4IIUA

Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with nadp+ at 2.1 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
243
structure length
243
Chain Sequence
MSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from Escherichia coli strain CFT073 complexed with NADP+ at 2.1 A resolution
rcsb
source organism Escherichia coli
total genus 92
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4iiuA00
5HS4A 3MJEA 4MP8A 2FR8A 3PTZA 1N5DA 1R0KA 1BMDA 5A05A 3OECA 1PEDA 3IKTA 3H2ZA 3TPCA 3T4EA 4EW6A 1X15A 3TZCA 1A7AA 2IEBA 4A03A 4DPMA 3H9UA 1BSVA 1IHXA 2BHLA 1RM4A 4OXKA 2EWMA 2AQIA 1FMCA 4PG6A 1HDOA 5I7VA 1NFRA 2ZATA 2D5CA 1WVGA 2X9NA 4B4OA 2GSDA 2QHXA 3GDFA 3ONEA 5IAAA 3GEGA 4OGWA 1IZ0A 4TQGA 3DTTA 2BFPA 5TT1A 4EBFA 3RUHA 3OQ1A 3C8MA 2O3RA 5EIOA 2ZK7A 3K2EA 1Y6JA 2CDAA 3SXPA 1VM6A 2HK8A 1WP4A 3KLMX 5T8KA 4IXTA 3GFGA 4NJMA 4BV8A 3RIHA 5IN5A 4MKXA 4J6FA 2FN7A 4XRRA 4XCVA 4Q3EA 4IDFA 2CDCA 4M89A 2HRBA 2PTGA 4MIYA 1BRMA 3E8XA 5GMOA 1YKFA 2Y0CA 1ZXBA 3GHYA 4GKVA 4U7WA 3PHHA 5A02A 3DAGA 2NU8A 1YB5A 3ORFA 1DDOA 4OSOA 4GX0A 5DDIP 1U5CA 1M6WA 1EQUA 1M67A 2B4TO 1BGVA 4NBWA 3GPIA 4ZICA 4NFSA 3EZYA 1NX6A 4MDHA 1JKIA 4GWGA 4XIYA 3WBBA 4BNWA 5I8WA 3ZHZA 4BO7A 1J4AA 4AJIA 1I3KA 5L95A 1E5QA 5DULA 3ZWBA 4KP7A 2Z1MA 3QP9A 4CQLB 1SMKA 4I1IA 2GLXA 1QLJA 2P2SA 2P9GA 4FN4A 1HDRA 5KJ1A 3UCFA 1QXSA 4WUVA 1P9LA 2O3TA 4M54A 1OC2A 3QVTA 3RUFA 4YR9A 1DPGA 1G0OA 1E7YA 4OYRA 1U3TA 2J3KA 1E7WA 3I9JA 3QQPA 3PHJA 5BNTA 2QW8A 4HUJA 2EHDA 1ZSNA 1LA2A 1V35A 3G3EA 3VKVA 4CM7A 4HY3A 4DVJA 3KYCB 2IEDA 2QYSA 3IUPA 5BQFA 1E7SA 1NQOA 3GZNB 4JLWA 1Q2XA 4CR6A 3GG9A 2O2SA 2NVUA 4P4LA 1A9ZA 2O3JA 3UHAA 2FR0A 4WASA 1GYRA 4GLOA 3PWKA 3CEAA 4CODB 5HBRA 1SOVA 5IN4A 1PQUA 4KTTE 4JP2A 4UUOA 3JYNA 5JMPA 2GASA 5EQFA 3F3SA 3AI1A 4RZHA 4LSWA 5LDHA 5F1OA 2HU2A 2ET6A 4KQXA 1PZHA 3N74A 1J49A 2RCYA 4EJ0A 1ZXLA 3SJUA 5CG1A 5F3RA 4I5EA 2DFDA 4RVSA 3O8QB 2V6MA 5JMWA 5C5IA 1ZKMA 3AOEC 5JC1A 3OIGA 3ZNPA 2DU8A 4DXHA 1MB4A 1NTOA 3BMCB 4Q3NA 1Y1PA 1EVJA 4RPKA 3NT2A 1YDWA 4L4XA 3AOGA 4M1QA 4AJ1A 2C5AA 1ID1A 5CG2A 2H6EA 1N9GB 3U4CA 5A9SA 1JVSA 1K6XA 2P68A 3JQGA 3WMWA 1UJMA 2X23A 3NDIA 4J4BA 4W99A 3IJPA 1N92A 4GX5A 1DIHA 4Y9DA 5IG2A 5IDQA 2WMDA 2D1YA 3QVXA 3OEYA 4D43A 3LSYA 4YAGA 1GAEO 5JAQA 3L4SO 1P1FA 3Q1LA 4W4TA 3F4BA 4RF2A 3VPXA 3ONFA 1AN9A 3EDMA 3O4RA 2FMUA 2JD0A 1E5LA 1FDVA 1WPQA 3ANMA 3I9KA 4MIOA 4Y6SA 4U8GA 3MWEB 1VL0A 3OJEA 4TWRA 4FQ8A 1DAPA 1NYTA 1D1SA 3ZU3A 3GDOA 2ZQYA 3WTBA 3VZRA 4UUNA 1P1IA 2R00C 1XKQA 4YRBA 3Q2IA 4D3FA 4CV0A 4UAGA 1I36A 2ZQZA 4YT4A 2VWGA 4XYGA 1H0KA 3GK3A 4GSLA 2DAPA 4D0RA 2ZYDA 4EI2A 3I5MA 5H82A 1FXSA 2I3GA 2ZB4A 1GQ2A 1CWUA 1NHGA 1I3MA 1QMGA 3GMSA 1F06A 3IP3A 3CH6A 2VHWA 5JCJD 4B3JA 3ZWMA 5GZ3A 1XGKA 3GDGA 3OICA 4FPXA 3NDJA 4BNGA 2RAFA 4DPKA 1PGQA 2JCYA 3HWRA 2CZCA 1N1GA 3GAZA 3T7CA 3EZLA 4PFJA 2AE2A 1ZJYA 4C7KA 5B12A 3WGYA 1Y8RB 3RKUA 2YDXA 3WJ7A 1Z7EA 1XA0A 1H5QA 1GQYA 3B1KA 2OMEA 1DC3A 3U09A 2Y0EA 3IJRA 2JKVA 3HB5X 2NACA 1V3UA 4J4HA 4BNKA 5JYEA 1YONA 3DC2A 1DFIA 1LSUA 3ZU2A 4XGIA 1E3SA 3ENKA 4DC1A 1PGNA 5DP2A 3GC6A 1IUKA 2VRCD 3DAPA 4GPD1 4YAIA 3FD8A 1R0SA 3DBLA 5DOZA 1UXGA 2OP0A 4QX6A 3DBVO 5JC8A 3QY9A 3DBHA 1DIAA 1YGYA 3CSDA 3DWFA 3LU1A 2YHUA 2B37A 3H7AA 3PYXA 3P19A 4YQZA 3ZDFA 4W82A 1QV7A 2QIOA 1F12A 1WAMA 2Q2VA 5C7LO 3HB4X 3E18A 3WWZA 2WD7A 4FCCA 4MVJF 3DZIA 2AE1A 2B35A 3ST7A 3CZRA 1RPNA 4MJLA 4E6PA 3HG7A 3PVZA 1NP3A 4LCEA 2SCUA 1BDBA 1P74A 3FSRA 5FFFA 3X2EA 1DIBA 1ISJA 5LDGA 3FTNA 2AHRA 2GN8A 1QORA 2J5KA 4ZQFA 3MOIA 2D5AA 1HZZA 3WWYA 3E9NA 1LLCA 4L74A 3ZWAA 2D2IA 3LLSA 1QG6A 1E77A 2DC1A 3F5QA 2E49A 3DMTA 3LF2A 1P3DA 3JQCA 3VVCA 1E6EA 4LGVA 3ZZNA 3EVTA 3FNEA 4KQWA 4Y98A 1ZK3A 4L75A 5F1KA 4CM9A 4HP8A 1DAOA 2JFHA 4ALLA 3MEQA 4ESOA 3CUKA 1NBOA 2E82A 4JQCA 3AK4A 1NQTA 1HKUA 4G5HA 1HLDA 3M1LA 1P77A 4A27A 2D4AA 4G2NA 3DHYA 4RVHA 4BO4A 1M75A 3M2TA 4YTEA 4Z0PA 1SEPA 3W6UA 5CAEA 5CDUA 1N7GA 2XF8A 4TZTA 2VUTA 2VUUA 4KWHA 2ILTA 4FR5A 3SC6A 2PKQO 2GN6A 1R66A 1DBVO 3DONA 3OETA 1JWBB 2D0IA 2DVMA 4CMBA 5IZ4A 3RUEA 3BMQA 4NG5A 3NTOA 3D7LA 2PNFA 3U9LA 5JSFA 3DL2A 3GFBA 3K92A 3ITKA 5EL0A 3UVEA 4J9VA 3LC2O 3I9OA 4M86A 4P4GA 4E2YA 1KEPA 3G1UA 5CEJA 1YB4A 1B14A 1DC5A 5ENDA 1B8UA 2ZB3A 3ZV5A 3VDRA 3SLKA 3PGJA 5CDYA 1UP4A 3FN4A 1EDOA 3E6AA 3QWAA 4FIZA 5A5EA 5U9CA 1ORRA 3FR7A 3HQ4O 4IIVA 1BVUA 3IP1A 1Y8QB 1K89A 2JD1A 2HMSA 4R1UA 3HE3A 3VHRA 4M55A 3WTCA 2QZZA 1BXZA 2B5VA 1I10A 4K28A 3DBRA 2Y67A 3WICA 4PVCA 4WLNA 1I01A 4BMNA 1ADCA 1W8DA 4FOOA 2WM3A 2HUNA 2DQ4A 4BVAA 5EESA 1UZMA 1ZH8A 3JCZA 4FC6A 4YEDA 2HSDA 3IOYA 4JBHA 3WXBA 2Q50A 3E82A 4CM3A 1W73A 3GNSA 4R1SA 3RI3A 2YJZA 4DYDA 2NNLD 2Y1EA 3U49A 3GT0A 3V1UA 1C0LA 1M76A 5L45A 1BXKA 3KTDA 5T5QA 1LU9A 5KVQA 1SZJG 4UREA 5L7TA 3DTYA 3NJ8A 1EK5A 1CYDA 3JQ7B 3RUAA 4YT8A 2AEJA 5DBIA 5HTOA 4JX8A 1NR1A 3UH1A 3ASUA 2Y99A 4ZA2A 1B8PA 2H5LA 1NNUA 1Y5RA 2P91A 3KUXA 2I9PA 4W6ZA 2BI7A 3LDHA 2JCXA 3PYMA 4DLLA 1U8FO 2J5RA 5IDYA 5B1YA 1YVEI 4AICA 1DO8A 3ZCXA 4DREA 1LSOA 1IB6A 4L4RA 3WFJA 4YYZA 3MWDB 2PZLA 2B4RO 1QP8A 4PRKA 3R6DA 1VJ0A 1ZNQO 1PS0A 1T4BA 2EKPA 2V6BA 1ULSA 1PQWA 1XDWA 1XU7A 2DBQA 3NRCA 4BMSA 2X5OA 1P1HA 3O38A 1O95A 1N8KA 2Q4EA 1XEAA 4MINA 2UAGA 1IOLA 1NPDA 1E1NA 3B20A 1EUZA 1ENYA 1CQIA 3ZNNA 1P0CA 5J23A 1R0LA 1LX6A 2YQ5A 4KMSA 3Q11A 4EDFA 2I76A 1Q0HA 4YCAA 5FI3A 3STHA 4J7UA 3GH3A 3KYCA 2A9FA 2JJYA 1C1XA 1HF3A 3I4FA 2CY0A 2BFMA 5A9TA 2CMDA 1QYXA 2OORA 3WGOA 4BNHA 9LDTA 2J3HA 4YVFA 1AE1A 5TC4A 4DIBA 1MA0A 1UAYA 5EN4A 1UDCA 4EUFA 1YRLA 3R3JA 4XJSA 5FWNA 4YJHB 2FY8A 3ZWWA 2CSUA 3L9XA 3R0IA 3UOGA 3HADA 1NWCA 2HO5A 3KB6A 4FBGA 5EERA 4CMEC 3WQRA 3PI7A 3AOEA 2ZYAA 1Z74A 1YBMA 3GMDA 3QRWA 1VSVA 4AL4A 1Q0LA 1CERA 2PZMA 3F1LA 4BNYA 4DQVA 3VZPA 4ZN6A 4RDIA 3OP4A 5ENVA 3TZ6A 4BNFA 4WCFC 2O50A 4M87A 3P2OA 5G2OA 2P4QA 4KUGA 3JYPA 1ISFA 5L4SA 1X13A 1VJTA 2GZ2A 2QRLA 2X5JO 3GRPA 1UUFA 2FPGA 3O8QA 4NNJA 3EW7A 3BMCA 4FFLA 1R16A 1DRUA 3WYCA 4R1NA 1C14A 2GDZA 2VWQA 4LK3A 5IDWA 1LLQA 3ZU4A 3RD5A 3SX2A 4IQGA 3F4LA 3SBOA 2W98A 4YT2A 2NM0A 3HZZA 4WNCA 5JAMA 5TF4A 4AJ4A 2FZWA 4YT5A 3TFOA 1EFLA 1NPTO 5KOIA 3QA9A 2BH9A 1OI7A 3FWZA 3A1NA 5A04A 1LSSA 4TRNA 4KUEA 3GEDA 3OQBA 5JXWA 4GX2A 3DZJA 4MP3A 5CHEA 4BOYA 4QQRA 3JQDA 4LSMA 4CMIA 3MJVA 2JHGA 1XELA 4J43A 3E5MA 3TZHA 4L8VA 1GYQA 2FPIA 2BKAA 4TKMA 4BQRA 2AG5A 5EINA 2HRZA 2P5UA 2WE7A 3K8ZA 3DFUA 1ADGA 4D44A 3IKVA 5DOVA 5JDCC 4NZ9A 2VUSA 1A27A 1K0UA 2YFHA 4OXNA 2DLDA 2H9IA 4MVJI 2AMFA 3DB2A 5BR7A 1KERA 3IIEA 1E7MA 3P2YA 4N5MA 4PG5A 4QSMA 2PGJA 2PY6A 1NHWA 1OZAA 4JJGA 1MP0A 4CV2A 1MFPA 2QG4A 1GADO 3K2BA 5L51A 3TOXA 2Q2QA 4W7IA 3W8EA 4C4OA 1HZJA 4CL3A 3VPGA 3Q9NA 4CM1A 5K9ZA 4I5GA 1X1TA 2PZJA 2TMDA 3O26A 3CXRA 4NBUA 3TNLA 2GN4A 3WLFA 4L0QA 3I83A 1ZUD1 3RFXA 4YBZA 4BS9A 5DF1A 4Z3KA 2VTDA 3UKOA 4BIIA 1KS9A 2O4UX 4L4SA 2VHXA 3QJ5A 4IMPA 4RL6A 4JROA 1UXHA 4BGUA 4N5NA 5C7IO 2DFVA 4XEHA 2X0JA 5ADHA 1Q0QA 4QO7A 4MKRA 1TVEA 1U2GA 2VYVA 4DLBA 1Y8RA 3JQFC 3GF4A 3IL2A 1BWSA 4IPTA 1H6DA 1WZIA 1R4NB 1GFSA 4IS3A 4KDFA 1KOLA 5KJ6A 3DOCA 4IQ8A 4AJPA 1GQQA 3PXXA 2VTEA 1WDMA 2JL1A 4GSKA 2JCVA 2C82A 3IS3A 1MLDA 1CDOA 3K9QO 4R1TA 3GEMA 4CQMD 2WDZA 3ZWOA 1UXIA 4BNIA 2DPHA 3WIDA 1HE4A 5G0VA 1H6CA 3PQDA 2HDHA 4R68A 1AHIA 1TI7A 3OIDA 1JTVA 4XR9A 5TJ9A 2VHZA 3NGLA 1GD1O 2Y05A 1P0FA 3QE3A 4R51A 3RU9A 5I9NA 1VKOA 2ZTMA 3DAFA 4QO8A 1ADBA 1JU9A 3BYZA 2Q49A 4BKPA 4BKQA 2R2GA 5AVOA 5HRUA 2X6TA 4NFYA 3OM9A 1H2BA 2QX7A 4GL4A 4I9NA 4CLRB 5FYDA 4CV1A 4FS3A 4H7PA 2YZ7A 2HK9A 2J3JA 3ZHYA 5JY6A 2PGDA 1PL7A 1HETA 3F6YA 5JW6A 3GVHA 3ASVA 3MCVA 3MJSA 4GI2A 5T57A 5K0ZA 3JYQA 1LEHA 1UXKA 1I8TA 4YAEA 4HKTA 4YJGB 5I7EA 2OBYA 2G0TA 5TS3A 3WYBA 3HN2A 2EIHA 3PPIA 3PZRA 1B0AA 3OHSX 1PZGA 1LDBA 4IDDA 4RVGA 3UICA 4PRLA 2CVZA 2BGKA 3ON5A 3ZWPA 1JA9A 4A5OA 3PDJA 3QWHA 2UDPA 4HNHA 1A5ZA 2I5PO 2W2LA 2PD6A 1SB8A 2Y1FA 4BO3A 2NWQA 2Y1GA 4URFA 4QUKA 4ZQBA 4DMMA 8LDHA 3A28A 3ZWNA 5BSGA 4WOKA 2I66A 2C0CA 1VLLA 4J2OA 1P44A 5GY7A 2NU6A 2CNBA 3GVCA 4TRRA 5F1PA 4BL5A 4BHTA 1B7GO 4E2ZA 1O94A 1X0XA 1HDGO 1LRKA 2G1UA 1Y8QA 4IJKA 4XIJA 1ISMA 3WYEA 3PK0A 1C0IA 4G65A 1RJWA 1I3NA 1G0NA 4J2HA 6ADHA 3P5SA 2UUPA 3PQFA 3FNHA 3GUCA 4Q3DA 2ZTLA 3SLGA 2CVQA 1LLDA 4OM8A 5ICMA 5KVSA 3ITDA 3U4HA 1HDXA 3GHHA 4JJFA 3SC4A 2Q1WA 1NVGA 2GF2A 2OOSA 1IY8A 2VYNA 4PG7A 1GYPA 1V6AA 2CVOA 4IQ0A 5F5LA 1D8AA 4TRMA 2HCTA 1B8VA 4CR7A 3EUWA 4DIOA 4NBRA 3BXXA 4R3WA 4IDEA 3DZHA 5C37A 2X58A 1KVUA 2GRAA 2LDBA 4U6QA 1P1KA 1XCBA 2O48X 4A73A 1Z82A 1CIVA 5KNLA 5IXYA 3KYDB 5DZSA 4AJ2A 2AA3A 1ZBQA 2R6JA 4FC7A 3LF1A 4WNIA 8ADHA 1JW9B 3ZNOA 4J0EA 4IJVA 1E3JA 3N58A 3D4PA 4EUEA 2XPCA 4UVEA 1ARZA 4QT0A 4J9UE 5BNIA 1MG5A 4CUJA 4RJTA 1ONNA 1HRDA 1PR3A 1VSUA 3LC1O 4RVFA 1JVBA 3PJDA 4E2XA 4A10A 5BT9A 5AQ1A 1E1MA 3JQAD 1MC5A 5T67A 1B2LA 1ULUA 2RBEA 4II2A 5C3MA 4Q3BA 3RBXA 5K6AC 1UXJA 3IUSA 3LVFO 3JQ9C 1GL3A 2A94A 4BKUA 4E5KA 2NTJA 3FBGA 2QZ9A 4O0LA 4ITUA 4JJIA 1TLTA 2OP1A 1Q7CA 1YH3A 2UYYA 3DO5A 4RVDA 4ZRMA 5G4KB 4IIUA 2VT3A 4HX5A 3PDUA 3LLVA 3MJ4A 1IHYA 5EMHA 4D79A 3H5AA 4F45A 1V0JA 4QECA 5TIIA 3W8DA 4NHEA 4BO6A 2XOXA 1DC6A 4I9HA 3P7MA 4CMEA 1YDEA 1DFHA 3S55A 5I9LA 2X9GA 3KBOA 2NVBA 2CDBA 1QRRA 3JD1A 3GOHA 4IGEA 3PJGA 2F1KA 3QVWA 2OL4A 4QFDA 1PGOA 4CM8B 4ND2A 4ID9A 4WCFA 3B70A 3AUSA 4YJHA 1PJ4A 4L73A 2ZYGA 5G0TA 4EUHA 4ZGWA 1DXYA 2X22A 2ZCUA 1R12A 2ZTVA 4OSPA 1ZO8A 2IYPA 1T2CA 3BTOA 3KSDO 2V6GA 3JQ8A 1SO8A 2HMUA 1J5PA 1PGJA 1B16A 4XX0A 1FDTA 2C2YA 4CLXA 1B3BA 3I4CA 3A14A 1QR6A 1OAAA 3AUAA 1I5RA 2YUTA 1NQ5A 3CINA 5B37A 1ISIA 1GZ6A 1MV8A 4Q9NA 5H81A 3RAJA 3NT5A 3OEWA 2IODA 2NLOA 2NTVA 5B4VA 2CUKA 4BQPA 4MOWA 1DC4A 3S8MA 4KZPA 1Y9EA 1L7DA 1Q7GA 5L9AA 4GLLA 1GUZA 1VKNA 2IE0A 2QRJA 2VQ3A 3C7DB 1YXMA 2FRDA 5ICSA 5KKAA 3NTRA 4IXWA 1YB1A 5AXAA 5DN9A 1DHTA 3L4BA 2GERA 1V3TA 2Q1TA 1J6UA 5I7SA 1HYGA 2EGGA 1YQGA 3L0DA 1YQXA 1O8CA 4B7UA 3FNGA 4NBVA 3JD3A 1SB9A 1LDNA 1YO6A 2PK3A 3GGGA 2CF6A 4HFJA 5JDCA 1XLTA 1D1TA 3HFSA 3RC1A 4BNUA 4WK6A 2I3AA 2RHCA 1PTJA 4WGGA 3INTA 3VKUA 2BF7A 9LDBA 4RV9A 4CLHA 3D64A 4WEOA 1Q1NA 1SNYA 2Y1OA 3I23A 4IJUA 1E3WB 3VOSA 4PVDA 3ZHBA 3JD4A 4O1MA 3OJOA 4HADA 4DPLA 3PYLA 3NYWA 4MVJM 4R4JA 1LRJA 3NAQA 4B4UA 4CM4B 1FK8A 1PL6A 4K1LA 3TRIA 1IE3A 3G79A 4MVJP 1GEEA 1PZFA 3C3XA 5KVVA 1AUPA 3BHJA 3VC7A 2J3IA 3KRTA 1GDHA 4QEDA 3RUCA 4CJXA 4FGWA 1ZK0A 1HWYA 3HJAA 4EJMA 4GGPA 4IJWA 1HT0A 1R6DA 3BTSA 1PL8A 3BMNB 4IDAA 1ZSVA 4JGBA 3WDSA 3JQFA 3OF2A 4TKLA 3WBFA 1PQPA 3BMOB 4ND5A 1X1EA 4BMVA 3ZWYA 4GMGA 4ZQEA 1MGOA 4MVJD 2C2XA 2VWHA 1EVYA 4BO2A 4NU5A 3H5NA 1YOVB 3ZI0A 2NU7A 4J0FA 3I3OA 4PLWA 4FFNA 4R69A 2C5EA 3RUIA 3WX0A 4CM5A 1DJQA 3C1OA 2PKRA 5DT9A 4BGIA 1KC1A 1PJQA 4ALJA 1FF9A 2W8ZA 4RGBA 5AYVA 4JIGA 1ZSYA 2WJPA 4QTZA 3UXYA 1R4NA 1AXEA 3V2GA 4RQUA 3HNPA 1CRWG 5H83A 2A35A 2EJWA 2X0RA 3AFNA 3CKYA 3QSGA 3PEFA 3VH2A 2J5QA 4I5DA 4Y67A 3C85A 3IQDB 1Q7BA 3R1IA 4FD3A 4P4NA 4D3SA 5I8ZA 3H5RA 3Q3CA 2G82A 3COSA 2OBNA 3RFTA 7ADHA 3EYWA 2GN9A 4TSKA 2W4QA 2EKQA 1XWFA 1BXGB 3D3EA 2VWPA 1ZFNA 3L6OO 4GWKA 4PLVA 2FR1A 1G6KA 4F46A 3WLEA 4UUPA 4YPOA 1Z6ZA 2W2KB 4RF4A 3FBTA 3SEFA 2BGLA 4KUHA 4DA9A 4EEXA 3H9EO 4MO2A 4J1NA 4XDYA 3PLRA 3DHNA 4B8WA 2HMTA 4F6LA 5IXSA 3H6KA 1C1DB 4ZVVA 4D46A 5ER6A 4CLRA 3WSWA 3RC7A 2XXBA 4E3ZA 3VAZA 1RYDA 4CMAA 3S1LA 3C1AA 5L4LA 3U5TA 2V65A 1U4SA 3D0OA 3PWSA 2D3TA 3UGKA 1ZEJA 1EK6A 3WGGA 4E32A 1ZEMA 4DMLA 4LCJA 3JYLA 1EE9A 3ETGA 4A0SA 1LSJA 1UDBA 5G0SA 3FPLA 5FI5A 4NK4A 3U0BA 2O7SA 1M6HA 3HDQA 1B3RA 4RPLA 2QQ5A 1QV6A 1C3VA 4YJGA 3RC9A 3ONDA 4BGVA 3E5RA 4D45A 5C7OO 1UZLA 3VH3A 1I2CA 1W6UA 5CDGA 1DIGA 1E7QA 2W2LD 4XYEA 4CM6A 4I08A 2EGHA 3L9WA 1GCUA 1YBAA 1U3UA 3I6IA 1E0DA 3UAGA 2NV6A 5GZ6A 1ZMTA 3WQQA 4FFOA 4XKJA 3RCBA 5JAZA 4ZD6A 5KWEA 3W4KA 4II3A 2PH3A 1T1RA 2IXBA 3OQ6A 5ILGA 2VT2A 5FEUA 2B0JA 2OHXA 6LDHA 2GZ3A 3K31A 4WLFA 2AQHA 4LN1A 2A92A 3W8FA 3RVDA 3TOZA 3I52A 5KJEA 5JE8A 1E6WA 1JAXA 2BFAA 3NKLA 4JBIA 1NQAO 4M49A 1GEGA 4NMHA 4FOSA 4HFRA 3F9IA 3FPCA 4CQLA 5EQDA 4U5QA 1LBEA 4B79A 1HE2A 1U3VA 1L7EA 4YACA 4BO0A 4I5FA 4ND3A 1MXFA 4RZIA 1WLYA 2X0NA 4PLTA 2VYND 1GPJA 4YJFB 3QVSA 1WDKA 4IBOA 3PHGA 3Q9UA 3QW2A 3W1VA 4CMGA 3RU7A 1T25A 4ND4A 4OKNA 3GNQA 4K6CA 1H6AA 4ALKA 4B7CA 1U28A 2YQ4A 4AJLA 3GZNA 1M2WA 3AI3A 3H9JA 3OA0A 4PZDA 4JCOA 4R54A 3K96A 4A26A 4ALIA 3BTUA 4JBGA 3KYDA 1V9LA 4PCVA 1X7HA 1EVZA 3VPHA 3PRJA 2V6FA 3OMLA 2JFFA 4CR8A 5THKA 5A9SB 5K6AA 5HA5A 3PJEA 3SJ7A 4YAKA 1NFFA 1ZK1A 4UEOA 4AFNA 3LT1A 5EJ2A 3BIOA 3JQ9A 4IUYA 3GNTA 4ALNA 3ROPA 4W9NA 3KV3O 3TDKA 3NUGA 3AFMA 1F8FA 5G4LA 2NADA 2P4HX 4ND1A 3EGOA 4ZJUA 1UR5A 1KVRA 4UVGA 5BSEA 3DQPA 3F46A 4WLOA 4NFHA 4WLEA 4XD2A 4WLVA 2I65A 3K5PA 1Z75A 5I9MA 3PZBA 1WXDA 1YS4A 3NV9A 3NGXA 4M8SA 3FR8A 5ILOA 1ZCJA 2EJVA 1N9GA 3SVTA 4NU6A 4EZBA 3TJRA 4BNVA 1M66A 1GTMA 3AY6A 3RJ9A 2O2YA 3MTJA 4L9RA 4DTIA 1BG6A 2Q99A 4C7JA 2Q2WA 3MTGA 3PWZA 3V2HA 1QYWA 2HJSA 2IRWA 5KVCA 4RPJA 2FOIA 4WE3A 2IZ0A 3HDHA 2ZTUA 4Q39A 4IGFA 3KLPX 4AVYA 1ONOA 3WOHA 4FJ0A 4CM8A 3HHPA 3CMCO 3L4BC 4XQCA 5KJFA 3JQ6A 2YDYA 5TT0A 1X7GA 3O9ZA 2AQKA 3H8VA 3AW9A 4J49A 5HS6A 1S6YA 3EY4A 1I2ZA 2H63A 5TGDA 5A5FA 1LXCA 2DT5A 1ML3A 1YBVA 1HL3A 1YQDA 4HWKA 5JCJA 3OBBA 4E30A 5THQA 1O6ZA 4JNKA 1KETA 2CFCA 1V8BA 3PFFA 1IULA 4U0JA 1LI4A 3WGHA 3KO8A 4A7PA 2EW8A 2ZCVA 4Z0TA 1LC3A 4DRYA 3ZV4A 3NDRA 3ZWVA 4HV4A 2VOJA 2EEZA 3E9MA 2E6UX 3FI9A 1EQ2A 3NTQA 3PLNA 1UDAA 1VRWA 3AY7A 5CP8A 5MDHA 4XQ9A 4TVBA 3PHLA 4BO9A 4N18A 4YJDA 4DQXA 3ANLA 3WIEA 1Y81A 1WW8A 2WTBA 1XU9A 1DEHA 1SBYA 4XJTA 4FFRA 4TMFA 2OZPA 3ETEA 4J4TA 5JBIA 1FDWA 2BELA 1NM5A 3K6JA 4R5MA 4CQMB 4DWVA 2B83A 2VRCA 4WCDA 1HDYA 3AUTA 3INGA 3V2UA 4YA6A 2CF5A 4HFNA 4R9RA 4S1VA 2QRKA 1NXQA 2IDZA 1I3LA 1U9JA 2C7VA 2D59A 4XA8A 4P38A 4XYMA 1LDEA 2JHFA 1X14A 3RBVA 3OSUA 3GR6A 3GPDG 3IDSA 3OJLA 5COQA 5JFOA 2WD7B 4PZCA 3ZW8A 5KIAA 1U5AA 2PFGA 3C1TA 1Y9AA 1KVSA 1XIVA 4XGKA 5COBA 1R37A 3DXFA 1WMAA 4BB6A 4CL8A 5ER9A 1LLUA 1E3WA 5DCUA 5TNXA 1TA4A 5KTKA 1H9BA 2H1SA 1GY8A 4N7RA 3JYOA 3ZHXA 2DBZA 4D7AA 1PJ3A 1SCUA 1T4DA 2AXQA 3BTVA 3E48A 4CM4A 1PZEA 2FPPA 5HM8A 1Z7BA 3B1FA 5GZ1A 4Y6PA 4ILKA 3DR3A 3H3JA 4ZU3A 5AOVA 4NDNE 4DQUA 4U0KA 2RH4A 4Z9YA 1NAIA 2IZZA 1V3VA 2OUIA 4GX1A 1L1FA 5CPFA 4WKGA 4CMHA 3JV7A 5JDIA 4JK3A 4N54A 5JLAA 3ROKA 3WJAA 3BMNA 1IL0A 1R4MB 2JFGA 2NQTA 1U4OA 2DUUA 1T26A 5JYDA 3S2GA 2E48A 3BMOA 1HLPA 3H2SA 3GY0A 5JPIA 2NVWA 3FHLA 1EVIA 2O4CA 1LQUA 4R5HA 4J1SA 2V7PA 4PLZA 2NTNA 3UCXA 1ENZA 5MGBA 2ZB8A 4QXMA 4Z6KA 3Q0EA 1WMBA 2BRUA 4OIMA 1ISGA 1H93A 1PJLA 3ADOA 2WWRA 4N5LA 1RYEA 2G76A 4CM9D 4XWYA 2GCGA 2PD3A 2C29D 4GQAA 1JQBA 1I0ZA 3LYLA 2B5WA 2Q1SA 1CQJA 1MC4A 4MP6A 4BNTA 4Y6RA 5A3JA 1KC3A 4RLSA 1PGPA 2Q46A 3PHIA 4LW8A 3DBRB 3HFGA 1Y5MA 4OL9A 1F14A 4MVJG 4WLUA 1KVQA 1E7RA 3MZ0A 1SAYA 2WYUA 3QIVA 4AJJA 3G17A 1BXGA 3RROA 3RSHA 4UVIA 3FCOA 1E92A 1RM0A 3T7EA 2IZ1A 2JD2A 4J7XA 3V8BA 3W4IA 3PFWO 3NEPX 2RHRA 4ZHSA 2DTDA 5L53A 1DJNA 4RPHA 2W2KA 5TSDA 3VH1A 4DGSA 4MVJH 3QVOA 4NQZA 4E5YA 3GRKA 4B4WA 2Z5LA 4B4VA 2O3SA 1PS8A 2Y1DA 4PLGA 1P45A 1NVTA 4I8XA 1UZNA 2Y0DA 2X86A 2DBRA 3HUDA 2WYVA 1C1DA 3I9NA 5DNAA 1PSDA 4U6SA 4XB2A 2E37A 1A7KA 4EGFA 1EUDA 2FZEA 4JP3A 1J0XO 4TVOA 3JD0A 1WZEA 4RF5A 1QYVA 4J3FA 1RWBA 2Y66A 3ROMA 1PU2A 2P9EA 4BNJA 1W0CA 3KEOA 1ZMOA 2NSDA 1MXHA 3ANNA 4F6CA 1HSZA 4ZQGA 5B4UA 3VZQA 4RQTA 4E4YA 2DTEA 1U8XX 4CLOB 2AG8A 1HYHA 1ZJZA 2P5YA 3HDYA 1X7DA 3JQAB 4R01A 1A9YA 1CEQA 3VTFA 3RFVA 3LT0A 2HK7A 3BA1A 5HWSA 2OXIA 1QSGA 4O59O 4YXFA 3IAHA 1C0KA 4FJ1A 1PR9A 2OFPA 3JQ7A 2DPGA 2ZB7A 4BNXA 1GZ3A 1XR3A 3U4DA 2PA3A 4XYLA 1I33A 1EEHA 1VL6A 5COAA 5U1PA 1EE2A 4PG4A 2DTXA 3DDNA 1C1XB 3DZKA 1ZVMA 1B15A 1JDJA 1LDGA 3A06A 4Z9XA 2HAEA 4A2CA 1ZW1A 3FF4A 2EXXA 1U3WA 4BV9A 4EITA 3PIIA 1P1JA 2C59A 3ZV3A 2W90A 3GZ4A 1KEWA 4GKBA 4PN3A 4K6FA 1BW9B 1T2AA 4W7HA 5TLSA 2X4GA 2C20A 3H9GA 1DFGA 1H9AA 2GO1A 2YHIB 4W9NC 3QWFA 1T24A 1DB3A 4D41A 1DSSG 1NFQA 2XAAA 4CMCA 1HDCA 4BKOA 4PG8A 3C7CB 4YJFA 1CF2O 1LRLA 3LZ6A 4KOAA 2X7HA 4Z9FA 4B3HA 2FSVA 1GUYA 5LC1A 3VVBA 2FHSA 4UVDA 1MX3A 3OIFA 1I30A 1BDMA 1SEVA 4RCVA 4ZQHA 3WNQA 2EF1A 1QKIA 1DIRA 1KVTA 4XR4A 3E1KA 2B69A 2WSBA 3BHMA 2GD1O 1Z73A 2GNAA 3PJFA 2P9CA 1YJQA 1FJHA 2VCYA 3KVOA 2O7QA 2FP4A 3L6EA 1K3TA 3CTMA 4IDGA 1RM3A 5IJZA 4P8RA 1NR7A 4PLYA 2WE8A 3KOUA 1PJSA 4DBVO 4WEQA 1R15A 4XQGA 2EW2A 1WNTA 1UH5A 4LISA 3UUWA 4CPDA 1HXHA 2Y93A 4FFMA 1VL8A 4KTVE 4PLHA 4WOJA 3TQHA 3FNFA 4H16A 3AY3A 1GV0A 2JAHA 4AG3A 1PJCA 4NPCA 4CMJA 3KSZO 3TL3A 2Q4BA 1A4UA 2PGLA 2JAPA 2UVDA 4CLDA 1LDMA 4NR0A 4BO1A 4HXYA 4CMIB 2IYOA 1OBFO 4NIMA 1LDYA 3T4XA 3ZV6A 4CUZA 3ABIA 3S2IA 2B4QA 3VZSA 2HKIA 3AM5A 2RIRA 3S2FA 3C7AA 4Z3DA 4BB5A 3GVXA 4Q3AA 5IZCA 2O3UA 4IMRA 3QV1A 1E3LA 4UEKA 1QYDA 1CETA 1TT5B 3LC7O 5T6BA 4AJKA 1UP6A 4GVLA 3QWBA 3D3WB 1ZZEA 1PJTA 1DOHA 4YDRA 2VOEA 1U7TA 2Q45A 1EMDA 3UF0A 3WS7A 1XQ6A 2HQ1A 2J6IA 1U2DA 3KYBA 4UUMA 1ISHA 5A1TA 2BMAA 2BI8A 3GG2A 4IDBA 5L3ZA 5JY1A 1LC0A 3CIFA 5AXCA 5KJCA 1DHRA 1DLIA 1EBFA 1GZ4A 3WNVA 1E1KA 2PKQP 3GGOA 4GMFA 3NJ4A 1TT7A 5CEEA 4PZEA 4GGOA 4AJHA 4MIEA 1XSEA 1VPDA 4AJNA 4EJ6A 4O5OA 1SPXA 4DBZA 4XGNA 2O23A 1H2HA 1O89A 4RO0A 2BGMA 3TWOA 1E1LA 2G5CA 4WPGA 3G49A 3GVPA 2B36A 4GH5A 3X2FA 3ZNQA 4E21A 4ROSA 4NBTA 2VZ9A 2PLAA 4NK5A 4P22A 3ZH2A 4MPDA 3RBZA 1Y7TA 3M6IA 1DRVA 2IXAA 3R3SA 4XRGA 3HSKA 2VN8A 1EZ4A 3V5NA 3LT2A 3AM3A 5CDTA 1QLHA 5L4NA 3GN1A 1D4FA 4FGSA 4RLHA 5BSFA 1D3AA 1VE9A 5TRTA 4BNLA 2HJRA 5JNLA 3Q6IA 4FSHA 2VNSA 4D42A 5BNFA 5IFLA 5DP1A 4YRAA 1T2EA 2ZJ1A 4CQMA 3ULKA 1H6BA 3B1JA 4R3NA 1I32A 1E3IA 3DMYA 4LVUA 4XQEA 1BVRA 1EFKA 1F0YA 3H4VA 5LCXA 5JDIC 1LTHR 4YQYA 4B7XA 5L7WA 2HMWA 2VYVD 3GN2A 2TMGA 1LJ8A 3TZQA 2DUWA 3EC7A 3U4IA 4H15A 1HTBA 2GZ1A 4CMKA 3TZKA 1I2BA 1JWAB 1Z45A 4TRJA 1O0SA 1YL5A 5A9RA 3M2PA 4MKZA 4QFCA 1NWHA 3G0OA 2QYTA 3JQBA 1MFZA 4HFMA 3RC2A 4DIFA 3GA0A 4PIVA 2GYYA 5F21A 2Q1UA 3DOJA 3WGIA 3PIDA 2J8ZA 1XG5A 4OQYA 2FWMX 2Y68A 5L40A 1GR0A 4KWIA 4OXYA 5DBGA 2OGUA 2POQX 4FDAA 4IY1A 4YAJA 3RJ5A 2RH8A 1HEUA 2YFQA 4E33A 1K5HA 4UVHA 1NAHA 1IPFA 1OOEA 2GGSA 2PZKA 4E5MA 4E5NA 1BHSA 4OOFA 1G1AA 3AI2A 5CFZA 3DEYX 4RF3A 1PWXA 3WGQA 3WSVA 2VNAA 3TL2A 4YWJA 4CLEA 1R4MA 1ZK2A 5A3VA 4ZRNA 1JKFA 3A9WA 4NJMB 4OQZA 1LQTA 5AXDA 1E6UA 1T1SA 2YYYA 5JO9A 3UFXA 3JD2A 3LQFA 5CPBA 5B4TA 3WG9A 4O63O 4INAA 3D5QA 1GPDG 1PS9A 5F5NA 4OJNA 1KBZA 4E31A 1SOWA 2FSSA 4OOEA 1DRWA 4X54A 3MOGA 5T8KC 4AJOA 5AXBA 1T2DA 4XDZA 3FTPA 1IZ9A 4DC0A 4BKRA 3IMFA 4D3DA 1P1RA 2AEMA 1NASA 1PJ2A 3DZGA 1FDSA 4BUCA 1KY5A 3CZMA 3OJFA 5TQVA 5G0WA 3E9QA 1TB4A 5ITWA 4E12A 2HLPA 3B6ZA 1N1EA 4BO8A 1O9BA 4IDCA 1N7HA 1WDLA 3CPSA 1UAGA 3MJTA 3K30A 1EBUA 2O3QA 2C54A 1OMOA 3FWNA 3C24A 4OHUA 5U4QA 3W6ZA 3GGPA 3TF5A 4NI5A 1JKJA 1JN0A 4IM7A 4RDHA 4TROA 2GPTA 1EUCA 4TZKA 3OFSA 3JTMA 1YJ8A 4PLFA 3GVIA 3JQEA 2EG9A 3H3FA 3PGXA 1PIWA 1A4IA 4S3MA 3UN1A 4BNNA 4YB8A 3MJCA 3S2EA 4JN6B 1VC2A 2VZ0A 1HE3A 1LUAA 2YY7A 3ZN2A 1ZK4A 3V1YA 4LRSB 4K9DA 3AWDA 1EDZA 3RWBA 2NVUB 1SC6A 4BGEA 3L6DA 4I9UA 2A4KA 1P31A 2EKLA 4PGFA 1HDZA 3Q2KA 3D4NA 3CE6A 4WECA 2AQ8A 1K2WA 3EHEA 3EK2A 3IC5A 1N2SA 2I6TA 3WGZA 3OA2A 1QYCA 5KKCA 1AXGA 3WGTA 4E0BA 1KYQA 2WYWA 3U62A 1D7OA 1KY4A 5JAIA 4LVCA 2WD8A 3UCEA 2YV1A 2OO5A 2X1HA 4J91A 5DCWA 1NPYA 4LMRA 3KEQA 2X5KO 4KDEA 1WWKA 2LDXA 1PJBA 3VDQA 5CEFA 3D1LA 1PX0A 3WR5A 3JQAA 4IS2A 4CLOA 4EYEA 4CV3A 3HN7A 3DOOA 2NQ8A 3O03A 4DL9A 1UP7A 1TXGA 4J16A 4FW8A 1OFGA 2PD4A 3WQSB 3ICCA 1YL7A 3OJ0A 3PP8A 1RM5A 4L76A 1JAYA 3WFIA 2AEFA 3D4OA 3VH4A 1PWZA 1A72A 2ZJ0A 4GAEA 1ZIDA 3VPSA 4GVXA 1E3EA 3L07A 3JQGB 3U3XA 4OKIA 5ES3A 3AUUA 2I99A 3ZGYA 1FDUA 3KXDA 4DUPA 3KM0A 5JCXA 2DKNA 5ITVA 4LMPA 2C07A 2ZIZA 3VPFA 3W4JA 4F3YA 4BO5A 7MDHA 3INRA 2BD0A 3D5TA 1K6JA 1GU7A 2G17A 4PLCA 3GUYA 3LK7A 1A71A 2YV3A 1ADFA 2PR2A 4J90A 4WCFB 3ETDA 1B26A 3I1JA 1BW9A 4HBGA 3I9MA 1KEUA 4OH1A 2AW5A 2GUGA 2YHIA 3AU9A 4WJZA 3WMXA 3OH8A 5JS6A 3F47A 2BLLA 3EVNA 2YV2A 3DZFA 4Q3CA 3JQ8B 1P33A 2VHVA 2Z95A 1BTOA 1XHLA 1RKXA 3ZWCA 3BZUA 4IINA 5G4KA 5IF3A 5CDSA 4OMUA 1ONPA 1I24A 3I9LA 1IPEA 2EV9A 5A03A 1GUFA 2EP5A 5IZCC 4Y8VA 4E5PA 3AJRA 3RUDA 4ALMA 3DZBA 1YE3A 2ZKLA 3HDJA 4FB5A 4OO3A 2YW9A 4XB1A 1XQ1A 2PV7A 1VI2A 3H65A 1U1IA 2I67A 3KSUA 3M1AA 3BAZA 3ZW9A 1ENOA 4R9SA 4NH4A 3PQEA 2NU9A 1S7CA 3QWIA 1NVMB 3NX4A 3TSCA 4K26A 3CMMA 3FRJA 2XXJA 2EERA 3N7UA 3F1KA 4B8ZA 4UULA 2X9VA 4EEZA 4IZHA 3ZWXA 2UUOA 3JSAA 2HMVA 4RORA 5L7YA 1KIFA 1YWGO 1HSOA 4Z0HO 5JO0A 1HE5A 4YRDA 3K73O 4G81A 4JXKA 2F00A 3TN7A 1KEVA 2R00A 1IYZA 2C7GA 3DHEA 3NT4A 4HNGA 3BHIA 4BNMA 4FJ2A 4CUKA 4GBJA 3ENNA 5T64A 3VTZA 3E03A 1H94A 1ENPA 3GQVA 4AJEA 1TT5A 2D8AA 4NJOA 4R41A 1U7HA 5KCZA 1T2FA 3D3WA 2UV8A 4RVUA 1MG0A 3H9QA 4DLAA 2PH5A 3ZU5A 3DBLB 3QLJA 5BSHA 2X0IA 3RASA 3DBHB 4E13A 3A4VA 1JLLA 4XYBA 3V1TC 4OAQA 1MUUA 1X0VA 1VJ1A 5FF9A 3ICPA 3G1TA 4J1QA 4J7CA 2NUAA 2VRBA 1GV1A 3GLQA 1OC4A 3QHAA 3UW3A 5I7FA 3GAFA 1F17A 3AU8A 2VZ8A 5A4DA 2CD9A 1YL6A 3RKRA 4MVJA 2GR9A 3DFZA 3LT4A 3F5SA 4J1TA 2PWZA 2X8LA 5TX7A 1GCOA 4PLPA 3AM4A 1W4ZA 3KHUA 3KETA 5G0UA 1AHHA 3ADPA 4MVJE 1C0PA 1O5IA 3JQBC 4UEJA 3WB9A 3I6QA 2EP7A 4LRTB 4RPGA 4IZIA 5DBFA 4E2WA 4DYVA 4B3IA 5IDXA 2Z1NA 3L77A 2Q3EA 1XYGA 4O6VA 1F8GA 5A06A 2DBVO 4BNZA 5TJHA 1LNQA 3TFQA 3EAGA 3EMKA 4XZ3A 3RQSA 1K6IA 2E4AA 3KZVA 5DCYA 5EPOA 3DMTC 2BFOA 4R16A 4H3VA 1AGNA 2Y1CA 1HYEA 1CJCA 2WEKA 1TEHA 3ROQA 1DLJA 1YOVA 3BMQB 4D0SA 4FFPA 2VHYA 4ONEA 2DM6A
chains in the Genus database with same CATH superfamily
1W96A 2X4DA 3KKZA 2R8OA 2Q0HA 3L01A 2XGJA 5AW7A 2FR8A 2FX3A 2ZXFA 2V6IA 3IKTA 2QRPA 3H2ZA 1L8AA 4XJVA 1A69A 3TPCA 4I3GA 1Y3DE 1JYFA 1N25A 1WUHS 4M1MA 3T4EA 1X15A 3LT5A 2G7MC 4KLRA 3H9BA 5E8RA 1LQ2A 4EW6A 1ZCFA 1TVKB 4DPMA 3GA7A 4RZ3A 4EVRA 3H9UA 3UJ3X 4WIAA 1ODLA 1GRNA 1ULAA 3AEXA 1DEOA 3IUQA 3KYJB 4K9KA 4ASUA 3L0IB 4TKUA 2XNDD 5FP0A 1ZW6A 4OBWA 2ZATA 1UODA 4A2PA 4JGIA 4DJDC 1M54A 4EWLA 3GDFA 2NXJA 3TSZA 5IAAA 3TMAA 4DB4A 2BKEA 5CJJA 4QXAA 1Q91A 2B5OA 3UOWA 1K8RA 1W7AA 2BFPA 3C87A 3U7QB 2GK4A 2CUTA 3OQ1A 2HIHA 4OUDA 4LGMA 3Q10A 2O3RA 5EIOA 1AHPA 1Y6JA 2CDAA 4LEIA 3R0QA 4XASA 1E96A 2N0SA 3A4IA 1K7FB 3O73A 2GK3A 3G2QA 1XMSA 3H42B 3RIHA 4J6FA 4PWYA 1AD2A 2FN7A 4XRRA 3DEFA 2ZXUA 4ZCPA 4IDFA 5ED0A 3LI2A 2PTGA 4MIYA 1BRMA 4G8DA 2HSZA 5JG7A 2JASA 2XUPA 3NFYA 4GSYA 4Q9HA 1VYUA 4M7WA 2ATXA 3GHYA 2HPAA 4U7WA 3PHHA 1LW6E 2X6QA 1I6KA 5JEEA 1SA0A 3ORFA 1R6AA 3MIZA 1FL9A 2M1ZA 2IH5A 1M67A 1XZDA 2YIMA 1BGVA 1HLGA 1S8OA 4MJXA 4NV1A 3OZSA 5AVSA 3EZYA 3JVVA 4Q4JB 4Z4FA 3IP5A 4MDHA 5KHOC 1E6LA 4BNWA 4B73A 1KI7A 1NGSA 1JWLA 3NALA 3ZHZA 5TF0A 4BO7A 5LQJA 1QRTA 2XUAA 2C1EA 2PPVA 1LPBB 1R9JA 3GBSA 2AH5A 2ZAYA 4W8GA 1Z88A 2QUKA 2CJPA 3QP9A 4CQLB 5ICCA 1SMKA 1DQYA 3N7TA 2XX3A 4ETMA 3LP6A 1IVNA 4C08A 4UXIA 2D5BA 1YRAA 4UPEA 4TS4A 3CZPA 3HU3A 1Y82A 1M1NB 2GXAA 1XMQB 1SCBA 1QE5A 3QYPA 4Q3LA 4QTXA 2BMDA 2EZUA 2AMLA 5F4BA 4AUEA 2QVYX 3BCUA 4O2AF 1G0OA 4GBED 3ND5A 2XQVA 4OYRA 4DRXA 3FSGA 2I4NA 2XY4A 3UH0A 3URMA 4CRWB 1N78A 4NAUA 3KEMA 4BN4A 5JJCA 3PV0A 2CHUA 4HB0A 4IIBA 2ZJOA 3OAAA 4RH0A 5KKNB 4L22A 2E87A 2VQDA 1WNFA 4DVJA 2H2GA 3UXHA 1RE0A 1QBKC 3EPPA 4BKMA 1YZYA 1NQOA 4JLWA 2XVXA 4MS1A 3REFA 1NURA 4PEVA 2P0YA 1EGMB 3ZCPA 1IJFA 2GXSA 4P4LA 3LXMA 4H1TA 3VNAA 2OFWA 3DV0B 4I55A 1AKUA 2ALJA 5BVHB 4WASA 2JGRA 4AB1A 4X60A 1EX7A 3CN7A 2ODPA 2CLLB 3FA2A 4TQAA 1YR6A 2Z2IA 1KMNA 5HBRA 2Q6IA 1ST2A 1CY7A 4GKAA 4RM2A 5BQ3A 1TYBE 2MSNA 2FOXA 1OYVA 4QXQA 5JMPA 2GASA 1CVLA 2XKAA 4KOEC 5DBEX 3QBTA 4RZHA 4X20A 2P6NA 1DO0A 1HDIA 1A50B 2CK3A 2DKOA 2QJWA 3AVOA 1Z22A 3DCIA 3K4QA 2UU9B 1NLZA 1KFCB 2ET6A 4QRHA 4NESA 3SDSA 5LQRA 3W9UA 4LFAB 1XLUA 3GW8A 4E14A 3EFBA 5EWJB 3VYRB 3SJUA 1MO6A 5BVGB 4US2R 2JIMA 4MW5A 1MABA 2CBXA 3KZCA 2IF2A 3WV5A 3WKEA 3AOEC 3LECA 5JC1A 1NSYA 4CIWA 3TVTA 3G88A 3PPXA 4B4VA 2HV9A 4RPKA 2LWIA 1EVJA 1MJGA 2WPDA 3SXUB 1SQ6A 4B34A 4HLCA 3CLRD 3KEGA 4AJ1A 2I7TA 1ID1A 2H6EA 3BIWA 3I8OA 4H59A 4DV0B 4N48A 2PRKA 3DEIA 3NWOA 5AW8A 3SF0A 4FLEA 1F6BA 5CXXA 2P68A 1W85B 3QBJA 1UJMA 3N53A 1XRNA 2GETA 2X23A 3CUTA 4GYJA 3WMWA 3KSRA 4W99A 3ZGNA 3BXOA 4GX5A 1DIHA 4Y9DA 5AH0A 1W46A 3QVXA 2WJHA 3SQNA 2IPAB 4K3VA 4YAGA 3MCAA 3L4SO 4F5YA 3Q1LA 4BP8A 2IEAA 1FFHA 5EJAA 2HT6A 4EY3A 1UEIA 3ONFA 2Z5FA 2ERYA 4YDHB 1AX9A 1RI4A 3ZWDA 4DS3A 3O4RA 2MSCB 3OVMA 1UK9A 4MNTA 4NCJA 5TB5A 3ANMA 3I9KA 4N3CA 5JH7A 1W9HA 5D6NA 1N9ZA 1YVRA 1PCXA 1GZHB 4D4GA 5B3KA 3SE0A 1JX6A 4FQ8A 1DAPA 2QT9A 1X1DA 4I3HA 3TIGA 2ECPA 1YI1A 1PZXA 3K53A 2YKGA 3FDZB 2G80A 3CIOA 4OYYA 3W1EA 2ZQYA 4S04A 3WTBA 3HBNA 2ACKA 4C22A 3LA6A 2XITA 3JZIA 1USKA 2XNKA 3QE0A 4OGLA 2HUPA 3DVQX 3QLVA 1GKKA 4TQ9A 5KHLB 1AQNA 3R0ZA 1I36A 2ZQZA 3PQ7A 4XYGA 2GTHA 1F3LA 4XVCA 1NU6A 3GK3A 3KJFA 3O3NB 4AU1A 4F12A 4UNRA 2OG1A 3TCNA 1EDBA 1UQRA 1UMBB 3M5WA 2DAPA 4MW4A 1ZYUA 3HHEA 1WCIA 3ETNA 3H86A 3I5MA 4IF6A 1RVV1 2JFVA 3LY7A 1CWUA 1NHGA 3GEBA 5HFJA 3CH6A 1F38A 3D81A 4TXJA 3PITA 2VHWA 1IK6A 1RLMA 3O6VA 2QSYA 4LYAA 4B3JA 3LS2A 1K7CA 4MI6A 2Z4RA 2F8MA 2F43B 1SWVA 3KG2A 1XGKA 1M5TA 3GDGA 3CX4A 4F4CA 5SV2A 3M1IA 4FNGA 3HJFA 3SKYA 1VPEA 2JH9A 3ASYA 1V96A 3NHBA 3QFSA 4JVOA 3TX6A 2O59A 4C7KA 1ZJYA 2XUHA 4TWJA 5KYYA 2YDXA 4HEHA 5LZ8A 5FO0A 3TSYA 3UTDA 1NBWB 2GD6A 1W0KA 2W42A 4N3BA 2OMEA 1OH5A 3IJRA 3CZQA 2QE7A 5JR3A 1P7PA 3DUFA 1C4OA 1JB9A 3QPDA 2VXBA 1SVWA 5I5EA 5JYEA 5FHQA 1YONA 1YQEA 3DE7X 4JT2A 3F5MA 3PGA1 3GNLA 2B4YA 3MAAC 1EVEA 1FUYB 1S2OA 1U94A 3GD7A 3IHTA 5DP2A 1IDN1 2DR3A 1Q19A 2AF4C 4B44A 5BMVF 2ADMA 1IUKA 3M70A 2VRCD 4GPD1 5P21A 3SVLA 1CCWA 2AMVA 3ZY3A 2YXDA 2JIDA 2OY0A 3M5PA 1F5SA 5DYTA 3PQ8A 2ROQA 5JC8A 4F4IA 1P4GA 3QY9A 1CE8B 2CNNA 4GP7A 1DIAA 5JAHA 2C96A 3ORQA 2PQ6A 3DWFA 4FKMA 1QZ3A 4OJMX 4FCTA 1UAAA 2GN2A 3U3ZA 1L3CA 1FX0A 3NC0C 2OHFA 3DULA 3K15A 4ZWNA 4NVRA 1BKSB 1F12A 2QIOA 3P2KA 1D09A 1RRFA 1WRBA 5DW0A 5FA6A 5C7LO 2WD7A 3ZR4B 1LK7A 5AUQA 4G01B 4WBNB 4E6PA 3A2KA 5DYWA 2OZKA 3EQ6A 3UJ9A 3HG7A 3EMVA 1UBRS 3GJYA 4ND6A 1P6XA 1U7XA 3CLHA 1BDBA 1P74A 4RM3A 1GA4A 5FFFA 1DIBA 3X2EA 1ISJA 2OHHA 2QVLA 5LDGA 2GN8A 2ZUFA 2J5KA 1BU5A 4ZRDA 3MOIA 1HZZA 4HN9A 1E66A 1T1GA 5BV1A 5EGSA 3HDVA 2ONJA 3K8OE 1J1UA 4REQB 1XL1A 1QG6A 2H8GA 3ML1A 4JMLA 5FPPA 1KOFA 1SM4A 1QHEA 2IHZA 1P3DA 3B60A 4BVEA 1QNLA 2JFNA 3U4MA 3AIKA 1YNSA 4MRNA 4GDMA 1UBJS 3FNEA 4Y98A 5F1KA 2YFKA 4HP8A 3H2HA 2X4IA 2CXNA 2JFHA 3CYFA 3GPBA 2M9MA 3CUKA 3BE8A 3LBAA 3MERA 2FV8A 4AZ0A 1NQTA 3WHKA 4FYYA 5EJEA 1HKUA 5JRJA 2ATEA 1QHNA 4KXQA 1QQBA 2YBEA 1EJBA 2GBIA 3D6NB 4OB7A 4Q7JB 1YZGA 3N28A 2W7TA 1A4XA 3FFBA 3M2TA 3QBDA 4OK3A 4YTEA 3CSUA 1YIDA 1JPUA 1SEPA 2AEEA 5KAMA 3W6UA 1YIOA 1N7GA 5AUPB 2ILTA 4IKOA 4ZQCB 4ZYZA 2PKQO 2GN6A 1C41A 2WJ6A 2B1IA 3QQ5A 2DVMA 1NI3A 4CMBA 3BMQA 2JDID 3D7LA 3NTOA 4DJEC 1RPJA 3GFBA 3IAM1 1UPFA 1M8PA 2I6UA 3K92A 2B30A 2V4ZA 4XUGB 5EL0A 2I71A 2PS3A 1C9JA 2QUZA 4EI9A 3ADCA 4X6LA 1KEPA 2FF7A 2WHXA 3G1UA 3P4XA 3PA6A 5ENDA 3OLYA 3NBFA 3NRBA 5MHTA 5DB4A 3SLKA 4H4CA 1UP4A 4A0GA 1EDOA 3UWOA 2ZWAA 3BIXA 4AS3A 3ZQJA 1UM9A 1V7ZA 1BVUA 1RPTA 3IP1A 1NUQA 1Y8QB 2ZT6A 1GSHA 2DUMA 1BJKA 2UZ1B 3MCUA 4KO8A 4O3FA 5EVCA 721PA 3VSAA 2JRLA 3WTCA 1OBOA 3BGOS 2GK6A 4DCSA 4RZXA 1EUDB 1U8TA 3UJ7A 4K28A 1Y7PA 3DBRA 2Y67A 3ZCQA 5C32A 3O7WA 5I6DA 5IUNC 5DX0A 1W8DA 2OECA 1O94C 2IYTA 4H3KB 2OO3A 4MYSA 3OZVA 1VMKA 2WM3A 3A9CA 4FOOA 5CX1B 5H3LA 4D3ZA 5FAKA 4IH1A 4C4ZA 3EFHA 4EHIA 4IAOA 1ZH8A 2G67A 3JCZA 1UWLA 1RHKA 3AJEA 4EABA 5IYZB 2PX2A 2ZM5A 2E6KA 2WHPB 2AX4A 3PC6A 2CB0A 2G88A 1RLTA 2P69A 2G9VA 2Q50A 3PSAA 1BWQA 1KI3A 1YZLA 1JHAA 2A6PA 1AZWA 3G6WA 3IODA 3OEEA 2QB5A 4YP1A 4DYDA 2HBRA 1R1DA 3EXIB 1C4KA 3GT0A 3U49A 4TTSA 1ANKA 1CRLA 2FI1A 4I1RA 5K0NA 2PZGA 2IF0A 2X8BA 4AX8A 1LU9A 3IB6A 4MB6A 3L8GA 1SZJG 1GPYA 3IR7A 2O6LA 4UREA 4P2BA 3DTYA 5KTSA 1YQTA 2TMKA 3R9XB 1V5WA 4Q24A 1N2CA 1RJFA 3EZ6A 1CYDA 3DYBA 3TW8A 5DBIA 4UMDA 2ORED 2VH1A 3HGMA 4QTUB 3WL7A 3ASUA 3KKMA 3PNLA 4I1VA 4MICA 1B8PA 4TMWA 3T38A 3BGVA 1TD1A 4LE1A 4Z9AA 2W4IA 1A8SA 1QFZA 2MMGA 4JDPA 2P11A 3V3KA 5HDBB 3OZRA 3FVWA 3Q7SA 1OV4A 4OI4A 3PYMA 4DLLA 1U8FO 3F96A 5F98A 5IDYA 5B1YA 1YVEI 4EF5A 5IMBA 2D0PB 2Y0BA 3DKRA 1P0MA 3MILA 1F4PA 5DBHX 2FA9A 2R7NA 2PYIA 3MWDB 5HBGA 2H3EA 2B4RO 4H0CA 1P81A 3TRFA 2C2MA 4ZCRA 1A8HA 2FH5B 1ZNQO 5GVRA 1T4BA 5B3AA 1QB8A 2BT4A 2V6BA 3TLCA 4MV4A 1AHNA 2IELA 5ANRB 5FQNA 1V4BA 5HUQA 2NUPB 1H69A 1XEAA 3H5LA 1IOLA 4B31A 3HKDA 5A3RA 2R6AA 4PZUA 2ZAIA 1CQIA 3GYGA 3ZNNA 1TYEB 2IEIA 2PSSA 1D2AA 2XDQA 1NNEA 1SKYE 4B3FX 3DBOB 1Y48E 1WHSA 1U99A 1MQSA 5LFAA 3S2ZA 4AM8A 4BU0A 5E4FA 2YQ5A 4KMSA 1ZNZA 3UUFA 1I9GA 3HO1A 4QOEA 3WYNA 4J7UA 3GH3A 5HF5A 2A9FA 1C1XA 2VK4A 5AKEA 1GSAA 5FJIA 3C3EA 4YONB 5A9TA 4BNHA 1QYXA 2ZKIA 1GAXA 5BT8A 2J3HA 4B09A 4O2BB 2WV9A 3TVDA 2QN3A 4TYQA 4DIBA 1MA0A 1UAYA 2WZCA 3QX7A 1BE0A 2ABWA 2HBQA 5EIWA 1XRLA 3QVKA 4YJHB 1HC7A 3RS0A 2QSUA 3PT9A 4RWEA 3RF6A 3II6X 2ZBGA 1NWCA 1OWOA 2HO5A 2BSXA 4CMEC 1TPYA 4RMNA 4PZPA 1O97C 1TCBA 1Z74A 4MROA 5E3JA 4AL4A 1Q0LA 1CERA 3F1LA 4RH3A 8OHMA 4RAQA 1FUUA 3MYRA 3OP4A 1Z25A 5DJ5A 4A3SA 1SUCA 3C97A 4QE3A 2A33A 3WYDA 4ZV4A 1KMQA 4M87A 1LV7A 3T5CA 4WDRA 4S0XA 3JYPA 5K0LA 5K8IA 5L4SA 4KI0A 2JI6A 3IELA 3O8QA 1UUFA 4O4HB 3OJXA 3I6YA 3IEXA 4F2WA 1FSZA 4QICA 2BR5A 3QMPA 3NXKA 3ESQA 4BWVA 1FVOA 1WZ2A 2HA0A 2JLAA 1U7UA 2AD1A 1DRUA 5K0CA 2O5EA 2GDZA 2BMJA 3AF3A 4G23A 4J0IA 3FTCA 1D6SA 1UPUA 3SX2A 1FOEB 2F62A 4OLFA 3D2AA 1UEJA 2P2LA 2QRQA 5FYQA 2ZAOA 1NN3A 3VZCA 1Z37A 3H75A 1QH9A 5K4HA 3TFOA 1EFLA 1NPTO 2WBLC 5KOIA 4E1AA 3FOWA 2BH9A 2WM9B 1LGYA 3USCS 1U8EA 1RHUA 3EULA 3A1NA 2Y76A 4R71A 1N6LA 1G8GA 3G5AA 2IY7A 7MHTA 1YZFA 4KUEA 4M8NE 1EM6A 4JC5A 1R0XA 1QF7A 1ZAKA 4GQIA 4DUGD 4PGMA 4AMGA 1TM4E 1UC9A 1XAJA 2P3LA 3K5WA 1KYVA 1Y42X 3MJVA 4ENWA 3T1HB 1GYQA 2BKAA 1P2GA 2QV0A 1M1YA 2H51A 3ROGA 5D1HA 5DIZA 1JJFA 4U9IS 2P5UA 4E46A 2WE7A 5KTNA 2F90A 1MB0A 4F6RA 4D44A 2R25B 4MRMB 5BN5A 4PRYA 1M1YE 3ND8A 4WMLA 4BNDA 4XDGA 2AFIA 2VCHA 1XLTC 2VVTA 3WRXC 4KFTA 1IN5A 1G8JA 5JVDB 1G1MA 4PE5B 1FY2A 3MLBA 4R7GA 5KPDA 2XBUA 4LMBA 2A5JA 5ALTA 1NW9B 2BP7A 4UHKA 1GTG1 2AFIE 4ZXFA 2Y1LA 3IIEA 4R2HA 1E7MA 1JQJC 3A9UA 4Z8XA 4CDGA 1C3OB 5BOSB 4G63A 1EFRA 4PG5A 4JLOA 5CLIA 5NLLA 1EK0A 4I50A 4Q7KA 4D9BA 2NSYA 3RS3A 1OZAA 4JJGA 4CV2A 1MFPA 1GADO 2HM7A 4PC6A 3B7GA 3HJHA 3CB4A 5FKJA 1KORA 3LVRE 1P5JA 4C4OA 2Q4OA 5BUZA 2GJ9A 2H4YA 4Y3UA 1R3UA 2PZJA 4I5GA 1Y33E 1N57A 3X1JA 4NBUA 2O8NA 4YRRA 2JJ1A 4PONA 1LW7A 1P1CA 4QOFA 4RU1A 3WLFA 1O8BA 1T6XA 2QL5A 3N8NA 1KDOA 3RS7A 3ZIDA 2JLWA 1QFMA 1MB9A 1VFNA 1ZUD1 3JQRA 4N8EA 4OXXA 3VDMA 1VE1A 4C0KA 4DIDA 4YMTA 3L6BA 4ER0A 3DG9A 1NMYA 5FUMA 5CA1B 3QJ5A 4AULA 5C7IO 4JROA 1UXHA 2ZRDA 4KAAA 4N5NA 4EG6A 4B32A 1YK1A 4YXWA 3HNRA 3DDZX 4PQYA 3H5VA 1VPWA 4DARA 5E7QA 3B9QA 4G3XA 3IL2A 4GIBA 4GM1A 3NYQA 3D8TA 2HTFA 2R6CA 3N8KA 4IS3A 3JPWA 4KDFA 3LYHA 3HM2A 5KJ6A 2R8PA 1QVRA 1SXPA 1GQQA 5JZVA 3FB1A 3I6ZA 3WLNA 1AK9A 2C82A 1W34A 2GWRA 1TO1E 3LLUA 2YZ2A 2VXCA 4R1TA 1NC3A 1JTEA 2IEYA 4QATA 4LF6B 3GUUA 2HDWA 3AM1A 5F1YA 2DPHA 3T7SA 2QDKA 3DVAB 1M34A 3UMBA 4MQUA 4YLEA 1PWYE 3THWA 4MWZA 5G0VA 1H6CA 1PDVA 1NR5A 3N6VA 1TAGA 5GM1A 3VBEA 4C4TA 3EEOA 3KTAA 4R83A 4R68A 4N01A 5TS2A 3BWYA 1M34E 2LCIA 5E9AA 4W5NA 3IVCA 5HEKA 3VU8A 2OILA 2Y0PA 1O6FA 4C6RA 1LD3A 4HEA6 1Q74A 5JS1A 3HV0A 2CZGA 2HNKA 3AEUA 4KIUA 1YULA 5I7AA 1JS1X 3S99A 3BYZA 4GLFA 2R2GA 2XWSA 2X8JB 4WL0A 5AVOA 5B3JA 4PR3A 3THRA 1H4SA 4XGRA 1EB8A 3LQYA 1H2BA 4NFYA 4DMKA 1W49A 4LBYA 1AURA 4WNAA 4F8EA 2F3SA 4Q4LA 4ZZ1A 2QX7A 3ER8A 5FLXA 1TCAA 5CH3A 3V33A 2BE9A 1DI0A 2J33A 1I94B 4XM1A 2C95A 5ECWA 3ZHYA 2ZI4A 2PGDA 1URPA 3BWEA 4QA9A 5H0IA 1YZVA 4DKJA 1MR3F 1NNSA 3UBTA 2MTBA 1AQLA 2PWYA 2Q07A 1E59A 3ASVA 4FX2A 2GEFA 3MJSA 3KVYA 4N82A 4RVNA 5EUQB 5T57A 1QNFA 2AUNA 3BXEA 1LEHA 5DFAA 1UXKA 1COZA 4UM7A 3WRWA 1E99A 1HURA 2P6UA 4MUGA 3MWJA 2J9XB 4YJGB 2G0TA 2LD4A 4LX8A 2FZVA 2EQAA 1ZD2P 3PPIA 4P58A 1TO2E 1Z13A 2CUNA 2R96A 3L7IA 5K3DA 1UJ2A 5C3UA 4DMFA 1KK3A 1N1MA 2QVCA 3H1BA 1XTZA 3NCHA 4TV8A 5CFRA 3O8OB 1CR4A 4YALA 1VLQA 2BGKA 3AYXB 4LRYA 2G25A 2NUBA 4M22A 3BRWA 3TKAA 3K0HA 1V25A 3ESZA 1KO4A 2CYCA 3NIFB 3TZBA 2H0RA 2I5PO 4CF3A 1PAUA 2ZYSA 3AJDA 1YUBA 5CHYA 3ZQ4A 1ZD1A 4PSKA 5IANA 3OEHD 4C3OB 8LDHA 4D3YA 2QBYB 3QY0A 3A28A 4Z7QB 3SCZA 1M1XB 1YR8A 2ZR8A 4Q9AA 1NU8A 2C0CA 4JL5A 3VYWA 5LQAA 2NU6A 1HQCA 4YDSA 3LH5A 2XNHA 4BHTA 2X15A 1R0ZA 1NJ8A 4P3XA 5HE8A 3DP9A 3H97A 1TIBA 3VU1A 4Y2YA 5KQLA 1YCGA 2HA3A 2GYVA 3I2GA 1XXHA 2NIPA 3F6BX 1CFJA 4XFJA 4X1IA 5FJJA 3DDHA 1ISMA 2C3PA 2WWYA 2FLWA 1SD2A 3NBYC 4IWYA 1G0NA 4AO6A 3EIXA 3P5SA 1XXHE 4WH0A 1M2EA 1NNLA 3D6FA 2ZTLA 4Q3DA 5FQOA 3SLGA 1ZOIA 1R00A 1NW8A 1DWUA 4ESEA 1LLDA 1Y1RA 1Z8FA 2ZTSA 4OM8A 3ITDA 2ZDGA 2PZEA 3O3OB 4U39A 1KE1A 3V7FA 5LM3A 2GF2A 4AY6A 1IY8A 1DTWA 2JAOA 3A6GA 3M6LA 4OBBA 2X42A 1L5OA 2NX2A 3VHXA 1J97A 4TRMA 1KBQA 4CR7A 2VPZA 3EUWA 1A9RA 2DXIA 2CMFA 3IUEA 4MV5A 3KPUA 2X58A 2ZWIA 2LDBA 3KXIA 4OQLA 1SXQA 3MCTA 4GRAA 4U6QA 3JALA 4RADA 1P1KA 5E3HA 5JUWA 1Z82A 3QELB 4N65A 5KNLA 3R7DA 3KYDB 4AJ2A 1L4FA 2KBEA 1ZBQA 1XEWY 4FC7A 5IWAB 3COJA 5KOYA 3CUVA 3LF1A 3QU5A 2FG6C 3ERCA 2C94A 4FE4A 4J0EA 4S35A 3AEKA 4IJVA 3N58A 4XWGA 1SVSA 2A0KA 2XPCA 1ULHA 4V38A 5EHIA 4UVEA 1SULA 2EF0A 5E2IA 3BE5A 1JDSA 1LPAB 3O82A 5J4HA 1LWNA 1D9ZA 1ZG3A 1HRDA 1KY3A 1VSUA 4KH0A 2YXLA 5BMOA 4RVFA 1G2OA 1Y4DE 4WRRA 4UCQA 4TTVA 1UT5A 5JI3E 5IAJA 3EQZA 5BT9A 4CEIB 1E1MA 2XRZA 1QHYA 1X6VA 1ULUA 2DT8A 2RBEA 3M6UA 2ZBFA 2WG0A 1V71A 3G89A 1NRJB 1PD1A 4D4LA 4DVGA 2XLCA 2MDTA 1XJ0A 3C70A 3DMNA 1TKAA 1T4GA 3U7EB 3FMVA 1GL3A 2A94A 2B7BA 3FHOA 4X61A 4CT0A 1U65A 4XWWA 2QZ9A 4JUCA 1CR1A 3D6MA 5CLLA 4YFYA 3ROEA 4TN1A 3ZY6A 4A1FA 5ES4B 5B1IA 5G4KB 5CXSA 4HX5A 4RC9A 3LLVA 4WACA 1WY7A 1IHYA 1WMFA 3AJAA 1MIOB 3BRQA 4QODA 4QECA 5TQVA 1FDIA 5E2AA 1ESEA 2A2ZA 4JCCA 1T9GR 3QEJA 2C1ZA 4L9AA 4UXJA 4BO6A 1TTTA 1X94A 1QIJA 1SXJC 2ODNA 2AL7A 3G8DA 4FCWA 4CIVA 2ZYTX 3TG8A 1Z12A 2M6KA 1V7CA 4S1PA 2J0UB 3IMCA 4A0RA 2NVBA 1M1ZA 4LWPA 4GZ3A 1QRRA 3GOHA 3ZW7A 4YV1A 3OPVA 5DE3A 1YR3A 5CBPA 2H7CA 1E9DA 2HHJA 2OK7A 4JSTA 4WCFA 2PSDA 3GCZA 4GI7A 2IP4A 3IO3A 2WF7A 3D59A 4PCAA 1C7QA 1PX2A 1ORTA 2BV3A 2FE4A 3VR1A 4EW3A 4C76A 3QMWA 1ZD3A 2NZ2A 3A6HA 3KSDO 2XMDA 3QI2A 4DSNA 2V6GA 5FTWA 5ELXA 3MS4A 3LL4A 1TTPB 1SRQA 5AVQA 2C2YA 5ALJA 4W1SA 3OT1A 1B3BA 2O2GA 3FPKA 1XRRA 1E2GA 1MAWA 3AUAA 1HNXB 1QS0A 2Y2UA 4L4YA 3VO9A 2YUTA 2EKZA 2F9MA 2I8LA 3CINA 1QFXA 1ISIA 1GZ6A 1MV8A 4Q9NA 4L2IA 3LUKA 3A26A 2JAQA 1GNVA 3QOFA 1XMIA 5B4VA 2OCLA 3HFJA 1I5OA 2XT6A 2WINI 2AWOA 2IIVA 4TSFD 3EDRA 2AFHB 2DCMA 3S8MA 2C57A 1FE8A 1Y9EA 1L7DA 3CLSC 4UARA 1G3MA 1Q7GA 3D6TB 3M3PA 1AQIA 1GUZA 1XJWA 1VKNA 2IE0A 2VQ3A 1SGWA 1YXMA 2A0YA 3GRUA 4DJJA 5ICSA 2IYYA 4E7OA 1VE3A 4IG9A 1KDVA 4KXWA 5CFNA 1UJ6A 4UJ3A 1KEEB 5AJHA 2FQXA 3KC2A 3L0DA 1O8CA 3EE6A 4B7UA 1KSGA 1COWA 4FDTA 5GWXA 4DABA 2XMQA 3EZ2A 2RC6A 2WU1A 1YHYA 1SB9A 4RV5A 4HFJA 3J7TA 3HFSA 2ZANA 3B2QA 3WLTA 3MS7A 4BNUA 5T41A 2I3AA 4A16A 4QDUA 5CYPA 1QRSA 1XVTA 1PTJA 3SHFA 1NLFA 1Z4OA 4QGGA 4FT2A 2W0SA 2BF7A 3HVJA 5DTMA 5KTRA 5KYTA 1NM5C 3NHZA 2ACEA 4WEOA 3RRYA 4JU8A 3GLUA 2Y1OA 4JZYA 1NBME 3BB4A 3WYFA 5HOEA 1DUIA 1TADA 2MYTA 5ALNA 3ZHBA 2G8NA 2I80A 1T1EA 3O83A 3OJOA 1IHDA 3OKPA 4MYCA 4UJ5A 4DPLA 3F67A 5LLDA 1PJZA 5CJPA 3T9BA 3OP1A 4IR7A 1LRJA 1OLXB 1OX4B 1Q84A 1TUEA 2WZBA 3MGAA 4MVJM 4UE3S 3OLVA 3ZH9B 3C15C 4DV2B 1QGYA 1MVLA 3G79A 3U39A 4H6PA 4DDHA 1QAQA 3C3XA 1CX9B 4WSOA 1P19A 5C8ZA 3I0MA 3A0RB 1ONBA 4EHDA 1B6TA 5JARA 4FGWA 1AUQA 3AR5A 2CMGA 3HJAA 4GGPA 1ZQ1A 2X5NA 1HT0A 3N6XA 1DKQA 5FPSA 2R47A 3BTSA 3BMNB 2XXAB 3MW8A 3I6BA 1JNXX 2ECOA 4IDAA 4BLRA 1UKZA 4ZCQA 3AP3A 2JVKA 2OCGA 4KPGA 5AKHA 4A8PA 3W5CA 3RAFC 2O54A 2A1UB 3OF2A 1PQPA 1CUIA 2CKMA 3BMOB 4GMGA 1W4RA 1EH5A 1QGDA 4GR4A 4L8GA 4NU0A 3WDMA 3ZCTA 1M2KA 5FBQB 621PA 1WD7A 1AZLA 1K5GA 3CW9A 1V1RA 1O96B 2NU7A 2XSZD 3AIMA 2OTCA 3MTQA 3NYIA 4J0FA 4P98A 1DX6A 5C51B 3CRMA 4AYXA 3WKCA 4URXR 3H2KA 3IE1A 1AZTA 3V1MA 3UB3A 1PJQA 2FFJA 3P96A 2P5SA 4TMVA 2RGAA 3EZNA 3AETA 3UWKA 3V4FA 2Z6UA 2H4WA 1ZZGA 3VAAA 2E1RA 3SM9A 2HWYA 2I2WA 2PGOA 1RXYA 5AYVA 3AUXA 5PNTA 3UWMA 5MF6A 1R4NA 3STWA 3GJ7A 3V2GA 2VP0A 3ZBPA 5JBNA 4BFSA 2FUG6 3TEFA 2C8KA 1NJ2A 3OUZA 3WHIA 1CRWG 3B36A 2A35A 1PFVA 3NP9A 3CKYA 3QSGA 3L84A 3R0JA 5H83A 2GK7A 1G63A 4B6OA 3TNJA 2WZQA 3VH2A 4NDZA 2CLSA 3H13A 3V9AA 1JDPA 4JEUA 2CLDX 2DP4E 2IIPA 3R8CA 1AS2A 4OQEA 3KKQA 3R1IA 1E6KA 2RHGB 1JFFA 3JW8A 2CXTA 2XNDA 4IVQA 2CD7A 3DE1X 2VTBA 3COSA 4FYJA 2JCBA 2GN9A 5I7HA 2W4QA 4S2EA 4JASB 4FZVA 3R7BA 1JU3A 5IC4A 1CULC 2IYFA 3JVDA 1J00A 1W5FA 3DTVB 2EKDA 4FGJA 4UTOA 2G1PA 3GARA 5EXXA 1IJEA 4PLVA 1JHYA 4PCUA 4W9RA 3TBKA 5A5VA 2Q5OA 1Y8AA 4CN8A 2FR1A 4B45A 3V7NA 1TX4B 1G6KA 2O6HA 1JQAA 4QELA 4BLWA 4PO8A 3S2SA 2A0XA 2BIFA 2W2KB 4D97A 5KEIA 3FBTA 2YXEA 4JXXA 4P3NA 1GT91 4KUHA 1UBGA 4EEXA 4GM4A 1HORA 4JVSB 1W88A 1Y98A 2VKQA 1GO2A 1X1BA 4HDOB 4K03A 3O21A 4Q03A 2I6QA 2D0OB 1NULA 3H6KA 4UQLA 2HV8A 4O4JB 5CW1A 1ZCBA 3PD0A 5AJTA 1T36B 1OH7A 3FMFA 2I54A 4ZVVA 4D46A 3M9WA 1V37A 3ZQKA 3K94A 2NU8B 4E3ZA 3RC7A 3VAZA 1RYDA 3VYSB 3IVAA 1MJNA 5EHGA 1PLLA 3D0OA 3PWSA 5F2EA 3UGKA 1KO5A 4WUTA 3GLFB 4E32A 3SOPA 1MAVA 3ETGA 4FWIB 4LHVA 4A0SA 3B5JA 1U6KA 4OBEA 4U5XA 5FI5A 3ZCVA 1MX9A 1RCTE 2O7SA 3X43A 2WWWA 4GHWA 2QQ5A 3NVAA 3P0EA 3NHWA 4TPKA 5AJYA 1QV6A 2D1TA 3SHOA 5HR5A 3LRPA 2RC5A 1G21A 3NMUF 2NO5A 3BX1A 4FYVA 4BE4A 1C5KA 1GPAA 1NOIA 4N6GA 4D45A 1POWA 1JLRA 1UZLA 1EWYA 3DE3X 4KQGA 3VH3A 3W7VA 3I5XA 5CDGA 1WQ3A 1RP1A 2H5IA 1G21E 1OJLA 2J6HA 2VDOB 2V7EA 1PUXA 2W2LD 4XYEA 3VHLB 4CFSA 4CM6A 1IBLB 2EWWA 3ZDAA 1DAHA 5SICE 2ASEA 3AF1A 1N7IA 1U3UA 3I6IA 3AINA 3OTOB 5AICA 1PFQA 2CFRA 1QLWA 1XEXA 4KN8A 5GZ6A 4XWKA 5KOHA 3QNUA 3RCBA 2VLBA 3P2IA 3QSYA 2FK7A 5ABPA 2AJ8A 4YV2A 1HT1E 5BSKA 4RD2A 3LXRA 3LO8A 5LZ5A 5MN4A 1JQEA 2HZ7A 2F3TA 4YLGA 5ILGA 5JV5A 1QO9A 1UJCA 2GBGA 3A3KA 1ODKA 5KSZA 1TGVA 2ENWA 2LGJA 1BROA 2K2QB 4K9PA 4WLFA 1Z0AA 3KZ1E 3W8FA 1GZSA 3NBMA 1GITA 5KJEA 4OHFA 4BX2A 3UIEA 3NKLA 2H2HA 1JKXA 2BFAA 3CR7A 4V0SA 3PNQA 2KJQA 4M49A 2OCYC 3B53X 1GEGA 5A4IS 3KV1A 4FOSA 5KNCD 1NKTA 3OI7A 2V8BA 3PCRB 4QOHA 5T4BA 3FPCA 4CQLA 1BJRE 5EQDA 4U7GA 4EPXA 3R6GA 1YQ9A 3OZ7A 4EGQA 4XVUA 1CT9A 3AR4A 3SXJA 2WHQA 3KCNA 2VNHA 5K8JB 3V4RA 3WL8A 3G9QA 1JPJA 1NVFA 3DZCA 5LA6F 3WRYC 3T54A 1K8XB 2DQZA 3D0QA 4EKEA 3PGLA 4RFSB 3A0UA 1A5AB 4PSVA 3JAMA 1V2GA 2CL7X 2FSPA 4O3MA 4IBOA 5EWLB 6CHYA 5BWOA 1ZJWA 1SBTA 2OV3A 3GNQA 3V8VA 3K9GA 2GILA 3WBKA 3QIAA 1FYEA 2BUAA 2YMPA 1KI6A 1FTQA 1NJ6A 2H59A 2WUVA 4LVNA 3BK7A 3UJNA 3KAQA 4HRVA 1U4NA 2FP4B 4JP5A 2GESA 3H9JA 4IIJB 1ZLXA 2O1XA 3F49S 3F90A 5KU7A 2OB1A 4Q1EA 5DHFA 2OKCA 1C29B 4ALIA 1GCIA 1MJGM 3BTUA 4MV1A 1XA3A 3MBIA 4JBGA 4Q9DA 3F7OA 1X7HA 1EVZA 3HUFA 3PRJA 1N8SA 2V6FA 5B30A 3LK6A 3OMLA 1X80B 2JFFA 3G0IA 1U0HC 4L5CA 3PDWA 5BO5A 3RRNA 5A0FA 3TSWA 4BN5A 4CR8A 3FX2A 3IAFA 3FZGA 4UQOA 2DOKA 4Q02A 2G71A 1ZK1A 4AFNA 2UUBB 3ZD7A 2Q5EA 4LDPA 4BP9A 3F8SA 3GNTA 3ROPA 1L7OA 2RKWA 3NUGA 3A70A 1F8FA 3MMPA 3SMVA 3WMGA 3NHRA 4XVHA 2FF5A 1A9SA 3FIJA 4C87A 3E7DA 3EGOA 4HSEA 1V8ZA 1Q0PA 4FFDA 4I5IA 4AG6A 2EQBA 2HHCA 2WHYA 3GOQA 5I9TA 3F46A 4FYMA 1BX1A 3P52A 1RMYA 3GWZA 5EXSA 4WLEA 3VSEA 4XD2A 2O14A 1H2WA 1PR1A 1YKGA 1RYNA 4DWJA 3ONWA 1Z75A 1H2EA 4YRTA 3GMTA 1FJGB 3OWHA 3SIWA 2I3ZA 3SKVA 3I76A 1YS4A 2JH3A 3NV9A 4TT3A 5CFOA 5I4KA 4KDRA 1GN9A 3O91A 4M8SA 2KM1A 2P2CA 3FR8A 3ZY5A 3SVTA 4GRDA 4M0KA 4NU6A 3UAOA 5HKAA 2G4LA 2AOXA 4TT8A 2BHNA 3G23A 3I58A 1B4DA 2BTQB 3R4VA 5JSYA 1BWRA 5A4KA 2O2YA 3EGEA 1W85A 4WERA 4O0MA 4PBRA 1O97D 2IOFA 2Q99A 4CDMA 4NZNA 3BRCA 2Q2WA 3PWZA 1UDXA 3IMKA 3R6TA 2GEJA 3I37X 1FIUA 4KODA 2HJSA 4GUAA 3HPQA 3WADA 2ZW9A 3HDHA 2C5FA 2H1HA 1CJVC 4Q39A 4IGFA 3CVYA 4MTLA 3KLPX 2KW5A 1G42A 2GB4A 2ZJAA 3LX4A 3WNZA 3X3HA 3ZGXA 3HHPA 2J46A 3L4BC 4RS3A 4CM8A 1US8A 5LWHA 4GPIB 4MUAA 2YDYA 1NKSA 3EBPA 1YRWA 1X19A 1JAHA 3O9ZA 5BXQC 3ZZMA 1Z4KA 1UQTA 4OB8A 3EY4A 3BDVA 4MS3B 3S7ZA 1QGZA 3ZI4A 4JBWA 1WSDA 2R9VA 2RJNA 3EIEA 5J9FA 5BQ5A 2NMVA 1ML3A 1VMEA 1HL3A 2FDRA 4E30A 7REQA 3QU2A 4JA0A 4Y1RB 4UNIA 3LUAA 5THQA 4JNKA 3W04A 2V97A 1LF0A 3DWIA 4YR7A 2YJTD 3WGHA 4DCJA 5DNEA 5EVJA 3TRHA 1JHQA 1VKRA 4B46A 4ZOBA 2GAJA 1XZKA 4PPGA 2Y6UA 2PIDA 3ICOA 4B35A 3BSYA 4UD6A 2EEZA 2NT3A 5KYVA 2R5FA 3HU1A 4ZO4A 2X40A 3OU7A 3W5JA 2CV1A 3FI9A 1NKVA 1EQ2A 2R8BA 1GLNA 1D2CA 1Y0BA 1IHUA 3AY7A 5CP8A 3FNQA 4DR3B 1TYAE 4TVBA 4L7QA 4ND8B 3BGIA 3STTA 4U7DA 1PNTA 1WY5A 4DQXA 1V6SA 2G06A 1NVVR 3MUOA 1E4OA 1N2XA 2PEYA 4FQ5A 2G72A 3CO5A 4XJTA 4FFRA 3R3XA 3V48A 1N6PA 2OZPA 5HJ7A 4FZJA 1T8UA 5IMSA 2NPIA 3HJTA 2BELA 3K6JA 1I0LA 4CQMB 1D2NA 5IFKA 3RC8A 3AVUA 1KI2A 2VRCA 3M6AA 4WXPA 2GCOB 3THSA 3WLQA 1ZESA 3INGA 3V2UA 2GJAA 2K4MA 4Q01A 3IBYA 3KZMA 4CIXA 5LKRA 3PS9A 2I7DA 5LLTA 5EKUA 3ZKAA 4MGEA 1G6HA 2QRKA 5DKFA 3R2JA 5JZBA 1CQPA 4Q6WA 4TX1A 1I3LA 4H6WA 2H0QA 1UQUA 1I13A 4XA8A