1QYDA

Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases, and their relationship to isoflavone reductases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
312
structure length
312
Chain Sequence
b'DKKSRVLIVGGTGYIGKRIVNASISLGHPTYVLFRPEVVSNIDKVQMLLYFKQLGAKLIEASLDDHQRLVDALKQVDVVISALAGGVLSHHILEQLKLVEAIKEAGNIKRFLPSEFGMDPDIMEHALQPGSITFIDKRKVRRAIEAASIPYTYVSSNMFAGYFAGSLAQLDGHMMPPRDKVLIYGDGNVKGIWVDEDDVGTYTIKSIDDPQTLNKTMYIRPPMNILSQKEVIQIWERLSEQNLDKIYISSQDFLADMKDKSYEEKIVRCHLYQIFFRGDLYNFEIGPNAIEATKLYPEVKYVTMDSYLERYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pinoresinol-lariciresinol reductase
publication title Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases and their relationship to isoflavone reductases.
pubmed doi rcsb
source organism Thuja plicata
molecule tags Plant protein
total genus 94
structure length 312
sequence length 312
chains with identical sequence B, C, D
ec nomenclature ec 1.23.1.1: (+)-pinoresinol reductase.
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1qydA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1qydA02
5JY6A 4WCDA 1Q2XA 3SEFA 2GN8A 1ZVMA 4ILKA 3R3JA 1VRWA 3DAPA 4J49A 4K1LA 3TZ6A 5DBGA 4FFLA 2PD6A 1P33A 4DIFA 3BMQA 4EDFA 1NQOA 4U7WA 2P5UA 2LDBA 5IDYA 4II3A 2Q46A 4O5OA 1FDSA 2EP5A 1BG6A 3ZV4A 1XA0A 2VNSA 1IPEA 4KUEA 3OEWA 3D7LA 3GFBA 4HBGA 4F46A 1DXYA 5KJEA 3RUEA 5EL0A 5CEJA 4NU5A 1E3WB 3U4IA 4YJHA 2ZYGA 1N92A 5JW6A 5T67A 1C14A 4M86A 1X7GA 1IY8A 2W2LD 1LSJA 1I2CA 3PHHA 3IJPA 4BO6A 3NT4A 3VKUA 4I5EA 3QP9A 3C1TA 3ENNA 4IMRA 2HRZA 4N5NA 3T4EA 4R3WA 3WWZA 2YW9A 4QFCA 1IUKA 4OSPA 4YR9A 4DWVA 1JKFA 1EE2A 2R2GA 2HMUA 1NVMB 5C7IO 1HF3A 4IBOA 1BW9B 1O9BA 4A27A 2Y68A 2YV1A 2QX7A 2XXBA 1M75A 1T4BA 1U3TA 1UP6A 2IEBA 3RU9A 1P1JA 1PJQA 1YONA 3I9LA 4J90A 4Q3CA 2OXIA 4E32A 2YFHA 2IDZA 3EZLA 2NU9A 3FNGA 3O4RA 1P3DA 4UUOA 1S6YA 4R4JA 5A9RA 4DPMA 1HYGA 3FSRA 3OIGA 2DPGA 4IDEA 3AOEA 1U28A 1YH3A 1O8CA 2NVUB 5ICSA 5DDIP 3U09A 1O5IA 3DOOA 1WMAA 3NAQA 3OMLA 4R54A 2Q1SA 3C8MA 4FJ0A 3U9LA 4AJJA 4CM7A 2BF7A 1E1NA 3FI9A 3KEOA 3LT1A 4N5MA 2NQ8A 1GV0A 1GYQA 1YGYA 2P9CA 4NI5A 1TI7A 1E0DA 4N54A 2HMWA 4WNIA 2X9NA 3JQCA 1H2BA 3WQQA 4KQWA 3KUXA 1LNQA 1J5PA 1B3BA 3RJ5A 3MEQA 5HS6A 3OHSX 4FGWA 1KVUA 4RDIA 3G3EA 3UW3A 4K26A 1LDEA 5BSHA 5GMOA 3ZWCA 2ZATA 5LDHA 4RPJA 1E3WA 1U3VA 1W0CA 2FZEA 4XJSA 4YJDA 3OETA 3W8FA 2BKAA 2WDZA 1KETA 1ZJYA 4L0QA 3U4HA 1ML3A 3DTTA 1LLCA 1GEGA 3VKVA 3QWBA 2RHCA 2Y0DA 4E6PA 1R0LA 1M6WA 4XQ9A 2F1KA 1BHSA 4PVDA 5A5EA 4A7PA 1DIBA 1KBZA 1LRKA 1JAXA 4CMHA 2GZ1A 4WPGA 2O4UX 3HB5X 4XCVA 4ND4A 4PLTA 2I9PA 1ISIA 2QRKA 3E18A 1BW9A 1NQAO 1Y7TA 2VHWA 1DC6A 2GZ3A 3L77A 5G0TA 2GRAA 1GV1A 1DBVO 4S1VA 5DOVA 5HWSA 4DPKA 1I32A 3ULKA 1Q7CA 3GY0A 3JCZA 3Q6IA 5A9TA 3I23A 2DBQA 4CV2A 2C82A 3DWFA 5L4LA 4YCAA 1OOEA 4ZICA 4JLWA 3JD1A 3DEYX 1VJ1A 3WG9A 1UJMA 5CDUA 3NGXA 1XQ1A 1M67A 2RIRA 2NVUA 3K2BA 3FD8A 1EBFA 3KLMX 1YBMA 1E6EA 4JK3A 3STHA 3RUFA 3GNSA 1JDJA 4PCVA 2BGLA 3WGIA 3KVOA 1DIAA 3NGLA 3BZUA 1O6ZA 3IDSA 3ITDA 3UCXA 1NAHA 3E9MA 4IQGA 4BNGA 2JAPA 3WLFA 4GH5A 1JU9A 2NV6A 2V6BA 3IUSA 3E5RA 3ZNQA 3RAJA 1N7GA 4BNWA 2AQ8A 4A5OA 4B7UA 2BGKA 1A9YA 3PGXA 3QJ5A 2AQHA 1DJNA 2AE2A 4L4XA 5AXBA 2FSSA 1I3NA 1K6IA 4ITUA 1HLPA 1A7KA 4BNTA 4E5PA 3CMCO 3CE6A 1ZEJA 2E49A 4KTTE 5ITWA 3UOGA 4I8XA 5TNXA 4CMIB 1BMDA 2C7GA 3AW9A 4J0FA 4HXYA 2GD1O 5IF3A 4IXWA 1EQ2A 1WW8A 3BHMA 2YZ7A 1NWCA 1DRWA 1U1IA 4EZBA 3ZV5A 2HQ1A 4M89A 3VPHA 1P31A 3LF2A 4CM5A 4CMGA 3JQGB 2YHIB 1CQIA 1HE5A 2DAPA 2X8LA 1SEPA 3AUUA 3OA0A 3P5SA 4CUJA 4GSKA 1EMDA 2PZKA 2X58A 3PLRA 1DFGA 3VAZA 1CJCA 4G81A 2HSDA 5EESA 4R3NA 4D41A 4DA9A 3NX4A 2I67A 5HRUA 4BS9A 4YPOA 1QRRA 4J7XA 2RCYA 4JGBA 1XDWA 3OEYA 2PH3A 5T57A 4U0KA 4WNCA 3SVTA 1NYTA 5H81A 3RU7A 1F8GA 1P1RA 4MIEA 1SB9A 2JFGA 1WWKA 3PHJA 1XHLA 1JKIA 1AXEA 2AA3A 1HYHA 1UXIA 2OO5A 1A9ZA 1YJQA 5KWEA 4PRKA 3H5AA 1YBVA 3RASA 4EUFA 2GUGA 2D4AA 5AQ1A 3WGQA 3GLQA 2WD8A 3C1OA 4D0SA 3OJLA 5I8WA 5KVQA 3HNPA 4NDNE 3TZCA 1VL0A 3DBHB 3VOSA 5CEFA 4J0EA 2Q45A 4MP8A 1BXGA 1X15A 4CMIA 2W2LA 4B8WA 3ABIA 3IIEA 1G1AA 1BVRA 3OJEA 4QECA 4PLGA 1ZJZA 1E6UA 2QYTA 5T5QA 4L9RA 3LVFO 1NFFA 2O3JA 4IQ8A 4BGIA 4RZIA 3D3WB 3PDJA 2Y1FA 4R41A 1HSZA 3V1UA 3SJ7A 4QT0A 1E3EA 2AEJA 1BRMA 3JQGA 4PZCA 2O3QA 5TJ9A 5FYDA 2F00A 2WSBA 2Z1MA 3LT0A 3F47A 3E82A 2WMDA 4PLPA 4JBIA 1K3TA 4MDHA 1MC5A 1Z74A 2O3RA 5T8KC 4O59O 2PD3A 5K9ZA 3ONFA 4GBJA 2UVDA 1PWZA 1MFPA 2V65A 1X0VA 4YEDA 4CLXA 3N58A 1UZNA 5AXAA 3Q9NA 1E1MA 1C0PA 4NMHA 2X9GA 3BHJA 1I3MA 2GASA 4H7PA 3KYBA 3GN1A 5KJ1A 3NUGA 4BNIA 1V3VA 1VL8A 1LU9A 3IJRA 2VZ0A 3V1YA 2IODA 4Z0PA 1MV8A 4J43A 5G0VA 1ZMOA 2OP1A 3I9KA 3MTJA 3KV3O 3A1NA 1ZKMA 1I3KA 1OC4A 2A9FA 4JROA 1V6AA 1KVSA 4IUYA 4QSMA 3ROKA 4PG6A 4DXHA 4DRYA 1LI4A 5TSDA 3RBZA 1B15A 4IJVA 5DF1A 1YL5A 1N8KA 4CM8B 1NP3A 3H3FA 2GN4A 4GMGA 4JJFA 1SCUA 1UP4A 2E37A 3JYQA 4KWHA 2ZTLA 3ZU2A 4C4OA 1DFIA 1DLIA 1OI7A 3DR3A 3PJEA 1HT0A 3D3WA 3ADPA 1LLDA 3GDOA 1PL8A 2Q4EA 3JQ8A 2PKQP 4FSHA 2PR2A 1IYZA 5MDHA 3H7AA 1O89A 3FWNA 2PA3A 1QYDA 4RJTA 4CMKA 1ISHA 2DTDA 1BXKA 5CG1A 2H1SA 4LCEA 3ICPA 4TROA 1WXDA 4CMCA 4UEOA 4R9RA 1HE2A 1PGJA 3A9WA 2PNFA 1DAOA 3DZKA 5ITVA 4FQ8A 3PIDA 4EJMA 3RBVA 3WFIA 5DP2A 4BNUA 3DOCA 3HADA 2HMVA 2OGUA 2W2KA 1FXSA 3L0DA 4RVFA 2OP0A 3VTZA 2ZB7A 1GU7A 1ONNA 1H6CA 1PJSA 4ZJUA 2GCGA 1GCOA 4QO8A 1R66A 3F4LA 2C54A 3WBFA 3SJUA 2NSDA 2O3UA 3AM4A 3MWEB 1ZK4A 1Z75A 3S2IA 4ZRNA 4IXTA 3F4BA 3UCFA 3K9QO 1KIFA 1JVBA 4EW6A 3GEMA 4ND5A 1LDGA 3AM5A 4PGFA 2ZQZA 4YT8A 1PJ4A 2G5CA 5IDQA 5I9NA 1GUZA 4GVXA 2VOEA 5CEEA 4CQMB 2NU8A 5JNLA 5DULA 4J4TA 4E2WA 2QRLA 1E92A 2NADA 1R6DA 3ZV6A 3TOXA 1HDZA 4CM8A 3VH3A 3DB2A 3RIHA 3UF0A 3IAHA 2PTGA 3E9QA 5JC8A 3OECA 4ZGWA 1TB4A 5EN4A 5ENVA 2Y1CA 4D3SA 3BMOB 5JC1A 3L6EA 4U6SA 1XKQA 4TRRA 1IHXA 2VN8A 4DLBA 4IDBA 1GZ6A 4FS3A 4RORA 3VTFA 4Q39A 2GYYA 3PRJA 3U5TA 2ZB8A 3ASUA 3CEAA 1GUYA 4YA6A 3HJAA 3P19A 2ZKLA 3FF4A 3AOGA 7ADHA 2OMEA 3PK0A 1LRJA 3GZ4A 3ZWYA 5EINA 3IP3A 3MWDB 1DC4A 3OQBA 1QP8A 1PR9A 2NTVA 3WNVA 2E82A 5A4DA 1ENYA 4J1SA 3DBRB 3W8DA 5HA5A 1RM4A 1PEDA 4OH1A 4FDAA 3DZFA 1AHIA 4XRGA 3AWDA 1Y81A 1HDGO 1E7MA 1ZBQA 4RL6A 4FIZA 3K73O 4U5QA 1GUFA 1QLJA 2R00A 3ZHBA 3GVPA 4XR4A 1WDKA 1TT7A 1GEEA 2JL1A 3WJ7A 5K0ZA 1GFSA 4RF2A 3S1LA 4JXKA 5L40A 4DLLA 2X86A 4LK3A 3ZHYA 3F3SA 3TNLA 3SX2A 3I9JA 5B1YA 1D8AA 4CQMA 5COBA 3O38A 2VTEA 3L4BA 3OA2A 1E3JA 3GFGA 4XWYA 3RUIA 1W4ZA 3FBGA 2PGJA 1C0LA 4BNMA 3GMSA 4XYGA 4HP8A 1HRDA 5AOVA 4CMEC 2PGDA 3T4XA 3RUHA 1EQUA 2Q2VA 1ZH8A 3O8QB 3A4VA 4N5LA 4CV1A 4XYMA 3WJAA 2XOXA 3EC7A 1B2LA 2O50A 3GGPA 4FFOA 3V2UA 4RVHA 3BMCB 1MLDA 3GAZA 4PRLA 1YWGO 5HS4A 4OOEA 1KYQA 4BMSA 4XX0A 5A9SB 1NAIA 3ZHZA 4W7HA 5TQVA 1CEQA 2VWGA 2PWZA 2Z95A 4BVAA 2CVZA 5CG2A 1B8PA 1D3AA 4CLEA 5KJ6A 3E8XA 4CM9D 4Z3KA 1GQYA 1X14A 3WLEA 4UVDA 4Q3DA 2QHXA 2QYSA 1Z7BA 1ARZA 4UUPA 1FJHA 3D4OA 3F6YA 3GHYA 5A3VA 4CMJA 3FBTA 3GA0A 1M2WA 2IZ1A 3I4CA 1YXMA 3HZZA 4RPKA 4B7CA 4FBGA 4E0BA 4L73A 3Q0EA 2TMGA 2DUWA 3FCOA 2Y1OA 1N1GA 3DMYA 3HDYA 1FDWA 4J1TA 2POQX 1I0ZA 2P91A 4BB6A 2DBVO 2WYVA 1NPDA 4J2HA 4LMPA 2BFAA 5JDCC 4BKQA 4Z6KA 4J7UA 4D0RA 3DZIA 4FC6A 1HTBA 1K6XA 2X0JA 4J2OA 1BVUA 1MX3A 5CDGA 5MGBA 4XYLA 4ND1A 5JLAA 3E9NA 2VQ3A 1K5HA 5I7FA 3W4IA 1LQUA 2FWMX 1DRVA 1J49A 4WECA 4LSWA 4B79A 3JSAA 2EF1A 2IYOA 4D44A 3ICCA 4MP6A 3U0BA 4XIJA 3ZH2A 1YB4A 1C3VA 3JTMA 4KMSA 3V5NA 4XDYA 2YQ5A 2DBZA 1XYGA 5AXDA 1O94A 4H15A 4M87A 4E21A 1VKOA 3O8QA 3AFMA 4FFPA 4ZU3A 3ANNA 1DC3A 2GO1A 3DDNA 3MJEA 4MVJM 3VH4A 4DBZA 2B5WA 1GQQA 5TGDA 2PGLA 5DCWA 3BMCA 1WVGA 4WKGA 3RC2A 2O48X 1PS9A 2Y1EA 3QWAA 3OQ6A 3KYCA 1KY4A 5A9SA 3N7UA 1BDBA 1UXKA 1AE1A 1CQJA 2BGMA 4WK6A 3FTPA 1BWSA 1MG0A 3X2EA 2G82A 2FPPA 1QMGA 2NLOA 2C2YA 5JFOA 3VHRA 3EHEA 4RQUA 1DLJA 2J5QA 2TMDA 3DBVO 4PG7A 5JAQA 4FOOA 4WE3A 1PGNA 4WCFB 3B6ZA 1TA4A 2DM6A 2QW8A 5F1PA 4GI2A 3KTDA 3SBOA 3GPIA 1H5QA 1RYEA 4BNKA 5A3JA 3T7EA 1UAYA 1Q1NA 2JD0A 4WASA 3C24A 4MOWA 4KDFA 2A94A 3GEGA 1QR6A 1N9GA 4CM6A 1WAMA 2CY0A 4KUHA 4HNGA 3ETDA 2UAGA 1SEVA 4TRNA 1LUAA 3HHPA 4B4VA 4JP3A 2BFOA 4BMNA 3ZU3A 1R4MA 3G79A 3TPCA 3T7CA 4ALKA 1I2BA 4IM7A 3H5NA 4ZHSA 2CD9A 5L53A 1DHRA 4RLHA 3OJFA 1DEHA 1KVQA 4E33A 4N18A 2P68A 4RZHA 4WEQA 4ALMA 2DFVA 3ZWWA 2EG9A 2I99A 2V6FA 1PWXA 2EHDA 3PIIA 4J7CA 4M54A 2OBNA 1B0AA 4BIIA 1U2GA 3PLNA 4NK4A 3BAZA 1VKNA 2Q2QA 1KY5A 5L45A 3ANLA 3AI2A 2JKVA 3M1AA 1ONPA 1P1FA 3VVCA 3JQBC 1Q7GA 4DMLA 4AL4A 4Z9FA 1EUDA 3ZWXA 1GD1O 2FY8A 1EDOA 3GGOA 1PQPA 2X5OA 3JYOA 1HETA 1V9LA 3AI1A 3D64A 1WDLA 3C85A 3UH1A 5CDYA 5DCUA 5KOIA 3HDJA 4ZQGA 2XPCA 2NNLD 1GPJA 2ZJ1A 3FRJA 1N5DA 3KXDA 3QW2A 4A0SA 1T2FA 5CAEA 3ZU5A 2HMSA 1EDZA 1KVRA 1A4UA 2NU7A 2VWPA 3DMTC 5G0WA 1A5ZA 1ZK1A 2O2SA 4O6VA 3U62A 3S2GA 3BTVA 5AXCA 2O3SA 1SBYA 3TL3A 2P2SA 2VRCA 1Q0QA 3K92A 2BD0A 4TRMA 4FW8A 3IC5A 1PQWA 1JQBA 4WCFA 1LDYA 4M55A 1JVSA 2NVWA 4E2XA 4C7JA 1QKIA 3ZWOA 4MKRA 4LRSB 1TEHA 1NQTA 3LLSA 1PZFA 3K2EA 5TJHA 4YRDA 3ZWNA 1NR7A 3KYDB 4BNNA 1D4FA 3QVTA 1MG5A 4R5MA 1NTOA 2YDXA 1ZNQO 1DRUA 2AXQA 4A73A 4BKUA 3E5MA 2J5KA 3IOYA 3B1JA 3OJOA 1WP4A 1BSVA 1F14A 2YDYA 4DC1A 5TF4A 4IIVA 4CLDA 1KEUA 4PLWA 3I3OA 4IDAA 3WNQA 1B8UA 1PGPA 3NDRA 5G0SA 3JQEA 1OZAA 3KETA 2C20A 1VL6A 3D5TA 5CFZA 1O95A 5BR7A 2ZIZA 4GSLA 1GL3A 1R37A 5I7VA 1RYDA 1H9BA 3JQ9C 5I9MA 5IAAA 2EKPA 3QIVA 3GT0A 2GR9A 2W4QA 1IE3A 3PZBA 4BGUA 1E6WA 2BI8A 4NFHA 1Y9AA 2IE0A 1B16A 4DC0A 4GX5A 5JY1A 3L07A 1HKUA 3V1TC 1ZFNA 3LT2A 2EGHA 4BL5A 4JNKA 4R51A 4HFNA 3P2OA 3WQSB 1ADGA 4O0LA 1YOVB 3GVIA 3OIFA 3PWSA 4GL4A 4NJOA 3ZW8A 5C37A 1LLQA 5JYEA 3WIDA 3VDQA 2Q2WA 4JN6B 1Q7BA 4U0JA 4UUNA 2Y1GA 2AMFA 2C5AA 2ET6A 5GY7A 4J3FA 1OAAA 3MJCA 3WMWA 4CLRB 4GVLA 1Y8QB 4UVHA 3AFNA 4NBTA 4CM9A 4BB5A 1ZSNA 3OFSA 4Y6SA 2JD2A 5JCJA 5CDTA 1U3WA 3DBLB 5FEUA 1X1EA 4A03A 1T2DA 2ZTUA 3KYDA 2DPHA 2EW8A 3EDMA 3WYBA 3VPSA 2ZQYA 1PJTA 1YL7A 3TZQA 1W73A 4IGFA 4BGEA 3F5QA 3TSCA 1P74A 2FPGA 4CMAA 5ADHA 3TJRA 1HSOA 4PVCA 3GEDA 1Y5MA 3ONEA 4L74A 4XA8A 3RSHA 1I5RA 3NDJA 1QLHA 3WX0A 4BO9A 3WQRA 2FMUA 2Y66A 3EVTA 4W9NC 3HFGA 1E77A 2PZJA 3RCBA 1H9AA 1R0SA 1WNTA 1V0JA 2FRDA 4TMFA 5A05A 3D5QA 2NM0A 2DLDA 3EW7A 1W6UA 4LVUA 4MINA 4XEHA 4E12A 4IDDA 5B4TA 3GK3A 2AG5A 3DAGA 3AM3A 2I3AA 1CYDA 3KM0A 4GPD1 4I9NA 4E4YA 4YT4A 1EZ4A 3NT5A 2J3KA 3ZU4A 2R6JA 3KHUA 4L4RA 4EI2A 3A06A 3B1KA 4JBHA 3ZNOA 1IULA 5I7EA 4F45A 1DIHA 2D59A 3RI3A 3ETGA 1VJ0A 4AJ1A 1IOLA 1KC1A 1FMCA 2Y67A 1HXHA 4X54A 4AJIA 1UXGA 3PFFA 4RCVA 4CM4B 4EEXA 1YE3A 4PLFA 2ZTMA 1DO8A 1YOVA 5C3MA 1FDUA 2X5KO 3D1LA 4XQGA 4I9UA 1Z6ZA 1SOVA 1JA9A 2C59A 3BTUA 3H4VA 1PU2A 1V8BA 4CLRA 3UKOA 1Y8QA 3MOIA 3CXRA 4YB8A 4F3YA 3AY3A 2FR1A 3GPDG 2EGGA 3H9QA 3PXXA 5HBRA 1E3IA 1DC5A 1KS9A 2GSDA 1F17A 4Q3BA 5AVOA 4CL3A 1U3UA 5AYVA 4LCJA 3IUPA 3F1LA 2P9GA 5ER6A 3S8MA 3CIFA 1EVIA 1TLTA 5ICMA 4BO3A 5CP8A 4ID9A 4WEOA 2B4RO 2HCTA 3MJ4A 4CQMD 1K2WA 1YB5A 1XU7A 2WE7A 3DHYA 1DJQA 1OC2A 1RM3A 3FPCA 3JYNA 4NZ9A 3GDFA 3WGGA 3ENKA 3DZBA 4BNFA 4MVJI 4E2ZA 3ZDFA 4JQCA 1DIGA 1P44A 4QO7A 2AQIA 1VM6A 1UXHA 2CMDA 2X0NA 4KDEA 5EQFA 4FB5A 4J4HA 4GX0A 4D79A 3F9IA 2PD4A 3PHGA 4XD2A 3ON5A 4TWRA 2DKNA 1D1SA 3OH8A 4DVJA 3PI7A 4PIVA 4RF5A 4QQRA 1AGNA 4PLYA 2G17A 1MC4A 4XQCA 4CR8A 3BMNB 1ZUD1 1SAYA 2YHIA 3IMFA 1Y9EA 4PFJA 3OICA 2D1YA 4XGKA 1DB3A 4P22A 3MJVA 1GZ3A 4Y6RA 3WFJA 3CSDA 4MKZA 3PQFA 1Z7EA 5B37A 1LX6A 3FTNA 5COQA 4TKLA 3PJDA 2HLPA 3AUTA 2X4GA 3FR8A 4MIOA 2NWQA 1C1DB 4WJZA 3UICA 4UUMA 5TLSA 4Y98A 1U9JA 2VWQA 3GGGA 1U5AA 3JD2A 1HZZA 3VZPA 9LDBA 1ADBA 5KVCA 4YTEA 5FI5A 3SC6A 5GZ3A 6ADHA 1A7AA 1YO6A 5FF9A 1PTJA 4HX5A 4IJKA 1ZXLA 4GQAA 4JX8A 4E30A 1LQTA 2HAEA 1U8FO 4AG3A 4BO8A 3FN4A 4JIGA 5KTKA 2B83A 3K30A 4EGFA 2YQ4A 1E7RA 2NTNA 3WGOA 3HB4X 1U5CA 2JHGA 1SO8A 4GAEA 1Y1PA 3DBHA 1KEVA 4B4UA 4WLEA 1KVTA 2WWRA 4E5YA 4DPLA 3UGKA 3VH2A 1RWBA 1UZLA 3H8VA 1T1RA 4YQZA 3V2GA 4J9VA 5JDIC 3O9ZA 3QHAA 2I3GA 5IZCC 4KQXA 5T64A 4XYBA 2ZK7A 1T1SA 2IZ0A 4CR7A 3BYZA 3E48A 3LF1A 4RQTA 1F12A 1NPTO 4RDHA 3I9MA 2ZB4A 3FHLA 3K5PA 4GX2A 3H9EO 2O2YA 3BMNA 1KEWA 2RH8A 2W98A 2IEDA 1EVYA 3EGOA 1A72A 1LSOA 1LBEA 1NR1A 1YDWA 3H9GA 2GF2A 1ISGA 4DYVA 4MPDA 4XDZA 2SCUA 3IKVA 3RC7A 3TOZA 3UUWA 2H9IA 4Q9NA 2VYVA 1MFZA 5H82A 2FHSA 3PVZA 3GVHA 3QQPA 4NU6A 1C1DA 1XLTA 5G2OA 1VSVA 3LT4A 3NJ4A 4Z0HO 1HDRA 4R16A 4IY1A 5F3RA 5L9AA 4N7RA 1B26A 1PR3A 2VUTA 1A71A 1LA2A 4FJ1A 2UUPA 3DO5A 4AFNA 1IZ9A 1PZEA 4J91A 4URFA 4IDCA 4MVJP 2PY6A 4TKMA 4RPHA 2CUKA 2J8ZA 1J6UA 5A5FA 1TT5B 3LYLA 3NTQA 1P0CA 2J3JA 3O26A 2Z5LA 4HADA 4E5MA 4DREA 2I66A 5IN4A 1NFQA 1K6JA 3HG7A 2NVBA 2IXAA 1EVJA 4ALIA 4PLCA 1Y5RA 2VTDA 3OM9A 3PWZA 2Q3EA 5C7LO 4P4GA 3TWOA 1FK8A 3GNTA 1IZ0A 4PLHA 3W4KA 5JXWA 2X5JO 4XB2A 4RVSA 4DQUA 2FOIA 2NTJA 3AK4A 3OQ1A 2PZMA 1C0KA 1MXFA 2JHFA 4IGEA 1XU9A 5HM8A 3NV9A 4Q3NA 4CODB 3IP1A 3P7MA 2P4HX 3WICA 1RPNA 3PFWO 4UEJA 1WMBA 1OFGA 4W82A 1ZK3A 3NTRA 3ST7A 2VRCD 2HU2A 4YAJA 3WSVA 4E2YA 3O03A 4WLOA 1U4SA 2GGSA 4UULA 3OSUA 4HFMA 4R1UA 4ZRMA 4S3MA 3W6ZA 1YQXA 4AJNA 4P8RA 4DQXA 5KJCA 1SNYA 3H9UA 4E5KA 1FDTA 1LXCA 4R9SA 2PV7A 1KEPA 2C2XA 4BO5A 3LZ6A 3JQ7B 2C5EA 1PL7A 3LC2O 5B4VA 1H0KA 4R69A 1RM5A 3PQEA 3BXXA 3CKYA 4OQYA 4BNHA 5CPFA 3GRKA 3ASVA 5L95A 2CSUA 1GPDG 2GNAA 3UVEA 4A2CA 4ND2A 1MP0A 1EBUA 5DN9A 1DAPA 1JAYA 1RJWA 3CUKA 3VZQA 1JWBB 1A4IA 1XG5A 1XR3A 1YDEA 3I9OA 4GKVA 5BT9A 4DYDA 2EERA 4GLOA 3UCEA 2LDXA 1IHYA 3SLGA 4EBFA 1GYRA 3ROQA 5F5LA 1X7DA 4NK5A 4B4WA 3QWFA 3C7CB 3GDGA 3I6IA 3INTA 4TSKA 4W7IA 3S2FA 1HDCA 1E7WA 1PL6A 4J16A 1E5LA 2PKRA 2ZJ0A 2QRJA 3PQDA 2GDZA 4MVJF 4P4NA 1ZW1A 4LISA 3K6JA 1YB1A 3AU9A 1XIVA 4I08A 1NPYA 2JCVA 4EUHA 3BMOA 4YAKA 1BDMA 3TZKA 4E3ZA 1VC2A 4NBVA 3GZNB 4YWJA 1QG6A 4YAIA 1V3UA 3WWYA 1GQ2A 2X7HA 2CDCA 5JE8A 1ONOA 5TC4A 1PJ3A 1ZSYA 5DP1A 4NIMA 1D1TA 3W6UA 3E03A 2JD1A 1IPFA 1J4AA 3DL2A 4LN1A 4W4TA 4BNLA 4EJ0A 3K31A 4BO4A 3INGA 3VZSA 1Z82A 4ZD6A 4D43A 1D7OA 3S55A 4L8VA 4LMRA 5JCJD 2D5AA 3JYLA 3ZNNA 4BMVA 2J5RA 1PS8A 4ALLA 4BO1A 9LDTA 2WYUA 3VDRA 1YS4A 3DBRA 5KKCA 2AEMA 3WGZA 3ADOA 1AUPA 3JQ7A 2GPTA 1JTVA 2WM3A 1G6KA 2YUTA 2ZYAA 2DUUA 2UV8A 4IPTA 3RUDA 4FCCA 4OMUA 4IZIA 4YBZA 3HDHA 1HDXA 1ENPA 3ZCXA 5KJFA 1SB8A 3H5RA 3VC7A 3WGHA 3PJFA 2EP7A 1ULUA 3QVSA 3VPFA 2RHRA 4CV3A 1T25A 5T8KA 2HK7A 3KB6A 2OORA 4LRTB 3RUAA 3GG9A 1AN9A 4ND3A 3CTMA 4DBVO 1NNUA 4EITA 2IRWA 3VZRA 1QYCA 3JQFC 5JO9A 3GQVA 2O7SA 3JD4A 3TDKA 1G0OA 3M6IA 4Q3AA 3ZGYA 2PK3A 4B3JA 1I8TA 3QY9A 4I5GA 2HJRA 2I5PO 5ER9A 4BHTA 2VYNA 3Q9UA 4YJHB 5F5NA 3LU1A 1PGOA 1PGQA 1GR0A 4IQ0A 2P9EA 3UAGA 3LLVA 3FNHA 1NBOA 2VWHA 4D3DA 1YRLA 4J1QA 2J6IA 4Z0TA 4MVJD 1QV7A 4NBWA 5IDWA 1UDAA 3HQ4O 1DFHA 1VE9A 1NVGA 5JS6A 3RBXA 2CF6A 4EUEA 1B8VA 2FP4A 3EUWA 4TQGA 4OOFA 3L9WA 5CHEA 4CUKA 3U49A 1E1LA 1I30A 2BHLA 2VZ8A 4ALJA 1T2AA 2UYYA 5TS3A 4RPGA 3CZRA 5JDIA 3I1JA 1N7HA 2ZCVA 1YQDA 2O23A 3NJ8A 1M6HA 3MCVA 2XAAA 2WEKA 3WGTA 3OIDA 2I76A 4CV0A 2YY7A 4I5DA 4OXKA 1SC6A 4L4SA 3V8BA 4RF3A 4D7AA 3DONA 4LGVA 4R1TA 3DC2A 4J9UE 4CUZA 2QZ9A 1EFKA 4YRBA 2EKQA 2NU6A 2WE8A 3KLPX 4RF4A 8ADHA 5TIIA 1NWHA 4BO2A 5G4LA 3HUDA 2D3TA 3AUSA 4Y6PA 4GWKA 4IJUA 2B36A 1FF9A 1NXQA 4YXFA 5J23A 2XXJA 2VNAA 2X0IA 3JV7A 2YFQA 4B3IA 3A28A 5DBFA 4UVIA 2YHUA 4BO0A 2VT2A 4Q3EA 1ISJA 4GWGA 4AJ4A 2C07A 1GDHA 5L7YA 4RVUA 3ZZNA 4OKIA 5G0UA 4GKBA 1U4OA 3CZMA 1T24A 4PG8A 1CRWG 1ORRA 3CINA 2EJWA 5C5IA 3NRCA 1GY8A 4DGSA 4OJNA 1I2ZA 5JMWA 1C0IA 1HDYA 3E6AA 3H2ZA 4BNVA 4HY3A 1HLDA 3RROA 4CM1A 1NVTA 2HK9A 4DUPA 3MJTA 2I6TA 2P4QA 4R1NA 2G0TA 2BH9A 1I3LA 4J1NA 4BQRA 4JBGA 3WGYA 4YJFB 4WLUA 1YQGA 2JJYA 1LSUA 2J3IA 1ADCA 1UDBA 3QWHA 4WUVA 3EZYA 1K0UA 3K8ZA 4RVDA 4ZQEA 3H6KA 2CNBA 1VI2A 3QVOA 3GUYA 4LW8A 1R15A 4YAGA 2EXXA 4OXNA 1HL3A 5CDSA 1QXSA 5F1OA 5LC1A 5BNTA 3IL2A 5TT1A 2IYPA 3MTGA 3FR7A 1PS0A 2NUAA 1RKXA 4KTVE 3NTOA 2WTBA 3HFSA 3LC1O 4IINA 4FOSA 3PGJA 4Z9XA 4FD3A 3QV1A 1HDOA 3IKTA 3W1VA 3QLJA 2X1HA 1CERA 2VCYA 3LC7O 2HDHA 2NQTA 2NACA 3JD3A 4UVGA 5I7SA 3HDQA 3DHNA 4XJTA 4K6CA 3VPGA 4WGGA 2FR8A 1P1IA 2DC1A 2E48A 5CPBA 3RWBA 3TN7A 4PLZA 4CMBA 4WOKA 4PZDA 5U9CA 1P9LA 1EUZA 4AJ2A 1JLLA 1B7GO 2A4KA 1P77A 4TZTA 4MO2A 1V3TA 4OYRA 2VHZA 1MA0A 2OBYA 3L4SO 4OO3A 4Y8VA 5GZ6A 4A10A 4XR9A 4C7KA 2VOJA 3HE3A 3W8EA 1P45A 3ZW9A 1E3SA 4A26A 3M1LA 3HN2A 1YBAA 1ADFA 4QUKA 1ZZEA 1XELA 1BGVA 2Q49A 3IQDB 3VVBA 4ZN6A 5BNFA 4XRRA 3UHAA 2JFFA 2OHXA 5IJZA 2Q1WA 2RAFA 3DHEA 4BUCA 4CQLB 5C7OO 1NX6A 4YJFA 4TZKA 4L76A 3RQSA 3VPXA 2VYVD 4ONEA 3PP8A 3JQAD 4QTZA 3G17A 4W6ZA 1QORA 5U1PA 3DOJA 1VLLA 3GN2A 1DSSG 2RBEA 2VZ9A 5EJ2A 4O1MA 1ENOA 2DBRA 4J4BA 2GZ2A 1W8DA 2H6EA 4BKPA 3F5SA 4CMEA 3BTOA 5BSFA 1ISMA 3WBBA 3E1KA 3KRTA 4OAQA 3MZ0A 2V6MA 1BTOA 1SOWA 3A14A 4BNZA 4M49A 3ETEA 4RVGA 3BA1A 3L6DA 4AJLA 4ESOA 4RV9A 4TVBA 1I10A 1HYEA 4OSOA 1E7YA 5JSFA 1E7SA 2B4TO 2BFMA 1PJ2A 3R1IA 3AY6A 2EV9A 3OJ0A 4F6LA 5IDXA 3QRWA 4O63O 1UUFA 4CM3A 3UXYA 2HUNA 5IN5A 1EUCA 3D3EA 4NG5A 3GG2A 3B1FA 3H65A 1J0XO 2PH5A 4DL9A 2DFDA 3INRA 4CLOB 1KERA 3QVXA 1E1KA 1ULSA 2EW2A 1N2SA 3ZWBA 5JO0A 1I33A 3GNQA 2JAHA 1MXHA 4WLNA 5JDCA 5DNAA 5F21A 5JMPA 4IJWA 2AE1A 4NH4A 4OM8A 2ZYDA 4DMMA 5IFLA 4UVEA 4KZPA 2I65A 2D8AA 2H63A 3MJSA 3F1KA 3PWKA 3GHHA 1F0YA 4CQLA 2IXBA 1BXGB 5DCYA 1MUUA 1PX0A 1QV6A 4BKRA 4MVJA 2YYYA 2CZCA 4EEZA 1I01A 3JQFA 5ILGA 3ANMA 3ORFA 4NBUA 4B4OA 1YKFA 4W99A 5I9LA 1UAGA 3GC6A 4XGNA 2B0JA 2DVMA 1MGOA 3D0OA 3DFZA 1LDNA 2C0CA 3CH6A 5G4KB 1V35A 4KWIA 1A27A 1QSGA 4XGIA 2PFGA 2QIOA 3KOUA 3TF5A 3ITKA 5DT9A 1Q0HA 4K28A 4GGOA 3WOHA 2R00C 2X9VA 3DBLA 4I5FA 4JCOA 5KVSA 3L6OO 2VUUA 1DHTA 1UXJA 1YVEI 1HEUA 5BQFA 3WMXA 3WXBA 2AG8A 4I9HA 1R12A 1Y8RB 4GLLA 2FZWA 5L3ZA 3M2PA 4KP7A 4BV9A 5EPOA 2WYWA 1LC0A 4ALNA 5DOZA 4P4LA 4BNJA 3L4BC 2GLXA 1Z73A 1ZMTA 3KBOA 1HE4A 1AXGA 2D0IA 2EKLA 3RKUA 1DIRA 4KOAA 4BOYA 4H3VA 2B37A 4LVCA 4OQZA 1TXGA 1XWFA 2BLLA 3EMKA 3GMDA 3LDHA 5BSEA 5EQDA 1LSSA 4CLOA 5K6AC 3DTYA 4G65A 4IMPA 1T2EA 1TVEA 3ZWPA 2VRBA 4DLAA 2BRUA 2AEFA 1DDOA 1EK5A 4ZQFA 3JD0A 2C7VA 3GH3A 5KIAA 3ROMA 2D5CA 1EE9A 3WYCA 2O3TA 3I52A 1I24A 2O4CA 4H16A 3GUCA 5L51A 3JQDA 5JPIA 4AJPA 4BNYA 1LEHA 3D4NA 3G0OA 3Q2KA 1U8XX 2FN7A 2WD7B 4E5NA 3MOGA 1XCBA 4I1IA 4CM4A 4NQZA 1X0XA 2CFCA 3ZN2A 3HSKA 2OZPA 4U6QA 5L7WA 2FSVA 1LC3A 3GOHA 1LLUA 4YJGB 3JQAB 2Z1NA 4FGSA 5GZ1A 2UUOA 2XF8A 1KC3A 3JQ8B 2C29D 2B35A 5G4KA 3C7AA 3JQBA 1S7CA 3OBBA 2RH4A 2UDPA 4EJ6A 4E31A 4YT2A 2CVOA 4XIYA 4OL9A 1EVZA 4QEDA 1O0SA 1QYXA 1BXZA 5ES3A 4YYZA 4IDFA 4BGVA 2W8ZA 3RD5A 4WOJA 1Y8RA 5JYDA 5JBIA 3DMTA 2W2KB 3I9NA 3R3SA 1U7HA 1LJ8A 3HN7A 1XSEA 1Z45A 3AU8A 1H2HA 1IL0A 4CJXA 2PZLA 3ZI0A 2B5VA 3LSYA 1X13A 3NKLA 3VH1A 4MKXA 5EMHA 4YAEA 1VJTA 3ONDA 1DPGA 5IZ4A 1PJBA 4BNXA 3QSGA 1N1EA 2VYND 4AJKA 2A92A 1H6DA 2FPIA 1X7HA 3RC1A 4MJLA 4HFJA 2CF5A 3ZWVA 3H2SA 1WPQA 4FFNA 4NR0A 1M66A 1JKJA 3CMMA 3EVNA 1PQUA 1G0NA 3UN1A 2QQ5A 2QZZA 3EK2A 4IS2A 3WS7A 1Y6JA 1ZK0A 2DTXA 3AUAA 3TQHA 1I36A 2J3HA 1GYPA 2X23A 3QE3A 3H3JA 1E5QA 1WDMA 4MVJE 3SC4A 3HWRA 2QG4A 5FI3A 3WTBA 4DTIA 4FN4A 2VHVA 1GCUA 2FR0A 4LSMA 3KEQA 1YJ8A 2WD7A 7MDHA 1YL6A 2G76A 5THKA 1NQ5A 3D4PA 3GR6A 1E7QA 3WSWA 1PJLA 4XKJA 4AJEA 3M2TA 3PHIA 4G2NA 4B7XA 5JAIA 1H94A 3RUCA 4YJGA 3GAFA 3JQAA 4OXYA 3C3XA 4R01A 3JQ9A 3OF2A 3PTZA 4AVYA 5IG2A 3PEFA 1Q0LA 2CVQA 3R6DA 2EEZA 4CPDA 2G1UA 4CL8A 1CDOA 4YT5A 1NASA 4GMFA 4Y9DA 4G5HA 4AJHA 5IXSA 4PG4A 2HJSA 2VT3A 2Y93A 2YV3A 5LDGA 1SPXA 4J6FA 1OBFO 1B14A 4IDGA 5T6BA 1PIWA 2HRBA 4QXMA 1GZ4A 4PLVA 4RGBA 3WR5A 4QX6A 2YJZA 2X0RA 2DU8A 2IZZA 4HFRA 2OUIA 4R68A 1T2CA 3WB9A 1NM5A 3B20A 3RJ9A 5DZSA 4RPLA 2B69A 2D2IA 4HWKA 3DZHA 3WIEA 5DBIA 1C1XB 1LDBA 2V6GA 3RFXA 3K96A 4WLVA 3CPSA 5H83A 1HE3A 2CDAA 4FC7A 1KOLA 4L75A 3WYEA 1U2DA 5TRTA 3NT2A 4MVJH 1ZK2A 4OIMA 4PZEA 2ILTA 2JFHA 5EERA 3WTCA 5A04A 6LDHA 1WZIA 4RLSA 5TX7A 4WLFA 2Y05A 4R1SA 4UAGA 5A02A 2X6TA 4IZHA 1K89A 2CDBA 3U4CA 4ZA2A 3RVDA 1UP7A 4FFMA 4OKNA 4ZQHA 1NHGA 3ZHXA 2ZB3A 1AHHA 3I4FA 1CIVA 1R0KA 2Y0CA 4OGWA 1R16A 3GVCA 3AOEC 4F6CA 1NHWA 3G49A 3ZWMA 2A35A 3ZNPA 1MB4A 1LTHR 4WCFC 3EAGA 1GTMA 4W9NA 1HWYA 4TRJA 1L1FA 4BQPA 4CLHA 4BO7A 3P2YA 3I5MA 2HO5A 5KKAA 3ROPA 5TT0A 4NFSA 1R4NB 2GN6A 4D42A 3S2EA 3QA9A 2Y1DA 2V7PA 3KO8A 1WLYA 2AHRA 3PHLA 3SLKA 2HK8A 1LDMA 4NHEA 5BSGA 5KVVA 4UREA 3KSUA 1VPDA 5B4UA 2O7QA 2PKQO 4YQYA 5FFFA 4BV8A 4D3FA 3DZGA 5KCZA 4YVFA 3PYXA 2E4AA 3ZV3A 2WJPA 3BIOA 3H9JA 1RM0A 2GN9A 5BNIA 3COSA 3AI3A 1SMKA 1TT5A 3DQPA 1X1TA 3IS3A 5L4SA 3TFQA 3TL2A 4D45A 4B8ZA 3DXFA 4ROSA 1C1XA 3TFOA 2DQ4A 1UDCA 2P5YA 3FNFA 3BTSA 2VUSA 4NJMB 4QFDA 4NPCA 5ILOA 2Q99A 1JWAB 3PPIA 2YV2A 1H6AA 4EYEA 1PZHA 5B12A 1UR5A 3PJGA 5THQA 1H6BA 3DZJA 3NDIA 1ZXBA 3V2HA 1ZSVA 3DFUA 1GAEO 4XQEA 3JYPA 1QYVA 2OFPA 3C7DB 4XYEA 4JJIA 3F46A 3G1UA 1ISFA 5EIOA 5ENDA 3OP4A 3GVXA 1XEAA 3PYMA 2ZTVA 4PG5A 2JCYA 2BFPA 3I6QA 2PLAA 4Z9YA 2GERA 1ZIDA 2W90A 4MIYA 3G1TA 1XQ6A 1ENZA 3LQFA 4MP3A 4M8SA 4YDRA 3QVWA 4B3HA 3KSDO 4K9DA 4NNJA 3JQ6A 4R5HA 3Q11A 3AY7A 2Q50A 2Q1UA 2AW5A 2Q4BA 3KSZO 5K6AA 3RFTA 1R4NA 3EY4A 2EIHA 3I83A 1L7EA 2B4QA 4AJOA 1F8FA 1B3RA 1ZEMA 3R0IA 4TVOA 1H93A 3GRPA 3KYCB 3UFXA 3PZRA 1M76A 4BKOA 3Q1LA 5L4NA 1JN0A 4YRAA 2H5LA 3GF4A 1P0FA 4NBRA 5FWNA 3L9XA 2Y0EA 5KNLA 3NEPX 4Z3DA 2OL4A 3TRIA 1VSUA 3RKRA 1XGKA 3DAFA 3EYWA 5JCXA 3C1AA 4HKTA 1ZCJA 1P1HA 4ZVVA 4DQVA 2AQKA 4P38A 5COAA 3FWZA 3W4JA 5JAZA 1UZMA 3TZHA 1F06A 4DIBA 4HV4A 5IXYA 3U4DA 4GGPA 1P1KA 1IB6A 4HUJA 1N9GB 3BMQB 4NJMA 8LDHA 3B70A 3BHIA 4MVJG 2EWMA 1L7DA 4Y67A 2EJVA 4U8GA 4JJGA 2BELA 4YACA 4RO0A 4ZQBA 1PJCA 4XZ3A 1EFLA 1R4MB 1ID1A 4FFRA 4GX1A 2OOSA 4AICA 3WDSA 1E3LA 5A1TA 4IS3A 1NFRA 5JAMA 5A06A 3FNEA 2DT5A 3QWIA 1SZJG 2JCXA 2VHXA 2VHYA 3KZVA 1PZGA 5F1KA 3GZNA 3X2FA 4JP2A 2ZCUA 4OHUA 1PSDA 5HTOA 5LCXA 2DTEA 4PN3A 4II2A 4DIOA 1CF2O 1CETA 1WZEA 3Q2IA 4FPXA 1EEHA 4M1QA 4K6FA 5I8ZA 1GADO 1U7TA 4D46A 1HZJA 1OMOA 2BMAA 1EK6A 4FR5A 3PDUA 4HNHA 4NFYA 3LK7A 3PYLA 1QYWA 4CR6A 5IZCA 5A03A 1T4DA 1UH5A 4IIUA 4UEKA 2BI7A 2E6UX 1LRLA 3NYWA 4XB1A 2Q1TA 1T26A 3FPLA 3AJRA 3Q3CA 3ZWAA 2Y99A 3SXPA 3RFVA 1FDVA 3RC9A 4FJ2A 1ZO8A 4E13A 1JW9B 2HMTA 4KUGA 5L7TA 1CWUA 3U3XA 5U4QA 1DOHA 4INAA 2X22A 3N74A 2HKIA
chains in the Genus database with same CATH superfamily
1A0OA 2R65A 2HDNB 4EYQA 4IJSA 3X3HA 2CJWB 3KQTA 3SEFA 2GXSA 2PGAA 5DVZA 1C7EA 2H1CA 5FJIA 1ZVMA 5GGXA 3R7WA 1QG2A 1QZZA 3A6JA 4TTTS 4PPFA 3JQQA 1L4HA 5DGDA 4KH1A 4RULA 2PD6A 1Y6ZA 4GT1A 5AVSA 1JYEA 1G8JA 4GYJA 2GH1A 4DIFA 3PSHA 2WZQA 2YXLA 3OJWA 1AB6A 5IDYA 4CKWA 2AOWA 1QCCA 2Q46A 2R11A 1K9SA 1SUWA 5H3CA 5IJ9B 2Q5LA 5EUQB 1BG6A 3NAZA 3UMMA 1O7JA 2VNSA 4KUEA 1Z5VA 3OEWA 3D2LA 3D7LA 3Q3JB 3GFBA 4HMPA 1WDTA 2LGJA 4GKKB 1DXYA 2L42A 4DR6B 1ZJ4A 4MMZB 2ZFUA 4OGFA 4Y2PA 3B6IA 4DV1B 1N92A 1RLTA 5CX4A 3HKCB 3SS8A 1C14A 2OECA 5KTPA 1OFVA 1QH9A 3MQ4A 4O4HF 2W2LD 1ZAYA 2I3DA 5C35A 1UOEA 2JGIA 2PRJA 1N2HA 5EVJA 3BORA 3LAWA 3PHHA 4EF5A 5JASA 3NT4A 3C3AA 1A2OA 1R9MA 4N5NA 5HG0A 1AQYA 4R3WA 1OGIA 5AICA 3G1WA 4Y6GB 1CZKA 4QFCA 3UH0A 1CUBA 2XUZA 5CVEA 4Y6QA 4LV5B 1EE2A 3NBYC 2HMUA 4LNHA 3E8MA 1YUMA 3SYMA 2DULA 2YMPA 3OEEA 4DJTA 1H4VB 3FUCA 3FGOA 3EGXB 4CTJA 3V4RA 4IBOA 1EFRD 4MQ6A 2YV1A 3CC8A 5FQOA 2R7NA 3H13A 1KFCB 3IT1A 1VDZA 1T4BA 2JW5A 2YZ2A 3ANSA 1FBTA 5DNVA 4GXRA 1YONA 1NI5A 4Q3CA 4Q9JA 1R0CA 4OM7A 3LY9A 2YFHA 4RFSA 1ZN8A 4REMA 4BXOA 5A9RA 1GNLA 1K1EA 2OSBA 3A3PA 4R0VA 3OY7A 4RJ2A 4DPMA 2J4DA 5AVRA 1HYGA 4IGKA 3FSRA 2DPGA 5KNCD 3AOEA 4UNNA 3LC0A 1YH3A 2R1ZA 1F6BA 4JU8A 4RYDA 1A77A 5DDIP 4R54A 3N3BC 2PUWA 1SURA 2ZSKA 4TKVB 4RKEA 3USCS 3VV2A 4AJJA 4ZI5A 1I2DA 3U3ZA 4EUSA 4I6JA 3TAUA 2BSXA 1GV0A 2V4ZA 2H8GA 2XB4A 3F9RA 2A9OA 5J40A 5AW5A 3GXBA 1AA9A 2VUHB 4NI5A 2HUPA 2RHTA 1TI7A 1FUYB 1PBNA 2C4MA 2HMWA 5T4FA 4E15A 5TQ0B 2AC2A 2HQBA 1M2VA 3WQQA 2PWPA 3KUXA 3EGCA 4BC1A 2C96A 2XQIA 4EJ2A 1B3BA 5H3LA 3VR4A 3MEQA 3KR2A 5HS6A 2Q62A 3OHSX 3SD7A 2E89A 4RVCA 3G3EA 4RFVA 5JD3A 1J42A 2GVNA 2VZLA 2YJ5A 3ZWCA 2ZATA 4RPJA 1NW6A 1Y3FE 4YJDA 5E2BA 4ES6A 3B51X 2WDZA 1OTYA 4L0QA 1ZJYA 1AX9A 2JLXA 4AT1A 3G23A 1AKRA 1DBQA 1HI9A 2CXPA 4NZOA 1XRQA 1ABBA 4YCBA 2B2CA 2JI6A 2R751 5DHTA 5HK8A 1NNEA 4FHFA 1XMPA 4EO7A 2P0AA 4NCAA 2VCEA 4Q7LA 1M6NA 1KQPA 4M88A 5AJTA 2UU9B 5A5EA 2JGKA 3OFND 4PICA 5DMXA 1CUYA 5EJ7A 3C5WP 3HA5A 2VTVA 4FEAA 2O6HA 2V98A 1JFVA 1VG1A 4OQMA 3URKA 2FSUA 3MSCA 5JARA 3IIJA 2VPTA 2W6QA 4PCUA 4TV9F 1L8QA 5B58C 1R50A 5EIHA 1U80A 1XI2A 2FWPA 2I9PA 2PUHA 2QRKA 3IAAA 1BW9A 1NQAO 1XRLA 2VHWA 4FEEA 3K0AB 2V7QA 3L77A 4IXDA 2AF4C 4NONA 4X60A 4PC7A 1DBVO 4S1VA 1OLUA 2GFHA 2N3ZA 1H5NA 2ZREA 3UIEA 3VVMA 2UVPB 4R9NA 2XMSA 3X1MA 4P4SB 2R5WA 2P11A 3JCZA 3I2JA 1M1UA 4HH1A 2ZPAA 4YREA 4YV0A 4M9UA 4CV2A 4MDFA 2HHJA 2HI0A 1V11A 2QUKA 3OE7D 4GMKA 4DJ5X 4YCAA 5L4LA 1M5RA 2WU4A 5JSZA 4OMCA 2WK1A 1VJ1A 5CDUA 2OT3B 5C4IA 3TG2A 4B6GA 1M67A 2I1WA 1Y4SA 2RIRA 3EZ2A 4N82A 1ODLA 1P2UA 2IYNA 2Y92A 4IO0A 2CFTA 2LP4Y 2J0QA 2VSOA 1OAKA 1UKYA 2E6KA 2GEKA 3RUFA 3IVRA 3KKZA 2PM8A 4PCVA 2BGLA 3WGIA 4QM6A 2C99A 2R1UA 3NGLA 3D4LA 3N39C 3QVKA 5F2KA 5BVGB 3LFHA 4HWSA 2G07A 3UCXA 5C1OA 5AVTA 1S02A 1NC1A 2IV3A 3L6BA 3JTEA 2NIPA 4GOOD 1VLZA 1JU9A 2AV6A 2NV6A 2OB1A 2TMKA 5JNUA 1ITZA 1YJBA 3E5RA 5FHQA 1N7GA 4ESEA 3RS5A 4ZO7A 4MS3A 2RC5A 2MMCA 3DVAA 1JSCA 5DXAA 1QWOA 5EJEA 1AUXA 2AKYA 1TTTA 1E3MA 2ZJ7A 3K53A 1RMYA 2BGKA 1XVLA 1EBBA 4JI7B 4DILA 1JIQA 3HI6A 4JUFA 1DJNA 3AQIA 4M53A 3F67A 4MTCA 1QH8B 1I3NA 1CJSA 1VECA 4ITUA 4UBIA 2H5JA 4XXHA 5D5PA 5JATA 3GLIB 3AMVA 4BNTA 3H04A 3FDFA 3UO8B 4X45A 2V4UA 5CRIA 1TF5A 4DY4A 4UC0A 1ZEJA 2IHYA 2VHCA 1GGHA 4UM5A 1UODA 4JJ8A 2VHQA 3LNCA 1JZTA 1W0KD 4WK4B 3HKBB 2PFKA 1PT5A 4ZDIA 3UBTA 3BZBA 3SXUA 1E6MA 3AW9A 3TZEA 1I4DD 1BWQA 3PNMA 1CDZA 1D4ZA 4RMIA 5H16A 3KCNA 4GNRA 3BE6A 2DPLA 1QB8A 4RA6B 1ZM3A 1NWCA 1DRWA 1YMVA 1ZWLA 3CNNA 4JYMA 5BYBA 1HX7A 1L4BA 2HQ1A 3ZBQA 3LF2A 2CCJA 4ZAXA 2PMWB 3H1EA 1STOA 3ASYA 3JALA 4CM5A 4CMGA 2YHBA 1BU5A 4EECA 3UNXA 5F7OA 1RWVA 4XPZA 4D8UA 2XZOA 2QRNA 3O6VA 1CQIA 2PX0A 4LZWA 3GLKA 3C1UA 4X5OA 4CIBA 1SEPA 1E4OA 4GSKA 2JJQA 1GKLA 4DLXA 2X58A 4LOJA 3ZV4A 1CLEA 5AJXA 1ONBA 1YZTA 3H16A 1RYHA 3ZGLA 4MPTA 3VAZA 3NJRA 3HVRA 2HSDA 1KIMA 5KWJA 3F6RA 4BP1A 4L3OA 3OBIA 4D41A 5I7RA 4J8PA 3KUCA 2V45A 2HPAA 3CPEA 4IZ6A 1WCV1 2D74A 3DEJA 4FDVA 1A4RA 5AP9A 4JGBA 6ABPA 3OEYA 5GVSA 2JFOA 1ZD3A 1SA0A 2PRKA 4IFIA 4L2IA 1GN9A 2A0FA 1QIIA 3KSBC 4ZZ3A 3DLBA 4WNCA 5ITSA 3RU7A 3TLJA 3EC2A 1F8GA 4MIEA 3D1JA 1TCVA 3VI3B 4X8OA 4DIKA 2WLSA 4NRDA 2GCIA 4RD6A 4Q9LA 1AXEA 2OVFA 2IZOA 2OO5A 2ST1A 3PKJA 2GK3A 4PRKA 4EUFA 1OGJA 4GSYA 2XKAA 3UGJA 4EW3A 2JJ8A 1KBQA 3FDXA 1CUCA 3SE0A 3NKFA 3F8SA 3RSFA 3ZHUA 5AQ1A 3GFRA 3R4CA 4EPVA 3OJLA 2REQB 5I8WA 5LUAA 3HNPA 1XUOA 3DQQA 2I54A 3DBHB 5F4ZA 4NZZA 4I50A 4J0EA 4IYJA 4DQDA 4CMIA 1IH8A 1FJ2A 1P2TA 3CLUD 4L5AA 1ZIXA 2BMVA 3UKJA 4KKXB 1ZCAA 1SCUB 3EB9A 4F97A 4I1UA 3IIEA 1BVRA 4QECA 4LXQA 4UBJA 3WJ2A 2C94A 2MIIA 2XX3A 5D3MA 3WYNA 2VDOB 2O3JA 1DZ3A 5A5GA 5B7QA 1P1BA 3ITNA 2OK7A 2P5TB 3PXAA 3GFOA 1E3EA 2AFHB 4ZVUA 1OSNA 5EWLB 5FPHA 4LX0A 1GNPA 1BRMA 2RHBA 4PZCA 4WN9B 3BB1A 5TJ9A 1AU9A 3DVRX 4EO4A 1QLWA 4MPRA 3LT0A 1PF7E 2IXEA 1C81A 2P35A 3B38A 4U7DA 1ZI9A 3TIGA 2ZE6A 3RFCA 4MDHA 1R2QA 4LC9A 5F64A 5HDBB 4KBYA 3H18A 3R5JA 1Y3BE 2P4SA 4JS0A 5T8KC 4EJSC 3ZVNA 3V7UA 1BE1A 2RB4A 5K9ZA 3TIVA 1C0EA 5KREA 2EP8A 4GBJA 2UVDA 1PWZA 2EATA 3DT8A 3IESA 4QDTA 3IE1A 2GK7A 2YV5A 3IT3A 5SZKB 1DBIA 1I7PA 5MFPA 1C3LA 3L7CA 4HGYA 4XIIA 3FKJA 4MI9A 3NVMB 4CLXA 1QIFA 1UZNA 3OOYA 4FWIB 4Y2HA 2JGDA 3Q9NA 5DYIA 3QEAZ 1HO3A 4G67A 1JHMA 4M3NA 1YDGA 5E6SB 4TVSA 3TQIA 3HP1A 2GRJA 3PDIB 1T3HA 3KYBA 5LP6B 4C29A 4BZZA 2E1PA 1K06A 2Z5VA 1AUVA 2DERA 3QEJA 5ABPA 2P7IA 1J8FA 3O1IC 5JQGF 3V1YA 1ZOIA 3GD5A 4GRAA 5LA6F 1DKPA 4LY6A 3KKNA 3QOXA 1L8LA 2LV8A 3TOCA 4NCBA 5G0VA 1D1QA 2ORIA 2P9JA 3MTJA 5HYVA 2F55A 1ECBA 1L7AA 2X4LA 4WOBA 4AROA 1AF7A 4ARAA 1V1MB 1T9DA 1UOOA 3FCXA 3IVXA 3A1EA 3KKEA 3QX7A 4QOGA 5G1NA 3RVRA 3E9RA 1FU7A 4JROA 1OC4A 1F8UA 2A9FA 2JHCA 2P78A 3STWA 3T7AA 3VNAA 3ZD9A 3HFRA 1ZYUA 4AS1A 1P29A 1QGOA 1RJ9A 3CRMA 3RIGA 1QIHA 4KO8A 1ZIPA 4EPTA 1B15A 1C1HA 2PH1A 4IJVA 3HWX1 3I5XA 1NP3A 2OPBA 1YBFA 4D3XA 2GN4A 1G4UR 3DZDA 4GMGA 4MGIR 4AAYA 1JJIA 2G28A 3DNMA 2CUNA 5H9VA 3A4LA 4W5OA 2IXDA 2LXNA 4E03A 2F1IA 1DFIA 1U0JA 1HT0A 3TS1A 3IURA 2IV2X 1E6CA 1LLDA 5JTUA 3HUEA 3OX3A 4KLZA 3I6YA 4BVKA 1V7ZA 1VLHA 5CB0A 1XL1A 3E0XA 4Q4CA 1YFKA 3ABSB 4MR7A 1EAMA 4DA0A 2QLBA 2PR2A 2VNHA 5MDHA 1JHOA 1O4VA 3H7AA 1LFAA 2NO9A 3FWNA 2G9VA 4KYVA 4X61A 5LZ5A 2QQGA 3ZE7A 4CMKA 4EUNA 2DTDA 3ND6A 5CG1A 2H1SA 1MQSA 1V4NA 5FOSA 2XXAA 5A7GA 2JDIA 3LUFA 4D99A 5IKOA 1GL7A 2HA6A 1DAOA 3DZKA 4DKXA 5BUZA 2O59A 3PIDA 3RBVA 3EJ6A 1JDNA 4A5SA 3U4MA 3L8EA 5JZMA 3DOCA 2PMDA 3HADA 5KUTA 4WOCA 1QRSA 4QTYA 4JLDA 4UU1A 1UF9A 2R4TA 4NVRA 4DDHA 2I29A 2VKQA 1GCAA 2JNWA 3R5KA 4Q93A 4XASA 3IEKA 5EWMB 5FCDA 2JK1A 3SKYA 1KHHA 1PJSA 2A1UA 3NHWA 1S96A 1R66A 2V58A 1X80A 3T3GA 1P2GA 3W2GA 1GKYA 1H0SA 2QP4A 2NSDA 3WBFA 3AM4A 4B81A 1ZK4A 3B3JA 3L5KA 4MAMA 1OAOA 2H06A 5EXPA 3WLTA 3ZQ4A 1HE8B 4CU2A 3MGAA 3O4VA 1DADA 1KIFA 3CZPA 3FOBA 4EW1A 1PSWA 2QJOA 4C5CA 3QH4A 4KV9A 2XMGA 4PYOA 4LNUB 3CUEF 3LXUX 4QASA 1PJ4A 4RD0A 2J0VA 3WLAA 1AGRA 2ATXA 5IDQA 2W2VA 2PBFA 5IXJA 3T41A 2NU8A 3U6KA 5B6JA 2CBZA 4J4TA 1PT8A 1E92A 1GG9A 5IAEA 2XRYA 2XCSB 4MS1A 1WXXA 1O77A 2ZI7A 5G40A 2I2FA 5PNTA 2CC2A 2IP4A 3DNPA 3U3MA 5KS2A 1DG3A 3TOXA 2ACVA 1HDZA 3MS4A 4NCIA 1Z0KA 3RANA 2JZOA 3TZBA 5ALXA 3VH3A 4CM8A 2W8BA 4EG0A 1CUZA 2AT1A 2YY6A 3A4YA 3JRNA 3UF0A 2UXBB 3D2BA 3EAQA 4WY2A 3RVSA 3VYWA 1OE0A 3SKXA 5DEIA 1JR6A 2HRDA 1LH0A 4EI9A 5JEEA 5KOYA 4P08A 2F6RA 4TRRA 2CDNA 1IHXA 2QQ0A 3NOVA 4WKBA 3P4YA 2VN8A 4HTAA 2B4AA 3PQ7A 2OV6A 4JA2A 2DMRA 3I76A 4JOQA 4O2BA 4XH9B 4RORA 1U0RA 4XOUA 4Q39A 2GYYA 2RH9B 3O84A 4XX0B 3U5TA 2IBTA 2FN4A 3PUZA 4FX5A 4DB2A 1R9NA 3HJAA 2ZKLA 1H23A 1AD2A 3F6CA 2OMEA 3WLHA 4ZYYA 7ADHA 1EUYA 1S3GA 4NXNB 4IDPA 2VPXA 5ELMA 2IUYA 4WIAA 4IIYA 2QTVA 2J5BA 2A88A 2WA1A 3DO8A 3DA8A 4FMCF 2XR1A 4O4JA 4IVPA 3VNQA 3E3NA 1QP8A 2DPMA 1PR9A 2VQSA 1YA6A 4BPBA 2E82A 2CEKA 1E9CA 2VT7A 2Z4TA 3DBRB 5CA0F 1P0PA 1Z6YA 1O95C 3O83A 4TL9A 4OFZA 2HLNA 2VAMA 3M6AA 4FDAA 5DH9A 1TCAA 3AWDA 1U3GA 1SXJD 2FJUA 5BRNA 3SVZA 2CEAA 1HDGO 4PFKA 2ZJFA 3VR5D 3UBMA 3K73O 5FRDA 4CG2A 3INGA 3OQPA 4ZVMA 1QLJA 5GJWC 3ZZUA 5J4KA 3AEZA 3JWPA 5C5DA 5B3KA 1L9KA 4HL6A 5CGQB 1YZKA 5BSUA 1YIOA 2Y6UA 3VTAA 1H9CA 2FNAA 4DSOA 2BMFA 2JIZD 1TCCA 3C7TA 4I81A 4MHOA 3TTSA 4RF2A 3OLYA 3PHCA 4IRUB 4MA4A 5GONF 3QVMA 5SZIA 1BNCA 3F3SA 1FNBA 5BQ3A 5BSWA 1D8AA 2A4MA 5COBA 3RW9A 4EELA 2LVBA 4M1SA 4Q24A 4V3CA 4LXYA 1Z6QA 3KD3A 1O5TA 3LFUA 1PQYA 2XBUA 1SK9A 3RREA 2G4CA 4BMPB 2XA2A 4DFDA 3RUIA 1W4ZA 4RA9B 3GGSA 1HNZB 4XYGA 4HP8A 1N2GA 5DM70 3TGLA 3KKMA 2G40A 1IQRA 5JV5A 1VYVA 2MYPA 3ZH9B 4GM1A 3F78A 2ZS9A 2GKGA 3WJAA 5ES4B 1XRJA 2JHAA 4V2UA 3G9UA 2O50A 4CWAA 3V2UA 4U02A 3K6RA 1EESA 3GAZA 4S1WA 1YWGO 1DQSA 3FMIA 2C4UA 2ZYWX 1JSZA 3A4MA 3JU3A 5A9SB 2J31A 2GAOA 2GEJA 3ZHZA 4CIYA 1THTA 4D9HA 2GM4A 4I66A 2XWQA 1CSEE 1Z33A 2HWXA 1TJ3A 3U48A 2FPPB 3NWPA 5JAUA 3I04M 2YZNA 2ZOSA 5CG2A 1HYBA 4CLEA 5KJ6A 1HNWB 3AI7A 4EX6A 2DPYA 1SIBE 2UZIR 2ZGVA 3UB3A 3UTCA 4UHDA 1ARZA 2J9RA 2BFEA 2ORYA 1IVNA 1FZQA 2BCJQ 3CRW1 3GHYA 3F5DA 4OLHA 5A3VA 4F86A 3ACBA 3H0EA 4ZVSA 4KQMA 5D6OA 2VA9A 2IU3A 4RPKA 4B7CA 1LBSA 4FBGA 5JXGA 5D6NA 1O5OA 5I5EA 5HIMA 3FPKA 1FDWA 1IHPA 3H5TA 1A95A 1YFLA 3U17A 3QYFA 1I0ZA 3AVOA 3STYA 4G4JA 2OGSA 3K9FC 4AF6A 1CU1A 2C2MA 2YWJA 1JDBB 2OOKA 4J2HA 4LMPA 5JDCC 3SAJA 4J7UA 4YAWA 5DX0A 2VBFA 2X0JA 3G6KA 3Q6MA 2HGSA 4L3WA 3GLGB 4BNDB 3ZCVA 1CR4A 1BVUA 4J2OA 5CDGA 2ARKA 1IC6A 1R4ZA 5MGBA 2HN9A 1THMA 3LUPA 4G5SA 4KLRA 5JLAA 4ECAA 1LQUA 4KPUA 4M76B 4E08A 5ESRA 1ZOPA 3THYA 1QGZA 4KIJA 1G9XA 2OZVA 4F04A 1PEYA 4WECA 3V4SA 5K3EA 1A7JA 1JDUA 2IHVA 3JSAA 2XKJE 2IYOA 2JCBA 2RSLA 3M0EA 1N0UA 3IELA 3L7NA 4O29A 1JR3A 3CRNA 1WDWB 3FMGA 1N8TA 4BQNA 1O9GA 4ABTA 2Z6AA 1ZX1A 1XYGA 3A4IA 4LOKA 1Z2OX 5KNBA 4B31A 4E21A 1W9MA 1KRWA 3FZEA 5LVAA 1ECFA 1JPVA 2RHHA 1UMCB 1W1IA 2A58A 3TBHA 4Z4IA 1G21E 5LLSA 3DHWC 4Q01A 3L02A 3DDNA 5ALJA 1P4AA 4B6EA 1OHHD 4DBZA 3WA7A 2YUIA 1NJ1A 2QROA 3HY3A 4QAJA 1D8TA 5TGDA 3W05A 2X8JB 4RKWA 4WKGA 1H2EA 2Y2UA 3QKRB 3TM4A 4YRJA 4OK5A 4TWZA 3GELA 2YRWA 1GHTA 1MQAA 1W44A 3KYCA 3HA3A 4LQDA 5BSKA 3KOZA 2QX8A 2WTUA 1BDBA 2AMJA 1AE1A 1H0HA 4G0OA 2BGMA 5A3QA 1QJ4A 2P27A 1OH6A 3FTPA 2CFOA 1AS2A 3X2EA 3IHTA 1QMGA 2C1ZA 2GO7A 2VXYA 2IOYA 3EHEA 4RQUA 5JAQA 3SHVA 2Y3IA 2Q9AA 7YASA 3FTFA 4ZZ1A 1TJYA 2ZTHA 1TA4A 4P93A 2IPAB 2QL5A 2QW8A 2OV4A 4B7ZA 5CIYA 4RTKA 3W5AA 3CUYA 4RE5A 4PHTA 4BNKA 3E0QA 4RSRA 3T7EA 1UAYA 1Q1NA 2JD0A 4WESB 4ZIRA 1M2HA 2I0FA 4CI9A 2ODPA 2P8JA 3UHOA 1UEJA 2BGJA 3IP5A 2YNMC 5FWXA 4B7AA 1ETHA 1NXSA 1N9GA 2OV3A 1KEKA 4CM6A 1Z63A 4YI5A 1HQDA 1L7PA 2GPJA 5JZBA 3LOPA 2UAGA 3EYAA 5HMLA 5ICMA 1FS6A 1U99A 1LUAA 3HHPA 2WF6A 3P9QA 3OFVA 1QYIA 2BFOA 5LXTF 4KV7A 3JRXA 5DYNA 2BEWB 1S2IA 3B1YA 3NHAA 1FFXA 2HX1A 2XGGA 3OJCA 4JBLA 1SHKA 4CL2A 5L53A 1DHRA 4NARA 1FL9A 3DP9A 4LX8A 3OJFA 4OHFA 1KVQA 1OLOA 2RC6A 3CF4A 5B2ZA 5TPZA 4TV8A 2HPZA 2QVBA 4RZHA 5JECA 4QGFA 3MRTA 2DFVA 2EG9A 4NENA 4D9BA 2EHDA 2VDWB 5EWJB 4DR4B 1TMKA 2ZI6A 2QTAA 3CLKA 3O3MB 2FSVC 13PKA 2VJQA 1U2GA 4L7QA 4CF4A 5ALVA 4HWPA 4TS9A 4CF7A 2VAXA 3AKYA 4W7SA 5HJ2A 1L7RA 4AX8A 4D9JA 1E98A 1T3ZA 3BAZA 4PYJA 1YMUA 1JQ3A 3ANLA 1GTG1 1LB1B 1FB5A 1TL7C 3C16C 5JZSA 1OB2A 1ONPA 4ON9A 4LTDA 4FFVA 4Z9FA 4JB0A 4ZEXA 1KR2A 3B5JA 4AZVA 1XXLA 2FY8A 1PQPA 2X5OA 3JZDA 1ESZA 1V9LA 1IIRA 2EQAA 2ZWOA 3U4QB 1RP1A 2E4XA 3UH1A 5KOIA 3BL8A 2CUTA 4Z1MD 2NNLD 3CLRD 1WD7A 2ZJ1A 4L02A 5CT4A 3QW2A 1T2FA 5DI3B 4B6PA 3KTFA 3ZU5A 1J8DA 1DELA 1KVRA 1L7QA 2NU7A 1KI6B 2RAVA 2WOJA 2I6SA 1EGHA 1ZK1A 3HCOA 3HBLA 5G0WA 2H2DA 1WCIA 5KCMA 1OWMA 2QM7A 1P3Y1 1EX7A 5AFSA 2O3SA 3I0MA 2ORVA 2VRCA 3ZUPA 4EYOA 5BVHB 3QKIA 1JDSA 4NBSA 3V7WA 1T6YA 4LTMA 4WCFA 2BMDA 1LZLA 1LDYA 1G5PA 4HBZA 1JVSA 5IJ0A 4EL5A 5HUQA 1QKIA 4E7PA 1BD4A 1JILA 1F4PA 4LRSB 4BFXA 2R7LA 1KP3A 3K2EA 3FNRA 1YSCA 2MHCA 1H42A 2WW8A 4K2HA 4BNNA 1G8HA 1OXBB 1T9CA 1TJ4A 2EFJA 3IO3A 4JFAA 3STVA 1GTVA 1R6TA 4X7MA 4ZU1X 3STXA 1T9GS 2ZB2A 4AP6A 2OCBA 1YZHA 2AXQA 3L04A 2VDRB 1MOSA 2KWIA 3E5MA 4LGCA 3IOYA 2PWAA 3MBKA 4H2DA 4FTWA 4REOA 3HR4A 4H31A 1L5SA 1LVUA 1PL0A 2EL7A 3KEFA 5JWHA 4CLDA 1J9EA 1X3LA 2QMQA 2QRPA 1TZ2A 2R66A 2NUTA 4GP6A 1NW5A 1YR6A 2Z8XA 4QOHA 4UZEA 1X77A 2VZEA 3D5EA 1B8UA 4XFJA 5G0SA 3TXAA 1MOQA 3CWCA 1ZM2A 1JI0A 4OLAA 2C4TA 1POWA 1UIRA 2Q27A 5EXSA 3SR0A 4DQKA 1VL6A 3K94A 1N2CE 1UBKS 3L6RA 5FP0A 1O95A 4YY3B 2RARA 1UMBB 1OLSA 1GL3A 1R37A 5I7VA 4ZCMA 1H9BA 4MIKA 3X1KA 4A9AA 3FCYA 5IAAA 1TM5E 1XRRA 3LI2A 5JD6A 5BW4A 5BSMA 4WZBA 1G3UA 2AN5A 3EIUA 3RDPA 2J6CA 3LXMA 2ZZNA 2FPWA 1QK3A 1B16A 4DC0A 4GX5A 1IRIA 3VPBA 1VJGA 1WUJS 2C8LA 3QF4B 1HKUA 2PZ8A 1QOZA 3QG5A 4INOA 1ZQ1A 4ZVOA 5IAJA 3I73A 3KJIA 2XAUA 4RGQA 3GRFA 821PA 4L07A 4M6WA 4DV4B 4IIJB 3K70B 4JNKA 2B8JA 4CI0B 1ZW6A 2A67A 4L51A 3EVDA 4JJEA 4HFNA 3L0YA 1W29A 1ML4A 2NO6A 2ZW9A 2H9YA 4UUBA 2G09A 3GVIA 2RD2A 4GL4A 2BL4A 4D9EA 5F76A 1RQRA 1TYDE 1PDVA 1Q7BA 2Q2WA 4JN6B 3FKQA 4Y30A 4XFDA 4Y2UA 1C3XA 3TRJA 5GY7A 1D7AA 1QP4A 4J3FA 3AF2A 3OUTA 2KMLA 3MJCA 4PO9A 2WWYA 4LJAA 1JEQB 2NXEA 3CUUA 2C9CA 5M29A 2GNOA 1F2TB 4KIFA 4JI2B 1ZSNA 3V1LA 4Y6SA 3L3BA 3CE9A 1U0FA 4RTQA 1OUMA 2V3WA 3E70C 4B48A 4BN0A 5FEUA 4A03A 1Q14A 2W2MA 1HEYA 3WGVA 3E53A 3GJ8A 2HA7A 4XVCA 4DRZA 2EW8A 1VTKA 3K09A 3EDMA 2JFNA 2D62A 3D2CA 4H6PA 1U2PA 1W93A 4QHSA 3ZI4A 2F3QA 1YL7A 4W8GA 2ID9A 3NHPA 3TZQA 4WBNF 7ABPA 3H11A 4IGFA 1N3BA 3TLXA 4I55A 5KWIA 2HSEA 2IXGA 3NBKA 3LVRE 4XCQA 1RHQA 4GUDA 2XEDA 4PS1A 3UJ3X 3R7BA 2YZGA 2PU7A 1E58A 2DUMA 1KH2A 1E9FA 2JFBA 2BTQA 1WUIS 2Q29A 4IFEA 4KLNA 3RSHA 2N1MA 1WXEA 1R6BX 3NDJA 3IHKA 3I0NA 4B80A 3QHQA 3ROFA 2FMUA 2Y66A 1FSFA 3MINB 3KHTA 1DNPA 2EAUA 2Z3ZA 2H1HA 2CNDA 5JAOA 2W6ID 1V0JA 2AR0A 3CH7A 5JYBA 1K08A 1USVA 3D5QA 3EW7A 4LVUA 3OZVA 1F8XA 4IDDA 1H2FA 2LTAA 1NOIA 2NAFA 3DAGA 4JLUA 1CYDA 4GPD1 3IUBA 9GPBA 2IK8A 5EUBA 3S4YA 2J7PD 5KMGA 3MIIA 4Q1VA 2R6CA 3MRXA 5GWXA 4S0XA 3KHUA 4HRVA 1QUEA 3AL0C 5DWQA 4R1LA 4PR3A 2FUCA 5I7EA 2XLCA 2WF8A 3P8ZA 1II8B 3M7IA 5IHPA 3IILA 1NW8A 3ELUA 2FWBA 2HHLA 3C45A 3L6UA 3RI3A 4YP5A 1EWRA 3PFFA 2HF2A 1BDJA 1D2MA 1YE3A 1EH5A 4OXRA 4U7TB 1DX6A 4DNPA 2TS1A 2X5KO 3D1LA 1J56A 3OU6A 1Z6ZA 5K0JA 1YFZA 2SNIE 1VFPA 4K81B 2WZDA 2FVXA 1ECCA 1LPAB 2R4UA 3Q12A 4HDNB 3COWA 3H2GA 1X9GA 1Y8QA 3MOIA 4YP9A 4EGAA 2VO1A 1TVKA 4BHHB 2CLLB 3H9QA 3OOEA 3PXXA 3ZBTA 1DJOA 2Q1YA 5HBRA 1VE7A 2GSDA 3H4IA 1RYFA 3H4TA 1F17A 3IUQA 3N86A 3R4VA 5AVOA 4EL0A 1KZ9A 1F3OA 3GRYA 3I5YA 1WHSB 3PFCA 2XNJA 3RS4A 1K2VN 3WV5A 1GNSA 2WAAA 4UM8B 5ER6A 3FB1A 4IJMA 4ZJPA 1NYQA 2X0DA 1TLTA 4Q1FA 2L2QA 4AUMA 4JEMA 5CYOA 4MA0A 4ID9A 5E9QA 2QN9A 5TE9A 3HK2A 3M5CA 2C61A 3FMVA 5DGXA 3C87A 1YB5A 1XU7A 3DHYA 4MI1A 1NBIA 1NDHA 2H17A 1WUKS 1OC2A 3JYNA 1Z4OA 3WLRA 3ENKA 2FG5A 1VPLA 1OLXA 1KORA 3I3SR 4WXRA 1J1IA 3M4JA 4JQCA 3FVQA 1QE5A 5LYJF 2IYXA 3KSAC 1XCGB 2AQIA 2Y0PA 2ZVPX 3CCFA 4KDRA 2X0NA 4KDEA 4YUWA 5EQFA 4IH4A 2H0RA 3CLUC 4J4HA 4BRSA 2XOKA 3GJZA 1Q1GA 1Z3IX 3K0BA 4OMFG 4YBRA 2ISCA 1QZXA 2PD4A 4D79A 3QXCA 1XKTA 2VHUA 4TWRA 3UA4A 1D1SA 3RK4A 4UNRA 3AZQA 1SCAA 1LV8A 1IBKB 4X6UA 5CFNA 1U5BB 3MERA 5C9ZA 1N78A 4ZODA 1IN4A 5JCOC 5JAHA 1BVHA 1YRYE 4C3UA 1R6AA 3DYVA 2EQBA 3UMGA 3TW6A 1M2OB 2QVXX 5CA1F 4FKBA 2YH2A 3E27A 2F17A 2IBSA 1OXMA 1DB3A 3MJVA 1GZ3A 5TVKA 3WFJA 1KI9A 4RVNA 4YDSA 1YUNA 4LZLA 4YMSA 3N0WA 3RSQA 2ZUDA 1RI5A 1UM9A 3STUA 1F8YA 2SCUB 3HYNA 1TAQA 4I3HA 3VR4H 2REOA 4KFRA 3QBDA 3T3EA 1YMQA 2WJJA 1UKEA 3IQFA 3IIKA 4JI6B 2NYVA 2QRGA 4REQB 4AC9A 4LSZA 4RSMA 4UUMA 3IPAA 2CLMB 2JLAA 5KYWA 4RUKA 2VWQA 1DTWA 3GGGA 4V0QA 1JB9A 4B0OA 4K9SA 9LDBA 5KVCA 3UJCA 1L4EA 1ZMBA 3BSSA 1L1RA 2RHWA 4DLTA 5A0TA 1YO6A 5CX1A 1TQ8A 2V55B 3ESZA 4IOMA 3CB2A 4NCKA 3UHPA 4MO9A 4PYNA 1ZH2A 4U2BA 2WICA 1JAIA 1G64A 4E30A 4EMTA 2Q4RA 4BO8A 4JIGA 2PXAA 1YJ5A 2WG2A 3FW1A 1ZVKA 3WGOA 3HB4X 1O08A 1DUSA 2YYZA 4V2IA 4NH0A 4XCXA 3WMEA 3WRWA 1KP9A 2B99A 2QD5A 3A36A 1RI2A 3VH2A 2EX4A 3H8VA 5ERYA 4NZPA 4ZI7F 3CZAA 4YUAA 3LL7A 2ZUEA 2QTHA 3OPMA 3O9ZA 4YWHA 1JX6A 1RVV1 1T5OA 2C4KA 3FSGD 3LP8A 4KQXA 4CTOA 1AKYA 4XYBA 4B3DA 1PD0A 2WNSA 9ABPA 1AV6A 4P58A 2I7TA 3PUVA 3DT9A 1DWPA 3EVFA 2XYVA 4D56A 1I4TD 3FCUB 2ISSD 1F12A 1NPTO 3O0DA 2CFSA 3I9MA 3OVMA 5CMLA 3BT7A 1OV4A 3R41A 4FNOA 1CPYA 2VNIA 4B3TB 3KAQA 3ZDRA 2QMEA 3Q3GE 2OBXA 2RH8A 4PAGA 3NB0A 4Q9AA 2XZDA 3Q98A 5FNVB 2YWXA 1OFUX 1C41A 3TE6A 5EJ6A 1DX4A 1YZGA 2CNLA 3ICVA 2GFQA 4MYRA 4DYHA 1NR1A 4B40A 4LK2A 1TTHA 2YMLA 4MPDA 4XDZA 3T34A 3UUWA 4ZVLA 1A50B 1RWQA 3DE6X 3AVQA 2H9IA 1N6LA 2EX1A 3CHYA 4O1IA 4O4IA 2G1JA 1AXRA 4K9RA 2FHSA 2DY0A 2IPXA 5DX1A 1C1DA 1T6BY 1XLTA 1ZVJA 3SR4A 4HB2A 1L7VC 1XP8A 2J9XB 1HDRA 3TE7A 3G0HA 2GF0A 2HPVA 4DLWA 3KOWA 1QZTA 4Y6OA 1XF9A 3V8MA 5CBPB 5LZ9A 2PZFA 3IVGA 5AHXA 4ZGBA 5LOVB 1E2BA 5CDHA 4P3KA 4WGFA 1IZ9A 4AFNA 5TMDA 2O8CA 4UQLA 1SBIA 5HF5A 1Z08A 4TX1A 1VKRA 4ZAVA 3TRFA 2ZE7A 2PQ0A 4MGYR 1VIVA 4RPHA 2BJHA 3PE6A 2J8ZA 2NG1A 3NHZA 4IXMA 1JXOA 1N2IA 3U16A 1TT5B 4BEBA 1JJBA 3LYLA 3Q88A 5EY5B 1NZDA 5FDFA 5JHGB 4FWTA 5FFNA 1Z56C 3QMPA 3A7EA 4G0QA 4E5MA 4DREA 1PJRA 5IN4A 1I6LA 3BQ9A 2XXAB 1GNVA 1K6JA 1IATA 1NFQA 2IXAA 4XARA 1Q7EA 1KAEA 2RI0A 2V1XA 2VTDA 3LCCA 3OM9A 4PLCA 1DC8A 3FAZA 3X44A 2NVOA 1R8XA 3G8BA 3T5GA 3KZNA 4QUEA 3W4KA 1IZ0A 1XAJA 2SHKA 2X5JO 1NGSA 2F1OA 4XB2A 1ESNA 1Y1LA 3K9CA 4L5YA 3UMRA 3NIFB 3OJXA 4JT4A 1CS0A 2HC9A 3MMXA 3TCXB 4UU7A 5HGJA 1RKVA 1MXFA 4B82A 4H08A 4IGEA 1PLJA 1U8EA 1SIWA 3QPCA 4TTVA 5CW1A 3SSNA 3BDAA 3DBOB 2ZJ5A 3NV9A 4JB2A 4N65A 4C4YA 2CV0A 4Q3NA 1TFUA 2P4HX 5A71A 1TD1A 2C1XA 2B1GA 5SZJA 3Q8MA 4RSGA 3T7IA 4GYYA 1SBCA 3WGJA 2NZJA 1ZK3A 3CWZA 2I2XB 3NTRA 4S1OA 5EHNA 2G9UA 1RMQA 4TMXA 4TXJA 2WAMA 1L5MA 2NV2B 1R0RE 1XTZA 3ECCA 3OZRA 3Q7TA 1WPRA 1OPRA 1G291 4YASA 1GDDA 3A4TA 4WLOA 1U4SA 1OXXK 3GDHA 4MCIA 4XTCS 5ALQA 1XNQB 1NNI1 1PLLA 4NMXB 4UULA 1GN8A 4HFMA 3PTLA 2IYTA 4R1UA 4ZRMA 4S3MA 3V34A 1YQXA 1JQDA 4LV6A 5TXGA 4LF5B 2DPXA 4FKZA 1SNYA 4FZ3A 5H1YA 3HU5A 5KSWB 2GEFA 4PAWA 2YWRA 3P0EA 2PV7A 1I5EA 1QO0A 2POCA 1EFCA 1NYRA 1E2NA 4AZ3B 4K8RB 1KYVA 5BYJA 3PQEA 3U19A 3CKYA 2XCRB 2OGWA 1QHSA 4RY2A 1A8PA 1K0FA 1SUFA 3MWEA 2GT1A 3Q8WA 3GLSA 4BATA 4E5UA 1CZRA 3RPEA 1U4NA 1SUDA 4XGRA 1DAPA 1R18A 5J2UA 4OQLA 5K01A 1QF6A 4LVNA 2BKEA 5REQA 3C5VA 4UHJA 4N0EA 3VZQA 2C78A 5JROA 2E85A 3W3AA 1XG5A 1H4SA 3L7YA 1YDEA 4KXWA 2QZPA 3K16A 2J09A 2EERA 3AIOA 3LECA 3SNKA 5F1YA 4R8MA 1GYRA 3KL2A 4MRRA 4QQ8A 4ECEA 1X7DA 4B4WA 4JLOA 2WY2D 5K1ZA 2I1QA 3AXTA 4B3MB 3C7CB 3KTAA 4TSKA 3AKEA 1A98A 3RVJA 2BH2A 1VDMA 1S3IA 1E5LA 1KK0A 1M10A 3ROTA 4FM9A 2ZJ6A 5HJ7A 2SICE 1E8DA 1YB1A 4R2LA 2AFHE 1HTTA 4X3CA 2P6RA 2JCVA 1XZFA 4JI3B 4EUHA 5AT1A 2RGEA 2ZIWB 4TLMB 2R8PA 3LUKA 4J0QA 1BDMA 3TZKA 1UPXA 4GMXA 3VUEA 1ZN9A 2KJQA 1OZ0A 1QG6A 4AJ9A 2MINA 4XWOA 1Z4KA 1KP2A 5JTTA 3VC3A 1YVPA 4PNPA 4R84A 2AL7A 4RH0A 3R75A 2ZANA 1KFBB 1YR8A 4NSNA 5FIUA 5JE8A 5B3JA 1FW8A 1GCGA 4FHCA 5TC4A 4Q7JB 4AW9A 1HORA 2QRHA 1FLVA 4TT3D 5DEOA 3DWIA 1IPFA 1J4AA 4FDUA 4W4TA 5DM4A 5AW1A 1BRTA 3K31A 4GE0A 1K3FA 2QTCA 4EA7A 5K8LA 4Y1RB 3HS3A 5JCJD 3HI4A 4ZYXA 2V3CC 4HYYA 3ICWA 3HCWA 2ZIEA 1VL1A 4YJ3B 1M73E 3TR0A 4KR7A 5K2MA 1SUEA 1C8LA 2AKAB 2WILA 3FFWA 4G4GA 4BASA 4FINA 3MK31 1AUPA 1VLVA 1W59A 4MMYB 4UFNA 1G6KA 3DEKA 1WABA 4JEHA 1PFVA 3LY7A 1UJNA 3KQMA 5B5SA 4IPTA 4FCCA 3BOSA 4OMUA 4ZU6X 3TQTA 3UK7A 1C7RA 3HDHA 1HDXA 2VC2B 5I8PA 2WMYA