5K0GA

Crystal structure of comt in complex with 4-[5-[1-(4-methoxyphenyl)ethyl]-1h-pyrazol-3-yl]-1,3-dimethylpyrazole
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
219
structure length
219
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 79
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0gA00
5LSAA 3EEOA 2PKWA 3A27A 5JR3A 5C1IA 3VC2A 4C03A 2WA1A 3X0DA 3FUVA 3KQQA 4QPNA 4C07A 3TKAA 3ER8A 5KYGA 2AN5A 1JSZA 2PXAA 1IY9A 5EKXA 4RVFA 3S68A 2HWKA 3UJAA 4ER6A 1P91A 3I53A 2P35A 1YF3A 3P9IA 4E70A 2ZTHA 3TOSA 4KRGA 4FGZA 3A7DA 4BLWA 1SKMA 2V7EA 2QY6A 3BUSA 2I6GA 3TRKA 2NP7A 3U81A 4P7JA 4RTLA 5BW4A 5E1MA 2JHCA 3HCFA 5EG5A 3KQOA 4U7PB 2V74B 3T7RA 3NDIA 4E2XA 2PX5A 2GS9A 5CVDA 5DM1A 3OU6A 4HSGA 4U7TB 2IIPA 3EVDA 3HTXA 5GIOE 1G6Q1 5MHTA 4OA5A 2FYTA 1TPYA 2PGXA 2ZULA 1SQFA 1KPGA 2PT9A 3LKZA 3EPPA 3UJBA 3DXXA 1NW8A 3P9KA 4G56A 4RTPA 1NW5A 5EMJA 3M4XA 2PX4A 3UBTA 5FQNA 4UOEA 5EC8A 4R8RA 4P7KA 3GRYA 3TMAA 3VSEA 2B25A 4BP1A 3HA7A 3LGAA 4OBXA 1N2XA 3GRVA 3K0BA 5DXJA 1D2GA 1YFLA 5FADA 3CGGA 2JH9A 4CXMA 3UZUA 2P40A 4P7FA 2B2CA 3CVOA 3DH0A 3LDUA 5EIFA 4PWYA 3L8DA 2OB1A 3HVIA 3P2EA 1R6AA 3LDFA 2HV9A 3CC8A 4OQEA 5C9ZA 4M37A 3PX2A 3UJ8A 2UYCA 3TQSA 4CKBA 5GINE 3KR1A 1L3CA 2UYQA 3OU2A 1YB2A 5FA8A 4WVLA 2ZZMA 4QDJA 4M36A 2PWPA 5DTMA 3SVZA 3BGIA 1RJGA 3TKYA 3MQ2A 5DRYA 2GLUA 3TM4A 4CKEA 2O57A 3DULA 4P7GA 3LCCA 2O0LA 5CD1A 5GP1A 3LBYA 3M33A 5DPMA 5EHGA 3MTIA 10MHA 1NV8A 4GC9A 3KHKA 3H2BA 1G8AA 2AN4A 4E30A 3A25A 2ZIFA 4MQ4A 5DRTA 1VP3A 5DSXA 1JG2A 3HA5A 1NW3A 5K0JA 5LQCA 4F86A 1P1CA 3B7PA 3C3YA 1Z3CA 2OBFA 3I64A 4PYJA 1I9GA 1AV6A 3BGVA 1RI1A 4GF5A 2PLWA 4LECA 4EK9A 1O9GA 3CCFA 3E8SA 3EVFA 4QDKA 3EMDA 4XUEA 5HFJA 2AVNA 3THRA 4BLVA 2AOTB 4R6XA 2DULA 3E7PA 5IH3A 1AQJA 1KIAA 1ORIA 2PX2A 5U4XA 3EEYA 3FRHA 3G2QA 1XCJA 1XTPA 1N7JA 5F2OA 5ICCA 3KPWA 4RV9A 3V97A 7MHTA 5DM0A 3P8ZA 5HIMA 4C04A 3B5IA 2HNKA 4HH4A 3UJCA 1NE2A 3GNLA 5E1BA 4MHTA 2G70A 4EKIA 2IPXA 3LL7A 3FPGA 3GIWA 4IWNA 3JWIA 3KR0A 3PVCA 5D1HA 2CL5A 1VQ1A 2YTZA 3EMBA 4P58A 5DLYA 2AZTA 5HOQA 3FPEA 1L9KA 3HCBA 4DKJA 8MHTA 3A26A 2NXEA 1EAMA 3OZRA 1MJFA 3AXSA 4ER7A 2FPOA 2H1RA 2WK1A 4QVGA 1P39A 5BP7A 3O4FA 3P71T 1NW6A 2FK7A 4HTFB 4YUVA 3T7TA 3UJDA 4CKCA 1L3IA 3OCJA 5K09A 1NV9A 2AVDA 2CMGA 3NDJA 2YVLA 3PB3A 2OY0A 3DOUA 4C08A 1UWVA 4HGZA 2A14A 5EEHA 1BC5A 3SM3A 1F3LA 3Q87B 1U2ZA 3G2OA 2IDJA 2P8JA 5F2NA 2XYQA 5CCBA 3DR5A 5DX8A 4RTKA 5CM2Z 1D2CA 1SUIA 2ZWAA 2JHPA 2QRVA 3EGEA 3KQSA 4GOLD 4RTOA 2R3SA 4GOOD 5KQSA 2CWWA 3NWEA 2XYRA 3A4TA 1DUSA 5KQRA 2IH2A 1RI5A 2IBSA 3I58A 1EG2A 3CBGA 5EIWA 3PFHA 1FPQA 3KR2A 1I4WA 3SSNA 2XBMA 1R00A 2HR1A 1JTEA 3NTVA 2DPMA 2GA9A 3VC1A 3FTDA 3I5UA 2AOUB 2JHAA 2Z6AA 3FUWA 2ZSUA 2K4MA 3B3GA 5B1SA 2AOVA 4FSXA 3FUXA 2C7QA 2P3OA 5ICGA 5T6BA 4YV2A 1XXLA 2AOXA 3O31A 5FWDA 1VL5A 1RI4A 2LD4A 3C6KA 4PYLA 4RWZA 1ZKDA 3G5LA 1HNNA 2IP2A 2QYOA 3A7EA 1XDZA 4GQBA 4FS8A 5FTWA 4DZRA 3KQWA 3LCVB 4RTJA 3LHDA 3MGGA 3OU7A 1AF7A 2IH4A 3G2PA 4AX8A 2B9EA 2F8LA 4QQKA 5EVJA 3SSOA 4DA4A 3BKXA 3UJ9A 4O29A 1VIDA 3E23A 4PCLA 1UFKA 3EVGA 3G5TA 5FHRA 3KQPA 3GO4A 3SMQA 1KR5A 2PV0A 1UIRA 5EMMA 3UFBA 2C7PA 5E8JA 3M70A 4XUCA 5G02A 2P1DA 3QV2A 3K6RA 4GOMD 1Q0SA 1G60A 2Z6QA 4DF3A 3NMUF 2NXCA 5E2BA 4RTQA 5CCXA 3B3JA 1MHTA 3FTFA 3MCZA 2PX8A 2EJUA 3ELYA 5CVVA 1TW2A 2OKCA 5CVEA 1O54A 2BR4A 2P41A 1M6YA 2YXEA 5E1DA 4BP3A 3GWZA 5DM4A 1DCTA 2P3LA 5K0FA 3IHTA 3KU1A 2GH1A 2ZW9A 2PY6A 3HVJA 2OO3A 2Q41A 3GXOA 3OZTA 4GC5A 4PIMA 4HRAA 4R6WA 4RTRA 4KDCA 3SSMA 3PT9A 3UJ7A 3M6XA 1YZ3A 5FCDA 1Q0TA 2H00A 2ZBRA 4AZWA 1NT2A 1ZHFA 2VDVE 1YFJA 3ELUA 4QTUB 3E05A 4KVZA 5LQUA 2O07A 2P7IA 3EVBA 5DTQA 2BR3A 1AQIA 5FWAA 2O06A 5M5BA 4JXJA 4KW7A 2XVMA 2JH8A 4PYKA 3HP7A 4PYNA 2CKDA 2Y1XA 3G7UA 2JJQA 2BM8A 2QM3A 5F2KA 3BZBA 4RSRA 5EMLA 4OX9Y 3CJTA 4KIGA 3TPZA 3SXJA 4R8SA 3GJYA 4MIKA 1O9HA 4K6MA 3BWMA 4X41A 3HCDA 1RI2A 3IV6A 4OBWA 4QPPA 3BWCA 2ZBPA 4AZTA 4E2ZA 3DXYA 4YV0A 3PLAE 1V39A 4E33A 1JQDA 2KW5A 4KIFA 3UA4A 2NXJA 1G38A 2OYRA 3RODA 3R3HA 1IXKA 3BWYA 3SR4A 1JG1A 4YV1A 4LWOA 3G88A 1WY7A 4F85A 4GUAA 4EKGA 1P1BA 4KDRA 2OZVA 1KHHA 5CIYA 2BZGA 2YUIA 3R6TA 4M7RA 1R8YA 1BOOA 3HEMA 2Z6UA 2ZZKA 3ERCA 1NW7A 3LDGA 3EVZA 4DMGA 1BHJA 2C7RA 2GB4A 3FYCA 5DSTA 2AOUA 5FA5A 5BW5A 5ERGB 5LQJA 3G2MA 3EVAA 2PT6A 1RJDA 4YUWA 2VDUE 3BT7A 3BXOA 3HM2A 4XUDA 4PGHA 3JWHA 1FBNA 1VPTA 2EG5A 1EJ6A 3HCEA 5DTRA 1X1DA 2N47A 3DXZA 3FPHA 3MAGA 4YUZA 1JTFA 3OPNA 3R0QA 4ZTBA 4ISCA 2G71A 1YUBA 3FPFA 1JSXA 2YXDA 1R74A 1SUSA 1XVAA 1L1EA 3DLCA 5GOZA 2XVAA 5E9WA 1DL5A 1TW3A 5K0NA 3FPJA 4X61A 3GGDA 2AS0A 3TFWA 3GRUA 3QOXA 1RJFA 2OB2A 3CKKA 3NJRA 5DXAA 2ZBQA 3GRRA 5CUQA 3FRIA 5HIKA 1WG8A 5FHQA 4V0RA 4DQ0A 4MTLA 1KP9A 4ATNA 4POOA 3AWIA 1QANA 2O05A 1KYZA 4DCMA 5E1OA 2OXTA 3MHTA 1OR8A 4IV8A 1SG9A 3ELDA 5EZQA 2ERCA 3JWGA 3KQVA 1ZGJA 4RVDA 3P97A 2B3TA 2PXXA 3CJQA 4YUXA 2I62A 3KPUA 3M6VA 2BH2A 4PYOA 3MTEA 2YXLA 3HCCA 3LECA 1FP2A 3PFGA 3GCZA 5EZSA 2ZZNA 3JWJA 1EIZA 4L7VA 2AOWA 4FSDA 4YUYA 3NW9A 3UA3A 5DWQA 2ONYA 4MWZA 5HZMA 4PYIA 2P3QA 5EGSA 5K0CA 4E31A 1QYRA 5GM1A 4ER3A 2IBTA 4RVGA 1KPHA 4BY9E 1QAOA 2PBFA 4PINA 3PX3A 5GWXA 4RYLA 3V8VA 3REOA 3THSA 4E32A 4YMHA 4FR0A 1PJZA 4X63A 1VBFA 5K0BA 1INLA 5CVJA 3T0IA 3MERA 3ANXA 2EJTA 4QTTB 2QE6A 5KVAA 2NP6A 3MB5A 3LPMA 1JQ3A 4FT4A 5P8WA 1X19A 4CTJA 2ADMA 3KQTA 5K01A 3P2IA 3TM5A 5DT2A 1R8XA 2G8NA 2YR0A 4LG1A 3SGLA 4EQZA 2PXCA 3F4KA 4GOND 3BGDA 4FZVA 3B89A 1JG4A 3FZGA 1NKVA 5DX0A 3TLJA 4HGYA 4C4AA 1PRYA 5LQAA 3OZSA 1X1AA 2AOTA 5ICFA 3EGIA 5EPEA 1QZZA 3C6MA 1H1DA 3HCAA 4C06A 4ER5A 1X1CA 1FJXA 2ONZA 1RJEA 2B78A 3GRZA 2ZCJA 4A6DA 4HC4A 4WXHA 4PIPA 5T67A 5JUWA 3IYLW 3KR9A 3M6UA 2FK8A 5EQJB 1M6EX 3LSTA 4BLUA 5K0EA 2CMHA 3FYDA 3LCUA 2NYUA 2VP3A 3IEIA 3ELWA 5K03A 5E9JA 1M0EA 1KPIA 3KPJA 2JG3A 4DM3A 2E5WA 5LR6A 2IGTA 3KPYA 3AJDA 1EJ0A 1KYWA 1XJ5A 3BWBA 1VLMA 2QRVB 2VDWA 4XCXA 2PWYA 2GAFA 4HTFA 5E9QA 1N7IA 4ER0A 2EX4A 3P9NA 5LQRA 1JQEA 1L3BA 3DMFA 4QVKA 2PSSA 3LX6A 3O7WA 1SQGA 1WXWA 2WA2A 4Y2HA 5EHIA 3T7SA 5IKMA 2OPBA 3G8BA 3FTEA 3G89A 4OQDA 1R18A 4PGGA 4C05A 4R05A 3UWPA 2FRXA 4PNEA 5EEGA 4X1OA 2IFTA 5ICEA 5LQNA 2IH5A 5BXYA 5EOVA 1JR4A 1IM8A 3HVHA 2G1PA 5HIIA 4HG2A 4H0NA 4PYMA 2ZFUA 3SX0A 2HMYB 5DM2A 5HEKA 3UJ6A 1KXZA 2YX1A 5HIJA 2UYHA 3R9XB 5FULA 3RW9A 4A6EA 5E2AA 4E2WA 2GPYA 3LBFA 4EVIA 2BM9A 3MCTA 4KWCA 4CTKA 1B42A 3OE5A 4Y30A 5K0LA 1FP1D 3G8AA 3DLIA 2R6ZA 1XDUA 5FUBA 2Y1WA 4IV0A 4E2YA 4RTNA 2NNWB 3EGVA 3AY0A 5C0OE 2AR0A 1ZG3A 2P7HA 3KQYA 1Y8CA 2ZWVA 3KPVA 3HA3A 3NVMB 1ZGAA 3C0KA 5DX1A 3FUUA 3ME5A 3P9CA 4RTSA 2UZ4A 1YZHA 2FHPA 3QOWA 1QAQA 3DP7A 4IKPA 4OA8A 2ZLBA 4B17A 4F84A 4PCAA 3ER9A 1NBHA 1D2HA 3C3PA 3OFJA 3I9FA 3M6WA 3FTCA 1G8SA 2H11A 4EMSA 1WXXA 3D2LA 1I1NA 3PS9A 2VZ9A 2ZIEA 5LQKA 1HMYA 5GIPE 5EKUA 3TR6A 4AZSA 4GBED 1BKYA 3AXTA 3KQMA 5EMKA 5K8VA 1WS6A 1ZQ9A 4PONA 3LKDA 4YMGA 5CVUA 3VYWA 3HVKA 3BKWA 3ORHA 5T64A 3DMGA 3RIEA 2AN3A 1EQAA 4RTMA 2IDKA 2PJDA 2ZIGA 4NECA 4QQNA 2ZVJA 3PTAA 4M38A 3HNRA 5FQOA 3KKZA 1RI3A 3OFKA 4DCGA 3DMHA 2G72A 4GEKA 2EFJA 1ORHA 2YQZA 2ORED 3EVEA 3NVKI 3Q7EA 4CWAA 3WSTA 2I9KA 1QAMA 3CJRA 4AUKA 2BR5A 3NWBA 9MHTA 5GM2A 2C7OA 2UYOA 3ID6C 4Z2YA 3GU3A 4X60A 1F38A 3B3FA 3DTNA 2NXNA 1XDSA 5E8RA 5HILA 4AZVA 4PYQA 1JG3A 2FCAA 2PVCA 1VE3A 2XYVA 2ESRA 3EVCA 4FT2A 4RVHA 1SVUA 4RX1A 5KS2A 4FP9A 3FUTA 3DUWA 1WZNA 3R24A 3GDHA 5K0GA 1VP9A 2I7CA 3OE4A 5K05A 1NBIA 2VS1A 2HTEA 5D1NA 5H02A 1T43A 1X1BA 1G55A 1XCLA 3P2KA 4V0QA 4LWPA
chains in the Genus database with same CATH superfamily
1KAGA 4P4GA 1CS0A 3JAKB 2QLLA 4B34A 1A9SA 1I2CA 3ZEAA 4YAGA 4W5HA 1JQ5A 4ALIA 3RJMA 4G01B 1BXGA 3SC2A 1HH4A 2D0PB 1XQXA 1V47A 3MIZA 2GUWA 1J23A 2VJMB 4HLDA 4RVFA 1GRQA 4MVJF 1P7YA 3AUUA 1TJ4A 2IV7A 3D6JA 1W0JA 3JR7A 1N2CA 1NNSA 4GM0A 2Q99A 3FHOA 4CCYB 4DJDC 1NM5C 2XVXA 3P4YA 4IICA 2QSYA 4NJEA 1P80A 3WGZA 3AF5A 5C7YA 1H4QA 1P4SA 1YBFA 5JNSA 2HREA 3ANTA 3DL0A 4OJMX 3NWOA 1WPXA 4PIVA 1A7KA 4BEBA 3BCRA 2JCXA 5KJEA 5LZ8A 1LPNA 1BH6A 4U7TB 4CKXA 5GZ6A 2Q1YA 3AR7A 2ZBEA 2P5YA 2PKQP 3BSSA 1NW5A 1RAIA 4OHVA 4QYIB 1GGEA 4I55B 1Q77A 4LDPA 3JATA 3KVVA 5EE1A 4MA0A 5IVPA 4P7KA 3GRYA 4P54A 3ZVKA 5FUWA 2HF8A 3OEYA 1S3GA 1WBJB 3D8NA 3SF8A 2ZRGA 2XVZA 2PSHA 1YRAA 2R84A 3GWGA 2P40A 5J47A 1XDDA 2XAUA 2CZCA 1XFAA 3QX7A 1LS6A 1K6IA 1Q19A 1ZGHA 4YT8A 3P2EA 3PGMA 1L9XA 4KLNA 3SZ3A 1GGKA 2WUVA 2HJWA 4OQEA 3KSUA 1C3JA 2FEXA 3AGQA 4HDMA 4IHJB 4BDSA 3FYUB 3HA2A 1HC7A 4B0PA 4CNQA 4DC9A 2KSQA 5CDUA 4UHJA 2H57A 4PPYA 4D9GA 2WM2A 4Q1AA 4Q1VA 2OZEA 3CNLA 1NE7A 4H16A 4HP8A 4QDJA 3SD7A 1C3OB 2ZI7A 1XZAA 2DBYA 1GAWA 3VPGA 5JDCA 3SHQA 2BUBA 2Q07A 3CWCA 3ZE8A 3MT0A 5F4BA 1NVAA 1OIXA 1DC5A 4IEFB 4P8RA 3KZ1E 4TMTA 1K75A 1EFVA 3W5IA 2Z8YM 1T13A 1YRWA 1A4IA 2ZUDA 3H0EA 3L1VA 1OASA 4OHXA 1T2FA 3KHKA 3OKCA 2WWVD 4DM4A 4O25A 1P1IA 4QT0A 2MMGA 3CH7A 2OECA 4DNXA 1Z56C 2ORWA 4E30A 2ISCA 2OORA 1KI9A 2Q2NA 4P32A 3MMSA 2H8GA 1KRHA 1O95D 3FNIA 2AZXA 1BCSB 2X1LA 4O6VA 4BQEA 1NI4B 3MOGA 3UICA 3U7EB 1KTVA 1VBMA 4MUYA 4Z0HO 5BOSB 5E6RA 4EQ6B 1YOVA 1CEQA 2FUNB 3V2GA 1Q7EA 2FKNA 3L4BC 5FL7D 4PNZA 3SBXA 4BVHA 4DCJA 5B1EA 2VLBA 4MRVA 5E7QA 1D6NA 2JAOA 2XBUA 3R5FA 2CFSA 1ZHOA 7GPBA 1NY6A 3EIEA 2RBEA 3JASB 3AVXA 3V97A 4IIYA 4PRYA 1SBYA 4OP2A 5K45A 2RJ3A 3E8MA 1U9YA 2V54A 2ZE5A 5D5QA 3OM8A 2XYHA 3TSOA 5AHKA 4DYDA 621PA 3B6MA 5JRZA 1OILA 1OX5A 4G5YA 4NMHA 4EKIA 5A0VA 3UK6A 3MAJA 3LFTA 4EG7A 5BN5A 2G1JA 4ZCMA 2MOKA 3H2SA 4HPWA 5T4EA 4NQZA 4CU2A 4QRIA 3SZRA 1KEVA 2JGMA 3HCBA 1TYAE 2WHPA 4U7GA 1DC8A 4AF7A 2AIRA 3GLIE 8MHTA 1CY7A 3RYTC 5HUHA 1H9BA 3L7YA 4DXHA 2D0IA 5C8YA 5BP7A 3T7TA 2TRSB 1UP6A 3MCWA 4Q4HA 4IDGA 4PCUA 4UUAA 5CEJA 7MDHA 5CIWA 2CMGA 3CSUA 5EFZA 1JIKA 1OBFO 1SVIA 2OBXA 3F5MA 3KOYA 4EA8A 4CIYA 2D5LA 3K32A 4HAYA 1ZXLA 1DFGA 4JBHA 4XLLA 3ZU6A 2GJ8A 4EIWA 2A3NA 4OM7A 2JFFA 1M72A 4KR7A 2DLDA 2UKDA 1WHSB 3ZJ5A 1VL0A 3TTUA 1BCRA 1E9SA 1R27A 2GF0A 3TSAA 4CJXA 1M1XB 5J5AA 4NOKA 2FUG6 4TTJA 3HO1A 2WSBA 4G9EA 1TIBA 2CDBA 1TZJA 3K9GA 5G3ZA 4RHYA 2IBSA 1WABA 1KVQA 3NTLA 4M8SA 1ELOA 2BJVA 4M8IA 2FPWA 2LKCA 1GG8A 1VCIA 1YVUA 4KQ1A 3IXMA 2XBMA 1RZUA 4J2HA 1F60A 4M9SA 2GA9A 2WPDA 3KT3A 4GMXA 4X8HA 1SC3A 2JHAA 1Z06A 2XMZA 1JEDA 4LCBA 5DB4A 1OI2A 3MJRA 4GP7A 3LAWA 4EZIA 2C7QA 4ZKDA 3ZNPA 3AEUB 4LF7B 3SKYA 5CB0A 1F2TB 1RI4A 3KKKA 1VIAA 4WOPA 4XD7D 1QHGA 2B61A 2FVXA 1RPJA 3G5LA 2IP2A 3IAS6 4B7CA 2WKSA 3C98A 1FNDA 4YJ3F 3LQRA 1GSAA 3SQWA 1VDZA 4G85A 4DA4A 1DKLA 1FF9A 1YRQA 2YS7A 3PE6A 3JVUA 4PVDA 2JIDA 3ETNA 3HJGA 3OC0A 3V00A 1WSAA 1VRVA 2TMKA 2OFPA 5AD1A 5CH3A 5DFAA 2G0AA 3BMQB 3I04A 4ZV9A 4GOXA 4C7BA 4D4MA 1RQ2A 1UPAA 2RG1A 4LE2A 2G0NA 1EA7A 4U7JA 4GMHA 2GCPA 2VK1A 1VKRA 1EVLA 4D92A 1ESMA 4D8YA 1NJ2A 3K1AA 4ND4A 1AC5A 3B1KA 4JLWA 1KAHA 4BVEA 1GQRA 1K0UA 2ISQA 1SU7A 4GC5A 5IWAB 3QFRA 4EPRA 1KY2A 4LXTA 4HRAA 3T3EA 4RM3A 1P44A 3SSMA 3EXHB 3TKLA 5J1SB 1KBOA 1U28C 3KCNA 3L8MA 3N7UA 4R2HA 2JFUA 2PZKA 3HI4A 3R77A 4Q3OA 4W9NC 4EL0A 4ZGGA 1XMXA 2C0PA 3D8RA 5H7XA 3MGBA 4GYWA 3V1UA 4JSTA 5DTQA 2PKCA 1ESCA 2BR3A 2EZUA 2P9QA 3L0BA 5FWAA 3QKSA 4GGMX 2XVMA 4I6JA 1Z0UA 4MWTA 4TTAA 2YY7A 3WL7A 4JUFA 2JJQA 2WYUA 1N5JA 5L6LB 3ZVNA 3BZBA 2PGAA 4B3GA 3PA6A 4KIGA 1VOTA 4M0LA 4WE3A 2V0CA 1OCEA 1L4GA 1WZIA 4MIKA 1UFOA 4DLNA 4ERNA 1PG0A 3NHZA 2F8SA 2V6JA 1EFLA 6ABPA 2ZBVA 5KHAA 1VPVA 3BS4A 5BQ5A 1NUQA 1O6ZA 2KW5A 4AY2A 4KGXA 4OQZA 3HXQA 2V5VA 4KX3A 2PEZA 1PK7A 3VJKA 4OCZA 5A6VA 2R751 4GP6A 4K9PA 3TSCA 3RBXA 4WV3A 1JMYA 3NIFB 1NRXA 2YW2A 2C2HA 2MYUA 4K9DA 4NH0A 3C2QA 1E79A 1KHHA 4Q1DA 5IJWA 4C6HA 2QAGB 3PD7A 2C2XA 1R8YA 1EB8A 4E5KA 1GLVA 2AI3A 3RRXA 4LDRA 3OIWA 3WDSA 2YBEA 1U7TA 1JALA 5EZ6B 2I2XB 3FYCA 3P0FA 4H6XA 2KB0A 1MT0A 2D00A 3NDRA 4RFSA 5DHQA 5I7AA 3RUIA 3ADOA 3B1YA 3QSYA 2ZCVA 2BFDA 3BXOA 1BDMA 1K63A 2OFOA 3I0ZA 3ND6A 4MAFA 3TVTA 3ZIAA 1XD8A 4DY4A 3KJEA 2NZXA 2ODQA 4ZRNA 3CKYA 3CX8A 3BMXA 1ATZA 1U0GA 3AKEA 1EVIA 4HDKB 5KOJB 4A36A 3L0OA 4DPKA 1ECJA 1UZUA 3T3PB 3DLCA 3CO5A 5ECGC 5CJJA 2XSZD 2E4VA 1P5RA 1FPMA 3FPJA 3QWIA 2ECFA 1B93A 1KVTA 3RLFA 1MD9A 2X7HA 4KQ9A 1SCQA 3N58A 4M1EA 2GDJA 2BMAA 1E69A 4GR5A 4MQFA 3IDAA 1F6BA 5ESWA 1O97D 1TLLA 3BXEA 8ADHA 3A8TA 3NEAA 3P9ZA 1JFRA 2RHBA 4H27A 4O3FA 1FP7A 4UHHA 1CDZA 1KYIA 1DQYA 5M04A 5AXCA 3L0YA 3LCRA 3M1YA 4NH4A 3QE4A 4NQRA 1XVIA 3MJEA 4Q3LA 4R5HA 3JWGA 5JY1A 2RIPA 4IV5A 1VYVA 1IL0A 1W48A 2BH2A 3I3OA 1DIOB 4UTNA 3IBTA 1CEEA 3BILA 3HCCA 4EFDA 1NJSA 1DIGA 3BL8A 3CUKA 2WINI 3VH2A 3RABA 2BFFA 3SS7X 4B4OA 1NKTA 1RBYA 3M6FA 2O3UA 1VFPA 1ACJA 3K53A 4QXOA 5BYKA 2C3PA 1P9NA 3GPLA 2DEUA 4TVKA 2R8XA 3W2EA 4EPTA 3HZOA 4EG0A 3ENQA 3AM5A 4NKRA 4Z7NB 4O2BF 1IY1A 4PRLA 2ZU0C 4OQXA 3VRHA 3ZTYA 3WBFA 3OPYA 4YMHA 1ZOSA 4QLOA 1C30B 5ED4A 3ETDA 3TD2A 1QOQB 1U8TA 3DOOA 1ODLA 2FSVC 4IOJA 4EJFA 3O03A 2WJYA 4NZMA 3ST7A 3CONA 1ZMOA 3DBRA 3OFSA 4B6PA 1EZ1A 1DT5A 4CTJA 4KFSA 3MLBA 4H2DA 3GBSA 1BG6A 3DV0B 2AJCA 3MBKA 1CUWA 2PGOA 4KWHA 4RORA 2Q4TA 1SUFA 2XNKA 4R5MA 2NPFA 1DBIA 3SGLA 1V9CA 2PXCA 1YMUA 3B9BA 4JU8A 1J0BA 1JIVA 3FWHA 3DE7X 4PO8A 1UMDA 1T4MA 1MOPA 3AILA 3EMKA 1VZ2A 2AOTA 4I50B 1AGXA 4BFSA 4RTJA 1PDWA 2CMFA 2CSXA 1K3TA 3JQ8A 4IDHA 1E3DA 4UPEA 1W88B 4LKOA 2C5SA 2NU6B 3NUGA 3UT5A 4D8UA 1NRJB 4I1UA 1A2OA 2HF9A 3RANA 4A6DA 4DGSA 5KNBH 2CFOA 2VHVA 3INNA 2OYSA 1C0EA 1DKRA 4YCJA 2PUTA 2GM9A 2HADA 3LBHA 5K0EA 3GP3A 5AK6A 3O4IA 2R5NA 3ICCA 5JAPA 1JXOA 1D09A 1V11B 3I0NA 3UWSA 3FX2A 3IMFA 1ENZA 3QBJA 4IKEA 3EXFB 1KYWA 1NHWA 3Q3JB 2HHAA 1M0TA 1R4NB 5E9QA 3VU9A 2H29A 1DPFA 2ZROA 4RYDA 4IMJB 2W43A 3VAAA 4F91B 5ALNA 3R41A 2YDYA 3PTLA 1BEEA 2WA2A 3UAXA 1QGZA 2W6ID 4UBIA 3G8BA 2C83A 2ONKA 2PUHA 3R4VA 4JY7A 4UVHA 3FLAA 2M2IA 3ECCA 2C04A 2J6IA 2L2QA 2VUHB 4PPFA 2VSOA 2JI9A 4QHSA 1NIJA 1F6DA 1XELA 3DW3X 3UV3A 1L4LA 3FZEA 1CC1S 2FY8A 4CUZA 3EQZA 1T4BA 3DD5A 5U9CA 1TQHA 4GPD1 1IZ0A 4KQ2A 3NNSA 4E2WA 3RADC 1WM1A 3RVDA 4OBBA 1RLIA 4LZJA 4W7IA 1N4AA 2IXDA 4A10A 4CM6A 3IJ5A 5BUQA 3BMOB 5F77A 2GAOA 4BMZA 1VJ1A 2PUJA 4IV0A 1GA6A 2II6A 2Z2IA 4HHEA 4UM9D 3L8YA 2IY7A 5B3AA 3L7LA 2O3RA 4UULA 1MO6A 1QIDA 5TARA 5JQGB 4RTSA 3LC2O 1WB9A 2V9CA 1FRQA 5EQDA 1KS9A 4B17A 1SXJA 1UQTA 2XQKA 3N8DA 4RL6A 5DW0A 1C8VB 4HPJB 2UVPA 3RYCB 4TMWA 4L15A 3D2LA 4C30A 1B0AA 3N2GB 5IDVA 4OIFA 3A32A 3M5DA 3RM3A 3UXYA 1OH5A 3AV0B 1CE8A 1P8JA 4HYEA 3BIWA 4AN4A 1V8FA 2QX4A 2XIJA 4OHUA 1PE0A 3O6VA 4R98A 3G2IA 5TT0A 2XNSA 3GFQA 3ZVLA 3HK2A 6NULA 3PUJA 4A27A 2PJDA 3LUFA 2R11A 4EEXA 3ZV7A 2FP4A 1KAEA 2IW3A 2P30A 5B37A 5K1ZA 1EGHA 1NW9B 4HX9A 4DM7A 1EAYA 5JALA 4Z0TA 3W4KA 3C7CB 4QG7A 1AKWA 4P7BA 2I7XA 1SCDA 1E2DA 1F8GA 2BCJQ 2DVMA 4J1TA 2ORED 4LK3A 4RF2A 4XRRA 1ZZEA 2CHUA 5AYVA 3R7WB 1TQ8A 3TLMA 4ZHQA 1TJ3A 4MUKA 5FUQA 3THXB 5AM1A 1PZNA 2R79A 4N8DA 2Y1KA 3RFXA 2B20A 3WLJA 2O5VA 3ADDA 1EA5A 3QE0A 1O96A 3RVMA 1UKYA 4L0CA 4G24A 4Y9SA 4F4FA 1IBKB 3L4EA 1DBVO 1XDSA 1GV0A 4QRHA 2WG0A 3OMLA 3P9XA 5B1SA 2FCAA 1VE3A 3QFFA 4BFYA 3ZDCA 4FT2A 4JWTA 2I4MA 1GU7A 1YI0A 1M0SA 5ILOA 1WVMA 4CM3A 3X2FA 4JYPA 5CT4A 5C80A 4ZYVA 4XDYA 3DPIA 1BXRB 4FX5A 4PZCA 3N70A 4KGDA 3WICA 2YJ4A 1IDOA 2JFBA 3JVVA 3OLVA 4F6RA 3ILYA 3BCHA 1KQFA 3ELBA 1U9IC 1GPUA 4FE4A 1JQKA 3TG2A 3I61A 3PHIA 2HMAA 2J09A 4TROA 5GONF 2W8BB 1GNSA 1AK1A 1RRVA 2J9FB 3EC2A 5EJ6A 2DUUA 5G41A 4C07A 3ER8A 1VYHA 2FG7C 4HAOA 2J6BA 3B60A 1CULC 1KDPA 1T5TA 2X22A 2AWOA 1U7UA 4WXPA 4BFLA 2I2BA 4IVRA 5MDHA 3WL4A 3I42A 1P91A 2QRJA 2IYYA 2OGSA 2PH7A 2RHCA 2ZJ1A 4ZJZA 5C5EA 4B4VA 3L7CA 3TTXA 1W93A 3PQ8A 2WQZA 3MT7A 3BUSA 1JTVA 5IVIA 3TO5A 3BGOS 1KZ9A 4R2KA 3DEFA 2B5VA 4W1QA 4OOFA 1DHRA 3ZZ0A 3TTYA 1M2JA 2H63A 3GUVA 4HDQB 2EW1A 3F73A 5E1OA 1CIVA 1G5TA 3E9EA 4HSGA 2R7AA 1PTKA 5J40A 2YJTD 4AP5A 2WNHA 4HDSA 4YFVA 4B46A 4REOA 5GIOE 1PLKA 5HA5A 4OA5A 4X45A 1E98A 2YS6A 3SKXA 1IAQA 5CW1A 3TWOA 1HFJA 4RLHA 4RTPA 3PL1A 5HUQA 1GTRA 1JDSA 2XVYA 3QMVA 1A50B 3GAZA 5AICA 1SU8A 2C9OA 4FSHA 1LRKA 3TMAA 3TG8A 3L4KA 4WLVA 2WJPA 3TNDA 1J2TA 2PGDA 3JW8A 4TYNA 2VKTA 4Y1RB 2GR9A 4JLDA 3WGGA 1XTSA 3W9SA 2JH9A 3BGSA 5GVSA 1FA9A 3ENVA 1G20B 4ZAFA 1NYRA 3DDZX 4ASUD 1EXNA 3UOGA 3M1IA 1TMKA 4JKIA 1NFRA 3UWKA 1WXHA 2JJ1D 3RKUA 3TD9A 1JFLA 1RWPA 4DEXA 1J2UA 1PNTA 4UU8A 1GZ3A 1BXKA 4RSHA 2DB3A 4RF4A 4AZ0A 2CDAA 2WWFA 2BEUA 5KDOA 2FETA 1HLPA 4MVJG 2X0NA 1EE1A 1XYVA 221PA 1HYHA 4M36A 1E9FA 2OK8A 4MRAA 4PSUA 5LZ5A 1C41A 3MQ2A 1HL3A 3VH1A 2H92A 3SC6A 1CIPA 2YZ7A 4EJMA 2AJ8A 1SOAA 2F9LA 4K87A 3NC4A 3CO0S 1YIDA 2Q50A 3BOSA 4XH9B 4EB6B 4MR9A 4UMDA 4B3MB 4CLOA 1NNEA 1IMOA 4ZO4A 3DL2A 3NHSA 2PBRA 4JGIA 2B34A 2ZIFA 4MQ4A 5DSXA 2VRBA 3GLSA 5F64A 3PQ7A 4EZBA 1QG6A 2ZITA 5IVDA 1QTRA 2QNBA 3HWSA 4WPGA 4ZQBA 4OSEA 3TZKA 4IIGA 4WQMA 4AJPA 4CMEC 2CLCX 4GKJB 3VKGA 2LCFA 3DZKA 4IF6A 2O2XA 3GK3A 1E4EB 1JJFA 1I13A 1SELA 3A6KA 1FTNA 3IQZA 4L7QA 2F67A 3VAZA 1UP7A 2QAGC 3I9V6 3P9QA 2Z95A 3NM4A 4UUQA 4AUMA 2A2ZA 3T12A 3WWEA 4R71A 1N2SA 1GL7A 3RC1A 3OOYA 1AV7A 1GARA 2XUKA 4G8CA 5FL7A 2EFYA 2FWMX 2RBKA 3QQ5A 1J56A 2CJWA 1NF9A 4D3ZA 4MHSA 3ZY3A 3IP6A 1N5OX 3MW8A 4P34A 3KR0A 5INTA 3FY4A 1GYPA 2WUWE 1V5WA 2G9NA 3ZGLA 4MS4B 4YAJA 4E15A 1O0SA 1D0IA 1E3IA 1Z28A 2PZBA 3OX4A 4A6PA 4TVOA 3RS9A 4CM5A 1NQOA 4XWGA 3PDIA 3UG6A 2I6TA 4BZXA 5AVUA 4ER7A 2FPOA 2NUPA 4GWLA 3O4JA 3EX7C 3HJAA 1NW6A 3QPDA 4YHHB 1EK1A 2B99A 4GZMA 4G1VA 3NBUA 4CUKA 1W7AA 2VNJA 5L95A 3AY7A 3URKA 1NJGA 1AHNA 2GCOA 3WB2A 1OWLA 2YVLA 3PB3A 1JFFA 4N5HX 4Q7EA 4QBIA 1HT3A 1GXSB 1RQLA 2VHXA 4HGZA 2DHRA 3ZDZB 1G2IA 4BHTA 2LCIA 1GRVA 2NUAB 3OQHA 3A36A 2RH4A 1E5LA 3TAHA 1L7QA 1GKUB 1TQDA 1BWRA 2BKUA 2CNLA 3FCXA 4D4HA 1WBBA 3VVMA 1KOLA 2FW8A 1TK2A 1L5VA 4MWGA 4KPUB 4OU4A 5ALRA 5EKTA 4G5HA 4ZVNA 2QK4A 3IAHA 3STXA 4R01A 3HDVA 1Z13A 1TYZA 4CG3A 4X93A 4JB0A 2IYLD 2Q8PA 4B8WA 3GP8A 1PGOA 2BGRA 1TMGE 1IWPB 4ZMBA 5AK0A 4JMPA 1IK6A 1N2EA 1SZDA 2ZAGA 1L7NA 2HR1A 1JTEA 1N5KA 3DA8A 1T2DA 2QZPA 3GX1A 4V03A 1UEXC 2ZSUA 1PGPA 3BORA 2DWQA 3LO5A 1W52X 5DT9A 1MHPA 5FBRB 2W2KA 1LK7A 2P3OA 2WYIA 4WN9A 5ICGA 4TWRA 1BQ4A 2X0RA 2GVDC 1V8PA 2FSFA 2LD4A 3JAWA 1AS3A 1Q0PA 1ZKDA 4U9HS 4Q16A 5JSZB 4Y2XA 2D1YA 2WJGA 3OU7A 4JA2A 5AO9A 4D9KA 5HNKA 1I6WA 1YQUA 4MVJI 4XD7A 1YQTA 3VO2A 4BBPA 5FPPA 3RT7A 2KBFA 2HJSA 3DOFA 4AZ3B 4COKA 1UFKA 3QEMA 2GHIA 4YX9A 3QFCA 1CY8A 4AJJA 1WNFA 4F46A 4PHCA 3CPSA 1Y4AE 1WJGA 4MLDA 1I6KA 2Y0BA 3WFIA 3PSAA 2O0KA 1KZYC 2MSEB 4G1EB 4PPGA 5HZKA 3OURA 2BELA 1PR4A 2TS1A 3SIWA 4CQNA 4NXMB 3ELYA 1IRIA 4FEGA 3WMGA 2WKQA 1YJCA 3NV7A 3IALA 1CV2A 3RKRA 3EEFA 2A1IA 3KSZO 2TMGA 4MICA 2VHUA 2W2TA 4A26A 3HR7A 4MIEA 1YC2A 4RTRA 5G1NA 1HQYE 4NMXB 4YDQA 3SWWA 4EW6A 3M6XA 4HAIA 1EFUA 3U4GA 1CUEA 3KAJA 2VDVE 1I3KA 1KBZA 1N8TA 4NDZA 5EZ5A 3A4NA 1OFUA 3A0UA 4FGLA 4Y2YA 4JXJA 4DZTA 3EUEA 4J1NA 4W8OA 5EJ9A 4JQOA 2CKDA 3G7UA 5DM60 4RPLA 5AVSA 1DE0A 4QQ8A 5JPIA 5F2KA 3L8HA 2DP4E 1AT1A 4OLHA 5AT1A 2BGLA 4XWWA 5JE8A 2ASVA 1VLZA 1K8YB 5MN6A 3N28A 4K6MA 2O8EA 4FVTA 1FDUA 2VNAA 2XA2A 2ZE6A 1UPTA 1GU0A 1WVIA 4OB7A 1NSYA 3QKWA 5A5VA 5I8WA 4L27A 3IAUA 5HFAA 2VK2A 4D8TA 3WKAA 4EITA 1OYOA 3AJRA 4DJAA 4Q7QA 4Z9AA 1LUAA 1VKHA 1C9EA 1T4CB 3DJFA 4NFHA 2H9YA 3IE1A 4OX9B 3FA2A 3Q2KA 3ABQB 4NHEA 2ZRLA 3CVUA 4RK6A 3G02A 1HZJA 2OCYC 3EAGA 3T7KA 1G4HA 2ID7A 1XZFA 5BSKA 1RKBA 2J4FA 1V1JA 5EP4A 2WQ6A 1QMPA 5KTRA 3TW8B 1O89A 3L4JA 4UASA 4GFDA 4KX5A 4Q18A 5CH8A 2R6GA 1D7OA 5AW3A 4NV1A 1IK4A 5ERGB 5B3LA 1JZTA 3GUUA 2JCBA 2PZAA 4CDNA 4HDNA 3RYHB 3GLGA 1VHLA 4Q00A 3QVWA 4U9IS 3ZJVA 4IDDA 1D6MA 2WHEA 2QW0X 3ISJA 3LRXA 2YVKA 1LU9A 2MSDB 2VJDA 2ZXEA 4J7CA 1VG1A 1XK7A 3LU1A 2A5JA 4W5WA 4I46A 3ZE6A 2BZ1A 3FPBA 3TLGA 4Y7CA 1AKVA 3ZY6A 3ADKA 3WYNA 2ZWOA 5ALIA 5A3JA 3QG5A 2SCUA 5GV7A 3F49S 1LVHA 1YDWA 3KT8A 3LZ6A 2OGUA 2QTBA 3FVWA 4RLSA 3S2UA 5LN1A 4WWHA 2ZB4A 2UYGA 4MULA 1ZN8A 1G7CA 2VWQA 2XSZA 2ZBQA 4ND5A 5JZVA 1CW2B 2GFQA 5ADVA 1XP5A 3PUKA 4EKEA 1DJPA 4V0RA 1ETHA 4MTLA 1T3SA 3CZQA 5G3YA 1KP9A 1W2GA 3RASA 1E62A 3BMNA 3DAHA 4GVPA 4RQTA 2FEPA 1W75A 1MO3A 4DL9A 4YXWD 3TECE 1M8PA 1OBVA 1F5NA 1MG5A 2B3TA 2RDMA 4TSRA 2DECA 4WLEA 2IBMA 4J7AA 5ENZA 2X14A 3M6VA 4JI3B 4DB4A 1J25A 5JARA 4JR0A 4DUZB 1NLUA 1X8LA 1B4DA 2AC4A 4YRRA 4IMPA 3T9DA 1NVVR 4MPJA 1RTKA 5CJPA 3ABIA 3QWFA 4R1PA 2P3QA 2ECOA 3M4YA 4MGYR 2AF4C 4OYLA 4QOIA 1BJRE 4I9HA 4N0EA 4YDSA 1C1DB 5T8KA 4ZDKA 3WG9A 1NQ5A 1SIUA 2H4HA 4RNDB 1XF9A 3QTTA 1WULS 2O48X 3V8VA 1JJVA 4FR0A 4M55A 4ZAVA 1QH0A 2A35A 2DJ5A 1C9NA 3FDFA 3RVRA 1E6EA 2QE6A 5KVAA 2FFJA 1U8AA 2ZS8A 1H69A 2EARA 2ADMA 2FQXA 2GMWA 3GD5A 5J58A 5J4KA 3OCUA 3TLBA 4LNUA 5L9AA 1UMBB 4IFIA 2YHSA 1GAJA 2ZAMA 5EXTA 1GL6A 3BX1A 1QTIA 3TB4A 2YBDA 1Z4LA 4XQGA 3SOZA 3TTVA 1Q12A 1Z5ZA 2H6EA 3VZSA 4D5EA 3VDMA 3DBLA 2GEUA 1Q6ZA 2G77B 5LIRA 1W5SA 2ZSHA 1FDSA 3A4IA 2JB9A 1TECE 5CT6A 2P62A 4IIEA 5EY5B 2OXEA 3EAFA 3V7NA 2OQIA 3ZKAA 3CZ5A 2D6FA 5GADl 4HWGA 3RJ5A 2FPPB 2VUUA 2YXBA 3COPA 2PPLA 1Y63A 4GG1A 4YRCA 3EDRA 4EW1A 4NENB 1ISJA 3AF1A 4CV1A 4J7XA 3SICE 3K0HA 3SR3A 4M9CA 4FM9A 2ZE8A 1JI0A 4XXHA 1WQ4A 4W63A 3QI2A 5C5CA 4H18A 3EFHA 5LR6A 1BVUA 2Q7DA 3UXEA 3WQHA 3THYA 4LXUA 1NFFA 1ZCBA 3N76A 1E1MA 4NBVA 1J1IA 4OJKA 3EZFA 5K3FB 3U7HB 1QIMA 4BEJA 3C3AA 1P45A 3KKQA 2I4NA 1FBTA 1T8YA 4BBJA 3PPWA 4C05A 3O94A 2J5QA 4MUIA 1RXVA 2ACKA 1T3ZA 2LTAA 1FRZA 2RHOA 1G6KA 3GJQA 4AD8A 3C8DA 4H6WA 4NE9A 1SG6A 4KC0A 1CUHA 2W6IA 1H42A 3BCUA 4PYMA 4TS3A 5ULLA 4JX9A 4A8JC 4TWBA 4II2A 3WO0A 1M7HA 5LBIA 3RW9A 4A6EA 5A9SA 3PWZA 1RCUA 5EJGA 4WN3A 3DVAB 2BM9A 4EGJA 5CK4A 4HKTA 3WC4A 2NXWA 2GLTA 4LW8A 2I65A 4E7PA 3M3HA 3OOHA 1H0HA 1FFWA 3PTZA 4NXNB 1HFWA 3UENA 4IXDA 1BKSB 4UFOA 3L5OA 1Y8CA 8AT1A 2Z3WA 4UEJA 4IIUA 3ME5A 4RPHA 3MSXA 5B6PA 4KMSA 1B6RA 4QICA 3L49A 2A92A 2JARA 3SEAA 2WJZB 2K6GA 5JEEA 1ZH0A 3I9FA 1I1NA 1NR5A 1QCCA 5TE9A 2JRCA 3AEQA 1RLOA 1VHWA 1SRQA 1XJQA 1ESNA 5TGTA 4YMGA 3MWKA 1RHKA 2ZIAA 2TECE 1NN1A 2I22A 3MTGA 1SR8A 4HGRA 3AZOA 4G36A 2IDKA 2OHXA 1XQWA 3QW4B 1QQAA 5AHOA 4INOA 4NYMR 5IYZF 2EZ4A 2EJVA 4EPXA 3PTAA 3R6WA 3DDSA 3ACDA 2D0OB 1D4OA 4K8OA 4OL0A 4J8PA 3SKVA 3GGOA 3AL2A 1A04A 3GFFA 2QXUA 1BKDR 3UCFA 4D74A 2BR5A 2W22A 9MHTA 3IQGX 4G9GA 1E1NA 2DWPA 3HN7A 1T9ZA 1Z7WA 1I1QB 4BWFB 2EDAA 3NALA 2C9DA 6REQA 1XNRB 2L0XA 5ES3A 1WXFA 5KPJA 3FTNA 4TLAA 1OLXA 4GYKA 3A06A 4QBGB 1FVHA 3SFTA 2QTWB 3P0RA 3O9MA 3GZNA 1U4NA 2XRMA 2WFMA 5E3IA 3Q7IA 1S8OA 4IP0A 5H3HA 4F12A 1CYEA 2QP3A 5EGNA 3SXUA 2AKEA 3B85A 4G8JA 3K9CA 3HJCA 4GZ6A 1IHDA 4BGDA 1DX6A 3L41A 5G53C 1H85A 3K5WA 4U2FA 5CDFA 2QEQA 2FWAA 1TIKA 3C5EA 4OHCA 4TRJA 4UZEA 2GK6A 3WK6A 4ZFNA 3P5SA 3V33A 4U63A 2I66A 4GVXA 1YV9A 2PXAA 1JAYA 2DTXA 2QTMA 2XCLA 3QVTA 1HRKA 1PEYA 3I53A 4WESB 1RCFA 1OSNA 4QFCA 5E7MA 3UPDA 4DLVA 4YLYA 5K0TA 3G6KA 3GPIA 3QVMA 1I2ZA 1Z36A 4TV9B 3TEMA 5C4MA 4JB3A 3ET4A 3R75A 3GZJA 1PD1A 1TAUA 1Q5PA 1OT5A 4YMLA 5ITWA 4OB8A 4F4DA 1W85B 2VTVA 1EZ4A 3PIRA 1E3WB 2YYZA 5LD2C 1QVRA 2GS9A 2R65A 3ILSA 4BMOB 4P4SA 2AUMA 3DTVB 1D0SA 3L4BA 2DYKA 3WGTA 1JR2A 4Z4HA 3KSBC 5LBTA 2WUEA 3FFBA 4Y9RA 2AN9A 3ZDQA 4RANA 4U5XA 1E3QA 2WEKA 4ZCQA 4OHRA 1SEPA 2IEAA 3D0OA 5AKJA 4R8RA 3M1AA 3HA7A 2I8CA 3GRVA 4TT3D 1MH1A 4DV4B 3DEHA 4TYMA 5HRAA 1ZIDA 1Y1RA 2QVYX 3OP4A 4O4HA 5K0ZA 4CXMA 1NVKA 1GTG1 4IJVA 1REQA 3CVOA 4V0KA 1FJ2A 4ACAA 5C52B 4M76B 3WFZA 3W2FA 3RK4A 1XYYA 3L8DA 4Q37A 3BMCA 5HZGA 2FZGA 4KQEA 2HV9A 4MVYA 4RCZA 4URXR 1WKBA 1Q7GA 2B1IA 3KALA 5AM5A 4ASUA 2J9ZB 3QWHA 2VUSA 4HUJA 4RK7A 1XVVA 4CKBA 5JSQA 1MQAA 5D6OA 1E1RD 2JJ1A 4BMSA 4JC8A 2XB6A 1MA0A 3W7AA 4U6NA 4XGRA 2DFTA 2ZAOA 3DQPA 4M21A 5DN9A 1FRFS 1OYVA 3CLTC 4Q82A 1FDWA 4HQKA 4G0VA 5FDFA 1KL7A 3DULA 1H8ED 2O0LA 2XTAA 1NL3A 1Z07A 4MUNA 4DUGD 1GKLA 3LBYA 4F2HA 4I4TF 1R0BA 1KNXA 2R00C 2H9AA 1DIHA 4ND1A 2O3SA 4GC9A 2A57A 3KYCB 4Z9XA 1GQFA 1I0LA 2H59A 1B3RA 2XTZA 1LLQA 2OWDA 4MUFA 5DRTA 5EHXA 3CZRA 3MELA 4C4SA 1POWA 2VWPA 2WIJA 3GT3A 4PPNA 1Z6PA 5TQJA 3ZNQA 1TEXA 3R3SA 4YUAA 3N6RA 1II8B 1NHGA 3DE1X 1VJDA 1ITZA 1FB5A 2F43B 4N12A 3I64A 4R3NA 5EJFA 3VHXA 1PUIA 4L8LA 3T8YA 1KI6B 2G6BA 3EY9A 2BGGA 3IO5A 1WU7A 4GF5A 4O4JA 1NVFA 3LNTA 5SY6A 2CUKA 3IQXA 1UBKS 4QDKA 3D1LA 3R7AA 4JJAA 3I6MA 3ZE7A 5BR4A 4JP5A 4X3CA 1YASA 1ZC4A 5IZ4A 1ZU4A 2GN8A 3FRHA 3NH6A 2JI7A 1RJWA 3WLIA 2NVBA 3VR4H 4TKUB 3TNYA 2G7MC 2XQIA 3VPDA 2FQYA 1DO2A 3GFVA 5KWEA 3OZXA 5E1BA 4YPVA 1OAOC 4A1OA 2IPXA 3HADA 1QORA 2BFEB 3F2VA 1UR5A 3FPGA 3GIWA 3MXTA 2HH9A 5J9FA 2BDTA 3NVDA 2C3UA 4LXYA 4IZOA 4A2QA 4DV7B 3V42A 2MHCA 2QE7D 1S01A 2ZJBA 2JAUA 2PAFA 3OTGA 1TCUA 2CLMB 3U17A 4ETNA 4ZYXA 4YRIA 5TJHA 3UWOA 1N9GA 2IHNA 4OYHA 4IXWA 1K92A 3DBOB 2JLVA 2J4DA 3TJMA 4EHJA 2Y0EA 4MS1A 4LYHA 3K72B 1YFKA 4ARUA 4RD6A 1ULHA 1U7WA 2OK7A 5K7SA 3SBOA 3ZIUA 3GFRA 1PR2A 4P9NA 1U2ZA 5ANRB 2HU8A 2V96A 3CT6A 1G5QA 2IDJA 1DTEA 1PNOA 2BMVA 4D9JA 4X8LA 4PBTA 4EA9A 4YP5A 4BOYA 4LY6A 1YQWA 2GRUA 4FFPA 5GMOA 7ABPA 1NXOA 2GYWA 1U28A 2I0FA 4YRKA 3LHFA 1DQZA 4W9NA 3QF7A 4Q21A 2BVNA 2OT3B 2R3SA 4IZHA 5I7OA 1L4EA 2VP2A 2WTBA 1NY5A 2IH2A 3CBGA 4L9WA 3GGGA 3GRKA 2RE8A 1Y34E 1XA3A 4UU7A 1ZSNA 2GPJA 3UB2A 1WKVA 1C7IA 1XTUA 1OAKA 3NTVA 4AO6A 1H5UA 1P7WA 2BSXA 4BP3A 4YR9A 3N3AC 3DMDA 1YTLA 1NU8A 2DQYA 3B3GA 5AWFC 4RIEA 3FUXA 3HKCA 3LKVA 4G1FA 4CVNA 4KYVA 1UPUA 3QPVA 2AOXA 1NMQA 1U3TA 3OETA 1PQUA 2VJBA 4O2AA 5K3CA 5EIEA 5AW0A 3RRJA 1M1NB 4FCWA 2DT8A 2LDXA 5K4HA 3A7EA 3QWBA 4UW9A 3AUJB 1GD1O 3OX3A 3W3AH 1PDOA 3QU5A 4RKYA 1I2MA 1S3SA 1EEXB 4H4EA 2B9EA 5J2TB 4DLKA 3HN6A 4DA7A 3VPBA 4KOEC 1BWPA 4DABA 1WX1A 1N2OA 3FH0A 1XJ0A 2P6RA 3AI1A 1O6FA 1LCIA 1U5BA 4CTNA 1TO2E 1G5RA 1RR6A 1WXEA 1FQOA 2UV8A 4RE6A 2EF0A 1SC1A 4BPBA 3HYNA 3JSAA 3QV2A 4GOMD 2ZJ6A 4DN6A 1A8IA 1HYQA 5M7EA 3QVOA 3PD0A 1UCFA 4P3PA 2XT6A 4RK4A 3SX4A 5BWLA 4G5OA 5AJUA 4OJTA 2BR4A 2FLWA 3ZE9A 4CMCA 3GWZA 3NOQA 1T1IA 5GV8A 3G7NA 2RAUA 1VXOA 1E2EA 2AEEA 4FJ2A 5BVHB 1NVVQ 5ECDA 1NOKA 3AESB 2JAXA 3DEZA 4D46A 2PUEA 1JYFA 3ZVMA 3PI6A 4R9VA 3WGIA 4D0LB 4L3WA 4QTUB 4TV8A 2XXAA 2O5CA 2H0AA 1XKLA 3GFBA 1P3DA 1Z0SA 5D51S 4KXVA 1YACA 1Z15A 2O06A 6ADHA 1W46A 2JGRA 4DLZA 1J9GA 3ECAA 3HABA 1WUKS 3PBKA 4PYKA 5HRUA 4DBLC 4AJNA 3SJUA 5DNDA 1RXSA 2C8KA 1GNPA 1UQRA 1XTTA 3HV2A 4HNAA 4J03A 4QXMA 4FLMA 3SXJA 3PXBA 3DHWC 4R8SA 1V35A 2AYZA 3H5AA 4INAA 3SDSA 4ZEOA 4B40A 4CMKA 1G0OA 1Q1ZA 2DY0A 5CGZA 3PFKA 4BNZA 3FMIA 2PUFA 4ARZA 2ZPAA 3HRIA 1GITA 2HK9A 8OHMA 4I4IA 1SURA 5F3WB 1S2DA 3ESAA 2OFWA 4JIMA 4UMVA 5AI0A 5KNCH 5JSYA 3T15A 3A4LA 3JAKA 1DARA 1XV5A 1AN0A 2EGGA 2EOAA 3BD8A 3KB1A 1KO8A 2BMJA 3KL2A 5AVZA 3SZOA 3Q3GE 4IMRA 1IPHA 2QLNA 3GG2A 2JLQA 1SOWA 2VJMA 1UODA 1S3FA 1EUYA 2W2XA 3EK2A 1OH8A 2BTQB 1P18A 1P3Y1 1BHJA 3E1KA 1N34B 4GXTA 2RGEA 2K2QB 3QHQA 4F1KA 3OOSA 4CCYA 3PF8A 2ZJ8A 4TM8A 6CHYA 3CX6A 2OPHA 1V0JA 3JWHA 3HMQA 2K7ZA 5AKIA 1JLRA 1NG1A 3H0CA 1XALA 4IDNA 3H8JA 3QJGA 2OO5C 1SBZA 3OZFA 3A0RB 4MQ6A 4ZT3A 3W5DA 4ZTBA 1RYBA 3IBYA 1T9GR 4PQFA 1C3EA 4IEIA 5FX2A 3UANA 4MKXA 1SUBA 4N4AA 4TYQA 4UEKA 4A0FA 2IX9A 4QTYA 2HCFA 1GPWB 1TUGA 1EVQA 1R8QA 1A4UA 1E1LA 1CK4A 1DL5A 1Q6YA 2AR9A 2CW5A 1EX9A 3G2HA 4ZOEA 3GD7A 4QEZA 1GQQA 5B3JA 3GLUA 1L5OA 4L74A 1ZMBA 4I55A 2A0UA 1P9RA 3O92A 4O63O 4OXYA 1BFUA 4QYIA 3SP1A 3CKKA 1CUAA 4J0QA 3W04A 4WBNF 2E6KA 1TE2A 2ZI6A 4PV7A 3GEGA 1J20A 1TZBA 5FHQA 2X42A 4ZVSA 4QUHA 5IG2A 3SHFA 2VDQB 1W4CA 3L46A 3AR4A 5TS2A 3JD4A 1RLUA 2NQ8A 4KRYA 1PV1A 1KYZA 1S2NA 2CDRA 1V4NA 2QROA 1ULAA 2REQB 2V4ZA 2XGSA 3E18A 3EXEA 2XQJA 2C1EA 4JVLA 4MLZA 5KSZA 1WOMA 3CNOA 5EZQA 4UZFA 1RHUA 3BTUA 1BMTA 4IHJA 3FYUA 1H3NA 1UDCA 3IHWA 3O91A 4RABA 1UM9B 1YKFA 5AM3A 1UF9A 1U6KA 3MTEA 4CLXA 4M9ZA 3IDFA 4YXWA 3U13A 5DGIA 4XX1A 4YPFA 2BEKA 2WJ3A 3KXLA 2AR7A 1C3OA 1K2VN 4X7RA 3BRSA 4I4CA 1PR9A 3HYRA 5IULC 1CUBA 1YIOA 3TRHA 4MWZA 2XECA 1AKNA 4TL6A 1QZ3A 2PLRA 2OD2A 2QGZA 5EGSA 3VR6H 4ER3A 3WKBA 4YT4A 4FKBA 5LB4A 2XY4A 5CX4A 5PGMA 5EXPA 4KKVA 1LPBB 3OHSX 2H4FA 1VBFA 1T6XA 2WMOB 3AMVA 1TKCA 2B2XA 4R3WA 3ANXA 3T0IA 5CB4F 2J30A 1U3WA 2WYWA 3AIKA 4UFNA 2NP6A 2ZKIA 4GQIA 1A5TA 2DSNA 2AHOA 5P8WA 4B9EA 1NC3A 1NULA 3QITA 4OQPA 4KREA 3ZLBA 2XR1A 3LKBA 1RYHA 5BOSA 5CNMA 4L8FA 4EQ6A 4YRZA 4IF4A 2OV1A 5HJ2A 2GD0A 4FFOA 4GOND 3ETHA 3KTAB 5IC5A 5JWHA 3PQ2A 3VPXA 5CK5A 2C3YA 1K4YA 4UHFA 5LQAA 4YRPA 1YTUA 2QM7A 4IILA 3U3JA 2Z5VA 4Z8YA 5F73A 1X1CA 1IHYA 1R5NA 1YCFA 2V97A 2ZSIA 3JASA 1SOUA 3GRZA 4K9NA 4MMZB 5FWXA 5I4CA 2Q6OA 2FGJA 1T8SA 1UH5A 2VF8A 4JB8A 4IX1A 1B00A 4XCVA 4YRTA 3IYLW 5A4MS 4YAUA 3T5DA 1VCNA 3IDOA 4XB2A 4DRZA 5HKOA 1GU1A 1RXCA 1ILWA 3BEDA 5CYFA 3S2SA 2CVPA 2XCSB 4EHBA 3IEIA 4A92A 4F9EA 1FXWF 2PS0A 2O2DA 2B0CA 2F1RA 3F2IA 5E9JA 3RS5A 1ZH8A 1OVMA 4GGPA 4PC1A 1GYQA 2PAAA 2DOKA 2CHQA 4FQ5A 1YKSA 2P90A 4B73A 3CWZA 4H1WA 1RXWA 2GKGA 1IULA 2VNHA 4DJJA 1KMCA 1XZGA 1WDKA 1Z18A 3EIQA 3R0VA 2R2GA 3ANSA 4RACA 3N75A 1K8QA 3G0GA 2FR8A 3C24A 3O7WA 2EVWX 5EHIA 5A7GA 4XPIB 5IH7A 1C0PA 4MWDA 4PGGA 1TO6A 3DZHA 2H07A 2ST1A 1W94A 1U3CA 2CNOA 3UMVA 1H2EA 3DWFA 2CVHA 1T6BY 2OCLA 4XM2A 3UCXA 1NG9A 2ZFUA 2J45A 4W6QA 1WHSA 2OZKA 4KO8A 5CVTA 4KE8A 2AFVA 1D2EA 2Q3BA 3ODPA 4KXUA 1Y6QA 3H9QA 4TLEA 1A8QA 2ZIVB 5EJAA 1XQ9A 3HPRA 1NX6A 5BSUA 4EMTA 4DEVA 1RYZA 1JFVA 4RJIA 3ZHXA 4KXNA 4LI0A 4UMFA 1U9IA 4C9BA 2ZVQX 2W4IA 3EUFA 3EYAA 4U00A 3WDLA 1HF3A 4NS1A 2QHXA 3FDZB 4L72A 4XI9A 3ZW9A 1S8AA 4I0WB 5DX1A 2A5GA 4HN2A 3TLKA 4NCAA 3VR5D 3P9CA 4FI3F 4NS4A 2Y1EA 1O58A 1R9MA 5B30A 3H3FA 3KWFA 5NULA 2ZANA 1D2HA 1H2FA 2ZRHA 3IH5A 1XVTA 3IAXA 4UCQA 1KQNA 4PZDA 3AEUA 4V1CI 5ALZA 3UKOA 3BJRA 1PO7A 3DHEA 3WWDA 3ED1A 4Z4GA 1U5AA 1F2TA 5FORA 5IAEA 3ZVRA 5K8VA 2OC9A 3Q1LA 5EYPB 3DMGA 4NNOA 5SY9A 1YVRA 3RBVA 1YDGA 4G65A 2JPDA 4R84A 4U4AA 3VV3A 2SKCA 1RFLA 4B82A 4OM8A 3DYIA 5CDGA 1NXVA 3C8MA 4IXMA 3BMQA 4W5QA 1CWUA 4F97A 1EUCB 1DG3A 5BW8A 5KSOA 3THWB 1J6UA 4PO9A 1I3LA 2P2GA 4H7JA 5BQXA 3T1OA 2GPBA 3OWXA 4YJ3B 3LQ1A 5JS8A 4LZOA 3AW9A 2FTKE 2ACVA 1SGWA 2FOLA 5CG1A 3B3FA 5CAEA 3WRYC 1EFAA 1JG3A 2JCSA 1BMFD 1K88A 2RH5A 2ZR9A 3FLBA 4FJ0A 4QAQA 4ZI5A 3G2KA 2VTEA 3F3KA 1JL3A 3SAJA 3O1JC 1LK0A 3WI7A 2AZMA 3GDHA 1HORA 1VIVA 3NC0C 4M6WA 4L0QA 3SC3A 3WDMA 2QS9A 3G23A 3NX4A 3KL4A 5B36A 5IM5A 4M1WA 5AM4A 4YO8A 4DWOA 3VNSA 1U8ZA 1Y7TA 5KX5F 2WI8A 3NEPX 2OD7A 2QF7A 3PIDA 1DO0A 5L6MB 3RC3A 2XMGA 4XR9A 9ATCA 1EVKA 2C9MA 4AL4A 1MTZA 5T5QA 4DMLA 3A28A 1AKYA 1XQYA 5LXTF 3M2PA 2VYQA 5I9SA 4EZEA 2C5LA 4ZEMA 2V4UA 1XOIA 3D6HA 3CURA 2POCA 4LOLA 3ZBTA 3ZQUA 1E1CA 3M3PA 4F3TA 1XEAA 3WLEA 2MINB 1N2ZA 1TYDE 1VPLA 3DNMA 5T41A 5IUJC 4L6AA 2ODWA 3U44B 2EJWA 3IQHX 3MJSA 1VI5A 1PWYE 3CR3C 4OL9A 1G64A 4U8HA 2DFLA 4WXMA 4JROA 1G3RA 4QODA 4PG8A 3A6PC 3UW1A 1G63A 1RAHA 3FNBA 4CMEA 4DLTA 3ASUA 3O4HA 2RIRA 2AT1A 5DF1A 4XOIA 3HCFA 4PICA 2XMBA 5DULA 2XMDA 3W5UA 1LSSA 3KVRA 5TVKA 1SCJA 1UXOA 1Z2PX 4KLCA 5AVJA 4A6XA 2QLFA 4KO1S 5SYAA 5A6SB 2CK3D 2QAGA 4ITRC 5EWLB 4B80A 5AUQA 2XYPA 1G6Q1 3HJFA 1PR5A 2H7CA 2PGXA 2UZ1B 5FFFA 5FNVF 1U7DA 2W6OA 3NVAA 4NARA 1RM0A 4WIAA 2FXVA 3PE3A 3UYKA 1N3IA 1N8SA 4ZJPA 2DJIA 1FMFA 2JFOA 3TJZA 1GCGA 4OKIA 1J2RA 2E7ZA 2VYND 3HXKA 3LGAA 3RAPR 3K0BA 4B6EA 4FHFA 4GI1A 4WKBA 4MQEB 1Z5PA 5LNK1 2EBHX 3UZUA 1ZKMA 3W6PA 1W0CA 2C5GA 2JLCA 2Z0MA 3HY6A 5JIBA 1OPRA 2VPXA 5KOJA 3B1XA 3PQFA 2CFCA 4ID9A 4TT3A 5EP2A 4DG9A 4WOBA 1L8QA 3I23A 4RKQA 4N48A 3ER6A 2RGYA 2JFXA 2IHTA 1C14A 3RRYA 2J5XA 3NHRA 4P93A 4ZJUA 4QHTA 1P9OA 2H8KA 3KT0A 2WSYB 3CVXA 1PL7A 2B1RA 4XUGB 2HA0A 4CEJA 3H2KA 5H80A 1KR2A 2F17A 4E46A 1E5QA 4R0MA 2MJLA 1E1RA 1Q1GA 2ZIZA 5CPBA 3JCZA 2HCBA 3AERA 3E2PA 3MTIA 3ANLA 2VQ3A 3L0SA 4O8ZA 2JGEA 3VO8A 3CISA 1PV4A 5ALFA 2YNMC 4E6PA 4IUBS 1H8EA 3QLEA 3EXIB 3QPUA 2QTFA 1VE1A 4DUGA 1ZX1A 1NQAO 2VH1A 3V8BA 4DPLA 3RT1A 3ENZA 4PG6A 1AMNA 4FCCA 3DKVA 8ATCA 2ZT7A 3VDNB 2QZZA 1TTPB 5JD6A 4QXAA 3C3YA 3IVRA 1Y8ZA 2GEKA 1JW9B 1JU4A 5ELLA 2ZAYA 1DC6A 2CUNA 3L6BA 4F5ZA 4NCNA 4E5UA 4LHYA 2JNWA 3OIUA 4LSGA 4B3SB 4XUEA 2E37A 1QKIA 1VA5A 2CZGA 5EAIA 3OCWA 3WLNA 4AJLA 2E4WA 3GI1A 3RREA 1L7OA 3RBZA 1C30A 1RWBA 2DPHA 5F7JA 4G0ZA 2W2MA 4C04A 4YB8A 5A4IS 5JLJA 3K4HA 3RAJA 3UJCA 4EX7A 3KZXA 5CYOA 3ZWQA 3FTPA 5JS1A 1CERA 5IDYA 3DV0A 3UKJA 3L1IA 3CCBA 3WTCA 4QG3A 2IY8A 1ZOOA 4EWLA 2DERA 1K6JA 4AY4A 1MFZA 1A8SA 4MP6A 1TKAA 2AZTA 2ZBFA 3JYHA 3TD6A 2ASEA 1ZOPA 4O2BB 4QXQA 4CHGA 4QUDA 1UBSB 5MN5A 4IIJF 3OZRA 1K8XB 1HMPA 4I50A 4OHOA 3TUZC 3D9QX 1XZBA 3IERA 1Y9ZA 3LQFA 3ORSA 4MI6A 2QE7A 2NU6A 4FHEA 3NUQA 4HL6A 4UUPA 5HKBA 5FUXA 3HJTA 2E5LB 3X43A 2C92A 4XYMA 4QEKA 1QH8B 3AJAA 5G2OA 4MW4A 5A4KA 4YI5A 3KD2A 3DUFA 3DOUA 3HFRA 1N2GA 3HC7A 2PLAA 5WRFA 3R74A 4L50A 3MUEA 3ON5A 2ANCA 2LE0A 2A14A 1ZM2A 3LK7A 3WHPA 1S0UA 1I1HA 3N87A 3R7BA 5A03A 4U0KA 1V11A 2F62A 5L7TA 1P6UA 4PS1A 4ZOCA 2KE5A 2QYTA 2XYQA 1EP2B 1QO7A 5CM2Z 1G16A 3EXFA 4BO8A 2ZU6A 2P9ZA 2CHFA 1R4NA 1OI3A 2HA7A 3GGCA 2PGNA 3IEPA 3TGWA 1KDRA 2XUGA 4DMUB 3QBEA 1HQCA 4O5OA 4OU5A 3TTSA 1LWNA 1AXGA 1DVRA 5C35A 1Z68A 2EHDA 2GYUA 3AHIA 2Q3JA 1BROA 2VRWA 4Q7JB 2WJWA 3KJFA 3V2IA 4G4SO 1YZFA 3GCWA 4KXMA 5KVQA 5B7QA 5A0TA 3SQNA 2FKAA 5C18A 1R5BA 2CEKA 4GPAA 5FAKA 3GMIA 2DPMA 1GFZA 1DRWA 2NV2B 2Y8EA 3I5UA 4XYBA 3U3OA 1WZEA 3DAPA 3VC1A 3ZX5A 5KEIA 3H75A 4GS5A 4R0NA 1LTKA 2AOVA 1I32A 2BFAA 1VB5A 2C4TA 3EZ7A 5AW5A 2W0SA 4BU0A 1EFTA 3BMOA 4G4SP 2R47A 4R8KA 4HX2A 3LUKA 3H9EO 3IILA 1M8KA 3D3NA 1OQAA 2AA3A 3CNBA 1HNNA 4MUBA 4F6LA 1K4MA 5J43A 5JQGA 2P6UA 1UXIA 4QQKA 1TYEB 1JHUA 3GDWA 1M2OB 4JLOA 2ZWPA 3MTBA 1Y1TA 3O3CA 4RVOA 1L5LA 3ZNOA 2FEAA 2QX7A 3QJ5A 1HDGO 3EAQA 4OXKA 1DUIA 4QU8A 3RRBA 2UUCB 2BGNA 2QLTA 3H2JA 3OPXA 4ZAYA 4D8XA 2I6QA 4BJHB 4NG4A 3K6SA 4ZKEA 3E9RA 3KLBA 5LYJF 1K3UB 3VZDA 4FYPA 3RHSA 4URHA 5FBKA 1GOTA 3FETA 1QZUA 4KBFA 2PX8A 3JTMA 1YS7A 2AN1A 5CGQB 4GVLA 7ADHA 1KGSA 2AFHA 1K86A 1M6YA 3WHLA 4N6OA 5IAAA 3WLMA 4HQ6A 5AQ1A 1HETA 1LW7A 3SY8A 2B7BA 2HWUA 4LGVA 1GGVA 3ZI4A 4UHEA 5F7OA 2ZRPA 1WR8A 3NAZA 1U0OC 4LRSB 3TCXB 2AI1A 2QTRA 3P0JA 3WMWA 4BJ6A 3R7WA 5BN3B 1QYCA 1U3FA 5IM4F 2ZYAA 1LC0A 3THXA 4BLSA 5L8VA 1NAHA 4AG3A 4JS0A 4F8JA 3KOZA 2G80A 2OAEA 5IAJA 4XASA 5TEWA 5JMTA 2JH8A 3LWNA 3A70A 3C85A 2P11A 4KJXA 1UPCA 4KQCA 5EIBC 4MRRA 2HW8A 4TL8A 4X1IB 2PUWA 1XSEA 1A98A 2W6PA 3G0IA 2RHGB 2VDPB 4R16A 5KCZA 1I9CA 4XX0B 1YOBA 2WE7A 5BQ3A 4CQMB 2WVHA 1U0SY 3CEJA 5DNCA 3AVUA 2KLBA 1AUQA 5E38A 1D5WA 3N8HA 3WRXC 1QVVA 2EKLA 3UAZA 4IDPA 4LBYA 1TM3E 1Y1SA 4KIFA 2X8BA 2I03A 1R8SA 4UNSA 4PZLA 3A6GA 1M6HA 2QG4A 3MWYW 4AF8A 1LBTA 2FSUA 1QFXA 2QM8A 3OTIA 1MAHA 3PA8A 3Q9UA 2W8BA 1I7LA 2J9FA 4PU0A 4BVBA 3H1FA 1Q11A 3C70A 2BFCB 4M9UA 3LQQA 1EX6A 4DUPA 1NLZA 4RZSA 1H6DA 2OSBA 2LCQA 3FPCA 3RJTA 5CIYA 4M0EA 3R5KA 3ROXA 2IYAA 3KHSA 5HW0A 3PQ5A 4QNMA 1HLDA 3FNFA 4K7JA 5AK4A 3QLUC 3LDGA 5B7PA 5CBPB 2Q5OA 3EN0A 4RSGA 5BMOA 4KQFA 1F6WA 3NTOA 5FA5A 1Q1NA 2Z58A 2R60A 4Z9FA 4ZCSA 4CF7A 2VDUE 1X94A 5GONB 2IYVA 3DTVD 3HM2A 4DANA 2FDXA 3TNFA 5DGCA 4ZV7A 4QC2A 1EJ6A 1RRMA 1MC4A 3ZCVA 3FWZA 3PDCA 3E58A 3U26A 3OQIA 1AIPA 2IT1A 2QMOA 4KUHA 2ERXA 5JZMA 2VAXA 1U9ZA 1ZU5A 4HB3A 5LA6F 4X7PA 3EPJA 2Q5IA 3FCEA 1D4FA 4OREX 2XB8A 3H4VA 1KH2A 4MUHA 3WIDA 1NLYA 5F33A 3KU4A 5D5PA 4R9NA 1E3EA 2PA3A 3GPBA 4TRMA 1OIVA 2QPOA 1I5OA 1AM4D 1ONSA 1TB4A 2VPPA 3OC6A 4CF3A 2YIDA 1BDBA 1YKGA 2IVFA 4H4CA 5AHRA 1N4DA 2FI1A 2ZS9A 3CF2A 4IH4A 4OV6B 1U0TA 4Y1RA 3K70D 2YOHA 1NQWA 2D5IA 2E2WA 1G20A 1S1CA 4B9AA 2CLIB 5I4IA 3PK0A 5FKJA 1VMIA 4L9AA 1A2QA 1RRPA 2O2ZA 4RJLA 4BYGA 3OKFA 4W82A 1CB7A 3C1AA 1NR7A 1C8LA 2I62A 1NBEA 3B8EA 4XWTA 4NMWA 4PYOA 1ZR2A 4RIHA 4MA4A 1LKZA 4UTXA 4YHBA 3VTFA 1FX1A 3WBKA 1X1RA 5J4HA 1L4MA 4LJYA 1SXJE 3QM1A 2XTNA 4Q01A 1W36C 1NLFA 4N82A 4MIOA 3JWJA 1UMCA 4KO4S 2AOWA 4FSDA 4Q6WA 4PLHA 2ZGVA 5AI8A 2GX6A 5H8WA 1SN7A 2RHMA 2RI1A 5HZMA 3KKEA 3FR7A 3NO4A 1QYRA 4UTZA 3FGPA 1CJTC 1O6CA 1GPLA 3EE6A 5H0IA 4EB6A 2ZYTX 4DCTA 3AEKB 3DMYA 4AECA 1I7DA 2HRCA 2IU3A 3B13B 5KYXB 3ZUGA 3A3OA 3F7MA 3VYRB 3A3NA 4ZI2A 3WA7A 2P9EA 3D0RA 2EJTA 2JLBA 4AJ4A 2Q9AA 3F3YA 3EMVA 4H17A 3RAFC 4TYWA 7YASA 4TX1A 4RQAA 1JVNA 3OT1B 1QB8A 1E4EA 1R4ZA 2P9YA 1P4HA 4I2VA 5DGTA 5IT9A 1UK7A 4FYHA 5DI9A 4E09A 1UBHS 4PCVA 1N75A 1QZZA 1LLCA 1USIA 1XF1A 1HE2A 2CXSA 4FFLA 3RH0A 3C3WA 2IOYA 2OGTA 4PR3A 3OQBA 4ZU6X 2D74A 2VQFB 3TXXA 3K9HA 3O73A 3T35A 4WXYB 3D3EA 3QLJA 4BWYA 1WIWA 3GNSA 4S2EA 1GVHA 1KKMA 1RVDA 1UC5B 3FFWA 4WK0B 1N7GA 5ICSA 5HJ5A 2FK8A 3V2HA 1PZEA 1YUMA 4NCHA 1V3TA 3UV6A 2JASA 2INGX 5K03A 1FDRA 3S1AB 4RULA 4BNIA 3OD5A 1TF5A 4DM3A 3D3QA 4DCSA 4U2GA 5DCUA 3KPYA 2W70A 5EINA 3MUFA 4JQYA 2XD4A 2GEBA 5LP1A 1KQ3A 1NUPA 2Y9MB 3IUYA 1Q3KA 3OECA 1P2BA 4G0MA 5D8DA 5GY7A 1JQEA 3V6LA 1UDBA 2Q3HA 1KAOA 1RLMA 3NHLA 1R0XA 3FOBA 1D6SA 1XP8A 3D8SA 1T10A 3FJ1A 5A04A 1ILEA 1YA4A 1UP4A 2B7LA 1GXSA 1X7WA 5CPFA 4ZZ3A 5C7OO 5H16A 3RC8A 1JT9A 3EFBA 3LK6A 2NUAA 3K35A 2EERA 3HVHA 3R5TA 4AQ7A 1RACA 1J8MF 1IN6A 2DCUA 3R9XB 1OIWA 1STOA 1V25A 3H87A 3ZW8A 1JMKC 1PJ8A 1KJYA 2BAGA 2VNSA 4KPUA 2XH8A 3ZWNA 5K8JB 2FFRA 1MN6A 3VYTB 4YCAA 1ISSA 1UT8A 4HCJA 4OO3A 2R6ZA 3CQ9A 5JS6A 2B4RO 1U8EA 2QRGA 1KJQA 3W2HA 2A9JA 3EGVA 4IFTA 4R2WA 4F11A 5DNAA 3EPKA 1ZK3A 2IU6A 2PH3A 1JAHA 1OFTA 3K5IA 2Q6LA 2RC6A 3MJ4A 7REQB 3K0KA 2F9FA 3P9PA 4KCGA 4PCAA 3I32A 3NRCA 3IXLA 2MSKA 1A9XA 3OY2A 4FE3A 4ND3A 4QPCA 1LXCA 3WNVA 3VR5A 2AG8A 2MWMA 3FOCA 3ZD9A 2GZAA 4QFBA 4RIFA 3K2BA 1W6RA 5C7IO 4HT3B 5JSZA 2NO0A 2VSQA 3FWKA 3ORRA 2YRXA 4P38A 3HVKA 3HB9A 3C1OA 4E3WA 5DGXA 4RY0A 1CR1A 2ATIA 3AHGA 4AZ3A 3UNXA 1XD9A 4V2IA 3GPCA 3HCOA 3KKZA 1RI3A 5JNLA 3DMHA 4GEKA 1HG1A 1IHXA 2EFJA 3CTMA 3IP3A 2Y1LA 4G4IA 1NQXA 1KF0A 4J4TA 1P5FA 3ZWMA 1AMOA 3RIMA 3M83A 4B6OA 2QVGA 2OQ2A 5H70A 1N57A 4H3VA 3ZGZA 1WXDA 3MEQA 4JJEA 1DAFA 3BBPA 1YQDA 3BFXA 4TGLA 4BNHA 4URFA 1FC0A 2FXIA 3RUCA 3U5ZB 3HDYA 1FUUA 1IATA 3BM5A 2ZBDA 4MW2A 4TVBA 4G3XA 3WV5A 1QIJA 1ACMA 3D2AA 1EWYA 1Q1EA 1ZK1A 1K7FB 3EGDB 1QX3A 4JLVA 5JMPA 2YC2C 4O0MA 5REQB 1FSPA 4EATA 1BMFA 1H22A 2ZATA 2VF7A 3AY6A 1NURA 3Q0EA 4PRZA 4UHBA 1I7QB 2PE5A 3N8KA 1G9SA 2N1MA 3V3TA 3C74A 3C3DA 1ZJ4A 5KTMA 1NRIA 2QUAA 1KJWA 4FR5A 1UT6A 1ZBDA 3CG4A 5KYUB 4MWEA 4MCIA 4YYZA 1AZSC 3CVYA 4BATA 1PJBA 4WI1A 3TVDA 5JFGA 4WCFB 3PQ6A 2R6DA 1KFJB 4NZPA 4UQLA 5I3CA 4C7OB 2RCYA 5F1OA 1Q7CA 2HWKA 4KYUA 2VJAA 3EQ8A 1PFWA 3P9IA 2QTTA 1M34E 3M82A 4GPIB 4BGUA 3PEEA 4MR8B 2I87A 4W7SA 3WADA 4D8VA 4HAZA 5JD4A 2YV2A 3PXCX 4HLCA 3O75A 1B2LA 4HB4A 4EO9A 1EINA 1U8FO 4TKMA 4J4BA 4RJTA 1T4CA 1GCUA 2G9QA 3WYFA 3EVTA 1DBQA 2CVFA 1WVGA 2I3BA 2JHCA 4UPDA 4RZXA 3KQOA 2ZJFA 2QU7A 4E2XA 3EZYA 3H5IA 1H0SA 1KK1A 3AKCA 4P6VF 1VG8A 3LUBA 3PNMA 3LUGA 3H1PA 1LH0A 1KJNA 4JYMA 2IIPA 4QHYA 2QX6A 3AKYA 5ARDA 1LSUA 2DGDA 2QR3A 4MV4A 3TW8A 1JJIA 2NADA 4PC7A 1TUBB 1N7HA 1G8FA 3OEWA 1XLWA 2NO6A 2NZUG 4ENWA 4ZTUB 4FU0A 2BEJA 1KOFA 3LDAA 1I33A 4G56A 2A5DA 2NUTA 4LJ9A 2VAVA 2CK3A 2YHAA 2I5PO 4KQIA 4KN5A 3RPEA 1ABFA 2EBFX 5CM9C 2YXNA 4V1CB 2JLWA 2C1ZA 2YCLA 2NPOA 3RQSA 5D84A 3DJYA 1B1CA 4UDYX 1N2XA 4MVJD 2VPWA 1JNYA 2ZJ7A 2ZRDA 3N5CA 4DRYA 5B1YA 1EPUA 2HM7A 3G1UA 3HFJA 2ZJ0A 2O8NA 4NAUA 5JO0A 3LDUA 4XSVA 1EE9A 1SC4A 3MINA 5L3ZA 4X7BA 1U2QA 2VYNA 2QP9X 3HVIA 5BW6B 2WWGA 5KCMA 4QGHA 4R1OA 2VLIA 3GA7A 3CC8A 4U02A 2HA5A 1UJ5A 1P2UA 4F06A 1KFKB 2EFEB 3TQSA 3GGPA 1VL1A 1YB2A 1T0JB 2AD5A 4S05A 2BGJA 2XLCA 4J4HA 5TIIA 3IEKA 3UB4A 3W34A 3NNDA 1G8HA 1V3UA 1ZMXA 2WUDA 2Y66A 3MN1A 4TKVB 3OCVA 4TS1A 5DTMA 4AYXA 5JADA 3E70C 4QRDA 4DA0A 4C5AA 1CY4A 2H1WA 2OG1A 3B12A 4O59O 4QL3A 5IFKA 3CU5A 4ZAGA 3M33A 2ZQ5A 3N53A 1OB2A 1TD9A 2R8RA 1NV8A 5I5EA 3H86A 4BBAA 1IPFA 1QR6A 2I55A 3UB3A 3AFGA 4BE7B 2X8WA 3Q3IA 1Z08A 2N1BA 4JLMA 1X7ZB 5BSWA 4WZ6A 3TH5A 1ZL2A 1J49A 2RAFA 1BJKA 4YBRA 4Q7LA 2FEKA 3W1EA 3BRWD 2JKYA 2F4NA 3STWA 1Z3CA 1TDJA 1ISGA 1AG9A 5BSFA 4YQFA 5IZCC 3IUBA 4IIXA 5DLEA 3B53X 3DO5A 3DOHA 3IUJA 2IOFK 4FN4A 4PSCA 4TUYF 3LD9A 3HNOA 3PHGA 4FGJA 3A14A 4QUIA 4RY9A 3ZHSA 1C1DA 1CUZA 3DV2A 5IEBA 2J48A 2DULA 2ARKA 3KOXA 2YCBA 2RGGA 3KLOA 1IWBB 3A9CA 2X6TA 5EQTA 3T3HA 5I9LA 4KZPA 4AT1A 1FP4B 5ICCA 3NGXA 3FNEA 5DHSA 1PWZA 4K6KA 1DV1A 1QHIA 3B5IA 5T3YA 1GNRA 1LVUA 1C7FA 3DBIA 3INRA 5BYBA 3O3NB 1C3VA 4BRSA 2XMPA 1JH8A 4DLLA 1HE3A 2BDEA 2X7XA 4IYJA 4GAEA 4DR2B 1DC3A 4LFBB 3LQYA 2IOFA 4P36A 5L53A 2G09A 1T5SA 3QLVC 3EHEA 1V71A 3OA0A 3X1KA 1QO9A 3T1YB 4GKAA 1XA4A 2R1TB 1ND5A 2XAAA 3PGLA 4M1MA 1ABBA 2OCBA 4HN4B 3OZDA 4EHDA 2W5UA 4QVGA 3CX4A 4A7PA 4GKKB 4HTFB 1L5ZA 2JEOA 1EDDA 1EHIA 4FCVA 1C1YA 4YA6A 3CLSC 3HBFA 1L3IA 3KHUA 3E3LA 1QYWA 2XCQA 3OCJA 4DLUA 4JBLA 4ZO6A 5K09A 1GUZA 1L5SA 5EJ2A 1C3LA 3OBIA 3FF4A 4UBLA 3A37A 3T7CA 2FPPA 3DGEC 2NYAA 4QU9A 2QRQA 1BHQ1 4P84A 3RTDA 4H7DA 1F3LA 4NENA 4EEKA 2IEDA 2OV6A 3F90A 2IS1A 1EWTA 1ZRNA 4LIPD 4XQ9A 3E2MA 1A9RA 3ESXA 4RCYA 3RVBA 4ZOQI 4AJEA 2D2FA 2BEVA 3EDYA 4II7A 1RWXA 4AIIA 3VVLA 1SHJA 2R96A 5EIBD 5K3FA 1I8TA 4GOOD 2CWWA 3NWEA 3OH8A 5EHQA 5G1OA 3A4TA 1CUIA 2VIIA 4PZYA 5B7GA 5KQRA 5CXSA 4KTTE 3GJ5A 4QQFA 1JI3A 2XQVA 4BNUA 3RVKA 1DEAA 1XYGA 2HL6A 2RHTA 3MCAA 1E2FA 1SVWA 3BDVA 5EESA