1ISGA

Crystal structure analysis of bst-1/cd157 with atpgammas
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1isgA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1isgA02
2CVOA 1J6UA 1ENOA 1IL0A 3T4EA 1CIVA 3TZCA 3WYEA 4BKUA 1RM5A 1RKXA 1DRWA 4GKBA 4HWKA 3FSRA 3LC1O 2YQ4A 3RKRA 3ZWNA 1G0NA 4AJJA 3GRPA 4BVAA 4CMEA 4DLAA 1EUDA 4BUCA 2B5VA 1NFFA 3ANMA 4L8VA 4Y9DA 3PYMA 1A9YA 1C14A 2C54A 3K2EA 4YT4A 4NFHA 2P9GA 3KHUA 3OJLA 5EIOA 1EE9A 3CMCO 4J1SA 1GU7A 1GUZA 2B4QA 3GUYA 4QUKA 4R1SA 2PZLA 3LC2O 4I9NA 1E3WA 2VTEA 1RJWA 3RVDA 2DBRA 2ET6A 2I3GA 3OSUA 1AGNA 4U8GA 4A27A 2FWMX 2CVZA 2RH8A 4JP3A 4CMJA 4N54A 1SO8A 1YVEI 4KOAA 5LCXA 4DUPA 4KTTE 1VL8A 3VPSA 1FDUA 1FMCA 3EYWA 1GYPA 2V6BA 4MP3A 4GSKA 2O4UX 1DFIA 2IE0A 5G0TA 4A2CA 3EZLA 1U7HA 1XQ6A 3BMCB 2BFAA 4IBOA 1PL8A 4B8WA 4NMHA 3PFFA 3W1VA 1NR7A 2C2XA 4PG4A 4LRTB 2Q45A 4PVDA 4Z9FA 4DQUA 3SX2A 1LDEA 1DRUA 4P4LA 3ZHXA 1B7GO 1LTHR 2DUUA 1KERA 4XYGA 4DC1A 3I52A 3MOGA 4M49A 1NHWA 1DDOA 1EUCA 1NVGA 2J5QA 1XU9A 4ILKA 4YACA 5F5LA 1N7GA 5L9AA 4Q3DA 2VOEA 1X7GA 1LLUA 1KVRA 5ADHA 5B1YA 4FIZA 1I32A 3ETGA 4RVDA 3FNFA 5JAZA 1V3TA 3FCOA 3WNQA 4GGPA 3ADOA 1YDEA 4JNKA 4R41A 2O7SA 1EZ4A 3VPGA 2JAPA 4CM9A 4IGEA 1X7DA 1ZSNA 1ZK2A 2DFDA 2Y99A 1R6DA 3AI3A 3JQ6A 4E2XA 3JYOA 1ZCJA 1NFQA 4PLGA 1I24A 2Y05A 1BXGB 2V6GA 4NBTA 1DOHA 5JYEA 1K3TA 2AQHA 5KVVA 1PZGA 3DWFA 4FD3A 2Y68A 3GNQA 1BDMA 4E32A 1LDMA 2NTJA 2Q50A 4TROA 5C7OO 2D5CA 4K1LA 4PG7A 1VL0A 4KDEA 1GQQA 1O6ZA 1T26A 3AU9A 3I5MA 3L6EA 4ND5A 2VWGA 5A05A 5A06A 5T57A 1GZ6A 2P4HX 2UUOA 4R68A 4E31A 1I2ZA 4K9DA 4JN6B 4KUGA 4YXFA 1WLYA 3AFNA 4WK6A 2PD6A 2X0NA 3ZV3A 1NBOA 2JAHA 2A92A 8ADHA 4B79A 3V2HA 3E9MA 4FB5A 3ST7A 3DMYA 2LDXA 5G0WA 4U6SA 3P19A 4PZDA 4NZ9A 3NKLA 3W6UA 2GASA 3ZHZA 1SC6A 4IDDA 3STHA 4PLZA 4DTIA 3VTZA 5A02A 1UUFA 2AE1A 5EL0A 4NQZA 3GA0A 1YWGO 1YJQA 4FQ8A 4J16A 4RF3A 5JO0A 2C29D 3QLJA 5KVSA 4RF5A 4GI2A 5C5IA 3ZU4A 2F1KA 5I8ZA 3NJ8A 4WEOA 2EJWA 4AJEA 3GF4A 2ZTUA 1A4UA 5BR7A 3TNLA 3ZWVA 4RDHA 2R00A 2VRCD 1PX0A 2P9EA 3E5RA 3ZW8A 4CMAA 2Q4BA 1YH3A 2XPCA 2CDAA 1GDHA 2PWZA 4Q3NA 5BQFA 3PDJA 4JQCA 4NBWA 4FBGA 5JS6A 4L4SA 4ZQFA 1FF9A 1ENZA 1MB4A 5DCYA 3TZHA 3BHIA 3PRJA 4YT5A 5L51A 1AHHA 4BNNA 2DBZA 1HYGA 2QW8A 1I0ZA 1YE3A 5F5NA 2YYYA 4O63O 1I3KA 2VRBA 2DFVA 3C8MA 3ICCA 2PD3A 3MOIA 4OXYA 4BL5A 4MKXA 5KJEA 1TVEA 4MDHA 2O3JA 3RFVA 3PQEA 4ALIA 3F46A 2AG8A 2R2GA 3OQ1A 5KJ6A 4AG3A 4BGIA 3NTRA 2WJPA 5ER9A 5JSFA 2PR2A 1E3WB 1F14A 1GL3A 1RM4A 3HFSA 3F5QA 1QYVA 3TQHA 1NP3A 4XGKA 1HYEA 3ZWCA 6ADHA 3KBOA 2GYYA 2BFMA 3LK7A 3PGJA 3OICA 4AJHA 1I3MA 5A3JA 5I8WA 3WXBA 2W98A 3KETA 1GQ2A 2HK9A 3ONDA 4KMSA 5G0UA 3PIDA 2FZEA 4HFJA 5TNXA 4KDFA 1E7QA 4BKOA 1HSOA 3K5PA 2FR1A 5I9LA 1U7TA 1VJTA 1WAMA 3VPXA 3U9LA 1B14A 4UUNA 1E3IA 3PP8A 4XA8A 3FPLA 3X2EA 4YQYA 1IZ0A 3R6DA 4CLEA 2HKIA 4BNTA 1TLTA 4K28A 4O6VA 4OM8A 3WX0A 5TX7A 3EGOA 1X15A 4BNMA 3RC2A 4RPLA 4P4GA 4U0KA 3ROMA 1ZKMA 1VPDA 1E1LA 3OBBA 3OIDA 1UP7A 2SCUA 2GD1O 3I9JA 2GGSA 2VHYA 8LDHA 5JW6A 1G1AA 2H6EA 4XGNA 4ONEA 1HDOA 4XDZA 4ZGWA 3EMKA 4G65A 4Z6KA 4JP2A 3BTUA 4IQ0A 2X8LA 2QRLA 5CG2A 2VUTA 3PYXA 3UF0A 1F12A 1ISMA 3HB5X 3GZ4A 4NPCA 1SNYA 1Y8RA 2YW9A 1D3AA 2IXBA 1LQUA 4PCVA 1M76A 1H6CA 4NFSA 5COQA 1OFGA 4YDRA 2NVUB 3D3WB 3U0BA 1HLDA 1UZLA 2ZB4A 2Q99A 1ZVMA 3WLEA 1BW9B 4B4UA 3H5NA 4BS9A 1LC0A 2PA3A 3ADPA 1J5PA 1PGJA 2VHZA 3B1JA 4LCJA 3JQAD 3ONEA 1E7SA 1YQGA 3WLFA 2DTDA 2I6TA 1TT5A 4L74A 2QZZA 3TSCA 3HHPA 1A4IA 4OXNA 3UGKA 4LVCA 4BNHA 3GG9A 2VN8A 5CEJA 2D4AA 2ZB7A 2BFOA 2DAPA 3OM9A 1LDGA 3F5SA 3NT4A 4WPGA 3JQ7A 1I3NA 4R4JA 1DC3A 3DZFA 3MJSA 4GWKA 2A35A 1DSSG 3E6AA 2Y1OA 2C0CA 2OUIA 2PGLA 1JWBB 2YFHA 4MIEA 3GMSA 4E2WA 5BNFA 4QO7A 3JQCA 4BOYA 4BMNA 2W2KA 5TGDA 1TB4A 4XR4A 2VUUA 4E3ZA 4RVUA 1VJ0A 2AEJA 4MVJM 2ZYAA 4XEHA 5DCWA 2JCVA 2J3HA 4OIMA 1H9AA 3ETDA 4O5OA 1Q0HA 3GEDA 3UH1A 1Z45A 3I4FA 2YFQA 3BTVA 3FWNA 3UUWA 4K6FA 3FTNA 2AQKA 4PLHA 5IXSA 1T2AA 4JGBA 5FI5A 4BO4A 3WB9A 1SMKA 1W8DA 5EQFA 5C7IO 5AQ1A 5FI3A 3AK4A 1GYRA 3GDOA 3FF4A 2B0JA 3I23A 4HFMA 1C1DA 5LDHA 3ROQA 2GSDA 1DAOA 4BQRA 5DBIA 1GPDG 2B36A 4R9RA 3IJRA 3LT2A 3ZWMA 1BDBA 1NXQA 2DC1A 3WG9A 2O2YA 1A7AA 1VJ1A 2CZCA 1U5CA 4TRRA 3S1LA 4XX0A 1UR5A 2BHLA 1P1JA 3H8VA 4RDIA 2WSBA 4GQAA 2V6FA 4IGFA 1UDAA 3PJEA 5EINA 3OFSA 1KC1A 4F6CA 2NVWA 2JJYA 4YA6A 3UFXA 2NWQA 3AM4A 4YJHB 2EW2A 2Z1NA 4B7CA 4E13A 4M55A 3VKUA 5JDCC 1GFSA 3INTA 4KUHA 3SC6A 3R1IA 3A1NA 3CPSA 1LLCA 1E7MA 3H2SA 3BHJA 4XIYA 5ICSA 5B4UA 4L75A 1ADBA 3F9IA 3ZH2A 3CUKA 5THKA 4UVHA 1ENPA 3QY9A 4NDNE 3D3EA 5L53A 2DTEA 2P68A 3W8DA 4A7PA 3Q9UA 2GUGA 3JTMA 4PGFA 2GR9A 5IAAA 2P5UA 3E1KA 4NK5A 4A5OA 2D0IA 3QSGA 4DQVA 4NI5A 1H5QA 4WCDA 4LISA 4ALJA 1ZK1A 3Q3CA 3TRIA 3TJRA 2YQ5A 4LMRA 1LBEA 5DZSA 3AJRA 3VHRA 4CLXA 1HDZA 3ZNQA 3DBVO 5A3VA 1HF3A 4LN1A 4A10A 1BVRA 3UHAA 1EK6A 3DAFA 3O26A 1LU9A 3DC2A 1DO8A 4RLSA 2I66A 1JA9A 2TMGA 1KEUA 3BMOA 1MXFA 3L6DA 5AOVA 4CMHA 2ZQZA 3HNPA 3PYLA 4J9VA 3M2PA 5F1PA 1XKQA 4QO8A 2QX7A 2NTNA 4MKRA 4YWJA 1OC2A 3RQSA 3TZQA 4B3HA 2WM3A 3HJAA 5L4LA 3FR8A 2DPGA 4UUPA 3PFWO 2V6MA 4F46A 1I2BA 1Y8RB 5F3RA 5J23A 1H0KA 2G1UA 3FHLA 4EUFA 3L4SO 4BB6A 1NAIA 3JYNA 2CDBA 3QVXA 2X1HA 5B4VA 5IN4A 5KJCA 3O03A 4CMIA 4NR0A 5TIIA 3GR6A 4QT0A 3S2FA 4PLPA 3R3JA 4FN4A 1QR6A 3JQFC 2PLAA 5HS4A 2C2YA 2OMEA 4AJPA 3JYLA 2YHUA 3DO5A 1T24A 4DIOA 1LSUA 1P0CA 1GR0A 4BHTA 4IDGA 1XWFA 3EVNA 3H65A 2FP4A 3LLSA 2OOSA 4FCCA 1ZXLA 3OF2A 1ZEMA 2H5LA 1VSUA 1H6BA 3CTMA 5L7WA 1LUAA 3E9NA 2EW8A 2VZ8A 3TL2A 5AXCA 3WMWA 3KSUA 4CM4A 4YYZA 4YB8A 4NK4A 4YBZA 4ALNA 2R6JA 1NTOA 3KYDA 3IKVA 5HBRA 1CJCA 1LLDA 3ZWWA 2BI8A 3BMCA 1PSDA 5ENDA 5TT1A 2G17A 3RU9A 4UVIA 1ZNQO 1UZNA 4F3YA 4IY1A 4Y6RA 2YHIB 1EUZA 1EBUA 1YXMA 1GCOA 1PGOA 1I5RA 4IDCA 4NJMA 1DRVA 5L40A 4CLDA 3E9QA 4DYDA 5CAEA 4UEJA 3T4XA 2FPPA 3FNGA 3RU7A 3S2EA 1XLTA 3I83A 2HUNA 5HA5A 1R37A 3DHEA 4IDEA 1T1SA 1SB8A 4QEDA 1V9LA 4WOKA 1KOLA 1MV8A 4D45A 3PJFA 3PJGA 5I7FA 2VWHA 4NH4A 1C1DB 3GZNA 2YDYA 4IINA 4IJUA 4FSHA 1Y6JA 1T2CA 3H5RA 2EIHA 5CHEA 3VZRA 2ZTVA 3H4VA 1QMGA 1HETA 3IJPA 3DMTC 4D46A 2OP1A 1R4MB 4YR9A 1JU9A 3GVIA 2PD4A 1KC3A 1BXGA 1TEHA 3WMXA 5GY7A 1GEEA 5HWSA 4DLBA 2HCTA 5IDWA 2GDZA 4AJOA 5KNLA 5TJHA 1V0JA 1XHLA 5U1PA 1WW8A 3IL2A 4E2YA 2AA3A 4CPDA 4EEXA 1HLPA 2W2LD 2HJRA 3GN1A 3FNHA 3AWDA 4J7UA 3PLNA 4R16A 4Z9XA 3MJEA 1BXZA 4PLFA 1TT7A 2W8ZA 4PVCA 1N2SA 4R5HA 5DBFA 3VH1A 4EJ0A 3GHHA 4TVBA 1GZ3A 3C1AA 4OSPA 4Q39A 4N7RA 4E12A 4PLYA 4D0SA 2J5KA 3KLPX 5CEEA 4W99A 2ZK7A 3DBHB 4A73A 3GNTA 5IXYA 4II2A 1PR3A 1YONA 1UAGA 4FR5A 4GLLA 2JL1A 1FDWA 1YJ8A 5L4NA 3I9OA 4ZU3A 2ZTLA 4B3JA 1E7RA 5G0SA 5JDCA 5TT0A 2LDBA 5A03A 1EVZA 4YT8A 3H2ZA 1NQOA 1HE4A 4IDAA 3V1TC 1ZK0A 4QXMA 2JCYA 1U28A 2FR0A 2JHGA 4U7WA 1GCUA 4CQMB 3BMOB 4UUOA 2D59A 4BO0A 4GMFA 4FGWA 3DDNA 3PPIA 1ISGA 4AJ1A 4BO7A 3JD3A 3KUXA 4AJ2A 3JYPA 1B3BA 1T2EA 1XR3A 1GUFA 5AXBA 4ZRNA 5KJFA 4B4WA 3VC7A 3ONFA 1I36A 3K31A 2NU6A 5ES3A 4Q3BA 1NQAO 2IYPA 3C1OA 4MJLA 4IS3A 3QP9A 1C0PA 4TVOA 1HTBA 3RUFA 1NQ5A 4L4XA 3BTSA 5IZCC 3DHYA 1E3JA 2NLOA 4MVJH 5L7TA 1MX3A 2Q3EA 3V5NA 4C4OA 1HZZA 3WFJA 4CLOB 4ZQEA 4L0QA 4BMVA 1KY4A 4CMIB 1QYCA 2VNSA 3DOOA 4CQLA 3INRA 4GPD1 2VYNA 4HNHA 4CV0A 3JD2A 1OZAA 2EKQA 3EW7A 2DT5A 1HDRA 4GAEA 2X9NA 2EKLA 4Q3CA 3OIFA 3NT2A 3QVTA 3SEFA 1N5DA 4WECA 1YL7A 1PR9A 2EEZA 3W4KA 2O3UA 1O5IA 1PJ3A 2OO5A 3AY7A 3W8FA 2CF5A 3OJOA 2WTBA 2YV1A 4HUJA 3RUDA 2EHDA 1UXJA 3DR3A 2J3KA 1V6AA 2PNFA 4IIVA 2PZJA 3KVOA 3MJCA 1GZ4A 4OKNA 4WEQA 1YQXA 3AUTA 3LU1A 3WBBA 3BHMA 1KEPA 4PLWA 5CP8A 1EDZA 4CM4B 3DFZA 1WMBA 5L4SA 1HKUA 4RPJA 3HDQA 3KYDB 2RCYA 3GFGA 3JQFA 1LRJA 1ZK4A 2EP7A 4I5EA 1O8CA 4IMRA 3TN7A 3WWZA 1BSVA 3RBVA 1U1IA 4JIGA 1R12A 2UDPA 4OKIA 2WE8A 4J43A 1UXHA 2GNAA 4NJMB 3C7AA 4I9UA 4P22A 4BNFA 4XYLA 4AVYA 1C1XB 1YB4A 5KCZA 4M1QA 2Y1FA 3OMLA 3JD0A 3G79A 1H6DA 2Y66A 5JCJA 2IZZA 1YB1A 3ZGYA 1PU2A 4CM9D 4ND2A 1PJTA 3MJTA 4PLTA 4B8ZA 2JD2A 2HU2A 3DXFA 1MUUA 4GH5A 2OBYA 1JW9B 1BMDA 4ZN6A 4NBVA 4OH1A 3WBFA 4FFPA 3KXDA 1DC4A 3GZNB 2ZJ0A 4BO2A 1T2FA 2CNBA 3ITDA 5FEUA 1HDXA 1ZK3A 4DQXA 1U5AA 1PZEA 4P4NA 1LSJA 3C85A 3ZV4A 4B7UA 5JFOA 4A0SA 4ZA2A 4CR6A 2EG9A 3GVXA 4WOJA 2NVUA 5CPBA 2NU9A 3D3WA 3PHLA 1MG5A 1WP4A 2W4QA 3JV7A 3QWFA 4R5MA 5IN5A 4E5NA 1LXCA 4RVFA 4RPHA 1BW9A 4EDFA 3GC6A 1SOVA 1C0IA 2X9VA 3QW2A 2PV7A 3K96A 3OA0A 3ORFA 5U9CA 3ENKA 3RFXA 1NQTA 3G0OA 1XSEA 3DMTA 1DIAA 1NPTO 3VH3A 1G6KA 4MPDA 1K6JA 5CDTA 1UP4A 3H9UA 4BNJA 4CMCA 4L9RA 4JBGA 1R16A 3D5QA 1RYEA 2WE7A 2B35A 3WYBA 1VL6A 2BGMA 3WFIA 4BKRA 4BO8A 3LC7O 3I3OA 3O9ZA 4JCOA 4DBVO 5A9SB 4YQZA 5T67A 1GADO 4J6FA 1M67A 4J1TA 4ZQHA 4CUJA 3K92A 3OJ0A 1D4FA 5IDYA 1ADGA 1P1RA 4GMGA 1J49A 1LX6A 1DXYA 3ZU2A 4OAQA 4ZQBA 3D5TA 1DLIA 4RLHA 2WWRA 4PZCA 4A03A 3B20A 1PGQA 4XR9A 1N8KA 2AQ8A 1R0LA 4OXKA 1PJSA 5IDQA 1I10A 2OL4A 3JQGB 2IRWA 1QYDA 2G76A 4GSLA 2XXJA 1IOLA 4JK3A 3EAGA 5BSHA 4BV8A 5A5FA 1P0FA 2C7VA 2WD8A 3ZWYA 4QTZA 4DLLA 3WQQA 4NU5A 1SOWA 1F17A 4YJGB 3VH2A 4D44A 4ESOA 1YDWA 1FDVA 1K0UA 2HQ1A 5JBIA 1N92A 3C7DB 1U4SA 2FSSA 1Y8QB 2WYVA 1WNTA 1ZSYA 1ISHA 2Q2VA 4BNUA 3KYCB 1K5HA 3AOGA 2QRKA 3TL3A 2VHXA 2DM6A 5ITVA 1B16A 1PS8A 4Z0PA 1LDNA 2JFFA 1B26A 3EK2A 3BZUA 4AJLA 1X0VA 5HRUA 4JLWA 2GPTA 1NFRA 1PJBA 4WASA 4XYEA 3MJVA 1IY8A 4CMBA 3WGGA 2NTVA 1O94A 2QIOA 4CQLB 1IPEA 1DPGA 2VHVA 4BO1A 3Q11A 4CR8A 3UXYA 3I9KA 4J7CA 1ZH8A 1DAPA 3OP4A 3GVHA 3L9WA 2VRCA 3RBZA 1JKIA 1NWHA 3GRKA 3WGHA 1R15A 3KOUA 4DPKA 2OORA 3IP3A 1MFPA 3H9EO 1PEDA 4EUHA 5LC1A 4BO6A 4KWHA 3GG2A 4JJIA 4YJHA 3LF2A 3E03A 3MTGA 5DOVA 1KBZA 4NHEA 2PTGA 5IZCA 3TZ6A 1HE3A 3WGIA 4CL8A 1Y5RA 4J1NA 1ULSA 5T64A 3DZBA 2WD7B 1M75A 3K73O 1DC5A 1Q7GA 2EWMA 1IZ9A 3DFUA 4IM7A 1P74A 4B3IA 3L4BC 1PL6A 2E37A 2H63A 2NU7A 4II3A 4TRNA 5CDYA 3MTJA 5JC1A 1DC6A 2DBVO 3M6IA 2RH4A 1P3DA 2Q2WA 2H9IA 2AMFA 3TPCA 1HRDA 1HWYA 4RQUA 3WGQA 4QFDA 4J7XA 5BNIA 5JDIC 4DPMA 4WLVA 2NADA 1K6XA 3PTZA 5ITWA 3KO8A 1JN0A 2X5JO 5FF9A 1RM3A 2J3IA 4HKTA 1YQDA 4XJTA 2RHRA 3VPHA 3NJ4A 2GRAA 2Z5LA 4FPXA 3A14A 3C1TA 4PIVA 1XA0A 4CUZA 1Y1PA 2YV2A 1N7HA 4IMPA 4FFOA 4HBGA 2VYVD 4OGWA 1ADFA 2PGJA 1EQUA 2G5CA 1WPQA 2ZCVA 3A28A 2GN4A 4PN3A 1U3WA 1ZIDA 3ZI0A 4CLRB 3I6IA 3GAZA 1YO6A 1U3TA 4H3VA 4O59O 3EDMA 4OL9A 5FYDA 1BRMA 1AN9A 5H81A 4E5YA 3DZGA 1QV6A 4XYBA 3WJAA 4CV2A 4KZPA 1YGYA 4QQRA 3RJ9A 1P9LA 2HO5A 2CDCA 3HQ4O 3PJDA 2AQIA 1ML3A 1I8TA 1CEQA 3GY0A 1KEVA 2E48A 2FRDA 1Q0LA 1VKNA 3PHGA 3ZWAA 2X5KO 5F21A 1VC2A 3KM0A 4D41A 3AOEC 4XYMA 3B1FA 2X9GA 4QECA 4YVFA 1BHSA 1D7OA 1RWBA 4K6CA 3H9QA 4DYVA 5JMWA 1Y7TA 1B8UA 4J91A 5MDHA 2VQ3A 3QVSA 1GPJA 3I6QA 4D3SA 5JPIA 4A26A 3DB2A 2O2SA 4R3WA 4ZD6A 3RCBA 1M2WA 3KSDO 2ZIZA 5KKAA 5JLAA 4ALLA 1A27A 1PJLA 3BMNB 1LLQA 3FNEA 2UVDA 4EI2A 5KJ1A 3DBRA 4M8SA 2QYTA 1PJQA 5CDGA 2GLXA 1LQTA 1VSVA 3IQDB 4WJZA 3ZN2A 2Q1WA 2YHIA 1U3VA 1U4OA 4K26A 5T8KC 5KIAA 5TC4A 2A9FA 2VT3A 3O4RA 4HY3A 3WGYA 1ONNA 3P7MA 1YOVB 5KVQA 5A9TA 1CRWG 3GGOA 1JAXA 4R51A 3I9NA 4RO0A 4CM5A 1ZZEA 1CYDA 3AUUA 4C7KA 4XCVA 4ZRMA 5JYDA 5DF1A 3E8XA 2GN6A 1PS9A 2OXIA 1E6EA 3Q2KA 2J5RA 2P2SA 2GN9A 5G0VA 4CV1A 4BNLA 5GZ3A 4EYEA 2O50A 4GX1A 2I67A 2EKPA 3FWZA 4WNCA 1EDOA 3FN4A 4EJ6A 3NDRA 1L7EA 4JJFA 1R4MA 4GGOA 4WNIA 1NYTA 3ZU3A 4O0LA 3QWBA 3E48A 3BMQA 4W7IA 3K30A 3NYWA 2A94A 5JAIA 4GX2A 4TSKA 1T25A 4RZHA 3U4DA 3L77A 2HDHA 4OQYA 3PHJA 4AICA 3DOJA 3NGLA 1CETA 3G1UA 9LDBA 3WIDA 1YL5A 1F8FA 3K9QO 4MINA 3VZPA 3JQDA 1E7WA 1PZFA 1JLLA 1XU7A 2Z1MA 4XJSA 1I01A 2X0RA 2GF2A 3S8MA 4WLFA 2ZCUA 1LRKA 3QWHA 3UCEA 4BKPA 3ABIA 2CSUA 3VZQA 2O3RA 2VZ0A 4Z0TA 4BB5A 1HYHA 2ZYGA 2BI7A 1QP8A 1AHIA 1WVGA 1XIVA 2D1YA 3LT1A 3O38A 3RWBA 3DBHA 3H7AA 2ZKLA 2VUSA 3AY3A 4I9HA 1NWCA 1LDYA 4D3DA 2DUWA 2VHWA 1GD1O 4LK3A 3ROPA 4W6ZA 1NASA 3IAHA 1F06A 3ZW9A 3U5TA 3WTCA 1IYZA 1P45A 5BSFA 3NT5A 1T1RA 2Q4EA 3HN2A 4DC0A 2IDZA 1KVQA 1LRLA 4YAGA 5COBA 1UDCA 4KQWA 3JSAA 5JY6A 3V8BA 4MOWA 4CQMA 4PRLA 4Z0HO 2CY0A 2FPIA 4DXHA 3BA1A 3TZKA 4GX0A 4DL9A 1QRRA 3HUDA 2HMUA 3L4BA 4JROA 4NFYA 1BWSA 2X7HA 1QXSA 2YV3A 3PK0A 2Q46A 1NM5A 5ILOA 3GOHA 2CFCA 1LSOA 3EUWA 1Z75A 1E3SA 5JDIA 1E6WA 3NEPX 4WGGA 3FI9A 5JXWA 4RJTA 1JTVA 1QORA 1MLDA 4CR7A 2XF8A 3COSA 4AFNA 4I5FA 3AUSA 4AJNA 4CLOA 1C0LA 3JQ8B 3MWEB 4KUEA 2Y0DA 3GFBA 4WKGA 1E3EA 1ID1A 2UAGA 1CQJA 1DJQA 4DBZA 3A9WA 3PWZA 5C3MA 1GV0A 4W9NC 1VRWA 3CEAA 3NRCA 5EPOA 1BG6A 3T7EA 4AJIA 1E5LA 3RASA 1ORRA 1A7KA 3FBTA 1V8BA 3LDHA 3NV9A 4KTVE 3VVBA 1L7DA 1Z74A 1JDJA 1ZEJA 3HG7A 4MO2A 4TKLA 2G0TA 1XEAA 3GAFA 5GZ6A 4CLHA 1PWXA 1Q7BA 2IEBA 1B15A 3PZBA 4YRDA 1WDMA 2B4TO 4Y6PA 5TLSA 1RPNA 1DJNA 3ZZNA 3TWOA 4TRJA 5DOZA 5I9NA 1IPFA 1HEUA 3PWSA 1P1IA 5KOIA 1AXEA 4DGSA 3GGGA 3JYQA 2FHSA 1EFKA 1VI2A 5JMPA 4ALKA 2HJSA 4RV9A 4TWRA 3DBRB 1X1EA 2I9PA 4CM8B 4D43A 4BNWA 3AOEA 2E6UX 1XYGA 5G4LA 4IIUA 1T2DA 3JQAB 2QRJA 3GPIA 4L76A 1ULUA 1GAEO 3UICA 2I76A 1MC5A 2Q1UA 1C1XA 3H5AA 5G2OA 4DA9A 4Z3KA 1L1FA 2I65A 2BLLA 4J9UE 4FOOA 1MG0A 3CSDA 3QIVA 3HWRA 3ANNA 2FOIA 4WUVA 2J6IA 1KYQA 3CKYA 1F0YA 4OYRA 5B37A 3VDRA 1X14A 1P44A 1HE5A 1KVSA 4PZEA 1CQIA 1Y9EA 1EFLA 1LJ8A 2FPGA 2D2IA 4B7XA 1XQ1A 5T8KA 5EESA 3GK3A 5TRTA 1E3LA 1KS9A 1ZO8A 3ZCXA 3DHNA 3BMQB 2HLPA 1BGVA 2W90A 3M1LA 4MP6A 4YAEA 5JAMA 1VM6A 1DBVO 4UVDA 2NUAA 2VTDA 4BO3A 3UVEA 2Y93A 5C7LO 3TOXA 2ZQYA 4GVLA 1ADCA 3EHEA 1HZJA 3HDHA 3IOYA 2J3JA 5T6BA 1EVJA 3OJFA 5F1KA 3OEYA 4DREA 4FFRA 3ZHYA 1MP0A 3DEYX 4FW8A 1VLLA 4Q3AA 5BSEA 2PFGA 3D0OA 1M66A 5I7EA 1JKJA 2X22A 4N5LA 3DZHA 2DTXA 1FJHA 3OJEA 4HADA 2B83A 3DZIA 4MVJA 5A9SA 2Q1SA 3SBOA 1WDLA 2C7GA 4XIJA 2VZ9A 1U8XX 1T4BA 3SJ7A 2PZKA 3OQ6A 2IZ0A 3PGXA 4GL4A 3CIFA 3Q2IA 1PQWA 4RGBA 1FDTA 2CVQA 5IG2A 4YAKA 5A4DA 2O23A 3RC9A 3D64A 1G0OA 4RQTA 2X5OA 5JC8A 2RIRA 3HDJA 2YJZA 3JQGA 4ROSA 5DNAA 3PWKA 1PL7A 4N5NA 1S6YA 4ALMA 3PXXA 3KV3O 1QYWA 1I30A 1XGKA 4DIBA 2FSVA 3AI2A 1WDKA 3LT4A 1VE9A 1KEWA 2BH9A 2O48X 5CDUA 2O3QA 4YJGA 4J2OA 3GT0A 1X1TA 5EERA 3SLKA 1JVSA 2CF6A 3A4VA 4PG5A 3DZJA 3H6KA 4BO9A 1Y8QA 4PFJA 3D7LA 1QV7A 4YT2A 1Q2XA 5U4QA 5BSGA 1BVUA 1K89A 1IULA 3IUPA 3KYBA 3KYCA 2VYND 3MZ0A 2XXBA 3H9JA 3Q6IA 1F8GA 1NHGA 1U3UA 2B69A 3UN1A 1TA4A 5DCUA 4CUKA 1GTMA 4PG8A 1P31A 2J8ZA 5AYVA 2NM0A 3OH8A 1A5ZA 4MVJE 4J4TA 1PQUA 1Q1NA 1N1EA 1XCBA 3F3SA 4FDAA 4FGSA 4NBRA 3F1LA 3IKTA 2GN8A 4PRKA 3WTBA 1DFGA 2VWPA 3QE3A 4H15A 1YBAA 4M87A 4D0RA 1MFZA 3ZHBA 3L6OO 5G4KA 4Z9YA 4DIFA 1PZHA 3BTOA 4U6QA 2WEKA 3OQBA 4IUYA 4LCEA 3JD4A 1R66A 4IZHA 3L0DA 1EE2A 1OC4A 2NQTA 1GEGA 1UZMA 3LSYA 4D42A 2PKQP 3IMFA 4OO3A 1MGOA 1UP6A 4PG6A 5TSDA 3S2GA 3DTYA 1DIRA 3DBLB 3M1AA 3A06A 1A9ZA 2WD7A 2OBNA 4W9NA 4IJWA 4I08A 3ENNA 5JCJD 5CEFA 3WIEA 5GMOA 4XRRA 1Z73A 4P8RA 4IS2A 3VZSA 3ROKA 3QVOA 1I33A 2DQ4A 2Z95A 3V1UA 1KVTA 3VTFA 3RUHA 1H6AA 5K0ZA 4MVJF 4OHUA 4WCFB 4F45A 2Y1DA 2HAEA 1U9JA 1QLHA 1JKFA 4MVJP 1ZUD1 3C7CB 4R9SA 2ZTMA 1ONPA 1H94A 1AE1A 4CMKA 1P1KA 4NBUA 2GZ1A 3R0IA 1W0CA 3S55A 2OZPA 2WYWA 3MWDB 2C20A 7MDHA 4GLOA 1XDWA 3ITKA 3WGTA 4YJFB 4W82A 4UVEA 4CMGA 1LNQA 2JD0A 3E82A 1OMOA 2EJVA 2P4QA 3W6ZA 1PQPA 2WMDA 3WICA 5KKCA 4XB1A 1LA2A 3HN7A 2DLDA 1ISJA 4C7JA 1X13A 3ETEA 1R0SA 4J4BA 4G5HA 4B4VA 4M89A 1KVUA 3GGPA 6LDHA 4UEOA 3SJUA 3RKUA 1QSGA 1D8AA 3ANLA 4XQCA 3RIHA 1V3UA 3PZRA 2VCYA 4G81A 3JQBC 2GZ2A 5L45A 4CLRA 3TFOA 3NGXA 1HE2A 4R69A 2NACA 3WGZA 4QX6A 1PWZA 4AJKA 1IB6A 1EMDA 3MEQA 5JO9A 4TQGA 2YUTA 1YKFA 3NX4A 3FTPA 1CWUA 4J4HA 4DPLA 5AVOA 1RYDA 4ND3A 2NNLD 3RFTA 1PJ2A 5HTOA 2F00A 2JCXA 5HM8A 3DQPA 4LRSB 3KEQA 3TDKA 3D4PA 2YDXA 4RF4A 2VNAA 3O8QA 2X4GA 2D3TA 3AW9A 1N9GB 4INAA 3VPFA 1WZIA 1E1MA 5AXAA 5K9ZA 2GO1A 2HMSA 1P77A 2I5PO 3BIOA 2Y1EA 3U4CA 3W4JA 1KY5A 3LLVA 4CM7A 3C3XA 2DBQA 3GEMA 4IQ8A 5H82A 2C5AA 1W73A 1O95A 1GV1A 2E4AA 3LYLA 1A72A 2P9CA 1B8VA 4J3FA 3PIIA 4ID9A 1EVYA 1E5QA 3AFMA 4MVJG 4TZKA 5TJ9A 1W6UA 1WZEA 1EBFA 4KWIA 3KTDA 3WSVA 4ZJUA 1HDGO 3D4OA 2AEFA 3DZKA 1DB3A 3BMNA 4BNGA 2O3TA 3GNSA 9LDTA 4H16A 1B8PA 1WMAA 3VH4A 4F6LA 2V7PA 3GVCA 1EQ2A 4R1TA 1JQBA 3QWIA 2C59A 2O7QA 3B70A 4U5QA 4RZIA 1AXGA 2POQX 3EZYA 2NV6A 1PS0A 3DONA 4MVJI 4E5MA 1YOVA 1E92A 4IPTA 2E82A 1ISIA 2EXXA 2X23A 3T7CA 4EZBA 3B6ZA 1NPYA 4U0JA 4RF2A 2EGGA 1S7CA 4NU6A 3U4IA 3F47A 1D1SA 1UAYA 2AHRA 1D1TA 1HDYA 4UULA 4XDYA 2HRBA 4LW8A 1BTOA 3HFGA 4J2HA 4FFMA 4YAIA 1KIFA 2QYSA 3I9LA 2JKVA 3RAJA 3U62A 1E1KA 1YBMA 4R54A 3OA2A 3JD1A 3WOHA 5IF3A 3SC4A 4OQZA 4HP8A 4WLUA 3VDQA 3QV1A 4O1MA 4EGFA 1R4NA 1KETA 1JVBA 4ITUA 5FFFA 5IDXA 4S3MA 3GVPA 3M2TA 4N18A 2OGUA 1B3RA 4BNXA 3H3FA 3RI3A 4FJ0A 5G4KB 4BGEA 4D79A 4I5DA 5AXDA 1QLJA 5KTKA 2O4CA 2QZ9A 4BV9A 1A71A 3TFQA 2A4KA 3PHIA 3SVTA 5HS6A 4JXKA 1CDOA 2EF1A 2YZ7A 3JQ9C 3INGA 1UJMA 4OOEA 1DHRA 3GEGA 3OHSX 4CM6A 2E49A 3CE6A 2Y0EA 4XKJA 4LVUA 4R3NA 3WJ7A 4YRBA 2EV9A 1H93A 3NDIA 2VOJA 2D8AA 2B37A 3OEWA 3KEOA 3SXPA 4CL3A 3ZNNA 5B12A 4S1VA 3X2FA 1UXGA 3IIEA 3K8ZA 3WGOA 4EITA 5CDSA 1SAYA 3FBGA 4WE3A 1DEHA 2YY7A 3K2BA 2VWQA 4XGIA 4GBJA 3FRJA 4FS3A 3PQFA 4WLNA 2HMWA 2X0IA 1QKIA 3I1JA 2PKRA 1ZBQA 1OI7A 5IZ4A 3HADA 3DOCA 3TF5A 4ND1A 2BD0A 4GWGA 4XQEA 4BNVA 3RC7A 2H1SA 1H9BA 2IXAA 4LGVA 1LSSA 1U8FO 3ZNOA 1OBFO 4DVJA 3AI1A 3GDGA 1UDBA 3V2GA 2BMAA 4UEKA 2C5EA 4BNIA 3CINA 5EMHA 4E21A 5KVCA 3UOGA 1M6WA 1XELA 2JFHA 1J0XO 5THQA 4DWVA 1FDSA 4EBFA 2PY6A 1O9BA 3AY6A 2BFPA 3RSHA 1SZJG 1JWAB 5EN4A 2ILTA 4GKVA 3N7UA 1XG5A 3EY4A 1PGPA 3PQDA 2V65A 4CODB 2VT2A 4XRGA 2X58A 3GQVA 3JQ8A 4HFNA 3KZVA 2P5YA 5EJ2A 5BNTA 4NNJA 3VOSA 4BNYA 2ZB8A 3WQSB 3GH3A 4BKQA 4J1QA 3V2UA 1C0KA 4LSWA 2XOXA 3O8QB 1H2BA 4PLVA 7ADHA 4QSMA 3G17A 4YEDA 3NTOA 4ZICA 3ULKA 3JQBA 4J0EA 2ZYDA 3LZ6A 5BT9A 2VYVA 4WCFC 2CUKA 3WNVA 3EVTA 1ZMTA 4FOSA 4DMLA 4ND4A 3Q0EA 2GCGA 1DHTA 2OFPA 4L73A 3ZV5A 1FK8A 3KRTA 5K6AC 3ZDFA 1QYXA 1OOEA 1K2WA 1WXDA 5ENVA 1J4AA 5JNLA 3V1YA 5KWEA 2NSDA 4RVHA 4CM8A 1U2GA 3PLRA 4RCVA 2DKNA 3I9MA 5L3ZA 2Y1GA 1NX6A 2B4RO 2P91A 3JQAA 2HRZA 3CZRA 1X7HA 2AXQA 1DIBA 4E4YA 4TMFA 5FWNA 4X54A 1PIWA 4DMMA 2CD9A 3OIGA 4FFNA 4BGUA 2IEDA 4BNZA 5JCXA 2JD1A 2FR8A 2XAAA 3ZWBA 3BAZA 4OSOA 1EVIA 4TZTA 4FFLA 5DN9A 3G49A 3P2OA 1NVMB 4XQ9A 1LC3A 1HL3A 1PTJA 3L07A 4I8XA 2FZWA 3P5SA 5JE8A 1NPDA 2NU8A 3KB6A 1UH5A 4R01A 1IUKA 1P1HA 2BGLA 4RL6A 4XB2A 3GUCA 3G1TA 4B4OA 1SBYA 5JAQA 1ZSVA 1R4NB 3K6JA 2IZ1A 3NAQA 1HXHA 4URFA 2B5WA 4NIMA 4XD2A 5TF4A 1ZW1A 3QQPA 3U49A 1LDBA 2AG5A 3N74A 1B0AA 1GYQA 1DIHA 5DULA 5CFZA 1V3VA 3LT0A 3PDUA 4YJDA 5DP1A 1HDCA 1SEVA 3E5MA 3C24A 1E1NA 2HMVA 1NR1A 2GERA 3PHHA 2EERA 1SB9A 1DLJA 4XWYA 5MGBA 3KLMX 4MIYA 3PI7A 3D4NA 2DPHA 4IJKA 4AL4A 2UV8A 5GZ1A 3DL2A 3LVFO 4R1UA 1O89A 2QHXA 3QJ5A 3PVZA 4CM1A 3JCZA 3WWYA 4E5PA 3NDJA 1OAAA 1M6HA 2JHFA 2G82A 3VKVA 1Q7CA 2DVMA 3UW3A 4EEZA 3F6YA 1YBVA 1I2CA 2CMDA 4IDBA 4W7HA 4W4TA 1CF2O 4E33A 3H3JA 1P33A 4LSMA 4H7PA 1I3LA 1V35A 2X0JA 5A1TA 2Q2QA 4CQMD 2C82A 4IXWA 1IE3A 3SLGA 3CXRA 4DRYA 2HMTA 3R3SA 3UCFA 1ENYA 3JQ9A 3WYCA 3DTTA 1WWKA 4JBIA 5DDIP 5H83A 4YTEA 1SEPA 1DFHA 1SCUA 3RUAA 2FY8A 5A9RA 3E18A 3WSWA 3GLQA 4JX8A 3I4CA 4PLCA 3FR7A 2WDZA 3Q1LA 4NG5A 1HT0A 3N58A 4TKMA 4E6PA 2RBEA 3WQRA 5I7SA 2I99A 1GY8A 5LDGA 3IUSA 4FJ2A 4MKZA 1IHYA 3ZNPA 4BNKA 1NVTA 1E77A 1ZXBA 1PJCA 3H9GA 3QRWA 4CMEC 3B1KA 1ONOA 4YAJA 2AE2A 5I7VA 1HSZA 2AEMA 3HZZA 1AUPA 4E0BA 1YRLA 4BGVA 5A04A 3RBXA 2QQ5A 3IP1A 1YB5A 5L7YA 2BRUA 3OECA 4M86A 5DBGA 1Q0QA 4FJ1A 4I1IA 1TXGA 4N5MA 1R0KA 1B2LA 3RJ5A 3DAGA 4BIIA 4E5KA 1EK5A 5TQVA 3WDSA 4J0FA 3CMMA 1T4DA 4Q9NA 3AUAA 4BQPA 2X86A 5A5EA 4NJOA 5B4TA 4D7AA 2TMDA 2OP0A 3GDFA 3IC5A 4KP7A 2Y0CA 4FC7A 2AW5A 4FC6A 3ZWOA 4JJGA 5I9MA 2NQ8A 4ZVVA 3F4BA 1Z7EA 4LMPA 2BKAA 2UUPA 3DBLA 3LF1A 4YPOA 4ZHSA 1TT5B 2C07A 4M54A 1P1FA 3AM3A 1Y5MA 3GHYA 5COAA 1UXKA 4MP8A 4CV3A 1ZFNA 4XQGA 1ARZA 4J90A 3F1KA 3JQ7B 4YRAA 2JFGA 2EGHA 3UAGA 2IODA 3VAZA 5IFLA 3Q9NA 4XZ3A 3DAPA 5L95A 4WCFA 1ZMOA 2PZMA 3G3EA 1Y81A 1BXKA 2FN7A 4KQXA 4GX5A 1E6UA 3PEFA 3FD8A 3QHAA 1H2HA 2DU8A 3RC1A 5JY1A 2PH3A 2OHXA 5K6AA 5TS3A 3S2IA 2BF7A 3MCVA 1IHXA 3RUEA 3W4IA 1YL6A 2W2KB 4YJFA 2HSDA 2NVBA 3RUCA 4CJXA 4RPGA 3UKOA 1N1GA 4HNGA 3F4LA 2PKQO 5CPFA 1ZJYA 2FMUA 5ICMA 5F1OA 3OETA 3P2YA 4Y8VA 4EW6A 1W4ZA 1Z82A 4HV4A 5C37A 4JBHA 4Y6SA 1TI7A 1GQYA 2EP5A 1U2DA 2PK3A 1YS4A 3ON5A 3FPCA 2QG4A 1PGNA 2ZATA 2ZB3A 2Q1TA 3RD5A 3RROA 2Y1CA 3D1LA 3EC7A 3IDSA 1NNUA 4HX5A 4IDFA 4BO5A 1LI4A 1CERA 4Q3EA 3GMDA 2D5AA 3ICPA 4WLEA 2HK7A 4TRMA 3ZU5A 2UYYA 4Y67A 2GZ3A 4G2NA 4IJVA 3VVCA 4HFRA 4GVXA 1PJ4A 5CG1A 4MVJD 4Z3DA 1K6IA 4HXYA 4CM3A 3UCXA 3ZWPA 2ZJ1A 3HDYA 3L9XA 4R1NA 3AU8A 1N9GA 4QFCA 4RVGA 4AJ4A 1NAHA 4D3FA 3NTQA 4UREA 2PH5A 4RPKA 4EJMA 3BYZA 4BMSA 3HE3A 4IQGA 3GPDG 1GUYA 1QG6A 4Y98A 3RUIA 2HK8A 1JAYA 3WR5A 2RAFA 2Q49A 1MA0A 1SPXA 4IZIA 1DIGA 1LEHA 3LQFA 1MC4A 3CZMA 5ER6A 2BGKA 3MJ4A 2X6TA 2IYOA 2I3AA 3JQEA 3IS3A 3QVWA 4WLOA 1Z6ZA 2W2LA 1O0SA 4UUMA 2PGDA 2R00C 3U09A 3BXXA 3ZWXA 1ZJZA 1RM0A 1X0XA 3U3XA 3GN2A 3WS7A 4EUEA 5DP2A 4YCAA 3W8EA 4UAGA 3ASUA 4J49A 1Z7BA 1C3VA 2O3SA 3HSKA 4E2ZA 3ZV6A 1Y9AA 5ILGA 4I5GA 3KSZO 5EQDA 5DT9A 3U4HA 2Y67A 3NUGA 4OJNA 4RORA 3HB4X 3TOZA 3QWAA 4UVGA 3AM5A 1ISFA 3CH6A 4OMUA 4IXTA 4P38A 1MXHA 1UXIA 2RHCA 5IJZA 1E0DA 1VKOA 1FXSA 4RVSA 4L4RA 4ZQGA 2WYUA 5T5QA 2BELA 4OOFA 4E30A 1EEHA 3QA9A 4MIOA 1E7YA 3ASVA
chains in the Genus database with same CATH superfamily
2BUBA 2CVOA 2XTMA 2PCLA 4DJTA 2GUWA 4BFUA 4LOKA 2XCTB 2I1WA 3UQZA 5BUQA 4JCCA 4BKUA 4H35A 4PICA 3AEQB 1CSEE 3NBQA 4G9BA 1FTSA 3EQZA 3WLSA 1LBTA 4E88A 3RTDA 1N5LA 3NTUA 3IEIA 5IBCA 4G5OA 1G21A 4JYCA 4IRMA 5CT8A 2FSIA 3LGSA 2YQ4A 4HB0A 3ML1A 3ZWNA 1C3LA 3AKCA 1GRCA 4RPCA 2EYQA 2WAAA 3GIDA 1NATA 2WYIA 4A6XA 4BUCA 5L3VA 4L8VA 4Y9DA 3PYMA 1I4WA 1C14A 4BFYA 2X41A 5LB4A 1J07A 3KHUA 3MB8A 3CW9A 3E9CA 2HRDA 4W5WA 2Z83A 4RKRA 4J1SA 4IL5A 1KZ6A 1O9HA 2GK4A 1M8JA 3GUYA 3HBFA 4K6GA 2B4AA 2PZLA 3ZX5A 4ARCA 2I4MA 2VTEA 4JYBA 4G09A 1G2PA 3IHWA 1O6FA 1EFPB 3W5HA 5CXQA 1ULAA 2ET6A 4I55F 1AGNA 1ECPA 3KAPA 4A27A 1U9YA 2O8NA 5BVHB 3M1IA 5BMVA 1CUXA 4JDUA 4CQJA 4XD7A 3IUYA 5E9JA 1T10A 4B6FA 4O08A 3N2ZB 3PUJA 4AURA 1WW2A 5LCXA 3IUBA 4HLNA 1C4XA 4MV9A 2HMYB 1VL8A 4KTTE 1FYWA 2G8LA 2AR7A 4IUDS 4ER3A 2YOGA 1H2RS 4HS4A 1A50B 2O4UX 1DX9A 1DFIA 2WUVA 4C4TA 3WLTA 4A2CA 4EY3A 3I76A 1QIGA 1U7HA 2P2YA 3KZKA 1HMPA 2QS9A 2WINI 4LXYA 3T8YA 2UXCB 2V3CC 4RIEA 1QIFA 1OFVA 5LP1A 3PEYA 4TMVA 4ZZ1A 1D4AA 1NR7A 2OGTA 1Q19A 2YS7A 2MCFA 1U5BA 3AQIA 3GBPA 1G2OA 2WZDA 1J7KA 5CW2A 4Z9FA 3SX2A 2V3WA 5LXTA 2FXVA 4LF4B 3NHBA 3VGJA 4OLAA 4ZVSA 1FTYA 4AZ0B 2HF8A 1NSTA 1BC5A 1Z0JA 2V7BA 2ATVA 1GGKA 2DUUA 2FPPB 2FQWA 2F9LA 3A4YA 4XYGA 4YV0A 3MOGA 4M49A 1PK8A 5BNWA 1R0CA 1DDOA 1JDBB 5HKOA 4ILKA 4EJFA 1AF4A 1N7GA 1VXRA 4GF5A 4AG6A 1JFFA 1X7GA 2H16A 4OHCA 2R7LA 5JJKA 5EYPA 3GARA 4II7A 2GO7A 4IIGA 1TVCA 3JRNA 4ENPA 1MORA 4I19A 3J81A 4MMZB 4J8PA 5GM2A 3G6KA 1K66A 1A9XB 2R1VB 1YDEA 4JNKA 1ZDMA 2O7SA 1WD7A 3L8CA 4DSZA 4DOMA 2G0NA 5LMCA 1WS6A 1X7DA 4W1PA 1ZK2A 1FP4B 4JUCA 1C3JA 2YNMC 3DYBA 3RV3A 1YQQA 3I5UA 4IH1A 4PLGA 2XADA 4FDTA 2A2ZA 4BTEA 4DCPA 3ENWA 5JD6A 3UGJA 2QTFA 2V6GA 4HUTA 1NP7A 1D2CA 4RZSA 5KVVA 3CUUA 1PZGA 3DWFA 1EX6A 3HJUA 3HU2A 4MWOA 3R3HA 1U11A 1U8AA 3C43A 4PR0A 4E32A 4FNGA 1FC0A 3IMCA 4K1LA 1OLSA 1J21A 1A2OA 2VDVE 4PG7A 1GQQA 3I5MA 3L6EA 2OXEA 5A06A 4MRRA 2B7CA 2QP9X 1Q1AA 5T57A 3U44B 2P4HX 2UUOA 3A9TA 4E31A 1DBWA 5JWHA 1I2ZA 2X2OA 3D1VA 4NENA 1PV2A 3TB4A 4O2BA 4IIFA 2PD6A 5IU6A 1NBOA 2JAHA 2A92A 3ESXA 3OE4A 4QGBA 4R9UC 8ADHA 3N39C 3QYFA 2QW0X 3Q8LA 1NJFA 3V2HA 1AMOA 1ODTC 2O5RA 1LQ2A 2Q8QA 2ZQ5A 4FB5A 4D9FA 2ASEA 2UZ0A 2COEA 1S7GA 1YVPA 2BEVB 3QKUA 3O2SB 4NZ9A 4X1IB 3WZLA 1PD0A 3H19A 4DMFA 5CNJA 2IPNA 2GASA 2Q0SA 5CFNA 3B78A 1I94B 2Z08A 2CLMB 3BXZA 3ZKWA 5A02A 3VTZA 3L6RA 121PA 4I1YA 3LT5A 1YTUA 3EF1A 3NTLA 4U3JB 2H11A 4I9GA 1JKXA 4FGUA 1FMLA 4IAOA 3LXRA 4YJ3B 2DCMA 5KNCA 4XW2A 1NVDA 1YWGO 4JZKA 4EX6A 1FNSA 2BWJA 1C9KA 4K8RB 4RF3A 2C29D 4M0UA 3ABQB 3K5IA 2Y3IA 3REQB 4A1OA 2VNJA 2X19A 3NJ8A 3KYJB 3O4JA 4B82A 3GF4A 2M98A 3T99A 2AOTA 4ZYLA 2AMYA 2R8OA 3UHJA 2VRCD 2P9EA 1I6MA 2ZYHA 1P7WA 3KB8A 3ZE2B 1YH3A 3E05A 4ESVA 4GYYA 4BLWA 5H59A 3RIMA 3B3GA 2PWZA 3L92A 4Q3NA 2XITA 3PDJA 4JQCA 4JQZA 4NBWA 3ICEA 4L4SA 3TAUA 1FF9A 3SZRA 2H2FA 1XMQB 5EQJB 1MB4A 2OXTA 4EPWA 4QHTA 4O4IA 2EJCA 5KQRA 4CKWB 3W5IA 1X6VA 3IVAA 2QW8A 3E22A 1YE3A 4GLJA 5FPPA 1XALA 3G68A 2G40A 2K7ZA 4O63O 1I3KA 1WB4A 3O94A 2VRBA 1RADA 5F77A 3SF0A 4DMGA 3ICCA 1JJFA 4EFMA 4EVQA 4EA7A 3W3ZB 3FIJA 2R1TB 1XZ8A 1JQDA 4RJKA 1U7ZA 4MDHA 2O3JA 2ZWPA 4RX1A 2ID9A 3PQEA 2ETVA 5AW2A 1FRNA 1HC7A 2X3FA 4JL5A 1RE0A 4KBGA 5KOYA 3I01A 4O29A 4JSYA 2AXEA 4NOLA 3DLTA 2WJPA 2PR2A 1E3WB 1RM4A 3KQTA 2BJVA 5EJ7A 2XCUA 2F7SA 3EH1A 1NP3A 2BFDA 4TV8F 5FR1A 3RRJA 3T95A 3E5HA 3ZWCA 6ADHA 4R0MA 3R5HA 1ADYA 3OICA 2FUG1 4L8YA 1OVMA 4WY5A 1HQDA 3FAZA 2ZE7A 1LZLA 5A3JA 1H1LB 5I8WA 4GNRA 4W5QA 2XRFA 3LKVA 1UWVA 1KIAA 4KMSA 3O9MA 4Y1GA 4WXYB 2ZB2A 4QXPA 2JRCA 2R7KA 4NBSA 3VTKA 2W42A 5EVJA 2EZUA 4D4IA 3CVYA 5KNDA 3EUEA 5I7WA 1ZOIA 3WHPA 2FR1A 1QIKA 1E89A 1Q0RA 1SCAA 5E6UB 3AL3A 3KBBA 5ELLA 1P3JA 1WAMA 3QW4B 4JSRA 3IQIX 2FFHA 3G0CA 3K1AA 1ZUNA 3UJDA 4XVUA 5BW8A 4TTTS 3V1MA 2XUGA 1E4EA 4YQYA 4X64B 2GBCA 2P9TA 4ZAVA 4U63A 5K8TA 4B0OA 1TLTA 4TTAA 2HD4A 4O6VA 3TIXB 4M3NA 1JLHA 4XVHA 4EMTA 4EPTA 4DV1B 2F6RA 3GJYA 3R6LA 4PSUA 5LA6A 4CIAA 3PE4A 1QGZA 1T36B 3ROMA 2E9SA 4L6AA 3R23A 4AUNA 1ZPDA 2CYCA 2L0XA 1VPDA 3CNOA 5FLKA 4AU1A 3PENA 3Q7SA 5LYJA 4MW2A 1G3IA 1LJUA 1UP7A 2ZIXA 3OCCA 4LC0A 5AKGA 3I9JA 2GGSA 4UMDA 4ZAGA 5JW6A 2AN1A 1IJFA 4EY7A 4X20A 1G1AA 1RBMA 2VJBA 2VP5A 1GZVA 1W52X 2XRYA 4KWTA 1J24A 2FPKA 2D0PB 5AO9A 1GVHA 1S4MA 3WMRA 1W5BA 2QE7A 5JH7F 3EMKA 3U7GA 4Z6KA 4JP2A 5I7HA 2W93A 4IQ0A 5CG2A 4ZMRA 4N4AA 2VUTA 3AXSA 2JLQA 3H1EA 4HAUA 4Y2HA 3ROEA 3SHOA 3EBOA 3SY8A 3UF0A 1I3OA 2YJGA 3HCPA 5AW0A 2AKEA 3RRNA 3KTAA 4QWMA 2GETA 1D09A 2FQQA 1I80A 1LQUA 2B98A 4HRVA 1OWMA 3PRHA 4KQ6A 5COQA 5BOVA 1TMKA 1XDSA 3LBIA 3O4HA 3NPAA 5DYWA 3FNIA 1UZLA 2ZB4A 5FTMA 2RKBA 3PA6A 1ZVMA 2YXPX 3D6TB 3H86A 2EX0A 4B4UA 4U2GA 4OK3A 4CG1A 1SBHA 2O8CA 1FTWA 2HSZA 4BQSA 4LCJA 4Y2QA 2AEEA 2HIMA 3IP5A 3JQAD 2PS3A 4KNYA 2YNMA 4LF6B 1YQGA 5K45A 1CR2A 2I6TA 2PYIA 1TT5A 2J3DA 4LYHA 3PEVA 1H3FA 2NO6A 4YXWA 4BCDA 1CRLA 2R96A 4B5KA 3KUKA 3D3JA 3GG9A 2D4AA 2VDMB 2ZB7A 2BFOA 3OM9A 1LDGA 3V3TA 1L9XA 1L3IA 3NT4A 4XWTA 3AEKB 3M89A 2QNRA 3WLLA 3LQQA 4GWKA 1XLTC 3DF7A 5B3LA 1OUMA 1EGAA 3C6KA 5CNKA 1NW6A 1YQ9A 2Y1OA 1Z22A 1QIDA 4P3NA 2REQB 3CPHA 1Z29A 2ZAOA 1VE5A 2GM9A 2WFLA 2NPOA 4FNMA 5JJBA 3DTVA 3G6WA 3SC2B 3H5IA 4KXYA 5EGSA 5KYWA 2QTGA 3DWIA 3EEFA 4X8MA 3V4OA 4BOYA 1AZWA 5BQXA 4JXZA 4ZIRB 2W2KA 1I0IA 2RHOA 2Q6KA 1BCSA 2VUUA 4E3ZA 4RVUA 1ESDA 2WHEA 3E15A 4KNVA 4U02A 3VC2A 2YHBA 3NPMA 4L5IA 1RFGE 1XAGA 4MVJM 5DCWA 3G9TA 2I62A 2Q5LA 4E15A 2J3HA 4OIMA 1E98A 1FVHA 5IAGA 2FRXA 4RK1A 4TS1A 2YY5A 9ABPA 4UHDA 1CUEA 5FT9A 1DKRA 3PC4A 2QYOA 4EYQA 4F4DA 3GJ3A 2PJDA 2YFQA 1GUDA 2GDJA 4K6FA 3ESQA 3R74A 3VOBA 3BFKA 2QU7A 5DTRA 1Y3HA 3ESYA 2VBCA 5EQFA 3SOZA 5BN4A 5FI3A 4O4HF 3AK4A 5ALZA 2IUYA 3WQBA 4P2BA 4KR9A 1WABA 4C1NA 4AO8A 4EHDA 1TVKB 3FDZA 3REOA 1A3CA 3SLRA 5LDHA 1O77A 1T1JA 2CJYA 1U8ZA 2YJ3A 3DVAA 4FILA 1CY2A 1DAOA 1N4AA 1NT4A 1Y7PA 4JB8A 5DBIA 1GPDG 2DJ5A 4R9RA 3L6CA 2A3NA 1QZXA 2BC9A 2ZIWB 2DC1A 5KYUB 1EK0A 3N86A 2P9HA 1FBTA 2IA5A 2GCOA 3NUQA 4TRRA 2B99A 3QV2A 5A4MS 5FOQA 1E8MA 1UR5A 1XWIA 1OGIA 1DEXA 4RDIA 4E46A 1S4QA 1NF8A 3CH7A 3ILYA 3EIHA 3M5CA 4Q4AA 1FXUA 4RADA 5E7JA 1KDZA 1KC1A 5KYNA 1IIBA 2C1ZA 1RMTA 4IXDA 5M29A 1O4VA 1AXRA 1VCIA 2PZFA 4JJZA 1RHRA 3UFXA 1DEKA 2FJUA 4AY5A 2Z1NA 3AZQA 3WAJA 4B80A 2BCJQ 3ES9A 4Q9KA 4YALA 3TKYA 1OX6A 4AZ3A 4C4RA 1VMKA 1CB0A 1Q0ZA 1R0ZA 2C2ZA 3AEXA 3INTA 1ZGHA 2WU3A 4NKRA 1TL7C 4UPDA 4OQQA 4QUBA 3GMTA 3LOPA 4I0WB 4UQPA 2GN1A 1QU2A 4RGYA 1B23P 2PNJA 4E4RA 4ME6A 4BMYA 5M3BA 5B4UA 4MIKA 3T0GA 3F9IA 4O0MA 1FTNA 4S1WA 4X85A 3CUKA 3ZH2A 4U7DA 4UVHA 2OXCA 2X3UA 2C7OA 1IQPA 3W8DA 3QE0A 4ZHQB 5A4KA 1E8DA 2I6FA 3E0QA 3O91A 3CVOA 3Q9UA 2OAEA 1BNCA 1OPRA 2P5UA 4PQEA 4HAIA 4RA6A 5K5EA 3QEBZ 1JI3A 2I4IA 2IL1A 2O14A 3RS2A 2IIBA 3QSGA 4LKOA 4B6GA 4DQVA 3QFCA 1EVKA 2HTFA 4OJQA 2VZEA 1WIWA 1UKZA 2ZWIA 3N8IA 1UKVY 4WA8A 2FF5A 4LMRA 1HDZA 2ZUBA 5TEWA 1VHTA 5A3VA 1HF3A 1T4CA 1EK6A 3DAFA 3O26A 1Z8NA 2QV7A 3RAGA 1DO8A 1KEUA 1MXFA 4YGYA 2JEYA 3AF4A 5AOVA 2ZQZA 3P27A 4ER7A 3K20A 1O08A 3KQLA 2XXAA 6YASA 3QXJA 3VU0A 1FX0A 1DAKA 1OC2A 4RKFA 1M34E 4GM0A 3AV3A 1UM8A 3HJAA 3OE1A 5L4LA 1AM4D 2DPGA 3A6FA 4RTJA 2QP4A 4GKKB 1EXNA 3MMSA 3PXCX 5F3RA 3KJZA 3OTOB 5CK5A 1Z4PX 2YZ2A 1H0KA 1UMDA 4K86A 5I8PA 4EUFA 3NNSA 1KP2A 3WA6A 3N07A 5JZVA 4V02A 3AVWA 1JHVA 4TXJA 2PUCA 1Z6AA 1D4ZA 4RZUA 4BB6A 1WVMA 4WBXC 1SPBS 4K46A 4MW6A 4DCCA 5ITZB 1XKLA 3O7MA 4QDZA 1WSWA 1WA5A 3S1SA 5T7BA 1MB0A 3JYNA 4QASA 5B4VA 2PZGA 1E1CB 4FW9A 5IN4A 3EF3A 3JQPA 4Y2TA 3RSQA 3W3AA 4CMIA 2CWDA 4XGQA 2WHXA 5TIIA 3NC4A 4ITVA 3SQMA 1SKYE 2DR3A 3F6PA 1ZLXA 4QD3A 2BEKA 1DNPA 4AJPA 5F78A 2ODWA 3RYFA 3RG8A 3K9LA 3FMOB 4JLVA 3L7YA 3F7MA 4JODA 4B6RA 1GKLA 3T3OA 3QI2A 3E2MA 3K6SA 2BHTA 4PGMA 4BHTA 2IIPA 3GFVA 4IDGA 2RGWA 1CJSA 3EVNA 2AKAB 1OXVA 4XVRA 5D3QA 4FCCA 4P33A 4G0WA 1ZXLA 3BDAA 1L7RA 1KMHA 1KXZA 5LWQA 1Y4DE 2P78A 1SGWA 1ZEMA 2DKOA 2H5LA 3ENQA 3V7NA 4JEMA 3JVVA 4C0SA 4FBLA 3CTMA 4TMYA 3E9NA 2A78A 4G0OA 3IUMA 4I4TB 3TQFA 3ZHUA 1B1AA 2WM8A 3MCWA 1XNRB 4P4SB 3WMWA 3CEJA 4JGIA 4CM4A 5FPHA 4YBZA 4YYZA 3GLFB 4N39A 1EESA 1YAHA 1CJCA 2TSYB 3ZWWA 2C4HA 5ENDA 1PSDA 2QAGC 3K4HA 1HI9A 3RU9A 4BE7B 1G19A 2RAUA 4H7FA 5AJUA 1ZNQO 2WA2A 3VXKA 3QF7A 4F3YA 3FI0A 5BSUA 2YHIB 1YXMA 3IHLA 2PGOA 3TZEA 5DM70 4ZCSA 1SOAA 4HGPA 5TGTA 5L40A 3GZTB 1NN3A 3FZGA 2IF2A 3FNGA 4LRWA 1VKZA 4MVWA 1BYIA 1XLTA 3GNLA 3GYBA 4OK6A 1WPRA 1ZP6A 3DHEA 1TU4A 3D0RA 4FZVA 4IDEA 1AH2A 3G5UA 4FXOA 1SB8A 2JJMA 3LE8A 4HQOA 4MCIA 4N7JA 1KOLA 3H97A 4HQLA 2ZZNA 1KFKB 1RHMA 4QGGA 1XRQA 1PFYA 3T52A 2VWHA 4QGSA 3EXEA 3S8EA 3LPAA 3QUTA 2E7ZA 2XNDA 2ZUDA 3I09A 2QUBA 2V8OA 5CCXA 1VOTA 1G59A 1RXIA 5CHEA 1BHQ1 3OZIA 3IJPA 4DG8A 1HETA 5FWYB 4F93B 1R4MB 2VPWA 1JU9A 4M1ZA 1FVFA 2PD4A 4P3KA 5FUWA 3FUVA 1N6KA 1TEHA 1N1DA 4HAXA 1GEEA 2PUEA 3A05A 1VPTA 5DASA 1OKKA 3COZA 2ZM5A 4IVNA 1Q0TA 2YC2C 2XUJA 1N2HA 2ZJOA 3E84A 3KDAA 1V0JA 3NLLA 4P53A 5TJHA 3TLYA 3VR1A 3AHFA 1NG9A 1XHLA 5DYNA 2IYUA 5U1PA 1WW8A 2C96A 3CCBA 1T0HB 3HB9A 2ACVA 2AS0A 3EXIB 2AZMA 3FZEA 4GLBA 3KSAC 1HR0B 1ZUHA 1HLPA 3C0KA 3DMRA 5DHPA 4EEXA 1D04A 4AF8A 1JLLB 1YRAA 4MYSA 3R2JA 4D6YA 3FNHA 2OY0A 1A5BB 4HLUA 2W11A 4REMA 1AS3A 1GPMA 5AI4A 3FPJA 4Z9XA 3H11A 4Y9SA 3G5MA 3WLRA 1TT7A 3EDRA 3WISA 1Z88A 5DBFA 3WIVA 3VH1A 1CQWA 1P7YA 4OSPA 4QPCA 3EWNA 4TVBA 4E12A 3DCJA 5FOUA 5M7EA 2SNIE 4XLZA 3OCVA 2ZUEA 5CB6A 5SYAA 4YS6A 1PDOA 4RJIA 4CW7A 3DA8A 2FMKA 2YJTD 1Q14A 4BMPB 2PANA 2AJ8A 1A9OA 3UUEA 3DBHB 2GAJA 1ZJJA 1S3GA 3E9DA 4N8EA 2X2FA 2LR0A 1JFVA 3THXA 3OZ7A 2YRWA 5DGXA 1GGFA 3DC7A 4GLLA 4I36A 4PS0A 2FZ5A 4DLXA 1DJOA 1ECJA 1M0WA 3DZCA 2C97A 2ZTLA 3A6LA 1E7RA 3HKCB 1WB6A 4HO1X 3TB6A 1GITA 3WAKA 3AHIA 4RD4A 2LDBA 1D2NA 2GHTA 3AO0B 5A7GA 1NQOA 4B17A 4TL6A 2I80A 4G8BA 4QXMA 3OLVA 5ALGA 1Z4MA 2W0MA 4G01B 3UMSA 4MUHA 4IP0A 1JEAA 4CQMB 1O94C 3BMOB 4UUOA 1QQBA 2D59A 2FPIB 4BO0A 1RTTA 2JC3A 2VYFA 3BCUA 3DDNA 4KEAA 4M6WB 4FE3A 4MCAA 5C4MA 3E0XA 4KPFC 1I1OA 3JD3A 2Q2NA 2VA9A 4QDXA 3VX4A 4ER6A 5CVJA 1T2EA 1N6HA 4F3RA 4ZYYA 5KQPA 5GP1A 3JRXA 1KGSA 2W2VA 4C5CA 1ILEA 2CCJA 4H3KB 3Q88A 3F96A 1KI2A 5ES3A 4DIMA 1MIOB 4Q21A 5DHRA 5BT8A 3R0XA 2ISCA 3B51X 2R5WA 1JJBA 1OWLA 4FI3F 1PJZA 5AK4A 1T1GA 2NLOA 4MMYB 2XWQA 3TCKA 4AS2A 1MX3A 1H2ZA 3L40A 3MXOA 5H16A 4C4OA 1PWYE 1T0UA 2BT4A 4X62B 2Z6AA 4ZQEA 4IFBA 3W2HA 1DKMA 2ZTHA 4BMVA 4YP9A 2IEYA 4CQLA 5FTNA 4F7WA 2TECE 4X7MA 1WCIA 3GP8A 4CV0A 1TRHA 5DTEA 1ES9A 2C3YA 4K1XA 5CB4B 5F33A 1PT8A 5CFPA 2ZUWA 4RZXA 4M1OA 2EU8A 4M1SA 4U5XA 1KF0A 1X3LA 3A70A 5KOJB 2XIJA 1AK2A 1XVAA 3OIFA 3LLUA 2JG3A 3G9XA 5EWJB 3OI7A 4PZPA 1O5IA 1ZA1A 3AY7A 2H7VA 2CNWA 2ONYA 3OJOA 4F6RA 2CLSA 2XYPA 1ZG3A 4HUJA 4KU4A 4RGQA 3ZVKA 1UXJA 2BFFB 1YKSA 2J3LA 4Q4HA 1V3QE 4JXJA 2PZJA 3KVOA 4PBRA 3MJCA 1NNSA 2P1DA 2O0HA 2ZSKA 4OKNA 5DW0A 1E9DA 3AUTA 4C30A 3W9UA 1BO6A 1G5RA 1RKQA 1V26A 2DPLA 1UK7A 3K9CA 4PLWA 3KPVA 5CP8A 2YVLA 4OUDB 3DFZA 4A6EA 3HDQA 3QENA 4U7HA 3W2TA 5GJBA 4R7ZA 4WNAB 1V1JA 1Y8CA 4HYQA 2XUQA 3N0XA 1CEXA 3NOQA 2BN4A 2CXNA 4OH7A 1IVYA 1TJ5A 3LWZA 1ZK4A 2EP7A 4IH9A 5CTAA 1JFSA 1O8CA 3AB3A 2PBLA 4MA0A 3RBVA 4W5OA 4JIGA 4TKVB 5H4HA 5F4ZA 2WE8A 1Q0PA 4J43A 4V3CA 4XYLA 4IHJA 2DRIA 4OFBA 2A5LA 3VSCA 3G88A 2UZ3A 3K4PA 2HWXA 3H42B 1LLFA 4Q12A 3IEKA 2IZZA 3SHFA 3W9YA 4TYYA 4ND2A 1PJTA 3LDUA 1ZKDA 3AFIA 4Q5IA 2A5JA 2JD2A 2HU2A 3P9PA 3DXFA 3L7BA 1MUUA 3RU3A 4MV6A 4TWIA 1BX3A 2XCLA 5ESXA 4IIEA 4I4NA 1Q0SA 3SKXA 3MT0A 1CJTC 1RBYA 1JR2A 1XRMA 1AG9A 2QAGA 3GP3A 3KXDA 1M6VA 1U94A 3GZNB 4FS8A 4R6WA 1E79A 1R6AA 2PSEA 2W22A 2ZJ0A 5JHHB 1T2FA 3A0RB 2N47A 2NZUG 1GCGA 2R86A 1VFPA 3L4EA 4D0NA 1COWA 1XTIA 4ZOQI 3DV0A 4N5HX 1X1AA 2FSHA 3O92A 4YI3A 5EJ6A 4P4NA 1LSJA 3LXXA 3C85A 4EGQA 3FJ1A 1U80A 2NT3A 1PEAA 4Q05A 5AJHA 5JFOA 2NUAB 4M1KA 1X1BA 1J90A 4WX2B 3E1SA 2P7HA 2ZJ3A 4R9VA 4CR6A 4DT1B 3CUWA 4ACBA 5CPBA 1WP4A 4R5MA 1WZCA 2VPTA 1QP0A 2L69A 1W581 2ZDQA 3LPLA 4RVFA 4ZQIA 1ZM7A 3RS9A 1BW9A 4RK7A 3PQ2A 5HKAA 2YFYA 5EXEA 3UAVA 5MHTA 1M1YA 2FF7A 2HBZA 4JASB 4ZVNA 5ALLA 3OA0A 4PC3A 4F84A 1V96A 1SIWA 3ENKA 4Q9DA 3RFXA 4KMMA 1NQTA 4URUR 3ZCTA 1K68A 3QFRA 3MBIA 3K1YA 1KJYA 1TQDA 4LOLA 3H2GA 4IMJB 4DEXA 3VH3A 1G6KA 2PS1A 2WFAA 3MXTA 1V95A 1UP4A 3HP1A 4CMCA 3D4LA 2QROA 5CCDA 3MS4A 5FTLA 1KOGA 2AMLA 2RGGA 2WE7A 2XT6A 1BMQA 1U0SY 1VL6A 3O4VA 4H4DA 4BKRA 2Y27A 1KMMA 3LC7O 3O9ZA 1J8DA 4F06A 5A9SB 3EISA 4FQ5A 4YQZA 4EA6A 2GNPA 2AKYA 2IJGX 4QEZA 1M67A 1U98A 3KOMA 1PEKE 3C3BA 3G5LA 2HX1A 3OJ0A 4Q4JB 5KDLA 1RWKA 3T3EA 3EPRA 4EG3A 2B1IA 1ADGA 1P1RA 1HNWB 1E6MA 4RTRA 1LX6A 5G53C 1DXYA 2Q8PA 3ZU2A 1ZX1A 4ECAA 3BERA 4QOHA 4JX9A 1GHTA 2X8JA 3QH4A 2WWRA 4HDMA 4HDCA 5DJ5A 2XV1A 5LQDA 4MQUA 2WJAA 3PWTA 1HEIA 3I1YA 4XGRA 4OXKA 4NCAA 4NYIQ 1ZD9A 1I10A 2OL4A 1MOPA 3AYXB 5LZ7A 2N0SA 5E4JA 1INLA 4H7IA 2VQ6A 2IBSA 2QQFA 5BSHA 2H1HA 1P0FA 2C7VA 4QTZA 3F6EX 1E5VA 4XWWA 4ETIA 1SOWA 3I64A 1Q3HA 3VH2A 1K0UA 3HCAA 3LECA 1GTVA 2PU5A 1ELOA 1U4SA 3ABOB 2WYVA 3C7DB 1WNTA 2BEWB 3DMGA 3NR2A 2VBIA 4ND8B 3O3CA 3TOCA 3ZDZB 5KDOA 2ATEA 3IQHX 1E1DA 5BO5A 3KYCB 1OZHA 3FPKA 4EHAA 5GQSA 2VHXA 1Y6FA 1Z3CA 4L5AA 3RWOA 5JNTA 3U7FB 1RW4A 3K94A 1B26A 3EK2A 2ORED 4AJLA 4YJ2B 3LUGA 1TD1A 1X0VA 4JEIA 4XOIA 2MINB 4ZYWA 4C08A 4EMBA 2GPTA 4AO7A 3W6NA 3MJVA 4ZOLF 5M2QA 2NTVA 4LFAB 4OD0A 5BN5A 1O94A 4TLEA 3RS5A 2RC5A 2E5FA 2GTPA 4OJYA 1DPGA 1AKQA 4BO1A 1SBTA 4FZRA 4BDTA 2Q4DA 4Y7CA 2LZ0A 1UBKS 2ZJ6A 1JIUA 2VJOA 2VRCA 4KKXB 5CM2Z 3B9BA 5SY6A 3WGHA 1SCDA 3BJIC 4KRXA 2L42A 3MBKA 3H9EO 5AW6A 3HFJA 5LC1A 3OOSA 2JGDB 2UZ1A 1CDDA 2OBMA 4PCAA 4MV0A 2QAIA 5HF8A 1U02A 4C4XA 3LF2A 3MTGA 2G71A 2R5FA 4NHEA 4O8ZA 3R41A 3TZ6A 3PNVA 4D1YA 5KEIA 4CL8A 4X93A 4G5SA 1CQPA 4TZ0A 3MTBA 4NBKA 5CYPA 4Y2UA 4AMYA 2YKGA 3LWDA 4X24A 4PBSA 4W5NA 3BKWA 3WHIA 3DZBA 2XVZA 1K8XB 3IVGA 1KJNA 3R76A 5FBKA 2WD7B 1CVRA 3K73O 4O1IA 2WLTA 3DPSA 3SNKA 1UT5A 1Q7GA 5AQEA 4KRFA 3AUKA 4TV9F 1EK1A 3DFUA 3GLGB 5FLEX 2ZBEA 3PE6A 4B3IA 1M2VB 1PL6A 3VNSA 1G63A 1GG9A 2H63A 2QV0A 2ZSDA 3B9PA 3I58A 2O8FB 4MKIA 2P4UA 1U1GA 1WD5A 3MTJA 4O2AF 3RJZA 3Q41A 1XEWY 5JC1A 2RH4A 4ZGGA 2EBHX 2CV2A 3PXBA 3QLTA 3HRKA 3NHWA 4MYHA 4R2LA 1HWYA 4RQUA 3TPCA 4QFDA 4J7XA 5BNIA 3WGQA 1WPGA 4DPMA 2INGX 1SHTX 1SU6A 2IYFA 4LY9A 4ZPJA 5C5DA 3CLTC 2GK3A 3PTZA 4XSGA 5ITWA 3EZNA 5EHXA 5K3BA 1X2BA 2ZDHA 3G8BA 4KKVA 4R1OA 2VRNA 3VSDA 1IXRC 1YULA 4HKTA 2J3IA 3W9BA 1YQDA 4US1R 5AESA 2RHRA 2CFOA 3CRMA 2R60A 5H1YA 3MYYA 2LCIA 3M6WA 4UD2A 4U1RA 2Z5LA 4ZREA 4EA9A 5K6RA 1D6MA 4FPXA 3E27A 2BDEA 1YR6A 5FV4A 4M7PA 4EB0A 1FLAA 4FX2A 2ODQA 1Y1PA 2YV2A 1N7HA 1RRPA 3NBAA 5K01A 5GV7A 4W9MC 4FFOA 4HBGA 2VYVD 5J40A 4JI4B 2ZJ5A 1JHOA 1EQUA 2FPLA 2G5CA 3JZAA 4ZZ0A 3WB2A 1S3FA 4D3XA 2GN4A 3MILA 2O07A 4MJ3A 1U3WA 1NXSA 2JDIA 3ZI0A 2WILA 4R8SA 1N34B 3OT1B 4X3CA 3SYMA 4JR1A 4B85A 4OL9A 2F48A 3ZD7A 1XHEA 1BRMA 2WA1A 3B3AA 1G1MA 4UXIA 2JHAA 3DZGA 1GFZA 2EF0A 4AT1A 4JUIA 4E14A 1XTKA 1YGYA 1B6RA 3G0BA 5T4BA 1QHXA 2GWHA 4S05A 1G20E 3OU6A 2AQIA 2H65A 1DO0A 2BOVA 1ML3A 3KR1A 1CEQA 3GY0A 4PSKA 4OGGA 4TT3D 4X6LA 3U9SA 4H1TA 4HNAA 2QR2A 3RAPR 5F21A 4INPA 1Y3DE 4C0KA 1K8ZB 1PX2A 4UOEA 4HUQA 4XYMA 3E7XA 3R7BA 1MHTA 1EA5A 2XLCA 4F4HA 1B73A 3FWHA 5IJAA 3DQZA 1IUNA 4K6CA 2V5AA 1CUDA 1P3Y1 1U2QA 1UK8A 2Q4OA 3H9QA 4GZ3A 4J91A 4D9JA 5AW4A 1QAMA 2B1QA 5JCZA 1V1RB 2FQYA 1XTUA 2D7CA 2LW7A 1GPJA 2R6ZA 2W2TA 3GFOA 2YCBA 3I6QA 3MW8A 3QVSA 4MRMA 3C3JA 4DA6A 4A26A 5AVVA 4AW9A 3L7CA 3OPYA 4R3WA 4Y1RA 1N7JA 5HJ7A 4MRNA 2WJ6A 4Q9JA 3RS7A 2ZIZA 2ZBVA 1EP3B 4JOBA 3IDQA 5KKAA 4M0DA 5JLAA 3ZC3A 4C03A 1Q57A 1PJLA 2JI7A 1LLQA 2WK1A 4WA7A 2OQIA 1AU9A 2GBGA 4RJLA 5JQGB 3NKFA 1L4HA 1BD3A 2QYTA 3E9ZA 1KJJA 3G2JA 4HCJA 4QYSA 5FPSA 1QPBA 1UADA 2R68A 4X3PA 2A5FA 5FDFA 3KNZA 3ZN2A 1U4OA 2Z0MA 2YZGA 2A9FA 4KX3A 1GTZA 3BK1A 3QE4A 3WGYA 1E3TA 1O7JA 3UJNA 1GGEA 3SIRA 3OCZA 4L5CA 4W9RA 3TBKA 4R05A 2ZCJA 2CL7X 3HVUA 1I2MA 3JRWA 4G97A 2PZEA 5F1YA 1P5JA 4DLPA 5U4XA 3X1KA 3MUOA 5EUQB 4CWAA 4C7KA 1CYDA 4WK0B 4EY6A 1L3BA 2QT1A 4J07A 2FN9A 3KKEA 4O4LA 4DLNA 2WFZA 2GCEA 5K6TA 3WRYC 3W77A 3WHKA 2O2CA 1KDVA 3PEWA 3FWPA 4PN7A 3BXHA 3Q2KA 4M2LA 3USES 4CV1A 6GPBA 4YC7A 1TQHA 2G80A 1CS0B 5B7PA 2BCEA 4ENRA 2ZANA 2WFMA 3SJAA 4V2IA 2QP3A 4DKXA 1IDN1 4HRYA 1RSZA 4JJFA 2VTBA 4HXGA 3K5HA 3KLBA 4TTVA 3R75A 4DA8A 1AC5A 3NTXA 4WNIA 1RFLA 4PGGA 1T9CA 3LUPA 3T38A 3I0NA 1ZD5A 1E9SA 1FOEB 4GX2A 3U4DA 3E7PA 4F4CA 4NATA 4KXUA 5JPDA 3CS3A 1BMFD 3EGVA 3DOJA 1TYZA 7MHTA 4B83A 1O0CA 5LFAA 1ZJWA 3G9UA 1YZNA 3WIDA 1THTA 5K05A 1JECA 3LBHA 1V8ZA 4TM8A 1L6IA 5J2UB 2YZKA 4M0PA 3VZPA 4MPTA 1PVVA 2R87A 2IU0A 4IDPA 1Z0SA 1VKJA 1E5DA 4ZCMA 1L4EA 1L7BA 1GRNA 1I01A 1SVNA 4AMVA 2JLWA 5LNK6 3ABZA 2X77A 2P40A 1H1DA 2D0DA 4KAXA 5AJXA 2I6GA 2SKCA 2ZCUA 3L93A 4U9IS 3LCVB 3JAWB 3LHKA 2Z8YA 2AMJA 2CSUA 3X1MA 5I9IA 4F0JA 1DIOB 3JSXA 1Q2UA 2BEJA 1K8QA 5IUNC 1SOUA 1HYHA 2WQ7A 1G20B 3BSSA 2JK1A 3ZK8A 2REXB 1VPEA 1QP8A 2FSVC 3ISTA 1XIVA 3LT1A 4OB7A 5AKHA 2YYAA 3WADA 1IJBA 3O8BA 4EI7A 1AURA 2R0QC 3AY3A 4D3DA 1M2NA 5IH3A 1M2FA 1N2BA 3I42A 3NVAA 2DUWA 3DMNA 2CD7A 1SU4A 1XRLA 2W2MA 3ZY5A 2WU4A 2MSKA 4FFBB 5A0FA 5BQPA 4BFZA 3ROPA 4UTNA 3C3KA 5KNBD 1QGOA 2RIPA 4FNOA 1NASA 4PTZA 1F06A 3RVLA 2PYDA 3SU8A 4ADSG 1JE1A 4FLFA 3D8NA 3HP4A 5FTWA 1CVLA 1LRLA 2AR0A 1NLYA 2E0IA 2BW0A 3I0ZA 1L5HB 3V8BA 3UQYS 4U2FA 5EE1A 3L8GA 4Z0HO 1NC3A 2IHZA 4ENWA 1CNMA 1YZFA 3U60B 4QUJA 1Y4AE 1NDHA 4FFDA 1DDIA 3KJGA 4ZAYA 4A0RA 4GX0A 4URXR 2LBPA 3FYDA 2HMUA 4XWGA 4JROA 1ODIA 3ASZA 2QLBA 1P7CA 2X0KA 1TADA 2X7HA 2EATA 1J2TA 2YV3A 1Q92A 1ZRSA 1DAGA 2ZRNA 3ICOA 4X94A 1VI5A 5H0IA 3P9IA 1SJ9A 2HDNB 5TPZD 1WXXA 2CFCA 1I0LA 1PT9A 3EUWA 4ZWNA 3ND5A 1R8YA 4ARVA 2DXIA 3RSOA 2D5LA 1HFEL 4L28A 1DWOA 5KMGB 3UMMA 2HCRA 4AP6A 5JXJA 1YVUA 2IXFA 3QUAA 4YUZA 1D2MA 4LJ4A 4ZDKA 4ZKDA 1MLDA 4CR7A 3ELDA 5F4BA 5ICGA 1WXFA 2XF8A 2OFFA 3UV6A 4C6TA 5AK3A 3AUSA 3G2NA 4G89A 1C0LA 2HF9A 4DJFC 4CLOA 5KHOC 1KJ9A 3AR7A 1PDWA 3M0EA 3DDCA 1DJQA 1T43A 2A67A 3A1CA 1G64A 3BZBA 3A9WA 3PWZA 5C3MA 5BYBA 2A1UB 4MI6A 1DPFA 1W4CA 2II6A 2R65A 3EVZA 4MS1A 4YLGA 3T7EA 4D02A 3G59A 4CIWA 5LQKA 3C4JA 2Z6QA 5AK5A 1ORRA 4J0HA 4KTVE 2ZOSA 4JR2A 2X1MA 5IM5A 3AI7A 3ZD8A 1PKXA 2HF7A 1ZEJA 3MWLA 3TLGA 1T4GA 3MMPA 3OIVA 5GZ6A 4Z4EA 2E5WA 4BZQA 3EZ9A 3PZBA 2B4TO 2D8MA 2QMUA 5TLSA 3DAHA 2Y76A 4URZR 1RPNA 4IGAA 1MNAA 4KRGA 4LDZA 3HA2A 1RLUA 4D98A 3TWOA 1BAPA 4DR1B 3C3AA 1TQ8A 4ZO4A 4ENSA 2FWRA 4GR5A 3O2NA 1NRXA 3VOAA 2DWPA 3GRUA 4M9RA 1AXEA 2ZRHA 3GGGA 2FHSA 4KQMA 2ZI5A 3KL2A 1FA9A 3V8NA 1KO4A 1XWWA 1TOAA 4RV9A 2O7NA 2IX9A 1X1EA 2I9PA 3DBRB 4CM8B 4FUQA 3AVTA 2P2LA 4YMWA 5J58A 2H8GA 3BJRA 1HNXB 3AF2A 4HN4B 4FOLA 3O9VA 1Z4IA 3Q8KA 2QRJA 3GPIA 4I3HA 1GAEO 3IAEA 1NLUA 3AETA 1I2DA 2AN4A 3F6BX 4B40A 5G2OA 4DA9A 5ALEA 2IYXA 3P2MA 2PMFA 3U0VA 4V2UA 1HTTA 3LAWA 3OPYI 4NOJA 4ZV4A 4J9UE 1QONA 1SUPA 3EE6A 4FZJA 4DR3B 1RCTE 1CTQA 2FOIA 1AKTA 2J6IA 1P6UA 1D5CA 3SBDA 4KN6A 1OLUA 2QRNA 5B37A 2R6FA 2ZR0A 1U0EA 2ZBDA 3LY9A 3MN1A 1HE5A 2UVQA 4BVGA 3GZJA 1DG1G 1KVSA 2OVFA 5CX1B 1EP9A 1F2TB 1JLKA 1ITZA 1Z15A 4LHEA 4MHTA 5C35A 3K2IA 2JFVA 4EI8A 2TRSB 4B7XA 1QC5A 3HYCA 3HUEA 2ONJA 3ZJTA 1VZ3A 2GK6A 2HWUA 3DG9A 1UMBB 1DG9A 1E3LA 1KS9A 1QH1A 2HF2A 2GFQA 3EW9A 1YQWA 1SVSA 2PL9A 3BMQB 1BGVA 3N8KA 4PAGA 2ONZA 5JAMA 5KX5F 5IKXA 3SQWA 4U8HA 4EB3A 1J0EA 5FA6A 3J81k 1T9BA 4CCAA 2VH5R 3TW8B 3UMCA 1TAHA