2I8LA

Solution structure of an endopeptidase hyci from escherichia coli
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
b'MTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAVEEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase 3 maturation protease
publication title Solution structure and backbone dynamics of an endopeptidase HycI from Escherichia coli: implications for mechanism of the [NiFe] hydrogenase maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 43
structure length 156
sequence length 156
ec nomenclature ec 3.4.23.51: HycI peptidase.
pdb deposition date 2006-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01750 HycI Hydrogenase maturation protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HybD-like 2i8lA00
1C8BA 1CFZA 2I8LA 3PU6A 2KMLA 5IJAA 2E85A
chains in the Genus database with same CATH superfamily
2KX7A 3CMCO 5A4JA 4O08A 4BB6A 1JFRA 4FGJA 1K68A 4JJFA 4TZ0A 1MX3A 2V7WA 1QF6A 1W8DA 3FCEA 5HDQA 1E59A 5AW3A 1ABEA 3HJCA 2I6TA 3KLNA 4DIDA 1G4UR 4NBRA 4V0QA 5BQXA 1VKZA 3EH2A 5LXTF 1XK6A 1XZGA 4HNSA 3W6OA 3BWMA 2K2WA 3W4KA 5IULC 3A70A 3SFVA 4M86A 1KVTA 3KO8A 1J56A 1SHJA 3T7CA 4NU6A 3V8MA 1JQ3A 2J3JA 2FA9A 4IDBA 1N0HA 2I7TA 2NZJA 2D00A 5IASA 4OP3A 1NMSA 2XXBA 3DFKA 3RF6A 1H5UA 2PSJA 5AW7A 4IVRA 3SBXA 4GRIA 2GBLC 3TX2A 3HXTA 1JQ5A 1Q0ZA 2BVNA 4YNBA 1Y4DE 2BGNA 3BREA 2ONJA 3W8DA 2OBYA 1DMRA 2ZT6A 4QOSA 1S9DA 3EDMA 1D2EA 4WKBA 2PVCA 5H5JA 1P0CA 1FDIA 1CUSA 4OJNA 4G1CA 1YZFA 5DP1A 4BQPA 3KYDB 3IOMA 3OJCA 4D8XA 1U9CA 2ZRCA 4UBLA 4PYJA 1KYWA 2JZNA 4NK4A 3WSTA 3LOUA 4IHJB 2F9FA 2P75A 3K1ZA 4Q47A 3WG9A 2Y1KA 1DAOA 3QVGB 1QM5A 4CDNA 2C54A 1E2PA 1DC3A 3VPAA 3KKNA 1E3WA 1ZINA 2G88A 3DC7A 2GX6A 3V4VB 4JUIA 5AM2A 5FHRA 4EVRA 1P5JA 2IDZA 3AESA 5AT1A 5I7SA 1OD6A 3JPYA 4AP5A 4QRHA 1DIGA 3M9LA 1II8B 1VJRA 2IDKA 4O2BA 3ZIUA 4KNYA 4GR5A 2E5LB 1X7WB 2PGJA 2LUOA 4CT5A 2UXCB 1UXIA 3LAWA 2N1BA 4EUNA 1NR5A 1HYQA 3GVPA 1RJGA 4CMIB 3THXB 2IX9A 1GCAA 2PTHA 4KSCA 2RBEA 3DOJA 3RJ9A 2FQYA 4CV0A 1PIWA 5C7YA 5JJKA 3ANYB 1YE8A 1YUNA 2C58A 5JCXA 2DF8A 2OB2A 3DQZA 1NG9A 1WQ4A 4LF7B 3O4JA 4MRVA 3I09A 4ZPXA 2IZ0A 5EKTA 2PY6A 3FF4A 3LQFA 2I80A 2F43B 3U7RA 2B7CA 4BKMA 2BFOA 5JS7A 1JDPA 5A1JA 3TIIA 1UBNA 3LTEA 4R8SA 3W5CA 2EKDA 1OX4A 1TAQA 4YDQA 2E4UA 3B9RA 4QUDA 3WA7A 1U3TA 1RZVA 3HJTA 1KQNA 3ZD8A 2YV4A 4Z99A 1F8XA 5EJ6A 5JRDS 4J1QA 2OGWA 4JWKA 2AHRA 4INOA 5A9TA 4XH9B 2FPPA 1USUA 4U5XA 1Q0QA 4MXDA 3MYYA 4DIMA 4DYDA 3IPLA 4LFCB 1OU0A 1LCIA 3UOAB 2ZRPA 2VPWA 3DO8A 2NM0A 5K3BA 3GI1A 3P9KA 4GBGA 4RULA 5E9AA 1NQ5A 2Y68A 3B7WA 3C7CB 1ZK1A 5AR1A 4C6TA 1Y1SA 2Y1GA 3NDJA 4P4LA 1EGHA 1Z06A 2ZCVA 4YHBA 2H2HA 5K6AC 2C99A 4ZWNA 2VP9A 5JAOA 4PX9A 3A6PC 3G0CA 1LB1B 3SHOA 3HA5A 1P1JA 4E46A 4GP9A 1VKNA 2DJIA 3I42A 4LZWA 4PGMA 5AHOA 5E1DA 5EJGA 2ZUTA 1FUUA 4D43A 3FKJA 5AW1A 3W5BA 5T7BA 3HYTA 3JQAA 3A3OA 3NAMA 2O2JA 4GYWA 4TQAA 3MBKA 2IHUA 4D99A 5BSVA 1PO7A 3NHAA 4EZBA 2O07A 1CNFA 4YROA 4HFRA 2PD6A 5CTJA 2PFGA 3VXKA 3RYFB 1D0SA 4BN4A 3TD6A 1WCXA 2QPAA 2BY4A 1GKKA 2HXGA 2BFPA 3H5WA 1FDOA 4Z9BA 4C3VA 2C0PA 4RZSA 2ZIVB 4OXKA 4YWJA 3NORA 4B6OA 2QMOA 3CPEA 3E4DA 4NCBA 2C2HA 5KSPA 2PKXA 1YOVB 4X7PA 1IY0A 2JKVA 4ZOBA 3SR0A 1W96A 3FWZA 1RYMA 3PL1A 4EW3A 3G2MA 1U3WA 5KTPA 2ZUFA 3GDGA 3VU9B 4ALNA 1XNHA 2R5WA 3AX6A 3TMAA 4LE0A 2WMOB 2Q5OA 3T9DA 1A2QA 3R23A 2C83A 1E5XA 4BQIA 1J90A 3A4IA 3CSSA 4EA8A 4DCNA 4YQYA 3PF8A 1QP0A 2IYXA 4UC0A 1QGOA 3WBKA 2Z57A 3DAFA 3WNBA 1W6RA 2VYNA 3DVQX 5FLYA 4R8VA 3SXUA 2JGIA 1NBAA 1GLVA 3ADOA 3TMKA 1DX9A 4AZ3B 4BFUA 5JMOA 4UREA 3RWOA 3U4CA 4J0FA 5AKYA 5LU8A 1TCUA 1R0LA 2X3FA 4OD0A 3FDZA 3P2IA 1IHOA 1LPPA 3LYHA 4U39A 4F3NA 3FJ1A 2PS3A 1EVZA 4QVKA 1TW2A 3ACCA 1MAHA 4RK4A 5EWJA 3WKCA 1BZYA 1N77A 2O3RA 2WJPA 4DR1B 5ES3A 1JPNA 3CEAA 3T0GA 2AMLA 2QN9A 1JHOA 3TKAA 3NDIA 5P8WA 2D5AA 1KY4A 4YUAA 5G3YA 1QZTA 4HQ6A 4X63A 1M5TA 1P9LA 2FY8A 3QLJA 4MR9A 4B33A 1QFYA 3AR2A 2VAMA 1FQKA 3L1IA 4XM2A 1UZMA 2SECE 3ICEA 1WABA 2Q6IA 4JT9A 3S8YA 3G68A 4LKOA 3QEOA 3IMGA 4PZUA 5IYZF 2C5BA 4WLNA 3H5VA 3U4DA 5EJFA 4OX9B 3MGCA 1JG6A 1Y8AA 5DCWA 2X0DA 4EY4A 3OM8A 3MMSA 1ILEA 2BH2A 3HCAA 1SHLA 4KMMA 3H2JA 3F74A 4M8IA 5AHWA 2MT9A 2WFLB 1BMTA 2OYSA 3IOCA 4G0OA 3OZAA 5CA1F 4JR1A 1DX6A 2WWVD 1KK1A 5KHLB 1U4SA 1DRVA 4P1ZA 2CXXA 5IXJA 5LQAA 4P3OA 1VGQA 1KZ9A 1DC4A 1XAIA 5FT9A 5JAPA 4F5WA 5LM3A 1W75A 3LC2O 4DZRA 1QU3A 4LZOA 2QAIA 3JW8A 3KPWA 5DM1A 3HKCB 4KNVA 1TM7E 5I7HA 3DGEC 4PC1A 4EHJA 3O8BA 1Z56C 1DKUA 1V8PA 3C3DA 2O06A 3N8DA 4FJ2A 5CM2Z 3SM9A 2QTVA 4EVQA 4H4EA 2ZXFA 5IAGA 1ZD5A 1IZ9A 3QVUA 3FIJA 5L4SA 2PIAA 3V8EA 3BGVA 2IHKA 3PIDA 2ZRMA 5ESWA 3UCXA 2R8YA 3THYA 2GLUA 3KHKA 3WGMA 4W7IA 3TM5A 4M1OA 3KEOA 3KTAA 4EB0A 2I55A 4C5CA 1N2JA 2JAXA 3GLGA 4E07A 5CB4F 3OOWA 4K9KA 4QATA 2W6OA 4MRPA 1NTRA 5H4GA 1JR2A 2NAPA 2YVQA 2CBZA 3K9CA 3RHTA 4MVJP 5FUMA 1A7AA 1KXJA 1LSJA 2JJMA 1QV7A 3O7MA 4JKIA 3KG2A 3EULA 1QRAA 4DXHA 4KITB 3OZ7A 3GLHA 3CX7A 4KRGA 1X94A 3X2FA 4US2R 3MRVA 3BQ9A 3CONA 4D4IA 3FA2A 2UUBB 4L28A 3HUFA 4R1MA 5DULA 4EHDA 2O05A 4YRZA 4EUKA 5C7IO 2XDAA 1JMKC 1CR0A 1EA5A 1T8YA 2EZ9A 3NFRA 1OXUA 3QE3A 1JXQA 3KJQA 4RY0A 4XTCS 1P33A 4NMXB 4DV7B 3H7AA 4QA9A 1R0BA 2HSGA 4UXJA 1FRQA 1N9KA 2QVYX 3E61A 3EFBA 3HZOA 1Z36A 2BEUA 1DIAA 2PO7A 3K20A 4XSGA 4DBZA 2ID7A 2NWQA 4P7FA 5FA6A 2OZKA 1AKUA 1MU0A 4HGPA 4WDQA 1P4SA 3BVPA 2IHZA 5FO1A 5FOSA 3L7JA 4EMSA 4WRRA 4O4LF 3C5CA 1LU9A 4CLOA 2CVZA 1I2DA 4ML3A 4H3VA 5EKUA 3TD9A 4YCLA 1I24A 4L85A 4LBYA 1RHUA 4YEDA 1K3TA 1R1DA 2QTBA 1VYVA 3FBGA 3SJAA 4D8VA 1YRHA 2E48A 5GZ6A 4EO9A 3BL6A 2WMNB 4GSKA 2PIDA 3ZGZA 2CHQA 1KQOA 2J3MA 1YDFA 1M6VA 1UC8A 1K5PA 5C3UA 1ZMOA 4V03A 3ZY4A 1E0SA 3PIRA 4D9JA 4JJ6A 3ZWWA 3HO1A 3CZPA 4PYMA 4URZR 5JUWA 3D8SA 3WLOA 1YBVA 2C3OA 1D2RA 5G1OA 3ZU3A 3CNHA 4OM8A 4LF9B 2OBLA 2ADMA 3PG5A 1FVXA 1NIJA 4BJHB 4KAAA 1HYBA 1FPQA 4Z9FA 1SCJA 1FY2A 2PA3A 5JPIA 4JJ4A 3DP9A 4XIFA 1D7OA 1JDZA 1SKYE 2QTAA 3OEWA 4I55A 3L02A 5T6BA 4BHTA 2UU9B 4XR9A 1XZQA 1GU1A 2MYTA 2YYZA 4HQKA 1EAMA 4DM7A 3EA0A 3JZAA 3LVQE 3DR5A 3F47A 5AHRA 4IL5A 1NP6A 5ALRA 3DE0X 1BE1A 4OLFA 3KHTA 2IV3A 5ARCA 3IB6A 4P4TA 4K87A 4TROA 4L57A 3TJMA 2C2KA 4QELA 4R7ZA 2H4YA 3LKZA 3HDHA 4UEQA 1J7KA 4DG8A 1CSEE 2JFBA 3RC7A 3QITA 2B4QA 1DLIA 4K6GA 4KQGA 3CSUA 4YCJA 1RJEA 1RJWA 3M5WA 1UK7A 1LNZA 1SUCA 2I8CA 2DQYA 3H5LA 4WZBA 4KYTA 3TTYA 3UWMA 2RE8A 1UKCA 3QHAA 3ETHA 4GOOD 2NIPA 1Y9JA 4G41A 3U7HB 4O0MA 3W2HA 1SC6A 3AIMA 3ZDYB 5FNVB 1J06A 3KQHA 4LJSA 3WLAA 3WAGA 1WBBA 1SUEA 3OWHA 4QYTA 3DW3X 1HFWA 1J9EA 1FS5A 1Q50A 2IUFA 3AJEA 3NCTA 5BYJA 4F1KA 1HNZB 2ZI5A 2H4JA 1DZIA 3ZCSA 2B34A 3PQ2A 1J2RA 1FFHA 3I9NA 2BF7A 3K3PA 4LE2A 4GP6A 5DE3A 4HWGA 3K6JA 5EMHA 1KO7A 2OTCA 4PBTA 5JDIC 1Z2AA 2DFLA 4FHDA 4ZANA 4G67A 4JX8A 4OK6A 4PGFA 4EKEA 3HS3A 3U3OA 1FUIA 5KTMA 2GESA 3GK3A 2YJ3A 3JU3A 3JWIA 1Y1QA 1ZQ9A 2XUOA 4G3XA 3NHSA 3YASA 5J3JA 2Q8PA 3KT3A 3S8EA 3Q8KA 4IV0A 4R7GA 3P9YA 4GX1A 3O1JC 5IKEA 5KNBH 3H84A 1ACMA 2GF0A 3SEFA 1KMHA 4E88A 2XDWA 4RUKA 3S1SA 2YWDA 2EV9A 2P8JA 5EGNA 3K71B 1QIFA 1U8TA 4W8GA 2J0SA 4N7RA 1QH0A 4UTNA 1E9VA 2J9XB 3BSSA 2O1EA 3DJFA 4QVGA 1GRNA 2CF6A 4G0QA 4PPFA 4RETA 4V0KA 4CQMD 3K1TA 1XDDA 4QU5A 1C9KA 3SNKA 4C6RA 3DMGA 1J5XA 3F7OA 3VPDA 1S4MA 2Q2WA 4O0LA 4W4TA 4XRGA 4KK4A 4EA7A 4C08A 3G13A 1F4VA 3GMDA 2NYAA 5EXPA 5F5XA 3SYLA 1AO0A 2ZJ2A 3AKEA 1Q6YA 4I7EA 4MO2A 4KP7A 1WIWA 4N4AA 4NICA 3WHKA 3JS5A 1AV7A 1QGZA 1XTPA 3KV1A 1OWLA 4R3WA 2IXDA 3UAXA 3MUFA 2VBIA 3NJRA 1Y7PA 3MTEA 4MQ5A 1I2AA 4EEZA 2WWRA 4PCAA 2JBWA 3L6DA 4J03A 1J5EB 4X1YB 2FLVA 1NZJA 3RAPR 2LD4A 4RHTA 4U7JA 5HE9A 1MAAA 1V1MA 5LJLA 2B8NA 2YOHA 4WUTA 2I7XA 3UCFA 4G8DA 2DM6A 9ATCA 2EVWX 1XU4A 2ZTUA 1MQSA 3DZ8A 5HCUA 2YBDA 3DUWA 2WSLA 1T9GR 2Z2JA 2EW1A 2F64A 2UXBB 1PK9A 1MVLA 3S8MA 2BFCB 4R8RA 4R2MA 3PKZA 3AIKA 4YRNA 4TZTA 4M55A 1GZVA 4KQCA 1L6IA 2DH5A 3WYGA 4M0EA 5EWJB 5A7HA 3TZ6A 2A9RA 3B8EA 1XOIA 1DHTA 5C1IA 3SOPA 2O19A 2XCIA 4M2LA 2C2ZA 4WINA 5JC8A 3LS2A 1QHSA 1G8SA 4HX5A 4E11A 3O8OA 4AC9A 2FB9A 5FEMA 2P2YA 4E1AA 1ISRA 4EG7A 3AXSA 2W2PA 2H6EA 2BHSA 2HSZA 2X23A 5I9SA 1MV8A 1Q11A 4TRJA 3FFBA 1UP4A 4KQ6A 4R98A 3F5MA 4L02A 4E70A 4QZVA 3CQ9A 1JZQA 5CT4A 1QRUA 2G6TA 2HW8A 2FFAA 1U8YA 5AKEA 2JFYA 3I5XA 5HFAA 4WESB 3RIEA 2XT0A 4KQXA 3OT4A 4PTLA 1RJ9A 3T95A 3ADDA 1G42A 1LI4A 1NJFA 1P31A 2XZDA 2DTEA 3LLUA 2F17A 2VH1A 1POXA 4XWAA 3GXOA 5HTOA 3NM5A 3ZLTA 4RKWA 2JVIA 3D2LA 2PX2A 2PDAA 3OSUA 4CQMB 2AD1A 4Q3OA 1Q7RA 3AYXB 4CU5A 3NKVA 1N5JA 4YXWD 4QXAA 1QQAA 4MDEA 3GROA 3TB6A 4CIVA 2N47A 1TK3A 3WIDA 4XYLA 5LVAA 3LUDA 3IHLA 3A06A 3NBZC 2VIIA 1EFVB 2H11A 4UMVA 1ZI6A 1HY3A 3FZGA 1UXOA 3KB1A 4HNHA 5F7ZA 2J6CA 3SSAA 5CDSA 1XZJA 1QTRA 1CJMA 2ZJ0A 4EPXA 3OETA 4RSGA 4M8NE 3ZU6A 3AVWA 3R1IA 4AJ9A 1M6HA 1ULTA 3WLMA 1ZH0A 1X80A 2HHJA 4KFTA 5JLAA 3EASA 1K08A 4BLTA 3M6FA 5B55A 4EG5A 5TSDA 4IQ0A 2JIPA 2D1SA 3BRWA 4MVJA 4MB6A 3ZDCA 1EDDA 1ZH6A 2HWUA 2FK8A 2RHTA 3VPHA 1GZUA 1QC5A 2WSYB 4UOEA 3FHTA 4DQLA 1VLHA 2VT6A 3NUZA 2EJBA 2YHAA 4ZCQA 1DWPA 3AHIA 4EUHA 2LNDA 1VL6A 3R6LA 3FPGA 1NN3A 3SZMA 4A91A 4R6WA 3ZCRA 5GIOE 4ABTA 4CNBA 1LLUA 2KLBA 4Z1OA 2QLLA 2WJGA 4ZU6X 1UDCA 4RJIA 1HYGA 2VEOA 4PVDA 3ITNA 3L0CA 4R2KA 1W5FA 3S2FA 3JQBA 5T4EA 3ILXA 1YR8A 4D7AA 4OHCA 3MAGA 3VYRB 3LA8A 4R71A 2RFLA 4M7WA 2GWRA 1OFIA 4O2BF 1KGDA 1XMVA 4Q1VA 4JK3A 3HBNA 2DWQA 4XFKA 4JYMA 1H1DA 4KBYA 4NESA 4PNPA 4X1KA 5EYPA 1C9EA 3BIXA 3O92A 4WQMA 4BNHA 4BZZA 1ZL0A 3N8HA 2XTAA 5LQSA 2BCEA 5CJPA 1Z7YA 1MVOA 4GR9A 5H81A 1DVRA 1YBFA 5CT8A 1LBHA 2IEYA 1UQTA 3DBHA 4YX9A 3GNQA 2JA1A 5DBEX 2PAAA 4I99A 3EOAI 3A6DA 5DK6A 5H9WA 1Q0PA 5CD1A 1QGAA 5BV8A 1DKOA 2I3BA 3D4PA 1ZW6A 1F60A 1H1TA 3F3YA 4XX0A 3K1AA 4XCQA 1NKSA 3SC3A 4ZYVA 5TQVA 1VBNA 4HWPA 3SHTA 1A0OA 1PGPA 2AUTA 2QG6A 2J0QA 1QFXA 2RHWA 1RCUA 2V7XA 3H16A 1XMQB 1KF0A 2DB3A 2G04A 2I71A 4CJXA 3WGLA 2BM1A 2PM8A 1G41A 1ZM4A 2VWGA 3GT0A 1C3OB 3AL3A 3MT8A 1XYYA 4FVTA 4I1VA 1DCFA 1ZOOA 3QW4B 4OP1A 3OCWA 5DNEA 1V3UA 3MSCA 4MRMA 1TZCA 1Y9AA 3FETA 4H7DA 2DWUA 4ZRDA 3SSNA 4BMYA 4YJFB 4BAGA 5KOJA 1WTAA 1BVUA 3ZJ4A 4BB5A 4M9QA 3VH2A 1T0PA 1EJ6A 3GQVA 3S2UA 5AM3A 2H2IA 3AUYA 2GUGA 1SU4A 3T5MA 2CLSA 1YS2X 1C4WA 1YB6A 1UPCA 5HFNA 1ATZA 4JOCA 4EYSA 5BW6B 1XDSA 4BTEA 1YB1A 2NPFA 4ZGGA 4HTAA 5FPQA 1U6IA 2B21A 4PZLA 4JI5B 3WYFA 5CFMA 2A0KA 3EOZA 4C2BA 2DLDA 2RCNA 4S1PA 1P29A 3HNPA 3QI2A 2BFDB 4Z1MA 4D0LB 2C7PA 3WIOA 1BMQA 2ZIXB 5AOAA 1E62A 4TOIA 2H4HA 3WO1A 4BDTA 2G07A 3VVLA 3V8RA 3TVTA 3PC4A 4I46A 1Y5IA 4TV9B 4AUMA 1KI3A 1WHSB 2WBLC 4EY8A 2BMFA 2GM9A 1Y7TA 3TQCA 2HWYA 4YUXA 5CIQA 1JLMA 1E0KA 3Q8WA 1H0HA 1GAJA 2J67A 3Q9UA 2C3UA 1V48A 4IW3B 4WBXC 5J40A 4QE3A 1UIRA 5LC1A 4JENA 1SBCA 3UMBA 3UXYA 3PQFA 4EO4A 2JFVA 1RCTE 1OBCA 1M2NA 2Q21A 4IVNA 4NBUA 3EPJA 3MZ0A 1LV7A 3JQ8A 4G86A 3RBAA 3PR3A 4BBJA 5EFOA 4NXNB 2HU2A 3PUHA 1VCMA 3H1FA 3V1UA 4B3IA 4HADA 4HPWA 4QO8A 4C06A 2P4EA 2WOOA 3BEOA 4OHOA 2I03A 1OZFA 3ZDEA 1GUDA 2JFUA 4X97A 4JLWA 4RNDB 1EK6A 3JD3A 3O0DA 1K98A 3PU6A 1DQZA 2CK3D 2JKYA 4FGWA 4ZOAA 5JSYA 2ZRIA 3C7AA 3N39C 2FQWA 4G4JA 3TM4A 4L4SA 3Q15C 3F6CA 2BBWA 3SF0A 4ESHA 1R74A 2WNHA 5BNIA 3ZWPA 3PC2A 4MW6A 3BB3A 4YAEA 1OZGA 4IIUA 1U90A 5DT9A 1KE1A 2O0MA 3WA6A 1ZCJA 3L2OB 1W93A 4MGZR 2QN7A 3K53A 4NHOA 5FOXA 5IAJA 3U4AA 2FE1A 3PC7A 3QIVA 2R48A 4MARA 2DUUA 2CLEB 2CL6X 2ZBQA 1U94A 5AW2A 5ECWA 1CE8A 3QXJA 1OTHA 1H0SA 2QRMA 4F85A 3TZCA 4KJXA 1P6QA 2J85A 3DZDA 121PA 2C9MA 3VC1A 4ABYA 4B17A 3EWNA 3LIPA 5EGSA 1ESCA 4KODA 4MQEA 3ZGOA 1ZWKA 1P44A 1GQRA 1THGA 1YU9A 4DPKA 3AETA 4PHHA 3H9CA 2PFKA 2BM8A 1NZFA 4H7IA 3O8CA 1MZPA 3LU1A 3H65A 5LR6A 4XGQA 1FNDA 5AP9A 4AZWA 3JQGB 1SCQA 1FEZA 1V9SA 1KZYC 1YAJA 2E0IA 3DUFB 2PX8A 2CXSA 3ETCA 5AJXA 1WKCA 5CJJA 3ICVA 1ZRSA 2BEWB 1NPYA 3N2KB 4M0CA 3W8EA 4DT1B 4JI4B 3R3ZA 5AWFC 1XZNA 2QX8A 1COZA 4WN3A 4L6AA 1GNLA 3WLPA 1R0XA 1COWA 5J43A 1O8BA 3ETJA 4N47A 4HCJA 2PUVA 3DOOA 4QQRA 2WTEA 5LZ8A 4F5EA 2VPPA 4MS4B 3HKEB 3O82A 4PC7A 1J23A 1MNQA 1BMDA 3MRTA 4OQDA 5EI5A 3GEMA 4R0MA 4Z51A 1Q91A 4BLQA 5CCEA 3E27A 3UATA 4QEKA 1NUSA 4RH3A 4YP1A 1BG6A 2QLBA 3HKBA 3PX7A 1BHJA 4L3WA 3RVQA 3UN1A 2ODAA 4QLBA 5CTAA 1WAMA 2PH7A 2ZRLA 3R20A 1U9IC 1A4UA 1Z75A 1Y1TA 1MP0A 4ZAXA 2R4UA 3S0JA 4BKPA 4D3FA 2JRCA 4FSXA 3SQLA 3ICOA 4NWIA 2ZJ8A 2ZDGA 3H11B 3K2IA 5IT4A 4MROA 3ZXIA 3CLRD 1TCCA 1CB0A 1GYQA 1FP1D 3OFSA 2PX3A 4RTLA 3L0PA 1PJQA 3IKLA 4IEFB 2PBZA 4MCAA 4IQ4A 1JLLB 4LRXA 3GLFB 1KRHA 1NAIA 1ZI8A 4KR3A 2BONA 4NMMA 3IEIA 5ALWA 3Q2IA 4XGNA 1PR9A 3WMFA 2O8NA 2OQ2A 4GZLA 3WYAA 1ORRA 3VNSA 1I1OA 3L92A 2XBLA 2AYXA 1ECCA 5SYAA 3TZHA 1U7ZA 5B1EA 2ISSD 5A02A 4E2FA 1U0TA 1Y6QA 4XLZA 3RDPA 3WK9A 1JR6A 5T41A 3BG5A 4A27A 4HPXB 3MCAA 2AMVA 1W5TA 4I9GA 3ZBUA 3M89A 2Z2IA 2HLDA 3W0LB 3N75A 2PT6A 3FPSA 2DKNA 3KQWA 3ZXSA 2G67A 2OHVA 5ERXA 5A7FA 1Z39A 2FEXA 3JTMA 3QKWA 1O95C 2C29D 1MHPA 5CM9C 4YUWA 1DKPA 5FDFA 3H42B 2O2DA 4GFDA 5IC6A 9LDBA 3DEYX 4UHHA 1MO2A 3P4XA 1WW8A 2VF5X 3KAKA 4R84A 4DCMA 1B43A 5B7GA 1O96A 2EJWA 3PHIA 4RD1A 2O6HA 1RYYA 3K31A 2WP0A 4OI2A 3W9UA 5CXQA 3FNHA 2X1LA 1X38A 1ZBDA 1VECA 5E4YA 4KV9A 4CW7A 7YASA 5I8PA 1MVNA 2IF0A 5LP6B 3LL4A 4CLEA 1QPBA 4MQFA 4AS2A 2IXGA 2ZDHA 1JLRA 4FNMA 3ROPA 1ZI9A 1XBTA 4QU9A 4RIIA 2Z6VA 3B2NA 2HIMA 3GRYA 3VR5D 1N34B 3NU1A 2DKFA 2GK3A 4I5IA 4KWHA 5FBKA 5LBIA 3TCNA 1QMPA 4S2UA 3WMEA 3L6RA 3ZH2A 2IE0A 1I01A 5FIUA 2H1HA 4CKEA 3IT2A 3N6XA 4MKRA 1RKUA 2R0QC 3MPOA 4QBTA 4Y2PA 2VJCA 5AQEA 1YCGA 2YHIA 1L7EA 4R2IA 3KQKA 4BVBA 2PZGA 4HSEA 3DLPX 3IS3A 5AHXA 2J9ZB 1P7VA 3DPSA 5KDOA 4L8FA 3QUQA 4MS1A 4IILA 1O3YA 3FMGA 1YE5A 2G0TA 4HNGA 5HSGA 5KJ1A 2CUNA 3OWXA 1G2QA 2FFQA 4PSDA 2QM7A 1H3FA 3C3YA 3IQZA 3MOGA 5ULLA 3VGPA 5F9HA 2HYIC 2XTNA 5EE5B 1YQWA 4Y1GA 1LDYA 4BQQA 1JR3E 1OLUB 1Z16A 5KQPA 5J2UF 4JLDA 4YT4A 3CW9A 2PU7A 4S05A 2EEPA 4C9BA 4OMDA 4EDHA 2V4UA 3U0VA 1GA6A 1D6NA 3EXIB 4IMRA 2QLNA 2CBXA 2FZ5A 2QUZA 4ZREA 2C5AA 2YDXA 5DJ5A 2KB0A 4G97A 2GTPA 1G1MA 3GDWA 3B70A 5IHPA 4CEJB 2B8WA 1N3IA 3IEPA 4C4AA 4Z3KA 4C43A 1TPZA 3T52A 5K03A 5C8YF 3RVSA 4RE6A 5KTNA 1NRJB 3RNOA 2ZYUX 1J22A 4ZQEA 4CMBA 3CURA 3WGOA 4D74A 4NJOA 3ROGA 5AVZA 1E61A 1IJKA 1NM5A 3BFJA 2O2ZA 3RHZA 3FOCA 1OI4A 4TV8B 4ZMRA 3KLBA 4HXGA 5EP3A 3PNSA 3VSAA 1MXFA 1XTZA 4WZAA 2GGSA 3TR0A 5AK4A 2CV2A 1KETA 4BQEA 1NXQA 1JFFB 4EYEA 3F78A 1FSGA 4LGYA 3A6GA 2IU6A 4UHEA 2VNIA 4QYWA 3TEJA 4LPSA 3VNAA 4R7TA 4L3OA 1XKQA 3VBCA 1XGKA 3DWGA 2AMYA 3BAZA 1R0ZA 4JC4A 1UQRA 1G21E 3QU5A 1O03A 5KYTA 1FFEA 1W5BA 5AJZA 2R85A 1XALA 4HAWA 1IM5A 1E1RD 1FDSA 1UPBA 3QY0A 4I8DA 3SXPA 4EW1A 1JZTA 4QXPA 1NUPA 4OHBA 1N4DA 3Q2KA 1I9GA 3OJEA 5D85A 3BQMB 2QJOA 2Q5EA 3S99A 1B6SA 4EMUA 2PZMA 5B3JC 4LZJA 3H2YA 2H51A 4QDUA 4D26A 1K8YB 3UAZA 5IBPA 3TMYA 4AULA 2VN8A 4I50A 4OFZA 5KNDH 3D6AA 2COKA 4KOAA 1KARA 3SC4A 5FOQA 2JARA 5JS2A 4NS1A 1BJKA 1RZUA 2N46A 1D1PA 2NUAA 3LBFA 3OQBA 3CLVA 3ESZA 2V7GA 3ECAA 3BD9A 3QV2A 5TS3A 4W5JA 2C3MA 4OKSA 2DRIA 4Z6KA 5DN6A 1Y1RA 3VPSA 3ZLVA 3HH8A 2W00A 4D79A 3Q11A 5BUSA 3WYNA 1SKBA 5G0SA 1IH8A 4Q4JB 2REXB 4MR7A 3OIFA 1OGJA 1P74A 4A8JB 1SK8A 3AERA 2V0GA 3G89A 3TW6A 4E6EA 3CLRC 3EQ7A 2B7LA 5IDWA 3B3GA 4NZOA 4ZRNA 3SZ3A 3U37A 4ILKA 4R1TA 4UATA 1EUZA 4E2WA 3FTFA 1UFVA 2TMGA 1LSUA 4HVCA 1UJ5A 1BS9A 3DXZA 3VU0A 2RGAA 1ORVA 4BX9A 1E9CA 1W19A 1YIAA 4IBOA 3UA4A 1PHRA 4ND8A 2EKPA 2K5UA 1T10A 2ZYDA 4GEGA 2NUTB 5GM2A 1VP9A 1I30A 3INYA 5B64A 1VJ0A 1Y3IA 3HO6A 3E22B 1TK9A 1BRMA 4MV6A 2J3DA 4YP0A 4R1SA 1A69A 2VLBA 1PWZA 2YVKA 2AFHB 1TMOA 2JHAA 1O6BA 2P0EA 2IU4A 1O6GA 5D01A 3CEMA 5FAKA 3LBAA 3KFLA 4FINA 4REQA 1H8HA 4AG6A 1U2QA 3Q3JB 1ZJWA 3H1GA 1R8JA 4H4CA 3T3OA 1IG0A 2ZJBA 1NXSA 4J0JA 4FN4A 4PTYA 5C7OO 3U7IA 2XMCA 4KZKA 1JBEA 4Q7QA 4DV0B 4R81A 2EHJA 3HXLA 5H9VA 4RH0A 2AZMA 4LPKA 1XQ6A 1VIMA 4MS3A 3FYCA 3R5TA 4IIYA 1C9MA 2QN1A 4ZMSA 1Z0ZA 2YWJA 4CPDA 1E2JA 4IUBS 3ZWCA 4DNFA 5HXAA 4IUCS 1JJ7A 1VC2A 1ZM9A 3Q5GA 1LDBA 1KZHA 4B87A 3VYUB 1ZONA 4K9RA 3RANA 5B4VA 3HU1A 2IELA 4X8MA 1IBSA 5AKXA 2NYVA 1NJ1A 4QOHA 2VXYA 4D0GA 1OIVA 3D8NA 5AJYA 4BZQA 3G7UA 4PO1A 4OATA 3CX3A 4F96A 4JI1B 2X9NA 1ZCZA 3I92A 3CEJA 3OPYB 5EJ5A 5IUJC 3KEFA 3DT8A 1T25A 4HUQA 4TLCA 2XNHA 3E2IA 2IPLA 4DR4B 4HGZA 1LNQA 3QUBA 2BP7B 2X76A 4NV1A 5CIYA 3AO0B 1CEEA 4NOLA 2A5GA 2NU9A 3NWOA 1CK4A 2B8TA 4XIGS 2ZI9A 5JYDA 2FFHA 1RPTA 2KM1A 4BP3A 4EGCB 3D6UA 1F5SA 3EUFA 4ZT3A 4DLNA 4DLPA 3PJGA 1F14A 3DNMA 3ZY6A 4MYHA 5CG1A 4Y2QA 4I81A 3RYIA 1QOZA 1LD3A 1JP7A 2V58A 3DW1X 4ZA2A 2HQRA 2RHDA 3V6MA 1NX9A 1PTJC 2LRHA 2XWSA 1E18A 4A8JC 3HMQA 3I6MA 1X9GA 5ALMA 1JIQA 1NBHA 3O9VA 2GCIA 2H7XA 5DO9A 4EF6A 2AMFA 5JNRA 1J0CA 1QCCA 2XMRA 4QVIA 2NQ8A 3WL3A 2DQZA 1ISJA 1YZGA 4NSNA 2YMQA 1XWWA 4PE5B 1EUCA 4RZIA 2P9ZA 1IJFA 1JDUA 4DFDA 3CB4A 5I7FA 4Q12A 2OG1A 3EDQA 4DNXA 5CFQA 5I4CA 1TCVA 1DRUA 3T8YA 2ZWPA 4M87A 3V4FA 3X44A 1IY1A 3UC9A 3IDOA 5ECYA 4F4HA 4CETA 4GU5A 2Z6UA 3FLBA 1SZJG 4BUJA 4NENB 1WV1A 2HRBA 1YZKA 3VDMA 1RAIA 4Y6GB 3K9NA 1G59A 3Q7EA 3KUXA 4G65A 1JLHA 1A5SB 1L5SA 3C16C 2KHZA 1XRSB 5DHUA 1U99A 4G6ZA 3OZRA 3HEAA 1R6UA 3BXEA 4RS3A 2UUCB 1U5BA 2IZ7A 3K5PA 4V0LA 1H9AA 5CXXA 2DR0A 2RBGA 2YIMA 1VPVA 1JA0A 1X2EA 2WJZB 1C29B 1FTSA 1WW2A 4U7TB 1Y1PA 1Z6AA 4OHYA 3VV3A 4QYMA 2V55B 4F4IA 3BXPA 4O02B 5C8ZA 9MHTA 4ZVNA 4FPXA 1VDZA 4EKNB 1PQPA 3K2QA 1WMAA 4A6PA 1UBCA 3DBRA 4F4DA 3VZPA 1IUNA 3HRKA 4D4MA 4RKFA 4TYNA 4RF4A 5DI3B 4EWLA 1NMXA 4EFLA 2OL4A 2H9AA 3KUUA 4K0RA 4YJ2B 3TLBA 4YRJA 1M1ZA 1XUOA 5C51B 1FRVA 3CWQA 2I2CA 3RFFA 1BCRB 1QIHA 5LA6B 4BZWA 2QJTA 3IELA 4C78A 4GI2A 1IHXA 2WU8A 4BVKA 2HSDA 2QP9X 1DRKA 4IKEA 4PHFA 3TFWA 2Z9CA 4JLPA 4QDOA 5BQ5A 3PHCA 4N5HX 3RUEA 1KZ7B 3X2SA 2O8EA 3OJLA 1L3IA 1Y80A 4IIEA 3UHAA 4C7VA 2GETA 3PYMA 1T2FA 3ONFA 3LDAA 5JJIA 1T36A 2IXTA 2Y2UA 3IAS1 3G9UA 4DSTA 1E9EA 3VJMA 4TMVA 1CUUA 1OGIA 3L8EA 4MLZA 2DBRA 3HTXA 2IYFA 1MC8A 2REOA 3ZWMA 2FGJA 4H4DA 4LA4A 1DEAA 2IZ6A 4DUGA 1IN1A 2QI9F 2ZIFA 2BCJQ 2I2FA 2UZIR 3IEXA 1ISFA 4CLDA 4L15A 1OROA 5K7SA 4ARCA 4MGYR 4H9GA 4ZHQA 4LDNA 2J9FB 1R18A 4PC2A 5K3FA 3L4JA 5FD8A 1UMBB 4LI0A 3TTVA 3DYBA 4Y9SA 1OWOA 4RTSA 2TSYB 2GO1A 2WOJA 5MN5A 4C7OA 1K8ZB 2AW3A 2IDJA 1TF2A 4S12A 1EFPA 2ZE5A 1VCIA 3RC3A 4ESEA 4PNZA 1KIMA 4L0QA 3SE0A 2C94A 3P27A 4N54A 3H1TA 2VDJA 5CPFA 1O89A 3MOSA 3STWA 3RAEC 2WIKA 4BO6A 3R3HA 3IX7A 2QQFA 2QU7A 2Q1TA 2MSWA 1A9ZA 1Z45A 2I4LA 4DQKA 1ZN7A 2LP4Y 3RTDA 5CYGA 1U8FO 3CRNA 2JW5A 4KQ2A 4NPCA 4U0KA 3TTTA 4NFLA 5AIBA 3DVSX 1EA7A 1PU2A 3GBVA 1SMKA 1DFIA 3CNQS 3EAFA 5DEIA 4B82A 3H5NA 2OA0A 2F4VB 3AVVA 1ZD9A 1RWQA 2B0CA 3KR9A 2D4AA 4FOLA 4O4IB 4UBOA 4UOQA 5JQGB 4QRIA 2VDRB 3IJRA 5CBKA 3VZQA 1HT0A 3L84A 4H6WA 4RORA 3VVMA 5LYJF 1PL8A 5JEEA 5G4KA 2ZWAA 3HZRA 5AJHA 3PGJA 4YQFA 5KAMA 4KI0A 3CX6A 4IXNA 4R51A 3VKUA 1E4YA 1E7RA 4URUR 2IYNA 1RM0A 3ZW8A 1LK0A 4JSTA 1N5RA 2HM7A 3HACA 2G72A 1CUZA 2QY6A 1CUIA 2GM3A 3DZCA 4KXLA 1L2TA 4NCJA 1OKKD 1GZDA 2J4DA 3M83A 3Q0IA 4G09A 1A3CA 2XE6A 3PNBA 4IIJA 4AVYA 5JECA 2ZUEA 3INGA 1PDWA 5AQ1A 4QJ3A 4LYEA 1QANA 5ITSA 4OGLA 2QA5A 4TL7A 4XVQA 3QE0A 1S96A 4KXUA 2BJVA 5FL7A 3RKUA 1C41A 4ND4A 1BW9A 1ZLXA 1XTBA 1EAYA 3GGCA 3URKA 1YR7A 1KEWA 4EUEA 1N7GA 1PVDA 4HZGA 5EJ9A 4JCCA 2NP6A 1RC1A 1VMKA 2ANCA 2CLMB 5ECDA 4RZ2A 4TTJA 2Q28A 4L16A 2FSHA 3BFXA 4RMHA 5FBLB 4BP1A 4D6XA 4Q4HB 5I9IA 1SXJA 4BMOB 4XYMA 1B23P 1H66A 2PZEA 3DEAA 3JR3A 3LO8A 1OXKB 4OHVA 2DPYA 3ZDRA 1MGPA 2VJMA 1VYHA 1FU8A 1LNSA 5ICMA 3HWWA 4S0ZA 4A7PA 5E2IA 1DINA 4IRXA 2GYWA 1YGPA 3DFFA 3HB7A 4RZ3A 1T9AA 1P4HA 3HPRA 3M6LA 1KFJB 4YV7A 1T6NA 1TJYA 4PZAA 3ZWYA 4QFDA 3QF4B 2W70A 3DL0A 2VF7A 3B1WA 3EH1A 1BOFA 3CE9A 1YDMA 1N1GA 4L8VA 3VC3A 3GT3A 1L7AA 1VJDA 1O1YA 4CKYA 2GNOA 1H4SA 2VQSA 1S89A 2X4GA 1I6LA 4I8IA 4HN9A 4RPIA 1ESMA 1FXSA 2GM4A 4JZYA 5KVVA 1JVSA 1QYWA 2QD2A 2R751 3AEQB 2ZZMA 2JGNA 2LDBA 3NBUA 1WDLA 2C4MA 1E9FA 2AFRA 1GXSB 4AY5A 5FI1B 5AOCA 1L4LA 3UPDA 2X5OA 1YS1X 3PL5A 5JVDA 4FUQA 4N41A 4L2IB 3PVZA 5HS6A 3EFHA 2YV5A 3M34A 1S01A 4LDRA 2QW8A 3QBEA 4C2AA 4I4TB 4CCWA 1PL6A 5CVVA 2OESA 4PCVA 1SB9A 2J08A 1P2BA 4C05A 3PC6A 4Q05A 4E22A 1KDOA 3GEIA 3OMLA 2GHIA 5G41A 2YV3A 1G38A 3ZZTA 3HYCA 4BJ5A 4HX2A 1P1FA 4ETMA 3GJRA 3AH8A 1A27A 4O8ZA 3H5TA 2VP6A 1NF2A 4N7MA 1I4DD 2UZ0A 3HQ4O 1HYEA 2M6SA 4I36A 3TB4A 4URVR 1Z82A 1MA0A 4IZOA 1XDUA 2P2NA 1SCDA 1Z6TA 1ZM3A 2YDYA 4FMDB 4XGKA 3W4IA 1NOKA 2X15A 5BVHB 1NPDA 4OXYA 1ORTA 5FLEX 3WLFA 3K5HA 1RC0A 2HT6A 2FEAA 3X1YA 5MDHA 1PGQA 1GG2A 1C3LA 5B6PA 4R16A 1URPA 4POAA 3HB9A 3T3IA 1KR2A 1W52X 3EZLA 3N86A 5JH7A 1JJAA 2ONZA 2TMYA 3JAWA 4M0PA 4DV4B 2PKEA 5IH3A 4DMLA 4EY7A 4KH0A 3VPBA 2B1QA 3I2FA 4PWZA 4UPDA 3PVCA 4UUNA 4RHFA 4ZQHA 1CEXA 1L3CA 1GTMA 4JUDX 2FSPA 1KH1A 1J8YF 3V33A 1DDOA 3L8YA 1QGUB 3GZ4A 1V4VA 3A1DA 2A9QA 1RM3A 3DMPA 4RA9B 2YJ6A 2ZQ5A 4UVGA 2JJQA 4GT1A 3HCPA 3Q87B 5ADHA 3ZE6A 2BTEA 4UPEA 1BFDA 1A5TA 2QOEA 2XGOA 3BE4A 3OQJA 4RDCA 3UFXB 1HA3A 3MELA 3WLKX 2J9GA 1EQUA 1NV9A 4WBSA 3FVQA 1BWRA 4KN5A 2ZXUA 3SYMA 3D3JA 3L0ZA 3QWHA 4PPQA 4ZTUB 2Z3VA 2MYNA 4DLBA 5A5VA 5GOZA 4JLVA 3NBFA 5LWHA 3WLQA 2PUCA 1T1JA 2GRJA 2E4YA 3GJ4A 4LY9A 4UHDA 3DO5A 3IQIX 3PDJA 2O59A 3LD9A 1ST3A 3QTTA 5LKRA 4JOQA 1L4KA 3Q88A 3UC5A 1C2TA 2UVPB 3PB3A 5HJEA 3T54A 1TM3E 2C04A 1K8QA 3DXYA 2IYTA 4GWKA 4KPGA 5FBHA 1NJGA 2DFPA 3ZD7A 1XPUA 4KIWA 5K8LA 1BVRA 4H3KB 2I1VB 2HWWA 1UQUA 4J0QA 4RKEA 4R9NA 3O4FA 4RSRA 1IJEA 1ZKMA 3THSA 4BV8A 1NNLA 1Q0SA 2D59A 3KOYA 3U3XA 3UAGA 1RXUA 1NFRA 1EHYA 3IPYA 5DBFA 4JLSA 4JC0A 6ADHA 4BGUA 3LQ2A 5KVCA 3N8KA 1H4QA 1NC3A 2BWJA 4MW0A 2DTXA 1O8CA 3G79A 5BN3A 2QQ5A 4TM8A 3PNMA 4XGIA 5B3AA 1LWNA 3GA0A 1WUTA 3AEKB 1T9HA 4YP9A 4BMSA 3B20A 4B81A 2PT5A 3RBZA 4BIIA 2CHUA 4MULA 4DADA 1K9SA 3FLEA 1E4OA 4J3FA 2ESRA 1V41E 4UQPA 5ICCA 1AT1A 3HB4X 4X91A 1F12A 1EIZA 2FCAA 3KPYA 4Y30A 2BFEA 2IYUA 2GEBA 1QG0A 4K9PA 1XEXB 5FOUA 1F06A 1SURA 3H9QA 4ITUA 1ENZA 2AI2A 1FYVA 3KZOA 2WJ3A 3OM9A 2FCRA 1WKVA 1BSVA 3JSAA 4AZVA 1E1CA 1B42A 4B7XA 1YS7A 3WB1A 3DDWA 5KWVA 4TYQA 1VHDA 3MGAA 2ZJ7A 5K0SA 3DLCA 3HYLA 2K87A 3AOEC 1CKEA 3BL8A 5B58C 1PG2A 4NPAA 1VHWA 1XNJA 3G0BA 4YAFA 1N9GA 2X9VA 3MTAA 4OU4A 2Y66A 1JYSA 5FWNA 5AVUA 3CNNA 3T5AA 2WF8A 3KOMA 1M2OA 1U9YA 3KFVA 3FVVA 3D7NA 1PNVA 4OOFA 1KI6B 5ES4B 4EGAA 2IP1A 3F9CA 2H48A 1X1CA 4L8GA 1G20A 2NTEA 2XUIA 5JJCA 3AF2A 4MQ4A 3OZXA 4NFHA 4Q37A 1KY2A 2M6RA 5THQA 1L7DA 3WAJA 1A9XB 1GZSA 2BR3A 2P7HA 3IXQA 3QVLA 2GTHA 3D1JA 4JB8A 3JD0A 1DS6A 3DKIA 3IT3A 4URHA 2RHRA 3C6ZA 2ZJ1A 1YQXA 5DCYA 5C1PA 1F9AA 2WU0A 1SUIA 2Z95A 3F8TA 4H08A 3W3AH 5JZVA 3GLFE 2QZPA 2V6JA 1JN0A 3HCNA 3CLTC 2C8VA 4D57A 2QP4A 4DIFA 4Q7JB 3S5JA 3DWEX 4BOYA 3V1NA 4MKFA 4PY2A 4YRMA 3G02A 3WR5A 1NTOA 1KBOA 2XZLA 1GP2A 1MJFA 1T6BY 4YJ3B 3WTCA 4ZIRB 3K6SB 3A9TA 1QFSA 1SXGA 2V5VA 4LYJA 5CFPA 2ZJ4A 3R8CA 3AB7A 3KKLA 2RCYA 4S24A 4UHBA 4MV5A 3L6OO 1JWAB 5BVGA 3RCBA 3NJ4A 5CBPA 4L27A 1HM5A 4L5JA 5KQGA 4HDKB 2R86A 3ZZ1A 3LTNC 2HXSA 3PV0A 1BO6A 1HLGA 3KTDA 4G36A 3H0CA 3KBOA 4FHGA 4Q3LA 2IHBA 4RMJA 4YRDA 4EA6A 2PMCA 4I4LA 4EPRA 2EX0A 3ESBA 4Y1RA 3TN7A 1BDIA 4NNPA 5DIFA 2QN3A 6AT1A 3RLFA 4FFBA 1AMNA 1LFDB 1U3CA 4FKBA 1Y1KE 1O94A 4TKLA 5ELMA 3VTFA 4RVUA 4QT4A 3ESQA 2WZCA 4Z9AA 3D8BA 3QYFA 4CFYA 3D5EA 2QTHA 4K28A 2RGDA 4YAKA 5IZCA 2C9OA 7REQA 1XXHE 1K0FA 4MVCA 3RYHA 1NW4A 5TQ2B 3QX3A 2WAXA 1W73A 3OM0A 2Y9MB 3CTMA 2X5XA 3HBFA 5DX0A 5A5DA 2VH5R 2YHUA 1N3BA 1EWTA 1EGQA 3D2BA 3SD7A 2AG1A 4DYHA 3N07A 2WHPA 1GCGA 3BWDD 4FGUA 1Z68A 2Q49A 4U7GA 2YUTA 1XRNA 3BA6A 2JFZA 4ZQIA 3SWWA 3AM1A 2XMBA 3IVCA 2GYYA 3H3FA 3SC2B 1GHTA 3CUKA 3OX4A 4YCAA 2UYQA 3HFRA 1YKGA 3IBTA 4KDRA 1DUVG 2PL1A 2EJUA 2P9JA 1Z35A 1HQYE 2FZEA 3QHPA 4MRAA 5L9AA 3R3SA 4HAYA 4PZYA 5I7VA 1NQOA 1SQGA 4Z8YA 1AKYA 5DNDA 5HQ3B 1Y4AE 4WA7A 4Q6WA 1DTEA 1XAJA 2BR5A 1L7NA 2QX9A 4MWEA 2IV2X 1RPJA 1YQ9A 4FB4A 5EKDA 1R12A 5DHQA 4WLFA 1Z62A 2PLFA 1SOUA 2BGUA 3GCXA 1B6RA 2QTMA 3AG5A 8MHTA 5SV2A 2ZBPA 5DXFA 2GCEA 1DXQA 2J3LA 1UK6A 2PHZA 3T3GA 2PMEA 3ZV4A 4Q93A 4FSHA 1XR3A 2II6A 4XPIB 1GVHA 3JASB 2FP4B 2ZZKA 3K09C 1W4RA 2DUWA 1KGSA 3PRKE 4JP2A 3T7TA 1IQ0A 1UBMS 3TIVA 2GI4A 3WK6A 1JQJC 3A27A 3A2LA 3ELWA 2VDPB 4M37A 4ND2A 3ZDBA 2HY7A 3P20A 5K1ZA 5NULA 1B1CA 5JBIA 3D5QA 3P9RA 3NTRA 4JBYA 5A3VA 4J4HA 1N2CE 1KJYA 1Z4IA 2EZTA 3G5UA 3NGMA 4WOCA 5EQTA 5LUBA 3R5HA 2FETA 4KSBA 1DFHA 3WXMA 4TMYA 4BUZA 4ENSA 4DXAA 4CFZA 1WQ1R 1D3AA 2Z58A 5AHKA 2WHQA 3U3DA 4EQ6A 3GFVA 2ZANA 3C48A 1QH1B 1X39A 4CGZA 1XE3A 2I3DA 1O57A 1SGWA 3CEPB 2BSXA 4FGZA 3N8IA 4J0GA 5EHIA 4AJHA 4UMDA 3DAPA 5TNXA 3UK2A 1KYYA 5JATA 1AK1A 2C82A 3EFOB 5DMHA 3W5SA 4EJFA 3RG8A 3VPFA 4MUHA 2A0UA 2OAP1 2I1LA 3D6MA 2Z8ZA 4MUXA 4AO8A 2RJOA 2VJLA 2VWQA 3GLVA 3NHKA 5TDHA 2XIJA 4FMBB 5HBRA 3IGFA 2JD0A 3ZJ5A 4B3BA 1QYVA 2MINA 4AX4A 1KS9A 5JC1A 1ZKDA 1X19A 4IJQA 2Q4BA 4QDJA 3HKDA 2C4UA 2AMJA 3I0MA 3OQIA 1Z0SA 5AJWA 3O5AA 5F35A 2IW3A 3SN6A 3W6NA 2WJYA 2PTGA 2A59A 3W2GA 1KNQA 2G1AA 5C5CA 2COUA 4GOMD 2YICA 4RY2A 3RU2A 1A4RA 1JBKA 2B2NA 1S2DA 2E87A 1WVGA 1MRZA 1YMQA 2FSVA 2FFJA 3FPKA 3H1BA 3IHTA 3MTBA 1NOJA 1YRYE 4RGVA 5GJWC 2L0XA 5JCZA 2VP5A 4D3XA 2AX4A 2RKWA 4MJ3A 3RVBA 2HL6A 2RK4A 4V24A 2XVYA 1L3BA 1KFCB 4DNQA 5CU7A 1SB8A 1XQYA 2QENA 3AV0B 3OP1A 5F2EA 4DCPA 1BTOA 1H6CA 2Z2ZA 3MGBA 4Q39A 2D74A 5CT9A 4RW0A 3PXDA 5EMMA 4DLLA 1EM8A 1N3YA 4XVHA 3OHPA 2JJYA 3EVBA 4J49A 2FMXA 3AU8A 5HUJA 3TTXA 1BGWA 3RABA 2A86A 3UH0A 1RW4A 4FD2A 4J16C 3DDZX 5CDYA 3CPJB 4UU8A 3UGTA 2CLCX 1QKJA 4B4KA 2B7BA 4GG1A 4X94A 5DT2A 4QC2A 5BSEA 4X60A 1ZPDA 1Z15A 2R5NA 2C4HA 1CZNA 1WUIS 3CO5A 1HLDA 4ZV7A 3HCDA 3UT6A 1TM1E 3C85A 4LV5B 2R84A 3E3AA 4HNAA 4P22A 3FUCA 3BDAA 3H17A 5GGYA 4BMNA 4J0HA 2FMHA 1JTEA 3HDVA 3IAHA 4MA5A 5KZMB 1O77A 3SBDA 2XKAA 4Z3OA 3MWLA 1FJHA 1U2DC 2ZVDA 3FSJX 1QYRA 4F38A 4R8MA 2DKOA 1KKLA 4ZHQF 2V96A 2Y1CA 1C1DA 1E7WA 2VDWB 3QE2A 3RC1A 5M5BA 3AOGA 2CD9A 1OB2A 4RY8A 3KPVA 5IJWA 3U60B 3ZX4A 3ADBA 2OLEA 4HAZA 1MB0A 1V45E 2DWPA 2O0LA 3FYSA 3NTLA 4X6YA 3ZDAA 1G66A 5B30A 3GIWA 1J5PA 3ET5A 4OQ4A 1JWLA 3GU3A 2R4TA 1NFQA 2VZEA 5DHRA 1X2BA 4G84A 2EKBA 4GF5A 2AFHE 1EKXA 4XGRA 4IIDA 2R5FA 3LQ1A 2MR6A 5TPWB 4FR2A 3HU5A 1K3FA 3U0BA 3TF5A 1W87A 2DQSA 3W8NA 3K0FB 3B9QA 2SCUB 4HMPA 5CA0B 1LPOA 5JDCC 5DM2A 1FP2A 3VVCA 3WGNA 4MV4A 5EHQA 2FPRA 2ZPUA 4QDTA 5FOTA 3EDOA 1T9ZA 3CYFA 2HI0A 2B82A 3DLHA 1NN5A 3ZZNA 3K15A 1PV4A 2AOWA 4N3NA 2PANA 4CNQA 3TK1A 2O14A 4DA9A 1IN7A 2OFPA 3DPUA 4LQ4A 2XBMA 2O52A 2WP8J 3K1JA 2VUSA 5DASA 1J0DA 1LBTA 3TPZA 1NXVA 2PT9A 2VK4A 1J2TA 4HDCA 5YASA 5BSHA 2BEVA 3ZNNA 1PR2A 1Q19A 3PQ8A 2B1GA 2DFNA 5DH9A 5EKSA 2Z9BA 3BMOA 4AP9A 4F3TA 2IYYA 4A9AA 1HL7A 2NO5A 3EQ2A 3L3BA 3MRXA 4IIJF 4IDOA 4R1QA 5CRIA 3U31A 4P4SA 3ND9A 4XXHA 1YB7A 4RC9A 2BLLA 1Q92A 2J3QA 4PFQA 2W48A 3NMUF 5BOSB 4TLMB 3VPXA 1E94E 2GN9A 3GGDA 4FQ5A 4BDSA 4JAVC 3M8KA 3WRXC 2B61A 1MEOA 4CKCA 1HFEL 5KC8A 5EPUA 1LTKA 2GZAA 3ABSB 1OOEA 2ASEA 2RI0A 3CT4A 1KAGA 3PJEA 1X14A 4IDNA 4EUSA 4OQXA 3RS4A 3IKTA 1CS0A 4TWBA 4D82A 4JUBA 2QYSA 4GBED 3PT9A 3AVUA 1EBUA 2IODA 5CEJA 1RZRD 2JFOA 3ASVA 1YQUA 5ALLA 3R7LA 2GCOB 4LVCA 3LI2A 1N5IA 4NE9A 1YZVA 2RG7A 3D3WB 4UCFA 2PJZA 1NRWA 4HQOA 3LT2A 3AF0A 3C8MA 5JJ5A 1UBLS 2EKZA 5JCPA 4C4SA 4P33A 1NVXQ 4P3NA 5HHTA 1DTWA 3NT4A 4NMLA 1KERA 1MGOA 2G08A 2QRGA 2Z5VA 3HABA 3R2JA 4I1RA 3UK7A 4YAJA 3SR3A 4GNRA 1R6BX 4PNHA 4AJ2A 4AZ0A 3LC7O 1Q0RA 1HT3A 1GYPA 3FNFA 3L8GA 3Q7IA 4QWWA 1H23A 4H7FA 4EHHA 3PNVA 4ZHSA 5HKAA 2BKVA 2UYGA 5ALSA 3CF4G 2NVWA 5FKJA 1RHMA 3E0QA 4JCOA 4JXXA 1UAAA 2YWRA 2O54A 3IPCA 4KAFA 1GL9B 1N8TA 3IJPA 2RHHA 3P2KA 2QRQA 1N2GA 4UNRA 2MSNA 3ZV5A 1UJ6A 3VKGA 2R8ZA 5JVDF 3KWFA 4KVZA 4HL6A 4WXHA 4XTRA 2Q3DA 5A7GA 5TXGA 1PJTA 3UQYS 1NI3A 1DXHA 2ERXA 3ZQKA 4KVGA 1JILA 5B5SA 1CJTC 3UOWA 3O2JA 4L9SA 4RPCA 2XCRB 3ZKWB 2COEA 4B85A 3JRNA 5E3JA 2AOVA 3EZ2A 1BC5A 4UE2A 4GM1A 1Y34E 1IDOA 4PVCA 5ALNA 4FWTA 4AY3A 5AW9A 4WBNB 2BDTA 1SIBE 5D5HA 5AW6A 3A2NA 4KIFA 4RVHA 2YRXA 1T0HB 3ROTA 3QEKA 1T4CA 3SZOA 4U0JA 2QKYA 2QZ4A 2WU4A 3I2HA 4FLEA 5BT8A 5BNWA 2GJSA 1AU9A 5GMOA 4LXHA 2JATA 3JQ7B 2FPLA 4RF3A 4OFXA 4Y9DA 1XJCA 1JLKA 1UC9A 5EC8A 3D2AA 4KMSA 4BWVA 5CLJA 2HT1A 2A78A 1X9IA 1ISIA 4CMKA 2H1RA 4IFIA 4OI1A 2PMKA 3HV0A 5E4JA 2WFZA 1LSSA 5HGJA 4P83A 4B3DA 3WGIA 2ZFUA 2XXAB 2PWBA 1Z38A 3LDUA 1HT1E 1E3SA 1DBSA 1QIJA 1TLTA 2KBEA 2PSDA 2R68A 4M7PA 3S2YA 2X22A 1L0BA 2XE7A 3H2BA 2AR0A 4UHJA 1L5KA 4HMOA 2OHGA 3ZBQA 2W83A 2LCIA 4PF1A 3MERA 1V8DA 1USWA 1Y63A 3D64A 3DLIA 3PP8A 4HK4A 4QXQA 3GFFA 5IKPA 2Q2QA 5J4YA 4P3YA 3A9SA 2P4SA 4LDQA 5IBRA 1WMFA 3JAKB 2UZ1B 2EARA 1KYVA 3D0RA 4JVSB 3CHYA 4EELA 3ZVRA 1OPXA 4LQLA 1VE5A 4RHEA 2P2LA 4R83A 3AUXA 5DF1A 5IK2A 3IEVA 4CKBB 5PGMA 3OX2A 3PDIB 4MWGA 3FBWA 2BAGA 1W94A 2QVCA 3Q85A 4JVLA 5DNWA 5ALEA 2W8BB 4UNNA 4NYJQ 4XQCA 4YFYA 3S44A 2PH3A 3DMYA 5LQKA 4OJMX 5U4XA 4RIHA 3RSLA 2WMYA 3NWEA 2PUGA 3OCZA 3AI2A 3BE6A 4PQEA 2WE8A 3ZE2B 3IYLW 2OOSA 3C2QA 3EIQA 1ATIA 2NX2A 2ZJYA 2AVNA 3JYPA 3WKDA 5CG2A 4IOKA 2NXJA 1RLJA 3ROXA 5C35A 2DYKA 2H1CA 3A37A 5DYYA 2F3RA 5I3CA 4DS3A 1BWSA 4TTSA 3FSEA 3EGEA 2WYVA 4DLKA 3WRVA 1SUSA 1EUDB 1NBEA 4R69A 4OB6A 1AUPA 3RKSA 2LE0A 2BKLA 3B3JA 4ZT7A 1MKYA 4OHWA 3T1HB 3AILA 1F5NA 4QNNA 3AG6A 2RH4A 5EA2A 3PEWA 2F1OA 1NNSA 1X3SA 3F5DA 3UMRA 4B0PA 4A5SA 4OX9Y 2FZLA 1ODSA 4DDHA 4WEOA 1VE3A 1B00A 5JG7A 4FYKA 3TRDA 5K01A 3V8BA 5EEHA 1QE5A 2W6JA 3GUUA 3H7IA 1QBKC 5KMGA 2QG4A 4HLCA 4YREA 2ZUDA 5AESA 2BRUC 3UG6A 1A96A 3HHEA 3WKAA 5KYYB 1BEUB 4F3YA 2R00C 2R11A 3H5AA 1ZMTA 2RJ3A 1HI9A 1MTZA 4GMKA 2YJZA 3RFCA 3WI7A 1ZJZA 3LX8A 5DTQA 5BOVA 2DQKA 1AKNA 1E6EA 4CKWA 1B2LA 3HJAA 5CR9A 1S2IA 1UWVA 2HDOA 2P65A 3PXEA 4N9QA 5FFMA 5H0IA 5I9LA 1NVDA 2NSYA 4DSOA 1XU9A 1MJHA 2HREA 3I9MA 1L4NA 3HNRA 3TLJA 2Q45A 2ZSKA 1WO8A 3UWKA 2ZB8A 1OW3B 3EY9A 1IXYA 1XU7A 3CWCA 1NXXA 5HWSA 3GLIB 3FI0A 3SHWA 4YI5A 3RK0A 2FW9A 3QPBA 3HSKA 2HTFA 1AUVA 4JP3A 5BQFA 3E8MA 4X00A 1FTNA 4C4YA 1SJ9A 4P4NA 1D8TA 3S55A 4K05A 5HQTA 3UAWA 1DQSA 3JARB 3VKHA 2WJIA 4X1IA 2ERCA 3TUJC 1MIOB 2FW0A 2XVMA 1EWKA 1GTJ1 1FFXA 3L0IB 3FNEA 4RJJA 5E4FA 5LWQA 3I9FA 4DLUA 4PAGA 4L7QA 4U02A 2AN9A 1L5WA 4OFWA 3BHIA 1OV4A 3QPVA 1C9YA 1KJ8A 2HF8A 4G1VA 4PBSA 3UJAA 2HJGA 1B7GO 4KN8A 2R47A 3HUUA 5EIHA 2XQKA 4L9AA 2BV3A 2QUIA 5CNKA 2P1RA 1VE7A 2H4XA 3KX2A 4MIYA 4E7PA 1PLKA 4NTZA 5TIIA 2IEGA 1ZNWA 3P52A 1XQVA 4II7A 1YASA 3OCJA 4OYYA 3KUDA 4C4RA 3IUNA 4G0NA 1M8JA 4JI6B 2ZWMA 5TF0A 4CM4A 4IDDA 4JA0A 5A05A 4YO8A 4BZXA 4IZHA 3QVJA 1P9OA 2JBAA 4WASA 4BNDB 1T0UA 3NKFA 4ZYYA 4YXFA 1V5IA 1BXGA 2A9OA 5DN9A 3QKRB 2PVSA 3RWBA 1U0GA 3OY2A 4K9NA 2VDOB 2RGBA 2VAXA 4M99A 2WHEA 3TSOA 2JLQA 3BMXA 1Q1EA 2VF8A 3FGOA 2VXCA 2C97A 4ZV9A 4JI7B 1WEKA 1I51A 2O7NA 4MAMA 3PHJA 2EU8A 3KZ1E 1Z7GA 1G3IA 2RC6A 1L7OA 3UBTA 1XA4A 3UBMA 2J9YB 2PGIA 3U7QA 1JS1X 2ZVPX 3P9SA 1HRDA 1ELOA 4M22A 1XQWA 5LQDA 1WY7A 1FFSA 3HYNA 2RH8A 3OOSA 3KB8A 5CEEA 1Z73A 1FZQA 2CDNA 4O2AB 5A4DA 1DV1A 5IC4A 3JR7A 1L5HA 4OXXA 3BXGA 2EBWA 3KZKA 1YRAA 3HB1A 1P7YA 3LQRA 5GAJA 4CV2A 2Y92A 3GQBB 3TTUA 3RVJA 3FLMA 2FRXA 1OH6A 1PFQA 1JU4A 2YX1A 3QM1A 4KE9A 1KRXA 1EJBA 1IOZA 2XCUA 2ZWOA 1OLSA 3ETNA 1MQ9A 3W7BA 2J6IA 1AKTA 1Q74A 3MAJA 4EKDA 5BSWA 3J81A 1VA5A 4PFJA 4PHTA 4TYMA 3HZZA 4YRQA 4UUQA 3KSDO 4EYGA 3JYHA 5GJBA 5KX5A 5DBHX 1I2BA 4D98A 3VGJA 1TXGA 2C4KA 2G71A 2O9JA 2HLNA 4RA6B 5AM1A 3NYIA 1A7JA 4C7JA 5LOVA 1Z0JA 2NG1A 1ETUA 5THXA 2ORIA 3FKSA 1H8ED 3E5RA 5DYTA 1HT2E 4BPBA 3H05A 4BFVA 1XQXA 3LUHA 3IEUA 3NVMB 1R4NA 4BVGA 2A1UA 2PRJA 3GOHA 3ZDDA 4M6WB 1U9ZA 3EN0A 1PL7A 5B58T 2Q7XA 4CL8A 3MJVA 3UJPA 3QGMA 4UMEA 4OGFA 3OAAD 1SQ0A 2EKQA 1DAIA 1JECA 1LGYA 2HA6A 1RI2A 4LJ5A 1PG0A 4QTZA 4KGZA 4ANFA 1MR3F 1Z0DA 5IARA 2O3TA 1IHYA 1UJ2A 3KYBA 3KFXA 5J2TB 4ALMA 1KFEB 2RGNC 1MCZA 2WEKA 1GZ5A 2XODA 4KIGA 1NQUA 1J25A 4CG1A 4D4HA 3Q6NA 4Z2AA 4PSVA 4I19A 3OLYA 3K0SA 2QV7A 1Z3IX 2Q99A 2PRIA 5JSUA 1X7DA 1QO0D 4DT1A 4C22A 4E4TA 4YRIA 1E0DA 4DDTA 4UU7A 1WHTA 1ZU5A 1NT2A 5CVJA 4EAQA 5I48A 4N7JA 1D03A 1WX1A 3TIXB 2D1FA 1N78A 3E3NA 3DO6A 1RXCA 4IFTA 2OCYC 4I9UA 5DBGA 4EOGA 3L8DA 4FU0A 4B6GA 3F8SA 4HRAA 4HBGA 4AMYA 4FGLA 4QBGB 3PKJA 3NV9A 4KXMA 5KHOC 2ZB7A 2GD6A 3QI7A 4FZ5A 5TMBA 4FI3C 1E63A 3KELA 5BT9A 1NE7A 3KVNA 1E8DA 4IO1A 4TM7A 1IBLB 4KU4A 1MOZA 1RSZA 2QX7A 3OCUA 5FWAA 3HZHA 5T4HA 2LTAA 3M6VA 2FF7A 3NYWA 1TD1A 3I9LA 5HK9A 2WV9A 2FEKA 3VV2A 2G76A 5HFJA 2FDRA 3PNLA 1H9BA 3BM5A 2W4IA 1JPUA 4HH4A 4NQRA 3WWDA 5K4AA 3RJTA 3RYCA 3OPVA 5K0NA 1QQ7A 2VQDA 3W04A 5K8VA 2QYHA 1AXGA 3AEUA 1TQ2A 3FTQA 3IP6A 4DEVA 1MABA 1Z5WA 3TGPA 3TXYA 4JBGA 4M88A 3T7IA 1MO5A 3LHDA 3E2MA 4CQLB 3V7UA 5BSGA 4XD7A 2NO7A 1FL9A 4TSRA 1XZCA 2GJ4A 4CM1A 1W59A 2GRAA 1CQWA 1CUGA 8ABPA 2YNMA 3L79A 5E6SA 3AHJA 2DUJA 2X1VA 3QKIA 4N5NA 4RLQA 1H2AS 1ZGBA 4LMBA 1VZ2A 1V6AA 3PDWA 1RMQA 1MDFA 2ZAOA 3JD2A 3FSGA 4RQBA 3RVOA 1GNRA 2VG8A 3GLKA 3M4ZA 2RHBA 3AI7A 3CZ5A 4KLCA 3SZGA 1ZISA 1SKMA 1IRIA 1DI0A 4OUDA 4W8HA 5JNUA 3DB2A 3RK1A 1EGMB 1P1KA 1C3VA 2K6GA 2V1UA 1GARA 2WAMA 2WVJA 3D3KA 5AJTA 1ZC3A 4ZYXA 3EUAA 1NVAA 1YJ5A 2VTEA 4IX9A 4J43A 3WSVA 1HTTA 5SICE 3H13A 2DCUA 1E3JA 1DWUA 1OFUA 1Z9BA 1YIDA 4I9FA 4U2BA 2BPOA 3GBPA 1RD4A 4ZYZA 4TUYA 5JMPA 2QJFA 2IY7A 1JWBB 3BWYA 4O1IA 2PA0A 1H65A 1FVHA 1RFLA 1VPLA 3LDFA 5CNIA 3OICA 4G4SO 3U56A 4Y6QA 1CUDA 2XKKA 2J48A 3E5MA 1RPZA 4ZU1X 1CCWA 3JX9A 2HGZA 2EYUA 3IVAA 4FT4A 2OGSA 2MMGA 1T8SA 5F3DA 1E2UA 2GOYA 2GZ3A 5GP1A 2QRPA 4JP1A 5I45A 3IRUA 4F12A 4X54A 1VJTA 2I4OA 4QPPA 2JGMA 4K2AA 4QUGA 3R6DA 3VTKA 1KHTA 3CZAA 4G8CA 4NPHA 2A4KA 2CWWA 2OZLB 3AR7A 4TKMA 3ILYA 4MMXB 4NATA 5DX1A 2J0EA 3EIFA 2V7TA 2RB5A 2G25A 3IBGA 3LGXA 3NOVA 3LC1O 1T2EA 1ZNQO 2RSLA 1VYUA 1P1IA 5EZQA 1J6UA 1GTVA 1XPRA 3X1KA 1PFGA 3N70A 1PJAA 2NVUA 2P2GA 4K6OA 3U1VA 3E9DA 5L3SA 1V47A 2I4IA 2NUBA 4RPHA 5IWAB 4KGVA 3EIHA 3OC6A 3CVXA 3DKVA 3NHFA 1AE1A 3RHSA 3AI3A 2FWNA 1FA9A 1QIMA 2FMFA 2Y0CA 3LH5A 3DVLA 3NVAA 4MW5A 4NU8X 3OQOA 1J9ZA 1QAOA 2WC1A 4L1KA 4MUEA 5IEJA 3DQPA 3GNLA 1NUUA 2B9VA 4GC9A 4NH4A 3VNQA 2PSFA 3R5FA 4EY5A 5AW0A 1PJRA 5CB6A 5EZ6B 2VAPA 4Y0NA 3FTCA 2JHPA 2Q1YA 1N2SA 1TAGA 5TGDA 1ACLA 2MR5A 1V6CA 1KJIA 1XMXA 5ALVA 3WJ7A 2OECA 3OSZA 4FHFA 4NMWA 3EQ9A 3ADPA 3G3EA 3FZYA 5M7EA 3VA7A 3LXRA 2YMLA 3I05A 1TVKB 1BKSB 4A16A 4YRRA 3FE2A 5T64A 3E7DA 1DPFA 4BVLA 2O3SA 1IY8A 3ZHVA 5F12A 1T0IA 3MT9A 3K4HA 3WBJA 3ZDQA 1Z8HA 2FPMA 2P2CA 2P69A 3M9XA 2XCLA 1FTYA 2QL9A 4N0PA 1E3QA 3VU8A 5JW6A 3W5AA 1PK8A 3AGPA 3UJCA 3KNZA 3LK7A 1T5LA 4K9MA 3TUIC 1K8XB 1AMUA 1P4AA 1YAHA 3GJ7A 4G0PA 4DY6A 4HFNA 1HMPA 2X1MA 3PNPA 1SCUA 1PG5A 2BMVA 3BB1A 2X2PA 3BMCB 3C6BA 4BN0A 2DEUA 4Q7KA 2PUAA 3QEMA 4HH1A 4Z54A 3GEEA 4CM9A 3SDSA 1KXZA 4RTQA 2P67A 4RPGA 3VR6H 4EGSA 4KDFA 5JZBA 3ORRA 4GBJA 5THKA 2QORA 4RADA 3OUZA 3OTQA 4L95C 2JGDB 2GMWA 1X7ZB 3T15A 4D9CA 3KZCA 4EJ6A 2CJXA 3FZEA 5BY2A 3OI7A 1S3SA 3IUSA 4CRWB 4F2HA 2PZAA 3GX1A 3L8HA 4DBLC 3WO0A 5KNCH 4YACA 1Y5RA 2QX6A 4NFYA 1MMFB 1TF7A 3AINA 4EYKA 1T15A 1T5BA 3OD5A 5AK6A 1XLWA 2W8ZA 3PEFA 1JHQA 3D5TA 3HBAA 4IMJB 1TGYA 1NDUA 2GEUA 1LQTA 1EE1A 2QE7A 3EGXA 3PPWA 4RVFA 4COKA 1RYHA 2IVZA 5K0JA 5CGQB 2AXNA 2ZR0A 4IMIB 4N82A 3D6JA 3UPTA 3P1JA 1FPMA 4AG5A 2QM0A 1O6FA 1PSWA 1M83A 3R9KA 1F2TA 4OQYA 4XJXA 2PMBA 1GPAA 4D0RA 1L5NA 4RD2A 3TAUA 3DYVA 1QYIA 2OKCA 4UM8B 1A04A 1IMOA 2ECFA 2W22A 3AZOA 1TA0A 2QYOA 3QPUA 4PQGA 4MI1A 3JQAD 1C7QA 2PLRA 2PNJA 1JFVA 5F2OA 2GARA 1GJRA 1KP2A 3IAXA 1UEJA 1TE2A 4PONA 1FRNA 2GILA 3IOYA 5EN4A 1QHYA 3G82C 3IBYA 3KM0A 3PPVA 3I72A 1ZOSA 4TL9A 1E64A 4HGRA 3DEIA 3PDHA 3PBKA 5H3CA 1E3WB 1US8A 4FR5A 3RTEA 1QTNA 2SKEA 1S2GA 4Y67A 2CDCA 1CG6A 5B7QA 4YUVA 3IAAA 1XCOA 1XVTA 1NKVA 2C03A 3UVEA 5KKCA 4AP6A 1J2EA 1FYWA 4KXQA 2JGAA 2Q0QA 4JU9A 3KYCA 4PU0A 3WGHA 1JHMA 3OQ6A 3PLAE 1TC2A 2X5JO 3L0SA 4WXPA 3LPLA 4TXMA 1VL2A 1F6WA 2OLJA 2VNKA 4B80A 4UPVA 3RAFC 1OVMA 4UUOA 4WGFA 5B57C 5JPDA 3VNRA 3TWOA 5KYWB 2NZ2A 5EJAA 4H0CA 3RAGA 3T41A 4B6SA 4B74A 3HA3A 1FBNA 1UPXA 1Z6ZA 1Z6PA 2VYND 3A1UA 4GECA 4LNUA 1ECJA 3B12A 3DTYA 1BOOA 1DOAA 3IH5A 5DM0A 3I2IA 4B3XA 4K2HA 3OF5A 4NDAA 2WM9B 3B2EA 3O21A 4TS4A 3WLIA 1EMDA 3VUFA 1BH6A 4LJKA 4KV7A 3DHYA 1B1AA 2ZYAA 3A36A 3MINA 5MFPA 1DUSA 3EPRA 1BD3A 5T6MA 1VL1A 3PQ4A 4CIYA 2PH5A 4XDHA 2FPPB 5F1PA 2R1ZA 3M1IA 3QFHA 4DIOA 1EXWA 5KNBA 1IUKA 1EM6A 2YFYA 3PWKA 3S2IA 4C5BA 2FQXA 3EVEA 3GVIA 3MQ4A 4O25A 2YWGA 2JI8A 4L5CA 5BR1A 3D8RA 1TO1E 3AGQA 1OJLA 1OXXK 2ANBA 4QBFA 3ET4A 5KWEA 3IV9A 3L0BA 5FTKA 1SBQA 2NU8A 5I4BA 1I7SB 4FM9A 4C6TB 1TKBA 4X1OA 2G5GX 1Z4LA 2Q6TA 2VDNB 3H8SA 2QTGA 4IIVA 3HGQA 4O63O 3FOFC 1NQVA 4DRYA 5A4FS 2DETA 2VQ6A 3NOOA 5B1HA 4BO2A 2OVFA 4PANA 4JHLA 2VSNA 4MI3A 2CE7A 3TZEA 1ZSYA 2NQTA 1K9VF 1KOJA 1GA1A 3ZC3A 1RKBA 1XYGA 1PR1A 5FBZA 3AU9A 3PUIA 3JQAB 1R7RA 2PK3A 2JFNA 1PDVA 2AG5A 4OSEA 2GPYA 2ES4A 2Z1NA 3R77A 1TTHA 2BIFA 4N5IX 4B7AA 2JLZA 4J4BA 4KHZA 1GFIA 4IJ6A 1DAKA 1AUQA 5BUZA 2AJ8A 3CUSA 4C29A 4I6EA 4NEHB 4O8CA 4EJ0A 3VU3A 4B8ZA 3J7TA 4BFTA 2ID9A 3U4QA 2BZ0A 4NKRA 1FSFA 1PZXA 4G0YA 1W88B 2W4MA 4IGKA 4HOYA 2B92A 1C1YA 5EHGA 4CI9A 1K6EA 1RLMA 5ANRB 3MMPA 4ZP1A 4A26A 2O5EA 4PFKA 2I91A 1KHHA 3KE8A 2JLBA 5K45A 3P45A 3U1BA 2P3LA 1JSXA 1G2OA 2ENWA 3PFKA 5CFLA 4HV4A 1RYDA 4FOOA 4AYWA 1QWOA 1QTQA 3JCZA 2EX4A 2ALJA 2OBXA 4JQYA 4JITA 1FJXA 4N76A 1YULA 3D59A 1TX4B 5TX7A 3CNBA 1G3QA 2ERYA 4IKOA 1JI0A 3EG9A 3LKBA 4XPZA 3Q3EA 2CMGA 4ZI7F 4U8HA 2QW1A 1YFLA 2DPMA 4H15A 3SXUB 3ADCA 2OKGA 3HXKA 3V8QA 4KHPB 5CVUA 3FDZB 3IJ5A 4ZRMA 2BL4A 3EBOA 4CR6A 5TMDA 1ZAYA 3ILSA 3Q8LA 4CM8A 3M4XA 4UUMA 2HO4A 1WE2A 2G36A 2V6BA 2D0PB 5HX7A 4B3MB 2H65A 4KFCA 3V48A 4OH7A 5HKBA 1J97A 2P3SA 1SWVA 3L8FA 2O20A 2D13A 3A9RA 3QA3E 1SA0A 3IKJA 5A06A 1E2GA 3LBYA 3TKLA 4MR9B 2Q2VA 3NGLA 2FSGA 4PR0A 6CHYA 3FMPB 2JGFA 1NI4A 4FDAA 2CXHA 2JK1A 3VOAA 1FJGB 1QIKA 2Q62A 4KE6A 4IJMA 4LRSB 3TDNA 3K0AA 4J1SA 4P92A 1FSSA 5KOHA 4E21A 1I7DA 1A2OA 2BGRA 4HH3C 4KFRA 4BMCA 1N8KA 1RXIA 2C1XA 3GA7A 4BO1A 5FA8A 4DLRA 1M6YA 3D54D 3RFUA 4B5LA 4C89A 1V1RA 1NP7A 1YRLA 3E8XA 3IDFA 3VKFA 4ID3A 3IULA 1WB6A 5JD6A 1K2VN 4BO8A 4GHWA 3CB2A 4RVNA 5CHYA 3AHHA 3DTNA 3SJUA 3WYEA 5IBCA 2ZJFA 5AUPB 3U7JA 2DG2A 3OZIA 2D06A 4M1QA 1Y82A 3V1MA 1GPYA 1T9KA 4KR2A 1P19A 4BNZA 2ZI7A 2NNWB 2OGUA 4B9EA 2AG6A 2VOEA 4OGGA 4XJTA 4A8PA 4DSAA 1XZAA 1W35A 1AD2A 2GHRA 1WXHA 3VTZA 4WNAA 3T0IA 4M21A 5BSMA 2BFNA 1JHPA 1MIHA 4H3SA 3THYB 2JLWA 2Q4OA 3O2QB 4M76B 4PLTA 4UEKA 3KTAB 3Q7QA 1Y9ZA 3P4UA 1MUUA 2CXQA 2FPIA 4RLSA 4TMTA 4J0DA 3GLGB 1U8ZA 3LW8A 3ZPXA 5FADA 1UMDA 5JASA 2E85A 1ZNZA 2ENUA 2YINC 4KGXA 1B6TA 2JASA 2HQBA 3GG9A 4M9CA 5CW1A 3TCKA 1YR6A 2Y1WA 5F51A 3AB8A 4BASA 4F06A 2O0KA 1U0NA 2ZAIA 4Q3EA 1R15A 2PJDA 2Q1XA 4G8JA 3GLHB 3LYUA 3PICA 3OY7A 3ZHSA 4CE6A 2KBFA 1H2YA 2G6BA 3MB8A 1NU8A 4RAOA 3F98A 2X0JA 4RDHA 4O4HF 3CM0A 3DMHA 1M10A 1U0HC 2JIBA 4QJBA 4ZO8A 3G0GA 1X92A 3A1NA 3CW2A 1XROA 4JV5B 4AMBA 1KAQA 3I76A 3OURA 4N5DA 4LG1A 3UKOA 3UXMA 5LIRA 3P2EA 2P0AA 3TI7A 4MW2A 4OLHA 3E35A 3VX4A 3AP1A 4DWOA 3QEAZ 1ML4A 3GDFA 2PU5A 2QY9A 2BEUB 3H0KA 2G4VA 2VHWA 2XE8A 4WGGA 5DBOA 3ZGXA 4NOJA 3ZVNA 4J7AA 3COYA 1HETA 2MOKA 2C57A 4CMHA 2YZKA 4CLOB 2D1TA 3C4JA 3UHOA 3BOSA 4M0MA 2ZRFA 3FR8A 4QT0A 5C31A 5AKKA 1N2EA 3LYLA 3CUVA 4X62B 2QTTA 2SKDA 2A0WA 4F46A 1AA9A 4ETNA 4WWHA 3KLMX 3NTXA 3IMFA 3V9AA 1CJVC 8GPBA 2FMTA 4KTTE 3L7CA 3BXZA 5C53B 3ZK8A 3ZIDA 3CGGA 5KB3A 4G81A 5A04A 1M6VB 10MHA 2AXEA 4GW3A 5EXXA 5I9NA 4N0MA 1NXPA 1VMIA 1XB2A 3LP5A 2QUHA 5B1IA 5CB4B 3FUTA 1LK7A 3RV4A 2PL9A 3HE3A 5A3QA 3TR5A 3P71T 3ST7A 3WYCA 1X86B 1U3VA 4KWEA 3U81A 1CWUA 3DA8A 5DIZA 3VFDA 1EEHA 4PX3A 2HH9A 3THXA 1X70A 4UKDA 1BA2A 2L2QA 3WLEA 3UMMA 3QEBZ 4I55B 4Q9HA 1J33A 5DLDA 2XPCA 4D4KA 2YXBA 3DDHA 4H77A 2J87A 4DWWA 3FCAA 5FV4A 4RTPA 2OV6A 3UJBA 1AKVA 2QRZA 2OFFA 3SEZA 3TAXA 3ZBTA 3M82A 1BAPA 1PNOA 1MN6A 3JQRA 3DZFA 3L1HA 3FCOA 1Z63A 1SVSA 2OMEA 4HAUA 3U80A 5JNVA 2O1SA 4NU5A 2F43A 1XN1A 2GVZC 2I6UA 3HPQA 1XFAA 4TGLA 3WK5A 3C7KA 5JR3A 3BKXA 3F2IA 2GKGA 5EP4A 3RU7A 2O8CA 4K1XA 4BNUA 3I45A 4CLRA 3KSAC 4GE3A 4W5QA 3T3PB 1BXKA 4HNUA 4WZBB 2JAWA 5FPKA 3GLIE 2VUHB 2CV1A 3C5VA 2ZXEA 3OC0A 2NXCA 4WOBA 3GN1A 4KREA 4J3JA 3T4EA 7ABPA 1E6LA 5AXCA 1ZW1A 1F7UA 4BFZA 3KRTA 3A6JA 4MB2A 5COBA 3OZBA 5PNTA 3QKTA 1R8SA 4IHKA 3O6VA 1JHRA 3MD0A 4NONA 3N2EA 3N8NA 1GLGA 4MB0A 3R76A 3RM3A 1A76A 1RM5A 3CRMA 3RASA 1FNMA 1HDCA 3BKWA 1F6BA 2QR5A 3R9XA 2I87A 5BXQC 1YRBA 1GUYA 1L8QA 2HO5A 2UKDA 3GLQA 3I2KA 4LJ4A 2EF0A 2LCFA 3BC1A 5E3HA 3EODA 2Q2OA 1UJMA 1WUJS 1SIWA 2FXIA 3IUJA 2IITA 5F76A 4XI9A 1JH9A 1FZTA 2I67A 5IF3A 4YT5A 1EZ4A 4C3OB 4E4RA 4CKXA 1ODCA 3RUIA 2ODEA 5DNUA 4IJVA 1DEKA 1W4ZA 1A4XA 3DZGA 2E3JA 3ICQB 5GTDA 3RUCA 3RYFA 1XYVA 3VNBA 4Y98A 2HZBA 1KMHB 2OC9A 1BCSA 4JLKA 3EW9A 5CH5A 3F73A 3IDSA 3ZWKA 3I8SA 4BNNA 4Z5XA 3FKQA 5DSZA 1WDMA 3S27A 3MXOA 4V38A 1P3DA 1MNAA 1QP7A 2BFFB 3KYJB 2V65A 3UWOA 3FGPA 2HADA 4ZVMA 4DMFA 3L4KA 1YJCA 3I39X 4IICA 2W2LA 1CUVA 1E6CA 2XITA 3I6QA 2HDNB 5TR9A 2OR3A 2PUJA 2ZP1A 1RABA 1A4IA 5KTRA 4KWIA 5IRCD 4FZ3A 3O90A 1E1DA 2E6UX 1NW6A 3DBLA 4JQOA 1W0JA 1K75A 2OILA 1YBHA 2QJWA 1JR3A 4JKYA 3DOEA 3SFTA 4TVSA 5C5DA 4K81B 3JTEA 2EBFX 1F7VA 3KTOA 3UMFA 1VHLA 4D81A 1KZ4A 1PF7E 1C8VB 2JAUA 2WF5A 1PCXA 4KUHA 3B60A 3BRWD 4MVJD 3IAFA 1RC8A 1QAMA 3AUSA 4UAVA 1A5ZA 4HXFB 1E58A 2AJDA 1ANKA 1INLA 2EL9A 2WWXA 3QTBA 1GL7A 4JEIA 1V1MB 4BVAA 1QH8A 1NYRA 1SG9A 2ZRQA 4F5DA 5FWYB 1D8AA 2GHQA 3SZRA 2RD2A 1W2WB 4QDKA 1VLVA 1XZDA