3SHOA

Crystal structure of rpir transcription factor from sphaerobacter thermophilus (sugar isomerase domain)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
187
structure length
186
Chain Sequence
DRQQLPVQVFTNDIENLNQTLNQTQPEAIEAAVEAIRADHVIVVGMGFSAAVAVFLGHGLNSLGIRTTVLTEGGSTLTITLANLRPTDLMIGVSVWRYLRDTVAALAGAAERGVPTMALTDSSVSPPARIADHVLVAATRGVGHSLSPVGLIAVVNLLLAEIAVREPERALAVLREVDRLYREQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, RpiR family
publication title Crystal structure of RpiR transcription factor from Sphaerobacter thermophilus (sugar isomerase domain)
rcsb
source organism Sphaerobacter thermophilus
total genus 62
structure length 186
sequence length 187
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 3shoA00
2YVAA 4JV5B 3OOJA 3FF1A 4DV5B 4JI0B 2VQEB 4DV0B 4X64B 1GZDA 2PUWA 2I22A 3FXAA 4DV4B 1VI5A 2ZJ4A 2UU9B 2UUCB 3TRJA 4AMVA 5BY2A 1XMOB 1KOJA 4YY3B 3OTOB 3Q7IA 1C7QA 4DR6B 4X66B 3NBUA 4B3TB 1TK9A 4M0DA 4AQYB 1M3SA 4JI3B 4S12A 1JLHA 1MORA 2VQFB 4LF9B 4EM6A 1Q50A 3C3JA 4GKKB 1HM5A 1U0FA 3JAMA 3FKJA 1IBKB 4JI8B 3T1YB 1XNRB 5IWAB 2Q8NA 4LZJA 2CXRA 1N32B 4OX9B 3G68A 4JI7B 4DUYB 3PR3A 4JI5B 1HNZB 3QKIA 1NUHA 2CXNA 3IFSA 2A3NA 1XMQB 4DR4B 1MOSA 2I2WA 4JI4B 2UXBB 1VI6A 2UUAB 2CB0A 2POCA 4B3MB 4JI2B 1J5XA 1WIWA 4DR2B 5FLXA 4DR5B 1HR0B 1X94A 2VF5X 2AMLA 5LMNB 4KHPB 4NXNB 1IATA 3EUAA 1T10A 3TBFA 3ODPA 5A2QA 5LL6P 1HNWB 1IBLB 1XNQB 3KNZA 4K0KB 1JEOA 3FJ1A 1DQRA 3LJKA 4JI1B 4JYAB 3J80A 1TZBA 1TZCA 2DF8A 1B0ZA 2XHZA 2WU8A 2CXSA 3M5PA 3BCHA 3Q88A 1JXAA 1G98A 2X3YA 2E5LB 1U0EA 3I0ZA 4LFAB 4DR1B 1FJGB 2VF4X 1IRIA 1GZVA 4GKJB 1U0GA 1X9HA 3J7AC 4DV1B 1C7RA 4DV7B 2ZJ3A 3ETNA 1JIQA 4X62B 1N8TA 4LF8B 2CXQA 4U6NA 2J6HA 2ZM6B 2CXOA 2O2DA 3J81A 1X92A 4S1WA 5LMUB 4DV6B 1XTBA 2F4VB 4X65B 5BR8B 3BJZA 4LF6B 1NRIA 4DV2B 1N33B 4DR3B 4B3RB 3SHOA 2HHHB 2CXPA 1J5EB 2PUTA 4LFCB 2CXUA 2V4MA 2O2CA 5IT9A 2UXCB 2UUBB 3UJHA 4NXMB 2XBLA 2PUVA 3JX9A 1N36B 4DV3B 2E5FA 1IBMB 4LF7B 1VIMA 4TOIA 4DUZB 1MOQA 1I94B 2DECA 1ZZGA 1VIVA 2CVPA 3HBAA 4LFBB 1HOXA 4YHHB 1HNXB 3CVJA 2PGIA 1X9IA 3T1HB 4LF5B 4LF4B 3HJBA 5I01A 1N34B 4DR7B 2UXDB 4IVNA 4JI6B 2CXTA 4B3SB
chains in the Genus database with same CATH superfamily
2XMDA 5LP6C 4JXJA 1DIHA 4R81A 4ADSG 4LI3X 2QRQA 2F1RA 3MAGA 3VPFA 2HSJA 3ANSA 1Z36A 3LQ4A 1BO6A 3PUWA 3A6DA 2H9AA 4J2OA 2O4CA 3OECA 3ZY3A 4ZT7A 4YS6A 3BE6A 3EWAA 1T1JA 2PTHA 4PVCA 3N1UA 2R6ZA 4FLMA 2JEZA 2ZZNA 1SURA 3D6UA 3EVEA 3EZNA 3G8BA 2IXAA 2JHPA 1I32A 2JIQA 3I01A 4WX2B 5T67A 3WRXC 5DE3A 3RVRA 3NOVA 1BE0A 1SOVA 3A3OA 1L7NA 4I9NA 2PN1A 5DYTA 3WGQA 5LQKA 1AF4A 2ZTSA 3KP1A 3R3HA 3SE0A 5LYJA 3DH0A 4BPBA 3LQ1A 1E20A 2ZWIA 2J31A 3E58A 4M1SA 8ABPA 5IVKA 3N6XA 3O1HB 5K20A 1QDLB 1ZMTA 5AJXA 4P53A 5BN4A 1SU7A 3T12A 5AVXA 3HDHA 5G0UA 1U0OC 3T8YA 5JQGF 3T5BA 2Z2YA 5CVJA 4YMLA 5EZ6B 3GJTA 2P79A 5CLHA 1H93A 3JATA 3TDKA 1DEAA 4ZRDA 3K2EA 3N70A 1HPLA 3HXPA 2NUTB 5E4TA 4C4AA 4U9IS 5EZYB 1QCCA 1YH3A 2BKXA 2IY9A 3CR7A 4N0EA 3EZGA 1Z5PA 4GBED 2XWPA 4QRDA 1SELA 1FTQA 3C98A 1KDZA 5HBGA 3UG6A 4EO9A 1ZJ4A 3H3FA 2FR1A 4ZI5A 3IVGA 3B1XA 4MWDA 5K3FB 1KDOA 3BK1A 2NUPB 3PQEA 2B94A 3CEJA 3DMGA 1QS0A 3N7UA 2ZRQA 4A0RA 5HGXA 1VJDA 5BQ5A 1YR3A 4ED9A 2CW5A 3LBAA 5LZ9A 4RS4A 5AK4A 2AZDA 1I13A 2YNMA 1WMDA 1EGAA 1NXOA 3JVIA 3OZDA 3IO5A 1GZVA 4OHUA 2A7QA 5B2ZA 4ZI7B 1XKQA 3V4SA 3MT7A 1VG1A 2OZEA 4YP9A 4B71A 2Y0CA 3DBLB 1IHDA 3O82A 5JLJA 3LPAA 2Q29A 4UM8B 3RO7A 1XLVA 4QGHA 1KY4A 4P93A 2OHHA 5FBWB 1TD1A 2JGNA 3X2FA 1LLFA 1BE6A 1ZUHA 4R3WA 2FI1A 621PA 4G41A 4ECAA 5C2JB 1JR3A 2P8SA 1O4VA 4TRRA 4YRLA 2IGBA 3BRWD 5DXJA 2HA2A 4RETA 1S9HA 1PYOA 2QSUA 2J9YB 1M8PA 2VTEA 3D2CA 3QVKA 3ZW9A 5I7HA 2BP7A 4Z9FA 2HZ7A 2VLBA 2MMCA 4M9CA 5HK8A 1X87A 1XA4A 1PRYA 1ZD5A 3QEMB 4QKQA 4YR7A 1EXVA 3G2OA 1DIGA 1RXVA 3QUQA 4FMBB 1EVKA 2UUBB 2Y4OA 4JXZA 2NAPA 2WU3A 3KZXA 4GU5A 2DBRA 4MVJF 4IEFB 1Q91A 4IUYA 5L4LA 4YRGA 1ADBA 3MCTA 3NI2A 3WVNA 4D0NA 3T3OA 3FG9A 2QQ5A 2EF0A 3QITA 5TE9A 4NPCA 4ZP1A 5JAUA 3HJBA 4OKNA 1BMDA 3UK6A 1ZDMA 3MFYA 5EJ9A 2A1UA 3A14A 2BDTA 4UVIA 1QFSA 3HV2A 3P9XA 3IVXA 5TGDA 4L0MA 2PR7A 1KSGA 1BCSA 1E3JA 2CJPA 3UBMA 4FSHA 5IJAA 3EXG1 3FBGA 2BIFA 1LDYA 4RCVA 2OKCA 2X1LA 1YR7A 4U7WA 1E0DA 1EK2A 3RC3A 2ZZMA 4O5AA 1JWLA 5DMXA 4OCZA 1GRCA 2ZYHA 2FUKA 3W79A 3U0BA 3PGVA 3PHBE 3ULKA 2C20A 1PW5A 1LTHR 2IYSA 4PLHA 4EJSB 4FK8A 3D9QX 4PSUA 5G40A 5L6LB 3GFBA 2ODTX 3WB9A 3TR5A 1WB9A 4UARA 1E58A 2QZPA 2DC1A 2ZB3A 4HS9A 1UXOA 5JBNA 3ED5A 3UMGA 3I5XA 3AHEA 5EMNA 1N3IA 4CKBB 2DQZA 1CS4C 1G8GA 5BSUA 1VJ5A 4O4HF 4EKIA 2ZUDA 3WOHA 2AZTA 2WMYA 4B46A 5JAHA 1DHRA 2OYSA 5EPEA 3KZVA 1FUUA 2Q5JA 1YQUA 4BOYA 3SFVA 1OD6A 5AFSA 4Q3BA 2LXNA 1W88B 1EWKA 3UO8B 2G72A 2VXCA 1YOVB 4LAFA 4R5HA 2YC4C 3GK3A 4B7ZA 2F9MA 1Z38A 2XWJI 2YFHA 3ILYA 3NFRA 2HCBA 3ML1A 4NWIA 4WZBB 5JY1A 1WO8A 2NVUB 3FNQA 3VISA 3RBXA 2LD4A 3O9MA 3NHAA 4W8HA 4ZODA 4ATNA 1ZJJA 1ZLYA 4IFIA 1OE0A 4JELA 1AXGA 2PR2A 3EMDA 2OENG 3R7BA 3NBAA 1TJNA 2PO5A 3IURA 1FVFA 5AWFC 3TAHA 5JRJA 3OFSA 1T3HA 3LOQA 3QUBA 1JG3A 1TAUA 4YMGA 4C0SA 1RRVA 1TYEB 1CJSA 1T2UA 1RBYA 3GEIA 2XZOA 3NHJA 4I46A 5JCJA 1BEUB 1Z13A 4JEHA 1L4MA 2G0TA 1GZSA 3I9OA 3OCXA 2F67A 2QX7A 5DLQC 4G5HA 1OZAA 1KTVA 3L8MA 2G5CA 3NTQA 4HLNA 3NHUA 1KQFA 3VR6A 1PSDA 1DFIA 2GGSA 2I71A 1DBRA 1R50A 1S96A 1T8RA 2C03A 2M6SA 5IT4A 1BZYA 1WUYA 1T9GS 4LXXA 5JCZA 1RIFA 3H5AA 1NNI1 3IKVA 1G3RA 1NVAA 3K6RA 3PFHA 5G2OA 4ARZB 3KHKA 2WWXA 1JQJC 2AW5A 3PPXA 2YMPA 1IHYA 5EERA 3P94A 2FLKA 3EXHA 1IB6A 3PTZA 4HTFA 3DEYX 3P20A 1QE0A 4WADA 2C7PA 2YX1A 1CQIA 5C8ZA 4CEJA 1YUBA 2EP8A 3CH4B 3FMFA 5DP1A 4YIKA 2AUTA 1KOGA 4L72A 2XHEA 5ENZA 5KZMB 4O33A 1Z2OX 2W37A 2TRSB 5C37A 2DQYA 3PYXA 1QGDA 1T5SA 2P6OA 4JUDX 3JU3A 3BDAA 4X93A 2REXB 5EJFA 4M0UA 1WZUA 4L8VA 4IQFA 3EXG2 3TXYA 1YS1X 2E18A 2BGKA 2W4IA 1VI5A 1QGOA 3KO8A 4X3OA 2ZUEA 3ZWXA 3LL4A 1L1RA 1NW5A 5AVUA 2XDWA 2ZYSA 3AR2A 1CJCA 5DNEA 3S2UA 1G8JA 2C9DA 5JZ9A 1D2GA 3FE2A 1WULS 1XXHA 2WU0A 3HLKA 2GBLA 4K6KA 5I9NA 1L2TA 4BX0A 4PLVA 5L51A 3RABA 2IF2A 4G4JA 2CLMB 1DP4A 2IEZA 4WIAA 1E96A 1WRBA 1XRPA 2ZUUA 3LOPA 1VE6A 2HQBA 3NGLA 3PNLA 4NCXA 4Y2QA 2QPLA 3ACCA 2CFOA 4GI1A 3RUFA 5J4VA 4RTRA 2FWMX 4DJFC 2OK7A 2EX1A 1E1NA 5CT8A 1NBEA 4L7QA 2ILVA 4LJLA 3ZW8A 5JYBA 4HXFB 4OXKA 5E3JA 1YI1A 2Z83A 1TGVA 1HBJA 5HKBA 2B4QA 4URZR 1JWBB 2ZIAA 3JPYA 4IF6A 1JHQA 1TDJA 1I3KA 4IDQA 1CUIA 4XWYA 4H7HA 1XPJA 1DKMA 2CMHA 1RC1A 1T15A 3R0XA 2NIPA 1OIVA 3I9V1 2E4XA 4JBIA 3PFIA 3MVEA 3OZWA 1MTOA 4H3KB 1UBFA 4LISA 5DNWA 2W4QA 3VPAA 4FWIB 1QTRA 5CXSA 1EX1A 3IEXA 3SIXA 5AW2A 5HRUA 1V95A 1U7DA 1Z0AA 2I2AA 4BZZA 5B7GA 5MN6A 4CLOB 2ZI4A 3CR8A 1O2DA 1OZ0A 5BSTA 1XDSA 1M6NA 1E79A 2FPPB 3MLAA 3SM9A 2Y0EA 1UCFA 4MROA 1XB2A 4WLNA 2NYRA 4BNUA 4ZI2A 1NMSA 2VATA 2A9VA 2RHRA 1YBMA 1EQUA 4QELA 3WXMA 3HGTA 4EMBA 3EGOA 2XE8A 3TZCA 3ZK8A 3UJNA 1G5IA 1ZMRA 1B0ZA 2KPOA 1V7PC 4MICA 1FFXB 4PHCA 3Q3GE 2WYIA 1ZUD1 1IUOA 4OO3A 4B76A 3AGPA 1XNHA 1IXSB 2R6HA 1ZU5A 1J22A 2AOVA 1WXQA 1JBEA 2P3QA 2VBGA 3F6CA 1TF7A 4UHBA 2AV6A 1GNLA 1P1RA 3S2SA 2ZGVA 3TF5A 5ECGC 1ZNZA 4AZTA 3PLAE 3VBCA 1UBKS 1WQ4A 3IT3A 3IUYA 5LJIA 2I80A 4TM7A 4I2VA 2XXAA 1I2BA 2XNDA 1DC5A 1Q57A 2Z1MA 3E3MA 1IHXA 1XVUA 1UBMS 4W4TA 2W2XA 4P6VF 5A6SB 3BXGA 4F12A 2GHQA 3JCZA 1G3QA 2Z6VA 3W7BA 5JTTA 3VR4A 2BFMA 4MMYB 4BMCA 2VPWA 1DKQA 1FTGA 2SBTA 1HETA 2YDXA 3PFFA 2B5WA 5L6MB 1QLWA 1NBHA 3CZ9A 2VQSA 4IZIA 5ICSA 1R0RE 5AJYA 4LTDA 4RDHA 1QUEA 4S3MA 3ZWYA 4CDGA 5EFZA 5C8VA 3P9QA 3HA2A 2XMPA 1SHUX 4ZFNA 2ZUTA 1J5EB 1NN1A 4ARUA 2IEGA 3H2KA 4OHRA 3NYIA 5A5FA 1JNXX 1J1IA 3DZGA 3MUOA 2KQUA 1S1CA 1TLLA 3MQ2A 3R2JA 4GLBA 5A02A 4NFSA 2BMWA 4F9EA 1XZFA 3I37X 4DIUA 1ZXBA 3K0KA 2H2HA 3UC9A 2V0GA 4HV4A 3PHCA 4ILEA 4E22A 3QUCA 1Z7YA 5EL0A 1RVDA 2E4VA 3GPDG 2E89A 2HCRA 3E27A 3F7MA 1FRFS 1X9IA 3PZBA 2FFBA 1P3JA 3JQQA 1SBYA 3HU3A 1N6PA 4M9RA 5LM3A 1G0OA 4PPYA 3SX0A 1LPPA 2NTNA 1N2BA 1XZBA 4OB8A 1RCTE 2PUAA 3IHTA 4FILA 4TKVA 3PNVA 1RMYA 4WZAE 3TPFA 3QPWA 3OUUA 3CSDA 3FXAA 1HY3A 5ALHA 3KR2A 2R1VB 1JDVA 1PGJA 3TUJC 2NSYA 3GZJA 3IOEA 3ADDA 3DE7X 5ITVA 2GASA 5KAPA 1IBSA 1O77A 3A26A 3HCRA 4IQ0A 4BCDA 4UBIA 4M1OA 1AB6A 1F5SA 1MRSA 4GQBA 3IAM6 4QM6A 3EVFA 1A4XA 3ZKWA 3JASA 1FXSA 3GLQA 5JJCA 4PANA 1YFLA 1ZCZA 3L6OO 4KSYA 5BSEA 3K6SB 2R60A 1NBMD 1J0CA 3MOGA 4O2LA 3BQ9A 3VDQA 1GRVA 4ZAFA 2C29D 2ZRGA 1ZIDA 3OOYA 4ZVVA 1JZTA 1G20E 2WMDA 2Y99A 4V2IA 5CJJA 3I1JA 3KYIB 3H9BA 2NZXA 1I7LA 4X6XA 2FF5A 3R6GA 2CUNA 4XUDA 2GTIA 1C29B 2X15A 4MRMB 2B92A 3O9VA 2OQRA 2NADA 1KOLA 1I1NA 3L4SO 2BKAA 3LHKA 2IEAA 2JIBA 2AGVA 1DJQA 2GUGA 3UWKA 5IJ0B 4QFBA 3V1YA 3VKVA 2OEPA 5JH7A 1D6MA 3WGHA 1K8YB 4Y2TA 4EW1A 4N5HX 4RPJA 3R5HA 1YQEA 2DHCA 1RADA 3HYCA 3SJUA 1D2NA 3OJOA 3NHWA 3AHGA 2GF0A 3QX7A 4LECA 4NU0A 3RVKA 3WBKA 3HDJA 3L1IA 4K03A 1RPJA 1YS4A 3PFBA 4HLCA 4REMA 2FMKA 3ZE2B 1DEOA 4WCVA 5DTIA 3SAJA 4B43A 1CQJA 1SCIA 2HSZA 1E7QA 1YNOA 2V55B 3WYCA 4MS1A 1RRPA 3E8SA 3NHFA 3TFOA 2NU8A 4UUOA 1ISMA 3TB6A 1J90A 4WAUA 5ALYA 2HIMA 2BH2A 3N53A 3R74A 3TQFA 1Q0TA 1VM6A 1X15A 4M53A 2VHVA 4B87A 5DBHX 4PO8A 4HJRA 4YONB 3THSA 1X19A 4L02A 1E3TA 1XF9A 1E2MA 3KVRA 3RADC 2I4TA 4BFUA 5JMTA 4ZQEA 3UFXB 2HQRA 4HWSA 1QDEA 1YRWA 2FOIA 3GDOA 3OPYI 1R15A 4E08A 1W36D 3HEMA 5A3RA 4NJEA 2HFKA 4G4SO 1FU4A 3DAGA 2DBZA 1YDWA 3E5RA 1ZJZA 2FZ4A 3ZD6A 4J7UA 2BTQA 1MX1A 1ZSVA 1A8QA 4MRRA 3G5TA 1QIJA 3ITKA 5H68A 5JCXA 5LNK1 4MWCA 1KKUA 3IAUA 2OBBA 4JB0A 3HDVA 5TJ9A 3E9RA 3CRNA 4D3YA 3CVWA 4IJMA 1KJIA 3IEMA 1HORA 1TVKB 4M60A 1PFGA 3CVUA 1K7EB 4GP6A 3A6KA 2FRDA 4JP8A 4AG5A 3K15A 1U8TA 5JANA 2BFDB 2B61A 4UUAA 5JATA 3ICPA 4ZVLA 4UTRA 2V9ZA 3CZ5A 2NV2B 5JJLA 1V6AA 3CG4A 1EHCA 4GX5A 5K3SA 2QVGA 3FLAA 5C4MA 1OJLA 1NG9A 4HXEB 5HFNA 2XEDA 2YFKA 3FETA 1KC1A 2ZJ7A 4UBOA 4NBWA 3D7RA 2AN5A 3IXLA 3QKRA 3WQSB 2P2CA 3EIOA 1MZPA 2ZR7A 2B6HA 3VKWA 1VRCA 1NJ1A 2GSDA 4HGOA 2MSLA 5FXMA 4XRGA 1UPXA 3LP6A 4P22A 1U2QA 3CWQA 3M70A 4D1YA 2ZSFA 3GMIA 4PO1A 3NYQA 4YJFA 4G3XA 2EQAA 2J85A 2VHCA 4GM0A 4NDNE 3W8RA 3ZJ5A 4CM3A 5KNBD 4C4TA 1CP2A 2G28A 5NLLA 4MCAA 1YA8A 4CF3A 4W5JA 3ZCSA 3GEHA 5CX1A 3UHFA 3VSAA 4GZ6A 4ZCSA 4J7XA 3PL5A 3FYDA 2AFHE 3LLUA 1XP5A 1ECCA 2WPDA 5TRTA 2R7KA 1ZX1A 4Q1BA 1MFZA 4PNZA 2QN8A 4D41A 1PSZA 4LNHA 2DFTA 2YZ2A 1CF2O 1CTQA 1UBOS 4AO7A 3W2FA 3IAEA 3NDJA 6REQA 3DCNA 3AETA 4MV3A 4FJ1A 4YACA 4RV4A 3TTVA 2YIJA 4PG6A 3GLKA 4D9NA 3OE7A 3HL4A 5C7OO 1ZRHA 1FJ2A 2MJLA 2PBLA 1E3EA 2VF7A 4JBWA 3ZTWA 1A4UA 1HKUA 1JU4A 2I3AA 4D56A 1U5BB 4QBFA 3EPHA 1X7XA 1N57A 1NQVA 2GCIA 3IS3A 4DCGA 4ENSA 3ZGYA 4Q6BA 1H42A 1QVZA 3LUAA 4CF6A 4X41A 1U7UA 2QXYA 3BJIC 3GLHE 4AWBA 5HP4A 4C4PA 1DJMA 4LRSB 4ZDKA 5JNSA 5C8XA 2FOXA 1P6UA 1FE8A 1LF0A 2I6SA 4JJ8A 3ZIAA 1HT2E 4DUGD 4F6LA 3N9IA 1XD2A 1RLJA 1SRRA 2GSWA 1OWPA 3ONWA 1PBTA 3ENQA 4YCAA 3AU9A 5AVZA 5IJXA 4ACAA 3RGGA 1BVRA 1MIOA 3DT6A 4G6ZA 4BLWA 1H1TA 1KBZA 3LUJA 1KK0A 2YXLA 3BAZA 3OEEA 3EZ2A 2OHOA 4JDUA 2CVZA 1TM5E 4EOGA 5GINE 4YCDA 2QN9A 4PYIA 4XVUA 3KKPA 1YR8A 2ZJYA 5DOVA 5A3SA 2QTFA 5ADWA 1ZIOA 4M98A 3PUYA 3LU1A 4O2AB 4QU8A 2OQVA 3VHQA 4XVCA 5CDUA 5I7SA 2DFDA 2ZETA 2ZTLA 3S2GA 3I4LA 2MSEB 1QB7A 4ITVA 1P60A 3F74A 3PEYA 1P0PA 4MQEB 3UPTA 1OXXK 2I2FA 3B3GA 3HKEA 5FTKA 1N2GA 2JF0A 2J07A 3BJZA 5G4KA 2A0FA 2PMWB 5C7LO 1JDZA 4TYQA 2H9YA 3HB4X 4C03A 2XUGA 4D8VA 3V7NA 1J39A 3OQ1A 3G23A 1DQZA 1VMEA 4B6OA 5C8YB 1G7SA 1Q7RA 1VZ2A 2CYBA 1PYDA 5E9WA 1KFEB 4ON9A 2WKPA 1KR2A 1NBME 2P4HX 4S0XA 3EAFA 4AK9A 1ZVMA 1TK3A 3UM9A 4YRZA 2H2IA 4R9SA 4B8WA 5BPHA 4H6PA 3SZOA 1T4DA 4RMHA 3S2FA 4YHHB 1PFKA 5HF9A 2WQZA 4LF4B 3IBCA 5I01A 2V96A 1SXHA 1V4BA 5K3BA 3T3IA 4V0SA 4XWOA 3DMNA 13PKA 2BZ1A 3EGEA 2F8MA 4X8HA 2W2KA 2Z1DA 4OGWA 5D87A 1YIAA 1CK4A 1S01A 1FDIA 1JAIA 1I4OA 4MVWA 2H4JA 2ZBGA 3SZLA 3TIVA 4IGKA 1BTOA 1MU0A 3H5OA 4DT1A 2EJVA 3HA7A 3W9BA 4IIFA 1PQUA 4Q9HA 1ZW1A 4M0EA 4FMPA 4KQWA 4DQ0A 3IP6A 5A4AA 1RWNA 3ZWPA 5C7YA 2Y71A 2Z04A 3LMKA 4TWZA 5KDOA 2CSXA 3L07A 1DC7A 2HH9A 1U0RA 1QYXA 4TT3A 4DNPA 2FX2A 2C7RA 3OHSX 3LECA 4LCJA 4XXHA 5FD8A 2C5LA 1VBMA 3U7QA 1FUYB 4LZZA 1S1MA 2WF5A 3JVVA 5C34B 5LJLA 3T1YB 5JSKA 2D06A 1EU1A 1XTRA 3DXYA 3W2GA 2GJSA 4GMKA 5BRNA 5IWAB 3FSGA 3TKAA 1IXKA 3COSA 1DC3A 3HXKA 3JAWB 3TNDA 4C88A 3CZRA 1RYEA 4JI5B 3ASYA 2QN6A 3T5DA 1AD2A 2WZBA 3SVZA 1QK3A 4X8OA 5T41A 4EJSC 1RHQA 3S68A 3X1KA 1YZUA 2RHCA 2ZSEA 1N2JA 3MHTA 4Q18A 1ISPA 2VNAA 4EG0A 3CW8X 3DZ8A 2HUPA 2PWZA 5B7PA 1UIRA 2I3ZA 3IIEA 3FRJA 4KE6A 1GZHB 1V0JA 3S70A 5KYUB 1K3UB 4EYSA 1SC1A 1UFQA 4LV5B 4TN1A 2QY6A 4ND3A 1IBLB 4TROA 1EQ2A 5BV1A 2ECKA 4QZVA 5CXUA 4J4BA 3U9LA 3CB2A 1IY8A 1T5IA 1IN7A 3GFSA 3IOBA 4FNGA 4O4JF 5IDQA 2V54A 4KGDA 4PSKA 1MAWA 2XZDA 2YJTD 3IBFA 3V4LA 4AMUA 1F3LA 3Q88A 1H2RS 4RGYA 3MBKA 3B7PA 5JBIA 1IH8A 4LJ9A 1U4SA 3O83A 2YVKA 3KFLA 5ESXA 3T4EA 3W2IA 4KVZA 2W6JD 1XZCA 2OFWA 2ORVA 5E6SB 2JJ1D 4FFBB 5FOTA 1CE8B 2VDVE 3O2NA 4DIOA 1ZKDA 2VSQA 5FIUA 4YH1A 5FOVA 2H5IA 1P80A 2HRCA 4GC5A 5KHAA 2VHYA 2Z30A 4Q4JB 2R8RA 2RHHA 4PLTA 3X1XA 3ZGLA 4DLPA 1E9AA 1PJCA 3TOZA 3HVUA 5IJZA 4LJYA 2EKZA 4KAXA 2O8NA 3IHWA 4UM9B 4QSMA 5KVCA 1R0KA 3QEOA 2PJUA 2JB9A 4KRGA 5A03A 5CM9C 3IIMA 2VNHA 1A3CA 2ZAMA 4N4AA 1JTFA 4YQYA 3UICA 2XCTB 4D4JA 3PDWA 2OXEA 2XGMA 5IH7A 5KOJA 1E0SA 2BI4A 2RHWA 4LZNA 5LIRA 3ISVA 4FCTA 1H05A 3U39A 4RZSA 4EFDA 4DKJA 3ZDQA 3ONNA 1O6CA 1KRHA 2OHJA 4I50B 2VHZA 3FB1A 4YALA 3O4IA 1YJCA 1UJBA 5ANRB 1ADJA 4RZ2A 4EI8A 2DKNA 3FUXA 1RMTA 1OREA 1P3Y1 2BEUB 4BATA 1RWBA 1RWXA 1Z82A 3GJ7A 1P91A 2FXVA 2O8BB 4ZCLA 2F43A 2GAFA 4JENA 3AUJB 4M6WA 3GEBA 1MX5A 4EHIA 5E38A 4DOMA 5JS7A 4TXNA 3VH2A 3LCJA 5TV2A 3DLIA 2JGFA 5TGTA 2I4RA 5FBHA 5JVDB 1WMAA 1YS6A 4HX9A 1KE1A 2X9NA 3FX2A 4EB6B 3HZRA 4OA5A 5KU1A 1G4UR 3MWEB 2ZDHA 4MP6A 5J4YA 1SVNA 3PTAA 4ND2A 3R3UA 2Z09A 4V0NA 1TUBB 3HR4A 1U81A 2HWUA 3GT4A 4R2IA 3WMEA 3OZIA 5AJHA 1TVEA 4TTSA 2Q4DA 4FT2A 3USES 4B09A 1ZI8A 1QSGA 1N8NA 2QYHA 4AW9A 3EF3A 4TSRA 4WKCA 1FRZA 1W2GA 2PKCA 2W00A 5CW2A 3RU3A 1FW8A 5IAOA 4BMDA 2D2VA 4C0WA 1H5NA 1D7AA 1V35A 3DO5A 3HBFA 1XHEA 3IB3A 3MERA 4H2DA 4M87A 1T35A 2IHTA 2KW5A 2O0JA 3EAGA 4OJNA 4JI8B 2FSUA 1DWUA 2HJWA 3EIFA 4CTOA 4GE3A 2XUJA 2QR2A 4OIFA 4ZMBA 1CUHA 4KE9A 3R9WA 1X8LA 3OCWA 1ZI9A 1F2UA 4DR4B 3PQ4A 2JCSA 2I7XA 4QA9A 4MEAA 5LD2B 3QELB 4UD2A 3VDRA 4IBOA 3BCSA 3TKYA 4FKZA 1J99A 1JSCA 1G7TA 3NVDA 3RVLA 4RV9A 2FEOA 1Z3IX 5FOQA 2E2WA 1RAGA 1IWPB 1W87A 3H9JA 2WIDA 1RQLA 1XD8A 2R1TB 4EW6A 2B35A 2BJVA 1VQ1A 1DRJA 4C21A 4V1CB 4FEEA 1BS9A 4TTIA 3OF3A 3WGKA 3VJLA 2IA5A 3T3NA 3X44A 5BT9A 1AKUA 4HEA1 1E2KA 2GKOA 1K7CA 1Y4DE 2NYVA 3WS7A 1UMCA 3IQFA 1L4BA 4ICIA 3W78A 5A04A 4JJ7A 4DLRA 2ZBVA 1JH9A 4PGAA 3AOGA 4LZPA 3D59A 3OWHA 1GTG1 2R47A 4W99A 2GESA 2G76A 2P2ZA 3PFWO 3Q3CA 5GM1A 3HWX1 2VSOA 3UT5B 3VAYA 1GAXA 2REQA 4GI5A 2Q07A 1W6UA 3GVXA 4HDNB 3WRWA 4DG9A 2WAXA 4EHKA 1W581 4OHPA 3EFHA 1S2MA 4RKYA 3IUNA 1QH1A 2F9LA 1YAHA 2ZJ1A 3H9EO 5DHRA 3UPUA 1ZGGA 3PKJA 2EW1A 1EM8B 3FOFC 2MU1A 4KTVE 2J6IA 4MP3A 1ZOIA 2RGNA 1RTTA 4PS0A 1NASA 2M1ZA 4O4IB 5HRCA 1Z5OA 1ZXXA 3EZFA 4AULA 1EEXB 2JBAB 1SY7A 2XTNA 4IVRA 2Q41A 2WUVA 4O3FA 4B3BA 4QFDA 3R3XA 4H7KA 4HH4A 4YAEA 1HYHA 1W2WB 1BGVA 3D7NA 3I6ZA 5LQSA 4ZN6A 2O7NA 5I4BA 2I62A 3UAYA 1F17A 2C3MA 3HEAA 1CDEA 1L5RA 4JX8A 3TLXA 2X77A 3PQFA 1KWGA 3DEHA 3H1PA 1V43A 2PUGA 4MVXA 5DEIA 2D2XA 5GIPE 4WN9B 2FOLA 3R7WA 2UXDB 1X7YB 1XQ1A 4BO1A 1VE5A 1YC5A 3SHVA 1OT3A 4DA7A 4DJAA 1O0BA 5EMKA 1LX6A 5KX5B 3LSYA 4WXYB 1A98A 3LV8A 1I2CA 2VCYA 4Y2YA 1A2QA 1OFUX 3OZFA 4XFKA 3ENNA 1QMPA 3RBVA 2R8OA 4BS9A 1SBHA 3EXFB 5FOUA 2IV2X 3CVVA 4K88A 1DAIA 1EQAA 1YL7A 1ZQ9A 1YHYA 2OE2A 1C0EA 2Z4TA 3GCXA 3HCBA 3KELA 3PEVA 1XVVA 2HDNB 4OQNA 3AI1A 5AYVA 4DMHA 4HPJB 3JVEA 3R7FA 1NBWB 1YZTA 3ER9A 3CVOA 3TR0A 1SB8A 2CNKA 2VZEA 3FGOA 3VTAA 3MJFA 1GCOA 2YHIB 3DMDA 1YCDA 3EB9A 3FCEA 5H0IA 3ZS8A 1IY0A 2GA8A 1LBEA 2VUTA 3B5EA 1ENZA 1NAIA 2JFQA 4IDAA 5AJVB 4NQZA 1EFKA 3WYNA 5JH7F 4ZMSA 3B6IA 3TLYA 1W49A 1TW3A 2HWXA 2FFAA 5THQA 2OFPA 1N9GB 3STHA 5P8WA 1T8WA 4BVJA 3W5BA 2CL7X 4TZTA 1XNRB 1BU5A 3GA7A 4PHFA 3H1BA 2HA5A 3PXXA 4LWOA 4M1EA 2P9FA 1LS6A 1YBAA 2YYSA 2WC1A 3QTTA 5E1DA 2VHWA 5ILGA 3TBHA 4G1MB 1EXMA 3AH8A 4QPJC 1LBHA 3HJRA 1LCIA 4JUAA 4YEDA 5L7TA 1ODJA 4UU1A 1JKFA 3T3MB 1Z2AA 1YCHA 2DQ4A 3BEOA 3KFXA 5K0FA 2HLPA 2HAEA 3N8HA 5KC8A 1PWEA 5CM8B 3KCQA 4I4CA 4ZRMA 2BGJA 2VWGA 4HXYA 4KAAA 3LBNA 4BO0A 3AXSA 3U4GA 2TMDA 3QQPA 5BNTA 1U9JA 1UQRA 3K30A 3TECE 1NC1A 4AI6A 1E60A 1U2RA 5HW0A 4GXRA 1JVBA 2DY1A 5BSMA 3KSUA 5LQRA 1IYZA 3IEKA 4RY2A 4FLFA 1ULSA 1WUIS 4KKXB 1U04A 2BMEA 1QIDA 3MRTA 4WOBA 2F2TA 3ASUA 3ECAA 4KQKA 3RNOA 2X6RA 3RRYA 2XE4A 2J0VA 2CGEA 1NW6A 4LXHA 5FWNA 5K8TA 4M21A 1F0KA 3EA0A 4CF4A 3UV3A 1YJ8A 2F1JA 3D4LA 3G2PA 3TB4A 4D9EA 1RZVA 1NR1A 3PJGA 1OGYA 3D2BA 1MEOA 1JXMA 1Q3KA 1P9NA 3M9WA 3CF4G 3LHDA 4ISBA 1WMSA 4P86A 4WKNA 1U1FA 5AI4A 4UM7A 1E2IA 3IAXA 3S2IA 1SCUB 1LKZA 3EQ9A 1ZSNA 4LOAA 2WHPB 4R40A 4PAWA 3I2KA 3WQRA 4FWTA 4ZGWA 2IZ0A 1PS0A 1QPGA 1AQYA 5C1PA 1VJTA 1N0IA 3K5WA 4RCYA 2XKAA 1HRDA 3FUWA 2OHIA 3FKQA 1Y8CA 1DWOA 4NKRA 4WH0A 5DX8A 3WJ2A 1TRHA 3CINA 3P9YA 4XQCA 4ARCA 2FWIA 3QX3A 1KKLA 4JL6A 2EG5A 1BGWA 1KJ9A 1N1EA 2QYSA 4XDYA 2GCPA 2M9MA 1NHWA 1P62B 1EFUA 1YZFA 2WYUA 2YH2A 1SCDA 4ND8A 5DCUA 1L0BA 2J33A 4E21A 3I1FA 4X1YA 1FMLA 5ENVA 3FCCA 4OK6A 3TK1A 1HDEA 3EPLA 3LYUA 1EWRA 2Q6LA 4LFBB 3FTQA 4YAKA 4FFPA 1R8QA 2MT9A 1EZ4A 3M6LA 4EP1A 4BUJA 1AA9A 1NYTA 4HUJA 3W6ZA 3DE1X 4YXWD 5LYYA 2AG5A 1D2MA 2QQGA 4NPHA 2H2GA 2J5BA 3OO0A 5AW4A 1JDUA 4F4DA 1A5BB 4RPCA 4MHOA 1N5DA 2ZUBA 1PJ4A 5EKXA 3JQBC 1WD7A 4C6TA 1KQ3A 2FG6C 3KAJA 4FP9A 4KK4A 4Q03A 1WB4A 2YZ7A 3D3JA 1SH7A 3OKCA 1V2HE 3EEQA 1FS5A 4GFDA 1Z5GA 3MJVA 5KTPA 3DMTA 3AV3A 1AVTA 1L7DA 1TCVA 2W8ZA 4XQEA 4AMGA 1QO0D 4N7MA 4LQLA 3UYLA 3MXTA 4AS1A 1FS4A 3I9JA 3JVDA 2H3EA 2A1TR 2QTTA 3B2EA 1B2RA 1QC5B 2GHTA 1A9RA 2QMUA 3DJYA 4JCOA 4MS3B 3S0JA 4E5VA 1VKZA 2BGMA 5E6UA 3KOZA 3G5UA 2ZZKA 3RARA 4W5OA 4TSFA 3ZC3A 2O7SA 1IJBA 3ZDEA 3DLBA 3PT9A 1EVIA 2ORIA 1CUWA 3U3RA 4Q7MB 1CUUA 5A9SB 3R7AA 4BX8A 1U6JA 4K6FA 1HNZB 4QYSA 4CQLB 4E7PA 4BFCA 5LU9A 1RWQA 3HCCA 1NXPA 4OHZA 3MCWA 1SVKA 1HE2A 1Z15A 4N6GA 4KXMA 4UUNA 4WY8A 1A9OA 4X6LA 1ST2A 1JEEA 3NNDA 3I2IA 3NZEA 4HF7A 3PG5A 4CL0A 2O8EB 4ALJA 2UYOA 4FEGA 1GZ6A 4I1SA 3DLAA 4TMKA 5ALWA 3T7SA 3TBFA 5LL6P 1U3DA 4IWYA 1NP6A 4DMLA 4D79A 1JQDA 4K87A 2WHEA 4XVQA 1G20A 2G70A 5E7MA 4C20A 5CB8A 2P68A 1AK2A 2ZE5A 1CY7A 3AP2A 3LHIA 2A5LA 2VEOA 2IWRA 2GAOA 3ROKA 3PQCA 1CXZA 4F2WA 4ZO6A 3TM4A 2J3IA 2WV7A 4MS4B 3LTEA 1S8OA 2WKRA 2WYVA 4TLLB 4L74A 4WNCA 4TVBA 4K86A 3ZU4A 3VKHA 3HBNA 3JTMA 4R7TA 3D7LA 3LTNC 3GMSA 3KYDA 1QF6A 3DUFA 5JT1A 1KNQA 2C2XA 5DPMA 2VH2A 4C43A 5BOSA 2GCOA 4HDSB 2QX8A 1S0UA 2A88A 3QKSB 4AD8A 1JU9A 2Q3EA 4JA0A 3SP1A 5INTA 1Z73A 2ECPA 3E35A 1M2VB 2YVQA 3IALA 4FKMA 3S2YA 4FZ5A 4I2NA 1PDWA 2PCLA 5JSZA 5LMUB 2A9PA 2IE8A 4R2LA 2NACA 1JHUA 1U4NA 2CL6X 2CNNA 2GJKA 3HACA 2MWMA 4KMSA 3IBGA 2OCGA 5ECYA 3A4TA 1YUMA 3RHFA 1SQFA 2XI4A 3K9NA 4I6GA 3BT7A 2FZLA 1DMSA 2X4DA 3SHOA 121PA 2P6NA 4U9HS 2QTLA 4XQ0A 2J1LA 5F7JA 3RG2A 4XLZA 1I8TA 1QFJA 4DMFA 2ZE6A 1OMOA 1V25A 4ZU6X 5LZ8A 1GG2A 3PXEA 4IHJA 5L4SA 3L0ZA 1VIAA 1RNLA 1NR5A 3I3OA 4O3MA 1X1BA 5B1SA 1JDTA 1DNPA 3QVWA 3O6VA 4NR0A 2BTOA 1DC4A 1SVSA 1J8FA 1U28A 1ZOSA 2IYUA 3AR9A 4XLTA 5GOTA 2PZJA 3GJXC 4JUCA 2GZDA 3FMGA 5J2TA 3L06A 2YWDA 1L1QA 5C8DA 1XMXA 5KNCA 3MYYA 4RVOA 2PNJA 3TLEA 1G8KA 1THMA 2ZJ8A 3LI2A 3PSAA 4OYYA 4Q3EA 1JR6A 2QRMA 1AV6A 5FCDA 5JEEA 4B35A 3HJFA 3KXKA 1FIUA 4C5BA 4QOSA 4UPVA 4TMTA 3L6CA 4NCBA 1PT7A 4HDCA 1NJ2A 1HSOA 3MXOA 5D3MB 4G85A 4Q3NA 1P9RA 2IXEA 1TPZA 3DE4X 5D3KA 1J9ZA 2FDRA 3CNOA 1XVTA 4MOWA 4LYFA 4V03A 2I1QA 3EBLA 4F56A 1SXJE 2O2XA 4OU4A 3UMMA 4AYTA 1U7XA 4G0MA 4TRNA 5FTLA 1H3NA 1P2VA 3E4DA 3N5CA 4Q1DA 4KR0A 2XGGA 1N32B 3H19A 1JQ5A 2NO1A 3JW8A 1BRTA 2GM5A 5JYDA 1E9VA 4KWIA 1RYFA 5EMHA 5ICFA 4IXWA 3AF0A 4AX4A 6LDHA 5C53B 4OD0A 2C8VA 2LWIA 4DIEA 4EJ6A 4B4VA 2JIZA 4NYIR 2AS0A 2P3LA 1NP3A 3KWLA 1C9KA 2J59A 4G4SP 3B6EA 3ESRA 4XAQA 4GMFA 4F1KA 2H92A 4QEDA 3INNA 4LYHA 4D42A 4E5YA 1W30A 1ZP6A 4YI5A 1CC1S 5DGXA 3LO8A 1P6QA 2AFHA 1N0VC 1OX5A 1UPAA 2O48X 1O96B 3KQYA 4NEHB 1Q0RA 1JWAB 3C8HA 3W8NA 3SNKA 3DDHA 4IMJB 4Z5XA 1E1KA 2AEEA 3FJ1A 1J33A 2PRKA 4R2XA 2VJAA 5CEFA 5FBRB 1VMDA 5HJ5A 2R7NA 4LRYA 2H2AA 3QU4A 4EFKA 2WJPA 1IMOA 1OILA 1DAFA 1OLUA 4ZALA 1U0EA 2VT7A 1Q7GA 3K16A 4XEUA 2DYKA 5GGYA 3ZX5A 5BSFA 5LQCA 5J2UF 4PX5A 1X9HA 3K0HA 3M83A 4IOJA 5HJ7A 3NYRA 4Q21A 1U7OA 1EX6A 3BH6A 3DTVD 2YQ4A 4FDVA 4R1QA 1ZUWA 4R54A 4BBJA 3GLHA 4ZKDA 1XZIA 4O1MA 2VUSA 4ND5A 3JD2A 2X2EA 4HQFA 4OAPA 3BCUA 3GIDA 1IRXA 1NYRA 5MGBA 1FFBA 5DLDA 1KSJA 1RM3A 1WUJS 1T4CB 3ONEA 4PSCA 5FWAA 3JWPA 1H5QA 3MCUA 5KJ6A 1YV9A 4AMYA 1PUXA 1L1FA 3BJRA 3F47A 1G5HA 4MR9A 2JGEA 2PVCA 2NSHA 3C1UA 1M34E 3DNMA 2PLWA 3I9MA 3Q0IA 4FDAA 4NS1A 3RVMA 3UUWA 3O21A 1FQJA 4KK3A 4R9NA 5BW5A 2E5WA 2JIDA 4JLKA 5AKEA 2V6FA 2WUEA 1Q7BA 3HDTA 1RRFA 3KEFA 4U2GA 5EE1A 3GCGA 2O54A 2D13A 3NJRA 3NJ8A 2EKLA 2Z98A 3DVQX 2J45A 3CWZA 3OETA 4P4GA 3T3DA 1I36A 1LUAA 2FPKA 3RDPA 4DQXA 2H16A 3VU9A 2R97A 4PYOA 3HU2A 4N5NA 3GP3A 3HMQA 2QLNA 1GUBA 2EKPA 2X8LA 2ZULA 3QRWA 2VVTA 2L82A 2ZSAA 1ORDA 2IW3A 1G2QA 2YJ6A 2E4YA 2XGOA 4COOA 4DNQA 1N77A 3EC7A 4D9IA 1K4YA 1Y8AA 2FPGB 3OTWA 1C3VA 1FFEA 3UZUA 1N2CE 1V5FA 5FPKA 5F9HA 3IESA 1ODSA 4L76A 4G65A 4AWXA 4UTVA 4C87A 2NGRA 5A1TA 5CAEA 3ORQA 4N41A 2Q1TA 1O57A 4J8PA 2A9FA 1RXEA 2JASA 4FI3C 1KDRA 4HWKA 4RY9A 4JSYA 5BMVB 1NBMA 1U2GA 2XVAA 4QJ3A 4GDFA 5K5EA 2EHDA 2IPNA 1L6RA 4CCYA 5IXJA 2YOFA 3EF1A 2LCQA 3IIKA 4KYTA 1IVSA 2IYTA 1S7GA 2QX4A 1KXJA 4PRLA 3WMGA 1QYCA 4W9MC 3O4FA 2O5EA 3TINA 4FD2A 3RR2A 5C5DA 1Z45A 2JCYA 1RJDA 1MRNA 1ZH6A 4M76B 4RL4A 1MHPA 4CG2A 3EISA 1U0FA 4BEWA 5DYWA 5ITZA 3K1YA 1XL0A 2V7UA 3DKIA 3Q41A 4NJMA 3ZHVA 3U6KA 3AINA 1QHNA 2QZ4A 3D7SA 4D57A 5CTAA 4JU8A 5AK6A 3USCS 1F60A 2Y1EA 4CIXA 4DLNA 4EY6A 1S89A 3P5SA 1WV1A 1O94A 1GU7A 1KARA 1PFQA 2XODA 4FS3A 4GLOA 4MW1A 2H6EA 1FX1A 1OI3A 2VO1A 4R0VA 4X6YA 3MSCA 4E70A 4ETIA 1Y3CE 3CFYA 5AI8A 1E1CA 5JD3A 1BYIA 5HKKA 5KWIA 4KR2A 3HJUA 1QYWA 2OGZA 3EC1A 3NV9A 1Q6ZA 3DPSA 4K40A 4KX5A 1KKMA 3E05A 3EVZA 4O2RA 3VOBA 4X54A 5I51A 1YU9A 2IU3A 3KAPA 5KREA 5FBLB 2WD7A 4YAIA 1BW9B 2IIQA 2FB9A 3C3EA 4XE5A 1XNJA 1LEHA 2MTBA 3C7TA 3LUFA 2NOAA 1S8AA 1W0CA 5LD2C 4A0HA 4I81A 5EIBC 4PG8A 2B2NA 3EGDB 3PGKA 2FSPA 3OIFA 2P27A 4U2CA 1XLWA 2EEZA 3JQCA 5ESRA 4EO7A 2VF4X 1MXHA 3A32A 4YJGB 2YRWA 5LUAA 4RTOA 1L5VA 1U0GA 3C3BA 4YMHA 5IX8A 5LFAA 2PU5A 4ND4A 1G9TA 1TYAE 1A8IA 5EMJA 4YO8A 3TL2A 1G21B 3NS7A 1YMUA 2OCXA 3QP9A 3PPYA 5DSZA 4P0PB 5ALUA 3FZQA 3GRZA 4GVXA 3ZJYA 2O8VA 2VRCA 4F06A 1IHUA 2SKEA 1JE1A 5EIEA 5DCLA 3DE3X 4I8XA 4MUXA 3U56A 1DINA 3PVZA 1Z7WA 4HFRA 3H4VA 1Z0FA 5B55A 1UPCA 4B47A 5C5CA 2SCUB 3BORA 1B14A 1Z6GA 2J48A 1JZSA 5FWYA 1UC4B 5I4IA 3NHRA 3PC4A 1C1DB 3V7UA 5C52B 4LJ7A 5LKAA 3RC7A 3KQUA 1C8BA 2JFNA 4NHEA 1SXIA 2RH5A 2YBDA 2WNIA 1U98A 2H1RA 3G8CA 4MLPA 1Q1BA 5AQ1A 2XZLA 1BN6A 1LRKA 3G2JA 1F6WA 3VHXB 3RTGA 2IEDA 2PRIA 3COYA 3R5SA 1J23A 5B4UA 3MWLA 1IQ0A 2GTPA 4QU9A 3N2NA 1HFEL 3A9TA 2DPLA 2PO7A 4GS5A 5DGIA 1UAGA 2PL1A 1B8UA 1FZQA 3DYVA 5SZIA 5LC1A 4XJVA 3E15A 1FEZA 2PV0A 4ARSA 5EVJA 1KOJA 3QEJA 2HI0A 1M2NA 2Q45A 3FROA 3SZRA 7REQA 2BKEA 4GR4A 3U60B 4JLNA 1K6IA 1KJZA 3WYGA 4X1KA 5FOSA 3MJ4A 4J1TA 4EITA 3HP1A 3QLEA 4UU7A 1Y6GA 4KREA 3VR0A 3R3JA 4OAOA 4X9XA 4UHDA 1EZ1A 1I10A 5DYYA 1RAHA 4OA8A 1UMDA 2GAJA 3RJTA 4KHZA 2AH5A 2D2IA 4ASUA 3GYBA 4RSRA 1E8NA 3D81A 5J59A 3BULA 4HOYA 2Q7XA 4LDAA 5JYCA 1OZHA 2D5LA 3L0SA 1SKYE 3OTGA 2JLXA 1WW8A 3DAFA 2C8JA 1HE8B 1SFRA 1YC2A 2EEPA 5BYBA 2OBMA 1XCJA 2YQZA 3QKIA 1KORA 4NFYA 4YDQA 3LY5A 3RC8A 3X3HA 4LC1A 4HAUA 5FA8A 3SQOA 1MOSA 3ZHQA 5IASA 2RH9B 2A5DA 1Y33E 2JGMA 3V80A 4I8DA 4D99A 1J2TA 1H2YA 4IDNA 4B7AA 1E9RA 1JLLB 1S7CA 4KN5A 3RYIA 4DCPA 1GP2A 4RVSA 1DGQA 5FI0B 4B3JA 1H8HA 1RI3A 2CE2X 2J3JA 5KYYB 3WGJA 1RHMA 4EZBA 1KAGA 4R01A 3TR6A 3WGVA 1B76A 1HQDA 4OOEA 1H2XA 1ISGA 3IQZA 1O95C 5HFAA 3ND8A 1VYTA 3MEQA 3RIMA 4ZT4A 3VNAA 1BWSA 1EPUA 4FN4A 3BGWA 4P7BA 4TQAA 4C14A 1LV8A 2YZMA 3D1JA 3QPCA 4HQRA 1VPVA 2ODBA 4JLJA 4W9NC 4D92A 4N65A 1P1JA 4L28A 3L04A 4OH7A 2VQ3A 2JGRA 3VR5H 4XGKA 1UM9B 3GXOA 4K8OA 4PCUA 2NVWA 3RU7A 2XD9A 5DLEA 3E1KA 2YVLA 3M6IA 4RW0A 2GILA 2VIIA 4M4SA 5F9FA 3U4QA 5C9ZA 4PX2A 2VPTA 1HA3A 1G2IA 1XFDA 4PLPA 1E4VA 3BPSA 2FSVA 1FRVA 5KTOA 4YV0A 2AQ8A 1PQWA 2BBWA 3LE8A 4B34A 3PDUA 1NQXA 1WE2A 2R1ZA 1H4SA 1ZOLA 4I99A 2DBVO 5JD6A 2ZDQA 3DB1A 1Z5WA 5JC8A 4Z1MA 3ROTA 1CWUA 2EDCA 3CLRC 1NVFA 2I4IA 4KQFA 1SBTA 3WLKX 1VYHA 4NFHA 3BMXA 1RWPA 5AOCA 5TQ2B 5JFGA 2Q3LA 1GQFA 1Z4MA 2H07A 3IP9A 3JARB 5BORA 1HDGO 2WTAA 2QJFA 1DLJA 2J67A 1OGJA 5FWXB 4YI3A 1RI5A 1EJ0A 1SKAA 2YHUA 4H0FA 1TFRA 4HH3C 1I94B 4XIJA 3ICWA 4HHEA 1WABA 4M0CA 3TZ6A 3QWFA 3ZIUA 4E32A 1JG2A 1GLVA 1HOXA 1W1WA 1PTJA 3GB9A 3MJEA 1W4CA 2VPYA 2PJRA 1K88A 3EMVA 3GQBA 3EVBA 4RWZA 4R1MA 2G1JA 5E9JA 4QUGA 2QUZA 3V8PA 3BJMA 2WHYA 1E3WB 5AICA 4OLBA 1OBCA 1X9GA 1Y42X 2V7XA 3I34X 4MW6A 3DCIA 1P4SA 4F4IA 3WLNA 2WG2A 1C7ZA 1YT5A 5J1SB 5CA0A 4RSHA 1QAQA 3LO5A 4WOKA 4C3UA 2Z2JA 5FWDA 1QBGA 3ANMA 2BMFA 3B89A 3IPCA 1NF8A 5EQTA 4FHGA 3I05A 3L9XA 5C5EA 2YRXA 4IGAA 3PENA 4UE6A 1OXVA 5EJ2A 4U8HA 2NTYC 5HM8A 2ZIZA 3VKFA 2AHOA 1P81A 5B30A 3R24A 3RUHA 3HMKA 2QQFA 4GVPA 2A0UA 3RVJA 3GU3A 5BNWA 2WAAA 3G2QA 4PLGA 1BDIA 4YPOA 1V7CA 4YUZA 3WLTA 1DQSA 1E1QA 2BF4A 3KUUA 4QD3A 2XBUA 1L7RA 5EPOA 1ML4A 1E32A 1SBZA 3TSZA 1YZVA 3PGXA 2G5PA 4J3NA 3T3GA 1JX6A 1Y1PA 1YKGA 3FJYA 4Y2SA 1Z75A 3RUAA 1MHTA 3TD6A 3O95A 5JWOA 1GGNA 4HNAB 2WU4A 3I4FA 5B1DA 3TZLA 5J9FA 2NPIA 3C6MA 1V1RA 3TN7A 5CA1B 4AU1A 3KQVA 5DXAA 5EIXA 3O5AA 1U3UA 4ZU1X 5LCXA 1CZUA 4ENUA 3QH4A 2DWPA 2NQ8A 3EUAA 5F21A 1N6LA 2O2EA 1KO8A 1E0JA 2ABWA 2DHEA 4FMCB 5K6AA 3PUJA 4QQRA 5KHLB 2JZNA 1DFGA 1NMEA 2P62A 5F3WB 3K5IA 1QYRA 1KRWA 1DV2A 4UEWA 2JRCA 4CM4A 4KDCA 2EIXA 1VKOA 2JJ1A 2YFYA 4ZQGA 3E6AA 4V0OA 2JK1A 4IJQA 4XCQA 2C2HA 3VSEA 1UJ5A 2W43A 3AJAA 3DBVO 3FMVA 2AR7A 1GDHA 4L51A 1J8DA 3UG7A 1FFDA 4H77A 2I6FA 3AI7A 3E22B 3J7AC 4LDJA 2PE5A 3AR7A 1IBRA 1M76A 4R2WA 3SI7A 1N6NA 4HQKA 4BNTA 1T2NA 3WKDA 1VBKA 2H7VA 4JVMA 1EUCB 1T2AA 4JJGA 3TPZA 1BJRE 2XUOA 4IHJF 2UKDA 4BV9A 2I7DA 1T5DX 2RONA 2WBLC 4KQ6A 2DWOA 4HQ0A 5DHQA 1TTTA 4XGNA 1A9YA 3OZ7A 5B1EA 3CXRA 4CI0B 2WMNB 4RVNA 3EPKA 1HEIA 3GROA 4BTLA 4ZVQA 4FFSA 1DOAA 5K8UA 1C9YA 1Z25A 3ETLA 3L6UA 5JO0A 1ADGA 3AY7A 3H87A 4JL5A 1Z4NA 2FN3A 4Q12A 4F11A 5B1HA 3JQFA 3U3JA 3OLWA 3I53A 5I9SA 1XGKA 1Q20A 3A1SA 3QFCA 5B6JA 4DRZA 4R8KA 2ZVDA 4MNTA 3T1VA 2FZKA 4L3OA 4A5OA 1L7EA 1K75A 3C1AA 3W2TA 3L7JA 5JU6A 2VNSA 4B6GA 3WWYA 3U5TA 4OKSA 3P9ZA 1ZMOA 4WRRA 4U8GA 1IVNA 3RS3A 1HTBA 1YASA 3HLTA 1LBTA 2XQFA 3DVAA 5HK9A 4FMDF 1T36B 1NU8A 1Z0JA 4R7ZA 1GZDA 5KDDA 3HA5A 2OORA 3GJ6A 4AICA 4PYMA 3VAAA 2ZU0C 1T9AA 5JW6A 1PEYA 1M2OA 4IWNA 4DCTA 1B0UA 1N3LA 4N3AA 4TVSA 1ZRSA 2WSLA 4K6OA 3IMKA 4IKPA 1Z4OA 3DNFA 3VPCA 4ER0A 3OPYA 1X8JA 2JKYA 1ZOOA 1SCKA 1L5HA 4MR7B 4DJJA 4MKZA 2O8FA 1NPYA 4Y1EA 4YJHB 3MQFA 5FNVB 4DWVA 4FUTA 2A1TS 4BWFB 1TX4B 2BFOA 2ZOSA 5DO9A 4NU8X 2XRFA 4J3JA 3S5JA 3AHCA 4KXFB 1OLXA 5HMMA 4UCFA 1P77A 5L95A 4QHYA 2B98A 2GEJA 4BO7A 4Y2GA 1V7QA 2C8LA 1GPJA 2PGDA 4IZHA 2HU7A 5TT1A 2ZBEA 3BOSA 3MIZA 4F46A 1Q74A 3GQVA 4RK6A 5A1JA 1EFTA 5HFJA 1R4NB 5I7RA 1AY0A 2OSVA 3VKUA 4ZAGA 2QTWB 4LCBA 1M6VA 5B36A 4DC1A 4N76A 4X0EA 4ZHQB 4KHPB 1B8PA 4MV7A 2F1IA 2UYYA 3LBIA 2NSDA 1G6Q1 1GUAA 3QVSA 4LE1A 3CLTC 5A05A 3RKSA 4OJKA 1NC3A 1H3FA 1UKAA 4WXPA 1KAQA 2RAVA 3TIFA 4OMUA 5FI3A 2I0FA 3FDIA 1EFCA 1JSLA 2VK8A 3GGPA 1EGVB 3WE7A 2J3KA 2V7GA 3AF5A 4AKGA 2Y92A 3JQ6A 4MUMA 1Z29A 3AY6A 3CKLA 4K9KA 4JMPA 1TIKA 2G71A 2IXGA 3DF7A 4MAAA 4DRXB 1JA9A 8ATCA 2KM1A 5H4GA 3BTUA 4QWWA 2UYQA 4RNDB 1KO7A 4P2BA 2ZTMA 3PE6A 5FYDA 3RV4A 1M8GA 5K0GA 2QZJA 3B13B 4WKOA 4AJ4A 1X1EA 1I5OA 2FXIA 3DSRA 1UWLA 3ZLTA 5KYXB 4G8JA 3ZHRA 1YE8A 4EY8A 4HAWA 1Y6RA 2ZIUB 4MYHA 1DAOA 2YWGA 1R5OA 4I5IA 5IKMA 5ISMA 4J0KA 5CHYA 2GN4A 3PJFA 5TEWA 1UANA 3ZR4B 3ZWOA 4DA0A 5K4AA 1O8BA 2V6IA 2IUTA 3ICQB 3TPCA 2PYDA 2W93A 1XVAA 1ZD2P 2Q3DA 1T26A 1FVHA 3SBOA 3CUYA 3ESBA 3O75A 1ZY2A 3QIVA 4H9GA 3AP3A 2XDQA 1FXWA 1IONA 3GGSA 1ORIA 3QWBA 1D5WA 3U7HB 2G9VA 1RQXA 3SHTA 2EL9A 3V4OA 4LF5B 1NMXA 4DADA 1PT6A 2FP4B 1ETUA 2LUOA 3F5SA 3LDFA 1IPHA 4Z9AA 4S05A 2B8JA 3GHHA 2W2PA 1W19A 4ENVA 3CH7A 2JHGA 4UJ3A 5ALGA 3OJLA 4PLCA 3IT1A 4UBNA 2C95A 2PRSA 4GNRA 4H0CA 5IUKC 3AFHA 3THXB 4LXUA 3FTNA 3LCRA 4A0GA 4Z4HA 1A7JA 1CQXA 2OTCA 3JYHA 2JLUA 1SZCA 1R6BX 5AIBA 2EG9A 1TK9A 4HPXB 4AKTA 2J0UB 1GXSB 3AVYA 3QWHA 1QK4A 1XQYA 3H7AA 2EKDA 1KAHA 2OZLA 5AK5A 4DS3A 3ABSB 5HHTA 2B4RO 5JDCC 3F71A 3SQWA 1ONNA 1SVWA 1NZFA 4NS4A 6AT1A 1GKKA 2XVZA 4M37A 2NU6A 1WPQA 1ESCA 3CUTA 5K0ZA 2FFJA 3KTFA 1B26A 2GN6A 3G7NA 1TCCA 3LW8A 2DP4E 2VP4A 2ZSBA 3H11B 1LI5A 4JDPA 1JU3A 1S4QA 2DLCX 2ANBA 2VJYA 1SHKA 2MSKA 5F73A 1ZGZA 2BEVA 3IMGA 3KR9A 4MKIA 4KE7A 5DN6D 4KQ9A 2BELA 1VCNA 1Z08A 2AK2A 3BM5A 3WADA 2JGLA 4BWVA 3QEKA 1R7RA 3HRIA 9LDTA 1VJRA 1S3FA 2OAQ1 4YYZA 4F38A 3BE8A 5DGHA 1R0ZA 4PSVA 4JI2B 1K08A 1R4ZA 2ACKA 4MQ6A 1DIBA 3VHLB 4EGAA 4DR5B 5IRCD 2GBPA 4W7SA 3HZOA 1JG6A 1SXJA 3BWBA 5EKDA 2F3PA 5CT4A 2OUKA 1ARZA 3RJ9A 3KUDA 1S3IA 5CRIA 2I4OA 3FVQA 1GPBA 1N2OA 3R6WA 1LF5A 3HB1A 1GZ5A 4UU0A 4GYYA 3MIIA 4U7PB 1KI2A 5IZCA 4BO9A 2GLXA 2J6CA 1CUYA 1G3IA 1SG6A 2QMYA 1RWMA 3I9KA 4QTUB 4MAFA 2CXHA 2J4CA 4OJTA 1ZL2A 1L9KA 3SF8A 2YWFA 2GZSA 3DM5A 3OKFA 2RBEA 5CNMA 1Z5NA 3RSCA 1IZ7A 2A0XA 1YK1A 3CH6A 3NVAA 1NW3A 3Q8WA 1JXQA 4O29A 3GLIB 3TUZC 5JQGB 1R3DA 3UXYA 3ZV5A 2VDWB 2FPIA 2NT4A 1AK9A 2X3FA 3BL5A 4FYJA 3NPAA 3IJEB 1FYWA 4LF8B 4JBHA 1S2LA 2IPAB 4JWTA 3LOUA 3PD1A 2Q3BA 1XZQA 3HP7A 1EE2A 1H69A 1P74A 2A4MA 3KB1A 3BRQA 3PF8A 4FWBA 1WEHA 4I55A 3U3KA 4D9JA 3E9ZA 1DRUA 2O2ZA 3KSDO 1U3VA 4WXMA 3UOGA 1JAXA 4MA5A 3WB2A 1YSCA 1KFBB 3WNQA 1CZKA 5HIAA 4E14A 1Q2UA 3IQWA 3P0EA 1KSFX 4IOLA 4Z0NA 2QMEA 1LK5A 3BMCB 3I23A 4LJRA 3BQMB 2GNOA 5KINB 3DAPA 3KEMA 1JXOA 2VNIA 2OSBA 1FDUA 3CZAA 4JAVC 3OUTA 1G1AA 2C98A 3TOCA 1EFVB 2VUUA 3OZXA 2PIAA 2PGAA 1XI2A 2PUHA 3GWGA 4XSGA 4ETWA 5KYGA 4RZIA 3BE4A 1HEUA 3CRZA 5DBOA 1YRQA 3PNOA 5FADA 1JV2B 1XMSA 3QVLA 4CZ2A 1Y7LA 4HDMA 4B32A 1NDQA 1M34A 2DR0A 3X1DA 3HN2A 4H3HB 5FTNA 1AT1A 3WX0A 4C04A 5LP6A 2PT6A 1CUSA 2AOWA 2WOJA 5FL3A 3ILHA 4E1BA 2ZITA 4QHTA 2Z6UA 3GLTA 4LRUA 1VE9A 4ZWNA 1EDBA 1A7KA 2FE4A 3ZU3A 2Q5IA 5AKIA 3FNIA 5F2OA 3RSLA 1WHTB 4HG2A 1Q1GA 5A62A 4DYDA 1LPOA 4KW7A 3JWHA 2BR4A 4B3TB 4QBIA 1E77A 4WKGA 3V7WA 2OCKA 7ABPA 4Q4HB 3RSQA 3GAMA 5F98A 2VAMA 2BFFB 1B43A 3KKMA 4CW7A 3WRXA 1DOHA 2DBYA 2FMIA 3GLRA 3ELBA 1TZMA 3GFFA 1WUTA 2PDAA 3LP8A 3TH5A 4Y9RA 4E5MA 3KVYA 4OHKA 1N2CA 1QVAA 3LY8A 1EWYA 4TMZA 4L15A 3CZCA 3NETA 4DNOA 1ZHOA 5EUCA 3WFIA 1MABB 2F00A 3M6XA 1LQUA 2EFDB 2WU1A 3FHLA 4EFMA 1YKSA 4RHYA 3X1WA 2AG1A 3SDSA 1HZZA 1KQPA 5E6RB 4RENA 1SO8A 5TMBA 5AOAA 1N78A 3BMNB 1MXFA 2GEBA 1DAKA 2PVPA 4NZOA 2YASA 1XCBA 1NRJB 2CDCA 3B2NA 3DMRA 2D8AA 4P4SB 1N0WA 1QGUB 4TL9A 4UOZA 1KEEB 3EDRA 1CUDA 4N3BA 2WUGA 3AL2A 2L0XA 5CURA 3SFTA 4R0NA 4N48A 2X9LA 3L0PA 2XUDA 5BN5A 3IDZA 1OI2A 4F71A 3VAZA 1PVDA 4C22A 1FK8A 3WI7A 5K6TA 1V9CA 3N05A 3VR2A 1M66A 1J0DA 2UUOA 3FNBA 1DX4A 1ZG3A 3E7DA 4P84A 3AJDA 1LA2A 2C84A 3KZCA 1EUQA 5GJBA 1CJUC 3AVPA 4CIDA 2Q0HA 3NCHA 1P4RA 4YRPA 3LY9A 4JKYA 4O4HB 4RLFA 1AQ6A 1A2BA 1GPAA 2ZQYA 4DV1B 2PYZA 3AEKA 4OLHA 2X4GA 4D9CA 2IDMA 1JQEA 4R2JA 1I5RA 1F8YA 2BHRA 4EHNA 1H65A 2FEPA 4NENA 4JB8A 3D6MA 3LCVB 1XTZA 4Z3DA 5ADHA 2JLRA 3ZOKA 3OM9A 4A3SA 1QHYA 1QANA 3DHYA 2YWCA 3SYKA 3T5AA 5DYNA 1W73A 2WFLB 2D1YA 2ZB2A 4MQ5A 5IXSA 3COPA 5AUQA 2YS6A 2RDMA 1Q0PA 5FB3A 5DHPA 3FSRA 5DBEX 1QP0A 1GUZA 1V39A 3PQDA 2LRHA 3IVAA 4S1OA 4YCSA 3FPCA 3BH0A 4MWOA 4PXAA 1QKIA 2YHIA 2AOTB 4TLAA 3RWBA 2ZJ0A 1QGAA 3EGXB 2DQSA 1L5WA 3MW8A 2W90A 3IQDB 4ZYYA 5K0NA 3QJGA 1RP1A 1T9ZA 4DQDA 5CA0F 1D4AA 1U8UA 2EW8A 3W3AD 4DG5A 5BN3A 5HG0A 5KTSA 3ANYB 2EGGA 1X13A 3KTAB 1BD3A 3D1VA 2HEIA 5AK3A 2PX3A 1NX6A 3AT1A 3FN4A 4H0NA 1AZWA 2MR5A 2V0CA 3LVRE 1IY2A 2Y1XA 4TYMA 1LVHA 3W5VA 2J5RA 2QWXA 3QHPA 1Q19A 4EF4A 2AI2A 1OWNA 3KTOA 4MI9A 5TMEA 1H6AA 3F8TA 3U44A 1BX1A 3FPAA 4IM7A 3QYPA 3K9BA 5JZBA 5I6DA 2IPXA 2WVGA 3K09C 1RC8A 2QENA 3G0OA 4IP0A 4BMPB 1DL5A 2JJ2A 2ALJA 2YJNA 3KD3A 4G1EB 4DSAA 2H1WA 5M7EA 1MQAA 3AEXA 1SRQA 1C4WA 3HN6A 3MWGA 1U1DA 2I6TA 1IK4A 3W34A 4ECEA 4XGQA 2Q5QA 3VPHA 3M4JA 4CMJA 3WLOA 4M0DA 2BN4A 1QKKA 5FTJA 2K87A 1YF3A 2QAGC 3MJCA 4P34A 1OBHA 1P5ZB 3NX4A 4TUYA 2K7FA 1KDTA 3EOZA 2PH3A 2FPUA 2QM8A 2R6GA 3PK0A 3BHIA 2NU9B 1DTWA 1NF2A 2FRXA 3SKXA 3TNFA 3VJKA 4BJ6A 4KTTE 4QYXA 1E5VA 4C3ZA 2W0SA 1UZMA 5HDQA 3D64A 2NUAA 4CG1A 3RRJA 4JI7B 3PR1A 3V42A 3CNBA 2IK8A 4IDGA 5TY0A 1GGHA 2BOVA 2P77A 2BGTA 2ZJOA 4L5CA 4CMAA 1EFLA 4LQDA 1OI7A 1UMKA 1Q0HA 5IKOA 2DHQA 2ZW9A 4TL8A 3SEAA 4HWTA 1QVVA 5KMGB 3SHQA 1BSVA 2IXTA 2PYIA 3TJZA 5IDXA 4YJ2A 4BBZA 3PVCA 1W59A 4ESHA 1OCEA 4OMFG 1HNWB 2HA6A 1YR2A 1NVMB 2QP4A 2AKEA 4MJ7A 1SOAA 4XDGA 1QG4A 2QRLA 1VE3A 2FPWA 1HURA 3IUSA 2HMYB 4HAVA 1E9CA 3CX3A 1PFWA 3HCNA 3AFMA 5JZOA 3K1JA 4DHWA 3O90A 4GG1A 4ZICA 2O7VA 4HQOA 1MOZA 3E2MA 4QATA 2ADOA 1P4JA 1GNPA 3EQ2A 1DRWA 4LCEA 3TLBA 4CNBA 5TEVA 4L95C 3U80A 2PH5A 1FFHA 1M5UA 1Y37A 3EZLA 3F6BX 4ZZ2A 5IJ9A 4CRWB 1KEZA 3IEIA 3DOUA 2ZG6A 3PUZA 2HK8A 3QTBA 4ER7A 1CS0B 4OGGA 2IIVA 4Q16A 1LI4A 3HI6A 3EG9A 1W85B 2HIAA 4L7VA 4UHCA 4P80A 2ZKLA 3ZZNA 1DG3A 3TXXA 1SCAA 3ZCPA 2E87A 5I7EA 1E6CA 4AY5A 3PV0A 5KCMA 1NJ8A 1ODIA 4BEBA 4TZ6A 5KNBH 1K92A 2Q8QA 1F06A 1XTPA 3R44A 3UH0A 1IVYA 1Y8ZA 4MV5A 5CT9A 1E2JA 3P4UA 2OD2A 3O2JA 2C77A 3MAAC 1Z26A 4H7DA 3VMFA 5H9WA 3ZGOA 1RCUA 3ESDA 1C9DB 1UOEA 1Q1ZA 4DV3B 3R0QA 5H81A 3JQ8A 1SJ9A 1J07A 3JQ7B 5DNYB 2PRJA 2VAWA 4FVTA 4NDZA 4DYVA 4JB2A 3BMOA 1PNVA 4HDOB 1DCFA 2Z3VA 5CT5A 1I0ZA 4F9FA 1L4NA 3PNQA 3A9WA 3HDQA 5EIWA 2WIFA 2IYVA 1FDVA 1KBOA 1EHYA 2C4KA 1C8VB 2HADA 3QHAA 5JXJA 4IIJA 5IT0A 1Y5NA 3WFZA 2Y9PB 1GGMA 2WA1A 5K7SA 1STOA 2Q2QA 4FYHA 4DJ5X 4BJ5A 4MHTA 3N2GA 3GELA 1DXYA 1MJGA 2BLLA 2P41A 3T15A 5BNIA 2UU9B 1E2NA 1MH1A 4DLXA 3IQEA 2BM0A 5A7GA 4BB9A 4JFRA 2P4UA 3FWYA 1UEIA 1GNQA 4F4JA 1Z4LA 5BYKA 3AJEA 2FDCA 3F67A 1MDFA 1USVA 1T1RA 2YBEA 1L8AA 1U8EA 2HBRA 3B60A 5C51B 1F2TA 5CM2Z 1PV4A 3OM0A 2BCGY 3RYIB 1L8OA 1DUSA 2X8BA 4PX9A 4TWIA 4EYOA 2GZ2A 5JSUA 1PJQA 4V38A 3KL4A 1TQ6A 3KSZO 1T8UA 1IN4A 1HE5A 3PC8C 3P9RA 3IR5A 1V2GA 2M32A 2GD0A 2X3UA 3I92A 3JAKA 4TQ9A 5I8ZA 2XNSA 4RA6A 5LSAA 1UT6A 3RG8A 5CFPA 3MF4A 1SBQA 1KPIA 2XYRA 1C80A 2CB9A 3LXUX 4TMYA 1RJ9A 3FB4A 4GGOA 4O25A 3WLQA 2B1QA 4QIHA 2ORED 4AJJA 2FUNB 2FNAA 4FFMA 4OQ4A 3WL4A 2AYXA 3DDZX 3JRNA 4GSLA 1WOYA 5HBRA 2PY6A 1RHJA 1I2AA 4M0MA 4NV0A 2X4IA 4D80A 1LPSA 1Z35A 1DHTA 1A9QA 1PT5A 3DBHA 1N6KA 4FNAA 2BT4A 4B9AA 2ONCA 3A0UA 4G5FA 4JS0A 4F4UA 1U4OA 5J4KA 2G6BA 4HQNA 3U16A 2GN9A 1L5YA 3KQQA 2N46A 3TQOA 4IKEA 1GGKA 4KRYA 4X7BA 4PCLA 3JD1A 5EHIA 4ZU3A 2WWIA 2JCGA 3JZFA 3L1JA 4GUDA 1XF1A 4QO8A 4C7JA 5HKOA 3WRYA 3WNCA 5LOVB 4JJ6A 3ZKAA 3ND5A 4A0FA 1D6SA 3HB5X 3AESB 5LIPA 2OESA 5HWSA 3QKTA 1TT5B 5CVDA 2NVOA 1PFUA 3HCAA 3DLHA 3OA2A 1THGA 1PL6A 3KOUA 4J0CA 4P4TA 3QE0A 5SZKB 3L9WA 5GZ3A 1XJCA 2QVYX 1FXWF 1P39A 3ILVA 3OD1A 2GKSA 2IP2A 4DA4A 5IBRA 4CKWB 3DONA 2H0AA 4LIPD 4PZ9A 3S29A 2WJIA 3FWKA 4FEAA 4IIUA 4WVLA 3TMAA 1F8FA 2XTAA 4PHHA 2BMAA 5HIJA 4C0QC 4ENTA 1TK2A 1ZGHA 4LVCA 4HAYA 4MKFA 4YRBA 5BWLA 3B36A 3FPKA 1XJWA 3PS9A 1BQEA 3ENKA 3ET5A 4RJJA 1R00A 4IY1A 4CT5A 1JQBA 4ZZ0A 4MRSA 1S8FA 1Z5VA 4UDXX 1ESEA 5KTKA 1YWGO 1Z68A 1H8EA 1KJYA 3BN3A 1NBOA 1SIBE 2B0JA 2DFKB 2C3OA 4LY6A 4WD3A 4Y2VA 1FYFA 3OT1A 1WZCA 4DLLA 2DUWA 3R6LA 4F8YA 4ZK2A 1AA6A 1N36B 2VHJA 1KH2A 3QJYA 3D8SA 4ISCA 1FU8A 4JLPA 1NHGA 1PD1A 3T34A 2JHFA 3MINA 2DH6A 1FSPA 3M6FA 1OROA 1U0SY 3C97A 2IRWA 3G88A 3GUZA 5AVVA 1NUSA 2DPMA 5HOEA 2WP0A 2W2NA 1P1HA 4J07A 1XZKA 3VDXA 4EABA 1VFPA 3KHUA 3OHPA 3X1MA 5EHZA 4AP6A 2GBGA 2RHJA 1X1AA 3IGFA 3DXZA 3UHJA 3D3QA 3LUGA 3VBEA 4UM9D 4X63A 5KYWB 2ZJ4A 1VYUA 4GLLA 4F9TA 1GZ7A 1NWHA 5IDWA 2IJGX 2H52A 4ITUA 2WIAA 3T7EA 2XOKA 2XXBA 3K0AA 2Q4OA 4X66B 2WNSA 1ODLA 1W52X 3OPVA 2HSGA 1LGYA 3F6SA 2GK7A 4TTRA 2QVZX 2IVFA 4ZDWA 2VQFB 3WK5A 4ZPJA 2ZPAA 3SYLA 4Z9XA 1GJRA 4L07A 5EUMA 3T1OA 3PX3A 1OXUA 5I9IA 3L6DA 2PUFA 4NMLA 4YMTA 1ZWKA 1G8PA 1HDCA 4AXXA 2JZCA 2Y77A 3KQKA 4UU8A 3PJDA 2HA4A 4X1OA 3I61A 2D7CA 2BBTA 1OW3B 3BSYA 1QTNA 1KIAA 1Z0DA 3LFTA 4UAJA 4XIIA 2OV3A 3CUSA 3OX3A 2NZ2A 2QT9A 4CWAA 1YB2A 1V1MA 2VCEA 4PR3A 3ROMA 4E3WA 5LYJB 1DADA 2FWNA 4X24A 5I7AA 3ANXA 1MB9A 3UMVA 1VG8A 4DBZA 4FIZA 3B52X 3ZZ1A 3ORYA 2GAAA 1V47A 5JNVA 5GONA 5LZ4A 1LW7A 2JGDA 1MAAA 1UFVA 5BN4B 1Z8DA 2FY8A 4MVCA 4OHYA 1E1RD 3P4YA 5BXQC 2OHXA 3IL2A 2PD3A 2ZRIA 2AI3A 4ZAXA 1ZICA 3CCCA 5JTUA 4X92A 3JATB 1DKLA 2C5SA 4ERXA 3T0GA 2FPLA 1SQ0A 1OFUA 1JHDA 1T2VA 1JKMA 1Y34E 1WX1A 4Q47A 2C2KA 1USWA 3B51X 1Y9DA 4F4HA 4I55F 3JS5A 1K0FA 3WY9A 1F12A 3UAGA 3GEMA 4AN1A 3F2VA 5EE5B 1X39A 2HJGA 4U2BA 3L0YA 3MS2A 4FGZA 2X3YA 4KMOA 4LOJA 1Y5MA 5MFZA 1QRRA 1GL3A 2DE0X 1OYVA 1J21A 4QODA 2R751 5FO0A 1QR2A 1QS0B 1NOKA 2EFEB 3FVWA 3JSAA 3NRJA 4G9EA 4ZQBA 4BO3A 1L3BA 5HNKA 4MVJE 3WSVA 3A1UA 3C14C 4FBGA 3QVXA 4GKAA 3TQQA 1GUYA 2FLWA 5D7NA 3VPXA 2VP9A 1HF3A 4GO1A 5EIBD 3CM0A 1IXRC 3ZHSA 1L9XA 4DQUA 4RNCA 3DL4A 1GKIA 3JVUA 3O1JC 3C5CA 3SYRA 3I83A 4E46A 2KWIA 3P27A 5EINA 1UAAA 2NTEA 1PK7A 4C4ZA 4D5GA 3ZDBA 1KVUA 1N8KA 4JN6B 4XPIA 1TYBE 1P44A 2OXCA 3AOEA 4RTSA 3GV0A 4TRJA 5HCIA 1XTTA 3VR3A 2P1DA 4DIMA 5LP6F 2YICA 3OZEA 4MA4A 2P1RA 4E2XA 1BHO1 3LQYA 3Q10A 2WJVA 1P5FA 4MR8A 3STUA 4E33A 3ZQ6A 1SG0A 2BP7B 1D4OA 1DCKA 1QV7A 1VHQA 1VJGA 2AIRA 2GZAA 2QAJA 1Z4JA 3EWSA 5IBCA 2ZRMA 1XZGA 2BGRA 3NHBA 4ESEA 4DEXA 1GARA 2PGIA 1CD5A 3IPAA 2W8BA 3MRVA 2LIVA 1GFSA 1Y5LA 2Q1XA 4Y3UA 3P0JA 4BRUA 4BY9E 1GA6A 4QX6A 2WE7A 4D43A 3VR4H 5BQOA 4DLYA 1MJ5A 1R3UA 1ORWA 3I2GA 1T3ZA 4KKVA 2YXEA 3EASA 4YAFA 4RH3A 3O26A 1WLSA 2OBYA 3D6VA 5JDIC 2ZI3A 4JL8A 2JLBA 2HGSA 2DXIA 1I80A 3D7MA 1RW4A 5T4BA 2IHBA 1BCSB 3DV9A 2HJHA 1JUDA 3S5UA 1YJQA 2C3YA 2YV4A 2XZTA 4OK5A 3ROEA 4B6PA 1FCJA 3PC6A 4LHVA 1CUGA 1ZC4A 4LOIA 4P81A 3RVSA 3ZU6A 3U3ZA 4CMBA 2CCGA 4JI3B 5JXWA 1GN8A 2VLIA 4EB8A 1PX2A 3K92A 5DM70 2DUUA 1KEVA 4L9SA 3TTTA 4CHTA 4N7JA 3TJMA 3A6JA 3BK2A 2G7MC 3GNLA 3EXAA 1W6RA 1XNGA 4GOXA 4YJGA 3T1TA 1I24A 3GDFA 1TLTA 3JYQA 4Z2YA 4CKEA 5KQMA 3ZTYA 5F4ZA 3DCYA 4RJIA 2DQKA 4RM2A 1WXDA 1XEWY 3ETEA 1AUQA 3NAZA 4YRAA 4BMZA 2GYVA 3B70A 1HT1E 4GVLA 3H5RA 2CJWA 1JVNA 2OUIA 2I5PO 4L8WB 4N40A 4XDZA 3TRKA 3V4PB 3V2UA 2P6PA 2UUAB 2AXPA 5DKFA 2WOOA 1EXWA 1O9GA 1DFHA 4JUBA 4MWSA 1KOFA 5BYAA 5FEMA 1MQ8B 4ZOEA 2R66A 1YFZA 3ZX4A 4O59O 1OGIA 2ZSHA 3CIFA 3M2PA 4PR0A 4RCZA 3DEAA 5ALJA 2BFCA 2JAWA 4LMPA 4MINA 3VOTA 3TZEA 4E5DA 4V3BA 1FL9A 2V4UA 4EI7A 1C3XA 2RCNA 3M5CA 2X1MA 4PS1A 1I01A 5BWBA 5HM6A 2OLJA 2FPMA 3R9KA 1A97A 1SC4A 2QK4A 4JC5A 3U13A 4M1MA 2CXSA 4ZVUA 2WYOA 1AQUA 4P54A 3OEHA 5JXHA 2PMKA 3K94A 1UFOA 2Q3HA 4WOJA 3SYMA 1Z0IA 3TSOA 1O95D 3AY0A 2X6QA 3PEWA 1Q1NA 1ZESA 2FQ1A 4HSEA 2O5CA 3HI4A 1EFRA 3MELA 3WC4A 2QMQA 4BKQA 2DU8A 2NN3C 4PZUA 1NQ5A 2GPAA 3N2ZB 3L0DA 3VU3A 4W8OA 4QRHA 4RIHA 4DQLA 5JISA 4B3DA 1IEWA 3KXDA 2GFQA 1FU7A 2AMVA 4W1PA 5AKGA 4ZHSA 2C42A 3H1AA 4TKUA 1Y5RA 4E2WA 5B1YA 1M54A 1MUUA 3N8IA 1OFTA 1IXYA 5I47A 3PB3A 1W4RA 1W5BA 2B7BA 4KQEA 2WYWA 2XQVA 1MVLA 1GLGA 2C58A 3DHVA 3KZOA 1IZ0A 1HMYA 2RGUA 3OQPA 3EODA 5EJMA 2ZBQA 2A9OA 1MTZA 3C87A 5TVKA 3BC1A 3BKWA 2Z8YM 1IM8A 4V3CA 3TRFA 3JQEA 3WP0A 4CLHA 5FV4A 4UCWA 1PV2A 3DE0X 1FQWA 421PA 3LLCA 3I8OA 2QGZA 4QXMA 2XCRB 3CLRD 3DOFA 1BHQ1 4AP9A 4RIEA 2HLNA 3EXHB 1RE1A 1KI4A 4HTFB 3H3JA 4BO5A 3GEDA 4EECA 4KITB 3DHNA 3PXGA 4R31A 2ZRDA 4KLZA 1Q1AA 1J0EA 1CQIB 1NN3A 3FZEA 3MN1A 4RE6A 4CEJB 1ZONA 5KQGA 4HLDA 2IOHA 3MB5A 4M0PA 2XJ4A 4G0XA 4LTNA 5JMPA 5C1IA 3WLFA 2AOUA 2OZPA 2A86A 3W5IA 1M7GA 3RT1A 4AO8A 4Q3CA 4QARA 2IF0A 3B6KA 4ZT3A 1Z18A 4TLEA 4QM7A 1FFAA 4RACA 5EFOA 4EG6A 1TJ5A 4XH9B 2QIOA 3PZRA 1GKLA 3CEPB 3BGVA 1GCAA 2DTDA 1WKCA 3IRUA 5FFNA 3EVAA 1HWYA 2NXEA 5FUQA 3GJ5A 2YWEA 3LWZA 2R7LA 4N9QA 4AQYB 2YRFA 1XZHA 3IQHX 4AJKA 4HVAA 3ZBUA 2Y1OA 2VPZA 4L57A 2RB4A 3GBVA 1VL6A 1VMAA 4MGEA 2IH4A 1PVOA 3I9NA 3BFKA 4CU2A 3SY8A 1XXHB 1D2AA 4YJ2F 2CF6A 5HUJA 1Z12A 1O89A 3JQ9A 2G5TA 3DZBA 2ZBUA 3QUTA 1Y3FE 5AKYA 4TTJA 3RTEA 4BB0A 3GDWA 3HE3A 3HJCA 3UXHA 3HVIA 5I4CA 3LT0A 3T61A 2IPLA 3TI7A 4CMEC 4RD0A 2CFRA 5F5XA 3PXCX 5ENDA 4R05A 1UPBA 3K71B 2CKDA 2WFZA 5EZSA 3ZDFA 3GNQA 5B12A 1TZ2A 4DSUA 4F60A 3KB2A 2V5AA 5IAKA 1E4EA 3WNZA 5ALPA 2XVMA 2QPAA 4Z7JA 5JMWA 3CJQA 4Y0VA 3UYKA 2W71A 1JIXA 1RFLA 4TV9A 3PC7A 3NTRA 3WWOA 1W5FA 4MW0A 3AWIA 1EHIA 4C7OA 3K72B 4ZGBA 3W8DA 4F5ZA 3NVKI 2ACEA 1P8JA 2FQQA 1VJ0A 4TT8A 4CI9A 2JGKA 2XNKA 4EA7A 4FHZA 1DWQA 3M5PA 3TJRA 3SEQA 2WVJA 1PHRA 5ADVA 3D6TB 3TQTA 4QG7A 4DLSA 2HNKA 5SICE 3Q7RA 2LIPA 1PX0A 1T29A 3WOVA 3F90A 4EHLA 3C4QA 1TIPA 1NJ6A 1XKXA 2QTCA 4D6XA 3MQ4A 4RPHA 5T5QA 4QQKA 4U6QA 1DSSG 4B3FX 4ZV4A 2J9FA 2HPHA 3NEAA 1QLJA 5E4YA 3SIWA 1D1TA 1DEKA 3DEZA 5AXAA 2AX4A 2C9YA 1BOFA 2VP2A 4U7DA 2HMVA 1IB0A 3KYCA 3HO8A 3L0CA 3N8KA 4K46A 3ZXXA 5KJCA 2JGAA 3PFCA 1F8UA 4UBJA 4UNQA 3FYCA 4IIJF 1CFZA 2B4YA 5T4FA