4V0OA

Crystal structure of bbs1n in complex with arl6dn, soaked with lead
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
molecule keywords ARF-LIKE SMALL GTPASE
total genus 48
structure length 166
sequence length 166
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0oA00
2OBNA 5L3QB 1ZM3A 2JJ2D 3VNUA 2ZRHA 3QVUA 4M1OA 1HYQA 2ORWA 1FX0B 2WOOA 2C8VA 2QTVB 1CU1A 1KNXA 3AP3A 3BH0A 5CDFE 2R9VA 4YMTA 1VECA 3SNHA 5FPKA 1T4GA 3SYNA 1N5JA 3A1WA 1IHUA 1U9IC 3K0AB 1E2LA 3RRZA 1FFHA 1CKEA 1R2QA 2CNWA 3TNFA 3WNBA 4ZKDA 3VR1A 3CPHA 3QKSA 4C4PA 2QAGA 3VKHA 2QMUA 2NIPA 1UF9A 1GOTA 5FTKA 4G3XA 4GFDA 4YMVA 4I1SA 3UG7A 2NO1A 3OIVA 3QEJA 5FL3A 1E2QA 2LCFA 2WAYA 1GRNA 2R6GA 3DDCA 4Q48A 3NEJA 1W44A 3FE2A 1SXJD 1II8B 2J7PD 2Q0HA 5AUPB 2QNRA 3HYTA 1HUQA 2OFWA 2WKQA 5AWFC 3I32A 3TBKA 3QENA 1Z6AA 3KQLA 1XXHE 3U2QA 1W0KA 2GK6A 5KPJA 3SJZA 3NHBA 2MSEB 4LDJA 1T0JB 4AK9A 5BN3A 1UKEA 1OIWA 1EFCA 2YWEA 3MAAC 4LOAA 4Q5IA 2PCJA 2YOHA 3ZZ0A 1S9DA 2B7BA 2RGCA 4RD1A 4E5UA 2ZVQX 4XD7A 2GF0A 3W6OA 4MRSA 2VHUA 1ZINA 3B1XA 1HEIA 3TKLA 5F3WB 3RS4A 4C2TA 3CRRA 3KJHA 3NH9A 4L16A 3RS0A 4EPWA 4OI1A 3L0SA 2DYKA 3CW2A 4AYWA 4PAOA 1G7SA 5FFMA 1OSNA 1Q1BA 3LNCA 2J3EA 4NYMR 4WXRA 5DISB 3U5ZB 3THYB 2IS2A 1E9EA 1G291 2PZEA 2A7QA 2OV2A 3N2IA 1XD2A 4HAXA 5FUXA 2I4IA 5M04A 1OFIA 2VF7A 1SZPA 4RZUA 3OFNA 4Q01A 3SR0A 4P4SB 1N5IA 2ZRBA 1GKIA 3AH8A 3RS2A 4EUNA 4IXMA 3X1YA 4QOSA 2NG1A 2RHDA 1Y3AA 5FOWA 1FNNA 2FEOA 4LJ4A 4ZI2A 2J0UA 3B8HA 3HP1A 3I92A 3AUYA 3T61A 2ZVPX 1LW7A 2R65A 1YZTA 4UXIA 3L8YA 5DI9A 5FPSA 3RWMB 4XSGA 2XJ9A 2OZEA 4IHQA 4DZZA 1P2SA 1K5DA 2OESA 2OCAA 3NBZC 1AIPA 2BDTA 4B35A 2OG2A 2WWFA 5BQ5A 1NSFA 1E79D 5HR5A 2H16A 3A36A 5LB4A 3DHWC 4DSNA 4M9QA 3ASZA 1UBCA 3LBIA 4RD2A 4MKHA 5EP3A 3IILA 3FOZA 4MA4A 4DT1A 4AWXA 4N0EA 3SN6A 2IS1A 2BCJQ 4RD4A 3SS8A 3ZVNA 1NG9A 2JLYA 5DH9A 4IDPA 2QP9X 1MKYA 2FG5A 4IOKA 2FOLA 1BOFA 2IUSA 4ZV4A 1W36B 3O47A 4RJLA 4AI6A 1NBME 3FYHA 2PZGA 2JASA 3GQBA 3VU9B 2XB4A 3KJIA 2ZQ5A 4HB0A 1D9XA 2VP9A 4OQLA 4Q9JA 5EXPA 4DKXA 1X6VA 1P62B 1NJFA 1EK0A 1DPFA 2XTMA 4C7OA 3NBXX 1YR9A 4MITA 1WQ1R 1KMQA 5EJEA 2FSIA 1KHTA 2W2TA 3GLHE 3RS7A 4AIIA 4EAQA 4D82A 2IYQA 2ZRMA 1ZJ6A 4Z51A 4WBSA 4E03A 4PO1A 1UFQA 3ADDA 4U7DA 3EC1A 1RRGA 1J99A 4IOJA 1QHYA 4TMXA 3G0HA 4M1WA 2ZSDA 5H1YA 1NBMA 5FOSA 5SZHB 4XJXA 2G83A 1VG0B 1XEWX 2ZJAA 2GJ8A 4LJYA 2IWHA 4NH0A 1CR1A 2YNMA 2ZRFA 2J87A 4LCBA 3U3KA 2G0TA 2J0UB 6Q21A 4KITB 1W4BA 5FUVA 4AG6A 1FUUA 1NLFA 2B6HA 2EU8A 3GJ3A 1X8KA 2IXFA 3KKPA 2A2ZA 1XMVA 2N42A 2RGEA 4KFTA 2ATVA 4AC9A 2P6RA 5EXSA 5JS7A 2P5TB 3AP2A 1VHLA 3C7KA 3EXAA 1Z0FA 3LX8A 2X8AA 3ETLA 3VR2A 1E2EA 2ZM5A 2FN4A 2BWJA 1FQJA 2R2AA 1S2MA 4R71A 3PQCA 3NHAA 5FBLB 5EE1A 1CULC 1DO0A 2F9MA 2YJTD 3TH5A 2C78A 1NMXA 1OE0A 2PX0A 4JBYA 1PLKA 3TAUA 5H70A 4TMWA 2HXSA 1A2BA 4DSTA 1IXSB 1U0LA 5HZHA 1KO1A 2KI5A 3KTAA 4H1VA 3R7WA 1V5WA 2QBYA 2A5GA 3AVYA 4Y0AA 2ZR9A 4V0OA 3U6KA 4HYYA 4MGYR 2AFIE 4IRUB 4KJZA 1OXSC 1ZC3A 4AD8A 1GILA 1XCGB 3EPLA 3T34A 3H86A 2ZRKA 2N46A 5IF9A 4F4IA 4BUJA 1N6NA 2ODEA 4GPTA 1CLUA 1AGPA 1N6IA 2SHKA 4QGHA 5KNDA 2CHQA 5J4VA 3ZIAD 1BYIA 2R6DA 1NN1A 2BBWA 4KI0A 3EC2A 4QBHA 1G5TA 4PHHA 1EFTA 1JQJC 4B74A 3KQHA 5FUWA 2IF0A 2AWNA 3L0IB 4POAA 2PLFA 1OIXA 2JLQA 3LFUA 3FPAA 1YKSA 1NVVR 3KXIA 1VCOA 4FN5A 1SULA 3AVUA 2JLWA 2ZI4A 4R2IA 4E09A 1KI1A 1MO6A 3ZQ6A 1R0YA 5L8VA 2IEZA 2PH1A 1KY3A 5ANRB 3RVBA 5D3MB 4XOIA 4B48A 3CRMA 3AF3A 4LPKA 4CVNA 3S1AA 2JIZA 1JI0A 2E87A 1VHTA 1MABA 1XP8A 3VKWA 3K9NA 4B44A 3CONA 4Q9KA 2VTKA 2ZS8A 1SKYE 1MT0A 4ARZB 3QIAA 3C5HA 3MRSA 3NDBB 2W6JA 2RCNA 3EIQA 1R6BX 3TW8B 2BEJA 5JBQA 3T1QA 1G8YA 2V3CC 3P20A 2ZE8A 2GRJA 3Q9LA 4PC6A 2HDNB 1VTKA 2HEIA 4M2LA 1B0UA 1P7CA 3K9LA 3WHLA 4PO8A 2PZFA 1XDBA 4OI0A 1E9SA 1P4SA 3E2IA 3R9XA 3MUFA 4BLPA 4ZKEA 1S1CA 1QHNA 4PHFA 2G1KA 3B1WA 2JLVA 1M34E 2Q9AA 2FEMA 1VCNA 5TV2A 4LBYA 4MUBA 5BN5A 1G8GA 1E0AA 2NOAA 3EZ6A 4NCIA 1SVIA 4CEHB 2JIZD 5FPHA 3AGPA 4TYQA 1OXXK 3P27A 4CRWB 2EFHB 2ZREA 2GXQA 2AXNA 2J0QA 2WWIA 1KGDA 5CYPA 4DEXA 4D80A 3RYTC 3WBKA 4PZLA 2WMOB 1G7CA 1RVDA 3D8BA 2FPMA 1AKYA 4A0RA 5H8WA 2PT7A 4ABYA 2JLSA 4CEJA 4KLZA 4I1VA 5FOXA 1ZMXA 4DIEA 4FCWA 4KV9A 4BFXA 2CJWB 2QPTA 5AUOB 2ZYTX 2JLXA 3DM5A 1XJ0A 3WMEA 1A2KC 2KBFA 1DO2A 3F0TA 2IK8A 4PHGA 4QHSA 3EPKA 1KAGA 3K0FB 1HQYE 3AV0B 4W5HA 4JVLA 4AY2A 1SVOA 1XTIA 3NG1A 2VSXA 4TYWA 5J4YA 1OB2A 4X8OA 1JBKA 4XH9B 3R9IA 4A8JA 3D31A 3UWKA 1FL9A 4LJ9A 5G41A 4HEJA 1XBTA 1LF5A 1KK3A 5C4GB 4DLUA 1G17A 1W48A 1ZD1A 3FB4A 4Q7MB 5FH9A 3UXMA 1S96A 4V03A 2YC4C 2ZRJA 2OUKA 3VMFA 2CLCX 1P73A 4XWOA 1BKDR 3RRYA 2H8KA 5KTYA 4JSTA 2WWWA 1ZAKA 3QBVA 2EWWA 5J40A 1XD8A 3TSZA 1NNEA 3AUXA 3IUYA 1OXTA 3RHFA 4F92B 1VYTA 3UMSA 1I2DA 1R0XA 4US1R 5EUMA 3W9YA 4BPBA 1ZRHA 1RIFA 1G1MA 4EPYA 1Q22A 2WVJA 1J8MF 4B71A 1QHXA 1Z06A 2CE2X 3W34A 2QAJA 4Q02A 1SVMA 1HA3A 1TF2A 2CCJA 2O0HA 1GKUB 2J1LA 3KB1A 4LX0A 3LV8A 1KJZA 1W1WA 2V1XA 4HDCA 4MKFA 3SJCA 1KI4A 3CX8A 1D2EA 5KYKA 3QEOA 4M9ZA 1DEKA 2DY1A 3U7GA 5GADl 4Q03A 3AKYA 4CYMA 1ZC4A 4G0NA 3FKQA 3U7EB 1E9AA 1WE2A 1N0WA 4I1OA 3QF4B 1OXUA 4FMBB 1H8HA 1NVVQ 1EFUA 5HKKA 1YRBA 1GFIA 5FPYA 1QG4A 4WZ6A 4QHTA 2EFCB 2GHIA 4X8LA 5J4HA 2PBRA 2REBA 2VHCA 4QKQA 3WBJA 3T06B 1US8A 3ASYA 1TL7C 2FA9A 2QA5A 1Q57A 3ADKA 3GEHA 5B64A 3K0SA 4PQFA 2QMOA 4LHYA 5DHAA 4NYIR 1LB1B 3W6NA 3PJRA 3VQTA 4U5XA 5DI3B 2QL6A 3GLHA 3GCGA 1EFRD 4OK6A 4P4TA 2W83A 2CLDX 2OFXA 3NKVA 2QP4A 3OAAD 4HI0E 1NKTA 2GCOB 3BFXA 5LB2A 5JI3E 3EPJA 2ONJA 4JBXA 4II7A 1ZNZA 4TMZA 4XVQA 4B6FA 1Q3HA 4QBFA 1E6CA 2H1LA 1CXZA 4CEIB 1GUAA 5TXGA 5KOYA 2ZUBA 1KZGB 4JJZA 1IJEA 4JJKA 1VCMA 1I4LD 3HPQA 4JLKA 5CJ2A 1OKKA 4P4SA 2QQEA 5DE3A 2QPAA 2ZRDA 3QKUA 3UWOA 1T0HB 2OAP1 2WV9A 1KO7A 4JIMA 2ZAMA 2O0KA 2C5LA 3R9WA 3MLEA 2FWRA 1DAHA 2PX3A 4CT4B 2I1VB 1BO6A 2FSFA 4JYCA 4PC7A 1N0VC 4HDQB 3EAQA 2BCGY 2VL7A 2R8RA 2C03A 4L9WA 2XNDA 2ONKA 3LD9A 4YONB 4PAMA 5HZKA 2IYWA 1S9HA 3I5YA 3QF7A 5CM9C 5JECA 3LQRA 1NP6A 4YXWA 1GNQA 1QHHA 2JLUA 2CK3D 1P9NA 2WIAA 2C95A 4QFMA 3I3SR 1E9DA 2QT1A 1M7HA 3BE4A 2AK2A 3MJRA 1XF9A 4PPNA 2CXXA 2GESA 1OLOA 1QVAA 3EW9A 4MUAA 4RD3A 1E96A 1JXOA 2NTYC 1MRNA 1WP9A 2ZYUX 2J5XA 2NQ2C 5CJPA 1XXHA 3A8TA 4TLBA 3RAPR 4HUTA 2HUPA 4NBSA 2H18A 2IF2A 4G01B 1XWIA 1ZM2A 2ORIA 2J0SA 2REXB 4PSAA 1Z2CA 2BMJA 1SVKA 4B2LA 2VEDA 3EZ7A 1KOFA 3B1YA 2GDJA 1FTSA 1W2GA 1UJ2A 5LD2C 4PTLA 2CVFA 4DEYA 2ZUDA 2GCPA 5JSZA 2JJ8A 3P1JA 4LWZA 4DCVA 1F48A 4BLSA 3QNUA 1FNMA 1NJGA 1R5BA 4L8GA 4ZIRA 1X1SA 2ZROA 5J4KA 4LZZA 4LYAA 4OQFA 1I2MA 2H57A 1BH2A 2N1BA 4MH0R 5JWOA 2OCPA 3RRNA 4B47A 4URUR 1U81A 5DYIA 2OILA 1VMAA 3OEHA 3DZ8A 5BWMA 4LJ6A 4QBGB 2UZ3A 3W8NA 1RE0A 1UDXA 4B3CA 2C96A 1NVUQ 2ZI3A 3WYGA 1AA9A 1J8YF 1TEVA 1RJ9B 2Q3FA 1JB1A 2GWHA 5TARA 3VFDA 4IDNA 1K5GA 1E1QA 1NN3A 2ZR0A 1S3SA 1NL3A 3TR5A 4Z1MD 1ZVQA 5KSZA 4URWR 4M21A 3LW7A 1N0UA 5EP2A 1PV4A 2QBYB 2XAUA 2GKSA 1X86B 1WB9A 3TUJC 1ESNA 4HUQB 2P2LA 3V4RA 4CEIA 4RCZA 1K8RA 2YC2C 3D7MA 4DLVA 3GJ7A 1QBKC 4ITRC 2GA8A 5G3YA 3FDIA 3OIUA 1C9KA 2JCSA 5FL7A 5LD2B 4RCYA 3X1WA 1GKYA 2AN9A 4BASA 1FW6A 4HZUA 1D8TA 1Z47A 4MYTA 1IJFA 1WXQA 3TK1A 5EXXA 1OB5A 3K09C 4DVGA 1S3GA 4M9XA 1EESA 4A92A 2OSBA 4KODA 3UK6A 1JR3D 3AGQA 4A36A 4UKDA 4EIWA 2HJGA 4XTCS 1E4YA 4KVGA 5FBWB 4LY6A 4WW0A 5JZVA 3AM1A 2IX3A 5F9HA 3LW8A 2IXGA 3THOA 1L4YA 1Z6TA 4EQ6A 3B5JA 3PFIA 3KJGA 4Q7LA 1NVXQ 1UKVY 1Z28A 4QJ3A 1HQCA 1XZQA 4TL8A 2XEXA 5DHFA 3AKEA 4ACBA 1OXVA 1E9BA 1XTJA 1YZGA 1U0JA 5JS8A 3QQ5A 1E2PA 2AL7A 3OEED 1GNPA 4BFSA 1T5LA 3U6BA 4LBZA 2ZITA 2CEAA 1QDEA 2WBLC 3GJ0A 1IXZA 3BBPA 3ZVLA 2AD1A 1QG2A 3KZ1E 1AN0A 4JLDA 1Q1QA 5FUYA 2R6CA 3X1ZA 4BGDA 1JNYA 1IY0A 4GZMA 1NF3A 2BC9A 2ZE6A 4NCNA 2P6NA 4EJSB 5KNCA 3GLGE 4C0JA 4M1KA 5JHHB 2AD5A 2HF9A 1VG9B 4V0MA 5LPNA 1CJMA 1G3MA 4DCUA 1P61B 4Z54A 3UANA 2BOVA 4Z1MA 4KO8A 5JHGB 4K81B 2QM8A 3U60B 2WJGA 4DDTA 4TYNA 1EWRA 3THXA 5FTMA 2X1VA 3K8YA 3MWJA 5EE9A 2DFKB 1R5NA 2MSDB 4P4UA 5JCZA 2KWIA 1E2GA 1XRJA 1T5IA 1F2TA 1XPRA 4C30A 2WIBA 4V02A 2F9LA 4K8OA 4UXHA 5TMPA 3IEUA 4D0GA 5K8LA 3HU3A 3M6AA 1E32A 2GJSA 2QU8A 2X77A 1SXJA 3WNDA 1IY2A 1PZNA 4LHVA 3IBYA 3QJYA 2ANBA 3W5JA 4HLCA 3U4QA 1Z0DA 4GDFA 1U94A 1W36D 3T5GA 3K0FA 4ZCIA 4Z8YA 2NO9A 1PVOA 3OEEA 2FPLA 2H92A 3L43A 4ESVA 1I4DD 1WCV1 3B2EA 3F3YA 1KKLA 2ZSAA 4JSYA 1HURA 1JAIA 4TLAA 2CJWA 4PX9A 3SOPA 2XGJA 1NBMD 2OLJA 3Q5EA 2EWVA 3Q72A 2W0MA 1Z5ZA 3UG6A 2VRWA 3K1JA 2OAQ1 2QY9A 4XVUA 3WYAA 4ZI3A 4KU4A 2PCLA 3BC1A 3EX7C 5E7MA 3VTKA 2DPXA 3V9PA 1F3OA 4JLAA 4ASUD 1CRPA 4NCKA 4IEIA 5HCIA 2RGXA 3FKSA 1F2UA 5JI2E 3ZH9B 4WXPA 2NZJA 3HU2A 5CITA 2X2FA 3EWSA 2V7QD 1NN5A 1IY1A 2W6JD 3ONWA 1TEXA 4AURA 3CRQA 2D4HA 2QORA 2F55A 1E9RA 3AF1A 3CR7A 4Q4HB 3CUEF 1QVRA 1DVRA 3PVSA 4JBWA 4TLDA 4BFUA 3IQWA 3IEVA 1F6BA 4XWAA 3QXHA 4MKGA 3KTAB 1Q3TA 2VP2A 3GP8A 2WM9B 4DBLC 1ZIOA 3X1DA 3GD7A 4J0QA 5K8TA 3W3AA 3WMGA 4L15A 4R9UC 3ZGXA 3QPWA 3TR0A 1R8SA 3RS3A 5J47A 2IL1A 3LDAA 5JWRA 3KX2A 1BIFA 3LY5A 2V7QA 5SZJA 3TW4A 2AFHE 3U44B 2B7CA 2VHTA 1JPNA 3TAHA 421PA 1KSFX 4NYJR 4RZ3A 4L9SA 4F7WA 3A4NA 3UMRA 1KYIA 1SKYB 3U7HB 3FVQA 4NPHA 5EUQB 3OAAA 4PO9A 4BEBA 2GK7A 4BECA 1E79A 2UZIR 4K46A 4TYYA 2VH5R 4NONA 1LS6A 4Q7KA 4ILEA 1JEDA 5EE5B 1Z0AA 3A4MA 3BWDD 3V00A 3W5IA 2XB2A 5JJKA 1ZW6A 4I99A 5C1BA 1NN0A 2EW1A 4B75A 4B76A 3A1UA 4EJSC 4KXFB 2WHXA 5FOUA 1KI6B 2PLRA 4Q4JB 3FMOB 3CH5A 4Q9HA 3NVAA 4BLOA 5CDFA 1XX6A 3ZQJA 4JZKA 5IK2A 4EFMA 5D3QA 1QRAA 4JKIA 2YV5A 3KKOA 1ZUHA 3U44A 4ESHA 2ZRNA 4JT4A 2ZUCA 4DB4A 3WRYC 3PG5A 1IOZA 4DT1B 2DFTA 2GTPA 4Y0VA 1M7GA 2OBLA 1Z6YA 5KSOA 2ANCA 3HR7A 2G3YA 4B6EA 3G5UA 5L3SA 3R8FA 4BFWA 3IHWA 1E1RD 2IA5A 3PUXA 4MGZR 2H5EA 4U00A 3EIEA 3OEHD 1E9CA 4URZR 4OHWA 3B9PA 3QXJA 4V0LA 5JCPA 2QENA 2Z6VA 3I72A 4KFUA 1F5NA 5KSYA 3T5DA 1W0KD 4YLGA 4LYHA 4RZ2A 3W8RA 1GIAA 4C2UA 4QC2A 1TU4A 2GNOA 2XX3A 4A2WA 2EVWX 5B2ZA 4FW9A 3N70A 4JL6A 4JL5A 1RPZA 2O0JA 2QN6A 1P72A 3PXGA 3HPRA 3SDZA 4UNQA 1G8FA 1XNJA 1NY6A 1E2IA 4IEEA 4OHZA 4BWYA 4LYFA 4PXAA 1AJEA 4LV5B 1BS1A 3ZD7A 3TSOA 2EYUA 4CEJB 2O8CA 2FSGA 2ORVA 4PR0A 3ZLJA 3QG1A 1WRBA 1XEFA 2GZDA 2ODNA 3H84A 3LH5A 4M22A 1S4QA 2W58A 2GCOA 4V0ME 1QHHB 3UKDA 3DEFA 2ZPTX 3TIFA 3TQFA 3WRXC 1CEEA 3TUZC 4R2HA 1KAOA 4KYIB 4EJSA 3C14C 2A78A 4M1YA 2WWYA 3GFPA 1IXRC 4QM6A 3QVVA 3FHOA 3ICQB 1YVDA 2QRZA 4NP6A 1IAQA 5L3QA 4NZYA 2NPIA 2O8BA 3KQKA 5FOVA 4TMKA 2IHYA 1OH6A 3B9QA 2JJ2A 1FZQA 2BM1A 2QI9C 2QT0A 4LHXA 5F9FA 5FTLA 1MV5A 1LF0A 1NIPA 2BKUA 2ZJBA 1ZIPA 4Q19A 2FGJA 1VG1A 2C2HA 4TTRA 1DAFA 2NGRA 1IONA 2PT5A 1H8HD 3DL0A 4EPRA 1Z8FA 4BZPA 1KI2A 1SXJE 5B30A 1G19A 3IGFA 4OJQA 1E2FA 4Q18A 2IUUA 3CPEA 2F7SA 3SHWA 2O8EA 2MMGA 1VIAA 1IBRA 3AQ4A 3GJ6A 3PITA 1Z0KA 3WY9A 1XU4A 4GL2A 4I81A 2ODBA 3U61B 4H9GA 3P26A 4NCHA 1W7AA 2ZRCA 2GBLA 5CIWA 5GJWC 1EFHA 1SHKA 4QRHA 4F4JA 3FMFA 3FMPB 4QNMA 1EX6A 5FL7D 1UKYA 5JRZA 1A82A 2D06A 3J81k 1S8FA 5EZ6B 1L8QA 5DN6A 5FTNA 5UKDA 3K0CA 1WBBA 1VPLA 3CM0A 1T3SA 4B3FX 4W9MC 1PUJA 2VSOA 1DAIA 1T9HA 1F2TB 4OI4A 2QGNA 3TVDA 1G7RA 1JAHA 4KCGA 4UNNA 4A6XA 4B33A 4EFNA 3AVTA 2E9SA 2IT1A 4YDHB 1A5TA 4BEJA 1G41A 4XIGS 1HT1E 4A9AA 1PUIA 3BIFA 3QPVA 4D25A 1ANKA 1NVWQ 1ZUIA 4RSGA 3C15C 3L0PA 5KSPA 2P6UA 1L7VC 4X8HA 2F43A 5EQTA 4G5QA 3B60A 4JLJA 1CR2A 5EZ5A 2AKAB 4R7ZA 4GBMA 1J70A 3DMDA 5AUQA 3OF5A 1D5CA 1FMJA 1KY2A 2GEDA 2HYIC 4DB2A 2GETA 1HT2E 3T35A 2VP5A 4GMXA 3SE0A 3K0CC 1IN5A 2QTFA 3TJZA 4A8JC 3ZYCA 2IHBA 3CF0A 3WYFA 3BH6A 1GZSA 1UADA 2CK3A 2QUZA 2FSHA 4C0AC 2G0NA 2YINC 3GLFB 4LI0A 3LQQA 3VNVA 3E1SA 4DCSA 1FP7A 4Q21A 1JXMA 3I62A 1II9A 3IKJA 5CLLA 1KK2A 2LKCA 2XTZA 5GVRA 2QSZA 4AKGA 3TUIC 1G18A 4DCTA 1OV4A 1R4AA 2GAOA 2P67A 3QF4A 1YZLA 5AR1A 5HCNA 4TLCA 1NI3A 3JZMA 3LXXA 2ZETA 4YXWD 5JEDA 3X2SA 2IS6A 1AZTA 4RD0A 1KNQA 1EG7A 3AVOA 5K8IA 1TQDA 3TGPA 1UPTA 4O2LA 3PUYA 2YOGA 1DAGA 2CCKA 4OI2A 2XNSA 4B34A 3BFVA 4ZO4A 3PCRB 1GRRA 1MO3A 4TL9A 1GSIA 1U8ZA 5CB6A 3MFYA 2GILA 5JMTA 4U02A 4LYJA 4MRRA 3CKLA 2WJIA 1G3UA 4KHZA 2NO6A 4P33A 2GEUA 1ZNWA 2GBLC 3A1VA 3QKTA 1ZNYA 3AVQA 5IT5A 5JJLA 4URYR 3PEUA 1WA5A 4TSFD 3VR6A 1IQPA 4DDVA 2ZU0C 3QKRB 4AG5A 4UNSA 4M1TA 1Z22A 2A5DA 4D4JA 2CL0X 2RH5A 3IPYA 3Q85A 4HLDA 5JLJA 4PAQA 2DHRA 2ZE7A 1TU3A 3PIRA 5SZIA 1OH8A 1G6OA 1TQ4A 4JL8A 2BJVA 4HAYA 1E69A 1ZD9A 3B1ZA 4KYUA 4WIAA 5J4LA 3VAAA 1ONBA 1TQ2A 2XTNA 5D3MA 1SXJB 1T3LA 1E94E 1LNZA 5HKKD 4IVRA 3SJBA 1OHHA 2AX4A 1W36C 2F6RA 2FZLA 1XEWY 1KI9A 1U99A 3B85A 3HYRA 1OIVA 2LKDA 4BE7B 1XCMA 2ATXA 4HAVA 4C0LA 1YHNA 2FF7A 1JR6A 2EYQA 3OIYA 2IYVA 3B13B 4IOMA 4HAUA 4N3NA 1GTVA 1G6HA 5HE8A 1XMSA 5IDVA 1N6RA 1D2MA 1KZ7B 1ZP6A 2Q9BA 3DOEA 4MQBA 1T91A 1GM5A 3AP1A 3R20A 3RSOA 2PL3A 4LJAA 4C0KA 3UMFA 4O25A 4C0QC 4DLWA 1ZM7A 4PZZA 4TSFA 4B2PA 1NMZA 1AM4D 2IEYA 1DADA 4WA7A 1ETUA 3T12A 5FBQB 1RJ9A 4EQ6B 1VIYA 2JAQA 1XD2B 2ASEA 3KQNA 4WZAE 1AQUA 2JLZA 3DMNA 4A1FA 2FX3A 2GJAA 1US8B 3BB3A 1OFTA 3CWQA 1YZNA 1OYYA 2XSZA 4NU0A 4LC1A 3K0EA 4NE2A 1W5SA 1XTRA 4P3YA 4DLSA 4TL7A 3GPLA 3VR3A 3GLHB 3KB2A 2XXAB 5F2EA 2FJUA 3AVPA 4D81A 1JEEA 2QQ0A 4W5WA 1Z07A 1EX7A 3R8CA 5BXQC 3U3JA 1MO4A 1XD9A 4XTRA 4TTQA 2IXEA 4PZYA 3TMKA 3G82C 4LC0A 1II0A 5BW8A 4MGKR 3ZZTA 2ERYA 3BK7A 4BRWA 1EXMA 2MMCA 1ZD8A 4M4SA 5IRCD 3P32A 4FIDA 4QGGA 2ZJZA 3EARA 2PJRA 1XZPA 3KXKA 2XNDD 4DIDA 5AJWA 4XD7D 2XZPA 2RHMA 2ZSFA 3DKVA 1P2VA 2REOA 4FCTA 3KL4A 1H8ED 3KFXA 4TTPA 4DDUA 1ZBDA 1CP2A 5GJVC 1XTQA 3QE0A 1DBSA 2I1QA 4OK3A 5SZKB 2BMFA 8OHMA 1KDOA 2G1JA 3QPUA 2JA1A 1HH4A 2P0EA 4TMVA 3FGNA 2QAGB 4S35A 5KUTA 1E4VA 5EE0A 3VR4A 1JR3E 3QXSA 1G3QA 1GWNA 1T8UA 1ZYUA 2P3SA 5EP1A 3DVLA 1G8PA 1HTWA 4KSCA 4JVMA 3EA0A 1P75A 3GLGA 3SJAA 2RMKA 2YWGA 3IBGA 3JVVA 1A4RA 1XEXA 4MGIR 2V6JA 1YR6A 1CR0A 3D6TB 3RDPA 3GFOA 3BJIC 1SQ5A 1G5PA 1W0JD 3IDQA 1CJUC 4IDHA 1UEIA 2IYRA 4XSHA 3MWYW 5DNYB 4E07A 1E3MA 1S1MA 5LBIA 1C1YA 2P65A 5CIQA 3KKMA 3NEYA 3ZJYA 3SQXA 2NMVA 2CDNA 1Q12A 1R8QA 2WAXA 2L0XA 4MYUA 4LV8B 4JVNA 5DIFA 1NMYA 3GLFA 4KFSA 5F98A 1Q1ZA 5LDDC 4B2IA 3UATA 4Q47A 1QHSA 3F8TA 3TRFA 1KMHB 1NLZA 4XVRA 2HJVA 4ZDWA 4L5BA 1JPJA 1G4UR 2QMEA 2GXSA 3SYLA 3GLIB 3RS5A 2X2EA 4DCNA 2P5SA 3KKQA 1QZXA 2IS4A 3VX4A 2O52A 4TT3D 1ZNXA 2C98A 3PEYA 3K70B 2WKPA 3L82B 2HLDD 1Q21A 5L3RA 3W90A 1W49A 2W2VA 1E0JA 3SBEA 4A2QA 1NKSA 2ECKA 1AKEA 3BRWD 2GXAA 1NRJB 4R98A 4E22A 5JSZB 4DLTA 1HE1C 2RAPA 1ZUNB 4A0GA 1BYUA 2ZANA 3C41J 2VA8A 4FD2A 4F4CA 3OZXA 4BFZA 2O8BB 1A1VA 3HJNA 1U8YA 4JLOA 4YDSA 3RC8A 2F1IA 3THYA 4JLPA 4DLXA 1X8LA 5JRJA 1E2MA 1F2UB 1N3BA 4FMCF 3FHCB 4ARZA 4GNKA 3LAWA 2FZ4A 5BYKA 1E99A 3U3MA 2OCYC 3PEWA 5CB8A 1CJVC 1O87A 1N6LA 1OJLA 1W46A 2CL7X 4LBWA 2IW3A 3REGA 2NZ8A 4IDQA 3S1AB 4PQRA 2VPPA 4OHXA 3ICEA 1Q0UA 4DLZA 1PLJA 2F1JA 4KBFA 1J7KA 2IYYA 2RGGA 1RYFA 3C8UA 4NL4H 4PPQA 4Q1EA 4Q1BA 4TYPA 1Z6GA 3U7FB 1Q1EA 2XZLA 1T6NA 4KFRA 3T1TA 1IN4A 2V8OA 4HSEA 2D2FA 3MCAA 3VHXA 3AVWA 3U3RA 1AS3A 2DB3A 3BS4A 1M7BA 5IK2D 4Q7JB 1ESMA 1KMHA 3CWZA 2NO7A 1MR3F 4PANA 3KJEA 3HWSA 1G7TA 4RFSB 5B58C 1BMFD 1GRQA 2C77A 2QAGC 1NIJA 3NDPA 2WWXA 2DR3A 4GOJA 4QHYA 4A6PA 1DS6A 3BB1A 4FMDF 4QJ5A 2GAAA 1FPMA 2ERXA 1UKZA 2Q3HA 1M1YE 3CH4B 1M6NA 2V54A 3H2YA 1FTNA 4DLYA 2QPOA 3IO5A 4FINA 1ODFA 5FBVB 2WOJA 1TADA 3L2OB 4WAUA 3AF2A 3KQUA 4Q1AA 1FOEB 2CVHA 3H1TA 5H68A 3KUDA 5TDHA 4JYBA 3DOFA 4US2R 2AKYA 5KO2A 1KTVA 5FBRB 3C5CA 1XJCA 1Q44A 1Z08A 4OL0A 5L3SB 3VX3A 5CYOA 3IPXA 1G4AE 4QGAA 2WICA 3CX7A 4QXAA 2A3RA 5KDOA 2CHGA 2R6AA 4IKEA 4C0BA 3O8BA 4D2IA 1G64A 3IO3A 4AYTA 4F91B 1W4AA 5C46F 2JATA 2BIFA 1PLLA 1KO8A 2CHVA 2IYTA 2A5YB 3EIHA 2K5UA 3E5HA 3W6PA 1G16A 3E70C 2EQBA 3IHLA 4D4MA 1D6JA 3PV0A 2Z0MA 5C18A 2X19A 3A58B 1OYWA 3CNOA 1VDZA 1KK0A 2F43B 2WSSD 3A4LA 4ERNA 1AS2A 3OE7D 2CNWD 2V4ZA 3IIJA 3FWYA 2ZRAA 3A1TA 2HLDA 5C4MA 3BORA 1XCPA 3CF6R 2RGAA 2IC5A 1I4TD 5JFGA 2RGNA 5DYGA 4FCVA 1RYHA 1TAGA 4MYHA 1W4RA 2FE4A 4HLUC 3WXMA 2WKRA 2BMDA 3JZAA 1OH5A 1X3SA 3BFKA 2ZI5A 1EFRA 2J0VA 2GJ9A 3CRVA 4P32A 2TMKA 1COWD 3MGCA 1UAAA 5GVSA 3QOFA 2R44A 1RW4A 2D62A 4LHWA 1ZU4A 2QG6A 3DKPA 2ZJ8A 2XITA 4Q1DA 4ZCMA 4AKIA 2GXUA 2VP4A 4ZIRB 5E4FA 4MRNA 4A15A 1NLYA 3QY0A 2OT3B 3GLGB 1P9WA 5CLQA 3AVXA 2QM7A 1AK2A 4JLBA 1ZM9A 3ZS8A 2IYZA 5A5GA 2Z43A 2VSFA 2ZAOA 3P4XA 2GF9A 5TY0A 3QI2A 2HV8A 1XJQA 4IW3B 4LV6A 1ZCAA 4P0TA 4PHTA 2ZE5A 5FI0B 1WBDA 2DWQA 1D9ZA 2FMXA 3B82A 4WVFA 4BFTA 1L4UA 1CR4A 2PMKA 4UQOA 2VHJA 2BBSA 4UNRA 4LJ5A 4DDWA 4O3MA 1DAKA 4A0HA 5G3ZA 1W4CA 3OFND 4Q4HA 3FFAA 1DAEA 1RZ3A 1Z29A 4IFBA 3VKGA 1RRCA 1Z2AA 2IYUA 4HDOB 2ZI6A 3ND8A 5B57C 1GG2A 2CCGA 4EPXA 3PUZA 1AGRA 2PMDA 4M8NE 2XZOA 1E0KA 1EWQA 3CNLA 1OT3A 4DSUA 3C16C 2IBMA 4LSGA 3AVVA 2O5VA 4N1AA 1SVSA 1CJKC 3GJ8A 1GL6A 1XMIA 1QF9A 2RKOA 2JJ1D 4FXPA 5AUNB 1XPOA 4RKEA 3LLUA 2R62A 3PEVA 4QM7A 3AKCA 2J46A 1TX4B 3RABA 5DO9A 4BZXA 2QMHA 1SHZA 3MG9A 2GZAA 5KPDA 3U3OA 4RVCA 2OBMA 1H8EA 2A5JA 2EFDB 3CPJB 5DGXA 2Q6TA 4PFSA 1N6HA 2ZJOA 3LXRA 3REFA 2B8WA 2ZR7A 5TB5A 3MJHA 4G1UC 4JKYA 5CM8B 3JVUA 4KBGA 3ZS9A 4URVR 3P4YA 2OXCA 1KO4A 4NCJA 4RFVA 5DLQC 4FMCB 3OHMA 2B92A 4X8MA 1IN6A 1II8A 3ZVMA 1S0UA 3I1FA 2Z4RA 1UBFA 4PPFA 5EXTA 1G21E 2ZSBA 1NSTA 4IDOA 3QXXA 3GLFE 1E1RA 3IIMA 5K8UA 3LBHA 3WNCA 5KU1A 1G20E 1P3JA 2W6IA 2WMNB 2WJYA 4QBIA 3V4FA 4D0LB 1SVLA 3MSXA 4IJMA 4ON9A 4WOPA 4D4LA 1U0HC 4EFLA 5FR2A 5FPTA 1XFAA 5AJZA 4LPSA 4M1MA 1U2RA 2WPDD 4TQUS 4QGFA 3GJ4A 5P21A 4CDGA 3TQCA 5KDDA 2NPFA 3SHFA 4ZDIA 1KI7A 2Q9CA 3ZDQA 2J59A 4PC1A 3ZZUA 4B73A 1AQYA 2JGNA 2BBOA 3HDTA 3TVTA 1FQKA 2D74A 4TL6A 4KAXA 1YQTA 4CZ2A 3K53A 2QEQA 2WJJA 2KE5A 1RRPA 3CZQA 1E2JA 2HXYA 3M0EA 3NC1C 3QKRA 4UNPA 1KJYA 4YMUA 5AJXA 1DARA 4TQ9A 1OKKD 4GRAA 4DUGD 2VP0A 1ZU5A 2FFQA 221PA 1N5KA 4ACAA 2HT1A 2CLSA 2ZSEA 1GL9B 3UPUA 3RSLA 1LFDB 4OKSA 4W7SA 1N5LA 3THWB 1KSJA 2IYXA 5HTKA 3GEIA 4ZDKA 4Q4AB 2AHOA 1YZUA 3A1SA 3ND9A 2KB0A 4JLMA 4M0LA 3ZVRA 3SC3A 2OM2A 4DSOA 3EPHA 3BOSA 1JJ7A 1LTQA 2J41A 2MSCB 4MRPA 3T1VA 3B7GA 4FMDB 1UDWA 1OF1A 2QP3A 3BH7A 1DTSA 2ZRGA 1C4OA 2OO7A 4A0FA 3OE7A 4JLNA 3LVQE 4TLEA 2E1RA 4ASUA 5A4JA 4CF7A 2YYZA 4WZBE 2G6BA 3PUWA 1VYVA 3EG5A 2FFAA 4TQAA 1P5ZB 4HZUB 1FUKA 2B21A 2VBCA 4G5OA 2BMEA 2PEYA 1GITA 1FMLA 2FH5B 4MKIA 5DSZA 4A4DA 1LY1A 2QGZA 3LBNA 2G77B 2Z4SA 1KK1A 2HYDA 1OW3B 2ZYVX 1RKBA 1UBEA 2Z5FA 3L8ZA 1GP2A 2G88A 3CRW1 3PR1A 1E9FA 2VLIA 2D3WA 2VHQA 1U9IA 2ZI9A 1TNDA 3A6PC 4B3DA 4YMWA 4W5JA 3KXLA 4MDFA 3THWA 4GMDA 1EGAA 4UJ3A 3Q5DA 2OFOA 3LO5A 2CL6X 4NDZA 1DELA 1CIPA 1T8TA 2QE7D 3BXZA 5E7IA 3B78A 3CZPA 1P2UA 3VU9A 1Z83A 2DBYA 3I61A 1A7JA 1J2JA 2B8TA 2OCBA 2W2XA 3K9GA 4LJ8A 4C9BA 4JT2A 5FOTA 4OHVA 4B3BA 3I5XA 3EZ9A 2OLKA 2JLRA 2ZI7A 4O0MA 1N2CE 4IFEA 4B3GA 3I8SA 1JECA 1RFLA 2QROA 3PUVA 4A82A 4BLQA 3I73A 4YQFA 1OPXA 1KDPA 4S2EA 4GI7A 2GVZC 3Q7QA 2FGKA 4H1UA 3EZ2A 4HLQB 4HB2A 3SU8A 1R5OA 4AYXA 2O8DA 3M4YA 5C2JB 2IYLD 1WMSA 4C0HA 2J7PA 4GT1A 1XB2A 5E3HA 2C04A 3EA5A 2YKGA 4KLNA 4TT3A 5FI1B 821PA 1G8HA 3H4MA 2AXPA 4YC7A 3U4QB 1UEJA 4GOKA 4D26A 1CRQA 2HCBA 1KI8A 4DC9A 2AR7A 1MOZA 4NTZA 4G5SA 4GZLA 621PA 4OYHA 4JMPA 1D2NA 3CLVA 4PQYA 4RY2A 1CBUA 4Q9LA 1G3RA 3QBTA 1XTKA 1LS1A 2GVDC 5G53C 2F3TA 2KJQA 2V1UA 4IXNA 1DG1G 3NBFA 4XWKA 5FR1A 1TTTA 1Z0JA 3H0KA 4BFYA 4F93B 1FP6A 1W2HA 2A5FA 2F1HA 2RGNC 2PEZA 1KKMA 2VYFA 3NTUA 4FWIB 3R7WB 5HPYB 2HF8A 3K09A 3MMPA 3N2EA 3DO6A 4OHYA 1MH1A 5G40A 4BQSA 2RB4A 2WWHA 1SXJC 2VQSA 4LBVA 1AZSC 3QUSA 4YMSA 2J45A 1JR3A 2A30A 4IOLA 4O2RA 5IHPA 3Q3JB 1DOAA 2FDCA 4MDEA 1COWA 2O8FB 4Q1FA 3RLFA 2NO0A 4I4LA 4Q66C 1YZQA 4US0R 3EASA 3SYKA 3D3QA 2ZRIA 3MD0A 4KVAA 4D6PA 4M9SA 3WP1B 2O8CB 2V55B 1YJ5A 1WDTA 2D7CA 3NH6A 4M1SA 2CE7A 1E2KA 2ZXUA 3LRPA 1ELOA 4TZ0A 1R0ZA 4HAWA 2ZU6A 2WJVA 4NYJQ 2WTUA 2ZS9A 4BRUA 4FWTA 1MRSA 2F3RA 2ZJ5A 2WPDA 2W6ID 4B43A 2C9CA 4CGZA 3FMIA 2ZIAA 2XJ4A 1M8PA 2F1RA 1DAMA 3ADCA 3QSYA 1W0JA 4P31A 3RWOA 1SGWA 3VR5A 3LLMA 1X8JA 3IQXA 1OH7A 3MWKA 4HUQA 1XMJA 4PPGA 3AB3A 3CR8A 3B6EA 4DRZA 1ZM4A 3ZIAA 2XOKD 2A9KA 3T1OA 2CBZA 3N5CA 2UKDA 1QHGA 5EP4A 3KUCA 1FX0A 4EDHA 1U90A 1KO5A 4BFVA 2J9RA 3I4LA 3BAFA 121PA 2OXRA 5JWHA 2VO1A 3A37A 3KFVA 4ZPXA 3HU1A 3SI7A 2JEOA 4D4KA 1GNRA 3QKSB 3NXSA 5CK5A 1YE8A 2ZRPA 2C9OA 1YRAA 4OJKA 3TLXA 4DJTA 4CT5A 1E2NA 2ZTSA 4GOXA 3PENA 2R6FA 4NKRA 1P9RA 3GJ5A 2O8DB 4JS0A 3AKDA 3C4JA 3NBYC 2DWOA 1E98A 2VF8A 4LK2A 2XOKA 1PJRA 2ODWA 4Q4AA 4V0NA 3RC3A 2BJWA 2FFHA 4HATA 2AWOA 2H7VA 2JJ1A 4Q4LA 3SBDA 3GJXC 1YR8A 4C0SA 4Q1CA 4CEHA 3O8DA 1P2TA 3DZDA 4DXAA 2I3BA 4LHZA 4C7OB 3LX5A 4NYIQ 4PC2A 5HE9A 3CB4A 2V9PA 4AKEA 4NHOA 1G3IA 5KHOC 3BGWA 3KDSE 2BV3A 2W0SA 4LGMA 5EE3A 1B23P 5JJIA 4URXR 3SZRA 4OQXA 1QHIA 5BN4A 1ZCBA 1X1RA 2H17A 2XXAA 4TZ6A 3MWLA 4V0KA 3O8CA 2JDIA 4EPVA 4BZQA 4C3ZA 1P60A 1Z63A 3VHLB 2XSZD 3SEAA 521PA 4DWJA 4L4UA 3NC0C 2C9YA 721PA 3NIBA 1E0SA 2V6IA 4TWZA 2G9NA 1WF3A 1L2TA 4EPTA 2GZHA 1W47A 1CS4C 3CBQA 1OFUX 3IIKA 4IVPA 1OHHD 3CF2A 2QRNA 1LV7A 4G5RA 4HB4A 1RC8A 3RNLA 1IM2A 1KI6A 4JLVA 4Q4JA 5J5CA 2WSMA 4AKHA 3GEEA 4PSKA 2YZ2A 2WZQA 3CIOA 3BB4A 4RZXA 2JDID 4KSBA 4QJ4A 4TMTA 2FNAA 4RFSA 4JVSB 2J7KA 2WSSA 1HE8B 4MYCA 3WP0A 2YHSA 1AS0A 5GJBA 1XXHB 2BEKA 2AK3A 1E1QD 2OE2A 2FU5C 4D0NA 3FKSD 5JEEA 1N25A 4IVQA 2FPKA 3SFVA 4GSYA 1TF7A 2VIIA 2Z83A 3HR8A 2IYSA 2VP6A 4FI3C 4LUCA 1GAJA 2GJKA 1XEXB 3THXB 2IUTA 1GVNB 1VG8A 2KSQA 4NMMA 4CIDA 3K70D 1GL7A 1M2OB 2WJHA 3QG5A 3Q8XB 1TQ6A 2LWIA 2EFEB 4GP7A 2Q21A 5TVKA 1J90A 5ELXA 1UM8A 2QE7A 4LRWA 1TF5A 4Q9IA 2GCNA 4HZIA 2DCUA 5CK4A 3X1XA 1JQLB 1SVWA 1U98A 1N6OA 2OEPA 3LWNA 1BMFA 1V43A 2GEVA 5KNBA 1TMKA 3RRMA 4OQMA 1TUIA 1Z0IA 4RKFA 3B1VA 3OESA 1P6XA 3LVRE 1Z6XA 4I1UA 1HV8A 3DPUA 1MABB 1N6PA 2BVNA 4PSVA 1O3YA 2C99A 3UIEA 4B3XA 4BLRA 1Q20A 2ZYWX 3EZFA 1CTQA 5AJVB 1W5TA 2O8EB 4PC3A 1Z3IX 3DM9B 5AJYA 3WHKA 1R10A 2FV8A 3W3ZB 2YOFA 4HLUA 1UBGA 1VKJA 3M1IA 1OFHA 1H65A 1TPZA 2KBEA 4N0DA 4A2PA 2Y8EA 3L0OA 4BLTA 1F60A 3K0AA 1HY3A 4EKDA 2QZ4A 4RD6A 5L3VA 4OBEA 1NY5A 4UXJA 1U8AA 2QTHA 1IN7A 2W00A 2ZS7A 4M53A 1M74A 4ZCLA 4QG7A 2O8FA 5E7JA 1IN8A 2Q3MA 1SKQA 4DLRA 3BD9A 5DI3A 3K9HA 3FFBA 3SFZA 2CMKA 4CW7A 3GFTA 3FTQA 1GDDA 3QXCA 3OIWA 3F5FA 3CX6A 3ADBA 2DWPA 5AK0A 4DHEA 4GP6A 3SQWA 1TUEA 3TE6A 1R7RA 2BM0A 2BKEA 4LJ7A 4QNRA 3BERA 4UJ5A 2IWRA 3GLIA 4TN1A 3O8RA 2D2EA 1E2HA 4Z8XA 3FHTA 2DFNA 5FTJA 2ZRLA 2ZJ2A 4NYMQ 3KKNA 3T15A 1YR7A 2QSYA 1DG3A 2YVUA 1MO5A 4QL3A 1CJTC 2ZJYA 3AF4A 2BBTA 1Y63A 3NWJA 2FFBA 2BHRA 4ZDJA 5GJCA 4HB3A 2DFLA 5DN6D 2EFGA 1KDTA 2ZEJA 5KDLA 1VYUA 4B32A 1KSGA 3GLIE 1JJVA 1JALA 1N6KA 4OQNA 3WMFA 3ZD6A 1NG1A 4HAZA 1KDRA 3CO5A 3EWAA 2PJZA 4A8JB 1KI3A 4F38A 1VCIA 2YWFA 4DUGA 3I8XA 1R0WA 4Q00A 1KJWA 1KSHA 1YU9A 3CNNA 2OHFA 4MRVA 5E95A 3LA6A 2UVQA 3GMTA 2D7DA 1LVGA 3K70C 1CF4A 1XTSA 2WWGA 1E2DA 3RANA 2HT6A 1G5RA 5A0FA 2YWHA 1G9XA 3AF0A 1XPUA 1RRFA 1KIMA 5BYJA 3ECCA 3Q7PA 1YZKA 2RGBA 2RGDA 3AEZA 3TSWA 4G5GA 2HCJB 1DE0A 1K6MA 1T3HA 4OK5A
chains in the Genus database with same CATH superfamily
4IAOA 1FJHA 1ZM3A 2JAXA 3VNUA 2XUHA 2QRJA 3PHBE 4DREA 2ORWA 5K4GA 2QTVB 1CU1A 3AP3A 4N3AA 1T8SA 4G8JA 5GOZA 3VDRA 2R9VA 1VECA 4XOUA 5B1IA 1AKQA 4S2UA 5BV1A 2O54A 3UMFA 3TNFA 1E2LA 1YMQA 1CKEA 4NG5A 2PA3A 4LRSB 1OTXA 4Q3CA 2NYVA 3QKSA 4L2IA 4R01A 5AKXA 1UWCA 3VR1A 4D3SA 1JTVA 3ED5A 1L4NA 2NIPA 3LQ2A 1BZYA 1UF9A 1TLLA 1I5OA 1A8IA 2C2OA 4I1SA 2C54A 1PR3A 1E2QA 2LCFA 2WAYA 1HNNA 4K6MA 4Q48A 1TZKA 3NEJA 1W44A 4TWIA 1FP1D 1YZVA 1SXJD 3MEQA 2Q0HA 4LMBA 2RAUA 5AUPB 2I2BA 1P7YA 1R37A 3GUYA 3RAEC 4EA7A 2BFPA 3GUCA 2OFWA 3DDOA 3VJKA 3TBKA 1YRHA 4HGPA 4AL4A 1T15A 4Y0NA 1Z6AA 3UCXA 1EDEA 3U2QA 1LPSA 1UZAA 4H6VA 2GK6A 1CE8A 3PPYA 2MSEB 3LPNA 4ZOAA 3SJZA 2XUFA 2PL9A 1K66A 4AK9A 3BK2A 3AJ8A 1QRSA 2QX9A 4PIPA 2B4YA 4JROA 1UXHA 4QPNA 4Q5IA 2PCJA 2YOHA 1RNLA 2ZYHA 5IASA 2PKRA 5ITWA 3W6OA 2Q5EA 1P2GA 4QGBA 3T5AA 4ERXA 2PX6A 2WAOA 4DQUA 4WUVA 5AI9A 5EQDA 5JAZA 1NUAA 3B1XA 3MRVA 3TKLA 2CV0A 1P91A 3RS4A 1ZN9A 3CRRA 5FUMA 5J5AA 1XTVA 1BHSA 4C2TA 3LRTA 4EPWA 3OZ7A 3L0SA 3AJEA 3CS3A 3SC2A 1O77A 1G7SA 4JP2A 3ZWWA 3B1JA 1Y9AA 4NYMR 5DISB 1SBQA 1W0CA 3L8FA 1G291 2NX2A 1L8LA 3CFYA 1XVIA 4BMNA 1NXTA 2MR6A 2HA4A 2ZWAA 3OUZA 3EDQA 3ONDA 3HMKA 7ABPA 5DYYA 3KZOA 3D2LA 1LJLA 1V2HE 2PUHA 3AILA 3F74A 3O7WA 5EIFA 5LLDA 1SXHA 3OFNA 3D8UA 2H2HA 4H08A 3RYCB 4NPCA 1P29A 4WD3A 4ER5A 2ZRBA 3RS2A 4JQZA 4EUNA 5KYXA 3P9PA 1DC8A 1E4EA 1HC7A 4AIRA 1XWWA 4QOSA 2I67A 4TRNA 3AC0A 2AC7A 5FEMA 3X1YA 3KCNA 4EB3A 2QTNA 1P6UA 2RHDA 4RE5A 3Q7TA 3RRXA 4U7GA 1KDZA 4LJ4A 1U6IA 3RYHA 2J0UA 1H6CA 4XGNA 2QL9A 3B8HA 3HP1A 4RIHA 3JY6A 3AUYA 1NAHA 4TS9A 1KBOA 1LW7A 2R65A 1YZTA 2XCIA 3VZBA 2O8NA 3FPKA 3JSXA 3OBBA 2HK8A 4X95A 1MEJA 2OCAA 1QHFA 4KTVE 5TE9A 4Q34A 1QLHA 2OG2A 4MR7A 2P35A 4O4HB 4ZFNA 1LC0A 3UAZA 1J2TA 3DHWC 2FPIA 4G26A 4M9QA 4MI3A 3R0VA 4JUFA 1YHZA 3Q6IA 1C7FA 4QUEA 4IV8A 2BL4A 5AK3A 2YZKA 5EP3A 1IM5A 2Y1DA 4LRUA 4MA4A 1EP1B 3PTZA 2L69A 3SN6A 3BQNB 3DLTA 4OYRA 3SS8A 1EGHA 4K3UA 5B3JC 1DHTA 4WA8A 4IOKA 1CC1S 1JHQA 4U3JB 4UULA 1G9SA 3UB3A 4J1NA 1W36B 4S1OA 3AEKB 4QU5A 3SAJA 4AI6A 1NBME 3H65A 3SXUA 4DRXA 2V58A 5D8DA 1GUZA 2OV3A 3ESCA 3KJIA 4M9RA 2VP9A 4DY6A 4OQLA 5IEJA 2I22A 4C20A 1P62B 2WVHA 5EYPA 1EK0A 1SA0A 5BNIA 2XTMA 1QJCA 1Y8AA 2IOHA 3NBXX 1YR9A 4MITA 4J49A 4ZQCB 1ISMA 1KHTA 1RBMA 1ECPA 2W2TA 3PK0A 4MJXA 1VRWA 4Y9RA 4D82A 2ZRMA 3G89A 1V2GA 4TVOA 3E22B 3AU8A 4PO1A 5LN1A 1GZ3A 3JD0A 4E12A 4R1TA 3EC1A 1NM5C 1JLMA 1J99A 1QPGA 4TMXA 3HC7A 4M1WA 4LHEA 3QPBA 1QGUB 1NBMA 2WP0A 2CFOA 5FOSA 2AG8A 5SZHB 3UK7A 4D9IA 2E4VA 1VG0B 1XEWX 2VYVA 2ZUUA 4XX0B 3BJMA 3W3AH 2VS1A 4NH0A 3DUFA 4F8EA 3JWEA 2I4OA 4O1HA 5AIAA 3U3KA 6Q21A 4LF8B 5TPZD 2CEKA 2EU8A 2B6HA 4YUWA 1MA3A 4J16A 1KPIA 1PBTA 1XMVA 2A2ZA 2C0PA 1GXSB 1Z6ZA 2RGEA 4JGGA 4X5OA 4FOSA 3CB2A 1DMRA 1VHLA 2L42A 1ND5A 3EXAA 4ABTA 1X7YA 3KAQA 4Q6WA 3I4FA 2LE0A 2MSWA 1WQ4A 3AONB 4YIHA 3PC8A 4RS3A 4UTOA 2XCRB 4R71A 1R6XA 3B3AA 3K4HA 1PGNA 1X14A 1X7GA 4HTAA 2GN6A 2WTXA 3C70A 4I50B 1C1XA 2PX0A 3NNSA 4JBYA 5FLKA 5SV2A 2OQVA 3MJVA 3RYFB 4PN3A 2G8LA 5AW6A 3K9CA 1OZGA 1FRZA 1WXHA 2XE7A 5FWNA 2AJBA 1L5KA 2FMUA 5ALDA 5K2MA 1KO1A 1P7PA 4EJ0A 3R3SA 3KSUA 2FXVA 4H1VA 5AVZA 3AVYA 2ID9A 4DS3A 5K3FB 3GJYA 3U6KA 2HRBA 4WFJA 5I5EA 2VYVD 2J8ZA 4N5IX 4RSMA 3PA8A 4NX2A 1GILA 2BISA 3HSKA 3T34A 3TZEA 4EY6A 2Z5GA 5C35A 4CM7A 2N46A 2BFDA 5JDIA 1IU9A 4CUJA 3I9MA 5IF9A 3VVLA 1N6NA 1K9SA 4WV3A 2GARA 4ITUA 4HXFB 3VUEA 2HHJA 5KNDA 1VIVA 2XMZA 2X76A 3PFWO 5I9SA 3IEMA 3E0QA 4L9RA 3ZIAD 2B25A 2BBWA 3PNMA 2H1VA 4KI0A 1HQKA 5K5EA 3DWIA 1EFTA 3OO0A 3GAMA 4TVKA 1ES9A 1E1CB 2X3FA 1ULBA 2PKYX 2W48A 4XI9A 2I78A 5FUWA 1WTAA 3LFUA 3HA2A 2C31A 2PRZA 3JYLA 3KCQA 4GKBA 5JVDA 1GTJ1 1NVAA 3AEXA 4R2IA 1MO6A 1R0YA 1RXIA 3JS5A 1T8WA 1X13A 1XFDA 2A4MA 2PH1A 3MINA 3KVYA 1SZJG 4P36A 4XOIA 5D3MB 1BE0A 3ACCA 3UHOA 5HUQA 1EM6A 3B20A 1QYIA 1R16A 3AF3A 3W5DA 4LPKA 3DE1X 2FRDA 3S1AA 1IXKA 1XP8A 2QLJA 3LCCA 3R0XA 4D8YA 2IBTA 4B44A 1TK2A 4Q9KA 1UL1X 4MLDA 3A9TA 2PNJA 1I7PA 1YDGA 2ZS8A 3EQ9A 5JSKA 4ZQGA 1MT0A 3QIAA 5A4FS 1LDEA 1B0PA 2PXHA 5IXSA 4L1KA 3I5UA 1ID1A 2DX7A 5ED0A 3EIWA 3ZJVA 4V2UA 5JZBA 3EODA 3AR3A 1J2EA 1G8YA 3PTAA 1OU4A 2HDNB 3GT4A 5ALVA 3UOWA 4M2LA 3EFOB 3WHLA 4JU8A 2NU7A 3RC8A 4OI0A 3WSVA 2V6BA 4YCAA 1TLFA 1JLLB 3AJ9A 3CN9A 1F17A 1VIMA 2IITA 3GBSA 3IV9A 3MUFA 3QVOA 4BO7A 1AOXA 5KZMB 4YAJA 3L4BC 3MSCA 2NADA 2JLVA 3AINA 1Z4JA 4HBZA 3O8OB 1OLUA 5SYMA 3UICA 2B2CA 1E1KA 3DVAA 3IX7A 3T9EA 1WD5A 5BN5A 2NOAA 1ZWLA 3C5VA 3FBGA 3R0JA 1X7WB 3WKEA 2IYNA 3EZ6A 3IULA 4IIBA 4NCIA 4GYYA 4ZRDA 4CLHA 4D45A 1QGED 3SFTA 4CKEA 4AM8A 1ZD4A 3AGPA 1OXXK 5LXTB 2EFHB 4GPD1 2Q7XA 1KMMA 2VR1A 3CLRC 3OOWA 5ALTA 3UV7A 2HMVA 3NIWA 1AKUA 4E32A 4FGUA 1Z4OA 4BQEA 3RYTC 1QCDA 2RB5A 2WMOB 3BFPA 3DVSX 3LQFA 4PZLA 4C7BA 1K4KA 1XZJA 1TM4E 1CHDA 1AKYA 2A9PA 2P91A 3D8BA 3MELA 1JKMA 4KSYA 4S3MA 1L3BA 3DGFC 4AJPA 4BO1A 4I1VA 3HKEB 3ELYA 3JZDA 3A1DA 1Z8HA 1FMFA 1Y4DE 2JLXA 2ZYTX 3ESZA 1Z34A 1M75A 3NWPA 2WJPA 1XJ0A 4WCFC 2QXTA 3EW7A 2P9GA 4MICA 2FYTA 1XN1A 2ZP1A 1JGTA 3PGKA 1NW3A 4MS3A 4RJJA 1DO2A 2JH8A 5THQA 3TW0A 4DLPA 5L3SB 4PHGA 4S05A 3CE9A 4HX9A 2B30A 1PJBA 4DC0A 3H5LA 3AV0B 5EESA 2O2EA 4CODB 1T0UA 3EQ2A 3M7IA 2HADA 1XEAA 3BUSA 3NAQA 4P7FA 1JE1A 2I5PO 2JAWA 1N3YA 4LGYA 1G55A 4X8OA 1EJBA 4CETA 3HB4X 1KQPA 1I1QB 1NPYA 2QF7A 3D31A 3AFGA 4OHMA 5G41A 5BY2A 4PXYA 2EDCA 4EG7A 1ZD1A 1PL0A 4EO4A 4F8JA 4JUCA 3MJTA 4FI3F 4HWOA 5KYVA 5FH9A 3RBAA 4NBVA 1Z5WA 3QM1A 1A9QA 4QJBA 4NJOA 4FZJA 4BAGA 3SP1A 4ILKA 4B6SA 4RQAA 3KT6A 3IMCA 3E53A 3TR6A 4ENTA 2EWWA 3B53X 2XE4A 4XIYA 1YULA 5J40A 3WGKA 4UU7A 2JFFA 3QE3A 4CKYA 2DY0A 3EVDA 2AN3A 3AUXA 4NBRA 4X94A 4YGXB 5JPDA 4I6EA 4L8VA 4PNPA 1YMVA 1MBZA 2VKTA 4I4TF 2Z3WA 3RHFA 1VYTA 1M2NA 3UMVA 4YP0A 2IIVA 2Z8ZA 4RIFA 5IP5A 3W9YA 4BPBA 5CLHA 2EJTA 1RIFA 4G65A 5FDFA 1ZI9A 4FFNA 4UZFA 3AW9A 2WVJA 1CY8A 2OCLA 4RYLA 3TYXA 4LYYA 4B3RB 1Z06A 1H0RA 3N0TA 3PVCA 3GNSA 3G2HA 1AT1A 4JK3A 2P9ZA 1R9MA 3C1TA 3G02A 4Q24A 3ID6C 4LVCA 2O0HA 1GKUB 2XDQA 1PTKA 1QB7A 3OC6A 4BVAA 2NZYA 3G2LA 3BRQA 2HMAA 4LX0A 3LV8A 4QELA 2V1XA 3SJCA 5KYKA 2IS6A 1BWRA 4QYIA 2J0EA 1D2EA 2X8BA 3CX8A 3QEOA 1DEKA 1FRQA 3EXIA 3SZMA 4E88A 4EF6A 2BONA 3AKYA 1DFIA 1ZC4A 4P83A 1NTOA 2VVTA 3DHYA 3FVTA 1E9AA 3DVAB 4XRRA 1NI4B 4DG5A 5FWYA 1WE2A 3RC1A 1N0WA 2JS7A 4D3XA 1UINA 2MWMA 2DAPA 3FZEA 4XX1A 3KYIB 1RKUA 3QJGA 3WK4A 3R9XB 1H8HA 4XJTA 1NHGA 4EBFA 5AW7A 1GFIA 4P86A 4QHTA 3ZE6A 1SUIA 2II6A 4L76A 2REBA 2NXJA 1FX1A 3L9XA 2PYDA 2BYTA 3ASYA 2SKCA 4JI3B 2PGNA 3FUCA 3K0SA 2DUNA 4B3TB 4PQFA 4LHYA 5LZ7A 3HCBA 1QE0A 4ROSA 2O2GA 3E9MA 5DGDA 3PFCA 2YXPX 4P58A 5DI3B 2V45A 4DWOA 3LQ4A 5PGMA 2QL6A 3FPBA 3GCGA 3GG9A 3QWIA 1N2GA 1O89A 1X38A 3N9IA 4YGYA 3MHTA 2QP4A 3RC9A 4OYYA 3IUEA 2VWHA 2JHPA 4G23A 1H5UA 3QXGA 1QM5A 3WL5A 3A9SA 1WMBA 4G5XA 4II7A 4JBXA 4UM7A 4TMZA 2IV7A 2ONJA 3GDFA 4C3UA 4OATA 4RVSA 1EXDA 3VSBA 3IPLA 3I42A 1VSQA 3G2QA 3TQSA 2AT1A 2V7WA 2FWPA 5KOYA 2ZUBA 3HBLA 3UAXA 2P1RA 4LZLA 4KW7A 3GPCA 4JLKA 5CJ2A 1OKKA 2F64A 2LIPA 3A6HA 4P4SA 4U6NA 4IY1A 4TLMB 3RSCA 4BNLA 1WY7A 3UWOA 1GPAA 3KBOA 5FA6A 4EABA 1JIVA 3T41A 3BULA 5CB4A 1A8SA 2H4ZA 3LUKA 4OHRA 5LLSA 4ZJZA 3IE1A 1SUPA 5EI5A 2VNIA 1Z5VA 1IHDA 1DAHA 2PX3A 4FXOA 2GJ4A 1ISHA 4BVLA 1N0VC 4HDQB 4B84A 2R8RA 2JBHA 3PI7A 2XNDA 3H75A 4J91A 4LWPA 4KXMA 2IYWA 1S9HA 3LDUA 4YY3B 1ODSA 2QRVA 3I5YA 1K98A 4YJFA 2QIPA 4JXKA 1EWKA 1YB7A 3BSFA 1KMNA 3MTAA 2PPLA 4BC0A 3PXUA 4F3RA 3GZNB 4GHWA 1P9NA 1YZFA 2WIAA 3C3KA 1GTG1 1XKQA 1T6YA 1E9DA 2IU0A 1C1HA 3L4SO 4EUHA 5GZ3A 3BTSA 2FG7C 3GJZA 4KQFA 5C52B 4B5LA 3IVCA 1E92A 3ZU5A 1R0RE 3U1VA 4RD3A 3MBKA 2ZWOA 3ANTA 3LKBA 3TZLA 5AM0A 5ICMA 2FSVA 4D9EA 4P81A 4NBWA 1KQNA 4JA0A 4Z9BA 3T0GA 3ACDA 4WINA 3INGA 3IP3A 3NMUF 4K9KA 2DT8A 4BB9A 3H3JA 1EDDA 3KVVA 1XXHA 1NI4A 2P4UA 2V96A 4CR6A 2VT2A 1QFZA 1XWIA 1ZM2A 4LE1A 5DYNA 3RIHA 3TXXA 3BREA 4HR7A 5M2QA 3IL2A 3DOUA 3JZIA 2C3PA 1SVKA 3H5WA 4QG3A 2FQWA 1QO0A 2PG3A 3DL7A 2CXUA 3TQTA 5DFAA 5AOVA 2ATEA 2ARKA 4I4TB 2WU1A 2H2WA 1N9GA 4KR9A 4FSDA 4PTLA 2CVFA 3VPAA 2ZUDA 5LD2C 1HDXA 2V74B 3P1JA 5GQSA 5IVHA 2HDHA 2YBEA 4FE4A 3ZGNA 3HKBA 3ORSA 1FNMA 1R5BA 3FUUA 3MCVA 2QYOA 3RF7A 2Y0DA 5J4KA 3SXJA 2P1ZA 4KDFA 1I2MA 2H57A 3EVEA 1OLXA 4MH0R 3QPDA 5JWOA 3RRNA 7AT1A 2DQYA 2IW1A 4GR9A 3DZ8A 3AMVA 2YWCA 2UZ3A 3BMOB 3EZXA 2C96A 2ZBFA 2IXAA 2VJPA 4XCXA 3C0KA 1AA9A 1AQ6A 4J0HA 3S0JA 4CM5A 3VFDA 5TARA 1D7OA 4IDNA 5TGDA 3BD6A 4J3JA 1E1QA 4RVFA 1NN3A 1RJEA 4B17A 1I13A 2P77A 3TR5A 1QFMA 5KSZA 3GQVA 1YQQA 5LYJA 2BMWA 2HGZA 2OHHA 1K6XA 4KR6A 2QBYB 2XAUA 2GKSA 4RW0A 4EG8A 2P2LA 4OQ4A 1L9KA 2X5OA 2PWZA 4RMNA 5DBGA 4RCZA 1ZVJA 2YC2C 1FU7A 3KUUA 3NPMA 3GJ7A 4ZJPA 5G0TA 1B8OA 3FDIA 2AHRA 2H00A 3IKMB 4J43A 5FL7A 1YJ8A 1KBZA 4M1QA 4QXPA 3SIWA 2J3KA 2ZVJA 2AN9A 3GN1A 3VPSA 3ZKWA 4BASA 1F5SA 1WUJS 4MYTA 1E1MA 3HTXA 2ZVDA 2W7TA 3TK1A 3ND6A 4FYWA 5EXXA 5HYVA 1S3GA 1C7QA 2CNBA 5EN4A 2IUYA 5ALYA 2OSBA 4Z7QB 1JR3D 3IP9A 3VPDA 3AGQA 4ECAA 4A36A 1UBKS 3SSAA 1EK2A 4UKDA 4BKRA 2A35A 1E4YA 3N7TA 2V0NA 5FBWB 4HY3A 4LY6A 3MJFA 4ND8A 3WKBA 3LW8A 1QCCA 5CT9A 3S6JA 4JC4A 3THOA 1PQYA 4YRKA 2YQ4A 3U4GA 4FHEA 1VKRA 3OX1A 4X41A 1QQBA 1W85B 2CJYA 3KJGA 4QULA 4K87A 3R40A 2DHDA 5TSDA 4UUMA 6PFKA 2WTMA 1U3DA 1N3LA 4HN4B 1E7WA 2HF7A 2PGJA 1MC4A 4GM1A 4J6EA 2CWDA 2GHQA 5TQ2B 3CX3A 2AE1A 3GLVA 3OO1A 5EZYA 2V4MA 3EBOA 1E63A 3QQ5A 4BKPA 1UT5A 5AQ1A 1E2PA 3OEED 3V4SA 4LBZA 1ZOPA 1HKUA 2BR3A 3DMGA 1QDEA 1J2YA 1M72A 1AHHA 1V5IA 2G40A 6ADHA 1QDUA 3BBPA 1TEHA 2AD1A 1E9VA 2WDZA 3MLAA 4JLDA 2IOYA 2JI6A 1JNXX 4DYVA 4EVRA 2POCA 3DAHA 1JNYA 1UFKA 3UT5A 4K9QA 3M4XA 1NF3A 2BC9A 3LS2A 4WY5A 2CVZA 4EJSB 4WPGA 3GEMA 4RORA 5KNCA 3PS9A 5JHHB 2AD5A 1XL1A 2GB4A 2HF9A 1RLTA 2ORED 5AW1A 3ZY5A 1IAVA 3PUKA 1JL3A 1ZIYA 3HBJA 1XXLA 1R4MB 2VOJA 4Z1MA 3FFTA 2OWDA 3HABA 4HD8A 2B8NA 1T25A 2PKWA 4QQRA 1QVVA 2XVZA 3R6LA 3RREA 1FMCA 4DDTA 4UM9B 5J2UA 1MGPA 1EWRA 3THXA 5I7SA 2R7MA 2CDRA 2VLBA 4M0PA 1D2GA 1EVYA 2XUOA 1XHEA 2DFKB 1CRWG 2JCVA 2HA0A 4KN5A 3UAVA 4P4UA 5JCZA 1X19A 5EKXA 1E2GA 1U7HA 1XRJA 3H7IA 2QM0A 1T5IA 4W9RA 1C7JA 3DV0A 4K8OA 3RSZA 1LTKA 1U0BB 4I6GA 1HLDA 4RHXA 1CY0A 3C4VA 3ABIA 2OD9A 1PFVA 4D0GA 5AKYA 2OBFA 3I09A 3M6AA 4J29A 5AM5A 1EGQA 3CZCA 5JH7F 2GPWA 4EHAA 4JSRA 1U9CA 4PQEA 4MUXA 3HGMA 1PZNA 4K1LA 3NIFB 4FFWA 4RF4A 3QJYA 4XLTA 3T7KA 4HLCA 1C4KA 4OGGA 4JGIA 3PUJA 2R8EA 5B53A 2V9CA 4G41A 4Z8YA 1LBTA 1PVOA 3SHQA 3OEEA 2FPLA 3L43A 3R5FA 4GZ3A 4J1QA 4ND4A 4O6VA 1JQAA 3OLWA 3F3YA 1NC1A 1KKLA 2AS0A 2EHDA 4CV3A 1HURA 1FTQA 3CV3A 1JAIA 2RI1A 3ZWKA 1QANA 2GCGA 4PX9A 4BUZA 1KR5A 3SOPA 1NBMD 3E7FA 4LAFA 5B5SA 4C5BA 1WAMA 4HJXA 4ZO6A 3AL3A 3Q72A 2VBIA 3EG9B 3ENQA 3M6FA 5BOSA 1RYNA 5B3LA 4G9EA 4I9NA 3BC1A 1OTHA 3GCXA 5E7MA 2NTJA 4JLAA 3C48A 1E5LA 2NV6A 4QVIA 1RWWA 4NCKA 4V1CB 5GPBA 2RGXA 3FKSA 1F2UA 2IHNA 3JARA 3R5HA 1USKA 2YNMC 3QITA 4NFHA 3UTCA 2NZJA 1ZN7A 3HU2A 2ZBVA 2VXOA 1PNOA 2V7QD 4WDRA 2P9CA 1NN5A 1IY1A 2X86A 3WLHA 2W6JD 4MVJD 3UC5A 1E61A 1NVTA 1V26A 3FDZB 2BDUA 2HMUA 4TN5A 4YFYA 1UMCA 1JDUA 5D85A 3AF1A 4LE2A 3UK0A 3GGPA 4KXXA 4EKYA 1DVRA 5CM2Z 3TN7A 4TLDA 2GBGA 2M32A 2O5CA 5H80A 4PZEA 4DCGA 2Z1NA 3CU5A 3SY8A 2WAMA 1Y6RA 2JHAA 4XWAA 2W8ZA 2P11A 3QXHA 3KTAB 2CLOB 2VP2A 4MKGA 2WM9B 3X1DA 5JU6A 3GD7A 4J0QA 3UCFA 1W8IA 2A1UA 2E21A 3L8GA 4KR0A 3ZGXA 3P0HA 2HPHA 3PQ7A 2JFNA 4RHUA 1V5GA 3R5XA 4WWHA 3WGZA 4EGJA 1L1RA 2PM8A 1BJTA 1U2SA 4OLHA 2YVKA 1BIFA 5A2GA 4YO8A 1LXCA 3FOBA 4RVNA 4CDNA 3KIPA 3WBBA 1SU4A 3U44B 1CEYA 2B7CA 2AMFA 3PA6A 3ZLTA 1ZRSA 2F3QA 1GZUA 1ECFA 1KSFX 1C0IA 4KN6A 2IV3A 2EJCA 1SKYB 1IUPA 1ZITA 3N6RA 3ETEA 3W1EA 3M5PA 2F1KA 2PWBA 3FCXA 3OAAA 3OPMA 4BEBA 1EUQA 3ROTA 1NM5A 3Q7EA 4UPDA 2EBUA 2X41A 4K46A 4BECA 2QU7A 4Z49A 5E1MA 5DMHA 5KJ1A 2CFCA 1JEDA 1Q0HA 3R7AA 5JJKA 3PNYA 4K9NA 1OZHA 4WBNA 1NN0A 2OCDA 1QOPB 2YRFA 3R5KA 4RKWA 3FSGD 3TTSA 5LA6F 3GNTA 4WZBA 4EJSC 3STVA 5FOUA 3JVDA 1KI6B 4ZTZB 3FMOB 4WL0A 5FKJA 4Y2SA 1KDVA 1PGQA 2AR9A 2RBKA 4MUMA 1COZA 1PK8A 1XX6A 3ZQJA 4EFMA 3FPJA 3I01M 4V0SA 1GQFA 2EGHA 3DAFA 2QW1A 3KKOA 3U44A 1D5WA 2YFHA 4HVAA 1AGYA 4X63A 4ESHA 1P1JA 2A9FA 4JT4A 4QDTA 4X3CA 3U4CA 1M2WA 4H4CA 4JYZA 1RWPA 1T6ZA 4RHCA 1IOZA 2GTPA 4P8RA 2OBLA 4KIUA 3O94A 3R6WA 4RL4A 1QAOA 5L3SA 4RX1A 4B6EA 4EB8A 1A69A 3G5UA 5HKAA 4BFWA 4NS4A 2KMLA 2Y99A 3ML1A 3GLRA 4E5SA 2I2FA 4B9AA 4FNGA 2VDKB 4IKPA 4JX8A 4EKIA 3COZA 1RYBA 1TA9A 3FR7A 5LQKA 1UBTS 3WLNA 3IQDB 1PNTA 4HN9A 4ZT5A 2P8JA 5E0OA 4OHWA 3B9PA 3NGLA 1EP9A 2XQGA 3PCTA 4TUYB 2QENA 5JCPA 4KFUA 4KJXA 4RENA 4KTTE 3V80A 3T5DA 1W0KD 5KSYA 4LYHA 4DR5B 2DSTA 3JQFC 3V8PA 3W8RA 3WWZA 3ZYZA 4QC2A 4ZVSA 1IJBA 3K16A 1X7WA 4A2WA 3N70A 3JARB 3BE6A 3S7ZA 1HLGA 4G5FA 4N7JA 2XUDA 3U1BA 4Z53A 2QN6A 4QVGA 2WUFA 3ZDAA 1NW8A 4B3HA 4FNOA 1U9YA 2R4UA 4REMA 1JR4A 4GMHA 3CJQA 3VC2A 4LYFA 2VNJA 4P34A 2P9TA 3P45A 5JATA 3TSOA 3ZD7A 9ATCA 2MIIA 2YN0A 2O8CA 2H2IA 1RYZA 1FLAA 4PR0A 1PHPA 1VE7A 5LJLA 2J3IA 4UVGA 1YBMA 3DOOA 4M83A 2PUWA 3KP1A 4LRYA 3K15A 1LKZA 1Z4NA 1DGQA 2YIVX 3I04A 1ZGJA 3X1MA 4V0ME 3WRXC 1CEEA 4R2JA 3TQFA 5I4BA 2WVAA 4DUYB 3CHYA 3C14C 2V7TA 4JQSA 3LOUA 3GFPA 3R41A 4M1YA 5I4KA 2A0FA 1ZR4A 1ZKDA 4QM6A 4RPLA 1UK9A 2Q1WA 3EXFB 2I9PA 3BEDA 1P2DA 1U8TA 2GMWA 3IIEA 4NP6A 4QWWA 4NZYA 2NPIA 1C1XB 2I2XB 4Q4DA 2XXJA 1JG7A 3E9EA 3LBYA 1I1NA 1UJMA 4NU5A 5BXYA 4RPKA 3PRJA 4IH9A 3V4LA 4AP5A 3J80A 3QQPA 1OH6A 4CQLB 3DE5X 1FZQA 3I2IA 3P19A 1M6EX 4YQYA 1SCKA 3ZD8A 3LL7A 5AXBA 4YI3A 3D59A 5E6SB 5BMVB 3E8MA 3QWBA 2LTAA 3LUBA 2FW1A 4OGLA 2WSBA 2NGRA 4ZI7B 3W06A 5B30A 5C80A 1SXJE 4NULA 5B3JA 1G19A 3RUDA 1L1EA 1EVQA 4Q18A 2IUUA 2F7SA 2PGIA 3IVXA 5G2OA 4Z9AA 2LD4A 1P4RA 5B55A 3WZ2A 1K8ZB 3AQ4A 3ESRA 3KSZO 3IVAA 4OAOA 2XY4A 3A6LA 5A71A 4BVGA 2Z08A 3DGEC 4MJ3A 3UYLA 3LF2A 1W7AA 3SKXA 2ZRCA 1AKRA 4LQLA 4BVEA 1EFHA 4X0EA 3MUOA 5AKKA 1R4NA 3FMFA 2DPLA 5HQJA 3OQVA 3AVUA 1O5IA 4TM7A 2XE8A 3F7MA 1EX6A 4QNMA 3T7RA 4LMAA 4L6AA 2D06A 4E6EA 1DEHA 3PNLA 1FSGA 1S8FA 3C8ZA 3B8EA 1L8QA 4OM8A 2W42A 3DOHA 5UKDA 3K0CA 2VHYA 3CM0A 5K0GA 5CFPA 4B80A 4P92A 2JFZA 1D4OA 2EIXA 3BGOS 5BT8A 1TJ3A 1P18A 3CLUD 3GDGA 1F2TB 1SXPA 3ANNA 4BNKA 2BSQA 2G9RA 5EMKA 4ZJUA 4EM6A 3WA7A 1NU6A 3S4YA 2ZJ1A 1PTJA 1CHNA 2RHLA 4UNNA 5FWXA 4B33A 4EFNA 4Q3DA 1XVTA 5A2QA 1YS9A 1V7PC 2E9SA 4X1IA 4YDHB 1L5GB 2JCBA 1HG0A 1RM5A 5ALIA 2QNBA 1HT1E 3RSFA 1HNXB 5KYUB 3R8XA 3L1KA 4JUBA 4G81A 1ANKA 4L0MA 5TEVA 4HNGA 3JQFA 4M0KA 5FWAA 4ZOLB 3GIWA 3QPCA 5T57A 1UWLA 3RAJA 2HREA 3B3FA 5KSPA 1L7VC 5ICGA 4G5QA 3B60A 2XF8A 3HDVA 1B6RA 4X6LA 1J70A 5F3DA 5JZMA 1WCIA 1BHO1 3OKCA 1HT3A 1FMJA 1XQ9A 4D56A 4C76A 1L9XA 3JTEA 4EZEA 5KTNA 4DB2A 1H2EA 4WZBB 3AF5A 2FPSA 2ZBDA 3SE0A 3K0CC 3SS9X 3NIDB 3HDJA 2QTFA 1OAAA 3ES9A 4RA9A 4H18A 4R8RA 2IHBA 3CF0A 1BX1A 5AI8A 3WYFA 2AFVA 3MCTA 3ZYCA 5EYPB 5MDHA 1XDWA 3SVTA 2QUZA 1DAOA 3COVA 4NNOA 1W35A 1IOLA 4U2GA 2QQFA 2XDWA 4DCSA 4IGEA 1FP7A 1BXKA 1O97D 5B36A 2VHWA 4PSDA 3NPAA 1P80A 4Q21A 3IYLW 3VNRA 1VKOA 1R0BA 4EL0A 4FEEA 2LKCA 1M83A 2F9FA 2IUEA 2QSZA 1ID8A 3EY4A 2WWTA 1ZK1A 1H93A 4DCTA 2O1SA 5BQ3A 2GAOA 5AR1A 5KNBD 4YFVA 1QIGA 4TLCA 3O8QA 3V1UA 3D3WA 4IKOA 3UK1A 4F5WA 1L5NA 5C1OA 1NZDA 4RD0A 4P22A 3VZSA 5CVCA 1EG7A 2PQ2A 2TSYB 5EERA 2P78A 3I52A 1YVUA 5DVZA 1TA4A 5IEBA 1Q50A 3UPDA 3COWA 2C7QA 5EWMB 3TGPA 3K8QA 2RKWA 3BX1A 1SC4A 3RTCA 2CCKA 3GA0A 2XNSA 1VKNA 4C6HA 4NWIA 4UAVA 1WHTA 3FVWA 4NARA 1XK7A 1GSIA 2J9GA 1QGUA 1UAYA 4RPJA 4TL9A 5CB6A 1P5JA 4ZV9A 2FPPB 4WEQA 4RV4A 2DQSA 4R8KA 4BNIA 5J3JA 4YVFA 1MPTA 1Z13A 2IZ0A 5DM0A 2WJIA 2EHJA 3DTTA 2QRLA 1ZKMA 3HSYA 4O2AB 1D6NA 2NO6A 4ZAWA 4DR2B 4P33A 4L6IA 4P5EA 2PMEA 1QZTA 1JDBC 9ABPA 1G2OA 2HAEA 4URYR 3UUWA 1J0CA 1NF8A 2VC2B 4H77A 4DDVA 1YKGA 2ZU0C 3QKRB 3GXOA 3I01A 2M1XA 1Z22A 2GH1A 3PQFA 2NU9B 3CZ4A 3TJMA 4CUKA 4Q6BA 1ORIA 4HLDA 3ZN2A 5AVVA 3UJ3X 4PAQA 4OFZA 1BDHA 1X2EA 3BMNB 1ECBA 2OVBA 4MW6A 5CR9A 2NUAA 3GRYA 5KYYA 5TMBA 1G6OA 1V8PA 4JL8A 3RVRA 4HAYA 3WYBA 4OIFA 1X1EA 3QHAA 5J4LA 3ZCPA 1RI3A 3DKKA 2WYUA 5TJ9A 4BVFA 2PUAA 3T9BA 2XTNA 4W5NA 3W5HA 3LXMA 1SXJB 2EDAA 2BR5A 5DBEX 2I62A 4IVRA 2VZ0A 5EJ8A 4AFNA 1OHHA 1BDBA 1XROA 2AX4A 3T54A 4L9AA 3V8EA 4FZ3A 1FFEA 1UPXA 3AG5A 4MIEA 1J39A 1I2BA 1XEWY 5E38A 2J07A 2PGLA 2LKDA 1U2QA 1GAEO 4Q82A 2ATXA 2BR4A 3VA7A 2BGJA 2W4QA 1ESDA 2B20A 3DW3X 1GTL1 3OIYA 5BWLA 4I7EA 1PEAA 2OXIA 5MHTA 2IYVA 4IOMA 2IYOA 2WYIA 4FT4A 4LNAA 4HAUA 3D6FA 1PRYA 1G6HA 2LDXA 4NE7A 1XMSA 4Y8VA 3NHWA 3SMVA 4MQBA 1KZ7B 2P68A 2Q9BA 1GM5A 5BNWA 4Z5XA 4GYJA 1GGHA 2SKDA 1R0LA 3R20A 4KLCA 4RLSA 3RSOA 1GGNA 2ZSIA 3CKYA 4MQFB 4XB2A 4D8UA 1CF2O 4C0QC 3BCUA 3IVGA 2QTMA 4B2PA 3LT0A 2FWAA 2YIMA 1YJCA 4ZT4A 3WK5A 1KWGA 2YMPA 3KVOA 4ZV7A 1FXWA 2ONCA 4K6GA 1K0UA 1XYGA 1JYSA 1XD2B 2H0RA 1H5QA 3ED1A 2HSWA 1KEZA 1REQA 1EFPB 2FR0A 2I8LA 3JQDA 4YAUA 1US8B 3BB3A 3DMYA 3DTVA 1ATIA 2XSZA 3FKJA 3OCJA 4FX5A 4LC1A 2QZ9A 3V42A 4TL7A 4GECA 3GPLA 3IAFA 4WOBA 2XXAB 5CH5A 1L5SA 3LYAA 2FJUA 1L4EA 4RMJA 2ZIXB 2EZ4A 1A50B 2HBQA 1Z07A 1EX7A 4IUDS 4W5WA 3LCUA 4D81A 4BNTA 1MO4A 3RFCA 1JFLA 5BXQC 4IIXA 4TTQA 4C08A 5K3OA 4JI0B 4YK7A 3GELA 1C7RA 4PZYA 3TMKA 3D6HA 4LC0A 5DWDA 3TPFA 3K9FC 3IT2A 3OICA 4GMGA 4HDRB 4MGKR 4UOQA 4F56A 2ERYA 3BK7A 5A03A 3VH1A 4BHTA 1WZNA 4U0KA 1HZZC 3A6EA 4M8LA 3RRFA 3FZQA 4N82A 5IRCD 1Z0UA 2BFCA 1W6UA 3I1IA 1ZN2A 2M98A 4IQ8A 3EARA 1XZPA 2HRDA 5JANA 4Q7QA 5IJWA 3LCMA 4LEIA 3E9YA 4DIDA 3DZJA 5AW3A 1MW8X 2RHMA 3BD8A 1PNRA 5BMVF 1P2VA 3AR4A 3CMCO 3KL4A 1H8ED 5A3JA 4KLRA 4FFSA 2F3SA 1VXOA 2P2DA 5CEEA 1ZBDA 3BIJA 1EFLA 4HRXA 2I1QA 4H7HA 3SEZA 3ZTWA 2YZGA 2CYCA 3FN4A 1FPQA 2YFYA 3I5MA 4WBXC 4COKA 2JA1A 1IDN1 3QA3E 2O07A 3FGNA 3NP7A 1E4VA 4L5IA 4AY4A 3QXSA 3SMQA 4YJ3F 4JYAB 3V8BA 2WFLA 3LLCA 5EHNA 3QIVA 2P3SA 4JQCA 2DJIA 2NWQA 4KNVA 4MVXA 4O4JA 4KAFA 4JVMA 4KSCA 3TL2A 1P2BA 3O0DA 1VA4A 1EFVB 2OKGA 3JVVA 1Y4AE 4EK9A 2ZTUA 5JCXA 4RY0A 2V6JA 1WABA 4XSVA 3U49A 4HH3C 4RV9A 2JLWA 2OGZA 3MT0A 4ARBA 4GH5A 1P77A 3AYZB 1I4EB 2DQ4A 2VQ6A