2I8LA

Solution structure of an endopeptidase hyci from escherichia coli
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
MTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAVEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hydrogenase 3 maturation protease
publication title Solution structure and backbone dynamics of an endopeptidase HycI from Escherichia coli: implications for mechanism of the [NiFe] hydrogenase maturation
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 156
sequence length 156
ec nomenclature ec 3.4.23.51: HycI peptidase.
pdb deposition date 2006-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01750 HycI Hydrogenase maturation protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HybD-like 2i8lA00
3PU6A 1CFZA 5IJAA 2KMLA 1C8BA 2E85A 2I8LA
chains in the Genus database with same CATH superfamily
4DE5A 1KORA 2G76A 4X97A 4HXEB 3EN0A 5EP3A 1HE4A 2JZCA 2NSHA 4P0TA 4MP6A 4Q1AA 3HCAA 4G0OA 4AY4A 9LDBA 4AJNA 4A2CA 4GECA 3T1QA 3TNFA 3RSCA 2JAQA 3C1TA 2ZQ5A 3H5NA 2ZT6A 1GPMA 1H2EA 2PFGA 4J0HA 4MP3A 1A8QA 3EPKA 2XODA 2J3KA 3H5AA 4HWOA 4M9XA 4MZDA 4WZAB 3R0XA 4H1UA 3AKYA 3KYDA 1O0BA 1RBQA 1E18A 3G89A 4FN4A 2ZANA 3TXYA 4HYQA 2CK3A 3A3YA 2YWCA 2XB9A 2JFZA 2Z4RA 4LX0A 3RUAA 4O4JA 1I30A 3RYIA 3CEMA 2XKJE 4PLGA 4DG9A 4YBZA 2RK3A 4D46A 2WVJA 2R6ZA 2FXVA 2HCRA 1U7WA 2G67A 4B8ZA 3EUWA 4QPJC 1VECA 1RSZA 2DLNA 3D7SA 3NBXX 4LJKA 4M49A 4YRKA 1OMOA 4L3OA 3AJRA 4HDKA 4MW9A 3V80A 4ER0A 1KEZA 2X8LA 1SCQA 1WDMA 2Q27A 3EEBA 2B20A 2LGJA 3BL6A 1Q5PA 4BO2A 1I0LA 3LRPA 4CQJA 5LLTA 4YCCA 2BKUA 4M87A 5AKIA 1EMDA 1W0JD 3WK9A 2ZJOA 2EARA 2YINC 3TW8A 2JJ8A 2OBLA 4EI8A 3T3EA 1TFRA 3IE0A 5IVPA 1QQAA 5JECA 3RSGA 4YUWA 3ZOZA 5B3JA 4NJEA 1YULA 3IIEA 4AJ2A 4Y6QA 2O8FB 2WNHA 1C7QA 3I1IA 2BP7B 2XLCA 3NUQA 2ZR8A 2IYUA 1V7ZA 2INGX 4WV3A 1L9XA 5FPQA 3QQ5A 3ZQUA 4M9UA 5FNVF 3RC2A 4QELA 2H6EA 4YRDA 3N2ZB 1G8HA 1I3LA 2P75A 4GG1A 3PZRA 4C4RA 5KYXA 5KWIA 1DELA 4D8UA 4L5YA 2FWRA 1T43A 4IBOA 5A3JA 5GZ3A 4PVCA 4TMVA 2A2ZA 3IMGA 4Q9DA 3ZNOA 2YVUA 1J24A 4UXHA 5KX5A 4KAAA 2VHCA 1GZ3A 2TMYA 4GPZA 3U3RA 1I7NA 4FLMA 4I1OA 5SZJA 5AUPB 3N86A 2NV0A 3GEGA 4BMYA 5TARA 1L7PA 2C07A 2GM9A 4Y1RA 4ZVSA 4UAJA 3U37A 2BFWA 3Q7SA 5FPHA 1GFZA 4OQZA 4FEAA 4WWHA 2OBBA 1QH1A 4C03A 2IC5A 1KMNA 4W5NA 1RQXA 2PU7A 1S3IA 2ZSKA 4O2RA 1X7XB 4G4JA 2GS9A 5MFPA 5A71A 2R4TA 3L8EA 1A82A 4XIJA 3RK4A 3SVLA 4RVDA 3HI6A 4HFNA 2FFJA 2Y1GA 4P54A 4YPVA 1XMXA 2PXAA 4IMJB 4EEZA 4Z8XA 5T6MA 3RVPA 2M9MA 1QWOA 4DCGA 2EG9A 1NJ5A 2OXEA 4UHBA 3Q8LA 3T3PB 5FUQA 3R5HA 5EXEA 3IIMA 4ERNA 1ZA1A 2Z4TA 2JJYA 2Z3VA 3HEAA 2P4EA 2FQ1A 2WK1A 2H5LA 3KCQA 3MTEA 1GFIA 1KVRA 2DOKA 3BQMB 3EFOA 1KZHA 3LNTA 3M4NA 5FBZA 3ZS8A 3VZQA 4C87A 5HXAA 2HC9A 4MJ3A 5A5FA 2B2NA 3DNMA 5DW0A 5KCZA 3IRUA 2QTTA 4MI1A 4R1NA 1KDRA 5HW0A 4FNOA 3W2HA 3GG2A 1QANA 1YDEA 4KHZA 5KMGB 3T94A 3KVOA 3IB6A 5DLYA 5EQJB 4HR7A 1VKNA 1CB0A 1YR1A 1Y4ZA 2ESRA 3RRBA 2CJPA 2R1UA 2PL3A 5ARBA 1KWGA 2QTHA 1XXHE 3DVAB 1NP7A 4DLLA 5JPDA 2FEWB 5DASA 1OSNA 3PF8A 3I04M 2YYAA 1IOZA 3DGFC 1PSWA 4K05A 2BN4A 4BOYA 1E9EA 6ABPA 2BFBA 3HZRA 3LSTA 1TU3A 3OC6A 3GUZA 4KC0A 1INLA 4LCEA 5CVTA 3BFJA 1U1GA 1G8JA 1YVRA 3MAAC 3OY7A 2C1XA 4KXNA 2XW6A 3DBLA 3WV5A 1G0OA 4EUEA 3OO0A 3OSUA 4OUKX 1Z8FA 4H4CA 1AA9A 3PC7A 3IPAA 3D3WB 2BFFA 2W2OA 3E7XA 3NBMA 4CIXA 3GJZA 1NBMD 1YE5A 2GZ2A 5ELLA 3IEPA 5MGBA 1P7CA 5CFPA 1YB6A 1G5TA 4PYRA 2LUOA 3QELA 4BE4A 4CCYA 4CKBA 1NMZA 5EMJA 3WDSA 3USCS 4YRAA 5I9LA 3K31A 2GPJA 4ZO7A 4FW8A 4L74A 3EGXB 2OCPA 2L18A 3DOEA 1HYHA 2HLPA 3LWZA 4X8OA 4P32A 3OIGA 5KOHA 1SXQA 1GQRA 2BFEB 2REOA 1CY7A 3F5FA 2A0FA 4X3OA 3JQQA 4BO7A 1PR5A 3DXXA 1WVIA 4TTPA 1V5WA 4AY3A 5TSDA 2HPAA 2QSUA 4BN4A 4HDNB 1SIWA 1RJEA 3FVQA 3TX2A 1WSWA 3QSYA 3OIYA 1KEKA 1KYQA 2Y76A 4I8DA 2ZS8A 1JQ5A 1RRVA 1EUDA 2FZCA 2IUSA 1XHFA 1AQ6A 4PYOA 4BP8A 4K6FA 2IYEA 1RRGA 1J56A 4PBRA 4RL4A 2IDKA 4ZEXA 4FHZA 1Z6QA 4NATA 2ZUTA 1D6NA 2JK1A 2CB0A 2NX2A 2V8OA 3PPXA 3WJ1A 1KO4A 4EATA 4W1PA 2OBFA 3QX9A 3IAAA 3SK0A 2C8KA 1KI4A 5B1IA 3CVVA 2GYUA 4JD5A 4XFKA 5DZSA 1Y80A 2O8FA 4PG8A 2PSHA 1NI4A 2CHFA 3WV4A 3WMRA 3X2SA 2YY5A 1J25A 2NV6A 2L42A 3COZA 4DR5B 4KI7A 2JI6A 2ZB7A 3BQ9A 1CUFA 4PYJA 1R8JA 4H6PA 3D2BA 1TYDE 1E2LA 2ZUDA 3WKDA 2WF7A 3KLMX 4JEHA 1Z7BA 2DPMA 1NLYA 4I8IA 3UK0A 1N2HA 1VGRA 5A4FS 4DUYB 4GOJA 4TL9A 5DWVA 1DJLA 3OOHA 4LY3A 1KZGB 3IMCA 5A3SA 4DMHA 3D2CA 2YV5A 2W6MA 3EGCA 2YV2A 1C3LA 1FB5A 3OURA 1TTQB 1U2DA 1KOGA 2MIIA 5G3ZA 1CUDA 2B98A 2IPOA 3N5CA 1FVOA 4TLEA 4Q1FA 2ODAA 3KYCA 4PNHA 5A9TA 4ARIA 3HO6A 3ORHA 4NYIR 4Y2VA 4KREA 3K94A 4XEUA 4IS2A 3BXGA 3R6GA 1SO8A 2O0KA 3B7GA 1IZ9A 1R5JA 3KT0A 4QEZA 4Q3NA 3EWIA 3GNTA 4XCXA 4YMSA 4L27A 1GCUA 1SUDA 1PRYA 3BX1A 3KOZA 2XRYA 1JDNA 3R0QA 4WBSA 2WAYA 3HDHA 3DL2A 4UREA 2PEYA 1W48A 3OZRA 4F5YA 2HA2A 2XKKA 2F4VB 3D6AA 2X15A 2VZ8A 5DFAA 1P62B 4HRAA 3HUUA 4NDNE 1KAHA 3K20A 2JLBA 4NH0A 4CLXA 5JZ9A 5J2UA 1F48A 2FK8A 2H5IA 4YRZA 3UJNA 2YWHA 4IKOA 5CX1B 2QRNA 3FLEA 4OXXA 5F7ZA 3UWSA 3WOHA 4Q9NA 1YQGA 3HDQA 4TWAA 4B79A 4BCBA 3B36A 3KKNA 2I8AA 3D2AA 3FDFA 4QGBA 1DX9A 4JL8A 5BR8B 4LZZA 2V6BA 2C77A 3CNQS 4KGZA 4JL5A 4MS1A 4C14A 2FI1A 4B3DA 2HNAA 2K4MA 1IEXA 2BEVB 4KE9A 5HYVA 2JATA 1U5AA 1K97A 3UXYA 5IKXA 4OHCA 1M2FA 3R7NA 3MHPA 2P91A 1KQPA 4B1FA 5DGDA 1MEJA 3JQ9A 1JEQB 1N7IA 1VB5A 2FP3A 1XEWX 1E3WB 3JSXA 2BFDA 1I3OA 3RYHA 4R1QA 3WQQA 2GPSA 3GC6A 5IW8A 3VV2A 3TW6A 1HI9A 2YWXA 3ZJUA 4WDRA 1RXIA 2ZB3A 1G4UR 3OOEA 1NHGA 3V1UA 1X1DA 1Q0TA 3ZCTA 3SNHA 3RAFC 2JLSA 1Y3FE 3OCVA 5IDVA 5LYJA 5CYGA 3NTQA 2F43B 2PUBA 1Z8HA 5EUBA 4YCAA 1HUQA 1IEWA 3LC2O 2QP4A 2AXNA 2YYZA 4LXHA 4A0HA 5FAKA 3KQLA 2P68A 5JAQA 3CE9A 4TT8A 3EW9A 3VSDA 2GWHA 5BQFA 2LIVA 3L1IA 1IY8A 4WLOA 3AL3A 2ODNA 1MHPA 3O8NA 1W75A 3GR6A 4IHJB 2GJKA 2JJMA 4WGFA 4CKWB 2B1GA 1SBYA 3NDPA 4EW2A 3PHJA 5ITWA 4GE3A 5FF9A 3GLHE 2HK7A 3K0CA 3ER9A 3Q9LA 1STOA 1ZCJA 1DC6A 4FKZA 4FINA 1UH5A 1JDBC 3G1WA 3GFOA 2ODQA 3L7NA 3PNBA 4ZU6X 5IM4F 1BOFA 2OPHA 1FSPA 2JKYA 2ACEA 1LBTA 3OCUA 1SRQA 3B70A 1FFXA 1A9YA 4DCVA 4MR8A 4QPDA 1ONBA 1LSSA 3FLMA 2ZYWX 1X1SA 3NIBA 4I4LA 1PLKA 4ZO8A 3L7BA 4DJFC 5JZVA 2PL1A 4IUYA 1C1XB 3OWOA 4UCQA 3L7AA 2VP4A 4J94A 2ZBQA 3L0BA 4FYJA 4X1KB 4JQZA 1CRQA 1N7JA 2HIHA 5JJLA 3FHJA 5JSKA 1GRRA 3A1FA 2EEZA 4QO8A 5CB0A 3IVRA 3FCXA 1QRDA 1YOVA 4J1QA 3RGWS 3GRKA 1JG3A 1J0CA 2C29D 3F78A 3ETEA 2FXIA 4NKRA 3O1JC 1MXHA 1J8DA 1E0SA 3GJTA 4UE3S 4L85A 4NBNA 2IKQA 2Q6IA 3DKVA 4PWYA 5CXXA 3T0IA 4C0XA 5J4HA 1BYIA 5IBQA 3DQQA 3PS9A 3R7DA 3ZDRA 2QK4A 4MKFA 3DFIA 3ESYA 1MFZA 1QB7A 2NGRA 5K99A 2Q2OA 2NG1A 3FMFA 1A8SA 3C16C 3GFVA 2VKTA 2ZBDA 1HDEA 3EZNA 4I0WB 1Z62A 4HTAA 2XQKA 4IJ5A 4BCCA 1QTQA 3PUZA 3QE4A 1X1QA 1RI5A 4NG5A 2HQ1A 2O14A 4TKVA 5K03A 4BP3A 4H2DA 4YR9A 4OQYA 4JJKA 2M6KA 1XKQA 3JZMA 4QDZA 3PUWA 2IYSA 3PCTA 3WWDA 4I36A 1J23A 4M0CA 1VLJA 2Y6VA 5MFZA 1LNSA 1U0FA 1V8BA 5TPWA 3PGA1 2O3UA 2F3TA 3EWAA 4ZQEA 5LXTA 3OIDA 3GZNA 4RFSA 2XWSA 1USVA 2ABWA 4ZPXA 4Q01A 3H5LA 4EA7A 1TA9A 3FWHA 2V45A 2YS7A 1E1YA 1JZSA 1EFRA 1DAMA 1S2OA 1ZCFA 1ATIA 1M1NA 2R65A 2OTCA 2A67A 1E2JA 1BAPA 3IEXA 3LD9A 4C5BA 1GVHA 1DRVA 4QOGA 4CQMD 3IULA 3UH1A 1YNSA 4PPQA 4XEHA 1Y9JA 1ORTA 2GN8A 4XKJA 3U0VA 3ADDA 3HWSA 3AF4A 4BX8A 1OZHA 3G8AA 4YCJA 4YROA 1YL6A 1FDSA 2YRFA 4DLYA 2ZI3A 2IEYA 2AX4A 5HKOA 2BF4A 2OAEA 2NVUB 4L3VA 4MROA 5EEHA 3G0DA 5KHAA 3RS9A 3V5NA 5CA0B 3JQGB 2PGJA 2RK6A 1OKKD 3FGZA 1XAGA 2WW8A 1LXCA 2WA1A 3PUVA 2C78A 2MT9A 4DDTA 1P91A 1F7UA 1UPUA 3PVCA 2P1DA 2JFQA 2FR1A 2GOYA 5K3DA 5IS2A 1I10A 2GEDA 2HLDA 3UUFA 3WDMA 4B6JA 4JJ7A 4TQAA 3PNSA 1Z5UA 3AIIA 1YDFA 2C4UA 1DAIA 3R3ZA 1G6HA 1V7QA 1ZITA 3L7JA 1GNSA 5JJIA 3ZZ1A 3LK6A 3RS2A 4EG3A 1T5BA 4P93A 1O94C 1WA5A 2XKAA 4CG2A 3OHSX 2ATVA 3JATA 2AEFA 3EVEA 3KZVA 4UE2A 2WBLC 1SCUB 2PTHA 2Q9CA 1W9HA 3MSXA 4GRAA 1IBLB 3WKAA 5JO0A 1X1RA 2MYTA 3ZVLA 2OD7A 4LI0A 3U5ZB 5KU1A 2FPLA 1MJ5A 1MNQA 2E4ZA 1IK6A 2NQTA 4G07A 2DQSA 3PRKE 3AF0A 3ZD7A 4MVCA 2Q62A 5DNYB 1N2EA 2YIDA 8LDHA 2CVHA 2Y1OA 3HPRA 2E2WA 1L7VC 1N7HA 3I92A 1NAHA 1X1BA 4L51A 4CQLB 1B8NA 3LLSA 1K2VN 3TD9A 1J2EA 4Z3DA 3OM1A 4C7VA 5KYTA 3FYCA 2QZJA 4XXHA 2IGTA 3IBSA 4TWIA 3TCNA 1M6HA 2OXRA 2VQEB 3FPKA 1EHIA 2HYDA 4LYHA 1IBCA 4X1IB 3IVMA 3QKRB 4IJWA 5FNZA 4R8RA 1OT3A 4E5NA 4CKZA 3UG7A 1W5AA 4JC0A 2P1RA 2QXTA 2P2DA 3KAKA 4X90A 8MHTA 4J9VA 3S81A 2HJHA 1X1EA 1XDWA 4E88A 2XMRA 2FQXA 2DETA 2WIGA 4LRUA 5C8DA 1Z88A 3DEHA 5E9QA 1E2IA 4PSCA 5FX2A 5GJWC 2Q1YA 4P83A 2VJLA 3HV2A 1E9VA 1PEYA 4QOSA 2PR7A 1RPJA 2J59A 1NUQA 2XCOA 3BD9A 3TOSA 4C4AA 5HJ7A 2CVFA 2FLWA 4MEJA 5JASA 5KNCH 1MT0A 3EC2A 2F8MA 2WSLA 3K1YA 4PZDA 4ZCMA 4V1CA 1KSJA 3KR1A 4J7AA 3N28A 2BONA 3QVJA 1HTBA 1U2RA 4ETMA 4JB3A 2HO5A 1H6DA 4BMNA 4C29A 4HH3C 3R3HA 4G8JA 3WGOA 1IY1A 1KAOA 5TQ2A 4N8EA 2YHIB 5I6DA 4AJIA 2YCBA 1Z3CA 2BJHA 5JZSA 2G1UA 2PKYX 2WWIA 3IUJA 1N6RA 2RHWA 2WILA 3CEJA 4FDAA 4DTCA 4Y2UA 1HG1A 4C0KA 5FI0B 4ETIA 3N7TA 5EUCA 3QYJA 5SY6A 3MWEB 3RI3A 5G1PA 2GCIA 4AZSA 1J49A 3HXPA 5BUQA 3V4SA 1KJ9A 4HATA 4ZVTA 1XTQA 4M38A 2ZPUA 2JLXA 1OWMA 1EGAA 2TECE 1A1SA 3GAMA 3RPEA 4FGJA 4TMWA 3BXXA 2H8GA 2O2IA 2PT7A 3GRPA 3C3WA 3MCTA 4X24A 4DNQA 4E08A 4ZRDA 4Z8YA 2JCXA 5A9RA 1YJ5A 3K0KA 4Z2YA 4EUNA 2QUBA 3JQRA 4M1EA 4Q9HA 1BHJA 3DJFA 1JLSA 4EPXA 3CEHA 3KK0A 1RHQA 2VSYA 3GQBA 2P6PA 4LJ4A 4NS1A 1K5HA 2REXB 5AXCA 2BKVA 3R7SA 3U4CA 2OBMA 5E4JA 3KELA 2QVGA 3C24A 4GQBA 1DIHA 2AZXA 3SBDA 3TW0A 4LRTB 1RWOA 2Q2NA 4PPGA 2ZYVX 3W34A 2JAPA 1U8ZA 4IM7A 3A2LA 2PYZA 1PDWA 5FFNA 2QGZA 1D8TA 1OPRA 4NTZA 2ZJBA 3NAQA 1UBLS 1BXKA 2FF7A 3IOYA 1ESZA 4I1IA 4LJLA 4LOIA 5C1OA 3RVKA 4XDGA 2VPYA 4KKXB 4MKIA 1GTG1 4XX1A 4BDTA 2ZBVA 4FDLA 4WXMA 3WLKX 5A6VA 1DBIA 4OHUA 2Y0CA 3DD5A 4KTTE 2OCKA 3SR3A 3BMCB 1CZKA 1N57A 4MJ7A 3KPUA 1SVKA 3DMPA 1DIGA 5KNLA 5C8YA 3O3OB 4NZMA 3D7RA 1RU3A 2W2QA 4UBMA 3R8FA 3KQUA 1UT8A 3KQHA 2FX3A 1SUFA 4OHKA 4ETWA 5K6AA 1X15A 3P8ZA 5B7NA 5A2GA 2WIBA 4ZGBA 2ZCJA 4YLYA 4KWEA 4N9QA 1O08A 4CKCA 3N75A 1M8PA 5LQJA 4PZAA 5BSEA 1PDVA 4NNPA 4RU1A 3JWHA 3KVRA 1S96A 5AKYA 1IOWA 1U1IA 2J85A 2YNMA 4MVJI 3TK1A 4LGCA 5DYIA 4F9FA 3LS2A 3CV3A 2XVYA 1KI1A 3AP3A 5DJ5A 1UMDA 1LV8A 2OT3B 5GZ1A 4JU8A 3IXQA 4A8TA 2GHRA 5B6PA 3ZLUA 2WPDD 1U0BB 2P6NA 1EVZA 3TRFA 3OCJA 2OEPA 3NT4A 1WU7A 4HG2A 2CXSA 3OCZA 5FBVB 3KFVA 5HBRA 1JTEA 5JNUA 3UK6A 1KKUA 3WZMA 2Q1SA 3O8QA 2H29A 1MJHA 1OLXB 3EQ7A 3H8JA 2RD2A 1H2YA 2QZSA 3ROPA 1IB6A 1OPXA 3O5AA 3SF8A 1T9DA 2QN9A 3OAAA 3I6ZA 5IMSA 4K81B 1AXGA 2BZ1A 3CTMA 3HNRA 2Z83A 2QLBA 3FCYA 3NYQA 1Y7TA 2OK7A 2WYUA 4ZHQB 3H0CA 1M2OA 5BWNA 1GUZA 2W58A 3KL4A 1LS6A 3U3XA 1FX1A 2FV8A 4M1KA 2EWVA 2V6IA 4KQ9A 1U9JA 5B36A 3K9CA 3T4EA 1KQFA 3HJRA 3UK1A 2BYTA 4DCPA 1XYVA 2QWXA 1D3AA 3NNNA 4NJMB 3T3MB 4FGZA 1GDTA 3R5JA 3AEQA 4HPJB 1NONA 4KBFA 4LTDA 1IFXA 2GJSA 1YQTA 4G01B 1DFGA 1VLZA 3INGA 1FY2A 4M46A 3ZH2A 1W35A 3B1XA 3GJ3A 1KI6B 3RSLA 4IIJA 4FZRA 2O1XA 1DCFA 8AT1A 3A2MA 3OPQA 5CGZA 2JFHA 4W4TA 1NXPA 3BXHA 3QE9Y 4IJVA 5F5LA 1Z2NX 1DZIA 3BSWA 2VATA 3OZXA 4RW0A 3UWDA 3KOYA 4Y3UA 2QUHA 1D9ZA 1QHSA 5EKXA 3USZA 1FQJA 2G0AA 2ZB2A 1AV7A 2IW3A 3K6KA 3LX5A 5F2KA 2LKCA 3T7CA 3H65A 4ERXA 1SMKA 4PO8A 1QQBA 1PSDA 2O48X 2VDQB 5EMLA 2C97A 3H97A 3ESXA 4D82A 3D6NB 3BCRA 3P9PA 3L4EA 4AUEA 4EAAA 5KJ6A 3NEJA 5FHRA 3SHVA 3H3XA 4TLCA 1SD1A 2CBGA 1GTRA 4M1MA 5C1IA 5DGIA 1RWQA 1EPUA 4MCAA 2O7RA 4L8WB 1L7QA 4EJSB 4EKEA 2QRUA 1J2JA 4HOYA 4YRPA 2HI0A 4G0NA 1P80A 1FNDA 2AMLA 3IEKA 1GQOA 3VR6A 2OGZA 1J5XA 3CN9A 4XQGA 3UKOA 5A03A 1CUZA 1QYDA 2AG1A 3H7IA 3AEKA 1RKUA 5E4FA 1D03A 3TIFA 4HQLA 5JS7A 1AT1A 3JD2A 1OGYA 4LOKA 1R4NB 3SF0A 1GUAA 4IZHA 1GAXA 3JAKA 3CW2A 3T9CA 3FTQA 3IVAA 3MTGA 4EYKA 2JD0A 3QU7A 3AVTA 3BJIC 4EFMA 5D2CA 4C0LA 3AUTA 4FD2A 1XEAA 2EFJA 3FSGA 2H2DA 2J8ZA 4MVWA 4E70A 1GXSA 3IQGX 2H4FA 3LQ1A 1RYYA 4CIWA 1W19A 3GFRA 1H4VB 1UAYA 2GK3A 2VYQA 3U4IA 3PV0A 5FT9A 2WUEA 4WUVA 3P52A 4LDPA 4BO4A 4ZOCA 3QZUA 2H59A 5A6SB 3MPUA 4XRRA 1WUYA 2VTEA 3C6YA 1YKSA 1U1CA 1YBMA 2DXIA 3IP3A 2OYSA 4HEA1 2CNNA 2XQFA 3A10A 1SHLA 3EXIB 3RU2A 4DRXA 2ANBA 4RMNA 1QS0B 5G4LA 4BKPA 1P7ZA 3DF7A 3L6RA 3HMQA 1JBEA 4FSDA 1RM5A 2XUPA 3E70C 3UQZA 1QIHA 1NXOA 3DR5A 3BXOA 3NALA 4AM8A 1J22A 2O0JA 4KQJA 4LPKA 1V95A 3DBVO 4LY6A 4AG6A 4GBJA 1VE1A 2Z6VA 5BW5A 1I24A 1X74A 4NV1A 2RB4A 4K8RB 3D8HA 4I2VA 4U7GA 3SXJA 2P9CA 4J6EA 3ZE6A 3RC9A 3A8TA 5LJIA 4OXIA 2ZBEA 3QMPA 5LSAA 1PS8A 4UUMA 4XARA 4Q1DA 2VLBA 4YQEA 1FDWA 1J70A 1TUBA 2OFPA 2VDOB 2P7IA 5BSRA 1EZ1A 4BQRA 4UD6A 1CY0A 1EYZA 1G7CA 3K5HA 1E5TA 3I72A 3T1TA 1T5TA 1SA0A 5EWMA 1XMQB 3GPLA 1YS2X 2PV7A 1WHTA 4I6GA 4JSRA 4WK6A 3L05A 1B8OA 1V1MA 1YC5A 3ZXXA 3CU5A 1GEEA 4UU0A 5PGMA 4B17A 2QZ9A 2X40A 5AWFC 1QYRA 5AVJA 4A6EA 1M2WA 2EZ8A 1PKEA 2PUEA 3DE0X 1QZZA 3QFTA 4BKMA 1JSRA 4IOKA 5EEGA 3FOWA 4PHTA 1JP7A 3I04A 3N8NA 2ZXFA 1JJIA 1YIDA 3PIRA 1QCYA 3PVSA 5DLQC 3GJYA 1AK2A 1VPTA 4BQNA 5IH7A 2PBZA 2GT1A 5HQJA 1KE2A 5T6BA 3RANA 3IQDB 2GASA 4J4HA 3H11B 4FILA 1KGDA 5HFJA 5IZCC 2YBEA 3BFVA 2P9BA 3EEIA 3WAJA 5EFZA 1KRXA 1XEXA 3FGOA 1USKA 3V1MA 4L72A 2CVPA 5BWBA 2J7PA 1K2WA 2GD0A 4FQ7A 1LS1A 4I6EA 3RSOA 5KTRA 3D43A 5CDUA 1W4ZA 3MJEA 3HSKA 3WL8A 4Z7JA 1F06A 1Z0AA 3NOVA 1RXUA 5DYYA 3RAGA 3N2EA 4AZ3A 3AU8A 4Y2XA 4M1QA 2DULA 4FZ5A 3WLIA 4BO1A 1S0UA 5BXYA 3MEQA 4O6VA 2WUFA 2OMEA 1SBIA 4MYDA 3DZ8A 4TTIA 1J39A 5DYNA 3SLGA 1QF7A 4KZPA 5IKOA 1ESCA 2JNWA 2KSQA 3IFSA 4GQIA 4PVDA 3TS1A 5KQRA 2F4NA 4ENRA 4RTPA 2C4NA 4ARAA 1C7IA 2FA9A 5L3ZA 5JADA 2KX7A 3LTNC 2ZVJA 4OHFA 2JIZD 4PNZA 2OCGA 1DCMA 1VKZA 2XOKA 3DNFA 2JGFA 1HE3A 5DHUA 5JXGA 1CJKC 1PJSA 4HWSA 1VKJA 4G3XA 2P3SA 2P4HX 4LTMA 3HCDA 3ZV7A 5F98A 2CCJA 1BE0A 3PZBA 3ZDBA 3Q11A 3Q5EA 4WCFC 2J6HA 1AJEA 1DMRA 2DPXA 2J30A 3QLVA 4EY8A 1RAGA 2ROQA 3I61A 2R8OA 4RF4A 1A4XA 2PA0A 1XU9A 1W88A 1ZD5A 1BX3A 1QNLA 4CEIA 3TZEA 3WWOA 4CT4B 1YACA 4S1OA 3DT8A 2N1MA 2Z6AA 3I6MA 2R6HA 5T8KA 3U4GA 4ZEWA 1W96A 1PNTA 2BSAA 3NW9A 5EJIA 2PUHA 4E5KA 4ZDWA 3WLRA 2L82A 2GD2A 2QUJA 1QQ7A 4QYTA 2SECE 2O5VA 2Q28A 3GHYA 4LFBB 1K0UA 2V6FA 4RH0A 2VZ9A 4BQEA 4O4HA 4K1XA 2J0VA 4W5HA 3GBSA 4Y2TA 2BLLA 1SQSA 2BT4A 4K6HA 3ZCVA 4O1HA 1AMNA 1T3LA 1WD5A 3BREA 2C0CA 2RGYA 4RANA 1YJAA 3DOUA 2A84A 3SC3A 3SKXA 3ZY3A 3SHOA 4JSTA 1N1GA 2IY7A 1N1DA 4H7JA 4P86A 3LNCA 4XFDA 5EQTA 3DOCA 4EP1A 1OB2A 2BI7A 2VPWA 3H5IA 4TGLA 1KETA 4PPYA 5TGDA 1M6YA 4GXRA 3CNHA 1SU7A 2NTEA 3CO5A 3WSTA 4Q9AA 1CERA 4ZO6A 1MV8A 3BXFA 3ZD8A 1PR0A 3FYUC 1E98A 2IYXA 2PGDA 4IPTA 4X8MA 3TKAA 3NBYC 5CEEA 3I6QA 4DANA 1TKAA 1BWQA 5F7XA 3DP7A 4RESA 3TTWA 3VGPA 4RH1A 5LQDA 1NW4A 1JJFA 1P7YA 1XMSA 3TLJA 3K9NA 5FUXA 1XFAA 2CDRA 3PGKA 1UC4B 4F5EA 1ZIDA 1T8TA 3QE2A 5H4HA 4RLHA 4K6GA 1G6KA 4PHGA 3GGJA 1D5CA 4PONA 4AWBA 2BFCB 2I3AA 4LWPA 5CLHA 2HJRA 3BK2A 2NTJA 2NUTA 1RC0A 1U6JA 3TZHA 1YKGA 4JBXA 5F5XA 3AY3A 2EZTA 3RDPA 5DGTA 2K7FA 2VZLA 4FCTA 5CYFA 1M2VB 1QCZA 3ANSA 5HKLA 3IP6A 3Q7TA 1IWPB 5JCOC 1AGPA 1IHOA 3G8BA 3KE8A 4BY9E 3ZEIA 3IPXA 4D3SA 3TEFA 2OKGA 1DCKA 3HA2A 4BC0A 4OQ4A 4XYMA 1EG2A 3TQSA 1FFWA 1I2BA 1NU6A 1E9RA 4E6PA 5IU6A 2A9PA 3W04A 4Y2JA 2HFKA 1X8LA 2QX8A 3B2QA 5JANA 1RHUA 3IOEA 1X92A 4GL2A 1U2TA 4Q1CA 1F2DA 5ADWA 3H3FA 4G0YA 2AC2A 4XAQA 4AX8A 2P4SA 4LOAA 1CFZA 2F2TA 2YVQA 4WINA 1ID8A 2VQDA 1UZUA 4B9AA 4K03A 2QAGB 3R20A 1JPJA 4OSPA 1ZK1A 3URKA 4TS9A 3E9DA 3IAS1 3NTUA 2IV7A 1BN6A 1XAIA 4GZMA 3B8EA 2HWXA 4J1TA 5IEBA 3RBXA 1PD0A 2O2EA 5EJ5A 1GPDG 4QOIA 2CHGA 4N6OA 1BCSB 9MHTA 2BWJA 4H7IA 5EKSA 3UF0A 5KTNA 3ZR4B 1MW8X 4AKGA 5DU2A 3VU9A 1CU1A 3W5UA 5CFOA 4BJ3A 4A36A 4ZI7F 3Q72A 4EYOA 1OBOA 3WLQA 2WJWA 2FMHA 1S3GA 3OOYA 2VK4A 4ZIRA 2QEQA 1DJQA 2VT2A 2XYRA 4MWSA 5DBFA 5I47A 5A62A 2QT9A 5KYYA 4HTFB 3VAZA 3EZ6A 1IIBA 1GY8A 4PAQA 5KIAA 1DAFA 4X7PA 3UT5A 2P9EA 4CXMA 2VL7A 4TWZA 1L7OA 2CLFB 4QODA 4WXEA 3IJPA 2AZMA 4KWTA 1J0EA 2FZEA 1YQUA 3JD0A 3QTTA 4LZOA 4R3WA 2XCUA 4FFDA 3WWZA 3RVLA 5AUNB 1U3TA 2Y93A 5JUWA 5CD1A 2REBA 2V0CA 5FFMA 1HK7A 2ZIXB 1ZZEA 4INZA 2JK0A 5F3RA 4CN9A 3WGYA 3FTPA 4I1VA 2PXXA 1QF6A 1DO2A 4B4DA 4ZGWA 2QL9A 2PUDA 4MEBA 1REQB 3O9ZA 3Q7QA 5EP4A 4LGVA 3TIGA 2MSWA 2ZT8A 1BVYF 1WUKS 1D2MA 1R00A 2AFIA 2YIVX 4JVMA 5HF9A 3PX2A 2ZREA 4IGIA 2XDQA 4US2R 5JSUA 4S0ZA 1OFUA 1Y7LA 2WIAA 2TMKA 2EX0A 4M55A 4PZCA 3JPWA 1L5GB 2W90A 3SKYA 3SLKA 3W6OA 3JYHA 4ZVQA 1U2SA 1UJMA 2P2YA 2WYVA 1KHTA 2A58A 3NCTA 1H5QA 4R2WA 3TL3A 1QP7A 1U2GC 1KMCA 1MAUA 1W1IA 4KPUA 3O73A 1GFWA 1UMCB 3HR7A 1X1TA 1K9VF 1X14A 1DBQA 3ACDA 4QYXA 4JCOA 2O4UX 4EBFA 3TRIA 2B9EA 1VMKA 4UPDA 1I7QB 2UV8A 4N8SA 4U2FA 5JSHA 1GLNA 3MS4A 3RKUA 1QIDA 1W4BA 3C70A 5CK5A 1B1CA 2VT7A 3S70A 1CR4A 4TV8F 2G06A 4BNYA 5L4NA 1PBTA 5AM5A 3K70C 1UBGA 5BOSA 2XRFA 2VJNA 3EHEA 1AGNA 2BGIA 2IEBA 1WV1A 2XMCA 4OXKA 2PT6A 4I3FA 4XTCS 4R5MA 3S4YA 5ALFA 2OVBA 3PUHA 2ZRCA 4TKZA 3LRXA 1EEXB 5CVEA 4ZCSA 4UVHA 4HKTA 4HPXB 2JI8A 1H6CA 3M0EA 2VPTA 1S9DA 1RYZA 3PUXA 2Q8NA 4O3FA 3N6RA 1OLSA 2OFXA 3DHNA 4H0CA 3DLTA 1H2ZA 4GI7A 4HNSA 2Q1TA 1QV6A 3HUDA 4H31A 4IIEA 3ZX4A 3SZUA 2W6IA 1UQUA 2RGNC 3NHPA 4MUAA 5A0VA 3VSCA 1X9GA 3K0HA 1D7AA 1T15A 3PKZA 1RI3A 4E1BA 2VAMA 3THWA 6REQB 3P9ZA 1P7PA 4CM9D 4KRFA 1N75A 1EFCA 2YS6A 1MQ8B 2FSPA 2F3PA 2CLSA 5ETJA 3AI3A 2O54A 4UHDA 4COOA 4PYNA 4OB7A 3L84A 1C2TA 1VJ1A 4IYJA 3HFGA 3JTEA 3UPDA 4F3KA 4HI0E 4NENA 4P53A 3M4ZA 1NVUQ 4DEXA 4FXPA 4JFAA 1EE9A 1DKUA 4F3CA 4Y1FA 1T6BY 2NQ2C 2WM8A 2FUG1 5EERA 1OA0A 3L18A 2GBPA 2Q21A 2QROA 3OZEA 4NYMR 1JKMA 4URYR 5BV1A 5C46F 5LM3A 3H6HA 1UZNA 4LJYA 1NUPA 1N0UA 1HORA 4MCHA 5D3MB 1TO1E 5ESRA 3A4NA 5FTKA 3SBXA 3AC0A 2ZJ1A 1YFJA 4O2AF 3LPDA 3KBOA 4ARBA 3JVEA 4P4GA 1AUOA 1CXZA 2N3ZA 2WJJA 3FFWA 4OPMA 1G3RA 5D7BA 3MBOA 521PA 1O97D 1Q12A 4BUJA 3ZVMA 3ZJYA 1FZTA 3R75A 2NP6A 3JRNA 3KJQA 1W36D 3NXKA 5DPMA 5LOVF 2YASA 4HEJA 4PAMA 1IATA 2PV0A 4Z86A 2O2SA 3DR3A 4YAUA 1B73A 4O25A 2X5KO 1YMQA 4FX2A 4C2UA 4J2HA 3CT6A 4MWEA 1UZAA 3V8VA 4E2WA 2VAPA 5GONF 4BL5A 2PUJA 1WWKA 1V37A 3M34A 4NK5A 4TTAA 2DFDA 2QRLA 3GCWA 2P65A 3IHTA 3KQKA 3BEOA 1V35A 5JCXA 2GVDC 3RRYA 3U5TA 1NXQA 3LZCA 1LK7A 2GD1O 2BGWA 1QRUA 2VRCD 4J16A 4MW2A 3T9FA 2HREA 3D8BA 4AO6A 4R2MA 2EBUA 3Q10A 1Y3IA 1E3LA 1E62A 2R96A 3K9HA 4GKBA 3T7EA 1B8VA 2ZU6A 4IS3A 4RQAA 5BNIA 2HHAA 2P6MA 2RHHA 1DP4A 1E1CB 1VJGA 1EP1B 3DTYA 3W5IA 4DMUB 4Y6OA 1Z16A 2OCBA 1WHSA 2Z43A 3QEMB 4RS3A 1QP8A 4EA8A 1Z73A 1MA3A 5HQ3B 1J4AA 1M7BA 4XJXA 2VJYA 1AXEA 1F5NA 1SR8A 1HFWA 2FMXA 4V02A 3PRYA 3VX3A 2P9GA 5JDCA 1KVTA 4JKOA 4MAMA 4OI1A 4KLNA 4Z49A 3G1TA 2FSVC 5EWLB 1SJ9A 2W8ZA 3QE3A 2FDCA 1NYLA 4E33A 1XDUA 1AB6A 4ND2A 2OSVA 3T1VA 3I8OA 1JQ3A 1PFKA 2HZBA 1E79D 2B2CA 3R09A 2JBHA 4J4TA 4LYGA 3FZEA 4PW0A 4W7IA 2G25A 5CVVA 1RHRA 1QRRA 1U0EA 1IM5A 2HQOA 2QNBA 1VBKA 3F0TA 3CKLA 3EBPA 3RK0A 4MO2A 1GZSA 5JV5A 2O8BB 3K4QA 3P0EA 1JRLA 2NYVA 2ZYHA 1MH1A 3OX1A 3PNLA 3NWBA 4HAYA 1EA7A 2QSZA 1FLNA 3CFYA 4RQTA 3N2KB 5H0IA 3DEKA 4FONA 1E2FA 2DYKA 2FW9A 2FPGB 3HXLA 1NXXA 5FULA 4U2BA 4JJEA 3CH7A 2B8JA 3P7MA 4DPLA 1A2OA 1Z68A 5TJHA 2FOXA 1MG5A 1AURA 1RTKA 2I2WA 2ZETA 1SKQA 4LW8A 1YHYA 5K01A 1L7DA 5I9MA 4JITA 4GIBA 4TVSA 1NXVA 2FZKA 4AECA 4KBYA 1T8UA 4E21A 1TOAA 3WRYC 1Q0RA 3U7QA 4F1JA 3F3KA 3OLYA 4LG1A 4PTLA 1KMIY 4ZWNA 1JIIA 1MIOB 2QSJA 5HTKA 1DJNA 2EL9A 3QF4A 1FJXA 3G2JA 4B44A 1MVLA 1GYRA 3DMTC 2EQ5A 4JI0B 1VJTA 5BR7A 4FGLA 5HS4A 4LY0A 1RWKA 3OIVA 1T29A 1T0IA 1WDWB 3IVCA 2CJXA 4R2KA 2JLRA 4WN9A 4QVIA 2C58A 1PTKA 1RQNA 2EP7A 2AX3A 3JZAA 1U0OC 3OPYB 4RULA 1EUCB 3DTVB 4PNEA 2J48A 4IH4A 2HIAA 4REOA 1GG2A 1WBJB 3R7BA 5LN1A 1UZMA 3E27A 2H4XA 2OORA 1PGOA 1TMGE 1QG4A 2PMDA 4MV7A 3RARA 2XUZA 3LX4A 3RC1A 1N5JA 1GTMA 4MGKR 3QV2A 1N2BA 1SOUA 4ZOBA 3VSAA 1A3CA 4DUGA 4PQEA 5KKAA 1M54A 1M9NA 5A5DA 1E2MA 1ABBA 4QUHA 1SVIA 1XO1A 1V11A 4EHHA 2PZKA 2B30A 3QVOA 1XQ1A 2IBMA 2OCYC 2A9VA 4GM0A 4PF1A 7REQA 4F92B 5LP6A 1NATA 3FNGA 1WETA 2AHOA 2R6DA 1D6JA 4LVNA 2NTNA 3ZDZB 4WZ6A 4TUYF 4A26A 4HDRA 4DDMA 4RM2A 1C7FA 1G9SA 2E5WA 2AJLI 3CT4A 1KQGA 3CUEF 3PXXA 1KZYC 1X7WB 2X2FA 2XD9A 1XTJA 1ECGA 4I5IA 2PZFA 3SS9X 2GBGA 3TLGA 4YIHA 1ZFNA 3H19A 1FUKA 3FOCA 3H2KA 1QAMA 3AXTA 3LM8A 4QBKA 4NBSA 3ZC3A 3L4JA 4GAEA 1NWHA 3CVYA 4D96A 3SICE 1N5LA 3Q3CA 4NJOA 4CM3A 1H4SA 1PW7A 3HMKA 5FJIA 1D2AA 4KLCA 1NJGA 4A6XA 4DLWA 5JQGB 1PU2A 1Z12A 4H4DA 5C7YA 5HJEA 1Y8RB 2JJ2D 3IVGA 3HKEB 1T1GA 2BKXA 1GDHA 3GVIA 4NG4A 4DF3A 1BRMA 1W44A 1NSTA 1KTIA 4LYJA 5H68A 2B78A 5BNFA 1PT8A 1CR2A 2DH5A 3QFHA 4A03A 1SXGA 4WJZA 1N3BA 1NDHA 2NIPA 4II3A 1T36B 4N4AA 1BXGA 1DC3A 2RG1A 1MO3A 5HDBB 4RLQA 4E2XA 2JGLA 5TMDA 1ULBA 4D9EA 2XDYA 1IN5A 4GT1A 3GFPA 1FRFS 4JL6A 4KQIA 3BAFA 3V4OA 1OFIA 3MT8A 1CK4A 4TS4A 3SMQA 3ETGA 1AHHA 5IYZF 3DE1X 5FWXB 2AGVA 2RHOA 3L04A 3WB1A 4HH1A 5IJZA 4HDKB 3D8UA 1IXKA 1XJQA 2DRIA 3IHLA 5J1TB 3F5QA 4HWKA 3U13A 1OX4A 1YS1X 4JBNA 2QVCA 3G9TA 5HM8A 3DL0A 3WWPA 2XVXA 1T9HA 1E7MA 1J21A 4J1SA 1T4MA 1HQDA 3EJWA 3H87A 3CNBA 4J0EA 2DC1A 1JVBA 1X6VA 1A95A 1AG9A 1DT3A 4J75A 4O33A 1ZGZA 3GLGB 1VG1A 3SC2B 4CTNA 2EBFX 1G8YA 4BX3A 3RVQA 4JHXA 1GQFA 1GPNA 3RLIA 1B6RA 1M2NA 4IV5A 1G0NA 2P5YA 5AOBA 4ECAA 2QY9A 2IE8A 3HKDA 1XLVA 1A5ZA 4IQ8A 4UAVA 4FOOA 3MMXA 1PR6A 3LY8A 4KQCA 5I9BA 2A5FA 5I45A 2IDJA 3O4RA 1JJVA 4EY4A 4QDXA 4M2LA 4M8IA 3K9QO 2IZ0A 1XCLA 3PD1A 5IC5A 2XTAA 3IAXA 1PR2A 4JKYA 2EKDA 2P6RA 4HNRA 1T2EA 2QF7A 1UC5B 3HBAA 4CETA 5ALLA 4TLBA 5BOVA 5EWJA 2QTRA 3D02A 4P22A 1K06A 1XVLA 1CUJA 4IDGA 2DPHA 3MN1A 1QE0A 5AK3A 2ADFA 3UMCA 1P81A 1JEYB 2FUG6 2ZR0A 2OC9A 1YL7A 4CCSA 3KR9A 4AJPA 1OZGA 2E0IA 5KNCD 1KO5A 3VV3A 3W2IA 4CTOA 3FRJA 2H7VA 3KSUA 2D5BA 1Z35A 5KQSA 3KXLA 5T7BA 2A9FA 4L28A 3OFSA 3LY9A 4K7JA 4EA9A 4OMFG 5CDFE 1G2PA 2HU7A 1I4EB 1XNJA 3NTLA 1QONA 2RKWA 2YICA 4OFZA 3VYVA 4RV9A 4DV6B 3HCCA 4RVOA 2AG0A 3RTEA 3KKKA 1NTOA 3NBFA 1U8UA 3A14A 3O9VA 4HS9A 1ISJA 2E18A 2HA0A 5DHPA 3VOAA 2PUFA 3HR8A 3O4FA 1H1LB 5EN4A 1KHHA 4ZC1A 3EB9A 3CA8A 3REQA 3V2GA 1Q1GA 1U8FO 5TIIA 1WCWA 2FQYA 2FQWA 3KSZO 3BWXA 2XV1A 2WY2D 2GUGA 2F8SA 1NN0A 2P3LA 1QLHA 1N2SA 2D2IA 3A06A 1NFRA 1BS9A 3OICA 4GP7A 2IYNA 2WFAA 2YHBA 2YJTD 3QHPA 4ZARA 2CDBA 3EG5A 3OPXA 2XI4A 3E1GA 4LSZA 1RFLA 4L78A 4V0OA 4AX4A 2AOTB 5DCWA 1NVBA 1DQYA 2AF3C 1HQYE 4L4SA 3OO1A 1QOPB 2GK4A 3ELWA 4BFTA 1GUFA 5AKHA 2PVSA 3FNHA 4GKAA 3VUFA 2XAAA 2J31A 3CKMA 2WE7A 3LA8A 4PFSA 4DADA 4FC6A 2OOSA 3BM5A 5FUWA 1Y3BE 1NT4A 2IWRA 3GMIA 3L43A 3QU2A 5FNVB 2F6RA 3UMFA 1N25A 2AH5A 4YTEA 4N7BA 1HLDA 4W8HA 5MDHA 3DB2A 5CX4A 1BKDR 2BFBB 4F9GA 4RTRA 1IPFA 3H05A 4QOEA 1XDZA 2VK1A 3R7LA 3GI1A 2HHJA 3S55A 2QMHA 2V7GA 1D4FA 4DQDA 1C7ZA 3UWPA 1DXOA 4DV1B 4B3CA 1Z82A 1A76A 2Q3HA 2BFFB 3F6BX 3A36A 3Q8XB 4FMPA 3ZK7A 1HT1E 1KS9A 2AUTA 4LMBA 4UXJA 2O5RA 1WCIB 2AD1A 2M6RA 3H9JA 2O1EA 3PFCA 4NCNA 4O63O 1GSHA 1NVTA 2WTXA 4OHMA 1AHPA 3JQBA 1W2GA 2J9ZB 4RHEA 2JKVA 3RWOA 4Q9LA 3C4VA 5G0SA 3SCZA 4TL6A 2YYSA 3QJYA 2IODA 1R0XA 1XMPA 2P69A 2EW1A 2HMTA 2V6JA 3HKCA 1ZJJA 3LU1A 4ND1A 2VOJA 5GIOE 1K1EA 1QO9A 2DBQA 3NETA 5FLXA 3FPJA 3K0FA 1GNTA 1PT9A 2FPIA 2I6UA 4CHTA 2E7ZA 1YCHA 2XUDA 4L4XA 4U39A 3QWAA 1C29B 2P30A 3LCCA 2H4JA 2B0JA 1UC9A 2QRVA 3VX4A 1YQ9A 1PIWA 2VHXA 2X8JA 1CQIB 1I5EA 4WVLA 4P81A 4LBVA 2DCMA 4KVZA 1QYXA 3CF4G 4OMDA 2XOXA 4LRQA 4BFXA 3QXHA 2EWWA 1CFJA 1DXHA 5KPJA 1DWPA 5FPSA 4TTTS 5D1HA 2DUJA 4PIPA 1G7TA 4LNHA 4FB4A 4TTJA 4DHEA 2WSBA 4J7XA 5DNUA 4KXFB 5JQWA 2FWBA 4V0NA 5IUKC 4B48A 4TX1A 2DWQA 1TQ8A 2R00C 3IELA 4GW3A 3TAXA 5AVRA 3UW1A 3UANA 4ZKDA 3MJCA 3BG5A 3QOWA 4PTZA 1UK8A 1RM4A 4Q48A 3RWMB 1WLYA 3D3KA 3FWPA 5CT5A 2K5UA 5EJGA 5SYNA 2FUKA 1NVGA 3JYLA 5GJBA 3DPIA 2QT0A 3E9NA 1BW9A 4IIYA 4FQ8A 1UM8A 4FZ3A 2O8CB 2J3MA 3FUTA 1ACLA 1NQVA 1RM3A 2WZQA 3RUHA 1EX9A 1O77A 4MVJM 3KIPA 1P1IA 4Z4FA 1NBAA 7ADHA 3B6IA 4M1SA 1E96A 1OGIA 2Z30A 5GOZA 4RKFA 3EAQA 1DINA 4MV9A 5ALMA 5GADl 3FZYA 5CLGA 1V8FA 2VRNA 5ALHA 3IIIA 3OZFA 8GPBA 4IDDA 4UTXA 1GZ6A 3DKIA 4LTNA 1AM4D 3GDOA 1GZ7A 4R3UC 1NVXQ 2GRJA 3E9CA 4M9CA 3TQOA 1UM9B 4HGPA 4PHCA 2EIXA 4YXWD 2VG8A 3GG9A 2MU1A 3KYCB 5JFGA 2VHVA 3PKIA 3W1EA 3HUTA 1T2VA 3MUOA 2VJCA 5AI8A 4M0KA 1G38A 1SKBA 4W9RA 5GP1A 4MUYA 4XDHA 3NC0C 1T34A 3OVMA 2XB8A 2VCEA 3ENNA 3LL7A 4MMZB 3T5DA 1U2QA 2X13A 5KSOA 1GTSA 4QUBA 3DDUA 1QCDA 5J59A 4DIOA 2SKEA 2YRWA 2GF0A 3LCMA 3FIJA 3BGOS 3OEYA 1D07A 4IJKA 4UW9A 1M1YE 3L7IA 1UKAA 1U0NA 3V00A 5KTOA 1WMAA 2ZVDA 4OHRA 1DRJA 2HLNA 2R25B 3NBQA 4R40A 4LZAA 2X6RA 2PS1A 3SNKA 2HBZA 5EIBC 4Q7QA 3TQCA 2D1QA 2G3YA 2Y0BA 3TDNA 4CIDA 1ZN2A 1F17A 2FRDA 4IIVA 1AU9A 2BCEA 3CX3A 3W2GA 3GLUA 3AHFA 3W5DA 3GT4A 1JKFA 1Q6ZA 1RYEA 1T0HB 3M6XA 3VR2D 5KNBA 4KLZA 4ZK2A 1SBCA 3H04A 2HSZA 4BLSA 3CONA 3EVBA 2XXAA 3MJTA 3OZUA 3WB2A 1GLVA 4LXQA 3QX3A 1VPVA 4OBWA 2WF5A 3I9KA 4CEHB 4RVCA 1W8DA 2DTXA 1IYZA 5BSWA 4QO7A 4DLRA 5HZMA 5CNIA 5AJTA 3NOXA 3UPTA 1N3YA 2AN3A 1E59A 2HV9A 5EZ6B 5J5CA 4LVUA 3TAUA 2DBZA 2A0YA 2ARKA 2CHUA 1FCJA 3ET4A 3FY4A 3CH5A 1VB3A 4FZVA 4I9HA 5J4VA 3P71T 2RB5A 5ALEA 3RIEA 1H8HA 1RZUA 2WD7A 3GZJA 1A4UA 1ZJ6A 2RONA 3KSBC 5K0TA 3MLBA 4BNHA 1EFDN 1PLJA 5CG2A 4YRQA 3K1AA 5LZ9A 2HDHA 1N5MA 1QC5B 4Q37A 4LNUA 5BWLA 1FSFA 4R9VA 4WOCA 2H9AA 1Q7EA 1UF9A 3E1SA 1R4ZA 2C88A 3Q0EA 5K0SA 4XVRA 5JDIA 1NVFA 4AO8A 2IS1A 4DLNA 2OQRA 3RB8A 3AWDA 3R6LA 2VEDA 1QTNA 1Z07A 3LXMA 3NM5A 3R24A 2HDOA 4K9SA 3I39X 3TNLA 1ORRA 1OH5A 1NYQA 4Z3KA 1FFXB 5BMVA 4EGFA 5BSVA 3NVKI 3USES 1HH4A 4KLRA 3G8YA 4ZAVA 2BBSA 4CMJA 4JA2A 4UMVA 4YY3B 1CWUA 3N1UA 2XWJI 5KDLA 3TKLA 4BMOB 4PLFA 3A3PA 1V96A 5DTJA 1XN1A 1HGXA 3FHTA 4DEVA 5IC6A 5BN3B 5JAUA 1FDVA 1DG9A 1L8XA 5EP2A 4RGYA 3RT1A 3UZUA 5LNK6 1FXSA 1K7XB 2BY4A 3N53A 2HU2A 1YB5A 4DARA 2HW8A 4OGGA 2R7KA 4ZREA 4TMTA 1SNYA 4XQEA 3EF1A 3VYUB 2C03A 3FMOB 1N5OX 1ZGAA 2ZWVA 3PXEA 4D43A 4LXTA 4MHSA 3HGTA 1T9GR 3K0AB 1CJSA 1RWMA 1Q1ZA 2BUCA 3IR7A 4MW4A 3TMAA 3FDZA 5B7GA 1MVNA 1RLUA 5AFSA 2C3PA 2G82A 2PGIA 3ECSA 2R8EA 5KOJB 1O5TA 1K86A 3NEPX 4CEJB 4KFSA 2J3HA 2O8VA 3BHMA 4PTYA 2B1QA 4UD2A 4QM7A 2C8VA 1G8FA 1N6HA 4P2GA 1JIQA 1ZONA 5MGNA 4IFIA 3I5YA 2V3CC 1MHTA 1MW9X 3GRRA 4UBOA 4BLPA 3TAHA 3PKJA 5I9TA 3OOWA 2JH8A 1C7RA 4G1CA 1L5LA 1P17A 2FEPA 2DU8A 2H16A 2FFBA 5IM5A 2HCBA 1XDDA 3PNYA 4HGNA 2B4QA 4OMUA 1XN4A 2ECFA 4WQMA 1R8SA 1K8ZB 1XKXA 2YWGA 5HKKA 2QTLA 4Y8VA 2Y77A 4ZZ0A 3F1LA 5CH3A 1Y1TA 3K6JA 2WE8A 1ZYUA 1ORDA 2D00A 3KBBA 3O8OA 2IS4A 3DD1A 1Z6XA 4BB6A 1HG0A 3C5HA 3T3GA 4CFYA 3EEQA 5JWOA 3IMKA 4MRPA 5CB4A 5CP8A 1MKYA 2HSDA 2I34A 3RRZA 1QJCA 1QVWA 3IAM1 4DWJA 3R7WB 5FUVA 4JLOA 1VQ1A 1U8AA 4I1SA 4K9LA 4M86A 4PGGA 4PRYA 1PG0A 1XD2A 3KD3A 3FUXA 5KYVA 4L76A 3RIXA 3WIDA 3OIFA 2ACKA 3WYFA 4EB6B 3O84A 1GKKA 2PS0A 2WFLA 1V9LA 3AI2A 1TA4A 2JIMA 4HFRA 2CLDX 4KODA 3QH4A 3UWMA 1RQ2A 3EZ9A 4M3NA 5BQOA 2P2ZA 3ZI4A 4MKRA 1C14A 3A3NA 4L02A 1NQUA 2ZRJA 2YWDA 2ZSBA 4GC5A 1X7YB 1N2CB 1CV2A 5EZQA 2C1EA 4ZU3A 3K1ZA 4R8KA 1DKPA 1LJ8A 5L95A 2ZTVA 4AYXA 3T5BA 5EYPA 2FPSA 4PRLA 1C0PA 1P60A 2Y67A 2F3SA 1GTL1 2FP4A 1PZHA 3K6RA 4PNPA 5T64A 3RS4A 1J90A 3ZHUA 5TQVA 1AF7A 1ZS9A 4LSGA 3TUIC 2R8PA 3ADCA 1AHIA 4HT3B 4I50F 3MXOA 3ZE2B 5JYDA 1F3LA 4EG1A 2XQJA 1NQWA 1T9GS 3LE8A 2WTBA 3I0ZA 4ND8B 3SYMA 4DC9A 1XI2A 1VPLA 4ZCTA 1ZGHA 2ORIA 3DOHA 4AN1A 4WRRA 4BATA 1U11A 3QKSA 4JLKA 4ALJA 4A9AA 5J63A 1F1BA 1X1CA 1GEGA 2V74B 2IV3A 2ZJFA 4C06A 3IJ5A 4KO1S 3X1MA 2BSQA 4R9SA 3GCXA 4PLCA 4D9NA 3T5PA 3TPCA 1ZAYA 5CITA 4JFRA 2JA1A 4EPYA 1EX1A 4WZBE 4B7CA 1EHYA 3E7FA 4QNMA 2IF2A 2AC7A 3AFMA 1HDXA 1G3UA 5BO5A 2Y71A 5B6IA 1XLUA 2VWPA 1Y34E 3RNOA 2GAAA 1Y9AA 1QLJA 2EKQA 2VDLB 1QK5A 1SKMA 4RTLA 3E15A 1H05A 4BJ5A 3ELBA 4DDVA 3B13B 2QL7A 3OEHD 5F4ZA 1LDEA 4O8ZA 5AKZA 1IOVA 1LDBA 1PYDA 1ZUHA 1XD8A 2P67A 4N7JA 2A8YA 3MRVA 2H5JA 2H7CA 2I9PA 1LDMA 2DZDA 1WB9A 1CB7A 1X8XA 3MWJA 4C4OA 4LDQA 2WWTA 2XUGA 4KAFA 1TUEA 1GQ2A 4TM8A 5AI0A 1BE1A 5ERGB 3TLXA 5C3MA 2OO5C 1RXEA 5FBHA 2H1RA 1GZ4A 1NBIA 2A0UA 4KAJA 4YJ3A 1SB9A 3KLBA 1NP6A 1XTPA 4U02A 3HB1A 2XUAA 5J1SB 4YFYA 1YA8A 1BMDA 4MK4A 4Q7JB 5L6LB 3DZHA 2PX2A 2AOUA 3MERA 3EFEA 1ADFA 4KXMA 3AQ4A 4UUNA 1E64A 2C2OA 1KZ6A 3W2TA 3CR3C 5DNCA 1KS2A 4Y6RA 2BBTA 3DB1A 4TRMA 2EX4A 1IJFA 1TW2A 3FNQA 1U31A 3TMKA 3DZGA 3EX7C 1QHXA 1QZUA 2DHDA 4MPDA 4R69A 4ZQGA 6AT1A 3AGQA 3G82C 1HYQA 3QHQA 1RWPA 2B7BA 2XADA 1DKQA 1UC8A 2QIPA 2H65A 4KGXA 4N0PA 2I3GA 3GQBB 4R2LA 4N5DA 4YQFA 4JI4B 1SUBA 2AZ4A 4ZXPA 5ELXA 4M8LA 3DCJA 4P4SA 1JEAA 4OL0A 4ZVOA 3S5UA 3ASZA 3OZTA 4ZAWA 3EQ2A 3D7NA 1LDGA 4R2XA 2AJTA 1WMDA 1XLTA 2O5EA 1NC3A 2MWMA 4HGZA 5J3JA 1W4RA 5AK0A 5DLPA 3DEYX 2CFRA 3GLRA 4XPIA 4G2TA 2YX1A 5DISB 4JXJA 1ZMBA 2XPCA 3HU1A 4J90A 4QGAA 1XDBA 4DC0A 1IJKA 5IKMA 4ZPJA 3AEXA 3AW8A 2QW0X 3H17A 2HQRA 5ILOA 3MM4A 2BEUA 1W0JA 2JFYA 3UQYS 2BPOA 4GYWA 3GGCA 1OJLA 1NL3A 4RL6A 1S7GA 5AVKA 3Q2KA 4YAWA 1Y81A 4QU5A 4Y2PA 1SEVA 1YIOA 2D1TA 3N7UA 5BRJA 1CEYA 4PCVA 1WG8A 2FWJA 4B6PA 2NXEA 3AVWA 1E4OA 2YOHA 1WXEA 4IL5A 3ZCQA 2P9YA 3TQFA 1XZLA 4L57A 1EM8A 4AKSA 5A4IS 4URZR 4Y30A 1S2MA 2Q7XA 4IFEA 5EJ6A 4EENA 2QAGC 3BIOA 5JZOA 2XA1A 3VISA 3ODGA 2DSTA 4HB4A 4B76A 4FFNA 4L07A 4YC7A 3UAXA 1E2PA 1Q92A 2FR0A 3EDYA 2DY1A 1I6MA 3O0DA 1VPDA 3HACA 5EXPA 1KDYA 3ZDXB 3SM3A 4MR9A 1E4YA 1RCUA 1S01A 3C3YA 5I7AA 4QUIA 1ZSYA 1I13A 1SIOA 5FPTA 1FOEB 1U4SA 4EO9A 2V59A 4WLEA 4BE7B 4QBIA 5A0FA 2O2ZA 1EWQA 4DJAA 3U7EB 3AV0B 2ISSD 3DZCA 1FP1D 4UTPA 4ENQA 4HNAA 1ZU5A 3JASB 4J0JA 1AQIA 4BRUA 1PZGA 3W3AD 3H1PA 5TEVA 2ZIZA 4ZVRA 5ECGC 4MV0A 4INJA 1OI3A 1UEIA 2D0PB 4JA0A 1AH2A 1RQRA 1NF8A 2BMAA 1DPGA 1QGUA 1YZKA 3MF4A 2OSBA 4DYDA 4OUDB 1RWWA 3QP9A 2VTBB 5DM1A 3LF2A 2Q3JA 3NV7A 4PLZA 4Y98A 1RIFA 4BNNA 1N4DA 4MIEA 5B2EA 4DLSA 5E1OA 2H2HA 3TZQA 5JIBA 4EW6A 2XGOA 1DIOB 1O6GA 4PCUA 1P9NA 1G55A 3K9GA 5H3LA 2VJMA 1JH8A 3KYBA 4F60A 4ENVA 2GBLA 1CKEA 1EP3B 3AB8A 3PTZA 5A4AA 3SU8A 1QK4A 5J5VA 4UMDA 2B8TA 2Z98A 3O3NB 3P9YA 4M0FA 3NNDA 4NFLA 4OHXA 5HUQA 2FG7C 1RQLA 4B40A 4AZWA 2GPAA 4A8JA 1PZEA 1WCXA 1JGTA 4GSKA 1V4NA 4EHKA 1XYYA 2C2BA 1JLLB 3ELUA 4C3UA 1VRCA 1M8GA 4IZIA 2QRMA 4F6RA 4F9TA 1DC7A 3F73A 4H0FA 2FFQA 4F3NA 1P6QA 1Q0PA 5KYUA 1G98A 3GEDA 1A9RA 1CUIA 3TSAA 1SUEA 4WOJA 4M83A 3DHEA 2H1HA 4B71A 1ISFA 2M6SA 4Q3EA 5DWDA 4TZ6A 3JYQA 4YMLA 3V3KA 5LVAA 4B35A 3NHKA 3B3GA 4A3SA 2H1SA 4GWLA 4CV1A 4DR7B 2O8DA 3ONWA 1NBMA 2JASA 3ZV5A 3VVMA 3AERB 1J00A 5KTTA 2L19A 2LV8A 4BYGA 3B52X 3MRTA 4J9UE 2IYQA 2WMOB 4LCJA 4GPD1 5KINB 1GVNB 4L2IA 3TNJA 3DAOA 4QASA 2R6GA 4DTIA 2HY7A 5TT0A 3KEQA 4EK9A 2YRXA 4R2JA 4ODIA 2BMJA 2QG9A 2ZIUB 2FN3A 2H00A 4EUKA 5JVDF 4DA4A 2Q5JA 3ZE7A 3UIEA 4B3MB 2CLIB 3LTEA 1W2HA 2RSLA 1GL7A 3RROA 2MSEB 3QF7A 2GJAA 3C48A 4D56A 3PFFA 5GVSA 1GWNA 2M6LA 1ACMA 1X80A 4C3VA 1VXRA 1Q84A 2I76A 4IMPA 4KXXA 5TE9A 3L8YA 3GWGA 4LYAA 5DTIA 5HX7A 1TQ2A 2DX7A 1C81A 3N8DA 2R3SA 3L1UA 2N75A 1GNLA 2QSYA 3E7PA 3N7AA 2PANA 3LUFA 1VL1A 2ZRPA 4GVPA 2PZEA 3ILYA 2V7UA 5IEJA 1Z4LA 1EH5A 2O2DA 1WW8A 3DXYA 4YP0A 3UH0A 3EA5A 1XAJA 3B20A 3B8HA 2A7QA 2RKBA 4KX3A 3FMGA 4QDTA 2JBAB 1IVNA 4BNXA 3TTUA 4YUVA 3UV6A 2R44A 3WYEA 2TRSB 1Y8QA 3ICQB 3D4PA 3CIFA 5DBOA 1VHWA 1Q1EA 2C2ZA 4TT3A 4CL0A 3UB3A 1VPWA 4B7ZA 2J45A 4DNOA 1FTWA 1RE0A 3KR0A 4G9EA 3KEGA 4M0MA 4CHGA 2NNWB 2OKCA 2YVKA 4C4XA 5ARCA 2C4MA 4CV0A 3ZN2A 1QGED 1WL8A 1V45E 4FR0A 4RK5A 4DBZA 1NX9A 3HXKA 1YFZA 4LFCB 5LA6F 2QNIA 1ZD8A 4Z6KA 1G2OA 3U4DA 5SY4A 3WO1A 1E4EB 3JQPA 3D6TB 1C0EA 2UYCA 1Y5NA 3JRWA 4S1VA 2GESA 4LBWA 2DHCA 3DMGA 2ISQA 1BMQA 3E53A 1Y5MA 4QL3A 3ZQ6A 1GU7A 3AO0B 4O59O 3OJEA 4LDAA 3T95A 4CODB 4AJOA 4DILA 5IVKA 1V1MB 3DF9A 2R7NA 2CC2A 1NR1A 2X19A 3HO8A 3JXEA 2PMBA 1QX4A 1Z5OA 2R5WA 4IIXA 3GBVA 5TMEA 1SOWA 1JHRA 4BXOB 1UP7A 3GJRA 4C0HA 1FJGB 2B5VA 4U7PB 1VL8A 3JQEA 1HDIA 1VBNA 3BE5A 4PSVA 1LC3A 1M0WA 1WCYA 1XC7A 3FVRA 5YASA 4CUKA 3ZNNA 2AB0A 4K9PA 1QYCA 3DC7A 3HVHA 3HKBB 1VHDA 5JSZA 1KY2A 1QH8B 2XHEA 3EC7A 5AHRA 3A9CA 3K6SB 2Q7DA 4XOIA 3NHLA 3QGMA 2RBGA 4G86A 1H2XA 5LKAA 3M49A 3QUSA 5KDDA 2RARA 1O96B 3BWCA 1N2JA 1FUIA 2W2KA 4J8PA 3GUCA 1F2UB 3IXLA 1RPTA 1F1JA 3I9MA 4WA8A 1POWA 2EFDB 2Q7OE 3KTOA 5DRTA 3I9FA 3UJAA 3M83A 1K4MA 5BSTA 4K8OA 1Y1KE 3STWA 4S24A 1YK0A 2N9UA 1DEOA 4EEKA 3LGAA 4G26A 4K2HA 2G4CA 2EGHA 1KI9A 1WABA 2Z9DA 1KY4A 1I94B 3VJLA 4QATA 4Y2HA 3I53A 4GDMA 3R3XA 3W2EA 4NCKA 5FWYA 3ZLJA 2WSIA 5H16A 4MYRA 4RPLA 3UMMA 5H70A 1MRSA 5B6JA 2WT8A 3D4IA 5IJXA 1OZ0A 4YCBA 3T7AA 1YQXA 2IEAA 1RWBA 4YRTA 1VCNA 3LUHA 2H3EA 3KTAB 1PGPA 1SHZA 4YGXB 3ACBA 4XWYA 4E07A 3PQ8A 5E9AA 1LB1B 4GE0A 2I6TA 2K2QB 3CUUA 2IVFA 3G85A 3JQ8B 4I3GA 2DTDA 1RT9A 3PQ5A 4ALMA 4BZXA 3QMMA 3ABRB 1JECA 1CPYA 3JQAB 3SJUA 2CEAA 1UXOA 3NHJA 4ZMRA 3IB3A 1OI7A 4LS3A 1XKTA 4HDSA 1T5SA 4R7TA 2PSDA 3VSBA 4HUQB 1LBSA 3HPQA 4R71A 5K3CA 3WLEA 3DWGA 5IF9A 3EIFA 1P8JA 1QTIA 1CP2A 1XUOA 1ML4A 4MVJA 1ZX1A 5LBUA 1UBHS 5BN5B 4OQEA 5HF6A 3THOA 2CMDA 1IDOA 3VPGA 4CL8A 3W5AA 5EGNA 4Z9BA 1IBKB 2N42A 3OMLA 4D9FA 1ODFA 2AEEA 4RKEA 1PK9A 1UDBA 3U44A 4I1PA 5F3WB 4IYRA 3Q9UA 3FUWA 1JE0A 2A92A 2I65A 4KN9S 4OH7A 5DBIA 5CBPA 5IXJA 1VCMA 1SZPA 4ZTBA 1XK7A 4PIMA 3BRCA 1V1RB 1SXJA 3A1SA 4EARA 3B48A 3CJQA 3MJRA 1TM2A 4EVSA 2VNJA 3BULA 1JHXA 2YZNA 4FKBA 5DX1A 4OGWA 3DFKA 4ICIA 4ITRC 1O6FA 2CLMB 3IHKA 3G2PA 3TUJC 3AR4A 5HIMA 3RS7A 7AT1A 4NIMA 2XIJA 4C4ZA 4MA0A 4RHCA 4B34A 5IANA 1WTCA 2CSXA 2HSWA 4PXAA 3BUSA 2G7MC 2ZYAA 5KTPA 1UFVA 3KHKA 4JR1A 4H3KB 3ZU5A 4KXVA 5CVCA 4LK3A 3LLVA 4N0MA 1A4RA 1HY3A 1R8XA 2VP0A 5F76A 3CRQA 4F1KA 3MTDA 5J43A 1NF3A 1L6IA 3E35A 4X91A 3P2MA 3O03A 3CGGA 2YIMA 4PS0A 1Y5LA 2P4UA 2B4TO 4Z54A 5HA5A 4ZI5A 3WWYA 1NVMB 1XA0A 5EKTA 1DGQA 1LBIA 2C2MA 4RPGA 1JKIA 2PHZA 2C31A 2XITA 4RD0A 3P94A 3LOPA 1D4OA 4FHFA 3QLEA 2DWPA 3ZKWB 4CQMA 5JFOA 2Y1DA 3PHIA 5EFOA 2DERA 1ZNWA 3H0EA 2C59A 1B6TA 3B1JA 3TZCA 1JPNA 1Z6AA 4XWWA 1SCAA 1P2GA 1YRHA 2I78A 2PVCA 3ZDYB 1SKYE 3GNSA 3LA6A 3H9BA 1AUXA 2OZLA 2ZBGA 3I9V1 3C3DA 4XD7D 4EUFA 4BLVA 2G5GX 4MRAA 1ZW1A 3FBTA 4O4IF 3DDHA 1OAAA 3NPAA 2Q50A 3S2EA 1ZAKA 2RBKA 2KMLA 3EUAA 2GB4A 2AJ8A 1OKKA 1MB2A 4OLJA 4BFLA 1YBAA 1JH9A 3TG8A 1EGHA 4H0NA 4LKOA 3CQ9A 1BJRE 1M6NA 4HX2A 4ZQFA 3O9MA 1ZM3A 2ZTUA 4FU0A 2VFAA 4AZ0A 4EIWA 2C7RA 4FEYA 1ECLA 1BXZA 3ORYA 5EIHA 2BTOA 4AS2A 2F1IA 1TB4A 1MTOA 2AC4A 3LKBA 1GL3A 4I5GA 3WLSA 4R2HA 1OHHD 1POXA 3EFHA 1IJEA 1DPFA 2XE6A 2YFYA 3LIPA 5D87A 1LJUA 1FW8A 1UKYA 4UJ3A 3K9WA 5AKGA 3RM3A 3EFBA 3IOBA 1GKIA 2HEIA 3TN7A 4MDHA 2OD2A 3Q8KA 5LBTA 3WGGA 2B35A 3JAWB 4OAPA 4PRZA 2NU9B 1WZ2A 4IIFA 5B3JC 3C6ZA 3KJHA 5EI5A 4TYWA 1G20A 4FIDA 1MG0A 3E7WA 1MC1A 5G4KB 1HA3A 3V2UA 4E3ZA 4ZYZA 4RXUA 3BK1A 5J9FA 1QFJA 1FYEA 4P7FA 4JGBA 1Q20A 3U26A 1AN0A 4JVLA 1RD4A 1HLGA 1QGOA 1VLQA 2SHKA 2VDNB 3DYIA 3UXHA 5I3ZA 2V58A 3C14C 4BJ1A 4R3NA 2I4MA 1F0KA 1MN6A 1JHPA 1F8FA 2FJ0A 4BB5A 1C9DB 1O2DA 4XSHA 3IT2A 3B12A 4OAOA 3P0JA 4CG3A 4PINA 1A2QA 4PFJA 5IJ9A 1U8EA 4OHPA 3A4IA 2D0OB 1COWD 4EHIA 5K8UA 3MGGA 4QDJA 1ZH2A 3QVGA 4WX2B 1ULTA 3SJ7A 4WK0B 1R0RE 2ZBUA 3BMNB 3EBOA 3ENKA 4H35A 4JLUA 2P41A 2X0IA 3KLNA 5L40A 5HIAA 2Q9UA 2TMGA 3GCGA 1M34A 4FFMA 4KPUB 4QBGB 3VKVA 3VQTA 3DBHA 4KO3S 4B4KA 2HNKA 1YJBA 2ACVA 3OM0A 3QUQA 3EDMA 4NDAA 3HC7A 4DV0B 1KYXA 1H3EA 1G8KA 1PWZA 3N2GA 4JI8B 3VC3A 1X0XA 1VFPA 1TJ3A 1IHUA 1RHKA 3E2MA 3OF5A 3RSZA 4DDKA 3C3BA 2AI1A 2GAIA 3VVBA 2D2EA 4R05A 4Z99A 3WKCA 2HRCA 2C4HA 5IBPA 3BGSA 3MC1A 1QRSA 2PIAA 3UJ3X 2GXAA 3J81A 1TW3A 1TQHA 3ANTA 4EPTA 3C7AA 2ZIEA 1HMPA 1KP9A 1TDJA 2GETA 2HCFA 1P18A 1IAQA 2F3QA 1HO3A 1ZJZA 4Z0NA 5FPYA 1HZZC 1RAHA 4ARCA 1FFYA 3RV4A 4QYSA 3D8TA 4KDEA 4ZI7B 1Q1AA 2XUQA 4YMHA 4LHYA 3SSOA 3UC9A 3VR5D 5H1YA 1XT6A 3HYRA 4NMHA 3ZG6A 4AMZA 1GT6A 3QW2A 1HT0A 1FDIA 3IMFA 4N3BA 4LGYA 1P4HA 5I51A 3GRCA 3BMQA 3TLBA 1BHQ1 3U4QB 3NP7A 1PFGA 2PCJA 5F5NA 3EF0A 1SM4A 1EVIA 3LT1A 1X7GA 4YJ2A 3HM9A 1O0CA 1ZVKA 3A9UA 5BVGA 4WNAA 4XGNA 2PH3A 1HYBA 1XRRA 2I67A 3AFGA 2F9FA 1D4ZA 1P0CA 4RETA 3GVPA 4FMBB 4YJFB 2JL1A 3F2IA 1NMSA 3TIVA 2R0QC 1EXVA 4S1TA 5ER6A 3BKWA 2C9BA 4BEVA 5L7WA 3SS8A 1TGVA 1YHZA 1LFDB 2QN8A 1Z28A 2ZR9A 4K0RA 1E5XA 1K3FA 1P1JA 2WJ3A 4TSKA 5JNSA 5JSQA 1I5RA 1PNVA 1SHUX 3F8TA 5JO9A 5TNXA 3FPHA 4EQ6A 3U60B 3GDFA 4RSRA 1W34A 2HOQA 1F6BA 3FOBA 3Q88A 4L08A 3S29A 3TSCA 3U7RA 3LW8A 4CLOB 4F1WA 3AKZA 1JVNA 3UJ9A 2VRBA 4M99A 1Y8ZA 3A2KA 2G4LA 1JG4A 1JEOA 3GFQA 3MYYA 3EYAA 3KPWA 3RVNA 2B3TA 1C3JA 1QX3A 1VIMA 1QRTA 5CTAA 4QWWA 2P2LA 3EZGA 3PFBA 2VZEA 3A27A 4YX9A 1KBOA 4UQLA 5EIEA 5KQLA 2D5CA 4FR2A 1NM5A 3SWWA 3ROEA 1T0PA 3LP8A 4G6ZA 4RA6B 1H5NA 1JHZA 5LB2A 3U62A 4TLAA 1PV1A 3O7WA 2CMFA 4TV8B 3VR4D 5L3SB 4TS3A 4ZVKA 4HGRA 3SAJA 3TJRA 4FCWA 2W11A 3I09A 3ZH9B 2KYRA 2J0UA 1TYAE 2IPXA 1AQLA 3EK2A 4JYPA 4ZOEA 2XGJA 3KJZA 5GGXA 1TKBA 4XI9A 2TS1A 3KHUA 3Q7PA 2BFOA 3DLIA 3HY4A 1Z0UA 2VRWA 1FQOA 2QBYB 1X3LA 2CYCA 2IYPA 4CLRB 4DRZA 5F2NA 3NDBB 1HWYA 1DAKA 1Z0DA 2LW7A 3KAQA 3IEUA 3C5WP 4Y9TA 3L1KA 1W25A 4AF6A 2ENWA 2IW1A 3U4MA 5HIKA 3AJEA 1JG2A 4JLNA 4TSRA 5K3EA 1G3IA 2BHRA 4Q5IA 3QIAA 5KVAA 2OV8A 4QPPA 3AMVA 4F9EA 1FXWF 1AY0A 1LDNA 3OQPA 4ZJUA 1EFKA 3Q2OA 1D2EA 3F49S 3GP3A 4GRDA 3K2BA 4JJZA 4KDCA 3UJCA 5JAIA 4J0IA 3RBVA 2J4CA 5EHZA 2CB9A 4PWZA 1KBQA 4F3TA 4LWQA 3W8NA 1G9XA 3L46A 1AGRA 2YZ7A 4LVCA 2AQ8A 4IV0A 2ZB8A 4BRSA 3C2QA 3V8MA 3FKSD 3UEOA 2D3WA 1L5QA 3OE7D 4LOJA 3VKUA 1E3TA 3R3YA 1H5UA 1MAHA 1QWSA 3V8BA 3BMXA 2IX3A 3D2LA 1N3LA 2IWHA 3X1DA 1QU2A 1OBVA 3H0KA 1ZMXA 4MKXA 5D86A 3OY2A 2J6IA 5TGZA 4DIKA 2C9YA 5FORA 3ZBQA 4I55A 5CIQA 3ZEAA 3UB4A 1EJBA 3GLQA 2X4IA 1MOQA 4DQUA 3LZDA 1FRNA 3B78A 3MUFA 4GPIB 3S0JA 3UAZA 1PR9A 1HDRA 3AZPA 1OYYA 1R8YA 3TO5A 4RA9B 3VPAA 3QEAZ 4O2AB 4MO9A 1ZUIA 3SJAA 4OREX 3GLKA 5LZ4A 3ZU2A 2O9JA 4QQ8A 3AETB 1AUVA 1MZPA 4ZOLA 5C35A 4QTUB 1CUWA 1P2BA 2JFPA 5LOVB 2AWNA 1QP0A 3LPLA 1XZAA 4JJFA 3I9V6 5CYPA 4TMFA 4JMPA 3INYA 4YEDA 5HIJA 4KACA 3F9IA 3V1TC 3JQ9C 4CYMA 5LMZA 4HQ0A 2P4QA 4R1OA 3VMMA 3V4FA 2QX6A 2H5EA 2PO7A 3R77A 1HSZA 2COKA 3DE4X 5GONB 3GUYA 3TOXA 3AHIA 4GWKA 1B43A 2NZJA 3HVIA 4GH5A 3O3MB 3PDUA 5BQ3A 3LYUA 2J08A 1QQ5A 5KYGA 3H8SA 2K2WA 2HDWA 2ZWOA 3CLRD 2PT9A 1N2CE 4XUGB 4FR5A 2I6QA 2X9LA 1K5GA 1XZIA 3GRUA 3R74A 1ZN7A 3U3OA 5THQA 1XMVA 5LZ5A 1LK0A 2NWQA 2F7SA 1AZWA 1C3OA 2H1WA 4AVYA 2GHIA 3Q40A 3W6ZA 5AW2A 4MUNA 2HB6A 3KB8A 1XQXA 4M0DA 2P0AA 4BBAA 1RC8A 1FJ2A 5C1PA 2EGUA 4G5GA 3LVBA 2E89A 1KXJA 3G9XA 3HN2A 1ZDMA 3PSAA 1S5PA 4OF4A 4QYIA 1LPNA 5K0FA 1ZUWA 2ONYA 2R6R1 5DRYA 4AKEA 4UM7A 3K0CC 1V8ZA 5AHOA 5MN4A 3WQSB 3K8YA 3U3MA 5HKAA 1C9YA 4HLUA 1SRRA 2FAXA 1GP2A 4MR7B 3A0RB 5CXSA 2A9RA 4PSUA 4WDQA 3RIGA 1NMEA 4DZRA 1E92A 10MHA 4B3RB 3BZBA 4KDRA 2ZW9A 3FH0A 1NASA 2GN2A 1GG8A 2HHCA 5E0OA 3BWYA 4C07A 5DCUA 4DY4A 4KNYA 4EDHA 5EJ9A 4FHCA 3HM2A 3UOGA 3CLUD 2R8RA 4P7JA 3WYNA 1M3SA 3DC2A 3TOZA 1EUYA 2QUKA 3E18A 1NZJA 1OAOA 1ZOIA 5FADA 3TCKA 2BHNA 1A8UA 3R0JA 4FCVA 2BE7A 1Q16A 3DZIA 3E22B 3BDIA 3JRXA 1KFBB 3PL1A 3ZX5A 4NZOA 1JHUA 2YZMA 2I7XA 3ZHQA 3FMPB 2I7CA 4D0NA 2XE7A 3ABSB 3U40A 1EAYA 3K53A 3NKFA 4FW9A 3M1AA 1ADCA 2LE0A 2RI1A 4HC4A 5FP0A 4AIIA 4N6NA 4DWWA 1A9XA 1L3IA 1IUPA 4DIFA 2ZM5A 1QH0A 1QH9A 1RACA 1RYDA 4MV6A 1YT5A 5CT4A 5FI3A 5A02A 1R4MB 1NYTA 3GBPA 1CUBA 3H86A 2V7TA 3PUIA 3VPSA 1OXSC 3PL5A 3TR0A 3LKZA 1BD4A 3DDSA 2W4IA 2C3YA 2COUA 3ESQA 4GYKA 4KPFC 3Q3GE 5CNJA 3AVXA 2WAAA 1Z36A 3K2IA 4FVTA 4A8PA 5G2OA 3BJEA 4L6IA 4UTRA 1P5FA 3L0SA 5ERXA 3ITEA 1NZDA 1V5IA 3G2KA 4NC9A 5L4LA 3D5QA 4KYVA 1LTQA 5BNZA 1Q15A 3NU1A 4P7KA 2QDXA 2YOFA 2IOQA 1YK1A 4XDYA 3T8YA 1LV7A 1NOJA 5JH7F 1QOZA 2QPAA 4QX6A 4UULA 5FEMA 1IK4A 2VUTA 4MXDA 5IVDA 2VCHA 4QXPA 1G3MA 3K09C 1CZRA 1NJ2A 3HUFA 4V3BA 2SKDA 2EKBA 2V9PA 1NPDA 5EIWA 3MELA 4JB0A 3ZD6A 1XQWA 3LCVB 3FOZA 3O95A 3WKBA 3MW8A 1I0ZA 3SG0A 2VDRB 2EZ9A 4HN4B 5HZKA 5FAXA 2FZ5A 2FG5A 4MP8A 4HLQB 3A4TA 4ER7A 3IMEA 4JI3B 3HEBA 3HDVA 2GARA 3U4HA 4ZAGA 2XVAA 2FEAA 2WU8A 3PCRB 5BVHB 2UVPA 1XX6A 4TUYB 4DCNA 1UQRA 2CXTA 3OU2A 4JJAA 1KK0A 4LHXA 1GZVA 5E8JA 1HF3A 4FI3C 3TE6A 2R4QA 1TM1E 1HTTA 3DUFB 1VCIA 2FN7A 1A2KC 3KV3O 4M0PA 3WQRA 1T2AA 4IINA 4B7AA 1EP9A 4II2A 3TGWA 3NGXA 3EWSA 2X3UA 3WLFA 1MO4A 4FOTA 2JIZA 5SICE 5THXA 3NHUA 4YV1A 3PYXA 4KYIB 1ZINA 3PNVA 4G65A 1FP4A 4JVNA 2B82A 1VHTA 2AKYA 4HWPA 4BO8A 4DLTA 2QTAA 4BWYA 3N9IA 5I4KA 1N8TA 1I4LD 4C0SA 5IKEA 1LSUA 1L8QA 1M10A 1Z47A 3OA0A 5ED0A 5EKUA 4P34A 4KFTA 3C6KA 1PBNA 4H4EA 2A88A 1MX5A 1ZD1A 2GKOA 5KWVA 5CDSA 1D2HA 1ZWLA 1YGPA 2QUZA 4JI1B 3K73O 1BGXT 1QHFA 4XIFA 3F8SA 5ALUA 1YHNA 3EBLA 2A6PA 3IS3A 5FA8A 3E0XA 3EIEA 3PEYA 3PNKA 4LI3X 3IE1A 2P5TB 5EHGA 2IFTA 1I5OA 3AONB 4Y9UA 1DAOA 3W5SA 2BDEA 4HO1X 3ZWOA 1GGKA 1TZBA 5AKJA 4EWLA 2OFOA 2JVKA 2SCUA 2OM6A 1KO7A 2D13A 2AR9A 1QMGA 2EIHA 2IV2X 1EJ0A 3L4BA 1WBBA 4R81A 4IEFB 4RZHA 4TVOA 4PSKA 4LV5B 4A5OA 1Z6PA 1KK3A 3NHRA 3LGXA 5IYZB 2QVLA 2R6AA 1RJFA 3OLXA 4CMIB 4DIUA 2W6ID 2HMWA 3TQTA 4Z4HA 1MC8A 1M7GA 5IDXA 4V2IA 3EUEA 2QP3A 3IP1A 4IXTA 1FYFA 2RI0A 3Q7IA 3OM9A 4LF8B 2ZCVA 5DP1A 3HADA 2B99A 3NRJA 5J2TF 4W5RA 1W6RA 1SHTX 2D5LA 2VHTA 1PNQA 4ENTA 3EQ9A 4Y9SA 3EEOA 2ID4A 3D64A 3M6AA 4DM3A 4HYYA 5ALRA 5DT9A 1XE3A 5EQFA 4F2HA 1WAMA 1EXMA 1Z5ZA 5LMNB 1GFSA 5LLSA 3AEUA 3EW7A 5K8VA 3BPSA 5L51A 5HTOA 4FYPA 3ILVA 1JDPA 3DBIA 2FVXA 3HBNA 3AOGA 1RR6A 2CHQA 2MINA 2IUTA 3WGVA 1BDBA 1EAMA 2BHLA 4ZCPA 5LNK1 1FNCA 3HN7A 4GVXA 3UV7A 2BR3A 2AR0A 1UOQA 1XZ8A 3L5KA 3PGLA 4JJGA 4TKMA 4X84A 4IIBA 5FRDA 5F7OA 4EH1A 5KEIA 1HDGO 1MTZA 2DBRA 3VU0A 3ZHSA 2J5QA 5DM2A 3WQBA 3A4YA 2OG2A 4LRYA 4M6WA 3ZD9A 4YJGA 4HN9A 2QX9A 2O1WA 1CIVA 3I5AA 3LWNA 3PWKA 1S02A 4OCZA 2G71A