4V0OA

Crystal structure of bbs1n in complex with arl6dn, soaked with lead
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/structural protein
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 48
structure length 166
sequence length 166
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0oA00
1LFDB 2FFBA 4LZZA 3A1SA 1ZM4A 4BZPA 5TXGA 4GL2A 3P4XA 1YZQA 1L2TA 2ZUDA 1KI3A 1IY0A 5BQ5A 1XEXB 4JBYA 5EE0A 4O3MA 4GMDA 4MITA 4IVPA 2HT1A 1BIFA 3N2EA 1NN5A 3NG1A 1OFIA 3EIEA 3GJ5A 1E0KA 5FOSA 2ZITA 5B58C 3NBXX 1FOEB 2J5XA 3R9IA 1IBRA 2HXYA 2BC9A 5L3RA 1A1VA 1VCNA 4CGZA 3GLGA 1KK2A 2DB3A 3GJ6A 4TWZA 1UKYA 1JJVA 2J7KA 4C7OA 3R7WA 3MGCA 1FX0A 3V00A 3QNUA 2N46A 5E95A 3GJ8A 2HF8A 3PR1A 4B6FA 2OCYC 1UADA 1W44A 2F9MA 2W2VA 2H7VA 1GFIA 2OZEA 1GNRA 2XTMA 3MFYA 1S3GA 4F91B 2Z83A 1SQ5A 2P6NA 4S35A 3TSWA 4LPKA 4HEJA 4Q21A 3A1WA 4OHZA 3TAHA 4JSYA 4BFYA 2BBTA 4Z54A 4WBSA 5FR1A 3LAWA 5G3YA 1ESMA 2FX3A 2EFDB 1RFLA 3A4NA 4OK6A 3B13B 4IDQA 4LJ7A 1NSTA 5EXSA 4BRWA 1MRNA 2RGEA 3QPUA 1M6NA 2WJVA 3EPLA 4JT4A 1NNEA 4KVGA 1KDRA 4UJ3A 3U4QA 4UQOA 4JVNA 4NCKA 4RD3A 1BOFA 4PAMA 4GZLA 2VHCA 1G7RA 3FVQA 1K8RA 3UG7A 5HE8A 2H17A 3T15A 1GUAA 2WWHA 4P0TA 4HDQB 1JPJA 2NOAA 2Z4SA 3N2IA 3VTKA 3W6PA 2P5TB 3IHLA 1NP6A 4TLAA 2QNRA 2BMFA 4HUQB 1FP6A 5KDOA 1BYIA 3QXHA 4IFBA 1V5WA 3WNBA 4RD4A 1KI6A 2HYIC 5FBVB 1ZM2A 4AKGA 2V7QD 3DOEA 4AI6A 1KY2A 3DVLA 1H8HD 4A36A 1IN6A 2JCSA 5JWRA 1NY6A 2O8DA 2C9YA 3FKQA 3KQUA 1Q0UA 2W0MA 4DEXA 1II8A 2DFNA 2P5SA 4KFSA 2Q9CA 1AS0A 2XOKD 4Q1EA 5DHFA 4A8JB 1N5LA 4B43A 821PA 2W2TA 1G4UR 3IDQA 4Q47A 5JZVA 1KDTA 3CF6R 2VF7A 1IXSB 4OHVA 1IOZA 1G7TA 4V0OA 1O3YA 3V9PA 3VQTA 3RS5A 3CX7A 2OG2A 1W0JD 2NZ8A 2GAAA 2KB0A 1XCPA 2FFQA 4EPWA 4NYJR 4PXAA 1P2TA 4RD1A 1R0YA 2RB4A 4LJAA 2GHIA 2BIFA 3CLVA 3KB2A 2BEKA 4DCNA 3C41J 4ZIRB 3EWAA 2VRWA 1N6KA 1XEWY 2O8EB 3NH6A 3U61B 4IXMA 3CZQA 4YDHB 2WJGA 1D9XA 1KJYA 1J2JA 4W7SA 1BYUA 1YZNA 5L3SA 4LHWA 1XX6A 2WJYA 3WRXC 4QBIA 2VHTA 3PUXA 1DBSA 4M1KA 2P6RA 3AGQA 2JJ1A 4WXRA 1Q3HA 2XZPA 2AXNA 4G1UC 3LVRE 3HP1A 1AJEA 2QN6A 2J59A 1UKEA 2WKPA 4M2LA 2WTUA 4G5OA 1Z83A 3CKLA 3LV8A 1Q57A 1NLZA 4XSHA 1CF4A 1W0KD 3VFDA 4EQ6A 2ZRHA 2G6BA 4NYMR 1JBKA 4UNPA 4B74A 3DZDA 4NCIA 4FCTA 1ZYUA 3K8YA 4Z8YA 5FTMA 1P9WA 3EZ6A 4MA4A 1U94A 2W58A 4DLXA 1OHHD 3EA0A 3FHCB 2MMCA 2OAP1 1E1RD 2ZS7A 1U81A 2W6JD 3CBQA 2WOJA 2BBOA 5IK2D 3K0AA 3IPXA 2GKSA 4A1FA 1OXUA 4TSFD 5HKKA 5KPJA 1CTQA 1NY5A 3LW7A 1EFTA 4NCHA 4TMKA 3FHTA 2OHFA 5HZHA 2OBMA 1NLFA 2ZE6A 1E0JA 1XJQA 4PO9A 4B3CA 1FPMA 3AH8A 2B92A 521PA 1E3MA 4H1VA 4Q00A 2CJWB 1R5NA 1ZAKA 3VX3A 1U0HC 2G1JA 5J4HA 2O8CA 4XWKA 1T3SA 1MT0A 1BS1A 1J99A 1YRBA 4HZUB 2X19A 4HAZA 4H9GA 1T8TA 4PAOA 1RJ9B 3I8SA 3SC3A 1VIYA 1N6OA 2IYXA 1ZCBA 2CLSA 4OHXA 1WMSA 4ON9A 4FWTA 1I4LD 1J70A 4XJXA 4AIIA 2V54A 3LBNA 3SJCA 5LPNA 1CR4A 1AK2A 3GMTA 2RHMA 2Q21A 1MKYA 4NYIQ 3SHWA 4EPVA 5H8WA 5C2JB 1ODFA 1DG1G 3LQRA 1R4AA 3A58B 1I2MA 2CCKA 3J81k 4WXPA 3GJXC 1D2MA 5JHGB 1E79A 5LD2B 4ZI2A 1XNJA 2BMEA 2Z43A 5FOXA 2QG6A 3QXXA 1CR1A 4MGYR 1LS6A 1NL3A 1KOFA 1Z0JA 2OCPA 3HWSA 4P32A 1LV7A 2J3EA 1YR6A 4IDNA 4PPQA 3I8XA 3K1JA 1C9KA 3AVVA 1E2EA 3I1FA 5B2ZA 2EW1A 4CDGA 3PVSA 4HZIA 3CPEA 3WHKA 2R6DA 4Q4AB 5LD2C 5TB5A 2GAOA 2OSBA 1ZUNB 3LLMA 1R5BA 3RAPR 2IS6A 1G8FA 3QKSB 4LX0A 4Z8XA 2ZRKA 5L3VA 2R2AA 3MWJA 2GBLC 3M1IA 1OH5A 4C2TA 1XD2B 3IQXA 3IO3A 3AVXA 5KO2A 4KLNA 4PHGA 1Q12A 3GLIE 5H68A 1H8EA 3KXLA 2BKEA 4ASUA 2ZRPA 3QKRB 5TVKA 2JLXA 1T3LA 3HDTA 2VA8A 2CHGA 2H16A 4Z1MD 1TTTA 1TF5A 4URWR 4TYNA 4BWYA 1SKYB 3UMRA 2HEIA 3ND8A 3ADDA 1D8TA 2IYSA 3TW8B 5KUTA 1XTJA 1PJRA 1KSFX 4EJSB 3OEED 3LLUA 1XXHE 3RRZA 3U3OA 1G3RA 3AF1A 3QI2A 4IFEA 3CX6A 4UKDA 4A2PA 3ZVRA 1NVVR 4RFSB 1VG0B 5FL7A 2ODEA 5TDHA 4P31A 3HU2A 4M9ZA 4QM6A 2HLDA 2D62A 2BWJA 3BH0A 4CF7A 4QJ4A 3GJ0A 1JR3A 3RS3A 4EJSC 1XF9A 2ERYA 2ZSAA 4CVNA 5BN3A 4ZV4A 2JJ2A 2VP2A 1GILA 2QZ4A 1AA9A 2IT1A 2O0KA 5SZHB 1GL9B 3BERA 3WMGA 2G77B 1J90A 2ZI6A 3KTAB 4I1VA 1D5CA 4M9SA 4LBWA 2IS4A 1CJVC 2GCPA 4GP7A 3SR0A 3ADCA 1R0XA 5FBLB 1KZ7B 4A0FA 2IEZA 3EX7C 3IUYA 5SZJA 3KDSE 2ORIA 5FTKA 4RY2A 1S9HA 2YYZA 4M9QA 3TW4A 3ZVLA 1E9DA 1RC8A 1BMFD 1CU1A 1HE8B 1YR8A 3ONWA 4R9UC 4PZYA 4A8JA 3O8CA 5EP3A 1T6NA 1NMZA 2J0VA 1E9BA 1MO4A 2AXPA 5FPKA 5J47A 3TIFA 1E9EA 2YOHA 2JIZD 3BD9A 5SZKB 1TEXA 3PQCA 4RJLA 1E9CA 1LNZA 1U8YA 2QA5A 2HYDA 2WKRA 3ZVMA 2UZIR 3C4JA 1IN7A 2E87A 4W5JA 3D7MA 1M34E 3EW9A 3OE7D 3QUSA 4ARZB 3RHFA 4JL5A 3PUYA 4OI1A 4A92A 2EFCB 3GJ7A 3QEOA 4LC0A 4URZR 3SJZA 2FFAA 1XP8A 4XVUA 1Z6GA 2O8EA 1WCV1 1G8PA 2ZAMA 1E2PA 1N25A 2NO7A 3C16C 1DVRA 3BGWA 4MQBA 1G3MA 1CRQA 1NKSA 4V0MA 3WNCA 3CW2A 2L0XA 5HR5A 3CNLA 1CJKC 2G83A 3HU3A 1E9SA 1VCIA 4GT1A 3MD0A 1N6NA 4B2LA 4YMTA 4PC7A 3Q9LA 2ZE8A 3U6BA 2J7PA 4B33A 4PC3A 1Z0IA 3NEYA 1ELOA 1TNDA 2J46A 2MMGA 1E2FA 3OIYA 3P20A 2RMKA 3T1OA 4ZKEA 2IS1A 4HYYA 2GK6A 2XAUA 3BJIC 3IILA 2AR7A 2QRZA 3VR1A 4O2LA 5FPYA 5KDDA 2CK3A 2DHRA 1QVRA 2CVHA 4LJ6A 2JDIA 4L4UA 1E0SA 4M1SA 3TNFA 4A2QA 1KGDA 1GRRA 2WKQA 4C0QC 1XXHA 4V03A 3T1VA 121PA 1HT2E 1J8MF 2A30A 1FNNA 4OI2A 1J8YF 3K9HA 3SDZA 1ZIPA 3X1XA 4Q9HA 2UKDA 2ODBA 4NHOA 2RGNC 4FMDB 1E2DA 4PPGA 4RD6A 1XBTA 4G5QA 3GQBA 4BFTA 3L2OB 2NPFA 3WYAA 1KY3A 4DLSA 2G1KA 1PLKA 1SKYE 2FE4A 2IF0A 4KFUA 2N42A 2O8BB 4HDOB 1KO5A 1PUIA 3RC3A 2F1HA 1A4RA 5JWOA 2JASA 2I3BA 1M2OB 1F6BA 5A4JA 1IJEA 3I3SR 4DLWA 4NYMQ 3K70B 5IDVA 4KV9A 2WVJA 3VX4A 4HB0A 4A15A 3QEJA 3UKDA 3CRVA 3ZZTA 2IA5A 2CJWA 2SHKA 4XVQA 2ZVPX 1P60A 2GXSA 4NZYA 2OESA 3H84A 3PCRB 3B85A 1DOAA 4RCYA 4HZUA 4KSBA 4L8GA 2VHUA 2GZDA 1RJ9A 3ADBA 3WYFA 2CDNA 3OEHA 1R7RA 2YVUA 1MOZA 1Z2CA 5E4FA 3WNDA 4LOAA 1HURA 1SVWA 2GETA 2R6FA 3LA6A 3K70C 1DADA 2BM1A 1GSIA 1Z28A 1EXMA 1G5PA 2QUZA 1GNPA 4ZDKA 4A9AA 4AG6A 1Z3IX 4F4IA 5AUNB 2GEVA 1NBMD 1FFHA 3Q8XB 2O8FB 2QT0A 4PSAA 5JJIA 3PEYA 1N6LA 2XSZA 4JVSB 1K6MA 4TLCA 2F1JA 4Q1FA 421PA 1N0VC 1NRJB 2FA9A 5FI0B 4BFXA 4B3XA 5BYJA 5KSPA 3TVDA 4YQFA 2WIBA 2GBLA 3C14C 1GZSA 3TR0A 1E0AA 3AUXA 4D6PA 5DISB 1XCGB 1ZNZA 3CO5A 1XTQA 3ZVNA 1R0ZA 3LXRA 4TMXA 5KDLA 4DRZA 3B78A 1EFHA 3AVOA 4CEIB 4M9XA 4AKEA 1PLJA 4Q4AA 1X1SA 1KAOA 5FTJA 3BORA 3M6AA 5BW8A 3QKSA 2O0HA 4C2UA 1EK0A 4ABYA 1JAIA 4LBVA 5EP1A 3FTQA 1CXZA 2AK3A 4X8MA 4JBXA 1XD2A 2ASEA 1XMJA 3THYB 3TSOA 4HB3A 3R8CA 2Q9AA 1I4DD 4PR0A 4TMWA 3QKRA 4EUNA 3LX8A 1AGRA 4GOXA 2PLRA 1PV4A 4R2HA 2ZI4A 2IHYA 1SXJB 3K9GA 1M1YE 2EFHB 3QXCA 1M7GA 3PFIA 2H92A 2VYFA 3DKVA 2V9PA 2ZRLA 3T34A 1KYIA 4F93B 3CONA 4LJ9A 2YV5A 2PH1A 5EE9A 4EJSA 1G20E 3KKQA 1FNMA 2J0SA 1R8SA 2DBYA 1US8B 1XTSA 2G0TA 2ONKA 3QG5A 4FINA 4DDUA 2QAGB 5L8VA 2AK2A 1XZQA 1W47A 1NMYA 4LI0A 1KKLA 4QHTA 5TMPA 2Z4RA 3P27A 1TMKA 2JEOA 3KXIA 4RFSA 4TQ9A 3QJYA 5CYOA 1S1CA 2JLVA 1OKKD 1SXJC 4U7DA 5HPYB 1K5DA 1XCMA 3TE6A 1YR7A 1XZPA 3SQWA 3NXSA 1OH7A 3QF7A 1M74A 2BJWA 4YDSA 2GF0A 4OQNA 4EFNA 1G41A 4DLVA 4N0EA 4EPRA 3QKTA 2NGRA 4DUGD 1WBDA 2PZFA 1KSHA 4TZ6A 3LY5A 1OXSC 2PJZA 3OHMA 3K0AB 4JLOA 2QAGC 2HV8A 2ZI3A 3LQQA 4R7ZA 2F6RA 2FH5B 3ZD7A 1P2VA 4OHYA 3JZMA 5BYKA 2BHRA 2ZM5A 4D4LA 4PC1A 2OCBA 2G9NA 3IIMA 1NVVQ 1R8QA 3HYRA 3KX2A 2C96A 2ZEJA 4Q4LA 4UNQA 3LVQE 3UXMA 1V43A 1JAHA 2ZRDA 4BPBA 4B34A 4EFMA 2A3RA 2J45A 2XNDD 1KI1A 4PC6A 1F2TB 2RHDA 1DTSA 3N5CA 1NN3A 4QBFA 1OYWA 2ZS8A 2QP3A 1NIPA 3GLHB 3LW8A 3DHWC 4B2PA 3SHFA 2ZE7A 2JAQA 2ZRCA 3O8DA 4CIDA 1NIJA 1RIFA 1IONA 1P7CA 1Q20A 4IDPA 2YWHA 2F7SA 4KO8A 3ZS8A 1SHZA 4JVLA 1E79D 2NO0A 5C4MA 1YVDA 3T35A 2A5GA 4ARZA 4G3XA 3GJ3A 2VP0A 4CEJB 2IYZA 2X1VA 2XTZA 3KXKA 5GJVC 2FGKA 5DE3A 5GJCA 3SOPA 4DVGA 2XX3A 3LXXA 1Z6XA 4FW9A 2P2LA 4ZI3A 4TMZA 1UAAA 3LNCA 1VG8A 4QGAA 2A78A 3DDCA 1E94E 4X8LA 4MDFA 1XMIA 2C95A 2VEDA 4V0LA 2B6HA 1HE1C 1ZNXA 2WWYA 2AL7A 4GP6A 1P5ZB 2AD1A 1VG1A 2QMEA 2RGNA 2ZI9A 3PIRA 4KFTA 3WYGA 4BUJA 4Q4JB 2C03A 1GITA 2IYVA 1DE0A 3LBHA 4Q1AA 2ZRIA 3LRPA 1MO6A 4XD7A 4KAXA 5JCZA 3AVTA 2ZI7A 4Q7JB 3ZS9A 4EFLA 2ZYTX 2D4HA 5G3ZA 5FOTA 2ERXA 3T12A 3A1UA 2QGZA 3KKNA 3B6EA 3MG9A 4PHHA 3X1ZA 4ASUD 3REGA 1OF1A 2VP4A 2PL3A 3KB1A 1KI4A 1F2UA 2OFWA 3D8BA 2F3RA 2YJTD 4W9MC 4UXJA 1SHKA 5D3QA 5DO9A 2EYUA 4FMDF 4V02A 3SS8A 1CIPA 3W5JA 1SXJE 1TQDA 4M1YA 2O8BA 1SKQA 2Z0MA 4LY6A 5GJWC 5JRJA 1COWD 2ZJAA 3BH7A 3HPQA 5DYIA 1U90A 3EC2A 3ZGXA 1P3JA 4M53A 2ZTSA 5TY0A 1E9AA 2FSFA 2K5UA 2YWFA 5KYKA 2CLDX 4E09A 3M4YA 4P4TA 1KI8A 3OAAA 4LBYA 4LUCA 2AFIE 2FN4A 3MJHA 3RC8A 1ESNA 4JS0A 5AUQA 2DWPA 5FL7D 5CJPA 1TX4B 2ORWA 3A37A 4UJ5A 4OL0A 4Q1CA 5HTKA 5C4GB 2C78A 2XGJA 1JR3D 1WXQA 5E7MA 2ZR0A 1U98A 3U7EB 1D2NA 1HYQA 4LGMA 1CKEA 2QTVB 3E70C 5DN6D 2AX4A 4NU0A 4KSCA 4B3FX 3WHLA 4PQYA 4BLSA 3RNLA 2OEPA 4AYTA 2GZHA 1IAQA 2ZANA 2O8FA 3HYTA 2GF9A 2I4IA 4NH0A 3CIOA 1WQ1R 3EIHA 4AKHA 2HJVA 1JI0A 3QXSA 5AR1A 4ESHA 3PV0A 4ERNA 2XEXA 4HLUC 2J0UB 4DIEA 2IL1A 3P1JA 4ZKDA 2UZ3A 2X2FA 3I62A 1MV5A 3THOA 4ESVA 3GEHA 1E2MA 1WE2A 2HJGA 2OO7A 2JLWA 1OFTA 3ASZA 3GLHE 1UM8A 4B44A 4BQSA 1TQ6A 3HR7A 4OYHA 3ECCA 1OH6A 1NVXQ 4GRAA 1EGAA 3BFXA 4RCZA 4LYFA 4CEIA 1JEDA 4BFWA 4MUBA 1ZNYA 1U0JA 4E07A 1P61B 1XB2A 1FMJA 1ZW6A 3V4FA 3VKGA 2WPDA 2DCUA 1G8GA 5LB4A 1RZ3A 2OM2A 3W34A 4LBZA 5EP4A 4R71A 4EPYA 2Q6TA 2D7DA 5GADl 3FB4A 4TYQA 2FZ4A 2G88A 1E2JA 4TT3A 4X8HA 3RWOA 1UJ2A 3ZIAA 5FPHA 4D2IA 4PX9A 4CYMA 5CDFE 4D26A 4GMXA 3THYA 2E1RA 3KJEA 2P0EA 3UMFA 2OILA 4D0GA 5FUVA 3TUJC 2J7PD 2YC2C 4B3DA 2GEDA 1ZU4A 4WIAA 3WBKA 1Z8FA 3T5GA 3U6KA 2WJJA 4OJQA 3GLIB 3IO5A 4NKRA 4BZQA 2CL0X 1N6IA 4DIDA 4PPNA 1A7JA 1SXJA 1VHTA 2ZSFA 3BS4A 3EZ2A 4EPXA 4MYTA 2CK3D 2QP9X 2ATXA 2JDID 5FTLA 1IN5A 2WWIA 3KUDA 1LW7A 3JZAA 3T06B 1Q3TA 4US2R 3NDPA 5KU1A 1DELA 1US8A 3K9NA 5G53C 3SJBA 3FDIA 2QAGA 2GJSA 3BK7A 3QENA 1GVNB 3WP0A 2NO1A 3OESA 4US1R 2QROA 2XZOA 2GZAA 3EXAA 4D4MA 1XXHB 2O5VA 4OI4A 1Z0KA 2IYTA 1Q1QA 3C15C 4PPFA 5CB6A 3GJ4A 1GKIA 1QHIA 2BBWA 3BFVA 3MJRA 5AJYA 1KNXA 1TU4A 2CMKA 2VH5R 2J87A 2ECKA 1UBCA 3X2SA 2IWHA 3SU8A 5EJEA 2EWWA 4DB4A 1F48A 1T9HA 2ZQ5A 1W46A 4Q4HB 3B82A 3PUZA 2GNOA 3AVPA 1VECA 1EFRA 4XWOA 2QENA 3B1WA 4MKGA 4F7WA 2QMHA 4C0SA 4FD2A 3AVWA 2F1IA 3OIVA 1OFHA 4U02A 4C0HA 1ANKA 1F2TA 4OQMA 5JRZA 5A0FA 3BFKA 3C5CA 3D6TB 2GVDC 2B8TA 5F9FA 4HI0E 3GLHA 1DPFA 4JVMA 4G01B 1T8UA 1NVWQ 1O87A 4R2IA 1W48A 2J1LA 5J40A 2HCBA 5DI9A 4DT1B 4B75A 1F3OA 2A5YB 2NG1A 3U44B 2PT5A 2ZETA 4YMVA 1CRPA 1NMXA 1G3IA 4BRUA 1WP9A 3G5UA 3Q3JB 1FW6A 2QBYB 3VR4A 2A5JA 2C98A 2WIAA 5KNBA 4I99A 4MYUA 3L0SA 2F9LA 1UBFA 3K9LA 1CJTC 2RGBA 3R20A 1QHNA 4CEJA 1G7CA 3VMFA 4ACBA 5KSZA 3DMNA 1JECA 3UG6A 5FOUA 2V8OA 3A36A 5CDFA 3NVAA 3CX8A 1G7SA 1E2LA 1UEJA 2GA8A 2PBRA 1WB9A 1XWIA 3CZPA 2FG5A 1VDZA 4JMPA 4UNSA 4BFUA 3LD9A 2PEZA 1SVIA 4DDWA 1W5SA 3H0KA 4Q4JA 3AV0B 4RKFA 1XJCA 2ODWA 1BKDR 4JJKA 4D4JA 5KHOC 1AN0A 1PZNA 4MRVA 3W8NA 2DWOA 3VR3A 2GJ9A 2R62A 2ZU0C 4NDZA 5FH9A 3D3QA 1KHTA 4L15A 3T61A 4XH9B 3TR5A 4LYAA 1A2KC 2RKOA 2V4ZA 3GLFE 1DARA 1W4RA 3W3ZB 1WDTA 4U5XA 4JKYA 4XWAA 1S3SA 3EZFA 4PO1A 4PHTA 1WRBA 4V0KA 1RYHA 3U7HB 1Q1BA 4KCGA 5C46F 2V1UA 5F3WB 1X8KA 4QC2A 1ZC4A 4FN5A 3W6NA 4GDFA 1JXMA 1J7KA 1NJGA 1IQPA 3CWZA 2BV3A 2JLQA 1A2BA 1RRGA 2ATVA 2PCLA 2WSMA 4Z51A 2ZJ8A 2QPOA 3WRYC 4LJ5A 4POAA 1P4SA 3B1XA 2GESA 5BN4A 3L0IB 2YINC 1JXOA 3QF4B 3W5IA 3O47A 2ZUCA 1G16A 3EA5A 4DSOA 2IUSA 1AKEA 2XNSA 3BOSA 3AF4A 4XIGS 4GBMA 2QSZA 1KKMA 5DH9A 4FCVA 3I5YA 1N6RA 1T5LA 4NCNA 1W4CA 3K09C 4QHSA 5KTYA 5DYGA 1E32A 4DCVA 3NC1C 3LO5A 2VSFA 4G5SA 4HLUA 3EPJA 2GEUA 3MWLA 2XB2A 3I72A 4TN1A 3SBEA 3ZJYA 1N6PA 3KJIA 1DAMA 2FEOA 2ZRAA 3L82B 1XPOA 1W36D 1XMSA 3H86A 4P4SB 3I92A 2REOA 1RRPA 3B9PA 4LYJA 2XJ9A 4DLZA 4QBHA 2V55B 2ZRMA 3QIAA 3EZ9A 4C0KA 2QGNA 2NPIA 3GFPA 1A5TA 2H57A 1G4AE 3AEZA 2KE5A 2ZREA 3KKMA 1UDXA 1UKVY 2KBFA 4UNRA 2WAXA 3IPYA 3KQHA 1OJLA 2OLKA 4CZ2A 1Z0AA 1XU4A 2J0UA 5DHAA 3QG1A 1MH1A 2ZJOA 1SULA 2GRJA 4YLGA 3MWYW 5JECA 1FL9A 1G6HA 1W2HA 1HQCA 2BCGY 1GM5A 4HAUA 1M7HA 1SVSA 4WA7A 2FSGA 5JSZB 2C77A 2QI9C 1ZMXA 4URUR 4XSGA 3OFND 5L3QB 4RFVA 3LX5A 3ZQ6A 2CHQA 4GI7A 4IOMA 2JATA 3VR2A 4LV8B 2NIPA 2VQSA 1KO1A 1JQLB 2QPAA 4HAVA 4DWJA 1U2RA 1Q44A 3VHLB 4DHEA 1Y3AA 2R6AA 2IYLD 2A5FA 2V7QA 2XTNA 1AQYA 1U8ZA 3BE4A 3MMPA 3TSZA 4A6XA 1ZM9A 5CK5A 5EUMA 4II7A 2RAPA 2NO6A 4JLVA 1OIWA 3GLIA 4M4SA 3KKPA 4IOJA 3K0EA 4XD7D 3AUYA 3WP1B 4ZCIA 4BLRA 3B7GA 2W00A 3EAQA 1P2SA 4IDHA 4NYJQ 1NI3A 1T0JB 1KNQA 4DC9A 1QZXA 4QKQA 3GEEA 1MR3F 721PA 1FZQA 5AK0A 4Q7LA 2IXGA 4PQFA 1TF2A 1LB1B 3KJHA 2QE7A 4D4KA 3TJZA 5DI3A 1E2GA 1TEVA 2OXCA 4Q01A 1QRAA 4BFZA 5EE1A 1IXRC 1KK1A 1U9IC 1F2UB 3W90A 5AUPB 3KUCA 4KBFA 1X6VA 3OIWA 3QQ5A 2AFHE 4RD0A 3K70D 1XRJA 5JWHA 1OIXA 2FMXA 3QVUA 4LV6A 3OAAD 4D82A 4Q4HA 3IBYA 4LPSA 1TAGA 4QGFA 3G82C 2CE2X 2GCNA 3CNNA 3RABA 1VKJA 1G3UA 2OXRA 2QAJA 2REXB 1LF5A 3AKYA 2F43B 2Q9BA 2EU8A 4LHXA 4MKIA 4NE2A 1GKUB 1AIPA 2C8VA 3CB4A 5AWFC 2OV2A 1RRFA 3F0TA 1KMQA 4J0QA 4BLQA 1W0KA 2GILA 3RRMA 1EFUA 1XTRA 3H4MA 3WBJA 1OLOA 3H1TA 2C9CA 5JI2E 1ZBDA 1IN8A 1I2DA 2GCOB 2CNWA 2IYQA 4D81A 4RZXA 1CP2A 2FEMA 4OK5A 1AKYA 3NWJA 1OHHA 3BAFA 4LCBA 5FUXA 2WV9A 4W5HA 4F92B 3EZ7A 4QNRA 2W6JA 3D31A 4XOIA 2B21A 4DSTA 4DT1A 3U44A 4AKIA 3FKSA 2Z6VA 3SNHA 1D9ZA 3MUFA 3EPKA 4TSFA 2FGJA 2QBYA 3UIEA 1KAGA 2HXSA 1E2QA 1Z29A 3FFBA 2AHOA 4JLKA 3VU9B 4QFMA 3FPAA 4C0LA 4IRUB 2ZUBA 3NBZC 4DLRA 4BE7B 4B32A 1GOTA 5DNYB 4IHQA 3Q7PA 2OFOA 1KDOA 4DCSA 4PC2A 1DAGA 2C2HA 1OIVA 2YZ2A 3B1VA 5K8TA 1XDBA 4JLBA 4QHYA 2ZRBA 4DCTA 1MRSA 5BXQC 1C1YA 1G8HA 2FSHA 3BRWD 5A5GA 3KKOA 5CLQA 4BEJA 5FL3A 4BFSA 2WPDD 1S9DA 1II9A 2OCAA 3MSXA 1GL7A 2QMUA 4Q9LA 3KQNA 2X8AA 3UPUA 4JL6A 4JLMA 4HLCA 4AY2A 1X8JA 4TT3D 4EDHA 4IVRA 4DB2A 2KWIA 3NKVA 1IN4A 4JYBA 3VHXA 1R0WA 1Z6AA 4KHZA 3F5FA 4NMMA 3A4MA 2IHBA 1N5JA 3KJGA 4R98A 4C4PA 1T91A 3RS2A 2QQ0A 2QY9A 3ZYCA 1Q1EA 3DEFA 5HCNA 5SZIA 4URXR 2IX3A 3DM5A 4DBLC 2ORVA 1WF3A 3G0HA 4HLQB 4Q9JA 1S4QA 1SXJD 4NP6A 4YXWA 1G18A 4IEEA 1EG7A 2FWRA 2JJ1D 4K46A 4TYYA 4B3GA 3K09A 3P26A 4HSEA 2H18A 1D2EA 5CM9C 3F8TA 1XPRA 3ZH9B 2FPLA 3PEUA 2W0SA 1KJZA 3MRSA 4CT5A 5EZ5A 4LDJA 3QF4A 2N1BA 2PJRA 2WWGA 5DGXA 2P65A 4U00A 2FNAA 5G40A 3A1VA 5D3MA 5FOWA 4LSGA 2DPXA 1QF9A 4IXNA 4C3ZA 4KXFB 3R8FA 3THWB 5JS8A 4JL8A 1GRNA 2C5LA 1L7VC 1RYFA 2FDCA 5FBWB 3HJNA 4Q1BA 4A82A 3PUVA 3NEJA 5AUOB 5DIFA 2PMKA 1HQYE 1XMVA 3CWQA 3K0FA 4FMBB 4QGHA 4PHFA 5HKKD 3AGPA 4LJYA 3SEAA 1CJMA 1OPXA 2J0QA 4P4SA 4Z1MA 2FZLA 1EFRD 2FFHA 1S8FA 2Z5FA 4C30A 2PLFA 3CRQA 5IF9A 2ZYVX 3JVVA 4HATA 4PSVA 2WWWA 4WAUA 4C0BA 3GEIA 3GLGE 2F3TA 5EXTA 3MCAA 1QHXA 3B1YA 4JJZA 4D0NA 4NBSA 3I5XA 1N0UA 2O52A 3VR6A 4Q48A 1P62B 2QP4A 1Z63A 4UXIA 2MSCB 1G21E 5JSZA 1IJFA 2EFGA 2HF9A 4PZZA 3KFXA 3B2EA 4YMSA 3RS4A 2F55A 2YOGA 1GDDA 4ILEA 1LVGA 4P4UA 2QORA 5JMTA 1FP7A 5L3QA 2G3YA 3VR5A 4NONA 4IEIA 2VL7A 1ZUIA 1JB1A 5JJLA 3C5HA 1EWRA 4AWXA 1AQUA 3QPVA 1Q22A 3DOFA 3W9YA 2VO1A 4YC7A 1QG2A 4NYIR 5CIWA 2Q3MA 3AP1A 1HTWA 1R5OA 1NF3A 2REBA 4JZKA 4RKEA 2YKGA 2B8WA 3CNOA 1RVDA 3AM1A 1YZKA 4RVCA 1EX6A 1ZM7A 2VIIA 2ZRNA 3PJRA 4OI0A 2MSEB 1AGPA 1L4UA 3PG5A 1W5TA 4QG7A 4US0R 1NLYA 2QM7A 1Z6TA 2QRNA 5DSZA 3SFVA 1Z0FA 3TK1A 1QHGA 1OV4A 2C04A 3TAUA 1DAEA 2X77A 3QSYA 1GAJA 3RS0A 3MAAC 4MRSA 2VSXA 1U9IA 3T1TA 2HCJB 3FMOB 1NBME 2W2XA 4NL4H 4KVAA 4D0LB 2JIZA 1KIMA 4YMWA 4MGKR 4LHZA 2CCJA 4DLYA 5JS7A 2WSSA 4HDCA 2QSYA 3U3JA 3UATA 2QPTA 5CJ2A 1PVOA 1G9XA 5EP2A 4DKXA 1FMLA 1G17A 1H8ED 2ZJBA 3EPHA 1E4YA 1EX7A 4Q9KA 2IS2A 2DFLA 1JPNA 2D74A 2BVNA 3NIBA 1G64A 5TARA 4H1UA 3AF2A 1OXTA 1P72A 4Q1DA 4QL3A 4MGZR 4KLZA 5E3HA 3ZZ0A 1VIAA 1YQTA 3DMDA 4HLDA 2NMVA 2CEAA 1DO2A 2Q3FA 4OHWA 2PX0A 2WZQA 5TV2A 1ZP6A 4M1TA 5H1YA 1Q21A 2ZJYA 2OAQ1 4JLJA 2BEJA 3X1WA 1KO4A 1WA5A 2JA1A 3BH6A 4IW3B 3L0OA 2F43A 4LJ8A 1Z08A 2FV8A 4LWZA 3QY0A 1OXVA 5EQTA 1IY1A 1DG3A 3AKCA 1YZUA 2PCJA 4M8NE 4ZPXA 1OSNA 3GFOA 2PEYA 2R9VA 4F4JA 2ZRJA 4B35A 1N5IA 2J9RA 2ZR7A 2GCOA 2HLDD 3FYHA 2CBZA 3K0CC 4TL9A 4QJ3A 5CM8B 3EWSA 5K8IA 4DSUA 3K0SA 2GVZC 3Q5DA 2QM8A 5F9HA 3CPJB 3F3YA 1PUJA 3PENA 2PZEA 3OZXA 4NPHA 4HAYA 1S96A 3UMSA 2JJ2D 4ZCMA 5CITA 1QHHA 5BWMA 2LWIA 1RW4A 1LF0A 2W6IA 1ZINA 4ZDWA 3CR7A 5ANRB 4DLUA 4Q66C 4AYXA 3TQCA 3FMPB 3S1AB 5EXXA 1TL7C 5LB2A 4PTLA 1W4AA 2WHXA 1AZSC 1VG9B 3VU9A 1B0UA 1FQJA 1T5IA 1CS4C 2NO9A 2QTHA 2G0NA 1S1MA 3R9WA 3FWYA 2IUUA 1Z0DA 3ICEA 4MKHA 4QOSA 3QBVA 2ZAOA 3U60B 2RCNA 3P4YA 1E69A 3ZLJA 2DWQA 3O8BA 1UBEA 4PO8A 4ITRC 2F1RA 2AN9A 8OHMA 4TLEA 4JLAA 3C7KA 3FE2A 3OF5A 4DZZA 4N3NA 4RZUA 2B7BA 1S0UA 1N3BA 3RWMB 3SYNA 1VCOA 3TKLA 1HEIA 2I1VB 4LHVA 2J41A 2YOFA 3DPUA 2NTYC 2EVWX 4RZ2A 4X8OA 4B73A 1F5NA 1NBMA 4URVR 2AWNA 1OXXK 1QVAA 2R65A 4PAQA 1P6XA 3IGFA 3QXJA 3AP2A 5FR2A 2EWVA 5GVSA 3LBIA 4UXHA 1DAFA 4A0RA 1OE0A 4NTZA 5J4LA 3KFVA 2JLZA 3L8YA 1JQJC 4BZXA 3A4LA 3X1DA 4OBEA 3GFTA 4V0NA 3HPRA 3GLFB 1OB5A 1CEEA 4S2EA 4IKEA 3WXMA 3DM9B 2GWHA 2QEQA 3NBFA 1OYYA 3JVUA 3TH5A 2WBLC 5K8UA 1G8YA 1E99A 4B47A 1XTIA 1U8AA 4MRNA 4KYUA 1AM4D 4BEBA 3LH5A 4CEHB 5H70A 1TQ2A 4HB2A 2QE7D 4A8JC 5IT5A 1OH8A 5FUWA 4JBWA 3AQ4A 1Z6YA 3THWA 4TQAA 1WBBA 1HT1E 4MRPA 1E96A 2ZYUX 2H1LA 3THXA 5JEEA 4B2IA 1VMAA 2CL7X 1TADA 4A2WA 1HV8A 5DI3B 5EUQB 3OIUA 3HR8A 3BXZA 4IOLA 1NG1A 1TUIA 1G3QA 2RGXA 2YC4C 5B30A 3IHWA 2BMJA 2XXAB 1UF9A 4AD8A 3SFZA 2CLCX 4MYHA 3UWOA 3R9XA 3Q72A 3SN6A 4BLPA 2IF2A 2HUPA 4KITB 5F98A 5P21A 3ZDQA 4JYCA 3NC0C 5UKDA 1EESA 2HDNB 3EG5A 5FFMA 1SGWA 2FJUA 4BFVA 3IBGA 1TPZA 2B7CA 1Z2AA 2BBSA 3E2IA 4JLNA 3REFA 4K81B 2DFTA 4XVRA 5B57C 2PX3A 4PQRA 2CNWD 5FBQB 3ICQB 2QMOA 2YNMA 3FMFA 1W7AA 2GXAA 5HZKA 4DJTA 4EKDA 3OEHD 2Q0HA 4FMCF 2PZGA 2ZJ5A 2FOLA 2VLIA 4B3BA 3U7FB 3FMIA 1OKKA 3FKSD 2FPMA 1BH2A 1YZTA 5AJVB 1NVUQ 1W49A 2H8KA 4CT4B 1P73A 2EYQA 2VP9A 1KO8A 1DS6A 5E7JA 4UNNA 2XZLA 4FIDA 3ZQJA 4QXAA 4YONB 2Q3HA 1KSJA 2H5EA 4DUGA 1R6BX 2XSZD 3TUZC 1T0HB 2FPKA 2IYUA 5JFGA 5KOYA 3I32A 4C0JA 2P67A 1N5KA 1MABB 2ZROA 4TTQA 1P2UA 1KSGA 3W6OA 3CM0A 4AK9A 5IRCD 1FUKA 1E1QA 3A8TA 4GZMA 1TU3A 3C8UA 1KMHB 4AURA 2KSQA 4OJKA 1QBKC 1NKTA 1YE8A 1FQKA 3E1SA 1CR2A 1ZJ6A 2XNDA 1JR3E 5DLQC 2JLYA 3WY9A 3V4RA 1Q1ZA 4PSKA 5EXPA 4BECA 2GJAA 2WOOA 5JBQA 2D2FA 4KODA 2JLRA 1YHNA 4QGGA 3CF0A 3FGNA 1ZU5A 3CRMA 1PLLA 1E2KA 4AG5A 4L5BA 4M22A 4JLPA 2CL6X 1N0WA 1XPUA 2ZSBA 1NJFA 1G5TA 1IY2A 4LRWA 1QHSA 1DAHA 2IBMA 2D3WA 5FTNA 3SJAA 4JSTA 4PZLA 5FI1B 2A5DA 4EAQA 4O0MA 3NHAA 4YXWD 1UDWA 1MO5A 3L8ZA 1CJUC 4LK2A 4WVFA 4PFSA 2RGCA 5AJWA 5AJXA 3RRYA 4I81A 1Z07A 3RRNA 3K0CA 4JIMA 2CCGA 4Q9IA 2WJIA 3ND9A 4C9BA 3IIKA 1G6OA 1XEXA 1E9RA 3MLEA 2ZIAA 3BWDD 1GL6A 2FU5C 5JEDA 3U3KA 1I4TD 4Y0VA 4KJZA 1KJWA 3KQKA 3CF2A 4A0GA 4HAXA 3NHBA 1KI2A 3AVYA 5D3MB 1DAKA 2WWFA 1YZLA 3NTUA 5CK4A 2EFEB 3I73A 2OFXA 2AKYA 3KL4A 2XJ4A 4L9SA 4V0ME 1ZD9A 3NH9A 1M8PA 1E98A 3U3MA 1AS2A 3ZZUA 4M21A 1W2GA 3CR8A 1VCMA 1E4VA 5J5CA 1W4BA 1H65A 1ZD1A 1VYUA 1ZC3A 4TQUS 2WJHA 4Q03A 1JJ7A 2DY1A 3AF0A 4C0AC 3BB4A 1XD8A 3K0FB 2D2EA 3AKDA 1TQ4A 1COWA 2D06A 2R8RA 1ZD8A 3S1AA 3TBKA 1E2HA 5JLJA 4M1WA 3AVQA 1QG4A 4DXAA 4IOKA 4KYIB 4GSYA 1C4OA 1T3HA 3FFAA 3RSLA 2ZR9A 3T1QA 3WMEA 2JLUA 2GJ8A 1DEKA 3LWNA 3AVUA 4Q7MB 4FXPA 1KO7A 3SQXA 4DCUA 1KTVA 1K5GA 2LKDA 1YRAA 4TTPA 3DO6A 3VNVA 2W83A 1KZGB 1ZCAA 1GP2A 1XEFA 1U99A 5J4VA 1ZNWA 4TLDA 4MRRA 1UFQA 3W3AA 3PEWA 1JR6A 4JKIA 2GDJA 3AB3A 4LC1A 3SZRA 1NN0A 5K8LA 2RH5A 4HUQA 3VKHA 1YZGA 4MH0R 5DN6A 5KPDA 1W36B 3IEVA 4P33A 1LTQA 2ZVQX 4TL7A 5CB8A 2JGNA 4BLOA 1SZPA 3M0EA 1N6HA 4DDVA 1YJ5A 3DKPA 4NCJA 4FWIB 4WZBE 2BMDA 1DO0A 2QQEA 2QL6A 2ZI5A 3LFUA 4G5GA 5C1BA 4E22A 4N1AA 4G5RA 3LDAA 4TYPA 3GLFA 4ZCLA 4K8OA 1H8HA 3TMKA 5ELXA 4GNKA 3MWKA 2ZE5A 2IW3A 1W36C 4JT2A 4WZ6A 4QBGB 4IDOA 4I1OA 1KI7A 2VHJA 3RYTC 1TUEA 2OT3B 2XOKA 3GPLA 2ANCA 3EASA 2IK8A 3PUWA 2WSSD 4OKSA 2WICA 1IM2A 1N2CE 1HUQA 1RPZA 1Z06A 4CEHA 3SI7A 3Q85A 3T5DA 4TYWA 4GOJA 4ZIRA 3RLFA 2E9SA 3B60A 1W0JA 4TMTA 2LCFA 5J4YA 4GPTA 5GVRA 3K53A 2KJQA 2WWXA 2ZJZA 3Q5EA 5LBIA 2KI5A 2GXUA 1OW3B 1CLUA 3DL0A 1CR0A 4CW7A 3UWKA 2VPPA 3RDPA 5B64A 3ADKA 1S2MA 1KK0A 5BN5A 2HT6A 2XXAA 2WM9B 2RGGA 1LS1A 1ZVQA 5HE9A 2ZPTX 3E5HA 4AYWA 1MO3A 1TF7A 2V1XA 4B6EA 3P32A 4MKFA 1T4GA 4W5WA 5FPTA 2AD5A 2CHVA 1X1RA 5FUYA 4QM7A 4F38A 2GK7A 2OE2A 2JJ8A 221PA 3B5JA 1KI9A 1HA3A 2UVQA 4HB4A 2BDTA 2VTKA 2XB4A 4WW0A 4OQXA 3H2YA 1ZM3A 4WOPA 2P3SA 3GLGB 2R44A 1D6JA 3L43A 1AZTA 4KFRA 3VNUA 4C7OB 3B1ZA 5E7IA 3TUIC 4MDEA 2YWEA 3R7WB 1R2QA 2ZU6A 1FX0B 2R6GA 2W6ID 4L9WA 2ANBA 2C9OA 3GD7A 2DR3A 3RS7A 2IWRA 2ZRGA 3ZD6A 3EARA 1HH4A 1DAIA 1E1RA 3B8HA 4LJ4A 1ETUA 5EE3A 3HU1A 1QHHB 5G41A 5EE5B 4OK3A 4WZAE 2VP6A 1M7BA 5IK2A 2O0JA 4XTCS 2FF7A 1Z47A 5FPSA 1MABA 3Q7QA 1EFCA 1Y63A 2GJKA 2VSOA 4Q02A 5GJBA 3GP8A 2ZXUA 4OQLA 2VHQA 1BO6A 2ODNA 621PA 4QRHA 4A0HA 3EC1A 1NG9A 1UKZA 1KMHA 1VPLA 1XD9A 4B48A 5KNCA 2QT1A 4L16A 4B71A 4MUAA 1QHYA 5JHHB 3AF3A 5FOVA 2IYYA 1XJ0A 1AS3A 2BJVA 4IJMA 4EPTA 3U4QB 3NBYC 2IYWA 2V3CC 1L8QA 1QDEA 3I4LA 1E2IA 2P6UA 3U2QA 3RVBA 3TRFA 4BASA 3VKWA 3UK6A 4FCWA 1X8LA 2ZJ2A 1ZIOA 3QKUA 4JLDA 4QNMA 2IC5A 1HY3A 1G5RA 3EIQA 3VAAA 4LYHA 3BIFA 1GTVA 2OBLA 3CUEF 4AC9A 4M1MA 2VF8A 3ZIAD 2RGDA 4A4DA 1KI6B 3QE0A 5CIQA 4RD2A 3RSOA 1GNQA 1IHUA 3CH5A 1G1MA 2O8DB 5F2EA 4O25A 4XTRA 1RE0A 2GXQA 3U5ZB 2FSIA 2WAYA 4ZO4A 2IUTA 4IVQA 1II8B 3L0PA 4TLBA 3O8RA 1G19A 1FTNA 4Q19A 4Q18A 3SYKA 1GWNA 3X1YA 1IXZA 3BBPA 1F60A 1JALA 1YR9A 2AWOA 2ZRFA 2CVFA 3CRW1 3QBTA 5M04A 3TQFA 2A9KA 4HUTA 4LV5B 4N0DA 3SBDA 4TMVA 5KSYA 3QPWA 1NSFA 4DSNA 1VYVA 4GOKA 5JI3E 2EQBA 1SVMA 4Y0AA 2NZJA 2BOVA 4TL8A 4HAWA 5IHPA 3BB1A 1EWQA 3AP3A 4I4LA 1FTSA 3PEVA 1GIAA 3SE0A 4MYCA 1SVKA 4QJ5A 2CE7A 3THXB 1ONBA 2IEYA 1OB2A 1E2NA 2YWGA 1ZRHA 1RKBA 1XTKA 5L3SB 5AJZA 4E5UA 1VTKA 5HCIA 2JLSA 3PITA 4TZ0A 2IYRA 2WMNB 4F4CA 2A7QA 4DDTA 3KQLA 2OBNA 4Q7KA 4PANA 5JCPA 4RZ3A 2ONJA 3PXGA 1YU9A 1XFAA 4OQFA 3IKJA 4B76A 2QTFA 2AKAB 4DLTA 3I61A 1L4YA 1ZUHA 3A1TA 3DZ8A 3BB3A 4EQ6B 1SVOA 4O2RA 3U3RA 4D25A 3BC1A 3OEEA 1UEIA 1X86B 3CRRA 2C99A 2A2ZA 1E9FA 1Z22A 1Z5ZA 3CH4B 5LDDC 4FMCB 1SVLA 1UBGA 1A82A 5CLLA 4D80A 5KNDA 3FHOA 2LKCA 3U7GA 4M0LA 1B23P 2VBCA 2OUKA 3FOZA 2PT7A 2Y8EA 1OFUX 4CRWB 3SYLA 4RSGA 2V6JA 4ZDJA 2KBEA 1KK3A 5J4KA 1E6CA 2R6CA 1JEEA 4TL6A 4ACAA 2V6IA 3TVTA 3KTAA 1XEWX 2NQ2C 4M1OA 4A6PA 2GTPA 3B9QA 3IIJA 2WMOB 3TLXA 1E1QD 3IQWA 1RRCA 5KSOA 1P75A 4TTRA 2RGAA 3AKEA 4Q5IA 1NN1A 3CPHA 2BCJQ 4KBGA 2O8CB 4MGIR 4ZDIA 1R10A 1GG2A 3QVVA 2IXFA 4LHYA 1P9RA 3ASYA 1U0LA 6Q21A 2I1QA 1UPTA 2TMKA 2ZSEA 1LY1A 1VYTA 2IXEA 2DYKA 4BLTA 3ETLA 2XITA 1BMFA 5JJKA 2MSDB 1JNYA 3NDBB 1W1WA 4KU4A 5EZ6B 5C18A 1GKYA 1P9NA 1FUUA 1X3SA 4DEYA 1YKSA 1GRQA 2ZSDA 3OFNA 4I1SA 3QOFA 1OT3A 2OLJA 2ZS9A 3IEUA 4EIWA 2BM0A 2ZYWX 4GFDA 5CYPA 3A6PC 3RANA 3GCGA 4P3YA 2X2EA 2YHSA 3KZ1E 2CXXA 3N70A 4URYR 2VP5A 4FI3C 3OE7A 1G291 2QU8A 2PMDA 1CULC 4KI0A 5FBRB 3UANA 1CBUA 4E03A 4G0NA 4YMUA 3TGPA 2BKUA 2DFKB 1VHLA 3WMFA 4BGDA 2D7CA 3W8RA 4I1UA 1II0A 1KDPA
chains in the Genus database with same CATH superfamily
3QU4A 4PW0A 2FFBA 1OI2A 4M86A 4X7BA 4Y2XA 1ZM4A 4YASA 4BZPA 3IDAA 1KDZA 2ZT6A 4NDAA 2JAXA 2WDZA 2XMDA 5EERA 1YZQA 4B87A 1B15A 1TB4A 2IYAA 2Z5VA 5BQ5A 1EIWA 5B36A 2Q6LA 1AGYA 4BNKA 4D9KA 4GZ5A 5ETJA 3MERA 4OU5A 3FNBA 1DSSG 3PNMA 4GYYA 1U28A 2ZITA 1PS0A 3IAAA 2OECA 2IH5A 1FOEB 2AR9A 3K4HA 3ELUA 2QDXA 4H18A 2LW7A 3JVDA 2BC9A 4Q3BA 5GIOE 4L85A 1M83A 4I50A 1E3TA 1HDEA 2R8YA 3GJTA 3O2SB 2R84A 1ZOSA 4J7CA 5ER6A 4E5PA 4C7OA 1JJVA 2LDBA 2RGRA 5JQGF 1JFVA 4D42A 3PX3A 2N46A 1CY0A 3GJ8A 4JUIA 4WACA 5E95A 3PR1A 3R7FA 3V8RA 3BJEA 3KB8A 4LFAB 5LKAA 2FWBA 2TS1A 2Z2XA 3MFYA 4GKVA 1S3GA 2EX0A 3R3ZA 2DUUA 3DTNA 4IIHA 4ENSA 1M10A 3TGLA 3F96A 3OZFA 4HEJA 4J2OA 3A9SA 3CQ9A 4WUVA 3QKWA 3CU5A 5ALRA 4OHZA 4BFYA 1WPRA 5JFOA 2BR4A 1FQOA 1FLAA 4Q3DA 1MHPA 4WBSA 1KQGA 2EW2A 3OC0A 1JFTA 1R4MA 1JTFA 4RX1A 1I1QB 2FX3A 1RFLA 4G1CA 4OK6A 1N36B 3CJTA 2VJQA 2BM9A 1NSTA 4FC6A 5EXSA 2BGLA 3QPUA 1M6NA 5IG2A 5JNRA 2IP1A 4JT4A 3SGLA 1G38A 1KDRA 2XE7A 3P0IA 4UJ3A 4DTIA 5KOJB 1RS0A 5DBEX 1H9CA 4ND2A 1HORA 4PAMA 2VHCA 2ZBEA 4XIYA 3FVQA 4BO2A 3AUKA 3SWWA 1K8RA 5K3FB 5HE8A 3T15A 2WW8A 4HRYA 2WU1A 2WWHA 3GNLA 1I3LA 3NATA 4P0TA 5CJJA 3ZW7A 3WFJA 5BN3B 3CUVA 2G09A 2BGTA 2JBAA 1NP6A 2V74B 3ENKA 2V45A 2PD6A 3G17A 3OPYI 4P98A 1DIGA 1FP6A 3U26A 1K6JA 1QH8B 4BQFA 3RS2A 1YOBA 1KI6A 1K08A 1YI1A 4KUGA 5FBVB 4AKGA 1L7PA 1KY2A 3AWIA 1H8HD 4J91A 1N2HA 4CMAA 5JWRA 5U4XA 1PNQA 4KQMA 2IV2X 1PX2A 2EP7A 3FKQA 4GX2A 1FLVA 4WLNA 3DPSA 1LV8A 1Q0UA 5C1PA 3KQUA 2YMLA 2PZAA 3P9XA 5DHFA 1EFVA 5IC4A 1HE5A 1N5LA 2ZTUA 1Z8HA 4OUKX 4I4IA 2HY7A 1XG5A 2JH9A 4E5NA 2P5YA 1KDTA 2VVTA 4JUDX 3CF6R 3MTGA 2XQJA 1O2DA 4JA2A 4LYGA 1C7JA 4JMLA 1O77A 1MPTA 1O3YA 2DUMA 4KWCA 1A98A 2P77A 5CB4A 2OG2A 3OWHA 1W0JD 2YS6A 4CKCA 1VA5A 2KB0A 5AK4A 1XCPA 1UBKS 1FYDA 4PXAA 1MHTA 1BEZA 4RD1A 4Z4IA 4QJBA 1G2OA 1E1NA 3H2BA 4FZ3A 3EVEA 4KR3A 2JAWA 2R8BA 2ADMA 1N6KA 2QQ5A 2SNIE 2J67A 1ATIA 1BAPA 1D9XA 1E6EA 1KJYA 2QTTA 3K05A 5AXDA 5KHAA 4HWRA 1JLLA 3CHYA 3ELWA 3PNLA 5L3SA 4HRVA 4IXWA 4LHWA 3WL7A 1XMQB 4ROSA 4FZJA 2W71A 1KR5A 4NNOA 3WRXC 4AO8A 4OAPA 5JJCA 4H0CA 3C39A 2XI4A 3LHDA 4GC9A 4IIJA 4NZ9A 5BY2A 3DOOA 1XKTA 1PWZA 2AXNA 1IZYA 3H2ZA 3HP1A 6YASA 5JUWA 4JHXA 5E6UB 2WKPA 3FFXA 2ZUEA 4Q3OA 3RTEA 5BORA 3LV8A 2I8LA 3N7AA 1A9XB 1Q57A 1SCQA 2NSLA 4UUAA 3VFDA 1U8CB 1W6UA 2ZRHA 3B6KA 4BU0A 5M3BA 5L7WA 2ECOA 1SQ6A 3VDQA 1P3Y1 2FRXA 1ZYUA 3RC2A 3AFHA 4AWAA 4ZCRA 5FTMA 1JF8A 4YAOA 5HNKA 3IPAA 4MA4A 3BGIA 1OHHD 3W0LB 5LZ4A 1IQUA 1XDUA 4ZRNA 2MMCA 2D0DA 2OAP1 1E1RD 3Q8KA 2Q1SA 2BEUA 2ZS7A 3IE1A 2H48A 4CQLA 4BP3A 2CD9A 5DCWA 3WTCA 2C7BA 2C8JA 1N0IA 1C1XA 1B8VA 1CY1A 1NXTA 1ZH4A 2PV0A 2QVXX 3DDZX 4QBKA 4RADA 5EA2A 1FW8A 1AUQA 2PXCA 1CTQA 5KPJA 4G0YA 3Q11A 2OHFA 2DECA 5CCDA 1E0JA 5KNCD 1FPMA 521PA 2GEFA 3AFNA 3HCDA 1UDCA 4UU7A 2VG8A 2GUWA 3B3FA 3SSMA 4CUZA 4ODIA 1E6KA 2G1JA 5BWNA 2O8CA 4TROA 1JW9B 1MJGM 1O0SA 1OX5A 4D0RA 2ZJFA 1J1UA 1S3IA 4HZUB 5CD9A 2O1SA 4H9GA 3PA8A 1RJ9B 4J49A 3I8SA 4N01A 4F5DA 3UXEA 1OC2A 1VIYA 2VT6A 5HA5A 1UP4A 1VRVA 5I9TA 1KERA 4I8XA 2WB2A 4AULA 2XDQA 3LQ1A 1YS7A 4OHXA 4CMIA 4YIHA 1PQWA 4AIIA 1J70A 1D3AA 2FW6A 3FHLA 3GAAA 3L01A 4EKEA 2YVAA 4RMHA 1N8TA 5EL0A 2ROQA 1CR4A 3GMTA 3KU1A 4GKAA 3WKAA 1MKYA 5JNTA 5H8WA 4DJFC 1ODFA 3NOQA 3QVJA 5LZ8A 4UMVA 5JROA 3JQGB 1ONSA 3F2IA 3PWSA 4Z4QA 1DJOA 1I2MA 4B4VA 3P5BA 2RHTA 3FDZA 3NHJA 4RGQA 3GJXC 1CY6A 1HLDA 2XMZA 4WXPA 3C1TA 4ZOLA 1GZ3A 3QWFA 1NA5A 4UE2A 1HZJA 1TD9A 2JGDB 1C3LA 2E0IA 2R5NA 4ZI2A 4RIFA 1HMYA 5GV7A 5EHIA 2BMEA 5FOXA 2QG6A 1YL7A 1EG2A 5SYAA 4KVZA 3DBVO 1JIXA 1Q1AA 1LS6A 1NL3A 1Z0JA 4P32A 3TD6A 4IH9A 3ZUPA 1YR6A 3N2GB 3MOIA 4IDNA 3T94A 3K1JA 3ZNPA 1HI9A 2BFWA 3PVSA 3O82A 4HOYA 3WHKA 4Q4AB 5LD2C 2YY7A 2NT4A 4HNRA 4PFJA 3OU6A 1ZUNB 4KV7A 1R5BA 3ZLVA 4BVJA 1LBIA 1G8FA 3QKSB 2UAGA 4N9WA 4Z8XA 3O1HB 3LPNA 3WYBA 1T8PA 1X1QA 5AM5A 2OD9A 2IIQA 5L3VA 3ORSA 5TQ0B 1NMEA 2P2YA 3VMMA 1OT5A 3WGJA 4C2TA 3EHEA 2E37A 3IALA 1XD2B 1OFUA 3GZJA 1BNCA 1XROA 3IO3A 4QXMA 4WVLA 4ZU3A 2DTXA 4KLNA 5DM0A 3Q9NA 3GLIE 1ZWKA 3A7DA 1FS4A 1U6IA 4MB6A 3KXLA 2BKEA 5AKIA 5H68A 4BMXA 4BNUA 5EJIA 4BO0A 7YASA 1EUQA 3OJ0A 4FYVA 3MCTA 4GYKA 4M0DA 5TVKA 3D0QA 4P53A 3HDTA 2WF6A 3JD4A 2H16A 2WF9A 1UP7A 3EBPA 4Z1MD 4L78A 1KAEA 3COWA 1X7XA 3OZ7A 1DJQA 3GGOA 4URWR 3EGXA 4BWYA 2P6PA 4EO9A 2RE8A 1UINA 1TCUA 1XAJA 2R96A 1BWRA 1P0CA 3AW8A 2IYSA 4EK9A 3LCRA 3WSVA 2NNLD 3P2MA 5F33A 2DWUA 3GMSA 1H42A 1KSFX 1YZ3A 2X5XA 4U3JA 3OEED 3LLUA 5A4KA 4MMZB 1SD1A 1ZGHA 1XXHE 1J22A 2WTBA 3IVMA 2BEWB 3TLMA 4GM1A 2CUTA 5ITSA 5KNDD 2ZWVA 3HN7A 4UKDA 5E8JA 1AB5A 2X9QA 3VZSA 2C2ZA 4Z3DA 3ZVRA 4B3TB 4KZPA 5EQDA 3W1EA 1KEKA 1V1RA 1VG0B 3OURA 1DWOA 5TDHA 3HU2A 3PKJA 4QM6A 4EBBA 3G02A 1XVVA 1Z7EA 3PE6A 3UHFA 1NT2A 3AHDA 3DZFA 3QHPA 4QJ4A 5G4KB 3RK1A 1L4GA 3IC5A 4AJ4A 3E48A 4EJSC 2ERYA 1IZ0A 4XIFA 2MYTA 4CVNA 1V2HE 4ZV4A 2O2GA 2UDPA 2NXNA 1XDGA 1GILA 3TNJA 2HZ7A 2DBZA 2IT1A 2O0KA 4M1ZA 3WR5A 5SZHB 1GL9B 3C97A 3VKFA 1SUDA 2G77B 4BCBA 1GJRA 2ZI6A 3KTAB 4P93A 4C6RA 2GCPA 5BRNA 5IP5A 3SR0A 5HFNA 5BQ3A 3ADCA 3PDIB 4MR8A 2FXVA 4A0FA 2IEZA 4QUIA 1CJBA 1T0IA 3IUYA 4H7KA 3KDSE 3GT0A 5FTKA 3E03A 3OIGA 3PFBA 3UJBA 4ESOA 3ZU3A 2WYHA 2YYZA 3HB9A 4KIJA 1ML3A 2QUIA 1TD1A 4PCVA 4DADA 1BMFD 5BMVB 3EAGA 1C0LA 2GK4A 5K3CA 5EP3A 2IHVA 3HA2A 3B1JA 3WLHA 4AS1A 1NMZA 3OUZA 4OEHA 1E9BA 2L82A 4GPD1 1H5QA 4K88A 2JHAA 3CXRA 3L0DA 4XQEA 3E9CA 2YOHA 5C1IA 2OV8A 1NW9B 3I76A 1O94D 1AKQA 1TYAE 3GGDA 3PQCA 4J1TA 6GPBA 5BSRA 2QA5A 1DTWA 2WKRA 4ZYUA 4B2YA 4LQLA 2CFRA 4XEUA 1H1DA 3S5UA 2IXBA 1V47A 3D7MA 1M34E 4OYRA 4QOEA 3IJEB 2GCGA 3RHFA 3JD1A 4JL5A 1ZOLA 1Y4DE 2G07A 3PUYA 2CLFB 4LC0A 1CUWA 3SJZA 1IQ0A 1Z6GA 2C7VA 2ZAMA 5JS1A 1N25A 4J76A 4H7HA 4O1MA 1WHSB 3FZQA 3PJEA 1U0NA 4R8KA 3SZGA 2GCIA 1Q6YA 1JZSA 2FP3A 4MQBA 2H2GA 4NS4A 1NKSA 4TXJA 5C7OO 5ELLA 3DMGA 5AW9A 3EXEA 4KQIA 2G83A 3HU3A 1VCIA 2DKFA 5D01A 3MD0A 3ELYA 3U6BA 1EESA 2Q50A 3Q9LA 4B33A 1CZOA 1D6MA 3F6EX 1GPWB 5CG2A 2M32A 3NEYA 5A5VA 3R6LA 1S7GA 3N39C 3NCHA 2QPLA 2JANA 1JU9A 2VAPA 4I1PA 3A2LA 1J2YA 2J9ZB 2RSLA 5EZSA 1MJGA 1Z5NA 4S1PA 3T1OA 2XAUA 3HWRA 2QYHA 1OZHA 4I9GA 5DOVA 3HA5A 5FPYA 3L7LA 5KDDA 1N2BA 1QVRA 2CK3A 3A1CA 4IVNA 3KOUA 2PUCA 4ARVA 3UT6A 1G8SA 4YT4A 1FK8A 2DAPA 4KN8A 1V8OA 4MICA 1G60A 4F0JA 4V03A 4BVAA 5FV4A 1C7IA 3MAJA 3A3PA 1F8YA 3IKVA 3K9HA 4RPGA 1ZIPA 5FTWA 4MKRA 4I50B 3OZEA 1J25A 5FO1A 3RIHA 2RGNC 4FMDB 2GZSA 5D7BA 3QMVA 4PPGA 5HQJA 4Z0TA 4ATNA 2FUNB 4NBVA 4BNJA 1KY3A 2G1KA 3DAHA 1XNHA 3L1IA 4YJHB 4WKOA 2V3WA 7AT1A 4BGVA 4MWCA 1KOJA 4IS2A 1BCSA 1F6BA 1M2OB 2HSZA 3PXBA 2Q5IA 3JQ8A 4DG8A 4EUEA 3CLUC 4ZV7A 5IZCA 2ZUUA 4NYMQ 1PSDA 2IE0A 2QTBA 5IWAB 3K70B 3VX4A 1SM4A 2Q7DA 2P0AA 4O4IB 3QEJA 3WWYA 1SCUA 2IA5A 3L8EA 2SHKA 4XVQA 3OSUA 5JCJD 3PC6A 4DRYA 4TKUB 4V2UA 4NZYA 5LMNB 2E4VA 3A6GA 3BF7A 1DOAA 4D79A 2CW5A 4PNHA 1ZH0A 4O4LB 5DBGA 1T0UA 2O2EA 1ODJA 5CFNA 4L8GA 4RK6A 4L0MA 3T0IA 5DASA 3ADBA 3WYFA 2CDNA 1N92A 1TZBA 2NZWA 1R7RA 1ZK0A 1MOZA 3PRYA 1HURA 1SVWA 2Z2IA 2R6FA 3EBLA 1OR8A 2GB4A 3LA6A 3T9AA 3T52A 3MNFA 4K2AA 4QDJA 1EXMA 4DXHA 4ZDKA 1GNPA 4E5KA 2Q8QA 5KEIA 1SQFA 5FB3A 2PGIA 4F4IA 2CFCA 3UGTA 4I7EA 4JJIA 3DO8A 5AJHA 3JRWA 4ZI7F 3FZGA 1LC3A 2O8FB 1W85A 5REQA 2EX1A 5C8YB 3JQDA 4ML3A 3PEYA 2XSZA 3V1KA 4RZHA 3OF3A 2F1JA 3LHIA 4GE0A 4WLFA 3D02A 5DYWA 4F46A 4S1OA 5FI0B 4XYGA 2R1TB 5BYJA 3L7NA 4AS2A 3K30A 3KSAC 3DDHA 3TVDA 6REQB 1UPCA 5AICA 2FQWA 2WIBA 2WUGA 3D8NA 1USUA 1U0RA 2GZ1A 3KHUA 3ROXA 3WDLA 3HNRA 1BEEA 1QOQB 3CO5A 2AS0A 2A9FA 3I9V1 3O92A 3BWMA 2DFPA 1EFVB 2PWAA 3QEMA 1THZA 1YJBA 1I94B 1VKOA 4CEIB 5TT1A 3IT3A 4OREX 1CUGA 4AKEA 4ZZ0A 2XLBA 3IURA 3WLKX 4TKLA 3SYTA 1X1SA 3NHMA 1X1BA 4IJWA 4M9RA 1EP9A 1AURA 2YFYA 1VSBA 4EABA 3RFFA 1LBQA 4ENTA 5CB4B 1EB9A 1LQUA 4ZQBA 5GGYA 4LBVA 4CKCB 4ZTUB 2WP8J 1XUOA 1VJDA 2QM0A 3BDAA 3JZIA 1RQ2A 2AK3A 5A2GA 4JBXA 3VHQA 1IHXA 5JCOC 5GINE 2XECA 1A5SB 2ASEA 4DS3A 1GRCA 4AICA 1HM5A 1PR5A 2GZ3A 3ENVA 2AOWA 5IS2A 4HFMA 4F3KA 5THXA 3VC7A 1YR3A 1F8XA 3D8TA 3KDPA 3IPCA 3QKRA 3KHTA 4D9CA 3U4CA 3DQQA 2MTBA 1O95A 4GOXA 4NPAA 5EIFA 4MCIA 5A6SB 3LPAA 4XYEA 2IHYA 1FU7A 3ER8A 4MVJD 1SXJB 4Z9AA 3K9GA 4YCJA 5CIYA 3AXSA 3GIWA 4IIJB 4BNZA 3QXCA 4AT1A 1M7GA 2JCXA 5B1EA 1JR4A 3TW8A 1NRXA 1LRKA 2Q49A 3PZBA 2QYSA 3LUHA 3TZ6A 1IZ9A 4J1QA 3UH1A 1SKBA 3SHQA 3IEIA 2J3HA 5CFMA 1FNMA 3LQFA 1UPBA 4R8VA 4DDUA 2ONKA 5ALOA 3MT8A 5H4GA 3EMKA 2AK2A 5IUNC 1RWWA 2ET6A 3OMLA 4S2UA 4ZALA 4L1KA 4B3HA 2JKVA 4JU9A 3ADOA 1PEKE 2P9QA 4GAEA 2BSAA 3P27A 2JLVA 3RQIA 4UARA 1S1CA 2I4OA 1JFFA 3HI4A 4U7DA 1U6JA 1XCMA 2XT0A 3TE6A 1T1JA 5JVDF 3SQWA 1HOXA 4ZYYA 4WA8A 1N3IA 1UMBB 4GHWA 2CLHB 1VCHA 4GZ3A 2J85A 3L6UA 4DLVA 1DBWA 2CDRA 2ESRA 4WKPA 3OC6A 1TIPA 3LY5A 1ZMTA 1FP4A 4JDUA 1CQIB 4BNDA 2ZQYA 3BRQA 4R7ZA 1MB0A 1TIKA 2QI9F 3ACDA 3EXG2 5ALMA 4OHYA 5BYKA 1P4JA 2GM5A 2ZM5A 1TI7A 3DYVA 5I9LA 3HRHA 5JSFA 3N3AC 3LBYA 1JKJA 1JBEA 3IIMA 4M3NA 2FZVA 3I5UA 1R8QA 2ZEJA 2J6HA 4ZCPA 1G1AA 3AR9A 3TIXB 3T3DA 3MTIA 3CLKA 4EUFA 1N32B 4BPBA 1XZHA 3H13A 1AXGA 5SY4A 1A50B 1JDVA 5JAIA 3R76A 1G2IA 1DTSA 1IL0A 4HPXB 3INTA 3VR4H 4B4WA 4C6HA 1ABEA 4BWGA 1OYWA 2ZS8A 1GZ4A 3VAZA 3HM2A 2LIVA 4WFKA 2XUKA 2JFVA 4FKZA 2B20A 2NX2A 4YI3A 2ACEA 5BW4A 1SXPA 3HCRA 3E4DA 2DLCX 5CYFA 1ZXBA 2NXEA 2JAQA 2ZRCA 2VWPA 3D4NA 2XDQB 4QDXA 4ZAFA 1NIJA 1ZIDA 1RIFA 5J2UF 4EJ0A 2WM3A 4G8DA 1P7CA 3GZTB 2D5IA 4GI2A 3F5QA 2YWHA 4IDPA 2F7SA 3G0GA 5IANA 1SHZA 4I9FA 1ULAA 5C4MA 3ENZA 3Q41A 2QS9A 4CHGA 2PQ6A 3RPEA 3STVA 2IBTA 2JFZA 2DQZA 3MMXA 3M34A 3FDZB 4QEKA 1CDZA 2CGEA 1FRZA 1SC1A 2C3OA 1Y7TA 2IYZA 2X1VA 2O5RA 2XTZA 3KXKA 4PYQA 4XRRA 5DE3A 5EZYF 3UWMA 4MLDA 4CCWA 1SUBA 4HNTA 1L7DA 4DBLE 1TZ2A 3D3NA 4ZI3A 1FNCA 1M54A 1VG8A 2A78A 5KYWB 4HDMA 2IZOA 3DDCA 1XWFA 4JUFA 1V5FA 3N5KA 4V0LA 1KTIA 1ZNXA 4I8DA 8ATCA 1FXWF 1Q84A 1N1GA 3PIRA 3NNDA 2WAOA 3BM5A 4ENUA 1ZESA 4WLVA 4ZMSA 5MFPA 2OAEA 1UQUA 1XVTA 1M1YA 2B4YA 3B36A 4Q1AA 4ZGWA 2E82A 2AMFA 3LRPA 4TUYF 4XD7A 4KAXA 3AVTA 3P9SA 1GZ5A 2ZYTX 1UQRA 1HOTA 3BFPA 5G3ZA 4C03A 5BRJA 1FNSA 5FOTA 2CY0A 4JB2A 4Q6BA 2D5CA 1G20A 4Y6GB 3T12A 3ZV7A 3A1UA 2X7XA 5ARCA 3B6EA 4PHHA 3TNYA 1QE3A 1SU6A 4X85A 3T9CA 3TTWA 3WLRA 1VBNA 1EVJA 3R0VA 3REGA 4DCJA 3RSSA 2VP4A 1K4YA 1IULA 1YO6A 5FYDA 3KB1A 3HDHA 5HF6A 2PUHA 2OFWA 2B4KA 2F3RA 3A27A 4W9MC 5LQDA 1G0NA 4UUBA 4BNTA 5DO9A 2ZTVA 1MX5A 5ALLA 1CIPA 1U1GA 1ADBA 3QTBA 3PHLA 5AHXA 3DBLB 3W5JA 4BB0A 2XMQA 2G5CA 4M1YA 5ESRA 1U65A 1N78A 4LY6A 5GJWC 5JRJA 2ZJAA 2HK7A 3BH7A 2YRXA 3JS5A 3LQKA 3GYBA 3IOYA 1MX3A 3N8NA 1LBTA 1P3JA 1JWBB 1ECBA 3BCUA 5EEHA 1EE2A 1KVTA 2SKDA 3L7IA 4GDMA 3R0JA 4CL0A 4E09A 1KI8A 3OAAA 4LBYA 3WIVA 1XMXA 4RHCA 3NFRA 3WOVA 2CXPA 2VUSA 2Y1OA 1PT8A 2BKAA 4UJ5A 3WYNA 3X43A 5FADA 5CAEB 4S04A 4FYYA 3JQEA 5HTKA 4ZO8A 5C4GB 3HCOA 2VXOA 2XGJA 3LJKA 1JR3D 4N65A 1U98A 3UJ7A 1B1CA 3F3KA 2ATEA 3ID6C 4GX1A 1I13A 4ZVKA 1VI2A 3ETNA 3E70C 2CV2A 2ZKIA 5G2OA 2AX4A 1C8BA 1Y3HA 4NU0A 4KSCA 4PQYA 3UVEA 3LCCA 1OZ0A 3O8QA 2GZHA 1SBHA 3MRVA 2ZUTA 5BV1A 1Q0RA 1ZUD1 1DO8A 2GF9A 3O8NA 4Z0HO 4B9EA 5AM4A 1WQ1R 1WW8A 1QOZA 3EIHA 3KQWA 3O26A 3EFOA 2HJVA 1JI0A 5AR1A 1Q0TA 1X14A 1LVUA 2Y68A 3EMBA 4MS3B 3ETGA 2D6FA 4D9JA 4MI6A 2J0UB 4DIEA 1ABFA 3P1JA 3ZY2A 1VM6A 2ONJA 4MQEB 5A06A 1GGVA 1QHFA 2NSJA 3GP5A 4I6GA 4LDPA 3THOA 1IJKA 4DY4A 2GO1A 3TCNA 3WOHA 3KPYA 1OFTA 1DLIA 1QR6A 1NXQA 2E1PA 4BVKA 4RUKA 2I6SA 3BXXA 3O4RA 1E1YA 4JENA 1NVXQ 4OYHA 1ULUA 4GRAA 4C87A 6ADHA 1EGAA 1GZVA 2C9MA 2GOYA 4NQRA 5CGZA 3UQZA 2AC4A 2VDWA 1QGAA 1E3SA 2GYWA 4TOIA 5ALSA 4MUEA 4BFWA 4CM3A 2PBLA 1PR9A 3PB3A 4DNPA 1UBHS 3D8UA 1ZW6A 4ARBA 2C2GA 4Y0NA 5CFLA 5JARA 4ZT7A 3AF5A 4C4AA 4ARCA 1QFJA 5B7PA 3NWPA 2POQX 3KB6A 2YWJA 2RHCA 4FOTA 5EP4A 4W9NA 4JIGA 1PV1A 1E77A 1ZUWA 2NUBA 2Q6TA 2D7DA 4TYQA 1EQUA 1JXAA 3B1KA 2IPNA 2I2XB 3PC4A 3ZCVA 1MV8A 3ZKAA 3DV0B 3OM1A 1GUDA 1Q92A 4O2BA 2ZIWB 1KQ3A 3K32A 2P0EA 3TLEA 4AP5A 2ZWIA 1SUWA 3H3XA 1VHDA 3C3YA 1VJRA 2CUNA 3KZCA 4GH5A 2J7PD 4F6RB 1B0ZA 1ORRA 2QE6A 2GEDA 3E35A 2X6QA 3O83A 4MWZA 3BZWA 3EDMA 3G5AA 1CS0A 2BEVA 4J0CA 3F6YA 4WIAA 4D0SA 1Q14A 3T5GA 3WLLA 4Z4FA 2WJJA 1EZ4A 4HMQA 3IO5A 4FEYA 4AXXA 2DE0X 1U7ZA 2PYIA 4UATA 4DIDA 1VHTA 2ARKA 1MVNA 1T1SA 2ZSFA 4Z7OB 1K6IA 1MN6A 4MYTA 4UBNA 2IV3A 4C0XA 2BE9A 1IC6A 2QP9X 5TJ9A 1ISFA 3A1FA 3DTYA 4F9TA 1OYOA 1WDMA 1LNSA 4KXXA 4FZVA 4US2R 5ALYA 3VV3A 1DELA 1US8A 2NV2B 5G53C 3SJBA 3FDIA 4OBXA 4WN3A 2HGZA 4LRUA 2HWXA 2AFIA 1UK6A 3ITDA 4US1R 1JVBA 4FM9A 3G88A 4Z99A 5JYCA 2IZ0A 4HJXA 3WDMA 4D4MA 3TSYA 1GGKA 4MMXB 4M8LA 1HYGA 1Z0KA 2NVUB 3BX1A 4PPFA 5I51A 2Z56A 3QEKA 1QHIA 1U9JA 3WV4A 2VOEA 4EVSA 3RHSA 2GNPA 2H31A 4KL8S 3NTOA 2VH5R 2D5AA 1ULSA 4B4UA 1QU3A 2ECKA 3X2SA 1P1CA 2O8NA 4FBGA 4IZ6A 4LYEA 5EJEA 5A9RA 4F1WA 4KUEA 4R2MA 5C37A 4ZCSA 4RK7A 2QJWA 1R0KA 1T9HA 5FFNA 1LWNA 4HEHA 4ZOQI 5ULLA 1BCSB 4PBRA 2OORA 5BNZA 3PQFA 4PTYA 2W6CX 4H7IA 1Y7PA 1TW2A 2BR5A 1Z0SA 1C0IA 1YA4A 2XXJA 1SOAA 5FBKA 2FQXA 2JLBA 4FD2A 3ON5A 5FT9A 1X9GA 1BDIA 1PD1A 3P94A 4PG8A 3DBIA 1K98A 4M83A 4U02A 4ZOEA 5KS2A 2UUAB 3W5DA 3WLIA 3V8MA 5C0OE 5DB4A 1F2TA 5U9CA 1U7XA 2ATCA 3HG7A 3WLSA 3O3MB 4FX2A 4RK1A 4YPVA 3D6TB 3QU9A 1BQ3A 2GVDC 1GTSA 3EDRA 5F9FA 4HI0E 2LP4Y 2JHCA 1VPEA 3G2IA 2C3PA 1V39A 4K9LA 1N2GA 5HSGA 2ZATA 3O2NA 5J40A 2H11A 2A5YB 4U8HA 4K9KA 3BKXA 5C7LO 1GPKA 3R5XA 3R7LA 3FWHA 4BRUA 1WP9A 3O5AA 3Q3JB 3ZCQA 5AESA 1FW6A 4MWDA 2W6QA 4EH1A 4WK2B 1W85B 3UV6A 3L0SA 2KS6A 3R20A 2CVZA 1K7YA 1KJNA 3G2QA 1EFDN 2P90A 3DBOB 3H5WA 3WRVA 4E2FA 4DQ0A 1YCFA 4GPBA 2DM6A 1SK8A 5K03A 1O0CA 1E3QA 4N03A 1IB0A 3PFNA 1ZGBA 1R0RE 1YDMA 1G7SA 1E2LA 3GFSA 5ERXA 2R79A 3SZLA 3HLTA 9LDBA 5BNTA 3JAMA 3M5WA 2WZDA 4F86A 3EF1A 4P86A 1DOZA 1MLDA 2AN3A 3HL0A 4KRFA 3HKEB 4UNSA 3LD9A 2N47A 4DDWA 2XPCA 3ROZA 4LGVA 4RKFA 1XJCA 5I7UA 4HWSA 3E82A 5KHOC 5KOHA 3LSYA 1Y5MA 5LCXA 4AG3A 2DWOA 3VR3A 4BCCA 2HO5A 1Y33E 1LLQA 2O59A 4L15A 5KQMA 3QIVA 4XH9B 1VE7A 2E4UA 1M2KA 3OWOA 4GLFA 3VHXB 3BTSA 3NLLA 3GLFE 1DARA 2LTAA 3PQ3A 3W3ZB 4MRMB 4RZSA 1P1BA 2XNJA 1Y1KE 4PE5B 4ZOCA 4BV9A 4IQ0A 1FTWA 4PO1A 4EYSA 1TDJA 4QOFA 4MI9A 3DLTA 4HK4A 2VWQA 5EMNA 4GDFA 1ZC4A 3DEZA 2IVFA 2ZJ4A 3V3TA 1IQPA 2A5LA 2JLQA 4G97A 3D5TA 2O57A 1A9RA 5G1OA 2JFWA 5IBPA 4P7JA 4EHHA 2JZOA 1Z36A 2WSMA 3QRWA 5HHTA 2QPOA 2VZEA 1BCRB 3H65A 4LJ5A 4LVUA 6NULA 1P4SA 3FPGA 1X19A 3B1XA 4WWHA 4N3BA 4BNWA 2AFHB 4CWAA 3V7UA 2GESA 3D7NA 2OMEA 3L0IB 2YINC 5H02A 1JV2B 2GPNA 3O47A 3W5IA 5BNIA 4UREA 3OY2A 1D2GA 1KZ6A 1KU0A 2Q8NA 2XNSA 1QPZA 4MGHA 2APJA 3ZTWA 3ZCTA 4CTJA 3AF4A 5C51B 4GBMA 1IDOA 3I83A 2QSZA 5IBQA 4EO7A 2ZCVA 3IJPA 4AZTA 4DJEC 1CV2A 1KS9A 1Y7LA 1S2GA 3KXDA 1T5LA 3U1BA 3R77A 2Q5QA 1YTLA 4X20B 1LK7A 3M6MD 3NT4A 4RGVA 3ROTA 1XQVA 5DYGA 1JE0A 2FUG6 2X4DA 2IHTA 2NYAA 1E32A 3G2OA 3IR5A 4WH0A 4DCVA 3LO5A 5LUBA 4HLUA 1DQNA 3RC1A 3MWLA 2Q3EA 1Y81A 5LJIA 3DNPA 2KLHA 1H4TA 3K5HA 4K9DA 4TN1A 3VZPA 3WISA 5LDHA 5DKFA 2FEOA 3I2HA 1PL7A 4R1MA 3H86A 5CVDA 1LX7A 3GBVA 3IRVA 1JDBB 4P4SB 4PLZA 3VR6H 3B9PA 2IZ6A 4IJQA 4DL9A 3P4UA 2P30A 4ALNA 1MO2A 1H0HA 3QIAA 4L4XA 2MJLA 2AJLI 2TRSB 3V1LA 4ARIA 1C0PA 2Q2VA 3PTAA 2H57A 2E4XA 3ENNA 1BW9B 4HQ6A 3RAJA 4UNRA 3CINA 3A6LA 2GHRA 3IPYA 4IQFA 3ZWAA 1ZZEA 3N8DA 3QK7A 3PGXA 1VE5A 1Y3DE 4ZT2A 1MH1A 5G0VA 4RHXA 3UJAA 1K8ZB 4XA8A 1OD6A 1KETA 2GBCA 4XD2A 3ZUGA 3LKZA 1GFZA 3AIIA 4OLBA 2FSVC 2I4RA 1JMVA 1V6SA 1HQCA 3AEXA 3QVWA 3RJMA 4OGKA 1TA4A 3LX4A 3QXGA 5T4HA 5JSZB 4GLOA 3OJLA 1YBHA 4CNBA 1RR6A 3C1OA 3G85A 5IDYA 1U1FA 3BXHA 1ZMXA 1C4XA 2GASA 4JBGA 3IEXA 1EJ0A 3MOSA 1CY4A 2Z8XA 5BN1A 1ZXLA 3E5MA 1AV6A 4D4IA 4GI7A 5U4QA 4IOMA 1L0BA 3EQ2A 3TQTA 3ZY3A 2JATA 3UMGA 4GKJB 3VR2A 3BWCA 3E7DA 3SQLA 3RVRA 3VNQA 4CLHA 4ED9A 1MQ8B 1JLKA 1KO1A 1ZVJA 5JTTA 4DV3B 4HAVA 4U9UA 3IQIX 2CXSA 1Y3AA 3CEJA 4V2IA 1GSHA 1PNRA 1N7JA 3DKIA 4HTAA 3B3AA 5TPZD 4A6XA 2D1TA 4G67A 4GUDA 2R85A 1Q7BA 2YHIA 3HLKA 1EX9A 4X64B 4B6QA 3USES 1ZD4A 1YCGA 2K87A 4EG5A 1CUCA 5LQJA 1TM4E 1OZFA 3AI3A 1I0ZA 4PBSA 3H6KA 1DX9A 2J4CA 3AEUA 1T8WA 3FMGA 3K0EA 4GRIA 2RC5A 2CUZA 4IOJA 1CD5A 4RJIA 4X9XA 4YMGA 1L8AA 1JWLA 1WPGA 4ZREA 4RLFA 5IVHA 3EAQA 2DC1A 2P9JA 5SYMA 3R3YA 4NYJQ 4ZANA 3VC3A 1NI3A 1PJ8A 1PCXA 1T0JB 4PX3A 5I7HA 1AKTA 3AEKB 5TEVA 4B6JA 4QKQA 2X8JB 4KI7A 2XYPA 2JFBA 5CXUA 4IO1A 3GEEA 1Q0HA 1L5NA 3KM0A 5AM3A 1XE3A 1JHYA 721PA 1FZQA 4DDMA 2Q07A 1RABA 4F2DA 2YJNA 5DHQA 4BX2A 3WGOA 1CDDA 1G20B 1LB1B 2HSJA 3TJZA 3GR6A 1TGVA 3C70A 1E2GA 4YJ3A 2OXCA 4IJUA 4JQYA 4Q01A 3VPSA 5F23A 2MU1A 1RHKA 2NXCA 3QMPA 2ZR8A 1PJSA 4P7GA 4JFAA 1HT0A 1KEEB 1SY7A 4JXKA 1K3TA 3NDIA 3PR2B 2FP4A 2XMCA 4BP9A 1XRJA 5JWHA 2FMXA 4OSPA 3W5UA 2X0JA 2QZSA 3QBJA 3G8YA 1ARZA 2QUJA 1VJGA 4LV6A 1ND5A 5IBCA 4L3WA 4Q4HA 2Q5EA 4L0QA 3DULA 2P3QA 3IBYA 1ACJA 5AH0A 2ZM6B 5B37A 4FHGA 4BMOB 1CNEA 1KFCB 4HVTA 2NUTB 2R7LA 2ZIUB 3A9TA 2OXRA 4LE1A 2REXB 3AKYA 4M7OA 2EU8A 4NE2A 1GKUB 3DHYA 5LLTA 1XDSA 1ZRNA 2VK8A 2XBMA 3KPVA 1R8XA 2GZMA 3C3PA 5E1BA 1X8XA 1YVRA 5I4KA 1Z8DA 3Q7IA 5DCUA 1ADFA 1XTRA 1E3WA 2F2TA 1ZHFA 2Q6OA 1XO1A 4B5LA 2IEIA 1I2DA 3GHHA 4URHA 4RZXA 2EGGA 1QAMA 4RPJA 5AVWA 4H3SA 2XCRB 1AV7A 4UM7A 1OHHA 5LP6B 4LCBA 1EGQA 1W4LA 5FUXA 1XEAA 2WV9A 4W5HA 4GD3Q 3D31A 2CVPA 4DT1A 4O2AB 2P9BA 4CL8A 4C0HA 4MGEA 3OICA 5DM2A 3SNHA 1D9ZA 4RDCA 2N3ZA 1NX6A 1QDLB 3FYUA 2JIDA 3MUFA 2IEGA 2Y66A 4IR7A 4KXLA 4NOJA 3EY4A 3EVZA 5E3JA 1KAGA 2HXSA 1E2QA 2JFYA 1K7FB 3EQ8A 4W1PA 5EHQA 4QFMA 4X60A 3FPAA 1AMUA 1SRQA 4C0LA 4IRUB 3EFOB 1NUUA 5TX7A 4GBGA 4B32A 3LWBA 1GOTA 2WG2A 3ESQA 3LHFA 3HN6A 5JAZA 2I8AA 5THKA 3URKA 2V0CA 1O96A 1QYRA 5BVHA 2EIHA 2W2MA 5K8TA 3LYAA 1XDBA 1FYWA 4K87A 3WKDA 3ZE6A 2HFJA 2OO5C 5D84A 1LDMA 4XQGA 1G8HA 3OWXA 3BRWD 1I2BA 1YQQA 2UVPA 4OQ4A 3ORFA 2W42A 1RM3A 1NZDA 4P3OA 3AM4A 1NV9A 3MSXA 3QP9A 3A6DA 2JGIA 1U2GA 2X8AA 3N2NA 1FFXA 1EA5A 3KAQA 1LW6E 4JA0A 4OAQA 5IYZA 4MUGA 1KAQA 4J4HA 3K9WA 5C8VA 4IILA 4AY2A 3EXFB 1H6AA 3O9MA 4TT3D 4DB2A 4PHCA 5E9AA 3SLKA 3UH0A 3JQ6A 1MT3A 1VJTA 3GWZA