3KR1A

Crystal structure of hpnmt in complex adohcy and 5-chloro-1h-benzo[d]imidazol-2-amine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kr1A00
4X1OA 4R8RA 1KXZA 3KHKA 2CL5A 4YUVA 4C06A 1G8SA 4CTJA 4MTLA 2ZIEA 4MHTA 3HCCA 3G7UA 4HTFA 3BKWA 2B25A 2PX5A 3FUUA 3C3PA 3GU3A 3KQOA 4OBWA 1N2XA 2P40A 4DA4A 1G6Q1 5T6BA 3LDUA 1RI2A 2PXAA 3BGIA 3G8AA 2VZ9A 3O4FA 3PT9A 4GOOD 3VC1A 3VSEA 4RTPA 2C7OA 5B1SA 2C7QA 2BR5A 4EK9A 5M5BA 5FUBA 4RVHA 2EJTA 4XUEA 3B3JA 2WK1A 5LQJA 5CVJA 4QQKA 4GOMD 4RTJA 1XXLA 4YMGA 2VDWA 2ONYA 1KPHA 1DUSA 5LQCA 3TPZA 2VS1A 3OU6A 3DLIA 5ICEA 2VDVE 1RJEA 1YF3A 2G71A 2C7RA 2Y1XA 5K01A 1YFJA 4E70A 2PX8A 5EHGA 4PGHA 4RV9A 1YB2A 2I9KA 1SKMA 2IDJA 2O06A 2PWPA 2R3SA 1NW5A 3EVAA 3HCFA 3PX2A 2ZFUA 5HIJA 2EG5A 1I9GA 2QRVB 3NTVA 2I7CA 3CJTA 1O54A 5EKXA 3FUXA 5H02A 2BH2A 3KQPA 3T7RA 5LR6A 3M6VA 4RVGA 3QV2A 2GPYA 1XDSA 4A6EA 1UWVA 1R6AA 3CVOA 3SSMA 5EIFA 3FTFA 1P91A 2KW5A 1KHHA 4E30A 2E5WA 3EVCA 5D1NA 2EX4A 3UJAA 4YV1A 1AV6A 4EQZA 1SUIA 3FTEA 1IY9A 1IM8A 1P1BA 2WA2A 3R6TA 3LX6A 5E2BA 4CKEA 5K0EA 2NXNA 3MERA 3IYLW 5E1BA 4BY9E 2BM8A 1KYWA 1NBIA 3NWEA 3NDIA 3G2PA 4E2ZA 3THRA 3HP7A 5E9QA 3PLAE 4P7FA 1YZ3A 5DXAA 2A14A 5DRYA 3LPMA 1XDZA 3GRUA 4KDCA 1ORHA 2B78A 3EVBA 4KW7A 5EZQA 5IKMA 3H2BA 1XJ5A 2HNKA 2NXCA 2P3OA 2P41A 3Q87B 2AVDA 5EG5A 4KIFA 3UWPA 1G38A 2BR3A 5FHQA 3GJYA 4X60A 2CMGA 1JQEA 3LHDA 3BKXA 3MB5A 1WZNA 2ZBPA 2PXCA 5GM1A 2V7EA 4FGZA 2JHCA 1JTFA 5FWDA 5C0OE 5JR3A 2ZULA 2I62A 2GS9A 3HCEA 1TW3A 1VP3A 5CVEA 2G8NA 3NDJA 2ZZNA 3HVIA 3UJ7A 2FRXA 4F84A 5HZMA 3Q7EA 1RJFA 5GINE 1I4WA 3JWIA 3A25A 5E1OA 1NE2A 3EVZA 2AOUA 5GM2A 1YFLA 1L3BA 2PJDA 1UFKA 1BKYA 1JG3A 3V8VA 2XVMA 1WY7A 4Y30A 5U4XA 5K05A 3OE5A 2XVAA 3A27A 3ELWA 3RIEA 3CBGA 1NW8A 3MCZA 3PFGA 1SG9A 4GQBA 2OPBA 4QDJA 3EPPA 2YXLA 5F2OA 1Z3CA 1D2CA 1R8XA 3M4XA 3AY0A 2G70A 1L1EA 2ZW9A 3HA5A 2ZZMA 3HCBA 4GOND 3X0DA 4LG1A 5DM2A 1KPIA 3GRYA 1JSZA 2JH8A 2B2CA 1YUBA 3UFBA 5F2KA 2PX4A 2ZVJA 3G2OA 3ERCA 1NW7A 2AN3A 2ZIGA 4BLWA 2GA9A 3CCFA 4CWAA 2ZIFA 1AF7A 3MGGA 4P7JA 4GBED 4YUXA 2NP6A 4RTRA 1BOOA 3BWCA 3ELYA 4EKGA 1RI3A 3DMGA 3KU1A 5K0JA 1X19A 2WA1A 2IH4A 1JQDA 2AOTA 2JJQA 2CWWA 2K4MA 2CMHA 1AQJA 4KRGA 1VQ1A 2O57A 2I6GA 1BHJA 3MCTA 4JXJA 1NKVA 5EMLA 3P9CA 5HIKA 1INLA 2AS0A 2UYQA 3TOSA 5DTRA 1ZHFA 3OFJA 3CKKA 3KQYA 1G55A 3FUVA 3KPUA 1QANA 3NW9A 3NMUF 2PWYA 4U7TB 3ANXA 3EGEA 5CD1A 4DQ0A 4P7KA 3KQQA 4FS8A 3IEIA 5CVDA 1R8YA 1QZZA 1RI4A 2G72A 3OE4A 3F4KA 4GUAA 5E8RA 5E2AA 3A7DA 2ZZKA 5HEKA 2PT9A 3SX0A 3M6UA 3KPVA 3DMFA 3HA7A 2AN5A 4HC4A 3SR4A 4BLUA 3GXOA 4M36A 3ER8A 3LBFA 5KQSA 2GH1A 2IP2A 2PV0A 3G5LA 3UJDA 5K0GA 3TQSA 4OX9Y 1X1CA 3O31A 3FTDA 3HCDA 3FPFA 2UYHA 4M38A 2ZBQA 3LDGA 2B3TA 3B89A 1KPGA 3BGVA 4U7PB 3I53A 5FWAA 4E32A 1XVAA 1G60A 7MHTA 3LCVB 4BP3A 4GF5A 2OKCA 3FPGA 3FTCA 2OB1A 4O29A 1FP2A 3SM3A 4GEKA 2O0LA 5HILA 3GIWA 3P2EA 2AVNA 4DZRA 3RW9A 1FBNA 2HWKA 1L9KA 4MWZA 4IKPA 4R05A 4BLVA 1JR4A 1NV8A 5LQAA 2Z6QA 1ORIA 5GP1A 2ERCA 9MHTA 1SQGA 2G1PA 5HFJA 5E1DA 1QAOA 2QRVA 2Y1WA 3EEOA 2ZCJA 2PX2A 3GNLA 1WXXA 3IHTA 5DX8A 5ICCA 2YR0A 1M6YA 3E7PA 5DM4A 3LKDA 2JHPA 2JHAA 5CVUA 3GRVA 1RI5A 4PYQA 5DT2A 4ER0A 3E8SA 2PBFA 3HNRA 4C4AA 4BP1A 3TKAA 3ME5A 3BGDA 3P9IA 4ER5A 3R0QA 4ZTBA 1NW3A 1WS6A 1Y8CA 1F3LA 5DX0A 5D1HA 3TKYA 5MHTA 4V0QA 4RSRA 4E2WA 2GB4A 3MHTA 3EVFA 4PYLA 3UJ8A 3KQTA 4PWYA 5EMKA 3KQWA 4GC5A 2VDUE 3GO4A 3D2LA 3KKZA 3P71T 4C08A 5KVAA 5IH3A 4RTLA 3UJBA 3U81A 4RTNA 4HSGA 4QQNA 5FQOA 1EAMA 4CKCA 2R6ZA 2QY6A 4H0NA 3V97A 4R6WA 3DMHA 4E2XA 4G56A 5K8VA 5EHIA 4HG2A 4R8SA 4NECA 4F85A 3DOUA 3TM4A 3BWBA 1JG1A 5EZSA 2UYOA 1FPQA 5E9JA 2ONZA 5EGSA 3TRKA 3HTXA 1ZQ9A 5DSTA 4QTTB 5CCXA 2IBSA 2FYTA 2FCAA 1O9GA 4M37A 3OCJA 4RTMA 3PVCA 3BWMA 1EG2A 3FYCA 4QPNA 2HTEA 4RVDA 3SXJA 5LQKA 3IV6A 1N7IA 5KQRA 4K6MA 5EIWA 3G88A 1RI1A 3HVHA 4PYIA 1SVUA 5F2NA 3GRRA 3CJQA 5FQNA 5HIIA 4P58A 2YTZA 5T64A 1KP9A 5DSXA 3TM5A 3LKZA 4ER6A 3CJRA 1VL5A 3REOA 5ICFA 3SGLA 4DCMA 1AQIA 3SMQA 1XCJA 1B42A 3A26A 5G02A 5GWXA 3NJRA 5LQRA 3QOWA 2NNWB 5DTMA 3P2KA 2IBTA 4IWNA 2PVCA 3DLCA 4RTKA 2ZBRA 4L7VA 1JQ3A 2F8LA 3AXTA 4HGZA 1D2HA 1NBHA 4PGGA 3EEYA 3SSOA 3UJ6A 3BUSA 5KYGA 3I5UA 3M6XA 1EJ0A 4R6XA 3B3FA 3KPYA 4KIGA 3FUTA 3OZSA 3PB3A 5DWQA 2FK8A 3K6RA 1JSXA 3LL7A 4RWZA 4DMGA 3JWGA 1X1BA 3E05A 2JG3A 2OB2A 3HCAA 4B17A 2UYCA 3O7WA 5DLYA 3OZTA 2OBFA 2BM9A 2C7PA 4Z2YA 3KR2A 2GAFA 3DTNA 3OFKA 1EQAA 2JH9A 4MIKA 2N47A 3BZBA 3DP7A 1YZHA 3KQVA 4PCAA 1X1DA 4V0RA 1R18A 3AXSA 3B5IA 2ZWAA 4LWOA 5EEGA 3DH0A 5EOVA 1O9HA 3SVZA 1JG2A 1XTPA 4AZSA 4YV0A 3TLJA 3T7TA 1EIZA 5LQUA 2AOTB 3LCUA 3P2IA 5GIPE 3DULA 3K0BA 2NXEA 1L3IA 3AWIA 3A7EA 5C1IA 3CC8A 3UJCA 4DKJA 3EMBA 2P7IA 1XCLA 1KR5A 3LDFA 1BC5A 2PLWA 4PYOA 5DM1A 5DX1A 3THSA 1H1DA 3DXYA 5CUQA 5C9ZA 3GWZA 2AOWA 5EEHA 5FTWA 3TFWA 3T0IA 4CKBA 3DUWA 2IH2A 3DXXA 4RTOA 4WXHA 4PONA 4DM3A 2B9EA 4HTFB 3NVKI 1PJZA 4LECA 1P39A 5EKUA 3PFHA 2P8JA 2IIPA 3A4TA 3B7PA 2GLUA 2DPMA 4F86A 1G8AA 5BW4A 2Z6UA 1Q0SA 2XYRA 1QYRA 2OXTA 3UA3A 3UJ9A 3PTAA 3EVEA 5CVVA 5EMJA 4C03A 4AX8A 1VIDA 4C07A 5K0CA 1JG4A 2O07A 3JWJA 3QOXA 4POOA 3G2QA 3ELDA 1NT2A 2AOXA 3R24A 3P9KA 5K0NA 4AZWA 3RODA 5GOZA 5BW5A 1TW2A 3M70A 3C3YA 5GIOE 1V39A 2AR0A 5CCBA 2CKDA 3R3HA 4XCXA 2NXJA 2OO3A 4FR0A 5JUWA 2NP7A 4X63A 3C6MA 1ZGAA 2ZSUA 3FYDA 2O05A 2P1DA 3ID6C 3KPJA 4IV0A 2Q41A 4RX1A 4QDKA 5FHRA 2PY6A 4KVZA 2OYRA 5BXYA 2YXEA 4CTKA 3KR0A 3LBYA 2HMYB 3MAGA 3DXZA 4FZVA 5DRTA 4CXMA 1VLMA 1SUSA 3R9XB 1Q0TA 5P8WA 2AZTA 3KR1A 2PGXA 3S68A 1ZKDA 3B3GA 1M0EA 3G5TA 1R74A 1D2GA 2P35A 4PYNA 4QPPA 1VBFA 3FRHA 3ELUA 4ER7A 3C6KA 1N7JA 3MTEA 3NVMB 5LQNA 3TR6A 4AUKA 2IH5A 4A6DA 2IFTA 1F38A 2YUIA 1NW6A 3FPEA 1VE3A 1KYZA 1NV9A 2AOVA 2BZGA 3EGIA 3SSNA 4PYJA 2EFJA 2YVLA 3LECA 4OA5A 4YV2A 1R00A 2P3QA 4XUDA 1U2ZA 2XYQA 2XBMA 2PXXA 3T7SA 5EVJA 3FPJA 1L3CA 1HNNA 2P7HA 3AJDA 3G89A 4DF3A 1FP1D 1VPTA 2P3LA 5FADA 5LSAA 2NYUA 5CIYA 3MQ2A 3OPNA 5CM2Z 5K03A 1QAMA 1T43A 2XYVA 4IV8A 2V74B 4QTUB 2UZ4A 3KQSA 3KR9A 5DTQA 4E33A 4ISCA 1DCTA 4FSDA 3FZGA 3UZUA 3UBTA 2YX1A 4KDRA 2LD4A 5DXJA 5EC8A 4FT2A 1HMYA 4EVIA 5DM0A 4OA8A 5EQJB 3GGDA 2BR4A 2QE6A 4P7GA 4PYKA 3G2MA 3BT7A 2ESRA 3FRIA 4E2YA 1FJXA 4OBXA 3GRZA 4EKIA 4MQ4A 4OQDA 4YUWA 2HR1A 1RJDA 2PT6A 3HVJA 4YMHA 4PINA 2ZLBA 3HVKA 1XDUA 5HOQA 1VP9A 3LCCA 4LWPA 5FULA 2EJUA 3CGGA 4X41A 3PX3A 4M7RA 2OY0A 3NWBA 2YXDA 5DPMA 5E9WA 3GCZA 3HA3A 4WVLA 5K0FA 1IXKA 2AOUB 2DULA 4OQEA 4PCLA 3UA4A 2ZWVA 5EPEA 1WXWA 4DCGA 5BP7A 1M6EX 5ICGA 4FSXA 4YUYA 1ZGJA 1ZG3A 3M6WA 5FA5A 3HM2A 1PRYA 3OU2A 3EMDA 2OZVA 3OZRA 3WSTA 2FK7A 5K0LA 5EMMA 3P9NA 1WG8A 3EVDA 3P8ZA 4C05A 4ER3A 5E8JA 2ADMA 5FCDA 3VC2A 1MJFA 3BWYA 4FP9A 2AN4A 2VP3A 2ORED 3I64A 4QVKA 1MHTA 4PYMA 3LGAA 1JTEA 1QAQA 1X1AA 2QYOA 4PIPA 3BXOA 2IPXA 3E23A 3FUWA 2IGTA 3KQMA 4RTQA 4RTSA 2H11A 3FPHA 5T67A 4GOLD 4XUCA 5K0BA 3G8BA 3MTIA 1UIRA 2PKWA 3I58A 3JWHA 2YQZA 4QVGA 4PNEA 4YUZA 4AZTA 3C0KA 1OR8A 3HEMA 2HV9A 3M33A 3ORHA 3P97A 4E31A 2Z6AA 2H00A 2IDKA 2ZTHA 1KIAA 2PSSA 4X61A 3GDHA 5ERGB 3VYWA 5KS2A 1P1CA 2FHPA 5FA8A 3DR5A 4KWCA 4RYLA 5E1MA 3ER9A 4Y2HA 4FT4A 3LSTA 4HRAA 4RVFA 4PIMA 3I9FA 2H1RA 4ATNA 1RJGA 4C04A 2FPOA 5K09A 1EJ6A 3TMAA 10MHA 4GC9A 3PS9A 1TPYA 1I1NA 8MHTA 4UOEA 1DL5A 4HGYA 1SQFA 3EGVA 3EVGA 4AZVA 3KPWA 3L8DA 4HH4A 5HIMA 4EMSA 2QM3A 3OU7A
chains in the Genus database with same CATH superfamily
2QB5A 1KXZA 3GNQA 1Y3HA 4AYTA 3DBHA 2O6HA 2WKPA 3HCCA 2FDRA 1S6YA 2Q8QA 3GZNA 4QYTA 1XJCA 2RHBA 3M5PA 2J4DA 2DUUA 2Q6OA 4G23A 2FOIA 3IO3A 5A7FA 5J43A 1TCCA 3CB2A 2DCUA 2JIMA 1VL2A 4FK8A 1WXEA 3MQFA 4G4IA 4WDRA 5LP6B 2C7OA 3PWZA 3FTEA 2ZT8A 3UB2A 3UTDA 5LP1A 3CLRD 1QWSA 1DTSA 1JKIA 3FFXA 1P7ZA 5A6SA 5TB5A 1Z8FA 2RH9B 2X9QA 3F74A 1V8PA 3O6VA 1DADA 1SU6A 3GUVA 4RNCA 2I7XA 1GNTA 4Y6GB 4IHQA 5D86A 2FZWA 5DH9A 2NU9B 3USCS 3UJNA 4MA0A 4R71A 2VJOA 3E5RA 3D3WA 4FGWA 4HX9A 4LBWA 1B15A 3ZU2A 2PUWA 5KX5A 3PQEA 3U4MA 2C83A 3FNIA 1YA6A 2ZJ3A 4DAEA 4ZV9A 3UAVA 5T4FA 1YQGA 2FPUA 1SKMA 2GWHA 1YZQA 1V8BA 2WU1A 3HUEA 4HB3A 3RTCA 4CMCA 3I2KA 4UNRA 1JEAA 3ET4A 1NMEA 1MJHA 3EAGA 2VJLA 1LJLA 3EQ6A 2X0RA 3MJCA 1FQJA 5H02A 3ZWBA 4YAIA 2PIDA 2VR1A 4B7ZA 3LVBA 3TSOA 3RUEA 3HEBA 1N0VC 1TGVA 5HM8A 1T34A 2V7QD 2F1RA 3DHVA 3U4AA 1BS9A 1E2QA 3FVTA 2EX4A 3WOVA 3T9FA 4RHXA 2PS9A 2YHAA 4RD1A 4F5EA 3RPEA 1EA5A 1KO4A 2BKAA 1ENPA 3E9QA 4CKEA 3DMYA 2CUZA 1N0UA 1NVVQ 3MYYA 2MHCA 1NKTA 1UBEA 4G5QA 4DVJA 1XU7A 1U9CA 2ZP1A 2XUAA 1ZGBA 2VP9A 1Y6GA 4YLEA 2BFCA 3L6EA 1VI2A 4UUNA 3H9QA 5KI6A 3AY7A 3ZEAA 4CMIB 3HN7A 4Q15A 3N6VA 2ZM6B 1OAKA 3UHJA 3WB2A 5EZQA 3VNQA 3RRZA 3H2BA 1LLCA 4IGAA 2XVYA 2YOGA 1RMTA 3ZV4A 4OH7A 3RTBA 4D3FA 1HORA 2RH4A 2HMTA 1RVDA 3TSYA 1RXEA 1PF7E 4YAOA 4C3VA 5D5PA 2COUA 3L77A 3IRVA 3RU2A 4J1NA 2O2CA 4TYPA 4CIYA 1ZJZA 2JK0A 3A36A 3P52A 2ZR7A 4LJ6A 2DWQA 1B3BA 1MW9X 3QVUA 4I2NA 5E6UA 4BHTA 3KFVA 1BS2A 1BFKA 1WIWA 3DEHA 3G0BA 1OLUB 2FAXA 3ZBPA 2GK3A 1MGPA 2WD8A 3GLKA 3VKWA 3Q7EA 4PRYA 4QTZA 1RTTA 3IIJA 1BHO1 2BCJQ 2IXAA 3I0MA 2H4YA 1JLLB 3BXPA 1T0IA 4I2VA 4XVHA 2UZIR 3FMIA 5LKRA 4P34A 2G4CA 2F9FA 3G5MA 3DQQA 2QTGA 2VXYA 4NJOA 5BUQA 2QORA 1CUJA 2LR0A 1MTZA 2WHRA 3OA0A 1CFZA 3IEVA 2O54A 5A0TA 5IM4A 1DV2A 2IODA 2E4AA 3O4VA 3PZRA 1ZWLA 3VDQA 4ZXPA 4D0RA 2QE7A 1GTRA 4XX1A 1EBUA 1W581 2FN4A 4W8GA 5K3EA 4X7BA 2I2XB 4L9SA 1L4FA 2VHCA 4BQRA 3C3JA 2EKBA 4A0SA 3JASA 1MV8A 3EHEA 3NBYC 2ZW9A 4ZO4A 4AG6A 1OAOC 2XOEA 2G9RA 4BBZA 3I1JA 4HB0A 4RK4A 4YQZA 2A0KA 2Y77A 3WGUA 3I1FA 3Q98A 3ERCA 1UMDB 4PCUA 3THWA 2G09A 2X2EA 2ZIFA 4EVQA 3GGSA 1OBFO 1FLAA 3U3OA 2QZ9A 4FLEA 4PHHA 4YT4A 4RTRA 2BKVA 3BWCA 3V4FA 5IK2D 1HTTA 4NXMB 1CUHA 2E85A 4X20A 4X97A 5H68A 4MPPA 3DTVA 4UCWA 4M98A 2FX2A 5KDLA 1T1EA 1YHZA 1WMBA 1EDOA 1TO1E 3VPAA 1X8LA 2RK3A 5DTRA 2ZBFA 1NBAA 1DS6A 3QOFA 2HSJA 4XSGA 3DEZA 4FE7A 4GBJA 3KSRA 5AI6A 4A15A 1JFTA 1AF4A 3EIEA 5AW2A 2JANA 1N3IA 3RTDA 4DMMA 5IDXA 1JFFA 4L15A 1C8LA 3OMWA 4D41A 4JVLA 1H5NA 4GKBA 4YO7A 1EVQA 4AJEA 5E2AA 3N2GA 1R0WA 1J0EA 1D2NA 2X13A 3CRVA 3D8NA 4JGGA 4K9DA 1THZA 2RI6A 3KPVA 1J9ZA 4FOSA 4OMUA 1RU3A 5KJFA 1JFLA 1GTZA 1NI4B 4S1NA 1C50A 1LLQA 3RADC 1X80B 5EE1A 1XNHA 5EJ2A 3HCDA 5CXSA 5IUNC 4S24A 1T5TA 2IVFA 3TS1A 4CMAA 4CM9D 1C7RA 3QWAA 5LBIA 3ZOKA 4EPVA 1B7GO 4UUBA 3KB8A 4GS5A 2XT6A 4DBLE 1LFDB 5JYEA 4NV0A 2AUNA 1FUYB 1B2LA 2AG8A 2AJLI 3X3HA 3AO0B 3QBJA 4MPTA 4GEKA 4H27A 2XOKA 4AJKA 4CODB 1FBNA 2FHSA 3QLUC 4D96A 2XE8A 3E7FA 5TNXA 5KWSA 2C95A 1P60A 4BECA 4JCOA 4RU1A 5TMPA 4MGYR 3S3TA 1N5RA 5H8WA 1AGXA 4Q3DA 2OILA 5DWVA 4BMXA 1Y7LA 2WZCA 3PDCA 5B2EA 2XXJA 2POCA 5JAIA 1ZK4A 3R0VA 3VKFA 5KYUA 3IHTA 4MP3A 1V8DA 5ITVA 2N9UA 4P4GA 4QELA 5C3MA 3H1PA 4AAYA 3KHSA 1RC1A 3CTPA 2JHPA 3MFQA 3H17A 4MDFA 2YWBA 2QN3A 3L4EA 3T6KA 3TXAA 1LBTA 2VRCA 4FXPA 1UBLS 2YHUA 4XX0B 5DNWA 5H3HA 2REQB 5L4SA 1KWKA 4OXNA 5KYYA 5HJ2A 5BVHB 1F3LA 3K9CA 1O94D 3MYRA 3UMJA 3VSCA 1UT8A 3QUCA 1JBEA 4M0CA 1JIKA 5E7MA 2GB4A 3TRIA 3PJRA 1Z2NX 1RSZA 2BFBA 3RVMA 1NLFA 3KLOA 2Z95A 1DJOA 3GO4A 5HQJA 3QH4A 5F4BA 2QX8A 1VMEA 2VLBA 1GSHA 1T36A 1H2RS 3RAGA 3D4IA 3LXRA 2PU5A 3ZNOA 4DMFA 5J4VA 2WTNA 1PSZA 2QY6A 3S2GA 5LNK6 2P9JA 1PG5A 4F85A 3UMSA 3M5CA 4G0MA 4N4AA 2WUFA 3PEVA 4N7MA 2W6ZA 3BB1A 4KQJA 3NTQA 5HS4A 2AKAB 1VXOA 3F8TA 4WCDA 2PD6A 5KDDA 4IGKA 4ND8B 1YR9A 3JVIA 3ROEA 3BOSA 4WLVA 2VG8A 2ZRGA 3QWIA 1MT0A 4UAUA 3G3EA 1VDZA 3TZEA 4YAKA 4W9NC 1JL3A 4MRAA 1O7JA 3T9EA 3L40A 2AQKA 1KYXA 1SGWA 3NWJA 3N0TA 4KQ2A 4C1NA 2X5KO 4IQ8A 2G9NA 2I6QA 3H97A 1AKMA 2VNSA 1CK4A 4CEHA 1G0OA 4OUKX 2ZKIA 4C76A 3ZCVA 1I2MA 4OAOA 5C5DA 4BQOA 5AM0A 3FOAA 4B6GA 2WYOA 1ECPA 2OV1A 5HGJA 2A5FA 4KRYA 3FCXA 1PHPA 2WYIA 3RH0A 4ZQCB 5GWXA 3W5DA 3W6NA 2JAHA 3BQ9A 3QY0A 4ZMBA 4Z3OA 2W90A 3QUBA 3B1FA 4AMVA 4URVR 2BHLA 1JQ3A 1DT5A 1R9JA 1U0LA 4QWMA 5DEIA 4FZ3A 5KYGA 5E6RB 4TMVA 3KKLA 3OLQA 3GGGA 4PC3A 1YQDA 2PQ2A 4IZOA 4HP8A 4DDVA 3I1YA 4WZBE 1Q2UA 4MMXB 3DUFB 4BB9A 1A9RA 4NBVA 5CA0F 1NUQA 3ITDA 1Y0BA 4QXOA 5AQEA 2YWCA 3HABA 3MMPA 1MC1A 3LO5A 3PPIA 5L6LB 5JSHA 1FUEA 1ZNYA 2R5WA 4NARA 3HO1A 2Y0PA 2BEVA 1U1FA 3NANA 2GPSA 3DDSA 3QVGB 4ND1A 4PLZA 1HMPA 3O8DA 1G7SA 3S28A 5KB3A 1J5EB 1Y5IA 1KKMA 3KQVA 1E6CA 1X1DA 3GLIB 1R18A 1TA0A 3EMVA 3JQAA 2CNKA 4FNOA 3SVZA 3L82B 4GM0A 3GJ8A 2E9SA 1HDGO 3ZGZA 1GPNA 3RG2A 1EIZA 3P96A 1NOKA 3IAS1 1PQYA 4C0WA 1JECA 2ILTA 3R40A 4MRMB 3P0HA 3Q3HA 2C4TA 4NZMA 4B33A 2A1UA 1NXOA 2RGCA 2OZKA 5TJHA 3DXYA 3N1UA 2AV6A 2DCMA 3TZKA 5KBYA 4ZOCA 1ICIA 4C21A 1L4KA 1W35A 3AB8A 1PG2A 2MR6A 3CX3A 3KCNA 3NRCA 5GONB 1IY8A 5BQPA 4NCNA 3HYCA 1W4LA 4RACA 3IAFA 4FNMA 5FOWA 2B5OA 2AMFA 4K9KA 3SNKA 3T06B 1V1RB 3WC4A 4BMZA 3QVLA 4OHCA 1KARA 4UQPA 4XQCA 2DPMA 1MN6A 5JEEA 3K09A 2NPOA 2Z4SA 3O9VA 2XYRA 4IINA 3D6AA 3N7TA 2GTIA 3CR7A 4JGIA 2FQWA 3GFGA 4NKRA 4Z54A 4F1JA 4ZFNA 3T5PA 3BCHA 4M0KA 4CQMB 4E08A 1E5LA 1POWA 4QNNA 5FWYA 1O8CA 1PFVA 1T2CA 2G1UA 1X8JA 1FDSA 5HBRA 5ILGA 1XMIA 3RVKA 5LYJF 4S35A 2H1FA 2QV7A 3WFIA 4AZWA 4XM1A 4J3JA 3LKBA 5GOZA 1JHAA 4E15A 5FV4A 1QFSA 2Z2KA 3C3YA 4Q05A 4EUNA 2FG6C 5CCBA 1QVZA 5MFPA 4O2AA 2WR8A 2EHDA 3U39A 5CFRA 1SBQA 2B7LA 3IFSA 1XZNA 3AG6A 3KOUA 4EY7A 5JUWA 1DAIA 5JD4A 2A3RA 3ZIUA 2ZSUA 3FYDA 4IV0A 2VDNB 2GN6A 4BMCA 4I5IA 1RP1A 3F1LA 3QKSA 4JP1A 2OYRA 4H4DA 1IZ9A 3PFBA 3LBYA 2E4XA 3AR5A 4CLOA 3T54A 1R0KA 2REXB 3MPUA 5FH9A 1I14A 1A9ZA 1TM2A 4LE2A 4DL9A 1WM1A 3CINA 4ZZ3A 3KR1A 3UGKA 2DH5A 3NATA 1JFSA 3X1MA 1B3RA 1R1DA 3JD0A 2HHHB 3DWGA 1X9HA 1ZISA 3KLPX 4HDSA 2Q8NA 4R2LA 4LSMA 1W7AA 1V6CA 1QOQB 2ZUSA 3QLEA 5DTIA 1XT6A 2YUIA 3K2IA 3S2FA 3EGIA 3ZVMA 3EXFB 4MWOA 4TXNA 4QU5A 2EZ4A 3FYTA 2E21A 1KZ1A 2FZLA 3R20A 5TC4A 4ACAA 4ADSG 2PUCA 3OWHA 4NEQA 4G3XA 4B3XA 5JANA 2HDNB 1ZONA 3TLBA 4CCYB 4J4TA 2W2QA 3V7FA 4R7ZA 1QLHA 5J5AA 1DE0A 3C3BA 1C1DB 4K8RB 4P4LA 1GADO 5DGCA 3U40A 3MQ2A 5D87A 1ETUA 2VK8A 2F17A 1QAMA 3IVAA 1QIMA 1T6BY 5KREA 2OP1A 2JD2A 3MUEA 1DO8A 1RJ9B 1SG0A 4EJSA 3I45A 5IAAA 4L0QA 4LZAA 1ES9A 1SCBA 4IDBA 2MYTA 1K0FA 1OTYA 3TTXA 4MKHA 4BQSA 4CL2A 3D8TA 5IXSA 3D6JA 4B2LA 3LZ6A 1XZEA 3I73A 3NHFA 2X5OA 1N1EA 1SULA 2VYVA 3HY4A 3OQPA 2ONCA 3PVZA 1O0BA 1Q83A 1QU3A 4YCBA 5G0SA 2ECFA 2MSEB 4JLOA 1Z5GA 4PPFA 2FP4B 2JIRA 5CH8A 5HTKA 2ZSIA 5KMGB 1FXUA 4BNUA 3UG6A 1G8GA 3M89A 4X41A 4ZVRA 2A9OA 1Q5PA 3ZE8A 4REOA 1E2FA 4BB5A 1L7VC 1HI9A 4HB4A 1G4AE 2Y4NA 3AL2A 2C2BA 1I6MA 1ODLA 3E18A 3BFXA 1JHPA 4RSGA 4BNKA 2JAWA 4E46A 3MJTA 1R5OA 1HDIA 4BXOA 1DU4A 3K0FA 2NACA 2UYYA 4AO8A 1SCJA 4RGYA 5EMMA 2J4FA 4RQTA 1BWQA 3OPVA 3F67A 5J1SB 2AG1A 3H6GA 2HO4A 4KV7A 3VC2A 5JCJD 4B6FA 2IUYA 3ZJ5A 4MRRA 5E0KB 1FMCA 3NG1A 3OIDA 3BFVA 4PIPA 8LDHA 421PA 1DX4A 1F48A 1HTBA 1MUUA 5L3QB 9GPBA 3WLEA 4AKEA 1M75A 2XMBA 4HMOA 5I4KA 3D7MA 4GOLD 5EINA 1DXOA 3D81A 3W3AD 5JS8A 1XMVA 3LX5A 4NCKA 3EOZA 4B3DA 1Y3CE 4W8OA 2I8AA 1JWLA 1YL7A 3O92A 4INOA 4YRQA 2J1LA 5EUBA 3KXIA 1OR8A 2OG1A 3HU5A 3KU4A 2V0GA 3HJFA 1OI3A 3B85A 4ZYLA 2D0IA 4RJTA 4AM8A 2A0XA 2JAUA 4EGSA 4M7PA 4XH9B 3MCWA 5C7YA 2QUIA 1FEZA 4PIMA 3VOAA 1SWWA 2R5NA 2K6GA 4XWOA 3TLYA 1EESA 2FJ0A 4NCJA 2JKYA 4F72A 5AW6A 3AI1A 2QTVB 4D02A 2P4EA 1J5PA 4TZ0A 3Q4GA 5ERYA 3DVAB 4C06A 3ASZA 2G28A 5I9SA 3EOBI 4XQ9A 4HSEA 1NJGA 2C9DA 1CU1A 2GHIA 3LVRE 1WB4A 2EWVA 2X1LA 3KQOA 2GNPA 2QXTA 3MRSA 3Q0TA 4H3HB 4OL9A 2YZ2A 3MQ4A 3PT9A 2GA8A 3SXUB 2XRMA 2G67A 2A9VA 2OBXA 3UMVA 4LJRA 2EFGA 5E7JA 3UPTA 4FMDB 3HY6A 4O2RA 4K46A 5TR9A 4LRWA 2IPLA 4JB2A 4KQIA 1LD3A 1ZN2A 3QQPA 4X8MA 5TF0A 3VISA 3DOFA 5LQJA 1EJBA 2R47A 1F2TA 1SG6A 1UOPA 3P2MA 2VZ8A 1X7XB 4HH0A 3THOA 4JI7B 4H6WA 3RFTA 1J70A 2VDVE 1R6BX 5C5IA 5I7RA 1NXPA 1E69A 4GKAA 3AVTA 1Q21A 4YJHB 5KVCA 4DA8A 3P5SA 1D5CA 1NJFA 3L8GA 2HSWA 4Y9DA 3QW4B 4RHUA 3ZCXA 2V7TA 3H4TA 4D45A 2RI1A 1PN3A 2I7CA 3MAAC 3KDSE 3TZHA 3WNZA 2AD5A 5BSTA 3RREA 3QV2A 2IKQA 3D0KA 3IE1A 3PE3A 3HCNA 1M2JA 1N6NA 3QTBA 1TEXA 4G4GA 1J0AA 1E9DA 2BE9A 3KEGA 5LA6F 1PBNA 5DM60 1MHPA 2ETVA 5JASA 4F4FA 4BO6A 2WWVD 2Q3JA 4NDNE 3SKXA 4GECA 5JQWA 1L8AA 2Z8XA 3USZA 3WRXA 1ML4A 2TYSB 2JGKA 3AEYA 2O7VA 4DJTA 2FVYA 1CB7A 3HJBA 3KZCA 1H1LA 1Y6RA 3W3ZB 3QVWA 1GDDA 4ZCPA 5K8JB 3DBOB 4J0EA 1M2FA 4FQ5A 3OBBA 2DKNA 1ZITA 1XQ6A 3O9MA 2OZEA 4BL5A 1U6IA 3OLWA 4PIVA 1MVOA 4ZCTA 4P8RA 3G1TA 4M89A 3THXB 3PE6A 4CFYA 1YCHA 2H0RA 1Q7RA 1TADA 3H8VA 2NXCA 2GN2A 5D3MB 1HKUA 3SR0A 3D1LA 3ZDCA 4RXUA 4DLTA 2CMGA 1NQVA 1TNDA 4D8YA 4EG6A 5CDGA 3OZBA 3BJMA 2Q2OA 3LM8A 4OB7A 4R1UA 4YJFA 2AEJA 1AHPA 5HOEA 5KTTA 2B30A 3WWDA 1CJBA 2JHGA 4B7UA 2Y3IA 2YYSA 5JJBA 2YZMA 4S1PA 2DLCX 3MWEB 4GLFA 1IBMB 5JR3A 2HHLA 3JARA 4R2WA 2I8CA 3KOWA 2P27A 4B09A 2FEAA 3K1YA 2PLAA 4WFKA 5IN4A 2QTFA 1QZ3A 3VBEA 4U02A 1Q50A 1RJFA 4NBTA 3QPCA 2FUCA 2PGDA 5GGXA 2BWJA 3JWIA 1HYEA 2DBZA 2V4ZA 3JATB 2QVGA 2Y76A 3IPLA 4GI3A 4H35A 4PW0A 3U1BA 1AQYA 1QYDA 1HE3A 3Q11A 4PPYA 4GM1A 4B6EA 3AOEA 1X9IA 3HDHA 1GAQA 2QD5A 4OQXA 3CRW1 1T1RA 1H2YA 1M3SA 1T91A 1Z0JA 2VQ3A 3CG0A 1T3TA 3COZA 2HRCA 3F4BA 4TGLA 3HZOA 1ZUNB 3H9CA 3ORQA 2LTAA 2QKYA 1CJKC 2ZU0C 2O9JA 3EPPA 4J07A 4JVOA 1J24A 1YB1A 1ATIA 3CUVA 4RHFA 2R84A 1Z4OA 5D7NA 5GTDA 4JJIA 2QBYB 1JAYA 1MA3A 2WAXA 5J59A 3CLTD 4JBLA 5DM2A 5H83A 3RAPR 3F5DA 5ALUA 1GSAA 2CXOA 2JH8A 2OOSA 4NIMA 4A4DA 4BCDA 3QITA 1DJMA 5IAKA 4BLWA 5FWNA 2UXBB 1OHHD 4CWAA 3GNSA 3MGGA 2JDID 3OFNA 3MELA 4ZMRA 3JQCA 1Y98A 5CHYA 2KPOA 2QRLA 2OBLA 2EL7A 2HU5A 1UFOA 4L50A 4YP9A 1AQNA 1UXHA 2GD6A 3CGWA 3TQRA 5FBWB 3UWOA 1G4UR 4W4TA 4O4IA 1UFQA 3C5WP 1NN5A 5EYPA 1JJBA 4H2DA 1VJDA 4GPAA 4TV9A 2H85A 2J30A 3OFJA 1XXHB 2WT9A 3B3AA 3DGEC 4ZOEA 1ULUA 5FB3A 5IC5A 2WMOB 2PHZA 2ZUFA 3L7CA 3D6TB 2Y8EA 1PR4A 3LT4A 5CD1A 1WF3A 3KL2A 3HG7A 3TIFA 2AX4A 1OYYA 1D9ZA 3SQXA 4EUKA 5IKXA 2NO6A 1QTNA 4F5WA 4YVFA 2VZLA 4Z99A 5IVIA 2O5RA 2ZZKA 3PNVA 1MG0A 1AS2A 2VDOB 2Q8PA 3H5RA 5AD1A 1S2MA 1IN4A 2AN5A 2XADA 2IUFA 4BLUA 4DILA 3ZDDA 3BIJA 5K0GA 2W2NA 2VCEA 4NMMA 3TPFA 1TQ8A 4W8HA 4L8GA 3WLJA 1YZKA 5F35A 1Z22A 4UPVA 4CIWA 5KNBH 3SQWA 1CBUA 2QA5A 3A9CA 3B9RA 4MKGA 4M38A 1QC5B 3ANMA 1FU7A 3AMVA 4R0NA 1HKHA 2DUNA 1P6XA 2NWQA 4E32A 2GBPA 4N12A 4KO2S 1X1SA 3N2ZB 4LKRA 4OLHA 1FMJA 2PD3A 2W22A 1DCMA 1J0CA 1XD2B 1FDWA 3QBEA 4OAPA 4RVUA 1SZJG 5HTOA 2BKLA 1GT6A 1QGOA 3CSUA 3RW9A 1V71A 1TCVA 2WP0A 2IY9A 3K09C 3MS2A 3SN6A 1E3DA 5JO9A 4EO4A 7REQA 1H2BA 5LQAA 3P4UA 3VKHA 1JHYA 2BMVA 3AVPA 4F60A 2JCVA 1RCTE 3PQ8A 4WECA 3MGKA 5DNAA 2A78A 1UBJS 2KQUA 2GPNA 4FFRA 4BZQA 5JATA 3PQDA 4Z0TA 4CF6A 1NVMB 5DX8A 2BOVA 5KNDD 2ZWIA 2B2XA 1BQEA 1HM5A 3L4BA 3HGTA 3Q5EA 4HBZA 1JHMA 3AWDA 2VP0A 2R5FA 4MUEA 2OGSA 3G0DA 1RI5A 2X4IA 4MWCA 1ZNQO 4RM3A 3RC1A 4NPAA 4BPRA 2BIFA 1K6MA 1MAVA 5TY0A 4I1YA 3V8PA 4Z4FA 4P08A 4ZVUA 4Q9AA 2G9ZA 3FDIA 4KXQA 2E5FA 3SY8A 4EG3A 3FFBA 3CNOA 5D1HA 1M2OB 4ZQEA 4ZHQA 1VHJA 3SOZA 2ZG6A 3QNUA 4NJEB 4MJ3A 4CT0A 1XPOA 1CS0A 2WNIA 5D5HA 3OJEA 1V8FA 2D1RA 3NHWA 3ETDA 1QIJA 2J07A 4Q4HA 4WCFA 3TXXA 2OHHA 3M3PA 4UEJA 1RKBA 2XKJE 4GO1A 3OJXA 4IDPA 1KS9A 3ETHA 4FX2A 1OAAA 3TEJA 3DE1X 5FXMA 5K8UA 3BE4A 4GP7A 5LXTA 4NECA 2W4IA 1YGYA 2DRIA 3EF1A 5DNCA 4XYBA 1QH0A 2H2DA 4G1MB 3SBXA 3HDYA 5CFOA 1LDNA 1G7RA 5IFKA 1JT2A 1X92A 4QGAA 1Y5NA 3PDJA 3SX4A 3T3HA 3VR3A 2EG9A 3NP7A 2NU6B 5DCWA 3SXJA 3IXMA 3V4ZA 2BBOA 3ESCA 5DBOA 4NMWA 1RCFA 3PUIA 3MD0A 4PYIA 3W7AA 2HHCA 3L7DA 5F2NA 3I09A 1SUEA 2XTJA 5HIIA 4Y2QA 2MU1A 4EJSC 5JZSA 4AN1A 2ZI3A 2B8EA 2YW2A 4IIYA 4RJLA 3LKZA 4RJIA 3LUPA 3U4GA 2OK8A 2NTJA 1MAHA 5AK3A 1B6RA 5KQMA 4ZRDA 3ICQB 1NF9A 1YOVB 2GOYA 3LK7A 3QOWA 1WHTB 4LDAA 2OHXA 2JNWA 3D0QA 1C3OA 5BN5B 3S44A 5MGNA 3SQOA 1Y48E 4RMHA 3OQIB 4TVKA 3LU1A 1PU2A 1DQZA 3GFSA 1QF7A 2AYXA 3FOCA 1XRMA 2BMAA 3RRYA 2BDUA 2ZUTA 3NDPA 3AKCA 3ZR4B 3VTAA 1U1EA 4OFBA 2XQKA 1FZTA 3D7RA 4LC9A 1UZUA 1G20B 2EL9A 2EP8A 5BO5A 3UUEA 3LXXA 1J42A 3AY6A 1ORWA 2A0WA 1G6HA 1Z08A 4Q0MA 3V7WA 3STHA 3B1KA 3OQNA 1ZPDA 3CRMA 3L7OA 2OXRA 2BSQA 1IQUA 4LHSA 3MB8A 4C6RA 1KK1A 5L53A 4UEKA 5HK8A 5DGHA 4XGRA 4A91A 4A8JA 1GL7A 4LDZA 3OUUA 3QU5A 1QRSA 3H0KA 4JYBA 3SFVA 2ZTLA 2JFQA 3KV3O 3GDGA 2PKYX 1DBVO 3DQPA 2EXXA 3WHPA 5HJ5A 5KOIA 4MVXA 1GN8A 1QYWA 3FBGA 1KEPA 5DHPA 5CA0A 4LFCB 2Q9AA 5KOJB 4KV9A 3RV4A 2HYDA 1IVYA 4AJOA 2UU9B 4KSCA 4PYOA 3FYSA 1KERA 5EN4A 3WYNA 3ADDA 2IJGX 1LBIA 2HMUA 2IZ1A 3DDWA 4CKXA 4Z7JA 1SUDA 3LOPA 2J59A 4A8PA 4U0JA 1XTIA 5EKSA 4HH1A 1IJEA 3L7JA 1RRCA 1P7WA 3HO8A 4LECA 3GBSA 4N1AA 5CA1A 2V3WA 3CPEA 2D7DA 3L01A 1I4EB 4G01B 5AVXA 1MA0A 2VDRB 2F1IA 1IG0A 1OKKD 4WKGA 3AJEA 5IAEA 4EKDA 1R0SA 4DR4B 1XD9A 1DMRA 4EBFA 4OB8A 1MNAA 3PNYA 3SJCA 1QRRA 1U6JA 4BN5A 4G4SO 1P2SA 1E4EB 5C7LO 1D03A 5EJFA 4I3HA 3W05A 2I3AA 4IDCA 3I2YX 5BPHA 4XEUA 1O0CA 3EX7C 1NG1A 3ONVA 4JLDA 3CE6A 1TJ3A 1U9ZA 2DTXA 2QEQA 1CG6A 3RSLA 1OH8A 1NHGA 1WR8A 4I9HA 5DHFA 1BE6A 2F43A 1UOOA 3OZFA 4CN8A 1C7JA 3CZPA 4NMLA 3B6KA 4QHTA 1Y5RA 1I1OA 2B8WA 4IX9A 1NRWA 1JR3A 2P2CA 3QU7A 1WMFA 1ZIPA 3DE2X 1GLNA 3H2GA 3QWFA 4QO8A 4AN4A 1EE9A 3ZE2B 4EZEA 4DLVA 2YXEA 2OC9A 4MP8A 2D7JA 2FZCA 4TXLA 1ZEMA 4OD0A 3UUWA 2JA1A 5I9LA 4NULA 5DV9A 2NTNA 5SYMA 2VTVA 3EEIA 4CI9A 1H3NA 4QDTA 1O97C 4GX0A 5CR9A 5K45A 5I6DA 3C85A 2ZI4A 2E6UX 2MINB 3AERA 5LL6P 1B76A 3BEOA 1MO4A 2K87A 1ZO8A 2K2WA 3GRAA 1EE2A 2C5FA 2C4UA 3TTVA 1LRKA 3SF8B 3QPBA 4XI9A 3WK7A 4PO1A 5H3LA 1LPOA 5MN4A 2FI1A 3TTUA 4A0QA 1JIQA 3ZLBA 5ICSA 1DVRA 5LB4A 3FDZB 4B79A 4RF4A 4J9VA 4N9QA 3TZQA 2V96A 4LJ7A 4DWWA 5K03A 4BNYA 4UHCA 3YASA 4EELA 2SKDA 3I42A 3IUSA 4QTUB 3U3JA 4NU5A 1NOJA 4RESA 1A4IA 1CUWA 3IT3A 3FNBA 3IL2A 1E2PA 5K4AA 3T7KA 3H3XA 1U80A 2QJWA 3PFFA 3IOEA 1BXKA 3O73A 5EQJB 4H0CA 3KM0A 1L7RA 1TF7A 1I7NA 1NC1A 2YHBA 2HFKA 1CVRA 4PVDA 2PKQO 5HUHA 2CUTA 1JEYB 4FE3A 1UXGA 4OQMA 2EDCA 1W0JD 3SBOA 2ZTSA 5JXJA 2ZLBA 1JAIA 3LCCA 4TKZA 4TPKA 3R8FA 1V7QA 4NS4A 4IJQA 3E5HA 3HPRA 2R0QC 3PX3A 1D07A 2VJMB 4JP2A 1QO0D 1J25A 4V2UA 5F5LA 4YONB 3TRFA 4DKXA 2FFAA 3LX4A 2ZWVA 3RABA 1KI1A 1WXWA 1NP7A 1T25A 5JPIA 1YCFA 1SC1A 5BP7A 1UFRA 2BGTA 5TLSA 4NCIA 2C2YA 2QGZA 2KSQA 3OU2A 2ZYGA 4MI3A 2OZVA 3W7BA 1OV4A 3Q88A 2P9FA 1TUBB 2P4QA 3QK7A 4HDRA 4OGFA 1RIIA 2A5YB 4TM8A 3H2ZA 3ZZTA 3K0CA 2JI4A 4AICA 4B40A 4EB0A 2MYUA 1MJFA 5B6IA 3AU8A 1RBMA 4PWZA 4PYMA 2A1TR 3WLRA 4HNGA 3C3CA 2AQIA 3OPYI 3ESQA 3ZLTA 2DLNA 2OC4A 3AP2A 2BKEA 1IE3A 2Z0MA 1Z4PX 4CHTA 1K6XA 1PNRA 1CJSA 4Z0NA 1IH8A 3TECE 3C2QA 1UKEA 1RD4A 1GUAA 1A72A 1P29A 2POQX 3AOEC 4E5SA 5JMWA 3L0PA 4IIFA 1UEJA 3PGJA 2X58A 2I1QA 4ED9A 4U7DA 5G4KA 1DBIA 3RFFA 3PNMA 3TLMA 3LUAA 3GH1A 3B5EA 4ILKA 3AL3A 4NYJQ 4QDZA 5IBQA 3LFTA 3M6FA 1G3RA 3OOSA 4FT4A 4Y2HA 3D3NA 4UHHA 3WRYA 4CM1A 2H1RA 4GX1A 2JIZA 3NAGA 1XTSA 1RWQA 4RIHA 4F1WA 2OORA 2IUTA 2KHZA 4L5AA 2HLDD 3GXBA 2ZIXB 10MHA 1TPYA 5CCDA 5BPFA 1MPTA 3CVJA 1XQXA 2J3HA 2C92A 4DSNA 1QV6A 1I2DA 3VA7A 1UKCA 4ERXA 5AIBA 2VJQA 2B1JA 4N6GA 4ZD6A 5B6PA 1GYQA 4KC0A 2ZT6A 3DAFA 4FEYA 2W2PA 4G8CA 1FX0A 3QE2A 2JK1A 1EXWA 4QE3A 1D09A 4KN9S 5IYZA 3SZOA 3NHUA 1U2EA 4MVJE 1RWOA 1DAPA 3IVXA 2VJKA 4CFSA 1HRKA 1PFWA 1RYZA 3MMSA 1LBQA 2Y27A 1Y8QB 4B6SA 4G1FA 1FOEB 1J07A 4EW3A 2HRDA 1I2AA 3H2SA 1L8QA 4K6HA 1KY4A 2DQZA 1M5TA 1NZFA 4C6TB 2GCGA 3OQ6A 3ASYA 4OEHA 3EC7A 2C5BA 2PZBA 3FNGA 3EZYA 3GAZA 4XM2A 1W94A 5AM1A 5IT9A 3I6QA 2HW8A 4I81A 1C3LA 4KDFA 2DFPA 3V3TA 2B94A 4ZA2A 1LTQA 1M2GA 2NSDA 4D43A 3KVYA 2XUIA 4PTYA 3QEMB 2V6BA 4O4JA 2C7RA 3CXRA 4BNLA 2UXDB 1HQDA 3M9XA 5I4CA 1H8ED 3JS5A 5JAHA 4IEFB 3E9MA 3FXAA 2AFVA 3KALA 4U7FA 1L5SA 3AP3A 2QJOA 3GIDA 2E2WA 3HJRA 4XIJA 3T3DA 3E9YA 4LBVA 3FYUB 2ZXUA 1WZIA 4TZTA 1HDRA 2X3UA 1NJ8A 1RM4A 1X6VA 1YB7A 2GAAA 3L0SA 4O8CA 1ZGHA 1GZHB 2CHEA 4AQDA 2WE7A 3FTFA 1B6SA 1UOEA 2Q1UA 1XDGA 1TK2A 2ZANA 3FCYA 3QBVA 1J20A 1CZHA 1S2LA 2WM8A 4U2EA 2JKZA 3N2YA 2NV6A 3N3AC 3CCCA 1ULTA 4W1PA 2HJGA 1IY0A 3DOIA 3DL4A 5D1NA 5D85A 2C96A 4D4MA 4XQEA 3CEJA 1DUIA 1AHHA 1DC5A 2WA2A 3A1TA 2DFNA 2D3WA 3DCYA 3GB9A 1PSDA 4INAA 2D8AA 2W4MA 2YKGA 4KO4S 1IHDA 4YRLA 3UWMA 4AWBA 3U7RA 1P3Y1 2VEDA 4QBFA 3NDIA 2Z1MA 3ANLA 2CXUA 5E9QA 2CBXA 2ID8A 5JCXA 3AF3A 4Y0VA 1B73A 3L4BC 4MO9A 1RHJA 2W6CX 5ALXA 4BEBA 1AN9A 3VR1A 4B4VA 4WHMA 4JYMA 1XJ5A 2P41A 2VUSA 1L8LA 2WVHA 4M1WA 5ALDA 3JQPA 3LK6A 4EIWA 4OI2A 3QI7A 2ZIUB 3C1UA 2OD9A 3BKXA 3VV3A 2PZGA 1T4MA 4LQLA 4MS4B 4JXZA 1U3FA 5GM1A 4JVSB 1DG3A 2ZYSA 4LY6A 3JVVA 1XQVA 4LX8A 3KJFA 1O95A 2Q3BA 3GDOA 4MIEA 1SA0A 1YRYE 3KZKA 3SFZA 1YMVA 3EPKA 4H08A 4L1KA 2V7UA 1LSSA 3SZUA 1BMDA 1G6KA 2DKFA 4IKOA 3ITEA 2GEJA 4G8DA 4KG7A 4NEHB 3TGWA 2PS1A 1ZD3A 3LXUX 3O03A 3QF4A 1J49A 5DLQC 2XCTB 4TWRA 1UFKA 3AQIA 3HWX1 3UJ3X 4IIJB 4KPEC 4BKRA 5AVZA 1FDTA 1UZNA 2P2LA 2QN1A 1YVDA 4XOUA 1N8NA 4IFIA 3NDBB 3BXZA 1ZCFA 1M34A 1P1HA 4G2TA 2GILA 5HE9A 4MLPA 5F2OA 5I3ZA 4KE7A 1T0BA 4CRWB 1SCQA 5KDOA 4D9BA 2B4AA 2D0PB 4KGXA 3E3MA 2ODNA 4MK4A 5IANA 2AE2A 4UEWA 1VL1A 1NW4A 3ISTA 2G6BA 2J6CA 2AK3A 5AVKA 5F7OA 2F1KA 1L8OA 2VK4A 1E3QA 3MOIA 5AUPB 3RE1A 4GZ5A 3RSHA 2HPAA 3RVSA 2DWOA 2QMUA 5A1TA 3TRDA 4OQPA 4DC0A 4WXPA 4W5NA 4LPKA 3WAGA 3BRCA 1WLYA 4JODA 4TL9A 1ZW6A 1AMUA 1UZAA 1W34A 4J75A 1VECA 1T29A 4ZAGA 4ZWNA 3RUDA 3UF0A 3B9BA 3O5AA 4Y2RA 3PXGA 3VU0A 2YWEA 3H16A 2AS0A 1P0IA 2Q4TA 3G9XA 4V1CA 1P0FA 3TOVA 1V5IA 4D3XA 5LP6F 1SKYE 3W1EA 1SBHA 3LY7A 4H7EA 5AI4A 2CJWB 1QK3A 1EX9A 4TRJA 4ISBA 1EPUA 4WKBA 1WXQA 4C89A 2ONJA 3OJWA 3F97A 4RAQA 3BBPA 1JGTA 3D4BA 3TLZA 3RKSA 4PANA 1ZLXA 1SVOA 3UB4A 4A8JC 4FEAA 1IHYA 1UJNA 4PNPA 3M6UA 1E9BA 1ULBA 1YAHA 4OXQA 4ZOLB 3SIWA 5I7FA 1C7IA 2AJBA 4LRXA 4M36A 4OK5A 1IXRC 1BEEA 2IP2A 3FVWA 1C30B 4W1RA 2GZRA 4YAJA 2IGBA 4B85A 4YR7A 3RU7A 2CF6A 4WEQA 1P8AA 4RK1A 4R5HA 4WIAA 4WN9B 4UHDA 4HGRA 3V55A 3R7SA 5EE5B 5FL7D 3I62A 2Y6UA 4QPJC 4FTWA 4QJ3A 1V26A 5ER9A 5TF4A 4AG5A 1A8IA 2V7VA 2C82A 1R15A 3ZGOA 3HZHA 2GLTA 2Y71A 4D5EA 4N8SA 4D9FA 3DYIA 5HF6A 5BRAA 3EPRA 1SKBA 3HADA 4JITA 3GIWA 4N7RA 3WJAA 1SCKA 3ROMA 1YK1A 3J81k 1GNPA 2WU0A 1JKFA 1KQ3A 5EZ5A 2OSBA 1ZHHA 4P3XA 5KKAA 2FWIA 4BNDA 4X95A 2OMEA 4X1YA 2FPWA 4IHKA 1QIEA 4LY0A 3WGIA 1SVKA 1IC6A 1EUCA 2DT5A 2Y1WA 3BCRA 3KSZO 4OHMA 4PHCA 4MVJI 5AUQA 1I5OA 3O38A 3WHKA 2ZXFA 3BQMB 1EEXB 1QFJA 1I5EA 2ONKA 4X54A 3HKCB 2WLSA 5IJ9A 1QTQA 1MQ9A 3MSCA 3EQ8A 5ENVA 2B98A 3I9OA 1UBUS 4RL6A 2FPXA 2H57A 3N28A 4ZPXA 2EFDB 2TMYA 3NTOA 3O8QA 4MGZR 5YASA 2R66A 4PBRA 5B58C 3QIVA 3UYLA 2PU7A 2QAGA 4ZTBA 3R5XA 1KK0A 1OYWA 3JVUA 4WERA 5DX0A 4B7AA 4F9GA 4BMPB 4MYCA 3SQDA 4CR8A 4DCNA 4WZ6A 2XODA 3X1DA 1XRJA 1Z5NA 3GAAA 4WJZA 3DZ8A 3BSFA 1IN5A 3RYFB 4AZ0B 4DDMA 3M4NA 4AF7A 4CUZA 1UMCA 4PWYA 1K9SA 3BE6A 3DD1A 3JYQA 3P71T 5A3SA 4E6PA 3NAQA 1B0ZA 4OOFA 4LAFA 3ZV6A 4RTLA 1DP4A 3CG4A 3ITKA 3U81A 4LF8B 4DCVA 1FS5A 2PS3A 2YIDA 2XECA 4NCAA 4NG5A 3KOZA 4G9EA 3T1NA 5A9SA 4CR6A 3F5QA 5K8VA 3R7LA 4GXTA 3ENNA 2DWCA 3E8XA 3JAWB 4UHBA 3QPDA 5DISB 3B6EA 3GL9A 5KSYA 1SUFA 5EZSA 5K8IA 1MJ5A 4HX5A 1IYZA 3FAZA 1AZLA 3PC7A 3CUUA 2HD4A 5KINB 4ZCIA 4XYMA 2BGUA 4M37A 2RJNA 3PFKA 3JZFA 5BVGB 1RPAA 3D0OA 4XXHA 2GEBA 1JILA 2CW5A 4R1QA 4RVDA 3TL6A 4A2PA 4EG4A 1YU9A 1NTOA 4DJEC 2BEWB 5F1YA 1W29A 2JIDA 1S02A 1RI1A 1SJ9A 4U2KA 1PQWA 5COBA 3ZV5A 1IY2A 5EHZA 3CJQA 1OFUA 2AYYA 2GESA 2ATXA 1WEKA 3ADPA 4XR4A 1E2NA 1DQPA 3UKJA 3UT5B 3LQYA 2AUMA 2LE0A 3SLKA 3KUCA 2MDTA 2O2GA 3TJMA 1YJ5A 4ARVA 2G3YA 2HGZA 1K75A 3A9WA 3K4PA 3Q6NA 3GVXA 5DGIA 2IBTA 2GQ0A 2FUG6 3D6MA 2OBBA 3DLCA 3OEHD 4OGWA 4BBPA 4RABA 1UAGA 3SSOA 3VBCA 1GGNA 4MUHA 5FWXB 4D0GA 1QG4A 3BUSA 4HQRA 3GCDA 1SH7A 3PL1A 1E18A 2FZEA 2QROA 4LV8B 3UK1A 3NDRA 3K0KA 1IB0A 5CEFA 2O8BB 4DNXA 3P2JA 3PWTA 1JSXA 1C1XA 2BAGA 3A04A 3GRCA 1R4NB 4G1VA 2GZ2A 3GHYA 2D74A 3HRHA 3V33A 2JGAA 2Q4BA 3AI2A 1N2OA 1JA9A 5EL0A 4G5SA 4HDOB 5GJVC 3WHIA 2VP4A 1ZSVA 3I23A 4GMHA 4YECA 2XH8A 5DULA 3FR8A 1ZOPA 1Q0RA 2CXXA 5MF6A 2P9BA 1NFFA 4HQ0A 3N0XA 3FLEA 2ZROA 1ODIA 3K0CC 1XRSB 3N6XA 3ZY3A 1NVGA 2I2CA 4AZSA 1PQUA 4B32A 1V1JA 3A1UA 3W4IA 5HRUA 1BKSB 1O6FA 1MRNA 2RI0A 5A4JA 2AIRA 2XUZA 1WKBA 2JBAA 2PLWA 2FN8A 4R2JA 1H1DA 2Z3ZA 4LE1A 1MEOA 4R41A 2WYWA 3TFWA 1ESZA 4D82A 3T0IA 3N07A 3ETNA 3UAWA 2P3SA 3WE7A 1PLKA 4ZTUB 5A4MS 1BG6A 1PV1A 2VBGA 3HFGA 1Y6QA 1PJZA 2XUGA 3OM8A 4QWWA 3ZHSA 4CW7A 4GYJA 4TS3A 3WLSA 1N8KA 4JV5B 2XYHA 4JB3A 5CVCA 2HWUA 5EQTA 1Q0SA 4AT1A 4JP5A 4OG2A 2PZ8A 4LJ4A 2OHVA 4M88A 3WRYC 3AF0A 3N9IA 1SURA 3PYXA 1N2GA 3GARA 2IZ0A 2OORC 3D43A 1K2VN 4HDKB 1ZOSA 1MG5A 3R5FA 4HADA 3G2QA 2H54A 4NV1A 4ZVSA 3RIGA 4CQLB 1UBNA 3IE2A 1A5SB 5HFNA 5JCZA 2G77B 3NPAA 1DRUA 4G6ZA 5IUJC 1QNFA 4IUCS 5EIBC 1YRAA 2RBEA 1LDEA 4Y6PA 2FQ1A 1HYHA 2EJWA 3FLBA 1Y4DE 4INZA 3MLAA 3AGPA 4RY0A 4TROA 2JS7A 3ZW9A 3HBAA 2NP7A 4XDGA 4HUQA 1BMFD 1ZM3A 3WXMA 3UKDA 4IS3A 1BH6A 1PTKA 1LY1A 1THTA 2X3FA 4B80A 4GL2A 4UU1A 2WAYA 1XCBA 3ANNA 3KR0A 3Q3EA 4MGEA 4GSYA 3A8TA 4X65B 3EXHB 4JBIA 1BNCA 2PG3A 5F9HA 1GPDG 3R9XB 1T9CA 3O8OB 1BXRB 1XA3A 3TZLA 5P8WA 1Z2PX 2C4KA 1DPGA 1ZKDA 2B69A 2H0AA 2W2VA 4MZDA 4S1WA 4F97A 1W49A 3LUCA 5K7SA 1VJGA 1NC3A 1N7JA 2PSJA 3ZWQA 5BWBA 5FD8A 4GXNA 5K6AA 3ZLVA 5CIQA 3K8OE 5LCXA 4Q02A 3KELA 4BWGA 1E63A 2YV4A 1UPCA 3EA4A 3FJYA 3K16A 3O95A 3V1NA 2JLQA 2PKXA 2BCEA 4XA8A 2FPPB 2HREA 2PXXA 3DP9A 4JI0B 6YASA 1D0SA 4D0LB 4ESVA 1MX1A 3VV2A 1KYIA 5IT4A 1L3CA 3LIPA 5LJIA 1ZWKA 1LVHA 3DHEA 2FEXA 3ORRA 1FNNA 2DFKB 3U31A 1LDMA 1Z2CA 3MNFA 1YIOA 1H6AA 1UKBA 5CM2Z 1KE2A 1LPMA 4IV8A 1OWOA 2HJRA 2XBLA 5IFLA 2NVOA 1Q7TA 4TTTS 1Z73A 3T95A 1QM5A 3UZUA 5JS1A 4CKCB 3A6KA 1BU5A 2LD4A 3NRJA 3MOGA 3IQWA 5IZ4A 2ZB8A 1SR8A 2HA7A 2BGGA 4NOMA 3K6SB 2QE6A 4LV5B 2WBLC 2Y1OA 1Y3DE 2ESRA 2X2OA 1KY5A 4M6WA 3WGHA 4RA6A 1FJXA 3W2HA 1ZM2A 4GRDA 4Y1GA 2BGJA 3CIOA 5EWLB 3VU1A 2G8LA 5ECWA 1Q6YA 3NS7A 3QENA 4MDYA 4E1AA 4MR8B 1SIWA 1E2IA 5K0ZA 4OSOA 1GKYA 4Q37A 3N2LA 3QFTA 3GCZA 5EIOA 5LWHA 1SXGA 3H1GA 3HB7A 3TWOA 1M2WA 3T41A 4J03A 1TU3A 4I4TA 2W6IA 4FSXA 2N0SA 1R8JA 1YR3A 4U00A 2VI5A 2WJ4A 3TQTA 4KNVA 3EMDA 3K7EA 3L2OB 4OHVA 4L0MA 4PQGA 5HGXA 1Q12A 2RDMA 1M7GA 4F3YA 2JARA 4KKVA 2VKQA 1O5TA 2VHYA 5G41A 4ER3A 3F73A 1PL8A 4MKXA 3OZEA 1O95C 2B4TO 3ICPA 4MCHA 1CERA 4Q4JB 1FRFS 2CVHA 4XPIA 3RHSA 3W9YA 3WKBA 1WZEA 621PA 1J90A 5EJAA 1YQQA 5GJWC 3FSGA 1RHQA 2PH1A 2ZSHA 4A7PA 1SPXA 4RTQA 3EGWA 4CV3A 3EMKA 3WADA 4UCQA 3RSSA 4EUHA 1O3YA 2PKWA 4DEVA 2PUHA 2DR2A 4KXLA 4J0FA 3NU1A 1X7ZB 2L82A 4O2BA 4K3VA 4RK0A 3TSAA 4XWKA 2YXNA 4J2TA 1T1GA 1VMIA 1KP3A 1Z35A 2A58A 2IA5A 3F2VA 4GR4A 2DSTA 4MI1A 4O4HF 4G09A 5KJEA 1P5HA 3C7AA 4EB3A 1ZC4A 3QLVC 4RYLA 5CDYA 1YDMA 3N39C 3IPAA 2ZETA 1AIPA 4KPYA 3BZWA 4HRAA 3AI7A 2J3MA 1BAPA 2CZQA 4A26A 2R8OA 4GPBA 1H6DA 2JJ2D 3PFNA 4IUYA 4QO7A 3EW9A 3R6GA 3N76A 4X6LA 4DHWA 1K3FA 5B5SA 3VYVA 1CR4A 3OEWA 3I2IA 1S96A 4PZZA 4TVBA 3E2MA 3GCWA 3H1AA 3HQ4O 2O52A 3IDAA 2JFFA 1OGIA 5NLLA 4CM3A 4R8RA 5BRJA 4CTJA 3A2KA 3STTA 4B7CA 1Z63A 3OKCA 2VHWA 1YZYA 2Q9BA 4RH1A 5JROA 3A1DA 3OC0A 3RJMA 1R2QA 3FUUA 4AS3A 4UE2A 1YJXA 1UUFA 1ZZEA 3CV3A 2VZ9A 2VIIA 3Q7PA 1QFYA 2MSWA 2WABA 4NBRA 1JZTA 1NW9B 2DY0A 4NEGA 4BLRA 4BPBA 2Q45A 1MOPA 3L8EA 3OEYA 5JBIA 3FWPA 3TNYA 5LDDC 3WI7A 1ZR2A 3JD1A 1FA9A 4Q9HA 3TPZA 1T9BA 4YA6A 3VNAA 3NZEA 3VNBA 3X1WA 1NTRA 3GUHA 1VMDA 1X14A 2DP4E 3RRXA 1DWOA 3PWKA 2FQXA 4LRSB 3U7QA 3EFOA 1SUBA 1NKSA 4RV9A 1YIDA 2NUTB 3ONDA 3N05A 4KPGA 3FMPB 2R86A 4MW7A 5DBIA 2PWPA 3IEMA 3AP1A 4NNPA 1Z5ZA 1OYOA 2J0UB 4A0FA 2CD7A 2W2TA 3LUDA 3CJTA 3W8FA 3TQIA 2HFJA 3WB1A 1FS6A 3BMCB 1N0IA 3IE0A 3KXLA 3OF5A 4K2HA 4QREA 5TQVA 1JSLA 3OM0A 1OZ0A 1G21A 1Y3IA 4KQWA 4LEIA 4BB6A 1FFWA 1S3SA 1NMZA 5IHPA 3AM4A 1U2DC 3HSKA 1VKRA 1YAJA 1GQYA 4MRVA 3WJ7A 3ZVLA 1WDKA 3KCQA 1EHYA 4OHZA 3RUFA 3ZDAA 1G3QA 4EAAA 1ENZA 3H7IA 5CURA 5H4GA 3S8YA 2DH6A 4EVRA 3T7DA 2FQQA 2GM5A 1QVVA 2C0CA 4KQ9A 5HR5A 2A5GA 1KH2A 5JTUA 1NU6A 3FKSA 1IWOA 4V24A 4CZ2A 4MV7A 1FYEA 3QZUA 5AUNB 1T8YA 5KEIA 4OTZA 1G41A 1Y5LA 1YZLA 2W8BA 1OCEA 1LVGA 4L9RA 4MMYB 5BNTA 3FVQA 4QXMA 4BO4A 2GK6A 1SOUA 2FSIA 1FFEA 4ZI7A 1PAUA 1I13A 3MLEA 2JGDA 1P2DA 4S05A 2A0FA 3Q5DA 4F12A 2W2LD 4YNBA 5CK4A 2WJJA 8ADHA 5GY7A 1FQWA 3F46A 5C7IO 4WSOA 1RS0A 4DCOA 2QAGC 1ADJA 2ETXA 3LHDA 1YJ8A 4KK4A 4ZEXA 3LKVA 2ZJZA 3TCXB 3MEQA 2EF0A 4OXKA 3VM6A 1Y9EA 1Q0ZA 3H04A 3B7GA 3VKGA 1M8FA 1PJ2A 4TKLA 5JARA 5FTJA 5KQGA 3VZRA 1JYSA 3DO6A 4DXHA 1WU7A 2FG7C 4QUEA 4G0YA 3SC4A 2H5IA 4JS0A 5F77A 2C20A 2FPIA 2WFMA 4F84A 5DNUA 1E3WA 1R6TA 1J1ZA 2AFHA 4OKSA 4EHJA 4FE4A 3VNVA 5BV0A 2VSFA 4JXXA 4K9LA 2WF5A 4D6PA 2VHQA 3REFA 3L7BA 1VI6A 2ORIA 1QG6A 4G65A 4R3WA 2EZUA 5K05A 3ESDA 4OL0A 3A27A 721PA 4G41A 2B4QA 1IU9A 2B7BA 3DTTA 1GGMA 1PJ3A 1SCNE 1W44A 5IPFA 4WL0A 1AKWA 1CF2O 1JBQA 1YFKA 5G1OA 3TYXA 4ENRA 2JZOA 3BCSA 1R37A 2WOJA 1X39A 3E2IA 4PX2A 2JFOA 3N8NA 3ZWAA 4X8HA 2ZWOA 4Q4AA 4LNHA 2VZ0A 4FOLA 3H1TA 3U3ZA 3WLNA 1WVIA 3LW8A 3DA8A 5AI5A 4F6RA 5KPJA 3KB6A 1G8FA 1IAVA 1X15A 2AA3A 1B74A 1ZRNA 3IV7A 3U9SA 3WYFA 4KB5A 1P0CA 4CF5A 2XX3A 1OFGA 1L4MA 2I29A 3PDUA 4EKGA 3KYIB 4URYR 3UGQA 1X19A 4GL4A 4ALJA 1UZMA 1NYQA 3H4IA 4NYMR 1PP4A 2R6R1 3GFVA 4IOMA 3WTCA 4P4SA 3FDJA 1Q3HA 5NULA 3ONNA 1SCUB 3NTXA 2JAQA 3WDSA 1UDWA 4GDFA 2WUDA 4RA9A 1R10A 3H5LA 5AJWA 5DTEA 1T26A 2XGJA 2PUDA 4Q3LA 3ST7A 1WUJS 3NMUF 1LU9A 2IS4A 3C74A 4CIXA 3JYOA 3RFVA 1NJSA 4UHKA 1A71A 3H87A 4CE6A 3ZG6A 3D3QA 3HMQA 3GD7A 4BE9A 3FNRA 3UNXA 4JI8B 1LLDA 4UARA 4ROSA 3ZJUA 4YJ2B 1SB9A 4G5GA 3I61A 4HAUA 4WY5A 1QS0B 1YJCA 4A2QA 4A1OA 2I6TA 3CKLA 1IVSA 3Q3GE 3OHPA 4OMFG 3SKYA 2IZOA 3BGOS 3K1AA 4KJXA 4Z49A 2PIAA 1OILA 4RJ2A 5LP6A 2DQ4A 3K9QO 3IUMA 4GZMA 1DAMA 4R98A 4RKFA 4EI9A 2BMWA 4ETNA 2IZZA 3LDGA 4I5FA 3T1TA 3PNLA 4BV3A 4ZZIA 4IVQA 2ZRAA 2GRUA 1Z2OX 1V11A 3DXFA 4I46A 3C5CA 5JAQA 1PX2A 4EW1A 5LZ4A 4BP3A 4GF5A 1M1YE 4PG6A 4DIUA 4QM7A 2W6JA 3WGLA 2NU9A 4FFLA 4J3FA 1YDFA 2AFIA 4P98A 2HNBA 5FI0B 3NETA 3I04A 2N1BA 3AHIA 5L40A 1VB3A 2DUMA 3VPHA 3ZLJA 1U7WA 2IHZA 4KK3A 1JJAA 5JS7A 4PTZA 4MWZA 2OO7A 2WTAA 1SWVA 1A2KC 1XKQA 3Q2IA 3SDBA 1X8XA 1EFDN 1UAAA 5J4HA 3H5NA 4MWGA 5E1DA 3NM4A 2PH7A 5E7QA 1PWHA 2HU2A 4UD2A 3V7YA 2CFOA 5FOVA 3RHFA 1Z38A 4KH1A 2ZIAA 2J6HA 2RG7A 3NOXA 2GZSA 2NNLD 2ZR8A 3I2HA 1QHGA 3LKDA 4FOTA 2DJ5A 1DC3A 4FYMA 4IDNA 3RV3A 1Z15A 1IATA 2IEAA 1L8XA 2O3UA 2Z1NA 4FHZA 3ESBA 4EJ6A 4ER0A 4F4IA 3CCBA 4BP1A 5KAMA 1AQUA 2M2IA 4D9KA 1L5QA 4HN2A 1E1KA 5B64A 3BDAA 4AJNA 4ECEA 1PTJA 4V0QA 1X13A 2ASEA 1O6CA 3ACDA 2J7PD 2NADA 3FCSB 2DR0A 4GI5A 5BQ3A 1ZNWA 3R5HA 2VDUE 1D6JA 5E4TA 2QJRA 2WWXA 1TRHA 2FGJA 1V16B 5AWFC 7MDHA 3UJBA 1P3JA 2Q3HA 1KP2A 3HYLA 1FP4B 4AL4A 1ZX1A 4JC8A 4XD7D 2BFCB 4H0NA 4JA0A 4YRTA 4CMIA 3V2UA 1MEEA 3CUYA 2EATA 4AYXA 5K6AC 3ZU3A 4COOA 1L5RA 1GPMA 1TTHA 5A3RA 3MJVA 3HGMA 4MO2A 1L5YA 1RHUA 3QUTA 4YMLA 3KOXA 3CF2A 2RAPA 3B1JA 5DSTA 3OHSX 4QTTB 2AXNA 1XMJA 3EA5A 4EDHA 2R751 1HDXA 3CLSD 3AVOA 5BSVA 4RF3A 1MZVA 4LMAA 3WGVA 4JU8A 4Y6QA 5LQKA 2ID9A 3W5UA 1E8MA 1OLUA 3P9XA 5LNK1 4P0QB 4MJXA 3KQLA 1M5RA 4GWGA 3GRFA 1JLLA 1YVRA 2VP5A 4PO9A 4NONA 3SGLA 4J7UA 3SMQA 4B4OA 2CFRA 1YOBA 1XDBA 2HWYA 1IPFA 2WE8A 2XDYA 5EZ6B 3S4YA 3WY9A 1G2QA 4YMIA 1WSAA 1C0EA 1JA0A 9ABPA 3BM5A 2V5AA 1YC2A 3AXTA 3GFRA 1GO2A 4JLKA 3L8MA 2FRDA 4R8KA 3ZY5A 3LY8A 2SICE 1O6BA 1GFWA 4G5FA 2I1VB 2WHQA 8AT1A 1T2VA 3COJA 1QQBA 1G42A 1CLEA 2Z30A 1Q1QA 3HCAA 4B17A 2UYCA 4FDTA 5JJ5A 2CJXA 2WTEA 4LRQA 4IGEA 4Q19A 1H0SA 4BU1A 1UMDA 4IMRA 3IKLA 4ETIA 3QKRB 2IE0A 3R9IA 1ZN7A 4K81B 1H66A 1V1MB 1FNSA 4IMJB 1SKYB 2O3JA 3HUTA 4MQLA 1GU0A 5ALKA 1W46A 3RARA 5KTNA 4LWOA 1V7ZA 4X20B 2WILA 5ED0A 3T7TA 5JY6A 2ZE8A 1TMYA 4DMRA 1U7HA 1XAIA 3VMMA 5LMCA 4BP8A 2L19A 2QD3A 4UXHA 3Q9UA 4OHRA 1ZRSA 2PH5A 2XE7A 3CC8A 3GEBA 3P27A 4WN3A 4ZREA 4I50B 5DW3A 8ABPA 4O1HA 4ZOAA 2I55A 2AI3A 2GXUA 3K8YA 2V9ZA 4ZN6A 3QPUA 2ZJ1A 3AR8A 3HWSA 3CLUC 3INNA 4RH3A 4MHSA 2AC4A 2C99A 1P39A 4FZJA 3V1LA 4BVGA 3N0RA 4HQ6A 3I6YA 4XIFA 5AKIA 2RHDA 2VA8A 5DB4A 1G8AA 1ZRHA 2G0TA 1LVUA 1ULSA 1P3DA 3N2GB 5IG2A 2W6NA 1ZJYA 4MEBA 1NI4A 2YMQA 3BAZA 4Y9RA 5ITZB 3EVEA 1ZCZA 4IY1A 1CQIB 1JPUA 2GPBA 2QPAA 4U7HA 1H2AS 1X80A 5FEUA 1JG4A 3Q40A 4P83A 3SYMA 4GNKA 3GPCA 4KH0A 3AVUA 2KB0A 1CJVC 4IH9A 3QVKA 1ZU4A 4AUMA 1AMOA 4D9IA 4TMXA 1GPWB 1YQTA 1XRNA 3I9JA 3I5YA 2P4SA 4XDHA 4FZ5A 2FMTA 1GPAA 3IVGA 3LBHA 2BMJA 3FZYA 1U8UA 3GV0A 3L0YA 4IYJA 1LJUA 1MGOA 3KZXA 3NIBA 4KVZA 3UB3A 2IOQA 2JFGA 4QUDA 1J2YA 1PR9A 4DCJA 4UZEA 1J8YF 2EYUA 1J7KA 4KFUA 3G8DA 3O3NB 1PNTA 2DY1A 4YXWA 3VR4H 4F2HA 3WA6A 4ZVNA 3D8BA 2OM2A 3HE3A 2Q6LA 4BVBA 2CVOA 4HO1X 3CT6A 4P2GA 2C7VA 2XA9A 1GPJA 1WJGA 4PPGA 4UOQA 4GM4A 2TMGA 3W5AA 2HQOA 4RKQA 4CCWA 4UUMA 3NT4A 1P4AA 1GGEA 3Q6MA 4E5VA 5JJKA 1AGPA 1RYFA 5ECYA 2REQA 4IIUA 4M53A 1FFHA 4WK2B 3LWBA 4FW9A 5BVHA 4WK6A 2AN1A 4P31A 3T34A 1UDXA 2DTDA 1KMHB 2BN4A 4GRIA 1VHLA 4OHFA 2COKA 3ELBA 2NO4A 1P8JA 1CUSA 2Z57A 1C3XA 2BFBB 4A6XA 1U28C 2N42A 1J99A 2VUHB 2J32A 4L6AA 4OK3A 4F2DA 1PJQA 5D00A 2XYVA 3E1GA 1ODSA 1NMSA 2WDPA 1CW2B 3PT5A 2UZ4A 1E2LA 4YAFA 4EW6A 4LXHA 2NZVG 4ISCA 1JDNA 1FYDA 1IN7A 3M34A 1MRSA 5JAMA 3PHLA 1XTUA 2HJ9A 5FP0A 4QOGA 4EVIA 4OA8A 4PYKA 2ZJ4A 3O8RA 2YRWA 2PBRA 4ND8A 2O8BA 2Q2QA 1PR5A 1TTPB 5G40A 4FMBB 3PI7A 1XDUA 1CY2A 2GI4A 3GEEA 4BQPA 3QELA 1UXKA 1RC0A 1YDEA 2VAMA 3CGGA 3C7TA 5IN5A 5JZOA 2P8SA 3BA6A 4KWIA 1QHHB 4E5MA 5E9WA 4UMVA 5HMLA 1CUXA 3JQQA 2XOXA 3O8BA 4E14A 4GVLA 1EVLA 1N2CA 1J00A 2VF8A 3EZ6A 4PHTA 3GLRA 1QUEA 1W6UA 3WWYA 3AF4A 2Q07A 3JQ9A 2VCHA 3M6WA 1RLUA 3U19A 2HIGA 5CB0A 1WUKS 1SD1A 5DSZA 3CF4G 1SCAA 4F6CA 3CZRA 2H1OA 3S2EA 1UAYA 1GRRA 3UUFA 1IY1A 1ZUHA 2VP3A 5E6RA 3QHAA 3LGAA 4TQAA 4UFOA 4B3JA 3CR8A 1C8VB 2HQRA 4E94A 3FUWA 1Z18A 1TECE 3DZDA 4PQEA 3MWJA 4KPUB 2IWHA 3QFCA 4B47A 4XRGA 1VZ3A 5CX1A 2Q5QA 1C4WA 2X2PA 5EZYB 2J5KA 1XCOA 3EIHA 3LFHA 4I19A 4PPQA 5A05A 3T3EA 2XNDD 1UDRA 2KWIA 1NAHA 4HS9A 1KTIA 3DKKA 4R3NA 2GXQA 3F7OA 3PQ7A 3TL2A 3ONWA 1ESCA 4E31A 2CV0A 3NM6B 4YI5A 1MB9A 2FEPA 4ZVKA 3GLIA 1IOVA 4BVLA 4HTAA 1P1CA 2Y1LA 3ONFA 3JQAB 5E1MA 1RPTA 2DQSA 2CHVA 2P9TA 1QCZA 3GZTB 4R3UC 1JMVA 2P11A 3P0FA 2O8DB 2FOLA 1Y9AA 1D0VA 2E18A 1RZ3A 3HDVA 1AKEA 4K9NA 2DX7A 3DEYX 3TMAA 1P7CA 1KH3A 1QDEA 3FR7A 4NOJA 4F45A 3BGSA 5CLHA 2QL7A 1B8VA 3W78A 3RVBA 4EZBA 5IXJA 3B6ZA 4HWSA 4YCJA 4HH4A 2C61A 4J1QA 3VPXA 4EMSA 2Y9MB 1CR0A 3OU7A 2XR1A 1QSGA 2CL5A 5GONA 1G8SA 2A2ZA 4DIEA 4MHTA 5DMXA 3EFHA 1QOPB 5B7GA 3OO0A 1WB9A 2B25A 1CE8A 4RE6A 1EZZA 4S0ZA 1XKTA 5FAXA 3VVCA 3C3KA 2COEA 1LBSA 4JFRA 1P7PA 2ODWA 2PXAA 3X2EA 3X1XA 2QM0A 3AM3A 2IW1A 4FIDA 2H3HA 2RMKA 4LFAB 4CQMA 4WTOA 1VJ5A 3A28A 4MVYA 4NDAA 4RVHA 1CP2A 3BFKA 3IR6A 5JQGF 1DEXA 1KJ8A 2YJNA 3QXGA 4IIVA 5FWYB 1KZ4A 1GCOA 1KPHA 2JPDA 4QL3A 2P6OA 4PNZA 1NX6A 2CVFA 1OWLA 4UU8A 4V0LA 3PCRB 1OSNA 2AJCA 4BFSA 2AI2A 1T4BA 2GBFA 2ZRPA 2PX8A 4I4CA 4NMHA 4M1OA 1DKMA 2RGWA 5ALPA 2IDJA 2X8LA 1NW5A 1UBTS 2P5UA 3GD5A 1Q1EA 4UW9A 5CRIA 1KOGA 1YR6A 2R4TA 5JHHB 3DMPA 2GJSA 3C24A 3MGCA 3MCUA 1IDN1 1YBFA 1VBKA 3QKSB 4KQCA 3PUHA 1SHJA 1UINA 1L4NA 1GPH1 2NAFA 3ANTA 5HCNA 3TMYA 4V38A 4CLOB 4R4JA 2IC5A 4C3ZA 4XIIA 4YUAA 2JGIA 2WWTA 2A1TS 1QGYA 4RXMA 2ZI7A 2E5WA 2OZLA 1K06A 3M8KA 2XMCA 4PAMA 1QGDA 3WMEA 2QDXA 3KFXA 5IVPA 3L1VA 1TM1E 4KWEA 1K7CA 1KHTA 4EY4A 1D8AA 3BJZA 1CJUC 3EXFA 1N75A 5H7XA 4BBAA 4YCNA 1W0CA 2WU4A 3JAMA 5T3UA 3UEOA 3MGAA 2YCBA 3G2PA 3QRWA 3VAAA 1ESDA 2IWRA 1NRJB 4CCYA 2ISSD 2YL2A 4QDOA 2C88A 5BN3B 5K4GA 3IKVA 1C1DA 1FNCA 3FW1A 3GLFE 3CUSA 2PVSA 2JZNA 1K6EA 3D6UA 3COSA 2HNKA 3NORA 3Q87B 4HDMB 4Q9LA 5HKOA 1X2EA 4KIFA 3SC2B 1NY6A 1RJ9A 1N7GA 4KQFA 3O26A 1YWGO 4FXOA 1P1KA 3G2LA 3F49S 4LGYA 3SHOA 1ISHA 3MTDA 3CH6A 1PTJC 3WB0A 2EV9A 2YWFA 1EP9A 3QI2A 2MMCA 4N3NA 4WVFA 4E22A 2VTBB 1S1MA 2I2DA 3IHKA 1QZTA 4OHXA 1E9VA 3VJRA 1NXXA 3U4HA 2GS9A 1TFRA 2JJ8A 3TGPA 4ECAA 3AGQA 2BBWA 4J0GA 2RC5A 3CNQS 2HB6A 3TFOA 2FP4A 4UBLA 5HJEA 1PUXA 3FTPA 4ODIA 3PQ3A 4BQQA 5KMGA 2FOXA 1GYPA 4FFMA 1I6LA 1TZKA 1F2VA 4BIIA 1L5MA 5KYWB 2R8BA 5A1JA 3A25A 2QF7A 1JDUA 3AIMA 3ZCSA 2GD1O 5HMMA 3LP8A 3AC0A 1FY2A 3PQ4A 5JFTA 3OY7A 5B3LA 4KOAA 2CN1A 1QHIA 1CZKA 5DMHA 1P2UA 1WY7A 2G0NA 2GYVA 2WKWA 5U4XA 1WCXA 2VH1A 4OH1A 4P36A 4BKOA 3MXOA 3RIEA 3WMGA 2K7FA 4BXOB 3IPRA 1VJCA 3TE7A 4WFQA 1H42A 1C7FA 3GJ6A 1Z3CA 2A0UA 3M4XA 3EISA 1I3KA 3U6KA 4MUJA 1TEVA 2JC3A 3CH7A 3ZWVA 2R85A 4JJ6A 4RF2A 3LW7A 3W77A 2GRJA 5J4YA 3DTYA 3JCZA 1Z29A 2R6AA 3CRNA 4JBHA 4Q47A 5F2KA 2YY7A 2OTCA 3G2OA 5I8PA 1P75A 4N0MA 5L3QA 1Q11A 2FPLA 4QOIA 5CPFA 4P7JA 4IGFA 1ZD9A 2FSGA 4G0ZA 4L07A 1AC5A 1A9OA 3OP4A 2J3JA 1RI3A 5F5XA 4GOXA 4IQGA 1V3UA 2WA1A 1XPUA 1CXZA 4DUGD 3NFRA 1RQGA 3SEFA 4KAFA 3RUCA 1BHJA 1E1QA 2FRDC 2NXWA 2R00A 5F7XA 1HT3A 2YFKA 4DRZA 2YWJA 3AFIA 1RRMA 1QYCA 3U9LA 3LTEA 1GA1A 3ZJVA 1V5EA 1GQFA 3TUZC 5KYNA 4X8OA 1YZUA 3DNPA 1RAEA 2VYCA 2IUSA 3IMKA 4U7TB 1A27A 1B23P 1SUWA 3N86A 4HWGA 3G79A 1RWPA 5L4LA 3CX6A 3GBPA 3KYDB 3MD9A 4OJKA 2JJ2A 2P9HA 4QUIA 3KAKA 5EKTA 3DVAA 2Q7XA 4R2MA 1GFSA 2YRXA 4EO9A