1QYDA

Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases, and their relationship to isoflavone reductases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
312
structure length
312
Chain Sequence
DKKSRVLIVGGTGYIGKRIVNASISLGHPTYVLFRPEVVSNIDKVQMLLYFKQLGAKLIEASLDDHQRLVDALKQVDVVISALAGGVLSHHILEQLKLVEAIKEAGNIKRFLPSEFGMDPDIMEHALQPGSITFIDKRKVRRAIEAASIPYTYVSSNMFAGYFAGSLAQLDGHMMPPRDKVLIYGDGNVKGIWVDEDDVGTYTIKSIDDPQTLNKTMYIRPPMNILSQKEVIQIWERLSEQNLDKIYISSQDFLADMKDKSYEEKIVRCHLYQIFFRGDLYNFEIGPNAIEATKLYPEVKYVTMDSYLERYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pinoresinol-lariciresinol reductase
publication title Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases and their relationship to isoflavone reductases.
pubmed doi rcsb
source organism Thuja plicata
molecule tags Plant protein
total genus 94
structure length 312
sequence length 312
chains with identical sequence B, C, D
ec nomenclature ec 1.23.1.1: (+)-pinoresinol reductase.
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1qydA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1qydA02
2Q1WA 5TC4A 2ZIZA 1UJMA 3NEPX 3PQEA 1H6BA 3ZWYA 4WE3A 3A1NA 4XQCA 1E3SA 1PS9A 2DPGA 2PKQO 5LC1A 1DIAA 3D7LA 2VWHA 1ZNQO 4GH5A 3B70A 5A5FA 3RFVA 4D7AA 2C59A 4LRSB 8ADHA 3DZJA 1QRRA 3INTA 3JCZA 3C7AA 4XDZA 1UXHA 1KOLA 3O9ZA 1X13A 1KVTA 3Q0EA 1JQBA 3I83A 4CUKA 4RF4A 2WYWA 3L9XA 4Q3EA 4RF3A 5A4DA 5L45A 3JQ7A 4J1TA 3HJAA 1B8PA 2P9EA 3PYLA 1YRLA 1UH5A 4OXNA 2JFHA 1M76A 2R6JA 1BMDA 2FMUA 1B3BA 1QKIA 1WDKA 3UCFA 5IXYA 5COAA 1CQIA 3F3SA 2GSDA 4GAEA 4YAEA 4Z9FA 3NT2A 3HNPA 3U4DA 4DGSA 1XA0A 1EEHA 4IGFA 1DFHA 1SAYA 1MC4A 2UAGA 1I3MA 1I33A 4JX8A 4YAGA 4IZHA 3IAHA 3U4CA 5GZ3A 5KJ6A 5F1PA 1DO8A 2O3RA 1S6YA 2W2LA 4HY3A 5B1YA 3PTZA 4BB6A 1EUZA 2JCVA 4G2NA 4D42A 4WGGA 2O3JA 3U0BA 1H2HA 4CODB 4O59O 4JBGA 4XGKA 5TT0A 3QLJA 3L6DA 2Q1UA 2NQ8A 3JQFC 3LT4A 5JE8A 4DPKA 3CMMA 1ML3A 3H8VA 4NFYA 3ZWCA 4RV9A 1QYCA 1IOLA 4J16A 3DL2A 4HP8A 1E7MA 2BFPA 1NM5A 2I99A 3WSVA 3IQDB 2WD8A 5DOVA 3AFNA 3NDIA 1U9JA 3ZWNA 2X4GA 3B1FA 3L4BC 3C1OA 3FPLA 4KP7A 3DONA 3N7UA 3EUWA 4RPGA 5AYVA 3WFJA 3ZHYA 5AQ1A 3K92A 1R12A 5DOZA 2I6TA 2NU6A 2W90A 1X14A 3LVFO 1CYDA 1XEAA 5T6BA 3TN7A 4KUGA 4WLVA 3LF2A 2WMDA 3OJOA 3SEFA 3HDYA 1NQTA 1Z45A 4TVBA 4R3NA 4FR5A 1YDWA 3E1KA 2Q3EA 1WP4A 3D1LA 3F6YA 4E31A 1JKIA 2HJRA 1ZH8A 2F1KA 2VUSA 4W7HA 4UEOA 4FN4A 3GG2A 1YKFA 2WYUA 3H5AA 5F1OA 1IY8A 3RBVA 1FDVA 3VZRA 3OETA 4IDAA 4II3A 3QVWA 1IYZA 3ZW9A 4R51A 1IPEA 2ILTA 1LSSA 3OHSX 1PWXA 4YRBA 1ZCJA 1FDUA 3KUXA 3GT0A 1LDBA 5IDXA 2P4QA 1KY5A 2FRDA 4D45A 4XYGA 1ZZEA 2NM0A 2YQ5A 4NBRA 1MG0A 4X54A 4LVCA 1YXMA 1DB3A 1KVRA 3OM9A 3JSAA 3SLKA 3AM4A 4XQEA 1E3EA 1MB4A 2PZLA 1OC2A 1B16A 3FWNA 5LDGA 3RUFA 2VYVA 2B4TO 3GC6A 4WLFA 5FWNA 1HLPA 1B26A 1H6AA 1DEHA 2PY6A 1I32A 4P4LA 1N8KA 3U9LA 3DAFA 3FR7A 4TKMA 3T4XA 4GVLA 3GVPA 2CDAA 2HMWA 1D4FA 2VUUA 3MOIA 4BL5A 4BKPA 3OJFA 3VPHA 4D3DA 4QQRA 4YYZA 1GEGA 2BFOA 1JWBB 4LCEA 4CMEA 1C1DB 1FDWA 1HL3A 4UUPA 4B3JA 1LRLA 2YV1A 3DMTC 3GGGA 4BO3A 4EUHA 1P45A 2C2YA 3PI7A 4ZQFA 5F5NA 3V5NA 1GUZA 4QEDA 3GUYA 1P33A 2YY7A 5C3MA 3W4IA 4PLHA 3UHAA 4NQZA 5TX7A 2C2XA 1SEPA 1EE2A 4P8RA 3BXXA 3TOZA 4I5DA 4XZ3A 5JO9A 2GUGA 3JQCA 1ZK4A 4L8VA 2FR1A 3ZDFA 1Z7BA 2YZ7A 3RROA 2D3TA 4K28A 3STHA 5K6AA 5L4LA 2PLAA 3C7CB 4BNZA 5IZCC 1NNUA 3NDJA 1LDEA 3RUCA 2D2IA 1K89A 2I9PA 4BNLA 5GZ6A 1P74A 3V1UA 3UCEA 4IMPA 1HDRA 3PHLA 3QWBA 4L75A 1EK6A 3E5MA 4L76A 4EDFA 3OSUA 3IDSA 3VH1A 4XJTA 1V0JA 4XB2A 4PFJA 4GVXA 4CV1A 2BI7A 4KDFA 3AOEC 4E32A 3OEWA 5JFOA 3MWDB 4DLBA 2ZJ1A 4XEHA 5T8KC 3OJLA 2BGLA 3F5SA 4MP6A 3LC1O 3G17A 3MJCA 1GCUA 3ZN2A 2VYNA 3UFXA 4KZPA 4IJKA 5CAEA 4FFNA 2Q46A 3I23A 1KY4A 2J3JA 2V6MA 4LN1A 3NTQA 5AXBA 1ENPA 2R2GA 3E18A 4TZTA 1DOHA 1T2CA 5MDHA 1DIHA 2W2LD 2QRJA 1IHYA 1MGOA 2O23A 2ZYGA 2JD1A 3VHRA 1R4NB 5TJ9A 2GNAA 3NTRA 4GWGA 4R5HA 4WJZA 3WLFA 1EK5A 1W0CA 4YAJA 1UDCA 4BVAA 4D3FA 2YDXA 3ZU3A 4GPD1 1C1DA 1HSOA 2O3QA 4B4WA 3GVXA 3OP4A 3KSZO 1RKXA 4ZQBA 3GZNB 4B3HA 3GFGA 3GHHA 3BTSA 1TXGA 2PGJA 4IS2A 3F4BA 1Q7GA 1WDMA 4HNGA 1DC4A 1E7YA 1QV6A 1Q0HA 4UEKA 1A72A 1X7HA 3AW9A 1P3DA 3MJEA 4QT0A 1F8FA 1DHTA 2BELA 3RD5A 5BSGA 4M86A 2IZ1A 2B35A 2A94A 1GTMA 1K0UA 3WJ7A 4E0BA 4D0SA 1XKQA 2YW9A 4S3MA 1LC3A 2DPHA 2Q50A 5TJHA 1RM0A 2QG4A 3AUSA 3GNSA 2CVOA 3AUUA 4HADA 5JS6A 3M2TA 3EY4A 3WG9A 4YDRA 3ZU4A 4CUJA 4IDEA 4LK3A 3VOSA 5TGDA 6ADHA 1D1SA 4IY1A 1W4ZA 4YPOA 2BHLA 4F45A 3E5RA 2B0JA 3RJ9A 2GD1O 4JJFA 1BWSA 2BMAA 4J0FA 4OMUA 4P38A 1LSJA 1ISIA 3E48A 1VL0A 3IOYA 3ORFA 2D8AA 2VRBA 3ZHZA 1ZW1A 2YHIB 1KVQA 3Q2KA 3VTFA 3QWHA 1YDEA 3EC7A 2Y1OA 2I65A 3TZ6A 3BMCB 4WK6A 4YJFB 2QIOA 3F1LA 1NR7A 1KBZA 1JDJA 1GY8A 3TNLA 2DTXA 1T26A 2FR0A 1P1KA 1U5AA 4OSPA 2HCTA 3DFZA 1R4NA 3ONDA 1QR6A 1LDNA 1VRWA 1T1SA 3FNGA 4BO2A 1GCOA 2JL1A 2DT5A 4CLHA 1NQAO 2AMFA 1Z82A 3ZW8A 2PD6A 3I9MA 3GZNA 4D46A 5TSDA 2J8ZA 3U4HA 4CL3A 3RC7A 4OXYA 1N9GB 1PGOA 3R6DA 4FQ8A 1QLHA 1GYQA 1PGNA 4GI2A 5JCJD 3VKVA 3CSDA 3NT5A 2DFVA 3PEFA 5JYEA 5ILGA 4EI2A 2EV9A 3JTMA 1Y9EA 2XPCA 2ZTUA 1Y5MA 1KEUA 1KYQA 5A05A 3FNEA 4PG8A 1J6UA 4ALLA 5DCUA 4B7XA 4DQXA 3CZMA 3M1AA 4H3VA 3AOGA 2CDCA 2OHXA 2OZPA 1LNQA 1NTOA 4F6CA 4J0EA 3KB6A 3H65A 5DCYA 2GF2A 4TQGA 1ADGA 2VRCA 1BXZA 1P1RA 3F5QA 3I4FA 3V1TC 2JD2A 5GMOA 1G6KA 4CM9A 2Q1TA 2GPTA 3TSCA 2FR8A 4Q3DA 5G0SA 5KKCA 1PZGA 3LLVA 4FS3A 4YQZA 1PEDA 2E82A 1DRWA 1GUFA 2FWMX 2OXIA 2YHIA 5ITWA 5C37A 3HDHA 3H3JA 5L7WA 1HSZA 4R9RA 1PR3A 4R9SA 1E7RA 3BZUA 2UDPA 2VYND 4PRLA 1C0KA 3HFGA 3HFSA 3BMCA 1NHGA 2A92A 3Q9NA 3NV9A 4UVEA 4INAA 1ZVMA 2HDHA 3DZKA 3WGZA 1NFFA 4A10A 4BNVA 3UOGA 3HDQA 1EQ2A 5TLSA 2IZZA 2P9CA 3A06A 4J49A 1JN0A 3ETGA 3N58A 1BHSA 3JYLA 2ZTVA 1PQPA 3C1AA 2X7HA 1KETA 1P44A 4RQUA 1B8UA 4PG6A 1LLQA 4DTIA 1U3VA 1UXJA 1CDOA 1ZMTA 1ISJA 4L0QA 5L53A 4NU6A 1E6UA 3GF4A 2I67A 3JQ6A 2C5AA 5ICMA 4D44A 1LI4A 3UAGA 4TZKA 4RLHA 3JD1A 5U4QA 4MVJM 3DBHB 3EHEA 1N9GA 2Y66A 2CNBA 3H9GA 5F5LA 1UP6A 1C3VA 1Y1PA 1DFGA 3ONEA 3H2SA 3GEMA 4ALMA 3DDNA 2NWQA 3JYNA 1FDTA 4B79A 3NTOA 4YT8A 1P77A 1UAGA 3K30A 1X7GA 4A5OA 1W6UA 2RIRA 2P2SA 2I66A 1K6JA 4M49A 2EGHA 1LQUA 4GX1A 2FSSA 4YJDA 3S2FA 2NVBA 2O4CA 5IDYA 4Q3BA 1E6EA 1VKOA 4RPKA 3OIFA 3OECA 3OQBA 4P22A 5CEEA 2BF7A 2O48X 4CQLB 2J5KA 5BNIA 4J1NA 4TVOA 1HF3A 4UULA 4YB8A 1B3RA 2X0RA 4R01A 2CFCA 4NR0A 1R0SA 4WPGA 1EUCA 2A9FA 3TFQA 2PKQP 1H6DA 2LDBA 2DTDA 4GSLA 4E4YA 2AG8A 2HK8A 1B15A 1GR0A 3ZU5A 4BV8A 2EJVA 1X15A 5CHEA 3WYEA 3PXXA 3E9MA 3KYDB 4BO8A 3Q2IA 5JPIA 4PN3A 3VAZA 4BNGA 4XB1A 2H5LA 5G4LA 2C5EA 5BR7A 4PLGA 1I0ZA 5IN5A 4WLEA 4D0RA 4LISA 4YVFA 1P9LA 2ZJ0A 4KUHA 1BTOA 5JDIC 3OIGA 3ZHXA 4EBFA 4BO1A 4WCFC 4NG5A 4MPDA 2EP7A 4KOAA 3SJ7A 2IE0A 4ZQEA 2EJWA 4ALNA 4FGWA 3VDQA 5HA5A 1RM3A 3VH3A 2GN9A 2C7VA 1PZFA 2O3TA 4K1LA 2OUIA 4DIFA 2CY0A 4BNFA 2DFDA 3FTNA 5KJFA 1KS9A 5TF4A 3GZ4A 3DHYA 3DZHA 4RCVA 5G4KB 2C54A 3WTBA 2Q49A 4CV2A 4EJ6A 4RJTA 3NAQA 2BI8A 4BO4A 3KM0A 1CJCA 3EZLA 2VTDA 3TRIA 4Y98A 2WTBA 3DBHA 3I9JA 3KBOA 4F46A 1L7EA 1EQUA 1U8FO 2FPIA 4PZEA 4U6SA 4Z0HO 4BQRA 4B8WA 1PL8A 3GNTA 4IM7A 4PZCA 3QP9A 3GPDG 4E3ZA 2DQ4A 5DCWA 2C20A 1WDLA 4RDIA 3NT4A 4LW8A 3PWKA 1YQGA 2HMSA 2B83A 1E3JA 1NHWA 2BFAA 3ZU2A 1BXKA 1ISGA 3GEGA 3KVOA 3PJFA 3RWBA 2TMGA 2NVWA 5L3ZA 2EERA 4TWRA 3VKUA 1GZ6A 3PJDA 5B12A 3BHJA 5DZSA 1ARZA 4CQLA 3DEYX 2VRCD 2QQ5A 1GADO 4R69A 4NNJA 3HDJA 1T2DA 1VE9A 3EW7A 4JJIA 1MXHA 3D3WB 1LRJA 4QO8A 1UDAA 3ZWXA 1VC2A 3QE3A 4CM5A 4CLEA 4JQCA 1ZEMA 3VVCA 1GDHA 1DIGA 3QA9A 4P4NA 2DLDA 1VL8A 3KYDA 4FSHA 1C1XB 2NADA 3GGPA 1FJHA 4Z9XA 3RKRA 2WYVA 2AG5A 3V2HA 2O2SA 1J0XO 1O6ZA 3L6OO 4NFHA 4WKGA 4HWKA 1U4SA 3G79A 3BMQB 3RASA 4CMHA 4E2YA 1HDYA 5DNAA 2CVQA 4GKVA 4BGVA 4NFSA 3DWFA 4PVCA 1PL6A 1UR5A 1Q2XA 2Y1EA 3PGJA 4XGNA 4YR9A 3TF5A 1JAXA 3WICA 4K9DA 3L0DA 2JHGA 1PQWA 2Q2VA 5JW6A 1V3VA 2HAEA 1LDGA 3GPIA 2AQHA 4GL4A 3ON5A 5G4KA 4ZICA 1DDOA 2H63A 4GBJA 2RAFA 5ES3A 3T7EA 1XCBA 2E49A 4ND1A 4W6ZA 4IIVA 1XHLA 1T25A 2EWMA 1JKFA 5FYDA 3GN1A 1D8AA 4NK4A 2ET6A 1U1IA 1E0DA 3GY0A 4Y6SA 2XAAA 3S2EA 2YDYA 4A2CA 1GUYA 2JAPA 5BT9A 2VWPA 3PZRA 3O26A 5IG2A 4LMRA 2WD7B 3QHAA 2B4RO 4J6FA 5C7LO 4OAQA 1Z6ZA 4PLVA 1WVGA 4BNTA 3RU9A 3CH6A 4LRTB 1ZKMA 1V8BA 1NPYA 1I8TA 1XELA 4WLNA 1YONA 3I1JA 3EYWA 4N7RA 4J91A 1BRMA 4FW8A 3D3WA 4ONEA 4WEQA 4AJ1A 3G49A 3PDUA 5KJEA 3FSRA 3HHPA 2QZ9A 1RM4A 2HO5A 1C1XA 2JCYA 2PFGA 3M1LA 4JGBA 4NI5A 3ZWWA 3GNQA 5COQA 4BNYA 3JQDA 3VZPA 3AI1A 3WIEA 1KEPA 2UVDA 4E5NA 3BMQA 2X9NA 4XYMA 1DJQA 2VWGA 3FBGA 2EXXA 1YBMA 4W9NA 2BKAA 5CDSA 4RVFA 3PLNA 5ENVA 4ZRNA 1YE3A 4Y67A 4CMIB 4IDCA 4CQMB 1DC5A 1B0AA 4BNIA 2NTJA 3RUAA 3QQPA 1CERA 2PD3A 4I08A 2G76A 1VJTA 2W2KB 3MJSA 4QO7A 2DUUA 2PV7A 3GAFA 1GYRA 2QX7A 3FBTA 1U8XX 2HJSA 4QSMA 1ISMA 1UAYA 3ANMA 1LLCA 4Z6KA 1ZEJA 4XGIA 1OFGA 4CMBA 2YYYA 2H1SA 3WWZA 4LSMA 3ZV3A 4K6FA 1E1LA 4WNCA 5JAZA 1E5LA 4OHUA 1OBFO 1PSDA 1NFRA 2BGKA 2OBYA 1P1FA 2VUTA 3RUEA 4IIUA 3BTVA 5AOVA 2X58A 2YFHA 3P2OA 5A3VA 4AJ2A 3DAGA 4CLOB 4R1SA 3I9OA 4DA9A 2HK7A 4FDAA 4XX0A 4ND5A 3V8BA 4E5KA 7MDHA 3PFWO 4YJGB 1OI7A 2VNSA 4N54A 4IDFA 2EW8A 1ORRA 2VQ3A 5IDWA 3WGOA 3I3OA 4HV4A 3BMOA 5IJZA 1GQYA 4MVJD 2GZ2A 2WD7A 3EZYA 4C7JA 2W8ZA 4ND3A 5KOIA 4G65A 3K2BA 1EBFA 1WXDA 1WLYA 4GX0A 3PJGA 2GO1A 2AEMA 5BNTA 4IQ8A 1DHRA 1XR3A 4ZHSA 1SNYA 1T1RA 1NAHA 3AJRA 2IXAA 2IRWA 1E92A 1XLTA 3IL2A 1BDBA 4BUCA 3FPCA 3W1VA 5COBA 3GOHA 3PHJA 5CDTA 2CMDA 4GWKA 3DR3A 1P0FA 1HE2A 3PFFA 1UZLA 4KTVE 8LDHA 1PJQA 1JLLA 3UCXA 4DIBA 2R00A 4J1QA 5HRUA 3UF0A 4E5MA 1WAMA 2Y1GA 1HTBA 4G5HA 4J90A 3WMXA 1VLLA 5DF1A 1RJWA 4Z9YA 3FCOA 3JD3A 5FI5A 1F06A 1LBEA 3FNHA 3KRTA 4CMIA 3WIDA 4CQMA 3ZWVA 3BTUA 5IZ4A 1MUUA 5EJ2A 4MVJF 2QRLA 4HFNA 4K26A 1LTHR 3FNFA 4Q3NA 5FF9A 2OP1A 2W2KA 3I9KA 2E4AA 1TI7A 2POQX 4PLPA 5B4UA 4NJOA 1TB4A 4TROA 5G0WA 1ZXBA 4PG5A 5EIOA 3BA1A 3GVCA 1X0XA 2YQ4A 1HWYA 2HRBA 4WEOA 5TT1A 4BQPA 5JCJA 1I3NA 4MKRA 5H82A 4BNNA 2WE7A 4WECA 4FGSA 2OBNA 4O6VA 4YJHB 4CLOA 2A4KA 5TS3A 1ZSVA 1LSOA 5B37A 2V6BA 4Q3AA 3EAGA 4CUZA 3GDFA 4YJGA 5EMHA 3LSYA 4GX2A 3WFIA 4MVJP 1I30A 1SCUA 4NK5A 4U6QA 1D3AA 1Z75A 3WQSB 5FEUA 2EIHA 5JY1A 2OOSA 1Y8QB 5IF3A 4J4BA 3QW2A 3WQRA 4OM8A 3QWFA 1BDMA 3GVIA 1GPDG 1B2LA 5KNLA 5THKA 2UV8A 5B4TA 2EKLA 1SB9A 1NASA 2BLLA 3JQAA 1UUFA 3CKYA 5B4VA 2RH8A 4WUVA 3FHLA 1EVZA 2DC1A 4GGPA 4E33A 1DXYA 3KZVA 2X9GA 1VSVA 4J3FA 4IDBA 3X2EA 1JTVA 4A03A 4IS3A 2P5UA 3KLPX 4XR4A 4E6PA 2IDZA 4CMKA 4WNIA 1MP0A 2X9VA 3PDJA 4OXKA 3RIHA 4OQYA 4DC0A 2HK9A 2PH5A 3JQFA 3DZGA 3OMLA 5JO0A 3TZCA 2CZCA 4B4VA 4IBOA 2B5WA 4E21A 3INRA 1YO6A 4YRDA 4RPLA 3QJ5A 1ZUD1 1PQUA 2VHYA 3SVTA 1TLTA 3DBVO 3CPSA 3LDHA 3IIEA 1XQ1A 5A1TA 3HE3A 4NH4A 4AJNA 1UP4A 3EDMA 3PWSA 4ZQHA 2UUOA 1N2SA 4TRJA 1DRUA 2C07A 3L4BA 3EK2A 3ITDA 3O38A 2X0NA 2FPGA 3NDRA 2X8LA 3PQFA 2VZ0A 5HS6A 3WYCA 4CLRB 2DUWA 1T4BA 3O8QB 5JC1A 2D59A 3UKOA 1GD1O 3U5TA 1SOVA 2PZKA 1NWHA 4IQ0A 2Y1CA 1SMKA 4D79A 4J4TA 1RYEA 1LX6A 1MLDA 1OZAA 4TKLA 4E2XA 2CD9A 1PJSA 4OYRA 5A3JA 1PZHA 5DBIA 1EFLA 2V6FA 2VHWA 1QP8A 5ICSA 3U3XA 1UZMA 2SCUA 2OMEA 2Y05A 2CUKA 1FK8A 5KVSA 1DBVO 1Y7TA 2B5VA 2Q4BA 5U9CA 4NBVA 3PYMA 4UUMA 5TQVA 3RBXA 4YJHA 5EQDA 2W98A 3QRWA 1Q7BA 1N1GA 4O1MA 1MFZA 1KERA 3DTYA 1V6AA 1Y8RB 3GRPA 1NWCA 3GK3A 1HDZA 3GH3A 3HZZA 4HKTA 4L73A 4YT4A 3IUSA 1SB8A 1T2FA 4B7UA 3QIVA 1Y8QA 3Q11A 4C7KA 1G0OA 1IHXA 1Q0QA 1V35A 3C8MA 3K8ZA 4XRGA 1YJQA 4MVJG 2Y99A 4YACA 1O89A 3JQEA 3ETEA 4LCJA 4EEZA 5JCXA 3JQ9C 3L4SO 5L4NA 3JYQA 3LT0A 2Q2QA 1A4UA 3H9UA 1EDOA 4YBZA 4BNWA 3S55A 2EGGA 2VZ9A 4YT5A 1KC1A 3PIDA 4IINA 2E37A 3D4PA 3SJUA 3U49A 3DMTA 4E2ZA 5TNXA 4UVIA 3RKUA 3VH4A 3I52A 3WWYA 1DFIA 5A06A 1I36A 3IJRA 2Q45A 3AUTA 1UXIA 1U2DA 4DBVO 1P1JA 3PLRA 3AY7A 3WGGA 3H7AA 3ASUA 3X2FA 2NU8A 3AY3A 4KQWA 4FFLA 5A02A 2XOXA 2IYOA 4DWVA 3PWZA 3IKVA 4ZA2A 4R54A 3S2IA 3I6QA 4CLDA 1AHIA 4CQMD 4CLRA 4ZJUA 3O8QA 4R1TA 4GKBA 2VN8A 1C14A 1DLJA 1YQDA 4P4GA 3DOJA 3JQBC 1E7WA 2B36A 3ASVA 2Q2WA 5IZCA 3FTPA 2RCYA 4FOSA 4HFRA 1DC6A 1DLIA 3HQ4O 5I7EA 3KYBA 1M2WA 1PR9A 1QYXA 1WW8A 3M6IA 5EINA 4BMNA 4L74A 4W4TA 2HSDA 4DC1A 5GY7A 5KJCA 4IDGA 1EZ4A 1MXFA 5DDIP 4NIMA 1ONPA 1EE9A 2PKRA 5LDHA 4K6CA 4N5LA 1E77A 1NR1A 4CM1A 1W73A 4MIEA 5T67A 4UVGA 1AXEA 2G82A 3A9WA 4FC6A 4QUKA 3AOEA 2Y1FA 3WGIA 1XGKA 5KTKA 2HKIA 5EL0A 1AXGA 5T8KA 1U3TA 3L77A 5TRTA 1H93A 1LU9A 4M87A 4BMSA 1Y8RA 1VL6A 3QY9A 1L1FA 4U7WA 1PJ4A 4CJXA 4NJMB 4FFMA 4Z3KA 3EMKA 4JNKA 4J4HA 2G0TA 3KV3O 5KCZA 4RF5A 1ISFA 3F47A 3KTDA 4XKJA 1YL5A 1T4DA 2YUTA 3JQAD 3KETA 1SEVA 2V7PA 4OO3A 5L9AA 3GMDA 4QTZA 5CPBA 4CM7A 3DZFA 3AWDA 2HMUA 2GLXA 1QV7A 4HNHA 1LLUA 4AJJA 2Y67A 2PH3A 1PJTA 1JU9A 3WBBA 1HYEA 1T2AA 1U7HA 1BW9A 3CUKA 4CV3A 1JVBA 2VCYA 3F1KA 4ITUA 3C7DB 2GYYA 2X23A 4UUOA 4AL4A 2HU2A 3WLEA 3B1KA 4GLLA 1PJ3A 3H4VA 3GDGA 1YB5A 1ZK3A 2XXJA 4RQTA 5KKAA 4I8XA 2ZQZA 2FY8A 2DVMA 1GZ4A 1WMBA 2O50A 1GQQA 3DHNA 3W4JA 3SBOA 1SOWA 5K9ZA 1RYDA 3WS7A 1E3LA 4IPTA 2J5QA 4GGOA 3TL3A 5JDCC 4FBGA 5A9SB 2DTEA 5KWEA 3ADPA 5AXCA 1E5QA 1OMOA 3GEDA 3HB4X 4AJEA 3TFOA 3D4NA 5CDGA 4JXKA 3B20A 1LUAA 4C4OA 2IEDA 2ZB8A 2I3AA 4MIYA 3QVTA 3ZWAA 5HTOA 1G0NA 3KHUA 3ZNQA 1H9AA 4F6LA 4UEJA 3CINA 4XYBA 3FRJA 1VKNA 3JQ9A 4BO9A 2GRAA 5IXSA 4CPDA 4FFOA 3HSKA 1A9YA 3PHGA 2J3HA 2E48A 4LVUA 3H9JA 1FMCA 3H5RA 4EJMA 5I9LA 3G3EA 4CV0A 4NJMA 5AVOA 2IODA 5BNFA 2OFPA 3NRCA 3ZH2A 1H6CA 3WTCA 1Q0LA 4CL8A 4A0SA 5JLAA 1CIVA 4H7PA 1YBVA 3DO5A 1KEWA 3L07A 1E7SA 3GDOA 3C85A 4QFDA 2I3GA 1I01A 3PIIA 1PGPA 1TA4A 3GLQA 2WE8A 4DVJA 4DYVA 2Z1NA 1JKJA 1EVJA 4D41A 3IP1A 3PVZA 4FIZA 1HT0A 1Y6JA 4FC7A 3G1TA 1FDSA 4JN6B 4XQGA 3BTOA 4FJ1A 4N5MA 3HN2A 4NBWA 1EDZA 2W4QA 5ITVA 5A9RA 1E1NA 4S1VA 1HYGA 4E13A 2CDBA 4U8GA 3WX0A 3NUGA 1YVEI 4BKOA 4DQUA 4II2A 1U4OA 1U3UA 4FD3A 5I7SA 4J9UE 1GAEO 1HE5A 4WLUA 4MP3A 1NXQA 4XJSA 2PGLA 3I6IA 3ULKA 4BKRA 1R6DA 4GSKA 1GPJA 4AJLA 4KDEA 1W8DA 1YS4A 2X6TA 3RUHA 4BNHA 2Q99A 2Z1MA 1U3WA 4BKUA 2AHRA 1GV0A 3E8XA 1ULSA 2FHSA 4U0KA 2PA3A 3ZNPA 4ESOA 1O5IA 4RGBA 1EVIA 5A9SA 2FN7A 4FPXA 3Q9UA 1NVMB 2QRKA 4WCDA 5G0UA 1E3IA 1LA2A 4XYEA 1I2ZA 3AU9A 1GQ2A 4LMPA 1T2EA 1Q7CA 3DOCA 2YJZA 2PZMA 1RPNA 3VPSA 1YH3A 4ZVVA 4OOFA 4QFCA 4R1NA 5AXAA 3IP3A 1UDBA 4GLOA 4IUYA 3P19A 5ENDA 3A14A 3K9QO 4RVSA 4XWYA 3LF1A 3OH8A 1QYVA 2DKNA 2RHCA 4ZRMA 4MVJA 1E1MA 1U5CA 2IEBA 4KUEA 5CP8A 4IJUA 3S2GA 4I5EA 3ZV5A 4PLWA 1DRVA 2PNFA 5H81A 4B8ZA 3WJAA 4XIJA 3ADOA 3A28A 3Q1LA 4B4UA 1ZJZA 2B37A 3LT2A 3O03A 3ROPA 2X5OA 3DOOA 3GFBA 3V2UA 1H94A 4XRRA 4YCAA 3ZWMA 3H9EO 4DXHA 3ICCA 1HZJA 4XCVA 4RZHA 3WMWA 4CM8B 4J7UA 2NU7A 4WASA 3JYPA 2GN8A 2ZYAA 2HUNA 2F00A 3LK7A 3JD0A 4IXWA 1XG5A 3ZV4A 3GQVA 3G0OA 9LDBA 3TQHA 4RO0A 1H0KA 3M2PA 3DC2A 1VPDA 2UUPA 3EVTA 1FXSA 2HMVA 3E9QA 2FZEA 4R41A 4RVGA 4UVDA 4W99A 1MV8A 2EHDA 3OA0A 3RU7A 3TJRA 3DZIA 3K2EA 4PZDA 3W6ZA 2QW8A 1MG5A 2UYYA 3B1JA 5A03A 1SO8A 3DMYA 1BGVA 2OL4A 2WJPA 2GR9A 1GZ3A 1LC0A 2NNLD 3P2YA 4DPMA 3RFTA 2AQIA 2AEJA 1NX6A 2BFMA 2ZTLA 1YL7A 3F46A 2IYPA 1DAPA 3LYLA 3FD8A 4PIVA 4RPJA 4ZD6A 2G17A 2JKVA 1DIRA 2BRUA 2PK3A 1ID1A 4PGFA 1QLJA 4ZGWA 2JAHA 1AUPA 4PG7A 4ILKA 4PLCA 4BNJA 1ZSNA 2ZK7A 1WNTA 5T64A 3UVEA 3GVHA 4IZIA 1TT7A 1F17A 1IB6A 2HMTA 4BO5A 3ETDA 3WNVA 2LDXA 3FI9A 1JAYA 1ADBA 5I9MA 1I2BA 4XQ9A 4Z3DA 2FSVA 2VWQA 3DB2A 1SZJG 1B8VA 3I9NA 5IDQA 3GMSA 3BMOB 2O3UA 3BMNB 1E1KA 2FZWA 2ZATA 3IS3A 3FR8A 3KO8A 4M1QA 4MIOA 4BHTA 4BOYA 4M8SA 1PWZA 1NQOA 4CMEC 1Z73A 4J1SA 5K0ZA 4AICA 1HDXA 1N5DA 3U4IA 4I9HA 1B7GO 1A4IA 3GRKA 3CZRA 5JDIA 3ZZNA 5BSHA 2O2YA 3MWEB 3H5NA 4JP2A 1YL6A 1ADCA 1I24A 2AE1A 3K96A 1HXHA 4CM8A 2RBEA 4D3SA 2NVUA 4WCFA 1XU7A 3GR6A 1PS0A 3IC5A 5EQFA 4CMGA 2Y0DA 3ZWPA 3TZHA 4J7CA 5DP1A 2A35A 1NQ5A 1R0KA 4EJ0A 3ROQA 4PLYA 4ALJA 1DJNA 3C1TA 4EYEA 3W8FA 5L7YA 1I5RA 1O95A 4U5QA 5JYDA 4IJVA 4I5GA 1Q1NA 3JYOA 4EW6A 5K6AC 1K3TA 5G0TA 5KVQA 1GFSA 4TRRA 2AQ8A 3TOXA 5ILOA 1YB4A 3K31A 4JBHA 4BV9A 3PPIA 4BNMA 1BG6A 1SPXA 2X0IA 4U0JA 3E9NA 3JQGB 3WOHA 1N1EA 4E12A 3UICA 1A9ZA 3GAZA 4XIYA 4RORA 4AJHA 4JCOA 4YRAA 1F14A 3UGKA 3AM5A 3PHHA 2EP5A 4J7XA 5JSFA 3OJ0A 5IFLA 2O7QA 3G1UA 1AE1A 4I9NA 1DAOA 2ZKLA 4HFJA 4B7CA 3GG9A 5MGBA 1ZJYA 4R16A 3FN4A 2DM6A 5F21A 3TDKA 1H2BA 1LDYA 4DL9A 4E2WA 1I2CA 3H6KA 4JK3A 4MVJI 3V1YA 5JBIA 1NPDA 3D4OA 3WQQA 5CFZA 1C0PA 2GZ1A 3F4LA 3MEQA 4BIIA 5CDYA 1GYPA 1R37A 3D5TA 3LC2O 5DULA 4ND2A 1DIBA 3VVBA 3H3FA 4CMJA 3UUWA 1HDGO 4BNUA 1D7OA 1NVTA 3LU1A 4ALIA 1I3LA 1PGJA 4Q9NA 3PQDA 3ZWOA 1S7CA 2X0JA 4MVJH 4EUFA 2NSDA 3T7CA 3BMNA 3WGHA 4FJ2A 1AN9A 1V9LA 2BH9A 1ZK0A 2AXQA 4QECA 3SC6A 2EKQA 5I8WA 5I7VA 3JQ8B 2ZCVA 1U28A 2PD4A 1EBUA 1MC5A 3NYWA 4M54A 4YEDA 3JQAB 2Y1DA 1OC4A 3QVOA 1J49A 3WGYA 4JROA 2PZJA 3C3XA 4ND4A 3GUCA 5JAQA 5JNLA 4M55A 2P4HX 4R1UA 5JAMA 4UREA 4DYDA 3I5MA 2VZ8A 1WZEA 5T57A 3AU8A 4DLAA 3O4RA 2WM3A 2VHXA 3K73O 1HE3A 1A27A 1BSVA 2NQTA 4UAGA 1E3WB 1PIWA 3RUIA 4W7IA 5L95A 4BGEA 2Y0CA 1QG6A 1XSEA 3HUDA 3BYZA 2J3IA 4G81A 1XYGA 1IULA 1R66A 1VM6A 4MINA 4Q3CA 3JQGA 4RVUA 1YGYA 2P5YA 2NTNA 4RPHA 3JD2A 1N7GA 2D0IA 3PYXA 2X1HA 2GERA 1L7DA 3GHYA 2OP0A 2EKPA 1ZSYA 3ZWBA 4DMLA 3AI2A 4HFMA 1O0SA 3TZKA 4AJOA 4QXMA 3NGXA 4UUNA 1HZZA 4BO0A 2NU9A 1F12A 2JJYA 4XD2A 3TPCA 4NMHA 3ANNA 3WDSA 4EUEA 1WWKA 1PL7A 2TMDA 3C24A 3RSHA 3ANLA 4GQAA 5JXWA 3RC9A 4MJLA 4A7PA 5DBGA 5F1KA 2JFGA 1R16A 1ZIDA 1ENYA 3AFMA 3S8MA 4LSWA 2I5PO 3RBZA 1YOVB 3SX2A 1YQXA 3EGOA 1ONNA 4CR7A 1NYTA 1DC3A 4GMFA 1PJ2A 4CMAA 1CEQA 1UXGA 5TIIA 1QYDA 1JW9B 3WYBA 1R4MB 1Z74A 1M67A 4N18A 2OORA 3JQ8A 4AFNA 4OH1A 1A5ZA 4N5NA 3VZQA 2VOJA 4R5MA 2QYSA 3ABIA 4IQGA 4Y8VA 4E5PA 4CM4B 2BGMA 4HX5A 4QX6A 2G1UA 2EEZA 3OICA 2CF6A 4KTTE 3DAPA 3SLGA 4OGWA 3MJVA 4PLZA 4UVHA 3KXDA 3W8DA 1KVUA 1P1IA 1E3WA 1P0CA 1V3TA 4FJ0A 4A26A 4BS9A 3VZSA 4IGEA 1NPTO 3NX4A 1P1HA 3AUAA 3QSGA 4TRNA 1CQJA 2VHZA 2G5CA 1HRDA 3D5QA 3D3EA 4FB5A 1M75A 4PLFA 3UXYA 3ITKA 3WGTA 4F3YA 1PJCA 1XIVA 3CMCO 1RWBA 4MKXA 4CLXA 5CEFA 3FF4A 4R3WA 3RQSA 1EMDA 2X5JO 3MOGA 4DUPA 2CVZA 5C7IO 5L4SA 3WGQA 1ISHA 5JMPA 3R1IA 2GGSA 4FOOA 2WEKA 2P9GA 1HDOA 4Y6PA 4A27A 4BGUA 1LQTA 4RLSA 3VDRA 2DBQA 2OGUA 1H5QA 3JD4A 4CM6A 2B4QA 5EERA 1ONOA 3DZBA 3V2GA 3CE6A 2PGDA 4B4OA 2HLPA 3QVXA 1NVGA 2AA3A 2DAPA 1CF2O 2PTGA 4CR8A 4B3IA 1YOVA 3KOUA 1QSGA 5F3RA 3VC7A 3KEQA 5I8ZA 3PP8A 3SXPA 5C5IA 4L4XA 4AJIA 1EUDA 4R68A 1R4MA 2D1YA 1A7KA 3GA0A 3MZ0A 4BB5A 1M66A 5IAAA 3I4CA 1T24A 2Q4EA 1SC6A 4M89A 3MJTA 1O94A 5EESA 3ICPA 4NU5A 5CDUA 2P91A 3BAZA 4ID9A 3W4KA 4DBZA 3B6ZA 4DREA 4EZBA 4CM4A 3FWZA 4AJKA 5H83A 5DBFA 1BW9B 4TRMA 4OIMA 2GN4A 2D5CA 1QORA 5L40A 3QVSA 2DBVO 4E5YA 5CPFA 3VPFA 3DFUA 4PCVA 2O7SA 2D5AA 2V6GA 3DBLB 1MA0A 3ENNA 4AVYA 3KLMX 1CETA 2I76A 3OA2A 2FOIA 3ZV6A 4AJ4A 1ZFNA 4CR6A 1G1AA 1X7DA 4EEXA 3I9LA 4JLWA 4NZ9A 4MVJE 1PZEA 2C82A 4L4RA 3QV1A 1RM5A 1K2WA 1XQ6A 2H6EA 4ZN6A 2ZYDA 1X1EA 4WOKA 2H9IA 3K5PA 5HBRA 4L4SA 2VYVD 3BHIA 5J23A 1IPFA 4TSKA 4HXYA 3DBRB 3OEYA 1BVRA 3INGA 3RFXA 4E30A 2GZ3A 2J3KA 2Y68A 1NAIA 4EITA 2EG9A 4OJNA 2FPPA 3HG7A 4OOEA 4Y6RA 4BO7A 1VJ1A 2DBRA 4Y9DA 3IKTA 1HEUA 2PR2A 5JMWA 1EFKA 3ST7A 3T4EA 2FP4A 4J2HA 2C0CA 4YA6A 1NFQA 3OF2A 3OQ6A 3H9QA 3OFSA 1UZNA 5G2OA 3DTTA 1AGNA 2X5KO 3BIOA 5LCXA 5A04A 3MTGA 4MKZA 3VH2A 5HM8A 1GL3A 4J2OA 1HLDA 3MTJA 3NGLA 3NJ8A 2Q1SA 2Z5LA 2VOEA 2HQ1A 4NDNE 2J6IA 1F8GA 3Q3CA 4XYLA 4H16A 4HBGA 4DPLA 3HWRA 3LT1A 3W8EA 3DQPA 3OJEA 4J9VA 3KYCB 4TMFA 4PG4A 3N74A 2ZTMA 3U62A 2B69A 2IXBA 2ZCUA 1MX3A 3QWAA 1YJ8A 3WNQA 3MCVA 5FI3A 4ZQGA 1LJ8A 2WDZA 3GN2A 1ENZA 3ENKA 5IN4A 2RH4A 1Y9AA 2DBZA 4YXFA 5CG2A 3QWIA 5ER6A 3PHIA 1LSUA 4URFA 1KVSA 3RC1A 2JCXA 3OQ1A 3VPGA 1KIFA 3VTZA 1E6WA 2BD0A 4MOWA 5C7OO 2CSUA 1JWAB 1KC3A 2D4AA 4KWIA 3KSDO 5JC8A 4OL9A 2EW2A 1LRKA 2NACA 3DBLA 3EVNA 2Y0EA 4MO2A 4I1IA 3DXFA 3TL2A 4RVDA 1M6WA 1HETA 1PGQA 3P5SA 4XR9A 2XF8A 2P68A 3WBFA 2JD0A 4BNKA 4YT2A 1TVEA 4RDHA 3E6AA 2OO5A 3ROMA 4YJFA 4O0LA 1ULUA 3ZCXA 1DPGA 3PK0A 5DP2A 5JY6A 1IL0A 3DBRA 3L6EA 3BHMA 4O5OA 2YHUA 1R0LA 1LEHA 1IZ9A 4JP3A 4I5FA 4I9UA 3UW3A 1MFPA 5L7TA 3PJEA 2JHFA 5JAIA 4IMRA 3HN7A 1UP7A 4DQVA 4J43A 1XWFA 1X1TA 1U7TA 2X22A 6LDHA 3LLSA 4DLLA 4RL6A 3WB9A 1PS8A 3F9IA 1YB1A 1M6HA 1PTJA 1QYWA 1J5PA 1AHHA 3CTMA 3ROKA 1A7AA 3ZHBA 1K6IA 3R3JA 4CMCA 5HS4A 3RJ5A 3TZQA 3GGOA 3RAJA 5L51A 1K6XA 2PWZA 3KEOA 3R3SA 5I9NA 4JBIA 4DRYA 4OKNA 1ZXLA 2YFQA 3HADA 1PX0A 4WLOA 2AEFA 1NP3A 5THQA 3ONFA 1IZ0A 3AM3A 4MDHA 5KVCA 3KYCA 4W82A 4LGVA 1UXKA 1R15A 3SC4A 3PGXA 4O63O 4BNXA 2WWRA 4JJGA 5KJ1A 1CRWG 3PZBA 1GEEA 3WSWA 2NTVA 3IMFA 3RCBA 1BVUA 3UN1A 4YWJA 3E03A 2GDZA 2X86A 1BXGB 4XDYA 3UH1A 4D43A 3ZI0A 1VJ0A 3JQBA 3NJ4A 1ZK1A 3CXRA 1N92A 3MJ4A 4RF2A 4CM3A 2QZZA 3E82A 2ZB4A 1SBYA 4GX5A 4IDDA 1D1TA 4L9RA 1IE3A 5T5QA 1TEHA 4KMSA 5KVVA 3W6UA 3RI3A 2VT2A 1JA9A 5FFFA 1XU9A 4Q39A 4EGFA 1XDWA 3IJPA 2DU8A 1U2GA 3LC7O 1HE4A 3CEAA 2VT3A 4NPCA 1DSSG 4ALKA 1NBOA 3AY6A 3P7MA 3AI3A 1TT5B 4YAKA 2ZB3A 4KQXA 2O3SA 2CF5A 5GZ1A 1ZBQA 2VTEA 1H9BA 1ZMOA 3WR5A 2Y93A 4FFRA 1JVSA 5CG1A 4OSOA 1Y5RA 4PLTA 3CIFA 4YTEA 1P31A 1VSUA 1YBAA 1PJLA 3K6JA 1GU7A 1QMGA 3D0OA 2O4UX 5I7FA 1PJBA 2AW5A 4FFPA 5A9TA 4BO6A 2GCGA 1HYHA 1ADFA 1I10A 4IXTA 2NLOA 4W9NC 2VNAA 1A71A 1O9BA 2ZQYA 5EPOA 1FF9A 3HB5X 3PRJA 3WXBA 1E7QA 1LXCA 2NUAA 1CWUA 2WSBA 1YWGO 4BGIA 1J4AA 1GV1A 1OAAA 2RHRA 3RUDA 1Z7EA 5AXDA 4HUJA 4AJPA 1IUKA 1X0VA 2VHVA 4WCFB 2NVUB 7ADHA 2GN6A 1C0LA 4WOJA 1PU2A 2JFFA 3IUPA 5BSEA 3KSUA 4ROSA 1ZK2A 2QYTA 1WPQA 3DHEA 4DIOA 1QXSA 4NBTA 3JQ7B 4PRKA 4FCCA 1ZO8A 4RZIA 3LZ6A 5DN9A 5A5EA 5ER9A 2Z95A 2V65A 4YQYA 4JIGA 1BXGA 2ZB7A 4ZU3A 1C0IA 1OOEA 5DT9A 5HWSA 5G0VA 4CM9D 5JDCA 4A73A 1O8CA 3COSA 3H2ZA 3U09A 4OQZA 2HRZA 1ENOA 3TWOA 1Y81A 2XXBA 1V3UA 1WZIA 2YV3A 4KWHA 9LDTA 3ZNNA 4OKIA 2NV6A 4BMVA 5BSFA 1HDCA 3JV7A 3VPXA 4GMGA 3LQFA 1I3KA 2GASA 3NKLA 1LDMA 4DMMA 4Z0TA 1KEVA 1HKUA 1WMAA 5U1PA 2IZ0A 3AK4A 3RVDA 4MP8A 1EVYA 4R4JA 4YAIA 4Z0PA 1TT5A 3L9WA 5EN4A 5KIAA 3ZNOA 2EF1A 1K5HA 1VI2A 2AQKA 4IJWA 2YV2A 4PVDA 2AE2A 1F0YA 5ADHA 2QHXA 4H15A 1LLDA 4RVHA 2C29D 1N7HA 3S1LA 1B14A 2C7GA 3A4VA 2R00C 3ZGYA 3R0IA 3OBBA 2J5RA 3Q6IA 3D64A 4NBUA 4XA8A 3RC2A 4AG3A 4BKQA 5CEJA 4NHEA 2E6UX 5BQFA 3OIDA
chains in the Genus database with same CATH superfamily
4G0QA 1OFUA 3C41J 3GZTB 2VH1A 5LA6F 1PHRA 2ZIZA 1UJMA 3NEPX 1L5HA 2FWJA 1CZKA 1D7AA 3IQXA 5K6TA 3HJTA 4WE3A 3FIJA 1PS9A 3FDFA 1N5MA 1AS0A 1B8NA 4M8NE 3B53X 4JJ8A 3DWGA 3W8RA 1KYZA 4L7VA 5EVCA 4GH5A 4C4TA 3AEYA 4JX9A 1YQEA 3MCUA 2QTVB 5C8VA 3F7OA 5YASA 1TVKA 1XMJA 3INTA 5G41A 1YT5A 1KU0A 4TLBA 2IYRA 4RKYA 5FUYA 1GAWA 3O9ZA 2RHGB 4S35A 5DI3B 1X13A 2ORWA 1KVTA 4OQMA 3RNLA 2PV0A 1I7QB 1JQBA 3I83A 4DUYB 1BDHA 1Z7YA 2W71A 3STTA 3WAKA 3J80A 4MW4A 2H2WA 5JMTA 2R4TA 3LFHA 5L45A 5FCDA 3P0RA 4OI0A 3PXCX 3K2IA 4M1ZA 3JWEA 1DQSA 1KHTA 4ZHQB 4UBOA 3RW9A 5A2GA 3INYA 1XZ8A 3PJRA 4W5OA 5K8TA 2FMUA 5AW7A 2PUJA 3HKBB 1SXIA 2H16A 3KLNA 4UEQA 3DPIA 1B4DA 3UCFA 3FOCA 2Z2IA 4DFDA 4K03A 3ZY5A 3GCZA 4LMAA 1S8NA 3IP9A 3OPVA 4WSOA 2ODWA 3JQQA 4D2IA 4F86A 1A96A 1T34A 3HNPA 4JHLA 4BVFA 1GZDA 4DDMA 5KQGA 1QWOA 3DE7X 3JWJA 4IGFA 4KFTA 3GPBA 4N0MA 3VSCA 4DJFC 1Z7WA 2C5LA 1L4KA 4YAGA 1F8YA 1ZJ4A 5CT9A 2IPMA 4ZQIA 5GZ3A 5LWQA 1RDFA 2JFXA 5F1PA 1DO8A 1KYVA 1S6YA 1SCJA 1Z0AA 2O3RA 3H8WA 1KSFX 1CUZA 1SQ6A 3MQFA 4LK2A 4PAQA 3E22A 3RVOA 2HTEA 3UFBA 1Z4LA 3MJRA 4BB6A 4GR5A 2UKDA 3EFOA 1L3CA 1LNZA 4ZT3A 2JCVA 1RTKA 1UWCA 4EPXA 1R0CA 3VZCA 1KJ8A 2ZUDA 1H2HA 3PXEA 4IFEA 1TAHA 3U0BA 4CODB 4D9EA 4OJQA 5KWJA 1TTTA 3PC7A 2NSJA 4JJKA 1REQB 3QLJA 2FW8A 3CTPA 1AM4D 3CJRA 3P97A 4P1ZA 2Q1UA 2NQ8A 4W1RA 5BWCA 5JE8A 4DPKA 2J0SA 1L8OA 3JALA 1VP3A 2D4HA 1ECCA 1PR5A 2I2XB 4J16A 5FLYA 2FN4A 4HP8A 1Q3KA 1W581 2P75A 2WYIA 1E7MA 1IOWA 1NM5A 1MPTA 1E2KA 4JZYA 2EBUA 2P4UA 3IQDB 1KJ9A 1FUEA 2WD8A 4H0NA 2FK8A 2YIDA 1GCIA 1M9NA 2V6IA 2A7QA 3NDIA 3L0SA 3M6UA 4FNOA 1CSEE 2O9JA 3ZWNA 4E1BA 2X4GA 3L4BC 5TE9A 2HA5A 4EKEA 1W47A 3DONA 3ZHYA 1GITA 1R5NA 4IO0A 4W5WA 4FWTA 2ONYA 4D8YA 5FADA 3SMVA 2QNBA 3CX4A 3TLCA 2WMYA 2W8BB 4QDKA 2R8PA 1CYDA 3V6LA 3TN7A 4M1EA 1L4EA 2R1VA 4OI1A 1IJFA 3D8HA 3HDYA 3OLYA 3DVQX 1Z45A 2VP5A 3BWXA 3EZNA 4TVBA 4ER6A 1DG3A 3E1KA 1G3QA 1WP4A 2I6FA 4E31A 1JKIA 3DVLA 4FXPA 5JCPA 2WWGA 1YKFA 1NBME 2WYUA 3T3HA 3F97A 3COJA 3KOYA 1T9GR 5EIXA 2IHNA 4D8TA 3VZRA 2H7YA 3K1TA 4TTIA 4I6GA 4II3A 3QVWA 4AT1A 4R51A 4LC9A 4P5DA 4U9UA 4CKZA 3SJBA 2ILTA 1PWXA 3G9QA 3ONWA 1IHOA 3EQ8A 1FDUA 3KUXA 2P9BA 2ZPAA 5KU1A 4P92A 2VDVE 1CRPA 1F4LA 3ETNA 1FFWA 1LWNA 4RV5A 3CT4A 3FZQA 3PUZA 4YMSA 3PFGA 3DTVA 3G9ZA 4LTNA 3GAMA 3HGTA 1AO0A 4X54A 5BYAA 4IDUB 1F48A 2X7JA 1QIJA 2WHPA 1KVRA 2XX3A 4PC1A 2G0AA 5FL3A 4KPUB 2V1XA 4D5GA 4BNIA 2VNJA 1GAXA 4D3YA 1ZG3A 3AM4A 4B0OA 1YMUA 2NG1A 1MB4A 2BEWA 3RUFA 3ZW7A 1B16A 4BTLA 1ZR4A 4E5UA 3Q3GE 5H7XA 4DIDA 3GC6A 4WLFA 5FWNA 1ZD2P 5KNCD 5PGMA 3TCXB 1F6DA 1JDVA 1EP3B 1DEHA 3KWLA 1G63A 4JITA 3NXSA 3LECA 1E64A 5EOVA 2FG7C 2F59A 3COYA 3HCEA 1JNXX 2A0YA 3LPMA 2VUUA 4BL5A 3A05A 3OJFA 1Y80A 4D3DA 1TDJA 3ECCA 1TFRA 1KDZA 4Q1CA 4XIIA 1RIFA 2BFOA 2YRWA 3MMZA 1UMDA 2ONCA 4ZEOA 5GIPE 4WXRA 3MUOA 5ISMA 2M1XA 3T0IA 3DMTC 3GGGA 4BO3A 1WCIA 2PX5A 1SUFA 1P45A 3DOHA 1IXSB 4K8OA 1Z0UA 1PR1A 5F5NA 3WL7A 2BGIA 2RHTA 3ZE7A 3RTEA 4ARCA 4TKZA 1P33A 2KSQA 1KNXA 3G88A 3HKCA 3FPGA 4G0OA 1LWOA 1IFXA 2YVLA 4JLNA 2VLBA 3BCRA 4IZ6A 3UHAA 3P1JA 1G20B 1DV1A 1U7DA 2GI4A 5JH7A 1EE2A 3MFQA 2XYHA 1HFWA 4BDTA 1U0TA 2CXPA 1N8TA 2R3SA 2F3QA 4XZ3A 5KREA 1L6RA 4KO1S 2B98A 1K1EA 2ZT7A 1CT9A 2X76A 3R77A 5B1DA 1ZK4A 4L8VA 1RRVA 1AQNA 3C6QA 2WZBA 3LX4A 3RROA 1SZCA 2WAYA 3L1KA 4ZI7A 1Z37A 2KWIA 1EFUA 1S7GA 1WV0A 3B2EA 4F1JA 4Q7KA 3STHA 1I13A 2CLHB 4BMXA 1ODIA 3GGDA 1XFAA 5HKBA 2ZRHA 4R83A 5AO9A 1U4NA 2P0YA 1KL7A 3NDJA 2ZREA 1TF7A 4WN9A 3RUCA 2ANBA 4M0UA 3BRSA 1JG4A 1K89A 1QK3A 1P74A 4OK6A 3UMRA 2RG7A 1TC1A 4PXSA 5KB3A 2OK7A 1H8HD 5B3AA 4E5DA 1WTAA 1P75A 1WKCA 4JY7A 5TPWB 3PHLA 4L75A 3O0TA 1YHNA 621PA 1AJEA 2CK3A 4IXDA 2ZQ5A 3E5MA 1G8SA 3HGQA 4EDFA 4XJTA 4XB2A 1WU8A 4Q7EA 1BHJA 2O0LA 4BVHA 2REXB 1QHEA 2I1QA 2IHKA 2ZR8A 3FZYA 4PFJA 1QU3A 5JQGA 2FFJA 1UIMA 3OZFA 1WO8A 4URHA 3J81A 4BQSA 2XWQA 4UQPA 5JFOA 1R6AA 2VNIA 1AGRA 1EDBA 2ZJ1A 4PV7A 5JMOA 1V7PC 4XEHA 3GARA 4HQRA 3QFSA 5T8KC 4ZMSA 4BASA 2J5BA 1IBLB 4V38A 4H2DA 2ZIEA 1DKQA 3CKKA 3O4VA 4Q1DA 3G17A 5J5VA 1MW8X 5E6UB 1OWMA 4M1TA 3K70D 1XKTA 3AB8A 4FFNA 2Q46A 4Q1AA 5L6MB 1A9XA 2X42A 1U0GA 4JUCA 1MX1A 1Y3HA 2V6MA 1ZJ5A 5AXBA 2RC5A 3E18A 1N5JA 4TZTA 5HJ5A 1DOHA 1EINA 1R0YA 1KYXA 1NR5A 5H3HA 3ZE1B 2O23A 1HG0A 3QEMA 2E4ZA 4FINA 4EJSC 2W6QA 2JD1A 1R4NB 4YP9A 2O05A 1SOUA 3NTRA 3PTAA 2P9ZA 4AUMA 3SVLA 1UOPA 3WLFA 2HR1A 1YAJA 3OZGA 1EK5A 1HQYE 1TEVA 4YAJA 5CA1B 1XD2A 1JHAA 3AMVA 1UQTA 3H0EA 3ZU3A 3RWOA 1I6WA 1T5TA 1HSOA 1J0DA 1E89A 1PT5A 2VI5A 2O3QA 3HB9A 3GVXA 5IYZA 3DFFA 4RY8A 3VJLA 5AKLA 3TDMA 1NQUA 2A30A 4A0FA 2C04A 3B7GA 3BDIA 4B3HA 4GFDA 3GFGA 1WUHS 1O6FA 1COWA 2JHAA 3BTSA 3IIKA 2ONJA 3SNKA 3F4BA 1Q7GA 1WDMA 1Z39A 4M83A 1L7XA 1Z2AA 4KE6A 3UV3A 2RH5A 3M6MD 1Q0HA 2QAJA 4GZ3A 4UEKA 3AEQB 5CLQA 3VA7A 3B51X 4HS9A 1A72A 4NV3A 4L0CA 1VTKA 2VZLA 2JI7A 3DMGA 4OAOA 4Z1MA 3F2IA 4RAQA 4DLPA 2OV2A 4OLBA 5BSGA 4IEIA 2IZ1A 4M86A 2YHAA 3RK4A 1GXSB 2H52A 5JRJA 5ICFA 2IKSA 4E0BA 3ISTA 3LCUA 4CMCA 5D1NA 4S3MA 4IYJA 2Q0SA 1YMQA 5DM70 5AW0A 4BRUA 2JG3A 4KVFA 2H2AA 1X9GA 2JKZA 3BCUA 9MHTA 3EY4A 3WG9A 4S2EA 3ZU4A 4EELA 1W2GA 3VOSA 3WHLA 4IY1A 5FR2A 2PMWB 4H7FA 2QT0A 3SXUA 1G2IA 4NH0A 4BLUA 4X94A 3E5RA 1SBCA 5IAEA 3WRWA 2GD1O 3GB9A 4AXXA 1BWSA 2R7NA 5KOHA 4TYMA 3DLCA 4FHFA 1M2KA 1RWOA 4FILA 4MCIA 5HGJA 4CE6A 1DNPA 3IOYA 5AJHA 3HBAA 4CFZA 3ZGXA 3ZHZA 1ZW1A 4PRYA 2ZUWA 2XZTA 3RSZA 3S6JA 2YHIB 4EABA 1RJEA 2PIDA 5AUNB 1ESEA 3DTVD 2JZOA 3FYHA 2RD2A 3MWDA 2AR7A 4OLHA 3H5OA 4I55B 4Y9UA 5D3KA 2QZ4A 2FU5C 1YDEA 2CCJA 2QM7A 2QX6A 1JAHA 3MRXA 4LXIA 4QTYA 3OQOA 5GJVC 3EJWA 1M7GA 4EHJA 3IE1A 4AZ0B 2WU3A 1KY2A 1Z26A 4WK6A 3VR6H 1JR2A 2IEGA 3DZDA 3LCMA 2W83A 4ZWNA 2QIOA 3BXOA 4TMZA 3T7TA 4PZPA 4TVKA 4DIUA 4LYDA 3CEHA 3VVMA 2UXCB 1NI4A 3K1ZA 4C43A 5CD1A 4UJ3A 1T26A 3FB4A 4RA6B 4FNMA 4R8RA 1NW8A 3SE0A 4LXXA 2E1RA 1RMYA 1R9GA 1QR6A 1OYWA 1LDNA 3AYXB 4ZOEA 4RQBA 1VRWA 3FLAA 3JU3A 3HWX1 1IK4A 2JEYA 2PUTA 2WC1A 2BMEA 1NT2A 3NBUA 3PB3A 4DVGA 3HS3A 1GKIA 1F2UB 1RR6A 4CLHA 4FSXA 1Z82A 3UGQA 1Z18A 5DJ5A 2VJKA 1JFVA 2NYAA 3GZNA 5TPZD 2ZBUA 2J8ZA 1KMNA 4CL3A 3TLZA 2BLNA 1N9GB 4FIDA 4ZHQF 2Y4NA 3A4LA 1FYVA 4CQMD 4X1YB 1XDZA 5JCJD 4IIGA 3NT5A 1B73A 3DE1X 3WLLA 3F0TA 5JYEA 1N6IA 4EI2A 3IALA 4DG5A 5EIFA 3HJGA 3KAQA 2WTEA 3TAHA 1C7RA 3HDGA 4CHGA 1PAUA 1K7FB 5D00A 5A05A 4K2AA 1Y5IA 2FEAA 1NDUA 2C5GA 1GGMA 4YGXB 3LZDA 2XNKA 5KSPA 1FPMA 3M1AA 4UQOA 4W8HA 1J2TA 2J9RA 4MWSA 3V7WA 1UJNA 3S99A 3ADBA 1NTOA 5KTYA 2F3TA 4R7ZA 1NMSA 4TQGA 4EMUA 4F4JA 3SS8A 5BN4B 2CK3D 1BXZA 1P1RA 2HO4A 3I4FA 1FNNA 3NZEA 3R44A 1WMSA 1FU7A 1MMFB 4H27A 1KIAA 2FN3A 4I2VA 1EUCB 2FI1A 5GMOA 2Q1TA 2AZDA 1NVWQ 2GPJA 1IHPA 2WM2A 2PWYA 4QBFA 2YCBA 5G0SA 2Y1LA 1PZGA 1MAVA 3BMXA 4LYAA 4B6PA 3W5CA 4KE8A 1R6XA 4YQZA 5I51A 2E82A 4FZRA 4IKEA 4L8LA 4TM7A 5F77A 3VYSB 4ESVA 2OXIA 2E55A 1AZTA 2QN7A 1CR0A 5EC8A 1L5FA 3EOAI 4QGAA 1R0RE 1HSZA 2M1ZA 4PGMA 2X8WA 4R9RA 1BOOA 4A3SA 2H1FA 5HF8A 4C0BA 3HFGA 3HFSA 3D3QA 1NHGA 2ROQA 2DFPA 2PBZA 3CWQA 2A92A 3HCOA 1SC1A 4KXNA 3T5AA 2GAAA 3DSRA 1QFJA 4INAA 4YT4A 1NFFA 3LPCA 4YY3B 3HDQA 1EQ2A 2JFYA 2COEA 4M7PA 5LBTA 4KQHA 1D8TA 4BLTA 1FA9A 4L4YA 1QYIA 3BE6A 3GD7A 4YIKA 3LHDA 1QK5A 1BHSA 1THZA 4IOMA 3B1VA 2JCBA 1C3JA 3WKBA 5F3DA 2X7HA 3T4PA 2R8ZA 1OA1A 1U3VA 3WLQA 3DKRA 3R7LA 1UXJA 3RIGA 1CDOA 1JHUA 1NVFA 1CNEA 4P5EA 4LQCA 1E6UA 1QQ7A 3JQ6A 5JADA 4JL6A 2C5AA 3TGWA 1UJ5A 1ZA2A 1VYHA 4DG8A 1LI4A 1UK7A 5C52B 4RLHA 1VHDA 5IBQA 3LDAA 1RYBA 5U4QA 2GHRA 2TYSB 4HPXB 1C50A 3KSBC 2PVPA 4DMFA 1R0XA 2FPIB 2M9MA 2Y66A 3H9GA 1RE0A 2XHZA 1G55A 4KHZA 4WXHA 3V7UA 2CDRA 1TU3A 5DLPA 1NXVA 3OMXA 4UHBA 2ZUUA 1SOMA 4FFBA 2QU8A 4IWYA 4Z1MD 1WLSA 1Y8CA 3HXKA 5AK3A 5KWVA 4FFSA 4G4SP 2BRUC 3KELA 5FPYA 4QULA 4PTZA 1X7GA 5I9SA 4ZMRA 1K8QA 3FZGA 4KAAA 2HBYA 5FD8A 4BZWA 5I5GA 2CLSA 4M49A 3PT9A 4BBPA 5CXQA 2CNLA 1LQUA 3QLUA 4Q82A 1JBQA 5FQOA 4YJDA 1Y1TA 1NXWA 2A0UA 4XTCS 4CT0A 5IDYA 5CEEA 4Q3BA 1VKOA 4WAUA 3WDMA 2VHEA 3ZBPA 4CQLB 2BZSA 2RDMA 2RHBA 4J1NA 3TTUA 4RL4A 1B3RA 2QJOA 1WKVA 4O2BA 3ESZA 3H83A 4D9NA 1E32A 3TW4A 3BB3A 3DDCA 2X8JB 4F3RA 1S96A 3E7DA 4P35A 1OI3A 2LDBA 4IHJF 3UJBA 2DF8A 1GN8A 4B6RA 3M3DA 4JWTA 3R20A 3UJ6A 2GM9A 3HRHA 3KYDB 5JPIA 4LXUA 1DKRA 4LDNA 4BNGA 4XQ0A 2H5LA 3D4BA 5G4LA 5JZ9A 1IEWA 2QTRA 5IN5A 3A4IA 2VJCA 2XYGA 1V8DA 4WLEA 4D0RA 4LZWA 3H16A 4RKQA 4YVFA 3F90A 1HV8A 1BKSB 4GR4A 4LBWA 4DBLE 3L4EA 4P0QB 3OQIB 3B6KA 3FUUA 5ALSA 1CFZA 5ESWA 4CCSA 5K09A 4X91A 2N75A 3BD8A 4WCFC 3EF3A 3OQHA 4UNIA 4L3OA 2IE0A 4N49A 1QRTA 4R0VA 3DD1A 5C8YB 1E3MA 3EA0A 1YR9A 2O2CA 4FGWA 2VK4A 4J76A 1RM3A 1S3GA 2GN9A 1A5BB 3Q5EA 3NS7A 3VDQA 4V0MA 2EDCA 2OUIA 4D9GA 4DIFA 5BMVB 3LPNA 2B6HA 3FTNA 2JIPA 4EEKA 2WR8A 5TF4A 2NO9A 4XGRA 3FNQA 3AEUA 4KI7A 1B6GA 3UT6A 3QNMA 2FPLA 2B6NA 3I1FA 4L3VA 3WTBA 2C3MA 1K98A 1K4MA 1UBOS 4RJTA 4AP6A 4QTUB 1JEQA 1HDIA 2JGLA 5FLKA 2IP1A 5L3QA 3ZX4A 3QZUA 1NBMD 5EJ7A 1HH4A 2QMZA 3N6XA 4V3BA 3HVRA 1XL1A 2HA7A 5JAUA 2XCUA 4URVR 4C1BA 3HUTA 4JL5A 2CYBA 2PFSA 4WNAB 1ZUIA 4F4HA 5DIFA 5CMLA 3RT1A 1ESCA 2XE6A 4PZCA 4BB9A 3HI6A 2V03A 3CCFA 3QP9A 5JQWA 3GLFB 2P1ZA 2DQ4A 1Z6AA 2C20A 3DO6A 3K5IA 3RO7A 3RQIA 1ZINA 3BN3A 2Q6VA 2WZCA 4IJMA 2HIMA 1GKYA 4RDIA 3UMGA 1ZN9A 3WKDA 5BSWA 3HP7A 4LW8A 5HSGA 3PWKA 5FPQA 2RK4A 4UQLA 3OQMA 1KZYC 2BFAA 3DB1A 2Q3JA 2IOYA 4D99A 1DRKA 4Q00A 3KVOA 3RWBA 5JS7A 4WIAA 4MHTA 1EVEA 4HB2A 2Q6TA 5ED4A 3U9TA 4A8JB 2VSQA 3THWB 5DZSA 3QPWA 3REQB 2CYAA 2EC5A 4B3FX 3KSAC 4EF4A 4ENQA 1GADO 1XLUA 4OHCA 3HDJA 4C6RA 5I47A 4P7BA 3EW7A 4YYEA 3V7NA 3IE2A 3TEFA 1UDAA 3ZWXA 3QE3A 2NQ2C 2NZUG 3PNBA 1CQXA 2JVKA 4FUQA 1ESMA 1C2TA 1GDHA 1DIGA 1ZEMA 2WHXA 3QA9A 4EI9A 1JV2B 3ZOKA 1C8BA 4LDPA 2ODTX 1C1XB 3G2JA 5EXTA 2HB6A 2FLWA 3RKRA 4BJ1A 4GL2A 1GGVA 1UJ4A 1IXRC 2AG5A 2O2SA 3IP6A 1Y4AE 3GXBA 4P4SA 4Q02A 4EA6A 4MB6A 3EZ2A 5ETJA 1P72A 1U28C 1E98A 2AFHA 3MD9A 3QFRA 1FNCA 3DV0A 2JI6A 4WKGA 4XSVA 5AI4A 5HK8A 3OG9A 2G9VA 2R87A 2V4UA 2HSWA 1XRRA 1E9CA 4QPZA 3E7FA 3F2VA 2XADA 4YRCA 5CM8B 4G8CA 5DNAA 4BKMA 3N2KA 3CB2A 4RK5A 2C2BA 3ZGNA 3M5PA 1AUXA 2R5FA 3F7MA 3KVVA 1VLHA 3HCWA 1T3HA 3QPVA 1U3GA 2XMRA 4XGNA 1JAXA 4L2IA 4HWGA 4UXJA 2GH1A 2R751 1YU6A 4B85A 1XPOA 3OEHA 2HYDA 1JPNA 5DXAA 5JW6A 2PT7A 4HXGA 1YE5A 1NUPA 2DUJA 2Q3FA 3MT7A 3Q3VA 3GPIA 4I4CA 3KB2A 4TL7A 3I12A 5H3CA 3P0JA 4TTPA 4DR1B 4ZICA 2YYZA 4ND8B 4GBJA 2RAFA 5ES3A 5DEOA 5LU8A 2E49A 1W29A 2F3UA 4LPSA 4LWPA 4MEJA 3L06A 4ND1A 1XF1A 4N9WA 2V7QA 2W0SA 1K8ZB 2DQKA 2G7MC 3RF6A 3F3MA 5B57C 3LW8A 5CD9A 3TQCA 1DOAA 1V71A 5EQJB 3GN1A 1D8AA 5KQRA 2ET6A 1EA7A 2B21A 1U1IA 3KVYA 2VRWA 3GY0A 3QE9Y 5BWOA 1J0BA 4B0PA 2JAQA 1DX6A 4EKNB 1G3MA 5H9VA 1PJRA 4XJVA 4M22A 3HTXA 1PJ8A 2VWPA 1QS0A 1YQUA 3U13A 3UT5B 5DO9A 2P3SA 3V3KA 4LOLA 4B73A 4DMCA 5CXSA 5IG2A 3V1MA 1NVBA 2DUNA 3GFPA 5HF5A 3UMCA 1VHWA 4TS3A 3LLCA 1U0OC 5DMXA 4BZPA 1Z6ZA 2UYGA 4PLVA 5F7XA 2PS3A 4W9RA 3BT7A 4DGQA 3NHRA 3G5TA 1UC8A 4LRTB 2VFAA 1JAZA 1ZKMA 2BP7B 2OFXA 3AVOA 3IEIA 3FDZA 3HBLA 4E14A 1NJSA 3Q6NA 3BUSA 2GF0A 4WLNA 5J1SB 4JFAA 2AMVA 3DTVB 1JIQA 4YRQA 1EFTA 4K6HA 3X1YA 2WJ3A 4ONEA 4A6DA 4DARA 2ZI6A 4GPEA 4W1PA 4CIBA 2PSSA 4Q4JA 2AC2A 1KI6B 1CD5A 3CZQA 2YYAA 1RVDA 2BUBA 4ZZ2A 3N2LA 4AO7A 1MOQA 4ABYA 2ZI3A 2XNCA 1FTSA 2FPXA 2JNWA 2NO7A 1WUJS 1DJQA 2VWGA 3QE4A 3OZCA 4W9NA 2XJ4A 2BKAA 4KXQA 5CDSA 3HO1A 1QLWA 3NP7A 5ENVA 4ZRNA 4YAUA 1TQ6A 3TG8A 4CMIB 4IDCA 5BN3B 1FSSA 1RC0A 2EHJA 4B6JA 3NBMA 4EATA 1YDFA 1DAFA 1EX7A 1SCNE 3OE5A 4X5OA 1SWWA 1MQ8B 2GESA 3ND5A 3LOUA 4YRJA 1XDGA 3DLPX 3RUAA 4OHYA 5GGXA 1BMFA 3M6FA 2PD3A 2PYIA 4A82A 3BXPA 4A15A 5MFPA 4QAQA 3NC1C 1VSBA 3FLEA 4KIGA 4P5PA 5H0IA 4D97A 1ZEJA 2XUPA 3ES9A 4HZIA 1Q16A 3ZKWA 2YYYA 1JQEA 2OT3B 2H1SA 1Z9BA 5JU6A 2JFBA 1RQGA 1W5TA 4LSMA 1GG2A 1QVVA 2NO0A 2FQYA 2OHHA 1CUBA 2YWRA 2ZXFA 1PRYA 1CY7A 4B2YA 1RXWA 2ODNA 2VHTA 2OBYA 3JWGA 1P1FA 3WXMA 2RBGA 4IIUA 4DRXA 5AOVA 2ORIA 2ZI7A 4R1SA 5JPCA 3D43A 1TJNA 4LZPA 1IRXA 4FDAA 4N3AA 2F7SA 4ND5A 4XX0A 2AUTA 1CY2A 4LRUA 3V8BA 4A6XA 2QGZA 4ZI2A 2C3YA 2VHJA 2IXTA 4NYJQ 1G59A 4JASB 3T7DA 4UZSA 2RHHA 2UVPB 1RAIA 5IJZA 4IJSA 3GCXA 3LUAA 4EK9A 4KX3A 1CY8A 4MVJD 2PL3A 1QBGA 2WD7A 3KZCA 4B35A 2QM0A 4ZFNA 1TTHA 4XFDA 3VFDA 1L4GA 3KK0A 4ND3A 5BVHA 4DDKA 5H4GA 3K2BA 3I2IA 1N2HA 5IBRA 4N82A 5IUNC 1OH8A 1T10A 2QORA 1T3TA 3L1JA 1XEXB 5BNTA 5TY0A 1ZGHA 1CJUC 1PP4A 2R7KA 2OXEA 3GRYA 1VPTA 1LBIA 2CB0A 2Q3DA 3SWWA 4CTMA 5JROA 4UZFA 4ZT6A 1E92A 1ZGCA 3V4SA 1QIHA 4BUCA 2HDNB 3ADKA 2OCXA 4NATA 3GOHA 4B3RB 3MTDA 3PHJA 4FW9A 2YVAA 1O5TA 5CDTA 4D56A 1GNLA 1K06A 2IOFA 3G9XA 5GADl 1L3IA 1A9XB 2RGEA 1UZLA 2XCIA 1J42A 2YXNA 1JLLA 1WXGA 2BAGA 3PC2A 2R00A 4W1QA 2P2DA 1DKMA 4DIEA 2Q0QA 1WXFA 4M0KA 3V1NA 5LMUB 1PKXA 3F6PA 2W4MA 4MWOA 2ZCJA 1QTNA 3DDUA 3T38A 4F3CA 2PX6A 5DF1A 4S1OA 5AT1A 3X0DA 4FMDF 5FWXB 5IC4A 1AA9A 2ZRAA 1U3CA 1M2OA 2FLKA 1XD2B 2QPTA 3LBIA 3FNHA 2MSCB 3ENWA 3VR5D 2ZSJA 2AZTA 4B34A 2INGX 3WIDA 4L22A 4WVLA 2DWUA 3N0VA 3T3IA 3ZWVA 4CQMA 1O96A 3R5SA 5CA0F 4LRWA 1XRJA 3DDHA 4XWKA 4L5BA 1FRVA 3OEHD 4Q3NA 2CXUA 1KEZA 2OP1A 3LWBA 3VZDA 2W2KA 4A2WA 3I9KA 5AVQA 2E4AA 1V5IA 2XYQA 4JEIA 4WZBE 2RK3A 4IVQA 2GX6A 2DRIA 3H1GA 4LECA 3QBVA 1QP4A 1U9IC 1CFJA 1OAOC 2D1TA 4PG5A 2DKOA 2GJ4A 4KQEA 1B23P 2B20A 2HRBA 2WIKA 3PXUA 6ABPA 2V9ZA 2IPLA 2M32A 5C81A 2V7QD 3C6YA 4MKRA 4MUNA 1JMKC 1SXGA 3NBZC 2VAVA 4DSTA 4RZ2A 5H82A 3CEPB 5BYKA 2NT4A 1HYQA 3ZLAA 3EGXA 4YJHB 3SEZA 1IM2A 2A4KA 1UK9A 4YRLA 5LMNB 5D51S 5CVTA 1CC1S 5LJLA 1EFVB 5DLEA 4LF5B 1XTZA 2PWBA 3UAZA 2EFGA 2V6BA 2GFHA 1N4DA 3LQ2A 1QZUA 4CUZA 4EI7A 4YJGA 3GLIE 2CE2X 2JGDA 1D2GA 1ML4A 2GWHA 4HAXA 3UMFA 2WP0A 1BJKA 2XDAA 3HL4A 3QF4A 1WE2A 3CF0A 3TEJA 3WQSB 2J4DA 1AKTA 2LKDA 5JY1A 4UTXA 2HXGA 5IF3A 4V0OA 3K05A 3BWDD 2QPAA 1FSFA 1G8GA 4EFMA 5KOHB 3Q7TA 1T9GS 4HWOA 1B2LA 2XKAA 5DX8A 2O5RA 2QOEA 2R1TB 3R5XA 2IYWA 4TQAA 1SB9A 5ARCA 3ORHA 4LFBB 5C8YF 1GQOA 2GK7A 4B3XA 5IMBA 2Q07A 1UDRA 3IO3A 2ZDHA 3V7FA 4PY2A 3T41A 3FHLA 4UC0A 1DWUA 1EVZA 2DC1A 3MSXA 2EZ4A 4E3WA 4E33A 5BMVF 2OD7A 5JJLA 1DXYA 5LB4A 1JTVA 4IS3A 2B1RA 3L7JA 1DXOA 1GSIA 4OP1A 4CMKA 3O4HA 4E6PA 4EYOA 3U16A 3MB5A 1NP6A 5IKEA 3B3GA 5F3WB 3DVAA 3R5FA 3WK9A 2PH5A 3QUSA 2YC4C 3VR4H 4XX1A 3COVA 1A50B 3X3HA 4YJ3B 2RKBA 5GAJA 3INRA 3UUGA 1EXNA 3D1JA 3M0EA 3BIWA 4MLCA 3C39A 2BGNA 3ETLA 1J2YA 3ZXIA 2H4YA 3ETHA 3HE3A 3LY7A 2G07A 5CTAA 4X71A 1PLJA 5EUMA 4ZQHA 5AOAA 2NPFA 2ZSFA 4EJ2A 2VKTA 4TRJA 3L4BA 1GGEA 2OQ2A 2X0NA 1H4SA 3NTXA 5HS6A 1LPAB 2X8LA 3R8CA 2RHLA 2MR5A 5ALRA 3WBKA 2DUWA 2A9RA 4D74A 2HEIA 1MKYA 1BU5A 1TQ2A 3MINB 4IHJA 5SZIA 4XDGA 3TAUA 5ITSA 4RW0A 4GZMA 3VNBA 1V26A 3SI7A 1NMEA 1QO9A 1XNRB 2XVXA 2XQVA 2BZ0A 4K9OA 2FSIA 1XOIA 4KLNA 5BSVA 1GPKA 1E2MA 2Q4RA 2R6CA 2WWIA 3G7SA 5B58T 4E2XA 5FTLA 1T4CA 1PZHA 1TYDE 1EFLA 1ONSA 1QP8A 1ZRMA 2VHWA 4WK4B 3T5CA 1Z0JA 4MV5A 3ONVA 2OMEA 2QRHA 4QHYA 1ZVJA 1FK8A 4UMEA 2I8AA 2MOKA 2Q4BA 2G67A 3A2LA 3W6OA 4UUMA 5TQVA 2W37A 3MBIA 3OHMA 3QUAA 3TJMA 2P9TA 2ZJZA 2JH8A 2R6HA 3C3JA 2OQIA 1I2MA 2OO5C 2QR2A 2XVYA 3QRWA 4MV6A 2AI1A 1FFXA 2B3TA 2Y76A 1N1GA 2IP2A 3G7NA 3SZMA 3SNHA 1ZJWA 1DDGA 1YQQA 3NAZA 4OX9B 4EHDA 1HL7A 1YJXA 1DCMA 5DYNA 4JLSA 4PU0A 5I48A 3MUEA 1DBIA 1IY2A 1P2GA 1Z6TA 3GH3A 3K4PA 2D74A 3OD1A 4HKTA 5KC9A 4RE5A 1ZHFA 1SB8A 1T2FA 3OCWA 5GJCA 3A6FA 3DE2X 3C8MA 3NIFB 2NX2A 4RM3A 3UKJA 1YJQA 3OZXA 2Y99A 3I2YX 4UAVA 1N5IA 1L5OA 3SQNA 5JZVA 2ODBA 3VYWA 4DIMA 1PTJC 4EY3A 4QQNA 1OGYA 1KORA 1N1MA 2HH9A 2PZ8A 4YBZA 2OAQ1 3HVIA 4R8KA 2W5UA 3NHWA 1GIAA 1GDTA 3GLKA 2BFNA 4QKQA 1KC1A 3PIDA 4Q05A 3D4PA 4PBRA 2ECPA 2L19A 2YOGA 3DMTA 2V5UA 4C4YA 3VH4A 1ATIA 2XI4A 3I52A 3TW0A 1WD7A 4UHDA 3TB6A 3HU1A 1DX9A 3MLBA 5H70A 1YCFA 3EBOA 3GFQA 3R6TA 5EZYB 2W2TA 3LQ4A 1FC0A 4BNDA 2E1PA 3IQFA 3R8XA 4DBVO 5CVCA 4ED9A 5HIKA 4MDYA 1NU8A 3X2FA 1CVRA 3FPBA 4BRWA 1NVVQ 1OJ7A 1FY2A 3LP5A 3RHSA 4XOIA 2AWOA 4JOCA 5MF6A 2R6ZA 1SBIA 1R4ZA 1KQPA 1CY0A 2SKCA 1X19A 2PUCA 4GSYA 2YFKA 4GOKA 1B6SA 2DECA 3E4DA 4U7JA 3CGWA 3MMPA 4WOCA 4CLDA 3THRA 1NJFA 1GSAA 3KUKA 1WW2A 4CIVA 1U0LA 3JATB 4X6LA 1Z56C 2XB2A 4IIXA 5EKSA 4G0YA 3T7SA 4C3ZA 3PFKA 4KLCA 2QM3A 4WA8A 3QG1A 4RA9A 5ALXA 3FTPA 2RCYA 2FHPA 1DLIA 5I7EA 2AVNA 3KYBA 5DM2A 3RIEA 1ZY2A 4U2BA 5AHKA 3ESRA 1KPHA 1SVUA 3PQ7A 5BYBA 4AAYA 3M6IA 2NSHA 4ZAZA 4S1TA 3LD9A 4W4TA 2P77A 1JI0A 5E8RA 2WIJA 4FFBB 1U8AA 4IDGA 3SYLA 1SVNA 1MXFA 2ID4A 4GPZA 5F64A 3T5GA 3UXEA 1XB2A 2PKWA 4K6CA 3RIYA 4N5LA 4CM1A 3GLVA 1W73A 1NNSA 3OOJA 1L3BA 2FTKE 2G71A 4FD2A 4HWPA 3A9WA 4FC6A 4PIPA 1MO2A 2RARA 2Y1FA 3RIXA 2JFZA 4KMMA 2H48A 4OBBA 2HKIA 3UV7A 2I7CA 4GXNA 1AXGA 5T8KA 3RREA 1R18A 2DHDA 3HR7A 3OOWA 3PNSA 4DSAA 1L1FA 3TW8A 2NVOA 4NENB 4C0WA 4CJXA 3D59A 5CRIA 3WO1A 2VQ6A 4F91B 5EI5A 4JNKA 1SFRA 1WABA 4J4HA 3F6SA 1JU4A 2G0TA 3KV3O 1MJHA 4Y2QA 3STYA 4XB6B 2VDOB 3OI7A 1POWA 3LBAA 1K5GA 2GRUA 3KTDA 5DRTA 1AS3A 1D6JA 4XKJA 2Q62A 4M0MA 1FVHA 1U7UA 2W2NA 1KYYA 5JXIA 1GRQA 1QFSA 2OECA 4ARZB 4EJSA 2J67A 1NNLA 3UB3A 4EPYA 4EVQA 2V7PA 3WWDA 1HY3A 3O3NB 5FA5A 3U7HB 4OO3A 3ZCQA 2ZJ7A 1OXVA 4AWXA 4BDSA 1VJCA 3EN0A 5TMPA 3MRVA 1TM4E 4KQGA 3L6CA 4U1RA 4MRRA 1UDXA 4JNCA 1WB6A 5IVHA 2FZ4A 1QV7A 3AZQA 2C00A 1PCXA 4HNHA 2Y67A 4AJJA 2PH3A 3QE2A 1H3FA 3ZCTA 5AP9A 1PJTA 1VLMA 1JU9A 3QOWA 1HYEA 1U7HA 2ZRNA 1BW9A 1O4WA 2DUMA 3OX2A 3OPYA 1DT3A 4CV3A 4EZIA 2DPLA 3C7DB 1VI6A 3G8CA 3N2IA 2GYYA 2X23A 4RCYA 4BMOB 1K8YB 2A9JA 2VAWA 5I6DA 5DYIA 3CGGA 3W7AA 3GDHA 2Y0BA 2RHDA 1K9SA 1YHYA 1YB5A 4N03A 1KEKA 1S5PA 2R4QA 2XXJA 1QIGA 3DOIA 2ZQZA 3AEKB 3CG4A 1XTUA 2DVMA 4QPCA 1M2FA 1N9KA 4WZAB 4YP0A 4DCVA 1GQQA 4WI1A 2YY5A 4FNGA 3TIXB 5F9FA 3AEUB 3N0TA 4MUJA 3SBOA 2ODEA 2VH5R 4F96A 1RYDA 2XTAA 4M1WA 1WUYA 1N8NA 3FMFA 3JRNA 5JDCC 4IGKA 1KZ4A 1L4FA 5AXCA 2OHFA 1E5QA 4AJEA 1VP9A 4EKYA 1QHSA 3EXIA 4KHPB 2L17A 3CYFA 4AN1A 4IOKA 5EGSA 1LUAA 1ZCBA 3AW8A 2DZDA 2V7EA 4N3GA 4ZALA 5GV8A 4C4OA 1SHLA 1U0BB 3DG9A 2YJ4A 2F1OA 1C4XA 1ZD8A 3ORSA 4MIYA 1QAOA 4U7TB 1KPGA 3R3ZA 4JDUA 3KHUA 5DTQA 1K88A 4GM0A 1CJSA 4XYBA 3O7WA 1VKNA 3JQ9A 2GRAA 5IXSA 3C14C 3PNYA 2IOHA 1L7BA 1C0EA 2C4NA 4PW0A 5I8PA 3DWIA 3OKPA 4HUQA 2GXQA 1DTWB 3H9JA 3OZUA 3I2JA 2X1LA 1G5HA 1NT4A 1Z8HA 3DMNA 2DH6A 2ZXEA 3LUJA 4M53A 5C8ZA 4NEHB 2JHPA 4M3NA 2D7JA 2YWJA 3IPLA 3NRCA 1WB5A 1DTEA 4LRXA 1H6CA 3BB4A 3WTCA 4E4TA 2VA8A 1OFTA 5JLAA 3T94A 2G9QA 5DGXA 2W2OA 1L5VA 3DO5A 2D5BA 1KFKB 2FMKA 1X1QA 1PZMA 1QB7A 1PLLA 3QU7A 1NLUA 2PJZA 3HXPA 4QFDA 3VI3B 1I01A 1YQ9A 4ATNA 4MK4A 4IDXA 2GOYA 1BCSA 1TA4A 3IT0A 3OZVA 1CHDA 1QGUA 4KN8A 3TSYA 4DVJA 2CHVA 1WX1A 2OZVA 3N75A 3QU2A 5LMCA 1VQ1A 3UJDA 4D41A 4DCSA 4P3NA 1GL6A 2AFHB 3AUYA 1NF9A 4FIZA 4O2LA 2CV1A 3DV0B 4GQIA 1Y6JA 2G25A 2OVBA 4HLNA 4XQGA 4R7GA 1Z0FA 4FJ1A 1E1YA 4NBWA 3V48A 2YXEA 4UM5A 1WBDA 2AX4A 5DIZA 3H13A 4NEQA 3VPAA 3D54D 4ZTBA 2A9QA 1JQDA 2AYXA 4YWHA 5HMLA 2JLSA 3K0CC 2NYUA 4DKXA 4U8GA 4Y18A 2JGJA 3NUGA 3WX0A 3ZTYA 2HFKA 4H3HB 4II2A 1AIPA 1L5ZA 2PXXA 4K05A 1V95A 1W4AA 4B31A 1GAEO 1HE5A 5KSWB 4WLUA 4B3TB 4K6MA 2ZUSA 4BCCA 3FOAA 3I6IA 1ODKA 4DB2A 1SVOA 5HIJA 3TBKA 2NOAA 4J1TC 4BKRA 1R6DA 4ID3A 2JAOA 4HC4A 2FEWB 1Y6ZA 1Y9ZA 3GQBA 1FX0B 1YS4A 1L5KA 5K01A 3TCKA 3DDOA 4WBSA 4CKCB 16PKA 2Z1MA 2O52A 3RPEA 1FFCA 3PUKA 5DTMA 5GOZA 1GV0A 2HPVA 2PA3A 3PCTA 4U0KA 4RGBA 3I8OA 2G8LA 4PC2A 4ESOA 3CVXA 4G1UC 2GZDA 3Q9UA 3QA3E 5JECA 3BRWD 5AW5A 4EJFA 4WZZA 1E3IA 1LA2A