1YQQA

Escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
QFSHNPLFCIDIIKTYKPDFTPRVAFILGSGLGALADQIENAVAISYEKLPGFPVSTVHGHAGELVLGHLQGVPVVCMKGRGHFYEGRGMTIMTDAIRTFKLLGCELLFCTNAAGSLRPEVGAGSLVALKDHINTMPGTPMVGLNDDRFGERFFSLANAYDAEYRALLQKVAKEEGFPLTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCDLKVVAVSAITNMAEGLSDVKLSHAQTLAAAELSKQNFINLICGFLRKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Xanthosine phosphorylase
publication title Escherichia coli Purine Nucleoside Phosphorylase II, the Product of the xapA Gene
pubmed doi rcsb
source organism Escherichia coli
total genus 81
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yqqA00
1QE5A 4DAOA 4WKCA 4TXJA 5CYFA 3DJFA 5CCEA 4L5CA 2OXFA 4F2PA 4TS3A 4X24A 1CG6A 1K3FA 3FUCA 4I2VA 4OGKA 2AI3A 3K8QA 4L6IA 1PR5A 3PNPA 1Y1TA 5EFOA 1RR6A 4R31A 4L0MA 5F78A 2A0WA 5F7ZA 1Z33A 2HN9A 4L5AA 5B7GA 1PWYE 3OZEA 1V48A 4G8JA 1K9SA 4NS1A 4OJTA 4MCIA 2ON6A 1T8SA 4EB8A 1ULBA 3KUKA 4JOSA 4NSNA 4D9HA 1U1GA 1I80A 3OOEA 4QEZA 1U1FA 2BSXA 1OUMA 1OTXA 1TCVA 4OEHA 1CB0A 4TS9A 4TXLA 1VHWA 5JPCA 4DAEA 4K6OA 1PBNA 1T0UA 3D1VA 4MARA 1G2OA 3EMVA 1V41E 5DK6A 3DP9A 4BMYA 1JDTA 1N3IA 4JWTA 1JDSA 1ULAA 2AI1A 1VFNA 2QSUA 1Y6RA 4TTIA 4GKAA 3UAWA 4KN5A 3P0EA 4QARA 1ZL2A 3K8OE 4OF4A 4G41A 4YO8A 2H8GA 1XE3A 4WKBA 1TD1A 2P4SA 3KHSA 1Y1SA 5B7NA 3DF9A 2HSWA 1M73E 1RXSA 1JDVA 4WKNA 1TGYA 1C3XA 3OCCA 5B7QA 2IQ5A 1T8YA 3PHBE 1YRYE 1T8RA 3O4VA 2AC7A 3EUFA 4NY1A 3E0QA 2HWUA 3LA8A 1RYZA 3SCZA 3C74A 4TYMA 1V3QE 1PK9A 2ISCA 4GLJA 1SQ6A 2PGAA 3UT6A 4F3CA 1Z34A 4TTJA 1VMKA 4WKOA 1K27A 4MCHA 1YQUA 1PKEA 1WTAA 1Y6QA 2A0XA 3BJEA 1JPVA 5CXSA 4RJ2A 3IEXA 1Y1QA 4LDNA 3INYA 3DPSA 5F76A 2I4TA 2QTTA 1JDUA 1Z5NA 4DA6A 1A9TA 1OTYA 3MMSA 1Y1RA 3KU4A 1OU4A 1LX7A 4TXNA 1SD1A 3KVVA 2Q7OE 4EARA 1Q1GA 1A9PA 1VHJA 3BSFA 3QPBA 4GLFA 4TXHA 2QTGA 3UAVA 4QAQA 1V45E 1PR4A 3NBQA 1OVGA 5KB3A 1SD2A 4LZWA 5IFKA 5F73A 3OZCA 5IU6A 1A69A 1ECPA 4PR3A 1B8OA 3BL6A 4YMLA 5EPUA 3FNQA 1PR0A 4QATA 4TTAA 2I8AA 1NC3A 3EEIA 4OY3A 4JP5A 1RT9A 4QFBA 5B7PA 5CCDA 4F1WA 5EUBA 4WKPA 4D8YA 1NC1A 3TL6A 3LBAA 3BGSA 4D98A 3P0FA 4E1VA 3E9RA 1RSZA 4D8VA 1PR1A 1PF7E 3OOHA 2HRDA 1PW7A 5CYGA 5CXQA 4DA8A 3NM5A 4BMXA 4YNBA 3GGSA 3ODGA 1YBFA 4DARA 1SJ9A 5F7XA 3LGSA 3NM4A 4OGLA 1YQQA 4M3NA 1JYSA 4DA0A 1Z5OA 1ODKA 1V2HE 1Z39A 3IOMA 3FB1A 2QDKA 2OC9A 1JE0A 2OECA 3DDOA 4U2KA 3KVRA 5F7OA 1ODJA 1Z36A 1RXCA 4QASA 3OPVA 1A9SA 4D8XA 1RCTE 3O6VA 1B8NA 4F2WA 3UAXA 2AI2A 4BN0A 4BMZA 3KVYA 4IP0A 1LV8A 2A0YA 3F8WA 4P54A 1JP7A 3ONVA 4LKRA 3FAZA 2A8YA 1A9RA 1U1EA 5C80A 1Z5PA 4PNPA 3FWPA 1U1DA 1U1CA 1LVUA 1A9OA 1NW4A 2QPLA 4ECEA 3OZDA 4YJKA 1Z38A 4R2WA 4LNAA 1RFGE 1RXUA 1FXUA 1TGVA 5FAKA 4G89A 4F3KA 2B94A 4M7WA 4DABA 1PR6A 1T8WA 1PK7A 1JDZA 1ZOSA 3E9ZA 3EUEA 2OC4A 1RXYA 3NM6B 4GMHA 1ODIA 4R2XA 1YR3A 4TXMA 3FOWA 3GB9A 1Z37A 1TCUA 3OF3A 5ETJA 3MB8A 3PHCA 4DANA 4M1EA 3UAYA 4H1TA 3UAZA 1PR2A 3OZBA 3T94A 4DA7A 5F77A 1Z35A 2GUWA 1JE1A 3U40A 4FFSA 2RJ3A 4L5YA 1A9QA 4LNHA 5F7JA 1ODLA 2XRFA 5K1ZA 3PNSA 3ENZA 1OV6A 1V4NA 4UC0A 5I3CA
chains in the Genus database with same CATH superfamily
1FJHA 1TJPB 2Q45A 3OBIA 3PSAA 4MH0R 3H18A 4LYDA 1WMAA 3UUWA 2V65A 1T9BA 2OHIA 2RHGB 2YJ5A 1I6KA 5K8UA 3RASA 2Z4RA 4M87A 1KQFA 4MA0A 1DIBA 5JMWA 4CDGA 1TDJA 5JYCA 2J87A 1B0AA 3JCZA 3LWZA 1PS8A 3Q2IA 4MKZA 4B76A 4TUYA 3IO3A 2SBTA 4E51A 2D1QA 3RC3A 1EGHA 4OFZA 2ECPA 5FUBA 1VTKA 3H84A 5K09A 1AHIA 3KKMA 5DGDA 1GD1O 2XUOA 3PYLA 5K7SA 5B3LA 2YXLA 3BMQB 2IZ5A 2QX9A 1U2EA 4JYCA 1XRJA 4CEHB 1CYEA 1Y1TA 4EOGA 1NVDA 4PC7A 3TZHA 1OC4A 3G8CA 2P9QA 2WK1A 3L7YA 2FF7A 1NXWA 1SCBA 5DTQA 2QRLA 2HO5A 3GLQA 4KI0A 1EPUA 2QYOA 4Z2YA 1L5HB 3UM9A 1V6AA 3C6YA 1H69A 1RKVA 5DV9A 1ZP6A 4C0LA 3LPMA 4MGEA 3ZBQA 2FPWA 3PQEA 4DXAA 4ERNA 3RC2A 3WI7A 4HNVA 4YUAA 1ZPDA 2JFNA 1GQYA 3QRWA 4G8JA 4UQPA 1H2EA 3D6NB 4BATA 1ADCA 3W6UA 3LVRE 4IM7A 4H7KA 1WXDA 2AYYA 4CBVA 5A5FA 4CIYA 3UBTA 3MJCA 1HNXB 3PFIA 2ZUBA 3EA4A 1Q14A 4WY8A 2Y6VA 3TLJA 5C5IA 2DHEA 1VJCA 3URKA 2HMUA 1JXAA 3F9CA 4AO6A 3MLBA 3E18A 3HM2A 3P2MA 3UC9A 1WMDA 5A06A 4BNDA 3QY9A 1U4OA 2J9YB 1BGWA 4JEMA 4RPCA 3N87A 4KVFA 1E2IA 1U2DA 3KFXA 4N4AA 4WWHA 3LKDA 4RD4A 4AY3A 3GVHA 3IR6A 5TMEA 5K8IA 1BYUA 4C2UA 2YMPA 1WRBA 2ZVPX 2YMMA 1D1PA 3PC8C 4BMPB 4BEVA 3UAOA 1NX6A 2GASA 1U1FA 4LBVA 2VF7A 3C15C 3TTTA 1KMHB 4JDUA 1KYZA 5G40A 3SWWA 2G63A 4DIMA 2X3UA 1IN4A 3PEVA 1EK0A 2IGTA 2CL0X 1TRKA 4MAFA 1QPZA 5IHXA 2HW8A 5KTNA 4B6GA 4L2IA 4YRTA 4F8JA 4X41A 1ABBA 1E1QA 5IT0A 3AUSA 4O4HB 2WFZA 5LBIA 1J0AA 1ISPA 1ZEMA 2H7VA 3BORA 1VHWA 1GTL1 4M8SA 3EIEA 2FUEA 1N8NA 3HSKA 1J90A 1G60A 3QELB 3M5PA 4UM9B 3C3BA 4IIJB 2C3UA 5IKPA 4IUYA 2OYCA 1RWPA 4YUXA 3AEKB 4O4IB 1KP2A 4R1UA 1IG0A 1XCOA 3FKSD 4DMFA 1SHKA 3ZV4A 5B30A 1Q50A 3GLFE 2W2LA 3REQA 2BCGY 3TNDA 3QEAZ 1E1NA 1LC0A 1S89A 1XYYA 3B1FA 4I1YA 3P26A 1VGQA 3KS9A 3MD9A 4XVRA 1RQPA 2ALJA 2CE7A 2G1UA 4K81B 3I9MA 1DU4A 1QRTA 3VR0A 3U9TA 4BXOA 1GTVA 5A03A 4J43A 3I34X 4GIBA 1P1BA 5E6RA 3B82A 1DQRA 4XM2A 2XZOA 3A6PC 4PG5A 3NMUF 1IB6A 4IH4A 4W1PA 5EOVA 4YR7A 3RVNA 3F5FA 2F48A 1P3DA 5KQGA 4NMLA 5E4FA 2XUZA 3RSOA 3ZKWB 3NVAA 1TQ4A 2R6JA 2IXGA 1P4AA 3C3JA 1O1YA 4US1R 1PN3A 2HT6A 3UAWA 5EJ4A 2OEPA 2H1LA 1A76A 3N8DA 3P0JA 4Y6RA 5D3ZA 4BQEA 1J7KA 1VL2A 1O5IA 1NX9A 3S5JA 4A0GA 1M34E 1ATZA 3I83A 4O25A 5E4YA 3W7VA 4MNTA 4OA5A 4XIGS 5IJWA 4GDFA 3I5UA 2W2QA 4GWLA 2IXEA 5FQNA 3FCUB 1G5PA 4YO8A 3TTSA 4BB9A 4E5DA 3OLXA 4EPXA 5I7HA 1X1TA 3D64A 4J1NA 2HV8A 5L9AA 3ORRA 2IPMA 1N75A 2JW5A 3LDAA 2C95A 3QUAA 4XD2A 5P21A 3VHQA 5L3QA 2W4IA 2YQZA 4H7FA 3N6RA 4JA0A 4JR1A 4MB6A 3E6AA 3HGMA 4XDHA 3DKIA 1OB2A 4Z1OA 3K0CA 4Z0NA 1R6BX 4BFSA 3NETA 4UZSA 1XN4A 1CE8A 4HDMA 1GZUA 4B7AA 2HSEA 4U9UA 4YRDA 1I2BA 2W2PA 4KGZA 1NMXA 1J2RA 4HSEA 2XE8A 4WKNA 1X7YA 3NRBA 1C3XA 5DCYA 2GK6A 2QLJA 3ZGYA 4EPYA 2UYHA 1EGAA 4TM7A 2V74B 3X2SA 4BVJA 5KU7A 3TKLA 1E20A 3BICA 3FYUB 3KKLA 3QMPA 4Q5IA 5IJZA 5J3JA 1ZN9A 1OBFO 1GZHB 1H8ED 3EUFA 4ID9A 4BCDA 4RCZA 1V7QA 2CXTA 2OP1A 3WIDA 4HLCA 4HUQA 3MUOA 1ZHHA 2I7VA 4K87A 4NP6A 3ZZUA 1QSGA 2P2CA 1I3CA 3RFTA 1WXIA 2E9SA 3LBNA 3VKUA 2IITA 2WAMA 4CN9A 1GLVA 1B42A 2BI8A 4N3BA 3PTAA 3HKEA 3RYIA 5DGIA 3ZWXA 3FNHA 2PL1A 3JY6A 4L4XA 4LGCA 4PZYA 2AQKA 1XP5A 4I1UA 4O59O 1BKDR 1GG8A 3BTSA 1GNQA 1MXFA 3HN6A 1SCDA 3T5GA 2G07A 3BWEA 5CAEA 3IA2A 1ZR2A 1E2JA 3HBMA 1N4DA 3UWPA 2ZPTX 4X9XA 1Z34A 4P92A 1UKEA 3WYDA 2L17A 2PTGA 1N2XA 2YMQA 1A7JA 1NBWB 2FU5C 1R6VA 5I9SA 4DPLA 4EF5A 1MZVA 3D54D 1FNCA 5JWRA 3OHSX 2VXYA 1LPNA 2WVHA 1WUKS 4OBBA 2PLWA 2Q5EA 1EX1A 3P4XA 2Q5OA 5TEVA 2C7PA 2Q0QA 4WNAB 2MSEB 1QYWA 2FMXA 2GCOB 3X1DA 1WL8A 3IKMB 3A31A 4ZMSA 1QP4A 5J5AA 1WUTA 2IDKA 1BMTA 1S1CA 3N2YA 1KC3A 3GA0A 4HFMA 5C8YB 1R4MA 3R3VA 3HE3A 3S70A 3WWDA 5KNCA 3H5WA 5C32A 3CGGA 1TKCA 3FMGA 3GLHE 3Q6MA 4RYDA 1KYWA 2HC9A 3H0KA 4WDQA 3RT9A 1QPGA 2DRIA 2XDQA 5GM2A 2HK9A 5DFAA 3PCXA 5JPIA 2WVAA 4LHEA 4W7HA 3ADPA 1VP3A 2I55A 4EARA 3I61A 1MB9A 3O4IA 1U0NA 2X0FA 2QTNA 4QOGA 3H0EA 4U8GA 1TEXA 1F7VA 1I4WA 1DP4A 1XLWA 2DBRA 3KE8A 2PEYA 1SQ5A 4LZNA 5EL0A 5KYKA 2XOEA 3E4DA 5F64A 1NF9A 3NDJA 2AT1A 1KDRA 2KE5A 1ACMA 1GUAA 1M7HA 2W0MA 4I08A 4DLNA 1SHZA 1MH9A 3CEAA 1ZFNA 3CMCO 3NV7A 1SBTA 4P22A 5T6MA 1W34A 1GNLA 3OG9A 3STWA 3GRFA 4GPZA 2EBFX 3ZGNA 1I1OA 4QBIA 4YMVA 1T1IA 1JIJA 1YOBA 3MJVA 2WM2A 3CW2A 3DTVD 1CUDA 4FEAA 3ESXA 3L8ZA 4PR0A 5DISB 3O74A 5IFKA 2YYZA 3EFEA 3CBGA 1H2YA 3NKFA 3OZCA 5FUVA 1A88A 3DMFA 4A2PA 5A1TA 2Z5VA 4I1OA 4XUCA 2GX6A 2OAEA 2R62A 2YXDA 4OHUA 3CUVA 1XKXA 3KB8A 4X45A 3VZSA 2PKCA 2WVJA 3D4LA 3IP1A 4FOOA 4Q00A 3X43A 3NHUA 1XDBA 3TVDA 1MZPA 3H2YA 1KTIA 2FSPA 1K89A 1O6CA 4JCCA 1XCGB 4E88A 4N41A 4IIVA 5FNVF 5G1PA 3RB8A 2O2JA 1SU7A 4W5RA 3IERA 1F8XA 2C9CA 2NU9A 4HD8A 4N9QA 1QF6A 2H5LA 1BRTA 1Z6GA 3V46A 2PKWA 2GZRA 3E1SA 3ENKA 1VBNA 2FCAA 1I10A 3MTGA 3SS7X 1XPUA 2I9PA 2ZRLA 4WXPA 5CBPA 3NB0A 4OL0A 3AFHA 1SB8A 1NBME 2Q5QA 3FWHA 3ND8A 4JKIA 5B7PA 2AD5A 1GAWA 3WL4A 1I94B 3I72A 3QH4A 2V58A 1SVIA 3KLMX 1EX6A 6REQA 3G2HA 3C14C 1R4NA 1NQAO 1NYQA 1F60A 1G42A 3CEMA 2ETVA 3H2IA 4Q9LA 5MFZA 4MQUA 2GWRA 1E79D 2BMEA 2DWQA 3BGSA 4AYXA 1AQJA 4U7DA 1WR8A 2FKAA 4U9IS 3A1SA 1WSDA 1TKAA 2OZPA 2I99A 2QZSA 3AB7A 3G1WA 3R4VA 1GYQA 1LSJA 1QK4A 3MWYW 3RFXA 3J7AC 5JI2E 3E3OA 3L4BC 3R0ZA 3CM0A 4JSRA 5FTLA 3FLEA 1PU2A 4WQMA 2G9NA 2X0RA 2QRKA 1WAMA 1MRNA 3DNPA 3IAS1 1DUVG 2JGLA 1E9RA 1R5OA 2VDJA 3E5NA 3GI1A 5AJWA 2D8MA 1W29A 3EG9B 1RJWA 1C3JA 2XUJA 3LCJA 5DM0A 4CDMA 1SC9A 4W5TA 4JUBA 3R20A 4RMIA 2CFSA 2G8NA 1OYVA 2IV7A 4BMCA 4M1SA 1I14A 4JI1B 2P91A 4Q3DA 2FR8C 3FNIA 1BRMA 4D8TA 5ENVA 2GM3A 2JGAA 3A6GA 1P17A 4G3XA 1ZD9A 3BD9A 4RH3A 4TKVA 2CLKB 1ILEA 2BM9A 1CEQA 1ODFA 3O03A 4V03A 4YMTA 1SXIA 2B2CA 3KTAB 2APJA 1DI0A 4CM8B 3T5PA 1N36B 2DKOA 5IKMA 2OC9A 2GPWA 4Z1MA 1RWKA 4C0WA 2P6PA 4AKHA 4GSLA 1KJWA 1GZ6A 3ONDA 1HRDA 4X3CA 5E6SA 3VHRA 3PZBA 1E8DA 3MF4A 1MJGA 2YX1A 3PX2A 3L02A 4WOBA 2I03A 2G06A 3RC1A 4YCCA 3TJZA 2C3OA 2PX3A 2O5EA 1U02A 1K5PA 2PSEA 3PP8A 3T1QA 4YRFA 5FL7D 4J0DA 2WEKA 2QN6A 3SC2B 2VBIA 5GP1A 2QJRA 1QIIA 2BTEA 4ZT5A 1TPYA 2HLDA 1NQ5A 4W63A 1B8NA 1XRPA 1JJ7A 3TLYA 3OIUA 4COOA 4DQDA 2VZ8A 1CUSA 2PT7A 3U4QB 4A8PA 1IBCA 3KL4A 2WU3A 4A8JA 1QVWA 3IESA 3O1HB 1OWNA 1W87A 3JXEA 4WBNB 3ONEA 2V7EA 1ZMXA 3EMKA 3IUBA 1QAQA 3NHYA 5CNMA 3U3OA 1XMIA 4MV8A 4MYTA 4XB1A 1J39A 3TLEA 3LHFA 4NARA 2RHRA 3DOIA 3B6JA 2VBGA 2WKPA 3GPIA 2VJMB 3OUZA 3M4NA 3G2MA 3R0VA 4YMSA 3TCKA 1TC2A 1X7GA 2MYUA 3FPFA 3EC2A 5I5GA 5JT1A 3UUEA 1AT1A 4OX9Y 3HYLA 3NBAA 3NPMA 2H2AA 4IIJF 4NJMB 3JD0A 1IBSA 3BFJA 4RH0A 5K0LA 1A71A 1AN9A 2RHLA 3D6AA 4O4IF 5D2CA 1O6GA 3F3YA 3GP8A 1GCOA 4AP6A 1QV6A 1SC4A 2MJLA 2H2IA 2PA3A 2OCGA 4PLWA 4LGYA 3VU9A 2OBYA 3AESA 1IJEA 4Y2QA 5C2JB 3TSZA 4FE7A 2PH7A 1QGUA 1T9GR 4Q1CA 2Q4OA 1AF4A 1QGOA 2DJIA 2ZUDA 3JYHA 3Q2OA 3ZY3A 2IYLD 2CNLA 1KO5A 3KZOA 4IKEA 5AHRA 2WB4A 1DGQA 1XVAA 4CM6A 4EHNA 5T6BA 4W5NA 5UKDA 3QXJA 3RC7A 3KOXA 1J6UA 5ALYA 3UOWA 4UBLA 5JH7B 5FLXA 4CEJB 3GL9A 4PNHA 4B4UA 2Q5HA 2QRHA 2HXYA 1Q0TA 1YI1A 1V43A 3ZHZA 2HSJA 2ZJBA 1P91A 1JH8A 1JLSA 3H4TA 4P3YA 3K4HA 1FFXB 4KO4S 4BNLA 1Z5WA 2FQQA 2Z08A 4ZPJA 4DZTA 2YOHA 4Q1DA 2W6NA 1WF3A 2JFWA 3A36A 1NJ8A 1HOTA 3VJLA 4R2XA 4QGGA 5E7JA 2ZJ5A 3RIHA 1P7YA 1YASA 1L8QA 2A6PA 1XZKA 1AUVA 1Y6JA 2PXHA 2V7QD 4OM7A 4OFWA 4DRYA 5JNTA 1K75A 2BKEA 2A58A 1NVVR 3QSGA 4FYJA 1DPFA 4RD3A 1RJFA 1SZDA 3D4PA 4PYJA 4NQRA 3WL6A 2IH2A 5D6OA 3L18A 4PY2A 2UZ0A 4G85A 1YVEI 2XKBA 5BSVA 5AW2A 3GFRA 1M0EA 4JODA 2EX1A 1W4BA 1VBMA 2H1IA 2NV6A 3M6VA 4OOFA 1DMRA 1FP4A 1HM5A 4GBJA 1V71A 3TE7A 1XF9A 4BWGA 3QF7A 3EXIB 4FFSA 5GZ1A 2IVFA 3ZXIA 1Y3IA 4O1IA 4ER6A 1Y9JA 4G4SO 2QRZA 3EA5A 3PWZA 1A9QA 1XPOA 2FPIB 1II8B 1LVGA 1GA6A 1KFKB 3N9IA 2B3DA 4D43A 1ODLA 4NYJQ 3QX3A 5DBIA 4PXYA 4LMBA 1JEQB 1Z73A 3DONA 2W5UA 4OHRA 1H1LA 3QGMA 4H59A 2BE7A 1PEAA 5KZMB 3E9EA 3UKJA 2CD7A 3I04A 2W8BB 3BKXA 5K51A 4RENA 4IEFB 1OSNA 3IEMA 1FZTA 4OK3A 2BP7B 3OA2A 4UEKA 2I22A 4CHGA 2PSJA 1S9HA 1IN5A 1LK7A 4E2WA 1V6SA 3T7IA 3P0RA 1F6BA 5JJIA 3JZFA 2DH6A 4RPHA 4RJTA 2BJWA 4X8LA 1SBZA 2IDJA 2IHUA 3LI2A 4I2VA 1NTRA 2C61A 4TTQA 5IAJA 3CE6A 2ZR9A 4H4CA 3NBYC 2IBSA 1K8YB 2GYUA 1KY5A 1H2FA 3A4IA 3GGPA 1CS0A 1X3LA 3LOPA 4FX2A 3CWQA 3P4UA 4QLBA 1LFAA 1LJLA 5C8YF 3HZOA 4QYIB 3VH3A 4ZK2A 9LDTA 3J81A 5F78A 1IN1A 4E22A 3DHVA 2BHTA 4R0MA 4DA4A 3TVTA 1XF1A 2A14A 2VDVE 3H19A 2AQHA 3X2FA 2GCEA 3I6BA 4JBXA 2O0KA 2P4EA 2JI8A 3U1VA 1NVUQ 4TLEA 2V7WA 2LUOA 1A1SA 3IMGA 4D4IA 1NYTA 1EQ2A 2IU6A 4DLBA 1G21E 1QQAA 4KPUA 1E1RA 1IY8A 1WE2A 1G8GA 4HAUA 4DPKA 1V48A 3TQFA 3I52A 5A2QA 3H1AA 1BHSA 3I05A 2PG3A 3INTA 1YQXA 3LCMA 4XSGA 3OM8A 2HWWA 4KXVA 3NI2A 4IG9A 3EISA 1AXGA 2E5LB 1YZYA 3FPBA 4M0KA 5EYPB 4KQ6A 3OPXA 4DIKA 3U60B 3SIRA 1M6EX 4ZYWA 1TK9A 3L1KA 5KJCA 3AR4A 2BOVA 2JCBA 1YKSA 3B89A 2PGJA 4JR0A 3CONA 3PTZA 4HEHA 1FSGA 1K8XB 2H29A 3KUKA 4TLCA 4BO6A 2C9MA 3M6XA 4KHPB 2UDPA 3ETLA 4MW0A 2REQA 5ERXA 5KJ6A 3FVWA 1JI0A 3T3EA 1WCV1 2BMWA 3HGTA 3ZK8A 5A3VA 3DO5A 2XMQA 4ZOBA 4E4YA 1F4LA 2XQJA 4FM9A 4XXHA 1BE1A 3L0DA 2FRXA 4YK7A 2OXTA 3PF8A 2C97A 4HDKB 1E1LA 4K26A 5IN5A 2GLXA 1VB3A 3DL7A 3OOEA 5KYYB 1DWOA 5CYOA 4QOHA 3CUUA 4A8TA 4C7VA 1P6UA 2XUGA 3V7FA 4CVNA 2P6UA 4DL9A 1KFEB 1NW5A 2HMSA 1TCVA 2QMZA 2Z58A 3C3YA 2IRWA 2ZWAA 3EVTA 4FBGA 3AHCA 4MRNA 5TS3A 6AT1A 3T1TA 3CVUA 3PXUA 2VAVA 2YCBA 4HNSA 1TJ4A 1EDOA 2Y2UA 1T8TA 4IV5A 4QOSA 3KALA 1YZHA 1T6NA 3KD3A 4ZAWA 5ADHA 5HVNA 1HQKA 4IDEA 3USZA 2VRBA 3P2OA 1PZHA 4Z7QB 5K8LA 4IHJB 2VKTA 1YB1A 4IXDA 1B74A 2RKOA 5B2ZA 4D9IA 1Z7BA 3ORSA 1HT0A 1UFKA 3QG1A 4ZVPA 3FTNA 3IEPA 3W9BA 4EUEA 4YMHA 3TIXB 3KJQA 4FDVA 4J0EA 5CTAA 5G0SA 3D6TB 2J0SA 3FSEA 5IC5A 3CWCA 2DYKA 4K6FA 4XVQA 3SC4A 3SHOA 4TYWA 1TZBA 3KJIA 1JW9B 4KMOA 1UDXA 4TLBA 4YJ2F 1E4OA 3UGKA 2HDNB 3KQTA 1JDTA 2WT9A 3NTVA 1KVQA 1JDSA 3COZA 2JGNA 1Z0IA 2KBFA 5TV2A 3GMDA 1QZXA 4G56A 2W2NA 4HNRA 4HZGA 4AO8A 4IDOA 3E22B 1ETUA 4RV5A 1L5NA 2XBLA 2JDIA 3A28A 4F4FA 1JXMA 2PD3A 5JDIC 2PMCA 1EJ2A 4HS9A 1UKYA 1W94A 4TPKA 4EDHA 1OTHA 4N01A 5KHLB 2FRDC 4US2R 1G8HA 4DCOA 2YNMA 2P5TB 4MULA 1T1SA 4UM5A 5HX7A 3EPJA 1E9VA 1T43A 1RLIA 4YAIA 2E85A 2P5SA 3BDAA 2J3KA 4BX9A 1PJ3A 1W4CA 4WACA 5BSRA 2O2ZA 4PSAA 4G41A 3V6MA 2AG0A 3CF6R 1VGRA 1GRQA 2C2BA 4ON9A 3COVA 1WEHA 2GPTA 3K0FA 2QUHA 4XB2A 1WMSA 3A9VA 1T0JB 3CRRA 3IQDB 1A95A 4G01B 1GT91 4EPTA 3D6FA 1CUVA 3ZWYA 1KMCA 5ARBA 3ZWMA 1XAHA 1SFRA 3TB4A 1RXSA 5FBZA 4EENA 2C8LA 1MDFA 3LUFA 1PL0A 1IHXA 2DR0A 1N1MA 2WTMA 3B53X 1KNQA 3G8AA 3LQQA 3NORA 5JD3A 4BUCA 1K97A 3G0GA 3GA5A 4FJ1A 3TL3A 1YS7A 2ONCA 5G3YA 4F8YA 2P65A 3W9UA 3I6IA 3MWLA 4KR6A 1DCFA 1NAHA 1Z82A 1AV7A 1RABA 3GA7A 521PA 2RAVA 4NY1A 4BQFA 1MN6A 3PF9A 4QDKA 1NNEA 4KXQA 4WBNF 2FW6A 5TC4A 3RIEA 4MKRA 3H99A 2COUA 3UFBA 5C5CA 1JKMA 1RYZA 4DUGA 2JLSA 4KXYA 2YVUA 4R40A 5F21A 4JXZA 1O95D 3H9CA 1ZGZA 3C6KA 5KJFA 1PJ4A 1F17A 5TEWA 5SZHB 1MUUA 2BVNA 1KHHA 2NYAA 4YJHB 3UOAB 4XVCA 1YZLA 2R68A 2OLKA 4DCSA 2PGAA 4PG6A 3QUSA 4IDPA 3STTA 2VJYA 3O73A 3V4PB 1TM5E 2A1UB 2CDRA 2FEOA 3C7TA 1CJCA 1GJRA 1UPBA 1Z6PA 2OFPA 2OV3A 3AUYA 2AW5A 1QYXA 2Q8QA 3E58A 1IRXA 1AGPA 3D59A 5EIWA 1GU1A 2ZJ3A 5HIJA 4CKZA 1PZNA 3OQ6A 4UE2A 5DXJA 2VYND 1S8NA 3RRBA 3U3XA 5AUPB 3PPIA 4KQ9A 2A9FA 4X7PA 1Y9EA 3H8WA 1B3RA 3HY6A 1Z47A 3AZPA 4LDNA 3INYA 2C42A 2HBZA 5K0FA 4BDSA 1QZ3A 2DBYA 1QFJA 1WB9A 1FXWF 1N2SA 1UBJS 3HLKA 5A4MS 5FUQA 5JH7F 3CNQS 5DNAA 2C54A 4D80A 1OD6A 2R8XA 4Q37A 4WL0A 2KW5A 2BGMA 3KVVA 4PHTA 2YFQA 4ZAFA 4WZBA 2QROA 3RK4A 3F46A 1YGYA 2C2WA 1D2AA 2Z1NA 5JS2A 3OQNA 4AZ0A 1O9GA 1IHOA 2ENWA 5DNYB 3ROXA 1UFVA 4DDVA 1QX3A 3LA6A 1I1HA 1UAGA 1VIAA 2JJ2A 4DR4B 3D1JA 1FSPA 3EGDA 2Z4SA 3GPBA 3UK2A 3SIWA 3V4FA 3QENA 1EVEA 2E82A 1E4YA 3CH4B 4LY3A 4Y2GA 2L69A 3IMCA 2HH9A 3BWXA 4BKQA 3KAQA 4J3FA 4OYRA 5L3SB 2F8TA 1QO0A 2B3TA 3EEOA 1RLOA 1OGYA 2GF2A 2YWCA 3K92A 2GPAA 4LVUA 5CU7A 5DTIA 2HA5A 2Q62A 3LBHA 4N18A 1D8AA 2JCGA 2VJOA 2YWGA 4BUZA 1KY3A 2VP5A 4QGFA 1IOLA 3KYDB 2ZZKA 1IOWA 2QLNA 4NJEB 4Z53A 2JZOA 2CVPA 2GTIA 4MW4A 4PFKA 4L0CA 1Q0PA 3SBXA 2FDCA 3PJEA 4M0CA 2DPMA 3GP5A 3ET5A 4AMUA 4KIJA 1K98A 4RW0A 5CVTA 4BWVA 4PLYA 3ADDA 3AR9A 4KOAA 4G26A 3ZTTA 5K0CA 1SCKA 2HR1A 3L8YA 1EZZA 2HA0A 5K3FA 4BLVA 1TKRA 4G5QA 1P2UA 4BKMA 1JS1X 2Z8ZA 5KOJA 2YZNA 5I7AA 1RZ3A 5FOXA 1OLOA 1RE0A 4MXDA 3VR4D 1H5UA 3IUQA 1GV0A 4WXRA 1BH6A 3D6MA 3ETJA 4IW3B 1OGIA 3PFGA 1WHTB 5JBNA 1KZ6A 1S5PA 1D1SA 3CRW1 4E94A 3K0HA 4G1CA 3ZBUA 5ILOA 1B41A 2XDWA 1LZKA 2VPQA 5IULC 1EJBA 3QP9A 2ZI9A 3H2ZA 5B12A 1P7PA 1ZNWA 2WSLA 3NW9A 2JJQA 3F7MA 3WQRA 4CMBA 4QKQA 1EIZA 1Z2NX 4C01A 3PVZA 4ZD6A 5HGXA 4UEJA 1DIHA 1P0FA 3GAFA 1EX9A 4W99A 4IDFA 4FYHA 5BR1A 3USES 3ED5A 2WSYB 1FTQA 4XM0A 2FN7A 3PGMA 5FPHA 1NNSA 5HK9A 5M5BA 2XMSA 1NT4A 1SG6A 4FEGA 5HIMA 5JAIA 4C2TA 3I6QA 1P81A 3ZU3A 5DHFA 3BQMB 1ZHFA 2BMAA 1YVUA 2Q5IA 3V6LA 4JHXA 5JSHA 5KUTA 4B6RA 1UANA 1QIEA 1EFKA 3N8HA 4C89A 2PBRA 2X5OA 3HVIA 5J5VA 1GZ7A 3OHPA 5CX1A 2D62A 2OXRA 2HJVA 2JHGA 1GRNA 4OGLA 2CMDA 2BIFA 1P2TA 2ACWA 4J03A 3GMTA 5EEHA 3EHEA 2GK7A 4WTOA 2C99A 2QJOA 5FP0A 1NJ1A 1TMKA 1B16A 2B1GA 1Z5OA 2QAIA 1PT9A 2PUVA 4W5OA 3PGA1 4R2MA 1V1RB 4A1FA 2A92A 4XGNA 1YFKA 2VWHA 4LFCB 1NRXA 1ZCFA 1ZVKA 3BA1A 3HDTA 2CUNA 5H8WA 3S2UA 3VR6A 5CVCA 3KVOA 5AW8A 1CQJB 5EP1A 2WWFA 5AKEA 4CKYA 3KSMA 3TAXA 2AUTA 1KYXA 3P5SA 3T52A 4Z4GA 2XCTB 2B9EA 3DV2A 3HYRA 3LBFA 3PQ7A 3Q5EA 5I9NA 5KWVA 2Y1XA 3A11A 3H11B 2K5UA 3MCUA 4N8SA 1RCTE 3TSWA 2IYQA 2RCNA 4KI7A 3SNHA 2FMTA 1RWQA 2GPJA 4G0XA 2XTZA 3NAQA 4GBED 1J0XO 3HVHA 1ZIYA 3QOYA 4G23A 4EHLA 1IRIA 4XIYA 1PZEA 1C29B 3UHAA 4O08A 1CQIB 4JYAB 4Z51A 3TW4A 4JI3B 3U31A 2RHTA 2GPNA 3HABA 2NADA 2GJSA 2DXIA 1VJ1A 4DVGA 3ONVA 4L15A 3HB0A 2IVZA 2JZNA 3QHPA 2GM9A 3CY6A 2J7PA 5EJ2A 3Q3JB 4DLRA 4DMGA 1DS6A 5ABPA 4EEXA 4ZC1A 1HZZA 3OEEA 4DQKA 4YY3B 3FOZA 1DADA 5AWFC 4MI6A 5E3JA 3KZMA 3TI9A 4C6TA 1PJRA 1UBLS 2ZGVA 3EQ7A 3VSDA 5JQGA 4IHJF 4DM3A 1NBAA 4J2TA 2PVCA 3IAEA 5FDFA 2ORYA 2TECE 4JYBA 1VCNA 5SZIA 4A0FA 3GFVA 4XARA 1F4PA 2FUG6 3QXGA 1JLKA 3SX0A 3X1XA 1DWQA 1C4WA 3K0EA 4OXKA 3HWRA 3Q6IA 4YJKA 1J2UA 1RFGE 4GW3A 4ND6A 1I2DA 1SC1A 1U3FA 2QAGA 1T4CA 2VHYA 3U3ZA 2XEDA 3GARA 5JTTA 4O4JA 4MUEA 4MCAA 5I5EA 3QF4A 3MLAA 1I30A 3LL4A 1GVNB 2I6TA 4NOLA 1BS9A 2I6XA 3ZHYA 3V4RA 3ZN2A 5HF9A 3T3IA 4FDMA 2GBPA 4KO1S 5C53B 3F0TA 1LSOA 1UMCB 4DABA 2HA4A 4IZ6A 5B55A 1UWCA 1OF1A 1OPRA 1ZDMA 2V3VA 2WJPA 3P71T 1UM9B 3PFWO 4BTLA 3THWB 3EDRA 3EUEA 4L16A 4ZJYA 2N1MA 4JA2A 4UTNA 1Y7IA 2MR6A 4LYHA 4QYTA 4LY6A 2GYVA 5F9FA 2ZIGA 2X77A 4GOLD 5HZMA 5ETJA 1B7GO 2X1MA 5EJ6A 2JFGA 1I3KA 2PFKA 1YTLA 4IUCS 5G53C 4ETIA 1AKRA 1UK6A 4OPMA 3RI3A 3ICPA 1T2FA 4B6PA 2OVFA 5AKLA 1YZKA 1TM1E 3V2IA 4KC0A 5HOQA 1NYRA 4FW9A 1VDMA 1DTEA 1GWNA 1SK8A 4OJNA 3DFUA 2E48A 4PHCA 5KO2A 2ZCJA 1E3MA 3SX2A 2HNKA 3BSWA 4DLVA 3A6KA 5KTRA 1DKQA 2JIPA 3CVXA 1RE1A 5DPMA 1KFBB 1N3LA 5EG5A 5LU8A 1OROA 2I33A 1OXXK 4X44A 2R7KA 4E14A 2VH5R 3NR2A 1JE1A 3CLUD 1R0SA 2Y1WA 3DMDA 4LSGA 3UMGA 1NXPA 2DC1A 2HK8A 2NPOA 1O96B 4IQFA 5CT8A 3KR9A 1CZNA 5AW6A 4LYYA 1L5RA 3UB4A 4AP9A 1EUZA 1RAEA 2XMBA 5IBRA 4RKFA 4IOKA 1Z0DA 4EEZA 3NH6A 4JP2A 3R3WA 3DEHA 4P93A 3LIPA 3I2GA 5IC6A 3V32A 3EZ6A 5F9MA 1M8JA 1XZHA 3IBGA 3RVPA 2I76A 4YRNA 1SUAA 4BVAA 3WO1A 3G0DA 2JGDA 2I67A 3A4YA 2OV8A 4WKCA 4GZMA 5CYFA 5H7XA 4GOJA 3PXGA 4EPRA 3MCZA 3A6LA 4YMGA 2MU1A 5KVVA 1XMVA 1UPCA 1L7QA 1NUUA 1IUOA 2RGDA 3R7DA 1E6KA 4G81A 3VU8A 5BWOA 2CZCA 3FI9A 4ZO8A 3EGVA 4CLRB 2FSFA 5L3ZA 1XRRA 3KCNA 4MR8A 1XEWX 4K3UA 4L95C 2GHIA 3DFZA 4QGAA 3EZNA 3G2IA 5AK5A 2P8JA 3DMGA 4ZI5A 4D4HA 3OIDA 5FUMA 4YDQA 5IJ9B 3WGUA 1UMBA 5TQ2A 4CR7A 2IOFK 3ZIAA 1N0HA 3PNPA 4RMJA 2B92A 1SHUX 3UTDA 3TAUA 4BIIA 5CB4A 1H2XA 2XZLA 4YRAA 1SQ0A 1GVHA 2YS7A 3K2BA 5ILQA 821PA 1U7HA 2FSIA 2YXEA 4P8RA 1NRJB 5IYZA 2BZ1A 1NJ5A 2WJVA 4X6UA 1O9HA 3O3CA 3N07A 2OZKA 2QQFA 4QTXA 2C07A 2C03A 4TQ9A 3STXA 2QPOA 2VAMA 3IT1A 1FVHA 2W2VA 2O57A 3HXMA 1SO8A 3LAWA 3AIIA 3MWFA 5DIFA 5BSTA 3HQ4O 3PEFA 5J47A 1A9XA 3FOFC 1Y4ZA 2OO5A 2XA2A 1VCIA 4DYHA 4KFCA 1G5HA 1BXGB 3QVGA 5D5PA 1JLLB 4JUIA 3PIDA 1H6CA 4HH0A 4MRRA 4D25A 2JIMA 4YI3A 4JBHA 4AQDA 3QEKA 3OZFA 2XE6A 2QI9C 4FHFA 3SR0A 5I4IA 4AJIA 3SVZA 1ZY2A 2GBLA 3DO8A 3GUYA 3VU0A 5KKNB 1YNOA 3MERA 4N65A 5J58A 4D56A 5B3AA 2XB4A 3MM4A 3RQSA 4P4SB 1GITA 2D8AA 2BD0A 1X8LA 5HZKA 3BB1A 1ZCJA 2E4VA 1LF0A 3OURA 2A5YB 1QH0A 1AGYA 2DUMA 2RH9B 4ISCA 2CCJA 1OFUA 2AK3A 1SBYA 1F0PA 1QKIA 1V3TA 1YV9A 2VOJA 1JL3A 1U0TA 4U2EA 4WNCA 5SYNA 5T4HA 4GH5A 2Z6AA 2B5OA 2WIBA 1JEOA 5THXA 3T0GA 4ZCSA 3TAHA 4BECA 3EW9A 1UEXC 1QRDA 1E0KA 1O77A 1RIFA 1QAOA 2BN4A 2OCKA 2RSLA 3BWCA 2WQ6A 4J16A 3T5TA 1FU4A 3X0DA 1JMKC 4B3FX 4BLRA 1Y8ZA 1NMEA 4PAOA 3NDIA 2ORWA 4J6FA 3HXTA 4IG4A 4RUKA 3KO8A 2CNWA 4UATA 2HWXA 4GUDA 3UJHA 4BHTA 3HCWA 5BXQC 4XWWA 1OIWA 1M1YA 4K6OA 4QUBA 4X20A 3KQQA 1MJGM 5JU6A 3GRVA 4Z4QA 4RQAA 3M3DA 3JQAD 1R7RA 5SZKB 3UT5B 1EXVA 3IULA 1U0SY 1QG6A 3HYSA 2OYRA 1R9MA 1E5XA 1TIPA 4X3OA 1QU2A 3WNZA 2QTZA 3S68A 3E7XA 1BVUA 1W0KA 4RHCA 3PNLA 4LJAA 1LRKA 4CMIB 2Y76A 4GUAA 5MN6A 2Q1UA 1E3WA 2GZ2A 3DJYA 4Q9IA 4DZRA 4BMYA 1UJBA 5FEUA 3HU3A 3CVYA 4DDMA 1HLFA 1GTMA 1TM2A 3C8UA 4MO9A 5EC8A 4B2IA 3HV0A 1YIAA 4AS1A 4WESB 1WDWB 4XYBA 4C0BA 1KRHA 1T9CA 1OC2A 2OCIA 2B4RO 3F6PA 5E9QA 2X8WA 3LG2A 3SOPA 2X8JA 3FBWA 1JMVA 4EG8A 4FCTA 3TN7A 2G76A 4KN5A 2W6JD 1XMOB 2E49A 4F4DA 3MXTA 5G4KB 3U3JA 2BTQA 2R4UA 1LTQA 4KQIA 2CNDA 3TM4A 4PX2A 2DFVA 1TD9A 5K4AA 2WP0A 2VP0A 2YHIB 2QD3A 5EIFA 3V1NA 5MN4A 3U16A 5DEOA 3TBHA 1XE3A 2HIAA 4HVTA 4I46A 1K0UA 3L04A 4CG2A 2GJ9A 5LLTA 1YR8A 4YCSA 1PR3A 3NIWA 1FXSA 5JSZA 1IATA 1ESCA 4QUJA 2ZBVA 3DLPX 1DAPA 3DTVB 3MA0A 3PBKA 4V0MA 3MCWA 5CG2A 5E7MA 1XA4A 2I2CA 4NH4A 1N3BA 1XA0A 3ZOZA 4OM8A 4DY4A 2WJ4A 2HSWA 3ORFA 5CLHA 4F93B 3QVJA 3R3XA 4TLDA 4Z4CA 3RVQA 2YVQA 3EFBA 3EVBA 5I51A 4CQLA 3MJSA 1ZC4A 4GO1A 4O02B 3ZHXA 2GA8A 2Q0SA 3HDYA 3NTXA 4MUHA 5AK0A 4EPVA 5H9VA 3CNLA 4M46A 1AX9A 4EGAA 5FO1A 2BZSA 1ZMRA 2ONZA 1J25A 3IDSA 4TV8B 4IGKA 4IWNA 4OLBA 1YRYE 3DF7A 4KACA 4M54A 1C9DB 2LXNA 4GOKA 2J3DA 1COWD 2C5FA 2FPSA 3R0IA 4I81A 3IVAA 4LHVA 1GQOA 5IABA 1EAMA 3OCXA 2XQVA 3RV4A 5IEBA 2HWUA 2G9VA 1E8NA 4GXQA 1TA0A 1UJ4A 5CFNA 1UADA 3SS8A 3ZJ4A 5JO0A 4JLNA 5DOZA 3ZXXA 5KEIA 5ESRA 3CB4A 3CRNA 1KRWA 3TX6A 3UPTA 4RABA 2FOLA 2MSCB 3LKVA 4NYMQ 3VC2A 1Z16A 4NNOA 4A0SA 3EC1A 3HB5X 1KE2A 5E2AA 3PXBA 5IXJA 3LRTA 1N33B 1T0BA 5AHOA 5DHAA 3SXJA 4L7QA 4BNIA 3UMYA 5BN4A 1NVAA 4CIVA 5AVUA 4PG4A 2OHHA 2XB6A 2WDZA 1NKVA 2JFVA 3AOEC 3C87A 2BELA 3DXYA 5K3DA 4EW2A 5HKKD 3PGXA 4LE0A 4BMVA 2C4UA 3WV5A 5CFRA 2WI8A 4ITVA 1ADJA 4XD7A 2ZLBA 2BFPA 3AW9A 3GT7A 4EJSC 2DQSA 1XZLA 3ZBPA 1XBTA 1U65A 2RKWA 1HGXA 4B9EA 3B5EA 3D4IA 2JI7A 4FILA 2UUAB 2Z3WA 3IV9A 4F46A 4BMSA 3QVWA 4DA6A 2PWBA 4EIWA 5BW4A 3HYTA 3OZTA 5K4HA 1A9TA 3KQHA 3WSTA 1VE6A 2WPNA 1C4KA 1JVSA 2IU3A 3PVSA 5K3CA 4R1PA 3FMOB 1UQRA 4C7BA 3D81A 3WGJA 1DG9A 5I47A 5I7SA 4R9NA 2ZJYA 4PX3A 1US8A 2PL9A 2I3DA 4A82A 4B0PA 1TTPB 3HCAA 1WZEA 1ULZA 4O5OA 5LN1A 2FV8A 3UXHA 1AUPA 3B20A 3DBRA 4FC6A 5KOHA 4N39A 4NR0A 4QGBA 4CCYA 2ZTLA 3NAGA 5JSFA 1FMTA 1RMQA 1FF9A 1HXHA 1XKLA 1A8QA 3E7PA 5HRAA 3PJRA 1Y3AA 2CXPA 2X19A 1QC5B 3O8NA 4ZT4A 4TLLB 1DMSA 1X2BA 2UZ3A 3UAVA 4PLTA 2UYYA 1SY7A 1Y4AE 2VHXA 2LBPA 4QULA 1OVGA 2BRUA 1DHRA 3MBOA 5HNKA 1MW8X 1L5YA 4JBNA 3D2CA 5K8TA 1A04A 1SUPA 1R0LA 3FSRA 1OKKD 3PB3A 5HFNA 3W2TA 5T7BA 4EG5A 3QYJA 4DBLC 1A69A 2BHNA 3I32A 1TZKA 2CL6X 2EFYA 4R69A 2I71A 3QG5A 3L8MA 3KJFA 4GM4A 4PLZA 3GBVA 4G4GA 4HZIA 4NMXB 1YJCA 2E2WA 4BFTA 3S8EA 5BSFA 4OQNA 3ECAA 1T0PA 1ZGAA 3BXGA 3TPFA 1IE3A 3AI7A 2QF7A 3CX7A 5L7TA 4RTPA 3PCTA 1Z75A 1H8HA 2G08A 4RVDA 5ALRA 2BGUA 5JJCA 2R8RA 3M4JA 3UK6A 4ZA2A 1F4VA 1CEEA 1G6Q1 1QH8A 2CL7X 2LRHA 1W85A 3L7JA 5FO0A 2H4WA 4MO2A 2QT9A 3DEZA 2FZCA 4GLOA 2ZT8A 1ZI8A 2IC5A 1R8QA 4QG3A 1TIKA 2CHGA 2GBIA 3MUEA 2EOAA 1OY1A 2P41A 5JZ9A 3SAJA 4E5SA 1OZHA 1UBHS 4C0XA 2UUOA 2IP2A 4KDRA 4DIUA 2ZRIA 3BHIA 3I0ZA 1GLGA 2IYZA 4C7OA 4B33A 4TN1A 1OX4B 5BQOA 3QX9A 1A3CA 1Z0ZA 4LXTA 2JGEA 1GG2A 4JLMA 4YHBA 3ZV7A 1GGEA 5FBKA 3IJ5A 4QODA 2C1XA 1IHYA 1OGJA 2J9GA 3TPZA 4Y9RA 3TEJA 5HS4A 1IN8A 4BZPA 1MHPA 1PTJC 4MMZB 3SLKA 3LLUA 4DBVO 3RRMA 2IU4A 1BE0A 1JDNA 1XEXA 3KG2A 4ZKEA 1PZMA 3NM5A 3ZCQA 4EF4A 5E95A 1SCNE 1WO8A 1M5RA 2IS6A 1JIKA 1OI7A 2PO5A 2X0KA 1JLHA 3K6SB 1MAHA 2W2KA 4YCAA 2C8KA 4E5UA 4MQMA 1W93A 5AESA 4WLUA 3UA3A 5FKJA 4RMHA 2JJ1A 4FB4A 1PWZA 4MVJF 4ZDJA 4PICA 1U3CA 3K4PA 2Q3BA 3OEHD 2Z5LA 4MQLA 4NRDA 5FBLB 1GADO 1YR7A 2CNOA 1UBUS 5LQMA 5ARCA 1L5KA 5LMCA 3I9OA 1F51E 3DYVA 1MOQA 1SG0A 2Q50A 3JYQA 5IX8A 1B8PA 4L85A 1AG9A 3GZTB 3L4KA 3LKZA 1SHJA 4YXWD 1ECFA 3SMVA 1P2DA 4KN9S 3KK0A 4M22A 5DTJA 5CFQA 1I2CA 1SUSA 4OHFA 3U3MA 1FC0A 2QORA 4RKRA 4Y2XA 5E6UA 2DUJA 5TSDA 3OY7A 1HDGO 1NHWA 5G2OA 1DKLA 1U99A 1M2HA 3TKYA 2XB2A 3PDHA 1NVEA 4HPXB 4ENPA 3JVDA 5CT9A 5GJVC 2FUKA 1JH9A 1K6JA 4JU8A 2YJ4A 1AGXA 3RARA 3AF5A 1BU8A 2B8TA 4PQEA 3B85A 3TBFA 2AI2A 3BBLA 3FH0A 3G68A 3HU1A 4MP8A 3RT1A 3TEMA 4YAKA 2QLMA 1UPFA 3PRYA 3O5AA 4H7PA 4TZKA 4R68A 1YB4A 3C98A 2JLWA 3SQDA 2Q6IA 3QIVA 4IS2A 5E9AA 3ZV3A 2RHBA 1JR3E 3WHKA 3FHTA 1PWEA 3ZGVA 1GPNA 4DIBA 3L7IA 3L1HA 1G20A 2I66A 3W6ZA 3ZWKA 1K5DA 2EZ8A 3C5EA 4WLFA 3KQPA 1TYAE 3D02A 1Q7GA 1GPLA 2ZSFA 3DE5X 5GAJA 2JVJA 4MVJP 1BEZA 2FSVC 4YJ3B 4Y2PA 1A9YA 3QEMA 3H1EA 3KSRA 1UZLA 4BJHB 3KSAC 1MEJA 2NOAA 2CJWB 3IQXA 4CETA 1ADYA 3RC8A 4Y0AA 3B8EA 4UM8B 5GY7A 3SJCA 2PQMA 3COSA 2J31A 3QPVA 2KS6A 1UXHA 3AGQA 3RTBA 2H92A 1WZ2A 1DC7A 5BSHA 1IOZA 1YZVA 4D57A 3UNXA 2P27A 3HNPA 4OBXA 4R2WA 4LNAA 3T54A 1BGVA 1TK3A 5TXGA 3F47A 1VJGA 2OHFA 4UFPA 3GROA 1G59A 1H2BA 2VJKA 1P73A 1OW3B 1GNSA 5ECGC 1O3YA 3O8OB 4CM4B 3JVVA 3LUGA 2NO7A 2FMFA 2MMGA 3F67A 4Z9FA 2BGWA 4F3KA 2ZVDA 3DULA 2EFJA 4XYLA 1PZFA 2GN9A 4TMVA 2QGZA 2VPXA 3B3GA 3N70A 3VFDA 2QBYA 2X5JO 1Z4MA 2V7XA 2C59A 1IFXA 2B21A 4IQ0A 4BNNA 2I80A 4DDHA 1IVYA 2JHPA 2A86A 3OO0A 4L4UA 4UMVA 4TWZA 3VNUA 1JQLB 2ASVA 5LXTB 1TQHA 3P2IA 2NZYA 4LHSA 3MTDA 3B9PA 4GXRA 2E89A 3KYJB 1W2HA 5FOQA 3JQ7B 1ZNQO 2OC4A 4XWTA 1OH7A 2YW2A 2QD5A 2QM7A 3LUKA 1NT2A 2ZB2A 4IKOA 4KLAA 1ML3A 1Y5LA 4MPRA 3AETB 4BP1A 3K3PA 4DY6A 1Z6ZA 2JCXA 2IDZA 1LPMA 3NP7A 1JAIA 2WAOA 2QB5A 4P0PB 2IUYA 4NFYA 1Y8RA 1C5KA 1TAHA 3O8BA 3EFHA 4Q3KA 2P9BA 3B8HA 2HWYA 3H5RA 1YRHA 3I45A 4BBJA 2JF0A 2IP1A 3EIWA 2EWWA 1U04A 1P1IA 1F3OA 3ZYCA 2QN1A 3F6BX 3M0EA 5L51A 1GAQA 4H1HA 4GOXA 5IK2A 4E46A 3WNQA 2AG5A 5A7FA 5HMMA 3THXB 4TV8F 2WNSA 4LRWA 3GFSA 1NXOA 2ZITA 4KE7A 3S7TA 3IP5A 5HZHA 5F51A 4KXLA 4UFNA 1D6MA 1Z7GA 4RF3A 3W5CA 4MVJI 4WLVA 2VP6A 1DKNA 3AH8A 2Z3ZA 1QOQB 3IX7A 2XYQA 4W1SA 4CM1A 3P7MA 3W3AH 3BULA 4XIFA 4BQQA 2IEBA 4EI2A 3OM9A 3D8SA 4PNZA 2NMVA 3N2GA 3H3FA 2FOXA 5FOUA 1Z9BA 2G0TA 2ZQZA 1EDDA 3AUAA 3JWPA 4YRCA 2D7DA 3PFNA 5DP2A 1E3SA 2J5RA 2W2XA 2VT6A 2XSZD 3PWSA 1QE5A 1EDBA 1SULA 4DAOA 1PYGA 2F62A 4JOBA 4YP0A 1D2CA 2ZAMA 4KNVA 4TTVA 2ZI7A 3LNTA 3ZWCA 3ZHQA 4BNMA 4DTCA 3G1TA 3WL8A 3WLPA 1BA3A 4RNDB 2G7MC 2K87A 2IZ6A 1CFZA 2OMKA 3BX1A 4RC9A 4C7JA 1SBCA 1FYFA 3HR8A 4GRDA 1G5RA 4IVRA 4PCUA 4X54A 3ECSA 1MABB 5CDSA 2BFBB 3MT7A 2W6PA 5JLAA 5K0JA 3SKXA 4MUGA 1NBMD 2FPPB 1WP4A 9MHTA 1OA0A 5A05A 1YBMA 3PC4A 4YPFA 1ZVQA 2HOQA 5HG0A 1EWVA 1JV2B 3UIEA 1JKJB 1ISGA 1U7WA 1W9HA 3HCCA 4FLMA 4MVYA 5CXXA 1ZSYA 5KC9A 1TO2E 1V96A 3VBCA 1UJMA 2AC2A 5TT0A 3NTRA 3G8DA 1M8PA 3A6FA 4BBPA 1U28A 3ASYA 4TVOA 4GFDA 1IEVA 1EE1A 3ETGA 2A35A 4A26A 2VPPA 1SPBS 4ZT6A 3O1JC 1XXHB 5TB5A 3LKBA 4J0FA 4DQVA 5GV7A 1A7UA 2HIMA 4Z9XA 4ZEOA 1QH9A 3HJHA 1Q1ZA 3AERB 3DSRA 4PQRA 5I8WA 3QEJA 4X63A 1CRLA 5EUMA 3CC8A 1IAVA 1O57A 3ILVA 1GPH1 4MQFA 3C5HA 4OUDA 2H18A 3D2BA 1YDFA 1L5FA 3TUIC 4FYIA 4MKFA 5BOVA 4BVFA 2F3UA 4XWYA 4PTZA 2ON6A 1B1AA 1RYYA 3AY0A 1XTPA 2EL7A 1VBFA 2RGAA 3I23A 4EB8A 2PVSA 1JTEA 3BIXA 4N3GA 1XDDA 3TZKA 3ZVRA 4MWEA 3MXOA 1ZNYA 2J5BA 1SURA 2VYQA 4JNKA 1Z13A 5AQEA 2QN2A 3BRCA 3LT0A 3M1YA 1C7RA 1MRSA 3MINA 4HLUC 1WETA 1GQ2A 1F20A 4ZAXA 1MW9X 3R1IA 5HM8A 5D00A 1ANKA 3FFBA 2F3SA 2QP3A 2VWPA 2XVZA 3F1KA 3QHQA 1GNPA 4L7VA 4M9CA 4M98A 5CIWA 2GTPA 2ZW9A 5KNDA 1ENZA 3GXBA 2JLBA 3MSCA 4G5SA 3LYLA 2WWWA 3R6LA 1PT5A 2PZKA 3FX2A 4ER5A 1OYOA 5BOSB 5AVWA 4H15A 1S4MA 3KIPA 4QUGA 4CKWA 2BFEA 1BXZA 4WADA 4F6RA 5FUYA 3BH6A 2D74A 4JT4A 3WYGA 3RLFA 1W5TA 3ZDBA 3IAXA 2D1SA 4XPIA 3MJTA 3RUPA 3QFSA 4EG1A 3PX3A 1UDRA 4WXMA 4TL8A 5JCOA 1X70A 2DBVO 2NACA 1GEGA 4K9QA 2GETA 4KN6A 4TMYA 2CT8A 1YA4A 5EHNA 5AK4A 3DOOA 3KXIA 1CR1A 3L8HA 3QUCA 1H1DA 2ZSBA 4NBTA 3H16A 1YS1X 3ZZMA 3WLQA 1I9GA 2EP5A 3SP1A 1GN8A 1NOJA 2GFQA 3ZY5A 1NYLA 3OKPA 4MPTA 3W5VA 2AE2A 2PZBA 3MVEA 1NW3A 2CN1A 3H1GA 1FMLA 1RM0A 4L4RA 1WHSA 4Z3DA 2Z1MA 1FMFA 4YI5A 5DEIA 1KVSA 1TA4A 3ZLVA 1UJ6A 2NTYC 3HBNA 1KOLA 5TQ0B 4PYQA 3R6WA 3GCZA 2IYOA 4NBUA 3HR4A 4NU0A 2O14A 1WA5A 4WCFA 1FFYA 2EKLA 1T1EA 1EVYA 4LBZA 5F5LA 1DAFA 1XAJA 1SEPA 1EP1B 1VPDA 2FLWA 2YVLA 3H5TA 4XZ3A 3FDIA 3SDBA 3FTFA 1RLJA 2PS0A 3ZCTA 3L1VA 2JFUA 4X90A 3SZUA 4IIGA 1CKEA 3AT1A 4FWTA 2GAJA 4QYSA 3VISA 4GQIA 1R0YA 1VYVA 1XHEA 4QARA 1JQ5A 4BN5A 2FEAA 4I0WB 2ZFUA 3G2OA 1SHLA 3B7WA 3S2EA 4GHWA 5BUQA 1AB6A 3M6AA 3TD9A 1JR2A 1E60A 4YR9A 3IBFA 1RZVA 2C5SA 4LZOA 3QTLA 1CNFA 3ZJ5A 2BTOA 1IEQA 3PC2A 1PR9A 1ZD2P 1ZNZA 2OOKA 5KYUA 3ADBA 2K7FA 1I7DA 2CXXA 2VF5X 4K9KA 5EHIA 4ZV9A 2XR1A 4AUEA 1E3EA 1R74A 2ZRQA 2J5KA 2B1RA 4FYWA 3ERCA 1LBEA 5EMMA 3VNBA 3IBCA 3UKDA 3GNTA 3HWSA 4JI8B 1TQ2A 4FQ5A 4L28A 4ILKA 4Y2YA 5HFAA 4ZZIA 7MDHA 3N59A 2I5PO 4J29A 2C88A 5C34B 3WZMA 2BEUA 4QIHA 5GOTA 4Q4JA 2X41A 3W5IA 5AVZA 2DEUA 1AQYA 5ALQA 2V4MA 3GLGB 4D3XA 1ZJ4A 1Z2EA 3KR2A 4W5JA 1YOVA 4KVAA 3G0HA 5FFMA 1UPXA 4NG5A 2OPHA 1L4FA 1V16A 3MS7A 3RU9A 5HFJA 5LZ5A 3AEQA 4AJEA 1VYHA 3NNSA 3EQ9A 1MG5A 3BC1A 3NWEA 1RPJA 4MV4A 2B4YA 3CPJB 3GCDA 3ESYA 2YQ5A 1L1FA 4EABA 1Z2OX 2GXUA 2HAEA 2CL5A 3CINA 4MKGA 4LOJA 3HYNA 4DRXB 3OFSA 1CK4A 3RKUA 4UOZA 4OXNA 2IIBA 4JGBA 3UYKA 3U7HB 4Q05A 1Q1EA 2BFDA 3E84A 3OAAD 3ROMA 4BAGA 3MT9A 2DUUA 1P1KA 2F1HA 3L8GA 4U3JA 4H4EA 2VCHA 5HK8A 3BXXA 3PKIA 3B6IA 1I1QB 4YJFA 1PFVA 1BVYF 2A0XA 2V55B 3D6JA 4G4SP 4J0HA 4LUCA 1RYDA 3LFUA 4X6LA 3TXYA 4ZOLB 3WMRA 2AZXA 1GAJA 4MEJA 3PR3A 3BGIA 5JAHA 3WTCA 5FBVB 3L7AA 4KQKA 2VP2A 4OREX 5CXSA 2AFIE 4NFHA 2W37A 4RPLA 5FFNA 1EUCB 2FVYA 4MMXB 4XWAA 3V8PA 5E2BA 4D4KA 3NUQA 5HJ2A 2CHEA 2FFJA 1Z0AA 2I4TA 2PZEA 3AUUA 3QU4A 1YFJA 2X76A 3JQ9C 1HC7A 4MSUA 2OBMA 2ZRGA 4NESA 1SUBA 4KFSA 1G6OA 3KT6A 3RLIA 5GMOA 5TVKA 1L7MA 2PX6A 2EGHA 2Q7OE 3B1ZA 5BUSA 3KKNA 4JMPA 2IELA 3CLRC 3OQJA 3K73O 3GEIA 5AP9A 1T3SA 1X1EA 2O7NA 3D3WB 5H1YA 3TQIA 4XDYA 3G5TA 3GJ8A 1QS0A 1RI1A 3CUEF 2OSBA 4ECAA 5D86A 3GJRA 2J1LA 4JOQA 3GFQA 4BQRA 4Y18A 5G0WA 3MYRA 1G5QA 5ALTA 1YL7A 2HXGA 5GJWC 2KJQA 1KU6A 1QHEA 2WIJA 1ZH0A 1V4BA 3LH5A 3VOAA 4FGWA 2XGJA 1F38A 1FB5A 2X15A 3PUYA 4PX9A 1SUWA 1KS9A 2N9UA 1CUAA 2ZBFA 1P5JA 4IHKA 3R9XB 4ARAA 4XFDA 4G9GA 2BEJA 2C8JA 4CL0A 2CFCA 3N2KA 3Q9LA 5IU6A 1FQWA 4PXSA 3S2SA 5LYJB 1T5OA 3ENQA 5CTJA 4A16A 3FFAA 5ALGA 3LDGA 4F97A 2PQ2A 3WICA 4CKBB 4PVDA 4OQDA 3B9BA 2E18A 5DNUA 2ZTVA 2OGSA 4XDGA 4EJSB 3CS3A 1N6HA 5EHQA 1J2YA 3Q12A 4ZHQA 3ZE8A 1B14A 2IYUA 5C18A 5CEFA 2UUBB 4C4TA 4XLLA 2ZI6A 3S55A 1MR3F 2YJZA 4MHTA 3IGFA 1RBQA 1A2OA 1P4GA 4UNSA 5PGMA 4K9OA 1EM8A 1V7PC 4RA6A 4G1MB 2UZ4A 3CH6A 3OLCX 3IAS6 3KEMA 1RYEA 1Q7EA 1ZINA 4OSEA 4P3KA 1QE0A 1QHFA 3KQMA 1ZJWA 2NAPA 1WNFA 1P31A 4YXFA 3CRVA 3ROZA 1YE5A 1SOWA 2IXDA 3UFXA 3ZU2A 5DNVA 4GU5A 1LCIA 5BY2A 5EUBA 5FD8A 1J5PA 2AKAB 5J63A 1Y89A 1HURA 1N6RA 2ERXA 2VYVD 3DAYA 2ONJA 3S2FA 2W48A 3GIDA 5I7FA 2QX4A 2Z5FA 4YRZA 2PUEA 2FE1A 4X84A 5HMLA 4NHEA 5J2TB 4H9GA 2JFXA 5A9RA 3GU3A 3SOZA 2P2LA 4CIXA 2AA3A 4FZ5A 1E3QA 4ND7A 5HCUA 4P9NA 1P9WA 5SV2A 4FI3C 4AKGA 2YDYA 4D02A 3AFGA 4DWJA 1GPBA 1H94A 4LNUB 4WGGA 3EFOA 2C31A 4B3IA 2JFPA 1ONOA 4OI4A 4OQQA 1XZQA 4B8WA 2CFRA 2V5VA 2VJNA 2WG1A 1M0TA 3TQRA 1PUIA 3HUTA 2ESRA 4AKEA 1C81A 2I7DA 2J9FA 4BO2A 2J45A 1D6SA 1X7XB 2AOTA 1ORVA 1UMDA 1L3BA 2WKQA 2WZQA 4TRNA 1RI4A 4XQCA 4NFSA 3BK7A 5IMBA 5J5CA 4EO9A 1X9IA 1NDUA 5IDQA 1NMSA 4F4HA 1JYEA 4RFVA 1R3UA 4PGGA 1EB8A 2D54A 3MRTA 4ZVLA 3Q3HA 1F0NA 3DO6A 3ZQKA 3IE1A 2EF0A 2OSVA 3LQ2A 1T8PA 4LXUA 3GXOA 4UBJA 3EEYA 1PX2A 2OP0A 1AQNA 1Z28A 4B6SA 3WGIA 3D2LA 4TWBA 2OFFA 1B76A 4LJKA 1KAHA 1ZLXA 3N05A 3RVLA 2M32A 4IBOA 3M4XA 4MYUA 4RY2A 3QWHA 3D3KA 1ODJA 4AZ3A 4YVFA 2HUPA 1TLLA 1E3LA 4Q3LA 4XR9A 4D9CA 3ZE0B 2Q5JA 2RARA 3HWWA 2XUKA 1KJ9A 4N8DA 4OU4A 4HB4A 3RW9A 4ARUA 3GN2A 2JIZA 1NQTA 3LPAA 4OXQA 3WAKA 1E3TA 4ESHA 2RHMA 4R16A 3U4AA 1ZW1A 1X9HA 1ZISA 1E9FA 3D4OA 3T9EA 2W2LD 3SI7A 3CZMA 4TMXA 1WDKA 1HYQA 3S2YA 3T3DA 4WCDA 4N3NA 4RHEA 1TVEA 4LF8B 2BFCB 2AUMA 2XZPA 1T2AA 5LQSA 4C2AA 1A9RA 1KXJA 1SC6A 2VYFA 4YN3A 5K20A 2ZG6A 4P7GA 2F59A 4ALLA 2LD4A 4YRSA 3OU2A 2FFHA 4MR9A 4UEQA 2Y4NA 4HQKA 4PNPA 3PITA 4CM3A 3MBKA 3Q0TA 2XHZA 1UMKA 3JAMA 2VHEA 2XX3A 2GILA 1HV8A 2NP6A 3WBJA 1PFKA 1KYYA 2CMKA 3Q7QA 3VPCA 1TTTA 1S8OA 1LU9A 1E96A 2EJVA 3PWTA 3OZAA 4JVLA 2QPLA 1U3DA 3IH5A 3LM8A 3MSXA 3PUHA 4IYJA 4LE1A 3ZXSA 2EJWA 3UXMA 4RTRA 2PMWB 4PLGA 3SJBA 1F2UB 4UQLA 4A0QA 1Q0LA 3UUGA 2G5GX 3SPXA 3JQDA 4IRUB 3ZNPA 1T3LA 5K2OA 1JWAB 4ND3A 1FFEA 3TOVA 2AEEA 2AS0A 2YIDA 2BUBA 2QI9F 3DL0A 3ORHA 2XI4A 4K46A 3ZBTA 2VUUA 4D6XA 5J2UA 1QHHA 2H0AA 4G25A 1K06A 2CMGA 4Q03A 2JEOA 1KI1A 3EXAA 3FY4A 1E4VA 5LP6C 3TW0A 3VHXB 1RM4A 2QQ0A 5JCJA 5C1IA 1W5BA 2E4XA 2I4RA 1Z18A 2D5LA 2WU4A 3STUA 1MX5A 2YRWA 4HOYA 4J0QA 2O2SA 4LJRA 3SHFA 3SYLA 1KK2A 2QN8A 4F3NA 1ECLA 1UEIA 3B48A 3JQEA 3B1VA 3CMMA 3ZCXA 1M1NA 2VP3A 3MIIA 1EZ1A 1P62B 1X1BA 2IHKA 3FPGA 5FCDA 4AJ1A 2XVAA 5FX2A 4ZQCB 2IOQA 2ZR0A 3QM1A 4KQ1A 3AVWA 5DGCA 3TTVA 4MHOA 1QG2A 1LDGA 4GMDA 3FOWA 5H4HA 3SD7A 1SXJA 3C16C 5AW0A 3HXKA 2BONA 1XRQA 4DVJA 1UJ5A 4KX5A 3PRHA 4ZC8A 1G8PA 4PFJA 4U2CA 4DANA 3BTVA 2O8EB 1ZJYA 4F1KA 1T5DX 2QRVA 3SZRA 3NCHA 4EA9A 3IDFA 3DBOB 3KXLA 2N47A 3AG5A 2BGJA 4M1EA 2Z2IA 4UZEA 1UP7A 3AL3A 4LX0A 1GPUA 4UDYX 3UQZA 4HQNA 5LZ2A 2VBFA 3UAZA 3S1AB 1O03A 1DEAA 3HZZA 4EPWA 3LF2A 6LDHA 3IQIX 1PFQA 3T41A 3BSYA 4ZIRA 4XSVA 4HZUA 4Q7KA 2MYTA 1F2TB 2C1EA 1JIQA 2XNKA 2FPKA 1CQWA 1L9KA 3OO1A 4Q47A 3T94A 2W7TA 4F11A 3BEOA 4Q1BA 1TUBA 1YBAA 4Y1FA 3RS9A 5KCMA 5A0FA 1ISIA 2PGOA 4B3DA 2UVQA 2IIVA 2L18A 1J06A 2HCRA 3LK6A 4HXEB 3ZIUA 1OLXB 1IXSB 4BJ6A 1Q1NA 3PA6A 1V4VA 3MGBA 5ALPA 3VNAA 4AG3A 2PEZA 4JVSB 3CNOA 4OFBA 5CH8A 2XRYA 4O8ZA 4RM3A 3WC4A 2PXXA 1YCHA 4ASUA 4BP9A 1CLEA 4YDSA 1K86A 2GKOA 2DTEA 1S2NA 4N7RA 5ER9A 1XZPA 4HRXA 2XWPA 5H3LA 3WG9A 3L92A 1C3VA 3A10A 1NE2A 4HDNB 4RVCA 5KNCD 1OU0A 2F43A 3W8RA 4Z49A 3DOJA 2J6CA 4RLSA 4DOMA 3TQHA 3KJGA 3DD1A 4MRMB 5IPFA 2A5JA 4EL0A 5FIUA 1WW8A 1XU4A 3JQAB 1ZJZA 1N2OA 5FWXA 4L0DA 1TMOA 1KEZA 4E4TA 2EU8A 1K3FA 4UNRA 2VI5A 4UMFA 4LQCA 3LMKA 3LT4A 3E2PA 3A6HA 2C83A 3C39A 2F3TA 3KU1A 4G5HA 2NZWA 4KX3A 4OATA 3LQ1A 2G6TA 4ZOLF 5FL3A 4BE7B 3W04A 2UZIR 1LC3A 2IX3A 1GTRA 4BFXA 1LK0A 2PR7A 1CJKC 3UK0A 3WK6A 4ADSG 5HEKA 4DNQA 4MKHA 3HO1A 3PSHA 2Y99A 2D4AA 3RODA 1P9NA 2Q3EA 5CH5A 3KOZA 4EI8A 3OX2A 3IMFA 3R7SA 5IWAB 3G9ZA 1SRRA 4MZXA 4LF5B 3QK7A 1I24A 5B2FA 5CMLA 1E7SA 3DUFB 2PX4A 5IXYA 1DARA 1REQB 2VPZA 1BQ3A 3CUYA 3ZWOA 4OMCA 3KEOA 3IHLA 2AG8A 4Y9TA 2NU8B 4QWMA 5ITSA 3O95A 3SJUA 3T3NA 5BRJA 1PWYE 3CGWA 1H5QA 4ZGBA 1PYOA 1CHNA 2CWWA 3EY4A 3HI4A 3M89A 4RETA 3AEUA 4ZO9A 4J6EA 3NV9A 4DT1B 1WTCA 2REXB 3B3JA 1QB7A 4NS1A 3KLPX 4ZVOA 4FE3A 3LCRA 5D3MB 1LVHA 3ZDZB 1FP1D 1P0MA 1UC4B 2BCJQ 3U0BA 2I4LA 3D3NA 3P94A 1VL8A 3FIUA 1LLQA 1I2AA 4UTRA 1ZKMA 4V1CI 3CBQA 3H7AA 2VTBA 1PSDA 4ZICA 1IDOA 2VSYA 2ATIA 1U2PA 2WFMA 3MAGA 4BLQA 4UUMA 2GVDC 1E5DA 3OCJA 4GI3A 5LYJF 4OBEA 3LPNA 4E7PA 1DT5A 1M8GA 2V6IA 2G8LA 3MK31 1BS1A 1JVNA 2R00C 3ESCA 4Q1VA 2NXNA 3E1KA 4JQZA 4KR0A 1ZM9A 4O4HA 1QGDA 1OUMA 4CU5A 2ATEA 3DMPA 3JQBC 3L0BA 4KBGA 1J20A 1RS0A 1OYYA 4NE2A 4R8LA 1JNXX 5IARA 1NVVQ 3RK1A 3IUMA 3P9NA 4LDJA 4NZOA 3AEKA 4X8MA 2Q3LA 4DG5A 1N7HA 4Y0NA 1YE3A 2W6QA 4B74A 2JLZA 4ARBA 1YS6A 3K7EA 1VB5A 4AF6A 4XJXA 4PGFA 1QIJA 2GEDA 5A9SB 3OTGA 5JPCA 2BFFB 4AT1A 2QQGA 1UWKA 2QX8A 2A0KA 3WIUA 4EBFA 2JCSA 2O1EA 3W3AA 4DG9A 1DRVA 3S29A 5H16A 1NVTA 1R10A 3HP7A 3EYAA 3JASA 3CJQA 2IUUA 2JBAB 1MO3A 1ZZEA 2FN3A 3MS2A 5AKJA 2WY2D 4B8ZA 2EW1A 4JJGA 4NEGA 1Y3FE 3C45A 2CJYA 3Q0IA 5J2TF 4QD3A 3HJBA 1ST3A 2HCBA 1LNQA 1ELOA 4MIOA 1KDZA 5B58T 1LW7A 2BR3A 2IJGX 5A4JA 1KEUA 4Z1MD 1JJIA 1M1XB 1N0UA 2EFDB 3JAKA 4MGKR 1L5WA 3CNBA 3U4CA 2V97A 3GEGA 2Z6VA 4BVEA 4LYJA 5AVKA 1X0VA 1VFNA 2QD4A 1Y6RA 2X0DA 4QZVA 1ZCBA 3DT8A 1K6MA 1TRHA 3EVDA 4Q9AA 3T6KA 2ZJAA 2ZVQX 3EEFA 1N2GA 3LQKA 1X7WA 1SVUA 1B23P 3EBOA 1WUHS 4OA8A 4QHSA 2WPDD 4BO0A 5CFLA 2IYTA 5C1PA 3RADC 1IOVA 2NM0A 2H5IA 1Z4PX 3FR8A 4HL6A 4M0LA 3GLSA 4BGUA 4D46A 3U09A 2W42A 4WKBA 5K0GA 3IUJA 5LB4A 2EBHX 1VRVA 5GONB 2PBFA 1W4LA 4EG7A 4P08A 1CX9B 3BMCB 4DWWA 2PUAA 3BH0A 4CQMD 2X0EA 4D3YA 1E1DA 1IZYA 3M6FA 4IO1A 3TVYA 4JQSA 1UBOS 2O3QA 3KZ1E 4HNHA 4I55B 4J0GA 1E6MA 3HWX1 2QUKA 1GCUA 3E9DA 3DLTA 1DV1A 4LRUA 4NLLA 5DTEA 3HVJA 3V7UA 3FYUA 4PZCA 3CN9A 4U1RA 2XB8A 1FFHA 1S02A 1S8AA 2B30A 3U7IA 3BZWA 4OTZA 4DSNA 3KYBA 2CFIA 3LLVA 3OCCA 4MGHA 2R6ZA 5B7QA 3FG9A 2FNAA 1WUIS 1QX4A 4UXIA 3F4BA 3UMRA 3S81A 3S2ZA 4LV5B 2QN9A 3LWDA 3R0QA 2FX3A 2VSQA 2SHKA 1YONA 1U2DC 1XEFA 1J49A 2AC7A 3FYHA 1WDLA 4MJ7A 3OCWA 2QYSA 3O83A 2PUBA 4HX5A 1M76A 1Y0BA 2BFWA 2VPTA 1MD9A 4UU7A 4YFVA 4CF6A 4ZTZB 4WAUA 1OXUA 1LPAB 5EWJB 2WG2A 2DX7A 3H42B 4QPPA 1M2NA 1HL7A 4G0ZA 3L8DA 2ZB3A 3PGVA 1O6ZA 5LCXA 5MN5A 4JITA 1SK9A 3IAAA 1VG8A 3OJ0A 1ZA1A 2F17A 3SZLA 2BZ0A 2XCUA 3KVNA 2NVUB 4F7WA 1FJGB 3IR7A 1WG8A 4AJLA 1RHRA 4TTJA 3WDKA 4OMUA 3NJ4A 4JS0A 1XWIA 2H2WA 3D7SA 3QIAA 4MV6A 5DP1A 5BN5B 5C8YA 2Y66A 2G71A 3VGPA 4CKEB 5GZ3A 1COZA 3ZHVA 1GLNA 4LV8B 4C6RA 1KERA 1IJBA 3M2TA 3VI4B 3ZWAA 2NU7B 3G6KA 3G85A 4Q82A 3CX6A 3GJ0A 3LDFA 3ITKA 3MIZA 4P3XA 4AI6A 4D4GA 3SQXA 1EESA 1S6YA 4RJ2A 4W4TA 4O2BB 3AJDA 3CIFA 3JPWA 1C1XA 3AHJA 1RRVA 3O1LA 3P9KA 5F76A 1Z63A 4TQAA 1G3QA 1I32A 4L3OA 1EH5A 4NYIR 5AUOB 3OWHA 1J8FA 2HRRA 1ZD3A 2QMHA 1EUDB 3TW6A 3Q0EA 3WYCA 5IUNC 3ETHA 2Z2XA 4QO8A 4PRYA 1ZAYA 1XK7A 4XUGB 5JVDA 2CV1A 4N49A 2XLCA 4JLBA 2CBGA 5CDGA 3B7PA 2GZ3A 4YBRA 3ISTA 3KLNA 2YCLA 2BGRA 1P33A 3PA8A 5LQUA 4EZIA 1M6YA 3TRDA 4ZO6A 3E2MA 4LW8A 5LA6B 5HIKA 2WJYA 4JLJA 3FNFA 4DDKA 1I1NA 1Q7CA 3AP3A 3OJFA 2ZIXA 4G5XA 1RYMA 3TEFA 5JYDA 1BA2A 2GZAA 2QN7A 1KDYA 4ZEVA 2X1LA 2CFTA 2PU5A 3D6VA 3VTZA 4AUNA 4RGBA 4ZYLA 1DKUA 1C9KA 2RFLA 5IKOA 3K5WA 3P2YA 4EUFA 1GG9A 5TQVA 4MGZR 1P4SA 1K2VN 2GD6A 4RLQA 4N0DA 4MVJE 4HWTA 1TW3A 1NN0A 2ZCVA 1CY1A 1NI3A 1S0UA 2VUIB 1PWXA 1QNFA 1R2QA 1EFTA 1E1YA 3K31A 5BQXA 3K0CC 4H17A 4OYLA 5U9CA 2P3SA 2ROQA 2Z43A 3V42A 1U3GA 5EPUA 2AXPA 1HQCA 4M49A 3WADA 2O2CA 2K4MA 2WM9B 5ED4A 2XUHA 2YIMA 2HZ7A 1OMOA 1J24A 2QOEA 4MYDA 1KARA 3DTNA 4OHOA 1P0CA 5FV7A 4GI5A 1N6KA 2GMWA 3D0QA 1XX6A 4N5DA 2OGZA 3VOSA 2H85A 3N86A 3ICWA 4MUYA 1DJLA 3CNEA 5B58C 4ERXA 2O0JA 4JASB 4C4XA 4LQDA 3N2NA 4O33A 1F48A 1RYFA 1SR8A 4BAUA 4ER3A 1GGMA 2YV3A 5FOSA 5CCDA 4C06A 1FLVA 1HDOA 2WSIA 4YCJA 2VDWB 4AAYA 2VSNA 4EWLA 3TG8A 4M1YA 1JSRA 3K6JA 1J4AA 1DKPA 1SVOA 1V7ZA 3VO9A 4WK0B 4BVBA 3LBAA 1SOMA 1D4ZA 1FNBA 2D1FA 2O2XA 1M72A 3EG9A 3JQFA 1SKYB 1GKIA 2FW0A 4KXUA 5EE9A 2W70A 2A1TR 3SM3A 3W0LB 3EQ6A 3T61A 2FG5A 4KQGA 4W9RA 3CH7A 2V1UA 4HYYA 1E6LA 4JLWA 2GQ0A 1T1JA 2DMRA 3MOIA 3RFUA 4Z7NB 4ZCLA 1FYXA 1ZK2A 3WWOA 4D99A 1RRMA 4EUKA 5KOYA 3EX7C 2FEMA 3GLGE 4ZREA 1P3JA 3IV6A 3WLRA 1KVUA 3X1MA 4EJMA 3IE0A 1XZ8A 3NRJA 2HIGA 2QL7A 3WA7A 1NVMB 4R51A 1YJXA 2XUQA 4V0SA 5A3RA 1K7EB 2ZDGA 1CZHA 3NYQA 4MLPA 1QHYA 2V96A 1VG9B 3B1JA 3QWAA 4JGGA 4QOEA 3T3HA 5MF6A 1QJ4A 1A97A 4XX1A 3JARB 4H77A 5BUZA 2NV0A 3G89A 2J5QA 1POXA 1K4KA 1M2GA 1RC1A 2REBA 4YP1A 1WUJS 2C7QA 3RTEA 3V2HA 2WWTA 3RPEA 1X13A 5CIQA 3FB1A 4CQNA 1BW9B 1U6KA 1F6DA 4R9UC 4Z4HA 1TQ6A 3A1UA 3COPA 3PQ8A 4GM1A 1J9ZA 5DM60 4ETWA 1DO0A 1GL3A 4E07A 3SC2A 3EDMA 1UBGA 1QXSA 2OB1A 1KXZA 3VUFA 3HSYA 2FEWB 2X8BA 2POCA 4HQLA 2IX9A 3SY8A 2HL6A 2R1TA 4URXR 4NKRA 4M8IA 4W5WA 2GFHA 5H3HA 3T7JA 3G13A 4AS3A 2BI7A 2G70A 2WHPB 1HFKA 2WTXA 4Q4HB 3O75A 3TSAA 2QX7A 2YKGA 1EVZA 3VVLA 4KE9A 4HTAA 4E3WA 5IN4A 3PXDA 5ICFA 2W6IA 5EE0A 2H4HA 1N6PA 3HDVA 1NP3A 4Q3AA 2I65A 2OOSA 4P35A 4HYQA 4Q21A 1MTOA 4MQEB 4U7TB 3ZE1B 3ZWNA 4F92B 2Q1YA 4EECA 1E2BA 2R7AA 1F5SA 2FB9A 2JAOA 2X2FA 3QTBA 4YCLA 5I7OA 2ADMA 2DFNA 2UKDA 1ZAKA 1LPOA 4ZALA 3TMAA 4M83A 4ZCMA 4G84A 7REQA 1YRLA 5FWDA 1XVIA 2IIPA 4H08A 1WBJB 3GUHA 3OZ7A 3LS2A 4UTOA 1T9AA 2B5WA 3PNMA 4OQPA 4XQ0A 1EUYA 4N6GA 1RC0A 2TYSB 2M1XA 3KTDA 1E5VA 3PC6A 1R9GA 3PS9A 4R1SA 5T5QA 3ZOKA 4CLDA 3H6GA 3B9QA 1C1YA 1K8ZB 1QIKA 4TWAA 3F3MA 3N5CA 2BM1A 1EAYA 4J90A 1V3VA 3TGPA 5ALHA 3DE0X 1EFRA 1D5CA 3KR1A 2DTDA 1ULHA 1GSAA 3IMKA 5G4LA 3WGVA 3F49S 3N3BC 1T2DA 2YV4A 3KPUA 4ID3A 4XASA 3GC6A 2UYQA 1JFFA 2TS1A 5B53A 3UWOA 3EF3A 5JH7A 1Y6ZA 4C43A 4DV7B 2C82A 4RHYA 2EEZA 2FP4A 2HLHA 4YONB 1EJ6A 1O94A 3FGOA 5DI3B 3RANA 3DLCA 5FH9A 3O8QB 4BRZA 1BOOA 5KX5B 1DIAA 4RTOA 5CH3A 2P35A 3ODPA 3JZMA 3T1HB 1V39A 3A4MA 4G8DA 2X7HA 4RLHA 1R12A 1EWTA 2O8DB 1IVNA 1ZUWA 2QUAA 3PGKA 4ITRC 4QVGA 2WYWA 1FLAA 1RHUA 2NUTB 4XGKA 3SE7A 3GJ6A 3UJCA 3VX3A 1U5BB 1DPGA 2CLLB 1FQJA 1A50B 1O97D 5CD1A 3K32A 4AIRA 4B84A 3Q10A 1IULA 5HKLA 2GVNA 4Q7EA 1ODIA 5REQB 3GB9A 3ENVA 2XCQA 4KSCA 1DZ3A 3RJTA 1KTVA 3KC2A 3BD8A 4UUAA 5GONF 4DMMA 1RHQA 3NBKA 2NTJA 3A2LA 3ESDA 4G86A 4MVJM 6NULA 4GC9A 2MYNA 2CNBA 1FVOA 4I55F 3CSDA 3GVXA 3VVBA 3C3WA 3ZHOA 5L40A 1JSCA 3BN3A 1W49A 3EXIA 4DEXA 3HNRA 3HN2A 3K4QA 4KLCA 1JIXA 1DWPA 3K1YA 3CIOA 1V11B 4GLLA 1CNEA 3K0AB 4BU0A 3DT6A 2BKXA 5A6SA 3TDNA 3GRRA 3N2ZB 4TT3A 4CWAA 4P4UA 5H80A 1L1RA 3VPBA 4UARA 2OHOA 4BNVA 4K6CA 1DIOB 3HCFA 2O8NA 4KHZA 3WSWA 2VXOA 4ENRA 2PUFA 3LVQE 5JDCA 1Z0UA 1GILA 2W8BA 4Q4AB 5K0EA 4DR6B 2C9YA 2XNHA 4ZQBA 4DCPA 2QU8A 2Y1EA 4Q3NA 1UZNA 4P0TA 1XU9A 2AKYA 2BF4A 3A4LA 3ENZA 4HXYA 4TV9B 1QNLA 4GE0A 4LZPA 5FR1A 4C21A 3ZE9A 4GGPA 4CL3A 2UXCB 1R0XA 3K09A 3VZPA 3SVTA 3MWJA 5PNTA 1PP4A 1Q15A 3ADOA 3T7AA 3SF8B 2G9UA 2NUAA 2WUVA 3GWGA 1DQPA 1FX0A 4ITUA