1YQQA

Escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
QFSHNPLFCIDIIKTYKPDFTPRVAFILGSGLGALADQIENAVAISYEKLPGFPVSTVHGHAGELVLGHLQGVPVVCMKGRGHFYEGRGMTIMTDAIRTFKLLGCELLFCTNAAGSLRPEVGAGSLVALKDHINTMPGTPMVGLNDDRFGERFFSLANAYDAEYRALLQKVAKEEGFPLTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCDLKVVAVSAITNMAEGLSDVKLSHAQTLAAAELSKQNFINLICGFLRKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthosine phosphorylase
publication title Escherichia coli Purine Nucleoside Phosphorylase II, the Product of the xapA Gene
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 81
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yqqA00
1LV8A 1VHWA 2HRDA 1JDSA 3PHBE 4L0MA 1T8SA 2QTTA 1Z5OA 3UT6A 4TTIA 1YQQA 1RXYA 3KVRA 4R2XA 2A0WA 4EARA 3K8OE 4WKCA 3E9RA 4IP0A 4X24A 1JP7A 4D8YA 5F77A 2PGAA 1Z38A 3LA8A 1PR6A 1A9SA 1PR0A 3OZBA 1T8WA 4TTJA 1T8RA 4D8XA 4DA6A 1RXCA 1A9PA 3PNSA 4MARA 4MCIA 3FOWA 1RR6A 4F2WA 1OTYA 5C80A 3LBAA 3GGSA 5B7NA 1Z34A 1C3XA 4QATA 1LVUA 3UAZA 1SD2A 4FFSA 4YNBA 4WKPA 4BMXA 3O4VA 1ULBA 5B7GA 3NM4A 1ULAA 4L5AA 4DAOA 1U1EA 3F8WA 3LGSA 4WKBA 1PR4A 1B8NA 3FWPA 4TXJA 3KHSA 1Y1SA 1V48A 4DA7A 1Y1TA 1V45E 4TXLA 3KVYA 3OZCA 3BSFA 1M73E 4WKNA 1ECPA 4TXHA 4OGKA 3UAXA 4YMLA 4DAEA 4DARA 4GLFA 2BSXA 4I2VA 3PHCA 1YQUA 1JYSA 4WKOA 1VFNA 4NY1A 1VHJA 4G41A 5F78A 1ODIA 1SD1A 4GLJA 4LDNA 3QPBA 1V4NA 4BMZA 1V2HE 3KVVA 5CXSA 3UAVA 1QE5A 1Z37A 5JPCA 3BL6A 4DA8A 1RFGE 1JDTA 5EFOA 4GMHA 4NSNA 1YBFA 3DF9A 1PR1A 1TCUA 4OF4A 1JE0A 3DDOA 5ETJA 4EB8A 4LKRA 1G2OA 3P0FA 2QSUA 5DK6A 4JP5A 5F7OA 5CCEA 4TS9A 1JPVA 1T0UA 3OZEA 2OC4A 2QPLA 1JE1A 1PF7E 2XRFA 1TGVA 5IU6A 1Z39A 3FAZA 3DPSA 4R2WA 1Z5PA 4OY3A 4QASA 4NS1A 3D1VA 3OOEA 4YO8A 3EUEA 4UC0A 5I3CA 1PBNA 5B7PA 1JDVA 4L5YA 1Y1QA 1A9RA 2B94A 4L5CA 5F76A 1K9SA 3E0QA 1A9OA 1V41E 1PK9A 3PNPA 4QARA 3KUKA 3EEIA 4RJ2A 2A8YA 4OGLA 1RXUA 2A0YA 3OCCA 2AI2A 4QFBA 3KU4A 1RSZA 2AI1A 4TTAA 2HSWA 4F2PA 4TS3A 2P4SA 1NW4A 3EMVA 1Q1GA 1CG6A 4PNPA 1NC1A 2A0XA 3OF3A 4QAQA 4P54A 4F3KA 4TYMA 4BN0A 5F7JA 3OPVA 1TD1A 2OC9A 1ODJA 4TXNA 4F3CA 1OV6A 4LNHA 1WTAA 4F1WA 3IOMA 1YRYE 1OVGA 4PR3A 3P0EA 1Z36A 1Y6RA 2Q7OE 4QEZA 5EUBA 4ECEA 1PR2A 5CXQA 4JOSA 1NC3A 1Z5NA 3FUCA 1K3FA 2OXFA 5CYFA 1ZL2A 3MB8A 4K6OA 3OZDA 4KN5A 4DANA 4GKAA 3BJEA 3NBQA 5CCDA 4D8VA 5KB3A 1OU4A 1Y6QA 1V3QE 5F7ZA 5F73A 1TCVA 1ODLA 3INYA 1JDUA 5F7XA 1PK7A 1A69A 1RXSA 5EPUA 4M7WA 3UAYA 3OOHA 1I80A 4DABA 2ON6A 5IFKA 5CYGA 4JWTA 3TL6A 4DA0A 5B7QA 2HWUA 1PR5A 3O6VA 1PW7A 2QDKA 1K27A 1ZOSA 4M1EA 1Y1RA 1U1GA 4LZWA 2IQ5A 1VMKA 4G8JA 3MMSA 3FNQA 1LX7A 1FXUA 4M3NA 1YR3A 3E9ZA 1N3IA 3GB9A 2ISCA 1PKEA 3ODGA 2HN9A 3K8QA 4H1TA 3ONVA 1A9TA 4G89A 5FAKA 4YJKA 1XE3A 1SQ6A 3IEXA 1RCTE 1Z33A 2OECA 1RT9A 4R31A 4E1VA 1T8YA 3UAWA 4TXMA 2I4TA 1SJ9A 2GUWA 3ENZA 1B8OA 3DP9A 3U40A 2AI3A 1Z35A 3SCZA 1TGYA 2H8GA 1CB0A 1PWYE 1U1CA 2RJ3A 1U1DA 3T94A 2QTGA 4BMYA 4D9HA 3C74A 4OEHA 1ODKA 2I8AA 4LNAA 1OTXA 4L6IA 1U1FA 3FB1A 3EUFA 3NM5A 1JDZA 3DJFA 4D98A 2AC7A 1OUMA 1A9QA 3BGSA 4MCHA 1RYZA 3NM6B 4OJTA 4U2KA 5K1ZA
chains in the Genus database with same CATH superfamily
2EERA 4X1OA 3WKCA 4DHEA 5LYYA 1T6YA 3KETA 3FPCA 3H2KA 1H6DA 4F85A 5CA1A 2CXPA 1KK3A 3V1NA 3T38A 2JH9A 2IUEA 2R97A 3I32A 2ILVA 5CJPA 1VL0A 3PHJA 2QRGA 4Q9LA 1RCFA 1PGNA 2Z1NA 4ZHQB 4JLBA 4K88A 2WWGA 3G2JA 1ZH6A 4PHTA 5MHTA 2OV2A 2AH5A 2CFTA 1AKYA 1YQQA 1SEPA 2MSWA 1RBQA 4CLHA 2HSGA 2FMHA 4R2XA 9LDTA 4PLGA 2GGSA 1BOOA 5DPMA 2FW1A 1N6IA 3NVMB 4II7A 2H1OA 621PA 3QHPA 4Q18A 1QO0A 3H0KA 4D6PA 2PIAA 4OAQA 2IBTA 2CB0A 3E9RA 5A0TA 4Z0HO 1K4MA 3RYCA 4MR7A 1JH9A 2CW5A 3JSXA 5C1BA 2GBLA 4MPRA 2AF3C 2ZCUA 3Q9SA 1M8KA 4K6FA 2OV3A 4E3WA 2JC3A 3O1JC 1Y7LA 2R5WA 4H7DA 1E2FA 4F21A 1BDHA 4S1VA 1VB5A 4MR8B 3O8CA 1JFRA 1YA6A 3N2KB 1RIIA 1BWRA 1VL1A 2P0EA 1XJ5A 1PR0A 1RWBA 3R8XA 1LEHA 1TT5A 2C7VA 3UFXB 2VAPA 3JYOA 2XF8A 5LFAA 3VYSB 4DA6A 3B60A 3IALA 3SE0A 1J0CA 5GVRA 5CT9A 3DE1X 1DDGA 1WDKA 4BE9A 2UYOA 1YKSA 2NVOA 3WGUA 1SPBS 1V5WA 1DCFA 2CMKA 4DDHA 2ZI3A 1HOXA 3R9XA 4HH1A 4XYEA 2HSEA 2CNWD 5A5DA 3D8HA 3CX4A 3P9PA 3OOWA 3S2SA 1T9BA 2P6UA 3SHFA 3EIWA 2J0VA 3TBKA 3L18A 1KRHA 2X9LA 2BGGA 1RU3A 2SCUA 4L16A 2FZ4A 4DQ0A 1FFAA 2BM8A 5DLYA 3MNFA 4RMJA 3MBIA 4UTXA 3L07A 5DASA 4QL3A 5LZ5A 1L0BA 4QUEA 3S6JA 4DXHA 5LZ9A 5HRAA 1NWHA 3GDWA 3L2OB 3NCHA 4IS3A 2Q7DA 1AE1A 1QFYA 3HUUA 4D4JA 4LS3A 4KQHA 5ALYA 4BMXA 4P84A 1WAMA 3NHKA 1OX4B 1JTVA 2NIPA 4JB8A 4KKXB 5JS6A 1Q0PA 2Y76A 2UU9B 2ZWPA 3QW4B 3WIEA 4L2IA 4ZGBA 1WUKS 4HB0A 4ERXA 3VJRA 2O05A 1G3MA 3B78A 3FETA 3WKAA 4X1YB 1E9CA 2FQWA 2ZSEA 3U7HB 2G9VA 4H7IA 3WVNA 1U1EA 1N9GB 5IJ9B 5GJWC 4C0KA 1IWOA 1BAPA 2C97A 4A27A 1UFQA 3DOCA 4RCZA 3B5IA 3VZDA 1VFPA 5EMLA 5J43A 2FG5A 1NLMA 1JG7A 4U39A 1JEYA 4QUAA 5CLJA 1G8FA 2XUHA 1YE8A 4MPDA 1WZUA 3KXKA 4PSAA 1TFRA 2PT5A 1M8GA 5IPFA 1XMPA 2BEKA 2W6ZA 3S27A 2QBYA 2FZLA 3F3YA 5LMZA 2PU5A 3DO8A 3EDQA 4OUDA 4ZYUA 1V8BA 1PGOA 1U2RA 3GLHE 1N0IA 3TF5A 2W4IA 3STYA 4CQMB 3FPJA 3GLGB 2VH2A 4Q3DA 3KJQA 5DTEA 3I1YA 3TDKA 2AOWA 4UEQA 3ZDEA 1O0SA 4U63A 3K5IA 1K5GA 1RADA 1T4MA 2G72A 2IHVA 5KINB 3BH6A 2QN3A 3Q6MA 3QF4A 1XHLA 3JARA 1EE1A 1N2CB 3WWCA 1HE8B 5IN4A 1TM5E 1XCLA 2PYDA 4ZU6X 3HXTA 3JATB 3Q15C 1D9XA 5HZGA 1PVOA 1ZHOA 5GGYA 2CLHB 3UK2A 1T0IA 2M6RA 1QCZA 6LDHA 5KJ6A 2QUBA 4P2BA 3QXCA 4NNJA 4PYIA 1W9HA 4HRAA 3DP7A 5EG5A 2QLTA 2R9VA 2ZJ4A 1NM5C 2GESA 2H5JA 2I76A 4CBVA 2UZ4A 4CDMA 4WBNB 3G9UA 4XGNA 3DT6A 5K0ZA 2CUNA 2SNIE 1KOJA 2VHXA 1DKQA 3EDCA 4TV9F 4BL5A 2W8BB 3K53A 2QD4A 5LCXA 3ZWXA 4IZIA 4JELA 2FRDC 4JKIA 1T9GS 1CUCA 1I1HA 3PEUA 4J94A 3ANLA 1TZ2A 2RK3A 3IO5A 3KLNA 4RZHA 4HSGA 5AO9A 1AKWA 1IC6A 1BJRE 1M3SA 1N5JA 4L4SA 4P80A 1PDOA 2XIJA 1HDRA 1WCYA 3FVRA 1GLGA 2OL4A 3ZHCA 1U7TA 2GXQA 1BW9B 5MFZA 1BEZA 4IZOA 4NBNA 2J67A 3I5UA 1I94B 5D7BA 4I1YA 3AI3A 4E12A 4YP9A 4LF8B 2GCIA 4NNPA 3ZE9A 2P0YA 1KYQA 4Q4AB 4KR6A 3GFTA 1DBIA 1SUSA 1XQWA 2INGX 2JGLA 1NMYA 3E9DA 1OH5A 4EGCB 1TPYA 2YASA 1GO2A 1V35A 2ZVQX 1PRYA 2VJMB 3TUJC 3NBMA 4MA0A 5EGNA 3UUFA 3EWAA 4TS4A 4CDNA 1BXRB 4CHTA 1P4RA 2PRYA 4DRZA 3HP1A 5AI4A 5IH7A 2EKBA 4UTPA 1OD6A 1KORA 4Q34A 2XITA 3IQHX 4MB0A 5A6SB 2FCRA 3EBLA 2PPVA 4IKOA 1VE9A 4FM9A 1MPTA 4GKBA 2QQGA 1IXZA 2LDXA 3NANA 1ORRA 2GT1A 2Y99A 1AO3A 5T4HA 4LQ4A 3UAOA 1XA4A 4QOEA 1FX0B 3KJZA 5ICGA 2WJIA 1SN7A 4UFPA 3NXKA 1QV9A 2WIBA 4P35A 5IAJA 2OFFA 3FZYA 3UTDA 1FTWA 1QIMA 2HCFA 3ORYA 4QOIA 4AZ3B 3RREA 1C9NA 1Z5PA 3MCZA 1E2HA 2HMYB 1MQ8B 2OEPA 1JLHA 1C3LA 2W71A 2XLCA 3EIHA 4IIEA 3VSEA 4Q9JA 3TNFA 2MSKA 4EUSA 3OQJA 3HFSA 4MJ3A 5CUQA 4B3IA 4F1JA 1LNQA 2ZRMA 4BEJA 1NI3A 4Q1DA 3SYMA 3AG6A 1KP3A 2ADFA 3NWEA 3R5FA 2COEA 2IXGA 4AG5A 5BY2A 1J39A 2TMKA 4W1SA 1WSWA 4JI7B 2ZB4A 5B3AA 1XMVA 2QRVA 1KYTA 2EGHA 4MI9A 2L69A 2XDYA 5LC1A 4QM7A 4BO2A 1LJ8A 1GZ7A 1W4CA 4QBFA 3ZY5A 3KFXA 1RKBA 1FS4A 2VK2A 5JAMA 5AVVA 1IPHA 3E0QA 2FW9A 4Z3DA 5F2NA 3WNCA 1OAOC 1FMLA 2FCAA 3FNEA 1RKXA 1PK9A 2HD4A 1T1IA 4GVXA 4U0JA 2WWVD 4ZODA 4O2BF 4RD6A 3GA7A 3ZYZA 4L07A 2TECE 3OFSA 1H6BA 1LBSA 4AQDA 1EFLA 1XZNA 2IWHA 4E5VA 4L6AA 4Q37A 5C8DA 2XXBA 1QG4A 1GDTA 4V0LA 4WOBA 3W1WA 3W77A 1EI9A 1VIVA 4P4LA 4F2PA 2Q3CA 3P97A 4M7PA 4QUHA 4A8JC 1TM4E 2RHGB 3UMMA 5MFPA 3QEAZ 3EMVA 1GU1A 3EB9A 2QG6A 5EZ5A 3N0VA 1P1RA 2IKSA 2PWAA 2BGIA 3LF1A 2ZJ6A 3SSMA 4RVSA 3THYB 5HG0A 4ITUA 5C8VA 2H92A 4M83A 4NCJA 2Z5VA 4TYMA 3IBTA 3WGLA 2XXAB 4BDSA 3R0ZA 1EWTA 3FROA 1ZR4A 3RFCA 3HVRA 1N6NA 4HR7A 1CUVA 4XPIB 1SMKA 3T52A 3AR3A 1IY2A 3Q7TA 4LJLA 3TVTA 3CO5A 3TE7A 4OSEA 3N0RA 4LDPA 3QU5A 3GCDA 3WSWA 3TM4A 1E2KA 1O96B 3MQFA 5INTA 1PNVA 1GGVA 2WYUA 3GUVA 4P38A 1PSWA 1ZK0A 3H1TA 3QXSA 2QSYA 4MCJA 2J3IA 2X7JA 3H97A 4O2AA 1XAIA 1TU3A 3GUUA 2NZ8A 4K6MA 3FD8A 3FYHA 4AF7A 1F0KA 1F0NA 5DYTA 2VJYA 2VKTA 3CNNA 5EWJA 1LI7A 1WVGA 3BE5A 3IVCA 3LNCA 4ND5A 5F5LA 1HNWB 1PEYA 1YDHA 5A05A 4EG3A 3QEJA 4U2BA 4OFZA 3KL4A 3SN6A 4Z3KA 4TUYF 5TS2A 4ZYZA 1DEOA 4OSPA 4AXBA 4LSGA 2HBRA 3IULA 3S5JA 4KPYA 2NU6A 1EFVA 3HUEA 2LW7A 4IHQA 4Q01A 5C1PA 3WFJA 1EVJA 1FNCA 2I66A 2P91A 2O3RA 2C4NA 4IYJA 4UUPA 4JUFA 1UBRS 1M76A 3EQ9A 1G5HA 3AI1A 1L3IA 3K6RA 5MGNA 2DHCA 1PJRA 4TM7A 1F8FA 2Z6AA 1UKVY 2PXXA 1QSGA 1Q7CA 4JHXA 3OO1A 4JEHA 4OKNA 5DLQC 3BWBA 4AN1A 4DANA 4BQEA 4EGAA 1OBVA 4WCFB 2BH2A 2Z43A 2WWHA 2R8YA 1CUZA 3FCSB 3C8DA 5DSTA 1GZSA 1UZAA 4N3BA 1CC1S 3P9NA 4Q48A 4WFQA 1Y6JA 2DAPA 4NHOA 5CVVA 5KB3A 5I9TA 3ROKA 4M1TA 4YA6A 3AQIA 4JJZA 4L72A 5BYKA 5JR3A 1XRNA 5EJFA 3MRTA 3SZLA 3SFZA 3BXOA 1TCVA 1XR3A 4JLJA 4MW9A 2WYHA 1BDBA 1U3CA 1T24A 3FW1A 1IEWA 1E3SA 4M99A 2P4QA 1PQPA 1J70A 1JF8A 1PJLA 3CZMA 2IZZA 5HCIA 3B48A 5HF6A 3M3DA 3FMFA 3N1UA 4TM8A 1HG1A 1QHFA 2CBXA 4INJA 4NOMA 1Q1ZA 1T2AA 3SQXA 1AKUA 1SRQA 5IFKA 3L8FA 1IQ0A 5LUAA 1R6TA 1UODA 3O4FA 1SA0B 1Y7HA 4LZPA 3GHHA 5B6JA 2FQQA 5A4JA 3PSHA 3SR0A 7REQB 4CTMA 3ABZA 1D5WA 4YMWA 1JTFA 1ZGJA 3AVTA 1L8LA 1T2EA 1YZYA 4QTTB 4PICA 1WA5A 3PP8A 2FHSA 4ZVKA 1PZFA 3AU8A 4WV3A 1X7WB 2GJAA 2OKGA 4BLUA 4F6CA 3H83A 3OFND 5LDDC 3J7AC 3AF0A 4MEBA 5TDHA 3ND5A 3DL2A 1MCZA 2VT7A 1NG1A 5CA0B 2XMSA 1KAHA 1K4KA 1ZHFA 2I6SA 2X2FA 3C1UA 3IE0A 4LDRA 4XOUA 1LKZA 2M1ZA 3FNHA 5J9FA 1OA1A 3H5LA 3X1KA 4EAAA 2FOXA 3ADKA 4FTWA 3OTGA 4TZKA 1UBFA 4Q9NA 4L95C 4RIEA 3MGAA 1YBMA 1U3TA 3GEDA 3EA4A 1IVNA 2VBCA 4MQUA 4WDRA 2WQ7A 4Z7JA 2I29A 1L5QA 5A02A 1T2UA 4G1MB 2Z9BA 5F9HA 3JQ9C 3IX7A 4MYTA 3UYLA 3REQB 4JT8A 2ETVA 4HLDA 4NMLA 3PX3A 2F1KA 2GN6A 1K98A 2QGFA 3L4BA 4IWNA 4J16A 3GJRA 1RTKA 3ZI4A 2ODQA 5IUNC 5DWQA 4BV2A 4Z4EA 3BGOS 1FJHA 3JWJA 5ADWA 4KQMA 5I9MA 3WV5A 2AJDA 3OOYA 2JD1A 3HVJA 1EA5A 1R74A 2JJ8A 4LHXA 1XK6A 4ZQBA 2GSWA 4MA4A 2O8NA 1NY5A 1PFVA 1JPUA 2X1VA 1A9YA 3EZ9A 3SZOA 2PZBA 5HQ3B 1ZSNA 2WDZA 3O3NB 2RI6A 1X15A 4HADA 4ZQCB 5LOVF 1MB0A 2W2TA 1P81A 4UXIA 3VGJA 1IHYA 2IUYA 2X5NA 3THWA 2IYXA 1B1AA 5A0FA 1UBKS 4HGNA 1QX3A 1LI5A 4NBUA 1PFYA 3MYRA 1Z9BA 2A5YB 4O6VA 3ZWWA 2VC2B 3AHIA 4ENPA 2IYAA 3WIOA 3GLSA 1QORA 4Z53A 4H9GA 1AMNA 3TBFA 2PMFA 3OQMA 1ZN7A 4QE3A 3F97A 1S4MA 4CZ2A 1ECFA 1JHQA 3SKVA 4NWIA 5DM2A 3M6WA 2C7BA 2B69A 1L2TA 1B74A 2VDWA 3R5XA 2W2PA 3CJTA 5LOVA 2N46A 3MJRA 4FEEA 3VR3D 1LDEA 3M4JA 3RADC 1FYVA 2YYSA 3QVWA 4HGPA 2Q9CA 4XX1A 2Z3WA 3V2HA 1XBTA 4DC0A 5AM2A 1ZUNA 4HNAA 1X2BA 3ILXA 1YE3A 1T15A 3L6CA 4Q03A 5BV1A 2YJTD 3LLVA 4LWZA 4D5GA 4DV3B 5EZ6B 3B6JA 1IJKA 5J1TB 1Z88A 1NN0A 4QVKA 3CKMA 4NE7A 4KO8A 3DJFA 5ER6A 3BREA 3NHPA 2WAMA 1FEZA 1X3SA 3ANSA 5CR9A 3OFKA 4GQIA 3IQFA 3KYCB 2Q3MA 2BI4A 4RVNA 1TT7A 5EMNA 3RODA 3VU9A 2H1CA 4F6RA 4CIWA 2GF0A 4CV3A 3GVPA 4MYRA 1DTWA 2VNJA 2XDAA 3GJXC 2NSHA 4DJDC 2O5VA 3NHWA 2QTRA 3N0XA 1R4NA 4AWXA 2ZJZA 3LBHA 4FS8A 1KJZA 4KX5A 1N2GA 5IUKC 5M04A 4CEIA 5AKXA 1OJ7A 2NVUB 4HQKA 2ATVA 3DE5X 3JALA 2BFDB 4M8IA 3DXFA 2H4JA 4W82A 5LP6B 5E6UA 1GVNB 2X8WA 3W2TA 2D7JA 2RD2A 1KJQA 3NTLA 4PWZA 4BB6A 2ZJYA 4ZOEA 2VYFA 3CNEA 3MGKA 3OZ7A 3N8NA 4XLZA 4MMZB 5L4LA 4NJMB 1XC7A 3K96A 1XQXA 2C4UA 2EP8A 4FZJA 4BVGA 1HDCA 4Y6GB 4J03A 3PTAA 4KREA 2DC1A 3EG9A 2QLJA 1XZEA 2VYND 3TG8A 1QOPB 5JCXA 4D8TA 2A9JA 5E7JA 4G81A 3X2SA 3AF4A 5NLLA 3QH4A 4PPNA 5KTPA 1NQOA 2GYYA 3BVPA 3UXEA 4F71A 2BKLA 2OD9A 3OQIA 4C4YA 3RFUA 5BSTA 2QX9A 1RI3A 2DLNA 2CEKA 1I1NA 4HQLA 3GLHA 2G0AA 1TB4A 1RHRA 2JIPA 4R1QA 5CFNA 4YHHB 4LJ9A 1OWPA 3Q7PA 1O6FA 1R16A 4LOAA 4IP0A 4YQEA 1L7OA 5EJ2A 4BJHB 5CB8A 5DNDA 1GNSA 2P0AA 1F6DA 1X9IA 5F77A 3CF2A 4JI2B 1DRVA 3CJRA 1PLLA 2GZ3A 3D3KA 1RXVA 2O20A 4HWGA 2JJ1D 4EBBA 3GJ4A 5F1OA 3K5PA 3TBHA 3Q3GE 3EC7A 1MXFA 5BSWA 1A9SA 1NP6A 2DQKA 4OOFA 3DBLB 4Q9KA 1SBNE 3TPFA 4BBJA 1HDEA 1RABA 2G71A 1CDEA 1D7AA 1ABBA 1B2RA 5I8WA 4MUAA 4BEVA 5ULLA 1Y9AA 2IYPA 4XASA 4ZVRA 2CNDA 4NPCA 4YJFA 4C88A 3DE2X 1FY2A 4HDSA 1WBBA 2FAXA 3ZDXB 2KW5A 2IV2X 2D4HA 2REQA 1R4MB 2VHVA 4Q9HA 2J32A 5FTNA 2EBUA 4B7ZA 2K2QB 1WVMA 4F9TA 1N7GA 4AD8A 2QLFA 1JQEA 4OXXA 1NFRA 2BUBA 4EW3A 1TM3E 3ZV3A 2C1XA 2YZ2A 4MJXA 1HE5A 2MSDB 2WJJA 3OQHA 3LL7A 3Q10A 4IBOA 5SYMA 4GPTA 3RUCA 3VKWA 1ND6A 3S81A 3A7EA 3AUUA 4GP9A 3LK7A 1EDDA 1H2RS 1I5RA 4L5JA 4RK1A 4XTRA 3U9LA 1HT0A 1Z6QA 5ESXA 3BC1A 4JVSB 5H7XA 2OHJA 3JVIA 4IH4A 4EL5A 1UBOS 3A3KA 1H3FA 5E2IA 1X7YB 5FV7A 3A4YA 5GONB 3IUNA 3R20A 2C7QA 2YN2A 1RQNA 1HPLA 1P2BA 1SD2A 2QXTA 1NVEA 3ENVA 1CQXA 3PXDA 5TPWB 2OQ2A 2R8EA 3DLCA 3K92A 4JUIA 3AMVA 1T4CA 3KYBA 4D26A 2PR7A 1Y7TA 3JQRA 1HA3A 5C18A 4CFYA 2A35A 4U7WA 1YQ9A 3QVKA 3U3RA 5A9RA 1ULAA 2FPOA 1ZXLA 1A98A 2VF4X 3DM5A 3GDGA 3K31A 5CIWA 1MFZA 2V4UA 3AZOA 4EPRA 3RJMA 3FHTA 1Y3BE 5EFZA 3QX9A 5EIWA 3OESA 5IVDA 3UMVA 3ZI0A 1ZK3A 1HFKA 3KQPA 1RQ2A 1N7HA 1XVIA 2Y1XA 2ZT8A 4LV5B 1KFCB 3ISTA 4GPAA 4CU5A 1CW2B 2EG5A 1ZNQO 3EF1A 3E9MA 1V5FA 1TTQB 1U0LA 3H2ZA 1H9CA 2A4KA 2FZWA 3TSZA 4JASB 3ZWOA 1C9DB 1W4LA 2VSOA 4NULA 2X14A 1TAHA 5CHYA 3TJZA 5BUCA 4IQGA 3E2MA 3L0OA 5JMOA 3IMGA 1HT2E 2FFRA 1HE2A 5B30A 5FBQB 3D2BA 5FWYB 3AKEA 5HKOA 1NQWA 5LMUB 3EEOA 4UW9A 1GZ5A 3BSFA 3JQGB 3AJ9A 4RUKA 1O8CA 3RM3A 2JAWA 3K1AA 4IG9A 4OA8A 2HIAA 3S4YA 4BKUA 3K70B 4P33A 3NXSA 1I8TA 1QB8A 2GS9A 1V9CA 2AUMA 4PW0A 4B6OA 4B0PA 1MW9X 4DFDA 4DMRA 1OXBB 4ZYWA 1QTNA 5U4XA 1N5DA 2I3BA 2F48A 2GPYA 2BMAA 2GLTA 2NUAA 3M34A 4ZAGA 1TKRA 1E18A 1TMYA 4CUKA 3I6IA 3IQDB 1QHXA 4ZI2A 2QJOA 2ZI7A 3C6KA 3FAKA 4NLLA 3JQAB 4WIAA 3F49S 1KOLA 3RGWS 5HK9A 1N33B 4HV4A 5I6DA 5CJJA 4HYYA 3CFYA 5KC9A 1ZMRA 1KI3A 1VPEA 5EP1A 2R1VB 3JSAA 4BX2A 1B26A 5GM2A 5EKDA 3TG2A 3BPSA 3W4KA 2P40A 4JBLA 5ARBA 5BRJA 3DV0A 2JIBA 3HLYA 1EXMA 3NHJA 3L8EA 2FWPA 1LVGA 2H4HA 2OCXA 4UMEA 1XTZA 1DVRA 1MNQA 1U7XA 3LJKA 4LVUA 3KBBA 4BVBA 5IX8A 2QL5A 5LQNA 4ZDJA 3U61B 5FP0A 1EDBA 1OVMA 3ZZNA 4MQ6A 2FZGA 4GLJA 3GFSA 4ZYLA 2VN8A 5K0CA 2Z3ZA 4LDNA 4KOEC 1Y6FA 2XYGA 3R7SA 4ZDWA 3OSUA 4WKGA 2FFQA 1HXHA 3W5HA 2LIVA 1UWCA 1OFIA 5CW2A 2AW3A 5YASA 3OLXA 4YDHB 5CXSA 3B5JA 2J3QA 1ZK2A 2P7HA 4TSRA 2FUG6 2PT9A 1S2GA 3UG7A 4JA2A 3TB6A 3CN7A 2D8MA 4H77A 4GMHA 4OBEA 4UHKA 2OBNA 4EJFA 2R11A 1EGMB 2GK4A 2Q2OA 2YOHA 3DF9A 3VDQA 2OT3B 1QV6A 3RC8A 1PR1A 1ZKDA 4KH0A 4DUZB 3WKBA 2PGXA 1C0LA 2WVHA 5CT6A 4C7JA 1B73A 2EATA 1SIUA 3DDOA 5DYWA 1NPDA 3CUYA 3I8OA 4EX7A 5JANA 4WNCA 2MYPA 1G2OA 1QIIA 3R6DA 1Z6ZA 2F4NA 1UPBA 1ZMBA 3IV7A 2QSUA 3I39X 3C7DB 5AI0A 5HGJA 1L5GB 3VI3B 1ADCA 3P9ZA 1R37A 1AKRA 1DHRA 1DOZA 2I03A 2YRXA 3H8VA 2D1QA 3GNLA 3QA3E 3SICE 4RF4A 5DCLA 2R751 3T3DA 3OZEA 3BK7A 3GXBA 2VCHA 4IIXA 4BLTA 1MO2A 4UAGA 3RTBA 1FFSA 1IHOA 3VYWA 3O8OA 1FU4A 1SKUA 4Z9XA 4ZJPA 3FH0A 4IJQA 3M6MD 4DR6B 2CHVA 3EA0A 1KI6B 4Y9RA 3W5SA 2C4HA 2JLVA 2GA9A 3UY4A 2MINA 4I14A 1TJ3A 2OBLA 4B5KA 1GJRA 3V1LA 1ISPA 1PT5A 2G1KA 5GV7A 4G9BA 3MHTA 3RYTC 1F7VA 1Z08A 4PC7A 2NAFA 3ICPA 1OXKB 1CV2A 3TEJA 1S3GA 3NNNA 4CKBB 4X8OA 1NXSA 1P17A 1UZUA 2VJAA 3DZCA 4ZAZA 3NIBA 3OMWA 4D56A 2ZZNA 2B94A 4ZDIA 5LXTB 4YXWA 5T5QA 4MUJA 3EC2A 3JTMA 4MWOA 3WL8A 3CUVA 1AXEA 1YHYA 1DAOA 1CE8A 2XXJA 2YV5A 5DDIP 3PI7A 4ENUA 5LN1A 1KEEB 1F9EA 5JG7A 1EHCA 3Q3CA 5B6IA 1OY1A 3VR1A 1RYYA 4ETMA 2AL7A 1ORHA 2BDEA 4JBGA 2B6NA 3D9QX 4IDAA 3UK6A 4O4JF 4DNFA 3WO1A 4I1VA 1ZIDA 1YQTA 4JCCA 4JS0A 4R1MA 5EHXA 4QFBA 3KU4A 3TZKA 2XUDA 4X65B 3S2ZA 1RW4A 2KYRA 5JAZA 2Z8ZA 3TZCA 3QU7A 5L3SA 2CBZA 1YCFA 2L42A 1ESMA 2IYZA 1U9IA 2VWPA 3N07A 4LYAA 4PGMA 3MINA 3P71T 3LT2A 3PL1A 4KRFA 5D3KA 1JLLB 3JQ6A 4P34A 3H18A 3Q4GA 1ETHA 4L74A 3NTQA 4NBSA 1RZRD 1EB8A 1DEHA 1PJ3A 1PZEA 2GZ1A 3IERA 2FMIA 1XDSA 4JWKA 4QRDA 3RVNA 2P27A 5I51A 4JODA 3TE6A 3NUZA 1PNTA 2I4NA 2NTEA 3WGNA 2R8RA 4I1IA 4OB8A 4M9RA 4YRFA 1FTQA 4V0KA 5BWOA 5SZJA 2ZGVA 1GQOA 4LXQA 3PFIA 1VMAA 3FA2A 4B40A 1U8UA 1IATA 1ZKMA 3T3PB 5CDSA 1JG1A 1R66A 2EX1A 4TKLA 1SG9A 4EFNA 9ATCA 1M5RA 2PX5A 5A5VA 4HQ6A 2ZP1A 5K3DA 3O7MA 1YH3A 3IPYA 3HCPA 4UUQA 1DBSA 4D9FA 3OO0A 3RTAA 5CX4A 2HMWA 2O07A 3PZBA 4RHTA 4QQKA 5C1IA 4AAYA 5BNZA 5JHHB 2FWIA 1Q92A 4ZCRA 2RH4A 2HK8A 1SBIA 3R24A 3AM1A 1G9SA 4YONB 4LUCA 1GQYA 5EZYA 3RUEA 1P3DA 4EEXA 3BE6A 4MIYA 4MRMA 3D3WA 5ESWA 2NU8A 5DF1A 3KXIA 5TGTA 2Z6QA 2GETA 4PPGA 3WIDA 3O2JA 4QDUA 2I55A 2LP4Y 3H9EO 3O0DA 4CQNA 5AM4A 1MF7A 2Q3DA 1JQKA 2A3RA 4MUEA 5DGXA 3ITKA 3AKZA 3HKDB 3SNHA 3RSZA 2I6FA 1VB3A 3TJRA 4ZT3A 1FP2A 4WRRA 2Z5GA 5EMJA 2GK3A 5C9ZA 2V6IA 2CL0X 4ZT4A 1O0CA 3QFTA 1NIJA 2V6FA 2XQIA 4N7RA 1O7JA 1W46A 3CGWA 1HUQA 1VYHA 1OU4A 4HB2A 2O8CA 5IC6A 3KEMA 5FAXA 4DLRA 4DLNA 3VNUA 1P5ZB 1EU1A 3GGDA 4UAVA 4WERA 5I7FA 3FCAA 3DXXA 1JBKA 3EPKA 3INYA 4TRNA 4XH9B 2I1LA 1QGAA 1PK7A 1ZS9A 2E5FA 2H52A 2C7RA 1E1DA 1Z22A 1NNUA 2DKFA 4EPVA 2A0FA 4QOSA 2HT6A 1EM8A 4E0BA 5FUVA 1K5DA 3A14A 2WB2A 4WY8A 1FRZA 1FP7A 2AHRA 1I0LA 1ONNA 4S3MA 4OU4A 1QGUB 2Q0QA 1I3CA 2B0CA 2I7DA 2QG4A 3F9RA 5AW7A 4E33A 2XMDA 5J4KA 5KOHA 3LECA 1E0JA 3GYGA 2C5FA 3BMQA 1KMHA 4EFMA 5KTOA 3CWZA 4MMXB 3TAUA 1AVTA 5DHSA 3B1JA 2OXTA 4EATA 2NX2A 1BFDA 2LPMA 3F6PA 3LUAA 3JQ8A 4NS4A 4QOJA 3SXUA 2QDKA 2VP5A 3S1LA 1K27A 1XTIA 1DI0A 1EK0A 2XPCA 3TD2A 4DG5A 4LFAB 1IRXA 1U1GA 2EF1A 3ME5A 3GGGA 2GTPA 4ID9A 4IOMA 4K46A 4QQRA 3R5KA 5BO5A 3DKRA 5BV7A 1I9CA 2HHAA 1CBUA 4YWJA 5DBEX 1W88A 1C4KA 1BGXT 3ESYA 4K9DA 1LX7A 3KE9A 3PIIA 1HQKA 4KAFA 2ZI6A 4ZQGA 3RUPA 4DLVA 2VPZA 3FTEA 3Q3VA 4ARUA 4B17A 1U8TA 3BTUA 3E9ZA 1N3IA 3AVVA 1L5NA 4TV8F 3IKVA 1AHIA 1HBJA 4TROA 1RPNA 2VJKA 2W2OA 3F5FA 2F90A 5BRNA 3JYPA 4C0LA 1XLUA 4B85A 3V4ZA 3I28A 1IB6A 3OEWA 4A26A 2RH9B 5MN6A 2O59A 3R2JA 4R98A 4AX4A 1IOVA 4CCAA 3Q8XB 1IJBA 4X1IB 1XB2A 3KWMA 3K1YA 3QVGA 1EFUA 5I8ZA 1DAIA 1Q19A 2WK1A 3PPWA 4P4TA 3MELA 1Z33A 2PTHA 2B83A 2PPLA 4PX5A 3FPGA 4Y2YA 1T5SA 3W78A 3B85A 5I5EA 2XCTB 4DMMA 1CJTC 2Z2JA 4CKZA 4IV0A 4R31A 3JYNA 3I0MA 4IINA 2ZSKA 1O1YA 3HCDA 1X1BA 4CTOA 5JNWA 3UAWA 3G9XA 1HYQA 1Q0RA 2EW1A 3LCJA 1OAOA 1H93A 2YHSA 3OFNA 4ND3A 3ZDZB 1HY3A 2Q0SA 3SLGA 1UC8A 3JQBC 2EDAA 3O5AA 3TX6A 3CF0A 3E2PA 1J00A 1OLSB 1QJ4A 2BM9A 4HGYA 2VCYA 1BU8A 3FBTA 3S8MA 3ZBUA 4PYKA 5E4JA 3SCZA 4EB0A 2P78A 4YXFA 4R0NA 4AQYB 3EQ6A 5ADVA 1XVUA 1CB0A 4HDRA 1FFYA 1KK1A 4AKIA 2IDJA 2YWFA 2F8TA 5AQ1A 1E99A 1JR2A 1VHLA 2CVZA 3G9QA 1RI5A 4J2OA 1H66A 3LCCA 3KT6A 3R3HA 3KQHA 4ESEA 3MTDA 2NXNA 1NMQA 2X86A 4ZOLF 1PFUA 1QLJA 1MT0A 5ED0A 3SY8A 3WQQA 5ADUS 3DD5A 3QVTA 4MWSA 2HW8A 2HTEA 1YQDA 1V5IA 2O7VA 4MVJG 1Z4JA 1BNCA 5AP9A 4WESB 3IEMA 1HFJA 2PXAA 4YACA 2HQ1A 4TT8A 3GEPA 4M8KA 4HQFA 3DBHB 3QXHA 1FDIA 2C0PA 1LPAB 3EZGA 4GZLA 2YZGA 1N9KA 3E3MA 3IP3A 3WLHA 5ITZB 4DW8A 5JD4A 1DSSG 1X92A 4OGGA 3C5WP 2YY7A 4HGQA 2V7TA 4KFRA 4R54A 3IFSA 2CCGA 1I7NA 3T9DA 1N75A 4Y1EA 5JNRA 1QS0A 2AN3A 3T12A 1W4AA 2A5LA 3GOHA 1JZQA 4FHEA 5DHAA 5LZ2A 1EMDA 1L1RA 5F52A 5J1SB 2O2CA 4ID3A 5DVZA 1QDUA 1QRUA 3RRMA 3NV7A 4U7GA 4MCHA 1V16B 1DAGA 2O0KA 3AFNA 1P44A 3F1KA 4CM1A 2HYDA 1CERA 1F5NA 2XYPA 3JWHA 2JGRA 4IHAA 4HT3B 1D04A 4B3MB 1VIAA 1S5PA 4W5WA 5C32A 3EVAA 1BC5A 1ORWA 2FNAA 3LLUA 1TE2A 3O8DA 4EFKA 1NV9A 4DIUA 5F23A 1M2EA 5EJ6A 2WAAA 2HMUA 4H1UA 4MCAA 5LQRA 2EQ5A 1L7BA 1MEEA 3OIDA 2HLPA 1M2HA 1U9JA 1YI1A 4HDKA 3LDHA 1YOVA 4EG6A 3ANXA 3PQ2A 3CNHA 4H7PA 5FUBA 4C0XA 3RPEA 1MX9A 3QKRB 4DIKA 4QGSA 1WL8A 3Q88A 5FLEX 3FLEA 2ID9A 1Q0HA 1T8SA 1ZM4A 5BN4A 4UXJA 2GRUA 1MVLA 4IYRA 4J0IA 4RFSB 5P21A 4EAQA 2LUOA 3QE3A 1Z56C 4KO1S 4EGJA 1RAGA 3ECCA 4TTIA 2Y0BA 4KITB 4LGVA 1CZHA 2C92A 2AKAB 2J48A 4IGAA 2J4DA 2PRJA 2YBDA 3H5WA 3JTEA 5JAOA 3VKHA 3KWLA 5IKXA 2JB9A 4X71A 2A5DA 1F1JA 5FO1A 5FBLB 1VXOA 1NJ8A 4MB6A 2ZB2A 4X24A 5JD3A 1U81A 3HBAA 3AUAA 3WLKX 4CT5A 2E85A 3MEQA 1ZZEA 4X8LA 1C7ZA 1X7ZB 2OBFA 4IUCS 3JQQA 2YVAA 3TTXA 1D5CA 3E18A 3WL6A 1VLHA 3DLBA 5JSHA 1NURA 4CT0A 4AXXA 2BMDA 3KZNA 2RAPA 4ZOBA 1MEOA 5AVZA 5ALVA 4QPCA 1YJBA 3DMFA 2X8LA 3A4MA 2XRZA 5IVKA 3M6IA 4K40A 3K2BA 3ZJ4A 4CWAA 2HA2A 4F4CA 1FNDA 2A33A 1XN1A 4D3FA 1RLUA 4RMGA 1RXCA 4JN6B 4EG7A 3DAYA 3VNVA 1XCPA 4HF7A 2CVOA 3ESCA 2KMLA 3KE8A 2RGEA 2G6BA 2QAIA 3NCTA 2Z8YA 4K6GA 3PX7A 4DB4A 3PRYA 4QDKA 3A8TA 5EXSA 2H16A 2DM6A 3GNQA 5FNVA 2PKEA 1V7QA 1UZNA 3RQIA 1CLEA 4B6EA 4EG5A 2EW8A 5FNZA 4IF6A 3LBAA 3RS3A 2AJ8A 3KR0A 3FUTA 4M22A 3VDNB 1TX4B 5I48A 3RS9A 2J4CA 4MWBA 2RGNA 4L7VA 4KSYA 4D1YA 5IJWA 3M4YA 1B15A 5TQVA 5LQMA 2XZLA 3CH6A 4JAVC 1Z82A 3L0SA 5ECGC 1FMCA 5DM70 4Q05A 2QI9F 1BVRA 3ZWDA 4N6GA 1JKMA 3EGWA 3ZZUA 1C9YA 2XQGA 5AUOB 1OFUA 4BQOA 3BE8A 1FPQA 1ULBA 5KVCA 1XJCA 3NB0A 1N8NA 3AXSA 2AA3A 2AOUA 1GGMA 2UZ1A 4NONA 1P9OA 1YJAA 2R6AA 4B45A 4UEOA 3PDHA 2IH5A 1ZOLA 2IL1A 1RKVA 3A6ZA 3F8WA 2CZCA 5KWJA 4JI8B 3QXGA 1JLRA 1JKJA 2CDCA 4LBYA 1F6BA 4N48A 1VLMA 4LFCB 1XP8A 1N8SA 3NC0C 5TE9A 3UMSA 2BZ1A 3VKUA 3R3ZA 4BECA 4DSZA 5A6VA 3B9BA 2VSQA 3B2QA 3NFRA 5AHKA 2PUAA 2AB0A 4N3AA 1IULA 4LHEA 1J2RA 4PBRA 2WUFA 3CJQA 1SOAA 4JJ6A 4PYJA 4TTTS 4MGZR 2W00A 1OW3B 2VRCD 3CR7A 3U3DA 5TX7A 4NFLA 4C7OA 4E2ZA 1VSBA 4ZZIA 4FW9A 4JJ8A 1W5EA 5CM8B 1YO6A 3T3OA 1UK7A 2VF5X 4PFSA 3HA7A 3TSOA 1C9EA 5KHOC 3J81A 1O6BA 4F56A 3LD9A 4FDTA 2ZTSA 2ZIZA 1KEUA 2GVZC 2HLDA 2X5JO 4M6WB 1YZQA 3RFVA 2J30A 1Z8NA 1NQVA 3RRNA 2PG3A 2YJGA 3TR6A 5FPQA 1UJ6A 2JFBA 4M36A 1UMKA 2FR0A 1JAXA 1JEEA 1K89A 2EJWA 4MUBA 4HVAA 1MJHA 3DOIA 3EFOB 2OZLB 3LF2A 4JBHA 3ITDA 4TMYA 4XOIA 5LA6F 4YRKA 1ADYA 1H85A 5ADHA 3FWYA 4WUTA 3THXA 2HYIC 4OK3A 5ALLA 2ZZMA 5F5NA 4WXYB 1Y9JA 2XZDA 5JS7A 4POOA 1SXIA 5E8JA 1CR2A 5HM8A 3GJZA 1RBMA 3SIPA 4Z8XA 2MMCA 3OKPA 1BCSB 5B2ZA 4LJRA 3N2GA 1N2OA 5EI5A 4RNCA 2ODTX 3NKFA 3G89A 5E6RA 5F78A 3WLLA 1K8YB 2R00C 3LY7A 3OIYA 1CJCA 3IKTA 2IV7A 3D8BA 2FZ5A 3LUCA 2O2GA 1MOPA 1SD1A 3SFTA 4RVFA 4RKWA 2ZITA 1NVBA 1XEWY 2NVWA 3QPBA 4K9PA 5G3YA 4F3TA 2ZSFA 4KHPB 2FSFA 5B5SA 3E7WA 2GM4A 4AUEA 1JFTA 1SUBA 4RC9A 4WFKA 3BKWA 3O21A 4ZIRB 5C5CA 1F4VA 1RFGE 2JAUA 4NMWA 3CIOA 4XB6B 4D9CA 3C3KA 1ZVKA 1U0SY 1FNBA 3ZY2A 1SHZA 4PLWA 1HE3A 5JBNA 2VP3A 1GL6A 2G76A 3DA8A 1NF3A 1HLFA 5ED4A 1KDZA 2DVMA 1XPUA 3OZFA 1BDIA 3AERA 3BGIA 3K9QO 3WJ7A 2CLLB 1FPMA 4PGAA 1AUXA 3QBDA 5D8DA 2Z2ZA 3CRVA 2BL4A 5ALRA 1IJFA 3EOAI 4OYYA 3RSOA 3T99A 5A06A 1H4VB 4I46A 1YSCA 1SURA 3HEMA 2V8BA 5GIOE 3VAYA 2H2WA 1KAOA 3E15A 5GMOA 2R6GA 5DKFA 5ITWA 5B1HA 1EFPA 2H00A 1V7PC 2OGZA 1W49A 4Q7LA 4K26A 3T4XA 4I1SA 4BLWA 3G2NA 5BMVA 2FSIA 2EWMA 2ORWA 2O3SA 3BFJA 3DW3X 3E58A 3PR1A 3IIJA 4F8EA 5K0EA 1KZ4A 2MSNA 3II6X 1GITA 4ZU3A 4NR0A 1SHJA 1MEJA 3BRQA 2XNDD 4I0WB 3E22A 4IDDA 5DTMA 2GVNA 5JMPA 1EINA 2IYNA 1IOLA 2NU9A 2C0CA 2WT9A 2FX3A 3HFGA 3HM2A 4FC6A 5UKDA 5HWSA 1E0KA 1ZIOA 3D1VA 2UYCA 1KDRA 2X8JB 1OGJA 4E6EA 2XB8A 3HB1A 4RM2A 2YWEA 4YECA 3UN1A 5KSYA 3H2GA 4GSYA 4R4JA 1AKTA 1W7AA 3A37A 4P98A 4ARBA 1XRLA 3EEBA 1V39A 4FGSA 4K28A 2J3DA 3KK0A 2O8DB 5CYOA 8MHTA 3BDVA 3NAMA 2CV2A 1A8QA 3GELA 1QHNA 1C3OB 1YWGO 3W9SA 3FDZB 4WE3A 3RJ9A 4FLMA 2ZTUA 3I6ZA 1XCJA 3UV3A 3QBEA 3WGQA 1BN7A 1UCFA 1Z3CA 1F4PA 3QELB 2C9MA 2Q5JA 3ND8A 1JIUA 1QHEA 4HH0A 4UM7A 3LX8A 4PRLA 3PTZA 4P7FA 3KUKA 1QH8B 3FMIA 3EEIA 4R9NA 1A2QA 3OURA 5AOVA 4DPLA 2VSYA 1P31A 5DNVA 4ZYVA 5JAHA 4RULA 5CCBA 4FT2A 1GSIA 4AMGA 1VL6A 4RGQA 4OHCA 3T1VA 1ATZA 3AOGA 2XUQA 4UDXX 1UXHA 3WC4A 4OLBA 2LV8A 2IY7A 4B7UA 3KQWA 1ES9A 3L7KA 5BVGA 1NXPA 4KQWA 2OE2A 3CNLA 1Y80A 2OGUA 5AUPB 1SK9A 4XRRA 1HURA 2XTAA 1KAMA 1NW4A 5A7GA 1OI4A 1RFLA 1Z7EA 1X9GA 2CMGA 3OJWA 4H18A 2NZVG 1SBCA 1T9AA 3C5CA 4DLTA 2XWPA 1PCXA 4ABYA 1ZU5A 2Y93A 4AS2A 1YA4A 2FPXA 3FVTA 1N5OX 3E7PA 2D6FA 1Y6ZA 3NUGA 2QQFA 3A2KA 3RCBA 3U5ZB 4P4UA 3W79A 5E3JA 3R5SA 2J7PD 2CSUA 1J8VA 3I04A 1S6YA 1LK0A 4NEHB 3AVOA 4A82A 2IF0A 4FDVA 4RKEA 3VR6D 4H7FA 1U3VA 2OZPA 4TXNA 4G26A 3AKDA 2O06A 1RIFA 1YFLA 1XKTA 1AH2A 3PRKE 4L76A 2XUAA 3ZV4A 4BUCA 1L5ZA 5FTWA 5KDLA 2Z4RA 1R8SA 2O7NA 4NIMA 3AZPA 3ZHTA 2PMDA 4WEOA 3WIVA 4D02A 3HSYA 3IJPA 4Y7CA 5ECDA 4IDBA 5KKNB 2Y6UA 4BNDA 1RAIA 1Y8AA 2RGCA 4EUHA 2Z4TA 4BWVA 2FA9A 3QUCA 4LX8A 5AVTA 5J58A 1XEXA 1B23P 3TIGA 2V3CC 1MTOA 4ZVSA 2ZTHA 4UEJA 1IY0A 1JAYA 1M0WA 4MUKA 4ECEA 1H4SA 2CWDA 3I4CA 4G4IA 4GVLA 1T10A 3A1FA 3NJRA 1Z4OA 1GTL1 4ND8A 4G07A 4OMDA 1CS0B 4B3JA 1K75A 5JDIC 2IDZA 2NZXA 4PZZA 3LPLA 2UUAB 2IIQA 3LQYA 3LSYA 2B1JA 4B09A 5BW6B 2LKDA 4E7OA 1QYCA 2BZSA 4ZHSA 1FJ2A 1RZRA 2OO5C 4LVNA 2H2HA 2IZ1A 2CUKA 4MGIR 3ZDYB 4AG3A 5L4SA 4MQMA 1PJCA 2Z2YA 1ZN2A 3OBBA 3N2NA 3PKZA 3QEKA 3T5CA 5SY9A 2H8KA 2QVYX 3HY4A 2IX3A 3BJEA 2N47A 1L9KA 3QTBA 2W2QA 2V0GA 4U7FA 5A4FS 1MTZA 4EKNB 1UBUS 1Z4QA 1Q3TA 4RKQA 3GPBA 4BJ3A 3PCRB 4FXOA 1FFDA 4O2LA 4R9VA 3ID6C 4I3FA 4UBLA 1J2JA 4MUMA 5DNCA 2IP4A 5IBRA 1TAUA 1E8MA 2X40A 1OILA 1RXSA 3S2FA 3ZWKA 4LY3A 3QITA 1A8UA 3GDHA 2PL1A 4G1CA 4LJSA 3S2IA 3UB4A 3LC2O 5DMXA 4CL0A 1FUKA 4OV6B 3PQ6A 4F4IA 1XAJA 3NDIA 4PYLA 3ZQKA 1MJFA 1NA5A 3ZWBA 1GNQA 3A3OA 4WXEA 4HJXA 2IZ6A 4BTLA 3AL0C 2NO4A 1M9NA 1FDVA 2E3JA 4GYJA 4MCIA 4O3MA 2FB9A 3ICOA 4K9RA 4EYOA 1VKHA 2VJDA 4RA6A 3EH1A 4D4KA 3SEQA 1DIGA 2CE2X 4HLUA 2Q6VA 4K6CA 4KXNA 4RS3A 4EJ0A 2FKNA 1ODCA 2XX3A 2C1EA 2GBPA 1IL0A 3H65A 5FFMA 2X0IA 5DTQA 2CK3D 4L7QA 4ZKDA 4RXTA 1C0PA 3RARA 1FYFA 3MILA 4H3HB 2WTAA 3K9FC 1C0IA 2P68A 2VYVD 1JEOA 1KFJB 1ZCFA 3ORSA 3OTHA 3W3AD 3K09A 1N1EA 4B2YA 1J49A 1QPZA 2AMVA 3GLRA 5J5AA 4B6PA 4P3KA 2CCKA 2OCGA 2VAXA 1MKYA 4MA5A 1HSZA 3IP5A 4QLBA 2HGZA 1U28C 2WIFA 4JKYA 3B20A 4DMUB 3WBFA 3KPVA 5ILQA 1HL3A 2JLQA 4MVJD 5C3MA 1YDMA 1YZUA 2HV8A 2JLRA 3ZZTA 3L84A 4X7PA 3PGLA 1AUOA 1GUYA 2XF2A 3ZCQA 1J5PA 4OHYA 3P2KA 4RJKA 5CX1A 1I7QB 3FN4A 2DGDA 3Q7IA 3DE7X 2FFAA 4MVYA 5CB4A 2DFLA 1THZA 4WUVA 2YHIB 1D2CA 4P1ZA 3NO4A 3W2GA 3BERA 3LQ1A 1OX5A 2FEXA 2JZNA 2AMFA 1NW6A 3P5BA 5AXDA 1KERA 1P1FA 2JVKA 2W2XA 3SR4A 3W8DA 3COWA 1XL1A 4P3YA 5EHNA 2M1XA 9GPBA 2KI5A 5IUJC 1W0CA 1XE3A 1GTG1 2QX7A 4NZ9A 1JDPA 4Z7NB 1MPXA 1VLLA 2NGRA 1MBZA 3ZE6A 4DLSA 4X66B 1GTSA 1DOAA 5DHPA 2PJUA 1GRNA 2YV2A 3LI2A 1UKCA 2A67A 2BGRA 4RIIA 4OVKA 2IHKA 3VSDA 1NATA 2X0JA 1KK0A 3L8MA 3P2OA 1EWKA 1ZI8A 1HYEA 4FUTA 4JDPA 3TKAA 3EFHA 3R3XA 3R5TA 2NUTB 3IA7A 1EBBA 2I1QA 3JZAA 4HTFA 4LTNA 1D2NA 4MV9A 5EJGA 5EYPA 5IKPA 4KYVA 3NYQA 4K0KB 2NZUG 4JIMA 3UJ6A 1N5LA 3H05A 4G1VA 4IIDA 4KHZA 1E2DA 4ENQA 4CM4B 2BP7B 1XP5A 2YCLA 4RD1A 1WCIA 4N5LA 2NW6A 1PFQA 1CJVC 4YRJA 4EVIA 4MRPA 1NUAA 1ZIPA 4ZYXA 4H4CA 2IPAB 3PGXA 1YTUA 3G8DA 4M9UA 1DS6A 3N8IA 3K5WA 4FFNA 4MGEA 4JT9A 2C61A 2BR5A 2YS7A 5CH5A 3U7QA 4XLLA 1OTXA 4PPFA 4KV7A 4F60A 4LMRA 2OHFA 4M0DA 4RLHA 1GAWA 3ENKA 1EUYA 1XZHA 2FLWA 3EUFA 4MDHA 1PD1A 5DCUA 2OXIA 1D2MA 3D4LA 3TZ6A 3GEMA 4Q66C 4BFYA 4BKRA 2JGFA 1Y3AA 4YJHA 1UQUA 5FBZA 4L28A 4FMCB 4R2MA 4TX1A 5DN9A 5HFJA 3LQKA 1W0KD 3EVTA 4A73A 5EIEA 5IWCA 4HDMA 1Z17A 2ZT7A 3FFXA 1XVAA 3IMFA 1G20E 3REFA 3DXYA 4DRXA 2I6QA 2ONCA 1LSUA 2HHLA 3AX6A 5DBOA 1QZTA 3OZWA 2IGBA 2GCPA 4BB0A 1A72A 5JQGA 5JTUA 2QIPA 4J0CA 2C99A 3QVSA 1ZD9A 3CX8A 3GJQA 1N2JA 4LPKA 2PRIA 1RP1A 3LYUA 3AIOA 4Z9AA 2WY2D 5AKKA 4AG6A 4B9AA 1USKA 2V6GA 3E9EA 3HGQA 3NM6B 1S4QA 2QYTA 4KE6A 5EINA 4OJTA 1J0BA 5K1ZA 3EZ6A 3ZK7A 1TKCA 2NUPB 1VG1A 1HZJA 2ATEA 2QMOA 4CE6A 4FKZA 4A7PA 4W9RA 1Z73A 3L5OA 5CT8A 1N2XA 4ZXPA 4A8HA 2JGNA 1CZNA 1X94A 4MGYR 1XLTC 2BW0A 3KQSA 3KQYA 2P65A 3ELDA 4MV4A 2YVUA 4N03A 4TQ9A 3PQFA 4IRUB 4BQNA 3TLKA 3D7KA 1WX1A 2HC9A 2A9OA 2FW7A 3LT4A 2JDID 3EVDA 3NMUF 1JDJA 4N6OA 1C7IA 2XBLA 3ESXA 4S1OA 4F97A 4AC9A 4L9SA 1XWFA 4FE4A 4JOBA 1SGWA 1AQJA 5M29A 2B9EA 1LBHA 5CNJA 4JJGA 3GBSA 1UAAA 4L8GA 1RYHA 4QRIA 3A36A 3TS1A 4CM8A 4R3UC 2RBGA 3AL3A 4TKVA 4CF7A 4AICA 3N05A 4DWOA 2YFKA 2CXUA 4K3UA 5DI3B 1GL3A 2OXRA 2ZIUB 4FQ8A 2J41A 5JRZA 5FT9A 3HLTA 1XT6A 4HB3A 2AW5A 4UZSA 3EZYA 2GPSA 4FCWA 4MVJE 5JUWA 3W5JA 1T35A 4Q1CA 1NUSA 1GG5A 4N0DA 4U6SA 2WVAA 4Q9IA 1L5MA 4HYEA 4Q3BA 1I14A 2HU2A 1K3UB 2QW1A 3INGA 3LC7O 1QQ6A 2M6KA 5HXAA 1CHDA 1PK8A 4H08A 4N6NA 1S2LA 5KTMA 1BSVA 1RRKA 2H2FA 2J9ZB 3K0HA 1NY6A 4DSTA 3UUWA 3WDLA 4W9NA 2HKIA 5K3OA 2ILTA 3MGGA 3PNSA 1CHNA 1XRSB 3H2HA 3I2HA 1BKSB 3F6RA 1P2SA 3OJEA 1UPUA 2P6PA 3GEHA 1CZOA 4HATA 1L4FA 2BGMA 3EZLA 3P0HA 1R0ZA 4NCHA 1W4ZA 3HZOA 4PC2A 1X0VA 4FNAA 1OTYA 4FFVA 2L17A 1FK8A 3LPDA 4TS1A 3FCOA 3AW9A 1CXZA 4PRZA 4D3DA 1VLZA 3EIXA 3I2KA 3CWCA 3E8XA 4COOA 3OCVA 1U8EA 4UM5A 3C16C 3P26A 2VXYA 2N9UA 4AZSA 3DWFA 4J07A 1GGFA 1PNQA 1EBFA 4B80A 2XTNA 4MYDA 2HXGA 2EP7A 2KSQA 3TQTA 5E8RA 4A2QA 2HI0A 2XODA 4FUQA 1X74A 1Z3IX 1YZ3A 2H06A 3OLCX 4WKPA 3UT5A 4BZPA 4OJNA 1NVUQ 1JIXA 3LVQE 1HFWA 3KTDA 2WHPA 4IH1A 4KTTE 3JR3A 4P2GA 5HFNA 3VYTB 5CA1B 5FWXB 2Q3FA 2AQKA 1RWQA 2QM7A 5HW0A 1NW5A 4EA6A 1R64A 2H17A 3F47A 3DNFA 3N2LA 3QE2A 2ZPAA 1GPLA 4C7KA 4EZIA 5LBUA 4R41A 4DUGA 1KQPA 1UP7A 5EOVA 1CU1A 1QYXA 2D5CA 4FI3F 3OEED 4EO7A 3A6GA 4JEIA 4MV8A 3WMEA 3Q0EA 3HRHA 1E61A 4U8HA 4DY4A 2Q2NA 4RE5A 1KTVA 4JR2A 2GD1O 3OX1A 4PSDA 1XZJA 3BZWA 3CUWA 4I9UA 5IEJA 3B8HA 4MW1A 1QIKA 3U60B 4CEJA 1K97A 2GJKA 4CV0A 3FWPA 4XKJA 3KHSA 1Y1SA 2H3HA 3PGA1 3EXFA 4MR7B 1J0AA 5H59A 1AKQA 2XRMA 1FP4A 4GP6A 1VKRA 2HMSA 4M1ZA 1KQFA 5EMKA 1POWA 1BQEA 1F8XA 1J42A 2J3EA 2YQZA 5L3RA 4EK9A 3T9FA 1ULHA 4C5AA 3THRA 4TYWA 4PIVA 4PVDA 1OZFA 3BFXA 3SKYA 2WWXA 5D5PA 3S40A 1W2HA 4KBFA 3MTGA 1S0UA 4O08A 5LBIA 5A5GA 1X1SA 3ZBTA 4UJ3A 4L27A 2XMPA 1CR1A 3HJTA 2P6NA 2Y0EA 1Z25A 3LCMA 1APBA 3K2IA 3ABIA 1MX3A 1PX0A 3OEHA 3PLRA 2BSXA 5C31A 2XB6A 4QXRA 3BB4A 1YQUA 1FLNA 1RPZA 4WZAB 5LVAA 2QRQA 4WKOA 1J24A 2RIPA 4D79A 4A23A 4OQ4A 4MO9A 3KJNA 2DLDA 3AB3A 2WJVA 5G1PA 2R5NA 4KXMA 4MQFB 3OZUA 4MAFA 3K9WA 3LVBA 3AP2A 4DDKA 1TXGA 2DPXA 1JMYA 2XMQA 4G41A 5ILGA 2F3QA 4GMXA 4F2HA 5BW8A 3ETDA 5AI5A 1TVKA 4BGDA 2SCUB 2VPTA 4XAQA 3VVLA 1SD5A 4HDNB 3A3YA 1KS9A 1N2SA 2FY8A 5H4GA 3HR8A 1ZZGA 5BPHA 4Y2UA 1NUQA 2Y27A 4Q1EA 1T26A 4MUYA 2FWBA 4HAOA 5GZ1A 4QGBA 2G4VA 2JBAA 5FBWB 2K5UA 4N9QA 2AN5A 3C3CA 1RM3A 5AW6A 3GJ6A 1KS2A 1LQUA 4L2IB 4DC1A 3D2CA 3D7NA 4U9IS 2GM9A 4DA8A 4PYNA 2ISSD 4BNIA 2FPPA 1SNYA 1NJ1A 4PX9A 2OAGA 2JASA 5E7MA 4JBWA 5IC5A 4AMYA 4M9CA 4G4GA 1ZEMA 2W2MA 3Q7RA 4P31A 4BNXA 3I9MA 2Y1KA 3WLNA 2JL1A 1G21A 1NWCA 3BL8A 1JEYB 1W581 2OFOA 5EMMA 3EGEA 2Q8PA 5SV2A 2Q2WA 1Y3DE 3V7FA 3WB0A 3O2QB 2C5LA 1CQIA 2YV4A 4JP5A 1LS6A 5JBQA 5FL3A 3HP4A 3BRWA 1RJEA 1WXEA 4Q82A 3ZDRA 5EJEA 2VK4A 2QBYB 5CITA 4F2DA 5JWHA 1GRCA 4OUDB 3IDOA 3B2NA 1XYYA 2J6CA 3DKIA 4KK3A 1P75A 4CCSA 4C0SA 1TGVA 2EZTA 2O6HA 2C9OA 4BFWA 5EMHA 4LGYA 1NI4A 4HBZA 4KVAA 4OBWA 4WLEA 4GH5A 2PR2A 3HQ4O 2WYWA 5AXBA 2TMGA 3JARB 1V1MA 4Y2GA 1PGQA 4F4HA 4JUDX 2Z1DA 5ES4B 4ZMSA 3E81A 4D57A 5JO0A 1EXNA 3JRWA 2DUJA 2HNKA 4R3WA 1L4UA 4JZKA 4BU1A 2PSJA 3NETA 1SCBA 2IK8A 3WRXC 5IYZF 3IIEA 5KNBH 4ZHQF 4ZOCA 2CXXA 2WYOA 5EQJB 4FIZA 3D4PA 1WP4A 4U3JA 3WNVA 2IH2A 1TA9A 1CETA 1Q15A 4X7BA 1YR7A 3ETEA 4JMLA 5D84A 2K6GA 1DV2A 2V7WA 3QJYA 5CDHA 4B6GA 5I7UA 3I62A 5CVUA 2ZJOA 2XQKA 3QQ5A 4OU5A 2Z3VA 2E18A 3LXUX 4XUGB 4LF5B 2MWMA 1TJ5A 5JYDA 4UATA 5C7YA 2CJPA 2PBFA 2P9CA 4JUCA 1LTKA 4MKIA 1G59A 2QRJA 5CB6A 1KNQA 2VUHB 1QAMA 2FPSA 2XSZD 3PXXA 2PJRA 2BLLA 3WIUA 2ZCJA 1KOGA 1R0SA 1E3IA 2VA9A 2X4DA 2MSCB 3LBIA 4ZVOA 4BGVA 1IHPA 4GP7A 4AJNA 3WRWA 1U0NA 2AFRA 2EHJA 1ORTA 4TWIA 1N32B 3BMXA 3K2EA 4FYJA 4X20A 3UH0A 1QHHA 2VLBA 2BI8A 1ZOIA 2A7XA 2CF6A 1SVWA 2DJ5A 3R1IA 5T64A 2JCYA 4RL4A 3U19A 4IXTA 4TV9B 5D5QA 2QG9A 4OXRA 1XQYA 2QKYA 3VZPA 5JJCA 2DZDA 1UT6A 2TMDA 1V8ZA 3DVAB 1M0SA 1E7MA 4BO0A 1OB2A 1IUPA 2IA5A 2IEBA 3QP9A 2VQ3A 3WMXA 4RA9A 5IJXA 5IP5A 3AWIA 1XDBA 3GWZA 2LCFA 1CQWA 2HK6A 1T1EA 4M38A 5EWMB 1Z5VA 4KH1A 3RFFA 1B8VA 3UHFA 4EGQA 4PR3A 5LM3A 3ED5A 3OOSA 1U65A 3LUPA 5DW0A 1OZGA 3DOOA 2O8BA 3CEPB 1GSOA 2OMEA 2W2LD 1JA1A 4OQZA 4A5OA 1NASA 4R2LA 4MV7A 4GR4A 2KJQA 1S02A 1RJWA 2XA1A 5AT1A 3PEEA 2PLWA 4IMPA 2H1RA 3FHJA 3PKIA 3I5XA 2YZMA 2Y1EA 5ENVA 1D6SA 3B3AA 1X7DA 5LMNB 1D9ZA 3NIFB 4IRXA 3L9WA 3HUTA 3VR6H 1F2TB 2VT6A 1R88A 3CRZA 3WZ2A 3X1XA 3WYGA 1PLJA 2RK6A 3JZFA 5AW9A 4L22A 4NCBA 2WOOA 2WNHA 2C07A 1ZM2A 2E6UX 1JEDA 2J31A 2QRVB 3OJFA 3LY8A 5KNCH 4RFVA 2JLZA 4HXFB 2ZRIA 3OZDA 4ZK6A 1W6UA 4WOPA 2F00A 2J7PA 5G02A 1E5TA 4A8PA 1E69A 1KI1A 4NRDA 4JB3A 1MJGA 1GFSA 2HA7A 3GEBA 2WFZA 4Q00A 3VR6A 1T43A 4QBGB 5CM2Z 3L4EA 1Z8FA 3M2PA 1YUNA 2FMXA 2Y1GA 4F96A 1UOEA 1AM4D 5F73A 3VVMA 1WUTA 3ZOKA 2H57A 4L8WB 3S29A 5AVXA 1IDN1 4LECA 2NVBA 1ZLYA 4XD7D 4OMUA 1GUDA 2ZUBA 3TW4A 3PRHA 3ZBPA 2GWHA 5EPUA 4U9UA 2CFCA 4CMIB 2PSEA 5KQLA 4ZRMA 2C8JA 1I80A 5JYEA 4D96A 5F21A 4EOGA 4YV2A 4IJVA 2AC2A 1A5AB 4UARA 4XR4A 3AV0B 4FZ3A 2PWZA 3OZTA 1UOPA 2YJ3A 3EXEB 1KI8A 2CLDX 2F2TA 4GECA 4GWGA 4KLAA 3AOEC 3BWMA 4L02A 3ABQB 4JB0A 4TVOA 1JJIA 3TDMA 2A0UA 2B2CA 1TQHA 2XCIA 4KVFA 1L4LA 2AS0A 4BAZA 3PFGA 4O2BB 3WMWA 3FIJA 3VO2A 1XXHE 2BYTA 2YC4C 4G1FA 2QZ9A 1G20A 5TQ0B 4ER3A 3TOZA 5K01A 4UU1A 5K6TA 4WBNF 1ONSA 4CEHA 1OXMA 1SQ0A 3RYHA 5K3BA 2EYUA 3OQ1A 1WCV1 5C8YA 4DEYA 2R86A 4OQQA 2ZBPA 3ZCSA 1NVAA 3VUFA 2B61A 2WUWE 2PS1A 3GMDA 4E14A 1N5RA 1R5NA 1PL0A 5EWJB 4LXHA 3V3KA 1SVOA 3ZLJA 3ECSA 4I08A 1Z4NA 2GFQA 3N0WA 2JRCA 3I76A 3W5CA 1J99A 4X5OA 3NNDA 4W6ZA 4C4OA 1BZYA 1QIJA 2X8BA 3G79A 3S1SA 3CZPA 4XVQA 1E6LA 2VP0A 2ISCA 4TRJA 5H68A 2FXIA 1G8PA 3ODGA 4LDJA 1PWZA 4V3CA 4XM2A 3H2SA 3V4RA 5JJIA 4Y18A 2LTAA 2FMTA 1HE4A 1WPQA 2MJLA 1OFUX 2A4MA 2JARA 1YACA 3DO6A 1Q3KA 5FR2A 1DXHA 4EX6A 4RTQA 4LXXA 2HRBA 1SQ6A 2XY4A 2HDNB 4KE9A 2JI6A 1RCTE 5JEDA 2WUEA 5DWDA 1E89A 1YULA 1CIJA 3R9IA 3KJXA 2O4CA 1RT9A 1LGYA 4H4DA 2CL7X 4MVJH 2GBFA 2B4YA 4EQZA 1K63A 5AJYA 3ZPXA 1GEEA 1Q11A 3CY6A 5CDTA 4EA7A 2VYVA 3VV2A 4TUYB 2ZWIA 1PWXA 2OVBA 3NTXA 4INZA 1XQ6A 1RAHA 3HKCB 5FA6A 1F7UA 2XGSA 4HPXB 5C46F 5JAUA 1L4MA 4KOAA 4J6FA 4KZPA 3TCXB 2XUKA 1AMUA 1M2OB 1U2PA 4MVJA 2ZDHA 1RHQA 2FN4A 3L7AA 2IIPA 2ZZKA 4GZ3A 4DTIA 1EK5A 3K5HA 1WW2A 4BMVA 1SHLA 2PX4A 3P27A 1TF5A 3PR2B 2ZXEA 3IBCA 3VQTA 3GEEA 4D2IA 4JJIA 2UAGA 4WLUA 1Y33E 3UJ7A 2QMUA 3HYLA 1C81A 3RRJA 2X1HA 5IARA 1AUVA 5CD1A 4EJSC 1DGQA 1SUEA 1PYOA 2JNWA 2PYIA 3UQYS 3VV3A 4RDXA 4KRYA 2ZATA 2G5GX 1D6NA 1YS2X 2Z09A 4G37A 2C04A 4GLLA 3D3EA 4HWTA 3T3HA 3ZKAA 4ZI7A 5AESA 7GPBA 1X0XA 4L6IA 1YE5A 3I8XA 1GZDA 2VDLB 4ACAA 3ZEIA 1JT9A 2X15A 1YMVA 3NBZC 4BV8A 1HTTA 1CK4A 1S3SA 3O3CA 5FBKA 4LPSA 4ARAA 3TPZA 5JY6A 4D98A 3KXPA 3ADOA 3RS8A 4O5OA 1M1XB 1WQ1R 4MQEA 5T3YA 3C48A 2A5JA 2D00A 2NZJA 3DYIA 4RCVA 2WFAA 1FNMA 1HQCA 4P7BA 3VGPA 4AZWA 3AEZA 3KXDA 1CIPA 2C2BA 4DT1A 1D1QA 1JWAB 2W22A 3ZX4A 5AHOA 5BOVA 2ZB8A 1K8RA 1GPAA 2PD3A 2WAXA 3DMTA 4LY6A 3KZXA 3VR5D 2W93A 1KY5A 1R8YA 4XB1A 2W83A 3VNAA 4Z4FA 3QKIA 5KREA 1IG0A 3CB2A 4RJTA 3LIIA 2YVLA 5ILOA 5CFZA 4N12A 2B8JA 2JVJA 2QN6A 3I61A 2QNBA 5TB5A 1SBTA 2PMWB 1BN6A 1BD3A 4BZQA 1I0ZA 3ZEAA 2W6OA 1IEVA 1FB5A 3B3GA 3IH5A 3FPKA 4RD0A 3THWB 1GAXA 1PV1A 2DR3A 1T2FA 2P2LA 4BEWA 5JPIA 3A2LA 3VSBA 3I01A 4OHRA 2XWQA 3QRWA 4HAWA 3MQ2A 3FLBA 1P7VA 4PINA 2V5VA 4EARA 1DV1A 3K8OE 4OL0A 4RVUA 1L6IA 2QAGC 1BOFA 2QZSA 2AFHE 1A2BA 3PQEA 5AJZA 2OCPA 2DKOA 1PJBA 3LCRA 5M34A 4MROA 3SF8B 1KTIA 1CUIA 1EJBA 1BHSA 1OLXB 1ISRA 2DTXA 3PXCX 1C41A 3CCFA 4R16A 1P29A 3U44B 2WG2A 4UAUA 2VDWB 4FYIA 3ICVA 3P8ZA 2VH5R 3KQQA 5LOVB 3LSTA 5D6NA 2UYQA 1NDQA 2Q9UA 1N92A 4QBKA 4MP3A 3TN7A 2WUGA 3F98A 4B8ZA 4HNAB 2QQ0A 3DXZA 4DJJA 3C3PA 2YNMC 4ZQFA 1Y98A 2IZ5A 4I3HA 2ZIVB 1G9XA 1LF0A 2FPRA 2ID7A 3ILHA 1A76A 3K1ZA 1VPDA 4P7KA 4YT5A 3DR5A 3KOZA 3WWYA 3I4FA 2G5PA 5IVIA 1OFHA 3C3JA 2JDIA 1OYOA 4BLSA 2BFWA 5BXQC 1II0A 1IU9A 3HFJA 1YONA 3SC2A 3VU9B 1C1XB 3MJFA 3BMNA 4AVYA 4F6RB 2A78A 5I47A 3GGSA 4BZWA 2WTBA 4IXWA 2XAUA 3Q9NA 1RQXA 1DTWB 2GR9A 3ED1A 2ADOA 1F2DA 1CY6A 3RAJA 5J40A 1A2OA 1YRLA 4OXKA 1PT9A 1MA0A 1ZDMA 3U31A 4D4HA 2I65A 1PJ2A 1Z29A 4FKMA 2B92A 5CP8A 2QJFA 3SBEA 3BL5A 3UHAA 3DUFA 5B2EA 2PLAA 2OK8A 3FNGA 2I4MA 2D1RA 2B8WA 1U0RA 2O5RA 2PVCA 4DHWA 4Y1FA 3AP1A 1EVYA 3EGVA 5LIRA 4PZAA 4JP8A 5KQGA 3SZGA 1EJ0A 3COSA 3F7OA 1N9ZA 1Z26A 2NQTA 3EQZA 2BKUA 3AEYA 3Q3IA 4BNVA 1UBSB 3JQ7A 4PCLA 1R6XA 4RZUA 4ABTA 2PE5A 1ZD8A 2Y68A 1B14A 1O54A 1U2SA 1VJ0A 1ZQ1A 3PNBA 3PFNA 3VPGA 2E55A 3C5EA 3OQIB 4ZU1X 1WD5A 4CMHA 2IYWA 4HI0E 2WM8A 3UMBA 1K7XB 3FYUC 1Y9ZA 3GLHB 821PA 4J90A 3QBJA 4R40A 1ZXXA 2RB5A 2V65A 2V9ZA 3MERA 4UE2A 5JSKA 3WGHA 3AEKA 4NZOA 1HZZC 5EIBC 4BX8A 4EWLA 5L53A 5U9CA 1AZTA 3G6KA 3BZBA 3T4EA 2W7TA 5KVVA 5HE8A 1QNLA 3OQVA 1XLWA 4D0RA 4NAHA 4JNCA 1M2JA 3F3SA 2G7MC 2A58A 2YWHA 5JROA 1GTVA 5K9ZA 3EVBA 1R8XA 2I2BA 3OM9A 1W6RA 1V43A 1ILEA 3RC7A 4E32A 4OQNA 3M6AA 4TXHA 4EPTA 4D4GA 1Y4AE 2RKBA 1WEHA 1B0ZA 2GQ0A 5LQSA 1NVDA 1P61B 3B6EA 4LJ7A 3HPQA 3DE0X 1U3DA 2AXQA 1RRFA 2OXEA 2QX8A 2RGRA 4DCOA 2E4VA 3ZW8A 2UKDA 4HDSB 4C7VA 1EX9A 5BSHA 2RKOA 3UA4A 1YT5A 2REQB 3BTOA 2GERA 1P0MA 4L5IA 3WA6A 4QZVA 2PA3A 1ZJZA 1DAMA 5AIAA 3LZDA 4H27A 4YLEA 3WP1B 3HTXA 1E9BA 2O3TA 3OC0A 1H9BA 2H9IA 5IXSA 3OEEA 2AF4C 3QU9A 1O0BA 4R8RA 4CTKA 1Z0SA 5DLEA 4A36A 3DGFC 3L0YA 1DAFA 1XFAA 5TQ2A 2O2JA 2VNAA 3LT0A 4EMSA 5L40A 1SXGA 3VR2A 1M8PA 1XG5A 2X9NA 3H16A 1NXWA 6CHYA 4JC4A 5THKA 1QKIA 4U7JA 2JLAA 3OCUA 1JFFA 3T06B 1W1IA 2UZAA 2Y4NA 5EEGA 3OC6A 3ER6A 2D0IA 1G3RA 3TDNA 1UK9A 2JGAA 5BW5A 1FJGB 3AUSA 5L51A 1T4CB 1QE5A 3AESA 5FL7D 1KDOA 3JWGA 1ZVVA 3I05A 4ANFA 1IE3A 3QPUA 4KXFB 1E64A 2YNMD 2YJNA 1Z6TA 2EJVA 4ZCSA 3GN2A 1SIOA 1Z2AA 4G65A 4CR6A 5A3QA 3N2IA 4HJRA 1KZ9A 1VI6A 3AF1A 1RJGA 4AX8A 5L4NA 2V7XA 2R2AA 2YWJA 4WGGA 3IAXA 3OLWA 3DZDA 4AS1A 2YQ5A 4F8JA 3LIPA 1J22A 3NHZA 3K0AB 1EFRD 2JCXA 3TCKA 3EZFA 3VYRB 4KAJA 1E2LA 2QTVA 5KJFA 2GHRA 5HK8A 4Q3CA 1R00A 1PL7A 3C5VA 4ND4A 1YRHA 4BGIA 2QGZA 1YC5A 1TEXA 4XWGA 3L7BA 3SE7A 3R8CA 1IWBB 4QDJA 4OFBA 5JIBA 3K1AB 1OH6A 2IHNA 2C58A 1RACA 4YQZA 3SLKA 3CMMA 3DVLA 3O91A 1GU0A 3WS7A 3ZGLA 5IU6A 4AKHA 2APJA 1Z63A 1ZXBA 3GRVA 2FZVA 3WK7A 1T9CA 2JK1A 4R2WA 1YU9A 4ZO8A 3NHBA 1WPRA 2RHHA 5JHGB 4BXOA 4MRVA 2HT1A 3ZHUA 4LG1A 5IMBA 3AK4A 4OJMX 4MLDA 1E7QA 5REQA 3URKA 1DBVO 4AI6A 3BXFA 1SC6A 3KM0A 4LZOA 4UC0A 1K6XA 5HKLA 3VPFA 5B7PA 5KMGA 4IQ0A 5GZ3A 1PEAA 4I5FA 3GT0A 5HJ5A 4LV6A 3KD2A 3X0DA 2X0RA 3TK1A 2ZUSA 1C50A 1EAYA 3KQTA 4G84A 4MVWA 1ZR2A 4X7MA 3VDRA 3DV0B 1NGSA 3LDAA 2OA0A 1A9RA 1SVUA 5BPFA 1WQ3A 4XPZA 4AMZA 1DJPA 2VF2A 1FFCA 5K51A 4D82A 4HAYA 1K9SA 4HAZA 2Z6VA 3PC4A 5EIBD 2J6BA 2X9GA 3PFWO 3D3NA 3ZDCA 2O2DA 1KJJA 1CKEA 2B8EA 5L9AA 2C8VA 3X1DA 1USIA 2ZBRA 2X0DA 3DONA 1PR3A 4PLYA 4Q02A 4WJZA 2BGJA 4J3JA 2J85A 5K05A 1Y48E 3MMZA 3NONA 1U6JA 2IFTA 3S55A 4AKGA 3R4VA 3WYCA 2NN3C 3D4BA 3E53A 4GM4A 2WQZA 4HZIA 4MHOA 3PVCA 1I3NA 2HXSA 2VT2A 4Y2TA 1KFBB 3QVVA 3TZEA 3CIFA 3KBOA 1P2FA 3T35A 1W34A 1UQRA 1Y1KE 1R50A 1TW2A 2PT7A 4IHJA 1WZCA 4QHYA 4C0BA 4E15A 2C29D 1XXHA 3NGXA 4FI3C 5EJ9A 4PCAA 4ZCIA 5KKAA 2YXEA 1IIBA 3GEGA 5K3SA 2BGUA 1XYVA 3DOJA 1BVUA 3QJGA 5JNSA 4YRGA 4F3KA 1BA3A 1ESZA 3STWA 3H1GA 5LIPA 1G8KA 2RHOA 3JASA 4YJDA 3DFKA 5IBCA 4B3GA 4NF2A 2Y05A 2YWBA 2IWRA 1CJKC 5EE3A 2R4TA 1USGA 2FP4B 4CRWB 3M4NA 4WA7A 2E2WA 1GA1A 2IP2A 3RT9A 1FF9A 3BH0A 2O8EA 3ITEA 2GSDA 2FSHA 4BHTA 1RZ3A 4AJ2A 1F2UA 1DTEA 2RI1A 3O8NA 2G28A 4KXWA 3KEGA 3CBQA 2NSYA 2DCMA 2WD7A 4DV7B 3OPYI 3R9WA 1EDOA 3O31A 4WCVA 2EFJA 2GCEA 1KU6A 1SM4A 2EX4A 2MINB 3FOFC 1PGJA 1YHZA 1NN1A 1OT5A 2HF8A 2VJOA 3CKKA 1PTJC 4W5JA 1M5UA 4CLDA 2CDAA 5C8YB 4HQ0A 2HA4A 3AB7A 1X14A 1GOTA 1YI8A 2H6EA 2OWEA 4LHYA 3LWZA 3E61A 5JARA 5CYFA 1XI2A 4UNRA 2N3ZA 3GARA 3KHTA 2I54A 2X41A 5C35A 4MS3A 5GAJA 1PNOA 1EHYA 4GOMD 2IPLA 2DEUA 4QYIB 5A4AA 3KKPA 4I50F 3ZTWA 3AVWA 4OPMA 4WLOA 3TCNA 2A92A 5DSXA 4MRAA 3W6NA 3RVBA 3UWDA 4FDLA 1EP1B 4YH1A 2BGNA 1MAVA 1DO8A 2F1OA 2A9PA 5HMMA 4ZEOA 3ZV7A 4D5EA 4JYZA 2M6SA 3EGOA 3EQ8A 3TW6A 3GA0A 4IGKA 3OZSA 2DPGA 3UMCA 5A62A 1E2QA 4NP6A 3RASA 4EM6A 2ICAA 2W2LA 4GEGA 4HSEA 2GH1A 5IZCC 5MN5A 3GD7A 4OQMA 2IEYA 3UWSA 3GCWA 2C8KA 5MN4A 5F5XA 4U7DA 5FUYA 5I4IA 4OYRA 1XQ9A 1YFKA 3LQ4A 4LDAA 4OREX 1G5TA 3RVDA 1KJ9A 4PO8A 4F2GA 2A7QA 2PZEA 1G1MA 4FE3A 3SBXA 3L6UA 3T1OA 5DGDA 2AXEA 1RQGA 4D8UA 4C76A 2Y77A 3BQNB 3OOJA 4QRHA 2R4UA 4ZOAA 1DQNA 1U3UA 1FOEB 2H18A 2KE5A 4D4MA 4TVKA 4TKZA 4D6YA 2BFPA 3JAWB 3K30A 4BE4A 4WEQA 2QMHA 3QU2A 4LOJA 3I2GA 1ZJ6A 2KM1A 1WHSB 4IGEA 3R7DA 2EWWA 2ZI4A 2BFEA 4YRTA 4Z3OA 6ABPA 5FFNA 5JRDS 3HS3A 4WW0A 1ANKA 4XYMA 1M75A 3C4QA 3KWJA 5EP2A 3G0DA 3C1TA 1Z0AA 4MWCA 1BS2A 1NZJA 4PSUA 4IGIA 5EKXA 3PUYA 4BVJA 5K8JB 3SYNA 2WWWA 4M3NA 5A5FA 3IESA 1J1ZA 4H6XA 4U7HA 2O3QA 1V4BA 1V0JA 1WY5A 4FU0A 1COWD 1PFGA 4J4TA 3UW3A 4Q16A 4ALNA 2YVKA 5TLSA 1KKMA 1UBLS 3GAAA 5FOTA 1K6MA 3BZUA 4HWOA 1PKEA 4M1MA 5C5DA 4DR1B 1Y5NA 2PL5A 5IN5A 5EZQA 1N8KA 5TV2A 4C7BA 3NHUA 4JXZA 1K3TA 2R48A 3P9RA 3CLKA 5F64A 1P1BA 3RNLA 4KWTA 1LDNA 3IKLA 4MAMA 3UV6A 3MWEA 1YQXA 4JI1B 3BF7A 1CRWG 3IEXA 2RHMA 1MX1A 4IV5A 5IDWA 2IS6A 1TC2A 3QFFA 2CYCA 3HHPA 4GYKA 4L6CA 1MB9A 3EEYA 1CNEA 1KE1A 1YKFA 2V1XA 4KPEC 4S2UA 4O4HF 2X0NA 3U0VA 4E1VA 1Y42X 2J09A 5AKZA 2O8CB 4AK9A 1P2TA 4PXYA 5M5BA 1C0EA 3DQQA 1FBTA 4WNIA 2X9QA 4QSMA 2B36A 1G64A 3MCTA 2X6RA 2I9KA 1SJ9A 5FF9A 1B8OA 1T3ZA 3K0FA 3CO0S 2HDOA 1EM8B 1SAYA 2QTNA 4C6TA 1W47A 4J0HA 1A8HA 5B3JA 3WK6A 3KSDO 5ALEA 4GRAA 4KQFA 3BIFA 2B2XA 1GR0A 1DJNA 4RJIA 3TGLA 1YRWA 3JX9A 1DLIA 1IM2A 1W85A 1NVWQ 1SIWA 2QTGA 1L7EA 3BMQB 1KMHB 3C74A 3AEQB 1NMSA 1VPLA 1NULA 3NP7A 3X2FA 1ODKA 2NXEA 4OI1A 4L1KA 4LNAA 3Q7EA 4CTNA 4LQDA 1JA9A 1OAKA 1K1EA 2RC6A 2QX6A 3LLSA 5DE3A 3U3JA 4CM9D 3CLHA 3JQ8B 3K4HA 4KMOA 4OYHA 3O9MA 5DYIA 4I55A 5KOIA 3TOSA 4PN7A 4D3SA 4R8SA 2BT4A 9MHTA 1COZA 3LAWA 3GLFE 4QECA 3V7UA 1CZKA 4PZLA 1LQ2A 5JCZA 1ZRMA 1UDCA 2BOVA 4NCXA 3IEUA 4YK7A 4RK6A 3CH7A 3ZBQA 1KZYC 4QT0A 1W88B 4DQVA 4G5HA 3LDFA 5K6RA 2VP9A 1OBFO 5JFOA 2PGIA 5LNK6 1FFXA 2E4WA 2W4MA 1H6CA