3KR1A

Crystal structure of hpnmt in complex adohcy and 5-chloro-1h-benzo[d]imidazol-2-amine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kr1A00
1JTEA 2JHPA 1NV8A 5EMJA 3WSTA 1EG2A 3HEMA 5DSTA 3UZUA 3MHTA 2IBSA 1RI4A 2P35A 2ZTHA 3CBGA 4OQDA 3GGDA 3EMBA 2ZIGA 5DTMA 2PV0A 1MJFA 2PXCA 2AS0A 5K0CA 1RJFA 2OBFA 3SSOA 1YFJA 3UJAA 4QDKA 2AN4A 2IIPA 2XVMA 4C07A 2JG3A 1ZQ9A 3FYCA 5EQJB 2PT9A 2Z6QA 4MHTA 2JH8A 3GIWA 4FSXA 5EG5A 1R6AA 3TPZA 5ICCA 2YXDA 4RV9A 5GIOE 3O31A 3DMFA 3HVIA 2UZ4A 1O9HA 3KPWA 3KQOA 2QRVB 1RI1A 4YV0A 1TW2A 4X41A 3HP7A 4QVKA 4QTUB 3G2PA 1FP2A 1NW5A 4OA8A 3UJDA 1L3IA 5LQRA 1YFLA 5E2BA 1NW3A 2P7HA 1G6Q1 3KQVA 5DT2A 3R3HA 3CCFA 4C05A 4RVHA 4KIGA 5EHIA 1JG2A 2B2CA 4QDJA 3B3FA 3P71T 4CTKA 2UYHA 3IYLW 4P7JA 5HILA 3KPYA 4RVDA 2QRVA 4V0QA 4RTLA 3OU6A 1N2XA 4M7RA 2WA1A 4IV0A 4MWZA 4RX1A 4YMGA 3GU3A 3M6WA 4PCLA 2R6ZA 3UA3A 2GPYA 5FTWA 3ELDA 5DLYA 4CKCA 2IDJA 3LSTA 3HVJA 3P9NA 2UYQA 1VP9A 2GAFA 3BGDA 4U7TB 1VBFA 3BT7A 5B1SA 3PX3A 5DWQA 2VS1A 1SG9A 3SMQA 3BWMA 1KPGA 3EEOA 1NV9A 3LCCA 4R8SA 5CUQA 4MQ4A 4RTKA 1P91A 1I4WA 4F86A 2C7QA 2V74B 1HMYA 4C08A 5C0OE 2OKCA 5DX1A 1NT2A 1VIDA 3R24A 3O7WA 1N7JA 3P9IA 4XCXA 5GOZA 4ER3A 2Z6UA 3M6VA 2P1DA 4PGGA 2NXJA 3QV2A 3I58A 3GRZA 4DCGA 1Q0TA 3GRRA 2ADMA 3LHDA 3LKDA 2JHAA 2PXXA 3FUTA 1WXWA 4RVFA 2FRXA 5DM0A 5EZQA 1FBNA 5HFJA 3MCTA 4ER7A 2I6GA 3UJ7A 2ORED 3E05A 3QOXA 4K6MA 2NNWB 4X1OA 4POOA 3LDFA 4RTMA 4LWOA 2ZIFA 3EVFA 5CVDA 5F2NA 1SKMA 2WA2A 1ZKDA 1JQEA 4E70A 5CVEA 4R8RA 3M33A 4BY9E 4ATNA 3M70A 5FQNA 4RYLA 5EMLA 1U2ZA 1VP3A 4P7KA 2ZZKA 3VSEA 3MAGA 2PGXA 4PWYA 4PONA 4A6DA 4R6XA 3FTDA 3SVZA 5P8WA 2H00A 1JG1A 1EJ0A 3HCCA 4FT2A 4BP3A 1ZHFA 2P41A 4GEKA 3DXXA 3G5LA 3THSA 4PNEA 2B78A 4KVZA 4E33A 1G60A 3A26A 3IHTA 5ICEA 1AQJA 3EVDA 3P9CA 4QPPA 2HMYB 1NBIA 1ZG3A 3EVCA 4E30A 1R00A 1XCLA 2B9EA 2PX4A 3LKZA 3KR0A 5DX0A 1SUSA 1QAOA 3P8ZA 3FPEA 4BLVA 5K05A 5ERGB 4KRGA 3G89A 4RWZA 1L1EA 1INLA 3R6TA 3KR9A 3C0KA 4QVGA 3BGVA 3SR4A 4EKIA 5JUWA 4E2XA 5E9JA 1O54A 5K0BA 2I9KA 3GDHA 1PRYA 1TPYA 3DTNA 1L3BA 3KKZA 2K4MA 4PYQA 5KQSA 1P1BA 5LSAA 3OZSA 3DXYA 4XUEA 4EKGA 1R18A 3SSNA 2ZBPA 4QTTB 1VQ1A 5GM1A 4C03A 4LG1A 3L8DA 1JTFA 5FA5A 3BKXA 3KPUA 3UWPA 1XDUA 1ZGJA 3KQPA 5FWDA 5EIFA 4AZVA 3NMUF 5EC8A 3EVBA 3PT9A 2XYQA 4HRAA 3CJQA 2Q41A 4EK9A 5EEHA 1PJZA 5HOQA 2CMHA 2V7EA 3REOA 2VP3A 4GOND 3DULA 2C7PA 5EZSA 3KQTA 5MHTA 4M38A 4FT4A 4GBED 1QZZA 1VPTA 3FRIA 4H0NA 3KPVA 1YUBA 4V0RA 3P2EA 5DX8A 5KVAA 2N47A 1Z3CA 1XTPA 3FRHA 1YZ3A 2Y1XA 5FHRA 3ER9A 2C7RA 1KYWA 1XDSA 4CKBA 5EVJA 4DCMA 4OX9Y 1L3CA 3F4KA 3MQ2A 2FK8A 4HH4A 4C04A 7MHTA 2HNKA 2ZBRA 1BKYA 1SVUA 2ZZNA 4RTPA 3P2KA 1KP9A 5LQKA 2VDWA 2BR4A 2H1RA 4XUCA 1BHJA 9MHTA 1IY9A 5IH3A 3V97A 5DM4A 2PLWA 3HA3A 4X63A 3V8VA 1WXXA 3UJ8A 1FJXA 2JH9A 3DMHA 3KQMA 2HR1A 3OZRA 3AWIA 2PT6A 4LECA 3P9KA 3B5IA 8MHTA 3G2MA 4KDCA 2FHPA 5E9WA 2OPBA 3I53A 1ORHA 5BW5A 1D2GA 1JG4A 3HNRA 5FA8A 5CVJA 1X1DA 5ICGA 2EJUA 4OBWA 3JWGA 5EHGA 4GUAA 3ME5A 1XJ5A 1IXKA 3M6XA 2BM9A 5CM2Z 2AN5A 3HCBA 3FPGA 2G8NA 3SGLA 2G70A 3NW9A 3TLJA 4YUYA 1H1DA 5LQAA 2DPMA 4AX8A 3BZBA 4U7PB 2P40A 3FTFA 5C9ZA 2BZGA 3EEYA 3LL7A 5K03A 5DRTA 3KHKA 1FPQA 2FYTA 3ELYA 5DM1A 3X0DA 5HZMA 1JSXA 2G72A 2ONYA 5LQCA 3EPPA 1BOOA 4P7FA 4E31A 3CKKA 2C7OA 3BGIA 5HEKA 3P97A 3C6KA 4P7GA 3UFBA 3R9XB 5DSXA 2PBFA 5FCDA 5C1IA 3OCJA 2OYRA 3GWZA 1X1CA 2ZCJA 5LQUA 4FSDA 2NP6A 2O05A 5E1MA 3UBTA 3GNLA 5DXAA 3PTAA 3Q7EA 5T64A 4B17A 5EMKA 2NXCA 3VYWA 2LD4A 5K0GA 4PGHA 4PIPA 3TR6A 5CD1A 4GC5A 3PS9A 4PYJA 5CVUA 1DCTA 2BM8A 3UJBA 4NECA 3FTEA 1O9GA 2ERCA 3A7EA 4PYNA 1G55A 5CVVA 5FHQA 5DM2A 3E23A 4PINA 5JR3A 4YMHA 3OZTA 4AZTA 4F85A 4C06A 1OR8A 5K01A 4BP1A 2PWYA 2YUIA 1P39A 4HTFB 3DLIA 3NTVA 4IKPA 5F2KA 1V39A 5CCXA 3SX0A 3CC8A 3K0BA 4BLWA 4CXMA 5D1HA 1NW7A 1UWVA 2H11A 2IDKA 3FPFA 3KQWA 2ZFUA 4JXJA 2OY0A 4DM3A 4X60A 3DP7A 3TQSA 1EAMA 3BWCA 1ZGAA 1EIZA 3LDUA 2JJQA 3AXTA 2BH2A 2CMGA 3E7PA 2CKDA 4HTFA 3OFJA 3SXJA 1JSZA 3HA7A 2XYVA 3DXZA 1P1CA 2EJTA 2IH2A 1YB2A 4CTJA 4MIKA 4XUDA 2YXLA 4PIMA 4R6WA 1QAQA 2XVAA 3GRYA 1N7IA 1TW3A 2ZSUA 3B7PA 3FYDA 3H2BA 1FP1D 5KQRA 2AOXA 3ORHA 4P58A 1KYZA 4F84A 3BWBA 3JWHA 2AVNA 3EGEA 3THRA 2GA9A 4OBXA 1VLMA 2UYOA 4YUVA 4FZVA 5H02A 2GS9A 1KHHA 3T7SA 5DPMA 4AUKA 4PYIA 1JR4A 2AZTA 3DMGA 2NP7A 2PXAA 5EKUA 3ANXA 3LDGA 2IFTA 4KIFA 3NDIA 1SQGA 3HCAA 1KXZA 2OO3A 10MHA 2FCAA 2QE6A 2O06A 1X19A 3ER8A 1R74A 5IKMA 3SM3A 4EQZA 4OA5A 2PY6A 3EVGA 3M6UA 3NJRA 3G88A 3SSMA 4IV8A 5FQOA 3AJDA 3R0QA 3BWYA 1NKVA 2HTEA 4AZSA 4R05A 2AOWA 4LWPA 4Z2YA 5E8JA 5K8VA 3TOSA 3A25A 5HIJA 4M36A 1RI5A 2PX5A 2PSSA 3KQSA 1QANA 3I9FA 4KWCA 2ESRA 1WY7A 4HSGA 4DKJA 5K0EA 4A6EA 2AOUA 4BLUA 4GOMD 4M37A 5K0NA 2G1PA 1KPIA 3RW9A 3NVMB 1NBHA 1KIAA 1X1BA 4GQBA 3IV6A 1AQIA 3TKYA 2EG5A 3DH0A 2WK1A 3PB3A 2KW5A 4EVIA 5K0JA 2EX4A 4ZTBA 5EEGA 1F38A 1JQDA 4HGYA 5T6BA 3AXSA 5GIPE 1VL5A 3TMAA 3MCZA 4RSRA 5GP1A 1G8AA 2O57A 4C4AA 2AOTA 5HIKA 1RJDA 5BW4A 3NVKI 1R8XA 5DXJA 3HTXA 3PLAE 3JWIA 2EFJA 3T0IA 2ZZMA 1EQAA 1WZNA 3E8SA 2P3OA 5E2AA 5FADA 2CWWA 5DTRA 4YV1A 2GLUA 2QM3A 4DZRA 4YUZA 1XVAA 2FK7A 1R8YA 2AVDA 1KPHA 3GCZA 5HIIA 1AV6A 5DRYA 2Z6AA 3MB5A 1T43A 1DL5A 4MTLA 2YXEA 4AZWA 3CGGA 2BR5A 2ZIEA 2JHCA 5EGSA 3GRUA 5BP7A 2O0LA 3G7UA 3TM5A 3UJ6A 3C6MA 5KYGA 1YZHA 3M4XA 1WS6A 2PWPA 3U81A 5CIYA 2NXEA 4DQ0A 4E2ZA 3MTIA 2IPXA 4E2YA 4YUWA 2I62A 2P3LA 2YR0A 1ORIA 3KU1A 5G02A 4E2WA 2NXNA 1JG3A 2ONZA 3P2IA 4X61A 4RTRA 4DMGA 3ELWA 3MERA 3TRKA 5E9QA 1SQFA 1RJEA 3ELUA 4FP9A 1D2CA 5CCBA 2CL5A 3AY0A 1UIRA 3FUVA 1QAMA 1M6EX 1F3LA 3TM4A 5HIMA 2ZLBA 3NDJA 4YV2A 5BXYA 3UJ9A 1IM8A 3OU2A 4E32A 4GF5A 5M5BA 3FUWA 1QYRA 3HVHA 3JWJA 2Y1WA 2R3SA 5EPEA 5LQJA 1RI2A 3A4TA 3FUUA 3B3GA 3G2OA 3LGAA 2QY6A 5D1NA 5U4XA 2P7IA 5FWAA 2AR0A 5EKXA 5E1OA 4GC9A 3HCDA 4DA4A 1M0EA 2OXTA 4FR0A 1G8SA 2ZWAA 3HCFA 5E1BA 2B25A 4PYMA 5ICFA 3LECA 2FPOA 4L7VA 1EJ6A 4FGZA 5DTQA 5F2OA 2GH1A 2VDUE 2YX1A 3EGIA 3OFKA 5K0FA 1DUSA 3RIEA 3LCUA 3OE5A 3PFHA 1JQ3A 2ZULA 3NWEA 2OB2A 2VZ9A 2PVCA 3O4FA 3TKAA 3EVZA 1NW6A 3GRVA 3GXOA 4KW7A 5FULA 3KQYA 3G2QA 5FUBA 2IGTA 4CKEA 3OU7A 5E1DA 3DR5A 3CVOA 2AN3A 4CWAA 5K09A 4HG2A 3KR2A 2HV9A 5K0LA 3FZGA 5EMMA 3FTCA 4UOEA 4Y2HA 2B3TA 2XBMA 1B42A 1RJGA 3UJCA 2AOVA 3PFGA 3CJTA 3I64A 1D2HA 3LBFA 3PX2A 2IP2A 4GOLD 4KDRA 2P8JA 3VC1A 2OZVA 2QYOA 3DUWA 5T67A 2ZBQA 3LCVB 3FPHA 5LQNA 3I5UA 3LX6A 2IBTA 3EGVA 2PX2A 5EIWA 3S68A 4YUXA 3DOUA 3C3PA 3C3YA 3CJRA 4ER6A 1AF7A 2O07A 5GINE 4PCAA 4ISCA 2PJDA 2IH4A 3HVKA 3KPJA 2E5WA 3UA4A 3FUXA 3EVEA 4DF3A 1HNNA 3A7DA 4WXHA 4HGZA 3A27A 1I9GA 2OB1A 3HM2A 4PYOA 2UYCA 1NE2A 2G71A 4ER5A 4QQKA 4Y30A 1KR5A 2I7CA 2YTZA 4G56A 3MGGA 4EMSA 4PYKA 1XXLA 2AOUB 5EOVA 2IH5A 3FPJA 3BXOA 2PX8A 2YQZA 1SUIA 3HCEA 2YVLA 4HC4A 3GJYA 3LPMA 1WG8A 1X1AA 3MTEA 3OPNA 3RODA 1YF3A 2XYRA 1NW8A 2VDVE 4QPNA 4QQNA 1UFKA 1Q0SA 4RTOA 2ZW9A 2ZVJA 3K6RA 4PYLA 3G5TA 4RTQA 2GB4A 1I1NA 2DULA 2P3QA 3D2LA 4RTSA 4ER0A 5KS2A 4RTNA 3TFWA 2HWKA 1VE3A 2AOTB 3VC2A 3ID6C 3LBYA 3GO4A 3PVCA 4RTJA 1MHTA 2ZWVA 1XCJA 4RVGA 3QOWA 3G8BA 2NYUA 1L9KA 1RI3A 3ERCA 4OQEA 5GWXA 1BC5A 3EMDA 3OE4A 3T7TA 2BR3A 2F8LA 3HA5A 3NWBA 3Q87B 1Y8CA 4FS8A 4IWNA 4O29A 3DLCA 5E8RA 3G8AA 2A14A 3B3JA 3B89A 3KQQA 1M6YA 4WVLA 2PKWA 3BKWA 3T7RA 3IEIA 4GOOD 1G38A 5GM2A 1XDZA 3KR1A 5LR6A 3BUSA 3EVAA
chains in the Genus database with same CATH superfamily
1Z8NA 2IXFA 1XKXA 3P0RA 4NMHA 1HDZA 2FQQA 2R7KA 1YQDA 4JYPA 1E64A 1VCHA 2KB0A 3K0FA 4ZOLB 5SYMA 1NBAA 5DVZA 2Y4NA 4CM1A 4FDTA 4YACA 3SSOA 1USVA 4F21A 5G41A 2C1ZA 2CHQA 2M6KA 1HBJA 3SM9A 1HR0B 4INPA 4QJ3A 2ZR0A 1K27A 2JFUA 1AIPA 2JH8A 2XV1A 5FL7D 4Z1MD 3DPSA 1VPDA 4XFDA 1V47A 2OEPA 2W42A 2IUEA 3R6DA 1XK7A 1J99A 4UMFA 1E7MA 1DBSA 2AE1A 1XRLA 2MJLA 3OCZA 1TIBA 2ACEA 5HPYB 4YV0A 2HSEA 4IJVA 2OG2A 4DCOA 1BO6A 5EJGA 4B3XA 1YK1A 2OHFA 3F5QA 5JVDF 1FYXA 4BB0A 4L76A 2O2JA 2J3MA 4MRNA 1I7QB 4NFLA 3AVVA 3GC6A 3R3HA 1NR7A 3UKDA 3B3FA 4E4TA 2XT6A 5L3QA 1DKPA 3KPYA 1C3JA 3G79A 3A9VA 4IV0A 4MWZA 1A82A 2YHSA 6NULA 5JRDS 3MS7A 4AMZA 1IOVA 1NTOA 2FSUA 2ZUDA 3OLWA 1IZYA 1E9DA 3OZFA 5EP3A 2RGNC 5JSZA 2FETA 2IKQA 2XMCA 5U9CA 2DQ4A 5C34B 5G4LA 2QLFA 3X1JA 3CG0A 1DEXA 2JIPA 4EYGA 3EEOA 1JWLA 1REQA 3KJIA 3LCCA 2Z43A 1EFPA 4C0AC 2Z98A 1SXQA 1GSOA 2R9VA 1P91A 2XDWA 2BVNA 4M49A 4W4TA 4IHAA 4RK7A 4P2BA 1D8TA 1YI0A 5FBHA 1AD2A 3I58A 2LBPA 3IA7A 2DWPA 4KZKA 3UK7A 5BUZA 2FN3A 2N42A 2PPLA 3HFGA 2Q4EA 4RVFA 3UAYA 2WHXA 1PGOA 4DLBA 1H4SA 3UGKA 2Q7OE 2A9PA 3B7WA 1G16A 2I6GA 3HN6A 3MJ4A 1OYWA 4M46A 4MKIA 2PKXA 1ID8A 3ZE9A 2DU8A 4MW2A 2FN4A 1I2AA 3OQIA 4JA2A 1S6YA 3AHJA 1OBCA 1LF5A 4OL9A 2R7NA 2WNIA 1GZDA 3VOTA 5A6SA 3LQ2A 1XNJA 2APJA 5M7EA 1H94A 5F3WB 3EQZA 1T1RA 4PONA 1G8MA 3IVGA 3S2ZA 3N3AC 5LLTA 2BTOA 3OQMA 1PZEA 2DHEA 4FUQA 3NDBB 2PD3A 3AVUA 5ICMA 3RYHB 3IT0A 1Q21A 4F1WA 2G9VA 3FFBA 2P41A 4PGMA 2QNRA 4EPYA 1NVVQ 5JQWA 3WYBA 3K2IA 1RQXA 1XTTA 4BVBA 4UULA 1JEJA 1FYFA 2X9NA 5B55A 4B2LA 4WXYB 3JATA 3P8ZA 5BPFA 2XXAB 5D00A 1J9GA 5KYKA 1L1EA 2J07A 4RJLA 3S1AB 1MTZA 3CGWA 4FILA 3N75A 4HQKA 2G83A 3HHEA 1PG2A 3QV1A 4KU4A 3NXSA 3PNQA 4RS3A 5HMMA 1QG4A 2X0EA 1JJVA 4ZK2A 4HXGA 5JDIC 2GZMA 3R6LA 1BVYF 3NYWA 3OQBA 2GJSA 4XGKA 2WTBA 1DADA 1K0UA 3D6JA 4UARA 1KJNA 5AKZA 3MVEA 1XYVA 4OPMA 5HS4A 3KG2A 1D0IA 1K8YB 1UP4A 2HKIA 3DDHA 4K28A 2W70A 2ZBDA 1H5QA 1TGYA 5LXTB 3IAAA 5FA5A 3W2EA 721PA 3VNBA 4EA8A 3LBIA 4YCAA 4UDYX 1X38A 1SXPA 1R3UA 2CF6A 4Z51A 5FD8A 3JQ7B 1JPNA 4C6TA 4LRUA 1Z6TA 4RH3A 4I5IA 4TTVA 5KTYA 2PYDA 3Q8KA 4EQ6A 4WASA 5CJJA 3RLIA 4US0R 1U6JA 3QUQA 4GX1A 4NESA 1TD1A 1FSSA 1GN9A 1OXSC 2I2DA 2PQ0A 5BSTA 4I81A 4WZAE 4KBFA 4Z1MA 2BSQA 2BW0A 3IVRA 1QZZA 1Z4IA 3FRIA 3P2EA 1U1CA 1T8WA 1VDZA 3ZV5A 4IUBS 3FKJA 3QVWA 5ED4A 1Y89A 1U0NA 3QFRA 1VPLA 1V6CA 2JRLA 2VUIB 2Y1XA 1WHTB 3W2HA 1U1GA 3ER9A 5FNVF 3VAYA 4NBNA 1KSHA 1FS6A 1XEXB 2RCYA 3O4HA 4CLOA 1KI4A 4OJKA 4DUGD 1GWNA 4L4RA 1G66A 1AO0A 4K46A 2RHGB 1P60A 4UXIA 5DEOA 5GGXA 4QTYA 2B82A 3A6GA 2NO5A 3AHHA 3OY2A 4B3BA 3RVQA 4RORA 3DGFC 2X0DA 3PKIA 1FJXA 2R6HA 4OK3A 3C1TA 3UAZA 3BF8A 1VB5A 3OZRA 4PV7A 2FN7A 2X19A 4JEIA 8MHTA 1QXSA 4H77A 2WM3A 3W3ZB 4OXYA 2C9YA 1GRRA 3R44A 4JXKA 3WR5A 3BE4A 5E3HA 2Y66A 3EXIA 2IYAA 1MOQA 1L5VA 2HM7A 2YV1A 2HMVA 4NATA 5AK4A 4A3SA 4EJ0A 4TTSA 2XADA 3VI3B 5EJ5A 3RE1A 1RFLA 5LZ5A 1GPKA 4BX2A 1CZUA 1H3FA 3DBRB 1FMJA 2C4HA 1N6IA 3I01M 1WMBA 3A32A 4LJLA 5SZJA 4AMBA 3H9QA 3UK0A 3JYOA 5IJ0A 3GLRA 4RFLA 1NP3A 1X3SA 3ELYA 4YMLA 5JXWA 2IYEA 1UMDB 4PLZA 5ALXA 2NU6B 2E0IA 3EZYA 4PO1A 1JQJC 3PHGA 2JLQA 3ZNQA 4L73A 2HHJA 2WAXA 1L7VC 4F4HA 1SVWA 2ONKA 3C6KA 4MI9A 2IU0A 3SICE 1JIIA 3VOAA 4PEVA 4KQHA 1AK9A 4C4YA 2AC4A 5C1IA 2G5TA 3MJHA 1J06A 2UXCB 4IXNA 4LY3A 4U2CA 5C3UA 3GCWA 3WHKA 5LQUA 2H1OA 2H7YA 3RK4A 3FBWA 2I6UA 2WHPA 3QLEA 2VHEA 4MQ5A 4D3DA 1UZMA 4IJWA 4ZGGA 3QVKA 1KDYA 3OUTA 3MSCA 3EGOA 5T64A 5HJ5A 3W5JA 4J1SA 1ENPA 1XQVA 3AR2A 2XMRA 1SCIA 3DDUA 4GO1A 4J7XA 4DYHA 5K0GA 4JXZA 4ODIA 3DBLB 3WQRA 2QT1A 1P2UA 1KI6A 1WUTA 1Q6ZA 3N6VA 4D82A 1O9GA 1SBHA 4D3FA 2UZ3A 3ZLUA 1Q83A 3T9AA 1XTRA 4BVGA 2I6QA 2J7PD 3DBVO 3HXKA 4AKSA 5JU6A 2P1RA 5KI6A 1XQ6A 1S9HA 1JI3A 1E2KA 4EGJA 1KP3A 1ZJ5A 4MVJG 4CXMA 2H85A 3PCTA 1UFRA 3ZE2B 1XYGA 2CNLA 3CY6A 1JYFA 3DCIA 1TMOA 2H11A 2JEOA 3AP2A 5E4JA 3VBEA 1G0NA 1HLDA 4RPKA 1VTKA 1MR3F 4RO0A 2OCKA 1CUWA 5G3YA 3TQSA 4LFAB 3TLCA 2E6KA 3OQHA 3DV9A 3V2UA 1V71A 2YIJA 3E7PA 2PFGA 1POXA 2AXNA 2XOKA 1GL7A 3CLUC 1RWPA 16PKA 3CZCA 2XGMA 4KR0A 4MR7B 1RTTA 1TLLA 2HPHA 5IBPA 3SOPA 3FVTA 4EBFA 1N77A 2L42A 1RYNA 1UPUA 1QYWA 2XDQB 3DWFA 4LGMA 1KDVA 2PSJA 3VPXA 4OQXA 3HEAA 5HZHA 3X1XA 3MINA 5FNVA 5LIPA 4C7OA 4XEUA 5G0WA 3MOIA 2A6PA 1GTVA 1JZTA 2E4UA 2E2WA 4WZBA 1AQLA 4YJHB 2QP3A 2VAMA 5HRUA 3E35A 3WK8A 3TEJA 2OWEA 4PZ9A 4A1OA 5F9HA 1SHUX 4LQLA 3KL4A 4REOA 3BL5A 4MIYA 1I5RA 3IP7A 5KPDA 1WUKS 3BD7A 5JAMA 3MTDA 1B93A 3BEOA 5FO1A 2A3RA 1ENZA 1TLFA 5AJUA 3QOFA 5LUBA 3ZBTA 2ZB4A 4RK6A 1M2GA 3SSMA 2YICA 1G5PA 1RE0A 1ZM2A 4IV8A 4YH1A 5BW8A 4EYQA 4DCCA 2W4MA 3P32A 1SUEA 3A28A 2GRAA 3H9CA 4RIHA 4TZTA 4F6RA 4IDPA 3WS7A 1CUIA 3EQ9A 2E48A 1PS9A 3A6LA 3V33A 1PWEA 3PQCA 4PG6A 4W5HA 1WY7A 3BRQA 5HXAA 4BV3A 3GLTA 5HA5A 2QAGC 1QK4A 4TRNA 3QLUC 3UKOA 2RK4A 3FRJA 1XRPA 4FOSA 3HJTA 5G3ZA 5TVGA 5JQGA 2AG1A 2A5DA 4GOKA 3VNSA 3SYNA 3CVWA 3N6XA 4GQBA 1J0DA 1UAYA 1I36A 1P6QA 1AQIA 1NF8A 3FG9A 3NOVA 4FEAA 4G3XA 5TQJA 1YHZA 1JZQA 3MGCA 1OVMA 3SS9X 4Q3AA 2FFJA 2WZDA 3OEHD 4M1QA 1SVIA 2V7QA 1PDVA 3RAGA 5B7GA 2PT7A 1AZSC 4AM8A 1EK5A 1G8AA 2ZSAA 4DDUA 3ORQA 2QJRA 2PK3A 3PLAE 1QR2A 1MPTA 3FDIA 1H0HA 1XQ9A 4TLCA 4AMUA 2F8SA 1EG7A 4J90A 4J3FA 1L5HA 1K2WA 4DDMA 4C5CA 4XJTA 5BR4A 1L7MA 4RY8A 3WFJA 2EZ9A 2O7QA 3L93A 1E98A 2RGRA 1SVSA 4M98A 1T2DA 1U1IA 2D5BA 1YL5A 1X2EA 4HATA 2BDEA 1ZMXA 3U4MA 3AJ8A 2CJWA 1EB8A 4YMUA 4HWOA 1N1GA 1QYCA 2VNAA 2XTNA 3E53A 2FN8A 3IESA 2R6R1 3ASZA 3WL7A 3ZHUA 4YX9A 1B3BA 2B6HA 4IVQA 4ZWNA 3ZTWA 3PE4A 3WSWA 3L9WA 5EE9A 4F4JA 2RGUA 1BQ3A 3D3QA 3ADBA 3QWHA 1OLUA 1T1SA 1O0SA 3DVRX 4J2HA 1VKNA 4BCCA 3GLHE 4D74A 4IJMA 4DFDA 3T3HA 3J81A 2HEGA 3I2JA 4QDUA 3CZ5A 2W8BA 4MGKR 3UVEA 1H1LA 3AY0A 3FUVA 3L7KA 3C15C 3FIUA 3JASB 1CNEA 3K72B 3WY9A 1CR2A 2PA3A 3A1TA 4KV9A 1NFFA 2XYPA 1LQ2A 3L02A 4GUDA 3CZRA 3HMQA 1EKXA 3KXIA 3T9EA 3JWJA 5LNK1 4LJRA 1B0UA 4WECA 3G2OA 2OAGA 4UPEA 5U4XA 1CE8A 5FAKA 1O89A 5L40A 2WTUA 2AHOA 3HGQA 4I5FA 5EKXA 1OLOA 1FE8A 3UEOA 4K9DA 1G98A 4FR0A 5E1BA 4NJOA 3VZCA 4F3CA 1CQIB 4Q1DA 1DBRA 1JIXA 4J0FA 2QXYA 4YS6A 5ALFA 1Z7GA 1G7TA 3B9PA 4L7QA 1BFUA 1K89A 4EI7A 3KYCA 3CX3A 3INRA 5CXSA 4M7WA 4OHRA 1BS9A 1MQ9A 4B6QA 2H6EA 1M1NA 3H8JA 3KHUA 3FHJA 1VCOA 5FX2A 3MRVA 1DE0A 5JXIA 3MRTA 1TXGA 2ZRPA 1NLFA 1Y4DE 3AFHA 3KQYA 4YI5A 5I8PA 4A2WA 3GVHA 3ZWPA 1EE9A 1OWPA 2YQ5A 1UUFA 2I4OA 2OBNA 2Z2YA 4IYJA 3PXEA 2UUPA 2ZI6A 4JVNA 4K6HA 4PPGA 2JF0A 1T1EA 2HV9A 4K03A 3FZGA 4YXFA 2WD8A 1E7RA 4JJEA 1OXVA 2LDBA 3SX4A 2EKPA 1X1EA 2X7JA 1KH1A 3LBAA 1T91A 2BEUB 2ZM5A 3DUWA 1RXUA 1MZVA 2H1LA 2QJFA 3PHJA 1KQFA 3B8HA 2NYAA 2EARA 2Q45A 1C7QA 1S4MA 3JU3A 3NHZA 2V6GA 4AQYB 3MNFA 4G5YA 2JIRA 1U0OC 1VYTA 3IV7A 1RVV1 3L1IA 4N01A 3ZS8A 3DD1A 4Y2JA 2ZRJA 4ZAGA 2PS1A 3WLMA 3C70A 4QHSA 2G82A 1DNPA 3OH8A 5CX4A 4PGFA 3G5MA 1SCUA 3AESB 4U02A 5IFKA 2G71A 2JIDA 4CM4A 1E60A 1J09A 2SCUA 5EYPB 4FEEA 1GUAA 3H2KA 4DB2A 3X1ZA 1XT6A 2F8TA 3HU5A 3ITEA 1QVVA 2IP1A 3FY4A 5CLQA 3EBLA 1QCCA 3L7OA 4AB1A 5KYUB 1MVLA 1TJ5A 1TEZA 4IZIA 5ALDA 3T5CA 1G3UA 3W5AA 1YF3A 3OPNA 4QRIA 4RMHA 3I61A 1P31A 3GB9A 4URHA 2OC9A 1NJ5A 2OCGA 2QTWB 4RU1A 2XD4A 4I9UA 4UFPA 2YHUA 2IZZA 3L8HA 2ZANA 4RTOA 4D80A 1UXOA 1N2ZA 2CZGA 3GJ6A 1M2EA 2NV2B 4X3OA 4FGKA 2DPYA 3ILXA 1YDFA 1DHRA 4HPJB 2XCSB 1FX0A 2ASEA 2Q4DA 3ZV3A 5BV1A 2QZ4A 4AI6A 1ETUA 5CJPA 1EFHA 4Q4AA 3UIEA 2OORA 3C87A 1BC5A 3OM1A 1X7YA 3PHIA 4O4JB 2VYVA 2I71A 1AKUA 2A14A 2CZQA 1A5TA 4XJXA 4PG8A 3LXRA 1M6YA 3SFZA 4D7AA 2DF8A 4L1KA 4P54A 3H84A 1WXQA 4EY4A 4GYYA 4R41A 1Z0ZA 3CIOA 4QJ4A 1Z47A 1VFPA 3A1NA 1HGXA 4ZC8A 4DRYA 1H8EA 2WUGA 3TPCA 2X4LA 3LRXA 1LF0A 5AVYA 1NKTA 2CLDX 4GZ5A 4NIMA 2Z4SA 2XZPA 1KFBB 2FF5A 2PXCA 5GVSA 4I1YA 4N5MA 4B79A 3EPJA 1FJ2A 2VSQA 5CA0B 4HD8A 4UBJA 3QVVA 2FPWA 1WAMA 2GTHA 4J75A 2I5PO 5I6DA 3R8CA 4H17A 4RESA 3MUEA 1CG6A 2XX3A 3H2ZA 4M8IA 2CHUA 1XMVA 3I5AA 2V9ZA 5GIOE 2VFAA 3UJPA 1F1BA 4C0XA 3V8QA 2FP4B 2XUGA 3NRCA 3KOOA 3QVJA 2UZ4A 4LBZA 3KPWA 1E32A 3BRWA 2PZLA 4QVKA 1G9TA 4MUMA 2I78A 4FFBA 1T5OA 2CXHA 3I9V1 2JLZA 4K9RA 1AS3A 1FLVA 4DBLC 2AYYA 1PVVA 1XD8A 3MSXA 1DG3A 2YDYA 4I99A 4C05A 2CLMB 3ZLJA 1SXGA 2O1WA 1XELA 1VFNA 5DYGA 4FWTA 5REQB 4MIEA 2FW9A 4RVDA 3GLIE 4WH0A 1XVIA 1GO2A 4WY8A 1Y82A 3LVRE 1VKHA 4MVJI 4RSMA 4ECEA 4O0LA 1TD9A 1T4CB 2RHJA 5FTWA 4J4BA 3RKSA 1QV6A 3BGDA 3MOGA 3F2VA 4II3A 2BBSA 4MYDA 5AICA 5B37A 1MV5A 3FNHA 2Y6UA 1SU6A 4K9KA 3SMQA 5I7RA 1TYEB 2OTCA 1GPNA 4B7ZA 2GSWA 2QZJA 4IIEA 5A62A 3KQLA 1I80A 1LSJA 3RADC 3V7YA 4RTKA 2JZOA 1MW8X 3P4XA 3GJQA 2ERXA 4TM8A 4BJ1A 2C83A 4URFA 3MCUA 4WLNA 3CVYA 4ER3A 1ID1A 1ZD8A 1M2FA 3NHWA 4JYBA 2Z6UA 1BNCA 2OZKA 4I8DA 4M1YA 1K8ZB 4EATA 1ILWA 1LFAA 1X1RA 1L5QA 1WQ3A 4BNUA 1DLIA 2LGJA 3TZEA 4UHJA 3QOXA 1EA7A 2ABWA 4ZVPA 1U9ZA 4D0SA 2AJTA 4NNOA 1I0IA 1PLJA 4LWOA 2Q5CA 4PFJA 5E9AA 5A7GA 2WKRA 4UBKA 1Z0IA 2J30A 4LGVA 1KYIA 4P7KA 4A8JB 4M1OA 4ZZIA 2Q6VA 1N5JA 1DGQA 1YDMA 2Q3EA 4EB6B 3VVCA 1KJ8A 1PHPA 3A2KA 2M98A 3FOBA 5FEMA 1P7VA 2FX2A 3IQXA 4OD0A 2VTKA 4CFZA 4B76A 3THSA 4RQUA 1PNVA 1MO6A 1TOAA 1UC5B 2B9VA 1Z83A 1BX3A 3OIYA 2PUFA 5CA1B 4ZCRA 5EQDA 3ICQB 1XCLA 4X0EA 2E5LB 3GMDA 4NJEB 1F8FA 1SUSA 1NR5A 2CL0X 2DH5A 4IDAA 1N0VC 2YV5A 1RJ9B 1LVUA 5E9JA 1LK0A 2I9KA 3CEPB 1R9JA 1TZJA 2CXQA 4MWEA 2XB4A 1XPUA 1EVKA 3P5SA 1U1EA 2R68A 1KORA 1RVDA 3ZU2A 3PEWA 3I6YA 1GU1A 1P7WA 1TADA 2K5UA 4YMSA 5LZ4A 2D1TA 2FQYA 2BFNA 1HYHA 1RHQA 1YB7A 3D3JA 3I9NA 3RD5A 1C7ZA 2GT1A 1MEOA 3QUTA 4HUQA 1FSGA 2OCAA 1JMYA 3V1TC 3N8GA 3SS8A 3IMEA 3HYLA 4MICA 1SUWA 4HNGA 4RCVA 1G5TA 5IAAA 2BISA 3L4KA 3F1KA 3VVBA 1BDHA 1YRBA 4KZPA 2WSIA 4F7WA 4UM8B 4YRDA 2IV2X 1OB5A 1UBUS 4HNAB 1ULAA 4LBWA 5DX8A 4C4OA 1QUEA 1J2EA 2EDCA 4DJAA 5AI4A 5KC8A 1GT6A 1HT0A 2GBLA 3EXFB 2PL3A 1A9RA 3R0VA 4D96A 1DO2A 2BGUA 3SEZA 4OX9Y 4TUYF 3RYIA 4B80A 2YS7A 2HH9A 4OMUA 4WACA 1BZYA 4XWOA 1QH0A 3WB2A 5KJFA 3JQRA 1JHVA 1R9NA 2BR4A 2IXAA 3KSUA 5KYXB 1E7WA 3TG8A 4TV8F 2VAXA 1V2GA 3PIRA 1SR8A 1U5BA 2Q7XA 4FYJA 4LRYA 4Y1GA 3TFQA 3ZX4A 4BQOA 4HVCA 2H59A 1GNQA 2G7MC 4ZZ2A 2NTEA 4TXNA 2JLUA 1KMMA 3LG2A 3PIDA 2P6UA 5JHGB 3EDYA 3F0TA 1T5BA 1GL9B 2XQGA 1H2HA 1A4IA 1QMGA 3VYUB 4M8SA 1ENOA 1K2VN 1Q7EA 5ICGA 2IHNA 4WESB 1K98A 1Q1GA 2ORWA 3IS3A 3FJYA 3L8MA 1N7GA 4GKKB 2GHIA 3NW9A 3RANA 2R84A 4Q7QA 1RSZA 1OYOA 4Y9RA 2DPMA 5CDSA 5EJ8A 1P17A 5AOAA 3KZMA 1ACLA 4J9VA 4UZFA 3TVYA 2C2BA 3IMKA 5KOJA 2EJVA 2PBLA 1R3DA 1LY1A 3OO1A 2C2HA 4HI0E 4U9HS 2ZG6A 3RTGA 2ONYA 2V59A 4XDGA 2FPUA 5J4KA 4DV3B 2IK8A 2G04A 4FC7A 4G1EB 4RZ2A 1GTL1 3AIIA 1HT3A 4QNMA 5ECDA 3KE8A 2OZPA 5ALJA 4JBNA 4LOAA 2C2ZA 1Z22A 3VTZA 4Q3CA 3O1HB 4IJQA 2R65A 3A6PC 2BMJA 2EP7A 5J2UB 4QXOA 2LTAA 3SF0A 2J0UB 4B0OA 5C7YA 3HDJA 3ROKA 1ADGA 5HYVA 2X6QA 1B26A 2QX6A 1H4VB 3IAS6 3LUHA 3KQNA 4CBVA 2OO7A 2DUNA 1DX4A 3EZNA 4HLUC 2KLBA 1TM2A 3F6YA 2IEIA 4MPTA 4JH0A 2NXCA 1Z2DA 2P9QA 2XCQA 2WFMA 3EYAA 3UHOA 2GK6A 3RS0A 2ZK7A 3HKDA 3SJCA 1RM0A 2J9XB 3D2BA 3OM0A 1FDIA 3PUWA 1CVRA 1OXBB 1U4NA 1Z16A 2ZKIA 5FHQA 1O6ZA 1UEIA 2HF2A 4MI3A 4QO7A 3MPOA 5CNIA 3F7TA 2YJZA 5J23A 4ZEWA 3U26A 5LDHA 5CD9A 3DC2A 1IWPB 2QVYX 3DEKA 3IDFA 5JNSA 1HWYA 2CBGA 3IPLA 4JCCA 4AQDA 2VBCA 3QG5A 4OKIA 2PH5A 3FBTA 1ZNXA 2H16A 4CDRA 4DIDA 2EWWA 1S1MA 1IMOA 4C4TA 2ZFUA 1NJ1A 3MCVA 5AJZA 4ZCPA 1A98A 1XZEA 4ZOLF 5HBGA 1EAMA 4PICA 1ZGAA 3FI0A 4LYJA 2PV7A 3R23A 5FLXA 4DR3B 3VNUA 2Z83A 4BWVA 2G40A 4ZK6A 4MAMA 4E1AA 3ZZUA 3PPYA 1ONOA 1W96A 4MRPA 2JGDA 2P4QA 1UPBA 4ML3A 2E1PA 3UB3A 2I2WA 1G4AE 4BL5A 2QR2A 4EL5A 2QE7D 3K9LA 4B2IA 3DE5X 3IDSA 1YRLA 3ENNA 2E55A 4FFWA 4ND7A 5K3BA 1EXDA 3K9NA 4TUYA 3ORHA 1F8UA 2ZS9A 5KTSA 5DM60 3ZHZA 3EG9A 2AVNA 1PR2A 2I76A 1JSCA 3DQPA 3G2NA 4EJFA 1Q7GA 2WYIA 3IP1A 8OHMA 1A4XA 2P9HA 4XAQA 2R48A 4EAAA 5T8KA 1YU9A 2H5IA 3A3PA 2Q4TA 3GFBA 2JDID 4N0EA 4PY2A 4TV8A 1MABA 1U31A 4M99A 1W36D 4Q1CA 4C0LA 2IFTA 4KVGA 3U3MA 4EGSA 4ZRMA 5JC8A 2W6MA 2V7WA 3K09C 4CHGA 4YDSA 4EW1A 3ER8A 3OZAA 5FBZA 2Y76A 3PU6A 2R47A 1R7RA 3IOEA 3CZMA 3PC7A 3DAPA 4H1UA 2YWRA 4OHPA 2QV7A 4E51A 4BQFA 1GM5A 2F62A 4X3CA 2FSHA 4DAEA 1NVMB 2VT2A 3B6IA 3G68A 4O3FA 1PU2A 2CC2A 3FNFA 1PYOA 2P9FA 4NPCA 3PD7A 4XB6B 3WL5A 1T3HA 2QVZX 2GJKA 3L1UA 4QOGA 1ZVVA 1TTPB 1GNPA 1WUHS 2AOUA 4UVDA 3IBCA 4QXQA 4DQDA 2VT3A 4L07A 1XCMA 2C96A 4C1NA 5HHTA 3HCWA 4JUCA 4JC4A 2V7BA 2J5KA 1E3TA 2IS4A 3FPAA 3IPYA 4XIJA 2KW5A 4I9GA 3VU8A 3ZWDA 5CB0A 2EQAA 3L92A 3WNCA 4BKUA 4OXRA 2WJAA 3GUYA 4I19A 3TQFA 5A5VA 2DY0A 3L5KA 2WJVA 3MS2A 4BCDA 4JGBA 1HZZA 1ZGBA 2V7XA 4RSRA 4UMVA 4UTPA 1LBQA 2GXAA 3LXMA 3QVXA 3PDIB 4TS4A 4UCXA 5EIAA 2WF7A 4KPUB 5KOIA 1BDBA 1QDLB 3TQTA 1ADJA 4DABA 2REXB 1M2NA 4FYIA 4KAJA 4RUKA 1A72A 3I30X 1KEUA 1EP3B 4NRDA 2FK7A 2X0NA 2X0KA 3O6VA 4O2AB 3WXMA 3VI4B 5C7IO 2WQZA 5DRYA 2PZ8A 1BD4A 1X74A 3FETA 1E0SA 3M6FA 4D9IA 3ENQA 4Z53A 3GELA 3VHLB 3Q3HA 1R0BA 1ZIPA 5HFNA 2YJNA 3EEBA 3O8QA 3SBXA 3G7UA 4KLRA 3PA6A 1DAMA 4G01B 3ON5A 1UIMA 3ROEA 4CV3A 2C92A 1MB3A 2IYFA 1FYEA 4MCHA 2C5HA 3RRJA 3FLMA 3YASA 4MULA 4ZOLA 3ZR4B 4WFIA 3RWMB 4GZ6A 4MQBA 2X58A 3KJGA 4RJKA 3BOSA 4EG6A 4CDNA 1ZOIA 3B9RA 1JG3A 3N2GB 1XA0A 4X94A 2J0VA 2WZQA 2BV3A 5LXTF 3ELWA 4DEVA 4LXIA 4YDQA 3HXMA 1ZLYA 1LLDA 1Q15A 4RGQA 1ND5A 3SQMA 2ATCA 4E5NA 1V3UA 1YS7A 3BHNA 3CZPA 3BGOS 1EUQA 4HYEA 4F6LA 2HZBA 1IBMB 4EG7A 2ZWIA 2EL7A 3TXXA 1RWOA 1Z6QA 4GSKA 4WGGA 1WXHA 1MRNA 3V7FA 1ABEA 2P68A 2QVBA 3E58A 2K6GA 2Q29A 2WIDA 2OGTA 3IP3A 4IMPA 5F5XA 4LZAA 1NP6A 1WZIA 4U2EA 3AI2A 3CM0A 5KJEA 3WQQA 1HL7A 3COVA 3CF4A 3U9LA 4CMIA 2QE7A 3EQ7A 4HDRB 2OQIA 2OZLB 1ULSA 1RKBA 3DEIA 1P8JA 4I4TB 4N7JA 1LBHA 3ETJA 1HEUA 2X23A 3D43A 1HDXA 3A10A 4PFKA 2W90A 3N8IA 5F35A 5DK4A 4AT1A 4PZLA 1Z35A 2H48A 3DTTA 8ADHA 1EFAA 1A2KC 1OT5A 3R0JA 1QYDA 2YVQA 1T9DA 1TX4B 3EVZA 5EVCA 4BPRA 1V1JA 1MRSA 2HB6A 1COWD 1J70A 1L4NA 1Z4OA 2GYYA 4TV9F 4MUIA 4X90A 1LVGA 3QW4B 2NNLD 4R2MA 2WDPA 4XLTA 4ZO4A 1Z12A 3SNHA 2FZLA 4QSHA 3VR5D 5EERA 3HR8A 1YONA 2OAQ1 3R8FA 4LY0A 1MO5A 3AF4A 2QTLA 1OI2A 3LBFA 8ABPA 2QLJA 4QC2A 3O2QB 2EF1A 1YMQA 1JFVA 3EASA 4K3VA 5LA6B 3BK7A 2VHXA 1PQWA 2FR8A 3D3WA 5H5JA 4BV8A 2MSWA 4EYSA 4Z4CA 4E94A 3TSWA 5LQNA 2IBTA 3DVSX 4X6UA 421PA 3NC4A 3UMFA 4F5DA 1QGYA 4MMYB 4YAGA 5JEEA 3OA2A 1U3UA 3C3YA 3CJRA 1KIMA 4L4ZA 4R98A 3VZRA 6LDHA 3I5MA 5FWXB 3GBVA 2OXIA 4EJ6A 3LC7O 3OQPA 5ALEA 5CRIA 1YDGA 2A0WA 3G0IA 4DUYB 2GOYA 3A7DA 4IOKA 4WXHA 1XZFA 2FI1A 5AKLA 1OBVA 2QMQA 4IAOA 2R86A 1NE2A 2EVWX 4ER5A 1CUYA 2ZU0C 3SHFA 4TMXA 1LEHA 3GCGA 5AK3A 4CMGA 3Q6MA 2B98A 3R5FA 3OEEA 5DK6A 1KZ1A 2CBXA 3A04A 1SUIA 1J0XO 2IDMA 3X1YA 2YVLA 5CG1A 3RSGA 1NL3A 2OYSA 2F3PA 5EMNA 5TSDA 4GZ3A 1A95A 3GVPA 4A0SA 5C81A 5CFQA 5CFLA 1I1HA 4QPNA 1XAJA 3SVLA 3LF2A 2VJPA 1JDSA 1BU5A 4C20A 3C41J 2JNWA 4PYLA 4Q82A 3BH7A 1OV4A 2H1VA 2CDBA 5E6UB 4RTSA 3S1AA 1CB7A 2ZSKA 3LE8A 4NYJQ 1Y9JA 3BTOA 3QEJA 2XCIA 1LTQA 1ODCA 2P79A 2CFTA 4FGWA 4LSMA 5CK5A 1GZ4A 2QRPA 3FOWA 4Y3UA 1TA9A 4LYYA 3PVCA 5L3RA 2PKCA 3QI2A 2H8KA 2HI0A 1LPPA 4BJ3A 1IAQA 4ZQGA 4JJ7A 2JAWA 5FWYB 5LXTA 1CQPA 1ODJA 4OQEA 1CRLA 4WCFC 3A3OA 1YR7A 3FYHA 3T7TA 3UMBA 3BAFA 1J8DA 3ZXYA 4QREA 3LD9A 3OZGA 2P30A 4OUDA 3ET5A 4CMAA 4P5PA 3B89A 1MUUA 2FQXA 3GVXA 1QDEA 5C1DA 3VR6D 1W1WA 1SB9A 3TZQA 3AQIA 3OQJA 4ZQIA 5LR6A 1BG6A 2IGBA 2VP5A 3OZ7A 4YCSA 2YJ4A 1A5ZA 2ORYA 1P2TA 3JAKB 1EG2A 3K05A 2XRMA 4MUGA 3HU1A 2IBSA 4CKWB 1FVOA 2WWIA 2ZT8A 3OPYB 4MXDA 4UMDA 2ZIGA 4D42A 1M2WA 3GF4A 2BP7A 3MMZA 3W8RA 1TB4A 4XEHA 3SXUB 2IU6A 1WHTA 4NMMA 3TAHA 4C07A 4DHWA 2ECKA 3ZKWB 1HORA 3ECAA 3VX4A 5FDFA 1RYEA 3OSUA 4TPKA 4V2UA 4X1YA 2XUIA 4EA9A 3Q3JB 4TS9A 5IBRA 2NSYA 2YS6A 3EPHA 4GMXA 2RGXA 2C99A 1TUGA 1CY6A 4ZA2A 3ND5A 5C5CA 4E22A 3AP3A 3ILYA 3A14A 1K3UB 1IG0A 1QZ3A 5JFOA 4DLUA 4Q39A 4TV9A 1USKA 4KBYA 1XV5A 3RUCA 3W8FA 1CY4A 2WD7A 1VSVA 3U9TA 1I30A 1RRVA 2PFKA 3WWDA 1CHDA 2EWMA 4BGVA 4DC0A 3Q8XB 4MUKA 3ND7A 3VRHA 4BN4A 2X4GA 3EWSA 5AHKA 4EHLA 4BTVA 5J43A 4M7RA 4TMKA 4BYGA 2WA1A 2FWMX 3G1TA 2WWWA 1ZH0A 1Z5ZA 1R12A 4Y7CA 1KQGA 3TQIA 1C80A 2ZXFA 4IQGA 1ZINA 4HL6A 2BFCA 4EFNA 3DBRA 2XUQA 5HQJA 5BYJA 1G6HA 1X7XA 3INTA 2HCJB 1E59A 1T2NA 4LQ4A 4UDOA 1NVFA 1UMDA 3EY4A 1NV9A 2NU6A 3I9JA 2PEYA 2H5JA 3G0OA 4EMBA 4G1MB 9LDBA 5KHAA 3NHUA 4ZGBA 1O94C 3MRXA 4QU5A 3EE6A 5IN5A 1XVLA 2CNKA 3CRZA 3RTEA 4DA8A 5AUPB 5C31A 3NH9A 3O7WA 2BM1A 1NE7A 4JR0A 5A0FA 3GNSA 3GHHA 4RZXA 3WLKX 3K5HA 5DBOA 3T1NA 3NHYA 5EKSA 1A88A 3ISJA 5I7UA 1FFAA 1RKVA 2ADMA 1N33B 5DM0A 5EZQA 2DR0A 3TBFA 4PNHA 1CUGA 3AUSA 3RDPA 3E05A 4BAGA 1IRIA 1BWSA 4JR2A 4K6MA 3I05A 3TAUA 1HE2A 3USZA 5LPNA 4HAXA 5DGDA 5IN4A 3DBLA 4LPKA 4A6PA 1A9OA 4ENRA 2QYHA 4NZNA 4ZMRA 3DLPX 4IICA 3JTEA 5ES3A 3GQVA 5TEVA 3TQQA 3G0HA 3Q7PA 2IWRA 2VK8A 5KWJA 4LXYA 4NFYA 1I7PA 1NQVA 2XMPA 3DM9B 2FEXA 3PQ8A 3H9EO 2JFPA 3RTDA 3HJBA 1DEHA 4G5RA 4IFIA 1UDRA 2YNMC 2ZYDA 4U7HA 5IDXA 4CW7A 5JJKA 4EI8A 3TN7A 2QMOA 3PC4A 2GA8A 2XTAA 5ICEA 4KQ2A 1AQJA 1NRWA 3LGXA 4O2LA 4JY7A 5BWMA 4DTIA 2W0MA 2HYIC 2IY9A 5PGMA 5FBVB 3U48A 3DFKA 2QGNA 4Z5XA 1GT91 3RQSA 1G7SA 3FPEA 1QLHA 4FJ0A 4UHBA 1LNQA 1FFEA 5BQFA 1NULA 5L9AA 1PT9A 3QMVA 4K9PA 1PD0A 1K9SA 1LSSA 4MYRA 4EHDA 3DYIA 1ESDA 4JELA 4P38A 2V3VA 2W2TA 3KJEA 5DHQA 4MR7A 1A9YA 5FLYA 3DOHA 2QMZA 4OLHA 2D13A 1Z34A 2RGAA 2K4MA 4R3UC 4MRRA 2DQYA 4R1MA 1D6NA 5LSAA 1NGSA 5D5HA 2XDYA 4RHUA 2JZNA 3DFIA 1I6KA 2QRHA 3R0XA 3G0DA 4RM2A 2AE2A 2COKA 1NM5C 5DGXA 3ZV4A 5DNUA 2WVHA 1ZGJA 3H6GA 4ZCQA 3NMUF 1CCWA 4AZVA 4UUOA 4QG3A 4GH5A 4ITUA 3ZC3A 4MV1A 4YJHA 1IM5A 1FS4A 1ZUNB 4D41A 1LRKA 1EUYA 2FZWA 3PQ7A 3LCRA 3BFPA 3S2FA 1E1KA 2O7VA 1U8FO 3CR7A 1SPXA 2DY1A 3WHPA 4HN2A 2HGSA 4LWZA 3KP1A 5IJXA 4ZO8A 2C9OA 2AZMA 1EVJA 3FRHA 3A6FA 2PA0A 2CE2X 4R5MA 2WWVD 2ZAYA 3L4BA 4X6YA 4XD7D 4CKBA 5LWQA 3EHEA 2K7FA 1NVVR 1C3EA 2JBWA 2J9YB 4P3NA 2AR7A 3V6MA 4IQ8A 1BKYA 1V95A 4GKBA 2ZZNA 2Y1OA 2V6BA 4M6WB 1G2QA 4EB3A 4AG6A 2WVGA 3M4JA 2O6LA 2O4UX 2W6OA 3RBZA 3OMLA 4AS2A 4DEYA 1GG2A 4MA0A 4YYEA 3ESAA 3LC0A 3MMNA 2AW3A 3ZXXA 3TB6A 2B4RO 4I3HA 1RXWA 5J3JA 3FSGA 2PQMA 4MZXA 3UT6A 2NVOA 1AUQA 1BJKA 3QELB 5BUCA 4PLTA 5IASA 3NBKA 2ZP1A 5LLDA 3GQBB 3TUJC 3K9QO 3PGMA 2VBGA 1GZ3A 3BORA 2W2VA 4PZCA 4BNXA 3AR6A 3AOEA 3P9RA 2CXNA 3R4CA 4HFMA 1DQZA 1XTVA 4HQOA 4HXFB 3T7RA 4R1QA 5JCPA 1CY8A 4R40A 4RF5A 3WWOA 5DM1A 2FYTA 1IXZA 1OFUA 2HREA 4PXAA 4Z7QB 2O8EA 2CLLB 2HUPA 1GPDG 3EMVA 4HDQB 3SJZA 3TRFA 3HBFA 5AK5A 3U4AA 1GQOA 1L1FA 4WBNF 5IFLA 2Q62A 1N8TA 1B6GA 3OBIA 3RPEA 3KVYA 4UTNA 5EUCA 3L07A 1Z38A 1BHSA 1KL7A 1WB6A 3KAPA 4RELA 4IX1A 1SBTA 1MORA 3W90A 4MK4A 1K5HA 1N2CB 4FW9A 4BYMA 5DXAA 5HM8A 2B37A 3PTZA 1A9XB 5L3ZA 3BFKA 3RABA 2HEIA 5K6AA 4WN9A 4FHCA 4F5EA 3U7FB 5IYZB 2MSCB 1F6BA 3QTLA 4HWRA 2A0KA 1KY5A 2BKAA 2JH3A 4UBOA 4JKIA 4XW2A 3MS4A 3BIOA 3TCKA 4PYNA 5IMBA 3TRIA 5LM3A 1ZVMA 3VO2A 3WTCA 4G0ZA 4CIWA 2H31A 3OZTA 4AZTA 3RV4A 2HUNA 4F8EA 1O9BA 3VZSA 1SXJD 1Y8RB 3VU3A 4RIFA 4AZ3B 2ALJA 2HSWA 3NB0A 4TKUA 2BCJQ 2WAOA 3WKDA 3ISVA 1X9IA 2AL7A 4TWZA 4JXJA 4JDPA 1YAHA 5SZHB 1KSGA 3SK0A 4BB9A 1FJGB 1IUKA 5A0VA 4MX8A 1HX7A 4UNSA 1KDPA 1G2PA 2X7HA 1ZM3A 3K0AB 4HS4A 3F6EX 3F9RA 3OFJA 4GYKA 2ODQA 4NH4A 2B3DA 5A4IS 4IDDA 5DNCA 4DDWA 1D1SA 3COSA 2C0CA 3E5MA 3SAJA 1P1CA 5AJWA 5G0VA 3TZBA 3RBVA 1SPBS 3KZNA 1QG6A 1XZDA 1F5SA 1PQYA 3QFSA 1OBFO 1CRZA 1IH8A 3GJRA 3VZQA 3JYLA 4R6WA 3RC3A 3GRYA 1TW3A 3K20A 1IZZA 3B7PA 3S40A 4BNNA 4TYYA 3CMMA 4B43A 1J0BA 3QPWA 1JEAA 1PN3A 3WO0A 1LJLA 1TJ4A 1I4OA 5FIUA 4C7XA 1EX1A 3PPWA 1HT2E 1X8JA 4ZKDA 1WXDA 2CLFB 2Q6IA 3ZHTA 4AKIA 2KBEA 3LDGA 1Z39A 2BEUA 3K32A 3PRHA 2B99A 3PQ4A 4PPQA 2V4MA 4PZYA 1G2IA 4QYMA 4BE7B 2O06A 3BSYA 5BVHB 2BDTA 4MDYA 5LZ8A 5IF3A 5BT9A 3ZW9A 2J45A 4DJTA 2IEDA 4R84A 4DVJA 4EQZA 2QVLA 5TB5A 4E7OA 3L77A 4FM9A 1QF7A 4Q7KA 1P5JA 1UBGA 1LD3A 1BMFA 1CJUC 3KVNA 4WE3A 3R0QA 5FTNA 1ZD5A 3KJFA 5SV2A 2V5AA 1ZISA 3QWIA 4G5XA 2C4NA 4W8HA 3VJKA 2C1XA 3KT8A 3WGYA 1K8RA 1FQOA 4KWCA 2JI7A 3IP5A 3AESA 2VJAA 1NBWB 1WB4A 2H1HA 4PLFA 1W94A 2EW2A 3TDNA 4TMVA 1E1QD 4M8LA 3UXMA 4QBIA 5CIWA 4L5AA 3ZD9A 2FWJA 2A30A 1DCKA 3AKYA 1C30B 5KYUA 3HFSA 3CUYA 4R3NA 4Y6OA 5DB4A 4BLQA 2VF8A 1KFJB 4WBNA 2MSLA 1UK6A 4LZNA 4TMYA 1EFUA 1S3IA 3H5TA 3DH0A 4D9EA 1D1PA 2QTCA 4JUFA 13PKA 1GFSA 1EJ2A 4R2HA 4DEXA 5EEGA 3MWKA 3KCQA 2XNKA 3KC2A 3ONVA 2XTJA 2QD4A 5AIBA 2GASA 1PBTA 2QRMA 3HC7A 4QGGA 3GX1A 2BGNA 3MRSA 1OPXA 4PPYA 3GR6A 5FOTA 1WMDA 3MTJA 1R8XA 4GR5A 5CLIA 5ES4B 3G1WA 1XMPA 2HXYA 4TLBA 5IT4A 4BEBA 4E5UA 4QOJA 2P3OA 1JXMA 2ZZMA 1U7DA 1KU0A 2WTMA 4I1OA 1K68A 3PUVA 1UZUA 3E9NA 1Z0AA 3I2HA 4Y9SA 1LLQA 2NV0A 1EDDA 4Z86A 4G81A 1VGQA 3DZHA 5FBLB 4MLPA 1T9CA 2MR5A 5HKKA 5CA1F 2J3HA 1CUEA 3I9MA 3L7CA 3ZVNA 1XFDA 5BQ3A 4A26A 3UWKA 1DSSG 5KREA 2NT4A 4N41A 1ULHA 1FEZA 1OTXA 3P94A 4D8UA 2D2XA 1MCZA 1JA9A 4OHOA 4YAJA 5HRCA 4FQ8A 2HIMA 5IXJA 3GDWA 2XQIA 3NXKA 3DCJA 2XE6A 5CIYA 1Z88A 1K7XB 2P4HX 3FZQA 4KFUA 4LZJA 1B23P 3LVQE 1RBZA 1NLZA 1PL6A 2AWNA 1L5NA 1M5TA 4NNJA 4CTNA 3R5TA 4GP7A 4MR8B 1PZXA 5IHXA 4J43A 3OWXA 5KOHB 1I4EB 3LF1A 1X9HA 1UBLS 1BFDA 2BPOA 2O14A 4RK4A 1GADO 4NAVA 3WLRA 4BBPA 2IW1A 2FP4A 3E6AA 1E0JA 2FY8A 3L1JA 5IM5A 3X44A 4O4LF 1KZ9A 5CD1A 3F5DA 3LRTA 5CP8A 4E7PA 2FSIA 3F6BX 4LX8A 1HE5A 1BRTA 1C9JA 3WIOA 1TIKA 5I4KA 3ZDFA 3BMXA 4ACAA 4YMTA 4GC9A 2BJVA 1M0EA 2LPMA 4NF2A 2JFYA 3Q3IA 4MKRA 1WA5A 1NUSA 2B25A 5REQA 1RM5A 1EJ6A 3MD0A 4REQB 2AC2A 2XUAA 4TKMA 3RAFC 3PNYA 3DJFA 4W9MC 1PVDA 5L4SA 1LI5A 3OFKA 3UQZA 1DWPA 3CZQA 2IXBA 3T3OA 2VG8A 2ASVA 4N54A 3AB3A 1C7EA 1QHYA 1VIVA 2FFHA 1BJRE 4K0RA 5JYEA 2ZXUA 2XMBA 3PC3A 1FLAA 4BDSA 4N12A 1JDPA 2AK2A 3EGXB 5A02A 1GNRA 3CUVA 5FULA 1KO4A 4HN4B 1FXUA 3MD9A 2MYNA 3HU3A 1JIUA 3KUXA 4A5SA 4UEWA 1V5IA 3E82A 3H87A 3I2KA 5IJ9A 4TZ6A 3PD1A 1GG5A 1HPLA 1U80A 1N4DA 2IYXA 3ISTA 2XNSA 2AFHB 2VA8A 1G8YA 1BW9B 3C3AA 5H81A 3CJTA 3G0BA 1EWRA 1G19A 3DNMA 4WNYA 4E2FA 2OZVA 4DQXA 1XU9A 3I0NA 5KDLA 5T67A 3LCVB 3JYPA 1GGMA 4UUNA 4EABA 3AR3A 3F9IA 2CE7A 5F23A 5HGXA 3S68A 4YUXA 1POWA 3AEQA 2UVDA 1E1QA 4U6QA 5B3JC 1R0XA 1U2GA 1U98A 2V7VA 3GT4A 4I46A 3UMVA 2IH4A 3CONA 2PGNA 4Y2YA 1NY6A 1U0RA 2R8EA 1JECA 2ZJ0A 2YWGA 5BNFA 3WFIA 2CMDA 4GOXA 2Z1NA 5CGQB 4YRKA 4XWKA 3U7RA 4YR7A 1ULUA 4A8JA 1R5BA 1ZM4A 1SBZA 2YTZA 4IDNA 4OXIA 2QPTA 5FL3A 5A1TA 1EGHA 3D8HA 3BH6A 1CUBA 3CS3A 5KOYA 4EB6A 2PX8A 3UUEA 4IVNA 1OU4A 2YMLA 3K1AA 1HSZA 1IK4A 1V41E 3GDOA 4X8MA 3BMOB 5F64A 1DUVG 2I66A 1JKXA 4X6LA 4ZVUA 5CA1A 1AHNA 4YR9A 2KLHA 4NJEA 2ZVJA 5K8LA 3EODA 4YHHB 4FR2A 3DLHA 1DKQA 1Z8FA 2PGDA 1BIFA 4F2HA 3KXPA 1JGTA 4K05A 5ADWA 1P2SA 1RJ9A 4KQXA 2F59A 1E5XA 3BIXA 3OZBA 4I8IA 4R9NA 1SM4A 1H23A 2J5BA 4EJMA 3IJ5A 1NVGA 2Z3VA 3HE3A 3OX1A 4JJ6A 3CVJA 5J4YA 3EFHA 2J5RA 5AI8A 1Q0PA 2AEMA 4HVAA 4RNDB 1JHZA 4O29A 1KK3A 5HE8A 1VIYA 1NMXA 3CRQA 3A1FA 4RKYA 4IIHA 4MEAA 4WXEA 3ZBPA 5H7XA 3BKWA 4ND2A 4AULA 5B7PA 1P19A 3BZWA 1C1XB 3DE4X 4PO3X 4QYWA 4HO1X 4Z8XA 1GVHA 1NNSA 5FV7A 2L17A 1JLKA 4O4LA 3BIFA 3K73O 2O0JA 3H9JA 5KBYA 1WSBA 2CK3D 1RXEA 5BN4B 1I1OA 2ZDQA 3CBGA 1GZSA 3DMTC 3JRNA 3V55A 1E7QA 1FVHA 4LJ8A 3TQHA 1I3KA 1M8PA 1OU0A 4UHDA 4XRRA 2DECA 5EJ7A 3ZJVA 4MHTA 3O94A 2C9MA 3RFFA 2ZRBA 1Q3KA 3FF1A 4JYMA 1O95A 1MJ5A 3QKTA 4GW3A 2QTBA 1NURA 5KYXA 1SXHA 4Z7JA 3KX2A 4XWTA 3VDMA 3MFQA 3JQFA 2PSEA 2WYHA 4OXKA 2JHFA 2I55A 2ZE8A 1TVMA 3OFVA 2FOLA 2QDKA 3DEYX 2HJ9A 1B8OA 3AMVA 3KQVA 3MWDB 5DFAA 4F92B 5C51B 1EM8A 4JJKA 4A10A 4AUEA 4KIGA 4QYSA 1JU9A 2QN9A 3OCCA 1ZFNA 1K4YA 1E77A 1GFIA 3B70A 4YMIA 4CT4B 2ZUFA 4WESA 3T4XA 4Q1VA 1GNTA 2ISSD 2ZJFA 3EC7A 5GY7A 3C8MA 4IDBA 3OD5A 4LVCA 4R51A 3UA3A 3WK9A 2HRCA 2JARA 5EMHA 2UYQA 2X0RA 1M0TA 2DTEA 4FR5A 3M4NA 4JODA 4UTXA 1XGKA 5LU9A 2Y3IA 3MB8A 2ZB8A 4LXHA 2OQVA 4ZICA 4JLAA 5F51A 2M6SA 1I5EA 1WIWA 3FNQA 4MS4A 4PSAA 4Z3DA 4B33A 4MDFA 4K5QA 4K7JA 4BTLA 3U16A 1PK8A 3B1YA 3H5RA 3L6OO 2NUTB 4NG4A 3JS5A 3UO8B 4KREA 2GVNA 1HMYA 2FPMA 4GI1A 4AY5A 3ICVA 4XCXA 1JHPA 2B69A 3GZJA 1HG0A 5ERYA 2IYPA 2I34A 3B36A 3GGJA 3QV2A 4IINA 3IIJA 2J0UA 1EDBA 1XPJA 4XWWA 4PX2A 1EGMB 3O75A 3SZOA 3UXYA 3QMWA 3LLCA 1KRHA 4JP2A 3JQAD 2FR0A 3IUJA 1P81A 2JVKA 1PS0A 3ZJ4A 4QHTA 4HN9A 5IKOA 1EZZA 3FGNA 1N9GA 4R1UA 3G0GA 4XCVA 2MINB 3CF4G 3H7AA 5E0OA 4Z9YA 5KNCD 4XM0A 3Q9LA 1SKMA 2YINC 4DCNA 2OGSA 4FKBA 5JAPA 2VUSA 3N5KA 5ARBA 1X13A 1ZJ4A 4O2AF 1OC2A 1C9KA 4EUFA 2IUSA 1MQ8B 4H2DA 4G36A 3QBJA 4PQGA 4P5DA 2VF2A 2NUAB 4I66A 3HR7A 3SVZA 3GH1A 4Z9BA 4CF6A 4HH0A 1LSOA 2VWQA 3CPEA 4D6YA 3VSCA 1G60A 1E96A 1PGNA 4TSKA 5BWLA 1X14A 2BFPA 4RQBA 4EHKA 1J2YA 4LCEA 3DLBA 3RS3A 5LJLA 1T4GA 5F3DA 3DBIA 1E9SA 3EF1A 3UT5B 1W4AA 2KS6A 1N57A 3C0KA 1LPMA 2UZAA 2ZJ2A 1PG5A 2DGDA 2ZI7A 3ASYA 3COPA 1DKOA 1E5DA 1KVUA 3GA5A 3I01A 1QHNA 3KHTA 3OLVA 3WZLA 3DZIA 4ZYVA 5MGBA 4P35A 3RC2A 1QRUA 1W6UA 1OMOA 1YV9A 2AW5A 2QUBA 4G4SO 4FX5A 4G65A 3VHRA 4JVOA 5ER6A 5CG2A 4I1VA 2OGUA 2D8MA 3ZIAD 5L7YA 3AU8A 1SZCA 1EUZA 4F5ZA 3N2YA 5JPDA 2QX7A 2IHKA 4URUR 2P67A 2W2XA 5K4GA 4OVKA 4YLEA 2BIFA 1ML3A 4RHXA 5KEIA 2IOQA 4OYHA 2HLDA 1N0HA 1Y1TA 2GBIA 1XMSA 2J8ZA 3DOJA 4I4TF 4QDXA 5CFMA 3KHSA 4K9LA 1VPWA 2HHHB 3FMVA 1P7CA 2AFIE 1FFHA 3QMPA 4JQSA 1V1MA 2GEFA 3V4LA 2N47A 2EQBA 1XPOA 1PDWA 2BE7A 3L2OB 4GD3Q 1UFVA 2WLTA 5C80A 3CRNA 1AQYA 2RHLA 1KAGA 1GEEA 2WF9A 4HH4A 2NADA 3LUPA 2PH3A 3ZU5A 1JFTA 1PEAA 4ZO9A 5FT9A 3HHPA 1JEYB 2CV1A 4FLEA 4G2NA 2XWJI 5TQ2B 5L3VA 4OP1A 3JY6A 3F7MA 4P34A 4MNTA 1BWPA 3ZTYA 1NN3A 1NONA 2QMEA 2P0YA 2ZROA 1R66A 1L7AA 1KJWA 3KQMA 4LYEA 4QDTA 2D7CA 1BA2A 3AWIA 4ZT7A 2VQDA 4OEHA 1JFRA 5LA6F 2Q3FA 1WBJB 3QF4B 3HJUA 4COOA 3ZY3A 4EPWA 2HHCA 5C8YB 5GJBA 1YC2A 1F14A 2YMPA 3AOGA 3TTUA 4KL8S 2JI8A 2I7TA 3JAMA 3WYFA 1XG5A 4G84A 3DO8A 3SBDA 3RIMA 3NNNA 5SYNA 4DIBA 1GPBA 1X3LA 3FPGA 3GBSA 3IKMB 3NX4A 1OJ7A 1RWMA 3JSAA 4JLOA 4RK5A 5D87A 4XARA 2X0FA 4D46A 4YJKA 1VE7A 2ZEJA 3L0SA 2LCQA 3BZBA 4CIDA 3GEBA 3N86A 4ZV9A 4OHCA 1U5CA 5BR7A 1GFWA 4FX2A 3FTFA 3PDIA 1A9ZA 2PL5A 1C3OA 1PGPA 1XKLA 2ZIZA 4FIDA 4KPUA 1YDHA 2WILA 1AUXA 1KO5A 1UADA 5KNBD 3A3NA 3HMKA 2ZE7A 3KALA 1NNI1 3K0EA 4ZD6A 4ZJPA 5DWVA 5JJ5A 4Y0VA 4OH7A 2EP8A 4JT9A 1RLOA 2BI4A 4X92A 1A71A 2OHOA 3I6IA 4O2AA 3D6NB 4P92A 2ZPUA 3WNDA 1B74A 1WPGA 4INZA 3BVPA 4R0VA 2MHCA 1KI2A 4DYDA 1KS9A 3E2IA 5A0TA 1AE1A 2OYRA 1Y1RA 3ZQJA 1IHPA 3EIWA 4UKDA 4D79A 5KNCA 4FSDA 4AUNA 3EUAA 1EWKA 1SCDA 3JYHA 3OE7D 2WC1A 3O82A 2P9YA 4JB8A 4ABYA 1DP4A 3A4VA 2DHRA 3CFYA 3Q7EA 1PW7A 1YQ9A 5DOZA 4E3WA 3D3KA 3OWHA 3V4SA 4UTRA 4EO9A 5D51S 4LDAA 4RDHA 3LHSA 3PNSA 1JNXX 1EUDA 3KLMX 3U6BA 1XR3A 2WU8A 3CBQA 4L5YA 3VYRB 4W5RA 4UHKA 1DCTA 3FTEA 4Z4FA 4JIGA 3WJ2A 1S8NA 2AK3A 5LCXA 4M0LA 5AKHA 5HF6A 3T7EA 1K5DA 1XVVA 4O08A 3KYDB 1MN6A 4Q9HA 4P7BA 2PZGA 4WQMA 2EX1A 3CG4A 1JH9A 3OJLA 2AA3A 1XAHA 3NTVA 3GYGA 4BLWA 4CCYB 4OJYA 5JSFA 1NQOA 4QUDA 4F2GA 3AZPA 2IIQA 1QGDA 5A3VA 2IODA 4HDRA 2OZLA 3L8CA 5FAXA 3WWZA 3L8YA 3EXG1 4GR4A 3IEMA 1YR6A 3PXXA 4I4TA 4X97A 2X41A 5M3BA 2GZ2A 1YDWA 2DJ5A 1KAOA 4X6XA 1DHTA 3FFAA 3W79A 2VRCA 2GJ4A 1WNFA 1YQXA 2FEWB 4L28A 3RK0A 4H27A 2W58A 2Q4BA 2R7LA 4HRVA 4TMTA 4BC0A 1FFYA 1OI3A 1QO0A 3I23A 2AOXA 4WN3A 3LQKA 2X3FA 3BMNB 4C0SA 1Y1PA 5KCMA 2G9NA 1ZEMA 1T0JB 2DHCA 2OMEA 3MILA 3NNSA 6CHYA 5EIXA 3I83A 3LUFA 1DOZA 4KQ9A 4M83A 4NBTA 4AY4A 2IV7A 1QZUA 1A2OA 4I6EA 1JR4A 2AZTA 3DMGA 4JK3A 4NEHB 3M49A 5IAKA 3WL6A 2A0XA 1KZGB 3F97A 3UGQA 5L6MB 1ATIA 2FWAA 1VIMA 2QRLA 3E3LA 3CYFA 3G5AA 1D03A 4PX9A 3RWOA 5LA6A 5CDYA 2OCXA 2CJPA 1H5NA 1NUAA 3NORA 4QBGB 4Y9TA 3DUFB 3E4DA 4L6IA 2OMKA 3D6MA 1NXPA 3E7DA 3WKBA 2F7SA 4KJZA 1NFQA 1JA1A 4HFJA 1W59A 3V3TA 2PUHA 5FWXA 3H86A 4YRLA 3DQZA 4DR4B 1XEWY 4AJ2A 3E3AA 1NKVA 4AZSA 4YRGA 5E8JA 3GGCA 4YV7A 1E5LA 1YZNA 3KNZA 4LXTA 3ZNNA 2OVBA 2AG8A 1QANA 3HV2A 1F2UB 4OH1A 2ESRA 3RREA 2R0QC 3IEVA 1RADA 3UT0A 3E1SA 4B8YA 4O02B 3OJWA 2O3QA 2YJ3A 4GOMD 1C4XA 4F06A 2YY7A 4TWBA 1PYGA 4KLCA 3UANA 3OA0A 2HV8A 3VKVA 3TGLA 2J9GA 2PJZA 3IAEA 2J59A 3RCBA 2YWDA 4IJ6A 2CMFA 3H5VA 1NSFA 4PTLA 4ZHSA 3AG6A 2FDRA 4M9QA 3ZWVA 4B4VA 5K0JA 1T4MA 3P9SA 1Z63A 1THGA 1KTIA 3AEZA 2NPOA 4JYCA 5E6UA 3VU0A 3OQVA 2ZUEA 1GU7A 2G09A 2NU9B 2Q5OA 3EOZA 4OU5A 4DDKA 1CEXA 2OECA 3TMKA 1N9KA 3NVKI 3P0JA 1LBSA 4M7OA 4AJJA 4B81A 4BFTA 5P21A 5HUHA 4O8ZA 1WETA 3G9TA 521PA 1EQAA 2QP4A 1JWBB 1W73A 1U11A 1RYYA 2ZB2A 5FADA 3WJ7A 5AM2A 2OPHA 2GLXA 3AUYA 2F1JA 3U4QB 2VA9A 4AC9A 2FF7A 2FW7A 5K3AA 3JYQA 2L0XA 1B16A 4O4HF 2IPOA 4MKHA 5KTKA 2Z6AA 3SC3A 5KHOC 2O8VA 3D59A 2BF4A 1NTRA 2ODAA 3HADA 2HPVA 4MPDA 2A2ZA 4KGVA 3NT2A 3LPCA 5HKLA 4ENSA 2QAIA 1X8KA 2H2FA 5DP1A 3WGTA 3K9FC 3C6MA 4L9AA 3AG5A 2NIPA 4TS3A 3JAKA 4DWOA 4E1VA 2I4MA 1LH0A 1V11A 3IAUA 4CKWA 1FTWA 4O5OA 4E2ZA 4H0FA 1QQBA 2ECQA 2YXNA 2V8OA 4LV6A 2I9PA 3BGSA 2W2KB 4ND8B 4PQFA 2ONZA 4W9NA 2BGWA 4PLYA 1ATZA 4Q7JB 3SXUA 2W98A 3VSBA 3WMXA 1OH8A 3JWEA 3GGSA 4LTNA 4V1CA 3H0KA 4W1SA 4G26A 3OLXA 2Q9CA 4ARZA 1R0WA 1Y4AE 2D4HA 1QAMA 2HRRA 4NMWA 3SJAA 1N2JA 5A9TA 1TAUA 3L6RA 2C4TA 3K2EA 3TTVA 1XJ0A 5JROA 1VHLA 4D3XA 4PN7A 5FB3A 4FIZA 3E22B 4WRRA 2IOYA 2H2HA 3OWOA 5JCOC 4QQFA 2YZNA 2WJPA 3GT7A 4E2XA 2P6MA 3B3GA 3FYTA 3P9ZA 4R1PA 1DWQA 2ZSHA 4KACA 5DYTA 5F21A 1FLNA 3D6HA 1HZJA 3LCJA 1Z5OA 1BXKA 1YCGA 5IT9A 4L8LA 4ZOCA 4DA4A 3UAOA 1M75A 3SYTA 5TARA 1JQLB 1FMFA 2X9GA 1R10A 3LECA 3PXUA 3OJFA 3RRYA 3FWZA 4WOBA 4AO6A 1SQSA 2ZJ4A 3LO5A 4IQ0A 2XNDA 3SIWA 1W35A 1U0GA 4NCJA 4QBTA 4MYSA 4Z0TA 2VDUE 2YWXA 3TQOA 4EHFA 1P4SA 4URWR 2XBLA 3PGVA 5EXSA 1ORTA 5T41A 2D1RA 2GTPA 1DJQA 3DT8A 3SIPA 2QGFA 1WABA 1NP7A 2JGFA 5AHOA 3H2IA 3T1QA 3QUSA 4G0YA 4GWGA 2G6TA 2A7QA 1Q0UA 2HLNA 3GEMA 3TQRA 4ZDJA 1KFEB 1P2DA 1JHAA 4NEGA 3E3NA 4AUMA 3V48A 3LUCA 1ZIYA 1Q1AA 2QN7A 4L9WA 4MJXA 3RHTA 5EMMA 2XUKA 4FEGA 3R3YA 4BFXA 1RJGA 3H6KA 1N0WA 2PJRA 3DFZA 1J1IA 2HMWA 4LTMA 2GO1A 4HEA6 3ITDA 1ZC4A 2CXUA 4O5AA 4OG2A 1CQJB 4R5HA 1AKEA 3FHCB 2FW1A 3V8RA 5IF9A 4Z3OA 4R2IA 4NCXA 2GDZA 3DOUA 4C1BA 1N1MA 2O07A 1W5EA 3JAWB 2MYPA 2G80A 3BBLA 4JT2A 3PSAA 4I1SA 3NGLA 3WQHA 3HVKA 3KPJA 4MW0A 4HAOA 3T52A 5ICSA 3MQFA 1JH8A 4XZ3A 2G17A 2ZBUA 3OBBA 4I9HA 5CMLA 2F48A 4C22A 5HQ3B 2H5EA 4FNAA 1JAZA 3OOYA 4ZI5A 3U5ZB 1D2RA 2IYQA 1PFYA 4KNYA 3Q5EA 5J5CA 3TDMA 1B4DA 4CHTA 1UBSB 2RJNA 5EWMB 1RAAA 3OAAA 1FYDA 3LPMA 1P8AA 1VE5A 3C7AA 1RXCA 3P9XA 3CRMA 5L8VA 5BXQC 4YT4A 2XPCA 1SC1A 4LZLA 3V4ZA 3WAGA 2HCFA 1RWVA 1E4EB 4PX3A 2OD2A 1GHTA 2CHVA 4WZAB 3ONWA 2WE8A 3KWJA 1UOPA 4MQEB 4NFHA 3TFWA 1OH5A 4QSMA 4R01A 4KUGA 4Z7NB 5FEUA 1GQQA 4X20A 3RS4A 1GEGA 3CUSA 4CIVA 3VR3D 1WMFA 4E13A 3IIEA 5MFPA 4XXHA 2RHCA 1W5AA 4QULA 1PTJC 1I33A 5FA6A 3T5AA 2O8BB 2GZ1A 3EIQA 3UKJA 4GHWA 5E8RA 1ZXXA 3IIMA 1KXJA 5EFOA 4ZZ0A 2XEXA 1QX4A 3FFTA 4JZKA 2JEYA 1GDTA 1MX1A 2X14A 3PJDA 1JW9B 4LNHA 1DC3A 1OXKB 4V3CA 1AMNA 1J5PA 4FFDA 1ZUNA 2WTEA 4X45A 1JTEA 5DLPA 1S89A 3A6KA 3M81A 4BBZA 1T9BA 3QLJA 4J1TA 3HZRA 4X7BA 5EE3A 3W9UA 3MHTA 1N6RA 2IXEA 2QI9F 1I2CA 4PW0A 4JLUA 4BMVA 5I7WA 2XGSA 2ZI9A 3IE2A 4F96A 1Z5PA 5IBQA 1CEYA 1NF9A 4G1BA 3T8YA 2VDLB 3PZRA 1P75A 1AKRA 2IYNA 3FX2A 4MB6A 1JALA 3QJGA 4NQZA 4V0MA 3R9KA 3KXKA 1G42A 3BQNB 1NMQA 4IV5A 3HK2A 4M6WA 5T3YA 4PLVA 5B1YA 3NUQA 3PDUA 4QASA 1RI1A 1SXJE 4X41A 3T54A 5JWHA 3RSSA 1BWRA 2W6CX 4X1KA 1U1DA 4E5KA 2DERA 4MR9A 2FEOA 4W5OA 2PUBA 1XZBA 2IHTA 3N28A 3SU8A 4AF8A 4U00A 1H2FA 3H19A 5SYAA 3VDRA 2JFWA 3S28A 2MMGA 4CM5A 2QD2A 1KOFA 1Z45A 2DWUA 3GQBA 3ZWBA 4ASUD 4YMGA 5IM4F 1T8SA 2GPYA 3MLAA 4GAEA 4ZMBA 3O4GA 3IQEA 2CT8A 1BH2A 4PC3A 1TMKA 4DSNA 1YVRA 5DTIA 3NM5A 3Q3VA 4LRXA 1NBEA 4XGRA 3PUZA 4DZZA 4DCJA 2QMHA 3IUSA 1JPUA 4R2LA 1E1MA 1I5OA 5MN5A 4MW6A 2IC5A 1L7BA 3BMCA 3GDFA 4CM9A 4GBGA 2OKCA 4RAOA 2BFEB 1I6MA 3IUMA 4QVIA 4IM7A 3NM4A 2XA1A 2W22A 2FSVC 3HJAA 1M5UA 3IEXA 3LUJA 2J3KA 2W2QA 3GRZA 3K3PA 4FFPA 4OGGA 2O52A 1KJZA 4YQZA 5IUNC 3OQOA 3GRRA 1QRRA 1WV0A 4BO7A 4YIKA 2D0IA 2MWMA 2B1RA 1WXWA 2HDNB 1R8SA 2RC5A 3HGMA 1FBNA 3CKMA 4GVLA 4JP3A 4KO3S 1GAXA 1C3VA 4GI5A 1A9XA 4JHLA 1MIHA 2I4LA 3KKQA 3CNNA 3LZ6A 4RS4A 1GPYA 4JI3B 3MPUA 4GM4A 3V8BA 2GEUA 1WEKA 2J7KA 4DYVA 1KYYA 2GD6A 3ZNOA 4ZPJA 1D2EA 5EMLA 4CI0B 1QWSA 1Y1QA 4BX8A 1M6WA 2ZZKA 4X1IB 3TPFA 3ABQB 1WMSA 4JENA 3Q41A 3LIPA 3VSEA 1FOEB 1IBKB 2GDJA 2MMCA 2NAPA 3KUKA 4DVGA 3IDOA 2H08A 1ZYUA 4OMDA 3UMYA 2PHZA 1Y8RA 1A4RA 1DARA 1H2YA 1MF7A 1RAHA 3KSMA 1N2EA 4MDHA 4BP3A 1P3DA 3HNPA 1KEZA 1FFBA 1JBQA 1P72A 1BHQ1 2PUWA 1TRKA 4HZIA 3DF9A 2QA5A 3QYPA 2ZAGA 3E1GA 4AAYA 1K7SN 1MGOA 4E30A 4KI0A 4TVSA 2BMWA 5AWFC 4J49A 4PBRA 1WKVA 3MAAC 2OM2A 2J33A 1E2DA 2RHWA 4BLVA 5K05A 1UMCB 3W77A 4L5IA 4HDNA 1G9SA 1JR3D 1CZHA 4XWAA 3KR9A 5SICE 4OM8A 3ZEAA 1QS0B 4YRIA 1O54A 2NYVA 3BXGA 1BA3A 5B3JA 3CT6A 5EHNA 5B3AA 1IZ8A 3T7AA 1LTHR 1H05A 2XSZD 3CIFA 3CN9A 3NHPA 4MYCA 3G2LA 1TEXA 4PYQA 5KQSA 1IBLB 3CLUD 3DXYA 2V9CA 3SSNA 3CLRC 1WU7A 2OXCA 2QL7A 1MNAA 3O90A 2EBWA 4QTTB 4EOGA 5BQXA 5TQVA 4NK4A 3PL5A 4IGIA 4AWXA 4JLPA 4KVFA 4OYLA 5CXUA 1U63A 2ETVA 4ZMSA 3THYB 2GZAA 5BSHA 2MTBA 1FMLA 4JQOA 4YT8A 5AW0A 2XT9A 2C9DA 3AYZB 3RS7A 2O19A 5D2CA 4GOND 4B6RA 2IYTA 5JCXA 4YDRA 5AMXA 4XYGA 2XUHA 4UUPA 1E6KA 1NU6A 1RP1A 2DG2A 2HX1A 3ABOB 3JCZA 3P19A 2FNAA 5BVHA 5HUQA 2J87A 1TYCA 3OIWA 1ADYA 3U0BA 1NDUA 4IOMA 4Q3LA 3UMRA 1CUAA 3UFXB 3ZCTA 5EVJA 5IM4A 3AL3A 2VKQA 4JFRA 4ZARA 2C57A 1OC4A 1T5IA 2HPZA 1U9IA 2GHRA 5IEBA 4S0ZA 1M83A 4QQ8A 3R7NA 1BHJA 3SKXA 2PS3A 2Q6LA 5CB6A 2VH1A 1MXFA 1NJGA