3KR1A

Crystal structure of hpnmt in complex adohcy and 5-chloro-1h-benzo[d]imidazol-2-amine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kr1A00
1UWVA 3EVCA 3GU3A 1YUBA 3HEMA 3OZRA 3KQSA 4E33A 1D2HA 4AZSA 2IGTA 1P91A 3THRA 5GINE 3GRUA 5K01A 3IHTA 5DT2A 1YZ3A 4YMGA 3SVZA 3SX0A 4E30A 3EGIA 4GC5A 3MGGA 5BW5A 3LDGA 5GWXA 4RWZA 4X61A 5LQJA 2O57A 2PLWA 1Z3CA 1SQFA 3HA7A 1D2CA 5JR3A 2PT6A 1JR4A 3TM4A 3T0IA 2GAFA 5EEGA 1KPHA 5LQKA 4KDRA 5FWDA 2DPMA 4PYKA 1SG9A 4QPPA 2ZTHA 2AOVA 1JG4A 3JWIA 4R05A 3MERA 2PKWA 3NVKI 1G38A 2PXXA 1X1AA 2ZW9A 3KHKA 1L3BA 3ER9A 1Q0TA 1BHJA 2AN5A 2PT9A 1I1NA 3M6VA 1ORIA 3OFJA 2IDKA 3AJDA 4E31A 3FTDA 1QAOA 1U2ZA 2HMYB 3EEOA 2ONZA 4WXHA 1FBNA 5GP1A 4OA5A 1V39A 3GRZA 4HC4A 4PINA 4KW7A 4CWAA 1KR5A 3QOXA 4C03A 2AN4A 3GJYA 2XYVA 3VC2A 3QV2A 3Q87B 1EIZA 3AWIA 2JHPA 4HGYA 1VQ1A 3E7PA 4KDCA 3LDUA 2WA2A 3BWCA 1G8SA 3FYCA 3O4FA 4PYIA 1FPQA 5DLYA 5JUWA 3ER8A 3KQOA 1RI3A 5FTWA 1H1DA 4EKIA 3SSMA 4H0NA 1HNNA 5BW4A 3OZSA 1EQAA 3EVZA 1I9GA 1WXXA 5EGSA 4MHTA 4M36A 3NJRA 5DPMA 3TOSA 5K03A 2P7IA 3LECA 5LQUA 4IWNA 3HVIA 4R6XA 1ORHA 5P8WA 5E1OA 1B42A 2ZBRA 3EGEA 4DCGA 2K4MA 3REOA 3Q7EA 3KPJA 4ER6A 5IH3A 2YXEA 3QOWA 3SM3A 2BM8A 5EEHA 3P71T 4YUZA 3AY0A 3H2BA 5LQCA 2P8JA 3P97A 4RTLA 3HM2A 3SSOA 3KQVA 2B3TA 3A25A 4QTUB 5E9QA 4X41A 4HG2A 2OZVA 3G8BA 3K0BA 2XYRA 1KYZA 3KPVA 4FT2A 2BR3A 4UOEA 1SVUA 3KR2A 5K0FA 4YMHA 4AZWA 1AQJA 2C7PA 1JSXA 4OQDA 2I6GA 5ICFA 1TPYA 2OO3A 2YX1A 3BKXA 2UYCA 3FRIA 5HIMA 3FTFA 4GBED 5ICEA 1AV6A 4IKPA 2P1DA 2UYQA 4MWZA 2BM9A 5EG5A 1BC5A 1JQDA 5EMJA 2FK7A 3SXJA 4GF5A 4ER0A 3RODA 2I62A 2A14A 2ZBQA 4HRAA 4EK9A 5T67A 4KRGA 1NW6A 5EHGA 5GM2A 3C6MA 4FSXA 5K0JA 3C0KA 5DM1A 4E2WA 3FUVA 1SKMA 3S68A 2YXDA 3UJCA 5C1IA 3EEYA 1IM8A 2ZVJA 5K8VA 1WG8A 1OR8A 3OE4A 4P7JA 2O07A 4PCLA 3GNLA 2EG5A 4X60A 5FCDA 4L7VA 4AZTA 4ER3A 4F86A 2OB2A 5DX8A 4ER7A 5K0CA 2AS0A 3I5UA 3LKZA 5EIWA 1HMYA 2BR4A 1G8AA 5K0NA 5MHTA 2OB1A 3EVEA 2KW5A 5CVVA 2GPYA 4R8SA 5C0OE 3FPFA 1ZHFA 5LR6A 5LQNA 4BP1A 4GUAA 4Y2HA 3HCDA 1VP3A 4RTNA 2GH1A 2IPXA 2AOTA 1NBIA 3DULA 4KWCA 3BGVA 3LBFA 3GO4A 1FP2A 5CM2Z 1JQEA 3GRRA 4HH4A 2BH2A 2PGXA 3M4XA 5DWQA 5K05A 3OU6A 1P1CA 2ZWAA 4RX1A 3HCCA 5KQSA 4QDKA 3G89A 1JTFA 3KU1A 1YB2A 5ICCA 3KR9A 3NWBA 3PVCA 4NECA 2NNWB 4HTFA 2OPBA 5CVEA 1G6Q1 4R8RA 2ESRA 4GEKA 4RVGA 3A26A 4RTOA 2JH8A 2P40A 2CMHA 4PNEA 1RI5A 3DLIA 1R00A 3EVFA 1XDSA 3G5TA 3P9IA 4XUDA 4DKJA 1YFLA 4BY9E 3KPWA 3DTNA 2ERCA 4EVIA 4QVKA 1T43A 1WXWA 2AZTA 2PXAA 3EGVA 1WS6A 3DMFA 4BLUA 4GQBA 5K0BA 2P35A 4Y30A 5GM1A 4FGZA 4CKBA 3EMDA 3TR6A 4GOOD 5EPEA 1NV9A 2PWYA 4F85A 3EVBA 3I58A 4ZTBA 1EG2A 4AX8A 2WK1A 2O06A 4OX9Y 4QVGA 1VL5A 5EC8A 3UJ7A 4E70A 4FP9A 4MQ4A 3P9KA 3C3YA 3PLAE 1IY9A 1N7JA 2FYTA 3OPNA 4E32A 4ATNA 3CC8A 3HNRA 3MHTA 1TW2A 2ZBPA 3AXSA 3TLJA 1VLMA 5DSTA 3HA3A 3OU7A 1NKVA 2XVAA 3G8AA 2EJUA 3IEIA 3KR1A 3HA5A 4AUKA 2HNKA 2G1PA 3KQWA 1XXLA 1VP9A 2ZWVA 4IV8A 4LECA 5HILA 3DOUA 3SGLA 4B17A 3GDHA 3HCAA 5FHRA 2ZULA 2EX4A 2PXCA 2QRVA 3UJAA 3A27A 2IP2A 3HCFA 3VSEA 1NW3A 4C04A 3AXTA 3P2IA 4PYLA 2P41A 5KVAA 2C7OA 2PV0A 2P3QA 3P2KA 1XVAA 4PGHA 1JTEA 3SMQA 2Z6AA 2YTZA 1BOOA 1X1CA 1NW8A 2V74B 2OKCA 3G2MA 3C6KA 3KQQA 3HCEA 4V0RA 3P9CA 4DMGA 3M6WA 2IH4A 5DX1A 5DXAA 4PYQA 2NP6A 2FHPA 5BXYA 3RIEA 3LSTA 4G56A 3UJ9A 5KQRA 1KYWA 1O9GA 2F8LA 3NW9A 4MIKA 5E2BA 3CBGA 5HIIA 3GIWA 3GRYA 3LX6A 5F2KA 5B1SA 4C07A 1QANA 4RTPA 4BLVA 2P3OA 2PJDA 3G88A 3ERCA 3FUXA 5FADA 3UJDA 5FQNA 1XDUA 3UJ6A 3HVHA 4PIPA 3RW9A 2ZFUA 4X1OA 2JHCA 2BZGA 4U7TB 3TFWA 4C05A 1RJFA 1SUSA 1ZQ9A 2H1RA 2EFJA 4RTRA 1KIAA 1L3CA 3B7PA 3FRHA 2CL5A 2O0LA 3ME5A 1WZNA 2I7CA 4FR0A 4LG1A 2IBSA 4HSGA 3SR4A 10MHA 1ZGJA 2VS1A 2YR0A 3KQMA 3B3FA 3TMAA 4P7KA 1NV8A 3P9NA 5DTQA 3B5IA 3E8SA 2PWPA 2OY0A 2JJQA 3FZGA 2R3SA 4OQEA 5EMMA 5K0GA 4RVFA 4YUXA 4FT4A 1L9KA 5IKMA 1KPIA 1SQGA 4RSRA 5E1BA 3KR0A 4JXJA 2NYUA 3BT7A 2DULA 1VPTA 2AOUA 2PX5A 2BR5A 3OZTA 1QYRA 4PWYA 1IXKA 3WSTA 2AOXA 3GWZA 4YV0A 3HP7A 5E1MA 5CD1A 2JG3A 4DM3A 4LWOA 3HVKA 2PSSA 4EQZA 4DZRA 1Y8CA 5FHQA 2AR0A 2FRXA 3C3PA 5FULA 4POOA 3UFBA 1RJEA 3IV6A 3NTVA 4QPNA 3P8ZA 5FA5A 4RTKA 4FS8A 4GC9A 5EVJA 3JWJA 3MB5A 3PFGA 3EMBA 2GS9A 5ICGA 1VE3A 5U4XA 4DCMA 3TKAA 5C9ZA 2B25A 3HCBA 3UWPA 2JH9A 3G2OA 2IFTA 2ZZKA 3B3GA 2O05A 4P7FA 3CKKA 2UYHA 1MHTA 3PFHA 3PX3A 1M6YA 4GOND 2QY6A 3DUWA 2PY6A 4V0QA 3ELWA 5GIOE 3ELDA 2QYOA 2G72A 3I64A 4XCXA 1ZKDA 4RTSA 2C7RA 3LKDA 3DR5A 2VDUE 4MTLA 4DA4A 2R6ZA 3TPZA 1O54A 2PX2A 4IV0A 3NDIA 5HEKA 3PS9A 1M0EA 4QQNA 5T6BA 4A6EA 5E8JA 5FWAA 2UZ4A 4RV9A 3V97A 3TM5A 3DXYA 2C7QA 2FPOA 2NXEA 3TKYA 9MHTA 5CVJA 5HZMA 4F84A 3KQTA 3G2QA 1WY7A 4RYLA 2HTEA 2IH2A 1INLA 3NMUF 1NBHA 2VZ9A 1G60A 4RTMA 1L3IA 2OXTA 2CWWA 2NXCA 2ZIFA 3M70A 4PONA 4M38A 4C08A 1DL5A 1KPGA 2AOTB 4X63A 3R6TA 5DX0A 4EMSA 1Q0SA 3BGDA 1EJ6A 5DM2A 5DTRA 2ZZMA 1R8XA 2CMGA 1R8YA 2PX8A 2NXNA 5HIJA 4Z2YA 3BWMA 3JWHA 3LBYA 1DCTA 3FPEA 2PX4A 3ORHA 3T7TA 5FUBA 4PGGA 2AVDA 3KQYA 5LSAA 3DXXA 4GOMD 2NXJA 4HGZA 4CTKA 3R3HA 2N47A 5BP7A 2PBFA 3FPHA 1RJDA 2AOUB 1R74A 4OBXA 1M6EX 2AVNA 3DH0A 2ZIGA 3G2PA 3M6UA 3NVMB 2FCAA 3ELUA 1NW7A 3R24A 4ISCA 4ER5A 2GB4A 5D1HA 2Z6QA 4RTQA 2E5WA 2PVCA 5DRYA 5T64A 3E23A 3B3JA 4OBWA 5FA8A 4CTJA 1QZZA 1I4WA 3BZBA 3MTIA 4RVHA 4O29A 4WVLA 3JWGA 1KP9A 5CIYA 5KS2A 2GA9A 3T7RA 2CKDA 1RI4A 3I9FA 3G5LA 2QRVB 1BKYA 2HV9A 2B2CA 2YXLA 3NDJA 5K0EA 3GCZA 3A7DA 1FJXA 4M37A 4QTTB 4BLWA 5EKUA 2VP3A 5D1NA 5E8RA 1JG2A 3LDFA 1F38A 3A4TA 3BWYA 1X1BA 1ZG3A 2B78A 2GLUA 3NWEA 1JG1A 5EQJB 1YZHA 5EOVA 4GOLD 3DMHA 3MCZA 4PCAA 1R6AA 3G7UA 5EKXA 2YUIA 3ANXA 1XTPA 3A7EA 4P7GA 2H00A 1KXZA 2YVLA 2H11A 5H02A 1G55A 5CVDA 1MJFA 2VDVE 2Y1XA 1EAMA 2VDWA 3BUSA 4LWPA 2WA1A 4RVDA 4M7RA 4CXMA 3LPMA 3FTEA 3OCJA 4E2XA 2ZCJA 1ZGAA 4CKCA 5HIKA 3T7SA 4PYJA 5EZQA 1RI2A 1X1DA 1N2XA 3F4KA 5DTMA 1P39A 3M6XA 3LCUA 1NT2A 2QM3A 5E9WA 3BGIA 5HFJA 1TW3A 3FPJA 1PJZA 5CCBA 2ZLBA 3UA4A 3IYLW 3FTCA 3K6RA 3UZUA 3LL7A 4C06A 1KHHA 2IIPA 3FUUA 4PYNA 3VC1A 4DQ0A 1P1BA 3CGGA 5F2OA 4PYOA 3CJQA 2AN3A 3D2LA 1YFJA 3P2EA 3LGAA 5GOZA 4XUCA 2Q41A 2NP7A 3ID6C 5ERGB 5EIFA 3UBTA 3FUWA 4PIMA 1JG3A 5CCXA 3LCCA 4YUVA 1UFKA 5CUQA 4HTFB 4PYMA 5K09A 5GIPE 3THSA 3CVOA 3TRKA 3M33A 2YQZA 4XUEA 1VIDA 2UYOA 3BWBA 3KPUA 5DRTA 2ZSUA 4KIFA 4E2YA 3EPPA 1UIRA 3I53A 4QQKA 5EHIA 3HTXA 2B9EA 3BXOA 2XBMA 2IH5A 3X0DA 1QAMA 4OA8A 1NW5A 3LCVB 2HR1A 3GGDA 3UJ8A 4YUYA 1JQ3A 3DXZA 3KPYA 2ZIEA 3U81A 5EZSA 4U7PB 2HWKA 4K6MA 4P58A 3KKZA 1N7IA 1RJGA 3CJRA 3MAGA 3VYWA 2IBTA 2Y1WA 4DF3A 3MTEA 1XDZA 4FSDA 3MQ2A 5DXJA 3CCFA 3DP7A 2IDJA 1DUSA 3R9XB 2FK8A 1AQIA 3PX2A 5KYGA 1XJ5A 4YV1A 2ADMA 3GRVA 5DSXA 3ELYA 4KVZA 3OE5A 5K0LA 4AZVA 3PTAA 2OYRA 3DMGA 3FPGA 4YUWA 4RTJA 3GXOA 3MCTA 3R0QA 5HOQA 4C4AA 2ONYA 1X19A 2G71A 4CKEA 1VBFA 1AF7A 1L1EA 1XCLA 3V8VA 5M5BA 4FZVA 3CJTA 3KQPA 4QDJA 4A6DA 3B89A 5DM0A 5E1DA 5EMKA 1XCJA 5F2NA 3O7WA 1F3LA 3E05A 5E9JA 1JSZA 3O31A 2JHAA 1R18A 3OFKA 2V7EA 2P3LA 3L8DA 1FP1D 3EVGA 2P7HA 7MHTA 2OBFA 4E2ZA 5CVUA 5DM4A 3EVAA 5LQAA 3DLCA 1SUIA 2I9KA 2Z6UA 2AOWA 3BKWA 4YV2A 4KIGA 3PT9A 3UA3A 2G8NA 3UJBA 2G70A 4BP3A 1QAQA 1YF3A 2ZZNA 2QE6A 3TQSA 5FQOA 5G02A 3HVJA 5E2AA 4EKGA 5LQRA 3FUTA 8MHTA 1EJ0A 3PB3A 3SSNA 1PRYA 2XVMA 2LD4A 1NE2A 4R6WA 1O9HA 1RI1A 5EMLA 2EJTA 2ORED 3FYDA 3LHDA 3OU2A 3EVDA 2XYQA 1D2GA
chains in the Genus database with same CATH superfamily
3IJRA 4RBNA 5JOQA 1CRQA 1DIGA 3Q3JB 5FLYA 3CV3A 2HEGA 3F9RA 4DC9A 1EXDA 4KO2S 3FOBA 4ND4A 4OD0A 3ZHCA 2WQ7A 4B82A 5EAIA 2F4VB 4L4UA 1ZNWA 2V4MA 3HA7A 3QGMA 4BO6A 4OHMA 2AEEA 2X76A 4N65A 1U0EA 3TM4A 1LRKA 3B7WA 4X44A 3RS7A 4B9AA 1H1LA 2Q4OA 1KBOA 4KDRA 4UE2A 2C3OA 2CJYA 5B58T 4E5PA 5WRFA 3PP8A 1JECA 1YFZA 1YS7A 3NVKI 1P9NA 2AXPA 1TM2A 2TS1A 3O6VA 4RPLA 2CFTA 1TTQB 2ZYDA 4HLUA 3ZW8A 3RU3A 1I33A 3M6VA 2GT1A 2IDKA 3IMKA 2FGJA 1D6JA 5F23A 2OLEA 1WMAA 2FH5B 1UDRA 1EXWA 1BCSA 2RAFA 3VNVA 3IDFA 1PKEA 3FVVA 3R5XA 4HRXA 4NATA 1UUFA 1J70A 3V7UA 1J7KA 5DLEA 3BH7A 3M9XA 5JJIA 1FNCA 3OLZA 1TF2A 3HVUA 3WHLA 5JUWA 1XEXB 3OKFA 4IJQA 5DIZA 2WKWA 4UATA 1CUFA 3R8XA 1Z5PA 4EKIA 5GAJA 1U8TA 4NS4A 3COZA 4QYMA 3ZY6A 2Z98A 4XLZA 1P17A 3PIDA 1M75A 3PUZA 4NWIA 2OG2A 1J2UA 3PHCA 4BGVA 3DMNA 5I3ZA 4LCBA 1JXQA 4O5AA 1R0LA 4P35A 2IDZA 2BFMA 5IVDA 1T4GA 2CXHA 2UUBB 2C8JA 4FQ5A 3OFND 1AZTA 4WN9A 5F7ZA 1ZUNA 1WCYA 3CXRA 2ATIA 3TOSA 5FAKA 4XH9B 1ISHA 3B53X 1TFUA 2D5LA 2YYZA 5LLTA 2RHWA 5J63A 2X3YA 3EXHC 2K4MA 1XVLA 3K4HA 1FP7A 2H1OA 1POWA 1SA0B 1WZIA 3QOWA 3UMGA 2QKYA 3VR6H 1AKWA 1Z3IX 4J0HA 3SE7A 5B58C 5HJ7A 2PM8A 4WLOA 4ZYZA 5KMGA 1GA6A 1XELA 3LLCA 4U2DA 4DVJA 4BNKA 4ZXPA 2GZRA 3O47A 5ALNA 1YVDA 2ECFA 4CM3A 2IIVA 4LZLA 3CH4B 1WMBA 3BJIC 1U63A 5JIBA 1KEZA 1RWOA 4U1RA 2JCGA 4MVYA 3Q72A 3M4YA 3UT0A 5IC5A 4MB0A 2B8NA 3T1NA 4BGEA 2UVPB 1LPSA 1A27A 1A9RA 1SUDA 2ADOA 2B2NA 2JVKA 2NQ2C 1QO9A 3OAAD 4FC6A 1HRDA 4GVLA 3ZNPA 4CT5A 2RH4A 1TJ3A 3ZVNA 6ABPA 2VHEA 1CK4A 1UXIA 1UBNA 4ZVTA 5JSQA 3RHZA 3WE7A 5JH7B 3FKQA 4LV8B 4ZK2A 1UZUA 5K2OA 3WL3A 5LXTB 4O33A 2OYSA 1U1EA 4PLCA 3UJCA 4YRIA 2BEKA 7YASA 2IXAA 1U2TA 3P5BA 3DWFA 1J1ZA 2AFHB 4ZVVA 1KJ8A 4OFWA 2KI5A 5D87A 4YAIA 2WHRA 5HJ2A 1BIFA 4OXQA 3W04A 5EKSA 3FOFC 3I30X 2BM0A 4FD2A 3EVEA 1VJ1A 2A88A 2ZRNA 3JYHA 4UC0A 5LBIA 1E2DA 1SHLA 3HCDA 4DUZB 1H4SA 1WCWA 1JFFB 1S9DA 1AKQA 1IONA 3D3EA 5BSFA 4JVNA 1IWBB 1VKRA 1U7OA 1Z15A 3TW0A 5GONA 1M2GA 2W00A 1GAQA 2PQ0A 2R86A 1DLIA 2PRKA 4K40A 1V43A 3HCCA 4Y3UA 3AB3A 2XWSA 4LX8A 5IDVA 3DKPA 5J4KA 3KJXA 5DBEX 4LF7B 1I51A 5AKKA 3ND9A 3QEJA 2YCLA 4OB8A 1NATA 1KBQA 4QDXA 1J8MF 4NECA 5IVHA 1ESNA 3R6WA 1TMOA 4FX2A 3RWBA 4MP6A 4GKKB 3TO5A 4R8RA 1QH9A 1XP5A 2GDZA 3STVA 3KT0A 3TDKA 4PO1A 4P3XA 3AUYA 4B7XA 3K70B 3U26A 1W88A 2CLKB 1N2CA 2NN3C 2OHVA 3QP9A 4HEQA 3RE1A 3TNLA 1JXOA 2JEYA 1JPNA 2Q6OA 5KJCA 1QGZA 4ZVQA 1OVGA 2PIDA 4X6YA 5JRJA 3DL0A 3ROQA 3ZWNA 1VXOA 2QU8A 2F1HA 3I76A 2P2GA 2F4NA 1PK7A 2GNOA 1Q83A 1TT5A 3FCUB 1H0SA 4Z2AA 1ISMA 5AVUA 1GZSA 1QHEA 1BG6A 2GNAA 2B7LA 2PKEA 1EB9A 2VUTA 3HKCB 2Q3JA 1UK8A 4WOKA 3KZCA 1SH7A 3CMCO 3FKSD 2PO5A 1JHPA 3A4YA 3IP8A 1HQCA 2N42A 3LF2A 1WCIA 2AX4A 2JJ2D 2QN6A 3JQCA 4M8KA 1T6NA 1ZKMA 3AXSA 4P36A 4UMVA 4HNSA 4X8HA 2DY1A 2ZI7A 4JEHA 1QGED 4K0RA 1V6CA 4EHJA 2G1KA 4MAAA 3ZLJA 2P6NA 2CJPA 1LS1A 3RG2A 4D9BA 3IBTA 1J2EA 3BORA 4LHYA 3DZKA 1QX3A 2W58A 5LMNB 2YJ5A 3M3PA 2AE1A 2EX4A 1Y8RB 2VIIA 4AIRA 3CEPB 1EK2A 2O1XA 3F5FA 1ID1A 1T29A 3TMYA 1I1OA 4EG3A 1XNGA 1RWXA 2F9FA 4H2DA 5EJ2A 4ABTA 1U5CA 3P26A 3S27A 5HFNA 1EFHA 4OGFA 2ZYUX 1TA4A 1XTUA 4NQZA 2OXCA 2GCGA 3PGKA 1ADYA 3G2MA 4Q3DA 3UCXA 1SXJB 1R64A 1Y9AA 1E3WA 1G4AE 2I7VA 1CU1A 4AO6A 1VJTA 1KKLA 4B3RB 3WGTA 1JW9B 5COBA 4KR7A 1XJWA 2J32A 3QE3A 1P2SA 4B75A 1SK9A 1WB4A 3ZK8A 2J6BA 1N8KA 2QUHA 5ENZA 1HDYA 2WZCA 1DWOA 2V45A 4S1WA 3CGWA 3QI7A 4HD8A 1ZWLA 3AR8A 3PDWA 2WPNA 4UTZA 2HXSA 4IYRA 4S1VA 5L3SA 3ERCA 4QU8A 1AKNA 4Z9FA 3LUGA 4XCQA 2GUGA 1H6CA 2MDTA 2P1RA 5EERA 3VBEA 1PNTA 5INTA 2PE5A 4OFZA 3LQ1A 1T0JB 2IK8A 1NYLA 2JAOA 2OP1A 4Y7CA 4MVJH 4RTRA 4F38A 1RC1A 2H8GA 3EUFA 2GSWA 3GQVA 4LG1A 4EJSB 1Y1LA 3ME5A 5K3BA 3URKA 3SR4A 3LX4A 5TS3A 4U7HA 3V1TC 4G2TA 3OESA 3QLUC 3JU3A 1LS6A 5B3AA 2R79A 3JAWB 5H82A 1YAJA 1XEAA 2M6SA 5EMMA 2IYAA 2G82A 5F9MA 3GA5A 3KHUA 2ZVPX 3SKVA 2FW7A 1G7TA 3DE4X 4I0WB 1AHPA 3RS0A 1WW3A 1BCRA 5ES4B 1QRUA 2ORVA 4H7HA 4PBRA 3ZWMA 4YACA 5LDDC 4C2AA 1BW9A 4JXJA 3AV3A 2VSOA 1CG6A 3ASZA 4CHGA 4DCOA 2NUBA 1WQ3A 5DBOA 4ODIA 4DMUB 3DMTA 3GD7A 2G07A 2OQ2A 4JL8A 1CDZA 3N2GB 3SOPA 4KYUA 4F5EA 2JG3A 4IQFA 1V9SA 4LFCB 4BQRA 1SBCA 4BVEA 4QM6A 1OJ7A 2PSSA 2XSZD 3TXXA 2QTAA 3GGJA 5L40A 1QH8B 1NNEA 1SXJE 2WTMA 2FRXA 2Y1EA 1WZCA 2GJ4A 3EG9B 3IUSA 4NDAA 1FFSA 3PDHA 4RE5A 7ABPA 3FCOA 2Q62A 3MMPA 5EY5B 3EMBA 4AU1A 5ICGA 5TT1A 2ZVQX 1SUEA 2TECE 4O1MA 4ES6A 5BSUA 2OXFA 5FBZA 3UXMA 1J49A 4OXYA 2CVOA 3RAGA 3LX5A 3SHTA 2CB0A 5ITSA 4ENWA 1KQ3A 2Q9BA 3U7JA 1N8SA 2A8YA 3ADPA 1RS0A 3ECCA 5KYNA 1AN0A 3O84A 2BHRA 3EB9A 1EHYA 1ZKDA 3FH0A 4YRLA 1Y8QB 5TEVA 4XGIA 3RC2A 4AG5A 2A58A 4OHXA 1L4MA 4BNLA 1VHTA 1GGNA 5JLJA 2Z5GA 3G02A 4KXVA 1AB6A 3DKKA 2NACA 5IRCD 3W8FA 2ZR8A 1QQAA 1XNHA 1G19A 1VGVA 1VYHA 1JAXA 3D8BA 2ZWOA 1YA6A 3V3TA 4XJSA 1AS0A 2MMCA 3B9PA 5T6BA 1QXSA 2PKYX 3VR4H 4HNTA 4D0SA 2YHSA 3UWOA 4NNOA 5CDHA 1AMOA 2FSHA 4BB6A 2ZRGA 3GG2A 3G1UA 1JZQA 2OESA 2XV1A 3C1UA 1I4DD 2YV5A 4B5LA 3ELBA 3FPCA 4G25A 4ZI2A 4HAXA 1SBZA 1G20B 3PQ6A 4NCXA 4UM9B 4YR9A 2ZIFA 4KTTE 1J06A 4WKNA 2O8FB 4JI0B 4U63A 4BQNA 5IMBA 2DHEA 3FROA 2PYDA 1QP7A 3DC7A 4M1TA 4J3NA 3W5HA 5JAMA 1OBHA 3ZCSA 3WLRA 3MJEA 1JU4A 4EHBA 4MW2A 3TZEA 5LFAA 3P20A 1A9XB 1M67A 3VMFA 3ZCUA 1JU3A 4YRDA 4C1BA 4KL8S 1OX6A 4FFSA 4K88A 3NHKA 4B2PA 3NYQA 4MIEA 3LY5A 4IY1A 3NPAA 1Z4JA 3IOEA 1E3IA 1UK6A 2PR2A 3CNBA 1GT6A 2XMCA 4XFJA 3UOWA 1TKCA 4A1FA 3WKEA 2G77B 1TQDA 3GCWA 4M98A 1YZNA 5HK9A 5JPCA 2HWWA 2PN1A 3RHFA 3KSMA 4OI2A 5FYDA 3T7RA 3VVMA 2QNRA 4DR4B 4PE5B 5AHKA 5FJJA 3RUDA 2E4XA 2EFGA 2W70A 3LOPA 1SU4A 2ZAMA 3A6KA 4J1NA 4M37A 3M4JA 4KNYA 1FLNA 1QGOA 1TU0A 1Y34E 4QULA 2IPNA 1CUVA 3HJHA 2DETA 5HK8A 4S1OA 3L7BA 1P9OA 4IV5A 3ACBA 2GD2A 4Q4AB 1WQ4A 1LNSA 1YR3A 4CTOA 3IO5A 4NMWA 4DLXA 5CITA 2LGJA 3QE9Y 1YZTA 1D07A 5ALXA 3MMXA 5DULA 1YUNA 2V6BA 4GOJA 4Q00A 3I2GA 1I4OA 5B7PA 2ZATA 1X9GA 4V0OA 5BV2P 1M5TA 4NOJA 5IJ9B 5LNK1 4ZKEA 5A4JA 4PS1A 3MTAA 2VYVD 1EAMA 4F4CA 5AVZA 2WA1A 4U2CA 4CXMA 4H27A 2HZBA 3EEFA 1W93A 4KO3S 5EGNA 2VUUA 4MV8A 1M7GA 2ICAA 3LVRE 4L8FA 4QYXA 3MPOA 2I9PA 3VO9A 1F9AA 2J59A 3KYCA 1KERA 4HQNA 3L3BA 4J3JA 3BJMA 4QRIA 4PZCA 4E2FA 3PQ5A 5JROA 4MW4A 2JLBA 1ZA2A 1F2DA 4F4HA 1TW3A 1TZCA 4WKBA 3IYLW 3Q88A 3QI2A 2CXTA 1PQUA 1KVQA 1EQUA 4BLPA 4MGHA 4E09A 4EHAA 4YXFA 3PQ7A 1XDBA 5C8YA 4EUFA 5DTEA 1VCHA 2UZ1B 3A32A 4E5NA 4N5LA 2IPMA 3E6AA 2ZE7A 4WIAA 2HYIC 4ZU3A 4KI7A 2ZG6A 1EWTA 1XRSB 2YVKA 5BO5A 5AKGA 2EZUA 2ZBFA 3NC1C 3FZQA 3GEPA 3O2SB 3Q7IA 3IDSA 4DXAA 3LYHA 4PZPA 2UV8A 4PYMA 2YJNA 4P4TA 1LWNA 2XXJA 3DOJA 5I8PA 5LIRA 3CLRC 4P7BA 2O7RA 5KI6A 4BRZA 2WOJA 3I9KA 2CXPA 2VYND 5EE3A 1Y0BA 3HBNA 1AXRA 4I1UA 3SDZA 1XUOA 5B1DA 4D9JA 1GD1O 4K9NA 2ZIAA 3AB8A 3PA6A 3PQ2A 1HE2A 5JASA 5IUKC 2IUYA 3NEAA 3DVSX 1BD3A 3LPLA 4LXTA 1RLMA 1H4VB 4L73A 3ZS9A 5CFMA 3LMKA 2O8EA 4QU9A 5MN6A 3T9AA 5KPJA 2Y1FA 1AGRA 4PQFA 1VIMA 2VYCA 3DNFA 1FU4A 4QNRA 5EZSA 2HM7A 4PPNA 1L4KA 4X54A 2BGLA 3AEUB 3ZY4A 4G0OA 4N8EA 2H63A 2BZ1A 4ZJYA 2ZJ2A 3U7FB 3V7WA 5E6UB 3D6UA 1GCGA 3WADA 1YGYA 4DABA 3FVTA 2G1UA 3H5OA 4NCNA 3RVRA 2CKMA 4YUWA 4JSTA 3N8GA 2AGVA 4L5JA 3W8RA 4MLCA 5CA0A 4Q9NA 1AF7A 1M1UA 1L7NA 5DT9A 4Q3AA 1Y42X 1TAGA 1TUBB 2HWYA 4WOPA 4LDZA 5FBKA 1ZIXA 2PDAA 1GNPA 4ID9A 2NT4A 3JVEA 1BHSA 2VJYA 2A1TS 3H84A 2DFLA 3EIUA 3O31A 4ZCIA 4X1IA 3VISA 1RHMA 1XT6A 2JHGA 3HY4A 1RXCA 4NY1A 4E2ZA 4EWLA 2DH5A 5CVUA 4YPOA 4JLMA 4DCSA 3FDFA 5A7FA 3MWFA 2VZ0A 4E88A 1PT8A 1QYWA 3BKWA 1QZUA 1PF7E 4KIGA 1Q6YA 2A5YB 4PTZA 5FV7A 1Z07A 1XZJA 1MOPA 1IM5A 1K6JA 1OXKB 2PZFA 1P0MA 2WYOA 2FN9A 2XMQA 1QE3A 2JBAA 1KFJB 3EBPA 4H7FA 3TL2A 5IG2A 1UBCA 4Z49A 3CF4G 2AJLI 2QN8A 3FUCA 2LD4A 3VMMA 1XMOB 1AV7A 4RVUA 5G1NA 3TLGB 2ID4A 1IHOA 2ZRJA 4KR0A 1G8PA 1H2WA 2FFAA 1C3LA 5E9AA 2QN1A 3AF0A 2AWOA 3FZYA 3GU3A 1Z18A 1UKBA 2CVPA 3OZRA 3QA9A 2JKZA 3EBOA 3WO1A 1D2HA 3VC7A 3CWCA 5LXTA 3HUFA 4KK3A 3WWDA 5JC8A 5CDUA 1N2CB 2QTHA 4D45A 2QR5A 3N53A 1PDOA 4KDEA 4UUAA 4YMGA 3COJA 3AU9A 4LYGA 2AKAB 4GLFA 4OQQA 1TM4E 4ZOEA 5GWXA 3UWSA 5ITZB 1Z3CA 4PNHA 1B1AA 3L7OA 1DIBA 2I2BA 5IYZA 5D86A 2YWGA 1TL7C 1OLOA 2CYAA 2UUPA 1KFEB 4MI3A 4W6QA 4IHQA 2QVBA 3OT5A 4XUGB 1E9RA 3EXEA 4AN4A 1VL6A 4RKQA 4R7ZA 4L78A 3K53A 4BFUA 3U1BA 2AG0A 3BX1A 1G38A 2PXXA 1EA5A 3LXUX 1GNVA 3Q10A 1VHLA 2NM0A 4RPJA 2OWDA 4RZSA 5GZ1A 2AN5A 4Q1FA 4FZJA 3FTDA 1HOTA 2Y4NA 3AHFA 3MFYA 2V98A 1H4TA 4WECA 2PS1A 1OREA 4DNFA 3RPEA 3ZE6A 3RROA 4KW7A 3PWTA 3QOXA 2J3QA 2J7PA 3D9QX 5G1OA 2V7PA 2BOVA 1VSTA 4HLQB 3V8MA 1XZEA 1B43A 3Q2IA 3AWIA 5KWIA 1E2NA 1XQ9A 3E7PA 3UFXB 2YJGA 3CZ9A 5TLSA 1A8UA 1JR2A 1P6QA 2AEJA 4RO0A 3O1IC 3VDQA 4E46A 3DYBA 4YLEA 3U3DA 2IYTA 4B3XA 4B43A 1HZZA 1NASA 1MO5A 3RVSA 4CLOA 2JF0A 4ZI7A 4PFJA 2WJVA 5A2GA 2LNDA 4R9RA 2BKLA 3I1FA 4YMSA 4Q16A 1REQB 3DE3X 1GXSA 3G2LA 4FUTA 3ED1A 3IVGA 4G1VA 1WSAA 4TTAA 3K1ZA 3AM5A 4DLSA 4G37A 1FDVA 2W2VA 5TY0A 3Q8XB 5HMMA 3HU1A 1QPZA 3PX7A 4WACA 1UEIA 2WF9A 3HUEA 3T3MB 4DYVA 3GLTA 4YQFA 3QF4A 5KNBH 1RM0A 3MOGA 4YRGA 1MHPA 2WAAA 4LDNA 4MA0A 1ECPA 2R1ZA 1C9NA 4BQEA 2XA2A 3FNIA 1GVHA 4UOEA 5I7FA 1KYZA 1DJOA 2I2AA 4KE8A 4DV0B 3QEMA 4GYWA 4ZU1X 4YMHA 4RUKA 2YHUA 2V3WA 2VA8A 5EUBA 1TPYA 1XPJA 1FE8A 1KS9A 2OO3A 2QT9A 3BXFA 3EGOA 3RSHA 3USCS 2Y1CA 1PT6A 1CX9B 4C14A 4HDAA 3QLTA 4ME6A 2C4HA 4BYGA 1Y4UA 3UJPA 1BEEA 4BECA 1SOUA 2Z1DA 1DC3A 1FDUA 4NYMR 1H9AA 5IJ0A 1UKZA 5IYZB 1M8GA 4ND2A 4XA8A 2CB9A 1ODSA 4FMPA 2ZBQA 2A14A 4L3WA 4QQRA 5BNZA 2J3LA 2LBPA 2PUTA 2O8VA 2OE2A 4K1XA 4KRGA 4C01A 3IP6A 4EVRA 2QRPA 4PBTA 1JEEA 4HX9A 4BGIA 9ABPA 4BVGA 4ND6A 2J9FB 4B46A 2OUIA 3HB5X 3S68A 3B1VA 2CNKA 1NBMA 2H5JA 5B7NA 5EJMA 1Y3FE 3BBPA 2NV2B 2W2PA 2XNKA 4CMBA 1ZK4A 3PI7A 3ZWWA 5LA6F 4AZTA 2CVHA 1EGVB 4B09A 2COUA 2W11A 1QZTA 3I5UA 4JCOA 4KZKA 4V1CA 2FPPA 2VKTA 4ZOCA 2WI8A 3RT7A 4GI5A 2O8EB 1Q5PA 3D0KA 3D6AA 4B3DA 4CQMA 1WZ2A 4GG1A 3OOJA 2NZYA 3C4JA 1E2PA 1FUKA 1PTJA 1VBNA 3PCXA 4QX6A 4MW5A 3DDOA 3BWEA 4GHWA 1DEHA 2Z83A 1FW6A 3N7AA 2PGXA 2WWXA 3CU5A 3OCXA 5DWQA 4D8WA 4ND3A 1E0AA 2ZGVA 3AW8A 1KVSA 4HGRA 1V3TA 4L27A 5I7EA 5ETJA 3K6SB 3CZ5A 5A71A 5I48A 5K6AA 1AB5A 2GJAA 1R0XA 1UPFA 3GJTA 4MINA 3CYFA 3HXTA 5E0KB 5IABA 1C4WA 1GA4A 1E61A 1U0SY 1YMUA 1ZK1A 3OFNA 5H81A 1IUKA 3M89A 3WRWA 3S1SA 1YHNA 1H8HD 4BUZA 3BD8A 3GUCA 4OJQA 5BV7A 2O8DA 3WL4A 1THMA 1QRRA 1FB5A 4BB0A 4BX8A 2A59A 1XDSA 2CMFA 4G1FA 1QH1B 2H65A 2GXSA 5IF3A 1ZSNA 4EB3A 2O4CA 2Q50A 4BMSA 4NYIQ 4PN3A 1WS6A 4UBKA 5EHXA 2DLCX 5E4TA 4ZDWA 3I4FA 2BP7B 2XCLA 3I5AA 4UCXA 4EUNA 1UODA 1XXHA 3E18A 3PZRA 2PWYA 1KVUA 2LCIA 4U7FA 4F85A 2EKPA 3OTQA 3Q41A 4F71A 2V7XA 2FX5A 3BDVA 4L02A 3UXEA 1YI0A 3RRZA 2W8BA 4Q3NA 2RE8A 1C9DB 3JVDA 5A3VA 3BWVA 3MCVA 4AJ1A 1QK5A 1G3QA 3OETA 3UC9A 4AF8A 4B1FA 4BO3A 1IN1A 3AL2A 3HA3A 4M0MA 2Q6KA 2VK1A 4IXNA 2CHFA 4EHKA 2IITA 4N7JA 5JCOC 1UDBA 1JR6A 4HNGA 1EFPA 1QHFA 3E0XA 3SGLA 3GDHA 2HA3A 4MR7A 2C9MA 4W4TA 2PNJA 4EKDA 4YMLA 2PFGA 3AUSA 3IE1A 2QRVA 4D9MA 1KY2A 5FI3A 2V59A 3VSEA 1Z5NA 5BNTA 3HH8A 4XCVA 1IEWA 1PEYA 1EUDB 2P5TB 2QDKA 3K1YA 4JL6A 4OM7A 3C1TA 3QBVA 5AKHA 4IAOA 1H2YA 1NBAA 3GJ5A 1CTQA 1AQYA 4JHLA 3R6GA 1SNYA 3OWXA 2QK4A 3RVPA 2O5RA 1Z2AA 1TYDE 3KQQA 4A16A 2VHVA 3P9CA 3JVIA 3X1XA 3HXPA 4P6VF 3RIYA 4L1KA 2NP6A 4B87A 3I39X 3UAGA 4A27A 2QN3A 5FEUA 2XOEA 4UHFA 3SF0A 3UJ9A 3KE8A 1G2PA 3U0BA 3FRJA 3CBGA 5CCEA 4M8LA 3BH6A 1J07A 3UCEA 3FETA 4DEYA 3VU0A 4GOKA 3ISTA 5FADA 1MO6A 1OWLA 3ORQA 4HPJB 3R7WA 4GPBA 3VR2D 1UEXC 3H83A 5I4CA 5JZSA 3F7NA 4O2AF 1ODJA 3PQCA 2XCUA 3QWBA 4WKOA 4DCUA 3A1VA 3ZV4A 4UTXA 4OK6A 3LQKA 4YH1A 4FGJA 2O0LA 1GZ6A 2XEXA 3DE5X 1QYVA 1E5LA 1SZDA 4ISBA 4NDZA 4ND8B 1P77A 5FWXA 3VAYA 1U7HA 2CXRA 1MJGM 2IHNA 3FDXA 1NW9B 1GQ2A 2YZMA 1M8FA 3N07A 4NZPA 4X0EA 4GDMA 2Q27A 2OHFA 3GA7A 2DWPA 1Z8HA 4M4SA 4F8YA 3H5AA 3FWYA 4D9GA 1HDCA 5EFZA 3VU3A 4G0PA 3B1YA 1LDGA 1CLUA 4O1HA 3IPCA 2HRRA 1W76A 4I1OA 1G63A 3SHFA 1X0XA 3C2QA 4NE7A 2WHEA 1SVLA 2YOGA 3C8MA 3IUEA 4AF6A 5IKMA 4C7XA 2RGWA 5EQTA 2IOHA 4D82A 3TGPA 3BT7A 2CE2X 1O8CA 4AM8A 1AMUA 2HA4A 4YT4A 1CZRA 2C04A 2VBFA 3QE4A 4S1PA 2BGGA 1WVIA 2XEDA 3BXGA 3NTRA 4W8GA 1G5FA 2AQIA 2B1GA 2MMGA 1F8GA 4J2HA 4EQZA 1EESA 1JPUA 1X39A 3L82B 1UC8A 5EJEA 4J1TA 1AQNA 1CRPA 3ZHVA 1ICIA 3IS3A 2QW8A 2I7DA 4XRRA 4HKTA 1MABB 3QYFA 2DMRA 4O25A 4EJ2A 2A57A 3LLUA 4JNCA 1NMSA 1FC0A 3MHPA 5LXTF 2W90A 4CV0A 3ZD6A 2CZGA 4QYIA 2VZ8A 4RIIA 1Y7TA 5AW4A 1A1SA 2ZYWX 4JLOA 4DCMA 3REFA 2WHQA 2GN0A 1XD9A 3CVVA 1R4NB 2BBOA 2J5BA 3EFOB 1F4PA 3ZGLA 5FWYB 3KX2A 4YRAA 2J3KA 2HWUA 4DSNA 4U7JA 2Q3LA 1MC1A 2BLNA 3ABQB 4X6UA 4BNDA 1YQDA 1G3IA 3ZVRA 3B5JA 4F4IA 2GZDA 4J7CA 1OIVA 2I2FA 4AZ0B 3TSCA 1WXIA 3ZIAA 4F04A 1X7WA 3IKLA 1Z9BA 1HDRA 1GR1A 1ZH0A 1XSEA 5KQLA 2E6UX 4OSEA 2GN2A 4K9KA 3UHAA 5HUHA 2GVNA 4Q3KA 3M8KA 2GA8A 1II9A 2FPOA 4OL0A 3LOQA 2EZ9A 5CXSA 1Y4DE 1UBLS 3WBFA 2IH2A 2YRWA 4HDSB 1INLA 4QSHA 3WQQA 1U04A 3BTUA 4RTMA 3BMCA 4M1MA 3ZKWA 1W7AA 3SBDA 1TEZA 2J0EA 3TD6A 2DT8A 1P80A 3GJ0A 3ICPA 2R1VA 4KRYA 2TMDA 4MHSA 2PSHA 4FYXA 1C4OA 1Q0SA 3LC1O 3MF4A 3M81A 2C96A 2PX8A 3MWJA 4TOIA 1CUZA 2F1KA 1JA1A 5HA5A 3BQMB 3UHJA 4GM1A 1V7ZA 3RS2A 3VNSA 4UHHA 3HYTA 5KKAA 1CJCA 2G67A 3M2PA 5BR1A 4YI5A 3VSAA 4N5IX 2QN9A 3D8RA 3IXMA 1QMGA 3NORA 1F2TA 2IXGA 4L28A 3VR4A 1CIVA 4R54A 3UG7A 1E3EA 2FU5C 4URYR 4JH0A 3ZWPA 4ASUD 1O95A 3MN1A 1XTBA 3OOWA 1ZM4A 3PFFA 5CLGA 1SKBA 2YV1A 3ZGNA 3JD0A 2DWQA 1IY0A 4YMUA 5IDXA 1T8WA 5KS2A 2E18A 1JJIA 3OHSX 2QW1A 3H6HA 1W75A 1VYUA 4H6PA 5EZYA 1BKYA 2PU5A 1USGA 3E5NA 4AT1A 1KH3A 3S70A 3A6JA 3OUUA 3Q98A 1CF4A 3DL2A 3R3JA 5EVCA 4L3OA 2JI6A 3LFHA 1N0WA 1NBEA 1P8JA 2LIVA 2E21A 3BB4A 4PZUA 4DMRA 2VH2A 3IALA 3P2YA 5EJ6A 2YH2A 1UWLA 4RMJA 1GFZA 4B6PA 2VVTA 3BULA 1VE1A 2VHTA 3VU9A 3KWMA 1NSTA 3PXBA 4TZKA 1H9CA 3A7EA 1KO1A 2GRAA 3NHSA 1QJ4A 2I6SA 1E3DA 4AK9A 2I99A 2W6MA 5BYKA 4LOLA 1SUWA 3DFUA 2WUWE 3SYRA 2VBCA 1KYQA 2YQ5A 3T7SA 4PYJA 1BMFA 3RAPR 3RM3A 2GF9A 1B8NA 5E7JA 1TDJA 2C8LA 4RF3A 5IN4A 3X2SA 2ZI9A 2JFXA 5L3SB 4YCCA 4AY5A 2I8CA 2XR1A 3ESYA 4HEA6 3SIPA 2R68A 4B6JA 4BU0A 4EPVA 5IX8A 4YHBA 4KOAA 2ZLBA 2YN4A 3AUFA 2P6MA 2I3AA 4KBYA 1KYTA 4ZU6X 3K6RA 1T9CA 3RHTA 4DARA 4DWWA 4R2HA 1NOIA 2Q5LA 1NU6A 1DJMA 3KEOA 4EA7A 4Y1EA 1DVRA 1ULHA 1NLMA 2PA0A 3DBRB 4P80A 3UKJA 2P4UA 4HZUA 5D3MB 2XAUA 4M46A 3T61A 4CIYA 1G5TA 3KEGA 4IVNA 1ADGA 5CMLA 3L8ZA 2NP7A 1VI5A 2YWCA 5C1PA 4JI1B 1SKQA 2FOXA 3TEFA 1EFKA 1FJ2A 1OFVA 1IOLA 2Q3HA 2IHZA 4OB6A 2AYXA 3BERA 1RQNA 1QV9A 3M5WA 1MAWA 1NUAA 1LI4A 2JI8A 3BWBA 3L8HA 3L93A 4HS9A 4GNRA 3UC5A 2CYCA 2WNSA 5SZJA 4UOZA 1H42A 3EC2A 4UZEA 1DBQA 1TU3A 1EFVB 1PS8A 1KBZA 5ILOA 1SN7A 3EIEA 3G7NA 1B76A 4YAGA 1H6AA 3OQMA 1WXFA 1W73A 2H06A 3I6ZA 4ZT3A 3UJ8A 4RA9B 3GUHA 3LSYA 4GRAA 1DZ3A 2IT1A 1AY0A 1DHTA 4MMZB 1XFDA 1Z16A 2ZITA 3VYWA 2ILTA 4MUKA 1VLQA 5A9SA 2VK4A 3P32A 4FM9A 4HBGA 2PWBA 1RYZA 1NF8A 2DPXA 3KEQA 3UMCA 4KXNA 3K09C 4KWHA 3EQ2A 3ER6A 4I7EA 4B3IA 1SXJC 2YWBA 3PTAA 3T1TA 4B6GA 4CN8A 1UPAA 4KN6A 4E1VA 1KDPA 2DERA 4MKXA 3I92A 5HOQA 1W8DA 3T3OA 4PCUA 2VF7A 4MRMA 4DT1B 2AI3A 1LDYA 2FPMA 1K9VF 1NSYA 4DHWA 3R5SA 4OF4A 4MVJD 1NQWA 2GYWA 2Q3MA 4HZGA 2WIGA 3ETHA 4EM6A 4A3SA 1M9NA 1O5TA 2OCKA 4Z4IA 2VN8A 1YS4A 1B0AA 4NK4A 1JSZA 5I6DA 4BNUA 1QWSA 4M60A 2CLFB 2P75A 3FWKA 3L18A 2XZLA 3LWNA 2VHUA 1ST2A 4NYJQ 4BEVA 1WP9A 4LRUA 4TYNA 2I4LA 2AHOA 4OFXA 5IKPA 2PX6A 3ABOB 4FR2A 1RKQA 1HE8B 3PTLA 1MB0A 3QF4B 1WDTA 4NIMA 3PCTA 2V7QA 1PLJA 3WGJA 1FFDA 2W5UA 3OQBA 3AHGA 2L17A 2QVGA 3E35A 3UVEA 2XYQA 2PYIA 5AVVA 2MSEB 3BH0A 4I4TF 4KQHA 4WCDA 2JLUA 4N48A 1O6ZA 3GFBA 4DG9A 2GZ1A 4Z4QA 3GELA 3H4VA 1WO8A 1RWKA 1SBHA 3KUUA 3O8CA 3HLTA 4NBTA 1ACJA 2FW6A 3BMNB 1HNWB 4F3CA 1SMKA 1XRMA 2MIIA 2ZYTX 3IA7A 2J9YB 3MQFA 3NCHA 1YZ3A 2BFOA 5J23A 2F1OA 2X58A 4MQLA 1UDXA 1N2HA 1LV8A 1E62A 2POQX 1FMJA 2XJ9A 2YNMD 4YYZA 2MINA 3Q11A 2D4HA 4QYSA 1BXRB 3DVAA 3UAOA 3I61A 4CGZA 1BQ4A 4BVAA 2BEVB 3T1QA 1SB8A 3ZV6A 5BT9A 2BD0A 2JGDA 4FJ1A 1T6XA 1U6JA 2B0JA 2IZ6A 2Q6LA 3LRXA 4ZIRB 2VQ3A 2OZEA 1WKVA 3BB1A 1KZGB 5CT5A 1VZ2A 3KHKA 3AX6A 4RVNA 5F3RA 4Q4LA 3WMWA 2GCPA 4QU5A 4ALJA 1M34B 1L4GA 2XH8A 2JK0A 3A70A 3LA6A 3LBAA 3JQQA 3MWGA 1U9ZA 1LDEA 2DAPA 4E12A 2HFKA 2FFQA 4OI1A 1SUBA 2NU6A 1AIPA 1OA1A 2R1TB 4CT4B 2GCNA 1U2PA 1QGYA 1E0SA 3K9BA 3STUA 5L4LA 3I6YA 1PKXA 1KR5A 1ULBA 4IGFA 2AKEA 1JAIA 2WZBA 2XYVA 2NSHA 1R4ZA 3EJWA 3GPBA 5UKDA 1J2JA 2YWRA 5I51A 2PH1A 3EXEB 2HJWA 4KDCA 1VCMA 3H2JA 4RY0A 2FKAA 2EKDA 5HJ5A 1UADA 4PYIA 1G8SA 2V8OA 3O4FA 1CWUA 4JODA 2ZM6B 2Q5IA 2KS6A 1SU6A 1JQBA 2P9JA 2PGLA 2QSUA 2QX9A 3FBGA 1YOBA 2HCJB 3KHTA 3VKWA 1BX0A 2CLIB 2I1WA 4H0NA 4HQKA 4BNFA 3OZSA 4EHDA 2VHQA 1WXXA 5JBQA 4O2LA 1L5ZA 5CPFA 2R8ZA 2HEIA 4XARA 1EFRD 4XI9A 5IJAA 2W4MA 4H4EA 1KJZA 3CEHA 4Y1GA 1B8UA 4N12A 1C1YA 5P8WA 3JATB 2J33A 3K9CA 4XWTA 3P2JA 5I9BA 3ZCTA 5CBPB 3KPJA 4JHXA 2WF8A 3PKZA 4HB0A 3SM3A 1H1LB 1CY2A 4M1ZA 2GZ3A 4GYJA 4UBJA 4EVSA 3MINA 2OG1A 4KC0A 4DCJA 1NXPA 1NWHA 1NLYA 1C4KA 2HDWA 3SSOA 3JD1A 3HRKA 2RHRA 4JEUA 1B14A 4QTUB 1DBRA 1NQTA 2BGKA 2XMSA 3NH9A 4AJOA 1RAFA 2YWHA 3QNUA 4AZWA 3EPLA 4B3TB 3O94A 5FPTA 3IFSA 2PRJA 3KYJB 1TTHA 2UYCA 3SU8A 3WZLA 1ZINA 2JFFA 4BYMA 1QRSA 3L7DA 5HIMA 1OH6A 2D7JA 1EM8B 4QNMA 3E2PA 4DMKA 3FTFA 3CRNA 4B3JA 5CM9C 1P4GA 2WD7B 3LG2A 4DRXA 4NJMB 4UAJA 4KLCA 2GM9A 5LMCA 3JARB 4KJXA 4KMMA 3RODA 3O93A 1UKVY 4AECA 3QFCA 2GYUA 3TIVA 1EWRA 2WIBA 1CP3A 2OXEA 4JT2A 4Q4JB 1S2OA 4TYWA 4L9AA 3ZXXA 4CCWA 4M9ZA 2GUWA 3FI0A 3I6BA 4M2LA 1FRNA 2ZPUA 4Y2TA 3PPWA 3SQDA 4BFCA 1L4UA 3RYFA 3PRJA 1LX6A 2UAGA 1E5DA 1T3LA 5D00A 1E94E 7MHTA 1HMYA 3N2YA 1G8AA 1DO0A 3OZUA 1QCYA 4HH0A 5CW1A 3F5SA 5E6SB 3VDNB 3NTXA 3JQ7B 1IZ8A 3FPFA 3FVRA 5JI3E 5LQNA 2O3JA 2NX2A 1ZISA 6GPBA 4F8EA 4YAFA 5F5NA 3FMFA 3I62A 1JEDA 1OLUA 1G0OA 2CUTA 2AR9A 1CR2A 1FP2A 3NASA 3TBHA 2BH2A 4AUEA 4TV9B 3M4XA 1E1KA 1J24A 3ODGA 3TCKA 5M7EA 1KMHA 3C5EA 3GJ4A 5HZGA 1Z0AA 2RJOA 4H16A 1FBTA 3OJEA 5MGNA 1KGDA 1K6EA 2OO7A 2ZVDA 4HX5A 5JS2A 3MWEB 3J81k 4I9HA 2JEZA 1NUTA 2C1XA 4LUCA 1FYWA 2ESRA 1AS2A 2Y2UA 3EYAA 3TRJA 2WAOA 4BZWA 4RVCA 2QLJA 2K7FA 4LVOA 2C2WA 1V35A 4QBGB 2FSVC 2HLNA 3WWZA 1FVOA 3UQZA 4BE4A 2IS4A 1I3KA 1PJLA 3DDHA 4D9FA 4PIVA 4LJ9A 1RPZA 3HACA 1VCNA 2Q8NA 1T2FA 3ZVLA 3C70A 4X7PA 3C5CA 3ETDA 1G41A 3JS5A 3UY4A 2XE7A 1TLFA 3EVBA 1CQZA 5IU6A 3AQ4A 5JSZB 1I6WA 3KZKA 1UJNA 2PH7A 4X7MA 2AZDA 3WBKA 1JLSA 3S7ZA 4NBKA 4I9UA 1DPGA 3VO8A 2JZCA 2VPIA 3U4AA 1UPCA 3MS7A 4TS3A 1E2FA 4XDHA 4HYEA 1JFVA 2HW8A 3G8AA 1TK9A 2AC7A 1AVTA 2L42A 1ZHHA 3F1LA 3HA5A 4FD3A 4LJSA 2EBWA 3OJXA 2QRNA 4JBGA 2B5VA 4CT0A 4TXHA 1PNRA 2EQAA 4DMLA 3VTFA 1RWBA 3FNEA 1O94C 2GEFA 1V5IA 3A27A 4FDTA 2ANCA 1M3SA 4MRMB 4DT1A 4Z7OB 1U98A 4MQ5A 1JTEA 4YCNA 2XNDA 3PHLA 2VRCA 3O9MA 5FBRB 1QORA 3SJUA 1NUPA 1SM4A 3G6WA 1KTIA 1PR6A 3M6WA 1A7AA 4Q18A 1ZJ4A 3DE6X 1MW8X 3TYXA 4M0UA 3T0FA 4EO4A 4KZPA 1K7XB 3DEZA 3I9V1 4HH3C 4LE2A 1NI3A 2WV7A 3N6VA 4RXUA 3TLMA 1XJ0A 3P2OA 4TVOA 4MIKA 4BO9A 5HIIA 3ZDBA 5F2KA 1PLKA 3IPRA 4C0QC 5C80A 1OXTA 3FHCB 2C3UA 3V42A 2D1TA 4BLVA 4V0LA 2PJDA 1N5OX 4BGDA 2AJDA 1I2MA 1NR5A 1ZOIA 2N1BA 1XDUA 4A1OA 3PEEA 2X0RA 4H7DA 2GEJA 1RJFA 4U5XA 1NVVR 1NYTA 4XIYA 5CA1A 1KIAA 1H1TA 1ZRHA 3R8FA 1W4CA 2HA5A 1N57A 2Q0HA 2XZPA 3ZIDA 3K1JA 2DE0X 3ONVA 4M8IA 6ADHA 2ZRQA 3CRMA 5C31A 2H4FA 2QQ0A 3E8SA 5JAHA 2R25B 3VKUA 3Q1KA 2E49A 3GEBA 1E63A 2RHBA 1XPOA 3OIVA 2VTBB 2Q6IA 3UMJA 4OJYA 3PNVA 3C3XA 1GDHA 4RU1A 2IX3A 1BU8A 5BQXA 2CDBA 1DWUA 1HLPA 4NAUA 4YJ3B 5C8DA 1KDRA 3FJYA 4U2BA 3KYIB 3BSWA 4TWIA 3HZOA 1CUHA 1GZHB 3GFOA 3H11A 3VO2A 1KZHA 4NDNE 2BR5A 3NKFA 2ZSEA 3IAM1 4LXHA 3PNQA 2C5LA 3AEUA 4LJ6A 4R9NA 2RB4A 2C0QA 4NS1A 4R1UA 3TW8A 4DDUA 1CV2A 2HRQA 1K7CA 3ZTYA 3AL0C 4FN5A 4CF4A 3BK1A 2G09A 3AUUA 5IYZF 4ZVLA 2D4AA 2BKXA 5D7NA 4LYJA 4LPKA 4QYIB 3HKBA 5EP3A 1RMYA 1E4YA 3LRPA 1Y8QA 3NTVA 3HFSA 2ZIZA 2OORA 3GVCA 1ZMRA 1MT3A 4HGOA 4BFLA 3FXAA 5T6MA 4OYYA 3SZRA 2QX4A 1VFPA 1Q50A 2GETA 5U4XA 4DJTA 1V1RB 4WEQA 4HAUA 2REQB 3WNDA 3DO5A 3ZQJA 4C6HA 4CFZA 5C9ZA 4ZCPA 2F7SA 2IFTA 4RENA 1NPTO 1XZHA 5LOVB 4RLSA 1U2GC 5LKRA 1HE5A 3BS4A 1UR5A 1VFNA 2IP4A 3PFHA 3PX3A 4QAJA 2QY6A 5JD3A 4JB3A 2B7BA 4OG2A 2PY6A 3ADBA 4Q9AA 1C7EA 1XA3A 4YHHB 1Z33A 4DVGA 1WDKA 1IAVA 2GQ0A 4FEAA 4OQXA 1EVIA 3PDIB 2AI2A 2G3YA 1DIOB 1YNSA 1L5GB 5BMVB 5AW8A 5F3WB 4JDPA 1AOXA 5FWYA 5C8YB 3B6MA 2WM9B 3RFVA 4ZCRA 3D4OA 1GAJA 2R65A 521PA 5JDCA 1FJHA 1GLVA 5JY6A 2VUHB 2F3TA 2SKCA 1PSWA 1R10A 3M83A 2CK3D 2Y0BA 3LUCA 4WUTA 4ZEVA 4CMHA 4ZI3A 2HTEA 2LIPA 3AVQA 4KG7A 4Z5XA 4R98A 2C9OA 5DM60 2QZPA 2Y0DA 4ONEA 2CWWA 3EC7A 2OQIA 3H5IA 1LZLA 2XKJE 2IQ5A 4EMSA 5DN6D 3BGDA 2II6A 3BDAA 3SQMA 4FDLA 3FLEA 2CLSA 4WMLA 1OFUA 3BWMA 5HIJA 3HJNA 3IDZA 4MCJA 4Z2YA 1H3EA 3HNOA 3MT9A 2PUGA 1H93A 1NHWA 3D3QA 1GTZA 3AY3A 5FI5A 4X62B 5ALYA 2JAXA 3EDMA 3PE4A 1WEKA 5KSYA 2N47A 5G0VA 4S1TA 5LJLA 5COQA 1P19A 1NN0A 1Y80A 3CLSD 2FCAA 1GN9A 1KDVA 2VDKB 2ZBDA 4TX1A 1AS3A 2E2WA 2GHTA 3BMCB 5D1HA 3W34A 3ZKWB 1QG6A 3TF5A 4W9MC 2Z6QA 1WVGA 3FCXA 1PD0A 5DB4A 3HB0A 4Z9YA 1JDPA 4ZVNA 4DZTA 3C16C 1E9EA 1L6RA 4RIHA 4WVLA 4EG0A 1EIWA 2Q1WA 2C5BA 3IVRA 2GRUA 3T99A 4TUYB 3TUJC 1HFJA 1X7YB 4DXHA 1GYQA 2XKBA 3TQFA 2E3JA 3BMQA 5T4BA 2P2YA 2YMQA 4LZOA 3I6QA 4UCWA 5M3BA 4CMEA 3A06A 2WDZA 4FKBA 5LB2A 1L5NA 1ZH2A 2HPVA 1U7UA 2V7BA 3UJHA 5KOIA 3EOAI 2R8BA 4TRRA 1DDGA 2W2OA 4F56A 2ACVA 3QEBZ 1DO8A 2QD4A 2C3PA 5ARCA 3VH4A 2ZIWB 4KE6A 2JZNA 5DI3B 4TYYA 1A7JA 4MWDA 3WMGA 3SZUA 2IV2X 3U9SA 3OVMA 4LYFA 4QXMA 1DMSA 3HWWA 3O0DA 4TM7A 4LJYA 4O8ZA 1XHLA 2ZUTA 3ULKA 3BE5A 3SXUA 5H68A 1UXJA 2O20A 4LC9A 3FTEA 4MYUA 3QBEA 1JEJA 4QBHA 3UAYA 1NR1A 4IO1A 4Q1VA 3BPSA 4UVGA 5L8VA 4W5QA 3QUTA 5EKTA 4S12A 5JCZA 1P72A 1N2ZA 1P39A 1LSOA 1ORVA 1X7ZB 2QTCA 1E9DA 1US8A 2QGNA 1G7SA 1AK2A 4B48A 5CCBA 4I9FA 3WBJA 4ENRA 4PNZA 1I7LA 1E1RA 2WVGA 3HB4X 2IW3A 4GBMA 2XOKA 5EMHA 3D7SA 3UZUA 3L0YA 3LL7A 3VC1A 4P34A 1F7VA 4PYNA 1EUQA 4D25A 3REQB 3UYLA 1CPYA 1E9SA 3CQ9A 3UN1A 2F8SA 3BRCA 4Q9LA 2X7HA 3F97A 5U4QA 1MPTA 1EP3B 5IW8A 1ST3A 2ONKA 3T7AA 1TZ2A 1JUDA 2W6JA 2PKCA 2Y77A 4J7XA 5BWBA 3WA7A 2DKOA 2A35A 2VJDA 3JQBC 5K09A 1ZJWA 2VXYA 3M33A 5LMZA 4C21A 3E22A 4JA0A 3T1VA 2UYOA 3FM9A 2PJRA 4F9GA 2HLHA 1KU6A 1TO2E 1TF7A 4BMZA 4WKPA 1D6SA 1SULA 2P2NA 4P3KA 4KWTA 4WRRA 1E7SA 3H3JA 2BMJA 3BF8A 2WJGA 3CUEF 3LCVB 4H4DA 5HQJA 1UBTS 3T7CA 4M1YA 2V8BA 2QUBA 4GNKA 4MQMA 4CLOB 4CLRA 2HWKA 1W0KD 2IBTA 5AW0A 2Y1WA 3I9NA 4TMKA 2ZTLA 3EXIB 2WSLA 3LUPA 4FSDA 3CNHA 1SQ5A 3LK7A 4Y1FA 1BYUA 1QTNA 2OZLA 5AKJA 3A1WA 5JWHA 3EWIA 4NNPA 3I72A 3OQVA 2ODWA 4IMIB 4ROSA 3OPQA 4UPDA 5I8WA 3Q1LA 3FPGA 3AESB 5LDHA 1PUXA 3SAJA 1RRKA 4GZMA 3L4JA 1L1EA 4QNNA 1CJMA 2EG9A 1IRXA 1TZMA 3FWHA 3OZIA 3LT2A 2ZSJA 3ZKAA 4AF7A 1XMIA 4BLTA 2G08A 1M54A 4HVAA 1FUIA 1F3LA 3C39A 1UBJS 2R00A 2VWGA 5TPWB 3GEMA 3KK0A 3L8DA 4EUEA 4MQEA 3PNMA 4TV9A 1HE3A 4FBGA 3DLCA 1SUIA 4EF6A 4NICA 1R6TA 1TEXA 3JYNA 5TMBA 3SF8B 1R4MB 1KYYA 5DNAA 3EA5A 1NXVA 3H1FA 3SJ7A 4MQFA 5JSZA 1YIDA 3JQBA 1XAGA 1LF0A 3HGMA 4UOQA 1FNSA 3B2QA 3TTVA 1U0FA 4GQAA 5IS2A 4IF4A 3MNFA 4RPKA 3SKXA 1A9ZA 4P0QB 2Q29A 2FPIB 1AF4A 1JQ5A 3VX3A 1T15A 1WDLA 5HUJA 4RABA 2WE8A 1PD1A 1SWVA 1TKAA 4RF2A 2Q4BA 1ECBA 1UWCA 1IQRA 1LD3A 1M0WA 3MGGA 2W0MA 2P2DA 4PAMA 5TARA 5BW5A 5LQJA 1U3GA 2PLWA 5BN5A 4LF4B 4NU0A 3WDKA 1E3SA 2N0SA 4BGUA 3K0CA 2CDNA 2IYWA 1F6BA 3K94A 3WB2A 5CH5A 4Z3DA 2EWVA 3MTJA 5K6AC 3KJEA 2VPYA 3KZNA 5CYPA 1TKRA 4M1SA 1TYZA 2ZTHA 1QBGA 1MX9A 4CM4A 2VTVA 2VSQA 1IWPB 2DWOA 3JWIA 4LDPA 4WFJA 1ZUNB 1ODCA 1GSOA 5G3YA 4Z6KA 2GF0A 1LW6E 1QKIA 3HLYA 1TI7A 2X3FA 4ZT7A 1DBSA 1LTHR 2JI7A 3ZCQA 2X40A 3PEUA 1QAOA 4BAGA 1L5QA 4COKA 1E58A 3E48A 1V39A 4FWIB 2QV0A 4PZLA 4UNSA 3DONA 3G6KA 4IMPA 5CURA 3W5JA 5B12A 2D3WA 5AJWA 3I5XA 3PT5A 2GVZC 3RS8A 1JAZA 1C29B 1ZN2A 2CVZA 3NGLA 3R8CA 4F96A 3E9RA 2Z9BA 5FWNA 2BUCA 3G9UA 5ARDA 3RBXA 4U5QA 1RIFA 2PFSA 1KQFA 2BHSA 2Q8PA 4NBVA 1EINA 1P2UA 2XIQA 3OO0A 1EFRA 2CBGA 3T3NA 13PKA 4WQMA 2OGSA 2VPTA 4URXR 1Q7CA 1P0CA 3LBNA 3RV4A 3ZY5A 1LXCA 4IX1A 5EESA 4OAPA 2C54A 1UZLA 4V0KA 1P1IA 2B8JA 1UKCA 3OFVA 3ITDA 4QATA 5K03A 1L5LA 4AC9A 1T2NA 4TROA 4QVIA 1JWAB 3R3YA 4HEJA 5KAPA 4TKZA 3V8BA 3GEGA 2GN4A 3REOA 3B2NA 4ER6A 5HG0A 3SS8A 4D56A 1P3JA 4DMFA 2CDAA 4F4FA 3KLNA 3R6LA 1VHJA 1B2LA 3DDUA 5AKYA 3HV0A 1M74A 2P8JA 3ZWCA 4HQRA 2KLBA 4MWSA 4B3BA 4YIKA 2X5KO 3FGZA 3K0BA 2FWNA 3QW4B 4JMLA 1SCJA 2EF1A 3PR2B 1CJSA 4QTYA 3AUTA 2CDRA 4DLVA 5KTSA 2YX1A 3K2IA 1HC7A 1F2VA 4JEMA 3RASA 2FSVA 3R0JA 1AV6A 4JBXA 1I5EA 4LSWA 3V9PA 2VRCD 1P4SA 2GPBA 4NX2A 4TV8B 4N7MA 1XZ8A 4NG5A 5ALLA 1MOZA 4GZ6A 2QHXA 4ZO7A 1Y6RA 4YIHA 1V96A 3RYCB 4HJRA 4XB6B 4Z4CA 5AUPB 5C53B 2V96A 1E8NA 2P5SA 2Q99A 1VJ0A 5BQFA 2V0GA 3CF2A 3BD9A 2AQ8A 2ZJ3A 4PCLA 1SIBE 2BHLA 2OENG 1J2RA 4QDUA 3TRDA 2O2XA 4LXYA 1K7YA 2VWQA 4MUHA 1LVHA 5EIWA 1SOWA 4O4LA 3FLMA 5L6MB 5BXQC 3B6JA 2C2KA 4KWEA 4TL9A 3TGLA 4Z1MA 2PUDA 2XCSB 1FDOA 4R8SA 3U7QB 2V3CC 4K9MA 3ET4A 1W0KA 2BKVA 3TNYA 3QBTA 4GUAA 1T3ZA 3TSAA 3VR5D 3AVOA 2J9ZB 2O7VA 3HFRA 4KWCA 2Q1UA 2R6JA 3PDJA 4GXRA 4KIUA 1A5ZA 2IF0A 2QUAA 1JE0A 3VRHA 5CB4B 5HXAA 5K99A 2OO5A 3E5RA 5K3SA 1YZLA 2IXBA 3EBLA 4O4JB 4HWTA 1NKSA 1Y7HA 1Q6ZA 5CB8A 2O1SA 2VJMB 3VZDA 3LIPA 1E1QD 2JIBA 4N8SA 1JEOA 2AUTA 2XYHA 3V1KA 1FL9A 4TMXA 3Q5EA 5J2TF 2G5TA 3A26A 2PJUA 2P40A 3AR4A 5ITZA 1RM5A 4Q7JB 4ZAXA 2RC5A 3ROTA 4G0ZA 3FJOA 4A6PA 1YFLA 3NHAA 5DK4A 2XSZA 2BEWA 4BNIA 1QR2A 1FVFA 1WXWA 1XQYA 3ETGA 1PUIA 2BCJQ 1E9BA 4ZVMA 4L5IA 3W3AH 3FHJA 1LJLA 1PT7A 3DQZA 3SZOA 4WESA 3VNBA 4QYTA 5JY1A 2D6FA 3UGTA 1T8PA 3GW8A 3AILA 4ZVKA 4XWOA 5F7OA 5F73A 2P9TA 5EI5A 5ILGA 4E5DA 4EKYA 4CEHB 2OKGA 3DWEX 4WBNB 5KJFA 2W2KA 4K28A 5FOSA 1Z4NA 3TSOA 2B4TO 4IXTA 4R5HA 3M3DA 4BVHA 5IANA 3PA8A 4GX5A 3TLJA 6LDHA 2V6FA 3MK31 1X38A 2D1YA 5A2QA 1FQWA 3RKSA 5EINA 2Z8ZA 2XVAA 1L5SA 1TF5A 5J4YA 4G0UA 1VMEA 3PEYA 1PGQA 5G0TA 2JGNA 2HK8A 4YQYA 1RYMA 1IC6A 2R4QA 2XNHA 3DQQA 3K31A 5K6TA 2J31A 3EPJA 4HLUC 3D8SA 3V7YA 4DKXA 1GPJA 1T8UA 1F1BA 1I80A 2VPXA 3AG5A 2VDJA 5DOVA 1RP1A 5JNLA 1M2KA 2PV0A 5LZ5A 3A9RA 2GPNA 2MYUA 4JUIA 4EJMA 1A4RA 3ZE7A 5ED0A 1BOOA 1B0UA 1VJGA 4KO8A 4MS3B 3QSYA 1UMDA 1JILA 4G1CA 1MRZA 4HX2A 2WQZA 2H4JA 3AIOA 3IC5A 2B6HA 4MXDA 2NU9B 2C1EA 2VDWB 4HP8A 3CLUC 1IXRC 1PBTA 3EFOA 4JELA 4O5OA 4WZZA 4Y98A 5LYJA 3EPHA 5AH0A 3SQWA 4DFDA 4EFNA 2ZJOA 4K9QA 1QANA 5FWXB 1QKKA 1EE1A 1XAJA 4IOKA 1PNQA 2A1IA 4F6RA 4V24A 4DWJA 3AJRA 4DOMA 3MWKA 2PAAA 4DN6A 2C2XA 1ADJA 2HADA 2ZBEA 3E9ZA 4C05A 1E2JA 2JA2A 1BXGB 2VYNA 1G20A 2AFVA 2NGRA 4B85A 3F6PA 5I9SA 4YDQA 4OQPA 5KDDA 2ZIVB 1QVZA 1RTTA 2H7YA 1QH8A 4G0XA 1YZGA 4FWTA 3JRNA 3MJTA 2GBPA 2WHYA 1N25A 1PDWA 2O3SA 3GJZA 2WYVA 3CG4A 3OPXA 1XLVA 4M0KA 1BA3A 3NOVA 5DDIP 3ZE1B 3GRKA 4URUR 4IGEA 5EWMA 5HKAA 1EWKA 2JHFA 3WMXA 4HNAA 4JLDA 3TVDA 3A1CA 3FNFA 4MWEA 2Y1KA 4DA8A 1HSOA 3OEED 1VPTA 3NNDA 1RWQA 2I65A 4K8OA 4QBFA 4GBGA 3ROPA 5DHUA 4YV0A 4OXRA 1YDWA 3F6RA 2HMUA 5JS6A 1CNMA 5FUVA 2QJWA 3A6GA 4HDOB 4QUGA 1WB5A 4IIBA 2DTXA 4B35A 4DWOA 3F7OA 3T38A 1KWKA 3Q5DA 1UPBA 4D8XA 4HXEB 1R0BA 1V0JA 3C3PA 3QZUA 1HL7A 3FX2A 4WXEA 3VTZA 1ZSYA 2CNWD 1TQ4A 2OV2A 3IV6A 4XEUA 3WLLA 4MYCA 1MEOA 5A1TA 1U8EA 4NV1A 2H1SA 3EG9A 1VCOA 3KV1A 3MB5A 4PG8A 1JBKA 3KV3O 3C4QA 4IXWA 4LF9B 3QHAA 1M2VA 1XVUA 2VAXA 1VBMA 4UHJA 3PQDA 3OBIA 2Q49A 4MUJA 4WZ6A 1B4DA 5AMXA 1XC7A 3DZHA 3TH5A 3WLEA 1JH9A 2QQFA 4JSRA 1WMSA 1DG1G 4JLNA 4CMKA 2IYSA 4KMOA 4H3SA 3TZQA 3F8TA 1SUCA 3H19A 4IILA 1BMTA 5A5VA 3BL5A 3OIGA 1PJSA 2BTQB 1QH1A 1TIKA 2FGKA 1XRQA 4JU9A 5L53A 1NP6A 1GFSA 1O54A 1RLIA 1CNFA 5EA2A 3O4RA 4ZOQI 3ZDDA 3M34A 3TW6A 4HNVA 5JANA 3G2KA 2PVSA 4X95A 4M0PA 5JD5A 4HN4B 3JAMA 1UEJA 2FDXA 2ZB8A 2B82A 2O7QA 2VFAA 3TNFA 1X1TA 2FZGA 3DBVO 2MU1A 4QUAA 1TQ6A 1A8PA 3ZZNA 1WY7A 4RAQA 3RSQA 4EJ6A 1W5FA 2WJJA 2IZOA 2OXTA 2HBQA 3PUKA 4AFNA 1GTG1 2B4RO 2YFKA 1I30A 3LXRA 2F1IA 3RGGA 4G3XA 1F5SA 1P31A 1VMAA 2W8BB 2YYYA 2ZU0C 3GUZA 3NXSA 2OCYC 2RARA 1VG1A 1JA0A 5T3UA 5AFSA 3GJQA 4NFSA 4US0R 2C5FA 1ZVKA 2G1AA 2QLFA 1CVLA 1I3NA 1ODKA 3BGOS 3EARA 1OTYA 3WJ2A 1Y1SA 1KO4A 2QM8A 2WBLC 2AVDA 4EEZA 5AVTA 4XKJA 3U4QB 3DTTA 1QV6A 1RT9A 3COWA 3UAXA 1QLHA 2JAQA 1M6EX 2AVNA 2GD6A 2V9PA 1MABA 2GKGA 2FQWA 1P5ZB 2PKXA 3N2KB 5BQ5A 3VPHA 1GT91 1YQ9A 1AE1A 3GQBA 1KY5A 4JBYA 4XFDA 4XVUA 3BZBA 3ZEAA 5JZ9A 1QPBA 3AIIA 5JCJD 2A9QA 4PPFA 3QELA 3PUHA 4BJHB 5JPDA 1YRLA 2W43A 3UT6A 2R7AA 1UJ5A 2QRKA 1YDGA 4BLWA 5B5SA 5DVZA 3IP7A 4WINA 3IR5A 1F0YA 4L75A 1XQ1A 2RGRA 3O8LA 3X1MA 3ZK9A 1HLGA 3BTVA 5EQJB 1T9HA 5BYJA 4CKYA 5EOVA 5EUQB 4JLBA 3G7UA 2YUIA 1CQPA 4WLNA 4YRBA 5JD6A 4JP2A 1SOVA 3WK4A 3GUYA 4LE1A 2Z2XA 3MUOA 3EN0A 4V3CA 5TQ0B 2JDIA 5KNBA 2ALJA 4AMZA 1Z06A 1TNDA 1DJQA 1PJAA 2VDWA 4H18A 3WP0A 4RVDA 2HRCA 4UTPA 1A2BA 1PR3A 4MVWA 1CR4A 2F43B 4ZWNA 1ANKA 3IELA 2ZJ1A 1P7ZA 4BU1A 3BFJA 1DC8A 3X43A 4XQ0A 2OM6A 4ZOLF 1HSZA 2AJ8A 3OQOA 2RHHA 2XQIA 1AGYA 4NCKA 5JFTA 4PNPA 1VMIA 3L7YA 3NYRA 2UUOA 4QGHA 3N2LA 2HIHA 4DNPA 1OXXK 2A94A 3ET5A 3IEPA 4KB5A 3KOOA 4MUXA 4MKHA 4F5YA 3OLWA 2YDXA 4GX0A 4DJFC 2CHVA 3N2GA 5IBCA 1GZVA 4RY9A 2Z08A 5JSKA 2Z2ZA 4C06A 1MGPA 1LB1B 4B3HA 1JHDA 1EFDN 3D4NA 3PCRB 4YLYA 3FFTA 4MR9A 1PUJA 1HMPA 2R8EA 2ZJ6A 3HJAA 2ZE8A 3INRA 2XHEA 3G0HA 1RFLA 1ECCA 3SLRA 1NPYA 1ENYA 2QYSA 4C6SA 2B2XA 1JG3A 1XQ6A 1Y7PA 2G5GX 1ZBQA 2P9YA 2XDWA 2GK6A 1F6WA 3JQEA 4ARCA 5GIPE 2YWEA 3CVOA 2JIZD 4P08A 3JQAD 3KSDO 5HMLA 3VI4B 5J2TA 5IDYA 1T3GA 5JHGB 3OOSA 2BGWA 1ATIA 4FIDA 2BGRA 4KTVE 3TZ6A 2TYSB 4KXUA 4Q48A 1HRKA 1S5PA 2D1FA 1UIRA 1SPXA 3IH5A 1GHTA 2R6DA 2QMZA 1NURA 3EULA 3PGXA 1EA7A 1V7CA 4TLEA 1UBEA 1AQ6A 5A9TA 4D6PA 4QXAA 2HR1A 2UYGA 5EWJA 3K5HA 3BQ9A 1Y9DA 3I01A 3KOXA 3WL8A 4V2IA 4UQPA 3UMBA 1DO2A 3TKLA 2XTMA 3KKZA 4DF3A 1K3FA 4E5KA 2XQFA 1R15A 1K9SA 3UHPA 5GVRA 4W5RA 3PX2A 1Z26A 4IR7A 5DGTA 1DPFA 1Y6JA 4BN0A 1GZUA 1WUIS 4E22A 1PJ4A 3H13A 3O73A 2DC1A 5DYWA 2JAHA 3U3XA 4CKWB 3B8EA 3WDMA 1X13A 4MH0R 3R5JA 2V9ZA 4DBLC 4MWGA 4TXLA 2G71A 5I5EA 3O3CA 4J6FA 1EWVA 1Z38A 4IX9A 5HZHA 4MCHA 4I1SA 3L6RA 1C3OB 3D7NA 4TLMB 1C5KA 3RYIB 1FS6A 1PZXA 4GIBA 2QN2A 1SA0A 1CQIB 2WHPA 1KMHB 1BRMA 3E0QA 4XX1A 2DOKA 3COYA 3ZZMA 4YEDA 3NAGA 5BN3B 1E2MA 3V1LA 1W1UA 1OBCA 2XHZA 2QTRA 2VT7A 4Y18A 4HVCA 1L4EA 2HSDA 2IYZA 5G02A 3HVJA 3N8DA 2P62A 3IOYA 1Q14A 4PQRA 4GKAA 4WLUA 3OQHA 4DAOA 3A14A 2YXNA 1JP7A 2FUG1 3TZBA 3VO1A 4YJFA 3W6OA 2DG2A 3QTBA 3E9DA 4FZ5A 3P7MA 1QO7A 5ED4A 4NVRA 4TRNA 1XU9A 1GG9A 1A9OA 2XQKA 4IWXA 3FF4A 2HN9A 3TI9A 2GHQA 1U7ZA 3MMZA 5EIHA 4PVDA 3LO8A 3ZY2A 4ZMBA 1WHSB 4PXAA 4W8OA 3KFLA 1Q3HA 2VT6A 5FBLB 2XCQA 1FZTA 1N9ZA 2YIVX 2ZSFA 2WILA 3TX2A 5GPBA 4AMUA 5IJ0B 3HPQA 5ECDA 5AVKA 2PFKA 4B3FX 1PG2A 3PSHA 3WFIA 3BWDD 3L6UA 1QHXA 1SC4A 4EEXA 2IDMA 7REQA 2LV8A 2FOIA 1U7XA 4RMNA 5A4DA 2ZRHA 3MJSA 1SXHA 4BXOA 4TSKA 1LTKA 2JBHA 3MCUA 2DLNA 3RH0A 5ITVA 3HO1A 1X15A 3W2HA 4A7PA 2H3HA 4Q4CA 3AVTA 1DEAA 4LRWA 2P0AA 1VKNA 2BIFA 4G01B 1JI0A 1JJAA 4IZHA 5CP8A 2HMYB 3H8JA 3H75A 4DMCA 1FBNA 3MT0A 2QTFA 3GRZA 4PINA 2AK2A 2RDMA 2VJLA 4MKGA 4TL8A 2XTZA 1RQGA 3B20A 3T7EA 3UTDA 4ZOBA 1T2VA 1EIZA 2DQ4A 2I6FA 1VQ1A 4CM4B 4YK7A 1ZU4A 4BKQA 5CXXA 4ZT2A 3UF0A 4PANA 1VKZA 3KIPA 3QKRA 1WIWA 3KQOA 5FTWA 4QODA 4F3RA 4AY6A 2AFHE 1Q95A 1ZGGA 1XV5A 4JENA 2QZSA 2Z30A 4JUAA 1FUUA 1QB8A 3K9NA 1J23A 3Q0TA 1VHQA 2JFVA 5C3MA 2FFBA 4QXQA 1BKDR 1ENOA 1TXGA 3QVWA 3TPCA 1EVQA 3NJRA 4KIJA 3TSYA 3IKVA 1FEZA 1WMEA 1AGPA 3INTA 4OVKA 4NBNA 5EXTA 3HVIA 4C0HA 4FFWA 4MV3A 3RSSA 1Q15A 2XDQB 5E4FA 5AQEA 3CHYA 4R3UC 4BVLA 4CM1A 2ZTMA 4HN2A 5IH3A 1EGAA 4OMDA 5FNVA 1H0HA 2R4UA 4E7OA 3AY0A 3GFQA 2AE2A 5TRTA 1Z0IA 2ZDHA 3V8EA 2Y27A 4G36A 3H65A 4X41A 1QGUB 4B34A 3CW9A 4G63A 1N34B 2C2ZA 4L6AA 5SICE 1GPNA 4CDRA 1TZKA 1VPLA 3EA0A 1AQJA 3W2IA 3I5MA 3T1HB 1DNPA 3E7XA 3FRIA 3GPIA 3W79A 4AP6A 2ID7A 1Z5UA 1UJ4A 1X8XA 2IEGA 1FXWF 3C8DA 1FFCA 2JFBA 2V5UA 5DHFA 1G6KA 4UFPA 5C7IO 3KLMX 4G1UC 1LNQA 2YNMA 2ZU6A 2SBTA 5ALHA 4ZAZA 5HKKD 3A6DA 4JP8A 7AT1A 5LP6F 3ZG6A 1OXBB 1SCIA 1RPAA 3VNQA 3C0KA 5EWJB 4YRPA 3KKLA 5C8YF 5K0JA 1Y1PA 3QLUA 4A0HA 5JZBA 4XYGA 1GSIA 3EA4A 4XIIA 2EX1A 1E77A 5KPDA 2VQFB 4MV7A 1X8LA 2O07A 3TRFA 2DR3A 5DX8A 3E3OA 5B7QA 3LKZA 4ON9A 1JJFA 1N2OA 3KB6A 2J0QA 4IS3A 5BQPA 1ICEA 3W7AA 1WU7A 3RTAA 2DBZA 3ZGVA 2ZI4A 4Q0MA 2Y99A 2Q0SA 2H0QA 2YV2A 2ZAOA 1A5SB 2H0RA 4FHFA 3WWCA 3ZDRA 5HX7A 2WWVD 5FTJA 1I4TD 1KVTA 1Z37A 3DB1A 2GJ8A 3AZQA 3IP9A 2QIPA 4PQEA 5A5FA 1OV6A 5BSWA 1G9TA 2OGWA 1SHTX 3JQDA 2GSDA 1KU0A 2DQZA 1JPJA 1GGMA 2O48X 4IDNA 3VR1A 1LBHA 1JYEA 3TD2A 4EFDA 4I5GA 4S3MA 5GTDA 1SQ0A 2I1VB 4C4SA 2D2FA 1SU7A 4Q9IA 2I4IA 1G6Q1 5F1KA 5KC8A 3A0RB 1BWPA 3ST7A 3UHOA 1U2RA 3Q9NA 1J7JA 1KQPA 3LW7A 3NM6B 4EJSC 1JDJA 1N77A 2Z58A 4ZTZB 2QX6A 1WKCA 1EH5A 1XRRA 1Z7GA 4BY9E 3ZNOA 121PA 1QZXA 1C3EA 3DBRA 3BIXA 1IJKA 4NMXB 3DVRX 4QVKA 4E3ZA 1MRSA 3X1WA 4RD6A 2AF3C 3AJAA 4V0ME 1N9GA 2IYXA 2P35A 2WVJA 1ZGZA 3N2NA 5GM1A 4FGZA 3KVVA 4BO8A 4BJ3A 3UTCA 1RSZA 1ZQ1A 2X4GA 4LYYA 5C8ZA 1UT8A 1RXVA 4XWYA 3I58A 5KQMA 2IQIA 3G8DA 1U3WA 3RARA 3WRXC 1P4HA 4LFAB 4IIXA 4D8VA 3MC1A 1SC9A 4FP9A 3H2ZA 3P9KA 3C3YA 4I8XA 1IY9A 3U31A 2QVXX 2WU4A 3W9SA 1MJNA 5ALZA 1KC1A 3EZLA 1X74A 2JCYA 3OU7A 4WAUA 4Q19A 1GITA 2ACWA 4WN3A 4UMFA 4NPHA 2WF6A 4H08A 2X14A 3ADCA 2ZULA 3UJAA 3X2FA 4IJWA 3IXQA 1GARA 4V03A 3ZOZA 2FJUA 3W6UA