1QYDA

Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases, and their relationship to isoflavone reductases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
312
structure length
312
Chain Sequence
DKKSRVLIVGGTGYIGKRIVNASISLGHPTYVLFRPEVVSNIDKVQMLLYFKQLGAKLIEASLDDHQRLVDALKQVDVVISALAGGVLSHHILEQLKLVEAIKEAGNIKRFLPSEFGMDPDIMEHALQPGSITFIDKRKVRRAIEAASIPYTYVSSNMFAGYFAGSLAQLDGHMMPPRDKVLIYGDGNVKGIWVDEDDVGTYTIKSIDDPQTLNKTMYIRPPMNILSQKEVIQIWERLSEQNLDKIYISSQDFLADMKDKSYEEKIVRCHLYQIFFRGDLYNFEIGPNAIEATKLYPEVKYVTMDSYLERYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pinoresinol-lariciresinol reductase
publication title Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases and their relationship to isoflavone reductases.
pubmed doi rcsb
source organism Thuja plicata
molecule tags Plant protein
total genus 94
structure length 312
sequence length 312
chains with identical sequence B, C, D
ec nomenclature ec 1.23.1.1: (+)-pinoresinol reductase.
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1qydA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1qydA02
5ER6A 2WYWA 4TWRA 4XYLA 5IZCA 1F12A 2V65A 3S2GA 2EERA 3IJRA 5TIIA 1VPDA 2O7QA 2AA3A 3QQPA 2QX7A 3HFSA 3KLMX 2DVMA 1PJSA 4LK3A 4NQZA 4NBWA 5JSFA 1QV7A 3PRJA 4BNZA 3ANNA 1YB5A 4O1MA 2HMUA 4IQ8A 2PKRA 3ZWAA 3FR8A 4BNYA 4ESOA 2XF8A 2QZ9A 4NMHA 3I9NA 2W2KA 3HFGA 2AEJA 3ZHYA 3RAJA 3ZNQA 3K73O 3DTYA 5F1KA 4PLWA 1TT5B 3E18A 4Y67A 7ADHA 2I67A 3T4XA 3I6QA 1QSGA 4GGPA 4L73A 1EFKA 4JCOA 4RQTA 1PTJA 3EGOA 1LRLA 3L77A 2VTDA 2Y05A 1ZMTA 3N7UA 1MLDA 1QLJA 2Y68A 3K31A 3GMDA 5CDGA 4QTZA 4P4GA 4BGVA 4CM9A 2ZQZA 3DHYA 4YAEA 3RUAA 1WXDA 2Q99A 1IY8A 1XEAA 3AK4A 3LF1A 2OO5A 5HWSA 3BAZA 3QVWA 2FR0A 3S2IA 1RWBA 4J7CA 2P4HX 3F9IA 2PZKA 4UREA 1B8VA 4D46A 2AHRA 4IDFA 3WGHA 4B7CA 1LX6A 4IDBA 2A9FA 1T2DA 4E12A 4PG5A 1E3WB 1FDSA 2W90A 4KUGA 4NG5A 3RFTA 3DBLB 2FRDA 4JJFA 1KY4A 3VH2A 2DM6A 2VUSA 4EEXA 1EK6A 2JFGA 1ZNQO 2OXIA 4MVJA 4FFNA 4R51A 4KTVE 1H2BA 2HK8A 3MCVA 3GFBA 5I7EA 2EJVA 4MDHA 3S2EA 2X4GA 5MDHA 3WSWA 3NTOA 5U1PA 1X15A 1C1XB 4ZA2A 4E31A 2I76A 4EW6A 1HDYA 5EMHA 4DPLA 1I33A 5KIAA 3EY4A 2O3TA 1QYXA 4NFSA 1I24A 3EAGA 5L3ZA 2NTNA 3BMQA 4DBVO 1PZEA 1ZVMA 5B4TA 2QG4A 3NDIA 3WGIA 2ZTUA 4OGWA 3I9JA 5CAEA 4MIOA 1EEHA 3ONFA 4HUJA 3EK2A 1DIBA 4CLEA 3QW2A 4G2NA 2JD0A 1JW9B 2NACA 1WZIA 1N92A 2WM3A 1KEWA 4K1LA 3H9UA 1LC0A 1PJCA 4K28A 3ZU5A 4M8SA 4AVYA 4LW8A 5L95A 3R3SA 3LYLA 5ENDA 4YT8A 4D42A 2NU8A 4XDZA 4EZBA 4DRYA 1C0KA 2QIOA 3PQFA 4YBZA 2DUWA 1B2LA 2ZB4A 3NUGA 3Q1LA 5L7TA 1GTMA 2FMUA 4H3VA 4RVSA 2CSUA 3GVXA 3ADOA 3ZHZA 4UVHA 5BNFA 4CM1A 5GY7A 3OJOA 4F3YA 4MIEA 1H93A 4WCFB 3N58A 1WMAA 1KBZA 3E8XA 3KM0A 3FTPA 4DQXA 3D4PA 1JDJA 1U3WA 2V6FA 1YL5A 3WBBA 2X7HA 4J4TA 4J2OA 4MOWA 4B7UA 5IF3A 5A5FA 1SAYA 3R1IA 5BNIA 5AYVA 1Y8RB 4PRKA 3ZHBA 1FJHA 5JDCA 2RH4A 9LDBA 3ZHXA 1U8FO 4NK4A 2PZLA 1T2EA 8LDHA 3GVPA 3GY0A 4Z0TA 4RGBA 1XA0A 4RPHA 2EGHA 4AJLA 1KVTA 3C8MA 1JA9A 1PZFA 3K96A 5DCWA 5L7YA 4GX5A 3FBGA 2VYND 3GZNB 1ISMA 2B4RO 3LVFO 2ZIZA 4GLLA 2AMFA 4QXMA 3ENKA 3DWFA 4DQUA 1ZSYA 3HUDA 1UAYA 4YRDA 4WJZA 1WZEA 3AUAA 1V35A 3PVZA 3F46A 5A06A 4DC1A 5I7SA 3AWDA 4HNGA 2GN9A 3LQFA 5DN9A 5TSDA 5TT0A 5LC1A 2YHIA 3GEGA 3MJ4A 3SJUA 2J3KA 2X5JO 4TSKA 1I3NA 4CQMA 4Y9DA 1BGVA 1KVQA 1PS0A 3JQAA 5EN4A 2RAFA 4RF5A 3RWBA 4J0EA 3H8VA 4Z0PA 4A03A 3OECA 3JCZA 3G1UA 4M49A 4D79A 1H2HA 3UW3A 3D4OA 3C7AA 1ONNA 1W0CA 3GEMA 4CL8A 3D1LA 1YVEI 2EHDA 4MKZA 3UGKA 4YT5A 1JAYA 2WD8A 4CM8A 3JQ9C 5F5NA 4KUEA 3AW9A 4CMKA 3WS7A 4NBUA 2RBEA 4L4SA 1XU9A 2WYVA 2W8ZA 1X7GA 2G0TA 5G0VA 1KEVA 4L9RA 2AW5A 2QRLA 2PZJA 1JU9A 4IDAA 4ID9A 5IXSA 3QWIA 4GLOA 3SVTA 5DOVA 2VNSA 1C0IA 3GGPA 4UVGA 4WLEA 5TX7A 4FOOA 3ZNOA 4BO8A 3R6DA 3WQQA 1QG6A 4TVBA 1DDOA 2YZ7A 2I65A 2WD7B 2R6JA 2B5WA 2OUIA 4XB1A 3GNQA 3FTNA 1E7SA 2EP5A 4UVEA 1J6UA 4DWVA 4MPDA 5LCXA 4GWKA 3JD2A 3GGGA 4BO9A 4RDHA 1ZJYA 4L0QA 4D3FA 4CV3A 4HBGA 5TLSA 3GVCA 4OOEA 1Q7BA 1M2WA 1U3VA 4TMFA 3HZZA 3WGYA 3CIFA 1X0VA 3H2ZA 3ZDFA 3QE3A 1JAXA 4CM3A 1PR3A 3ANLA 5IN5A 3LT4A 2AQ8A 3GT0A 3K30A 3IMFA 1JVSA 2FN7A 1XGKA 4DLAA 4HV4A 3PHHA 4HP8A 2VQ3A 1NM5A 4Z9XA 5KOIA 3FF4A 3CUKA 1H0KA 3RC7A 1I10A 3KYDB 3GDFA 5LDGA 1ID1A 4YJFA 2UAGA 3UAGA 2W2LD 1VRWA 1Q0LA 4QT0A 1NVTA 3H9JA 3RVDA 2IXAA 4OJNA 2QQ5A 1F14A 4BO5A 5TNXA 3LSYA 3O03A 3AU9A 3M1AA 3WX0A 5JW6A 3H3JA 5AXBA 3KZVA 3DBRA 3M2TA 5ICMA 2GRAA 2X0RA 3QJ5A 4GKVA 4NJMA 2XOXA 3OSUA 4YEDA 2QYSA 1R0LA 2HLPA 3BHJA 1DLIA 3RSHA 5L4NA 1ML3A 4ZQGA 1NWHA 4YYZA 4TRRA 3L4SO 3WB9A 4OYRA 5IG2A 1VLLA 5AQ1A 3ETDA 2GN8A 2Z1MA 4HFRA 3AI3A 2D1YA 1D8AA 3H3FA 3NDJA 3SLKA 3GPIA 4G81A 1GV0A 1R6DA 4FW8A 1HE2A 5JFOA 3EVNA 4E0BA 3JQ8A 2Q46A 4N54A 3WJAA 3ZV3A 3LU1A 3NDRA 3ZU4A 4YT2A 3K9QO 2BGLA 3GRKA 1LA2A 5T8KA 1H6DA 3I6IA 3AFMA 3CMCO 3GOHA 2AEFA 2EV9A 5F21A 2XAAA 4K26A 4DQVA 3WFIA 4WNCA 3ZCXA 4KP7A 1PS8A 2C29D 3INGA 3VPFA 4CMIB 3KVOA 3BTOA 3WYEA 3MOGA 1SEPA 2B5VA 3GR6A 5U4QA 3QWBA 1PZGA 3F4BA 3O8QA 3V1YA 4Z9FA 4MVJF 5BT9A 1Q7GA 2ZCUA 1O6ZA 4PLFA 1NQOA 4ND2A 1I5RA 3RUDA 4OQYA 4UUNA 3OF2A 1IZ9A 4YDRA 5CEFA 2I9PA 1GZ6A 2G82A 4RF3A 1T4BA 2O4UX 4W99A 1LLDA 1GUFA 3ASUA 2DTDA 3D5QA 1TEHA 2DTEA 3JQGA 2PV7A 5A05A 4A2CA 4O5OA 1O5IA 1OAAA 4JLWA 3RJ5A 4LVUA 3E9MA 5JNLA 1U4OA 4YJHA 3Q6IA 4CLRA 4ZU3A 1C0PA 4GKBA 5DCYA 5ADHA 2AG5A 3VZQA 3I4FA 2Y0DA 4XEHA 4QFDA 1GQQA 1HWYA 5T67A 4BKPA 1RM3A 3OIFA 4KZPA 3KSUA 3DBVO 1C1DB 5BSFA 4HFJA 1GADO 1DXYA 1MG5A 1VM6A 1HDOA 3W4KA 1P74A 3E9QA 4AJPA 1I01A 3JSAA 3RUCA 4Q3NA 4KOAA 4OHUA 3GAFA 4BNJA 3TN7A 3B70A 3OQ1A 2E6UX 4FFRA 3BMCA 4BNMA 2PLAA 4F45A 3DZKA 5TQVA 3VOSA 4PCVA 3FNEA 3HN2A 4CM4A 4HFNA 4JN6B 5TGDA 2ZB3A 1R0SA 4RORA 1PGOA 3WJ7A 1N1EA 3RFXA 1FDTA 2B37A 4YXFA 2FR8A 3VPHA 2G76A 2PGDA 5F1OA 2H9IA 2PY6A 2C5AA 2VCYA 2DPGA 3COSA 4JJIA 4BB5A 3WQRA 2FSVA 4D41A 3WOHA 3C3XA 1ENPA 1N7HA 2JAPA 2HAEA 2AXQA 1ZEMA 4MINA 4MVJG 1LLCA 1WPQA 1LI4A 4BNKA 1E92A 2XXBA 4PLYA 1O8CA 3V1UA 3IC5A 4A26A 3LLVA 4E32A 3ASVA 4U8GA 4XIYA 2GDZA 3AY3A 3D3EA 3K92A 4HADA 2YUTA 1GEGA 4R5MA 4BNLA 3PZRA 1GQYA 1XYGA 4YPOA 3AY7A 3PIDA 1E3IA 3PPIA 1OC2A 3D3WB 2VYVA 5GZ6A 5G0SA 1BDMA 2Q2WA 5JY6A 3NT5A 2XXJA 2GF2A 4J91A 1LDNA 4Y6PA 3H65A 1MG0A 2IDZA 1WW8A 3B1JA 4CR7A 1Z74A 4R1SA 1VKOA 4WCFC 5JYDA 2WEKA 3TFOA 1R4NB 1TT5A 1I0ZA 1LDBA 1WLYA 3E5MA 1BW9B 3WWYA 2YFHA 4U0KA 1RYDA 3WNQA 1MV8A 3W4JA 1HDCA 1PGPA 4WECA 4EDFA 4RPJA 5EJ2A 3ROPA 3DBHB 3FN4A 4PFJA 5CEEA 4FB5A 5B37A 2Z5LA 1UP6A 1DLJA 3JD0A 4MVJM 2NADA 5B1YA 5KVSA 1BXKA 4MP6A 3PHJA 3UXYA 3G17A 4EUHA 1SC6A 5I8WA 1UXJA 4CPDA 5K6AA 3PZBA 4J2HA 2IEDA 4DLBA 4FC7A 4ALNA 1NXQA 3NJ4A 5GZ1A 3JQ7A 4ALJA 3GPDG 6LDHA 3EW7A 2X23A 3CPSA 2JCVA 4QUKA 1PJ3A 4Q3CA 3GGOA 1PWXA 1Z7BA 2Y99A 1E3WA 4R5HA 4YACA 5L51A 3DBLA 3FWNA 1IOLA 4WPGA 3TRIA 2PA3A 1QYDA 1Y9AA 3U9LA 4YTEA 4A0SA 3AI1A 3KSDO 4FDAA 4B4OA 3TOZA 3PJEA 4RVDA 4OL9A 1LLUA 1DOHA 5TF4A 4IS2A 2CDCA 2OP1A 3BTVA 4CLXA 1OOEA 1P45A 1Q0HA 1DEHA 1DFIA 1MXHA 4XA8A 4MO2A 1PQUA 1WWKA 2NM0A 5K0ZA 1LDMA 4PZDA 4J4HA 4J7UA 4K6CA 5IDXA 5AOVA 3JQFC 4IJKA 3BXXA 1ZK2A 1IE3A 4NFYA 1HLPA 1VJ1A 3NGXA 2Z95A 4B79A 1FDUA 3WNVA 1E7WA 1TB4A 1KC3A 1AGNA 1ENOA 2O7SA 4RV9A 5G0UA 3C85A 1BVRA 1KOLA 2JFHA 5EIOA 2WDZA 3KEOA 3X2EA 1LRKA 1FF9A 3NJ8A 1EMDA 1CEQA 5KJ1A 4TVOA 1A27A 4KUHA 1NWCA 2X0IA 2A4KA 2P9EA 1FDVA 1VSVA 1PQWA 1WDKA 4KWHA 1QP8A 2C54A 3MZ0A 5C7IO 3CH6A 2D4AA 5CG1A 2BGKA 3LT0A 2I66A 3UCEA 3PFWO 3GEDA 3A9WA 1GUZA 3DHEA 4AICA 4RPKA 1ORRA 3CKYA 3Q3CA 5ENVA 2ZB7A 3ROQA 3WWZA 2HKIA 4Y98A 5ILOA 3FBTA 1P3DA 3GNTA 5EPOA 3U4CA 1EZ4A 3DZHA 4IQGA 4I5EA 2DFDA 3ZWPA 2QYTA 3JQBC 1MC5A 1EUDA 2J3IA 1VL8A 1BRMA 2DQ4A 1HSZA 2VZ0A 1N9GB 1V3VA 4RVUA 4WK6A 4CMGA 2FP4A 3KRTA 4EEZA 3GZNA 2QW8A 4YJDA 3U62A 1U7TA 1ZSVA 3AOEA 4PLHA 1BXGA 3IP3A 2EW8A 3ULKA 3VKVA 1ZCJA 3GC6A 1D3AA 2OHXA 3DZBA 1E1NA 5I7FA 2D59A 4C7JA 4WEOA 4XCVA 3VZRA 5T5QA 3INRA 4N7RA 1PJLA 4LMRA 3VTZA 2JD2A 2DPHA 4J3FA 4DIOA 1DC3A 2OBNA 4J16A 3RFVA 3CTMA 1PGQA 2GPTA 4GPD1 1UXKA 4M87A 3I9MA 2X1HA 3EDMA 4NK5A 1K6XA 2EGGA 3JV7A 4GI2A 1HE5A 5A9TA 4HY3A 3PGJA 2CVQA 4C4OA 1E1KA 3P7MA 2YDYA 5COAA 4ZJUA 1UZNA 2HJRA 3NYWA 5H82A 1UP4A 4UUMA 4Y6SA 4TRNA 3WMXA 3L4BA 3UHAA 2CY0A 3FR7A 1UZLA 3IAHA 4I5DA 4RPLA 3RKRA 1NR1A 3VAZA 1YBMA 3SXPA 1DAOA 2GUGA 2VRCA 3OQBA 4FN4A 4MVJE 1GL3A 3BA1A 3L0DA 4OSPA 4Q39A 1SMKA 4JIGA 4CMEC 3PHIA 5JCJA 1SO8A 1O95A 3JQDA 1FMCA 5A9SA 3QVXA 1G6KA 2WD7A 3GHHA 5G0WA 4M89A 4QECA 4IXWA 1F0YA 4WGGA 4X54A 4FCCA 2ZYDA 3DAGA 5JAZA 3NX4A 3WIEA 2X9VA 3DZGA 4TQGA 4LISA 1NX6A 2O2SA 4NR0A 3GVHA 1EQ2A 4WEQA 4WASA 3RASA 2WJPA 2EW2A 4M54A 4FGSA 3SX2A 4QFCA 1Q1NA 4RF2A 3DMTA 5JS6A 3QRWA 3GLQA 3UOGA 5COBA 4NBTA 1ULSA 3KBOA 1EFLA 4LVCA 1JTVA 1VL0A 2J6IA 3TZCA 3MJEA 2I3AA 3UCXA 2RIRA 2Y1DA 2RHRA 4LCJA 3MWDB 5L4SA 3PGXA 3P5SA 3ZV4A 5IAAA 2D2IA 1W6UA 2CFCA 3N74A 3C7DB 1UUFA 2YYYA 4LN1A 4PIVA 1NPTO 3QWHA 3HSKA 5IZ4A 2R00A 4RVGA 1QRRA 1I3LA 1SB8A 3EVTA 1P77A 3KYCA 4AJHA 4JROA 1GQ2A 4R01A 2YJZA 1DC6A 2IODA 4CM9D 4UULA 4J90A 5JDIA 4OXYA 1PJ2A 2NU7A 5JMPA 2AQKA 4ZQBA 3QSGA 1Z75A 3ZWCA 4BUCA 1JWAB 1IB6A 3DZJA 1PX0A 4BO1A 5BSEA 3RC1A 1HT0A 4XIJA 3VPXA 3TZ6A 3ZWMA 4GH5A 2EKQA 1MGOA 2P4QA 8ADHA 3OP4A 1TI7A 1OFGA 3D5TA 5F3RA 4DC0A 1Y6JA 1X7HA 4MVJD 1HYEA 2WWRA 1NBOA 2NWQA 3KO8A 1ZEJA 1B26A 4IZIA 1SCUA 4XKJA 3I9KA 1DRUA 5C7LO 4P38A 5BSHA 1A9ZA 1B14A 1F8FA 4XYGA 2EKLA 4BO7A 1U28A 4ND3A 3TWOA 4H15A 4OMUA 3A1NA 2PWZA 4GSLA 2HRZA 5B12A 2RH8A 1RM5A 3RU7A 4BGUA 3X2FA 1ARZA 2B0JA 3AY6A 3TPCA 5FYDA 1HDRA 3WGTA 3HDHA 3O38A 2Z1NA 3QP9A 4DXHA 2FZWA 2GN6A 4OM8A 1U3TA 2X22A 2Q2VA 1K6IA 3OBBA 3PHGA 4CLOA 5FF9A 2VTEA 2W98A 4BKQA 4IZHA 3PYMA 3DL2A 5CFZA 1MXFA 4I8XA 2Y1GA 4A5OA 2GN4A 2VT3A 4JXKA 1LSOA 2CUKA 3IJPA 4NPCA 1A7AA 3M1LA 1M75A 2EF1A 3SLGA 4RDIA 4IY1A 4M1QA 1G0OA 2QRJA 1UDAA 2IXBA 2NVBA 5FFFA 1NPYA 4E4YA 2GYYA 3LC1O 4IPTA 2IEBA 1C14A 4I9HA 4IM7A 2EWMA 2NVWA 1NAIA 2RHCA 4BV9A 5FEUA 1KEUA 4AJKA 3PJFA 5KWEA 3JYLA 3DMYA 3RUFA 2ZYGA 1EQUA 3H5AA 3CZMA 2YV2A 3DAPA 4J1QA 3EC7A 5MGBA 4ALLA 5L45A 2TMDA 4URFA 5AVOA 1V0JA 1YH3A 1DHTA 1KVSA 2HUNA 4OXKA 2NUAA 3RBXA 3WICA 4Q9NA 3GH3A 4DPKA 1E7QA 1GAEO 2YQ4A 4RQUA 5CP8A 1J4AA 4IDGA 4JBIA 4LGVA 4CMBA 1GDHA 2DBZA 3GN2A 2D5CA 4BIIA 1KVUA 3BZUA 2NVUB 1OBFO 3OHSX 2OMEA 4CUKA 3RC9A 1ISJA 5JPIA 4HKTA 3PYXA 1DIHA 1EK5A 4RO0A 4YJGB 1JVBA 2Q45A 5CEJA 1AUPA 4MKRA 1U2DA 1LTHR 5IDQA 3LC7O 4MIYA 5K9ZA 3TJRA 1U7HA 4BNGA 5C3MA 5BSGA 1ADCA 2B35A 1NFRA 1HTBA 1JQBA 3JYNA 2HDHA 1X0XA 1RM0A 4JP3A 1LDEA 1DAPA 5DBIA 4ZRMA 4D7AA 4YVFA 4ILKA 1MB4A 4S1VA 4P4LA 3GQVA 4II3A 1SB9A 2ZTLA 3TL2A 1KS9A 4ND4A 2YDXA 3W6ZA 1P1RA 1LNQA 3E48A 2W2KB 1GV1A 2NSDA 2HMTA 2I5PO 3S55A 1ISIA 1SZJG 1W73A 1VE9A 2CF5A 1ISHA 2Y1EA 3CMMA 4INAA 4IMPA 3VC7A 1JLLA 1QR6A 2BGMA 3MTGA 1HF3A 4AJEA 2DBVO 5H81A 4NU5A 2X58A 4DA9A 4DUPA 2UUOA 2AQHA 4O59O 3PK0A 1E3EA 3DOJA 4J9UE 4I08A 4E5PA 1YL7A 5HM8A 2DBRA 4ITUA 2WE7A 4J1TA 1NFQA 4JX8A 1ZSNA 3ENNA 2ZYAA 4J1SA 4J9VA 4B8ZA 1LU9A 5L4LA 4CQMD 4K9DA 4U5QA 2C0CA 3JQAD 4WKGA 5KTKA 1A71A 4IDDA 2NLOA 1HEUA 4RPGA 4F46A 3KEQA 3GDOA 5CPFA 3VDRA 3ETGA 4EJ6A 1ISGA 3F5SA 3BHMA 5KNLA 2P91A 1T2AA 1T2FA 1YBAA 4IINA 1X13A 1I2ZA 3AM5A 4XQ9A 1E7MA 4CUJA 3U09A 3WFJA 4YWJA 3HB5X 4RZIA 3B1KA 4PLVA 4CM6A 5IDYA 4MVJI 1BW9A 2EKPA 2FPIA 1V8BA 1E5LA 1YGYA 2PD6A 3I83A 4IJUA 1BHSA 3K5PA 4LRTB 3RI3A 3DC2A 4XR9A 2FR1A 1IYZA 2YY7A 4AJOA 3F47A 3OFSA 1BSVA 1N8KA 5AXCA 3V1TC 1WAMA 2QRKA 1RKXA 3BMQB 1K3TA 1ZW1A 5IN4A 4QEDA 3RROA 3OJEA 1LXCA 2GCGA 1NYTA 3PLRA 2Q50A 1ZK3A 3VKUA 1DBVO 3CZRA 4GSKA 3PFFA 4YA6A 3NTQA 5CDTA 4BNFA 1MC4A 2HU2A 3KB6A 1KERA 1YXMA 3L6EA 4ZD6A 4YRAA 5JAIA 1FK8A 1A4UA 2UV8A 1E3SA 3U3XA 1XDWA 2ZK7A 1DFHA 4E3ZA 1GEEA 2D5AA 4BO3A 2GASA 3JQ9A 4J6FA 2FZEA 4MJLA 2X5OA 4P4NA 3INTA 5C5IA 5GZ3A 1EBUA 4CLHA 4FFLA 1N7GA 4R54A 4U0JA 4PLTA 1PQPA 2ZJ0A 3K2BA 3S1LA 2P9CA 5ICSA 3SBOA 4FJ1A 1E77A 4C7KA 4I5FA 1NQAO 1JKIA 3DO5A 1RYEA 3Q2KA 4W9NA 2Y1OA 4E2ZA 4L76A 1DFGA 1NFFA 3C7CB 3LDHA 4CR8A 1SEVA 5U9CA 2GERA 3VVBA 3VPGA 4ZICA 1DC5A 3D7LA 2GR9A 1YOVA 4FBGA 3ROKA 4BGEA 1ZUD1 4BVAA 2FOIA 5DNAA 3D0OA 1U1IA 2O48X 4IGFA 3RKUA 1ZZEA 4WLNA 4P8RA 4D44A 2JCXA 2VWGA 1P0CA 2NTVA 1HSOA 3CINA 2PR2A 5BQFA 3DZFA 4KQWA 3TNLA 5JXWA 1E7YA 4IS3A 1XQ1A 2YQ5A 1P0FA 3K8ZA 3FHLA 1DPGA 1E6WA 1I2CA 2Q1SA 3RU9A 1U5AA 2D8AA 3I5MA 3DHNA 3RUHA 1FDWA 1XHLA 4JGBA 2NTJA 1D4FA 1P9LA 4FJ0A 1Q7CA 3PLNA 4R69A 2A92A 1AXGA 1QMGA 1ZK0A 1HYHA 3ON5A 3B20A 2GZ3A 3MJTA 3GK3A 2Y1FA 1R4MB 3K2EA 4R4JA 2R2GA 1NHWA 2HO5A 3OJLA 1K2WA 4DBZA 4H16A 1M6WA 2YHIB 2C7GA 2GD1O 2GZ2A 1PGJA 1LSSA 3L07A 3V2GA 3WMWA 4CQMB 3L9XA 1UAGA 1KC1A 1F8GA 3CE6A 3IUPA 3ZN2A 4EUEA 4CR6A 1WNTA 3DTTA 2HSDA 4I1IA 5HS4A 4LSWA 2CNBA 3DOCA 4XX0A 4CM8B 4OAQA 3GRPA 4OXNA 1M6HA 1EDOA 5DCUA 4XYMA 1QYCA 5GMOA 3Q9UA 2Q1UA 3D4NA 1LDYA 2PZMA 1MA0A 2NU6A 1DB3A 1ZXLA 5G4LA 5H83A 1L1FA 4YR9A 1D1TA 4KDFA 1BXZA 1B15A 1ZIDA 3QV1A 3IDSA 1SNYA 3A14A 1GPDG 1GY8A 3ICCA 4JQCA 2NV6A 1YS4A 3G0OA 1P33A 1HE4A 3PP8A 5HA5A 4KWIA 3ZU3A 4FSHA 1YDWA 3DFZA 2O3JA 1V3TA 2B83A 3HE3A 1MFZA 3JYPA 4OOFA 1ZXBA 2E37A 4QX6A 4ALKA 1IHYA 1OI7A 4YQYA 1UXIA 2X9GA 5FWNA 5THQA 3JD4A 3CSDA 3OICA 2Q4BA 3WGOA 4FQ8A 1F06A 5CHEA 2HMWA 3SEFA 3WDSA 2O4CA 2FSSA 4UEJA 3O4RA 3A28A 3PIIA 4MVJH 1CRWG 1K5HA 1UR5A 4UVDA 3JQEA 2O3SA 3MTJA 3UH1A 2NQTA 1A5ZA 5JY1A 5DDIP 3PYLA 3S8MA 2YFQA 1JN0A 3H9GA 3HDJA 3NKLA 1I8TA 2QHXA 1PWZA 3DFUA 3PQEA 2BHLA 2OORA 4E30A 1PU2A 4GWGA 3RQSA 5C37A 3H4VA 2X0JA 1HZJA 4UUPA 2PH3A 1PJTA 1J49A 4EGFA 4W7IA 2BFMA 1ADBA 2VHWA 5JLAA 4IQ0A 4PG8A 1KIFA 4OQZA 1VI2A 1VL6A 3DBRB 4TKMA 5JBIA 1E5QA 1P1IA 1LBEA 1P1JA 4NJMB 5TT1A 2B4QA 1HETA 4RVHA 1YQGA 2X86A 1CETA 2VOJA 1AHHA 3H9EO 4Q3EA 2VYVD 2Q1TA 3GG2A 3VVCA 1T1SA 4BMSA 1Y1PA 3BTUA 4NBVA 4BNTA 2IYOA 4FGWA 2LDBA 3ZWVA 1E3LA 1KVRA 2Y93A 1C1XA 1GZ3A 3JQ6A 3L6DA 1IPFA 2IYPA 3QIVA 3G49A 3JQ8B 4XRRA 4NIMA 3F3SA 3TZQA 1LDGA 1O94A 2GLXA 2PGJA 3DOOA 5T6BA 4E33A 4G65A 5I9LA 1DSSG 2Q2QA 1I32A 2C20A 4J49A 4Z9YA 3GDGA 3SJ7A 3FI9A 2F1KA 4B4WA 4ZHSA 2TMGA 1YRLA 5IZCC 1Y8QB 3IKVA 2HK7A 1GUYA 3IP1A 2PD4A 1IHXA 4OH1A 4XD2A 1LUAA 2Y0EA 1HE3A 3HN7A 1AHIA 1P31A 4I9UA 5DBGA 4E5YA 1K6JA 3PWZA 4TRMA 4PLCA 5JO0A 5EINA 1Q2XA 2IZZA 1R37A 1JWBB 3I4CA 4CODB 3GG9A 2C2XA 3WGQA 3R3JA 3BTSA 4R68A 3W8EA 4AFNA 1SBYA 2OOSA 5KKAA 2P2SA 3AU8A 3UUWA 4A7PA 4ZVVA 4IJVA 4CUZA 1HDZA 3L4BC 3JQGB 3ZH2A 1BTOA 1H6AA 3C1AA 1ENZA 1VSUA 1Z73A 5JC1A 3D64A 4Q3BA 4WCFA 3T7CA 3MWEB 4LRSB 4I5GA 1NPDA 5JAMA 2XPCA 2G5CA 4XGIA 5IXYA 1EE9A 4WLUA 4QQRA 1Y8RA 4ALIA 2EP7A 3VH4A 2X5KO 4PLPA 3FWZA 1HKUA 2Q3EA 4R1TA 3JD3A 4FFPA 3UVEA 3I52A 3LC2O 3R0IA 4UEOA 4B4UA 1MP0A 3BMCB 5G4KB 4CMAA 2VOEA 2C07A 1Z82A 1T26A 5IJZA 2LDXA 3OEYA 5DULA 3I1JA 1T25A 3E9NA 1O89A 2BFOA 4BS9A 1ZMOA 3CEAA 3OIGA 5CDYA 1XG5A 5ITVA 2PH5A 4WUVA 1H5QA 3I9LA 4TRJA 2BLLA 3OETA 3ZW9A 1E6UA 1CQJA 3H7AA 1NHGA 5FI3A 2OL4A 3Q2IA 2C59A 4DLLA 2FPGA 4D45A 1QYVA 4PVCA 1YL6A 3CXRA 5BR7A 5A4DA 3E6AA 1QV6A 3W6UA 4XRGA 3HDQA 1CJCA 4E5KA 4UAGA 3DEYX 4BO2A 3ZWOA 1PL6A 1GU7A 4WE3A 1O0SA 4BNUA 3O9ZA 2BFPA 2DU8A 2Y1CA 5KJ6A 2VNAA 4JJGA 2OZPA 2JCYA 4B4VA 3FPLA 4QSMA 3SC4A 1DC4A 3U4DA 1QKIA 3MJSA 4JBHA 1YDEA 5JDIC 2NVUA 3OA0A 4FOSA 4ZRNA 3QWFA 3ITDA 3F1LA 4UUOA 1UP7A 4G5HA 4YJGA 1R12A 1EBFA 2Q1WA 4N5MA 5JE8A 2DLDA 4UVIA 2J5KA 4NZ9A 3GUYA 1E0DA 1CIVA 2ZJ1A 3AFNA 5C7OO 4S3MA 5JO9A 2IZ0A 1Y9EA 2EIHA 4XYEA 1EVIA 1H6BA 1I36A 4TROA 4RF4A 4Q3DA 3WBFA 1DHRA 3VTFA 1EUCA 4YAKA 4HXYA 1PJBA 2JHFA 3MEQA 1DIRA 4XQCA 2FWMX 3UICA 3KXDA 1NP3A 1DIAA 2B69A 3BMOB 3C1OA 4WLVA 3AI2A 4EUFA 3LZ6A 3NTRA 5JDCC 2E48A 4YB8A 2V6BA 3E03A 4R16A 2HMSA 3OQ6A 1SOWA 2F00A 4GAEA 5B4UA 4CV0A 5LDHA 4GL4A 5HRUA 1E1LA 3HADA 4IXTA 1B0AA 4CQLB 3GMSA 5T57A 3QA9A 1G0NA 5L53A 4U6QA 1GD1O 2V6GA 3JQ7B 4DMLA 2WYUA 4J4BA 1A7KA 5TJHA 3ZWBA 2EEZA 1TVEA 4GVXA 2JFFA 3NEPX 2NU9A 4FD3A 4R41A 2G1UA 5F5LA 4ZQEA 1LLQA 3RUEA 4RJTA 1ENYA 2E82A 2EXXA 3KYDA 3LLSA 4U6SA 4PLGA 3JQBA 1GPJA 1YO6A 5THKA 3KETA 2C2YA 4TZKA 3F6YA 4RLHA 4CV1A 3KSZO 3ONEA 1Z7EA 2VRCD 3GFGA 3RIHA 2WTBA 9LDTA 4BKRA 4YRBA 2GGSA 3TF5A 3P19A 2OGUA 2UUPA 1P44A 4J43A 4PLZA 3OH8A 1ONOA 5JCJD 2P5YA 2HJSA 4IJWA 4DL9A 1I2BA 2QZZA 2G17A 2P9GA 3PEFA 3V8BA 1U4SA 3EYWA 1XIVA 5A3VA 4L4RA 1A9YA 2J5RA 3T7EA 4XJSA 2BI7A 2VWPA 2PKQO 3M2PA 3GA0A 2E4AA 3NT2A 3BMNB 4GMFA 1QXSA 3IS3A 4A10A 5COQA 2ZTVA 4NH4A 1K89A 2FPPA 3JYQA 2VYNA 4WLFA 4J0FA 4BV8A 3Q9NA 1EVJA 4CMIA 2PGLA 5IFLA 1JKFA 1LSUA 1YONA 2YV1A 3W4IA 4DPMA 4MP8A 2DFVA 1D1SA 4FJ2A 5B4VA 3U4IA 3PTZA 5EL0A 1I3MA 1T24A 3UF0A 3ZU2A 1YJQA 1WDLA 2I6TA 3ETEA 4BNNA 3ZZNA 3P2YA 4WNIA 1PEDA 3V2UA 1NQTA 1IZ0A 3TDKA 4CMEA 1M66A 2NNLD 2UVDA 4L4XA 3U0BA 3VH1A 1N1GA 4BHTA 4M86A 3VHRA 4BNXA 1LSJA 4AJ4A 1LRJA 2AEMA 2DTXA 5ER9A 1C0LA 2X9NA 4B3HA 2H6EA 1MUUA 3GN1A 3GF4A 1X1EA 2VT2A 3TQHA 2PKQP 4QO7A 2X6TA 4R1NA 2OFPA 3V5NA 4NI5A 1XELA 1JKJA 2C82A 4CMHA 3B1FA 3M6IA 3P2OA 4HX5A 4JP2A 1C1DA 4O63O 4R1UA 1U2GA 2ZKLA 4CMCA 2ZB8A 4GX2A 1LJ8A 3S2FA 4II2A 2VWQA 5ES3A 5KCZA 5F1PA 3PDUA 1PS9A 3WR5A 4BNVA 4FFMA 4XGKA 1IL0A 1AXEA 3W8DA 3ZGYA 2H1SA 1KETA 4PG7A 1BXGB 2DKNA 2BF7A 2JAHA 3VDQA 3FNGA 4TZTA 2OP0A 3ZI0A 2VUUA 5G2OA 4DVJA 3RCBA 4D3DA 1UDBA 1PZHA 2PTGA 2VWHA 4IGEA 5ILGA 3TSCA 1R4MA 3OIDA 1NAHA 4Y6RA 3ZV5A 4BNWA 1ZH8A 1SOVA 4L74A 2ILTA 1HXHA 2J5QA 1H9AA 1W4ZA 1ZJZA 1L7DA 1NR7A 5KVVA 4R3WA 2WMDA 2CMDA 4W82A 3F1KA 4E5NA 5T8KC 4RVFA 1E1MA 1N2SA 5DT9A 3PDJA 4BKOA 3W8FA 4AG3A 3JTMA 4BMNA 4CV2A 4Z3KA 3G79A 4E6PA 1QYWA 1HDGO 4BKUA 3QLJA 1U9JA 3WQSB 2W2LA 4CM7A 5TJ9A 3UCFA 3FPCA 3EMKA 2VHXA 4B8WA 4ONEA 4E5MA 2J3JA 2V6MA 2AQIA 2RCYA 3IQDB 4IUYA 1CDOA 1FXSA 1I30A 3U4HA 4W9NC 3FNHA 3FNFA 4NFHA 5EERA 2PFGA 5A9SB 4I9NA 4PN3A 3D3WA 2O3UA 2BH9A 2I99A 4BB6A 4N5LA 1PIWA 2H63A 4FFOA 3ZWYA 3VPSA 1X14A 3A06A 4H7PA 3WLFA 4R9SA 4PG6A 1P1KA 1ZK1A 1M76A 4N5NA 3UN1A 1V9LA 5CDUA 3NV9A 1UZMA 1GCOA 4EJMA 1YBVA 1P1HA 2AG8A 1R4NA 4BO6A 1BG6A 2BFAA 3EZYA 3RJ9A 1QLHA 1WDMA 2CDAA 3VH3A 2IE0A 4XZ3A 1HL3A 4ROSA 2VN8A 2O3QA 1H6CA 3DBHA 1PGNA 5AXAA 4DIFA 2CD9A 2VHVA 3OJFA 4B3IA 2BD0A 4W6ZA 2PK3A 3PXXA 3WYBA 3AUSA 3VZPA 1R66A 5JC8A 1RPNA 3ABIA 5A3JA 2JD1A 4W7HA 5TC4A 5A5EA 5I9NA 3JYOA 1OZAA 3WXBA 3MOIA 4AJJA 1CQIA 4D0RA 3KYCB 4Q3AA 3ZWXA 3WGGA 1TA4A 1IULA 1H94A 1LC3A 1UXHA 3HJAA 4CMJA 3IL2A 1TLTA 2A35A 1Y5RA 1ZO8A 3I9OA 4GGOA 5EQDA 3HG7A 2BRUA 3RUIA 2P5UA 2GO1A 3B6ZA 3ZWWA 7MDHA 1DJNA 3AOGA 4WCDA 1GR0A 4OKIA 3UFXA 3E82A 3GUCA 4IDCA 4IMRA 4ZQHA 3ZNPA 3JQCA 5CDSA 3KHUA 4L75A 1H9BA 1GYQA 3BYZA 1ADGA 1UJMA 3WIDA 4WOJA 3WTBA 4OKNA 4YCAA 4ZGWA 4NU6A 2O2YA 4O0LA 2DT5A 4NNJA 2HMVA 1Y81A 1W8DA 3WSVA 3Q0EA 5ITWA 1WP4A 1BWSA 1EVZA 2NQ8A 1GYRA 3C1TA 2JKVA 1AE1A 1Y8QA 3AUTA 3E5RA 3LF2A 3QWAA 3STHA 4QO8A 5FI5A 1CYDA 1PL8A 2EJWA 3H2SA 4Z0HO 3KUXA 3IUSA 2ET6A 5CPBA 4E2XA 3I23A 3ST7A 3ICPA 1SPXA 4FR5A 4BO0A 1GCUA 2X0NA 1T2CA 1ONPA 4N18A 2J8ZA 3G1TA 3VZSA 2VZ8A 1S6YA 2VHYA 4J1NA 4A73A 4AJ2A 4CLOB 2HRBA 1Z6ZA 3OA2A 2Y66A 1CF2O 4E2WA 2VZ9A 1Y5MA 3HHPA 4OIMA 1XSEA 4IIVA 3GVIA 1E3JA 1K0UA 2A94A 3ZWNA 1B3RA 1EE2A 1UH5A 1XCBA 1C3VA 3FSRA 4MVJP 3H9QA 1HLDA 4XQGA 4PG4A 2BKAA 3KV3O 5L9AA 1RJWA 2B36A 1A72A 1J0XO 5CG2A 5EQFA 1ZFNA 4PVDA 4DTIA 3IOYA 5K6AC 4HNHA 4XWYA 3WTCA 1PJQA 4NDNE 4D0SA 2V7PA 4K6FA 3AJRA 3QVSA 5A1TA 4OO3A 3PI7A 4XYBA 1YJ8A 4PRLA 3OJ0A 1V3UA 4BQRA 1HRDA 4F6LA 1NQ5A 3MJVA 4CL3A 3OMLA 3DB2A 1IUKA 3JQAB 4TKLA 5HBRA 2BMAA 2VRBA 3GZ4A 5KVCA 3HB4X 2YV3A 1NTOA 5G4KA 3F5QA 3C24A 4FPXA 4Y8VA 1BDBA 2FY8A 3ROMA 1N9GA 3EUWA 3OEWA 1ADFA 1Y7TA 2J3HA 5DOZA 1OMOA 4GX0A 1DRVA 3LK7A 3H5RA 4BNIA 4BNHA 3PHLA 3GNSA 1MX3A 5TRTA 4KTTE 4KMSA 4BOYA 4DIBA 1Q0QA 1OC4A 3AM3A 2YHUA 3DXFA 4J7XA 4MP3A 1U3UA 2ZCVA 3TFQA 4R9RA 3ANMA 5HS6A 1LQTA 1CWUA 4NJOA 2D0IA 2AE1A 4A27A 1YE3A 1ZK4A 1ULUA 2CVOA 4IIUA 4LMPA 4B3JA 3QVOA 1KEPA 4HWKA 4GMGA 1EUZA 3AUUA 4FIZA 3ZV6A 4EYEA 1PSDA 2WSBA 1VC2A 1B3BA 4JK3A 1DJQA 3SC6A 4DMMA 4DYDA 2DC1A 2PNFA 1TXGA 1A4IA 2FHSA 4GBJA 1U8XX 4FS3A 4BO4A 2UDPA 1HZZA 1KY5A 1ISFA 1DRWA 1GFSA 1X1TA 5TS3A 2Q4EA 4BQPA 3WGZA 1DIGA 5AXDA 3IKTA 1B7GO 3FRJA 3LT1A 3HWRA 3RBVA 3QHAA 4OSOA 1YB4A 4O6VA 3TL3A 1VJTA 3ORFA 5KJFA 3FCOA 2OBYA 4R3NA 2ZQYA 5J23A 1D7OA 1YWGO 4EJ0A 3V2HA 4YJFB 3WLEA 1R15A 4Z6KA 5DBFA 1DO8A 4DYVA 1UDCA 4XJTA 1S7CA 4B7XA 3ZNNA 2DAPA 5KVQA 4XGNA 4ND1A 1UXGA 2GNAA 3BMOA 4UEKA 3U49A 4YT4A 5JAQA 4CJXA 4DGSA 5G0TA 1GZ4A 2Y0CA 3NRCA 2CZCA 1YB1A 4L8VA 2WE8A 3FD8A 4GQAA 1VKNA 4EI2A 4AJIA 1B8UA 1YQXA 3DQPA 1XR3A 5KJEA 2AE2A 1IPEA 3OM9A 4RZHA 4E2YA 2SCUA 4CQLA 3I3OA 4YAIA 3Q11A 2PD3A 3EHEA 1CERA 1XKQA 1GYPA 3QY9A 4NBRA 3BIOA 4ZN6A 2JL1A 4NHEA 1T1RA 2IZ1A 1VJ0A 3HQ4O 5I8ZA 5DF1A 1T4DA 5L40A 1V6AA 3QVTA 1NVGA 3AM4A 1G1AA 2O23A 1MFPA 2GSDA 2HQ1A 3AOEC 3G3EA 3RC2A 1J5PA 1N5DA 3UKOA 1E7RA 5A02A 4IDEA 1R0KA 3DZIA 3HDYA 3PQDA 5DP1A 3DONA 1U5CA 1X7DA 4XR4A 4GX1A 2O3RA 4PZCA 5HTOA 4AJ1A 3JD1A 2YW9A 1LQUA 2H5LA 4XDYA 1EDZA 4LCEA 5I7VA 5KJCA 2X8LA 4RCVA 5DZSA 4CLDA 2VUTA 1ZBQA 4ALMA 3TZHA 2GZ1A 3O8QB 4GVLA 4P22A 1B8PA 4W4TA 2UYYA 3O26A 5A03A 3GHYA 4KQXA 5A9RA 5BNTA 3BHIA 5JYEA 5L7WA 3E1KA 2B4TO 5EESA 2ZTMA 1R16A 1QORA 1YQDA 1XWFA 1F17A 4ND5A 4AJNA 1O9BA 1PJ4A 1RM4A 4PGFA 3PWSA 4XQEA 2POQX 4XB2A 5JCXA 1P1FA 5T64A 2HCTA 4E13A 5A04A 3PWKA 4BGIA 2JHGA 4M55A 3BMNA 1YOVB 2P68A 3ZW8A 4MKXA 2Q49A 4YJHB 2JJYA 4DREA 4CLRB 4Z3DA 1BVUA 1PL7A 2C5EA 1I3KA 3L6OO 4WLOA 3TOXA 4D3SA 2CVZA 2D3TA 2O50A 1NASA 4AL4A 1PR9A 1WVGA 2E49A 4FC6A 1WMBA 2VHZA 3RBZA 5JMWA 4D43A 3RD5A 1LEHA 1EVYA 3WYCA 3MJCA 4LSMA 4RLSA 3K6JA 1YKFA 1B16A 2HK9A 1XU7A 4JNKA 6ADHA 3U5TA 1NVMB 1AN9A 3DAFA 1Z45A 2W4QA 2Y67A 5DP2A 3H5NA 3T4EA 2EG9A 3L9WA 3DR3A 3NAQA 4BMVA 3DMTC 4YAJA 1ZKMA 3EZLA 3TZKA 2I3GA 4HFMA 4CM4B 3GAZA 1TT7A 3KTDA 1HYGA 4PZEA 5KKCA 3HNPA 2DUUA 1HDXA 1BMDA 4KDEA 4EITA 2DBQA 4YAGA 2BELA 2CF6A 5IDWA 3NGLA 3LT2A 4E21A 2BI8A 4CM5A 2IRWA 3A4VA 3PJGA 4RL6A 3F4LA 4JBGA 4YQZA 3W1VA 4BL5A 3KYBA 2CDBA 1M67A 4ZQFA 3ADPA 4EBFA 2R00C 3IIEA 4WOKA 1E6EA 3ONDA 1XLTA 2ZATA 3WG9A 3PJDA 1KYQA 3KLPX 4F6CA 4IBOA 3H6KA 3ITKA 1XQ6A 1L7EA 3KOUA 4U7WA 5I9MA 3NT4A 2C7VA 3DDNA 1NNUA 3JQFA
chains in the Genus database with same CATH superfamily
3GJRA 2WYWA 4G4GA 4TWRA 5IZCA 1Q50A 4W63A 5AHWA 3K2QA 1SOUA 4QGSA 3S2GA 3K9GA 4WH0A 2RGAA 5TIIA 2W6CX 2X8BA 2O7QA 3OCCA 2AA3A 2V0NA 3QQPA 3SQWA 3FHOA 4MX8A 5JEDA 3IV7A 1OHHD 3C48A 4AIIA 4LK3A 4NBWA 1QV7A 2W2MA 4OA5A 2PKRA 3CUEF 3SYTA 2Z6AA 4ESOA 5JSQA 5FBZA 2GH1A 2QZ9A 1KMNA 3I9NA 2W2KA 3LBHA 4L9SA 4NMHA 5ESRA 3V8VA 5JARA 1GWNA 4RKRA 2FDRA 1Q1AA 3IEUA 3V4SA 4G26A 5JXJA 3OLQA 3V9AA 4RM2A 4DMKA 3GFRA 4PLWA 2NPIA 3UGJA 5EIHA 1CLEA 1V4BA 3ED1A 1U28C 1EGQA 3LTEA 5FV7A 3T4XA 2FWPA 2DGDA 1M2GA 3BVPA 1M1YB 1YIOA 1ULZA 4GGPA 4HAIA 2GM4A 1PTJA 3HJFA 1LRLA 2QMOA 4IO1A 4K9QA 3H18A 3L77A 4PQGA 1ZJ6A 3B38A 5KC8A 4Q05A 3BORA 2PT5A 3V2IA 1MLDA 1QLJA 4K5QA 1FUUA 1TUEA 4IR7A 4PHCA 5ALTA 3VSDA 5A4MS 3AILA 4P4GA 4KIFA 2BSQA 3DYIA 5ALFA 4YAEA 3AVUA 3RUAA 1D5CA 3LF1A 4QUBA 4QGGA 4LYYA 2FR0A 4J7CA 5JLJA 3F9IA 1PEKE 1DGQA 1Y1SA 4UREA 1XZJA 2FETA 4NCXA 3FKJA 1E3MA 1T2DA 2P6MA 4UHJA 1TUBB 5AW9A 5C9ZA 3M5DA 4PG5A 1FDSA 4TTTS 1G4HA 2W90A 4PANA 4NG5A 2WKSA 3DBLB 2Q5OA 3VH2A 2YOGA 2VUSA 4CNBA 3C2QA 4EEXA 1HGXA 3EC2A 3UWKA 4P80A 3P2JA 3MSXA 5HUJA 4C0HA 2KB0A 5TPWA 3NUQA 3ZWKA 4V0QA 3QITA 3MCVA 1FXWA 3GFBA 4GP6A 4IWYA 4YAUA 1I94B 1W29A 4CT4B 2X4GA 4IEFB 5E6UA 2E87A 4QODA 4UE3S 5IVPA 3DL0A 3W2IA 2JI6A 1O6BA 4CCSA 2I6GA 3N2KA 1HDYA 5HJ2A 1T8UA 2FUG6 3TKLA 5JD3A 3TLGA 5L3ZA 1Z63A 3F49S 1OXUA 2O8NA 4UM7A 5DYNA 4Z9BA 2QM3A 3OCUA 3OOHA 4ILEA 4FLFA 2W0MA 2C7OA 3RYFB 1KRWA 1XDUA 4PS0A 5IVIA 4JLKA 3ORSA 1J70A 2V7BA 4O4JA 5LPNA 1DIBA 4C0LA 3NIBA 4NQRA 3QW2A 1QNLA 4L50A 4U39A 4B1FA 4UPEA 5IEJA 4FGJA 1XPOA 3VYUB 4A6DA 3R9XA 1G20E 2VXBA 4JEHA 3LOQA 1AIPA 1JW9B 4RHEA 1LPBB 2ZFUA 5CK5A 1WZIA 1EI9A 4B87A 4C3UA 2Q6IA 3E7WA 1XFDA 5AM2A 4K1LA 4AYWA 3AL2A 4D92A 3EZGA 4LW8A 5EIBD 1G5PA 2BM8A 2J48A 5L95A 2Q5CA 1S2OA 2PVPA 2XNDD 4QD3A 4YT8A 5JI2E 2D5IA 4XDZA 1J8FA 4H3SA 4QELA 3RRXA 1RMQA 3GFQA 2O2EA 4JI4B 1MDBA 1XEWY 2HJWA 4FLEA 1KR2A 1VG0B 4EZEA 1A4XA 1ZOIA 4QXRA 2XRZA 3Q1LA 2JAQA 2Z9CA 4AC9A 4DLXA 5L7TA 2OR3A 1KR5A 3DMDA 3FGZA 3QMWA 5DM4A 1X1BA 1G17A 2QE6A 3FWPA 4LECA 1NBHA 5DFAA 5K4AA 3U1TA 3WK4A 3MQFA 3IAXA 5IKOA 2H1IA 4U9IS 4F3YA 4MIEA 1H93A 1RAHA 5CDFE 3N58A 5LU8A 2C92A 1WMAA 3GEBA 3UFBA 3GAAA 4XIFA 1CRZA 2H29A 4J1TC 5CXXA 3KM0A 4Q3LA 2ORYA 1OBHA 4DQXA 2QAGB 1G9TA 3PUYA 4QYWA 4N6GA 4F5YA 2NXWA 3EUAA 1PZXA 2YHAA 4JELA 2PZGA 1KI1A 2L69A 1G7CA 2BM0A 3UB2A 1PEAA 4REOA 4CNQA 2JASA 1RRFA 1CF9A 4B47A 2XCIA 1QS0A 4PRKA 4TWIA 2ONJA 4EARA 1OYVA 4MW7A 4DLNA 4TM7A 3LOUA 4H3KB 1BKDR 1N2CB 2RH4A 2ZIEA 2PN1A 3C0KA 3DVSX 2OM6A 3QMVA 5DSXA 1R4ZA 2PZLA 1T2EA 1W1IA 3MD0A 3GVPA 4Z0TA 2F62A 4RPHA 4ZPJA 3WNBA 2OV4A 2C78A 3CW2A 5GOZA 2EGHA 3NWEA 3EXHA 3ZCUA 1KVTA 1Q0SA 2C4NA 3LXMA 3NC0C 4XOUA 4GX5A 3HEMA 5AW0A 4K81B 2R5WA 3KJHA 4WNAB 2HADA 1ISMA 3EXFA 3PC8C 2B4RO 3VRHA 4A82A 2VJBA 3HKCB 1XA3A 4QGBA 4GLLA 3GGDA 1VHDA 1RWXA 4U9UA 5TQ0B 1FRVA 2AYZA 3UZUA 5CYGA 3DWFA 4PTLA 2CFRA 2CLFB 2D0PB 1NSYA 2RHGB 3D7KA 3NNDA 3DB1A 1QFYA 1RWOA 1COWA 3A27A 5JWOA 3EARA 1BCSA 3T5PA 3PVZA 2GK7A 3DHVA 4KQHA 4L8YA 5AK6A 4BZQA 4XUEA 4E1AA 3OY2A 5I7SA 3WLAA 1T5TA 3HB7A 2P90A 1AB5A 5TT0A 5GONF 1FU4A 1JPUA 4PIMA 4EP1A 2YHIA 3GEGA 4H6PA 4MWOA 5LMNB 3K8OE 3PE3A 2OXRA 1C9DB 3SJUA 1HA3A 1MRZA 1I3NA 4CQMA 4EATA 1FSFA 1VPLA 3ZTTA 2AD1A 4Q18A 3Q6NA 4J0EA 1T34A 3UHOA 2XXAB 4Z0PA 3U40A 4A03A 3JCZA 3NHRA 3A4NA 3UW3A 4G1CA 1Z0SA 1DEOA 3UJ9A 4HDKA 2Z3ZA 4P34A 3A8TA 3CX3A 4PAGA 1U0HC 2EHDA 3HMKA 2P6RA 2BDTA 1JAYA 4CM8A 2B9EA 2QRNA 1DJOA 2VA9A 5FNVA 1I1NA 4KE8A 1XROA 4PGMA 3SX0A 4E7OA 4S05A 3QPWA 5EP3A 3WS7A 3DPSA 2C2MA 2RBEA 3B3JA 3C5VA 4JFAA 1IUOA 3IR7A 1GAWA 4TTQA 4X3OA 2CHEA 1CXZA 2OCIA 2AW5A 4C4SA 5J4HA 2PZJA 1CDZA 2JGFA 2DKFA 4ID9A 1UPBA 4JR0A 1FTYA 2BKEA 3DXXA 3A3OA 4X1KB 4GLOA 5DOVA 3MBKA 3PCXA 4HX9A 4EB3A 4HDNA 3ZUGA 4WLEA 3GGPA 5TVKA 1GG9A 2I1WA 1JQ3A 2IX9A 2YMMA 1EE1A 5PNTA 2WAAA 4BO8A 1QG6A 3EIFA 1CP2A 4G0XA 2O0JA 2I65A 4AF7A 1H1LA 2XOKD 2B5WA 4YP7A 2JJ8A 3GNQA 4IOJA 2HN9A 3IMGA 4MWZA 1QVZA 3QUSA 3FOFC 3WV4A 4DWVA 3UJHA 2F3TA 2J7KA 2XR1A 5LCXA 2G5TA 4BLOA 3GGGA 4IXNA 4RDHA 3ZCVA 4CV3A 4UBMA 1KO4A 1R4AA 1EINA 3HUTA 1C9KA 1NW3A 4BLUA 3HZZA 2IH5A 3STVA 1OPRA 3GGSA 3GLIE 5DB4A 4OLFA 5D85A 2GPNA 2ZRAA 3ANLA 1G6HA 4OLJA 5BY2A 3LT4A 1MB0A 5IAGA 3DKPA 2PWBA 2FN3A 3TM4A 2AQ8A 3GT0A 1G5IA 2FN7A 3IMFA 1XGKA 2CLEB 2O20A 2QQEA 4D4HA 2ONCA 3UWOA 2HA6A 4M1EA 2R4QA 2CVHA 3G1WA 1BWQA 3CUKA 5D2CA 2DQYA 3AIOA 1N3IA 3KYDB 2JATA 3UAGA 1S89A 3M5CA 4D9CA 2W2LD 5E4YA 2CT8A 1VRWA 4UBJA 1Q0LA 2F3UA 5IT0A 3RVDA 5A3SA 2DETA 3AVQA 4QBIA 2FDCA 3LSYA 1KGSA 4HB0A 5DBEX 2Z58A 1CY8A 4KYUA 5ESWA 5JW6A 4CG2A 2VL7A 3KZVA 3DBRA 1H1DA 1C8VB 1BQ4A 2H59A 2ZBPA 2GRAA 3BEOA 3QJ5A 5IAJA 3W5UA 2R8ZA 5DN6A 5H80A 1R0LA 1GNLA 2GLUA 2HLHA 1OZFA 3A6EA 1EU1A 2NOAA 5BOVA 4JI6B 5L4NA 4BEWA 4N41A 2WYOA 1PJAA 1L7XA 3WB9A 4OYRA 1NZJA 1VLLA 3C5CA 5FTKA 2QAJA 1TLFA 4CIYA 3ADDA 2EFJA 2Z1MA 3NM6B 4MCHA 1L5FA 3C7TA 1CUCA 2JEZA 2OQRA 2D3WA 2RBKA 2D1RA 3H3FA 1CUFA 1GUAA 4PGAA 4Q3KA 1XTQA 2C88A 5BUQA 2BDUA 4E0BA 1ZCFA 3JQ8A 1P4HA 4Q00A 2W48A 3GH1A 4YT2A 2BGLA 2CLKB 2LRHA 1Z4NA 3DTVD 1H6DA 4R2WA 2J7PD 1IZYA 3UB4A 4F2DA 1MJGA 4C7OB 4EGJA 2AEFA 3ZDEA 4K26A 2FPUA 4I9FA 5I45A 3U6BA 3MJFA 3WFIA 3ZCXA 4C29A 3JASA 3NIFB 1NW8A 1MABB 1FRNA 2P2NA 3LYHA 4ZOCA 1RPAA 3WL7A 3D6AA 1T3LA 3THXB 4IF4A 1VIVA 3GFOA 2HBRA 2P30A 2Q6OA 3DNMA 3LWBA 3H4IA 3GR6A 1VLQA 1C7FA 1QANA 5U4QA 3WQBA 4M76B 5AW4A 5BT9A 1Q7GA 2FX5A 1KXJA 1ODJA 1SVLA 2FW8A 2ZCUA 3K0FA 4W5HA 4EK9A 4PIPA 4Q4CA 4ND2A 3U1BA 1JS1X 1QE5A 2GZAA 1QG0A 2OYRA 4D81A 1IZ9A 1FXWF 1QJ4A 3QZUA 2PUEA 2LD4A 2GZMA 3PR1A 4PE5B 2OBMA 2R86A 3PD1A 3PITA 4LY6A 1S2DA 2V7GA 1YKSA 4RF3A 2O4UX 1QB8A 2IS6A 3EMDA 1PZNA 2BUAA 2ZI5A 3ASUA 4LV8B 4I7EA 4JVSB 3TM5A 3AT1A 3U31A 3FB4A 4ZHQA 1GGVA 1VFPA 5K99A 4CCYB 4IG9A 4M7RA 1K8QA 5FI0B 3B9BA 3LO8A 4AWAA 3N2GB 5F2EA 4RHYA 3SM3A 2XWBF 4JLWA 2R3SA 2AI2A 5LP6C 1EDDA 1KZ1A 1WD7A 4M22A 1PLLA 1I5EA 4ZU3A 2IYAA 1QHXA 1X7ZB 3DV0B 1T9CA 2IXGA 3V34A 2WG1A 3VZQA 4O4JF 4BQFA 3ETJA 1NQVA 1JR3D 4QFDA 4P54A 2FCAA 1GSIA 2WJAA 5LUBA 2R2AA 1QGUA 3A10A 2HXYA 5DXAA 2OORC 4D4KA 3K8QA 1RZRD 1OB2A 3TX2A 1GNPA 1GADO 1TJ5A 2XYVA 3NBKA 3AUKA 4RHTA 2DUMA 2ZVPX 3S29A 5AJZA 5CT4A 1USUA 2ZYVX 2NUAB 4P5EA 1NXWA 2ZAOA 1J2RA 1K5GA 5HM6A 3TN7A 3H19A 5FWDA 3SMVA 2OHVA 3C87A 3T7AA 4IDUB 4URZR 3EA0A 3KKKA 1NW6A 1VJGA 3DZKA 4BFWA 4F45A 3M6VA 5C52B 4KWCA 3NG1A 5TGDA 1R0SA 5FV4A 1IRIA 2RHDA 1UT8A 3HJUA 2HBZA 2QTWB 5B2EA 3E4DA 5IAEA 1NNLA 1FDTA 1FFCA 4YRLA 4R2MA 1AUXA 2IUEA 3BQ9A 1USKA 3MUOA 4QU5A 5ALIA 3OCJA 2FR8A 3NR2A 3K6SB 2G76A 2JK1A 5DO9A 2Q6KA 4EF6A 3QI7A 1KQGA 1K8XB 3OCVA 1JDNA 5CBKA 2VTKA 3B89A 3HSYA 3WQRA 2G5PA 4KPYA 5H9VA 1CV2A 3SHWA 4Q7EA 2VDKB 3T7IA 3AC0A 5A2QA 3OZTA 3OUTA 3PUWA 1FL9A 1ENPA 1N5MA 3AX6A 5EWMA 3UHJA 4U7DA 1N7HA 4REMA 4Q1CA 4RE5A 4KNWA 2HA0A 2HCRA 4MINA 2Z3VA 4BMPB 2FP3A 3LUKA 4MVJG 3FOZA 1ZJWA 3ASZA 1LI4A 3ACCA 1M5RA 1THTA 3LA8A 3RNOA 1E92A 1O8CA 3IC5A 3NXSA 2JF0A 3MYRA 3TDMA 2UZ1A 2UVPA 2QTBA 2O0HA 3GZJA 3HBLA 3KT3A 4A3SA 4ISCA 1XVLA 3TNYA 3TEJA 1FFXA 2B8JA 4HADA 1VBNA 4M0UA 5DGTA 1EUQA 5E7MA 3L4JA 1ZHFA 1CUGA 2ROQA 3PZRA 4W8HA 4EKNB 4D8XA 1O9GA 1U3DA 2OE2A 3GUUA 1I7DA 2I2CA 1TMGE 1D09A 1E3IA 3PIDA 1I14A 4FMPA 5IUJC 5C1BA 3Q3JB 4AZVA 3NRBA 4FP9A 3Q7PA 1YQWA 1RQGA 3LBAA 1RRCA 2AIRA 3ABZA 4G36A 3PFIA 2Q2WA 4ARAA 3NT5A 2GF9A 4GRIA 1GA1A 2XXJA 4HMPA 1XOIA 3O3NB 3PSAA 4UE6A 1MG0A 2IDZA 1WW8A 3B1JA 3WDMA 2OGTA 4N3CA 2XA1A 3I34X 3CHYA 4WCFC 1R3DA 1GZ5A 2V7EA 2WEKA 4ECAA 1JIQA 1V71A 1N1DA 4MI3A 4JI7B 4ARCA 2YFHA 2N1MA 1COZA 1RYDA 1Y34E 1M1YA 2NZ8A 2P0YA 2QD1A 1IB0A 1OBVA 1PGPA 2XV1A 3EQ2A 4PFJA 2P79A 3ZS8A 1W25A 1NN1A 1XDZA 3JD0A 1ZHOA 2ZETA 2H52A 3R7FA 5IANA 4DXAA 3TEMA 3DKRA 4MP6A 4QYSA 1WO8A 3NWPA 4R2JA 3PF8A 1RPZA 4KQ6A 1SC6A 3O92A 1DV1A 3MT0A 3SHOA 4UOZA 1CZOA 2VQEB 1AKMA 3L6UA 3NOQA 4MUYA 2CBXA 4J2HA 2IEDA 4GF5A 4FC7A 4MI1A 4DLBA 4F12A 3FOCA 3NJ4A 4M0PA 4BNDB 2JZCA 1FQJA 3GPDG 4ZT7A 5SY9A 1TQ6A 3DCIA 2WDPA 3EW7A 5HFNA 4HZIA 6LDHA 3KQKA 3KQNA 3PQ8A 1SHUX 1J07A 2JCVA 2QI9C 3H6HA 1PJ3A 2ICAA 1K88A 3GGOA 4UZSA 5JS7A 1TCBA 4B45A 5EXDA 2B4AA 5BN3A 4F9TA 3W5VA 3NRJA 1C5KA 1M6VB 3DBLA 4HRAA 4MQFA 4TYQA 1WXGA 3HABA 4WPGA 4PNHA 3W5JA 3M49A 2WMOB 3B82A 4MV3A 2WRZA 4A0SA 2OPBA 2C77A 2RK3A 4RIEA 1EYZA 4RGYA 2IUYA 1OROA 4FDAA 3KYIB 3HCWA 2O0KA 4V3BA 5AI6A 1V2HE 3UFXB 4JXZA 4J0GA 4HDMA 3OT1B 2A33A 4IS2A 1YR2A 5FOTA 1NSFA 2CDCA 4EYOA 3BTVA 4BCDA 1V96A 2JGDA 3NQ41 1OOEA 3NBMA 1Q0HA 3LGSA 4XB6B 1TCCA 3WAKA 5JZ9A 2HT1A 2EGUA 5EE1A 1JYSA 2AFIA 4Y1GA 1K27A 2NM0A 3GRRA 2ACKA 5K0ZA 3CVYA 4JCCA 3L7DA 1U65A 3IKLA 2OZLA 5JCOA 1VIDA 1GLGA 1NYQA 1JTEA 2OLKA 3NO4A 1B0UA 1YK1A 1L5RA 2F1OA 4FOLA 3OZWA 1OGIA 3NGXA 3OWHA 3RYHB 1RLUA 4I3FA 4ZI5A 3HDVA 4OK5A 3GLHE 2A0YA 4GNRA 3PQ6A 3CN9A 1Q83A 2PKXA 3O7WA 3UMRA 1ODTC 1X42A 1RVV1 2DWPA 3CW9A 4KQ1A 3VYWA 5B7PA 3PPWA 1KYIA 1M33A 2V6JA 1X74A 1KOLA 2D2XA 1U0GA 2WDZA 3KEOA 5DYIA 3X2EA 3IE1A 2I9KA 3P9SA 3SXUB 1LRKA 3IT3A 1JEYA 2ZR9A 5CVJA 3EZ7A 4TS1A 1A27A 4D8WA 4E3WA 1WP9A 2X0IA 5IJ9A 5BWLA 2P9EA 1W59A 2NX2A 1TYCA 1JNXX 1WHTA 4FHFA 5CX1B 1VSVA 5CXQA 5TQ0A 1WDKA 4YCLA 2CFIA 5JJLA 4DT1B 1KAQA 1QP8A 2ZSBA 4JQOA 4KWHA 4MZDA 3EPLA 1RWQA 3MZ0A 1TA9A 2CUTA 5FNZA 5EJ5A 4F85A 3W6PA 5IPFA 4F56A 3SDZA 1U2EA 5AKGA 4BFVA 1D2NA 5FUBA 1EHYA 3TD2A 4LCBA 2P3SA 1OIXA 4KH0A 3DHEA 3LUDA 4M60A 4AICA 1HR0B 4WQMA 4Q1BA 1W34A 2AFVA 4BPBA 5AW1A 3CKYA 2HPAA 2O2ZA 3VNQA 4B34A 3B3QA 2ZDGA 4U2CA 1N2IA 3GJ8A 4O08A 1ISPA 3AVXA 5ILOA 3PJRA 1LS1A 4MQ4A 4LGYA 2JDID 4P9NA 4AKEA 3ZHTA 3MGKA 3CR3C 1JL3A 1L5MA 2ZJ2A 3DZHA 2ECFA 3IVMA 2FQWA 1V6CA 4I1RA 4ITVA 4IQGA 4TLAA 3B51X 4DV0B 4I5EA 2H0RA 3ITNA 3ZE0B 2GZHA 4I1PA 2J3DA 5CYPA 4KWTA 3KQQA 2QZPA 5E9JA 3JVDA 4CMGA 2ZBVA 4WNAA 2FK7A 1YFKA 3SQDA 5JI3E 2MSNA 3HKCA 5LB4A 1USIA 3U62A 2FK8A 4GO1A 1R5BA 1U7TA 4PLHA 1ECJA 3RVQA 3IP3A 3UTDA 1T5IA 2P6NA 4ZHQF 1ZCJA 3P4UA 4AECA 1JG2A 1NKTA 3I1IA 2AC7A 3D6TB 4NDAA 1S2GA 4JI0B 1E1NA 5I7FA 1ZU4A 2MU1A 3KZMA 4QQKA 2ZUEA 4MRNA 1RRKA 1UQTA 1W76A 4J8PA 4XCVA 4C7JA 2WWTA 3DUWA 5H4HA 4BFYA 4MLDA 4IH9A 3MGBA 1PJLA 3C14C 4ES6A 1J8YF 2QRHA 1FSZA 3OEHD 4LOKA 1CR1A 1QBGA 3VTZA 2BLNA 4ZMBA 3TECE 1DC3A 1G8MA 1N5LA 2Q3LA 3U2QA 4M21A 5JNSA 4EA8A 2I6XA 3FXAA 2VC2B 4UTOA 2GPTA 2I03A 4B83A 2RAPA 4M87A 4R98A 1YS7A 2LZ0A 3OO0A 2PV0A 3RYTC 3LHSA 4HY3A 2BAGA 1KZGB 1Z4QA 2YWFA 3CZ5A 4EPVA 4XWWA 1HK7A 4C4OA 2QROA 4NENA 1E1KA 3DEAA 4ZJUA 1R0XA 4WVFA 1T9BA 4M83A 1J9ZA 3VR3D 4AMZA 2HJRA 3NYWA 1UP4A 3HRIA 1M5UA 2BMJA 4CDRA 1RR6A 4MWCA 3QKTA 3A1EA 2ISSD 3IAHA 4RPLA 3TEFA 2IL1A 2EOAA 2XQKA 1YBMA 2HGZA 4D9KA 1M34A 5K4HA 1Z6TA 1UL1X 2DZDA 4QJIA 2QU8A 4RA6B 1G38A 3F78A 1B43A 1V1MB 1VE3A 2QUKA 3AW8A 4GT1A 4IDNA 2IIPA 1O95A 5H3HA 4YRZA 1MJ5A 5FPKA 4HWSA 4QU8A 5AT1A 3BWXA 4N01A 1TKAA 5DNEA 2ARKA 3GHHA 5G0WA 4QECA 2YCLA 1QHHA 3B2QA 3OKPA 3KJXA 2ZYDA 1ZM3A 1FMJA 3NX4A 1X3LA 4HF7A 3DZGA 3JZIA 4RETA 3ISVA 3KOYA 5KC9A 4KN8A 2ZUTA 2PGXA 2G4CA 2BCJQ 3A37A 1GGMA 1YMUA 3AESB 4FGSA 4WMLA 3SQMA 3W5SA 2VAPA 3DMTA 4JFRA 5CB4A 1Q17A 1GAJA 1Q3HA 2OCYC 4HQKA 2QLMA 4NBTA 5COBA 1RU3A 2E4UA 4ZVQA 1VPWA 3MTQA 3WLQA 2BEVA 1EFLA 3VR2D 4LVCA 2WF9A 3LQ1A 1P75A 2IF0A 3G9XA 4UM5A 3RTDA 5BRAA 4ZI2A 1KZ4A 1M7HA 3VJMA 1BS9A 3GLVA 1W9HA 1PV4A 2EZ4A 2PUWA 3BXOA 3P5SA 1JHDA 1H65A 3ZV4A 5IAAA 3E7PA 4WJKB 1KMCA 1HL7A 3FPFA 3N74A 1UUFA 2PWPA 2X76A 4OB7A 1NN5A 1KJZA 1RHKA 4PIVA 4CKXA 1GCGA 4CTMA 1F6WA 1I6KA 2ISCA 3HSKA 4GUAA 4PBSA 1Q15A 1S5PA 1NLUA 2ZWPA 1HNZB 3F5MA 1E1YA 1G4AE 4RVGA 3UPUA 2Y0PA 1FJ2A 1QRRA 2VQ6A 3SR4A 1P77A 2H92A 4AJHA 4GSYA 4JROA 3HYRA 4R01A 5BN5B 2VXYA 3L0SA 4RA9B 3RHTA 5AM3A 3JWIA 3HGTA 5GGXA 3RVMA 2XWJI 3UTCA 3K9BA 2I2BA 1T0BA 4MLZA 1U80A 4NX2A 5FAXA 4FW9A 4ZYLA 4QHYA 4PV7A 3UUEA 4OXYA 2NU7A 2D13A 2OHJA 3GDHA 1KJ9A 2CVFA 1CNEA 2FWIA 2L18A 2HF8A 1FSPA 2JLBA 4AKSA 5AOCA 2FZ4A 1RPTA 2ZKIA 5E3JA 1QAQA 2FOXA 1N5IA 3FSEA 3U44A 4JBYA 2C9YA 1XAJA 3IH5A 4WZBB 3RC1A 4WBNF 4L02A 1HT0A 4BB0A 1IEWA 5HGXA 2OB2A 4LS3A 1L5KA 2D2EA 3O91A 2QRQA 4MDFA 2CWDA 2HX1A 3OP4A 3D5TA 1E1RD 4W5RA 1X7HA 1XKXA 2PRKA 4LXGA 1RVDA 3DO6A 2NWQA 5BXQC 2C94A 4J07A 4RS3A 1WTAA 5C4GB 3KO8A 1ZEJA 1CKEA 5AUOB 2JGNA 4C7OA 4TV8A 1ZVKA 4P98A 4WFIA 1MABA 2G0NA 2O9JA 3I9KA 1E3QA 3MTDA 5BSHA 1JEDA 1B14A 2GPBA 2JZOA 1F8FA 1VDZA 4IRUB 3LP6A 3OP1A 4BO7A 3I3SR 4IYRA 2OAEA 4MWGA 1E79D 1Z2OX 1M2OB 4QJBA 2UVQA 3ZZTA 2GCNA 3SS7X 4GSLA 5ARDA 4OM7A 2R6DA 2YN2A 3K8YA 2DFPA 4PEVA 3X2FA 3BGVA 1ZN8A 5AMXA 3PUJA 3HDHA 2PWAA 5IVKA 1MT0A 4KWEA 4BMZA 5AVRA 4DXHA 4W5WA 5KWJA 3VR4H 2GN6A 3INNA 1U3TA 3IEKA 1NJ5A 4CLOA 3CFYA 3I73A 4BKQA 2NO0A 1OBOA 2I80A 5CFZA 1WXHA 2Y1GA 2GZDA 1OWMA 3SJBA 4MQEA 2PVSA 2CUKA 3H86A 2DT8A 3PL1A 1UPUA 3N2GA 3MILA 1M75A 4RDIA 1K66A 2AD5A 1G0OA 4JLSA 4MVWA 5EMJA 2ZRCA 1DAMA 2IXBA 3H8WA 3QEAZ 3BDIA 4AT1A 1Y4DE 1X7ZA 4WBXC 4I9HA 4RTRA 5FEUA 4BV9A 5JSUA 4B35A 2WSYB 4DV2B 4AJKA 5EKXA 4EAQA 1KOGA 3PJFA 5KWEA 1AO0A 1RE0A 3CKKA 2X8JB 1MAWA 1EQUA 4J1QA 3CZMA 4K87A 5FA5A 1M73E 3ME5A 4X7MA 5MGBA 2XF2A 4ALLA 5AVOA 1GKKA 2AT1A 2ZZKA 4KODA 5K8VA 1KVSA 1Q22A 1U7WA 2NUAA 1PHRA 3PDIB 3WICA 4FBMA 1YZLA 4ZOBA 5EJEA 3HYNA 1OFUX 3C3EA 1GDHA 3JSXA 4HPXB 4LYDA 4ZAWA 1XRSB 1H2AS 1BX0A 4MAMA 4IDUA 1W4AA 4A6EA 4NV3A 3CKMA 4IIXA 1JYEA 3DVQX 2BRUC 1W85A 2C84A 3U4QA 1AGYA 1EK5A 1VE5A 3BGSA 1ZA2A 1Z0ZA 4RO0A 3L93A 1WM1A 1LTHR 2QIPA 1JVNA 1KSHA 1L5VA 3LC7O 4MIYA 5FBWB 4V1CB 1DAGA 5HF9A 3ZOZA 1C81A 3HS3A 1SVUA 1DIOB 2CXPA 3C4QA 2V4ZA 3K6SA 5FULA 4OAPA 1PE0A 5DBIA 3WRXC 3FCSB 4YVFA 1R6TA 1XWIA 4IFBA 4ILKA 5AHRA 5ETJA 4Y6QA 1Y82A 4P4LA 4II3A 1SB9A 3TL2A 5K0SA 5LL6P 3KQYA 1B76A 1DKUA 1P1RA 4FXOA 4G5FA 4QTUB 2FUNB 1GV1A 4IX1A 5CJJA 4YJ2B 4Z53A 2HMTA 3V3TA 3H13A 1RRVA 3A25A 3GRAA 3LK6A 3MTEA 4N9WA 1SZJG 1W73A 3CMMA 2ZR7A 3PCRB 3VU3A 5L3SB 2XX3A 1ZI8A 3IO3A 4Y2JA 5SYAA 2BGMA 4MUXA 4NBNA 2WWFA 2XA2A 2XZLA 4BVBA 1DMRA 4AJEA 3HYLA 5H81A 4NU5A 4JUIA 3V1NA 2UUOA 4O59O 3PK0A 4N0DA 2J9RA 1M7BA 3DJYA 1MJHA 2CDNA 3DP7A 4LOIA 1OV4A 3ELDA 3EGWA 2QMUA 1YL7A 4J9UE 4RY2A 1T6ZA 5DLDA 1YJAA 2QAIA 3B5IA 4E5PA 7GPBA 1ZN9A 3EQ9A 4KBGA 1AMUA 1VE7A 3WNDA 2RGCA 4E6EA 3ENNA 5TF0A 2IYEA 1A9QA 1SVKA 3A4TA 3JQAD 3S5UA 4IDDA 3Q7RA 1N5OX 2OO3A 2W43A 1HEUA 4JVNA 3T5MA 3ETHA 5CPFA 4GVPA 3ZJVA 2QYOA 3PNOA 1G3RA 3N5CA 1MO6A 1T2FA 1YBAA 3BD8A 4IINA 5ALLA 3AM5A 1GRNA 3GYGA 1E7MA 3I6YA 4TLMB 3U09A 4XLZA 4NLLA 3WFJA 1UJ4A 5EPUA 3VAAA 1BC5A 1Y5NA 4CKCB 5BWBA 2GK4A 3HB5X 5F73A 5JE8A 3B1KA 4PBTA 1R1DA 4DA6A 3IT1A 4AN4A 2QLFA 2YS7A 4M8LA 5I48A 3V1KA 1E5LA 5GM2A 3TR0A 2QLBA 2PD6A 3I61A 2ECPA 3RI3A 2FXIA 1TZJA 3SKVA 3J80A 2J0QA 4HNQA 2ZBUA 2VBFA 4V0RA 3OFNA 2YY7A 4AJOA 4ERXA 1VHTA 2QLJA 3OFSA 2O8FA 1E2IA 2VF8A 3GD7A 4I99A 2Y6VA 2ZT6A 3H1PA 3T3DA 1FDIA 2VP2A 1UBMS 2FMXA 2WJZB 3GRUA 2JCGA 5FLXA 4DB4A 1CZUA 4EQZA 2PAFA 1KZHA 4TXHA 1ZW1A 4AWXA 4BNDA 4ZVNA 2R85A 2X3UA 1XU4A 1U0TA 4N65A 2YJGA 4LAFA 3EF1A 4C6SA 1LW7A 1TAHA 3MUNA 3OAAD 1ZK3A 3VKUA 1DBVO 4YA6A 4UDYX 4CKYA 2ZYTX 3FX2A 2QU7A 1TF7A 3UA3A 2HU2A 1KJQA 5JAIA 4TTVA 2XCSB 4Q9HA 2UV8A 3R3ZA 3U3XA 1XDWA 2FPPB 2ODTX 5BYAA 1DFHA 2AW3A 1RMTA 2FSVC 1GGJA 3EDCA 4KE7A 4F3KA 4F4DA 4MKGA 4PYIA 4R3UC 4J6FA 5C5IA 4P4NA 4G5SA 3CSSA 3INTA 3NMUF 1YQTA 3WLHA 3WLSA 5DHSA 4CLHA 2HQOA 1MOQA 5CB4F 3A4LA 4R54A 4U0JA 3T0IA 4PLTA 1STOA 1RWPA 4G0PA 4MRPA 3S1LA 3MGAA 3TLEA 5AOAA 4FEGA 4WBSA 4YLGA 2V97A 1MOZA 4O4LB 3ZJYA 1SKYB 2E4XA 2XE7A 4FJ1A 1E77A 1YRBA 3C8HA 1NQAO 4D26A 1LQ2A 2QVXX 4JVMA 4P83A 3SSOA 3Q2KA 4FKZA 4W9NA 3PUZA 4RTNA 1W46A 4L76A 3CZQA 1Q6ZA 3LDHA 3I04M 1FNMA 1HZZC 5KTPA 5U9CA 3B3FA 3P2KA 4UBKA 2PSDA 1OFVA 1R9GA 2FEAA 3BBPA 3D31A 2PSJA 1GO2A 2RARA 1H3FA 1FP4B 2CYBA 2XDQB 3N1UA 3UG6A 2WHEA 4ZARA 1ZD5A 2BKUA 4BBAA 5IX8A 1TD1A 1JA0A 1YOVA 4UMVA 1ZGAA 4IIDA 3ESQA 1Z8DA 4BGEA 4P32A 4M1OA 4EG5A 1L8XA 3WIBA 1ZCAA 3GMIA 4FOPA 4PTZA 4ZVMA 3BXPA 4IGFA 1ZZEA 1MRSA 1WUHS 2JCXA 3GNLA 4KAAA 3F7NA 4HWPA 5DX0A 1I2MA 1P0CA 2HJVA 3EMVA 4JQYA 4AUKA 1M0EA 1JKJB 1TO1E 3CINA 3KLOA 4BZZA 3DZFA 3VJRA 1KJ8A 2WR8A 3R7SA 1GM5A 4K6KA 1E7YA 1GL9B 3FMVA 2YQ5A 3KOMA 1P0FA 3K8ZA 1TVMA 3M33A 3K0BA 5K0EA 1KGDA 3B1YA 5JVDA 1PYDA 2BIFA 3J81k 4FMBB 1XRJA 4DM3A 4F4IA 1WTCA 3RU9A 3VOTA 1JLRA 2M98A 5DXFA 4CU5A 3GWGA 2J3LA 1JH8A 3I5MA 4OCZA 1L9KA 4RHUA 1WW2A 4R1MA 3R41A 1UINA 1ZAKA 1RYNA 5F12A 1WL8A 1ZG3A 3ETCA 1KK3A 1TLLA 2WZCA 1PQYA 3FYHA 1HG0A 2ZSJA 3ON5A 1AOXA 1EXNA 3B20A 3MJTA 4RVOA 5T6MA 4TV8F 2BFEB 4EVQA 3ZCTA 1NHWA 1CBUA 3FLEA 4DBZA 3L82B 3ZZUA 1AKUA 4IIJB 1OH6A 3EDOA 1U04A 4YJKA 3T1VA 2W7TA 3QVKA 4CTJA 1V5WA 1C9YA 4E94A 3PKJA 3WK7A 2XEXA 5EJ8A 3W0LB 2ZYUX 3FTDA 3EX7C 4FWTA 1VJRA 1USGA 1UMKA 1FYVA 1OYOA 4I1IA 5C2JB 1EFPB 1M8KA 3DOCA 1X19A 3GEHA 4BLWA 2KE5A 4MH0R 3NH9A 3GQBB 5KYYA 1EAMA 5KTRA 1M6HA 5IULC 3AHIA 3SF8B 2XBMA 5GGYA 3Q9UA 4ZK2A 2Q1UA 4DZRA 1WCYA 1VA4A 2XUIA 1DB3A 2NSYA 2EAUA 1ZXLA 3GLUA 3E3OA 1D1TA 4KDFA 3RYIB 1VTKA 1YK0A 1BXZA 4I8DA 3UAVA 5HRCA 5IM4A 1M1YE 1QPZA 1A95A 2IV7A 3HXPA 1GNVA 4R8RA 3PDCA 2ATCA 3CLTC 3RK0A 1GY8A 1ORIA 1HFKA 3QBJA 3UPTA 5ANRB 5AFSA 5CD9A 4TTJA 4B3GA 1TW2A 1TU0A 3G0OA 2IE8A 1VI6A 1P33A 2BHSA 4I50A 4OHFA 5H0IA 3WKDA 1W0JA 3HO1A 3VA7A 4FSHA 1YDWA 4L95C 2O3JA 1V3TA 3BA6A 1OT3A 3HA7A 1M72A 2A5FA 1XDGA 3A32A 3HCAA 3KB2A 4OOFA 4OQMA 3S0JA 3ZE6A 4ALKA 4F91B 3KVYA 1MORA 2CJWB 2IYSA 2Q4BA 1GIAA 3ESXA 1OY1A 1V5IA 2XNSA 3LO5A 4FQ8A 4EM6A 2E18A 4TQ9A 2Y1KA 3SEFA 4F8EA 2HA2A 1RTTA 2GD0A 2X4IA 3OJCA 3O4RA 1YFZA 2PCJA 3DD5A 4MVJH 4XM0A 1K5HA 4J0QA 3A6JA 4D3ZA 3IT2A 4CRWB 4EW1A 3MTJA 2O3SA 3UH1A 2Z43A 4B3CA 2ORIA 3V4PB 1A5ZA 3WYFA 3B6EA 4A23A 1G21B 3G5MA 1SXQA 4MRVA 3H9GA 1I8TA 3II6X 3DFUA 3S2SA 4DE5A 3QFHA 2GVNA 4PONA 3SSAA 4E30A 4PX9A 1NIPA 8GPBA 2HA3A 2X0JA 3JVEA 4O4IF 2B20A 4UUPA 2PLRA 5SYNA 1J49A 2XCUA 4UNPA 4QPJC 4GPTA 3HA2A 2A1TS 3UUFA 2AFRA 1XJQA 3DUFB 2AFIE 2XB6A 1JQAA 2N46A 2Q9CA 3C1UA 3ONNA 4BQSA 4YRGA 4JU9A 4F3RA 2O2XA 4DXDA 1P1IA 1P1JA 1RE1A 4NJMB 3EFEA 2B4QA 2QN9A 5JBIA 1ZM7A 1HETA 4BFCA 4RZXA 4RVHA 5JAOA 1CYEA 1YQGA 5CB6A 4UMDA 1AHHA 2XUPA 1P60A 2R87A 2Q1TA 3EAFA 4Q3EA 4KACA 1EM8B 2IY8A 4A1OA 3VVCA 4YIHA 4MGKR 5D3MB 2BGUA 3BTUA 4K9NA 4NBVA 3FLAA 2IYOA 3K0AB 1SC9A 2Z6UA 2PU5A 2LDBA 4G23A 3TB6A 4GXRA 4A0RA 4YRJA 3KJEA 4FYHA 4GQBA 3AKYA 1Z2PX 2M2IA 3NAMA 3ILVA 1OU0A 3G49A 1VCNA 1WSBA 2C9CA 4L6AA 3C16C 4WERA 5EPEA 4AXBA 4QOFA 4NIMA 1KFCB 1VZ2A 1LDGA 1NVKA 4R2LA 3T5TA 1NVVR 4ME6A 5H16A 2CDRA 4BVLA 2OHOA 2Q3DA 3MMNA 2ZXEA 4E33A 5LU9A 1DSSG 2Q2QA 3SR0A 3FHJA 2VF2A 4Z9YA 4DJDC 3LBYA 4ZHSA 4YP0A 3OPYA 1IAQA 1YRLA 5IZCC 5LKRA 2VS1A 3G0GA 4Z4IA 1Z5VA 1Z5PA 5K7SA 3RFUA 2P2YA 2E5WA 3IKMB 4GLFA 1PNVA 1GPBA 2F1IA 2W6NA 3RC3A 2EFYA 3F3KA 1HE3A 5DNUA 3QJYA 5DV9A 1RBZA 2QSUA 4C0JA 4E5YA 4UAVA 4H18A 4YH1A 3P9QA 5IU6A 3PT9A 1QYRA 3DMPA 1Q2XA 2IZZA 2BBTA 3QKUA 2GX6A 3IBTA 4F38A 3SBEA 4N9QA 3EEYA 5DHRA 4F21A 1R0BA 4FGZA 4I2NA 4LHZA 5GJVC 2I1QA 4WZBA 4YPFA 1C7JA 1K86A 2H16A 1FP2A 3R3JA 3WGQA 4INZA 1DCMA 1CY4A 3W8EA 3GJ7A 2WJ3A 4AFNA 5DTJA 2O8DB 2J1LA 4CUZA 3UUWA 5A0TA 2R751 1EP9A 2FI1A 4MMZB 1HDZA 2OC4A 3JQGB 4NYMR 1PTJC 2PKYX 2F8MA 3DYBA 4H08A 1XMSA 4KQJA 4DDTA 5J9FA 3MAJA 4ECEA 4C0QC 3ELWA 3EXIB 5BSUA 5HSGA 4IRMA 1IH8A 3ZLUA 1WEKA 2LVBA 3C3AA 4K2HA 3M3PA 4Q3BA 1JFFB 4NXNB 2EDAA 4A2PA 4LRSB 5DE3A 1AQJA 3C4JA 3DWIA 2Q4DA 5ALHA 1NXTA 4J1JA 1X7YA 2J6BA