4V0OA

Crystal structure of bbs1n in complex with arl6dn, soaked with lead
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
b'SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
total genus 48
structure length 166
sequence length 166
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0oA00
2FOLA 3RSOA 1M7HA 4IVRA 1FMLA 3BB1A 3THOA 2B8TA 4UNSA 2ERYA 4GFDA 5B58C 3DZ8A 1II9A 2ZE6A 3BH0A 1W4CA 1M74A 4JVNA 4ZDJA 4QOSA 1Y3AA 4JVMA 2NTYC 1FOEB 2RGAA 4GOKA 4EPWA 4ZCMA 1RKBA 2WWGA 4MYHA 1DADA 3PEVA 4NZYA 4ZKEA 4KFUA 2OHFA 2ODWA 4Q47A 5B64A 3KL4A 4Y0AA 3T15A 2YOFA 2P2LA 2LCFA 4G0NA 3V4FA 5CK4A 3IIJA 5GJWC 3OAAD 1XMVA 2ANBA 2H1LA 5L3RA 2ZIAA 1DOAA 3IKJA 1R0WA 4BGDA 4KITB 1N5JA 1NSFA 1PUJA 2V54A 4I99A 5FR1A 1R0YA 4B76A 3QI2A 4NCKA 2D7CA 3D31A 3R20A 1XTRA 2H5EA 3HU3A 2XXAB 1MO4A 2EFGA 3ZIAD 5L8VA 2ZE8A 4ESHA 2VHCA 1OPXA 2GZHA 3TBKA 3TQCA 2W00A 1LY1A 5FOWA 4ON9A 3NTUA 1QG4A 1XJ0A 3AVWA 3R9XA 1BMFD 3PUWA 2GAOA 5FL7D 1ZM9A 2XNSA 3I8SA 5DYGA 3ASYA 1KMHA 4WZAE 1VG0B 2X1VA 4MRNA 3KQNA 4UJ5A 3C8UA 3REGA 1MO6A 4KI0A 1P61B 4YXWA 5JI3E 3NC1C 1BO6A 4FWIB 4HAWA 4BZXA 5JJLA 2W0MA 3NIBA 3N70A 4MH0R 2ZSBA 1Q20A 2R6FA 2HJGA 1XMSA 3I62A 3EZ9A 1R0XA 1H8ED 3IQWA 2H17A 1Q1QA 4CRWB 2IYXA 3W5JA 3NBZC 2GEVA 2NPIA 4B47A 1OSNA 3CBQA 4YDHB 5JECA 1VPLA 1FP6A 2GK7A 3AF3A 5G40A 1ANKA 4ZI2A 4MYUA 5JLJA 2WBLC 4N0EA 5EP3A 4CT5A 3AM1A 2DPXA 3NHBA 4LY6A 4QHSA 2KB0A 1R0ZA 2VP2A 1W2HA 4OQMA 2GJ8A 2IYVA 3TLXA 2WV9A 3LLMA 1KO4A 4O0MA 1SXJE 3QG1A 4MUAA 4NDZA 1Z6YA 2C78A 2H18A 4ILEA 1NBME 1R5BA 1FTNA 1KHTA 4JL5A 2Z0MA 1G16A 2IXGA 1QVRA 4LHZA 1CR4A 2A9KA 4M21A 4AY2A 1VCMA 2GESA 1Z6AA 3P26A 4WW0A 5AJVB 2FZ4A 1OH6A 3U44B 1NKSA 4HLUA 4IOKA 3K9LA 3FMIA 2OLKA 4V0KA 2RB4A 4PFSA 2EVWX 4C0JA 1Q21A 1N3BA 4C0LA 4JBYA 4ZCLA 2YC4C 4HUQB 4NONA 3CF6R 1GP2A 5DH9A 3UMRA 3SJZA 3ZDQA 4DSNA 1JR3D 1U81A 3ZGXA 1JJVA 1NVWQ 2WJJA 4FCVA 2AKYA 1U2RA 4F38A 2DFLA 4DCUA 4IFEA 2MMGA 2ZANA 3LDAA 3NH6A 2EFCB 1AZTA 1II8B 2WPDD 3SC3A 1N6HA 4UXHA 2ZI4A 1Q1ZA 4NHOA 3MCAA 2P67A 1CU1A 1PLLA 1CBUA 3K8YA 4ESVA 1IOZA 5CK5A 3LVQE 1P2VA 1ESMA 4QC2A 3KQUA 3EZ2A 1M2OB 4FMBB 5EZ6B 3X1ZA 4WOPA 3IEVA 4GMXA 1QHNA 2Q3MA 4UKDA 4B2PA 1WMSA 4KBGA 3KTAB 4YXWD 1T3SA 1RRPA 3S1AB 2J0UA 1G64A 4PQYA 3NH9A 1G7SA 4G5SA 4EPVA 5LDDC 1NN0A 3I8XA 3K70C 3VNUA 2RAPA 3B78A 2OUKA 2FZLA 1I4LD 2MSDB 4XWKA 1JECA 3IHLA 1RRGA 2CE2X 5CIQA 1W1WA 2ZAOA 4XH9B 1KNXA 1ZMXA 2B8WA 1B0UA 4EKDA 2G83A 1CRQA 1YR6A 1ZM7A 3NBXX 3RYTC 3ZZ0A 2GKSA 3KB1A 4LRWA 2BVNA 3TQFA 4I1UA 4DSUA 3QPUA 1AM4D 1XJCA 2C9OA 3SS8A 1UBFA 5AJZA 4KFSA 4XOIA 3BFXA 3GLHA 3B9PA 4I1VA 4R2IA 2AWOA 4QGHA 4BLTA 4IJMA 2OFOA 1G5RA 1T91A 4HB3A 4QBHA 2GILA 2ZYUX 1GVNB 3P4XA 1R6BX 4KSBA 3HPRA 1GG2A 2AWNA 2NO7A 4D0NA 2ZSDA 4RD4A 4V0MA 2W83A 2IS6A 4Q1DA 3OEED 4P33A 3K09C 1TF2A 1U90A 1G1MA 2Q9BA 2ZJBA 3FE2A 2NO1A 4LC1A 4MGIR 4PZLA 4UNRA 4PHFA 1UAAA 2XOKD 1X1RA 2XZPA 2H8KA 4RD2A 2MSEB 1Y63A 4FMCF 3W6OA 2GEUA 2O8DA 2VLIA 4IXMA 1KI3A 4K8OA 4OI4A 2EQBA 2BMJA 3CRVA 1NVVR 4UXIA 1TADA 1OXXK 1KMHB 4PXAA 2QBYA 1KOFA 5FTKA 1ETUA 2YVUA 1HUQA 1FW6A 1E2MA 1KTVA 1E4YA 1W2GA 2ZXUA 3Q72A 2SHKA 2N46A 4MRRA 3TGPA 1HEIA 1EFCA 3IBYA 2VH5R 3QEJA 4M53A 3OEHA 4BFZA 2JJ1D 3SFZA 4LYAA 4X8HA 3EZ6A 5HE8A 1P2SA 3AB3A 3LQQA 4BE7B 1N6RA 2BC9A 4B34A 2R2AA 5FPSA 2ZRMA 5C4GB 4TLDA 3NDBB 2PJZA 3SJCA 2G77B 4LYFA 2ODBA 2ZR9A 2PZEA 2W6JD 2NZ8A 1NN5A 4RCZA 1F48A 2DFTA 2WJIA 1ZJ6A 4TTRA 2PX3A 2WSSD 3UIEA 1DAFA 3QEOA 5LB2A 1KO8A 1XX6A 1KI2A 3CNNA 1R5NA 1SVLA 3KQLA 2ZVQX 1XXHA 2O5VA 5KDOA 1E94E 2RCNA 1HA3A 5C2JB 2KWIA 4QM7A 1XMJA 3THWA 1EFTA 4ZIRA 1T8TA 2QMOA 4HZUA 2J0SA 4P31A 1GWNA 1L2TA 1S9DA 4KXFB 3TAUA 4GOJA 3K70D 3LX5A 3NHAA 4NPHA 4DLVA 4B6FA 4JJKA 5ELXA 2VTKA 4TSFD 4YONB 1K8RA 2G0TA 2VP4A 1E9RA 1Z2CA 3UWOA 2PZGA 5F98A 1KGDA 1ZNXA 1AKYA 3LW7A 2GK6A 2FSGA 2W2XA 3CWQA 2WICA 2D7DA 2ZS8A 1UKVY 1Z0FA 2IWHA 5HPYB 3PENA 2J7KA 1UADA 3A37A 3QY0A 3AF0A 5CJPA 4RD0A 1NY6A 4PAOA 3P32A 4URWR 3LW8A 1ZUHA 4FCTA 3U3MA 1AJEA 2QT1A 1ZCBA 5LB4A 2HLDD 4C9BA 4I81A 1T5IA 4BFTA 1CR0A 4AG6A 4PQFA 3PITA 1JNYA 3NEJA 4U5XA 5FPHA 3SBEA 1EXMA 4D81A 2WJYA 5FI1B 1DAMA 1WCV1 1VECA 4PC6A 2GXUA 1OB2A 4LJYA 3GJ7A 2EFEB 4IVPA 1UKEA 2HYDA 1Z0DA 3EC1A 1E2DA 3U7EB 4DCTA 4DDTA 1MV5A 3BJIC 2D2FA 3BORA 1TNDA 5J4YA 3FHTA 3FMPB 1NJGA 1ZC4A 2NPFA 4DLXA 1G18A 5BN3A 1BH2A 3SOPA 2WTUA 3TE6A 3PUXA 1EFRA 1M7GA 1UKYA 1AZSC 4NYMQ 1F60A 2CJWA 2QMUA 2F6RA 2I4IA 4BFVA 2YOGA 1EFUA 2VBCA 3BS4A 3EIEA 3TSWA 1JPJA 1QHSA 2OCBA 4LHVA 3VHXA 4A82A 1EK0A 4GPTA 4WVFA 4QBGB 1Z2AA 3VU9A 2OE2A 2VSXA 5HCNA 4Z1MD 5DLQC 3QSYA 4MGYR 2ZI9A 4OQFA 1XMIA 3O8RA 3CX8A 3RRNA 3T61A 1DAKA 2IHBA 1KO5A 2CCKA 2JEOA 3A4MA 3GLHB 2WIAA 2O0HA 4TTQA 2IWRA 2KSQA 2I3BA 3K0CC 3NG1A 1ZNWA 3ZVLA 4P4UA 2GJKA 2XNDD 4GBMA 3N2EA 2AL7A 2HYIC 2B92A 2VEDA 4EDHA 1SXJC 2ZSAA 4BLPA 4Z8YA 1UBEA 4FW9A 4QHYA 5H70A 3MSXA 3SBDA 4S2EA 4TQ9A 1Z0KA 2C8VA 1D2MA 4LI0A 4ZPXA 4F7WA 5GJVC 1KSJA 3AUYA 3OIYA 5SZIA 3QXSA 2ZRCA 4D26A 2KBFA 1CIPA 2OCYC 3U3JA 3RS3A 4CYMA 2AD5A 1MABA 3FHOA 2ZVPX 1KI9A 2QI9C 1HE8B 3DO6A 3QKTA 1DVRA 1AS2A 4B75A 2O8DB 1VG8A 5KHOC 3AVUA 2C96A 1AIPA 1P60A 2B7CA 3UATA 3M1IA 2J41A 4ASUA 3FPAA 3LBIA 2FF7A 2GZAA 1P2UA 1YU9A 5FFMA 4AYXA 2QBYB 3B2EA 1GNPA 4C3ZA 3QXXA 2ZYVX 4LPSA 1OHHD 2IYTA 4GOXA 2FG5A 2QAJA 4M1MA 4KLZA 2JIZA 2ZI3A 1SKYE 2ECKA 5LD2C 1SVMA 2GCOA 4B48A 2WMNB 2JLQA 4A8JA 2QL6A 3CZQA 3FMFA 4E09A 4IDNA 4LUCA 3CIOA 4K46A 3C5CA 4TYQA 2QP9X 1W0JD 4W5HA 5K8UA 1P9RA 3I4LA 5EE3A 4Q01A 4KLNA 3GP8A 1W4RA 4B3XA 1E0JA 1G8GA 4YLGA 1CR2A 3BAFA 4JJZA 3BH6A 2P6RA 4C0HA 3A1UA 3KJEA 1E9SA 1KI8A 4JLOA 5JJKA 2GF0A 2F1RA 2WOOA 3AF4A 4IOJA 4Q5IA 5K8IA 1GKUB 5KYKA 1YQTA 4DLZA 3U6KA 2K5UA 1KK1A 3C5HA 1E9FA 3DHWC 4OQNA 4Q9IA 3DMNA 1AGPA 1ZC3A 4JL6A 1GFIA 4O2RA 2WJGA 1W36B 6Q21A 4UJ3A 3DDCA 4DVGA 1HQYE 2FH5B 2BIFA 4PC2A 1VCNA 2J45A 1XXHB 3MAAC 4AIIA 2KI5A 1CP2A 4IOMA 2IS1A 5BQ5A 1KJYA 1XRJA 3WBKA 2B21A 2JDID 4ZDIA 2WKPA 3ZLJA 5DISB 4HZUB 3A36A 4DXAA 3CH4B 1SVSA 2R8RA 1D2NA 2N1BA 2C9CA 3WMGA 3H2YA 3WHLA 4R9UC 5AUQA 1XF9A 5DYIA 3QE0A 4L5BA 1TX4B 1DAHA 1KDRA 2D06A 1G5TA 2OCPA 3B13B 1FP7A 3QNUA 4PO1A 5FTNA 3WXMA 1MOZA 1ZU5A 2FGKA 3IHWA 5FUXA 5AJYA 3WYGA 5JCZA 4C4PA 3QKSA 1YR7A 2I1QA 1OFIA 1Z08A 1HY3A 5EE1A 721PA 3FKQA 4KV9A 4TMKA 3WRXC 4B71A 1TU4A 4MRSA 1FQKA 5TARA 3OIUA 2HUPA 1S96A 1ZYUA 4M1WA 1P9WA 1PVOA 2GBLA 2BBWA 1E1RD 3THYA 2IYRA 1QVAA 2JGNA 1TQ2A 1YR8A 1G4UR 3K1JA 4RD6A 2VHQA 3LD9A 4AG5A 2FE4A 1SXJD 4LJ6A 3GMTA 3TUJC 4KHZA 1EG7A 1NMYA 1NBMD 2IF0A 4A0GA 4OI1A 3ICQB 1OF1A 1RFLA 4TMXA 5FI0B 1DPFA 5C46F 3B6EA 2WAYA 3QXJA 1EESA 2YWEA 3CF2A 1CR1A 1NLZA 1SQ5A 2P6UA 3KKMA 4FINA 4DLTA 3IILA 2RGNA 3CZPA 2GJ9A 1NJFA 4HYYA 3SYLA 2FPLA 1BYUA 3VMFA 2NQ2C 4AKGA 3FWYA 1AKEA 1N6OA 1E9AA 1JQJC 2VSOA 4V0NA 4LV8B 3ND9A 3CNOA 1JPNA 1XPUA 1YZTA 5CM9C 3C4JA 4KFTA 1GL7A 1H65A 5KPJA 1PV4A 2JLXA 2HDNB 3OAAA 1IQPA 4HLQB 1E0AA 4XD7D 3T12A 1LNZA 4C2UA 4XTCS 3VU9B 2DWPA 1SHKA 3WNDA 4HAXA 3GLGE 4NCJA 1Z06A 5JZVA 1KZ7B 3U7GA 4OBEA 4JVSB 2CEAA 3BB4A 3B8HA 4CT4B 1KK3A 3H1TA 1WXQA 1G19A 4TLAA 1Q44A 1DTSA 3ZIAA 3EG5A 4D80A 1WBBA 3VKHA 3RDPA 4XSHA 1LB1B 4XVUA 5CB6A 3PEUA 2IYLD 2EW1A 1IY0A 1Q57A 1NMXA 4ZKDA 2PH1A 1BMFA 5JSZA 2OBMA 4HB2A 4LDJA 5FL7A 2GXSA 3M4YA 1IN4A 2NOAA 3B1ZA 3JZAA 3LQRA 3GLIE 5GVSA 2C9YA 1EGAA 1CJUC 1SHZA 3B7GA 3ETLA 3QQ5A 2CHVA 1MABB 4NBSA 4PSVA 3AF1A 4S35A 2QN6A 3EPLA 1G20E 4Z8XA 2X2FA 3QG5A 2JLZA 4HATA 3VR4A 121PA 5FUWA 3U6BA 2L0XA 1OLOA 2J46A 4NYMR 1UKZA 4C0BA 1H8EA 1I2MA 3CR7A 4D4KA 2DY1A 3NDPA 1NVXQ 2F1JA 4DLWA 5L3QA 1SVOA 2ATVA 4F4IA 1U8ZA 1UDWA 2GCOB 4PSKA 3K9NA 4LSGA 4AKEA 1CLUA 3DOEA 4TLCA 1CKEA 2MMCA 2NMVA 1PLJA 2V4ZA 3A1SA 3T5DA 4KO8A 3GJ5A 4D6PA 3I3SR 3LLUA 2JATA 2EFDB 1C4OA 1UPTA 3MWKA 2FSHA 4UNNA 4A36A 2IA5A 4OJQA 3NEYA 4HLCA 4LJ4A 4YMWA 1SKQA 1GOTA 3HDTA 1MR3F 5C18A 5HZKA 4PPFA 1NF3A 5EUQB 3ZJYA 1B23P 1D2EA 4K81B 1NG9A 2YINC 2PJRA 3L2OB 1P7CA 1I4DD 1S2MA 1E2QA 2CVHA 2FPMA 4LYJA 2F43B 5FBWB 3FTQA 1M6NA 1IXZA 4H1UA 1G17A 5DGXA 3EZFA 4CDGA 2E87A 4Q9KA 3Q7PA 4G5RA 5FBVB 1CF4A 4P4SA 1JR3A 3ICEA 4TT3D 2BV3A 4B35A 4PC3A 3E5HA 2RMKA 2J7PD 3WMFA 3LXXA 5E4FA 2BMDA 2ZE5A 1AQUA 1G3QA 2BEKA 1J8YF 1NN3A 2WM9B 1O3YA 3QKSB 2IK8A 2V6IA 2WPDA 4KFRA 1RRCA 5J40A 3QJYA 4BUJA 1YE8A 3TK1A 1P62B 4I1OA 2GCNA 2PX0A 4DZZA 5SZHB 3IPYA 1OFUX 1S1MA 4Q1EA 3ZQJA 1XEXA 1GM5A 4Q19A 2ZJYA 2ZITA 1S3SA 1NP6A 1ZUNB 2YOHA 1KAGA 1TQ4A 1HTWA 1E2EA 2Z43A 4LCBA 3C41J 4YMVA 2IEZA 2PZFA 1E9EA 1YZUA 2C99A 5E7IA 2G88A 1FUUA 2OXRA 2QGNA 2OFXA 4CF7A 3U7FB 2EWVA 4NYJQ 1E9CA 4US0R 2YKGA 4WZ6A 1DG1G 3O8DA 4M2LA 2HT6A 4X8OA 4A0FA 2R62A 3RRZA 4KVAA 5L3VA 2IHYA 1ZNYA 2N42A 2W2TA 1FX0B 4C0AC 4W7SA 2WKQA 3DM9B 2PEYA 3SYNA 1COWD 4F92B 1KIMA 1XTJA 4CEIB 1TL7C 3GEEA 3ADDA 4RFSA 3K0FA 1KSFX 1MH1A 5DE3A 1R5OA 3BK7A 1ZIOA 1HT1E 1WE2A 1OIXA 3A1VA 4M1YA 2D4HA 1X8KA 4M1OA 4QG7A 3GLFE 2O8CA 3SU8A 4WAUA 3O8BA 4DCVA 3W90A 4Q7KA 3V00A 1W0KD 2X77A 5FBQB 3UWKA 3MLEA 1XFAA 4O2LA 2HT1A 3Q85A 2BBOA 1NVUQ 2VPPA 4KJZA 3OEEA 4E22A 3KKOA 3PUZA 1Q1EA 1SVKA 1E79D 4GL2A 4C0KA 3KXIA 5AJWA 3K9HA 3N5CA 4G1UC 1ZVQA 2CHQA 4GI7A 2IXFA 4DCSA 2XOKA 2AD1A 1E2NA 1DARA 3CPEA 2R6DA 1G7RA 2WHXA 2ZRDA 4FD2A 3AKEA 2JLUA 3CM0A 4TTPA 2GAAA 1J7KA 5JSZB 1JEDA 1OW3B 1XTQA 2V6JA 3SHFA 3KUCA 4UNPA 4IDQA 4MKFA 4EJSC 4MKGA 1H8HD 2RKOA 4LJAA 4JLVA 1T3HA 3HYTA 4OL0A 1G3RA 1G3UA 3P27A 1ZINA 3X1XA 1FL9A 2KE5A 1QDEA 3ADBA 5EE5B 2ZR7A 3EW9A 2LKCA 2XZLA 2P3SA 4LJ7A 2QMHA 4Q9HA 4BEJA 3BIFA 2JJ1A 4HZIA 1GZSA 4DLUA 1OB5A 2G6BA 3VQTA 1YZKA 2WWXA 1XU4A 2IYZA 4LYHA 2BKUA 3QKRA 4MRVA 4E5UA 4B6EA 4BFXA 1NY5A 3BERA 1D9XA 3E2IA 3CB4A 1GL6A 4MDEA 1OIWA 4JLAA 5L3QB 1P75A 3LBHA 2IXEA 2W6JA 2ZI5A 3LX8A 3NKVA 2GCPA 4QRHA 1FQJA 3BWDD 4IKEA 2CMKA 3L0OA 4ZI3A 2UVQA 3UMFA 3J81k 1M8PA 1G7CA 2WSSA 2OCAA 5G41A 5TXGA 5F9FA 2ZUDA 4BLOA 1Z6XA 2QY9A 2QAGC 3CLVA 4M9QA 3GJ6A 3MRSA 1IN8A 4ITRC 3O8CA 4BLRA 1W49A 2CL7X 2HEIA 1XDBA 4OHWA 5JRJA 1M34E 3SFVA 4G3XA 3U3OA 1KK2A 3E70C 3X1DA 4ACAA 3IIKA 1S9HA 1KSHA 2FDCA 2FJUA 2VP9A 1HQCA 4BQSA 2TMKA 2O8FA 2ZROA 4B3BA 2G9NA 4ZCIA 1N6IA 4I1SA 4TSFA 4V0LA 3AP2A 4OK6A 4HB4A 5D3QA 2J0QA 4FMDB 1DEKA 1OXUA 1YRBA 1ZD1A 2FFHA 1KI4A 3Q5EA 3T34A 3IGFA 4JYBA 3UG6A 4EPXA 3ADKA 1QG2A 3TNFA 2AFIE 4L16A 2IX3A 5LBIA 3W34A 3VR1A 2Q21A 3GEIA 4Q00A 1OKKD 4LHYA 3PUVA 3A1WA 3K53A 4Q1AA 4P4SB 3KQHA 3EWAA 4NYIQ 3WBJA 3HU2A 1US8A 2A5DA 2P6NA 4QNRA 2HXSA 3ZYCA 2CL0X 4JS0A 1D6JA 4M9SA 2HLDA 5HZHA 4GRAA 2G1KA 4TYPA 2WWHA 4RVCA 5E7JA 221PA 4Q21A 5AR1A 1A1VA 5FTJA 3K0EA 2ORVA 2FGJA 1KDOA 4EFLA 3SZRA 5J4HA 4TL8A 4NU0A 4A6XA 3UKDA 3IO3A 1T0HB 2QPAA 1Z63A 1XEXB 3K09A 1BIFA 2AXNA 1U9IC 2JASA 4HLDA 3BGWA 1ZM4A 4YMSA 2AR7A 2Z4SA 4Z54A 1RYHA 1OYYA 1IN6A 1ONBA 4KSCA 5CITA 4D4LA 1E6CA 4LK2A 4LGMA 4R7ZA 3W5IA 3T35A 1Z83A 4V03A 1GRQA 2NZJA 4DC9A 2OEPA 3TW4A 2REXB 3ZD7A 3PEYA 2YYZA 1N0WA 4W9MC 2FX3A 3TVTA 5HR5A 1E3MA 2GA8A 1YKSA 4Z1MA 3W6PA 4US2R 2CLDX 3TUZC 2HV8A 4TLEA 5IDVA 4JL8A 4RFSB 2PMDA 1GKIA 2H57A 1NLFA 3A6PC 4F91B 4KCGA 5TY0A 1GUAA 2O8CB 2GHIA 3QXHA 2P5SA 2VRWA 1ZIPA 4D4MA 3MFYA 4KVGA 2YNMA 4IEIA 1HYQA 1KI6A 4Q1CA 1NN1A 2XNDA 1G41A 2R6AA 3KJHA 1DAIA 3CW2A 1G8PA 4FXPA 4Q4AA 3T1TA 3QIAA 4LHXA 3VR3A 1NIJA 3NWJA 3F8TA 4LBYA 3KFVA 4Q9JA 1QZXA 4ARZA 2FSIA 1U8AA 1LF0A 4BRUA 3KKQA 1E2GA 1CS4C 1XCMA 1J70A 1M7BA 3BXZA 3GEHA 3AP1A 3I32A 2J87A 2A5JA 4NL4H 3OF5A 1IAQA 4TL7A 4TMWA 3TR5A 4FN5A 3AEZA 5KPDA 2X19A 1C1YA 2A2ZA 4B3CA 2JLVA 1T4GA 3PIRA 4DIDA 4ZO4A 2F3RA 4TL6A 4NYJR 3L43A 1V43A 2RGXA 1GL9B 2I1VB 1OHHA 5CDFE 2FN4A 4OKSA 2PCJA 4A6PA 2IT1A 4TYYA 3DM5A 5KTYA 1J90A 4Q48A 4GSYA 5FOXA 4TMVA 1NLYA 4Q4JA 1W0JA 2QMEA 1A2BA 4DRZA 1U0HC 5BN5A 5D3MA 4MRPA 3BRWD 4OHVA 1JBKA 3UXMA 4DJTA 1Z47A 3C16C 3QKRB 3RANA 5A5GA 3W3AA 2JA1A 4LBWA 1LVGA 1SGWA 4NCNA 5H1YA 5J47A 1RRFA 3I92A 3D6TB 2CXXA 2AK3A 3QBTA 5CM8B 4R2HA 2BEJA 2J0UB 1IY1A 2J1LA 3VR6A 5FBLB 1U0JA 3ZS8A 3U4QA 4Q4HA 2ZU6A 3ZQ6A 4A92A 2F9LA 2V1UA 5C1BA 5BN4A 1JAHA 2CDNA 5FUYA 3T5GA 1G21E 2GVDC 1XPRA 3QBVA 4IDPA 2IYSA 3W8NA 1GILA 3RWOA 2JDIA 2ZM5A 1E2KA 2GTPA 3W6NA 4M1KA 3W3ZB 4B3DA 2CK3D 1QHHA 3DZDA 1ZU4A 3EA0A 2O8FB 3K70B 1F2UA 3EZ7A 5TV2A 1E9BA 5EP1A 4KODA 3BBPA 4JZKA 4URXR 2ODEA 5EXTA 1KDPA 1AK2A 1UEJA 1WDTA 4U7DA 4RFVA 1P72A 3OFND 4IDOA 2VQSA 4RKEA 3G0HA 5FTLA 1DO0A 5DSZA 3LA6A 4TZ0A 4PHTA 4AK9A 4QJ3A 3I61A 2YHSA 3BE4A 4B2LA 5DN6D 3ASZA 5KDDA 1FPMA 2YWHA 1US8B 2EYUA 4N1AA 2ZJAA 2QSYA 2GNOA 2ZRAA 1CJVC 1GSIA 3KFXA 2WSMA 4Q66C 4YC7A 4TZ6A 2IF2A 1E1RA 3K0CA 5E95A 5AJXA 1YZQA 2RHDA 3PCRB 4LOAA 2F1HA 2RGGA 1LV7A 3IUYA 4G5QA 1E9DA 1SXJA 4OJKA 5FL3A 1RPZA 1NBMA 3SQXA 2GF9A 1UEIA 3DVLA 1ZD8A 3VKGA 4KBFA 4MGZR 2QM8A 3LY5A 1PJRA 4QFMA 1SZPA 3RS4A 1KI1A 2FA9A 4HAYA 4URVR 5JWHA 3EA5A 1WP9A 3CONA 1E99A 1XEWY 1G9XA 3FKSD 1E98A 2UKDA 4JLJA 1OYWA 5GJBA 5C4MA 2BBTA 5E7MA 3AQ4A 2QROA 2XX3A 2QA5A 3CH5A 3GD7A 4PAMA 1JR6A 2QORA 2XJ4A 2H92A 1Q3TA 4UXJA 1N0UA 4XD7A 2O52A 1X1SA 2A30A 2MSCB 4RJLA 3DKPA 1JAIA 1W48A 4RY2A 1G7TA 2WKRA 1TEXA 3Q9LA 1DE0A 2NGRA 4NYIR 2F3TA 4M4SA 2CCGA 4KU4A 4PC7A 5TVKA 4CEJA 1YZNA 1D9ZA 1ZBDA 1ZW6A 1F5NA 2BCGY 4PX9A 4QHTA 4EPYA 1YR9A 1L7VC 2QEQA 1KI6B 1YVDA 4KYUA 2Z4RA 4Q4AB 1VHLA 4JLDA 2Q9CA 4JLPA 2BHRA 4JMPA 1VTKA 1OFHA 5EXPA 3THWB 1DELA 1QF9A 4ZIRB 2J59A 2UZIR 4ARZB 1KI7A 1WRBA 3LO5A 2CHGA 4XSGA 4AKIA 3AVOA 1IONA 3EARA 3TIFA 2ODNA 5L3SA 3FGNA 3TH5A 5LPNA 1E2HA 4M0LA 3K0AA 1KYIA 1QBKC 3KX2A 4GDFA 3HP1A 5HE9A 5AUNB 3VR5A 4GNKA 2FWRA 3L0PA 3V4RA 1C9KA 3KQKA 2QPOA 5SZKB 3AV0B 2JJ8A 2GWHA 1AS0A 1VKJA 5JRZA 1NSTA 2JLYA 3MWJA 4LBVA 3C14C 1HURA 4JSYA 4Q7JB 5J4LA 3FMOB 4MDFA 3PJRA 1E69A 1NKTA 1XWIA 4ZV4A 4II7A 1VG9B 1N6NA 2ATXA 1W5TA 4Z51A 3EAQA 2VL7A 4Q4JB 1X8LA 2GBLC 2GZDA 3EASA 2F1IA 2XJ9A 2BMFA 1MO5A 5D3MB 1DG3A 1OE0A 2FPKA 4XVRA 1G5PA 1N5KA 1VYTA 1NNEA 1KY3A 8OHMA 3Q8XB 4DBLC 2CLSA 2QQ0A 2JJ2D 3K9GA 3M0EA 2IUTA 1OV4A 1XD2A 1E1QD 4A4DA 2IYWA 2NO0A 3H86A 4AKHA 1NG1A 3I5XA 2F9MA 3U4QB 1U94A 4Q4HB 3B82A 1R10A 2CJWB 4QXAA 4H1VA 3U2QA 3AVVA 2XTZA 1UJ2A 3ADCA 1RC8A 5BXQC 3AP3A 5SZJA 1IJEA 3H0KA 3SDZA 3ZVRA 3GLHE 3PXGA 3SYKA 1CXZA 3LH5A 4RZXA 4EUNA 2ZRJA 1AN0A 3QPWA 4KYIB 4JLKA 2RGCA 4M8NE 1QHHB 3HJNA 1GRNA 1F2UB 2QUZA 3KXLA 4Q03A 4TT3A 4XWAA 4LZZA 2Q3FA 4QGGA 2HCBA 4V0ME 3ZVNA 2J7PA 3QKUA 3RAPR 2W0SA 1II0A 5DHAA 3BC1A 3TJZA 4YMTA 3MWLA 2OESA 5F2EA 5G53C 5EZ5A 2E1RA 5EP2A 1XD8A 1KSGA 3SNHA 3OE7D 4A2WA 3U61B 3WYFA 5IT5A 3LFUA 4W5JA 1NL3A 3HPQA 4WA7A 3I72A 5FOVA 4RZ2A 1QRAA 2ERXA 1ZCAA 1VHTA 4URZR 5G3YA 2CCJA 2W58A 4HB0A 2HJVA 2V55B 1VIAA 4TQUS 1Z6GA 2ZJZA 1CRPA 1U99A 5DO9A 3Q3JB 2QT0A 2H7VA 5B2ZA 5AUOB 1XBTA 4YQFA 2QRZA 5JHHB 1OXVA 1SXJB 3B1WA 4MUBA 1TF5A 1XNJA 3ZS9A 3RABA 1CULC 2NG1A 4EAQA 2NO9A 4QKQA 5DNYB 2OLJA 2VP5A 3IQXA 4HI0E 4DKXA 4U02A 1I2DA 5JJIA 3EPKA 3MGCA 2VHJA 3CRMA 5FOUA 1L4UA 4IW3B 2CNWD 3IPXA 4HEJA 4R98A 1COWA 1G4AE 4G01B 2XSZD 4A8JB 2GETA 1PZNA 3EPHA 2WZQA 4OQLA 1E2PA 4O3MA 3IIMA 3U5ZB 1HE1C 3B1VA 2XTMA 4RZ3A 5JS7A 2WAXA 1TEVA 2DWOA 2O0JA 3DOFA 5IK2D 1N6LA 2EU8A 1EX7A 2PT5A 4TQAA 1UBCA 1W44A 2QZ4A 3DEFA 5KSZA 1XXHE 1W0KA 3UPUA 2XB2A 5KNCA 2Y8EA 4N0DA 4G5GA 5LD2B 3X1YA 2B6HA 1MRSA 3QF4A 4NKRA 2O8EA 3TW8B 4N3NA 3PUYA 4A2PA 3KZ1E 4HDCA 4TYWA 2IW3A 3T1QA 4D0GA 5CIWA 1E79A 2G0NA 1DBSA 3VFDA 2DWQA 4CEJB 3M6AA 2W2VA 3HR8A 1XEFA 2ZYTX 2CVFA 3AKDA 2ZRIA 4LJ5A 2AK2A 3NBFA 1ZM3A 1ZAKA 1CJMA 2PCLA 1J99A 1YHNA 1RIFA 2Q0HA 2ZJ8A 3TAHA 1OH8A 1H8HA 1G6HA 2ONJA 4DB2A 3CF0A 5L3SB 2ZRHA 3WRYC 1LTQA 1UF9A 2O0KA 1WQ1R 3K0AB 3LRPA 5J4VA 1LS6A 2ZRNA 4D82A 4CVNA 5JHGB 3SN6A 1F2TA 1FTSA 2WMOB 4XIGS 3GFOA 5A4JA 2QENA 3EC2A 2ASEA 3FYHA 4GP7A 2AXPA 1KJWA 2JAQA 4B3GA 5HKKA 2EFHB 3SQWA 4E07A 3A1TA 4C0QC 4DDWA 2V7QD 1SULA 1P6XA 4QM6A 3PEWA 2QM7A 2VP0A 3CPHA 4PPGA 3LXRA 3CX6A 4TL9A 3FFAA 1ZD9A 2VHTA 1ZRHA 5GJCA 1AGRA 1D5CA 3VX3A 2W6ID 3BFKA 3DKVA 3W9YA 1TF7A 3THYB 4XJXA 1VMAA 2PT7A 2IEYA 3MD0A 4X8LA 2V3CC 2IUUA 3EIQA 4NP6A 1S8FA 1X6VA 5P21A 2EWWA 4NH0A 2ZRGA 4AD8A 2CE7A 5JI2E 1N5LA 1Q0UA 2B7BA 3GJ4A 3GCGA 4M1TA 4NCIA 1Z0IA 5BYJA 3F3YA 1R8SA 1LF5A 1N6PA 2R6CA 4WXPA 1UBGA 3AGPA 4EPTA 1XD2B 3TUIC 1XEWX 2A78A 2ZU0C 4Y0VA 1LS1A 2DYKA 4AYWA 4BECA 5TB5A 3RNLA 2QTHA 3REFA 2FNAA 4Q1BA 4F4JA 1ZP6A 3QVUA 4G5OA 2JLWA 2IUSA 3D7MA 3VR2A 4M22A 2WJVA 2X8AA 3FVQA 3CR8A 5IF9A 3TMKA 1OH7A 1YJ5A 1OKKA 3CNLA 3HYRA 4JYCA 5DI9A 3G82C 4IFBA 5K8TA 1VYVA 3VAAA 1J2JA 2IS2A 5EUMA 2PL3A 2BCJQ 4B74A 1ZM2A 2OO7A 2YZ2A 1IBRA 1FNNA 2ZRFA 1LFDB 2FFAA 4BRWA 5B57C 1TU3A 2D2EA 2J9RA 2G1JA 3T1OA 5CYOA 1W46A 2ZSFA 4PZYA 4BFSA 4HLUC 4NTZA 3THXA 3V9PA 4MKIA 1FZQA 2LWIA 4FI3C 1W7AA 2A7QA 2J5XA 1OFTA 5DHFA 1E0SA 1WB9A 2XGJA 5CB8A 4DT1A 4CEHA 3QENA 5G3ZA 5A0FA 4BFWA 2C2HA 3NVAA 3PVSA 3TR0A 1T9HA 3SE0A 2R9VA 2ZRKA 3UMSA 4WBSA 3CRRA 4IVQA 1G3MA 1GDDA 2ZJ2A 4DLYA 5HKKD 1ZNZA 4Q1FA 4DB4A 2DR3A 5EXXA 4LWZA 4EJSA 4R71A 4JLBA 1F6BA 1TPZA 4IRUB 4F93B 2PEZA 5J5CA 3C7KA 2WIBA 1IM2A 4NE2A 1L8QA 1IXRC 1A2KC 4MQBA 3U3RA 5FUVA 2VO1A 3QXCA 1T0JB 3A4LA 4BFUA 3SJBA 3KDSE 4PSAA 3RRYA 3UG7A 2CLCX 1VDZA 2OZEA 4AI6A 3RS2A 3AF2A 2VYFA 4IXNA 5TMPA 4F4CA 1SVWA 1BKDR 3R8CA 2ZI7A 5M04A 3X2SA 1R2QA 3VX4A 4A9AA 1E2LA 2XB4A 4HAZA 2QNRA 4Q18A 2IYUA 3HU1A 4D0LB 3KJGA 1AA9A 1E2JA 1ELOA 1QHYA 2VIIA 3QOFA 4JIMA 1TQ6A 1CEEA 1WA5A 2CBZA 3MG9A 5GADl 2O8EB 3QF4B 5KOYA 1E0KA 5EP4A 1A5TA 1X8JA 4IOLA 1IXSB 1XTKA 1PLKA 1ODFA 3AH8A 2OXCA 2AX4A 1E96A 1IY2A 4A15A 4BFYA 2VP6A 1G291 4O25A 3TSZA 3ECCA 2QAGA 2O8BA 5EE0A 1Q22A 4Q4LA 3L0IB 2WVJA 1KO7A 4KAXA 2LKDA 4OYHA 3AVYA 4C30A 2Z5FA 1GIAA 2ZRBA 4DSTA 1XTIA 1NRJB 2GVZC 3L8YA 5EJEA 4GP6A 2F7SA 3PR1A 3BOSA 3HWSA 1JALA 1Q3HA 3GJXC 5JS8A 5DI3A 2OT3B 2GXQA 4QBIA 4B33A 3TSOA 1KO1A 2BM1A 1F3OA 2PLFA 3NBYC 2ZTSA 1F2TB 5CLLA 4BASA 3VNVA 2WJHA 1IN5A 1PUIA 1HT2E 1NIPA 3B9QA 3RHFA 3R8FA 2ZE7A 3W8RA 2ZQ5A 4RD1A 5J4KA 1G8HA 3A58B 4MITA 5TDHA 3KJIA 1EWRA 3EX7C 4FMCB 2ANCA 5BYKA 3EIHA 1MO3A 4FMDF 621PA 1YZLA 3GJ3A 2BBSA 4GT1A 1A7JA 1Z0AA 3O47A 1XTSA 1W4AA 1Z8FA 4L4UA 4A1FA 4AWXA 3GLGA 3F5FA 5EE9A 2Q3HA 1D8TA 1U98A 2HF8A 2QQEA 2QSZA 5GVRA 4DLSA 1BYIA 1OXTA 4RZUA 4IDHA 3H4MA 4XTRA 1A4RA 1Z29A 3RLFA 2QGZA 2ZRPA 4OHZA 3CRQA 2IYQA 2QE7A 1XCPA 2ZREA 2VA8A 1XZPA 4JLMA 3WMEA 4QBFA 3MJHA 4LV5B 4E03A 3GLIA 1U9IA 4V0OA 2REOA 3QUSA 1VIYA 4IEEA 5ANRB 4JKIA 3MWYW 1KMQA 2AHOA 2CK3A 2PMKA 1IN7A 2RGDA 1T8UA 1S3GA 1N6KA 2ONKA 4GMDA 3K0FB 2D62A 4FWTA 4OHXA 2OFWA 1MKYA 4GZMA 4QJ5A 3VKWA 3U60B 2DB3A 3R7WA 3SHWA 3Q5DA 3CX7A 3UK6A 1VCOA 3OFNA 5H8WA 4LC0A 1W36C 1TTTA 1TMKA 3WP1B 2JCSA 3P4YA 3SR0A 4D4JA 3SJAA 4B32A 3CO5A 1U0LA 1Z6TA 4PHHA 5DN6A 3AKCA 5KSPA 1SKYB 3HR7A 4B2IA 2XZOA 2BDTA 5EQTA 4HSEA 1DAEA 3NC0C 5EXSA 2IBMA 2OBNA 2PLRA 1MRNA 1WBDA 2QTFA 4MKHA 5FR2A 4HAVA 3D8BA 2FFBA 4D2IA 2RHMA 3ND8A 2IS4A 3PFIA 1IJFA 3RS5A 1OH5A 3AVQA 1RZ3A 3RC8A 1P4SA 3THXB 2ZRLA 3KB2A 2OG2A 2Z83A 4U00A 1R7RA 3AUXA 3FOZA 2ZS7A 4OQXA 4DT1B 5HCIA 4DLRA 4CEHB 3L82B 1P3JA 1RW4A 3FDIA 3AVXA 4EFNA 5AUPB 3OIVA 4MYCA 3P1JA 1MT0A 4DDVA 2BMEA 2EYQA 2QP3A 5B30A 4LJ8A 1XPOA 4EIWA 4XWOA 1K5DA 1QHGA 3B60A 3TVDA 1UM8A 3JZMA 4CZ2A 4EJSB 4JT4A 3FKSA 2RH5A 4HDOB 3RS0A 4P4TA 2Q9AA 1P9NA 2PBRA 5FPYA 1CJKC 3B1XA 4RCYA 4LBZA 3BH7A 2BJWA 1XB2A 3DL0A 2WOJA 3FFBA 2RGEA 3CUEF 1E2IA 4DCNA 5FOTA 1EX6A 1I4TD 3N2IA 1Z22A 4XVQA 1TUEA 3VTKA 4AURA 1W4BA 3I1FA 2NO6A 2ZS9A 4PZZA 4LX0A 3WP0A 1G8YA 2ORIA 4CIDA 3I5YA 4OI0A 2QE7D 1IHUA 2A5GA 3TRFA 3SI7A 4UQOA 2ZYWX 3C15C 4LPKA 1KZGB 2AFHE 5UKDA 3ONWA 2V1XA 3WNCA 2XAUA 3JVUA 2D3WA 1VCIA 1QHIA 4MYTA 3E1SA 3VHLB 1FNMA 1T3LA 4RD3A 3OEHD 1JR3E 2OV2A 3AKYA 4MA4A 2G3YA 2QAGB 2QG6A 2O8BB 5JWOA 3LWNA 2A3RA 1QHXA 1VG1A 3FB4A 5FOSA 3JVVA 1AQYA 2V9PA 3KUDA 4PO8A 1KKLA 1V5WA 4C7OA 1TAGA 521PA 3L8ZA 4MGKR 1GKYA 4M9XA 3CKLA 1A82A 4WIAA 5DI3B 4A2QA 4CW7A 5JEEA 1Z28A 4AC9A 3U7HB 1KNQA 2DBYA 3UANA 4L15A 1EFHA 2OBLA 3PV0A 2ZUCA 5KNDA 1XZQA 3CWZA 4GZLA 4EQ6A 2ORWA 2FEOA 2R6GA 5AK0A 3GLFA 2FSFA 3LVRE 4JT2A 4C0SA 3AVPA 5KSOA 1W36D 4CGZA 1YZGA 1N25A 2P65A 5AWFC 3WY9A 2GEDA 1WF3A 3QVVA 5F9HA 4DEYA 2ZR0A 4JBXA 2DHRA 4B44A 2R44A 2QU8A 3GLGB 4ABYA 2C95A 4BZPA 3MJRA 5H68A 3P20A 4PPNA 4W5WA 1YRAA 2FEMA 1RJ9A 2JJ2A 2C77A 2FMXA 1NI3A 2A5FA 4B73A 1E1QA 3PG5A 4UNQA 4DUGA 5KU1A 3RVBA 2OM2A 3WNBA 4A8JC 1XP8A 1RYFA 2ZUBA 1R4AA 4PR0A 4PC1A 2QRNA 421PA 2JLRA 3IBGA 2ZAMA 3GLIB 2C04A 2ZJ5A 3ZZTA 1AS3A 1DS6A 5JWRA 1JEEA 1N0VC 5IHPA 1HV8A 2AN9A 2R65A 4TN1A 4EFMA 2REBA 2NIPA 4RKFA 1GITA 4J0QA 1GRRA 4JSTA 1N2CE 4BPBA 4I4LA 1U8YA 1SVIA 3R7WB 3QPVA 3A8TA 1CTQA 4B3FX 2YC2C 4D25A 4L9WA 5HTKA 1T5LA 3EWSA 1KY2A 4ZDWA 1GNRA 5FH9A 3OE7A 1JB1A 1N5IA 2IL1A 4NMMA 2AKAB 4NCHA 2RGBA 1FMJA 2FFQA 4YMUA 3A4NA 4QNMA 1E32A 1KK0A 1Q12A 2QTVB 5FBRB 3LNCA 1GAJA 1FFHA 3GJ0A 1EFRD 1E4VA 4ERNA 3EXAA 4QL3A 5KDLA 3R9IA 5K8LA 3OESA 4PPQA 3KKNA 1JQLB 1S1CA 2VHUA 3B5JA 3GFPA 1Z07A 2F55A 2F43A 4A0RA 2XITA 2ZSEA 1Q1BA 2V8OA 1FUKA 3NXSA 4PTLA 4BWYA 4PQRA 1KAOA 4V02A 3MUFA 5BW8A 5KUTA 5KO2A 1GTVA 1UFQA 2ZEJA 5FPTA 4BZQA 3RSLA 3RRMA 2WWFA 3IO5A 4OK5A 4RSGA 1BS1A 4URYR 1JXMA 2YJTD 2IYYA 2CNWA 3BD9A 5KNBA 3H84A 1TQDA 2XSZA 5FPKA 2QP4A 2DFNA 2XXAA 1LW7A 1W5SA 1CJTC 4AYTA 2GJAA 2JLSA 4TMTA 5JBQA 3OZXA 3B85A 3LAWA 2WWYA 2WWWA 2WWIA 2VF8A 4DHEA 1L4YA 1Z3IX 2VF7A 5CLQA 2GXAA 1BOFA 2KBEA 2KJQA 2ZPTX 4PAQA 4X8MA 5IK2A 3T06B 5JCPA 2A5YB 4QJ4A 1W47A 2P5TB 4Q9LA 1P2TA 2J0VA 3RS7A 3AVTA 2YWFA 2VSFA 3DPUA 2YWGA 1X3SA 1KJZA 1XCGB 4TYNA 2E9SA 3RWMB 1Z5ZA 2Z6VA 3EPJA 5E3HA 4Q7LA 3X1WA 4EPRA 5JFGA 4JBWA 4DUGD 2X2EA 2BWJA 4ZDKA 4TWZA 2RGNC 4TMZA 4H9GA 2GRJA 4B43A 1E2FA 3ZD6A 3IDQA 4FCWA 3I73A 5CYPA 4WXRA 4ASUD 1R8QA 3BFVA 2XTNA 2GJSA 4TLBA 1DAGA 2BM0A 4A0HA 4BLQA 2OILA 3PQCA 1K6MA 4LHWA 3DMDA 4ACBA 1G3IA 1FX0A 2JIZD 1S0UA 1J8MF 5CJ2A 5JMTA 2FU5C 3GJ8A 3WHKA 4BEBA 4WZBE 4P3YA 1RVDA 2OAQ1 4CEIA 1JI0A 3RC3A 2GDJA 3LBNA 4PO9A 1G8FA 4L9SA 4Q02A 3L0SA 4URUR 3D3QA 1G6OA 2BJVA 2BKEA 3BB3A 3AGQA 1KDTA 2OSBA 1X86B 3Q7QA 4C7OB 4P0TA 4PHGA 1S4QA 3K0SA 1UDXA 5BWMA 1HH4A 2V7QA 3CRW1 4Q7MB 2C5LA 3CPJB 3B1YA 4HDQB 4OHYA 1VYUA 821PA 3TKLA 2ZI6A 1OIVA 2P0EA 3SEAA 3OIWA 2YV5A 5FTMA 2OAP1 2W6IA 2ZETA 1TUIA 4EQ6B 4LV6A 3GLFB 2ZJOA 5DIFA 5F3WB 1DO2A 2QPTA 3KKPA 4LJ9A 2Q6TA 3T1VA 4JVLA 3KXKA 3U44A 4L8GA 5JEDA 2C03A 4IHQA 4HAUA 3ZVMA 3OHMA 2FV8A 1Z0JA 4JKYA 3ZH9B 4JLNA 4BLSA 4HUTA 1RJ9B 4HUQA 2D74A 3G5UA 3GQBA 3U3KA 3LV8A 1M1YE 1RE0A 3F0TA 2C98A 4DIEA 3IEUA 2BOVA 4C2TA 4QGFA 1ZUIA 3QF7A 1GNQA 4P32A 4M9ZA 1JXOA 1T6NA 4M1SA 4DWJA 1II8A 1P5ZB 2IC5A 1K5GA 5KSYA 4POAA 1XJQA 2J3EA 4US1R 2HF9A 3GPLA 1OXSC 5CDFA 1NMZA 1P73A 4YDSA 3MMPA 5IRCD 2XEXA 1JJ7A 2HCJB 1O87A 1XD9A 1OJLA 3KTAA 4OK3A 3ZZUA 3R9WA 2DCUA 4PANA 3S1AA 2DFKB 2H16A 2UZ3A 1ESNA 1OT3A 4DDUA 2CL6X 4OI2A 4FIDA 4QGAA 3FHCB 3WYAA 4DEXA 1NVVQ 1KKMA 1EWQA 2HXYA 3GFTA 4DSOA
chains in the Genus database with same CATH superfamily
2FOLA 4RS4A 5D5QA 1SCBA 4IRMA 4R1OA 3G8BA 4UNSA 3UK0A 3TRDA 4TKMA 2F62A 1II9A 3BH0A 4FHDA 1M74A 1PR6A 2JBAB 3ZHXA 4C20A 4ALLA 4ZDJA 1USUA 4EPWA 2Z6AA 2GX6A 3QWHA 2PX4A 1M1ZA 2WAMA 3CEPB 4IDCA 4ZCMA 3QYPA 1W94A 2JLZA 4QPDA 4IYRA 1BXRB 2EC5A 4J43A 3V2GA 5TMDA 1DXHA 2GHRA 1SBTA 2TMDA 1M34B 3HY3A 1Z9BA 1SBYA 1Y81A 4TKZA 1ECBA 1TCAA 2O7NA 5CK4A 3L6DA 3X3HA 1IBKB 5T7BA 4CNQA 1EUCA 3LA8A 3JX9A 3OAAD 1N78A 1O94A 1SOAA 3DE0X 1Q83A 4BGDA 3ADOA 1N5JA 4WESA 1NSFA 2QYTA 1K6IA 1DMSA 1J6UA 5G4LA 4I99A 5FR1A 3HJHA 2PYZA 3Q6NA 1J00A 2D7CA 2DECA 3HVKA 4EATA 1XTRA 2H5EA 3HU3A 3MCTA 5H80A 3TTTA 4CM6A 5L8VA 3VGJA 5I8PA 3VZDA 9MHTA 2H3HA 3HXTA 4RQUA 2BI8A 5JVDA 4UM9D 1LY1A 4KQXA 4J90A 4CMIB 4HRVA 5LZ7A 2IBTA 1P5FA 5BV8A 5AK3A 3PUWA 4N39A 3WIDA 5LFAA 3DD5A 1D4FA 3KVNA 3BD6A 1J25A 3T38A 3GVHA 3ASYA 2QF7A 1NJ1A 2IDMA 2YDYA 4FLMA 4P22A 2XF2A 3CH7A 5LZ4A 2BFDB 4PEVA 4WDQA 3RYIA 3VR4D 1T9GS 3NC1C 1QNFA 4NBTA 2FUG1 4RXMA 5J23A 3GFGA 2W0MA 4JHXA 1BA3A 2ZSBA 3E5NA 1E89A 4L8YA 5DBOA 4J3NA 2KW5A 3TM4A 2WE7A 5L6LB 2H4HA 1IQRA 5I47A 1H1TA 3KZNA 4X41A 4QBKA 4CRWB 4MQMA 1DQSA 5C8DA 3DCNA 4PZUA 1RYDA 4GL4A 1DJNA 1LI5A 1E1LA 2J5KA 2GEVA 3G7UA 3GBPA 3Q1KA 4JP8A 4K8RB 4TZKA 3B3JA 1QC5B 3K2IA 4K9OA 1VSUA 4U7PB 4B47A 4DREA 4E0BA 4EUSA 2A35A 3CBQA 2PMBA 4Y2JA 4YDHB 5E8JA 3VPCA 2GK7A 3AF3A 4ESOA 4ZI2A 4FMPA 4FFPA 4K03A 1R9MA 1SRRA 3A3PA 4ZAVA 5IH7A 1C0IA 2QG4A 1C4XA 4QO7A 3V8QA 2C4MA 5ALGA 4CT5A 1QFYA 1QRRA 5C1IA 4FHFA 3VSAA 4LY6A 4UPEA 1QF7A 2G0AA 4GM0A 3NT2A 4B45A 1QMGA 3ITDA 1QUEA 3MXTA 4XKJA 2X14A 1ZQ1A 2GJ8A 2O3UA 4HLNA 4XM1A 2CJYA 2FSUA 4N8SA 1SIWA 3AJRA 3GAMA 5ILGA 5AKLA 4EX7A 5IJ0B 1Z6YA 2C78A 4GQBA 5F12A 5C81A 1WSAA 3UV7A 4ILEA 1CE8A 3BE5A 5CGQB 3R5KA 2HA6A 2Z0MA 1M6VA 3LDHA 5TQJA 1DHRA 1QIKA 4UZFA 4F72A 4N01A 3P26A 1JDVA 1SBCA 2C9DA 2R8EA 3LT4A 1FJHA 1HI9A 3E18A 4YECA 4PGAA 4Y9TA 4HLUA 3C8ZA 3K9LA 1X7WB 4GX5A 4HDNA 1YHZA 2AYYA 4MEJA 1T13A 5CLJA 4KPGA 3ZHOA 4KO2S 4OKIA 3QE2A 4PFSA 4PLZA 4G37A 1XCBA 3WB2A 2UUCB 3CLSC 1J8VA 1J9EA 4J0IA 1JWLA 1ORWA 2WF8A 1RP7A 2OCGA 3QWFA 4B0OA 3GQBB 1GT6A 1U2SA 3EXFB 1DCMA 1DV1A 4WNAA 2OGUA 4X44A 4XRRA 4XYBA 3TSCA 4D3ZA 2FSVA 4KI7A 4TMFA 3TCKA 4F6RA 1NVWQ 1XU7A 1VSTA 2OHXA 2DFLA 5A3VA 3E3LA 5AKXA 3HKCA 1KQNA 2FF5A 1BROA 1WMAA 2MMGA 5I8ZA 2AXEA 2FWBA 1BOOA 1HDXA 3ZY3A 1DGQA 1XMPA 4Q15A 4NHOA 2IU4A 2P67A 2IH4A 4BKMA 4ESVA 1B6TA 3C3EA 5KYXB 4MS4A 2FUG6 4U1RA 1CUJA 4KK4A 3KQUA 5IBRA 3X2FA 4YRSA 4GC9A 4WOPA 3MWGA 3EGOA 3RBXA 1KJ8A 1U3GA 3OKCA 3QVGA 2GKGA 4KBGA 3KTAB 1MUUA 1R27A 2WHQA 3LHDA 5DTEA 4PQYA 4CN8A 4ZPJA 4DCJA 3DP7A 2CY0A 1G7SA 1UEXC 4WLNA 1NN0A 4FZ5A 4WXMA 3SK0A 4EB6B 3CLUC 3T99A 4JC4A 1MC8A 1UK8A 4F1WA 2CMDA 4L4RA 4V39A 4KJXA 4NXNB 2MSDB 4XWKA 1JECA 3HL4A 3ZJTA 1NNSA 1RRGA 2CE2X 2G1PA 1QE0A 2P0AA 4WDRA 4NIMA 5C8XA 1ZMXA 4BNKA 4P36A 4X61A 1CRQA 2G6TA 3HN7A 4WUVA 1YTLA 5L53A 1H2WA 3KB1A 3W1WA 4LRWA 3E0QA 3PHHA 1NASA 2BVNA 1WCXA 2ATIA 2XGGA 3ESZA 3TQFA 3WFIA 3DEZA 3K8QA 4D9IA 2G25A 1JIIA 1AM4D 4FOSA 4NJEA 3QFTA 5AJZA 4KFSA 1OR8A 3GLHA 3AERA 4I1VA 3K2QA 4MVJG 4JI1B 1EQ2A 2MSWA 4R1NA 2Z2JA 1G5RA 1HETA 1KDYA 1H5QA 3AESB 3GZNA 4KTTE 2R96A 2GILA 4IHJF 2EZ4A 3N2KA 5FORA 2OAGA 3HPRA 2D5BA 2AWNA 4D0NA 2WSBA 4QLAA 1GCOA 4V0MA 4X5OA 4YRJA 2XA9A 4M8LA 4BMDA 2IS6A 4O2AA 2Z3WA 3OEED 3JVDA 5INTA 3K6JA 3M6WA 2RKBA 2QRQA 4R1SA 2XBUA 5JAMA 4U0JA 1Q0RA 1VL1A 4LC1A 1XO1A 4PHFA 2GFQA 3E9ZA 1X1RA 4OP3A 4EY5A 4RD2A 2JZNA 2MSEB 3I6IA 3L8GA 4PYRA 3Q2OA 3ZLVA 3P0JA 3R9XB 1H93A 1KI3A 4LNHA 3DHEA 3V5NA 4CKEB 2BMJA 1YONA 2V45A 4JP2A 4NFHA 4Y2RA 3QOYA 1N1MA 2ADMA 4UBNA 4QUGA 1KMHB 1KOFA 1M3SA 2C07A 2RGUA 3KHKA 2OM6A 5FTKA 3SXUB 3T7DA 1FW6A 1E2MA 1KTVA 3U19A 4EW2A 3M1AA 5F78A 3NRJA 1N3IA 2SHKA 4U7GA 3CUVA 1XZDA 2XQVA 1HEIA 4FC7A 4JZYA 2VOEA 4L0CA 3RSQA 5LZ9A 4L5JA 1A04A 2I8AA 3S28A 5C5DA 2VH5R 1TW3A 2DUJA 2MU1A 3TLYA 1NP3A 1IU9A 3SFZA 3JSAA 4X8HA 5HE8A 3WYCA 2BC9A 3LWZA 2R2AA 3IBFA 4QULA 1ISHA 4EG5A 1R66A 4U2FA 3T4PA 2YNMC 1TAQA 3PQ4A 4Y1RB 3IIIA 2CXTA 4LYFA 5LMZA 4DLAA 5AJTA 4YJ2F 4FHEA 2ZR9A 5KJCA 3PUJA 3EJWA 1JLRA 5HJ5A 2WPNA 1NN5A 4BC0A 2IEDA 3MXOA 2WJIA 4D9GA 3UYKA 1A9ZA 4C3VA 1RABA 1JMVA 2D00A 4BNMA 3U5TA 1EG2A 4H18A 4PZ0A 3ZXUB 5F1KA 1GO2A 5C51B 1Y1TA 1UXHA 4HDKA 3GA0A 1J21A 1KO8A 4DA4A 4QDUA 2UZ0A 1R5NA 3I6YA 1XXHA 1F8YA 1MXHA 5C8YA 3TZQA 3KCNA 5K0GA 5JARA 5KDOA 1N2JA 4YJGB 2RCNA 5DWVA 2KWIA 5IAKA 4BAGA 2HNKA 5ARBA 3THWA 3QVOA 4OLFA 4Q05A 2C7QA 1J22A 3AHDA 3V8RA 2J0SA 3VV3A 4EHLA 1Y7IA 1L2TA 2P7HA 3DVRX 3PVZA 2JHCA 4GOJA 2X9GA 3JQFC 4NABA 3UWPA 5CXXA 2HX1A 5ELXA 1IRIA 2VTKA 2IYOA 3EDRA 4FK8A 4YONB 2QY6A 3CZCA 3KHSA 3ZLBA 3A4VA 3UWOA 5D7NA 1GNSA 1ENYA 2PZGA 3JY6A 1KGDA 3LW7A 3FHLA 2FSGA 4NEQA 1UXJA 5HGXA 1DINA 1DI0A 4GF5A 4CGYA 3ZHVA 1UKVY 3EBPA 3G9ZA 1XVVA 3ABOB 4C3UA 5HPYB 2L2QA 3PENA 4R1UA 2VUHB 3A37A 3CTMA 2B9EA 3AF0A 1FXUA 2H1VA 1L5QA 3OZTA 1NY6A 4PAOA 5B4TA 4URWR 3AUAA 4D8XA 5LB4A 4C9BA 3MOSA 4I81A 2B83A 3RS8A 4RULA 4BFTA 1SHJA 5IC4A 1RQGA 3HUTA 5DGCA 3RUPA 1SY7A 1DAMA 4HMQA 1HRKA 1B42A 3FBTA 2K7ZA 1K0FA 2BKXA 1TKRA 4LTDA 2GXUA 4FUTA 4DC0A 1RADA 4J0GA 1JG7A 2D6FA 1P7YA 1QK5A 5CW1A 2CZCA 3ICVA 3JYOA 4D02A 4B4KA 5FADA 1VJTA 3FWHA 4ALJA 4Z3DA 4DDTA 2D2FA 3QBJA 2AE2A 1CS0A 4ALKA 4LNAA 3OMXA 1YE3A 5I7UA 3FHTA 5IU6A 1NJGA 3BMOB 4AJPA 3PWZA 2HSDA 5BN3A 2X1HA 3PQFA 1TYDE 3PUXA 1EFRA 4JR1A 3L84A 1M7GA 2KS6A 1QV9A 1HFWA 1C3OA 1IHYA 3M3HA 3O38A 4P7JA 1WAMA 4FOPA 1KR5A 1V96A 3AETB 2GKOA 4FKMA 4PS0A 5JAQA 4HBZA 4BFVA 1U63A 2Z30A 3TECE 2FQWA 1YVPA 1VL2A 1JPJA 1WOYA 3ID6C 4LA4A 4YREA 3AHEA 5MHTA 2I54A 3IEXA 1AA6A 1A9QA 1X7YA 3ZPXA 1Z2AA 2XMQA 3S2IA 3ZKWA 3VU9A 4EHDA 5EJAA 5AT1A 1K6JA 1OLUA 4Z1MD 5DLQC 2XKJE 1W35A 4OQFA 3CX8A 1G2PA 2YN2A 1SUSA 3EFBA 3G0DA 4A6DA 1N8SA 3AUTA 1PJQA 2Y67A 3PC4A 3I9KA 3H8WA 4F84A 5KVVA 3TJMA 2O0HA 3C45A 5DM0A 4TTQA 3C3PA 4BMXA 2IWRA 4ZYYA 4QM6A 2AJ8A 3PGKA 1LV8A 2WU0A 3ZVLA 1FFGA 4P4UA 4R0NA 5D51S 2ODTX 2W98A 2JFQA 2XKAA 3PE4A 4ZTBA 2VEDA 4EDHA 3VR3D 4KUEA 5IZ4A 4GUAA 4FSXA 3FUUA 4Z8YA 1O9BA 4QHYA 1JLHA 1UBOS 3UK2A 2W9XA 1GZUA 4MR9B 4ZCTA 2CN1A 1E5VA 3I42A 1CX9B 3I53A 4ZAGA 1BFDA 1FMFA 2ZATA 3W06A 3PI6A 3Q9SA 3QXSA 3U3JA 4KGVA 5H59A 3JQRA 4J8PA 3E9DA 1AQIA 1G5QA 1MABA 1KI9A 3H97A 4FZRA 4RMJA 2W2LA 4XB6B 3RUIA 3NDJA 1R6UA 4H0FA 2JFOA 5KHOC 3JQCA 2BAGA 2WF9A 4EH1A 1P60A 2FW9A 3VXKA 4ARCA 4H7IA 2J5QA 1Y6FA 2H29A 2J41A 1TM4E 4IG9A 5NLLA 3LBIA 4BNVA 5A1JA 2NV6A 1ENZA 2IZZA 3B2EA 1GNPA 3RF7A 1BRTA 2XY4A 1DCFA 4X1KB 4C21A 1MTOA 4FKBA 1BSVA 2CYCA 2QMQA 2IYPA 3MVEA 1QO0D 4MV8A 1HE5A 2WA1A 2WHPA 4ZWNA 1WXDA 3KAJA 5JV5A 1AKRA 2HY7A 4Z7JA 1GZ5A 3BQNB 1T1EA 5LD2C 1TPYA 4B48A 2WMNB 2JLQA 1FC0A 2QL6A 3CZQA 3FUWA 3IMGA 4HH0A 2AZDA 4KQ9A 3CIOA 5DX1A 3VTAA 4F8YA 4MUIA 4W5HA 4G9EA 1P9RA 3IL2A 5BVGB 2P2ZA 1OVGA 3KRTA 1W4RA 2GAIA 3EDOA 2W22A 3QMVA 3KLPX 4KLNA 4YWHA 4BO3A 1E0JA 5EJ9A 4U6NA 1G8GA 2IZ7A 2FZCA 2C31A 4HXEB 1E58A 5DDIP 5L7YA 2BFCA 1QO7A 3KJEA 2FMFA 2GF0A 4XFJA 3AF4A 1ODKA 4IOJA 5K8IA 1NVTA 1RXSA 2F3SA 3PP8A 1YQTA 4DLZA 5J2TF 4GKBA 3DHWC 4OQNA 4D9FA 3DMNA 2SECE 1NYRA 4JL6A 3PWKA 1GFIA 1ESZA 1W36B 1DJMA 4JBLA 2PKQP 4UJ3A 3ELDA 1HQYE 1AO3A 2FH5B 3QYJA 3MAAC 2VK8A 2KI5A 4RQBA 1TO1E 2IS1A 1J2TA 4Z4HA 1TZ2A 1XRJA 3VDXA 2I2BA 2FYTA 1A88A 3WBKA 4BC1A 1O58A 2R86A 5DNAA 1R4NB 5F51A 4B87A 5IWAB 1I94B 1LQ2A 5DISB 3A36A 4QU9A 4N5IX 3R0ZA 5A7HA 1SVSA 1IG0A 3IEPA 3JQ8B 1LPSA 4RSRA 2N1BA 2C9CA 3GWZA 4E5MA 4MUFA 5BT9A 3H2YA 4CUZA 1MD9A 3PHGA 4MWGA 2GFIA 5F73A 4DQDA 5F3RA 4MW9A 3UAVA 4PO1A 1DAHA 3B13B 2D06A 1G5TA 4MPTA 4ZU3A 5FTNA 4ERNA 1I7NA 2JIQA 2FGKA 2XQGA 3IHWA 4HGPA 2B82A 3IIEA 4LMAA 1RAGA 5FUXA 4E2YA 4C4PA 1HLDA 1AC5A 1YR7A 2VDNB 3DO5A 3E9RA 4YCAA 3TLEA 4AQDA 5T3UA 2VHXA 4MUHA 4NBRA 3KTFA 5AW2A 3K6RA 3RARA 1NONA 1PG0A 1WHSA 2P4UA 3FKQA 5HS6A 3WRXC 1B0PA 5D85A 4BNGA 3GRVA 4JYZA 1SBZA 1YQUA 1PSWA 2PZ8A 2I03A 1T4CB 1B93A 1GGHA 3BCSA 3CLRD 1TYBE 1ZUNA 3I5MA 4FGJA 4WE3A 3TQOA 3USES 3UUGA 1B6GA 2UXBB 3LU1A 4M6WA 3UJAA 4N3AA 2IYRA 5EVJA 1YACA 3TGWA 1G4UR 2DCMA 3HJGA 3KWFA 3LD9A 3N87A 4UMVA 1RAHA 3VKVA 1SXJD 3TG8A 3BKWA 3TUJC 4FFMA 2BHNA 3LHIA 4KHZA 4JJ8A 1OPRA 1EG7A 4BTVA 3ZDFA 1NMYA 1NBMD 4Z0TA 1XLWA 4NBUA 4OI1A 1ZJ5A 3WWOA 1MMFB 1YCDA 4L57A 4TMXA 3TWOA 5DCLA 5C46F 3RG8A 3EF0A 3HFSA 3QXJA 5ALOA 3TQIA 4XWWA 3DTVD 4Y2XA 2DU8A 1NLZA 1WCYA 5B37A 1CEYA 3HCEA 2AA3A 3H2BA 4FINA 3CZPA 2GJ9A 4GAEA 4ADSG 4BGIA 3A3YA 4HPWA 3G17A 3HS3A 4AKGA 1SXIA 3P45A 1IHPA 1N6OA 2QYHA 1U9CA 1JQJC 2A5LA 4V0NA 4TS4A 4LV8B 2Z6QA 3CNOA 1DEXA 3I5AA 2W4IA 4JELA 4JNCA 1KH3A 1Z3CA 2C42A 3C4JA 1E0AA 3AJ8A 1UP7A 3OAAA 2V6BA 2CNBA 4LE1A 3MIZA 1F51E 1YS2X 3L0ZA 4XD7D 4UDXX 3B3FA 4XTCS 4C2UA 3WNDA 1TYAE 3HUFA 3AR3A 3G2NA 3L1HA 2FG6C 4KX5A 1EJ2A 2Y05A 2F1OA 1Z06A 3P94A 5EAIA 5C53B 1KZ7B 2IUYA 2I67A 2W2PA 1SKUA 3BB4A 1PL8A 5DBIA 4TUYB 4JI0B 1DRJA 2QTZA 1DTSA 1VKZA 1CHNA 2FLWA 2OSVA 3EG5A 3GCXA 3N58A 3OQJA 4MIYA 3B38A 4F85A 3GMDA 1LB1B 4QGBA 3H2JA 4XSHA 2M6LA 4L4ZA 4XVUA 3L7NA 1MENA 4TV9F 1F4VA 2FRVA 2ZIZA 4WFJA 2R48A 3UENA 1EGHA 5LQUA 5AI0A 1M2VA 4JT9A 1UZMA 3FR7A 4DXHA 3M4YA 2V7EA 3HYSA 1HT0A 3F5DA 4W99A 1R4MB 3RCBA 2UUOA 3UVEA 4E5VA 4K0RA 4RPHA 7AT1A 5LYJA 1H9AA 1P1FA 1TZMA 1YDMA 2C9YA 3B7GA 4L07A 4NBSA 2J9FB 2CHVA 1RCTE 2WQZA 2BFAA 6ADHA 2C92A 1M8JA 5TPZD 3G2OA 2EX1A 2RJOA 4QX6A 1E3TA 4MVCA 4BX9A 4N5HX 4MJLA 5IXYA 2HWKA 3QG5A 5K8JB 4HATA 4S12A 3S1LA 5CDTA 2VJQA 2J46A 4NECA 4EA6A 3T7SA 3BWVA 4AB1A 2X6RA 3KYBA 2F1JA 4PZCA 1OXMA 2PZBA 1XL0A 2OZLB 3ENZA 4WV3A 4AW9A 1SVOA 3GUYA 2ATVA 3WWPA 5K0JA 1AXEA 3CCCA 5WRFA 1SPBS 1Y7TA 1JQ3A 3IODA 3DOEA 4TLCA 1LBEA 2BEUA 2V4ZA 2UUPA 4QXRA 3T5DA 3S2ZA 3GJ5A 2Y66A 4FFSA 4O2BB 4N6GA 2IZOA 5HIMA 5FJIA 4L5CA 3PT9A 2PUWA 2ZYSA 3TLGA 1NC3A 1S2GA 1UPTA 3MWKA 5JCOC 2R1TA 1N0HA 1QP7A 2WM8A 1TYCA 3HBNA 2M32A 4I19A 3G23A 5LUBA 3IURA 4RY8A 4D9NA 3NEYA 4TQGA 1NR1A 1WUYA 1ECJA 2HRQA 1E4EA 2YRXA 3OLVA 5IVDA 1KQ3A 1XJ5A 4HDRB 4EECA 1PRYA 3GARA 3OD1A 5A02A 1NX9A 5AVTA 3KCQA 1FDUA 5AKGA 4K81B 1WX1A 4CLEA 4YUYA 2PJRA 1S2MA 1SU8A 2CVHA 4KXQA 3HP4A 3NT4A 4BMCA 1M6NA 2OXEA 3HB4X 3D4IA 1K06A 1W96A 4P4GA 1IBSA 4CQMD 5DGXA 3GFSA 1HSZA 1YI0A 2BF4A 2YS6A 4L6CA 4CDGA 3ZWKA 4PTZA 1EUQA 2YMLA 1ICEA 3BM5A 2J3DA 3CZRA 3GX1A 3Q7PA 4XIYA 1ONPA 4NX2A 1KERA 1SCAA 4B35A 4RELA 3VZCA 3ZWQA 2RMKA 3WWCA 3PC8A 1N9GB 3LXXA 5E4FA 4U2GA 5JADA 1AU9A 2VF4X 1AQUA 5U4QA 1C7JA 2JF0A 3UHFA 5ILOA 4HH4A 3ANLA 4G0MA 3WXBA 5FWNA 3BMQA 1HOXA 4QATA 1U0BB 2ORED 2Z98A 3UH0A 4LYEA 3JD4A 3HK2A 2R5NA 1K92A 1LCIA 2GF2A 2ORYA 3GPIA 1ISMA 2GCNA 4TV8B 1ESCA 4DZZA 5SZHB 3RROA 3WKEA 3GYGA 3IPYA 3O2SB 2NADA 2AGVA 1S1MA 4LY3A 4Q1EA 4YYEA 3WA7A 2PBLA 3ETJA 5LMUB 1NP6A 3C3XA 1NXWA 2Q1UA 1TA4A 3JRNA 2WD8A 1KBQA 1PI3A 4BJ1A 3PD1A 1HTWA 5HSGA 3ZCUA 4JI6B 4K86A 2V7VA 4DC1A 3HO1A 1HE3A 3WJ2A 1O4WA 3PNLA 2FP4A 2IEZA 1Q17A 1E9EA 2O3TA 2PZFA 3JAWA 2EKZA 3KYCB 2H2DA 3LQ2A 4K9LA 1AKMA 2YXNA 3IA2A 4X1OA 1X77A 5E7IA 4E94A 2XWJI 2GUWA 4WXHA 5K2MA 1XTUA 3U7JA 3PT5A 5FHRA 2PUCA 3U7FB 4F04A 5B2EA 4NYJQ 4PX2A 3EMBA 5HOQA 4G1FA 4US0R 2X3YA 5K3CA 1T6ZA 1UOEA 2HSEA 4X8OA 5DASA 3UAOA 1DEHA 4WBNB 2TSYB 3FFWA 1VLZA 4M3NA 4YHBA 3K30A 3ROTA 5LQCA 1UOOA 4ZK2A 3CXUA 5GTDA 1PT8A 2QUKA 1COWD 2XE4A 5IAGA 4Z4CA 3BXXA 4CEIB 3TKAA 2J09A 3L6UA 1FRZA 3Q6MA 3VBCA 1EM8A 4XA8A 3I30X 3ZGZA 5EIHA 1DKNA 1MH1A 2W8BB 1R5OA 1ZIOA 4LYDA 5CH5A 3A1VA 4M1YA 4BJHB 4L95C 1VA5A 2V9CA 3WLMA 5BV7A 1UFRA 4DCVA 4G4IA 2DKOA 3UT5A 1A2OA 3U0BA 3UWKA 1HDGO 1PS0A 4OHMA 5ALTA 2HHJA 3Q85A 2BBOA 5HWSA 1GT91 2O59A 1NF2A 3OEEA 2GBPA 4N0MA 4Y2SA 3OQHA 4L8FA 3HHPA 4V3CA 1E79D 4I5GA 1ZZGA 3K9BA 3KXIA 4OGFA 4C1BA 4G1UC 3RW9A 3SIWA 2A4KA 4RTSA 2OBBA 2Q4OA 2VPZA 5K3SA 1MJNA 4IKPA 4DANA 2OCLA 1PQ4A 2ZRDA 3L6BA 3LK6A 4L9RA 4TTPA 4B6OA 3W8FA 1OW3B 4BNIA 2REQA 3LKDA 1M2KA 3D59A 3DZGA 3RYCB 1QANA 1YJXA 2RKOA 3AR8A 4L76A 5BR8B 1DUVG 1T3HA 3ZK7A 4CM4A 3GY0A 4K2HA 3P27A 3SXJA 2JFWA 1ZHHA 1FL9A 3TRIA 1OX4A 1N4AA 2ZCJA 3PJDA 3TINA 3C6XA 1UBLS 4X7RA 1GDTA 3L7DA 4LJ7A 2QMHA 4Q9HA 2XYRA 3BIFA 5KQSA 3WYEA 4WK0B 5HQ3B 4BDSA 1HEUA 4DLUA 4E7OA 4ESEA 1YUNA 5BSFA 3UK1A 1ENPA 3DJFA 2Y2VA 4NBLA 3A4TA 5A6SB 5FNVB 1E92A 1YUBA 3V8VA 2DPYA 4CG1A 1UUFA 5BQPA 3VZBA 3P2IA 4EVIA 4ZHQB 4ENWA 3E2IA 2H8GA 4LE2A 1GL6A 4JLAA 3DW3X 1P75A 1K8YB 1YH3A 4I3HA 4M38A 4CFYA 2IXEA 3AFOA 2ZI5A 2HAEA 4O4IB 4DQKA 4QRHA 4GKVA 1AHPA 1YB2A 2YVAA 4WH0A 5ALHA 1BW9A 5IABA 1ORTA 2BSXA 5F3DA 2BTEA 1GCUA 4R0VA 2PG3A 3H0EA 3T8YA 3J81k 3GOQA 2Z04A 3DKIA 5C0OE 1EAYA 3CH6A 4ZO8A 1C1DB 3PPVA 3GJ6A 4NZPA 3MRSA 4BLRA 2CL7X 1NXPA 1PWEA 2IFTA 4GXNA 4IHKA 2H9YA 2BFBB 3CIFA 4LKRA 4S1WA 1JZSA 2NVWA 2CF6A 3QUQA 3E70C 1QNLA 1J0DA 3PQ3A 3ZGNA 3VPSA 5LLTA 1AH2A 1OAOA 2NWQA 1Y4DE 3M4XA 4UDYX 2MSLA 1C1XA 4LJRA 4JCCA 1EP2B 3JQBA 1HQCA 1Y4ZA 3NIWA 4BQSA 4LFBB 4IQ8A 5ALEA 3P19A 2O3JA 3IXQA 2O8FA 4B3BA 4ZCIA 2QB5A 2WIGA 2O4CA 1RI4A 4HB4A 4OK6A 3RSHA 4EHKA 4F56A 2XCRB 1YRBA 1OXUA 2B9VA 5I7FA 2AFHB 4EPXA 4JYBA 1WW3A 4RA6A 2XUAA 3RK4A 3TNFA 4UHCA 1JHZA 2YZKA 2AFIE 4L16A 1Z8HA 3OUZA 1NDHA 4ZRNA 3I2HA 4LHYA 4DFDA 2CXHA 3PUVA 3Q8KA 3G6KA 4P4SB 4Q1AA 3EWAA 2HSZA 3DDUA 3MIIA 1I7PA 3QK7A 2OLEA 4REMA 1W52X 2G1AA 4WZBA 1L8OA 4NYIQ 3IT0A 3FLAA 1H0HA 2QN2A 3HU2A 1GXSB 1A9PA 2A5DA 2CL0X 1KP3A 2ZPUA 5JMOA 3DXFA 3AVYA 1E1KA 4BKQA 2P9JA 5KWIA 4EY4A 2WWHA 1PQWA 4N76A 221PA 4LWPA 5D01A 2VDVE 1IEXA 2NT4A 4FYPA 2ORVA 1T43A 4AJJA 1F9EA 1H5NA 1WUTA 2FX5A 4EO9A 3KEMA 1E5DA 4BBJA 3ZV7A 4EFLA 1AUOA 4A6XA 3UKDA 5IXSA 2HIMA 4IO0A 2XLCA 5A4FS 1K7YA 2VJLA 1ZS9A 2YCLA 3DVAA 3K09A 2AXNA 4MDYA 3EGEA 2CUTA 3EVBA 1SEVA 4CMEC 4L75A 4HLDA 2VT7A 1CY8A 5BW4A 1NXQA 1PK9A 1LX7A 1ZM4A 5CUQA 2Z4SA 2Q5CA 1R6TA 1OYYA 1IN6A 1HG1A 5AM1A 5EZYF 4FE3A 5CITA 4MQFA 3IQDB 3ND6A 2H4FA 3R5JA 4HRAA 1UM9B 1YF3A 2QU7A 2EX0A 4BHTA 1OOEA 3H75A 3ZDDA 1Z83A 4X45A 3Q11A 2YMPA 3LKVA 4HGRA 1UT5A 2OEPA 1M1YA 4HN2A 3PX7A 3D8RA 1FYDA 3TB4A 3AXTA 2VNAA 3FF4A 4KR3A 2ZYDA 4MXDA 3ZWVA 4W9MC 1QPGA 3L6CA 1KJQA 1KRHA 4GOLD 4MS3B 1ZI6A 1HWYA 2LTAA 4IIHA 4R3UC 4Z1MA 3SZLA 1E3MA 1BGVA 2BMAA 3TUZC 1NQTA 3PD0A 2YICA 2VJMA 2XE7A 3CSDA 3IQGX 4RFSB 3V7UA 3VH3A 1KP9A 1KA9H 3PCXA 2IE0A 4KCGA 3VH2A 3OE5A 3W5CA 1NVAA 2OOKA 2GHIA 1KEVA 2FN8A 2VRWA 4ZARA 4H7EA 1HZZA 3ZWOA 2F9FA 2WHYA 4GI5A 5C1PA 2AOTA 1FRVA 3P9NA 4IEIA 4J29A 3F6PA 3UGTA 7YASA 3E8MA 5IVHA 3KJHA 1V26A 1G8PA 1V9SA 3H2GA 4FXPA 4RKQA 3ILSA 4LHXA 3VR3A 1VI6A 4U0KA 4ER3A 3F8TA 4LBYA 2Q5QA 3FVVA 3JR3A 1ZXLA 3CMCO 1N2CB 3DFZA 3JYLA 1U8AA 1EUDA 3UK7A 2A86A 1IUOA 1MAHA 3HCPA 1CUBA 3KELA 3RKUA 4E1VA 3P9SA 3I32A 5JBNA 5F4BA 4TMWA 4WI1A 5B1EA 4FN5A 2EJTA 3NAMA 3AEZA 4B0PA 1SEPA 2PMEA 2YQ5A 1BX1A 1GFWA 4RETA 4B3CA 5ELMA 1YS1X 1YA4A 1YR2A 3IB3A 4JAVC 4L8WB 3TAXA 5IFKA 1T4GA 2JLVA 3ENKA 3P5SA 3Q7TA 1D5WA 4DIDA 5JCJD 1VKRA 2F3RA 5E9AA 1P74A 1YQQA 2RGXA 1GL9B 3ZCRA 4RV9A 4QQNA 5FAXA 3TN7A 1QO0A 3BDAA 1VBNA 4A6PA 2J3LA 4Y3UA 1BVYF 4AICA 4J91A 4TYYA 3DM5A 5IBQA 1GTG1 3D8SA 2GZ1A 2Y1LA 2LUOA 4H7JA 5FOXA 5TS2A 3WGVA 1CVIA 1FFDA 3WGMA 1RRVA 3GVPA 2PHZA 3ORYA 3W4JA 4DRZA 4CNBA 3CT4A 5D3MA 4MRPA 3ZH2A 1Z18A 4FM9A 1ST3A 4ARIA 4MUGA 4BWVA 3IDFA 3MFQA 3P2YA 3T9AA 3S1SA 2CXXA 3MJTA 5DF1A 5CM8B 3PC7A 3MT8A 4P7GA 4AZ3B 4BQOA 1SCUA 2HF2A 2PVPA 1OA1A 1T5BA 2AI3A 4D3FA 3IUSA 3BAZA 1IY1A 2J1LA 4GBJA 3VR6A 4P38A 1FJ2A 3SQDA 4EHJA 1ZW1A 1E20A 5LQAA 4YRLA 3LUGA 4ZVUA 5C1DA 1N5MA 1X7ZB 5BN4A 5JPIA 3OTIA 4ZVNA 5TMEA 1G21E 5BV1A 4IDPA 4LZWA 3LRXA 2IYSA 3ZYZA 2R11A 2VWHA 1C0LA 1K7EB 1PW5A 3KSAC 2IU0A 1LGYA 1GILA 1O5TA 2ECPA 3W6NA 4OXIA 2I99A 3W3ZB 2W48A 3GH3A 5GGYA 4XWTA 4O4HA 4HVLA 2PWPA 2WG2A 1ZCZA 3EZ7A 4MVYA 4UFNA 3B36A 1SWVA 1WZCA 3CUWA 2EIHA 3KWLA 4GI3A 3ZV5A 4MCHA 3PVCA 4R7TA 5ULLA 1RD4A 1AK2A 1QE5A 1UEJA 1ZJ4A 4YRRA 4GKAA 1I32A 2XAAA 4RFVA 3DMPA 4IDOA 1VMKA 4Q16A 2XYPA 2I1LA 3LA6A 4AK9A 4TZ0A 1B8VA 2W2KB 1QO9A 3AUUA 3BE4A 2YBEA 5DN6D 1L1RA 2H54A 1QF6A 4DGSA 1W85A 1SU7A 3A2LA 2LV8A 3OMLA 1JMYA 5LIPA 2EYUA 1GADO 2BEVB 4QAQA 1N75A 1E8MA 2D5CA 1VPVA 2QSYA 4JB8A 2GNOA 3TIXB 1H6DA 3OI7A 1GSIA 3KFXA 4B17A 3R9XA 2QRUA 5EVCA 5GV8A 5E95A 3TQQA 1IATA 3M3PA 2CNDA 5MN4A 3EFEA 2JFNA 1L3IA 2C83A 1VMEA 2RGGA 2WU4A 4J1SA 1GPNA 3O74A 4Z0PA 4BFLA 4P98A 1SXJA 4DV7B 1YTUA 2D2VA 2JGFA 4OJKA 4ZTUB 1Q7CA 1NBMA 3OEWA 1RPZA 1SWWA 4AUEA 1PWZA 4UHBA 3ZDYB 1ZD8A 2BFFA 2Z08A 5GIPE 2GAJA 4MGZR 3DTVA 4AY5A 3KDPA 2ID9A 4U3JA 2ZT8A 4YV1A 3WJ1A 1IFXA 2FA9A 4LX8A 4JDUA 1QFSA 5LQSA 4EY7A 1EMDA 1TD9A 1XHLA 4R3WA 1FP4A 1OGYA 1WP9A 1ZX1A 3F71A 3QW2A 4UCQA 4Y67A 3HJFA 4QECA 3RQIA 2NU9A 4IL5A 2XD4A 3TX6A 1EIZA 2RBEA 2X5NA 3DUWA 5EWMB 3UXHA 3WK4A 5C4MA 5E7MA 1P1RA 2HXGA 5BXYA 4JOQA 4ENVA 3AQ4A 2XX3A 4E6PA 3CH5A 4NATA 2FETA 2QORA 2H92A 4XD7A 4UXJA 1N0UA 2ZZNA 1JW9B 4MA5A 4OJNA 3LC2O 5IEJA 3ME5A 3ZUPA 1C8LA 4E1BA 4RJLA 2N1MA 1EUYA 2O7QA 3TKYA 1MH9A 3KKZA 1DE0A 1GSHA 2NGRA 1J07A 2F3TA 1O96B 4GDMA 4NMXB 4RE6A 3LOQA 4G97A 3UA3A 4NEHB 1NW7A 3MNFA 1V16B 4CEJA 3GP5A 4MUJA 2BCGY 1BU5A 4M7WA 1YR9A 4NBVA 1L7VC 3SC2A 5JNVA 4QFDA 1NUUA 4H3HB 1F1BA 2I78A 4IKOA 3V1KA 4Q4AB 1U0SY 2A9PA 1AKTA 1NBHA 3ETCA 4JLPA 2BHRA 4QYWA 4X6YA 3V7FA 5BURA 3IAHA 1DLIA 5EMNA 4ZVOA 4ARZB 1YMUA 1ULAA 1WRBA 3F6SA 2CHGA 3ZCXA 3JPWA 4OA5A 4ARVA 4AKIA 4UD6A 1OD6A 3FI0A 1J1IA 3K0AA 2GPWA 4OAOA 2ZUWA 1Z4OA 5TPZA 1I6WA 1Q2XA 1VDMA 3P52A 5HE9A 3ZWXA 1ODLA 2KMLA 5AUNB 4CMAA 4D97A 2FRDA 2FWRA 3LBYA 1V8PA 4UHDA 1LI7A 2QXUA 5CCBA 1C9KA 1TTQB 2NQ8A 2QPOA 2KLBA 3EQ9A 3IT1A 1L5KA 1XZGA 3R7AA 4RTPA 3UJHA 4JWKA 4IYJA 1LD3A 1JHPA 1AS0A 3F7OA 4MVJD 1U6JA 3I0MA 3LF2A 1NSTA 4P5EA 5TGDA 5ALDA 3WZLA 1C1HA 1VP9A 2E4ZA 4BVAA 4IUCS 4AJ2A 2J4CA 1HURA 1PJTA 4DF3A 1U0OC 2DT8A 1KY4A 3FMOB 4ZRMA 1F12A 3KSMA 5H4HA 5FA5A 2W70A 4ZMBA 5J4LA 2I9PA 1VP3A 1L4BA 2O1EA 3PKJA 2VL7A 3I05A 3LQYA 2RGWA 4B4DA 5ITWA 1WCIA 2Y0BA 3FPGA 1DWUA 2XJ9A 1MO5A 1QTNA 1DG3A 1ZA1A 3H4TA 3IAS6 4YVFA 2A0UA 4PWZA 3SHVA 1QPZA 4GR5A 2QV0A 1OBHA 1CZUA 1EE9A 3CY6A 4Q1CA 5D87A 3U17A 3U4GA 1RTTA