The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
94
|
sequence length |
312
|
structure length |
312
|
Chain Sequence |
DKKSRVLIVGGTGYIGKRIVNASISLGHPTYVLFRPEVVSNIDKVQMLLYFKQLGAKLIEASLDDHQRLVDALKQVDVVISALAGGVLSHHILEQLKLVEAIKEAGNIKRFLPSEFGMDPDIMEHALQPGSITFIDKRKVRRAIEAASIPYTYVSSNMFAGYFAGSLAQLDGHMMPPRDKVLIYGDGNVKGIWVDEDDVGTYTIKSIDDPQTLNKTMYIRPPMNILSQKEVIQIWERLSEQNLDKIYISSQDFLADMKDKSYEEKIVRCHLYQIFFRGDLYNFEIGPNAIEATKLYPEVKYVTMDSYLERYV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
pinoresinol-lariciresinol reductase
|
| publication title |
Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases and their relationship to isoflavone reductases.
pubmed doi rcsb |
| source organism |
Thuja plicata
|
| molecule tags |
Plant protein
|
| total genus |
94
|
| structure length |
312
|
| sequence length |
312
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
1.23.1.1: (+)-pinoresinol reductase. |
| pdb deposition date | 2003-09-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05368 | NmrA | NmrA-like family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | NAD(P)-binding Rossmann-like Domain | ||
| Alpha Beta | Alpha-Beta Complex | UDP-galactose 4-epimerase; domain 1 | UDP-galactose 4-epimerase, domain 1 |
