3KR1A

Crystal structure of hpnmt in complex adohcy and 5-chloro-1h-benzo[d]imidazol-2-amine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kr1A00
2ORED 3NW9A 3B3GA 3UJ7A 1JTEA 1VP3A 3GXOA 2NP6A 5FQOA 2C7OA 2NYUA 5ICGA 3UBTA 3VC2A 3MERA 1SUIA 3HNRA 2ZIEA 3HTXA 3ORHA 5EMJA 2N47A 1FPQA 2G72A 3EVGA 3MTEA 1TW3A 5FA5A 3LDUA 3NDJA 2O0LA 5DX0A 2ZCJA 1SUSA 2IH5A 3NVMB 3TPZA 2C7QA 2XBMA 2QYOA 1T43A 3ELYA 3EPPA 2OBFA 4GOLD 4KIGA 3UJ8A 2OZVA 2LD4A 3VC1A 3OU2A 3OPNA 4FT2A 3X0DA 2VS1A 1IM8A 3MB5A 4EK9A 3TOSA 5EHGA 5CUQA 5HIIA 4FSXA 4HTFA 3MTIA 3EVDA 1HNNA 3G8AA 1L3BA 3D2LA 2AN5A 2ZZNA 1ORIA 4KVZA 1JSXA 1XDSA 2GPYA 3G5LA 4OBXA 4BLUA 5DXAA 1KIAA 2PWPA 2AZTA 4X61A 1P39A 2JHPA 2OY0A 4PYLA 3FPFA 3PS9A 4NECA 2AR0A 3B7PA 1VPTA 2JH8A 2XYQA 4KIFA 4EKIA 3TKAA 1IXKA 2P3QA 4ER6A 1RI1A 3RODA 4F85A 3AXTA 5FA8A 2ZIGA 3HVKA 2IGTA 5GM1A 4GBED 3TRKA 1F3LA 5DRTA 4BP1A 2AOVA 3GO4A 3B5IA 3FUXA 4C05A 4PGGA 1N7IA 4C04A 3IHTA 2PVCA 2JH9A 4BP3A 1G8AA 1Z3CA 2QRVB 2VDVE 3KKZA 2CMHA 4R05A 3ER9A 5EZQA 2PXXA 4HC4A 5K0CA 3RW9A 1R6AA 1R74A 3K0BA 4FZVA 5LR6A 1PJZA 3B3FA 4GF5A 3DXXA 2H1RA 3FYCA 3I9FA 2ZBPA 2FCAA 2Z6UA 1R8XA 3UJCA 5LQKA 3GRZA 4A6EA 5DX8A 2UYQA 3UA4A 2UYCA 3GIWA 2GH1A 4FGZA 3FPGA 3O7WA 5DM4A 3T7SA 3LL7A 3QOXA 2BH2A 3M6XA 5HIMA 2Z6AA 3GRUA 5K05A 5EIWA 4KDCA 3KPUA 1JTFA 2JG3A 3T0IA 2VZ9A 3KQMA 3P9IA 5E1MA 2ZZKA 2K4MA 5CVVA 5DX1A 1BHJA 1DUSA 1IY9A 3DH0A 4ATNA 3Q87B 3OU6A 5E9WA 1INLA 3CJTA 3DULA 4LECA 1UFKA 2P8JA 3M70A 4POOA 2PX2A 2H00A 3QV2A 3P71T 4X1OA 1BC5A 5K0BA 4Y2HA 5FHRA 4RSRA 3EGIA 2AS0A 3OFKA 3BWMA 9MHTA 3BWCA 4M37A 2ZSUA 3EGEA 3HVJA 3FYDA 3G8BA 4GEKA 1JQDA 5EOVA 5T6BA 2HR1A 3DTNA 1L1EA 3LECA 3SSMA 1JG1A 2BR4A 3E8SA 4GOMD 4KRGA 2VDWA 3TKYA 3PX2A 4IV8A 4PCLA 4QVGA 3UWPA 4RTOA 3BT7A 2EJUA 1UIRA 2EX4A 4QPNA 3EMDA 1Y8CA 2YQZA 3G2PA 3GCZA 4BY9E 1X1AA 2CL5A 4PYKA 5EKXA 2AN3A 4E31A 5P8WA 4LWPA 1QAMA 3G89A 4E2YA 2Q41A 4AZWA 1XJ5A 2XVAA 5LQUA 5K8VA 2BZGA 4MIKA 4OA5A 2GS9A 2V7EA 4FP9A 5DPMA 2E5WA 3PTAA 1NBHA 3HCBA 3KPWA 3NWBA 4Z2YA 5C1IA 1RJEA 3E23A 3UZUA 5BW4A 5BXYA 4E33A 2FHPA 2QE6A 1D2HA 1KP9A 3CVOA 3L8DA 4EMSA 5LQAA 3ME5A 2ESRA 4UOEA 3P8ZA 3LKZA 1ORHA 2XVMA 2YTZA 1I9GA 2PWYA 3KR2A 4CKCA 2P35A 3ID6C 3FRHA 1RI3A 1YZ3A 2G8NA 2GA9A 1WG8A 2PV0A 3TMAA 3DXZA 3FUUA 3KQVA 5FWDA 2I6GA 1EJ0A 1RI2A 2O06A 4YV0A 4RTLA 4MHTA 5LQCA 4RV9A 2PXCA 4GQBA 3P9NA 3KQQA 5EMLA 1SQFA 2IDJA 3UJ9A 4PIMA 2Z6QA 1MHTA 4JXJA 1KYWA 2B25A 3UJAA 1G55A 4AX8A 3PVCA 3NDIA 4C07A 5EEHA 3H2BA 5IKMA 2IBSA 2ZWAA 3AY0A 4HGYA 5CM2Z 1KXZA 1R8YA 3C0KA 3R3HA 2PGXA 3EVCA 3HM2A 3KQSA 5EG5A 2JHCA 2I62A 3C6MA 4HTFB 4ER3A 3TM5A 3FZGA 2AOUB 5DRYA 3KR0A 5FHQA 5CD1A 4XUDA 2ONYA 3RIEA 3GGDA 1KHHA 3FTEA 3KHKA 2PSSA 1FP2A 3ELUA 4PYMA 3C3PA 4MTLA 4RYLA 4EQZA 2PY6A 5KYGA 5EHIA 3C6KA 3E05A 5HEKA 1XTPA 4C03A 5BW5A 4A6DA 5MHTA 4Y30A 4FT4A 3VSEA 4DMGA 1YFJA 4OQDA 1L3IA 2IP2A 1RJGA 2YXLA 4PGHA 5E8JA 3SSOA 3KR9A 3PLAE 3EVFA 2IFTA 5ERGB 1JSZA 1JQEA 2OO3A 3LCUA 4MWZA 4DKJA 1B42A 3BGDA 3MCZA 3NWEA 4OBWA 3THRA 3R6TA 4RVHA 3SMQA 1N2XA 3KQTA 5E9JA 3LBFA 5C9ZA 2IDKA 4WXHA 1NW8A 1NBIA 3G2QA 1NV9A 5K0EA 2FPOA 2CWWA 3MHTA 1H1DA 3BXOA 4YMHA 4OQEA 2HV9A 4RTRA 4RTMA 1Q0TA 4P58A 4CTJA 3CJRA 1JQ3A 3CGGA 4RX1A 4PWYA 5DM0A 1L3CA 1WXWA 2QM3A 2ZWVA 5B1SA 5KQSA 4R8SA 1BOOA 5EMKA 3DMFA 5EKUA 4C4AA 2OB2A 2ZBRA 3CC8A 3P97A 3FUVA 1HMYA 1QAQA 4GOOD 2XYVA 4RVDA 2PXAA 5DM2A 1YB2A 1WS6A 1WY7A 2P3OA 3A7DA 1M0EA 1R18A 2DULA 2OXTA 3OZTA 2EG5A 1Q0SA 3BGIA 2ZTHA 4YUWA 5K03A 2ZLBA 3FTDA 5FUBA 3REOA 4P7GA 3A25A 3A7EA 3LX6A 4CKBA 2O57A 3LSTA 4RTJA 2IH2A 5LQRA 3IV6A 3GU3A 1YZHA 5ICEA 5EIFA 1XCLA 4P7JA 4DCMA 3QOWA 3V8VA 1N7JA 2GLUA 2B2CA 3EMBA 4ER5A 1UWVA 3PFGA 3G5TA 3MCTA 4PIPA 5GOZA 2B78A 3JWIA 2CMGA 4R6XA 5E2BA 1NW7A 5FQNA 3GRRA 1YF3A 2IH4A 3R9XB 2C7RA 3ELDA 2AOXA 3UFBA 4X60A 1ZHFA 4DA4A 1EAMA 2I7CA 2UZ4A 3FPEA 3I58A 5KQRA 4E32A 5M5BA 3ERCA 4G56A 4QPPA 1P91A 1NKVA 4GC9A 5DTRA 1JR4A 3EEYA 3TM4A 4HGZA 1PRYA 2R6ZA 2PBFA 4RTPA 3AXSA 1G60A 3O4FA 5CVDA 4AUKA 5JUWA 2O07A 2P40A 1EIZA 1VBFA 3BWYA 4K6MA 3TQSA 4EKGA 4KWCA 4V0RA 4PONA 3S68A 1G6Q1 4RTKA 2BM9A 2O05A 4M38A 3OFJA 5E8RA 1G8SA 2BM8A 2F8LA 5CIYA 4E70A 5KS2A 3OZRA 2AOWA 3BZBA 4YV2A 2UYOA 3EVZA 1TPYA 5H02A 5HILA 2AVDA 3B3JA 1M6YA 4L7VA 3FTFA 5GIPE 2A14A 3KQWA 1NV8A 1QZZA 1O9HA 4P7KA 1VL5A 2NP7A 2AVNA 5T67A 3HVHA 3FRIA 4U7TB 5FADA 3NMUF 3M33A 4QDJA 1VE3A 3Q7EA 5DSTA 5EMMA 3PB3A 3MAGA 5CVJA 5DSXA 3A27A 5K0LA 2FK7A 1YUBA 2AOTA 3IYLW 3P2KA 1O9GA 3P9CA 4PYIA 4ZTBA 3U81A 5D1NA 5BP7A 3NTVA 5K0GA 3G2MA 5D1HA 1M6EX 4F86A 1NT2A 3LDFA 3LKDA 1XDZA 3PFHA 3KPVA 1EJ6A 2G70A 2YUIA 4LWOA 4AZVA 5F2NA 3SSNA 1EQAA 3HVIA 4HRAA 3SXJA 1JG4A 4ER7A 3EVAA 5G02A 3SGLA 2QRVA 4X63A 2PT9A 3TR6A 3EEOA 5GWXA 3NVKI 3DXYA 1G38A 2YXEA 3DMHA 3P2EA 5ICFA 3DLIA 4FSDA 3SM3A 3OE4A 3UA3A 4QTTB 1VIDA 2G1PA 3OU7A 2KW5A 5CCXA 3CJQA 3MGGA 5E2AA 1SG9A 3AJDA 4QQNA 4AZSA 4CTKA 5K0NA 5E1DA 5T64A 1X1BA 3R24A 4F84A 4YUZA 1X1CA 2FRXA 3LCVB 2AN4A 5F2KA 2Y1XA 5DTMA 5GM2A 4PYJA 3G2OA 4LG1A 1F38A 2FK8A 2NNWB 5CVEA 5DXJA 2P7IA 5DWQA 1AV6A 3LCCA 1NW6A 3I5UA 5LQJA 3UJBA 3BKXA 3DMGA 3SVZA 3HCCA 3M6WA 3V97A 2OYRA 4YUXA 3HA7A 5FWAA 2GAFA 2H11A 3G88A 3GJYA 3M6VA 2DPMA 5EC8A 4HG2A 4AZTA 2XYRA 3A4TA 1SVUA 1RJDA 3C3YA 3CBGA 3DP7A 1P1CA 3O31A 1NW5A 4H0NA 2EFJA 2FYTA 4HH4A 1AQIA 4IWNA 2B9EA 3KPJA 2P3LA 5E9QA 4KDRA 4DF3A 4B17A 5ICCA 4XUEA 3HCEA 1ZGAA 2BR5A 5FCDA 4M7RA 1WZNA 1P1BA 1DCTA 3R0QA 1DL5A 1VP9A 2B3TA 2IIPA 4PYQA 4CWAA 4E2XA 2YX1A 3GWZA 3JWGA 4O29A 3BUSA 3LBYA 7MHTA 4YMGA 3GRYA 5F2OA 2VDUE 1BKYA 4OX9Y 1FBNA 1KR5A 1ZQ9A 3OZSA 3DR5A 4GC5A 1KPGA 3HEMA 4X41A 4DQ0A 2ZFUA 3VYWA 4R8RA 3DOUA 4RVFA 2ZW9A 5DLYA 3FPHA 4PNEA 3BWBA 1JG3A 1I1NA 1XDUA 2PX8A 5K01A 4V0QA 4M36A 3EVBA 4YUYA 3BKWA 3UJDA 5EGSA 3EVEA 2BR3A 1ZGJA 2OKCA 5EEGA 1X19A 1XCJA 3LHDA 2GB4A 5K0JA 1QAOA 3OCJA 2VP3A 2ADMA 5HFJA 3FUTA 3NJRA 1SQGA 3P9KA 1L9KA 1FP1D 5EZSA 3LDGA 1ZG3A 2ZIFA 3M4XA 3HCAA 4GOND 3GRVA 2ZZMA 1R00A 3CCFA 2YR0A 1KPHA 5DTQA 3B89A 3A26A 5HOQA 1VQ1A 3I64A 4RTSA 2NXNA 4FR0A 3TLJA 2NXJA 2P7HA 3M6UA 4ISCA 1D2GA 2WA2A 4YV1A 5HIKA 5DM1A 3T7TA 1SKMA 4C06A 1RI4A 1O54A 3BGVA 1V39A 3SR4A 5EQJB 3AWIA 3SX0A 2C7PA 2OPBA 2AOUA 2NXEA 2JHAA 3F4KA 3THSA 4MQ4A 2YXDA 4E30A 4RWZA 1RJFA 4WVLA 5E1BA 1NW3A 3HA3A 4BLWA 4ER0A 1ZKDA 2G71A 2IPXA 4DM3A 3T7RA 2ZVJA 2PX5A 1KYZA 3UJ6A 3MQ2A 2JJQA 4XCXA 2IBTA 4IKPA 2OB1A 3P2IA 4E2ZA 4QQKA 5FTWA 4BLVA 2PJDA 3ANXA 3JWJA 1U2ZA 2HMYB 3PT9A 4PYOA 4P7FA 5EPEA 3PX3A 2WK1A 2I9KA 4CKEA 3G7UA 3KQYA 1X1DA 8MHTA 1QYRA 3FTCA 3GDHA 2ZULA 3E7PA 3JWHA 1EG2A 3KU1A 4GUAA 4DCGA 2P41A 1RI5A 3HA5A 3WSTA 4IV0A 1JG2A 3FUWA 2EJTA 1KPIA 1AQJA 2UYHA 2HWKA 1VLMA 4PINA 3DUWA 2WA1A 3HCDA 4PYNA 4R6WA 3LPMA 3KQOA 3KQPA 4HSGA 1OR8A 1FJXA 2ONZA 5IH3A 3KR1A 2Y1WA 3GNLA 5FULA 4C08A 5JR3A 4QTUB 5GINE 2ERCA 3FPJA 2YVLA 4XUCA 5GIOE 3IEIA 5CCBA 4PCAA 2NXCA 3KPYA 2HNKA 2PX4A 2CKDA 1WXXA 4RVGA 5U4XA 1MJFA 4OA8A 1I4WA 1XVAA 2PKWA 5K09A 10MHA 3DLCA 5LSAA 2QY6A 3OE5A 5HZMA 4RTQA 1D2CA 2PLWA 5KVAA 3ER8A 3LGAA 1YFLA 4QDKA 3TFWA 2HTEA 5CVUA 5HIJA 5LQNA 3CKKA 4KW7A 1QANA 5DT2A 5K0FA 1NE2A 4FS8A 4EVIA 4CXMA 1XXLA 2PT6A 3ELWA 4YUVA 4E2WA 1TW2A 5E1OA 2P1DA 2V74B 3HP7A 3I53A 2ZBQA 2AOTB 4U7PB 3EGVA 3HCFA 5EVJA 4DZRA 4RTNA 3K6RA 5GP1A 4QVKA 1AF7A 5C0OE 2R3SA
chains in the Genus database with same CATH superfamily
3NHLA 1SHJA 2GYWA 3GDFA 2QE7D 3F6BX 2PMEA 4DARA 2HZBA 4HZUA 3R6LA 1OLSA 5KKCA 4XPZA 1P4GA 4L4ZA 1XZNA 3H18A 3N87A 5KQLA 1D4ZA 2O59A 2OV6A 1R4MB 4D3FA 1PU2A 1SUIA 2AG6A 3RYIB 1MVLA 5KJ6A 4WEQA 4EG3A 2BFBB 3R5XA 4OH1A 1KO7A 2XUPA 3ED1A 5DOVA 2APJA 2QZJA 1QK4A 2HX1A 1RXEA 3NHWA 4GWGA 4BTVA 3QNMA 2IH5A 2G07A 3LO5A 3FXAA 3ZHCA 3FSEA 4MAFA 3DZ8A 1PW7A 2OV4A 4F3RA 3STXA 1LRJA 2A0XA 3QVOA 1NUHA 1DARA 3WRXA 4LRQA 1ZX1A 4CZ2A 4CQMD 1SHLA 2FWMX 4IDQA 1W4BA 1P8JA 1T5SA 2CGEA 4FXPA 1R4NA 2ZXUA 1H2XA 1IY0A 4KI7A 2NO4A 3KYDB 4DY4A 4XVQA 1DV2A 1ZN2A 1MGOA 2QUHA 4NK5A 5FOUA 4YT8A 3ZHQA 3HKEA 1NQUA 4GLFA 1KMIY 2VOEA 2IHJA 5KNDH 1XRMA 4D9NA 5D6OA 2HPVA 1BRTA 3KZCA 2JLXA 5ES4B 3HDTA 1YH3A 2OXFA 3H1PA 3OJOA 4X61A 1SAYA 1GN9A 2OY0A 1U8EA 1VGVA 4KMOA 1KRWA 1F8FA 3ITNA 3H19A 4MR8B 2B8EA 1SWVA 4ZYVA 1Y33E 1VYUA 2GARA 3CINA 3TRKA 1I8TA 5GM1A 1L4NA 1Z34A 1VSVA 1W94A 3SSAA 2DTXA 4K26A 4G4SO 4HYTA 2P4QA 2O2HA 2IYNA 3BK1A 4NP6A 3IUPA 5JSUA 3QE2A 1YOVB 2GTHA 2Z2KA 1H1LB 2RH9B 5AW1A 2PZGA 5EZQA 1EM8A 3M9LA 4ZU1X 1CUUA 1O77A 2CFTA 2IOYA 1QKJA 1N4AA 4O2LA 1W1UA 2KJQA 1P19A 3EDOA 1YZQA 3N58A 4QGHA 1J0DA 2ODBA 2ZBPA 5JMPA 4YRGA 2HTFA 2J7PD 4QXOA 4M0LA 2UYCA 2IVZA 4EI2A 1Y1LA 2A1TR 3FGZA 4M8IA 4R3UC 1MX3A 1XRLA 3N0RA 1Z25A 1Q6YA 1ODIA 2H6EA 4MUNA 3VOTA 5E6SA 3DTTA 1K0FA 2W22A 4GI5A 3ETLA 3CSUA 1BEUB 4M1WA 1TU0A 3HU5A 2QT9A 1C9NA 1R0SA 4ZJUA 1WTAA 2VTVA 1IY9A 3W5HA 3R6WA 3OU6A 3T6KA 3ZGVA 5CJJA 1CR1A 4LVOA 1M1YE 3M70A 5B1HA 3QX8A 3W9UA 1PSWA 3E9ZA 2WF9A 3P71T 4GKBA 1IK6A 3C7CB 4RSRA 3DCIA 4H18A 3BWMA 2OFXA 2Y4NA 2C2KA 4G0ZA 1EFVA 4HEQA 1YQUA 3WB9A 3LLUA 1WA5A 2P77A 3GA7A 2ERXA 2GTPA 3R76A 1T6XA 3SSMA 4N9WA 2GI4A 4YRIA 3OICA 1G291 2BR4A 2WWXA 3RFCA 4YPVA 4TTIA 3FOCA 3ANSA 1MPXA 4QVGA 3G1WA 5A5FA 1KZ9A 4DR5B 2UZIR 3ZXIA 2NYRA 1ZU4A 2YOGA 3A9SA 1ZJ5A 3GV0A 4LIPD 3OPMA 1IIBA 1U0GA 1G1AA 1SKQA 2QD2A 3C6QA 3KZXA 4ZYUA 1R0LA 5K8VA 1X77A 1QGYA 5G4LA 4F92B 5L45A 5IJWA 4IDNA 1UXKA 3EASA 1AGNA 1ESDA 3DE6X 3CRNA 3VAYA 3NWBA 4A73A 5HXAA 2NUTB 4IIXA 4B80A 3L7BA 3N39C 3WS7A 3WQQA 2OCLA 3T5AA 2BH9A 1FU4A 2M9MA 3O3NB 3ORSA 5IF3A 1Q16A 1EG7A 2WKSA 4MCHA 4CKCA 3VYSB 1IXRC 4DW8A 3AR4A 5JCJD 1D3AA 2W98A 3Q0EA 4GWLA 2G8NA 1AMUA 4YRMA 1PZFA 1BZYA 1NVFA 1E8MA 3LG2A 5KJCA 2FMHA 4HGPA 4I1IA 3AFIA 2W2TA 2VPZA 4ER7A 2XTJA 1KI2A 1ZC3A 3L9XA 3HG7A 4GQBA 1MOPA 5FPYA 3OPYI 5TV2A 5KTYA 4RJIA 2XTAA 5KNBD 5I47A 5HQ3A 1DBRA 4WXRA 1A5SB 1RWMA 3V8PA 3IEMA 1SQ5A 2J5BA 1KOFA 1XQXA 3CNHA 1DAIA 1P1JA 3I9KA 5H3HA 5AW0A 1QUEA 2AC4A 4C78A 4PANA 4C07A 1DC3A 5DNAA 3FN4A 4ZRMA 3RDPA 3B9RA 4JB0A 2KSQA 2ZUFA 1YJAA 3I0MA 4W8HA 4OLAA 3KKPA 3HM2A 3KM0A 4Z53A 4MKRA 2QUBA 4M88A 4QQ8A 1Y8QB 3MOSA 5EVCA 3IMKA 4ZI5A 1KO5A 1VKOA 5EE5B 1NMZA 3TBKA 3THWB 4Z8YA 3I5YA 5CD1A 3CQ9A 2BGIA 2FE1A 2IIQA 2X23A 4DKJA 2PT5A 2C59A 4MTLA 4DV7B 2BZSA 5FUQA 1MQ8B 1NR5A 2HF9A 1BG6A 3KEOA 1Y3FE 4CV1A 4I9UA 3G6KA 1Z8HA 3NBUA 1HOXA 1YNSA 3EXFA 3PV0A 3IQGX 5IM5A 1A9ZA 1E2QA 1F06A 1L8AA 1PNTA 2I4TA 3CKLA 2GKGA 1X7YA 3KR9A 3LUFA 4IDDA 4Q05A 4BJ6A 5J4HA 3IJ5A 3ZUGA 3R4CA 4E5KA 1RQRA 1ADBA 4Z4IA 3D7RA 1PZMA 1Y3CE 1WCV1 2X0IA 1J8VA 1PT7A 1QHXA 3A6DA 5DWVA 4LE1A 5FL3A 3TDKA 5IH7A 2F3RA 5K0EA 5F7XA 3QX7A 3O8QB 1E9RA 1KK0A 1RJ9B 1J00A 3DMPA 4QUAA 2HV9A 1I7NA 1Z2PX 2QRQA 3ODPA 4G0WA 3K9LA 3RC3A 1ZGGA 1DKMA 4RFSA 3V8MA 1JNXX 2P78A 3NP9A 2J9YB 4A27A 3KXPA 2COKA 4BXOB 1YBMA 4D43A 3N1UA 4Q9NA 2DHQA 1Q0UA 1V5WA 3AWDA 2PLAA 1C3LA 5KYNA 1B0ZA 3G59A 4FFBA 2R6JA 3U4CA 2P3OA 3TTYA 2JCGA 3G2NA 4URHA 1IK4A 3QENA 1JT9A 2O19A 3EAGA 5F7ZA 2HU8A 3LA6A 4N0MA 3LCRA 4ZAXA 2I87A 2G82A 4AKHA 1CJCA 4FYJA 3IV9A 4QSHA 4EB3A 3OO1A 3GU3A 2HPZA 4BMZA 1N6OA 3ZDAA 1N7JA 2Q5OA 1ABEA 2GETA 2JGMA 4TZ6A 1NVKA 4PNPA 2OHGA 2JFNA 5DYTA 3K53A 3MCTA 2B1GA 2YIDA 5JDIA 3PRJA 3I9OA 4KQHA 1JKJA 2P8SA 3E2MA 4B09A 4IIVA 1U0SY 3PHGA 5KDLA 4DCUA 1JSRA 4UBJA 4E5SA 4E32A 5C4IA 3FCCA 3SD7A 4IUYA 4UBNA 4AP5A 3T7DA 1YQEA 1MDBA 3DYVA 4M22A 3TLEA 4Q4DA 1W2WB 2O8NA 2OBLA 1X8JA 1BXGA 3TM4A 1KO1A 2DXIA 4JMPA 5FTJA 2C2BA 3AXSA 1I7LA 2HNAA 2XRMA 1HRKA 1JXQA 1HI9A 3R5KA 3Q3EA 2O07A 2IK8A 3QY0A 4OQ4A 3PD7A 1USWA 2H0QA 3CPHA 3UMVA 4HLUA 4ZAYA 1VBFA 3KUDA 1DKQA 3OEED 1X0XA 4ZI7F 4QFCA 4V0RA 2EHJA 2QJFA 3QWHA 4KB5A 5DLPA 5EZYB 2O05A 4C0BA 4PNHA 1PNRA 3DBIA 3ICVA 4N7RA 1YHYA 3FDZB 4M83A 2VVTA 3NUZA 3D6AA 3CUWA 2NZVG 3IUBA 3WGTA 4AY6A 1LQUA 4K5QA 3LPDA 1JJIA 5BSEA 2I5PO 4OI1A 2G1PA 4D8YA 3RTGA 1D04A 4O4IB 3DT6A 3C98A 5BSRA 1B8OA 2GPWA 1LPMA 2QTGA 1MIOA 3OD1A 4JITA 3BSYA 4RY0A 4ZOQI 3VR6H 2PKCA 4A0QA 1J21A 1WW3A 1WP9A 1ZEMA 4WLEA 1JEYA 5MGBA 1ID1A 2JFYA 3EX7C 2X7HA 8AT1A 5FRDA 1Q3HA 4P0TA 3V55A 3D2CA 3VSBA 1HYQA 3P9CA 1AD2A 2Z2ZA 1WHTA 1A5TA 3CNQS 1J8YF 1G20A 3HJRA 3KFLA 3FZEA 2CNKA 2DGDA 2QSZA 4FCVA 1N8SA 3W9YA 5EHXA 2NMVA 2PS3A 4S12A 1NA5A 1WQ1R 1E2NA 1EFDN 1FSGA 3IP5A 1PTJA 4NG5A 3T61A 1XKTA 1XMOB 1F7VA 3PQ3A 4X20B 4JB2A 3PC3A 3A2KA 2VSFA 1R5BA 4X1IB 5CB0A 4K1LA 2G4VA 4K0RA 3TR6A 4G5RA 4BNMA 4F4DA 2NV0A 2GXAA 1JMVA 1WUKS 1YMVA 2LCFA 1EP1B 1HE8B 4KPGA 1GUBA 4X00A 1G38A 4RHFA 2XZDA 3OLCX 2FFAA 2HQSA 3EF0A 1UMBA 3F0TA 4DXAA 1GZUA 1Z35A 2BT4A 2DPYA 4EG5A 3HXTA 1RM4A 3BC1A 1ZRHA 5GMOA 1B43A 4G8BA 4U9HS 4BX2A 5JSZA 3A6FA 3B7WA 4DLNA 3T9EA 1L7AA 2UKDA 5ARBA 5BY2A 2ID4A 4DJJA 4U6NA 1FXWA 5LQDA 1VLJA 1JU9A 3EWSA 4CCYB 5HDBB 3Q3VA 4BMOB 5JANA 2B9VA 2O4CA 4B85A 3R7DA 4PC6A 1AV6A 5FO1A 2QU8A 3SU8A 1D6MA 4AUMA 4F93B 1PUXA 1RYZA 1ZVJA 1JW9B 4K88A 1QTQA 4KI0A 1OFUX 4NCHA 2OGTA 4NZ9A 1GT91 3TAXA 2WAXA 3W77A 4BV9A 1WF6A 4HG2A 2EBWA 4P31A 3KEGA 5TX7A 4DTCA 1KY5A 2BI8A 4HH4A 1XO1A 4M1SA 3DGEC 2JATA 4D8UA 2QAJA 1ENOA 2WHPB 1KEVA 4O2BA 1E2EA 3ZH9B 4AN4A 5C80A 4CEJA 1A88A 3QKSB 1Q7RA 4H59A 4JJ6A 4B44A 1J2EA 2H85A 4O1HA 5H9VA 4B87A 3C6ZA 2VRBA 2XVYA 4RHYA 4E6EA 2V7TA 1GTRA 1T25A 1FRQA 2WFAA 2ZBDA 4MP8A 1L1FA 4B7UA 3L4BC 5C81A 4IICA 4RF4A 4GI1A 1ZR4A 4RQAA 3NRBA 1XAJA 3FPLA 4FMDF 3NBZC 4NK4A 2GRJA 2VNSA 3NKFA 4OOEA 2OUKA 2R6FA 1REQB 5DTJA 2QUJA 4ZOLA 3V4OA 3FJOA 4YRAA 2RKWA 4IXNA 3HFJA 2ZW9A 2VWPA 3K5HA 1TTTA 2WUFA 1SKUA 3FPAA 1CYDA 2W2XA 3H5LA 3U1TA 5KU7A 2OZEA 4HDSB 3OT5A 4Y2PA 1FP6A 4L5AA 2A9PA 2OG1A 2ECFA 2VYFA 4LQDA 4MW4A 1W34A 1U7WA 2C4VA 1NRJB 1P62B 2WSSD 3KAQA 3OZFA 5FPQA 1L9KA 3W6NA 3O4VA 1G59A 2C5FA 3JASB 4BQPA 3NKLA 4JLUA 4JR1A 1KQGA 2IRWA 4JYBA 2ZZMA 5JTUA 5L95A 1KEEA 1A82A 1JHUA 2WIFA 3C5EA 3ML1A 4FDLA 3VC3A 4DR3B 2F4VB 2QWXA 4GI3A 4IS2A 4R2HA 1N25A 1QIEA 3CX4A 1N6LA 4LTMA 2ON6A 3RVNA 1G3UA 5LNK1 2FA9A 3DHYA 4C0QC 3AI2A 1Y6GA 2IXBA 4RFVA 4LJ8A 4BUJA 2D0DA 3JU3A 1P0IA 1CUWA 2DCMA 2WWVD 1Y7TA 1OAOC 2PEYA 2PTGA 3HYSA 1EXMA 4TWBA 5FR1A 3PSAA 1RC8A 1BQ4A 4ER0A 2AQKA 2OHFA 1KRXA 3TZCA 2JVKA 3OT1A 4L4YA 4LOJA 3TCKA 2QMUA 3PI6A 2IPNA 4HQFA 3UJ6A 4C22A 5CITA 1EX7A 2GBIA 4V1CB 2HJSA 2BVNA 3P2IA 4D0GA 1N2EA 3CLUD 4I8IA 4QQKA 2GDZA 2C4MA 4QDXA 3VR5D 3VR4H 1C3EA 2HRRA 3TZLA 3DEIA 2HHLA 3OTQA 2IYLD 4C5AA 4RVNA 2C2MA 1Z83A 4II3A 3BG5A 1NQWA 3HKBA 2QVZX 2IXEA 2C9ZA 3EXEA 2XA2A 1R15A 4G4JA 3LBAA 1KDZA 3RVRA 4D3YA 3EIWA 3MJRA 4RA9B 3MUFA 2QN3A 2W6OA 3IEPA 1Y3DE 1NBMD 3B3QA 3ONEA 5BQOA 2Q5JA 4CQMB 5C46F 1UODA 4ZT2A 1K8QA 3OMLA 4YQZA 1NVTA 2RKBA 2RB4A 3FYUA 4BB6A 3TG2A 1V5FA 1Q77A 3IEIA 5B3KA 1CP2A 1IVYA 1NBME 3IDAA 5HTKA 5IPFA 1UMDB 2CKDA 2QR2A 3W6OA 3ZV6A 2NZUG 2IHYA 3GQBA 2QQ0A 3V1NA 4H0FA 4ZHQF 2IS6A 1Y9EA 3CUVA 2Y05A 1IQPA 4KIJA 4RTQA 2PLWA 2VTKA 4NABA 4C0HA 5LQNA 2H5EA 5DLEA 1TEZA 2GZSA 1ZRNA 1QDLB 2WIAA 5ALYA 4FZ3A 1EUDA 3ZEIA 1E0AA 1QO9A 1XU9A 3FFTA 4QDUA 1Z0FA 2WILA 3CUTA 3HP7A 3A2LA 3I53A 2R00A 2L69A 4RTNA 4KQGA 4R84A 3TRDA 2BHLA 2GN2A 3QK7A 2VZ0A 3DG9A 5KPDA 3RYCB 4KXNA 3QOYA 3U19A 2FEWB 3REGA 3VPFA 1ARZA 1G2OA 2HA4A 1CBUA 1G8PA 3TSWA 3SP1A 3CRW1 1L5KA 5HCUA 1RZRD 5DM70 1E9FA 2VPYA 4QQFA 4ZWNA 2OCAA 2PT7A 2KLBA 1GNLA 3K9HA 5CDHA 3HYNA 1R1DA 2QN6A 1CIPA 1U8FO 3G7SA 2D59A 3LDUA 4P3PA 2UUPA 4UCQA 1NZJA 2N42A 2ZJ4A 3FI0A 4R2IA 1TKBA 3QIAA 1JIJA 1SN7A 3TL6A 2ZAGA 5A62A 4I5IA 2P0AA 3QA3E 5JWHA 2V3VA 2XQGA 4IG9A 4UUNA 1O96A 1HNZB 4GOLD 2YMLA 3A6GA 4ZKEA 1VYHA 2O6HA 5TMEA 1PT5A 1P29A 1ZI8A 4WBSA 1ORVA 3UJ8A 4CIBA 2PSHA 4LSWA 4ZVMA 1WKVA 1XDGA 1XZJA 3GR6A 4I4TA 4K6GA 4C0XA 1GGHA 2VXYA 3MCWA 4QA9A 4RIIA 2QTVA 4FYHA 1W93A 2R7KA 1R0XA 2GN0A 1D2MA 4DLUA 4OYRA 2FG5A 2O2SA 1OB5A 4HTFA 2PGDA 2CHGA 1E64A 3FWKA 3RF6A 1M0WA 3MPUA 4FYMA 2EYQA 2INGX 2CJFA 4C4XA 1Y4AE 3UK7A 3Q98A 4G0MA 4V24A 3GJQA 5HZHA 4M1YA 5JSZB 3FCEA 1XNQB 5AIAA 3EXHC 3KTFA 1MA3A 3B7PA 2XYQA 4EKIA 2VJMB 3O2QB 4WACA 2B8JA 4BO4A 5EZ5A 3R7AA 1Y42X 1KAMA 2ZRBA 1N6KA 2ZIGA 4WESB 5DGXA 3TR0A 5LZ2A 3ABSB 5CCXA 4ABYA 1XB2A 2AOVA 2ZJ3A 1VHDA 2UDPA 4M0KA 3TH5A 4ZVKA 5HHTA 3EWIA 1T36A 5L3SA 1P0CA 4N18A 3DZCA 3JWPA 3PWSA 4YWJA 4UE2A 5CPBA 5K0CA 1JF8A 1VPEA 4ARZA 1FFBA 1GT6A 2HEIA 1DC8A 3H87A 2AFHE 2ID9A 1Q0PA 2RHOA 3IB3A 2Y93A 5J63A 1XHLA 3V4SA 5H9WA 2FN8A 4KE9A 4NJEA 2PSJA 4PGFA 4PLTA 4WN9B 2NQ8A 4D9FA 3F73A 4BZWA 3ZE1B 4WD3A 3T7KA 2QIOA 4LN1A 4TT3D 2QPOA 3K1ZA 2VP2A 1O08A 3U44B 4NFSA 3R1IA 1ZBQA 4FMBB 3SIRA 5FH9A 1NM5C 2YWRA 4DGSA 3D4LA 2GAIA 1BFUA 4WH0A 1XTZA 2ADOA 4ITVA 4JOBA 1KL7A 5BMOA 3SHQA 4HS9A 1AXRA 5AUQA 2H00A 2C78A 4QELA 5LFAA 5K0BA 1AC5A 3CG0A 3LBNA 1Q0ZA 5SV2A 1PL6A 1UXHA 1SVMA 2WV7A 3NAMA 1E2DA 2VQSA 4MUFA 2P5SA 2A59A 3FYDA 3G8BA 3GVHA 3ESZA 3OFND 3RCBA 5C5DA 4YP0A 3TLMA 5JH7B 2IIVA 2ID7A 2ZGVA 3JWEA 4XDYA 3P0JA 3KJGA 4Q9HA 1YA6A 4ZYLA 3UWPA 4LWZA 2F1JA 1PWZA 3DTVB 1VB3A 2I4LA 1TD9A 1PWYE 4L74A 4N8EA 5EKXA 4QXAA 4FYPA 4I19A 1YQ9A 3L04A 5JPIA 4I55B 4E2YA 5SYNA 1P80A 3NWJA 4MUHA 3HJBA 4FDMA 4TKUA 3ZDEA 4CM3A 2I6TA 5BSVA 2P62A 4F1KA 4F72A 2Y0CA 5A2QA 1TAUA 5FBZA 1FZTA 1TMKA 3D8SA 1MJGM 1SOWA 1QC5B 2PUVA 3WL8A 1E20A 1DB3A 1EVEA 2BEUA 3HCBA 1B74A 3OX2A 4IX9A 2BEVB 1JQ5A 3E23A 5IJ9B 1D2HA 5FJIA 4LJ7A 5LQAA 1UBHS 2FAXA 1MC1A 2Q5FA 2QRUA 3ZN2A 4UOEA 5GPBA 4Z1OA 2XVMA 3KR2A 1IN4A 2YXBA 3T34A 1H2BA 5B6JA 3I2YX 4BQQA 1I6MA 3LHKA 3ADDA 1FFDA 2PVPA 3VA7A 4ZMBA 4Q7LA 4LYAA 4YAKA 3WLFA 1UJ6A 1UQRA 3MT9A 1I3OA 4IEFB 4RV9A 3BQNB 3GEHA 3B1JA 1GPWB 1RCFA 1PLLA 4JQCA 2DWCA 5G0VA 3UJ9A 4J2HA 4BO2A 2Z6QA 3L01A 1XYGA 2HXYA 1B6SA 4OGWA 3BEOA 3VR5H 1CLEA 1IOLA 2RGNC 3CY6A 5TEVA 5IX8A 1G3IA 1J5EB 1VKJA 1RRKA 4G41A 4H60A 1JFTA 4OLFA 2JDID 4RSHA 1EWVA 3O4RA 2X2PA 2XUKA 4JGGA 3RVJA 1ZM4A 4P2BA 2YV4A 2NAPA 4XIFA 2WIDA 5KNCH 3R3HA 1QG0A 3FSRA 3EVCA 4TMWA 3KWJA 5EG5A 4PX3A 4ER3A 1CVRA 3S2GA 1PJLA 2Q4TA 2BE7A 2JFOA 3HY4A 3HU2A 1T3HA 1GCIA 3QW4B 2H1IA 3QJYA 1VKNA 2PEZA 3ELUA 3A4YA 3PA8A 4Q0MA 4PN3A 2SKDA 4I6JA 5CXXA 1S2DA 4YRRA 2ODPA 2ZYAA 3IVRA 3PGLA 1C1HA 2VAXA 2OZLA 3IIMA 4WJLA 4LF9B 1M1YB 1CVLA 1KYVA 5HKKD 1QP4A 1OBFO 3L0SA 5F1OA 4HWGA 3ZPXA 3OURA 3QBVA 4NMLA 5B4UA 1RYEA 1YR9A 3OX4A 5DXFA 4KR6A 4MW9A 1IQUA 4PHFA 1ZGBA 3SMQA 3OIYA 1JXOA 1NDQA 5BQXA 3WQRA 1NBIA 4PO3X 3FTPA 1VRVA 3S7TA 3IA2A 2DZDA 4MO2A 2ONCA 2RBKA 3HWWA 4W6QA 3DQPA 4DWVA 1E79A 4FFMA 2RJOA 2VNAA 1LW6E 4CIYA 4HQKA 1E2IA 2J3HA 5DM0A 2O8BB 4HMQA 2J46A 4LOHA 3DVRX 3O8LA 4EYSA 4OB6A 3U61B 2Z9CA 4HSEA 2ZBRA 3NBAA 3T15A 1XIVA 2P5UA 4Q4HB 3UBMA 2V7UA 3PITA 4PE5B 1MG0A 2GD6A 1YB2A 1YVUA 4XI9A 3RM3A 3RSCA 1JHYA 1SXGA 1BTOA 4KG7A 4FHZA 2HDOA 4UM9B 4BU0A 4MGIR 1N2JA 3A7EA 1FFXA 2C4WA 2JGJA 3JATB 2JLZA 2Z58A 2I66A 5T57A 1NDHA 5ICEA 3BB4A 5EIXA 1RW4A 3GYGA 3JY6A 4R01A 3H84A 4QX6A 1WD7A 1X7YB 4R3WA 5JLJA 1Z2EA 2MMCA 3G5TA 4C6HA 1X9HA 1LD3A 1JEOA 1JLKA 2FSIA 1AMNA 2OHVA 1PDVA 4EFLA 1FDOA 4EUSA 3RJZA 2CVFA 3CFYA 4LZOA 5HKLA 2PKXA 4GWKA 3CRMA 5ALRA 4FGKA 5FOVA 1G21B 2YJ3A 2DFDA 3PSHA 7MDHA 4QYMA 1WNFA 4PFQA 2R47A 4IHJF 1UJ5A 5YASA 5FNVB 1EX6A 3NHBA 4HGZA 4QL3A 4KGVA 4UBLA 4WFQA 5LA6F 1NP6A 1WEKA 3OOSA 5DMHA 4JNKA 2PUHA 3AINA 3D6NB 3IUQA 3NYIA 4FIZA 4FXOA 5BYJA 1JH8A 5EESA 4QTYA 2LGJA 3BH7A 3FWNA 4MS1A 4DV6B 2P4EA 4K9PA 3GT4A 3BK2A 3ZE0B 3SAJA 4UBKA 3EUAA 1T24A 3N2ZB 2R2GA 2BM9A 3CF4A 4JVLA 4X1KB 5CT8A 4KR2A 1H2YA 4R51A 2GCEA 1XL1A 2P9YA 2VRCA 5JMTA 1OYOA 2G9RA 1QU3A 4CRWB 3I30X 2VWGA 3CLRC 3NT5A 2VJDA 3DDCA 3FOBA 3OJEA 4DCTA 1SCIA 1M6YA 2HK9A 3I2IA 3WHLA 4C43A 3H2IA 2VBGA 3EQZA 3AJEA 1V26A 3D2BA 3ZWCA 1VFNA 1XMQB 3DLBA 1XZBA 2ZJZA 2I4MA 1OLXA 1LF5A 1P75A 5AVVA 1RHJA 3MRSA 2NP7A 2AVNA 3TBFA 3ZI7A 4YJFB 1JDSA 1U6KA 3DT9A 3B2EA 3NOXA 2C00A 2ZSHA 4N5HX 5B58T 1II8A 3W3AD 4QO7A 2WR8A 1WV0A 3ZBUA 3C45A 1FVFA 4DMRA 4LC0A 3LQFA 1GZ4A 3RE1A 5A5DA 5SYAA 1L5HB 4JVNA 4DY6A 5D1HA 3DDUA 1SCAA 3OLZA 3R3ZA 4NOLA 1SVNA 1CPYA 3LBIA 3FM9A 3DF7A 3IDQA 1IXSB 4H1VA 4LXIA 4TLCA 4B4KA 1G66A 2ICAA 5ADHA 5LMNB 4C2AA 1ECGA 2FWJA 1JQJC 2JGNA 3Q7QA 2GEJA 5G0SA 1YZUA 5FYQA 2R5NA 1P2VA 2VQ3A 3GFPA 3LO8A 1UH5A 4YNBA 2QT1A 1A8PA 2WJIA 5C5EA 1M5RA 3JTEA 1BD4A 4GRIA 3SLGA 2I2BA 5K45A 1CDZA 3PL1A 4Q9AA 4V0SA 4ZGWA 3KLBA 4Y6LA 1SG9A 2XNKA 2AYZA 4N47A 5JROA 1WKCA 5C2JB 3UC5A 2AN4A 5FBRB 3S27A 1C81A 1Y3BE 2OXRA 2ODEA 3FD8A 3LWZA 5H4HA 5DP1A 4J1TA 1QIMA 3W9BA 4PAOA 5J23A 1M8FA 3NHUA 4X84A 5HK8A 5DWQA 2GBLA 5KBYA 3ZV4A 1V47A 4RZ3A 5EUQB 4ZZ2A 2PIAA 3IXLA 3AYXB 3OHSX 4KFCA 5LMZA 3LOUA 3D6HA 5KVQA 3UHJA 4OIFA 3U4AA 5I7RA 2I4RA 2VYCA 3W8DA 1FPMA 3ZTYA 1KQPA 5IWCA 1AE1A 2CN1A 3KZ1E 1R6DA 3A4TA 3F8TA 4V2IA 4DILA 1HDZA 1TX4B 4H7FA 1N77A 4UCWA 1U02A 1ZK4A 3TVTA 3INTA 4NAHA 3HBAA 4B17A 5BWLA 4RJJA 5K3FA 1A98A 2YZMA 5E6UA 1DAOA 1E92A 3TFQA 1FLVA 3JQFA 1N2ZA 5AH0A 4BVHA 3U4GA 2H1SA 4I9GA 4MVJG 3QYAA 4WZZA 1W85A 2W83A 2AJDA 2HCBA 4JI1B 1CS0B 4EVQA 4HAWA 2XGJA 3F7OA 1KJ8A 2Q4EA 5GVSA 3KQKA 3L8MA 2Z4RA 4DMCA 3EF3A 2C20A 4G1MB 4MYCA 3TSAA 3QTBA 1OTXA 2QRKA 4LX0A 5EIEA 1KR5A 2VSOA 4I4LA 3IE1A 1F2TB 4X41A 4LPKA 4BTEA 2VDOB 1H42A 4FYIA 4B4UA 1THMA 4P0QB 3C3AA 4BX3A 2ACEA 2DPGA 2G09A 2JI6A 3DOUA 4B4VA 5FOQA 4PNEA 2IS1A 1CV2A 3BILA 3GPDG 3FB4A 4B79A 3B53X 2Z8YM 4R1NA 3L4SO 4TYQA 4ENQA 3JYQA 4I08A 2NU9B 1PGOA 2XECA 5BURA 2HMWA 1EMDA 1M73E 1JKMA 2C07A 2IEZA 3O82A 3RSFA 4YT2A 1O89A 2QEQA 4YEDA 4HVTA 1YS1X 2DPXA 1ONSA 1EWRA 3AUSA 4RD6A 2AQIA 5FD8A 5EZSA 5H82A 2QU7A 2ZIFA 4EHIA 2PRJA 4IGIA 5CA0F 4MINA 4KN9S 3R9WA 2Q1WA 5ITZB 3GH3A 5JI2E 5JZSA 4O0MA 4AJLA 3HJHA 3JQQA 5HOQA 5JNLA 1OWMA 2H1VA 1MAWA 4JU9A 4INZA 2QGZA 3EUFA 5BSUA 3FB1A 2JCVA 5CG2A 3M5PA 4M1OA 1LDBA 1GKKA 2JARA 2HIHA 1G7CA 2CLIB 2XGSA 3MJCA 3OOJA 4D9GA 2GKOA 2QI9F 1VG9B 2MJLA 3H9BA 3OBIA 3BGVA 1V39A 5FIUA 3SR4A 5I45A 1Y1KE 4G9BA 4JGIA 4ZO6A 1HT1E 2I99A 3UPDA 2FPPB 1VMAA 5FNVA 4G4IA 1N92A 4KWTA 3H9UA 5ALSA 1ZN9A 4B32A 1E1QA 1PSDA 4P4TA 5K6RA 3JVEA 3TLGA 1GKYA 1QE3A 3X1YA 3MQ2A 2PPVA 1JEEA 1QFMA 1BXRB 1HKHA 2OB1A 3KSBC 4E14A 1Z5PA 2QUKA 4B3JA 5JT1A 4KRYA 4GDFA 1TO6A 1KS9A 4YHHB 2X1MA 3NI2A 3JWJA 1DT3A 3K9GA 3LUDA 2D4HA 4PQGA 2JLSA 4QUBA 3C8ZA 1U0FA 4RPKA 3RKRA 3TLCA 1UJCA 1RHQA 1B6RA 3D4OA 5COQA 1Y6ZA 3SBDA 4MLZA 3JWHA 1LJ8A 2JJ1A 1VOTA 2H08A 1FMFA 5KX5A 1LFAA 2P41A 3CU5A 3HA5A 4TYMA 2NO5A 2XE7A 5DHUA 3ZWDA 1U2DA 2OHIA 3FUWA 3I2GA 3MILA 4R41A 1ECJA 5K8UA 2WQ6A 3CBQA 1VLMA 5CX1B 3U5ZB 3P52A 2AEEA 3LZ6A 3DZHA 1Z26A 4CCAA 2DMRA 2D62A 3GF4A 2OFFA 4R69A 1XPUA 2Y1WA 1ZM2A 4EYGA 1RAFA 4XUCA 3O5AA 4LVNA 3TQHA 1TK3A 2OC9A 4DWWA 5H3LA 4XYBA 4RVGA 2O23A 4ML3A 5KSYA 4AM8A 2VF4X 3RKUA 3U7IA 2NYAA 1RXWA 4GNKA 4XM1A 2Q6KA 1WSDA 1K5HA 3E61A 2W2KA 1PZNA 5ETJA 3OZVA 3BA6A 3IP3A 4US0R 2JD0A 5KOIA 1ZXXA 1CE8B 2QRZA 1I4DD 3LWDA 4MQEA 2ZSDA 5JZVA 1EVQA 3MBIA 3E5NA 3T94A 2Q07A 2HF8A 4G09A 4MI6A 4Q1FA 4Q3CA 4ZHSA 5IHXA 3U4MA 3LBHA 4AJ2A 1PJRA 3ONFA 3DXFA 2JJ1D 3K5IA 1F0KA 1V95A 4E31A 1Z33A 3BXXA 2Z5VA 3QE4A 5TGTA 5JQGB 1KGSA 1Z6AA 2I4IA 4OFBA 1CRZA 1AGXA 1JTVA 2Q0SA 3AUXA 3A2MA 4O8CA 4YBRA 5GONF 3V2UA 1S6YA 3LNTA 2N47A 3SM9A 2UUCB 3S44A 4OKNA 3E2PA 3AETA 1UJBA 4AY3A 1JEDA 1V6CA 4Y1FA 1JILA 2FW9A 5TY0A 3NDJA 4X3OA 5AJXA 3SEAA 5TPWA 3W3AH 3L0PA 1XVIA 4IUBS 1NKTA 2CT8A 1JRLA 1YS2X 3NEPX 5B3AA 3RYHA 1BVYF 5JVDB 1NXVA 2QTFA 3LXUX 1XVVA 3QHPA 4KSBA 3GP5A 4D5EA 5JCXA 5LD2C 1FS5A 4MKIA 2C95A 2ZE6A 5COAA 3IA7A 5AI6A 3IC5A 3S1AB 5A9RA 1ZHOA 4MV9A 1F8GA 1DG3A 1J9ZA 1A71A 2JGKA 1ZVQA 3E7DA 3LH5A 4FEYA 3ZWBA 1YS9A 1T2AA 1UZMA 5ARDA 1TYZA 2Q45A 1NLFA 3D1JA 4B3XA 2AW5A 1CDEA 1DFGA 2ZUUA 3BIOA 3D2LA 1GYQA 3KCQA 5K3BA 3VU8A 2FR8C 4JN6B 4EPXA 1EFPB 4TXNA 1Q3KA 2AF4C 4W1QA 2ZZNA 3O92A 5CGQB 1C4WA 1Y0BA 2Q2QA 4GKVA 4ENWA 1TGYA 4AU1A 3GLVA 2G0NA 3BN3A 3K35A 1CE8A 4W5TA 3O1HB 4GR9A 1CQJA 3A1UA 1G20B 3BL5A 2IW3A 3P20A 1GUFA 1YTUA 2MDTA 5GAJA 2DCUA 1NJGA 1IRIA 3NRCA 4EPTA 1E7SA 3E2IA 4FGWA 5JASA 3VSAA 1MDFA 1H5UA 2IGTA 2RDMA 1NIJA 4R8VA 2IYOA 4HWSA 1NYTA 3SS9X 1IHPA 1OLOA 1V1RA 4LOLA 1EX1A 1YA4A 4QYIA 3WK6A 4J91A 4C04A 1JHRA 4RA6A 4JODA 5G3YA 2VAWA 4JQZA 1GD1O 2IV3A 5EJ6A 4U63A 5TLSA 2OK7A 2CLLB 4KX3A 3RW9A 5BSTA 3KYCA 3FR8A 5F21A 2PUJA 3AG5A 2VTBA 2ALJA 3E9YA 1EGVB 3FYCA 3K3PA 4FUTA 1D8TA 4YHBA 1R8XA 1HOTA 1EZ1A 3IBTA 5LB4A 2ZYHA 2WYWA 3UK6A 3AF1A 3L43A 3WOVA 5DI9A 4BJ3A 4D9MA 3TW8B 3N0VA 4FONA 4MWGA 4X9XA 4YAGA 1SKYE 5AVTA 5L3QA 3PF8A 3O9VA 3FOZA 4MCJA 4N5NA 3EPKA 2CVZA 1OYWA 2BF7A 1E9AA 1OU4A 1CY6A 3GMDA 4PTLA 4X54A 4LJYA 1A27A 1RC1A 4DNPA 2WIKA 2B4KA 1NVBA 2XI4A 1EZ4A 5HKAA 4CDRA 5IZ4A 5B7QA 4QU0A 3GAZA 3BJEA 3EIOA 1NN5A 4IUDS 4JIGA 3F8SA 4BV3A 4DT1B 4TTVA 1BE1A 1Z7YA 5LZ7A 1FTWA 4RL6A 3LY9A 3U0BA 4CMBA 4CG1A 4P22A 3TN7A 3VZCA 3PRYA 5F12A 1J97A 2WTBA 3ETDA 4M1TA 3QLUC 1Z7EA 4TT3A 3TUZC 1CR0A 2PS0A 5TNXA 3CW2A 2R1ZA 2HRCA 3VYTB 5FPSA 1H0HA 3N2IA 2KE5A 5C35A 1E2LA 3FCSB 2JLWA 1X0VA 3RRZA 5CA0B 4BRUA 1NNSA 3FWZA 3G89A 1BE0A 4US2R 1P1KA 1ZCBA 4AZWA 5UKDA 5IS2A 5LQUA 3DA8A 4X8LA 2VF7A 4OQYA 1TMOA 1RAGA 1G9SA 3OIFA 1I1QB 4BO7A 3KPWA 3VI3B 1UK7A 1UL1X 2RC5A 2RKOA 4QDOA 5LXTF 1RNLA 3UZUA 1KNXA 2XUFA 5IBQA 1JYFA 3OLQA 1W4RA 5HRAA 5LWHA 1GPNA 3VU1A 3T1HB 1OH8A 4HJXA 4LJAA 2ESRA 3IKTA 2YVUA 3DE3X 2DHCA 4FMDB 3B1WA 5FV7A 3P4YA 4IIGA 3V00A 4B6OA 5JALA 1E2GA 4XR4A 1QS0B 1GY8A 3BWVA 4G5QA 3TAHA 1F0NA 4JC5A 2OBNA 1BVUA 1TZCA 4RW0A 5L3QB 5BORA 3ONVA 1YO6A 3FHTA 3AZPA 4GSYA 3EA0A 4ODIA 1LC0A 4X45A 1JHAA 5AW8A 2BEKA 3KVRA 2XMPA 5DYNA 4V02A 3FDFA 2Z2IA 5AR1A 1KYWA 5MF6A 3UJAA 1G55A 3ZE2B 2YYSA 3PVCA 4F45A 4OQPA 1JZTA 1NLZA 5BW8A 3U17A 2P6NA 3RSOA 4KITB 2ZWAA 3L18A 5CNMA 4KFRA 1QB7A 2RAPA 4HWPA 2PGOA 5JD3A 4KN6A 1GM5A 1AJEA 4HDMA 4N5MA 1MVNA 2I62A 3KLOA 5FHQA 3GVIA 4G8CA 3U3XA 1W7AA 2X8LA 3H2GA 3UAYA 4TTRA 2G9NA 3DB2A 5K8LA 5MN6A 1CK4A 3IP9A 4Y30A 3HMKA 3F6CA 4FEAA 4GBGA 1RJGA 3USZA 1XNJA 4B0OA 1IFXA 2IZ6A 1UEXC 1GR1A 1N9GB 3D7SA 4PLPA 4U2FA 2H17A 3K8OE 5E7MA 1V8DA 3HGTA 1LNZA 3R5FA 4A4DA 1MA0A 3TO5A 4B3DA 5C9ZA 3KLMX 3TZHA 4D3SA 1XLUA 4EQ6A 5K3EA 1E4YA 2A2ZA 1NW8A 3QMMA 1C9KA 2QSUA 2YCBA 3GOHA 3ZWWA 4GPIB 3ZWYA 5BV1A 1RPNA 2AA3A 3FJYA 2Y92A 1E32A 1XQYA 4M8NE 1Q0TA 4EO9A 1Z75A 3ISTA 2PGNA 1YULA 2FKAA 1O8CA 1XEXA 2X86A 1S2LA 2YRWA 1GVNB 1O94D 4PWZA 3QLTA 3L5OA 5EKUA 5EMKA 5BR1A 4JEUA 2J9FA 1DAHA 4IZ6A 4XYMA 2PXAA 2QQ5A 1A7JA 4I2NA 1DC6A 3U31A 1NNEA 1WY7A 4K9OA 1W0KA 2VBIA 3C7DB 1M5UA 3I1YA 2AIRA 4Z9AA 3LP5A 3RASA 1BEEA 3VUFA 2JI7A 3IUMA 2ZLBA 3FTDA 1OB2A 2J9XB 2W0SA 1G2QA 1I0IA 3L4JA 5J59A 2V1UA 4OOFA 1YZHA 5L7TA 3TS1A 1IY8A 1O5IA 4JP1A 3SICE 2GJAA 3NDPA 2ZDQA 3PFGA 1YJXA 1PFUA 3TG8A 3GRRA 3B51X 3HDHA 2CLCX 3HE3A 2CNOA 4G5SA 4I5FA 2AOXA 5CU7A 4F96A 3DLHA 2O8EB 1I0ZA 3UXMA 1J1UA 4AIRA 2GSWA 4C4YA 1RYBA 1H8HD 1WTCA 5H1YA 1E0SA 4O3MA 3BDVA 3O4HA 2EDAA 4IIJB 4GQIA 2G76A 3CZ4A 4XW2A 3IMCA 3AHIA 3ZE9A 3JS5A 2O1WA 3I09A 3O7MA 4HAUA 1GQFA 1DG1G 1E3WA 2PBFA 4KHPB 1OX4A 1QJCA 2PH3A 3AU8A 4UMDA 4B3HA 5A3RA 1SUFA 3W4JA 2BN4A 4MWSA 1P17A 5I9SA 1UAAA 3ZDBA 2OHOA 4OJNA 4NCKA 1LTQA 1LWNA 2B7LA 2JZOA 1TAQA 3TQSA 1XVTA 1TKAA 2YZNA 2ZE8A 3IEUA 3JQAA 3OY7A 4P7BA 2FDCA 2VK8A 4B73A 4IF6A 2ECQA 3TW6A 4GKKB 3KKEA 4CM4A 1KE2A 1PJCA 4H7IA 2O1EA 3OWOA 4G86A 2FPGA 3DZIA 3PA6A 1YCHA 1CUSA 2RI1A 3V8BA 4IH9A 2X0RA 3E35A 1V6AA 4QJ3A 4BZZA 5G0TA 3WIUA 4E13A 4EM6A 1GPH1 1JV2B 3VPCA 2ZJOA 2ZJ0A 1XEXB 4KLNA 3K16A 1VBNA 3JAWA 5HTOA 3WWCA 2BFDB 2QQEA 2R25B 1ZH8A 3DEKA 3A27A 3OKFA 3PUZA 5F4BA 4CQMA 3WB0A 3H4VA 5CB4B 5AHWA 3C5VA 3TCNA 2RGGA 3OC0A 1OC4A 3L93A 4N12A 4PYIA 5D1NA 1W30A 5DK4A 3UCFA 4MVYA 4ZQEA 3QWAA 3C5CA 5IN5A 1NT2A 2P6OA 1BJKA 1SUWA 4UQPA 2VZEA 3MQFA 1U3CA 4BATA 2G7ZA 1D1QA 3RUFA 3P0HA 3NBYC 4W5JA 3DVAB 1GAEO 1OVGA 2QNIA 3AV3A 5D85A 1L8QA 3SHVA 3SX2A 3VM6A 4BVKA 3KFVA 1T9KA 2QRVA 4O4JF 4ZJYA 3RAEC 2I1VB 3FPKA 1E99A 2XUGA 5LB2A 3BMCA 4G2NA 2E5FA 3V6LA 4QNRA 4CNBA 1ZESA 2HT6A 1MO6A 1RYFA 3B82A 3N74A 4CF7A 4YX9A 3FNFA 4M2LA 1CU1A 1QE5A 3K05A 3TXXA 3W2EA 2XXAB 2F1OA 2Z8XA 4EG1A 3TNFA 2VYNA 5DE3A 4ZVLA 2IZ0A 4EG8A 3PJGA 1Q6ZA 5HSGA 4G0UA 1RHRA 2W6MA 4QTXA 2VRNA 4PC7A 3STVA 4X66B 4ZICA 1WOMA 3L0CA 3NTLA 2D5LA 3AUTA 4BCCA 4CKZA 2FG6C 1Z07A 3JSXA 3A31A 5KNCA 2VPTA 5LQJA 4YROA 2ZE5A 1X2EA 3URMA 1ZOLA 5EJIA 1IZZA 3GPCA 4L15A 3FGPA 4F6RB 1XYYA 4MW0A 4WZAB 1K08A 2E37A 4Y9TA 1OXMA 4GEGA 3L0YA 3JXEA 4P3OA 5I51A 3HKDA 3DZFA 3EPJA 2F55A 4ESOA 4H0NA 3IQIX 4Q3LA 2NUBA 1H3FA 4B47A 1WHSB 1YSCA 2H4WA 1CUZA 3EXIA 3MTBA 1WRBA 2LIVA 4RNCA 4XARA 1U99A 5ALGA 1Z63A 3EFOA 2REQA 2Z30A 1RM3A 4IIBA 1UFQA 1Y6FA 3UWDA 3HR4A 1F4VA 1ODKA 1LEHA 1G4HA 1IN8A 1P2TA 1PJ2A 2BZ1A 2Q6LA 1KDVA 1Y4SA 3FOWA 4QOGA 3PPYA 4EGJA 4C30A 1DL5A 4PYQA 1C9EA 1QP8A 2GKSA 3AB8A 5HF9A 3RYTC 1QGUA 1LU9A 1YBVA 1W0JD 2AB0A 1UANA 2VDUE 4NYJQ 3U7FB 4QDZA 4OX9Y 1U0BB 1Z74A 3CE6A 2FX3A 3FDXA 4PG8A 3RUDA 5KYXA 5EPEA 5HIAA 3SDBA 4K05A 4O5OA 1F20A 3DE2X 2H65A 2ILVA 1XRRA 4M9ZA 1M2OB 4RXMA 3FPHA 5A0FA 1E61A 1AUXA 1D0IA 5ES3A 1JPUA 1OXTA 4M36A 1P4RA 3PPVA 5EE3A 2WHPA 4O2BB 2BR3A 1QHYA 4FCCA 1VE9A 1J70A 4HH0A 4HXEB 1MW8X 4D81A 1QAOA 7ADHA 3OCJA 4GZMA 3GEBA 4FEEA 1B73A 3VJLA 5DI3B 5IKEA 5LNK6 1YKSA 3WK9A 4N82A 5LZ8A 4ASUA 1AKUA 2WHQA 1FP1D 3BB1A 4NZMA 5JRZA 3CEHA 1OFHA 3AVPA 1BCRB 4MJ7A 4JWTA 5DH9A 3EDYA 3GRVA 1VPDA 3CRRA 3VJMA 2LXNA 4G8DA 5K3OA 1A7UA 1M2EA 2AG8A 1T8UA 1H22A 1Y4UA 5EQFA 2AKYA 4KO8A 4UFPA 4RTSA 2ZTVA 2SKEA 3CH6A 3DUFB 4YDRA 1IPEA 4PSCA 3IULA 1NSYA 4P82A 4TXMA 4CCYA 3QKIA 3WGHA 3EXG2 1C0KA 1DOZA 5FI0B 5HIKA 3ZXUB 3FMIA 2Y3IA 2YN0A 3AJAA 5EP3A 2QUAA 2BBTA 4U7JA 1YJ5A 3DONA 3AJ8A 4HPWA 5EAIA 3VV2A 5MN4A 1BXGB 3AF3A 2HO4A 1NW3A 3NBFA 4UAGA 1XQ1A 1C29B 2PX5A 3A1TA 3AZQA 2E48A 3IVMA 2R79A 1YZYA 2FEMA 2XHZA 4K9MA 4O4HF 1UWKA 4YUYA 2QX9A 3QVSA 4XRRA 1DBQA 1EAYA 1II8B 5EI5A 5K8IA 1SXHA 5AJWA 2CHQA 2X3YA 2WT9A 5EP2A 5BRAA 1SZPA 1OCEA 4FOOA 1CJVC 1YZGA 3HUFA 4BQSA 1NUTA 2C61A 3MPOA 3OPYA 1ZFNA 1TTQB 2Q5CA 2BFCB 3AI3A 3ENKA 4JU8A 5DBIA 5JNTA 4B31A 4PN7A 4RK4A 3LQ2A 2ZJ5A 2YBEA 2G1JA 3FJ1A 3HCNA 3QPUA 5KOJA 1RR6A 4R6WA 1CY2A 2BE9A 2MYUA 5LYYA 2ZJ2A 1HSZA 4GPTA 3DV0B 4ZZ3A 1KJQA 3H9QA 4O6VA 4RQTA 4AI6A 3AX6A 2D8AA 3B2QA 2KI5A 3LSYA 3NT4A 4LV8B 4ZANA 5GINE 4MR9A 5DNUA 2P11A 3IELA 4YCCA 1ONNA 1C1XB 1CY4A 2QDXA 1UBGA 1MJNA 2HNKA 3N2YA 3QKWA 4DUGA 4Z6KA 1LLCA 4XAQA 5K09A 1DXYA 1R9JA 2IUTA 1RJ9A 4FUQA 4MVXA 4CL3A 2G83A 2B8NA 2FZWA 2NO9A 4ZXFA 1JEQB 1Z6TA 1GTG1 1L5RA 4NCBA 1G9XA 1CKEA 1J25A 2QB5A 2C5LA 4MVJP 2Q50A 5HX7A 2IVFA 4XSHA 3QXCA 1TYCA 2J6HA 4TKLA 4CMJA 2VHWA 2H8GA 4LPSA 3O91A 4IGAA 3EGVA 1FUKA 1GNTA 4YXWA 2EZ9A 2R3SA 2OSBA 3UJ7A 4YP9A 4L8VA 2JBAA 4ITUA 2AKAB 1RZVA 2VA9A 1R6BX 3ABIA 3WRYC 3OA2A 3EBOA 1MORA 3OZ7A 2E1PA 5G4KB 4AO7A 4OP1A 2XMDA 3GB9A 1H4SA 1W2HA 2ZSJA 3PNBA 1NI5A 1UK6A 1XDBA 4R1SA 2ZR9A 2VSQA 1LLDA 1QDEA 4R81A 4ZCSA 2GYVA 4EMTA 5BV0A 5CXUA 2XKJE 2VAPA 3WLKX 1TB4A 3MJEA 1JALA 4UTVA 4S1VA 2GPTA 3B6MA 2ZRCA 1BN6A 3RVSA 1XRNA 1SBHA 3RU3A 5LIRA 2OBFA 5L7WA 2HKIA 4FZJA 4OM7A 1RAEA 1QX4A 4KIGA 5FF9A 1CFJA 1JHQA 1XZQA 2CF6A 1UT8A 3OU2A 6REQA 3TTUA 3TB6A 3ZU5A 4WI1A 1T9AA 4TXLA 1I4LD 1TM3E 3H6KA 1ZYUA 2VLIA 4LMRA 2QRPA 3I1FA 3ICEA 3ZS8A 5FJJA 3MJ4A 1J1IA 5JY6A 1QK3A 2GPYA 4NOMA 3CHYA 1HQDA 3KUUA 4QD3A 2W2LD 2FMFA 3J7TA 5JSYA 3C5WP 1N5MA 4XM0A 2VDPB 1NF9A 3IBSA 5DNEA 3PDHA 2ODNA 4EUNA 1N9KA 3C3XA 2BZ0A 1W9MA 3Q6MA 4XVRA 5E3HA 3EC7A 5JE8A 4CF4A 2C4TA 1U9IA 1Z7GA 3G8YA 2DJ5A 1XT6A 3THXB 1MAUA 5H8WA 1KAGA 4ER6A 1RI1A 1JE0A 1OAOA 4OHFA 5IMSA 4JBYA 3NFYA 4N01A 5IABA 3K72B 2OV1A 3KJXA 3EZFA 1S01A 2D5BA 3A3YA 2Y6UA 3B5IA 1F2VA 3FNBA 3ILHA 3L49A 1N7IA 2IY9A 2J9ZB 2V6GA 3EW7A 4PZUA 1JIVA 1Z3CA 2IOFK 1YT5A 3G0BA 3DTYA 4EZBA 3IV7A 4X93A 3FYSA 3GRFA 1IZYA 1J2RA 4FZVA 5CDYA 3NHSA 5ALTA 3MG9A 5E38A 1NKSA 4BO5A 4AKIA 4L6AA 2QRLA 5LOVB 1YDGA 5LQKA 4PPGA 3KVYA 2X3FA 2FPPA 1ATIA 4MROA 5B7PA 3N0XA 3WJ7A 1U2EA 3QOXA 3GC6A 1L4HA 4UM5A 5HIMA 3NTRA 1NUQA 2VJLA 4UM8B 3KPUA 4I5EA 3U3MA 1FU8A 3KO8A 3L7AA 4YP5A 2FZEA 4DE5A 5E1MA 2I3AA 2O8EA 1GLNA 2YWFA 2HXGA 1A76A 3W2GA 2ZVDA 1CW2B 1G8HA 5HZKA 3UEOA 4V1CA 5L3SB 1X7WA 3BXPA 3PR1A 2HIGA 2VDMB 2A5FA 3VO2A 2WJ4A 2C96A 1IDN1 2ZYDA 3KUKA 4U8HA 4DUGD 4NEQA 4RKWA 3SEFA 1QC5A 3C3MA 3C4QA 4HS4A 1KO8A 4HGOA 2WUEA 3TIFA 1X3SA 3TI9A 5FTLA 1GILA 3EGEA 1YMQA 5EOVA 3O4JA 2JIRA 3GNTA 2YW2A 5A1JA 3E8SA 2XRFA 1P5RA 3OQ6A 5F98A 1YCDA 1LTHR 5CX4A 1H1LA 1SELA 4KZPA 4DDVA 4BLPA 1UIRA 4TL8A 1ENYA 2DUNA 2OCPA 2P9EA 3T5GA 2WIGA 1X1AA 4WK2B 1KKMA 1AU9A 1AKRA 2NZ2A 2QM8A 4LDJA 4F2DA 3FYUB 1JI0A 3LMKA 5JPDA 1EP2B 3COWA 4LW8A 4UVDA 1BOFA 3PQDA 2ACWA 4NBUA 1NE7A 2FZLA 3BERA 3RADC 2GS9A 1N5OX 4W99A 2ZBGA 3GQBB 1JPJA 1XD9A 1NBHA 3GPBA 2N1BA 5JU6A 4DR7B 1N3YA 2GF0A 1DIGA 1L7MA 3PUYA 1OA1A 3DNFA 3KL2A 1CULC 1O95D 2VI5A 3CIFA 2V45A 2W6ZA 2OORC 2YC4C 4PC3A 1KBQA 1X80B 2VPWA 5C7LO 1WUTA 1E1NA 2NTNA 4DLWA 1VPVA 3BH6A 3SSNA 4D8XA 1X92A 1RI3A 3CF6R 3ORQA 4OQLA 4K6CA 5AI8A 4Z4QA 1EJ0A 1PZEA 3E6AA 3S2EA 4CMHA 1FUEA 1B16A 1G5RA 1E6EA 2QP3A 3GFVA 3RLFA 3SJCA 3ZYCA 1WKBA 5LDHA 2MSDB 4A2WA 3HS3A 1ZK3A 1RSZA 2CJYA 4FHGA 2CHFA 4CIXA 2H7XA 2GF2A 1UBKS 1P1FA 4R4JA 4UDNA 1M0SA 4AP6A 1TMGE 2HOQA 2ZT7A 3L8EA 4LOAA 1HNXB 2CJXA 1BGVA 1AUPA 1VG1A 2C9OA 3B2NA 3Q72A 1BX0A 3QFRA 1DRJA 4OQQA 4CEIA 5H0IA 1DWUA 1IE3A 1P9WA 2WBLC 3UG7A 1A1VA 2DEUA 1CERA 3E9QA 2QX4A 1T1EA 2EVWX 2HGZA 3N2GA 1ZJ6A 1QSGA 4RE5A 2A88A 4HB4A 3TM5A 5EJFA 4DJFC 4DQLA 2Q7OE 1IWPB 3T0FA 4HN4B 1AQ6A 3A11A 4ENTA 2MR6A 2C5AA 1GU0A 3EXG1 3UB4A 1FJGB 4LJ6A 3FCXA 4PG6A 3P9YA 1XTPA 2NAFA 4A6DA 2QKYA 3HBNA 4QOEA 4OQDA 3S70A 4EOGA 1L3IA 1QS0A 1ZUHA 3HYTA 3R8CA 3PWTA 1QTIA 3PR3A 4RCVA 2V3CC 1IVSA 2WE8A 4H7DA 5HKBA 1FQOA 4YRBA 4GR4A 1UC4B 4MWZA 1E69A 5JXJA 3BGDA 2B6NA 2Z2YA 3DBRB 4FQ7A 2JNWA 2FUG6 2HLHA 3QBDA 2ACKA 1XCMA 2FXIA 2QD3A 4ND8A 1E1CB 1XI2A 2P30A 3GJTA 3IVGA 3L1VA 4NEGA 5IAOA 5JXHA 2E18A 2WHEA 4YGXB 1U4SA 1M8GA 4QYSA 1FC0A 1KOJA 2Q3BA 2QK4A 3DO8A 2PYIA 2G04A 4YMHA 1HFKA 2ZKIA 1W85B 2GCPA 3AERA 3WHKA 3CJRA 3G9ZA 3S3TA 3BD8A 4A92A 3HUUA 1L3CA 4EUHA 4NU8X 2HCTA 2FSVA 4G67A 3X44A 4GOOD 2XGOA 1QHEA 2H8KA 4Z9BA 2VJKA 2HHAA 1WS6A 1X7ZB 3WMWA 5NLLA 1W47A 2PUTA 1HXHA 3RUAA 2H3HA 2J08A 4LKOA 5K03A 1DRUA 1WSAA 4P32A 4RY9A 3VYRB 4IVQA 2BCEA 4N8DA 3QFCA 4FDTA 4JBGA 4NE9A 4OB7A 5JARA 1KC1A 4ZP1A 2IH2A 3BSSA 4QFDA 1YB1A 3QOWA 1IBSA 2QV7A 3AUFA 2AUNA 4QU8A 5EPOA 1ZU5A 4WJZA 5FFMA 5LKAA 4OQXA 1P3JA 4I0WB 4ZZIA 2PUEA 3L6EA 3PGMA 4OJYA 1TAGA 3EULA 1VB5A 5DEOA 4U3JA 3UFBA 3NHFA 3IXMA 5B1EA 1EUDB 3RC9A 1MF7A 2BFBA 5KCZA 2P9JA 4JYPA 4QPDA 1NKVA 2CFOA 5JJLA 5GV8A 4Z0PA 1QCYA 4DBLE 3K4HA 1U1DA 1FU7A 4RTPA 2W8ZA 2RHJA 3MAAC 3K4QA 2CBGA 2JBAB 2AFVA 1E3IA 5CCDA 5SYMA 4DJTA 4AUKA 2O48X 2X9NA 3ZHYA 3THYB 1DRWA 1M10A 1W59A 2J9FB 5GGYA 4BVBA 2C3OA 1PJ3A 5AJZA 1VFPA 2QXUA 4YAFA 4J3FA 4X1IA 5SY6A 3QMVA 3VZDA 3U3DA 1NL3A 4LY6A 2CSXA 1ADGA 1J4AA 4OHKA 3WB1A 4IGEA 5IARA 3NKVA 2EYUA 4ZEXA 3ZLBA 5JO0A 1YDEA 2G1AA 5JZOA 2XNJA 5TC4A 3WDMA 2J0QA 5EJEA 1B15A 3NHKA 2J32A 1NMSA 2G9VA 3Q9SA 3ABZA 4M98A 2A14A 3GT3A 4Q4HA 4TLBA 3IUYA 2ORWA 3H2JA 1XAGA 1CNFA 3RFXA 2EP8A 3OLXA 4GDMA 1G3RA 3V7YA 4Y2QA 1OHHD 1MAHA 2JRCA 13PKA 2P9TA 4QBGB 3W2HA 3NHPA 2RHGB 4ZV4A 1YOBA 2VF5X 4JBXA 2WFZA 5I8ZA 1FQWA 2FK7A 3KOMA 3QWIA 3MMNA 3L3BA 4ZTBA 3UFXA 3D7LA 4FMCF 3K6SA 5IVIA 4XD7D 4QHYA 4LSMA 3CYFA 2VAMA 1LV8A 3O9MA 5ESXA 5F4ZA 4Z5XA 5CB8A 2H57A 4BDSA 2WIJA 3U13A 3PEWA 4FM9A 4Y1GA 2W5UA 1RZUA 1GGNA 3GJ5A 5DOZA 3MJFA 3N8KA 3TEFA 3K2IA 2HCFA 3RJ5A 5ITSA 1U1IA 1E63A 1DRKA 1K89A 1TU3A 4EHLA 4EHBA 2GJ9A 1PX0A 5AK4A 1H05A 3QXGA 2C4HA 3I12A 4GMGA 4MV7A 1HA3A 2YV5A 3R77A 1Z2DA 2JAUA 1LBEA 5CB4F 2X76A 1JXAA 4U7GA 1CY1A 1S9HA 3E9CA 5E2AA 4XWTA 1XZKA 1TKRA 4CDNA 4Z99A 2HQBA 4ZMRA 3L8HA 3ZXYA 2V0NA 1E6CA 1I3NA 1JAYA 2DKNA 4J0DA 4MRSA 4Q03A 4TMZA 3VV3A 1PR0A 2JIOA 2FK8A 2EWMA 4DBLC 4KUHA 4OAPA 3WYGA 1U3WA 2MU1A 4F38A 1XELA 1PZXA 4X64B 5ERYA 3BKXA 1OI3A 3BMNB 3B5EA 4P80A 4QYIB 3QKUA 4C2BA 3EJWA 3OTHA 3V97A 5I4BA 1ZJ4A 3B1VA 4EKDA 2EXXA 1EDDA 3KTOA 3KU4A 1FTQA 2CCJA 3FLEA 2AN1A 1OI7A 3NV7A 1C1DB 4B9EA 1XTIA 4IWNA 1PJQA 1RXYA 3QGMA 2J3EA 5KO2A 4P53A 5ICCA 2PXHA 2P3SA 1WZ2A 2GZ1A 5EIHA 1R9NA 4UHBA 1LSOA 3K8ZA 2BR5A 1LZLA 5K3AA 3M6FA 3FNIA 3ILSA 1YUNA 2B34A 3SFTA 3P0EA 1GL6A 2XV1A 3FDJA 4ARVA 2HWXA 3EDMA 4ARBA 3TGWA 5ALPA 3IQEA 4XPIA 2I91A 1X1SA 1OFUA 3RUPA 4WKOA 2PR2A 2ODTX 2A0KA 2YHIB 1MRSA 1TM2A 4G0OA 4YRQA 3LLMA 4WOBA 4CLDA 5JAHA 2X5XA 4JY7A 2WTUA 1HR0B 2H4JA 1C1YA 3DAFA 1N75A 1ZD5A 1I1NA 2JI8A 3GUZA 4Z49A 1SIBE 1EK5A 3EVBA 4RIHA 3D3WA 1IEVA 5AI5A 1AO3A 1LTKA 2GB4A 1OBVA 4JJ7A 2OQVA 2QMYA 2F1IA 4AKTA 5HZGA 3PQEA 3Q41A 4KLCA 5CLLA 3M4NA 1IB6A 2Q49A 1SQGA 2NVOA 3JQPA 5FT9A 4X91A 4ANFA 4FYYA 1NTRA 3LDGA 3M4XA 4A1FA 3WK7A 3TB4A 4J9UE 3K1YA 2C9MA 2W7TA 3T5DA 1ZXLA 2SECE 4UDOA 1KPHA 2JAPA 4NYIQ 3W1WA 3L8FA 3OQIA 4HNGA 4MP3A 4N7BA 2FSVC 2WD8A 5LYJA 2N1MA 4EHHA 1SC4A 4BEJA 1D2GA 3UN1A 2XE4A 1D1SA 2AZDA 1J07A 3N5KA 4GAEA 2K87A 3M4YA 2Q5QA 2R66A 2W37A 4RH3A 2XOXA 4RBNA 5EQJB 3SX0A 4D98A 3ZQ6A 3NEAA 4WLNA 1OWNA 4E30A 3D31A 3SS8A 2FF7A 2RC6A 4G0YA 1XTRA 4XZ3A 4GM1A 1X1QA 1KJWA 1A4UA 2DBVO 2ZSIA 3BQMB 5G2OA 4ZIRB 3BA1A 3NAGA 2W11A 4MZDA 4YJ3A 3F4BA 1HETA 5LDGA 1X94A 1Z0JA 3ONDA 1NJFA 1PR6A 5ENZA 5WRFA 2NLOA 4PYOA 4R9NA 2Q3DA 2IYTA 5IZCA 2BRUA 1VM6A 3R44A 5IJ9A 5J40A 2G0AA 3SPXA 4L8YA 3DM9B 5JXIA 2B2XA 1RI5A 2PKRA 3IPCA 3K20A 3O3CA 4I3FA 1MU0A 3WZMA 4BO3A 4O08A 3K0KA 3ACBA 3O8QA 2H1OA 1W4LA 3DDWA 3CX6A 1Q7BA 3DPIA 4JVOA 4O4IF 4PINA 1HEUA 4PGMA 5DU2A 5G4KA 2QMOA 3ZCRA 3OF2A 4D7AA 2AV6A 1C7ZA 2W4MA 1E9SA 1HM5A 1X42A 4OF4A 1WDMA 2ONZA 3NEYA 1I24A 4L8WB 1ZNZA 3AVQA 4ENVA 4A6PA 4MS4B 2ERCA 1OFIA 1ZK0A 2PN1A 2ZSKA 4U7WA 5AWFC 5GIOE 1UK8A 4PCAA 2ATXA 2NXCA 5CLIA 4UOQA 1ZS9A 2YWCA 2PQ6A 2ZIXA 3HXLA 3ITKA 4KAFA 1VE5A 3TX6A 3IUJA 5K8CA 4JV5B 1XQ6A 3RGWS 1JJBA 2X9VA 3E81A 5L9AA 1YFLA 4HFJA 2UZAA 3BOSA 5HIJA 4I4TB 1UMBB 5DN6D 2IT1A 1ODTC 1ADCA 1T0PA 4X5OA 2VZLA 5DT2A 3WIEA 4ZVUA 4AWBA 4BUCA 5K0FA 2XXAA 2G8LA 2YVQA 1FJ2A 2ZRQA 5EMNA 5CG1A 2V74B 2X6QA 4BWGA 2AOTB 1KF0A 3IBCA 3NONA 1OZGA 4JD5A 4WECA 4YGYA 1QGOA 5EJAA 5C0OE 4QUIA 1T2EA 2XUHA 3RIHA 1JTEA 3ES9A 1BD3A 1DIOB 2QLBA 2YWDA 3PDIA 3QRWA 4LHYA 4DV2B 3S28A 4H2DA 5HQ3B 3GHHA 3DBOB 1CY8A 2VAVA 1XFAA 5B1YA 1RWOA 1MC8A 2H07A 1GGMA 4JLDA 2VHCA 5FB3A 2VA8A 1EDBA 2DT8A 3ZKWA 1HNWB 3QFFA 2GAAA 3L06A 4GU5A 5EJ5A 4B75A 2GBFA 2JGDB 4IWXA 3D4NA 2NU9A 4Z54A 4JH0A 4NAUA 2ZIUB 4LK3A 4R7TA 5DP2A 5DTIA 4BNJA 1HTWA 3WK8A 5GZ3A 4NBRA 3NIBA 5DZSA 3UUWA 3OFNA 1UXOA 3ET5A 3PK0A 4TXJA 3ZV7A 4BPRA 1IHYA 4XKJA 5DGCA 1J2YA 5THQA 3U09A 3L0OA 4MOWA 4D2IA 2GBCA 2MWMA 3G49A 2H06A 3OIUA 1QO0A 5HBGA 1H3EA 5IEBA 1U2GA 3ILXA 1DDIA 3L7IA 4HYEA 4WPGA 3LTEA 2BSXA 4YN3A 5HIIA 3ZCUA 1T5BA 1L3BA 2X5NA 1YOVA 2XMZA 4AUNA 1K6XA 2IZ1A 1XLVA 1JI3A 2OBXA 2VCEA 2G1KA 4PBTA 1XRJA 5DBEX 1N8TA 2VJAA 5ENDA 4LA4A 3M5WA 5A4KA 5TPWB 3OZCA 5KNCD 3SX4A 4GZLA 2PWPA 3MBKA 1IQRA 3CONA 2WAYA 1EB8A 2EG9A 3ZY3A 5BVGA 1FVOA 2XWPA 3JQGB 5F3RA 3ZV3A 3THWA 4I4CA 4NSNA 5IULC 2C04A 1S96A 3M1YA 1F3LA 1THGA 4R9UC 3UGQA 1BYUA 1U6JA 3KHSA 1FNSA 2CW5A 2K2QB 4RZSA 1UC5B 1V4BA 2BYTA 1OXSC 2FWRA 2QRVB 3SDZA 5AW3A 2H9AA 1R74A 3L2OB 3LP6A 4BNKA 2F3UA 3OT1B 4LEIA 4Z1MA 3M4JA 3BZUA 4KODA 4MCIA 3SIXA 2XOEA 2J7KA 4MUEA 3GXBA 4BNLA 3VH1A 3ICOA 3ZCQA 4DIDA 4E07A 2D1YA 5KKAA 4MDEA 4FGZA 3OZIA 3T7SA 5BVGB 1X7ZA 3KUXA 3NANA 5ALNA 2FX5A 5J9FA 5FYDA 1EFRD 2H48A 5FTMA 5AW9A 4KDCA 4EDHA 1GNSA 4UVIA 5D8DA 1M3SA 2IUYA 1U90A 2JJYA 4GXRA 4KAJA 4CV2A 5KDOA 4UU8A 1Z5UA 2YV1A 3EY9A 1YMUA 3I83A 3SYMA 2D2IA 3T8YA 3B6IA 2J59A 2D1TA 4Q34A 4TM8A 1NRWA 4FJ2A 5REQA 3W5UA 4AZ3A 2REQB 5F78A 1KVUA 3R5TA 5ED4A 1YHNA 3L9WA 1I30A 2P8JA 3FG9A 3L07A 4FZ5A 1G7TA 1BC5A 2B20A 1HX7A 5FHRA 2XCUA 5ADUS 2QMEA 1EWYA 1H6AA 2A9FA 3Q3IA 2EFYA 1BW9B 2FSGA 1VA5A 2BI7A 3EFEA 3ND9A 4HDOB 4M0CA 5BN1A 2A7QA 4BKRA 4DV1B 2CSUA 4LUCA 1JDNA 1UBCA 2EJUA 1KS2A 2E7ZA 4GOXA 4J0FA 5AI0A 1ULSA 2ZYSA 5A5GA 2AQ8A 5AP9A 3I6ZA 1E6UA 4YAEA 4LWPA 2F9MA 4BX0A 2Q41A 2I2CA 1C7QA 1F9EA 1TM4E 1U0EA 2J5KA 3GROA 4RUKA 5DCUA 5DBHX 3TRJA 3VXKA 2PZAA 3EH1A 1H5QA 4FP9A 1E3SA 1WHTB 2GZ3A 4F91B 3TBHA 1MT0A 4NJMA 2R48A 4QEZA 1VPLA 1RZRA 2Q8NA 2DERA 2A9QA 4MWBA 5ELXA 4FHEA 1SK9A 3IR5A 5M2QA 3FIJA 3LRXA 3ZHXA 3G85A 4FOSA 2HA7A 4H3SA 5CFRA 1TQ8A 3GLGA 3B3AA 3LP8A 1YRLA 4RQUA 4N3AA 3WAGA 4MYDA 1EK2A 2JIBA 4I1UA 4MW6A 1XROA 5EMLA 2IBMA 3IJEB 3UTDA 3WL3A 1PLKA 2GUGA 1TEVA 5LQSA 3HVRA 2AFIB 4JXJA 2EZUA 2P2YA 3LAWA 1KOGA 5FUYA 4OHPA 1Z0ZA 3EY4A 1IOZA 1CQZA 4LGCA 5I9TA 3KWFA 1C8KA 1QZTA 1ULAA 2C77A 3ZK7A 2H2FA 2YY5A 1A9RA 3D0RA 1XTBA 3GWGA 4KLRA 1EFHA 1VC2A 1T5HX 3O73A 4UHEA 1E66A 4CL0A 1ENZA 4LXHA 4UZSA 2D2XA 1EU1A 2QM7A 4ZEVA 1PD0A 3GGDA 2FEPA 2C31A 1MFZA 1HZJA 3NXKA