4V0OA

Crystal structure of bbs1n in complex with arl6dn, soaked with lead
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
b'SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
total genus 48
structure length 166
sequence length 166
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0oA00
1E6CA 2IEZA 2GHIA 1E2PA 2RKOA 2J7PA 2YV5A 1G6OA 4PZYA 1UKVY 4F91B 2VYFA 4Q4LA 4UJ5A 4B35A 1B0UA 1RC8A 3X1ZA 2G9NA 3OEHA 4FMCB 3A58B 3PEVA 2C95A 4PAMA 1COWA 4PC1A 5AUQA 5FL7D 1UKZA 3VU9A 5E3HA 2ORVA 5HKKA 3DMDA 1T0HB 1CR4A 4B2IA 4W5JA 3V4FA 4BFUA 3EPJA 1JXMA 1HTWA 2QT0A 1JJVA 1CR2A 1ZM9A 2IYLD 3FFAA 4LY6A 4LV5B 2GXQA 4DZZA 4DLYA 1OFHA 3ECCA 1UPTA 3TAUA 4LDJA 1H8EA 3OIYA 4QBFA 3C7KA 5KDLA 5KNCA 4QM6A 2XXAB 3C5HA 1XF9A 1N6OA 2QAGC 1EFHA 3ADDA 1IY0A 4F38A 2V8OA 2YWEA 4TZ0A 3UANA 3OEED 2FH5B 4M1MA 1DEKA 2X19A 2ZJ5A 5DN6A 5FI1B 1FTSA 4HUQA 4IKEA 4LJAA 1T3HA 1S4QA 2GBLA 2WJGA 5B64A 1E9EA 3B78A 1HA3A 1XB2A 2G1KA 1MO4A 2FF7A 1CRQA 2WIBA 2ZSFA 4TQ9A 5G3YA 1TEVA 1CJTC 4ZI2A 2GNOA 2EVWX 1WCV1 2CVFA 2OFOA 4GNKA 4QGAA 3NHBA 4ZKEA 2GVDC 4D6PA 3MWJA 2BMJA 5TY0A 4QJ5A 3NDBB 3QE0A 5AUPB 3GLGA 3SQXA 2Q9BA 2H57A 5LPNA 1X3SA 2ZAOA 2ZE7A 2XNDD 3CZQA 2DWPA 3I8XA 3T35A 2Z4SA 3DM5A 1Z63A 2N46A 4G5OA 3NBFA 2LWIA 3GEEA 5G3ZA 5DH9A 2PT7A 3ZZUA 2OV2A 1V43A 3DPUA 4GRAA 2JASA 2FX3A 2ODNA 4G0NA 1KJYA 2CLCX 4GOXA 5FTNA 3ZH9B 2EQBA 5L3QB 2IF0A 3ZZ0A 1G5TA 2QP4A 1LS1A 1L8QA 4PC7A 4LJ9A 2GAAA 4D81A 3K0AA 1VG0B 4NL4H 1SZPA 1BO6A 2GDJA 3AP1A 4C30A 3FMFA 2QBYA 4NCJA 4KVAA 2FN4A 5B30A 3W90A 4AI6A 1Z83A 4LUCA 3QKRA 1SVMA 1DE0A 2LKCA 4N1AA 4NCNA 3T1QA 3CONA 1E9CA 4Q19A 3K53A 3I92A 3CRMA 1SULA 4E22A 2O0HA 3G0HA 3HWSA 421PA 4EPVA 1TX4B 3ICEA 4HAVA 1CS4C 1EFRD 5SZIA 1E2NA 2GWHA 5CM8B 2CHVA 1E0KA 3E5HA 3AVYA 1JAIA 3THYB 4QGHA 2HCJB 3EZ2A 1RVDA 3I1FA 1MOZA 5FPTA 4F7WA 2HXYA 1WBBA 3D31A 2L0XA 2CMKA 3NC1C 4QC2A 1XCMA 2IXGA 3HDTA 2QP9X 2OM2A 4DCVA 1E2FA 1D2NA 4YMWA 4EKDA 3O8RA 5CYOA 4MRSA 2OILA 4A6XA 1VCMA 4P4UA 3AKDA 1A7JA 2ATVA 2FEMA 3EZFA 4TTQA 5BN4A 2O8CB 4G5SA 4D0GA 2R6CA 2WOOA 1A1VA 4JJKA 3IBGA 2XITA 5GADl 2B92A 4AD8A 4U5XA 2GVZC 1E69A 2ZRBA 1G8PA 5A5GA 4OQFA 3QEOA 3C15C 1Z5ZA 1XXHA 1ZUNB 1KK0A 2OAP1 2RAPA 1OFTA 2RGAA 3HR8A 1HYQA 2CL6X 3KJEA 4US1R 4ZCLA 5JJKA 2O8BA 3LA6A 3CIOA 1AKEA 3PCRB 1VKJA 4HDCA 4BQSA 1E98A 3QQ5A 1X86B 4DXAA 4BFXA 5G53C 2G88A 3AVOA 3EIHA 1Z2AA 1EFUA 1KK2A 1YU9A 1OB5A 1KO7A 2QL6A 2HYIC 3K9LA 4CEHA 2NO1A 3GLFA 1Q21A 1W49A 2G83A 2O8DB 4XD7D 5HPYB 2YZ2A 4RKFA 4UXHA 4Q1FA 3SHWA 4LJYA 1AZSC 4DKXA 2J1LA 2KJQA 3C41J 3K0FA 4US0R 4JVLA 4PZLA 4EPYA 4KYIB 2YC4C 3FWYA 3WBKA 2JDID 2VF8A 2QPTA 2F1RA 3QKSA 2DFNA 1W4BA 3QUSA 3AF4A 1KDTA 3ZQJA 4B48A 4Z8XA 3I4LA 4ZDWA 1U0JA 2JATA 2O5VA 1KMQA 2YC2C 1CF4A 4GSYA 5KDOA 5J4KA 1KI8A 1XZPA 3TQFA 1RZ3A 2GKSA 1DS6A 3T1OA 4FCVA 5C46F 1S3SA 4TSFD 3TVDA 2PMDA 4MRRA 4JVNA 2BDTA 1KOFA 2ORWA 1UEIA 3WNDA 4CEJB 3M0EA 4MRVA 1IY1A 3I5XA 1E96A 3BFXA 4GBMA 3REFA 2BBWA 3M6AA 4KSBA 2FJUA 2GAOA 3AVTA 1UBCA 1PLJA 1KY3A 3NTUA 4QRHA 3RSOA 4HLUA 1AJEA 1M2OB 2VP0A 1DAEA 2F9MA 3QVUA 1S3GA 1MT0A 1UEJA 1IXRC 5L3SB 2BMEA 3I8SA 1T4GA 1ZP6A 2FSIA 5SZHB 4RCZA 3QIAA 4EPXA 4OL0A 4W7SA 2H8KA 2CCJA 2ZI5A 4BLSA 1LY1A 2REOA 3U4QA 2CK3A 3B1XA 4F4CA 1NBMA 2PLFA 3I5YA 2ZAMA 2OFXA 4LV6A 5JHHB 1R6BX 3SN6A 1GG2A 4UQOA 3PQCA 4M9QA 4M9XA 5A0FA 3S1AB 1BIFA 3LFUA 1P7CA 4V02A 1ANKA 2IYVA 1OYWA 1W4CA 4GFDA 4HDOB 3T61A 4XWKA 1Z22A 4B3CA 4DLSA 4OK3A 3A1TA 1N2CE 2DFKB 3KQNA 4GZMA 1TQ2A 1XBTA 4HAYA 1IONA 2R62A 4JLAA 4AC9A 5JZVA 4UXJA 1AS3A 1MRNA 4KCGA 4KFUA 2QMUA 2FDCA 2QU8A 1W47A 1ZIPA 3AUXA 2FGJA 5ELXA 1Z0JA 3C16C 3MUFA 1XMSA 2PEZA 4V0NA 3R9WA 3QF7A 1X1RA 2MMGA 1AGRA 1D2EA 1P62B 3ZGXA 1X6VA 1VG9B 2ZU6A 1AQYA 1H8HA 3CF6R 4AG5A 4O2RA 3V00A 2OXCA 4LZZA 2IT1A 3EA0A 3FKQA 2J87A 1NL3A 3KB2A 1E4YA 3KUDA 3QF4B 4ZKDA 4MKFA 2ECKA 1AZTA 3HPQA 3TIFA 2D3WA 1FL9A 2V9PA 2V3CC 3UPUA 5DHAA 1MR3F 4Q18A 3W9YA 5CB8A 1WB9A 2C2HA 3W5IA 1PJRA 4DLZA 2Q3HA 1EESA 2WZQA 2V55B 1KY2A 1R4AA 2BOVA 5K8IA 2QMEA 3KQUA 4MGIR 2J3EA 4Q4JA 1W0JD 2GJAA 5AWFC 2OO7A 3MG9A 3E2IA 3R7WB 1XD2B 1BYIA 1Z08A 1Q22A 1P6XA 4Q03A 2I1VB 4JLVA 3U7FB 1ZINA 4EFMA 5JI3E 4BUJA 1D9XA 1RKBA 1E94E 3ASZA 4I99A 4DCNA 1G1MA 5EUQB 1UJ2A 2VP4A 1II9A 3W6OA 3UK6A 1MV5A 2CNWA 2NO0A 2ZR0A 4FXPA 3KQHA 2AXNA 1LV7A 1XRJA 2VHJA 1E2QA 1EX6A 2WKPA 4MYCA 1NP6A 1YZUA 5IT5A 4LGMA 1DAHA 1LW7A 2V6JA 3TRFA 2Q3MA 4D82A 1HT1E 1ZC4A 2OZEA 1E0SA 3J81k 5J4HA 4KBGA 4H1UA 4UNPA 4JL8A 3L8ZA 2ZR7A 4ILEA 4MDEA 2H7VA 1VCNA 4HZUB 3H2YA 1K5DA 3HJNA 3UWKA 2RGNC 4IW3B 5FOUA 3KFXA 3SYKA 1JR6A 1GKYA 3LVQE 3LQQA 3X1WA 3TMKA 3CF0A 3RAPR 3I62A 5JS7A 1UADA 1FMJA 3AP2A 3VHLB 4V0ME 1N6NA 3B9QA 1VIAA 1GILA 4V0KA 3LO5A 2OCAA 4B33A 4X8HA 1SXJA 3RRYA 4MKIA 5TB5A 4OBEA 1XWIA 1GL9B 2Q9CA 3IDQA 3NBZC 2IL1A 2XOKD 2A5YB 1G4UR 4AKHA 1U99A 5EJEA 4TT3D 2WKRA 3FKSD 2ZJBA 4NDZA 2ZR9A 3AGPA 1DAKA 4WXPA 1A82A 1W2GA 2NMVA 5GJVC 1ZJ6A 3Q72A 4KI0A 3FHOA 3CX8A 4OI2A 1ZM7A 1E1QA 4BFYA 1YR7A 2ZRPA 3IIJA 4C0BA 1GL7A 3M1IA 5JJLA 3K0CC 1KKLA 2QY9A 3GJ4A 3A4LA 4HATA 1NSFA 1F2UB 1YR8A 3L0IB 3B1YA 1QHSA 1CU1A 2BKEA 4U7DA 4WAUA 5HE9A 5JCPA 4XVQA 2PCLA 3I3SR 3B85A 1FZQA 1P2UA 3A1UA 4KHZA 1PLLA 3IGFA 3N2IA 4B73A 4KITB 3CX7A 3K09A 3FVQA 3KXKA 2TMKA 1V5WA 3BB4A 3SQWA 3MD0A 1RFLA 1YZGA 1M7GA 1QDEA 4C2TA 2HDNB 1ZW6A 2ZYWX 3P4XA 1FX0B 1QHHB 3QBVA 2RGGA 3KZ1E 1E79A 1O3YA 2FNAA 3MGCA 3L2OB 2DFTA 1BS1A 1D8TA 1J70A 2WJHA 3CZPA 3KXLA 4Z1MA 4URUR 1ZUHA 2WMNB 3A37A 3ADBA 2RCNA 3QY0A 2IWRA 4BFTA 3PITA 3RS7A 1XMVA 3SS8A 1NN0A 2J0SA 1KK1A 4IEEA 2AFIE 2P6UA 4LYJA 4AYTA 3GQBA 4JSYA 3FHTA 4PHHA 5DI3A 1OT3A 2FFAA 1C4OA 5EXTA 5J4VA 5BN5A 2ZSDA 1KI2A 1Q3TA 2RGEA 2Z5FA 4ITRC 5DI9A 4PO1A 3AVUA 2BV3A 4TYYA 4FMDF 2NG1A 4DT1A 3FOZA 2CE2X 3ZIAD 1XTIA 2FU5C 4ZIRB 1R5BA 1OLOA 4HB2A 3EIQA 5FL3A 3ZS9A 3PEWA 2VP2A 3UKDA 4BASA 1OKKD 4MYTA 3NXSA 4Q4AB 1J8MF 5KSYA 2DCUA 2QGNA 2XJ4A 2AXPA 2WWXA 4C7OB 2QROA 1N0WA 2EYUA 2D4HA 1FUUA 3CPEA 1G291 2OBLA 5FPSA 1G3IA 3LX5A 5FL7A 1SVLA 3WP0A 3RABA 3WNBA 3KJGA 4RFSB 4P4SB 1E0AA 4YMUA 3VQTA 3LY5A 1EXMA 2IYQA 4NTZA 2GEVA 2V1XA 3EWSA 3TQCA 5JHGB 5CK4A 4IVQA 4BPBA 1XX6A 2CXXA 3TGPA 1GNRA 1W7AA 1S0UA 1GNQA 2NZJA 2YVUA 3DVLA 3GJ3A 5KU1A 4EQ6A 3U6BA 4LX0A 1GITA 3RHFA 5HCNA 1E9BA 2ZRLA 4Q7KA 5D3QA 1IN5A 1WQ1R 4LWZA 1F48A 4PX9A 3OEEA 3PEYA 3GLIE 3G82C 1NMYA 3ND8A 5B57C 2HF8A 2ZIAA 2GETA 2BJVA 3REGA 5BWMA 4DCSA 4E07A 5KNBA 4P3YA 2V7QD 1ZYUA 3OFND 2WIAA 2OBNA 1J7KA 1GTVA 1ZBDA 3BRWD 2GF0A 2EWWA 1P2TA 3GLHE 1MO3A 2SHKA 5J5CA 3GP8A 4WBSA 4HUTA 1N5IA 1FTNA 2J45A 4ACAA 4DVGA 3OHMA 4IOKA 1NY6A 5DE3A 2WWIA 4KVGA 4AG6A 1W36B 3AVPA 2AN9A 3T1TA 3RC3A 2XSZD 3EASA 4FCWA 4N0DA 1TF7A 4K81B 4DJTA 5IRCD 2XNDA 4A2PA 4CVNA 1KI6B 1G16A 2EFEB 3JZAA 4LHYA 2ANCA 1L4UA 1ESNA 1WDTA 4UJ3A 4JIMA 2XGJA 1XEWX 2PL3A 4TLDA 4D0LB 2QMHA 2PT5A 4PAQA 4X8LA 2QA5A 1JEDA 3E1SA 2QTFA 4AYWA 1WF3A 4KBFA 2AK2A 2PEYA 2FPKA 3A36A 3GLIB 3UG6A 1Z0FA 1GWNA 4UNRA 1JECA 2W2VA 2GXSA 3SYLA 1TADA 2EFCB 5DYGA 5FTJA 1FMLA 3WYGA 5FBVB 4AYXA 5FOWA 3W6PA 4C2UA 2ZM5A 3GLHB 4JLKA 1BYUA 2K5UA 2R8RA 4CW7A 3ZDQA 1UBGA 4EJSA 2ZREA 1AKYA 3CR8A 5TXGA 2FSGA 4MGYR 1KJZA 2C96A 2QEQA 1A2BA 3B9PA 1UAAA 3QPVA 4M53A 4A1FA 4HB0A 1MRSA 4RY2A 3Q5DA 3T15A 4MA4A 3QXXA 4HEJA 1Z3IX 1EWQA 1VHLA 2KBEA 3L82B 4LJ4A 4BFWA 2OCYC 1YZQA 1NMXA 5FUWA 3RVBA 4A8JB 2F43A 3T34A 1ESMA 2J5XA 1OYYA 1KZGB 3OIWA 4OJQA 1DTSA 2PZEA 2BCGY 5JECA 4GL2A 4DLWA 5AJXA 2QNRA 4Q7LA 3B8HA 4B3DA 3P20A 3AF0A 3HR7A 1T5LA 4I4LA 3LWNA 3MCAA 1FUKA 4HSEA 4AK9A 2P5SA 4GP7A 1JI0A 4BLOA 1GRRA 2D06A 2WWFA 3Q8XB 4QL3A 2GK6A 1XU4A 3WMFA 3PUVA 4Y0AA 2IYUA 2H18A 3TH5A 2ZQ5A 4I1OA 5DISB 1X1SA 1XFAA 1N6HA 1G7SA 1R0ZA 4TQUS 1SQ5A 3HU3A 3O47A 3VAAA 1U9IC 3VFDA 4C0KA 4D4MA 1AA9A 2VSFA 1UBEA 1XXHE 1KI9A 1X8LA 1EWRA 1GRNA 3CF2A 1S96A 4A6PA 1F2TA 2ZS7A 4TLEA 4TL6A 5FOXA 5FBRB 2ZE5A 1OIXA 4M8NE 2F1HA 2FSFA 2WICA 1E2IA 1OH8A 2OE2A 4FWIB 5F2EA 2G1JA 3LXXA 3RS3A 1SVWA 2B7BA 5DLQC 4B47A 2G6BA 4TMTA 3GJ5A 1VMAA 4HB3A 4XD7A 2QQEA 4RD6A 5F9HA 1KSGA 3RC8A 1W36C 3LBHA 2FSHA 1W5TA 3U3RA 2IW3A 3RRNA 3ADKA 2PJZA 3NHAA 2I1QA 3EPHA 2GCNA 2A5JA 3RYTC 3UXMA 1N6RA 1Z06A 2JDIA 1H65A 3CNOA 1SVOA 3LQRA 5JLJA 2VTKA 3B1WA 2JGNA 1WA5A 2C99A 2C5LA 4EFLA 1KSHA 2ZJOA 3SHFA 4IOJA 1P3JA 5EP3A 2D62A 3RDPA 1RRFA 3SJCA 1CRPA 1DVRA 1NN3A 3QPUA 2UKDA 5BYKA 5DYIA 4HYYA 4MQBA 3TJZA 4TSFA 2H16A 1F3OA 2DFLA 2QAGA 3SE0A 4B6EA 1M6NA 1KNQA 1T3LA 4JBYA 4TMWA 2JLYA 4MGZR 3TSZA 1YR6A 2GBLC 2WOJA 1SHKA 4URXR 1KI1A 1NJGA 3BORA 2ZI3A 4NCHA 4N0EA 1E99A 1IAQA 1P75A 4HLCA 2RHDA 3U7HB 2VBCA 3K70B 4RFVA 2JJ1D 2VIIA 2CLSA 2KE5A 2ZI9A 3VR6A 1C1YA 4TYWA 5JWHA 2IWHA 1DAIA 1KAGA 4HLQB 1OV4A 1IJEA 2ODWA 3U7GA 2WAXA 2CVHA 3NBYC 2QT1A 4NH0A 3TLXA 1KGDA 4A8JC 1Z28A 1FP6A 3L0PA 3D8BA 4D80A 1MABB 1XEWY 2JLXA 2FZ4A 1NBME 1U98A 3EZ6A 4PSKA 3W3ZB 1G8FA 1L7VC 1PZNA 1ODFA 1UDXA 1IXZA 2H1LA 2ODBA 1U0LA 3BC1A 4EPTA 2EFHB 1TU3A 3TE6A 2OBMA 1GKUB 4OQXA 1R0XA 1U90A 1R0WA 2G3YA 1I4LD 2ZRMA 2KWIA 4MGKR 1J2JA 2XAUA 1KTVA 4LBWA 4C0LA 1KNXA 1XTSA 4M1OA 5BN3A 2BEKA 4F4IA 2JIZD 5CIQA 4BWYA 4PZZA 2ZRHA 4TYPA 2B8TA 1NIJA 1M34E 1E2MA 2CCKA 1NY5A 2OXRA 3VNUA 2ZI6A 1DAGA 2BWJA 3EG5A 4MYHA 1OFUX 2WV9A 4M4SA 4CF7A 1M7BA 1VHTA 4QM7A 1US8A 2P2LA 3CB4A 5HCIA 1Z47A 1G6HA 1II8B 3KTAB 3MJHA 2R6FA 3BS4A 2OG2A 3H1TA 3KFVA 4NYJQ 3MWLA 4TYNA 5EE3A 3U3JA 3FFBA 4PQYA 1M1YE 4PSAA 5EZ6B 2WMOB 2ZRCA 1DELA 2Z83A 2BM1A 4LK2A 1FQJA 2EU8A 4WVFA 2A5FA 4JMPA 4A0FA 1NLZA 1RRGA 2OLKA 4GMXA 4L9WA 2ATXA 2W2XA 3MAAC 4PC3A 4IFEA 4D4LA 3OIUA 1JB1A 3I32A 5KSZA 4KFRA 4X8MA 3WRXC 2PCJA 2QQ0A 1W0JA 4IVPA 3SFVA 3C4JA 4LI0A 4UKDA 4E5UA 4CEJA 3GEHA 4RJLA 2C9YA 5CDFA 1KDOA 3ZZTA 1RPZA 4H9GA 4QBHA 1TUEA 2GEDA 2WSSD 2YINC 1A4RA 1KJWA 3EW9A 3M4YA 1LVGA 5L3RA 2QE7D 521PA 4A0HA 1G18A 2MSDB 1LS6A 2ZRJA 2A5GA 1OXXK 2HT6A 2OUKA 5ANRB 4ZI3A 4CDGA 5LDDC 1MO6A 4IDNA 3D3QA 4Q7JB 1W4RA 4BGDA 1PVOA 2JLSA 1QHIA 2C04A 4JS0A 4C0HA 1CJUC 4EAQA 3NG1A 4LHXA 4A2WA 4WZBE 4RD3A 4S2EA 3H84A 2EW1A 2XXAA 1JPJA 1VIYA 4DDVA 4YC7A 4EFNA 2BM0A 2HJGA 5CLLA 4WW0A 4YONB 1U2RA 4YMSA 1ELOA 4WOPA 1KHTA 1KDRA 2IUUA 2KB0A 4Q9KA 4XSHA 3K70C 4PR0A 4MUBA 3W8RA 2NZ8A 3H86A 4LBYA 3TNFA 2C03A 3H4MA 1XJCA 2ZSAA 1NG9A 4IEIA 4Q4JB 5CJ2A 1VECA 4J0QA 4RD2A 1DPFA 3CRVA 4NCIA 2O8EB 5JFGA 2QPAA 4WXRA 2WVJA 2XZOA 1NN5A 1W36D 3CRQA 1G20E 5HKKD 1CR1A 3EA5A 2IYRA 4QBGB 1BMFD 4EDHA 5JMTA 2XOKA 3AM1A 2REBA 2QM7A 2PLRA 3VNVA 3X1XA 3LX8A 5EE5B 4TT3A 1CTQA 1PUIA 2ZVPX 3FKSA 1YHNA 5JSZB 1KMHB 1QF9A 2AX4A 4BLQA 4RD0A 1FNMA 2W6ID 3PEUA 4FINA 2IYTA 2OCPA 4QNRA 1P73A 3B1ZA 3K0SA 2OT3B 3NWJA 2WHXA 2Q3FA 2EFDB 1Z6AA 4MH0R 3TW8B 5L3QA 5J4YA 2QAJA 2QRZA 4K8OA 2XZLA 1KIMA 1ZM2A 2VLIA 1J99A 4NYIQ 4ZDKA 2QZ4A 4I1SA 2ZXUA 2J0QA 2Z0MA 3K8YA 4PPQA 5IK2D 1SVIA 4V0LA 2ZRNA 4BLRA 3NEJA 3IHWA 4E09A 2F6RA 4DIEA 4I1UA 1T6NA 4HZIA 1N25A 3TVTA 5EUMA 3W5JA 2GA8A 4NE2A 5CM9C 3U3KA 3QEJA 1NKSA 4URYR 2NO9A 2O0KA 4PO8A 2QPOA 4ZDJA 5DSZA 2GJKA 3QENA 3X1DA 4ZDIA 4DB2A 3W8NA 1JR3E 4IVRA 2ZETA 1P9WA 4M1YA 3DKVA 2GJ8A 3G5UA 3THYA 1AK2A 4JLNA 2VSXA 4B74A 4NYJR 1XTKA 4JLBA 3GPLA 2AK3A 4WZAE 4JLDA 3U7EB 1YRAA 4GDFA 2UZIR 2YWFA 1NVWQ 1T3SA 1GVNB 3BERA 5E7JA 5EXSA 3UIEA 2W58A 1G19A 4B3FX 1G17A 3GJXC 2V4ZA 2Q6TA 1HH4A 2W83A 3SFZA 1G5RA 4LJ7A 2DWQA 5H70A 2WM9B 2WPDD 3KQKA 1YRBA 1U0HC 1JQJC 3RWMB 2XB4A 3R20A 1XDBA 3ZIAA 2GEUA 3B5JA 1J90A 3PIRA 2KSQA 2ZI7A 3SBEA 3O8DA 5D3MB 3FTQA 1CLUA 5CITA 2Z6VA 1OKKA 1P61B 3U44A 3RRZA 3BFVA 2J0UB 3QXSA 5FR2A 2E87A 3LW8A 4R2IA 1ETUA 1XTRA 2H5EA 3THXA 1N0UA 1M8PA 4ARZB 1L2TA 4LV8B 2YWGA 1JXOA 2AWOA 2FG5A 4MITA 2V6IA 2C98A 4R2HA 2J41A 3ZQ6A 4L8GA 1QHXA 3DM9B 3EX7C 1S1MA 1SHZA 4P31A 1EK0A 1P4SA 4BRUA 2O8DA 5GJWC 1UF9A 3KQLA 2ZITA 1U8AA 1P2VA 2C9CA 4LYHA 4KXFB 1KAOA 4DSTA 5JBQA 3VR1A 4OI4A 1WBDA 3GEIA 2BCJQ 1Q1QA 1XEXB 3B6EA 3T1VA 3AF1A 2N1BA 4V0OA 1ZUIA 1P2SA 2Q9AA 3CNLA 5KSOA 1KK3A 2V7QA 3NIBA 3OFNA 3THWB 2WWHA 3U6KA 3AH8A 2X2EA 2A9KA 2I4IA 3P1JA 3WXMA 2GXAA 4CEIB 2CEAA 3LVRE 4O2LA 2VEDA 4KU4A 3AQ4A 2XEXA 3QXJA 4LYFA 3VHXA 4B32A 4TN1A 3MWYW 1R8QA 3GFOA 3JVVA 3DKPA 3BJIC 2XSZA 1CKEA 2GZAA 1OIWA 4PPFA 5JWRA 1G8HA 5TARA 3K70D 2ZJ2A 3K9NA 3GJ7A 3P32A 4PQRA 5L3SA 4NYIR 3AV0B 5M04A 121PA 3KX2A 5FUYA 1VG1A 4KO8A 4TZ6A 1ZM4A 1II0A 2EYQA 4IDOA 4DBLC 1NF3A 2AHOA 4D25A 2VH5R 4TLAA 4MKHA 4RZ3A 4G5GA 2HUPA 4BFSA 2YKGA 4OJKA 4F93B 5KNDA 5EZ5A 3BBPA 5F9FA 3K0EA 1G64A 4RVCA 4NYMQ 4Q01A 4EPRA 3S1AA 1Q20A 3LNCA 1G8GA 2PX3A 4HB4A 5FOTA 3TUJC 3OF5A 1LF0A 1TUIA 2ZRAA 4QHYA 1IXSB 2DYKA 5HE8A 5KYKA 1DADA 4RSGA 3A4NA 1NJFA 3O8CA 2XJ9A 1E32A 3K09C 2N42A 3CUEF 2HLDA 1R7RA 3N2EA 1DAFA 3TUZC 1HE1C 1QRAA 5CB6A 5EP4A 2VP5A 3OZXA 4LHZA 1JQLB 3AP3A 3QF4A 2GF9A 1D6JA 3IILA 2BHRA 1XD8A 2O0JA 2ZJYA 2ZRIA 5EP2A 2RGCA 2CJWA 1OF1A 2GXUA 2F9LA 2FPLA 1T8UA 1EFTA 3Q7QA 3OAAD 1G3RA 1S1CA 3DOEA 5B2ZA 5KDDA 4LRWA 4QGGA 1Q3HA 4DEYA 4ESHA 1Q1EA 2RMKA 5KO2A 1Z6YA 1N6IA 3MJRA 3EPKA 2G77B 4NP6A 5JRJA 3VKHA 2CL7X 1AM4D 3SEAA 3LD9A 4RKEA 4KLNA 5HZHA 2PJRA 1B23P 2IS6A 4P33A 2VPPA 1E1RD 1SKQA 3R7WA 2WAYA 1XD2A 4LC0A 3QKUA 4I1VA 3FGNA 2DPXA 3EAQA 4P4TA 4Q4HB 4HAZA 4URWR 3X1YA 4NBSA 3WBJA 1JPNA 1SVKA 1BKDR 1CJMA 1R5OA 2ERYA 2HXSA 2OHFA 3SR0A 3VX4A 4KFSA 2ZU0C 3IEVA 4Q47A 3EPLA 2NGRA 4HAXA 1W5SA 3BFKA 2P67A 1KO5A 4JSTA 4QOSA 4FMBB 1FPMA 3QG1A 4B71A 2X8AA 5LD2B 4S35A 4M1SA 2B7CA 2ZPTX 3BH6A 3GD7A 2IXEA 1FFHA 2JLWA 1RJ9B 4QHTA 2CLDX 4JBXA 3ZS8A 3VR3A 4AKIA 3BGWA 2O8FB 2PBRA 1OXUA 1OXTA 2FFQA 2FPMA 3WRYC 2IX3A 4HZUA 4BLPA 2NO7A 3B82A 4LOAA 2YJTD 4DDTA 2CHGA 6Q21A 2C77A 2A3RA 1IN8A 4GMDA 1GIAA 3QXHA 1DOAA 4M21A 1IN6A 4PC2A 3KJIA 3AVQA 2G0NA 4IRUB 3RS2A 2OCBA 4HI0E 4LHVA 1LFDB 2QSZA 3PJRA 1IQPA 2ZJAA 4Y0VA 1KKMA 5CJPA 4XVRA 1JNYA 2BJWA 2UZ3A 2OLJA 2WJYA 3PXGA 3SC3A 2B6HA 4PHFA 2IXFA 2ZYVX 1Q1BA 2ZUCA 1R2QA 2VF7A 2GJSA 4V03A 2IYWA 5BQ5A 1E9SA 4LPSA 4Q1AA 5TVKA 3T5GA 1G7RA 1XTJA 3IO5A 4NKRA 5C4GB 2W6JD 4M0LA 3VU9B 4JYCA 1GOTA 3TR0A 4KODA 3F5FA 2JJ1A 2OFWA 4I81A 4DCTA 2ZE6A 1R8SA 2G0TA 4PPNA 3GLGE 1F2UA 3ETLA 3NEYA 4R71A 1T0JB 5EXXA 2ZS8A 4LHWA 2RGDA 4NCKA 4NYMR 1OHHD 2H17A 3L0SA 5FTLA 3R9XA 1QHNA 1RRPA 2FFHA 2IS4A 3VX3A 3TSOA 2JEOA 1Q0UA 1ZU5A 1NVVQ 3A1WA 2PZFA 1Z07A 3IHLA 4FN5A 4FI3C 2MSCB 4N3NA 4PPGA 4D2IA 2DY1A 4FWTA 4V0MA 1G7CA 3C14C 1FP7A 4NONA 1GSIA 1NVXQ 4YXWD 1EG7A 1FX0A 1QHHA 2ZYTX 2FA9A 4TWZA 5L8VA 3LDAA 3P27A 1Z0AA 2W00A 1Z0KA 3VKWA 4HUQB 3SDZA 1QHYA 4NZYA 1ZVQA 2QGZA 4C4PA 3VMFA 1KI7A 4DSOA 4OI0A 4A0RA 4ZCIA 1TU4A 2IYSA 2IYZA 4C0SA 4C0JA 1Z0DA 2WKQA 1Y63A 3UMSA 3NC0C 1HY3A 2IEYA 2AWNA 2VHCA 1ZRHA 3IUYA 2Z4RA 3KKPA 5AJWA 4C0AC 4PXAA 5JEEA 4C0QC 2IUTA 4XJXA 4NMMA 3TW4A 1EFRA 4RD1A 2GCOA 3ADCA 1M74A 1I2DA 3T5DA 3BAFA 3GLGB 3SYNA 2KBFA 4H1VA 1U94A 2E9SA 3B1VA 3QSYA 5FPKA 1OW3B 1Q1ZA 4OK5A 4OHYA 1TF2A 2ZVQX 4XWOA 5J40A 2FZLA 4LJ5A 1DO2A 2P3SA 3H0KA 4DUGD 5LD2C 4GPTA 3CWZA 4ZIRA 4XIGS 3SJZA 2IHYA 1XNJA 2IC5A 2VL7A 3GMTA 1VPLA 3KKNA 3MRSA 5GJBA 4G1UC 4FMDB 4Q4AA 5KTYA 721PA 1P5ZB 4B3XA 5JJIA 1JR3D 1GKIA 2JA1A 3K0AB 1XPUA 4L4UA 4HLDA 4U02A 4C7OA 2WWGA 3QXCA 3RWOA 5GVSA 2QBYB 2NQ2C 1ZCAA 3PUYA 3BXZA 3O8BA 3IBYA 2DR3A 1ONBA 3IQXA 5FBLB 3R8FA 1JALA 1N5LA 4BZQA 2KI5A 3QKRB 1E3MA 3KB1A 1TL7C 4RFSA 1AS2A 4P4SA 2QUZA 3SU8A 2GCPA 4QHSA 2QE7A 1R5NA 3WMGA 5LBIA 4YMTA 1TF5A 2ONJA 5DHFA 1Z6TA 2ZROA 1ZAKA 2C78A 3VR5A 3VR4A 1YVDA 4FW9A 1U9IA 5LB2A 3A8TA 3SNHA 4C3ZA 1NG1A 1W0KD 3HYTA 4JLOA 1ZD8A 2HYDA 5FI0B 1P60A 2IHBA 1MO5A 1XPOA 3QPWA 3KKMA 4MYUA 4GT1A 4DLXA 4IDPA 2D7CA 4PTLA 4EPWA 3ZLJA 3MLEA 3B13B 3GLFE 4OK6A 3U61B 4TMKA 2E1RA 3T06B 1UKEA 1UKYA 1NNEA 2D74A 3K9GA 3OE7D 3GJ0A 3Q3JB 5DO9A 1CULC 2RGBA 1Z2CA 2NPFA 3SBDA 4AIIA 5B58C 1EX7A 1F5NA 3ND9A 2IK8A 3AVVA 1Y3AA 4DLTA 4ZCMA 5J4LA 2ZTSA 1Q44A 3L0OA 4IOLA 3IQWA 4DEXA 4JT4A 1ZM3A 4YMVA 2VHUA 3EXAA 1YZLA 2P6NA 1UBFA 1PV4A 1MKYA 2NOAA 2ZRDA 2VA8A 3CH5A 1BMFA 4QFMA 1XXHB 3F8TA 4AKEA 1Q12A 4TMZA 4ASUD 4LJ6A 2R44A 3WHKA 2AFHE 4W9MC 3GJ6A 1QZXA 1HQYE 1KI6A 4CIDA 3C8UA 3DMNA 3N70A 1E9DA 2O8BB 1ZD9A 4RZXA 2GRJA 1NSTA 5A4JA 3DO6A 3VKGA 2W6IA 5FH9A 3KXIA 4HDQB 1NVUQ 1R10A 2BKUA 3LBNA 2NIPA 3ZVLA 1AGPA 3CM0A 4DLVA 4QKQA 2B21A 3ONWA 1XJQA 4NU0A 1NVVR 4YDSA 4IHQA 2XTNA 5FR1A 3GLIA 2RHMA 3DL0A 5KOYA 1XMIA 1GP2A 1KZ7B 4XH9B 1NIPA 3GLFB 4CEHB 5IK2A 3U60B 1YZNA 2QMOA 4CYMA 2FGKA 3F3YA 1P72A 2QI9C 5LB4A 5H1YA 3GLHA 1E9AA 2HF9A 3BH7A 4JLPA 1XPRA 4LJ8A 4YQFA 3LRPA 3K0FB 3PVSA 2ZUBA 4W5WA 1N6KA 2FMXA 4OI1A 3A6PC 1UM8A 1OH5A 5DNYB 2QRNA 2REXB 4URVR 1NKTA 1CXZA 3CPHA 4B3GA 3QKSB 4KSCA 1NMZA 1RE0A 3OESA 1DBSA 3R8CA 4II7A 3EZ9A 4RCYA 3UWOA 1GAJA 4CRWB 4DCUA 2AKYA 3NDPA 2JLZA 4A8JA 1SGWA 1ZD1A 4AWXA 4KV9A 1U8ZA 2ZSEA 3LW7A 1VDZA 3I72A 3ZVNA 3CO5A 1XCPA 3THOA 2QSYA 3IPXA 3IPYA 4DDWA 4DIDA 4M9ZA 3A1VA 3VTKA 2WTUA 4K46A 2YOHA 1VYVA 1ZU4A 3ZVRA 3WY9A 4HAWA 5C18A 2WPDA 1GNPA 4CT5A 1CBUA 1RW4A 1SVSA 5FBQB 4A92A 1AIPA 4US2R 2GK7A 4Q21A 3U4QB 1LTQA 1CEEA 3IIKA 1A5TA 1G41A 2AL7A 2YOGA 4A82A 1AS0A 2JJ2D 1TAGA 3RANA 3LLMA 2IS1A 4LYAA 1E2EA 4TMXA 2A5DA 2CBZA 2XB2A 4LBVA 3X2SA 3U2QA 3A4MA 1NN1A 2NPIA 3B60A 5E95A 1ZNXA 1MH1A 5HTKA 2JAQA 5E7MA 3JVUA 2YOFA 3ZD6A 4OQLA 3UMRA 1XD9A 4DHEA 1L4YA 2I3BA 2Y8EA 4KYUA 4BECA 1E2LA 3AUYA 2D2FA 3HYRA 2C8VA 1IJFA 2A30A 2RGXA 2UVQA 4KAXA 2EFGA 2F55A 5F3WB 2FEOA 4MRNA 5FFMA 3WYFA 1ZMXA 3EWAA 1VCIA 4L9SA 3RLFA 3UG7A 3TK1A 3CX6A 1NRJB 1R0YA 2ODEA 3U3MA 1E4VA 3P4YA 4OHWA 4IOMA 2R6DA 4CT4B 4PSVA 4TQAA 4XTCS 1QVAA 4M2LA 5FPYA 2P6RA 5KUTA 3U44B 4KFTA 5SZJA 1QBKC 2JJ8A 4M1TA 2BIFA 2GJ9A 1F6BA 1N0VC 4FD2A 3W34A 3GFTA 3DHWC 2JCSA 2D2EA 1XEFA 2OESA 3THXB 2J7PD 4Z8YA 4D26A 3AEZA 3K9HA 2GESA 1KDPA 3MMPA 4D4KA 3OEHD 4PQFA 1COWD 2B8WA 4JL6A 5FUXA 4DSUA 1TNDA 3QJYA 5FOVA 3C5CA 1SXJE 1ZCBA 2VHQA 1W46A 2FFBA 3VR2A 3PV0A 2ANBA 3DZDA 1VG8A 2XNSA 3NVAA 4BZPA 4A15A 1OH6A 5K8LA 4IJMA 4OYHA 3KL4A 1HT2E 2LCFA 2ZS9A 4OQMA 1H8ED 5P21A 1MABA 2OAQ1 2VSOA 4F4JA 4XSGA 5E4FA 1GM5A 1FW6A 2P5TB 4Q9HA 2GILA 1K8RA 1KO4A 1J8YF 4BEJA 5AUOB 2ZI4A 1W2HA 4IDQA 5DN6D 4F92B 1E2HA 2QP3A 2VRWA 4GI7A 4OHVA 4HLUC 1D9ZA 1KO8A 4D0NA 3SOPA 2ERXA 4M1KA 3AKCA 2R2AA 4M1WA 2W0MA 1AQUA 1XTQA 2WBLC 3BE4A 2AR7A 3SJBA 1CJKC 5DGXA 4MUAA 2X77A 3EC2A 1SKYE 3CWQA 5GVRA 3FHCB 3WMEA 4LPKA 5C2JB 1PUJA 1FNNA 1SXJB 1XJ0A 1KSFX 2J59A 2NTYC 4B2LA 5C1BA 2ASEA 2ONKA 2W0SA 2X1VA 4Q5IA 5EQTA 4BFVA 2IYXA 1E2JA 1II8A 3KTAA 1LF5A 1ZNYA 2OEPA 1G4AE 2P0EA 3KKOA 1OE0A 4QNMA 3PUXA 1G3QA 3P26A 2ZE8A 4L5BA 1TTTA 3BD9A 2BEJA 3PUWA 4IXNA 4LBZA 2DHRA 1OPXA 1G8YA 3B2EA 4ESVA 1A2KC 3OAAA 1S2MA 2R6AA 4Q48A 2QN6A 1E2GA 3MSXA 4Q9LA 2EWVA 3PFIA 3V4RA 1AN0A 3FMOB 4L15A 3LAWA 3EIEA 2O8CA 1T9HA 4DC9A 1HV8A 5IF9A 3LXRA 1G9XA 4Z54A 3IO3A 1E1RA 4LC1A 2F3TA 2ZRKA 2RH5A 3BB1A 1W48A 4A36A 3TUIC 3ZYCA 4XOIA 1BOFA 4ACBA 1E9RA 3L43A 1SKYB 4GP6A 2ZYUX 4URZR 3MFYA 4LCBA 4QJ4A 2QENA 1T91A 4JVSB 2W2TA 1W1WA 3FE2A 2A78A 4LSGA 3BH0A 4L16A 4Q1DA 3V9PA 1RYHA 4QG7A 5KSPA 4B44A 1U81A 5CYPA 5L3VA 3AKEA 4UNQA 3K1JA 3QVVA 3FMPB 4MRPA 3B7GA 2PZGA 2HCBA 1E0JA 2CJWB 4B76A 1I2MA 1IOZA 1G3MA 3ASYA 3GJ8A 4JYBA 3WNCA 4C9BA 4CGZA 5TMPA 4WA7A 1TQ4A 5JWOA 1QG2A 3W3AA 5DI3B 2QORA 2JLQA 5EXPA 1GZSA 1OXVA 2PX0A 2OSBA 4MKGA 4DRZA 3HPRA 1ZC3A 1QHGA 4PANA 4Q66C 4A0GA 1QVRA 5HZKA 2O8EA 3D7MA 4R7ZA 1P9RA 2ZRFA 4RD4A 4DT1B 3EC1A 1GUAA 1VCOA 2CDNA 3FB4A 1W4AA 1M7HA 2C9OA 3AVXA 5BW8A 3LV8A 1Z6XA 2ZSBA 2F1IA 2Q0HA 1GFIA 1G21E 3RS5A 5JCZA 5JSZA 1KMHA 1UFQA 5F98A 4ZV4A 1OIVA 1I4TD 2GZHA 3NH6A 5FBWB 4B34A 4BE7B 4G3XA 1OB2A 2D7DA 1HEIA 4GOKA 4O0MA 2W6JA 4GZLA 4IDHA 2VP9A 3RSLA 1CIPA 4BZXA 2YYZA 4Z51A 2RGNA 4KLZA 5AR1A 2BVNA 3CH4B 5EE1A 4A2QA 1OHHA 2FV8A 5JEDA 2VHTA 2GTPA 1SXJC 1KI4A 1TQDA 1N5KA 1JAHA 3CKLA 4EQ6B 4EIWA 5FPHA 4UNNA 1IBRA 3EZ7A 5KPJA 3D6TB 4Q02A 5SZKB 1WXQA 4RZ2A 1D2MA 1DARA 1NLFA 4DWJA 4YXWA 1GRQA 4JL5A 1WMSA 4TMVA 5EP1A 4ABYA 2WWWA 2J7KA 4JJZA 3GCGA 5H8WA 2QM8A 2FWRA 1DO0A 4AURA 4OHZA 4POAA 3AB3A 1NI3A 4R9UC 5K8TA 2VQSA 2YWHA 1CP2A 5DIFA 2RB4A 1YE8A 1I4DD 1TPZA 1YR9A 4W5HA 2GZDA 3K0CA 2V1UA 3SJAA 2J0VA 3LLUA 4YLGA 4XTRA 3I61A 4G01B 2F3RA 3NBXX 1IN7A 1YZKA 2XX3A 1XP8A 3KKQA 3NH9A 3NKVA 5IHPA 1U8YA 5CIWA 5JRZA 3FDIA 3QNUA 1TQ6A 4U00A 1KSJA 4DLRA 4Q9JA 1JJ7A 4OHXA 4PC6A 5UKDA 1K5GA 1IY2A 4AY2A 3T12A 3TR5A 3Q5EA 4XVUA 4TTRA 4DUGA 1OXSC 1XCGB 2AD1A 2AD5A 1EFCA 2CK3D 4DSNA 5D3MA 3PR1A 1HUQA 1NBMD 4BLTA 2DB3A 5BXQC 2O52A 2IS2A 2J0UA 1JR3A 3FYHA 3QG5A 1S9DA 4P0TA 4PHTA 4Q7MB 1T8TA 3PG5A 3TSWA 4Q1CA 4JBWA 3E70C 4ARZA 2ORIA 3KDSE 1N5JA 4EJSB 3WHLA 3Q7PA 4TL9A 1G3UA 2IYYA 4RZUA 1ZNZA 3CRRA 5AJYA 1OSNA 4JT2A 2Z43A 5C4MA 1G7TA 4TL8A 1QG4A 4O25A 4PAOA 1EGAA 3N5CA 1VTKA 2GCOB 2IA5A 1IHUA 2AKAB 1H8HD 1X8KA 4UNSA 2R9VA 4BEBA 2HJVA 4HAUA 1W0KA 1TEXA 1D5CA 2F43B 2J46A 1RYFA 5FOSA 2WSMA 1DG3A 1S9HA 4TL7A 2XTZA 4B2PA 2QTHA 2BBTA 2WJIA 3DZ8A 5FTKA 4NPHA 4PFSA 1XEXA 1WRBA 1ZIOA 5G40A 2XTMA 2IF2A 1CJVC 2ZJ8A 3UMFA 2BC9A 1Z0IA 1Q57A 1HQCA 1E9FA 3OE7A 3THWA 2R6GA 4YDHB 2ZRGA 2CE7A 4EUNA 2QTVB 5EE0A 3IIMA 4CEIA 3OIVA 3I73A 2JLVA 1F60A 4PHGA 3WP1B 5KHOC 3Q9LA 1RRCA 4FCTA 2DBYA 5TV2A 4JVMA 1HURA 3AVWA 3CPJB 4OKSA 3JZMA 4OQNA 5TDHA 4ASUA 4Q00A 1N6LA 1WE2A 4FMCF 3MWKA 1NLYA 1TMKA 1F2TB 3W6NA 4Q1EA 1BH2A 5HR5A 4JLJA 5JS8A 4TLBA 5FUVA 2WJJA 1W44A 2CNWD 3TAHA 5AK0A 621PA 2F1JA 821PA 221PA 3QBTA 2WWYA 1KYIA 2CL0X 3KUCA 1C9KA 3A1SA 5BYJA 5AUNB 1ZNWA 2YHSA 3LH5A 1XMJA 4AKGA 3RRMA 5CLQA 2VP6A 4QXAA 1Z6GA 4M9SA 3SI7A 2X2FA 2HT1A 5K8UA 3RS4A 3RS0A 4IXMA 3DOFA 1HE8B 3UATA 4B6FA 2ZJZA 1KI3A 3CLVA 3L8YA 2BBSA 4ZPXA 1VYTA 3ZD7A 3BB3A 4QBIA 4DDUA 4DLUA 2F7SA 4JKYA 3CR7A 4A9AA 3IEUA 3TBKA 3ZVMA 1CR0A 2PH1A 4MDFA 2BBOA 2R65A 3SZRA 1SXJD 1UDWA 4A4DA 5GJCA 1OJLA 3HU1A 2QAGB 1Z8FA 2ZEJA 5AJVB 5AJZA 2JIZA 2IBMA 4TTPA 2IUSA 2NO6A 3BWDD 2LKDA 1IN4A 3CRW1 4O3MA 4WIAA 5KPDA 3U5ZB 4ON9A 4EJSC 3KJHA 3QKTA 4BFZA 1E1QD 2QG6A 4R98A 5IDVA 5J47A 4P32A 1FOEB 4X8OA 1KO1A 5G41A 1Z29A 1YJ5A 3AGQA 4TLCA 4QGFA 2A2ZA 3LBIA 1N6PA 1LB1B 4KJZA 3F0TA 4BRWA 4G5QA 3DEFA 4G5RA 5H68A 3CNNA 1T5IA 4B43A 3ZJYA 2JJ2A 1VYUA 2ZANA 3QOFA 1GDDA 4B75A 1E2KA 3HU2A 2WJVA 2CCGA 4Q4HA 2XZPA 1FQKA 4XWAA 3EARA 4IFBA 4ZO4A 2HEIA 3AF2A 1P9NA 3BOSA 4Q9IA 1E79D 2YNMA 1N3BA 2PMKA 3PUZA 2JLUA 4PO9A 2HLDD 4JKIA 4NHOA 2H92A 3ICQB 1DAMA 1JBKA 3CBQA 4Z1MD 1OH7A 2FE4A 3RNLA 1O87A 3AKYA 8OHMA 2VO1A 1K6MA 4WZ6A 1RIFA 2WSSA 3FMIA 5CDFE 1RJ9A 3TKLA 1OFIA 1DG1G 1LNZA 2V54A 4CZ2A 2O8FA 1YQTA 4JLMA 2FOLA 1WP9A 4D4JA 4B3BA 3PENA 4Q1BA 5FTMA 4M22A 2A7QA 2P65A 4TYQA 3WYAA 4GOJA 3Q85A 2BMDA 4ERNA 3CW2A 1US8B 2MSEB 1S8FA 3R9IA 4DB4A 2JLRA 2ZUDA 5CK5A 4QJ3A 3DDCA 1E2DA 1YZTA 3GFPA 1IM2A 3U3OA 1G5PA 2MMCA 2J9RA 1GL6A 1JEEA 2DWOA 3AF3A 4JZKA 5JI2E 2Q21A 3HP1A 4E03A 1PLKA 4UXIA 2BMFA 5EE9A 2HV8A 1X8JA 3IKJA 3QI2A 3BIFA 3FPAA 2CHQA 4FIDA 1XZQA 5E7IA 3BK7A 1YKSA
chains in the Genus database with same CATH superfamily
4L4RA 4U1RA 1E2PA 2A4KA 2N47A 3N58A 2FUKA 3ZHQA 3F7MA 1UKVY 4PZYA 4Q4LA 4PGFA 1OLXB 3V42A 1B0UA 2EOAA 4LISA 1H4QA 2FUCA 4NIMA 5JAIA 4MEAA 4Y7DA 3OIGA 3A58B 4IMJB 1XI2A 3CGGA 1BJRE 3E58A 4MUKA 1DFIA 1UKZA 4PC1A 3HKEA 5F4ZA 5FL7D 5ILOA 4YHHB 1K06A 3DMDA 4RJJA 5AVOA 1OFGA 1PG0A 2E49A 4UHDA 2BZ1A 5CLFA 3M6UA 1PJZA 1HTWA 2QT0A 1JJVA 3OZ7A 4OKNA 3WJ1A 3IKVA 2IEGA 3ECAA 3U40A 4M9CA 2IYEA 2C5EA 3H5WA 1OFHA 2A4MA 3MYRA 3KL2A 1UPTA 2RAFA 3LCVB 1LX6A 4QOFA 4LVNA 2MSKA 3K2IA 2LVBA 3OIYA 1K3TA 2JFYA 2JIBA 1WUJS 2QLTA 3C7KA 3HDYA 2X0FA 5KNCA 3C5HA 1DEXA 4EBFA 2V0GA 3H7IA 3U80A 2V8OA 2YWEA 3O31A 2HZ7A 4KR0A 1MIHA 3OEED 2R0QC 1JKXA 4M1MA 3WJAA 1EEHA 1XWWA 2X19A 3H42B 4JLWA 3S7TA 3D4OA 5DN6A 5FI1B 1FTSA 2V8BA 4J91A 4M36A 5T64A 1T3HA 1YL6A 1T2CA 3OFVA 1N5OX 2DG2A 5B64A 2I4LA 2NU7B 2P69A 4Y1GA 1XB2A 3KSUA 4GRDA 1GTL1 2G1KA 1MO4A 3EYWA 2FF7A 2XQVA 3FBWA 1BD4A 1CRQA 2VWPA 3FRHA 4P7FA 4RIEA 4TV8A 3RK4A 2AF4C 2RHOA 1TEVA 4O59O 5G3YA 5AOBA 1CJTC 1Y7TA 4RY0A 2P9TA 4C6HA 4G1BA 4BLUA 5IXYA 5DNDA 1DJMA 1L4MA 2CVFA 2OFOA 4ZHQB 3NHBA 4ZKEA 3ILYA 2BMJA 3N8NA 4JA0A 1SKBA 3QMMA 3DAPA 3CUYA 3GLGA 1CE8B 3A2LA 3SXJA 2Q9BA 2OO5C 3BEDA 1D7AA 2A1UA 1X3SA 3CEPB 1BCSB 1QS0B 3EZNA 1SG9A 4UVIA 3BCUA 4F9EA 3G17A 2NVWA 2DWPA 3WLSA 4EI2A 2BGUA 2YIMA 4U9UA 1LPBB 4TM7A 5TMEA 3NBFA 2IUEA 1MXHA 3DEYX 3VSDA 5ITZA 2PT7A 2OV2A 4RK6A 5JVDA 2M2IA 4FBLA 2FMFA 2JASA 4TVKA 4G0NA 1KJYA 2CLCX 1RKVA 3R5KA 1PR5A 5FTNA 3ZDZB 2IF0A 3QU7A 1G5TA 4PC7A 1LS1A 1QCYA 5CCDA 1JA1A 1DIAA 2G71A 2WUWE 3DFFA 1SQGA 2XHZA 4RKRA 4W1QA 4QSHA 1BO6A 2XCOA 3DMTC 4YA6A 1H4VB 5CLIA 1DP4A 4COOA 4L6AA 4MYDA 4NCJA 2VDUE 4ITVA 8ABPA 1QGUB 1KEEB 1Z83A 5H80A 2ZWAA 5BQ3A 4LUCA 5L6MB 1YBHA 5H0IA 1DE0A 4NCNA 2CNDA 3EEYA 4Q19A 4FLMA 2E89A 1QF7A 3I92A 3T9CA 5IASA 1VP9A 3OQOA 5JPDA 3ETGA 1V1MB 2QTBA 3PGVA 2ALJA 4LQ4A 1EFRD 4OH1A 3T9BA 3KUXA 4Q3AA 2WIDA 4E5VA 1E0KA 1WEKA 4ISBA 1XUOA 3WIDA 3LOPA 4QGHA 4W5QA 5HDBB 5I3ZA 1XNQB 1XHEA 4CMIA 3U0BA 2CLKB 4RVSA 3I1FA 5C8DA 3HZZA 1BXGB 1MOZA 4ZOEA 2HXYA 2L0XA 4UTZA 2DZDA 3TJMA 1L5SA 3EVDA 1XCMA 3T8YA 3HDTA 2QP9X 4AQDA 4EI7A 1PR1A 4Q7EA 4RHYA 4E2FA 2TMDA 5CYOA 4E1AA 3KCQA 4ENPA 1VCMA 1JHMA 1YDGA 2JIMA 2LP4Y 4JLUA 3C48A 4P4UA 1GV0A 1A7JA 2ATVA 2VUUA 6LDHA 2FEMA 3DB2A 3TEFA 1JKJB 4DFDA 4HX9A 2AEJA 2WOOA 2XUAA 3O7MA 5CX1A 1NXOA 1DKMA 4RACA 4G6ZA 4PYMA 3HWWA 4DQDA 1Y3FE 3IP3A 5HOQA 1V3UA 4AD8A 2DTDA 3H5TA 3WGVA 5J23A 1M2JA 2H85A 4PVDA 5CXQA 2EJCA 1N3LA 1U8CB 1ADBA 1DXYA 3C15C 4RVGA 3I28A 2VFAA 2PSDA 4XEHA 4AUKA 1VP3A 1Q3KA 1BS9A 1U3UA 3HR8A 4CKCA 4XZ3A 1G9TA 1LSOA 1VB3A 3KJEA 1JIVA 1XKXA 4US1R 3O2NA 1V41E 4ZCLA 3U39A 4ZZ1A 2GPWA 2V7TA 1J0EA 1Z73A 3VYWA 1ILEA 4BQSA 4GAEA 4LGYA 1X86B 4BFXA 3MBIA 1J9ZA 4GLBA 1LWNA 5G53C 2F62A 3AVOA 2X6TA 1QE0A 4TXNA 1KK2A 3O4RA 3ODPA 3OJEA 4AMYA 3BDAA 1Q21A 4JXKA 4Z2YA 4D74A 5KQGA 3X1JA 1HE2A 1RQ2A 4LTDA 5FHRA 2ZDGA 4B4VA 3K32A 4RKFA 1SQ6A 1MT3A 3S2EA 4EUSA 2AYXA 3Q7IA 2MR6A 4US0R 2A0FA 5BWLA 4PZLA 2ZT5A 4KYIB 2YC4C 3FWYA 4H7HA 3H9CA 5D1HA 3WBKA 4RF2A 3TBFA 4G0UA 1L7BA 5A2GA 1AO3A 3I0MA 3KLMX 3M1AA 4RKQA 1W4BA 1JG2A 5JARA 2IEDA 3I4LA 1B7GO 2FZ5A 3ICCA 2JATA 1L5MA 2O5VA 1KMQA 3IUQA 2AFHA 4JROA 2OSVA 4ZOAA 3O4IA 5TR9A 3A05A 5J4KA 2KPOA 2VDPB 1QUEA 1RHQA 3TQFA 1B2RA 1QAOA 1ULTA 2C7BA 2JGMA 3T1OA 3HM9A 3V4PB 2W4MA 3M1LA 2BDTA 2E4XA 2DSNA 1K88A 4TTSA 3M0EA 4XVHA 4PICA 1XN1A 2R48A 3ONVA 4V0QA 1DKLA 4H7DA 5DLYA 3KHSA 1IHDA 3REFA 2BBWA 2YMMA 2P7IA 4K6FA 1VE6A 5E1MA 5BQPA 3P97A 4YWHA 1K2WA 4ECEA 1DJPA 2XA9A 3E1GA 2VP0A 3CLSD 3QVUA 4IXDA 1N57A 1CP3A 1S3GA 3GK3A 3RYFA 1CQIB 4R1PA 4MUYA 1ZP6A 1CFZA 5FTWA 4YQEA 3M6LA 1S2IA 3P9PA 4QUJA 2GPNA 4Y2RA 4AY4A 4LXQA 4RTQA 2HK8A 2WYHA 4OL0A 3EEFA 1DHTA 1XQ1A 5ECGC 2VYND 1I3CA 3LIIA 4U7GA 1LNSA 3F9CA 5SYMA 2HLPA 2DQYA 3AJ9A 2NU9B 1JU9A 1X38A 4LV6A 3ZCRA 4ALMA 2V9ZA 3DPSA 5JHHB 5L4SA 4HV4A 1GG2A 5AVKA 3PQCA 4MKRA 3GLUA 4M9QA 2QX6A 3GG9A 2OWEA 3L8EA 1M2KA 3LFUA 1P7CA 2UVPB 1ANKA 1MCZA 2P3LA 1W4CA 4HDOB 3T61A 3UOWA 1Z22A 3A6LA 4OK3A 3A1TA 1S6YA 4CF5A 2DFKB 1PN3A 3KQNA 4GZMA 4DR7B 1IONA 4JLAA 5JZVA 1YS6A 5AI4A 2C1EA 1AS3A 2IOHA 2QMUA 4FHFA 3INRA 3URMA 1EVYA 2O3QA 1QX3A 1EKXA 2R60A 3AXTA 3DDOA 3QVGB 4E4RA 2HO5A 3TRJA 3ZE9A 2CNLA 2KX7A 3PTZA 3RC9A 3CF6R 2XMPA 1HDYA 4L7VA 2HIAA 4MZDA 1FDIA 1P45A 4FC6A 1UAYA 2C7PA 3RT7A 1W36C 1T2FA 1KP2A 2HMAA 3V00A 2ODPA 1QLJA 2OXCA 4LF6B 1YVPA 4LZZA 3EA0A 2XRZA 3VO2A 1NL3A 3VI4B 1J5XA 3QF4B 2F3PA 1PFUA 3WWPA 1XVUA 4L95C 2QJWA 3BWVA 1P7WA 3GBSA 1FL9A 5D5QA 1I0LA 1QH1A 4BX2A 4K6GA 1NPDA 4BP9A 3UPUA 1WBJB 3GRAA 4I50B 4MA5A 2A88A 2C2HA 1PJRA 3M4XA 3ZC3A 2YMLA 5KTKA 3HCBA 2A9RA 1E1YA 1EESA 1LZLA 3DWGA 4R2WA 4E70A 1LC3A 3QVLA 2UV8A 1R0BA 4FYKA 4HDKA 4U7FA 1IRIA 5K8IA 5JUWA 4C7XA 3L5KA 2Y1WA 3MTAA 4UC0A 4QO7A 2OLEA 3SNKA 4QE3A 3VH3A 5JV5A 2CXOA 3KETA 3VJRA 4BNZA 2H29A 1BYIA 1Z08A 3PHBE 1EP2B 3GGOA 1M2VB 4JLVA 3IJPA 3U7FB 1ZINA 2V03A 4I9GA 4BUJA 3K1AB 2XQKA 4OATA 1PIWA 4XA8A 3PX3A 4I3GA 1NXSA 3MS2A 2ZJ7A 4DCNA 2WAAA 4H15A 1G1MA 1YS4A 2WA1A 4TTIA 5BP7A 3UAWA 6REQA 5JJCA 2XBLA 1XYYA 4P82A 4G67A 4D3XA 3ZUGA 3R09A 4K26A 2B8NA 1II9A 4NCBA 3PZBA 1U65A 3UK6A 4HLNA 1RTKA 2CFCA 1CHDA 1QQAA 1NQUA 2PVSA 3RQSA 4YP9A 1DDGA 5HZGA 4HJXA 3HXOA 1IPHA 2VHJA 1EX6A 2Q2WA 4QXOA 3ZPXA 4LGMA 3J81k 2Q3MA 4D82A 1E6WA 3F1KA 3DG9A 4O0LA 1WDKA 3HWX1 4KBGA 3E05A 3AM4A 4EVQA 1VLJA 2WP8J 3UCXA 5TC4A 1M2WA 2ZR7A 5CA1F 5ADVA 4ILEA 2H7VA 3V8VA 3UWKA 3HTXA 4IKOA 4YRGA 1UL1X 2ZUFA 1X77A 4XDYA 4L8LA 3STTA 3HFRA 3LVQE 4YYZA 1FNSA 2VJKA 1Y4ZA 3CTPA 1SMKA 3I62A 2ZSKA 4U2KA 4KRYA 2XF2A 2Z09A 5IDXA 5TJ9A 4E08A 3VPAA 1EM8A 3E0QA 5G1OA 2P9JA 1GZVA 4JASB 2PV7A 5AW7A 4N12A 2ACEA 2HHHB 4OBEA 1MC1A 4B83A 2I1LA 4NBWA 4TT3D 1L9KA 1C14A 1CUXA 2BHTA 2XTAA 2ZR9A 2EV9A 3L6OO 2VYQA 3AWIA 2NMVA 3AUFA 4TXLA 1ZJ6A 5BMVB 3AUSA 1X7ZA 3AG5A 3ZY3A 3IEPA 1JJIA 2XHEA 4B6QA 4BFYA 4DDKA 2ILVA 2ZRPA 5I9LA 3OQ6A 1PVDA 5JQWA 5JSQA 2XT0A 3A4YA 5LQCA 2J4FA 3O93A 3PC3A 1GSOA 1K9SA 5CLHA 1U3CA 1CU1A 3FWZA 2DFVA 2V6FA 3GDHA 3RM3A 2WKSA 2JBAA 3A11A 2HBRA 1IZ8A 1TPYA 3G68A 4GPBA 4KN6A 4XVQA 5JCPA 3PHIA 3FDZB 1R18A 2QD4A 3QLJA 4DUPA 4Z4HA 1SXPA 3NYIA 1U1CA 3EWNA 3BB4A 1SOAA 1YZGA 1PK8A 4FB5A 1QDEA 1VE1A 5EA2A 1HG1A 1HSZA 2Y1CA 2PU5A 4KXXA 3H99A 4YJGB 1CY8A 3QBVA 4ZEMA 2P35A 1FC0A 3GPDG 1O3YA 2HSDA 1N2GA 4RE5A 1Z5UA 2PG3A 3BTOA 5E9QA 1L3CA 2QSJA 3IP6A 2P1DA 4OAPA 4G84A 2QTMA 2LIPA 4N47A 3VO9A 3ADBA 4CDRA 4BMSA 1UMCB 3SZOA 2PKQP 3QX7A 4GZ5A 1LEHA 2O0LA 1QQBA 1U7HA 3GLVA 3EEOA 3IR7A 1F1BA 2DE0X 5EWJB 4FGZA 2VT7A 3C24A 1Q6ZA 3O73A 5BW5A 1MJNA 1QE3A 2P6UA 2OQIA 1EX9A 3GQBA 4JSYA 3FN4A 1DWUA 3B7PA 3LC2O 4KAFA 1I2ZA 4LDQA 3DEKA 5JVDF 3AB7A 3RADC 2QUAA 5EUCA 1C4OA 5BN5A 1YGYA 2YDYA 3D43A 1TIBA 4GQBA 3AVUA 3D54D 3IAHA 3VDQA 3KNZA 4DTIA 3FWHA 4X20B 1Q92A 3OM1A 1PFYA 4JA2A 3ZIAD 3EN0A 5HF6A 5I9TA 4QXQA 1H6BA 5ALTA 5HEKA 2ZZKA 1E8MA 5KYUA 2BTOA 4ZIRB 3FMGA 1OLOA 4HB2A 1LLDA 3DHVA 2VP2A 3UKDA 1OKKD 1JSLA 2DU8A 3NXSA 5AW0A 3OMLA 3UW1A 2AXPA 3A3KA 3WL7A 1B74A 1H85A 2Z8XA 4C7OB 2YZKA 4LRXA 4NBKA 2QROA 4CUKA 1H1DA 2EYUA 3CPEA 1EFPA 5CXSA 1OXMA 1YS9A 3IULA 2CJFA 4RH3A 3L93A 1P2DA 5ESXA 1JDTA 1ZJ5A 2XVMA 1L1EA 4DLKA 4YMUA 1YDWA 1T26A 3LY5A 1EXMA 4E15A 3DBRA 3LQKA 4NTZA 4OMDA 3ZHYA 2N9UA 3TQCA 1BQEA 5F1YA 5JHGB 1PTJA 3RE1A 1CHNA 3TGPA 2BTEA 1GNRA 3BA1A 4EF5A 1S0UA 2UVDA 1G4HA 3JQ7B 2GKGA 4E14A 2NZJA 3GJ3A 4FE7A 1L5KA 4J43A 4QLOA 3HO6A 3L04A 4KXMA 3RHFA 3WLAA 3WYNA 3ONDA 2JFXA 4CIVA 5FDFA 5ICGA 5BR8B 1Z82A 3QE9Y 4D9IA 2AC7A 4IIUA 1OILA 1J20A 4CM3A 4QG3A 1N2ZA 1EPUA 3TOCA 1F48A 3KBOA 2XE8A 3PFWO 1YA4A 4ZVLA 3WLIA 5KYYB 3U09A 4PX3A 1WW8A 2J0EA 3OP1A 2ZIAA 4OPMA 1G0OA 2BFEA 2GETA 3REGA 4DCSA 3OPYA 4E07A 1QPGA 5KNBA 1OT5A 2GFQA 1ZMRA 1EE1A 3VKUA 4CF4A 3V2UA 3D0KA 2V3CC 3B70A 1D0IA 1GTVA 2BEUA 2GF0A 3CT6A 1JKMA 3O5AA 4Q9DA 1P0MA 3DLTA 2B36A 2W8ZA 2SHKA 4L50A 3KCNA 4TM8A 5J5CA 3PI7A 4WBSA 4B85A 4HUTA 1XGKA 3ECSA 1FTNA 2JCBA 4ACAA 5AKLA 4OGGA 4UEQA 4R2XA 3NHUA 4QPNA 3TKYA 1CZNA 1NBWB 4EGQA 3TTWA 2VUHB 2AN9A 4J16A 4EKEA 3T1TA 4RVOA 3N2NA 3BIXA 5EL0A 2PJUA 3EASA 4G0MA 3ZHRA 4N0DA 4N5DA 1OREA 4JHXA 2XNDA 3C4QA 5IT0A 1YUBA 1U6IA 1WDTA 1EK5A 2ZIVB 5ITZB 4PLYA 3NJRA 1WR8A 3NYQA 2B3DA 5FIUA 1JEDA 4U7WA 3TNYA 2PLAA 4EKNB 3I83A 2J6BA 3G02A 3RVMA 4LEIA 5C7YA 5HQTA 3I5UA 2AK2A 1NYTA 2FPKA 3A36A 4FZ3A 1D6MA 4MO2A 4NJEB 5LQDA 2XI4A 3MGBA 4FYWA 5BWNA 4PNEA 4CQMB 2GXSA 3RKSA 2JI6A 3WYGA 4MI6A 1FBTA 3DP7A 2MTBA 2YZGA 1KBZA 2I6XA 1JG4A 4OHCA 1VJ1A 3NMUF 2N3ZA 5CTAA 3MT8A 1H94A 2JIPA 2R8RA 4RHXA 3PQ2A 3VPXA 1UOQA 2CLHB 1GQRA 2BE9A 3CBGA 3PYMA 2ZG6A 4Q3OA 3ZIUA 4GPD1 1NASA 3D2LA 4GYJA 4BGVA 3B9PA 3CZRA 3E5NA 3I6IA 2ZOSA 3SM3A 2PGNA 3ENNA 4UCXA 5LDHA 4HB0A 1BZYA 1MRSA 3SHQA 4JBIA 4D9JA 5ED0A 3QXXA 3DBLB 4M7WA 4W6QA 4HQFA 3CW9A 2IEBA 4H1HA 2O7SA 1NA5A 2XB8A 3K94A 2FZWA 1NYLA 4ZHSA 1NMXA 3A31A 2X5KO 4R9SA 3AIMA 4ZOCA 2J5XA 3SLGA 5HIIA 1KZGB 3DVSX 2IXDA 3ISVA 1YJCA 3BT7A 2O59A 2C2OA 3CO0S 4Q7LA 3WKCA 2WVAA 2F59A 1KEPA 4JX9A 4J0GA 1T5LA 3PLAE 1SCUB 3ABRB 1TTPB 2WD9A 4HSEA 1ZA1A 4P80A 5JXHA 1GTRA 2VATA 4MQEB 1JI0A 2WPNA 3TOXA 1A9XB 3JQGA 4RK5A 1NVGA 2CSXA 3KSRA 2H18A 3P2JA 4MVJI 4TXHA 4UM8B 5JC8A 1ZHFA 3A6KA 4C06A 3FYUB 3HXTA 4PTYA 2PY6A 1U9IC 2VJMB 3A3OA 3COSA 3IAFA 2B83A 5FUMA 4JUBA 1MJFA 1EVEA 1NVDA 2A35A 3COZA 3LC0A 4G09A 4ZVKA 5IM4F 3KV3O 2JH8A 4BVBA 4ZT4A 4R84A 3EGCA 3TIXB 3CF2A 1ST2A 4NZ9A 1I0IA 1IIBA 2MR5A 4LWQA 4WCVA 1YB7A 2I65A 3H13A 1NXTA 4TLEA 3CLUD 1JTFA 3LT2A 4TL6A 3JAMA 4ALJA 1H2EA 4AJ9A 4M8NE 2F1HA 2FSFA 2WICA 3DZIA 4H6PA 4RWZA 4BKPA 5BNWA 5CFQA 3CJRA 2VXCA 3E5RA 1O08A 3LUPA 3LXXA 1SVWA 5ISMA 2FN8A 5DLQC 1GAWA 3QUAA 4B47A 3ESXA 5KSOA 1X7HA 3WB9A 1JE0A 3MHPA 1VMAA 4HB3A 3VR3D 3D6NB 4GRIA 4WLNA 4HYTA 4XD7A 2QQEA 3D3EA 3OJXA 1CERA 2Y0BA 3KHKA 3U3RA 1DWOA 2IW3A 3AM3A 3E35A 1UDBA 2CMDA 1YKGA 3L5OA 3VBCA 4EFKA 1JPVA 1XZMA 2I1QA 5CAEB 3IQIX 2GCNA 2R1UA 3RYTC 4L27A 1QIFA 1Z06A 3GT3A 4JODA 3R7AA 5GOTA 5JLJA 5JAUA 2NNWB 1B41A 2JGNA 2Q8PA 3GRCA 3HGTA 4YT8A 1KSHA 9ABPA 1OX6A 2ZJOA 2FR8C 5DTEA 1W96A 2B3TA 4NBTA 1VKNA 1SUIA 2YQ4A 4J76A 1M2NA 1GPLA 1MQAA 2O14A 2Q1YA 3Q7SA 3Q87B 5DX8A 1ECJA 4OD0A 1AKWA 1J06A 2UKDA 4YUAA 5BYKA 5D7BA 2BT4A 2VDVE 2FLKA 4HYYA 4KK3A 4MQBA 3TJZA 3ZDFA 1WW3A 4TMWA 1FTQA 1F9AA 1YQQA 1YR6A 2GBLC 3C6KA 3JYHA 3KTFA 1WPXA 4D43A 4URXR 3WZMA 1W94A 1HOTA 5LQMA 1QFJA 2ZI3A 2ZJ6A 5L6LB 1E99A 5ITSA 1NBAA 4RFVA 1Y7IA 2JJ1D 3P2IA 2IEIA 4GI2A 1I7DA 2FRDC 4OHMA 2FPUA 3CS3A 4ND2A 1C1YA 1LI7A 4D3ZA 5J63A 5KWVA 5FX2A 4K9MA 5JWHA 3RJTA 3OURA 1XT6A 1DAIA 3LZ6A 1IJEA 3ES9A 4L4YA 2C4WA 4JQSA 1C7RA 2H0QA 1VSUA 2VHVA 2HFKA 3HRHA 1AQ6A 3SX2A 4GLFA 1FP6A 2BGLA 1KQPA 3H9EO 1XEWY 3G13A 2PFGA 4JZYA 4X84A 1WIWA 3X43A 2NAPA 4RPLA 5BNIA 5JZ9A 1N75A 2GJ4A 1F8UA 1W85A 5H59A 1PZNA 4QGSA 1W87A 2P9FA 1UDXA 2WHYA 4LQLA 2OYCA 2COEA 1U0LA 1UPCA 2EFHB 3A9TA 1HORA 2OBBA 1JT2A 2FUG1 1R0XA 3JPWA 2I33A 1LKZA 3P9QA 2ZRMA 1YSCA 3O4FA 1LK7A 1J2JA 1TCCA 3KEGA 3RTAA 4BNDA 5BVGA 2I2WA 4KG7A 1Q1AA 3I23A 4EATA 4LXUA 4YJ3B 2AMJA 1V39A 4F4HA 3IXLA 5IFLA 3L4JA 1W4ZA 1YJQA 4AG3A 2PUGA 3UAYA 5C34B 3NVMB 1PFGA 1GR1A 5ELMA 4LJRA 4BNHA 5AW5A 1Q84A 3OFKA 4EYSA 4M4SA 4M7PA 3F5QA 1M7BA 1VHTA 1JR4A 2P2LA 1YE3A 1SCDA 1WW2A 1G6HA 1L6RA 2D54A 2AUNA 2IDMA 2I7XA 1JLRA 2OG2A 3BS4A 3KTAB 3MWLA 3O0TA 4MS3A 4ZK6A 2WYWA 4O29A 3I6YA 4P22A 4JXJA 1U9CA 3BXHA 1FLDA 1WF6A 2W6ZA 2YJ3A 1JIKA 5AW2A 2JIOA 5FQNA 1VPTA 3OUZA 2A5FA 3ME5A 3L46A 4JMPA 3OJOA 4X1IB 4A0FA 3ZTWA 4ZYTA 1N1MA 2C3PA 2IYNA 2ZVDA 5F3DA 4RLQA 1N92A 3ROTA 4KDFA 4MLDA 1JB1A 1UEXC 3IP1A 1C1HA 1DKOA 2WNIA 1FLNA 1FPQA 1P6UA 4AL4A 1ZBQA 1OASA 2PZMA 1CJSA 4PLZA 5C1IA 2JGRA 4DABA 3K8OE 3RSQA 2QQ0A 1YGPA 1ODSA 4QJBA 3SX0A 1J1IA 3UFBA 5FLYA 3IDSA 4EGSA 4U2GA 2CUKA 1TA4A 1ZD5A 4RJLA 5CDFA 3ZZTA 2ZBFA 1RPZA 4BE9A 4QBHA 3OKFA 3ST7A 5E2BA 3M83A 1O95D 3WJ2A 1GYQA 2PNJA 2A0WA 1J09A 3NHRA 1SKUA 4XIYA 2BTQA 2FMTA 1UBHS 2OUKA 3PRYA 4WXMA 4UBNA 3PKIA 5IKMA 4IDNA 3D3QA 3A28A 4CMAA 2VRCD 3IJEB 4MEBA 1IQRA 1W4RA 2ZPUA 1ZD3A 4BGDA 4BMCA 4AZSA 3M6VA 2FZCA 2C04A 1PVOA 1M1YB 4LHXA 3NCHA 2EKBA 4WZBE 4DDVA 1U0SY 1X1EA 5DP1A 3Q40A 3J7TA 2XIJA 1V8PA 1LI4A 1XZDA 5CLLA 2CNBA 1JFFB 1O5OA 3AT1A 3COWA 3DZKA 4WW0A 4YMSA 2VPXA 5B7QA 1ELOA 1VOTA 4WOPA 2AE1A 1N4AA 3CFYA 5AW9A 1E5VA 2IUUA 3HO8A 1DDIA 2G7ZA 2X6RA 1Z8HA 1N1EA 3EHDA 2HDWA 3D8RA 3QELA 4UUQA 2FMHA 2ZZMA 4M46A 2B1QA 5FBHA 4MUBA 1F5SA 3W8RA 1XN4A 2XXBA 2Y9PB 2NZ8A 1J5EB 4GKAA 2ZIXB 3H4MA 3PP8A 1AY0A 1GGVA 4O08A 3QQPA 5EAIA 1PT8A 3ZD8A 4JOQA 4Q4JB 4RD2A 4F6RB 5JR3A 5KZMB 2O8EB 4PONA 5JFGA 4H4EA 4OUKX 3I4FA 4WXRA 3NHZA 3W4IA 1NN5A 3HB5X 3LECA 4QOGA 3AETA 3UB3A 2GNAA 2H07A 2PFKA 3GAAA 4EDHA 2EP5A 4FWBA 3HDHA 2PRYA 2PVPA 3VNVA 3X1XA 1ZISA 2ZYRA 3TLGB 2H1CA 4NDNE 2LRHA 2H2IA 4RDIA 5JSZB 3SD7A 2VDWA 5A3SA 4J0CA 1WXDA 1ZMBA 2PGXA 2WW8A 3HUFA 4B3HA 1YMVA 2W6ID 4FINA 3PEUA 2IYTA 3TDNA 3IVCA 3TX2A 1PR3A 3B1ZA 3NWJA 2WHXA 1Z4IA 4ZJPA 1PNTA 2Q3FA 3TW8B 5HRCA 1S01A 1Z74A 3BXGA 2OHJA 2QRZA 3O84A 1WPGA 1KIMA 3UUEA 2XZLA 4CFSA 1ZM2A 2LR0A 4H3KB 4NU5A 4WZZA 5DEIA 3TSYA 1OBVA 2ZXUA 3TAXA 1PX2A 1WKBA 5IK2D 4CQMD 4KIFA 3UQYS 4V0LA 2ZRNA 4DJDC 1R6UA 2PD6A 3N8GA 4ML3A 2F6RA 2BGRA 4DIEA 1RXWA 3N0XA 3F8SA 5EPEA 5EJAA 3V1UA 1YB2A 5AXDA 1C30A 2D0PB 4A26A 4TYMA 4F56A 4HZIA 4Q1VA 4F2GA 1Q0SA 3ZHBA 3TVTA 1K66A 4BO0A 5C5CA 3ODGA 5A7GA 4PO8A 2QPOA 4E5SA 3EODA 3AONB 3CX4A 3G0IA 2SBTA 5B1IA 3ORFA 1JR3E 3IBSA 4H1WA 2H00A 4QPZA 2PA0A 4RH1A 4YJHA 1F0NA 4YBZA 1AK2A 3OQ1A 4LFCB 4UM9B 4PYRA 5B5SA 2VSXA 3H04A 1JUDA 4E4TA 1EB8A 4JLBA 1L8LA 3GPLA 2EKLA 3AHJA 4O2AF 3UYLA 1PKEA 4BWGA 5JC1A 3ORYA 2X0EA 3U7EB 4YIHA 4HG2A 1VXRA 1NVWQ 1T3SA 1WG8A 3G9XA 4IJWA 4XYMA 1TU0A 2W58A 2SCUA 5L53A 1OCEA 3SKYA 1A9RA 2E5WA 1V1JA 1T1JA 5KWEA 3P96A 2V4ZA 2Q6TA 5F52A 1QZ3A 1UR5A 2GR9A 2W83A 3C5VA 5F5NA 2JFPA 4LMPA 3WLHA 2QKYA 2WHPA 2AJ8A 4XGRA 2IDJA 1PJ8A 1M2EA 2FWPA 2GEUA 4X94A 3GZTB 3CLHA 1PQUA 2KSQA 4X65B 1Z5PA 1V3QE 3LWZA 5FCDA 3ITDA 1QP0A 3ESDA 5BV8A 1Z2EA 5D3MB 2O0MA 5CITA 1ZUNA 4UD2A 4O8ZA 1IHPA 1P61B 4Y2GA 2F1OA 2DM6A 3NUZA 1QGOA 3ZWCA 1JNXX 4LF9B 5KJ6A 1F2DA 3RYCA 3GUCA 3HKCB 1G2QA 1XTRA 1KPHA 1A5ZA 4H3HB 1P39A 5B55A 5IJ0A 3VAYA 2C2MA 3TLMA 3MTEA 2WZDA 2E4UA 4LV8B 1H66A 2CMGA 3B9RA 1C3LA 2XUQA 1EE2A 1YBFA 3L05A 3OLQA 2AQIA 2OGWA 4X7BA 2WJ6A 5DLEA 2C98A 4MV4A 1NP3A 1Z0UA 3UENA 3PD0A 3SKVA 4DCJA 1S1MA 1U2DA 4WLFA 4BE4A 4BRUA 2O8DA 1ORVA 1C8LA 1KYTA 2A3NA 3LXMA 4PRZA 5GJWC 3HO1A 1YDFA 1UXOA 4RU1A 1Z2DA 1HYEA 2AEMA 3ML1A 1NBIA 5ER6A 4MWEA 4GHWA 1T1RA 3EEBA 3S5JA 2OGUA 1WY5A 2C9CA 4KXFB 4DSTA 2I78A 3DE0X 2VKQA 4OI4A 1WBDA 1ZGJA 1Q1QA 3NFRA 1XEXB 2DMRA 3B6EA 2D5CA 3SF8A 4EBBA 4QREA 4JYMA 2H2WA 4HK4A 4NZOA 1P2SA 3CNLA 3DLIA 4FP9A 1ISJA 2UZ1B 5CPFA 4CR8A 3TB6A 3PLRA 1B43A 1JEOA 1UAGA 3OFNA 4HRVA 3THWB 2PXXA 2HWXA 2X2EA 1I3MA 4G24A 5B7GA 3H1BA 2PUTA 3KSZO 2GXAA 3WNQA 2CEAA 2QG4A 4KU4A 4NENB 2XEXA 3LYLA 4TS1A 3Q88A 4S1WA 3UHAA 5I6DA 4B32A 1DB3A 2HF2A 4RYLA 4TN1A 1RMTA 4XR9A 2Y6VA 4BCCA 2FX5A 2I3AA 3GFOA 4OLJA 3N7AA 4FE4A 2PWYA 1U7WA 4HX5A 3DKPA 3BJIC 3BMQA 2EFJA 3ZNPA 4Z9YA 5JWRA 3KVNA 3TMAA 1K7CA 2DHDA 4FDMA 4NWIA 4S2UA 3TE6A 2ZJ2A 1XVAA 1PSZA 2TMGA 3GJ7A 4MVWA 3N2GA 4HADA 4F84A 3ON5A 5CH8A 3VR2D 4F2PA 4QUBA 4HVCA 5L3SA 2JBHA 5M04A 121PA 2RHTA 5D84A 3I6QA 2C82A 7ABPA 1II0A 3DEZA 4BRSA 4EX6A 4PZ0A 1SBIA 1ZLYA 4HNSA 1A9QA 4WV3A 1OMOA 1YIAA 2QYTA 2VH5R 4F1JA 3CN9A 1F38A 2HQRA 5AVWA 3A9SA 4GX2A 3BWBA 5FUQA 4BFSA 1GTG1 4WI1A 3BBPA 4WADA 1RP7A 2BFFB 1IL0A 4RVCA 3W1VA 3HJUA 2O5EA 4LGVA 1HQDA 1C3JA 2HKIA 2C4KA 5B53A 2XGMA 1N32B 1VHQA 3HC7A 1VJGA 2RHLA 2YXBA 3NBKA 5ALUA 4FFPA 1H0RA 4G0XA 5E2IA 1B73A 3TUJC 2ZRAA 1TUIA 3WK5A 5K3SA 4CV2A 4OG2A 1I2AA 4QPDA 5KYKA 3DDZX 3ICVA 4MIOA 4RSGA 4QUAA 5CT8A 1F14A 3A4NA 2YXLA 2I87A 5KOHA 3O8CA 2C61A 2V3VA 1R9NA 2RGUA 4H4DA 4UZFA 4AO6A 3Q8KA 1EVLA 2IJGX 4ZCQA 3DBHB 4N0PA 1TYZA 1U7UA 3K09C 5E7QA 4GMGA 3HCRA 5C7LO 1APBA 1WQ4A 2IPMA 5HA5A 1Z88A 3BYZA 3O1IC 4AS1A 1DAFA 3I09A 4UAJA 5A5DA 5JJBA 3BKXA 3U3XA 3CZ9A 2VP5A 4U2CA 4EF4A 3COPA 1AO0A 3DDSA 4MP8A 1V4VA 1JQLB 2GQ0A 2AG1A 3CSDA 4L0QA 4WN9A 4EHDA 3AR2A 2BHRA 3N1UA 1XD8A 1ZNQO 4IKPA 1K6EA 5C7OO 1KOLA 2XYPA 4OHKA 4JUDX 2RGCA 2CJWA 5HNKA 1C4KA 1OF1A 1EP1B 4IJ5A 3KS9A 1E59A 3DOEA 5AXBA 2ISSD 4LRWA 3K20A 1HLDA 4OJTA 2O3SA 4QGGA 5EIAA 2Q7DA 4ESHA 1Q1EA 1TKCA 4HWTA 2W8BB 4IIJF 3QZUA 2ZXEA 3UMCA 4Z4FA 4YP7A 1XC7A 1I6KA 3C6MA 3NLLA 4NP6A 3I2HA 4KXNA 3WIBA 3G3EA 5JDIA 5THXA 1E3TA 3LD9A 5C8YB 1O54A 5ALRA 1QIKA 2EEZA 2GM4A 2PJRA 1EG2A 2IS6A 3ICPA 2PSSA 1E1RD 1SKQA 1SUEA 3FUCA 4PV7A 5KI6A 5JW6A 2W93A 1GGMA 3PNLA 3GDOA 3FBTA 4MV5A 5FAXA 3QTTA 1V1RB 3CKYA 1XAHA 1TZMA 3COYA 1XDGA 4NBSA 1SC3A 4G8DA 4TOIA 1J23A 1CJMA 2ERYA 2OHFA 2HXSA 2VEOA 1O0SA 1B93A 1P0PA 1YH3A 2XR1A 3EAFA 4LECA 3VX4A 3IEVA 1KRWA 2XE7A 4C22A 2NGRA 3OLYA 1SOMA 1A8SA 2JD1A 4G9EA 1YZYA 2XMRA 3I9FA 4MEJA 1IVYA 1RT9A 1I13A 1MXFA 1KO5A 4YS6A 4X95A 4BHTA 3QG1A 1JHYA 2O2ZA 2X8AA 4B71A 4S35A 2CFSA 4XRGA 1QP7A 4CKEA 4M1SA 5B4TA 2B7CA 2PQ0A 3BH6A 3TINA 3IE1A 3CHYA 3GD7A 4EG8A 1T2DA 3LHSA 1ZVJA 5ER9A 4UPDA 5KVAA 2CLDX 5EWMB 1TGVA 2JLWA 2A84A 3CVOA 4AKIA 4BZWA 3BGWA 2DULA 1QP8A 2WSLA 4MICA 3JWPA 3ROXA 2FFQA 2FPMA 1L7QA 4HH0A 2XXJA 1Z4KA 2W7TA 5CDTA 3D3WB 3AKZA 4HOYA 3RARA 4EABA 1PL0A 1HMPA 1Z12A 2CHGA 1KJJA 2GHRA 3IOBA 5AOCA 3SEFA 2A3RA 2WMYA 2L19A 3SHVA 3R6WA 3UGJA 3OTIA 3ROEA 4U6SA 5CA1B 3EXEB 4M21A 1CUVA 5DBIA 5IABA 1QU2A 3FNBA 1GAQA 3FVWA 1OI2A 2OCBA 2XDWA 3TSAA 1IWOA 5B4UA 2PS0A 4HI0E 3S8YA 3HA3A 1TJNA 2QSZA 1L9XA 3ZCPA 4AZ3B 4TUYB 3V48A 3ZR4B 4A03A 5GONA 4XVRA 2BJWA 2WJYA 3VMMA 2UXCB 2ZYVX 1EIWA 4F21A 1Q1BA 1PWYE 4IUBS 4F2HA 4FCCA 3I2JA 5LN1A 1J6UA 3ORSA 2VF7A 3UK2A 2GJSA 4ZOQI 1UBLS 1E9SA 1Q6YA 1LX7A 1E0DA 3KU4A 4LE0A 5BXYA 3P71T 5DFAA 1XTJA 4RQUA 1KYYA 4YRLA 3EE6A 4M0LA 4JYCA 3HKEB 4BS9A 2JAHA 1TT5A 4FKBA 3QIVA 4MAMA 3WSTA 3A2KA 3T7JA 2ZE6A 3O2QB 5DBGA 4YAGA 3DE2X