3SHOA

Crystal structure of rpir transcription factor from sphaerobacter thermophilus (sugar isomerase domain)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
187
structure length
186
Chain Sequence
DRQQLPVQVFTNDIENLNQTLNQTQPEAIEAAVEAIRADHVIVVGMGFSAAVAVFLGHGLNSLGIRTTVLTEGGSTLTITLANLRPTDLMIGVSVWRYLRDTVAALAGAAERGVPTMALTDSSVSPPARIADHVLVAATRGVGHSLSPVGLIAVVNLLLAEIAVREPERALAVLREVDRLYREQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, RpiR family
publication title Crystal structure of RpiR transcription factor from Sphaerobacter thermophilus (sugar isomerase domain)
rcsb
source organism Sphaerobacter thermophilus
molecule tags Transcription regulator
total genus 62
structure length 186
sequence length 187
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 3shoA00
3J81A 3ODPA 5LMUB 3OOJA 4LZJA 1ZZGA 1KOJA 1Q50A 1MOSA 1HNXB 4OX9B 1U0GA 5LMNB 4LF4B 4JYAB 1C7RA 4DV6B 4JI0B 2UUAB 4LFBB 3J80A 3J7AC 1N33B 5IWAB 1N8TA 2DECA 3NBUA 3LJKA 2PUTA 4JI1B 2ZJ3A 2YVAA 2I22A 3FJ1A 1N32B 4S12A 2UXBB 2CXOA 5LL6P 3SHOA 1X92A 1VIVA 4AQYB 4DR7B 1TZBA 4KHPB 4EM6A 1IBLB 1C7QA 3FKJA 3TBFA 2X3YA 1IRIA 2CXPA 4B3SB 2CXNA 4JV5B 2VQEB 2O2DA 1IATA 1HOXA 4DV0B 2CB0A 1J5XA 4YY3B 1GZDA 4YHHB 1B0ZA 4GKJB 2ZJ4A 1XNQB 2DF8A 4B3MB 1N34B 5BY2A 2UXDB 1JXAA 4DUYB 4NXNB 1XNRB 1WIWA 3OTOB 1GZVA 1TZCA 4TOIA 3FXAA 3TRJA 4LF5B 3HBAA 3HJBA 1XTBA 1MOQA 1TK9A 1FJGB 2E5FA 3IFSA 2WU8A 1VI5A 5A2QA 2A3NA 2J6HA 3KNZA 2CXTA 1JLHA 3G68A 3JX9A 4B3TB 3T1YB 2O2CA 2VQFB 2PUVA 1XMQB 4DR6B 1MORA 2VF5X 3Q7IA 4X62B 1XMOB 3JAMA 2HHHB 2UUCB 5IT9A 1IBKB 2CXRA 4JI2B 4X64B 4S1WA 4LFCB 2PGIA 2UU9B 4LF8B 2UXCB 2CVPA 4K0KB 4JI4B 5I01A 1I94B 2PUWA 1U0EA 1N36B 1NRIA 2CXQA 1X9IA 4DV1B 3PR3A 2I2WA 1VI6A 3QKIA 4DV7B 1U0FA 3FF1A 1M3SA 1VIMA 1DQRA 4JI3B 1J5EB 4DR4B 3C3JA 4LFAB 4U6NA 3Q88A 4JI8B 4LF6B 1IBMB 4DV3B 1X94A 2POCA 4DV4B 1HNWB 2F4VB 3UJHA 2UUBB 4DR1B 4B3RB 1HM5A 3BCHA 4JI6B 2ZM6B 4IVNA 4X65B 4DV2B 4JI7B 4GKKB 4DR5B 2V4MA 1X9HA 4DR2B 3ETNA 2E5LB 1NUHA 2CXUA 3I0ZA 5BR8B 3M5PA 1JEOA 2XBLA 4LF7B 2XHZA 1G98A 4X66B 1HR0B 2CXSA 3BJZA 3EUAA 5FLXA 4LF9B 1HNZB 1JIQA 4DR3B 4AMVA 1T10A 4NXMB 4JI5B 2Q8NA 2VF4X 3T1HB 4DUZB 4M0DA 4DV5B 3CVJA 2AMLA
chains in the Genus database with same CATH superfamily
3OC6A 1NDUA 3PP8A 4LX0A 4OY3A 3U3RA 4KQJA 1E58A 1ZK2A 2WC1A 4M87A 3SLKA 4KOEC 1NNSA 3AX6A 2OBXA 4PSUA 2ORWA 2WNHA 2UUAB 3E2MA 4HCJA 2CF6A 2R00C 3OPNA 3TPCA 2WABA 1UDAA 2RHJA 3EE6A 3M2TA 3P20A 3PHGA 3VZPA 1U0OC 2ZT6A 4OHKA 4JUAA 4XYLA 4XASA 2EKDA 1BDJA 3RADC 3KYDB 1QRRA 4NF2A 5JPIA 1J2TA 3SXUA 1V16B 4MW7A 3UJCA 2Q0XA 3RS3A 5B3LA 5KEIA 1G20E 1Z8DA 2OC9A 5FLEX 2ZR8A 5A3VA 4BO4A 1T2CA 3DJFA 4E3ZA 5KX5B 3Q7TA 1M8PA 2VJMB 1Y7LA 3AHDA 1JG4A 3UWOA 3S1AA 3MSXA 1FDSA 3MS7A 1E2KA 4KN6A 1DI0A 1BXRB 1TUEA 1AHHA 1T0PA 2QLLA 3IJEB 4P58A 4QO8A 1SXJA 3UMCA 5DTMA 5KX5A 2VNKA 3A28A 2ZFUA 3D8NA 4EW2A 2OCDA 3GLSA 3O1LA 1M2EA 4IUYA 1DRWA 1JXAA 2RGNC 4UPVA 4X1YA 1M1ZA 2XPCA 4XH9B 5G3YA 3ZGXA 2HQOA 4G86A 4CUJA 1GUZA 2P0AA 4PO3X 2Q2VA 3HN7A 1J8YF 1ZISA 3PC8C 5EMLA 2B92A 2W0MA 1N3IA 3PR1A 2XECA 4K8RB 4D8XA 3IFSA 3H2HA 4RCYA 1XTUA 1H2AS 1YQGA 2VT3A 3I6ZA 3RODA 4RTMA 4EBBA 3FOAA 1GGVA 5TB5A 3NVAA 4YO8A 3UW1A 4CCAA 2J6BA 4QODA 2HPAA 2ODBA 1KTIA 4RESA 3EEIA 4LAFA 3UAVA 2O19A 1CF4A 4P7JA 3ZCVA 1Z2EA 2FEPA 1CQIB 3FBWA 3FFAA 4NL4H 4TS4A 5CUQA 4YASA 1C50A 3FPBA 1Z28A 4LGYA 1NW9B 3L7KA 1V5FA 2BEWA 2GR9A 3B3GA 3EIUA 1R9GA 1OFIA 4A8JB 5E1OA 4ZZ2A 4BL5A 3QE9Y 2WZBA 4LJ7A 4YRCA 5AVWA 4E2YA 5KVQA 1M1YB 4KXYA 3OFKA 4J0IA 3UB4A 3Q3HA 4E32A 1W4RA 2CJFA 2MSCB 3L0ZA 4Q4HA 5C2JB 1GU0A 4F5ZA 4CKEB 2JAPA 2C58A 1UWCA 4H4CA 2Z8ZA 4C3OB 3U4CA 3ZTWA 3L18A 4LJAA 5G1PA 2IP4A 3NUGA 5C8XA 2CVHA 3R76A 3VDMA 1NSFA 4OBXA 1DJLA 3MMZA 3RRYA 3UKJA 3V2IA 2YNMC 4LYYA 1ZIPA 4IIEA 3QP9A 5BMVA 4QUJA 4BU1A 4NEGA 4RUKA 1JHRA 2F3RA 2XB4A 4I9UA 3DA8A 3O82A 5AVUA 1F17A 1V1JA 4EP1A 1BOFA 4K6OA 4L51A 1OD6A 2ACKA 1NUHA 3C7CB 4QOHA 1RBMA 3SZUA 1JEDA 3TLEA 4W5RA 2HW8A 4N82A 1EE2A 1JEOA 1RWVA 5HMMA 3X1JA 2BGUA 4WJLA 1I13A 2HU7A 4NMHA 3DTNA 1TJYA 4EHJA 2A30A 5F2NA 1U81A 3OP4A 4B4DA 3I53A 4QHTA 3SJZA 3ZV7A 3OTHA 5J2UF 2H4WA 2NZJA 5L4LA 2QMYA 3NP9A 1NYRA 3ICQB 4DL9A 4UTPA 2PQ2A 3SYMA 2P4HX 2DH5A 1T9KA 5EIHA 3HDVA 2DERA 4G4GA 1GSAA 3WAJA 1KYQA 4BRWA 4DNOA 2FGJA 5HBRA 3ML1A 2PX4A 1DELA 3H11A 2ISQA 4FFBA 1EDOA 4HVLA 2DFPA 1I4DD 1KO5A 4G5OA 3BHNA 1TO2E 4K3UA 1U1DA 2P3QA 2X9NA 2YZGA 3ZIAD 5BUSA 2VH1A 3H6KA 4CQMA 3KLMX 2V74B 1IBRA 3EQ6A 4N18A 3IKTA 3PUWA 2N1BA 5DJ5A 3B9QA 3CRZA 4DNQA 3GJSA 1G64A 4PX5A 3CTMA 4V2UA 4KVFA 3ICOA 1R74A 1Z4MA 3R9XA 4F45A 3IQXA 2G9NA 4E09A 1FP7A 3C3XA 4GE3A 1NVFA 4AQYB 2VLBA 4DDKA 5C0OE 2C29D 3HWSA 4XQCA 3NLLA 1ZJYA 2MMGA 2VJAA 5EXXA 5HFJA 5MGBA 3DBVO 1VCMA 3FGPA 4TL7A 3S55A 3ZWAA 5K0LA 1I3LA 2VHUA 3FPKA 5HKAA 3BL8A 3F90A 4AY3A 2G3YA 2JFBA 4Q19A 3ANLA 4ZOQI 3TK1A 2XITA 5DHFA 4NSNA 1GZ4A 1ENPA 2AV6A 3MJFA 5FDFA 3HZZA 1E6UA 1JXQA 4G0WA 1PT5A 2TMYA 1N5LA 2E4WA 4UM7A 1SHKA 1EDBA 1UANA 1YCHA 4KEAA 1QYXA 2CYBA 3UM9A 2AUNA 5A4AA 3TF5A 3CPHA 1QIMA 2CK3D 1TM5E 1V4BA 5G4LA 4B82A 3ADKA 1DOAA 2YYSA 1NDHA 3OOHA 3EHEA 1A9XA 1EK1A 4YUZA 2VTBB 1Z17A 2XOKA 4I81A 1E1RA 2N46A 3IMKA 4RWZA 1EUDB 2PS9A 4ZO6A 2ZT5A 3TZ6A 1TVKB 3EHDA 2HJSA 4JNKA 4XWGA 2N9UA 2P40A 5B5SA 1HOTA 1E8MA 3JQDA 3NM4A 4LSZA 4TLCA 2AK3A 5EXTA 3TLJA 1V11B 3UOAB 2WIFA 1DDOA 1ND6A 1NVVR 1YGYA 2IYWA 2OQ2A 4FT2A 4Q9KA 3I05A 1Q12A 3X3HA 3ZPXA 3OX4A 4B71A 4YWHA 5JD5A 3ICWA 3K5HA 4JI3B 1XEWX 3G3EA 3KFXA 2KLBA 5EYPB 4ZVOA 1IJBA 2AFIA 1WUKS 5IXSA 1FXSA 1KH3A 2VZLA 3INGA 3KEQA 1R1DA 5EVJA 2HDOA 5K0JA 3KALA 1EFPB 4CMEC 4IV0A 4Q3AA 3V9AA 3JV7A 3PFFA 2I2BA 5DT2A 1VIAA 2XUZA 5FULA 2QPTA 4TXLA 3I52A 3AF6A 3ND7A 1F9AA 3GVCA 3HKDA 2O0KA 1PK9A 3EXAA 1NLFA 3C3AA 4J1QA 5DE3A 1GY8A 2A9FA 3UWMA 3UK0A 2OILA 5J58A 1WE2A 1RZRD 1VLQA 3C8UA 3OFJA 1M2HA 2GBCA 4L4YA 3SM9A 1Q0HA 1II9A 1GNTA 2JJQA 3CF2A 221PA 2G0TA 3F5SA 1P2SA 1Y6ZA 4QGSA 1VCNA 4FFRA 4QLOA 5DNDA 5JMOA 3P1JA 2HU5A 3DAOA 4EKEA 5A3QA 1E3JA 1E3TA 3P0IA 4R8RA 6REQB 1F0NA 1LPPA 3QKSB 4ILKA 3KSAC 4ZOLA 4QREA 2DFDA 3WYDA 4BN4A 3S1SA 2JLYA 5FORA 3ZVMA 4AX8A 5P8WA 5L3QB 2GVNA 1SWWA 2NU9B 4U1RA 4WCVA 5BR7A 3UAWA 4XJVA 3MOGA 5B12A 2BFPA 3AEUA 5BV2P 4LZJA 4KRFA 1DMRA 3RKSA 2FWPA 4TYMA 2WIKA 2IA5A 2JBWA 1HT0A 3DOCA 2CHFA 6ADHA 4HQKA 3SC4A 3V4ZA 3PNSA 1DVRA 4E88A 5GY7A 2N1MA 3F5DA 3HXQA 3TM5A 1FL9A 5H02A 3V1TC 3GELA 5AXCA 4B8YA 3QKRA 1DPGA 2P90A 4IDDA 4PINA 3CJQA 4QAQA 3SLRA 1NUSA 2WA2A 2IXTA 4RE5A 3TBHA 4BUCA 1A5SB 4WSOA 2FPKA 1MJGM 3GFSA 4ICIA 2MINB 2RJ3A 2VPXA 4GECA 4XJTA 5HJEA 2W98A 3IRVA 2UUOA 5L4NA 1GNQA 4FDUA 2VXBA 3DW3X 2NO9A 1JRLA 1K0UA 1Y33E 2YICA 5J59A 4GX5A 3BJMA 3QEOA 3JWEA 4HUTA 4IDOA 4XCQA 5L4SA 3G0HA 2HFJA 2QLNA 1U7ZA 4GNKA 2C8JA 1XG5A 2RHOA 3CZ9A 3PNYA 4RD6A 4ZGGA 1BWSA 4OQXA 3PUZA 2VZ8A 2H2WA 2ZPAA 1LY1A 5CYPA 1NHWA 1Q6ZA 2UVDA 2COEA 4M88A 2RC6A 3VJKA 4QD3A 2PWZA 3BGIA 2OV6A 5BY2A 1D4AA 2Z30A 2CKMA 3BJIC 3N8GA 4DUYB 4ZAVA 3QNUA 5LBIA 1YSCA 4M55A 5HDBB 5AVQA 5G0UA 4ZYVA 1FXUA 3IIEA 3OO1A 5F3RA 2DVMA 3R5HA 5JD4A 2OAGA 1N2EA 1MJ5A 2OLJA 1CB0A 2CFOA 5AM0A 1E3EA 1VLMA 1TF2A 1HYBA 1XZCA 2P0YA 3BCRA 3GLGE 2CXTA 3NHJA 2GK6A 3TR0A 1QHNA 1L5HA 2FPXA 1JSXA 4JOQA 3ELYA 3U60B 1LK0A 3N2GB 3Q7IA 4DR6B 3R0XA 2O2HA 3F6CA 3IUPA 1YIOA 1OSNA 1SN7A 2WU4A 1MB9A 3EEFA 3G5UA 5DO9A 2BF7A 1GRCA 1IZ9A 1JFVA 1UFQA 3QY0A 3B8EA 3QXSA 4ZO9A 2IFTA 3GFBA 4D02A 4EG3A 2Y6UA 4PG4A 1QYCA 1R27A 2CB9A 4O1HA 4PRKA 2XKKA 4GPD1 3DUFA 2A67A 3D3EA 1UADA 3C87A 3ZDBA 4LY9A 2OD7A 3QVGB 4BFSA 3MIZA 4B6EA 3VR5H 3UTCA 1SBCA 3GNLA 3EA0A 2NO6A 2ORED 3ILSA 1ZK1A 3N70A 4ER6A 3ESRA 1NXXA 3ZGOA 2JGDA 3BT7A 3UVEA 3DP9A 1GKKA 3N05A 5ALZA 1OB5A 1RWMA 1Y8RB 1WNTA 2HL6A 3PA8A 4H0FA 1ZI6A 4MWDA 1JI3A 1PJQA 1SEPA 2IPNA 4L8FA 4R6WA 3TRDA 3BQMB 1I7NA 5J9FA 5CCBA 2DLCX 5FBKA 4MUIA 4Y1RA 5EKXA 3SC2A 4BP1A 4JUBA 2I03A 5DBFA 2ECPA 3L8MA 4B4WA 3ZDEA 3OH8A 4KN9S 4R51A 1A4UA 3ZJUA 4PF1A 3IDAA 4RPGA 3HJUA 4B2YA 1CTQA 4J2OA 4JASB 5LC1A 3HPRA 4HUQA 1J9ZA 1T4CA 3C7TA 1H66A 3WWYA 3A11A 3ENWA 4GL4A 2F1JA 1JFSA 2ARKA 2PZBA 3UG6A 2X8BA 3FCUB 4TMFA 1B93A 2DFKB 3I8SA 3FYUC 1UL1X 5EAIA 5HCNA 3WZMA 3VOAA 2WSLA 3G2JA 3FOZA 2QRKA 4O2BB 4O2RA 3TSZA 5KNCD 1XDBA 2FPGB 1ISJA 2OY0A 3O1HB 3NHRA 2RHDA 1QVZA 2IDJA 1GDDA 3HYSA 3G2LA 5FFMA 3K8OE 2BP7B 4KSCA 5EEGA 1XALA 4IDCA 1H05A 3TNJA 1MXFA 3U7RA 2H92A 2I5PO 2ZCVA 3V1KA 4H1TA 4YIHA 1IHXA 1XCBA 3DD5A 2OCXA 2PL3A 2PH7A 3CISA 1NTOA 4ZU1X 3TINA 3A6JA 1TD9A 1WB6A 1M73E 2A9RA 3AEKA 4HB4A 4J76A 4KPGA 1JSCA 2YJTD 4IDNA 1QV9A 3L9XA 4IH1A 4HEQA 3ZQUA 4IBOA 4BIMA 4CCYA 4ZV9A 5IJ9B 3I6MA 1B8VA 2X1LA 4DR7B 1GYRA 3QSGA 4H27A 4EM6A 3LBYA 4MW6A 4LGMA 5KOIA 4EG5A 2I7DA 4OEHA 3UCEA 5DMXA 3PNPA 4BNFA 4X3PA 2DJ5A 4LOLA 2XE7A 4BEVA 1P7WA 5HG0A 2JLWA 1SXJC 2QIPA 3E27A 2AC4A 5CHYA 5IAKA 4H1HA 1WEKA 4NJEB 4V3CA 1OBFO 3EQ8A 1V35A 1VJ1A 3HKBB 3L0IB 4CKWA 2IHVA 1QCDA 4XR4A 5E4YA 1S8OA 3II6X 4R05A 1E3QA 3HZOA 1JEYA 4CIVA 2DEUA 4RZSA 4HEA6 1ULTA 1YULA 3K96A 3KT8A 4Y2JA 4C0LA 2ZIVB 4C6HA 1SQ6A 1VG9B 4ZI3A 4RW0A 1KZYC 4OK6A 2F2TA 3F2VA 1X7DA 3HO1A 2EATA 1V45E 2H5JA 3AR8A 1XJCA 3MYRA 3KQQA 3PDIA 2ZZNA 1YDEA 2R62A 2RJOA 5DV9A 3UXMA 3NDRA 3AIOA 1GPUA 2QUBA 3TR6A 2GM9A 1XQ9A 1MORA 2O2JA 2PUCA 1YR6A 2DH6A 1PNVA 4KXNA 5LB2A 5C3UA 3T3GA 2E6KA 1SOAA 3V6LA 4CM7A 1UEJA 4HMOA 2P79A 4F3YA 4BO7A 2G83A 4G0XA 1JLKA 4HBZA 2VYFA 3B1XA 3LDUA 5JAMA 1QFJA 5JNWA 4FUTA 2A9PA 3U4QB 3WXBA 4NMMA 2QRNA 3LQKA 4Y2TA 4HDRB 2WZCA 3F0TA 2PMWB 1NNI1 4FWBA 1U7OA 2DWQA 1VRCA 4LC1A 2SKCA 3G1TA 3HL4A 4PANA 1OZ0A 1ITZA 5CGQB 5KVSA 3KDSE 4UEWA 3VMMA 3ZCRA 5KYUA 2P9GA 3EVAA 2VDRB 1E9EA 3CBGA 4HVCA 1TQ8A 1YVPA 2HC9A 2OO5A 3A1CA 3VPAA 2C4HA 5DDIP 1IN1A 3N8NA 3AIMA 4RXUA 4GIBA 2PKRA 3G13A 3PEYA 1RWWA 3LLCA 4HPWA 4URFA 3ELWA 4L7QA 2I1QA 3VVMA 5DWVA 2I2FA 1ST2A 1NXVA 2OBMA 4FEYA 4IIHA 2VK8A 4JT2A 3E9DA 4BVFA 1IEWA 3A3PA 3I28A 3EYWA 4KQEA 5LXTF 3TZQA 2JBHA 3U3DA 4ES6A 3IE1A 2HJ9A 5TMEA 5ES3A 4EB6A 1JVBA 1X3SA 4HV4A 1U7TA 1N6NA 2A4MA 3OTWA 3HFRA 4RGVA 2Y4NA 1RIIA 3L0PA 1VGVA 2R65A 4R8LA 2VF4X 2VYCA 2ZRJA 2QYOA 1N1GA 4E7PA 4FKMA 5JQGA 1O97D 1QH8A 2QP4A 4FDAA 4ZZ3A 3KQLA 2Y1CA 3IV7A 4N5DA 3H9QA 5DISB 1HH4A 1E18A 5I9IA 2WJ4A 1X1AA 3LC1O 1CUUA 4KC0A 4E5SA 4EY5A 4UMDA 1TKAA 2B1GA 1NKVA 2GDJA 4IJVA 1B6GA 2PUEA 3A9WA 4IFBA 3PRYA 1NJGA 1WHTB 1WKCA 2RK4A 3OPQA 4ID9A 3SQLA 1FFXB 1OZAA 1SCIA 2D1SA 2HXGA 2QTAA 4Y6PA 3UT6A 3SR3A 1KIAA 3V1MA 1VSVA 5K5EA 4FD2A 3SSAA 1LDNA 1YC2A 3FVTA 2GBLA 3NDPA 3X1WA 2K5UA 1LC3A 3L2OB 4E14A 2RHRA 2ZRLA 3MUNA 5AW1A 1O89A 5CIYA 4RH3A 2I2DA 4AXXA 2DQKA 3SBOA 3IQGX 3D2BA 3OMWA 2N3ZA 2A86A 3NCHA 3PX3A 4WLEA 3HK2A 4DYVA 1TLLA 3OQIB 2FA9A 1Y3BE 4UNNA 5CVDA 2QM0A 3SICE 4AG5A 2OTCA 5B3KA 1B0ZA 1RS0A 2AZ4A 3HEBA 4LMBA 5DYIA 4G1BA 1YH3A 1HDOA 4BQRA 5ICCA 4TVBA 3ZE1B 2H51A 3SZMA 3IB6A 2CD7A 3NHBA 5ALSA 4LJKA 3GFVA 1RW4A 2VEDA 4QL3A 2G4LA 4W9MC 2XZTA 2ZRCA 2NN3C 1B0PA 1XF9A 3O83A 3T4PA 2WJHA 4URYR 2QRVB 1VMAA 1R3UA 3GU3A 3P45A 5EUCA 4E0BA 4GR9A 4G5GA 4RCVA 1S2GA 5D2CA 3EZYA 3MN1A 2O2YA 2PZMA 2DU8A 1LS6A 1FUKA 4CNBA 1IBKB 2Q3EA 4DM3A 2PBLA 1SIBE 3VQTA 2H52A 3QVVA 4BO5A 2AXPA 1H1LA 1E4EA 3IPXA 3BB3A 4IQ0A 1EWQA 1UBRS 5DX8A 5BT9A 4M53A 3KP1A 3CM0A 3NWJA 3RVSA 1GOTA 3CZCA 4R7ZA 1E1DA 4W63A 1SU7A 1WCIA 2KE5A 2QD3A 3IRUA 3SX2A 4A8PA 4BZQA 5ALVA 4QDZA 2C94A 1ZNWA 2WKWA 2ZIUB 1KVSA 1XRJA 4OLAA 1FJ2A 3B1ZA 4L1KA 4YGXB 5AUQA 4DR1B 3C3EA 5MF6A 1Q19A 4UKDA 2WIJA 4CZ2A 5JLJA 2C2OA 5AVXA 3E22B 1LJ8A 1Z08A 5IF9A 5HKLA 5LZ5A 1HDRA 1KF0A 2FUG6 4TQAA 2Q5HA 2XZDA 1TL7C 1LDMA 3ENNA 4HGQA 5BOVA 3RHFA 1ZM4A 5A4DA 1A9SA 1VA5A 3KBBA 1MIOA 1ZAYA 3X44A 5H9WA 3FWNA 1FSFA 2RKBA 5KNCA 5JFOA 4MK4A 1HR0B 3LT5A 1H9CA 2HPZA 3IA2A 3WLKX 5F7XA 5ITVA 2Z1MA 4RD4A 1OZGA 4DIUA 2XADA 4BMYA 1BXKA 3OI7A 2OHJA 5AJYA 3BXPA 2JGFA 2IDMA 1VDZA 1O94A 2X15A 3ET5A 1BMTA 3KOZA 2WJVA 5JAIA 1VPWA 5J5AA 3V6MA 1P4JA 2AMLA 2BR4A 3W5CA 2GFIA 4QTXA 4FC6A 4C7MA 1EUYA 3AJDA 3HU3A 4KVGA 1K4KA 3OWHA 4QNNA 2ZAIA 3WL6A 5ICMA 3C7AA 5BNWA 3KOUA 2BAGA 5J63A 3O2QB 1IQUA 1YZVA 5F35A 1S2DA 1DNPA 3FUUA 4Y30A 5ESWA 1J97A 3MJ4A 4CDGA 2ACEA 4FYMA 1QFZA 1UP7A 1STOA 4NNJA 4XRRA 2PWBA 1VE7A 2YWJA 3R3HA 4Q1VA 5KOHA 4XVRA 1IN7A 3HYTA 2HN9A 3QYJA 5TMBA 3WV4A 3TJZA 4Q37A 5DGXA 1EA5A 1FQOA 2D8AA 2O0HA 3CLRD 1YTLA 3EGXA 2C8VA 3NGLA 1ADBA 5KVCA 2AG1A 4WLOA 1WF3A 5C8YF 3AT1A 4M6WB 4PZLA 3TLAA 1H2EA 3PCXA 4XM2A 4M0KA 4DMGA 3QYPA 4Q15A 3S4YA 5B55A 4ERNA 1YB5A 4CEJA 1RKVA 1DRVA 1DV2A 2PL1A 2X8JA 5IBPA 3H9GA 2BSQA 1XIVA 2BR3A 3H2KA 1FE8A 3AERA 3GG9A 2H7CA 1D07A 2JLSA 2O8NA 5B57C 2QPAA 4MUYA 3TAUA 2A6PA 2GEUA 1HEIA 2BFCA 1KVTA 2ZQ5A 3NIGB 1B41A 1K8YB 2VDQB 2VPZA 3PITA 3EVNA 2ZIXB 4G24A 3OTOB 3MJTA 3FFXA 2EJWA 1R0XA 3D2AA 3GEGA 3MTJA 2W4IA 1YMVA 2GBPA 1I9CA 4JJEA 1YVRA 4R4JA 2AN3A 2DZDA 4MICA 2HEGA 1XZEA 3AUFA 3C6BA 4QDTA 1G0NA 2RHCA 2GZDA 2X40A 3ONDA 2XGMA 4M0PA 3FVWA 3RCBA 1RHQA 2G6BA 4L8WB 1Z3CA 2P2SA 2G67A 5GGXA 5B3JA 3M7IA 5JCPA 2O2GA 5NULA 3OQ6A 1LK7A 1XZMA 5LD2B 1DQYA 1F1BA 5LMUB 1B76A 2VDJA 2R4TA 4PRYA 3HSYA 3OFND 5KJCA 4CRWB 1U0SY 3WBJA 4F9GA 5F3DA 1ZM7A 1JU3A 1XQYA 3P7MA 5EUQB 3B7PA 3RNOA 1KH1A 2BM8A 3HNPA 5L95A 3IIIA 4DCJA 2WTUA 3S2GA 5B53A 1A5BB 1B2RA 1UMBA 1T3SA 2XSZD 3NC4A 4RXTA 1Y8QB 3OQOA 4ID3A 1AV6A 1SJ9A 4J0GA 1HDGO 1XQVA 5C8DA 2ONYA 2FLVA 2Y0EA 1CZOA 4BQQA 4GR4A 2JATA 4YJKA 1FMTA 1BJRE 1GV0A 1NU6A 4O8ZA 4UUOA 2IUFA 3PL1A 4C0WA 4MSUA 3A6DA 4IHAA 4BX0A 2GO1A 2V7WA 1YOBA 3TZKA 2JD1A 4DDVA 1TJ5A 1BTOA 5IXYA 2JFPA 1PFUA 1C0LA 1PR0A 2GNOA 5EP3A 5SZHB 3VR4H 1H6AA 4IRUB 3C43A 5FI3A 1DTWA 2GEVA 2WPDD 2RGXA 3KB1A 2FF7A 1N2JA 2BZ1A 2GPYA 2Q5OA 3FRIA 4GM4A 4O5AA 3TL3A 1MFZA 3BWYA 1CD5A 1PTJC 2QL6A 3KOOA 4HH3C 3M1IA 1Q6YA 5E9QA 4DRZA 4TPKA 1OA0A 4JX8A 4L5IA 1C9YA 4RH1A 4CIXA 2REOA 2HSEA 2PPVA 4YV0A 4LZLA 2HY7A 2GNAA 3GA7A 2GSWA 1CUHA 3C3CA 3E9QA 4O63O 1EXMA 3ESAA 4Q02A 3MUEA 3UMRA 1QPGA 4ND1A 3RHTA 1OX6A 1E79D 2E37A 2YWHA 2Z8XA 1D2NA 2FDCA 1U9IA 1ONSA 3KZXA 1EFVA 3MAAC 3PD7A 2ENWA 3LVRE 1YZTA 1JQAA 3HEMA 3FVQA 3V1LA 3I8XA 4NCXA 1LPBB 2VHEA 3I4LA 1JIVA 1MLDA 4H6WA 4KWHA 1Z37A 1DG3A 1QTNA 2CXOA 1I1HA 3T12A 4MQFB 3H5LA 4U5QA 1WUYA 2VHVA 5LN1A 5DYGA 4ARCA 4NS1A 3X43A 2FLKA 1JLLB 1L8QA 4E5YA 3GDGA 3ICCA 4TKMA 4J2TA 4YRSA 1IQRA 1TC1A 4MIEA 3NEPX 1HTTA 2G1KA 2PMFA 4N48A 4LDJA 5HFAA 4C6RA 3JYHA 4PFQA 1BA2A 4FOPA 1T9BA 2NSHA 1WOMA 2OGWA 2HXSA 1IUNA 2NXJA 3DFIA 3TDMA 1XNQB 2VN8A 2YCLA 4B1FA 1CHDA 5BN4A 1TYEB 1HMYA 2GA9A 2WWWA 4ZMBA 1KHTA 1N5MA 4BMDA 4EG6A 2VWPA 5FWAA 3GGOA 1WVIA 3EW7A 1WMSA 5KU7A 1EAMA 5K2OA 1NV8A 4UCQA 5H3HA 2PN1A 1EGAA 2ZU0C 3D2LA 1J39A 1ZMTA 2EAUA 3CF4G 3K9LA 2XA1A 2PLAA 3NAQA 2HIHA 3WLMA 1TZ2A 4LCEA 3QX7A 1A9ZA 2H2HA 1O08A 4BOYA 3FDZA 3M4NA 1UPTA 5FNVA 1TAQA 1N92A 4DMHA 5BRJA 4EG1A 3A36A 2HJHA 3L5OA 1WV0A 5L7TA 3PPXA 4E5PA 4IICA 5FUMA 3RVDA 4YR9A 3REOA 3L1KA 2IEGA 2R66A 2J9XB 3D3WB 1K88A 1IHPA 1DJOA 1YZYA 5JY6A 2A5YB 4HUJA 4U7HA 3N53A 2W2LD 4YTEA 1XMJA 1HYGA 5LIPA 1MZPA 3PZBA 3ZZ1A 5HSGA 2UVPA 2CZGA 3VO1A 1I3CA 3TTUA 1REQB 1PIWA 3TWOA 4P53A 4QWMA 1P5RA 1E9FA 1PQYA 5EIBD 1XU4A 3BTSA 1D7OA 1VTKA 2WWRA 1D0IA 2FSVA 2R84A 4KRYA 4UDNA 3KR0A 4F71A 3MWKA 2XQGA 1TW2A 2WM8A 2YZ7A 3QBJA 2D1RA 2WSMA 3N2ZB 1RE1A 2LKCA 4I08A 3I12A 3R6DA 2ZBDA 4FLFA 1TYDE 4R3WA 5LYJA 3L7JA 1OTXA 2X76A 3CMMA 1GQFA 2AFHB 2R48A 2ZBUA 4DIMA 3MTAA 1Y80A 3DPUA 4MCHA 3OTGA 4D42A 4BO6A 3SWWA 3A4YA 4PIMA 3GWZA 8LDHA 3VDNB 4B0PA 1GGKA 1Y4UA 3DL0A 5EZSA 2QRPA 4M9UA 4QYIA 4JT4A 1PEAA 4LI0A 3N07A 1T9HA 2AC2A 2EEPA 3I5AA 2JKYA 4D5GA 2A0WA 2OCGA 1KI9A 1V9LA 3MOIA 2YJ6A 4KUGA 4A2QA 3F1LA 1IQPA 1U2DA 3M5DA 2OV4A 2FG6C 1LV7A 2D0OB 4URVR 2F48A 4B3IA 5AUPB 4FSHA 1U2SA 2DQSA 4NU5A 4WGFA 1U5BA 4BKPA 4A0RA 1UM9A 1VYVA 2WLSA 1M2OA 1EFRD 4G3XA 4WCFB 3KB8A 4RSGA 5THXA 2QQ5A 3WRXA 3FTEA 5EHZA 4KUHA 4LF4B 4DZRA 1KO8A 4F04A 4UZFA 1NMQA 3O8DA 3CZPA 3L07A 2PQ6A 4KIUA 4QEZA 4UDOA 3J80A 5CCEA 4MUKA 4XX1A 1RWNA 1O7JA 3EIXA 4J3NA 2YDXA 1XQ1A 3UN1A 4RZHA 2BGIA 4E6PA 2HREA 3MJDA 1YF3A 2QE7A 4Y2YA 5IJZA 4IL5A 1L6RA 1OI3A 1ZLYA 4EPRA 4XQ9A 4RS3A 4S12A 4Y67A 5FIUA 4TT3D 5FBQB 2PUFA 2B4TO 4JNCA 4CEHA 5PNTA 4ZYTA 5I4KA 2HDHA 2NQTA 2H2AA 3N74A 4C29A 1O8BA 2C9DA 5KOYA 3TLZA 3S99A 2IW3A 2O3UA 3AVOA 4JS0A 3N76A 2AZXA 1T9GS 4IOKA 3WQRA 1NVDA 3DMTC 4XOUA 2IE0A 2ZUVA 4R1OA 3FOEC 3ENQA 2EP5A 1TF7A 4RTJA 3LV8A 4W5QA 1T6NA 4WNAB 2Z2YA 3WLRA 1Q0ZA 3A1FA 3GN1A 5GWXA 3GDOA 4DQDA 3P8ZA 1GL3A 3N2YA 2MT9A 3JATA 3KE9A 3UMGA 4H7PA 1MDBA 4CUZA 5I9BA 2E5WA 1A3CA 1OH7A 4LJ5A 3FUVA 4OMCA 3ZE8A 2VBGA 3LBHA 2Q6TA 3OFNA 4ENUA 4O4IB 5BWNA 3WWOA 5AJZA 3VAYA 2CE7A 5LP6B 1CRQA 4MZXA 4AJLA 3FYTA 4YP6A 3L4JA 2YKGA 4CM1A 4CDMA 4Q00A 3OZWA 1D8TA 3IPYA 4ZV7A 2FPUA 2GKGA 2ODAA 1L4MA 2XSZA 2XVXA 3TQQA 3JQPA 3RV3A 3THWA 2BPOA 2PPLA 3KYCB 2QVBA 3KK0A 1I24A 2EGUA 2AMYA 3AQ4A 4M76B 1L5QA 3BX1A 3TLGB 4RVOA 4OKIA 4JI4B 1KA9H 3PL5A 4ZQBA 4X62B 4KIWA 4DSAA 4HS4A 1I4LD 2DR0A 2XKAA 3A2MA 1L1EA 5ELXA 1DQRA 1TECE 2Q4DA 3A0UA 3LAWA 4WVFA 4ALNA 2FJPA 4UHKA 1BD4A 3NWPA 1S2NA 2YMQA 2X0JA 4IGEA 2H9AA 4YPFA 4AULA 5KNLA 3D4BA 1GGEA 1GCOA 1VGQA 1Z82A 4FNAA 4RGYA 5TGZA 2AJDA 3DL4A 4DCGA 2ERCA 3P9ZA 2PZAA 1Y42X 5KQSA 1G63A 1N25A 3WY9A 3K0CA 2CFRA 1NMSA 1U4OA 4BGUA 4DPMA 2G5CA 1EP2B 4PQFA 5EWMA 3WNVA 2IT1A 3K6SB 3IULA 4MJ7A 4U0JA 1XXHE 4OX9Y 1ANKA 1SZJG 2IYYA 3EVFA 3F49S 3TNDA 3P9QA 3MELA 3Q5DA 2E1RA 4D79A 4DTIA 1MO2A 3JRXA 4DYHA 3AESA 1BOOA 3OSUA 4D5EA 3COWA 4MGZR 5FEMA 2Q4TA 4LJ6A 5BNTA 3U44B 2J0EA 4DLYA 1WPRA 2XIJA 3FR8A 1Q1BA 4N3BA 5KB3A 3FUXA 4Q7MB 1RMTA 4QJ5A 3V8MA 4JLPA 4DIDA 3F5MA 3RDPA 4EGAA 1E79A 3LT4A 3BDAA 1N3YA 2O8CB 5K0GA 3DEHA 2WMNB 3GMDA 3M81A 1U5CA 4L02A 1SKYB 4BEJA 2NVUA 3SAJA 2PNFA 2D4AA 5IAOA 3DVRX 4I50F 4RLSA 4HDSA 3WHIA 4F8YA 3VR6D 4CKBA 2ZYTX 3GJRA 3FNHA 1S8FA 4ZD6A 2HUNA 3C5EA 2JGNA 2JBAA 4UQPA 5DHSA 1OH8A 4MQ5A 1AK9A 2JHCA 4X63A 3RSSA 5FOQA 1B8NA 1Z6TA 1P3JA 1GGJA 2O5VA 1KSFX 2A7XA 1S2LA 2XI4A 2P11A 3GGPA 4GPTA 5AT1A 1X7WA 4Z6KA 1IN6A 4XM0A 4UOZA 5C46F 4PG6A 1L5VA 3L7MA 4NATA 4QKQA 4YONB 4WXHA 2VWGA 3DULA 4FZ5A 4F9FA 2OD9A 3O4VA 3JQAA 2ZYVX 1WY7A 4N12A 4A0GA 3BMQB 3EBOA 3WGTA 5C5DA 3K31A 1AN9A 3ZOKA 1LF5A 5F5XA 2GZ2A 4NG5A 4X95A 1IRIA 2QLFA 1T8TA 4Y6GB 2ZAGA 3I9V6 4UBIA 3L82B 4DJFC 2H1HA 5DBOA 2ZBPA 1KIFA 1LD3A 1WG8A 3FLEA 3TRHA 3WYCA 1L5WA 3CX8A 3KFLA 5CITA 4I66A 5BSEA 3L77A 1XRMA 1V3VA 4B6FA 4ZICA 3FWYA 1RXEA 1P0CA 4RHCA 4MVJI 2NV2B 1KAGA 2Q6KA 2VHZA 3UGQA 4FCVA 4LXUA 1TZCA 3M4JA 3FXAA 3SBXA 5FYQA 1YJQA 1XLWA 5H3LA 3PPIA 1N4DA 2A84A 2C5HA 4F6RB 2GYWA 2FW7A 1QH9A 2W2LA 3JQ7A 4PZ9A 1QAQA 3TG8A 2O59A 2J3JA 3G2OA 3G89A 1DKQA 4HWOA 4KMMA 4P6VF 2O2CA 2RD2A 4DBZA 4AO7A 1T1SA 3FNRA 4LXGA 4X1IA 2XAAA 4NBRA 2AI2A 5EUMA 3ROXA 3WLPA 4C06A 1XAJA 5B3JC 3HFJA 1VRWA 3ISVA 1NI4A 4L6AA 2VCHA 4JLWA 1DKOA 3BHMA 4KQHA 1N2ZA 2R7MA 4NWIA 5BQXA 1J00A 2UU9B 4A5SA 3UH1A 2FW1A 3QWAA 1U0EA 2PR7A 2Q3CA 3NBKA 4UUNA 4BP3A 4EJ0A 3PIIA 1QFSA 3B5IA 5AM3A 3UJ9A 4CF4A 2XV1A 1EJ0A 4LSGA 1WHSB 1BXGA 4ILEA 3CVXA 4H08A 1BQ4A 5KMGA 3L8ZA 4KIGA 3FHLA 5IEJA 4LG1A 2OK8A 3W9YA 2Z5VA 1H3NA 4PZAA 3WSVA 5AKIA 3HRIA 1C41A 1ZOPA 3FFTA 1TB4A 2DBZA 5ARDA 4P3XA 5IBRA 3PI6A 4MPJA 4ZAXA 4Z49A 3ENZA 1XMIA 4JUIA 3NANA 3JQFA 1GXSA 4DCUA 3K20A 2FPSA 4ECEA 1ZCAA 3ANMA 3AM5A 2C00A 4RD0A 2ZRMA 3QHPA 3A1WA 1E2QA 5JSKA 3VBEA 2V96A 1U28C 2WHPA 3DTVD 1LSJA 5HQ3A 4WZAB 5CXXA 1IL0A 2YTZA 5ELMA 5BSGA 4ZREA 4IG4A 2AHOA 1JG6A 1E1CB 2WUVA 2G8LA 4ZHQA 3LZ6A 2Q4BA 3NH6A 3CNNA 3C4JA 2OGTA 1SOWA 3BK7A 4GWLA 4HN9A 4HRAA 1JHPA 1UXGA 4RKWA 5DF1A 1VMDA 4D99A 3PXAA 2VF8A 1SB9A 2ZWVA 4N7RA 3ST7A 4YLYA 4GZ5A 3QEJA 2B8TA 1CNEA 2RAVA 2P91A 2VYQA 1EX1A 4P5PA 4R9SA 3TKYA 4QU8A 2HU2A 1E1QA 2FP4B 3D8RA 1PGNA 3D0RA 1XE3A 1D1TA 1C3OA 3JQQA 3FNBA 1DXQA 1J25A 1H1DA 1K86A 4U9IS 4AVYA 4KVZA 4OFBA 4WKCA 5JIBA 1MW9X 3OF5A 3T5GA 4Z7JA 1IN4A 5B30A 4FS3A 3A4IA 4KQWA 5TS2A 4KQ2A 4OHBA 5KTPA 3G8DA 1K8ZB 1U9IC 2BHNA 5ALKA 3VHXB 4W7SA 3W9BA 3K30A 4ZEMA 4P0PB 2JGRA 4M83A 1CS0A 4I6EA 3HB5X 3CEAA 4OB8A 3BMOA 4IDGA 4C22A 5JZVA 2XRFA 4OU5A 4TYWA 4TV9B 3A37A 2C2XA 1FYEA 2GN4A 2QN8A 1BO6A 4RWEA 1XN1A 4NK5A 4DIOA 4PEVA 4RTRA 3EZGA 2HQRA 3N8HA 1KBZA 3GPBA 1SVWA 4XZ3A 2KWIA 3T3DA 3ZZMA 1IATA 1UC8A 5CTAA 3EDOA 3W2IA 5FL7A 3K32A 4PG5A 1YUMA 1PNQA 2OSBA 4TWRA 4NMWA 5BN1A 1GLVA 3GLKA 4N03A 1OAOC 3QV2A 3CRRA 5DU2A 3M70A 3N7AA 3QEMB 4P9NA 1PV1A 4IILA 5I3ZA 2GAOA 3HEAA 1NQUA 4C4ZA 4NBWA 3QFCA 2BBTA 1M0WA 4BEWA 3TMAA 3PKZA 2CNWA 2A3NA 5CX1B 3DMPA 3O8OA 1RM3A 2FX5A 3DWFA 2FPPB 3C5VA 4G1EB 4LWOA 3PTAA 3P0FA 4RY2A 1A8QA 1UK9A 4BEBA 1QIHA 3JR3A 3GAMA 4BXOB 1B3RA 1QHSA 1GEEA 3NHKA 4C7OB 1VHTA 2DG2A 3EEBA 2PJRA 5J2TA 3UFXA 1W5BA 2QJRA 1ACLA 3DH0A 3QNMA 1GRVA 1VA4A 1D4FA 4D57A 1GSIA 3E7PA 1OBCA 4BLWA 1UFKA 3C1UA 2ZT7A 5H4GA 2QT0A 1XEXB 5CVEA 2XMQA 5KTKA 2CL6X 2FSVC 4OQEA 2OM6A 5JAZA 3F4BA 2VDWB 1HM5A 2HRDA 1S9DA 3IODA 2FUKA 2ZM6B 1BX3A 2DPGA 3P9IA 5AXAA 2Z2XA 1WPGA 1JR2A 4BO8A 4EKGA 3FTQA 4DRXB 4INJA 3RHZA 1ADGA 3IIMA 1JKIA 4YRFA 2OXEA 5A4JA 2XVYA 4HS9A 3C3KA 2G07A 1Z2DA 3L6DA 4AF8A 5JT1A 4DKJA 2CEKA 3A6ZA 2I3GA 3CC8A 4YRJA 4M7PA 1EFLA 1WV1A 4BVJA 5KKCA 1E0DA 1MQ9A 2ZVJA 3I2GA 5C8VA 5HUQA 3WIOA 3CZAA 5J4VA 1RRGA 4J7CA 3P9RA 4D9GA 2GH1A 1U8AA 1Z0DA 2GEBA 2Q8NA 1TMYA 2B2NA 4C14A 4S04A 5LOVB 3ROPA 3EVBA 3IP5A 2XT6A 3HCAA 1X1SA 2DHCA 2IEAA 3FCSB 1Z38A 3G0OA 3WRXC 1TEHA 4BLVA 3K0KA 5DNAA 4EB3A 2O8FA 4I9HA 2R86A 3S2IA 3UF0A 5CT6A 2J0UB 3GAFA 2WD9A 3CW2A 2NUTB 4KZPA 1NXTA 3WB9A 2Z98A 4EI9A 3W5HA 4E4RA 3DOJA 3KJGA 1E8NA 4X8MA 2OESA 1AE1A 1ZX1A 3LT1A 2MSWA 4Q39A 3ZHRA 5K0TA 4OH7A 4DSOA 1QQAA 2IELA 3PS9A 4H7HA 5IAEA 1YAHA 1P4SA 4GX1A 4J9VA 4ZDKA 1IONA 2EFJA 2RH5A 2OECA 5B7QA 3BQ9A 4RULA 2B7CA 2NU8A 4PXSA 3UZUA 3G6WA 5EJEA 4ERXA 2ZIGA 1XJWA 2C7GA 3ELDA 5C80A 4KWEA 3GLIA 3PDJA 3LK6A 1JTFA 4DDWA 5JXHA 1Z36A 4XCXA 2XUJA 5EPOA 2FEOA 2Y27A 1ZD3A 3DFZA 2CUZA 5CNKA 3EB9A 1CR6A 3L8GA 3SP1A 1H5UA 3MWDA 3DHVA 4BMCA 3F6BX 2ZSUA 1GZDA 1TXGA 5IC6A 4O3MA 4EJMA 2GM3A 3IUYA 4K1LA 3VZBA 5F7OA 1ZM9A 1OLSB 1ECLA 1GKYA 3IR6A 2PGNA 4Q66C 3OEHD 1I3KA 4YXWA 3EQ2A 4FB4A 1OFVA 1JFRA 1P3DA 3GJ3A 4DN6A 5KNDD 2QDKA 4A10A 4CMIB 4X5OA 1DAGA 1JEJA 3DB1A 4YRLA 3TQFA 3LUPA 2APJA 2SNIE 4ZXPA 4RTSA 3OHPA 1Z0ZA 2EF1A 2P9HA 2ZZKA 3WLJA 5B7GA 5CB0A 2GXAA 1LNQA 1KZ7B 2M1XA 1X6VA 2H5LA 3IUBA 4WFIA 3AYZB 1XN4A 2ZJOA 4YMVA 1ID8A 3C6XA 3MFYA 5EY5B 5FUYA 2PUVA 4PE5B 1OBHA 1LDYA 2QR2A 1IAVA 3B36A 3GJ4A 4CM8B 1GA1A 3NWBA 1E99A 4ROTA 5DTRA 5LR6A 3LDHA 1R3DA 4TQ9A 7REQA 3H2IA 4C0HA 4RTPA 2J0QA 5AI5A 2C07A 3PT5A 2JA1A 3PKIA 5CR9A 1HUQA 4E4YA 1HE1C 4D8YA 4EHIA 3BDIA 3PQDA 2PO7A 1M1NB 1VZ2A 3IDQA 4UBKA 4LHYA 4XDHA 5E0KB 5EXEA 5AESA 3WSTA 1DRJA 2EBUA 3AEZA 1XVVA 3H13A 2QGFA 2ZI9A 2VDKB 4L5CA 1X13A 4HNQA 1LX6A 1GPWB 1KMIY 3W2HA 4FM9A 2I7XA 1XMPA 2E7ZA 3ZR4B 2NUAB 4BNVA 3TQCA 5I47A 1GTSA 3ANNA 2WWYA 3RNLA 3AETB 1T9DA 2BEUA 4HYQA 4EQ6A 3JAKA 4ZOBA 5DNEA 1W8IA 3HS3A 3K0CC 2YQ5A 3IAXA 3DDUA 1QG0A 3GL9A 3KYBA 2ZJYA 5CRIA 1ZW6A 1MIHA 3Q0TA 5G4KB 4H7IA 4OLBA 3BF8A 5FH9A 1NW6A 3WTBA 4DOMA 4L8LA 2EP7A 4GSYA 5EP2A 5UKDA 2BOVA 4M9ZA 1AA6A 2PBRA 3OF2A 4MZDA 1SOMA 2QTFA 4B7ZA 4EYEA 1U8UA 5I4IA 1E69A 2LD4A 5C1IA 4BKOA 1QQ7A 1M74A 3AF1A 3IAEA 2QG6A 4S0XA 3WHPA 3EQ9A 3KYDA 1Y1SA 2POQX 4W82A 4AMVA 3PLAE 3ZGYA 2P8JA 4S2UA 2WWHA 1O57A 2W11A 4FQ7A 1PR1A 5JE8A 1E0AA 1KK0A 2VHJA 2WTEA 3ZDXB 1ULUA 1X2EA 2VDPB 2VJMA 2ZUSA 4R3NA 2JIDA 4PNPA 3DKRA 4PLHA 5C32A 1TCBA 4D3DA 2QX6A 3HP1A 3NETA 3D6VA 5C18A 4NCAA 1BXRA 1C0KA 3K9NA 2OBBA 1GUBA 5C5CA 4IMPA 1BE6A 1BHO1 1N5RA 3A26A 1BU5A 2XHEA 2P6NA 3VJMA 4PQRA 2ZCUA 3P2EA 4R9NA 1Z0IA 3ZBQA 1XB2A 4B76A 1SMKA 4PFSA 3GLFE 1V5IA 3CJRA 1W87A 3AHIA 5KHOC 2HRQA 2AEFA 4BAZA 4LY3A 3DMGA 2VJPA 3M6UA 4R1MA 2WVJA 2QENA 2BBSA 4L8GA 1S2MA 3RRNA 2WD7B 4K26A 1VJCA 5FFNA 1G21E 3EDQA 4D0NA 4EO9A 4KR2A 4YAEA 1JV2B 2R6DA 2YIJA 1KJIA 2XIQA 3U9SA 3C7KA 1CQIA 3HM9A 4DZTA 3M83A 4B4KA 1N0HA 1A1SA 2H07A 1M2FA 1ULHA 3QITA 1UDXA 4A8JA 4MMXB 3D5TA 2XZOA 3STWA 1N9ZA 2Z6UA 2I3BA 1NXOA 4MW9A 1A9TA 1GQSA 1BH2A 1M1YA 3LPAA 1FIUA 3DD1A 1FNBA 4XGKA 1U2GA 1LSOA 4JLMA 4PZ0A 4F8EA 1G66A 3AI1A 2HK9A 4NPCA 3UUEA 3TUZC 3BMXA 1AHNA 2ZWMA 4M0FA 4GKAA 1MAVA 3GZNB 1UK7A 3OZGA 1XZIA 3ILXA 2H4FA 1GILA 2JGAA 2RG1A 3DDNA 2QNRA 3FR7A 1FRFS 4EQZA 1NW8A 4DCTA 1XU7A 4RSMA 1G2QA 1ZICA 4FGWA 4LRTB 1JKMA 1GFWA 1TVEA 2B98A 2IYQA 2VHTA 1FPQA 2WY2D 1RLIA 3A2LA 3EC7A 1QZXA 4P22A 5G1OA 3RIGA 2Q8PA 4HXFB 2KS6A 5H0IA 1S89A 4TYQA 3U7GA 3B1FA 3OD5A 4D8TA 2XMCA 2IX9A 4YJ3B 1P7YA 4P8RA 1JQBA 2JJ2D 2ZUEA 1EVYA 1QYVA 1ZN9A 2CMDA 1ISSA 5HZGA 3RS7A 3IAHA 2XZPA 4LS3A 2AJ8A 2YFYA 4B84A 4KLCA 2AEJA 3ISTA 1TD1A 3DM5A 3SJ7A 521PA 1P6XA 2GRUA 3JQFC 4CKYA 1MX5A 1W9MA 1GCAA 1Y9ZA 2HHCA 3CKLA 3E0XA 4YT4A 5M04A 1ETHA 2PTHA 4LV6A 1BG6A 1SBHA 4BV9A 5AVYA 3THXB 4TSFD 4YMLA 1DL5A 3DWIA 2YFKA 3G59A 3PTLA 3P2JA 3L1VA 2GVDC 5ALDA 4B85A 2G1UA 1YNOA 1S8NA 1GD1O 2W4MA 3IP9A 3OZSA 3CX4A 2IVFA 2IGBA 2PMBA 4M9QA 5EIAA 4B5KA 1R0YA 2IS1A 4NABA 5CEJA 4FEGA 1F4LA 5FO1A 4E03A 3EPKA 2UYCA 2ZXFA 2H31A 4ATNA 5B6PA 3V8BA 3HXMA 1ZL2A 4GRAA 4JCCA 1GFIA 3RRXA 1SB8A 3UJ7A 1EFKA 2EDCA 3GBPA 3H84A 3LGXA 1DT5A 1IDOA 2G17A 2OXRA 1DUVG 5AKYA 3RT9A 2O2XA 1TQHA 1W34A 3N39C 3TXAA 1VPVA 4IIXA 1I8TA 3EGWA 4WZ6A 4HEJA 3OZTA 1DKNA 1FTNA 3IKMB 4D9HA 1Q1EA 3LX8A 4FFOA 1L5LA 5TE9A 3K70C 4ZI7B 1FA9A 2GJ9A 4G36A 3SBDA 3H8JA 4K88A 3DPIA 2ODWA 1T25A 2D2VA 2D0IA 1KMNA 2I33A 3KT6A 3W8NA 1E3LA 4UJ5A 2PWAA 1L0BA 5HJ2A 4F97A 1ULZA 2GFHA 3L01A 4UHDA 2I91A 1NLUA 4LHWA 5HS6A 2WV9A 3K2QA 2CMKA 2J07A 3PHCA 1NMYA 1KI3A 3CNQS 4PLYA 5KNDA 4R98A 1JVNA 1XJ5A 1PSZA 4JUDX 3IGFA 4GMGA 4B3FX 1H3FA 4MDYA 2GRJA 1BFUA 3HMQA 4R9RA 3C70A 4L4SA 5COQA 1LPOA 1Z6AA 1WD5A 1EUDA 1QQ6A 2YWGA 4N5MA 2FZKA 1TVKA 5BYJA 3RFVA 5LQUA 5I7SA 1FLDA 3KUKA 5LMZA 3PJRA 4LC0A 4XOIA 4FJ0A 3AB8A 4TMVA 4EHDA 3R2JA 4L8VA 3G7UA 1V11A 3OE5A 5B58C 3OE7D 3F7MA 4KX3A 2HYIC 4KLAA 5JSQA 3DEJA 4DQXA 1AKNA 2J3MA 2ORVA 1M34E 1KC1A 1RRVA 2Q4OA 1XSEA 1J8VA 3EA4A 3G5LA 3NIBA 4M1SA 4UMFA 5FRDA 3VO2A 3JVEA 5EYPA 3NUZA 4MR9B 3ZDAA 1Z68A 3G2HA 1IH8A 3KZVA 1ESEA 5JR3A 1WLYA 1H0SA 3QBEA 3PI7A 4TS1A 5IK2D 2BFDB 1EFPA 5HQ3B 5A2QA 4Z86A 1D2CA 1OASA 3UTDA 3G68A 4CFSA 4RL4A 4WK2B 5CFMA 3AF2A 1RQ7A 3TFWA 2QVCA 1JPVA 3U37A 1T9GR 3QPVA 4PC3A 4LVNA 3CUSA 2G77B 3X1MA 4MWGA 1X7GA 1T2FA 2B4YA 3I1YA 3R0VA 2A94A 2IOYA 2JIZD 3Q9SA 3O91A 1RC0A 1ECBA 2IXBA 1RXVA 1D5CA 4HPXB 1LS1A 4H16A 3URKA 3WLTA 3IAS1 2NP7A 5CNIA 3QJYA 1JDVA 1J6UA 3LUAA 4YN3A 2IV3A 4EA8A 8ADHA 2BI8A 3RG2A 3VAAA 3D6JA 1AXRA 4KL8S 2P2YA 2DUMA 4NI5A 3LW8A 4TLLB 2OK7A 4BIIA 1FRQA 4MRPA 6REQA 2ES4A 2IHZA 2HXYA 3BIOA 4G56A 4F4FA 5FBHA 1SBQA 1MR3F 1YZQA 5HHTA 2MOKA 2E6UX 3NBYC 4J4BA 1UBTS 1F3OA 1QNLA 3KEMA 5FFFA 5L3QA 3EGDB 2NU9A 4V24A 1L4KA 2GXSA 4QYSA 1KZ1A 4KH1A 3VJLA 1LJUA 3ZTYA 5GZ1A 4AKEA 4JGBA 3VFDA 4CNQA 5LYJF 4KMSA 1GVHA 1F9EA 1FX0B 1WLSA 2C4TA 3QX8A 1TKRA 3KZKA 2AG5A 1WZUA 4E33A 3ICPA 2OOKA 2WYHA 2JFQA 1MXHA 2QUKA 3EEQA 4ACAA 3K09C 5IT4A 5CH3A 3E5MA 4PPYA 3PDCA 4IIVA 2JCYA 2XQKA 1C9MA 4ZODA 2YFHA 4CM5A 1KOGA 3K5WA 1M2KA 2R5WA 4MVJA 4FFWA 4FSDA 2OHIA 4NBVA 3QMPA 1JMVA 2A7QA 4DR3B 3DLPX 3O90A 3M9LA 4HNHA 1A8SA 4UHCA 2MINA 5CVVA 2AIRA 1FVFA 1V8PA 2P77A 5AKXA 1FW6A 2C0QA 5DGHA 4QRIA 1AUVA 1PJ8A 3KPWA 1LI5A 3PDHA 4D1YA 4A36A 4GGPA 3OHSX 4FC7A 2XTNA 3AY3A 5FJJA 2GGSA 1M7BA 3L8DA 5B7NA 4Z7OB 1V9SA 2OVFA 4EYGA 3GJ6A 1CY6A 1Y63A 5E7MA 3KQSA 4GE0A 1K1EA 2CC2A 2ZOSA 3WA6A 1UPXA 4D3ZA 1VPEA 2VJBA 1U5AA 4J0QA 1W4LA 2PKYX 4Q34A 1PJTA 1T4MA 2ZVDA 3A05A 4Y7CA 1GT91 5JNTA 1YUNA 1GZ6A 2PRZA 3LA6A 4ZYYA 5E0OA 2MWMA 1ACJA 1JPUA 2OSVA 3AGPA 4W5WA 3ZHVA 3O31A 1LBSA 3IQEA 3FNIA 4N0QA 3VR5A 4BVGA 3JQCA 4DARA 3NUQA 1S3FA 3ROEA 2AFRA 2Q2OA 3AM4A 3N2GA 2C7PA 5LU8A 1WB5A 4URHA 2B7BA 3S3TA 4AP6A 2ZBQA 3E7FA 1NQOA 1J33A 1ZINA 1KVRA 1P4RA 3HP7A 3KVOA 3RVKA 5CD1A 3AKYA 2NU7B 2PVCA 2LDXA 2J08A 2PXAA 2QSJA 2VJOA 5ALQA 2I29A 1AHPA 2BFEB 1N2CE 1KO4A 2Z9DA 2D8MA 4HL6A 3FSGA 5A06A 5DM2A 4WX2B 3QVGA 3H2GA 2KQUA 3P0HA 5ALWA 2AOTB 3TSWA 3MJSA 5LPNA 2NO1A 2B82A 3DF7A 1ESMA 4KG7A 3HA3A 1XA4A 5CLHA 5GOTA 3GLHE 1DEXA 5H70A 2FTKE 2JJ2A 2CDRA 1ZL0A 1Y8RA 2RJNA 1JHMA 3KKZA 3LCCA 4QVGA 1I30A 5IHXA 1NVBA 4AY4A 4CU2A 1R88A 2JH3A 5K3BA 3TAXA 1T3HA 3CX3A 3EN0A 1U6JA 2UZIR 3OJ0A 2X3UA 3NYIA 3NTLA 3F8SA 4OGKA 2VTEA 3BOSA 4R54A 2O3QA 3W05A 4CCSA 2HHAA 4XPIB 3RB8A 2VUTA 3MJVA 3M6LA 1NWHA 2EVWX 4U2EA 1H3EA 4F4CA 1JIIA 2D1YA 4LKRA 2M2IA 1BYUA 3Q10A 1XHEA 1RRKA 1G7CA 1ZRMA 2IRWA 4QOJA 1XT6A 3FBTA 4CDRA 4YH1A 3EXHB 5K3AA 5ER6A 1L7NA 5A4MS 3OG9A 1Z35A 1Y1KE 1G6KA 2NNLD 3JD3A 3WR5A 1X3LA 421PA 1MB3A 4ZMSA 4H7DA 3FYCA 4JT9A 3WNBA 2GF2A 1R5NA 3EF1A 1JDTA 2DHRA 4TYNA 2I6XA 3CTPA 2FPGA 5HE9A 3WB2A 1IE3A 3EFOB 4LYGA 4C7JA 1ES9A 1MV8A 5A0FA 5BQ3A 3QPBA 1R4AA 2BP7A 1J8QA 2HMVA 2VDUE 4WJKB 5HZKA 1ZN2A 5IAGA 3JSAA 3IVGA 3PYXA 2VPIA 1I2AA 2PH5A 1UC9A 4IEIA 5AW2A 2AJCA 2C77A 3DAPA 3CPEA 2YXPX 4YI3A 4CTKA 1T8PA 1PRYA 1ZXLA 2P78A 1TDJA 1DAMA 1NC1A 3CZQA 3PYLA 4A92A 4PG7A 1ICIA 3CUYA 3GT0A 3TTYA 1NP3A 3OIWA 3FYSA 3CRMA 1A4IA 2P6OA 4UAJA 2PUGA 4DANA 1K6MA 3O4FA 3H5IA 5JV5A 3ABRB 2JFXA 2LCFA 4HZUB 4ZCPA 4B2LA 4CT5A 4J0CA 3RROA 5HR5A 3L8HA 1M2NA 1B6RA 2H7VA 1VLVA 4NJEA 4CMCA 3ZXIA 1N2BA 4KZKA 4MUBA 4K6MA 3HKBA 1O0SA 2HA2A 2B3TA 2JAOA 4YJDA 1V5EA 1A98A 2OBLA 2W2QA 4LJSA 3AJ8A 3TLYA 1Y48E 1ZEMA 1MO4A 4FE7A 1A5ZA 2I22A 2Z83A 1M2VB 3HG7A 4KITB 1QGUB 3HUFA 1H42A 2QKYA 5IYZF 4OQDA 2UZAA 4GI1A 5ILOA 3KOYA 2C4KA 4LSWA 4BGDA 2MSKA 1RP7A 3HB1A 3P4YA 1GGMA 1P62B 2X2OA 4PCAA 4RX1A 3LECA 4RY0A 1CEXA 2FV8A 5CURA 5IK2A 3RLIA 2CWDA 4Q16A 2QZ9A 1T29A 3KX2A 4OA5A 4F93B 3ZDRA 1I0ZA 2HM7A 1DFGA 1SUEA 4MR8B 4A8JC 4DJEC 3U4QA 3TZHA 4HVTA 2OHXA 4G5RA 2ECFA 4MVCA 1EWKA 2OXTA 5KJFA 4HDRA 3GVPA 1OIWA 3R24A 1U2GC 1P1BA 2P3SA 1YJBA 1OYYA 1OH5A 2GAAA 1HQKA 2B21A 2LP4Y 5CNMA 4MB6A 1QP4A 3DDOA 5LKAA 4UW9A 2ADOA 3WGLA 1CLEA 1QR6A 3RJTA 2QLJA 3QMWA 2CZQA 4F06A 2X4LA 2HLHA 3THRA 1QNFA 2H06A 3H1AA 2A0XA 4JA2A 1GTL1 4LHZA 4Z9YA 5EP4A 1UP6A 4OP2A 4URZR 3RFXA 1CG6A 4WERA 2RCNA 1T5DX 4QXOA 3U2QA 1U98A 5ITWA 3F2IA 1SXHA 2HCBA 5K0ZA 1H4VB 4W9NC 5A4FS 4J0KA 5FYDA 1L9KA 3PHJA 4F4HA 3AUUA 3V2UA 1VCIA 5E6RB 5A04A 3IHTA 3OWOA 3PR3A 5DHQA 1M7HA 3E9RA 3FPAA 1VGRA 1G5PA 1AQ6A 4TLAA 2G9UA 2VPTA 1OBVA 7YASA 3AR5A 2HFKA 1MV5A 4O4JB 2V98A 2WJIA 5TY0A 4UNRA 1IFXA 2DPHA 1Z4KA 2VCEA 1UXIA 1LDGA 2B1JA 4CLRB 5ES4B 3IDZA 3CVWA 1PNRA 3BXGA 3OZIA 4X6YA 2FMKA 2XCOA 2I3DA 3KT0A 3MBKA 4IVNA 5EMHA 5EXPA 3FDXA 1YRLA 4LBWA 2Q7DA 3KL4A 4D25A 1OGYA 1JMYA 4N40A 3U40A 3W7BA 3L1JA 1RHRA 1YFKA 1SHTX 1KERA 2ZUWA 5DLPA 5H3CA 2GOYA 1TJNA 4Q3BA 1E7SA 4UQOA 4EB0A 1ZIDA 1JR3E 3LCVB 1J06A 2IL1A 3EFEA 3D1VA 1U1IA 1JUDA 1WHTA 4KBYA 4UUQA 2V7EA 3I45A 1FFXA 3T4XA 4ZHQF 5J4LA 1E0SA 2QBYB 3AI3A 1N1MA 2QLBA 4NOKA 4J7AA 5DLEA 2XH8A 1NLZA 2ZAOA 3KYJB 3ONNA 3QENA 1QQTA 2E4ZA 1I5OA 4G0MA 2W70A 4D6YA 1LH0A 3PGKA 1ZPDA 3VXKA 4B7UA 3PGA1 2VRWA 2C2ZA 1UJCA 3OC0A 5KTMA 2Z04A 4XA8A 3QBVA 4WFJA 5TRTA 1Y8CA 3ZXUB 3HYLA 4EGSA 3G0DA 3OQIA 4TRNA 1A96A 2BFBB 4C2TA 1FFDA 1QK3A 3DOUA 2RKWA 1BDMA 2ZU6A 3L1HA 4NLLA 1S01A 4NX2A 5T6MA 3H65A 4D8WA 3WQQA 5IVPA 3TTSA 1FY2A 4QLBA 1PL6A 1LDBA 1ELOA 2I6QA 4DMCA 2OENG 1VE3A 4J3JA 2BJVA 4R2HA 4PBTA 4WXRA 2YQZA 2WFZA 1HQCA 4B34A 1EMDA 1JWAB 4NNOA 2MHCA 1THMA 3QLUA 3CCBA 1TZBA 4YV7A 2IP2A 1COWA 1VQ1A 1WQ1R 4LJYA 3RR2A 1K8QA 1L4UA 1XP8A 2R8YA 1T4BA 4UU8A 1GR0A 2C4VA 3UUGA 3LP8A 1SCJA 4NY1A 2CJWB 3OJOA 3IR5A 3MWFA 4OV6B 5IHPA 5D6OA 1IIRA 3ADCA 1X0XA 1XRSB 4YRPA 1KK2A 1XCMA 3T9AA 5J43A 2DUJA 1GAQA 3OICA 3TMYA 2L19A 4MI1A 3CNOA 2VT7A 3IP6A 5FUXA 1P2FA 2XUGA 4WE3A 2AN9A 4AT1A 5E6SB 2PX6A 1Z47A 2K7ZA 1ZUD1 5TSDA 4A3SA 3IUNA 3SC3A 4LDAA 2O06A 1FNSA 1RI5A 4Y1GA 4IRXA 4B81A 3R9KA 4U63A 3P71T 4HD8A 3SQDA 5IG2A 4DRYA 2LBPA 2CUNA 1BROA 1XNJA 1E61A 3DMDA 3HRKA 5JD6A 2WINI 3G8AA 5FHRA 2O1EA 1UKVY 3HJGA 4NZNA 1G8FA 1E9RA 2C5SA 1IY0A 3E22A 2OPHA 1RP1A 3B38A 3I9NA 2ZBGA 1KARA 3B89A 2BI7A 3D9QX 3RSQA 1X7ZB 2SBTA 4L4ZA 4L76A 3BA6A 4BE7B 3A1SA 2P6MA 2X5NA 3AZQA 4M1WA 4MYDA 4LNUA 4D97A 4OL9A 2NYUA 3F4LA 1NRIA 4D9FA 1T5TA 4XDZA 5C3MA 3CY6A 3H1PA 1UJNA 2D06A 5F1OA 5LA6B 2FMTA 3VNUA 3H7AA 2V7PA 1I2MA 4LFAB 1ZO8A 3KU4A 1BN7A 3NOVA 2IHTA 4IXNA 4JLAA 4XIYA 4AN1A 1FDRA 5BW5A 1EVZA 2Y99A 3IT0A 1SRRA 3MRXA 1XDUA 2F3UA 2BZ0A 2BEVB 1ID1A 4AURA 1ZQ9A 1G2OA 2OC4A 2DFNA 3D4IA 2ATCA 4JL8A 4TMWA 3OEWA 2CLIB 1EUCB 2IHKA 2O7SA 1GM5A 5DM1A 2WE8A 5EZQA 3ZK8A 3ONWA 3O6VA 3KZMA 1HTBA 1ZSYA 3E2IA 4DM7A 1THGA 4DJ5X 4L0CA 5K3OA 4MDEA 5A71A 3NBMA 3B7GA 1KS2A 1KYYA 1RWKA 5DBGA 1ICEA 1AKMA 3NH9A 4JBNA 2PIAA 1DCMA 1M6WA 3AILA 5JXGA 4KAJA 2Z4SA 4AO8A 2TMGA 3WK6A 1BSVA 1TAHA 3VU1A 1CJBA 3DV9A 4G4IA 5IDVA 4DMRA 3SGLA 4LJLA 3MINB 3CH4B 3CX6A 1YDWA 1KEPA 2J48A 4M6WA 4W7HA 4X6XA 5K4GA 1E2MA 4BLQA 2WF5A 1C0EA 2IYOA 3MK31 1BKDR 1WF6A 1YKSA 2J1LA 1EDZA 3AR2A 5NLLA 4P35A 3WICA 4HTAA 3WIUA 4B87A 4ZYXA 1MB4A 2H4JA 3PCTA 2M9MA 5KWVA 4PY2A 4IS3A 4JKYA 3E5RA 4PAWA 1KPGA 4PQGA 5T7BA 2YYAA 3TRKA 2NSLA 4EIWA 2XDYA 1OW3B 2ZIXA 1T6XA 5BSRA 4TV9A 4IFEA 2GBFA 1JQDA 1UH5A 2Z6VA 4LNAA 1X92A 1E7WA 2HQSA 1HO3A 4GVLA 3UPDA 5JCXA 2GHRA 2JASA 3MOSA 3V2HA 3GA0A 4ZCIA 2BGTA 2QM8A 2J9RA 5KJEA 2V03A 1V25A 4NESA 5KS2A 1X86B 3LSYA 1X8JA 2FN3A 1ABFA 2DTDA 2G88A 4QVIA 5MFZA 3WMFA 1P8AA 3MAGA 4LVCA 5ICEA 2PUBA 3SEQA 3KSRA 2ZITA 4JC0A 2GK3A 2E48A 2AYYA 5L40A 1YS7A 3RG8A 2Y8EA 3FLBA 4WBSA 4LWQA 4N0DA 4P08A 4YJ2B 3WGJA 2EWVA 5C34B 1HWYA 2QTCA 4B83A 5KTTA 3LF2A 1WXFA 1QOPB 5IZCA 2Y1GA 4N3GA 1DADA 1KVUA 3OAAA 4MUEA 3DONA 4L85A 1CY0A 3V8QA 1KI6B 1GAXA 4HWGA 4KQFA 4MVJM 2ZPTX 3D0QA 3ONFA 4JGIA 4WGGA 4QXPA 1Y8QA 1AMNA 4WADA 3D2CA 2WD8A 4XM1A 3P9XA 5ICGA 1NY5A 4RVFA 3KR9A 4RDHA 1O58A 1JIXA 1BHQ1 3B9BA 4HH1A 2C7BA 5JH7B 1T0IA 3IXQA 3W5SA 3WLIA 1US8B 3H16A 3H9BA 1OLUB 4GVPA 4TZ6A 1UZAA 2HJVA 2YYYA 4NE9A 2O0MA 4JXJA 2ODPA 4BO1A 2RI6A 2VPQA 5HGJA 3GPIA 1DWOA 4KFCA 4IGFA 3ERCA 3F6RA 2FPIB 5IH7A 3LDFA 3PHLA 4DR4B 1O54A 4GYWA 3SIWA 1FVHA 1P45A 2CLSA 4P4GA 4F2WA 4S0ZA 4J94A 4L3OA 2B4QA 2MSDB 4DHEA 3ZV5A 1AT1A 4GMKA 4HZGA 5D8DA 3HZRA 1C1XB 1A2QA 3PCRB 5CB4F 2H59A 3QUAA 3PNKA 4C88A 4EATA 1M10A 1T1EA 4M4SA 4ZOAA 4TWZA 1VBMA 2IPMA 1Z2OX 5EMJA 3RS2A 5JROA 3H2ZA 2RCYA 5KYNA 4OOFA 1JN0A 4TKVA 3BTUA 5KYXB 4ZVSA 3C1AA 5JAOA 1RLJA 3B70A 3FGZA 3W5DA 2KHZA 4DGSA 4V0ME 4EDFA 5D86A 2O5CA 1YE8A 2J3HA 3JQGB 5I9LA 2F8LA 3GOHA 1GPKA 3GOQA 5C53B 2F17A 4NXMB 5EJGA 1G9TA 2AI3A 1GTG1 2Y1EA 4MQFA 3DKKA 3HYCA 5LU9A 1XDWA 3V42A 4UXHA 5JWHA 1ECGA 5H4HA 5SYMA 4CTOA 4IOJA 1E7RA 1JLLA 3ET4A 1Z5UA 3FWPA 4IIUA 2A1TS 3QVTA 4W6QA 5EPEA 3H11B 1P9LA 2IIPA 4IH4A 3DDZX 1Q1GA 2D7CA 2PXHA 4FFBB 4JODA 1UAYA 4RKEA 1TUGA 1Z5NA 5HIMA 3OTQA 3GLTA 4FCTA 4M0LA 4CIBA 2IJGX 2NZVG 3E81A 2VUSA 3PE4A 4EHLA 5CCXA 2RIRA 2YRWA 3FUTA 2QN7A 3HWRA 1AY0A 1X42A 3WLOA 3DFUA 3UJ6A 5HILA 3VI4B 5BN3B 4BTVA 1B15A 2CNKA 3JAWA 5B6JA 5AW0A 5DVZA 4F4DA 2XYRA 4P2BA 3VSAA 4N5NA 3KSUA 4KAXA 2W6QA 4RVUA 4S1NA 2BDUA 4BNHA 1L5FA 1M6HA 4TTRA 2DM6A 1MAHA 1KIMA 2WR8A 3IOCA 4PLCA 5HZMA 3DXZA 1A7UA 4ZYWA 1QXSA 1RR6A 4KRXA 1HDYA 2DSTA 3MC1A 3D3WA 4QNMA 5F1KA 2A1UB 3UFBA 5M2QA 3D6UA 5HM8A 2PFGA 3EK2A 1LV8A 3M1AA 1Q7CA 4YR7A 3GEIA 3LRXA 4UEKA 1ORRA 2IU4A 1GPBA 4HX2A 4B3TB 3DFKA 3MTBA 1REQA 3BREA 3O84A 4CG3A 5IULC 2OFWA 4WY8A 2HUPA 3VVLA 4HAZA 3RAGA 2FP3A 2FEMA 2IKQA 3AWDA 2NZWA 4RAQA 2GK4A 3NW9A 1MQAA 1F4VA 2VZ0A 3BD6A 4MLDA 5DTJA 1ZNZA 3OHMA 5FPKA 1CJCA 1YE5A 2AQHA 4YALA 3AEQB 2X1HA 2FPRA 3TFQA 1TYAE 2R1ZA 2ZGVA 1PEDA 3QQPA 3V7YA 2AFHA 2QG4A 5JS7A 4R1UA 2AA3A 1E6CA 3A3KA 4UMEA 1Q7GA 3R6WA 4K1XA 4QT0A 1DAEA 2FZEA 3PD0A 3IEIA 4LXIA 4E51A 4MLCA 5HF5A 3DCNA 4LNHA 5H80A 1RPTA 2CHUA 4FZJA 5TGDA 4ENTA 4RTLA 3WDKA 2XCTB 1I33A 1N2XA 3A1NA 2ZSKA 1AUQA 1UBEA 2IYSA 4YACA 2V6MA 3VBCA 3FLAA 3MJCA 4PRLA 4EOGA 1T6BY 3AR4A 4RZUA 2NP6A 3M89A 1QO0D 4ZZ0A 2QN1A 2WEKA 2F9FA 3ZK7A 4BC0A 3GRVA 4UTXA 2OGUA 1YTUA 2B20A 4JI6B 4HNAB 4BKQA 3HKDB 4DCNA 1Z62A 4WCFA 1ZOIA 3T61A 4S35A 4RK1A 5KWJA 1OC4A 1Z15A 3E3NA 3LNTA 4C4OA 5A5GA 1E9AA 1N3LA 3TM4A 3PWKA 4NK4A 4AUNA 2JIRA 3NHWA 2PGDA 1P4AA 4H4DA 1J2JA 1DKRA 4JC5A 4AS3A 4Z4FA 2FPLA 1Y5IA 3HVHA 5ARBA 2J6IA 4IJ5A 1SOVA 2Z95A 3M9XA 4RTKA 2OYRA 2FN8A 5GV8A 4FN5A 3GX1A 3BWXA 4Z4GA 1VOTA 2V7QD 5HK8A 3B85A 5IEBA 3W3AH 4Q1FA 1ZWLA 3V8VA 4E22A 5DW0A 3AHJA 1A97A 4PGAA 4EX7A 4LYHA 3EGEA 1SO8A 1U8ZA 2IF0A 1P1KA 3H6HA 2AYZA 3IKVA 5I7HA 3AEUB 3OIDA 4JR0A 4RQTA 5JD3A 4BWVA 2VUHB 3OZDA 4HYTA 1CE8B 3S2ZA 2W90A 1KAOA 5DFAA 3PTZA 4DUGD 3L84A 4WNAA 4J1SA 2B5VA 1G3UA 1P1HA 3I39X 3K71B 1MTOA 1W0JA 2IYTA 4U2KA 2PUTA 5AM4A 3ZJYA 2GPAA 2BVNA 3OT5A 4QECA 2V7TA 3S68A 3L6RA 4FGLA 3H83A 4HDKB 4O4IA 4J0JA 4AKGA 3QLUC 3K4HA 5LP6A 4W7IA 2WAOA 4CMJA 3WNCA 4AM8A 4MINA 1ISMA 2VOEA 1J8DA 3GFTA 3Q1LA 4OSOA 2EFHB 1RJFA 3FBGA 1Z5OA 3LVQE 4PBSA 4RFLA 5GJWC 5AQEA 4CW7A 3GY0A 2R8BA 4ZVMA 1F5NA 3BE5A 4QO7A 4UFPA 3FE2A 3KYCA 4FGJA 3BIFA 2QRHA 3U80A 1BVHA 4ETNA 2ZJZA 1EK2A 2IPOA 4HGPA 4Q9IA 3TLGA 3H05A 2YHSA 4BQPA 1K63A 4YAWA 1KZHA 4BNKA 4K2AA 4JVMA 4Q9HA 1Q22A 3OX3A 5E95A 5I8ZA 5KQGA 5AJWA 2PZKA 3GBVA 4BLSA 2K2QB 2VDNB 1PKEA 1FLNA 5AICA 5LQRA 1W30A 3LUHA 4LOJA 5SY9A 1NYQA 4JLOA 3ZXXA 3H1GA 2NYVA 2PAAA 4X90A 3H5WA 4AZWA 3QVWA 2KW5A 4CV2A 1E9VA 1SKQA 1XCJA 4KR0A 3DHWC 5GQSA 3K6SA 2GESA 4MS1B 4H1VA 4JOBA 4A6XA 4KMOA 4RK7A 2BT4A 4WOBA 5BUCA 5J2TB 2ZSHA 2PRKA 1WMDA 2RC5A 1DHTA 3DBRB 3DUFB 3HCCA 4XYMA 1TA0A 4WA8A 3G9XA 5F51A 2I2WA 1B26A 3G79A 1K92A 1GADO 2G5GX 3Q8LA 2IY8A 4KQ9A 1EUQA 3MIIA 4MP6A 1N6LA 4UD6A 2YMLA 1FFSA 3OJXA 2WTMA 5DWQA 1Q77A 1USVA 3H6GA 3A4TA 4WNCA 4ZPJA 3ND6A 5F5LA 3W77A 4CLOB 1SKAA 1R2QA 3N2LA 4BMVA 4CV0A 2ONJA 4ALKA 1FYXA 2QPLA 4WY5A 4KLNA 1RPJA 3ZCTA 4X9XA 3MVEA 1KGSA 4BMOB 2YVKA 2GAFA 1FVOA 3CKKA 1VECA 5EJ7A 1JIKA 1MUUA 4U9UA 4D0GA 4ETMA 1NWCA 2JZCA 4L0MA 3K0HA 2QVGA 1PLLA 3WV5A 1XVLA 5AK0A 5J3JA 1E3IA 2ZS7A 1FSPA 5ALFA 5D01A 4L15A 4LXXA 3GP5A 5JC1A 3BJZA 4C01A 1E98A 2MCFA 4J75A 5HVNA 1U90A 5EHXA 3D7KA 1T8WA 1ZRSA 2XB8A 5CYFA 2JIQA 2ONCA 3ND5A 3RS5A 2YYZA 4K6HA 3IUEA 1E6EA 1ZIXA 1YRYE 3D8TA 3N0XA 1L1FA 3T06B 3VTAA 2JCBA 5J1SB 3BMQA 3ZLJA 1R6XA 1A82A 1BX0A 4M37A 4QYMA 2HIMA 3EEOA 2I7VA 2XCUA 5IJ0B 1E1YA 1J07A 1G7SA 3HMKA 3LPNA 4MVJP 1IZYA 1KI4A 1SBZA 2FKAA 4MROA 4ZQFA 4WT7A 3SS7X 4KPUB 3PIDA 4A23A 5IAAA 1Q50A 3LZDA 3ESXA 4IXMA 2XUKA 4F84A 5CFLA 2REXB 3K0AB 1U1EA 2R8RA 3CLUD 4M0UA 4PX9A 1M33A 4AMUA 4IAOA 5DNYB 3T8YA 3AG6A 5GOZA 5THKA 1ZBDA 2GPNA 1QGDA 3BIWA 1PW5A 1NJ1A 3E35A 4OHMA 1T36B 3HFSA 2IE8A 4KO8A 3ZU5A 2WWXA 4U00A 4CT0A 3R6TA 2QW1A 4RE6A 4X45A 5HBGA 4DW8A 1HT1E 4WN3A 2BZGA 4CHTA 4YP0A 1F0YA 4CCYB 4YNBA 4F6RA 4GR5A 5I7FA 4OL0A 3TKAA 5IU6A 2C8LA 1U8XX 2F7SA 1XZKA 2ZTVA 4JEUA 4R9VA 2H85A 3OBIA 5KDDA 1TYCA 4MDFA 3UMSA 2ZUDA 1Q1AA 4TRJA 3W78A 2DT8A 5HQJA 4MWTA 2L69A 5A7HA 2D5BA 3GRCA 5KSYA 4BDSA 1C5KA 1XDDA 4RKQA 3K8QA 1SXJE 1HOXA 3OFSA 2FQ1A 5K0NA 5AP9A 3HJAA 3Q40A 5LD2C 1SZDA 1ZD1A 2WNSA 3LHDA 3HVRA 3VKVA 4K28A 2OAQ1 3WG9A 3NCTA 1ISFA 2EX0A 1JEYB 2GZ1A 2LRHA 1WHSA 4FBGA 3CRW1 4FOTA 1OBOA 3UHFA 5I7VA 5IZCC 2P6UA 2ZSJA 3FMGA 1LI7A 3CURA 3EJ6A 4RANA 4ACBA 4GXNA 3ZGVA 4I7EA 4YJGB 3AP3A 1QWSA 3DO5A 1BVRA 4MJLA 1RI4A 1B4DA 3TSCA 4I4TB 1QO0A 1RYYA 2BGLA 4R68A 1XEFA 3HCPA 4MUJA 1TIKA 4MW2A 1ML3A 4Z0PA 3L1UA 2R6FA 3TQHA 5JDIA 3TMKA 2R8OA 2B34A 4JIMA 4WZAA 1AB6A 5AVKA 3CUUA 4TMXA 1VYHA 1ISIA 1E1CA 1ZD4A 1JS1X 4N7MA 1VIMA 2Z9CA 1QRDA 1IM2A 2P5UA 2R751 3MLEA 3PXUA 3T1OA 3SZGA 4C2UA 4TXHA 3EIWA 2FZWA 2CLLB 1B16A 3DWGA 5KWSA 5KYUB 4M1EA 1QIFA 5E7JA 5KOHB 2O8DB 2F4VB 1GIAA 2A4KA 3JASB 3T35A 4DF3A 5JYDA 1HF3A 5IFLA 1C30B 3RM3A 3TLXA 2X22A 4QZVA 2R68A 1U7DA 5TF0A 2ZSAA 1BRMA 1YI8A 3IBYA 4QYXA 4O2BF 2W37A 4N47A 4TV8F 3FMOB 1T0BA 1YQDA 2C9CA 3BL5A 4EHBA 2E5LB 3JPYA 4RKYA 4S1OA 1UKEA 4TTAA 3GZTB 3OJLA 2BEJA 5ECDA 2VH2A 1YVEI 1NVKA 2W6ID 2Y93A 3LKDA 3VHXA 4DG5A 3DZBA 3O94A 1MD9A 3QJ5A 4F6LA 1DG1G 3IBFA 2ZVQX 3UK7A 2HGZA 5TNXA 2L0XA 1DMSA 1YB4A 1YS9A 3A25A 4JSTA 3DE3X 4HSEA 4LK2A 4EF4A 1NI3A 1ZI9A 3DC2A 3DZDA 1TIBA 1GUYA 1NU8A 3DV2A 3IE0A 3GJ0A 4MVWA 3LY8A 3BIXA 4Q3EA 4AKSA 1K2WA 1QH8B 4JP1A 2ZRGA 5IT5A 2YS6A 4DLLA 5CLJA 2GM4A 1YVUA 2PLNA 1JHYA 1ZZGA 3H7IA 3A6EA 1LQUA 3PUIA 3CXRA 3ESBA 4KACA 4QTZA 2ACWA 3U6KA 2JZNA 3TN7A 4C78A 2BE9A 3W4JA 1BWPA 4YMSA 2BLNA 5IBQA 2DECA 3KTOA 3NTRA 2DY1A 3OP1A 3QEMA 4FDVA 3KJQA 4F12A 1LBQA 2EX1A 3QLVC 1FTSA 1WMEA 5HK9A 3BD7A 4G85A 3M4XA 1DC8A 2D74A 1ZKMA 2BBOA 2CLKB 3AY7A 2VHQA 4JBLA 1ZW1A 3P9CA 4XD7D 5CX1A 5C4GB 1EM8B 4QC2A 1CDZA 4MWCA 4DQVA 2PS3A 2FPPA 2PNJA 4Z4IA 5A0VA 1QHHB 2CNLA 1AKUA 2BFNA 2Q1UA 3U0VA 1SEVA 4D46A 4KR6A 3FB1A 1H2WA 5BP7A 1UBLS 4BXOA 3TX2A 3FMPB 3ADBA 4N39A 4C7OA 2R6CA 4NIMA 3ZWWA 3PUXA 4Z8YA 4ZV4A 1WM1A 3BXZA 3KLOA 3QWIA 1V71A 2ERXA 3AOEA 2OCPA 2Q5EA 4I4CA 2Z09A 3GJXC 5IVDA 4IF4A 2PV7A 1NDQA 1LJLA 1TLTA 4M89A 3EIOA 3AFGA 1YASA 1E32A 2OVBA 2GPBA 3SSOA 4QXMA 2AR7A 3KV3O 2ZUUA 5CK5A 3FHTA 1TVCA 4R0VA 1XEXA 3C3MA 1WEHA 2ZEJA 3FZQA 2QAGC 4IZHA 3S2UA 1KR5A 1HORA 4DILA 1FF9A 2CW5A 1CUJA 1T5LA 2VDWA 3GEPA 1YQUA 2Q7OE 3U7IA 1NE7A 2VQDA 3GCXA 2I80A 3NV7A 1CRZA 1VL0A 3QA3E 2V55B 3FHCB 1PDWA 4ITUA 4RSHA 3ZHZA 1DZ3A 5LDGA 4ER0A 2H7YA 2Y92A 3K73O 2O8VA 5DI9A 1E4EB 3PBKA 1PYDA 4GU5A 4ZDIA 1YB7A 2EFDB