5K0GA

Crystal structure of comt in complex with 4-[5-[1-(4-methoxyphenyl)ethyl]-1h-pyrazol-3-yl]-1,3-dimethylpyrazole
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
219
structure length
219
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 79
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0gA00
2PX4A 4G56A 3EVAA 3G2PA 5EMJA 3RW9A 3UJAA 3G2QA 3KHKA 3DTNA 3A26A 3B3JA 2AOWA 3K6RA 5F2OA 3HVKA 2B78A 1RI4A 3TLJA 1XJ5A 4EMSA 1NV8A 3EMBA 4P7GA 4PYKA 1V39A 2GPYA 1JTEA 5FADA 1QAOA 2PVCA 3C6KA 4E2YA 2C7OA 4QQKA 2PV0A 5E8RA 3IHTA 3M33A 3EVDA 2FCAA 4IWNA 4KRGA 2Z6QA 3ORHA 2Z6AA 4BLVA 4ATNA 4OA8A 3SM3A 2K4MA 3UJBA 2WA1A 5DTMA 3A7EA 5HEKA 4BLUA 2XVAA 3JWIA 1JSXA 3THSA 2YXLA 3UA4A 4RV9A 3UFBA 1B42A 4Z2YA 3AXSA 2BM9A 3O7WA 2JG3A 3M4XA 3SSMA 1VPTA 5E8JA 3HTXA 1PJZA 3OE5A 3KR1A 2P3QA 1NW5A 4HC4A 2AS0A 1KR5A 4FT4A 2R6ZA 4X61A 1YFJA 1ZKDA 2GS9A 3PVCA 2ZIGA 3LBFA 3EVCA 5HILA 1EJ6A 2QM3A 3HCCA 2CKDA 3G2OA 3OZTA 5JUWA 1VBFA 4KW7A 5K0JA 3KQMA 2B9EA 5EIFA 5T64A 2YXDA 3GRUA 5DPMA 2NXJA 5HFJA 4OX9Y 3M6WA 3P9CA 5C1IA 5LQRA 5DM0A 2PX2A 5LSAA 3HA5A 3OFKA 2V74B 3GU3A 3CGGA 4DZRA 2NXNA 2P35A 4RVHA 1INLA 1KPHA 1R8XA 1VL5A 4F85A 5FHQA 3BKXA 4BP1A 2Y1XA 1JSZA 3LGAA 1VLMA 3BGIA 2BR3A 5E1DA 4P7FA 3PS9A 4C05A 4EVIA 1L9KA 2NXCA 2VDUE 1JG4A 2ZBQA 1U2ZA 2H1RA 5HIIA 1SUIA 3GRYA 5DSTA 4DM3A 1D2GA 1FP1D 2PT9A 4POOA 1O9HA 4PYMA 2IPXA 3UA3A 4OQDA 4AZSA 3CVOA 1XDUA 1XDZA 2YX1A 5EIWA 3FPEA 3P2IA 3PX3A 1X1AA 1WG8A 4AZVA 5GIPE 3GJYA 5LQCA 3KQPA 3FUXA 4XUEA 2A14A 3AWIA 2JJQA 5HZMA 4R6WA 1NBIA 4E2XA 3NDIA 3D2LA 3P71T 4C03A 5ERGB 1N7JA 1JG2A 1NW6A 3EPPA 3EGIA 1YB2A 5BW4A 1RI3A 3SGLA 4OBXA 3MTIA 3BWBA 2ESRA 4RVDA 4RX1A 5HIMA 3M70A 1NE2A 1R6AA 2ZBRA 2EFJA 3OE4A 5GP1A 1SKMA 4KDCA 5DTQA 2GH1A 4GC9A 2FYTA 4RTKA 1G60A 1X1BA 5LQAA 5EEGA 3MHTA 2HNKA 3B3GA 4R8SA 3MAGA 3TKAA 3NDJA 2Y1WA 5CVDA 5EZSA 3MB5A 4PYIA 5LQUA 3E7PA 3FTFA 3KQQA 3LSTA 3UJ7A 3DH0A 4ER5A 3TR6A 4P7KA 5KQSA 5EHGA 3THRA 5KVAA 2P40A 3H2BA 2QYOA 3ME5A 4HGYA 3UJ9A 4OA5A 5CIYA 4LWPA 4PGGA 1MJFA 4RTPA 3T7SA 1D2CA 3KR2A 2AOTA 3LX6A 4PIPA 5D1NA 5EC8A 3V97A 3PT9A 5K09A 3GWZA 3BWYA 2ZLBA 4M36A 5CVJA 3HCBA 3ER9A 1KXZA 1BC5A 3QOXA 3EGVA 4HTFA 1MHTA 3C3PA 3NW9A 3HVJA 4F86A 1JG3A 3G89A 4AZWA 5EG5A 2ADMA 2I9KA 3LPMA 3I5UA 2PWYA 2O05A 3SMQA 1NT2A 3ELYA 1H1DA 2G72A 2ZWVA 4CTKA 2IDKA 2IP2A 1UFKA 3C6MA 4HGZA 5IH3A 3SSOA 1SUSA 3UJCA 1VE3A 2IFTA 2IBTA 3SX0A 1KHHA 2AVNA 3G88A 4KVZA 1FP2A 3E8SA 3BWMA 4ZTBA 5FA8A 4C08A 2PGXA 2ZW9A 3T7TA 4F84A 4YUYA 5CM2Z 1Q0TA 4BY9E 1R8YA 3E23A 1ORIA 5FA5A 1JQ3A 1KPGA 4R8RA 3BGDA 4OQEA 2ONZA 1ORHA 2PXCA 4PYOA 2OKCA 2O07A 4IKPA 2C7RA 3DP7A 3TRKA 5K03A 2C7PA 2QRVA 3I53A 4QVGA 1KIAA 1JG1A 4XUCA 3NWBA 1AQIA 4JXJA 5EOVA 5B1SA 3EEOA 3P2EA 4BP3A 3GRZA 5G02A 3B3FA 2NYUA 4A6EA 2FK8A 3ELDA 5E9JA 1G55A 3OFJA 3P8ZA 2UYOA 3I64A 2I62A 4BLWA 4EQZA 3G7UA 1M0EA 2I6GA 1NW8A 1YUBA 4GOLD 2AOUB 1BKYA 4B17A 3KR0A 4PINA 1WY7A 4PYQA 2G8NA 1L3CA 4OBWA 2IH5A 1WS6A 2LD4A 2V7EA 3GO4A 3KU1A 4H0NA 4YUWA 2N47A 3LDUA 1NKVA 3PB3A 4E70A 4LWOA 2OB2A 5CCBA 3REOA 3FZGA 3OU2A 1X1DA 2OY0A 3DLCA 4HG2A 1SG9A 5K01A 2GLUA 4E2ZA 1TW3A 3U81A 5BXYA 3DUWA 2UYHA 10MHA 7MHTA 1T43A 3CCFA 1F3LA 5U4XA 3WSTA 1DCTA 3LKDA 2EJUA 3B89A 3TQSA 5K0BA 5GOZA 5K0LA 3PX2A 4RVGA 3OZRA 1OR8A 3KPJA 5FQOA 1JQDA 2H11A 3G5LA 2KW5A 3DR5A 3JWHA 3KQYA 3LDFA 3MQ2A 3NWEA 2I7CA 4K6MA 4P58A 1O54A 1P1BA 5EKUA 3LECA 5FCDA 4V0QA 1QYRA 5JR3A 3BGVA 1VP9A 3GGDA 3P9IA 3BXOA 3BUSA 1DL5A 1RI5A 4HH4A 4KIFA 4P7JA 4A6DA 1EJ0A 4ER7A 2JH8A 5HIKA 4MHTA 3MTEA 3FUTA 3HCFA 2PLWA 2CWWA 2EJTA 2AN4A 3HCDA 1I9GA 2YQZA 4CKCA 4RWZA 3I9FA 1NBHA 5CVEA 5ICCA 1HMYA 2P3OA 5HIJA 2EG5A 4MIKA 5FUBA 2IBSA 3UJ6A 1EQAA 1YZ3A 2NNWB 2PBFA 1WZNA 2AN3A 3IV6A 5BW5A 4MQ4A 1P1CA 2AR0A 4NECA 4LG1A 1XTPA 3JWJA 3EVFA 1M6EX 4QTTB 4E2WA 5EQJB 4R6XA 5EMMA 3DXXA 3ER8A 3KQVA 1RJEA 3ID6C 5DWQA 3KKZA 3GXOA 5K0CA 1QAQA 3VSEA 3TMAA 5H02A 3KPWA 2QY6A 4QVKA 1G8AA 1Y8CA 1G8SA 2H00A 1L3BA 3B5IA 5F2NA 1KYWA 4EKIA 3GDHA 4MWZA 2F8LA 2GA9A 1M6YA 1N7IA 4EK9A 2HTEA 2IH2A 5K0GA 1SQGA 3KQOA 2ZULA 3OZSA 4PGHA 2P8JA 5GM1A 4YV1A 4KIGA 4QDKA 2G71A 5LQKA 3CJTA 4YMHA 2BM8A 4PONA 2VP3A 1JTFA 5DX1A 4YUZA 4HRAA 2OBFA 3FYDA 2EX4A 3HCEA 4YUVA 1FJXA 1XVAA 4ER6A 4AX8A 3NVKI 1XCJA 2OYRA 3QOWA 4CTJA 2CMHA 3EVBA 3GIWA 1I1NA 4M37A 3RODA 3VC2A 4AZTA 5C9ZA 2Q41A 3A4TA 3ELWA 4WVLA 2XYRA 5K0FA 1ZGJA 3MERA 3HP7A 4E32A 2P3LA 3LHDA 5E2BA 5E9QA 3UJDA 3NMUF 3EVEA 2B3TA 2VDVE 3PFHA 3KQWA 1ZG3A 4RSRA 3FPHA 3A7DA 3DXZA 4E30A 5CUQA 2ZWAA 4Y30A 4X60A 5GIOE 4XCXA 1R74A 2FK7A 2VS1A 2WA2A 3Q87B 4PNEA 5EGSA 1VP3A 2JHAA 3UWPA 3OU6A 4C4AA 2UZ4A 2P7IA 4LECA 3BZBA 3SSNA 1R00A 4QPNA 5P8WA 4GEKA 2PX5A 1N2XA 4GOND 2ZTHA 2IH4A 2AOXA 3LKZA 5K8VA 4RTSA 2O06A 2WK1A 2IDJA 3PTAA 3EVZA 4ER3A 2OXTA 1O9GA 3P9KA 2YXEA 4IV8A 4E31A 3ANXA 2YR0A 4PIMA 3X0DA 5BP7A 3C3YA 3M6XA 1QAMA 4YV0A 4FS8A 1QZZA 2BR5A 2PY6A 5C0OE 2PX8A 4M7RA 5GINE 3GRVA 4O29A 1YZHA 1FBNA 3FUVA 5DTRA 5EMLA 5GWXA 2PJDA 1BOOA 3ERCA 5FWAA 4U7PB 2JHCA 5CVUA 5GM2A 3TKYA 3TM5A 1WXWA 4Y2HA 3ELUA 4RTLA 2AN5A 2P41A 3C0KA 3GNLA 3P9NA 1RI2A 3FUWA 2AOTB 2FRXA 2OPBA 3BKWA 3IEIA 5DXJA 5F2KA 2B2CA 3G8BA 2ZIFA 4PYLA 3SXJA 3FRIA 2FHPA 3UBTA 3FPJA 4HTFB 2HV9A 2PKWA 3TOSA 1HNNA 4PYNA 2ZFUA 3I58A 5EVJA 2P7HA 2XYVA 1PRYA 1SQFA 4GUAA 3T7RA 1RJGA 1L3IA 3KPUA 4MTLA 5FWDA 4PYJA 8MHTA 2AOVA 4DCMA 4GC5A 4RYLA 1I4WA 1UIRA 1AQJA 3EGEA 2UYQA 3MCTA 3OPNA 4XUDA 2ZZKA 3CC8A 3FRHA 5EMKA 3TPZA 2P1DA 4U7TB 1EIZA 3R9XB 2PSSA 1NW7A 5CVVA 2HWKA 2ZIEA 3CJQA 3KQSA 3GRRA 5LQJA 2B25A 3DXYA 1ZGAA 2UYCA 2VZ9A 3VYWA 3Q7EA 2ONYA 1UWVA 5T6BA 3BWCA 2PXAA 3O31A 5KS2A 4QPPA 2YTZA 4HSGA 1IM8A 2XVMA 2ZBPA 3EVGA 4IV0A 4RTMA 5K0NA 4DA4A 3DMHA 1YF3A 3G8AA 4X63A 4DMGA 2QRVB 3HM2A 5HOQA 3LDGA 1KP9A 3PFGA 1X19A 3A27A 1FPQA 3MCZA 3NJRA 4KWCA 1F38A 2YVLA 1IY9A 1DUSA 1D2HA 1JQEA 1VIDA 3K0BA 3R24A 2OO3A 3GCZA 2ZCJA 1NV9A 3KPVA 2G70A 1Q0SA 3UJ8A 2O57A 2R3SA 3HA7A 5EPEA 3NVMB 4DKJA 3B7PA 4FP9A 5M5BA 2Z6UA 1P91A 5FTWA 2CL5A 5CCXA 3P2KA 5EHIA 3CKKA 4FGZA 1G38A 2BH2A 2BR4A 1ZQ9A 2FPOA 2AVDA 4V0RA 1TPYA 3R6TA 5KQRA 3AJDA 1EG2A 3G5TA 3FTDA 3DMFA 1P39A 5K0EA 3EMDA 4RTQA 5KYGA 2AZTA 2XYQA 2PWPA 4PWYA 3SVZA 4X41A 4GOOD 5DM2A 5DXAA 5T67A 5LQNA 3CBGA 3FTCA 4RVFA 1X1CA 3G2MA 3DULA 2OB1A 3T0IA 5DT2A 4AUKA 1AV6A 1VQ1A 3UZUA 2ZVJA 1QANA 3LBYA 5E1OA 2ERCA 1AF7A 2YUIA 3QV2A 4FSDA 3S68A 3R0QA 2IGTA 4EKGA 5IKMA 4M38A 1BHJA 1XXLA 1KPIA 2BZGA 5FULA 4KDRA 3KQTA 3FPGA 4CKEA 4PCLA 2DULA 2QE6A 5E1MA 3HVIA 5EKXA 3LCCA 4ER0A 3P97A 4QTUB 1YFLA 4YV2A 2HR1A 2CMGA 1ZHFA 5D1HA 4DCGA 2IIPA 4GF5A 4RTRA 1JR4A 1WXXA 3HVHA 2ZZMA 1L1EA 4FZVA 1Z3CA 1RJFA 5FHRA 2HMYB 2NXEA 1KYZA 4DF3A 4GOMD 5K05A 1SVUA 4YUXA 5ICGA 3PLAE 4L7VA 3AXTA 1TW2A 3VC1A 2PT6A 4QQNA 3FPFA 2GAFA 2G1PA 3AY0A 1RJDA 3HCAA 4QDJA 5MHTA 3HEMA 2OZVA 2ZZNA 3DLIA 4FR0A 5DSXA 4YMGA 2E5WA 3A25A 4C06A 4GQBA 3FTEA 2VDWA 3FUUA 4R05A 3F4KA 5DX8A 5DRYA 5DX0A 2NP6A 3OCJA 1EAMA 1XCLA 3CJRA 3L8DA 3TM4A 3DOUA 3EEYA 2ORED 4E33A 4CKBA 2AOUA 3KR9A 4RTJA 3NTVA 4WXHA 3E05A 3LL7A 4DQ0A 3M6VA 3HA3A 3LCUA 3OU7A 5ICEA 3BT7A 1XDSA 2PXXA 2O0LA 5DM1A 5LR6A 3KPYA 5DM4A 5EEHA 5CD1A 1G6Q1 4RTOA 4X1OA 5DLYA 3V8VA 2JH9A 3HNRA 5E1BA 1RI1A 2DPMA 3FYCA 4ISCA 5DRTA 3MGGA 3JWGA 4FSXA 5FQNA 3DMGA 4FT2A 5EZQA 5E2AA 5ICFA 3R3HA 4C04A 4PCAA 3O4FA 3RIEA 4CXMA 4GBED 2C7QA 2XBMA 9MHTA 3LCVB 2JHPA 4C07A 1R18A 2GB4A 1IXKA 1NW3A 4CWAA 3SR4A 4RTNA 5E9WA 2NP7A 2ZSUA 3M6UA 3IYLW 4UOEA 3TFWA
chains in the Genus database with same CATH superfamily
4DCTA 1ECCA 4AWBA 4BRWA 2IYAA 1OX5A 4LV5B 4CIBA 1QIJA 1XPOA 5D00A 1LJLA 3V55A 4DNQA 2V4UA 2W6IA 4N39A 1JFRA 2ECKA 1MO5A 4CNBA 4ON9A 1JPNA 3GFTA 4IO0A 4P7GA 4QDXA 1SNYA 1R3UA 1R4MA 1GFIA 2B30A 2CXXA 3IODA 4H7HA 4PXSA 2P6OA 4MV6A 4FE4A 2FWRA 4Y6PA 5B12A 1VL2A 3K2BA 4QQKA 3WBBA 4F3KA 4WNCA 4NEGA 4DG9A 3HZOA 1Y98A 3AO0B 3B8HA 3KUUA 1CQXA 1VKJA 2X9GA 3R7DA 4CUKA 2HT6A 1FP6A 1M75A 1BXGB 2NV6A 3QPCA 3C2QA 1RJ9B 2G5TA 4RV9A 1V3QE 4ZI7B 2BM9A 4JLMA 3MT8A 3KXDA 4Y7CA 4PZYA 3CF4A 3TPCA 3KR1A 2PUVA 5G41A 3DPUA 1QO7A 1VDZA 1YRAA 2GS9A 1M74A 4CM9A 3CEPB 4HNVA 3LLCA 5LMCA 3CH6A 3K9LA 4G65A 1TIKA 3PFCA 1SZDA 3THYA 5JVDF 4XDGA 2G1JA 3OSZA 3OP1A 3WAGA 3INGA 3ROKA 4JI4B 4NOLA 1EE2A 4JASB 4YLEA 4C7XA 3ICQB 1ZMRA 1O94C 2IEGA 3HWSA 3N86A 1YASA 3LA6A 4H6XA 3CGGA 4MUMA 4Y9DA 4YP9A 2HADA 1J8YF 3MTGA 3RKSA 2BKUA 4YP7A 3WWCA 4Q4CA 4KGZA 2QAIA 3CNOA 3H3JA 1FUEA 2EBFX 2VT7A 2QSYA 4I1OA 2AD1A 1BHO1 4ZU3A 3A1SA 4R3WA 4KRXA 3ZYZA 3T3NA 4HZIA 1G3MA 3DDHA 4MMZB 5I6DA 1RXWA 4IVRA 1TRKA 1E99A 3R7SA 3CE9A 1T5IA 1YS7A 2Y1OA 2GNOA 3DE7X 5JFTA 5AI4A 4FYMA 2ZBQA 2WJAA 2VLIA 4LHWA 2FSIA 1NLZA 4QU0A 1D2GA 4Z3OA 1RS0A 3V4PB 3ILSA 1VDMA 2ZJZA 3FMGA 1UAAA 4I8DA 1EVKA 3A0RB 2PGAA 4TMKA 5EIWA 3UC9A 1CUHA 3QG5A 1WETA 3IMEA 1JDBB 2LCFA 3QW4B 1LLCA 3FZYA 1UPCA 3G9UA 4OHFA 4MI6A 3KQPA 4FHZA 5JS2A 3QBTA 4L5AA 1RE0A 1GD1O 4FOOA 5JJCA 4B3GA 3WP1B 1JT2A 2RGAA 2HY7A 2JJ8A 4UBKA 3S2EA 4L8LA 2AFRA 3MPUA 2ZRNA 3BTUA 1YB2A 3L8MA 3PRKE 1W73A 4ZANA 3UBMA 1ZC3A 2VEOA 3Q41A 4EUFA 1TAUA 1XCOA 1DRKA 2Z9BA 3OQJA 2ZVDA 1U6JA 1YJ5A 1L4UA 2BL4A 4BO2A 4L85A 3B6IA 2DGDA 4KDCA 1FOEB 3VNSA 5ARDA 4OJQA 3NDJA 1CQJB 2B99A 3MB5A 3U17A 1IBKB 1L7BA 2HB6A 4FYIA 1QGAA 4M1YA 5BQPA 3DE4X 4L4UA 4O3FA 4P7KA 3F1LA 5EHGA 3LXRA 2QI9F 2D0PB 3K53A 4G5HA 3T4EA 1MJFA 2V9CA 3EY9A 3T7SA 2E2WA 2HM7A 3V97A 4GOXA 1XBTA 1EDZA 1ZBQA 3OE1A 3PWZA 3TZCA 1FUKA 4GOJA 1NUSA 4LJSA 2ZRFA 4R1PA 4RA9B 4WCFC 5CFNA 3CZ5A 3BICA 2I4MA 3I62A 2O8DA 3Q11A 1KIMA 3TRFA 2O05A 2VJQA 1C9JA 1E3IA 5H83A 1J20A 3EG9B 4TXNA 1A50B 5ELMA 4RQUA 1NVBA 3BEDA 4KYTA 4QZVA 3U6KA 1RZRD 2W2PA 4QEKA 2IBTA 2HUPA 1UK9A 4KXXA 5DGDA 1IWOA 5AT1A 3MA0A 1XZCA 1T5HX 4B0PA 4C89A 2GBGA 1R8YA 3T3DA 3LUHA 1K6IA 3D31A 2B1QA 4S1PA 4K0RA 3O94A 3N39C 5K1ZA 4AY3A 4LJRA 1ADYA 1LPOA 4R8RA 4RV4A 5EE1A 3O4HA 4RNDB 1TEHA 2QN3A 2ZPTX 5KHAA 4D56A 4YECA 3AZQA 4DQKA 3UAGA 1VXRA 4IIGA 4BQNA 3P9SA 2YN2A 5B58C 1XHEA 1GPAA 1NNSA 2NUAA 1C7IA 3VYSB 3TLAA 5A4IS 5BUCA 3TZ6A 2ZCVA 4MVJA 1X80B 1JHOA 4MS3B 3JZMA 3SCZA 1E0DA 1EVEA 1CUVA 3QVMA 2CFRA 4MOWA 3MXTA 4MKZA 3U7GA 1TUBB 3EEOA 3NUGA 3P2EA 2VRBA 1DO2A 4IM7A 1U3DA 3QRWA 3LQRA 5ITZB 2QVLA 3L7DA 1OKKD 3L46A 3ELDA 4IF6A 4Z3DA 3W79A 2D06A 3WJ1A 4U2EA 4KUEA 2UYOA 4JMPA 1RRCA 3NHLA 4CF6A 1Z06A 2WF9A 1GUBA 3FKSA 5G1PA 4F46A 3TIFA 1K75A 3OUZA 1U0JA 3RADC 4EJ2A 2V7EA 3H97A 3OJEA 3PCXA 2N47A 3LDUA 5G4KB 2WWTA 4HFMA 5IFLA 4YMTA 1F14A 1G21E 3OICA 4WXYB 1S2OA 1XZDA 4L2IB 2ZYHA 2ZDQA 4D3YA 3GEMA 1OW3B 2H57A 5H3LA 4BQIA 2B37A 3ZLTA 3C7TA 3E3OA 4FN5A 3VO9A 1JFTA 5B3KA 1CS4C 3ZQJA 4LVUA 5DBGA 1TKCA 5K3OA 5EZYA 4BNLA 2KE5A 3QFFA 3TQSA 4QULA 4RJ2A 1VL0A 4JKYA 3U4HA 5CG2A 1OR8A 1E9AA 1O95C 1USWA 1XVVA 4DIBA 2YWJA 5F23A 2AFHE 1E62A 2IZOA 3A1EA 3KQYA 5KSYA 1UC5B 3TWOA 2RHMA 5H1YA 3MGKA 1I2AA 1Z4LA 1TM7E 1VJRA 3BGVA 4TPKA 4AXXA 5CBPB 5JXGA 1P4SA 3MGCA 4RLFA 1JR6A 1H2WA 4ZD6A 3PPWA 4NNPA 1DAIA 3R0ZA 1PS9A 1N5OX 3IHWA 1E7MA 2B98A 4BKQA 2C54A 4Y2TA 3P2YA 3QMWA 4RDXA 1E4EA 2OILA 3R1IA 2UVPA 2YCLA 5EA2A 3UG7A 2ZIVB 5NULA 5TB5A 3V3TA 2Y1EA 3G7NA 2LDBA 5E6RA 1LDMA 3TW6A 1EK5A 2FXIA 3QVGB 1M1NA 4ZJZA 1YZLA 1F5NA 4H6WA 5ALRA 1YJ8A 3WDKA 4F3NA 4DDUA 1NE7A 1SKUA 1QAQA 4NENB 4XIYA 3KSBC 2NPOA 3ZS9A 1OGJA 2B34A 2NZXA 3HY3A 5DM60 3A05A 2X3UA 1FX0B 4MYCA 5CDFA 3S28A 2DUUA 4LHYA 4MZXA 3IDFA 1KWKA 3RVNA 1YKGA 4LE1A 1EM8A 4JODA 1OTHA 5BRNA 4CRWB 2RB5A 4CKYA 4D0RA 4HADA 4KIGA 3PUXA 2G9NA 4B3HA 4POAA 2ATEA 4AU1A 1PV2A 2NPFA 3UXEA 2VP3A 1WOYA 5DX1A 4A5OA 5JTTA 3WRYA 1EU1A 2O8EB 2UZ1B 2QL7A 4H2DA 1C1DA 3HRKA 2NUTA 2CMHA 3DEZA 4NABA 1MO2A 4KNVA 5HJEA 4JL8A 2XNHA 4WCDA 5KJEA 4IDDA 3WS7A 2XIJA 5FI5A 3IAS1 5JPIA 3ZZUA 3VO8A 3R2JA 1XD8A 1GU0A 3I01M 1HPLA 4RVCA 4CKCB 1RQPA 2GCEA 4YJGB 4IQFA 3GT7A 5LBTA 4BFZA 1Q6ZA 3QXGA 4KE8A 4KO4S 5HZGA 4L08A 4YRIA 2X23A 1RXVA 1P8JA 3OZIA 4GI1A 4DJ5X 3JW8A 2VS1A 4PAQA 1GTL1 3R5KA 3H83A 1I30A 4WA8A 5A7FA 1DKMA 4I99A 4LNUA 4BNZA 1ULUA 4H08A 3HUDA 3Q1LA 2LR0A 3ED5A 3FNQA 1T25A 4F9FA 5AW2A 2EARA 2IE0A 2QTMA 4JT9A 4MWEA 4ZT6A 1NBEA 4OOEA 1QG6A 2WK1A 4RPHA 2F3SA 5JQGB 1GARA 1R0CA 2AI2A 2VYND 3G0OA 1ISHA 4B8YA 2QUIA 5JCJD 1SCUA 3AR9A 5F4BA 1EWYA 3ZD7A 1DPFA 5EFZA 4AJNA 2N9UA 1QZZA 1I32A 4PS1A 3AHIA 5LD2C 3ILYA 3FUVA 5EMLA 4RELA 3WJAA 4G0UA 3CO0S 3PFIA 4M22A 2LUOA 1BCRB 4MB6A 1ZIPA 3ELUA 5DT9A 5I8WA 2D2EA 2I5PO 1HRKA 4IOKA 1ODIA 3MB8A 2EG9A 1D04A 1C3VA 1JXOA 1QS0A 2BRUC 2G06A 3D8BA 3DEJA 3QKTA 2FHPA 4FDLA 5KNCH 2HHHB 3H16A 1KETA 4L3VA 1ZSYA 5JDIA 4HNGA 4OHZA 4PYNA 5JNTA 4QTYA 2BFFA 4WKCA 1T9GS 1WB5A 2BKAA 1L5HA 3EZ6A 5LIRA 4JLBA 2VHYA 3R6WA 3EIHA 4NF2A 2PL3A 2C83A 2VHEA 3WL6A 4Y1EA 1PNRA 1HTBA 1II8A 4Q16A 5LZ2A 1IZYA 3Q7PA 1TK2A 5I7AA 1UKYA 4FE3A 3FLMA 4M49A 5I7UA 2Y99A 3UICA 4EHIA 4C6HA 1V6SA 3DEYX 3L4BA 5ALDA 3WNDA 3VPAA 2R1VA 2QX8A 1V47A 4KX3A 2WWHA 4L02A 5CB0A 5CD9A 1KI7A 2RGCA 3SMVA 4PZ0A 4DLYA 5H9WA 4XB1A 3EGXB 3BWCA 4E5YA 5JASA 1NVEA 1G66A 4J2TA 1GGNA 5F12A 2TMYA 1NJ6A 1WDMA 3QKWA 5BQ5A 3T7KA 3RGWS 4C4YA 3EPJA 4DA4A 1RRMA 2Q46A 3L1HA 5ESRA 1LSJA 3ISVA 3PE4A 5EP1A 3VRHA 1IHDA 1VG9B 3N8IA 3ZCSA 5A03A 4HB0A 3OWXA 2K2QB 1X19A 2CCKA 3ACDA 2O48X 3RB8A 5BQOA 4L8VA 1RFLA 3K1AB 5HKKA 2IA5A 1MW9X 4GM0A 4B3BA 3Q2IA 1D6NA 3HLTA 2VWHA 2QI9C 4JJGA 4ZT5A 4D43A 2G70A 1E6WA 3DUFB 4PZAA 2IHVA 5CH8A 3LLMA 5TPZD 3VA7A 3WIOA 5CXXA 3JQGB 2XBUA 3SC4A 2BM1A 4LXYA 4ZWNA 4DLNA 3P2KA 5CGZA 5TV2A 1KEVA 1G38A 2NVBA 1V4NA 5K6AC 2BR4A 1QUEA 3PITA 4JQSA 1TPYA 5ILOA 3AJDA 1GILA 2O7VA 3K9QO 3T3EA 4D41A 1QMGA 2IV7A 5EHZA 4QREA 2VP4A 4DR2B 3LV8A 4OJNA 2FMFA 1ODTC 3LVQE 2HJHA 3WMGA 3EE6A 4MJ7A 2Q6OA 4BJ3A 2XOEA 1C14A 3VR6D 4N0MA 4ZQEA 2NO6A 2O0HA 3HEBA 2JCXA 1HV8A 3R41A 1IOWA 4IP0A 4WK2B 3QFTA 4Q24A 1PNVA 2VAPA 3HEAA 2V7QA 5HF5A 3EEIA 4ECEA 3TOCA 2QEQA 3G2NA 3MIZA 4OI2A 4QYMA 4IPTA 3H1EA 2HXSA 4LJ4A 4ENPA 2EKBA 2EL9A 3LRTA 1TZBA 4QFMA 2QP4A 1I7QB 1CRWG 4LUCA 5LZ9A 2ERCA 5F9FA 1L7EA 3A32A 2PFKA 3CLSD 3HZRA 3O4VA 3AJ9A 3Q6MA 3L7OA 3R0QA 5L53A 1WCIA 3G2HA 4RH1A 1ODSA 2W6NA 3AF0A 2CVPA 2EVWX 4UC0A 1NVTA 4XFJA 1R12A 1DBQA 4HSEA 2VR1A 5B3JC 2QE6A 4G41A 1JBQA 1XRQA 2RGNC 1QH8B 1IN5A 2R1ZA 5IN5A 1YONA 4E08A 1AC5A 5JAIA 1XAJA 1P2BA 2GWHA 2KPOA 2CYAA 2BEVA 2VQDA 3H6HA 4MGZR 1PQ4A 4JZKA 4ZYLA 4Z4IA 3S44A 5IXJA 5ISMA 4DCGA 4D9GA 4YFVA 1M2EA 3TNDA 4M7OA 2B2XA 3J80A 4K6GA 2W2XA 3I92A 5EJ7A 1H5UA 5K3CA 1J42A 4DF3A 1N1EA 3RBAA 1JA0A 2Q0HA 3KEGA 1UXJA 1WTAA 1O4WA 1E1RA 2NTJA 3PYLA 1K7EB 2Q5OA 3MD9A 1JPVA 1JHQA 1BWQA 1F06A 2AI3A 3HCAA 1M2FA 3UHAA 3I45A 3L6UA 2JFUA 3LKVA 1J22A 2QV7A 3UH0A 3SQNA 4Q6BA 1A9PA 4PV7A 5DX8A 1B16A 4LZJA 5AFSA 4HDMB 3KVNA 4ZQGA 2ORED 4WI1A 2Q62A 1ZEJA 2QTCA 4HFRA 5TS2A 1FYVA 3LYLA 4J3NA 5M29A 1JPUA 3IDZA 2Z8YA 3IPRA 4UDXX 5ADWA 3DMTC 3QOYA 4RTOA 4G6ZA 5FUYA 1JLHA 3NT2A 3CVUA 2GERA 5JSKA 1C3XA 3EH2A 3SS9X 2BMWA 2ES4A 2OBLA 5CNJA 4BV2A 4J0DA 2B21A 3JWGA 3E9QA 2WPNA 4R01A 3UN1A 3CH5A 5E2AA 2JLUA 5BXQC 2DX7A 3MT9A 2I8LA 3ZBUA 1CZHA 5ALZA 1YR7A 4MPRA 1OLUB 4NMWA 4GSYA 4PAOA 2BVNA 2GPSA 2J0UA 3E5RA 2NP7A 2R85A 2XGGA 1DWQA 3VZDA 5AIAA 1ZONA 2XE7A 1JVNA 2GZRA 4FUTA 4G56A 4RIHA 5FR2A 2QPOA 1RACA 3SC2A 5C4MA 4JA2A 3A26A 3B3JA 1Z16A 4L6IA 2HTFA 3LX5A 5EIBD 5HA5A 2WSIA 4EHDA 3G17A 1VLQA 4ITRC 5T3UA 3I09A 1V6AA 5B55A 2YZ2A 4WZZA 3QY0A 3HS3A 1HNZB 2EFHB 4JVOA 4R2KA 3NV7A 1GYRA 1UFOA 3V4LA 2C5BA 3D4BA 3FGNA 4GUDA 3TXAA 3DW3X 4BVEA 5HP4A 1SBHA 2HLPA 2WAOA 1Q7RA 4HFNA 5JMWA 5MFPA 1IATA 5IARA 4R3NA 1LK7A 1S8AA 3AHDA 1JDSA 2PS3A 3A7EA 4IYRA 1WF6A 1JSXA 3RSFA 3COJA 1ADGA 2OSBA 3OZ7A 1L8QA 3ENNA 3KXPA 2MR6A 1X3SA 3O7WA 4TKVB 4XYMA 2PQ0A 1H0RA 3RRXA 4B45A 2BBWA 2JGRA 1ZD1A 3SSMA 1PQYA 3MLAA 5LA6F 3T12A 1CF9A 1VFNA 3NWPA 2O59A 1OT5A 4KAJA 2B82A 3TTTA 4F4JA 1L5MA 2IK8A 3F2VA 4XJVA 3LE8A 4M83A 3GPBA 4LTMA 4Z1MA 3FI9A 3LBFA 2P6RA 3DTVD 3KTFA 4PGMA 3RYCA 2R4TA 4DMUB 4V2IA 3ZW9A 2JVIA 4DSTA 3QVLA 4M8NE 3E4CA 4JJKA 2WYOA 2M9MA 4EY3A 1KOLA 1V0JA 1W34A 2QR2A 4J4BA 2QBYA 2CUNA 3DA8A 2A5FA 3FHOA 3QHQA 4FDVA 4TYPA 4K9QA 4CQLB 4NFLA 4CI9A 1XRSB 2BPOA 2XTNA 4HN9A 1KY2A 1G2OA 2JGFA 4KQIA 3WIVA 2ISSD 4JJ6A 2GZ3A 4EO4A 3RIHA 1WDTA 2BFEA 3EA4A 5KDDA 2PKCA 2VSYA 1KJJA 1Z5OA 2NXCA 3WGMA 3W8EA 2IU3A 4G1UC 1TQ4A 2G4VA 5AWFC 1S01A 2H3EA 3Q6NA 2PT9A 5JFGA 4UUOA 3W6ZA 2HO5A 4G37A 4MQLA 1EH5A 4CN9A 4MPTA 4ZT7A 5JWHA 4BXOB 3DR3A 4UXHA 4WCFB 1WG8A 5BUQA 5I7HA 1QG4A 3KYDA 4C3ZA 2JAHA 3FUXA 3ZDRA 4L27A 1E0KA 3GLFB 3MWKA 1B7GO 3WBFA 4QX6A 5T8KC 1WO8A 5BYKA 3GLVA 3LF2A 4MVJM 3U16A 1JFVA 3DZGA 3CR7A 1HDOA 3HSYA 4KSCA 4A23A 1E63A 5IT5A 2BGGA 4CIWA 1GRVA 3QXJA 2CUKA 2NXWA 4P31A 1U8UA 1RZ3A 2V3WA 1V6CA 2FN3A 2VOEA 4DV0B 2VG8A 2RKWA 1FA9A 4YYEA 4GWGA 1OLSB 3IIMA 3DE1X 2A8YA 3SBEA 4Q00A 5HK8A 5KVCA 4MVCA 3V32A 3TJZA 3V8BA 5LQAA 4P0TA 2IEZA 3MAGA 1Q15A 3C3WA 4MSUA 4RACA 1W1IA 3V33A 3AI3A 2RAFA 1Q22A 1ZRHA 3VU1A 2WIFA 4H31A 4MUGA 2NSJA 4AM8A 1YI0A 1Z18A 4NV3A 2IZ0A 3PEYA 3V80A 1QXSA 1XX6A 3W3AH 3W7VA 1N2BA 5BR7A 1BDIA 4Q1VA 3JALA 2A1TR 1RXIA 4RYDA 3VSAA 1J0BA 1EMDA 1QIHA 2CFTA 4J4HA 1TJYA 3PQ6A 3HCBA 5E0KB 4ZARA 1Z9BA 4ZIRA 2V5UA 3NHWA 4XSGA 3RTGA 5HQTA 3PJGA 2ILTA 2JGNA 5H81A 1ECGA 3HA2A 1GPJA 1JTVA 2KWIA 4J90A 2D1RA 1CJMA 3S70A 3ZU5A 3ELYA 3O3MB 3GRPA 1F2UB 3MJDA 1XTTA 1QGUB 4LRWA 2H48A 1UIMA 1SHTX 4E6PA 1X8JA 2AVNA 3MJSA 5ECWA 1DC8A 5J4HA 1K6JA 4QHSA 3K5PA 3KYIB 1OTYA 3HFSA 2CLSA 3GVHA 3PI6A 4X20A 3BGOS 1RAFA 4V0ME 1SXGA 1TQ6A 1TO2E 3DC2A 3EULA 1EXMA 1I4LD 1A96A 4Q12A 1A72A 1L5LA 1KPGA 1GR1A 2HT1A 2CK3A 1TO6A 2UVDA 2XRMA 2Z8ZA 1UOPA 3LKBA 3KFVA 1FXUA 3OPYA 5GONA 1SCDA 1BO6A 1NY6A 1RT9A 2P9TA 2RGXA 4FD2A 1XP5A 4BMCA 3ZWCA 4EIWA 1XDGA 4DCVA 1AMUA 1DXQA 1AO3A 1B8OA 3Q7RA 1QO9A 1C8BA 2ACVA 4RFSA 5LZ4A 2EFEB 4Z86A 3D7NA 2ZUCA 1J23A 1MJ5A 1RYNA 3B3FA 3FR7A 2NAPA 2C5FA 2ZJ8A 3I4LA 3O2SB 4RCVA 2NZYA 2PL1A 3S99A 3QX3A 3I61A 2XXAB 4BFXA 2OBXA 1H1LB 1PF7E 2JRCA 3F49S 2R7LA 2FR1A 2ZPUA 3T1TA 2XJ4A 3MBKA 3QU5A 4JHXA 4EW3A 3TB4A 1PUIA 1OZFA 2NLOA 4WESA 4JB8A 3ZCUA 5MN4A 2I1VB 3KO8A 4YJKA 3LC7O 3FBTA 2Q4OA 3EQ2A 3PC8A 3CLVA 4Q4AA 3L4JA 4LZAA 2X5XA 1PJ2A 4E21A 3KYJB 3ZVNA 3MMZA 3CVXA 1CBUA 1MTZA 1ABEA 1N6NA 2ETVA 2CF5A 3ZLBA 1EJ2A 1PP4A 1JE1A 2RGRA 5FXMA 1SG9A 4IXDA 2PA0A 2PZJA 10MHA 3F6CA 3M8KA 4JQYA 4BHTA 5KWJA 3DUWA 1HDIA 4X1YB 4Y0VA 2WQ7A 5U4XA 4MK4A 5CA1F 3PHHA 5CP8A 3B89A 1ULTA 3CLSC 4NBKA 3DD5A 3F8SA 3ZR4B 4B8WA 5FO0A 1LC3A 3UK1A 4XX0A 2GRAA 2QW1A 1WSDA 2XMBA 2YHUA 1XQXA 4M1QA 2PQ2A 1JQDA 3MQ2A 4HGOA 3SOZA 4B3FX 1AQJA 5B1YA 1FSPA 3VJLA 2A67A 1DI0A 1E0AA 2AG0A 2XLCA 3TKLA 5LUAA 3NHBA 4DA7A 3GGDA 1SBIA 3T5MA 4RF2A 3N2GA 2B4RO 5AM0A 2ZS8A 3O8OB 5DYTA 3BRWA 4G1CA 2EATA 2F1KA 1EJ0A 2DY1A 2CDBA 1VE1A 2JH8A 3OZCA 3IVAA 4BPRA 4PTYA 1OBCA 3KQLA 5B4TA 5C2JB 2ISCA 2J5XA 1P81A 1RYYA 2DWPA 1OHHA 3M4NA 3VMFA 1OLXA 4TMWA 3E82A 2OBYA 2P0YA 1T9BA 3TCXB 2EG5A 5ESWA 5BSUA 3UOWA 3DZHA 1K4YA 3AERB 1XK6A 5IXYA 1Z68A 1ZN9A 4LG1A 3STYA 1TDJA 1OROA 4E2WA 1RWXA 4TV8A 4A2PA 3G0HA 1FTWA 1XWIA 2BC9A 4PO9A 4M88A 2FPUA 3ISTA 1NC1A 2XGSA 3PNQA 2LBPA 3O2JA 4UVHA 2GDJA 1AN9A 3TDMA 2HHAA 5A9SB 5HYVA 1J1UA 4QUJA 1XPJA 4KXYA 3HKEA 3I9LA 4M1WA 1EFDN 3MJRA 1LTHR 4N49A 2IHBA 5IKOA 5B57C 2RHDA 4EKIA 4QASA 1WY5A 1OA1A 3ZY3A 3IUMA 3C8ZA 3IUBA 3C7CB 1L8LA 2J67A 3O5AA 1T10A 2XJ9A 1T3LA 4LSWA 4QDKA 1K8QA 4C0BA 1ZRSA 4L4YA 4MEBA 2DBQA 1N2ZA 2WLSA 2RHHA 2Y2UA 3GEEA 2H7CA 5TQ2A 5T4EA 2EX4A 5JVDB 1JTFA 4N3NA 1QHYA 2YN0A 1XVAA 2EU8A 1APBA 4NYIR 1OLOA 4UNPA 4U6SA 2ZB3A 5AVKA 1NF3A 3AJRA 4EVRA 4K1XA 4L50A 3NAMA 1Y80A 3WAJA 3U44B 2P3LA 3FPKA 4C43A 5H82A 4DIMA 4LDQA 4IUCS 4BLSA 3IQDB 3O4JA 2PKYX 5FOSA 3D4IA 1TIBA 2VTEA 4FSHA 3K4QA 4TN1A 1ZG3A 4ZPXA 1JQKA 3PVZA 5LXTF 4OAQA 1EP2B 4XQEA 4EGCB 4IOLA 4KFSA 5A7GA 3N53A 1KOJA 1XTJA 3FBGA 5EGSA 2JHAA 4PNEA 5KU7A 1V1RB 2O2SA 1Y6QA 2NTVA 3COWA 3JASB 4N3BA 1GU7A 4BE4A 1DAHA 3NNSA 1N2XA 2YFHA 4DNXA 1W0CA 2P6PA 3KE9A 2EXXA 2EJWA 3H2YA 3CMCO 2IT1A 2V97A 3PNPA 5G3ZA 4ER3A 2WW8A 3UWSA 4EFKA 1QKJA 5BP7A 2QE7A 1ADCA 4C7KA 4TROA 2C20A 3H2SA 1ZGBA 3PNSA 2ZJAA 1S2IA 5CM8B 2HLNA 5I48A 2WDZA 1NUQA 2X4LA 3ZY5A 3MZ0A 3DE0X 3L1UA 5AW8A 4PG4A 1ZMXA 4UUPA 4XGQA 4KPEC 4U7PB 3TIIA 4KMRA 4QKQA 4OCZA 4H0CA 2Q29A 2BV3A 2WILA 2FF7A 4BNJA 4RTLA 1SXJD 4Q1CA 4UBIA 3FUWA 3BKWA 4GGPA 3TN7A 1UR5A 5A3QA 1BSVA 4E11A 3W78A 1FPMA 3AKZA 4HTFB 1NXQA 5KVVA 3A0UA 3SYNA 1BJKA 1U7WA 1LEHA 4ND5A 3H42B 1GCIA 3D6MA 1PRYA 2VTBA 4JLSA 1CZNA 1VI2A 1PJTA 1L3IA 2YV3A 3NOOA 4FHDA 3K72B 5L45A 8MHTA 4I08A 1ATIA 2ZYAA 4FU0A 2C78A 4DRYA 3DSRA 3UWMA 4AJJA 2P11A 2YHIA 1DHRA 1OC2A 3M1LA 5EINA 3ZXXA 5ED4A 2I3DA 2Y66A 1ORTA 1VKOA 2A9VA 1CUEA 2MU1A 2FG7C 4ZVMA 5GV8A 2ZIEA 4UTXA 1N3BA 1ZGAA 5EVCA 5CT5A 1T4CA 2GR9A 1TADA 1E7RA 2QNRA 4IBOA 1OFGA 3S2SA 1VLHA 3HBAA 4OP3A 4Y1RA 1WVMA 1ESMA 1GOTA 4EYOA 4HK4A 2PPVA 4JJZA 1A9YA 1Q1GA 1RMQA 3QKIA 5DFAA 1FX1A 2ZTUA 5H16A 2WTEA 3CNBA 5B6PA 1Q84A 2ZE6A 3WA6A 1PX0A 3A27A 2GLTA 2VDRB 1SVMA 2YVLA 1RBZA 3OFNA 1VIDA 1DUSA 4PLPA 4BMYA 3UPTA 1D07A 4DA0A 2DPYA 4Q3DA 2BTEA 4OHRA 1NV9A 3HO8A 3NTXA 1IWPB 2P68A 2OVBA 3GEPA 4LJ8A 3WGYA 4EG0A 1O87A 1YVEI 1H3FA 3PYXA 4KE9A 1P61B 1ZNXA 1D9XA 2GEKA 3U3RA 5EHIA 2R0QC 3ZXIA 1GG9A 2AVDA 3TZHA 5D85A 1ZU5A 2NACA 1MLDA 3G9ZA 4G4JA 4RPLA 1G2PA 1C3EA 5EE0A 3RAJA 1K68A 2AZTA 3AF5A 1RVDA 2PWPA 2CLKB 1S2MA 3LUAA 4RQTA 1G98A 2IRWA 4MVYA 2YHBA 3GAFA 1GCAA 4NHEA 4AN0A 3D0RA 3RLFA 1CPYA 2CL7X 5HKAA 1VIYA 1RHUA 1M10A 2WD7B 4EL0A 2EZUA 4AG3A 2EBHX 4MJ3A 4V02A 1XHFA 1U8AA 1PGPA 2NVOA 5HTKA 5TJHA 1VQ1A 2J4CA 3WNZA 4B4DA 4F3YA 2PKRA 5BY2A 3UNXA 3W05A 4DCSA 1XZMA 2O3SA 3L79A 4X5OA 1Y82A 2FGKA 4ZO9A 4J16A 3TX6A 4W5RA 3L0IB 3PNLA 3ZEIA 2AIRA 2WDPA 2BWJA 3IOYA 4J1QA 5K3FA 2HU5A 1I2BA 4O5OA 1CRPA 1EP1B 1BZYA 3GHYA 4QBHA 4X90A 1GL6A 3FXAA 2DKFA 4FMPA 5BW6B 5K4GA 4B6QA 2WJVA 3SG0A 3EPKA 1T0PA 5BURA 2FV8A 5JY6A 2YQ4A 1Z7YA 4LBZA 4BQOA 1PJSA 3RR2A 3HVHA 2Y05A 4OX9B 4URWR 1N0WA 1XMPA 2V6FA 3MM4A 1B93A 3PUKA 1NTRA 3H2ZA 1NVXQ 1KYZA 5FHRA 3Q3CA 3T0FA 4U2DA 4BRUA 4RJTA 3KDSE 4NPHA 4YLYA 1ZGGA 4XE5A 2XGJA 4O4HF 4TQAA 3D8UA 1L7QA 1IN7A 2FMKA 2OT3B 3KC2A 2EHDA 4QEDA 1RYDA 1UJNA 4PFQA 1UJ6A 1PQPA 1MHPA 5ECYA 3RASA 3ZZNA 4AYTA 1GG2A 2E5WA 2R47A 5ALOA 3D3QA 1YR8A 1QV7A 3LBIA 1YRHA 4B74A 2Q3BA 3HB0A 4EJSC 4LSZA 2BMFA 2GGSA 3KM0A 1HY3A 2ZKIA 3KR9A 4WFKA 1YMQA 3JSAA 5ALSA 3VTAA 2VSQA 1U90A 2GD0A 4N6GA 4GRDA 4N8EA 2H85A 4S2EA 4ZI7A 3CVWA 4PRLA 4MLPA 4XM2A 4RF3A 4DQXA 2YS6A 2XOKA 2IYNA 4N18A 4KOEC 2LCIA 5SY9A 4EPXA 2HDWA 3QU7A 4FR5A 4PN7A 1W85B 2VK8A 4OI1A 4TS9A 3UT5A 1K5DA 5FQNA 4CODB 4HWOA 1T0IA 4C04A 3BSYA 4BV3A 4Z0HO 2IL1A 4N0QA 2ALJA 3ZE9A 5ULLA 3ULKA 1U3FA 3QTTA 4RS3A 2ZP1A 2WZCA 3W5BA 4ME6A 1Z88A 4ND3A 3OF2A 2FX2A 1M34B 3OLVA 3QSGA 4NG4A 4QLBA 1I13A 1XRLA 3QWIA 3HVKA 4WH0A 4B3CA 2O2XA 2HF8A 3V6LA 1BXKA 2ZJ6A 5F77A 4A92A 2BGJA 3FHLA 3ZWVA 1T8YA 4EZIA 3A9UA 1ULAA 1XJ0A 3A3YA 3IHTA 4I1SA 3RSQA 3W5CA 4GW3A 3ROEA 4V3BA 3BFJA 9LDTA 4PG7A 2O8CB 3TZLA 5CM9C 4OA8A 4RE6A 2K4MA 4EABA 4QG3A 2W6JA 3KJGA 4JFAA 4CM1A 3WLTA 3HVUA 4OFWA 4LOJA 4F6CA 3TCKA 4Z2YA 5FBVB 3O84A 1D2MA 2BLNA 4K6HA 2YXBA 4BKUA 2YY6A 4DA6A 4Q9IA 2Q5LA 3DCYA 4ARZB 4ALLA 4JV5B 3PEUA 4DMMA 1R6DA 4NS4A 1EIWA 1CF2O 1WULS 1W6RA 2OZEA 1WBBA 1EJ6A 2QM3A 1KP2A 3IEXA 4H1TA 4RPKA 3VDXA 3ZWYA 4PAWA 2D5AA 1GFSA 1MB0A 4EEXA 2I9PA 4HO1X 2UUPA 2NXJA 1R0WA 2PSFA 3NGLA 4Y6LA 1PZHA 4K9LA 3ZQ6A 3MRTA 4BJ5A 1Y6FA 1WLYA 1IN8A 3AZOA 2WP0A 3HN7A 1GITA 2JGLA 2VPWA 2G0AA 1TIPA 1CQJA 4I1VA 1KL7A 3GJXC 4I3GA 4NBWA 2VXCA 1FDVA 4AO7A 1JSZA 2LNDA 1GYQA 1U9CA 2WPDD 3IE2A 1WNTA 2QUJA 4LE0A 3D7MA 5GGYA 3X3HA 4NARA 2F64A 1T6YA 4CQMD 4I5IA 4W8HA 1TZJA 2ZYSA 3STWA 3FWKA 4J0JA 3VUEA 4HV4A 3L6RA 1VIVA 5EP2A 5KYKA 3TRHA 1ZM4A 4MROA 3KZ1E 4EX7A 3EVNA 5BNWA 3VR4A 2IS2A 2A9OA 2XMCA 3G0GA 2FGJA 4I4TF 2JJQA 3WDLA 1OZ0A 1T8SA 2LTAA 2PZEA 1GJRA 2G5CA 4P3KA 3V4RA 1IDOA 3ESRA 3P71T 5ERGB 1GPLA 3GGCA 4C0WA 2XCRB 4CCAA 4QJ3A 2AMVA 1KI4A 1YOBA 4X84A 1QSGA 1QRRA 3E0QA 4GLJA 5HIMA 1QHXA 3S5JA 2HQOA 2HIGA 3K4HA 3L6OO 2EDAA 4GC9A 4RMNA 3S40A 3AP1A 1GL7A 1YVUA 2FZ4A 2FMHA 3QVXA 2NO7A 3A1NA 3R3UA 4W4TA 4WZ6A 3TKAA 3TTSA 3G1UA 4C20A 3E7PA 3A4MA 1SXJC 1JPJA 5I9LA 3TR6A 2HF2A 3BMCB 2PRJA 4PGGA 3JVDA 4YY3B 2I67A 3OEYA 3EIWA 1P6QA 2WEKA 3LX6A 2AOTA 3LOQA 4MR9B 1V3UA 1UDAA 1HL3A 2NAFA 4P4SB 1XQ9A 4HP8A 5FI0B 1F4LA 3CVYA 5CNMA 3CIFA 3C3PA 3VOTA 1UMBB 3G89A 1ZK1A 4MH0R 4ZVSA 1ONPA 3LPMA 4DL9A 3I5UA 5EJFA 1Z4QA 3ZGXA 2B4TO 1GZ4A 3B6JA 4D3XA 1QQ5A 4PLGA 4DIKA 1W46A 4CT4B 3H05A 5G4KA 1YR6A 2ECQA 2C88A 2W37A 3BQNB 4HDNA 4WGGA 5FA8A 1G21A 2AJ8A 3ROFA 3SX0A 4F45A 5JBNA 1EHYA 1XTIA 2FZKA 3ENQA 3HB7A 2JEYA 4J0KA 2B8NA 2FFAA 2G6TA 1IAVA 5IVDA 2FFJA 2CD7A 1R0KA 3C3MA 1X1RA 3CRMA 2AB0A 5DBOA 1E2GA 2O5EA 4K81B 2Y1CA 1G8FA 1T9DA 5B53A 1U0RA 1MX1A 2ANBA 3L3BA 1V8OA 2F1OA 3LD9A 5B1HA 3SQDA 1DC4A 1V8BA 2AFHA 5MGBA 2GPBA 5BNTA 2Q3JA 4KQEA 3D8RA 5B1SA 2VP9A 1WUIS 3PUZA 1LBQA 1QYVA 4GPIB 4TL7A 1E89A 3X2SA 5K0SA 4DEVA 2YOHA 4LGMA 3S8MA 2DEUA 3EIEA 4MHSA 1RCFA 5JO9A 1LA2A 4XPZA 2ZI7A 4RD0A 3UCXA 5DVZA 2Z08A 3G7UA 4Z4FA 2I6GA 4P2GA 5DV9A 1QRSA 3CLUD 5IBRA 1ZDMA 1QYWA 1KORA 2ZYDA 3CV3A 3ZIDA 2I1WA 2NOAA 3WKBA 4DB2A 2XDAA 4QGFA 2V7XA 3LDHA 3M4YA 5L6LB 2DPGA 4TUYA 4R0MA 4G97A 1QHEA 1GSIA 4LWOA 4UD6A 1Z83A 1P2TA 4OJMX 4FYPA 1M6NA 3U0BA 4C5AA 2Z2IA 4XEUA 2BHLA 5MDHA 3NNNA 5I47A 4NENA 3CCCA 4KBGA 5C8YA 3H6KA 5BXYA 5U9CA 1YU9A 1TAQA 3RBZA 1ZPDA 4I2NA 4JXZA 1Q19A 1A7JA 4UTZA 3RQIA 121PA 1P9NA 1YTUA 3OIFA 3ADOA 2PHZA 1NFQA 3F71A 1IM2A 2OHJA 5JS7A 3B1ZA 2ZCUA 5KNCD 4ND7A 3KPJA 1V1JA 3LUGA 2LKCA 4BO5A 2XMPA 5HG0A 4KO1S 4MYSA 2PL9A 1W5TA 1Q92A 2OAEA 5REQB 3KL2A 1S8OA 3H2JA 3L8CA 3OEWA 2UZ1A 3RU9A 2C9BA 3CUTA 4R1LA 5EIEA 4BO9A 1DAFA 3BUSA 4P7JA 1Z6XA 3IPCA 4I50F 4NQZA 4ZT2A 5FYQA 4AL4A 4ER7A 1CLUA 5J4KA 1H8HA 3NXSA 3N1UA 2J3QA 2EJTA 1N7GA 4X85A 4BQQA 2BMDA 4JXKA 4CKCA 5CDUA 1M7BA 1MP0A 2BCGY 3PHIA 5JMOA 4YJFB 1PS8A 3PNOA 2GK3A 2HIAA 2X2FA 4Y1FA 1AZSC 1NRIA 1P2FA 2V6BA 3QY9A 4I9NA 2QTGA 1U3VA 4L1KA 5TGDA 2ZUTA 7MDHA 4Y6SA 4MS1A 3NTLA 4QTTB 5IP5A 2H6EA 4HNAA 1UP6A 1F17A 1PN3A 1H9BA 1NXVA 1N6OA 1QVVA 3CX4A 3O83A 4P4TA 4E07A 4E3ZA 4E5PA 3KQVA 4O4LF 5DWQA 4UTNA 3F5FA 3Q8LA 1R6BX 3B9BA 5LVAA 3GVIA 3V1TC 3QKRB 1GPKA 4KR7A 5T4HA 4JI1B 4CGYA 2COKA 3I37X 3QNMA 1NJFA 1G8SA 3IBYA 2OCXA 2JK1A 4UNQA 2XE6A 8ATCA 4WPGA 4R7TA 5LA6B 3UHJA 3Q0TA 3MVEA 2B7LA 4BO4A 4B3SB 4M89A 5KI6A 3WYDA 3MPOA 2J9FB 3OZSA 2D54A 2QMOA 3F90A 4DABA 3T6KA 1G19A 3SYMA 4P9NA 2IOYA 1QYXA 3K0FB 1KRWA 3M83A 3ZNOA 3IBFA 1GKLA 2H0AA 1PG5A 4EB0A 5BN1A 3GN2A 1IB0A 2WHRA 3MGAA 1FUUA 3U4GA 2MCFA 4RL6A 4JR2A 3ELWA 4OHMA 1MQ8B 2WHYA 2HFJA 1YU6A 3DTVB 2MSEB 1FMCA 1XKTA 1XC7A 3HKDB 2BEJA 1M72A 2QN9A 1DTWB 3EDCA 2FU5C 4JWKA 5JYBA 4AP5A 1DGQA 1ID8A 1N2HA 3GB9A 4QOEA 1Q12A 1UBJS 1ARZA 3BIFA 2DHCA 1GYPA 3HDQA 3SM9A 5IT9A 4BL5A 1N36B 5DCUA 1T1SA 3R7NA 1P2SA 3RTEA 3IX7A 5K3BA 4LJYA 1QE5A 3SXUA 2DE0X 3S1AA 2QRPA 4AJIA 2FHSA 3B60A 3ZCQA 2RSLA 3OU6A 4LXIA 2PCLA 2B4QA 3N59A 3O4RA 5TQJA 2OHOA 3GLSA 3IVGA 4M8IA 2G9QA 2ZE5A 1QF6A 2XE4A 1K2WA 4L15A 2QL6A 1H6DA 4FXPA 3MBIA 3A04A 3QBDA 1O9GA 2PUHA 2YXEA 3P9KA 3DL7A 4PIMA 1ABBA 3U9SA 1AXGA 2GO1A 2I6TA 4LYYA 2IP1A 2PZMA 1TUGA 1BKSB 3M6XA 3TNYA 5KDOA 3FZEA 5GINE 1YS6A 1TA4A 1L4HA 4M6WB 1YFZA 1M33A 5HS6A 4FFVA 2WY2D 1K88A 4LYGA 1VL8A 4Q7KA 3TKYA 4FWIB 3W6NA 2XUGA 4DLLA 3GQBB 2DJIA 3ZS8A 1HE8B 2P41A 2X4DA 2VL7A 3K1AA 1RI2A 5JNRA 1OA0A 3RRBA 3ZI0A 2EW1A 1S7GA 1M0WA 1L7MA 1VL1A 4IEFB 3U7HB 4DUPA 3DUFA 2QX6A 4BB5A 3TOSA 2NSHA 3PYMA 5IUKC 3ANMA 4BMVA 4FFBB 1TU0A 3JQGA 4KZPA 5HPYB 1B6SA 1D7AA 1AKYA 1C30A 2CXQA 2CXSA 2FETA 2RIRA 3EEQA 3HU2A 2VZ8A 3ILVA 5FWDA 3RARA 3BERA 3BTOA 2RI1A 3W5VA 3GMIA 4Q9NA 4RDHA 1YS2X 4OK3A 1J2UA 1J56A 2D5BA 4L8YA 4W5JA 1JA1A 2YWEA 4BAUA 1E5VA 3UV6A 2I6SA 3D7SA 5U4QA 3OC6A 4JX9A 3QMPA 4CMIA 1DIGA 1KI3A 1M1XB 2CDNA 1NLYA 1IC6A 5JCOA 2HCTA 3R6DA 4ND4A 3WWEA 4B33A 3MK31 4W5OA 1P18A 1VGQA 2ZANA 3UMSA 5J5VA 2ZB7A 5LL6P 1ZD2P 3DE5X 3HB1A 3DF7A 4N76A 1D4ZA 1LX6A 4Z53A 2P3SA 1IY1A 3K73O 4WK0B 5F64A 5FWXB 2A92A 4CQMB 4BFTA 1ZIDA 3RYIB 3TI9A 2NU6B 4X66B 3V7NA 1JH8A 1HYGA 1S3FA 4II2A 4YGYA 4EY7A 2HQBA 4EHBA 3IQWA 4Z0TA 1CUFA 3V4ZA 4TS4A 1RZVA 1Z6ZA 2DPLA 2XTZA 3LGSA 3QVSA 4HRXA 4MWTA 3LQ4A 3NEYA 4IZOA 4CG0A 3HJFA 4P34A 1CQIB 3KKEA 2J0QA 2EBUA 1QH8A 3GEBA 3L6BA 4WOJA 5D7NA 2Q99A 3PQ8A 2B6NA 1C7JA 2NV0A 3KIPA 4JYAB 3JQ8A 2AC2A 2A0UA 3LQFA 3I28A 4EI9A 1EFAA 2W8BA 4YT8A 3RVKA 3NT5A 1BD3A 1PDVA 5LJIA 1HLDA 1YAHA 3RG8A 3GLGE 3TVDA 4CM4B 2AEFA 2D1FA 4PAMA 5E6UB 2FPOA 2JCGA 2OGUA 1M83A 2YJGA 2I71A 3FZNA 4J2OA 4B3IA 1WF3A 4YUAA 5MF6A 4QUKA 1V1MB 2RHGB 4GXRA 4CDMA 4E5VA 1VHDA 2FPPA 3DMFA 1QRDA 2FPRA 1AQLA 3Q88A 4OHWA 1H5NA 4WJKB 1QH9A 3DZCA 1NIJA 3HCRA 4MDHA 4WXRA 5LQNA 2ZPAA 2WSYB 2XUPA 2JI6A 3DCIA 4NWIA 5HX7A 3TGPA 4F5YA 3ZZMA 1Z4NA 4HDMA 2JHFA 1NQUA 1Y42X 1SZJG 2VI5A 5KNBH 4RAOA 3T7IA 1QANA 4FE7A 3IP5A 4Q7QA 4ASUA 3B52X 3BE5A 1PGJA 1QQ6A 2YWFA 4F6RB 1MO3A 4REOA 4YRNA 2IPAB 3G9QA 4NOMA 3ZZTA 4ENTA 5KQGA 3E9CA 2VUUA 4EJSB 4N9WA 1XF1A 1HQCA 3I5MA 3B1VA 3KQUA 2ICAA 2RGEA 2WJ6A 3LPNA 4NZZA 1AHIA 5CA1B 2XGMA 4UUNA 1CUXA 4B80A 4OKIA 5CHEA 3F67A 5HJ2A 4ZAFA 1TFRA 2GN0A 4I5FA 1O0CA 1LFDB 5IVKA 1RWWA 2I6FA 1Z73A 2FVYA 4UEJA 1YL7A 4HN4B 5JOQA 1KFEB 1V8DA 3VZSA 2XW6A 2VZLA 3JVEA 1JG6A 1CUZA 5CEFA 1Z3CA 3QUAA 3BCHA 4QLAA 1T5LA 4ZT4A 3ZV6A 2OLKA 1S3SA 2BONA 1QM5A 3BXFA 3EF3A 1GGJA 1IQ0A 1TTQB 4TTVA 4AKGA 2ZYWX 3NXKA 4GR5A 4OH7A 4WNAB 3ZGYA 4EG4A 4RGQA 4XZ3A 1VCMA 2ENWA 2GAFA 5AVJA 4Z99A 3EOBI 2VHWA 1YE5A 2IZ6A 1W88B 4OL9A 5KTOA 1JZQA 4MV1A 1Z4IA 1CNFA 1AB6A 4Q7MB 1QYCA 4C0SA 1GEGA 5IJXA 1LQTA 4PZEA 3U7QB 1JJAA 3H65A 1E2FA 1FRZA 3D0KA 3QF7A 4DSNA 3FPAA 2DUNA 2J3KA 1ZN8A 3PTLA 2GEBA 4CKBA 1Y6JA 1LK5A 4RTJA 3GOQA 2OCPA 3PC4A 4HQNA 2DFDA 3JX9A 3M6VA 3HA3A 1W8IA 2ZWOA 2PXXA 1V5IA 4M60A 3T9EA 2BFCB 4KR3A 5A4MS 4ID9A 1GQOA 4IDNA 2M6KA 2DH6A 4EY8A 2NT3A 5BV8A 3ENKA 1BXRB 1S1CA 5DYIA 4K1LA 5SZIA 5C8ZA 3NWOA 4QUEA 4B79A 2LPMA 1RDFA 1W4CA 2NVWA 4FSXA 4ZC1A 5EZQA 5LLSA 2XSZD 3WB9A 3DAHA 3QLEA 4J6EA 4LPSA 1L4FA 2P9HA 3JAWA 2C7QA 3OIGA 3ORYA 4WLOA 4Y9TA 5L3SB 1BQ3A 3QVWA 2VWPA 4WNYA 2W2KB 3IYLW 2O19A 4UOEA 1TJ5A 1EZ1A 3K8OE 3Q3HA 4QELA 3WLJA 4Z51A 4US1R 1J25A 3G2PA 1C9KA 3UXHA 2VHTA 1NHGA 2WJ4A 3DTNA 3MWJA 4H7IA 5A1JA 5FPYA 1ONNA 4JROA 2GOYA 4LTDA 1GQRA 1TEZA 1AN0A 3KQKA 3W90A 2BFBB 2ZT5A 1XVIA 3JYHA 5THXA 4DQUA 2FCRA 3GDOA 2P9QA 2C7OA 1SUBA 1VE5A 4MO9A 1BFUA 3IDOA 2W6QA 4KE6A 3ZCPA 2VDWB 3AUSA 1C7FA 3SYTA 4MW5A 4R1NA 4RM2A 5LXTB 2F9FA 1LU9A 2CV1A 3FF4A 3IOEA 4BMZA 3ABZA 4QWWA 1W52X 3SFVA 4RH3A 2HWWA 2LV8A 1KF0A 2TECE 3RFFA 1Y9JA 1XUOA 3MUEA 4WW0A 5KHOC 3RRNA 5DB4A 2VJYA 4D3FA 5ALPA 1E2UA 5F2EA 1T4MA 4AECA 1WXIA 2JFOA 2B35A 3M9WA 1USGA 2QNBA 1KO8A 1P2UA 4M3NA 2G80A 1C8VB 1OB2A 1IBSA 4NCXA 2EIHA 3JRNA 1JEAA 2CKDA 4MLDA 1UZMA 2BGUA 2QXYA 2OAGA 5AXAA 3V4SA 5IVPA 5B1DA 2DUMA 1ILWA 3F2IA 3ESZA 1CJUC 1GZ6A 2TRSB 4GP9A 5FFMA 2H5IA 2J3DA 3AETB 3K05A 3WWPA 2PX2A 2GDZA 2ZAIA 3RS5A 2WJYA 4MRMB 4WZBB 1SR8A 1WEHA 3EDQA 4GH5A 2GD6A 4E5DA 5CLQA 3GLHB 3W3ZB 2WC1A 4OVKA 1BEEA 3K9BA 2C4HA 2Q27A 1B8UA 4HOYA 1ODLA 3C1TA 2Q5EA 1NQTA 1UM9B 2LE0A 4A26A 5IYZA 2P4EA 1DEAA 3RRJA 3VC3A 2GYVA 2OCKA 3H13A 4F3RA 1DG9A 1GTZA 3EGDA 3BXGA 4JUAA 2XZOA 2A9FA 3IJPA 3K0CC 4IV5A 3DQPA 2O8BB 1SXJB 4QSMA 5IRCD 1DEKA 2DETA 1F0NA 1B43A 1QFMA 1IU9A 1I1OA 2J3EA 1I6LA 3MSCA 2EYQA 1E9BA 3GJ0A 4RA6B 1U7DA 2K7FA 4PE5B 2CLLB 1W48A 1XDUA 2RFLA 2CLOB 4OQLA 4RY8A 3RVOA 4XVRA 1RR6A 3TQCA 2O2ZA 1QNFA 3K70D 1QRTA 4KPUB 2Y27A 3AR8A 5LQCA 3FZQA 1QGUA 1QONA 5NLLA 3UPDA 2QN8A 3FVTA 3EFEA 5DTIA 3GLUA 3PF8A 4C03A 1GLGA 4RD6A 3JD3A 1NW6A 1MTOA 1QVZA 1U1CA 1XTBA 3DF9A 3NEJA 3PHBE 3QU2A 1MO4A 2D0IA 4FOLA 3B7WA 4I4NA 4IG9A 3HDTA 3SZLA 4V0MA 3S7ZA 5MGNA 3NC1C 1A04A 1U7OA 3QKUA 3DEFA 4L16A 1U4OA 3ZIUA 2FMTA 1C1HA 1V5FA 3W8DA 4DZTA 5GP1A 3T3HA 1U8XX 2DWCA 3K31A 3CSUA 5EEGA 2ZUVA 2ZGVA 3B3GA 1LQUA 4LX8A 3GLTA 5CVDA 2QLFA 3G23A 2QK4A 2Y1LA 4YONB 3V48A 5KYYA 3T3PB 5KVAA 3RHTA 3WB1A 1XZIA 3OE7D 3ME5A 4KE7A 3RSLA 1UK6A 4OA5A 3TVYA 4OHKA 1TKBA 5AW9A 2IC5A 3AESB 1B1AA 1Y33E 3GWZA 3KOOA 3T7JA 3VR5A 4YJ3A 1T1JA 3KYCA 4LGCA 3H1TA 2VUHB 2OM2A 5K51A 4AD8A 5K0TA 2HW8A 3VNUA 1XLUA 1WEKA 4MQFB 3K0EA 4K9RA 4N3CA 2QQ0A 1RM3A 5ELXA 4FLEA 3WMRA 4MHOA 5GZ3A 1NLUA 4BWVA 5KTPA 2E18A 1NOJA 3WBJA 5IDWA 3W5AA 1MJHA 1U1GA 3MINA 4YASA 1P19A 4Q4JA 3G3EA 3SF0A 3SSOA 1PD1A 4WDQA 3FNIA 3OIDA 3ZH2A 1F51E 1JLSA 3ZOKA 1Z0DA 4E1AA 5C7IO 4L6CA 2G6BA 3QIVA 4CKEB 3BWMA 3UXYA 2AK3A 3L8EA 4V0SA 1R5JA 3E23A 4RJJA 1ISJA 4AJOA 1TT5B 4CNQA 3TL3A 3A3PA 1ISGA 4X1YA 3ZLVA 5L51A 2PUJA 2VRCD 3ZQ4A 1G5HA 2P5YA 4J0EA 2ZK7A 5J1SB 2WG1A 1IMOA 1T91A 3AMVA 4UCXA 1DWPA 4UHBA 1WMAA 1PJBA 2SHKA 2DUWA 4IZ6A 5ECGC 5BSVA 4NCAA 1FZTA 5HCUA 3ADDA 3AHEA 3C1UA 4BGEA 4KH1A 1JG1A 5K3DA 5LN1A 3N2LA 5JYEA 4BFUA 1AHNA 1E79A 2ZVPX 3CRQA 4ND2A 5JE8A 2CYCA 1JZSA 1ZVJA 3NU1A 4XD7D 3VZPA 3TRJA 1C4KA 3SHOA 4BQSA 3JZFA 4PLWA 6LDHA 3UBTA 3ZWQA 5LMUB 2ID7A 3ZWWA 2Z95A 2FDCA 2OMEA 4A0GA 1OE0A 4O4HB 3OM8A 2NG1A 4DJAA 5IHPA 2JLXA 4TYYA 3QA9A 5K45A 2OO5C 1L3CA 1VCNA 2IPNA 2PGJA 4LRQA 3PQ7A 3T4XA 4CDRA 3E15A 5DI3B 3QUTA 3VSCA 4D99A 3RRYA 3FSEA 3IUSA 1RYZA 4RK7A 4ZKDA 4F91B 1IN1A 1ZMTA 2AE1A 4ROTA 3VXKA 3OIWA 1EUZA 1EBFA 1O6FA 3IJEB 3OSUA 4K86A 1Q44A 2WIBA 2YICA 4OM7A 3WGNA 3ZHVA 1Z6GA 3ZE0B 1YB6A 2HLDD 4DXHA 2EC5A 3KVYA 1XA3A 2VAWA 4I46A 7MHTA 1YRBA 5H3HA 4BFYA 1YR2A 9ABPA 2MYPA 3AHFA 2EX1A 4PR3A 3ZNNA 2C9CA 3OZFA 1FSSA 1O5IA 3GVCA 2P2YA 5K2MA 2W6OA 3H9BA 4RDCA 4GPAA 1KK0A 2X5KO 1U80A 4BMNA 1DIOB 3MCUA 4PRZA 1VSQA 3B5EA 4Q1EA 4REMA 3RT1A 5JR3A 4JBNA 3WLEA 4NBRA 3TMYA 1N9ZA 4PGFA 2VF4X 4R2IA 5IM5A 1OV6A 2ZIZA 1H23A 2WJHA 3VAZA 3KJZA 4CMEC 5H8WA 3G8YA 2NMVA 4EH1A 2UXCB 3SQWA 3WR5A 3U44A 1Z0JA 3BTVA 4BVJA 1T6ZA 1W0JA 5IF9A 5TQ0A 1YDEA 3V6MA 4ZU1X 4E03A 2BRUA 2JBHA 3R77A 2W42A 1KVTA 1YZUA 4GYKA 4XXHA 3OT1A 3JQBC 4MQ4A 3SBDA 2QZJA 3EVFA 4C1BA 3ESQA 3K9NA 4G8BA 1V1RA 4YPVA 3E58A 5EE3A 5SZKB 3KKZA 3GXOA 2QJWA 2POCA 4LRTB 3EOZA 4Q9LA 3WNVA 3DB2A 2QUKA 4N7JA 1VKZA 3BC1A 3BGWA 4WUTA 4QVKA 5LMZA 3I5XA 3OA2A 1L4LA 1Y1PA 3COYA 1JKXA 3KD3A 1XK7A 3IUNA 1S8FA 3PTZA 3NC0C 4FGWA 5F2NA 4LK3A 1N7IA 1YS4A 1MAWA 3CB2A 2D1QA 6YASA 5K0GA 2YDXA 5EMHA 1HDZA 3PJEA 1L5VA 1VB3A 1BNCA 2ZIAA 3TOXA 4ARAA 1NXWA 2VK2A 5BWBA 1KKUA 3DVRX 3WQBA 4L3OA 5CU7A 5DZSA 1G16A 5IJ9B 1TA9A 3R9WA 1MV8A 5C7OO 3NVKI 5EJ9A 1XCJA 1RYFA 1Y7TA 1FU7A 4AKSA 2J5RA 1TMOA 3A4NA 3OPXA 1Q0UA 4HVAA 5HRAA 1V7CA 4DKXA 5K7SA 4C4SA 3U7IA 5D3MA 4RFLA 1N7HA 1SZCA 4TXJA 3KETA 1NLMA 2TSYB 2CVOA 1YDFA 1RM0A 2YJZA 3GK3A 4HDAA 1KKMA 3G0BA 4RSRA 5DTEA 1JDTA 3GY0A 3JQRA 3MYRA 3FMVA 4NMHA 4UU0A 5KNDD 4XCXA 3ADPA 3AONB 2BYTA 2FK7A 2W6ZA 1X0VA 1HDRA 3Q87B 2EWWA 3R5FA 1UXIA 3FR8A 3A2KA 4PQRA 3SSNA 4RAQA 3SXPA 4BDSA 5K6AA 1QC5B 3RF7A 5KUTA 3PEWA 4JYZA 3KJIA 5ARBA 1TGYA 2O8VA 1K9SA 1EINA 2GF9A 4O6VA 3FCSB 1QV9A 2FMIA 1PL7A 3UJ3X 1WP9A 2CLDX 2Q3LA 4MPJA 1JL3A 3RH0A 1F0YA 1X70A 1DQPA 1ZMOA 1ZXLA 2FUKA 2PMDA 1EUCA 2C5HA 3FMFA 4I4TB 1M54A 4WN9B 4N7RA 4ADSG 2BR5A 2CDCA 4H17A 3UWKA 3JARB 2V7VA 3WKDA 1ISPA 1U99A 4BB0A 3LPDA 4BZPA 3HY6A 1FUYB 1YULA 5HNKA 4MAAA 4MRAA 3SZRA 4AO6A 4ENWA 1X7YB 3MS2A 3KG2A 1RZRA 4F4DA 1J21A 3OCVA 4QXAA 4Y2HA 2F62A 4OHXA 2AN5A 3BHIA 3FTNA 3TGWA 1GA4A 1F4PA 3AIIA 3PLRA 1EYZA 3TM4A 3G8BA 3ZY6A 4F0JA 5A2QA 5KX5F 3VO2A 4LFAB 1ZO8A 3GMDA 1JWBB 4JLDA 2B61A 2HV9A 2ZSKA 4OB6A 4RD4A 3UQYS 2GHQA 4LZNA 4OI0A 1Z5PA 1Q1ZA 4I9FA 2RGWA 4C0HA 1SQFA 3OTHA 1RJGA 1US8B 1Y3FE 3DNPA 5T6MA 3IUYA 1QDEA 2R7KA 3AEYA 2PUFA 2ZDHA 3MCTA 4CF7A 1R8QA 3UFXB 3ZU6A 3R9XB 5BSEA 2F9LA 1URPA 3DL0A 4QYIA 4XYEA 5TC4A 1LBTA 3INTA 2XUHA 2XVZA 3DDNA 4NFHA 5LYYA 5I7WA 2YCBA 2WFLB 2WD7A 4FD3A 1P4AA 4F3CA 1NYTA 4I1IA 5JFOA 1QX3A 2Z30A 3K70C 2WE8A 3EIOA 1EM6A 4MB2A 4GKKB 1IVNA 1QTNA 1SOVA 1D7OA 3DZKA 3GUUA 3MW8A 2IV3A 1AGYA 1U81A 2WMOB 2NZVG 5FKJA 1IM8A 1HDEA 2XVMA 4RTMA 1WUYA 1NYLA 1RM4A 1SBCA 2Y1GA 3T1YB 4D44A 3OLYA 4RLHA 4ZO8A 4B6FA 1M1YB 4C0KA 1GL9B 3PFGA 3GARA 2GAJA 2OV3A 1E1CA 1U7PA 1U5BA 2IODA 2P9BA 3QX9A 4MQMA 3AKDA 4ZYVA 3U9LA 3VKVA 3DMTA 1KDYA 3L7NA 4GEGA 1DO0A 1RZUA 3OQPA 5LKRA 1E9SA 1XYVA 1FXSA 2XQIA 3FFBA 3LHSA 2O57A 1TJ4A 4LXUA 1ZLYA 3B7PA 5A0FA 3IR7A 5M5BA 4G63A 2OTCA 2WINI 5JEEA 5JNWA 4JLPA 3IERA 3NIFB 1Q14A 5CNKA 4EYQA 3BJRA 3JU3A 1MVNA 3D6HA 5EXTA 2LDXA 4HFJA 3TLEA 1V16A 1SKQA 5A4FS 2GETA 2VH2A 3CUUA 1I4DD 5JD6A 1H6AA 5FV7A 1E4VA 5HW0A 4E2FA 5BR4A 1XQ6A 2C2YA 3T3IA 4C5BA 4C7BA 2Q4EA 3ISJA 2VIIA 5AXCA 2FNAA 3RGGA 3ZK7A 3JQ9C 4UE3S 1U0LA 1BFKA 4ZK6A 1KDOA 1OXSC 1QG2A 2BMVA 1GKUB 2QPLA 3K09A 4BVLA 3D43A 3SFZA 2B6HA 1TL7C 4HNTA 2PKXA 3FCAA 2C59A 3I2KA 1SY7A 3LW8A 4M0UA 4M9ZA 3HP4A 5BVHA 1H2HA 3JWEA 1NU8A 4S05A 5L3ZA 1QNLA 3AIKA 4C30A 2XGOA 2H4XA 4TKZA 4EY4A 5JXHA 2JEOA 3FTQA 3S81A 1W36D 2XCOA 4M38A 3HQ4O 2BCEA 4PHTA 3WLLA 4RF5A 1ICIA 4WLNA 1XEWX 1M5TA 3ETNA 2CWDA 2X1VA 1W85A 3DM5A 4TTSA 3THWB 4CIXA 1NBOA 4EFNA 3S1SA 3M0EA 3LCCA 1ZIOA 3M6FA 5ITVA 3HBNA 4LYEA 3CPSA 3F6BX 2VLBA 1JH9A 3H5AA 2PX3A 1GPNA 2VA8A 4RTRA 3BMQB 2HWXA 1U2GA 2H07A 3F96A 1TYCA 5T7BA 2OQVA 3EH1A 4BTLA 1RJFA 1R5BA 5IDQA 1DKPA 2PWAA 2F48A 2X2PA 5TX7A 3ZWAA 5ICGA 5K05A 3PLAE 3ZDQA 2IZ7A 3I6QA 2JB9A 1TC1A 1IXRC 4I50B 4XB6B 1TK9A 5MHTA 1G5FA 4H7PA 5AOCA 3USCS 1KO4A 1U0SY 1LUAA 5WRFA 5DSXA 2IYWA 4I81A 1LH0A 3O8QB 4D25A 3BBPA 1PWXA 2Z56A 3BWDD 3FUUA 4FYWA 3F4KA 4TXMA 5ELLA 3R0VA 3H99A 1O7JA 4BB6A 3C87A 1TT7A 1Y8ZA 1A5BB 4ZMRA 2ZI6A 2G25A 5EJ2A 3OY2A 3OCCA 3QLVC 4W7SA 3TIVA 5CB4A 2JC3A 4YHHB 1O0BA 4IJVA 3Q7TA 4O4LB 1UKEA 2JGJA 2HPZA 1YB1A 2PUTA 5DM4A 4RM3A 2O3QA 5KAPA 5EPOA 1N6LA 2PMBA 3PWTA 3RJZA 3TSWA 4I5EA 3UK2A 4E3WA 4TTRA 4J7CA 1XEXB 5ESDA 1AKVA 4AMUA 4O2RA 4IFIA 4YFYA 3O4FA 2GJAA 2YNMD 3G13A 4OJKA 5JG7A 3C7DB 1J49A 1ORWA 1YACA 3ZU4A 2BFPA 2XBMA 4C07A 4MYRA 1W7AA 4C0JA 3JATB 1PFWA 4OO3A 1GKYA 5A62A 4Q3BA 4B6EA 5CMLA 4ED9A 2PX4A 2VYNA 2VDJA 1EUDB 1YHNA 4PNZA 1EDDA 2GARA 3PKZA 4YCDA 3TAXA 3H7AA 4URFA 1G5RA 3V1YA 4ZCIA 1WPGA 2CZGA 1RI4A 1SKBA 2JCBA 1XJ5A 2XDQA 3FYUC 3ETJA 3HBJA 3NBAA 1P7YA 1S02A 1LPPA 2P67A 3DNFA 4GOKA 5FIUA 5HUJA 3LT1A 4NV0A 3SSAA 4BNYA 1GPBA 5BV0A 1XZ8A 2JVKA 3CUVA 1K5GA 4P93A 2F1RA 2LVBA 5ALHA 3V34A 4M0FA 3T1NA 3TLXA 5HEKA 4NR0A 3CM0A 1D5CA 1X8XA 3JWIA 5F73A 2Q3MA 4Y2XA 1EFPB 3RANA 1J9GA 5F3DA 3SLGA 4PLTA 3GPCA 3RVMA 2PH1A 2PZBA 1RP7A 1KXJA 4GI7A 4Z0PA 3SIRA 4TS3A 5MN6A 3FPBA 4FW9A 4YRRA 4X61A 2AYZA 2YHAA 1TD1A 1ZKDA 2ZQYA 4MGEA 3VKFA 4HEA6 3ZHQA 3OURA 1MC5A 3HKCB 3HU3A 1GPDG 2NUPB 3ENZA 3EVCA 1M1UA 3H2IA 1C3OA 1HC7A 4H3KB 4IVPA 5E3IA 1U65A 3C70A 3GRFA 2O8FB 1VKRA 4AKHA 3TE7A 1E3WB 1CCWA 3L01A 1N9KA 2YINC 5HFJA 1R3DA 2WMNB 4ID3A 1YCGA 1PBNA 4ZZ3A 1JEQB 2FOIA 3GELA 2A9QA 2WUVA 4G0MA 5ALNA 3P7MA 5C5CA 4R41A 4KAAA 3V8QA 1NVVQ 2XUDA 3BH7A 1PDOA 3OUTA 3DLAA 5BWOA 2WKQA 3PFKA 2WYHA 1XZAA 1W2HA 1ZW6A 2ZSEA 3T06B 2CB0A 2FUNB 1ONOA 3GEIA 3C3BA 4FILA 4RSMA 4JI5B 4CW7A 1HKHA 1N9GB 1DJQA 2R8OA 3PZRA 4JENA 4P7FA 1UWCA 3RV4A 3STHA 1ZWKA 4KQ1A 2W2OA 1D2RA 4FLFA 4OYRA 4U2CA 4H7EA 5KTTA 2R7AA 4JS0A 5E4YA 2VBCA 3PE6A 2VQFB 2NX2A 1AHPA 4AZSA 3DWGA 3ITDA 4EYEA 1M0SA 3O90A 3RYFB 2BMAA 1DAGA 2QR3A 5KBYA 4AWAA 4H15A 4R2MA 1XRJA 1ISSA 1JHYA 4GGOA 1PZEA 4TL9A 3AWIA 3I2YX 2ZRPA 4L3WA 2IU6A 4E2XA 1BN7A 1DBWA 1MOZA 3D2LA 1GFWA 2RB4A 5F7XA 2Q5JA 4NU8X 5CLJA 1FS5A 1S2NA 1DV1A 1UMDB 2HRZA 2OGZA 3GJ7A 4HDKB 1L5KA 4BUCA 3FOEC 5AOAA 2W8ZA 1LJ8A 1Q0QA 2C00A 1SKAA 4BWYA 1ORVA 2LIPA 4FINA 2QN1A 1F20A 5CNIA 3TTWA 3KXKA 4BASA 4DLKA 4NIMA 4K88A 3FOFC 4YCMA 3SKVA 2A1IA 1GZ7A 1SAYA 1EWRA 1VYTA 2V03A 3O75A 4Q48A 3RT9A 1FRQA 2HNKA 3LDAA 3OQ6A 1OD6A 4B2LA 4EAAA 3MHTA 2BDEA 4KYIB 3E2MA 5E38A 2XITA 4PYIA 5LQUA 3FTFA 4F72A 3LSTA 3K9FC 2VJMB 1LSUA 2QLMA 5TVKA 1E2BA 3WHLA 3IH5A 1W4RA 1VCOA 2WWGA 2WJZB 5KQSA 1WV1A 2ANCA 2QYOA 3JV7A 1GGFA 5DYGA 1AU9A 4KR2A 4LXXA 1KO5A 3DDCA 4KJZA 2Y71A 2AJCA 2ZJ7A 2WYVA 4HAXA 4TTAA 2EBWA 1MRNA 1H9AA 2RHJA 4MQBA 3ER9A 3EGVA 1DJOA 3M5PA 4HWPA 1ZUHA 3NW9A 3H7IA 3IO5A 4AZWA 3W8NA 4JOBA 5AVTA 1OF1A 1BS1A 1N3YA 2QPAA 3A9TA 3ZXSA 2P4SA 5IK2D 3PGXA 4JA0A 4G9GA 3S5UA 3NONA 1UT8A 1P4JA 2HSGA 2ZBGA 4DW8A 3KT8A 3JQEA 2E49A 4LAFA 1Q17A 2PLAA 3SAJA 5H68A 3WIDA 1Q83A 2D7JA 2WKWA 3ADCA 3G8CA 3C7KA 4W1SA 5FPQA 3OJXA 2PU7A 3NORA 5JQGA 4OQXA 2VUTA 3WL7A 4LHVA 5C7LO 5CM2Z 2C57A 2C1XA 4DYHA 8ABPA 3VISA 1ZHOA 2H29A 7REQA 1AK9A 5CW2A 1NPTO 1FP4B 4XWTA 5JQGF 2XXBA 1P0QA 4DAOA 2ARKA 2NQTA 2IGBA 5J2UF 3GUHA 1E9RA 1KSFX 1LBEA 4LJ9A 1WD7A 1TCAA 2G07A 4R7ZA 2C4UA 1NL3A 4M46A 5JAHA 4OFZA 4F7WA 4DV7B 4ZGGA 4LXQA 3UUFA 3LQYA 1MAAA 3Q2KA 5REQA 1SG0A 2XNDA 3SVTA 1GAEO 3IMKA 1R6XA 4XUCA 5IVIA 4JXJA 5EOVA 3JYQA 4XWYA 3B1KA 4ZP1A 5IJWA 2X0IA 3DMPA 1USUA 3TZBA