3SHOA

Crystal structure of rpir transcription factor from sphaerobacter thermophilus (sugar isomerase domain)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
187
structure length
186
Chain Sequence
b'DRQQLPVQVFTNDIENLNQTLNQTQPEAIEAAVEAIRADHVIVVGMGFSAAVAVFLGHGLNSLGIRTTVLTEGGSTLTITLANLRPTDLMIGVSVWRYLRDTVAALAGAAERGVPTMALTDSSVSPPARIADHVLVAATRGVGHSLSPVGLIAVVNLLLAEIAVREPERALAVLREVDRLYREQGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, RpiR family
molecule tags Transcription regulator
source organism Sphaerobacter thermophilus
publication title Crystal structure of RpiR transcription factor from Sphaerobacter thermophilus (sugar isomerase domain)
rcsb
total genus 62
structure length 186
sequence length 187
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 3shoA00
3PR3A 2VQEB 1MOQA 1TZCA 2X3YA 5IT9A 4LF5B 3I0ZA 1VIVA 4JI6B 1MORA 1U0GA 1VIMA 2CB0A 1C7RA 4DR7B 3HJBA 4M0DA 1TK9A 4DV2B 2VQFB 2UXCB 1X94A 3BCHA 2Q8NA 4DV4B 3ODPA 4JI7B 4X62B 1G98A 4LF6B 4DV0B 1XNRB 4JI5B 4AMVA 1ZZGA 5A2QA 4NXNB 2WU8A 4EM6A 1U0EA 3ETNA 4OX9B 2ZM6B 3G68A 1N32B 2UUCB 3FJ1A 4AQYB 5LMNB 2CXUA 4U6NA 1N33B 2A3NA 1HM5A 2DF8A 2I22A 4GKJB 4B3RB 2CVPA 2PUWA 3T1YB 3NBUA 1IATA 3SHOA 2CXPA 1HOXA 3Q88A 4DUYB 4LF7B 2E5LB 1TZBA 3JAMA 4JI4B 4JI8B 2XHZA 3OTOB 3CVJA 3FXAA 3IFSA 4LFAB 2CXNA 4JI1B 1J5EB 1N8TA 2V4MA 1X9IA 4S12A 1XNQB 1IBLB 1WIWA 4NXMB 1JLHA 3FF1A 2VF4X 5LMUB 2DECA 2ZJ3A 1VI5A 1M3SA 4LF9B 1B0ZA 2J6HA 2UXBB 1I94B 5I01A 1J5XA 3J80A 4X64B 1XTBA 2POCA 3J7AC 3JX9A 2AMLA 1X92A 3KNZA 1N36B 2UUBB 4JYAB 5BR8B 4JI2B 4TOIA 1NRIA 2I2WA 1IBMB 2F4VB 4LFCB 4IVNA 4X66B 4DR3B 1JEOA 1N34B 4B3MB 4JV5B 3C3JA 1U0FA 4DR2B 2O2CA 3HBAA 5FLXA 1VI6A 5LL6P 4B3TB 3M5PA 2PUTA 4S1WA 4LF4B 1IBKB 1HNWB 1T10A 1IRIA 2CXOA 4X65B 4DV7B 1XMOB 2UU9B 4B3SB 4DV5B 2XBLA 3J81A 4DV3B 2HHHB 4GKKB 5IWAB 2CXRA 2PUVA 4YY3B 4LFBB 4KHPB 3UJHA 2CXQA 1XMQB 2ZJ4A 2CXSA 1Q50A 4JI3B 2VF5X 5BY2A 1JXAA 4K0KB 3Q7IA 2UXDB 1HNXB 1KOJA 1HR0B 1HNZB 3TRJA 1GZVA 3LJKA 2CXTA 4DV1B 1GZDA 1NUHA 4DR4B 3BJZA 4DR5B 4JI0B 4LF8B 2YVAA 4LZJA 4DV6B 4DUZB 1MOSA 4DR1B 4DR6B 2O2DA 3FKJA 1FJGB 2E5FA 3EUAA 3QKIA 3TBFA 2UUAB 1JIQA 1DQRA 1X9HA 4YHHB 1C7QA 2PGIA 3T1HB 3OOJA
chains in the Genus database with same CATH superfamily
4CIVA 4FGJA 2NW6A 2Q49A 3RM3A 4P22A 2PTHA 5AKKA 1J0BA 5DRYA 1W4BA 2P69A 3ZH2A 2PS1A 3ND8A 3DEIA 2CB0A 4K03A 4DDWA 4RTRA 3BQMB 5GV8A 4IZ6A 4KXWA 2V59A 2ZRDA 2ZUUA 4RF2A 5ALMA 5AJWA 4M0LA 4L0QA 4X5OA 4ME6A 1GZUA 4Z2YA 3FOZA 1R50A 3IQXA 3EZNA 1ODJA 1KZ7B 1GN8A 3BHIA 2MU1A 4AJJA 3FSGA 3DTVB 4MI1A 5FD8A 1S3GA 2V4UA 1SCIA 3DKRA 5DWQA 4RPJA 4ETMA 3OJLA 1WMDA 4CTJA 1CUSA 1SU8A 4OX9B 3T7TA 4B3FX 4BP8A 1OUMA 1Z06A 2PH1A 2EIHA 2VCEA 3FBGA 1A82A 1NKTA 4IDAA 3CNEA 1N33B 1VYTA 1YR2A 1SVMA 4PYMA 2EKPA 5JS1A 1Z8DA 1I10A 1DC6A 1XK6A 4UBNA 5C5EA 2B78A 3K2QA 3H5LA 2CXPA 2FWMX 3IP1A 1JEQB 2FFBA 3MZ0A 3UJDA 2WG1A 2F59A 3WIUA 3BWDD 3OUUA 3ZNQA 1Y48E 4OA8A 1C3OB 3O2QB 4KSBA 3IOCA 4IIFA 4UKDA 4W8OA 3K70D 1ELOA 4GPZA 1N2IA 1DZ3A 1T9AA 2RG1A 2XMDA 3ZIUA 2RHTA 1DGQA 5BVHB 2EKZA 3DLAA 1GYQA 4JASB 1RZRA 4EZBA 3N0TA 4LF9B 3MQ4A 1OW3B 2JHCA 4OFZA 1N7GA 5FH9A 2EJUA 1T35A 1K8RA 2OV8A 5DOZA 1GRCA 1VG0B 4QICA 3CZRA 2R11A 2O50A 4BGIA 1VPEA 3IJ5A 4ZYVA 3HY6A 4NR0A 3IE0A 2OXRA 3ZV6A 3ZLTA 3V4VB 5AESA 1AKYA 2E6KA 1GGNA 3OQJA 5JRDS 2QL6A 4N40A 1EH5A 3I04M 3L0OA 2P0AA 5G40A 1X7ZA 2AG8A 5IX8A 2NXEA 2HJVA 4H3HB 3PX7A 3KJGA 2M2IA 3INNA 2A33A 3LH5A 3PUWA 1RRCA 4LE0A 2G8LA 1ZLXA 1RJFA 1WD5A 3KSZO 4XUGB 2HLDD 2QZJA 3S27A 1U7UA 4OQNA 2G25A 3O8QB 4B3SB 2D5AA 2VYND 3TEFA 3RD5A 4KREA 1KXJA 3HL4A 2BDEA 1K6JA 4MLDA 4PEVA 3EFHA 2ZYSA 3DUFA 5KMGB 2AOUB 3AO0B 3AR7A 1ZH8A 1T1IA 1SBHA 3HCEA 4OLJA 4C0QC 1CUIA 2IU6A 1JIXA 1Q0HA 1IJBA 5JPCA 4FU0A 4P83A 4ZXFA 5I7OA 1ZC4A 4R31A 5KI6A 2PIAA 1EUZA 2W2KB 4YRFA 3OQOA 1AC5A 4ZI2A 2WYWA 5CR9A 4ZD6A 2X5OA 3I8SA 5M7EA 3SLGA 3UENA 2PK3A 2C2WA 4G9EA 1WBJB 1LLFA 2IITA 1G20A 3WKBA 1U2GA 1BS9A 3BXXA 5D3KA 1OIXA 1TCVA 3ILXA 4JH0A 4DM7A 1PG0A 1NVMB 1WXIA 1XZAA 3BQ9A 3PNYA 4XUDA 2DYKA 4CTMA 4NYJR 1XJQA 1GL3A 2I34A 2P65A 2BISA 3AZOA 3F2IA 3TRKA 4A0QA 4B44A 5BUQA 1A3CA 3T5GA 2HA0A 3GFOA 1WQ3A 3HFJA 3CC8A 3GHHA 3HJCA 4R3WA 2O5RA 5D1NA 4X6YA 1S2NA 5K3SA 3T54A 3HA7A 3D8SA 4P5DA 5D5HA 3D6MA 2QV0A 5DIFA 4ZQHA 3ZLVA 3HYNA 2OO5C 3AZQA 1KAEA 3H11A 4O6VA 5KOIA 1VLLA 3VC7A 1DKRA 3DS8A 3DM5A 4OMUA 2ZE7A 3VR0A 1HE5A 2I2CA 5EJ5A 1NQOA 1M0EA 5ENVA 5HIJA 4F9EA 1ZDMA 4YCDA 4IDQA 5K0JA 4D43A 1IZ8A 4AMYA 2BPOA 3QUSA 3JQEA 3EGCA 8MHTA 4F93B 3O38A 2P6PA 5ALWA 4AJ2A 3KYBA 4MVWA 2WYIA 4TRNA 1NVDA 5LMNB 1ZINA 4KPUB 3QYAA 2JFXA 3PEWA 5G4KB 4LWQA 3JSXA 2DBQA 2QTVA 4PBTA 3DFIA 4ZQFA 1DBIA 2GPAA 1NF8A 2OUIA 2X19A 5BT8A 2DFNA 2QD5A 1DKQA 4U2KA 1X13A 2JJ1D 2CNNA 4LXQA 4YONB 4FKZA 3WP0A 2W90A 4Z4FA 3RG2A 2OTCA 4G36A 1KI4A 3U3RA 4YI3A 3PE6A 3SSMA 1XNQB 2C9DA 4PN7A 3ZDAA 4NXMB 4INPA 4BWFB 1ECPA 2WUDA 3EYAA 1NFRA 3RLFA 3PFNA 1V95A 3L77A 3P9NA 3ZWVA 5THKA 5ITZB 5LR6A 3CWCA 5EAIA 4F6CA 2WVGA 3F90A 1GY8A 2PX3A 3DR3A 1NUTA 3HXKA 4M0PA 1D2MA 1PYOA 1NFFA 2IHZA 3JX9A 4HYYA 4OK6A 4YB8A 3SN6A 3WJAA 3F5QA 1ZSYA 4B8ZA 4KO4S 4FYVA 1HEIA 1NQWA 4JHXA 3E2IA 2E87A 1C3VA 4NU6A 3ZCXA 4G09A 3S29A 2A4KA 4CLHA 2I62A 5IH7A 2MDTA 1NQVA 4ZHSA 1JQBA 2WM3A 5CBPB 5JI3E 1GTRA 3B70A 4YDQA 2PZGA 3B1XA 5FTNA 2XYPA 3NHBA 2MSWA 5GONA 3F6PA 1BTOA 1ZXXA 3HFSA 5IKMA 4ARCA 1CY4A 1N3LA 2HBYA 4CQJA 3TKLA 2X6TA 4OIMA 2NPOA 1R6XA 1IOWA 4HAOA 3EGEA 2B9EA 4KYVA 3B5IA 4YROA 4UFPA 3SQMA 2HBZA 3NTXA 5BSEA 5K8LA 3UGJA 1NSTA 2Q4DA 4MUAA 3SQXA 4LRSB 4CMHA 3FG9A 2A9FA 4ZAFA 1M1YB 1ZJ6A 4TMWA 3ZV7A 2LTAA 1SUWA 4BUZA 3ILHA 1LA2A 1BMQA 4FIDA 2JNWA 4YCMA 2YXBA 4Y9SA 3LIPA 2W2QA 4YRJA 3KQNA 4MULA 1E9FA 2NZUG 3ABSB 3QVSA 1FNMA 2WTNA 5GP1A 4L8GA 1O6CA 3CN9A 2OBXA 3KLMX 3R7DA 4O4JF 2G80A 3D5QA 1FJGB 4FXPA 2IWHA 1GKKA 4K9MA 3WAKA 1LC3A 2XKJE 2CMFA 3G1TA 3AUFA 4QBFA 4BQEA 4C7BA 3LU1A 3EMDA 4CU5A 3SZ3A 1PL0A 1G2OA 3K0AB 4I66A 1YDWA 2H4YA 3A3NA 3CV3A 4G07A 4HWOA 4ENSA 4RK6A 1USGA 1P60A 2R6R1 3K0CC 3ZXYA 1Z6XA 2OK8A 4A1FA 3KEFA 3EEQA 1S8OA 3LQQA 1BXGB 2GAAA 1U28A 2BEKA 4XJSA 4BFSA 2AJLI 3L8YA 5ALYA 2XQIA 2ZJ2A 2DHEA 1ZU4A 2QP4A 3DXFA 1H5NA 1EFRD 1QK4A 3R5XA 1OTHA 2G9VA 3LOUA 3D6AA 3G7UA 4L22A 4QUBA 1HC7A 4IUCS 1TMGE 3TZQA 1TM7E 3V1MA 4BQNA 1QONA 2R4UA 3NHYA 4Y67A 2ZM6B 1X2EA 3CF0A 4HTFA 3T34A 1LI4A 3QLUA 1ZO8A 4ARZB 4XCVA 1A5BB 2BR4A 2BVNA 2H29A 2JAQA 3GAFA 3I58A 1J33A 1RIFA 2IYQA 3NC4A 3VDRA 1LPBB 4DDTA 1OYVA 2XNHA 3RBVA 2IF2A 2P75A 3C45A 3FW1A 3LT4A 2O2EA 2XNDD 3E8SA 3N8DA 4NDAA 4RCYA 2QLBA 4EF6A 4ZOLA 2WFZA 4W5JA 4GGOA 4FDLA 1CJBA 1L5HA 2GN6A 3FUUA 1PKXA 2GTPA 2YHUA 2PSEA 5EEGA 3FF4A 3KJFA 3PJRA 3DZHA 1UMBB 2GLTA 3DO5A 4CM5A 2CV2A 2G5TA 4R2XA 1RAHA 2FN3A 5FTKA 1WUKS 2XNJA 3KHKA 4A8JA 3QG1A 4UTXA 3L7YA 4L0DA 3AKYA 3HTXA 4DUGA 5H8WA 2VHJA 1B0UA 5DE3A 4AKSA 2OGWA 4FI3F 1KTIA 5JVDA 4R68A 4F6RA 1MEOA 1CF2O 1D5CA 1NRXA 3EEBA 2NU6A 3NC0C 3UEOA 4G89A 4I19A 2CF6A 3VA7A 3DFMA 4C4SA 3ER9A 1GAEO 2VDKB 4FR5A 2FJPA 4B8YA 1JI0A 1LQ2A 2PGNA 1E7RA 3NT5A 3Q7QA 3QTLA 4AKGA 3B2NA 3I04A 4XCXA 5DBIA 3I83A 2VHCA 1NYRA 1FTSA 3R2JA 3ISTA 4YJGB 1C4WA 2NO9A 2V7WA 5LL6P 4HMOA 2FUCA 1J8YF 4IDHA 3V42A 2GZ3A 3W5IA 4W82A 4C89A 4QRHA 3UWKA 8LDHA 1R66A 4I2NA 1LRLA 2AMJA 4GI3A 5IM4F 2H16A 3PEYA 4HDRB 1MNQA 4K81B 4ZQIA 3PDJA 1D2NA 3KUCA 2WVAA 4FXOA 2R6FA 3RKUA 3STVA 3RQSA 5TF0A 5JROA 1EVEA 3I8XA 1O87A 2WWRA 4X45A 1Z45A 2I4TA 1OU0A 2L17A 1AB6A 3PD7A 4JJKA 1JQKA 1NULA 4LXTA 4RELA 2K4MA 1BRTA 4TKUA 5BSKA 4D9JA 1MXHA 4ZO7A 2BSQA 5E3IA 2JAXA 3C87A 1XZIA 3CZCA 1X19A 2H54A 2V4ZA 3C85A 3E8XA 1W52X 3ZYCA 4Q4CA 1R0XA 16PKA 1HF3A 1H9BA 1RQLA 1Y4SA 2FSIA 2F4NA 3FWKA 3L82B 3LWDA 4HRYA 4I08A 3SEZA 5TGDA 5J2TA 5FF9A 2EW8A 4IYRA 4ML3A 4UTZA 1DFIA 3SC2B 3ELWA 3DP7A 4XD7D 2JA2A 4W1RA 2AE1A 4BQRA 3LUKA 1XMJA 3QLJA 4BV3A 3OLXA 3GT4A 3DB2A 2H2FA 3PXXA 4WQMA 3DOHA 2RKOA 2VCYA 3BE6A 5H0IA 1IM5A 2ATCA 3F49S 3SZMA 3X2FA 5IMBA 4DCOA 1C7RA 2EEZA 3NLLA 1E2QA 3RSQA 4E11A 2BRUA 2ZATA 4F92B 1MEJA 4Q4HB 2VXCA 2FLWA 3U3XA 2JCVA 3WV4A 3D2CA 1WMFA 2GTIA 3AY6A 3BCHA 3QEBZ 3Q85A 4J1NA 1Q6YA 1RSZA 3W2IA 1DT5A 2IU3A 3CO0S 1F2DA 2HHAA 4CM7A 3F6RA 4R3NA 5IWCA 2PE5A 3U40A 1WNTA 1ESNA 4RMIA 3QEOA 4R98A 5I9LA 3U16A 1SEVA 3K5PA 4Q39A 3LLCA 2YNMC 5KPJA 3E61A 3JV7A 4U6NA 1QHEA 3NBAA 4QTXA 5ES4B 3TI7A 2Q5FA 4MOWA 3ZHTA 4RGYA 1WDLA 2QRPA 5C8YA 1G7TA 5JZVA 1U8YA 5EWJA 2XAUA 3C3CA 5C7IO 3GOHA 3MGCA 2EDCA 1XVLA 2XUZA 5DYTA 3C74A 1E2UA 2DHRA 2VYVA 4FGUA 1SHTX 4W5HA 3FWPA 3AI3A 3B6KA 2WHYA 5MDHA 1NF9A 5DTRA 1FMCA 1N1GA 3CVJA 3NPMA 4AF7A 1VBFA 2OMEA 4PZAA 4JHLA 5KTMA 1NN3A 1WIWA 1JF8A 4O33A 3BORA 4XWTA 1QKJA 1QUEA 1E1RD 2FEXA 4DWOA 3QPUA 2QSZA 4GNKA 4R0MA 5JCZA 2GVDC 1Q0TA 1HZJA 1EE9A 2HLHA 1L4LA 1ZH0A 3CVUA 5HMMA 4B82A 3WMFA 2A88A 3D3WB 1TO1E 4GMXA 5K8IA 1KVTA 4JELA 721PA 3RR2A 3OZTA 4NOJA 2ZVPX 3NBXX 1KJNA 3CE6A 1ZNZA 4LQLA 5BORA 1E32A 2WJGA 4LRYA 5E6UB 3WA6A 3GPLA 4FSHA 4RA6B 3FBTA 3S99A 1ZMBA 3RYCA 2XMSA 3GGDA 4ZMRA 4I4LA 1V1JA 4BFTA 1N6IA 4IHJF 1P45A 5C31A 5SZHB 4BQOA 5HKLA 3PXGA 3V80A 2D4HA 1N1EA 1HOTA 2BBOA 4D4IA 2QRKA 2QW0X 3EA4A 1G2QA 4XJVA 1JJVA 1H2AS 1INLA 3H97A 3N75A 4MZDA 1IU9A 1Z25A 2BGKA 3BB4A 1NDUA 2YRXA 3JW8A 4B9AA 1X7DA 4YMUA 1SKAA 2Q50A 1OI3A 3FKSA 4IOLA 4WBNB 2YWXA 2QM0A 1PNQA 4WJKB 4FD3A 4KXVA 3LDAA 4O2BB 3NEAA 1QCCA 5I7EA 3CSSA 3LUGA 1YQ9A 3M8KA 3RVKA 1Q1GA 1U98A 1ZXBA 3C5WP 4ZT6A 2V98A 1J25A 3W34A 2O8EB 3SBEA 3D8NA 3DT8A 1S01A 5D86A 2W70A 1A2BA 4I36A 5K45A 5FWYA 2PRJA 3OM8A 3GCWA 3O3NB 1HKHA 3K9FC 1G66A 1SCDA 2Q4OA 4O4JA 1K1EA 1EQUA 1I3OA 1N4DA 2LRHA 2N3ZA 3BWCA 5KOHB 5KQGA 4WIAA 1S2MA 4UTOA 3T5TA 2PUGA 1TRKA 4B3CA 2R3SA 3AH8A 4BUCA 3W5SA 2E5FA 3KTFA 4ZEMA 3QKIA 2HI0A 4TTTS 3GJTA 2Z83A 3B5JA 4OHXA 5TQJA 3F4KA 3VPAA 3H11B 3WLMA 5I9TA 4JBGA 5CDSA 2WU0A 1II8B 1Q0ZA 1R0WA 2AZ4A 2X76A 1EVIA 1WX1A 1Y5IA 3DPUA 4RZIA 5DOVA 1JEYB 2IZ7A 1JMKC 3BERA 3TIGA 1QVAA 2AOTA 1JHPA 2BFCB 4DVGA 3V4FA 1JBEA 1SIBE 4Z8XA 5BWMA 5CCEA 1R0ZA 3PUIA 4HVAA 3OA2A 4DAOA 3WRYC 4D9NA 1YULA 5LP6B 1XD9A 3GUCA 2PS3A 3GUZA 3H65A 3MPUA 1VHDA 4FYXA 2HSJA 1MJHA 2QW1A 3CX7A 3HADA 4EGJA 4PANA 5EZQA 4LRTB 3WHLA 2J7PD 2B0JA 3FM9A 2CNOA 2EWWA 4PS1A 3OFND 3CMCO 2ZCJA 4Q7KA 2R8BA 4L9WA 4BB9A 4DT1B 4MO2A 1KMHB 1TK2A 5BOVA 1WKCA 3Q2IA 3G5AA 3MELA 4Z54A 3SY8A 3I4CA 1I51A 3FFTA 4ZWNA 5KTKA 5MHTA 4AL4A 2PUDA 1NP7A 1ZUNA 2FPPA 4QWWA 3I9NA 1GT91 1L6RA 3QOYA 5GJCA 5DHTA 3GA7A 3U3KA 4H7PA 4K86A 5JISA 1N7JA 4HXGA 1QJCA 3OH8A 3UXHA 1RXVA 4HXFB 2FW6A 2L69A 1XTKA 5DTIA 4FOLA 1EFTA 2O7NA 1C4OA 1P2TA 2C9ZA 2G72A 3I34X 3NDPA 3FOEC 4GT1A 1QCYA 4H15A 3VVBA 5K0LA 2HHJA 1KPHA 1YQEA 2FKAA 5DGDA 5DF1A 5G1OA 4BLOA 1JNXX 2FMUA 1Z9BA 2CFRA 4FCCA 4EJMA 3I9KA 1W0KD 4OMCA 2JVJA 1Y9JA 5CBKA 1E2LA 2ZRAA 1KI3A 1RRFA 3GCGA 1QF9A 4G9GA 4TSFD 2V9CA 1UJ5A 5ER9A 2G7ZA 3S1LA 1S6YA 5JBIA 1E7QA 1V39A 4UNPA 4RJLA 1PLLA 1Y7LA 1P17A 3L8ZA 1KK2A 3VHXA 4RS4A 4AZ0B 2C29D 2XWJI 1N9ZA 2I7CA 4PVCA 4ERNA 2IS1A 3CW2A 1Q44A 5CT5A 2X41A 4ECEA 4F8JA 4LGMA 1M8GA 2QGZA 2VJKA 1UKVY 3M4YA 3M7IA 1K5GA 4KEAA 1UZMA 2AF4C 1FNCA 1GFWA 1RLUA 3DKKA 1D07A 4ZAGA 5BNFA 3RVQA 3TIVA 3PE3A 1FMFA 2A5LA 2G1UA 3TKYA 2ZWIA 1G7SA 3AT1A 5AW4A 3ZCRA 1PT6A 3RB8A 3AJ8A 1W0JD 3GZJA 1PSWA 4ER3A 5IN4A 5JNUA 4BBZA 2WUEA 2HNAA 4UNQA 3UWMA 4IR7A 5BSGA 3D64A 4AJNA 4D9HA 1X2BA 2XQVA 3H19A 5KKAA 3IQEA 2WIDA 4M9XA 4DQUA 5LMCA 2XRFA 3AL3A 4RF5A 3IO5A 5ICSA 2G06A 5B53A 1TYDE 4BO9A 4TRRA 4Y2RA 4RH1A 3BJZA 2W0SA 4EFMA 1Y42X 5BPHA 4R2IA 221PA 3W5DA 5FO1A 3PNLA 3WKDA 3W8DA 5JAOA 1DJMA 2Q9CA 2RHMA 1K66A 3HEBA 1DSSG 4XKJA 1BGWA 1JAIA 2WSBA 3R3VA 2IEZA 4D4MA 3CM0A 2PHZA 5LUAA 2GLXA 1O54A 1OBFO 1ZIXA 2ZUWA 3LF1A 4RJ2A 1OA0A 2ZRNA 4ESEA 1PVOA 1FLNA 1CV2A 5JD4A 2FFHA 2NYVA 3RV3A 5I6DA 5HE9A 5HGJA 4BUJA 3O3CA 4IXNA 1W4ZA 1WZ2A 1E20A 1MXFA 4X8MA 4KN8A 3RS7A 4IQ8A 3DHEA 2DPMA 2M9MA 2D74A 4GLOA 4KGXA 2W83A 4P54A 4R0VA 4WLVA 3UJ3X 3VU3A 4L8FA 4BOYA 4GUDA 1HT0A 4MAAA 1VGQA 1XL0A 4F9GA 2A5YB 1E1CA 4BAZA 1NXTA 4AS3A 4AMGA 1L5VA 4V3BA 4BFYA 4B4UA 1PUJA 2GQ0A 4EYEA 1UP7A 4ER0A 2WTUA 5EUQB 4BNJA 1X38A 2OFOA 4MYUA 1ACMA 5KKNB 3VU9B 2WF9A 4E09A 4MROA 2FZKA 4OFXA 3U3DA 1WHSB 2DF8A 4I99A 3BL5A 3THYA 1NRWA 1X1EA 3C6BA 4DA9A 3SI7A 4QX6A 1AS0A 4TWIA 2X8LA 4B83A 3HJUA 4F3CA 1LDNA 2WF5A 4RF3A 2RGBA 1T26A 4MINA 3RROA 1Q0UA 5A3VA 1V43A 3GOQA 2B2NA 1GUDA 3KJQA 3LWNA 2XHZA 4XVHA 4EW2A 2DKFA 2X0RA 4LJRA 1NXPA 1GSIA 1TUBB 2QRGA 4UCXA 2V4MA 4FILA 4CTOA 2WHRA 5L3SA 3HPQA 4ZVPA 2GPBA 4IMJB 2K7ZA 5BQOA 3IPXA 2V6IA 1AXEA 5AVXA 4XQCA 3CF4G 3KCNA 4WACA 4YP1A 2UZ4A 3AEQB 4XGQA 3SHTA 1P33A 4B6JA 1KEKA 5IVIA 3E22A 4QPZA 3LV8A 5KAMA 2IIBA 3T3IA 4H27A 4JYBA 4NEGA 3Q0TA 2POCA 5ECYA 1XA4A 2NO6A 5AI9A 1X92A 3RG8A 1LBIA 2ZUSA 3T5MA 1SA0B 2J6CA 4AKEA 4BC0A 1Z39A 5JPIA 5FNZA 3PTZA 3GFVA 4KQGA 4ND4A 4Y2UA 1SZCA 3GRUA 1E3WA 2ZRKA 4HDQB 4HNSA 1J09A 1F2TA 1JQJC 1YR3A 3P2JA 2JJQA 1QTNA 4GQBA 2W37A 3Q8XB 3WISA 2G09A 2QMYA 3UAVA 3K31A 1G8YA 2DQYA 1CUXA 2HEIA 1LTKA 4X7BA 3KSRA 1H5UA 1NJ1A 4TVOA 1G18A 3MMNA 1XLTA 3ETHA 5F7OA 5DM4A 1AKRA 5HJ7A 2YHBA 4MUNA 1KEPA 1OLOA 2B21A 2VJMA 4ZEXA 1F5SA 2FVYA 2MSKA 4RXUA 2NV6A 5FNVA 1JZTA 2IV2X 2AQHA 2E21A 2XUJA 1U0TA 1R5NA 1U6JA 3DDZX 4LVUA 5T3YA 3Q7IA 3DOIA 3T9FA 1EFAA 9ATCA 3I5XA 3WFZA 2ZS7A 1IZ9A 4F2DA 1IG0A 1IONA 3PIIA 4DV1B 3PNQA 1E3IA 3WIEA 3HA5A 3K0KA 1R9GA 1DAKA 2C4KA 3KU4A 5DLEA 3BWYA 1N7HA 4LJAA 2QJTA 4INJA 4W8GA 4XD7A 4Q5IA 2BHLA 5CJ2A 4EPTA 4R7GA 1IN8A 1Z74A 4RD3A 2H7YA 2WKSA 5DP2A 1AKUA 1AURA 4NENA 1KARA 1Y8RB 3B1WA 3JQBA 3VX4A 3W2EA 3GJQA 2I91A 1X87A 3NYIA 4JKIA 2QMUA 2F9MA 2BMVA 3OFJA 3MAJA 5T4HA 1LDBA 1M34A 2P2LA 1RAIA 1XMPA 5FFMA 2D62A 3LA8A 4P3XA 5IUNC 3L6UA 2EX4A 3WNZA 2JRLA 1YS6A 2A1UB 2GAIA 2ZREA 4ZT3A 3CKMA 2MSNA 1KIFA 2IDJA 2B7BA 2VJAA 3M4XA 1V4NA 2H31A 3BRCA 2VPWA 3P2KA 2OP0A 4YRSA 1E8MA 2M1ZA 3TVTA 4GZMA 3RFUA 3S1AB 1G8KA 1T5IA 1UBTS 4CLRB 2D13A 4H7IA 3G2JA 3HRKA 2C2ZA 3TMKA 1YR7A 1Y8ZA 1T2CA 4EUFA 4JITA 1ZRHA 1ODCA 2J48A 5G3YA 1YVRA 4Z9FA 4RL4A 1V71A 1NE7A 5JDIC 4KQKA 3ANXA 2QJOA 5TB5A 4R41A 4OYYA 2FDXA 2CXUA 4OI2A 2CL5A 2PXXA 4HLNA 4ZGGA 2HNBA 4B84A 3GLHE 4YECA 3N59A 3RRXA 8ATCA 3IPYA 1ZUWA 4LW8A 2YN0A 4MKRA 4KOAA 2IHBA 1FDOA 4PQYA 4PW0A 4PZLA 2PRZA 2QAJA 5AVJA 5A7FA 3CEPB 5I7RA 5U9CA 3GFBA 1A0OA 3DGFC 4OXKA 3DVAB 1DBWA 1M2NA 2AR0A 1E4OA 2VBFA 1YS1X 2Y2VA 2HV8A 2ZYWX 3G2LA 4QYIA 1MJGA 3FHTA 5IULC 4IFEA 1PAUA 1CDDA 1RPNA 1M2GA 1OLSA 4REMA 4UEJA 3IQHX 3EK2A 4MS3A 1NI5A 1NE2A 3RYIA 3S2EA 5BN5A 1B0ZA 3PVCA 4Y6SA 4O8CA 2JEOA 1UK9A 3HCBA 2BM8A 3QVGB 4C5BA 2X9NA 3KZCA 1AUVA 1XN4A 2G83A 3MJDA 3UHPA 5B1EA 5BP7A 2OV2A 3CLHA 2KYRA 5LWQA 4LTMA 2BI8A 4UHKA 2ALJA 4BNZA 3VC1A 5REQB 1F51E 3RHSA 5AW0A 3VNAA 4J4BA 4TXJA 4O3MA 1QYDA 2EU8A 2Z58A 4MTLA 4DSAA 2DR3A 2J8ZA 1VA5A 1FVFA 3TLMA 1E7WA 3LQFA 4E21A 4O8ZA 1A76A 1ORRA 1VJDA 1ULBA 4NIMA 4YS6A 4R2WA 1LSJA 3TRHA 3WZMA 4FHCA 1C3EA 3ICPA 1Q0PA 4MB6A 1DNPA 1I8TA 4ESOA 3CNNA 4K9OA 2HHHB 4C1BA 2XKKA 4Q05A 3GV0A 2C5AA 3H2JA 2Q6TA 2CXQA 4Q9JA 3P2EA 3QJYA 4ZQCB 1X77A 3A06A 4UATA 4AP6A 4CM9A 5DU2A 4LDAA 5K05A 4DDVA 3PUZA 5DX1A 1XQVA 3A6EA 2X2PA 3JRXA 5THQA 1Y1RA 2XTMA 3LX6A 5C4MA 1MABA 1K7XB 4EPXA 4D0SA 3WLKX 1DG1G 4EYKA 3ANSA 2H59A 2ZBDA 4JODA 1AOXA 1T2EA 4NY1A 5IRCD 2BCJQ 4MUBA 3WK4A 5CD9A 4CG3A 1KI7A 4F3RA 5HIIA 3TZBA 1EHYA 2VAMA 2ZJ8A 2FW8A 3TH5A 1N2JA 1L5FA 1P1FA 3E3AA 4D81A 2XMZA 3KKKA 4PRKA 3PNOA 5FHQA 4ZZ1A 1OFIA 2MJLA 2YHIB 3QIVA 4URVR 3FMFA 3D3NA 3HP7A 2QL5A 4E46A 1PYGA 4HC4A 3PXBA 5L6MB 3L40A 3ZW9A 2SECE 3MOGA 1QS0B 4NBRA 2EJVA 2G88A 1H6BA 1E89A 3KWFA 3LDGA 5LDGA 2BZSA 5DTJA 4PLPA 3BN3A 4XR9A 1EAYA 1JJBA 1YA8A 1BCSA 3FDXA 1IQ0A 1V7QA 2VRNA 3NB0A 4GMKA 1CQWA 3IVRA 4EG7A 3TTTA 2XGGA 4EG6A 1OOEA 1TF2A 1CLUA 1N8SA 1V3QE 5JZ9A 4ZXPA 1THGA 1RWKA 1CUCA 1XTQA 4BO1A 4CNBA 2C7QA 1WCV1 1V16B 2VP6A 3OE5A 1R4ZA 4TM7A 4G1UC 3IVXA 2WLTA 3I64A 4U2CA 1XF9A 5FPTA 2Q8PA 2JHAA 3I6IA 2HF9A 1MJ5A 1TLTA 1SCQA 1QH1B 2VYQA 3L92A 2BGGA 5LMZA 2OXCA 5HQ3A 1QPZA 3D2LA 4TS3A 4YP6A 4N41A 4HEHA 3ASVA 2CLSA 4NS1A 4C6TA 1ZU5A 1CUZA 3LX8A 3GCXA 4MP3A 3TJMA 4BX9A 1UBEA 3JVEA 1FLVA 3LPNA 1A8UA 3MS2A 3AVXA 1KMCA 1Z8NA 4Z4EA 1VC2A 1XDUA 4L5IA 5U4XA 3VR3D 2INGX 1TM5E 1EWVA 3GB9A 4PO8A 4Y6PA 5B58T 1N6OA 1EGVB 5J1SB 4B7AA 4A0FA 1LLCA 2QAGC 1IZYA 3WYDA 5BWLA 5DMXA 4QOIA 4N9WA 3T1YB 3GQBA 3QYJA 1QP7A 2Z3ZA 3UNXA 3DCIA 3HO6A 1R2QA 3JR7A 4G0NA 4GX5A 3JARA 1GA4A 4UUBA 5LBIA 2BHNA 4BNVA 1RCTE 5J4LA 5LUBA 4J4HA 4TGLA 1EQ2A 3GZNA 3SMQA 4BLQA 4BJ1A 2X86A 2JIDA 3GO4A 1AQIA 2X5JO 3EDQA 2VT7A 3C3PA 3G8YA 4D3DA 2JS7A 2BDUA 5KTNA 1L4FA 1XZDA 1F1JA 1Q16A 2ZWMA 1NLMA 3A10A 3SAJA 3BA1A 1ISPA 1CB7A 2G0TA 5CK4A 3T3NA 4R7ZA 1PKEA 1DG9A 5GM1A 1K8YB 3W2GA 4YMLA 1Z0SA 4DG8A 1N2OA 1TVMA 5AVSA 2BJVA 2FZLA 2R7MA 4GOND 3FJOA 3LUJA 2Q3JA 3D9QX 5LQRA 1P4HA 2I4OA 3A26A 4DMLA 2H1OA 4J0FA 1J0DA 3SE7A 2VPQA 4WY8A 2PIDA 3AHJA 3OPYI 2PAFA 5EP2A 2HJGA 2FWPA 1T6NA 2R7AA 5DPMA 1O9BA 3VOTA 4M8IA 4TZTA 4U1RA 1EDBA 5JD6A 1QLJA 2EX1A 4BGUA 2ZXUA 2KX7A 1RWOA 3QMVA 1EVKA 3PUKA 4TTPA 4QU8A 3U9LA 4AKTA 2JGDB 4OD0A 3EODA 2OC4A 2Z8YA 3IR7A 4E5UA 4D5EA 1GNRA 4WKOA 3E7FA 2QLTA 5FULA 5JD3A 5LLDA 1T9GS 3P96A 1PIWA 1RM3A 1Q3HA 1CRQA 2HXSA 2CXTA 2VQSA 1UBRS 3AW8A 3INYA 4BTVA 5K4GA 4FCTA 4GSYA 3UJ9A 4KGZA 2BHRA 2PGDA 5KYXA 2GVNA 4MEBA 1FX1A 1C3OA 2HJHA 3LXXA 1YMVA 2HA3A 2C4TA 4LSWA 5E8JA 2EEPA 3O8OB 4MV5A 2IYEA 1DJPA 1RBMA 2VTDA 4I2VA 4PHHA 4M53A 1AK9A 4GOXA 5AK3A 5BYJA 1W9HA 2RHWA 1BEZA 2ZSBA 5C1BA 2FMFA 1E1LA 4AWBA 1XP5A 3IPCA 4HGYA 4OOEA 4RCVA 3B1KA 1E69A 2VO1A 3EIQA 3FYHA 1ZVKA 3CZPA 4JLMA 4AULA 5FOTA 3V7FA 3MN1A 1K7EB 3CU5A 5G1NA 4ZI7B 4HAUA 5F2NA 4WN9A 1YDEA 3L6BA 3A1WA 4JGBA 3VO9A 3NTQA 3Q87B 1JR3E 3ZHCA 2I54A 2OCIA 3E6AA 4K40A 1YDHA 3ACBA 4R1SA 2G5PA 1P1BA 4K9NA 5CFRA 4ZTZB 5GTDA 5GAJA 1AF7A 2YOFA 1PL8A 1MH9A 1IJFA 1T36B 1XQ6A 2BKLA 3ITNA 2D5LA 4WXRA 2ESRA 3ZW8A 1EYZA 4EAQA 4RHTA 3QU5A 2UUCB 1MRSA 4G23A 3ESRA 2I9KA 4EEKA 1MC4A 2AOUA 3IBGA 3T61A 3T3HA 1EFHA 1O5OA 2BM0A 2PRKA 4HZUB 3M81A 3PXCX 4ISBA 1JLMA 1WG8A 4KO1S 3ZV5A 3RVLA 3VBEA 4E03A 1ZVVA 1CS0B 3NRCA 4UXJA 4EB3A 5I8ZA 3O2SB 2NVOA 5ENZA 5J5CA 3IEXA 1ECLA 2VP5A 4E5NA 4BB0A 4TLCA 1HRDA 2VHUA 2GUWA 2IS2A 3AB3A 4HWPA 1DZIA 2RI1A 1MJGM 3CURA 4S12A 2XE4A 1B76A 4COOA 1G5QA 2QGFA 5JXJA 1XGKA 1GIAA 1M2OA 3A1SA 3PGKA 1OILA 2XX3A 4IH1A 3EGXA 1LK5A 4MK4A 4E5YA 3NIFB 3I9V1 4PX2A 1JJIA 3VO2A 1GL9B 4WY2A 3MQ2A 5B4VA 1YWGO 1ULUA 1J2UA 4NLLA 3VR2D 2EARA 4S1VA 2P6NA 4GQAA 3DDWA 1E1MA 1S2GA 3GUVA 4JL8A 4OI4A 5B37A 2MYPA 4ZKEA 3KT0A 3OTGA 2FPOA 4WAUA 3ZWAA 1WEKA 1G5PA 2LE0A 3L1IA 3P71T 3L2OB 2VNHA 4M9ZA 4BLSA 2NZVG 3IIIA 4IOKA 3WGVA 5A0TA 1YZFA 1JS1X 4ES6A 4J2TA 5KVCA 2WMNB 4J7XA 3QIAA 3FPSA 4KNVA 5KZMB 4MWSA 2FPUA 4R8SA 2UU9B 3QE2A 3KRTA 1NX9A 4B17A 3WNQA 1GXSB 4NBVA 1ZCAA 5JG7A 1A8SA 3FFWA 3I53A 4GM4A 3Q72A 2I65A 2I1VB 5M3BA 4CV0A 4PYIA 1FSGA 3IQWA 3KZXA 2WSLA 3R9XA 2BEVB 4Z99A 4V0RA 3AR6A 4ARVA 4PYJA 3I5YA 4NCKA 1J2RA 1UWVA 2AUMA 2PMCA 4EK9A 3LP8A 3A2KA 4YLEA 1HYQA 4AC9A 3RREA 1L5MA 4PU0A 2O3QA 4KH1A 4OMDA 2ZXEA 1JV2B 5DXFA 3RSZA 3IVMA 1A7UA 2BWJA 3B1YA 1KP9A 4RADA 3SXUA 1OT5A 5LD2C 5NULA 1Y0BA 2BBSA 2CJXA 2P77A 4H4DA 4XYMA 1YQXA 1ZD3A 4ZICA 4C43A 2O59A 4RAOA 1I14A 2A1UA 3MWKA 3QV1A 1Y3FE 4RPKA 4TMZA 3RSSA 1T5TA 2JZNA 4HB2A 1MW9X 2XT6A 4I1OA 5AQEA 4PLGA 1V47A 1J7JA 1Q1AA 4G65A 1DBPA 2A5FA 3G0DA 4HQNA 4Q9KA 4DTIA 5ED4A 5IT9A 4G0WA 3SJBA 3FPBA 6REQB 4DIDA 1DKMA 4UUPA 1KQNA 1WZIA 3GRYA 1IN1A 3MFQA 4BO4A 1OAKA 1UEXC 2MYTA 4XW2A 2ZSDA 2VQ6A 3AV3A 3ZHUA 2H8KA 4P34A 2IU4A 4R51A 2WW8A 3S2YA 4FZ3A 2C5EA 2O7QA 1QHSA 3ANTA 4GOLD 4V2UA 1D09A 1KBOA 2QSYA 4FS8A 3KQOA 3CNHA 4L9SA 5FFFA 3COSA 1G3RA 3AVPA 2ACVA 5AW5A 4Y6GB 1F4PA 3QX7A 3UMGA 4LOHA 3L4BA 1KMIY 1TO6A 2IE8A 3DVAA 5KS2A 3CW9A 2B3DA 4TV8B 2PLFA 3TOCA 4EY6A 1ZCBA 1KDZA 5I7UA 1WMAA 2JLCA 2VJCA 3NBUA 1DV2A 1OLSB 5KUTA 4RS3A 3RVOA 2DFLA 4GFDA 4IF4A 3AUKA 1LRKA 3DQPA 3K96A 1MT0A 4UAJA 2ILVA 4US0R 3DHYA 4Y0VA 5GGYA 3RVJA 10MHA 1OZFA 3D7SA 1QHIA 5H3LA 3AFNA 4TLBA 1VLZA 1VHLA 2CBZA 2HZBA 3PQ3A 3GVPA 1JIUA 5B1IA 4DSTA 4ENTA 2Z30A 3IJRA 1TCCA 3RYHA 3W4JA 4GBED 4HAXA 4IW3B 1CWUA 4MR7B 4XARA 1YA6A 3GFTA 5C51B 5EIBC 4QVIA 2QE7A 5CFLA 9LDBA 4PG7A 1JVNA 2W2LD 5C52B 2HMUA 1H2EA 2E6UX 3A9WA 4KV7A 4X3CA 1YZVA 1JBQA 1Y5MA 1IVYA 2YH2A 3TQHA 1FFBA 1UJBA 3RYFA 3L8GA 1U4NA 2IY9A 3BMNB 1FSZA 5KHAA 3R7AA 4EITA 1BH2A 1EJ2A 1W5AA 4LJYA 5ADUS 1T3GA 2CHUA 2IOFA 3GPBA 3JY6A 3ND6A 4V2IA 4GI1A 5CIQA 3CH4B 1E2NA 3A11A 2DEUA 2W42A 4DDKA 1YJXA 4JYMA 4LI0A 1BDHA 5UKDA 1CR2A 1ZZEA 2OCBA 3ZXUB 4F0JA 1E9SA 1RLTA 2AR7A 1R7RA 3K32A 4X1YA 1PWYE 4HYQA 1U63A 1AQ6A 3KOOA 3QE0A 1K0UA 3CNOA 2PL1A 1TKRA 2ZR8A 3HU5A 3GBPA 3I37X 4KI0A 4C30A 3W8NA 1XLWA 1ZH4A 3CVOA 4HTAA 2QR5A 1Q19A 1BXZA 4Z2AA 1ZHHA 1PGNA 4I8DA 4HEA1 4PCLA 4V38A 5BV2P 3TG8A 3C1OA 1EK0A 1YSCA 1V7CA 2C20A 4HPWA 2O19A 1G20E 4HD8A 3KU1A 2NNWB 3VM6A 2UXDB 3SIPA 1PDWA 5B4TA 2DERA 2GX6A 3HDJA 2ZFUA 2NPIA 5KYKA 3ZTYA 4IX9A 1ILWA 1BDBA 3MWDB 5T7BA 4WJLA 3ZDCA 1C41A 4S04A 3HBLA 1HT3A 1CEQA 1H1LB 3N5KA 3LXRA 5A5GA 3ZH9B 1RMYA 4JOSA 2GGSA 1PEYA 4RHXA 3SF8A 3T3MB 4R4JA 1TLFA 2QXTA 3L3BA 1KYZA 3L0SA 4GR5A 3IILA 3DE4X 5ECWA 4DR1B 2ZEJA 3O90A 1NX6A 3UA4A 5EIEA 5E7MA 4QU0A 4HMQA 1IPFA 2FU5C 1H1DA 2W6JA 4U2DA 1K0FA 1TUGA 4TXLA 5P21A 4TYYA 1YB5A 4ARUA 4D0NA 4F1KA 4E2ZA 2DUWA 2UKDA 5KYNA 2JHGA 5CYPA 2Z6UA 4I1YA 1OZ0A 3UWOA 5DYWA 5ALJA 1XCGB 4BU1A 2R66A 2WMOB 4OHRA 5DNAA 1NQTA 4JT9A 1X80B 3ESCA 1AV6A 3HCOA 3UGTA 4OAQA 1U7HA 1E2BA 5H02A 2VI5A 3JQGA 1FE8A 1GGEA 2VWPA 1B6SA 4JU8A 3A3YA 4DV4B 1MQ9A 4FW8A 5KCZA 2LD4A 1ISGA 1WVGA 4WKCA 4Y1EA 3VV2A 1RWPA 2EP7A 3LTEA 2O7SA 3ZDYB 4TQUS 3TD9A 1NW3A 2GRAA 2Z43A 2X40A 3PKIA 3PGLA 5L4LA 4Z4IA 1PR4A 1PU2A 2VUTA 3EPRA 4J0DA 2PKXA 2FJ0A 1R0SA 1SQ5A 1W29A 2EBHX 2I55A 2YMLA 3W5BA 3PDIA 4IDBA 3BD9A 2HSWA 4R69A 5F23A 5JZMA 5AVUA 3E9RA 3O47A 3ZUGA 4D3XA 2XWPA 3RFCA 1J9GA 1GG5A 2V58A 1G9XA 3W6OA 4HVTA 2Q45A 4E3ZA 1CX9B 3KWLA 2PJRA 3AFIA 4JXXA 4ZAWA 3AETB 1LK0A 2OG2A 3H13A 1R0KA 4GPAA 2RHOA 3K70C 5CVVA 1Z35A 1L1FA 1YZHA 2QD3A 4N5MA 1WQ4A 4ZVVA 3M5DA 3M6MD 5AWFC 3EEFA 5JSKA 2QE6A 3DOUA 3OA0A 4F2GA 3B89A 4M38A 1JVBA 3VPDA 1OPXA 4Q93A 2OHJA 4MVJM 2FPXA 1YBAA 2C61A 1E4EB 4AICA 1OLUA 1YCGA 1U6KA 1KZGB 2XF8A 3B7WA 3TECE 2WVJA 1A8PA 4IY1A 2GCPA 3SMVA 1RACA 4EWLA 1SH7A 2WZBA 3G2HA 1N4AA 5K01A 1CEEA 3OT1A 1UQUA 3D4LA 3GLGA 3KPJA 2PMDA 5K9ZA 1KTVA 2XQJA 2O2CA 2FQXA 1Z0FA 3FZGA 4C0SA 3QE9Y 1GSHA 2PS9A 3NUGA 1YBVA 4DA0A 3E05A 4GI2A 1BCRB 4G8BA 2J9RA 2YL2A 2JFHA 1HLDA 3KFXA 2A5GA 2LCFA 3KR0A 5DW0A 3VR6H 1XTPA 4KVGA 2SBTA 1T8YA 1VDZA 2PMKA 4RLFA 1BROA 4D3FA 1N2ZA 3OX2A 2OT3B 2GN9A 3JATA 4GMDA 4I46A 1RI2A 3BMCB 5IF9A 3RWOA 1T25A 2B4AA 3OP1A 2NVWA 2C7VA 3SXJA 1BGVA 1ZJYA 1W1UA 4OHFA 1IN6A 2GYVA 2QRZA 5DYIA 3VRHA 2Z2KA 3VVMA 2TYSB 4BV2A 2E9SA 4UEWA 1MPXA 1RAGA 3T52A 2JIQA 2AZMA 3X2SA 1FX0A 1G5TA 5KYYA 1FJXA 1E5VA 3CCBA 5DNEA 5K7SA 1LBQA 4RF4A 3U09A 1UBKS 1GG2A 2F48A 2IIPA 5B1YA 4AJ4A 2C2YA 2QS9A 2OBFA 1X86B 3CWQA 3HV0A 3U7FB 2YIVX 1T1JA 2GEUA 2CZCA 3ZZUA 1VE7A 5DHUA 1H4SA 1HYGA 2WHXA 1U2EA 3UAOA 3ZI0A 4IH4A 4RZSA 3BH6A 4GICA 4OGLA 1E63A 1MOQA 2P8SA 4BVBA 3L41A 1G9TA 1TU3A 2PKRA 3FPKA 1VIVA 1LS6A 2RHDA 4LVOA 4YUVA 3WYNA 4F1WA 3CH7A 4M9UA 1E2EA 3GRKA 3DHWC 3O5AA 4UMFA 1ZGZA 5AK5A 4N6OA 4IO0A 3AIOA 5F35A 4RD1A 4E51A 5CA1A 1G8FA 3ENQA 1TA0A 5F1YA 5ESWA 3ZGVA 4ETWA 4YACA 5JNWA 1LV8A 3NVMB 1J70A 2YVLA 4XDGA 3ANMA 3SBDA 1XRMA 2VJOA 4YJ3A 2QX6A 3LKBA 4EY3A 3DNMA 4P7GA 1JR6A 4YMVA 5KEIA 1ACJA 1IBSA 1Y6FA 4WVLA 2EERA 1GTL1 1SIOA 4LF8B 4N7JA 1R6TA 3DJYA 1T8PA 1B2RA 3PQ5A 3PGXA 4HV4A 4L15A 4RTLA 1REQB 2QQFA 3AUSA 2GRJA 3PFGA 3GR6A 4UASA 4OB6A 3A0RB 1JQAA 3BULA 5DSXA 2VTVA 2FUNB 1S3SA 3LVBA 2C3UA 3WLFA 2BFBB 2CVZA 4NSNA 4ZZ2A 1H2XA 2V9PA 2XZDA 1TQDA 4NFLA 2AOXA 1NF3A 1PQ4A 4NK5A 1LF0A 1CEYA 4AMUA 2IXTA 2GJ8A 4EIWA 4XSHA 3G1WA 7MHTA 2BL4A 2C57A 1LDGA 1P5RA 3DBRB 2A2ZA 2XUAA 3UV3A 1XWFA 1K86A 2OKCA 2QN8A 2ZRBA 3H5WA 3K0FA 4TMXA 3ANNA 4WCDA 3A32A 5BQ5A 3TYXA 4EYSA 4D9CA 3K9HA 5BSWA 3NETA 1PJAA 2XPCA 4QPNA 3T6KA 1AM4D 3OQVA 3EARA 4WPGA 2X6QA 2XOEA 4G4SP 4Z1MD 3G7NA 4TT8A 5IXJA 3M33A 4C76A 4KQXA 3IEVA 1RU3A 1PWXA 3GNLA 1VLJA 3Q7PA 4IL5A 1DS6A 1QHFA 2JLSA 1LJ8A 4PHGA 1QC5B 4HDMB 4PYQA 4ZAVA 3QKWA 4HEA6 1PFGA 2CGEA 2YOGA 1CNEA 1R5BA 2B35A 4Y8VA 5EJ2A 3PWTA 4MO9A 4MWZA 4QGBA 1THTA 3JSAA 1KJ8A 5BQXA 2DCMA 3IQZA 3NI2A 3HXMA 2J32A 1DOAA 1HQCA 2V7UA 1KFKB 2GKOA 2QT9A 3EIUA 4R2MA 3SDSA 3T4EA 3UAXA 4TV9F 1E2GA 1S02A 1JDVA 4B3IA 3JYQA 4BN0A 1QO0D 4ZO4A 3DPSA 2UYYA 4ALLA 1U3CA 1C5KA 4G56A 3AIIA 3HH8A 2V7QD 2IH4A 2AI1A 4C2UA 2F8SA 1SXJA 1TUIA 3I76A 1THMA 2V7BA 2Y9PB 3P9RA 4E3WA 1D1QA 1BRMA 1FFGA 3HB9A 1CCWA 4WZAB 4H4CA 2E4ZA 3B3FA 3TLBA 3S2GA 4DLZA 1YQGA 1XRNA 2IDZA 3P9ZA 1YRWA 3RVSA 4NCJA 3JYOA 3JQ8B 1PX2A 2NT3A 1E6MA 3C7AA 1XXHE 1VMIA 3P4YA 4FJ0A 3L1HA 1JH9A 2JHPA 3WOVA 3P8ZA 3J7TA 1IY1A 1G5RA 3SQLA 3K6SB 3OLWA 2YBDA 3B12A 1PZXA 2HCJB 4MQEB 4ZJUA 2FCRA 3GRAA 4GX0A 4LDPA 4YBRA 3JTMA 3LXUX 3MT8A 4TKVA 3BSYA 5DNWA 5KDDA 3P45A 2Z1NA 5K0EA 7MDHA 2OZLA 4RV5A 1ZFNA 5U1PA 1U0GA 4AB1A 1EU1A 2AGVA 3LT5A 4XASA 2RSLA 1GFZA 4YCSA 4I8IA 3TLZA 2P67A 2XBMA 5H9VA 3GPDG 4H2DA 2PUJA 3K6KA 1CP2A 3OEED 1H1TA 1ZCFA 4OBXA 5DI3A 5JSQA 3OHSX 3LOQA 5I4CA 3H9JA 3DVQX 2XLCA 2WT9A 2QROA 2IV3A 4JSYA 3E9NA 3PHIA 4JLKA 4K9SA 3VZCA 4CMGA 3DF7A 5D5PA 4AUMA 3QWAA 2PMFA 2XVMA 2H4HA 3I5UA 2M32A 4MW5A 3ROGA 3LCRA 4IGAA 3TB6A 4P31A 4BNHA 5HCIA 2CBGA 4NBLA 4J0GA 4YT8A 1KGSA 1SQSA 5CT8A 1RYBA 1LCIA 3G5LA 5H3CA 4D8XA 3GDFA 1JYSA 4EGCB 1W5EA 4J7CA 1KEEA 5E9WA 1QU2A 2MTBA 4KUEA 4U8GA 1H22A 1CC1S 5SZJA 1RKXA 5F7ZA 1NM5C 2VJLA 4YFVA 1ES9A 3F8TA 4RPLA 4KXQA 4XYLA 5I5EA 2ZYDA 4IIYA 1JPVA 2H2DA 3VYVA 3Q5GA 2A9RA 2JPDA 4WSOA 3AXSA 5EUBA 2ZJ5A 2XMBA 4HQOA 4F04A 3OWHA 4PXSA 1JHAA 1KQ3A 1E6KA 4BN5A 3F4LA 2HCFA 5J63A 3JASA 3IIMA 2Z08A 1EVZA 1H93A 5IU6A 4CN8A 1RPAA 2P0YA 4J3JA 5CM8B 2FN7A 2J59A 2O1EA 4JT2A 1U81A 4HDKB 1ZK2A 3FTCA 3LW8A 4G2TA 4BLTA 5EOVA 4X64B 3E53A 4K1LA 4PC6A 4QDZA 4A82A 4EAAA 3CONA 5LYYA 5K8UA 3UMMA 1QQ6A 4AYTA 3V8RA 3CUUA 2A9QA 3MLAA 1MHPA 3EG9B 4L51A 4TXHA 2NVUB 5EUCA 4KX3A 4ZDIA 5JIBA 3UANA 1VL8A 1USWA 2VJQA 2J0EA 2FW7A 2YWHA 4LCJA 1W76A 4OM8A 3RO7A 3KQLA 1SXJD 3ZXSA 1D0IA 3ETGA 2YDYA 3WX0A 4JV5B 1WCWA 1LI7A 1WCYA 4DWJA 1JSXA 1JDZA 4S1WA 4EGQA 2B3TA 5AUOB 1A9XA 4QASA 5G0VA 4DCCA 5B30A 1KDPA 3HYRA 1C9KA 3IQFA 3ZQUA 3DEJA 4XWKA 2Q2NA 4OGKA 5KNBD 1SXJE 3GF4A 4MR8B 1R4AA 2OVBA 4EY7A 4Z4CA 2YZGA 1C81A 1U7TA 4XLTA 2XBUA 3JWEA 4HBGA 1WPGA 1YJ5A 3EMKA 4KOEC 3BK2A 1JXAA 1Q92A 1OR8A 5TPWA 4MHSA 3S5JA 3VQTA 5ELXA 5BWCA 1M6EX 1KOJA 1U4SA 2PZBA 4PF1A 1TM4E 1IY2A 4MPPA 5K4AA 1WVMA 4JLBA 1DOHA 2Z5GA 3H0CA 2OCDA 5FV4A 2PH3A 3HYLA 4YRRA 4F60A 4F71A 3QUBA 1G63A 2QVLA 4D6XA 4E5SA 3IAAA 2BFEA 5LQJA 3LBAA 2Q07A 3PC8A 1KK1A 2JAOA 2IOFK 1OX5A 4XB1A 4YWHA 4F11A 5HM6A 4NMXB 5C8XA 3TZHA 1Z7EA 2R47A 2W2KA 3C6XA 3PWSA 3V4PB 4MNTA 1QF6A 1PT5A 3ENWA 5H80A 4CPDA 1JR4A 4DCMA 1XDZA 3BIOA 4NDZA 3ZBUA 4QM6A 1Q5PA 2X3YA 2ZIWB 3GRVA 3EJ6A 2ERYA 1L5RA 4MA5A 3GLTA 4JQSA 2UVPB 1L7NA 1R6BX 3IAFA 1SQGA 4MRPA 4HUJA 4NONA 2JIBA 2A8YA 2QZ9A 1F2TB 3ROFA 4A27A 4B31A 1USIA 2VTEA 3FLEA 4DCUA 3T5BA 2YV5A 4Y7DA 1H9CA 3AWDA 2FY8A 3V7WA 3OE7A 4ALKA 1ZX1A 3M6UA 1ZOOA 4IJMA 3JQ9A 1KO7A 1QR6A 2O5VA 2AJTA 1DINA 3JWHA 2WU8A 4MKIA 2AG0A 1ZA1A 2C4UA 3CUEF 4LNUA 5HG0A 3H5RA 5K3DA 1BWSA 2HFKA 4FFNA 4KDEA 5LIPA 2XTNA 5L3QB 4J90A 3CVWA 4G0UA 1DKOA 2O23A 3ME5A 2RDMA 4DLYA 2JLZA 1PJLA 1RXSA 2QRQA 3CRQA 4HDOB 4G1MB 2P6OA 5BQPA 4CQMB 2VATA 2VP0A 1AZSC 4DUYB 3Q4GA 2C7PA 4L5JA 1ATZA 4LQDA 2W6PA 1XDDA 2ETVA 2I03A 2G71A 2JD1A 3FGPA 1Y7TA 4BVAA 3FUCA 5A3QA 1V6CA 2G4VA 5FL7D 4C3UA 3VPHA 5CJPA 3L8DA 3T99A 5K4HA 5AD1A 2F3SA 4DA8A 4DUGD 5KO2A 2WPDD 2UZ1A 2VPXA 3GJZA 2JIMA 3IUNA 5SY6A 4RH3A 1EG2A 3CTMA 2WJZB 3EHEA 3FPCA 3EAFA 1JDBB 3QF4B 2XYGA 2XF2A 3TLGB 2P3QA 1B8VA 2VDWB 1IWOA 5HCNA 1J39A 1BVRA 2QG4A 3ZIDA 5DWVA 1R1DA 2ZPAA 4Q9LA 1I33A 4FBMA 4WXHA 1LX7A 5CPFA 2J4CA 4LMPA 4ZYZA 4V1CA 3CVYA 1BCRA 1EDZA 2J3KA 3ISVA 4KLZA 4QOHA 3WO0A 3UOAB 3L7KA 3E9YA 2ZK7A 4RW0A 2G6BA 3DAFA 4FFBB 4I9UA 1WOYA 1L4KA 1EUQA 1ZJ4A 1FUIA 2BKXA 3H4MA 2TMGA 2EZ9A 3OPYA 3QLEA 5IARA 2FSFA 1BWRA 5DYGA 5IMSA 1JDUA 4NOKA 1A27A 1LV7A 5JSZA 1Y4AE 4HB3A 4YY3B 4BX2A 3Q6IA 1GDDA 2GNPA 3WSVA 3AF1A 4R54A 5LP6C 4DYDA 4GWKA 4IBOA 3GJ6A 3MSXA 2ZM5A 3EIHA 1K92A 1PG5A 4MKHA 1D03A 2E4WA 2H0RA 1WAMA 2ZBEA 4B73A 1V5IA 3SM9A 2O1SA 4BX0A 5BRAA 2YJTD 4MYHA 2O2ZA 1ZA2A 2XI4A 4CEHA 4ZCIA 1Y4UA 3U44A 4KR3A 4MVCA 4XQ9A 1C1HA 3JU3A 3CEAA 3RGGA 4KAAA 1KI6B 2WVHA 4FB4A 1H2FA 5KYGA 3FCOA 5L51A 4D26A 1OBCA 2BEWA 1ENYA 5KVQA 4QU5A 1A9PA 1R5OA 3WQSB 3WWDA 3WMWA 3LHSA 2NUPB 3O3MB 4LCEA 1BMTA 3O8DA 4WINA 3LFUA 1DQZA 1ZP6A 3UKDA 3O7WA 1P5FA 1VL0A 2V8BA 1XEXB 2JI7A 4RHCA 1JH8A 1L4BA 4UVHA 1V4VA 3K9CA 4KZKA 1R64A 3RE1A 3EASA 1GNPA 1G0OA 3TZEA 3WXMA 4A4DA 4BASA 3RC2A 1OX6A 3TNFA 3CZ5A 4C7MA 4YJ3B 5BUCA 5IP5A 4RIIA 1KWKA 4H1HA 3AINA 1L3IA 4RTPA 3T3DA 3K0AA 2DWOA 4TMVA 5JEEA 4G5SA 3UKJA 4FUTA 4W1PA 3I2IA 3TDMA 4KXYA 5TVKA 3WRWA 3DUWA 3G0OA 3MMSA 1ITZA 3CF4A 1RE0A 2JCXA 3ONVA 3MHPA 5H1YA 2VBIA 2V6BA 1BXGA 5HM8A 4CQLB 3RTAA 1OFTA 4J4TA 4MJXA 1R37A 4LHWA 2REQB 3QBJA 2EQAA 2JJ2D 3U0BA 4A91A 2H2WA 1HZZA 1BAPA 1LNSA 2XEDA 5HS6A 3S70A 4D9KA 1QPBA 5A9RA 2HMVA 4LV8B 4N3AA 1KR5A 1Z36A 4NBKA 3F7MA 5KQMA 4D7AA 1SXPA 1TZBA 4HNHA 5AUQA 4PINA 5HNKA 2ZRCA 4RX1A 1RI4A 4OHCA 1JHVA 4JUIA 4GOMD 4B79A 3F78A 1KH3A 3WMGA 1O94A 4BRSA 5HR5A 4POAA 1OH8A 3FX2A 5A9SB 1K4MA 1C1XB 3E2MA 3HUTA 1TU0A 3LVRE 1KZHA 1XK7A 3BK7A 2FEKA 4D96A 5ISMA 5KJFA 4DMCA 4OLHA 1RWNA 1TEVA 2R1TA 2PYZA 4UM5A 1R9NA 3CLRC 4WNAA 1M6VB 2W98A 4L5CA 3ZZTA 3AQ4A 3GIDA 4EMBA 3EBLA 4I5FA 4OP2A 2OHFA 3FZQA 2IF0A 3VYTB 1YZYA 4B6RA 1H5QA 2WICA 3GEPA 4GGPA 4DABA 2H4WA 5AW7A 1T1RA 2AN4A 5LDHA 1BS1A 1NWHA 1UL1X 3W3AH 2YIJA 3BXOA 2XXAB 1QH1A 2QUAA 4L2IA 4FSDA 1HH4A 3O4VA 1ECCA 3H9CA 3VU8A 4CMEC 3LDUA 5EVJA 1MQ8B 1TUEA 4UFOA 1HQYE 1BFKA 2X8JB 1UOPA 3HLYA 2LIPA 3QWHA 1E59A 1ZK4A 3NBMA 1G6Q1 2CHGA 3EVFA 5ALTA 3WOHA 2QVGA 3BJIC 1UBCA 5I7SA 2HMSA 1E5DA 2RGDA 4JS0A 4Q6WA 4XPZA 3BAFA 5ADWA 1Z63A 2OSVA 4UAVA 2R00C 2VP9A 2XQKA 1U7PA 3OC6A 4GNRA 4MWCA 4NHEA 4RPHA 2BTOA 3USZA 1Q7RA 3ZD8A 3JARB 3BFVA 3ONNA 2IYUA 3IUSA 1A2QA 2BKVA 3L04A 1VZ2A 1AS2A 4GH5A 4IIGA 4R81A 4DJJA 1MN6A 4BFLA 1LPMA 1SVIA 1I5OA 4TKUB 1ODFA 1XXLA 4XR4A 3A3PA 2JKVA 5KVSA 3HG7A 3M2PA 3R6GA 1XCBA 2CB9A 4I14A 2GO1A 1APBA 2IBTA 3GJ3A 1N78A 3A58B 3KTAA 3LFHA 3AHIA 1O1YA 1Z62A 1K89A 3CE9A 2W6CX 2PO5A 5BWOA 1ZK1A 2OR3A 4YGYA 4TTRA 2WU1A 2C99A 2XWQA 2XVAA 4OU4A 1OXXK 3KLOA 3N7AA 4NE9A 3SPXA 1ZJWA 4GOKA 3HJBA 3LUPA 5KWJA 3H5TA 1XVUA 3Q6NA 4FNAA 1CRPA 3CISA 4G5YA 3PDHA 2PT9A 1X1AA 3MMXA 1RQRA 2H4XA 3NIBA 4EG1A 3ND5A 3ED1A 2ZQZA 2Z2IA 1GLGA 3RIYA 2PWYA 3FWYA 3H8SA 4WZBA 3HCWA 1XTTA 3U4HA 4ZGBA 2QQ0A 3JD0A 5EJ8A 3IL2A 4DLLA 1TF5A 3E3MA 1EP1B 2KQUA 4PLFA 1WXHA 4Q4HA 5E7JA 5HUQA 2RAUA 3BS4A 1L9KA 5JNSA 2O8DB 3IMFA 3O26A 1H3NA 2D59A 3HA3A 4JY7A 1BDMA 4ROTA 1NI4A 2WF7A 2IODA 1OROA 1XSEA 1PZEA 4XPIA 5ELMA 3IGFA 1JA1A 1ZD9A 2RAPA 3MBIA 3EPPA 3NBZC 4DMKA 4CF7A 4HH0A 2HWWA 5J2TF 5JAPA 2FWIA 8GPBA 1C50A 1MX5A 1YT5A 1WLYA 4YBZA 4UTPA 1IIRA 1IE3A 2WT8A 4EBFA 4WMLA 3L4KA 5JRJA 2A67A 2ZTHA 1DIRA 1K2VN 3QX8A 1EXMA 3CJRA 2LUOA 2F3QA 3EVTA 5EWJB 4Z3DA 2E0IA 2XTZA 1JHRA 1XZGA 3HKEA 3QPVA 3U1TA 4N5LA 4MGHA 4CXMA 3DLHA 3W8FA 1P19A 2WA1A 4RA6A 1RYMA 3F7NA 4RTJA 4I6EA 1UBJS 3I9OA 4KQFA 2RGRA 1ZGJA 1H6AA 1X3LA 3BWXA 4ZRDA 5FLEX 2HA5A 3L6DA 5A4JA 5LJIA 2D06A 1G2PA 4WN9B 2JBWA 3CKYA 3E5NA 3TTUA 4LQ4A 3ROXA 2FWAA 1BZYA 2J7PA 4IFBA 4H7JA 2BGMA 2HA2A 1DEKA 2G67A 1J7KA 1NBME 2AYYA 2NAPA 3L7BA 3B8EA 4HUQB 4CRWB 4N5DA 5HW0A 4FX5A 1BC5A 1MX3A 1XI2A 3OD5A 4FQ5A 3RAGA 4B34A 2H1HA 2ZSUA 5CM2Z 5EYPB 4MDEA 3TTVA 3CG0A 1AKWA 2HN9A 1VPWA 1OLXB 2D0OB 3LHDA 4RSMA 4KBYA 1MEEA 2HX1A 2QD1A 1NPDA 3UA3A 3EOBI 3UJHA 1DKPA 1OBVA 2JDID 5F21A 3WTBA 3ZWOA 5A05A 4EHBA 3GXOA 5JY1A 4EKYA 5CXUA 1VDMA 3R0ZA 1V3TA 4K8OA 1BW9A 4L5AA 1WEHA 3LUBA 4L7VA 4R40A 1QZ3A 4ZVTA 3RFFA 1KZYC 2PM8A 3G6KA 1M74A 5K6AC 4LDZA 2FQQA 3ESDA 4CT0A 5KBYA 4EVSA 1O9GA 1GZ5A 3LSYA 1FXWF 2O20A 1JHYA 1X7XB 3L8MA 3K35A 4QVGA 1F6BA 1HE1C 3AR2A 3HYTA 4R8LA 3WSWA 5F51A 2B69A 4UU7A 5IZCA 1IULA 1R9JA 2WUWE 4G37A 1SKBA 3HU1A 4DR6B 1QF7A 5D3MB 3PKJA 3HUDA 3WVNA 4YAGA 1NW5A 4RYLA 3GRRA 4MV7A 3LFTA 4PO9A 1WWKA 4YJFA 3EGVA 1YACA 1U0SY 1YFLA 4MGZR 3NEYA 2XCRB 1YI8A 3C97A 1T91A 1XHEA 3DCYA 1LBEA 1VA4A 1I4OA 1V48A 4IILA 5IFKA 3KYIB 1XJCA 3W9SA 1X1TA 4DA4A 2CL6X 3EYWA 4G1EB 1R4MA 4PLHA 2OFWA 4DNPA 5EE3A 1BGXT 1C7ZA 4AROA 4IHJB 3R8FA 4MW2A 1BD3A 2BC9A 4LXIA 5HDQA 3G89A 3PYLA 4YRCA 2J0UA 5E6SB 3VR5H 3KHTA 4CV1A 4P4GA 4YREA 3FLBA 4CWAA 4CT5A 1CF4A 2JB9A 2WJHA 3CF6R 3KJHA 3KZNA 1GZSA 1QVZA 4QTYA 5D7BA 1RBQA 1UQTA 4MQFB 4FC7A 1DTSA 1T6BY 2YWEA 4WX2B 5FBRB 1PTKA 2WSMA 5K09A 1RKQA 1M1UA 4FMBB 1T3LA 1RAAA 1QH8B 3DR5A 1YI0A 5TRTA 3P2MA 3ZCPA 1HDGO 2YFHA 3MT9A 2DX7A 3KOYA 4FCWA 3WRXA 3U4AA 3BJRA 1YHNA 2QG6A 4J07A 4IVPA 3EQ8A 3KKMA 2Q41A 2GK7A 1JKIA 1DRKA 3G0IA 3PPXA 5FYDA 5ICMA 1CZLA 1S9HA 1YS4A 5NLLA 4IWYA 3ZQ4A 4R8VA 3HEMA 1HT2E 1F06A 5JFTA 4BATA 5EQJB 3NMUF 3NX4A 2HRCA 3OE1A 3QW4B 2BUBA 4KQIA 5TLSA 5DTQA 3UK0A 3VJKA 1Q2XA 2VCHA 3N2GB 3ZBTA 1UFVA 1AKQA 4EPVA 1C0EA 2Q5EA 4I4TA 2AE2A 3OWXA 3QEMB 1FTWA 2WKPA 1JXOA 2AJDA 2GXUA 1ISMA 3M5CA 1XEFA 2CEAA 4GM0A 3L6OO 3VAAA 4PHCA 3UT0A 3U61B 3T9BA 3MUNA 4PFQA 2Q7XA 2GA8A 2FPLA 2X15A 4WK2B 3SEAA 1C9MA 1ILEA 4Q03A 2WV9A 4RY8A 1OJ7A 5GQSA 1ESMA 1Z6QA 2JD2A 3KKZA 2NZYA 3N3AC 4BRWA 1D2AA 4H18A 3A6DA 4MRVA 4Q00A 4CE6A 2GYYA 4JP1A 3C6KA 3KHSA 2DOKA 2EQ5A 4YRQA 3FMVA 3OZIA 4NJMA 2YYZA 4WOCA 3TL2A 3F9IA 4G85A 2CLHB 1FVXA 3TTYA 2XGOA 1JPNA 4C0WA 1UDWA 3Q98A 4PG6A 4EHNA 1TI7A 2EF0A 2RHGB 5KDOA 3T3OA 1JLKA 1K5PA 2OYSA 3LKZA 4CM4A 4D97A 3UT5B 1TEZA 1IZZA 3WGJA 3B3QA 2A5DA 3OTQA 4LRUA 4TV8A 2C7OA 3COWA 4PRZA 1NMXA 4H31A 4QATA 1U8TA 2PD6A 3IVGA 1PZGA 1MVLA 2FPGA 4YAOA 5EJMA 1M1XB 2GH1A 4GRIA 2R0QC 1VSQA 2PSSA 3A37A 4KWIA 1XOIA 3DYIA 5JAZA 4EX6A 3GPIA 2GBFA 1EUDB 1JT9A 3OHPA 4WHMA 2ISSD 2BHSA 2H0AA 2QXYA 2UVDA 2IPLA 2EQBA 4G5OA 3V5NA 1JAXA 3PU6A 3T3PB 3ZEIA 2VJDA 3C3KA 3KWMA 3HPRA 4LNHA 4MRSA 4DGQA 1NVGA 3TZCA 2DR2A 1G38A 3WL8A 4KSCA 1XLVA 4DHWA 1DMRA 1B6RA 2AN3A 1XAHA 3D31A 3HHPA 4YRZA 2HDHA 3EDYA 4Q7MB 1FP4A 3TW4A 2LWIA 2R6JA 4HAZA 1H65A 2R9VA 5JXWA 4RACA 4OXRA 4Z0NA 3FYDA 4FOSA 1EK2A 3M1LA 3AM4A 3AKCA 4OVKA 2E48A 1PK8A 1K6EA 5A7GA 5ITSA 3UPDA 1CUWA 1WETA 2OO7A 2OORC 3T9EA 3K2EA 5AJUA 5KVAA 2QTBA 1JDJA 1Q74A 2EKQA 2P9YA 1C29B 1K98A 3ZHBA 1OAAA 3ODPA 1Z68A 3Q3CA 4NICA 4E94A 4KE6A 4EHDA 5BUSA 5KSWB 1IK6A 5BVHA 3LAWA 3KSDO 2QVYX 5ESXA 1DO2A 4C14A 5KB3A 1VSVA 1TJ3A 1W25A 2JI4A 2VL7A 2ZUBA 1I3MA 1S3FA 2F7SA 4HSEA 4ARBA 5DHAA 5C81A 5HX7A 1FCJA 4BL5A 3THRA 3CLTD 4O2AF 3VO8A 1TGVA 2ZR7A 4C0JA 3EDMA 2GFIA 3WKEA 2BH2A 3ZVMA 2QT1A 3DYBA 1LK7A 5GJVC 2NXNA 3MC1A 1Z2OX 1VMDA 3CSUA 4W9MC 5AM3A 2ZBGA 3G2OA 4Y9UA 4L0MA 2IGBA 4JBHA 1Z6PA 4AJ9A 2GF2A 3LW7A 4HPXB 3GT7A 4JXZA 3JS5A 1KYXA 2XB6A 3THYB 4V02A 1PSZA 1AGPA 5TS3A 3VYRB 2CVOA 1W88B 2YR0A 1FUKA 5T4EA 3OLZA 4ZGWA 5IJ9B 3IBYA 2BFMA 5KINB 1EINA 2XMPA 1XEWY 3DD1A 3VOBA 1QHHB 2BUAA 3GC6A 5KHLB 3A1NA 5EIOA 1DG3A 3RIHA 1ZGBA 4HDSA 1IQRA 4R84A 2UUBB 3RSOA 4B2YA 4BIMA 2VPYA 3B3GA 1SK8A 4TWBA 3TGLA 2YHAA 4CLOB 4HMPA 5F2KA 5IK2D 2C98A 1L2TA 1DTWA 4PSVA 4BE7B 4E0BA 2GBGA 1TJYA 2HYDA 3QFSA 2X8JA 3RU7A 4LYAA 5EJ6A 1VXRA 5JZOA 2QUKA 3AUXA 5A9TA 4ER7A 4BLVA 4G0XA 1DAMA 5J40A 4WUVA 4CLXA 3E9DA 1VLMA 3KYDA 4KW7A 4MUXA 4FHZA 1NMEA 3FAZA 1RHKA 1XZHA 5TJHA 4GKKB 5L6LB 4D1YA 2SHKA 2OYRA 1NLFA 2LGJA 1EWTA 1IB0A 1ZMRA 2MSEB 3L79A 4LCBA 4BV9A 1AUXA 5A4IS 4IKOA 2A9VA 2WWFA 1I2CA 3BX1A 4JJFA 4KN9S 4K0KB 2H1VA 2V6FA 1FFWA 3PDIB 3DQZA 3RS5A 1ZN7A 2CLKB 2R8XA 3R20A 4RHUA 3AUJB 1HNZB 1PBTA 1XTIA 3HC7A 4TTVA 1H8HD 1W34A 1OBOA 1M76A 1E9AA 4BRZA 2JDIA 1PR5A 1QIGA 2WA2A 1GV0A 2BI4A 4B5LA 5IDXA 4BMCA 1FSFA 3L6CA 5CYOA 4FR0A 1EP3B 4KBGA 4TQGA 1VJRA 3AP3A 3ZD9A 1KZ9A 3FGZA 3M2TA 1CUJA 3LVQE 2ZSHA 2AWNA 2O8CB 1QAOA 3QOWA 3IQGX 2E7ZA 2HQOA 2IE0A 3S7TA 3IKVA 1FXUA 8ADHA 2V74B 1QO0A 4YRNA 4JIGA 1Y6RA 2ZE6A 1M73E 1DCMA 1N1DA 3AHGA 4RENA 3P9QA 5A4KA 1SKQA 3OZGA 3SK0A 4EUSA 5BYAA 4AY2A 4MQBA 4Q4LA 5C8VA 1URPA 1KNQA 1B3RA 1RVV1 4M7RA 1NW7A 4R3UC 4IYJA 1L7MA 4UREA 3IURA 3RTBA 3QF7A 4G97A 3NCTA 4LECA 3JQDA 3QGMA 3T5PA 5CNKA 2IVZA 3QHAA 5EKUA 4N0MA 3VTAA 2B92A 1GTJ1 2HSZA 4J29A 4BMNA 3X1ZA 5HZHA 4FT4A 1U3DA 2I4MA 2Q4RA 1A4IA 4HLDA 5TARA 3U0VA 2C3MA 2KLHA 1GPAA 4PGGA 5U4QA 3RSFA 2O57A 1OC2A 5FA6A 2IW3A 1YC5A 1D7AA 2QK4A 3H6KA 3ND7A 2ENUA 4KMOA 2OHGA 1B43A 5BWNA 1ZNWA 1J49A 5FEUA 2XOXA 4EB0A 4PG4A 1ZY2A 2D2FA 2R6CA 3IMCA 3K1AB 2YUIA 1HDRA 4H0CA 4C0AC 2GSDA 3L0YA 3WWYA 4A2WA 1RP7A 1W2GA 4BWGA 4EKNB 2Y1OA 3TNLA 4DC1A 1QRSA 2QUHA 3NYRA 3NGMA 2E89A 4M86A 4DMGA 1HSOA 2BFDA 3KYCA 3N2ZB 4Q7EA 4YI5A 3QELB 3BH0A 1J5PA 1XAJA 3L7JA 2QOEA 2ZB7A 3AHDA 3LUDA 4G5XA 4OH1A 1TYZA 1Z4KA 2EBFX 2VXOA 4WCFC 5ULLA 1YJCA 2ZDQA 4JKOA 5FI3A 3ZGXA 1OHHA 2RH5A 3IFSA 2WV7A 3T41A 2R4QA 2JJ1A 2ODPA 1MAHA 3PPVA 3SFVA 4BO6A 1TIBA 4FYPA 5A4DA 2LV8A 3O6VA 3UMJA 5AI5A 2B8EA 3BXEA 3QFTA 3MERA 5K0TA 1NOJA 2X5KO 4NH0A 1QFMA 1NW4A 2YWRA 4GD3Q 4KTVE 1AGRA 1MW8X 2IKSA 5F77A 3SYNA 1JB9A 4HUQA 2G08A 3CN7A 1JXQA 2P9EA 2P1RA 5FHRA 3AESB 4F86A 4CIDA 1RWMA 5JC1A 4O25A 2EFCB 4LC1A 3T94A 3RVNA 1JHZA 1H9AA 3GLKA 1FZQA 2ORYA 3EXFA 3DAYA 1V3UA 3JWPA 1A4XA 3LQYA 4Q4DA 5C46F 5FBZA 3OJ0A 3BKXA 1DX4A 4FYWA 2H1WA 2JHFA 4GKBA 4R16A 1UAGA 4XLLA 4OHBA 2C54A 1GQFA 2ZJOA 3T1VA 1B1CA 1MGPA 2Q9AA 2QR3A 2ZRIA 3NEJA 4BGEA 4Q4AB 1VRCA 2O8BA 3VHLB 4EMSA 1TQ8A 4CUJA 2QHXA 4N8DA 2D3TA 1JFLA 1ISHA 2IEYA 4BRUA 1L5WA 3FCYA 2CL0X 3LPDA 4RJJA 3H5NA 4MKGA 1OH7A 3DHNA 3R0JA 3AB7A 4PLTA 4V0OA 3OFNA 3NWOA 2AZXA 3D8BA 1B42A 5ALXA 1V45E 2AZTA 2P9BA 4YJKA 4AWXA 2X22A 4FFVA 1YL6A 4V0ME 4U9HS 3CNQS 1NXSA 4PWZA 3B6EA 3I39X 3QLVC 3RHFA 4YRBA 1DRJA 1JRLA 1TD1A 3E9MA 4MUHA 1UKAA 3AEXA 2ZRJA 2ILTA 2R62A 3GG2A 1PS0A 4PN3A 1VGVA 2I7XA 4RSHA 1MABB 1MC1A 2COEA 3GDOA 4WNYA 5J4KA 5LOVA 3IE1A 1ZIYA 2AYZA 3VZBA 1JFSA 4C9BA 2AFIB 1XQ1A 3MTDA 2CVFA 1SC1A 1SHZA 1TT7A 2JIZA 1L7QA 4E5MA 1WMSA 3DZJA 3MJSA 2Q7OE 3A27A 3FOCA 4HYEA 2VSNA 1ORWA 3NKFA 2OV3A 4BNLA 4HRVA 1MGOA 3L0IB 1NVEA 1P4GA 1BQ4A 1EX7A 1U2DA 3BBPA 2QRNA 4OJTA 4KFTA 5ENDA 5T8KC 2QW8A 4BPRA 4DG5A 1K4YA 4BEWA 4YMTA 3SFTA 2GASA 1QH8A 3GMIA 5D2CA 4TSFA 1RTKA 2KBFA 3HKCB 3FHJA 1C7FA 4IJVA 3EDCA 3DV0B 3KD2A 2WJ6A 4QELA 4XZ3A 4G41A 3WK9A 1ZK0A 2MIIA 2JCSA 1UBHS 3K4PA 1GPNA 4Z9XA 3UH0A 4ZYWA 4U7DA 4DSNA 1UC8A 4A03A 1UBSB 3GEDA 1RWBA 3WK7A 4CIWA 2NU6B 2CLEB 2CWDA 2O2GA 5IJ0A 2Z1MA 2R48A 4L9RA 4PQGA 4EABA 2C7GA 4AG6A 2ZW9A 4J49A 3MMZA 3AVWA 1XDSA 1A69A 3PX3A 4Z8YA 5KPDA 2BTQB 4IHAA 4XIGS 5D51S 2W48A 4Q7LA 4MCIA 5EPUA 4EB8A 3B6IA 1T6YA 1CY0A 2LBPA 3GRPA 13PKA 3AKEA 4LXYA 1RFLA 2X4LA 5FAXA 5DNCA 1ODTC 3W7VA 4B48A 4C20A 2ZGVA 1UXOA 5IM4A 3FXAA 4BZXA 1IHUA 3IB3A 2ZU0C 3K5HA 1N2BA 2F3TA 2FE1A 3OLQA 1O94D 3MCVA 2VK1A 2CE7A 2ET6A 1MB2A 3WLSA 5HRAA 2OHXA 4GGMX 2O5EA 1A8IA 1E3SA 3U4IA 3IVCA 1FRZA 2PQMA 5TMEA 3CG4A 4ND7A 4Y6QA 4TKVB 3SHWA 2R6AA 4X97A 1HV8A 1H0KA 3PFBA 2YMMA 1AO3A 5HFAA 4BGDA 4QGHA 4YK7A 1M67A 2JFBA 3NAMA 4H1VA 3IHKA 2GF0A 3USCS 4DBZA 4DM3A 3MG9A 5D84A 2FMHA 2HU8A 2FOXA 2N46A 1EDOA 3AF2A 4FBLA 4BKMA 4H7KA 5EWMB 1SRRA 3PNMA 2CWWA 1GP2A 2XCUA 4UPVA 2CNWD 3SC2A 1JSRA 2ZSEA 3OE7D 4INZA 1MBZA 3BDIA 4FZVA 4PO3X 2IW1A 1VJ0A 4JUAA 5GOZA 1KI8A 1FNNA 3SZRA 2QX4A 4MVJD 3WBKA 1SBZA 1S2OA 4RPCA 2Z6QA 1U1GA 3PEFA 1QMPA 3MD9A 3MCTA 4ZQEA 3DDNA 5SV2A 4EG3A 3RJTA 1KZ6A 2QAGB 2R8PA 2WF8A 1M83A 2VP4A 3C1AA 1TTQB 3N2IA 2FPIA 3DBHB 3LX5A 4DY4A 5JI2E 1JE1A 2XDYA 2PUCA 1CHDA 1WUHS 2HPAA 1NJ6A 4MVJE 1BXRA 4IOMA 4DMUB 1L7BA 4U3JA 4LBVA 1QOZA 4LZAA 3RIEA 1I6MA 1C1YA 4FEYA 1D6NA 3ZVRA 5A71A 1CYDA 2C07A 2PTGA 3ZZ1A 3W77A 1BMDA 2QMOA 4FMPA 3SU8A 1RVDA 4AZTA 3MNFA 1VSTA 2XKAA 3R6TA 1MB0A 2JJ2A 4LAFA 2CLIB 3GG9A 1Y8QA 2Q5QA 3IOEA 3QKSB 2QIOA 3OMWA 3TWOA 2BGUA 4CMIA 5ADVA 3TGPA 4OEHA 2VQEB 4M83A 2IYOA 2BF7A 4PSUA 1KYQA 4RPIA 2EJBA 1Y4ZA 5HDBB 3V7YA 3UHAA 3TOZA 3GJRA 3ZU4A 5H3HA 2IPXA 2QX8A 1ECFA 2NTVA 1N6LA 2H2GA 3G82C 1H6DA 4WJZA 1W2HA 2Z09A 2A9KA 1TEXA 4I5DA 1CUBA 1X7YB 2XRMA 1AK2A 2UV8A 3F3KA 1YXMA 1AUOA 4I7EA 2FFAA 4GXQA 2YQ4A 3VNQA 2W93A 2COKA 4EL5A 5T6MA 4ZI7A 5F7XA 2Z9CA 3BIJA 6ABPA 3LMKA 3KEOA 4KTTE 5D85A 4L4XA 2I4NA 2DVMA 3SR3A 2PZKA 1YH3A 3MIZA 3W90A 3G88A 3E35A 4QJ4A 3PQ7A 3AKDA 4ZK2A 3C3MA 2V03A 3L7DA 5DEIA 4KQHA 2PX8A 4MPJA 3R8XA 3GDHA 3K9QO 3QTTA 4D6PA 2CKMA 4MGEA 3KBOA 5E3JA 3Q3GE 1FY2A 1CJKC 1O08A 1IATA 2B83A 3WKAA 1JEAA 3C3DA 4H6PA 2XIJA 5HGXA 5IJ9A 3G8CA 4EW1A 2ZAOA 1TEHA 1NVXQ 4WXPA 3T4XA 1TQHA 4BKUA 1H8HA 5J9FA 4HZUA 3Q7SA 4LFAB 3O4GA 3ZKWB 5C1DA 3AR4A 5LPNA 5JO0A 4PRLA 5F64A 2E5WA 3A6PC 2XV1A 4YMWA 4ZTBA 3A1EA 1Z6TA 4EJSB 2H7CA 1L7PA 3NPAA 4PR3A 1KK3A 3VPXA 2FFQA 3H42B 4FDMA 3NOQA 1A5SB 3ZYZA 3BMOA 2ENWA 1WSWA 5ALLA 5LQCA 3F5SA 4B5KA 3AY3A 3MM4A 1Y9ZA 2J9XB 5JS2A 1NYQA 1F48A 4KITB 5FPHA 1ESCA 5FT9A 2HCTA 3A9TA 3V7NA 4CF4A 3VO1A 4EB6B 1PTJC 1RRMA 4NZNA 4CF6A 1WDKA 3ES9A