1DXQA

Crystal structure of mouse nad[p]h-quinone oxidoreductase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
273
structure length
273
Chain Sequence
AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLLMKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QUINONE REDUCTASE
publication title Structures of Recombinant Mouse and Human Nad(P)H:Quinone Oxidoreductases:Species Comparison and Structural Changes with Substrate Binding and Release
pubmed doi rcsb
source organism Mus musculus
molecule tags Flavoprotein
total genus 86
structure length 273
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2000-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dxqA00
4QODA 2MTBA 4HS4A 5B3LA 1CZOA 3KEGA 2FZVA 3K1YA 4XDGA 4Y9RA 1YKGA 4PU0A 6NULA 1VMEA 1AKWA 3F2VA 2BZSA 3FNIA 4FGLA 3EDOA 1X77A 1FLVA 3W77A 4QOGA 2KQUA 2QMYA 4LAFA 1WSBA 3TE7A 2F1OA 2BPOA 4XDHA 1DXOA 1CZUA 4N82A 1XYVA 5LBTA 4S24A 2Z9DA 2HPVA 3NHYA 4FGJA 1SG0A 2FLVA 1J9GA 1AKTA 3P0RA 4ZVKA 2QWXA 1D4AA 2AMJA 5LMCA 4F8YA 3F90A 4LTNA 4LA4A 4N9QA 4U7FA 4J8PA 2OHHA 3HR4A 3NHPA 1FX1A 2V5VA 4NULA 2A5LA 1FLNA 4H2DA 4M0CA 1XI2A 4D02A 4DILA 3FVWA 3NFRA 5LJLA 3R6WA 2XOEA 3F6SA 2ARKA 1RTTA 5ULLA 3L9XA 3UXHA 2HNAA 3N39C 5FX2A 4YAUA 1YCGA 2OHIA 2BN4A 1QHEA 3EYWA 1TLLA 5JROA 4NLLA 1GG5A 1FLDA 1J9EA 3GAMA 3KAQA 2BMVA 2QX6A 4CETA 1I1OA 2Z9CA 1H66A 3QFRA 3S2YA 1T5BA 2FX2A 1ZWKA 3HA2A 5A4KA 1J9ZA 1WSWA 4QOIA 3U7RA 1AHNA 3NHWA 5BUCA 1FUEA 3SVLA 1B1CA 1CZLA 1XYYA 1D04A 2R97A 3GFSA 4N65A 2RG1A 1AKVA 1E5DA 4BMOB 1CZKA 2HNBA 3QE2A 3G5MA 3RPEA 3ZHOA 5LLDA 1T0IA 1AG9A 1QBGA 3ESYA 3NLLA 4HEQA 3OJWA 1KBOA 3OJXA 3F6RA 2W5UA 4GR9A 3U7IA 3OWHA 3GFRA 3OX3A 1JA1A 3FW1A 1XT6A 5F12A 4H6PA 4Y7CA 4U7GA 3KLBA 1C7EA 1H69A 4R81A 4YAOA 3W79A 1TIKA 4YALA 5EAIA 2QMZA 3LT5A 3NHKA 3O73A 3OVMA 3D7NA 2Q9UA 1BU5A 2FOXA 3OX2A 4ESEA 3TZBA 3HLYA 1ZWLA 4C14A 4Y9UA 2B3DA 2MOKA 5NLLA 4BMPB 4PTYA 2Z9BA 2V5UA 1RCFA 4YQEA 2N1MA 3NHFA 4ICIA 1AKUA 1AKRA 2M6SA 1AKQA 3NHJA 2QX8A 4YAFA 3FX2A 3ESZA 3O2NA 3W7AA 3K20A 4PTZA 3B6IA 2FDXA 2WC1A 1DX9A 1QR2A 3NHUA 1D03A 5LBUA 1YCFA 1V4BA 2Q62A 1YDGA 2MWMA 1OBOA 4FGKA 5EMNA 3OX1A 2FZ5A 3NHLA 3B6MA 1SQSA 1J8QA 1YOBA 2QR2A 1CZNA 1RLIA 3JSXA 3QFCA 1YCHA 1FVXA 4QOEA 4GI5A 4YAWA 5B3KA 5FUQA 1YRHA 4ZVLA 5FA6A 2V9CA 3W78A 3N3BC 2X2OA 3KAPA 3NHRA 2R96A 4CF6A 3ES9A 2M6RA 2ZKIA 3UXEA 2FVXA 4LTDA 4OXXA 5NULA 1FTGA 4C0WA 3NHSA 3OWXA 1NNI1 3N3AC 5F4BA 1F4PA 4QOFA 3L9WA 4C76A 1CZRA 1RLJA 4QOHA 2Z98A 1OBVA 1OFVA 3TEMA 1BVYF 2XODA 3B6JA 3ESXA 5F51A 1ZX1A 1KBQA 1QRDA 2FAXA 2QX9A 3LCMA 2BF4A 2OHJA 5LVAA 2GSWA 4ZVMA 2D5IA 4GQIA 5LJIA 1AMOA 1DXQA 1CZHA 2MT9A 5EA2A 5TGZA 4DIKA 4ZVNA 1FLAA 4FX2A 1C7FA 2OYSA 1AZLA 4C0XA 4LTMA 2QX4A 3GFQA 1JA0A 4U7HA 2X2PA 4QOJA 3B6KA 2FCRA 3FJOA 4DY4A 2KLBA
chains in the Genus database with same CATH superfamily
3PYMA 3R5TA 3TEFA 2GPTA 3P19A 2E1RA 4BV3A 4DT1A 3EVFA 1Z6GA 1ZNWA 4U6QA 3GYBA 3LHSA 4GPAA 2W2VA 3USES 5MN5A 1U0TA 1EBUA 4DWWA 4MUJA 4YRKA 1L3IA 2ZUTA 3RS7A 2CNNA 4V0KA 3MGKA 5LDHA 4DUYB 1UC5B 1TM3E 2H7CA 2VBFA 3D43A 3MZ0A 4MWGA 2WLSA 4A0HA 3DTTA 4ZQHA 1Z39A 5EKTA 3I58A 1L7EA 2WU0A 4M9SA 3ZY6A 5AQEA 1IRXA 3GGJA 3STHA 2P9QA 3IVMA 3PDIB 3IUNA 1QFYA 1T10A 4S1OA 6NULA 5AH0A 2I80A 2OSVA 1C9YA 1IUNA 2XUAA 5JSZB 2P9FA 2ZJ5A 4LCBA 4U0JA 5F2OA 2E55A 2Z4TA 1W8IA 1X77A 2EFGA 2QY6A 2WU1A 4R83A 4N0DA 4OQNA 1OX6A 4F2DA 1AUQA 4K9QA 1VLJA 2QUHA 1U6KA 4M87A 2O52A 3GWGA 1E63A 3GQVA 4GO1A 2OUIA 4F06A 2YVKA 1TD9A 3R5FA 1LC0A 1GSAA 1QFSA 2VPQA 1H1TA 3PJGA 5H3HA 1M5TA 2DT8A 2W2MA 4RKYA 1NW7A 2LDXA 3NH6A 1ZY2A 2EZ9A 2AHOA 3IO5A 1CZUA 1N2ZA 2FRDA 1CSEE 3W3AA 4QX6A 1K2VN 4UU7A 3U4GA 1QQBA 2NQTA 3J81k 2CXQA 1KRXA 4BP3A 2EP5A 2YJTD 1BDJA 2AMFA 3QMVA 2IEDA 4XD7A 3NHZA 1VHLA 4S1PA 1NUAA 3PHCA 1KK0A 2HPVA 5EWJB 4G37A 4F5WA 5BWOA 3QLUC 5IFKA 1A04A 3A14A 3LTEA 4B3SB 4RULA 3DL2A 3KZVA 4DABA 3E0XA 2RGUA 3MRXA 1U31A 3WFZA 1EHIA 1JA9A 2I3DA 4F4JA 4LXTA 5MN6A 4HNAB 4M8LA 4HLUC 3AXSA 3RV3A 4B3JA 1SA0B 4WRRA 2H1WA 2PQ6A 3F5FA 4EP1A 2R87A 3TW4A 4HR7A 1C4WA 3QM1A 5AK6A 1SUIA 3BXZA 1SGWA 4C4AA 4F93B 2CVZA 2XH8A 3V9AA 4K0KB 2FUG6 1F0KA 5FLEX 4J1TA 2SBTA 1M66A 1RLTA 5HNKA 4JT2A 4LY9A 4BNKA 3GHHA 4MYCA 2QW0X 3LK7A 3I0ZA 2R8YA 5JRJA 1A4IA 2GUWA 4NEGA 2A5LA 4JJKA 2O8EB 2B7BA 1IN5A 4IPTA 1RYBA 1IVYA 3IP1A 4MRVA 3KOXA 2AOWA 5HUJA 2ZBRA 1R18A 1I1NA 2UZAA 2VVTA 3A4IA 3E0QA 3EH1A 3KEOA 1WOYA 3PRJA 1MR3F 5JCOA 4D02A 3UK6A 2VQ6A 1E94E 2L0XA 2VSOA 5HDQA 4WKGA 4DZTA 4OPMA 3CZ4A 4DNOA 1ZOSA 3BKXA 1QG6A 2BR3A 1J49A 3IT1A 3ITKA 4K8OA 3IOCA 3H86A 5BR8B 4I66A 4IH4A 1F8GA 1TU0A 1V47A 2YZMA 3ETGA 4F84A 3IV6A 3IV9A 3PFNA 4UUMA 3SBOA 1YZ3A 1VDZA 3HM9A 2W6MA 1WB4A 2FK7A 2WWRA 3IT0A 1A9XA 2P3SA 4MUFA 5IUJC 3L9XA 4UTZA 2D0IA 3A3YA 3WYFA 3WYGA 3CR8A 3SZUA 2FEWB 2AWNA 1OC4A 3SBXA 1Q6ZA 2HNAA 3MMZA 1E20A 2J3QA 4UVDA 4XPIA 4MGHA 3UJ6A 1QB7A 4ENSA 2HDOA 1BA3A 5FOVA 1SBQA 3T15A 4P7BA 3HYNA 1UEJA 5DM60 1OBHA 1BIFA 1UZMA 3KVYA 2IKSA 2D0PB 1NL3A 2HLHA 2OILA 3II6X 4FTWA 4KOAA 4FDTA 4M1ZA 4MV9A 1M34B 2BFWA 3OURA 3CLRD 4KR9A 3RABA 5L51A 4MLPA 1TLLA 5C18A 3ZEIA 4CQMB 3G3EA 1VBMA 3WRXA 5IZCA 2O2XA 5FPHA 1X87A 3W7BA 4NLLA 4PPNA 2ST1A 1P18A 1PJ8A 5FTKA 3GAMA 2R84A 5ICEA 3U61B 1OH8A 1IRIA 5I9LA 3UW3A 4JLDA 1LSOA 1N4AA 2WVJA 3RROA 3RVMA 3UHPA 3E9MA 3LBYA 2C1EA 3DVLA 3VNSA 2VDLB 3KZMA 1EM8A 3P0FA 4KR7A 4ZK6A 2SHKA 1S9DA 3UOWA 3WI7A 4DHEA 4LHSA 5AVTA 3QX8A 4P83A 1PJAA 1H66A 3O92A 3S70A 3TSOA 1AD2A 4INPA 4YIKA 5KYKA 5CB4A 5KTYA 4KIUA 5ILQA 3Q3JB 4P84A 4TMFA 3IB6A 4NFSA 4D56A 4A9AA 4MP3A 4DV0B 3Q1LA 1NW6A 5B5SA 5A0VA 3T4PA 4UHBA 4ND4A 3HA2A 5E8RA 3BFKA 3G2KA 1DJLA 4QL3A 2UYYA 1J9ZA 2ZR0A 1YDMA 1AJEA 3PFIA 3K0CC 2YWFA 5JBNA 1EWTA 2QDXA 1T2AA 3V4VB 4KK3A 3OEHD 2QRPA 4RENA 3SC6A 1V48A 4EI7A 3GJRA 1O58A 1UDWA 1HQYE 1T2FA 3SVLA 2FW1A 4CQJA 4CU2A 4QQ8A 4HV4A 5EZYB 3T7AA 3CPEA 3H4IA 3H9EO 1UMDB 2MMGA 1D09A 3C4VA 4GVXA 4L9RA 1MG5A 3NW9A 3KPWA 4XWOA 1VCIA 5BN1A 1YZLA 1EK0A 1D4OA 4ZAWA 1P9RA 3DFMA 1PWHA 1J0DA 3QE2A 4G5GA 4HWRA 3RPEA 1JQLB 3DAYA 2X86A 1KNQA 2XMBA 5E9JA 4ECEA 4Y9SA 4Z4IA 4RMJA 1T9CA 4DADA 2APJA 1TT5A 3EN0A 3KXPA 1VL2A 1II0A 2QJFA 2R00C 5CCXA 4RV5A 3ZOZA 3IUSA 1BCSB 1WU8A 3WZ2A 3ZPXA 4CR8A 4Z7QB 4Q15A 4OX9Y 1KBOA 4AJ9A 3K96A 4Z0NA 1LLQA 1Q92A 3NKLA 4XAQA 4ND8B 1J21A 3KR1A 2YHUA 4CEJA 2HIAA 5FPKA 4TS9A 3FDXA 2XMDA 4XOIA 4F9TA 5T67A 4FK8A 4QGSA 5KNDH 2WM8A 5JNUA 4GMGA 2CXSA 3SEFA 5TDHA 1UCFA 1DKUA 3TW6A 3VMFA 4B8ZA 4DCSA 4BO7A 1DP4A 1ONNA 5ENVA 1X9IA 2R8PA 3WC4A 3LXRA 1EQUA 3OSUA 3HBNA 5E6SB 5GAJA 1LPPA 3SI7A 5IHPA 2YYZA 3LQQA 3GP8A 1BE8A 2KWIA 1COZA 3QNMA 4CM1A 1WPXA 1LWNA 3O1JC 1KI3A 1EXNA 3E23A 3GQBB 3N6XA 3Q87B 4O4IA 3LQFA 4AJOA 5JSQA 1T13A 5BQFA 3BF8A 3QOFA 1ORRA 2ATCA 1G7SA 3SN6A 1JLHA 2E6KA 4B3DA 4DIDA 3HDTA 5H70A 1NF2A 3C3WA 2PGXA 4K2AA 2DKFA 3IJEB 4L72A 2QG4A 2VTDA 2XTZA 2YDXA 5SV2A 3AV3A 3QVUA 2G9RA 4LWZA 4KMSA 1R8SA 3GCXA 3GP3A 4JI1B 3RU2A 1AO3A 4BBZA 2ZSAA 1DFIA 1OKKA 4L50A 2QD3A 3USZA 1Z4MA 3WLNA 4GOXA 3SMVA 1R7RA 1LX7A 2J0QA 2JJ2A 3VR6A 1EESA 3EPHA 1WY7A 4BO1A 2PKEA 5AJVB 5JIBA 2G9ZA 1ZI6A 1VBKA 1BTOA 2VF2A 4JP3A 4UBMA 1YMVA 3KJIA 3OX2A 4X3OA 4ESEA 1WQ3A 3WHPA 3AINA 3A2LA 4FYMA 1ODJA 3IOYA 3VDRA 4YXWD 2BY4A 2IXEA 3GBPA 4M38A 5EJ5A 3F9CA 1XZAA 3A6KA 5HILA 4B6GA 2TSYB 1N5DA 1UANA 5C0OE 4AYWA 2H2DA 4QIHA 3O4FA 1T1GA 1XLVA 4D8TA 5ED4A 2VYNA 4S04A 4DV6B 4KR2A 4M1TA 1GZHB 3D1VA 5BRJA 3A9SA 2EV9A 1PX0A 1OFUX 1ZNQO 3EFOB 3KYDB 3ZDRA 2O0MA 1U2DA 2IOFK 4UEWA 2WABA 2WKRA 4ZCTA 2CLIB 2XBMA 3AF5A 2DPGA 3DEIA 3GRYA 2QYHA 2VF8A 3N6VA 3VU8A 2VP9A 1SU7A 1UT6A 5HIKA 3VJKA 2WICA 1HT1E 1IN8A 1NATA 1YBFA 1CNFA 2V74B 3IIJA 2GBGA 4EDFA 1GTMA 2ZR9A 1DEKA 4HS9A 4OGKA 2F55A 3UFBA 4RH3A 3TQOA 3E9ZA 1P6QA 3B6IA 3GEMA 1PSZA 1UOQA 2NXNA 2ORYA 5F2EA 5HFAA 5L40A 3HJFA 5C46F 2CNOA 3V4ZA 3H0CA 4HGYA 1KARA 2X6QA 5I7HA 3MVEA 3CVYA 4FYHA 1YIDA 4I1OA 3A1WA 3CVUA 2Q3EA 4R2JA 1Z88A 5K0GA 1C9KA 1G1MA 1VJ1A 2H92A 3EDQA 4IZHA 5IANA 2VXCA 2OAEA 1FSPA 4BKUA 5AD1A 3CRW1 3G68A 2V0CA 1FFXA 3L2OB 4DWOA 1SKYB 3GJQA 3QEMA 3T1YB 3V1LA 1JB9A 3I83A 1RQ7A 1YDGA 3HFJA 2MWMA 1E5TA 5KC8A 1Y42X 1N32B 1W88A 3MIIA 1F2TB 1G7RA 1E3SA 1DEHA 1Y89A 2JZNA 2Y92A 4WX2B 3QLVC 2JLVA 5AK4A 3KLOA 2H0RA 3P45A 3U2QA 3I72A 5I6DA 4YUXA 4GP9A 2KSQA 1L6RA 1F7UA 2XIQA 2YJ6A 4ZODA 2D1FA 3JQ7B 5JXIA 5L3VA 4IIDA 5KPDA 2GFQA 1D0IA 1QCCA 4BJ3A 1MW8X 1JDBB 3BXPA 1CUZA 3GGGA 1PKEA 2VLIA 5LD2B 3DJYA 4EY7A 2PGOA 1G3MA 4LHEA 4V02A 4RKQA 3BMCA 1XMSA 4QUAA 4D0RA 2WG1A 3GA0A 3DTVB 3S7ZA 5JXWA 1XD2B 2JARA 1MUUA 3AFOA 5JAQA 1OCEA 1DAIA 4NMMA 4OHKA 1L7VC 4FHEA 5AESA 4X65B 1CERA 4OP3A 4LZNA 3PPVA 4LYAA 1N2BA 3KTFA 4BJ5A 4Q4CA 5GZ3A 1PJRA 5IYZA 2VBGA 2PQ0A 2BDTA 3A2NA 3ESDA 4JZKA 1RTKA 2JAUA 5DI3B 3NGMA 3TTWA 3ZKAA 3BBPA 4MW0A 2HZ7A 2ZYHA 1SZCA 1SR8A 3FFXA 4HD8A 3A1TA 4HDAA 2V9CA 4MDFA 1SU4A 5IUNC 4ZV7A 2FEXA 2O9JA 3F67A 2VJAA 1AZWA 3BGOS 3QBJA 5JJLA 1M5UA 2PX4A 2VHJA 3D6HA 5BP7A 1WXXA 2A0FA 2E7ZA 3HGTA 2E1PA 5CAEB 5AFSA 1T2EA 2QRUA 3HDHA 3QUCA 1K8RA 2DWUA 1B8NA 4NIMA 3UXEA 5K5EA 3HJCA 3QG1A 4HAOA 1LJ8A 3RSCA 1XEXA 3T34A 5JCZA 3BRWA 1Q2UA 3THSA 3CUEF 4LOKA 3EQ9A 3QIVA 3K4QA 3LHKA 4EABA 1TF5A 2DECA 1B6TA 3WKEA 4L8FA 4BO5A 1L9XA 4CT5A 3GVIA 3K71B 1EAMA 4V3BA 3ORQA 3CUVA 2HEGA 5JMOA 1MDFA 1RIIA 4MRMB 2OGUA 4CLRB 5LOVB 3P9QA 4MZDA 4B6PA 4KQGA 4RA6A 5J4KA 4KPUB 3U1BA 1OOEA 2FRDC 4U8GA 5FUYA 4NYMQ 2IHNA 1HEYA 2H7YA 4JBIA 4FNMA 4P4TA 3EEFA 5CYOA 5K9ZA 1HNWB 3LUCA 3WMWA 4Q18A 1VG8A 2EF1A 3F46A 3V8QA 3ONEA 1GQQA 3FHCB 1ZJ4A 1B42A 4KWTA 2X8BA 5L53A 4OI2A 3UAZA 5K3CA 1GVNB 4L1KA 1RP7A 4KACA 4PXSA 3TLJA 2CHEA 3O26A 1UP7A 1YB2A 2YRXA 2VF7A 1IQ0A 1WR8A 3EPRA 3LXMA 3PX7A 1GFWA 5ESXA 5K0CA 5EIBC 4E11A 5IULC 4JV5B 5H1YA 3EARA 4KXFB 3V8NA 3RVPA 5IARA 1GZSA 4WA7A 2RE8A 3PUVA 4J1TC 4Q7MB 2FKAA 3R3VA 2B4QA 4B6JA 4Q1AA 1J1UA 1OD6A 1L5NA 4KGDA 1DEOA 1V5GA 2AG5A 2JAQA 4ZVMA 1YJBA 2XTMA 4BGDA 3KOMA 3QTBA 5D84A 3HBAA 5ICCA 5KYYB 1H0SA 4H1WA 1MAVA 3Q3CA 4YI3A 5AJUA 3ROPA 1LBHA 3AVUA 1Z3IX 1JQAA 5DBHX 3HVIA 4E46A 4LVOA 5FV7A 1CRZA 5JCOC 3QXHA 1Z5VA 1CETA 2SCUA 1X7ZB 1CY7A 2D0DA 1NF9A 2PEYA 5KREA 1GTSA 3CE9A 1KIMA 2OD7A 1OBFO 3DBHB 1C7FA 2W90A 4KPGA 1EQ2A 2GKOA 3QVMA 5BVGB 4FOOA 4K3VA 4QXRA 1YFKA 2QTAA 3AF1A 3T5TA 4E4YA 3QUQA 4AIIA 3OZWA 1KPGA 4EA7A 2ATEA 2PRSA 4JOCA 5DHQA 2O8DB 2GZ3A 4EY3A 1YU6A 2RDMA 3DL4A 4FOPA 4RD3A 5CW1A 4BUZA 5JFTA 2QX4A 3AIIA 2XGMA 3C14C 2BVNA 3MELA 5TQ0A 4C0SA 1LU9A 1NQXA 4L78A 1XJ0A 3G9ZA 4RW0A 5LQAA 2O50A 2TS1A 1F60A 4QPNA 5IJWA 2NUAA 3E82A 3QI7A 4EPVA 4K9DA 2YV1A 3OZBA 5HF9A 4PM4A 1T3LA 4AW9A 4MI3A 4Z5XA 4RY0A 4YAGA 5TQJA 3WP0A 2JKZA 3PHBE 3QVKA 3GZTB 2DFVA 4ZI3A 1Y8AA 3QKTA 4E32A 5BNFA 3R5HA 1VSQA 2MTBA 2CL6X 4HN9A 4BKQA 3QU2A 4CE6A 1ZU5A 2VDMB 4PZPA 5JPIA 2FZCA 4BLQA 3DXFA 4A15A 5IZCC 1FL9A 1K27A 3WRXC 4I9NA 5HZHA 2V1XA 3UBTA 2GAIA 5BOSA 5E4JA 2UYGA 2QVCA 1NP6A 2VTVA 1YQTA 2QQ0A 3T9EA 3WLFA 4C5CA 1F8XA 5CXSA 4WACA 3H5AA 4BU1A 3R9KA 3O3NB 1AKWA 1K6IA 1CUDA 2VDUE 3SKYA 1ADJA 3C24A 5KYVA 2R65A 1I6LA 2Q6VA 1TLTA 4P08A 1SXPA 2A9JA 2ZJAA 4Y9TA 1QANA 4ZZIA 4F4UA 3PDWA 4CL2A 2C78A 4C0HA 1MHTA 1P1CA 1KAHA 3HG7A 4M1SA 1YB1A 1LKZA 3KE8A 4NDZA 1DAGA 5JYCA 2ZJ7A 3B3FA 2Q5CA 4LAFA 5CM9C 1FVHA 1P3JA 1M54A 2I1LA 3I2FA 3EPPA 3EGDA 5TY0A 1E7MA 2J5BA 3UJCA 1Z33A 1WHTA 4L75A 3K30A 2UZ1B 2PT6A 3CM0A 1Z18A 5HOEA 4RPIA 2R5NA 5L95A 4NFYA 2GZRA 4GZLA 3EXAA 3NIFB 3OZRA 5J1SB 4FFOA 1VOTA 1YXMA 2VXOA 4QTZA 1SO8A 5E0KB 5MDHA 2OSBA 1GADO 3C48A 3FB1A 3VGPA 3RSOA 4JP8A 5HMLA 4LJ5A 5LZ9A 1NVGA 1ZMTA 1QF9A 2BFEA 4TTAA 1U99A 5T8KA 1G20A 5HW0A 2W7TA 4EELA 1MQAA 3OOYA 2PGIA 1R3DA 4PS1A 1E5QA 2WIDA 2G07A 2PKXA 4LMRA 1X8XA 1M6VB 4YK7A 1S4QA 3E8XA 4ZHSA 3QKUA 3LT2A 1YJ8A 4DM4A 1JFTA 3V1MA 1A82A 3KL2A 3R23A 1PQ4A 4KZKA 2IX3A 4HGZA 2VUIB 4LRWA 2PQMA 1NMQA 1VLVA 2DUUA 3MRSA 3VOBA 4B0PA 5DHFA 2ZSDA 1WF3A 4HGPA 3KPUA 2MYPA 1V11B 5F7ZA 5CT9A 1Y7TA 4YDQA 1RE0A 5EIOA 3TDMA 4EO7A 1KNXA 5HIAA 4QBGB 1Y80A 2A0YA 3VHXA 1Y5MA 4FQ5A 4TSFD 2V58A 5C80A 5M5BA 4P82A 2YH2A 4BB6A 1M2GA 4K6HA 4E7OA 4C3UA 1U9ZA 5ECYA 5HF5A 3AERB 1MO2A 1Z5NA 2VYFA 3QJ5A 4OQZA 1WP4A 2PZKA 4HTFA 1FXWF 3VR3A 5KOJB 1CIVA 4RSGA 5BT8A 3D3EA 5JMWA 4OBWA 4Z2AA 8LDHA 2XYVA 3GPBA 3GAZA 3IPAA 6LDHA 3WL6A 1UPUA 3PQDA 4ZO8A 1NUPA 1ZD3A 3MGAA 5BYJA 2ZETA 4V0QA 1W36D 4X1IA 5C8YB 2BUCA 3M4JA 4DXHA 3ZY5A 3SPXA 3CH6A 1X7YA 2IGBA 1GA6A 3LY5A 4QYIA 4RDIA 2OL4A 4JL8A 3AF6A 4KNYA 3KJXA 1P9LA 1ADGA 3FWPA 4U2CA 3SSOA 4MS1B 5JBQA 2R7MA 4ZTUB 4RIEA 3RSLA 1DOZA 1W2HA 4CKBB 4BYGA 3G9UA 2GF2A 2P6PA 2XNKA 1N0WA 1Z6TA 5C31A 2FRXA 3JZMA 5HX7A 5J5AA 3K0SA 4OH7A 2REXB 3OKFA 1ZJ6A 5IDXA 3HP7A 3PF8A 2BJVA 4YAUA 1N75A 3QUAA 4G65A 1S7CA 5G4LA 3SHFA 2F8SA 2V7QD 1F9AA 4JSYA 5KHAA 3KP1A 1MAUA 4EFNA 4TROA 3SFVA 3A1SA 4DDHA 1E69A 1L8LA 2Y0BA 3GGPA 4JL6A 5G2OA 2FMXA 1XQYA 2ZIWB 5SYAA 1Z37A 4JENA 4PVDA 1QORA 5CX1B 4J4TA 2L18A 3BGSA 1BCRA 1CY4A 4AZWA 3Q41A 3NXKA 1U2DC 4DMFA 1X86B 3C85A 3IODA 3R44A 4R3UC 5EZYF 2ECPA 4IXTA 1W96A 3ASYA 4IQFA 3B85A 4D74A 2J3DA 3IQZA 3AUJB 4AO8A 5CURA 2JK0A 1W9HA 2ZYWX 3VSCA 3LW7A 3LRTA 4KRGA 4CQLA 4R8MA 2FP4A 4WOCA 4MR9A 3E3AA 4Q3KA 1TEHA 3UJHA 2I3BA 5CJPA 4DZZA 2GDZA 4A8TA 4TMVA 2WA1A 3ZIDA 1Z6PA 5BUQA 1VI6A 3IBGA 1W6RA 1TM7E 2EF0A 2YOHA 3ORYA 3RJMA 3LDHA 3FETA 1J8DA 1P75A 1PX2A 5BNWA 1VTKA 3GVXA 4HH3C 3TF5A 1QF6A 1II8A 2ZR8A 3E7FA 3QE0A 4FDUA 1YTUA 2Y9PB 4LW8A 2FEPA 3RS3A 3H87A 4HQOA 3ANXA 2V7PA 2OV6A 2IUEA 3NVMB 1QRRA 4N3AA 3ULKA 2XXAB 3AJRA 4M0PA 5KAPA 5REQB 2J59A 1JLLA 1NU6A 1XDGA 3FCEA 3A32A 4NFLA 4RY9A 4TLDA 2YMMA 3W1EA 4GAEA 4EBBA 1RZRA 1VL0A 4DLLA 1K8XB 3IQXA 1W25A 3QIAA 2WR8A 3G5MA 1DJMA 1QC5B 3GY0A 3IHLA 3UKDA 5LLDA 4ETNA 4X64B 1JDPA 1BGXT 2JA1A 2QMUA 4M54A 5J5CA 5LA6B 4P0QB 3AF0A 1V1MA 1GT91 5EJFA 1YHYA 2ZDHA 3F5QA 3PCXA 4IUDS 4JS0A 2YN2A 3CT6A 3FGPA 3FROA 2Z4SA 3F3KA 5U4XA 5C4IA 4MOWA 1NMZA 4XD2A 5JPCA 3CIFA 5CIYA 3I64A 3IELA 1LV7A 3IIKA 4EEKA 4F97A 2Q4BA 4NARA 2O2CA 4R1QA 4UUQA 4JROA 4L8WB 2O07A 4RCYA 1OTXA 3K9FC 5KYUB 1U0BB 3PR2B 3RT9A 4DE5A 3OQNA 1GFIA 2QL5A 5B7NA 1BXKA 2YJGA 5BSKA 3CNQS 1NVVR 4KE9A 4Y2QA 3H6HA 3F6YA 3WLMA 1L3CA 1J6UA 3DDUA 3OPMA 2GM9A 1N8TA 2AR9A 3SKVA 4W7SA 3UH1A 1A7AA 4S12A 5E7IA 3R7BA 4E1VA 5BW5A 3DLHA 3H11B 3T7DA 4J16A 2GTHA 2R68A 4QPZA 5FWDA 5G0WA 4EF4A 5HP4A 1PV2A 3PIIA 2O4UX 1B23P 1HLGA 4F3NA 2FEOA 2I6FA 4FB4A 2A57A 4YJDA 3KV3O 3FTCA 3GCWA 1KOGA 4N3GA 4LK3A 5HTOA 4C7OB 3CJRA 2QVBA 1AN9A 2DQSA 4UTOA 4P92A 3O9VA 3N0VA 5AM4A 3TG2A 1GILA 2LNDA 3OLWA 2H29A 1X7XA 4KHPB 2NMVA 2F1IA 3VPSA 1JPNA 1PT7A 3P2YA 4OQQA 4LDJA 1P5HA 2BGNA 4HBGA 4UC0A 1UBLS 1OU4A 2MSEB 1RKBA 4Y2SA 2XB8A 4MA5A 5CR9A 4FHZA 4FOSA 1ISJA 1LUAA 3RSZA 1QH0A 3OPYA 4F46A 1NIJA 1F4LA 4C87A 3GEIA 3IKLA 3PEYA 1UFOA 2FQXA 3O0DA 4BZWA 1AK9A 3GJ6A 4XR9A 3OF3A 3R5JA 1Q15A 3WB2A 1PO7A 3JYQA 3VTAA 3JARA 4X44A 4C14A 4H6VA 3VPDA 5AYVA 3NDRA 4MV8A 3G8CA 1H2FA 4QPJC 4YIHA 2YV3A 3ZQKA 1NHGA 1U2RA 4BLVA 3I05A 3X2EA 1NTOA 1OWNA 1ZIDA 2JBAA 3M8KA 4GBJA 4ES6A 3PDUA 4LVCA 1JRLA 5BWLA 2PSFA 2O8BB 1SBYA 1RXYA 3ZWWA 3UV6A 4KQHA 4JEIA 2DJ5A 5D3MB 4G8CA 3RD5A 3N8KA 1J99A 4B6FA 4IQ4A 2YNMD 4G63A 1L1FA 3SIWA 4UXJA 1Q1ZA 1PL6A 3JD1A 4BO4A 5JCPA 2GJKA 2QUJA 3V1UA 4GUDA 2B1RA 3WK7A 4X90A 1YH3A 1Z7YA 1XZIA 2VHTA 1DJQA 4WLOA 3ZNOA 3PE4A 3GLFA 1DKOA 1G5IA 1TGVA 3FYSA 3M5DA 4QDXA 4U1RA 3TCKA 1KXZA 1N2XA 1IBCA 3HZRA 3LDAA 3USCS 1HQDA 5BWNA 5HHTA 4W1RA 4P7FA 5B1DA 2BFMA 3SE7A 5SY9A 3ZVLA 4EKEA 3A4YA 1UDXA 1RC1A 5BPFA 4BB5A 1JMYA 1C1DB 1QKIA 3ZWMA 3IBYA 2IE0A 4LKRA 1O2DA 2XOXA 2QORA 5JS1A 1AGNA 4UM9B 4PC6A 1DFHA 2C42A 4N7RA 3D6FA 3LWDA 1DJOA 1RQNA 3BSSA 1G17A 4IMPA 1BAPA 5EL0A 5A6SB 4QYXA 3ZEAA 3QE4A 3ZKWB 1QS0B 2XOKA 4JK3A 4NH0A 5FI5A 1KJIA 3GROA 4LMBA 4PZCA 5BSEA 1VJRA 1XYGA 3HSYA 5DRTA 2C99A 2PK3A 3K1JA 2EWWA 3TD6A 4ASUD 4Q9DA 1JJIA 1TCBA 3IPRA 4G0QA 4L8VA 4CGYA 2YCBA 5DTMA 2CD9A 3KYBA 1I7DA 2G1KA 3GRKA 1QH8A 1NJ5A 2QR2A 4OJNA 2ALJA 5BUZA 3MJDA 4JWKA 4R51A 3CO5A 1RLIA 2GEUA 5AVJA 3SC2B 4PICA 1Z07A 3O2QB 4YBZA 1F0PA 3JSXA 4JI8B 5KSWB 2Q6TA 3P9KA 1EEXB 2OORA 4YLGA 2ZP1A 1E59A 3WNQA 4RFSA 1A98A 4M7RA 4GPTA 1H3EA 2X0RA 1GSIA 2C9ZA 3OO1A 2W43A 4KV7A 3U3ZA 5JAIA 1G20E 1KJ8A 1Q0HA 4D8XA 1T5IA 1P8AA 1H1LB 1XXHE 1M2OA 1JGTA 3EZ9A 3OHMA 3MJFA 5FADA 4W9MC 2CHUA 1KMQA 2Z3VA 1C9DB 4KDFA 3KAPA 2I0FA 4QXMA 2AVNA 2O1SA 1BMFD 2IYUA 3PFFA 1UIMA 3IKVA 3DW1X 4TZTA 1Z5PA 4RSMA 1CDDA 4DR2B 4QQFA 3HY6A 5AI4A 4LQCA 4L07A 5FWYB 4XYLA 4R1UA 3VDXA 1VLQA 2Q0XA 2QN2A 3M6WA 3QPDA 5DF1A 3FKSA 3OWXA 1STOA 3CURA 1Z26A 4ND7A 2WB2A 2ZSEA 4KX3A 4J7XA 2CLHB 2WP0A 3HO8A 1SN7A 1R88A 1ZEMA 3N7UA 3H65A 2H59A 4RM2A 2C3YA 3EISA 2QZSA 4YJHA 5BYBA 4RACA 4OMCA 1DKNA 2H0QA 5FLKA 4AJEA 4Y3UA 5EQFA 2I76A 1Z0UA 4HZUB 3TNFA 2HDNB 3RODA 4MO9A 5CXUA 4HFMA 4LWPA 1RLJA 3UICA 1KC3A 1IJKA 1FS6A 5HK8A 4A0SA 4BRUA 4D5GA 1M0WA 3IAXA 2HPHA 2XWBF 5K3SA 1SY7A 3MWEB 5HCIA 3T8YA 3HCAA 1A8SA 1RHUA 1DAKA 5CJJA 1FFAA 4NJMB 3J7AC 5IU6A 2WLTA 1OMOA 3GWZA 5T8KC 4BRZA 1T43A 3EW7A 4OU5A 2FNAA 1B6GA 2AQ8A 3CRQA 1A8QA 3Q5EA 2JLSA 4PPYA 1JAIA 2AVDA 2QZZA 3K5HA 4NS1A 2NUBA 4ARIA 4Z4FA 4TT3D 1KJ9A 3T1QA 2UUAB 4LN1A 2XODA 1HNXB 1U65A 3B6JA 2BE9A 5J2UB 3Q8MA 4Z1MA 4PAOA 1I2MA 2P0YA 1UXIA 1WDWB 4RY8A 2E4WA 1HTWA 3RHTA 3ZU2A 4ZJPA 5SZJA 1QGED 4CVNA 3EGEA 5AW8A 1A5TA 1RRGA 3WS7A 1L4LA 3MBKA 3ETLA 4QC2A 1H85A 4WLFA 1U7PA 2FR8A 3RUHA 3U81A 1XZGA 2GWHA 2WY2D 3FHLA 4UHHA 4HAUA 1S2LA 1JHQA 2ZAYA 3Q11A 4LSMA 3EH2A 4D9GA 1QZZA 5B7PA 4YONB 4CEJB 2JI8A 3VGJA 4XOUA 1Z5WA 2BDUA 2IEZA 1G5QA 2CJYA 2NUPA 1TF2A 2WAYA 3IAM1 2BMFA 2OLJA 5EA2A 5C81A 5IJ0B 1FSSA 3K09A 3WGZA 1PT5A 2WRZA 1W1UA 2HF9A 5ECDA 3TQTA 3W04A 3DB1A 5HVNA 1D5CA 1B3RA 1XB2A 2X9QA 1I2CA 5JH7A 5CLQA 3F6PA 2PL3A 3G49A 4WI1A 3BRQA 3BWCA 3QPCA 1ESNA 1NE7A 2H51A 2X8JA 3NCTA 3DZ8A 3QH4A 4H4EA 4YJ2F 4ALMA 4AQYB 1EWVA 3T3IA 1YAHA 3IHKA 4ESOA 4RTKA 1JAYA 1GFZA 3B12A 1GT6A 2WIFA 4I50B 1I3CA 2ZXFA 4I9HA 2QM3A 5FNVB 1EFAA 3VNVA 1P33A 2D5AA 1UFQA 3U40A 5CBPA 1OU0A 1T3TA 4O4JA 4L76A 3ICQB 4F04A 2DPYA 1ZR2A 1Z4PX 4OGLA 2E2WA 1KO7A 2QVZX 4ZT4A 3TD9A 2JFUA 1VSBA 1SD1A 1GN9A 1VL1A 4D0SA 1TL7C 2GQ0A 4YCSA 4DLSA 2LDBA 2ZBGA 5KSZA 4YMLA 1Y98A 4K86A 1NR5A 3FZNA 1YZUA 4JBHA 1IHUA 1HRDA 4Q9LA 5DOVA 4ZI2A 3CLVA 3DZCA 1VXRA 1WTAA 2Z6AA 2G9UA 3O8OB 4KPFC 5CA0B 1N7JA 2Z04A 2P6OA 2GI4A 3N8DA 1P6XA 4XRGA 4DMRA 1XK7A 3EQ6A 4R9VA 3L79A 5KZMB 1BOOA 4WXHA 5P21A 2BI4A 3IILA 1XKTA 4BC0A 5SZHB 3KOWA 3PYXA 4LVUA 1KE1A 3C3AA 1TMYA 4ZIRA 3S0JA 1F2UB 3DZJA 4TV9B 1T5OA 2J46A 2Q29A 4DLWA 5JVDA 1YQEA 5CH5A 2FW9A 1M76A 3TLEA 1MP0A 1II9A 1QCDA 4H3HB 3EDOA 4NYJR 2WSLA 4LEIA 2W2XA 4QUGA 1SK9A 3EWSA 5DHRA 2GYUA 3CBQA 3PHHA 2OXCA 3NRJA 2BMEA 1Q6YA 3QUBA 1RAEA 2FXVA 4EFKA 5CA1F 2O54A 2VH2A 4LDZA 3W5AA 1W4CA 1GR1A 3ZCQA 4D0NA 4O2AA 2IYWA 3K35A 1HV8A 4D26A 2KYRA 2QMYA 4CTKA 3SJUA 4IFEA 4KAAA 1YC5A 1GIAA 1S0UA 2QQGA 4V0OA 2JS7A 1HURA 2V7EA 1NMEA 1DI0A 3HJRA 5KNBA 2PDAA 1DAHA 3NV9A 4P3XA 1FMLA 2ZRMA 3SXPA 4MYTA 2O6HA 2PEZA 4X6XA 4OXKA 3ZWXA 2AJDA 4PX5A 3COVA 4BVAA 8ABPA 1E2JA 4M1KA 4JB2A 4KK4A 4QNRA 3TR5A 1I9CA 1BQEA 3GDFA 3JYNA 1TEVA 1I1QB 3DEAA 4G86A 1U2GA 2OFFA 1I2ZA 4EMUA 3ZWBA 5FXMA 1PT8A 4KYIB 5TJ9A 1KEWA 2BMDA 5K0TA 4EJ0A 4UOZA 3WMXA 5G0SA 3GXBA 4W5NA 3VSAA 1IXKA 2IWHA 1I3NA 1O9GA 4JQOA 2R1UA 4HRAA 4OXYA 3HI4A 3PR3A 4M37A 5J47A 1VPDA 1D4AA 2L19A 4E6PA 3CKMA 4X45A 2XPCA 3A1EA 3TO5A 1SUAA 4ZYYA 5CVTA 2QMHA 3BHNA 5KWIA 1PYDA 3BHJA 4I3FA 3JD2A 1VZ2A 4LA4A 3HWSA 2AF3C 2OB2A 4N9QA 4U7FA 1ONPA 4XVRA 3WOHA 4ND2A 3TZCA 3D2CA 3H1BA 1KI9A 3QI2A 4QATA 5ALQA 3FUVA 5L9AA 3LO5A 5AJTA 4PO9A 1SVSA 3COYA 5ARDA 1U9IA 5JR3A 3RYCB 4J16C 3GJ7A 2LIVA 4WXRA 4G0VA 2JKYA 5LDDC 2DUJA 3ZDEA 4CNQA 2YIJA 3SHVA 3E7WA 1FU8A 1AA9A 4CCAA 5JATA 3OJCA 4F71A 1USKA 5I7WA 2BHTA 3K5IA 4MQFB 1P2GA 1Y3HA 1X7HA 1DDGA 3GLFE 1AO0A 3KBBA 4BZXA 1NVUQ 3OIGA 4BNLA 2VP3A 3K31A 2BBTA 2HQRA 3TXXA 2OAP1 3FGZA 1X1RA 2C1XA 2WM2A 3E7DA 2B9EA 1P31A 1CT9A 1Z4OA 2XD9A 3BERA 3M2TA 5KKAA 2R5WA 2QVXX 3GJ3A 2XLBA 3FZEA 3OEWA 3PJRA 5LXTA 3KXIA 3KQOA 1PGNA 1ISMA 3W5HA 1X1EA 4I8XA 5CM2Z 1B15A 1E7WA 3Q7RA 2VSYA 3L8HA 3VI3B 4I1PA 3JVEA 4P53A 2JFZA 3SQXA 2D0OB 4RUKA 3AY6A 1YE5A 1MCZA 1UZUA 1L7BA 3Q2KA 4EA8A 2W6IA 2NO4A 3ZXYA 4ARCA 3CISA 4TYPA 4Q9IA 4BIIA 3T5AA 1C30A 1QHEA 5LQMA 3EEIA 1O03A 2IHVA 2IYRA 1CQZA 2UVDA 1NNLA 3ESBA 2Y76A 2ZCUA 4E15A 4BO9A 3K3PA 4IWNA 2ZJBA 1TK9A 1RBMA 5B55A 3FMFA 3HCDA 5IAKA 4EIWA 5CD9A 5JSHA 2H07A 5COAA 4B6SA 4OQFA 4FXPA 4F8JA 3N8NA 3RVBA 2X4LA 1PR9A 4PPQA 5H68A 5H0IA 5JCJA 1EEHA 1E60A 4HL6A 3K0KA 3FUTA 3ZIAD 5T3YA 4QTXA 4RHFA 4GI2A 1R9GA 3CLHA 4TM8A 2POCA 3QXCA 3MGBA 1HI9A 2QYOA 4RIIA 1R6TA 4ONEA 3PDCA 2CF6A 4P8RA 1KA9H 2KW5A 2NYAA 2PBLA 1FUYB 2KPOA 2EGGA 2P1ZA 2WPDA 3AETA 3ZCVA 1HKUA 4E1AA 4B83A 2UUBB 3HEAA 4WSOA 2WFAA 4OMFG 1K63A 2CK3D 5EGSA 4EEZA 1MABB 2ON6A 3JTMA 5BUCA 3LZDA 2PZEA 4FIDA 3WMGA 3UYLA 3C3JA 4F38A 3BFPA 2FPPB 4CM8B 1CZLA 3KU1A 4OI0A 4JFAA 1XYYA 5IBQA 4D2IA 3SDSA 4C0BA 4G5XA 4M0LA 2ZGVA 4BGEA 2QTLA 3QV2A 1YJQA 2HA4A 4K3UA 3BREA 2N0SA 3DF9A 5DDIP 2GKGA 3R4VA 1FTQA 1ICEA 1X14A 5FBKA 2O0LA 1DBRA 2IQ5A 3DLPX 2YASA 2RHWA 2CVHA 5EUMA 3KQWA 5HE8A 2BL4A 3EZ2A 2WSMA 3NM6B 1FFDA 4O4HF 3UT5B 4C21A 3ZJ5A 2VPTA 2D3WA 4F56A 4YV2A 3KZCA 5AVVA 2E5LB 4TL9A 3REFA 1W0CA 3T9FA 1JJBA 1RDFA 4IIFA 3ZWPA 3TLCA 1CUYA 3S6JA 4B3RB 4EGSA 4LNAA 3AR5A 4K6MA 5LZ2A 1KO4A 3DJFA 1KBZA 1HR0B 3OJXA 3CLSC 1FP2A 1I3LA 2OORC 5DWVA 1YR8A 3KJQA 1BX1A 1Z2AA 2GILA 2ATXA 3BRSA 3CW2A 4LXYA 1Q12A 3DXXA 4FIZA 3SXUA 2GZDA 5HF6A 2DRIA 4LNUA 2B4KA 3ZNQA 3AR3A 1Y6ZA 3M4XA 4IRMA 4HXEB 4ZGBA 2AG8A 2PAFA 3HVKA 1PR5A 3NC4A 2G9QA 4UD6A 1EX6A 1XRNA 3IQIX 4UD2A 4XIFA 5F12A 5CDGA 1UWVA 3PJEA 3T3PB 3HWX1 2FSSA 4U7GA 3JQ9A 5ALEA 3CVOA 5IKPA 4ISCA 1D1TA 1HO3A 3C1UA 3WWOA 3VKVA 1BSVA 3SF0A 1AHHA 4Q4AA 4UEOA 2DSNA 3ERCA 2WF5A 3ZWNA 5A1TA 2ZVPX 3DVAB 4ND3A 1JKJA 3G79A 4COKA 1EUQA 3TJZA 4YCLA 3A3NA 1ZUIA 2ACEA 3OAAD 4E5NA 1L5YA 4AY2A 3KEMA 3A1NA 3Q72A 4AYTA 2NZUG 1QRTA 5JRDS 1QHIA 4KXYA 1Q0LA 3JWGA 4W6QA 3R7LA 2QMZA 4QT0A 3V33A 2A84A 2X7HA 1G5PA 1LBQA 2JIZA 3A37A 3MCZA 1HE5A 2GA9A 4FQ7A 4HUJA 5HG0A 1R0SA 2H11A 5EVCA 4W4TA 3B7WA 2C2KA 4S1TA 3S1AA 4DWVA 2FGJA 4NC9A 1TW3A 2G4CA 2JFOA 3HZHA 5CT5A 1GAEO 2W2OA 5CXXA 1FSGA 2GK6A 2P62A 2W6JD 5IN5A 1M1NB 3WLKX 4TN5A 2WJPA 4RQAA 4MTLA 1ZSYA 3LLVA 3PIRA 4QHYA 1CRWG 2DMRA 3VKWA 3VO2A 2FPKA 2XZTA 2GCNA 3Q6IA 1JG3A 1UBKS 1WKCA 2J0EA 3L7OA 5KB3A 5L3SB 3THXB 3DHNA 4NYMR 4P93A 1XL1A 3UC9A 5CDUA 1EWQA 2B83A 2HK7A 2JF0A 4JJ4A 1EXMA 5J58A 4YJ3B 5E1OA 4ZEWA 4N5HX 1SURA 1DX6A 2R4UA 2A0XA 2ZK7A 1JI0A 3L1KA 3SBEA 4LNHA 4R2IA 5I7OA 5IC6A 4B7AA 4MRRA 5EQJB 3Q9LA 4KBGA 1RMYA 2OV2A 1D5WA 3STTA 2EC5A 2PH3A 4ZOLA 3EHDA 2YZGA 3LCJA 3L8GA 1J2UA 4MHSA 1K7CA 3H5LA 5LNK1 3C8DA 3STXA 3T3EA 3K9QO 5LBIA 3LIIA 5EMHA 1S2MA 2FR8C 5FTJA 3EIWA 3I1YA 4YRJA 4Y1GA 5TC4A 3KAKA 1FTWA 3NIDB 1PYGA 1WB9A 1XDZA 1UFVA 3ZWCA 3EJWA 2XKKA 3UW1A 1BVRA 3GOQA 3ZZNA 5DBIA 1PAUA 1L5ZA 5DM1A 3REOA 3N86A 3TZQA 3CUKA 1AQYA 2C5HA 3KWMA 1TQ8A 3BM5A 1E9EA 1K7FB 3CEJA 3LDUA 4I9FA 2N46A 4RD2A 4ITVA 3DCNA 1F0NA 3DMRA 2YRWA 3LFHA 5DK4A 4TYQA 4DPMA 5K8CA 4CMAA 4DWJA 3D8BA 4PRZA 5FTWA 3ZCUA 3S99A 2VAMA 3ILHA 4ZYZA 1CQWA 2Q5EA 1E1YA 3JXEA 1UK7A 3ETDA 3LQKA 3AVWA 2GD0A 3EVBA 5CP8A 4RZSA 1ONOA 1V96A 1XN4A 4LJ6A 3SCZA 1E6WA 1PZFA 1Q7BA 3N7TA 4LI0A 3DF7A 4EVRA 4TUYA 1TT7A 2FPIA 3KOZA 3ZW8A 4GNRA 1V9SA 3EF1A 5CJ2A 1N34B 1D2HA 4WBNA 2VKQA 3ICEA 4ZMBA 3C4QA 3IP5A 2HU2A 3L6EA 3ER6A 3QX9A 5CIQA 1HORA 3PDJA 3FDFA 4OG2A 4UOEA 5AI9A 3CYFA 2VDWA 2D7JA 1X7WA 2CLKB 2XKBA 3KVVA 3OP1A 5KAMA 1SCNE 4WEQA 3ZK7A 1DT5A 2IIBA 4LZLA 3SKXA 5KOHA 2Q5HA 3FPFA 3ILXA 5IH7A 2VP2A 3URKA 2WTMA 4RAQA 3GEEA 1BRTA 1P44A 1PK7A 2ZTUA 4P1ZA 3WYEA 3WWCA 1OUMA 5HKOA 5AUQA 3U26A 1YBVA 1E1QA 3DHVA 9LDBA 4EF5A 4YAWA 1EFLA 2HNKA 4X7MA 1XXHB 4IILA 1MT0A 5B3KA 4HGRA 3UMBA 2BOVA 4TLMB 3NPAA 3OZDA 4QEDA 2O0JA 2ZT6A 1LZLA 3VM6A 1U8XX 2G0TA 3DBLA 5KQGA 3N3BC 3WSTA 2FF5A 4FFBB 1ANKA 4M0EA 2P2GA 2YBEA 3BJZA 1SVUA 3D3NA 2EKPA 3ECSA 5LB2A 2R6AA 3EGIA 5ETJA 1XFDA 1V95A 4FR2A 3L4KA 3CZ9A 3MNFA 4F9FA 2Z1NA 2GNOA 2ZYRA 1VJGA 1P9NA 1D2EA 1Z34A 2DFNA 1Z7BA 2V98A 3BWMA 3CCBA 3F7NA 2GN0A 3PNOA 4TLCA 2YVQA 3VR6H 3MCTA 1OYWA 4OHXA 5IASA 4BDTA 1DQZA 2ZW9A 1EFPB 2HLDD 4KR6A 3B53X 4H0NA 5F21A 2P65A 3FVTA 4MS4A 2OG2A 1HT3A 2VDOB 3EUEA 3KB6A 4E21A 2ORVA 3OMWA 1KL7A 1EPUA 4MVJM 4YJKA 2HN9A 5BMOA 2QKYA 3A9TA 4YRCA 1EVYA 1QHGA 1VIVA 2GD1O 2WFLA 3K53A 4BP1A 3ZTTA 1U0JA 4HJRA 4IG9A 1OFTA 2CDAA 2OXFA 3M1IA 1GARA 2PWAA 4DL9A 4KJXA 5AKJA 4WKBA 4HQFA 4Y2VA 3RVKA 1ODTC 2Z98A 2E3JA 1AK1A 1V71A 3FI0A 3LKVA 2IA5A 2QTZA 4BNHA 4LXQA 3U7JA 4CCYB 2M2IA 3WJAA 4PGGA 3JPYA 3AT1A 3JVUA 4O63O 2AOVA 4EOGA 1U2GC 1SRQA 2ISSD 3S2FA 2ZCVA 2ZSUA 4LRXA 1NJGA 4K26A 3R3HA 2WQ7A 2CN1A 4ZOQI 2ES4A 1TM4E 2GKSA 5CB4F 4UQLA 2J3EA 4N6NA 1C5KA 1CUBA 3O3OB 4L22A 4BV2A 1RIFA 3GLIB 3IP3A 3NYIA 2C82A 5H83A 4E09A 4KAJA 2C4WA 3STVA 3G5TA 3LCMA 4I50F 2BF4A 2VP0A 3S4YA 2VPZA 5AVQA 1LK5A 1RQGA 3MERA 1OF1A 4U5XA 1PJCA 3NTQA 1RI5A 4B46A 1TMGE 2A9QA 3K8ZA 2ZDQA 3OFNA 2OO7A 3CKYA 1Z75A 3FDIA 1KOFA 3ETNA 4G23A 1A1VA 4MQLA 3T7JA 1J06A 2JH9A 1E6UA 1ZAKA 3CGGA 2C7QA 2WUEA 3ZX5A 1HE8B 3VAYA 5U9CA 4QTTB 2PWPA 4A1OA 1Z7GA 5I7EA 4ZJYA 4BX0A 2REOA 1YRLA 2IF2A 4X54A 3T12A 1Z9BA 1J2EA 1UBCA 3RTAA 1WUHS 5J9FA 2HXYA 5CA0F 2ZIUB 2P9JA 4ER3A 1KHTA 2G67A 5LP6A 1MQ9A 2Q5JA 2REBA 3ONWA 4R16A 5BNZA 2IOFA 4ZGWA 3AESB 3UA3A 3TECE 1RPZA 1UZAA 1VL5A 2ANBA 4OM7A 4N5DA 3M34A 3DP7A 4JB0A 4X1YA 4BMNA 1WHSA 4DR6B 2YS6A 3NIBA 5KJEA 1F06A 1QDUA 2PSDA 3OQIB 4RA9B 4ZOCA 4LUCA 1RM4A 4EHHA 2JGNA 4MCJA 1YACA 4OKNA 4MIOA 1KJQA 3FJOA 4C03A 2HU8A 3SJZA 1Q11A 1KSFX 2CNKA 1VJDA 4FSDA 4MS3A 2QRVA 3O94A 3W8NA 1FZTA 1TX4B 4HDKB 4KN9S 1LI4A 4Y6QA 5DGIA 3RWBA 1T34A 4EI8A 5A3SA 3T7SA 4KNVA 1LPBB 7REQB 2CFRA 2VDJA 4RF5A 5LUBA 3DUWA 4CF5A 4PGAA 2ONCA 4EKYA 1D4ZA 1CUHA 2A0WA 1E7SA 1M1ZA 1GTJ1 2P77A 2QYTA 4LJAA 4R05A 5EG5A 3P9CA 4E51A 5HSGA 4DXAA 1USWA 4I5DA 3NOVA 4G0ZA 4HDSB 1F17A 1XTUA 2VR1A 3A6LA 2B2XA 1UBHS 4Q4HB 1Z0AA 1Y1TA 1YDEA 1B93A 3TLGB 1VMEA 2I1VB 5EXSA 5FJJA 3R7NA 2VRNA 1PKXA 2JJ1D 2WDPA 1AKMA 5J40A 4KLNA 1XCJA 4L15A 4N8EA 3ZV5A 3GI1A 2D1QA 1J2TA 1YE3A 2F1HA 3PVZA 1BW9A 3QK7A 1WU7A 4MVJA 2JDID 3AEZA 4OB6A 1E8DA 3W77A 3ZHTA 4TN1A 2NOAA 1X1AA 3ICWA 4ZQFA 1XD8A 1YZQA 1LPSA 1V5WA 1LTHR 2KQUA 3B70A 3UHJA 1D0SA 1K6JA 3RC9A 1BE0A 4C7JA 3PC8A 2G77B 3IO3A 1Z0JA 1L5RA 1QIGA 4LHWA 4MVWA 4TWRA 3FCSB 1EAYA 2YMQA 2BMWA 4G81A 2WZQA 2JK1A 4QRHA 2FMIA 1C7JA 2AUNA 4FKMA 4CMKA 5C5DA 2V1UA 4E03A 2G8LA 5EIWA 3TMYA 4EHAA 2EKLA 2Q6OA 4QULA 4TKZA 4JH0A 3FUWA 3GLQA 4FN5A 4JLUA 3KB8A 2WOJA 3AFGA 1TPYA 4WVFA 1NW9B 3PEFA 4NYIR 4WH0A 4F4HA 3QWBA 1ENOA 1P72A 3ITDA 3L7KA 3K1AA 4EHFA 4JI3B 3AVVA 2QL6A 2ZITA 1IG3A 4JMLA 5IT0A 1ICIA 5KYWB 1KEEA 4ND6A 4EO9A 5HR5A 2BHLA 1MB4A 3GU3A 3SG0A 3JQAD 1G63A 4RU1A 3PNYA 2NXWA 4XEUA 2XIJA 1YDFA 4UJ3A 3RYFB 4BPRA 4D8UA 3ND7A 4MYDA 4IKOA 1J9GA 4M8KA 4N1AA 2NUTA 2MSNA 4X9XA 3M3DA 1VSVA 3P0RA 3U3KA 3RC3A 4ALKA 1CJVC 1ZPDA 1P2FA 2F3RA 2HIMA 1CD5A 2EP8A 2QWXA 3DG9A 4Z99A 5I9NA 1RHQA 3MB5A 4BQNA 4JCOA 1JKIA 2DQKA 2VQEB 2Q4RA 3F90A 5JXGA 3H1GA 5CT4A 3ZWDA 3SM3A 3BE6A 4PYOA 4QXAA 3EPLA 1I01A 3FRIA 1HDXA 4LBVA 3W34A 1VSUA 2O6LA 1N3LA 3DOUA 4FWBA 1IN1A 2QLTA 3JY6A 1MOQA 2H4ZA 4NULA 3MTJA 4OAQA 5CYFA 3I9FA 3TIFA 4RWZA 1V3UA 1XD9A 2WT8A 1NUTA 1UMBA 3RI3A 4PGMA 4JA2A 1EM6A 2ONYA 3RTCA 3O8RA 2O8CA 5CVCA 3MT8A 2AR7A 1N33B 4L5IA 3FVWA 3M81A 4KQ6A 3JQ9C 1NWCA 2HRQA 3K92A 1G9TA 1UT5A 2AZTA 2JJQA 3ZX4A 3TSWA 1UC4B 4TZ0A 5HEKA 1OV6A 5A3JA 1CG6A 3L7JA 3WNZA 1XAGA 2PV7A 2WWWA 3EVGA 5M2QA 3F6SA 2HJHA 1T1IA 3QF7A 3K6SB 5F78A 2A4KA 1MAWA 4HX2A 1KI2A 2YYYA 4B7UA 2OMKA 3Q3IA 1SRRA 3T38A 1E62A 3CVVA 1FDOA 3KJNA 2NAPA 2G72A 4K9SA 5ULLA 5LKAA 3M6FA 3CF2A 5CLIA 5A05A 4HRVA 1GTZA 3EZ7A 4MW2A 3PRYA 1ZH6A 2GAOA 2DFLA 3EWNA 5HUHA 3AOGA 2B92A 2PKWA 1YF3A 3AEUB 3DLTA 4IDEA 1NQAO 1U0FA 1DMSA 4DR3B 3TZHA 1AUVA 5IYZF 1NVDA 1W48A 2BN4A 2Y2UA 4GPD1 2BFPA 4Q1CA 4RGYA 5EEGA 2O1XA 4ABYA 4DM7A 5JROA 5DASA 3KPVA 1ZGBA 2IKQA 4EY6A 3WL8A 1OLXA 2WMOB 3GD7A 1JH8A 1U8YA 2JFBA 2O8NA 2HH9A 5EYPB 5GOZA 2Q0QA 1N2IA 1US8B 3ILSA 1KDZA 5IEJA 5T4EA 4PYNA 3BMQA 1TECE 5E9AA 4XIGS 2BMVA 2QI9C 4ZHQA 2IW1A 4DIEA 1T1RA 3KFXA 4G0NA 4A16A 2LZ0A 1ZSVA 3IOBA 1JHOA 4UAVA 1K3UB 2NXEA 4MW7A 1ZQ9A 1U3DA 1Y7IA 1IWOA 1QK3A 4P7KA 5LQJA 4IFBA 4XEHA 1T3GA 3K6SA 5ALGA 3V2GA 2X0IA 3ZXSA 4P4SA 1HFJA 5A7GA 2J6IA 2IW3A 2BYTA 3NDBB 3MINA 3ZZTA 3WWDA 3ZC3A 1G4HA 5A4KA 1TYBE 3TSAA 2C00A 3DCYA 1XQVA 2JZOA 1E6MA 1I32A 1QVZA 3KR9A 4TKMA 4TXLA 2HK9A 3IH5A 1JDZA 3L6DA 4H0FA 3N7AA 4C4RA 4DA6A 5I4IA 2ZUFA 3EK2A 1GCUA 4ZALA 1J5EB 2G1UA 3PLAE 2JLQA 3N2LA 2O57A 4UNQA 1BD4A 2O2IA 1XO1A 3TRDA 4JIGA 2I3AA 1H5UA 3WGLA 5CNJA 4HT3B 2PYDA 3MWYW 3O8QB 4MUAA 4YP6A 3TSYA 4I8DA 1W36B 2BFFB 1CS0A 2XUZA 4B7CA 1AGPA 4IDHA 1R1DA 4TX1A 2BFDB 2NO6A 3T1HB 1IBMB 1GGJA 3QRWA 3H5IA 1AG9A 4MDYA 1R4NA 2GPWA 3OC6A 2NNWB 4IMRA 3ZY2A 1B4DA 1RRFA 4TQUS 5A5DA 4N5NA 5ALYA 4LOLA 4JDUA 1P81A 1F20A 3RC1A 3KJGA 4HDRA 3ETJA 2PT5A 4N0PA 4NBKA 2EJUA 5K0BA 3ONNA 4ZVRA 4CLOA 2IDZA 3DTYA 1PG2A 1TJ3A 1WZNA 1QOQB 1V9CA 2XNSA 3R7AA 3SNHA 1KGSA 4MR7B 1PEYA 4CRWB 2QL9A 4XYGA 2H3EA 2BUBA 2IYEA 2VSFA 1RCUA 3CEMA 1EDEA 3F4KA 3HNRA 2C7RA 1IIRA 4LXHA 4Y2TA 2GM4A 5DEIA 1JQ3A 4MWTA 4UUAA 2J5RA 3PTAA 1OLUA 5EPUA 2PUTA 3OT4A 4AKEA 2X4GA 2WWYA 4U4AA 4R7GA 1SXQA 2VJLA 2CDNA 2QQ5A 1EKXA 5K4HA 3KAJA 4JHLA 3IOEA 5AHKA 5DLYA 1TKCA 3DV9A 3GRFA 3WLHA 2YIMA 5BQ3A 2X13A 2X22A 3OESA 3LDFA 3LLSA 3NBKA 4IDAA 2XNDA 4RLQA 2V7BA 2AS0A 5F3DA 1XPRA 5H16A 4UNSA 3HUFA 4G0YA 4KSBA 4RKFA 2QRQA 4XJTA 4Y2JA 1O57A 1INLA 1G4AE 1ZUNB 3D8RA 4ISBA 3RANA 4EG1A 3W9UA 4EY5A 1TQDA 1U5AA 1V3VA 1ZD1A 4A6EA 2DLCX 4LVNA 1QE5A 5TPZD 1C50A 3A8TA 5AOAA 3UO8B 3I4LA 1TO6A 4OGFA 4Q7EA 4JUAA 1ZMRA 1CTQA 3FKJA 3OVMA 2O3QA 1Z4LA 3T0FA 1G6HA 3VZCA 5E6UB 4CF7A 2GTPA 3UUEA 3W2HA 1SAYA 1TCVA 5LSAA 5ENDA 1TVKA 4JT9A 1C9NA 2GJ8A 3HYRA 4XTRA 1JJFA 3CW8X 3IV7A 2VAWA 3HJUA 1GU0A 1F12A 1S2DA 3DMPA 1OI2A 2B3DA 3G7NA 4LE2A 3FRHA 4BCDA 1XCOA 1W5TA 2XGSA 3ILYA 2O20A 3FWYA 4JBWA 2FUG1 1Q84A 1FQOA 2EERA 2KI5A 4JOBA 5DYIA 1JYFA 3PX2A 4AT1A 5JARA 2HMWA 2CZQA 1KMIY 3LUAA 2R8EA 3ADOA 2BSXA 1X7DA 1IE3A 3UQZA 4DV4B 2V97A 1PFYA 4UM5A 2R11A 2AB0A 4ZA2A 1VKNA 5IJ9A 3D6TB 1VIDA 2CV1A 3I6YA 1N3BA 4PPFA 5G0UA 2VJCA 2BC9A 4B4VA 1REQB 4O02B 4RDCA 3P9SA 4ZCIA 4YAFA 1UEIA 3CN7A 1GPWB 2ZSFA 3MHTA 3JAKB 2NX2A 2NSJA 4QEZA 4YV0A 3K20A 2PMFA 4XXHA 5IHXA 2Z6UA 4JA0A 4K6CA 3JQEA 1FP4A 5A5EA 2FDXA 3D7MA 3Q7TA 4NZMA 1JXOA 3IHTA 5E6RA 5JQGF 2ENUA 5DV9A 3TW8B 1FFBA 2OHVA 2VYVA 3K16A 3GT4A 4EW3A 3JD0A 1JX6A 4AKIA 1QJ4A 1HOXA 3R77A 1M2NA 4XTCS 4YI5A 3REQB 4DA4A 4YRQA 2AQKA 3KQTA 4FCTA 4HWKA 5M04A 4I5GA 3FOEC 3QELA 4IVPA 4MMXB 3WWZA 3HACA 2PYIA 4K9OA 3RKSA 3FPKA 4LFBB 1YO6A 1TE2A 3FTFA 1YCFA 4X66B 1N9GA 3M3PA 1UK6A 4V03A 5LP6C 2VO1A 2EG5A 1UMCB 2FZ5A 3WSWA 4AURA 4EUHA 5H82A 1V5EA 1F5SA 2YJ4A 5ITZA 4CKZA 4A26A 1JTVA 4NMXB 3P4YA 4KXVA 3UYKA 1JYSA 1FE8A 4YYEA 4DYHA 5JMTA 2RGBA 1QUEA 1P60A 4C43A 1Z56C 5E8JA 2H17A 2PO7A 1QZTA 3PVCA 3QZUA 1OYYA 3WK9A 4M7WA 3THYB 3S2SA 5ITWA 2JANA 2VAPA 4BCBA 1ILWA 4X71A 3R8XA 3GAAA 4YGXB 3B82A 3VR4A 4ZOBA 3WWPA 2JHCA 3OBIA 5J5VA 5K3BA 3ESRA 4BQQA 3VKHA 2B8TA 3QW2A 4E12A 4IQ0A 3W9BA 2DB3A 1FUKA 3V4LA 1T5LA 5TE9A 2AI1A 5EE9A 3ZUGA 4HNVA 1PNRA 3U6KA 4RC9A 4ZVLA 5LKRA 3CPSA 4QLOA 2RSLA 2XJ9A 5C32A 2W93A 3KR2A 1M2HA 3TI9A 1WP9A 3BCSA 2ZI6A 1WXIA 1IZ7A 1H6BA 3G0IA 4QNMA 2ZYUX 4CCSA 5BMVB 4UASA 5JXJA 1ZUWA 1PV1A 1GZ7A 1C29B 1N6OA 1XE3A 3K8OE 4Q39A 4MUBA 2YZ2A 3L41A 1YDHA 4IIJA 4BNNA 1IXYA 2FQYA 1HE1C 5TX7A 3RHSA 3L0IB 2A58A 3LDGA 4TWBA 5EJ8A 4KWHA 3F4LA 3D7SA 1X0XA 2QTGA 4WZBB 1O4VA 5JADA 5ARBA 3VJMA 4TMWA 2G3YA 4I8IA 2OZLB 1WBBA 3PC2A 1W94A 4G56A 4HP8A 5F4BA 1Y4ZA 4BQRA 5I3CA 5JZSA 2SKEA 1Z16A 2GEKA 1FQWA 3C3PA 3PC8C 4XWKA 2SKCA 4O5AA 1SUCA 3KQNA 4CEHA 4C76A 4MWBA 1U80A 5KTKA 4B43A 3CPJB 3O84A 4MQ5A 3HO1A 2NZYA 5FWAA 1B0PA 1OI4A 2EZ4A 2R62A 4K8RB 5JSUA 3RWOA 3MLEA 2O2JA 4ZAVA 2V8OA 4BV8A 1S1MA 1QK5A 2GF0A 4MPDA 1N2JA 3W6PA 1C4KA 3MC1A 1XZKA 2HRZA 1TUGA 1W19A 2NVWA 2WFMA 1Q1EA 1KAMA 2VHWA 4FEGA 5AI5A 3ICVA 5EP4A 2VOJA 2QLNA 4EYOA 1AE1A 1Y33E 1QO0A 1U0OC 4KJZA 3ZE1B 1NJ1A 1YFZA 4G41A 3RVRA 3VNBA 4WXMA 2Z1DA 4M49A 2B4TO 3KXLA 4O2RA 4PLHA 4QD3A 4M6WA 4UBLA 3WQQA 3ICCA 5KMGB 1R4AA 2Y1FA 3R3UA 4GEGA 4RK7A 4YPFA 4BMVA 4YRZA 5HQ3B 3N5KA 3ZWVA 1XRLA 1CK4A 1QDLB 2H5JA 3O83A 4WBXC 1HF3A 5EIFA 4WVLA 2AEJA 5T4HA 2SICE 3GLHB 2ZTHA 4ZAFA 1OGYA 3ZGVA 4WESB 5KJ6A 3LCVB 2ZJ0A 3FPBA 3KQYA 2FG6C 4L57A 2I4LA 2FPOA 4TWJA 4DLUA 2XWSA 4FC7A 3AG6A 4ZU3A 3NJ4A 4O6VA 4R1OA 2VHCA 4LY0A 1CZHA 2PVPA 3AV0B 2XMSA 4OH1A 3TQFA 3ZDZB 1KEVA 1DBPA 1EMDA 5GVSA 3WO1A 4BNMA 4BGIA 2ZI7A 4DSOA 1JSLA 3D9QX 4H1HA 3SQMA 1P5FA 2NO5A 5FULA 1Q1GA 1FQJA 3RU3A 1J2YA 1L4MA 5EPEA 2AJTA 1QYRA 4GPEA 4QJ4A 4OQEA 4CFZA 1XZJA 3FSJX 3ON5A 1GXSB 4QGGA 4RFLA 5F64A 5B53A 4YP0A 4PLCA 1TIBA 4ZTBA 2O7NA 1J70A 1UOPA 3TPFA 3LNTA 2OKGA 2X8LA 4I4TB 1YNSA 4HY3A 3T3GA 1IK4A 4DYVA 4ZMRA 4WD3A 5JAMA 3WMEA 2Q7XA 5B4UA 2FPGB 2MR5A 3AZQA 3U3JA 3VOSA 1ZN7A 3B1FA 4RKRA 1O6FA 4RV4A 3DZHA 5KTSA 1GUAA 3KQPA 2IEGA 1KO8A 1R6UA 4X6YA 5BRNA 5B3LA 3RSFA 5U4QA 1QIKA 3W8DA 4HWOA 4Y0NA 1KAOA 3LT0A 5DX0A 3MCVA 3GT7A 3UAXA 4IH9A 4BE4A 1QIDA 5JNRA 1GQ2A 4R8VA 4RZIA 2LRHA 4Y1RB 4J75A 3T52A 4LZOA 2QLMA 3EZYA 4J90A 4YDRA 5TQ2A 3S81A 5CT8A 5DCWA 4Q1DA 4Z6KA 1HRKA 4Y9RA 1LPAB 3HM2A 5FCDA 1JN0A 5HBGA 1A95A 2VK4A 3O3CA 4MGZR 4EUSA 1RZ3A 1X8JA 5TS3A 1ZVJA 3GPCA 3VYTB 3HLTA 3IP9A 3L3BA 4QUBA 1O0BA 1Y8RB 3B6EA 1V2HE 4JU8A 3GF4A 1OBCA 1M2EA 1PVDA 4RTOA 3O8BA 3AVOA 2VCEA 2PHZA 1I30A 3EULA 3I6IA 4NX2A 4CODB 4EJMA 3MJVA 2FOIA 1CNMA 3QFSA 4TTJA 1T9AA 5HF8A 5GPBA 2YCLA 3ABZA 3GMTA 3KOOA 3U49A 2JIPA 1EB9A 4CUKA 2F4VB 1FDVA 4QOGA 2J6CA 3ZGNA 5EJ2A 4DIOA 1BWPA 1MIOB 1D07A 3HHPA 2X9VA 1XF9A 3KHUA 4IS2A 4RGVA 3TE7A 2WD9A 2DLNA 2HQ1A 3LGXA 1IEQA 2YHIA 4QBTA 1CF9A 3DC2A 2ZUEA 1I3MA 2NU6A 5FRDA 3KSRA 2FFHA 4LOJA 5DGTA 4YRLA 1LWOA 2Z2YA 4PONA 1CF4A 2QPAA 4FWIB 4UM8B 4BFUA 2J31A 3I9V6 1U4SA 4BZQA 3VISA 1DEXA 3ROMA 3W1WA 2YWEA 3L0OA 1KFJB 3OIFA 2VQDA 1KZHA 4NBNA 3E3OA 1K75A 4MULA 2X4IA 2Z3ZA 2IPXA 3H1FA 4GBGA 1HL3A 4EAAA 3R6DA 1UBRS 3BBLA 3ZDFA 2C4VA 2I8AA 1CUXA 1DG3A 4BNJA 3ZYCA 2A1UB 3ZK8A 4F86A 4L2IB 2PUFA 2OCXA 2X4DA 3IR5A 1EZ1A 1I10A 3KKQA 5G1PA 5C5IA 4X95A 3JALB 1H65A 3Q0TA 4FQ8A 4R40A 5JWRA 1PWYE 2OK7A 1PJBA 5E7MA 1JB1A 3HDJA 3JVVA 3DBVO 3IE0A 3W06A 1K8QA 1WS6A 3EXFA 2PTHA 3WGKA 1SJ9A 3KSZO 5EMLA 4HDQB 2ZZNA 4LBWA 2XYRA 2Y68A 1KRHA 4IRUB 4JKIA 1NQTA 5FI0B 3OKAA 4PFQA 5IK2D 4CIYA 5KNBD 3ENNA 4QDUA 4LDQA 4B80A 1OZFA 1UJBA 3RYTC 2YY5A 4W5HA 4ZU1X 4CHTA 3LZ6A 4URYR 2YC4C 1NBMA 5KVAA 1I33A 1SFRA 4OFZA 521PA 4S1WA 3CCFA 2OCDA 3K9NA 2J4CA 1ODKA 4FS3A 1ZSNA 3UMVA 2P5UA 1EXDA 4OAPA 4URXR 2XCIA 3L5OA 4ZWNA 3SR0A 5IH3A 1PRYA 3C5VA 2OCYC 4FBMA 1TYDE 3PGLA 5C3MA 5HWSA 3KQLA 2PMCA 3P96A 5KDLA 2HJWA 4YRGA 4TMTA 5DBFA 1L5OA 2WJ4A 4L4XA 4LHVA 1R27A 3ENWA 2CB0A 3N58A 3ANNA 4I2NA 4PYLA 4U7DA 3OM0A 2XOEA 3VRHA 1YVDA 2JGDB 2ARKA 2P8SA 1M1YB 2XJ4A 4XX0A 2C84A 3F49S 4KQ9A 5DYGA 1E4EA 1E92A 1GQRA 1F7VA 5DH9A 4D4JA 1UBJS 3D6NB 3RK0A 1I6MA 2EDCA 2H52A 3NVDA 4Q34A 4Z4CA 2ATIA 1JZTA 2AFHA 2WHEA 2R6FA 2PUDA 4DTIA 1NI3A 4X6LA 2GS9A 2DC1A 1QRUA 3RJ5A 4H7IA 5CH8A 4R3WA 1ST3A 1GKYA 1VGVA 2Q5IA 3FPHA 3H1PA 5DN9A 4A73A 2GETA 3B1KA 4MV4A 3H75A 3AM4A 3U3DA 1NI4A 4X1OA 3M2PA 4DMKA 1WZIA 4J0QA 1XCBA 1G2OA 1I4OA 2A1TS 5D86A 3IJPA 1C0PA 1UXKA 2WNHA 4E22A 1KTVA 5JRZA 3SS8A 1KTIA 3QUSA 1HDYA 2D7CA 2GNPA 2PX0A 4E5SA 1KH1A 2F3TA 2QPOA 3I5MA 3ITNA 1FLDA 1IUOA 3AUKA 1BH2A 1TUBA 4R2LA 2REQB 3FRJA 4GQBA 3ZD7A 1WCWA 1E3WB 2I29A 4PC2A 2WHRA 1TJ5A 2UVPB 3WHLA 5ALJA 1C4XA 1YB4A 1T35A 5G3YA 1IQPA 1FX0B 2QP4A 2I99A 3AIOA 3WKCA 4F60A 3FPCA 3EEQA 1S01A 3P2IA 4L9AA 4M99A 2CVQA 4ER5A 4B3GA 4L5AA 4TMZA 4O5OA 4D42A 1Z0FA 3LOUA 1BN7A 1O96A 1QQ6A 2L82A 3LUDA 2W2KB 3OU7A 4DG8A 3MJSA 4KVAA 3BPSA 3BZWA 2CJFA 4GGOA 4HH0A 5CGZA 1W85A 3VU0A 2GK7A 5KDOA 4PGHA 4DUPA 4D4IA 2X0DA 4HVLA 3ELBA 1RKUA 2RBGA 3EE6A 3NHWA 4HAXA 4JOSA 1BXGB 4M4SA 3MM4A 4P4UA 4YJGA 2RGGA 3FVRA 3UWMA 4J3JA 2NWQA 2PN1A 3F97A 5CPFA 4QTYA 2PUCA 1B1CA 1HT0A 2ZRNA 2VN8A 3KYCB 3A9CA 3LXXA 1ZCJA 2Y2VA 2I6GA 4ZEXA 3O4GA 2XZPA 2JCBA 1GKUB 5C1BA 1WCV1 2X2FA 3UB3A 1RYNA 2AOTB 3LCRA 4H31A 4EB8A 1Z6YA 4DMUB 4FU0A 2E5FA 2PX5A 3TWOA 5AW7A 4NNPA 2C04A 1A9SA 1ZCZA 2DX7A 4RQUA 3HCCA 3AB7A 3AFMA 5A9RA 4ZYTA 1E64A 3QJYA 2EBWA 4OJYA 3CEHA 4HQLA 1V9LA 3BA6A 1Y4UA 2P3OA 2XBUA 2D1YA 3E22A 4OUDA 4QWWA 1P0FA 1GQYA 3DE2X 3DMFA 1KKMA 3PD1A 3RYIB 5KSOA 5IM4A 4ZCSA 2O2HA 2J67A 3N9IA 3K9CA 4YN3A 3VH4A 2CZCA 5C7IO 1SHUX 5B3JA 4A2WA 1NP7A 1RAGA 2UZ0A 3KHSA 4JFRA 3SC4A 3MJCA 4NE2A 1VJ0A 1IDN1 4ZQBA 1FDTA 3WGTA 4A4DA 4BAZA 1LTKA 2QN8A 3CJTA 2ZU0C 2QBYB 2XCOA 2Y0CA 1KEZA 1MC8A 2HF7A 1RC0A 1T2CA 2HGSA 2XY4A 3U44B 3AJAA 1O54A 4XLTA 4CIWA 6GPBA 1KU0A 4WCFA 1F6WA 5K2MA 2HWKA 3HFGA 1G8AA 2HPAA 2B37A 4OXIA 1PJ4A 2R1VB 4TS1A 4Y2YA 2PS9A 1A2KC 1VE3A 3DE1X 4OLHA 4FW9A 1QGUA 1SC3A 2Q8QA 4KDRA 4L85A 3WY9A 5JH7F 4N47A 1Y9DA 2GXQA 4H6PA 4Y7CA 4OU4A 1MEEA 2I4MA 2ZI5A 2B78A 2IXGA 2Z0MA 1VE6A 3PT5A 4NL4H 5T5QA 3RASA 4GM4A 3W6ZA 3DAPA 3HCPA 3PWZA 5CVUA 1JEYB 4KO2S 3EMVA 1R4MB 3RQIA 1N5OX 1SB9A 5DFAA 4RZUA 3K70D 4F4DA 3D8TA 3IRUA 2WF6A 1KPHA 3RWMB 4QUIA 4GGPA 1U98A 4W8GA 2EIXA 1JG2A 1VYVA 1RWBA 2ODTX 3F96A 1K4KA 4HAIA 1Z6AA 4O4JF 3RFCA 4YEDA 3CEPB 5EKSA 5HOQA 4ZO4A 1TU4A 3FMPB 3OTGA 3VUEA 5KMGA 1P1KA 1EI9A 2GO1A 2I4IA 4GI1A 3FAZA 4FB5A 5K8VA 2IRWA 4DCCA 1ZMOA 4ZGGA 4I46A 4WNYA 9LDTA 3C41J 1VHQA 4IUBS 2XTNA 3JPWA 4TWZA 3RVDA 4OQPA 2VNSA 5CX4A 1NYRA 3NEJA 4MK4A 3DFUA 3R8FA 1QU3A 4Y9UA 3UMRA 4MW1A 5JJCA 1EVJA 4Q3LA 1ZK1A 3VH3A 3P0IA 2MOKA 3OJEA 3H5TA 4UFNA 3F8SA 2EQBA 2Q0SA 1PT6A 2R6GA 4KFRA 1UM8A 4MR8A 1U7HA 3MWDA 5D2CA 4B33A 1U0HC 1SCDA 2NPOA 2VZLA 4OBXA 4XKJA 4IL5A 3AY7A 3BTOA 4EG7A 4IDGA 3HBLA 1K5DA 1M1XB 3PQ2A 4MX8A 1GTL1 2B98A 3FNBA 3MYYA 4DNFA 5KNCA 5JVDF 6ABPA 1XJWA 2C2OA 3G2LA 2Y1OA 4Z86A 4JLNA 1Z0DA 1BXRB 2VEDA 1E3TA 3BSWA 3LCCA 1RXEA 1SQ5A 2QXYA 1IZZA 1E5XA 3BXXA 1NKTA 2VUSA 3GB9A 4HN4B 2UUOA 3FIUA 1U4OA 3R1IA 5BVHA 4B4UA 3AONB 1C1XA 1QTRA 1VE5A 3OC0A 1N6RA 1WG8A 3HYTA 3MJEA 4KEAA 2AD5A 2HWXA 4MYRA 5TMEA 1I8TA 1NNUA 4O2AF 3VPAA 3SP1A 3KUCA 2CXPA 2EKDA 4L8LA 4X7RA 3AWIA 3MN1A 3D5EA 5FL3A 3TAXA 1DUSA 1M9NA 3GRUA 3OLYA 4AM8A 3V34A 1OREA 4P5PA 1JMVA 3WYDA 4ADSG 5FH9A 3KD2A 1IXRC 1XCLA 2XVAA 3EB9A 1RJWA 1UJCA 1YASA 2J9FB 4IDDA 1W93A 5TQVA 3SEAA 3WGQA 2V6FA 4J0KA 4MICA 1NURA 5E9QA 2COEA 2QLFA 5JW6A 1BFKA 5EP3A 3I9NA 1L7QA 2EYUA 2FZLA 1K3FA 1UPXA 3BD9A 1BS9A 1OT5A 1GPJA 2BKVA 1RE1A 4IDCA 5E0OA 2CBGA 3F7TA 4FYVA 3AM5A 4B3MB 1JVBA 2COKA 3AJ8A 4Q16A 3ED5A 2O8CB 1OASA 4FFDA 1AY0A 2C2MA 2LCFA 2GBIA 1QYDA 3CA8A 3QW4B 4L27A 2ZIFA 4G0OA 2D5LA 5KEIA 2A67A 5DNYB 5JWOA 2PUWA 3PGVA 1C2YA 4GLOA 2WF7A 1QZUA 1IB0A 1PWZA 3PT9A 5KTNA 1JFFA 1VZ3A 1WX1A 1GTG1 3GD5A 3GGOA 1H2EA 3K94A 4J6FA 4WHMA 4XQEA 4A5SA 4B73A 5BMVF 5LMZA 1HQKA 1YZKA 2W8BA 2XQGA 3C16C 3E61A 4IEEA 1T0BA 2QUZA 4MZXA 4UAGA 4KQMA 4R0MA 2VPWA 4EB3A 1WWKA 1X3LA 3A6FA 2VZ8A 4B79A 3LE8A 3M5CA 5CK5A 1SXJD 1OXUA 3QKWA 3EY9A 4AO6A 3C3XA 4OEHA 2NT4A 3AMVA 5AHOA 3SAJA 4LC1A 3WLIA 1QWOA 4BO2A 1NFQA 3ELYA 1BN6A 3RUDA 4CKEB 3TNJA 2ZPAA 1YRHA 1C8VB 3V8PA 4A10A 4AJPA 4FFWA 4ZI7A 4JYPA 1T36A 4NJEA 2ZYTX 3OD5A 3T5GA 3H1TA 1B8PA 4M36A 1G9SA 3ROTA 2OD9A 2JI4A 2X2OA 3WLRA 4W8OA 5JS8A 3WXMA 4W5TA 3BEOA 3OE7D 1R74A 1V8OA 3SF8A 4GMHA 3H2KA 1BXZA 1VRVA 2CC2A 2HYDA 2BEVB 3WWYA 1PJ2A 3LD9A 4C6TB 2MHCA 1A4UA 4RZHA 4W1SA 5EJGA 1WBDA 1YVEI 2ABWA 1OXSC 1V3QE 3AFIA 3F5MA 3H2YA 3Q5GA 5LXTF 1LSUA 2K2WA 5FTNA 3TKLA 2DFDA 1NBME 2X7JA 5FUBA 3PA6A 3OT1B 1BG6A 1Q83A 3IUEA 4JBNA 4PXAA 3TZEA 3TXAA 3U4HA 2XRMA 4KXWA 3ZGLA 4G5SA 2PLNA 4B32A 4BQPA 1H8ED 1YQGA 3KTAB 4RD0A 1BH6A 3A4NA 3WDMA 4EUNA 3SQWA 1T8UA 4ZQEA 3SJAA 4QDZA 1QG0A 2WM9B 3URMA 3G6KA 2X1MA 3LW8A 2J7PD 2HQOA 1P74A 3IMGA 2PANA 2O5VA 1VE9A 4QUDA 1UJ5A 1IY2A 1L5QA 3R3YA 3U7HB 3WLPA 2BHRA 3BE5A 3DOEA 3SSMA 1Z2OX 4ZCLA 2H48A 2VH5R 1ENYA 2JD2A 2E4AA 2FUEA 1CUUA 2CXOA 1EGAA 2X58A 3QE3A 4G07A 3IQFA 3BIWA 2O2SA 5KNDA 3CUSA 2AFHE 2CKMA 3AK4A 1Z8DA 5AO9A 3D0RA 5IJXA 4YRPA 2JJYA 4HCJA 1K7XB 5CG2A 3TOXA 4D4KA 3U39A 3GVPA 2YRFA 3HPQA 3SJCA 3RC8A 2A9OA 2MINA 2W8ZA 1K1EA 1DPGA 3NANA 4XVHA 3HJTA 4FMPA 3ZI4A 4E7PA 4J03A 4FNGA 2IS2A 4Z9XA 4G0UA 4HVCA 3L0BA 3LK6A 2B82A 3U4DA 4R2KA 2VRBA 5C52B 1WXGA 1OFGA 2IEBA 3K15A 5J23A 1VPVA 3KOYA 3UAGA 4KYVA 2C3MA 4O33A 1S2GA 3AHIA 4CM7A 1DXQA 1DXYA 1KMNA 3O75A 5CGQB 3Q2OA 4HUQB 1T8SA 2EJTA 3B3GA 3IIIA 4FSXA 3S1LA 1XHFA 4NXNB 2MT9A 1R0BA 1SUWA 1Y1RA 3K6RA 3GN2A 3MRVA 2M6LA 5I9MA 3OY7A 4DIKA 1CJBA 3PVSA 2HIHA 1LEHA 4DJTA 3DT9A 1PYOA 1HQCA 2OXTA 3GZ4A 3W7VA 4BVBA 4BX3A 2XW6A 3ZWKA 1C0IA 2VNKA 4K28A 3KT0A 3ZJ4A 2OYSA 2G5CA 4R69A 1NZDA 1B0ZA 2ZULA 3CG0A 1T4MA 3IT2A 3OJ0A 4LV5B 1BDMA 3RIMA 3L8YA 3R7FA 1FMFA 4IHJB 4EHKA 3FM9A 4J76A 1O0SA 3H13A 2NTNA 4DRZA 3P7MA 5FWNA 2C83A 2Q41A 2XX3