1ISGA

Crystal structure analysis of bst-1/cd157 with atpgammas
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
total genus 85
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1isgA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1isgA02
4RCVA 1CQIA 3PFWO 3PIIA 1EUCA 3HUDA 3P19A 1CWUA 1J5PA 2B4QA 1IL0A 1ZKMA 1ZK3A 1O89A 4Q3NA 4RPHA 2DKNA 4YRDA 5JDIA 3L77A 1H2HA 1MUUA 2OP1A 2AQ8A 4FPXA 1J49A 4RZHA 5DT9A 3GVHA 3OJFA 3ZDFA 3QVXA 4J1TA 4W7HA 2QRJA 4D0SA 4YT4A 3WTCA 2HSDA 1YWGO 1ZEJA 4R69A 3WFIA 1LRJA 2ZJ0A 4KOAA 2HRZA 1HYHA 3HHPA 3GA0A 3ZWAA 3S55A 4WLUA 5FI3A 5JMWA 4H3VA 5B37A 1GV1A 3VH4A 3GDFA 4ZQGA 1LLDA 2W98A 4ROSA 4I9HA 3S8MA 4BNZA 5MGBA 4NNJA 3VKUA 3EAGA 4Z3DA 4CL3A 2W90A 1BRMA 1C0LA 1GTMA 4ZQHA 4NZ9A 1XCBA 2WM3A 3RFTA 4LK3A 1T4BA 4MP6A 3U4DA 3UVEA 3SLGA 1GY8A 1AHHA 3D1LA 4JP3A 1DRUA 3DBLB 4UVHA 5DCYA 4XJSA 4DL9A 2V6GA 2X5OA 4D43A 2TMDA 3ORFA 5JPIA 2O4UX 1KC1A 1ADGA 3PHHA 2HU2A 1G1AA 3LU1A 2PK3A 4KWIA 4M1QA 3LLSA 3BMCB 4DC1A 3ZNNA 1A27A 4R4JA 4MIYA 3VZRA 3NTOA 1AGNA 4MP3A 4NK4A 4CLXA 2HDHA 2AEMA 2YV1A 2JHFA 4PG4A 3AFNA 2ZJ1A 1V0JA 1KS9A 3MTGA 1AXEA 4TRNA 2FWMX 4NHEA 3ZNPA 5ITVA 2FSSA 4E4YA 4FD3A 5HA5A 5B4TA 1QG6A 5JAMA 1JVSA 3WMWA 4CUKA 1JTVA 4TSKA 2YW9A 4O5OA 1LC3A 1OFGA 4E5PA 1HT0A 3GR6A 4KDEA 5ADHA 2V6MA 3MTJA 1XLTA 4ZRNA 1LRLA 3RJ9A 1V3UA 4HFMA 4LCEA 4O6VA 2FP4A 1SNYA 4FR5A 8LDHA 1NFQA 3RKRA 1TEHA 3C1AA 3OIFA 4DQUA 3D5TA 1YVEI 3GQVA 1B2LA 2IE0A 4YBZA 4ZA2A 4BNVA 2Q45A 1ENPA 3RWBA 3I52A 3KTDA 4GI2A 5T8KC 2ZCUA 4MVJH 2Y67A 3WGIA 1NWHA 1HL3A 5T67A 4M55A 4AJJA 1ENYA 3WWZA 3OHSX 4EUHA 2CNBA 3ASUA 1NFRA 3WIEA 1VL0A 3QWHA 4C4OA 4J16A 1LBEA 5IF3A 4D0RA 1Y7TA 3LT0A 2I66A 5ICSA 1E5QA 3I1JA 4NH4A 4OKNA 3GG2A 1LSOA 4XRRA 5L9AA 4W9NA 2O3UA 4I5DA 4JJFA 2DFDA 1NAHA 4E2XA 1YO6A 1LI4A 2Y99A 3D0OA 1GEEA 3QWAA 1LSJA 3B1KA 1Q1NA 2WD7B 5A3VA 4N18A 4W6ZA 2X5KO 3DDNA 4H16A 5DF1A 2ZB7A 4OMUA 3VDQA 2VRBA 3DZBA 1I0ZA 2OGUA 2OUIA 3DZGA 3SJUA 4BKUA 2YUTA 4I1IA 4Q39A 4WCFC 1DJNA 1F8GA 1XQ1A 4IMPA 4M86A 1ZMTA 4M54A 3D7LA 3PYMA 4XQEA 1ENZA 5EQFA 2YFHA 4L75A 3PGXA 1X1EA 3IMFA 3IUPA 3RKUA 1T26A 2PR2A 1MX3A 2EGGA 4IDBA 2IZ1A 2O7QA 3DAFA 4NMHA 4ALIA 2NADA 1I30A 2RHCA 1B8PA 4KTTE 2D5AA 5BQFA 3WJAA 3ZV6A 1RM3A 4PLHA 2Y68A 1V8BA 1E7QA 1HDZA 1HZJA 4UVEA 4OH1A 1LDMA 1ZZEA 1X14A 2HMVA 1PQWA 1GYRA 3F6YA 4EITA 3NRCA 1C3VA 3KV3O 3N74A 3S2GA 3C24A 2C2XA 2VNAA 4R16A 5F1OA 5DDIP 2AEJA 1MXFA 1YS4A 4NBTA 4YYZA 2GNAA 3ZWBA 1ZSYA 4EUFA 3UGKA 1LJ8A 2QYSA 4CUJA 5BSEA 4WLFA 3H65A 1Y1PA 4OQZA 4ESOA 5IDWA 3LYLA 2HJSA 4TWRA 4OXNA 1EFLA 4BO7A 2EIHA 4NJMB 2G0TA 5AVOA 1KERA 4YTEA 3FNFA 3VAZA 3BA1A 4YAIA 1PZHA 1P74A 4P4NA 2VWQA 2PGLA 2ZATA 1CETA 2D1YA 1DAPA 3Q11A 1B3RA 1P1IA 4AJIA 2PH3A 3OMLA 1WDLA 3ZZNA 5BNTA 3U4HA 3ZWYA 3CMMA 1YQDA 3M6IA 2Q1TA 1YDWA 2NM0A 5L95A 3ZWPA 2GDZA 3LT4A 1R0KA 3GUYA 4C7JA 2JD1A 4B79A 2VZ9A 3B1JA 4HNGA 1T2FA 5KJ6A 1XDWA 4AICA 5IZCA 2DQ4A 1L1FA 4WLEA 3ZNOA 3KEQA 4MO2A 2G1UA 3JQBA 3GZNA 1C1DA 2OORA 4BNWA 4PLFA 3RCBA 4XQGA 3I9NA 4M49A 4WJZA 4IJWA 1DFIA 2VCYA 2JKVA 2P9GA 2EERA 3Q0EA 1BXZA 5IXSA 1MGOA 3OIGA 5F21A 5A5FA 2GASA 3ZWOA 2UYYA 3MZ0A 4CM8B 1E6UA 4MIEA 1PWXA 4FOSA 4N5NA 3VTFA 4JN6B 3WGYA 3DBRB 4RJTA 2O3QA 1YL5A 1NR1A 4RLSA 2J3KA 3JD0A 4J1NA 4UUOA 1KBZA 3DO5A 3GVIA 4GMGA 4DGSA 1T4DA 4IQ0A 5I7SA 4GX1A 9LDTA 4GMFA 2D5CA 1LDGA 2Y05A 2VQ3A 1EMDA 1BVUA 1NHGA 3FPCA 1VJTA 1A4IA 4HFJA 1N9GB 2OHXA 4ND3A 1FMCA 1OBFO 2GN4A 3V2HA 5K9ZA 4YJGB 2PA3A 4GQAA 2E37A 1UH5A 3MJVA 1ZJZA 3GGOA 2DTDA 1P1FA 3ZW8A 3I4FA 2VWPA 4BHTA 3BTUA 4N7RA 4YT5A 1HF3A 4J0FA 1Z45A 4J9UE 3RC2A 1VM6A 3H9EO 1SPXA 1KEWA 3PWKA 3CZRA 3QY9A 3IDSA 4WNIA 3H4VA 2G76A 6ADHA 4AJ1A 1U2DA 5HBRA 1W0CA 1EVYA 1UXKA 3H3FA 1FK8A 1XWFA 2R6JA 3H9UA 2A35A 4B4UA 2DC1A 1NX6A 3L6OO 4DPKA 4TRJA 5COAA 1BMDA 3PVZA 4GSKA 4K26A 3EK2A 3JQCA 3WMXA 4BVAA 5BR7A 1TVEA 1LSSA 4EZBA 2NU8A 4Z9FA 4NIMA 5JCJA 3JQAD 2VT3A 3BTVA 4E0BA 3CEAA 1XU7A 2X86A 1I2ZA 1O0SA 1U3VA 1BWSA 4MP8A 5L7YA 3RBXA 5A1TA 3O26A 3HWRA 2GZ3A 4M87A 1WP4A 1CERA 1R0LA 1X7GA 3ZWVA 2JAHA 3WJ7A 1CDOA 5L4SA 1PS0A 1IPFA 1D1SA 3B6ZA 4EYEA 2OFPA 3TOXA 2OMEA 4XB2A 4EBFA 4PFJA 4CR7A 3VPSA 3X2FA 2XXJA 4ILKA 1A7AA 1B0AA 3FPLA 1GUZA 5TT1A 2HKIA 4OOFA 3PDUA 4ZJUA 1Z7EA 1UP6A 2CSUA 2J5QA 2QIOA 3JQEA 4II2A 8ADHA 2H9IA 3AK4A 3STHA 3PXXA 1A9ZA 1JKIA 4ALKA 2BFOA 4O59O 1BW9A 2O2YA 1WVGA 4CUZA 1R4MB 4BKQA 5CEEA 1Q7CA 3FNEA 1E6WA 2AE2A 3HZZA 1BXKA 1PGJA 4HXYA 4Z9YA 5HS6A 1J0XO 2Q46A 1DLJA 1PU2A 1L7EA 3HN2A 4BNGA 3JYQA 5JE8A 3QSGA 5B4VA 1C0KA 2AHRA 3DWFA 4FJ1A 4NU5A 5G0UA 4D45A 3ETDA 3IP3A 3W6ZA 3AY6A 1SAYA 5THKA 4OAQA 4XZ3A 4QFDA 3HDYA 4XR4A 4YAKA 1NQOA 5AOVA 5CPBA 3DHEA 2DBQA 4PLWA 3DAGA 5JFOA 4I5EA 3DR3A 3GEGA 5CDYA 2NVUB 3AWDA 3BMOB 3PDJA 4W9NC 1HTBA 4P4GA 1ULSA 4LGVA 5JDCC 3RJ5A 4BKPA 4RPKA 3JQ8A 1HDYA 1UXJA 5BT9A 3GFBA 3NKLA 4DLLA 1DHRA 1P45A 4GVXA 4BQRA 2EJVA 3EW7A 3GAZA 3GK3A 4J3FA 3ZWNA 1J4AA 1N1EA 3MJ4A 1LQTA 1GYQA 3E6AA 4JP2A 2W2KB 4CL8A 5IZ4A 2J6IA 3NTRA 4WCFA 1YB5A 2HLPA 5ILOA 2X9NA 1EFKA 4INAA 3QVWA 1GDHA 3GVXA 3D3WB 4CQLA 4CLDA 1KEVA 3LF1A 3OJLA 5JAQA 5I9MA 1DIHA 1KC3A 1P0CA 5HRUA 3D4PA 3S2EA 2AG8A 5EERA 4JGBA 1P9LA 4J4HA 1HYGA 2CDAA 3BMNA 5IAAA 3GZ4A 2GYYA 5I7VA 1RWBA 3DONA 3DZJA 2FN7A 3GOHA 2X8LA 1Y81A 3PYLA 3OICA 1E3JA 4XYGA 2J3IA 4AJ2A 2DUUA 4F6CA 1IPEA 2HK9A 2QZ9A 5TLSA 1ADCA 2GERA 1ISGA 1NYTA 3HQ4O 4UUPA 1D3AA 1Y8QB 4IJUA 3RVDA 1XELA 3OIDA 4AVYA 4OQYA 5F1PA 1MV8A 2BI8A 3NUGA 2EKQA 3VH2A 2CF6A 3PTZA 4J2HA 4GL4A 1VL6A 4EUEA 2DAPA 3HFGA 2EKPA 3KEOA 4J91A 4O63O 5G4KA 1ZEMA 3MWEB 2GN8A 1BG6A 2VWHA 3BZUA 2GGSA 1A9YA 5F5NA 2J8ZA 4CLHA 2X5JO 1JKJA 3PJGA 1YRLA 4MVJF 2V7PA 4CM1A 4IDDA 4R9SA 4L76A 4M8SA 2RH4A 3F5QA 4RQUA 2X6TA 1PJTA 4HFNA 4OHUA 2X0RA 3PQEA 5F3RA 1NVMB 3KYCA 1K6JA 4GGOA 5G2OA 5BSHA 4Q3AA 4E33A 3O8QA 1D4FA 1ZXLA 2E6UX 1PTJA 5DCWA 1H94A 3KVOA 1DPGA 2BMAA 5IDYA 1Q7BA 2Q4EA 4NBWA 4RVHA 1PQUA 2W4QA 5ENDA 3JQGA 3H5AA 5L53A 4CLRA 3LVFO 3P5SA 5T64A 2VRCA 4HKTA 2Q49A 3HJAA 3MJSA 3W8DA 4CM9D 3EMKA 1A72A 3T7EA 2CDBA 3KUXA 4D3SA 4ZN6A 3U3XA 2A94A 5L4LA 3G1TA 4R41A 3A06A 4BL5A 5ER6A 3GDOA 3AY3A 1U7HA 3CINA 3VPHA 3NAQA 2C7GA 3RSHA 4BO8A 3N58A 1N2SA 1YOVA 1GQYA 5GZ1A 2F1KA 3KBOA 4HADA 1IZ0A 1LA2A 3RUEA 2NTJA 3B70A 3S2FA 1R0SA 5DBGA 1U5CA 1LEHA 1LDYA 4R3WA 5CPFA 1EQ2A 4BO5A 3I9OA 1ONOA 1UR5A 1HDGO 3CKYA 3M2PA 1Y9EA 5T57A 5TX7A 2HCTA 1PIWA 2FHSA 2WD8A 2DM6A 4J90A 1Q0QA 4EEZA 1H5QA 5KJ1A 2J3HA 1XHLA 2I76A 1F17A 1HWYA 2B36A 1OMOA 2OBNA 4NFYA 1VC2A 4KWHA 5KIAA 3W4KA 1RM0A 2VOEA 4YWJA 5TC4A 2C20A 3L0DA 3KZVA 4CLOA 3JQ8B 4XGNA 3DTYA 2YY7A 3KO8A 4DPLA 3K96A 3E82A 4B7UA 4AJ4A 1PJQA 2ZB8A 4DBZA 2UUOA 4X54A 1E92A 1EUDA 4J9VA 1ISIA 1B16A 2A92A 2YHIA 4U6QA 4BO2A 5B4UA 1VI2A 3WS7A 1O95A 4PRLA 2C7VA 1CEQA 1PL7A 1YQGA 5KKCA 3VPGA 2A4KA 4NG5A 5TQVA 3FHLA 4IS3A 4QFCA 2VHWA 3AI3A 5BNIA 1EK5A 1A7KA 2ZTVA 3G0OA 4LSWA 4LMPA 4L4XA 2NTNA 4PLVA 3U9LA 3ROMA 1PR9A 4BNYA 4JROA 1ORRA 5TJHA 5KVSA 1FDWA 2EJWA 1ONNA 4ID9A 3I6QA 2D8AA 3HB5X 1Z74A 3JQDA 2JHGA 3ADPA 4IZHA 5H82A 5DBFA 4XGIA 4BO6A 1FJHA 5C7LO 3KOUA 1Q0LA 3ST7A 1EE2A 5A03A 3K31A 4IUYA 2VHYA 3DAPA 4FGWA 1IHYA 3QLJA 1BDBA 4IXTA 3LDHA 4BB6A 2PD4A 3RU7A 3V1TC 5A02A 1U4SA 3ZW9A 1VJ1A 4RQTA 3K2EA 3QW2A 4M89A 3DC2A 2I67A 2RAFA 3T4EA 4IIUA 4ZVVA 1R4NA 2GN6A 4ALMA 3ZV4A 2H6EA 1NBOA 3ZGYA 3ASVA 5L45A 3AW9A 1EEHA 3SXPA 1GUYA 1HEUA 5C3MA 4E2WA 1IZ9A 2VHZA 4Z0TA 1T25A 1TT5B 4W82A 3DOJA 4UEKA 5F1KA 2WJPA 1I24A 4PIVA 1BDMA 3OQ6A 5B1YA 2NVUA 5FI5A 4EI2A 2JFHA 4XYEA 1YBMA 4WOKA 3ZU3A 1I8TA 4FQ8A 3SJ7A 4IM7A 3W8EA 1XGKA 1DEHA 3DOOA 1VPDA 2D3TA 1OC2A 3L6DA 1I2BA 2FR8A 3FF4A 5FEUA 1TT7A 4W99A 2O23A 4CMAA 1H93A 3VHRA 2G5CA 3WGOA 4Y6RA 4YXFA 4BKOA 4IY1A 3TOZA 1LX6A 4ONEA 5GMOA 3V5NA 4B4VA 2VRCD 1D7OA 2R00A 4MKXA 5JO0A 1F06A 4BO9A 2NQTA 3GG9A 3RUHA 4GKBA 4CR8A 1XSEA 3E18A 4RV9A 3ZU2A 4QX6A 3KSZO 4ZGWA 5JDCA 2CF5A 1F0YA 1X0VA 2H63A 2GSDA 4J6FA 1VKNA 4YDRA 2C5AA 1P3DA 1L7DA 5JBIA 1UXIA 1KY5A 1HE4A 1E77A 4BKRA 4BNNA 1PR3A 3FTNA 1I33A 5DP1A 1U3TA 2PZMA 3DXFA 3KYDA 3GPDG 1G6KA 2EXXA 3ONFA 5T6BA 3ZHYA 2O2SA 3ROQA 2PTGA 3DBRA 3T7CA 3C85A 5ES3A 1QYVA 4NBUA 4E21A 3KSDO 3I9KA 3KLMX 3DBHB 1CJCA 1DIBA 2VHVA 4XR9A 4CM8A 4K1LA 4K28A 1AHIA 1PEDA 1SB9A 3GDGA 4XYMA 4LCJA 2OBYA 3TZQA 3F4BA 3UXYA 3CIFA 1ENOA 1PSDA 5ER9A 1ZK0A 2TMGA 3GZNB 1W8DA 3GT0A 5EIOA 3UCXA 1XQ6A 1R4NB 3Q3CA 2B69A 1NNUA 1SO8A 3OSUA 3NGLA 1ISFA 2B5VA 3OP4A 1QORA 2I3AA 3HNPA 3G17A 1X7HA 4WKGA 1X13A 2PNFA 4LSMA 5LCXA 3C8MA 3G1UA 5DULA 4B8WA 4YJDA 1DFGA 4DIBA 1LRKA 1U5AA 4JLWA 4MVJI 3NJ4A 4CMIB 3GRKA 3ZNQA 1I32A 2E82A 2Q3EA 1UXGA 2PKRA 5JNLA 5IFLA 2G82A 2GRAA 1DFHA 2IEDA 3DOCA 3PGJA 4AJKA 1HDCA 3C7AA 2ILTA 3EYWA 2Z5LA 4CODB 1Y5RA 3OA2A 5AXDA 1CF2O 2G17A 1PGPA 4PG6A 2Z95A 1B3BA 3JYPA 3MEQA 3ETEA 4FSHA 4N54A 4U0KA 2BD0A 4GH5A 1NAIA 1JAXA 3FSRA 4FFOA 1QRRA 1TXGA 3CMCO 4XB1A 5A9RA 1IHXA 3TSCA 1ZH8A 2JJYA 2NWQA 3BTSA 3DTTA 2AW5A 2AG5A 4BNIA 2BFAA 4RPJA 3KYCB 5TNXA 1F8FA 2X1HA 5EPOA 4DC0A 3I9LA 4CJXA 1XR3A 1MP0A 2FOIA 5CDSA 2FR0A 1P0FA 1PZEA 4CMCA 4NDNE 3WQQA 3RUIA 3RC1A 1ULUA 2AA3A 3WGGA 2QHXA 2UDPA 5TS3A 4TMFA 4J49A 3GRPA 2ZIZA 1M75A 1H2BA 1OZAA 5IN4A 1RJWA 3E03A 3G79A 5COBA 4JK3A 4A03A 1HSZA 2PGJA 1DIGA 4LVCA 4UAGA 1HE3A 1I3NA 2Z1NA 1ZUD1 3NJ8A 4GKVA 4U8GA 1GQ2A 3E9QA 3EVNA 3K2BA 2OP0A 3GVCA 3I83A 1W6UA 3V1YA 1GEGA 3AM5A 4MKZA 4RDHA 4RPGA 3UFXA 3B1FA 4XQ9A 3VVBA 4CM7A 3VKVA 1ZSVA 3D64A 3V1UA 1IB6A 4R68A 3WQSB 3QP9A 1YH3A 4Q3EA 2YDXA 1YBVA 4YJHB 5A9SA 4CM9A 4QXMA 4PGFA 2I3GA 1DLIA 4QT0A 4G5HA 3SEFA 4AJOA 5DBIA 4D79A 3IUSA 1P31A 5COQA 3UW3A 1RYEA 4BNUA 4JBIA 3GUCA 4QSMA 3WYEA 4BGEA 3L07A 4LRSB 5CDUA 1VRWA 1UAYA 5TF4A 4WASA 3K9QO 4XQCA 1RM4A 1WXDA 1LU9A 4JBGA 4CMHA 4IZIA 4KZPA 4A5OA 1HETA 4FFNA 4FFLA 4JQCA 2X23A 3K73O 1Z75A 3GLQA 2VT2A 4OL9A 1UUFA 2GZ2A 3TL2A 1JVBA 2QW8A 2C0CA 4FBGA 1I3KA 3C3XA 1U7TA 1ADBA 4BNJA 4IDAA 3LF2A 4YJGA 4CM6A 2BH9A 3A9WA 1ARZA 2DT5A 2YQ5A 1HE5A 4LVUA 4FB5A 2JD0A 5J23A 1F12A 5A05A 5IG2A 5HWSA 1N7GA 3DEYX 4H7PA 4OJNA 4FW8A 1C1XA 4XJTA 2P91A 2YQ4A 1WDKA 2GF2A 1KEUA 2PZJA 1P1KA 3TF5A 4YAJA 3AUAA 1ZW1A 3LT2A 2XPCA 4K6CA 4YPOA 5JSFA 4I5GA 2ZYAA 2GCGA 4CPDA 1HKUA 2X9VA 1I3LA 3M1LA 5FWNA 4Q3DA 2PD3A 2IEBA 2JL1A 3DBVO 3U49A 1YL7A 1WMBA 4GGPA 3TZCA 4TRMA 3UCFA 1T2CA 4PLYA 1M2WA 2AE1A 1DC4A 1KVRA 4B3JA 3SBOA 4O0LA 3UKOA 3E1KA 4HUJA 2LDXA 5H81A 1EQUA 3L9XA 4NFSA 2O3JA 1K3TA 3IJPA 3R3JA 4CMEA 3PHJA 1KETA 3HE3A 2GR9A 1B26A 3PPIA 4BQPA 2PY6A 4IGEA 2NLOA 4WEQA 1IY8A 3RUCA 4Q3CA 5EESA 1I5RA 1DHTA 4KP7A 1YJQA 2NU6A 2D2IA 5DCUA 1DIRA 3KYBA 1A5ZA 1PJCA 2J5KA 3ABIA 2Y66A 1PJLA 5A5EA 3PWSA 2FZWA 1HRDA 3AU8A 4ZRMA 2AQHA 1GFSA 3GMDA 1Y6JA 3I6IA 1QP8A 3HB4X 4JCOA 3OQ1A 4D41A 3NGXA 3AOEA 1R6DA 4ZQFA 1I2CA 2BRUA 4B8ZA 3VZPA 1EK6A 3U5TA 1GD1O 4ZQEA 5KVCA 1JWBB 2CFCA 4W7IA 1U3UA 3IC5A 3D5QA 4IXWA 3ANNA 4RL6A 1EE9A 3Q9UA 1FDUA 4L74A 5EJ2A 1QXSA 2Y93A 5KJFA 5KNLA 3GF4A 4OIMA 4RORA 2R00C 2PZKA 1O5IA 3A28A 4J4TA 4CMJA 3ROPA 2IXAA 1XG5A 4YJFB 3EUWA 1ZK1A 1E7WA 4F3YA 2VWGA 4XIYA 4ALLA 4DREA 1QYCA 4MVJM 4S3MA 4YJFA 3H5RA 4NK5A 5THQA 2PKQO 4XEHA 1LLCA 1YBAA 1B7GO 3E5MA 1M67A 4R1NA 4BMVA 4MVJG 3GHYA 1LC0A 3WX0A 2PD6A 3QWBA 2DBVO 1DB3A 1P1HA 2AMFA 3K92A 4Y8VA 4J7UA 2VUTA 4IQGA 3RI3A 5TJ9A 1OAAA 2F00A 2OO5A 2OZPA 7ADHA 4JIGA 4XA8A 3EY4A 2C5EA 2RBEA 3T4XA 3MCVA 3Q2IA 4GSLA 5TRTA 3UAGA 5A9TA 1NPDA 4FGSA 5JY6A 5GZ6A 3TFQA 1JWAB 3FWZA 4Z0PA 2FRDA 3F5SA 4Z9XA 1HDOA 2BELA 3NT2A 3QQPA 1PGNA 3H9QA 4NU6A 4H15A 5L4NA 3F1LA 1CYDA 3ITDA 5I9LA 3OF2A 1C14A 3F47A 2Y1EA 3U09A 2FZEA 3RROA 3PQFA 3DBLA 4DYVA 4J7CA 3Q9NA 1VE9A 3GMSA 4B3HA 4NR0A 2FPPA 1R37A 2GD1O 2JFFA 5GY7A 5AQ1A 1YGYA 1GADO 1MB4A 4ALJA 4DQVA 3GC6A 2VN8A 3GVPA 4PVDA 4GLOA 4ALNA 3RU9A 3S2IA 2HMTA 1Q2XA 3INTA 1XYGA 2HAEA 2C07A 1NM5A 4AFNA 1HYEA 1X15A 3O38A 4I9NA 2HRBA 4TVOA 5FF9A 1UP7A 3K8ZA 2P4QA 5LC1A 4KUHA 4CM4B 4YT2A 1PS8A 3FBTA 3GN2A 4Y6SA 3LLVA 2JCXA 1JAYA 4J1SA 2VTDA 3JD3A 4DUPA 3W4JA 3MWDB 3PEFA 5DN9A 3RC7A 2VYVD 1I36A 2DPGA 1NR7A 3BHIA 2IYOA 5C5IA 4PZCA 3S1LA 4CMBA 2O48X 1EVIA 3ZU5A 2P2SA 2XAAA 2DU8A 5L3ZA 3INGA 1ZIDA 2BFPA 1N5DA 4R1SA 2BKAA 3DZFA 2B4TO 2DFVA 4PLGA 3F1KA 4ITUA 1EZ4A 1HSOA 2DTEA 2Y1DA 3IAHA 1E5LA 1PGQA 1HDXA 1XEAA 3OBBA 1RM5A 2ZCVA 2IXBA 1E1MA 3L9WA 1ZSNA 2C59A 3JQ7B 4E5YA 4YRBA 1KY4A 4BGIA 2FPGA 2CUKA 2Y1GA 3UHAA 2RHRA 3UF0A 2RH8A 3PK0A 4P4LA 2W2LD 5A3JA 5H83A 3JQAB 1C1DB 3JSAA 2NSDA 2OOSA 3ANMA 1U1IA 1MA0A 1WZIA 4TZTA 3FWNA 3F3SA 1H9BA 3PZBA 4RF2A 1YQXA 3AFMA 3RC9A 4QTZA 2B5WA 2GLXA 3EDMA 4L0QA 1Z7BA 3JQ9C 3DHNA 1PL6A 2ZQYA 1KEPA 3MOIA 1YB4A 1HE2A 4E3ZA 1SEPA 1GZ6A 2GUGA 3PZRA 4R3NA 5LDHA 3IL2A 4RVUA 5CG1A 3OEYA 3TN7A 4FJ0A 1E3WA 4WK6A 2EEZA 4JNKA 4CV1A 1MXHA 5ENVA 1QLJA 2B0JA 1UZLA 3IOYA 3K5PA 1LLUA 3O03A 2E49A 2QG4A 1MG5A 1C1XB 1V9LA 4CM4A 1GAEO 4QECA 2E48A 3VH1A 4ZICA 4ZD6A 1SB8A 3W8FA 3PHGA 3PI7A 1UDBA 1QV6A 4B7CA 4K9DA 4UVDA 4PZEA 3OFSA 5IDXA 1P1RA 2FPIA 2YHUA 2ZTLA 1E7RA 3IQDB 1VSVA 2UAGA 2CVQA 1BXGA 1P77A 1Z73A 2HQ1A 2DLDA 1UDCA 3JCZA 1JW9B 3QIVA 3RUFA 1U8FO 4EJ6A 4GWKA 4JJGA 3N7UA 3VH3A 2O3TA 1Z6ZA 4P8RA 5DOZA 5JXWA 2X0NA 4FFRA 5JAZA 3KLPX 2JAPA 2ZTUA 3QVTA 4RZIA 3MOGA 3C7DB 4DMLA 1K6IA 2FSVA 4XKJA 4CMEC 3BHJA 3PQDA 1PWZA 4KQXA 1BGVA 4EJ0A 1NQ5A 4WE3A 3LC1O 5A06A 3AY7A 4KUGA 3AJRA 4LN1A 1SBYA 2Y0CA 5IDQA 2QX7A 1P33A 1YE3A 5BSFA 1ZCJA 3PHLA 2PGDA 3W4IA 2CVZA 1RKXA 3FNHA 3DL2A 3WGQA 2ZB4A 4Z6KA 1WNTA 5JC8A 2CMDA 3ONEA 4ND5A 3H2ZA 3AM4A 1X7DA 3IS3A 1EDZA 2JD2A 4YJHA 1K6XA 3TL3A 4CM5A 1QYWA 1JQBA 1PZGA 4TROA 5JCJD 4YQZA 4CM3A 4W4TA 1G0NA 2D0IA 3AOEC 4B3IA 4FS3A 2J5RA 4J4BA 4I5FA 1J6UA 1ZVMA 3WWYA 4EDFA 4JBHA 4E5MA 1I01A 1G0OA 1T2AA 4E13A 3I9MA 2Y1FA 4IDGA 1DC3A 4E5KA 5CG2A 3H6KA 4PLTA 5KCZA 3P7MA 3PFFA 2YZ7A 3DHYA 5CFZA 5HTOA 4F45A 4U6SA 3H7AA 5AXCA 1IE3A 1LUAA 1SEVA 3ULKA 1B8VA 2PZLA 3JV7A 1T2EA 4FIZA 1EVJA 2XXBA 4Y98A 5IXYA 1BXGB 4QQRA 3TJRA 3WG9A 1NFFA 3MJCA 1GQQA 1R15A 4KTVE 4WEOA 3P2YA 4J2OA 2Y0DA 2E4AA 2V6BA 3JYLA 2HO5A 2NACA 1DOHA 1KVQA 3AI1A 4LRTB 3H9JA 2O3RA 1IULA 5KJEA 1R16A 3JQ6A 5JAIA 1H9AA 1NWCA 3VPFA 3OJ0A 2UV8A 1B15A 1NQAO 5JY1A 4BOYA 3WXBA 3FR8A 1V35A 3RASA 1ZNQO 3DFZA 5DNAA 5BNFA 2GZ1A 3WOHA 3ZI0A 2NU9A 3QWIA 2NVBA 2EGHA 3WNVA 1LDEA 4Z3KA 1N92A 2P68A 1CQJA 1DC6A 1E3WB 1QKIA 2ZB3A 3CUKA 5FFFA 2YYYA 1JKFA 4MKRA 4KQWA 1NQTA 3F9IA 4DTIA 3PIDA 4UVGA 1Y5MA 1A4UA 1E7YA 1M6HA 1O9BA 4I9UA 4ZU3A 1V3VA 4BB5A 5L7TA 3R1IA 2GN9A 4S1VA 1YL6A 2NV6A 3WGTA 3LZ6A 5JC1A 3OA0A 2W8ZA 5CP8A 4XX0A 2YV2A 4MJLA 3VVCA 1DC5A 1LLQA 2B83A 5HS4A 4RVFA 3VDRA 2XF8A 4BMNA 4NJOA 3W6UA 4UREA 2QRKA 4QO8A 4CV2A 3JQAA 4YR9A 5ICMA 5AXBA 1M6WA 5U1PA 3EC7A 5KWEA 4IBOA 3BMCA 2WYVA 1ML3A 2PWZA 4PCVA 4D46A 5C37A 1GV0A 1AXGA 3INRA 1JN0A 4RO0A 3EHEA 3WFJA 4PN3A 4DLBA 4E2YA 1MC4A 3BHMA 4UUNA 4LISA 4U7WA 4IIVA 1NHWA 2NVWA 4EEXA 3CTMA 5EQDA 1QSGA 1GZ3A 2NQ8A 2JCYA 3GNTA 3JTMA 4NFHA 4RLHA 3NX4A 4BO4A 2BI7A 4PG7A 3I5MA 1NPTO 2Y1OA 2V6FA 1EBUA 3ZWXA 1QR6A 3OJOA 2WYUA 1IOLA 3FI9A 1YJ8A 1MFPA 3A4VA 4RF4A 1EDOA 2WMDA 4BS9A 3BMQB 2FR1A 4CQMA 3QJ5A 1R66A 4R54A 4EJMA 3BIOA 3PRJA 2BGKA 2Q4BA 1N8KA 4BUCA 3RFXA 1FXSA 3VC7A 1X1TA 3AM3A 3OH8A 4L73A 1X0XA 5LDGA 9LDBA 1TLTA 2HJRA 3NDRA 4R5MA 3IKTA 4Q9NA 5L40A 2VZ0A 4ND1A 4RVDA 2C54A 2HK7A 4XIJA 4PLPA 2CZCA 3TDKA 3CZMA 2ZKLA 3Q6IA 4KMSA 5DZSA 2CVOA 4WGGA 2C82A 4GX5A 2UUPA 3NV9A 4L4RA 4PLZA 3RBZA 3GNSA 2EP5A 3CXRA 3WNQA 4IS2A 4GLLA 3DQPA 5CEJA 1TT5A 3M2TA 4C7KA 3U0BA 3PHIA 4OGWA 4B4OA 3BTOA 1ZBQA 4UEOA 3PJEA 3HG7A 3Q1LA 4RPLA 4U5QA 1P44A 3UCEA 2P5UA 2WTBA 4Z0HO 3ETGA 1JLLA 2Y1CA 4BMSA 3EGOA 4WNCA 5A9SB 1KIFA 3JYNA 4YQYA 4PVCA 4IGFA 3LK7A 1ONPA 6LDHA 4PRKA 3DZKA 1O94A 4GX2A 3O9ZA 1ZK4A 4Y6PA 4DMMA 3WYBA 4OXYA 1DBVO 5KTKA 1V3TA 4MVJP 3K6JA 4HWKA 5G4LA 3WQRA 3ZHZA 3EZYA 3JQ9A 3JYOA 5G0VA 1YXMA 3G3EA 2EV9A 1VJ0A 2C29D 1GL3A 4MOWA 1M66A 3PLNA 4PG5A 1ISJA 3I3OA 4DBVO 3GGPA 3ZU4A 1ZJYA 5JLAA 1LDNA 4E32A 3H5NA 4BGUA 5JS6A 2H1SA 4K6FA 1GCUA 4BNFA 4AJPA 4BGVA 5HM8A 2O7SA 1QMGA 1BHSA 2Z1MA 3O4RA 3PP8A 4PZDA 4D3FA 5JYDA 3VZQA 1PJ4A 2WE7A 2JCVA 1WZEA 3P2OA 4B7XA 1UZNA 3AOGA 4WECA 4AJLA 3U4IA 5AYVA 3KXDA 4E30A 1YDEA 3JQFC 3MJEA 4R01A 3VZSA 4HV4A 4FN4A 1T1SA 3QVOA 1KOLA 2D59A 3WTBA 1H6AA 1ZFNA 4BNLA 4FCCA 3PJFA 3WSVA 4WLVA 2ZYDA 3L4BC 1WPQA 3HFSA 4NPCA 2DBRA 5TT0A 3ZCXA 1XA0A 2HMSA 2EWMA 1HLPA 1EUZA 1K89A 2Q1WA 1E0DA 4OOEA 1DJQA 1UZMA 1LTHR 3NEPX 2YFQA 1GCOA 5BSGA 4A0SA 3FNGA 4E5NA 3GH3A 3NYWA 5G4KB 4AJEA 2HUNA 4QUKA 1DSSG 1PS9A 3C7CB 1NTOA 3L6EA 4IDFA 3RQSA 1QYXA 1Y8QA 4IMRA 3RUAA 1T2DA 3WLEA 2IRWA 4GWGA 4A26A 4D42A 2X22A 3WBBA 2R2GA 3U4CA 4CMIA 3RD5A 1Y8RA 1DO8A 1CIVA 4Y9DA 2YJZA 4DIOA 4GX0A 2B4RO 3UICA 4CV3A 3DBHA 5ITWA 3E8XA 1YOVB 1D8AA 4ND4A 3DMTC 1MLDA 2BFMA 3BAZA 1WW8A 3RFVA 5EN4A 3OETA 4AJNA 4BIIA 4TQGA 1MC5A 4IJKA 5JW6A 5F5LA 4DQXA 3OJEA 1PJ3A 4TVBA 3TPCA 1AUPA 2FMUA 3LSYA 1KYQA 1E3IA 3ZWMA 3E9NA 4BNTA 1DAOA 2CD9A 4Y67A 3SX2A 2WYWA 4E2ZA 4NBRA 4MPDA 4YACA 1XKQA 1BTOA 4A73A 3CSDA 1UDAA 4UUMA 2Q1SA 3V8BA 4YRAA 3BMOA 1QV7A 3FTPA 5A4DA 5K6AC 2WE8A 2EF1A 3F4LA 2IZZA 1DDOA 5U4QA 1PJBA 3COSA 2I5PO 2VHXA 5FYDA 1NVTA 4XYBA 3AI2A 3NT5A 3WICA 1YKFA 4IINA 1DRWA 1PJ2A 3KB6A 2SCUA 3ZHBA 2DTXA 3I9JA 4CMGA 2O3SA 1O8CA 3KETA 1GUFA 4NI5A 4FDAA 2VNSA 3VTZA 2X58A 1HDRA 2EW8A 3F46A 4CV0A 1JDJA 4CR6A 4D44A 3TFOA 4OYRA 1TB4A 4YT8A 5L51A 1ZXBA 5KKAA 1GZ4A 7MDHA 3Q2KA 1E1LA 3TWOA 2CY0A 4MVJD 3DFUA 5G0TA 4IJVA 2Y0EA 1M76A 1EBFA 5G0SA 2GO1A 4FOOA 3SC4A 2IZ0A 3H8VA 1FF9A 4XGKA 4AJHA 3TNLA 1WMAA 4AL4A 1T1RA 1GPJA 2Q2VA 2Q2QA 2IODA 2O50A 2VYNA 3AU9A 5TIIA 4MIOA 4YEDA 4BV8A 1GR0A 1GPDG 3OEWA 4G2NA 3VOSA 1OC4A 4BO0A 2BLLA 4DLAA 4R1TA 3JD1A 2I9PA 2VOJA 4R9RA 3GHHA 3V2GA 1Z82A 2QYTA 1C0IA 2QZZA 2W2KA 4IDEA 4DIFA 4G81A 4A2CA 2PFGA 4FC6A 4RF3A 2POQX 5JYEA 1VKOA 4I8XA 2YV3A 4DVJA 1B14A 4XRGA 4WUVA 1TI7A 5TGDA 3RUDA 1ZO8A 3GN1A 4ND2A 4U0JA 4BO1A 3HN7A 3AUTA 2X0JA 4WLNA 3BYZA 3ZV3A 1NASA 4RVSA 4TKLA 1UJMA 5CDGA 1K5HA 3KYDB 3WR5A 1JU9A 2PV7A 3A14A 4HX5A 5T5QA 1Y9AA 4JJIA 2DUWA 1IYZA 1P1JA 3FRJA 3R6DA 1SOWA 3WSWA 4WOJA 2ZK7A 3H2SA 3TZKA 3IJRA 1H6CA 1ID1A 4QEDA 5MDHA 2Q1UA 2FY8A 2WEKA 2YHIB 1H0KA 4CLEA 4LW8A 3K30A 1RYDA 3G49A 1XIVA 2P4HX 2C2YA 5JDIC 2DPHA 1EVZA 1O6ZA 4XDZA 5CDTA 1Q0HA 2BGLA 3BXXA 2BF7A 1GYPA 1E7MA 3OM9A 3SVTA 2QRLA 1ADFA 3TQHA 5EINA 1VLLA 1DXYA 4BNXA 4OM8A 4NQZA 1BW9B 1GU7A 1ISHA 1LQUA 5IN5A 1Q7GA 1OI7A 4BNKA 3ZV5A 3E48A 4ZQBA 3EZLA 4KDFA 2H5LA 1V6AA 3ON5A 2XOXA 3HDQA 2OXIA 1KVSA 1E3SA 2ZTMA 3D3EA 1MFZA 1NPYA 3DZHA 1U9JA 3DB2A 1MG0A 3R3SA 4URFA 4B4WA 2AEFA 4CLOB 4NBVA 4Q3BA 1T24A 3QWFA 3NTQA 4IQ8A 3UUWA 3ZH2A 1FDTA 4YA6A 3U62A 2P9CA 3L4SO 3LT1A 4E6PA 1HLDA 2DVMA 3SC6A 4N5MA 3ROKA 4BO3A 1WWKA 4YAGA 4L8VA 3H9GA 3QRWA 4WLOA 1PGOA 4WCFB 5C7IO 4J7XA 1H6BA 4RF5A 3E9MA 1FDVA 5KOIA 3PWZA 4HNHA 3WBFA 2RIRA 1K2WA 3VPXA 4EGFA 1H6DA 2UVDA 4OO3A 2HMWA 4XD2A 4DPMA 1VL8A 4RDIA 3FD8A 3NT4A 4A27A 5A04A 2B35A 4YVFA 3WGHA 5GZ3A 3C1OA 4GBJA 2GPTA 1I3MA 1DRVA 1UXHA 4L9RA 4TRRA 3ZN2A 3CH6A 3JQFA 1HZZA 1NXQA 4FFMA 4UEJA 4EW6A 4DWVA 3O8QB 1IUKA 2NNLD 2HMUA 1N7HA 1TA4A 3X2EA 3JD2A 4DYDA 2WSBA 3FCOA 4KUEA 2NTVA 1U4OA 3ANLA 4AG3A 4E31A 3RAJA 2V65A 2DBZA 1SCUA 3LC7O 2IYPA 3L4BA 2VYVA 4P22A 1E1KA 4R1UA 5DP2A 4CLRB 2Q2WA 3JQGB 4JX8A 1KVTA 4JXKA 3W1VA 3ONDA 4FC7A 4NJMA 2ZYGA 3ENKA 4BNMA 3QHAA 2JFGA 4CQMB 4XCVA 5C7OO 3AUUA 2NUAA 1N9GA 5ILGA 4GPD1 2HK8A 4IDCA 2AQKA 2OL4A 3GGGA 3WLFA 2D4AA 4FJ2A 4A10A 4II3A 5I7EA 3FN4A 2BGMA 4MVJA 4E12A 1DIAA 2CDCA 4YCAA 1E3LA 1LXCA 5T8KA 3D4OA 4RVGA 2Q50A 5EL0A 1ZMOA 1WLYA 5KJCA 1LDBA 2VZ8A 2I6TA 4RGBA 5I8WA 2W2LA 3BMNB 4HBGA 4N5LA 4YB8A 3HSKA 3GFGA 3LC2O 4FFPA 1YB1A 1BSVA 4J43A 4OXKA 4QO7A 5K0ZA 5I9NA 1PQPA 3IP1A 2YDYA 5EMHA 3OQBA 3ICPA 1S7CA 3PJDA 4OSOA 2RCYA 2O4CA 3MJTA 3M1AA 5CHEA 2P9EA 4UVIA 4BV9A 3PYXA 3GEDA 2ZQZA 1PJSA 3GEMA 1UP4A 3JD4A 3DMYA 1UAGA 4MVJE 3DMTA 3UN1A 1K0UA 4D7AA 2EKLA 3GAFA 3LQFA 1R12A 4R51A 1JA9A 3RIHA 3TZHA 4P38A 1SMKA 2I65A 3CE6A 3TZ6A 5B12A 4F6LA 1B8UA 1HXHA 3I4CA 1U3WA 4HP8A 5I8ZA 3EVTA 4MINA 5CEFA 2WD7A 1Y8RB 4R5HA 4PLCA 3A1NA 5CAEA 5I7FA 3ICCA 3KRTA 5KVQA 3RBVA 3JQ7A 1NVGA 4J1QA 3IIEA 3GPIA 4D3DA 4GVLA 1E1NA 1W73A 1VSUA 1ZK2A 2A9FA 5G0WA 2AXQA 5K6AA 3QA9A 3ZHXA 3OECA 1ISMA 2WDZA 1KVUA 3D4NA 1AN9A 3IKVA 3WGZA 4CQMD 3AUSA 1SOVA 4HY3A 5IJZA 2EHDA 5AXAA 3ENNA 1E7SA 4WPGA 1E6EA 5JCXA 2IDZA 3KHUA 1XU9A 2J3JA 2WWRA 4A7PA 3QV1A 3ZWWA 2VUSA 5L7WA 1W4ZA 4DRYA 3I23A 1BVRA 4YAEA 4ZHSA 3C1TA 1A71A 4TZKA 3NDJA 3CPSA 4XYLA 1U2GA 4OSPA 1NP3A 2LDBA 3ITKA 2BHLA 2ET6A 4GAEA 3WIDA 4O1MA 4J0EA 3KM0A 4MDHA 2PKQP 2P5YA 3BMQA 1F14A 4CMKA 1R4MA 1E3EA 2B37A 3DZIA 4I08A 2AQIA 4DXHA 2VTEA 3B20A 4XDYA 2X9GA 3HDHA 5JO9A 4PG8A 1WAMA 2PLAA 1WDMA 2Q99A 3HADA 3QE3A 4LMRA 4WCDA 1PL8A 2EP7A 3ADOA 5TSDA 4BNHA 1PZFA 1SC6A 1OOEA 1C0PA 2X0IA 3WB9A 4G65A 2X7HA 4UULA 1CRWG 2EG9A 1I10A 3HDJA 3NDIA 4HFRA 3TRIA 1QYDA 1LSUA 1U8XX 2VUUA 5JMPA 3R0IA 3D3WA 3FBGA 2EW2A 3QVSA 4CQLB 2X4GA 1SZJG 3PLRA 3UOGA 1D1TA 3E5RA 3SLKA 5KVVA 1N1GA 3GNQA 3ZWCA 1AE1A 4IPTA 4XWYA 5IZCC 1S6YA 1LNQA 4DA9A 3GY0A 3V2UA 2PH5A 2VYND 1PX0A 1FDSA 3JQBC 4L4SA 3H3JA 1QLHA 2QQ5A 2I99A 4F46A 3FR7A 4OKIA 3UH1A 3WDSA 1YONA 1RPNA 3KSUA 5U9CA 4TKMA 1U28A 3WYCA 2NU7A 5DOVA
chains in the Genus database with same CATH superfamily
1BNCA 2XWSA 3PIIA 3AG6A 1SCBA 3T4PA 3AKDA 1A9TA 2B4QA 1ZKMA 2XCIA 2E6KA 4Q3NA 4YNBA 4DKJA 1JDNA 5JDIA 1EFCA 3L77A 1RZVA 3K5WA 4X63A 3UUGA 3WY9A 4DGQA 1TEVA 4RY9A 2WWXA 4FPXA 1J49A 4KKVA 3ZDEA 5JZBA 3Q8WA 4RZHA 3FY4A 5DT9A 3A6HA 3OJFA 3PNSA 3ONNA 5BMVF 1N57A 3B5IA 3SQXA 3R6WA 4D0SA 1PW5A 3WTCA 1P4SA 2HSDA 3I61A 1TKRA 1YWGO 1ZEJA 1T4MA 5BV2P 1QE3A 2F9LA 3PNQA 1ZWLA 1SHJA 1TK2A 4B74A 1OH8A 4LYEA 3EFOA 4CFZA 1R6BX 3GA0A 3OEED 4G0PA 4WCVA 4ENVA 4L0DA 4G4SO 4N7BA 4OY3A 3VV2A 3BWEA 4AUNA 5EJ7A 2EAUA 3R76A 2FEAA 3FCEA 1GV1A 1CZLA 1U9IA 5B37A 4RU1A 3S8MA 3O1HB 2V7BA 4I9HA 2ZRFA 3BB1A 3AW8A 3I2KA 4MITA 1ORWA 4ND8A 1CQIB 5MGBA 5C35A 3FYCA 1KY3A 4BZWA 5JI2E 4RJIA 2GAFA 5I47A 2WM3A 4HTAA 3W2GA 4LK3A 1T4BA 3WIBA 3BDIA 1G8HA 4P4UA 1A2QA 3LLUA 3CF6R 2WA1A 3U4DA 1N6NA 3VNVA 2FPUA 1GY8A 2GCOA 1CE8B 1I2AA 3HFJA 1EJ2A 1WIWA 2E4YA 3PL1A 4OGGA 3AVUA 1QPGA 1V37A 1SXPA 1NQWA 1G1AA 3R3XA 2PK3A 3TTYA 1C4KA 1VG1A 5LD2C 1ZL2A 4KQ2A 2ZRGA 5T41A 2YZKA 4FOLA 3NHLA 1NJSA 1N7IA 4GOND 4MIYA 3SP1A 1AGNA 3OZEA 5TGTA 8MHTA 4CLXA 1NBIA 4NARA 4P3PA 4TMYA 4CIXA 4D96A 5I4KA 1WSBA 1CUEA 1PWYE 2ERXA 3AFNA 3EVFA 3BEDA 3HYLA 3NUZA 2Q6VA 5FLEX 1F9AA 3UUFA 4TRNA 2XSZD 5BPFA 1E63A 3RSOA 2WMOB 5HA5A 3TW0A 1O9HA 1RBMA 3BH6A 5B4TA 4RULA 2OM2A 1QFZA 2BEVB 3VPBA 1C9YA 1T1JA 4NECA 5I7AA 3ROFA 4A0GA 4RM3A 3EEOA 2TMKA 3CZ5A 2V58A 3OVMA 4HGNA 4L51A 3REQA 1JTVA 4TSKA 2YXBA 1B0PA 4D9FA 1TIBA 2G7ZA 3P52A 4E5PA 1NI3A 4DZZA 4WK2B 2BKVA 1F38A 5FA5A 4HYEA 2ZSFA 4IX9A 5IT9A 1XLTA 4LV8B 4ZRNA 4OB8A 3CVWA 2YZNA 2Z4TA 4ZT2A 1XPOA 1Z2AA 1P7VA 1V3UA 3P2KA 4HFMA 3R7BA 3RUPA 3T3HA 4UCWA 3II6X 3OCUA 4F8EA 3OOHA 3D6VA 3P0JA 4BZQA 2B78A 2CKDA 3WLTA 4KFTA 1WPRA 1R0CA 2ONZA 3WIOA 3X43A 1D0SA 3UM9A 4YRRA 2G25A 1CRQA 4IJ6A 4K9RA 1M8JA 2KW5A 2X2PA 2AW3A 5F4BA 3W8NA 1HL7A 4FHDA 4JI2B 1ENPA 2WTEA 3F98A 3KFLA 1ACJA 4TXMA 1FXWA 1M8GA 2ZCUA 3MJRA 2A30A 4KXMA 4MVJH 4W63A 1M0EA 1NWHA 1HL3A 3A1TA 5T67A 3SHQA 4OHPA 4Y9RA 1NVDA 3QG5A 4JB2A 4KWCA 1EYZA 2MWMA 4J29A 1N6OA 1Q0PA 2CNBA 3ASUA 4WMLA 1WQ3A 4G9GA 1V5IA 5IYZA 2ECQA 3R0JA 4IRMA 3GYGA 3LUHA 1QNFA 1XPJA 1Z26A 2GCEA 2FFQA 2O20A 4ML3A 5AJHA 4UBJA 1M2KA 2ZFUA 3OEHD 3T94A 1EVEA 2BEVA 2ECFA 3WMRA 2GA8A 5ICSA 2Y71A 3GA5A 4FFBA 4HS9A 4MLPA 4Q9HA 3GG2A 5DVZA 3MMPA 3VRHA 4BFYA 4YV1A 5KS2A 5C8XA 4MRNA 3OPNA 3SBXA 3U3RA 5BURA 1Q3KA 3B2NA 3N2NA 3N6RA 4I5DA 1JXMA 4ZHQA 4HI0E 1BDIA 3IEVA 1OCEA 3R9WA 1RWNA 4G3XA 1C7QA 2LV8A 4N7JA 1OX4A 3E27A 2QVBA 2RGCA 1ZNYA 3B1KA 2WD7B 2W2VA 3G0IA 3KS9A 1UBCA 5AKHA 4H16A 1G3QA 1X7WB 3VDQA 2VRBA 3QMPA 5JVDB 5AW8A 1BWPA 3DZGA 4X41A 1TCBA 5EOVA 3SXUB 1AA6A 3BXGA 1XD9A 2WJHA 1NUHA 1IDOA 1QWSA 1WCIB 3IHKA 5JYBA 1V6CA 1DJNA 1XQ1A 4TYQA 2ERCA 4PWZA 2JAUA 2XIJA 3HJGA 1NI4A 3IUEA 4LWQA 5ALYA 2ZIFA 4MV9A 3PYMA 4XQEA 2YFHA 1X7WA 2QN9A 3TSOA 3RKUA 4DQ0A 3IMFA 1V8PA 1DPFA 2XNJA 1LTKA 1PTKA 4NMHA 2O7QA 3A3OA 4ZOEA 4Q4HA 1NY6A 3QX3A 2CC2A 3FPBA 4CNBA 2RHCA 4KTTE 4CIDA 3A04A 3DLIA 5LBIA 1IWBB 2YN2A 5CFRA 3UB2A 3HVRA 3ZY4A 3RV4A 3IEKA 1V8BA 1HDZA 1HZJA 1TYAE 3DCIA 3N2IA 2YYZA 1H05A 1UJ4A 4OH1A 4UVEA 3WK7A 4W5OA 1WG8A 1VZ2A 2HMVA 4PF1A 3ZD8A 4UU0A 3D4BA 3ZVLA 3BCUA 4QGHA 3IAAA 3NRCA 4FFBB 2QTVA 2VBFA 3JARB 1RQGA 1KI8A 4TUYA 4CW7A 5SYMA 2JHCA 2C2XA 3A25A 1WKCA 5DDIP 3UYKA 4RZ2A 2AS0A 4LYHA 1EWYA 1RRKA 3DE1X 3AQ4A 3ILVA 3N2GA 4RKYA 3WKAA 2B9EA 1FMJA 3PEWA 4LWOA 1ZSYA 1WZNA 3N86A 4LE2A 3UBMA 4D25A 2CHFA 3SIPA 1U2GC 1VMKA 1XD2B 3QV2A 5BSEA 3S27A 4WLFA 4A8HA 4OQZA 4ESOA 3G23A 2CXTA 3CKLA 5A2QA 3AKEA 1IZYA 5JI3E 2EHJA 3H3XA 4TWRA 2VTVA 1U1CA 1EFLA 4B7AA 2YICA 4B6QA 1B4DA 3KL2A 2C2BA 3FTCA 2CXXA 3GJRA 1KDVA 3V7YA 3ET4A 5JOQA 3FMGA 4IQFA 3WL5A 3DHWC 1JTEA 3IEPA 4C0AC 4AKGA 4JT9A 5TQ0B 4F06A 2ZUWA 3PXEA 3RS3A 1N2CE 1PZHA 1QAQA 2WLTA 3D3JA 3L43A 4JLUA 4YP5A 1I7SB 2H4HA 2IYXA 2I33A 1NLMA 4DB2A 2IIVA 3G9XA 3G7UA 4K9NA 1RWKA 2WHEA 2WV9A 3D2BA 2F9MA 4TTPA 5FWAA 5KYYA 5LWQA 1NMZA 1CZKA 1YQ9A 2VF4X 2Z8XA 3DDWA 3H4MA 3M6IA 1X6VA 2CXUA 2Q1TA 5JR3A 3CB2A 1YDWA 3UEOA 5FIUA 5F98A 1D7AA 3IV9A 3RYTC 3D1JA 3ZWPA 1HK7A 2GDZA 2L18A 4YR7A 2PUEA 2HCBA 1Z4IA 3GUYA 1UC9A 3SF8B 4C7JA 4E5VA 5H4GA 1KYTA 4B79A 2VZ9A 3CONA 1DQNA 2A0YA 4PPYA 2FFAA 2EU8A 5CLJA 3GUUA 3P32A 3ZUGA 1M5UA 2XDQA 1IIBA 1OT5A 4R2LA 1MH9A 1CIJA 1O5TA 2R8OA 4WLEA 3ZNOA 4G1MB 2AOTA 2YYSA 5J2UF 5H3CA 1I6KA 4MO2A 1U2RA 1C50A 1WCWA 1C1DA 2DFNA 3F0TA 3JQBA 1BE0A 4HO1X 4XQGA 1N2JA 4IJWA 3T5MA 2Q7DA 1P9WA 1AU9A 2VCYA 3D43A 3GJ8A 3L1UA 1BWRA 3S44A 1KOGA 2CLLB 1L4BA 2UYYA 2QX8A 2W37A 2AJTA 2FWRA 2ISCA 3QX9A 1Y5NA 4MIEA 3ZD9A 5DXFA 2Z8ZA 2G77B 1NY5A 4FOSA 4ZOLB 3DUFB 3WGYA 4BQFA 2CEAA 2FG5A 1IAVA 5ES4B 1S8NA 5KU1A 1I4OA 3OQVA 1KWKA 2J3KA 5EZ5A 3BHNA 4W5RA 4DE5A 3RADC 3D0RA 5AM3A 4UUOA 4AY2A 4GR9A 3IRUA 4R8MA 3ND6A 1FUYB 3T5CA 1L8AA 4GMFA 3WIUA 2PDAA 4JITA 2VQ3A 1N7JA 1OW3B 3FPCA 3ZDAA 4LZOA 2QM3A 1N9GB 4ND3A 2V4MA 1JHQA 1FMCA 2HBYA 3MXOA 3V2HA 3SLRA 3M5CA 4S1PA 1NF3A 4POOA 1Z0SA 1OTXA 3DOIA 4JJZA 3OCWA 3HJBA 4R8LA 1FDRA 1L7MA 3BXZA 1H2EA 3IT1A 2UUAB 1CCWA 3H1AA 5JSHA 3IUNA 3DEZA 4BHTA 4Y30A 3PB3A 4ZEMA 3BJRA 1Z45A 3OO0A 1MJHA 1VM6A 3KJXA 3EVZA 1T3TA 2J9XB 4PCUA 3WK4A 4EECA 1KEWA 1OLSA 4LY0A 3QE9Y 3TECE 2ADOA 4H7DA 3CZRA 3QY9A 3IR6A 4WNIA 1E3DA 4TTSA 4GZMA 4BZPA 5BXQC 1GRVA 1ZIOA 6ADHA 1U2DA 5HBRA 3O8LA 3UNXA 3RF7A 4ESHA 1O1YA 2A7QA 3EE6A 4K3VA 1L9KA 1RAEA 2F67A 3QVGB 4KSCA 5HF8A 1KDRA 4HB2A 4RWEA 2XB2A 4M1SA 4P80A 4YUVA 3TB6A 2OQRA 1IH8A 5T4BA 4TXHA 5AM4A 2PUBA 4D8XA 3UT5A 1KSHA 3AESB 4WNAB 1QFSA 4A8JA 4IIYA 1BMDA 4AULA 2IUEA 4GSKA 1DUVG 1ZG3A 1TK3A 1W0KD 3EK2A 3JQCA 3FH0A 4K26A 5D5QA 5BR7A 2BCEA 3PCXA 1HFKA 2D5LA 5BSTA 4NIMA 1X8KA 5CT9A 4F21A 3BTVA 4EY4A 4QYIA 3CEAA 5HHTA 4EO7A 4MP8A 5FHQA 3FOEC 3H2KA 5H80A 4D56A 1O87A 3HWRA 4IKPA 2A5LA 2GZ3A 3I76A 1DUSA 4ZANA 4JUAA 1FQKA 1PEYA 2F3QA 2E4XA 3DQZA 3Q98A 1X7GA 4CEIB 2QR3A 3PCRB 1DKRA 1PS0A 1Y63A 1OLOA 3PKIA 2QX6A 1FLNA 4EYEA 2HCJB 1XVTA 4C0SA 3AR4A 4LC0A 3DO6A 3OZVA 3ZDZB 3AJEA 4NYIR 3P0FA 3WBKA 4XB2A 3DMNA 1KAOA 2WWYA 1SELA 4KPGA 4R1PA 4B6OA 3CNQS 2J9GA 1I0LA 4HD8A 3UMBA 5TT1A 5DYNA 4ZJUA 5IWAB 4II2A 1CNMA 2H9IA 2RC5A 3THRA 3N2EA 3AK4A 3LFHA 2Y1WA 3BN3A 3W8RA 5HSGA 2AZTA 2CUTA 4OHCA 1JKIA 1N5KA 4ALKA 3NXKA 1WPGA 2SBTA 5JH7F 1BW9A 2WHPB 2IDJA 2ZAOA 1BEUB 2O2YA 3DMFA 4CUZA 1RLTA 2JDIA 1VJCA 3L1HA 3ZHCA 4BATA 3L4KA 4DLYA 3PDCA 1E6WA 2Q9AA 5AW9A 2VDJA 1J0XO 1T0BA 2Q46A 1VB5A 2R47A 3G5MA 4LFCB 3B9QA 3EUAA 3GXBA 1NXXA 2XWPA 5JASA 3QUBA 3JYQA 2PGOA 1KK1A 3QSGA 4LVOA 4RNCA 5JE8A 5B4VA 9ATCA 1JE0A 2AHRA 5G0UA 3DVRX 2PRKA 2QSZA 3MQ4A 4L5BA 4AS3A 5AI6A 1E20A 5J4KA 3QF4A 4QFDA 4N3NA 3RS9A 5AOVA 5CPBA 1EXMA 1XRPA 3M8KA 1ZAYA 4PLWA 4C78A 4PQEA 3DAGA 3GEGA 3WGUA 2D74A 2NVUB 5DT2A 5AD1A 4Q4HB 4Z86A 5JDCC 5HDQA 4BKPA 5G1OA 4KQFA 2WTUA 1CQWA 1DQZA 1UXJA 2XB8A 5BT9A 4UNSA 2DERA 13PKA 3MFQA 3NKLA 5FBWB 5GV7A 4D0RA 1P45A 4BZXA 5LJLA 3CUSA 1F2VA 1Y4SA 4BQRA 2EJVA 2XKAA 3GAZA 3TB4A 3QXHA 2Y2UA 1BKDR 4B09A 1SJ9A 2ZSHA 3M0EA 1CZOA 5IZ4A 2Q0QA 2J6IA 2IPOA 3PUZA 1PFVA 4QEZA 3W5VA 3MAAC 4AZSA 5JTUA 2AG0A 3FFAA 4WCFA 3ZKWB 2OD9A 4YV0A 1Z5ZA 3HKBB 5ILOA 4INAA 3RVOA 3K8YA 3ZTWA 1GDHA 5IJ0B 1GNVA 3H1EA 2H8KA 3OJLA 1SVUA 3UFXB 4I2VA 5I9MA 3D54D 1DIHA 1KC3A 1C3OA 1P0CA 1TRHA 1ZN7A 1QCZA 1CUUA 1ZOIA 3OJCA 4G23A 4LZWA 4C06A 2AG8A 2H59A 5EERA 3EVAA 4JGBA 5AVYA 4J4HA 1T6ZA 2UZ1B 2XSZA 4EQZA 2PHZA 1CZUA 2Z2IA 4IHJB 3GOHA 3WWOA 1BKYA 2AMVA 2H7CA 2X8LA 1Y81A 2FSIA 4RTJA 2PRSA 2J3IA 2EWWA 2ZT7A 1DO0A 1LS1A 3FUCA 5DWQA 1DINA 4N76A 2BE7A 1IPEA 1GITA 2HK9A 3AV3A 5TLSA 2GERA 3NPMA 1ISGA 3QPVA 3HQ4O 2NUPA 3KLNA 4UUPA 3GAMA 2ZROA 4ZK6A 4PTYA 4YRTA 3K0CA 3IULA 3KLOA 2ORED 5REQA 1GZVA 1K66A 1OYVA 2BI8A 3IA2A 3NUGA 3OPXA 3VH2A 1QIMA 4LF6B 4OLFA 4J2HA 4GL4A 5MFZA 1V8FA 3IAM6 2FMHA 3O95A 4J91A 4FFDA 3MOSA 4O63O 2YFYA 2GN8A 5AJWA 5E4TA 1JIXA 1BG6A 4GOJA 4M0DA 3BZUA 4M9ZA 2GGSA 1A9YA 2Q3MA 5F5NA 1ZJWA 4MV5A 4CLHA 4HN2A 5F2EA 1ECJA 1YK1A 3U40A 4ER6A 2XY4A 3E7PA 1WA5A 2ZP1A 2GN0A 3K70B 1K8YB 1RWOA 2RH4A 3BGWA 3KZ1E 3HJRA 1JF8A 4G36A 4P93A 3UWSA 5JHHB 1FVOA 2OO3A 5DNVA 4NFLA 1DEOA 4JV5B 4QGAA 3A6ZA 3DR5A 1KJIA 4KIWA 2XTJA 3CSUA 1NDUA 4N0DA 5E1OA 4E33A 1BU5A 5CLFA 1NNEA 1NJ8A 4FCVA 1PTJA 3EODA 3K0KA 5DCWA 4AJHA 5KTMA 3ICVA 2XUHA 3MAGA 4Y2RA 2LBPA 5IDYA 2Q4EA 3A05A 4K9KA 2B98A 1WQ1R 3IQWA 3WA7A 4UBLA 2W4QA 3JQGA 4IG9A 2QSJA 3W5AA 3LVFO 1P73A 3B6JA 4O2BB 5DHUA 2O1XA 3BL5A 3MRXA 3W8DA 5AHKA 5FJJA 3RRMA 4E03A 4NONA 4YRSA 6CHYA 3IQGX 4OHZA 1V7QA 1DIOB 1ORTA 1XMIA 1FVFA 1S3IA 2NUPB 2VQSA 4EHAA 3RB8A 2BEUB 4MULA 5L4LA 2QQFA 2VDQB 5E1BA 5FL7D 2ZDHA 1VE6A 3D6HA 4F4JA 3RSHA 2ESRA 1G8FA 1RSZA 4FQ5A 1ETUA 2VK2A 5LXTB 5GZ1A 4Q1VA 4RTRA 1UC4B 3HVHA 1R0SA 2E85A 4CIYA 1U5CA 3GRUA 2YOGA 2COKA 3MYYA 4KXWA 4UFOA 5C1IA 3TK1A 4B73A 4ZGBA 2R0QC 4OM7A 1WJGA 5H81A 3KTAA 1ONOA 1Z16A 4IP0A 1I6WA 1HDGO 4NS4A 4B17A 4OAPA 4C29A 1UWVA 1ZJ5A 2O1SA 1Y9EA 2B1IA 5T57A 3TLGB 5DLYA 4QVIA 2BP7B 3PR3A 5TX7A 2R3SA 1XCMA 3HKBA 3K9LA 2WAXA 5EWJA 5AFSA 1GCGA 1PIWA 2FHSA 4KC0A 3I12A 1HE1C 2OLKA 3CR8A 5KJ1A 3K0EA 1F17A 3K09C 4INPA 1OMOA 2RK4A 2GARA 2R60A 4UUBA 1R6VA 2OBMA 5UKDA 1RM0A 5F2OA 2XUZA 1KOJA 5FWYB 2WU8A 3FPJA 3HHEA 4CLOA 4C05A 3DTYA 3BDAA 3B85A 2I7CA 3RNOA 2NW6A 3E82A 5A0TA 4JEUA 4ARVA 4JC0A 2RI0A 4K9MA 1E3QA 1UQTA 4HNSA 4ZREA 1II0A 4J9VA 4Z49A 2IWRA 3KQLA 1MB9A 3L0CA 4L1KA 1IY0A 3IHTA 5ESDA 3ZXYA 2C7VA 4I3GA 4KDRA 1J33A 2HNBA 3D6UA 1MVNA 4KKXB 3IOBA 3R9IA 3T4UA 3VPGA 3ZLUA 1JFRA 1QK3A 1P3Y1 1MAWA 1KIAA 3I04A 1WMDA 4PZ9A 3AI3A 3WI7A 4MLCA 3U16A 3K4QA 1UBRS 5BNIA 1ZGJA 3LPMA 4EF4A 3SQNA 2QRNA 4LMPA 2WAOA 3ZLBA 2I3BA 1R9MA 3ROMA 2VBIA 3KOWA 4LPSA 4TMTA 4WKCA 4BU0A 1P61B 2QL5A 2ZBFA 4CFSA 1ORRA 1YUNA 4TTTS 3L8MA 4ID9A 4M6WB 1S2LA 3I6QA 3KWLA 3PU6A 3FWYA 3HVUA 4J94A 2D8AA 5FL7A 2IIPA 5GGYA 4YDQA 3JQDA 2JHGA 4WN9B 2CFIA 3ZBPA 2VJOA 3UWDA 4U7TB 4CKEB 4XGIA 3M4XA 4Y2YA 2L19A 4EUNA 3KOUA 5HRAA 5AI4A 5A03A 4E7PA 2K7ZA 5BWCA 3K31A 1NN3A 1D2EA 1E4OA 1C8VB 1K06A 5TGZA 5BQOA 3DAPA 5JSZA 3ZHRA 4CEHB 1FFCA 2UXDB 1XV5A 3QLJA 3OE4A 3MC1A 3LDHA 2PD4A 1EX6A 3HBFA 3NIWA 3K9BA 4KYTA 3K9NA 5K3OA 1BWQA 5A02A 2W6JA 2WF9A 1VJ1A 2RG1A 3A37A 1L5KA 1G63A 3K2EA 5G41A 4OHOA 2PSJA 3FMPB 3ROTA 3MUNA 5EC8A 3PJRA 3E81A 2I67A 1D6SA 2RAFA 3LCVB 4FNGA 4GQIA 4IIUA 4ZVVA 3NBZC 1QX3A 1SA0A 4ALMA 5TC4A 2QRQA 4BMOB 2H6EA 1NBOA 3ASVA 1SPBS 3AW9A 3T9EA 1KFCB 4JYCA 4OJMX 4BMDA 4CF5A 2C2ZA 2HXYA 3LW7A 2EARA 3CX3A 2VHZA 4P53A 2XJ9A 1T25A 1XRMA 4K7JA 1KHTA 1Q12A 5B7NA 4UEKA 1A1VA 1UJBA 4DLTA 4PIVA 1BDMA 1MEOA 1TEXA 1IHUA 3OQ6A 4O8ZA 1FTWA 1M2OA 2AOXA 1ZBDA 2JFHA 4ZCLA 3IFSA 3LIPA 4HQLA 4EELA 1XGKA 4P4SA 5LBUA 1DEHA 4BUJA 3DOOA 1TQ8A 2ZUFA 1VPDA 3L6DA 3M34A 4Q7JB 3OHPA 4BFLA 1TT7A 3I34X 2J0QA 4W99A 2PUTA 4CMAA 2HEIA 2WB4A 4X3OA 4BP1A 3PXBA 2VJCA 4BKOA 4WQMA 2WR8A 2R86A 2RHWA 4IDQA 3HMKA 1RYNA 1IMOA 4YP9A 2DWUA 6Q21A 3QSYA 2Z6QA 1H2XA 2NYVA 2BFFA 3ABSB 3D6TB 1ZGCA 3EDYA 4OFWA 4DNFA 1DRKA 2VXCA 1UBOS 3PC2A 2H9AA 2NQTA 3GG9A 1Z4KA 4RIGA 2AMJA 5ABPA 2SCUB 3VKWA 2A84A 3HM2A 1F3LA 1G17A 4M0LA 4RV9A 4BRZA 1V1JA 1NJGA 1E94E 4YDRA 1F0YA 1BE1A 2H63A 4F9FA 5AJYA 2ZDQA 1L7DA 4Q03A 3DLPX 5E3IA 1AKMA 2G09A 3F90A 2W70A 2QUJA 2F1IA 4MQ6A 4BNNA 3A3KA 2GFQA 2P2CA 2W6ID 4GM1A 1G6KA 4Z7NB 2V6JA 4Z54A 4IMJB 4JLKA 5ES3A 3NEJA 2ZWIA 1HRKA 1JQJC 2QRHA 1H0SA 3BE6A 3I9KA 1FS6A 4LZJA 2IJGX 1GFIA 4KJXA 4P31A 1DIBA 4L07A 2WA2A 2Q5HA 1MORA 2ZT5A 1CD5A 3ZTYA 5KSWB 1G21B 2VQFB 2XNKA 1P4JA 1SB9A 2DYKA 3IUQA 3Q15C 5FKJA 2V7TA 3RS8A 2IIBA 3GP3A 1TTPB 2ZS9A 3F4BA 3ZQ6A 3CVOA 4D9MA 4R8KA 2J5XA 1QC5B 4HR7A 2JGLA 3EQ8A 2TMGA 2FNAA 3HV0A 4OTZA 2OV4A 4V2UA 1CUHA 1CQXA 1JQDA 1T9ZA 3UCXA 3B8HA 3ZXIA 4ZIRA 1ISFA 2IEGA 1LVUA 2B5VA 1QORA 2E1PA 4PZPA 5DM70 2C5HA 2I3AA 3VXKA 1U1FA 1X13A 1X7XA 5LCXA 5DPMA 1L5NA 3SF8A 3H6HA 3G1UA 3I8OA 3V4FA 2HW8A 3QBVA 2QV0A 4LYFA 4MRAA 4CKYA 2R1TB 1LRKA 1WXIA 4C2AA 4R83A 3GBPA 4JLWA 4UJ3A 3H05A 3K32A 3F74A 1YQUA 5AKIA 2J7KA 1ML4A 5CVJA 3X1DA 4TYPA 2I4NA 4D4JA 1OXVA 2CFTA 4FYMA 2PKRA 3FLEA 1Y6GA 4HJXA 2WMNB 3AEYA 4P86A 2KM1A 4UNQA 2Q7OE 1EFVB 4FWIB 3KEGA 4EO4A 5K6RA 4DIKA 2GRAA 4W9RA 2E4WA 4I1OA 2IEDA 1AC5A 3DOCA 3KBBA 3KOMA 3L8ZA 3FAZA 3QW4B 4ZEWA 2ILTA 1RIIA 2PXAA 2VT6A 2OUKA 2ATIA 2QTZA 4GQBA 2PZFA 4E5SA 3GAAA 4IO0A 3MEQA 1OX6A 1TJYA 2FG7C 4N54A 1N2XA 1F7UA 1D1QA 3MPOA 1M33A 1KMQA 4HEQA 4R2WA 1SQ0A 2REQA 3RIEA 1JAXA 1N0VC 4FFOA 4BV2A 1TXGA 3WHLA 2D5IA 4NOMA 5F52A 5FCDA 4CYMA 4DABA 1R8YA 5A9RA 3TSCA 1ZH8A 4KO3S 5FO0A 1W4CA 1V43A 3SCZA 2AG5A 5HE9A 4EG8A 2ODTX 3KE9A 5TNXA 3LQ1A 4Q9LA 1XNRB 2X1HA 1ZGHA 5FYQA 3I5XA 3H7IA 3D8SA 4H7EA 3L1KA 3BF7A 4K87A 2VQEB 4LJLA 3TPFA 1AMNA 3Q4GA 1WLSA 2X5XA 1KMHA 1N75A 1T5DX 4JEIA 1P18A 2DLCX 4ZFNA 2AA3A 5C5EA 5TS3A 3H18A 1T1EA 1YS9A 2RBGA 3DGEC 2HFJA 3P9ZA 5GM1A 1LLFA 1OZAA 3PD0A 5HGXA 3U26A 1TCUA 3QOYA 4LVCA 4LJKA 4UW9A 1ZUD1 1FYXA 3EPPA 3UJHA 3OZGA 4YJ2B 4G37A 1NBWB 2XGGA 3K2BA 2DCMA 5ECGC 4M1WA 1BC5A 3GVCA 5CDHA 3O2QB 2ZRMA 4RPGA 1O6FA 4P2GA 2NSHA 3AXTA 1OH5A 1FB5A 5CXUA 2PXCA 4HDQB 2AZ4A 4K46A 1CHNA 2B99A 3UGTA 1DX4A 1TVKA 2WWTA 1AKUA 1SGWA 4N39A 3V1UA 1EJ0A 3WQSB 2IBMA 1FE8A 5IUNC 1V9CA 1YBVA 3H19A 3HUUA 3UOAB 4PW0A 1HR0B 1YI8A 5JNTA 4F85A 4P08A 4NCNA 5F33A 3LKBA 4C6RA 1IONA 4TN5A 5AUPB 5DBEX 1OILA 2LCIA 1P31A 1G21A 2RGYA 1RYEA 4PS0A 1OV6A 3UW3A 4BNUA 5B58C 4BGEA 3O3NB 4LRSB 5E7QA 5JAPA 3UWMA 3CWQA 1VRWA 3WBJA 1FZTA 5FUMA 2D5BA 2IS1A 4IGKA 1KYZA 1F4LA 2A67A 2O2GA 3HVKA 3OZAA 2WNIA 5JSKA 5C1OA 4Q4CA 1XK6A 1RC0A 3I2HA 3V46A 1GPH1 4ACBA 1TA0A 1CS4C 1RWPA 5FUWA 2XQFA 3OZFA 4CMHA 4IZIA 1QCCA 4MI9A 2JBAB 2YASA 3IBTA 4I4IA 4B43A 3BFXA 4MQ4A 4KZPA 5WRFA 2Q3BA 2FW1A 2H1LA 3A2LA 4HG2A 4FFNA 4FFLA 4M6WA 3KQWA 3PEEA 2VA8A 2AR0A 4HQ0A 1O95C 1UUFA 4UXIA 2YVUA 2Y0PA 4LQCA 4DSTA 1H2ZA 1JR3D 1TZBA 2RGGA 4EFLA 4EO9A 2FN4A 3FKQA 4BBAA 1AQNA 3M6MD 4R98A 3IA7A 4FBGA 1I3KA 5E9JA 4AKSA 4EG6A 5KYUB 3HXMA 3KOOA 1ADBA 5LD2B 1KZYC 1MAUA 3B6EA 2QYOA 4OHKA 4C0KA 4EMBA 2XRFA 3A9WA 5BOSA 5AW6A 1IEQA 4M22A 2VDMB 3VU0A 5EP4A 4Y9UA 4FB5A 4BZZA 3BM5A 5AK0A 4QASA 5J23A 1LI5A 1RKQA 3MWKA 2HPAA 5IG2A 2QTAA 1XE3A 2QTFA 4UASA 1PO7A 2DHDA 5FUBA 5AJXA 1G4AE 2NOAA 2V3WA 4H7PA 5C7YA 1C1XA 3WHPA 3LBFA 3N07A 2P91A 4ER5A 1R0XA 1W0JA 2PT7A 3T52A 2EQBA 2RJOA 3ZCPA 5HUQA 2PL5A 5KOJA 2OCPA 4EOGA 1Z2NX 3HB9A 2HWWA 5KDDA 1T1IA 3B6IA 4G0ZA 2XUOA 3LT2A 1SC1A 1OAOA 3HA2A 4YO8A 1XZHA 3FNBA 2ZYAA 3VR3A 5JH7A 2X9VA 3M1LA 5BWMA 5FWNA 1JIIA 1NGSA 1ULAA 1XTTA 2C8JA 2VPZA 2ZIEA 4Q3DA 4D6XA 4B83A 3B12A 1PL0A 2H4ZA 1QAMA 1PYGA 1WOYA 4GGPA 1KK2A 1N6KA 1FFDA 1QO9A 4PLYA 5I7UA 5KNBH 3AERB 4NYJQ 3SBOA 3FUVA 3MWLA 3SJBA 1UMDA 3UKOA 3W77A 2IIQA 1VMIA 5B1IA 5JCOA 4HUJA 1RZRA 1C41A 1DUIA 3Q0TA 3L7AA 4NENB 1EQUA 1L1RA 1AK9A 2Z2YA 2M98A 2K5UA 2MYNA 1MCZA 2WJ6A 3FPKA 1B73A 3R3JA 2FSVC 2ZB2A 4F72A 4MUFA 2PY6A 2YHSA 4IGEA 1ULZA 2G88A 2PKEA 3G8BA 3KPUA 4WEQA 1V1RB 4WY5A 1DL5A 1WULS 1Z36A 4I1YA 1M1YE 2GBIA 4Q3CA 3RUCA 1GU0A 2B8JA 1IM2A 5CNKA 5FX2A 2OC4A 3JX9A 3RVJA 4BAZA 1OA0A 1VBMA 2GEUA 1BE6A 1OX4B 5F7ZA 1DEAA 1NOJA 3L06A 3ABIA 3R7FA 1NUTA 1U3GA 2B7BA 1M74A 2RGWA 1LVHA 2MMCA 4U63A 2Y66A 4ZT7A 2XUFA 4EUKA 1PJLA 3Q8XB 1CQJB 1EH5A 1N5JA 3H86A 1DCKA 5ITZB 1DQYA 3LCMA 4TMZA 4UE2A 4S2EA 1GFSA 4Q4JA 5HJ5A 1QP8A 1ZINA 4DV2B 1Z39A 3NGXA 4Z1MD 3VR2D 2CLDX 1I2CA 2BRUA 4B8ZA 3A2KA 3U5TA 1GD1O 5JJ5A 1YJXA 2WJWA 5DTQA 3TR0A 4EI8A 1JWBB 3O0DA 2ZUVA 3NIBA 4WKBA 2ZYVX 1MIOB 2H2GA 3IC5A 4UM5A 3MLAA 2I4RA 4P6VF 4RL6A 4UZSA 3VJMA 4XLLA 5EJ2A 3EMBA 2V7GA 2XUKA 1JNYA 1POXA 4K2AA 2WSMA 3N75A 4IWYA 3VBEA 4KLRA 1KEKA 1XZCA 2PZKA 1CP2A 4J4TA 1XZNA 2N46A 3HO8A 2YRXA 3D6AA 1MV5A 4HN4B 1N0WA 1DX9A 2WICA 2PZBA 4EQ6A 2C7RA 2FSPA 3GZJA 2WSIA 1PR1A 5F1YA 5I3ZA 4RTSA 1U1EA 4OHFA 1WXHA 2JEYA 2IU3A 3AEUB 4YMHA 2C4MA 2A58A 3AZOA 3NASA 3ZY6A 2VYFA 1XQWA 3IVXA 4R1NA 2GPBA 4E2FA 3GHYA 1A3CA 1YRYE 4BVEA 3WDMA 4UHBA 2FDXA 1WKVA 2ISQA 4GKKB 2PD6A 4PCLA 4NF2A 4ZAZA 1DCFA 3ZTTA 1Z0JA 2MDTA 3EUFA 2HA7A 5FPPA 2B7CA 5J4HA 2DFTA 1OAAA 5DI9A 5BUSA 2FW6A 4QUBA 3D59A 3DS8A 5T4HA 2GBLC 3OLCX 4F91B 4Z9AA 7ADHA 4XA8A 3LLCA 3QUTA 4DM3A 3AFGA 1TLLA 2C5EA 2JGDB 4ZAGA 2CFRA 2RBEA 5H3HA 5EIXA 1IMJA 2ASEA 3T4XA 1NBMD 3Q2IA 1R6TA 3DKPA 4GSLA 3UAGA 3PQ8A 2HYIC 2VJLA 2YBEA 4LVNA 5JY6A 2H16A 3VYVA 5BSVA 3OM8A 4Z0PA 3L1IA 4O4JF 4Z9XA 2BELA 2GEVA 1SUFA 2GH1A 3SQLA 4C6TA 3ELDA 3NT2A 3QQPA 1YR9A 2CVPA 4LQLA 4M1TA 5I7WA 5AUOB 1QHIA 2JEOA 3F1LA 3BKWA 1RAHA 2OXTA 4FMBB 4HJRA 5B5SA 1E79D 3AINA 4Q05A 5J5CA 2IA5A 2GCOB 3A31A 2HHAA 1Y3AA 2VAPA 2WFLA 2QE6A 1XL1A 1HM5A 1SVNA 1ESDA 3MA0A 3OE1A 1AZSC 4NDAA 3NZEA 1MB4A 1IU9A 3GC6A 1RVDA 2Q5LA 2VN8A 3GVPA 4DJEC 5MN4A 4DJJA 4YMVA 3P9IA 3RHZA 1G8JA 5E6UB 3QTLA 3THSA 4EP1A 4FHZA 1Y8CA 3CGGA 4XUEA 3RU9A 3VA7A 4BWYA 2G5PA 4HMQA 4AMUA 2CLKB 4LYYA 4D80A 1OYOA 1NM5A 2W71A 1SG0A 2JRCA 3UJPA 4RPCA 1XWIA 4Q34A 1Z0DA 4JBYA 1T8WA 4Q5IA 1FQJA 2WSSD 4LDQA 4JI5B 3N7TA 2ODNA 3O38A 4L5YA 3ZCVA 4NYMQ 1SOMA 2FG6C 3L7NA 5KOJB 1QS0A 1JT2A 5CFQA 5FNVF 7GPBA 3H0CA 1S02A 3A6JA 1G9TA 5LC1A 2R9VA 1VIAA 2X42A 3B89A 3LLVA 1QPZA 1X86B 4M0FA 1B1CA 3MWEA 3STTA 2AF4C 1FYEA 4WKOA 5ALDA 1GSIA 3PEFA 4KGDA 1ZA1A 2COEA 4Y2UA 1OR8A 4DCMA 2JGNA 2AJCA 1L7RA 2IYOA 2H65A 4PZCA 1XKXA 2OWEA 2P5TB 2VLIA 2WM9B 2J85A 4NNOA 3ZU5A 4ZYXA 5HIMA 1WUJS 1MTZA 1XALA 1VKHA 4ER7A 4L8FA 1MJGA 5LOVA 1HNNA 3GDHA 4M7PA 4R1SA 1OBOA 2BKAA 3DV0B 3Q41A 4TL7A 4UMEA 2DFVA 3L8EA 4ZCRA 5GJVC 2PMWB 1G5IA 3NHSA 4YGYA 3AB3A 3QENA 5J2TB 3OBBA 2ZCVA 2KS6A 3O2SB 2WJGA 4LNUB 3DKRA 5AVKA 1KRXA 3F73A 1V7PC 3JQ7B 3KUUA 3QKSB 3QEMB 2Q6TA 4REMA 4U2BA 3SM9A 3VUEA 4BAUA 4E5YA 4ECEA 4YRBA 7YASA 4HZUB 2FPGA 3P4UA 1W30A 4BP9A 3G5UA 4LOLA 3W3ZB 2KB0A 4A1OA 2FPGB 3UF0A 3JPWA 4P4LA 3WRYA 4BVLA 2W2LD 2O59A 5H83A 2OHOA 5DHPA 3JSAA 2CJFA 3KD3A 2BUBA 1OFHA 1K5GA 3FGNA 3GJ5A 1QH1B 1WHSA 3FWNA 3F3SA 1OV4A 4KPUB 4UBMA 2BFBA 3NHRA 3FFBA 1KXJA 3H16A 1Z37A 2UU9B 5IKEA 3AFMA 2ZJ5A 4YASA 5FPKA 4JYZA 3LUAA 2GLXA 1Z7BA 3AHIA 3ZJYA 4NMXB 2V5VA 2R7KA 2KPOA 3MMNA 5ALSA 2Z8YA 3DHNA 1PL6A 2C5SA 2FPMA 2ZQYA 3MOIA 4FX5A 4XM2A 1RKVA 2INGX 4E3ZA 1EFRA 5CVTA 4DIUA 5HNKA 1AKWA 4RV5A 1RJGA 3FUUA 2M6RA 2ZSEA 4Y1GA 1I3CA 3O3CA 4K6OA 4HQ6A 4LZPA 5HJ2A 1WPXA 3MRSA 4WK6A 1E3WA 4FKZA 4X6UA 4BASA 2I71A 5LB2A 5IHXA 3KQYA 2QOEA 3KPVA 2CJPA 4OA8A 5ENVA 2HNAA 3FKSA 1FYDA 1QLJA 1UANA 1UZLA 2B0JA 2MSCB 3ME5A 4UARA 4L2IA 1UAAA 1FSGA 2B6HA 1XUOA 1CLEA 3LBIA 2XXAA 4O4IA 1MG5A 1OIXA 5AK5A 1SKAA 1TZMA 4HDKB 1V9LA 3ZLJA 1GAEO 4QECA 1K7YA 4ZICA 2C7OA 3AHGA 2BKUA 4P35A 3W8FA 3PHGA 1ZCFA 4FXOA 3U7JA 2FJ0A 3G9UA 2VDUE 2HHJA 1UDBA 2RJ3A 1QV6A 3DBOB 4QM7A 4LF4B 4PZEA 3EZXA 5IDXA 2ZUBA 4KVZA 3GLFE 4X66B 2YHUA 2WHPA 4CU2A 2BGTA 1E7RA 1RXSA 2UAGA 3DE0X 3ZJUA 2ZS8A 3F6RA 1BXGA 4FCWA 3USES 2DLDA 1UDCA 3IP9A 1P2GA 3GIWA 1DT3A 3QIVA 4EJ6A 2DGDA 3S99A 3MS7A 4EDHA 1CIPA 2C2GA 4A2WA 5JNSA 4M1MA 4KREA 5DW3A 2O3TA 3JAWB 4GD3Q 2IXGA 5DOZA 4FFRA 1RI1A 3MMSA 3M49A 4DMKA 4CBVA 5HIIA 3UMJA 3MK31 2JB9A 2JAPA 3QVTA 5K05A 3L6BA 5ED4A 4B3CA 3DV9A 3MN1A 3JYHA 4RZIA 2JATA 3C7DB 4NV1A 4QWMA 2FEMA 1JBKA 2YWCA 4L08A 4XFDA 3JZFA 2CKMA 5IF9A 4KQXA 1BGVA 1OAKA 3EFBA 4EJ0A 4F8YA 2Y2VA 5EVCA 3A3YA 4KUGA 4JP1A 3AJRA 3UC9A 5GP1A 3TPZA 4F5YA 4XWGA 5IDQA 1GNSA 1CRZA 1P33A 3PUJA 2HR1A 1MEJA 3KG2A 5TMBA 3K53A 1J9ZA 2V03A 2D2EA 1M6NA 2AOTB 2PGDA 3FNHA 1PK9A 3WGQA 3W05A 5JLJA 1K5PA 5EQJB 1PLLA 4KR3A 4Z6KA