3L40A

Crystal structure of s. pombe brc1 brct5-brct6 domains
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
b'TNAKASKRVYITFTGYDKKPSIDNLKKLDMSITSNPSKCTHLIAPRILRTSKFLCSIPYGPCVVTMDWINSCLKTHEIVDEEPYLLNDPEKELELGCTLESALKRARAQGPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKRLARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTIFLQNYDWLIKTVLRQEIDVNDRIADEFAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BRCT-containing protein 1
molecule tags Cell cycle
source organism Schizosaccharomyces pombe
publication title gammaH2A binds Brc1 to maintain genome integrity during S-phase.
pubmed doi rcsb
total genus 72
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l40A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l40A02
3PC8A 3AL2A 4BMCA 3AL3A 2COKA 1T2UA 3QVGB 3PD7A 3K0KA 3QVGA 4IFIA 3COJA 2ETXA 3PC6A 3HUEA 1T15A 2D8MA 3K15A 4BMDA 3EF0A 3SHTA 3PXBA 2K6GA 3PXCX 1T29A 4OFBA 2E2WA 2DUNA 2XNKA 4IGKA 2JW5A 1L7BA 3L41A 1T2VA 3T7JA 4BU1A 3L46A 1IN1A 4BU0A 2EBUA 3EF1A 2COEA 3I0MA 3HUFA 4N40A 5ECGC 2XNHA 3UENA 3SQDA 2K7FA 1WF6A 3SZMA 2NTEA 2M2IA 3KTFA 3T1NA 1Y98A 3PC7A 2AZMA 1GZHB 3PXEA 4Y2GA 2L42A 3L40A 1KZYC 1OQAA 3SHVA 3T7IA 3K05A 4U4AA 3PC8C 4Y18A 2WT8A 1N5OX 3PA6A 1Z56C 2ADOA 2VXCA 3T7KA 2INGX 2COUA 3K16A 4JLUA 3I0NA 1L0BA 3U3ZA 2R1ZA 2HTFA 4ID3A 4XPZA 3K0HA 3JVEA 1JNXX 3FA2A 2LE0A 1IMOA 2EBWA 2EP8A 3OLCX 4XQ0A 1CDZA 2VXBA 3UEOA 3II6X 3PXAA 3PXDA
chains in the Genus database with same CATH superfamily
3EPHA 3IEXA 1TRHA 4D26A 3L8DA 2WNSA 4R01A 5E1OA 2E37A 4BGEA 2POQX 1T2UA 2Q3MA 1NBWB 1UPCA 2ZJ2A 4DTCA 4UKDA 3PENA 1RXVA 4M0KA 2ZT6A 1OI4A 5L4SA 1Z0IA 2XIQA 1GGFA 1PYGA 3DXYA 3HR7A 5L3VA 4GZ6A 2VNIA 1FRNA 3L8FA 3O83A 2QAIA 3B82A 3GRFA 3CPEA 2H7CA 3AUSA 4C3UA 2FPPB 1ONNA 3EBPA 2Z98A 3GJ8A 3WGGA 1KQNA 2K6GA 1X1CA 2AJ8A 3G0HA 1G2OA 1TYAE 3K5IA 4I3HA 4EAAA 2PUHA 3HP4A 5CT5A 1C4WA 1R37A 5I47A 5JMWA 2EF0A 3FVQA 4MPJA 1P9RA 4D41A 3TLMA 1J8QA 1MC1A 4BNKA 5AI0A 3I6ZA 3OKCA 4DT1A 1OIWA 3G9XA 3W6NA 4BMNA 3UJAA 4RHTA 3C7DB 2ZANA 2WINI 4IUBS 2QUKA 3ZWBA 2OMKA 3PWZA 1H0RA 5FUMA 2DLNA 4H1WA 1UPTA 4V0QA 4CV3A 1M83A 4ZDKA 4A2PA 3W9SA 1RZRA 2Y76A 4KBFA 5IAGA 3DEJA 3VVLA 5LFAA 1E8DA 4FEEA 4IO1A 3O74A 3R6WA 5A9TA 5TQ2A 3LW7A 4UE2A 1ZR4A 1P4JA 2QRQA 4PINA 1N5DA 5LXTB 4O1IA 3SI7A 1QRRA 2LKDA 2ZRAA 2Q0HA 1F4PA 3HJTA 2G9VA 3PCRB 1XCBA 4X6YA 1EX9A 1F8GA 3OTGA 2FG6C 4EZIA 4ED9A 2GN1A 1I14A 3EMVA 1YI8A 3NUZA 4L4ZA 4PQFA 5IEBA 1NAIA 3TAHA 1VLQA 2WRZA 1CR0A 2KHZA 3IIKA 3AWIA 4QQFA 3WLJA 4EZEA 2X8JA 4FS3A 3ANSA 3NLLA 3SM3A 2EW1A 3ZE2B 3KSBC 2PO7A 2VDNB 4II2A 3EXAA 2QM7A 5FNVB 1TFUA 2X5OA 2CE2X 3QIVA 3ZLJA 1FQKA 1F1JA 3TIGA 2D06A 4O59O 1I4TD 4KU4A 5KIAA 5KREA 2IW3A 2JD2A 3FN4A 3CKYA 2PUBA 4KR6A 2G09A 1L5FA 3RSHA 4WNYA 5AD1A 4PGMA 4C2UA 3FPEA 3KHUA 4CDGA 2JHPA 4GOND 5EGSA 3TRKA 3WYBA 2I7DA 2YJ5A 4GMFA 4C05A 1X9IA 4EG8A 1V3VA 3WHLA 2VHYA 1E9CA 5A5FA 3U4DA 3K53A 1F12A 1YULA 2B1IA 3C7KA 1SHZA 3PXAA 5DGIA 1ZC3A 2TMYA 3K0HA 4FZVA 5LP6C 4FGUA 3ZY2A 4X60A 4FB4A 5CVTA 3I6IA 1JEYB 1L4YA 1LPBB 1QDEA 2EGUA 3P2IA 4RS4A 4G8CA 2JZCA 2CYAA 4US2R 1UFKA 4JLSA 3QE2A 3ZE0B 3I32A 1LDEA 4JQCA 4CM9A 1JE1A 4R7ZA 3C6ZA 4AJHA 5LUAA 1CHNA 4D0NA 5JPCA 3P52A 5LOVB 2XADA 2NU7B 2PZMA 2OD2A 3O3NB 1FUEA 1FUUA 3ODGA 4FMCB 4HGNA 2PSJA 4LWQA 2HUPA 3W5SA 4BC0A 3AHHA 1N2CE 4WY5A 3M5CA 4NBKA 4J91A 4JYPA 1RQ7A 3VA7A 1U3FA 1Q0RA 2LIPA 3K9BA 4N39A 3T35A 3H1PA 4RK7A 1R7RA 4CHTA 1L7QA 1SR8A 2YYAA 4DC1A 2IQIA 5JAHA 2CD7A 3DPSA 5I7FA 2IYOA 5KYYA 1FC0A 4MX8A 3BMOA 4NTZA 4HEHA 3JQRA 1TZMA 2Z04A 4R9NA 4MAFA 4PZEA 3ZOKA 4G6ZA 5JYCA 1PK7A 2OR3A 5FR2A 1V2HE 1XZQA 4I46A 1PR1A 3NDJA 3UHFA 4MQUA 2QJOA 1KY3A 3GLFA 5KYGA 3A1VA 1OKKA 4DQDA 3BB1A 3I1IA 3M6UA 4B1FA 1SIWA 5CLLA 2B4AA 1I4WA 2XNKA 3FMPB 1A04A 5IYZF 4DWWA 1UFVA 1WZUA 3HCPA 4QXAA 4DA6A 4FBGA 4B3XA 4PZYA 3MLAA 4F71A 3AO0B 8OHMA 4CDMA 1TLFA 1TX4B 1WJGA 3DDCA 4JHXA 3OLYA 4C04A 5H4GA 2ASEA 3EN0A 3KAJA 1L8QA 3DKIA 1QUEA 3E70C 4H0NA 4P38A 3WOHA 1IHXA 1XQ1A 3UAWA 3OFKA 5K8VA 2QM0A 3H3JA 1KS2A 1M33A 4J43A 3FSRA 2NACA 4M1QA 2BEUA 3V1LA 1KK0A 5FP0A 3VVBA 1OWLA 2RCYA 3P2YA 4EBBA 4X91A 1PGOA 1ZIPA 5JLAA 2WDPA 3NCTA 4OHMA 2HHCA 3OURA 1RXYA 2WUEA 5EMHA 4CCAA 2Y27A 2Z8YM 2H9AA 3ETLA 3HJRA 1BW9A 4JELA 3FX2A 1QOQB 4IICA 5DJ5A 1KVUA 1T6BY 4I4TA 5EAIA 1PUJA 4JUDX 2QR5A 1U7XA 2BR3A 3NHAA 3NWBA 3UT5B 3L40A 1JQ5A 4I1IA 4CUKA 1BHQ1 1VSVA 1B73A 1PDOA 4EO9A 2IZ0A 3B3FA 3A1FA 3N0TA 4NU8X 4PAGA 4EY6A 1WB4A 2EAUA 2FQ1A 3FOWA 1UK6A 3VOAA 4KG7A 5A2GA 2VVTA 1RYYA 4LN1A 5HJ2A 4RA6B 3R0ZA 4LY6A 3OTIA 1YKFA 1E69A 1WB5A 4HOYA 4LYDA 3RG8A 2FP3A 4TSKA 5JFTA 5L8VA 1SUEA 4GKBA 1D2NA 1RABA 4BCBA 4KFRA 3V48A 1QAQA 3C3AA 4LI3X 4P1ZA 1CU1A 3ZS9A 3L0CA 4EUNA 3ZHBA 4D7AA 4DF3A 1NM5A 1KRHA 1EAMA 1VJTA 1FFHA 2PXCA 3WL5A 3ABRB 1GQRA 4I14A 3L7IA 3QBDA 5ALJA 5LKRA 1DC8A 1OKKD 4I9UA 2P9EA 1KZ7B 4LS3A 5GOZA 4MW1A 1PLJA 4O4LB 4UTVA 2R6JA 3M33A 1X1RA 5JQWA 3MAGA 5HMMA 3GG9A 3LUKA 4YP7A 2ACEA 2B78A 5EE3A 4BP9A 5K8LA 2JKVA 4BQSA 4I6JA 1QHFA 3S40A 3WAJA 2JKZA 1U5CA 1WULS 3LW8A 3A9WA 2WVGA 3OKPA 3QOYA 2ZWPA 2AFHA 1T8YA 2BJWA 5JVDF 2H29A 3GGOA 4B4WA 5H70A 2KE5A 5H3HA 5LZ7A 1ZU5A 1IVSA 4L08A 4JGGA 3K72B 5KYXB 3IUPA 4M3NA 4BVLA 4Z7NB 1DRJA 1UWVA 2OZPA 2VNHA 3NXKA 3OFSA 3PPYA 5SY4A 5IC4A 3O8BA 5IRCD 1TYZA 4RLHA 2OP1A 3MELA 2YWFA 1N1EA 4X7BA 3U3RA 3KDAA 3ADCA 1QFYA 1YCFA 3VU8A 3C41J 3U2QA 2QMOA 1ZD9A 4OL9A 4QBGB 5F73A 3IKMB 3IIIA 4P4GA 1B2LA 5LCXA 4UC0A 4H4EA 1ZS9A 2YZ2A 1XL0A 3M83A 3BGWA 3QI2A 4URFA 2QLBA 3FCCA 3RIEA 1L5GB 3TW8A 1KZHA 3VV3A 1ZM3A 4J2OA 4A27A 4AZ0A 4CU5A 1B42A 2Y1WA 4Z54A 3ZVRA 4ZJPA 1WUTA 4ZMBA 1JEQB 4LI0A 2OK8A 2G9QA 2VPIA 2GEDA 4BO6A 4JZYA 4H7PA 5AO9A 3T3DA 1KIFA 5DNEA 4LZNA 4CEHB 5KO2A 3OLZA 4Q66C 1L5LA 3OOJA 5ALOA 3LUHA 1YR6A 3I23A 3VU0A 2GBFA 3C4VA 2GK4A 1V5FA 2P5YA 3LUAA 5CA1A 2K7FA 1DFIA 2VBCA 4QO8A 5JU6A 2FGJA 4N8DA 2WIBA 2JCSA 4Q48A 1Y82A 2FSVA 3AI2A 3B5IA 2NVOA 3H1EA 3UH0A 2X7XA 5FBQB 3EISA 2IIPA 4J1TA 4A0SA 4MITA 2LNDA 4PG4A 1AA6A 4REOA 5JW6A 1H0HA 4N12A 4ZJYA 1O94C 2PJDA 3DMNA 3LKBA 5M5BA 2WJ6A 2KM1A 4RMGA 2JLUA 1Z0UA 4DIUA 1RJGA 2CNBA 3N0WA 5C37A 2QLFA 3EZXA 2BISA 2CXXA 2FSHA 1XT6A 3QFFA 3HBLA 1C3XA 4B7XA 1OTHA 2XWSA 4CIYA 3NT2A 1Q92A 1FB5A 3DMTC 4M6WA 1V3TA 3ILYA 3Q7SA 4BX2A 2I3AA 2HTEA 4V38A 3VSAA 1JA9A 1SQGA 4KWIA 5HSGA 3BXHA 3PRHA 5EHIA 2WHPA 4ZCIA 4JDPA 5EJ8A 2C7PA 2FTKE 5FBRB 2UAGA 1WPXA 2DEUA 1EHIA 4AROA 1CY1A 4EUEA 1R4ZA 1XP5A 4ZDJA 2PANA 2JGKA 5K3SA 2ZTMA 5TS3A 3RKRA 4LJLA 2AFIB 1PN3A 1SCNE 2Z8ZA 4HI0E 2J9XB 2OLJA 1G9SA 3T3PB 2IHNA 4L6IA 2EKLA 4YP5A 3UUWA 4RJJA 5JXIA 4HYQA 2V6IA 3L06A 1T8SA 3UH1A 2WIKA 1EXWA 2ZIXB 1W35A 4EX6A 1BRTA 3ZV4A 1YF3A 3IESA 4RJLA 3BXZA 3ADPA 3G2LA 1MORA 3WDSA 5FDFA 1GN9A 5HZMA 4GUDA 4ZC1A 4C76A 4D97A 1TQDA 5CLIA 1JEAA 5TGZA 3TDKA 1HFWA 1TK9A 3WLTA 1AGPA 3MUNA 5FYDA 1PSWA 4B3DA 1S1MA 3GU3A 3ZI0A 1SU4A 2AEMA 2PX6A 1B76A 3B70A 4QUEA 5E9AA 2YW9A 3D64A 4RHUA 5LQKA 2HWYA 2IYNA 5IUJC 2VWHA 3O2SB 2H59A 2Y68A 4PZ9A 1VPWA 1FMFA 2AG6A 3DHYA 4EGAA 1MN6A 1DAHA 3CXRA 3KR1A 4UAGA 3B6ZA 6ADHA 4H6VA 4NARA 1KPGA 4U7HA 1LTKA 3LUGA 1LVGA 2H8KA 2FW0A 2IWHA 1FVXA 1Z75A 2DWCA 3GPLA 1EHCA 2D8MA 1RLIA 2GR9A 4LJRA 3HGTA 1KYWA 4BLVA 4X6UA 2HSEA 4QZVA 3MGAA 4I4TB 2GFQA 1KZ6A 5BWCA 2ZZNA 1B1CA 3F6BX 4JJEA 1W49A 4UUNA 4OQLA 4C4ZA 3QX8A 1WXXA 3BZUA 2H52A 4IIYA 1G8SA 4XX1A 2QTHA 3IA7A 3TCKA 3FKSD 3R5XA 1Z68A 1C3LA 2JLYA 3H6GA 1VCNA 2E48A 1FFYA 1XCPA 1JV2B 5L53A 5CT4A 1Y1LA 2AQIA 1BMFD 1E2MA 3CONA 4XLLA 2B7CA 2WVAA 4KDRA 3VDXA 2NVUA 1V4BA 3KLMX 4LYAA 5CM2Z 4YCSA 3ZVLA 3KZCA 4K03A 5ITZA 2D6FA 3BULA 4BRWA 1J20A 1S01A 4EGQA 2R79A 4UPDA 4E5PA 1VDMA 4MROA 1G6Q1 5AVOA 1KYVA 2A1UA 5IJWA 1PJTA 1PVOA 4H27A 2GO7A 4P4UA 2WTXA 4PYJA 2RK4A 4RIHA 4OOFA 4TWIA 5FPTA 1U7PA 5CYOA 2W71A 3ICCA 4XB1A 2M2IA 2XDQA 3C97A 4G97A 2XV1A 4H3HB 2PRZA 1YB6A 2GCOA 5A4MS 3THYB 2WABA 3L7AA 1H8EA 4JOQA 4B7CA 1K6IA 4RVFA 3RSZA 2QN8A 2RHCA 3H17A 2Y0EA 3R5JA 4FK8A 4UXHA 1KDPA 1RXIA 4MYTA 2YVLA 4YRIA 1G21E 3GJXC 4E70A 1BA2A 1H2AS 3W6ZA 1NXSA 1P72A 1U28A 2JA1A 1Q0LA 1KDZA 2B20A 4P5DA 5AVXA 3WLEA 1DAGA 2YVAA 1FCJA 4WADA 1R8QA 3TFQA 5E1BA 2J07A 4DEVA 2ONZA 2V4ZA 3UV6A 5CITA 5DTMA 1N2GA 1WDKA 3KL2A 1FLAA 1WOMA 3HE3A 3OQ6A 4MV1A 4AG3A 2AFHB 3F5QA 2Z1DA 2O5EA 1WXWA 2R85A 3U39A 4EG0A 1O0SA 1J49A 3O2QB 5HIJA 1E1MA 4WW0A 4A1FA 3FKJA 1JR4A 2W6QA 3TLXA 4M37A 4DN6A 1T4BA 3FBGA 4YJDA 4EG3A 2CLSA 3HLTA 3C24A 3NJ4A 1REQA 1A2OA 1R0XA 1R9MA 1VXOA 2GARA 2HPVA 2WF9A 1CETA 3NAGA 1SURA 3SQXA 4W5TA 2WSLA 3UAXA 3QEAZ 4B8WA 1VOTA 2ORWA 3UWOA 1OI2A 2FPKA 2ZBVA 1CY2A 1SU8A 1VGVA 4RSMA 4E12A 4FDLA 4EPWA 2EG9A 1JT2A 3D6VA 3IAM1 1I80A 3MYYA 4TMTA 2EP8A 3P0RA 4P7KA 2XLCA 1D4AA 1WNTA 1Z4MA 3F67A 2QRLA 2XB9A 5FBHA 2GF2A 1JQAA 3QKSA 1G3QA 4P33A 3UG7A 2QT1A 4AXXA 3BG5A 5FX2A 1S8FA 4DREA 1DBSA 4IMRA 5ALSA 3ESDA 4I7EA 1D5CA 1DJOA 3P9ZA 2VTKA 2BFBA 5ECDA 3UCFA 1K08A 3VYWA 1R0CA 3LHSA 5I5GA 4B4OA 3L6UA 5DW0A 5ETJA 3ZHCA 3KJQA 4TGLA 3ZUPA 5K99A 5BR7A 1T5LA 1VMAA 2BFAA 2WV9A 3DTVB 3L6OO 5JQGF 3A6KA 1SMKA 2ZE7A 3F3SA 1E62A 4OGKA 4DVJA 3MAAC 2GPSA 1DRKA 1Z33A 4BTVA 1OPXA 1SRRA 4AJEA 3HVIA 1OLOA 1KPIA 1MOZA 1RZUA 3HPQA 4UTPA 2KBEA 3NCHA 1H9BA 4EB3A 5JEDA 2I2AA 4H7KA 3TIIA 4L22A 1CB0A 2M9MA 1DZ3A 3FR7A 3BM5A 4F85A 1XNJA 4WX2B 4ZEOA 1QUFA 1X77A 2GJSA 2HBQA 3IVRA 4R54A 5HJ5A 4DA0A 2WM8A 3F1LA 5JS6A 3CUEF 4IYJA 2Z57A 3L1IA 4FR2A 5FHRA 4MS1B 3NBYC 1F0PA 4DCPA 4YO8A 4X41A 4M1EA 3CV3A 3MS2A 1S2MA 1UDRA 4JS0A 1Q1NA 5EE5B 3JWJA 5H3CA 4LJAA 1JA0A 5IXYA 3EF1A 1XEWX 5DLDA 3GXOA 2FZWA 1R9GA 2ZM5A 1Z8FA 2ZP1A 4HH0A 3CW2A 3IDZA 4FMDF 3ZHUA 4DLPA 4BKUA 1ZRSA 4YR9A 2XNHA 2RHGB 4I9NA 1Z2PX 1DIHA 1Q7TA 1RIFA 2H1RA 1NVDA 2R5FA 1M54A 5G0VA 1T2EA 3I0ZA 3TFWA 2YHBA 3GFBA 3CZPA 4YRDA 4WZAB 5FOQA 3FWKA 1LSUA 4Q00A 5A7GA 4CHGA 1DIBA 4KW7A 2JC3A 1NKTA 4PG6A 4G1VA 4EGSA 1NN1A 5ESDA 2JARA 5E7QA 2HWKA 3OZFA 2PZFA 1OLSB 4NPCA 1QKJA 2CKDA 4QECA 4RD6A 1E63A 5HRCA 2FSGA 4CZ2A 3LQKA 4ABYA 2FPSA 2O8EB 3CISA 3HDQA 2QOEA 4P7FA 4JYBA 3TX6A 1VM6A 4PCLA 4CPDA 2NU9B 3AOEA 1VCOA 5ESRA 5EMMA 4F4UA 4MDEA 3BH6A 1L4MA 2IUUA 4AO6A 3OZIA 1VLMA 3F7NA 3P0HA 4EL5A 3OT1B 2ZAGA 1NYRA 3IUMA 4E30A 2JLXA 4TTTS 1JDUA 3DL4A 4G65A 4G67A 1KI9A 4L9SA 4Z9XA 3TTXA 3UTCA 3V1YA 3GA7A 1M3SA 1NXTA 5JXJA 1NX6A 3F4KA 1KMNA 4IIBA 4PQEA 1Z4NA 3FUTA 3L2OB 1MEEA 1JYEA 5GADl 2IYYA 3GDWA 3HA3A 1NLYA 1TW3A 4J9UE 3WICA 4G24A 3WX0A 4RE5A 5EE0A 3QUBA 2MDTA 1DT3A 1K86A 4YAWA 5JC1A 5KYWB 2II6A 2EC5A 2XUDA 4RL6A 4DDHA 1GGHA 1DBWA 4MYDA 3O91A 1CIPA 1S6YA 4EM6A 1VIYA 2X19A 1KBQA 4D56A 3RFUA 3VKGA 1LKZA 2P6RA 4HRYA 2Y67A 3LRXA 5JAOA 1MB4A 4PHHA 1J7JA 3C3CA 3PQ3A 3RUFA 1MVLA 2IKSA 4OP2A 3B7WA 4NP6A 3QWFA 1P19A 4N7JA 1E6LA 4OLHA 2BTQA 1MO4A 3CH5A 4R9RA 4AKTA 1D6NA 1Z4JA 4PGHA 1ZR2A 4FYPA 3T7CA 3A4TA 4CCSA 1VJ0A 1YB4A 1Z5PA 2Q3JA 2WHRA 3L9WA 4O4JB 1A2KC 1HE4A 4DT1B 1WY7A 3RRFA 4Z99A 1Z12A 4J4HA 4LJ7A 4MV8A 3CZQA 4ZICA 1G8KA 4JVOA 4PEVA 2WWTA 4ALMA 2I4OA 4Q6BA 3JZFA 4NATA 4KYTA 1SXJD 1XO1A 1L5OA 1XRQA 4KK3A 3L0IB 1VHDA 1E1CA 4EW3A 3Q2OA 4GP7A 2BCGY 4U7DA 2O0HA 4IGFA 4UDXX 4YT4A 3WL4A 1K7XB 3L04A 4ZXPA 4JLJA 5REQB 4B33A 4TTIA 1U7TA 2JNWA 1K6EA 1YZNA 3PIIA 3LXMA 4F46A 2X58A 3RRBA 3SC2A 3LU1A 3TNLA 5EL0A 4EATA 1XZBA 2DBYA 3V7YA 4S05A 1XVUA 2PLAA 2YOFA 4XYGA 3DHVA 4BTLA 5CG2A 3LQRA 1YB7A 1VJ1A 2OGSA 2PRJA 1SFRA 3H2JA 3ENQA 3LLVA 4WK6A 2HU7A 4RKFA 1OSNA 2O8DB 4K9OA 4LF5B 2TSYB 1RI5A 1YMUA 3KB6A 1DARA 1TAHA 3MRTA 1Y3BE 3I2YX 5LYYA 1O54A 4GHWA 5I9NA 3RV3A 1C1XA 1E2LA 3I9KA 4I2VA 1I2DA 1KO4A 3D7LA 4B2YA 1NJSA 1TADA 1L5YA 2CXOA 2WPNA 3GRVA 3H16A 5JSFA 4LDRA 5LQRA 1AC5A 1MAHA 1Y9AA 5U4XA 4UFPA 2ROQA 5LSAA 4GD3Q 4H31A 1L2TA 1JJVA 1JS1X 2LVBA 3E05A 1JXOA 3TQFA 4BJHB 3G8YA 2C00A 2MYUA 4YJ3F 1I3KA 3CLSC 4D82A 1ZI8A 3NAQA 4MVJM 1KI3A 1DIOB 4GU5A 4UU8A 3T1YB 1OC4A 1ZK2A 2N46A 3IILA 4L8WB 2C83A 2VF8A 4Q9AA 4QOEA 1H8HA 5ALFA 2CFCA 4RPHA 5JPIA 1GU7A 3QTTA 5JAQA 4NE2A 2FEWB 3I9LA 1UIMA 4U2FA 3V4OA 1G42A 3KYIB 4L8YA 5GGXA 1RRGA 2EGGA 3MWDA 4LEIA 3SS9X 3JSXA 3ELBA 2FN7A 4TQUS 1K3UB 1V48A 5EJ4A 1US8B 1Y1SA 3NC4A 4D8TA 1GJRA 1XRPA 1WMSA 1WU8A 2QZJA 2FOLA 2VBIA 3IGFA 4N5HX 2JK0A 4RQAA 3UMBA 3WS7A 3UZUA 4V0NA 3UK2A 2AG8A 5IW8A 4D8YA 1ND5A 5TR9A 4ENWA 5CP8A 5CEJA 1NR5A 2J5RA 3ZLUA 4RMHA 3D2BA 2P2CA 1EX7A 3X1ZA 3DW1X 2C3UA 2AD5A 5LWQA 1U2EA 3ED1A 2BDUA 2Q5QA 1TM7E 4OL0A 4OOEA 3WL6A 5CIQA 2OO5C 5ARBA 1CR1A 1RI4A 1FRQA 3O9ZA 4TVSA 3BDVA 4U7GA 4EARA 1YDHA 4UU0A 1KNXA 1DJLA 2QM3A 3FPHA 2C03A 2P2SA 3GEBA 3N5CA 3D6TB 1VSQA 1Z37A 1DP4A 1EM8A 3G7UA 1A2BA 2FN4A 1OYVA 1UAGA 3I8OA 4FYKA 4I66A 3HVKA 2EERA 4AM8A 1OXSC 2Q5FA 4DGSA 4RZIA 1Y1PA 3K6SB 2B0JA 3R20A 4EVRA 5G40A 1GG2A 5FPHA 2VDLB 1VMIA 3ANTA 3GDHA 2XYPA 4M98A 2RGXA 4N18A 5TQ0A 4BVHA 4JYZA 5LD2C 3TB4A 2JJ1A 1LQ2A 2P65A 4AKEA 3H4TA 1M34E 2BMJA 3MIIA 2EZ4A 4QUJA 3R7DA 1S3GA 4FQ7A 4OXNA 3MVEA 5FI3A 4G9BA 2CXTA 1ZGZA 3SKXA 2WIDA 2Z0MA 3DAHA 1L5HA 4EKYA 4NICA 5A62A 2AE2A 4F6RB 3R24A 2ZIEA 1GOTA 4O2LA 4RSRA 3PQ2A 4R16A 3S2IA 2J8ZA 1AURA 4J0GA 4YP9A 3ZBPA 3J7TA 1K63A 2QDKA 4X00A 1GQSA 4JLKA 1OYYA 1SVOA 1OLSA 3BSFA 1E7WA 1BDHA 1KH3A 5AQ1A 1MF7A 3NM4A 5IXJA 4IYRA 3RT9A 1CT9A 3NI2A 1GZ6A 2WSSA 4IIFA 4DCGA 1HI9A 1ADFA 1HKHA 3M6WA 4GPTA 3OZRA 4N8EA 3SX0A 1GTG1 1HEUA 1YJXA 2Y1EA 2FW8A 3EXEB 3DV0A 2SNIE 3A14A 1PVVA 3IQFA 3X2FA 2PWYA 5HGXA 4YASA 1MJ5A 4PIVA 1E2DA 2YUIA 2HLPA 3MS4A 1V1MB 1PR5A 2GD2A 1YCHA 1S7GA 3V80A 3BXXA 3MCWA 3P0JA 3K9CA 1QHHA 2ZJYA 3TZQA 3WGLA 4W5RA 2RC5A 4ADSG 4XJVA 5EE9A 3PGXA 3MXTA 4I55F 5HGJA 4KPYA 3R7WA 2FJPA 3L6RA 3LHFA 4KSBA 1RPJA 2XCSB 5GV8A 5JPDA 1Q1EA 1XZMA 4PYLA 3VJMA 2DPGA 1IZ9A 2PUDA 3OM1A 2VEDA 2I55A 5EWJB 4GFDA 1V9LA 2A0WA 2XZPA 4MVJH 1I2BA 3UAYA 2EWMA 3FFXA 5CFQA 1TPZA 3B20A 1QRAA 2QSYA 1PQWA 4W5QA 2QU8A 4MHOA 5JECA 2V8BA 1J7KA 2Y05A 1A9ZA 2L42A 4JSYA 4FIDA 2C99A 3WKBA 5HUHA 4EBFA 1NQTA 3N7AA 3USZA 1P61B 2MYPA 1TA0A 2PTHA 2UV8A 5L7WA 2PIDA 3EUAA 5L51A 2V0CA 4C0SA 2YJTD 4N7BA 3NBUA 3D9QX 3BIOA 1P7VA 2P90A 1LZLA 4LQ4A 1GFSA 2P2ZA 4UMFA 3V8EA 1N4DA 1KIMA 3EDYA 3RUCA 1EDDA 3SFTA 5A9RA 1FFXB 3A2KA 5DTIA 1MLDA 2P91A 3HLYA 4GLBA 4ZJZA 5C53B 1GA1A 3IEUA 3ZXYA 1IMJA 2JGIA 1CRQA 3DGEC 4OEHA 2J09A 4ETNA 3A58B 1ML3A 5CVEA 3NTUA 4ND8A 1ZXXA 2M98A 4JOBA 2WWXA 4G8DA 3F6SA 3HZHA 2JHAA 4MJXA 1ST3A 4H60A 3P9RA 5CT8A 4HQKA 2XUAA 2Z4TA 1EGAA 3Q7EA 4EF6A 3A4VA 2QTGA 1FS6A 1CW2B 1X39A 1XZIA 2MSCB 4R3UC 9GPBA 721PA 5HZGA 1NUAA 1EFVA 2I6GA 4J03A 1YJBA 3UAOA 1SHKA 3ZH9B 3TUZC 4FW9A 4IDAA 1A8IA 4Y1RA 4O3MA 5BWNA 4OYHA 2VUHB 4DNOA 4KNVA 4Y2RA 1KI6B 2JK1A 4FC6A 4X1IB 1K88A 3OU6A 2E55A 1JLLB 4H59A 1JHQA 2G08A 2OLKA 1P1KA 3LKZA 1RAHA 1T6NA 4FXOA 5GVRA 3QYPA 2FSIA 4UZEA 3ZEIA 1YV9A 2FWNA 4Q18A 4QYIA 3D4LA 5EP4A 1WBJB 2C07A 2OBXA 3ZW7A 1J8DA 1N6KA 1XYGA 3ZQ4A 1GKKA 1FXWF 4Z4EA 2CLHB 1RXCA 2VEOA 3CLVA 3M5PA 3N2ZB 1KI6A 3KNZA 4HPWA 4MUIA 4TKLA 2OA0A 1NF9A 2J6BA 4P4NA 2ERCA 5CB4A 3N8NA 4G0UA 4UZSA 1UDBA 3AQ4A 4CTNA 1SCDA 1SUWA 1W34A 2HBRA 4DLXA 3MCZA 1N6IA 1L5MA 3LX5A 3ZLTA 5JT1A 3C98A 3SKVA 4DHEA 3OQJA 5IM5A 1X2BA 5CG1A 1FTSA 1U2DC 4EI7A 4FCTA 2G9NA 1T29A 1CQWA 1KY4A 5ICGA 3TNJA 4JI1B 3SD7A 5C0OE 2ZSBA 1L7AA 1VHQA 2V6JA 1XA4A 2IOFK 3R23A 1K0FA 3EEOA 3U61B 3RTCA 4M89A 4IIXA 2XOEA 3QVLA 1YASA 4JP3A 2AC7A 3DEHA 2QBYA 5LQCA 3LF1A 3PFFA 4LJKA 4QBIA 3ZDXB 1KAHA 2H0AA 1WY5A 2VYVA 1I4OA 2V3WA 2CLFB 2VIIA 2ZYGA 2PLNA 1E60A 3C45A 2W4IA 2WUWE 2QWXA 4N4AA 1F9AA 3A31A 5AW2A 5HPYB 3CSDA 2PDAA 3I73A 3SHQA 3GLHB 4RIFA 1RCTE 3CSSA 3OMLA 3KYCB 5H5JA 1FSZA 3GP3A 3T1NA 1DC5A 3X43A 4F3NA 4R69A 5LMZA 4G5HA 2XUIA 2Q6IA 4UD6A 4IOJA 5HF6A 1IBCA 2OBNA 3FYCA 3HCNA 3PD1A 5DWVA 4NFSA 5F5NA 4CN9A 3UHAA 3VSEA 4CNQA 4UD2A 1YAHA 1QLJA 3RAGA 4B6OA 1NNLA 3LBYA 3WHIA 4BVFA 4QFBA 3FW1A 4LDQA 3QPDA 4BRSA 1FF9A 1LS6A 1Q0QA 2EHJA 4OHCA 5A4KA 5FHQA 1PQPA 5K5EA 2GGSA 1OQAA 4YK7A 3LWZA 1P5JA 3W8EA 2FX2A 1YHZA 3CUSA 1XJQA 4BBAA 1JH9A 1Z38A 2W98A 3UJ6A 1ABEA 2I29A 2QP9X 3FZQA 3KQMA 3GBPA 1Y8RB 4ME6A 4LMPA 3AMVA 1T9GS 2QVBA 4PVDA 1JDSA 4QWMA 4RPGA 3VI3B 1EFPB 4RH0A 5COBA 1O0BA 3QU2A 5E1DA 1ADCA 3GAFA 3M89A 4CW7A 5DHRA 4LGCA 5DMXA 2WUFA 1OHHD 4QUKA 2CJPA 1B93A 5JQGB 4NAVA 2XOKD 2QROA 4ZI7F 1CJBA 2PJUA 1AOXA 3EVAA 4H18A 2EEPA 3K1TA 2OGUA 4E5VA 4LF6B 4EJ2A 1FX1A 1GQ2A 4IRMA 5HF5A 4TT3D 2DULA 2HWXA 3DR5A 3IVXA 1ISRA 2WU8A 2O2CA 3EFHA 4C4YA 4XA8A 4M54A 3GFQA 1V4NA 1H4QA 3LWDA 1F5SA 3EVEA 1U9JA 2Z2IA 1XDDA 1IXYA 2FJUA 3RKSA 1PS8A 3MINB 1X8KA 9ATCA 1F14A 1Z4IA 1QPGA 1YU6A 2RG7A 4RHXA 3WVNA 1FS4A 2GD0A 2IYLD 3RGGA 1QVWA 2VBGA 3JR7A 3FDXA 4MV3A 4AIIA 1BX1A 3KELA 2JPDA 3FKSA 2A9FA 5L7YA 3NBAA 1H4TA 1WR8A 3CNQS 4AJJA 1T3ZA 3EUWA 1ZUWA 5JNUA 1S9DA 1OB5A 4E0BA 3IUJA 4GX5A 2QT9A 2WBLC 1NW9B 3KBOA 4ZCSA 1ZD1A 5BNWA 2I9KA 4E4YA 3KEFA 1UMDA 2DX7A 4GG1A 3JVDA 4YQEA 3EXIA 2OV6A 5L3SA 2Y99A 4KQ9A 1GV1A 1ZJYA 1XIVA 2AE1A 2P75A 3ADOA 3BQNB 3VPFA 5IYZA 5KHLB 1O6CA 3DMGA 3KKMA 4K9NA 4R3WA 3B2NA 3LM8A 1N92A 2C88A 1G3MA 2OHXA 5F1OA 1EWKA 2ZRNA 4MGEA 2BFNA 1RM0A 3UT0A 3WV4A 3SR3A 2I71A 4QFCA 3K7EA 5I7WA 1C14A 3L7LA 4G1UC 1P9WA 1XZNA 5EFZA 2A0KA 4ZEWA 4DWOA 4WQMA 1VBMA 1HUQA 1OH5A 4X61A 4DM4A 4BMZA 1AKRA 2FWPA 4D92A 3O3CA 4HP8A 3F6CA 1JKMA 3QQPA 4IRXA 3EQ8A 3K5PA 4EABA 3P5BA 2PT6A 1NBMD 2BKXA 2XUQA 4F9FA 1CNFA 4AKSA 1JHVA 1GXSA 2ATCA 3VRHA 3LCVB 2VHJA 2CXNA 3OQOA 4ND5A 2ZIZA 5KQSA 3GEDA 1Y4ZA 2IYUA 2EQ5A 4W5HA 2HFJA 4HWKA 1U3TA 3GFTA 4AKGA 3SC2B 3T61A 3D3WA 2QIPA 4G4IA 4U2CA 4J0KA 2H5LA 3QPBA 1DX9A 4B3HA 1YDGA 2G70A 2QAJA 1R4NA 1W2HA 2QJTA 2IW1A 2QXUA 3KALA 4Q0MA 5ECYA 4EDHA 1QK4A 1EK6A 2VZLA 5CFRA 5GJCA 2FXIA 4OXIA 4XDHA 1RWNA 3L6DA 1QGZA 1UBCA 2DOKA 1JLLA 1X38A 5DK4A 3ZKWB 4BMYA 4IUYA 5E8RA 2IK8A 4FDVA 3PC8C 4X85A 5JLJA 3H5NA 4J4TA 4PLCA 1SG0A 5JCZA 2XZDA 1CFJA 4RPCA 4OYRA 3ZH2A 1DE0A 3KPUA 4QU5A 4R40A 2PNJA 4ZI5A 4J94A 1QHGA 1DEKA 2F1OA 4DZRA 5B2FA 3NH9A 4AY4A 1G59A 3ZDFA 1KEZA 5KYKA 3STHA 5IF3A 1FRFS 1ZIXA 1TM4E 2XHZA 3B7GA 3SIRA 1JSLA 1T5BA 3L7YA 2C2BA 4BNDA 2L18A 3GLVA 3DLBA 2KX7A 5KEIA 4ISBA 3S1AA 1C3EA 2PPLA 4PAQA 4IQ4A 2UVPA 3U60B 1BZYA 2C2HA 5FORA 1ZHFA 2W4MA 1Y37A 3IO5A 3OPQA 3T4PA 2IYFA 3A6DA 4RLQA 3F5DA 1BSVA 1JHRA 1TC1A 2AFIE 2R84A 3M2PA 3DCIA 4W82A 2H4FA 4REMA 2IFTA 1XCMA 2Q1XA 4LRUA 3C5HA 3WWYA 1L5ZA 3VMFA 3P20A 1IY2A 1W93A 2IF2A 3AFNA 2IV3A 2NMVA 1HGXA 2WF8A 1G20A 4LPKA 3EFOB 1PFYA 3HY6A 1PWHA 3GZNA 3SC6A 1WTAA 1X42A 4S1PA 4JJKA 4XVUA 3U7GA 4A36A 4F4FA 5A0VA 1QZZA 3HADA 1DFHA 1NSYA 3EASA 2ZT7A 2GK7A 3FPAA 4DRXB 1G2QA 4YYEA 4UE6A 5I45A 2D4HA 3L1VA 1PKEA 3P9CA 3WBFA 1AJEA 1CUGA 2M6KA 1Q22A 4GPEA 4HWOA 4KAFA 2VTEA 1OVMA 4BX8A 3ZY6A 1R6TA 5C8YB 2OYRA 1P2SA 1SRQA 2HXYA 4YWHA 2PVSA 2R6R1 1IY8A 1T35A 5SZIA 1GUAA 2F3SA 2YCLA 4NK5A 4JH0A 4Y0NA 4ZGGA 2GO1A 1XMXA 4J0QA 3A6GA 5LU8A 3AH8A 2E6KA 3BJMA 4WT7A 3WLKX 1TEZA 1U1CA 3LFTA 2B8TA 1G7SA 4OQXA 2MSLA 3K0FA 3VHXA 3OIWA 1BWRA 3AUUA 1GRNA 4RZ3A 4A03A 4RJTA 5FWXA 2NUAB 1WPQA 3D4OA 5ULLA 5EC8A 5KYWA 2FPPA 2GAIA 3BCUA 1SKQA 4DYHA 2CB9A 4JT8A 4BJ5A 5M7EA 4I08A 1DTEA 1IHYA 3RIGA 3DLAA 3E0QA 1HDEA 2DT8A 3CF0A 3STXA 3T34A 3AY0A 4D9FA 1M0EA 2DC1A 2N75A 2OZLA 1N25A 4E2XA 5IBRA 2PL3A 3HBFA 3LBHA 4XKJA 1EM6A 5J5AA 3SQDA 4YR7A 2V3VA 4M7OA 5EIEA 1CQXA 1RJEA 2CCJA 2YRWA 3DOJA 4UASA 3UW1A 3D8BA 2Q6VA 4G5YA 5BSEA 2BMVA 3HNOA 1VCIA 5JISA 2EFHB 4WHMA 3FCSB 3I5XA 3OKAA 3N2LA 3EWSA 3IH5A 4I5FA 3V7NA 3ZOZA 3OLVA 3GZNB 3HZOA 2G6TA 3QVXA 1R0RE 1E2PA 4Q9LA 4Y9RA 1A7KA 1Y4SA 4I50A 4RTMA 2IHUA 3AEKB 4NCHA 3NTVA 3Q0EA 3TLZA 2P6OA 3QV2A 1JUDA 3DONA 4N0EA 4TYNA 4WKCA 4L0CA 1Z2CA 3I30X 4KE7A 3N74A 1Q12A 3HLKA 3NVDA 1XX6A 4MO2A 2PZBA 5FWYB 1M5RA 4MZDA 1ZGCA 4I50B 2CXHA 2WYIA 3GHHA 1Y7LA 4M7WA 2XRYA 4XQ9A 1ISHA 3TGPA 2WYUA 3NW9A 1NSFA 1CRLA 3T9BA 2ZVPX 1IL0A 2P3SA 3QU7A 2R8OA 2JLSA 2Z2YA 3JPWA 3EZYA 1IQRA 1DELA 3Q11A 2MR5A 3RYIA 2GN8A 3KOOA 1I9GA 5TE9A 3S29A 3L84A 4EKGA 1M6VA 2JHCA 5KTSA 4JKOA 3GOHA 3Q8WA 4CYMA 1SOMA 3LCJA 3V1TC 3AFGA 3LP8A 4K2AA 2GN2A 5AHKA 4BFCA 4RWZA 3NHPA 1I1QB 3ISJA 3C6XA 2E0IA 3OCYA 3KKOA 3AR4A 1F48A 1M5TA 2W6MA 1HFKA 3AJRA 1ATIA 4W6QA 1E1YA 4MS3A 1CY6A 1TAGA 2IEDA 1GNQA 1UXHA 3MBOA 4P08A 5CM9C 4ESOA 4QJ3A 5AW7A 5I5EA 3CF6R 4QIHA 2FSUA 2HA5A 2XQFA 5G0SA 4D4JA 2EJVA 1CD5A 1K68A 1D2RA 2G5TA 3BMQB 4O0MA 1ZH2A 4RK4A 5JE8A 1T91A 1A4XA 1GVHA 2G8LA 4GNRA 4QSMA 2WJGA 3CWCA 1D6JA 3O4HA 3TW0A 5D84A 1HOXA 2EX0A 2GKOA 1O5IA 1RKBA 1U3WA 3D43A 3DAYA 5G3YA 2ZRPA 1S4QA 1I4EB 2ZROA 4JXKA 5BN4B 4MLZA 1V9SA 2OBYA 5CYFA 3RKUA 4MW7A 2ZVQX 3W3AA 2X0IA 4JK3A 3BWDD 3NNDA 5G4LA 4UTOA 4NU0A 4ARVA 5ALZA 3FB4A 3ESXA 1RBZA 2JGJA 1Z36A 3RPEA 5I4BA 5IT4A 1T8UA 1XAIA 1YR7A 4YRMA 221PA 4HQ6A 2ESRA 4U6SA 2OBLA 1P75A 2H1FA 4CF7A 1G19A 1RQRA 2IF0A 4Y2JA 2P6NA 1QS0A 2BR5A 2E87A 4HWPA 4MAMA 3V42A 5JRJA 4M8NE 3LC1O 1MA0A 4RZ2A 1L9KA 3F6RA 2WVHA 3LFHA 2IY7A 2LWIA 3BREA 3VDRA 1T9ZA 3U5ZB 1J42A 1LRKA 3AINA 1FE8A 2ZE5A 3KIPA 5JSQA 1NF8A 3W78A 1JHYA 1V5GA 5EWMB 4IXNA 2W37A 2V7GA 2ZYDA 5E7JA 5F3RA 3RS4A 5M2QA 3A27A 1F7UA 1EFRA 3C8MA 1XPUA 3W6OA 4O1MA 2VPXA 2AUNA 3IIJA 4LCJA 5DYIA 2WEKA 5JSZA 2H06A 4TZTA 2O7QA 2B7BA 3V3KA 3MCVA 4MEJA 3HA2A 4TTSA 3T5BA 5LJIA 5FRDA 2NTEA 1WHSA 4MVJD 4M36A 5GJWC 4YJHA 4PC3A 1OI3A 1U1IA 2XGMA 4QOSA 1HBJA 4Q7JB 5FCDA 4AMUA 5B6JA 4OUDB 2BMDA 2DFPA 5BN4A 3UKOA 1BVHA 2YZMA 2VSQA 1TQHA 4KH0A 4MUNA 4UEJA 3LA6A 4AX8A 3DBOB 5BSVA 3MJTA 5HQ3A 3DWGA 2QL7A 2UVDA 4BOYA 4MDHA 1P74A 3O8OA 1T6XA 2HRCA 3EWIA 2DB3A 1UPBA 5BMVF 2ZTLA 3TL6A 4V2UA 1IY9A 2C04A 4XFDA 1TVCA 3LRPA 2IU3A 2ZJ5A 1EX6A 1YZVA 4RAOA 1WA5A 2MSDB 4YWJA 2VQDA 4XSHA 3SXUB 3TZEA 1HMPA 3WYAA 1RIIA 1AE1A 1VYVA 1DZIA 3T0FA 2AZXA 1Z4QA 4GBED 1EP9A 1MXHA 9MHTA 1ZRMA 2R66A 3BD8A 2GPTA 1U2TA 3PF8A 4GMHA 1Z18A 3FD8A 4OHRA 4CT0A 1TF5A 1NY6A 3EIWA 2W22A 1NWHA 2K5UA 2R1ZA 3GROA 4HEJA 3DDWA 1TCCA 2GJ8A 1ZN8A 1J97A 1HYQA 2FEXA 3CNOA 3QM1A 1NT2A 4UAVA 4RSHA 5LBIA 5BW4A 2YVQA 1MW8X 3E5NA 1Q5PA 1LY1A 1IN5A 1WXQA 3FAZA 5HUJA 1QQBA 3PNKA 4KXLA 3U0BA 2PWAA 3HMKA 2MMGA 3Q10A 1N1MA 3JTEA 5FIUA 3TOCA 4XEUA 5KWIA 3DEAA 3ZHYA 4DMGA 2CMDA 3QBVA 1N6NA 5JS7A 3EQ6A 5LA6A 5TS2A 2NZYA 3ZXSA 4DIBA 3NBFA 2GHRA 2FA9A 2FMXA 5DWDA 1VCMA 3UC5A 2QUHA 4WSOA 1WDMA 3WFJA 4DMKA 2GESA 421PA 4UU7A 3PSAA 4ZTUB 2ZCUA 3JD2A 5KAMA 5IKOA 3HA5A 4QRIA 4B75A 5MDHA 2IZ1A 2CBZA 5ADWA 5IASA 3PUZA 4FFOA 5L4LA 1K89A 4MQLA 5E9QA 1SOWA 2W2OA 821PA 1MFPA 1VDZA 4K0RA 1G6KA 1L7XA 3COJA 1GSIA 2YQ4A 1CJTC 2XKAA 1A5BB 2A8YA 2TMKA 3W04A 3PE3A 2SHKA 1HTWA 3NP7A 2C42A 2YR0A 1AHNA 3MINA 1A8PA 4MA0A 1TEXA 2JBHA 4D98A 2WKSA 4HWGA 1Z39A 2FYTA 4OQNA 1XE3A 5CH5A 5C81A 1IM8A 3IOBA 4PE5B 2NXWA 3B1WA 4RESA 3Q2KA 1GUDA 2CDBA 3ZS8A 3U44A 4HAUA 4LNUB 2DQKA 1JU3A 3WMXA 4YUZA 2GVZC 2P5TB 3N87A 3BZWA 1H1TA 4TTQA 3WIUA 3QUCA 4G63A 1JX6A 3SMVA 4OBBA 4WGGA 4C1BA 2P11A 3NKLA 1F8XA 1IWBB 2AIRA 2A9QA 2JLRA 3BXFA 4X1IA 3DG9A 1E2UA 4LSWA 3RVDA 3VU3A 4EW1A 1NJ1A 1P1BA 4RY0A 2IHJA 3GOQA 4I50F 4EJSA 1Y48E 3B1VA 1XZKA 2N1MA 2YZKA 4K87A 4NZMA 2AF4C 3OEYA 2VRCA 3KB8A 1USUA 4MKHA 1Q3TA 3I9MA 3TLCA 1A95A 3SJZA 3UGTA 3ZWDA 1GGMA 1CG6A 5TNXA 2ATIA 1RPAA 4XASA 2ZIWB 3C14C 5AHWA 5EHZA 3UUFA 2PSFA 5ELLA 3ZYZA 3RVBA 1ZKDA 4CIVA 1YNSA 3F9IA 1ZOSA 2WJ3A 4K28A 4K40A 2XQJA 4M9XA 1LUAA 3GUHA 4BNWA 4QTXA 3GRYA 4QOHA 1UXIA 1UBOS 3WWDA 3E8MA 2YTZA 4TUYB 3T9EA 4P3KA 1TLLA 2O0KA 3N3AC 4TXNA 3ZV5A 2XIJA 1II0A 1LPPA 5CD9A 3LL7A 2VPQA 3OD5A 2IIVA 4G84A 1M2EA 2B83A 2RGNA 1W2WB 1EA7A 4YHHB 3EQ7A 4ZAZA 4ZDWA 1QR6A 2PX2A 4WVFA 2GB4A 3TTTA 2Q3DA 4GGOA 5A7FA 4DCUA 1M0TA 2MYTA 4LDZA 4IDQA 4LSZA 2BE9A 1LDYA 3OD1A 1MAVA 3MJFA 3ZX5A 5AK4A 1M73E 2C7OA 2E5FA 2JIZD 2HPAA 4RDCA 5F9FA 3PEWA 3FHTA 5FWNA 3D5TA 1M74A 1J22A 4BZWA 3PKIA 4RH3A 2QNBA 4U6QA 4OHZA 3O26A 3HJHA 4TYYA 2JD1A 4KQ2A 5A05A 1MFZA 1PEDA 1XXHB 3E3OA 4XR4A 1YVPA 4YPOA 2NP6A 1U1EA 2OO3A 4X93A 1YZYA 3HFSA 4GLOA 3VYTB 4DAOA 2I22A 3PFHA 5HTOA 4DQUA 2B8NA 4JUBA 1MO3A 2JI4A 2WU4A 4Q47A 1QPBA 1W0KA 1KEUA 4IFTA 2R7AA 3QG1A 5L3QB 2ZTVA 4LNHA 4F2GA 3STVA 1RWMA 1P3DA 4DUPA 2WLTA 4QVIA 3Q5GA 4AICA 1RSZA 5TMEA 1W8DA 3UBMA 2QN9A 3ZXIA 4WPGA 4X84A 1TM5E 3PPIA 1E32A 1R1DA 1XOIA 2GRJA 2HLNA 2TMDA 3IQEA 3AEXA 3BTUA 1T6ZA 4N3CA 4MR7A 2PH1A 5GONB 4I6GA 3FYUA 2WI8A 2F1HA 3H83A 2PWBA 5KWEA 5CT9A 1CZLA 1PJLA 2ZKLA 4Q05A 1U3UA 4NBUA 2HDOA 3M2TA 5TQVA 4QYWA 4B44A 1V16B 3E2MA 3QITA 2P40A 4PXYA 4XDZA 1VG9B 2ZB8A 1I7DA 5G02A 3BQMB 4MULA 1HY3A 2P77A 2RCNA 5E3HA 2COEA 1U3CA 5KI6A 3K5HA 3D6JA 4L4XA 2PVCA 4MKZA 1JFFB 1LC3A 2FJ0A 1VIDA 4EFMA 4QC2A 1E2JA 1F3LA 3HPRA 4EFNA 3ESCA 2O1WA 2ZAMA 1O6GA 1FSFA 4OD0A 3N2KB 2RHMA 2JBAA 1WCXA 1MAWA 5C1PA 1GCIA 2AC2A 2D74A 5BY2A 4RC9A 3HYLA 5JAMA 3KTFA 5FNVA 3BE5A 4COOA 1PEKE 4FNGA 2PJZA 1K92A 1XU9A 2J1LA 4HD8A 4A0RA 4NEHB 4CGZA 2P9BA 4NMXB 4Y2SA 2UXDB 1SZPA 1ZFNA 2BM1A 3IBTA 1QG4A 5K0CA 3G0DA 1C9JA 3L7DA 3RV4A 1BTOA 2X0FA 3ZGNA 2JL1A 2I34A 2WOJA 3CUWA 1E6WA 1QMPA 2P9HA 3WDKA 1U7OA 4IH1A 2CVZA 4GW3A 4EYKA 2C5LA 3BFVA 2N9UA 2O7SA 1E9RA 2YY6A 2PL1A 3FDJA 1NX9A 1ULUA 4YFVA 4TS4A 3HHEA 2IBSA 2PH5A 2HSJA 4PFKA 1U7HA 2PIAA 4ZO4A 4OKIA 1UMCB 2AFRA 1DTWA 2VK2A 2O3TA 2YBEA 3C70A 4ZHQA 3REQB 4QT0A 4J9VA 3DHEA 3KXPA 3UVEA 3UJ3X 4Q4AA 5ICMA 4ZREA 4KKXB 2R5WA 5DI9A 4ZQBA 4C0BA 3C39A 1WUJS 3NASA 4KQXA 3WMEA 4QFDA 2B8JA 3AWDA 3THOA 3ICPA 3PUKA 2F17A 3E27A 4FP9A 4KVAA 4KUGA 1I7SB 2XCRB 4HBZA 4V0MA 4P3YA 4L9WA 5CNJA 5HBRA 1LTQA 3TIFA 5SYNA 4C0WA 1U3GA 4EG4A 1HYHA 2ENWA 4UM9D 2HIMA 4BNNA 2HI0A 3LQ1A 1Y9EA 3DB1A 3ZC3A 1E1QA 2W2TA 3RSCA 1CRWG 1MX5A 1UMDB 1RTKA 5J4KA 4DV5B 1RCFA 3T06B 2AUTA 4HXFB 4TWRA 3ZGZA 4ER3A 1G8AA 2WJYA 1SVNA 3K8OE 2ZYUX 4NOJA 3L6BA 5A0FA 3ZHQA 4EFLA 1VKJA 3GELA 3M6AA 5E9WA 1U7UA 2CFTA 4NRDA 3ZD9A 4XWGA 2IUEA 3KP1A 1RKQA 1CUXA 3RVLA 3ZZ1A 2D2EA 4Y1EA 5KMGA 4RF5A 4B45A 1K3TA 4OREX 4CMCA 3DUFA 1Z83A 1V6SA 2HMAA 3JWPA 4OAQA 4C3VA 1XJWA 4RMJA 2Z5FA 3K2IA 3V7UA 3WQRA 4RWEA 2ZYHA 3DNFA 1C9MA 4H7FA 3T9CA 3L7NA 4BGIA 1K7SN 2RBGA 1F1BA 3NO4A 1GNPA 1OOEA 3PL5A 4YONB 3LVFO 5ALPA 2D7DA 3KYDB 2P41A 3A6EA 2IHYA 3MM4A 4HV4A 1EA5A 3ITDA 5CLGA 5CTJA 1C0LA 2I7XA 4TMVA 1MJFA 4EP1A 3CJRA 3QA9A 1GGEA 4BMDA 4IIGA 2BL4A 3M1YA 4JCOA 4E03A 5KNDH 1LU9A 2QY6A 3ZPXA 3Q7RA 2QYOA 3CEHA 4JBLA 1N2XA 3WNQA 1I6WA 1TU4A 3ZNOA 2AOUA 3VR2A 3TFOA 3SDSA 1Z29A 5JDCC 3ZZNA 1XMVA 3G3EA 3GW8A 2AEJA 4QHSA 2CL5A 3BIXA 5EYPB 3GVCA 4F2WA 2ZCJA 4PO3X 4R0MA 1BIFA 4KK4A 3HM2A 2ZR7A 2JIBA 4EHAA 1EAYA 5AW4A 1PDWA 4TSRA 1NLMA 2CJXA 2VTVA 3L4BC 3GN2A 2NO5A 1VYTA 2OXCA 2Q4DA 2X5KO 3C5EA 3IB6A 3KVYA 3HN2A 2O54A 2FF7A 1SC4A 3O90A 4LXGA 1J2TA 2CZQA 2WWRA 2SKDA 2IH2A 2Q1UA 1AQ6A 2R1VB 1WBBA 2HQ1A 4I8XA 4D4LA 2A5YB 3RFTA 3DO8A 3V3TA 2F4NA 4DANA 4UDOA 5JRZA 3OESA 1ADYA 4HMOA 2R8BA 4WFKA 4HSGA 4M0CA 2XSZA 3ZVMA 3V46A 3KK0A 4DNPA 1G8MA 4N5LA 1J1IA 1JW9B 1T9CA 3GDGA 1XGKA 4KZKA 2HPZA 3RYCB 4S3MA 1QS0B 4EK9A 2ZWOA 3BSSA 1J6UA 4G5QA 4A8JB 1M6WA 1YL7A 1C7FA 3LBIA 3RLFA 4CMJA 3KWLA 4YP0A 3T94A 2PGLA 2ZJ8A 5E6RB 3FJ1A 4UATA 1GL3A 3CB2A 3JASA 1KOFA 4KWHA 4ENSA 3IUYA 4CIXA 4ZV7A 1DXHA 1OXVA 2CLDX 3IXQA 3F9CA 3WGMA 3ZCXA 2FVXA 5JBIA 3PTAA 4I0WB 4CN8A 2NUPA 2OY0A 3CVWA 3EZLA 5AJVB 4F11A 1DAMA 3BXPA 3ZZ0A 4RQTA 2AMVA 4X7MA 1RRVA 2Y6UA 3A1SA 4LVNA 4JMPA 1TIPA 2ZI7A 4OQ4A 3W4KA 4K6KA 1GYPA 3PA6A 3B1JA 2Q0SA 3ZWYA 1BMQA 1W6UA 2D2FA 2Z5VA 4AS3A 1T0PA 1LH0A 2P2NA 4D99A 3D4BA 3IS3A 1RRCA 1N7JA 2VUSA 2BCEA 2X4GA 1ODLA 2OENG 3ABSB 4FLFA 1Z5ZA 2WA1A 1KI4A 3C1AA 1X7WA 3LKVA 4YTEA 1E3JA 1I7QB 2YZ7A 2PSHA 3Q0IA 2C20A 2FOIA 3PVZA 4O4JF 4BS9A 4D74A 4DTIA 1U2SA 1N2IA 4KLCA 3IHKA 3TEFA 2EVWX 1W19A 4WJLA 1TKRA 2CGEA 3N70A 2DQZA 1UKAA 3SJCA 2WYWA 5E6UB 3H18A 4ZAVA 1XNQB 1FUIA 1VB3A 5IP5A 2WJWA 1DV1A 5AXAA 3WL3A 1PT5A 2I3ZA 3O9VA 1TPYA 2GVDC 3MTQA 4U9HS 1UWLA 1QH8A 1U02A 5CLHA 2NPIA 4R8VA 2IZZA 1IUKA 1V5WA 3IP3A 4R8RA 4L8LA 5EVJA 5EKDA 1JECA 2O3UA 3H7IA 3JQFC 3LJKA 1FMJA 1Z0KA 3CLSD 3EY4A 2D62A 2C4NA 3GEHA 3GMIA 1U8CB 2HA7A 3PC8A 4IUCS 5IK2D 1NW5A 4OHBA 1X86B 1YS1X 4KHZA 3DOIA 4PBTA 3T5GA 2VAMA 4O5OA 1M10A 2NYAA 3G9ZA 4Z9YA 5CDSA 1DV2A 2F48A 1UJ6A 5AW0A 1YJQA 2ZT5A 4GLJA 1C7RA 1YZKA 3HDYA 5KHAA 2BHTA 1XXHE 3AI1A 3CKKA 1ISGA 4IHAA 4ZO8A 5KCZA 1YZTA 4HAZA 2Q9BA 2V7VA 2P68A 3KJHA 3PGVA 5LZ4A 1XTPA 3W5JA 1AZLA 1V11B 2LTAA 3N8KA 4FX2A 1IZZA 3SJUA 3TK1A 3TLBA 4G5FA 4ZYXA 3IAAA 4DCNA 3RVQA 1B8VA 5J43A 1BWPA 2Z9DA 2B7LA 3D8UA 1N8SA 3PGKA 3L41A 5HKOA 3VR4D 2PZKA 1W5BA 4P58A 1AK1A 1LEHA 4LWOA 4DR7B 2IYXA 2NO1A 3ZY5A 1EVQA 1KK3A 3HKDA 6PFKA 1PP4A 1S5PA 4KDFA 5E4TA 2ZBFA 4J3FA 1Z25A 1FRZA 1X19A 3DE0X 3GF4A 4POAA 4PPNA 2VT3A 4XUGB 2AX3A 1P4GA 2XVMA 4OGFA 1JWLA 2O8CA 2VHZA 5AKIA 3KSMA 1Z7WA 3KEMA 2QLLA 2AXQA 4WZ6A 3OQMA 2OAP1 4ZT3A 2QTFA 5C34B 5JARA 2IZOA 3LYAA 3AVWA 1Q57A 3GPCA 2VKTA 4DLYA 4HPJB 1MV5A 2PHZA 5DYNA 4ZCRA 3KT6A 4K9SA 3SY8A 2VHVA 2AMYA 2CHUA 2Q1WA 4KIFA 2HYDA 4AN0A 4YUAA 3D8SA 2V8OA 1OGYA 2BEJA 4EIWA 2JCYA 2JRLA 4QEDA 5KOHA 1Z0FA 3HN6A 3B9PA 3AHGA 4MA5A 3RG2A 4L2IB 5EJEA 4YCCA 5FO1A 4DHWA 2AXEA 4OLBA 1EEXB 1MQ8B 5BXQC 2WAXA 2OG2A 4I9GA 3D7KA 4KFSA 4GRIA 3RWBA 3ZK8A 5A2QA 3PSHA 3SHVA 5CBPB 1BVUA 1OLUA 1YUNA 4HGOA 3WYFA 5ERGB 3SAJA 3IAM6 1LPNA 2CV0A 1ZVQA 4O4HF 3I04M 4DLTA 1ZZEA 2E85A 3L49A 1JF8A 3D2AA 1EINA 4IPTA 4DE5A 5J59A 4TN1A 1UDCA 1JQLB 1GAQA 1OFUX 3HP7A 5EJGA 3VX3A 4L5YA 4DDKA 2IEYA 1G64A 4RVDA 2WJAA 3EA0A 4JBIA 3U80A 1X7XA 4KE6A 1FEZA 3CX8A 4RFVA 5T57A 2DUWA 3RNLA 2OCXA 2ZBDA 1K98A 3QHAA 1CB7A 1L7PA 5EI5A 5FUVA 3KUDA 2PKQP 4WVLA 1JR2A 4JI4B 4HL6A 4KRFA 4ARUA 2NUTA 3JATA 3QH4A 3AL0C 2E5LB 5KTYA 1SGWA 1MJGA 1SQ0A 2YJ3A 4JITA 3SK0A 1Q77A 5SZJA 1QSGA 2ID8A 3IT2A 3P71T 3H8WA 4I9FA 3UOWA 2UZAA 3FROA 4EITA 4N48A 4EHKA 4DB4A 4LXYA 1QG0A 2DHRA 2R1VA 1BWQA 3PT5A 1OZHA 1T2CA 3BMCA 1NF2A 2WF6A 1C9NA 4UQPA 1X1SA 3BA6A 3GVIA 3EB9A 1AHHA 4P2GA 3GLQA 2R2GA 2IY8A 2VH2A 1IJBA 4QG7A 4KFCA 1EZ1A 1RWBA 4ERNA 2I1LA 4BNMA 1DDOA 2FW1A 1GZ4A 3OIFA 1WUYA 1E0KA 1UJBA 4MYHA 4MPPA 2I4NA 3I1YA 4OB6A 4RA9A 4BJ6A 1VRVA 4J1TC 3R4CA 3TLYA 5B58T 2CZGA 2IP1A 2VHEA 1AGRA 3VTFA 1H2RS 3I34X 2RJNA 3AKYA 2RGGA 4A8JA 2C7QA 4JYAB 1QF9A 2O6LA 2YXBA 4XD7D 3F2VA 2NSLA 1EZ4A 4KWEA 1O8CA 5J5VA 3FSGD 1CCWA 1D2AA 2QN3A 1QIHA 4H3VA 3RADC 2VA9A 5IMBA 5ENZA 1JWAB 2FWIA 3QJYA 4MI3A 1KDRA 5B3JA 2C7RA 1X7XB 2ZRMA 2WJZB 4P6VF 2GPJA 3FWZA 3KB1A 3KFXA 4Q3OA 4CUJA 1AKYA 5I7OA 2V7XA 4UUAA 3BXOA 1B3BA 3IKVA 4L3OA 2OVBA 3PNPA 2BMFA 5DNCA 1E2NA 1PS9A 1FX0A 3V2GA 1KU0A 2HFKA 3JQ6A 5JROA 3AG6A 5I9MA 4UARA 1X7DA 4BATA 3EZGA 4G5OA 1P1HA 1EUCB 5HFJA 3IL2A 2D59A 2P27A 3DCJA 4QQKA 4YUXA 2Y1LA 3E3MA 4LZLA 4X8OA 2R44A 5BOVA 4NCKA 1CYEA 1MG0A 3H65A 3ZGVA 3WGVA 2ID7A 3MRXA 4L50A 3OCZA 1QIDA 3QE9Y 3V7WA 3K4QA 1WZIA 3IDQA 2Q5CA 1O58A 2FB9A 1PFWA 2VYND 4MCIA 1MRSA 1WQ4A 2JAOA 3A10A 4JY7A 4X24A 4Y2PA 4G0PA 5KTNA 3RTAA 3NZEA 1XQXA 4FFRA 3PGMA 1EVYA 3IOEA 3PA8A 2X42A 1F0KA 3AP1A 4KGVA 5HIMA 3FYUC 3GJSA 3Q9SA 2FEMA 4BNJA 5T5QA 1TAQA 3VKFA 2NT4A 3CRZA 4E07A 4OG2A 3U6KA 3D6UA 5ADVA 4IVQA 4KWCA 3NHSA 1OZ0A 3GEGA 4RPLA 5K3AA 1JAHA 1KWGA 3W2FA 4YECA 1GLNA 4G85A 1TYEB 3HSKA 3PFGA 2ZYTX 1KHHA 3D2LA 4G0MA 4UHJA 4XUEA 2XDYA 2XYRA 1NVBA 3UFXB 2E4UA 5B5SA 1A98A 1AS0A 1YGPA 1NQOA 1NI4B 1OFUA 3COSA 1XZHA 3WLIA 3OJEA 4MP6A 3KOMA 5FB3A 2VJCA 1D0VA 1ZIOA 3RHZA 3RSFA 4QQ8A 4R8LA 4MWDA 1VPTA 3PD0A 2JA2A 4DMFA 2I3DA 3FF1A 5CB4B 1XZLA 2DERA 1XTJA 5DT2A 3OIGA 2V6MA 4JJ7A 3U4AA 2QG9A 1Y6JA 2RHJA 3E3NA 3WLPA 1L1EA 1N5LA 2OORC 1QRSA 1DTWB 3I04A 2R11A 4TLAA 5ALTA 4ZHQB 5IHXA 3LP6A 4DV0B 4US0R 4KGXA 5BWOA 2CUKA 1U9IC 2JLBA 1IQ0A 3KT0A 3VPCA 1Q0UA 3THYA 1TZBA 1N0IA 3TSZA 3W8DA 2OPHA 1B23P 1JAYA 5BW5A 5IWAB 3O47A 1YR8A 1ZM9A 2BBOA 1AZWA 5CRIA 1SVWA 2CVPA 2QX7A 2PSSA 1HFJA 3URKA 4BFYA 1DAIA 1U8YA 1UJNA 4HX5A 3ROQA 3UK6A 4JT9A 4O8ZA 3S8YA 1QYIA 4LJYA 2ENUA 1NN3A 1NLUA 1JHDA 1YL6A 2XT0A 2PYIA 3LS2A 1XD2B 3H5IA 4P31A 3UICA 3S8EA 3HUEA 4O29A 2RKWA 2EYUA 3FIJA 1GPJA 2A57A 4HQNA 1K9SA 1KETA 2ZSAA 1TCVA 4IVNA 4YXWA 4ZIRB 5JJIA 1R8YA 4HLNA 2VP4A 4CF3A 2XMCA 4G36A 2A9KA 4LGMA 4FEYA 4H4DA 1HORA 2CLEB 5DPMA 2QTZA 3CMCO 3NGLA 3UHJA 1OBVA 1GPLA 4ZRDA 3K32A 1CFZA 4ETMA 2XECA 3P9XA 2D1FA 2JIQA 2DHQA 3MOIA 2QMQA 5CXXA 3M5WA 4OA8A 1U8UA 1ZC4A 3A4MA 3MK31 4IDBA 4L73A 4CTMA 4N5NA 2DXIA 4F9GA 5E0KB 1P9LA 3FNBA 4YRAA 1EB9A 5LNK6 3ZCSA 4B46A 1J1ZA 1U7DA 4B3IA 3E84A 1U0TA 2ACKA 2VHCA 4NNJA 3VR2D 1ACJA 3LDFA 1LZKA 2GLXA 3MC1A 2BONA 3WLOA 5HRAA 4FFBA 1KEVA 4P3OA 1BFKA 1ZIYA 2IS6A 1IWOA 5EWLA 3AIOA 3CEJA 3GRRA 3PFWO 2WAAA 4JN6B 2IGBA 3CCBA 4X63A 2FRDC 4UDNA 1PHPA 3Q3EA 1DXQA 3DE3X 1FLNA 3N9IA 4J0FA 1BEZA 4FFBB 3TPFA 1XPJA 3MQ4A 3UWSA 4DYDA 2QG6A 2MIIA 4NCAA 1XVAA 3MEQA 3L1JA 5K0ZA 1QANA 2JGAA 1TK3A 3HJFA 1H65A 3EVBA 3HCDA 2QSJA 2VCYA 4OJTA 3T9DA 2IXAA 2P2YA 2WDZA 1K5HA 3T9AA 2ZSHA 4EX7A 4MR7B 1CHDA 1ZXLA 4B40A 3KUCA 2CB0A 4KTVE 3EVGA 4CLOB 2B99A 2QZSA 1VL1A 4MUGA 2AUMA 1P4RA 2DP4E 2OV3A 3WOVA 2X6TA 1G2IA 4F5YA 3U4QA 4JBGA 2CLOB 1I3MA 2OMEA 4OY3A 1EVLA 1Z6PA 4YP6A 4FZ5A 1DC3A 4RLSA 4KOEC 1LDMA 4R2IA 1IFXA 4QTTB 4KITB 2NG1A 4RZQA 4RGYA 4OQMA 4ITVA 3QXCA 5D1NA 1MH1A 4CNBA 2YCBA 3G2IA 5SY6A 5DBEX 3WKAA 1IOWA 2IYRA 2B9VA 5KINB 2BGKA 3CMMA 4A0FA 2VT6A 4M88A 4XLTA 4XWYA 1XNHA 4TV8B 3TQTA 3ZK7A 3ZU3A 4PRYA 1DL5A 1KQPA 3HB1A 4WECA 3VAAA 2R1TA 4HVLA 2IEBA 2QD1A 4S1OA 1YBFA 5ALRA 2YMQA 1ZSNA 2G06A 4M55A 4M86A 1YSCA 2HJGA 3FMFA 4YREA 3ANNA 5LQAA 4YYZA 2H7YA 4LC1A 2Z43A 3B9QA 5F2OA 2JATA 5T41A 5EIAA 4MQBA 3NHWA 5F76A 5KQRA 2AW3A 2Y93A 1I24A 3G6KA 3O84A 1QWOA 4N01A 3SOPA 3TBHA 3FDZB 2EX4A 1N2BA 1Z6TA 2WYHA 3WWEA 5AW1A 5JJCA 2GPAA 5AK6A 3P2OA 4JVSB 1LSSA 1J2YA 1Y33E 2LDXA 2I1QA 1LNZA 3X1XA 2ATEA 3O3MB 4N6NA 4P2BA 4LVCA 4TKUB 1NYQA 1T5TA 1VMEA 3TB6A 4YAKA 2CEKA 2SCUA 2GT1A 2VOJA 1K5GA 2QNIA 3ETEA 3LO5A 3PJDA 3B60A 3QKTA 4XQGA 2D5AA 3U7EB 2ZYAA 5BVHA 4AFNA 3HZRA 3N53A 1CF4A 1B6RA 2NGRA 3FAKA 1B0UA 4J2TA 5FPSA 1I5OA 1SHTX 3M4XA 4BB0A 3LA8A 4ZXFA 3NT4A 4BFVA 4LSMA 4UM5A 1XF9A 4KN8A 2NPFA 3E9ZA 3RQSA 3V1KA 2V58A 2YJZA 5BVHB 1YR9A 3NTXA 2VWGA 3HDJA 4H4CA 2C5BA 4U02A 4NBSA 2IITA 4UDYX 3VU1A 2AG0A 5IJZA 2XHEA 1YS9A 2EFYA 1P2GA 3DKKA 5JRDS 1JTVA 1Z8HA 5DIZA 3DWIA 4TLEA 1POXA 1V7QA 2NV6A 1QHHB 4IFEA 5CIWA 4BMPB 1DVRA 2VYFA 1RQLA 2H7XA 3RU2A 1R5OA 1IM2A 4O02B 5H59A 4BKQA 5C3MA 1IOVA 4ZO7A 1GPYA 3GCXA 1QG2A 1U6IA 2CSUA 3A6FA 1TJ3A 1TNDA 1U0LA 1YRHA 2ZJ1A 1Z5OA 3GMDA 1YWGO 4HJXA 4HQ0A 4N7MA 1E3SA 2JH9A 5AW6A 2JB9A 4WNIA 3FGPA 1LI5A 1I3NA 3PVCA 1QE0A 2B6NA 2JZOA 3H4MA 5FI0B 3R74A 4EGJA 1GRCA 1UKBA 4BNHA 4FYWA 4KRXA 1Z7EA 3KUUA 4HLQB 1M8GA 4Q7EA 3T54A 5JMOA 2JAXA 3DL0A 4KP7A 4RAQA 4LY3A 5KYUB 3DPUA 3DMPA 2PG3A 1P5HA 2CEAA 2IT1A 2L2QA 4JUFA 4X92A 2YRXA 4F5WA 1H2BA 3JQGB 4ARSA 4DEYA 1AGYA 3FHCB 2GEVA 3CJTA 1B8NA 2OG1A 4RLFA 5FJJA 4POOA 3HEAA 1XHEA 2WIAA 4L76A 3SICE 2AWOA 3E22A 1C3OA 2GYVA 3RFXA 4P81A 3U09A 3H75A 2FFHA 2VJBA 3D6AA 1XKLA 1HOTA 1W0CA 3LT5A 1GNTA 4JENA 4BB5A 3W4IA 2P3OA 4HAOA 4YMTA 3CG4A 3SYRA 3PJFA 1G55A 4Q1BA 4Y18A 4FNMA 1YZFA 2ZIFA 3NRCA 4ND8B 4DLVA 1LBSA 2I87A 2VXCA 2X22A 3C2QA 1OXBB 2WJIA 3F5FA 3ZWWA 2EV9A 4CV2A 1QV9A 1F06A 1XTZA 3PPVA 5FL3A 3RI3A 2IQ5A 1EJBA 4WKNA 5FD8A 1RZ3A 4CQMD 2NU7A 4IZ6A 5LPNA 1EK1A 1I0IA 1RLTA 2OQRA 1EFVB 5AKLA 4AJOA 4DIMA 3VNVA 5EMNA 1YK1A 3EX7C 4M46A 1B6SA 1J0AA 4RHEA 3V55A 3ZEAA 3BTSA 1W94A 2WG2A 1JG7A 1VLJA 3WLRA 5D5HA 3O95A 3QMWA 3EC7A 4MVJF 3EOAI 3LCMA 4GM1A 5EP1A 1BX3A 5FOXA 3TTUA 3WB9A 1HQYE 1ZI6A 3GLIB 4C08A 3B3JA 4G8JA 4JJZA 1TCBA 1UBRS 2VDWA 2XA1A 3PR2B 1ZM2A 1WKCA 2DFDA 1W44A 2EBHX 4NAHA 2OZVA 4CQLB 1FPQA 4BQFA 2FFRA 3DBVO 1WLSA 2GDJA 2H1SA 2Y1DA 3PRYA 4C89A 4PLHA 2PZAA 1L1FA 2XB8A 4L4RA 3BORA 3BGIA 2XUFA 4DSAA 1V43A 4FGLA 4IOLA 2NZUG 2WKQA 4L85A 1FJ2A 1L4EA 4LDJA 4F84A 3NOVA 5KJ1A 3ZWOA 1HPLA 2AYZA 2C8JA 4XM0A 3RYHA 3CRMA 1NW3A 1GNVA 2G4VA 4TTRA 5FT9A 3KUKA 2OCDA 4IDGA 3W7BA 1HM5A 2BKEA 5HW0A 5F1YA 2PTGA 1KR5A 2CXSA 2YHUA 3GX1A 4OB7A 4QHYA 4CKEB 4DLNA 1LI7A 2GZMA 1GZVA 5EJAA 4Q12A 5K0EA 5MN4A 2GERA 5EFOA 1ISPA 3U4CA 3JVVA 1DHTA 4YVFA 1EU1A 1THMA 3D3EA 3KZVA 1IG3A 1XZAA 2X6QA 2QUBA 2VKQA 5CVCA 2J3DA 4LECA 3ZBQA 3SE0A 1A9RA 2QX9A 4AU1A 4N76A 5DP2A 2O3QA 2HMSA 4XWOA 5BPFA 1YBAA 2HSGA 1QO0A 3VSBA 4B6JA 4BKPA 3HB5X 3D3NA 1X80A 3T1QA 5KNDD 1W85B 2ODNA 3ET5A 2NZ8A 3WFZA 3P9IA 4A5SA 3QTLA 1MQAA 3IVMA 1SHLA 3HDVA 1IIBA 4RVOA 5LVAA 2YIMA 3ROKA 4N6GA 3LPMA 3INNA 1JDTA 2X13A 3ILVA 5DM2A 3OCCA 3RCBA 2YY5A 2BOVA 1QCZA 2HCJB 1WRBA 4P3PA 4OQDA 3STTA 3B3AA 1LLQA 3BOSA 5D5QA 3S44A 2ET6A 4MWEA 4MDFA 1Q3HA 1QKKA 4O08A 1EXMA 5LQSA 1WCYA 4M8KA 3LTNC 5JJKA 2AI1A 2I2FA 2XKBA 1UOQA 2HHJA 1LX6A 3PP8A 4B73A 4OK3A 1FX0B 4AZ3B 3NYQA 4HLDA 4NZNA 1ZICA 4A0QA 1P9NA 1V8BA 3HRKA 1FFBA 1LFAA 4UOQA 1OX6A 4YIHA 4EMTA 4M8LA 5B53A 2XGJA 1ZY2A 4G23A 3ZDQA 3TE6A 3ZE7A 1MO2A 1AKNA 3B8HA 2I4IA 3GJQA 3T3EA 1W47A 5BN5B 2YHIB 3N6VA 2IYSA 5BV2P 5B1YA 4ETIA 1TT5B 4D9JA 4M0MA 5TRTA 2G1UA 2R6FA 4Z7JA 2DBVO 3I05A 5TY0A 1YQUA 4EKNB 1RYBA 3SJ7A 1W5TA 5L95A 2VRBA 2QP3A 4XCQA 3CLUC 1D03A 2OAGA 4ITUA 4M1YA 5K51A 3HU5A 4BQPA 1NMQA 1WL8A 3OIDA 2PQ6A 1TTQB 3HACA 3INRA 4KQEA 1KXJA 4YJKA 4MSUA 5CW1A 1X1QA 2AYYA 4BVGA 1Z34A 4BVBA 3JY6A 5DULA 4ALJA 4L5CA 1BS9A 1H85A 1RYZA 3DV2A 1KJIA 4OQFA 1W88A 1CZKA 2X0NA 3II6X 3TTYA 3OFND 1A9PA 1O2DA 4UULA 5J58A 4TMZA 3JCZA 5TPZA 3NIFB 4R2LA 1NKSA 3F4BA 4BJ1A 3HTXA 3ND7A 4I1OA 3HL0A 2ZYVX 5D1HA 2QV0A 2GHTA 4IJUA 2XT9A 1J5EB 1QRUA 5KSOA 5T4HA 5BT8A 1JFRA 3N6RA 1UBUS 4NYJR 3QF7A 2D0OB 1P73A 3KDPA 5LD2B 3QVJA 3FOBA 1M34A 4NR0A 3ZU6A 4AULA 3CLUD 4DCOA 1U11A 4ZPXA 4GI2A 2XAAA 4KR9A 3T7SA 4DY4A 2IPXA 2IC5A 2AX4A 3V4ZA 4DFDA 5FV7A 3UMMA 3I6BA 1QTIA 5KQLA 3DKPA 5C52B 5A6SB 1OH7A 2FKAA 1VSTA 2GETA 3O73A 4KRGA 5JCOA 4KNYA 3MAJA 1U98A 4D4HA 3L46A 1ZW6A 1WMDA 2YC4C 4XI9A 5AVKA 4DDUA 4E08A 2ECOA 3HJCA 2XB2A 1FVOA 1N2ZA 4ER7A 1OV6A 3U31A 1PGPA 2H5IA 5K9ZA 3U7HB 5E4FA 2A0UA 3CRRA 4OGGA 1YMQA 3AI3A 3LBAA 3DE7X 4ZOBA 5F51A 4RTNA 2P62A 3P5SA 1WUKS 2PEZA 1ZJ5A 2O2IA 3IOMA 3OM9A 4MS1A 1FY2A 1Q44A 2FFQA 2Q21A 4ZVNA 5KYYB 3GLGE 1A1VA 4BY9E 2QJWA 1STOA 3F8WA 4JFAA 4EF4A 4H1UA 1WUHS 3G82C 4JJGA 5CFNA 3CBQA 3IEIA 3E5MA 4L74A 3RTBA 4E2FA 4P3XA 3EOBI 3OUTA 2P5UA 5GAJA 3WGTA 5J47A 4R68A 4J75A 2VP0A 2CBXA 2B6HA 2F6RA 3V8PA 4YV2A 2GAOA 3GNQA 3LVQE 3LPAA 1YQQA 3M1AA 4IZIA 5CB6A 5JTTA 1XJ5A 1R3UA 3ORQA 3EYWA 1OLXA 3VI4B 3KQQA 3X1JA 3PNVA 1M2OA 1SHUX 1IULA 1GPH1 1CUBA 2CVOA 3DDZX 2OB2A 2XVYA 1SZDA 3JQAD 4JUIA 4NZZA 1NQVA 2WM2A 2WD7A 3ZWKA 2W58A 4BIMA 1WZ2A 5TGDA 1T36B 1SVMA 1XEAA 2JFUA 3A26A 2XCQA 1UZUA 1T0JB 2FG5A 3OZVA 1JFTA 3L1KA 2IZ7A 2LR0A 4G09A 1SU6A 1E6UA 4K8RB 4CDRA 4IQFA 1FSGA 1SVLA 4YX9A 2B0CA 3HBJA 1D2GA 4XD2A 3OZGA 1DX4A 5DLEA 1V45E 1FXUA 3AIIA 1J0XO 1TQ2A 1BWSA 2X1MA 1SG6A 3PFNA 2RH5A 4OJKA 3TDNA 3M49A 3RFFA 4FSHA 1Y81A 1YBMA 4AMVA 2FMIA 1MCZA 2ZAYA 3H3XA 2HYIC 1ZPDA 3IHTA 1RJFA 3QBEA 3WLFA 2HIAA 5A5VA 2BZ0A 4J90A 1DLJA 2AG1A 3IT0A 4D9MA 3U3OA 1M2KA 3E9DA 3E61A 1TMYA 1K5DA 5A04A 3UMYA 2H7VA 3VR1A 1ELOA 3JD1A 4KLAA 5HP4A 2EHDA 3N2GB 2FPXA 4EQ6B 4YMUA 1W25A 2HGZA 2ZDGA 1U3VA 2JBAB 2E18A 4FI3C 2OCLA 4CV0A 4TYPA 1GKYA 2ZGVA 3FPFA 4FYVA 4GZ3A 4EG1A 5FXMA 1XN4A 4IF4A 2BN4A 4KXWA 4DV1B 4BNUA 2ONKA 3BRWA 3JTMA 3NTOA 4JXZA 1NYLA 2X8JB 1IN4A 5JI2E 4YCMA 2EZUA 1PW5A 2KSQA 2M32A 4E1AA 1WIWA 2W8BA 1XDWA 3WG9A 4FMPA 4C4OA 3IUQA 4WBNB 2PXAA 1JDPA 4BO8A 4D4MA 4L8VA 3JYOA 4U0JA 2K2QB 1E2EA 2I67A 2DPHA 3VO9A 3K70D 3MRSA 3MWEB 4QKQA 3B51X 5AJXA 1V11A 4NENA 1HZZA 2YVKA 3DTVD 3KTAB 1H0SA 2LGJA 5T3UA 4K2HA 1HG0A 3DP7A 4N3BA 3JAWB 1THZA 4ZJUA 2NNWB 4NEQA 5K8UA 1IG0A 5HJEA 3FUXA 5FTNA 4ARAA 4GC9A 2DBZA 2C96A 1VKZA 2I4RA 1G18A 3PLRA 5B3AA 2PBRA 2I7TA 3AVPA 4BVKA 2XT6A 1HH4A 3UQYS 5JWRA 5KNCA 1WETA 4FOLA 1JAIA 2GJAA 2P8JA 3FHJA 1GTJ1 3QE3A 4MPDA 5JWHA 4DZZA 4R4JA 2H48A 4EUKA 3SYMA 4TQGA 3AHDA 3D8HA 3GRCA 4EVIA 5BV1A 4TYWA 5DGXA 2JIOA 1Y3HA 1YONA 4FFMA 1TT5A 4I2NA 1T4CB 4Z9FA 1QXSA 3HEBA 5KYXA 5C18A 4XVRA 1Z0AA 1YR3A 2GASA 3I5YA 5SZKB 5DHPA 1N1DA 3IUEA 4YA6A 3DA8A 4V24A 4OI2A 3EWNA 1CR4A 1E3EA 3K0AA 5DDIP 1HEYA 2GYUA 3FZYA 4IV5A 4TRRA 5A3JA 2ANCA 5H7XA 1ZYUA 2VR1A 3KJIA 3FR8A 3ZJ4A 3EZNA 4F56A 3Q85A 5D6OA 4MCJA 4CMEC 3AJ9A 3W90A 4DB2A 1T5SA 4EI8A 4KWTA 1RMQA 3L6EA 3A36A 4OXQA 4BNGA 2H2IA 4G9EA 3X2SA 1K4MA 2GLTA 3FFWA 3QXJA 2GKSA 2KQUA 2NQTA 4DIKA 1YDMA 4ZYVA 4AWBA 2G0NA 3DCNA 2PN1A 2ZUUA 3UGQA 4YBRA 3X1KA 2VZ0A 3IKLA 4EHHA 2NO9A 5L6LB 4CODB 1PT8A 3U4GA 3PHBE 5A6VA 3F8SA 4XFKA 1B0AA 4E5UA 4DW8A 4Z2AA 4BNXA 4PICA 4E6EA 4BWVA 4B0PA 4BFWA 4BV9A 1D1TA 4QGBA 3FOEC 5HKBA 4DQLA 1HSZA 1E2HA 1Y8CA 2WF7A 3DVLA 4IVRA 1DQNA 1THTA 4NXNB 1XFDA 3I9FA 4OHWA 3BF7A 4G4SO 2P1DA 1BQEA 3FYTA 1WSBA 2CL0X 1E2KA 3E03A 1GT6A 1LV7A 1ZN7A 1EE1A 4TZKA 2QF7A 4GMXA 1P0FA 1PIWA 2OV2A 3BGDA 1ZOLA 3PK0A 1X3SA 4B8ZA 3JD0A 3WTCA 3NAZA 4YALA 1E4YA 3ANLA 4LHYA 3AOEC 4JWTA 3S99A 3VR6H 5IFLA 1ZM4A 1Y7IA 1JDBB 1XPRA 2AR7A 3OBBA 1NVAA 2WHPB 4FYXA 1KE2A 4FHGA 3SPXA 4EPTA 1BW9B 3FI0A 4JBXA 3FKQA 4MUAA 5LUBA 4AS2A 4Z3OA 2IP2A 1VYHA 3F1KA 2BEWA 3ZKWA 3N8IA 4D80A 1E2FA 2OHHA 3D2CA 4E3WA 4DA7A 3GLHA 5HDBB 2CHEA 3DLTA 4LOKA 1L5WA 3ZQKA 2Q2QA 3OZAA 3AVXA 4FHCA 2DT5A 1TYBE 3FRJA 1ZSYA 4X97A 5HCNA 4F4IA 2XH8A 3B6EA 4MINA 621PA 1U63A 1HNXB 5BOSA 4HGPA 4Q3DA 4B6SA 3BWVA 3QUTA 4TXLA 5HEKA 1DRWA 4R7TA 1YQ9A 1UC9A 4C4TA 3SBEA 2HQRA 1WEHA 1QKIA 2N1BA 2QRUA 3G5TA 1L5SA 1T43A 3GIDA 2D13A 4C0XA 5HZKA 5J2TA 2O3SA 2QPLA 4Q15A 1N7HA 3DH0A 1E6EA 1NLFA 1PL8A 4YUYA 2ZXEA 3KJXA