1QYDA

Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases, and their relationship to isoflavone reductases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
312
structure length
312
Chain Sequence
DKKSRVLIVGGTGYIGKRIVNASISLGHPTYVLFRPEVVSNIDKVQMLLYFKQLGAKLIEASLDDHQRLVDALKQVDVVISALAGGVLSHHILEQLKLVEAIKEAGNIKRFLPSEFGMDPDIMEHALQPGSITFIDKRKVRRAIEAASIPYTYVSSNMFAGYFAGSLAQLDGHMMPPRDKVLIYGDGNVKGIWVDEDDVGTYTIKSIDDPQTLNKTMYIRPPMNILSQKEVIQIWERLSEQNLDKIYISSQDFLADMKDKSYEEKIVRCHLYQIFFRGDLYNFEIGPNAIEATKLYPEVKYVTMDSYLERYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords pinoresinol-lariciresinol reductase
publication title Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases and their relationship to isoflavone reductases.
pubmed doi rcsb
source organism Thuja plicata
total genus 94
structure length 312
sequence length 312
chains with identical sequence B, C, D
ec nomenclature ec 1.23.1.1: (+)-pinoresinol reductase.
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1qydA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1qydA02
2EHDA 1F8GA 5DOZA 5L3ZA 3TZQA 4IJVA 1YWGO 1I24A 4DL9A 3B1KA 3I23A 4CJXA 1G6KA 4LCEA 4TRNA 3VZSA 3AY3A 4CM6A 3SBOA 1NPYA 4BNFA 1LLCA 2PV7A 3DAPA 3DMTA 1IHXA 2J3KA 1KVQA 3EVNA 5AXBA 5HWSA 5U4QA 1VKOA 4Z9XA 4Z0PA 1J0XO 5KVCA 5KVSA 2UVDA 1HE3A 1XWFA 5EQDA 4ONEA 5CDGA 1NPDA 3L0DA 3I6QA 2X5JO 1VRWA 4R68A 4BMSA 1XA0A 4NBWA 1MGOA 4CMIB 3A1NA 2PKQP 1FMCA 3FWZA 4N18A 5EQFA 2GZ1A 1UDAA 3B6ZA 1A9ZA 3GG2A 1UXGA 3BHIA 2FPIA 5JXWA 4RF2A 4MVJI 1I10A 3WFIA 2ZYDA 5K0ZA 3OHSX 2CD9A 3FNFA 3RKUA 1ZEMA 3PWKA 4J7UA 3RBXA 3PPIA 2JFGA 4BGVA 1WXDA 1R0LA 2X86A 1CRWG 1IPEA 4HUJA 4PLCA 1DO8A 3OJEA 5G0WA 3S2IA 3VPHA 4YRBA 2QYSA 2GUGA 1E3WB 2Y1OA 3R6DA 2GR9A 3SC4A 3BTSA 4W9NC 3ETGA 1BG6A 3RBVA 4YBZA 1P1HA 3QIVA 5L95A 2B37A 1F8FA 1XCBA 1B3BA 1DFIA 1NQ5A 3GR6A 1Q7CA 4R69A 3ZW9A 4BMVA 4AJKA 3LF2A 1YKFA 2VNSA 4YJFB 1PL7A 3D4PA 3UKOA 5JO9A 3PFWO 2CF5A 3QWFA 3PK0A 4BO6A 4C4OA 2VT3A 4RVSA 1ZSNA 2VUTA 3PDUA 5CEFA 4XYEA 3SLGA 1GEGA 1PTJA 3TL2A 3OM9A 2IRWA 1O6ZA 1E7MA 1P74A 3C7DB 3GMSA 4J1SA 1JTVA 1ZK3A 5J23A 4KUHA 3RUDA 2ZB7A 3ZWVA 3KOUA 4Y67A 4BB6A 1ONPA 3HN2A 4IIUA 3UFXA 1WDKA 4ITUA 3ORFA 1YXMA 3HE3A 4ALLA 3U4HA 3H6KA 1QRRA 1YBMA 4J3FA 4EGFA 1BTOA 1SB9A 4D0RA 5K9ZA 1HTBA 1DHRA 1TT5A 1QV7A 4O63O 1GTMA 1QG6A 1YDWA 2Q1WA 3ZNPA 3ZWNA 2ET6A 3ZI0A 4OL9A 3GZNA 5COQA 2WD8A 1QP8A 3MJCA 5T8KC 2IZ0A 5KJ6A 3MOIA 3EMKA 1HXHA 1QV6A 1CIVA 1EVZA 3QHAA 2I3AA 5IDQA 3G17A 2O3TA 3FNGA 3GEMA 3NUGA 1LQTA 1NXQA 1ZO8A 2X58A 4XRRA 5JY6A 4IGFA 2HDHA 4J6FA 3GN2A 3BZUA 3DMYA 5JYDA 1YB5A 3WS7A 4ALNA 4FQ8A 3GLQA 3KLPX 4BNLA 4BV9A 4HWKA 1UUFA 2VYVD 2PZMA 1LC3A 3AI3A 3ST7A 5DP1A 1HLPA 4KP7A 3ONEA 2PNFA 3WJ7A 4A26A 4KUGA 5DNAA 2O23A 1XSEA 3JQCA 4BO9A 4D41A 4R1NA 4PZEA 1U3TA 5B4TA 2WYWA 1YB1A 4N54A 3U62A 1A27A 4O5OA 5HBRA 3NEPX 4JBHA 5TX7A 3FRJA 5A9SB 2CVQA 1T4DA 3WGIA 1LDGA 3CMCO 4Z6KA 1UZNA 4J4TA 5T67A 4UVDA 1AXGA 1FXSA 1NAIA 4CM8A 1Y5RA 4MVJA 2DTEA 3WIEA 5CG1A 1X13A 4WNIA 4WLOA 1C1DB 4O6VA 5IN4A 2NTJA 2E4AA 4RLHA 4CQLA 4KDFA 3TNLA 1JQBA 3PLNA 3AOEC 4RVGA 3WGZA 4XA8A 3MJSA 3WXBA 2NUAA 1J6UA 4BO2A 2DBVO 5HS4A 3MOGA 2W98A 1LSJA 4YJGA 4AJEA 2HK9A 4QO8A 3GZ4A 5TF4A 3D3WB 3NAQA 1XQ1A 4FBGA 2RH4A 4NBRA 2YFHA 4YAKA 5IXSA 1MC4A 3ZU2A 4KDEA 1BXGB 1NNUA 2Y68A 4KQWA 1LTHR 3AY6A 3L4BC 3RC7A 4RQUA 1SB8A 1L7EA 1HWYA 1I33A 1U28A 2CF6A 3V8BA 3QQPA 3VPFA 5L4LA 3NT2A 4WLUA 2OUIA 3MJ4A 3TWOA 3HN7A 4BNWA 1DOHA 2W2LD 5DCWA 1C0IA 1LLQA 1NBOA 2P4QA 1R12A 5TT0A 1E6EA 1HDOA 3W8FA 3FPCA 3PYXA 1OZAA 1MLDA 3FWNA 1UXIA 2VUUA 3D7LA 2V6BA 1X7HA 2CFCA 3PHHA 2EGHA 4IJUA 4RZIA 3H4VA 1BRMA 2VWQA 3BTUA 1GL3A 2ZK7A 4XEHA 3D5QA 1HYEA 4CLEA 3E1KA 3H8VA 4A5OA 3AWDA 5LDHA 1DRWA 2YQ4A 1NAHA 5IDWA 1YQXA 4JGBA 1BVUA 4DPLA 1KEPA 5G0VA 1HDRA 5A9RA 2JCXA 3RBZA 2FZWA 4JX8A 1CEQA 3WG9A 1FDVA 4BIIA 1YONA 5A5FA 4DVJA 1P44A 3ADOA 1MXHA 1B8VA 1NQTA 3H65A 1ENYA 2Q3EA 3K6JA 5A02A 3CZMA 4YR9A 3HADA 4OXYA 3BAZA 3NJ8A 3GEGA 2WE7A 4IXWA 3QRWA 4CM7A 3WDSA 4NI5A 4BNTA 3O26A 4IY1A 4RVHA 1EQ2A 3WOHA 1Z73A 3K30A 5IZCC 1IUKA 2FR1A 3F46A 2NSDA 4K26A 1EUDA 5G0TA 4E3ZA 1ZSYA 4XYLA 3OETA 2EEZA 3LVFO 4K6FA 1DHTA 5JDIA 1U3UA 3WNQA 5L4NA 1X14A 2YZ7A 4PLYA 5CEJA 4CQMA 1HDGO 1SPXA 3E5RA 2C7VA 1NWCA 4RF3A 3BMQB 3BMOB 2NTVA 3ZWPA 2OORA 3T7CA 5FYDA 1EFKA 4CR7A 4CMEC 1JKFA 3KYCA 4JJFA 1PX0A 2J5KA 2X23A 3EY4A 3M6IA 2JJYA 1M66A 3F3SA 4TWRA 4MVJH 3RC1A 4MINA 1Z75A 1ADBA 1CWUA 3QJ5A 1KOLA 3DHNA 3CKYA 1I5RA 1NFRA 2J6IA 4LK3A 4FGSA 4LISA 3U5TA 2Z1NA 4M8SA 1X0XA 4AJOA 3ZWCA 2W2KA 1MB4A 5IAAA 4OJNA 5IF3A 1DXYA 4II3A 4R9SA 2CVOA 2SCUA 3HFSA 4OH1A 1E3EA 3O38A 1NR7A 1V9LA 3JSAA 5DN9A 2IE0A 1EQUA 1SOVA 4I08A 1XR3A 4BB5A 2WM3A 1SCUA 5C5IA 3H9GA 3PXXA 2OO5A 2Y1CA 1E7QA 3B20A 3NV9A 1R15A 4WLNA 1AN9A 3K31A 3HB4X 3ZN2A 4YAIA 5MDHA 1UR5A 2POQX 1HL3A 1R4MA 1A72A 1AXEA 3ONFA 4RPKA 2OBYA 1KERA 4ZRMA 5KOIA 2B5VA 1KS9A 5JNLA 1T4BA 1NFQA 5DF1A 1E1MA 1JWAB 4AG3A 4CLRB 4E4YA 3M2TA 4ALIA 1YE3A 3P2OA 1Y8QA 4FDAA 2E6UX 3P5SA 1GADO 1U7HA 3GVPA 2VHWA 4XQCA 4JXKA 2ZYGA 3AUTA 3VKUA 3WLEA 4A0SA 3C85A 1OMOA 1TEHA 3FR8A 4GVLA 3DBRA 5HRUA 3OJ0A 1Y7TA 3K5PA 1WDMA 1OOEA 2P4HX 2XXBA 5A3VA 1YQGA 1ISMA 3DHYA 4IBOA 4CM1A 1GDHA 4ZN6A 2ZJ0A 3HG7A 1NP3A 4CL3A 3I9MA 1V3VA 4IIVA 2XAAA 2FZEA 3N7UA 1LUAA 1GCOA 1WLYA 3JQAB 4IQ0A 3VDQA 3K2BA 3WWYA 1OFGA 1FDWA 2IXAA 1U1IA 4H15A 2BI7A 1U3WA 3NGXA 5I8WA 3WGHA 3BMCA 1U4SA 1V8BA 3JQ7B 4O1MA 4XD2A 1GAEO 1UAYA 4OO3A 4RO0A 3WYBA 2P9GA 2I6TA 1F14A 1H2HA 1JVBA 3AU8A 3IJRA 4MVJM 3Q2IA 4TRJA 3GNQA 1DIGA 4Q3CA 5HS6A 1GZ4A 1DIBA 1XU7A 5GY7A 1K5HA 1QYXA 5TS3A 5KNLA 4XWYA 2JAPA 1C0LA 3FF4A 1YOVB 4XYMA 3WGYA 5CG2A 1VL6A 2R00C 2GPTA 4N7RA 1MP0A 3EZYA 1PJTA 2OMEA 3GNTA 4HNHA 3MWDB 4CL8A 3M1AA 2O3UA 1GFSA 1LQUA 5HTOA 3WB9A 3A14A 2FR0A 2J5RA 3K92A 3UUWA 3IP3A 5EMHA 4DTIA 1N9GB 3M1LA 2OFPA 3PJEA 1YL6A 1CQIA 4R01A 2P5UA 3AJRA 2B0JA 1Y81A 2WEKA 5DOVA 3H3FA 4MDHA 1VSUA 2X9VA 4EEZA 3ICCA 5JY1A 4BV8A 3RU7A 4J2HA 1MX3A 2ZKLA 1O89A 3FI9A 1IL0A 1BMDA 4M55A 4NJOA 2Y05A 4TKLA 2YHUA 1N8KA 1WAMA 3ZV4A 5BSGA 4LSWA 2QZZA 2NNLD 2UYYA 2HKIA 1A9YA 5T64A 5AOVA 1NHGA 2Y93A 3AU9A 3PHJA 1DLJA 5BSHA 4ALKA 3V5NA 3U09A 2C20A 1SOWA 4A03A 2HMWA 3IUSA 4YACA 4YRDA 5F1OA 4GL4A 3CH6A 4GI2A 3EAGA 1YVEI 1DAOA 4I9NA 3G1TA 3LK7A 4ZVVA 3VPXA 4BKRA 2W4QA 5LCXA 2AA3A 1KETA 3TOXA 4BL5A 2VYVA 3H9EO 4CV0A 4BQRA 4P8RA 4CM4A 2D4AA 4YT8A 1RM3A 5ICMA 4NBVA 3X2FA 5KIAA 1ZXBA 1BW9B 2AEJA 2O48X 1VC2A 2O2SA 1CJCA 4DMMA 4QO7A 3VHRA 2UV8A 1JDJA 4OQYA 4L73A 2GYYA 4R51A 4W99A 5ITWA 1EMDA 4WCFA 3U0BA 2O7SA 2NU7A 2YJZA 1GUZA 4XYGA 2JKVA 1UP7A 2WSBA 4WLEA 3GHYA 1XLTA 4E5YA 3ZWYA 3IAHA 2WD7A 4RZHA 1NASA 2ZTLA 3X2EA 3FBGA 1JLLA 3KBOA 3QE3A 4GKBA 3UOGA 2J8ZA 3JTMA 3N58A 1KVSA 2OP0A 2RAFA 3LT1A 3MJEA 4IS3A 1DC5A 4BNJA 3JQGB 4GLLA 4WKGA 3GFGA 1ML3A 3OSUA 4K1LA 1YS4A 3WIDA 2ILTA 2X8LA 5ADHA 5I7FA 4FFMA 4XGNA 2JFFA 2EKLA 3UGKA 3ABIA 3WFJA 2XXJA 1KEUA 5IJZA 2BKAA 4XR4A 1VL0A 1KEWA 1W0CA 4AVYA 4MKXA 4IM7A 4CR8A 4HBGA 1Y1PA 2PH3A 3NTRA 4J90A 3W6UA 4CLXA 4CR6A 1LLUA 4IUYA 3CE6A 3UAGA 2W2LA 4Y6PA 2EJWA 3F5QA 1DPGA 1HDYA 4RCVA 2GN9A 5B12A 1Y8RB 1KC3A 2H6EA 1F12A 1GYRA 3IKVA 4IDGA 4D3DA 4GX0A 3VH4A 2NVBA 4ZA2A 3EZLA 1LI4A 1LSUA 3DZKA 4AJJA 1SZJG 3TZ6A 4HFRA 3TF5A 3PHIA 4JCOA 1AHIA 5ER6A 1MG0A 4DIFA 1RM4A 3DDNA 2FSVA 1BGVA 3INRA 1E7RA 5TC4A 4XGKA 2VTDA 5EIOA 3JD3A 1FDTA 3GFBA 3DWFA 4XX0A 4GSLA 3KEQA 4W9NA 2FWMX 1GY8A 3ETEA 3PJDA 1R66A 1I3MA 4W4TA 3OA2A 4PGFA 1H2BA 1Z74A 3G1UA 5B1YA 5H81A 2VYND 3LU1A 4YAJA 5B4VA 1D4FA 3DFZA 2DUWA 1YDEA 3TPCA 1DLIA 2EGGA 3KHUA 2OOSA 3JYQA 2J3IA 4BKOA 3ZWBA 4JROA 2I67A 1U8XX 1SEVA 1RKXA 2YHIB 4IS2A 3IMFA 1XIVA 1EUZA 1T2EA 3C24A 1QLJA 2C2XA 2UAGA 5KVQA 4CLOB 2BH9A 5JCXA 5KKCA 3L6DA 4ZQEA 4RL6A 1D1SA 1GR0A 4XJSA 4KTTE 1QLHA 2BHLA 2AEFA 1Q0LA 3HFGA 4J4HA 3BYZA 5F1KA 3HZZA 3GVXA 3O9ZA 3VVBA 5KCZA 2DQ4A 3GUYA 1ZEJA 4FFLA 4XB2A 4GPD1 1P1KA 5FWNA 1H94A 3HWRA 5F21A 4FR5A 4PFJA 1MA0A 3TDKA 5T8KA 4MVJG 1D8AA 4YEDA 3ROQA 4AJLA 2Y99A 3C7CB 2OXIA 2LDXA 2GF2A 4ZRNA 5JC1A 1DIRA 1LDNA 3IOYA 5ER9A 2OGUA 1G0OA 1Z6ZA 1ZJZA 4NBUA 1PIWA 1P0CA 3WICA 2UUOA 5FFFA 2DFVA 1JW9B 5CDSA 1PGJA 2V65A 1K89A 3VVCA 1LA2A 4RPGA 3ADPA 5GMOA 3PDJA 1R4NA 3AFNA 5KJ1A 1XGKA 4EBFA 4UAGA 2UUPA 4INAA 4UREA 3PWSA 1HZZA 4LN1A 3F4BA 4XDYA 4DPMA 1PEDA 1B16A 4BNUA 3PP8A 3T4EA 2BRUA 3LT4A 3WNVA 4Q3EA 8ADHA 2GNAA 1H6BA 2DM6A 4IMRA 5MGBA 5I7EA 1VJ1A 4DWVA 4YJDA 2PFGA 2NTNA 4B7UA 1YRLA 4FS3A 3H7AA 3I4FA 5JC8A 1Q1NA 1M2WA 4J91A 2EERA 2YW9A 1E5QA 2R2GA 2RCYA 5H82A 4LRSB 3DBLA 1P77A 4NPCA 3R0IA 3DC2A 5DCUA 1E3SA 3IJPA 2ZB8A 2IEBA 9LDBA 1H5QA 3NX4A 5COBA 1UP6A 2AQHA 1EE2A 1X7DA 3ZNOA 4IQ8A 1PGPA 4NG5A 4YT5A 5F5NA 4B3HA 3WR5A 4DQVA 2IYPA 4J16A 2AQIA 2JL1A 4R3WA 2NLOA 3AOEA 3KRTA 4L8VA 3M2PA 2FPPA 5HM8A 5I7SA 4WE3A 2VN8A 1S6YA 4PLGA 4LRTB 3C8MA 1WNTA 4WOKA 2JD2A 4AJHA 3WWZA 2HUNA 4NU6A 5DDIP 2BGKA 2IZZA 3PI7A 3L4BA 1O8CA 1LBEA 4ND4A 3ITDA 1LC0A 1KBZA 1HDCA 2AXQA 1PGNA 3OIGA 3IKTA 3EGOA 4NIMA 5DBIA 5JAIA 4WNCA 3WQSB 4GX5A 1QORA 3OQ1A 1OC2A 3UCEA 3LZ6A 1FDUA 1T24A 1ZCJA 3RROA 3EUWA 4EJ0A 5AQ1A 4MPDA 4L0QA 1B2LA 2RBEA 4GSKA 1SAYA 4UVEA 2IODA 1V35A 4I5EA 1GU7A 2J3JA 2H63A 4R1UA 3DAFA 1A4IA 1WDLA 3OMLA 2GASA 3RAJA 4EJ6A 1M67A 4B8WA 3GZNB 2YQ5A 3Q3CA 4IDAA 4Q39A 2Q49A 4OKNA 2F00A 1KY5A 7ADHA 1V3TA 3C1TA 2I5PO 4IDEA 2QG4A 1IYZA 2J5QA 4NFHA 5EESA 3T4XA 5EJ2A 4BO5A 4CUJA 5CAEA 2E82A 2DC1A 1GQ2A 3ZHYA 3VZRA 1UJMA 4CMJA 1KVRA 2FHSA 3FSRA 2AQ8A 4DQUA 2AEMA 1C3VA 1PZHA 2OL4A 4B79A 1LDEA 2HCTA 3CSDA 5BSFA 3TL3A 3Q1LA 1U4OA 4OGWA 2VZ9A 1VJ0A 3L9XA 4PLWA 2B4TO 2VRBA 3KYBA 4RF5A 1U9JA 3RIHA 4YJHA 1NVGA 1PL8A 5IZCA 3UCFA 1KY4A 1T2AA 1O95A 2HK7A 4O59O 3EVTA 4NK4A 4PG4A 1DJNA 2D5CA 3GGOA 1HETA 4Q3AA 2VNAA 1TXGA 4G81A 3I5MA 1OBFO 3BMNA 2C07A 3L6EA 1XDWA 3HNPA 2CDBA 2O3SA 3QP9A 4OAQA 4XJTA 3E82A 1DC6A 1B26A 2HMUA 4Z9YA 1E3IA 3H5NA 3ZWOA 4CMEA 2Q46A 2AQKA 4N5NA 1E6WA 2GN4A 4HFNA 2NQTA 1ISJA 2AG5A 2BFPA 2QYTA 4BNHA 2WE8A 2NU8A 2AMFA 4ROSA 4CM8B 1LDMA 1NM5A 1PS9A 3FBTA 3IS3A 2EP5A 3JD0A 3STHA 1X0VA 1I01A 4GWKA 4G65A 1JAYA 3GGGA 3OQBA 1BXKA 4CQLB 3EYWA 4QQRA 3NT5A 2NVUA 2GZ3A 2CZCA 5BNTA 1HLDA 5JMWA 1KEVA 1W73A 2J3HA 4QECA 2QIOA 2C0CA 5IXYA 1Q0QA 3NTOA 4L4SA 4WUVA 3GT0A 3G3EA 3VTFA 2GDZA 4IXTA 1QYVA 2VZ0A 4FJ0A 4GVXA 3JV7A 1UXHA 4MKZA 1W8DA 1K2WA 2BGLA 2HJSA 3QSGA 3GVHA 4ILKA 5ENDA 3GAFA 3DZBA 1KYQA 4PG6A 4GGPA 3PEFA 4AJNA 4FGWA 4FCCA 5JAZA 5AVOA 1BXZA 5EERA 1ENPA 5G0UA 4IDBA 4J0FA 4JQCA 5JAQA 1EDOA 2I9PA 1YJQA 1HYGA 2JCVA 3AFMA 3OQ6A 3KYDA 4OQZA 4R1TA 3RQSA 2GN6A 4FSHA 2DTXA 4GH5A 2VRCD 2NADA 3NDIA 1JWBB 1YJ8A 4CMBA 4BNIA 4CUKA 3ROMA 3RFVA 3ZWMA 1PZFA 3F4LA 3ITKA 3VH3A 4ZJUA 4BO4A 2R6JA 5C7IO 5F1PA 3JQEA 1C1DA 4FC6A 4RJTA 5A5EA 2H9IA 4Y98A 4MP8A 1YH3A 1U3VA 3DO5A 3MJVA 4J49A 1QR6A 3SVTA 3TSCA 4D46A 3MEQA 2HAEA 4BNKA 1LSOA 2I76A 2JCYA 5JFOA 3I6IA 3D3WA 3KETA 4B7XA 1N2SA 5IN5A 1VKNA 2VT2A 1A7AA 1E7SA 2E49A 4M49A 3PWZA 5JS6A 4GMFA 1RJWA 3PHGA 4FFPA 1Z7EA 4UUOA 1H9BA 2O3RA 1UDBA 4RV9A 3TFQA 2A92A 3S8MA 3V2HA 1MXFA 2Q50A 4IMPA 4CQMB 4E31A 1R0SA 4QXMA 1Y6JA 4OYRA 2VYNA 4TROA 4D45A 1HE4A 2YYYA 1K0UA 4RPLA 3KYCB 5FEUA 3PJFA 4TVOA 3PIIA 2Y0DA 3WTCA 2R00A 3JQDA 3Q0EA 4PZCA 4AJIA 1WZEA 3KB6A 1RYEA 4JNKA 1K6IA 1LX6A 1ONOA 3TOZA 4OIMA 5G4LA 3WYEA 2QW8A 5HA5A 1BWSA 2O3JA 2PA3A 3Q2KA 3ZU3A 3DZHA 1I2CA 3DFUA 4GX2A 4EUHA 2W2KB 3IIEA 4FC7A 1KVTA 1LJ8A 2JAHA 3RUHA 2ZATA 4BO3A 4YT4A 4YAGA 4JBIA 4OMUA 1Q0HA 2DFDA 2QRLA 1DRVA 4MJLA 2A9FA 1UAGA 2D1YA 3CUKA 3WSWA 5FI5A 3TJRA 1I3NA 4H16A 3H2SA 3F47A 4IZHA 5JCJD 4JLWA 3E48A 5DP2A 1SC6A 3W1VA 1R16A 5AXAA 5T5QA 3RJ9A 5CP8A 4BNGA 4EUFA 3QLJA 4DRYA 2EV9A 3AM4A 3GH3A 1R4MB 3NJ4A 4D43A 1W4ZA 1NR1A 4R54A 5A05A 1C1XA 4R16A 4LMPA 3JQFC 4HY3A 4BNYA 2HMSA 2WDZA 4F6CA 2GO1A 3E9MA 4HV4A 4NK5A 2PD3A 4G5HA 1GQQA 3AI1A 1Y8QB 1HSOA 4NH4A 1U2DA 3MZ0A 3GRKA 3RUIA 4BQPA 5KJCA 2FY8A 3H5AA 1MV8A 1DIAA 5DBFA 1J5PA 2X7HA 3DBRB 4MVJE 3KSDO 1RWBA 3PYLA 5B4UA 4FPXA 1X7GA 3D64A 1HDZA 1T2CA 4EW6A 3DHEA 4WLFA 5ITVA 4FFOA 4R1SA 1GEEA 1ZKMA 4D3FA 2DBRA 1PJSA 4BUCA 4CM3A 4CM5A 4CV3A 3SX2A 4EYEA 5EL0A 4OOFA 1ZMOA 5I9LA 4NZ9A 2O4UX 3ZZNA 2JFHA 1I2BA 4E12A 3BMCB 3PIDA 4J7CA 5FI3A 4N5MA 4FOSA 2V6GA 4CMAA 4U0JA 3HQ4O 2DBZA 3V1YA 2Q99A 3GY0A 4IJKA 3KVOA 4F46A 1PJLA 4I8XA 2X9NA 2PKQO 4L4RA 4PVCA 4D44A 2HLPA 5EPOA 1J4AA 2Q45A 4E2WA 1UP4A 4KTVE 3NDJA 1YBVA 4LCJA 2E48A 2PGJA 4HXYA 4BO7A 1LDBA 4KQXA 2BGMA 4EUEA 3RU9A 3PRJA 2QQ5A 4P22A 4DPKA 2CNBA 4LGVA 4E30A 1EEHA 1AGNA 3F9IA 4J7XA 1SBYA 1DSSG 5H83A 3O8QA 2P91A 4DC1A 4E6PA 3NGLA 3KSUA 1AE1A 1VPDA 2CDCA 3CMMA 3ONDA 3PLRA 3U4DA 4B4VA 3E18A 1BHSA 1JA9A 3GPDG 4MVJP 4DA9A 4XR9A 3DQPA 1DC3A 1I2ZA 2YFQA 3GQVA 3K73O 1K3TA 2OBNA 5GZ6A 3PJGA 4XKJA 1EVIA 4CLHA 1B3RA 1JKJA 2XPCA 4GLOA 3GMDA 1I30A 4G2NA 2PY6A 4M87A 4DREA 2UDPA 4E2YA 2X4GA 1U5AA 4WEOA 3RD5A 1E92A 1FK8A 3H2ZA 4OXKA 3Q6IA 2C59A 4PLTA 1IZ9A 1QYDA 1YQDA 1ZFNA 3JCZA 4MKRA 4PIVA 5KJEA 4B3JA 2G17A 1EVYA 3ZHBA 3FN4A 4EEXA 1NVTA 3VH1A 4ZHSA 2NACA 3DTYA 4YTEA 2A4KA 1IZ0A 3JQ6A 5DULA 1GPDG 3BTVA 4I5DA 3PZBA 4XIYA 1E6UA 2VHZA 1P31A 3IC5A 1A71A 4CM4B 1DFGA 2RIRA 1T26A 4UVGA 3DOJA 2EW2A 4HADA 4BS9A 3I9KA 1B7GO 1GYPA 1E1LA 2NQ8A 4TQGA 1G0NA 5JE8A 3UH1A 4YT2A 1E3JA 4TZTA 1YO6A 5TSDA 4YQZA 4I5GA 1X15A 3DZJA 4W6ZA 4WCFB 1WMAA 1E77A 4Q3NA 4TKMA 4P4LA 5A06A 2VTEA 2D8AA 4PVDA 4OHUA 4MIYA 4YRAA 2BELA 4EDFA 1ARZA 3WGGA 3WGOA 2WD7B 4N5LA 3JQ8A 1Z7BA 4AL4A 2HMTA 3PVZA 4JP2A 3DR3A 1PWZA 3JYLA 2BLLA 4E13A 3UW3A 2YDXA 2Y66A 4KUEA 2DU8A 1LNQA 5A04A 4YPOA 1QSGA 4BNZA 2A94A 4IDCA 4MVJF 1I8TA 2V6FA 2P5YA 1ISHA 3JYNA 2HJRA 3WX0A 4LW8A 2CY0A 5L45A 5AYVA 2DKNA 2ZYAA 1N1EA 1WP4A 5JSFA 2P9EA 1PJ4A 1Y9EA 4F45A 1ZZEA 4DIBA 5KWEA 4BNVA 1HZJA 4QUKA 1PJBA 3IDSA 1N7GA 3C7AA 1U2GA 4IPTA 2C2YA 2WTBA 4BVAA 2Y1EA 1UDCA 2X0RA 4WPGA 4D79A 3C3XA 3DONA 1WZIA 4KWIA 2TMGA 3EDMA 4P4GA 2CVZA 3ZWWA 4DMLA 2HK8A 4J4BA 3OIDA 1BDBA 4YYZA 1EK5A 5I8ZA 2PKRA 2OHXA 1JN0A 2VRCA 1CETA 2VWGA 1N7HA 5EN4A 4B4OA 2D0IA 5AXCA 2BFOA 4IZIA 3NDRA 2FOIA 3H5RA 1EVJA 2GGSA 3RI3A 3K2EA 4PLZA 1I32A 5JLAA 2BMAA 3H3JA 1QYCA 2VUSA 4UUMA 3TN7A 4IINA 4BGUA 3V2GA 1EZ4A 1OAAA 3A9WA 1SEPA 3DBHB 2Z5LA 4J43A 4Y9DA 1XU9A 3RWBA 4PLPA 2BI8A 3C1OA 3W6ZA 4QFCA 1E7YA 2XOXA 4K6CA 3G0OA 4F3YA 3GPIA 3QW2A 1P1JA 2DLDA 1D3AA 1F17A 3OBBA 1PJ3A 1LU9A 2DUUA 3AOGA 2PLAA 1IY8A 4J2OA 4Y6RA 3DB2A 3VPGA 3DTTA 4C7KA 2VZ8A 3GGPA 3G79A 5A3JA 3SJ7A 1KVUA 4J9UE 4R4JA 4WOJA 4BO0A 1NPTO 4GKVA 3KO8A 1ZW1A 1E1NA 2A35A 1XELA 2O2YA 3GC6A 1T2FA 3BIOA 2FSSA 4I5FA 4Z3DA 1EK6A 4U5QA 4OSPA 4AICA 4YDRA 3UF0A 2V6MA 2B5WA 3RSHA 4CV1A 3RVDA 3WGQA 3W8EA 2RHCA 4NMHA 1ZMTA 2VCYA 2Y1DA 4AJ2A 4DLLA 4F6LA 4UEJA 4YAEA 1ZK2A 3R3SA 5JDCC 3LYLA 1I36A 3V1UA 5CDUA 4QX6A 4U6QA 3VTZA 1LDYA 2EXXA 1WPQA 1NWHA 3W4JA 1E0DA 3JYPA 5G0SA 4Q3DA 3DL2A 3LQFA 3R3JA 4CMKA 2BD0A 4W7IA 2EIHA 1R4NB 2BFMA 2D5AA 1K6XA 3QA9A 3SXPA 3RUAA 3GRPA 4QSMA 3H9JA 4RVDA 5K6AC 2GN8A 2EF1A 1R0KA 3I3OA 3I9OA 1R37A 2YV3A 1YB4A 4ZQBA 5CDYA 1O9BA 1ZVMA 1L1FA 5JCJA 4Q3BA 3FD8A 3ZNNA 4A27A 5IFLA 1VJTA 3OJFA 3A4VA 2JD1A 2I65A 4TZKA 3L6OO 1ZJYA 2Z1MA 1PS0A 5L9AA 2HMVA 3I83A 5CDTA 2NM0A 1NQAO 3KXDA 4NJMA 5G2OA 4ALMA 3VAZA 5A03A 3ICPA 3PGJA 4WASA 3BTOA 1D7OA 3WQRA 2C7GA 4R3NA 3UXYA 3JQBC 4RLSA 3V1TC 3QWBA 4UEOA 3ON5A 3ASUA 3FHLA 2Q2QA 3GF4A 1PL6A 1RM5A 1VI2A 3EW7A 4P38A 1VSVA 4GAEA 1O0SA 1C14A 5G4KA 4UUPA 2G82A 1JU9A 5LC1A 4PG5A 4E0BA 2P2SA 5LDGA 8LDHA 2I66A 4GBJA 2PGLA 1NHWA 2P9CA 3D1LA 3TFOA 4D3SA 4ZICA 1NQOA 4NDNE 3VC7A 4O0LA 1ORRA 1MFZA 4NR0A 4WECA 1TI7A 3I9JA 3ZH2A 4TSKA 1BSVA 3KUXA 2VWHA 4IDFA 4ND5A 4WEQA 1KIFA 2H5LA 3ENNA 3GOHA 3DOOA 1H93A 4NFYA 3HB5X 1TB4A 1U5CA 1XQ6A 2I3GA 4R41A 3KSZO 4E2ZA 1CDOA 1B0AA 5JPIA 2IDZA 2O7QA 2AE2A 1B14A 1WVGA 2DT5A 3CIFA 5KKAA 5C7LO 1NVMB 4FJ2A 1DIHA 3BA1A 3TRIA 2B35A 1DBVO 4ZQHA 3QY9A 1QKIA 5JW6A 4CMIA 1WW8A 1H6CA 2WMDA 4FIZA 1EBFA 2RH8A 1Q7GA 3JD1A 4E5MA 2W8ZA 2X0JA 3QVTA 4UULA 3JYOA 5TRTA 4CM9D 3WJAA 6ADHA 4EZBA 4QT0A 3LDHA 1JVSA 4MIOA 2BFAA 1TT5B 3DOCA 2VHXA 2AHRA 4R5HA 4X54A 5C7OO 1EFLA 3OA0A 4E5NA 3H9QA 4JBGA 1ISGA 4YB8A 1U8FO 4A2CA 3IL2A 4E33A 1P33A 4CLDA 3L4SO 4Z9FA 3RUFA 3QWHA 4AJ4A 2DTDA 3JQAD 4RQTA 1ZNQO 3BXXA 4ZU3A 1N1GA 4M1QA 5DBGA 2NV6A 1E3WA 4A7PA 3GNSA 5JYEA 3C1AA 1I3LA 2C5EA 4YJHB 3WSVA 2X1HA 3PZRA 3ZWAA 1T1RA 1DJQA 3HDQA 1PGOA 2GZ2A 5JO0A 1GYQA 1C0PA 4BNXA 3BMNB 1RPNA 3CPSA 3ANLA 4XQ9A 1F06A 1LXCA 4YJFA 3W4IA 2YY7A 7MDHA 1X1TA 2IZ1A 1MG5A 1V6AA 3I9NA 3GDOA 4NFSA 4CV2A 5TT1A 1CERA 2DPHA 3HHPA 3AW9A 3GDFA 5L51A 2Y0EA 2EWMA 2WYUA 3VZQA 3K96A 3QVXA 4E2XA 3SC6A 1XEAA 2TMDA 4XGIA 4WCDA 4ESOA 2CMDA 2FRDA 2Z95A 1PR3A 3E8XA 4CPDA 1FJHA 1SNYA 4I1IA 3GHHA 4J9VA 3JQ9C 4DUPA 3GEDA 4XRGA 3P19A 3UN1A 3KLMX 3ASVA 3RC2A 5L7WA 3EK2A 5GZ1A 3DBVO 1P1FA 2NVUB 1A7KA 1M76A 4PLFA 3UICA 2E37A 3CINA 3ENKA 2PD6A 1LLDA 3L9WA 2P68A 1MC5A 1TT7A 5ICSA 3CEAA 4D7AA 1UXJA 2ZCVA 1LRJA 1D1TA 1XKQA 2BF7A 2NWQA 4IDDA 1ONNA 4YQYA 5BNFA 4J1TA 5A9TA 4PRKA 3AM5A 5TJHA 4YJGB 4FB5A 3E9NA 3I4CA 3L77A 4DYVA 3U4IA 3LF1A 3DMTC 3QWIA 3PYMA 4MOWA 3QV1A 2G1UA 3O4RA 3JQFA 3Q11A 4PLHA 4EJMA 4UVIA 4RPHA 3KYDB 4S3MA 2ZB3A 4RF4A 2JHFA 4LVUA 1G1AA 2C54A 4BO8A 2EW8A 5DZSA 3ZGYA 2X0IA 2QRKA 1PZGA 1YL5A 4RGBA 3RASA 2X6TA 4PG8A 3F6YA 3ZV5A 2HU2A 2OP1A 2D2IA 1P1RA 4QTZA 4Z0TA 1ZUD1 2QZ9A 2HRZA 1DB3A 3VPSA 2WWRA 4JK3A 5ILGA 4P4NA 4B4WA 4HKTA 1AHHA 4YWJA 1UXKA 4LMRA 3RJ5A 5JBIA 5FF9A 5A9SA 1LRLA 4BO1A 3IP1A 5IDYA 4U7WA 2ZQYA 2PH5A 1T1SA 2PZLA 1I0ZA 3ULKA 3I1JA 1TVEA 3OH8A 1ULUA 4BOYA 3ROKA 2LDBA 5THKA 4MIEA 4IGEA 9LDTA 1LRKA 1NFFA 2GERA 1VL8A 5ES3A 1P9LA 5ENVA 1HF3A 4BNNA 3EC7A 3KZVA 1B8PA 4DYDA 1O94A 1GZ6A 4OSOA 4RDIA 1QMGA 3ZCXA 3UCXA 4DQXA 4J1NA 2PR2A 4GX1A 1BXGA 1TLTA 3WBFA 5A1TA 3RFXA 3F5SA 4CUZA 4XDZA 1P45A 2B4QA 3OECA 3PQEA 4NU5A 1JKIA 2YUTA 4B4UA 3VKVA 4MO2A 1IOLA 2C5AA 4D0SA 1GPJA 4JJGA 1E5LA 1HYHA 1GD1O 3P2YA 4CODB 4ZGWA 2H1SA 1T2DA 1WWKA 4W7HA 4WK6A 5JMPA 2NVWA 4ZQFA 3W8DA 1SO8A 4B8ZA 3E5MA 1P1IA 2O3QA 2QRJA 4XIJA 3DZIA 4BHTA 3MWEB 4NHEA 2YDYA 1A4UA 4II2A 3ROPA 2QHXA 1GV0A 4TRMA 2ZTVA 3LLVA 1DFHA 4PCVA 4S1VA 5A4DA 1IPFA 1NX6A 3VDRA 2G76A 3GVIA 4IJWA 2Q1TA 1WMBA 3DZFA 3U9LA 3QVWA 2D3TA 2FPGA 5L53A 5DCYA 2B83A 3CXRA 5TNXA 3SLKA 3LC1O 2ZQZA 4L74A 1FDSA 3AUSA 2EP7A 3WLFA 2GSDA 4CMCA 1C1XB 2HQ1A 2B36A 3FPLA 3GVCA 3INTA 1RM0A 2O50A 4I9HA 1DAPA 2IYOA 6LDHA 2HRBA 3U3XA 1A5ZA 1YL7A 2RHRA 4URFA 3TZCA 3JD4A 2PGDA 1GUYA 1N5DA 2NU9A 4XQEA 4E21A 2V7PA 3RUCA 4UUNA 2IEDA 1IHYA 2PTGA 4ID9A 3BMQA 5CHEA 3BMOA 1DEHA 3B1FA 4RPJA 2VOEA 3UHAA 4U6SA 2XF8A 3OEWA 3ZU4A 2ZJ1A 1M6WA 3ANNA 2X5OA 4HX5A 4FJ1A 4AJ1A 5TJ9A 3HUDA 5I7VA 4WJZA 1H0KA 2X0NA 1PWXA 2C82A 3LC7O 4GWGA 4UEKA 3U4CA 5GZ3A 4H7PA 1OC4A 2HSDA 4XZ3A 3GUCA 5AXDA 3DZGA 4NBTA 2PD4A 4FD3A 2X5KO 3QVOA 4GQAA 1P3DA 1RYDA 2Y1GA 3FCOA 3AI2A 4XCVA 4Q9NA 3W4KA 3WQQA 2DBQA 5CFZA 4J0EA 3KTDA 1ZSVA 2Q4BA 3O03A 4ZQGA 1ADCA 1H6DA 4YA6A 2GD1O 2YV1A 3HDHA 4L75A 4D42A 3D5TA 2CSUA 4E5PA 1L7DA 1FF9A 2CDAA 3DEYX 1B15A 4DXHA 4QFDA 3KEOA 4OOEA 4JIGA 3AK4A 3LC2O 1EE9A 3R1IA 4GGOA 3PQDA 4QEDA 1IE3A 4E32A 2I99A 1HDXA 3NKLA 5EINA 1E7WA 4K9DA 4BGIA 3MTGA 2FN7A 3ZW8A 3WGTA 3U49A 1EUCA 3O8QB 5T6BA 5ILOA 1VLLA 4TVBA 4EI2A 1TA4A 5KJFA 4CLRA 2D59A 1ZH8A 2EJVA 2CUKA 1U7TA 4KWHA 1T25A 4PRLA 2B4RO 4E5KA 3FNEA 4AFNA 5L40A 4BNMA 1W6UA 2W90A 1H9AA 2DAPA 2WJPA 2EG9A 3AM3A 3ZU5A 3A28A 1LEHA 2Q4EA 2VHVA 3DXFA 4CM9A 2O4CA 1NTOA 1OI7A 1PZEA 3G49A 4A73A 3B70A 3AY7A 3E03A 3ZV3A 1QYWA 3S2EA 3D4OA 3I52A 3NT4A 3LLSA 5U1PA 4FFNA 2PZKA 1PSDA 2YV2A 3JQAA 3WBBA 1ENZA 1XHLA 3SEFA 4LVCA 5B37A 1XG5A 5IZ4A 4ND2A 1PR9A 2QX7A 4DGSA 4M89A 3JQ7A 4ND3A 1ISIA 1E3LA 4CMHA 2EKPA 1KC1A 3PHLA 5JDIC 1JAXA 5KTKA 1CF2O 1ADFA 4YXFA 4RVUA 4Z3KA 3OJLA 4M86A 2AE1A 1M6HA 3LT2A 3ANMA 2PWZA 2NU6A 3AUUA 1YOVA 3Q9NA 1VM6A 4PLVA 2Q1UA 3GK3A 1LSSA 2DPGA 2Q2WA 4L76A 2ZTMA 3EHEA 4PZDA 1ID1A 4HP8A 3JQ8B 3Q9UA 3IQDB 3OP4A 2ZIZA 5JDCA 1N9GA 3PTZA 4B3IA 1DDOA 3OIFA 2Y67A 3KV3O 5C37A 3HJAA 3TZKA 1O5IA 1I3KA 1NYTA 4FW8A 5IDXA 5JAMA 4L9RA 4BKUA 2AG8A 3HSKA 2VWPA 4WGGA 1PU2A 4PG7A 4DBVO 4RDHA 2DVMA 3ZDFA 1GQYA 5BNIA 1CQJA 4Y8VA 3COSA 3OFSA 5K6AA 3H9UA 3CTMA 3K9QO 4OKIA 1PJ2A 3PQFA 2HO5A 3WMXA 3N74A 1HSZA 4FN4A 1PJQA 1UH5A 3HDYA 3V2UA 3VOSA 5BSEA 2GCGA 4XYBA 3RCBA 4ZD6A 3E6AA 5C3MA 2IXBA 1Y9AA 4XB1A 3QVSA 3RC9A 2AW5A 3RKRA 5F5LA 4B7CA 2C29D 1ULSA 1VE9A 3BHMA 3BHJA 2X9GA 4K28A 1ISFA 1K6JA 3FTPA 4JP3A 4A10A 2G0TA 1Z45A 2Q2VA 2VQ3A 2VOJA 1SMKA 5IG2A 2Y0CA 3ZWXA 3S2GA 5CPBA 2PK3A 4KOAA 1PQWA 1E1KA 4MVJD 1MFPA 3T7EA 1F0YA 5COAA 2PZJA 3WMWA 3P7MA 1UZMA 3FTNA 1ZXLA 3JQBA 5KVVA 1BW9A 1IULA 4TMFA 1ADGA 4Y6SA 1J49A 1MUUA 3E9QA 2EKQA 2FR8A 4R9RA 4HFJA 5TIIA 4YVFA 1XYGA 4U8GA 3NTQA 4OXNA 4FOOA 1PQPA 3S55A 3KM0A 1B8UA 2Q1SA 4W82A 5THQA 3NRCA 3FNHA 1ZBQA 1C0KA 1Y5MA 1AUPA 1BVRA 4KZPA 4AJPA 1YBAA 3LSYA 4J1QA 3S1LA 3ZV6A 4WLVA 2FP4A 3VH2A 3JQGA 3GN1A 5CEEA 5L7YA 4RORA 2JHGA 3MJTA 5T57A 3ZHZA 3MCVA 4DLAA 5TGDA 1HE2A 3WTBA 1Q7BA 4H3VA 2GLXA 4CMGA 5BQFA 3FR7A 1HEUA 1ZIDA 3IUPA 1CYDA 4LSMA 1UZLA 1HKUA 3PFFA 4EITA 3S2FA 3D3EA 1HT0A 3A06A 1ZK4A 4HFMA 1GUFA 5F3RA 4OM8A 3HDJA 3D0OA 3NYWA 3ZHXA 4UVHA 2ZTUA 2FMUA 3JD2A 4I9UA 1H6AA 4DBZA 4BGEA 3L07A 1Y8RA 2B69A 1DRUA 2WYVA 3GAZA 2VHYA 3WYCA 3F1LA 3CZRA 4DIOA 1X1EA 3TQHA 3B1JA 4DC0A 1PQUA 1ZK0A 4KMSA 4BKQA 3GG9A 1EBUA 2F1KA 3ZNQA 3DBHA 3I9LA 4PN3A 1HRDA 3VZPA 5CPFA 1ENOA 1GZ3A 4HNGA 1ZK1A 1V3UA 1GV1A 3OF2A 1M75A 2ZCUA 2JD0A 4CQMD 4YCAA 5TLSA 5DT9A 1HE5A 3TZHA 3LT0A 1Q2XA 3D4NA 4L4XA 4FFRA 4ND1A 1EDZA 4MP3A 5L4SA 4Z0HO 3RFTA 1DC4A 3GDGA 4ALJA 3INGA 4MP6A 5BT9A 4BMNA 1N92A 1PJCA 3GA0A 4NNJA 1BDMA 1YGYA 2YHIA 3OJOA 4NJMB 3PGXA 4U0KA 4CLOA 2Y1FA 4RVFA 4XQGA 3OEYA 5L7TA 4JJIA 4IQGA 1V0JA 3JQ9A 4NQZA 1PGQA 2ZB4A 1P0FA 4GMGA 3SJUA 5BR7A 4M54A 5I9NA 3MTJA 5TQVA 3DBLB 1R6DA 3ETDA 2X22A 1Z82A 4R5MA 5G4KB 2OZPA 4BKPA 1QXSA 4TRRA 3DAGA 5U9CA 3AUAA 4WCFC 3F1KA 4DLBA 2GRAA 1S7CA 1GCUA 4C7JA 1PS8A 3UVEA 3K8ZA 1IB6A 3QWAA 3OICA 4JN6B 2G5CA 3RUEA 5I9MA
chains in the Genus database with same CATH superfamily
1G7TA 4IH1A 2EHDA 1IG0A 1R6VA 3WYAA 2K4MA 5DU2A 3TZQA 4IJVA 3P96A 4TTSA 4EQ6A 3L8YA 2FW0A 4DL9A 2F1HA 1G63A 2J85A 2CNWA 3GPBA 3I23A 4EO7A 4YUYA 5F7OA 2HJHA 2V96A 4KJXA 4LCEA 4KAXA 3MCUA 3CRW1 3L0ZA 4OHMA 4UW9A 1OV6A 1PT9A 5LXTB 3WL6A 3SBOA 3HBLA 3SQWA 3O2SB 1NPYA 3KB8A 3DAPA 1KYZA 4BNFA 4BEJA 3IO3A 4IDHA 2C5BA 2J3KA 4E11A 1KVQA 1ZAYA 3RDPA 5I45A 1VKOA 1D03A 4Y2YA 5KVCA 2BVNA 1HE3A 1WF3A 5CDGA 4ONEA 3IE2A 1NNI1 4N5IX 4OHFA 3L0DA 4BMSA 2X5JO 3WO0A 4BLTA 5KDDA 1PT6A 1Z4LA 2Q5QA 1SQ6A 3FVWA 4NBWA 3SYNA 1XKLA 3VA7A 3A1NA 1E2NA 1G8FA 3GFFA 4L78A 5AOBA 3RHZA 4EHAA 2W6JA 2GZ1A 5BO5A 3B6ZA 3GG2A 4CVNA 5AVVA 2XTAA 3JW8A 5JYBA 1VP3A 3A2LA 3SFVA 5CCDA 1UXGA 5JXWA 1VFPA 2FCRA 3O21A 4MVJI 4QOJA 5JOQA 3OTWA 2PS0A 1YA4A 2MYTA 3OHSX 1ZEMA 1WCYA 1P81A 1PR6A 4J7UA 4E4RA 2JFGA 4PFQA 4WKCA 1X1DA 1SBHA 2PGOA 3G9UA 3UK7A 4ZCMA 3ZLAA 1CRWG 1VMIA 4HEA1 1GGNA 3OJEA 5G0WA 1CR6A 3M3PA 3NH9A 4KNVA 2FSVC 3VPHA 4B6QA 3BDIA 3WGJA 2O5CA 1H2EA 5BQ5A 2GR9A 2NPIA 4B44A 4DR6B 1OASA 4W9NC 3G7UA 5UKDA 3HXOA 4F71A 1UC9A 3RBVA 3U7GA 5CX1A 4GYKA 5DYGA 4PC1A 1GZHB 2AGVA 2B37A 4MVYA 1MHPA 1B3BA 1NQ5A 2Q6KA 2Y92A 3GLGA 5F76A 4LOAA 4BAZA 3N6VA 5P8WA 1V1RB 1KIAA 1DAGA 1GQSA 1APBA 5FPTA 2VNSA 1VJDA 4EHDA 3W3ZB 3PFWO 3QWFA 5JJBA 1T2VA 4BO6A 2N75A 1TCVA 3P0HA 2D0DA 2PMBA 3PDUA 4QE3A 3QX3A 4LXGA 1LJUA 4UHEA 2YMLA 4ISCA 3WK4A 1P9OA 1RHJA 5I8PA 2JIBA 1RBQA 4B2PA 3NHFA 1ZK3A 5J23A 1HFKA 4KUHA 1JA1A 1ATZA 2UZIR 2GK6A 4WBSA 4BASA 2I0FA 4Y1EA 3UFBA 4UNSA 5AK6A 4GO1A 3FWKA 1QTIA 1YXMA 3RHFA 2UVPA 4PQFA 2OCAA 4HQRA 1KA9H 2GFIA 3H6KA 4LAFA 4UNNA 4HNAA 4D0LB 5LB4A 3GPLA 5FCDA 4GKJB 4EGFA 3USZA 1FW6A 4DCVA 5K9ZA 1XRQA 1QTQA 1DHRA 1KHHA 1QV7A 1TT5A 2A7QA 3FUTA 1YDWA 4GOMD 3ZWNA 5CA0F 2ET6A 4LPSA 4ENSA 4FHGA 2LKCA 2QUAA 4NBKA 3TYXA 1BD4A 1KH1A 4UQPA 4MDYA 1X1SA 3O3OB 1Y82A 5KJ6A 2OKCA 4QJ4A 4DCSA 4QDUA 3L0SA 1CIVA 3P4YA 2I3AA 4YCNA 1VIDA 3OZTA 1EFVA 1ZOLA 5F73A 4UBOA 1ZO8A 2G5GX 3DTVD 3IYLW 3NPAA 2QLLA 3MT8A 4HEA6 4LNHA 4XRRA 1QHHB 1C7JA 4S12A 1HNWB 3TINA 5IJWA 4OMCA 4ZRDA 3GN2A 3BZUA 3OIWA 3MLAA 5IC5A 2IH2A 1LF5A 4ZAGA 5AHRA 1WB6A 2ISSD 4O02B 5LQAA 3ETCA 4KHPB 4S1PA 3KLPX 4BNLA 1CUJA 3AL2A 3RAGA 1ZRSA 2PZMA 1DO2A 5FUQA 5K3BA 3QKIA 1HLPA 2BRUC 3JTEA 4LBVA 3H11B 4DCPA 3KQKA 1OFUA 1QQ7A 2NO1A 1M6YA 4LEIA 4F3KA 4MQ6A 1EFRA 2XGOA 3EDRA 4Y2PA 3D8UA 1QK5A 4MMZB 5BW8A 1EDBA 2ASVA 5IJXA 4IHKA 5I3CA 3H8WA 4QDKA 2XXAB 1YDHA 3GJQA 5B4TA 4FB4A 2WYWA 1U1DA 5AKHA 1FZQA 3U62A 4DLXA 3AT1A 2QVXX 5TX7A 1NR5A 5A9SB 5AHKA 3YASA 2J41A 1OR8A 4DGQA 3WGIA 4Z6KA 3QUCA 4J4TA 1EGVB 1ZCBA 5FPHA 5AUPB 1V6SA 1Z35A 3JVEA 3MILA 5DI3B 3MT7A 4CM8A 3S0JA 1U9IC 1ZINA 2ORWA 4PSDA 4URHA 3RJTA 3QHPA 5CG1A 2BTEA 4WLOA 5TVGA 2XWSA 3C3WA 2JIMA 5IN4A 3U1TA 2DWQA 4A9AA 4CQLA 4KDFA 3TNLA 1UZUA 1WMFA 1Y6QA 1ZIYA 4TXHA 1W93A 4RVGA 3WXBA 3VO8A 2NUAA 1J6UA 3K9WA 2JLVA 2H1VA 4OQQA 4UNPA 2FSHA 2W98A 4M83A 1LSJA 4ZCSA 4H9GA 5TS2A 4A2QA 4PSKA 3GZ4A 2WU1A 3D3WB 1SD5A 3NAQA 4FBGA 4NBRA 5EGSA 2NTEA 3UV3A 1MW8X 3EXFA 4IQFA 1THMA 2IUSA 5LSAA 5INTA 4KDEA 1NNUA 1BA3A 4R0MA 5A4IS 1ZAKA 1EVKA 1JAHA 1LTHR 3DKVA 1U99A 2Q3CA 1GA1A 3PCXA 1U28A 2CF6A 1DL5A 2HU7A 3QQPA 5J63A 3BQ9A 1JDPA 3NT2A 4EYSA 5L4LA 4WLUA 3HN7A 2OLKA 1DOHA 1KARA 1OFIA 1O9GA 5GVRA 3RR2A 3TXYA 3I8OA 4P86A 1Y7LA 4YO8A 1C0IA 4HB3A 3NOOA 4I9GA 1VI5A 4KV7A 3VNBA 2O1EA 1FNMA 2P4QA 2G77B 1OZAA 1T8PA 5BWLA 2E5FA 2YUIA 4FWIB 4MCAA 3FWNA 4KAFA 4PSVA 2VUUA 5GJBA 1VLJA 1S2IA 1X7HA 2CFCA 2V6BA 2W4MA 1XZIA 3PHHA 4HH3C 4PHFA 3H4VA 1PLJA 3IBFA 1P19A 2VWQA 5KYYB 1TPZA 1AKYA 2FPOA 3DOEA 4JX9A 3A6EA 3D5QA 3UWKA 4CLEA 4JNGA 3H8VA 3L06A 4A5OA 4WZBE 1Y1QA 1DRWA 2HHJA 5DWDA 1DKNA 4N0DA 2EGUA 3ABOB 5IDWA 4DQDA 4CN8A 2GUWA 1G3UA 4DPLA 3C7KA 1GPWB 1LPBB 3IX7A 1QO0A 1OAOA 2L69A 5G0VA 4YY3B 1NF9A 3AF3A 5AKJA 2YXLA 4LMAA 3K1JA 3JPYA 1FDVA 3QYAA 1YONA 1UZAA 4UPVA 4D4MA 5A5FA 5C81A 4BFSA 1P44A 5FWAA 3IV6A 3SX4A 2EZ4A 3H65A 1ENYA 2DKFA 3HH8A 2Q3EA 3M81A 5FLYA 1ZOPA 5BYBA 2OYCA 1ANKA 4XLLA 4UZSA 4M9SA 4CWAA 2GHRA 3BAZA 4FMCB 3GEGA 3GUUA 3QXSA 4O29A 3HO8A 4AKGA 1OHHA 4IXWA 3N8KA 3QRWA 4PYKA 1EQ2A 3TNDA 3WOHA 2HEIA 3K30A 2R79A 4ARSA 2JVIA 5LBUA 1SVUA 5K2MA 3Q5GA 1ZSYA 3ESDA 4JEHA 5IJ9A 3QF4B 2CCJA 3OETA 1Z06A 1REQA 2B25A 2QP3A 2ZSJA 5KSOA 3IT0A 2WJVA 1IXYA 3FSGA 1WZ2A 1RT9A 2G80A 1XP5A 2RCNA 2NU9B 2XUFA 3TRKA 5C1OA 2BGTA 4PLYA 3KVNA 1C81A 5A3SA 5CEJA 4HK4A 3SF8A 1XROA 2AFIE 4YMUA 1DUSA 2CHEA 4G5OA 3KQUA 2PG3A 3T7CA 4AJ9A 4MI6A 5FYDA 5DHUA 4G89A 2ADMA 1JKFA 3KYCA 4JJFA 4CF4A 4DV5B 2PZBA 4M1OA 2CK3D 3GMIA 3P9PA 4V0ME 2Z4RA 2BHSA 1NLMA 4BN4A 3RNLA 1W2HA 3MGBA 2QMUA 3SSMA 2XW6A 3UGTA 1WD7A 4MVJH 5K8TA 4MINA 1NY6A 3U44A 1NXSA 1PSWA 5DM2A 5I5EA 1EFTA 3DWIA 3D9QX 3DAYA 4G1CA 4O4LA 4AIRA 3U5TA 4M8SA 3TJZA 3TQRA 1UT6A 4N3AA 1KDOA 1WHTB 5ESRA 1MB4A 1UIRA 2Q28A 4Z4FA 1Y48E 2WJ3A 1DXYA 3I01M 5C4IA 4GF5A 2REQB 4QPJC 3E8SA 1P9NA 1J0AA 3REQB 4OH1A 5DSTA 3O38A 3LM8A 2HNBA 4MK4A 1NR7A 1R64A 2XF2A 3L6RA 3FPKA 3ZHOA 2P4EA 3AESA 3UQZA 4GXRA 2VF4X 2QB5A 3FNQA 2QI9C 2WM3A 5C5IA 5E8JA 1VMEA 2OO5A 2Y1CA 1XVLA 5DNVA 3RRFA 5IH7A 1ZBDA 3GLIA 5SZIA 1MTZA 3NVMB 1CR0A 5E3HA 3ZCSA 1PWYE 1IXKA 2I2BA 2I4OA 4ESEA 3K31A 2RH5A 5JSYA 4MQ4A 4EA9A 4YAIA 1EYZA 2D1RA 2E2WA 2F43B 3CUUA 5IASA 4ZKDA 2QRHA 2VJDA 1HL3A 4MVCA 4PY2A 4E14A 1S01A 1SG0A 1A72A 1XMSA 2OBYA 4ZRMA 5KWIA 1KS9A 4TLMB 1JDUA 3U3OA 4GOLD 1T4BA 1NFQA 2IHJA 4FOLA 5IMBA 1E1MA 4QNMA 4UPEA 1EAYA 1NF2A 1X1RA 1U0TA 2H5IA 3GJXC 4HLQB 4QHSA 2VYCA 4LFAB 3T3PB 4QRHA 1JLSA 1U7ZA 1YE3A 3VNRA 2G40A 2QUBA 3EXIB 3LLMA 4IHJA 1FLNA 4UC0A 4UHJA 1U7HA 3WLEA 3AUTA 2OCPA 3K16A 1IY0A 3VHXB 3WGLA 1TEHA 2WJJA 1E5XA 1RFGE 4M60A 3AO0B 3NBYC 1Y7TA 1RJ9B 1YCDA 3QVGA 4DJEC 1L4HA 2XXBA 4YWHA 3NOXA 5A3VA 2H16A 1IBLB 1YDMA 1MX5A 1ISMA 2ZOSA 4JYBA 5G41A 1GDHA 3MSXA 4ZN6A 1XK6A 4OSEA 5I4BA 3AVYA 3EOZA 2YS7A 3LOPA 4UCQA 3K4PA 1V3VA 2CCGA 2V7QA 3NIFB 1XEWY 4B85A 2FZEA 3VJMA 1AMNA 4M53A 4RWZA 2HSWA 3TR6A 4NE7A 2ZAGA 1Y4UA 3WXMA 3ZY6A 3NXSA 1GCOA 1Z26A 3IAM1 1HT3A 2FK8A 3K2BA 5IUKC 3WWYA 1FDWA 4NCNA 4AUNA 1U1IA 1X7WB 4LBZA 2BI7A 1XE3A 2F67A 4M1WA 3TDMA 4DSOA 4AQDA 1V8BA 1DTWB 3GARA 4O1MA 1VJGA 2RKBA 4QUJA 1GZVA 1GAEO 4XD2A 1H4SA 3D8NA 1PHRA 3PQCA 4Q4HA 4BVLA 1QTRA 1JVBA 1QCYA 1S8NA 4FDTA 1G55A 3GNQA 4N41A 2B8EA 5A4AA 4G5YA 1TGVA 4Q3CA 4YV0A 2WWFA 4WQMA 1Y3IA 3LXXA 4XPIB 3LUHA 1QYXA 3EG9A 4Y2XA 2XGGA 1OKKD 5KNLA 1UBSB 2PUGA 1XF1A 3JARB 4OP3A 3MGCA 3F6RA 3KZNA 3FOZA 4AY6A 1MP0A 3UMGA 1PJTA 2YN2A 5CDFA 3GNTA 1IHDA 2BMVA 4HNHA 1Q14A 3H04A 5LQKA 3M6VA 4P83A 3MWDB 3IOEA 4JLJA 1RYFA 2ZKIA 4JD5A 4GECA 4DRXB 4DTIA 2J5RA 3KS9A 4FGLA 3IP3A 4LI0A 3UUWA 2WFLA 1YL6A 4NYMR 1QO7A 1YIOA 2IYZA 4DV7B 1YJBA 2YFKA 3TW0A 5CLQA 4NCXA 4LF7B 4I3FA 3H3FA 1TC2A 1VSUA 1W0JA 2QZJA 1NN3A 1NI4B 1U3DA 2BFEB 2P9JA 4NJEA 2MYPA 5KOJB 3HRIA 3FB1A 4OI4A 1MX3A 1DUIA 4TKLA 2FRXA 3ZV4A 1CX9B 3L8CA 1U6KA 2WA1A 1A9YA 3W78A 2Y93A 4RSMA 3K53A 1IY1A 1TCAA 2ZZMA 1AA9A 4X60A 1VHWA 1SOWA 1MVLA 2C20A 4IOMA 2IZ6A 1NXVA 4A03A 3IHTA 2HMWA 4HI0E 5FWYA 1EHYA 5I7UA 1OBOA 2GBCA 2AJBA 1J2TA 4NZZA 1RRMA 1RPAA 1FU4A 4MW0A 4P33A 2AOUB 2NXJA 3MOSA 4JLOA 3P20A 4WXHA 4YRTA 3RVSA 4EY6A 1CZNA 3L7MA 4ZVVA 2HPAA 2W4QA 4BKRA 2IYWA 3Q6MA 3ZGVA 4BVKA 1CUHA 5LCXA 1EK0A 5ALJA 3IIJA 3GNLA 1KETA 3BIFA 4UFPA 3TDNA 4P0TA 3DUFA 3H9EO 4MITA 4CV0A 1MR3F 2INGX 5I9TA 4P8RA 1RI3A 2GNPA 4YT8A 1MBZA 3OD5A 1M10A 3L7NA 3OJCA 2R8XA 1XZQA 2UZ1A 2O48X 3DTNA 4DMMA 4TUYF 4NEQA 3SKYA 1RKVA 3MMZA 4OQYA 4U7DA 3SXJA 2GYYA 4YLGA 5DM4A 4BNDB 4W99A 1YFLA 2CHVA 4ZCTA 1EMDA 4WCFA 2D2FA 2VT7A 2NU7A 3I2IA 1GUZA 2EHJA 3ELYA 2J45A 1UP7A 1CKEA 2WSBA 3KPVA 4S1TA 3N8DA 1JA0A 4TV9A 3VXKA 3IPAA 3ZWYA 2WD7A 2FOLA 1N9ZA 2GESA 5HM6A 1ZH6A 4PXSA 3FBGA 4Q9DA 4NZPA 3MTQA 3BFPA 3HUUA 1NW3A 1BRTA 1LFAA 3ND9A 4LY6A 2HXSA 1Y5NA 3MJEA 2ZVDA 5KQPA 5BR4A 2F3QA 4H6WA 4YCJA 3ITNA 4BNJA 1XP8A 3L2OB 3W0LB 2N1BA 4W5TA 4WKGA 4BZZA 3G88A 3GJ4A 4LKRA 1ML3A 3TZBA 1YS4A 2QMZA 1NA5A 1RAIA 3DLTA 3V4FA 1ODLA 3T5BA 3K1AB 2EVWX 3HGTA 5E0KB 1R5NA 3L7OA 4HAIA 3ABIA 2FMIA 1QGDA 4AWXA 5IJZA 3AMVA 4I4TF 2R65A 2WC1A 1DVRA 5CLIA 3OEHD 1T8YA 1W0CA 4AVYA 3C7TA 3VR5D 4MKXA 4Q4LA 2PUFA 1R8JA 1BO6A 1ZD4A 2XEDA 1WE2A 1F60A 1P4JA 2PH3A 1YQEA 1HGXA 2J46A 4FZ3A 5F9FA 4IUYA 2OA0A 1YMQA 5FWXA 3RSGA 4LHYA 5REQB 4MHOA 5F7ZA 2QTRA 4B33A 3U60B 1TX4B 1WF6A 3B6KA 4B71A 4BJHB 4QG3A 5H4GA 1KC3A 5KMGB 4IDGA 3I05A 4PZ0A 2ZR7A 4RTSA 1E2JA 1QS0A 2H0RA 2VS1A 5BMVB 1LSUA 4MLDA 3SJCA 4AJJA 4IOKA 2BUBA 1KP9A 2A14A 1AHIA 4GR5A 4NOJA 1AUVA 3IURA 1BGVA 3BJMA 1E7RA 1NT4A 5KREA 4XGKA 1K5DA 2QR3A 2GAAA 2YWDA 3DWFA 3JD3A 4IFBA 4JWKA 4D2IA 4ZOBA 3I72A 5B1HA 5L3QA 3H0KA 2WTAA 1GY8A 1QIIA 4MUGA 5LP6A 1YI1A 3L40A 2NX2A 1WXHA 4IFIA 4NE9A 2VF8A 3B1VA 1E6LA 3I5UA 1TYCA 4Q7JB 4URZR 2JGDA 3F3KA 5DGHA 2BM8A 4FZVA 2EC5A 1P8JA 2H2AA 2IE8A 1JDBB 2Q8QA 1QDUA 4BFWA 2WTXA 4PN7A 2DUWA 3TPCA 2ENWA 1DLIA 2ORYA 4D5EA 2EGGA 1HTTA 1RACA 2OOSA 1P72A 2WMNB 3O8DA 4I50B 2J9YB 5J5CA 4BKOA 1V5FA 3A6ZA 4ZT6A 2GI4A 2I67A 1SEVA 1RKXA 2EP8A 4FMDB 3IMFA 1XIVA 1EUZA 1T2EA 4IS2A 4CLOB 3B1XA 3QNMA 3IDZA 3HM9A 4RTLA 2B94A 1G17A 4WJLA 3NVDA 4XJSA 5FD8A 3HCFA 3DCJA 2OO7A 3F74A 3HFGA 1HE1C 2DWUA 3PFNA 4MWZA 4AF6A 2VDWB 3QKUA 3VVBA 3O9ZA 3I3SR 3TX6A 4TYNA 5KCZA 1N57A 4MWOA 2WOOA 4ZYTA 4FFLA 3NKVA 5AK5A 5AKYA 1L7VC 2G88A 4OY3A 2V8BA 2ZS7A 4EIWA 3THXB 2O8NA 4C9BA 4OH7A 4OUDB 2R48A 1EFPA 1Z6GA 3HWRA 1YZGA 4O3MA 2A0UA 1ZJJA 4A15A 1S9DA 2JA2A 3TDKA 5T8KA 2IP2A 3D3QA 5C8YF 1Z0FA 2NZ2A 3ZD7A 2AXNA 1QZXA 1CUEA 1FFSA 1DIRA 1LDNA 1DQZA 1L1RA 5ER9A 2B92A 1ZJZA 2KBFA 3FOFC 1C4XA 2VDVE 1S2DA 2UUOA 5FADA 5FFFA 5DN6D 1JW9B 3A4NA 5CDSA 1SC1A 2Z2JA 3L1UA 2V65A 4EG3A 4EGAA 2ZRBA 2PT5A 3CF4A 3ADPA 5GMOA 5F12A 5DGCA 1BJKA 4LXUA 4R1LA 5GOZA 2CNKA 2FE4A 3B7WA 4MB0A 4E94A 3IODA 3K9LA 3BD8A 4TMWA 4LN1A 4ODIA 4G23A 5A62A 1X9GA 2VHCA 2Z58A 3STTA 2PZAA 1U8AA 1K8ZB 1B16A 3N2EA 4U8HA 3NYRA 4BNUA 4AKEA 3T4EA 2G3YA 4N8SA 3LT4A 5E9QA 3NAGA 1LBHA 3KAKA 4ZTZB 4RH3A 3IDFA 4LG1A 5LA6A 4I1YA 3CYFA 2DM6A 4F3CA 2Y77A 5AM3A 1E99A 2QR5A 5BSKA 3SNHA 4B7UA 2NTNA 3EUFA 4Q1EA 1YRLA 4FYKA 1MO4A 1H2YA 3B82A 3H7AA 2A1TS 2GK7A 1RDFA 2PWBA 3P4XA 4J91A 5DHRA 1DQNA 4KO8A 1QH1B 3OUTA 3G02A 3VU9B 1OYOA 4K87A 4ZO8A 1QO9A 3RFUA 1QIHA 5JD4A 3DBLA 1KJ8A 2WIDA 3JX9A 1N6LA 5FQOA 4R0NA 5A6VA 1URPA 9LDBA 1H5QA 5COBA 2J0VA 1EE2A 3WL5A 4IQ8A 5DCLA 4NG5A 4MUAA 5EE3A 1FSZA 3ESZA 3LKVA 2G1KA 1OIXA 2ECFA 1PWHA 4PC6A 3Q98A 4BVJA 2JL1A 4Q7MB 1P3Y1 4R3WA 2NLOA 1H23A 2J6HA 3KRTA 2HK6A 5JQGF 1SRQA 3H1PA 4DEYA 1ECBA 3PNYA 1SA0B 4WE3A 1S6YA 2GEVA 4HYQA 1XTBA 4KQ9A 4ME6A 2COUA 2FN9A 2XVAA 4LRTB 3C8MA 4PLGA 3EA5A 2JD2A 1BX0A 1D4AA 1TO2E 3HKCA 4M88A 4NU6A 5K05A 4PPFA 5CJ2A 1AZSC 3SJAA 4L4UA 2OZKA 3P2MA 4RD2A 3FWPA 4MGKR 2XGMA 2AXQA 4EVQA 3DOFA 3F97A 3LPAA 1SXJD 4C0BA 3IKTA 2R5NA 1HYQA 3EGOA 4MRRA 4JI8B 2MTBA 4GX5A 3UCEA 1Z5NA 2R6DA 3M6LA 4LC1A 5EYPA 1Z18A 3RGWS 2PRZA 3IVAA 3Q10A 1ZCJA 3RROA 4DR2B 2BMDA 2I7XA 4I46A 5FBRB 4MPDA 4I55B 2X5NA 4L0QA 1Q44A 4A6PA 4EJ0A 2VAXA 3N2YA 4QBTA 4R8SA 2EQ5A 1SAYA 3CZ4A 3EVGA 3OF3A 4LRQA 3RREA 1M2VB 1U0HC 1V35A 2J3JA 3TECE 2H63A 1L7OA 3ZQKA 4AMZA 5JARA 1TFUA 1WDLA 3O82A 1TU4A 3UK0A 2W42A 2DRIA 5C31A 1YQWA 3FYUB 3KKZA 3VKGA 1N8NA 1KO1A 1QPBA 2OCBA 2YQ5A 4KPGA 2AFIB 3U4DA 1V45E 1X8LA 3QVMA 3ZY3A 3WGVA 5BV8A 2Q49A 4HQNA 5A6SB 1FA9A 2GD2A 4GT1A 2V7EA 4LHZA 1KOGA 8ABPA 5AW6A 4NFHA 1PJAA 5EJ2A 4CUJA 2K6GA 1QGZA 1GQ2A 4JSYA 3FGPA 4HL6A 4X3CA 3RFCA 4CYMA 2XAUA 2P7HA 1Y3AA 4QU9A 1NLFA 1M34E 1NRJB 3I12A 3FSRA 5BMOA 5I4IA 2AEMA 2OL4A 3FAKA 3W2IA 4MEJA 4W1QA 3FETA 5C1DA 4S1NA 1OZ0A 1KZ6A 3WC4A 1QF9A 2B21A 1ZI9A 4Q02A 1UWLA 3AWIA 1T0UA 3L9XA 4RF5A 4AMBA 4YJHA 4CF6A 1EX1A 4ZXPA 5IZCA 1K7YA 2OK8A 1DTSA 3STYA 3UCFA 5KX5A 4NK4A 3VOAA 3UV7A 2WK1A 1KGSA 3R5FA 4PXAA 1QGUB 4HT3B 4QUHA 4RFVA 2JBAA 1K6EA 2VATA 2C07A 2WAAA 3GYGA 3B8HA 3LJKA 4G2TA 1E79A 2HO4A 3QP9A 1LX7A 2DH5A 5AH0A 1W5EA 4XJTA 4YS6A 2XBMA 2ZYTX 3ZD6A 3A3OA 1TL7C 4DXAA 1DC6A 1YR9A 2DYKA 2Z6UA 1KQ3A 2MSKA 3UH0A 4JI2B 4WDRA 3SEAA 4E5VA 2GN4A 1U80A 4HFNA 2AG5A 3IULA 2NZJA 3JY6A 3RADC 3K5HA 2B1JA 2XA2A 2EP5A 1TADA 4CIXA 1XEWX 5HFNA 1X0VA 1I01A 4RA9B 1MJNA 1WEHA 3FSJX 1JAYA 5AKEA 4Y1RB 4FQ7A 5LBTA 5IRCD 1CZRA 4ES6A 4QQRA 1KEKA 3TI7A 1SRRA 3N0XA 4N5DA 3PIRA 1MF7A 2NVUA 2QJFA 1XU4A 2GMWA 4IJ6A 5IYZF 5JMWA 4JLVA 2K87A 5KYUA 1K6MA 1TF2A 1E61A 3O1LA 2R4QA 2YXDA 2HBRA 4QLAA 4Y2QA 4ER5A 2PRSA 4BYGA 1OJLA 4KK3A 4WUVA 5FUWA 3G3EA 1K0FA 3NHAA 3DE3X 2PGXA 3CCFA 4BUZA 2XZLA 1XCLA 2OHVA 3OE4A 4BQNA 3AW8A 4HQ0A 4XOIA 1TA9A 3AVVA 1NSTA 1P18A 1L3IA 1PFKA 1TKRA 2FJUA 1JSZA 1P0MA 2HJSA 2VA9A 3MUNA 3QOFA 3RS9A 4C7VA 1UIMA 1J9GA 1UBTS 3OQHA 1SUBA 3H18A 4G8BA 4PX9A 3AQ4A 5B58T 4NXMB 2JLBA 3PEFA 3WMRA 3OZBA 1JG7A 5J40A 4FGWA 1ZD5A 4M76B 1YS6A 4IEFB 3S27A 1XPOA 4QDOA 4L9WA 5AVOA 5E7JA 3M34A 1WSWA 4KITB 1S9HA 5G0UA 3REFA 2BEUA 4ZDKA 4TTJA 1NW6A 4DJ5X 2I9PA 3AFMA 1HYGA 3KYDA 5TVKA 2G8NA 4LY0A 3RQSA 2Z04A 2YIMA 3WWOA 5E4JA 3RQIA 3FF1A 1DUVG 1J1IA 4UBMA 4WK0B 3T7AA 4BNIA 4Z5XA 2YHSA 4N6NA 4EB6B 2R8EA 3ROMA 1TK9A 4CFSA 3MCTA 4MI9A 4U5XA 2C2OA 1EU1A 3F4LA 2OEPA 3BRCA 3QYJA 4H1VA 4ZJUA 2OZEA 5C7IO 5F1PA 3JQEA 3I2YX 4EGQA 2VJNA 3I1YA 4JBNA 2H9IA 4RJTA 4RHXA 3TMKA 5CDHA 5BV0A 2ODWA 4ER7A 4J49A 4A8TA 2ZTHA 4X85A 3CVUA 1TRHA 3K70D 2ZXUA 1II8A 2CFSA 2JCYA 3NQ41 3V8EA 5JFOA 2Z2YA 5EE0A 1VKNA 5C8DA 2VT2A 3COPA 2KPOA 1VMAA 3BCHA 3PBKA 4QM6A 1NBMA 2WJGA 3USES 1E4OA 4HZIA 3TW6A 3DPUA 4ZC8A 1EUDB 1B0PA 2WJ6A 1R8YA 1E2UA 3PHGA 4QTXA 5CYOA 3TIVA 4EG5A 1UK7A 5LQJA 1YAJA 4U4AA 1WZUA 2XIQA 1GPH1 2GETA 2WMOB 4I1UA 4UUQA 1T5OA 4EO4A 1UDWA 5JHHB 1CXZA 3NS7A 2YNMD 3L7AA 4OHYA 1Z2NX 2A92A 3AP2A 3PXBA 5AM1A 3V2HA 4S0ZA 4UM9B 3U37A 4DZZA 2OWEA 1I9CA 5ADUS 3OPYB 5FI0B 1F9EA 3FHJA 4E31A 2XBUA 4W5NA 4Q4JB 1WBJB 1GCIA 1SKBA 1X9HA 3QELB 2ZBGA 4QXMA 2WRZA 3RC3A 4OLHA 1A77A 2A5LA 3BSWA 1P2SA 2HPHA 4OYRA 4X63A 4CEJA 2VYNA 3GXBA 2YYYA 1K0UA 4REQB 4RPLA 3COZA 5KQRA 1JHVA 5FEUA 3PJFA 3PIIA 2PVCA 1UBJS 2Y0DA 1EWVA 3TLMA 4HEJA 1R8XA 2YXBA 4ZMSA 5C32A 4PZCA 3U4MA 2Q2NA 2A9QA 3KTFA 3P5BA 4NYIR 3EXHB 5CM9C 4MO9A 4BLQA 4DNFA 1DCTA 1ORDA 4M1KA 1CP3A 4OIMA 3SR3A 3GFRA 3GCDA 4MYRA 5JH7B 2ZBVA 3H19A 1ZZGA 1MRNA 4MRMB 2PXHA 2G08A 1BYIA 3IIEA 4Q1VA 4QQNA 1AMOA 2MJLA 2ZATA 2DWOA 3I9V6 4AAYA 4YAWA 2DFDA 3PD7A 4MS3B 2C1EA 3IP7A 4BBZA 1XQWA 1YBHA 1W85A 3CH7A 4LGMA 5HIAA 2D1YA 2HNAA 2PT9A 4OPMA 3WSWA 4LJSA 3D0RA 5IKEA 4RWEA 1I3NA 5P21A 4HZUB 2RGAA 3KQPA 5FLEX 5E4YA 3UHFA 4DM4A 2CV1A 2JC3A 1EEXB 2ZITA 5JNRA 1L4BA 3R24A 2VQDA 1W5AA 4DJDC 1Z2CA 5HKAA 5AXAA 2WSLA 2XWQA 1M83A 1HNNA 2OHFA 5KC8A 2PLFA 3NVAA 4BNGA 3VNUA 4N1AA 4ZO9A 4ZDJA 4NARA 2X8BA 5CNMA 1NR1A 4GOKA 2CFOA 3QUSA 3DDOA 4LF6B 2HFKA 3F49S 4HY3A 1VYHA 4F6CA 1TYAE 2GO1A 3E9MA 2IEYA 3L7DA 3PNLA 2NXNA 2WAYA 2KS6A 3EBLA 2PD3A 3IHWA 3U4AA 3WZLA 1IJEA 2HGSA 1HSOA 1SU8A 4B7ZA 2Z6QA 3OT1A 3HZRA 1AQIA 3DVLA 5E1OA 2NZYA 4YAFA 3ZS9A 3FPGA 1T34A 1A2OA 4G4IA 1LV7A 3R3UA 4IWNA 1RWBA 5CH8A 5K3AA 4YIHA 3KOOA 1TTTA 4PAWA 4UM5A 2XVMA 5K01A 1HDZA 2IFTA 1UT8A 5A5VA 3NIBA 4UUBA 5CD9A 4K88A 3VBEA 3D4IA 1Y8AA 1Q0TA 1H1LA 2LUOA 4FDVA 4MJ3A 2DERA 4RIEA 4C7OB 3FVRA 4YP7A 1XAGA 1PJSA 2R1UA 4BUCA 4CM5A 4FHEA 3EF0A 5IKPA 3SX2A 1H8HA 1Z62A 3DEIA 5TQJA 2CVHA 4JLKA 2QE7D 3L3BA 5EIWA 4D9NA 3MIZA 2FQ1A 4NRDA 4NOMA 4R8KA 3C8HA 1KDZA 2HIMA 3VYTB 1TUIA 5I9LA 3EZNA 4LWPA 4OIFA 4YRIA 1KI4A 2IPXA 3BMCB 2XKKA 2ORIA 4HAXA 2XB6A 4IXMA 3EA0A 4FOSA 5AJHA 2XECA 1FFXA 4TTPA 4U0JA 4ZI2A 2VZEA 4JASB 4OHXA 4IJKA 1MKYA 3LOUA 1TU0A 3H16A 4F46A 4QVKA 4I8XA 4IZOA 4L4RA 2GCNA 5EPOA 1WXIA 5EJGA 3ZQ6A 3CZCA 3FOCA 3BKXA 3GCWA 3M1IA 4RKEA 1YBVA 4LNUB 4Z3OA 1UQRA 2E48A 5CK4A 1K9SA 3T61A 3TB4A 4HXYA 4OLAA 1EFAA 3Q72A 2BFWA 3LHDA 2IHBA 1O5OA 1KRHA 2ATXA 2O06A 3EODA 3RG2A 2ATIA 4EHFA 4B6JA 1HKHA 1LK0A 4P22A 1HOXA 2CNBA 2MDTA 4LGVA 3RNOA 3VC1A 2YBDA 3N3BC 3CWCA 1USKA 6CHYA 2JFUA 3I61A 2FQWA 4OB8A 4JI1B 1DSSG 4HAUA 3L1JA 2G07A 2F9MA 4WKOA 3K1TA 2PRYA 3O4FA 4DC1A 4WV3A 5K0GA 4PICA 4ZANA 5LP1A 4W5OA 5ILQA 2J6CA 4BATA 2QTZA 2ZYVX 4BX3A 3LYUA 2QAGA 1I4TD 2FX3A 3DH0A 4MVJP 2J9FB 3LL7A 4HSGA 2GHQA 3H17A 1V4VA 1OLXA 5C8VA 4IMJB 3V48A 2K7FA 1DAKA 1VL1A 1YZYA 3IEUA 3LAWA 4XKJA 5D1NA 3KB2A 4E46A 2RC5A 2VDLB 3GI1A 1L8LA 2Z0MA 3GMDA 5HK8A 4H08A 1J0BA 2WSIA 4B5KA 4B4DA 3AF6A 2PY6A 3CUTA 3P1JA 3X1MA 1DI0A 4RSHA 5GQSA 4IDUB 4KQFA 2HEGA 4AQ7A 1E92A 2HREA 2C5HA 2H18A 2GCIA 2R6HA 5ICFA 2PH1A 1OW3B 1ZFNA 5CYGA 4FYXA 2IPAB 4PIVA 2DQZA 4LJ9A 1NXPA 1EVYA 3ZHBA 1OWLA 4P3OA 1D1QA 4EEXA 4G41A 3D8TA 1RYYA 1IIRA 4PQYA 4OHKA 1WV1A 3CS3A 2JJ2A 4YTEA 3AR2A 4OATA 1V5EA 2DQSA 5DULA 1K4KA 4A2PA 4DQLA 2X7JA 4FONA 2F1OA 1E6UA 4U2FA 3C3CA 1UAAA 1KP2A 2O1WA 2YWRA 4FSXA 4UVGA 2EW2A 4BPBA 3GX1A 4V39A 1E1LA 4W9RA 1WABA 2NQ8A 4Z49A 2D1TA 3QPWA 1S02A 1E3JA 4GBGA 1NF8A 1RPTA 2XZDA 1X6VA 3AC0A 3MJRA 3M9LA 1YT5A 4HDMA 4YQZA 2GJSA 2VBGA 3X44A 5A06A 5ES4B 2EBHX 1E77A 2Q8NA 3FPSA 4P4LA 2D8AA 1GFWA 4OHUA 4WCVA 4MIYA 2YWEA 3SAJA 2CFTA 2QZPA 2BELA 2PR7A 3OX3A 1TW2A 5KQGA 2N9UA 1VHTA 3T34A 4N5LA 3T3HA 3JQ8A 2C57A 2HMTA 2WZQA 5HF9A 2FQYA 4TSFA 2B3DA 4LJAA 3LCRA 4MB2A 4XIIA 2MCFA 1E6CA 1ZI6A 2GRUA 2YDXA 2HT1A 4PHGA 1FX0B 3UUEA 1XT6A 5CFMA 2QAJA 4YPOA 1QSGA 4BFYA 4BNZA 1JQJC 2H07A 2C7BA 4IDCA 1O0BA 4KQ6A 4AO7A 4NDZA 1Y80A 1PZMA 2HJRA 3C5WP 4BFXA 3KQLA 2YN4A 3ZK9A 1ECCA 2I2CA 3Q8WA 4LA4A 3WHKA 4JY7A 5L45A 1T6ZA 1XC7A 5AYVA 2A2ZA 2J07A 1WP4A 2WIBA 4M7WA 1Z08A 1JHDA 1YI8A 3NVKI 4X0EA 1TGYA 2BJVA 2ZJ4A 3NWOA 3SMVA 5E6SA 4F45A 1ZZEA 4DIBA 4BNVA 4QUKA 3CLVA 1VG0B 5DFAA 3QEBZ 3DVAB 4O4JB 5IC6A 1UC4B 1ODFA 1L4FA 3NWEA 1U2GA 4RY8A 1ZD9A 2C2YA 2VPPA 1FLDA 3FI0A 3KXPA 4GZLA 4PGHA 5F77A 3VC2A 2X0RA 2IPOA 4TL6A 4D79A 2VUHB 2GTHA 3EDMA 1SCNE 1COWA 2HK8A 2WJIA 4J4BA 4UHHA 4YYZA 1M7HA 4V3BA 3TM5A 1XQYA 1EK5A 5DMXA 2PKRA 3AB7A 2FA9A 2XDQB 3HYNA 1E5VA 1AG9A 2C3MA 2QSUA 2J3MA 3TE6A 1N7HA 2OG2A 2ZRIA 4MRSA 5EN4A 4RABA 2GAIA 3B9QA 4GC9A 4IZIA 1OQAA 3P2IA 4PQGA 1KO7A 4UCFA 4E7PA 2W6QA 3F90A 1XN4A 2JPDA 3G85A 2ZW9A 2GGSA 4JLNA 1UBKS 3U2QA 3VVMA 4OQDA 4OQMA 3NM4A 5JLAA 3MINB 1J23A 2JDID 1RHKA 2F9LA 1QYCA 3H3JA 4O4IA 3F7TA 4UARA 3TTUA 3WIOA 5KTTA 2EZ9A 4IINA 1N6OA 3FROA 4AO6A 2XSZA 5G1OA 3OF5A 3GYBA 3L1HA 4DCTA 4P5EA 2VHJA 3WWDA 2O19A 4MS4B 4CXMA 2C9OA 2EFGA 1N32B 4N82A 3TBHA 1F2TB 3RWBA 5A5GA 1M34B 4LJRA 4MQMA 4PLPA 3C1OA 1Y1RA 3W6ZA 1IMOA 3M6AA 2VDNB 3A6JA 3ZJ5A 1SD1A 1XZLA 3QEOA 2FZ5A 4NX2A 3OIYA 2ONCA 2AG0A 1P1JA 1D3AA 1S2OA 3OBBA 1P1BA 1PJ3A 4WY8A 1IN4A 1PL0A 5LQRA 2IXDA 4NMMA 1SXGA 4DG8A 4YAUA 1GGJA 1IEVA 4WZAE 3VPGA 2O5EA 1H1TA 1U1EA 3FHCB 3TOCA 2DJIA 3OU2A 3R75A 2JI4A 4KG7A 2O0HA 5LWQA 4QL3A 4J9UE 4WOJA 1RXCA 3IIMA 5CR9A 1QIFA 3IAS1 5F7XA 2PRIA 4I5FA 3MAAC 4NPAA 3CLRC 4Z3DA 2OOKA 1Z4IA 2BEVA 2DWCA 2P1RA 2QV0A 3ACDA 1N7JA 4O2RA 1ZM3A 1R27A 1ZGZA 2D13A 1MCZA 2V6MA 4JYMA 4REOA 4F06A 4LI3X 3W8EA 4NMHA 3NHUA 4J0CA 2Y1DA 4AJ2A 4F6LA 4ZYYA 5F2NA 3IILA 4UEJA 2BGGA 5FTLA 1R0CA 1NUTA 2A9JA 3HP4A 3R3SA 1E9SA 1ZDMA 3AINA 3EEQA 5JDCC 1I36A 4GOXA 5KU1A 4BNWA 2D0OB 1LDYA 2EXXA 3EVDA 1NONA 1NWHA 1E0DA 1RRGA 1UOQA 3H2JA 3JYPA 4QYIA 2XYGA 1JTFA 3WI7A 3WK8A 2XLBA 3F78A 3DNMA 3LQFA 5EJFA 2R86A 3L18A 4W7IA 5LJLA 3S1AB 2WKQA 3OPNA 4HHEA 4B8YA 1XD8A 2P2YA 2QSZA 3EYAA 4EECA 1YNSA 1V3QE 2CYCA 4F9GA 5BPFA 4RVDA 1RXYA 5K6AC 3HJRA 3TGLA 1IU9A 3MCWA 4O4LF 2XUKA