4IIUA

Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with nadp+ at 2.1 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
243
structure length
243
Chain Sequence
MSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from Escherichia coli strain CFT073 complexed with NADP+ at 2.1 A resolution
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
total genus 92
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4iiuA00
3CMMA 1XIVA 1EFKA 2FR0A 3RBXA 5EQDA 4KTTE 1T4BA 4YRDA 3GPDG 1Z7EA 1NP3A 3FNEA 3QLJA 2W8ZA 3HADA 4E33A 1GL3A 4L74A 4L9RA 4B3JA 1SCUA 1FK8A 1P3DA 4BKOA 3JYLA 3EUWA 2J8ZA 3FR7A 1UDBA 2OGUA 3DBRA 3QWFA 3GY0A 3UF0A 4BO5A 3E5MA 5A3VA 1DPGA 1BXGB 4GBJA 4J7UA 3KB6A 3DONA 3WMWA 4OJNA 3CMCO 3DBHB 4XGKA 4B3IA 1GY8A 3GQVA 3PIDA 3JTMA 2C54A 3IKTA 2DPHA 2NM0A 4I9UA 4Y98A 3KSUA 4PLCA 4YBZA 1UAGA 1U3TA 5KKAA 4CM4B 4CMHA 1G6KA 3JYNA 2R2GA 3LF1A 2HRZA 2X86A 4A0SA 4GLOA 4U6SA 4R51A 3LZ6A 5JPIA 5I9LA 1NFQA 1I32A 2DFDA 1KVSA 4EI2A 2I99A 2B5WA 5I8ZA 3R0IA 1LTHR 5JY6A 1R4NA 1ID1A 1Q7CA 3M6IA 3PYMA 2WE8A 4MKZA 5LCXA 1LJ8A 3OETA 3U4HA 4IZIA 1GQQA 1CF2O 3ZWAA 3DHEA 1V35A 1JLLA 4UUMA 4GMFA 1L7EA 2ZJ0A 4XJSA 1ISGA 3F46A 4BNMA 1I5RA 1P33A 4PLGA 4E3ZA 1GCOA 1ZBQA 1JU9A 3ASUA 1C1XA 2W2KB 4OAQA 4FC6A 5H82A 2HK9A 4KUHA 4E21A 2YZ7A 1ONOA 3DBRB 5FI5A 2CUKA 3KRTA 4PCVA 1PJ4A 3C1AA 3I3OA 3JQ6A 4WEOA 3Q1LA 2EP7A 1YGYA 3E1KA 2J3HA 1DFGA 1EVJA 2G1UA 4E12A 1LLUA 1U4SA 1ADBA 3ANLA 1A7AA 4MIYA 1WMBA 4FPXA 2AG8A 4XRGA 2VYVA 4H16A 1ZCJA 4Q3AA 4AJHA 4ALLA 5L51A 1HE2A 3JQFA 3OJLA 1M2WA 4IDGA 4YTEA 5I7FA 4GX5A 4ND5A 4XQEA 3PHHA 3UKOA 1PJ2A 3RUFA 3IMFA 4XWYA 2Y0EA 5IZCC 2A4KA 5TLSA 4TVOA 4YJHA 5KJ6A 3KVOA 1R0SA 3S2IA 5JDCA 4RLSA 1XYGA 3CXRA 1UP4A 3HQ4O 1KS9A 4RVGA 4YAGA 4N5NA 4BO3A 2CF6A 3VH1A 1GPJA 4XYLA 4GGPA 1ZNQO 4YJGA 4ALJA 2Y1DA 1QYVA 2HMUA 1I3NA 3D5QA 4CL8A 4GI2A 2P9CA 4CM4A 1PJ3A 5DOZA 5IN5A 3U4CA 2I65A 4Q39A 4WASA 1B2LA 4YT2A 5B4TA 2PLAA 3WOHA 1LC0A 3VHRA 3GF4A 1WZEA 2JHGA 2R00A 4J1NA 4CM8B 1ZIDA 4RQUA 4R3WA 2VRBA 2PH5A 2LDBA 4NPCA 3TOXA 5THQA 1CQIA 1ENOA 3WIDA 1J49A 4OKNA 2V6BA 3JD1A 4BHTA 2HMSA 3K8ZA 3C1OA 1F17A 4NZ9A 4J6FA 4LRSB 3KYCB 3AOGA 1U5AA 2HU2A 4RVFA 2EW2A 1PWZA 4RPHA 7MDHA 1Z74A 2QYSA 5TS3A 1Y9EA 5K0ZA 4U7WA 2YFHA 4I5FA 3LVFO 3L6EA 2AW5A 3HG7A 2VUSA 3I83A 3NTRA 1PJSA 4A2CA 3ZV3A 2JHFA 3CPSA 4XB1A 3I6QA 2E4AA 4BMNA 3PLRA 5JXWA 4E2YA 2EGHA 1CIVA 1Y9AA 1YBMA 1FF9A 5C37A 4WGGA 2P5YA 4WJZA 4AJNA 2GCGA 3ZWBA 3G17A 4FCCA 3K92A 1HDOA 1R16A 3U5TA 2ZK7A 3QSGA 1RKXA 4GQAA 4BKPA 1GZ3A 4L76A 5JFOA 3LYLA 3RFTA 1JAYA 1YL7A 4XJTA 5TF4A 3D3WA 5HBRA 2A9FA 2HDHA 4BS9A 2VCYA 4LMRA 2HUNA 4O0LA 1HSOA 2P91A 4XYMA 1PX0A 1Y6JA 4RCVA 1F0YA 5I9MA 1ULSA 5DULA 3QVTA 4Q3CA 5TJ9A 2ZYGA 3NDJA 2RH4A 4CV1A 3TF5A 5AVOA 2BFAA 4E5NA 1YJQA 2BFMA 4NFSA 3F3SA 3OIDA 1R37A 3QWAA 4QO8A 3HN2A 4PFJA 4YDRA 1VSVA 3PGJA 4HNGA 4ZRNA 4TRJA 3JQ8B 1J0XO 1GFSA 2Q49A 2ZB4A 3CTMA 3DZKA 2C07A 3FTNA 3QRWA 3VPXA 3BAZA 2CY0A 1XHLA 1ULUA 2J6IA 1QXSA 4CMBA 1YB5A 1GEGA 3FBTA 3GNQA 1Z6ZA 4YYZA 1E7YA 3C7DB 2QRLA 1NBOA 4AJ1A 5CDYA 1XDWA 5EMHA 4IJUA 4OL9A 3BHIA 3FHLA 5JCJD 1GPDG 3L07A 3WXBA 1U8XX 5FEUA 3D1LA 3TZQA 2VTDA 3EGOA 4GKVA 4QTZA 2O50A 4HFMA 2GN6A 4BNHA 3JD3A 2X0JA 3PYLA 3CZMA 4N18A 5TRTA 4D0SA 3O26A 1GV1A 3DB2A 4WNIA 4CM9A 3GT0A 1Y8QA 1IULA 3NAQA 3DQPA 3ICCA 1QG6A 2E6UX 4F46A 4JLWA 5L45A 1XCBA 1X0XA 2X8LA 1MLDA 3UCEA 3L9XA 4CMJA 3M1LA 3RU7A 1MFZA 2PGJA 4WCFA 5K6AA 1PGPA 4Q3BA 1R66A 4IQ8A 5AXBA 2QQ5A 3LC1O 3HJAA 4L4SA 3VPFA 1YH3A 3IOYA 4ALKA 5DZSA 2OHXA 4A03A 2Q1SA 3Q11A 1GADO 1QYWA 4L8VA 5JAZA 2GDZA 1EEHA 2NTVA 4UUOA 4Z3KA 2E49A 3PQFA 1EK6A 4N5LA 3RUHA 3DBLB 5C5IA 4ND1A 1IB6A 1WWKA 1N7GA 4CM8A 3CSDA 4CMKA 1EUZA 1AGNA 3WNQA 3GVHA 3IIEA 3QVOA 1PJLA 2GRAA 3ST7A 5KOIA 3VDQA 3RUCA 2NTNA 5G4KA 3VOSA 2NU9A 4MVJE 5A9SA 1FDWA 1C14A 4W82A 4I5GA 4YQZA 4IINA 5BSHA 2EEZA 2PFGA 3CE6A 4DYVA 1DAOA 2O4UX 4URFA 4EJMA 2VTEA 1NR7A 1U7TA 4HKTA 4CR8A 3VVCA 4BQRA 4RDIA 4FFPA 1MXFA 1WP4A 5A9RA 1HLDA 4OXNA 2DTEA 1NXQA 5KTKA 1LRLA 4FB5A 3AY6A 2ZTMA 3OA0A 3D4OA 1X15A 1ZFNA 1D1TA 3ETDA 4LK3A 1KVTA 2X9VA 1LLDA 3FWNA 4FW8A 4WPGA 3WBBA 1E6EA 2CNBA 3NRCA 3ZNOA 4R1UA 4NU5A 4W7IA 2BRUA 5TNXA 4E5PA 5GZ1A 4MIEA 3U4DA 3H5RA 4BUCA 5BSFA 3O8QA 3JCZA 4NBUA 1I01A 3WSVA 3DEYX 3KYCA 2YQ5A 1GQ2A 3TQHA 4A7PA 1E3JA 1HE3A 4XR4A 1HF3A 2NSDA 4I1IA 4RF2A 4FD3A 1DC6A 2D2IA 3IUPA 4XDZA 4BO4A 1X7DA 5C7OO 5TSDA 5L4LA 4AJLA 4DUPA 3ANMA 4EBFA 1PL6A 3F4LA 1ZK4A 4ND2A 4DMMA 2RIRA 2X9NA 4UULA 2FR8A 3JQ9C 2ZYDA 4HXYA 1ZK0A 2O4CA 4IJVA 2HJSA 4E4YA 3LK7A 4FOOA 4R4JA 4D3DA 1IUKA 3C8MA 4QSMA 3TDKA 3A14A 1BG6A 2D5CA 3A28A 1Y81A 5F1PA 3DHYA 4I9NA 1DO8A 1RWBA 2TMDA 5DBGA 4CMIB 4MINA 3U9LA 3SBOA 1LDYA 4BNYA 5CAEA 4WLOA 1E1KA 1PS9A 3WGOA 1NYTA 4OHUA 2UDPA 1CWUA 2O2YA 1OOEA 1QRRA 2V65A 3E5RA 3LT1A 1O0SA 3K31A 3LLVA 1I8TA 3NJ4A 4AJJA 1EVYA 3O8QB 4NK5A 3H9JA 3JQAA 1XWFA 1LSOA 3KHUA 2UUOA 4YVFA 3GAZA 4KDFA 1HDGO 1ZK3A 3BZUA 4ESOA 3ONFA 5TIIA 3C1TA 5COQA 4MPDA 2WYWA 4J4BA 4LRTB 4WLEA 2AEMA 1PGJA 3GDGA 1MG5A 1MUUA 2ZQYA 4PG6A 4K9DA 3WTCA 1KVUA 3SX2A 3ZHYA 4CM7A 5JO0A 3ZI0A 3EW7A 2OP1A 4JJGA 3DZGA 5TJHA 3WX0A 5GZ3A 4XQGA 2J5RA 2OOSA 5JE8A 4R01A 1A7KA 1HXHA 3WFIA 4BGVA 2IODA 2I9PA 2H6EA 1DIBA 4YACA 3V5NA 2J5KA 3FNGA 5CEFA 3AJRA 1VL0A 2G82A 3NUGA 3TZ6A 1EFLA 1LRKA 1SMKA 3ZWVA 4F3YA 5AXAA 4JP2A 5KVVA 1U7HA 2HK7A 1GYQA 1KBZA 2Z1NA 1GDHA 2Q1WA 1I3LA 4I5EA 4JQCA 5DNAA 4UVEA 3V1UA 4C7JA 1LI4A 4KUGA 2ZATA 1YKFA 3C3XA 5CEJA 3JQ8A 1ZJYA 2OBNA 4YPOA 2YV2A 1O9BA 2HCTA 3OJEA 5G0TA 1NTOA 4GH5A 3I1JA 1EQ2A 3I9KA 4MVJF 2BD0A 5A04A 2EG9A 1BHSA 4L73A 3HB5X 4MVJP 1CYDA 4MKXA 4JIGA 4DA9A 3UCFA 3H3FA 3G1TA 4BNNA 3WGGA 4CLXA 1RJWA 3DZBA 5GY7A 3ZNNA 3PGXA 5DT9A 1X14A 3WGTA 1I2ZA 1EBUA 1PR9A 1Y8RB 3Q6IA 4CLOB 1XLTA 4D45A 1ZMOA 1ONNA 2HKIA 3JV7A 3BMCB 1XQ6A 1KERA 2IZ0A 4QEDA 2AE1A 4RVHA 2PKQO 3L77A 3CUKA 1OC2A 3TZHA 1P9LA 4R54A 4WLUA 5H83A 2EKPA 1HDYA 2I3GA 1D4FA 1ADFA 4TRMA 2VT3A 3RC9A 1EE2A 3FTPA 5CDSA 3PDJA 1E1NA 2PZJA 2V6MA 4UEKA 3EY4A 3HFGA 4GAEA 4WUVA 1DSSG 2AEFA 2CD9A 3RC1A 3VZQA 4BO8A 3WB9A 2D8AA 1A9ZA 2ZIZA 5KJEA 3FNHA 4CR6A 3GHHA 2UUPA 2JD0A 3M1AA 3HWRA 2JJYA 3GDFA 5KVCA 3WYBA 1A4UA 4CQMA 2V6GA 4E5YA 4PN3A 2E82A 4EUFA 4DQXA 3PQDA 1MX3A 1AXGA 1NPYA 1Q0QA 1F14A 2HMTA 3ROMA 5L4NA 3G49A 3DFUA 8ADHA 4AVYA 3ZWYA 1GYRA 3B6ZA 3ZH2A 4IPTA 4CMGA 1P1KA 1N9GB 3EZYA 2O48X 5I9NA 1V3TA 3PHIA 3BIOA 2A92A 1Q1NA 3AOEC 1F8GA 2YY7A 4RPLA 3PXXA 4PLFA 2VOJA 4WECA 4YA6A 4WLFA 2NU7A 3DMYA 1H93A 2X0NA 3WDSA 1UDAA 4CJXA 3MTJA 4GX0A 5C3MA 4XGIA 4J2HA 4DRYA 2FY8A 3W8FA 2CDAA 1LQUA 1PZGA 3GHYA 1E5QA 4RF3A 1GR0A 2O23A 4M87A 5CFZA 5IZ4A 4J9UE 1LDEA 3RUAA 3MOIA 3E9NA 5HRUA 4A10A 4RDHA 3PTZA 1L7DA 3D64A 1D3AA 1E3WA 4P38A 3NTOA 4J90A 2DPGA 4WE3A 3TWOA 4NIMA 1BXKA 3E82A 1CETA 3NEPX 1T2DA 3GUYA 4PVCA 4TQGA 2O3UA 4IGEA 3NJ8A 2O3JA 3RWBA 1LNQA 3OBBA 1DRUA 4NJMA 2PKQP 2WJPA 2YUTA 3QV1A 1DJQA 3V1YA 3KBOA 4TKLA 2JAHA 3T7EA 2DTXA 4CM9D 1EDOA 4QFDA 2YW9A 4C7KA 1F8FA 4IS2A 4CLEA 4JROA 4DLBA 4JJIA 1DIGA 3PPIA 5ENDA 4XCVA 5L7YA 4JP3A 2J5QA 1K2WA 2C2YA 1P45A 4M49A 1E1MA 4PLYA 4OH1A 4YQYA 1IE3A 2ZQZA 3RQSA 3S55A 4DVJA 1ZZEA 4MP8A 2D0IA 1PZFA 1IY8A 4LGVA 1T2FA 1TVEA 4Z0PA 1YL5A 4R68A 4O59O 4B79A 1D1SA 3CIFA 3E9QA 3W6ZA 1UJMA 3BYZA 3DL2A 2WEKA 3HDYA 1PJTA 2C5EA 5JS6A 5L40A 3K96A 4OSOA 4D0RA 1EE9A 5K9ZA 1H9AA 1OFGA 3L6DA 4PLTA 4D42A 1K89A 3QA9A 4INAA 3OIFA 2VWQA 2CMDA 1YQXA 4BNUA 5JBIA 3AY7A 4EDFA 3OJFA 4AL4A 1TT5B 4OMUA 4P4GA 4ZQHA 3V2HA 2IXBA 5EERA 5F1OA 5EIOA 3WWZA 2IRWA 3O4RA 3UGKA 4NMHA 2NADA 2P2SA 4EITA 1T1SA 5G4LA 2VHZA 3PJEA 4P4NA 1EK5A 1QYXA 2NVUA 3IQDB 5HS6A 2RHCA 4ALMA 1U5CA 2NQTA 1NFRA 5ADHA 3ABIA 3GAFA 1E6UA 2ET6A 1FDVA 5HWSA 4HP8A 2BFOA 4LSWA 4UVHA 1BGVA 3JSAA 1XG5A 3GFGA 1MGOA 1KEUA 1PIWA 2RHRA 2WM3A 1BMDA 1PZHA 3ZWNA 2B0JA 3ETEA 2C29D 1B14A 3QQPA 1GUYA 3H2ZA 2AQIA 3F4BA 3GGPA 4FS3A 1NAHA 4XYBA 3IJPA 3JQBC 2PK3A 1ZSYA 2LDXA 4A73A 4CV3A 3OICA 1I2CA 1YQGA 3JQGB 3OEWA 2Z95A 1ZXLA 4LVCA 4J3FA 2UV8A 4E5MA 3D4PA 3DZJA 3LU1A 3PEFA 4NFHA 5F1KA 3RBZA 3GZ4A 1A72A 4WKGA 1ZH8A 1MA0A 4QO7A 3MTGA 1N1EA 1DB3A 1WW8A 4XB2A 1SZJG 2PNFA 2GZ3A 1KEPA 2HSDA 1N8KA 1GUFA 1UUFA 1ZMTA 1B3BA 4ONEA 2BGMA 3W4KA 4R5HA 4TRRA 5A02A 4CQLB 1XKQA 3MOGA 4BNIA 5B4UA 1LSJA 7ADHA 4PRLA 5G0SA 3AM3A 1HYHA 1C0KA 1VL8A 1RYEA 3AUAA 1J5PA 5JAMA 4RORA 4I5DA 3IP3A 3P19A 5JMWA 3SLKA 4N5MA 4FJ0A 1HLPA 3D7LA 3SEFA 1VJ0A 5B37A 4CQMB 5ICSA 1JW9B 1C1DA 3AOEA 2O3RA 1RYDA 2JKVA 1ONPA 1WXDA 2EKQA 1GV0A 3PLNA 4CMAA 1CJCA 5ILOA 1D8AA 1SOWA 3GFBA 5EINA 4RF5A 2PD6A 4LMPA 2BHLA 1WZIA 4DTIA 5FI3A 2D1YA 4FR5A 4FFOA 2C5AA 3OH8A 3VZRA 1RM0A 1C0LA 2IYOA 1C0IA 2ZB7A 1H9BA 3ENKA 2QHXA 2X5KO 3S2GA 4QQRA 5JO9A 2AEJA 4BNLA 1PL7A 5AXCA 4YEDA 4BO1A 3DHNA 2EWMA 3ROKA 3WYEA 3DZFA 3PIIA 5L7TA 1Z73A 5LC1A 3Q2IA 3FBGA 4CLOA 4J16A 4NI5A 3GZNB 3PFWO 5DCYA 1KEWA 1GTMA 3VH2A 3C24A 2DTDA 3GK3A 2H9IA 3KUXA 1B26A 4NBWA 1ZK2A 1XR3A 3FNFA 5EL0A 4DIOA 4ZQGA 3JQAB 1QYDA 3SLGA 4Q9NA 5A4DA 1NQ5A 4ZHSA 3IL2A 2PD3A 4DYDA 3HN7A 2PA3A 3WQSB 2QZZA 4YAIA 3ON5A 2YDYA 1O6ZA 1YOVA 3I9OA 4RLHA 4R41A 5G2OA 1QV7A 3WG9A 4CODB 3OQ6A 1GCUA 3NGLA 3DTYA 5T8KC 2BLLA 2X23A 4Z0HO 4NHEA 2C7VA 3GMDA 4JK3A 2XXJA 5IXYA 1TA4A 1LLQA 2JFFA 3SXPA 1S7CA 3I9MA 1V8BA 4CR7A 1DLIA 4YAJA 5T64A 2XAAA 2VWHA 4BNZA 1A71A 2YDXA 3E03A 1YO6A 4XQCA 2NV6A 2NQ8A 4FGWA 3EK2A 4D3FA 2BI7A 2GN8A 1JWAB 3N58A 2B4TO 1G0NA 1S6YA 3PZRA 4KQWA 4Z9YA 1NPTO 3A4VA 1P1FA 1CERA 2P5UA 2D59A 3PWKA 4EYEA 1K6JA 8LDHA 3STHA 3JYPA 1HETA 5IFLA 3HUDA 3RAJA 3ZNPA 4PG7A 4RZHA 3S2FA 1PJBA 1E6WA 2FZEA 2VNSA 5BQFA 3OIGA 1OAAA 1HYGA 3JQGA 3RUEA 3SC6A 2QW8A 4BOYA 3JQCA 1NHWA 4CM5A 2VN8A 1M66A 3ZHZA 2GN9A 4CPDA 2YJZA 1WDKA 2PZLA 3K9QO 4GL4A 4RVUA 3RI3A 3U49A 1FDTA 4II3A 4AJOA 5BNFA 2JAPA 2Y1OA 5EN4A 3TFQA 4CM1A 2OL4A 1NR1A 2JL1A 1FDUA 4LCJA 4R5MA 4P8RA 4J43A 4EEZA 1NWHA 1I3KA 3RJ5A 4CMEC 3ZNQA 3NGXA 3QVWA 4JX8A 4TROA 1QLHA 3ENNA 2NVUB 4DC0A 1IOLA 3TRIA 1DJNA 4OGWA 1O5IA 3KLPX 4OYRA 3KOUA 4KWIA 4IMPA 4PIVA 1NQTA 2VHXA 5ITVA 4YJFA 5KWEA 1DC5A 3FF4A 1XU9A 4PZEA 1GEEA 2ZJ1A 3GNSA 4ZQEA 2I76A 5F21A 5IG2A 1ZEMA 4JBHA 5ILGA 1A5ZA 2IE0A 5A03A 2JD2A 4ITUA 4DPMA 1Y1PA 1RPNA 2BKAA 2I3AA 4NNJA 3DDNA 1ORRA 1Y5RA 3I9JA 4B7UA 2W90A 1HE4A 1I24A 4IJWA 2BI8A 5KJ1A 1HZJA 2DAPA 5B4VA 4ZQBA 3IJRA 2WWRA 2I66A 3AUTA 4PLZA 2WYVA 4UEOA 1EMDA 3AU8A 3QW2A 4ALIA 2VRCA 2AXQA 2FWMX 1YBVA 4E30A 1VPDA 4YT5A 3AUSA 2GUGA 3DOCA 4P4LA 5ES3A 1U3VA 3ROQA 1T2AA 4G81A 4I08A 2XOXA 2VWPA 4WNCA 4E31A 3E18A 4U0KA 1B8UA 1J4AA 1E7WA 3VH4A 2JD1A 4I8XA 3R6DA 4WOKA 1KY4A 1ADCA 4ZGWA 3RFVA 3HE3A 2GPTA 3BHJA 3OMLA 5DP1A 3CKYA 4J0FA 4Z9FA 1YVEI 1DFHA 4WCFC 5K6AC 4UAGA 1ML3A 2GF2A 1KVRA 3W8DA 5A9SB 3QWBA 2PGDA 3Q9UA 4DBZA 3LQFA 4XKJA 3M2TA 1YQDA 1N5DA 5KJCA 1R0LA 3PJFA 4IIUA 3NT2A 1LDGA 1TXGA 2AMFA 4ID9A 2GYYA 2O7QA 1Q0HA 3I6IA 3MCVA 3LLSA 1ZEJA 1I10A 4HX5A 1H6CA 3ZU5A 1HKUA 1JN0A 4IXTA 4J91A 4XD2A 4AFNA 2FRDA 4IUYA 1M75A 1VSUA 1AE1A 1Q7GA 3HDQA 3NTQA 1MG0A 1YS4A 3S2EA 1DIRA 4BNVA 2J3JA 1LLCA 4KP7A 3CEAA 4ROSA 3BXXA 3K5PA 1K6XA 2FPPA 2Q2QA 3K2EA 3MEQA 4NBRA 4NBVA 2YHUA 3OSUA 4PZDA 2QIOA 3K2BA 4GLLA 4M55A 2XF8A 3CH6A 3SVTA 4Q3DA 1WMAA 1F06A 3AWDA 3RU9A 1ARZA 5LDGA 4ZN6A 5L9AA 6ADHA 2P9GA 4IDAA 5H81A 1LA2A 3GH3A 4W7HA 1UP6A 2GZ1A 4IMRA 4L4XA 4NH4A 4NG5A 1YDEA 4BB5A 3MZ0A 4IJKA 2FPGA 1YONA 4FIZA 4DPLA 4YB8A 2Y67A 2YV1A 3GNTA 1M6HA 1AUPA 3WSWA 2EERA 2AQ8A 1JTVA 1E5LA 3KZVA 3UXYA 2GASA 2BF7A 4ZU3A 2X58A 3FI9A 1VL6A 3I52A 3KSDO 4Y8VA 3INTA 2GGSA 1SB9A 1LSUA 1XELA 1JAXA 2YHIB 3B20A 3VPHA 5G0WA 3LC7O 4MKRA 4FQ8A 5G0UA 4FC7A 1P74A 4J4TA 4BNJA 3ZV4A 1DIAA 2DUUA 3QVSA 3GN2A 4E6PA 2Z5LA 3LDHA 4DGSA 2EKLA 3ZDFA 1XQ1A 1DEHA 3AM5A 4UEJA 1ISHA 1FXSA 5BNIA 3ZU2A 1DC4A 2CVQA 2J3KA 3PWSA 1YOVB 1B8PA 5B12A 3JQBA 3ZWOA 4ND3A 4R16A 4DC1A 4U0JA 1U9JA 5JDIA 3GMSA 2NTJA 5JY1A 3G0OA 3BA1A 2FMUA 4XR9A 1K3TA 1FMCA 1TI7A 2NVBA 3DTTA 1YRLA 4IDCA 4M8SA 1B0AA 1ZW1A 2Y1GA 5I8WA 1UZMA 3OFSA 2B83A 4TMFA 1UZNA 3HB4X 4XQ9A 3GZNA 2B5VA 3GG2A 2ILTA 4RF4A 2OFPA 5COAA 4XYEA 2GERA 3RD5A 1QKIA 2VHVA 2YQ4A 4JBIA 3ZW9A 1WDLA 3H4VA 1NVGA 3UCXA 1X7HA 1E7SA 2Y0DA 1J6UA 5I7VA 1KEVA 5F5LA 4YCAA 5BNTA 1PQPA 4CLHA 4CLDA 5DBFA 1P0FA 5DCUA 1PSDA 1Z75A 1V0JA 1V6AA 3VPSA 5HTOA 3WJAA 4XYGA 3B1FA 2Y05A 4JXKA 3ANNA 3WGYA 3GR6A 4NDNE 4E2WA 1DIHA 2Q45A 3GRPA 4R9RA 3I4CA 2O2SA 2DC1A 5F5NA 1EQUA 3DWFA 1TT5A 1BW9A 1DFIA 1NQAO 2JFGA 4HFRA 2FR1A 4F6LA 3OQBA 3V2GA 3VTZA 2IEDA 2CFCA 1VJ1A 5JCXA 1ZO8A 1BSVA 5U9CA 4QX6A 4J7CA 4HV4A 4GWGA 5ICMA 4MVJA 3JQ7B 4YRBA 2OXIA 3KYDB 4ILKA 4WOJA 4PLWA 1PR3A 5CDGA 2WD8A 3H9GA 4YWJA 1Z45A 2JCYA 4YXFA 2YV3A 5FWNA 2VNAA 1QLJA 2V7PA 2W2LA 3GUCA 3QY9A 2BMAA 4JBGA 1BVUA 1I3MA 3F5QA 4MO2A 4NJOA 3WTBA 1IPEA 3GDOA 4LVUA 3ZV5A 3N7UA 3BMOB 1UR5A 5CDTA 4RVDA 4J1SA 1ZK1A 2H5LA 4BNTA 3BTUA 1KC1A 2R00C 3EMKA 3WICA 5JC1A 1N7HA 4HADA 3BMNA 5DOVA 5TX7A 3KEQA 4UVDA 3ZWXA 4LCEA 3PJGA 1H94A 2YYYA 5GMOA 5G0VA 3RC7A 5TC4A 3VZSA 4RPGA 1Y5MA 3WQRA 4RL6A 5A3JA 2AA3A 1B15A 3QE3A 3BTSA 3PP8A 1U2DA 1JWBB 1MV8A 4EUHA 2VRCD 1PEDA 3FPLA 1EZ4A 5J23A 4W9NA 3VAZA 2VQ3A 4CUJA 4EW6A 1A4IA 4YAKA 3MJEA 3INGA 1T2CA 2VYVD 1U8FO 4EZBA 1PTJA 2PV7A 2G0TA 3T7CA 3IC5A 5BR7A 4GMGA 5A1TA 5DDIP 2H63A 4JJFA 5IZCA 3AU9A 3AY3A 4MIOA 3ZV6A 3I4FA 2PZMA 1OBFO 2OBYA 4BNGA 3Q2KA 3RIHA 2Q4EA 4DQVA 1BXZA 3NX4A 4CLRB 3RKUA 3B70A 1YJ8A 2JCXA 1H0KA 4B8ZA 2O7SA 2QYTA 1I33A 4KDEA 4XEHA 3B1JA 4BQPA 4TZTA 1X7GA 1WNTA 1P1HA 3JYQA 4CQMD 1ZUD1 4RV9A 5G4KB 1GZ6A 1V3VA 1P31A 1U4OA 4JGBA 4XA8A 1ZKMA 2Y68A 2CF5A 2XXBA 4GKBA 4WLNA 4WCDA 1SAYA 2C59A 5IJZA 3HZZA 4WK6A 4A26A 2QX7A 2JFHA 3HFSA 4GWKA 3RSHA 1ENPA 2G17A 5GZ6A 3EDMA 2DT5A 4BGIA 4S3MA 4KMSA 2I5PO 1B16A 3BMNB 3C85A 3PRJA 4BO9A 3JQEA 1EDZA 1SNYA 1ISFA 1LQTA 1WLYA 2TMGA 4UUNA 3UFXA 1AXEA 4OQZA 4ZICA 1ZSVA 2BH9A 1O89A 3EHEA 4BO7A 2PZKA 1O94A 3G79A 2X5OA 1UP7A 4K6CA 1XSEA 3BMCA 3GVIA 2OMEA 3EYWA 3DBHA 3IAHA 2HO5A 4R3NA 4D46A 3DO5A 1LDMA 3ITDA 1OI7A 3W6UA 5HM8A 3KM0A 1BXGA 3NT5A 1UXJA 2Y93A 1W73A 1KY5A 5IN4A 2X0IA 4IDBA 1DRWA 6LDHA 1PGNA 1KOLA 4ZRMA 3FCOA 1EVZA 3V8BA 1MC4A 3LSYA 3Q3CA 1UAYA 4FGSA 4BO2A 1SPXA 1P77A 4BL5A 3RROA 4TSKA 1EBFA 2DU8A 1OZAA 3KEOA 2B36A 1MP0A 1RM5A 1W6UA 1RM3A 3I5MA 4B7CA 4BNXA 2V6FA 4MVJI 3EC7A 1GZ4A 5ITWA 1PS0A 3H2SA 4LW8A 1GQYA 4RPKA 4Y67A 4DIFA 1XGKA 4BKRA 1WAMA 4K6FA 3ZCXA 4PRKA 1R4MB 5JMPA 4BV8A 4QXMA 1WVGA 2EJVA 1YWGO 3QWIA 4FJ1A 3GRKA 3IKVA 1UDCA 1YB1A 5CPFA 4B3HA 3TJRA 4NJMB 1UZLA 3TZKA 3WFJA 1NHGA 1RM4A 5EPOA 1NQOA 1HDCA 2H1SA 3RJ9A 3P2YA 4CQLA 5IF3A 1LXCA 5L3ZA 3F1KA 1VKOA 4W99A 1YXMA 3VZPA 3OM9A 2NU6A 3ITKA 4B4WA 4PG8A 3OECA 1ZXBA 3RCBA 1PGQA 2A35A 4OOFA 4DBVO 1W4ZA 1EVIA 4J9VA 1AHHA 2IZZA 2QZ9A 4NQZA 3GLQA 4DXHA 2HQ1A 4DQUA 4E0BA 1Y8RA 5IAAA 3H7AA 1E1LA 3L0DA 4GSLA 2EGGA 4FFRA 3ZWWA 1BTOA 5KIAA 2AQHA 1LEHA 3UW3A 3WGQA 2X22A 3KYBA 3VPGA 1H6DA 4XX0A 4KZPA 1SBYA 4CV2A 4AJEA 3GGGA 2PR2A 3I23A 2X7HA 2OP0A 1N92A 1X1TA 3LC2O 3ZU4A 5JNLA 1DHRA 3JQ7A 1TLTA 3DBVO 1HZZA 2OUIA 4IY1A 4G5HA 4RGBA 4DLAA 1PZEA 1QP8A 4KWHA 2EF1A 4JNKA 3WGZA 1YE3A 4D3SA 2DBQA 1NX6A 5TT0A 4GVXA 4DL9A 4E2ZA 3TSCA 4CV0A 2AE2A 4HBGA 1PL8A 5B1YA 3ONDA 3W8EA 1H6AA 5I7EA 3PI7A 4ZJUA 3MWDB 1DDOA 4C4OA 4EUEA 4L75A 2IDZA 3ZWPA 4ZD6A 4D7AA 1DAPA 4Z3DA 4IS3A 5F3RA 2Q3EA 2Q46A 3FD8A 1JA9A 3ZU3A 3KETA 3K6JA 2RCYA 4MVJH 3RFXA 1VLLA 3H65A 3SJUA 4H7PA 5CHEA 4DLLA 3AFNA 3PK0A 5BT9A 3GVXA 1IZ9A 4IZHA 1LSSA 3DAPA 5JLAA 3QJ5A 4B4UA 2EHDA 1QORA 1D7OA 3DOJA 3QWHA 4WLVA 2VYND 3Q0EA 3DFZA 2C82A 2CDCA 2D5AA 3WNVA 4D41A 3WS7A 2AQKA 2B4QA 4X54A 4S1VA 3QVXA 1SOVA 4OO3A 3TL3A 4M89A 4D43A 2GZ2A 5DBIA 3IP1A 3RASA 5IDXA 3NT4A 2EW8A 3UN1A 1KETA 3VTFA 2DKNA 4YRAA 4MJLA 4GVLA 3WWYA 1T2EA 3GG9A 3G1UA 2X1HA 4IDEA 3PFFA 4HNHA 3QHAA 1C0PA 1GUZA 4FFMA 1HSZA 4NK4A 4CL3A 3LF2A 1E3SA 3ORFA 1HL3A 1BDBA 1IHXA 2FZWA 4OOEA 4YJHB 3AW9A 3FPCA 1E3WB 2FP4A 1V9LA 4FOSA 3BMOA 2P68A 2E48A 1V3UA 1FDSA 3GC6A 1U1IA 4TZKA 2DBVO 4O63O 3WLFA 1H6BA 3X2EA 5C7IO 2DVMA 3PHJA 2X9GA 4KOAA 3H5NA 1HWYA 5COBA 2Q2VA 5KVQA 3IDSA 1E92A 3NYWA 4XGNA 4M1QA 4IIVA 5EESA 3UH1A 2CVOA 3A1NA 3KYDA 2GR9A 2R6JA 4MVJD 3AI2A 4PLPA 5HA5A 3ZHBA 4II2A 3HDHA 4HFJA 5I7SA 1DLJA 2CSUA 5L95A 1AHIA 1MB4A 2WDZA 1JKJA 1C1XB 1SC6A 2P4HX 3F47A 2IXAA 1X1EA 4YR9A 4NU6A 1HEUA 1BW9B 1LRJA 2IZ1A 3OJ0A 2G5CA 5IDQA 3COSA 3RVDA 4PG4A 4I9HA 2WYUA 4AICA 1UXIA 4Y6PA 2F1KA 3WYCA 1QSGA 4BB6A 2PH3A 3KO8A 2PY6A 4ZQFA 9LDBA 5HS4A 1DXYA 5MDHA 4GX2A 2P9EA 2GSDA 4W4TA 3TL2A 2FSVA 4RPJA 1O8CA 1LDNA 1IL0A 5ENVA 1H2HA 3OQ1A 4IDDA 2ZB8A 5JAQA 3QP9A 5A5FA 1UH5A 5DF1A 3AI3A 2SCUA 4J7XA 2VWGA 3P2OA 4PVDA 1ADGA 2JCVA 3JQDA 4CUZA 1TT7A 3WMXA 1HE5A 4BNWA 4GX1A 4HFNA 1HDXA 1R6DA 1PS8A 1IHYA 1B3RA 3NDRA 4AJ2A 4RJTA 5LDHA 1DOHA 1KC3A 4QUKA 5CG2A 3OHSX 5CEEA 3A06A 5JDCC 3VH3A 2Z1MA 2VZ9A 3R3JA 4BO6A 1DC3A 1R15A 4JN6B 4Z9XA 3O9ZA 4XZ3A 2Q99A 4CM3A 1PJQA 5EQFA 4PGFA 5FF9A 3EVTA 2WE7A 4W6ZA 1E0DA 1E7RA 3GOHA 3NKLA 3D5TA 5JDIC 3UHAA 2DFVA 1MFPA 4ZA2A 3VDRA 9LDTA 1VRWA 2HMWA 4J1QA 3GN1A 4D44A 1P1IA 2B4RO 1NNUA 1ENYA 3D4NA 1BVRA 2POQX 5TT1A 3A9WA 3WIEA 4U6QA 1N9GA 3MJVA 4MOWA 3WLEA 4WCFB 1BWSA 2RAFA 4IGFA 3ZW8A 4CM6A 3L4BA 4YT8A 1NM5A 2C20A 2OO5A 3V1TC 4BGUA 2EXXA 3L4BC 4BNKA 2PWZA 1VKNA 2VOEA 3MJTA 2I6TA 4FBGA 4XRRA 1I30A 5BSGA 2UVDA 3DMTA 5T57A 1C3VA 4R1TA 2EIHA 1HYEA 3H9QA 3PWZA 4IBOA 3FRJA 4P22A 3P5SA 4JCOA 4O5OA 2RBEA 3WR5A 2VZ8A 4E5KA 1P0CA 1G0OA 1BRMA 1R12A 3E48A 2Q2WA 1JKIA 3KLMX 3OP4A 5T67A 5A06A 5TQVA 5DCWA 1WDMA 1TB4A 5C7LO 4UVGA 5KCZA 1ISJA 1PJCA 1IPFA 3RUIA 3D0OA 3R1IA 1T24A 3SC4A 2Y1EA 1ISMA 2NNLD 3K73O 3OA2A 3S8MA 4BV9A 1VC2A 3T4XA 2HMVA 4KQXA 3NDIA 5BSEA 1YB4A 4GPD1 1QYCA 1A9YA 3DAFA 2O3QA 1SEPA 2Q1TA 4OKIA 3ZWCA 4PG5A 3ASVA 3TN7A 4AJPA 4GSKA 3VVBA 1ENZA 2O3SA 4N7RA 4Y6RA 1ISIA 4A27A 2HK8A 2HLPA 5DN9A 1HTBA 4BMVA 1G1AA 5JC8A 3DZIA 2DBRA 3FSRA 3IS3A 2B69A 1K6IA 2VUTA 2OZPA 3DOOA 4K28A 4EGFA 3BMQA 1T26A 5KJFA 3NV9A 3TPCA 3FR8A 3JYOA 4LSMA 4CMIA 3EZLA 3PYXA 1P44A 4E13A 1MXHA 3DR3A 5FFFA 3G3EA 4PLHA 5CPBA 3W4JA 1M6WA 2OORA 2Y99A 3BTVA 4HUJA 1U3UA 3C7AA 1IZ0A 1YBAA 2FSSA 4EEXA 5T6BA 3DAGA 3ADPA 1UXHA 4QECA 1Y8QB 1E3EA 1NVMB 2WD7A 3FWZA 4UUPA 3CZRA 4IQ0A 3RUDA 1K0UA 5JW6A 4M54A 3UAGA 3CINA 4HWKA 3V2UA 2X6TA 4TRNA 1CEQA 2DBZA 3WGIA 1KYQA 4MP3A 4DREA 5MGBA 4Q3NA 3U0BA 5T8KA 5AOVA 4NBTA 1H5QA 4IXWA 3LT4A 1QR6A 4R1SA 2AG5A 3PHGA 1Q0LA 2CDBA 1NASA 3T4EA 3HHPA 4FJ2A 3ULKA 3DZHA 4FDAA 3MJ4A 3FN4A 4EJ0A 1Q2XA 1ZVMA 4ZVVA 1JKFA 4PZCA 5AYVA 1OC4A 4RZIA 4CMEA 3L6OO 3PQEA 5IDYA 4L0QA 1VE9A 2Q4BA 3UOGA 4BMSA 1HDRA 4PLVA 1OMOA 1U3WA 3DMTC 3BMQB 3JQ9A 3N74A 1LU9A 1A27A 3MWEB 1AN9A 4N54A 4U8GA 4OXYA 4E32A 1NPDA 5U1PA 4TWRA 3PDUA 1PU2A 3HNPA 3MJCA 4LN1A 2ZTVA 4D79A 3H6KA 2WMDA 3HSKA 4MVJG 4J49A 4F45A 5A5EA 2XPCA 1Q7BA 1UXGA 4K26A 3TZCA 3E9MA 4J0EA 1HT0A 1VJTA 3WGHA 1JQBA 3R3SA 2E37A 2NU8A 1DRVA 1ZSNA 2ZCVA 1NVTA 3RKRA 4EJ6A 4FSHA 4E2XA 5TGDA 4F6CA 2YHIA 3WQQA 3GPIA 1NAIA 3OF2A 4Y6SA 4YAEA 5KVSA 3DBLA 2Y0CA 3PZBA 4Z6KA 4R69A 2QG4A 1KIFA 4W9NC 2J3IA 4YJGB 1B8VA 4IDFA 1JVSA 3KXDA 1I36A 2DQ4A 1GYPA 2ZCUA 4IQGA 3UUWA 3ZWMA 1PWXA 3WBFA 1LBEA 2GLXA 3W1VA 2FHSA 4BNFA 1BDMA 3TOZA 1IYZA 2IEBA 4FFLA 3LT2A 3ICPA 3H3JA 3B1KA 3H9EO 4AG3A 2FOIA 4FN4A 4M86A 3GVCA 1DHTA 1YDWA 2VUUA 1LX6A 1NWCA 3F1LA 5JCJA 4O1MA 5L53A 3AI1A 2UAGA 1TEHA 1R0KA 4BKQA 4BGEA 1VM6A 2PTGA 1CDOA 1I0ZA 3ROPA 2B37A 2YFQA 4CUKA 1T1RA 1KVQA 1N2SA 3EAGA 3AK4A 3GEGA 4CLRA 4J2OA 3ZHXA 1P1JA 1SEVA 2NWQA 1T4DA 3ETGA 4G2NA 3O38A 2GO1A 3U09A 3ADOA 4DPKA 4BIIA 3OJOA 2W2KA 3VKVA 5JAIA 2BGKA 4WEQA 3I9LA 4CMCA 4RVSA 1EUCA 4OIMA 5CP8A 1UXKA 2C2XA 1VI2A 3IUSA 5AXDA 4RQTA 4YJFB 4GGOA 3ZN2A 1E7QA 2UYYA 1M76A 1LC3A 3HDJA 5ER9A 4DIBA 3AFMA 3JD0A 3TNLA 1DBVO 2Q1UA 4U5QA 1E7MA 2AHRA 2VHWA 4KTVE 3WJ7A 5L4SA 4UVIA 2X5JO 2I67A 2PKRA 4YJDA 3ZGYA 4BKUA 3C7CB 5EJ2A 4IM7A 3BHMA 3GEMA 4MDHA 5T5QA 2VT2A 2QRJA 3RC2A 3Q9NA 4YT4A 3EVNA 4R1NA 1L1FA 4KUEA 4AJIA 4UREA 1YL6A 1N1GA 4ND4A 3UICA 3W4IA 2X4GA 2B35A 2HRBA 3H5AA 1E3LA 5AQ1A 2FN7A 1WPQA 2NACA 2EJWA 3AUUA 2X0RA 2BGLA 4Z0TA 3F6YA 3D3WB 3RBVA 5IXSA 4OQYA 2NUAA 3F9IA 1XU7A 2HJRA 2ZB3A 3JD4A 1Z7BA 1JDJA 1W8DA 5JYEA 3VKUA 2D3TA 1CRWG 4OXKA 3X2FA 1FJHA 3SJ7A 4BO0A 4LISA 2W2LD 3DXFA 2O3TA 1B7GO 4G65A 4K1LA 2WSBA 3LT0A 1PQWA 2D4AA 3KV3O 4MP6A 3U4IA 1EUDA 1K5HA 2C7GA 3O03A 3M2PA 5CDUA 3D3EA 2ZYAA 2WD7B 3F5SA 3JQFC 2NVWA 2VZ0A 4NFYA 2EV9A 2Y66A 1GAEO 5KNLA 1NFFA 1Z82A 2G76A 4XIYA 5DP2A 5A9TA 4TVBA 2W4QA 1SO8A 5JYDA 5L7WA 1SB8A 1C1DB 2A94A 3GEDA 3PVZA 4R9SA 4NR0A 2VHYA 3KTDA 3L4SO 1E3IA 3OEYA 1R4NB 3TFOA 1H2BA 4O6VA 3GA0A 3JD2A 2Y1FA 4Y9DA 2QRKA 2GD1O 1HRDA 1JVBA 3L9WA 1LDBA 2NLOA 1Y7TA 4A5OA 2BELA 2ZTUA 3MJSA 4B8WA 4DWVA 2ZTLA 2Q50A 4B4VA 1XA0A 2DM6A 4B7XA 1W0CA 2BFPA 2WTBA 1GD1O 2PD4A 1P1RA 2EP5A 2DUWA 1MC5A 2W98A 3KSZO 2VYNA 3INRA 2CZCA 5KKCA 4BVAA 4XIJA 2DLDA 1I2BA 5IDWA 1O95A 4FFNA 2PGLA 4Q3EA 2RH8A 1HDZA 3VC7A 1U2GA 1X13A 3BTOA 5JSFA 1ZJZA 3E6AA 3UVEA 1U28A 2GNAA 3QIVA 4MVJM 1QMGA 3H8VA 1PGOA 4OSPA 2Y1CA 4AJ4A 1F12A 4XDYA 1CQJA 2HAEA 3U62A 1T25A 5A05A 5THKA 4QFCA 3GGOA 3GVPA 4RO0A 2C0CA 2CVZA 3H9UA 3PHLA 5CG1A 3ONEA 4ALNA 4H15A 3S1LA 3AM4A 4TKMA 3K30A 2GN4A 5U4QA 4DMLA 3PJDA 1M67A 2FPIA 5FYDA 5ER6A 2F00A 3JQAD 4J1TA 3ZZNA 1PQUA 4AJKA 1XEAA 3DC2A 1E77A 3I9NA 3P7MA 1GU7A 4B4OA 2P4QA 4OM8A 1LUAA 4H3VA 2ZKLA 1R4MA 4HY3A 3U3XA 4QT0A 4L4RA 1X0VA 4J4HA 1QV6A 2IYPA 3E8XA
chains in the Genus database with same CATH superfamily
1XKTA 1XIVA 1ECLA 1SXJC 3G88A 4GRDA 1HE8B 2FR0A 3NVMB 5JTTA 1T4BA 1HFEL 1OI3A 4BJ3A 3GPDG 4M0LA 1KDPA 3AIIA 3FNEA 5AVRA 5K3FA 1OREA 1P7PA 2W8ZA 5ARDA 4X92A 3SOPA 2FQYA 1A2OA 4NY1A 4L74A 2OM6A 3CRMA 2G7MC 2WBLC 2BMWA 1YUNA 1YVUA 1FK8A 1OFIA 2PX8A 3VR4D 3JYLA 4MJXA 3UMFA 5JALA 3Q7RA 3ZE8A 1VP3A 3QWFA 4MWSA 1R64A 3GY0A 4A0HA 4NBSA 1PZMA 1D2NA 4PSKA 5A3VA 4OCZA 3KJFA 4GBJA 1JIJA 3CWQA 3PX2A 2GAAA 1GTG1 1L4GA 5AR1A 2PEZA 4UNNA 3MMNA 1FY2A 4XGKA 1CUXA 1GGJA 4GUDA 1I7PA 4BB0A 4BBAA 3PIDA 1DCMA 1QPBA 1WJGA 4MQEB 4NX2A 3NWBA 3SCZA 3JTMA 2HV9A 2GEUA 3WLSA 2EL9A 4E09A 5HP4A 3W79A 4QD3A 3KSUA 4AUMA 2IP4A 8ABPA 4V1CB 3FCSB 1XYVA 4OXQA 4DRZA 2CJXA 3W06A 1PAUA 2PWBA 3LF1A 5EY5B 3LCUA 5EYPA 2NZXA 5T4BA 3SQWA 3TIFA 1KS2A 4GLOA 4ENPA 1Z0SA 1M6VB 2DETA 1EFDN 5I9LA 1NFQA 1U65A 5FAKA 4XD7A 3ZIUA 4QOSA 4EI2A 2I99A 2AKYA 2PN1A 2PMWB 4QARA 2IYFA 5I7AA 1X1BA 4YRKA 1Q7CA 1WOYA 2D7CA 1R0YA 3FDJA 3NANA 2NZJA 3P94A 5LCXA 4BX0A 3IDOA 1T15A 1BHJA 2YZMA 3Q6NA 3L0OA 2PX2A 4POOA 2PUDA 4LE2A 1JLLA 2VF2A 3AVOA 3SXUB 3C70A 5ALRA 1PW5A 2ZI3A 5J4YA 3UB2A 2JJ2D 3O3CA 3Q1KA 1L5NA 2NSYA 2VR1A 2ONJA 1KDYA 3MWGA 4UAJA 1HNXB 4ZXFA 2D2XA 4E3ZA 2B4KA 1C1XA 3F5FA 2PXHA 3MSCA 4FC6A 1BKDR 4MV6A 4QRIA 5FI5A 1NKTA 4FYPA 1II8B 4TXHA 4CIBA 3I3OA 1YRQA 4CKBA 4OHWA 4XLZA 5ESDA 4DLKA 1Q17A 2AH5A 5GVSA 4QHTA 5BN4B 3ZV7A 1DFGA 1EVJA 5JFGA 5FUMA 3KXIA 1ADBA 3ANLA 3RG2A 5K1ZA 3GYBA 4IQ4A 1RE0A 3OX1A 4LZLA 1IATA 1KSHA 1ZCJA 4Q3AA 3Q8KA 2JAWA 3IBGA 4R2XA 5F77A 5L51A 3JQFA 4JLDA 1M2WA 4YTEA 5DHSA 1QF9A 2QNRA 3TRJA 2ZVJA 5DWQA 2IE8A 4C9BA 4XQEA 4Q9IA 3EAFA 4HXGA 1BIFA 2E5FA 2R65A 5BY2A 4U2EA 4DQLA 5FORA 1NQXA 4KC0A 3NVKI 5TLSA 5BOVA 1KH2A 2O2EA 4OY3A 4D6XA 5KNCA 1ZD8A 2VCHA 4TVOA 2AK2A 3NM6B 4YJHA 5KJ6A 3MAJA 3WL5A 4AYTA 1Y4AE 4ARCA 4RLSA 4NE9A 2P69A 1UP4A 4HGNA 4YAGA 4N5NA 4Y1RA 1CY2A 3TPZA 2EBWA 1GPJA 4LGMA 3BH0A 1I7LA 1XFAA 4YJGA 1Z07A 5FBLB 1QYVA 4CL8A 2JNWA 2JGMA 2RGBA 4CT5A 2DWQA 1G98A 1PJ3A 3E1GA 1SXJE 5MDHA 1PVOA 2HREA 5IUJC 4OLBA 1GVNB 1CLEA 2XOEA 1SKAA 2B8EA 2P65A 2Q5CA 3SE7A 3D2LA 3HCEA 3CW2A 1WZEA 2OO7A 4RW0A 4D56A 5FV7A 2R00A 1E98A 5JOQA 3TTWA 2J3EA 1ZGJA 3UK6A 2FQXA 1H42A 3A1VA 4B6PA 5FV4A 1XLVA 2ATXA 1ULBA 3L7JA 4R3WA 1O97D 3FCAA 2VA9A 1EFCA 2VRBA 2PH5A 2H0RA 4NPCA 4NPAA 3NAGA 3B7GA 4OK6A 3UPTA 1J49A 4OKNA 1OXVA 3JD1A 4Q3KA 1QRSA 2DFLA 1FDIA 2IZOA 2OKCA 3AHGA 2P9TA 4GBGA 1E0SA 2CHGA 2QUZA 4J6FA 4LRSB 3KYCB 1J06A 4NABA 5ITSA 1UJBA 2HA6A 4V0MA 2G9QA 2AB0A 2ENUA 4UM5A 2HU2A 1JTEA 3HKBB 4MQ6A 1NXOA 1PNQA 4YROA 3JVEA 1WMEA 2QYSA 1QVAA 1Y9EA 1EFHA 1DOAA 2HC9A 4MR7B 4QGGA 4AY2A 4I5FA 1M2GA 4WK0B 4HDNB 2AW5A 3HG7A 5HILA 4CQJA 5ILQA 4PZUA 1LBTA 1PJSA 3NTRA 4GZLA 5JG7A 5FBVB 1X1RA 1V4BA 4KGDA 3ZGVA 4A2CA 1I2DA 2ZCJA 1GOTA 2APJA 4RSGA 2YYSA 5KYUA 4HEA1 2F7SA 1M8GA 4DCMA 4WOPA 2ZETA 3ESQA 3I6QA 4K3VA 1ZUNA 3ETHA 3PLRA 3GIDA 5F12A 4CKYA 5HMMA 3T9CA 3NS7A 1UKYA 2Z9CA 3H0CA 2A0KA 3FPSA 4FYYA 4IXDA 5T7BA 4FCCA 3HKCB 4MXDA 4DANA 1QGOA 2JLRA 3DE5X 3TTSA 3SF8B 2I0FA 2HYDA 4GP6A 2R8PA 4ZCIA 1NA5A 1WEHA 1MQ9A 3TLYA 2QYHA 4A6XA 2CNWA 4JLMA 2QN3A 4BKPA 3WMRA 3LBAA 3ICWA 3FWPA 3LT5A 4MS4B 3RFTA 2B34A 2HDOA 3P8ZA 2IOFA 3C16C 3R2JA 1JAYA 3CLSC 3IPLA 3H2HA 4XJTA 1ISSA 4QBFA 4HBZA 5LXTF 2OCBA 5K0BA 3BVPA 4PEVA 4LWPA 1WNFA 4FKZA 4Y2GA 3G0IA 1S89A 5LLTA 4X6UA 1F8XA 4BS9A 2WU3A 4LXYA 4LMRA 3TTYA 2HUNA 3ZGLA 4CKEB 1K27A 2RB4A 4EB0A 1NMZA 5M7EA 2ZZMA 1Y6JA 2GYVA 2YJ5A 3AF5A 3LWZA 4RCVA 1F0YA 2X40A 3JYHA 3AHIA 2CK3A 3EC2A 4G5XA 4OB7A 5TJ9A 2ZYGA 1HK7A 3NDJA 4GBED 1D6SA 3ZJYA 3CY6A 1YOBA 4O8CA 1HO3A 5AVOA 2BFAA 1XJCA 2CUNA 4FSXA 1YJQA 2DHQA 1Q2UA 1T3LA 4NFSA 2VTBA 3H04A 3D8NA 2B5OA 4PFJA 3Q9SA 1UM8A 2VJCA 4QC2A 2EZ8A 3TVYA 5IAGA 3AGPA 2E4WA 3TOSA 4DM3A 3CTMA 4BV3A 1IQ0A 1Z8HA 3FWKA 3BAZA 2CY0A 1G63A 2IHZA 4I6GA 3EQ7A 1FMTA 1Z2AA 2QU7A 1L7XA 2VUHB 3A1SA 4HRXA 2MU1A 2ZIWB 1C0EA 3OQJA 3U17A 2WTUA 1QG0A 4NZNA 2OXFA 2Y8EA 1WKBA 3TE7A 1Z6ZA 2AJLI 2CHFA 5PGMA 1NBOA 2HLDA 2HR1A 1OU0A 3OKAA 4I4LA 4D0NA 2IEZA 4IJUA 5EMHA 3FSGA 2FPMA 5G3YA 5ES4B 2E0IA 5JS7A 2CHVA 2Z2XA 3C6QA 2B7LA 4WZAE 1MJGM 4LWQA 3EPPA 4ZAXA 5KEIA 2DR2A 1V25A 5FEUA 3QUTA 3ORSA 2FZGA 3A4LA 3A9SA 4QRDA 3TZQA 2IYVA 1KSJA 3M33A 2ZT5A 4QE3A 3UENA 5LYYA 4BNHA 3K0AB 3JD3A 3PYLA 4MWGA 2PCJA 3CZMA 5EE0A 5TRTA 3UMJA 1GV1A 4UM7A 4WNIA 3VPCA 4X20B 4AUKA 4CM9A 4EF5A 1XVAA 1SWWA 4KAXA 4QGSA 3ICCA 4IYRA 4TSFA 1QG6A 1KH3A 1MJ5A 2NG1A 1TQ4A 2ZT8A 2E6UX 3KKEA 3MCWA 4F46A 4JXZA 1P8AA 2PVCA 2I8LA 2I2DA 2ZZKA 1XCBA 2DFKB 2C58A 4FMPA 2X8LA 5CM9C 4B7ZA 5MHTA 1J90A 2CGEA 3PNLA 4P4UA 3S2YA 5CB0A 5K6AA 4LXHA 1PGPA 3NIFB 1VPWA 4GECA 1VZ2A 4Q3BA 1R66A 3VR3A 1SC4A 4A9AA 3WLMA 3HCPA 1X38A 1G5QA 5NULA 4D02A 1YH3A 2BPOA 3Q3VA 4Z4GA 1CZOA 4AURA 1C7EA 1WCIA 1ZITA 4N9WA 4NMXB 4TWAA 3QNUA 5DZSA 5JD3A 3AESA 1ZNXA 3JSXA 3B89A 3R75A 2Q1SA 4A03A 4B5LA 1XJ5A 1Z0KA 4PWZA 3GMTA 2GDZA 4F86A 4TT3D 2QE7A 3QXHA 4IXMA 4XCQA 5AVKA 3BBPA 2E49A 4KQ6A 4F4IA 3AIKA 1IQPA 3LFTA 1EK6A 1RAAA 4XGRA 4N5LA 4MPRA 1L7QA 2KI5A 4MB2A 4UBNA 1Y3CE 1P7ZA 2Q3MA 5I9BA 1MRSA 1XLUA 1Z6PA 3V4SA 2OB1A 4ND1A 4JVLA 4CM8A 1EUZA 3A70A 3EGXA 1VDMA 2DCUA 3DVAB 3RIYA 3GLHB 4WBNF 1PNTA 1PJLA 4QLAA 5FD8A 5UKDA 2GCPA 3RS7A 3VDQA 5G4KA 1WP9A 1YGPA 1DINA 1DKOA 2NU9A 2ANCA 3G85A 4QQKA 3VR5A 3CZCA 3NTUA 1CK4A 3IMGA 1G5FA 4YQZA 5IAJA 4OUDB 4K9PA 4REMA 2YZGA 1GQFA 1JI0A 1P0MA 2JJ1A 3A9RA 2V97A 3MBOA 2XQJA 4URFA 4N3NA 2V1XA 3BDAA 1NR7A 1AU9A 4RXUA 5IJAA 5FA5A 3SY8A 1JPJA 3I1YA 2Z8XA 1U2TA 3ZXSA 1D04A 1ZXXA 1U8YA 4RDIA 1V2GA 1ZU4A 3NEJA 4FFPA 3FVVA 4B6FA 1MXFA 1HLDA 1A50B 2GTPA 1KZ4A 4NOMA 1LRLA 5FR2A 1YMVA 1XP8A 5EJGA 2WY2D 2P30A 4IFIA 2FK7A 1T3ZA 2YHBA 2MJLA 2R6HA 3N8HA 1I9CA 4R7GA 4QFMA 4M6WA 1XRNA 3IERA 3FWNA 5SYAA 4L0CA 1NZDA 3O82A 1JQAA 1E59A 2EJUA 4EPXA 2JB9A 3D6JA 1W4RA 3F78A 3LM8A 5D51S 5C4GB 4K0RA 1J25A 1YRBA 3MMSA 1L9XA 5D5PA 721PA 4OHFA 5TNXA 4E5PA 1IBSA 3ELBA 1TZBA 4HN4B 4M0DA 3X1KA 5TEWA 5EKSA 1IBMB 5F3WB 4KLNA 1KI9A 2AOWA 2HB6A 5BSFA 3O8QA 3JCZA 2WR8A 2HM7A 2C5SA 4HZGA 1UKCA 1GQ2A 1QGED 2GB4A 3TQHA 3MGBA 3EEIA 4IGAA 4KDCA 5GGXA 5J47A 2OBMA 1HE3A 4XR4A 2OMKA 4E15A 1JE0A 4I1IA 2Y6VA 2A6PA 4GHWA 3GFTA 3WFZA 3RTBA 5FOVA 5EMMA 2D2IA 1HZZC 2HCRA 2XNDD 3NEYA 3JASA 2O8BB 1J2EA 4F96A 1MIOA 3C87A 4D4IA 1PL6A 5TVGA 2AWNA 1ZK4A 2WJZB 3PC6A 3W77A 1OFVA 3UBMA 4ENWA 4BVLA 2EKBA 4GPZA 2FR8A 4V3BA 2RK3A 4MITA 4IDOA 2ROQA 4IJVA 3U4QB 4CVNA 4E4YA 3EGXB 1ACMA 3DC7A 3IT0A 1JMKC 1PR5A 4ZCSA 3MGKA 3VV2A 3HVIA 5BT8A 3KWFA 1Y81A 3A28A 3NHSA 3DHYA 2TMDA 4TXJA 4QYIA 4JT9A 1V8ZA 1AGYA 3LGSA 3OQVA 3VNVA 3WISA 4PY2A 1REQB 3MWJA 4IIJA 3E4DA 2JCBA 4I1UA 4WLOA 3WGOA 2L18A 3TNJA 1H4SA 3KV1A 2B2NA 3ENZA 2PBFA 3L7DA 3P71T 4E4RA 2G5PA 1X7XB 5DSZA 5EKUA 4Z1OA 3NJ4A 1O0SA 3KTAA 3LLVA 1AZLA 2EAUA 3VKGA 3C98A 3HHEA 4BVGA 2FSGA 4UMEA 4EH1A 2AMJA 1QQ6A 2UUOA 4IDPA 4YVFA 5AM4A 2FXIA 4QRHA 3DHVA 5CGQB 1G19A 1XWWA 2IYXA 3PL1A 3TLCA 1GDDA 5A7HA 1ZK3A 3BZUA 4M9RA 3RK4A 4HVLA 1VJCA 3ONFA 2GN1A 3C1TA 5COQA 1I3CA 3ENWA 4LDAA 1ECGA 2J7KA 3Q3EA 4LRTB 5H3CA 2AEMA 5HIAA 3M4JA 1MUUA 3F0TA 3OZAA 3HJTA 3SX2A 5BSVA 4S2EA 2HJVA 4CM7A 5I7RA 1Z8NA 1JB1A 4HDAA 4X6YA 3RYTC 4RGQA 4DYHA 2P41A 5JO0A 2I4NA 4JJGA 3UV3A 4DF3A 2FSVC 1PK8A 2B6HA 2IUSA 2OPHA 3ROXA 4DJFC 1HXHA 3WFIA 3KKQA 1C9DB 4FCWA 4IUDS 2IODA 5FR1A 3SNKA 4CQNA 2XDQB 4D9NA 3QU2A 3UAYA 4UU7A 2DYKA 2H6EA 2R4TA 5B1IA 3FWYA 3L01A 1ZJ5A 4C14A 4YACA 2I9KA 1CZRA 1EJ6A 1OXBB 3VR5D 3NH9A 3IUJA 1KPHA 3A3YA 1U8EA 1QVWA 3NUGA 2XUJA 4F3YA 3HN6A 3A6PC 2WSIA 2FUCA 3GCXA 3RSLA 3T7SA 4AAYA 5KVVA 3VU0A 5K0GA 1U7HA 2YIMA 3ANXA 4KXLA 5JCOC 5T3YA 4QNNA 2ZWPA 4JEIA 1GDHA 1I3LA 3B12A 3PDCA 2AI2A 5DNAA 3V1UA 1KEEA 5LMZA 3R8FA 4Y9TA 3BRWA 4YRIA 4NG4A 1Y4SA 2L2QA 4F7WA 4L08A 5J2UA 5CEJA 4D9CA 1E6LA 4LECA 3W9BA 2QUBA 1ZJYA 2D8MA 1X7ZB 1Y98A 2BUBA 2DY0A 3OJEA 3K5WA 1UJNA 3ZQKA 3JAWB 4G1BA 1E1DA 2FWAA 3WV5A 5BYJA 5JXHA 5LR6A 3UUFA 1X8KA 3REGA 1J99A 3BXPA 4PAGA 1Y6QA 4DCJA 1MJFA 2BD0A 3FKJA 4OLJA 4OXIA 1W52X 5B6PA 3STUA 3TR0A 1YKSA 3PD1A 1YZKA 2BE7A 3HB5X 3Q4GA 4J76A 4MUKA 4X1KB 3T5CA 2KWIA 3PXBA 2O19A 3LNCA 4L95C 3T99A 3UXEA 4EQ6A 2A0FA 3EXHB 1YHYA 4CF3A 1JLHA 2HPVA 1K3FA 3PGXA 3ZNNA 1IIBA 1X14A 2RGWA 5ABPA 1I2ZA 5KTSA 2EJBA 3WYAA 4OX9B 4CLOB 4BUZA 4BWVA 4D45A 4TLLB 2IS2A 2HKIA 3ZBTA 1XQ6A 1HOXA 3IX7A 3F6BX 4Q7EA 1G2PA 1EB8A 1FX0A 2HFKA 4R54A 4UHCA 3G2HA 3TIVA 1R7RA 1O03A 1POXA 5L8VA 1S2IA 2AVDA 1SU4A 2OZLB 4UZFA 1EE2A 1SR8A 1W4AA 3PDJA 5IJ0B 1W9MA 1P0QA 2O05A 5J5AA 5BURA 1Z18A 1DSSG 1UWLA 2ZTHA 4JB3A 5DNWA 5KSPA 3RC1A 4I1SA 2IF0A 3B5JA 2R0QC 1DCKA 1F2VA 2G9RA 1A9ZA 1STOA 3NKFA 4DA4A 3P45A 1LTQA 2DQKA 1VMKA 2Y92A 4CR6A 4K2AA 1A9SA 4B48A 3L0SA 1YRHA 3EX7C 4Y9UA 3GLIB 1BJKA 2UUPA 3VC1A 3M1AA 5AM1A 2ZULA 3D43A 2JJYA 3HWRA 3COZA 5C1IA 3GDFA 4AI6A 3WYBA 1JYSA 1K68A 2FQWA 2KX7A 4DQXA 1NPYA 1AXGA 2YBDA 4G8BA 1XXLA 2FN8A 1XRSB 3G49A 1B1AA 1KHTA 1NW3A 3B1YA 4XARA 5IAEA 5AIBA 4RTSA 4IPTA 1YS1X 2JASA 3WA7A 4P36A 2O48X 4Z8XA 1V3TA 1KOGA 3PHIA 4DXDA 1P2BA 4QXAA 1Q1NA 5LN1A 4NCIA 2GYUA 3WKEA 4PONA 2JKYA 3PXXA 4RPLA 2H3HA 4J7AA 4PHTA 4RHCA 3RSQA 3TQOA 3COYA 1ACLA 3TW0A 4YA6A 2XMDA 5AW1A 1HFKA 2ZBFA 2R8XA 5B2EA 4WLFA 4LJKA 1RADA 2ATCA 1N2CB 3N6XA 4AZSA 3FNBA 3ASZA 1VG0B 1R2QA 4P0TA 4CJXA 4KAAA 1TKRA 1VE3A 3KEMA 5C3MA 1YACA 3EFHA 4C7VA 4DRYA 2X8JA 4U2DA 4OI0A 3TD9A 1OR8A 1W5FA 3IQZA 1GR0A 3TM5A 1HTTA 5CFZA 2RH9B 1LDEA 5E0OA 1ODIA 3MOIA 2ZG6A 3DFIA 4RDHA 4H77A 2GRUA 3TW8B 1E3WA 4PQRA 2XB9A 4ENTA 1WUHS 4J90A 1JG7A 4WIAA 3SBEA 2BYTA 1CJMA 1BXKA 1CUDA 1R0ZA 3BXOA 1O5TA 3NEPX 2CLKB 3O2NA 5FJIA 3ZHQA 1W36C 1GILA 2O3JA 4UATA 3RWBA 5JMTA 2CV1A 1R8SA 3EB9A 3PNYA 3EN0A 3PT5A 1D09A 1ZD4A 3ZY2A 4IR7A 4BFTA 3G2NA 4JSTA 3D8TA 3QV1A 2H8GA 4HR7A 4O4LB 2FF7A 5EGNA 2C2OA 2BM8A 3KBOA 1PQ4A 4TKLA 5JSYA 4IH1A 4DTCA 1EDOA 4QWMA 2YW9A 4X7MA 3I72A 2GRJA 3ZE7A 4CLEA 1J0CA 3QEBZ 1Q11A 1QHFA 2EX4A 4OHXA 5BW6B 3D6TB 3NP9A 1FUEA 1K2WA 2JPDA 1GSOA 3EDOA 2H7CA 4YONB 1ZR2A 4PLYA 4AZ3B 4JV5B 1WB5A 2ZBVA 3I1IA 1PZFA 4FGLA 4YRTA 1T2FA 1S4QA 1MZVA 2KW5A 3THSA 4E1BA 5JISA 5EP4A 1JXMA 3W6ZA 4BFWA 3BYZA 4OI2A 4PZ0A 2G08A 1CT9A 1PJTA 1QM5A 2C5EA 4ZDIA 1Z2PX 3K96A 3MT9A 4OQQA 5FNVA 2V4ZA 1ZD2P 2O0JA 1OBHA 1TQDA 3CNHA 3ZTWA 1BGWA 3IUYA 1MO4A 3QA9A 4DZRA 3Q6MA 1DU4A 2P9YA 4HGZA 1N25A 1Y82A 3KNZA 3OIFA 2X3FA 1W49A 4INAA 3EH1A 4IHJA 2FUNB 5SZIA 1YQXA 2FPUA 5JBIA 4L0MA 5EUBA 4MQ4A 1XMSA 4QTTB 3SIRA 2ORED 4OMUA 4P4GA 1WQ4A 2Z8ZA 3CS3A 4ZQHA 2WZQA 4AZWA 3CVWA 2HF7A 3L8MA 2LGJA 3EWIA 1GPNA 5F1OA 4D97A 1WCV1 1DJOA 1HH4A 1M1NB 1T1SA 4TSRA 5CT9A 3AR9A 2BEUA 3K0KA 5HS6A 3WV4A 4KGZA 4AXXA 3V4FA 1U5CA 4ZGBA 1NFRA 3GAFA 1E6UA 3OLZA 1FDVA 2XTNA 1G21E 4F8EA 4F4DA 5HWSA 1NRWA 1RTTA 2BFOA 4UVHA 3NGMA 4W5JA 3IR7A 4AECA 4IP0A 4LG1A 4KITB 5AVQA 2MMCA 1FVFA 1L8LA 1KEUA 1PIWA 4U9HS 1K8ZB 3ZLVA 3UJNA 3JRWA 1B14A 4FZRA 3F4BA 5LQNA 4I0WB 3IJPA 3E81A 1WV0A 2DY1A 3GEEA 1ZSYA 4A73A 4DMKA 5JFTA 4ZTBA 1E9DA 5AICA 4WW0A 4PX9A 5LYJA 2FP3A 4LA4A 4HAOA 3OEWA 4I1VA 3UPDA 3S1SA 2CCJA 1PR1A 2J32A 4PQFA 5JSZA 4DJAA 4B4KA 2ID4A 3TBFA 5H3LA 1N0IA 3BH7A 4AWBA 2WJ4A 3B9BA 3C4QA 3X44A 4ZZ3A 3KQOA 5DFAA 1MA0A 2VFAA 4XVRA 5FA6A 3ZHUA 1DB3A 2GCEA 3UK2A 4M0MA 4Z4HA 2FJUA 2PNFA 1KEPA 1VP9A 3V33A 3CO5A 1R4ZA 1GKLA 1GUFA 4RAQA 4CKBB 3NOXA 5DTJA 1ORWA 3DBOB 1XZFA 4GYJA 1QE5A 3KHTA 1NXXA 3DOUA 4REQB 1Y6ZA 4ZHQA 3MOGA 4PHHA 4X9XA 4PO3X 4QDJA 3K1ZA 3G7UA 5G0SA 3AUAA 2G4CA 3RHZA 1X7WA 5JAMA 3V1KA 1FW8A 2GNPA 2QTGA 1RAGA 3IP3A 4ZQCB 3OFND 3PC8A 4XPIB 1HLPA 5KREA 1X9GA 2YRXA 1UMCB 5AW5A 2PO5A 3SEFA 1QK5A 1LF5A 1SQFA 3MC1A 3H5LA 4CQMB 2ATVA 1NN5A 3TGWA 2WYOA 1EK2A 1RYDA 3T6KA 2P0YA 1G3QA 2EKQA 1WXDA 1FS4A 2JKVA 2O2XA 2NUPA 3PLNA 3RTEA 5ILOA 3GFBA 5EINA 4RF5A 5IC4A 2PD6A 1K66A 3K09C 3P9RA 2QY9A 3RO7A 5FI3A 4FR5A 1SZPA 2WIJA 2C5AA 4NCHA 3OH8A 3LX5A 4L9AA 4U2FA 4FHGA 1C0LA 4Q12A 3C2QA 2QD1A 4X8LA 3ENKA 4ARZA 3LP6A 5JO9A 2AEJA 4JHLA 3SZMA 4WZZA 5CBKA 2J9GA 1SBQA 1PL7A 5IUNC 2YCLA 2H00A 4MJ3A 1US8A 1T3TA 4YEDA 2W2PA 3GJTA 1F4PA 4LPSA 5K7SA 1FW6A 3DHNA 2O0MA 4IMJB 2DBYA 4AP9A 3OQHA 5L7TA 3IXMA 4RLFA 1CRZA 4E1VA 1Z73A 2VDWB 5JD4A 4M9CA 1Y80A 4CLOA 3EDQA 1YMQA 4NI5A 2CLMB 3R5TA 1MW8X 3OE5A 5DMHA 4ZOLB 3KUXA 1B26A 3KOMA 1J20A 1FTQA 5IFKA 4NEQA 3QYJA 1GARA 1YRAA 3BWVA 1P75A 3CT6A 1R9MA 3GLSA 3KLOA 1XQWA 4RCZA 1I3OA 3U26A 3L7IA 4MPPA 5D8DA 1SIBE 5FL3A 5EJEA 1JX6A 3JQAB 4ZQGA 4ZI7F 2IU0A 5F23A 4QHYA 3OQPA 2VF5X 4ZHSA 5CDHA 2HW8A 3L1UA 1UBFA 1RQ2A 1MMFB 4DYDA 1FNDA 2BEWA 2Q0QA 3ON5A 2BOVA 1A5SB 2JGLA 1DTSA 5EJ6A 2HQRA 4MQFA 4RLHA 3CSUA 3MMPA 4LXTA 1GCUA 1Q91A 3ZZ0A 1XE3A 3IEXA 1K88A 3ACBA 4M0FA 5EXPA 4NHEA 3QE9Y 1IVNA 3MXTA 2Q3CA 2XXJA 2W6QA 4ZVMA 5IXYA 4X24A 4EIWA 3WWPA 4F1JA 2XQGA 3PXCX 3OTIA 5EEGA 4HNSA 3RIGA 3TSOA 3ZDZB 3RTGA 3DDHA 4CCYB 5IH3A 2VWHA 3EAQA 3EXG2 2IV7A 4BNZA 5U4XA 5ADWA 1EUCB 2BEJA 2QLLA 4M99A 1JSRA 2YDXA 4CDMA 2R6R1 5BSMA 3GFRA 1GZHB 4JLOA 4KQCA 1TLFA 2BI7A 1NMYA 2EZTA 4PSCA 3A6LA 4BLPA 2H4FA 3N58A 3K8OE 2XMPA 3PUWA 4OHYA 3HH8A 1G0NA 4V0KA 4YRSA 1ZPDA 3IP5A 3QV2A 5M29A 4UPDA 5E9JA 2VJMB 2HSZA 4YALA 4GOMD 3C6ZA 1JG2A 2Z08A 1P1FA 5KNCH 4X1YA 2P5UA 2ZE5A 3H5TA 5A6VA 3PR1A 2IYUA 4TN5A 3OX4A 4K9NA 1HETA 3SQOA 3A6HA 3ODGA 2BE9A 5IFLA 3CGGA 1X8JA 3S2FA 3FTDA 3ZNPA 1E6WA 4CI0B 5BQFA 4LZWA 1E9VA 5JSZB 1I4OA 3OZIA 1M2FA 2YNMC 3WK8A 3WL3A 3OSZA 2HJ9A 2REQA 4Z4IA 5B30A 5K8TA 3ZHVA 3RSGA 3ED1A 3VR2A 1ZM7A 1GPAA 1GN8A 1XDGA 2QTHA 5CCEA 2LCFA 4UE2A 4AJOA 2O1WA 1VG9B 2JAPA 5BNFA 3UMMA 3K0CA 2B1JA 3DT6A 3QOWA 1NR1A 3D1JA 4HEQA 5K0LA 5LPNA 3ZUGA 4FQ5A 1OY1A 3ELWA 4P8RA 1EWTA 5HYVA 1YT5A 4QUHA 5IF9A 3OZGA 1GM5A 3NUQA 2OVBA 3L93A 4RNCA 3HZHA 3FUCA 2H52A 4MH0R 3QVWA 1KBQA 2AN3A 1RP7A 3GA5A 3U0VA 4F2HA 3SVLA 3ENNA 1QVVA 5DYTA 3RLFA 3TRIA 1EFRA 3PEYA 1DJNA 1U8AA 4IDQA 4OGWA 3TE6A 1N2ZA 1N5LA 2JI7A 5KOJB 2JEYA 5EHQA 1NQTA 2R97A 2VHXA 5ITVA 3CWCA 4QUIA 4YJFA 4R8KA 5KWEA 1MX1A 1VSQA 1XZKA 3WY9A 2DLCX 2NGRA 5M3BA 5IG2A 4Q4LA 3I09A 4ZQEA 2QUIA 4IWNA 2AN4A 4GEKA 4S2UA 3NQ41 1M74A 5DNEA 1FS6A 1ZEMA 4JBHA 3MB8A 1A5ZA 5ILGA 3ZTYA 4X8MA 2Z2KA 4PPGA 1E9EA 4NXNB 1FSSA 1SN7A 2O57A 1QU2A 4DIKA 3R9WA 1RPNA 2IP2A 2HU7A 1F0PA 1IBRA 3HFJA 3IAXA 3LIIA 5CR9A 1H3NA 3M9XA 3OY7A 3FRHA 2DQSA 4ARVA 4I5IA 3HXQA 2JBAA 3O8DA 3LX8A 2WIFA 4H35A 3SHQA 4B7UA 4DB4A 1BHO1 2BI8A 3GFSA 5KJ1A 4KHZA 5HTKA 3H4MA 1U7XA 1ZY2A 3J81k 5B4VA 2QT9A 4EA8A 2QN7A 3PRKE 1P6QA 2H17A 5DN6D 3SZUA 4EJSA 2F8MA 1W5SA 3IJRA 1G6OA 1NVXQ 3GJQA 2RI0A 2GK4A 4UEOA 3QW2A 3L5KA 4DLTA 4J3NA 2VRCA 3EBPA 3GMIA 1QQAA 1QAQA 2AXQA 4YAUA 1YBVA 4RLQA 1P5RA 1PVDA 1JKJB 3CF0A 2XMGA 1ZIOA 4P4LA 5CNMA 1U3VA 1T2AA 1K63A 3MT7A 3IMKA 4XWTA 4JC0A 4HLCA 1U9IA 3ILHA 3FYUC 3E18A 4C5AA 1E7WA 1I1OA 3VH4A 1R8YA 3E9RA 3U9SA 1P61B 2CBGA 1ADCA 4ZGWA 2JIZA 2JH9A 4I6EA 2BGNA 2GPTA 1UEJA 5CB8A 4UE6A 2YOHA 3BXHA 3HU2A 1QFZA 5TY0A 3OLQA 1N2XA 1EWRA 2BSXA 3GEPA 4YI5A 5DP1A 1BS9A 4Z9FA 4D6PA 5F98A 1NDHA 1TFRA 2GF2A 2JGAA 2PGXA 3VU9A 2H1OA 4GMHA 2PGDA 2V3CC 3BRSA 2QRMA 1QUEA 1RI5A 2HK6A 1R00A 4GT1A 3NOOA 4XKJA 2GAFA 4B81A 2DR0A 2X42A 3OF3A 1KI4A 5KJCA 3SDSA 2GBFA 1XRQA 4TMYA 1R0LA 3PJFA 1LDGA 1TXGA 2AMFA 3JZFA 4ID9A 3ONNA 4WFQA 4XSHA 3ZDYB 4B71A 1TEZA 2ZSFA 1DUSA 2WUDA 4TWJA 5BN3B 1I10A 4HX5A 4LV5B 2P1DA 1GFZA 4J91A 5EWJB 5DSXA 2FRDA 4I55F 4MS1B 3T12A 4RK6A 2BWJA 3NTQA 3S1AA 3OZCA 1YS4A 3V4RA 2Z3ZA 2ZBDA 3DE0X 3HGTA 3S2EA 5KTTA 2WQ6A 2Q8NA 4BYGA 4KP7A 1XU4A 2JCSA 3KEFA 2FPPA 2Q2QA 3MEQA 2OQVA 4O0MA 5KTPA 4YUVA 3OSUA 1I5OA 3X1XA 3LFUA 1VGVA 4Q1FA 1YE5A 3IJEB 2Q3BA 3GGJA 2XRFA 2B82A 13PKA 2YICA 3AWDA 4MUGA 3DNFA 5LDGA 3RU9A 2QRGA 4FUTA 5L9AA 1PUJA 6ADHA 3DGFC 1BMFD 1ECFA 4BFSA 4ZT7A 4HS9A 2IS6A 1G9SA 1O4VA 5DN6A 1Z3CA 5EQJB 1M1ZA 4W7HA 1L4LA 1WE2A 2VHJA 3HY4A 4L4XA 1YDEA 4UZSA 4IJKA 3VUEA 1EIZA 1TYAE 4NZYA 2FPGA 1YONA 3TNFA 3ZVLA 1UFKA 3EVAA 2YV1A 2AR0A 3FCEA 1NONA 2ZDQA 4AU1A 3NHYA 1NW7A 2WP8J 3WO1A 2RHGB 3IBCA 5B7NA 4ZU6X 4LY3A 4M8LA 1DEKA 1V6SA 4MDEA 1GA4A 4KIUA 4C88A 4C7XA 3OZXA 4P31A 1V4VA 1VL6A 3QFHA 4W63A 2EYQA 1QB7A 2WV9A 4RV5A 1LI5A 4PXYA 4P7FA 2P9BA 5JS1A 1OYYA 3OZRA 4PM4A 4E22A 3UJ7A 5AKHA 1YFKA 4C0WA 4FQ8A 2H57A 4FC7A 1G5IA 4YI3A 1NI4A 5JRDS 2CNOA 3CJTA 4URYR 3ZV4A 1A8QA 1CS0A 4NXMB 2PRYA 4ZI5A 2C0PA 1W96A 2I7DA 2XHEA 3LECA 4BVJA 3FMIA 3DDWA 2EKLA 1TM3E 2R5NA 4UDNA 5DEOA 1W75A 3ZU2A 1UBUS 2CVQA 2E2WA 4WXYB 1R5JA 2IITA 1CRQA 3PHBE 4PNHA 4JWTA 1B8PA 1W5BA 3CF2A 2POCA 2JA1A 4FYIA 4ABTA 2BEWB 4EHLA 3C6BA 3CR7A 4JUFA 3COVA 3L82B 4PPNA 5K4GA 1U9JA 3EH2A 4NPHA 5FOQA 1ZVKA 2FMUA 5JBNA 4FMDB 1K3TA 1G8HA 2WZBA 2NVBA 3FVWA 1TQ6A 1XEXA 2HCFA 3L1VA 1W47A 2ILVA 3G2OA 4HDRB 4FGJA 1ZW1A 1J2UA 3T1OA 3FOWA 4TMFA 4CEIA 3TO5A 1QP4A 2D7DA 2V9ZA 3BGWA 1C50A 3QXCA 1SOMA 2IEIA 3GZNA 3PNSA 1FUUA 4KXQA 4B46A 5C35A 1XAIA 4FWTA 3VX4A 2C7PA 1HL7A 3GG2A 2A5DA 2ILTA 3N2EA 4MUHA 4RF4A 4Q5IA 5FWYB 3MXOA 4DSZA 3W5BA 3SX0A 3PUJA 4O2BA 1WETA 2QLJA 2VHVA 3HO1A 3ZW9A 3TMKA 2F90A 3H4VA 4G23A 1ZOIA 3D3JA 5KSWB 4LZJA 2CNWD 5BQ3A 1J6UA 3A2MA 4PYMA 2FG5A 4XXHA 4YP6A 3WRYC 4QLBA 3D7KA 1P0FA 2WWFA 1P19A 1PSDA 1Z75A 1SBIA 1T8UA 1XN1A 1V0JA 2BDEA 3ZE1B 1BS2A 4R9VA 2VP3A 4RHEA 5GONF 3VPSA 2PM8A 1IRXA 5HTOA 2WTEA 4S0ZA 1JG1A 4XYGA 3B1FA 3ANNA 1PYOA 3KWJA 3GR6A 4KSYA 4NDNE 4RY0A 1JDZA 5IKOA 2YJTD 2ASEA 1DIHA 4FHDA 5CVCA 2VJLA 3GRPA 1QBGA 4QU9A 3I4CA 3OJWA 1GHTA 1QX3A 2PMDA 2AFHE 3UM9A 4MAFA 3WQHA 2JZCA 5LMUB 4N39A 4GZ5A 5MN5A 1ORIA 2Q5QA 3ZZUA 1V1RA 1CD5A 1X80A 3A3PA 1BW9A 1DFIA 2IIVA 2JFGA 4QNRA 4F6LA 3OQBA 1M2NA 4LBVA 2IV3A 4JEMA 1GG2A 2Q3DA 4X6LA 4IIHA 5JCXA 5F9FA 5U9CA 3KQHA 4N7BA 3C41J 2VXYA 3U6BA 4L5AA 5ICMA 1QH0A 4CU5A 3JQ7B 3G2PA 1X9IA 2VBCA 3EHDA 2R11A 3KYDB 4AF8A 5HSGA 2OV4A 4MPTA 3SMVA 2XE8A 4JP5A 1GZDA 4WOJA 4HUQB 2UUAB 2GXQA 1IN6A 1J00A 4WFKA 3W3ZB 1ZD9A 2BEVB 1F60A 1G66A 4KRXA 4BMXA 4C4SA 5JVDF 1U8UA 3P27A 1PEAA 1QO7A 1USIA 1Z45A 3IRVA 3DLIA 4Q03A 1U0TA 2EBHX 4J0IA 2YV3A 5FLYA 4ZVUA 1H65A 3T1QA 4A2WA 5FWNA 3A4MA 5IK2D 3AVUA 1JHMA 1EWVA 2ZUBA 3EEQA 3F5QA 4NJOA 5LYJB 4RK0A 4EFLA 5KNDD 4QSHA 1L8QA 4Q05A 2HLHA 3KL4A 3GDOA 3VI4B 3IIIA 2A0WA 3VZBA 3ZE6A 3L7OA 4LOJA 1CUVA 2EWVA 2VUIB 3AR5A 4LHVA 4PPYA 4TLCA 5CLHA 4HHEA 4YP0A 5CDTA 3ZI7A 2QBYA 2JGJA 2OHFA 2PQ0A 2H5LA 3ONWA 4TYPA 1KC1A 3WICA 2HL6A 1N7HA 3BMNA 3QK7A 5DOVA 4P53A 2EC5A 5E7JA 2NMVA 1J2TA 1H94A 2YYYA 2BJHA 1EQAA 3AF1A 4HWPA 4F5ZA 2ZSJA 3EYAA 4M46A 4JR0A 4I46A 4UQPA 4DUZB 4B47A 3I01M 5BR4A 4ASUA 3BTSA 1Z16A 2WB2A 4JENA 3GLGE 1QP0A 1KWGA 1TAGA 2DX7A 5FTNA 3RTDA 3FOEC 4RZXA 3HGMA 3FPLA 3GJ3A 3K15A 3NDPA 1GGVA 1KDTA 3MTBA 4EW6A 2IYYA 1W85A 3U7FB 3QA3E 1IXYA 4IVPA 1T2CA 2VYVD 1SFRA 2PUVA 4TS4A 2OO5C 4M38A 1PTJA 4JYZA 3IC5A 4J1TC 1YJ5A 4GFDA 4ZJZA 4PFSA 4L0DA 5DDIP 3CZ4A 4O8ZA 3NRJA 2TMYA 5E1OA 2BLNA 4MIOA 1EI9A 2A86A 2NTEA 5K6TA 3I4FA 3R7AA 4OQDA 1CU1A 2X4DA 5TMDA 1QIGA 4PGAA 2OBYA 2WRZA 4BNGA 3Q2KA 4NOLA 1A4XA 4OIFA 3QELB 2D1RA 3WAGA 1FFGA 1Y8CA 4TMZA 1II8A 3P9XA 4LGCA 4OMDA 3TLMA 2DEUA 3HY3A 2JGNA 4GI7A 2QYTA 2F3QA 4N0MA 2GPBA 4OJMX 2YFKA 4XEHA 5ANRB 4TZTA 1JEEA 3P2MA 1V3QE 1UWKA 3JYQA 4R98A 4WZ6A 3D8HA 4OQPA 1ZUD1 1OQAA 3EFOA 3HUFA 1GZ6A 1JQJC 3Q5GA 5DSTA 2X8AA 3O8RA 1Z13A 1U4OA 5IPFA 4XA8A 1ZKMA 2ZAYA 1XF1A 1AF4A 1J23A 4GKBA 3AR2A 3VR5H 1SAYA 2W7TA 2HA0A 1RBYA 1MV5A 4ANFA 4LI0A 4GG1A 2BFFA 2OQRA 4LYYA 4GWKA 4ZCRA 1Y5NA 4EHIA 4O29A 1JXAA 3PI6A 2F6RA 1JZQA 3LTEA 2I5PO 2RG7A 4H1VA 4RACA 3U7GA 2ZRPA 1A96A 1CJVC 3F9CA