4IIUA

Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with nadp+ at 2.1 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
243
structure length
243
Chain Sequence
b'MSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from Escherichia coli strain CFT073 complexed with NADP+ at 2.1 A resolution
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 92
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4iiuA00
3GAFA 2B5VA 5IZCA 2VQ3A 1R0LA 5KVCA 3ZU2A 1ONNA 5TJ9A 5I7FA 3TFOA 1GEGA 3UF0A 3QVSA 4TROA 4E5YA 4DMMA 4PLZA 5A06A 1ZK4A 1EZ4A 2C2YA 1LUAA 4JBGA 4K1LA 4MVJD 2WE8A 1W4ZA 3NDJA 1I2CA 4PVDA 4E5MA 3JQ7A 3NUGA 4ZQEA 3DBVO 1NPTO 1B3RA 3D5TA 4IS2A 5C7IO 5G0VA 4DC1A 3GK3A 5L4NA 1ZK1A 1U1IA 4CMHA 3OBBA 1U3WA 2YHUA 2DU8A 1IZ0A 2YV2A 2GD1O 2RAFA 2AQ8A 2FSVA 4LSWA 4J91A 5ICSA 2O23A 4GQAA 4FIZA 1R0KA 2FSSA 2OBYA 2RCYA 1E1MA 1XWFA 1DB3A 2AXQA 4XZ3A 3MJ4A 2Y0CA 1GUZA 1OFGA 4LK3A 4MVJG 3WSWA 3DZBA 4M8SA 3R3SA 4XX0A 1E7SA 3A14A 1O6ZA 1NP3A 3HNPA 1YH3A 1J6UA 1SCUA 2Q1WA 2ZQYA 2J3IA 3BMOA 1VKOA 3DOOA 3G79A 4CL3A 5IXSA 3TOXA 4OHUA 1PL7A 2VTEA 4FFLA 5A3VA 4BNTA 3AOEA 1YL7A 1HDCA 3NAQA 4AJLA 1GQQA 4G81A 1P1JA 4YPOA 4JLWA 3ICCA 1QYDA 3F5SA 1ZXLA 2QYSA 4W99A 3TSCA 1KY5A 1LNQA 3SX2A 1SEPA 4GI2A 3X2FA 1A4UA 3PHHA 1SC6A 4YWJA 4MP8A 4NK5A 1KEUA 3WDSA 3O4RA 4BMNA 4DA9A 1K6JA 3ZWBA 1V3VA 4R3WA 3VVCA 4IZHA 1YOVB 2Q2WA 3HQ4O 5HS6A 1GUYA 4UEKA 2EP7A 4H3VA 3R0IA 3WBBA 4L4XA 4JJFA 4PFJA 5IF3A 2NVUB 5TRTA 4XRRA 2NU9A 1QORA 1HEUA 1U7TA 3W4JA 3W6ZA 3WQSB 2POQX 4BUCA 3LC7O 3OQ1A 2PTGA 3RC7A 3U4HA 1XYGA 2A9FA 2VNAA 3WGGA 2CY0A 4FGWA 3PP8A 3ZW9A 1OAAA 2EGGA 2J5QA 2W2LA 3ZWAA 2EERA 3V1UA 3P7MA 1K6XA 4CLHA 4E6PA 3TZCA 4XGKA 1U8FO 3DZKA 1SOWA 3OEWA 3QE3A 3Q0EA 4IBOA 1U2GA 1NR7A 2I9PA 2PY6A 2XXJA 5FI5A 3KLPX 4GVXA 4MKRA 4PCVA 4XIYA 4BO0A 1GPJA 2AQIA 2XOXA 3JQGA 4BO8A 2DQ4A 1NXQA 4FFOA 4WOKA 4KUEA 1R4NB 2UV8A 2XPCA 2W4QA 1HSZA 1VSVA 1Z7EA 2A4KA 3JQAA 3MOIA 4OYRA 4DLAA 4EJ6A 4OQZA 1GDHA 4RV9A 3ASUA 3NGLA 1XG5A 3AM5A 3FNHA 2X86A 4E2WA 4HADA 1Y5RA 4XDZA 2BH9A 4CM4B 4LGVA 2W2KB 1T2DA 1JKIA 4G5HA 2Y66A 3WTCA 2BGLA 3M1LA 3EHEA 4DBZA 1GQYA 3AK4A 1JAYA 4PZCA 1BW9B 2DUUA 4PLYA 4LCEA 4P4GA 2O48X 3ASVA 2HK8A 4XDYA 3P5SA 4XYBA 3FTNA 2D5CA 2Y99A 4BNYA 1X14A 1TXGA 2B36A 4Q3EA 1E3WB 4YBZA 2UDPA 4O59O 5DCYA 3SXPA 1NHWA 5L95A 2D8AA 4FFNA 2NACA 1JAXA 3DFZA 3V1TC 2NV6A 3VHRA 3D3EA 3WOHA 3UFXA 2EHDA 2CDAA 1LRJA 2F1KA 2UVDA 4GX2A 4MIOA 3RUDA 3HDJA 3IAHA 2ZB7A 1G0OA 1YRLA 1V6AA 2ZTUA 4WCFB 1UH5A 1K2WA 1VI2A 3ZI0A 3PHJA 1DHRA 4PRKA 4PG8A 2GZ1A 3ZV3A 1WMAA 3AFMA 4KUHA 2UYYA 3A9WA 1MX3A 1V9LA 3F47A 5A9SA 3GDFA 4BNNA 1GV1A 2C54A 1DFIA 4JP2A 4AJKA 5EN4A 4I5GA 2YFHA 3C3XA 4I8XA 4O0LA 3NKLA 1C1XA 5IFLA 1E3EA 1O5IA 1UAYA 4RPHA 1ZSYA 3RUEA 1ULUA 3TN7A 1P77A 3ZWVA 3AU9A 2OUIA 4UVGA 3WTBA 3ZV6A 1Y8QB 1IZ9A 4QO7A 5F5LA 4BKOA 5AXDA 1GUFA 4YACA 3O38A 4FFRA 3TDKA 3ZW8A 3P2OA 1DBVO 5KJ6A 1O8CA 3JQEA 1OOEA 2XXBA 4FQ8A 3U49A 1NWHA 1UP6A 4R16A 3AWDA 1Q1NA 1LDGA 1P1IA 1ADCA 3AY6A 3L4BA 4AJPA 5LDGA 3GVCA 3Q9NA 3D7LA 5B4VA 3PZRA 2X9GA 1YBVA 4NZ9A 2FPPA 1ZBQA 1ISIA 1JKFA 2PKQO 1XU7A 4FC6A 2VWPA 4W4TA 2DBRA 3WYEA 5DDIP 4RPGA 4E31A 4XYGA 1PL6A 2BGKA 3HN7A 2GN6A 1XU9A 1TT5B 3DBLA 5KKCA 1BMDA 4BNVA 3E48A 2D3TA 3JQ8B 2P2SA 4W9NC 3NEPX 1NFQA 4NU6A 5L45A 5G0TA 3RFVA 3D3WA 4JN6B 4EZBA 4RCVA 3LQFA 4O63O 1HYHA 3CZRA 1KOLA 5BNIA 2GRAA 4DIBA 4QTZA 4UEOA 4DYVA 3JQBA 3ZNQA 5AQ1A 4MKZA 3IP1A 4TMFA 1PJCA 3IUSA 3K31A 2C7GA 1CQJA 3BZUA 3RBXA 6LDHA 1OMOA 1YDEA 4Q9NA 4MO2A 3VTZA 5K0ZA 3H65A 4B4VA 2NSDA 3WMXA 2BLLA 3LT2A 3PQDA 1DO8A 3G0OA 3BTUA 2R2GA 3KYDA 4NMHA 3NRCA 1PU2A 3L07A 4BNFA 1WWKA 5L51A 3CMCO 3SBOA 2CMDA 2H5LA 2NM0A 3FR8A 1P9LA 3O8QA 1XGKA 2YHIA 1TEHA 3DEYX 1MXFA 3BA1A 3RUHA 3NDIA 4YAIA 1ZNQO 3GA0A 3JQ7B 2V7PA 4A03A 2EP5A 2W90A 1K6IA 1G6KA 4MKXA 1C14A 1M75A 3PDUA 3ROPA 3ZZNA 1NHGA 4MOWA 1WNTA 5K6AA 4TQGA 3QY9A 3FWZA 2R6JA 4J1SA 3ROKA 2DM6A 1Y5MA 5DP1A 4BOYA 1HE2A 4XGNA 1PTJA 4OGWA 2VRCD 1FDUA 4J4BA 1P3DA 2ZYGA 3ENKA 4J1NA 2EWMA 2NU7A 4CMBA 1GR0A 1TI7A 2WE7A 3IJRA 5I9NA 4EEXA 5C5IA 1EDZA 2PKQP 4Z9YA 4UVDA 4L74A 4UVHA 5A3JA 4RPKA 3VKUA 2JKVA 4B79A 1U3VA 3FI9A 1X1EA 1WXDA 3BMOB 3MCVA 4ZQBA 3I9KA 1WAMA 1EE2A 3JYPA 4TZKA 2OO5A 2VYND 3I4CA 4II2A 4UUNA 2AW5A 5JDCA 5KCZA 5TLSA 2Y1GA 1YWGO 3DTYA 4FR5A 4IQ8A 1T1SA 1P0FA 5CEFA 3WJ7A 3UVEA 3ZU3A 5IXYA 4QX6A 3RWBA 5G0UA 1DFGA 2GR9A 4PRLA 1N7HA 2IODA 1A9YA 3RAJA 1ZCJA 1O9BA 2Y1EA 4N7RA 2I99A 3I23A 1A4IA 1NR1A 3IJPA 1ZK2A 1K89A 2VYVA 3PGXA 4R69A 2ZKLA 3FWNA 1ULSA 3NJ4A 4CUZA 3QVOA 4BGVA 4WECA 1A71A 1A72A 3GVPA 3H9JA 4FFMA 2BFPA 2HRBA 1EE9A 1XDWA 3ROMA 2R00C 1ADFA 2JL1A 4ZRMA 1C0PA 3DZIA 2I67A 2AMFA 3S1LA 3B1JA 4M54A 3UCXA 1QYWA 4J3FA 4RLHA 1UJMA 4XCVA 3BTSA 4YAJA 3E82A 2GUGA 4HUJA 4KWHA 1T2AA 3CE6A 3WYCA 4BO3A 3GDOA 2YW9A 4MVJP 4L73A 4NI5A 2IZZA 5CFZA 3PEFA 4IIVA 3DXFA 3ADOA 4J2HA 5JFOA 1PWXA 1H5QA 3C8MA 3GFBA 2Q2QA 5BSFA 3BYZA 1BTOA 3MWEB 3IL2A 2YDYA 3F9IA 3C1TA 1QR6A 1UXKA 4GAEA 1RYEA 2QRLA 4C4OA 2HMUA 5EPOA 2P9EA 4Z9XA 5A02A 1WP4A 5CDYA 2G82A 3DL2A 3JQGB 2ILTA 4AJNA 1QLJA 1I30A 3B70A 3F1LA 5AXAA 1R66A 1H93A 1YQXA 3E6AA 2HK7A 2BHLA 4R41A 1HLPA 3BHMA 5JCJD 3JQAB 1YJ8A 3DHNA 2O7QA 2OORA 3PYXA 3EMKA 3GQVA 4HFMA 3QJ5A 3VDRA 4MIEA 1C0KA 2DLDA 4N18A 3E8XA 3ULKA 1Q0QA 3PVZA 2WD7A 1ISHA 1U5CA 2BD0A 3S2EA 4Y9DA 1I32A 1YQDA 3C7DB 4YAEA 4IMRA 3KETA 3JQFC 4CMGA 2RHCA 4IQ0A 3GGGA 1KVQA 4DL9A 3FNGA 4ZGWA 2BI8A 2PNFA 3T4EA 1BXGA 3GPDG 4E2YA 4ND2A 1VJ1A 4E21A 4FGSA 3DC2A 4FN4A 4J9UE 1VC2A 3F4LA 2VHXA 1HT0A 5CDGA 1R0SA 4DGSA 4YJDA 4RDHA 1JDJA 5CPFA 5CPBA 3ZN2A 3PFFA 2I66A 3JYNA 1EVIA 1T4BA 4LMRA 4XQEA 4EEZA 4AJ4A 1IYZA 3KLMX 3QP9A 5DNAA 4QFDA 3ZWXA 4M49A 2QQ5A 4D79A 3NT4A 1GD1O 3D4NA 3GEGA 3PHIA 2FN7A 4LRTB 2EW2A 3HDYA 3I9JA 3F46A 2FZWA 2DAPA 2YJZA 4K9DA 3F3SA 3GRPA 3KEQA 5A9SB 3NT5A 2O2YA 4RQTA 4BL5A 1C1DA 4JBIA 1I2ZA 4WE3A 2BMAA 2QG4A 4IUYA 3CEAA 3KBOA 3S2GA 1BVUA 1B26A 2VOEA 3ETDA 1C1XB 5BNTA 3WSVA 5LC1A 1N9GA 1PGJA 3ZNNA 1NVTA 3W1VA 3H6KA 1YE3A 1DSSG 4HV4A 1UZNA 4J90A 5MGBA 1E7YA 3WXBA 2X5OA 3KB6A 1LTHR 2QZZA 1I3KA 5ENVA 1P74A 3AU8A 2V6BA 4UVIA 5JAQA 1DOHA 4J9VA 3O03A 4YAGA 1IOLA 4H15A 4N54A 3FR7A 3DDNA 2P9GA 3GFGA 1XKQA 3I83A 3JD2A 2H9IA 4DRYA 4CMCA 4FW8A 2H1SA 2NNLD 2Y93A 2DUWA 2QRKA 1D4FA 2IRWA 4GSKA 5EERA 4CLDA 1B8PA 1PL8A 2FZEA 1NX6A 1IE3A 2EG9A 5JC1A 3MJEA 2HSDA 4S1VA 2DTXA 1MFPA 3F4BA 3DHYA 4YDRA 2A35A 1Y9EA 1TA4A 3HUDA 4AJ1A 1P1RA 1GFSA 1P1KA 3DBLB 2XAAA 4UUPA 4IM7A 1I10A 2P91A 3STHA 2GASA 3NV9A 1SAYA 4OL9A 3A28A 4O5OA 1ZZEA 3HZZA 2I3AA 4IDAA 5TS3A 3D3WB 4JK3A 5CEEA 5CDTA 2VUSA 2E37A 1MUUA 3RKRA 2Q50A 2LDXA 3AW9A 3U4CA 4DREA 1N1EA 4E32A 3AM3A 3KSZO 4ZQHA 3ICPA 2G5CA 4IDBA 2VN8A 3JD4A 4Q39A 1ZUD1 3U09A 1KEWA 1D1TA 3QWFA 4RPLA 2QZ9A 2AEJA 4J43A 3HHPA 3KYDB 2IYOA 2Q4BA 4YEDA 2GERA 3T7CA 4BO5A 5KTKA 2GSDA 2PH3A 1ENZA 4B4UA 3O8QB 3K9QO 5FF9A 2YHIB 2J5KA 5JDIA 1PJTA 1E1NA 4YT4A 4UULA 1ZKMA 1NAHA 4OMUA 1T25A 4IINA 5L9AA 1U3TA 4YRDA 3RROA 5T64A 2PGDA 3QQPA 3RC1A 4BHTA 1ZO8A 2V6GA 4G65A 2YUTA 1J49A 3JCZA 4I5FA 4P4NA 2P4HX 2BGMA 3TPCA 1QYXA 3PI7A 1K5HA 5DN9A 1VSUA 4JX8A 3OIDA 1H6DA 1LX6A 2HLPA 2W98A 2Y0DA 1GTMA 2O3QA 4A26A 5KOIA 3KM0A 5CG2A 4YXFA 1I33A 5ITWA 4NNJA 2JFHA 5T8KA 2GF2A 1XQ1A 2Y1OA 2EXXA 4URFA 4DQXA 4B3JA 5TSDA 3I9OA 4M55A 3PQFA 4NU5A 2X6TA 4WLUA 1FXSA 4W7IA 4HNGA 5LCXA 1H2HA 2Z95A 3PYMA 4WLNA 2YY7A 3OA0A 2DVMA 4U5QA 3EVNA 3WGHA 1GCOA 4ITUA 1I2BA 1U2DA 3C24A 1P1HA 5A05A 4NBUA 1ISJA 5JXWA 1I3LA 3H9EO 2JAPA 5H82A 3BHJA 3ITKA 3UGKA 3DWFA 3E1KA 4ALMA 4TWRA 4IIUA 4INAA 3RU9A 4AJ2A 4CV3A 5JNLA 3H9GA 1UP7A 3WG9A 5I8ZA 4IJKA 3H7AA 4JQCA 1KIFA 1QG6A 5H81A 3FTPA 3W4IA 3WGYA 3WWZA 4EJ0A 5IG2A 1AE1A 2CFCA 1LEHA 1GYRA 4AL4A 5C37A 4NFHA 3TL3A 3RASA 1HDGO 2CSUA 2ZK7A 3OFSA 2FOIA 3UH1A 1CF2O 4NHEA 3V2GA 2NQ8A 4KZPA 4B8ZA 3AY3A 4E5PA 2JJYA 4GWGA 1DAOA 1H6AA 3HDHA 1MLDA 4K6CA 5AYVA 1HWYA 1ZEMA 4WLFA 4RL6A 3GEDA 1Q0HA 3DFUA 2PFGA 1M76A 2C5EA 2HMSA 2ZB4A 3H8VA 4IMPA 3BMQA 4B7UA 3OETA 4NG5A 4E5NA 1VPDA 1WDKA 3LVFO 4XWYA 3K73O 5COAA 3PZBA 1NPDA 4DUPA 3UN1A 4Z3KA 4XJTA 2BI7A 2O2SA 2B4RO 5IAAA 5AXCA 4DWVA 3COSA 4DPLA 5KIAA 3ZU5A 1P31A 4CMJA 4XYLA 4BMSA 3E5RA 2PD4A 4Z9FA 2DPHA 4F6CA 5BSGA 1WDLA 5TJHA 2FR8A 2C0CA 4NJMB 3KSUA 2NWQA 4KWIA 8ADHA 2DBQA 3WQRA 1JN0A 2IXAA 1DJQA 1EVJA 4J4TA 4KQWA 3A4VA 2WD7B 3PLNA 3WX0A 4HBGA 4I9NA 3U4DA 1ZIDA 4BIIA 4CM1A 4YAKA 1H94A 3I3OA 4RVHA 1D3AA 4TKLA 5HS4A 1F12A 3SJ7A 3CIFA 2W8ZA 4R54A 4ROSA 1WZIA 1HE4A 2BF7A 5F1KA 1BXGB 4L8VA 4YQYA 5T6BA 4EITA 4BQPA 9LDTA 3S2FA 3MTGA 4BNJA 4D3FA 1XSEA 2DTEA 3TZHA 2JD2A 5CHEA 3ZNOA 4D46A 1EQ2A 3NJ8A 3RBVA 4N5NA 1YB1A 2YFQA 4JGBA 1DC5A 4DMLA 4WLEA 5JMWA 4ZQFA 1L7DA 1M2WA 1MG0A 5ADHA 1KS9A 3JQ6A 4D3DA 1SBYA 4DC0A 2O3UA 4OSPA 4J2OA 3QWHA 1Y7TA 2PZMA 3EK2A 4XEHA 2X9NA 5C3MA 4ZVVA 3NTOA 4Q3NA 3GVXA 4CM6A 4PVCA 4RVDA 4BGEA 3U5TA 4GLLA 3RC9A 4BO6A 1QYCA 2V65A 4CM9A 3UHAA 3A06A 1ENOA 3WFJA 4IXWA 4CMEC 1C1DB 1LJ8A 1YBAA 2PGJA 1KBZA 2J3HA 3DBRA 3BXXA 4EUFA 1N9GB 2AQKA 1K0UA 1E7WA 1R16A 4B3IA 4FJ2A 1LI4A 4AJHA 4YRBA 2NTNA 1NFFA 1JKJA 2HQ1A 3CKYA 2OMEA 1PZHA 3M2PA 4P8RA 3ZDFA 4L76A 4YJHA 5IN5A 3WYBA 3E9QA 4WCDA 1LSSA 1ZJZA 2JAHA 1T2EA 3GT0A 3TNLA 1LLCA 2E49A 1W73A 1E7QA 1E6EA 4R9RA 4PLPA 5JO0A 4ZICA 3KYCA 2RH8A 3U3XA 4ZA2A 5DBIA 1RJWA 2X0JA 4CPDA 3M1AA 3PXXA 3CPSA 1HRDA 5TX7A 1EFKA 4PLWA 3K92A 3KXDA 4JROA 5HBRA 3Q2IA 5TGDA 1ID1A 3L0DA 4QEDA 1LA2A 5L3ZA 2J3KA 3MEQA 4RVGA 1P44A 5T57A 3TZKA 1HDYA 3QWBA 4RPJA 1HYGA 1MA0A 1YQGA 1MG5A 3IP3A 4IDFA 1GYPA 1JVBA 2PA3A 4BNIA 3DTTA 3ONDA 4PG6A 3P2YA 2PH5A 2B4TO 1JWBB 1IY8A 2EEZA 5F3RA 3VZRA 4YYZA 3CMMA 4WEOA 1DIAA 2I3GA 4ND4A 5KJCA 5C7OO 5JBIA 3R3JA 4R4JA 2SCUA 2CVQA 3K8ZA 3PRJA 3RJ9A 4CM7A 1U7HA 4CQLA 4YT2A 3G17A 4XYMA 1ZSVA 1BDMA 1D7OA 4CR7A 1CQIA 3LZ6A 1GEEA 4BNKA 1TT7A 1PSDA 3JQDA 3JD1A 2D5AA 4NJOA 2QYTA 3IOYA 4MVJE 3ZCXA 2NU6A 4GMFA 3E03A 4TZTA 4DQVA 2YZ7A 3L9XA 1JWAB 4CL8A 1KETA 3ZH2A 1NYTA 3GC6A 1DLIA 1Z75A 3GH3A 5TNXA 1ONPA 5JYDA 3KZVA 2GLXA 4J1TA 2OFPA 1DJNA 1DRVA 1NNUA 4FB5A 1P45A 1J0XO 1OI7A 4Y6RA 4NBWA 4IPTA 4XA8A 1NVGA 4OKNA 5JPIA 3ZWCA 3WGOA 4LW8A 2WD8A 2AE2A 1HKUA 4BVAA 1BSVA 4XR4A 5KJFA 4CQMA 2EIHA 5U4QA 4EI2A 4AG3A 4MJLA 1DIBA 1H6BA 1X1TA 3FRJA 4WOJA 1BWSA 1GAEO 1TB4A 2Y1CA 3JQBC 3FN4A 3OICA 4F6LA 4LVUA 1S6YA 3UCEA 4BV9A 4XD2A 4ZN6A 1X7DA 1V35A 1NBOA 1LU9A 3C7CB 5KWEA 1K3TA 1H9AA 4PLFA 4W9NA 3CXRA 3LLVA 3HB4X 1YB4A 4RQUA 2C2XA 3ZWMA 1U28A 4K6FA 1LLDA 3DZGA 4MVJA 5DBFA 1RKXA 2C07A 4NBVA 2NQTA 3R6DA 4YCAA 2RIRA 1PGOA 1EQUA 1Q2XA 4XQ9A 2CVOA 1DC3A 2GZ3A 2CUKA 4KQXA 4R5MA 3FPCA 3RFXA 5JSFA 2DTDA 5KVVA 3IDSA 2OGUA 2P9CA 2VZ9A 3WGTA 2GN8A 1R12A 4BNXA 1PEDA 1EUZA 4DXHA 5T67A 1F17A 1RM5A 3I1JA 1V3TA 5L7YA 1LSOA 2Q1TA 5KNLA 4Y98A 4GKVA 4UAGA 4L0QA 2D1YA 1I3MA 4R1SA 3SC4A 4FSHA 5IN4A 3NDRA 3IIEA 3UAGA 1LSUA 4ND5A 2O50A 5DOVA 5HA5A 1XR3A 3GGOA 4IGEA 4BGIA 5BT9A 4EUEA 1F14A 3OEYA 4W82A 1LSJA 4D41A 2VZ8A 4D0SA 5A4DA 2DFVA 2Q1UA 2X58A 1IPEA 3H5RA 5B4UA 4BGUA 4D45A 1R15A 1YONA 3SVTA 3TL2A 1E6WA 1OC4A 1XHLA 4XGIA 5I9LA 1GADO 4HWKA 4IJUA 2VHZA 4Q3AA 1IHYA 1IULA 1OZAA 3ZHXA 1SNYA 3MTJA 2EKPA 2EJWA 3GZ4A 5FWNA 3BMQB 3HWRA 2WJPA 4DQUA 1M6HA 5AOVA 3U62A 4QSMA 1TVEA 1EMDA 4R68A 4R9SA 2VT2A 4B4WA 2G1UA 5TQVA 4EJMA 5U9CA 3RSHA 3TZQA 1XEAA 3B1KA 3U0BA 1PGPA 1QRRA 1Z82A 4J7CA 1NAIA 4FFPA 5COQA 1PQPA 1F06A 4YRAA 2VHWA 3B1FA 2JFGA 2Y0EA 4OKIA 5CP8A 3AUUA 1GV0A 4XJSA 1BXZA 4X54A 5F21A 3AY7A 1HZJA 4RVFA 5U1PA 4CMAA 5T5QA 1HXHA 2DBZA 1IHXA 3GF4A 4BNZA 1I8TA 2ZB8A 1UZLA 4L75A 3KTDA 3D64A 3RUCA 3BIOA 3HB5X 4Z0TA 1PR9A 2FHSA 1U3UA 3C7AA 2QX7A 2V6FA 4N5MA 1GPDG 1B15A 3OF2A 4JNKA 4BNWA 1Y81A 4OO3A 1CWUA 2I6TA 4OOEA 5EESA 1PJBA 3PIIA 1I0ZA 2HDHA 2AA3A 2B5WA 3K30A 3PIDA 2JCXA 1ZVMA 3GVHA 4RLSA 4G2NA 3WJAA 3I6QA 3QSGA 4LISA 3F5QA 5G4KA 4CJXA 3OP4A 5JLAA 3SLGA 1GU7A 4LMPA 3VH1A 3KOUA 1H9BA 2JD1A 3LK7A 3WQQA 4NJMA 4UUOA 4DVJA 2WMDA 3SLKA 2CZCA 3M6IA 5KJ1A 2AG8A 2HCTA 1HZZA 3VAZA 4GMGA 5DCUA 5LDHA 3LDHA 2C59A 3PJFA 1PGQA 1BG6A 4LN1A 2ZCUA 3N7UA 2YQ4A 1QLHA 1I24A 3RFTA 3D0OA 4DTIA 1LDBA 4OXKA 2J3JA 1MGOA 3O26A 4OQYA 4F45A 2ZIZA 3DBRB 1EFLA 4FBGA 5HM8A 5L53A 4OOFA 1B8UA 3QV1A 2DC1A 4H7PA 4J7UA 4YT8A 4GBJA 3RIHA 4Q3BA 5JS6A 3PK0A 4BKPA 1OBFO 5F1OA 1KVUA 3ZWYA 2WTBA 4YJHB 1P1FA 1YO6A 4MVJM 3JQFA 3H3FA 3E5MA 2B4QA 1W0CA 2Z1MA 2X7HA 4RZIA 4E13A 3DOJA 4NDNE 5A03A 1B0AA 2A92A 3KYCB 1CIVA 1GYQA 2X22A 3RQSA 1PGNA 3QVWA 4IJWA 4W7HA 3VZPA 1DC6A 2W2LD 5BSEA 3BMNA 1T2CA 1EVZA 5FEUA 1AXEA 4GX5A 3RCBA 3MZ0A 4TKMA 4D43A 3H2SA 1E92A 1HF3A 2Y68A 1KY4A 4E30A 3WGZA 2PV7A 1SPXA 4GH5A 4JP3A 4NQZA 4RVUA 3WB9A 1A5ZA 1YS4A 5JW6A 2FR0A 3DHEA 3OM9A 4J4HA 5CAEA 2DT5A 2G76A 4OH1A 4PG7A 3V8BA 3I6IA 2ZTMA 3JQ9C 3ZWWA 4DLBA 1JQBA 1O0SA 1V3UA 5L40A 3OQ6A 2ZJ1A 2OL4A 3LT1A 5HRUA 3WIDA 3JQAD 3S8MA 3GG2A 1UAGA 3W8DA 5TIIA 1HDXA 3EZYA 1B8VA 4HNHA 3H3JA 1E7MA 1ML3A 1X0VA 2AQHA 4WNIA 4CQLB 1EDOA 2X9VA 3EVTA 4OJNA 4D42A 4Y6SA 3DMTC 2G0TA 4WCFC 3ZU4A 3ETEA 2NU8A 1O89A 2ZJ0A 2HMWA 3HADA 4ZHSA 2D4AA 4LCJA 3DAFA 4JCOA 3LC1O 3AUAA 4I9UA 4YJFA 3ZWPA 4BO4A 1LBEA 4Z6KA 4GX0A 4TRRA 1B7GO 4K28A 3L6EA 1NM5A 1PJ3A 4S3MA 3PGJA 1ENYA 1VKNA 4JXKA 2IE0A 1U5AA 1EUCA 5A1TA 3H5NA 1X13A 3K6JA 2HAEA 5THQA 4PN3A 4YJGA 5DP2A 3S2IA 4A73A 4HP8A 1DHTA 3F1KA 3UXYA 4WJZA 1LLQA 1XQ6A 3TRIA 4GPD1 4BO9A 1DIRA 3RBZA 4CQMB 2HK9A 4U6SA 2IXBA 1SO8A 2GCGA 2NLOA 2PZJA 4ND1A 1N7GA 4ESOA 1PS0A 2C5AA 3K2BA 5K9ZA 3D5QA 1BVRA 1V0JA 4WUVA 4FD3A 3PWSA 3F6YA 5JY1A 3ZV5A 4BMVA 4Q3CA 4NH4A 4DIFA 1VJ0A 4XRGA 4FJ0A 3H5AA 4NBTA 3ZGYA 3VDQA 5JAMA 3JV7A 5B12A 2WDZA 3W4KA 2C7VA 3GHYA 5F5NA 3ZWNA 3FBTA 1D1SA 2WYUA 5B4TA 2NTJA 3D4PA 1CEQA 3WLEA 2EF1A 4MIYA 5A9RA 2YV3A 5JO9A 1ENPA 3TQHA 7MDHA 3RKUA 3OJFA 1XA0A 4U6QA 1O94A 5THKA 1MB4A 1ZJYA 3WGQA 3Q2KA 2C29D 3V2HA 5I7VA 1DLJA 1NQAO 4CLRA 1LRKA 5IDWA 2WYVA 3VPHA 2EKLA 3N58A 2X0IA 1KVSA 1UR5A 1SOVA 4H16A 1QMGA 3OIGA 2VRCA 6ADHA 1AN9A 1FDWA 1LRLA 2HMVA 3EUWA 1GQ2A 3FHLA 4RORA 3GVIA 3MOGA 4HFJA 1VL8A 4GLOA 1RM4A 3U4IA 5JC8A 1JLLA 3SJUA 3QRWA 4OSOA 1VL0A 2PD6A 1AUPA 4ND3A 5IZCC 4ALNA 1C3VA 2FMUA 5I7SA 3I9LA 1Z7BA 4LVCA 3WNVA 1YBMA 3ITDA 2TMDA 3NT2A 1PZGA 4NFSA 1E0DA 4BO1A 3PWZA 1BHSA 3UCFA 4ALLA 4UEJA 4ALJA 2VYNA 4KDFA 3WICA 5L4SA 1BGVA 5G4LA 2OXIA 2GN4A 4EW6A 2BFAA 4II3A 3UOGA 4GGOA 1KEPA 1N5DA 1UDCA 2OBNA 1PQUA 1RYDA 1QP8A 3JSAA 2PGLA 5BNFA 3KRTA 4GVLA 4P22A 3GY0A 1VRWA 2X0RA 1HDOA 2P68A 5CEJA 3L4SO 1UXGA 5ILGA 8LDHA 1D8AA 2UUPA 5KKAA 4AVYA 4C7JA 4XKJA 3EDMA 4UUMA 3VZSA 1EK5A 4J0FA 1PX0A 5IDXA 3SEFA 1Z73A 5BR7A 1EEHA 4RDIA 1JU9A 3CTMA 4P38A 4BB5A 4GX1A 2DKNA 2J6IA 4EDFA 3EYWA 1IUKA 3NYWA 3I9MA 2I65A 3G49A 1DRWA 4CLOA 4A2CA 5TT1A 3L6OO 1E3LA 5L7WA 1YKFA 1KVTA 3ONFA 4GGPA 4OXNA 3CUKA 3VPFA 3VPXA 3AOEC 5KVSA 1YJQA 1HE3A 1A9ZA 2JHGA 4NFYA 3JYOA 3KSDO 1F0YA 1PJSA 3VH4A 3HN2A 1Y9AA 4TRNA 3VH3A 5AVOA 2EJVA 1DEHA 3I4FA 3QLJA 4MPDA 3AJRA 4PG5A 4M86A 3DQPA 1HDZA 4Z3DA 5ER9A 5ENDA 3LF1A 4YVFA 2CVZA 2VHYA 1GZ3A 3JD0A 3PYLA 2GN9A 4WEQA 2B83A 3D1LA 3V5NA 1G0NA 3IUPA 5JCJA 2HMTA 3RJ5A 1Q7GA 1MC5A 5G4KB 1ZMTA 5FI3A 3GUCA 2JFFA 4ID9A 5A5EA 3FNEA 1UUFA 3FNFA 3BTVA 4YB8A 4ILKA 3ANMA 4D0RA 2YYYA 3GOHA 3LC2O 1KC1A 4CV2A 3TZ6A 5BQFA 4KMSA 1JTVA 3GNTA 4BNLA 2O3JA 4HKTA 3WLFA 3GRKA 4MP3A 5G2OA 3RI3A 2QHXA 2QRJA 3AUSA 3DB2A 5J23A 3HG7A 1PS9A 4PLGA 1SZJG 2IDZA 4TRJA 3ETGA 2GPTA 3PHLA 1A7AA 4NR0A 4CUJA 5DCWA 4EGFA 1DDOA 2AEMA 2HRZA 5ES3A 2VYVD 3QA9A 1I36A 1W6UA 1HTBA 3D4OA 2PR2A 3DAGA 4Y8VA 4CLXA 2X23A 2Y1DA 1U9JA 2QW8A 3INRA 1YGYA 3PWKA 2WWRA 4M1QA 4WNCA 2VWGA 5GZ6A 5EINA 1WW8A 2RBEA 1X7HA 1ZMOA 3QIVA 4RF4A 1LQTA 3G1TA 1F8GA 2GGSA 2X8LA 5EQDA 2PKRA 4PGFA 1B16A 3UUWA 3IQDB 3DONA 3PTZA 3AM4A 1IPFA 3G1UA 4U7WA 3GEMA 3KVOA 3DBHA 5A5FA 1X15A 1Z6ZA 3BMNB 5DOZA 3ONEA 4R5HA 2Y1FA 4IGFA 5GY7A 4AJIA 1C0IA 4XQCA 3VC7A 1NPYA 3KYBA 4XB2A 1GZ6A 1ZFNA 5B1YA 4J6FA 3JYLA 4RVSA 1HSOA 2YV1A 4QO8A 2Y05A 4WGGA 3GZNA 3RD5A 2F00A 1N1GA 3EZLA 1DXYA 1KERA 5FYDA 2VHVA 3HJAA 1R37A 2O3RA 3B20A 4YT5A 2O7SA 4GSLA 2EGHA 2BFOA 3S55A 3UICA 1YXMA 2BKAA 4W6ZA 4CMEA 1NFRA 2BELA 2GYYA 2QIOA 4DPKA 2BFMA 2CF5A 3PPIA 1LDEA 5DT9A 3VH2A 4D3SA 3ZHYA 1P33A 1RPNA 3CINA 3UKOA 2C20A 2O4UX 2GO1A 1L1FA 2FR1A 4ALIA 1R6DA 2VWQA 1LC3A 4ZU3A 1PJ2A 2P5YA 3ON5A 3EC7A 3EGOA 1PZFA 4Z0PA 4YJFB 4FOSA 1E5QA 3QW2A 3OIFA 5ICMA 4OM8A 3LYLA 4D7AA 1CYDA 1BRMA 4R51A 3DZHA 3KHUA 4J16A 4IDDA 3H9QA 3Q1LA 1E3IA 4YJGB 4CV1A 5HWSA 1IL0A 3W6UA 1PQWA 1DPGA 3ZHBA 1JA9A 4FS3A 4IDCA 1Y8RA 1FF9A 3GMDA 3GNSA 4FC7A 3FPLA 2VTDA 4RGBA 1CRWG 1UXIA 5IDYA 1Z74A 1ZK0A 1VLLA 3LF2A 3ZNPA 4AJJA 2ZYAA 3CH6A 3VVBA 3PHGA 4DLLA 5JYEA 3L4BC 1VM6A 4L4RA 5GMOA 4LRSB 4I1IA 1EUDA 1NTOA 4FPXA 1R4MA 5I9MA 1I5RA 1V8BA 5GZ3A 1Y1PA 5FFFA 2B69A 1FDSA 3RU7A 3WMWA 1FMCA 3MJSA 2I76A 2GZ2A 4B7XA 1H6CA 1EVYA 1OC2A 4P4LA 4MVJF 3RC2A 3QWIA 3Q11A 4DIOA 1KC3A 4R01A 5DULA 3QVTA 3RVDA 7ADHA 1WZEA 2Q3EA 4HY3A 4CLRB 4QFCA 3HSKA 4FCCA 4J1QA 3A1NA 4Z0HO 2E4AA 4B8WA 2OP0A 4WLOA 1AHHA 4CMKA 2D2IA 4YTEA 3EW7A 1ZH8A 3W8EA 4BKUA 1S7CA 2IEBA 2VT3A 3L77A 2Q49A 4FJ1A 3EAGA 3KO8A 4M87A 3IC5A 3T7EA 2VRBA 1LQUA 4ZRNA 4KOAA 4TSKA 1FK8A 4D44A 1FDTA 1LLUA 1QXSA 1TLTA 5EJ2A 1Z45A 2PLAA 2PZKA 1T1RA 3DR3A 3Q6IA 4NPCA 1QYVA 4YA6A 4E4YA 2HU2A 5ER6A 1YL6A 4ONEA 5CDSA 1UZMA 1GY8A 2WSBA 4CM8A 2CNBA 2PD3A 4QUKA 5A04A 3KUXA 4ALKA 3DMYA 4E3ZA 5AXBA 3IKTA 1DC4A 5A9TA 1AXGA 1MV8A 1MC4A 2O4CA 2Q99A 1J4AA 4TVBA 4IY1A 4CMIA 1WVGA 4QECA 2CD9A 2Q46A 2WYWA 3Q3CA 4O6VA 1SB8A 2VCYA 3WNQA 3GMSA 3VPGA 1LDNA 3WGIA 3GNQA 1DRUA 3LLSA 3R1IA 2PK3A 1CETA 1LC0A 5BSHA 5B37A 5KJEA 1EBUA 5K6AC 2D59A 5L7TA 1L7EA 5ILOA 4E33A 1NQTA 2O3TA 1ISMA 3LU1A 1WLYA 2RH4A 2Q1SA 4JIGA 5ITVA 4JJGA 5IZ4A 4E5KA 2YQ5A 3NGXA 2CF6A 5G0SA 4Y67A 3C1OA 4NIMA 1B2LA 1ADBA 4RF5A 4N5LA 2JCVA 4LSMA 1LDYA 5C7LO 4UREA 4BB6A 4TRMA 1PIWA 2VZ0A 3BMCA 2OHXA 4CLOB 5L4LA 1NASA 2ET6A 3O9ZA 1YB5A 1DIHA 3DO5A 1N8KA 2J8ZA 2AHRA 1E1LA 1I3NA 4BO2A 4EUHA 3PLRA 5DBGA 5JDCC 1J5PA 4BQRA 1Q7BA 3CZMA 3ANLA 4HXYA 4A5OA 1PS8A 4UVEA 4ZQGA 1A7KA 4AJEA 2AEFA 1EK6A 2NVWA 3MJTA 1A27A 5IJZA 1B3BA 3AOGA 1CDOA 3QWAA 1T4DA 4CV0A 3E18A 4NBRA 3IMFA 2HJRA 4OXYA 1H0KA 4E2XA 2J5RA 2V6MA 2B0JA 4B4OA 3OMLA 3I5MA 5IDQA 1FDVA 1VJTA 2ZATA 2DPGA 3JD3A 1Q7CA 4CM5A 1NWCA 1SEVA 1F8FA 2IZ1A 1DIGA 2NTVA 2AE1A 3P19A 4WKGA 1AHIA 4IDEA 3AI1A 1UP4A 1E5LA 2P4QA 4IJVA 1X7GA 3OHSX 1SB9A 5MDHA 3IS3A 1T2FA 2BRUA 1LDMA 3HDQA 4JBHA 4E2ZA 4O1MA 1PJ4A 3GN1A 2JD0A 1U8XX 3PFWO 3ROQA 1P0CA 3QHAA 1HE5A 4CODB 2CDBA 5JAZA 4E0BA 1PZEA 4BKQA 2R00A 5JAIA 2NVBA 4GL4A 2X5KO 1DFHA 1KEVA 2Z5LA 4ZD6A 2Q45A 3TOZA 3ZHZA 2UAGA 4R1TA 3OJOA 3VPSA 1M6WA 2IEDA 3V2UA 1WPQA 3GLQA 2O3SA 4B7CA 1MP0A 3MJVA 2ZYDA 4YQZA 1T24A 3RUIA 2CDCA 3FBGA 3SC6A 2P5UA 1NVMB 3FF4A 3M2TA 3H9UA 3AUTA 4J0EA 3DBHB 4XIJA 2ZTVA 3TJRA 5JE8A 1YVEI 4HFRA 3FD8A 4OIMA 2XF8A 4R1UA 1ISFA 2Z1NA 2ZQZA 2TMGA 3VKVA 2PWZA 1JVSA 4IQGA 1XIVA 3OJLA 2HO5A 4CR6A 1Q0LA 1QV7A 2G17A 4IDGA 4XR9A 4EBFA 1YOVA 3WIEA 2X4GA 2EKQA 1N2SA 4Y6PA 1E3JA 1SMKA 3ZV4A 4MDHA 3OJEA 1C0LA 4AICA 1PJQA 2NVUA 2FWMX 3GZNB 5I7EA 1QV6A 1ONOA 1U4OA 5EIOA 2E82A 4U0JA 4F3YA 4PZEA 3KV3O 1Y6JA 1ZK3A 1ZXBA 3TFQA 4PG4A 2JCYA 3U9LA 5JCXA 4M89A 3GAZA 4MVJI 2AG5A 3QVXA 1UDAA 2ZTLA 3OSUA 5COBA 5DF1A 3MJCA 4I5DA 4BO7A 3ABIA 4GWKA 4MVJH 3C85A 3JTMA 4KTTE 1N92A 1QKIA 3VOSA 3RUAA 3GDGA 4YR9A 4RF2A 2C82A 9LDBA 4IZIA 2FY8A 4K26A 4KUGA 4BNMA 4E12A 3C1AA 1HL3A 2VUUA 5TF4A 1ARZA 1CJCA 1PR3A 4WK6A 1UXHA 2X5JO 4XB1A 3V1YA 1BDBA 1M67A 1EBFA 1ADGA 3E9MA 2NADA 5GZ1A 3HE3A 1R4NA 2GDZA 5TC4A 5JMPA 3OJ0A 1T26A 3W8FA 2FRDA 3CSDA 1KVRA 3GG9A 2ZCVA 3L9WA 3DAPA 2FPIA 3PJEA 2DBVO 1NQOA 1Y8RB 3JYQA 4PLCA 4AJOA 3AFNA 4CM4A 4A7PA 1IB6A 2W2KA 1YL5A 3GPIA 1HLDA 1BW9A 3K5PA 1E1KA 2E6UX 4R3NA 1JW9B 1QSGA 5H83A 3T4XA 3KEOA 1VE9A 1X0XA 4CM9D 4L4SA 3DZFA 4WLVA 3I52A 3NTQA 3X2EA 2DFDA 2WEKA 3JQ9A 3PQEA 1E3WA 1RM0A 1ISGA 1E77A 1R4MB 2B37A 4NK4A 1DAPA 3INGA 4R1NA 4XQGA 3BAZA 2E48A 4GKBA 3LT4A 3L6DA 4EYEA 3GR6A 4BNHA 1PJLA 2Y67A 1UDBA 5CDUA 3GGPA 4CLEA 4KP7A 4AFNA 3MWDB 1LXCA 3LT0A 4IS3A 3I9NA 2HKIA 5I8WA 3ST7A 2VOJA 3DMTA 5EL0A 4WCFA 1WMBA 3B6ZA 2I5PO 3N74A 4WASA 4L9RA 2OP1A 3OQBA 4J7XA 3AI2A 2X1HA 3OECA 3GUYA 1RWBA 5HTOA 3UW3A 2HJSA 1MFZA 3BTOA 2RHRA 5KVQA 3TWOA 4FDAA 3Q9UA 1I01A 4U8GA 2JHFA 3ANNA 1HETA 2IZ0A 1MXHA 4DBVO 2LDBA 4QQRA 3JQCA 2FPGA 3ENNA 3OA2A 2Q4EA 1BXKA 4PLVA 4TVOA 3BHIA 3NX4A 4BS9A 4A10A 4RJTA 1XCBA 2UUOA 1Y8QA 4FOOA 3HFGA 1FJHA 3K2EA 4CM8B 4DPMA 2A94A 1AGNA 3EY4A 2YDXA 4XYEA 3WFIA 3E9NA 2GNAA 5EQFA 3ADPA 4RF3A 2ZB3A 3TF5A 1CERA 1E7RA 3VTFA 2Q2VA 4C7KA 2OZPA 5JDIC 1RM3A 1VL6A 3ORFA 4CMIB 1E6UA 3IKVA 3OH8A 4BKRA 1HDRA 3FCOA 3INTA 4A0SA 1E3SA 1B14A 2HUNA 4PLHA 5F1PA 4BV8A 1ORRA 4IXTA 5EMHA 1GL3A 2B35A 4KDEA 4QXMA 4HX5A 2H6EA 4BNGA 2EW8A 3VZQA 3GN2A 3PJDA 1G1AA 2VUTA 1U4SA 1W8DA 5JY6A 2OOSA 4I08A 2D0IA 3FSRA 4QT0A 1KYQA 1ZW1A 2IYPA 3RUFA 4BNUA 5TT0A 3H2ZA 4MP6A 3WR5A 4PZDA 1H2BA 3WBFA 2WM3A 5G0WA 4A27A 3AI3A 3WS7A 2EV9A 1TT5A 4CUKA 4F46A 1XELA 3PJGA 4PLTA 3PDJA 1UXJA 4ZJUA 2FP4A 5T8KC 5CG1A 4CM3A 3JQ8A 3LSYA 1GZ4A 2H63A 3K96A 4J49A 4I9HA 4KTVE 4RO0A 1PWZA 1GCUA 1ZSNA 2VWHA 4WPGA 4DYDA 1WDMA 3G3EA 4OAQA 2VNSA 2X0NA 3HFSA 4MINA 2NUAA 3DOCA 4HFNA 1HYEA 1ZEJA 3H4VA 4B3HA 4JJIA 3BMCB 2PZLA 3DZJA 1M66A 4PIVA 1NQ5A 1YDWA 4CQMD 1O95A 3ZWOA 4RZHA 4CR8A 4I5EA 3GHHA 4Q3DA 3WWYA 3NTRA 4U0KA 5DZSA 1XLTA
chains in the Genus database with same CATH superfamily
5K0JA 3GLGE 3ZIAA 3U4AA 1OGJA 2ECQA 4FU0A 2IDJA 5CT4A 1NVWQ 1NZJA 3H99A 3UMBA 1U8EA 1PO7A 4WJLA 2FOXA 5I5GA 2ZJ2A 4DM7A 5CB0A 4DMMA 2G8NA 3A9CA 1GG5A 3DLTA 2FFBA 1Z2NX 1XJCA 1Z88A 2IYYA 3C3BA 3R3ZA 4INOA 5ALDA 1F9AA 4BMCA 4BTLA 2PL1A 4ID3A 4X8OA 3HUTA 2XKJE 3UT6A 1R6XA 1W4ZA 2ID8A 3NUGA 2BBWA 3DBVO 4V2UA 3V7NA 4I4CA 2HV8A 3Q7EA 1IEXA 1P80A 3HO6A 1H05A 2HREA 5IPFA 3KOMA 4BPBA 1U1IA 4KIGA 5CB8A 1U3WA 4CIYA 2YHUA 2DU8A 1QDUA 1IZ0A 2VHJA 2YXBA 1A5BB 5ALRA 2RAFA 5A6SA 2AQ8A 3DUFA 5IDVA 1UC4B 4F3RA 4UNRA 4DS3A 2P77A 3TNYA 1AX9A 1SHUX 4EK9A 4GI7A 2EJUA 5BSUA 4XZ3A 4LHXA 4P84A 3CS3A 1HY3A 4TMTA 1LTQA 1V39A 1OWLA 4LK3A 4MVJG 4P4TA 3BD7A 4F86A 3DJFA 3V34A 3COWA 4M8SA 1K97A 3HCAA 3MW8A 5C8XA 4F21A 3RHFA 2B3TA 1O6ZA 4GQIA 1NP3A 1TCCA 1UBRS 1KAQA 2WJJA 2II6A 5IAGA 3TLJA 2XTAA 1J6UA 4HVCA 4NCKA 2VG8A 4O4HF 3ED5A 6REQA 3ZVMA 4YHHB 1ZOLA 2J3IA 1VKOA 1QQTA 3G79A 2C7OA 2QUHA 4U9HS 3MUEA 2H51A 5I5EA 4BVHA 2VTEA 1R9GA 1WKVA 1OVGA 5A3VA 4JY7A 1IAVA 4QQNA 4BNTA 3D43A 1YL7A 1XL0A 2YICA 1HDCA 1TTQB 2QW1A 4AJLA 1LV7A 1TVMA 1JLSA 3PENA 4YPOA 1IEWA 1P1JA 2X76A 3BXFA 3LC0A 3A3KA 1CRPA 1ORTA 1QYDA 4B6PA 4M8KA 1LNQA 4PANA 4QQFA 4RGYA 3S2SA 4KQEA 4A9AA 2YVKA 2X3FA 3ZXUB 1PT7A 4MQUA 2QBYA 1SOAA 1SC6A 4I55A 4JFRA 4YWJA 1RRVA 3FOEC 3FXAA 2MR5A 2CHUA 2Y71A 3RJMA 3QE9Y 1LPMA 1O7JA 3C41J 4YUWA 4DA9A 3EVBA 2JAXA 2FQQA 1TMKA 2XCRB 3HQ4O 1G7SA 3RHZA 4UEKA 2W11A 4RH1A 5ECYA 5J4KA 1QPBA 4H3VA 1QIKA 4NVRA 2QNRA 2IPLA 3LP5A 4JJFA 3A8TA 3K0BA 1FFCA 4RVNA 4MO9A 2RE8A 1QORA 1PT9A 5IMBA 3W6ZA 2VH2A 4EO9A 4OM7A 2POQX 4LC1A 1NVVR 3LC7O 4PZUA 4BAGA 4BUCA 1Z3IX 3OQ1A 2PTGA 4H6XA 3UBTA 3U4HA 2NUBA 3WGGA 2IITA 5JH7A 3HC7A 1E1RA 2J5QA 2EERA 3E1GA 3KJXA 3P7MA 1PJZA 2FQXA 4P36A 3F5FA 4G5GA 3TZCA 1JR2A 4ZOQI 1U8FO 3E3OA 1C9KA 4LEIA 3ZGZA 3OEWA 2DY0A 1JIJA 1WV0A 4GE3A 3WGMA 1E3MA 3MWEA 3Q0EA 4ZYYA 3I04M 3DT9A 4RJLA 1KIMA 2DJ5A 3E7DA 3IQEA 1T6ZA 3N8NA 4MHOA 3P9RA 2C57A 2I1LA 1MQAA 1KAMA 1NT4A 2GKSA 2G25A 3KLPX 1M3SA 1J70A 4PCVA 2PBRA 2XUJA 3KWLA 4H7DA 4NE7A 2AQIA 2XOXA 2DQ4A 1R9JA 4WOKA 4KUEA 1TU3A 3A6JA 5I9TA 1CUAA 3TIIA 2XPCA 1Z7EA 4C06A 4K6MA 2Z8XA 1IN8A 2LVBA 2XQFA 3OAAD 1UDRA 4QOEA 2HFKA 4RIEA 3HCOA 4TKZA 5GV8A 5BUQA 3AM5A 5KEIA 4FSXA 4BVGA 3IHTA 3INYA 3PLAE 1A2KC 1AGPA 1ZGZA 1UBKS 5LQSA 2ZSUA 1I2AA 2R8ZA 2BH9A 3K53A 4CM4B 4WWHA 1T2DA 4KO4S 3TZBA 1UBJS 2Y66A 4JL6A 5JEEA 3EHEA 5EXDA 5D3QA 4DCGA 4H4DA 1BD4A 3UW1A 4PLYA 4LCEA 4P4GA 2O48X 2J3EA 2R9VA 3GWZA 4OHCA 4A3SA 3QKRA 2RJ3A 4CN8A 3K70B 5MF6A 1W4RA 3P5SA 2BCJQ 1G98A 3NBAA 4LZLA 1CJMA 2LBPA 3FTNA 2GAIA 3NIFB 2D5CA 2Y99A 4DR1B 1X14A 4P0QB 3A9RA 1TXGA 5B7GA 3TGLA 4Q3EA 4JT2A 4A1FA 3PXEA 2I1QA 4O59O 1NULA 4LAFA 1SXGA 2ILVA 5DCYA 1ZU5A 4D3ZA 4YMHA 4Z3OA 2D8AA 3DS8A 4POAA 1KTIA 2Z9DA 1GL9B 1SD2A 5C8YB 5DGXA 3R24A 5BYBA 2NV6A 1E2BA 2WY2D 3VHRA 2QRVA 2XNCA 3A6HA 4B2YA 3D3EA 4IV8A 4MMXB 3WDMA 3GMTA 2AR7A 3PSAA 3RS5A 3NFYA 3O2JA 1P7CA 1V5WA 2UVDA 3R77A 4GKJB 4MIOA 4QEZA 3HDJA 5DHAA 3A6GA 4J16C 3RYIB 1C9YA 1G0OA 1C9MA 4WCFB 1UH5A 2IYQA 3E4CA 4DMUB 5AW8A 4Y0VA 3DQZA 3OCCA 5EZYF 4YFYA 4Y1RB 1EXVA 1KYTA 1XCPA 4OHRA 3L01A 2J0VA 3FVVA 3EF3A 3N6XA 5CLHA 3EQZA 5JRJA 3OTGA 4L51A 1AVTA 3GJ8A 4KUHA 2QVGA 2UYYA 1Z7WA 3A9WA 3H8WA 3IDOA 3IV7A 1MX3A 2I3DA 5AVKA 3F47A 2P4EA 4GP6A 5A9SA 5AW7A 4QYIB 1GV1A 1YZNA 4FYXA 4BNNA 4AJKA 4OB8A 2VJCA 4H0FA 3LO5A 4I5GA 3K1AA 4WVLA 2YFHA 3C3XA 3L0IB 1O3YA 4UQPA 3NKLA 1XHFA 4JC5A 5IFLA 1E3EA 1UAYA 1W1UA 2JC3A 3QMPA 3GU3A 1IONA 2CFSA 3AHFA 4DV0B 3HPQA 3U80A 4ZZ1A 5HFNA 5FBZA 5LR6A 2OUIA 3Q0IA 3EF1A 5FOUA 4DC9A 2UXCB 2A0YA 3F2VA 4X66B 3LH5A 1M2NA 2IS2A 4LNAA 1FVXA 3ANTA 3LRTA 4M9XA 4C0SA 3DLIA 3DV0B 3HABA 4U3JA 3SM3A 1U2QA 3ESBA 5AXDA 3EPLA 1GUFA 3O38A 3ZW8A 4R71A 2OXFA 1M74A 5LMNB 1O8CA 3JQEA 2RCNA 2XXBA 3TTUA 4R16A 2J32A 2GKGA 3H19A 4NENA 1FFEA 2PXXA 1JE1A 1ADCA 4TL9A 5KSWB 3AY6A 3RBAA 3NS7A 5JU6A 4JB0A 3NI2A 3T9CA 3ZVLA 2B20A 2CLIB 2JLVA 3Q9NA 5F7ZA 3BDAA 4H18A 3GLIB 5IM4A 1YUNA 1ULBA 5HOQA 2RGNA 3DD5A 2X9GA 4RTRA 4LG1A 2Z3VA 2Q3LA 3HP1A 4HDRB 4A1OA 1R7RA 4FC6A 1G3MA 1OFVA 2DBRA 2G63A 3WYEA 1NRWA 1YUBA 2NSJA 2XGOA 2RGAA 4RPGA 4E31A 1Y6QA 4OB6A 3ZLVA 5IEJA 2BGKA 5E6SB 4FSDA 2GN6A 1CS0A 1XU9A 4HBZA 4LYAA 3WVNA 4B9AA 5LQAA 4KK4A 1BMDA 1DAMA 2EZ8A 5IJ0B 3OEHD 3A26A 4BNVA 1U2PA 2DZDA 4FMBB 1NOJA 4TSFD 2D3TA 5AHRA 3WA6A 3CZCA 3IAUA 4FGZA 2N47A 3TAHA 3NEPX 4JB2A 1NFQA 5G1PA 8ATCA 3DH0A 1HEIA 3D3WA 1YASA 2R4QA 2ODWA 4RCVA 1FRFS 4RTJA 2WA2A 1CR0A 1ODJA 3O82A 3R0QA 1C4OA 2FSFA 4O63O 3N8IA 3QKWA 4REMA 5BNIA 5HE9A 4QTZA 2Q4RA 2ODBA 4YV2A 1EFUA 5CCXA 1E4EA 5AQ1A 3IEMA 4TMFA 5BQPA 3SHQA 4BCDA 1LY1A 3IUSA 2C7GA 3KPJA 2VDWA 4HL6A 4HRXA 3RBXA 4ZT6A 4BEJA 4DA6A 4DCVA 4ZK2A 4MO2A 5EUBA 4WA8A 2IQIA 3VTZA 5K0ZA 2Z1DA 1HNZB 4AO8A 3KSBC 4HOYA 3LT2A 1M1YE 1VKHA 2WFAA 4NMHA 3WB2A 4FNAA 2DPYA 1PU2A 3CCBA 4AJ9A 4BNFA 5JPDA 5L51A 1Z4MA 1ZVKA 3OTHA 4PSVA 3SBOA 4RESA 3RAFC 3UB2A 2CMDA 3DSRA 1D0IA 1S8FA 2H54A 4YRFA 1QS0B 1UZAA 2YWEA 3RUHA 1G291 1BWPA 2O8EB 3OCUA 3GA0A 3RWOA 2OLEA 2P2NA 4BFXA 1YZTA 3JQ7B 1W9HA 4DAEA 5BPFA 2QZJA 3JR7A 4YMSA 1P7ZA 4UKDA 4Z8XA 4XE5A 1G6KA 4JMLA 3NAGA 3M5CA 4WZ6A 3IURA 3L6RA 1C14A 1O8BA 3SFTA 3HRHA 4N9QA 1MEEA 3BEOA 3TGWA 5A3RA 4LF5B 3EPPA 2VDNB 3SFVA 2HJGA 1PLLA 3VX4A 1KO8A 1LPNA 1GUAA 2JZOA 2XNDD 1SBQA 2O57A 2Y1XA 3DAYA 3IBGA 1X70A 1HE2A 2CNWA 4NV3A 4XGNA 3L8YA 16PKA 2BLNA 1FDUA 3N7AA 1V43A 3VA7A 1QC5B 1KRWA 2O05A 4O1IA 4XD7D 4Y9SA 3MBOA 3ENKA 1T9ZA 1RTKA 5ALWA 5MN6A 1L5KA 4CMBA 2GEBA 4NATA 5C9ZA 2DBYA 3BK2A 4A2QA 1JIQA 2EZUA 4XEUA 3RSQA 1MNQA 2ZIGA 4G26A 4DLXA 3GLGB 3W1EA 1RABA 2XI4A 4UVHA 1SCUB 4DM4A 1IBSA 2JKVA 2WKQA 3O8OB 1VIMA 1U3VA 3VU0A 1G18A 4A0GA 1WW3A 4RE5A 3BMOB 2E4WA 3FWHA 4ZQBA 4P98A 5JWOA 4G23A 1WAMA 3WBKA 3JYPA 4TZKA 4W5RA 2H59A 4II2A 5LLDA 1OU0A 5TLSA 4L4ZA 2WUDA 2AFIA 3X1JA 4LQCA 2XLBA 5EA2A 1KHHA 1P0FA 1YDHA 1XRNA 4UMVA 1G20A 5CEFA 1VB5A 4OQLA 2XTMA 4JI8B 1QGZA 4G5OA 1GQSA 1OYVA 5FOWA 3TMAA 1TTTA 1J8MF 4PX9A 2GR9A 4PRLA 5B1DA 5JQGB 1WMDA 3AR2A 2ZDHA 4LOAA 4ZZ3A 3RAJA 2V0NA 5I51A 2BMDA 4NSNA 3ZHQA 1GRNA 4KFTA 3GROA 1L0BA 1OVMA 4LZOA 5JCZA 3VYWA 3IJPA 3K2QA 4XJVA 5A4FS 3QELB 4R69A 4RNDB 1QHNA 1Z68A 2ZKLA 1RYMA 1ULSA 3MS2A 5IKEA 3IFSA 2PT6A 3LCVB 4OD0A 5B6PA 4WECA 2O8CA 3RVLA 3TFOA 1P7YA 1R0CA 3O4VA 3OOHA 4FFMA 4EG6A 2CE7A 5DRTA 2HMYB 2R00C 1ADFA 3KL2A 3ROEA 3ROMA 2IVFA 3S1AA 3UGJA 2JI6A 5GIPE 4JI2B 2SKDA 1QWSA 1YNOA 4TV8A 3B1JA 2RGUA 5ALZA 4J3FA 4RLHA 2NU9B 4XCVA 1I7DA 1YUMA 1OSNA 3BTSA 3LKZA 4GR9A 4YBRA 4KWHA 1SXJE 1EWQA 1WCXA 4GMKA 4BO3A 1TE2A 1TAHA 3RNOA 3GXBA 2WM2A 2YW9A 3C3EA 3D1VA 1KFCB 2JFQA 3EPRA 4NI5A 3BSSA 5CFZA 2GEJA 1WVMA 1XTSA 3CRNA 3DXFA 4EG0A 1H2RS 5ALIA 1GDDA 1PWXA 2G7MC 4MGYR 1H5QA 1FTWA 2YWFA 4IQ4A 4BB0A 4S0XA 1GJRA 5CLIA 2Q2QA 3CH4B 2V7QA 3MCAA 1BTOA 4F1JA 1FQWA 4I46A 2TSYB 3OPVA 5TEWA 2EFDB 5HKBA 2Z4SA 4CKYA 4KSBA 2J41A 4IAOA 4LY3A 4IIJF 1A7JA 4MZXA 1G3IA 3T38A 1TMOA 3JRNA 1MX9A 3L8CA 5EPOA 3V3KA 2WHEA 5A02A 5K8UA 2MR6A 3DL2A 3PGLA 4NNOA 5I4KA 3LXRA 2ILTA 2JGNA 4AJNA 1I30A 1TAQA 3F1LA 4FKZA 1R66A 2HW8A 1NBWB 1YQXA 1NJFA 3BUSA 4R41A 2BHLA 1HLPA 1VJRA 5KWJA 3AUJB 1OLSA 4JOSA 1CY0A 5JCJD 1YJ8A 3OTQA 2ACEA 2CK3D 1RZVA 1RW4A 5CA0A 1C0KA 2JJ8A 4TV9B 3E8XA 5K8LA 1Q0QA 3PVZA 2WD7A 3FROA 1ISHA 3QOFA 5TMDA 3NMUF 3UWMA 1YQDA 2FZKA 4M3NA 4YAEA 4IMRA 3RE1A 3B12A 3KETA 4WKCA 1X7WB 2C3PA 4CMGA 4EWLA 3ZQUA 3N0VA 1W2GA 3MGGA 2L42A 1G4UR 1RXEA 3AJDA 3DM9B 3GJRA 2PNFA 1OXXK 2MJLA 1KDYA 1M7BA 4HB0A 2JVKA 3GPDG 4MAFA 1E9BA 3CVVA 3MCUA 4ND2A 3LQRA 4WZZA 3ZLUA 4FN4A 1U1EA 1WXXA 4B0PA 4K8OA 3IMEA 4J9UE 2IKSA 4Q16A 3F4LA 4QDJA 2GD6A 3O3NB 4HQKA 4TMZA 4V2IA 2V6IA 4EUKA 4Q4AB 4NF2A 5CDGA 5KTYA 2FN3A 2ZUSA 2GARA 3LUHA 5CPBA 1FFXB 3AIIA 1FTNA 1WTAA 1FVHA 1TX4B 2JI4A 1T4BA 1ZGJA 4U2GA 1MPTA 2Q9AA 3U4QB 2M6RA 3JRXA 2OKGA 3UH1A 1CC1S 1G64A 1ZM3A 2R1TA 4IGAA 3Q6MA 1EWVA 3K9FC 1PVOA 1C7ZA 4O33A 1U02A 4MW5A 4D79A 1SVOA 2EG5A 4IDPA 4OKSA 5DTQA 1BA2A 4AF6A 1JHRA 3DO6A 1ACLA 3SSMA 1FVOA 2FN7A 2PA0A 1J8VA 3G8YA 4LRTB 4GYJA 2HA5A 3F46A 1OBHA 1OAOC 4EG4A 2RHOA 1HQDA 4Q66C 2XE6A 3F3SA 2QF7A 4JYBA 1RVDA 4F4CA 2IXDA 1AF7A 1QHHA 2O2YA 3BN3A 3HEBA 3NT5A 4IEIA 4EI7A 3ADKA 1OX6A 2QG4A 4IUYA 3ETDA 2VOEA 1WHTB 1SBIA 1C1XB 1X1SA 2YW2A 3D8UA 3PQ3A 1JSRA 4M1TA 4PZYA 1PGJA 5EC8A 5LC1A 3WSVA 1ECLA 2QSUA 2YJ3A 1KARA 5G02A 2JIRA 5JNUA 4LZJA 5JQWA 4MWEA 1BDHA 1XRSB 3W1VA 2P0YA 1CD5A 3KQUA 3HR7A 3D5EA 2QD4A 3F67A 3W90A 2WINI 4EI8A 4AZTA 2WTAA 4J90A 4OHFA 1UAAA 2G07A 2FWIA 3D8RA 3PXUA 2X5OA 1XA4A 2OC4A 1LTHR 2QZZA 1I3KA 1PK7A 3BWCA 3E7WA 2FDCA 3SHVA 4G85A 1D2MA 1OWPA 4WIAA 5EE1A 3FPHA 3FR7A 3SM9A 1G5RA 4DSAA 3DDNA 4ARZA 1XKQA 4P7BA 3I83A 2FDXA 2AG6A 1E66A 3H84A 3FFWA 3GFTA 4G5FA 2G04A 4CMCA 2DUWA 5JOQA 3FYCA 1PEYA 3VR2D 2EJTA 4J0IA 3BCRA 3NZEA 1SUBA 3EQ6A 5FHRA 3MJEA 4MUHA 5JC1A 4G3XA 2DTXA 1IQ0A 4FCTA 2XZLA 3FMGA 4BE7B 1Y9EA 4GS5A 3DMRA 1KNXA 5EPUA 3N2LA 3HUDA 3CWZA 3LQ1A 3PF9A 1P1RA 1R6UA 2PFKA 2WWTA 3W5JA 3LGAA 1JFTA 1N6LA 5LPNA 3TKLA 1P1KA 3DBLB 2A57A 2ORWA 3KS9A 2QGZA 4IM7A 4UUPA 2R1ZA 4K6HA 3GLHA 2BN4A 2NW6A 3C3CA 3R3VA 5A6VA 3B1VA 5F33A 2QSYA 4S05A 4O5OA 3PUJA 2I3AA 3O73A 3QKIA 4IG4A 4JK3A 4KR0A 2DB3A 4PXAA 3BM5A 1FFWA 5H59A 3S28A 4CT0A 1NUPA 2Y0BA 1MUUA 4IRMA 2ANBA 2LDXA 4HDCA 4DREA 4EGAA 2A88A 4PX3A 1ZITA 4E32A 4DA0A 5EGSA 1CZKA 3DE7X 4ZDWA 2CJPA 1CY7A 1LI5A 2HJHA 3QFFA 4RS4A 3NXKA 4FN5A 5ALJA 5DX8A 2AJCA 3LI2A 3ICPA 1CQJB 5E0KB 1O94C 1SQ5A 5EQJB 1KZ4A 3QXGA 2VN8A 5KDLA 1UBUS 4NXNB 2R5WA 1BFUA 2QT0A 3IQXA 4IDQA 1D2AA 3NAZA 3N3BC 4HQ0A 4ZIRA 3HHPA 3UH0A 3KYDB 3AW8A 2NYAA 4TS9A 4YCCA 2IYOA 1PR6A 1I1QB 1TQHA 2Q4BA 4JJZA 3VVMA 2EFYA 3BJEA 4V38A 3MTBA 5KTKA 1HFJA 1TUGA 2PH3A 4NCNA 1HTTA 3O8QB 3IP7A 5FF9A 4HWPA 4B3MB 1H69A 4DIDA 4FX5A 2J5KA 4UDXX 4N0DA 1KFJB 1VLVA 2X1LA 1AZWA 3NOOA 2QA5A 3OPMA 3FB1A 2Z5FA 4OMUA 3JVIA 5TF0A 4DQLA 2AKAB 2XRMA 2PVCA 1U3TA 3FMFA 4B3TB 1QIDA 4YRDA 3RROA 3DT8A 2V45A 3EIXA 1ZM7A 3WK5A 4BHTA 1IQRA 3TIXB 4P5DA 1CX9B 3JRWA 3QEBZ 2YUTA 1J49A 2R751 3K1ZA 4J0GA 1TM3E 3BSFA 1F20A 4P4NA 5EWMA 3TPCA 3GA5A 1B74A 3ZTYA 1NT2A 2YVAA 5DN9A 3BCUA 2BGNA 3U0VA 1O0BA 4CF5A 2XEXA 3QEKA 1UMDA 2B1GA 2PUHA 1JDSA 3LYAA 1ZCZA 3PFIA 4UUBA 5GWXA 1BGXT 1OX4A 1V1RA 1XDSA 2JGAA 2FXIA 1Z17A 4A6PA 1GZHB 3DWGA 3I9OA 2MSLA 1P2UA 5HIIA 4JXZA 1ZGGA 4WLUA 3VO9A 4CIVA 3UT0A 1N33B 3F7NA 4HNGA 3AP3A 2NNWB 4BFSA 1M1YB 3V8EA 3OA0A 4U5QA 1HLGA 1BDIA 3BXPA 1W5AA 3L79A 4KXWA 3RVQA 4ITUA 3DLHA 4QBGB 3H1GA 4UFOA 2J87A 2AOUA 1P1HA 4UUAA 3EPJA 1DRKA 4LSGA 5KYYA 1ISJA 2QN3A 3EIQA 2FWAA 3BK7A 5KZMB 1I3LA 2HU7A 2PLRA 2WFMA 4BC1A 3GIWA 4M60A 3H9EO 5GOTA 2JAPA 3W8NA 1V16A 2G9VA 1ZMXA 3BHJA 3P32A 1NURA 4CKZA 1E8MA 3DWFA 1US8A 3E35A 1Z06A 2OCKA 4INAA 4EENA 1NKSA 3RU9A 4MR8B 5JNLA 4L2IB 4DNPA 1AGXA 4KACA 1U90A 4ZGGA 5KPJA 2XD4A 5I8ZA 2VNHA 4UFNA 1KZ9A 4GZ5A 5B30A 2N46A 1QG6A 3WGYA 1ESNA 4IV5A 5IG2A 4OI4A 3O3OB 2WTXA 3SYRA 5LJIA 2CFCA 1WUKS 4GKAA 5C37A 4I55F 2YFYA 5EMMA 3R7NA 3WOVA 3AKCA 2PZFA 3MS7A 2NQ8A 4NHEA 5K0NA 3TQIA 1CVLA 1NC3A 2CXXA 1IBMB 3DEZA 1JPJA 4M9UA 4QARA 3AY3A 2VQDA 4HZUB 1S8AA 4I50A 3EQ8A 3W6NA 3U19A 1QQAA 1YHYA 1C9DB 1FFHA 1D6JA 1XCJA 1H6AA 3HDHA 1V4VA 4G1FA 4KH0A 4PS0A 3ZHVA 1K08A 2E4XA 1MLDA 5K2MA 4ZJZA 5C4MA 2XYRA 4K6CA 1Z15A 2C03A 1Q1AA 2FLVA 1N2ZA 5AYVA 4ZCQA 1ZEMA 3ZDAA 4RL6A 1EYZA 3SZMA 1CNEA 2RHHA 4BQEA 1BWQA 1X3LA 3GEDA 2C2WA 1XZAA 3THYA 5IVPA 3MBIA 1NUSA 1Q0HA 3P45A 2PFGA 5JNVA 1Y9ZA 5JROA 2NGRA 4IVNA 4IMPA 3BMQA 1XT6A 1HUQA 3BRCA 3F71A 2HPVA 3LVFO 4I1SA 3EBPA 3IJEB 4HATA 4BJHB 2IS4A 3PZBA 3T3OA 1VE5A 3LCRA 4RK0A 5HEKA 3MQ2A 4W63A 4WACA 4ASUA 5KHAA 3FOBA 3FOAA 3DEIA 4XJTA 1W30A 2BI7A 2GK7A 3ABRB 1XO1A 1TKBA 4DPLA 3KVRA 1KHTA 4MI1A 5GM2A 2OM2A 1P4AA 4UAUA 2XNKA 1EE1A 4KRGA 1TF5A 2VSXA 3G6KA 1B0ZA 1VKJA 4ZTBA 3K0SA 3MMXA 3VNAA 2DPHA 3KKLA 3VO8A 1LI7A 1DDIA 2GAAA 3CT4A 3PQ8A 2R68A 1ILWA 3ZYZA 1C80A 4BP8A 4KXFB 3KSUA 1H8HD 2HF7A 4KWIA 1W46A 2AFHE 2QTGA 4O4LA 1JN0A 4YALA 1PNQA 1DJQA 13PKA 3PR3A 1EVJA 1K27A 2VKQA 5I9IA 2UXBB 4UPEA 2HPZA 3U56A 4KQ2A 1RZRD 2P78A 4TTPA 1D4ZA 2QUJA 3WX0A 4G0PA 1O08A 3NW9A 2PJDA 5FPKA 5IC4A 1NN3A 1ZIDA 4CM1A 3BH0A 1H94A 4QJ4A 3RGGA 4YXWA 4NAUA 4DUGA 3BB1A 1EP3B 3AF6A 3SE0A 3IVAA 4RXMA 4DMGA 3TRJA 4Q4JA 1JHUA 1SXJB 4ROSA 5EWJB 3CZAA 4Z4HA 5SZJA 1HE4A 1L5GB 3HJCA 2WWYA 2ONYA 4OX9Y 1R74A 9LDTA 2BKUA 3DFFA 1ZOSA 2W22A 3S2FA 2O8BA 1GPUA 1NW8A 4BNJA 4C3UA 4Z4IA 1LZKA 1JEDA 1XSEA 4Z0NA 5T4EA 5EJEA 2JD2A 3DL0A 3NJ8A 1RE0A 4N5NA 1ETHA 1KDTA 4JGBA 4X9XA 4ZTUB 2MSEB 1HFWA 1W1IA 2VPPA 2J0UB 3V7UA 2IZOA 3GRYA 1L7DA 1M2WA 1MG0A 1HKHA 1AZLA 2TRSB 3EFOB 1KS9A 3FUCA 3I8SA 3MXOA 3TR6A 5K05A 4D3DA 2EZ4A 1B41A 1J0BA 2O3UA 1JBKA 1RLTA 4LBVA 4PBRA 4UW9A 3OZIA 3KKZA 1Y1TA 2X9NA 3ICEA 1DMSA 4ZVVA 3HZHA 3GVXA 3C3YA 3I30X 3U5TA 3PTLA 4OJMX 5AR1A 5K03A 2PH1A 2QU7A 4GLLA 3RC9A 4ERXA 3L7AA 4WZBA 5LB2A 4YIHA 1X8JA 3OM0A 2Q27A 2IX3A 1CZLA 3CLUC 4C4XA 5B3LA 4BV3A 1SXQA 3CZ9A 1ENOA 4KLRA 1C1DB 3B60A 1YR1A 2IXEA 1UWCA 4K88A 1KBZA 2VPYA 3KUUA 2YIMA 3M4XA 4DR2B 2YMMA 2YXEA 3BXXA 1N9GB 3LPDA 2AOVA 5D87A 2F67A 5DYWA 1K0UA 2IY9A 3ND5A 1R16A 2PN1A 3TM4A 3X1MA 1NFFA 1UKEA 3O9VA 1UEIA 4AC9A 1L5QA 3PUYA 4AKSA 2PUEA 1NIJA 4X7MA 3EUAA 4FOTA 3PC8C 3ZDFA 1L5FA 4K6KA 5IN5A 3H16A 1QO0D 3RKRA 1ZJZA 3OZUA 1T2EA 1RYZA 3C5EA 3R2JA 1ZN7A 1X7ZA 3AQIA 3KD3A 4PINA 3RIGA 1W73A 2CWWA 1Z6XA 2G09A 4GLJA 4D74A 3ZEIA 5DKFA 5CLLA 3A6ZA 3OD1A 2N1BA 5CM9C 1EU1A 1P4GA 1E9DA 5DBIA 1RJWA 5CFOA 3FA2A 2QQFA 4BKMA 2X8BA 3SAJA 3EIHA 4J6EA 1MB0A 5CJPA 5ILQA 1T0IA 5IJ9A 3WLRA 1EFKA 4O4IA 4BB9A 3KU4A 1DQPA 3VKWA 5J3JA 4L0CA 1O9HA 5HBRA 5TGDA 4JOQA 3WRYA 3L0DA 1PWYE 2FUG1 4WOPA 2QUZA 1CZUA 2FZVA 1BFKA 2VNJA 3N9IA 5K8IA 4DR6B 4L8YA 2AUNA 5FORA 1QDLB 5IM4F 2J3KA 3MRSA 1P44A 3R7LA 3EXAA 3G8CA 2PX2A 4JYZA 3IQGX 1AKUA 4KR3A 4BQFA 3K16A 5CXXA 2Y1LA 3N07A 1Z25A 1YQGA 4XW2A 3U6KA 2E3JA 4IDFA 5CVJA 4R2LA 3O75A 1GYPA 1JVBA 2GJ9A 3L1KA 2PS9A 1M2JA 3QUBA 4MMYB 1ATIA 3GEPA 3ONDA 4PG6A 3LY7A 2B4TO 1JWBB 2WMNB 4YYZA 3N1UA 1O96A 2Z2KA 1G2IA 5DASA 1DIAA 1BXRA 4MYRA 4ND4A 4RNCA 2WUWE 2OD2A 1X3SA 2Y9PB 3R6WA 3WIBA 1M2VA 1NF2A 2JFWA 2X5NA 2X6QA 2VP3A 1YKSA 4FZ3A 4BNDB 1ODSA 1Z8DA 2CVQA 2SCUA 3BMXA 3G0DA 3K8ZA 1U7HA 4CM7A 3S27A 3B7WA 3G17A 4XYMA 5AIBA 3PNQA 3QE2A 5K99A 2BZSA 4MRNA 4V0RA 3M4ZA 1CQIA 2W6PA 3LZ6A 1JB9A 3JQDA 1IJKA 1XD9A 3JD1A 1GDTA 2WQ7A 1V47A 4YRLA 3E03A 5ESWA 5JXJA 3MG9A 1JWAB 4CL8A 2RGNC 2HMAA 4B73A 1KETA 1JEEA 2QMEA 3ZH2A 2DCMA 3GC6A 3Q40A 5FUQA 5LXTB 1Z75A 3GH3A 2QYHA 5JYDA 2F4NA 2QAGC 1DEXA 2J3MA 1DJNA 1NNUA 1I80A 3R0XA 4LKOA 2ONZA 5FADA 3UYLA 3FNQA 4GDFA 4EGJA 4PZPA 4TT3D 2O0HA 4OH7A 4UFPA 4IJ5A 4OKNA 4L57A 1G8FA 3ZWCA 4HUTA 4BASA 4LW8A 1PE0A 3NOXA 3BF7A 1W4LA 2MMGA 5AOBA 2W6MA 3EGDA 1VXOA 1XF1A 5HZKA 1RHJA 5U4QA 1YOBA 2BHRA 4D4HA 2QENA 1X9GA 4WOJA 4EMBA 2XNSA 1BWSA 2Y1CA 2O19A 3FN4A 5G1NA 1T4MA 1QIJA 1TMGE 2ZVJA 3KNZA 4F6LA 3AESB 2XZOA 4XI9A 2YZKA 4WN3A 1XZNA 4XD2A 1NXTA 1W96A 4NCHA 1X7DA 1V35A 3KT6A 1YK0A 1JI3A 3CQ9A 2ZI5A 1KDPA 1K3TA 4L4UA 4LPKA 4D4MA 1E4OA 1ZDMA 3W5UA 1P8AA 4HT3B 4RQUA 2CJWA 1YB4A 1UPUA 1Z5VA 2FW6A 3M6LA 5JATA 2ACVA 3M0EA 4HGZA 4Y1GA 4D57A 1J2EA 2ATXA 2C2XA 4K6OA 2NV0A 4PY2A 3SZLA 3UWPA 1E2LA 1JKMA 2M2IA 1Z9BA 2QX8A 5C1BA 2V5UA 4MVJA 4D96A 1QF9A 3LHDA 1KPGA 1KI6A 3F6SA 5EXXA 3FH0A 9ATCA 4JC8A 2V58A 2VHTA 4UEWA 2E5LB 2Z8ZA 4LJ8A 3KQYA 3RTDA 4DNOA 5HUHA 4DADA 3STWA 2VQ6A 1ZS9A 3A25A 3FPCA 5LMUB 2RHBA 1NJ5A 2EBUA 3NNDA 1SVWA 1HG0A 2DTDA 1VPTA 2JFBA 2HUPA 3L04A 3QSYA 1GKIA 1CU1A 2GN8A 1O4WA 2PUFA 1PEDA 4G1BA 2HNBA 1EUZA 1D4OA 4OLJA 3TQRA 5DXJA 2F8SA 1F17A 5L7YA 1AKNA 4KSCA 5C1IA 1Q91A 3IOBA 3A2LA 4AN1A 2F62A 2DWCA 2P6MA 3QU4A 4RGQA 2BW0A 3LWDA 3TI9A 4E94A 5B58C 3S99A 2ZZMA 1N3BA 1I3MA 2D1YA 4LHZA 3Q8MA 3DAOA 2FPSA 1AG9A 3SC4A 3ZBQA 3NDRA 3SYKA 3T1OA 5GONB 1S2MA 1JEOA 2Q9UA 3B9RA 1DP4A 4ND5A 5FLKA 2O50A 2VF8A 3SDSA 5F9FA 4CU5A 4EUEA 1IHUA 2CNLA 4EYKA 2EF0A 4NYJR 4O2BA 3WB1A 1Y82A 1XLVA 1DC7A 1LSJA 5DLYA 3R5JA 1FRQA 4K9MA 1MW9X 4D41A 4E1VA 2QX4A 4D0SA 5A4DA 2DFVA 2XBMA 4UAJA 2ZJZA 3H5RA 3F97A 2QOEA 1YA8A 1M8FA 1ODTC 2ANCA 1E6WA 1XHLA 3B7PA 1AKRA 4MB0A 4EL5A 5I9LA 3WWPA 2P6RA 2F3RA 4IJUA 4F3KA 2FUEA 5EHNA 4Q01A 4Q3AA 3UMJA 2BTOA 1IHYA 4LV6A 3P0RA 1VCMA 4U5XA 4TV8F 3V6MA 5A5VA 5A2GA 3TLGA 1DAIA 2GS9A 3MTJA 1OXBB 3PUWA 2EJWA 3GZ4A 1SUFA 2FEKA 2CUNA 2GBGA 1N5LA 1XTIA 1T3GA 2KJQA 3IVGA 3LRXA 4RULA 1N7IA 2P0EA 2GFHA 3F96A 2H11A 5AOVA 2LE0A 3A4TA 2QAJA 1BE8A 4R68A 3AEZA 5JSQA 5U9CA 3GJTA 5IHXA 1B4DA 1XEXA 3T3PB 3U0BA 2IYRA 5LNK1 2O1SA 2AJLI 5COQA 4EB0A 1FFYA 1DCMA 4XDGA 2JAQA 1T4GA 1PQPA 2JEZA 2BM9A 2OQIA 3CEHA 4YRAA 2R86A 3V32A 4QNMA 2JFGA 2Y0EA 3DR5A 2A33A 1EQAA 4BN0A 2XSZD 4H60A 4H6WA 3HKCB 3OKPA 5TQJA 1GV0A 1K6MA 2ZIXB 5F21A 4ADSG 4BAZA 3QFHA 3GFFA 4RVFA 1ZBDA 5U1PA 3UHJA 1NN1A 3PGKA 4F6RA 1KTVA 2JZCA 3EH1A 4KK3A 4MV8A 2XHEA 2UVPB 5C52B 3N28A 2ID4A 1HQCA 4L4YA 2IZ7A 2VCEA 3FVQA 4DZRA 3KTDA 2QVLA 1OXUA 1T5IA 3H2JA 3N3AC 5HP4A 4REOA 1KE2A 3R9XA 2C7BA 1VJCA 4UARA 1GT6A 4Z0TA 5IEBA 1U9ZA 1U3UA 2XE7A 5CA0F 2GKOA 5AUPB 3BICA 3OCZA 1JEJA 2CLHB 3D02A 1B15A 2WT8A 1DQNA 1PYOA 3OOEA 1Y81A 4QZVA 5DVZA 4CKWA 3EGXB 3LOUA 1NSTA 1CWUA 1MBZA 2WR8A 3UHFA 1DCFA 5ALPA 3O1LA 4NECA 5KNDD 4FYHA 5LOVB 1Q19A 3K30A 4PQEA 2PMKA 3M6VA 1LVGA 2JCXA 4RZSA 3UIEA 2VYFA 5K6RA 4KXUA 4TLCA 1VMDA 4G2NA 5J2TB 4EX6A 3WJAA 3I6QA 1XP5A 4R8SA 2YVLA 1U0BB 4Z7OB 1T1GA 2N0SA 5G4KA 3HWSA 3RNLA 3EMDA 3IEXA 3OP4A 2OHVA 2MSKA 3ABQB 1GU7A 4LYHA 4NPAA 3VH1A 3SZRA 1D1QA 2JD1A 3EIEA 1M1ZA 4LNUB 3SS8A 4XUCA 2V7WA 2CZCA 3M6IA 1JT9A 5KJ1A 2AG8A 2QXTA 3MBKA 4RKQA 4WK4B 4W1RA 5K4AA 5DCUA 4E6PA 2YH2A 3GPLA 3PJFA 2O0LA 2RHDA 2GBLC 1ZH2A 3A2MA 4UBIA 2ZIEA 4CI9A 3K1JA 3N7UA 3USCS 3D8SA 5ALUA 1QLHA 4CZ2A 3IQWA 5BN1A 1N6PA 4KYIB 1RAHA 1YS2X 2I4OA 2OV3A 4CRWB 2G4CA 1N36B 4B6EA 1ZVQA 1B6SA 3SC2B 4OQYA 1NOKA 2IW3A 3K09A 4DKJA 1Q3HA 2ZIZA 3DBRB 3RRBA 2NUPA 4KEAA 1PEAA 4OFWA 1L5HB 4AMBA 2YWXA 3MC1A 3NJRA 4S1TA 4YRQA 1A96A 5FI0B 3WYBA 1B8UA 1YZGA 2GTPA 1BE0A 4R3UC 4QYMA 2IS1A 1I14A 1JKJB 3OQHA 2P27A 3EEQA 1VTKA 3A32A 5F1OA 3Q12A 3ET4A 4AM8A 2RHTA 3W06A 4MVJM 3HJUA 1VBNA 3FDIA 3JQFA 3H3FA 3SBDA 1UDXA 3KXPA 2H2FA 3E5MA 2VP9A 4M46A 5TPWA 4Z54A 4EYOA 3B53X 3AZOA 1EVLA 1J90A 2Y27A 1EB9A 3DOJA 4Q3OA 1IPHA 3VR6H 4IDOA 4NDNE 5DK6A 1L9XA 2A92A 2A2ZA 3CZQA 3KYCB 1GYQA 2X22A 1BU8A 5CNIA 1KSHA 1ZM2A 3QVWA 1CR1A 3DBOB 4QBKA 4YCJA 1DC6A 4JV5B 3CGWA 5IAOA 1EVZA 1N2CA 3I76A 1I0LA 2ECKA 3L1HA 1DMRA 3LP8A 3CUEF 4D43A 3H2SA 5T6MA 1KMHB 1JTFA 1HF3A 3WMEA 4UCXA 2PV7A 1SPXA 1I94B 4LDNA 1UT8A 3A6KA 4RVUA 3WB9A 1A5ZA 1OWMA 2ZBEA 4ZCMA 1G7RA 4CIWA 3OM9A 1PJ8A 1V6SA 3EVAA 3V8BA 1NG9A 3B5IA 1GTJ1 3EQ7A 1MX1A 2WHQA 2BGUA 2BY4A 2VQSA 5FI1B 1XVAA 3EIUA 2QMHA 1ZNYA 4B6SA 5L40A 1BQ4A 3L1UA 3GCWA 3OQ6A 2VL7A 4KAAA 4OA8A 1G9XA 1H1LA 3JQAD 2CBXA 1FQJA 5TIIA 3HXMA 2YJTD 2G40A 3G9XA 2A0FA 4BQNA 1UPCA 1ML3A 2QTVA 1JXQA 2VS1A 1RZUA 5KYTA 3FZQA 4QUEA 1RJ9B 1NP6A 3LBYA 4OJNA 3R4CA 4XTRA 1MDFA 5H3LA 2NU8A 1XAHA 1ZCBA 5CD9A 1BJRE 1UC5B 3JARA 2COEA 2OQVA 4Y1FA 2I03A 3AUAA 1IN7A 1JJVA 3C15C 2IUYA 4BO4A 3F98A 5HCUA 2ZANA 1DKRA 3W5IA 3FPKA 2R5FA 4PHCA 1JH8A 4CWAA 4M0CA 3I34X 2CNKA 3LY5A 3PGJA 1ENYA 3KJGA 3AF4A 3CPHA 4F8YA 2PSSA 3HI6A 4BVFA 4BMPB 1C30A 3PEYA 5JSYA 4MQ4A 1GCAA 4AMYA 3QVUA 5DP2A 4PN3A 1L1EA 3THOA 4HP8A 2JEYA 1DHTA 3UXYA 1BYIA 1M8GA 2FHPA