1YS6A 3H1PA 1RIIA 4KI0A 1RKQA 1B3BA 2Y4OA 5KYXA 1M66A 4M7PA 3EOBI 2HD4A 2QZ4A 3KKKA 4CEHB 3QTBA 2WMDA 3SVTA 4CBVA 3U09A 4I6GA 3ORHA 3EZ6A 1DC7A 1KPGA 1DJNA 4OSPA 5FOWA 3SICE 3D8TA 2SCUB 4N3GA 1VPLA 1E94E 5HBRA 1NZJA 3A3PA 2JFPA 2ZFUA 1WSBA 3A2MA 4K6CA 3N05A 2B3TA 3IQDB 1VECA 2YS6A 4Y2QA 5HCUA 4IVRA 2P9TA 1JEDA 1JSRA 4JJZA 4DCNA 3UPTA 3VZQA 3ETJA 3X3HA 1Y1KE 3K2BA 2AG0A 4G65A 4MIEA 1R5NA 4BATA 2QW0X 2VOJA 4KGZA 1M5UA 2PZBA 3RRJA 4R2HA 1PRYA 1OV6A 2KPOA 3VYSB 4OMDA 4Q1EA 4D4JA 2ODWA 5FH9A 3RSSA 2IJGX 2BCGY 4GOKA 1ST2A 5ITVA 3A4TA 2FZWA 4MO9A 3ZZMA 4E11A 3AJEA 4G0OA 3LW7A 3MAAC 1DQNA 3NYIA 2AUMA 2AFIA 3K9HA 4UCWA 5AI5A 3DBOB 4UAGA 4L4ZA 4WNYA 4XJTA 2IF0A 3P9PA 3LM8A 4ZRMA 1NHWA 4J03A 3VKHA 1JL3A 5SYAA 3SCZA 1J00A 4LZPA 3TZHA 5CLFA 3DOJA 1DKOA 4OO3A 4WV3A 3YASA 1GG2A 3OQPA 4C04A 2ZB8A 1BHJA 1C4KA 1Y5RA 2QRZA 3UYLA 1C50A 3GRAA 1GJRA 1BXGB 1EFDN 4BFTA 4C1BA 3TM5A 3X1YA 1CR6A 2O23A 1X7ZA 3KJHA 3NATA 2EWMA 2PD4A 3OQJA 3OJXA 4GI2A 4GUDA 4TKVB 5JNTA 1R4NB 3N0TA 4PGMA 3O8NA 2EU8A 4KR0A 2R5FA 3ADPA 2OGUA 4YQFA 4Q34A 2YQZA 4CI9A 3O8RA 4X6YA 1I7NA 2R8PA 3EAFA 2WUEA 1P91A 3ROZA 4R68A 3RYFB 5JISA 3I2GA 2CDBA 3L77A 1FDRA 5CEJA 1OLSA 1RAAA 1JQJC 1SKQA 2XE7A 4AJEA 5CCDA 4CUZA 3RIYA 3PQFA 4OYRA 4P7JA 3MS2A 2J7PD 3NZEA 4ER5A 2NG1A 3I09A 1UXJA 2W6NA 1J2TA 1R10A 3DDWA 3IE0A 1M6VA 1MRNA 4LAFA 4WMLA 3ZV4A 5HZMA 2Q5CA 3ZX5A 4GMHA 3EX7C 1E32A 4MGYR 4X1YB 2J07A 4IIBA 5G4KA 3BM5A 4ECEA 1GZ6A 4UUBA 2X5JO 2EJWA 5FAXA 3A3OA 1A4IA 4CMIA 4F3NA 4TVSA 4W99A 4LDZA 1KYVA 4CL0A 1I3LA 3X1ZA 3R5JA 1JS1X 1YZQA 3I6BA 4Q00A 5BSKA 5JHGB 5DFAA 1DCFA 5ISMA 4YFVA 1U31A 1V45E 2VTEA 3A7DA 2Z0MA 1HLGA 4IIJB 1S2NA 2KE5A 3DO6A 4I7EA 2PX0A 2ZR9A 3VHQA 1UT8A 1JKJB 4I8IA 4IJUA 3X1DA 1NYQA 4Y2UA 5FNVA 3SZ3A 2ZW9A 2I1LA 4N5LA 1MUUA 5CIYA 3RS3A 3DW3X 3UJCA 4HS9A 4X7PA 4Z5XA 1K5DA 1J33A 1FA9A 1XL0A 3M5PA 3SJBA 3IV7A 1E1DA 4TTTS 5LZ4A 3QKSB 4KOEC 3HKEA 3KZNA 4J6EA 2BEVA 2OKGA 4LF6B 3GYGA 3EA0A 4TL7A 2BIFA 3WS7A 2G1KA 4NABA 4KGXA 4W7SA 3RK0A 3ZBTA 3ZZTA 2OO5A 1QVAA 1VIYA 1B41A 2YRFA 5ULLA 3SXUB 4YS6A 4BNDA 4KJXA 2BISA 4DV4B 4DNOA 4EO7A 1V5EA 4M76B 2EHDA 4LS3A 3GZTB 1P2DA 3JD1A 1G8HA 5CFOA 1T3ZA 1TK9A 9ATCA 2N9UA 5A05A 5JYEA 4V0QA 3BGSA 3UWSA 1AMUA 4MI6A 2B36A 4JSTA 1XZJA 1W96A 3P2YA 3OD5A 3GNTA 4P34A 1S2OA 5A62A 1IPEA 3ENKA 5TARA 4EZIA 2WWWA 2H1LA 5KC9A 3TI7A 1XYGA 1VDMA 2PRJA 5IVDA 3A9SA 3ILXA 5AP9A 4TMWA 4A8JB 4DWJA 3RAGA 4EJ0A 1G7SA 2VYNA 2NUPA 2WD7B 4G5RA 4KB5A 1WPXA 5DI3A 4ZREA 5KNDH 1SQSA 2ZWPA 4QOHA 1WD5A 4M83A 3G1UA 2IS4A 3KYDB 5IWCA 4IQ0A 1E0DA 5KNBH 3CO0S 1VBMA 3NT5A 3WB9A 4PYMA 4DYVA 1SXPA 1J5EB 1FXUA 2GHRA 2GRAA 2Z1MA 3C5EA 4I36A 4KE9A 4Z86A 5DOVA 2QG6A 4J0EA 1L7DA 2X2EA 1FFYA 1I3OA 1ZGAA 2MMCA 1A7JA 1RWOA 3NO4A 4GRDA 1C7JA 4L5CA 3FKQA 4XASA 1GAJA 2NIPA 3S2ZA 1USUA 3AOEC 4EAQA 1QB8A 2TYSB 3LUHA 3PD7A 5I9IA 4M37A 2XTAA 2VJAA 4AWXA 1D2HA 4K1XA 4RKEA 3ELUA 4YRDA 1JSXA 5EMJA 1M54A 5JAIA 2J5RA 4KIUA 3WNVA 3V8PA 1WXXA 3KUKA 4ESHA 2GD1O 5CVJA 1X7WB 3R0XA 2IXBA 4YAWA 2RK3A 3SDSA 3ZGZA 1FRFS 1EFPA 1HE8B 2I4OA 4EP1A 5JAPA 2BM1A 3UMFA 1UC8A 2CVFA 1K7CA 2QN1A 3OPNA 5ALVA 1JKIA 1ONNA 2FPPB 4MS4A 3KTFA 1TTHA 2H92A 4XE5A 3WLNA 1G7RA 1PX0A 3EVNA 1ADJA 3IQXA 3FNQA 1UBLS 1FW8A 4Q24A 3DAPA 3HJUA 4GE3A 3CKYA 4WK0B 2XDYA 3R7WB 4IJ6A 2PMWB 4PSCA 3FCEA 4Q3CA 3TSZA 2C9MA 4XR9A 5K8LA 3MCAA 4UCXA 3ZY2A 3L40A 1TNDA 3SC4A 1XQ9A 4YMIA 4WZZA 1ZQ1A 2WYOA 1L5HB 3CY6A 1ECLA 5HX7A 1FYFA 3NM4A 3SZMA 1NQTA 3GVXA 1Q7GA 1BMTA 3EH2A 1OBHA 3E5HA 3HU2A 3WWDA 4FLEA 2RD2A 3PNBA 2OK8A 4XWWA 1YS9A 2WF7A 1NHGA 1V41E 2GVNA 4G9GA 1P44A 3QX8A 1QGED 1PT7A 3QEMA 2I54A 1E5XA 3GJSA 4LJSA 5I9BA 2RFLA 1OU0A 2OB1A 3KHKA 1TCCA 3U40A 1JJFA 4LNUB 4D79A 4M1EA 5HMMA 3W8RA 4DLAA 2ZUEA 1B93A 3ID6C 2LE0A 1DEXA 4ARCA 2HPZA 5IM4F 3HV0A 3NVKI 4KQFA 2C2YA 3COPA 3M9LA 1JR2A 1PR0A 4DV2B 4EHAA 1IZ7A 1QAQA 2VXOA 1EA5A 3UAOA 2PM8A 3TRKA 4YRSA 2Z98A 4NU5A 1MFZA 5YASA 5J1TB 5TPZA 1NT2A 1BXRA 4F12A 3KQHA 1MIHA 1E2DA 2WTAA 1YBHA 4MR9A 1R4MA 1VPTA 1TEHA 2ORVA 3ZD6A 1KAGA 1EJ0A 1MEJA 3DA8A 3G85A 4EMSA 2WHEA 4FE3A 4K3VA 1VJ1A 1UBKS 2IXAA 2ZRBA 3KYCA 3TXAA 4EG5A 1UQUA 1DEOA 4E03A 4B71A 2ZYGA 4BE4A 2FUG6 2NXWA 2FPRA 3C8UA 5B2FA 2PG3A 1M67A 1SRRA 4A73A 2ZVPX 2R60A 4CMBA 3OZVA 5K8TA 3KL4A 3R2JA 4KOAA 4UJ5A 5DM1A 4BNIA 1G0NA 1VHLA 3PIIA 2IBSA 2AW5A 3QVMA 1P2BA 3JQ8B 4L3VA 5GM2A 2OKCA 3UV3A 4HUTA 1G19A 3C70A 2ZCJA 1VLQA 3UHPA 4I1VA 2FPIA 3U3KA 2ZUTA 1KEZA 2QRJA 2C4WA 4IIFA 4C20A 3OM8A 5AUPB 3IHKA 5JV5A 3HRHA 1TI7A 4YMGA 3EE6A 3HCBA 3IKMB 1GQSA 2WYUA 4V0ME 2XIJA 5DNAA 1KQPA 1NVMB 1RXUA 1WMDA 2X6RA 3EDQA 4ZO4A 3SG0A 3GGGA 1AD2A 4QUBA 1SMKA 1ES9A 1GZVA 4RVOA 3J81A 4B75A 2I4MA 1ORRA 1LC0A 2W2MA 4RXTA 5EZ6B 621PA 4KK4A 4RVCA 2CC2A 1PD0A 4MUIA 4M9ZA 2PU7A 3H0CA 3HB1A 4CQMA 5E9QA 5HILA 3RBVA 2GBLA 1IJFA 2ZXFA 3DKKA 1QG4A 1BS1A 4ZI2A 3T1HB 2FSPA 1V7PC 3CVOA 4Y2YA 3UO8B 5CGZA 3JD3A 1NJSA 1Y6JA 1V4VA 1A9SA 2BKAA 2XQIA 2Y2UA 1PG0A 1D3AA 2WDZA 3O8OA 1PZEA 1USKA 5DYGA 1T2NA 5A5GA 5HK9A 1J1UA 4JS0A 2Q2OA 2VHZA 2OLJA 4JA2A 2G0AA 1GV1A 3ED1A 3EIFA 1Y98A 3B12A 3KV1A 3P4UA 4B7AA 1RKXA 1GU0A 5KTPA 5E6UB 1LTKA 2VF8A 5CDGA 2WK1A 1O5OA 1UP4A 4BV3A 4OU5A 2H54A 5FKJA 3R7DA 3KWFA 3HWX1 5ESRA 4KYIB 7ABPA 1YE8A 3ZHCA 2F4VB 1GILA 2R751 2PSHA 4JQCA 5FI3A 3VHXA 5A7HA 2WIKA 3F9RA 1DV1A 3ANSA 5EJIA 5CB4F 5JD6A 3MSCA 3PLNA 3UB2A 3OF2A 5FBWB 4F92B 5EYPB 5CLQA 1M2GA 5CVCA 2VYFA 4J49A 1K7XB 3KXLA 2OQRA 2PWBA 4UE2A 3SJCA 4XCQA 3CEPB 1H2ZA 2QAJA 2LIVA 1GFWA 2PEZA 3Q7SA 2PGDA 2VUSA 3MJDA 2EAUA 3N2KB 1DE0A 1KQ3A 1YD7A 3CLUD 4NR0A 3OH8A 1E5TA 3DS8A 2IOYA 2ZJYA 3SN6A 2F62A 2ONYA 3AF1A 2HTFA 3NUQA 3I9FA 4NK4A 5CA0A 5H8WA 3SF8A 3DP9A 3GNQA 5HF9A 4XUEA 2EZ8A 2Z57A 3LHKA 4JT9A 1K6MA 3CW9A 4AJKA 1ZR4A 4EA7A 2FN7A 3IH5A 2Y3IA 2YWGA 1G98A 4L3WA 3BHIA 3V4RA 5CH8A 5EIEA 1VBFA 3NCHA 3M3HA 1UF9A 1G18A 3N0XA 1O8BA 1JE1A 4MV7A 5EKXA 3SIRA 1XA3A 4QPCA 3E05A 5EHIA 4J3NA 1GTG1 1K6EA 1Y3IA 2AK2A 1KZHA 5AM2A 4V0SA 3ZGVA 2P5SA 2BE7A 1C7EA 4WWHA 3TX6A 3JAKB 2IYLD 4UU1A 2XBMA 3ZBUA 1WV1A 3V8BA 1OYWA 3QMPA 5JQGA 3OX2A 4B3SB 2P9QA 2AC4A 1SKMA 3OCJA 4EWLA 2YV1A 3MFYA 5DNYB 4Z0HO 4TKUA 2GN4A 1NN3A 3JQQA 4C0AC 3BJMA 4MQBA 3UMYA 4WFJA 1RVDA 3E15A 3PCXA 5I4CA 1ZXLA 4GOJA 1T9CA 1XF9A 4HLDA 3QY0A 4E4YA 3JWPA 5JZ9A 3IJEB 3ORYA 3H1AA 5JCJA 1YFLA 4CIAA 1EIWA 2X7HA 4KCGA 4OLHA 5B1IA 5IAKA 1TM2A 2Z09A 5I7UA 2VHYA 1WUIS 1U9ZA 1T26A 2Q9AA 4QGBA 4RK4A 4YQZA 4E2YA 1NYTA 3VV2A 2NM0A 1CY0A 2UYQA 5G41A 1U94A 2JFVA 3FYUC 4QDXA 5DNCA 3OUZA 4DM7A 5IJ9B 3JALB 5L51A 2B4RO 5ELLA 2G04A 5BOVA 4KHPB 1E4YA 2CFCA 2QUAA 4FW8A 3EG9A 1CUEA 1Z28A 2FETA 4IDFA 3JWHA 1GSHA 4JB0A 4ZOLF 4MAFA 4BLOA 2R4UA 2FQQA 3BIXA 4MI1A 3TLAA 1NR7A 2EW1A 1C8BA 1ORDA 1SUPA 3TNJA 4G1BA 4BNYA 3LA6A 4QJ5A 3D7KA 2OHJA 3QKIA 1LX7A 1ESMA 1FNNA 5DASA 4V0MA 1PLKA 1D07A 2OXTA 4XM1A 2BFBB 1ZESA 1DJMA 1E1RD 1FFDA 1IIBA 1Q0PA 2B1RA 3G17A 4G63A 4RPHA 5IT0A 4MXDA 5CT6A 1W4BA 3K8QA 4B7ZA 2ZUWA 3QE2A 4IHJA 1IZZA 2PCLA 4YFYA 3AI1A 3TIFA 4WLEA 1MEEA 2W6MA 4M8NE 1FYDA 1LS1A 2WLTA 1WHSA 1MO3A 2XNCA 4BX2A 4CTMA 2QE7A 5LU9A 5FTMA 4B9EA 1R3UA 3U4CA 1TM1E 1FE8A 2XAUA 3MAGA 2JKYA 2VJPA 1I1OA 3PYXA 4BB6A 2GXAA 1TUGA 4ISBA 3B5IA 2YZKA 4JT4A 2ZTUA 2XCTB 4INJA 8ABPA 1YOVA 4N82A 4QFDA 3EG5A 1W47A 3ZVMA 4AS3A 4K9MA 5F2EA 1CUSA 1SUWA 4KDCA 1U2PA 1VG9B 3FAKA 2HK9A 3Q1KA 4R9NA 4XWOA 4F60A 5T5QA 3K0KA 1PVDA 4M9SA 2ZI6A 3H16A 3ZU3A 2NSYA 2X5XA 3NHAA 4LZNA 1RJ9B 3PJFA 1HPLA 4Y0NA 1KO7A 2QNIA 1IHYA 4OFZA 1KZ7B 4D4MA 1VB5A 1TQ4A 4OQDA 2OFXA 1C3JA 2VDLB 1ZUIA 1F12A 4X91A 4CI0B 2RHJA 3TKLA 4DV6B 4B80A 3RS2A 2HB6A 1KQOA 2VQ3A 1JBEA 4M0MA 4YT2A 2XNJA 3JZIA 3ZNNA 4MRMB 1N0UA 2BJVA 1NVXQ 2BMJA 4NI5A 4ZXPA 4AJNA 4C4OA 4ZVQA 5J5CA 1JEJA 1LJUA 3FNHA 1KOLA 5ABPA 3VMFA 4U7DA 3AF4A 3IAUA 4KXUA 4XA8A 4AECA 5LQRA 1TA4A 2ISQA 3IAS6 3ZHYA 3D4NA 4TVOA 5C4IA 1Q74A 4UFNA 4D74A 2Y1DA 4WXRA 1Y1LA 2FFQA 2C4NA 3WHLA 2X6TA 3T9FA 1FXSA 3AVVA 3L1JA 3X44A 4BLPA 2XTJA 2I6SA 3OLWA 1TZMA 4DMUB 1RHKA 1JTEA 2I6XA 4DDHA 4KDRA 4W6ZA 1XLTA 4P9NA 1XN4A 3UN1A 3KOYA 2NSJA 4RY0A 3L1KA 4ROTA 1Z38A 1TQ8A 1Z3IX 1JAHA 2VNAA 3II6X 5F7ZA 1SOVA 5I6DA 3LBAA 1LK7A 2GM3A 2VP6A 5D3QA 4PG4A 3JVEA 2HHJA 1PNVA 1N0IA 5J63A 4KR6A 1SM4A 4ER0A 4N3CA 1RACA 5CLJA 4QNNA 4X66B 1UWCA 2JCSA 2RSLA 3GA5A 1ZKDA 4HTFB 1IVNA 4TMYA 4WH0A 4TV9F 3HGQA 2DPMA 4ACAA 3I83A 3ENZA 1EAYA 1Q22A 2IVZA 3NPAA 3P9QA 3SQLA 1LJ8A 2DUUA 3F6RA 4KLCA 3WLFA 1DP4A 2A92A 3PXEA 4M36A 1YFJA 1RWQA 3ZXSA 4INOA 5DM0A 1WSDA 4Y3UA 2WUFA 1G63A 3PGJA 1OD6A 1F14A 4YC7A 3STYA 2IK8A 2QN2A 4PPGA 2PY6A 5AYVA 4PM4A 3M33A 4NENB 2ZJOA 5ES4B 2DAPA 4F2GA 3DV2A 4HK4A 3C6BA 4R69A 3GP3A 3RBXA 1N2JA 3RUHA 3OMLA 4N40A 1JZTA 1QM5A 2XIQA 4ZQEA 4JXZA 3HJHA 5CX1A 3W1VA 4PLGA 4REMA 5BY2A 5EL0A 2LCIA 1FQJA 3Q7QA 5C1DA 5IU6A 1LU9A 1E9DA 4JL5A 3HK2A 1CUWA 2FPKA 2C88A 1YNOA 1A4UA 1DKRA 5HKKA 1LPSA 1DOAA 4H4DA 4DQVA 4C0QC 3VBCA 3V4PB 3FDXA 1V3QE 5I8PA 2BUCA 3H9CA 2CJYA 2FPSA 2YJ6A 2ZUVA 1QO0D 3QX9A 2XT0A 4PVDA 4AVYA 2CFSA 4FGLA 5FL7D 4C5BA 3CLSD 3OT1A 1WDTA 2HBZA 1T35A 2O8CB 4FS3A 1OREA 5D2CA 5A4DA 3FYTA 4BO5A 2OV4A 1PIWA 3I62A 3F74A 3OZXA 1E1KA 1A8IA 4HQNA 2GARA 3LTNC 5DHTA 1EXMA 2Q6OA 1SJ9A 1W1IA 2O2HA 5L40A 1KRWA 4KEAA 2EARA 2NO9A 3DV0B 5FTJA 2E85A 1WBJB 4DA9A 3BJZA 1JXMA 1SCBA 5AW3A 1ZRMA 5KTTA 4ZWNA 1TVCA 3HNPA 4PR3A 2UZAA 3CUVA 4HYTA 2RB4A 3QXXA 3Q6NA 4WESA 4B9AA 3IIMA 2P9GA 3IESA 5HSGA 1O9GA 5GONA 1A98A 4HXYA 1D0SA 1EVZA 1W2GA 5D1NA 1E99A 2FOIA 4O2AB 4Z3OA 1BQ3A 1P33A 5DBEX 4YV1A 4UXIA 4GM4A 2QYSA 1XNHA 2WIAA 1X7DA 4UTXA 2WAOA 3GVPA 3M6FA 1SNYA 3FNGA 1ETUA 2WT9A 1UKVY 2JVKA 1JDPA 1U65A 2DPGA 3QEJA 1YR8A 4MS1B 2AXEA 1L4KA 4IFBA 3E0XA 5B3AA 4AY6A 4UBOA 4F45A 1N6IA 2PUAA 2A1UA 3D6AA 2XY4A 1XYYA 1Z4NA 3Q8XB 3K9QO 4DEVA 2A9RA 2VNJA 3W04A 1AQJA 3NOQA 1XRMA 1XEXA 4H15A 4DLRA 4DRZA 3MWLA 1ZM4A 1KK0A 1M6EX 2OCXA 5EIBC 3PS9A 1AHNA 2VWHA 5BSRA 1G55A 3PRJA 2PH5A 3J81k 1JG1A 1RAFA 2Q50A 4II7A 1L5SA 4OJYA 4QVIA 2ZUFA 4FKZA 1RW4A 2OBLA 2OK7A 1ACMA 2ZWOA 3HV2A 1V8DA 5U4XA 1ENZA 2J0SA 3QWAA 4GEGA 4F91B 4AAYA 1XCPA 1SC3A 2B1QA 3RUEA 4JQYA 5KYUB 13PKA 3DCNA 3IL2A 3FWZA 2GASA 1JGTA 2PU5A 2V3VA 3DAGA 3F5QA 1M76A 3O91A 4J76A 1IBLB 4G5OA 2XOEA 4MCJA 3A9WA 3TR0A 3MIZA 1VSVA 4LZAA 1HWYA 2I55A 1F6WA 1OIVA 1XX6A 3AK4A 3ZZNA 4B6JA 4F04A 4J16A 1U8UA 2PUJA 4RH1A 1XXHE 3EBOA 3VU9A 2P91A 1MIOB 1W0JA 3BD7A 1QZZA 2H1OA 2J4DA 2CNKA 2IE8A 3USES 1J2EA 5KSWB 2OCPA 2Y0DA 3CZPA 3BHNA 3R0ZA 4D92A 1W93A 5LMNB 4P82A 1LK5A 2GWRA 3MTDA 4J0KA 1XC7A 4ERNA 1HFJA 4YUZA 5AUNB 5JXHA 4AS2A 3WFJA 4LJAA 4RENA 2ZIUB 1N57A 1RQ2A 3FVVA 2XEDA 3TRDA 2YMQA 3ZNPA 2Z2KA 3R44A 2QRPA 3LQ4A 3UHAA 5A6SA 2UUAB 4DW8A 1KIAA 5BQPA 5IJZA 1PEDA 1SZDA 4ACBA 5DSXA 1MN6A 3LMKA 2O0HA 4JP8A 1WUHS 2XUGA 4XKJA 4D8WA 3F3MA 4FYWA 3DR3A 1IPFA 4AK9A 1KAMA 5KS2A 3RRNA 2GAOA 4PNHA 5FEMA 4NG4A 4W5OA 5K03A 2GFQA 3VBEA 2G17A 4XIFA 3E5RA 4PTLA 5KOHB 3PQEA 1KORA 1XCBA 2P9YA 3QV2A 4EFMA 4J3FA 1XHLA 4JJ7A 1FQKA 5JI2E 2ZK7A 1KDVA 3T5BA 4IIVA 2GESA 1BX1A 2JH3A 5LZ8A 1FRQA 5JAZA 1YA4A 2PT6A 3EMVA 4ZVVA 5TT0A 2ID9A 4DABA 1FNBA 1COZA 2FEMA 2G71A 2F9FA 2L82A 3ABSB 3B9BA 4OGKA 2AKEA 2Y0EA 5AW0A 4JL8A 5G0TA 3SKXA 2W83A 4AUNA 4RHUA 2VSOA 1NN1A 4LMAA 4BNKA 1WDKA 1J97A 2ETXA 3GROA 4DSAA 3TB4A 5K0EA 2ZIGA 2RHDA 1JJAA 1N5MA 3GMTA 1XLTC 3SEFA 2CVOA 1W2WB 1ZD9A 4TN1A 2QMYA 2B8NA 1MX3A 1X39A 2BFCA 1HL3A 2HO5A 4ETNA 4ZV4A 3G02A 4OM7A 3CISA 1HLPA 3OIFA 4GVPA 4M8KA 1JA0A 3GGPA 1JHUA 4KTVE 3FOFC 4GLJA 3F5SA 4HVLA 1BH2A 3EWSA 3ADDA 2GEVA 1HK7A 3G1WA 3IV9A 4TTQA 5L3RA 3RU2A 2FZKA 4MLPA 4EY7A 3U44A 5KJEA 4GRAA 2QGNA 3ST7A 4C89A 2RHCA 5GJBA 2G88A 5AI0A 1NOIA 3VR6A 3V1YA 3AVWA 3KB1A 1AS0A 2LZ0A 2W7TA 2V6JA 4LK2A 5DKFA 2N75A 4W5WA 3EVZA 4RK6A 3JQAB 1SBHA 3EXIB 3OLYA 1ZM9A 2HJRA 3PDHA 3DE2X 3QVGB 4FR5A 4H6WA 4RPCA 4Y0AA 3DH0A 4RORA 5KYGA 2RH5A 1HR0B 3UATA 5FX2A 1GQRA 4R5HA 2C2OA 1Y33E 2CWWA 2JIBA 2C5HA 1RAIA 1TUIA 2O6LA 2QUBA 3TLBA 2QRKA 2K7FA 1L5LA 4EHFA 2OOSA 4KAJA 1U5AA 1A3CA 1NX6A 4FFWA 4ZEVA 2AMFA 4G1CA 2RARA 3PI7A 4NZ9A 3V2IA 4HAYA 3QVXA 4KQIA 3HNRA 2ZWIA 4XLLA 1GKIA 1DFHA 4A0RA 2QI9C 1YWGO 4CF6A 3MJ4A 1P73A 5DEIA 2D7DA 5LOVB 1XAGA 1YJXA 3AIIA 2QBYB 3O1LA 3OM1A 4RVUA 4Y1EA 4FBLA 2NSDA 1XMIA 4L3OA 3BQMB 5G2OA 1XVUA 2V6GA 2B6HA 4U3JB 1BGWA 1DQYA 3IAXA 3D6TB 5KI6A 3JD4A 3GLIE 1KO8A 3LL7A 4ZYVA 4JA0A 4KODA 4L07A 3WBJA 4DCPA 1LEHA 1ECBA 1L8QA 2NVBA 2WUWE 3GD7A 4W8HA 1ESZA 4BGVA 4PGAA 4ENUA 1YRHA 3ZE8A 1XV5A 3C87A 5HGJA 1GWNA 4LJKA 1N7HA 3EC2A 5FI5A 4PNZA 5F7XA 1UPFA 3MGGA 2PD3A 4BWYA 3GEBA 1KI6B 2VUHB 2XHEA 4JI1B 5KVVA 4IIHA 3EEYA 3THXA 1EIZA 2UXCB 4TXJA 1XXHA 3UC5A 2I7XA 1DQZA 2L69A 4FFRA 3DDUA 3ZD9A 4BNDB 4BYGA 2CE7A 1L5YA 1RM0A 4JODA 1Y37A 1QTIA 4OHBA 5KCZA 4TLMB 1O97D 4WKCA 2C3UA 4EI9A 2QG4A 3T4EA 1ZD5A 3E9ZA 1P4AA 1XCOA 3ECCA 3G2PA 3K70C 4R5MA 3EB9A 4AZSA 1YA6A 1F8UA 1ZOOA 3BTSA 3QGMA 1S4MA 2BM8A 2PPVA 5KX5A 1HYGA 4MO2A 4UVEA 4KG7A 5EERA 1WL8A 1RYEA 4AKHA 1RPJA 1XTVA 2EZ4A 4IOLA 4D44A 1UDXA 2JASA 4U5XA 2GCEA 2V3WA 1AA6A 5CFPA 5FI1B 1YS4A 1DNPA 4K9PA 5BYBA 4CTOA 4YP0A 1DGQA 1RI3A 4NNPA 4FJ2A 3VJMA 2JLXA 3TG2A 2BTQA 2IH4A 3PXDA 5IVPA 3COYA 4NF2A 4JV5B 5F7OA 1TUEA 3SVZA 4AMUA 3TKAA 4EUKA 4C1NA 4XD2A 4KO3S 3NBMA 4YCDA 1IN5A 3TJMA 3FFXA 3ONDA 3BXGA 1QO9A 1HY3A 3P4XA 1PJRA 3PTZA 4Q9AA 1K8QA 1G8GA 4K5QA 5IP5A 3RS9A 1W75A 4BLWA 4PN7A 3AB8A 5BWOA 3LX4A 1D2CA 4FOPA 4H1TA 4IXTA 2QT9A 4NICA 5FR1A 1UBNA 1R37A 1RYFA 3FZQA 3P0FA 3A3KA 2W6QA 3LNTA 3TVYA 3VPXA 5CLHA 1HG1A 5JSFA 3WZ2A 4G1EB 3MCVA 4A26A 1XAHA 4YDQA 3H2GA 1IVSA 1G20A 3CU5A 4EFLA 3GLKA 1CR2A 3OICA 4RQBA 4D80A 2EBUA 1M33A 1GGKA 3MWFA 4ZDKA 1U6JA 2I1VB 1WU8A 2GRUA 2V5UA 1E2KA 2X9QA 3V6MA 3F9IA 4CKCB 1L5OA 3PLRA 4J16C 3FAZA 3OZIA 3MXTA 1DMRA 1NVTA 5KNCD 4WIAA 2WA1A 4EOGA 4BYMA 2AE1A 5IF3A 1H1DA 4OH7A 4DLXA 2C2KA 1NW6A 1XU7A 4YP1A 2CYCA 5F23A 4MUXA 2A33A 3U4IA 3U48A 5JFTA 5A0TA 1KA9H 3OPYA 3C5HA 4WBNA 1GU7A 4V02A 3WK7A 2P9CA 2EFHB 4WD3A 4NY1A 4RTSA 4QUJA 4NSNA 5GJVC 4LRQA 1KQGA 1Z4KA 1F6DA 1Z0SA 3CZAA 3L0BA 3SHVA 3FOEC 5F35A 1EP9A 4EA9A 5IMSA 3KT6A 5JBQA 3Q3IA 4HR7A 4KMSA 1KMNA 2RKWA 5J9FA 4EFKA 2XI4A 3TNLA 2JFYA 3TIGA 1U1DA 3OHSX 2XD9A 2YQ4A 1N2HA 2RK4A 1PT8A 2AG5A 1J20A 2Y4NA 4BNMA 3NAQA 1FP6A 1WPGA 3MINA 3I73A 4C7KA 3B8EA 5FWNA 2A3RA 3M6AA 1QTNA 2Q8QA 5F3RA 2XCIA 4ZAWA 1LBSA 5AXDA 4E94A 3B6IA 3TE7A 1XKLA 4LUCA 4Y8VA 2E82A 1HFEL 5NLLA 5TPWB 4EY5A 3W6OA 4X94A 3ZYZA 2OSBA 2BZSA 5CLLA 1GCIA 4GMGA 2C3YA 4AF8A 2D62A 4E4RA 5A5DA 4RVNA 4TL9A 3K05A 2WHPB 5IT5A 3CLTD 1OGIA 2IITA 3UPDA 4M9QA 5K0SA 2AJDA 3AQ4A 2AX4A 5JS1A 2J9ZB 2O5CA 3HB5X 4ZP1A 1QH1B 3H3FA 3JY6A 5D86A 6REQA 4A6PA 4CQLA 3OE4A 4R6XA 2LRHA 1QVVA 3KYCB 1IXYA 1VJGA 4FHCA 4LDQA 3T3DA 1YR6A 1WETA 4TQGA 3GV0A 1WEHA 2AR9A 2VQEB 3A4IA 4DY6A 5CB8A 4B3MB 1QNLA 2C2MA 4C6HA 1HE4A 1VHQA 4HMOA 3TRJA 4P36A 3R6GA 1P3JA 3E1KA 1DRKA 2KSQA 3EWNA 4H6VA 4O2BA 4Q1BA 1O6GA 4I3HA 3K1AA 4DXDA 4WN9A 3C74A 4FGWA 1FDIA 2E2WA 1WMAA 3QZUA 4OUDB 5B1YA 2I78A 3SZUA 4KGDA 4YRNA 3EZLA 4D99A 1HG0A 4DHEA 3T5MA 1GPBA 1MG5A 4FFDA 4RF5A 2D6FA 2I66A 4JX9A 3V46A 1I3CA 3HVIA 1DU4A 3AFGA 3IE2A 2WILA 3KKOA 4II2A 1JKXA 2Z9CA 3LHDA 5HFJA 5ITZA 4N8DA 4CM8B 1OVMA 1TZKA 4EHKA 4E2WA 4ZAVA 4G0ZA 3PC8A 2FSVA 3LKDA 1XD9A 2EL7A 1KHTA 3DAYA 1ECCA 3HB0A 4GS5A 3A3YA 5BUSA 3FCYA 1RKVA 2GHTA 1W4LA 1N34B 1AF4A 1E77A 2JB9A 1CFZA 1WCYA 1DLIA 2YVQA 1GT91 4EYGA 1KOFA 4FFPA 3I3OA 1U2DC 4TVBA 5JSKA 3LO5A 3WLOA 3U4AA 2V97A 2YXNA 3ADBA 4ZAFA 4YMHA 2WQZA 1Y5NA 3C6MA 1SHTX 5D84A 5EN4A 5F4ZA 2GN0A 3L0YA 1YR7A 1LBTA 3QE3A 3NFRA 4H6PA 3VNRA 4RCZA 3C7AA 3O5AA 1L5WA 1VCMA 4A2WA 4ZPXA 5C1PA 5JJIA 3DUFA 1I2AA 2DKNA 3E3MA 4UCFA 1NNLA 4CV1A 4DT1B 4LV8B 3VHXB 3ND8A 4QU8A 3OQIA 1FXWF 1H2RS 1QQTA 4Y7CA 3RSZA 4IF6A 3VYTB 1QV7A 3TUIC 3ZIAD 1WCWA 2OC4A 3E22B 4CKZA 4R6WA 2NP7A 3N2ZB 1HDZA 2XB2A 1DO0A 2B25A 3RFXA 1J8QA 3IOBA 3N07A 1TK3A 4N39A 5I7HA 4IICA 2H7XA 4ALMA 4WKNA 3U61B 4W9NC 4G2NA 3STUA 4NZZA 2E87A 2H5EA 3MQ4A 3OTGA 5JDIC 1QHHA 2IYEA 3G5UA 3GCXA 3A7EA 5ADVA 4QE3A 2ATXA 4KXYA 1BKSB 2EZUA 1C41A 3V1MA 5CA0B 2AVDA 4OFXA 5T4EA 4H3KB 3H6KA 1AN0A 1YCFA 3DMDA 3SXPA 1U9CA 3SYLA 3VR0A 3KO8A 1OTXA 4LI3X 4Q82A 1IULA 1RP1A 1OC4A 2DRIA 2XB6A 3AVOA 1F2DA 3OZRA 4MWSA 5A4JA 1SOMA 2PAAA 2G06A 2YX1A 3CN9A 3N87A 4BCBA 4DCGA 2VQ6A 2NADA 4HQ6A 1PDVA 3A05A 3QWFA 1EWKA 4YT5A 3EXHC 3EXFB 2E1RA 4AURA 1VP3A 3G23A 4H6XA 4CQJA 1WR8A 2QP4A 3PGXA 3VSDA 2Q8NA 3NBXX 1XNJA 1M1YE 5CH5A 3DBRB 4P0QB 1Z5OA 4K9KA 3MJTA 2R7MA 2AEMA 2WYHA 4I50F 4H4CA 3UGQA 1GQYA 3GUUA 3MB5A 4FMCF 4U4AA 2FFAA 2IU6A 3E81A 4R83A 3CR3C 1EWTA 1FFHA 4WK4B 1JPNA 2C54A 4H77A 4X45A 1MAAA 2OZLB 3RSFA 1NJ5A 3SC3A 3WYFA 3JVIA 3L7KA 4GP9A 3L7MA 4MB6A 4QODA 1UODA 1HRKA 1G9XA 4NAVA 1KY5A 5LP1A 1HSZA 1ETHA 2GNOA 5JBIA 2V59A 4H0CA 1B8OA 3W5CA 4AYTA 4MWZA 4MGIR 2ZI5A 4E2FA 4MIKA 4ZT6A 3NBZC 5IZCA 1XO1A 2CMGA 3G59A 4JL6A 4JUDX 4TMZA 4E14A 4FNMA 4Q4JA 1MTOA 2YTZA 6GPBA 5IAEA 5HWSA 5CYGA 4CMEC 5IS2A 2XTZA 3R1IA 5CB6A 2HDHA 2O54A 2IP4A 2ZYSA 3OTIA 1AO3A 4HDSA 4L16A 5EZYF 5TS2A 3S2GA 1VE7A 4FGJA 4BZQA 2PYDA 2YWRA 3C1AA 2R8OA 4ENSA 5C5EA 3A4VA 3IIEA 4C6TB 2CYBA 1ATZA 1HT3A 1YR9A 4FOOA 1AKNA 3EG9B 3HA3A 4L5AA 4M0FA 4MICA 4YGXB 3UJAA 2O8FB 2C42A 4GR4A 5DLPA 1TIPA 1H1LB 2PGJA 5EWMB 4N49A 3WGTA 5TGZA 1OOEA 1QX3A 1FDOA 4YRKA 3EUFA 1GPKA 3IDSA 4I9FA 1U3CA 2DTEA 3RR2A 1YB6A 2H52A 2QRLA 3HADA 2H4HA 3F6PA 4X20A 3I2HA 3U7FB 2R1VB 1NV8A 3D9QX 1JR3E 1JLMA 4KLNA 5AVUA 2E55A 1L1RA 5CRIA 1Z74A 5EP4A 4YAGA 1SUDA 5LUAA 4IHJB 1QFSA 2GFIA 4QBTA 3QTTA 2ZI9A 4R1SA 4KMRA 2DMRA 4IRMA 3K0BA 2H65A 1ZWLA 1HUQA 1V1MA 2O2ZA 4YHHB 2XJ4A 5LNK6 1Z6TA 3RTEA 2TMKA 1DBWA 4MWTA 3AL3A 5DX8A 3REGA 2VQDA 3KPUA 5CA1F 2X1MA 3OIWA 3SHTA 1NC3A 4QREA 1RTKA 1JHVA 2J9YB 3PYLA 3T3HA 4Q3EA 3DBVO 3QF4A 5FOTA 2A0YA 5E1MA 3ECSA 4JASB 2HCRA 2PE5A 5BXYA 3L7AA 2F43B 4Z49A 1EDEA 3LQ2A 2HA7A 4N6NA 2GZMA 2QX9A 4OHVA 4ZC1A 2JFHA 5FWYB 2BHNA 2LIPA 2YXDA 3DVAB 1T4CA 3LZ6A 3OJCA 1GL3A 3FCCA 5IEBA 1CS0A 2NAFA 4TTPA 1A7KA 3V3KA 1N2GA 3CS3A 3LK6A 3B6MA 3UFBA 2YHAA 1E1QD 3I6QA 3P0JA 4HYQA 4YJ3B 1G4UR 3UCFA 1HTBA 4F6LA 1Y6ZA 4DIFA 1PFKA 1FFXB 1L4MA 4YGYA 4RKWA 2B21A 3GA0A 1A71A 5HKOA 1G8AA 2D0DA 5TNXA 1ZJ6A 3GHHA 2XR1A 2WHQA 3KT0A 3MTIA 3CEMA 3DAOA 3C6QA 4Y6RA 3PBKA 3NEYA 2XWQA 1FP2A 3VR6H 3WGNA 4EG0A 3U3OA 3G2QA 3WG9A 3LF1A 4CCYB 2I4LA 3MBIA 3H4IA 5JNUA 1EI9A 2NWQA 5KYWA 4Q9DA 2X40A 1JQBA 3PNQA 2XWJI 1E9BA 3K9BA 3BERA 4EGCB 4F1KA 4YI3A 4DMFA 1SCUA 2GHQA 3BK2A 3QPUA 2J46A 1PNTA 1Q91A 2KWIA 3E3OA 4RPIA 3W4JA 4EG1A 1SPXA 1REQA 1X8LA 2EOAA 3U4QA 1ZWKA 4GG1A 4A15A 3NIFB 1QK4A 5KHLB 2B9VA 2VH2A 4IXDA 4G0VA 4M87A 3EA5A 1R5JA 3SNKA 3O8CA 4EGFA 3BKWA 1C4OA 3FUTA 3INGA 3LZDA 2WNSA 5C35A 1XTTA 2NZ2A 3LNCA 2NZVG 4NBWA 4UE3S 2E0IA 2QAGC 3H8JA 2O8BB 2AF3C 1PHPA 1VSBA 3KE8A 3CZ5A 1EDOA 1W9MA 2ZE6A 1EUYA 4I5DA 3PDCA 1WP4A 2D1FA 3H9BA 5EE9A 2CLHB 2WDPA 2FMHA 3UTCA 1K3UB 4WFQA 3KT8A 4HPXB 2B7LA 1CUXA 5DP2A 1TAUA 2OM6A 5IM4A 3ZEIA 3O31A 3RSOA 1PV2A 4W5RA 2XRYA 1L7AA 2AOUB 4R2JA 1M1ZA 1S3FA 2FR0A 3DW1X 3FMFA 3GEPA 3OFNA 1TO6A 1YVDA 4K8OA 5TEWA 1F8XA 3CGWA 3B1XA 4UC0A 1JQKA 1V6CA 2DH6A 4MYTA 4M0UA 4F72A 2XRFA 2WFMA 4LVNA 4B6EA 1XSEA 1Y42X 2OPBA 3LHSA 5FDFA 4N48A 1RJGA 3G79A 2CJXA 1WZEA 4NZMA 1WBBA 2P1RA 5DGTA 5DX1A 1Z6PA 4I4IA 2BF7A 1A72A 2O2YA 3PXXA 2F9MA 3LQFA 1PUXA 2RGYA 4L22A 4EJSA 2HIHA 3G9ZA 4PWZA 1E3DA 2VP4A 1NW8A 2RDMA 3DXYA 4ENVA 5HZGA 5C18A 2GX6A 1ANKA 1C1YA 3C3XA 5M34A 5JNRA 2M2IA 2VZ9A 1A9PA 1SHZA 4LSMA 4MVJM 4ZXFA 2J5BA 1XDDA 1P7VA 3CUKA 5AM1A 2FEAA 4MV6A 5CIWA 3LVFO 4PLZA 4MMZB 3OPYI 1V11B 4QTTB 4ZT5A 4GSYA 5B3KA 3EPPA 1JR3A 2AOTA 1TECE 1VI6A 3BS4A 3VR5A 4UUNA 2F00A 4KPEC 1QIKA 1OLXA 4YJFB 4R1TA 4AZVA 1KARA 4H4EA 5TMEA 2CFOA 2OGSA 3BPSA 3MWDB 2O3JA 3IEPA 4FBGA 4L5IA 5LUBA 1MB3A 3UK1A 3ZNQA 1QONA 4C03A 1P2FA 2O14A 2ODBA 4Z99A 1V1RB 3Q6MA 2BR3A 1PP4A 2F67A 2YIVX 3KAKA 1ZK3A 3S7ZA 3RFTA 3S6JA 5AW4A 3USCS 5A03A 1RP7A 4P31A 2DE0X 4PCVA 4E5NA 5EJ2A 3DR5A 4PYQA 5FBZA 5L3ZA 4YRIA 3AFNA 3K0HA 4AW9A 2P2SA 2ILTA 4D9IA 1BVUA 3LYHA 1OFVA 4RADA 5AOVA 1GPDG 1H2XA 4PCLA 3PUJA 4M7RA 1X0VA 2M6SA 2PNFA 3WQBA 1O95C 5JD5A 1WW8A 5FA6A 4JYPA 3U19A 3FBGA 1VMEA 4Q1AA 5EIXA 1WKCA 3QUCA 5FHQA 3LPCA 1BDBA 1JMVA 1QGYA 1TKCA 2X3YA 1FJXA 4MEBA 5LQDA 4RHXA 3KOWA 3UK6A 4DCJA 1F2TB 1O54A 1RFGE 1YMVA 2EGGA 3IDZA 3R24A 4HB0A 4NARA 1FYEA 1XPOA 5H0IA 5A3RA 4AP9A 1MEOA 2C3OA 4DUGA 3FTNA 4QTUB 4PG6A 3INNA 3HB4X 1H8HD 2Q4OA 3QJ5A 3WKEA 3NJ8A 2JNWA 5COBA 2BKXA 1APBA 2DFLA 3HDGA 5LZ2A 2Z5LA 2HRZA 5J5VA 5JYBA 3FKSD 5AI8A 4NDNE 5TVKA 3P97A 2VBGA 5B4TA 3D2AA 4D9MA 3G89A 1VM6A 1NJ2A 1UMBA 1ULSA 3BGVA 1P5ZB 5IJ0B 1R0CA 4DA6A 4DOMA 1FYVA 4ZCLA 2QD1A 3SZRA 1TKBA 1W5TA 1AY0A 3ZCRA 3GLTA 4NOKA 5EJMA 5K1ZA 1T4DA 3SC6A 1P2GA 4CM6A 1I7DA 5BQ3A 2X22A 1C8LA 1YL5A 2GPYA 1RRFA 1AKVA 2IUFA 3MXOA 1TLFA 2MSWA 4FFBA 3NP9A 4C2TA 3MGCA 3QU9A 4J0JA 4V0RA 1X1RA 4Y2VA 2R6ZA 1DDOA 1CC1S 4JU9A 1AH2A 2GPTA 3NEAA 5JSUA 2Q2NA 4MLZA 2QTTA 4S1OA 3RPEA 1LPAB 2RGEA 4DZRA 1P0MA 2XQVA 3MWYW 1N2CB 3EEBA 2YFYA 4MVXA 2QR3A 1SCDA 3I6MA 4OJKA 4OP2A 4U63A 3A1VA 2QV0A 4MA5A 1V6SA 2XA2A 4G6ZA 4R54A 2YWBA 5A6SB 4GF5A 3SX2A 5I7EA 1K4MA 1Z18A 3HYNA 5HZHA 5ENVA 4BY9E 3DQZA 1MO6A 2WI8A 5JCZA 1L7RA 1YU9A 4I3FA 1O7JA 4Z3DA 3VSBA 3E9CA 4G09A 1M2OB 4PC2A 2R7AA 4I5FA 3WQQA 5HG0A 4CDNA 3K96A 3BJRA 1VL6A 4KPUA 4IHKA 1ESCA 1FSZA 2NU9A 4HEQA 2QXTA 2L19A 3HZZA 1JX6A 2BEUB 4QXPA 2H0AA 3TXYA 3C8MA 3CX3A 1VI2A 2WJHA 4TN5A 4A0GA 4DM4A 5ADUS 2Z30A 5IF9A 2WWTA 3QXGA 3B3JA 1HQYE 2G8LA 2YNMD 3GT7A 3G8CA 3QWHA 3X1JA 4F46A 1A9XA 1E2UA 2R6R1 3OU2A 3P9SA 3CRVA 4G67A 4YJGB 5AKEA 5HOEA 3QHAA 2OLKA 1X77A 1EHCA 3WWCA 5IBCA 4GM1A 4DLVA 1JHAA 2HCFA 2PZLA 2TMYA 3AP1A 3QFRA 4G41A 4LZWA 4M0DA 4M88A 5BWLA 1D0VA 4RSHA 5I7WA 1OXSC 1SA0A 3DEKA 1N36B 3EYWA 3OZAA 2HQBA 3D0OA 2DCMA 5AM0A 4BQNA 4ZI5A 1DRVA 5EWJB 2AXQA 1WJGA 1JNXX 1NSYA 1F4LA 5FR2A 1A27A 3ZLVA 4DPLA 5DOZA 4ECAA 1R5BA 3BA1A 2FH5B 4KXLA 2HHAA 3FCOA 4KC0A 3TXXA 1JHDA 2PX4A 1IM2A 1WXIA 3HMQA 4FJ0A 1EJBA 3UJHA 4F2DA 4M21A 1OGYA 5LQCA 5I9LA 2YJ5A 3FBWA 5DYIA 2FXVA 3TNYA 1Y4UA 2VK4A 4L15A 3X1KA 4IIEA 3OLCX 2J7PA 2CBXA 4J2TA 3RK4A 1EESA 1OXXK 2WSSD 4WFKA 3I0ZA 3B1WA 3RI3A 4ALIA 2NT3A 2X41A 1JLLA 1Q92A 4MGHA 5F9HA 4IFIA 4QOFA 4MPDA 3NV7A 3P0HA 4QGGA 1LH0A 1RJDA 4P93A 3S5UA 3FLMA 4NZNA 2JI8A 3FWKA 1D2NA 3RJ5A 3TE6A 3LDGA 4A23A 2G1JA 4BHTA 3K6SA 3DPUA 3I45A 2UUCB 4UBIA 3K0FA 3ORFA 5ERXA 5JJ5A 5JWRA 4Y6LA 2XCSB 2XXAB 1ZN7A 3RDPA 3CHYA 1YDMA 5C7YA 2FK8A 3O75A 2H59A 2J0EA 2EQAA 3FNBA 5HMLA 4AG3A 1C3OA 2NO6A 4QFMA 1ULTA 2MSKA 4Q12A 2I67A 2PUCA 1CT9A 1G6OA 1QH8B 4DJJA 5DGCA 1NQOA 1UBJS 3QPDA 3SYRA 4EA6A 3Q3CA 1LI7A 2Y9PB 4PVCA 1EHYA 1Y3CE 2FZLA 1TL7C 5TDHA 2ZSEA 1NF2A 2AJBA 3KCQA 5DB4A 4ZAZA 2O5RA 1OHHD 3EPHA 3RSHA 2Z6UA 3U7QB 4AS1A 3ZHTA 4L9RA 4RA9A 1TE2A 4EJSC 3V5NA 4P0TA 1PE0A 1DPGA 3F0TA 2UYYA 4ITVA 4E88A 2XF2A 3RT7A 2H17A 1JAXA 2JFUA 2ZOSA 4G1FA 2P27A 3KSMA 2DLNA 3JW8A 1BYIA 4UAJA 1P1JA 3NTXA 3PG5A 2YWFA 3UK0A 1QKIA 1CY1A 1SG6A 1KYIA 5BYKA 4X6UA 2MYTA 1A7AA 4OSOA 3PQ8A 1SKBA 1GVHA 5I8WA 1NM5A 1E7WA 4IH4A 1NLMA 4RTKA 4BUCA 1CJSA 5EJEA 5C4MA 1UKYA 1VLZA 1TUBA 1WOMA 5C2JB 1Y80A 3HUEA 2IYNA 4FT2A 5HA5A 2VDKB 5L8VA 3ETLA 3L49A 5HKBA 3THXB 5AKIA 1UR5A 3D0RA 3TD2A 4G0WA 2IEGA 3IXMA 1C0PA 1FDSA 1K5PA 4J2HA 3H4MA 3SWWA 1AQIA 2Z58A 4REOA 4PFJA 3FHTA 3HA7A 3I0NA 3L3BA 3IAHA 4LW8A 2D59A 1UK6A 2JVIA 4IWYA 1E5DA 2VSNA 4EJ6A 4YP9A 5T8KA 4E33A 5KJFA 1FYXA 1N0HA 4WCFA 4JUIA 2N0SA 2WKPA 1FQWA 3SYTA 1ILWA 1Q6ZA 1Y9AA 2D5AA 2LV8A 4URHA 3A25A 2X14A 2NACA 4RM3A 3E7DA 3IVAA 4HGRA 4EGAA 3L6UA 1GYQA 4E46A 4RGBA 1TJ3A 4CLRA 3EODA 4TV9A 3LV8A 2R68A 3VNSA 5JPIA 4BNLA 5ICGA 3AVTA 1X1SA 1ZITA 3QLEA 1JFVA 2FU5C 3KYBA 1RMQA 1FNCA 4UD6A 4MPRA 3UTDA 4YMTA 3PFBA 4J94A 1PV1A 1EQ2A 3K20A 4JVOA 4ME6A 2XH8A 3ZV5A 4HL6A 3SLRA 3PZRA 3SBEA 3LXRA 2X2PA 3PNLA 1VKNA 4E2ZA 1V1JA 4PO3X 4IXWA 4LJ7A 1EX6A 1ABFA 1TQDA 4RK0A 1YVEI 2VXYA 2NU6A 3I6ZA 1XIVA 4C0KA 1DCTA 4ZALA 1QK3A 3P5BA 5ITSA 4AM8A 4RMNA 4G5HA 4KXWA 1FS5A 1Z4MA 2FQXA 4XI9A 3WZLA 1DINA 3P9RA 1XALA 1H6CA 2PUTA 4J0HA 1G20B 5ERYA 4IWNA 2JEOA 5K8JB 3RYIA 4HXFB 4YDSA 1XAJA 1JVSA 3AZQA 4YO7A 2P4QA 1RYZA 4DR1B 5JR3A 1QB7A 2DBZA 4A0QA 1JHQA 5JPDA 5MN6A 3DVLA 4KQGA 4EO9A 5BUQA 1UJ2A 4AKGA 1SXIA 5EZQA 5LLDA 1QR6A 1DAFA 4DWOA 1JDUA 1H5QA 2XUKA 3M6VA 4TMKA 4C7OA 5SV2A 4AG6A 5LB4A 2X8BA 1QLWA 3UMGA 4MVJE 4F2PA 1UOPA 1PLLA 3FTDA 2GM9A 5EG5A 1J1IA 3O4VA 5FOXA 3TD6A 3HSKA 4R3UC 1GAWA 3HO1A 3PFGA 3O38A 1YL6A 4X1KA 1NVBA 3OQ1A 4PGGA 2DR3A 3CPSA 3GNSA 3I5MA 3U1TA 3VNBA 1ESEA 3M1YA 3DNPA 4YJ2F 3GWZA 3EJ6A 4YMUA 1EA7A 1EFVA 1ICIA 3PNPA 5B1EA 2XUQA 3ZTYA 1DTSA 4BO3A 2XWBF 5LJIA 1T5TA 3QVUA 4FWTA 3A1DA 3P4YA 3A36A 3V1KA 3GNLA 4OXIA 4JXXA 1U8CB 4UBKA 3WB1A 5GVRA 1KZ9A 2GZ3A 4KPFC 1OWLA 4JYZA 1I1HA 1P1HA 2YCBA 1E6LA 1J90A 4B3XA 2WU0A 3LP5A 3EQ9A 1DOHA 1NRIA 4CR7A 4XWGA 1P18A 4D7AA 3ZDCA 3BHMA 4MH0R 4OGGA 1YUNA 2JI4A 3HCOA 3FDFA 4GKVA 3CWZA 4NESA 4OGLA 4PLFA 4TUYB 3ZXYA 4PLYA 1QK5A 2OVBA 4W8GA 1Z2OX 2JIPA 4NZYA 4GBJA 3V9PA 5KWVA 4CLXA 4L4UA 2GYVA 1GRQA 4B7CA 5CNJA 4TKMA 4UPDA 3P45A 2POCA 2IOFA 1RVV1 4F3TA 2F3PA 4RV9A 4S1WA 1YE5A 1Z75A 4DZZA 4Q4AA 3HJAA 2QYTA 1UZUA 3PDIA 3T5GA 3I34X 4ZYUA 1Y8ZA 1DEHA 5JLJA 5CM9C 4EYEA 3HCWA 2VYVD 4F4UA 2HI0A 3GJRA 5DHFA 1K5HA 3QKRA 5DBFA 3E7XA 3MUNA 1WVIA 4FMBB 1LVUA 4KWHA 2M6LA 5B7NA 4GLFA 4CUKA 5JH7A 1O3YA 3B51X 3PHGA 2DF8A 2TRSB 3X2FA 2OV2A 3KKEA 3ICOA 4OHXA 2ZR8A 2RGRA 2J0UA 2AMVA 2QXUA 4H7DA 1QLJA 2VYQA 3DLPX 3E4DA 4AMZA 2WZCA 4XRGA 1BZYA 1C9YA 3AETA 4QPDA 2VJMA 4OB7A 5ETJA 1E92A 1FX0B 3WAKA 1J9EA 2WMNB 2PYIA 1DWQA 3U49A 3FLEA 5KBYA 2MJLA 2GHIA 2PGLA 2GXQA 1C30B 1YQWA 2NZUG 4A7PA 3BJEA 4O1MA 4RS3A 1W2HA 3TLGA 1Z25A 1UPCA 2QWXA 3EEIA 1RZRD 3PR2B 3ZE6A 2W2OA 1B6SA 4IS3A 3GLFA 3K9GA 3C4JA 5T57A 3F6SA 5JSZB 5K01A 1DAKA 4OL9A 8ADHA 4FS8A 3JYOA 3S99A 2O3UA 3WMWA 1VZ3A 3M49A 2DHEA 8AT1A 1VLMA 1D6MA 3LCUA 5B58C 4P7KA 5TQ0B 1XVTA 3K6KA 2Y0PA 4XPIB 3L07A 3CRQA 2VHXA 1RBZA 2C96A 3PI6A 4KFUA 4OG2A 5DXAA 5D1HA 3LXUX 2IIPA 3UWKA 5KTNA 4IL5A 1LK0A 4PQGA 4GO1A 2G80A 4NECA 2QHXA 1PT6A 3GEGA 1FUKA 4RY2A 4Q19A 2VDPB 3IIIA 5M3BA 4AZ3A 4DLZA 5KWJA 4DV5B 1UC9A 2AE2A 4HVTA 1N4DA 2F1IA 2YMPA 3PCRB 2YV3A 4OX9B 2OD9A 4XDHA 2I6TA 2GK3A 3R5FA 1ODCA 3RYHA 3HVHA 1UT6A 4LJ4A 1H3EA 1DWOA 3AUSA 5AKKA 3L0ZA 3JVUA 2CLFB 1EGHA 2VRCD 2DSTA 3OJFA 1K7SN 2Z8YM 2PSJA 3D4LA 5IC6A 5TJHA 4MA0A 2Z1DA 1X19A 4ND4A 2FMXA 3VR5H 3BRSA 5D5QA 2H2WA 5CNKA 1JW9B 3FJYA 5LLTA 1QQAA 5EHGA 2GCOB 2B2NA 4HLNA 4GQIA 4C4TA 2V1UA 5EXSA 3AJAA 3O26A 2SNIE 1YDGA 4MUMA 5EY5B 2C94A 2V7EA 3CX7A 2P2ZA 3VPCA 3I1YA 5U9CA 4A8HA 1QE3A 2RHOA 3WHKA 2FXIA 1KMHA 5EQDA 3COVA 4N9WA 3ZHQA 3X2EA 2ERYA 1CIVA 2JGFA 1YDEA 4MQFA 2W2XA 2GK6A 3OURA 2B3DA 3B53X 3VZDA 4DBLC 5KYYB 4TYWA 4GOLD 4WCFC 3IUPA 4QUKA 4ERXA 2GTIA 3DMHA 3GFBA 1FU7A 1CVRA 1JWLA 1P3DA 4QPNA 1GTL1 1TJNA 3FDZA 5HQJA 3VNQA 3D3WB 1PJQA 4FFSA 1ZEJA 2RAVA 4L0QA 4FI3C 3BSFA 1QRAA 1AXGA 3WR5A 1RYNA 2CB0A 3TLEA 5BPHA 2DXIA 1VYHA 2GXUA 4FP9A 1CX9B 2OAEA 3K35A 4PLVA 1PZGA 5JXGA 3DE4X 1YZNA 4ZCIA 1XWWA 1BCRA 2BEJA 2ZIXA 2FDRA 3IP9A 4MWBA 4XGQA 5DV9A 2JFFA 2CMHA 1T6XA 1W19A 3OO0A 1RBQA 1WF3A 1ZCFA 1B8UA 4TS9A 3O4IA 1MJ5A 1QUFA 5K6AA 1R16A 3PC3A 5H4HA 1P6XA 1AE1A 2AKAB 5E3HA 3DEIA 3D8NA 4PQFA 1ECPA 5HIJA 2A35A 1AMNA 3LHFA 1T0PA 2BH2A 2JLCA 2VAWA 6PFKA 3NDBB 4CKBB 2C4KA 2I7TA 3HKDB 2IXFA 3OLXA 4MV0A 4KL8S 3VZCA 4OF4A 1PKXA 4KV7A 4QSHA 2H1FA 1R64A 4KP7A 4IW3B 4M1ZA 3SBOA 4CKEA 1S2GA 1DQRA 3BORA 2ZRLA 4P5EA 2QRVB 2YWCA 1BFDA 3ELDA 4QRIA 1VJ5A 3D7MA 3N58A 2X2OA 3EFOB 2H7YA 4IV5A 5BN3B 3WMXA 3THYA 1GDTA 2IHNA 2YWXA 4ZKEA 1DTWA 4YO8A 4XPZA 1VCHA 4JEMA 1ISFA 5SYNA 3H2KA 4Y6PA 4CL2A 3AGPA 4CXMA 3WLEA 3HXMA 3E7WA 3GH3A 1U3UA 3NJ4A 3ITDA 1E1RA 1TA0A 4DGQA 2JIZD 3H86A 3LWZA 3I8OA 4FHFA 5DULA 1VYVA 4IQGA 2FK7A 4QA9A 1FZQA 4XRRA 3X43A 3KJGA 2FB9A 1S2LA 4PZLA 4MW4A 3OBBA 3OZTA 2EJUA 3DBHB 5DNVA 2AHRA 1ISIA 4XGNA 1RABA 3Q7RA 1XL1A 4UARA 1WB5A 1RYHA 4X00A 2H31A 5DCLA 5EPUA 1HO3A 2YDYA 1IXRC 4I1UA 4KO4S 4NJMA 4BUZA 5EHXA 2FG5A 4HFMA 4RL4A 1W59A 1TYDE 4MWCA 1TW3A 3MJRA 1O0SA 3V4ZA 4BJ1A 3ETCA 1TT5A 1DUSA 4X8HA 3S70A 5CDFA 3KWLA 4RTOA 2V7TA 1SVUA 4WZAE 2DR2A 3F47A 3E9EA 3KDSE 3RC7A 1MCZA 3AONB 3TPFA 1HM5A 3WFZA 4KKXB 2JI9A 5FLYA 4OJTA 2AOXA 2F1JA 4Q93A 2BI4A 1FY2A 2ODPA 4CM4B 5AW8A 2QPTA 5DJ5A 4LHYA 1PFVA 4JHXA 3W5HA 3T5CA 2RH4A 4OFWA 2CMFA 2CVQA 3QF4B 1HZZA 4IP0A 4NMHA 4DR5B 1E7RA 3IMGA 4QJIA 4ZQFA 2FLWA 3UMSA 5JWOA 3CVYA 1NG1A 1VSUA 2KHZA 2PMDA 1OILA 3O2JA 4R3WA 2J3EA 2AN4A 3UV6A 4DV3B 1QQ7A 3TTWA 5C5DA 3H13A 1AUPA 1L3BA 2HO4A 3W5BA 1CV2A 1KQNA 5DCUA 3A58B 4BO8A 1GGHA 2O0LA 1QVRA 1C29B 4YVFA 3TMAA 3NUZA 2OOKA 2QJOA 2BMEA 3A1TA 3Q3EA 5AK6A 4KRXA 5HIAA 3GUYA 1EGAA 2HPHA 2ZSFA 3CPEA 4FWIB 1QV9A 1CEEA 4JJKA 4KDEA 1CLUA 2VUTA 4WXYB 4DNXA 4OL0A 4R9UC 4CF7A 1QRRA 5F2OA 4ZJYA 1UM9A 2Z9DA 1V8BA 1Q1QA 1WX1A 3AJDA 5CYOA 3NDPA 3WRYA 1QHSA 2AW3A 2IYYA 2JFQA 3LY5A 2WYVA 1BX3A 2O5VA 2COKA 5KYWB 4Q18A 4YAIA 4URYR 4N3NA 2WTMA 3TSAA 1X14A 1SCUB 3EH1A 3V7UA 1Q11A 3GQVA 4JQSA 4FE4A 1RIFA 3QLUC 1SU7A 3E8XA 2FPLA 4RZIA 1Z5UA 2FMFA 2QT0A 1OH8A 1OKKD 3UENA 4B3BA 1E2QA 4PTYA 5AI9A 1CDDA 4TLDA 4PXSA 5K8IA 4DMKA 4WACA 4DQXA 1KVUA 4ARAA 4M1SA 4DLNA 4DV0B 3CNEA 2ZPAA 2WD9A 1X7XB 3MLBA 4JVSB 1A4XA 1WDWB 2GD6A 2HY7A 2NYAA 4BNJA 4ZDIA 1MT3A 3TSCA 1JEQB 3ADOA 4DJEC 4EKIA 2IC5A 1I0LA 5ICEA 2QNBA 4Z4IA 1NBWB 4S0ZA 5BUZA 1LX6A 1T0JB 2XSZD 3I32A 2JGNA 3GJQA 3ZI4A 4B5LA 2XUHA 3EF3A 1PFQA 1VYTA 5J5AA 1JJIA 2BP7A 2BEWA 3TLCA 5AJTA 4F4CA 4UMFA 3CV3A 3RVJA 1AA9A 1EM6A 1VMKA 3BIWA 4OATA 4JEIA 2ACEA 1X9HA 2IYAA 1QF9A 2QQEA 2W6OA 4REQB 3MRXA 1EGQA 4OK3A 3RVDA 4BDSA 1QO0A 2O0KA 4P3NA 2VTBA 5FL7A 2DH5A 3HPQA 3KYIB 3AV3A 1I7PA 1JFLA 2VZ0A 3ECAA 4BO9A 3LT0A 3OM9A 4U2FA 1C4WA 3D64A 3EVGA 2L0XA 4A3SA 3A9TA 2XE8A 2PCJA 1A0OA 1XD8A 1XTPA 3DFUA 5CAEB 1I51A 1H85A 5I5GA 3ZIUA 4ZIRB 2W42A 3TMYA 1E63A 2ATVA 3DV9A 1KBZA 5EP2A 2NO5A 2PSEA 3ZWPA 4RAQA 1KP2A 1QPZA 3NHKA 1QJ4A 1UPXA 3OTQA 3KKQA 4XD7D 5THKA 4XFKA 3FG9A 5EJ6A 2GCPA 5F5LA 1XMXA 3RODA 2DHRA 5EJFA 1I4LD 2OV3A 4OHOA 5DHPA 1DWUA 2Q0SA 2WBLC 4GC5A 2GNAA 2W5UA 3FJ1A 1P1FA 3N2IA 3T7AA 4M9RA 4EUFA 3WLMA 4LE0A 2ISCA 4EPVA 3H6HA 2B34A 3NHZA 3U5TA 4KBFA 1BD4A 5H9VA 4WZ6A 4F9GA 2H4FA 1E9EA 2G9UA 1FU4A 3BRQA 3WK8A 4RFSA 3WGUA 1XMOB 2I6FA 1YA8A 1NW7A 1VE1A 1JI0A 1G21E 2EP5A 2HLDD 3R5SA 4GGOA 4NPAA 3VGPA 3KEQA 4IKEA 4BIMA 1G3QA 4TRNA 3SQNA 3AFOA 5IFLA 5JS8A 4XDGA 2HHCA 3RIGA 4U02A 2XKBA 2VT7A 3ES9A 1DLJA 5DGHA 4O4HA 2VKTA 3HJGA 4MHSA 4DA4A 1TIKA 4MUBA 2I3AA 1UAAA 3FB4A 4RNDB 3CWQA 3H87A 2PLNA 1W8DA 5A1TA 5F1KA 3LK7A 1LF5A 4YCJA 1IBMB 4B3TB 1LBQA 3QVSA 3IERA 4MDYA 4NZPA 4U2BA 1L4NA 3HKBB 2GTHA 1NG9A 3SEZA 1WW3A 3M81A 2WPNA 5BP7A 3R7BA 1E3TA 2H8KA 2VHQA 3K6JA 2XEXA 4C0BA 3GARA 4WAUA 1P7PA 3NMUF 2Q3DA 4IDEA 2L17A 4NHOA 5LP6C 5C8YA 3V4SA 3VPDA 3HR8A 2NV6A 3AF0A 3FSGD 5CB4B 1SULA 5FPTA 3JQAD 2BHRA 1JSZA 3E2IA 3FGPA 3KU4A 3PUVA 4M0LA 4U9HS