3OU2A

Dhpi-sah complex structure
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
216
structure length
204
Chain Sequence
b'TSHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRPGPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Characterization and structure of DhpI, a phosphonate O-methyltransferase involved in dehydrophos biosynthesis.
pubmed doi rcsb
source organism Streptomyces luridus
molecule tags Transferase
total genus 65
structure length 204
sequence length 216
ec nomenclature
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ou2A00
3V97A 3LX6A 5E9JA 3EGIA 3DXXA 5K0LA 4RTKA 3GWZA 2G72A 3FYCA 3BZBA 3EGVA 3LSTA 3UA3A 5E1MA 5ICFA 5FCDA 4AX8A 3R24A 5T6BA 1YB2A 5FUBA 4HSGA 1WXXA 3NVKI 3GGDA 3KQOA 4NECA 3UBTA 3ERCA 2HV9A 2ZBPA 1JG1A 4X41A 2IBSA 5DLYA 3GNLA 4Z2YA 4CWAA 2EG5A 4PINA 3UWPA 2PBFA 2VDWA 3SR4A 4AUKA 2Z6UA 4OBWA 3FUWA 4YUYA 2ZW9A 3OPNA 4IV0A 4EVIA 2HMYB 3G2QA 3CKKA 1F3LA 4RV9A 3NVMB 3EVCA 3P2KA 5EC8A 3P71T 5E9WA 2NXNA 3FTFA 4RTMA 1RJDA 1X1DA 4RWZA 2OBFA 3HCCA 3CJTA 3HCBA 4GEKA 4PYNA 2IH5A 4GF5A 3SXJA 2ZBRA 3THRA 4QTUB 1H1DA 3C6MA 2P8JA 2PWPA 2ZZNA 1NW7A 1XDSA 2ZIFA 3KPUA 2NXEA 5KVAA 4AZVA 4XUCA 1SVUA 5EIWA 3L8DA 1DUSA 1D2GA 3GRYA 2G8NA 2PX5A 3MGGA 1AQIA 1B42A 2FYTA 4BLUA 1KYZA 1D2CA 3HNRA 4CKBA 2AOXA 5BW5A 4WXHA 1RJEA 2A14A 4AZSA 5ICEA 1PJZA 4HRAA 3GXOA 5DM0A 5JR3A 3DP7A 1I9GA 1Q0SA 4OA5A 1VQ1A 5LQRA 2PLWA 3UJDA 4E70A 3CJRA 3EPPA 4GOMD 2ZLBA 3KQSA 1FBNA 4QVKA 5CIYA 1EJ6A 1JTEA 2C7PA 3EMBA 4RX1A 3TKAA 2K4MA 2B9EA 3BKXA 4H0NA 2IPXA 4R8SA 3GRVA 2GA9A 2VDVE 5EMMA 3OZRA 3DMGA 2FHPA 2NNWB 1KR5A 3P97A 5EMJA 4PIMA 2ZFUA 2B3TA 4OQEA 3KQQA 2AVNA 4RVHA 2FCAA 4R6WA 3KPWA 3DMFA 1BHJA 2QYOA 2CKDA 1M0EA 3DUWA 2QRVB 5HIJA 2OZVA 4ER6A 3LKZA 2YUIA 3G89A 3LKDA 4X1OA 2UYOA 1N2XA 4RTQA 5K0FA 2B78A 2ONZA 1WXWA 3SSOA 1ZHFA 3BWMA 3MCZA 4OA8A 1XDUA 5FA5A 3REOA 1KXZA 3UJAA 5GM2A 4C4AA 4YV1A 4DKJA 4PYJA 4X60A 2G70A 4GBED 3TQSA 3A7EA 4QQNA 2OXTA 1R18A 2XVMA 5GIOE 3CBGA 3A27A 1KHHA 3A25A 3E7PA 4RTRA 3F4KA 2ZIGA 4QPNA 2YVLA 4PCAA 2WA1A 2AVDA 2H00A 2JH9A 3KR2A 2JHCA 2E5WA 4MQ4A 2QRVA 3SMQA 2EJUA 1JTFA 4E2YA 5M5BA 3ER8A 3OZSA 1AF7A 3NWBA 4MTLA 2BR4A 4IKPA 4GOLD 4P58A 2O07A 4U7TB 1PRYA 3BWYA 3G88A 4Y2HA 1ORHA 1SQGA 3P9CA 1YFJA 3M70A 4HTFB 8MHTA 2P3OA 3UJCA 4PGGA 5ICGA 1RI4A 3HCEA 5DM2A 5EVJA 4CTJA 1XXLA 1WZNA 5GM1A 3LBFA 3S68A 3V8VA 4HGZA 4YUZA 3I9FA 4KIFA 2AS0A 2PSSA 4ISCA 4PONA 2P7HA 2CL5A 3G8AA 4IWNA 2PY6A 4QDJA 4OQDA 1WG8A 3FZGA 1YZ3A 1X19A 3EVDA 5EEGA 2GPYA 2VP3A 5K0BA 2IP2A 3FYDA 3C0KA 3LCUA 4PYLA 4YUWA 2OYRA 1NBIA 3G8BA 3I58A 5IKMA 1XCLA 1INLA 2YTZA 4HH4A 1YFLA 2O06A 1TW2A 4R6XA 4HTFA 4A6EA 1WY7A 4P7JA 5GP1A 3P2IA 1FPQA 1ZGJA 3PB3A 3QOWA 4KDRA 4KIGA 3GIWA 5E8JA 4PCLA 4GOOD 1EG2A 4M38A 3X0DA 3GU3A 1UWVA 2PJDA 4ATNA 4C05A 4DQ0A 2BM9A 5DM1A 1RJGA 2BR3A 2DPMA 3O7WA 5ERGB 1KPHA 5K05A 3TRKA 4RVDA 5LQUA 2P40A 5LSAA 3LPMA 5GOZA 5HFJA 3GCZA 1RI2A 1SUSA 3EVFA 3E23A 3T7RA 3ORHA 4CXMA 2QM3A 4HG2A 5FHQA 5ICCA 4PGHA 3SM3A 4FR0A 1U2ZA 5DSTA 3DR5A 3R3HA 3MERA 4PIPA 1JSZA 3UJ6A 3FPHA 4P7GA 1R6AA 4RVFA 3UFBA 1VE3A 1G6Q1 4LG1A 1RI1A 1F38A 2OB1A 3PT9A 4M7RA 5KQSA 3HTXA 5DRYA 1ORIA 1N7IA 1G55A 5C0OE 2KW5A 1EQAA 3FRHA 2IGTA 3FUTA 2IIPA 2VDUE 3BGDA 2V74B 1R8XA 2PV0A 4EKIA 2GB4A 3IYLW 2PT9A 4YMHA 4MIKA 1QANA 1JSXA 1SG9A 1IY9A 2GLUA 3TOSA 2ZSUA 3CGGA 3SSMA 4HGYA 3OE5A 2LD4A 3MCTA 5DRTA 4GQBA 2BR5A 5E1BA 1L9KA 5DX1A 3BXOA 5DXJA 1VLMA 7MHTA 2PX8A 5FULA 5K8VA 3HVKA 4FS8A 2R3SA 2ZVJA 3ID6C 5D1HA 3PLAE 1L3CA 10MHA 2WK1A 5KS2A 3PX2A 5HIKA 1ZG3A 3LDGA 4FSXA 2FK7A 3M4XA 3NWEA 4PYMA 3C3YA 2Z6AA 5EMKA 4DCGA 4V0RA 1D2HA 2I62A 3G7UA 5EOVA 4YUXA 2V7EA 5LQKA 1QYRA 2Q41A 3RIEA 3SVZA 1BC5A 1YZHA 4DF3A 2B2CA 3MTEA 4GC9A 2QE6A 5HZMA 5EHIA 3PS9A 2UYCA 3DLIA 2YXDA 3KQVA 3KQMA 1OR8A 1P39A 5FQNA 2UYHA 3DMHA 5HIIA 2YQZA 1VP9A 5MHTA 5D1NA 2NYUA 3Q7EA 5CCBA 1X1CA 5K0CA 2BM8A 3HVHA 1SKMA 1NBHA 3BUSA 1L1EA 3E05A 4WVLA 5CVDA 5CD1A 5JUWA 1VP3A 5DX8A 1TW3A 3LCCA 4KW7A 3KU1A 3R0QA 4MWZA 1UIRA 4EKGA 3HA7A 4KVZA 2HWKA 3O4FA 1KPGA 3TKYA 3GO4A 4FT2A 4QVGA 1NT2A 5F2KA 2NXCA 3ANXA 2FK8A 3AWIA 3EGEA 5DT2A 5FWAA 3FTDA 3OU6A 1Y8CA 2PVCA 1DCTA 2XYQA 5LQAA 5DXAA 3TFWA 2B25A 2ZWVA 4ER5A 1I4WA 3UZUA 3EEOA 5GINE 2HR1A 3QV2A 3OZTA 5K0GA 5K0JA 2UZ4A 2JH8A 3KR0A 5EGSA 2O05A 1NV8A 1X1AA 4DCMA 3ER9A 3IV6A 3U81A 2P1DA 2N47A 2PT6A 3PX3A 4RTSA 4MHTA 3PTAA 4E32A 1G8AA 2R6ZA 5CVUA 4Y30A 1JG2A 3D2LA 4RTJA 5EMLA 1JQEA 5P8WA 2PXAA 2IBTA 4RTPA 3M33A 1RI5A 3NDJA 1O9HA 1QAQA 5LR6A 3GRZA 3ME5A 1JR4A 1TPYA 3RODA 4FSDA 2Y1XA 4EQZA 5CVEA 4BLVA 3G2PA 1EAMA 1NV9A 2GH1A 2IDJA 1KIAA 1R74A 1M6YA 4F85A 3OFJA 4F86A 1P1CA 2NP7A 5FHRA 2ADMA 4M36A 4C04A 1XCJA 1XTPA 3QOXA 1R8YA 4PYIA 3LL7A 4XCXA 3AJDA 5F2OA 2ESRA 4LWOA 1I1NA 3DTNA 3JWHA 4OX9Y 4XUEA 5T64A 3UJ7A 5U4XA 5GWXA 2JHAA 3OE4A 2OY0A 1MHTA 1L3BA 9MHTA 3ELUA 1NW6A 3AY0A 3KR9A 2ZCJA 1FP2A 1MJFA 2OB2A 2PX4A 3BWBA 3KPJA 3P8ZA 1VIDA 3H2BA 3IHTA 5DX0A 5E8RA 4YUVA 3T0IA 3EMDA 4YV0A 2EX4A 2CWWA 3GDHA 2IH2A 3EVBA 3GJYA 2CMHA 3B3JA 3HM2A 2OKCA 5CVVA 1RJFA 3DH0A 5EQJB 4POOA 2ZZKA 5CCXA 2C7OA 3FPEA 3NJRA 1G60A 1P91A 3G2MA 3I53A 3MB5A 2PGXA 1VPTA 4P7FA 5EKXA 2ZZMA 5KYGA 2Y1WA 5FQOA 4FZVA 3SSNA 4C07A 5H02A 3HEMA 5DTQA 3KKZA 1DL5A 5B1SA 1IXKA 2P3QA 1G38A 2Z6QA 4ER7A 4M37A 5DM4A 3KPVA 4JXJA 3CVOA 2BH2A 3K0BA 4ZTBA 2YXEA 4KRGA 4DZRA 3TLJA 4UOEA 3HCAA 2AN3A 3EVEA 3FUXA 1EIZA 1NW5A 3HVIA 3VYWA 1KPIA 5FTWA 3ELDA 3A7DA 1KYWA 4E2ZA 3UJ9A 5EHGA 1XVAA 3EVGA 2OPBA 5G02A 2IH4A 2AN5A 4KWCA 2JG3A 5LQNA 1G8SA 3DOUA 1L3IA 4ER3A 3B5IA 5C9ZA 4FT4A 2YXLA 5EEHA 3P9IA 1UFKA 3KQYA 2WA2A 3VC1A 3LHDA 5EG5A 3UJ8A 3MTIA 5K0NA 3EVZA 3TM5A 5HOQA 3MAGA 2C7RA 3B7PA 2YR0A 1YUBA 3BGVA 2EFJA 4RSRA 2VS1A 2H1RA 1X1BA 2PX2A 3A4TA 2OO3A 3WSTA 1AQJA 2ERCA 2IDKA 3JWIA 4QPPA 3KQWA 3FPJA 2QY6A 1VL5A 3TM4A 4O29A 5HEKA 3OCJA 5BW4A 2AZTA 2EJTA 5E1DA 5E2BA 3NTVA 3FPGA 4KDCA 5DTMA 4GC5A 1R00A 4G56A 1N7JA 4PYQA 4PYKA 4X61A 4DM3A 3Q87B 5BXYA 4FGZA 4P7KA 2ZTHA 1HNNA 3JWGA 3P2EA 4C06A 3EEYA 4AZWA 3CJQA 4B17A 4BLWA 2AOTB 5K01A 3HA5A 1AV6A 3LCVB 3NMUF 4RTLA 1NW3A 3LDFA 5CVJA 4R05A 5FADA 4DMGA 4E31A 1BOOA 3M6XA 1KP9A 2JHPA 4RTOA 2GAFA 2ZIEA 3UA4A 4FP9A 1NKVA 2HTEA 4K6MA 3T7SA 1WS6A 2ONYA 1FJXA 5EZSA 2AOWA 2YX1A 1RI3A 3PFGA 4V0QA 2ZWAA 2FRXA 2ORED 1SQFA 5K0EA 3C6KA 2G1PA 1O54A 1HMYA 3G5TA 3K6RA 2AR0A 1ZGAA 3FPFA 1NW8A 3NDIA 2O0LA 3OFKA 2ZULA 5CUQA 2C7QA 4F84A 1XJ5A 2UYQA 4RYLA 4EK9A 3P9KA 2AOVA 3DULA 2AOTA 5DPMA 2H11A 3UJBA 4CTKA 3MHTA 1Z3CA 1ZQ9A 5BP7A 3VSEA 5LQJA 2XBMA 4ER0A 3B3GA 3TR6A 5K03A 2XYRA 2O57A 2PKWA 3HCFA 2I6GA 3HP7A 3KR1A 3ELYA 3LECA 3NW9A 4LECA 4PYOA 4GOND 1P1BA 1O9GA 3FUVA 4EMSA 3KQPA 4OBXA 4YV2A 3CCFA 4CKEA 5GIPE 5CM2Z 3HA3A 2G71A 1QAOA 3EVAA 2IFTA 3C3PA 1T43A 4E2WA 5E9QA 1QZZA 2P7IA 2F8LA 5T67A 4LWPA 1BKYA 3B3FA 2NP6A 5FWDA 3B89A 3DLCA 3I64A 5IH3A 3LBYA 4R8RA 3PFHA 1V39A 3SGLA 2P41A 2JJQA 5LQCA 2P3LA 4QTTB 1YF3A 3THSA 1SUIA 4QQKA 5EZQA 5DWQA 4RTNA 3BWCA 2PXCA 2DULA 3OU7A 3SX0A 3TMAA 3TPZA 3BT7A 4PWYA 3FRIA 2AOUB 1XDZA 4XUDA 3ELWA 5KQRA 4DA4A 4C08A 5HILA 4X63A 2ZBQA 1NE2A 3AXTA 3E8SA 4E2XA 5DTRA 2XYVA 5EIFA 3VC2A 3RW9A 5E1OA 3OU2A 2CMGA 4PNEA 2I7CA 2BZGA 2FPOA 3GRRA 4L7VA 3BGIA 3T7TA 2GS9A 5C1IA 2HNKA 1VBFA 2AN4A 3A26A 3M6VA 5F2NA 1JG3A 1Q0TA 5E2AA 1JG4A 3IEIA 3M6UA 4HC4A 3M6WA 3P9NA 4BP1A 1IM8A 1JQDA 4QDKA 3FTEA 3G5LA 1JQ3A 3R6TA 2AOUA 3KQTA 3FUUA 3DXYA 3R9XB 2I9KA 3CC8A 3LDUA 4RVGA 3HCDA 2P35A 4C03A 2NXJA 5FA8A 2XVAA 3HVJA 3AXSA 4IV8A 4U7PB 4BY9E 3PVCA 3GRUA 3G2OA 5DSXA 1M6EX 1EJ0A 3JWJA 3O31A 3I5UA 4AZTA 4CKCA 2VZ9A 5EKUA 2PXXA 4YMGA 3BKWA 1FP1D 3FTCA 3MQ2A 1QAMA 4A6DA 4BP3A 3KHKA 5HIMA 4E30A 4E33A 1ZKDA 5K09A 2PWYA 3LGAA 3KPYA 5EPEA 4GUAA 3DXZA
chains in the Genus database with same CATH superfamily
2GJAA 4F8EA 1ABEA 4G5FA 3EGIA 3JR3A 5E3IA 5EGNA 4JMLA 3UPDA 4Z51A 1QRUA 1OGYA 1RM5A 3QWFA 2ZUEA 3D5EA 3L02A 1K1EA 3OKAA 5JDIC 4P5PA 3O8NA 1ZVKA 4YCMA 1JXOA 4ZCQA 5GADl 2M6LA 3UBTA 2ABWA 1I32A 2HV9A 3GJTA 4M8IA 5DHSA 1E1CB 3LS2A 3OOSA 3PKZA 2O2IA 3FVRA 1AKNA 3H18A 3FPKA 3MQFA 3KJNA 5SV2A 3Q10A 4EVIA 3T3PB 2VRBA 4QGSA 4ND2A 1FRZA 1PJBA 2ZS8A 4BU0A 3RE1A 4PZLA 3HCCA 4I7EA 5I8ZA 1W19A 4A3SA 4GYJA 3HCBA 1QH9A 2I6UA 5A05A 4YRNA 1PBNA 2ZYWX 1CY1A 1T4CB 3C24A 1ZC3A 4B4DA 2XGMA 4XQCA 1GTZA 1WPGA 1QZUA 1BX3A 4CKZA 3EULA 2IOFK 3IDOA 4A0RA 3JARB 3ADBA 4XQEA 1SKBA 3VSCA 4KNVA 4AN0A 1L5OA 3D8RA 1IMJA 1RQRA 2TMDA 3KVOA 2A35A 4TXHA 5E6SA 4IS2A 1KWKA 2BELA 4YDRA 1B6TA 4YGXB 3WB2A 1ODCA 5JI2E 3CLRD 1JJ7A 2IC5A 3MGAA 4E5YA 3L4KA 4MWCA 2JBAA 3CCBA 4KPYA 4JGBA 1JVSA 4HYQA 3W5AA 5I7VA 2XTMA 3EG9B 3MA0A 2RBKA 3ZKWB 4J94A 1HT3A 1U81A 2ZWMA 3JPWA 3EAQA 4KR2A 1L7XA 3TEFA 3A2NA 4JLWA 4ZEMA 3E9YA 3OIGA 1XXHE 1Z0DA 3DAOA 2NUAA 4PPNA 1GNQA 3IVRA 1KEEA 1J2JA 2PUJA 1D6SA 2PRIA 4IG9A 3KLMX 1LB1B 2EX1A 5EMMA 4RK7A 3S7ZA 3OZRA 3GJ7A 1NZFA 1PQPA 3ZQJA 1CUWA 1MC4A 3P97A 4JKYA 1IOLA 1M1YE 2YWHA 4R6WA 1Z6AA 3NHRA 3I4LA 3MWYW 3QHAA 4LYFA 3WYAA 3ZI0A 1JHMA 5A4FS 3CF6R 3T1VA 4MW9A 2C4HA 3IS3A 4R9SA 4NIMA 1Q11A 3ONNA 4WKCA 2J3MA 2RGNC 5D8DA 3AEXA 1M0WA 4LE1A 4KEAA 4LJAA 3ZZ1A 1QOPB 3K9FC 2F3TA 1XXHA 1RPJA 3T1QA 1NOIA 1VRVA 5D3MB 4JC0A 1HH4A 2IYTA 1GO2A 4X90A 3KSDO 3UJAA 4YV1A 5AW1A 1CNMA 1SUCA 1NI4A 1EE1A 4BZZA 1EFPA 2B99A 1JYEA 2XHZA 4XPIA 5TXGA 4KO8A 1UOPA 2V4UA 4PLPA 2XVMA 3Q72A 2B4TO 3H9JA 3ZX4A 1M1YA 2IHJA 1VG0B 1OY1A 3CGWA 1ZL0A 2XNKA 5KVSA 4PCAA 1GV0A 3A1UA 2AVDA 1ICIA 3MYRA 4ZHQF 1MX9A 4RPIA 5M5BA 1F0PA 1PD1A 4N65A 2E5FA 2AQIA 4UC0A 3KV1A 2HMVA 2QIPA 3GJQA 3R6GA 1N9GB 5FAXA 2O07A 3JAKA 4RK6A 4IMIB 2Q45A 4PG6A 1A9SA 1WL8A 4IFEA 1J70A 2D1SA 3TVYA 4OLBA 4BDSA 4UD6A 3R3ZA 2HLDD 3GJZA 5AKLA 2X5XA 4EY4A 3S68A 4EBFA 1BD3A 4AUMA 4OQDA 4H3HB 5E6RA 1HE8B 5JSZA 1QG4A 1U7ZA 1IIBA 3QGMA 3TLCA 2AK2A 2TSYB 3V5NA 1OTXA 1ZIYA 2ACEA 1FYWA 2VP3A 3C4QA 1IEXA 2COKA 1EHIA 4GVPA 1W9MA 3H16A 4PYLA 3O8QA 4XGIA 2DVMA 4KYVA 4MI1A 4HAWA 1KIFA 3QVLA 4YP7A 4CEIA 1Q1QA 1E4VA 1C1DB 1ISSA 4LCJA 1I6MA 4XEHA 4OHRA 1E98A 1TW2A 5KNBD 1LH0A 1XVVA 1ZCZA 2GJKA 4KIGA 3PCRB 2GDZA 4JB0A 4RQTA 4YS6A 1S5PA 4BP8A 5IG2A 2QSYA 2NZYA 4UZFA 4BQPA 3L9WA 3EXIB 1KK0A 2Y1CA 2EP8A 1Y8RB 2BM9A 2H5JA 4INOA 1AM4D 1QV7A 2FUCA 2HUPA 2CXQA 1SKUA 3U1VA 3UK0A 1WMFA 2JFPA 1VJ1A 3JVEA 3N8DA 4IZ6A 1E6MA 3B36A 2HPZA 4OHMA 1XRSB 4R1SA 3TBKA 5I01A 3IDQA 3I9OA 1GQRA 1XMVA 3VOSA 4M98A 4MRAA 4Y1EA 4HG2A 4G4JA 5ICCA 5KREA 4JJEA 3IQFA 2IUEA 3L07A 4PIPA 4WFJA 1SGWA 3UJ6A 2WTBA 4A4DA 1M1NA 1OXBB 1TQ6A 5KQSA 8ADHA 4JI4B 1ICEA 4M1YA 3GP8A 4QO8A 2IGTA 1UINA 4PC3A 1J2TA 2TMKA 1JA9A 3FUTA 3C14C 4RD4A 4BQNA 4JT9A 5AUOB 2IE8A 2JDIA 2ZRIA 5JT1A 4MIKA 5DM60 3ENZA 1D2NA 3IKMB 2VNIA 1ZD2P 2EZ8A 2GPSA 1E3LA 2ZSUA 4DSAA 3FFWA 5DYIA 4DW8A 1YJQA 3G7SA 1BX0A 1SXJE 2P75A 4MVXA 1ZESA 3J80A 5DX1A 2O48X 1SXIA 3QUCA 1DMRA 3QKSB 1CZRA 3FVTA 3GD5A 4P86A 4UU1A 4ZANA 3T3GA 4D8YA 3R5JA 4EUEA 2I6XA 2L42A 2W00A 1WQ3A 3DEIA 2P68A 4R68A 1WCYA 4W1RA 4CMKA 9ABPA 3KUCA 5JNRA 1OIWA 3H4MA 1VIMA 3QSGA 4P3PA 1NHWA 4LRQA 2C7RA 1U2PA 6REQB 4P31A 2Y27A 1J2RA 4XEUA 5MFZA 3NYRA 3BFPA 2GZAA 1L7QA 4R2LA 4ZAXA 1R66A 2J3QA 4GKBA 1E96A 3OECA 3ZGOA 3BDVA 2RARA 4B71A 4MR9B 1K0UA 4ESEA 1SXJA 2VEOA 1Q57A 1U7PA 2EBHX 4K6KA 3DBVO 5JAPA 3FMOB 5T6MA 3F5DA 1U8YA 2JKVA 2JLYA 1NM5C 5HIAA 3QJGA 1LI5A 1WDMA 3HVHA 3AF4A 1DIGA 1Z36A 4S24A 3AEQB 3TQTA 1U9YA 4DLRA 3BF8A 4MSUA 2HU8A 4C22A 4DCCA 4ZMRA 3HBAA 1KETA 2IY8A 1L5VA 1NN1A 3NEJA 4M0CA 4YROA 1CZKA 1JHUA 5AVQA 3M6MD 1VDMA 3VR5D 5L53A 3FLAA 3JZFA 2IV3A 3L1UA 1G291 3TKYA 1MFPA 2ZSDA 1RXIA 4FT2A 3U48A 4HRVA 4JQCA 1JMVA 3HP1A 2C61A 3PUJA 1BWRA 5T4EA 2K7ZA 3LNTA 4KQJA 2QP9X 4DBLE 4EHHA 1SOAA 2GUGA 1F8UA 3G9UA 4EHIA 3RG8A 4TT3D 4QE3A 1KF0A 1L5QA 4GM0A 2Y0EA 3AM3A 3U49A 2RK3A 4K9OA 2AMLA 5AKJA 1Y4SA 3HE3A 4WLUA 4TMVA 2C88A 2Q6IA 1WV0A 4FI3C 3QK7A 3IOEA 3W77A 2QUZA 4Q9IA 3GJ3A 4YRKA 5A3JA 4HB4A 1I7DA 4IDFA 3H1BA 4QOGA 4R2IA 4BNZA 3A4MA 3PCTA 3IPRA 4JAVC 3SKXA 1HYHA 1MA3A 2C5FA 2P0AA 1MPXA 2XOKD 3HB0A 4BWVA 4CZ2A 4EYKA 5AXDA 4Q4HB 1QDEA 1S9DA 4LOLA 2IZ5A 1ZAYA 4IIVA 1E6CA 2VTEA 4M36A 2HSDA 1RKUA 2O2XA 4PC2A 3K6SB 3IALA 3LIIA 3V2GA 4P32A 1M66A 1A5SB 1ETUA 1DTWB 4OD0A 4Q18A 4KR3A 5BYJA 3VOAA 3ZXSA 4Z4EA 3SG0A 1SVIA 4O4HB 1KMQA 4ME6A 3IB6A 1A2OA 1NQTA 1U1CA 2J4DA 2GM3A 3C6ZA 1G9XA 1ORWA 2C3UA 2IVFA 3A1WA 3CX7A 3NX4A 3WGZA 1PJSA 1WBBA 3KAJA 4DIEA 1BCSA 1JKFA 3IBTA 3LUPA 5B1HA 3L4BA 1NNUA 4J7UA 5JJIA 5JD6A 1XYVA 1ZNZA 3R7WA 5ALHA 3OICA 4C7MA 5GONB 2RAUA 4IMRA 3DFIA 4NMXB 3EQ6A 2BGWA 1FSZA 4B40A 1L5WA 2BMDA 2SKEA 1EYZA 2VT7A 3JATA 3NBZC 3KXPA 1E2DA 2JIMA 5ECGC 3F1KA 3UWSA 4DEXA 4IHJA 1UPUA 3HK2A 3I5YA 3KLOA 3K5HA 1TVMA 4GI1A 1N8KA 5HDBB 5EQDA 3IE0A 3ZWXA 4Z8XA 5JVDA 3KSBC 4D4KA 4DJDC 1M8PA 1T5OA 3NR2A 3HCAA 3BXPA 4XPZA 5JCXA 4AO8A 1EUCA 2RGEA 1HBJA 2VJYA 2ZKIA 4JI0B 3NAZA 5JE8A 1NXVA 1KYQA 3FBTA 3V8QA 3A7DA 1KYWA 1R4ZA 3PXBA 4QGHA 3UMBA 4HGNA 2GXSA 5BWCA 4IQ0A 2WR8A 5DNVA 4PQFA 2AN5A 4GOKA 2VATA 1EDOA 5IZCA 1L3IA 4ER3A 2O54A 1J5PA 3E3MA 3B5IA 3G79A 4DBZA 3PVZA 5EEHA 1RSZA 5ITZA 3KFXA 2HM7A 3NWPA 2OESA 1ONPA 1CY0A 4AJ4A 4EHFA 1QFSA 2BZSA 2FE4A 3LY7A 4FE3A 4US0R 3U3ZA 4CLOB 4DLZA 2FMTA 1G20E 1H0SA 5AHXA 3IMKA 1SR8A 3ROFA 3T1OA 1JAYA 4W7SA 4WY2A 3T7AA 1X7GA 2H1RA 5FTKA 1A2BA 1E3EA 1KQ3A 1LX6A 3ZTWA 1RHKA 4R5MA 3RASA 4H7PA 5CM8B 3OA2A 1JB9A 4O29A 3B70A 2AZTA 3VDNB 1WUTA 1GKUB 1QVAA 2IZ1A 1YCGA 1GD1O 2QA5A 4ZV7A 5C1DA 4KAJA 3RK1A 4LTDA 3LW7A 1YRQA 2MSNA 1XD9A 3ZHTA 4JLNA 4DLAA 4C06A 5ADHA 1NJ1A 2QIOA 4Q5IA 1DC6A 2UUPA 3TB4A 4B0PA 4EUSA 1GRNA 4LYGA 3LCVB 1G20A 3P2MA 5CVJA 2B1IA 3GFPA 1D5WA 2AF3C 3PKIA 2DF8A 4GLBA 5AM0A 4Z1MA 3MS2A 1TYCA 2GVNA 4EPXA 4EHDA 3KWMA 1C3OB 4JJKA 2JGKA 1E3WB 1K06A 2FPIA 1I2DA 1ST3A 2JVKA 1XTTA 2NU6A 4LXXA 4TQUS 4CGZA 3D6JA 1CG6A 3DOHA 4RM2A 1XPRA 3IQIX 1KL7A 1NT4A 2PLFA 4JY7A 5AXCA 4G8CA 4PZAA 1K6XA 3QIAA 1AHPA 2XMSA 4NP6A 3MK31 2ZULA 4HNUA 3WZLA 1XJ5A 2FA9A 3LTEA 4ZGWA 1VOTA 3OZFA 1GZSA 3Q5GA 4DNXA 8GPBA 2C84A 5LJIA 3HXQA 1PYGA 4E1AA 5K03A 3SS9X 1X6VA 2X7XA 1L7EA 3NW9A 4URXR 1C14A 2Z4RA 4EM6A 4REOA 1IE3A 5CDHA 3HHPA 3ZGVA 3AEZA 5ELXA 4G97A 2GBLA 2ACVA 1LLUA 1Z26A 3Q7QA 3BB4A 4ZVOA 4DA7A 5GIPE 1P2UA 3E4CA 3KUUA 1U28A 3KVYA 1UKZA 3IXQA 5FI0B 4PSCA 3LRTA 2OHXA 2VTDA 1NJFA 2FN4A 2PO7A 5E9QA 1P1HA 5HKLA 5B53A 2HJSA 4CN9A 5FOQA 3RI3A 4HVTA 5JOQA 2NYRA 1C4WA 3A1SA 5JS2A 5FWDA 4DLPA 2ZE8A 1ZI8A 4WFIA 3IILA 4GPD1 5AWFC 4AW9A 1UR5A 2FZCA 3G9ZA 1PAUA 2I78A 2C58A 3ONDA 2BE9A 4CI0B 1IXYA 5DI3A 4O63O 4V3BA 4GLLA 1IY0A 2WKRA 3MBIA 2XUGA 1CCWA 1B7GO 16PKA 1ZW6A 4ZQFA 1KO8A 1ORVA 3BRWD 4XGQA 2FEOA 3EGDB 3L7AA 3WHLA 1W0JD 3FZQA 4CM1A 4D9BA 4G0UA 1IHOA 2ODQA 1Q7BA 3NHYA 3NT2A 3TTXA 1FMFA 3E35A 3RH0A 4BFSA 2VT6A 4LQCA 5FPHA 1JHZA 1SKYE 2P6UA 4BVLA 4CF3A 2CL6X 1J90A 3L8GA 4CL0A 1XEXB 2C4NA 3I6ZA 4LGYA 5IX8A 4HATA 1QMPA 1E20A 2QTVA 4YRCA 7YASA 2W2MA 3O1HB 1MU0A 3QVWA 2J31A 5AKXA 1RKBA 1T2VA 2VAXA 5H3LA 2PQ6A 4IGFA 3QRWA 3AHFA 3M6VA 1JG3A 1AY0A 1IB6A 3LNCA 4MZDA 1LRKA 2C98A 1HE3A 2AK3A 2NZ8A 4ZOEA 3QELB 3NC4A 3JQ8A 3VU8A 4D1YA 3TG8A 4XX0A 2AOUA 2HRZA 2QTAA 3AIKA 3IUNA 3WK4A 3T9FA 2I9KA 4ZCTA 1NQAO 3E9QA 3LP6A 3EEQA 721PA 1JFFB 2DR0A 4YRPA 3AXSA 4G0MA 4AX4A 2RI0A 1LPPA 3DWEX 4WLNA 3OQMA 1M6NA 3K16A 1A88A 1UUFA 2BEJA 1QZ3A 2UKDA 3J7TA 4MAAA 4LF5B 5DLPA 1B8UA 4N7BA 2ZSAA 3JWJA 5C53B 4RD0A 4LRWA 2DEUA 5FP0A 1FDVA 2WF5A 2WTNA 1SD5A 3CB2A 2R8BA 1P1FA 3MQ2A 1QQTA 2IYXA 3H13A 3U2QA 5HCIA 1X7YB 1MDFA 1D6MA 4RULA 1TF5A 2BKVA 3N2YA 5HFAA 4B34A 3AEUA 5LYJB 2E4WA 3DXXA 4I50F 1BAPA 1GPKA 2ARKA 4CG3A 1Q95A 5LCXA 3IIKA 1GGNA 1KRHA 1VE5A 5DCYA 1IJFA 4AJNA 4ARCA 3R24A 1U0HC 3A70A 2MYPA 1DQPA 2BMWA 4UDXX 3QWBA 3LRPA 5C80A 5IJ0A 3NTLA 1TPZA 3AV0B 3CE6A 2D1TA 3CLTD 3IKJA 3V1NA 1ZM2A 4EIWA 3KETA 3D6FA 3OFVA 4Z99A 4EW2A 2EYUA 1VJ0A 3CF4G 3DKRA 3GFQA 3VKWA 4WRRA 3FNGA 4CV2A 1HDRA 5IDYA 1L8AA 2E9SA 4NEQA 4XSHA 4IWXA 4N9QA 1UBHS 1ZUD1 5D3ZA 4I8IA 2C9BA 2YHUA 3D2AA 4O4IB 1P7YA 3ZWVA 4FSHA 4KX3A 4MUEA 2ZJ3A 5DEOA 1CDDA 1RXCA 3UO8B 3A11A 4U5QA 4XD2A 2ES4A 2QU7A 4AJLA 3C3KA 1Q7EA 3JQ7A 1N32B 1NVVQ 3N8IA 2J0UB 1XKTA 2VUIB 5KDLA 3ZHBA 2B94A 2AFHE 5G1NA 4UNSA 4MH0R 2B1RA 2J85A 2PL3A 4QYSA 5JATA 1L1FA 3VR6A 4MP6A 1EK5A 3WADA 4R2JA 3ZE0B 3ZU3A 2PWPA 1PE0A 1BXGB 5A4AA 1AMOA 4LF8B 1XDSA 2MSKA 3IUMA 2COUA 4CEJA 1C1HA 1USWA 4PLFA 4P35A 3LT2A 1C8VB 4CDNA 2P5SA 3S2IA 4EEKA 1RCFA 6ADHA 3S2FA 2YN4A 3D3KA 1CF2O 2YMQA 3DZDA 2Z08A 3N5CA 5KINB 3WY9A 2Q2VA 3ICPA 3SEFA 4D41A 3IE1A 3H5RA 2R8PA 3OVMA 4AO7A 2GYWA 4YRBA 5HUHA 5F3RA 1RWVA 4H16A 1NQVA 2AFHA 5FTMA 4EELA 1Z4QA 4AZSA 5CDUA 4J8PA 2R25B 2I2CA 3TCXB 2XUOA 3IPXA 1N77A 4OQ4A 4W9RA 2E21A 1I9GA 4BQIA 4MRNA 3PC2A 3PNBA 3UJDA 1ZWKA 2QGZA 2NX2A 4GE3A 2AI3A 1E0AA 4L5BA 3AW8A 1TIBA 3MWFA 3OZVA 1ZUNB 2VFAA 5B30A 2KX7A 4C0XA 4L7QA 1NFFA 2P1ZA 1UJMA 4MUJA 3GXBA 4M9XA 4OXXA 4BWFB 4EARA 4KPGA 2DAPA 4Q24A 2B4RO 2EDCA 1RCTE 3MJ4A 1PR6A 4YJ2F 2F8TA 4LVNA 4B9AA 1SNYA 4RK0A 1L9XA 4I19A 4WESB 4B2LA 4ZCRA 1FS4A 1VKNA 1I7QB 1WSAA 3I2JA 4LY3A 4D8WA 1QHGA 2PH5A 1ABFA 4NABA 4LY9A 4NV0A 5L3RA 2ISSD 3Q9NA 3LUGA 2NU7A 2P5UA 4KMOA 3T3IA 3T6KA 1WUKS 4G1UC 4TQGA 1WEKA 2ISCA 4Q00A 4EF6A 3NOQA 1LA2A 1JKJB 2BOVA 2ZI9A 4IOMA 2CXOA 3MCZA 4ENWA 3T3NA 4HDCA 1ZIDA 2W2PA 4PCUA 5TVGA 2XUDA 3GD7A 3BQ9A 3EIOA 4RPKA 4YASA 1W47A 2CHEA 4NE2A 1U3VA 2GOYA 3EHDA 1V16A 4ZOAA 1YBHA 1X1SA 5ADVA 5SZKB 3PGJA 1ZMOA 2GCPA 1GZ6A 4OHBA 3CVVA 5JV5A 1GR0A 1E64A 3UGQA 5EJGA 4XSGA 1JTFA 4AY6A 3IIMA 3UT5A 4KK4A 4IGAA 2FKAA 1D9XA 1FUKA 5AFSA 3NYQA 2A9FA 3ETDA 4NAHA 4TV9A 2VHZA 5A7FA 1PG2A 3A6GA 3H7AA 1Q0UA 5JRDS 1SUPA 2YWXA 3T9EA 1C9JA 2JLSA 3LXMA 4KWHA 4LN1A 4Q4AB 4B46A 5EHZA 1RWOA 1O0CA 4X66B 4M1MA 4CTNA 3BE6A 3PU6A 2FPMA 3FY4A 2PZLA 3A05A 1P4JA 3GQVA 5GM1A 4FNAA 2B7LA 4ISCA 2XMGA 4R83A 4WBSA 4YHBA 3MUOA 3BF7A 1FP4A 1HF3A 1U80A 1YOVA 4DCVA 3UAZA 1PYDA 2V4ZA 4DRYA 3IAHA 1ABBA 3QU7A 4Q7JB 2AMFA 2HLHA 2Q2QA 5KNDH 3VUEA 4N5NA 1NSFA 1MX5A 1EFRA 1ULTA 2O06A 3MTGA 4FMCB 4K9DA 5A4DA 3FI0A 1E9AA 1K2VN 3S1AA 4BATA 3CT4A 1GUDA 4YCCA 1A69A 2BWJA 2VP6A 5E4YA 3GMDA 3ZNPA 1AA6A 3PA8A 4UATA 2FMXA 4BJ6A 1VPVA 2J5QA 5C1BA 2AC4A 4GXNA 3QX8A 1DARA 3LPMA 3PR1A 5GOZA 4UUAA 5KTTA 1GNTA 1MO5A 3TW6A 5AKGA 4G5YA 1NVXQ 2E4UA 4MVJH 1KC1A 4EHJA 2LDXA 2ZJOA 3N8GA 1S8OA 4MKHA 3SQNA 2AHRA 2GD6A 2NO6A 2P2NA 3KOYA 3VZRA 1UT5A 4N1AA 4PZDA 5ALPA 1WXEA 4H59A 2GYUA 4C7XA 4H1VA 3SICE 1AIPA 3R7SA 3VPCA 5F1YA 2QM8A 1G6Q1 4QU9A 2CFCA 1WKCA 5JMTA 4MMXB 1VSUA 3VHLB 1NJSA 13PKA 3I8XA 4BNXA 2WQZA 2Q9AA 3BCRA 3SMVA 5TMDA 2FWPA 3SSAA 3R74A 2VCYA 2OO5A 3IYLW 1S8AA 2FG6C 1XHEA 2XWPA 4J03A 1F8XA 3DF7A 2YMMA 4KRYA 1CWUA 4LI3X 3MD9A 5D5PA 3NUZA 4Y9RA 1OC4A 3MCTA 3E48A 3JD0A 3R7DA 1R1DA 1ZCJA 1L9KA 2RB5A 3AR8A 1EGHA 2AIRA 2D59A 3ITKA 4HDNA 4YQZA 3HBMA 2Q29A 3CZRA 3WGLA 1YTLA 2HPAA 2I6FA 5D85A 4GMGA 3VAAA 1SIUA 1RWKA 3D5TA 3U80A 3M2PA 1NDHA 4NENB 4AY4A 3BIJA 4D82A 4V0RA 5H83A 2I1WA 2IL1A 3ENWA 5HYVA 1RWBA 4BVFA 2I03A 1MP0A 1PR2A 3FVQA 1AB6A 5DNWA 3RAPR 5GJBA 4NCHA 2IPNA 4G26A 2E89A 4PAQA 5B3LA 3W78A 1YACA 3E9CA 1VI2A 3OLXA 1NJ5A 4RHUA 5MGNA 4C0KA 3FCCA 3QLEA 4RDIA 4A5OA 4EFLA 5HKBA 1H4QA 7REQA 1A4UA 2XBUA 1NXPA 4O4JB 4QYMA 2JI7A 1KI7A 2D4AA 2XUHA 3AM1A 3E1GA 1BVUA 5C4IA 1BMTA 1ULZA 2WQ7A 1NVVR 2LV8A 1M1XB 1D0SA 1E1LA 3WDLA 1W0KD 5EXXA 2O2ZA 2GO7A 4IJKA 5DIFA 5KYNA 1VA5A 2NPIA 1UWCA 1S1CA 4G5HA 3NKVA 1P9WA 1Z6QA 1X7WB 2TS1A 3FE2A 5AOAA 3ZCXA 2CE7A 4RUKA 4EKGA 4KFSA 3PC4A 4P4SA 5JMPA 3X2FA 4H77A 9LDBA 3H8SA 2C4MA 4MYSA 2G1AA 3DMTA 2CNDA 5FNVA 2UZ1B 3ZJUA 3ZN2A 1QFXA 4KZKA 4UUNA 4NDZA 2XYQA 4ZAYA 3FNQA 3TIXB 4EB0A 3QEKA 4WGFA 4QFDA 1I5OA 2IUYA 1D6NA 1G7RA 2JH8A 1HYGA 4GSYA 4KGVA 1FNCA 3CX6A 1P2VA 4GPBA 1EK0A 2Y93A 3BN3A 2FPUA 1BGXT 2JAHA 5D86A 3U81A 2PT6A 1FYVA 4COKA 4YJ3F 3VO9A 3KUDA 4G1MB 4JSYA 1CPYA 2PXAA 4WUTA 3GR6A 3SPXA 2YIVX 4L51A 2PKQO 5ULLA 3VU1A 1VMAA 1E9CA 3PBKA 3RVMA 5LXTA 1B1CA 1GLGA 1T8SA 5EZYB 3W5BA 5DBGA 3HKBB 1KZGB 4FXOA 4UPDA 5HFNA 4HZUB 1YR1A 4HB2A 1M7GA 2X5NA 1ZH8A 1WB6A 2J5BA 2H2WA 2NO1A 2QRGA 5F78A 1P1CA 4JVOA 3MJFA 4H0CA 4D02A 4AJJA 2QQEA 3ZE6A 2Q4EA 5BQXA 1Z73A 3RAGA 3A1FA 2HI0A 5C7YA 1OJ7A 3RRNA 1JXMA 2WTEA 4UEOA 5DMXA 5LFAA 3OSUA 9MHTA 3QBJA 4GG1A 4PTLA 4HX5A 2B69A 1M2HA 1N5OX 5AKHA 3X2EA 1HLFA 2WDPA 3KPJA 3H2BA 3IHTA 5ENZA 4MUAA 4ZO7A 4BN5A 3QUQA 2PH7A 3GVXA 4UCWA 3GDHA 1FYDA 3W8RA 1HX7A 4BO5A 4OKIA 1AZSC 4G0ZA 5ER6A 2FDXA 1HEIA 2JHGA 2ZIXA 4LX8A 3W2IA 4N3CA 3LWDA 3VPFA 4PXYA 4JGIA 4CLXA 2VH1A 1P91A 2A1UA 3L0IB 4LXIA 4BEJA 1KYTA 3SBXA 4R7TA 4DMCA 1JG6A 2FMHA 3AU8A 3T4EA 3B1XA 2JK1A 4NKRA 3FTPA 3HZRA 3I6BA 4WZAB 1SUEA 1Y80A 2AR9A 2D13A 5CA0A 2W6PA 3UB2A 3ZTYA 4CF6A 3ZDAA 2V58A 4EFDA 2IUTA 2BH2A 2QZSA 1PVOA 3PYXA 3W5JA 2NQ2C 3TR0A 1X1TA 1XNRB 3DTVB 2KLHA 3C16C 4L73A 3CNLA 3HVIA 3T3HA 4FFBA 3QI7A 2NU8A 3VJLA 3ZEIA 3ZGZA 4LY6A 3C7DB 3NAMA 1FS6A 1H22A 4UUOA 4W5RA 3UJ9A 4EGSA 1XVAA 3EVGA 3SWWA 5KYYA 4BMZA 4JLUA 1U7XA 2A1IA 3VHXA 5B4VA 2PX3A 3TOCA 5JROA 5KI6A 4M99A 4BS9A 1XPJA 3CF4A 1NHGA 1HE1C 1QC5B 4JI8B 1R6DA 4ZICA 1QZTA 3P9QA 1UBNA 3CXRA 2OHGA 4KYUA 5AQ1A 3FSJX 2OQ2A 2JI4A 4JVSB 4FW8A 4EW3A 1YB4A 4ZU1X 2OO3A 4YMLA 2GNOA 2IYSA 4KAFA 1DKNA 1NATA 2VP2A 3L5OA 4DOMA 2Z2JA 3PP8A 1K66A 2MSWA 4Y9TA 3T7IA 3L6BA 3WB0A 1Q15A 4PC7A 5DTMA 4GC5A 3NXSA 4QGAA 3BAFA 4WVFA 3ZV4A 4BB0A 3O8LA 5BOSB 4OX9B 4I8XA 4P7KA 1EGMB 1E66A 1W76A 3OLCX 2GFQA 3AY3A 4OSOA 5EP1A 2ID7A 1XTQA 2OD7A 2WVGA 2G1UA 3S2ZA 2APJA 3U7JA 3H19A 4RTLA 3MGCA 4DIKA 3OTOB 2R7NA 4L72A 4NFYA 4X5OA 5H80A 3TN7A 4Z4IA 4P4UA 2XMDA 2XCUA 5BWNA 3F3KA 4Q9HA 5FX2A 4B73A 2WJZB 1N5IA 2XRFA 3IEVA 3T9CA 1XX6A 1QYCA 2JFHA 4B4VA 4KR6A 3VDQA 1SB8A 4FQ7A 1T5IA 1FJXA 2P2GA 4AKIA 3QVGB 4K28A 1WW3A 4EA7A 5HRUA 4OJMX 3SZ3A 2MSDB 1XTJA 2ZWAA 2ORED 3ZHRA 1Q0ZA 2JH3A 5BR7A 1ZGCA 4M1QA 4UZSA 5CT9A 2VRNA 1KZ7B 3QXCA 4YPFA 2VO1A 4HVCA 4IQ4A 3NM4A 4EK9A 2F64A 1QBKC 2BEWB 1JEYB 4CF5A 2RHLA 3MHTA 3DBRA 1FLAA 1LS1A 1KP3A 2PSFA 2RGDA 3N7TA 4Q3AA 3VSEA 2VTBA 1LV7A 2GN4A 2CSXA 3KR1A 3EZ6A 4LECA 4MPPA 2I6GA 5KOYA 4GAEA 3D4OA 1O6BA 5E3HA 1C7JA 3H1FA 1Y7IA 4KO3S 4FFPA 4QU8A 4HO1X 1PLKA 2EW1A 4YQEA 1ZBDA 1THZA 1WU8A 4RS4A 4YO8A 2B98A 2BPOA 4OAOA 3F78A 5F5XA 1BW9A 3W9UA 2VJNA 4DRXB 4B83A 1GL3A 4ZZIA 1SZPA 1NLMA 4OHKA 4R41A 3FTQA 1J22A 3EIQA 5CX4A 4S1NA 3AV3A 4GDMA 2LXNA 2P3LA 4XQ0A 1E4YA 1K8XB 3V00A 1P2TA 3PF9A 4B85A 2V7TA 4PPGA 4TTIA 1CJBA 1LNZA 2BW0A 4Z4CA 3NVKI 3SX0A 2O2GA 3WB9A 4CMIA 4NXNB 1ULBA 1ZX1A 3R23A 4RCYA 3DEAA 2JLBA 1R4MA 3TX6A 2DZDA 3G6KA 3QMWA 4GR4A 1W87A 4LXGA 1YRBA 3RJ5A 1GGJA 6GPBA 3RC7A 1R6VA 1TZBA 1YMQA 2ZDQA 2XRYA 5EIFA 1XZ8A 1UPBA 1YVUA 5DOZA 4D46A 2PE5A 3T1HB 2AZ4A 3NTQA 2YHAA 3B9BA 3RRFA 4B3IA 1E1YA 4LE2A 2JAXA 3SYNA 4CIXA 1D07A 3AR9A 4GICA 3RTGA 4DQUA 4N5HX 1E6KA 2VHXA 1WZIA 2ZBFA 3CZCA 2QAGC 4LVUA 4BFUA 3O3MB 2VBCA 3P9NA 4XJVA 1IM8A 3SNHA 3FTEA 1JVNA 3CUKA 3TDKA 2H2HA 4LIPD 4QG7A 5ARBA 2RE8A 3CH6A 3V7WA 2NXJA 3S4YA 3JD1A 3K8ZA 1L7DA 3H9CA 4HDKA 3KKLA 3GPIA 4BNKA 2YVAA 3RSQA 2GN2A 3KYDB 3I83A 2OENG 4M0DA 5DTEA 4XQGA 1YCHA 1Z0IA 5KYVA 5I51A 2XCSB 4EUHA 2YJGA 4B6QA 4Y2UA 4CKCA 3IL2A 1IRXA 4LXYA 5HZKA 5FOSA 2HBRA 3DBLB 1U8TA 3GEDA 4JOQA 3TQRA 3WKBA 4A2WA 5BV0A 1DCTA 3V46A 3P94A 4DDMA 2YRFA 4QJ5A 5JAZA 1D2EA 4P8RA 3IO3A 3KOXA 3OESA 5E3JA 4TWZA 3V8MA 3I9V6 2BEVB 2PUTA 4HSGA 4L08A 1O94C 1BMQA 1DG9A 1GAWA 1MV5A 1DBPA 1V35A 3G49A 3TTYA 5CXUA 1MTOA 2DC1A 2WFMA 2VHEA 3AHDA 4W5OA 2PX0A 2W8ZA 3TNYA 4CWAA 3PDIA 2DBVO 4I4IA 4AJ2A 5IP5A 2OZLB 1G9SA 1V26A 3CX4A 1EDDA 3C70A 3IP5A 2UZ0A 3K30A 4JEHA 3CNNA 3F5QA 2GCOA 3QU4A 5EJ4A 1QOZA 1K6MA 1MJHA 1YNSA 3DL4A 3P71T 2B82A 4LRSB 5ERYA 4D92A 5DHUA 5J23A 3AB8A 4ROTA 2FB9A 1T25A 2MWMA 4K6FA 4Q7EA 3OTHA 4ALLA 3I9JA 1EVIA 2VJPA 3IIJA 5BYKA 5KTOA 1LI7A 5HCUA 5KTPA 1Y4AE 5DASA 4NCKA 1GPH1 3COYA 3MN1A 3E22B 5BN1A 3CNEA 2FPGA 5FOXA 3RC3A 5TMPA 4YJGA 2CHQA 2O52A 3OZWA 3EHEA 3GA7A 3KPUA 1YA6A 1G19A 4KDEA 1KU6A 3WIDA 3UK2A 1TJ3A 3D3NA 4AZVA 2HJVA 2C2GA 3FA2A 4MZXA 1ZW1A 4C0JA 1UK8A 3MRSA 2CE2X 1T0BA 3MJTA 3JQFA 2GCNA 2X0NA 2I4TA 2H4JA 4MWGA 1CIJA 3KCNA 3ASUA 3GAZA 1SIOA 2A9JA 3S5UA 3UUGA 4XUCA 5A71A 1KSGA 1G6KA 5SYAA 2VYCA 1RACA 4K3UA 5B7NA 4B4WA 2D2FA 4DCPA 3EA0A 1TJNA 1X13A 1R8QA 3Q1LA 1JKXA 4FFMA 3L1VA 3OZUA 4KBGA 3KJEA 4TWIA 4BKQA 5C4GB 4CM4A 3U6BA 4R8SA 5TJHA 5BMVB 4GZ6A 3L0ZA 4HQOA 4R0VA 5TF4A 1CUDA 1QHHB 1TCAA 3W79A 4OL0A 2FRDC 1PJ3A 4QYWA 1BE8A 3DFKA 5T4BA 5J47A 1SUWA 4RIGA 3FDFA 3VHQA 1JHQA 4K9MA 1UAAA 1TT7A 3KLPX 1ZLYA 2NU9A 3GDOA 3P9PA 1S1MA 4MAMA 2ZITA 4RKWA 3WJ7A 2JNWA 3U9SA 1FFHA 1M0EA 4HVLA 1FDSA 4MV6A 3TLKA 3EF1A 3C3BA 4MGHA 4C0SA 1NXOA 3LO8A 2X19A 1JVBA 4MHSA 3AVOA 2PMEA 5K3EA 1WCIA 3GLQA 3NH9A 1KERA 2WUWE 1YAHA 4H17A 4MKRA 4BB9A 1PR1A 3QEOA 4GBGA 4FN4A 1DLJA 5ED0A 4LRTB 1G8GA 1O89A 5F7ZA 2PK3A 2XKJE 3LWBA 3GMSA 5TPWB 5H7XA 2J6CA 1PR9A 2P1RA 2PQ2A 1MW9X 4HH0A 7ADHA 2AYXA 4J3FA 3AY7A 4BNFA 3QX3A 2C42A 2WJAA 4FOOA 1UZNA 1ZN7A 4QPNA 3VR2D 1FU7A 1JR2A 1Z0AA 2ZAOA 3QKUA 2X6QA 2EWVA 1OAKA 3W8NA 4BZQA 3CUTA 2QRVA 4OQZA 4MW6A 4TLEA 4CKXA 4CTOA 1S3GA 3DL0A 1IZ7A 2V8OA 3T35A 3UHAA 4C87A 3EXEB 5ALOA 4BLOA 3FD8A 1D04A 2WF7A 4GRIA 4Q1FA 3IDFA 3IAXA 3Q8XB 4HMOA 3T7KA 3UJCA 5CYGA 3ZDXB 5B6IA 1P2FA 4JHXA 3RYCB 2HU7A 2I65A 3C7TA 1A71A 3OUTA 3PNLA 3ZDFA 1W4ZA 3OEEA 3PUXA 4HNRA 3Q8LA 1U5BA 1OSNA 1D1SA 1J25A 2RK6A 3DEFA 3N6XA 5C8XA 1TZCA 3AU9A 4QHYA 1GPJA 4YRFA 3S27A 2ZS9A 3DL7A 4GT1A 3P0HA 4EF5A 1P8JA 4LFBB 1S4MA 1J8DA 1ZR2A 1MXFA 1U1IA 2WM2A 1TO6A 4ZGBA 3WQBA 5KOHB 3FB1A 2IPAB 2W2XA 1DDGA 2IZZA 4W8HA 3GZJA 3IDZA 4M7OA 2E1PA 4XOUA 5BT8A 1T5DX 1SJ9A 3V4RA 3TF5A 5A6SA 3HFJA 4ZREA 1SQSA 3VPBA 4IJMA 1QIGA 4K6GA 3GU3A 4J6EA 2I1LA 3I1YA 2PGOA 5THKA 5FWXB 2IXGA 1XLVA 1TOAA 3CU5A 4AG5A 2CLLB 1EGVB 1JBQA 1YQ9A 3QKIA 1RI2A 3TD2A 5AICA 5AIAA 3SEAA 1Y3DE 1I2ZA 2H7YA 4D4MA 5LM3A 1DC7A 4H7IA 4AZ3A 3E1KA 1HOXA 4LSMA 4OHWA 2VK1A 1U2ZA 5CLGA 3DONA 5DSTA 1SC3A 5AVVA 3LZCA 5HVNA 2IV2X 4B5KA 4GXQA 4BWGA 1R6AA 1JF8A 1AN0A 4A0HA 2RAFA 4MWBA 3WK7A 1C2TA 3K0EA 1R6UA 2P3SA 3CYFA 3T9DA 3ZXUB 2QORA 5L51A 3ICOA 3FOWA 1LCIA 4WN9B 2P9CA 1DBIA 4BX3A 4YMHA 1WPXA 1UC8A 5EWLB 1CUYA 1EXWA 1I2CA 4BCCA 4GQBA 2JAQA 4ZEVA 4M53A 2AI1A 3UWDA 1UBEA 1XMQB 1UPTA 1ZG3A 1MGOA 1CTQA 3U7QA 2J5KA 5F52A 3EPHA 1DWPA 3F5SA 3WYDA 5IJ9A 4L6IA 1ZAKA 3NKFA 2H3EA 4P08A 5DHAA 1VDZA 3AKEA 2V7PA 2Q41A 3EQZA 5SZHB 4ALNA 1BC5A 2O0HA 4U0JA 4UM9B 1MKYA 4G1VA 1T35A 5JSKA 4A8JB 5EKDA 1IONA 2QE6A 1XMXA 4EG4A 2XAUA 1OV4A 3JQPA 3GEHA 4FEGA 5DM70 3F98A 4BO0A 2Z56A 1Y6QA 2PQMA 3KQVA 4XCVA 5J2TB 4P0PB 3Q9SA 2HMTA 3OFNA 5C8YB 1B1AA 2NYUA 3O90A 4DDHA 2PL9A 1C30B 3A3YA 5B1YA 4KE8A 5JZVA 5BVHA 5BVGB 5GGXA 2AZDA 3G0CA 3QVMA 2P9JA 2VK4A 5JNLA 1FFDA 2WYHA 2G5CA 2J7PA 4FLFA 3NANA 5C31A 2OV3A 1ECLA 2NVWA 1C29B 1V8PA 3C7KA 1WULS 4KW7A 2H0QA 3ZWMA 2GK6A 4I55B 3UMFA 4EHLA 2J3IA 3A10A 4S3MA 3I9V1 3O4FA 4NWIA 2W70A 4I1YA 1QGDA 2AQ8A 1M72A 2ZIZA 4O2AA 3A9SA 3M1IA 2GZDA 3KNZA 2Q46A 1QIJA 3D4BA 2WFLB 1YAJA 2IT1A 2PVCA 4FYIA 3JCZA 3X2SA 1RM3A 1JAHA 1QKIA 3HBLA 4MA5A 4DILA 1RM0A 3EJWA 5FYQA 2XQGA 2C94A 2J9GA 1P0QA 1RRFA 2WILA 4U63A 3DDWA 4V1CA 4B7ZA 3CPHA 4RF5A 3U39A 1ZRSA 5JDCA 5EXSA 2C2MA 1X87A 1OFUX 3C3EA 1WD7A 1U2RA 3K2EA 1GGFA 2G9RA 4LDQA 5JI3E 1UDRA 2VSXA 3TO5A 4FLMA 4ZAWA 1L7NA 1GA4A 3ETHA 3GB9A 4Y30A 5EMLA 1CS0A 1JJFA 2IPMA 3A4VA 1RI5A 4UJ3A 1NVFA 1SULA 1HPLA 1TVKA 2ZWPA 3G5AA 3N76A 3GRZA 3QXHA 3CVWA 1AG9A 1COZA 1QZXA 3QWIA 4MVJF 2F3SA 3UK1A 4CUJA 1FTWA 1BDJA 2PX6A 4JLMA 1U0BB 3M4ZA 1V47A 4JJ7A 1RLJA 4YX9A 3VR4A 2BFNA 3JASA 4MRMB 4EW6A 5L8VA 4C04A 4TVKA 1VHDA 3F8TA 3ESQA 4LS3A 1CB7A 3M82A 2PUEA 2WD9A 3Q41A 2HWWA 4KR9A 1N3IA 2ZRCA 2OY0A 1MHTA 3ESAA 2F3RA 1JFLA 4G85A 3VI4B 5GINE 1A5BB 4QDXA 2JFNA 1C2YA 4NARA 5B3JA 1VIDA 3TH5A 4KXXA 1A0OA 1NP7A 1NLUA 2OBBA 5KC9A 1YQDA 4X6YA 3VR6H 4BNVA 2B4KA 4AF8A 1YQGA 3E5NA 3UIEA 4OO3A 4POOA 4IIJA 1E18A 2IE0A 3H17A 4DC0A 3FPEA 3MT8A 3TTWA 1JS1X 3IHWA 4MQEA 3EUEA 1YMVA 3GLFB 3HEMA 5E0KB 2OQVA 2B36A 5DGIA 5DTQA 5B1SA 2Z6QA 4WDRA 5DCWA 3N7AA 4JDUA 4NBNA 4E94A 1VBNA 3WGTA 2IZ6A 3CR3C 4KRGA 4BMXA 3DTVD 4UOEA 1FPMA 3SBOA 3WL8A 2WJ4A 1KI6A 1KFJB 1NOJA 1U0TA 3L8ZA 3C45A 5DISB 3KEOA 3WWPA 4ERXA 4AYTA 4F5ZA 1KY2A 1DWOA 3BD9A 4DR2B 2J9RA 2DBYA 2WSIA 5AKIA 1UZMA 3P19A 3VNSA 3ZWPA 2C20A 4PPQA 3BGOS 1I2AA 3ECAA 5FL7D 2IXDA 3I04M 3R0XA 3WLPA 4L78A 1ULSA 2B30A 2GK3A 3P9IA 2R62A 2BFBB 4JB8A 4M3NA 2R7KA 5A5EA 3ONFA 2EIXA 1BXRA 1P9OA 1JLHA 1C0EA 3DW3X 3HBJA 3L7NA 4Z9BA 4YYZA 4LF6B 1DJPA 1B15A 1YUBA 4OATA 4QHTA 2YWEA 3HEBA 1VXOA 2XY4A 5DOVA 4CV0A 2NNLD 5C5DA 1MUUA 1K8QA 2ZTSA 3KJQA 3RS8A 2HLPA 4MVYA 4KVAA 2GD1O 3O83A 3ZWWA 1YZLA 3BMOA 5A06A 2X4GA 3E6AA 4YPOA 1SCUB 3GLHE 4Y67A 5JJ5A 3OX3A 3R44A 5CLLA 5LIPA 5B6PA 1DAGA 4I1VA 2P9FA 5ALFA 4XH9B 2R60A 3QFFA 1WLYA 1Z83A 2PMWB 4QOIA 2QVLA 4F5EA 3FLBA 4ZCIA 2PBZA 4MGKR 4BV8A 4OMDA 1FP7A 4WXYB 2XJ9A 3UYLA 1F0KA 2BONA 3Q7PA 1OJLA 3U1TA 4KAXA 4ZQEA 5K3DA 2GAFA 1R6TA 1NKVA 2B35A 5AW0A 1QP7A 1XAJA 2HUNA 4X1KB 4ZOLA 1JDSA 1ZIXA 4WPGA 1E58A 2WJPA 1Z22A 3GLHA 3EXG1 4V0QA 4YJFB 3WGUA 5B1EA 3PEYA 2QLMA 1JH8A 2LPMA 1NI3A 1O54A 3I05A 4IDPA 3RVKA 3FZYA 3OFKA 4KOEC 4NCNA 4Z9FA 5BW6B 3BG5A 2BLLA 1TVEA 1Y1PA 1R0CA 1RT9A 3CRW1 4UNNA 2H85A 4HUQB 3RSOA 2XUQA 4P5EA 3MINA 4NI5A 5D5HA 4DWWA 3CRZA 4PYOA 2HXGA 1F6WA 3I28A 5KYUA 3W4IA 2NZWA 1W1WA 3JARA 3M4NA 1PL0A 4N7RA 1XWWA 4FX5A 4GFDA 4OFZA 2LRHA 1JHYA 1YBFA 4CDMA 1WBDA 1ZXBA 2QROA 4BCBA 3BMCA 3TL2A 1XMSA 2NV0A 4NESA 4TUYB 5T67A 3FHJA 1SHLA 4INZA 2O2DA 3G9TA 3THYA 3D0OA 1FNNA 4QXMA 4Z3KA 2GZRA 2XVXA 2BHRA 2J9XB 3LOUA 4YLYA 3BXXA 3GT0A 2YHIB 4FWBA 4HLUC 5JZSA 1CERA 4QODA 2N75A 3ZKWA 1SUIA 5J2UB 4MR8A 5EZQA 1IJBA 1KH3A 1Q22A 4O4LA 3OOWA 4UVEA 4EFMA 5D2CA 4EY8A 1XAIA 1ORDA 4ZI3A 1I94B 3OQ1A 4K9LA 1KO4A 3IT0A 5M29A 1BE1A 1XDZA 1K8YB 2IYYA 3GNTA 3MWDB 3AG5A 3N7UA 5JFOA 4C08A 5C1OA 1T15A 2XB4A 2HA3A 2W2KB 3AM5A 4EEXA 1VLHA 4JD5A 5ALLA 2BE7A 5KB3A 4L28A 1G5HA 3FVVA 4PXSA 4P82A 2ZIWB 3SZRA 4B84A 1WJGA 1UMBB 1L7BA 3BK7A 4YY3B 4LTMA 3BGIA 4D9GA 3V42A 3H04A 1ZXXA 4XB1A 5TGDA 3JVIA 3H4TA 4FGLA 1UC9A 2OAEA 4ZIRB 1E7MA 4J4TA 2BIFA 1ENYA 2BFFB 2J5XA 4TV8B 3BWDD 3GPLA 3ZJ5A 4C4XA 1ND5A 5BYAA 4OHFA 4O8CA 3EFOB 3IUYA 4HWRA 4JL5A 3AP1A 1X7ZA 3KAKA 3LUJA 3K8QA 1EP3B 3IT3A 1RR6A 1CLEA 4IV8A 4PZUA 4C43A 1F0NA 3IAS6 3SXUB 1L4UA 3IAFA 3PVCA 3RFTA 1WHSA 2PZMA 5DSXA 4CM6A 1ZM7A 4ZV4A 4TXMA 4B3MB 4JLPA 4X8MA 1LSOA 1L5HB 1VE6A 1H5NA 1BMDA 3H5IA 1R0XA 5C3UA 4QDUA 2WWWA 2CFSA 2W22A 1RVDA 1PUXA 3QE0A 4JROA 3SJ7A 5JNWA 2W2NA 5E7JA 1U3TA 2DERA 1HLPA 4TMKA 2G72A 1BEZA 1YFZA 4FHGA 1V8BA 2EOAA 1AKTA 1QV9A 2YV4A 4K9QA 5I7FA 1BEUB 2A4KA 3QENA 3EOZA 2RIPA 3PI6A 1U6KA 3I8OA 4UTVA 4HXYA 4MW5A 3IVXA 4MB6A 2A67A 4URHA 4EL0A 5IBCA 5JAQA 1I3MA 1NYTA 3T5GA 3DBIA 4HY3A 4KLCA 4M8SA 4RH1A 1JQBA 1WMEA 2QR2A 1U7UA 3O03A 1Q0LA 1P7WA 3P0JA 4X7PA 3ISJA 5ILQA 2C5LA 2ZP1A 2A9QA 2B2XA 4ZYLA 5FBHA 4BLSA 1QRTA 1E2BA 5ITVA 2YMPA 4RV9A 4J4BA 3TLBA 5HMLA 5A3SA 1T29A 1TQ8A 2PYZA 1YQXA 2XXAB 3KWJA 3EUFA 2HK9A 1MX3A 1GU1A 1RYEA 3NIFB 5HQ3B 3FTFA 4ETNA 4MINA 5KNCA 4RL4A 2I3DA 2HREA 4HH1A 5AW8A 4Y6LA 1G8FA 2QD3A 3AL2A 1E69A 3LH5A 3IXLA 3K72B 2G25A 4KOAA 3OQOA 4Q21A 1IXSB 1P1KA 2OUKA 4CHTA 4C4YA 2IQ5A 3UUEA 1OLSB 3GYBA 4ADSG 4H3KB 3ROZA 5AI9A 1L4GA 2EF0A 1WF6A 2B4QA 2BBSA 4M9QA 1B16A 1VMKA 3GZNB 2CLSA 2VHYA 3LP8A 2PX5A 4ICIA 4ECAA 4BIMA 4OIFA 3RU3A 4R71A 1BYIA 1I6KA 3K20A 3KZKA 2H2FA 4CKBA 2AOXA 3BICA 1KOFA 4FFRA 1DOHA 2VPZA 3TCNA 1ZK1A 3B38A 3AEYA 4RVOA 1N5JA 4OXRA 4NHOA 1PVDA 1WBJB 3NTOA 2A7XA 5BNZA 4EJMA 4J1TC 2AX4A 4JU8A 2YZ7A 5K20A 1UEJA 3LY5A 3LL4A 3C87A 4N82A 1XYGA 4IRMA 5JCOA 3RREA 2P4HX 1MENA 3G7NA 2K4MA 3C8HA 2GKGA 4E4RA 2X2FA 2OQIA 4O2BA 2C07A 4WKNA 2JCBA 3ZQ6A 4F96A 1GSIA 1PWEA 1QE3A 1HMPA 1ZRNA 2GCGA 1NBWB 1V9SA 4EUNA 1FFXA 3G1UA 3OQHA 3EYWA 1EINA 4RADA 2YKGA 3JSXA 1FRNA 4RO0A 2DUJA 2C0PA 3PPVA 1K3TA 4CMJA 5T7BA 3O2SB 4LDPA 2E6KA 3ZIAA 1QTQA 1XEWX 3H0KA 1O77A 4MR9A 4LV5B 1V8ZA 3KLBA 1N2XA 3BB1A 2CCGA 4W7IA 3N87A 3GDWA 2W6IA 8AT1A 5LUAA 2H18A 1OLOA 1F2TA 3LY9A 1GCUA 3BVPA 4KSCA 1FDOA 1CY7A 1GTG1 2HA5A 3K7EA 1EA5A 3LQ2A 1XO1A 4TMFA 2HQ1A 4V0ME 3NJ8A 1AKWA 1U3UA 4GBED 4E22A 3IJ5A 2B0JA 4KHZA 4EI8A 1NF8A 1V9CA 1Z38A 2FPSA 2GX6A 3MTDA 4WKPA 3AEQA 4N5IX 1XVLA 4YV7A 4P0QB 3O4GA 4CIYA 1Z4MA 4DB2A 1DOAA 1TIPA 4FDLA 1E5QA 2JH9A 4NMMA 4KXWA 3R0IA 2HDHA 3RVSA 3AHEA 4G1BA 3UMGA 3ENQA 2JAWA 3EODA 4UCXA 3HR7A 3NDPA 3K9CA 1KS2A 3P9CA 5IZ4A 4HTFB 4JUIA 2OCXA 1NAHA 1XJQA 1QP0A 2VYQA 3ICEA 2C2YA 1O6ZA 1QDLB 3GV0A 1B6RA 2WW8A 1PDWA 2YFQA 3L7KA 4FJ1A 4V0MA 4Z0HO 4YT8A 2MSEB 4Q3DA 1Y9AA 4WLOA 1VKOA 3EUWA 4JC4A 1B0PA 1U94A 5DNAA 3PSAA 3TZ6A 3LY8A 1A9PA 3BX1A 5FUQA 1ESNA 1NIPA 3TL6A 2DQZA 2OZEA 2WWYA 4MQ5A 1MQSA 4NJMA 2CXHA 1MMFB 5K0BA 5DDIP 2R8EA 1N8TA 1QGED 2IP2A 1E79A 1NJ2A 2ATXA 2ZRKA 4I1PA 4GQAA 1HE2A 4GSLA 2W71A 4LGCA 1OPRA 2GVDC 3I4CA 2PL1A 3W06A 1W88B 3PNQA 3CQ9A 5EL0A 4P7JA 4TTJA 2Z57A 2ZBGA 1MC8A 3ZBPA 3HVUA 3JX9A 4GOOD 1EG2A 3COPA 3ROKA 4R98A 5DBHX 1ENOA 3LX5A 1MAWA 5DNEA 3TRKA 2R9VA 3MBKA 4K6OA 3AYXB 2FP4A 1VKJA 1BN6A 3RDPA 1Y1RA 2ZJ5A 3DGEC 4JJ8A 2LNDA 4QJBA 2P4EA 3A9TA 3KELA 5CYPA 2O5RA 1L5NA 5B2ZA 3HQ4O 3UK7A 3AI3A 5UKDA 4TYYA 4M1SA 1OV6A 2CUZA 2QSUA 4NPHA 3N0XA 5CB4F 5JANA 4RK4A 2QTFA 3VXKA 2R8ZA 5H81A 3VJMA 4QIHA 4P7GA 2NADA 4IIFA 4A1FA 4XDGA 4TMZA 4ML3A 1B0AA 4BTEA 1P4AA 3JD2A 4Y0VA 3P4YA 1JSCA 3WK6A 1XQ1A 5D00A 3I39X 5TJ9A 1EE9A 3VDXA 1VTKA 3DFFA 2FG7C 4K1XA 4RHEA 1QU3A 1TFUA 2PV0A 1M67A 2A88A 2C1XA 3G9QA 3BFJA 2HY7A 4JJFA 1LFDB 1CYDA 3STHA 2YDXA 3K09C 1IZ8A 1E5TA 4Y7CA 1OXKB 1CEQA 4GKAA 1K6IA 2BGJA 2VJMA 5DRTA 3RRJA 4CL3A 3ZEAA 4K8OA 3ZI4A 3D81A 3L8MA 3MOGA 2GR9A 3EIFA 3DVLA 4NG4A 3LBNA 2D1FA 4P93A 2ZAGA 3HFSA 5U4QA 1AE1A 4C4PA 4F9TA 2ONJA 1L3CA 1UC5B 3IO5A 2BBTA 5IAKA 2Q5EA 3RSCA 3U7GA 1WZ2A 3PX2A 1EP9A 1GQQA 2I54A 3NWEA 5B2FA 5IVDA 5JVDF 2GETA 3RTCA 1F60A 2IUSA 3ZE8A 4AURA 1QUEA 5JS1A 1ML3A 1R8JA 2P9TA 3AKYA 1DNPA 3QYFA 5TQ2B 3R7NA 1K97A 4ESHA 2ZRQA 3MM4A 3V6MA 4G25A 5K3FB 2TRSB 2IA5A 4OOFA 3PYMA 1LXCA 3V48A 3GNQA 2KM1A 3DLIA 2FWBA 4TS1A 1I10A 2Q5OA 1PSDA 2Z9DA 2O4UX 3ND9A 3PVSA 4ZO9A 3O4IA 1X9GA 2JS7A 1BDMA 2GRAA 3GGJA 2CVQA 2OXFA 4MX8A 2WZDA 5MHTA 1VE9A 4KUEA 1P0CA 1F2DA 3BWVA 3UTDA 1K8ZB 5K0CA 1Y5LA 2VCEA 4L50A 4WVLA 1Y5MA 4RHXA 4WK4B 1TW3A 1G5FA 2WJGA 3SI7A 3KU1A 5C8DA 1P19A 2YZNA 2WD7B 3GL9A 1O6FA 5HRCA 4I1SA 3R5TA 4QFCA 4LWQA 3G5MA 4RH3A 2VK2A 4D42A 4KQ1A 1XR3A 1L7AA 4C6HA 1DXHA 2ODAA 4FMPA 5DV9A 1C3OA 1RZUA 2QN8A 4JLKA 3M83A 4U8HA 4B0OA 4F3RA 2PG3A 3MT7A 1WCXA 1J07A 2ZWOA 4XD7D 2H4YA 1TTHA 4DVGA 2UZ4A 3HDGA 2O8EB 5DN6A 2C95A 2A3NA 2F1JA 2H0RA 6AT1A 2REBA 3DT9A 3ZWAA 2HDNB 1GRQA 1ZEJA 2GNPA 2CN1A 3EOBI 4M9UA 1JDVA 4RTSA 1CUJA 1QPGA 2E55A 2V5AA 3B3AA 4ZYVA 5CB8A 3EDYA 3LX4A 1MQ9A 3SOPA 1E6WA 5K4HA 3K0AB 4HGOA 2H16A 2X5KO 2WP0A 4JNCA 4QUJA 2EKPA 5BN5B 4QWWA 4EG8A 1XKLA 1Y5NA 2QZZA 4PQEA 4L4UA 3V2UA 2LCQA 1V2GA 4EQZA 4C5AA 3U44A 1EAMA 3ZDEA 1A8QA 2IDJA 1JSRA 1M6YA 2V96A 4F85A 4DNPA 4A73A 1CLUA 1TYAE 2HA4A 3W9YA 5I4IA 2ZJAA 1SCBA 2XCQA 1CRPA 1IUOA 2Q7OE 4W1SA 1DLIA 3BXFA 2DJ5A 4RSMA 1DBQA 4N01A 3L0SA 2CHGA 2AWOA 2G4VA 3U4QA 4LF7B 3TXYA 2G67A 1YBVA 4IZHA 3OWXA 5C51B 2JFWA 4YXWA 1SBQA 3KTAB 1ZFNA 4CNQA 5DHQA 1IHUA 4UTPA 1F1BA 1Z4OA 4YNBA 5DX0A 3UMJA 2CJWB 4HQRA 3HDHA 2OHVA 1UQUA 3MGKA 3T0IA 3E9DA 4BPRA 3K70C 2V3CC 1E62A 1QVZA 1V7ZA 3ABZA 5DP1A 4EHNA 4P4TA 4TLMB 4D9NA 2XH8A 4XVHA 2OAQ1 2ODWA 3QSYA 4XWYA 4P4NA 1XIVA 4XLTA 2OZKA 2Q27A 3EGDA 5TPZD 2PJRA 2HYDA 2XGSA 3RUEA 1E7SA 3K9GA 1SBTA 3UEOA 1NLZA 2YZMA 4D7AA 2C96A 4PW0A 4DT1B 4KX5A 4GPZA 5KYWA 3LT0A 4MIOA 5KQLA 3P0IA 3UATA 1QORA 5E4FA 1Q3TA 1UK7A 4DV6B 1GTL1 1O3YA 3KPVA 2AL7A 2JJ2D 2GKOA 3FSGD 2A86A 1ZD1A 2UXCB 4G65A 4RZXA 2H9YA 2CEAA 3AHHA 1ODSA 3RVNA 2AC2A 2W43A 4Z2AA 1YD7A 1E4OA 2YMLA 2OVBA 3QELA 4EG6A 2DT8A 3D8UA 1MB2A 3AJ9A 2HRCA 4L5YA 5LQNA 2IXEA 4PX5A 4IKOA 1JFFA 1Q1EA 3LUBA 5HMMA 1UWKA 2YXLA 1YBMA 4F2WA 3W05A 2ANBA 2IHVA 2CB0A 5IBPA 1XP5A 1XHLA 2ECFA 1X80B 1Y6JA 4YRTA 1DDOA 1CUUA 3MWJA 3T3MB 5KUTA 5LOVB 1Z25A 4GNKA 1LBHA 3IJPA 2B8TA 2Q3JA 3DUFB 5EAIA 3JWPA 5FR2A 5IAJA 5TMBA 1ISMA 5L6LB 1AH2A 5KSYA 1U8FO 3VPAA 2ERCA 1OQAA 2JPDA 4Z5XA 3KJHA 3B60A 2QY6A 1OA0A 2QLNA 2LGJA 3FF1A 1XEWY 4HXEB 4RPHA 5LYJA 5JC1A 5KX5B 5E1DA 3C5HA 2Y6VA 4HLNA 1VZ3A 1KQGA 1VM6A 4AU1A 1IOVA 2BFWA 1NJGA 1ILWA 1F12A 3QLUA 5G1OA 2G7MC 5J3JA 4TM7A 2DHDA 1S96A 3LBIA 4C1BA 1GAJA 3VZSA 4KVGA 5LP6B 4X45A 4B17A 5DZSA 4OXKA 3DCIA 1KFKB 4UHKA 2DUNA 2XNDD 4AF6A 4XOIA 2GAAA 4OK3A 1X92A 1W5FA 3C98A 1JEQA 1RWXA 1ECCA 2QG6A 2W6MA 2GJ8A 5K2MA 1U0GA 3OQIA 4C4TA 1BYUA 2O7VA 4DLYA 1TUBB 1T3HA 2WABA 4O4IA 3WQHA 4ID3A 3EA4A 4HB0A 3QJYA 1UPFA 3O82A 3WWEA 5MF6A 3H9BA 1XI2A 2IHTA 4NOLA 1I33A 1KWGA 5JQGA 1HM5A 4UCQA 2E4VA 1KYIA 3FPFA 4QU0A 1TZMA 4IL5A 3WX0A 5KNCD 2G77B 1QQ7A 4KYTA 2AOVA 4IJWA 2R1TA 1BQ4A 3ECCA 1P45A 5BP7A 1G3RA 3C8DA 1BXGA 3SN6A 1BVYF 3OX1A 4KPEC 3ZY6A 3ELYA 4Q47A 3SHFA 2Q8PA 4OOEA 4JJZA 1SCQA 3JYLA 3PJDA 4XWAA 3L18A 3PE4A 1HR0B 1SN7A 4ZYUA 4E21A 2OCDA 5BQOA 1DAFA 1TM5E 1LBTA 2G71A 1QAOA 3A4LA 1WO8A 1GGEA 3CUYA 2IFTA 4RENA 4Z4FA 2EJBA 1G38A 2P9QA 5ALKA 3I9MA 1USIA 4LC1A 4MW4A 4BCDA 4KODA 3ZHQA 4M1EA 2PMCA 3GF4A 1JEAA 4CQLB 1DQRA 3AHJA 4WKBA 1XZGA 3DLCA 3KE9A 3BREA 4ED9A 3GLIB 2O3JA 4PLYA 3EARA 1GPNA 4X71A 4M6WB 4DJFC 5ICSA 3G2IA 2HSEA 3DMYA 4KO2S 1ZUNA 1JI0A 4L9SA 3CXUA 2DPHA 3R5SA 4AKSA 3CW9A 3LXXA 1WY5A 1Z07A 2WIFA 3JYQA 4NULA 4TXLA 3G9XA 4JYCA 3WLFA 4DIFA 3ICWA 4DA4A 3FMGA 1R0LA 3HDTA 3UJ3X 4CW7A 4D99A 1HNXB 5FB3A 4Z0PA 3WR5A 2ZTLA 4ZVUA 4WESA 4DCSA 3AC0A 4GM4A 2JIDA 1ZOIA 3M9XA 3OY2A 4ZI7B 1F9EA 1XRPA 3G82C 1H0KA 5LBTA 3JQGA 3BL8A 2ZSBA 1DKOA 4TTTS 3X1DA 1DAIA 1KMHB 2GZ1A 3EQ9A 3KEFA 4KWTA 1Y8ZA 2PA3A 3L79A 1XFAA 1VBFA 2W2OA 3CLSD 1WA5A 4B6GA 2ZRDA 2ZTMA 4GR9A 2GO1A 1N92A 4X8LA 1ZSNA 3O3CA 2Q0SA 4OHVA 4TMWA 1R50A 4HC4A 4CGYA 1ZOOA 2BMEA 3WGHA 3K4QA 2JAUA 4O1IA 2RG1A 2HEGA 3ONWA 3UH0A 3NCHA 4C03A 3AUFA 2Z83A 4S1OA 1XK7A 3IBSA 4JXKA 5KX5A 2C0CA 1IHXA 2AZMA 3MMPA 1FVHA 3MCAA 5ALGA 4WT7A 1A9RA 2HDOA 2WF9A 2XKBA 4W9MC 1I4LD 5BWOA 1WPQA 3OKFA 4Q0MA 4ZVNA 2B0CA 2O5VA 2G0AA 2WSSA 3PSHA 1IXRC 4GXTA 1H23A 4CDGA 1ZKDA 3TK1A 2PWYA 4EZIA 3I73A 2DWUA 3KLNA 4L0QA 1J9GA 1XK6A 3O4RA 3TNLA 5K8TA 1RXVA 1S2NA 4Q4AA 1UKBA 3UMMA 3LSTA 2GM5A 4LJKA 3VZQA 4KRXA 4N7JA 5KWSA 4I4CA 1NLYA 5IKOA 4ZO6A 1UFRA 3DE5X 3PC8A 1E6LA 3I1FA 3X3HA 2J4FA 5JECA 2OCIA 4JT4A 2MCFA 3VTKA 1ID8A 3T3EA 1LK5A 4Z2YA 1FMJA 2V3VA 2XMCA 3PWKA 2PBFA 1MOPA 3N2ZB 1E2LA 1M1UA 4XFJA 3DE4X 1VC2A 3PQFA 2VXYA 4KH0A 4BNYA 3G0HA 3CZPA 3BFKA 4L3WA 5E6SB 2CXTA 2J59A 2VP9A 1R0SA 1VL8A 2QT0A 1DXOA 1JFRA 1A7KA 3KVNA 2BEUB 1SOWA 4F21A 4ZXFA 4DDTA 2ODTX 4G0PA 2VPPA 2RAVA 2RGAA 2GFHA 1JEDA 3ZCRA 1EE2A 4WI1A 2JBAB 2E4ZA 3ANYB 2GWRA 2TMGA 1GARA 4LSGA 1B4DA 5JO0A 3IJRA 5CEEA 1VJGA 3IOMA 3UHJA 5JY6A 4M46A 3OEHD 3QPVA 5EKSA 2CHVA 1W6UA 3P7MA 2YCBA 5FL3A 4C1NA 2EIHA 4TSKA 3VPHA 2KYRA 4BAGA 3E0QA 2NUAB 2A9OA 1C81A 1Z2DA 3MPUA 1QCZA 4R51A 1CQWA 1R0ZA 3PICA 4LE0A 3RJ9A 3U13A 1DBRA 5JARA 1AQIA 4ZDIA 1D3AA 2UZ3A 3BH0A 3QFRA 3W5DA 3GJXC 2XE6A 2FETA 1AKMA 1ACMA 1CZNA 2GD0A 3GLKA 3OD1A 3VR4H 3WMFA 4DS3A 4BLPA 3V8PA 2IEZA 1OZ0A 2JGRA 2YIMA 2HWXA 5CLIA 2D74A 1DWUA 3W3AD 1C1XA 5LC1A 1TE2A 4FDUA 5LQRA 3OPYI 1YZUA 3LKVA 5IVHA 5G0TA 5EJ5A 3EBOA 2N3ZA 3HR4A 1XCPA 1EFAA 3A04A 3QLVA 5LA6A 1XXHB 1DMSA 5IC5A 3WBFA 2C7PA 4NMLA 4ZAVA 1Z2CA 4X6XA 1QQ5A 1PT9A 1NI4B 5HKOA 2OM6A 1H5UA 1EFPB 5CDSA 4XPIB 3GPBA 1D7AA 5GJCA 5JIBA 3PX7A 4DLSA 4EJ6A 1U0JA 2I8AA 3SQWA 4RDHA 1M1YB 2OWEA 1IQPA 1H2BA 1H0HA 2AUNA 1KY5A 2AVNA 3DFMA 4QXOA 1Q92A 1HT1E 1SRQA 4QXRA 4HEJA 1BNCA 4F5YA 1E2IA 1LDEA 1XZFA 3VPGA 1T9GS 3MT0A 4UEKA 3RVLA 3M2TA 3H2HA 2XUZA 1ES9A 1M2GA 2QK4A 3S2SA 4XVCA 5J4HA 5J4LA 4DCJA 2VSQA 3JAKB 5A3VA 4XYBA 4YUAA 5K0FA 4ZYWA 4QU5A 1Q1NA 5AW3A 4FGKA 2C2WA 2QL7A 1ONSA 1TU0A 3K1YA 1IG0A 5CP8A 1XDUA 3G8DA 4RVCA 3B6EA 5EWMA 3USCS 3RT9A 2YWFA 4L15A 4DKJA 3FWZA 5EIBD 1NY6A 4LJ8A 3WJ2A 4TYWA 1EFLA 1TD1A 2ZT6A 4G5OA 1T3LA 3A4NA 2H8GA 3A7EA 1T8UA 3CBGA 5I9IA 2HB6A 2XQVA 5LLTA 2X1LA 1YE3A 5E6RB 1NGSA 3L05A 1SHJA 2ZIGA 4XASA 5JSZB 3DBOB 2O1XA 1GZ4A 2BHTA 4CDRA 2VUHB 4DXAA 4O1HA 4MV8A 1PS9A 3TSOA 2Z8YM 4WCFA 2CDRA 4EENA 1CKEA 4CEIB 2ZXFA 3KVRA 2P9ZA 1FRQA 2EW8A 3S2UA 1A97A 3NBKA 2X13A 2VNJA 1LU9A 3SP1A 3CH7A 2RCYA 4M76B 4BV3A 2FR8A 2P62A 3FOZA 3UB3A 3GCXA 1B0ZA 2R11A 4H27A 3VYVA 3H7IA 3ZW7A 3TRFA 4E5VA 5JALA 4LNUA 4B3SB 2CLIB 1R3UA 3KWLA 4PONA 4B45A 2LCIA 1P7CA 2UVDA 2C29D 3INTA 3ZCTA 1WG8A 3HU5A 3TLMA 1X19A 1F1JA 2GZ3A 3RVJA 1ZD9A 4M0KA 3H6HA 2RHCA 2YWJA 5BOVA 2Y9PB 3ULKA 4IDNA 4ZVVA 3PQ4A 4TTRA 1YR2A 1ZJYA 2WZQA 4JQSA 4KK3A 2E3JA 5HZGA 5DYWA 1G63A 2FWJA 1Z2OX 4HZUA 3RYIB 3QNWA 4TSFD 1M1NB 3C43A 5CNJA 3C41J 3WWDA 3WJ1A 3V4SA 2IV7A 1QGYA 1T8TA 2GFIA 2Z1DA 3M1AA 3QZUA 3X0DA 1NVMB 1P7PA 3O3OB 3O74A 3OZCA 3OT4A 1SXJC 1NYRA 1RJGA 2V5VA 2AN1A 2XNSA 3NUQA 4YAFA 1PX0A 5DWVA 1UOEA 3F90A 3Q5EA 4Y6OA 5SY9A 3FMVA 5LSAA 4CMCA 5J4KA 5FFNA 1R64A 2CLEB 3LZDA <