4V0OA

Crystal structure of bbs1n in complex with arl6dn, soaked with lead
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
total genus 48
structure length 166
sequence length 166
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0oA00
4B3CA 2WJHA 3A4MA 3WHLA 2IYTA 1X86B 4LUCA 1HQCA 2I1VB 4P4UA 3BFVA 2AN9A 4QBFA 3BB3A 2QMUA 3W6OA 2RGBA 2BMDA 2P67A 3BWDD 1MKYA 1QHGA 3EW9A 2GZAA 3I8SA 3K9NA 3CKLA 2ZYUX 3EIHA 2QTFA 2J5XA 2FEMA 3MMPA 5CK4A 1AS3A 3E1SA 2RAPA 2IUUA 1EX6A 2BBTA 4LBWA 3JVUA 2FU5C 1WE2A 2FWRA 3A1UA 3T12A 1NVXQ 1GNPA 2XJ9A 3IHWA 2QRZA 1E2HA 3RNLA 2H5EA 3QI2A 4MQBA 3X1WA 2WKRA 2NIPA 5JJKA 4WOPA 1QHSA 4PX9A 1ZC3A 1SVSA 3KJEA 3LFUA 3NBYC 4ARZB 2C5LA 2J0VA 2BHRA 4JLMA 3C5CA 1WB9A 3KKMA 1XRJA 4NYJR 5BYJA 4F4CA 4C4PA 4TLEA 2OBMA 3P32A 5JMTA 4C0HA 5EXPA 1GM5A 5DHFA 821PA 3RLFA 2FJUA 2HF8A 4JYCA 2EWWA 5LPNA 3DVLA 3U44A 4M8NE 3OE7D 4QGFA 2O8FA 1LW7A 3RRZA 2OG2A 3V9PA 3QPVA 5LDDC 3ZQJA 4JBYA 4AG6A 3GLGE 3K70C 1NMYA 3TQCA 1IAQA 1GNRA 1DAKA 2H92A 2YWEA 4XVUA 4NBSA 1ZBDA 1HH4A 1YJ5A 2RHMA 1E9SA 4BFUA 1E2KA 3LQRA 4EJSC 5HR5A 2HJGA 2ZVQX 4HUQB 1W4BA 2DB3A 1SZPA 4TYPA 3RDPA 3NEYA 3KQUA 2E87A 1EWRA 2AKAB 2GVDC 1HE8B 2JLVA 2VQSA 4NPHA 4L4UA 1R8QA 3EIQA 4NHOA 4B35A 5DI9A 4KFSA 4ABYA 3K0EA 3BH7A 3U2QA 2OCBA 1KI3A 2JAQA 3B85A 1RJ9B 2JIZA 5L3RA 4TYNA 2ZRFA 1UADA 5JSZB 3IILA 5JI3E 1OFTA 3LBIA 1W2GA 4B6FA 1E9FA 3C8UA 2FSHA 4ZKEA 2YYZA 1UFQA 3WMEA 4QKQA 2G6BA 2CE7A 4A0HA 2CL6X 3CPEA 3LWNA 4NCJA 5DIFA 4ZKDA 2QMEA 2JJ1D 2HT6A 1OKKA 3T61A 1T0JB 5FOUA 1VIYA 3VR5A 4OJQA 2BC9A 2ZI7A 4D81A 4UXIA 2ZTSA 4B47A 1NN0A 4OQNA 1F6BA 3ZIAA 3R20A 3A36A 3IPYA 3KUCA 1NIJA 3B1ZA 4P4SB 1G1MA 4DIDA 4UQOA 4AG5A 3VR4A 2ZQ5A 5GJWC 4P4TA 1CKEA 3IEVA 1NF3A 5EXXA 2BEKA 4YDSA 1P9RA 1EG7A 4KODA 1FP6A 2DFKB 3FKQA 3HPQA 3VR3A 2QP3A 1SVMA 1S3GA 2FPKA 2CL0X 1FL9A 2FGKA 1BH2A 3NHBA 5AJVB 1N6PA 1LF0A 2O0JA 2XITA 2ZAOA 4HZIA 3RSLA 4MDFA 3GJ4A 2IXFA 1J8YF 4DDUA 1MO6A 5GJCA 3ZVLA 1YR8A 3DM5A 2VL7A 3TMKA 1R5BA 4DXAA 2B8TA 3DKPA 2WJYA 4M9ZA 4JZKA 1AZTA 1Z6GA 3DOFA 2O0HA 1NLYA 2FFQA 4US2R 2XEXA 4ESVA 4IW3B 4IXNA 2R6AA 2GZDA 4KVGA 4PSAA 5AWFC 5KSYA 2OESA 1QHHA 3W5JA 2WTUA 4R7ZA 3RS2A 4Q9HA 3KQKA 5CB6A 3CO5A 1C4OA 1RKBA 4A8JC 4W9MC 5KPJA 3GP8A 2IYXA 3A1VA 3WY9A 3THXB 3B78A 1IN6A 4B2LA 1NY6A 1NN5A 2CBZA 2RGGA 3N2IA 2NMVA 3PV0A 3WMFA 3EXAA 3LDAA 3FGNA 5G40A 4TYWA 5KDDA 3SR0A 4PC6A 2YHSA 3GJ7A 2Z4SA 4TQUS 1E9EA 2W0SA 1OFHA 1X6VA 4LGMA 4PR0A 1NG9A 2CCGA 1GDDA 1E2EA 2YOFA 5FUYA 2C78A 4DCNA 1IY2A 3GCGA 1LF5A 4FCVA 4DDVA 4L9SA 5LD2B 1FQJA 3T35A 3P4YA 1DO2A 3K9HA 2VSOA 2A5GA 1AGRA 1KDOA 2ATXA 2WMNB 2XTNA 1GVNB 3A1TA 1N5LA 1XD8A 2BMJA 1XD2B 3U3JA 3ZZUA 3OEED 3A6PC 2R6CA 4EJSA 4FWTA 1CEEA 1KMQA 1K8RA 2EYUA 1RIFA 2WHXA 4HUTA 1XF9A 2OT3B 2NO9A 1RE0A 1AQYA 2NPIA 3ZD7A 2O8BA 2F9LA 1ZIOA 1GKUB 1G19A 3KB1A 721PA 4A9AA 4HLUC 4JLVA 1XXHA 2IUSA 2I1QA 4IVPA 4A0RA 2QAGC 2ZRIA 2XSZA 2REXB 1E9RA 2ZRPA 2LWIA 2ZS8A 1CR2A 1KJWA 1RYHA 1KMHB 1U0HC 3IEUA 4LZZA 4AK9A 3DDCA 3CB4A 4UNRA 5KDOA 3BJIC 4NP6A 1KNXA 3GQBA 4XWKA 3SQWA 1G5PA 2J7PD 2IHBA 1ZIPA 2ZI9A 2G1KA 4TMVA 1LV7A 2QP4A 3ZGXA 3GEEA 3Q7PA 421PA 1GP2A 1QG2A 1N6OA 4HYYA 1F60A 4TQAA 1Y3AA 1LS6A 2CL7X 2FFHA 4UJ5A 4CT5A 4KFTA 4G5RA 4UNSA 1N3BA 3EZ2A 1TNDA 2AD5A 1U81A 5GADl 1Z0DA 4F92B 4I4LA 5AR1A 2XX3A 3WP0A 2VLIA 3SYLA 2A5FA 3HU2A 4LJYA 2XTMA 1ZM9A 3W90A 4ACBA 3BK7A 2J1LA 1WXQA 2ZUDA 3U7GA 1XTJA 1IONA 4TMKA 5DNYB 2K5UA 5D3MA 4V02A 4KJZA 2ZRJA 4URVR 1G17A 1Q57A 2B7CA 4Q66C 1R0YA 3WYAA 2IF2A 2AFHE 3CZPA 1G8PA 1YR9A 4Q00A 4AIIA 1MO5A 1OH5A 3GLHB 3FKSD 4RD3A 2OXRA 2YV5A 3EPHA 3B2EA 4BLQA 1KI8A 4B43A 3SN6A 1OH8A 2PL3A 4PQYA 3AVXA 4AKIA 3AF4A 5L3SB 1E98A 1VMAA 1R7RA 1P9WA 3AUYA 1ZUIA 2P2LA 2NG1A 3WBKA 2ZRMA 2FMXA 3AKYA 2WWIA 1XZQA 2YC2C 3DPUA 3PFIA 4G5GA 4WA7A 3RS5A 5CITA 4A8JA 4MGKR 1JR3E 1VG8A 4V0ME 3I4LA 4RZ2A 2QMOA 4BFTA 1R5NA 1SVIA 3NDBB 1B0UA 2OAQ1 3K0FA 1HA3A 1XMSA 1A82A 2JLQA 5KDLA 1TU3A 1E2JA 3LX5A 2X8AA 3L82B 1VCMA 3QBTA 5JS8A 3ECCA 4DSTA 1AK2A 1R5OA 4ITRC 2CEAA 1II9A 1TQ4A 3CWQA 1TEXA 3ZLJA 4GT1A 4Q4AA 2PCLA 5L3QB 1G3RA 1Z0IA 4JL8A 4EDHA 4DHEA 2XOKD 1KGDA 2FSFA 1Z0JA 2IWRA 1DBSA 2HCBA 5FL3A 3RHFA 2RGAA 1KO8A 1YVDA 2D4HA 3QIAA 1FQKA 3ZVNA 2V54A 5BN3A 5J4VA 3THWB 2W0MA 4IFBA 4O2RA 4QJ3A 1W1WA 2ODWA 3EG5A 2PEZA 4E07A 2OHFA 5DO9A 4B6EA 1YE8A 4II7A 4WIAA 3L0IB 5JRZA 3AVOA 1US8A 4NYIR 1KSGA 3REFA 2A9KA 4B48A 2CHVA 2P65A 1OW3B 4KAXA 3P26A 4OK5A 1LY1A 1LS1A 1ZCAA 2XNDA 3EPJA 2PLRA 1KO1A 4GRAA 3DMDA 2X2EA 2B7BA 1Q44A 2DFNA 4V0KA 3FHTA 4TZ6A 5CDFA 3FYHA 4MUBA 2CLSA 5GJVC 1A2KC 3SS8A 1XZPA 3CNOA 1R0WA 1NL3A 1NBME 2GJKA 3KXKA 4HLUA 2EU8A 1NLFA 3C14C 2QAGA 1OH7A 3NC0C 4OHYA 4RZXA 2EFEB 1MO3A 2BM1A 1TX4B 3CR7A 3OHMA 3CF0A 4G5SA 3TRFA 2WKPA 2A7QA 1Z63A 3HR7A 4TSFD 1G7RA 1YZLA 3CX8A 5FUVA 3GMTA 5FOSA 3UMSA 2NO7A 3L0OA 3NG1A 2W00A 3BRWD 4R98A 4HLDA 3MWJA 2Z83A 3OEHD 4YMWA 4YMSA 4DCSA 1RJ9A 3ZIAD 5AUQA 1KI6B 4QBGB 1W44A 3TQFA 4N0DA 4LJAA 1M8PA 2OFWA 4PXAA 5JSZA 1AGPA 1ZNWA 4RFSA 1IN5A 1FNNA 3FFBA 4Z1MD 1XCPA 2C2HA 2DBYA 1GNQA 4P31A 3BAFA 1AA9A 1TADA 4WAUA 5JHHB 1UM8A 1Z06A 3LNCA 3VR6A 2CE2X 3T34A 1J8MF 1N6HA 5AUNB 2W58A 1GZSA 1TU4A 1E1RA 1YZKA 3B1YA 2XZPA 4LPKA 3WXMA 4QJ4A 4AC9A 3H1TA 5C18A 3WHKA 1ANKA 1CLUA 4DIEA 2R44A 4MRPA 3UMRA 5EP4A 5FPHA 3E5HA 4LJ6A 3V00A 1W0KD 2IX3A 1FUUA 4DUGA 4C30A 3TVDA 2QGZA 1N2CE 5K8UA 2YWHA 1OFUX 2OSBA 5J4YA 4A36A 3TBKA 4AY2A 4G5QA 1WRBA 2ZR9A 4BFVA 1OJLA 1JECA 2BMEA 4BGDA 1G5RA 1P75A 1VCIA 2D7CA 4HAXA 2AXNA 1FNMA 3OFNA 3W8RA 2O8CB 4RD0A 2HCJB 1KO4A 3AQ4A 1XEWX 2BCGY 2ZXUA 1S0UA 1SXJB 1FUKA 4NU0A 1KOFA 4AD8A 1Q0UA 4JLBA 4M2LA 4UNNA 2GEUA 2KBEA 4L8GA 3BGWA 5E7IA 4M9XA 2KE5A 4D4LA 2W6ID 2CNWD 4BLSA 3CF2A 3ADDA 1RRGA 2QUZA 3I8XA 4CW7A 4YLGA 4RCYA 1JXOA 5J5CA 2N1BA 2Z5FA 4H1VA 1ZM2A 5EUMA 4QHYA 1OB5A 1N6LA 2R65A 2V9PA 2ZETA 2CDNA 2EFCB 2FDCA 1YZTA 5EE0A 5C4MA 1AJEA 2KWIA 1FTNA 2O52A 3CH4B 5SZJA 2QI9C 2VRWA 3NHAA 4BFWA 5TXGA 1WDTA 2G0TA 3NKVA 4LBVA 1S2MA 3FE2A 4LBYA 3U7HB 1CJTC 1Q21A 1VYVA 3RANA 1BYUA 4KYIB 4RVCA 2DCUA 1R0XA 2JJ2A 2OM2A 1DVRA 1II8A 2NOAA 5FFMA 4HAZA 4CF7A 4LYAA 3T1QA 5TDHA 3HU3A 3THYA 3HWSA 3TW4A 1JEEA 2DR3A 3T1VA 2PJZA 3N5CA 2VYFA 5HCIA 4ZDWA 2F55A 2Q3HA 2IK8A 4EPTA 4JSYA 2G77B 5F3WB 5HPYB 2ZI4A 5J47A 4KBGA 3UG6A 3DM9B 2ZM5A 3PITA 4C9BA 4C2UA 1XD2A 4YONB 1A7JA 3IGFA 1PLKA 1G8GA 5BW8A 2YWGA 3AKCA 2CK3D 3NDPA 4OHXA 5JJIA 1W36C 2QNRA 1FMLA 2BIFA 1V5WA 1WCV1 3A58B 2QE7D 3QF4A 5E7MA 3X2SA 4M21A 1IOZA 2GXSA 1NVUQ 4GSYA 3E2IA 3VHXA 4ZIRB 1GTVA 2W6JD 2QP9X 3I62A 1O87A 5KUTA 1E2QA 4O2LA 4Q9JA 4XVQA 3R7WB 3KUDA 1RZ3A 1JPJA 2V1UA 1UBEA 1G8FA 4QGAA 5EE3A 2J0UB 4EPVA 4D4MA 3D7MA 1IXZA 4Q19A 4LC0A 3NIBA 2BKEA 2RGDA 2ZRGA 2GVZC 4AURA 3OAAA 3UK6A 2GEVA 2WSMA 2DFTA 4BQSA 2QM7A 3GLFA 2AR7A 4CEHB 4PHTA 4O3MA 2QPAA 1CJUC 3QKTA 3LW8A 2L0XA 2ZE6A 4M53A 1UKYA 3QE0A 1AS0A 2WJIA 4LHZA 5FI0B 4V0LA 5DI3B 4KCGA 3CF6R 4XD7D 2ZI3A 4A0FA 4WZBE 4IKEA 2A3RA 1G3IA 1XJ0A 2GF0A 4LJ7A 1D6JA 3JZMA 3LVRE 3VR2A 4EPXA 3W6PA 2CJWA 3OIYA 4RSGA 4QG7A 2ZVPX 4TLAA 1L8QA 2QQ0A 3R9IA 3RAPR 4C0SA 5C1BA 2GHIA 2OAP1 3VU9A 1GKIA 4BWYA 2JGNA 1GL9B 2VP5A 4HATA 5CJ2A 4Q01A 3U4QB 4MITA 1RW4A 1QRAA 4A1FA 2ZUBA 3GLHA 4KXFB 1ESNA 6Q21A 1E79D 2GJSA 1E2DA 2IYZA 4KLZA 3K8YA 3TJZA 3F3YA 3L2OB 1UEJA 4A2QA 4M1WA 5B57C 4URYR 1KTVA 4C0AC 1QHXA 1XU4A 1H8EA 3KXLA 3GJ0A 4PAMA 3UWKA 3TE6A 3KFVA 1SULA 2PCJA 2YOHA 1XXHE 3F5FA 2F1HA 4D80A 2PX0A 2XZLA 1I2MA 3Q3JB 3AVQA 5EJEA 1E32A 4RD4A 2C95A 1UDXA 4W5HA 4IFEA 4OBEA 3T5DA 2QGNA 2YZ2A 2XJ4A 3PVSA 2GKSA 3H4MA 4NMMA 1XCGB 1YRBA 2ZI6A 3FHCB 1VECA 5AJYA 4CDGA 4XTCS 4O25A 3HPRA 3NBFA 5GVRA 2OBNA 4M1SA 5EP1A 2A5JA 1WBDA 1HY3A 4JT2A 1ZM3A 3T5GA 4MA4A 2F7SA 1R2QA 1TUEA 5FPKA 4HAWA 2EWVA 1MRNA 4LWZA 5EP3A 1M6NA 4NCKA 4KSBA 3SJBA 3THWA 3GLIB 2ZRHA 3SJCA 1KKMA 4ZI3A 3TNFA 3SHWA 1F5NA 2RGNC 4TT3D 4RZ3A 1SVWA 5FBQB 4C0KA 3M0EA 2F43A 4B34A 1SKYE 2XGJA 5JS7A 1LTQA 3IQWA 2QG6A 2ZSEA 3D3QA 4LCBA 1S9DA 3SE0A 1PLJA 1G18A 2J3EA 1X8LA 2ZIAA 4UXHA 2XB4A 3C16C 4QHTA 3W6NA 3CR8A 2WOOA 2PMDA 1KYIA 2Z0MA 1XNJA 2PX3A 5JFGA 2IYLD 3KJIA 5G41A 3MJHA 2WPDD 1CP2A 5E7JA 1VDZA 3TLXA 4Q4JB 2YKGA 3T1TA 4JBWA 4TL9A 1IXRC 1KSJA 2QZ4A 5FOTA 5FTNA 4OI1A 2ATVA 2ZJ2A 4A2WA 4ESHA 4B3GA 4ACAA 4Z8YA 2D74A 2VBCA 1CXZA 3THOA 2VHUA 3K0CA 4S35A 1RRCA 3EAQA 1R4AA 1D8TA 1LNZA 2IUTA 3LY5A 5JZVA 1I4LD 3QEJA 1KI6A 1F3OA 2XXAB 1M34E 1QZXA 1UDWA 2ZJZA 2F1JA 3QXCA 1MO4A 3UG7A 4UKDA 1H65A 1XP8A 2AL7A 4Q9KA 3CRVA 4JLKA 5CYOA 2JJ8A 1ZNZA 1T0HB 3PUVA 4DLUA 4JKYA 1QHIA 2GESA 4FMCF 3U5ZB 2JATA 4QNRA 2GJAA 3VX3A 1Z47A 4QFMA 1E69A 4ZCMA 3GLGB 1EFRD 1D5CA 2VA8A 2AX4A 4IDPA 1X1RA 3KTAB 2P3SA 1M7HA 2XZOA 4O0MA 3OFND 2CMKA 4U02A 1OXSC 2H7VA 2GK6A 4C0LA 2GILA 4MYUA 1FZQA 1OE0A 1COWD 1NKSA 5KPDA 1S1CA 1TF7A 1GRRA 2KI5A 4DDWA 5HKKA 1W49A 2NTYC 1UJ2A 2ONJA 2LKCA 2GCOA 4GZLA 4EAQA 1W48A 2HDNB 3AVPA 4PSKA 2IYVA 3SYNA 3L8YA 2BBWA 4JLAA 1Q12A 4EQ6B 1CBUA 1VHTA 3QVVA 2ZSAA 5AUOB 1JAIA 2A5DA 1NI3A 2O8CA 2ZE7A 1W47A 2J9RA 2GAOA 4WVFA 5CDFE 5KNDA 3TGPA 2ASEA 221PA 1SXJA 3BS4A 4GBMA 3TH5A 4HEJA 3K0AB 4GOJA 1XEWY 4IOKA 4B75A 1BKDR 2RH5A 1FOEB 4UNPA 2RMKA 2C8VA 2VPPA 3NEJA 1E2GA 1ZD1A 1S8FA 1MOZA 1KJYA 1GFIA 2RCNA 3P27A 2WAYA 1DEKA 2I3BA 4GP6A 3H84A 5GJBA 2QTHA 4G5OA 1T3LA 1U0LA 3UWOA 2JLYA 1E9CA 4EFNA 1F48A 3AVWA 3B5JA 2WJGA 4BRWA 2A78A 3PXGA 4E22A 3IIJA 3WNBA 3ZS9A 4BZPA 3AVVA 4AKHA 4OL0A 4MGZR 1Q3HA 3R9XA 1E9DA 3VTKA 1R6BX 4NDZA 2BMFA 2JDID 2C9OA 4PPNA 1EESA 3QKRB 2RGNA 3KFXA 1DAFA 1S3SA 1IN8A 4PO8A 1F2UB 1U94A 3PUYA 2RGCA 4EPWA 4DLSA 3VNVA 1I4DD 1D9XA 4HI0E 1JR6A 2OO7A 4CZ2A 1G3MA 1YHNA 3MLEA 5ELXA 3F8TA 2NO1A 4MKHA 1G8HA 1DAGA 4HDCA 4R2HA 5M04A 3B1XA 3EZ9A 3GD7A 1NP6A 1HURA 2H16A 4FMDF 4TLDA 5LB2A 2WAXA 4CEIB 2Z6VA 2NQ2C 2R8RA 3BORA 4Q21A 3SZRA 4X8OA 2VIIA 2VP6A 3CNNA 3EZ6A 2JLWA 5IK2D 2ZJOA 4NONA 4UNQA 2IS4A 5DYIA 3FFAA 4AKGA 3DOEA 3SOPA 3MWYW 2OCYC 4M9SA 3WBJA 4X8LA 4A15A 5AJXA 4FWIB 3KDSE 4DLVA 2GBLA 5BQ5A 4LYJA 3SJZA 4Q7MB 4U7DA 2V55B 5HE8A 4IDOA 5EQTA 4ERNA 2BM0A 4URUR 3R7WA 2GEDA 2OFXA 4EPRA 3IO3A 3BFXA 2NO0A 3BH6A 2WWHA 1E1QA 3GJ5A 1JPNA 4TWZA 4P0TA 4PQFA 2SHKA 2IBMA 1CJMA 1H8HA 3LVQE 2QBYB 2GWHA 3KQHA 2QA5A 4B3DA 4C0BA 4OI4A 3A4NA 1Z0AA 4FW9A 4CEHA 4US1R 1AKEA 1XMIA 2BBSA 1DPFA 2R6DA 2DHRA 2F9MA 3CM0A 1XPUA 5AUPB 3PJRA 1EFHA 2PT5A 1JR3D 2FF7A 2ZE5A 4LBZA 1GILA 2QENA 4HB4A 4EKDA 1ZD8A 1NVVQ 2VP4A 1EFCA 2Q3FA 5J4LA 4YDHB 3K53A 1EWQA 2H17A 2ZR0A 4Q4HA 5C4GB 4GMDA 2HYDA 3RRNA 2J0SA 5KSZA 2B92A 4G1UC 2ZSDA 3AGQA 1N0VC 2XTZA 3W34A 4KV9A 4CRWB 4TTPA 2JLZA 1G6OA 4Q1EA 3KKOA 2HF9A 3QXSA 1DAMA 3AGPA 2J59A 3ADKA 4URZR 1CJVC 1MV5A 3GPLA 2ZANA 3KJHA 2ZU6A 2ANCA 5HZHA 2OV2A 1CR4A 3PIRA 3SFZA 5A4JA 4MRVA 3EA5A 4I81A 5DE3A 1Z22A 5G3YA 2WWXA 2C04A 4MKGA 4ASUD 3AP1A 4JSTA 1SVKA 4FCTA 5DN6A 3VFDA 2RGXA 1VCOA 1TL7C 3FTQA 5FL7A 1N0WA 3AKEA 3FMPB 4OHWA 4X8MA 5B2ZA 3OIUA 4MRNA 4QOSA 1AZSC 2P5TB 1MABB 5JCZA 3GEIA 3ETLA 1DADA 1IM2A 1LFDB 2GTPA 1Z5ZA 2VP0A 3CBQA 4L9WA 4Z54A 2BKUA 5J4KA 3MD0A 1Q1EA 3HP1A 3PUWA 1NBMD 4A82A 1UKVY 2WV9A 2VO1A 5B64A 3GLFE 1QVAA 3EX7C 2NO6A 1KK2A 4LV5B 3BXZA 2IYRA 1VHLA 3H2YA 1K6MA 1JJVA 3BD9A 3I5YA 2O8EB 5J40A 1W5TA 2HLDA 3MWLA 2QM8A 2CCKA 3D8BA 3IDQA 2QN6A 1HT2E 2PBRA 3W9YA 2Z43A 3VKGA 3ADCA 1F2TB 2ORVA 4Q7KA 2WZQA 4C0JA 4HB3A 1L4YA 1Y63A 2UVQA 4LJ9A 1KK3A 1T91A 4NCHA 1HYQA 4DB2A 4Q1FA 1NJGA 3W8NA 3RABA 1P2TA 4G0NA 2MMGA 2RHDA 1XTRA 2V1XA 4Q1AA 1DOAA 2OE2A 1XTIA 1OXTA 4WBSA 1XDBA 1W7AA 3AP3A 4H9GA 1VTKA 2AWNA 2BDTA 4Q4JA 1N6KA 2MSEB 1KSHA 3UMFA 5F9HA 3P4XA 3CNLA 4RD2A 1DO0A 1OPXA 4Q48A 621PA 1PLLA 1T5IA 5CM9C 2GNOA 2JCSA 4IJMA 4FI3C 4BFYA 4ARZA 4IOLA 2R62A 3PEUA 2MMCA 2ERXA 4JLNA 4PO9A 4EFMA 2XXAA 3NXSA 4F91B 2BJVA 3EZ7A 2HXSA 4NYJQ 4Q7LA 4XH9B 2WKQA 4DEXA 5FR2A 1EXMA 1O3YA 1SKQA 1KAOA 1TF5A 1ZNXA 2HEIA 2EFDB 4YXWA 5KYKA 3ADBA 1GITA 1G7TA 4OHZA 1N6NA 1J2JA 5LD2C 2BV3A 3REGA 3FWYA 1N5KA 4HAUA 2H18A 2JIZD 4CEJB 3P20A 2WWYA 2WOJA 1DARA 4HUQA 3DZ8A 2VH5R 1GWNA 1B23P 2ZRDA 4IXMA 5J4HA 2FSIA 3QVUA 1YQTA 2HT1A 4B32A 4BZQA 3H0KA 4JL5A 1G4AE 1NVWQ 1WMSA 1OKKD 2OFOA 2ZSFA 2VSXA 2IEZA 2P6NA 2ZE8A 4Q03A 2HXYA 5FBWB 4EQ6A 5HCNA 4RY2A 1JNYA 4B3BA 3QG5A 2RKOA 3FMFA 5UKDA 2WIBA 4DLXA 2GDJA 4JVNA 3VKHA 3K0AA 5TY0A 4LI0A 1U8YA 4E03A 4MKIA 2IC5A 3FB4A 3P1JA 4LV6A 5GVSA 1Z6TA 4PHFA 3NH9A 4J0QA 4GL2A 2VHQA 4JS0A 5TB5A 2OILA 1ZU4A 3PUZA 5FBRB 4NCIA 2YNMA 1YR7A 3K09A 3L0PA 1FPMA 1HEIA 2QMHA 3QJYA 4PZYA 3FMIA 3Q72A 4P4SA 1R0ZA 4D0GA 5K8LA 1N6RA 2R9VA 4L16A 3I5XA 1G41A 3ND8A 1N5JA 3LRPA 1HTWA 2QPOA 1VYUA 2A5YB 3GJ8A 4N0EA 4EPYA 3NBZC 2EW1A 3O8CA 1U98A 1NMZA 3WNCA 2ZI5A 1E0JA 1G6HA 1P5ZB 2R2AA 3U44B 2OCAA 2O8FB 3EASA 3K9GA 5FOXA 1DAEA 1ETUA 1U8ZA 1VPLA 2GZHA 1T4GA 1QHNA 1F2UA 1S1MA 2ZRLA 1OH6A 1UKZA 3SNHA 4IEEA 1OSNA 5IHPA 4I1VA 1A4RA 1G16A 2C96A 3QKSB 5L3VA 1T9HA 3QPWA 4D2IA 2E1RA 4Q47A 2J0QA 3IKJA 1ZJ6A 1ZUHA 1I2DA 2ZJYA 3I32A 1CR0A 4BECA 1Z29A 3OE7A 4DSUA 1ZC4A 5EUQB 4DSNA 2XB2A 2ONKA 4JKIA 2AWOA 3B13B 5KNBA 5JJLA 4WZ6A 3PEVA 4Q1BA 2F3RA 4P3YA 3Q85A 1Q1ZA 2AFIE 4HZUB 1E96A 2FH5B 2O5VA 4JBXA 4D4JA 1PJRA 3THXA 1NKTA 3SBEA 4YMVA 2D06A 1SHZA 1PV4A 3K70D 1J7KA 1CJKC 1JEDA 1Q1BA 1SVLA 4V0OA 4HAVA 1LB1B 1LVGA 1EGAA 4XVRA 1TQ2A 4ZDKA 1GSIA 3BOSA 1AM4D 2JLXA 3UIEA 4G01B 1TQDA 1U2RA 2W2VA 2QT0A 2UZIR 4GMXA 4KYUA 3WNDA 2VF7A 2ZU0C 3MFYA 4BLPA 3G0HA 4DB4A 1Z2AA 2X2FA 4Z8XA 1OXVA 2W83A 4IHQA 1BOFA 1ZVQA 3EC1A 4DSOA 4U00A 5DSZA 1X1SA 5KU1A 4GZMA 2ZRKA 1KDRA 3X1DA 1VKJA 1E0SA 4JLOA 2JJ1A 2XSZD 4IEIA 4F7WA 1XX6A 1XTQA 2OZEA 1XMJA 2QPTA 3R9WA 4P33A 3ZH9B 2FNAA 2ZS9A 2Q3MA 3D6TB 5FI1B 1NMXA 5JWOA 4F4JA 3HR8A 3LAWA 4F93B 1YU9A 3UPUA 1KDTA 4C2TA 5SZIA 4JMPA 1ELOA 4GI7A 3U3OA 4A6XA 1WQ1R 2KJQA 2G88A 2GXQA 4OK3A 1Z28A 3SI7A 3QG1A 1KMHA 2JLUA 3KKNA 2F3TA 4WXRA 1KK1A 1VIAA 3K0CC 2Z4RA 3QXXA 1Z83A 1AQUA 4OQMA 5FBLB 1ONBA 1XPOA 5DGXA 1DG3A 1S4QA 1X8JA 3CRMA 4RD6A 2GK7A 5AK0A 3X1XA 1W4AA 4CGZA 1RYFA 2A2ZA 2PEYA 5H70A 1CRQA 3B6EA 1T3HA 4A6PA 4B33A 4JYBA 4R2IA 4PTLA 1WA5A 4CYMA 3NVAA 1JJ7A 4LJ4A 1AKYA 2IS1A 1NSTA 3EA0A 8OHMA 4LJ8A 1J70A 3CUEF 1X8KA 3LA6A 3EWSA 2ORWA 4BE7B 3CW2A 3MAAC 2WJVA 2IEYA 3QXHA 4HLQB 3KB2A 1XJQA 5KO2A 2O0KA 2VEDA 3VR1A 1KK0A 3K70B 4IRUB 4QNMA 4N3NA 3BC1A 2FEOA 4B3FX 1FW6A 1N25A 4JLPA 1E3MA 4BPBA 3DL0A 2ZAMA 1G7SA 3TUJC 3A1WA 4B2PA 1OXUA 3U6KA 1P61B 2P6UA 5AJWA 3L0SA 4EJSB 1IY0A 4FMCB 5CJPA 4F4IA 3B7GA 1IHUA 4LHWA 2ZS7A 3ONWA 5FUWA 3AVYA 1F2TA 1EFUA 3JVVA 5L3SA 4Q1CA 3M4YA 2N42A 3RS7A 3M6AA 1JI0A 1HUQA 1P73A 5CLQA 2O8BB 1ZUNB 1SXJC 2CCJA 1E9AA 1Z8FA 4WXPA 3MWKA 1XXHB 1KI7A 4V0MA 4TN1A 1KI4A 5E4FA 1M7GA 4PC3A 1KI1A 1GAJA 1K5GA 3A4LA 4UJ3A 5KNCA 2PZEA 4XTRA 4WW0A 2AKYA 3NC1C 4NZYA 1P2VA 5TVKA 1P7CA 5HZKA 2DPXA 3AKDA 3D31A 5IDVA 3QF7A 4DVGA 4LY6A 1KSFX 4A4DA 2QQEA 4XSHA 4YXWD 4S2EA 2F1RA 3KL4A 2IHYA 1BYIA 2ODEA 2AK2A 3O8DA 5L3QA 4DLTA 4BUJA 3AM1A 1FTSA 1FX0B 4QXAA 4ZDJA 2I4IA 3C4JA 5CB8A 3EPKA 2XNDD 2EQBA 1M74A 2WJJA 5FOVA 2WMOB 3IBGA 4K81B 4L15A 3IHLA 1RRFA 1YZQA 4KSCA 2WVJA 2FPMA 4RJLA 2J7PA 5EXTA 4TYYA 4GFDA 3CPJB 4TL7A 5A0FA 3AF2A 4L5BA 4LX0A 5DHAA 5BXQC 3JZAA 4TTRA 4AYTA 4NYIQ 2QY9A 2VHTA 2YVUA 5D3MB 4EIWA 1IY1A 3Q8XB 4PAOA 3I92A 1MRSA 1CTQA 3NH6A 1OF1A 1EFTA 3IO5A 4QGGA 5FUXA 3Q7QA 1L2TA 2ZRNA 4PPGA 4K46A 5CYPA 3SDZA 2JEOA 4PHHA 1KJZA 4KITB 1ZRHA 4MGYR 3TR0A 3ASZA 3I3SR 4KFUA 4A0GA 4QL3A 2Q21A 4NE2A 4LOAA 4NYMQ 2IYYA 3X1YA 4ZDIA 1XB2A 2G9NA 3DO6A 3W3AA 1SHKA 4A2PA 1IJEA 3OIWA 4LHVA 4JVLA 2GBLC 1E1RD 1P2SA 2IA5A 4PPFA 2VTKA 3OIVA 4A8JB 5KOYA 1JQJC 1VCNA 5B30A 4U5XA 3SQXA 4AI6A 3WP1B 2QAJA 4XSGA 3QKUA 3FKSA 3RWOA 1OIXA 2F6RA 2REBA 3K0FB 4DJTA 2FG5A 4FMDB 4NH0A 1Z0FA 3ZVMA 4DUGD 4QM6A 1OFIA 2MSDB 4OK6A 3VQTA 5DISB 5C2JB 2ZYWX 4GPTA 5KTYA 2C77A 5ANRB 5JWHA 3OESA 1W0JA 4C7OB 3PEYA 4Q4AB 4NL4H 1QVRA 4FN5A 4JL6A 4X8HA 1ZM4A 4M1KA 3N2EA 1KNQA 1R8SA 2KBFA 2W2XA 2QORA 3BE4A 2BEJA 3RRMA 2ZJBA 2G1JA 1KAGA 4C0QC 4YMUA 4TLCA 1E2FA 2GCNA 1XWIA 1ZP6A 3EC2A 1NRJB 4XWAA 1VG0B 1JALA 1Z2CA 3BB4A 4M1MA 2GETA 2QEQA 4B76A 1PVOA 1W4CA 4PZLA 3SC3A 1US8B 3CRW1 4OI0A 1MR3F 2D3WA 5SZKB 3RS0A 2P0EA 3SEAA 5EXSA 3CONA 3LBNA 2DWOA 1FMJA 2OLKA 3V4RA 4UXJA 2XOKA 4HLCA 5FTJA 4DDTA 4D0LB 2PT7A 1G20E 2CHQA 3C41J 2IWHA 3SU8A 4JIMA 3I1FA 5G3ZA 2PZGA 4Z51A 3CX7A 1OIVA 1YZNA 4I1SA 2ERYA 5EP2A 3QKSA 2DFLA 3QEOA 2FE4A 1D9ZA 2PMKA 3IBYA 3B8HA 4IDQA 2ZJAA 5L8VA 3O8BA 521PA 1CULC 2QAGB 2J7KA 1UEIA 1BIFA 2TMKA 1CR1A 2JJ2D 3CX6A 3M1IA 3QQ5A 4I99A 2O8DB 2PJRA 1U9IC 4NCNA 4PO1A 1TQ6A 4LHXA 5G53C 1W46A 1HV8A 2AK3A 2YC4C 1OHHA 1YZGA 3LW7A 4JVMA 4HZUA 2PZFA 2ZSBA 4NTZA 2C9YA 5JCPA 4EFLA 4DLRA 1M7BA 4RFSB 4TYQA 1JQLB 1ESMA 2FA9A 2V6IA 5JHGB 1KI9A 1PZNA 4JJKA 2FGJA 1DTSA 3VAAA 1ZMXA 3CPHA 4JVSB 5FR1A 2XAUA 3EWAA 5KSOA 2QL6A 2V7QA 2VP2A 5FOWA 4ON9A 4TSFA 4Q1DA 3WRYC 2P6RA 2PLFA 4ZCIA 2FZLA 1TTTA 3OEHA 4BFXA 1GRNA 4BRUA 3PR1A 3LV8A 1QG4A 3C15C 3U3RA 1M2OB 3TSZA 4XWOA 3FOZA 4MDEA 1U8AA 2H57A 4R9UC 5AJZA 2C99A 1X3SA 1TF2A 4LRWA 4RKFA 4NKRA 4Z1MA 4QJ5A 4PHGA 5SZHB 1TEVA 4B2IA 4BFSA 3S1AB 3I72A 2ZPTX 4OKSA 1NNEA 3EPLA 5JEDA 3W5IA 4CIDA 4KI0A 1W2HA 3U7FB 3MUFA 3B1WA 3O8RA 5EE5B 1IJFA 2H1LA 2EFHB 4IVQA 3TSOA 1HE1C 4BLRA 5JLJA 3ND9A 4Q4LA 3TK1A 1P2UA 3OAAD 4MYTA 4Q18A 2GCPA 4ZO4A 1W0KA 3GJXC 1P9NA 3DKVA 1DAHA 1NIPA 1G64A 2OEPA 3LLUA 4E5UA 4ZIRA 2G83A 2GJ9A 2PH1A 2FV8A 3ICEA 1BO6A 3SFVA 2IF0A 3GEHA 5D3QA 3GFPA 4PANA 2GRJA 4DCUA 3CH5A 2HUPA 3CLVA 5DH9A 3T1OA 2J0UA 3ZDQA 1YKSA 2KB0A 2YJTD 3U3KA 1ZYUA 2FN4A 3MCAA 5JI2E 2C98A 1DELA 1QDEA 2DWPA 3A37A 5IT5A 4LK2A 2JA1A 4MGIR 4TL8A 1Q22A 4TL6A 5F9FA 1S96A 2ANBA 1VG9B 2CNWA 2W6IA 4BEJA 4ZPXA 3N70A 1YR6A 3AV0B 5DI3A 5E95A 1II8B 1G3UA 5K8TA 1GIAA 3IIKA 1E2MA 1GUAA 3QY0A 1PUJA 1G9XA 3K9LA 1N0UA 2OLJA 2Q9BA 4M9QA 4MYCA 4OI2A 4PPQA 3K0SA 3THYB 5KHOC 3SYKA 1G3QA 3AF3A 3LH5A 1ZM7A 3LLMA 3MSXA 3QOFA 3IQXA 3CRRA 1E4YA 3DEFA 1H8ED 1KO7A 4WZAE 4RKEA 3ICQB 4FCWA 2ZEJA 1CRPA 1T3SA 3A1SA 3CRQA 4QBIA 3U4QA 3GJ3A 3RWMB 5DYGA 5C46F 5F2EA 3U6BA 3KZ1E 3O47A 1XPRA 1CF4A 3NTUA 1A2BA 1FFHA 4QRHA 3KQLA 2WICA 1Z08A 3QUSA 3QF4B 2NPFA 4V03A 4TMZA 2HYIC 5JRJA 3KQNA 3EIEA 4W5WA 4D4KA 1T8TA 1U9IA 2VHJA 2ZR7A 1VG1A 2CLCX 4M1TA 1AN0A 3U7EB 1HQYE 3PCRB 3UATA 5A5GA 2NZ8A 2UKDA 1RFLA 1Z6AA 1ZU5A 2AD1A 4FINA 1RC8A 3LXXA 2JLSA 1JXMA 2UZ3A 3WMGA 5FPYA 4V0NA 2CK3A 2WBLC 3UXMA 1OT3A 2OBLA 3ZJYA 1SVOA 2D2FA 4I1UA 4PC2A 3K09C 1XEXB 2QE7A 3KKQA 3GLFB 2Q0HA 2R6FA 4KVAA 4LSGA 1WBBA 2D7DA 2DWQA 1KZGB 3TUZC 2V4ZA 1OIWA 2W6JA 4HB0A 4KHZA 1FX0A 1KI2A 2GF9A 1W36D 2GXUA 1IBRA 1ZW6A 3LQQA 5E3HA 4PC1A 3GLIA 3UKDA 4GOKA 1T6NA 3CIOA 5FPSA 3GFOA 2WSSA 2Q9AA 4QBHA 1Z6XA 2VSFA 3GFTA 4DCVA 4LDJA 5JECA 2CJWB 1U0JA 5BN4A 5B58C 3BBPA 1AIPA 3FMOB 3OF5A 3QBVA 3RC8A 1ZNYA 3VU9B 2C03A 2N46A 3PQCA 3IPXA 3KX2A 1E6CA 4XJXA 4BEBA 2DY1A 4PAQA 3AVTA 2IXGA 4AYWA 2B21A 3MRSA 4CT4B 4XD7A 1Z07A 4XOIA 3RRYA 3GLHE 2AXPA 1NN1A 121PA 4M22A 5HE9A 2J45A 3ZD6A 1ZAKA 3BB1A 1WP9A 3Q9LA 3Q5DA 3RSOA 4TTQA 1W0JD 2WWFA 2QTVB 3C7KA 4RD1A 4KFRA 1L4UA 1U90A 1GL6A 4H1UA 1RVDA 3VNUA 1UBFA 2IL1A 1E79A 4JJZA 3KKPA 5FBVB 2JLRA 3MGCA 1XJCA 5TARA 1TUIA 1UPTA 2H8KA 1A5TA 1QBKC 2OCPA 4E09A 1E0AA 1TPZA 1DAIA 3HU1A 5P21A 4DCTA 4C7OA 1XD9A 5HKKD 2FSGA 1L7VC 5EE9A 1G4UR 1NY5A 4Q9IA 5BYKA 4PSVA 3R8FA 4DT1B 3GLGA 4ILEA 3LO5A 2ZRAA 3TVTA 3KTAA 3ZS8A 1KY2A 4HB2A 5H68A 1DS6A 1RPZA 4F38A 5IF9A 4DLYA 1IN4A 1E4VA 2E9SA 2J87A 2QU8A 5CM8B 1SXJD 2HV8A 3BH0A 1XTSA 2V8OA 1D2NA 4G3XA 2OXCA 2V6JA 2F43B 3B1VA 1W5SA 3U60B 4MRRA 2OUKA 4MUAA 1FP7A 2WWWA 4D82A 1J90A 3RC3A 2ZJ8A 4LHYA 5FTLA 2BBOA 2FPLA 4BLTA 2ORIA 4URXR 1OB2A 1GG2A 4CVNA 2BVNA 4FIDA 4URWR 5FTKA 1W36B 1OHHD 4BZXA 4DLZA 1E0KA 4DBLC 1BMFA 2FOLA 2XNSA 1XTKA 2MSCB 3FPAA 2V3CC 2QSZA 3TKLA 4NYMR 4TT3A 4R71A 4M0LA 1OYWA 2FFAA 1GKYA 3R8CA 4D0NA 2IS6A 2O8DA 5CK5A 3AP2A 1NJFA 2CHGA 2V7QD 3BERA 1KY3A 2D62A 1TMKA 4PC7A 5HTKA 3TR5A 5FH9A 2B8WA 1KKLA 2VHCA 4D6PA 1DE0A 3EARA 3QSYA 5TMPA 2YINC 2ZROA 5JWRA 4DKXA 1E94E 4HDOB 1C1YA 2WPDA 4BFZA 1P60A 3TIFA 4FD2A 3ZYCA 5JBQA 3IUYA 1GL7A 1J99A 2X77A 1P3JA 3SJAA 5IRCD 1UKEA 5BWMA 2CVHA 3WYGA 4FXPA 2VF8A 2W2TA 4LYFA 4B74A 2ZRCA 3QKRA 2DYKA 4PFSA 3RVBA 4ZV4A 1DG1G 4MYHA 3VKWA 4YMTA 1Q3TA 3HJNA 4TQ9A 2FX3A 3FHOA 4QHSA 2B6HA 2LKDA 3DZDA 2ZYTX 2ODNA 4TZ0A 3LXRA 3NBXX 1D2EA 4C3ZA 1A1VA 1V43A 3S1AA 3TAUA 1MT0A 3ZZTA 1XFAA 1RRPA 4CEIA 1TAGA 3GJ6A 3AVUA 2GCOB 2GAAA 1E1QD 4DZZA 4EUNA 3I61A 1EFRA 2EYQA 3B60A 3AF0A 4M1YA 1H8HD 1T8UA 4N1AA 1ZD9A 5K8IA 4HAYA 1COWA 1SXJE 2QRNA 4Q9LA 1C9KA 3ZZ0A 2IT1A 4IDNA 4FMBB 1UF9A 3QPUA 1JBKA 4AWXA 2QSYA 1T5LA 2IYWA 4OJKA 5BN5A 4B44A 5LB4A 2CVFA 1IN7A 2GA8A 2ODBA 3LD9A 4JLJA 4TMXA 4B71A 2CLDX 2QBYA 1KDPA 2F1IA 3PENA 2IW3A 4QGHA 4P32A 3WYFA 1QHYA 1Q20A 1UBCA 5EZ6B 2NZJA 2YOGA 3QENA 5CLLA 2QROA 3FDIA 4W7SA 4B73A 1MH1A 1OV4A 2AHOA 3C5HA 1GOTA 3X1ZA 1Z6YA 1E99A 2J46A 3BIFA 3KJGA 3ZQ6A 4AKEA 2X1VA 4LV8B 2Q6TA 4JT4A 3VX4A 1UBGA 2QT1A 4PZZA 4LC1A 3I73A 3UANA 3LX8A 4DEYA 2G0NA 1N5IA 4I1OA 5CIWA 1G7CA 3LBHA 5DN6D 2IXEA 2EFGA 3HYTA 3AF1A 3G5UA 4Q5IA 5FL7D 1UAAA 2WWGA 4DRZA 4DLWA 3L8ZA 1G8YA 2WIAA 1XBTA 2ZYVX 4TLBA 1P72A 4IDHA 4ZI2A 4QC2A 3E70C 2KSQA 4JLDA 2JDIA 2ECKA 4IVRA 2YWFA 1QHHB 4KLNA 4OQLA 1G5TA 4RCZA 3L43A 4POAA 5LBIA 3W3ZB 1YZUA 4US0R 2ZRBA 3AUXA 3RS4A 1KZ7B 4IOJA 4M1OA 3VMFA 3H86A 1YRAA 3QNUA 2Q9CA 1XEFA 1E2LA 2NGRA 1M1YE 2IYUA 4KBFA 3ASYA 4TMWA 1N6IA 3QXJA 2RGEA 4TMTA 1P6XA 3SBDA 1MABA 1QF9A 3AB3A 5TV2A 1R10A 1E2NA 2R6GA 3CZQA 1W4RA 2BJWA 2J41A 2HLDD 2P5SA 5IK2A 1G291 4B3XA 1CIPA 3AH8A 4W5JA 4RFVA 1OYYA 2WSSD 4MKFA 1K5DA 1XEXA 3ZVRA 4OQFA 1KHTA 4PQRA 1XMVA 2D2EA 1KIMA 1ZINA 2ZREA 4IOMA 1E2PA 4LJ5A 3VHLB 3CWZA 3PG5A 4BLOA 3B9PA 4A92A 3U61B 5F98A 4RZUA 2RB4A 1NVVR 4DWJA 3TSWA 2O8EA 4LYHA 1IXSB 3MJRA 3K1JA 1CU1A 1I4TD 1EK0A 4OYHA 5KSPA 4GDFA 2ZJ5A 4LPSA 1NSFA 1VYTA 1KO5A 1D2MA 4Q4HB 3WRXC 3T06B 2REOA 1G21E 3DMNA 5EZ5A 3T15A 1GRQA 4HDQB 3DHWC 3OZXA 4MH0R 2X19A 3KXIA 1P62B 4ZCLA 4YQFA 3RYTC 1JR3A 1JB1A 2HJVA 1AS2A 3TUIC 4M4SA 5FTMA 4QM7A 1Q1QA 3OEEA 4D26A 1E9BA 1ZCBA 2ZITA 3HYRA 4MRSA 3HDTA 1NN3A 2BCJQ 2WM9B 5H8WA 3Q5EA 4DC9A 1WF3A 3B9QA 3J81k 2G3YA 1OXXK 1U99A 2BWJA 4BASA 2FFBA 1BS1A 3F0TA 2JASA 3EZFA 2GJ8A 1EX7A 1NLZA 3A8TA 4OHVA 4Q7JB 1NG1A 1HT1E 1ODFA 2IYQA 4GOXA 1CS4C 3SHFA 2CXXA 1II0A 2IYSA 2FZ4A 3U3MA 1SGWA 1E2IA 2EVWX 4GP7A 2IS2A 3BFKA 2A30A 2ZUCA 3TW8B 1PUIA 5DLQC 3FVQA 5CIQA 1Z0KA 1S9HA 5EE1A 5JEEA 1OLOA 4AYXA 1Z3IX 3PEWA 2GXAA 4Y0VA 4KU4A 4ASUA 1SKYB 4D25A 2BOVA 4YC7A 4KO8A 4OQXA 3V4FA 5H1YA 4DT1A 3RS3A 2Y8EA 1SQ5A 4Y0AA 5FPTA 1JAHA 4Q02A 2VP9A 3MG9A 3AEZA 3NWJA 2LCFA 3GLIE 4GNKA 4HSEA 1BMFD 3G82C 1XCMA 4CEJA 2C9CA 1IQPA 4K8OA 3IIMA 3PUXA 4XIGS 3B82A 1NBMA 1P4SA 3TAHA
chains in the Genus database with same CATH superfamily
1WXHA 3EF0A 1HYBA 2J85A 3WHLA 2AMYA 2P2DA 1HQCA 3NVKI 3GCZA 4P4UA 2AN9A 4RXMA 2X41A 4P22A 3JVIA 2VYNA 2QMUA 4ZP1A 3DAYA 3W6OA 1RKQA 2BMDA 2RGBA 3MCTA 4WFKA 1QQ7A 5B1IA 3CKLA 2C7QA 1Z7EA 2ZYUX 3E05A 3O93A 2QTFA 3WI7A 5EJIA 2ZBQA 1KPHA 4X63A 3E1SA 4LVOA 4MMYB 3ONEA 1EX6A 2PRJA 3E8XA 2G04A 2Y1WA 5KNLA 2NTJA 3IKVA 3D6MA 3DKKA 3Q3VA 2BBTA 4Z7QB 4DEVA 3TW0A 3JVUA 4N18A 1IB0A 2FU5C 1U9ZA 2V96A 3A1UA 3LSTA 4TRNA 2MCFA 1JAXA 1GNPA 3QHAA 4X93A 5AOVA 5A62A 1VLHA 4OQQA 2OBFA 1J2RA 1I01A 5A1TA 3SHQA 4DMRA 5BSWA 1DJPA 1N34B 3OP4A 1EU1A 4FDAA 4IGAA 3EDQA 1ZC3A 4NBKA 3M6IA 3PFCA 1TYZA 4JLMA 1U6IA 3V1YA 4JQYA 4RWZA 4WLVA 1V8ZA 3K92A 1GPNA 3PWZA 1TZBA 4NYJR 5BYJA 4BO0A 1R6TA 4JLSA 3TZKA 2QAIA 4EAAA 2X5KO 2OBMA 3P32A 4EG3A 4IIJB 1KORA 2GHTA 4H0NA 4NBTA 1JVNA 5EXPA 1N7HA 3SC2A 1XNGA 3AI7A 1TVKA 4ZAXA 3U56A 1S2NA 5KYVA 5JNTA 1BDMA 4IR7A 3IQIX 3RIGA 3RLFA 1UZMA 4B80A 2EWWA 2XYQA 4HH1A 5BYAA 1H0KA 1YFZA 3LLCA 4J3FA 1I24A 3HDYA 3LPDA 3RRZA 3ZQJA 1WMAA 2O48X 3K70C 2AJTA 1NMYA 4DMHA 1IAQA 2R0QC 1GNRA 3TTUA 2P11A 4H7JA 4OXRA 1XWWA 2WUGA 3HY6A 2PKXA 3GRKA 3L1JA 3VTFA 3NDIA 4NBSA 1ZBDA 3A1CA 2BM9A 5K3DA 4BFUA 2P90A 4EKEA 1E2KA 1I2CA 2C2GA 3LQRA 3FSGD 3G9UA 2HJGA 3PGVA 4MUNA 1F12A 3QRWA 1WG8A 2XHZA 2JAUA 1SZPA 1S8OA 2FW6A 3II6X 3FPBA 2E87A 3KR0A 2AKAB 4XM0A 2O7RA 4O6VA 5I7UA 1CUDA 1CHNA 4CDNA 1AXRA 4NPHA 5FPPA 3O74A 3OMXA 3JWJA 1K7YA 1ZGAA 3OX1A 4EHNA 3CZ4A 3EGIA 2HMVA 1WJGA 1JG1A 5CGZA 1W1UA 5HIIA 2V4UA 3UXYA 1YIDA 4M9RA 2JAQA 3B85A 3LQ1A 4BMYA 1DIOB 2V6BA 3H9BA 1UADA 5LL6P 5JSZB 1CUCA 3ELDA 4ER7A 3LBIA 5T8KC 1CUUA 1UP7A 4B6FA 1UFQA 3WMEA 4FQ7A 4A0HA 3NVMB 4NJMA 4BV2A 3LWNA 3UCFA 5HTOA 3SGLA 4JP3A 5DN9A 5FORA 1XELA 3T8YA 4ZKDA 2DPHA 3G8BA 3SWWA 3C8ZA 3AZQA 2JBAA 3UPTA 2VTBA 3LRXA 4GWKA 2IHJA 3VR5A 2CEKA 2FJ0A 4D81A 2FRDA 2ZTSA 4L8FA 4UXIA 1NN0A 1F6BA 3R20A 3A36A 4DIDA 1NIJA 1DBQA 1JR2A 3B1ZA 5JJ5A 1XGKA 2X23A 4UQOA 2B25A 1A8IA 4JP1A 4BVBA 2QG4A 3QYPA 3D4BA 3DFKA 3FJOA 3VR4A 4A10A 2ZQ5A 2BTEA 4FE7A 4P4TA 2HJSA 3OZVA 6PFKA 1C9EA 4TWRA 3WWEA 3WGVA 2WIJA 4YDSA 1JNXX 1O0SA 1V7QA 1WVIA 2LRHA 1K7FB 3A1FA 3ROZA 1E3DA 1GN9A 3HXKA 1J07A 4X7MA 5JO9A 1SVMA 2CL0X 1OOEA 3BMOB 1FL9A 1J1ZA 1K6XA 1N5MA 4GH5A 4RLFA 1LF0A 4KJXA 1J2UA 2I67A 4HZIA 5CNMA 2C5BA 2Q5CA 3RSLA 3VXKA 3L3BA 1IXYA 3CGGA 3GJ4A 1J8YF 1MO6A 1PS8A 3D6FA 1YR8A 4XVHA 3DBVO 5GJCA 4Z3DA 3RVNA 2PS0A 5SICE 1OLXB 4W63A 4JZKA 4US2R 3N2KA 1Y4ZA 3GGSA 4DJFC 5EG5A 6REQA 5LU9A 4IW3B 2QD4A 4IXNA 4DV7B 2GZDA 2LIPA 5AWFC 3ZE1B 2OESA 4EF4A 3NQ41 5AI5A 2D1SA 4Q9HA 4P3XA 3KQKA 5KNDH 3R6WA 2FN7A 3QLTA 1U1GA 5BT8A 2C2KA 1USKA 5KPJA 2QKYA 4JQSA 1IHDA 4P7JA 4GXNA 1ACMA 1YGYA 3DE2X 1EVJA 5H3HA 4AJIA 1UMBB 1UM9A 2XNCA 3I0NA 3IRVA 4NXNB 1NN5A 2CBZA 5BNWA 3N2IA 1U3FA 1ZJWA 3PV0A 3JU3A 2Z3ZA 4H17A 5T4BA 4X20B 1MQ8B 3WMFA 3GARA 1GT91 3FGNA 4J2OA 4AF8A 1VSQA 4R31A 5L7YA 2Y0CA 3SR0A 2FWBA 4ZC1A 3GEBA 2YHSA 1U2QA 4PC6A 5FLXA 2Z4SA 1RKXA 1FSSA 2QN9A 1QYDA 4DF3A 3ZH2A 5FUYA 2XB9A 3PWKA 3ZDDA 2BFBA 4DCNA 3WLLA 3PQ6A 3GCGA 3H5LA 5FOQA 5KTPA 5K1ZA 1WB6A 4XM2A 9LDBA 3F1LA 1RXWA 1EVZA 2QRMA 4L1KA 4OSPA 5H4GA 3K9HA 1Q16A 2XTNA 3C6BA 3DV0A 2ATXA 1MDBA 1IULA 4JHLA 1XD8A 4UASA 1M8FA 1R6UA 4NV1A 3ZZUA 3O8QB 2GNPA 1Z9BA 3GLRA 3OEED 4GM0A 5EKTA 4QPNA 2P9YA 5KNCD 3URMA 1KMQA 1W9MA 1SUPA 2EYUA 2IH2A 1FJGB 1TXGA 1XU7A 2WHXA 4LVNA 3TLBA 2PX8A 2WYHA 3UF0A 3QU2A 5AKXA 4A8TA 1K0FA 4J16C 1ECGA 1DP4A 4TWIA 2GPSA 1AQYA 4JJ8A 1ZIOA 4LYGA 3HACA 4EWLA 4H1HA 4B45A 1DBRA 1SK9A 4PWZA 4K0KB 1L4LA 1WB4A 2VH2A 4DBLE 2QAGC 2XSZA 1OLSB 1L5QA 1E77A 2LWIA 5CB4B 1CR2A 3IEUA 3HYLA 2OK7A 4R8VA 1FTYA 5JBNA 3TAHA 1HNXB 3BJIC 3L49A 4LG1A 1GGVA 3GQBA 2FJPA 2N75A 4REMA 2J7PD 4TMVA 1ZIPA 2WQ6A 2C4WA 1J33A 4ROSA 5AK5A 1TTPB 3ZGXA 1C3XA 1PFUA 1EUQA 4V1CI 1YA4A 1GP2A 2AE1A 1N6OA 2I7DA 1FP4B 2OO3A 4F5EA 1PQYA 5CNIA 2YXNA 2Z58A 4TQAA 1WHSB 1GL3A 1U4SA 1V3VA 1XQ1A 2CL7X 4UJ5A 1L5NA 5B3JC 4G5RA 3TXAA 1PJCA 1NBHA 2RHWA 3ODPA 3EZ2A 4FP9A 2AD5A 4DG9A 1FLVA 1Z0DA 1A71A 4PLTA 2ENUA 3GYBA 3BWBA 2A0FA 5L53A 3SYLA 4MQ4A 2A5FA 4ACBA 3B53X 3W90A 3DLHA 1NVMB 4ZT3A 1Z4PX 3QFHA 4R8LA 4CKCB 5ALHA 3U7GA 2OHXA 2WEKA 5TX7A 2AN5A 4BKOA 2PKQP 2QZPA 2YJ6A 3DMRA 2YR0A 3R77A 4KJZA 5BOVA 1Q57A 5ARDA 3SS7X 3UH0A 3RVLA 4Q66C 5C4IA 2BF7A 1VFNA 2JGEA 3TLYA 1MHTA 4BQRA 4IVNA 1T9BA 1D0VA 4FSHA 1YR9A 3FPLA 3U4DA 1R6AA 1H9AA 3QFTA 3PQ5A 3IEXA 4XKJA 2YV5A 4C88A 2QTNA 2FEPA 1XDZA 4BMDA 3ANLA 1XZDA 4PQYA 4MAMA 4R51A 4EI8A 1NTOA 4QZVA 1BQ3A 3FNRA 3IKLA 3VTZA 3C39A 5KKCA 1P9WA 3AUYA 3TTTA 2NG1A 2C00A 4MW9A 2FMXA 4Y6LA 2WWIA 4OVKA 3PPVA 5EEHA 3RS5A 4A8JA 4TPKA 4U3JB 3CLSC 1GPH1 1JR3E 3U40A 1VG8A 2JIQA 3GL9A 3I4LA 3IEPA 1O6CA 4V0ME 5IKPA 3L5KA 3NPAA 2RC5A 5EWLB 4BFTA 1R5NA 3PXEA 4YMHA 3NDBB 5C9ZA 5EJAA 2ES4A 2QQ5A 4XGIA 4BB6A 2H3HA 4BNDB 3CF4A 4TV9B 1E2JA 2PUAA 1BN6A 1WOMA 2C7OA 1PJ4A 1TKAA 2HQSA 2O1EA 1AK2A 3AUSA 3GRCA 4ITRC 3INRA 3SSMA 4BMXA 4EG1A 4AUNA 2GYYA 2JNWA 1XJ5A 1TEXA 3TINA 3K9WA 4GT1A 1UBNA 2PCLA 1Z16A 2ZBEA 3HP4A 3NNNA 4GXQA 1HBJA 3U48A 2G6TA 2D5IA 2Z2ZA 2HU2A 5ICSA 2XOKD 5K6RA 5K2OA 3DEJA 2IWRA 1DBSA 5FL3A 3SM3A 2RGAA 3TOZA 1YVDA 5AJUA 1WBJB 4KK3A 1UXIA 1F9EA 2HB6A 5BN3A 1Q2XA 1QDUA 4QJ3A 4RKWA 3WAGA 3EG5A 2PEZA 4LXTA 5K05A 4Y2SA 4CCYA 5A9RA 1YE8A 1J20A 4II7A 4DLNA 1LGYA 1ZN7A 3AJAA 2I76A 4F5DA 1KSGA 4RM3A 3TW6A 5JATA 3JX9A 3JQBC 1LSOA 2NV6A 2RJ3A 4KAXA 1XMPA 1OW3B 3QIVA 4OLJA 3PICA 5ILOA 3DR5A 3KHKA 2NZUG 2YRXA 3UPDA 5IAOA 1ZCAA 3TQIA 2XNDA 5JANA 2ALJA 1KO1A 2PLRA 1MQ9A 3KWMA 2B7BA 1KQNA 3UWDA 2CMHA 1IPEA 5EXEA 1GSHA 4ISCA 4X6LA 2J3KA 1K8XB 1PBNA 3CNOA 1JDTA 5JLAA 1NBME 1RI4A 1OX6A 1YDWA 3Q12A 4I50A 4MUXA 2EU8A 1NLFA 1UQUA 3C14C 3NC0C 1MW9X 3M70A 2BM1A 2N9UA 4MS4A 3DLBA 3CF0A 2GZ2A 4G5SA 1VJCA 2WKPA 2ZT8A 4MW7A 3DG9A 4QEKA 3TPFA 2A7QA 1Z25A 1EVIA 2ZFUA 3ENKA 4CNQA 4GI1A 3OIGA 4C2BA 3DDWA 5EC8A 2BFOA 3UMSA 1N8NA 3CCBA 3NG1A 1DFIA 1DZIA 2R4QA 3OFSA 4CGYA 1ZVKA 2Z83A 4YMSA 4AZVA 3ZIAD 2ZTVA 2ZQZA 2YIMA 4D46A 4QT4A 4QBGB 1W44A 4BXOB 1ISHA 4Q6WA 4EY6A 2F8TA 1ENPA 1M8PA 2CNNA 2UDPA 3EGDB 1ZNWA 4RFSA 3N7TA 1FNNA 5A04A 1ZJ4A 2OORC 3I8OA 1M1ZA 2C2HA 2D8AA 3NHYA 3Q98A 4ZT5A 5IMBA 3RVSA 1GNQA 3S2ZA 3QTBA 1AA9A 3E9YA 2Y4OA 3LNCA 3FYUC 2CE2X 3T34A 1J8MF 1A1SA 4JQCA 1K5PA 2QX6A 4JI6B 5AUNB 1GZSA 1YE3A 1E1RA 3B1YA 1PR1A 4ND8A 4QJ4A 5ALWA 3QWAA 4AC9A 4ARIA 3QVOA 3UZUA 2IP2A 3WHKA 4CMEA 1V1JA 1ANKA 1CLUA 3OPNA 3PC6A 2C61A 4MRPA 2ZKIA 3L84A 3RIEA 4DIEA 2GAIA 2MSWA 2RAUA 3BILA 3TQQA 3KQQA 1IBKB 1W0KD 4NU6A 3NIWA 4DUGA 1M75A 4B6GA 1Q7RA 1DQSA 4TLMB 1UZLA 5ARBA 1QUEA 5A7GA 2GN4A 1N2CE 3DDHA 5K8UA 2UYQA 2YWHA 3AONB 5J2TF 2OSBA 4CIXA 1AKNA 1NTRA 3O3NB 5BR8B 4LZPA 3SIRA 1RI3A 1R6VA 4JBHA 2Q0QA 4BFVA 4AM8A 3WISA 2Z4TA 1A5ZA 4OUDA 2YWJA 2X86A 5DNAA 3V1LA 3W6UA 2GWRA 4CG2A 1VCIA 4FWBA 4RAOA 4CJXA 4MW6A 2WI8A 2AXNA 5KIAA 1FNMA 3Q8MA 3MHPA 4NPCA 4MV4A 4GUAA 3SX4A 3IAEA 1O7JA 5JYCA 1KYZA 1S0UA 1DEOA 1FUKA 2JW5A 1KOFA 4RELA 5CR9A 5E8RA 4AD8A 1TE2A 2QN7A 3JR3A 4OHRA 4PTYA 1N92A 4BAUA 2GEUA 4XLTA 2OV3A 1SCKA 1VKZA 3BGWA 4CR7A 5E7IA 4RK4A 4M9XA 4DRXA 1TGYA 1RRGA 2CB9A 2G80A 4FGWA 1C8VB 1YZVA 1U7WA 4RCYA 4YLGA 1VRCA 2Z5FA 2YIVX 4C7JA 4D9JA 1OGJA 1XYYA 2IIBA 3V33A 4AG3A 3AERA 2ZETA 4HPXB 1ZL0A 2CDNA 1RC1A 5EE0A 5C4MA 3AUTA 4Q9DA 4L76A 4F9FA 3U17A 5AVVA 1I9GA 3CH4B 5SZJA 1URPA 4AL4A 2I03A 4BFWA 5KCMA 4FHGA 1Y6GA 2J9ZB 1CJTC 2WG0A 4O63O 1C7IA 3U3ZA 1BYUA 2Q5EA 4FFVA 3G0DA 3HVKA 3UOGA 1DVRA 1II8A 1FSZA 2XVXA 2NOAA 2DLNA 2FB9A 3WB9A 4CWAA 4AJNA 2B4TO 1YACA 2VDWA 1ENYA 1XWFA 3UHAA 4O4HF 4YLYA 3GOQA 3HWSA 2DR3A 4AXBA 3JWEA 1SZDA 1P0PA 4YMIA 4NY1A 1SKMA 1BGXT 4NVRA 3I1JA 1XDSA 2Q3HA 4WZAA 4WCFA 4JSYA 5AK6A 1JFFB 2IZ0A 2I0FA 4R4JA 5HPYB 1H2AS 1ZSNA 2PFKA 2F3UA 2LR0A 4KBGA 5HIKA 1MRZA 3ZHOA 4MQUA 4EKNB 2ZM5A 1QYRA 1XD2A 4YONB 5JZOA 1A7JA 3KBOA 2O2CA 3IMGA 1DX9A 1MUUA 2I6FA 3TEMA 2ZIEA 2YWGA 3AKCA 4OHXA 2VNAA 4DR4B 1PGJA 1IZ0A 3OLQA 3KLNA 3E03A 1Z4JA 4WNYA 2HA3A 1ORHA 4CKBA 1JMVA 1RYDA 3Q6MA 2DX7A 2FEKA 1IOZA 3PUHA 4FCCA 4WY8A 1NVUQ 3TDMA 4GSYA 1FFEA 3RASA 3H65A 2W6JD 1M1YB 2QP9X 5E0OA 1FVHA 3L07A 1NASA 3DWFA 4FLMA 4YRPA 6ADHA 1I5EA 4AZSA 1CWUA 5GOTA 4X1OA 1F8UA 1Z2NX 1RZ3A 2H9IA 3QELB 4QVIA 4IY1A 4R1UA 4BJ3A 2EG5A 4TXNA 5FULA 3N05A 5KNBH 4DV6B 5EMNA 2AI3A 3AQIA 2CC2A 4D4MA 3OQ1A 1ZK3A 3DXZA 1PWEA 1J1IA 2AOUB 4Q9NA 4WVLA 3RW9A 4FDTA 2UU9B 1JKIA 4IKOA 2ZRGA 1CRLA 2PIDA 3IUJA 2WINI 4FHEA 3UK6A 1ECLA 1PHPA 4AURA 2DFTA 9LDTA 2DHDA 4RIGA 2QM7A 4ZYYA 2BFFB 2AR7A 1XG5A 3CXUA 3OZ7A 4S2UA 4XGQA 2XT0A 4CEHB 3QKTA 2B98A 1NJSA 3JQAD 2ZE6A 4IUYA 4H31A 1JIXA 4LJKA 1UKYA 4NSNA 4Z4EA 3QE0A 2NZVG 3WOVA 2WJIA 3TZQA 4ZZ3A 1Y9ZA 1A88A 1J00A 1SD2A 4PZUA 1GPYA 4RVFA 5CH8A 1M72A 1OVMA 3LLVA 4A0FA 3R8XA 1G3IA 1E3WB 1EPUA 5G1OA 1JHUA 4QXOA 2P9GA 2OGZA 3CJRA 2V0CA 3OOWA 5IH3A 4BRSA 5DNVA 3L7MA 4WTOA 2BMVA 4IX9A 3JQ7B 4M1EA 4CTJA 4IIUA 4AY5A 4E2WA 4MJ3A 1XKLA 4FW8A 3RAPR 4TLAA 1L8QA 2QQ0A 3E0XA 1E7MA 3K15A 5ALPA 2C82A 2IW1A 2IUEA 3K35A 4BWYA 4DR5B 1UXJA 2O3QA 5CJ2A 3U4QB 4G25A 5AESA 4MITA 2OC9A 1C4WA 2O6HA 3E7WA 1QRAA 4LZOA 3V9AA 3ND6A 5DT9A 2ZUBA 3GLHA 4S12A 2WJWA 4TS3A 1BA3A 1ESNA 1AA6A 4FZ5A 1E79D 4YVFA 1RCFA 1BQEA 3H87A 1AT1A 3IAS1 3K8YA 4MPPA 5DHUA 1XSEA 2BP7A 5FWAA 1UEJA 1H1DA 4EW6A 1I6MA 4A2QA 5JT1A 2C8JA 2VYQA 1SA0B 5EIAA 2VDRB 6GPBA 4G1CA 1AMOA 1NJ5A 2B5OA 1JHRA 2BGIA 4UHHA 1Q17A 3KXLA 4PAMA 5DXJA 3FYSA 3ZGLA 1C3OA 5JNLA 5BW4A 2OAGA 1QQTA 2HV9A 1EJBA 1DRKA 2QUAA 2YOHA 3HDVA 3I0ZA 1P81A 3F5FA 3G3EA 3LQFA 5ILGA 3WIOA 1JU9A 1ULZA 2MINB 2SCUB 3AVQA 1JA0A 1PQUA 1VIMA 4L3VA 4ZEWA 4GC9A 1GQOA 3E84A 4W7IA 3VOBA 4RD4A 1TGVA 2C95A 2XUQA 4BP9A 4Z4FA 1PFYA 4ZGBA 4OBEA 4LWQA 3UAGA 1ZH8A 2QGNA 5ES3A 4EYSA 4YCDA 4HEQA 2HO4A 1AK9A 2YZ2A 3PVSA 4TKMA 1KOLA 3UBMA 4KQXA 1XCGB 3D3NA 5FEMA 2HHJA 4DQ0A 4DWOA 5JXHA 1ZEJA 1OJ7A 1HDEA 5AJYA 3OFVA 2JFQA 3V42A 4CDGA 3F5QA 4LF4B 4M1SA 1EUYA 5AOBA 3U7IA 2BSAA 3ZIUA 5FT9A 4DSAA 5I7SA 1E92A 1UODA 3W2TA 4LWZA 5TPZD 1U7PA 1WOYA 3PL5A 4NCKA 2P2NA 4XOUA 4EMTA 2MIIA 3GLIB 1FVFA 1QMPA 1MW8X 4HBZA 3SJCA 5AW3A 4EFKA 2WU1A 2ZTMA 1RQNA 3HXTA 4F2GA 4ZI3A 3SHWA 2RGNC 5HUJA 2AYYA 4RZ3A 1SVWA 4EYEA 1RHUA 2PNJA 1LDGA 2C07A 4B34A 1SKYE 2A9QA 2XGJA 1Z8DA 5JS7A 3QPCA 4H6WA 2ZBDA 5LOVA 1ZJYA 2H1CA 3AX6A 3UCEA 2ZSEA 3K5WA 5KYYB 5F4BA 1I94B 4ALLA 5I4IA 2XYRA 3C85A 4IZOA 2RGRA 3SE0A 2HD4A 1PTJA 2JARA 3KT8A 3UA4A 3VZRA 3DP9A 3CLKA 4GX0A 1ZRMA 1SG6A 3MA0A 2G0AA 4G5FA 4QHTA 2JIOA 4N48A 2WOOA 1VMIA 2PMDA 1KR5A 5ETJA 1GGEA 1LPSA 5G41A 3PLAE 5E7JA 2BFDB 1D4AA 2YKGA 5ENVA 2K2QB 4EB0A 4JBWA 2PWZA 2QZ4A 4PLGA 4TL9A 4Q12A 2OQIA 3KLBA 3JQFC 4MVJA 4QU9A 4Q4CA 2A67A 3KR1A 5JCJA 1XA0A 1Q91A 2WNHA 5KYNA 2ZJ2A 2FETA 2ERCA 1U3VA 1W6RA 3R0ZA 1ZS9A 5HUHA 5AICA 3QHQA 3FDFA 5IX8A 1CXZA 3ZDXB 2VHUA 3K0CA 3K1TA 4FOSA 4JB3A 4AMUA 3LT4A 1D8TA 2B3DA 3ORFA 1OILA 5LQCA 3LY5A 3AIOA 5CW1A 1PFWA 4M87A 5CRIA 2PUCA 1M1UA 4UUQA 4O2AB 1A4UA 2QN3A 1VB5A 3M6WA 2NLOA 1JWLA 2Q5IA 1LPOA 1ABFA 2JFBA 3EXG1 3OPMA 3QXCA 2P2CA 4WA8A 1H65A 3I9LA 4K2AA 1GUYA 1JHAA 1ORIA 2HRDA 4TS4A 3W1WA 4CQMD 2JJ8A 5K5EA 2QW1A 1ZNZA 3PUVA 3FA2A 4DLUA 1N7JA 5ELMA 4ENQA 1QHEA 1TT7A 2IUFA 4EF5A 1LSJA 5F23A 1U2ZA 1ZIDA 3LWZA 2EKZA 2UYGA 4OEHA 3ZWXA 2Y1LA 1EFRD 3HB4X 3IXMA 4P58A 5T6BA 5BVGB 1HK7A 3KTAB 4RABA 3RYCB 3MNFA 3LT1A 4O0MA 3OFND 2FQQA 4UTNA 4E4YA 2OV4A 1U6KA 1WULS 4I9FA 1OXSC 5CFOA 3BCUA 1Z62A 2ADOA 3FOBA 3JAWA 1W5AA 3NAQA 3RAGA 5JO0A 3BMCB 4N3CA 1E18A 3E1KA 2M6LA 3V2UA 1NC1A 1TF7A 2B4KA 3V7FA 3CLSD 4FB5A 4PX3A 1JVBA 3B3GA 5HKKA 1PIWA 2TS1A 2AFVA 3DEHA 2ONJA 2LKCA 1PYOA 4PBTA 2CSUA 1QYIA 2GLTA 2HDNB 4PSKA 2IYVA 2VT3A 4CQNA 1K3UB 1W88A 2BBWA 1Q12A 1U3DA 3EAFA 4EQ6B 1F1BA 4Z0HO 1UWCA 3QVVA 1ZVVA 5AUOB 3H6HA 2I7VA 1JAIA 2O8CA 5ALEA 4WVFA 3IUPA 3TLKA 5CDFE 3HSKA 3FOCA 5I4BA 5D6OA 1O6GA 221PA 3GVPA 3L7AA 4B75A 1I8TA 3JWPA 4DMKA 4WD3A 1FOEB 4MV9A 2F00A 2YQ4A 4CCWA 1XNRB 2F67A 2VHZA 2C8VA 2VPPA 3HDQA 3NEJA 4NFHA 5EN4A 2FPGA 2IHZA 2IU4A 1DT3A 4B3JA 2CNDA 1Q77A 2ZJ4A 5CCXA 1U2PA 5CH3A 3SZGA 3N0WA 1T3LA 5KQSA 3GPBA 2VHYA 4CMIA 1E9CA 4EFNA 5BXYA 2R1VA 2YFKA 3ONDA 2WJGA 4GECA 1F06A 3VC7A 3ZQ4A 1XALA 1MX1A 2FPXA 1Z5OA 4BVAA 4E22A 2GTHA 3W8EA 5KAPA 4EW2A 4BLWA 3E9MA 3N8DA 3WNBA 3EMKA 4HPJB 4E6EA 3CEPB 1UOEA 3R9XA 1PR0A 4C20A 1PQPA 1PFVA 3OWOA 4I55B 4F12A 3B52X 4NFSA 1RQGA 2C9OA 1Z17A 3H11B 2VDQB 1S3SA 1X19A 3QLVC 1F2UB 1W8DA 3RYIA 1AZWA 2RGCA 4DLSA 4OQYA 5CFRA 3INNA 2AW5A 5E2IA 1G5FA 3E3MA 2E4VA 3ABSB 3Q6NA 4N6NA 3RKUA 3RWBA 1T6YA 4CQMB 1C9MA 2X5NA 1TJ4A 1DAGA 2XZTA 3DC7A 5M04A 1WMFA 3LCCA 3B1XA 4FGUA 4LXUA 5I01A 1KIAA 2CFSA 4DDKA 2JH3A 2JI9A 1HGXA 4I5FA 4D6YA 3LY7A 1KJ9A 4Q21A 2JLWA 5TT0A 3CNNA 1X1CA 1QANA 2ZJOA 5K6TA 1CVRA 1Y1TA 3F2VA 4V0RA 2A4KA 3DOEA 1OFGA 3MWYW 1LLDA 2R7KA 4M9SA 4WPGA 3WHIA 4FZJA 3EEFA 3V80A 1ETHA 2QZ9A 4ZALA 3LECA 2PWAA 3NC4A 4DLVA 3I9OA 5F2OA 3A9VA 3AF6A 3IV6A 1I7DA 1K4YA 3AFGA 2ZWVA 1WUHS 4URUR 2JFYA 1GO2A 4QJIA 4XWWA 4EPRA 4QQNA 2ZULA 3U4AA 1L7OA 2GFQA 2NO0A 2P4EA 3BH6A 2XUKA 1OROA 1JFVA 5CLJA 3ZTWA 4ZOAA 1JJIA 5T64A 1JPNA 4JI2B 5TSDA 2FWJA 1ZRNA 4Z49A 1SD5A 5IARA 4J4TA 1UQTA 2E4YA 2QBYB 3DW1X 3EIFA 4NF2A 5JDIA 4X61A 1JMYA 3DHVA 2GKGA 3A4NA 1Z0AA 4OI4A 3QVSA 3T9EA 3BM5A 2VAXA 4FC6A 4TTAA 3VOAA 3AR8A 4OJTA 1Y1KE 2OZVA 4CCAA 9GPBA 1B4DA 1DINA 3BRSA 2R6DA 1DPFA 1L4NA 3NM5A 3TL6A 4KGDA 1KYXA 5DWDA 1Z5UA 2J3DA 1EFHA 3TOVA 1JR3D 1NU8A 1YJQA 2ZE5A 4Q1VA 4EKDA 3ABIA 3QQPA 4C6TA 2Y1KA 1SCJA 1N0HA 2HEGA 3DHYA 1FE8A 1L4EA 4MQ6A 4DMMA 5LA6F 4QDOA 1WQ4A 5K0SA 1PO7A 2BGMA 1IBCA 2FWMX 2JK0A 3T3HA 4CU2A 4PHCA 2B92A 1U0FA 1OTYA 1DUSA 2R8EA 2XTZA 3BIWA 1D7AA 1QCZA 3PGKA 4K9SA 3W34A 3ZHYA 4UPVA 1T1IA 5KJ1A 3LPAA 2R3SA 2PS1A 4LA4A 2FPPA 4XLZA 1JMKC 3QXSA 1TUGA 2J59A 3ADKA 3L77A 4EI9A 2OHHA 1CJVC 1WDKA 4H08A 4MCAA 1X7GA 3E4DA 3ZDRA 2ZANA 1C1HA 1FFSA 2PBFA 4J91A 3TL3A 1T2FA 2Y0BA 2PV0A 4CUKA 4KDCA 4HWRA 4CLXA 2RGWA 4UMDA 3MAGA 4A8HA 4I81A 1Q6ZA 1VBKA 1UFVA 5DE3A 2O07A 5DRTA 3PI6A 4PNHA 1QV9A 2JS7A 1NXPA 2WWXA 3TLCA 4CMHA 5LP6B 2QN8A 3KCNA 4XWYA 1J0EA 4DR7B 1SVKA 5HQJA 1W581 2RGXA 1VCOA 4PGMA 3AXSA 3DL7A 1CYEA 1ULTA 3AJEA 2VRNA 5A3RA 3MIIA 1NOIA 3NCHA 1KARA 3OIUA 3DDZX 4QOSA 5B2ZA 1AZSC 4KGXA 4CKWA 3HKEA 2IDKA 4E2FA 1NMSA 3GEIA 1IUKA 2XGGA 2V5UA 1NXXA 4ME6A 2GTPA 4H60A 1JDZA 1H1TA 2BHSA 2FG7C 2FZVA 2VDMB 3OURA 4G2NA 4Z54A 2HUNA 1XVVA 1Q0HA 1NRXA 4YPOA 5JQGA 3G89A 3PQDA 4POOA 4IFIA 1NBMD 3I2GA 3RUFA 4ALNA 4LTDA 3ZDFA 4A82A 2G9RA 2AMVA 2WV9A 1ZMOA 4QOEA 2AKEA 4CKZA 3O83A 3F49S 4RM2A 4NK4A 1UBTS 2PQ0A 1KK2A 4FZ3A 4CM9D 1HZJA 3OLWA 2JLBA 3WRYA 3RTEA 3CBGA 3KEFA 2PZLA 5MFPA 4X90A 1A9XB 1JQDA 3C5VA 1RBMA 1RCUA 4BNGA 5C53B 3GHHA 1DTWA 1RKUA 2B78A 5ALDA 1Y9AA 2HHHB 3DZCA 3CA8A 1CQXA 2LV8A 2OCLA 4G4JA 3KELA 3QNWA 3WG9A 5GIPE 3WAKA 2XUGA 1AUPA 2A9JA 3IDQA 4R8MA 4RANA 2JGAA 2PBRA 3B36A 3W9YA 2O50A 2BELA 4I4IA 4B6PA 5BWLA 2GCGA 5ECWA 2ORVA 4Q7KA 3UMGA 3TSYA 5ULLA 2WDZA 1L5OA 1QM5A 1RPNA 4M9CA 4C0JA 1L4YA 3RTBA 3HZZA 3NJ8A 4QTTB 5TPWB 4QUGA 3T7RA 1KK3A 4WY5A 4XIFA 1V37A 4N7RA 4DB2A 3EMVA 3R7AA 1GJRA 5LQDA 1PR6A 5L6LB 3W8NA 5IH7A 1P2TA 1YB5A 4EVRA 2RHDA 4U6QA 2RHCA 3IR6A 2E49A 2V1XA 3BL8A 4D4IA 3N39C 1OXTA 2XKJE 5EZSA 1HE5A 1XDBA 4HDAA 4XJSA 1W7AA 2IU0A 3O73A 1VTKA 2AWNA 4R2KA 2ZYHA 4RO0A 2B9VA 3H7IA 4DJ5X 2MSEB 3IMKA 1USUA 3OU2A 5JSHA 5EERA 3P4XA 2FUEA 1VBMA 3KQPA 3PEFA 1P33A 4NENA 4PNZA 3RPEA 1EQ2A 2HM7A 1FFAA 2PX6A 3DE0X 3GZTB 1FFBA 4FGKA 4PTZA 1Z2DA 4EB6B 1BE0A 1Y3BE 1SBYA 1YO6A 1L4BA 4AUKA 1AMNA 1CDEA 3ELWA 3FG9A 3MTIA 4IOLA 2OV8A 4BFYA 1J9ZA 3ZGOA 8AT1A 2R62A 3DYVA 3JWGA 2MMCA 3LRTA 3IOBA 1QKJA 5EZYB 1GPDG 2ERXA 4JLNA 4PO9A 4EFMA 2GD6A 3VR0A 3J81A 3A9UA 3DMFA 1IDOA 1CDOA 3FAZA 3WSTA 1P4JA 1TK2A 4KWIA 3EZ7A 2YWDA 4IIJA 3PGXA 2VF2A 4RMJA 4CM4B 2X58A 4DEXA 1TF5A 5IC6A 3GEDA 1KAOA 3ADBA 2EFDB 2X4GA 2NVBA 1J8VA 4ZVVA 1J2JA 4HYQA 4HX2A 5KX5B 1GZDA 4UVGA 2P7HA 4D8WA 1UBLS 1CUGA 2QX4A 4PU0A 1PI3A 4C7BA 1T5TA 2Q8PA 1RPTA 3PKIA 4YDQA 5B3AA 2VDPB 1RWBA 4CF4A 1YI8A 2QYSA 4DVJA 4FBMA 5IXSA 3TZ6A 4MSUA 2JIZD 1P7VA 4XYGA 3EXHC 2XCUA 3REQA 2WOJA 1KEEB 4TVOA 5HFNA 4C3VA 2VH5R 1GWNA 4YX9A 1SRRA 1B23P 2VHVA 4IXMA 1H66A 2P8SA 1V6SA 3FOFC 3TDNA 2BUBA 2OBYA 1PSZA 3BIXA 4BU0A 1TFRA 3V8MA 2NU6B 3DCNA 5KTSA 4BZQA 4BTVA 3E9QA 5JS6A 4JL5A 1ZVJA 4PM4A 4JYZA 5EMKA 1OKKD 2I3AA 1M9NA 1UPFA 2PZJA 2VN8A 2IEZA 3GG9A 3EWIA 4Q03A 2IE8A 1GFZA 2OUIA 5FBWB 3RK4A 4R9VA 4J0HA 4N6OA 1KKUA 2PUHA 4N3BA 1X0XA 1L5GB 4FFNA 1PJ2A 3QG5A 2RKOA 5TGDA 4IJKA 1GR0A 2VKQA 1E6EA 4C43A 3AY0A 4OOFA 5IYZA 2B6NA 4Y1RB 1FS5A 2WC1A 5H83A 2RHRA 2HXGA 4RSHA 2FW9A 4OHUA 3HS3A 4YAUA 1ODSA 3I6BA 1HQKA 1L8LA 1VRVA 4RVSA 3T0GA 1VXOA 2IC5A 2XQIA 4YROA 3CZAA 1GAWA 3T9BA 4RDCA 5GVSA 1M5UA 1HYEA 2PYIA 3NH9A 3QUQA 2ID8A 2XPCA 4GG1A 2OILA 4J0QA 4KO3S 4NBNA 3VR3D 4Y2QA 4BB0A 4P92A 3T7DA 1OA1A 1YR7A 5CCEA 3L0PA 1FPMA 1XMXA 4X5OA 2QUBA 2X0KA 3QJYA 5BSVA 1WUTA 1LFAA 4PZYA 4YJ2B 2QN1A 3AEYA 4FNMA 4GLOA 4PYNA 5ESDA 5H80A 2R9VA 3PNYA 1NR1A 3ND8A 1ENZA 3B12A 3G2MA 1HTWA 4NCXA 4F6RA 1V1RB 1W30A 3V34A 4EPYA 1JH9A 3U7JA 1K97A 2V6MA 4F5ZA 3O8CA 2JHGA 2ZJ3A 1N2CB 3H9GA 2DTEA 4LW8A 3Q3GE 3HWRA 2R2AA 3U44B 1T2AA 2OCAA 3DLTA 3IB3A 2NXJA 1J5XA 3EASA 3K9GA 1RWOA 4RHEA 4CN9A 4DZRA 5EFOA 3U4CA 2OGTA 3BMOA 1U8ZA 1P9OA 1RTKA 2GZHA 4MQ5A 2Y68A 3DD5A 3UCXA 4V1CA 1S1MA 2ZRLA 1H23A 1OH6A 1ONSA 3KPUA 5CLHA 1T5SA 3QVXA 2XCRB 3OZWA 1CY8A 1OSNA 2XF8A 1A4RA 4EHAA 4YASA 1MJGM 3BSWA 2X3FA 3QKSB 4CF5A 1T9HA 4MZDA 2JIBA 2WUVA 2ECQA 4XD2A 2J0QA 1N3YA 3IHKA 1ZJ6A 3N75A 2ZJYA 2A86A 4ZOEA 2GYUA 4IZIA 1DBWA 1H05A 1CZKA 4DSUA 2O2DA 1G8SA 4DSNA 4W5NA 1JIKA 4JKIA 4ZO6A 1UK6A 5TF4A 4EDFA 2AWOA 5DP1A 3W2EA 3PEVA 1G8JA 2F3RA 2AZMA 1IM5A 3GY0A 1LVHA 3ILYA 3Q85A 4N0QA 2DLCX 3D3JA 4WASA 2AFIE 3DR3A 5AKKA 2DY0A 4LZNA 5E4TA 5ES4B 2FH5B 1GQQA 4JBXA 4D4JA 4MVXA 1NKTA 3SBEA 1P29A 3FSGA 1YDFA 5FFFA 1P80A 4A2CA 5HCUA 5DPMA 1LJUA 1J7KA 4MWBA 1DCKA 5GMOA 4CIAA 3KTOA 2VYVA 3EVNA 2GPTA 4V0OA 4X20A 3RC7A