4IIUA

Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with nadp+ at 2.1 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
243
structure length
243
Chain Sequence
b'MSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from Escherichia coli strain CFT073 complexed with NADP+ at 2.1 A resolution
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 92
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4iiuA00
4BQPA 1P74A 5HWSA 2VQ3A 3TJRA 2GERA 3B1KA 3PWZA 3GMDA 4TRRA 4PZCA 4TZKA 1NASA 2JKVA 3BMNB 4DPMA 2OL4A 1GU7A 2PH3A 3KETA 3E82A 2P5YA 3C7DB 4RZIA 5ES3A 1I33A 1DIHA 1MV8A 3DBHA 4RZHA 5H81A 1B0AA 4CQMB 1U3VA 3M6IA 1LBEA 4OKIA 3HHPA 2EEZA 3U4IA 1SEVA 5B4UA 2JHFA 1PZGA 4UEJA 1ISFA 2IYPA 5T57A 3RUCA 4BNGA 2WD8A 4IDBA 4Y9DA 2EKPA 4DIOA 1JAXA 3D5QA 1YWGO 2BFPA 2YQ5A 4WE3A 1QYXA 3VHRA 1U7HA 8LDHA 5A04A 1YBMA 1ZJZA 3NEPX 4QUKA 2VT2A 3RBVA 5IDYA 1MB4A 1SEPA 4BO1A 4BO9A 2VHVA 3HN7A 5JAIA 1EK5A 4E5KA 4TVBA 1O94A 1QLHA 2P5UA 2VZ9A 4G2NA 4CL3A 3E9QA 3GG2A 3IS3A 2JFFA 3GZ4A 4BKQA 5K6AC 1ISJA 2X7HA 3V1YA 1XKQA 2GN9A 1Z75A 4BNMA 3OH8A 4CR8A 2GASA 2DAPA 4GX0A 4I5EA 3DMTC 3D0OA 2H5LA 5IXSA 5TS3A 1GR0A 2I99A 1DJNA 3RKRA 4M1QA 1V35A 1NPTO 3AY3A 5JNLA 3EYWA 4YAJA 3MTGA 4N54A 2VTEA 3MJ4A 4WLNA 3OHSX 2DPHA 3PQEA 5A3VA 5A5EA 4LN1A 4B3IA 1XWFA 3PP8A 2WD7B 1H6CA 1PGJA 4BNLA 4DXHA 7ADHA 1EZ4A 1U7TA 4RLSA 2HAEA 1BXKA 3N74A 4U7WA 2WTBA 2FZWA 3ZN2A 2HJRA 1M66A 1PL6A 1KEWA 3WQRA 4E2ZA 4Z9FA 3BAZA 3CH6A 3FPLA 3VH3A 1UZMA 1LSUA 3E03A 2D1YA 4FC6A 2VUSA 2UV8A 4XQ9A 4GWGA 3C8MA 1AGNA 5DCWA 1PZEA 1ZMOA 3VTFA 3BYZA 1L1FA 3KTDA 4QX6A 1MA0A 1YO6A 3FR7A 5COAA 4J3FA 3LC1O 3OA2A 1F8FA 3DBVO 5TNXA 4F46A 1I3MA 1TA4A 1C0KA 1EVIA 2QQ5A 2A92A 3BHMA 3QA9A 4TVOA 2J5KA 1LDGA 2FR1A 3GN2A 3VH1A 4CL8A 2PZMA 1PIWA 3KSDO 2Y1GA 4D3SA 1X0VA 4ITUA 3A28A 4CV3A 2JAHA 4BNKA 5ER6A 4HUJA 4I5DA 4AG3A 1NPYA 3DR3A 4EEXA 3JQFA 5B4TA 1IB6A 1YKFA 2VWQA 5I9LA 1MP0A 3G0OA 1R6DA 1JU9A 3IMFA 1JA9A 3Q9UA 1KY4A 1JVSA 2ZYGA 4D45A 1LDEA 2CF6A 1ORRA 3ZHXA 4YBZA 4CJXA 4MVJM 2H63A 4GMFA 1YS4A 4O63O 5ILOA 1EE2A 1SOVA 3QVTA 1PQPA 1CQIA 5FI3A 3S2GA 2NVUA 3B1FA 1DLJA 3GDOA 4K6CA 2W4QA 2HU2A 1YJ8A 1PZFA 2W90A 4JX8A 4BNUA 4FJ0A 4UVEA 2OORA 4AJPA 4HFMA 1LLDA 1YH3A 3GF4A 3OQ1A 2X6TA 4BO3A 2OP0A 5BQFA 4TKLA 4OO3A 4BOYA 3BHJA 4XWYA 5EN4A 3W6UA 1CQJA 1C3VA 1NTOA 2B37A 3RU9A 3PFFA 4GWKA 2Z1MA 2ZQZA 1LRLA 4UVDA 1NWCA 3DDNA 2JL1A 1A4UA 2D5CA 2CSUA 3AFMA 3NGXA 4EBFA 3MOGA 4E6PA 2HQ1A 3F4LA 3RJ9A 1YGYA 1VL6A 4TRJA 3JQGA 1KERA 1FDSA 3WBBA 2DVMA 3QP9A 3PHHA 4IIVA 3GFBA 2XPCA 3TZ6A 5JMWA 5K9ZA 3DBLB 3TRIA 5L4LA 1DSSG 4CM9D 5DP1A 4E21A 5CEFA 1Y9AA 4EUHA 4DUPA 1U3WA 1GTMA 4O6VA 3RC9A 3WGQA 5CPFA 4ZQBA 5FEUA 1P1HA 5A9RA 3WIDA 1WP4A 4OH1A 5ER9A 3ZCXA 2ZTVA 4U0JA 3GAFA 3NT2A 3AU9A 3ZV3A 4OIMA 1ZH8A 1R16A 1HKUA 2JD2A 4MVJH 2D0IA 2Y68A 4KUHA 3RJ5A 4GMGA 4YJDA 3W8EA 2PA3A 3I1JA 1HSOA 4CLEA 4LCJA 4MINA 3SXPA 3MWDB 1AXGA 2XXJA 2DTEA 1ONPA 4AJKA 4IZIA 2Y99A 3H6KA 1PQUA 5TT0A 2NM0A 4Z9XA 2X9VA 3ZU5A 1E0DA 3JSAA 3IKVA 1H2BA 4BB6A 5ADHA 3A9WA 4WASA 4J9VA 4HFRA 1YQDA 2H1SA 3MWEB 2G5CA 4CLOA 1I30A 4A2CA 1R4NB 2YW9A 2BFAA 2OBYA 1H5QA 2AG5A 3JQCA 4RLHA 3BHIA 1HZJA 1PX0A 2C20A 4J7CA 5DP2A 3NDJA 4XB2A 1GY8A 2BGLA 2G76A 4A27A 3AFNA 1HE2A 3INRA 1K89A 2CF5A 2WYWA 4JBHA 4CQMA 1VLLA 1LSOA 4RV9A 4ND2A 5EERA 4EJ0A 3AI1A 3L4BA 4NNJA 1W0CA 4IMRA 3GUYA 3S2FA 3ZNNA 1LDBA 4G5HA 1KVRA 4M89A 3ZW8A 4ZQGA 5L3ZA 4K6FA 2P68A 1YVEI 4NBTA 2QRLA 1WDLA 2YDYA 1Y1PA 3SEFA 1PGQA 1F14A 3D4PA 4MVJP 2G82A 3ONEA 3SVTA 3GUCA 3KYDB 5EPOA 3ITDA 4AFNA 1WDMA 1P3DA 3BMOB 4R01A 1NXQA 1T2DA 4AL4A 2CDCA 1LC3A 3CMMA 3H9GA 4JGBA 4MIOA 3FNHA 1E3WB 3NKLA 4HADA 4FB5A 3I52A 2FY8A 2GF2A 3OECA 1NBOA 3C1TA 1NP3A 1VKOA 3JQBA 3FBTA 1N8KA 2IZ1A 1YOVA 4TKMA 1DJQA 3G49A 5EJ2A 4XR4A 2UYYA 2XOXA 3CXRA 3H2SA 4Y67A 1M6HA 1KEUA 3MEQA 2NVWA 3NDRA 4ALNA 5TF4A 1A7KA 1ULSA 2NACA 2Y0CA 2Q4BA 3WDSA 2GR9A 4NK4A 3NJ4A 4DBZA 1ZXBA 5JAQA 5IN5A 2C82A 3H5NA 3OSUA 5AXAA 4DTIA 1PJTA 3Q9NA 2YY7A 3UUWA 1R4MB 2BELA 1E3JA 3PIDA 4FN4A 2WD7A 5FFFA 4G65A 1PGNA 4C4OA 3VDRA 1JWBB 3T7EA 3S2EA 2X0RA 3H9QA 3LK7A 4DC1A 1PJQA 4D79A 4RO0A 3AJRA 1A9ZA 1U5CA 4BO2A 3RUAA 5BSHA 4HWKA 3GMSA 5EMHA 2FR0A 2R2GA 3EW7A 5I8ZA 3K2BA 4ND1A 4K9DA 3L6EA 1NQTA 2OHXA 1DIGA 4ZRNA 5T6BA 1UXIA 2NQ8A 4A10A 2Y05A 4Q3CA 4I9UA 4ZHSA 3F9IA 3UVEA 2C5AA 3UF0A 4BUCA 1VSVA 4OOEA 3WICA 5LC1A 1QYDA 4W99A 1QRRA 2NWQA 3JQFC 1N9GB 4L4RA 5L4SA 4KUGA 2LDXA 1E7SA 3F5QA 2P4HX 2UAGA 1KIFA 1NX6A 2QHXA 3HB4X 3QVOA 2ZQYA 3WQSB 4CPDA 3ASUA 1ZVMA 1T2AA 3G1UA 2EGHA 3QVXA 4JXKA 4PIVA 4JP2A 3HQ4O 3ONDA 3RC2A 4N5LA 3BXXA 1LQUA 1EQUA 3TFOA 3C3XA 3WXBA 4FFLA 5HTOA 3TZKA 2F00A 5JY1A 3ANLA 2D2IA 2YFQA 5JC1A 1N1EA 3QWFA 1B2LA 1IL0A 4PLHA 1HYHA 2DT5A 4PLPA 4Q3EA 4D0RA 4XYGA 1KS9A 2PD4A 5C5IA 3I9KA 4E5YA 4J7XA 1HDCA 4E2WA 3WYEA 2QYTA 1H6AA 3C85A 4D3FA 4WGGA 1GQ2A 1Y81A 5KOIA 3GLQA 5L4NA 5JDIA 3PEFA 4NU5A 3WSVA 5U1PA 3E1KA 2NNLD 3ROQA 3BMCB 3PYMA 5JPIA 5TX7A 4CR7A 2E48A 4WEQA 3RFXA 3JYNA 5IDWA 1UAGA 5CDTA 1PWXA 4BO5A 3TL2A 1ONNA 4Y98A 3I23A 3ANNA 4U5QA 3ZH2A 1YL6A 4CMBA 4OXKA 5FYDA 4EI2A 2C59A 1B7GO 1GCOA 5FF9A 2VHZA 3RUIA 2V6BA 4BNIA 1VJ1A 4LMPA 2IZ0A 1EBFA 1K0UA 4QECA 3NTQA 4TROA 3OIDA 4BMNA 4MP3A 2NVBA 3ON5A 1JN0A 2ZB7A 3RBXA 3QVSA 1J6UA 2I3GA 2QRJA 1JLLA 4FJ1A 4IDDA 1Y7TA 2O2YA 4ZRMA 3ZWCA 4WCFB 1TB4A 1XIVA 3DBLA 3EY4A 4OKNA 2I66A 3I9LA 1KVQA 1Z45A 3TFQA 4HKTA 1P1FA 1BDMA 2BD0A 1D8AA 3UKOA 3DFUA 1YXMA 2HMWA 4F3YA 2XF8A 3EGOA 2PR2A 4H15A 4R5MA 4B3HA 4DL9A 2VZ0A 4GH5A 2D8AA 3O9ZA 2PKQP 1QMGA 4L4SA 4LGVA 2X5JO 1LI4A 1CERA 4IINA 4RJTA 2EXXA 3HFSA 1GZ6A 4UREA 1QXSA 4LW8A 1WXDA 1PJSA 2QZZA 3VZSA 3Q1LA 4LK3A 3KO8A 4P4LA 4MP6A 5TC4A 4L76A 3R3JA 2VYVD 1RM3A 1O5IA 3CEAA 1P44A 1O9BA 2J5QA 4CUKA 4ZD6A 2YQ4A 3DMTA 5L53A 2Y66A 3PHIA 3TNLA 1D1TA 3H4VA 1R4NA 3V8BA 3L4BC 2O3UA 1B15A 4HY3A 5IDXA 2OFPA 3HJAA 3IAHA 3C1OA 1JDJA 1H9BA 1NVGA 1VL0A 2XXBA 5GMOA 3RFVA 4YAKA 5L7WA 1O6ZA 3HG7A 4IPTA 1HDGO 2ET6A 2EKQA 1MUUA 4PVDA 3K31A 4JK3A 3KVOA 4W82A 3IDSA 2AA3A 3GY0A 1HE5A 4II2A 4DPLA 2RHRA 3D3WB 4ZGWA 1LNQA 3F5SA 4BGEA 2O48X 2WYUA 1DLIA 4OOFA 1X15A 1E1NA 1U3TA 2E6UX 3P5SA 3U3XA 5L95A 1RWBA 5EINA 4ZJUA 1ZSNA 2EIHA 3O8QB 3RBZA 3DOJA 3QV1A 4NIMA 5L45A 4S1VA 3PJGA 4KWHA 1NFQA 2AQIA 2D59A 5K0ZA 4NBVA 4NI5A 1H2HA 3C7CB 4E2YA 4BO6A 1C0LA 1E3WA 9LDTA 4YAEA 5DBIA 3GR6A 4GSKA 2C2XA 4PG7A 3RSHA 1FDTA 3VC7A 4ZA2A 5HM8A 1SAYA 3GG9A 1GYPA 4NFHA 4YB8A 1GV0A 1RPNA 3VPSA 4IDEA 4XD2A 4U0KA 3KBOA 3A4VA 5EESA 3MOIA 3E5MA 3W4IA 5A06A 4J1TA 3K6JA 1E7YA 2ZCUA 3HADA 5C7LO 2PH5A 1M75A 3F1LA 4TSKA 1C1XB 1R4MA 4MDHA 5ENDA 5EQFA 4UUOA 5I7VA 3SX2A 2WDZA 4JNKA 4P4NA 3LDHA 1YRLA 5KJFA 5C7OO 2DUWA 1IPEA 2VNAA 4RVSA 3Q3CA 5F5LA 3FRJA 1YL5A 4CM8B 3QVWA 4QEDA 2HCTA 1CIVA 2PD6A 4I9HA 3ZWVA 1F06A 1S6YA 3OFSA 1RM0A 2C0CA 3KUXA 5G0SA 5A03A 2Y1EA 4B4VA 3BTVA 1OAAA 1KETA 3ZNPA 4B4UA 4FFRA 2Q49A 3ZWYA 2YUTA 2R6JA 5JFOA 3PXXA 3D4NA 2FMUA 2UUPA 2OMEA 4IDAA 1N9GA 3AUUA 5IZCA 3OQBA 1U28A 1I2CA 1N7HA 2R00A 2CZCA 2CNBA 5A5FA 1XR3A 4PLWA 2DM6A 4GVXA 2PWZA 3WTBA 1Z7BA 2Z5LA 4BL5A 4O5OA 3N58A 5BT9A 3U9LA 3K96A 4G81A 4Z6KA 4P22A 1VC2A 3K9QO 1HLDA 4UEOA 4YRBA 3KXDA 1AHIA 1TI7A 3I5MA 4C7JA 4WLFA 3U62A 2CY0A 5EL0A 6LDHA 1MFPA 2GDZA 3PGJA 1HE3A 2Y1DA 3EZLA 1BVRA 2ZB3A 1YBAA 5TJ9A 1ZIDA 1LRKA 2GO1A 3UCFA 4KWIA 4BKRA 1XDWA 3R3SA 2NU6A 4JJGA 2X86A 4DQVA 1SMKA 4W9NA 1PJCA 3WTCA 4J49A 4ROSA 4M49A 4AJ2A 2VUUA 2WE8A 3GNTA 4YJHB 3UOGA 3BMCA 1GPDG 1GEEA 2Q3EA 3IUPA 1V6AA 1LX6A 1DAPA 3RUDA 3QE3A 3K2EA 5JE8A 4FFOA 3GAZA 5CDGA 1FF9A 1YBVA 1YB5A 1T24A 1Y5RA 1H0KA 1V3UA 4HP8A 3LC2O 3U4CA 4D41A 1OBFO 2BHLA 2CDAA 4LISA 4YJFB 4CQLB 3EK2A 1PL7A 4IMPA 5KJ1A 3NUGA 1P1KA 4L8VA 1UXHA 1NR1A 3RUFA 2W2LD 3SBOA 2PV7A 3VVBA 5BSEA 1K6IA 3ZNQA 1HTBA 4XX0A 1UXKA 4KUEA 1ZK0A 3KLMX 3PQDA 1DC6A 4BKOA 3UFXA 4GX2A 4CUJA 1WDKA 4BNNA 1MLDA 1LDNA 5COQA 4RVDA 1LSJA 5CDUA 1HXHA 4O1MA 4WCFA 4OHUA 3PVZA 1DFIA 4PZEA 4AJHA 1D1SA 4DIBA 1QR6A 3QHAA 3RCBA 4EW6A 1MX3A 2PK3A 4F45A 1CWUA 3S55A 4BO4A 1NYTA 2OO5A 4AJIA 3ST7A 5LCXA 4WUVA 4BVAA 3WGOA 5AYVA 2GZ2A 4RCVA 4GX1A 1GAEO 4OXNA 5G0TA 2WSBA 2I5PO 5U9CA 3E48A 4N18A 1DB3A 4DGSA 4DLBA 1Q1NA 1H93A 2ZB8A 3GVPA 2IE0A 4GLLA 4E30A 3JQ7B 3I9OA 4NR0A 3GGPA 2HMSA 1IZ0A 1DEHA 3OIGA 1EVZA 3PWSA 4KTTE 1ZJYA 3AI3A 1YDEA 3ZWBA 2GN6A 3LT0A 2I67A 3GH3A 4DRYA 1RM4A 4ALMA 3V2GA 4BNYA 2F1KA 3ETDA 5B37A 3S2IA 1V0JA 5F3RA 3U49A 4EEZA 4XA8A 3B6ZA 3OA0A 1QKIA 4EJMA 1MXFA 3TZCA 1FDWA 3JTMA 4IY1A 1OMOA 2PKRA 1P0CA 1MGOA 4BB5A 3DAFA 2O50A 4Q9NA 4EZBA 4YRAA 7MDHA 2EHDA 2ZKLA 3JYOA 5JYDA 5TQVA 4XQEA 3WLEA 2O3RA 4H3VA 2A4KA 1T1RA 2YHUA 3JD3A 2DFVA 2EW8A 3PI7A 4D46A 3D3WA 4I1IA 4E32A 1KY5A 1LDMA 1XG5A 2UUOA 5A1TA 3LZ6A 1Q0LA 2GLXA 1KEVA 3M1LA 4L74A 4UVIA 3LF1A 4IZHA 3O8QA 4R9RA 1E3EA 1S7CA 3CUKA 2LDBA 5T67A 1ADFA 5IAAA 1HRDA 3I9JA 5G0WA 3MJVA 5BNIA 2HLPA 5JY6A 3KLPX 5F1PA 2V65A 5JLAA 3BTUA 3L6OO 4ZQEA 5KTKA 1R37A 4KTVE 5J23A 1F8GA 1MG5A 3NV9A 3X2FA 5KIAA 3ZU3A 1ZK4A 5DOZA 2NTVA 2B83A 3CINA 3BMQB 3DTYA 4YYZA 1DXYA 1WW8A 2FSVA 1E5LA 3K30A 5CEEA 4IDFA 5JCJD 2J3IA 2GD1O 1ZW1A 3ENKA 3FD8A 5DCYA 3V2HA 5F21A 4Z3DA 3GZNB 2A35A 3VDQA 4KQXA 1P45A 4OJNA 1LLUA 1PQWA 5CG2A 4J2OA 5A4DA 3DXFA 4CMCA 5HS4A 4BNVA 3VPGA 3C24A 1SNYA 1G1AA 3JYPA 4OQYA 4XYMA 2QIOA 1C1XA 1UZNA 1A27A 1PJBA 1N7GA 4BO7A 3RUEA 3PYXA 5DN9A 2V6GA 3R6DA 1JWAB 1A72A 3WFIA 4E2XA 2FR8A 2DFDA 4IJKA 3ZWPA 1R0LA 2GYYA 2VWPA 1HDZA 3DZKA 1K5HA 4GBJA 5IZCC 3AM3A 3F4BA 1NNUA 1CDOA 3WQQA 2R00C 1GFSA 5L51A 4GKBA 3HDYA 3ZWXA 4CMJA 2ZK7A 1AN9A 1N5DA 4CLRB 3WGTA 2DTXA 3KEOA 1SPXA 5CPBA 5JMPA 3G3EA 3RC7A 3FNFA 4FR5A 3TWOA 2NV6A 4ZQHA 1A5ZA 3AOEA 1DOHA 4E5MA 3HNPA 3DTTA 3HZZA 4DPKA 4MVJE 3NRCA 5F5NA 1HEUA 4E3ZA 4RQTA 2OZPA 2VCYA 2PZLA 1R15A 1M67A 1DIAA 1GL3A 3GC6A 4XQCA 1LTHR 2PD3A 1LU9A 4TQGA 2D3TA 5IZ4A 4OL9A 4W9NC 4NH4A 4NK5A 2W2KB 2Z95A 1TXGA 3NYWA 4RVHA 4CMAA 5TRTA 1ADGA 1EUDA 5F1KA 4IDGA 3ANMA 3DOCA 3WLFA 1ML3A 1EK6A 1VRWA 1PZHA 4GI2A 2V6MA 4K26A 1FMCA 1M76A 2E82A 3M2PA 1B8PA 4BO0A 1TLTA 1IOLA 4YDRA 3E9NA 4B79A 3TSCA 3D3EA 1EE9A 4E0BA 1GQYA 5KVSA 2VRCD 4EGFA 1ADBA 2ZTMA 4DQXA 3EDMA 2Q1WA 1T25A 3ROKA 1U2DA 3COSA 4YJHA 1K6JA 3AI2A 3ABIA 3JQ8B 1DRVA 3O26A 3BMNA 2PZJA 1NQ5A 4FD3A 2DBQA 1RM5A 3Q6IA 3OEWA 3U4HA 1VPDA 1I01A 2PKQO 1SBYA 4LVCA 4MJLA 3DHNA 4WCFC 1PEDA 4YJFA 4CQLA 1P31A 3OICA 4AJJA 3GDGA 1UH5A 4IGFA 1E7QA 4KDEA 1ZK1A 2SCUA 3CMCO 1ZO8A 5IDQA 3AK4A 1J4AA 4MIYA 3GVHA 5U4QA 2X0NA 5FI5A 2JAPA 5B4VA 3ZV5A 4R1UA 2B0JA 1X0XA 1JKJA 5L7YA 3BA1A 1MC5A 4EYEA 3HUDA 3IC5A 3LQFA 3LT1A 4YACA 3VTZA 1HL3A 2I6TA 2GZ3A 3NDIA 1ZSVA 3Q2KA 2AEJA 5TJHA 3GDFA 3PRJA 1BW9B 4FOOA 4KOAA 2FN7A 4RPLA 5G0VA 4XRRA 1U2GA 1E6UA 5C37A 2EV9A 3TZHA 1WLYA 5A9SB 1OC2A 4RQUA 2O4CA 1BXGB 3L4SO 1X14A 4P4GA 3S1LA 3AY6A 4IQ8A 1QYVA 1B26A 5T8KA 3TL3A 2C5EA 3WWYA 4E5PA 3H2ZA 2PGLA 3M1AA 4AJEA 3HDHA 4PRKA 2AQKA 1WZIA 5HA5A 9LDBA 4CMIB 2POQX 1W6UA 1NQOA 1PL8A 1VSUA 4TZTA 2B4QA 4YCAA 3JQEA 3A14A 4UULA 2TMGA 3QW2A 3SLGA 1JQBA 5CP8A 4D3DA 1W4ZA 2DBZA 4FDAA 5LDHA 1E7RA 4FQ8A 3OJEA 1E77A 2NU9A 4OM8A 1JW9B 1B8UA 3P2YA 1AE1A 2HRBA 2G1UA 3U4DA 4L73A 5DZSA 2GCGA 4Y6RA 3KYCB 1BG6A 3AUAA 5JO9A 3L77A 3KSZO 3AUSA 4JLWA 1T26A 1YE3A 3P19A 3SC4A 1U1IA 1NAIA 5A02A 3DZIA 4XB1A 4CLHA 2JFGA 3FTPA 2IZZA 1K2WA 4J4TA 3CPSA 4J16A 3LSYA 5I7FA 2PFGA 2ZYAA 3RAJA 4YVFA 1PS9A 1R12A 3HFGA 3BTOA 1OI7A 2AE2A 5KVVA 1L7EA 2AQHA 4QTZA 4RF2A 1ZKMA 1XEAA 3WOHA 2BLLA 3TQHA 3GGOA 3ROMA 5THQA 2BGKA 1QP8A 2C7VA 3I6IA 4LSMA 1MFZA 1I24A 1PJ2A 2FPGA 3PYLA 4R69A 1CF2O 1V3TA 5CFZA 1D7OA 4UUNA 4UUPA 4F6CA 2HMUA 1H6DA 3DFZA 4CV1A 1QYWA 3BMQA 3T4EA 5ITVA 4XGIA 4OQZA 1L7DA 4YJGB 3WMWA 4GGPA 4R68A 4AJOA 3GZNA 2BGMA 3VAZA 1D3AA 4QO8A 4PLGA 4EDFA 3MJEA 2AHRA 4PFJA 2GN4A 5B1YA 1EDOA 3PWKA 1ONOA 1XHLA 3PDUA 2Z1NA 5G0UA 2WM3A 2J6IA 2PTGA 3LLVA 4RPHA 4XIJA 2BFMA 4UAGA 1I5RA 1UJMA 3ZWMA 4ZN6A 2IXBA 3WYBA 2RHCA 4GPD1 2HRZA 5TIIA 5HRUA 3AOEC 5BSGA 2DKNA 4W6ZA 2EJWA 4L0QA 4ALKA 2NADA 2IEBA 3ZWOA 1DC5A 2H6EA 2EF1A 3D64A 3KYBA 2BKAA 1SZJG 3ZU4A 4R51A 4CLRA 3E18A 3I4FA 3IKTA 1BVUA 4NDNE 3CTMA 2B4TO 4DLLA 4NG5A 1JKIA 2HMTA 1HSZA 1XGKA 3GHYA 2FHSA 3UH1A 1P1RA 4EUEA 3NTRA 4ZU3A 3JQ9A 1FDVA 3O03A 3H5RA 4Y8VA 5AQ1A 2CVZA 3DZGA 5JCJA 4ALLA 2W98A 3F47A 2Q2WA 3H8VA 5COBA 3UAGA 2Q45A 4PZDA 3NTOA 2BH9A 2VNSA 1LQTA 4JBGA 3IOYA 2B5WA 2W2KA 4O0LA 4RDHA 3DAPA 5CDSA 3UCEA 3WGZA 2PGDA 1Q0HA 4WLEA 5L9AA 1H6BA 2WE7A 1QG6A 4FFMA 1A9YA 4UEKA 1HETA 2JCXA 2B36A 3ICPA 4OMUA 2C7GA 1NR7A 4H16A 1ISMA 4ZQFA 1W8DA 1V3VA 3I83A 3I3OA 2ZATA 4R54A 4RPGA 4HFJA 3MJCA 3QWHA 4MIEA 3CKYA 1EFKA 1NVTA 4ND3A 1FJHA 1ENZA 4JJFA 4HFNA 1WMBA 3EUWA 1ISGA 1Q7CA 3JQ8A 5AXDA 1B3BA 3WJAA 3FPCA 1PJ4A 3FTNA 2E37A 2EW2A 3H3JA 5GZ6A 4YT8A 4YT2A 4M8SA 1ZEJA 4CM9A 3ADOA 4D0SA 3VH2A 1E3LA 3K73O 4NHEA 4RORA 4XJSA 4Z0TA 2GUGA 5ENVA 4A73A 1PGOA 2BMAA 3UHAA 5JDCA 3RUHA 3QLJA 4IS2A 2P9GA 4O59O 4UVHA 5EIOA 2VUTA 1B3RA 5G4LA 2YHIB 2RCYA 1Z6ZA 4A0SA 1EQ2A 1Z74A 3GQVA 3WNVA 1M6WA 3M2TA 2I3AA 4I8XA 1E92A 5BR7A 2PY6A 3B70A 8ADHA 4FS3A 4BS9A 1ID1A 3KYDA 3RASA 5B12A 5T8KC 3WS7A 4KMSA 4D7AA 2YFHA 3BMOA 3LLSA 4PG5A 5KWEA 4MVJF 1W73A 4OSPA 1BW9A 5DBGA 1MXHA 2YV2A 1RKXA 3DMYA 4E33A 5ICSA 4MVJI 3P2OA 4OXYA 1MG0A 1GUYA 5T5QA 2Y1FA 3ZNOA 4IGEA 2JHGA 3OEYA 3DEYX 4Q3DA 2VRCA 3DHYA 3EVNA 2H9IA 3H9JA 4IS3A 1BXGA 1ZBQA 4ILKA 1UUFA 1E1LA 3UGKA 1X1TA 3E8XA 5BNFA 4CM7A 5DOVA 2VT3A 3L6DA 4Q3BA 4JIGA 3QQPA 1C0PA 4KZPA 4YR9A 4XDYA 1DC3A 4CMIA 4YQYA 2DBVO 5L40A 4J6FA 1UDCA 4CV2A 4WKGA 3I9NA 4LSWA 3H3FA 4J0EA 3ZDFA 1I32A 3WGIA 1U8FO 2I9PA 2V7PA 4ND4A 4DYDA 3L9WA 1OZAA 1K3TA 1LUAA 2B35A 1O8CA 4HBGA 2Y0EA 3FF4A 3W1VA 4R4JA 2X9GA 2Y1CA 4XR9A 2UVDA 5FWNA 1QLJA 4BNWA 3PIIA 3HDQA 3KRTA 5KNLA 5JS6A 4PLVA 3GRKA 3OBBA 4Y6SA 4WK6A 3F1KA 3KYCA 1GQQA 3GEGA 2NVUB 1TT7A 3DC2A 4CV0A 3K92A 1DPGA 4DWVA 4J1SA 4PLFA 4DMMA 1T4DA 2XAAA 3WYCA 4XYLA 3L0DA 3MTJA 3F3SA 3KSUA 2NU7A 3Q0EA 3G1TA 5MDHA 4R5HA 5A9TA 1DHTA 3FNEA 1Q0QA 1YB4A 2B69A 4ALIA 4K1LA 4RF3A 3F6YA 4BV8A 4Z0PA 3Q11A 3WIEA 3PJDA 3IP3A 3TOZA 3MJTA 2Q4EA 1ZNQO 4YT4A 5KVQA 4YT5A 3JCZA 4X54A 4B7CA 5DT9A 1KOLA 2P9CA 3SJ7A 1KBZA 3WNQA 4CLXA 4IM7A 1Z82A 2E4AA 4WLOA 2O7QA 1ARZA 4JCOA 1ULUA 3ZW9A 2AMFA 2FWMX 2ZYDA 3VKVA 2O4UX 4PRLA 3D1LA 4NQZA 4LRSB 2P4QA 1DIRA 2A94A 4YJGA 5DCUA 4MVJD 2BI7A 1TVEA 1VL8A 1XQ6A 5JAMA 4IBOA 3ADPA 2PZKA 4AJ1A 4FSHA 1HF3A 4MOWA 1EBUA 3STHA 1WVGA 1KVUA 4FW8A 3DBRB 5JCXA 1HWYA 4F6LA 2PLAA 2J3JA 2X0JA 3PFWO 1XU9A 4PLYA 1BHSA 1DHRA 4CMKA 1IE3A 1QORA 4FJ2A 1ENYA 3G79A 4OAQA 3FN4A 4HXYA 4P8RA 4WOKA 4B4WA 3JQ9C 2CMDA 3DO5A 2YDXA 4CLOB 3AOGA 3QY9A 2EG9A 2FRDA 4HX5A 3RI3A 1KVTA 1GPJA 1IPFA 4INAA 2IYOA 3VZRA 3N7UA 2NLOA 4PLTA 1KC1A 5AVOA 4TWRA 1LJ8A 3OJOA 4OGWA 1LEHA 2B4RO 3C7AA 3FNGA 3W8DA 4TRMA 1OOEA 2EKLA 4JJIA 1BSVA 3R0IA 1QSGA 3GPIA 3V2UA 3NAQA 5IG2A 1XQ1A 4FCCA 3DWFA 2TMDA 5TT1A 4J9UE 5MGBA 4IQ0A 1A4IA 3VPHA 5IFLA 3ZV4A 4LCEA 1ZK2A 4B7XA 1ZFNA 1LXCA 1N2SA 1SO8A 2NSDA 5I9NA 3FHLA 1T1SA 1XLTA 3H7AA 1E7MA 3E9MA 4RL6A 2RAFA 5G4KB 3AW9A 4JQCA 2NTNA 3T4XA 1H9AA 4XJTA 4ESOA 1PJLA 2PGJA 3GT0A 3FBGA 4BIIA 2CVQA 1SB9A 2O23A 5G2OA 1LSSA 1AHHA 4I5GA 2FPIA 4BHTA 2HKIA 1F12A 1YOVB 2JFHA 4ZVVA 2P9EA 3GN1A 1UAYA 1J5PA 3PQFA 5KKCA 5I7SA 1V9LA 2X58A 1CYDA 4WJZA 1YDWA 3NX4A 4ND5A 1X1EA 1TT5B 3KB6A 1GDHA 5JDCC 2AE1A 1U5AA 2WWRA 3WSWA 3OETA 2FP4A 2AEMA 3AM5A 1GEGA 3ZU2A 4MKXA 1V8BA 3UCXA 1E3SA 2Y93A 4PN3A 2Q1TA 3DQPA 1B8VA 4FFNA 1F0YA 3UN1A 4B4OA 4L75A 1DIBA 3PJFA 3VKUA 1E1MA 2YHIA 1VE9A 2P2SA 2GN8A 4DQUA 4Y6PA 2D5AA 5I7EA 2C29D 1DDOA 4QXMA 4WLVA 1IHXA 2EP7A 2VWHA 1JAYA 5DF1A 1VI2A 2W8ZA 3IUSA 3X2EA 4RGBA 4Q3AA 3G17A 3IJRA 1UZLA 3EAGA 1PSDA 4MPDA 2J5RA 1U3UA 2OOSA 3OM9A 3AU8A 1O95A 1BMDA 4XKJA 1LC0A 4XQGA 4YRDA 5JO0A 2VYVA 1EVJA 2EJVA 2NUAA 3ROPA 1B16A 4BGUA 1IUKA 3PLRA 1P0FA 1JKFA 1I36A 1ISIA 4FGWA 4XYEA 5C7IO 1T2CA 4J43A 2YJZA 2C54A 2WMDA 5IJZA 1EDZA 1I8TA 4R1NA 4CMGA 3PGXA 4ID9A 4CR6A 3DL2A 2G0TA 1G6KA 5JBIA 4AVYA 4WPGA 3WG9A 3RC1A 3IJPA 1N92A 2YV3A 4KP7A 1XCBA 1CRWG 5A05A 3RVDA 3CSDA 2I65A 2X1HA 3VPXA 2ZTLA 5F1OA 2WJPA 1YJQA 4IUYA 3GFGA 5DNAA 2HJSA 4QT0A 3VVCA 3ZGYA 1I3LA 2FPPA 1C1DB 2FOIA 4XGNA 2VRBA 1E7WA 2VOEA 3NGLA 4GL4A 4GVLA 4Z3KA 1HLPA 4N5MA 3GVXA 4YEDA 4FGSA 1VKNA 4RVUA 4BGVA 4CM8A 4YXFA 5KCZA 4U8GA 1PJ3A 4NZ9A 4CM4B 2I76A 3I4CA 3PZRA 4R3NA 4DREA 5JYEA 1GUFA 4J7UA 4LRTB 1X7DA 2AW5A 1GYQA 1M2WA 2WEKA 4PG6A 4C7KA 3HWRA 3HE3A 3F46A 3VOSA 4AJLA 3RROA 1E3IA 2DLDA 3BTSA 1HDRA 2X9NA 2AXQA 1U8XX 4YAGA 4YWJA 2BRUA 4XGKA 1HDXA 3QSGA 1IZ9A 4E31A 4RVGA 5JSFA 2BFOA 5JW6A 3WFJA 3ENNA 3RU7A 1NHGA 5ICMA 1CEQA 4IJWA 5JXWA 1P77A 3QJ5A 1C0IA 4NJOA 3WGHA 4BGIA 3RWBA 4DIFA 4QFCA 4BNHA 2CDBA 3TPCA 3PK0A 2IEDA 2OGUA 2RH8A 1ISHA 4HNGA 4Q39A 3KEQA 5CHEA 5L7TA 4I5FA 3W4KA 3ZWNA 3E5RA 3ONFA 1BTOA 3WR5A 4W7HA 5BSFA 2QZ9A 2O7SA 2X4GA 3L9XA 5TLSA 4ALJA 3JD2A 1E1KA 3HDJA 4CM5A 2VHXA 1NVMB 1VJTA 4DA9A 3V5NA 3CE6A 1VM6A 4H7PA 3W4JA 4BKUA 1XYGA 1WMAA 5CEJA 3CIFA 3BZUA 4KDFA 3ZI0A 1YONA 1Y5MA 4NFYA 4TMFA 4XZ3A 3WB9A 3GOHA 1UXJA 3GVCA 4CMHA 5IN4A 1U4OA 4XIYA 3DBRA 2ILTA 3AWDA 2YZ7A 1TEHA 1ZK3A 4Z0HO 1GUZA 2FSSA 3B1JA 2IDZA 1EMDA 2CD9A 2X5KO 3ORFA 4DMLA 4FBGA 3OF2A 4HV4A 1WAMA 3PHLA 4OYRA 1ZZEA 1JTVA 4NJMB 1KVSA 1AUPA 4WECA 1NQAO 1LA2A 2HMVA 4CODB 1NM5A 1EFLA 4BQRA 1LRJA 1SOWA 5DDIP 5IF3A 4WEOA 4MKZA 3V1UA 5H83A 2O2SA 3SJUA 1D4FA 3TZQA 4RPKA 3WX0A 4YQZA 1UP4A 2OBNA 4NBWA 4EITA 2B5VA 2VHWA 1A7AA 4Q3NA 5KJCA 4W7IA 4JBIA 3RIHA 1PR3A 1ENOA 3R1IA 3OIFA 3EC7A 4MVJA 1XU7A 2RBEA 3QRWA 4RF4A 4MVJG 4XDZA 4NMHA 3GEMA 1UXGA 1UDAA 2O3JA 4JP3A 5C3MA 1ZCJA 2ZJ0A 4M87A 2ZJ1A 2DTDA 4GSLA 2HO5A 3ULKA 1FXSA 2O3TA 2Q46A 1I0ZA 4GAEA 3C1AA 3RQSA 4QFDA 5G4KA 4PVCA 1Y8RB 1PTJA 1RJWA 4U6QA 1P33A 1UP6A 1PS0A 2JD1A 1E6EA 1T2FA 3GNQA 3JQ7A 3WWZA 3IP1A 4A03A 3LF2A 4RPJA 1HDOA 2ZB4A 1ADCA 3K8ZA 4E4YA 3GVIA 3KHUA 3ZWAA 1N1GA 3PZBA 4J2HA 1LLQA 2C2YA 5EQDA 4CMEA 5JC8A 5KJ6A 1GCUA 4S3MA 2NTJA 2W2LA 3GK3A 2AG8A 4FOSA 1TT5A 3GRPA 3PHGA 1OFGA 3I9MA 3UW3A 2P91A 1CJCA 4BMSA 2GGSA 1XA0A 3UXYA 3RFTA 3LC7O 3ZZNA 2O3SA 4UVGA 3JQAD 2QX7A 1ZEMA 3TOXA 5GY7A 2OUIA 3UICA 1PS8A 4BKPA 6ADHA 3ICCA 3IQDB 4MP8A 5HBRA 2GSDA 4IIUA 3DZHA 2FZEA 2VHYA 3OJFA 3DZFA 5KJEA 1F17A 4TRNA 3O4RA 1DAOA 4M86A 1Q2XA 1NWHA 5THKA 3PDJA 4PLZA 1DFGA 2VYND 5GZ3A 1YQGA 1ZXLA 4NU6A 2DBRA 4DBVO 2GRAA 4UUMA 3TF5A 3EVTA 3LVFO 4L4XA 1SCUA 2J8ZA 5AXBA 1I10A 5GZ1A 1NAHA 3MJSA 3PLNA 1IYZA 3SLKA 4BNTA 2VN8A 1DRWA 1WNTA 4EJ6A 5CG1A 2J3KA 4JN6B 2E49A 2CUKA 3OJLA 4AICA 3VPFA 5ITWA 1BWSA 2X8LA 2V6FA 3VH4A 2G17A 4YPOA 4BNZA 1LDYA 1Y8QB 2GPTA 3PJEA 3AY7A 4WNCA 4FFPA 3D4OA 3E6AA 3GPDG 4BNJA 3JQAB 5IXYA 3VZPA 1NHWA 1R66A 1J49A 3FR8A 4J0FA 4YA6A 1PGPA 5TSDA 1PR9A 2EERA 2QRKA 4WNIA 3DB2A 4URFA 1C1DA 3KOUA 1GYRA 3RKUA 1GZ4A 1P9LA 4LMRA 2HUNA 1EVYA 2Y0DA 2ZTUA 3MCVA 4J1QA 4R41A 4D42A 2IRWA 3Q2IA 4DYVA 3GGGA 1EUCA 4CM4A 1WWKA 1UR5A 4B3JA 1I2BA 1YL7A 3S8MA 1U9JA 5KKAA 4AJNA 2D4AA 2RIRA 4R9SA 2YYYA 3ZWWA 3GNSA 3PHJA 2X5OA 1BRMA 4FC7A 1T4BA 2DPGA 1R0KA 4NPCA 2JD0A 3DBHB 4NBUA 1ZMTA 2EGGA 4R1SA 4J4HA 5DBFA 4CLDA 4D44A 3U09A 3U5TA 4BO8A 1QV7A 5CAEA 4GKVA 3NT4A 2X23A 1UDBA 2BF7A 5T64A 1HT0A 2YV1A 4GGOA 4Z9YA 4FIZA 2QW8A 1EEHA 4W4TA 4D43A 1ENPA 4RF5A 3H65A 2A9FA 4JROA 4IXWA 2DUUA 4KQWA 4B8ZA 4B7UA 4CUZA 1WZEA 3JQ6A 2J3HA 3EHEA 3L07A 1B14A 4IJUA 4L9RA 1HZZA 1Z7EA 3H5AA 1IHYA 2X22A 3FSRA 3ZV6A 4BMVA 2HSDA 1XSEA 3KM0A 2Q99A 4J91A 1DO8A 4E13A 3A1NA 3VZQA 4PG8A 4E12A 4BNFA 3ASVA 1GADO 1HE4A 1K6XA 4QQRA 1PWZA 2HK9A 4R1TA 5H82A 4CM1A 3QWAA 2Q2VA 1J0XO 3JQDA 3LYLA 4N7RA 1FK8A 3GEDA 5DULA 3ZHBA 1I3NA 1O89A 4GLOA 4XYBA 3GA0A 5ILGA 5K6AA 1Z73A 3INGA 2IXAA 3INTA 1BXZA 4NFSA 1DC4A 3WGGA 4R16A 4IQGA 3D5TA 3PTZA 4NJMA 4IJVA 4XCVA 1Y6JA 3OMLA 1RYDA 4BNXA 3P7MA 4N5NA 1PU2A 4J4BA 3HB5X 3OP4A 3QIVA 1YB1A 4GQAA 3SC6A 3DZBA 1DFHA 3HSKA 1BDBA 3JYLA 4I9NA 4M55A 4A7PA 5BNTA 2QG4A 3IIEA 4YTEA 3WBFA 4PGFA 2X0IA 3DONA 1KEPA 2GZ1A 2UDPA 1NPDA 1XELA 4IDCA 3H9EO 3ZHYA 5TGDA 1Q7GA 4K28A 1HYGA 1R0SA 2JJYA 3EMKA 1GD1O 5A9SA 3JYQA 4J1NA 1UP7A 3JQBC 1ZUD1 5A3JA 1HDYA 3LT4A 1LLCA 3NT5A 5CDYA 1GZ3A 3DAGA 3RD5A 4CMEC 2DU8A 4QO7A 1C14A 1ZSYA 3B20A 3JD0A 1Y8RA 1T2EA 1KC3A 2GNAA 3K5PA 3LT2A 3PPIA 3A06A 4PLCA 3CZRA 4NBRA 2IODA 3OJ0A 4BV9A 2JCVA 2Q50A 1X7HA 1G0NA 3AM4A 2Q1UA 4YAIA 2Q2QA 3MZ0A 3ETEA 4XEHA 5AXCA 4FPXA 3QWBA 1KYQA 4I08A 1WPQA 2VTDA 4HNHA 1SB8A 4P38A 5I8WA 1I2ZA 2NU8A 5JAZA 5KVCA 3D7LA 4R3WA 1O0SA 1X13A 2PNFA 5HS6A 4ZICA 1IY8A 3CZMA 3WJ7A 1I3KA 3KV3O 1P1IA 4PG4A 2EWMA 3O38A 4IXTA 4A26A 4XRGA 2QYSA 4ONEA 1P1JA 1H94A 3I6QA 1EUZA 3BIOA 2HK7A 1E5QA 3JV7A 3QWIA 3ETGA 2WYVA 4PCVA 4DC0A 3DOOA 4U6SA 3ZHZA 2JCYA 2Y1OA 4M54A 1JVBA 4A5OA 3EZYA 1MC4A 4RDIA 3JQGB 3KZVA 2VWGA 1DRUA 3TN7A 1A71A 2VZ8A 3V1TC 1QYCA 4AJ4A 1YQXA 4B8WA 3FWZA 4QSMA 2BI8A 1HYEA 1CETA 4EUFA 2OP1A 3TDKA 4II3A 1G0OA 4DVJA 3WGYA 1NFRA 1RYEA 4CQMD 1VJ0A 2AQ8A 2CVOA 2Q1SA 4J90A 3FCOA 1E6WA 1DBVO 3IL2A 1OC4A 2DC1A 2HDHA 4GX5A 4MKRA 4RVFA 1SC6A 1IULA 1Y8QA 2OXIA 4WLUA 4CM6A 2AEFA 2EP5A 2O3QA 1NFFA 3JQAA 2NQTA 2CFCA 3FWNA 3GHHA 3NJ8A 4OSOA 5LDGA 5JDIC 2RH4A 3H9UA 4E5NA 4WCDA 3LU1A 3DZJA 1U4SA 3WMXA 3HN2A 3JD1A 2VOJA 3T7CA 2ZIZA 2DQ4A 2Y67A 3ITKA 2C07A 1AXEA 4WOJA 3W8FA 3W6ZA 4DLAA 3AUTA 3JD4A 3OQ6A 5I9MA 4LVUA 3FI9A 3U0BA 4CM3A 1GV1A 2ZCVA 2HK8A 1Y9EA 1X7GA 1QV6A 3DHEA 5AOVA 1BGVA 1FDUA 2VYNA 1Q7BA 4MO2A
chains in the Genus database with same CATH superfamily
4MQBA 3TGPA 3Q6NA 1UCFA 4YMUA 4TZKA 4K2HA 1NASA 2Z4SA 2VEOA 3BMNB 3SHOA 1KFKB 1GU7A 1REQB 1Z2PX 2NW6A 2L19A 3M49A 4RZIA 4PXAA 5ES3A 2HWYA 4UNPA 4C3OB 3DBHA 4ARVA 2G1KA 4BZWA 5IVIA 1GGNA 3A25A 4E09A 1PDWA 3H0EA 1A2QA 3H5TA 3HHPA 3I2HA 4QTTB 1SEVA 3WK5A 2OE2A 5B4UA 1D9ZA 4M98A 5IARA 3FPGA 4UEJA 3T7DA 1ISFA 1C3OA 4DIMA 5KTPA 2ZFUA 4YO7A 1TKBA 5A4AA 4IDBA 2VHEA 2X0FA 2ISCA 4WE3A 1QYXA 1OJLA 2HA0A 3NHPA 5CNMA 4EKYA 5A04A 3CRW1 4RC9A 2FU5C 3E84A 3KKNA 1P4HA 4PTLA 4QUKA 5HFJA 1PD0A 2PZAA 1N1MA 3OIVA 2VHVA 3HN7A 2QRNA 1EK5A 2H1VA 4EHNA 3WLHA 2HADA 3H5VA 3K70C 4JNCA 3IMCA 1XROA 1NI4A 2VZ9A 4YCBA 4J0CA 5DXAA 3WKCA 3ZXSA 4GOMD 4WZAE 3PX2A 2DFKB 1SQSA 3KVRA 1PBTA 4PNZA 3ZWQA 2JFFA 4JB2A 5GM2A 4BCDA 3RFFA 4BKQA 3IUMA 5BN4A 1XKQA 5H3CA 1JGTA 2IIVA 4LDPA 4LX8A 1LY1A 1N8TA 4TTIA 2GASA 4XLZA 1UODA 1RFGE 3WYGA 1LWNA 4Q7KA 3GB9A 3LKBA 2H5LA 3PFGA 2FEMA 5SYNA 1GR0A 2IYFA 1M33A 3VISA 4HDCA 5IJ9A 4LZAA 4N01A 3RKRA 1Z34A 1M1NB 4RE6A 4M1QA 4P33A 1U8TA 5EXTA 1G5TA 4EKEA 1M34B 2HQRA 1YFLA 5JJLA 1W49A 4JQSA 1A69A 4YAJA 3FA2A 2QDXA 2TS1A 1XZGA 1C30A 3RJMA 5A3QA 3TLKA 4CIAA 1US8A 4LN1A 4HGQA 3HFRA 2O8FB 5LJIA 4G9BA 1ACJA 1PGJA 2R60A 7ADHA 3HKCA 1H2AS 1U7TA 1JLRA 2R6HA 2HAEA 3N74A 3OT1B 3ZN2A 2HJRA 1PEYA 2ZWIA 3JAWA 4B3FX 2JK0A 3CH6A 5I4CA 4R8MA 3DPSA 2NVOA 1CLUA 4HD8A 5DHUA 1MX9A 1LSUA 3OAAD 3LS2A 3LZDA 4FXPA 1GGFA 1HT1E 1P73A 1I7DA 4GMKA 2VUSA 1TCBA 4XQ9A 5JTTA 5B1SA 2R7AA 1PZEA 1N6IA 1RVV1 1YZQA 2FTKE 3M4ZA 4WXRA 3VR2A 1L1FA 3ER8A 2O7NA 3KTDA 4QX6A 1TUBA 2QS9A 4RQBA 5JNSA 2GESA 4KQ2A 1CLEA 5JYCA 1X9HA 1ZDMA 1ZLYA 2QEQA 1S7GA 3C6XA 3LXMA 4F5DA 5CFRA 3WK4A 5AIAA 1WUTA 2J3LA 2PS1A 2RJNA 3EVZA 3OLCX 3MSXA 1N25A 2ONJA 4IX1A 4JFAA 3HCRA 4AF6A 2FR1A 4HLQB 1ZJ5A 2NZ8A 4LIPD 3C3MA 1Z4KA 2XQIA 4I5IA 3WK7A 1X0VA 2R11A 3C8DA 2ZRBA 5B3KA 2H9YA 3EJWA 3OJWA 1NC1A 3NV7A 3MWYW 1JZQA 3KL4A 4MJ3A 3ENVA 4PXSA 4XI9A 1NPYA 2MINA 2FWAA 1T1IA 4FYXA 3CT6A 2J4DA 3FHOA 4BLTA 3QEKA 4DCOA 3U1BA 3JQFA 1UK8A 3HKBA 1YQUA 1WXFA 3I6YA 3PNVA 4LS3A 3ZE6A 4ZJYA 2PG3A 2WLSA 1JU9A 3IMFA 1JA9A 1VG8A 2RH9B 2ZREA 3I2KA 3TEMA 2SKCA 1YK1A 3IDZA 2VDLB 4JJ7A 3SZMA 1SXJE 1LDEA 5ANRB 3V8MA 5IAOA 3AIKA 1K1EA 4EUNA 1V7PC 2AZDA 3H99A 3HI4A 2XECA 3KCQA 2EDCA 3ZD8A 2H63A 5CYFA 4MUNA 3DDUA 2ZXEA 1S8NA 5HUJA 1SOVA 1TTPB 2VG8A 4G97A 2D7DA 3LCCA 4AZ3A 3B1FA 3GDOA 1IG3A 1YZFA 4D9EA 1KJJA 2HU2A 1XA4A 2E9SA 1D2HA 2P6UA 1YJ8A 3H1GA 3SF8B 4RIFA 2O54A 2WMOB 2CW5A 2OORA 3HRKA 1N6KA 1YR2A 3JRXA 3GJRA 3KTOA 4HFMA 4M6WA 4Y2SA 4P3XA 1VGVA 3G1WA 5JNRA 3VDNB 4CTOA 5BQFA 4BOYA 1GA1A 3TTUA 3ZZ1A 4B09A 3Q40A 5EN4A 3W6UA 4LBZA 1C3VA 2R84A 1Y4DE 1NF9A 1TTTA 1FNMA 1P7VA 2VDWB 3MCAA 2Z1MA 2HF9A 3HUUA 4KPFC 1LRLA 3LOPA 2NXWA 3TG2A 3OQJA 4FEGA 3T7TA 1HNXB 1A4UA 3OPMA 4Z54A 1E0SA 2D5CA 2NO1A 5IFKA 1KJZA 2CSUA 2EJTA 3AFMA 3MOGA 2J0QA 4MWZA 3C8ZA 1PT6A 5AJYA 2VIIA 4UD2A 3JQGA 4DDUA 4C01A 2G9NA 2ZR0A 2JK1A 3V4FA 1O5OA 2WAYA 3N2ZB 4TL7A 2N9UA 2ZR9A 4ANFA 4DBLC 1CTQA 2OD7A 1JG2A 5JMWA 5K9ZA 2ZAOA 3TRIA 4R0NA 2NUPB 2YWDA 2UUCB 1DSSG 2WT8A 4RD1A 5DP1A 5FR2A 1KEEB 5G1PA 1W9HA 1CJTC 1D2EA 1SQFA 3FCAA 4E1VA 2B5OA 1GTMA 1DWPA 2JA2A 3RC9A 5CPFA 3FTDA 1E9AA 4UNNA 1WP4A 3EQ7A 5AW0A 1N2XA 1Z2EA 4IZOA 2I7DA 4U0JA 1ATIA 3NT2A 3ZUPA 1EVLA 3AU9A 3ZV3A 1ATZA 3IR7A 1R16A 1WS6A 3IELA 1GSHA 1T2VA 3ISJA 4DEVA 2D0IA 2H3EA 1Q14A 4NE2A 2UYGA 1MAHA 5F2OA 3BRSA 4MULA 4YLEA 2P5TB 1DRKA 4H7FA 2B25A 1K6EA 3KR0A 1JSXA 4PBTA 4O02B 4WZ6A 3SXPA 3U7QA 2IHTA 1AXGA 2XXJA 3SXUA 2YWFA 1ONPA 4Q02A 1KQOA 4FE3A 4LZJA 4AJKA 5FKJA 2C03A 4PQGA 4IZIA 1NJFA 3H6KA 1JHXA 5GIPE 2NM0A 2X9VA 2XMQA 4PBSA 3IKVA 4PHFA 1S3SA 1G59A 4U2BA 1H2BA 1MB0A 1QBGA 2QRVA 3Q3GE 2VDNB 1CT9A 2AOTB 4JSRA 5FIUA 4INZA 4AMVA 5EJGA 3UXEA 3KD3A 4QELA 1QM5A 4Y2JA 2W2QA 5HDBB 1BU8A 1H5QA 1EJ6A 4RKQA 1T0BA 2WIKA 2WNHA 3BHIA 4BFTA 1IQPA 5FOTA 1V3QE 1EZ1A 4J7CA 3BT7A 2WQ7A 2O9JA 4XB2A 3BIJA 3MTIA 3KSBC 4G0QA 3IPAA 2G67A 3NJRA 4LDJA 2C7OA 3DCJA 4FDLA 1HE2A 5LQAA 5HIMA 3UO8B 3NM5A 2HQBA 3NB0A 1TEZA 3PGA1 4KC0A 1B1AA 3L4BA 4QL3A 3SYLA 2OHIA 3S2FA 4Z9BA 3NHUA 1NUSA 1SC1A 1KVRA 2YWRA 4ICIA 1O6CA 3ZW8A 3X44A 1D4ZA 3C3KA 3C45A 5L3ZA 4L7VA 3QFFA 4NBTA 1CQZA 4FGLA 3DUFA 1JYEA 1Y1PA 3DE5X 4S2EA 2VHUA 1HYBA 3ACCA 5BPHA 2HPAA 3D4PA 3ONEA 3KYDB 3ZJUA 3I2JA 1NVVQ 2BGIA 2XX3A 4N0MA 8GPBA 2FPUA 1WDMA 1U8YA 2JFUA 4EQZA 5HVNA 1LC3A 2KM1A 4AU1A 5J43A 1MKYA 1XTTA 2EARA 1WM1A 3HJCA 3ONVA 4JGBA 4LZWA 4PAOA 1BS9A 2DY1A 1VG9B 4K0RA 4RAQA 3ZCQA 4XXHA 1NBOA 5TMDA 4B43A 5JMTA 4EHBA 1GVNB 1N8KA 2IZ1A 2VTBB 1DJQA 2G4CA 4G4GA 3I37X 3S3TA 1ZOPA 4BAGA 4Y67A 2EFEB 1V5FA 1M6HA 5ECDA 3Q98A 3BF8A 3HFJA 3MEQA 1QF9A 1TM3E 3NDRA 2HGZA 4GI1A 1QIGA 4KYVA 2VRNA 1JQ5A 1ULSA 2Q4BA 4ZODA 1Z9BA 1M1NA 4AROA 1WMEA 2B98A 2VXBA 1XP8A 5EHQA 1M34A 4OI2A 2QMUA 5JAQA 1USWA 5IN5A 1L5NA 3BIWA 3K5WA 3VPCA 1G8HA 3OSUA 1CB0A 3L1HA 4MQ4A 3OQHA 3UUWA 2Q3JA 1R4MB 3QUBA 3VGPA 5ADVA 5IWCA 1AQNA 2O8FA 1K66A 5FFFA 5DN6D 2ICAA 3LCUA 2B8EA 1R6UA 1D4AA 3C48A 3S2EA 5KTNA 1N2GA 5I51A 3EMDA 3OT1A 1PJQA 2PGXA 5DM0A 4MUEA 4TLMB 1A5TA 2ZPTX 3DQQA 4HWKA 3T0GA 1M6EX 4BBJA 2COEA 1DTEA 3G82C 1SK9A 2FR0A 2IIBA 4ND1A 3HSSA 3DFFA 3L6EA 3WAGA 4HB2A 1G20E 3A3PA 1NDUA 1U11A 2Y05A 4UHJA 4KHPB 2O59A 2CYAA 4JX9A 1LBHA 1VG1A 4PFKA 2C5AA 3UVEA 4BWYA 2EWWA 3R6GA 4LXYA 2I2CA 3LOUA 4FLFA 2I1LA 3C43A 1QRRA 3I8XA 4HC4A 4QDTA 3JQFC 2PU7A 3FKJA 4N49A 5DE3A 4IX9A 1Z0AA 2IX9A 2LDXA 2P6MA 3BCSA 2YMQA 4G85A 2P4HX 3BSSA 4A8TA 1KIFA 3WBJA 1YU6A 4YASA 1PX2A 4TLBA 1T2AA 1IOZA 3QVXA 1ZL2A 2FMXA 3BXZA 4JXKA 4PIVA 5FPPA 2Z9CA 1UFKA 3ONDA 1MZVA 1Q15A 1SHZA 4NLLA 4JXZA 3VZBA 3MRXA 3TBHA 3WXBA 5EVJA 4KG7A 3SP1A 5AI4A 1PFGA 1N1EA 3QWFA 4DLKA 5E1MA 4ZK2A 3KS9A 1EGAA 4FK8A 1EX9A 5K0JA 3G23A 1IL0A 4PLHA 3CONA 3WJ2A 4D0RA 1NMZA 5J1SB 2P6PA 2GAOA 3MGGA 4KDCA 4EG5A 1J9ZA 3UJ3X 1KMMA 1UBKS 4UFOA 4BMXA 4WUTA 2BKUA 4MRVA 2DMRA 4QUEA 3ZDQA 3ABRB 3UEOA 2G80A 3AM1A 2BGWA 2J07A 2ONKA 2XWQA 6CHYA 3ZGVA 2NPFA 5ALDA 1Q3KA 4PXYA 3RVKA 2OYSA 3IT1A 3SF8A 4QKQA 4X45A 3ZEAA 1FP2A 5B6PA 3MBOA 1IMOA 5CDTA 1P2DA 1I5OA 1MAVA 1GGJA 4WNYA 1R6BX 7MHTA 3R9KA 1E2BA 4LJ8A 1YL6A 3PPWA 2QTGA 3LNTA 4EI2A 2C59A 4E4TA 2JIQA 2BBOA 4N0DA 2L0XA 2VDWA 2A0XA 4ZDJA 3CUYA 1NBMD 2C5LA 2R8RA 3JATB 3PSAA 4X63A 2C7RA 1DIOB 3I0NA 2IZ0A 2DR3A 2XLCA 4Q05A 2ZUUA 1L5ZA 1AKYA 1B4DA 1V4BA 4QECA 4URWR 3VU1A 4EJFA 2W4MA 2F8TA 1GPMA 3H5IA 4JLKA 4R1OA 3KT6A 2ZLBA 1A8SA 1EXNA 4AMBA 1RYYA 1Z0DA 4OK3A 2QP3A 4QYMA 4QBHA 1LVHA 2I3GA 1CUGA 1E2HA 2IHBA 2QRJA 3UFXB 5FV7A 5LQMA 4OEHA 5DK4A 2G7ZA 3P26A 4HGYA 4XUGB 5KINB 2FZLA 2XWBF 1U2QA 1SUWA 1XYYA 2D62A 1E5TA 2ZT5A 2AYYA 5C8ZA 5T3UA 2BR3A 3J7AC 4LMAA 2JAWA 2NUPA 3OJXA 4JR1A 3H5LA 4V39A 3W04A 4KQHA 3H1BA 1KEEA 3G59A 4IH9A 2YY5A 4HKTA 4OQMA 1BGXT 1MO3A 4H4DA 2JATA 5H59A 1KZHA 2EX4A 4M8IA 3E1SA 5JPCA 3KQLA 2QN3A 2XF8A 4DC9A 3I4LA 3EGOA 1RYNA 2FJUA 4H15A 4P35A 4FI3F 5CIQA 5AOBA 2P3OA 2V8OA 2ZYUX 1MNQA 1RZVA 4FX2A 3KOMA 5DKFA 1ZIPA 4WRRA 1FDIA 1W87A 2PKQP 5F9HA 4CN8A 1EM8B 1UBGA 1NVUQ 2IYVA 3HCPA 3RSLA 3KDPA 3G85A 5HQJA 4PNEA 2C4MA 5GJVC 4EHLA 4R8LA 1TC2A 4UREA 1QXSA 5AVUA 1AO3A 4OM7A 1PJSA 3VZSA 4BDTA 1EFRD 5JYBA 1AU9A 1NL3A 1R9GA 3A6KA 5EKUA 4BE9A 3KO8A 1ODCA 1OILA 3PX3A 4MP6A 4P4LA 1KWGA 2ACKA 2AN3A 2QD1A 2QZ4A 3DEJA 5TC4A 1QHFA 3KE9A 1O5IA 5CBPB 4ZOAA 2QLMA 4ZD6A 2YQ4A 3USCS 3DMTA 4BFZA 1H4TA 2AOTA 5L53A 1IN7A 1DV1A 2IYWA 1ZITA 2Y66A 3PHIA 1D1TA 3U81A 2GXSA 3NWJA 4AT1A 3V8BA 4L0MA 4CHTA 4C7OB 3L4BC 5BY2A 4AMYA 2FVXA 4HY3A 3HJAA 4PNPA 1Z47A 2JKZA 1JDJA 1H9BA 2N1MA 3JPWA 5IAEA 4YAKA 2HHHB 1RXIA 4UEQA 4BBPA 3PKZA 1JDSA 1F9AA 2OAP1 3ROZA 3INNA 4PVDA 1MOSA 4U9HS 4H0NA 3EF3A 1IWBB 1KAMA 1XDUA 2BUAA 2V7BA 3IDSA 4X7MA 3GY0A 4PSDA 4U8HA 2I34A 4DUGA 3AVOA 4L28A 4Q4LA 2IF0A 3FFWA 4NMWA 1K5PA 4DPLA 5ALOA 1EWRA 4F38A 4DV2B 1K68A 5K3DA 2C5SA 1M0TA 4ZGWA 4V24A 3ROEA 4DJ5X 4HZIA 1WDTA 3FFXA 5DNVA 2F1OA 4OOFA 1X15A 1U3TA 3WLOA 1M6VB 3P5SA 4UASA 5L95A 3TCKA 2EIHA 5DHRA 3TCXB 4YV2A 4TZ0A 1T5SA 1Y1LA 4KIUA 1PR0A 3A2LA 1C81A 4NIMA 3RTDA 3F3MA 3PJGA 2PJRA 3F6SA 4CNQA 5B2FA 3L0SA 2X8WA 3FMIA 5AJWA 4BFXA 1EUYA 1V26A 3OE1A 4B80A 1BVYF 4RELA 1H2HA 4G0XA 2Q2OA 3DP9A 1F60A 2YASA 4HEA6 4RABA 9LDTA 3QUCA 1TIKA 3ZY4A 1F4VA 2I6UA 2XZPA 1H69A 4GSKA 1R74A 1LNZA 5AK0A 1NE7A 1X6VA 1JEEA 3B1VA 3RSHA 1AK1A 3ZDEA 4HLCA 2FF7A 3L4KA 2RHOA 2Y1LA 3PUWA 4JEUA 4ZXPA 3GG9A 2P2CA 1CUXA 2XUFA 4CXMA 2Q3HA 4IDEA 3VPSA 2PT9A 3DKKA 1Z0ZA 5EESA 1URPA 4H6VA 3NC0C 3W3ZB 3SU8A 5KAMA 5BMVB 4Y2QA 4BX8A 2ZUBA 1VMEA 2YYAA 3O94A 1RQ7A 3K6JA 1RC8A 1KEZA 1E7YA 5ED0A 3GBSA 1XWIA 3FMPB 3HADA 3ZVMA 1FJGB 4V0QA 1CE8B 3E22B 3TQTA 5BUCA 1OU0A 1F2DA 2HF7A 2IYLD 1R4MA 2PGIA 2R5NA 5EQFA 3WO0A 1WXQA 2DFLA 3TTTA 5LU8A 2QE6A 4LFAB 3SQNA 1LW7A 3NKVA 1E6LA 1Y1KE 3IUJA 2WDZA 1KMIY 4OLHA 2PAFA 4URUR 4P4NA 3VR3D 3LDHA 2H11A 5BRAA 1IUPA 4KLZA 5KJFA 4K5QA 2OGTA 2VHQA 2YICA 4RVSA 1OWMA 1JR2A 1T8SA 4GPEA 3O0DA 1EFPB 2JGIA 4I9HA 5GM1A 4ZZ2A 3KUXA 4BVAA 4TV8B 2I2BA 2PH7A 4N7JA 5D2CA 3GEIA 3O47A 4F5ZA 2Q8PA 1OAAA 3ESRA 2A1TR 5LLTA 3ZNPA 5HKOA 4FFRA 4FIDA 2Y1XA 3N70A 4X5OA 3ZQ4A 3PXXA 2YVKA 1RBQA 2WAOA 2B94A 1DBRA 2ZBUA 4MYDA 5EMKA 1ZX1A 5IZCA 2W58A 2GNPA 1U28A 3OQBA 2R8XA 3QNWA 2XYHA 4UU1A 2CNBA 3B3GA 3CLVA 3RVRA 4GVXA 2WK1A 4ER3A 1NRWA 1OXVA 5DGTA 2AYXA 3D6MA 2AT1A 3K96A 5FLKA 4JYZA 1ORIA 1QVRA 4P22A 4IIEA 3RS3A 3EVDA 1N7JA 3T3PB 4C7JA 4RK4A 3RS2A 2Z8YM 3Q7QA 1HRKA 1UKVY 5EMNA 4PINA 5B64A 4JL6A 5LP6B 3T1NA 2JCSA 3H16A 2ZB3A 2M9MA 4HDOB 3W5HA 1TK2A 1YBAA 5AKJA 6PFKA 5DK6A 5JFGA 3KZCA 3TRDA 2B8NA 3A2MA 3ZGLA 3FWKA 4MUHA 2NP7A 1A5AB 1QANA 1YAHA 2HCRA 2QUZA 1NNLA 3NATA 4K87A 4ER7A 5FDFA 3VOBA 5I3CA 1TU4A 1II9A 4HGOA 4IIBA 4O3FA 3PLAE 1Z29A 3LHKA 1NF8A 3TOVA 2VJKA 4KRXA 4KREA 5E3JA 5HF8A 4CT4B 3C4JA 3NO4A 2Q07A 5IEJA 1H23A 3N86A 1LPOA 4G89A 2UZ3A 1WF3A 3BM5A 4ROSA 2VUUA 3Q8LA 5HGXA 1JHDA 3VSDA 4KSBA 1GPDG 1GEEA 1RC1A 4FFDA 1V6AA 4S0ZA 5AW6A 1PQ4A 1R0YA 3QE3A 1TK9A 3K2EA 4GF5A 4FFOA 4KHZA 4QQKA 5HILA 1OXSC 5FTWA 3HCAA 4DTCA 3D2BA 3D4LA 3GD5A 5WRFA 5IUNC 1TM1E 4KGDA 2G4VA 1SRRA 1WY5A 1NQXA 1YJ5A 3ZV7A 4HP8A 3U4CA 1BO6A 1VJRA 2YXLA 3JATA 5IABA 2GOYA 1P1KA 2CLSA 3HXLA 2ADMA 2FG7C 4WJKB 2C95A 4P7BA 5ARCA 5BW8A 4AZSA 3ZKWB 3FOCA 1N36B 3ZNQA 4XX0A 4X3OA 3ZQ6A 1ODTC 2J59A 4R05A 3UOAB 3KLMX 3QU7A 1XRQA 3SOPA 3OEEA 1AUQA 5SY4A 4JI7B 3UFXA 3SD7A 2WUFA 3AL3A 4BXOB 1LDNA 4ZPJA 1LSJA 5TVGA 1HXHA 4O1MA 1ZMRA 3PU6A 4OHUA 4D5EA 1DFIA 4PZEA 1NUAA 5CVDA 4AJHA 2ZBGA 4C1BA 2RGRA 1QR6A 1KGSA 1GPLA 1QC5B 1WCYA 1XO1A 2VBFA 3AYZB 3QHAA 3ITNA 2FEXA 1MX3A 2VLIA 4EW6A 1WB5A 4F45A 2J9ZB 4HPJB 1NYTA 1AOXA 4C3UA 3TRKA 2B2CA 4KV9A 4UJ5A 1ZOLA 3ZW7A 2FSPA 3DW1X 2RHMA 4WUVA 1QWOA 2PX4A 3EGCA 5LCXA 1ODKA 1M10A 2IYTA 2ZRMA 5AYVA 1Q7TA 3KJIA 1J22A 4UAJA 3UK7A 4OXNA 1EM8A 3CXUA 1XWWA 2WWVD 2Y6VA 3B89A 1XNJA 4D80A 1XZHA 2X6QA 4ZOBA 4E70A 3MG9A 5SV2A 4DLBA 1Q1NA 1F8YA 2ZB8A 3EBPA 3GVPA 4PR0A 1C9KA 2NYAA 3FPSA 3TBFA 1R64A 2YINC 1ORVA 2HPHA 4NR0A 3C3EA 1DEHA 2VR1A 5BWNA 4JI3B 1ZJYA 3N8DA 3AI3A 2D06A 3GV0A 1IQUA 1YDEA 3IBFA 4U39A 4Z8YA 2Q0HA 3W9BA 5CBPA 3ELBA 1UJ2A 5HEKA 2G0AA 4XAQA 1K6MA 5B6IA 5J3JA 1GRRA 4ZOLF 3WL6A 3EWAA 4GIBA 4UTVA 3OU2A 1V0JA 1E4EA 1E79A 5EKTA 1Z4LA 3VSEA 3D6AA 3O4IA 3RU3A 4RIIA 3U49A 3ID6C 3N8KA 3OA0A 4DSTA 1KQGA 2XJ9A 1FDWA 4EZIA 1P0CA 1FFBA 1L3BA 4L0DA 3FSGA 4QXQA 4JI5B 5EJ8A 1BHQ1 1NC3A 2GCPA 3F8TA 4TMZA 4WKCA 1Z8NA 1G3UA 2Q6KA 1S2DA 4ZANA 4OSEA 4YRQA 1M0EA 2C96A 3BE8A 3WLEA 4H3VA 2OD2A 3B3JA 3G2NA 4PO1A 5LIRA 2OGSA 3KSRA 3N76A 4E32A 2QN8A 4MLZA 3T7RA 1GCAA 4MR8B 4LC9A 1Z36A 3QJYA 5EEHA 3OKFA 2H85A 5IAJA 2ZXUA 1VOTA 2PUCA 3M70A 1GTVA 4JOBA 4L74A 4UVIA 3W6NA 5JS8A 4X85A 4IZHA 2I6XA 3BQ9A 3DDSA 2X42A 5T67A 1ADFA 1QH8B 2O0MA 1R5BA 3I9JA 4KAXA 1CEXA 1V4VA 2FWNA 4EL5A 3VC1A 3ONNA 5TPWB 1YVDA 5F1PA 2ZAIA 2V65A 4IRXA 2DH6A 5J4YA 1H9CA 3WK9A 1NMXA 1V96A 2F59A 1QX3A 4MW6A 1PSWA 3QFCA 3AEQB 2NZYA 1N0WA 2VPTA 2Q4DA 4P93A 2H5EA 4B81A 1V8PA 2GLTA 2OV6A 3GJ3A 4WZAA 1TUEA 3LWZA 3KOYA 4MVCA 4L16A 5CU7A 1MW9X 3GBPA 4YO8A 4FR0A 2FSVA 1E5LA 5CEEA 1GZUA 3COPA 5DCYA 2GD1O 1ZW1A 4KPYA 3FD8A 2CV0A 3E3AA 1DOZA 3A9VA 5GGYA 3GZNB 4GW3A 2B34A 3OTHA 3EF1A 1TM5E 3B6EA 3Q4GA 1V8FA 4KQXA 1HKHA 2VDQB 3Q5GA 1GL6A 5EY5B 1A76A 5BMVA 5JALA 3SNKA 4LGMA 1PQWA 5EQTA 1XZLA 5JD5A 1YVPA 2WJHA 4CMCA 2WZDA 1GAQA 4XB6B 1DKUA 1U8EA 1GUAA 1CE8A 1N6OA 3JYPA 1A27A 5DYWA 4B9AA 2YJ3A 4C0KA 2PS0A 1WW2A 5HF6A 2CK3A 4BO7A 3PYXA 3Q7EA 4XWGA 2V6GA 3R6DA 3DOFA 3WLPA 5BOSB 3ZWPA 4CCYB 2GMWA 2A5LA 4NCNA 3HA3A 2GYYA 3CEJA 5SYMA 3ROGA 1NXVA 2HX1A 1HDZA 3P94A 4KLNA 6YASA 3H5WA 4GQIA 2WHQA 3KQSA 5IZCC 2JRLA 3AM3A 1U28C 1EFPA 3F4BA 4M83A 2QTRA 3WQQA 2XVYA 2WLTA 1GFSA 4QOFA 3UQYS 2QBYA 4GRIA 1ZQ1A 2VF5X 4TV8A 4ZALA 3FI0A 2ZK7A 5LOVB 1N5DA 3KJFA 1FRQA 1YS2X 3KFLA 1IK4A 1SPXA 1YI1A 5CPBA 4CLRB 3UWKA 4BZPA 1G20B 2N46A 3HDVA 5D1NA 4W5TA 2AGVA 2RK4A 3AONB 4M88A 1ORDA 5HQ3B 3AOEA 4NCBA 1LBQA 3BHNA 3PS9A 2C3OA 1TZ2A 3OFND 2ZIAA 5DJ5A 3PXDA 3PNLA 4L51A 2O5CA 4MEBA 1W5AA 4D9HA 2EYUA 4DPKA 2PRIA 1WW3A 2JZCA 5ERGB 2ZSAA 2GBLC 5F5NA 2JA1A 4RMJA 3DTVD 1ZD2P 4NE7A 5THXA 1M67A 4X20B 4FZVA 1MB2A 3LO5A 4DARA 2CFSA 4TLLB 3R9IA 4K6KA 1UZAA 1Z83A 3DMGA 4N40A 7REQB 1IIBA 1QB7A 3NH9A 3OF3A 1LU9A 2RG1A 3O21A 2XXAA 1G4HA 1N6HA 1Q1ZA 3NHMA 5TV2A 3W5AA 4LRUA 2GXAA 1HH4A 1SC3A 3GRZA 3KWJA 1E2UA 2W2KB 2Z95A 4R84A 3TXYA 1DE0A 4AI6A 5LP6A 3THWA 3EGDB 4F3CA 1ECJA 2V3VA 1Y6RA 4IDGA 5IC6A 2R6GA 3THRA 3M0EA 1H4VB 1QG2A 2EKBA 3WLFA 1EK6A 1OBOA 3SBDA 2NYVA 3EIUA 1PZHA 1KP3A 4ENSA 5A5VA 4LHZA 3T7SA 1B8PA 1QTIA 1DPFA 1TLTA 3KWMA 4HAYA 4YDRA 1NXTA 4DLVA 3OE7D 1SXJA 2I7VA 2P1ZA 4V1CB 3TSCA 3ETCA 2W42A 2O2CA 4BV3A 5M7EA 4ZIRB 4DN6A 2AD1A 1WULS 4O8CA 3O93A 1MA3A 1UC5B 1OX4B 4GBED 3VAYA 5DIFA 2IHJA 4UHKA 5C1OA 1GAXA 1GPYA 4ZGGA 1K6JA 3AI2A 1E3DA 2V5AA 1ZNWA 2FRDC 1Z0KA 1MB9A 5LUBA 1G5HA 1Q6YA 3GWGA 1UJ5A 4XCXA 2OUKA 2O2ZA 3N59A 3FLMA 3E4CA 1SBYA 2O8DA 1CY2A 3LGAA 3QE4A 3DHNA 3AVVA 3FVRA 1FTGA 4AJJA 4JQOA 1UH5A 2REQB 2XSZD 3G88A 4HGNA 3LHFA 3CMCO 4Y2RA 4BVHA 5IDQA 4YHBA 3ZLJA 3ZKWA 4DDMA 3TZBA 2VCEA 3ZE7A 2R6CA 3AG5A 1VBNA 1Y7IA 1FNDA 4ENRA 4YCDA 4C22A 2QX9A 1QGUB 5DGCA 4BXOA 3HUDA 5D6NA 3LQFA 5TY0A 4U63A 1E62A 2A4MA 4H0FA 4LOJA 1HL3A 2I6TA 4BP9A 1CY4A 4WTOA 1XRLA 1G4UR 1ZCAA 3PRJA 4IJ6A 4OVKA 3UATA 3GCWA 3FOWA 5KQLA 1E6UA 4MW0A 221PA 2GXUA 5C37A 2DKFA 3NUQA 3P4YA 3GDHA 1NN1A 5A9SB 1OC2A 2FLKA 1E2MA 4B0OA 3L4SO 3S1LA 2JLBA 3GU3A 1RHRA 4JH0A 5HUQA 1QYVA 3C87A 5T8KA 3TL3A 2A58A 3LY5A 4E5PA 1RCFA 2X3YA 3HDHA 3RAPR 3S6JA 3UHFA 1FDOA 1XRNA 2R97A 1PG5A 9LDBA 2FUEA 1QE5A 1T6NA 2IYAA 1TKCA 1Z8HA 2POQX 1W6UA 3EGXA 3ETLA 1OKKA 3PEUA 2B4QA 3DH0A 2PRSA 1ND5A 3QYFA 2H2AA 2YOGA 3K0KA 4OJMX 1S3IA 5FOQA 3CVJA 4B71A 1CVLA 1ULBA 1A0OA 1JQBA 1YJAA 3O31A 4A23A 2BMEA 2KSQA 4OMFG 5ELXA 5LDHA 2JIBA 4HZUA 4FQ8A 3OJEA 2UZ0A 4OM8A 4H1TA 2QUBA 2C9OA 1B8UA 3MHPA 3PRYA 3RVMA 3QXXA 4S1PA 4GL2A 3P2YA 1TJYA 2IA5A 1YR8A 4H31A 4Q0MA 1OCEA 1PQYA 3Q72A 4RHFA 3SBEA 4BX3A 3LV8A 3MTAA 2GD0A 3U4DA 2G1UA 3WB2A 3JQRA 4GHWA 1XU4A 2GAJA 4L73A 3SDSA 4P4SB 1Y8ZA 2NSJA 3L77A 2COKA 1T4CB 2QTHA 4DJEC 1Z26A 1GL7A 3ASZA 4JLWA 1DOAA 1YE3A 1ZH6A 621PA 3PB3A 2PXAA 3H2JA 3SC4A 1Y6GA 1U1IA 3CX4A 1NBHA 4K9SA 2QTFA 4NPAA 4QOIA 3SQDA 3W3AD 5ARBA 4JVMA 4CLHA 1DKLA 4U5XA 2G77B 4BPBA 4F9EA 3FTPA 1RZRA 4LZZA 4MUFA 4LHVA 3DD1A 2F3TA 3CPSA 4UTRA 3IO5A 2C4WA 2FDRA 2WM8A 4MR8A 2HJVA 5F7XA 5C35A 2PFGA 2C31A 1VZ3A 2ZRLA 2ZYAA 5FTLA 5D7NA 5IH3A 3QQ5A 3SJZA 3LQKA 2A0WA 2VJYA 2CSXA 2O52A 1L7EA 1XBTA 2AFRA 1LF5A 2QZJA 4RF2A 3ZK7A 1XEAA 1O3YA 2BLLA 3WOHA 3CPEA 1QH8A 3GGOA 5DYTA 5DNEA 2C7VA 3GQBA 3I6IA 3L0OA 4LSMA 4NZNA 1MFZA 1I24A 3FUWA 4OP2A 4Q34A 4ZV4A 3S8EA 1G17A 3U7HB 4JS0A 1BU5A 1BCSB 3EZ2A 4N6GA 2BONA 3W8RA 1MV5A 1QIKA 1V3TA 3D0KA 3HA5A 1DX9A 3AEQA 3GT7A 4NS4A 5CFZA 3ZPXA 5JSZB 4RZQA 1PYOA 3AHEA 3ZD9A 4XASA 1LTKA 4F6CA 4M76B 3KFXA 3DFZA 1RZ3A 4OGGA 5IMSA 2MSLA 3WMWA 1CUAA 4R2IA 5FNVB 3GZNA 4IO1A 1EVEA 1YS1X 2BGMA 4UU0A 1D3AA 5H16A 4BQNA 4B7AA 4EDFA 1AD2A 2TYSB 3IV7A 2Z2JA 3JVDA 3OI7A 4PFJA 5CR9A 1S2LA 1VHQA 1T8RA 1PNTA 4KKVA 3VHLB 2JDIA 4B2PA 3MN1A 1EDOA 3ELWA 3PWKA 1NVWQ 1XHLA 3EMBA 2IWHA 5BWBA 1QZXA 2VYCA 1IWOA 2AH5A 2ODEA 2QSYA 2LD4A 2BFMA 4HRYA 3R3UA 1I5RA 3KELA 4HQOA 1ZH0A 3V1NA 3VPDA 2KBEA 3F4KA 4KYIB 5BOSA 5CITA 4AY2A 1J7JA 1KR5A 5D3MB 2GN1A 3WYBA 2HRZA 3ZS8A 4CCYA 3AOEC 3FZQA 4K8OA 1QHHB 3SIPA 2PUVA 5SYAA 1JB1A 1P7CA 2B92A 3KAKA 4IG9A 4TV8F 5AW4A 5EJ4A 2FPOA 3KXLA 3A4TA 1A98A 2YJ6A 3NBUA 5JXJA 3TRFA 1C4OA 2J41A 4JENA 3SSNA 1DJMA 2EF1A 3D64A 3FB4A 4RNCA 3TSAA 2QJRA 1SZJG 3ZU4A 3CUVA 4CLRA 2AVDA 1CZUA 4GEKA 2XUJA 4NOKA 4KBGA 1KIMA 1CS0B 3O1IC 3V1LA 2YHBA 2I80A 2PKXA 1B6SA 1G20A 3OFKA 3BXHA 4ETIA 4DLLA 5KQPA 4NG5A 3THYB 1IPHA 1JKIA 1RRVA 4LMBA 2J9YB 4GM1A 5KC9A 1JG3A 4I4CA 4PQFA 1T9DA 2I6GA 4G36A 2ZJ3A 1NRIA 5H7XA 5CFOA 1P1RA 1DG1G 5LP6C 2FDCA 3JQ9A 1AQUA 2MU1A 3ESBA 3H5RA 5KNCA 4KXUA 4JMLA 1RMYA 2IHUA 2PBRA 3IODA 5BW6B 3OPVA 5CCDA 3O95A 4A92A 1PV2A 4WDRA 4X20A 4BTVA 3PICA 3PSHA 5HCNA 3LIPA 1MEEA 3QOWA 2Q27A 2ZANA 3H8VA 1EP1B 3M1IA 3S7TA 3UAGA 3WVNA 7REQA 1FMFA 1PNQA 3N3AC 4LRWA 13PKA 2D5LA 2WF7A 4YUVA 5LP6F 4JBGA 5JFTA 3IOYA 2ZU0C 1RBYA 2W2KA 4O0LA 3HTXA 5CDSA 3UCEA 3WGZA 2H8GA 2ZYIA 1JFSA 1Y1RA 3AF4A 4EPRA 1ZG3A 3QEAZ 1G6OA 3PA6A 2HRQA 2RBKA 4DRXB 4ZCMA 1G3IA 2IHYA 4Z49A 5IT4A 5AIBA 1S01A 3T3MB 4IV8A 4R2XA 5IVPA 1BMFD 4MV9A 3ZIDA 1NR7A 1L7RA 1ISMA 1F8XA 3K15A 4ZQFA 5ALVA 2GNOA 5C8XA 4V1CA 3I83A 2SKDA 3I3OA 1L3CA 3J81A 5H0IA 3ZOZA 2O0KA 4ZIRA 5J58A 4G3XA 4UW9A 3N0WA 1XLUA 4RH3A 4QD3A 1EESA 4QGAA 1OX4A 4AM8A 4ND3A 3VYVA 2Q62A 3NC4A 5EZQA 2D2EA 5D3ZA 4YXWA 3AR7A 4Z4GA 1WMBA 3LC0A 4ISBA 3ZHUA 4YQFA 4RTRA 3IEVA 1N2JA 3JZDA 1PJZA 1L8XA 2ATVA 3UJ6A 2JGDB 1TCVA 4NFHA 4A2PA 2UXCB 1PJ4A 2BDEA 2HF2A 3FTNA 3ML1A 1VLMA 2E37A 2EW2A 2VZEA 4CIWA 1NI3A 4IJ5A 2OCBA 3WL7A 4YT8A 4ESHA 3HZOA 3LOQA 1DAMA 3PITA 3ADOA 4KQMA 4CM9A 1D2CA 3TX2A 3ETJA 1U2SA 2AUTA 1SIUA 4B35A 1ZL0A 1VCIA 3ANXA 4PY2A 4NHEA 2FE1A 3SKVA 1D6NA 5EJFA 2REQA 3PC8A 3K9GA 4D6YA 4YUZA 3HM9A 4OLAA 1P4AA 1SCQA 3BREA 2Q0QA 4PAWA 4RGVA 3RUHA 4WGFA 1CR6A 4FDUA 1OHHA 4IIFA 4OHXA 5EIOA 4FILA 5JNVA 1N5RA 2QD4A 1U0OC 1XJWA 1RU3A 1TJ5A 1Z74A 2XF2A 3HXTA 4LQ4A 3WNVA 4M37A 4P98A 3ZDZB 5BR7A 4I8XA 1B73A 1EFDN 1QGUA 3JZFA 4FHCA 1Y3CE 1UOPA 4ZQCB 4WKNA 5EKSA 1H1TA 2VJPA 2QA5A 3HVKA 5T8KC 3IIIA 5MFZA 5KKNB 3ECAA 5KQGA 2YFHA 3BMOA 4MWOA 1QO7A 3TPFA 1QHNA 4MVJF 5KPJA 3REGA 1RCTE 4JB8A 5F73A 4PR3A 2YV2A 3JYHA 5CVJA 5ICSA 4MVJI 3DFKA 5HUHA 3P2OA 2IOFA 4OXYA 3AB3A 5CA0B 4B5KA 3T9CA 4ZEXA 1H05A 1ZVQA 4M7RA 4IGEA 1BE0A 1NQWA 1YR3A 3ZTWA 5IKXA 2NP6A 2DT8A 4RADA 3D9QX 3EVNA 4QM7A 1CZOA 4LKRA 2HSGA 5ALPA 1ZBQA 4CCSA 4KE9A 1UUFA 4QJ4A 1ODLA 2XJ4A 3E8XA 1O6GA 4CM7A 3FGPA 3BB4A 4JIGA 4PHCA 4Q3BA 4Q7JB 3T5CA 3BK7A 4LRXA 4KZPA 1XE3A 3TEJA 4E11A 4CIBA 1CHDA 1HFJA 1JSRA 1DC3A 1RAEA 1V25A 2FEWB 1JALA 1X92A 2IFTA 1AV7A 1EA7A 2LCIA 3R3ZA 2BBWA 3PQ4A 5SZHB 4ARUA 1QGOA 5DMXA 2P7HA 5FYQA 3WIVA 2EP8A 4CV2A 1P5JA 1V1RA 4FBMA 4RJJA 1I32A 4NJEB 3ZLTA 4POAA 4ND4A 2FCRA 5AVZA 2F1IA 3KQWA 1UJBA 1O8CA 4HBGA 2FPPB 2Y0EA 3FNBA 4XR9A 4XLLA 1CV2A 3HCFA 2WKWA 3V42A 3WNBA 1SKAA 3TMYA 4AX4A 2YKGA 3D1VA 4EVQA 1R0WA 1V47A 3R9WA 1Z4NA 4WK6A 1SG6A 2QTAA 2VKQA 2C0QA 1COZA 4P4SA 1TT7A 3DC2A 1ESMA 3MWJA 4X0EA 1QH9A 1T4CA 1ZHOA 3TLBA 1Q7EA 3ADDA 2JJ1D 1JDZA 1C7ZA 1L4KA 2FPWA 3G8YA