1ISGA

Crystal structure analysis of bst-1/cd157 with atpgammas
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
total genus 85
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1isgA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1isgA02
1GQQA 4CUZA 1GV1A 3PDJA 3WG9A 3OSUA 1LSSA 3RC2A 1IL0A 4FFOA 1DOHA 4LRSB 1UP6A 1ZSYA 3Q9UA 4P4NA 4R68A 3PJFA 5G4KA 4DLLA 5ITWA 1ZEJA 4Y6RA 4XJSA 4CMEA 3PRJA 2NSDA 2R00C 3WB9A 4HV4A 1NVMB 1R4NB 2DTDA 5T8KC 4XYEA 2VHWA 3U62A 1DIBA 3F46A 5JY6A 3UGKA 3G1TA 5C3MA 3UUWA 5FEUA 1YH3A 4BNZA 5TT1A 2I65A 3INGA 3STHA 1BVRA 4H16A 3LU1A 2WWRA 4KTTE 2FPPA 3JV7A 2GN8A 1Q0LA 5KNLA 3GGPA 3AI3A 4CL8A 4JXKA 4CLDA 3QRWA 5BSFA 1DB3A 4XEHA 2BFPA 3DMTC 3WQSB 3BTVA 1GR0A 1HLDA 1GUFA 2E6UX 1KVSA 5L9AA 2VTDA 4L73A 1KVRA 1QYDA 3ZWWA 1UR5A 1XDWA 3T7EA 4GGOA 3GEGA 2BMAA 4QXMA 2GRAA 3VH2A 1VLLA 5DULA 2BRUA 4B8ZA 1U9JA 4DC1A 1JVBA 1X7GA 2IXBA 1WDKA 4S1VA 2HAEA 3GR6A 3HUDA 4DIOA 2BH9A 1EBUA 4LVCA 3TFQA 1EQUA 1Z7EA 1C0KA 1TA4A 3JQAA 4DXHA 4J0EA 2EW2A 5BR7A 1C1DA 4H15A 4PZCA 3W4IA 1I5RA 3CSDA 3R6DA 4ONEA 4RORA 5KWEA 1KETA 1KC1A 2Y1GA 1KEPA 3F5QA 4Q3AA 3TZKA 4RLHA 3JD0A 1Z73A 5JW6A 1XYGA 1TI7A 2YDYA 4MVJM 4HFRA 4XYGA 2GZ3A 5CP8A 2FHSA 1O6ZA 2AXQA 2Q3EA 3H8VA 4CV3A 3L77A 3GA0A 1Q0HA 2VOEA 3ZNPA 1UZNA 2I67A 1U2DA 4RV9A 3NTQA 4CM8B 4Q3CA 5EINA 4ND1A 4RVUA 2GDZA 4PZEA 2ZCUA 2V7PA 3L4BC 3MOIA 5JLAA 2D4AA 1EFKA 3FN4A 2DKNA 2NTVA 5CDGA 1RJWA 2PD6A 1EQ2A 1GZ3A 4O59O 1O95A 2O2SA 3VTZA 3W4JA 4I5FA 3KVOA 3OICA 3N7UA 2NVUB 5L7WA 4OXYA 5KVCA 1YQDA 2EF1A 4AG3A 1ZKMA 4ZQBA 2Y1EA 2VT2A 2OMEA 3TJRA 4DPKA 1KVUA 2Q50A 2GASA 4NU6A 3ZH2A 1R4NA 1ZXLA 3IUPA 1WLYA 4BIIA 1D4FA 1LXCA 3TNLA 1YVEI 1X7HA 2PTGA 2YHIB 3F1LA 3AOGA 3FR7A 3LZ6A 3OA0A 3WMWA 4YA6A 4BVAA 3ENNA 2X5KO 4XCVA 3TOXA 1IHXA 1R16A 4ZJUA 1NX6A 2Z1MA 3JYOA 3NDIA 3WBBA 5B4VA 1UJMA 1W8DA 1GCOA 1IOLA 3Q11A 4E33A 5JAIA 4P38A 2NNLD 4RDIA 5HTOA 3JQEA 5KJFA 2I5PO 4K6CA 3NTOA 3U4IA 3DB2A 4C7KA 1B8PA 4CQMB 5JYEA 2BI8A 4IDEA 4TRNA 5B4UA 2UV8A 5AVOA 3OECA 4M8SA 2QQ5A 3JQ6A 1EUDA 2X1HA 1NPDA 2PA3A 4U0KA 5DF1A 2A4KA 4AFNA 1JWBB 3HB5X 4U6SA 4GX0A 1BXGA 1XA0A 2VZ0A 3GLQA 3I3OA 3P19A 1OAAA 3EK2A 5ILOA 2CD9A 2AE1A 5L7TA 1U5CA 3GDFA 3DO5A 4LRTB 3N74A 3B1KA 4D46A 4KMSA 4QT0A 3HN2A 4GH5A 4ZVVA 4B7UA 1E1KA 1NYTA 2CVOA 2X5JO 3L4SO 2Z1NA 1IB6A 4WNCA 4R16A 3PI7A 1XR3A 3P7MA 2PGJA 1M75A 3HHPA 4ZRMA 2P9CA 4P22A 1Q2XA 2WDZA 7ADHA 1XEAA 2I6TA 4XB2A 2Y0DA 3UVEA 5U1PA 4BNJA 3ADPA 5HRUA 1UDBA 3PIIA 2DVMA 4YCAA 3HJAA 2GUGA 3WLEA 3ASVA 1HDXA 1P31A 4X54A 1SOWA 4GX5A 2IEBA 3ITDA 4MVJE 5EIOA 1E6EA 2HU2A 3GC6A 1R66A 2CDAA 4MIOA 2Q99A 4LISA 3TRIA 3W8EA 1IZ9A 3KHUA 5A03A 1SPXA 3INRA 1EK6A 3QSGA 5JAQA 2G0TA 4E5MA 4JK3A 2J6IA 4HNHA 4G81A 3BMOA 2O3QA 2JFGA 1XIVA 2X0RA 1VM6A 5DP1A 4TMFA 2X23A 2PGLA 4IJWA 4YYZA 1UP7A 2PGDA 1UZMA 1PWXA 3DEYX 4MVJD 3NGLA 3H65A 2NVWA 5COQA 1A7AA 2PV7A 1EE9A 1Q1NA 1VKNA 3EDMA 4LCEA 4D3SA 4II2A 1CQJA 4AJNA 4ZRNA 2O3UA 2IDZA 1P1IA 2I9PA 1ISFA 2BFOA 3MOGA 3Q9NA 1M6WA 3PDUA 4WASA 1D1TA 1FDTA 2QG4A 3KSZO 4ND3A 1I32A 3HSKA 2C59A 2NVBA 1T2DA 4KTVE 1DC6A 4OQZA 3JYQA 1UP4A 3I5MA 1RM5A 4YJHA 4BNNA 2I66A 3ZW8A 4RPHA 1R37A 1QYCA 3JQ8B 2HK7A 5H82A 3HDHA 1DO8A 1PL8A 4BNWA 3DZHA 2HRZA 5EN4A 1ENZA 3U4CA 2CF6A 5KIAA 1F17A 3RC1A 4DQVA 1Y9AA 5BNFA 4R9RA 3AY3A 2V6BA 3IAHA 3QV1A 1N92A 2JAPA 3OJOA 3PPIA 3AFMA 5ES3A 2BFMA 5I7SA 3M2PA 4BOYA 1KY4A 5MDHA 4NJOA 1I2CA 2C20A 5FF9A 3WMXA 3CPSA 4W99A 3G79A 1BXGB 3CXRA 4A27A 1GQ2A 1HDZA 2X4GA 3T7CA 4FW8A 3ZI0A 4CLXA 3KSDO 4NFHA 4BO2A 4E6PA 3H5NA 4J1NA 2O3RA 3UFXA 2X6TA 1V35A 1QV7A 5B4TA 3DBLA 4IJKA 3ZN2A 3P2OA 1H6AA 1B0AA 1Y8RB 3RI3A 3VKVA 4E5NA 3BYZA 5TF4A 2BHLA 1JKFA 1JWAB 5TRTA 4AJPA 2V6GA 1O9BA 5FWNA 1KEUA 4LMRA 3CZMA 2EGGA 4M87A 3VH4A 1O89A 4MKRA 3I9LA 4UEKA 3GVXA 3T4XA 1YBAA 2ZTVA 3ZHBA 4CMCA 2HK9A 1HDRA 2CVQA 2WYWA 3PWSA 2GN6A 2IODA 2DPGA 3UF0A 3SX2A 4EDFA 4CLHA 4OYRA 2NU7A 5JS6A 3OBBA 4DYVA 1NBOA 4M1QA 2P9GA 5GY7A 2OORA 3AM3A 3NX4A 4QUKA 5ILGA 2X9VA 2Q2WA 4I9UA 3QWAA 3PWZA 2DAPA 3BHMA 3L0DA 5CFZA 1J6UA 1UAGA 1K6XA 2C5EA 3CMCO 3KV3O 4M55A 1K6IA 3I4FA 4IINA 4ZQFA 5JDCC 4WLVA 1Q0QA 4YAKA 3F1KA 4GX1A 3JQFA 4GMFA 3D3EA 3ZV4A 1W73A 2PH5A 2C2YA 2CDBA 2IYPA 4ALIA 1HF3A 1QORA 3PJEA 1U4OA 5AXBA 1I33A 2FZWA 4KWHA 3MTGA 3QWIA 4ZQEA 2AEMA 1XWFA 3IOYA 3TDKA 5IAAA 2I76A 1PQPA 4MP6A 2PKQP 2X9GA 4YRAA 1IPEA 3BIOA 1DAPA 2ZQYA 3DBRB 3RVDA 4J9UE 3I9KA 3JQAD 3TPCA 4FOOA 1A71A 3NDJA 2YV2A 4WNIA 2ZK7A 2Q46A 3E5RA 4NBWA 4ALMA 2ZB8A 2VWPA 2Y1DA 5C7OO 5L7YA 1BDMA 2WYVA 1NQTA 4IDDA 1CQIA 1Q7GA 3JQ8A 1PTJA 1GU7A 3ONEA 3TSCA 2XOXA 2YY7A 1E5QA 3PZRA 2GNAA 1U7TA 2Y93A 5A4DA 5IXSA 4ZA2A 4GPD1 4HBGA 5F1KA 5JY1A 3IJPA 1ZO8A 5ENVA 3TWOA 4EBFA 4PLCA 3QIVA 2VTEA 1E6UA 4LW8A 2FSSA 1EVZA 1G0NA 5CEJA 9LDTA 1LSUA 1SOVA 4LMPA 1H6BA 1H94A 4IQ0A 4JJGA 4DL9A 2BGKA 4DLAA 3NAQA 4PLGA 3H3JA 2RHCA 1Z74A 4JBIA 4FFLA 2IEDA 2BELA 4O0LA 4WCFC 3DTYA 3ABIA 4XZ3A 1WPQA 1E7YA 1PZFA 4DPLA 3G1UA 1PZGA 3G17A 3U5TA 4TWRA 3NV9A 1L1FA 3B20A 4CQLB 4YT5A 2OXIA 4CV0A 2NU8A 3TL2A 1G1AA 3ZWPA 1IUKA 3O38A 1FDSA 1A9ZA 3W8FA 4MIEA 4JJIA 2J3HA 4BGIA 4E32A 3KXDA 4Y6PA 1FF9A 4D0RA 3F3SA 4PG7A 5KKCA 2E82A 4PG4A 4BO7A 1Z82A 4F3YA 1A4UA 4DYDA 4TRRA 3ZWMA 1VKOA 3LF2A 4DA9A 3H5RA 4R1NA 5G0SA 5DBIA 1F0YA 3AU9A 1ISGA 1SEVA 2BI7A 4QFCA 2JL1A 4I08A 4L8VA 5KTKA 2E4AA 4GGPA 1T24A 4WOKA 5IF3A 2EXXA 5DT9A 4XIJA 1Y81A 3INTA 4N7RA 3UXYA 1IY8A 2YYYA 2CVZA 3JYLA 3BHJA 3DOJA 2EERA 4NR0A 4BNYA 4GVLA 2G76A 4E5PA 4BGEA 3D0OA 4BO3A 2X0IA 2Y66A 4EUEA 1L7DA 4GKVA 4J7UA 2DQ4A 4R9SA 4UAGA 4CUJA 3AUTA 3ORFA 4AJLA 2Q1SA 4WJZA 4XGIA 1MGOA 3LSYA 1LRKA 3ETDA 5JO9A 5LCXA 1MLDA 2W98A 4N5LA 4BMVA 1K89A 5I9MA 3C1OA 3FNFA 4LN1A 4O1MA 2HKIA 2UYYA 4CMBA 3EW7A 5IZCA 4RPJA 3LT4A 3PWKA 4MVJI 2X5OA 3PGJA 1VSUA 4N54A 1ADBA 5ER9A 4EZBA 3ETGA 1O0SA 1V8BA 2O3TA 3RUIA 5IDXA 3ZNOA 5JDIA 3N58A 3ONFA 3OETA 4E4YA 4BNKA 3SC6A 5B1YA 2EGHA 3EGOA 2GCGA 3A14A 2HK8A 4PLYA 5TSDA 5DZSA 4BNXA 4BMSA 5EL0A 4UUOA 1LQUA 3U0BA 1C1XB 4Z9YA 2Y68A 1F14A 1ORRA 1U3VA 3AY7A 3WS7A 1E77A 2RH4A 3ENKA 5TJ9A 4D0SA 5AXCA 3LQFA 2HMVA 3I6IA 4ZQHA 3RUAA 1XHLA 3EY4A 1EDZA 1GYRA 4IS2A 4BNVA 1RWBA 2P5UA 3GMDA 1P45A 2CUKA 4GLOA 1ZSNA 4MVJG 3GPDG 3RBVA 4RQTA 4R51A 5JCJA 3DHYA 1R4MB 1DDOA 3KEOA 1NXQA 1U7HA 1Y5RA 3UCXA 3ST7A 2GLXA 1J49A 3GRKA 3K8ZA 1XCBA 2WD7A 3WWYA 4E2YA 4UVHA 3SLGA 3GH3A 3VDRA 2XF8A 2PZJA 1NP3A 4YJDA 4U0JA 5B37A 4NIMA 1BWSA 1Y9EA 3GGOA 5TC4A 1Z75A 1ZVMA 4WPGA 1WW8A 2OUIA 4KUEA 4WK6A 4CMKA 4PVCA 1VRWA 3ZNQA 3GVHA 5BSHA 2VRBA 4KQWA 1HZZA 3FWZA 4GI2A 4MVJF 4M49A 5AXAA 1DC4A 1N7HA 3G0OA 4Q39A 4ALNA 1E3SA 3W8DA 1U4SA 5EQDA 3C1TA 3GNSA 3R0IA 3VAZA 1B26A 3DBLB 4EITA 1ZK1A 2TMDA 3EAGA 4YQYA 1N2SA 1Y5MA 3PZBA 3DMYA 1C14A 1PZEA 5JO0A 2FZEA 5HS4A 3G49A 4BB5A 4XKJA 3GEMA 2WMDA 3VPFA 3BMQA 1Y8QB 4NDNE 2WSBA 4YJGB 3GNTA 4TVBA 4U7WA 4NZ9A 4IJVA 5KVSA 2EV9A 3U09A 4BO0A 3JQ9C 1K0UA 4YAGA 3RUDA 1X1TA 3QVXA 4ZGWA 2VYNA 3WSVA 4PLTA 3S2EA 3ITKA 2HSDA 1K3TA 4W7HA 1PS8A 2AQKA 3PHGA 4BV8A 1E3IA 3EZLA 4ZU3A 4B4OA 3K30A 4PZDA 3UH1A 5ICMA 4MKZA 1DAOA 2Q1UA 4IZHA 1NPYA 4PCVA 2O7SA 4MDHA 2R00A 4I9HA 1PGOA 4RF2A 4UEOA 5T8KA 2DBRA 3DHEA 2DPHA 3QA9A 5CEEA 1LU9A 1V9LA 3A4VA 3DBVO 4QEDA 1UH5A 4MKXA 3WIEA 4NPCA 4BNIA 4ESOA 3O9ZA 4OAQA 1LTHR 3KYDB 4YXFA 4PGFA 5GZ6A 5T6BA 2YFHA 3GDOA 3V1UA 4YB8A 4XYLA 4I1IA 4KZPA 4O6VA 4P8RA 3RASA 1ZMOA 3DMTA 3I9JA 3BMOB 1B15A 3CTMA 1MG5A 2Q4BA 2C29D 4A2CA 1H2HA 4BO4A 3WJAA 4A26A 1FDVA 1NAIA 3VDQA 2YZ7A 3OJFA 2H5LA 3BXXA 2J8ZA 4QQRA 4DRYA 3PHIA 3VPHA 1YONA 2UVDA 3S8MA 4BMNA 2PD3A 1TEHA 4XQCA 5IZ4A 4W9NC 4OKNA 1XQ1A 4C4OA 3CE6A 1P1FA 3WGZA 1ZK3A 2GZ2A 4CM1A 1SO8A 4ZN6A 3ROQA 4J4BA 3ZDFA 1X0XA 2EP5A 4BNTA 1XSEA 1FDUA 3DL2A 3VH1A 3PHHA 3FNHA 4Z0PA 3KYDA 2FR1A 3SC4A 1TT5B 1O5IA 3ZGYA 2VRCD 1OC4A 3IQDB 1LRLA 1SC6A 1JLLA 4HFMA 2B0JA 4XQ9A 5HBRA 3RC7A 4F6LA 3ZWOA 2RHRA 4IMRA 3WNQA 4J4TA 3VTFA 1T4BA 2PR2A 4HX5A 4DGSA 3ZHZA 2ZYGA 1N1EA 3DWFA 3M1AA 3MJTA 3QVOA 4PRLA 3KOUA 2EW8A 1XGKA 4CM5A 2HQ1A 4ZHSA 3OF2A 3DZIA 1C0PA 1E7QA 2W8ZA 4J16A 3H2SA 1H9BA 4UUMA 1PJLA 1VSVA 3KZVA 3GNQA 1BHSA 2OP0A 3CKYA 4DIFA 2H63A 2ZTUA 3DAGA 4L76A 4Y98A 3WYBA 5G0TA 3VVCA 4A03A 4E21A 2D8AA 2GGSA 4MVJH 2EKPA 5L4LA 3S55A 4J1SA 1J4AA 4FS3A 2JHGA 4RCVA 4GAEA 3VKUA 1HDYA 4R3WA 5KCZA 3ANMA 3GQVA 4IQ8A 4RZIA 4LSMA 5FI5A 5G4KB 1ZJYA 4DC0A 2QRJA 4WOJA 1IPFA 4E0BA 5BQFA 3U3XA 3C7CB 5IFLA 2XAAA 2PLAA 3TN7A 4AJKA 3F4BA 3LK7A 2VN8A 1QYVA 3SBOA 4JIGA 5A02A 3FSRA 3UW3A 3GY0A 4IS3A 1MX3A 5JAZA 1E1NA 4YJFB 3NKLA 3HFGA 3I52A 4I9NA 4FOSA 4L4RA 1LSJA 2NACA 1DRVA 3ZU3A 2JCXA 1P77A 3Q3CA 1E3EA 4R5HA 3KBOA 4WLNA 4EI2A 3ZWAA 4AVYA 1DIHA 1ZFNA 3NT4A 4BGVA 1EMDA 2R2GA 5IXYA 4AJIA 1LX6A 1UUFA 2DLDA 3ON5A 5EJ2A 1DEHA 4Q3EA 2QRLA 2NVUA 4ZICA 1XG5A 4QSMA 4FC6A 3VC7A 4XRGA 4R41A 1CEQA 2PK3A 1T4DA 1BVUA 2D3TA 2D59A 1EUCA 5A04A 1I10A 3OQ6A 4IUYA 2QIOA 4MP8A 4WLFA 1HWYA 2D5AA 4CLEA 2OBYA 2O23A 2UUPA 3WX0A 4YRBA 2YHIA 1P0FA 3OP4A 3OIFA 4IGFA 4EJ0A 3DZKA 2JD1A 3DFUA 3IP3A 5ER6A 2J3KA 1PJ3A 1PJTA 3EVNA 1LLQA 2WE8A 2YQ4A 2VZ8A 5CDYA 3AWDA 2VHXA 1YRLA 4WLUA 1T1SA 4W9NA 1BRMA 5A5EA 1YOVB 2B37A 2JAHA 4INAA 1LLCA 2AA3A 5IJZA 3OM9A 4A5OA 3FF4A 3JYNA 3JD2A 5F3RA 3OA2A 3ULKA 2UAGA 4CJXA 1KVQA 3H7AA 5JDIC 3JSAA 5JYDA 3IMFA 1OMOA 1GPDG 1R0SA 3WDSA 2ZCVA 5A9TA 3QVSA 2TMGA 1YJQA 4IDAA 3HADA 4RVFA 3RJ9A 5T5QA 4B7XA 4DVJA 5JMWA 3U9LA 1E5LA 4NQZA 2C5AA 1UAYA 2HJSA 4L0QA 3ROPA 1NTOA 3PJGA 3WXBA 5CDUA 1YQXA 2X8LA 5DP2A 1X7DA 3HN7A 2OP1A 4J90A 3SXPA 3WLFA 4YJGA 3O03A 4OO3A 4YAJA 2NU9A 1Z7BA 5J23A 4FB5A 1SCUA 1V3VA 1QV6A 4HXYA 1ZH8A 1AUPA 3KLMX 1ID1A 2CZCA 1M67A 3HWRA 3Q0EA 3E9MA 4UREA 1H0KA 2B36A 4EGFA 4KQXA 4CMGA 3W4KA 2VHYA 1ADFA 1GEEA 3GDGA 3RU9A 2V6FA 4BUCA 4NH4A 2X9NA 3NUGA 5BT9A 1E1LA 2OHXA 1CWUA 5IN4A 1GL3A 4FFPA 1RPNA 1WNTA 4CR7A 3VPSA 4RF4A 3L9WA 4GLLA 3EMKA 3TOZA 3ZV3A 3BZUA 3LT2A 1W0CA 5KVVA 3WGYA 1ISJA 1ENPA 1M66A 2PZKA 1MUUA 4OXKA 1MB4A 3FHLA 3ZZNA 5G2OA 4NMHA 3K73O 5LDHA 3FPLA 3JQAB 3WYCA 1N9GB 4YR9A 4BKRA 3HE3A 3AI1A 4FGSA 5JBIA 1QP8A 2A35A 2HCTA 1VC2A 3EYWA 4ND5A 1M76A 1P1KA 2CF5A 4Z3DA 3NJ8A 1DPGA 1ENOA 4KDFA 3IP1A 1RKXA 2PZLA 4PVDA 5GMOA 1HE5A 3UOGA 1K6JA 4HADA 1FJHA 1I2ZA 1ZXBA 2JFHA 4UVIA 1X13A 3OIDA 3JQ7A 4EEZA 1ARZA 4JP3A 2VRCA 3P5SA 3RQSA 3JCZA 5COBA 1B3BA 2WM3A 2NWQA 1WWKA 4BNLA 4XDZA 3H9UA 4IDFA 3EZYA 3WGHA 3WGOA 4B4UA 1HE2A 3MJEA 4WCDA 2FY8A 4FIZA 1LDGA 1XU7A 3PQFA 4NFYA 4CLRB 2B35A 4J7XA 2D1YA 3I6QA 3KRTA 4RO0A 5B12A 5TT0A 3G3EA 2JCVA 4YBZA 1MXFA 4BO5A 4YPOA 1H93A 1KVTA 2DFVA 1NFFA 5DDIP 3K2EA 1BXKA 1JA9A 4IDCA 3KYCA 1MXHA 2Q1TA 2ZTLA 4MPDA 1O8CA 2NQ8A 2GD1O 2PKQO 1E3WB 4DLBA 1T25A 1UXHA 4PN3A 1GCUA 1CJCA 1GEGA 1GUYA 1I0ZA 4FGWA 4Q3NA 1NFQA 2B83A 2YV3A 5F21A 3GPIA 4JLWA 3RUCA 2GERA 2VT3A 1P1JA 3DFZA 4FSHA 1DC5A 4CV1A 4R4JA 3DQPA 4WEQA 1U8XX 1LQTA 3RJ5A 3WGGA 3E18A 3E82A 2W2LA 3EHEA 4YJHB 3AOEA 2J3JA 4PLHA 1PWZA 5KVQA 3H2ZA 2HJRA 3AUUA 1NM5A 3H5AA 1P9LA 3PLRA 1ZK2A 4FBGA 4RL6A 1NFRA 1U1IA 2AHRA 1GAEO 3C85A 1BG6A 3OEYA 4H3VA 5FI3A 1ZIDA 5IDYA 5I7EA 3L4BA 1KERA 4K1LA 4CL3A 2Q4EA 3WTBA 1DJNA 4IZIA 3E03A 4IXWA 7MDHA 1U3TA 2P68A 1CERA 4TZTA 2P4HX 3D4OA 3V8BA 5A06A 4J4HA 3GZNB 4QX6A 2QX7A 3AM4A 3T4EA 3QVTA 1PJSA 5T67A 5K0ZA 5A05A 4AJHA 4PLWA 3PIDA 1YXMA 1LLDA 3BMCA 3FCOA 3OJ0A 4GWKA 2PKRA 1YKFA 3GFBA 3WJ7A 1Y8QA 4MINA 4D3DA 5C7IO 3PVZA 2AW5A 1KS9A 3O4RA 1NQOA 3MJ4A 2C7GA 2DM6A 3PFFA 5CEFA 4NBUA 1ZNQO 5AXDA 5JCXA 2DBQA 1PZHA 1B3RA 1P74A 1BTOA 2BGMA 1UXGA 3MJVA 1EVJA 3DBHA 2P2SA 5BSEA 2IYOA 3QVWA 4UUNA 1SMKA 1HLPA 2J5RA 2G82A 1I3NA 3FI9A 3E9NA 2NQTA 4J9VA 3U4HA 1YQGA 3GVIA 4XQEA 1YE3A 1WZEA 5COAA 1GYPA 4RZHA 1X14A 4Z6KA 4XQGA 4CR6A 1VJ1A 4OSOA 3NJ4A 4U8GA 3S2GA 2FP4A 4YVFA 4L4SA 1DHTA 4N5MA 4HP8A 2WE7A 5CDTA 2W2KB 1H2BA 3RC9A 3DZGA 1E3WA 1C0IA 1G0OA 4EUHA 2QYSA 3C1AA 4HWKA 1EK5A 1X1EA 2FPIA 2IZ1A 1X15A 3HG7A 3X2EA 2DBZA 5L45A 3HFSA 4YTEA 4NJMA 5CDSA 1VI2A 4CLRA 3B1FA 3VPGA 4TZKA 5CHEA 1PJCA 4YT8A 1K5HA 4Z3KA 1A72A 5G4LA 4MVJP 2HMSA 4JROA 6LDHA 2FR0A 4FCCA 3PGXA 1R4MA 5A1TA 2QZ9A 5IZCC 3HB4X 4CODB 3OHSX 4M54A 3B1JA 4PRKA 3D1LA 3VHRA 5ITVA 1I2BA 1QSGA 1LA2A 1MC4A 4FJ2A 2Q49A 3X2FA 2QHXA 3EUWA 3ZHYA 4AJEA 5JE8A 2FPGA 1KBZA 2PD4A 4R54A 3UCFA 2PWZA 2VYVD 1HT0A 1JW9B 5THQA 1CRWG 1P3DA 1WP4A 2Q45A 3JYPA 2QRKA 4KOAA 1Y7TA 4XRRA 3CMMA 3CZRA 5KOIA 3I9NA 4WECA 2AE2A 2ZIZA 3ZWCA 3ZNNA 2DFDA 1YL7A 4JBGA 1OBFO 3GVPA 4J91A 3WWZA 4ALLA 3BMCB 1A9YA 3RUEA 4CM4B 1LUAA 3MEQA 1KY5A 3O8QA 1I36A 4JBHA 3FBTA 4LK3A 4W82A 3WFJA 3MJSA 1JU9A 2W90A 4RF5A 5JFOA 4NBRA 1GTMA 3PHLA 4FJ1A 1AHHA 3D64A 4RPKA 1GY8A 1JAXA 2O50A 3DHNA 2GN4A 1PGNA 4XB1A 4XDYA 3GOHA 1NVTA 2HMTA 4E2WA 3BTSA 3DOCA 3V1TC 4BNUA 1LEHA 4IIUA 4I5DA 2ZB7A 4CM3A 2DUWA 4E31A 5KJCA 4UULA 2I3AA 1IE3A 3HDQA 3GUYA 3WOHA 2Y05A 3R1IA 2YW9A 3TL3A 4BV9A 3FR8A 4E13A 3ZWYA 1I3MA 3DZFA 2EJWA 3IDSA 4YJFA 3SVTA 1LDNA 3C8MA 4EW6A 4JJFA 3IKVA 3ANNA 1L7EA 3NYWA 2VZ9A 2DTXA 5AOVA 3GT0A 4ID9A 3F4LA 3ROMA 1EVIA 3I23A 1ZW1A 1QMGA 5A3VA 3CIFA 4XIYA 4AICA 3IIEA 3E5MA 3WICA 1FK8A 5CPFA 5HS6A 4GX2A 1PQUA 2B5WA 3BMNB 2HO5A 4FFMA 1ADGA 2H1SA 1KEVA 4BL5A 4CLOB 1EEHA 1AE1A 2O4CA 3RFTA 4BO6A 3JQ9A 2RIRA 3PEFA 1PGQA 2NM0A 1PR9A 3SJ7A 1MFPA 1EUZA 3AM5A 3F47A 2Y99A 3TQHA 4BGUA 3OEWA 3I1JA 5DBFA 3TZ6A 3F6YA 3PYXA 1AN9A 5C5IA 4R5MA 2CDCA 3W6UA 4KWIA 4R69A 1NWHA 3ZWXA 4YRDA 5KJEA 1HYGA 1V6AA 1LDYA 3E9QA 4QO8A 3DZBA 4AJ4A 1HETA 2GN9A 3AU8A 2Q2QA 1VJTA 4IIVA 1PGJA 3RIHA 4CR8A 3C7AA 5U4QA 2IXAA 1ONNA 1PS0A 3C7DB 3GAZA 3LC2O 4N5NA 4RPLA 4G65A 1PQWA 3GMSA 4DIBA 2ZQZA 1GZ4A 1QXSA 3VZQA 1EE2A 5TGDA 3Q2IA 1CIVA 3GRPA 2A94A 5GZ3A 5IDWA 4PLPA 3I4CA 1P1RA 4W7IA 1HE4A 4O63O 4PLFA 4ZQGA 3K92A 2JFFA 3IJRA 4OXNA 1UXKA 3SEFA 1RYEA 5HWSA 3CEAA 8ADHA 1ADCA 4BS9A 3JQGA 4W6ZA 5TNXA 4ALKA 3LYLA 3W6ZA 3MJCA 4XD2A 3R3SA 2FRDA 1C1DB 1U3UA 5K6AA 1JDJA 1ISMA 3ROKA 1VPDA 4BO8A 3A28A 5EMHA 2E48A 5KJ6A 5LC1A 4EYEA 5AQ1A 3IC5A 3S2FA 3V2HA 4KDEA 4QECA 2POQX 4HUJA 2JD0A 1F12A 3GEDA 4DPMA 2HMWA 3IS3A 1DSSG 3M6IA 4WKGA 5FFFA 3FPCA 1BDBA 3KB6A 2ET6A 4MP3A 2R6JA 1K2WA 2GYYA 4I8XA 3TFOA 1ZUD1 3I9OA 3DTTA 2CNBA 4YQZA 2O3JA 4J3FA 1IHYA 4DQXA 2VWQA 3E6AA 4WEOA 5L53A 2ZTMA 5JNLA 5G0UA 4CM9A 2P4QA 1T1RA 4BNHA 4HY3A 1QG6A 1HDGO 3DC2A 4PIVA 5C7LO 4CLOA 4YEDA 2FR8A 1RM4A 1DRWA 1VE9A 4OIMA 2NV6A 4FFNA 4CMIB 1PX0A 4J2OA 3ZWNA 4ROSA 3D3WA 4MJLA 4G2NA 1GUZA 3KM0A 4HFJA 4L4XA 1NASA 1E7WA 3OJEA 5T64A 5JC1A 5A5FA 4OMUA 4FC7A 2EP7A 3JQDA 1FMCA 4KUGA 3NT5A 5A9SA 3AUSA 4DBZA 2PFGA 3FTPA 2VNSA 2YDXA 4U5QA 4G5HA 4UUPA 1DLIA 4WLEA 2JKVA 4CMEC 4BO9A 4YDRA 2B4RO 1QRRA 2UDPA 5JSFA 3ZWBA 3JQ7B 2Y0EA 4IPTA 3A9WA 2NTJA 4Z9XA 4J0FA 3QWBA 4M89A 1B2LA 2NLOA 2SCUA 3PHJA 1UXJA 4RGBA 2GR9A 1E7RA 1YL5A 2RAFA 3BHIA 2VYND 2EEZA 2HRBA 4FR5A 4F6CA 1A27A 1E7MA 2AQHA 2OO5A 3D5TA 3JTMA 1BXZA 4FQ8A 4S3MA 5L4NA 1EZ4A 1FXSA 1EDOA 5I9LA 1I24A 3KSUA 2X86A 1NHGA 3L6EA 1NNUA 4OSPA 3ZW9A 4CMJA 1PIWA 1LJ8A 2FMUA 1R0LA 5I8ZA 5EESA 1IYZA 2Q1WA 3KLPX 1LDEA 1TVEA 1DBVO 3U49A 4K28A 1ZBQA 4UVEA 1J5PA 1KC3A 2AEJA 3JQGB 1ONOA 4P4LA 5C37A 1EFLA 4NU5A 4M86A 2VHVA 1NVGA 1H6CA 1RYDA 2RH8A 4ZD6A 6ADHA 2C54A 3IUSA 5IN5A 1A4IA 2B5VA 5JDCA 3DOOA 5EQFA 5TX7A 1VL6A 1N1GA 3BA1A 5CPBA 2A92A 3VZSA 1PS9A 3KYBA 1WZIA 3OQ1A 4ND2A 4LVUA 3ADOA 2EHDA 4L75A 3K6JA 4DBVO 3VZPA 2DC1A 1JTVA 1NWCA 3CINA 3K31A 4GWGA 3VZRA 5IG2A 5U9CA 2I99A 3DZJA 4NI5A 4WE3A 3V2GA 3RAJA 2VQ3A 1DIAA 5F1OA 3QQPA 4B3IA 1B7GO 2D2IA 3Q6IA 2Y67A 3GHYA 3K96A 3LVFO 1SAYA 4U6QA 4L74A 3LT1A 5TJHA 2AG5A 3UCEA 1LDBA 5I7VA 2V6MA 4CPDA 1J0XO 4HNGA 5F5NA 1UDCA 2IZZA 1ULUA 1T2AA 4RVSA 2O7QA 3O8QB 4F46A 1RM0A 3S1LA 3GF4A 4JGBA 4DWVA 5THKA 3D3WB 1ZEMA 1T2FA 1XLTA 1JKIA 4RPGA 2O4UX 4FJ0A 2X0JA 3PFWO 4IMPA 3HZZA 3QP9A 3UHAA 5KKAA 4E2XA 1N9GA 2DBVO 2ZATA 1XU9A 1CYDA 4J1TA 1I3KA 3OJLA 4OOFA 4BHTA 4WCFB 1DXYA 4Z9FA 1LDMA 1WDLA 3L07A 1PL6A 3LC1O 2X7HA 2AQIA 1MP0A 2Z5LA 3JQBC 1MV8A 3WBFA 4DMLA 2PY6A 4HFNA 2OL4A 1I3LA 2VHZA 1Z45A 3QLJA 4YWJA 4C7JA 1HEUA 3BMQB 5ICSA 5IDQA 1PR3A 4QTZA 4NHEA 4ALJA 1A5ZA 3PYLA 3QW2A 5EERA 3LF1A 1HKUA 2B69A 3TZCA 4BKPA 3LLVA 2EKQA 3BTOA 5L3ZA 4CQMD 1I01A 4Y8VA 4B8WA 4RVGA 1GD1O 3H3FA 1AXGA 5JPIA 1SB8A 1ISIA 1DFIA 1LC3A 1YDWA 4JQCA 4E5YA 1WMBA 3FWNA 1DJQA 4XR4A 1LSOA 1GQYA 4R1TA 2YJZA 3BMNA 3ZV5A 2D0IA 3GGGA 1MC5A 4IDGA 2ILTA 4II3A 3UAGA 4WGGA 4AJOA 2WYUA 4J43A 3PP8A 4AL4A 4AJ1A 2VNAA 4B4WA 1HYEA 4EEXA 2DU8A 1BGVA 2FWMX 3AJRA 1YL6A 3PXXA 3UICA 3KYCB 4E2ZA 1XQ6A 3RFVA 5L95A 1ZMTA 3GN2A 1QLJA 1SBYA 4FPXA 5TS3A 4Y67A 1Y8RA 3NEPX 3DAFA 1E1MA 3QWFA 4A7PA 2LDBA 2NTNA 3WNVA 1ONPA 3GHHA 1R0KA 1QYXA 2HMUA 1KIFA 3PQDA 5G0WA 5MGBA 4ITUA 4CMAA 3DBHB 3F5SA 2VWGA 1E0DA 1R12A 2WJPA 3ZU5A 2RCYA 4LGVA 1PEDA 4A0SA 3GVCA 1HSOA 1Z6ZA 4KUHA 1VJ0A 4PG8A 4J49A 2QYTA 3RBZA 4PG5A 2JJYA 4TQGA 1V0JA 1AHIA 3PK0A 3WYEA 2GF2A 5JMPA 4Z0TA 1NQ5A 1OZAA 2O48X 3VVBA 1DRUA 3HNPA 3WTCA 4I5GA 3Q1LA 2ZB4A 3KUXA 1YGYA 2C82A 5A9RA 4NNJA 1PJ2A 1DIGA 1T2CA 2W2KA 1ISHA 3JD1A 1Q7BA 2Y0CA 4OGWA 2OBNA 2OOSA 4R1UA 1R6DA 4RQUA 3KETA 3PYMA 1QLHA 3GG2A 3QWHA 3WSWA 4OL9A 1HSZA 3DDNA 1DFHA 1T2EA 3E48A 4OJNA 2YV1A 4LCJA 4UVDA 4XR9A 4BQPA 3LLSA 1OFGA 4XYMA 2W2LD 1ML3A 3H9JA 4DQUA 1PGPA 4FN4A 3DXFA 3ICPA 4XWYA 3F9IA 1HYHA 3ZU4A 3JD4A 1X0VA 3ZWVA 2G5CA 2Y1FA 4BKOA 4TRMA 3I83A 2BD0A 2WD8A 3WGTA 3QY9A 3ZCXA 4Y9DA 3IKTA 1N5DA 1HXHA 1MA0A 3RKUA 1GPJA 1S6YA 2G1UA 3A06A 1ZSVA 3MZ0A 1QKIA 1TT7A 1QYWA 4D41A 2XXBA 3H9QA 4JP2A 1M2WA 3Q2KA 2X0NA 4WUVA 1TLTA 2Y1OA 3L6OO 1SEPA 4DREA 1DC3A 2JHFA 3GG9A 4EJMA 3M2TA 3DR3A 1HL3A 1Y1PA 1YDEA 4DUPA 1LLUA 1WAMA 2AMFA 2BGLA 3OH8A 4OOEA 2V65A 1PJQA 4MO2A 3RROA 4CV2A 2PH3A 4AJ2A 3EC7A 4NJMB 4TSKA 3H9GA 2I3GA 4XA8A 4XX0A 1NR1A 3RU7A 2A9FA 3VH3A 1D1SA 1ZCJA 5H83A 3D7LA 1U2GA 4KP7A 4TVOA 4IXTA 5L51A 4DTIA 4XGKA 3K2BA 4NK4A 2LDXA 1N8KA 2QW8A 5KJ1A 4IQGA 4CQLA 1B16A 4OM8A 3E1KA 2JD2A 5HA5A 3KEQA 4DMMA 1VL0A 2XPCA 1HDOA 3TZQA 3PQEA 3D4PA 1NQAO 5TLSA 3VOSA 3CH6A 3KTDA 4CM7A 2ZB3A 3L9XA 1YWGO 1DLJA 1GYQA 1PJBA 1UDAA 2F1KA 3AUAA 3JD3A 3OMLA 5CG1A 1HZJA 4J6FA 1U28A 4NK5A 2O3SA 3COSA 1HRDA 1JQBA 4B3JA 4GSLA 1BSVA 2J3IA 3HQ4O 3AK4A 3RSHA 1I30A 2ZJ0A 4IDBA 2NADA 3HDJA 4A10A 2IE0A 3H4VA 4FFRA 4CM4A 3H6KA 2O2YA 2ZYAA 3RFXA 3NDRA 1WXDA 3MTJA 1AGNA 1TXGA 2HDHA 2Y1CA 3W1VA 2CSUA 3WR5A 2EKLA 1C0LA 1YO6A 2ZJ1A 2RBEA 1EBFA 3VPXA 2EG9A 4PLZA 4PG6A 4K26A 1KEWA 3B6ZA 5F1PA 3C3XA 1GFSA 3R3JA 2DUUA 2Q2VA 3GZNA 2G17A 1PU2A 2AEFA 2OGUA 3GZ4A 4GBJA 2B4QA 1B14A 4MVJA 1WMAA 1HE3A 3UKOA 5I7FA 4IY1A 4GQAA 2AG8A 1P33A 2XXJA 3H9EO 4NBVA 3V1YA 4BKUA 3JQFC 1P44A 3PJDA 5ENDA 1LBEA 3GAFA 5DBGA 4R3NA 3ASUA 2HLPA 2DT5A 3AW9A 1JN0A 5HM8A 1E6WA 4CUKA 5L40A 1DHRA 2W4QA 1LRJA 3JQCA 4B4VA 3GUCA 1BW9B 1D8AA 1GADO 2VUTA 3AI2A 2F00A 2VOJA 4F45A 1G6KA 5CAEA 3TZHA 4UVGA 2IRWA 1E3LA 1XKQA 3IL2A 3ZU2A 2UUOA 1U5AA 4JN6B 3OQBA 1B8UA 3CUKA 1NAHA 1DIRA 2GO1A 3MWEB 1GZ6A 3D5QA 3GFGA 4OH1A 3RWBA 5JC8A 5DCWA 1GV0A 4Y6SA 4E3ZA 3FBGA 1Y6JA 2GPTA 2IZ0A 4FD3A 3NRCA 4A73A 1OC2A 1CF2O 4WCFA 3FNEA 4QO7A 3FTNA 3ZHXA 5DCUA 1H6DA 5A9SB 3JQBA 4URFA 2EIHA 4YAIA 4B79A 4TKLA 1LI4A 2X58A 1O94A 4GSKA 2H9IA 4D44A 2E37A 4E30A 4BB6A 5DCYA 3C24A 4BO1A 2PNFA 3AY6A 3GK3A 5DOVA 4EJ6A 5L4SA 2CFCA 2GSDA 3B70A 1R15A 4IJUA 1PL7A 3MWDB 1DFGA 3RD5A 1MFZA 1TT5A 2BKAA 1W6UA 2BF7A 1NPTO 5I9NA 4QFDA 2FOIA 4P4GA 1CDOA 4O5OA 3L6DA 5JXWA 3NTRA 3FNGA 1AXEA 4CM9D 1H5QA 3LDHA 4UEJA 2FN7A 3QHAA 2WEKA 2YFQA 2OZPA 4D43A 1WDMA 3EVTA 3NT2A 4OHUA 3RBXA 2EJVA 1SNYA 2QZZA 3DONA 4WLOA 4YACA 1LC0A 2OFPA 2YHUA 3RUFA 3QJ5A 1P0CA 4NBTA 5CG2A 3SLKA 1D7OA 2YUTA 1LNQA 2P5YA 2ZYDA 3M1LA 1E92A 3O26A 4BKQA 4OQYA 1YS4A 3RKRA 4B7CA 5JCJD 1MG0A 4JX8A 5I8WA 2AQ8A 3RUHA 4Q3BA 4CMIA 2VUSA 2C07A 4RVDA 3BAZA 4JNKA 3K9QO 4YAEA 3WQQA 1C1XA 2X22A 3WIDA 1B8VA 4IGEA 4PFJA 2VUUA 1EVYA 1ZK4A 2YQ5A 4FDAA 4OKIA 1U8FO 3P2YA 5GZ1A 3HDYA 4RVHA 1NR7A 5TIIA 1SB9A 2WD7B 3WGQA 1PSDA 2DTEA 3TF5A 1S7CA 3E8XA 1KOLA 3WQRA 2HUNA 5FYDA 3DAPA 4YT4A 1CETA 3DBRA 1D3AA 3ONDA 1YOVA 4I5EA 2C7VA 3QE3A 4IM7A 4LSWA 1YB5A 3MCVA 1YJ8A 1E7SA 4MOWA 1W4ZA 4RDHA 1ULSA 1OOEA 2PZMA 3NGXA 1ENYA 4B3HA 1XELA 5K9ZA 3S2IA 1N7GA 3WFIA 4CMHA 3V2UA 3ZV6A 1KYQA 3K5PA 1ZJZA 3D4NA 3ETEA 1WVGA 4TRJA 4K6FA 2NUAA 3ANLA 4XJTA 1HTBA 1YB1A 1I8TA 1VL8A 2JCYA 3PLNA 1FDWA 4RJTA 3GN1A 4PLVA 5JAMA 1P1HA 3U4DA 5BNIA 4Q9NA 5BSGA 2VYVA 2ZKLA 4RLSA 1BW9A 1F8GA 4CQMA 4NFSA 5DNAA 5BNTA 3LT0A 2EWMA 4GL4A 4RF3A 5H81A 4GVXA 5T57A 4D79A 1ZK0A 3ICCA 4HKTA 1JKJA 2B4TO 1RM3A 1F06A 1TB4A 4R1SA 4XGNA 1NHWA 4EUFA 4ND4A 1PJ4A 5K6AC 3WGIA 3BTUA 1HDCA 3LC7O 4J2HA 2Z95A 1OI7A 4H7PA 1IZ0A 4J7CA 4D7AA 3OIGA 2J5QA 4Q3DA 1GDHA 2VCYA 1YBMA 5AYVA 2CMDA 4BNGA 2P9EA 3FRJA 4MIYA 1V3UA 1A7KA 4ILKA 3AOEC 1T26A 4GMGA 2P91A 4D3FA 5DN9A 4E12A 1JVSA 3RCBA 2CY0A 3FD8A 1U3WA 2BFAA 2BLLA 4L9RA 5F5LA 4BNMA 3OFSA 5G0VA 1Q7CA 1E3JA 1ZZEA 4AJJA 5DOZA 4Z0HO 3SJUA 4K9DA 1H9AA 4N18A 4YT2A 3PTZA 8LDHA 9LDBA 1JAYA 2E49A 1C3VA 1YBVA 1UZLA 2D5CA 4GKBA 1YB4A 2GZ1A 4W4TA 1SZJG 4J1QA 3AFNA 1UXIA 4NG5A 4BNFA 2WTBA 2VWHA 3KO8A 2FSVA 1BMDA 4JCOA 4D45A 4CM8A 2H6EA 1V3TA 4CM6A 4R01A 1IULA 1F8FA 3I9MA 3V5NA 2NU6A 4TKMA 4D42A 1M6HA 4XYBA 2C2XA 4E5KA 2J5KA 3UN1A 2C0CA 5A3JA 4IBOA 5LDGA 5ADHA 1QR6A 3A1NA 5EPOA 4BQRA 4TROA 5TQVA
chains in the Genus database with same CATH superfamily
2R6R1 1GQQA 4B83A 1GV1A 2JAQA 3PDJA 3RHFA 2IHVA 2DECA 1N36B 3QE0A 3C6MA 2WKQA 1VLHA 4JHXA 3WBKA 5AVQA 5E4JA 3MJRA 1CZHA 1UM8A 2B30A 4DQ0A 1AG9A 2ORIA 2OYRA 3E7FA 3C3PA 1IXYA 5CDFA 4DLLA 3IPYA 1CVLA 1ZEJA 4Y6RA 1TVKB 4NAUA 1I3CA 3V7FA 4Y7CA 3WB9A 2CHEA 4GS5A 4MYDA 3UPDA 5T8KC 5FPYA 3DKPA 1N2CE 1UK6A 2OYSA 3GFTA 3N8GA 4G84A 1X7ZA 1EXVA 2PUHA 1DIBA 5LNK1 3TG2A 3THXB 2JBHA 1AQ6A 3CX6A 3G1TA 5FEUA 1YH3A 2D74A 2I65A 3INGA 4LG1A 3ZIUA 4H16A 5E3JA 3RV4A 1LZKA 3JV7A 1NF2A 2XE6A 2GN8A 3D4LA 3PQ6A 5DRYA 4YRGA 2XT0A 1F0KA 1PN3A 2YZKA 3BGWA 3BSSA 3KAQA 3QUCA 4R81A 3PUKA 4CL8A 5BSFA 3ETLA 1HT3A 1VPWA 2O8FB 4UBJA 3DMTC 4Q7KA 2DCMA 4D4IA 3P2MA 3CFYA 1GUFA 4LRQA 4MEJA 4HZUA 1KVSA 4A2QA 3OZUA 5L9AA 1Z0DA 1QYDA 1UR5A 4WADA 2YJ5A 4BQSA 3UXMA 1U99A 1RXWA 1QP7A 4D9MA 3LG2A 3T94A 3IILA 1B1AA 1WDKA 1Z4LA 4WTOA 5CGQB 5CLIA 1VP9A 1CD5A 5TQ2B 1TA4A 1L1EA 3V7NA 3FLMA 4PZYA 1PK9A 1IWOA 1C1DA 3NKFA 4H15A 4TTSA 3W2GA 3W4IA 3CSDA 1CUAA 4GOLD 2F8SA 3LFUA 2Q4TA 4UHHA 1Z5NA 2Y1GA 4BTVA 1FMJA 3FGPA 4RJLA 3U2QA 1Y4AE 3WAGA 1J21A 2FSFA 4Q3AA 3UJ7A 3TZKA 4MLDA 2AGVA 9ABPA 1XYGA 1TI7A 3MQFA 3ASYA 4MVJM 4P0QB 1EFCA 1W47A 2FWBA 1DTSA 2ZWVA 4RK4A 4IICA 3U81A 3ZDQA 5JS8A 1T4CA 3WB1A 1LW6E 4KNVA 3RVRA 2Z8XA 1AT1A 4AO7A 4UZEA 3UK1A 2BR4A 4CV3A 1KH2A 3C4QA 1MPTA 1N7IA 4IEEA 3V34A 2ODNA 2Q5CA 3VPAA 2I67A 1U2DA 2WJIA 2XCIA 1UQTA 4Q15A 4QXRA 4DZTA 1E61A 4E51A 3UPTA 5AJYA 2N3ZA 5JH7B 1IY2A 5EVJA 2PQ6A 1OR8A 3DA8A 2GDZA 1HMYA 3R6WA 4IWNA 4RVUA 1NVWQ 2YWXA 3V4LA 1PI3A 4IJ5A 4BP9A 2OKCA 4KLCA 4JI7B 5H02A 4X6YA 1JHAA 3W05A 2XDAA 2AG0A 4L5CA 5KQRA 4XPIA 1JBQA 1JSXA 1E9SA 3WGVA 3DP7A 2PD6A 4O59O 4QJ5A 4RYDA 4HDSA 5EKDA 5GONB 4E46A 3NP9A 3RJMA 2WQ6A 2QN2A 3OICA 2WAMA 1YSCA 3FUTA 5DE3A 2NVUB 3JAMA 4UHEA 1S2NA 4D9CA 4AG3A 1UPUA 2YJTD 3CKMA 4MV8A 2Y1EA 5FYQA 2YFKA 4QL3A 2CVFA 3QBJA 1KVUA 1B74A 2QIPA 3MWDA 4IGIA 4V0MA 4EFMA 4FZRA 5BR1A 1R4NA 1ZXLA 2D2EA 1MABA 2WZBA 2HIGA 3LKVA 1JPNA 3I1YA 3L1IA 3TSZA 4POOA 3FR7A 2QP3A 3F1LA 4MZDA 7YASA 4QNRA 4EB3A 1SZDA 2EHJA 1WU7A 2UUBB 2Y77A 3NBKA 3IV7A 3A27A 3ENNA 5CDHA 2X5KO 2AR7A 1GGMA 1PJRA 3FOZA 2HA7A 2QMHA 1UJ4A 4HEJA 3TOXA 4A2WA 1IHXA 1YQEA 1OHHA 3P4YA 2H17A 3NDIA 5B4VA 1U3FA 1FDOA 2PXAA 1Z07A 3KKLA 1W8DA 4F4IA 1IOLA 3Q11A 4URZR 4UU7A 4DABA 4LX0A 1ZGCA 2AC7A 1MAHA 1YS7A 4RDIA 2WVGA 3DMDA 2L18A 4H6VA 4PSAA 4K6CA 1EH5A 2WU4A 3FTQA 1K66A 2YL2A 4LZLA 5K8UA 1DAMA 4Z54A 2PEYA 5ERYA 5JYEA 2IIQA 4X7MA 5E7JA 4JFAA 1IAQA 4D25A 1PVOA 2UV8A 2Q6IA 3E9YA 3BRSA 4MR7A 4QTYA 4YMIA 3JQ6A 1EUDA 2JJ1D 3P2EA 4BTLA 1ZOIA 2HI0A 3C4VA 3OQIA 4DR2B 5DF1A 1A3CA 1BGXT 5FUWA 3C5VA 1L8XA 1TQ8A 4U6SA 1ZYUA 4FDVA 2PX3A 4M38A 1XA0A 1ZD3A 5AW1A 2VZ0A 5ULLA 3GLQA 3S81A 2IITA 5I7UA 2GA8A 3MYYA 2EFDB 3K9NA 4JH0A 1GG9A 2CNOA 2A5GA 1U5CA 2KQUA 3DEJA 4LZAA 4WZZA 4Y6OA 5ETJA 4IO0A 4UTNA 1LNZA 5HKOA 5CM8B 5HW0A 3WK6A 1Y0BA 3OPYI 3VUFA 3HL0A 5T4HA 4BXOA 4XB6B 3LIIA 4EHNA 4GXRA 3GLFE 3ECAA 3B3FA 3QFHA 4R16A 4UEQA 4ESVA 3P7MA 5PGMA 1JPJA 2W0MA 2OXIA 3HHPA 2OK7A 4AULA 4P22A 5J2UA 1R1DA 2NO5A 3AEKA 4P32A 5JTUA 3J7TA 1TM3E 4ZZ0A 2GXAA 4PEVA 4L27A 1ZC4A 1U5BB 1VG9B 2W5UA 1FPMA 2XODA 3BKWA 2MSCB 4YCAA 4CW7A 4WOCA 3K94A 4DV7B 2QS9A 4WJLA 4ERXA 2GJ8A 1MV5A 1WUHS 4LXUA 3TQIA 4EG4A 1XMJA 1SD1A 4RE6A 1SOWA 3QKRA 2ZUFA 2XCQA 1ANKA 1U4NA 4MVJE 4WY8A 5ALDA 2HU2A 3GC6A 4KV9A 5KO2A 2CDAA 3BK7A 3W8EA 2I29A 1E2JA 4LECA 4PGMA 1E79A 2OE2A 4MA0A 1C7QA 1EK6A 4AY5A 4DE5A 3FY4A 4JGGA 1Q1AA 3AO0B 4E5MA 1EBBA 1ZZGA 4F96A 3HUUA 1J2RA 2NU6B 1K63A 2WAXA 3N07A 4Y2VA 2XB2A 2Y0BA 4X63A 5DP1A 2REBA 4BMDA 4IJWA 1F7VA 5L6LB 2GJKA 3L0YA 3DEYX 4BVFA 1KDPA 3CUYA 1QHFA 3THYA 4H60A 5COQA 5CD9A 2FZCA 2R48A 1FL9A 4IO1A 4MMZB 1WMFA 2A9KA 2PXHA 3E1SA 4TWIA 1JQJC 2QLMA 4WBNF 1R5NA 2YJGA 1CQJA 5TGTA 5A4JA 4YAFA 1VL1A 2O3UA 2ZJ2A 4AJNA 2ZE6A 4FWTA 5EMKA 1KQ3A 3GFOA 4GLJA 5EFOA 4LPSA 2QRQA 2X4LA 3PDUA 4FEAA 3PE6A 1ZM4A 4RTOA 3OQNA 1P29A 2VS1A 5LMNB 4ND3A 4TKVB 4PRZA 1EIWA 3TECE 1H22A 2Y2VA 1T2DA 2VLIA 4KTVE 4OQZA 2EL9A 1IK4A 3QVVA 1GPAA 2WM2A 3JYQA 3I5MA 4JYMA 4OBXA 3ZG6A 4BNNA 2OD9A 5INTA 1LY1A 2P2YA 4CXMA 4WBSA 3JQ8B 2FF7A 2HK7A 3AESB 3T3DA 9ATCA 4DR6B 3IR5A 3DB1A 2FKNA 5ARDA 1Y3DE 3CY6A 4BNWA 1DKLA 3LUBA 3DZHA 4LZWA 4UATA 5EN4A 3RJZA 3U4CA 2VJMB 5CAEB 2KSQA 2CGEA 3EFOB 3RC1A 1Y9AA 3QX8A 4R9RA 3AY3A 1YZGA 3IAHA 1SBIA 4IVNA 2QNIA 4OGKA 1JBKA 1U0OC 3WNBA 5CA1A 3DDCA 1PSZA 3EWSA 2O5VA 3TLCA 3ET4A 1Z83A 1PNTA 2JJ1A 3M2PA 4FINA 1AQUA 5DHQA 4BOYA 5K99A 4K9NA 1RHQA 3H97A 5IC6A 3SR0A 2OLKA 3MJFA 3VJMA 3L8ZA 4QYIB 3VX3A 2IS4A 1A98A 1QKKA 3A7EA 2EBUA 3CPSA 4MCIA 1L7RA 4OA8A 1BXGB 4W99A 4AMYA 4EL0A 5LSAA 1W0JD 2B8JA 1V6CA 5DLDA 4A27A 2X4GA 1GDTA 3CWQA 5E7IA 1JWLA 3TIVA 4WNAA 2YMLA 3ZTTA 4NCBA 3KSDO 4NFHA 4BO2A 4E6PA 4NXMB 1GPYA 1YZHA 2VTBB 1RRFA 1LI7A 1V35A 1QV7A 4QQFA 4TLMB 3EVZA 4XCXA 4M1WA 3ZBUA 4JEIA 5EYPA 1AKRA 2V58A 2QX4A 4EJFA 2AMVA 2V5UA 1KMNA 1VE5A 4E5NA 4D4LA 2ERXA 4KO1S 4X00A 3CF4G 3L8DA 4EPWA 3N8IA 1JWAB 3HN6A 3NBAA 4LBYA 4H31A 3KDSE 4AJPA 2Z9DA 5FWNA 3AL0C 1NW6A 4BFWA 1KEUA 1B93A 5AW5A 1R9GA 4AY6A 4M87A 3DJYA 4ZOQI 1W581 2BGGA 1VHDA 1X80A 1JFFB 1XZPA 2QAGB 2R97A 4MYSA 3SP1A 4CNQA 1L3IA 4HUTA 1YK1A 2Z3WA 3MIIA 2HTFA 1L5SA 3BQ9A 3GVXA 3HBNA 3T4XA 3TVTA 3W34A 3WJ2A 3ZHBA 2HK9A 3ETCA 2ZT8A 4ZV9A 3ZIAA 2C94A 1ECCA 1PWEA 4Z99A 2GN6A 2BPOA 3RAGA 2VI5A 3S6JA 1EGQA 5LZ5A 3UF0A 3SX2A 2DR0A 1ZJ4A 4OYRA 1XDDA 3N53A 4EDFA 4ZJYA 2QN3A 2BDTA 4E14A 4ER6A 3L8MA 1Z6GA 5CCXA 1FQKA 3SX0A 2HHJA 3IVGA 4I1YA 4NSNA 4EM6A 1R5BA 2EOAA 4IR7A 2XMRA 1A77A 2CLIB 1FW8A 2M6RA 1IZYA 1UAGA 1K6XA 2BJVA 2C5EA 2ZI3A 2DWOA 3OOJA 4M55A 3FYCA 3I4FA 2QYHA 3GWGA 4UTZA 4IDOA 4QG3A 4XX0B 3ZV4A 1PD1A 4C88A 4DAOA 5KNDD 2BBTA 2CDBA 2IYPA 3BGSA 1QORA 4MUEA 1Y8AA 1U4OA 4BQQA 4NH0A 3HKCA 4NZYA 5CLFA 3QWIA 4ZQEA 3TW0A 3B52X 2AC4A 4FHCA 2I76A 1QO9A 2GB4A 2V74B 3GGCA 4MP6A 3TDNA 3UZUA 3ZXIA 4E5SA 4CEJA 2X9GA 3HJHA 3AJ9A 1IPEA 3D0KA 2Q3MA 1JDNA 3H1PA 3T6KA 3V1LA 4J9UE 2CNDA 1U0SY 1W96A 3I9KA 1KU6A 1QAQA 3UUGA 1YR3A 3FWHA 4KAAA 5GADl 4X60A 4QZVA 4MEAA 2Q46A 1FUEA 2LR0A 1SIUA 4NBWA 5UKDA 5ALNA 1UODA 2VWPA 5GM1A 1ZCAA 5JECA 3BL6A 5L7YA 4LF6B 1NQTA 2A67A 4IDDA 4I55F 4WN3A 3VH2A 3ONEA 3TSCA 2QJFA 2XOXA 4OBEA 2UZ4A 2OCLA 2Y93A 1RU3A 4GPD1 4LBWA 5K3FB 1ZD5A 3DUFB 1FFYA 3ZH9B 3ACBA 1KK2A 5JY1A 5FTLA 3IJPA 3O73A 1XP5A 4OLHA 1JAIA 4X97A 2EL7A 4UZSA 3EGVA 1GSIA 2GJ9A 3QIVA 1KZ7B 3GFSA 3NEYA 4UCWA 4X90A 5AW2A 4HBZA 5KS2A 4IFTA 3FOAA 5CVTA 9LDTA 2ZU6A 3DVAB 4LMPA 1FS4A 1H94A 4JJGA 5ERXA 4PYJA 2P35A 1SHLA 5EXTA 1N2JA 5FBKA 3MB5A 4PLGA 4XWKA 3CZ9A 4TSFA 2Q0XA 3SHTA 3H3JA 1MW8X 2FWAA 2IUEA 5LLTA 3WK7A 3A3NA 2IEDA 3UFBA 1OYWA 3PNQA 1E1CA 4M6WA 3VI3B 1F9AA 2IEYA 1OFUA 3LQKA 1TCAA 3HP7A 2REXB 3ABIA 3Q85A 2XY4A 5L8VA 3D8TA 5FBZA 2C03A 4V38A 1X80B 1C7FA 3YASA 5FPTA 3G1UA 2HSZA 3IR6A 1PZGA 3OQJA 4L2IB 4OHMA 3G17A 2P0AA 1GA1A 4C3ZA 4D92A 3T5AA 1G6OA 1L1FA 3OIWA 5KTPA 1EHYA 1P17A 1TF5A 4WKOA 1YFJA 2ONCA 5D8DA 1MPXA 2FUG1 4CV0A 1TF2A 1VKJA 1G1AA 3TL2A 4ZKDA 3HB7A 4ZEMA 5I8PA 4GM0A 1A9ZA 3AC0A 2J3HA 5DTIA 1DKRA 1X7WA 4G86A 4Y6PA 4CGYA 2CNNA 4LS3A 3V9PA 2G5PA 4D0RA 1H2YA 1AKYA 1ZIXA 2FX3A 3RIXA 4K9PA 2HRRA 4PG4A 4KLRA 1AOXA 2YJ4A 1Z82A 4HQLA 1A4UA 1K98A 4F3YA 2PGIA 4QQNA 4TUYB 1NJ6A 3GOQA 4RCYA 5EAIA 2HEIA 3HM2A 4NOJA 5FWXA 3RWMB 3PD0A 3H5RA 4GU5A 3RO7A 3O4FA 3QLUA 3E3MA 1G55A 4ODIA 1G5IA 5M34A 2VBGA 4LIPD 1S4QA 1J33A 5IDVA 3M7IA 2GFQA 2EXXA 3HVKA 4I4LA 4HAVA 4P3XA 2QLTA 1Z4NA 2JEYA 4XIJA 3VR4A 1ULTA 1NG1A 2OESA 2CWDA 2I1WA 2CVZA 1CQZA 3JYLA 3L8CA 4IFBA 4WAUA 2A59A 1Z5GA 3EXFA 2M1ZA 1SHTX 3DTNA 1HEYA 4E5PA 3ECCA 5AWFC 3ENZA 4BO3A 4DS3A 1COWA 1AGXA 1FY2A 2VVTA 1KPGA 3WRVA 4IYRA 2NU8B 1N9ZA 4LE2A 3NAZA 1FW6A 1L7DA 4GKVA 5DU2A 4J7UA 2MYUA 3HK2A 4CUJA 2HFJA 3P20A 4Q7EA 4RMIA 1YBFA 1JEOA 2VR1A 5DASA 4GOJA 3I12A 2Y6VA 4WJZA 3ADBA 2ZRJA 1ZGHA 3ABSB 4MI1A 1MLDA 1H0HA 3L0OA 1OGYA 1KYIA 2PN1A 2WK1A 5I9MA 2HZ7A 5FHQA 2AFHE 3BXPA 2BFEA 5KTYA 1K06A 4F11A 3D8UA 1VJGA 4HLUA 1WU8A 4LN1A 1RZVA 5AM2A 2GZSA 1QRSA 3CPJB 1JVNA 5IZCA 1KJQA 4YQEA 2X5OA 2WPDA 1I9GA 4EB0A 1YR9A 4EZBA 2IX9A 1ECBA 2FPOA 2P3LA 3O21A 3IIJA 4GDMA 1V8BA 4FQ5A 4U7HA 4ZVPA 3O94A 2WVAA 2H1LA 3OZBA 3VR4D 2VJYA 1CUCA 4R1OA 1DQPA 3SC6A 4E4YA 5B1YA 3MAGA 4CIWA 4US2R 1M7GA 1TA9A 3BIFA 4IVRA 4EATA 1HEIA 1GG5A 1E2QA 1UXOA 2C9DA 1DAEA 2CB9A 2JKZA 2HDNB 1DTEA 2PXXA 1RRPA 1N7JA 3GZJA 2IC5A 4MPRA 4OJTA 4PQFA 5DZSA 5FBWB 5BRNA 3VR3A 4G1MB 4FDTA 3QF4B 2H0QA 3PFHA 4UUOA 2Z9BA 5FCDA 4B46A 4UMFA 3TQSA 4C76A 2JIDA 2HMVA 3T5DA 4ZQHA 3PC3A 3EY4A 3RUAA 5EJ9A 3GWZA 1U8YA 1RDFA 3I53A 2EVWX 3KR9A 3R7NA 4CU5A 5DPMA 3PUWA 1LTKA 2IZOA 2CDNA 4R51A 4RQTA 3SBEA 4AYTA 2Q5JA 4OQLA 3NW9A 2ZS8A 1DDOA 2I78A 2I3DA 2NVOA 1NXQA 3MCWA 5H7XA 1U7HA 1Y5RA 3AYXB 3CB2A 3UJ3X 1BDJA 1US8B 1YIOA 2B5OA 1QO0A 3ST7A 5AUPB 2GLXA 4M3NA 4ZU6X 3S1AB 5KSWB 2WWXA 3ZY4A 1J49A 1KJZA 2H16A 2VJDA 1ATIA 1QE0A 1ZOSA 4M83A 3TW6A 3WWYA 2OXTA 3SLGA 4F3NA 2GM3A 3GH3A 1DZ3A 1ZIOA 2LZ0A 2P30A 2PZJA 4QT4A 4V0KA 2OUKA 2XHZA 2JHPA 3R9WA 2C9ZA 3OPYA 3OE5A 1JG3A 1UQUA 3ELWA 4WK6A 1SCJA 4QU9A 5E3HA 3DPUA 4CF4A 3ZCRA 4CMKA 4PVCA 3IA7A 5ALVA 1DG1G 1DO2A 2D0OB 4KQWA 1JEJA 1V1RA 3PQ7A 1KI4A 2F59A 4BP1A 1QV9A 4UPDA 1JLSA 3G0OA 5T4FA 1OTXA 1T9ZA 3DLIA 3U7EB 1RHKA 3LT5A 3T3EA 1E3SA 3T9AA 4JUBA 4HZUB 1JJVA 3EEFA 4IILA 5KYWA 4B6RA 3RHSA 3RT7A 4EITA 4KPUA 1ZK1A 3JATA 2P77A 3G82C 1N2SA 2HDOA 2I80A 4FT2A 4I4TF 4G37A 4EPVA 1KOJA 5D3QA 4ASUA 1ND6A 2XMCA 2AWNA 2OWEA 1DC7A 4KMRA 1NZFA 2IYYA 1QUEA 1VSQA 2X15A 2VZLA 4Y0AA 1EJ0A 2VT7A 5LVAA 1P5JA 4YJGB 1KWKA 4DIKA 1CY8A 1X1CA 2CHQA 3D3QA 5EPEA 3N0WA 3UHJA 5KVSA 1JEDA 4BO0A 3P94A 3JQ9C 4BJ3A 1K0UA 1YTLA 4TWZA 3RUDA 1PG5A 4QVGA 4W1RA 1G5HA 4KE8A 1L3BA 1TA0A 3QLTA 5A3QA 3Q8KA 1SGWA 3ITKA 4BV8A 1K3TA 2AQKA 4IRUB 4D82A 2ETVA 3BCHA 3MB8A 4ZU3A 1E3DA 4I4TA 4RSRA 4DCPA 3U7JA 1I9CA 2O7SA 1SK9A 4MDHA 4YRQA 2FN4A 2R00A 4V1CI 2P6MA 4B3FX 1XFDA 3GMIA 4CIXA 1ECFA 2BP7B 3R20A 4M1OA 3AEZA 2IHKA 3T15A 4EB6B 3DHEA 4OQXA 4AMZA 4AZ3A 5JT1A 1LU9A 3DEZA 2FK8A 1UH5A 1AU9A 2FJUA 3BG5A 2D00A 3PKIA 5JAHA 3IXQA 4GUAA 4NE7A 4PGFA 2ESRA 5DNVA 2J9RA 1AKQA 4FGZA 3RANA 2VAWA 2ZXUA 2H2IA 1QQ6A 3BBPA 3WGMA 4FI3C 2WVJA 4I50A 3ZQUA 1WDTA 1OIXA 3TLJA 3CTMA 3OQIB 4Y2UA 5AKKA 1JKJB 3C45A 4KQFA 4S05A 2H1OA 4A2CA 2FDXA 5BUSA 3HA5A 4ZYXA 4GIBA 1HKHA 1L1QA 4NZPA 3HCCA 4QJ4A 4AZ0B 1Q57A 3FHOA 2R25B 1AQLA 3Q7RA 3IXMA 1G21B 2RK4A 1ZW6A 1T9BA 4H6WA 4GMHA 4QQRA 4HVLA 4RC9A 4RHEA 1CHDA 1T5TA 5EUCA 3VPHA 4QU5A 1YONA 2HH9A 3GLFA 4N9WA 1NKTA 3RYFA 5JG7A 2GF0A 2H9AA 3H18A 3MGBA 4XQCA 1RE1A 3L8EA 1L5WA 3QUTA 3TLAA 5T6MA 4RLFA 5CB4A 3CE6A 5EJAA 1N2ZA 2PX5A 2ZIAA 4I3HA 1SURA 3BDAA 1P0PA 1Y33E 5KMGB 4ARIA 2REQB 2RI1A 3ROQA 1YZLA 4IXMA 4J4BA 4ZOLA 1F2TA 3KD3A 4BNTA 5L7WA 3AESA 1XSEA 4G07A 3ISTA 3Q7TA 4XD7D 3H5WA 4KI0A 5IBQA 1QGOA 3GNLA 4PGAA 5LYJF 4LRXA 4B3XA 1OAOC 1EP2B 1TT5B 5LQAA 3AZOA 3HJCA 3GX1A 4TOIA 3ZGYA 4ZREA 2QUIA 3D7SA 2AKEA 3TD9A 4YMUA 2XYGA 3IP6A 1LRLA 1NN5A 1P8JA 4GPIB 2FWRA 1JLLA 4PC3A 4RTPA 3HO6A 5HBRA 4AKSA 1FLDA 3H2YA 2JIOA 2CHUA 3EIEA 1CJSA 1RPAA 4YCDA 3W3AH 4ENUA 3ZWOA 4IMRA 3HVJA 1BMTA 1X39A 1T36A 2W83A 2WIBA 4I6EA 2PR2A 3FGZA 4HX5A 4ZQCB 1Y48E 1MNQA 1NI3A 3OZGA 1N1EA 2E1RA 3ISVA 3ZHZA 4ZCTA 3V2IA 3ZHUA 3M1AA 5C35A 5K01A 2IH5A 4HAWA 2EW8A 1XGKA 1YDMA 3I5UA 3LA6A 4YAOA 5EP3A 1MVNA 2B94A 4ZHSA 3DZIA 5AVXA 4KXVA 1C0PA 1E7QA 3GUHA 1EWVA 4TWAA 4X45A 3U31A 1O95C 5ADWA 4F4UA 3H2SA 2RIPA 1YRYE 5EIBC 4WKNA 3B6MA 2PL9A 3GNQA 3C3KA 2OP0A 3CKYA 3I09A 4C87A 3F98A 1FYEA 4L76A 3WYBA 2IIBA 2V6IA 1BKYA 2EKPA 2X2FA 3CZ5A 2ERCA 3TL6A 3R7LA 3OESA 3ZCVA 1TZCA 2RHGB 1HK7A 2PT6A 3H4MA 4OYLA 2QTTA 4RCVA 4WVLA 4AUNA 4ZGBA 1GTSA 3DLTA 2EX1A 3ORRA 4IQ8A 2ZM5A 1ODSA 3MWJA 4AS2A 2BF4A 2KJQA 1Q22A 4L02A 5KTOA 1XJCA 1E99A 1OFHA 2V7XA 1YS6A 3JAWA 4QPZA 5C1OA 4OUKX 1QFMA 2HU7A 2PLAA 4DV3B 4AJKA 1V95A 3LTNC 1I80A 2VNIA 1QZTA 3H9CA 1ABBA 1CE8B 4JIGA 1LK5A 2LCIA 3RBAA 3UW3A 3K15A 421PA 1MX3A 3EXEA 3NBXX 1RC8A 5EKSA 3C5CA 3NKLA 4I50B 3HFGA 2B7CA 3R3VA 4OBWA 5GJWC 4FOSA 1YUBA 1U8ZA 1LSJA 2RHLA 1I7LA 1RD4A 2NACA 3A4LA 3LDFA 2L0XA 3NATA 4BMZA 4UTVA 6REQA 2C4NA 3QXXA 5TS2A 3AR8A 1MAUA 1KRHA 1YQQA 5C4IA 4EI2A 4AVYA 1VP3A 1ZFNA 1WDWB 3NT4A 8GPBA 2YC4C 3NWPA 1F51E 2EBWA 2GEDA 1UUFA 1IHDA 3OT1B 2N1BA 1DEHA 1USVA 1XP8A 3PFKA 4ZICA 4IGKA 3UGTA 2QP4A 2BCEA 2B3TA 2ZIVB 4OQMA 4KX3A 3VC7A 4RHCA 4YP9A 4R41A 3H1FA 2R4TA 3PFCA 5B3LA 5FWDA 2A3RA 1T4DA 1BVUA 2ZFUA 2D3TA 3ZI7A 1EUCA 2D7CA 4UNSA 2RGYA 4PR0A 4WLFA 4LJSA 1HWYA 3CM0A 3RREA 3ZDBA 4F4JA 3OQOA 3WI7A 2YRWA 4EOGA 1RVV1 4YRBA 1V43A 1SUBA 4OMCA 4YH1A 3AEUA 1AK9A 3OIFA 5CGZA 4ZAXA 4EJ0A 2JD1A 2ZITA 3DFUA 4CZ2A 5HRCA 1RADA 3DH0A 1PJTA 1J5EB 1LLQA 2IYSA 4JI4B 1JH9A 3SZLA 1Q50A 4LNHA 3QPCA 4UBNA 4UE3S 1G7TA 1DCFA 2GWHA 1G59A 4WXHA 1BRMA 1CJKC 2HF9A 5D6NA 5HF8A 4EI7A 1IHPA 1RMQA 3GXOA 2B37A 2MSEB 3EE6A 2IU3A 1L4NA 4QDKA 1XCPA 3LUFA 2ZIXB 5FX2A 3JD2A 4RTJA 2BKEA 3OA2A 4LY6A 2UAGA 3M5CA 5GIPE 1P0QA 1TQHA 2DFTA 2VXCA 2VNKA 3H7AA 4GI1A 1GILA 5JYDA 1OMOA 4F3TA 2FPGB 8AT1A 3E7DA 1EE1A 1C7IA 3ILXA 1GPDG 3QHQA 5A9TA 5SY9A 1YJQA 3MINB 4IDAA 1KEZA 1JHRA 3U16A 1DV1A 5JMWA 4BMCA 1V11B 1JB9A 2EDAA 1GT6A 5DN6A 2PJRA 1MF7A 2FW6A 1CF4A 2C95A 2RKWA 3PJGA 4RFVA 1FTSA 4C4YA 3P0IA 2FSPA 2HNKA 4TT3D 3WXBA 1RJFA 5CDUA 1YQXA 2C0PA 2V54A 2P9HA 2ZE8A 4UAUA 1RCUA 5DP2A 4B5KA 1X7DA 1YI1A 3HN7A 2AR0A 2OP1A 3SXPA 1E2LA 3UMJA 3WZMA 2IHUA 1T0IA 2X4DA 1FE8A 2XHEA 4YFYA 3O0TA 3AF1A 5J23A 2CHFA 2P11A 1SCUA 4OI2A 4W5RA 4HXYA 2I1VB 2KBEA 5KYKA 1SU7A 1ZH8A 4B8YA 3HFJA 3ODGA 4YRNA 1OAOA 3Q15C 2CZCA 1M67A 3V4ZA 4DKXA 2QTLA 1RI3A 2QT9A 3DCJA 4CN8A 1OLSB 2JCGA 2P2ZA 3I1FA 3B9BA 1ZJWA 2VHYA 4DLUA 1TC1A 2HF2A 3H04A 4CF7A 3ID6C 3RU9A 2ZU0C 5KC8A 4YXWA 3L8GA 3MMSA 1E1LA 3KFVA 2W8BB 5BT9A 3KJHA 3I8XA 4ZCMA 1GL3A 4Z49A 2OD7A 4RUKA 2O2JA 1T5HX 3AP2A 3PGLA 4GC5A 4GLLA 5HKKD 3GLGA 3BIJA 3LT2A 1W0CA 3HSYA 4GZ3A 3WGYA 1ENPA 3LECA 1M66A 4EKDA 1EVQA 3FCAA 3OT5A 4BMYA 4MVYA 5JZOA 1GKYA 3NBQA 3AJAA 3CGWA 4FCWA 4NMHA 4G4SP 2X13A 3K73O 2LIPA 3ZIAD 4YUXA 4TZ0A 4EQ6B 5F7XA 4LHWA 3JQAB 3NOOA 1N9GB 1ZBDA 2HLNA 1EX1A 4KQHA 4MV4A 4Y2PA 4PQYA 4YR9A 1T15A 4FYPA 4YS6A 2MSDB 5KAMA 4F5EA 5AW3A 1Z4QA 3AI1A 3JVUA 4FGSA 4XM1A 1ESDA 2ONKA 3L7KA 5ALOA 3HY4A 1T6NA 4WA7A 5JBIA 3EXFB 4NHOA 3KZKA 2HCTA 2OCDA 3IEXA 3IDAA 4RA9A 2ZCJA 4Y2SA 2YVLA 3EF1A 5DLPA 3DPIA 2CF5A 4EARA 3NJ8A 1SWWA 1DPGA 1ENOA 1E9DA 2ZBDA 3DMHA 3P4XA 5A3SA 4HYTA 5P21A 4PVDA 2IYEA 3DKRA 1XZBA 4IX9A 3UOGA 2RKBA 1EP3B 4IDPA 2ECQA 1CT9A 3QX9A 1R6XA 1X19A 4PWYA 3CVXA 4B3SB 2YZNA 1OF1A 5D5PA 1ZXBA 4X3PA 4BE7B 1BZYA 4M1EA 2XA1A 4MUIA 3THRA 2RG1A 4FCVA 1LTQA 3BILA 3B60A 2WAAA 1G7CA 1H1LA 3SE0A 3P5SA 1EPUA 1SH7A 2V7EA 3AIIA 3R09A 2OSBA 4E88A 1JFTA 3DE7X 3O31A 1THZA 2VSOA 4MQFA 3P9SA 4YJ3A 3GJXC 3KP1A 3NXSA 2PVPA 3TYXA 3EX7C 2ZAOA 5IYZA 4M22A 5FO0A 4DANA 4NDAA 2WFAA 1ZJJA 5EMMA 3LFHA 2HBRA 4IDFA 4CKXA 3OUZA 3IULA 4L9AA 4D1YA 3SE7A 1EQAA 2UZ1B 4OP1A 3HY3A 1AM4D 5EIWA 5B1DA 1O08A 1Q1GA 1LDGA 1TL7C 1NUHA 1Y4UA 4NFYA 3TLGB 2JZCA 4CLRB 2D1YA 3BCRA 2JGMA 2TECE 2OLJA 1D0IA 3D8BA 2C5HA 4N4AA 2JCVA 4X5OA 5TT0A 1K3UB 2GKOA 2WNIA 4BO5A 1FSSA 1H93A 2DHQA 2DFVA 5AK3A 3K2EA 5SICE 3QSYA 4FILA 1M0WA 2Q1TA 1KK1A 2ZTLA 1HI9A 5DNEA 1XTKA 5B53A 1QR2A 5K3SA 1TZKA 3BFXA 5SYAA 4PYOA 3FOFC 4CFZA 1UXHA 2CMGA 5FULA 1XD2A 4PN3A 2QT0A 4G5RA 1GEGA 5EKXA 1I0ZA 1TUEA 1XDZA 4FXOA 5ALHA 1J7JA 3EWIA 4Q3NA 4MYCA 3RJTA 2GK6A 3EMVA 3EZNA 5ES4B 3B7GA 3GPIA 4JLWA 3M3PA 1HY3A 3QOFA 4PGGA 4C0QC 1DC5A 2N75A 1M2EA 2W6ID 4NAHA 3BJZA 5F76A 5CCBA 1WABA 1BJKA 1U8XX 3RJ5A 4TTTS 3KPJA 3VUEA 4D98A 5I48A 2Q6KA 1RHJA 3E18A 3CUUA 4ZVKA 1DXQA 4PLHA 3D7MA 4EW1A 1GTRA 1NM5A 3PLRA 3LPLA 5GP1A 1UT5A 5EE5B 1KYTA 3I32A 1NFRA 3MGKA 4KL8S 3RVOA 2D1QA 3B8HA 1Y6QA 4IWXA 1Z4PX 4QOJA 5HFJA 1VI5A 3OZCA 1C8LA 3L4BA 1KERA 3U3DA 4X1OA 2C77A 4NARA 2PRYA 5DTQA 2WFLB 1TMKA 4PFQA 3I9FA 4EG3A 1W88A 3MK31 2C42A 5K0NA 2UVPB 4HN4B 2P68A 4TX1A 2R1VB 3HYRA 4DMHA 5A06A 5ALRA 4S0XA 5LB4A 5B1IA 1KF0A 2W22A 4MCAA 2GPWA 3F7NA 2PL1A 3CRMA 5A5GA 3KOOA 3ZLUA 4YROA 4GR4A 5J2UF 2B2XA 1LLDA 4HEQA 3FCOA 5ESDA 2D5LA 4KRFA 4EKIA 3GFBA 4BQNA 5BR8B 3BWEA 2AUNA 3EFBA 1U8UA 1OKKA 3HA7A 1U0RA 2GEKA 4JOCA 1XQXA 3ZPXA 4D3DA 3CUWA 3ADDA 2WF5A 1U2PA 2C9OA 5AKZA 4WW0A 1S01A 1YB7A 3F5DA 4ZOCA 1NQOA 4PHCA 2DM6A 3T3MB 2BDEA 1DQYA 2OBFA 3V7UA 2FMTA 1FTGA 5EUQB 4DJEC 1P74A 1UXGA 2PMKA 4ZANA 4RY0A 2FOXA 2P2SA 1ZGBA 2IYOA 1GR1A 1HLPA 2J5RA 2W43A 1N6OA 1I3NA 3U4GA 4YCLA 3EGXB 1P2VA 2I2DA 1NW5A 3QLEA 4ED9A 2IDJA 2VH1A 2IYVA 2QD5A 3DOIA 1WZEA 1RHRA 4MPTA 5DHFA 1A7JA 5COAA 3KPYA 3QMPA 5HQ3B 3PB3A 1S2LA 4LQCA 4F4DA 2WIFA 3THWA 2FU5C 4XQGA 3PC7A 4L7QA 3L7MA 3A0UA 5AO9A 3NJ4A 4U8GA 3LQQA 1X1QA 1XZLA 2FP4A 2MSNA 3DL0A 1GPKA 2CE2X 1DHTA 3IOCA 4M60A 4KVFA 5DB4A 4BLSA 3Q3JB 3I6YA 1J9EA 1FRFS 3I1IA 2I03A 3KQWA 5C4MA 1HLGA 4MPJA 1W4RA 3IBFA 3RVNA 2YWHA 2IS2A 4EUHA 3IUQA 3OX1A 1KMCA 1G2QA 3PVCA 3NU1A 3HG7A 1XJQA 3X2EA 5JATA 3HXQA 5JZ9A 2DBZA 3SEAA 4YTEA 3IPCA 4PS0A 1ODCA 5GTDA 3FZGA 1OBCA 1V1MB 2Y71A 3HKEA 3LHKA 4TZKA 4Y9RA 7REQB 4YT8A 3UYLA 1LFDB 1HDIA 2ST1A 3KAJA 5E6SB 4Z8XA 5FIUA 1F8XA 4Z3KA 5KNCH 3V4RA 3ORYA 1F6WA 3GJ3A 3W2EA 1JDSA 1AF4A 1SXJC 1E6KA 2XOEA 1JFRA 4UUAA 4AZWA 1QYRA 3B5IA 3NDPA 4GRAA 5IVDA 3A1TA 1Z2CA 2VP6A 2WILA 2XOKD 5CFQA 3D1LA 1J23A 2ZBEA 1XMOB 3R9KA 1I2BA 1QSGA 4JBNA 1MC4A 4M1YA 1N57A 1BWQA 4EJSB 4F2HA 4EY4A 3EUWA 2ZPTX 1NVBA 4MWEA 1G5RA 1W34A 1M6NA 2BKUA 3CISA 1KBZA 1NUPA 1YI0A 3O90A 2X6RA 1VBKA 1C2TA 4KZKA 2VYVD 4P3NA 4RSHA 1I5EA 2IPNA 2JGEA 1Z8DA 1YR1A 4AKTA 3QBVA 2F7SA 3LPAA 1LW7A 2QGFA 2IYZA 2GCIA 4Q4AB 2QE7D 5HNKA 1C5KA 2IHTA 2QRKA 4M0CA 4OB8A 3A05A 1IHUA 2JW5A 4KOAA 4XRRA 4Y2RA 4DRZA 4N41A 4PPYA 1PV2A 3S2UA 5BNZA 3AHCA 4WECA 4RBNA 2AE2A 3N2KB 2IYTA 3OPXA 4G5YA 4BZZA 1U1DA 4CG0A 3ZNNA 2DFDA 2ZRIA 1SOUA 1OBFO 3A4MA 1TYAE 3K0BA 4JBGA 4L16A 5DI3A 3ESXA 4Y9TA 1P7PA 3R7BA 4N49A 2NSYA 4ALLA 4BLWA 4DEVA 3MEQA 2XBLA 3OX2A 1FNCA 1ORWA 1U6IA 3C3MA 3O8QA 3S2SA 5IFKA 4S1PA 5CB8A 4DV4B 2F9FA 3CLHA 4U7DA 2WIKA 2QTHA 2HF7A 4Z4IA 2RI6A 2ZSBA 4H7FA 3G2QA 1GP2A 1CUDA 5IWAB 1CJBA 2GNOA 2QQ0A 3FAKA 5EE0A 3G59A 3TLYA 1AHHA 1CDEA 3EIWA 4HX9A 1SHUX 2WKWA 3D64A 4NE9A 1JAXA 2GVDC 2HA4A 3I5AA 4JOQA 4BBZA 4GEKA 3WLAA 5KYYA 3EGXA 5IJAA 1GIAA 3BTSA 1Q84A 4AW9A 2VPPA 1H23A 3KTFA 2DUWA 3GROA 3TZBA 4XUCA 1ZMXA 4KVZA 4GZLA 4BE4A 3WO1A 4N3BA 2DWCA 4AMGA 1IE3A 3EY9A 1JHZA 2L17A 4JS0A 2V3WA 2YXEA 4BV9A 5ELLA 3LWNA 3U44B 3FR8A 4UTOA 1AKEA 5TQ0A 4F71A 1RJGA 1YK0A 4B43A 2BT4A 2R6FA 4EGJA 3FGNA 4RTLA 3IDSA 4YJFA 3SVTA 3A11A 2FSHA 4D9JA 2C8VA 4RAQA 2YFYA 4GI5A 3C8MA 1HNWB 4RSMA 4JJFA 4P08A 5I5EA 4LJYA 2VZ9A 1JQEA 1USUA 2G83A 5BYAA 2O2ZA 4MKIA 4KDRA 3MWKA 4L85A 1ZW1A 5ALTA 1DINA 2KBFA 1LF0A 3CIFA 4LRWA 2AHOA 2CLFB 1FK8A 5THKA 1LKZA 1W9HA 1C41A 4OMFG 5D84A 1JIQA 2B5WA 1GLVA 2JDID 3LO8A 1P2GA 1KEVA 4BL5A 1XAJA 3G68A 4N82A 5CT4A 2O4CA 4WMLA 3PEFA 1RT9A 3JWEA 4AIIA 1RJ9B 3OU6A 1IH8A 3AM5A 3C6YA 4M0KA 3OY7A 4QOEA 1X7YA 1HYQA 1SVWA 4KJXA 4BGUA 4LJRA 5JPDA 2H06A 4UZFA 1VA5A 4XGQA 3RGGA 1XX6A 3WDMA 1L5FA 3A9RA 3HNOA 3TNFA 5DBFA 2J85A 3F6YA 1GRVA 4BB0A 2HQSA 3KELA 5SZHB 4R69A 3CEJA 1AUVA 2DPLA 2XRMA 3QEMB 2EQ5A 3AF3A 3LY9A 4RAOA 4R8RA 2FFRA 2NT4A 3IVMA 5KJEA 4LRUA 3FVTA 1QH9A 1V6AA 4L8WB 2YUIA 4TLCA 4U6NA 3FH0A 1ECGA 4JB3A 3COWA