1ISGA

Crystal structure analysis of bst-1/cd157 with atpgammas
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bone marrow stromal cell antigen 1
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 85
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1isgA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1isgA02
3WIDA 4R5HA 1R4NB 2YFHA 3LT0A 3HADA 1Z6ZA 4MVJG 5EERA 1PGJA 3D3EA 3UF0A 3IAHA 3OA0A 1IYZA 3NUGA 4NG5A 3WQSB 1VKOA 1X13A 2Q1TA 1W0CA 3K9QO 4JK3A 4XRRA 4O0LA 2DBZA 2O4UX 2DTXA 3ZWXA 2RCYA 2VHYA 2YDYA 3WICA 2IRWA 1LDGA 3DTTA 4CLRB 3QJ5A 1XG5A 4WCDA 1E5QA 3ZDFA 1WXDA 1OBFO 4P4LA 3JQDA 3RC7A 5CHEA 1EUDA 5EMHA 1HDCA 1W6UA 3DFZA 2VOJA 5JAIA 4P38A 2X8LA 3ZHXA 5COBA 1MXHA 2Q3EA 4GX0A 4OHUA 1SC6A 4OSOA 3A14A 1VL6A 1DAOA 3VKVA 4CMEC 2Y1EA 4LMRA 4FFNA 3JD0A 4B4OA 5IZCA 3OJOA 1VLLA 4PLZA 3RIHA 3OETA 4HKTA 4NJMA 2JD2A 2V6MA 1DEHA 1LDMA 4E5PA 4EUFA 1VI2A 1WDLA 3AM5A 3DHNA 3GRKA 2HCTA 1NX6A 2RAFA 3H3FA 1N1GA 3I9JA 3LYLA 3COSA 1GUFA 3C7AA 2WM3A 1K89A 1D1TA 4EGFA 5DULA 3LC7O 3VH4A 2C54A 1SB8A 3DMYA 5DDIP 4RORA 2QIOA 4RVSA 4WECA 4BGVA 1BTOA 1TEHA 4KZPA 4GMGA 1U3TA 4BNIA 4XGNA 1OI7A 2J6IA 1HEUA 1A7AA 4I5EA 4WUVA 3GK3A 3ASUA 3H9QA 2PLAA 3JD1A 3PYXA 5JC1A 5EN4A 2JJYA 3E5MA 1L7EA 3DZKA 2YHIA 3WX0A 1LRKA 4PN3A 2X0RA 1RKXA 3TZHA 4NBRA 1O94A 1C0KA 2IZ1A 1DLIA 3KO8A 2QW8A 1D8AA 3P7MA 4D46A 3R1IA 3ZWPA 1DC5A 2H63A 1PJTA 2UDPA 3TOZA 2W98A 3IJRA 4W6ZA 1ARZA 4J1TA 2DT5A 4IIVA 2BHLA 1EQUA 3D5TA 2WEKA 3WMXA 3I4FA 1PL8A 4FOOA 3GVPA 5JDCC 4CM4B 3VTFA 4ZN6A 1SBYA 4W9NC 2IE0A 1YJ8A 3K2BA 1KBZA 2Q50A 3EZYA 4RL6A 1UDCA 3OIDA 4I1IA 3U4DA 2VHWA 1GPJA 2AA3A 3QW2A 5HS4A 4FFLA 4UEOA 1MGOA 4JJFA 5CPFA 3ASVA 3RFTA 3PFFA 4BB6A 1JWBB 1H0KA 3C24A 1HE3A 4MKZA 3DEYX 4PLPA 2B36A 1I2BA 4M8SA 3KEQA 4KDFA 4L74A 1Z73A 1YOVB 1PL7A 2P4HX 2J3KA 1LNQA 3IL2A 1EBFA 4XYGA 1NPYA 1Z74A 4IPTA 1LRLA 4W9NA 3RUIA 2ZK7A 3AY3A 5KJ1A 4PCVA 5TS3A 3RBZA 1ZJYA 4J4HA 1GV0A 1NVGA 2PNFA 4XRGA 2V6GA 2RIRA 3LVFO 3FPCA 4XX0A 5A9RA 1KC1A 4BO4A 3M2PA 4IDEA 4PLVA 4CM6A 4CMIB 5DT9A 4DREA 1NNUA 1C1DB 4E12A 4ZICA 1LQUA 1YQDA 2PA3A 1E7YA 2C2XA 2BKAA 4TKLA 5AYVA 2DTEA 4RQUA 5CDSA 1YB5A 3HN2A 4YRBA 2C5AA 4D44A 1Z82A 4FC7A 2V6BA 3IOYA 3RU9A 3KUXA 1P31A 2WYWA 5AXAA 3Q2IA 1UDAA 3WIEA 2I67A 1V0JA 4AJHA 1ZW1A 4AL4A 4HFMA 4DXHA 1U2DA 1C0LA 1LQTA 4IDFA 4ZQGA 4IJUA 5DF1A 3GPDG 2WYVA 4J7XA 5K9ZA 3H2ZA 2VUUA 4CMCA 2DUWA 4KUGA 3D4NA 3HUDA 3BZUA 4ALLA 3OJEA 5BNTA 1HE4A 1U8FO 2F00A 2VHVA 2X1HA 2B4RO 4OYRA 1LSUA 1MLDA 3QWBA 4IS2A 5G0SA 3VZSA 2RBEA 1PS0A 3JQAB 4YT4A 4XA8A 1X1TA 4PLHA 3LSYA 4WCFA 1LBEA 4H3VA 1R16A 2I5PO 2A94A 3DBHB 1MX3A 4RCVA 3WOHA 3Q6IA 1GL3A 4WK6A 4YEDA 2DAPA 1F06A 1N8KA 2HMVA 1E3EA 1NR7A 3GMDA 2FR1A 2XXJA 1PZEA 1CYDA 2DKNA 4FN4A 4ZJUA 4DIBA 3HFSA 2B4TO 4OKIA 2CNBA 4KP7A 2AXQA 1X14A 4YJHA 3WYCA 2OOSA 4R1NA 1LTHR 2AW5A 2NQTA 3JD3A 3WMWA 4NHEA 3WGYA 4R1TA 2VZ9A 3VVBA 3GGGA 2NACA 2EXXA 1M2WA 3GNTA 4IDGA 2X9VA 4UUMA 2HK7A 2O7SA 1ENYA 3IP3A 4IUYA 5IZ4A 1U8XX 3EDMA 2GZ2A 3ZWBA 1UR5A 3G17A 3Q9NA 1FF9A 4AJNA 1T2EA 1UDBA 4Q3DA 5GMOA 2GN9A 5A3VA 2BGMA 3ZNNA 4MPDA 3FBTA 1DLJA 1BVUA 4EW6A 2DM6A 3H9UA 4QEDA 3QWFA 4CMBA 4YJFA 4DBZA 2E49A 4YJGB 1LC0A 1QYCA 2AHRA 4UAGA 5THQA 1T4DA 1ISHA 2HJSA 2YHUA 1R4NA 4UVDA 3RUEA 3MCVA 3K5PA 4GLLA 1K5HA 3DTYA 3X2EA 1H2BA 3ZWCA 4NH4A 4IDAA 2NNLD 3QSGA 4YYZA 4ILKA 2Y0CA 3V8BA 4BS9A 3KBOA 1BDBA 4PRKA 3KOUA 3DR3A 3KYCB 1RM0A 1PJ4A 1Q7BA 1C3VA 3QP9A 4YRAA 2PZLA 3F4BA 1GAEO 4R1UA 3H8VA 4OXNA 4XGKA 4RVGA 4J91A 1LDBA 4CLRA 4BO6A 3VPSA 8ADHA 1CETA 3D64A 1A27A 2UYYA 3V5NA 1H6DA 1Q7CA 2X0JA 3HNPA 1TI7A 1EVJA 3F3SA 4IS3A 4QQRA 4XQCA 4CV1A 5KVSA 4J9UE 1XQ1A 3TZQA 1HTBA 3KHUA 4S3MA 1E1LA 4AVYA 2Q49A 1X0XA 3L07A 3BXXA 1DHRA 3PVZA 3R6DA 4U6QA 3H5AA 4F45A 2GR9A 4WJZA 4NFSA 5JCXA 4F6CA 1XA0A 1EVIA 5EIOA 1HYGA 2JCYA 3RD5A 1F8FA 3HDYA 3D7LA 3GN2A 2PZKA 4BQRA 4DWVA 1DPGA 1PL6A 3ST7A 2NVBA 1XDWA 3GFBA 1GZ4A 2C7GA 5TSDA 2C0CA 4OGWA 1HYEA 3H2SA 1CIVA 4WNIA 1C1XB 5B1YA 2JFFA 1A71A 3RFXA 4EEXA 1IL0A 1ZNQO 3VPFA 4CMGA 3CH6A 2HRBA 2DUUA 3FPLA 2J3HA 1DXYA 2H1SA 4UVIA 4BNTA 3GG9A 4Y8VA 3WWYA 2NU7A 4E5KA 3QVSA 2Z95A 3WJ7A 1V3VA 3FI9A 3OBBA 2VQ3A 5F5LA 4KWIA 5HWSA 1VC2A 4DMLA 4FQ8A 4DIOA 5A3JA 4CM1A 2YV2A 1EZ4A 2OL4A 3DMTC 4LSMA 4AJ1A 2PKRA 5T8KC 1U2GA 4IXWA 3BAZA 4PG5A 3F9IA 4FIZA 1UXIA 1ZCJA 3I9MA 3JQBA 4NNJA 3GEDA 4WOJA 4RPGA 5HTOA 2NADA 1LSOA 1P1KA 4OOEA 4B8ZA 4CM4A 3L4SO 2IYPA 3V2UA 3IJPA 5C7LO 1YH3A 2Z1MA 1P77A 3KYBA 4J2HA 3ENKA 3DBLB 2ZB4A 3R3JA 3WLEA 5CPBA 3L6OO 1E0DA 2R00C 3WNVA 4OO3A 2FOIA 1D7OA 3INRA 4EJ0A 3KRTA 1DJNA 1EUCA 2ILTA 3PHIA 4IJVA 2GDZA 4UUNA 1NFRA 3T4XA 3IQDB 2HMUA 4O59O 1HKUA 3DMTA 3KV3O 3U3XA 3I4CA 4AICA 4BVAA 4I5GA 1A7KA 4MOWA 3UCFA 1CF2O 1YBMA 1GFSA 1YOVA 5C3MA 2VWGA 2P4QA 4YT8A 1GYPA 1DHTA 4IQGA 3VDQA 2HMTA 3QVXA 4J0FA 3E6AA 5T67A 3D0OA 3CTMA 5TX7A 5ICSA 2R00A 3QVWA 1RM4A 2OUIA 1JU9A 3GR6A 3VVCA 3FD8A 4E21A 3A1NA 4CMIA 3WXBA 3A28A 2XAAA 1C1DA 4KOAA 4QO8A 5IJZA 3AFMA 2YFQA 2W2LD 1GTMA 2DTDA 2YV3A 5A4DA 4Q3NA 4R5MA 4B8WA 1G0OA 4J4TA 3ZN2A 4ZA2A 3RJ9A 3PHGA 1YS4A 4E4YA 3I9LA 1VL8A 4L4XA 4BNJA 2VRCD 1ISGA 1Y9EA 1ENOA 4B4WA 2H9IA 2PH5A 4HWKA 1GEGA 3NX4A 4QXMA 3PHLA 4DL9A 4DLLA 4F6LA 1GR0A 4Z0TA 4OSPA 3C7DB 4ND5A 1A4UA 2W4QA 3JQ8B 4RLHA 4XR4A 4HV4A 4YJDA 2D8AA 4FC6A 4RVUA 2ZTVA 1VL0A 4NZ9A 4CQLB 3BHMA 4CLXA 3F1LA 2X7HA 3UAGA 3H9EO 4RQTA 2AQ8A 3BMOB 3NJ4A 5DCUA 2ZYDA 1Y81A 4Y98A 3FF4A 3WQQA 1D3AA 4B4UA 3DO5A 3TSCA 2A4KA 3GA0A 1TVEA 3DBHA 4WEOA 4D42A 1DC4A 1UZMA 4I9NA 3MWDB 4JIGA 5G2OA 4A26A 1PJLA 3RASA 1PJCA 2ZIZA 2BFPA 1NAHA 1P1JA 3JCZA 1IY8A 4TQGA 1I3LA 3MJSA 5LDHA 2B5WA 4OQYA 3H9JA 3F1KA 1OZAA 2XXBA 5KVCA 3E9NA 3I83A 4B7UA 3MJTA 3P2YA 1UAGA 2W2LA 4PG7A 4UUOA 4Y9DA 1PS9A 1EK6A 2CDCA 2X5OA 4NDNE 3SBOA 4ND2A 2DPHA 3PEFA 3ZCXA 1H6AA 3MJ4A 3PJEA 4JN6B 1JVSA 1XEAA 2EGGA 3WQRA 4BNUA 3B20A 3NT2A 4R68A 4Z0HO 3V1YA 2VRCA 4IJWA 4LISA 2ZYGA 3EVNA 1H2HA 3ZV4A 3AI2A 3O9ZA 1JVBA 4LCJA 2X23A 1UXKA 1BHSA 4HP8A 4BO8A 1OMOA 5JSFA 2NU9A 3DOJA 1DRVA 4U6SA 3JYPA 1V35A 1I01A 4M87A 3KXDA 2PZJA 4CODB 2IYOA 5LCXA 1BMDA 2PKQP 4YR9A 3ROQA 3FR8A 4YJGA 3TFQA 3MOIA 3SVTA 1PX0A 1U4OA 5KVVA 2PWZA 1AGNA 1OFGA 2X9NA 1Y5MA 3KSUA 3E8XA 3QIVA 1YBAA 4RV9A 2CF6A 1PU2A 3NT4A 4BNHA 3DAFA 1ZBQA 3PGXA 5CDTA 1B26A 3ZV6A 1NXQA 3VDRA 1P45A 3N74A 4E2XA 1GEEA 2GN4A 2X0IA 3ANNA 3E82A 4KDEA 3KYCA 1X7HA 1JKJA 1IHXA 3L4BC 3NTRA 2DBQA 1VJ0A 1XYGA 4R1SA 4E31A 5L95A 2O23A 2PFGA 3U09A 4P4NA 4RPHA 1T2AA 1CWUA 2Q1WA 2FN7A 3CKYA 3CMCO 2PZMA 1E7SA 5IN4A 2A35A 1KEUA 5GZ3A 1U3VA 2BELA 1L1FA 2Y66A 1P1IA 1DRUA 2I6TA 1QSGA 1PEDA 2QQ5A 4CLHA 4DC0A 3GQVA 3WSWA 5IDXA 2BFAA 5T64A 1IB6A 4EUEA 1I2ZA 2DBVO 3K30A 2BI7A 3DOOA 3JSAA 3U9LA 2I3AA 1NBOA 2Y0EA 1GUYA 3L4BA 1R4MB 3TF5A 3OIFA 4R9SA 3JYLA 4TRRA 3PYMA 3RBXA 3GY0A 1H94A 1KC3A 3RROA 1JQBA 2P5YA 2Y1GA 4UVGA 1C1XA 2AE1A 3ZNQA 3I6QA 2VCYA 3UFXA 4BO0A 3EZLA 4H16A 2Y05A 3WBFA 5BQFA 3MWEB 1DIAA 3E03A 1UZLA 1FDSA 4A7PA 3ZWOA 2D59A 3EMKA 2SCUA 3RSHA 4TRJA 1M75A 1V6AA 4ZQBA 1XCBA 4KQXA 5C37A 2VTEA 2W8ZA 3K8ZA 4XEHA 4JX8A 5I8ZA 4D45A 3HB5X 4Y67A 3QHAA 2WDZA 2UUPA 4WOKA 3ZHBA 1ZK0A 2HAEA 1BRMA 3G49A 3VH3A 2YQ4A 3MTJA 2C5EA 1PS8A 1U9JA 2EKLA 2ZKLA 4GBJA 5U9CA 4A10A 1BW9B 3I23A 1NFQA 3DBLA 1NQTA 2VWPA 4IMRA 1DOHA 4D0SA 2OORA 3KB6A 4L4RA 1HXHA 4D3SA 2IZZA 5JY6A 3U5TA 4E3ZA 2UUOA 2QX7A 1E6UA 3OH8A 3ENNA 3W6UA 1ADGA 5F5NA 1QLJA 1RYDA 5IZCC 1KVQA 5EJ2A 3H7AA 4MP3A 3PYLA 4IDDA 2VOEA 4J7CA 1BSVA 1O89A 4JBHA 4XB2A 5L9AA 3PLNA 4JGBA 3IP1A 2Y0DA 4UVHA 4NMHA 3CUKA 2FR0A 1ZJZA 2NTVA 3ADOA 5IDQA 5IF3A 3R3SA 3BMCB 1JKFA 4FW8A 1T25A 4PZCA 1IZ0A 4DC1A 3UGKA 4BV9A 3VKUA 5JLAA 4FFMA 1T26A 1B2LA 3Q3CA 1DJQA 5EPOA 3ZW9A 1ISMA 5KVQA 3OHSX 4J9VA 3UW3A 3OSUA 2QYTA 4IDBA 3GDGA 3TL3A 1J0XO 4XB1A 1JKIA 3WS7A 2C59A 4RZHA 1ISJA 3V1UA 4ALNA 3U4CA 1UXHA 3V2HA 2OFPA 4JQCA 2FRDA 4DPKA 3RCBA 3DZIA 4CM7A 4Z9YA 1J49A 4J16A 3O38A 3GRPA 4L75A 5COAA 1KETA 4DBVO 3GVXA 3WR5A 3ZHYA 3G1UA 1KVSA 1RWBA 4IINA 5EQFA 2POQX 3ZU5A 6ADHA 1PWZA 3ORFA 3ZWMA 3KLMX 2PV7A 1NWCA 1V8BA 4BKOA 3JQ8A 2Q4BA 5K0ZA 2NWQA 1EBUA 2I76A 4P4GA 4E33A 4RVDA 1LLQA 1F8GA 3OEYA 4FJ0A 3PDUA 3WLFA 5H83A 2D4AA 5DCWA 4CQLA 3D1LA 5IFLA 1B3RA 3BMOA 3DFUA 1MP0A 3LDHA 5ER9A 3GF4A 3DQPA 1MG5A 1VSUA 2VHZA 4E2ZA 4XJSA 3OFSA 1OC2A 3H5NA 3FTNA 3LT2A 4GAEA 4MVJM 4RZIA 3TJRA 4W99A 1IHYA 3HG7A 1PGPA 2OHXA 3DOCA 4D0RA 4CR7A 4PLYA 3FNEA 4LSWA 2BH9A 5ADHA 3QLJA 2YDXA 4L0QA 4RF2A 4QUKA 1Z7EA 2GGSA 1T2FA 1KY4A 3ICCA 3F6YA 4OJNA 4YDRA 3L77A 3INGA 1LJ8A 2P9EA 3QE3A 5IN5A 4D3DA 1U1IA 4YAGA 4Q3AA 4ALJA 3BTVA 5CDGA 2WD7B 2CVOA 3QRWA 2V6FA 3NTQA 4DMMA 1UJMA 1UUFA 4Z9XA 3SEFA 5BNIA 3UCEA 5KCZA 5KWEA 4HADA 2ZCVA 4QX6A 1MC4A 1B0AA 4LN1A 3F5SA 1LRJA 3U0BA 4IQ0A 2HU2A 4GKVA 4BO2A 2PGLA 4PZDA 3A4VA 1N7GA 4N18A 3PJGA 3RJ5A 4KWHA 3AOGA 2FR8A 1J4AA 4FB5A 4CM9D 2VZ8A 1JAYA 2EF1A 1PZFA 5JAMA 5JYEA 5THKA 2ZTMA 2PGDA 1E6WA 2BLLA 4ND4A 4PZEA 4WCFC 4EBFA 4YT5A 1NQ5A 2QZ9A 1TLTA 3GMSA 3H4VA 1O6ZA 2FPGA 3RKUA 3FCOA 5CFZA 4MIOA 3UCXA 5KTKA 4PG8A 5CDYA 3VPGA 4BNMA 3V2GA 1TA4A 4GX2A 3RFVA 4PG6A 4BKQA 3CMMA 2PGJA 1CQJA 2OP1A 2J5QA 3CINA 3ONDA 4R4JA 4EZBA 3VPXA 4BHTA 3G79A 1YJQA 5I8WA 1HLPA 2GNAA 4EUHA 3S8MA 1QMGA 4L76A 3ROKA 2IEBA 3RBVA 1U4SA 2AEMA 7MDHA 2C20A 2HDHA 1YDWA 3TL2A 3PXXA 3MJEA 1PQUA 1VJ1A 4MKRA 2CF5A 2BGKA 2C2YA 2JD1A 1R6DA 4UULA 3LT1A 4B3HA 3GVIA 4CUJA 1R15A 2UVDA 3KEOA 1B14A 3I6IA 4CR6A 2D5CA 3UXYA 3WGOA 4DRYA 4IZIA 2YY7A 3U62A 3DZFA 3O4RA 1R4MA 3RVDA 1OAAA 2QYSA 5JDIA 1SZJG 2BFOA 2NU6A 2Y67A 3CEAA 1WMBA 3S2IA 5AXDA 5ENDA 1B8PA 2GN6A 3TN7A 2JL1A 1QV7A 2GERA 3F4LA 5ILGA 4GPD1 1Y1PA 1ZMTA 3JQ9A 1JA9A 2C29D 4CM9A 3D3WB 4J6FA 5G0TA 5IAAA 2HRZA 2G0TA 4RPKA 1B8UA 4FSHA 5L45A 4B79A 2C82A 1H93A 5TIIA 5DNAA 1EDZA 4FD3A 4KTTE 4WLNA 3IKVA 3LT4A 4FGWA 3DL2A 3W4JA 3NV9A 3EHEA 4W82A 3VAZA 5JNLA 3K96A 1H9AA 3AK4A 5DP2A 3W4IA 3WFJA 3ANMA 5TJ9A 1UXGA 2ZB7A 2GLXA 3ICPA 4MVJF 2VT3A 4ZVVA 5JMWA 3D4PA 1DO8A 4JBIA 4WGGA 1E92A 1LEHA 5I7SA 2BFMA 1N9GB 1BW9A 1E7WA 3TOXA 4R01A 1SPXA 4E2WA 3H9GA 4NR0A 4E30A 1F14A 4ND3A 1JAXA 4M89A 4J7UA 2JKVA 3JQGB 5L4NA 4U5QA 2LDXA 1YGYA 3K92A 1MFPA 1H5QA 1HSZA 2O2SA 4DYVA 4BV8A 4IGEA 5ES3A 5JXWA 5TT0A 1T1RA 3ITKA 5A5FA 5BNFA 5AVOA 4JP2A 1I2CA 3ANLA 3ONEA 1UZNA 3D4OA 2P68A 5DBFA 3BMCA 5J23A 3GLQA 2EJWA 1RJWA 3TPCA 2V65A 3IUPA 2Z5LA 3A9WA 3O26A 4CM8B 3C7CB 1PQWA 1KYQA 3HQ4O 1Z45A 2HUNA 4NI5A 3TRIA 2J8ZA 5MGBA 4DQXA 1J5PA 1NYTA 4WLUA 1XKQA 4MIYA 4HNGA 3SC6A 2NU8A 2B37A 4D41A 4GH5A 6LDHA 2ZYAA 2I65A 2X5KO 2IODA 2EW8A 3RWBA 4CQMB 1T4BA 1KVRA 3PWZA 3GZNB 1CQIA 4O6VA 2GZ1A 1YL5A 4PLFA 3PJDA 3WWZA 3GH3A 3I9OA 1UAYA 1XIVA 3VTZA 4JJGA 1EQ2A 1G6KA 3EVTA 3IDSA 4PFJA 3QY9A 4IY1A 4LK3A 3JQBC 3NDIA 4ND1A 4J1QA 3JTMA 4BUCA 1O95A 1PZHA 4BMVA 5B4TA 4ID9A 4J49A 3I9NA 2Q1SA 4UEJA 2WTBA 1T2CA 1NPDA 2YQ5A 1XU9A 1P0FA 4CMJA 1QV6A 5A9SB 5K6AA 4X54A 5AXBA 4GGPA 4DVJA 3JD2A 3WB9A 4RVFA 3AI1A 4ZQHA 1KEVA 3JD4A 4UUPA 4CV2A 2P9GA 1JW9B 2GYYA 3FWNA 9LDTA 4AJ4A 3WTCA 1DIBA 5L4SA 2HKIA 2NVWA 4OIMA 3H65A 4ZD6A 5BSEA 4AJJA 3ZZNA 5FYDA 5F1OA 3AUTA 3OJ0A 5IDYA 5DN9A 1EEHA 4IBOA 1B15A 1QRRA 4WLOA 2B83A 3AM4A 4G65A 3DBRB 4NIMA 3DONA 1A9ZA 3UUWA 2J5RA 4N5MA 4N5LA 1P0CA 5FF9A 3OQBA 1NM5A 1NP3A 1SNYA 3RUCA 1E7QA 1YQGA 5KNLA 4J2OA 2Q2WA 4GX5A 1QYXA 3GHHA 4FS3A 4K6FA 2OGUA 3JQAD 2VWQA 3AU8A 2LDBA 2IXAA 2WD7A 4GVLA 4I5FA 1WZEA 1O0SA 2D0IA 1XR3A 4UREA 1DAPA 1E3LA 4EJ6A 4NBUA 1QYDA 3EC7A 3AFNA 3JYOA 3WJAA 1G0NA 4FBGA 3W8DA 4MVJI 2VYVD 3OA2A 2YV1A 1NPTO 3CZMA 4II2A 1B7GO 1I3KA 4R69A 1YKFA 1UP4A 3ZWVA 3ETGA 4I5DA 4HFRA 2HJRA 4M49A 4IMPA 2B0JA 3GOHA 3B1FA 1EFLA 4XYMA 3WYBA 3AJRA 4Z3KA 2D2IA 5EL0A 3TFOA 3D5QA 4BNWA 1PQPA 5L3ZA 1NFFA 1YONA 2VNAA 1ZO8A 2O3JA 1HSOA 3FR7A 2EWMA 3FWZA 4CMAA 1KEWA 3GDFA 1BGVA 3PTZA 1VSVA 1E3JA 1EUZA 1XELA 3A06A 1H6CA 1OOEA 3CE6A 4MKXA 3ZNOA 4B3IA 3W4KA 4RDIA 2GASA 4L8VA 1BWSA 3EGOA 1BVRA 3GVCA 1KIFA 1WP4A 1X7DA 4RVHA 1SB9A 4WEQA 3SX2A 2P5UA 5TQVA 3SC4A 1ZKMA 2HLPA 3FNFA 1ADFA 3OEWA 2QG4A 2ET6A 1SEVA 1AXEA 1ZH8A 4CMKA 5LDGA 2GF2A 3LLSA 4Q9NA 1JTVA 3JQAA 4BB5A 3NTOA 2YZ7A 3OQ6A 4PVDA 3VH2A 1NASA 2AMFA 3BTUA 4ALIA 4HXYA 5DCYA 1FK8A 1XSEA 1GCOA 1QYVA 3U49A 1YXMA 5ILOA 4J1NA 3X2FA 1WNTA 4KQWA 4BO7A 5JE8A 3RC1A 2ZCUA 4BGIA 2VYVA 3PK0A 1X0VA 3VZRA 1LLCA 1SOVA 3C8MA 1DSSG 3BA1A 1TT7A 4A0SA 2NTNA 3PWSA 1KY5A 2BMAA 4M1QA 3E18A 4RO0A 3LU1A 2WMDA 1PJQA 3GC6A 4PLWA 1Q1NA 1Y9AA 4ZRMA 4Z0PA 1Y7TA 3MZ0A 3D3WA 4IIUA 4DYDA 1NAIA 2EHDA 4BNVA 1GD1O 4DQUA 3NYWA 4Y6PA 4MP6A 1KVUA 1I10A 4Q3CA 4IQ8A 4BOYA 4CQMD 3E48A 1I3NA 4N54A 5EINA 1Q7GA 4QSMA 1ML3A 3EK2A 3BMNB 3PQFA 2DBRA 2E4AA 4RF5A 1EFKA 1PTJA 2PD6A 1IOLA 1K2WA 3M1LA 5G0VA 5TT1A 1MB4A 4HY3A 1O8CA 3OICA 1FDVA 2XOXA 3EY4A 5ITWA 1RYEA 1N9GA 1AE1A 1QG6A 1BXGB 2Y1CA 4BKUA 2JCVA 1NQAO 3GN1A 5G4KB 3PIDA 1GUZA 3JYQA 4GKBA 5C5IA 4RGBA 3JQGA 4FJ1A 1ISFA 1LDEA 3VC7A 1ADBA 3ETEA 2Z1NA 4OXKA 4INAA 1ISIA 8LDHA 3WDSA 3ETDA 5CDUA 3MJCA 4XWYA 5ITVA 4BNNA 2ZATA 1DB3A 3DWFA 3UH1A 4OMUA 1N2SA 4Y6SA 4BO9A 2JHGA 2O3TA 1HDYA 1N1EA 1SO8A 1YE3A 1IULA 2FZEA 3HZZA 3TZ6A 4LVCA 1F0YA 1SMKA 2G17A 1P9LA 1DRWA 2AG8A 3AUUA 5H82A 1VKNA 3NT5A 4NJOA 4U8GA 4J1SA 4LCEA 4CM8A 2E48A 3ZWWA 2O3RA 3RC2A 1U7TA 1E1KA 3ONFA 3SLKA 1QYWA 2I9PA 4G81A 1HE2A 4AJPA 4YAIA 3C85A 3HE3A 3QWHA 3N7UA 4CQMA 3S2FA 3I52A 2R6JA 3E9QA 5COQA 4K9DA 2O3QA 4PIVA 3GZNA 3M6IA 1E3IA 1Q2XA 4QECA 5JO9A 1U3UA 4Z3DA 3ITDA 1O9BA 4E32A 4XJTA 1ID1A 1EDOA 2AEFA 4IZHA 4XIYA 4BKPA 1WAMA 2HO5A 2VNSA 3AY6A 1AXGA 4IM7A 2CZCA 2UV8A 4M55A 5A03A 4L4SA 1ZK4A 2DQ4A 2YJZA 2FZWA 2WE8A 4H7PA 2G1UA 1DIGA 3O8QB 3C1OA 4EYEA 1ZZEA 5FI5A 1R37A 3H6KA 1L7DA 4C4OA 3AWDA 1ZK3A 2VTDA 4BIIA 2XF8A 4CPDA 2G76A 4YACA 3WGQA 5BSFA 5A9SA 5C7IO 3B70A 3HHPA 3DZJA 2VUTA 2Y1OA 4I9HA 1LLUA 4NU5A 4HNHA 4AJLA 4CM5A 2D1YA 3OJFA 3BTOA 3ADPA 4I08A 4TROA 3JV7A 5A02A 1ZUD1 3MEQA 4A03A 1M67A 4MVJD 4XYLA 2FPIA 3PJFA 1F12A 3INTA 4BGUA 3HDHA 4IDCA 2NVUB 4FOSA 5MDHA 5KIAA 3HDQA 1GPDG 2GD1O 1V3UA 3PP8A 4NFHA 4PLTA 4YPOA 2PTGA 4EITA 4K26A 4JROA 1VE9A 1BXKA 3DBRA 3M2TA 2YW9A 2EKQA 4B7XA 2BD0A 1ADCA 5I7EA 3WGTA 1CRWG 1T24A 2EG9A 3ON5A 4RF4A 2DU8A 2X4GA 3AM3A 3G1TA 1E6EA 4WASA 4YB8A 1I5RA 1I0ZA 3B1KA 4TRNA 2P9CA 3Q2KA 1KVTA 3DAGA 4AJIA 2BI8A 4HX5A 1ONOA 1PWXA 3HDJA 4Q39A 5GY7A 2CY0A 4QO7A 3L9XA 3S55A 3H5RA 2G82A 1NHWA 1V9LA 3PPIA 5L51A 1N5DA 2O3UA 1WWKA 4HBGA 3TZKA 2FWMX 3PI7A 1QP8A 1NQOA 2DFDA 1I8TA 3MJVA 4U7WA 5KJCA 1K3TA 1W8DA 4BGEA 4WNCA 2Y1DA 3ZWAA 1TB4A 3MOGA 4L9RA 3HB4X 4AJEA 3P2OA 1PR9A 1ZXBA 3SJUA 3KZVA 5ICMA 1GZ3A 1I32A 2A9FA 2WJPA 2EV9A 3SJ7A 1NVTA 2EW2A 3PRJA 1E5LA 4XZ3A 2AQHA 2W2KB 3PQEA 4MVJA 1HDZA 2PH3A 1E1NA 2CUKA 2Q2QA 4JXKA 3RQSA 5B12A 4B3JA 4D3FA 4E13A 3B1JA 3K31A 1NR1A 3FRJA 3IC5A 2RH8A 1U7HA 4GWGA 1HDOA 1IE3A 1LSSA 4NBWA 4WLEA 5DBIA 3GZ4A 3FNGA 2QRLA 2DVMA 1E3WB 1RM3A 2GRAA 1W73A 4DLAA 3NAQA 1YWGO 4MIEA 2C7VA 4NBVA 4CV0A 5HRUA 3OP4A 3GHYA 3ZGYA 3K6JA 3FNHA 4CL3A 4LRTB 2B35A 1LA2A 5JW6A 4JJIA 1B3BA 4LMPA 5I9LA 4JP3A 2AG5A 3ZV5A 1DDOA 4HUJA 5HBRA 1H6BA 4NPCA 3O03A 4OH1A 3BTSA 4DA9A 3JQFC 4GVXA 3Q9UA 5KKCA 4NQZA 1ENPA 5KOIA 2D3TA 4CUKA 1TT5B 1ZEMA 1K6JA 4XQEA 2OXIA 4F3YA 5L7TA 2IXBA 1KEPA 1ZSNA 3KVOA 4CMEA 2OBNA 2VYND 1VJTA 1QR6A 3EW7A 4II3A 5IG2A 2Q1UA 2VRBA 1W4ZA 3BHJA 4GWKA 3JQ7B 3HSKA 4MJLA 2Y93A 3KYDB 3T7EA 4BQPA 5CAEA 3VHRA 4YTEA 1DFGA 3L0DA 4XR9A 5ENVA 3RUAA 2GCGA 3R0IA 3JQFA 1DIRA 1QKIA 2AQIA 2Q45A 4Y6RA 3Q1LA 2RH4A 5JY1A 3SLGA 1WW8A 1Y8QB 3OM9A 3DHEA 3ULKA 2VN8A 3TQHA 5F1KA 4WE3A 4JLWA 1PR3A 1BG6A 2GPTA 2O50A 3FHLA 4YQZA 1Y8RB 2B5VA 4M86A 4A5OA 3BMNA 1K6IA 3H3JA 4XDZA 4P8RA 1J6UA 2CFCA 1MV8A 4W4TA 3RAJA 1LUAA 3WGGA 4BMSA 5TF4A 1MG0A 4CM3A 4BNXA 4CLOB 1PSDA 5T57A 4PLGA 3PHJA 4QTZA 1Z7BA 2DPGA 3NDRA 1GADO 1ZK2A 1T1SA 4OOFA 3ZV3A 1C0IA 4E6PA 3V1TC 1BXGA 3ZWNA 2X58A 4P22A 3WG9A 3ZNPA 4FR5A 4OXYA 5JDCA 3PFWO 2ZB3A 5G4KA 1AHIA 5BSHA 2FSSA 3PDJA 4CMHA 2UAGA 1N92A 1U28A 4ONEA 3UKOA 4DPMA 5I7VA 5LC1A 1B16A 5L7YA 5I9NA 2VYNA 2OZPA 5U4QA 4E5MA 1GQYA 1NWHA 3GT0A 1PJBA 5HM8A 1PZGA 3LZ6A 1HWYA 2ZQZA 3KSZO 1DFHA 5TGDA 5A06A 3I9KA 2CSUA 2EJVA 3NKLA 2NUAA 3BIOA 2AE2A 3GUCA 3DAPA 5JDIC 4W7IA 2RHCA 1MC5A 1ULSA 4OL9A 3EUWA 1Q0HA 3RUFA 1WZIA 4U0JA 4XD2A 4BMNA 2OBYA 2O7QA 4D43A 3JQ9C 3CIFA 4NFYA 4J3FA 1A5ZA 3RUHA 5JO0A 5TC4A 5BT9A 1ZIDA 2VWHA 3GAZA 1CDOA 1WDMA 5TRTA 5A05A 1NVMB 4D79A 2W90A 1WDKA 4XQ9A 3F5QA 4XKJA 2OP0A 3IIEA 3ZHZA 2FP4A 3F46A 3AY7A 4Q3EA 3UICA 4C7JA 3NDJA 3GVHA 4IGFA 2CDBA 1UP6A 5EQDA 3N58A 3WSVA 3DHYA 1HZJA 5I7FA 5DZSA 3ZU4A 4YCAA 4R9RA 1YL6A 1H9BA 3QQPA 4NBTA 2FSVA 3PZRA 4DPLA 3STHA 4QFCA 5DP1A 3ABIA 3O8QA 2RHRA 3JQCA 2Q99A 3FTPA 2J3JA 3LLVA 1C14A 1UP7A 3F47A 1S7CA 2A92A 3JYNA 4KTVE 3UVEA 1SAYA 1B8VA 1BXZA 4BO1A 2WD8A 2I3GA 1HRDA 4ESOA 2QHXA 1U5AA 4M54A 1DIHA 4YT2A 2QRJA 3UHAA 5IXYA 1Z75A 2E82A 1GZ6A 2O3SA 1X1EA 1P33A 4UEKA 3KLPX 2E6UX 1SEPA 1ZK1A 1F17A 4URFA 3QV1A 1ZSVA 5CEJA 2GSDA 4ZQFA 4WLVA 4I9UA 4R3WA 4MDHA 5B4UA 4K6CA 3EAGA 2X22A 4FFRA 2NVUA 2YUTA 3MTGA 2GUGA 1MA0A 3PHHA 3GGOA 4BNLA 4O63O 1P1FA 4YBZA 2ZTLA 2NV6A 3HFGA 5F3RA 4BNYA 3ZI0A 3HN7A 2EP7A 4ZQEA 1MFZA 4BL5A 3ZU2A 3L6DA 5BSGA 2HMSA 4TZTA 1EMDA 2B69A 1N7HA 3BMQB 4L73A 4LW8A 2FY8A 2F1KA 3LQFA 1LLDA 3QVOA 5T5QA 3ZWYA 1HETA 4DIFA 3WYEA 1LX6A 1P44A 3C3XA 2VT2A 4LRSB 4YRDA 2G5CA 2GO1A 4EJMA 1ENZA 4XYEA 2PR2A 4JBGA 3IUSA 1A9YA 1G1AA 4AJKA 3E1KA 2QRKA 4H15A 4JNKA 5DBGA 3UOGA 1I24A 4HFJA 4J43A 1R12A 4K1LA 2C07A 4FCCA 1GYQA 1WLYA 5JS6A 2WE7A 3Q0EA 4R41A 5K6AC 4FPXA 4AFNA 3VZQA 5L53A 2HSDA 2TMDA 1CEQA 4BKRA 4AJOA 1XWFA 2IDZA 3LC1O 2B4QA 2PKQO 1R0KA 2W2KA 3CZRA 4R16A 3PWKA 2ZJ1A 3L9WA 4J90A 3RC9A 3HWRA 5JC8A 3KETA 4G2NA 1V3TA 1GV1A 4TWRA 5EESA 1HE5A 1PGQA 4YXFA 4BO5A 1Q0QA 4EI2A 1K0UA 2AQKA 4IJKA 1EE2A 2R2GA 1E3WA 1OC4A 3GNSA 1C0PA 2NM0A 2CDAA 3DC2A 1FDWA 1P1HA 3DZGA 3GEGA 1XLTA 1GYRA 4CLDA 4Z9FA 1EVZA 4IXTA 1X7GA 4OQZA 5B37A 4ZRNA 5I9MA 5DOVA 1ONNA 3ZW8A 5IDWA 5L40A 1VRWA 1QORA 4YQYA 3VH1A 1ONPA 1VM6A 4BNKA 2ZB8A 3GPIA 3RI3A 3I5MA 5KJ6A 1PJSA 3S2GA 4OKNA 2VUSA 5G0UA 4QFDA 1HF3A 2FPPA 4GGOA 1TT5A 1P74A 4E5NA 5JFOA 1HLDA 1YDEA 1JLLA 1HT0A 3EYWA 4KUHA 4O5OA 2Q2VA 3RUDA 4A27A 4J0EA 5TJHA 3AUSA 4CL8A 1LDYA 2PD3A 3JQ7A 5FFFA 3KYDA 4NU6A 5DOZA 3VZPA 5JMPA 4B7CA 2HK8A 4GX1A 4TRMA 3RKRA 3OECA 1PJ2A 1KS9A 1AUPA 4XCVA 3WTBA 1JN0A 3UN1A 7ADHA 4GMFA 4BNFA 3W8EA 3P19A 3KSDO 2CVQA 1FMCA 1XHLA 3U4IA 1Y8QA 4K28A 5JAQA 5KJEA 2CVZA 5A1TA 5JPIA 3DZBA 1VPDA 1Y8RA 1CERA 2H5LA 3PQDA 1Y6JA 3PLRA 2ZTUA 1LC3A 5CP8A 5ER6A 4NK5A 4GSKA 4CLOA 3LF1A 5T8KA 1ZVMA 5CG1A 3GG2A 3I3OA 5AXCA 4CUZA 4TVBA 1GY8A 3PGJA 1WVGA 3U4HA 1NTOA 2WYUA 4BO3A 3PZBA 5JYDA 2ZJ0A 4PLCA 2FHSA 1YL7A 1LI4A 5FWNA 1LU9A 4W7HA 1E77A 2D5AA 2EKPA 5GZ6A 3TWOA 1GU7A 3C1TA 1X15A 1K6XA 1P3DA 4OM8A 3S1LA 4DQVA 1SCUA 4E0BA 9LDBA 3B6ZA 5CEEA 1GQQA 4FGSA 4MINA 4RPJA 2EERA 2H6EA 4XDYA 2Y68A 4EEZA 2EP5A 4CJXA 3K2EA 1E1MA 4J4BA 4NJMB 2WSBA 4GLOA 3QA9A 1YQXA 1HDXA 1M6HA 4EDFA 3NJ8A 1IUKA 2VZ0A 4S1VA 5IXSA 3WFIA 1A72A 4WPGA 4ALKA 4E2YA 2XPCA 3FSRA 4ZU3A 3DB2A 4ZHSA 2JAHA 1LDNA 1YO6A 4GL4A 4RDHA 2JFHA 4E5YA 2E37A 4NK4A 5FI3A 5L4LA 3AU9A 3T4EA 2Q46A 1ZFNA 5A04A 4FFPA 1FDUA 2P2SA 3KM0A 1WMAA 1R0LA 2I99A 5AOVA 5U1PA 1R0SA 5BR7A 3QWIA 4KUEA 3GAFA 1NHGA 2JD0A 2GN8A 4LGVA 1TXGA 2V7PA 2X86A 1GDHA 2X6TA 1XGKA 2YHIB 1PGNA 5A5EA 4DLBA 1IPFA 1ORRA 3C1AA 3HJAA 1CJCA 1IZ9A 2PY6A 4BNGA 1XU7A 2GZ3A 1DC3A 2X0NA 4N7RA 3TDKA 4ALMA 2JCXA 3I1JA 4PGFA 1D4FA 2Y99A 1DFIA 3SXPA 5JBIA 4XYBA 1SOWA 1YB1A 2VHXA 4U0KA 1XQ6A 4YA6A 3G3EA 1S6YA 2X9GA 1E7MA 3NRCA 1E7RA 3AOEC 3LC2O 3TNLA 3OF2A 4YAKA 2J5KA 4AG3A 5AQ1A 1I30A 2YYYA 3AUAA 4OAQA 4TKMA 1HZZA 1RPNA 3G0OA 3WGIA 2JFGA 4WKGA 2NQ8A 4F46A 4YVFA 3ZH2A 1E3SA 4MVJP 1ZXLA 5C7OO 1R66A 3DZHA 3VOSA 2EGHA 5CG2A 2Q4EA 1QLHA 2BRUA 5T6BA 4FDAA 4A2CA 4YAEA 2JAPA 1AHHA 2PD4A 1GQ2A 5JAZA 1U3WA 3E5RA 1FXSA 1KOLA 1BDMA 1YVEI 1DC6A 1I33A 1YBVA 3OQ1A 3AOEA 3DBVO 2CMDA 4KMSA 5G4LA 3CSDA 2DC1A 3LF2A 2HQ1A 3AW9A 3BMQA 3QVTA 3WGHA 2NTJA 4DUPA 2AEJA 4QT0A 2IZ0A 4GSLA 3JQEA 1LXCA 5TLSA 1HL3A 5JCJD 4XQGA 1ULUA 3FN4A 3Q11A 3ROMA 1M6WA 1UH5A 1QXSA 3LK7A 4B4VA 4UVEA 3CPSA 3P5SA 3W1VA 4TZKA 2OMEA 4C7KA 5B4VA 4GQAA 1O5IA 1Y5RA 4Q3BA 4YWJA 4PG4A 1T2DA 2P91A 1RM5A 2HMWA 1EE9A 4MO2A 3IKTA 3K73O 3IS3A 5G0WA 2PK3A 4Z6KA 4A73A 3NGLA 2JHFA 1IPEA 5L7WA 1ZMOA 4CR8A 3M1AA 3RU7A 3OIGA 2X5JO 4N5NA 4RF3A 5FEUA 4TMFA 4XIJA 2OO5A 3WNQA 4XGIA 2Y1FA 1WPQA 1MXFA 4R51A 4CV3A 3GUYA 1JWAB 1UXJA 2CD9A 3NGXA 4O1MA 3W8FA 5HA5A 5CEFA 3T7CA 4LVUA 5GZ1A 3AI3A 2WWRA 3L6EA 3S2EA 2NSDA 5H81A 4DGSA 1EVYA 4WCFB 2NLOA 4RPLA 2I66A 1JDJA 4YAJA 5F21A 4TSKA 5KJFA 3BHIA 5A9TA 3OJLA 1MUUA 2QZZA 4I8XA 4CLEA 4G5HA 1HDRA 2TMGA 2O48X 3IMFA 3FBGA 3TZCA 3WBBA 3GDOA 4ROSA 1I36A 3JQ6A 5TNXA 1ZEJA 3GEMA 1A4IA 1U5CA 4R3NA 4ZGWA 1PJ3A 3E9MA 4YJHB 1EK5A 3GNQA 4R54A 5JCJA 2ZQYA 3QWAA 5HS6A 1HYHA 1ZSYA 4TVOA 2BF7A 5F1PA 4RJTA 4AJ2A 3DXFA 3W6ZA 1M66A 4MVJH 1GCUA 3ROPA 4FFOA 1FJHA 1HDGO 4BNZA 2O4CA 4PVCA 2O2YA 2FMUA 1P1RA 4D7AA 2BGLA 2EEZA 1PGOA 1AN9A 5KKAA 4DTIA 2DLDA 1DBVO 4MP8A 3VPHA 1LSJA 4HFNA 1D1SA 1YB4A 2J3IA 3OMLA 4JCOA 1FDTA 2IEDA 3PIIA 4RLSA 3ZU3A 4WLFA 2EIHA 4ITUA 1PIWA 1KERA 3GFGA 2DFVA 4FJ2A 3NEPX 3KTDA 2HK9A 4GI2A 1Q0LA 1YRLA 3BYZA 3GGPA 3WGZA 4YJFB 1I3MA 1M76A 3DDNA 3CXRA 4MVJE 4PRLA
chains in the Genus database with same CATH superfamily
5D51S 4Y6LA 4R5HA 1L5SA 1P1CA 1NNSA 1R4NB 3LT0A 2C4TA 4BLWA 1L4BA 5K6TA 4F9TA 3BA6A 4GM0A 3RF7A 3D3EA 3OZFA 3TRDA 4D9CA 3MJRA 3GRFA 3OA0A 4RZ3A 3NUGA 4S2EA 3AKDA 1CG6A 5K2OA 1PNOA 3TOVA 2C2OA 3RFCA 4RDXA 2GQ0A 1W0CA 1Z6PA 3K9QO 2G1KA 2RH9B 1AF7A 1K4YA 2DBZA 4Z1MA 1L5KA 5B7PA 1GAXA 2ERXA 3PX2A 4EB0A 1ZM2A 2EKDA 2PAFA 1NATA 2XWQA 3EFHA 5K8CA 1R50A 4WCDA 1E5QA 2LWIA 3LCJA 1Z5WA 5AVRA 1WXDA 1MABB 2E7ZA 3UMBA 5C52B 3O74A 3SDBA 3ZE7A 1JG1A 3KHKA 2XCSB 2IHKA 1TO2E 3DFZA 2WTNA 3ZXSA 1GNVA 2G07A 3VQTA 1TUBA 4FFBA 3N0RA 1MXHA 3OKPA 3HBJA 3W2IA 1QO9A 4OHUA 1CUYA 4RENA 5AK4A 1FLVA 1N5MA 4OSOA 2W4IA 4HQLA 4KIJA 3OUUA 1DT3A 3EJ6A 3VKVA 4X62B 1BQ3A 1WXFA 3JD0A 4FFNA 1ZGBA 2QR3A 3QPUA 3OJOA 3VOBA 1F6WA 1C3JA 4LDNA 1E4YA 1F8YA 2NUTA 3X0DA 5CB4A 2I62A 3NH9A 5EKTA 3DFKA 4E5PA 3AM5A 3GRKA 2LBPA 5A0TA 2HCTA 1NX6A 2BFFB 3NRJA 5IT5A 1N1GA 1E0KA 1JQJC 4UNRA 3C7AA 5KOHB 2QDXA 1BKDR 2R8PA 1DXHA 1M3SA 4H35A 4EGFA 3LC7O 3NDBB 4EF4A 4M8IA 16PKA 1VP3A 4FK8A 2C54A 2IYLD 4G1EB 1E2QA 2QIOA 3MBOA 4BGVA 1DAEA 1BTOA 4HH0A 3NVDA 4JHXA 4Z86A 4GMGA 4LAFA 1IBRA 1P2FA 3L7OA 4MWBA 4G6ZA 5ALNA 2ZI5A 3N0WA 3RYIA 4BNIA 2Y1WA 1HEUA 3OG9A 3OQVA 3WLIA 4CIYA 4ESVA 4O2BB 3X1YA 4YPVA 3SZLA 2M6RA 2NU7B 3ASUA 4JS0A 3H9QA 3R3HA 1IJFA 1GRCA 2ZS9A 3JD1A 5J47A 4N03A 5B58C 1QB8A 3GJ6A 1FJXA 3AJ8A 3WJ7A 1F0KA 3KD3A 4S35A 5AHWA 2JJYA 4RIFA 2UZ0A 1I6LA 2C9BA 4JLOA 5H9WA 2CCKA 5MF6A 1ULHA 3DZKA 2YHIA 3CCFA 3FKSA 3HWWA 4KNYA 1PYGA 1J33A 3QOYA 5EE9A 2CMKA 2QRMA 1O94A 3NIBA 1C0KA 3VYUB 5LNK6 2IK8A 2IZ1A 3KO8A 5JWHA 5AW3A 1XD2A 4HDMB 4D46A 2HR1A 3ZWPA 1CUWA 4JVMA 4OLHA 2QMUA 2XT9A 4HS4A 4V0LA 2EQAA 2AFIE 1XL1A 2WF8A 4J1TA 4W6ZA 4RC9A 3EGXB 4QLBA 1EQUA 1QK4A 1IBSA 1ZGGA 4FOOA 3WMXA 1KDOA 4POOA 3Q3EA 5DLQC 2ZBDA 4W9NC 2YJ5A 4ED9A 2ZRJA 2ODPA 4G85A 5HHTA 3V7YA 5HR5A 2HEGA 4TXMA 4FYPA 2A9RA 3T5AA 3EZYA 3UGJA 1UDCA 3OIDA 2WNSA 1GPJA 3QW2A 2H1WA 2PRYA 5HP4A 3QVVA 4GKJB 4YRSA 2GFIA 1MGOA 5CPFA 3ASVA 1G8AA 3LXUX 1C41A 3HI6A 5AKIA 4BB6A 2EZ8A 2RHMA 1HE3A 1GPLA 1BN7A 1A2QA 2BDUA 3BB4A 4RHEA 3ZGZA 2N47A 1NBIA 1LW6E 4O4LA 2ZE5A 3ORQA 3OQOA 2DOKA 3BWBA 4M8SA 2CSXA 4JL6A 4LQ4A 2GD2A 4L74A 4TKUA 4Z4EA 3WZLA 1Z73A 2ECPA 1YOVB 1L0BA 5D3MA 2GKOA 4D8TA 2BCEA 1VG0B 1JG6A 2IZ6A 3B1XA 1T1IA 1EBFA 1FB5A 3R6GA 5CGQB 3RHSA 3W9YA 1EXDA 1Z83A 2QVYX 1ZI6A 3S5UA 4W9NA 1XCOA 2Q6IA 4CF7A 4PCVA 1N2EA 2GEVA 3KQHA 1LCIA 3PEEA 4J4HA 1GV0A 1NVGA 2ORIA 3VBEA 2J0UB 4XRGA 4YR7A 1DQPA 2V6GA 4XX0A 4H1HA 2HZBA 4TTRA 3U7QB 3M2PA 4IDEA 3VSBA 4CMIB 2NPOA 2NZ2A 1NNUA 5DT9A 4UKDA 4ZV9A 4JI3B 1LQUA 2PA3A 2CT8A 3NW9A 1UDWA 2RG1A 2WICA 1TNDA 3T15A 4TKLA 4QBHA 1CY8A 5H80A 3PITA 3P9KA 4RD0A 3AONB 3T54A 5JRJA 2ZXUA 4UHHA 2RGDA 1FEZA 3KZMA 4G8JA 1Z82A 4D44A 1IG0A 4RTJA 2Y76A 2V6BA 2EU8A 1QP7A 3RU9A 4B7AA 2CXUA 5JNSA 2GARA 2O2XA 3BUSA 1YOBA 2O8VA 1U8CB 4YX9A 2ZUDA 2Z57A 1WBBA 3HLYA 2B9VA 3H4TA 3JWPA 3L6BA 1ZW1A 4MV6A 3ZZ0A 4AJHA 4YUAA 4WKBA 1HYQA 4DXHA 3SVLA 4I1PA 4GO1A 1WSAA 4D8YA 1Q1BA 2OZLB 4MS3B 2AG0A 5DF1A 4J7XA 2O2EA 4LFBB 4CMCA 5CURA 2MYTA 3D7RA 2YWCA 3D4NA 1CQPA 1OD6A 2CLIB 4NCXA 5FBHA 4GM1A 3ELUA 4OYHA 4RBNA 4BVLA 4MI1A 1Z37A 3OJEA 5BNTA 3NPMA 2GAIA 1HE4A 1J97A 2CEKA 3E3NA 5FUBA 3H4IA 1MLDA 3QWBA 5G0SA 4S1TA 3F3MA 2HLHA 1J9GA 2RBEA 5BO5A 3Q5GA 1IXSB 2XQJA 3JQAB 4G1UC 4YT4A 4XA8A 1X1TA 4XWWA 3B8HA 2MOKA 3LSYA 4LQCA 4CF4A 3UYLA 4Q3KA 1R16A 4R0MA 1N5KA 1HKHA 3DBHB 2XKAA 1SBIA 4MWEA 3O8OB 4Y0VA 3L79A 1GL3A 4QYMA 4YEDA 2DAPA 3VI4B 3JAKA 3DOHA 5CTJA 2DLCX 2QX6A 4KPGA 3HVKA 4FWBA 3G89A 2JRLA 3N05A 2HBQA 3IVAA 1N2GA 4NDAA 2YZNA 1A7JA 1M1YA 1ZHFA 5DHFA 4AX4A 5C81A 4HDAA 1PZEA 4JC5A 1J24A 1Q44A 2CWDA 2DKNA 2GPJA 2YZKA 3FLAA 3LGSA 5JEEA 2PRKA 3V7WA 1JYSA 3HFSA 1R0CA 2CNBA 4NYMQ 1KI8A 5LQNA 1UBNA 4KP7A 5FPYA 1VLVA 2G80A 1X14A 4KQ6A 4D25A 4JT2A 2OOSA 1L5HB 1V11A 1WCXA 1LTHR 4YMVA 4YROA 1XI2A 4CF3A 5AW8A 5CB0A 1L5YA 5EYPB 3WMWA 4R1TA 3VVBA 1ZX1A 1NSTA 3JYHA 4JYBA 2C57A 1EH5A 3RJMA 5G1OA 1W4CA 3U1BA 3U4AA 3JWHA 3IP3A 5BV8A 3SIRA 3KWJA 1CS4C 3G17A 3Q9NA 3KQKA 1W8IA 3ZCUA 1FF9A 1ESEA 1UJ2A 2R5NA 1PLLA 2JIPA 2FN9A 1T2EA 3HU2A 4RM2A 5GMOA 4EVSA 4YMHA 4V1CA 2WWFA 2VYQA 4DV5B 5JIBA 1USGA 2VA8A 4J0JA 1IONA 3FBTA 4KO1S 4M7PA 4MPDA 4KO8A 1XL0A 4ETWA 4M0UA 5HF8A 5LYYA 2AJ8A 5HX7A 2GETA 4H3SA 3IB3A 4OJYA 4QBGB 4DT1A 2WMNB 1BVUA 4LZNA 4EW6A 2NX2A 1Z5VA 4ENUA 4DBZA 3NIGB 1ILEA 1CFJA 2AHRA 2YVKA 1I2AA 4UAGA 4UBOA 4RFVA 5BQ5A 4YP7A 2YHUA 5THQA 3REQB 5BN5A 2P67A 4UTRA 2R4UA 4UVDA 2GJ9A 3ETNA 2V54A 3ZYCA 1K5HA 2B20A 3DZDA 1A8HA 1H2BA 4BRWA 4X64B 1WSWA 2HA3A 2X8JB 4H7IA 4R7ZA 4X3PA 4XPZA 4P7BA 4ER5A 1YQWA 1YZFA 3G8DA 1BDBA 3ZY2A 4E5VA 5C53B 3EGIA 4HDQB 1A9RA 2A7QA 1JNYA 4M0EA 3PFBA 2JBHA 3F4BA 4CFZA 4R1UA 3H8VA 3LX4A 1TUIA 1NJ2A 1HY3A 1LDBA 1T29A 4J91A 1FTQA 3VPSA 5DTEA 1N0VC 1LD3A 3D64A 3KZXA 4L8YA 1QH1A 4B87A 1FQOA 1H6DA 4YMLA 4G0VA 2QM7A 3H2KA 4GPZA 4XQCA 2YQZA 4IS3A 4QQRA 5KVSA 4DKJA 1UOOA 6REQB 3GB9A 1ZD2P 3L5OA 4GZ3A 4OATA 5FRDA 2H06A 4S3MA 1W1UA 3OAAD 2JGRA 1D2GA 1X0XA 3HBLA 4M0PA 2MWMA 4U2DA 3BXXA 1BE1A 2JGJA 1RQXA 3PVZA 3R6DA 3IPXA 1XVUA 1XPUA 4F45A 4XPIA 2IH5A 1DEOA 4X1IB 4B3GA 2RAPA 3KXPA 4BMXA 4EFKA 1BGXT 5JV5A 3QXSA 1C7ZA 2FPSA 3EA4A 1JIIA 4XIIA 1J1UA 2EDAA 3RD5A 1KP2A 2JF0A 2NW6A 3GN2A 3PGA1 3NZEA 2A86A 4V24A 5AK0A 4X41A 3HCNA 1MGPA 2B3TA 4DWVA 1GA4A 3OKFA 5E7QA 2FXVA 3B7GA 4DTCA 4M8NE 1P9NA 5IUKC 4YHHB 2IP2A 3CVJA 3FFWA 2I4MA 4WVFA 2JFFA 1A71A 1FFCA 3DJFA 8GPBA 7GPBA 2FKAA 2W2PA 1CUUA 4IDNA 1SZDA 2CCJA 3FPLA 4XM1A 3C5CA 4DR1B 1E58A 4DLUA 3RSQA 3VX3A 1VJ5A 3RO7A 3QVSA 5E8JA 3GJ5A 3LUCA 4B48A 1HK7A 2AR9A 3E58A 3OBBA 3SE7A 3NP9A 3IPYA 4QUGA 5LA6F 1E1QD 3UAVA 3WL5A 2QAGC 3BL6A 2JLRA 4C3UA 1JQLB 2JIOA 2I7CA 3BWYA 2HRQA 4AJ1A 2JAWA 2NUPB 2WSYB 4KMRA 3LUHA 4LTDA 5KBYA 3K0EA 1ZRHA 4FIZA 4OGKA 3UA3A 3VSDA 4JBLA 4WOJA 3I9MA 4RETA 5HTOA 1CUAA 2WZQA 1SQSA 1YDHA 4M9UA 4OOEA 3WBKA 4AN0A 3LFTA 5HCUA 3TJMA 3N8KA 3L4SO 3NBMA 5E3IA 3N2GA 3CZPA 3E3AA 1L1RA 3KYBA 3LBAA 2H1LA 1RLTA 1XCLA 3PNSA 4NMLA 4ZVPA 1RYYA 5HFJA 3Q7RA 3WLEA 3E9CA 1PAUA 4ZTBA 2CJXA 4RSRA 3UH0A 1QVWA 1K0FA 3WNVA 2X7XA 3INRA 4AG5A 4DADA 1ESCA 3L7MA 2C2GA 3QELA 4FYIA 1XZDA 3TRFA 1DJNA 2O8EA 1NRXA 1OLSA 4IJVA 4F3NA 1NFRA 1UK7A 3T4XA 2XB8A 4LYFA 3R4VA 4D2IA 1F1JA 2IHJA 4ZKEA 2L2QA 2IY8A 5DTMA 1OH8A 4ZJYA 1CP2A 1GFSA 1KS2A 2BHRA 2EBHX 2Q28A 3F71A 3LOUA 3ND7A 3OKAA 3NALA 4UARA 3ZK8A 4D4KA 5C3MA 5I48A 3C48A 3ET5A 2GCPA 5BWLA 1DHTA 1F2VA 2WA2A 4HDOB 3X3HA 2CLCX 2Z6QA 4C4AA 2VK4A 3K8YA 3VDQA 1QC5B 2WTEA 4YS6A 4NONA 2WMOB 3BIFA 4NP6A 3CTMA 3LBNA 1CDEA 1CUCA 1ORHA 2SBTA 3A2MA 1MB9A 1ZISA 3CQ9A 3AI7A 3H1PA 4PSUA 1BE8A 4WIAA 3REFA 3RLFA 3TIGA 4BE4A 3RSFA 3SQOA 1WO8A 5H3LA 5ITZA 2NVOA 3ZLVA 4E21A 3U6KA 4AF8A 1IN5A 4FDMA 5IU6A 1ST2A 3AY0A 5HW0A 3LH5A 4Q9DA 1PBTA 2FPOA 3QVJA 4P3OA 4QO8A 5ALHA 5EFZA 2YFQA 1L5WA 3GJXC 2YV3A 4DOMA 4Q3NA 5SYNA 1V8PA 1N2JA 3L2OB 3OEEA 4XVCA 3IEMA 4G1FA 2B3DA 3RVMA 1AUXA 4OHOA 2CL5A 3W5JA 2PX8A 1OZHA 2VH1A 3ZN2A 4ZA2A 3QLUC 3U4QB 1QE3A 4P32A 2XKJE 4WZAE 3PC6A 2VHTA 2XNJA 2NN3C 2OG1A 3D0RA 4YCDA 5ECDA 1HR0B 1RWNA 4ZQCB 4Q4CA 5C2JB 4K6HA 1HFJA 3C3YA 3QKWA 3IVCA 2DX7A 4DA6A 3AZPA 1RRMA 4HZUB 4EEKA 2IBTA 4HEHA 1VJCA 4HWKA 4DL9A 2AEEA 3NX4A 2J30A 4P9NA 4QXMA 3USZA 2UUAB 1GR0A 4L07A 4Z0TA 3C7DB 2A1UB 4ON9A 3JQ8B 4LJYA 5AICA 5LYJB 1N8SA 1H4QA 4YJDA 2D8AA 1JHPA 1JLRA 2OCLA 4BXOB 3SY8A 1VL0A 4NZ9A 2QMYA 4DWOA 3BHMA 3ECSA 1YB6A 4HYQA 1EX6A 5HF5A 3BMOB 3UUGA 1KKUA 1UQUA 3LHSA 1JYEA 2H92A 1WW2A 3AEKA 4F4JA 2QR5A 3LXXA 4LJ8A 2A4KA 1S02A 4D42A 3FPBA 4IRUB 4PW0A 1RZRD 2GOYA 3RK1A 4JI7B 2C03A 3LNTA 2YOHA 1UZMA 2Y0PA 3DR5A 1UWKA 3MSCA 1EDBA 4I9NA 4PWZA 3DV0B 1XOIA 1U1CA 1E20A 2ZIZA 4Z51A 3OPNA 1P1JA 2XYRA 3SYMA 1WLSA 4V3BA 4D5EA 3JCZA 5EKUA 4M1OA 4OQYA 2LCIA 1PSWA 2QS9A 3H9JA 1N2HA 4LC9A 4TQAA 3SSNA 5CITA 4QZVA 3RC3A 3OX4A 5DISB 4B85A 4B7UA 1LK5A 3SQXA 3MJTA 4B3RB 1YC5A 1AA9A 1UAGA 2EGUA 2W2LA 1JFFB 1EINA 3O47A 1NJFA 1VHWA 2IYFA 4I4TB 4PBRA 3AEYA 4C6SA 4YUWA 5DGIA 4UM9B 4MRPA 2R48A 5AIAA 1HNNA 4H17A 4EMTA 5IKPA 4P7GA 1G8YA 3ZCXA 2J4DA 4GM4A 3PJEA 1UDXA 1E0SA 2J45A 4JN6B 1JVSA 3NBYC 2PU5A 1WP9A 3OOJA 4PC3A 5CM8B 1PFVA 3HO1A 1VIAA 1WSBA 3ACDA 3A9VA 1PT5A 4Z0HO 1QE5A 3P9SA 1ZGCA 2DY1A 3Q2OA 1IIRA 5FWYB 3IODA 5ICFA 3OZWA 4QL3A 5M3BA 2JGNA 3EDQA 3NHLA 3A6GA 2ZVPX 5DHQA 2QI9F 3RR2A 3B5EA 2FXIA 3L8DA 4I36A 3HBNA 5CLLA 1ZL2A 3P2JA 2IU6A 2NU9A 3DOJA 2XRYA 1WABA 1GR1A 4JVNA 4KQHA 4EF6A 1FU7A 3KDAA 3QU4A 3HYCA 3RB8A 3SIWA 4DB2A 2EC5A 1B1AA 2RAVA 2IYOA 5LCXA 4N3BA 2E5FA 2PKQP 3CSUA 3OSZA 2AYZA 1M1NA 4LZZA 4QPPA 4XX1A 3M5CA 3ROQA 1R0RE 3FR8A 4LKOA 4M7RA 5AQEA 4EARA 4EO4A 3GROA 3WWEA 4R7GA 1WCWA 4B76A 1JIQA 1G8KA 1PX0A 1C7FA 1XA3A 2CXTA 3TXYA 5IYZA 1AGNA 5SZKB 4TTAA 4A5SA 1Y5MA 5D6NA 3E8XA 1DQRA 1YBAA 2ZGVA 3P9ZA 4LZLA 4EWLA 3BQNB 5LB4A 3HVRA 2H11A 3GJ4A 4ZP1A 2F1HA 2IZOA 1VXOA 2NOAA 4RK1A 3SQNA 3TGWA 2G40A 4AYWA 4D4MA 4OQFA 5GJWC 4PHTA 4YWHA 5DI3B 3ZV6A 5KYTA 5H3HA 3DEFA 3N74A 4Z7OB 1I7NA 2VKQA 2UZ4A 2X0IA 2IUSA 3SIXA 1X7HA 1IHXA 3NTRA 2WJAA 4JLJA 1Y5LA 5CNIA 3CM0A 4F2GA 2XTZA 1NQVA 1P18A 4R1SA 1LV8A 3K09A 4E31A 1VSBA 3S7ZA 3DLIA 1LBHA 2FI1A 4NYMR 5JQGA 2ZJ7A 1T2AA 1ZICA 4ZI5A 2PLWA 1RXEA 5DN6A 4O4JF 1DTEA 3MB8A 3PUXA 1NONA 3HACA 4N1AA 1YTUA 1FP4B 1KEUA 5GZ3A 1U3VA 3MF4A 5KYNA 1IUOA 1L1FA 5MN6A 4UOQA 1XTJA 2QX4A 4PYJA 1P1IA 1DRUA 2ODWA 3PICA 1PEDA 4I66A 1L4MA 4PINA 1ZUIA 4B84A 4EY6A 4D98A 1ZU4A 3G7NA 3BXOA 5GWXA 3V7FA 2IY7A 4DZTA 2R97A 3VNBA 1XZBA 2VRWA 4EUEA 4D26A 1RXSA 1AG9A 2DBVO 2I7TA 3GZJA 1LLFA 2BI7A 3DOOA 1NBOA 2ZROA 4KSCA 3K4QA 3T41A 1N77A 1R4MB 1T6NA 3P5BA 4KFSA 4CCWA 621PA 3VBCA 4RE5A 1YI0A 2HV8A 3IE0A 3LL7A 1TF2A 2V3WA 3EMVA 4X24A 3E7PA 3TLCA 4YNBA 3USES 2NU6B 1RDFA 1T4MA 1YBFA 2P5YA 3E9DA 1QGUA 2P4UA 4NZPA 1F2TB 1DQZA 3C4QA 3UFXA 4BO0A 4Y2XA 3OHMA 5A7GA 1YQQA 2XDQA 3FKQA 2Q2NA 4H16A 3P52A 2XUIA 4LFAB 3WBFA 2HV9A 3PSHA 2PQ2A 4FKZA 4KRXA 4RKYA 2XECA 1XJQA 2H4ZA 2J41A 1E5VA 3QKSA 4WY8A 2VAXA 4IVNA 3TNJA 3VJMA 5CVDA 4AI6A 3EMKA 2Z4RA 1U9IC 4MV3A 1U8AA 2B6HA 2HA5A 2XIJA 4Q03A 1Z13A 1N6NA 3R0ZA 5IVIA 5C37A 4R2IA 3RNOA 5C8ZA 2FVYA 2W8ZA 3D8UA 4XWAA 2Z2ZA 1P75A 2XCLA 4FNMA 5I8ZA 4YJKA 1RKBA 1ZC3A 4M4SA 3S40A 4D45A 4DV6B 3AERA 2UUPA 4YV0A 3ZDBA 4NE7A 4CIDA 2RGNA 3N76A 5FTLA 1GCGA 5JPDA 1K8QA 3IP6A 3FDZA 3SX0A 2HF8A 3MTJA 2GAOA 2C5EA 3OT5A 4HUQB 2C4MA 4KIWA 4PIPA 1U9JA 4TT3D 3WL6A 1X9IA 1CF9A 3QPBA 4R8KA 1DQYA 1F6DA 3OCVA 1HRKA 3DBLA 4Z54A 3KWLA 3UGTA 4BEJA 2XI4A 3HVUA 3IQXA 4NOMA 1HXHA 4N9WA 2PMFA 2IZZA 1ICIA 2AYXA 2UUOA 3ENNA 1YZNA 5F5NA 2JNWA 1VFPA 3FYUA 4MULA 2I6FA 4MA0A 4MRNA 4G26A 2C5LA 5EPUA 5K0EA 4IDDA 2VOEA 4ZIRB 1BSVA 2FRDC 3SQLA 5HKLA 2XQIA 1W36C 3OPVA 4JGBA 4PX3A 1K8YB 2Y0DA 4OHBA 3UJAA 2FZ4A 3CUKA 1EVEA 3GLIA 5KYXA 2JI8A 3ADOA 3BHNA 3H1BA 4NRDA 3R3SA 3THRA 2V6IA 1RQNA 3BMCB 4CIBA 4PZCA 4FMDB 2GYWA 1FYXA 3IHLA 4FE4A 4YK7A 3ROFA 3CZCA 1X1DA 3BN3A 4G0NA 3Q3CA 1B2LA 1PFQA 2FPRA 4I50F 4IO0A 3RRBA 3G0CA 1MT0A 4P5PA 3VR6D 2PJDA 3AIMA 3FUUA 3R7LA 2O0MA 2QJWA 1J0XO 3N2ZB 4ASUA 1YR1A 3GLHB 5E6UB 5I3CA 2QA5A 3JARA 2X1LA 2Y1LA 4GUDA 3V9AA 4RFLA 4ALNA 4D4GA 1UXHA 4AD8A 5NULA 2WJWA 1E64A 2FRDA 4UM9D 5B3JA 4ZI7F 3DZIA 3AVWA 1I7QB 3H11B 2FSPA 5BWOA 1QIKA 4L75A 3M81A 3ZVMA 2MSEB 4G4SP 3LUAA 1RWMA 3ZHYA 4BX8A 3ZBUA 2HRDA 4NSNA 3K4HA 1C9JA 4RJ2A 3TPFA 6ADHA 2JI7A 1U3GA 1VE7A 3EVFA 5JZVA 5ESRA 1D03A 1V8BA 4DYHA 1IY2A 1G8HA 1V6SA 2C94A 3DO8A 3N7AA 4AWAA 2VSQA 2Q3FA 4CG0A 3TLGA 3HEBA 1TW2A 2D1SA 3REOA 1DMSA 5ERYA 4ZJZA 5CBPB 2NWQA 1EBUA 4E33A 4ZODA 1QUFA 4PQEA 1LLQA 3NWPA 3M34A 2OSBA 1P81A 2Q21A 4FJ0A 3O90A 4CQLA 3U5ZB 5DCWA 1BMQA 4KPUB 3CKMA 4QJ5A 1E9VA 2XYQA 4ZAZA 3ICVA 4JWKA 1RNLA 3C2QA 2H1HA 1YS9A 2WPDD 3W5UA 1MG5A 5B1IA 2XE7A 4N5HX 2VHZA 1L7AA 4P3XA 4DCUA 4E22A 1O6BA 3MN1A 4ZYTA 1RACA 2OAQ1 3O4FA 3AHGA 3UXEA 2G28A 1C4KA 4FHCA 3MWDA 1EE1A 1J8DA 1Y7LA 3MMZA 2QTMA 4M0DA 4EG0A 3A4YA 4YLEA 1UAAA 2F8TA 3BB1A 4C4TA 3GPLA 1Q74A 4EMSA 1R9JA 3GU3A 4MW0A 1KYXA 2HDNB 4PAQA 3SYNA 5M5BA 4D0RA 4KK3A 5D00A 4CR7A 3TK1A 1K86A 2YICA 3QNUA 2YDXA 4L0QA 4RF2A 4UZFA 5CT9A 1JMKC 1T2FA 1SUBA 2C83A 1GPBA 3JATB 1MF7A 1CLEA 2D1RA 3L77A 3K20A 1JX6A 1SUEA 3LUJA 4FYHA 4Q4JA 1W19A 3ZHQA 1DX4A 1ZVQA 2PS9A 1W2HA 1Y34E 3QE3A 1U8TA 1RJGA 1MOSA 3MTIA 3QLTA 4O29A 4D3DA 5JAPA 1SU8A 2ZSFA 2WD7B 1Y1QA 2VDWA 2PYZA 3HI4A 5KOJB 1QPZA 1D9ZA 1A77A 4TLMB 2V6FA 1JEJA 1YAJA 2JDID 2YOGA 3CH5A 3INNA 3NTQA 5IAOA 1UUFA 3QSYA 2ZRNA 2PQ6A 3Q3IA 1FXWA 4OLJA 3KJQA 2AHOA 1OBOA 2D6FA 1JHYA 1JHUA 4GR4A 4WDQA 2WM8A 3BE6A 4UNIA 5B1SA 1MC4A 1B0AA 1SY7A 4WV3A 4REOA 4XM2A 1C81A 4PX2A 4LNUB 5G1PA 4BO2A 1ORVA 3SAJA 4UU8A 2UZ1B 1UPAA 4ZVTA 1C9YA 4AO6A 2IVFA 3A4VA 4QOSA 2CWWA 3PJGA 1Q95A 4RKQA 2Q5QA 3O8BA 3RSCA 1RMTA 2OV2A 2CE2X 3FIJA 4DUGA 5ALRA 4FB5A 1CEYA 2DHEA 3S70A 1JAYA 3G5UA 1PZFA 1DC8A 3GJ0A 3HUUA 2FSGA 1G2OA 2POCA 4FYJA 5BW8A 5JAMA 1PJRA 4RNDB 2J3EA 4JITA 1NOKA 4PZEA 3WRYC 1AK1A 1NQ5A 1S3GA 1TLTA 2FFHA 1CVLA 2QT9A 3GMSA 4MR7B 3FCOA 4XFKA 3S2ZA 3K2IA 4P34A 4X6XA 3TFWA 4EL5A 4C2TA 3UCXA 2W6MA 2I7XA 2X3UA 4BCCA 3AVQA 1P8AA 1LPBB 3CX4A 2OE2A 2MSNA 3R6WA 3VPGA 4BNMA 5K3CA 3X1KA 1UIMA 3ISTA 3RFUA 4GX2A 1G3IA 3RFVA 4BKQA 4HJXA 2P65A 2PGJA 2HA2A 1BXRB 1CQJA 1PFYA 1M1YE 2HUPA 2J5QA 2OP1A 3ESXA 1KFBB 3K5HA 1SCDA 4EZBA 3CVUA 3TYXA 3HCBA 3COJA 3IKLA 4F9EA 4YXWA 4IOLA 4HX9A 1PN3A 3G79A 1YJQA 1ZL0A 2FFAA 4BHTA 2GNAA 5I8WA 1J0AA 1XYYA 3G2MA 4EUHA 4ZCIA 2ID9A 1R3DA 1QMGA 2RGGA 4IKEA 2IEBA 4L50A 3ZDQA 3CTPA 2AEMA 1Z47A 4K9QA 2QE7A 5IH3A 3GCDA 3TL2A 3PXXA 3MJEA 1CDDA 4FCTA 2ZR8A 3LDUA 2CF5A 2QIPA 2BGKA 1H85A 2C2YA 2JD1A 2QL9A 4I9GA 4UULA 3MGAA 4B32A 3UAWA 5E9AA 2W22A 1R15A 2UVDA 1M6NA 3EQ6A 1LVGA 2XQVA 4RAOA 5KNCH 1YJ5A 2GEJA 2R66A 2ATIA 2CW5A 2VBCA 3LUKA 4M9SA 4Q66C 3U62A 5JD6A 3H5IA 3DZFA 2KPOA 1LX7A 2M32A 4JR0A 1SURA 4JNCA 1OAAA 3NNDA 4U39A 2B30A 1C30B 1YB7A 5AI9A 1SZJG 2QQGA 4TLAA 4KLZA 3SZGA 1KBOA 4JASB 4B3CA 1UODA 3P94A 3HB9A 2GERA 1QV7A 3TN7A 4DSOA 1NRWA 2HC9A 1ZM9A 5F1YA 4GPD1 3ZIDA 1GQRA 4B6PA 1YIAA 1D6MA 2V9ZA 3H2BA 3KJFA 3FOFC 3OMXA 2XTJA 4WKNA 1S4QA 3I30X 2G0TA 1SIOA 3LE8A 1FPMA 1I4WA 4OQQA 1H93A 2WDPA 2PHZA 1EDZA 3K72B 5DNAA 2A14A 5L3QB 1U3FA 4CKBA 4JLPA 5LLSA 3IIIA 1C8KA 2W58A 4H08A 4X63A 3DXYA 5CIWA 3W4JA 3AB3A 4RUKA 1J0EA 3C3MA 3VAZA 4PSCA 5JNLA 3K96A 3CWZA 2BEVB 1UQRA 2P6OA 1T4CA 1X6VA 3AR9A 2BKLA 3KZOA 3TPZA 1IQPA 2GLXA 3EQZA 4KW7A 2D1TA 4MVJF 3ETCA 1DO8A 2ZI7A 3EF3A 4GQBA 1JDBB 4R05A 3SNHA 4DVGA 3GLGB 1F8XA 5H8WA 1E92A 2BFMA 2XZDA 4JMLA 2EFGA 1M6YA 2XMZA 1VGRA 1PHPA 3RS3A 3X1ZA 1ORTA 2X0KA 3IILA 4NAUA 3WLJA 1IM5A 3HLKA 4MV4A 4WTOA 5EHIA 4KFTA 4F0JA 5AJTA 4ZPJA 3SZMA 2XOKA 3DDSA 4F1JA 1IN1A 1LTQA 5I7UA 2FEXA 3OE7D 4N8DA 2PG3A 3GLHE 1QH8A 5SY9A 1GPKA 3WK9A 4AQ7A 1B6TA 2LDXA 1ZAYA 1MRSA 4QBKA 3K92A 4DYVA 4GLFA 4U2FA 3BQ9A 2YYSA 3T6KA 2IYWA 2V9PA 2WU8A 3A4LA 2W2XA 4XVQA 3I73A 4DANA 1RFGE 1TO6A 2AJTA 3ANLA 1T1EA 5AOAA 3RT7A 3W77A 3T9CA 4RPIA 1PR6A 2OGSA 5IMSA 4ZEMA 1RXCA 3WK8A 2FYTA 3GLQA 3NNSA 3F9RA 4W7SA 3QXXA 4LDJA 1ZWKA 3HP4A 3O26A 3K05A 3C7CB 1PQWA 1FRNA 1Z12A 3HQ4O 4MB2A 4UBIA 3TRIA 4CM8B 3C14C 1RTTA 5KX5B 4DQXA 1J5PA 5MGBA 2NAFA 2BCJQ 4WLUA 4E09A 4JL5A 2PEYA 1DX9A 4HD8A 3NVKI 1ZH6A 2B37A 4KMMA 1FTWA 2ZYAA 4EYSA 2IODA 2EW8A 5GPBA 2VHEA 1KVRA 3PWZA 4DR6B 2BP7A 1KNQA 3JWIA 4DNQA 2J7PA 5E1BA 1YZ3A 4O6VA 5DM60 2ZBVA 2QQFA 1TCUA 3I2HA 4OHKA 4DNPA 1UAYA 2QKYA 4IILA 1DKNA 3R7BA 1QIEA 5P21A 4UFOA 3IDSA 2FN4A 4KN8A 4PPYA 4JC8A 3O2QB 4QHTA 1PT9A 2FCAA 2QY9A 3NETA 3BMXA 5KTPA 3DD1A 1YJBA 2ZBPA 5FV7A 4UJ5A 4BUCA 2P2CA 4LKRA 3UXMA 4CHGA 2NSYA 3F97A 2ZWOA 1KFEB 5GGYA 1MJ5A 1AMUA 2QWXA 3GMIA 3TIVA 2WYHA 2Q8NA 1D6NA 4O4LF 4UEJA 5JVDA 2YQ5A 5H7XA 1XU9A 3RS9A 3OX3A 1USWA 1R8JA 5DGTA 5LJLA 4ACAA 4TWJA 4MRRA 4JQYA 3FKJA 2XBUA 5CH5A 2MIIA 3TI7A 4ZEVA 3D3JA 3A1CA 3L7NA 4CV2A 1JPUA 2VJQA 4HB3A 3O4IA 5JD4A 4BJ3A 5LOVB 4JL8A 1D2MA 4AJ4A 3WTCA 5TQ2A 1QBKC 3EGXA 3H83A 2FPIB 1ZD3A 4IFBA 3H65A 2QZSA 4AZTA 1DAFA 2AH5A 1M0TA 2FFBA 3AIIA 3RU2A 5BSEA 4ARSA 5CGZA 4TV9A 1M2OB 1S2NA 3CLSD 4FNAA 4H3KB 5FYDA 1WG8A 5IDYA 5DN9A 1EEHA 4IBOA 3RRMA 1GFIA 4TVSA 4DXDA 1FUUA 4GXQA 5A6SA 4WLOA 3ASYA 1CY7A 1QHHA 2H5EA 3AM4A 3AP2A 3DBRB 4G65A 1OXBB 2V97A 3B85A 3FTEA 4GPEA 4N5MA 4N5LA 3PC3A 2EFEB 4KX3A 4HGPA 4WZZA 1NM5A 1NP3A 5FF9A 4DV7B 2QRNA 1YQGA 1E0JA 4MYRA 5LL6P 3ZG6A 4RA9B 1GQFA 1QYXA 1X86B 5SZIA 5EEHA 5KB3A 4HNTA 2JFWA 2VPZA 2F1IA 3B3QA 4TX1A 5JARA 2FX2A 2LDBA 1TZMA 2IXAA 3AFHA 5IC4A 4Q7KA 1U2ZA 4M60A 4CG1A 2D0IA 1O0SA 4A8TA 3JALB 1QIMA 2R60A 4B8YA 4YMIA 1E3LA 5LP6B 2AKAB 2GWRA 1KAGA 3AKZA 2C97A 1QYDA 4EHFA 3GLKA 4F56A 3JYOA 3S2SA 4WZBB 2B4YA 3W8DA 4QU8A 2AJCA 5JI2E 3WB0A 2JRCA 2YV1A 1CVRA 1NPTO 3FG9A 1YS6A 4II2A 1RHQA 1G8PA 3U31A 4U1RA 4B75A 1OX4B 2P1ZA 1UP4A 3SFTA 2XIQA 4L2IA 1BHO1 1L8LA 5JSKA 2BPOA 4M49A 1M34B 2ZULA 2FGKA 4DCGA 1XXHA 3GOHA 3K9FC 1XTRA 3U7FB 4OHVA 5JWRA 1NF8A 3E53A 5JPCA 1EFLA 2C2WA 3IBCA 4GIBA 3G02A 5J3JA 5HKAA 1MJGA 2D2IA 4ZOLB 1PKXA 4JEHA 3K8QA 1GPYA 4Q1CA 4BNWA 3FMIA 3SVZA 3VO1A 3RRNA 3I5YA 3FPEA 5FB3A 4N3CA 2Q3HA 3GWZA 1OAOA 2Q4RA 3GV0A 2HO4A 1W7AA 2XWPA 3E4CA 3R0XA 4CMAA 2FLWA 3EFOB 3Q6NA 3X44A 4AZVA 4DILA 1BGVA 2HNAA 3A06A 4IFIA 3WIBA 1H6CA 1M6EX 1FUYB 2PVCA 1NVKA 3M4ZA 4G09A 5CFMA 3EDOA 4GHWA 4L8VA 4UNNA 3RAPR 1DAKA 2W6QA 3GVCA 4IJ5A 5EZYF 1GILA 3ZVRA 4H7JA 4MCHA 1GOTA 5DNUA 1C5KA 3C98A 2QG4A 1HT2E 5LDGA 3LLSA 1PNRA 4P7FA 4Q9NA 1JTVA 4U2BA 3JQAA 3O75A 4PRZA 1Z88A 5F7JA 1JHDA 3A58B 2X14A 2JFVA 1BKSB 2YZ7A 3WIUA 1XRRA 1K9VF 2FZKA 3VH2A 1VCMA 2AMFA 1L6RA 3D6AA 2PT9A 5JS8A 5DCYA 1OWMA 1ZD5A 3UFBA 3U49A 4G2TA 4TYYA 5JRZA 2Z5FA 4EG1A 5FH9A 1YXMA 1GSHA 1MVOA 1NN3A 4KQWA 1E3DA 3RC1A 3JAMA 4CCAA 1W59A 2ANCA 2VYVA 3PK0A 2A5DA 5BW5A 2I2CA 1P5HA 3T06B 3QHQA 4ZEOA 3W8NA 2JEZA 4C07A 3THXB 2HSWA 2QF7A 4L85A 1KJYA 2A67A 4PC1A 1SOVA 3PNYA 1VB3A 1RQ2A 1TCBA 2XYVA 1RAHA 3CU5A 3GJZA 4DS3A 3QX7A 4EGAA 1QX3A 4M1QA 1M8PA 3Q9SA 1NSYA 2WMDA 4KXXA 4E88A 3GC6A 1JR4A 1W44A 1ZDMA 2H65A 4PLWA 4X6LA 1Y7TA 2EDCA 3EDYA 4DYDA 1NAIA 5IH7A 1YAHA 4FCVA 1NNEA 5GTDA 3D1JA 1GD1O 2XUOA 3A9UA 1D1PA 3OESA 4X20B 2AX4A 3B3JA 5B55A 4Y6PA 1LI7A 1NF3A 1YVDA 4YJ2B 1VMEA 1J06A 2W6JD 3FPFA 2I2DA 4PF1A 4QUJA 3R7AA 4QUHA 1ECPA 3AFGA 4IQ8A 4U9UA 5EWLA 4ZWNA 3U37A 3HMQA 2AB0A 1I3NA 4DXAA 4WVLA 1Q7GA 4I4IA 3EPPA 1ML3A 3T99A 3AP3A 4WSOA 3R9XA 2E4AA 3W3AA 4RF5A 4BB9A 5LMCA 4MW5A 1OIWA 4L0CA 4D6YA 3QITA 1MB4A 4H60A 2LKCA 5K0GA 5C5EA 3AF6A 3JXEA 3BGDA 2XOXA 3BXFA 3EY4A 4UHKA 5ITWA 5IBCA 4ZTUB 2WJHA 3AEQA 1N9GA 2OXCA 2RH5A 3BWCA 5FOWA 3SCZA 3VM6A 1BXGB 4BKUA 5BV2P 2RCNA 2VP6A 2O8NA 2JLSA 1KR5A 1GG5A 4JJ4A 4U02A 4UOZA 3K9HA 5G4KB 4BPBA 1THTA 4LF5B 4L7QA 3BSYA 3FFXA 2ZPAA 1QHYA 1GUZA 1TL7C 2KMLA 4CNQA 3PT5A 5A4JA 1SWWA 5K99A 1LDEA 4C2AA 4Z8YA 1CUHA 1FP2A 1EK1A 1XJWA 1V8DA 3ETEA 3X1WA 1NY6A 4OP3A 5EHGA 4RS4A 3VU9B 5CDUA 3BJZA 4QTXA 4QUAA 2OPBA 3RARA 3X1DA 3OY2A 2ONJA 5ITVA 4B6JA 2BGJA 5GM1A 4BNNA 5K7SA 3BL5A 1QVAA 3L8GA 5I9TA 3UH1A 3TBHA 1JSLA 3B1WA 4I4NA 2JHGA 3T7RA 1SO8A 1C3OA 2P0YA 2FZEA 3HZZA 5LQAA 2XQKA 3TZ6A 2WP0A 5LQRA 2IELA 1SMKA 3IJEB 2Q3MA 4RW0A 2P8JA 5H82A 3NT5A 4NJOA 4BAZA 1TMGE 4U8GA 4B82A 4J1SA 4LCEA 3R8CA 4DCCA 3SQWA 1Q0UA 1O6FA 2PQ0A 5DX8A 2I78A 2O3RA 3OE4A 1E96A 2ZAYA 4S0XA 2HB6A 3O1IC 1RWQA 2ZM6B 2HH9A 2OCKA 3I8OA 4DSUA 2WNIA 1HO3A 3ET4A 4NOKA 4CQMA 3LKVA 1RC8A 4ITVA