2I8LA

Solution structure of an endopeptidase hyci from escherichia coli
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
MTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAVEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase 3 maturation protease
publication title Solution structure and backbone dynamics of an endopeptidase HycI from Escherichia coli: implications for mechanism of the [NiFe] hydrogenase maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 43
structure length 156
sequence length 156
ec nomenclature ec 3.4.23.51: HycI peptidase.
pdb deposition date 2006-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01750 HycI Hydrogenase maturation protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HybD-like 2i8lA00
2KMLA 2E85A 1CFZA 1C8BA 2I8LA 5IJAA 3PU6A
chains in the Genus database with same CATH superfamily
2ISSD 5EP1A 2Z6QA 1J8YF 1G8PA 3GEHA 4XQEA 3DFFA 4FKMA 3AHHA 1PL8A 2C84A 3AR8A 4LHVA 2J0EA 3W6OA 5LB4A 4WSOA 1Q0UA 3PXDA 3LUBA 2WQZA 4TUYB 4EKNB 3EPJA 1AS2A 1HDRA 1NBEA 1U1DA 3RYIA 3G2KA 5LKRA 2CLIB 2ODAA 4B48A 4HQ6A 3SE7A 2FEMA 1QV7A 3G7UA 1YCFA 3OPYB 5TQVA 1HDZA 1AQ6A 3R3UA 4HKTA 4YALA 3O4GA 5ENZA 2DKOA 3UJ9A 3ND6A 1GAJA 1RACA 2JI8A 3RCBA 1YMVA 1Z68A 4G24A 2GD1O 3B1XA 1OFTA 2CE7A 1N2EA 3C4QA 1SNYA 1BXGB 1TB4A 3WGQA 1EM8B 4KSYA 2ZPTX 3QUCA 1XCMA 3C6MA 2XRYA 5IC5A 3N6RA 3KSAC 4FOLA 2TMYA 1J8VA 1P4SA 2OQVA 3HCAA 3CN7A 3KPUA 4OX9B 3B20A 2ZS8A 2F59A 5HKOA 1WXEA 5EWJA 4AS2A 6GPBA 3AVQA 4JX8A 3OJFA 2QP4A 1U0BB 1IQ0A 2PUVA 3BL5A 3VPDA 4BIMA 2VFAA 3EQ2A 4PPQA 5JD5A 3MUEA 4TV9B 1G6OA 1UBTS 4TXHA 3OAAA 1CR4A 3U48A 1AHPA 2E4WA 1WNFA 3A4TA 1Z0AA 3QU2A 2QNRA 4JENA 4YMVA 1FNMA 5AQEA 4Q3CA 3BXEA 4HUJA 5JRDS 4L9AA 5TV2A 2VP9A 3FMOB 2O1SA 4PG7A 3NWJA 3ZV3A 4G4GA 1KOJA 3A1CA 1ZD5A 3OQ1A 4HX5A 4KQIA 4P54A 1RAHA 1YOBA 5AJHA 3S40A 1UAYA 4B4OA 5E9QA 1RHKA 1YC5A 3MGKA 2EGHA 2Y3IA 1KFKB 3DEHA 2WUWE 5E4FA 1Y5IA 4EVQA 1OGIA 5DX8A 5IEJA 1SVIA 5KIAA 2NX2A 3VDQA 4YRDA 1FUUA 1VC2A 2B7LA 3ZV6A 3S8YA 1RLUA 2VH1A 4YFYA 1V39A 3E1SA 3VJMA 1UMBB 3WRXA 4JEUA 3AI1A 3F5MA 1EE9A 1RI5A 3AHIA 3LCJA 2CNLA 2FUEA 4UZSA 1FC0A 5DNEA 5JTUA 3CVYA 2TMDA 2RKBA 4BASA 1I7NA 2APJA 1ZNYA 1UZUA 2O2GA 1ZJ4A 4R3NA 4E5YA 1VPEA 2B4QA 3UYKA 4WZAE 3WZLA 5CRIA 4UC0A 2JLWA 2QRPA 2GESA 1Q17A 5C81A 3DOEA 4R9VA 2OV3A 3DZKA 5EZ6B 2EBWA 3V8BA 4YT2A 1MEJA 1CJVC 3H9BA 1D2AA 1WV1A 1DAMA 3LG2A 4L3VA 4RC9A 5LIRA 5LZ2A 4MV4A 5EZQA 1RRCA 1U02A 3HKCA 3GCXA 3IXMA 3USES 3KXDA 2UUAB 4M9SA 4PQFA 4TKZA 3LRTA 3K9QO 1YC2A 3E03A 4KAAA 3ELYA 3ZU4A 1I4OA 3PEYA 1A8UA 3B9QA 2V3WA 3R3ZA 3KKNA 3O8NA 2HEIA 3RYFB 3H0EA 3RSSA 3KSBC 3T3NA 5JLJA 3ABZA 1SXGA 3C5WP 4HDSB 4B3JA 3JWJA 2KM1A 3JD3A 1SCKA 2X1MA 4JQSA 2WWIA 3EFBA 4BKUA 4KN5A 1U63A 1U6IA 3R3JA 2Q6TA 2QI9C 4YP9A 5B58T 1E9SA 4QRDA 3KCNA 2MT9A 5BVHB 3HCOA 3KZMA 1CBUA 4Q82A 5GV7A 3RPEA 1JWLA 4PZDA 3QY9A 2XUJA 2XT6A 5IKXA 4L75A 1SIOA 1T3GA 2YW2A 2VHYA 3Q12A 3OX4A 3T8YA 1O6CA 3DZDA 4V0RA 5I7OA 1NUPA 1Z2CA 1DG3A 2UZIR 1X0XA 4QRHA 4WN9A 4XQ0A 2AN9A 3T0FA 1H5UA 3AUUA 4C2AA 2JKVA 1YFZA 2A9FA 2AYXA 3DDCA 4QPNA 3HEMA 1I7DA 3EA4A 3ZTYA 2RK3A 1Z5OA 3CX6A 2A0YA 4RZ2A 5JNRA 2PJDA 2QROA 3DNPA 4PQGA 3WMRA 1VMEA 1EA7A 2H9AA 4CKBA 2CHGA 3HVIA 4NZPA 4DLPA 1XTJA 2CKDA 4K6MA 1E4YA 1VCOA 1MQ9A 2YY7A 3CR8A 1Q12A 2D00A 4JJ8A 4V38A 5JVDF 3EWIA 1IH8A 1ZM7A 3MTBA 3WYGA 4E7PA 4IQ8A 3A2NA 4TSFA 1L7MA 4HH3C 2XW6A 1Y6RA 4XIGS 2Q9UA 4R1SA 2GETA 4B34A 4Q1FA 2W42A 1UMCB 3ZW8A 4TRMA 3K31A 4EHHA 5L3VA 1C8VB 1J70A 1P6XA 4B6PA 4ABYA 2A9PA 3DNMA 4TTAA 4AXXA 2XB6A 4ZWNA 3RKSA 3PIIA 3KHUA 2Y0DA 3B3JA 4P5PA 1KH1A 4BC0A 5EJ7A 1LDYA 5HOQA 1NWHA 2ZJ6A 2CEAA 3DLBA 1EFKA 4Z0TA 2V98A 2DWCA 4I9GA 1H2HA 2HRCA 5KINB 1X7WB 2YICA 1QP8A 1VMIA 4P4TA 1WBBA 2R8OA 5BOSB 2ID4A 1ZITA 3BIFA 5HKBA 1OYWA 5EP2A 5D7BA 2RK4A 4M0EA 3TLMA 4AJJA 4CMBA 4LDZA 2JIRA 3BN3A 3ENZA 2FPRA 3ZIDA 2Q6VA 4YHHB 4N9WA 2CLLB 2R8EA 1C4OA 4GAEA 4KXMA 3ZCUA 4QGFA 1VSBA 1P19A 2N75A 3I09A 2VYVD 4QODA 5E2AA 1N0WA 2QMOA 3IUQA 1UOOA 3PUVA 3R5KA 4PBTA 4Z99A 4XEUA 4FCTA 4MR9B 2C4UA 5BNTA 3DLPX 3HKDB 1E2BA 1C3VA 5BSEA 4D4LA 3QV2A 3H1AA 3H2YA 5BV2P 1DHTA 1WQ4A 4U00A 3K9GA 1AO3A 4A73A 3CV3A 4C0KA 4ZHQA 3CRVA 3RS7A 4NS4A 1A2QA 5BQPA 4BEJA 2XQGA 1WLYA 3S2IA 1JHOA 3EVAA 1CDZA 1GSIA 1ODLA 2IGTA 1G3MA 1YZKA 2ADMA 2OXCA 3SI7A 1MH1A 3JPYA 5ITZB 4KZPA 3FF1A 2A78A 3K6SB 4MVJP 1FB5A 1N1GA 2YJ3A 1HX7A 3JAKA 3MUOA 3NOOA 3ZY3A 4LVOA 3TL6A 4BZPA 1XZEA 3HB5X 5KJ1A 1ZJ5A 1ZD2P 2QM0A 3ZC3A 3I8SA 1U9YA 3KYBA 4FX5A 2BEJA 3TVTA 3PGXA 1Y8CA 3IHLA 4LISA 4FMDB 3LXUX 5JJLA 3INTA 4D9MA 1D2EA 2LIVA 3N8DA 1EFDN 4Q4DA 3WMEA 1GSOA 3BDVA 4YCDA 3ZLVA 5EIHA 3EN0A 3MWGA 4RKEA 4Y98A 3VOBA 4EEZA 3H4TA 3NI2A 2PYZA 2X41A 4PAOA 1A9XA 4P9NA 3I45A 4LV6A 1V6SA 3KOYA 4JBHA 2ZRQA 5JASA 1NXWA 4UAUA 3MF4A 3SC4A 4OXQA 4XYEA 5ELMA 1U7HA 2RGBA 4HWSA 4K1LA 1CFZA 4WXMA 4URHA 2GPYA 3RVKA 1GGJA 3HJHA 4S0XA 2XYRA 4UCQA 4R7ZA 2C31A 4K81B 5FULA 3C0KA 4HNAA 3GG9A 1HYGA 1BW9A 1PR0A 4XD2A 1Z63A 1GDHA 2QXUA 1E5QA 3G0GA 3HADA 3VR1A 5ALJA 1W4RA 2K4MA 4XJVA 3A10A 2C54A 1TFRA 4OI2A 2JIDA 4OHFA 4ALIA 1EFHA 5B64A 1JPUA 1CZOA 1U0TA 3ROZA 2CY0A 2R48A 1KMQA 3BTSA 1I24A 3EGCA 3N0VA 1ZC4A 1JIIA 2CCKA 2IOYA 4FE7A 1YT5A 3FVTA 2YIJA 1GUZA 3KHSA 1AUQA 3V4PB 4M9UA 4WEOA 1KSGA 4NICA 2IW3A 4ER3A 3ZOKA 2Y9MB 3RJTA 5K3OA 2WKRA 2Q27A 3KSUA 1DV1A 1LBQA 1GUDA 1P9NA 2ZJ1A 4RHYA 2IEBA 5J63A 1Q6ZA 4A8JA 1LWNA 4XLLA 5LQNA 1D8AA 4Y2JA 1QUEA 1HDGO 1IXRC 2QUBA 4F7WA 2I8CA 2PZFA 1K7YA 2PUGA 2WKPA 4ZN6A 5KQMA 3PE4A 4JLMA 3GH1A 3GAMA 4EUKA 1P5HA 1URPA 3BH0A 4TTTS 1RABA 5J5VA 5A0FA 1OPRA 4QULA 5EXPA 4U02A 3K2QA 5GVSA 5EKXA 1BMDA 1DCTA 2X5JO 1OZ0A 1AB5A 1ISIA 4NH4A 1NHGA 3IUMA 1WXHA 3TQHA 2UYHA 1JPNA 4GKAA 2ZIEA 3ZUGA 2AJ8A 3LX6A 2RARA 2OSBA 2VP6A 4OB7A 3RNOA 3FZQA 1EEXB 4IHJB 3NPAA 1JQBA 3H5VA 2IT1A 1CX9B 1JDNA 2CVQA 4WI1A 4ZT7A 4MTCA 4WV3A 2HL6A 2BLNA 1XI2A 5D01A 4IILA 4XJSA 3RSLA 1L5YA 4BVKA 4DV1B 1MVNA 2JCGA 4Y8VA 3HGQA 2PCLA 3HGTA 3ZHQA 1I36A 2AV6A 4YO8A 1W8DA 2WMYA 2GN8A 4MKFA 3SZMA 2CB9A 5CHEA 3AUTA 5KKCA 2YN4A 2WZQA 3GRKA 4J75A 2JGRA 2H7YA 3OTHA 2P4UA 2V4UA 1JIXA 4ACBA 5JMPA 1B16A 1XQXA 2I7CA 3EXG1 3NCTA 3DZ8A 3L7CA 2G09A 4O4HF 1WABA 2VKTA 2OE2A 3OZGA 1TPYA 1PSWA 1QYRA 3KPYA 3MJ4A 4X62B 3M4ZA 3Q3EA 4ZEVA 4CI9A 1G0OA 3H5TA 1SUIA 2D1TA 2P41A 5G2OA 1TRKA 2BTQB 3TTSA 1L7PA 4MICA 1E1CB 4R81A 1LS1A 2QRVA 5FOWA 5EIXA 3LYUA 4H7EA 3BH7A 3BICA 2B99A 2JBAA 1P0IA 1AG9A 4FFWA 4X6YA 3W77A 5CVVA 1R12A 4PGGA 3TW6A 4GM0A 4LX0A 7MDHA 2UUBB 2FUNB 1KK2A 3MCWA 4IWXA 3B6IA 4LQ4A 2PMFA 5CDYA 4LW8A 1PWHA 4YB8A 5THKA 3DZFA 5IK2D 2GK6A 1PUJA 3GUYA 4N8SA 2QIPA 1U1FA 1B41A 1KMIY 2HN9A 4F2GA 2IODA 2BISA 2CVFA 2J9GA 3TXYA 4F56A 3CH7A 1CY8A 4DUGD 3FBTA 3Q2IA 1U8EA 3SZUA 4EB0A 1ZBQA 1ODSA 4O2RA 4BE4A 4NABA 2B6HA 3EIXA 4QYIA 3GJ8A 4ZJZA 2EFEB 1EGQA 3U3MA 1VJDA 2IYEA 3B13B 1NASA 4YIHA 4PINA 4H3KB 3EG5A 3I01M 1XU4A 4BTLA 4TL7A 3TW8B 2Q7DA 4OQPA 3C6KA 2B5VA 4BVLA 3R09A 2W2XA 1YZTA 2X8AA 4IDCA 3QKSB 1L5HB 1MEEA 4JLOA 4WCFA 5CA0A 2Y1XA 2FA9A 5FNVF 4ENUA 5DTRA 4HG2A 2VRCA 5INTA 4G0OA 4WXEA 5KHAA 2QPAA 3ZNOA 3OZBA 1ES9A 2O59A 1LVGA 1L9KA 1E1MA 4WVLA 3RT1A 4CKZA 5LQKA 1CY0A 5I7SA 2GCGA 3QFRA 4TYNA 1AV7A 1ZISA 1G21B 5EOVA 4BNLA 5M04A 4U2BA 5IJ0A 4PLHA 1G41A 2LUOA 3BVPA 3JQ7A 3K1JA 4RULA 1Z3CA 4CFYA 2D59A 4Y2HA 1K5PA 2QAGA 4QYWA 5I8ZA 3WV5A 4FX2A 4C7OA 2XB2A 4DEYA 1CS0A 5EA2A 3HUEA 1FRZA 2MYUA 2PT9A 4DUPA 2GZRA 3PXAA 5A4KA 1D1PA 2PRSA 3DL4A 1NURA 1SUWA 1ZDMA 4CI0B 2HM7A 4UHJA 1N2XA 1BO6A 3GQBB 2PGNA 3HC7A 2HSEA 2CLOB 4Y2VA 1P1CA 1TA4A 1UCFA 3GEIA 5J3JA 2LKCA 3UQZA 4LXIA 5DHAA 4JQZA 1AN9A 3G89A 4JEHA 2HBQA 2NV2B 4Z8YA 2NUPA 1P4RA 4M46A 2DBRA 1EWTA 1P5RA 1RWMA 1X8LA 3EGXB 1ETHA 3AHJA 4HXGA 5AK0A 3OM8A 3I6YA 3JZIA 4Y1FA 1G20B 4E5PA 1COWD 4RCVA 4X85A 1VE6A 3NNSA 3GJ4A 4G0YA 1HTTA 2QQEA 2VNHA 1XVTA 4CM6A 3M6XA 4YACA 4HGYA 4PPGA 1GV1A 3FNFA 3GRPA 3JD0A 4ESVA 4FUTA 3VNUA 2C3PA 4O3MA 1DBWA 2IOFK 4FGKA 4LSGA 1CUGA 1PHRA 1U3WA 1EIWA 1W5EA 3IS3A 2ZSIA 1B00A 4ZV9A 3U4HA 1QRUA 2CN1A 1Y9AA 3DVAB 4HGZA 5DYYA 4A6XA 2INGX 4DNXA 1YQDA 3MD9A 2W7TA 3K4PA 1OZAA 4HY3A 2B21A 1T5IA 3HHPA 1PZNA 4RNDB 3WY9A 5A02A 4X5OA 4DPMA 4JJAA 4MHOA 4GR4A 4PWZA 1R4MB 2JFGA 1FTSA 1F0YA 4MQEA 5U4QA 4AJHA 2VPPA 4E22A 4ZJYA 4GI5A 2JG3A 3STYA 3W1VA 2CWWA 4LV8B 3DE2X 4LNAA 4J2HA 4YI3A 1EGMB 2MTBA 2ZQYA 1PR3A 1KPIA 2BEUA 4EA6A 3M4YA 1D4OA 4FEGA 3HVJA 1M83A 2FSVC 4EB3A 4H08A 3HPQA 4MJ7A 4KQMA 5HDBB 4J94A 4N7JA 1UEJA 3UF0A 1W1WA 3ZKWA 3BFJA 3H5OA 3WGLA 4DMRA 5TNXA 1P3Y1 3TF5A 1T5HX 5GGXA 3OHPA 1DP4A 2O8CA 4OIFA 1SG0A 3PDWA 3ICPA 1PW7A 1INLA 3FPBA 2X40A 1GNQA 2IIPA 5TC4A 1N6LA 3VPAA 1JBQA 1VG1A 1C14A 2IYFA 1MO3A 2CGEA 2Q3HA 3BCSA 3EDCA 3MAJA 1L4NA 3U3DA 4QT4A 3V1KA 1YHNA 2XRMA 2ZWMA 1SBTA 3CNNA 3PDJA 1V48A 3HYTA 4UHCA 5G3ZA 3SXUB 1Z5VA 2EJCA 1TC2A 3IESA 1O57A 5EINA 4MWOA 1R37A 2I2WA 3BXOA 1CIJA 2ZJBA 3T52A 1V4VA 2GJSA 1RBYA 4JB8A 1L5KA 1LEHA 1V37A 4MWEA 1L5SA 3CVVA 5DXAA 3QQPA 3X1ZA 3BMCA 3DBVO 1SQSA 2UVPB 1L5VA 3O2JA 2R2GA 2B92A 3QZUA 2MINB 1THTA 1EJ2A 2RGGA 3K0CC 3GO4A 4S04A 4B83A 2ZCJA 4IIHA 1GAEO 3TD9A 1IBKB 4K1XA 4ZQHA 4X20B 1QZUA 4B6OA 4I55A 3OEEA 1H0KA 1Y9ZA 3OKCA 1HZJA 4GZ5A 3QKRB 4F97A 2JATA 2O1WA 1QIEA 1WMEA 2ODQA 2Q0QA 3QFHA 3C7KA 4FYYA 4QEDA 4RZQA 2I7DA 5FPKA 3H2JA 1R6VA 4I5GA 5D86A 4UTOA 5IWAB 1YR2A 1XAJA 4G5YA 4HHEA 4UTPA 2F4NA 3LOPA 4IIFA 4NG4A 1NJ2A 3EXEB 1NW4A 3SIXA 3MGCA 4A82A 4BRSA 4IJUA 2X86A 2VAXA 1QGUA 3HDYA 3IEPA 4C6TB 1SUCA 4AWAA 2COEA 2BP7A 3V1UA 3OTGA 3WLLA 1AGNA 3IUEA 3HP1A 1QVRA 3RAFC 2VYQA 4F3CA 3GFRA 4XTCS 1ZBDA 4Z4EA 3AT1A 4NK4A 2BMDA 2WINI 2H31A 3VHLB 3U60B 1UOQA 4P08A 4X1YA 5JDIA 1VPLA 5H3LA 3TQSA 3VTKA 5E6SB 5L3QA 5MDHA 4B6FA 1ZK3A 1E6MA 4DCNA 1OFIA 5KKNB 1JQDA 4RCYA 4LOJA 1MPTA 2QPLA 3RTGA 2HSDA 1HSOA 4K0KB 4PE5B 2IHJA 1ZIYA 3BQMB 1E0SA 1QBGA 1XJ5A 2R6AA 1JDZA 3D6VA 3EMBA 5CB6A 5LQMA 4RPLA 4BO3A 1Z3IX 3D8TA 2O6LA 221PA 2X19A 3K0KA 5CVEA 5DM60 5KSWB 1IY8A 1VKRA 1YULA 5AK5A 3RUEA 2OECA 4LZWA 1TNDA 4OQZA 3VR5D 5KWIA 1IAVA 3VR5H 2OCKA 2UKDA 1C4XA 2BMWA 3GN2A 4QHYA 1RZ3A 1D1SA 2W6JA 4F12A 3WAJA 2XA9A 3NUQA 2O2HA 4CJXA 5F7XA 2F55A 4RPCA 2XUIA 4RY9A 1WZUA 3IAHA 3U4IA 4KWCA 4Y30A 1O94A 4KPUB 1ONPA 4MV9A 3RODA 2OGWA 5LWQA 1TMGE 3LQFA 2A5YB 2P7HA 1P2SA 4FT2A 4MIEA 1MJGM 5AQ1A 5K3EA 1YBHA 3K30A 4EY7A 4ZI7A 1EFRD 2OZLA 4G9BA 2JLZA 2AOUA 3JQ8A 1ZZEA 5C46F 3CIFA 4J4BA 3ZQ4A 4DIOA 5B2EA 1LNQA 1C0KA 1JT9A 1NNI1 3QOWA 4IDNA 1FP4A 4UTVA 2UUCB 2GPTA 1NV8A 2D74A 1VYHA 4H31A 4LF5B 3AM3A 1SPBS 4TUYF 3W0LB 3C3BA 3A1WA 3GRZA 3O3CA 1MZVA 3H1GA 1W48A 2CXQA 3AF3A 3R8FA 3ZDAA 2HZBA 2PJRA 3I72A 4TZ6A 2OQ2A 2F8SA 1CY6A 3OLZA 2QVZX 4BBZA 3ZWBA 3V4VB 2Q4EA 3OCZA 3O94A 2P1ZA 1N9GB 4R1UA 3ZZ0A 1FTWA 1Z88A 2O06A 1Q0TA 1M34E 2V6JA 3B1WA 2GN9A 4UUPA 4ZQCB 3T9FA 3V8NA 3ZNNA 1OAOA 2X1HA 1R9NA 2ODWA 3AKDA 4PZLA 2X2OA 1AH2A 2FW8A 2YWEA 3AIKA 2ZIWB 4KO8A 5EE9A 1D4ZA 3T95A 1DOAA 3IAAA 2ODTX 2C9MA 4LXGA 2Q3EA 2OFWA 2O2IA 3NVMB 3OQHA 4JA0A 2QS9A 3LF1A 4DM7A 4HATA 5JXWA 1XQ6A 1KDOA 4O4LB 5AKKA 4JC5A 5FRDA 3OWHA 4FEEA 7REQA 2O7RA 3OPXA 4R2HA 2JI4A 4MKRA 2OXIA 3F96A 3BWMA 1DFGA 5FLXA 1RW4A 2Z43A 4QUHA 1G5FA 1I2BA 1HE1C 3DM9B 1VE7A 4DDMA 1YBAA 4DREA 1EE1A 2AEMA 3HSKA 1BC5A 3VR6A 4MIOA 2AVDA 4OQXA 2Y0PA 1OJLA 1TXGA 3ETDA 3QOYA 2FHPA 4M37A 3K1TA 4RQAA 1VKOA 3PWKA 1EVLA 4O0MA 5T8KC 3FYDA 2QSZA 1WPRA 3SBEA 3H05A 4NZOA 5KCMA 5AJTA 2EHJA 3VRHA 2FFRA 2L2QA 2GI4A 1PR6A 4J6FA 4N0DA 3SVZA 4F7DA 1RWPA 3C3XA 4DV7B 3A3YA 4ZMSA 5CLIA 1D4FA 2AF4C 5PGMA 1JBKA 4WEQA 1FFGA 1N1MA 3RF6A 1L8LA 4URUR 3OOJA 2DH5A 4EATA 4EG8A 1DQNA 3OPQA 4A0SA 1RRMA 1UIMA 3C14C 3BOSA 1BWPA 2K7ZA 5AICA 3I32A 1YMUA 4I1SA 1Y1KE 1M6VA 4EVSA 2O5CA 2J9FA 1V1RB 5C7YA 1U2SA 5F21A 3W3ZB 4J0EA 1JJ7A 2ECPA 2W00A 4GYWA 4LQDA 4AZSA 4EW3A 4ITVA 2WNIA 1X14A 3L05A 1H6AA 3ESCA 4MVWA 1XEFA 2HLNA 1UBKS 1RKXA 2HLHA 1PNTA 4NYIR 3O26A 3EHDA 4ZHSA 2Y1EA 1OJ7A 3LHFA 1F6DA 3Q8LA 2XMZA 4MGEA 2GPNA 1AM4D 1R6XA 3OHMA 1WVIA 3A2MA 3KR1A 3ZQJA 3AJRA 4H1UA 3JYQA 4MVCA 3MWDA 5ALDA 1G55A 3LPCA 2P69A 1V1MA 4FW9A 4Z9AA 1VXOA 5HF8A 5E7IA 3WGYA 1LPSA 4A8TA 4ZVVA 1SXJA 3UMYA 1YJ5A 2GRJA 3GFOA 3T7CA 3KD3A 4I6GA 5EL0A 3WICA 5A04A 1M10A 1ZS9A 3FTQA 5FA5A 1XXHA 2CLKB 3X2SA 1VKHA 1RC1A 2FJ0A 3JQEA 4M55A 2W71A 5T5QA 2JNWA 3ZHUA 1LH0A 1LPPA 1ECJA 2HT6A 3FGOA 3IJRA 2H5IA 1QFXA 1NQOA 1FLVA 3DAOA 4MRPA 5DNYB 1R0SA 3O31A 3BRWD 4WPGA 4KBFA 4K9OA 3TKAA 1KI6A 5F4ZA 4FYPA 2VBIA 4UUBA 1RHQA 4RVFA 5FL3A 3IQFA 3WK5A 2CL6X 4BZQA 1NU6A 2C2HA 3TIVA 1F60A 4YRMA 4QQKA 4QWMA 1BQ4A 5JNUA 5K45A 2Y9PB 5TVGA 3WS7A 5LKAA 1II9A 2R60A 1JHDA 1H85A 1NBHA 3BWEA 3G7SA 4RLFA 4KXVA 5D6OA 5GPBA 5FAXA 1S6YA 3A6FA 4UPEA 1CJSA 4HJXA 1G8YA 5M29A 4KGZA 1ADCA 4M9CA 2HRZA 3E27A 3VHQA 3JS5A 1UH5A 3LY7A 3NKVA 2BMJA 3HCCA 5LQAA 4Y6LA 2E2WA 1IHOA 5ALHA 4S3MA 5F2NA 1YASA 1W88B 5ED4A 4FEAA 3D6TB 3IXLA 2V6FA 1FX0A 3O21A 2NVWA 5DM70 1UADA 3BMNB 1KU0A 3NIDB 4OQEA 3TOVA 3U4QB 2ODEA 4N8EA 4EB8A 1Z0KA 4AP6A 1ZCAA 4WY5A 1N5LA 3KHTA 2PZJA 1Q0ZA 1UBJS 4QTXA 1Z2AA 2PWZA 4LVNA 3KIPA 1GT6A 1YZGA 5TJHA 3TQIA 4K03A 5CNKA 4EDHA 5LDGA 3HEAA 4JB2A 1PIWA 3A4LA 5ICFA 4Z7NB 4YQZA 1KJQA 2PEZA 3N2YA 1DEKA 1JXMA 2VOJA 1T0HB 1JR2A 2J09A 2WPDD 2YRXA 4HPWA 4L4YA 4QQFA 4CLXA 1E1QA 2VF4X 4IUDS 1LQTA 2QYTA 1CVLA 3CGGA 5ECGC 1PGNA 1ACJA 2Q6OA 2EW2A 1XNGA 2PD6A 3A1FA 3AR3A 4RO0A 4BFTA 4AD8A 1UP4A 4DRXB 3GLGA 3PC2A 2VDPB 4TRRA 4EEKA 3TLBA 2O9JA 3UG6A 3QRWA 1ZGCA 1OC4A 3NDRA 5KSZA 3VNSA 1B6SA 3OLXA 1GG2A 2R751 3MLAA 4I2NA 4KVZA 4W6QA 1ZVMA 2R6DA 3G2QA 1X9GA 4NNOA 4PYKA 4RVGA 4IZOA 1TK9A 1XZCA 1KJNA 2WAAA 1Y5MA 2CK3A 2DWUA 2O3UA 3NALA 2O7VA 5CYFA 3RROA 5AHXA 4F4CA 3EGOA 1DO0A 2HEGA 2ECQA 2N0SA 3CN9A 2FPIB 3AU9A 4NVRA 5ERGB 4PHGA 3KYCA 1YRYE 4EHDA 3TTUA 2PO7A 1B1AA 1RXIA 1H1LA 2G4CA 2P3SA 2RK6A 2VCEA 2C03A 3BMXA 1GGKA 1PVOA 5FR2A 1U3GA 1N5JA 1ZH0A 2ONJA 1G18A 1S3GA 1XRJA 4IQ0A 1O95D 4CM8B 4BN4A 4V1CB 3VJKA 3C8MA 4Y2TA 3IIEA 3OX3A 5FL7A 1JA0A 1LDBA 2YFHA 4EECA 1Q22A 2G5TA 4TTIA 1Z5ZA 1T35A 3CLTD 3AG5A 5DTMA 3V48A 5KNBD 1JPVA 3JPWA 3SKXA 3CSSA 3DDOA 4LMRA 5KNBH 4IAOA 2O3JA 4LOHA 2RGYA 4RMHA 1QVAA 1UK8A 1PJAA 3O4JA 3S5JA 1E9BA 2AE2A 3E22B 1CUVA 4G3XA 4KMRA 5KTRA 3SBDA 4D0RA 1OA0A 3VZQA 5JOQA 4LKRA 3SQXA 3O4HA 4EKIA 2HFKA 3CGWA 1I4WA 3LTNC 1CUXA 2ZFUA 4UHKA 4FMDF 3WB1A 1VPVA 3ABQB 3QUAA 5AKZA 1OVMA 2C3YA 3KXKA 1SVKA 1KYVA 2P9EA 3C1UA 1Z56C 3KPVA 2GK7A 3DO6A 3EVEA 5H8WA 3KDSE 1DMSA 1K5HA 1ZJJA 2BPOA 2G9UA 2XHZA 3IC5A 4FHGA 4H7DA 3RLIA 4M9XA 4BNGA 2XY4A 2PD4A 1FVOA 2BFFA 1HT0A 5C1IA 3O82A 4YC7A 4QOGA 4CTNA 4EGSA 1YAJA 1FY2A 1NYTA 3GLFE 1NM5C 1GPUA 3IVMA 4LJKA 4I5IA 2DVMA 2P9HA 3GV0A 3NZEA 1DIHA 3DL0A 2CMFA 3BAFA 3CA8A 4RL6A 5DGTA 3TINA 2YKGA 4X0EA 4RA9A 3EC2A 4YAUA 4O4IA 2QTWB 1T0BA 4B3TB 3ENNA 1T2CA 5JZBA 4D8WA 2QVXX 4YMLA 1XLTC 2F1RA 3QWBA 3KQPA 4PXSA 4B6EA 3HI4A 1P62B 2I7TA 4WKPA 5AW5A 5C8YB 3FI0A 3GLKA 3PZBA 3I37X 5C1BA 3OHSX 4DNPA 3FKSD 7AT1A 4FPXA 1VRCA 1ZEJA 1YQGA 1LLDA 2N47A 1ISHA 1ZW6A 3T3IA 3I9KA 2GZMA 1EWKA 3HJNA 1XNRB 1QH1B 1MHPA 2GZDA 3IO3A 2FTKE 1UPUA 1B2LA 3Q3IA 5IVIA 3R7BA 1Q7RA 2XMDA 3RVRA 2B5OA 1GQOA 5P21A 1M3SA 5AW1A 1TM2A 3WWDA 3PLRA 4FDUA 1JLMA 4C08A 4V0MA 5CT4A 1MJ5A 2J3EA 4IHJF 3WNZA 2HV9A 2IUFA 1DXQA 4DA0A 5AXBA 1M2OB 2LKDA 1WM1A 1YSCA 4L28A 1NPYA 1XRNA 4GQAA 4EHLA 5AW7A 1NBMA 5ALVA 2YTZA 3JAMA 2OZVA 4RU1A 4GMXA 3L0BA 3JQQA 1KOLA 5LYJA 3B6MA 3RUHA 4J8PA 1M73E 3ZHTA 1U3UA 1Q14A 3KTFA 3TQCA 2DPYA 3TK1A 2VP5A 3GCZA 3PENA 3QLVC 4ZPXA 2ZDGA 2DUJA 5JSZA 2C20A 4ER0A 1Z25A 1IVNA 2QYOA 4KXXA 3GU3A 4MDEA 4QM7A 3M9XA 2XBMA 2B69A 3A6PC 4LUCA 4NZNA 2PX6A 5JCOA 3KKOA 3KQOA 2YVKA 2GUGA 3O6VA 4O2BB 3S7TA 3ITNA 5KVQA 5K5EA 2IEYA 2Z08A 5F5XA 2J3QA 4RTRA 3FCXA 2VTEA 3QOFA 1U81A 2G1PA 1RJGA 3AVPA 3OZWA 1UMDB 4ENWA 4KR6A 4LHEA 4QT0A 4ARZB 1NLFA 4FYWA 5EVJA 1LJUA 3HCEA 5COBA 1X7GA 1JMYA 3PDUA 3Q8WA 3ZXIA 1L4YA 3UXEA 2GFHA 1GNRA 1RHMA 2Y99A 3G8YA 4C5AA 2UV8A 5IVKA 3OQVA 1U8ZA 4B40A 3H9GA 2OHVA 3F0TA 2BAGA 4D9JA 1SBIA 1L7AA 3M3HA 1XCGB 5SV2A 1L1QA 3D02A 4QFBA 3H83A 1L4BA 4RE5A 2CV0A 1CZKA 4MZDA 4KLCA 4BNMA 4FEYA 4GPBA 4WOJA 4ADSG 1G1MA 5CB8A 3KQYA 1M0EA 3F46A 4IHQA 3TYXA 4Q7JB 5IUNC 2ZT6A 1DWOA 5K4GA 4DBZA 1FP2A 4QBTA 3IP3A 4GBGA 4RGYA 1L5OA 2NQTA 4DQXA 3C97A 4WMLA 3RRJA 3O0TA 2FR1A 2NU7B 2O2CA 4D1YA 3DYVA 1BS2A 1MGOA 1ZCJA 2C78A 2PX0A 2VR1A 2XYGA 3DC7A 3IGFA 4G4SO 2IFTA 4LEIA 4BL5A 3JAWA 2WVHA 4LNUA 5ICEA 2VQ6A 3AFNA 5AIAA 2O1XA 3V97A 5A1TA 1O0CA 1E1RA 3R3WA 3KLMX 1QDUA 2YHSA 1BVHA 2O2EA 1W29A 1LF0A 2R8XA 3WIDA 3CRRA 5E9JA 3OO0A 3NTLA 4IY1A 5ES4B 3GLHE 4IFIA 3PNYA 1DJMA 2B9VA 3PI7A 2IYSA 3R44A 1IFXA 2BKUA 2W43A 4MV3A 3KTOA 5CLQA 4EGAA 4B09A 5BURA 5IEBA 4HWGA 1SHZA 2JDIA 3HO1A 4CQNA 1SQGA 5DRTA 4LJ4A 2A4MA 2DKFA 1DJOA 1N6NA 1QLHA 1R0XA 3LGSA 4FCVA 3D1JA 3UW1A 4RKYA 3UFBA 4JV5B 3VR2D 1V45E 4EJSA 1K89A 4BQOA 2Q5OA 4A10A 3U4GA 4YREA 4BWGA 4LDQA 1NMEA 3TJMA 3KVRA 1X15A 1DGQA 1JVSA 4DMUB 2NZXA 3JYOA 2HPZA 3UAWA 5BV0A 3ESXA 3VHXB 3CONA 4DR1B 1U3TA 2XXAB 3SZRA 3AVUA 2RIRA 1J07A 3GLIA 1SZDA 4MPJA 2PMWB 2QN2A 3UBMA 3L41A 3QVMA 3WSVA 9GPBA 2BWJA 2WF8A 1WXFA 2Z2XA 4X97A 3WGOA 1U0SY 4PICA 1ZUIA 1DG1G 5HZGA 3AY3A 2PGOA 4GI1A 2BFEA 1UM9B 4Y2PA 1TCCA 1PDVA 2QSYA 1L4EA 1AKEA 1XOIA 4HUQB 3JSAA 3WGJA 4DLYA 1K88A 3IE1A 2FWNA 1OB2A 2OK7A 3G6KA 5LSAA 1HRKA 4MGZR 3FR7A 4FVTA 3WLHA 2PLNA 3W8DA 4W5RA 3DXYA 3HB9A 4EW1A 3NRCA 3C5CA 1G4AE 2EL9A 2VT6A 4AZ3B 4RVSA 5FFFA 1P9LA 2XKAA 4LC1A 5JNLA 2LWIA 1QRRA 1VJRA 3H8JA 3HN7A 4UUAA 4HEQA 1XAGA 3S68A 1Y9DA 3LHSA 4CF3A 4BQPA 2ZUSA 5FNZA 5FUBA 1XDSA 2DCUA 4UCWA 1BQ3A 1CB7A 3LPNA 1TJYA 1YOVB 2OHOA 2ZYTX 4QEZA 5IH3A 3VNBA 2GXUA 2Z1NA 4PZ9A 3U1VA 4CMAA 1QE5A 2J7PA 2RAFA 4M38A 1IEQA 4L2IB 1M7GA 4EMSA 2YJNA 4MS4B 4Q12A 4LJRA 4F96A 1UBGA 4FGSA 1GAXA 3RAPR 4Q9JA 2NUTA 3THSA 2I66A 5HR5A 4I9FA 5F73A 2Z6AA 3RVLA 3HUDA 3H5AA 3NVDA 3VYRB 4PFQA 4MKGA 1QZ3A 2AC7A 1P72A 1I5RA 1ZN9A 2Z2YA 4LY6A 2Q8QA 1XDGA 3KKQA 1P77A 4PNZA 4WTOA 1YR3A 2OY0A 1FSZA 1FQWA 1Q83A 4NBLA 2Y71A 1SXPA 4F2PA 3MW8A 4Q7KA 3DMNA 3RRBA 3RRNA 4BWFB 2GASA 2HCRA 4BLOA 3QE4A 4M0FA 1JR3D 1IPHA 1USIA 2FWIA 3IX7A 2OILA 3W6NA 1JZSA 4B85A 4KVAA 3UK2A 1SHJA 3Q3VA 3TD2A 1P4JA 3Q3HA 4IEEA 3AUJB 3C3AA 1EX6A 1IRXA 3U7FB 2Q5EA 4EJFA 3F6YA 4G5RA 3P4UA 3IKJA 3WISA 5FOQA 1KRXA 2IHTA 3UPDA 5LUAA 4FZVA 4S2UA 1QH8A 3DBLA 1CJTC 1F0KA 4LZOA 4Z3DA 1PK7A 4TTJA 3ZPXA 2F3SA 2R5NA 5DM2A 1R4ZA 1EQ2A 2IGBA 3F2IA 4OPMA 1ZKMA 4RTJA 1KRWA 5MFPA 1R6UA 3WBJA 4TWRA 3PNQA 2VEOA 2XDYA 3CZRA 1AGXA 3CLRC 1CR2A 2GXQA 3E2PA 4R31A 4B2YA 3I12A 3ZWMA 2CB0A 4EMUA 3I9V6 4B6GA 3KQMA 5JC1A 3Q11A 3CNEA 3DC2A 3RABA 3T9EA 2VVTA 4M0CA 3GGCA 1PUXA 2AN1A 3U6BA 3K6KA 1QU3A 4L6AA 1EGHA 1DCKA 2FLKA 2DFLA 3PKIA 4I9HA 4PBRA 3B38A 3UEOA 1MQAA 5KTOA 1TA9A 4ZODA 3AY6A 1K06A 3JQRA 3OIWA 1RKVA 2VHZA 2VYNA 3BORA 2AUTA 4GWKA 2H0AA 4B3IA 3ZHVA 2E55A 2GN6A 4BKRA 4RXUA 3P9PA 4RETA 3KQWA 3L0IB 3NP9A 1N7IA 3HA3A 3JY6A 1YVEI 3A9CA 4GEGA 1JAZA 4L57A 1E2NA 4GPEA 4MWTA 3HKEB 4YJ2B 3G1TA 1OV4A 2WHPA 1F1JA 3T1VA 4BYMA 4YMTA 4YCNA 5DHRA 4Y1RB 1KZGB 4C03A 2GSDA 4IDHA 4PGFA 4BTEA 1F8UA 1L9XA 3H7IA 4ZVMA 3CZAA 4P53A 2PT5A 1P9OA 2PYDA 3NX4A 4BXOB 4KR2A 1AA9A 3FKJA 1UKAA 3GCGA 4LFAB 1CYDA 3VZPA 2VSNA 3FSGA 4XW2A 3STVA 2G9ZA 4Z9XA 1ORWA 3MVEA 4ARSA 1JE0A 2ASEA 5CDUA 1PVVA 3RANA 4YEDA 3VYUB 3D5EA 4Q3NA 2NXNA 3UHAA 3UPTA 2WU8A 4L4RA 5E6RA 3KB1A 5J5AA 4BBAA 4RHEA 1P73A 1OXSC 2EARA 2YH2A 4BEWA 2JLVA 3EZFA 5ALQA 4LF9B 1CJKC 2B8JA 2BRUA 3MWFA 4A2CA 1O97C 1LSJA 3HU2A 4EQ6A 3EZYA 4HDCA 5JAOA 1CUZA 5BNIA 1XX6A 3UHPA 2IU3A 4KITB 1HLPA 1LI5A 1QJ4A 3A9VA 3KYJB 2AOTA 4XYMA 4D8YA 4EAAA 2WYWA 2NT3A 4GKBA 3WQRA 5AM2A 1SUPA 3REQB 1G5TA 4RELA 3L3BA 4DM4A 3LZDA 5A4AA 1U7XA 2RHJA 4Y6SA 4AQYB 4KK3A 2ZTHA 5IMSA 3E9DA 3FRIA 1S2IA 2GOYA 4NHOA 4YCAA 3V8VA 4FYXA 3VSCA 2P9YA 5EYPB 4I50A 2W6OA 4OFXA 3VO2A 4ZZ0A 1KJJA 1DJLA 1VPDA 3DZCA 4IIVA 4AS1A 2GVDC 3DTVB 2MSKA 1RE0A 1AKMA 1BXKA 2C9CA 1NPDA 5JW6A 2JEYA 3W2EA 4GO1A 4U2CA 3WL5A 1HYQA 1HXHA 1FBNA 4NE7A 1UBLS 2BI4A 1I1QB 3PQ6A 5ALXA 1RPTA 5TQ2B 3SAJA 5JBQA 1SKQA 3WMWA 3I8XA 5KMGB 4A2PA 1WJGA 2ZJ3A 2H0QA 4AULA 1I4TD 2H48A 3OIUA 1FFXA 3VX3A 5ADUS 4DV5B 4NFSA 3P94A 2PZEA 3FDIA 2A9JA 2GDJA 5IX8A 1L4UA 2J41A 3HUUA 1CVIA 2G4LA 1KKUA 2OOSA 3L0ZA 3PTLA 1A2BA 5KYUA 1KMHB 3ZJUA 3QXCA 3WV4A 5ILOA 1AQUA 2YOFA 2OORC 4N40A 4PYIA 3TLAA 1B26A 3PKJA 4RK1A 4O4LF 4RMNA 1BD4A 5L4SA 3NC4A 3DKKA 4C4ZA 2D06A 2FHSA 2PUWA 4JFRA 3URMA 4AO6A 5JJKA 1I6WA 2ZI7A 3RIGA 1EXNA 5F9HA 3CKYA 2ZTSA 3A1EA 4NAVA 1Z26A 1M6EX 1A9YA 3HP7A 2FN8A 2GAFA 1PS0A 3EUAA 3GRRA 2QRUA 4M6WB 2R11A 3FUTA 5DVZA 1GZDA 3SQLA 2E4YA 5KUTA 4P6VF 4ZEMA 3MNFA 2DZDA 2XPCA 5K3CA 4OM8A 2ZR9A 1BE0A 2SBTA 3ND5A 3Q6IA 1JWAB 4KE8A 3LA8A 4OP2A 4BO4A 1U5CA 2I03A 2WU1A 4KBYA 1JVBA 1C7RA 1N2CB 3HU5A 4RHTA 1ZC3A 4XGNA 4MB6A 3O8DA 3SHWA 2IXAA 3NBQA 5DNCA 4DS3A 1TAQA 1DRJA 2SCUB 4WFQA 4C20A 1QS0A 2B94A 3PUIA 2WWRA 3B7PA 4DKXA 2WP0A 4N6OA 3C8ZA 1WZCA 2NYVA 1B76A 2ZRIA 3OC0A 1NMSA 5FCDA 5FPPA 4F1KA 1QVZA 3RG2A 3NAQA 2H1RA 3Q3GE 1QHSA 3R2JA 2V6GA 4EGQA 3OZAA 1XMQB 1UUFA 2PTGA 5T4BA 1DCMA 1UKEA 3EMDA 1DFHA 3I0MA 1QG0A 1U65A 4EFMA 4JUDX 4BUCA 4Z4HA 1F7UA 4CETA 4BLQA 2IPXA 3W2IA 2P9GA 3LYLA 4MVJM 5L3SB 2QW8A 2QLFA 4DLLA 3FPAA 2GM5A 1JEOA 2M98A 3HDHA 3ROPA 2SHKA 2GAJA 2FPPB 4JYPA 2VF2A 5KSPA 5L7YA 3NHMA 1T2UA 3ZZMA 1OFGA 2WUDA 2VHXA 4RANA 3ZWNA 5A7HA 5CX1A 4DFDA 2IV2X 1Q0LA 2PGXA 2WUVA 3OZXA 4DAEA 3KZKA 4TS3A 4QQRA 3BJMA 2YV4A 1SUBA 3PRJA 1ITZA 1NVXQ 4NBSA 3VMFA 1C1DA 3DUFB 4YHBA 4XKJA 3U6KA 2HCTA 1FMCA 1ULSA 3K1YA 2IZ0A 3LRPA 3ZZUA 4ZIRB 5DOVA 2MSEB 1T5SA 1OPXA 1I13A 3E9RA 3RS3A 2BM8A 3BB3A 4AZVA 3LAWA 1O03A 4ILEA 4QQ8A 1NMQA 1JMVA 1WWKA 4KNWA 4YAKA 3M3PA 1R2QA 1ZWKA 2FSUA 2Q4TA 4ZYXA 2OFPA 2Q5FA 3BGOS 5BSRA 1X1DA 3A25A 1Y7HA 2H2WA 4IRXA 3UC5A 5LXTB 4E2WA 3H2KA 4OHXA 3T1HB 1EAYA 5EUQB 5LA6B 2XWBF 1QCYA 3GDOA 1F8FA 2RHWA 4IG9A 2WWYA 1MC1A 3FOZA 3ER8A 1PJZA 2ZTLA 1WBDA 3JQ9A 4D4IA 5CDHA 2ATCA 1I32A 2O0MA 2Q45A 1XYVA 1Z8HA 1OKKD 3I9OA 4DLKA 1PT8A 4FS8A 4QSMA 2JFYA 1G2IA 2PL9A 3T9CA 3Q3JB 3QXGA 4JBLA 1TM4E 1K97A 1XUOA 2JGDB 1FIUA 4BMVA 3RW9A 3T5AA 4B32A 2ZK7A 2IVZA 2OHJA 2NADA 3AP3A 5U9CA 1AMNA 1GRRA 3L1IA 1D2NA 3PA6A 1TCBA 5FBWB 3RS2A 2N1BA 5ADWA 3ICEA 3I1YA 3LOUA 1PV2A 1P74A 2IA5A 3M5WA 3EQ9A 1XGKA 2PUFA 4HLDA 3DZJA 3KT8A 2KW5A 4UEKA 4GRDA 5FV7A 4BECA 1II8B 3NORA 1BU8A 2PLAA 4JC8A 2A58A 1QQ7A 4GOJA 4HOYA 1EFAA 4MQFB 2PYIA 4Q0MA 1IXKA 1AD2A 1NR5A 3LT4A 2WSYB 4FZRA 1E3SA 3P4YA 3T1OA 2YXPX 1E6KA 5CH5A 3WLSA 4A16A 5TF4A 4BJHB 3ZLUA 2FW9A 2P2CA 1CUEA 2R85A 3M3DA 3UJNA 3D64A 2I2XB 4EA9A 2R00C 4PW0A 3AUXA 4QPDA 4B76A 4JJ4A 4RLSA 4DILA 1G63A 2DFVA 3ED5A 3I0ZA 1U5BA 3K32A 2NVUB 1BS9A 4F5EA 4GOKA 4PLCA 4RPKA 2GFIA 3DBRB 4TKUA 4QXOA 2AN5A 4MVJH 3FNEA 4OI1A 2LDBA 2FI1A 2WF6A 3WLNA 2PFKA 4XDHA 4HBZA 3EVTA 4LYYA 4DXHA 5FUWA 1QHNA 2ET6A 3GEDA 1A7AA 2XODA 1E6LA 1RPAA 3D6AA 1C0EA 4I99A 4RIFA 4Z7OB 1UDAA 1T6YA 2ECKA 4AKGA 3P9IA 3WB0A 2EF1A 4IIGA 1BCRB 1LJLA 1CZLA 4CKEA 2HSGA 4L8YA 4MW1A 5KVVA 2FZGA 1BE8A 1QH9A 2QJTA 1U0LA 5AI0A 3ESZA 3WG9A 1FCJA 1O9BA 2MYPA 3VPXA 4BVGA 4MV1A 3FUUA 3G2NA 1UINA 2YFYA 3KNZA 1BMFD 1EFLA 4IGKA 4PRLA 5KAMA 1G8FA 3H3JA 4UATA 1GCUA 4M22A 2V7QD 4Y6RA 2RFLA 2V7VA 3ZI4A 1RXVA 4GKJB 2E1PA 3IOCA 1XMXA 1ZVQA 1OBVA 1OW3B 1TK2A 3QF7A 5D6NA 4EEXA 5DIZA 2J9RA 1NZFA 1XF9A 2XMGA 3DTTA 4JS0A 3NEAA 1N6OA 3FG9A 1WLSA 4M4SA 3V9PA 2ZBVA 1JXAA 1N9KA 3PP8A 3R6DA 2WU4A 3H3XA 3NVAA 3U3XA 4J0JA 2W2LA 4JI6B 4BQRA 1QTQA 1NJ1A 3PHJA 4HAIA 1PS8A 2X4IA 2FQQA 3J81k 3QWAA 1W581 5CCEA 2FVYA 1AGYA 1ISMA 4INAA 2V9PA 4QEKA 4LFCB 4D98A 3CYFA 4A26A 1C30A 5A9RA 3OY7A 1PK9A 3S99A 1A77A 1PL7A 2WTEA 2B4YA 1T3SA 3DAYA 1L5LA 4B3HA 4Z0PA 1X7YA 1Z34A 4QOFA 5ILGA 2CDBA 2HA4A 1CSEE 2XTNA 3ZWVA 1CQZA 2I34A 5BSUA 1JAIA 3O9VA 5DGHA 3V2GA 2NV6A 5HX7A 5AO9A 1JG1A 5A0TA 5FBVB 4FM9A 1IVYA 3C74A 5BR7A 2J9ZB 1LDGA 2O8EA 4UXIA 4RMIA 3JVVA 3IR6A 1M1YB 2QMZA 1OF1A 5IYZA 5JWOA 5IUJC 3THYA 3KSDO 1XN1A 3NU1A 3UAVA 1V11B 1KVQA 2DSNA 2Q5QA 4EGFA 1L7EA 3FDXA 5SZIA 3KWMA 2O7NA 4WT7A 4URVR 2A5GA 2GCOB 1K3FA 1JGTA 2C96A 3H11B 1QYVA 3D3WB 1YQTA 3HCDA 3NONA 2QY6A 4J0IA 4JWTA 3KQNA 3SMVA 1G60A 1GILA 2JASA 2RKOA 3BMQA 3QEJA 4NCIA 2D7DA 1DAPA 3SP1A 4ZC1A 4RK0A 5LR6A 2FPLA 2NW6A 4WZAA 5FBQB 4AG6A 4DA6A 4OI0A 2EQBA 3PD1A 2WSIA 4J9VA 1E7SA 1RXEA 1WDLA 1THMA 4B31A 4YROA 4C6HA 1H9BA 1YH3A 3FAZA 4BNYA 3AEXA 3IDAA 4DKJA 3VNAA 5K0TA 2Y0CA 1AGRA 2PSDA 3L8FA 1QG4A 2Z5LA 2WHQA 5BQOA 2FW0A 3NHZA 1DIGA 4Q3BA 2OO5A 3NJRA 2IDKA 1JIJA 1NDHA 1L8XA 4W1SA 1RJWA 3G0BA 5E38A 1KY3A 2AI1A 4WOBA 4A8PA 4BV9A 4BNDA 4F2WA 2QSJA 1B6RA 4PBSA 1YR8A 4HGPA 4JLJA 4ER7A 5JATA 2P67A 1N2SA 2MYTA 4WE3A 2GXAA 2PLFA 1JDBC 1BDMA 1PAUA 1ZP6A 3AR2A 5LU8A 3UGTA 3T7RA 4RX1A 2KX7A 4QBHA 3HDGA 2ORIA 3U3JA 5KWVA 3CWQA 1QBKC 5AVJA 5JDIC 4E7OA 2AHOA 3FLEA 4PIPA 3UJ6A 1MHTA 1HL3A 3PPWA 4XYBA 1XMIA 4NV3A 4Y2UA 2FP4B 3AWDA 4R7GA 1E18A 3AUAA 4CV3A 5HSGA 2ZQ5A 5KDLA 4A6PA 2II6A 2X2EA 4O2BF 2Y1KA 4C4OA 3MBOA 3BIXA 3E2IA 3E5HA 1CQJA 2EWVA 1LV8A 2FEKA 4L51A 2A2ZA 2BBWA 4XPIA 3CG0A 4ZKDA 3E7PA 3GLTA 1XTSA 3K70D 1AMUA 2QD1A 2EX0A 3FDZA 4Z1MA 1XEXA 2Q28A 3Q2KA 2R4UA 4IPTA 4O5AA 2GT1A 2C2OA 3GC6A 4D92A 5J2TB 3L4BC 3V5NA 5HKKA 1CUJA 5MGNA 2H08A 1H0RA 3I83A 4P86A 4L78A 1A9QA 2PR2A 4P7JA 3AI2A 1K2WA 3EW9A 3FI9A 3P4XA 1QX3A 4UJ3A 3AM1A 3MWEA 4US1R 1ZIDA 3GFVA 3QE9Y 3LMKA 4EO4A 2OAP1 3ABRB 3ON5A 4UXHA 4DCPA 4JXJA 3VU9A 1YNOA 3GARA 3F6BX 1SCNE 3G9XA 1DCFA 2RGNC 4DIFA 1NUUA 5I4CA 1G2PA 3P8ZA 2YWCA 1A1SA 3RV4A 5C0OE 4C29A 1QU2A 5CDSA 3T1NA 2QVYX 3UT6A 1OB5A 2ZRHA 2CMDA 1Q3KA 2PWBA 1PV4A 3FDJA 4TYYA 3NUGA 3IKLA 4JQOA 3CH4B 1RZUA 5GZ6A 3TMAA 5IF3A 5JH7A 5K7SA 1JNXX 3IXQA 1QPGA 3CC8A 3WGUA 3DJFA 4GPZA 1J56A 2P6UA 4LYEA 1R0BA 4KR3A 3BIJA 3TB6A 2CD7A 4C0JA 4RLQA 4MUJA 1DJPA 3EC7A 3T3HA 5BSGA 5KSYA 3N5CA 2QPOA 3PWZA 2AQHA 1FW8A 1QJCA 4ZQGA 1RTTA 2PXXA 1FU8A 1YB6A 1IL0A 4CMGA 5BRJA 1D0VA 1USGA 3SMQA 5I7RA 4U7DA 3ZK9A 2Y1OA 3OKAA 4HAYA 3SY8A 2ENWA 3DGEC 1KZ9A 1GTMA 2YWRA 3ER6A 1R7RA 1ZJYA 3LXRA 5DTQA 3BCUA 4YP7A 4P83A 3F5FA 4U2DA 2V45A 4ZDKA 4KKVA 4AURA 4MMXB 3AF6A 1RQRA 1GSHA 1OZGA 2VRWA 3W3AA 4G23A 5SICE 2IITA 1ZOSA 2GCNA 3OLQA 4CL8A 4XTRA 2QM7A 3K4HA 4UBJA 5B7PA 5JD6A 4TMYA 1ST2A 1M2VB 3C15C 4A8HA 2X5OA 1ATZA 3OC6A 1BGWA 4URWR 3AEQB 4LXQA 3HKBB 3R9IA 1NW3A 2FVXA 2EZTA 4G5SA 1EFVA 3PC8A 1HDOA 2NUAA 4GXNA 1Y3FE 4F04A 4B9EA 2ONYA 1M6WA 2GBFA 5FO1A 3T4EA 4O4JA 4DIMA 1H3EA 2PQ6A 1ZSVA 1OASA 4TV8B 4WCFB 1NJ6A 3A36A 1P5JA 4UM5A 3REFA 4ZXPA 4OBEA 2PUTA 1NR7A 4YP0A 1N5IA 1XSEA 1S7CA 4R3UC 4KUEA 2NO9A 4GG1A 2I9PA 4IDAA 4QO8A 4ZXFA 2AN4A 4F6CA 1U2PA 2ZJ7A 4S1TA 1E77A 1A9ZA 2BDTA 2C9YA 3EBOA 2OM6A 4V3BA 4WOCA 5K3FB 4IFTA 5KNDD 4JI7B 2J3DA 1GZSA 1HYEA 3DF9A 3BFXA 4DLRA 1FTYA 3NR2A 4I36A 2PZLA 4CLHA 3C7DB 4GX1A 3P27A 2NU8B 1NI4B 3WRYA 3PNLA 4J3FA 2ZAGA 4WXYB 4GL2A 1Y6QA 3VO1A 1IY0A 5LUBA 5AOCA 3THWA 3CMCO 3R74A 4DR6B 1WU7A 2HU8A 2J87A 2NTEA 1TYAE 3BPSA 3TZ6A 4DLTA 3HJCA 3THXA 4RDCA 2QTBA 3BTUA 1DIAA 2IW1A 3QVXA 4J7XA 3RIYA 2J1LA 2L42A 4N76A 2COUA 2QUHA 1MNAA 5G53C 3ADBA 2WI8A 2Y6UA 3B89A 1I6LA 3DWEX 2HMTA 3OEHD 4OU5A 2HJRA 2R7LA 3DLHA 4UW9A 3OFND 1Y6GA 4KPEC 2C2YA 2LNDA 4RADA 1CEEA 3ZHSA 1VLVA 5ULLA 2W4QA 3C24A 3PE6A 2ZUUA 4NJEA 4AKEA 5HFJA 3S8EA 1JAYA 3A6ZA 2AKYA 2F17A 2X77A 4NQZA 3FYUC 5JPIA 4LHZA 3G85A 5G4KA 4R54A 3ZK7A 3KBBA 1OSNA 2EQ5A 1LGYA 1WUKS 2YS7A 2MHCA 3O95A 1G21E 4ATNA 2PZAA 3D2BA 3CLSD 5L9AA 1R3DA 2Z09A 3B70A 5G0VA 1TTTA 1ZD1A 1NRJB 2N46A 2NZVG 1AE1A 3CMMA 1QPBA 1Y34E 1RI2A 5G0SA 3RC9A 5HM8A 3TOSA 3C4JA 3WNBA 4K6OA 4ARUA 1EESA 4JSRA 2CJWA 2VXOA 2ZBQA 2FZWA 2P2YA 3DVLA 1J5XA 2HSWA 4Y6GB 5CA1A 5B6PA 1HO3A 4RWEA 5ALRA 3EY9A 1SU8A 5IDWA 1I1NA 1RBQA 4LDNA 3EFOA 3I6BA 1R10A 4YAEA 4N5HX 1V9CA 2A9QA 1DZ3A 4Z4QA 1DB3A 2R6FA 1N6PA 4PXYA 1NPTO 2VCYA 1PBTA 4LG1A 3TN7A 3GNTA 2HGZA 5I51A 4LGVA 1GAWA 4RH0A 3AJEA 2JFXA 3GVHA 3PYLA 4NECA 4WLEA 4C76A 2O3SA 3S2FA 2XGOA 1K86A 4QBIA 2R1TB 4K6KA 3SLGA 3AR7A 1P7PA 1P3JA 2P11A 3FPJA 2FN7A 2J31A 2C59A 1JSRA 4J1QA 1JALA 1VZ3A 3G5UA 1WCIB 4CQJA 1U9CA 2EDCA 2CXRA 4IDQA 4XEHA 4UFOA 3FPFA 1ABBA 1KRHA 2I3ZA 4PYMA 1QO0D 1RLIA 4LVCA 4YJ2F 1Z2OX 3EG9A 3WLRA 5LQDA 1XD2B 4NH0A 4A36A 5DW3A 3PD0A 5EZYB 1A97A 3QFSA 4N0MA 4ZFNA 1HSZA 4ZO6A 1D1TA 3BJEA 4PY2A 4REMA 1U0EA 3RJ9A 3UMJA 2ZRPA 3CEMA 5FTKA 3JR3A 1HFEL 3LPLA 4LCBA 1E64A 4LAFA 4DJ5X 1REQB 4V0OA 2RG7A 2VUUA 3OKFA 3LBIA 5JQGA 2AZTA 3D6MA 5AHOA 4NE2A 1EH5A 2HO5A 1SHUX 2I7VA 3EDRA 2A1UB 4OEHA 1GRNA 4B84A 3QVGA 5ALSA 2Q21A 5KO2A 2R25B 3X1YA 3OKPA 2P3QA 4HEA6 4CIDA 3GRCA 4R51A 1H2WA 3DOFA 3AVWA 2D2XA 3N7UA 5I45A 1CEXA 3RRXA 4BO9A 3SG0A 2OCYC 4HDQB 2GYVA 4YJFB 1L8OA 2KS6A 2XSZA 1MDBA 2VP3A 3AUYA 3G9QA 3MWYW 3LXMA 3LQ1A 4KQKA 2Q6LA 4UM9B 4BGUA 5L6LB 1VHJA 4MW6A 3TSAA 5ESWA 4CTOA 5JXHA 3SXPA 4XJTA 2WFZA 3MYYA 4JHXA 4F4DA 2ZZMA 1XEWX 3PICA 3BQNB 2L17A 2V03A 4JUCA 1KJIA 4HDAA 1CQWA 1BEEA 1JUDA 1ZJ6A 2VKQA 2RH4A 4B0PA 1SJ9A 2EBHX 2ZB2A 4IJMA 2RAVA 2FJPA 3PFGA 3L4KA 4HMPA 2LCFA 1BXRA 2C4WA 5HW0A 1PQYA 5EUMA 4DLSA 1MG0A 2G9RA 2QQFA 1XO1A 1H4QA 1Z13A 4BO8A 1OLXA 1RJDA 3G82C 1JEYB 3TSOA 4INPA 4PRZA 3F7MA 2R84A 1LDMA 4LJSA 2GBPA 5HFAA 5H5JA 3PX3A 1MD9A 2G5PA 4RZXA 3SZGA 4ZEXA 2WHRA 4FWTA 5F5NA 5LNK1 1D6MA 3H6GA 2XUPA 4FR5A 2O50A 4GHWA 4K05A 4R1TA 3UMSA 1NVGA 3FTDA 4XQ9A 2AJLI 5H4GA 3C70A 1ZFNA 1CQIB 3ACCA 3HRHA 4IV8A 5BWNA 3FKQA 2GO1A 5HEKA 1Z6YA 1L0BA 2F00A 3QPDA 4DMMA 1DLIA 2XLCA 2HMAA 4D46A 1XNHA 5C8ZA 3MJRA 1WMAA 2O8DB 4Q6WA 1QKKA 1UKYA 5JJ5A 2BFDA 5C4GB 1M33A 4GSLA 4KW7A 4L85A 3G8BA 3TE7A 3I39X 4Y9SA 1HLFA 3AUFA 3LFUA 4N12A 5D3QA 3E53A 1S96A 3PNPA 1X1AA 2GJ9A 3R24A 4OSOA 1Q2XA 1X7HA 2CXNA 1HQDA 2D62A 4BVEA 3VPBA 1VLJA 2DR0A 6YASA 2P79A 3JWEA 4FHCA 4UARA 3T3EA 3AB8A 4LRTB 2GEBA 2GB4A 3EXFA 4TSFD 5CK4A 2JS7A 1P2GA 1NONA 2JIPA 3BH6A 3WMXA 3HP4A 3ESDA 3P9YA 4G81A 2D5BA 2HA2A 1Z4OA 2H9IA 2HWXA 3FLAA 3O83A 3QFFA 4G56A 4PIVA 5F9MA 3SZLA 3T3PB 3VZDA 1EVZA 3EULA 2IWHA 2D54A 5K0GA 4KR0A 2F43A 4JQCA 5K3AA 4RXMA 4KV9A 4D9HA 2JFQA 4MAMA 1HZZA 1N5DA 4EY5A 1X77A 4QM6A 1K5DA 5ECYA 1U9JA 1KC3A 1GCGA 2QRHA 1EQUA 4D45A 1ZH8A 5AUOB 1C3LA 2QNIA 3UG7A 1EG7A 4LE1A 3GYGA 1TVKA 3FTFA 1WXQA 1QLWA 1MFZA 4KREA 2F62A 5L8VA 4Q6BA 2BFBB 1X7XB 4N1AA 2JGNA 4BMSA 4J2OA 4WFKA 5DM0A 4EL5A 4F60A 4C05A 4LYFA 4YUZA 3V1TC 4XB1A 2R96A 4Y6OA 3UXMA 4UOQA 3SYNA 1SQ5A 5KVCA 1BA2A 1DAOA 1TVMA 2VPYA 1UXJA 5AK6A 1PFQA 1SOUA 2HPAA 3BZUA 4P58A 1OLOA 4G86A 4ZRMA 2JLUA 3JVIA 2QG4A 1MU0A 4EIWA 4CWAA 3CSDA 4GYYA 4W4TA 1CVRA 2GK4A 4DG5A 3F6SA 1YJ8A 2MMGA 4JI4B 3BS4A 5EJ2A 3JARA 5KJCA 4WDQA 2R79A 2WV7A 1LA2A 4NBNA 5J2UF 5KWJA 5E0OA 4LJ7A 3ZI0A 2PWYA 2X4DA 5A7FA 4BKMA 4OMUA 3M2PA 5J4KA 2CF6A 4F45A 3IIIA 4HWKA 1UPTA 3ADDA 3ETLA 4CXMA 1P1JA 2FPXA 4KI7A 2CJFA 2C2ZA 2GJAA 1PJSA 2VDWB 2IL1A 1W96A 1ZOLA 2FQWA 4OQYA 2P1DA 1VE1A 2I3AA 4RFSB 3W2FA 5DHFA 2VHUA 4UU8A 2ZQZA 4KLRA 2AG8A 2PX5A 3S7ZA 1I2DA 2VLIA 2WIJA 5JFTA 3D7SA 5HQTA 4H4DA 1R18A 1XMJA 5AM5A 3AIMA 4UCXA 5LXTF 1VMDA 3EYWA 3W5JA 4ZO9A 3CXRA 5LJIA 5LA6F 2FDXA 3QBDA 4P2GA 1D09A 1YFLA 1NVVR 2ZWPA 4CGYA 1VCMA 1T8UA 2P2DA 3PSAA 1TYEB 2C29D 4G1MB 5LU9A 2P8JA 2AOVA 3CX3A 3ZLTA 3QELB 3IVRA 3X1JA 4D3YA 3TBFA 4TTPA 1SCUB 4PYNA 4NYJQ 5AI6A 1UWLA 5H83A 5FBKA 3G02A 3F67A 1DTEA 4YCLA 4DHWA 2RGDA 3P97A 1Q1NA 4UREA 3GEPA 1E7WA 1WMBA 1Z6QA 4KPFC 5BQ3A 3NS7A 4YCBA 4ND8A 3DT8A 2G36A 2QLMA 4LI0A 5ARDA 3RFXA 2HREA 1M6YA 3UJHA 2I29A 3DDUA 3EF3A 1NJSA 3GP3A 1Z16A 4MEJA 2E5FA 4HN2A 4XASA 4D82A 1IIRA 1MO4A 5B2ZA 1BVRA 4KO2S 1TJ5A 2WOOA 3DDNA 2D1SA 4UBOA 4YP1A 3UGKA 5A2GA 3OM1A 4KQFA 1VE9A 4QG7A 1ODCA 2IH2A 1IG3A 2LVBA 4PSDA 4QC2A 5AVUA 4P82A 1YZFA 2FKNA 1GU0A 5T4HA 3GRVA 2AFIB 3DE3X 5K6AA 5B58C 1KR5A 4PO9A 4LHYA 1E9RA 1HMYA 1E59A 1ZL0A 1U2DA 3DMTA 3LW7A 4U7GA 3RYCA 2CCGA 4R3WA 4IGFA 5EJ9A 1A7KA 1C9MA 1H23A 1XJCA 3B2EA 1SN7A 3MELA 2ZIXA 3QTBA 3T6KA 1M54A 3S81A 5D3MA 2V6IA 5IBRA 3HHEA 3HO6A 1F6WA 4IRUB 2QMUA 2ZSFA 3RSHA 2WIBA 2OKGA 1PJCA 3WNDA 3QV1A 4E5NA 4EHAA 5TIIA 5M34A 1YB5A 3RBXA 4DDVA 5EIWA 4BBJA 2OV1A 5I7FA 5KTPA 3WZ2A 3UMCA 3ZDBA 1Y3DE 2Q8NA 3BTVA 3D6JA 4BDSA 1MAVA 3CPEA 3IT2A 1IUOA 5IAKA 3NJ8A 4B44A 4PYRA 2HY7A 4GFDA 2DUWA 3QKUA 3SDZA 4TMZA 1E2IA 4RL4A 4ARBA 1G7SA 5JT1A 4JJIA 1L7QA 3QX8A 1G3UA 4AKTA 1GPKA 2FR8A 3EZGA 2IZ1A 1BKYA 4HRVA 3I76A 5JI2E 2MR6A 1TF5A 1T3HA 3FB4A 1E5DA 1K4KA 1SXHA 5TS2A 4EDFA 3PPYA 4MQMA 3IEXA 3ORSA 1OH5A 1SC1A 4B7XA 1XFDA 1GZ5A 3IYLW 4D97A 4DSNA 4YYZA 4ZOLA 3N76A 4JAVC 1PN3A 3UANA 1R8YA 1IIBA 3GELA 4ZQBA 1VPTA 4K2HA 2Q0SA 3MLBA 1FP1D 1YRAA 3E7WA 4OI4A 4HFNA 4DABA 2ODNA 5CEFA 3B1YA 5KNDH 2EW1A 5GTDA 3MCAA 3PGA1 1MV5A 3AERB 1NLZA 2W6ID 3QVSA 4HC4A 2J5KA 4Q4HA 4UTXA 5EIBC 3DEAA 4BV8A 1NQTA 4PRKA 3D8NA 1XMOB 2SICE 3R3HA 5HVNA 2B20A 3ELUA 5KYWA 2GX6A 3G68A 4KFUA 4WNAB 1VL0A 2FE1A 4EG1A 3LKBA 1VHTA 2C3OA 3ACBA 3L8EA 4L0CA 4C0BA 4BEBA 5GIPE 2WG1A 1QVVA 2RG1A 4ZKEA 3RRFA 1GTRA 1EBUA 1KO7A 1M2EA 4HDKB 4Q1EA 1K8YB 4YXFA 4J16A 4PC2A 4HNTA 4Q66C 1EP3B 2QX4A 3CZ9A 1J21A 1OV6A 5K01A 4XWWA 2R97A 3HYLA 3MLEA 5F3RA 2WMDA 1UFKA 2WTXA 3R0QA 1OTYA 1M6HA 4YT5A 4GNKA 3L7IA 3RC3A 2I33A 3CHYA 5JZVA 3B1VA 4K40A 5FLEX 3LUFA 4PNEA 1FP6A 1Z82A 4Q00A 3ANMA 1W85B 1ZK4A 3H6KA 1GGHA 1EK0A 1RD4A 3Q1LA 3ZWKA 4AX4A 5ABPA 5CEEA 3PCTA 2WTNA 3UT5B 1GGVA 1NNLA 4UPDA 3B85A 3IUBA 3PGLA 1TTPB 4MO9A 5IDYA 6ABPA 5BSKA 1S3FA 2WLTA 1C80A 5CHYA 5F3DA 5E1OA 3WGHA 1KYTA 5I7WA 2H4HA 1R4NA 1TJPB 3PGMA 3QG1A 2H1LA 2X9LA 2ZYGA 4MP6A 2BTEA 1JYEA 3D3NA 3TLGA 2QTCA 3HBFA 4M8SA 2VRCD 4MITA 1JAXA 3DW1X 3ZI7A 3KZVA 1Z7WA 4KLAA 4HTFB 5E2BA 3EWNA 4UVHA 1EK1A 2G07A 3GFQA 2QP9X 3HL0A 1A72A 4OF4A 2B61A 4BS9A 4D6YA 4AMZA 3DR3A 4Y9DA 4M1SA 2CXSA 2XNSA 3F4BA 1DL5A 3NUZA 2AMVA 4PFJA 721PA 3GFSA 4DCCA 1V5WA 4ZDWA 1T1GA 2G71A 4KHPB 2HIMA 1GA1A 5CCBA 3MXOA 2PKWA 2LGJA 3FFAA 3BJIC 3DAHA 3KDPA 4DBVO 621PA 3IP8A 5LZ4A 2CUKA 1HV8A 5G41A 4AO7A 2DKNA 2DBQA 2R7KA 2ZRAA 3W1WA 2W2VA 3FH0A 3VC7A 4ZRDA 1WXXA 3GZTB 4E1BA 5A4JA 5CDFE 4YBRA 3K4QA 3SWWA 3L49A 5A9SB 5EWMA 3R6TA 2V5AA 2HCJB 5DX1A 3F3MA 1PWYE 2DBVO 4Q48A 2XUKA 2WU0A 4IGAA 2E5LB 1HLGA 1ESMA 1W94A 1LUAA 3FVVA 1AKQA 2XAUA 4EI9A 3R76A 5JS6A 1XP8A 1BDBA 2EFYA 3ROQA 2P77A 5AM3A 1Z7YA 3S4YA 5JJCA 2JIZD 1G98A 5AXAA 2VWQA 4NRDA 4CE6A 4ABTA 3SEFA 1GU7A 4PTLA 1G3RA 2I6SA 4MCHA 1V6AA 2PUHA 4BJ6A 3GJ6A 2YMPA 1CZNA 4CL0A 2OMEA 5CLJA 1M75A 2HIGA 4B87A 2PX3A 2C00A 2W4MA 3ZHCA 1M2WA 5DTIA 3B6JA 4MQ4A 1E66A 2IU0A 4I4TB 1XK7A 4OUKX 4GX0A 2IXFA 3E6AA 1SUSA 3VZBA 1Z8FA 5J2TF 3F5QA 2IHZA 3WQQA 2WE8A 2Z8XA 1WXGA 3K96A 2WYIA 1GJRA 4O1MA 4PHCA 2HWKA 4FC6A 1ZNWA 3CF6R 5DCLA 5B3KA 1W0CA 4Y2QA 4MW0A 2FR0A 4QU8A 2BM0A 3SJZA 2O2YA 3K2BA 3T5DA 2B83A 5K6RA 4P4SB 3KTAB 1V8FA 1G38A 3LH5A 1QTRA 2Z8YM 3KJEA 5BXQC 4OJTA 1EDBA 2QVGA 4XVQA 3E4CA 2CXHA 3E1GA 2B1RA 3MT9A 1GVHA 4Z86A 5K8UA 1I9CA 2IX9A 4JODA 4E6EA 3PHIA 1RZRD 4UAJA 2G80A 2AVNA 4B1FA 4ZVQA 2DY1A 2QTMA 4H7HA 1S0UA 1U99A 4ISCA 1C29B 4JSYA 4LC9A 4LK2A 2HB6A 4NTZA 4Q3KA 3TVDA 2BFAA 4MYSA 3QVLA 3ZD6A 3VR0A 8ADHA 3D7KA 4OXYA 3RO7A 3TDKA 4W99A 5FPQA 2QWXA 4XQGA 3AR4A 4YLGA 2HXGA 2AD5A 2GXSA 4J1TA 3WWYA 4D4MA 3HE3A 4S1OA 3L43A 4BLSA 1S4MA 3OPVA 3G5AA 3N8IA 3JALA 4FI3C 4I1IA 4DBLC 1SRRA 4XYLA 3MHTA 1XYGA 2H29A 3M89A 2HXSA 4BGIA 4CIYA 4MVJF 1E32A 5B1DA 3RHZA 5AVSA 2GJ4A 5F9FA 4U4AA 4LDRA 4G0MA 3H19A 3LUPA 4E0BA 5DB4A 3DV0B 1SZPA 3CPJB 4MZXA 1A7JA 3NO4A 2ZDQA 1OHHD 2NM0A 5E4JA 1QNLA 1N6IA 2ZJ5A 4M21A 1ICIA 6AT1A 3GT7A 2AXQA 3OEED 4ZGGA 3NGMA 5A05A 4G0UA 3GPIA 1NQXA 2BGGA 5KVAA 3TLEA 3OOYA 1DKUA 1HNZB 4CHTA 4HEA1 1U4SA 2I55A 3HR4A 4H7IA 1ENOA 4W9MC 1KE2A 4QFMA 3L46A 4WHMA 2WIKA 2OP0A 3GGJA 4DXAA 2R8RA 3L18A 5LBIA 1BN7A 1AUVA 2CC2A 2A7QA 3LJKA 1KDVA 1EUDB 1VPWA 1NQUA 2P4HX 2XWJI 1JJIA 4XX0A 4XIJA 5GJWC 3QJGA 4G01B 2FN9A 3R7FA 3BD8A 2O52A 3FPKA 1ZMOA 3HYSA 5HUJA 1SY7A 4KTVE 4WLUA 3S3TA 1JLLA 3H4MA 3K3PA 5FI3A 1I1OA 1G2QA 2CDNA 2WJ4A 4CLOB 1XQ1A 2GJKA 4AN0A 2NYUA 2A0KA 2TRSB 3SX0A 4EPTA 1DJNA 3NLLA 5JVDA 1ESEA 4I6EA 1OFUX 5K0CA 4TZ0A 4RM3A 3ZOZA 4PZ0A 2ZOSA 3DBIA 3LHKA 4CT0A 3LVQE 1IE3A 2AE1A 2PGJA 4RUKA 5B3JA 3RU3A 4CQMA 5C8XA 1SVLA 4CR6A 3D1LA 2YC2C 1SQ0A 5JZ9A 1RLTA 2D0DA 2YN0A 2G1KA 1DTWA 3PFWO 4XDGA 5LLDA 2H7VA 4C06A 4CHGA 3MIZA 4L7QA 2XADA 3GLFA 5JU6A 1ZR4A 4L73A 4N5DA 5MHTA 1DADA 2UXCB 2VJNA 3BK1A 1E4OA 2QDKA 4IH9A 2JF0A 1L7RA 3IJPA 2W6JD 4HNRA 2F67A 1XAHA 2E82A 4UUQA 3STUA 2CVOA 4QTZA 3RSQA 4GMKA 1N32B 2IUTA 1O94D 3NV9A 5EUBA 4DSTA 2ATXA 1T9AA 1T8RA 1LBTA 2CJPA 3QENA 4NXNB 1D0SA 1DUIA 4FNOA 1FF9A 4HLCA 4Y0NA 1J1ZA 1RM3A 2C07A 4YRZA 1ODFA 1M1NA 3TTTA 1TKCA 2X0JA 1R88A 2A86A 5K0FA 5IS2A 1N2IA 2NXJA 2YOGA 3OSUA 4O63O 1EHYA 2GR9A 3NPMA 1Z0SA 4C3ZA 2I65A 4A6EA 4YRTA 1P60A 1P6UA 2BHLA 3GPDG 3WA7A 1VJGA 1J1IA 2ZANA 2FW1A 3EVCA 3NHLA 1NRXA 1KGDA 3QEMB 1IHUA 2YYSA 4H6VA 4I3GA 4X8HA 3T5BA 4CM4A 1KK0A 2FNAA 3DT6A 5AUNB 2ZIZA 3HDQA 1H4VB 2C0QA 1A9PA 2H9YA 3QMVA 5KPJA 3U13A 1PJ2A 1Y89A 1V5EA 4FXOA 4DWOA 4DV2B 4IOJA 4UNQA 3C39A 2OV6A 1B8NA 2VDQB 4IJWA 1SCAA 4GOLD 2ZIAA 3MOIA 1AT1A 2AQ8A 4H6WA 1UBOS 1LPAB 4FBMA 2JFZA 1I7LA 1GFZA 2WK1A 1VBMA 1FTGA 4YH1A 3TDMA 4BQSA 2HI0A 3D6NB 4BKOA 1GT91 3NEYA 2DB3A 3U2QA 1FNNA 5ETJA 1QRAA 1CC1S 2BBSA 3NCHA 2PH1A 1MXFA 2JGJA 5REQA 2QVCA 1D7AA 2OBNA 4N3CA 1E0KA 2WT8A 4DB2A 2XOXA 3E61A 4LCJA 4AY5A 3VZCA 1P7YA 2IHKA 3L40A 5G0WA 2O8FB 2NPIA 1CDEA 4X3OA 5BYAA 1WHSA 2R4QA 3VR6D 5DTJA 3H5WA 3TXAA 1HT2E 1X1EA 2BKVA 3VR6H 4BO2A 1R5JA 2MMCA 4JIGA 2VN8A 5HE9A 4YUVA 4HWOA 5EZYF 1TMYA 2FZ4A 4U0KA 1Y7LA 4RJLA 4ZVSA 4BJ1A 5KOHA 4UE3S 5A2QA 1BYIA 4L95C 1DO8A 1YL5A 5COQA 5HWSA 1K3TA 3PHHA 4HQRA 1ULAA 3TQOA 1IN8A 3HO8A 5CAEA 4REQA 1QONA 2WSSA 1GG5A 3EWSA 1QX4A 4TLBA 4Y6QA 2AIRA 1I5EA 4MS1A 5DWDA 2CMHA 1AXEA 3R7LA 4IVQA 4NV1A 3S2GA 1YVRA 1C9NA 3H2IA 3O5AA 4FQ7A 4LZNA 3HBAA 5LB2A 1OREA 3X1WA 1T9BA 5KOYA 4KFCA 2Y2UA 4RJKA 3WKDA 3W5BA 3R4VA 2B4RO 4M87A 1NIJA 2G77B 3D0RA 2P75A 3TUIC 4Z7JA 2JAUA 4WBNB 4AJKA 5TQ0A 3CNHA 1N0VC 3E15A 4OXRA 1EU1A 1GKUB 4G8JA 2OVBA 1OI7A 1EK6A 1DXYA 2D2VA 3GIWA 4P38A 3WIOA 2H7XA 3WLTA 5J4HA 2RE8A 1L4LA 2XX3A 1BCSA 2YINC 3IE0A 1CZRA 2V0NA 2D8AA 3FNRA 2M6RA 3QITA 4U6NA 3WYAA 1WXIA 1H94A 4GEKA 1U8UA 5T67A 1TQ6A 2AR0A 3MMXA 3HI6A 1BXZA 1JBEA 3STHA 2XQIA 3R40A 3EGDB 1ADBA 3KU1A 1XKXA 1E2PA 2PQ2A 1UBRS 2VUIB 1V4NA 3UOWA 5CB4A 3GLHA 1GNVA 1O6GA 3MZ0A 3UW3A 3B2NA 2R8PA 3RJMA 3ICCA 2AMLA 3RE1A 4A1OA 1DQSA 3T5MA 3WL3A 5DN6D 5K9ZA 4PNPA 4WXHA 1Y3BE 3KM0A 2BKEA 1CP3A 2BKLA 2FE4A 4LXYA 2PJZA 5LP6A 5AXCA 2XF2A 3IUSA 4L4ZA 3EQ6A 1VLQA 3I9LA 3WXBA 2BHRA 4G9GA 3ECCA 2H52A 3CTMA 1NXXA 4AM8A 4DDUA 4L72A 4JVSB 5E2IA 1NN0A 2BGIA 5CVCA 3PHLA 3GNSA 2YYYA 2IUUA 2QR5A 3ZU6A 4X6UA 4MUFA 4OQNA 4BFYA 1XV5A 4GI7A 1ZRHA 2DPGA 2ZUDA 1DI0A 4WESA 1KI2A 4J7AA 1G19A 5EQTA 4HO1X 4B4VA 4AVYA 3FNQA 2V7XA 2FMUA 3NB0A 1ZQ1A 2NO5A 4QHTA 4O4HA 5CT5A 3N2GA 2ZI4A 2ZRNA 2FMHA 3HLTA 1QHEA 2HK9A 1ZI9A 3ZLBA 4NXMB 1JILA 3EXAA 3OCUA 2O0JA 3CWZA 4QE3A 4M1KA 3RC2A 5B57C 1KZ6A 2J3LA 4NNPA 1SD1A 1GZ6A 4QECA 4C3UA 2FP3A 3FZEA 4NZYA 1CR6A 3QU4A 5ALTA 2Y0BA 4DMGA 1PYDA 2AXEA 1JEQB 1JDBB 3FGPA 2HA3A 4K9NA 2F90A 5KQPA 1JQ5A 3H8SA 1B8OA 4TS4A 5J58A 1M8PA 1JU9A 3FR8A 5CD9A 3F78A 1NF8A 1KO1A 4PLPA 1SC4A 1J42A 4G0VA 3UK7A 1A98A 1WD7A 2BZGA 4FP9A 4BNTA 3N8NA 2Z4RA 4PQRA 3ZJ5A 3ORRA 1KK1A 1YWGO 4HTAA 4MYTA 5EP3A 1Y8AA 4R6XA 3T7DA 1UAAA 4Q3EA 5IVDA 3DMDA 3R23A 4YMGA 4HNUA 1HLDA 2PS3A 3B52X 4ZZ1A 2GVZC 2Q7XA 1E1QD 4ZVUA 3S1AA 2GEDA 4NYJR 2VDVE 1M72A 2CCJA 2DBZA 5DFAA 5F3WB 1KJ8A 1QC5B 3H1BA 3O75A 2WSLA 4J49A 4LQCA 2HNAA 4RIHA 5F78A 5TSDA 5TT0A 4D2IA 2WJ3A 1IMOA 1XJ0A 2XNKA 1QORA 4JB3A 5K2MA 5TPWB 1VBNA 2FU5C 4D5EA 4I6JA 5BORA 1RKBA 5CMLA 3DP7A 4OJNA 2GPJA 2WA1A 4ME6A 1CRZA 4KR7A 1G2OA 4N5IX 3JQAA 1YS6A 2LE0A 4RY2A 3ZE7A 4BLUA 5BW8A 2H3EA 4MCAA 4UEJA 2YJTD 1DV2A 3GX1A 1S89A 3PF9A 4HDNB 5FNVA 1TVEA 3GJYA 3MQFA 2ZYAA 2WYUA 3SR4A 2B3DA 2K5UA 3IILA 3RJ5A 3P9ZA 3ZWCA 5A62A 1IM2A 3ONDA 4FYIA 1U80A 2R8ZA 4BRZA 3AO0B 1T36A 2D1RA 2ZDHA 1T3LA 1WF3A 3GJXC 3BZWA 3QH4A 4MW7A 1X8XA 1PFUA 3Q87B 4QXPA 3KJXA 3TSYA 3HB1A 1NY5A 2AT1A 2GILA 3KJQA 4QUIA 4U2EA 5IANA 1VJ0A 3RD5A 5IM4F 1TUBA 3AHDA 3IQIX 4P34A 4UMVA 3FTCA 4H59A 4L8VA 1E2HA 2NLOA 3Q6NA 1AZLA 4B5LA 1LS6A 1WCV1 1ZM2A 2JAOA 3D4OA 2WHXA 4O2AB 4HFRA 4LY3A 4ESEA 3H7AA 2OUKA 4Z1OA 1CETA 4DPLA 3L07A 4D44A 2DHCA 4R4JA 4EHNA 5JJBA 1EUCA 4W1QA 4IJVA 3LIIA 4LDAA 4BO6A 4NU8X 4QQNA 1OLSA 1ID8A 2NU9B 3G1WA 3U3KA 5KDDA 4CIWA 2WYOA 4PQEA 1J0AA 4M7OA 1CUSA 4PO1A 5BRNA 2PRKA 4AL4A 4PU0A 4W9NC 4MLPA 1KSFX 2HQBA 4OLHA 4KXQA 1R0RE 1NBIA 3JRWA 2PQMA 1SCDA 3K09C 5ICGA 3KO8A 3JCZA 4O29A 1NAHA 5IKMA 4N0QA 1N5KA 3D4BA 4GM4A 1TUIA 3KEMA 4PAWA 1KNXA 1O54A 3ZHYA 4FB4A 5LDHA 3H4IA 3CJTA 3AF5A 1RDFA 1SKYB 1BWSA 2CBGA 4IH1A 2ZTVA 3GUHA 4IWNA 3DP9A 1V6CA 2OAEA 3KT0A 3ONNA 3L06A 1N2CE 4YK7A 3MCTA 1TYBE 2ZRLA 4QUGA 1B15A 5AK3A 2ONCA 1GZUA 5KVSA 2JJQA 3RU9A 2OCXA 3N87A 3NOVA 1G8MA 5ITVA 2A94A 1T5DX 4Z5XA 4TYMA 1YF3A 3HY3A 2JLBA 5EE1A 5F77A 1WULS 2JIMA 3DFUA 2ZJAA 2XUGA 3PQ8A 4MKIA 1RMQA 2G4VA 4RE6A 3PEFA 1JDTA 3UJAA 2I4NA 1E3WA 3F4KA 3AL2A 4C0AC 3LWZA 1SZJG 4KFRA 4MEAA 2W70A 3VR4D 5C7LO 2A5FA 2HQSA 2OD2A 3VR4H 3EOZA 1N4AA 1QIDA 4GGOA 1SIBE 4WCVA 3F9IA