3L40A

Crystal structure of s. pombe brc1 brct5-brct6 domains
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
TNAKASKRVYITFTGYDKKPSIDNLKKLDMSITSNPSKCTHLIAPRILRTSKFLCSIPYGPCVVTMDWINSCLKTHEIVDEEPYLLNDPEKELELGCTLESALKRARAQGPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKRLARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTIFLQNYDWLIKTVLRQEIDVNDRIADEFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BRCT-containing protein 1
publication title gammaH2A binds Brc1 to maintain genome integrity during S-phase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 72
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l40A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l40A02
3HUFA 5ECGC 2D8MA 2E2WA 2R1ZA 2VXBA 3K05A 3PC8A 2VXCA 2EBUA 4Y2GA 3HUEA 3PXDA 2HTFA 2COUA 4N40A 1OQAA 1T15A 3SHVA 3QVGA 4BMDA 3SQDA 3PC7A 2WT8A 1JNXX 4XQ0A 3T7JA 4BU0A 2COEA 3PC8C 2XNKA 3T7IA 1T2UA 4Y18A 2INGX 3K15A 2DUNA 4BU1A 3FA2A 1T29A 3EF0A 2K6GA 1IN1A 3U3ZA 3L40A 2M2IA 4XPZA 3UEOA 3I0MA 3K0HA 1L0BA 3PC6A 3OLCX 3PA6A 4BMCA 1IMOA 2ADOA 1WF6A 4IFIA 2K7FA 3KTFA 2EP8A 3PXEA 3SZMA 2XNHA 3L46A 3T7KA 2COKA 3SHTA 1KZYC 3AL2A 2JW5A 3EF1A 3UENA 3AL3A 3PXBA 1CDZA 1GZHB 3II6X 2AZMA 3PXCX 3K0KA 4IGKA 3COJA 3PXAA 3PD7A 3L41A 3QVGB 3K16A 4ID3A 2ETXA 1N5OX 1Z56C 1L7BA 1Y98A 2LE0A 3T1NA 2L42A 4OFBA 2NTEA 3JVEA 2EBWA 1T2VA 4JLUA 4U4AA 3I0NA
chains in the Genus database with same CATH superfamily
3UJ9A 2F3UA 4YJ2B 3GJ4A 4YAEA 1CUVA 1W9HA 3QU5A 3LSTA 3FOCA 4J0KA 2GUGA 4KAAA 1CJMA 4KQFA 1TYEB 3I72A 4LX8A 3FWHA 4YAIA 5BVHB 4IKEA 1H8EA 3P0EA 4BN0A 1JSCA 1KNQA 3QKUA 2IH4A 4IIJA 3VDRA 1VG9B 1Z34A 2MTBA 1ZISA 4QULA 4RMHA 4TMTA 1IQ0A 2OXEA 4BZXA 3KOWA 4QG7A 1TL7C 5U1PA 1JIVA 2QM8A 3E1SA 3N8IA 3QELB 4F3NA 2R79A 2Z9CA 4RL6A 1CHDA 4WV3A 3P5SA 5BVGB 1GU0A 2ASVA 4E51A 5DF1A 5FA5A 1AMUA 2ZE8A 3SDSA 5LVAA 1ISRA 1U0TA 4OYLA 3S2UA 1MO5A 2H92A 4TV9F 4XCQA 5DHAA 2NZ8A 1S2GA 5E3JA 1N4AA 4AZ0B 4FOLA 3LO8A 1XTKA 2OORA 3PEYA 5J58A 4RLFA 2BFBA 5MN5A 4WECA 5D6OA 3AHIA 1BE6A 4EA9A 4ARCA 4BU1A 1RWBA 4HV4A 2QUBA 3BKWA 2CNNA 4JUDX 2K4MA 2WSSA 3CWZA 3DOIA 2P9GA 4DNOA 2AE1A 1I3OA 1HDZA 3CCCA 4EQ6A 1C4XA 4DL9A 1YUMA 4DLUA 4ND5A 4F2WA 7YASA 2Q0XA 4HEJA 1N8NA 5D86A 3UT6A 3GRRA 1SVNA 5IX8A 1W47A 2A86A 3DQPA 4YJ2A 3V7FA 5CXQA 1T1JA 1WUKS 4L7QA 2PQ0A 4N7MA 3SE7A 1QFSA 1LV8A 2A58A 3DL7A 3FMVA 4LXTA 4RNCA 4AJ1A 4CU5A 3PA6A 2IU0A 4OLAA 2BMFA 3D7KA 3SXUB 5MGBA 3D3EA 2UZAA 4CM4A 1JP7A 1TM1E 1VJ0A 4JNKA 5HRUA 3STUA 1JU9A 3CRMA 1CLEA 3KJNA 3NOOA 1AO0A 1W36B 5JBIA 1DEAA 1L5QA 4U8GA 5L3RA 3OJ0A 3M6LA 2X7HA 1AHHA 4YLGA 3VSCA 5CLJA 4KR6A 2LIPA 2G1UA 1Q83A 2G83A 2OHOA 3OJXA 1ZOLA 3HWRA 2AE2A 3P9NA 1AUVA 3PDWA 4I14A 4YRPA 3H1AA 3JRXA 4DAOA 4B0PA 3WMRA 2A0WA 5DHSA 4GKAA 1FSGA 4J0FA 2ZIXB 5E3IA 5FF9A 5K2MA 2QLTA 4N47A 1JX6A 4JSYA 4K87A 2YC4C 3M6MD 2I4OA 5F7JA 3N5KA 2GBGA 2JAWA 2NSHA 1LJ8A 1X8JA 3TIXB 4C0XA 3AEYA 3DM5A 1Z56C 4NOMA 4QAQA 3GLFA 1DJLA 4CBVA 1EFPB 1JYEA 2I3DA 2IYTA 2KMLA 3R9XB 2RHTA 4NH4A 5F7XA 1GGNA 2JH9A 4DRYA 2Z5VA 1C8KA 2HHJA 3LKBA 4HBGA 4HT3B 2FR8A 2C5LA 2H48A 1SVKA 3LPNA 4DPLA 3CIFA 2PRJA 5LKAA 2WVHA 1RLMA 4C0BA 2XB9A 4MS4B 2BF4A 2NO7A 3PITA 3LRTA 5H3LA 2YIJA 2FKAA 2YY5A 1FY2A 4BVHA 4HNUA 4BUCA 4DBLE 2R7LA 2YZMA 3SS8A 3WLTA 3KJIA 3BGIA 4DRXB 3IB3A 4NPHA 3ZHRA 1HMYA 1LSJA 2O1EA 4LSZA 3UZUA 1G55A 1LSUA 1VRCA 3P9PA 2B1QA 1OX4B 4H35A 1XAJA 4NZOA 4P9NA 2AI3A 3VU9B 4FT2A 1OY1A 5T8KA 5AWFC 1M34A 3AO0B 2ZIXA 2W2MA 2WIBA 4O63O 3DBRA 5ER9A 3V7YA 1F2TA 2ZOSA 4KEAA 1NFQA 5AJWA 4E5UA 1UKVY 2CMGA 3L8EA 1SXGA 3SHVA 4E0BA 1JG2A 1P1CA 4IO0A 5E6RB 5G3YA 2XYVA 3G9QA 3UKOA 4UNNA 5BRAA 5JEDA 3DDSA 1QHNA 1ZVKA 3FJ1A 3MXTA 4KC0A 3SC4A 1Z13A 3SHOA 3R9XA 4N54A 3WDMA 5DOVA 2P62A 4QNRA 1DKMA 2R4UA 3F0TA 4IXWA 4GL2A 1YB5A 5EOVA 1QGDA 2PGNA 2R96A 4BO1A 4ZDKA 5BN1A 1JYSA 3PUYA 2XEXA 2CCGA 2NM0A 3BK7A 3NFRA 2BM1A 4PQFA 3SBEA 2AX4A 4FLEA 4WLOA 2G06A 2DPYA 2ZBEA 3FKSD 5E6UA 5EKDA 4QZVA 1QGZA 3K9NA 5C3MA 4COKA 1KFBB 1QE0A 1KXJA 5EIOA 1SN7A 3A37A 2W11A 1JSRA 4BUJA 3KDAA 4QDZA 2V1UA 1NG9A 2HLDD 2VDQB 1UC8A 2V6MA 3T0IA 2B2NA 1GU7A 2BKLA 1TLFA 2GWHA 2DPMA 4XPIB 5K20A 1ZUD1 3AEQA 3RS9A 2FMHA 5FTMA 1YONA 3QOFA 4D9MA 2F3RA 2YV3A 3RJZA 1X7WB 4DRXA 1KO8A 1B6SA 4GI1A 1PF7E 4CL3A 1VIMA 1V2HE 2OCLA 1QB8A 3VU9A 4ETMA 2QBYB 1I94B 4OXKA 1ZN7A 3OTQA 4F5DA 4HLCA 4FCVA 2VO1A 3W7AA 5F5XA 4YRRA 2G80A 2PO7A 1NATA 3USZA 3AOEA 2DUWA 3HE3A 1SVSA 3MCVA 1N0VC 4YB8A 3TNJA 3KYJB 2FN8A 2AJCA 3T4UA 2V4UA 3FJOA 1PLLA 4RPHA 5E6RA 5FTNA 3K8YA 3BD9A 1GPNA 2QE7A 2NAFA 3G2QA 1MAVA 1IN7A 5KNDH 1E7QA 1RCFA 1FRQA 1OI4A 2OBYA 2OEPA 3AIKA 3KU1A 4K5QA 4UVHA 1L5NA 3UFBA 1XKQA 4B6OA 5I01A 4QU0A 1WB4A 2FSHA 2E49A 3H99A 1II0A 4KL8S 4UUNA 2CNOA 2PS3A 5LZ7A 2X4LA 1UC4B 5SZJA 2R8YA 2V6IA 4IDAA 3DAGA 1ZWKA 5I7EA 1MABB 4U2FA 3ZWYA 3PLNA 2KHZA 1SXJA 1WBJB 1RMQA 5CVVA 4W7SA 2ZRAA 2BEWA 1CULC 4HC4A 4HDAA 1ZR2A 5AXCA 3MBKA 4EJMA 1ZVQA 1VGRA 2F1HA 2SICE 4BWYA 5ALXA 2OGUA 2P90A 2BR4A 3U7QB 4RDHA 5ERYA 1HT0A 1ZA1A 4N6OA 1CUZA 2O5CA 1QVAA 4PLCA 3UJAA 3QXHA 3VZDA 3UM9A 3KEOA 4IIYA 3OZWA 2JKZA 1DUVG 4US1R 1KETA 3AUFA 4YTEA 4A2CA 2CBXA 4LHYA 1SU8A 1UXJA 2J3IA 3B1FA 1VYHA 1KKUA 1GWNA 1SRRA 1RRGA 2OP1A 1D8TA 2PZEA 4XR9A 3IMGA 5K4HA 3GJSA 1U5BB 2DT5A 2JGDB 2NZUG 2Y4NA 1YZLA 2ZEJA 3A6EA 1U99A 2PVCA 3JV7A 4KVZA 4RFVA 2H5EA 1K88A 4C3UA 4YT5A 1AGNA 4HAIA 1UEXC 1RBQA 3C74A 1UDXA 2WWHA 5E4TA 1T2EA 1X9HA 5BXQC 4NYMR 4JUCA 3ILHA 5GONA 1G38A 4JASB 5BQPA 2HLPA 3RJ9A 3ZGLA 1NYRA 3PNQA 3E9NA 3BRQA 3R0IA 3UJHA 3LU1A 4E2ZA 3C15C 1ZUHA 4OJYA 1E6EA 2ERCA 3SWWA 4JB0A 1FDOA 5JAZA 1O94D 4HAOA 1N2JA 4OHCA 3QMMA 4UEKA 4DM4A 3M1IA 2PH3A 5AQEA 4F8JA 1EUYA 3FPCA 5LA6F 7AT1A 3DQQA 1XI2A 2BGTA 3P32A 4BQOA 2OQRA 1YI0A 2EKQA 3VUFA 2FGJA 4M8LA 1O54A 1SY7A 1T5SA 1ISJA 2OLEA 3FPHA 3G0CA 4CMEC 4KITB 2XMCA 3IAS1 2XRYA 3OZVA 2FSVC 3U7QA 5FEUA 3WRYC 4ONEA 2QUZA 1TJNA 1YKSA 1UM9B 2YMPA 3O1HB 2CMHA 4RQTA 3ZJ4A 4C1NA 1T9HA 4Q01A 2IYPA 2DP4E 5DLPA 2ZVPX 5KC8A 3UOAB 4BXOB 1JQKA 1IK6A 2O2JA 4L51A 1T4GA 2DF8A 4EP1A 4FW9A 1CYDA 4ZEMA 2VDOB 1I80A 1EUZA 1XTTA 1FW8A 1P74A 2CLIB 2YWDA 4NNJA 1Z17A 2V7TA 4E5NA 5B7QA 1KI1A 1JIUA 1U5BA 2JGDA 3NAQA 5CM9C 3ZTWA 4FZ3A 4DJ5X 5JQGA 4O3MA 3W6UA 3DBLA 4WCFB 1GTJ1 4QQ8A 5I8PA 2WSIA 2QXYA 4ZPXA 2OM2A 3NNSA 3OPVA 4AG3A 3KL2A 5DFAA 2HF7A 2F1OA 2HQSA 1IXZA 2B30A 3EC1A 4IDPA 3VFDA 4ESHA 3G0HA 2FP3A 1WZUA 1N5MA 3CZRA 2IGBA 3LNTA 5C31A 2OGSA 3ZHSA 4B48A 4R9NA 1VHDA 1H93A 2HYDA 3DCJA 3HDHA 3OEYA 4YV0A 1F8UA 3GMSA 1OH8A 3PVSA 5HF5A 1USGA 2QR5A 1KTVA 1BD4A 1L4EA 2I7DA 2XTZA 3HI6A 1UJ5A 4LOLA 4RACA 3ZWXA 5CFRA 1U0GA 1YDGA 3KWFA 5EVJA 2G5GX 3IR6A 1TE2A 3VHRA 2HA6A 3LUAA 4NFYA 3GUUA 1SNYA 2WM8A 3GRVA 3WI7A 5J1SB 4HD8A 3KQKA 1W0KD 2Q0SA 3BMCA 4FFPA 1J00A 2XYHA 4F3KA 1E2BA 1GKUB 5JCJA 3GXOA 4MKIA 1BCSA 2YV1A 3K6KA 1KE1A 4BXOA 2PU7A 4FHZA 1GN8A 4D57A 5J2TB 1MX5A 4ZRMA 2ZLBA 3WBKA 2Z95A 3CUVA 2VHWA 1EX9A 1H2HA 3ISVA 4YIHA 1SCNE 1IWPB 3IT0A 1P9OA 4S0XA 2NU7A 1QSGA 3WIEA 4CTJA 3IULA 4WCFA 3K0FA 3ZDRA 6ABPA 3WL4A 5FCDA 3U3DA 1KA9H 5ED0A 5K09A 2RKBA 2BHSA 1Z5VA 4G0MA 3HY6A 2PKRA 4XEUA 4AKIA 3TQTA 4ND2A 4ND1A 2J48A 3HO8A 1M10A 2CJYA 2EU8A 1L8LA 3ILXA 4JC4A 4JR0A 5DGHA 4ZQEA 5EJAA 3R8XA 3UMSA 1QHEA 4X62B 2QN7A 4GPBA 4MPTA 5DOZA 3EDMA 1Z82A 1ZUNA 2ZJ3A 1NV8A 2VP9A 5I7RA 3IDZA 1B42A 3L7AA 4YP7A 5B2FA 1Q1NA 5L6MB 2B2XA 1V26A 3QJYA 4HDCA 2FMTA 3HUEA 3IXMA 2VDPB 2E1RA 4R84A 3RBXA 3PE4A 4DAEA 2XA1A 1TM5E 1HEYA 2Z8XA 3KDSE 3OZCA 3WLNA 3AUXA 4L16A 3TCKA 1J23A 1M67A 3ZU5A 2XV1A 1XLTC 2EKLA 1VHTA 5HX7A 2F43A 3IV9A 1UINA 4HZGA 4LNHA 4DFDA 3INNA 2DFDA 3SJBA 3OE5A 2DY0A 1FF9A 1IM2A 3TAXA 3KXKA 3R0XA 4FONA 421PA 2LVBA 3FNIA 4HVLA 1THTA 3CF0A 2QQ0A 5DW3A 4AZ3B 1RYYA 5A62A 2WUEA 3EEQA 4A73A 1RI3A 3NBKA 2W42A 2Q3JA 1N9GB 4GOXA 5JJLA 5TXGA 4BVLA 2D2IA 2G4VA 3Q98A 1TCVA 2EWVA 1D2HA 3WZLA 1FDVA 4KN5A 5A6SB 3LTEA 4EYGA 3EHEA 1I36A 1XLUA 3A6DA 3H8WA 3RGWS 3TXYA 2B8WA 5DM70 4MQEA 1FTQA 5HYVA 2C77A 4RH0A 2WKRA 2B98A 2VTBB 3KJXA 3O75A 1DG1G 1OWMA 1YA8A 3CLSC 3KPUA 2D5AA 4BVJA 3KETA 3HNRA 4L5BA 4Y0NA 1X38A 3WC4A 3TEFA 4IIJF 4RU1A 1H85A 2AFHB 1XQWA 2DKOA 4NE2A 2Q27A 1GR0A 3T9FA 4OAQA 5J4KA 4TLCA 1XRLA 3LP5A 1ZOIA 3ZY6A 5CVTA 4UHHA 4PAGA 5TY0A 4GS5A 2H29A 2XCOA 4WZAA 4Y8VA 2QR2A 1C4KA 1NC1A 1NN5A 1OGYA 3ED1A 1LPOA 3DONA 1OI7A 4MW0A 4N12A 3ZVMA 4I4TB 4B3XA 3HRKA 5E4JA 3GFFA 1N2BA 1YOVB 2O6HA 4EHNA 4KREA 2XQFA 1TO1E 2GKOA 4EO7A 4L5JA 5K3FA 3LCJA 4YS6A 4W8GA 4AY2A 4XB6B 2HCTA 1HQKA 4EPWA 5AD1A 4GP7A 1MZPA 4AZ3A 4YCAA 2X4GA 1OZAA 3RSGA 2P2ZA 2F62A 3H6GA 3I09A 2G9VA 1Z8FA 1O6BA 4OGLA 3EZLA 3BXXA 3UQZA 2QRJA 1U2QA 3N2KB 1BA2A 2WKSA 3P9SA 4O59O 1SUCA 4BQFA 5A6SA 2FYTA 1V41E 3T7CA 3LMKA 1AUPA 4FOOA 5FL3A 4Y6GB 4GWKA 5KQPA 4C0QC 5JIBA 3ZVLA 2FG6C 4B6FA 1T6XA 2JHPA 3E6AA 4RV4A 4ZT3A 5F2NA 3PDCA 3I12A 4BRZA 4CLHA 2CZCA 1EUDB 1V1MA 1OIWA 1P0QA 3W2IA 1BH2A 1NBWB 1BC5A 1J9GA 3F6YA 4EJSC 2YVAA 4G0OA 4N03A 2C9MA 1V37A 5D01A 5JFOA 2UUAB 2C3UA 1QZUA 3TFQA 4ZOBA 1AGRA 1MC1A 4AJIA 1CUSA 2VJKA 4HNGA 1V45E 1NVXQ 3DZKA 2XXAA 3L7MA 5CGZA 1GARA 3LWDA 3Q8KA 3I62A 1MH9A 2IPLA 3LS2A 3WV5A 3GP5A 1L8XA 1QHIA 5EMJA 2FOLA 1DWOA 4ZEWA 3DDCA 2QLMA 2CWDA 1M2WA 1TW3A 1HYGA 1PL0A 1RAEA 1O9HA 3BTOA 4BTVA 2F59A 3CE6A 4HX5A 1JLSA 4O4HB 4RD0A 4RPLA 1ZNYA 2JGKA 3GLKA 3QEOA 3R7WB 3TD6A 3HR7A 2FDXA 3E3OA 2HFKA 2H52A 5E1OA 4IXNA 4EYOA 1IXKA 4I6EA 4YQEA 3NM4A 4D2IA 1KZ6A 1NPYA 4OP2A 3CT6A 3T3HA 3QPCA 1K6JA 3ZZNA 4B40A 1G5QA 3DXZA 4PO1A 2WQZA 3RU2A 4HTAA 3PFHA 2JIOA 3Q7QA 4P93A 4AIIA 5IWCA 3A6ZA 3DULA 5JEEA 1YZFA 4K03A 4KB5A 4FBLA 4A0RA 2CSUA 3TUZC 3D64A 2R6CA 1OXKB 4C76A 1CUYA 1Z0ZA 1ADJA 1EUDA 2B1JA 1ZYUA 3HCFA 2P9EA 4E22A 4FZJA 2AGVA 1GTVA 4LJ5A 4LY3A 1UKEA 5CNKA 2JF0A 3U3KA 5G1OA 2ONJA 4XUGB 3JQAA 2A59A 4AG5A 4DMMA 1DWPA 2JEYA 2SHKA 5D84A 3ZQKA 2UYGA 1Z12A 2OOSA 3RKUA 3LLSA 4LYDA 2Y77A 4FC7A 2QMHA 4P3KA 4EB6B 1NRJB 3JQ6A 1GAQA 4S1OA 4OGFA 3AYXB 1MG0A 4Q4DA 3BIWA 1H9AA 2RH4A 3IQEA 1Z08A 2ODEA 5T4FA 1T1GA 2DKFA 2ODAA 4QYSA 3WMXA 1GU1A 2VJAA 2ZRIA 3I4LA 1YZUA 3L0OA 4KCGA 4F9EA 1X0VA 4Q4JA 3D6MA 1APBA 2V3WA 3EVGA 3R7WA 4EG8A 4K9KA 4ZEVA 4YRIA 3VTKA 2CUZA 4B35A 2Q3BA 5EP2A 4B8ZA 3T5MA 5ICSA 4E30A 5FQOA 5IUKC 3PWSA 3X1JA 2E7ZA 3B13B 1KDYA 2H31A 2CXPA 1DJQA 2PLWA 4WJKB 5B58T 3X2FA 4GPTA 2DQ4A 3M1AA 1FXWA 4CG2A 3NALA 1GPDG 3BDIA 4DNFA 2F8TA 4JLMA 3C6YA 1QLJA 3PHJA 5DNAA 3L6BA 3U7RA 4AUEA 4C3VA 3O4RA 4EBBA 2GPTA 2BEUB 2IIVA 3BMQA 3L8MA 4IYRA 4M1MA 4BDTA 5G4KB 1Y1RA 2HK6A 1OLSB 2X9QA 1RYNA 2PUGA 3VR0A 3I28A 4NOJA 2WJWA 4ZI5A 1QIFA 4DEYA 1BXGA 2KJQA 2I4TA 3QTLA 1PV2A 1ZJZA 3JVIA 4O2LA 3EZ7A 4KSCA 5GJBA 1U9CA 1PR2A 1H9CA 3DJFA 3C4JA 2HPHA 2IVZA 1U0RA 2JFVA 1NDHA 4PG6A 2C61A 1H3FA 1ODKA 1TRHA 1VHWA 1VPTA 2RMKA 1C0EA 3NHMA 4X3CA 5CCDA 3VPHA 4DBZA 2Q8QA 1W87A 4EI9A 2A7QA 4YQYA 5E8RA 3P2JA 4BN5A 1Z5GA 2BTOA 3C2QA 3V7WA 2J5RA 2PL9A 4RFLA 3ZXXA 2PPLA 4D3SA 4EL5A 5KYYB 3L8GA 1V1JA 2XOXA 3OPXA 3BL6A 2QUJA 4EVIA 1Y5NA 2AG6A 4JEHA 4JI3B 3B6EA 1QHGA 1JHDA 1PP4A 3JVEA 1B8VA 2QGFA 3AR8A 1GGHA 1MH1A 3HBAA 5IDQA 5B7GA 4AX8A 1G8HA 3MA0A 1ESMA 2EKZA 3IHKA 3F98A 1OXBB 3AKZA 2VOJA 4OB6A 1KP3A 3TCNA 3S2EA 4R69A 4WXHA 3VPBA 4IPTA 4RSHA 1U8XX 1EI9A 3OQIB 3NI2A 2I3GA 1M7HA 3DBHB 4I9HA 4MLPA 4CKCB 5J23A 1L5FA 2FFQA 3K8OE 1TM4E 1UJMA 4M1ZA 1SC4A 4QO7A 4YDSA 2LTAA 1B6TA 1XKLA 2VQ6A 4QX6A 3W5BA 2ECOA 1YACA 5J5CA 5CYPA 4C7OB 5KSYA 3G8AA 4J29A 2FPRA 4I81A 5G4KA 4G36A 4TMXA 2PKQP 2JLZA 2G77B 1MFPA 2E6UX 3N59A 4R1SA 2Y1KA 3D4IA 4Q7JB 5JXHA 3G2PA 1G2QA 5EHIA 5B1DA 3P2MA 1V47A 3DP9A 3HG7A 1WP9A 1CIPA 1O94C 4PQYA 4O0LA 2FSUA 1GSHA 4D3YA 4P81A 4Q3NA 2V65A 3ZPXA 4DWOA 3GEPA 4YHBA 1Q0QA 3ZE9A 5LQDA 4RGYA 3O90A 4AO6A 4TT3A 1HDYA 2I2CA 5AK5A 1WEHA 2GN0A 3PGA1 5H5JA 3SAJA 4AIRA 1HH4A 2OHJA 4LCJA 1I1OA 4HZIA 3Q15C 4MPJA 3ZBUA 3PJRA 3AUSA 1XP8A 1KMMA 1Q0ZA 1LLCA 3O74A 2O50A 2O52A 4C08A 5JXWA 1FNDA 1O97C 1ISFA 1LI5A 1VG8A 2FWJA 3SFVA 1I0IA 3L7DA 1QYDA 3F97A 5KUTA 2ZRNA 3EEBA 1KZ1A 2I33A 4M88A 3ULKA 2H1WA 3OQIA 5LSAA 3SIWA 3WHPA 2ZT8A 4AP9A 1MOSA 1N1MA 4I50A 3RC7A 4J7UA 3KOOA 2HIAA 1CS0B 3M9XA 3NBUA 4RVCA 4UC0A 2NVBA 3WP0A 3RANA 2W0MA 1ETHA 3GJ5A 3QVUA 3WISA 5KJ1A 4C7OA 2PZJA 4ZAYA 3FVRA 2DR3A 4LKRA 4Z2YA 4Z51A 4B3DA 3INRA 1Z6XA 4QOEA 4DYHA 1SUPA 3GFPA 3TD2A 1J39A 4NJEA 1CY6A 1OHHA 4N0EA 2C20A 1X19A 4Z2AA 1EKXA 1JKIA 5B7NA 1PJAA 4Y3UA 3ZE7A 2MSDB 2F8MA 4PLZA 3Q1LA 4TKZA 5CB4A 2R7KA 2WWFA 1KVSA 4B71A 2N9UA 1QMPA 1SXJE 1LVUA 3NP7A 4CDGA 3IA7A 3OPYB 2X9NA 2QN3A 1KVUA 4F3CA 3ZCVA 5HJ7A 3TIFA 3ELDA 2C8VA 2WYOA 3K1YA 5K05A 4NMLA 3V8EA 4W9MC 1FDTA 3MELA 2J6HA 4DT1B 1XTQA 3QVTA 2J4CA 3O2NA 4PYLA 4UVIA 4G0WA 5B4VA 1XVAA 1T3ZA 3B52X 1PYGA 2QZZA 3ILVA 3G79A 4KR9A 1EDEA 3SYLA 4HFMA 5A5DA 1AF4A 2J0VA 3IVCA 5TARA 3VM6A 3P4XA 2OMKA 1VCIA 4L4SA 4PLHA 5FPSA 2P0AA 1O9GA 3OECA 1XHEA 5DYIA 3N87A 5TF0A 5BWCA 5B3JA 2VAPA 4KLAA 4LJ7A 5DBOA 3TKAA 2RAPA 3WRWA 5BMOA 3K9LA 4FWTA 1J5EB 1Q5PA 4JWKA 4BEWA 4D6YA 2XE8A 4FLFA 2IEBA 1P7YA 2DECA 4WK2B 2QRVB 2RH5A 1B00A 2C95A 5J5AA 3PXGA 4J7AA 1OKKD 1SCQA 1DMRA 3GL9A 4MQUA 5JECA 5B6JA 3NXSA 2IYFA 1Q95A 2YCBA 1FNNA 4FFDA 4YGXB 3VU3A 3DD5A 1A9ZA 1JN0A 4HUTA 4OXIA 2WIGA 4E88A 4CLEA 3OE4A 4Z1MD 4RTNA 2ZAIA 1Z83A 3ZJVA 4AKGA 1Z73A 3O4GA 1CZUA 4M83A 1PJBA 2BFDB 2OK8A 2WV7A 3Q41A 4XTRA 5JT1A 2IBTA 4FHGA 1GAXA 1JDBC 1JKFA 2BMAA 3W1VA 1AQJA 3ZVKA 2XGJA 3VU0A 2J1LA 3KBBA 2OV4A 2QTAA 1OSNA 2P2DA 3LUDA 3ZX4A 4EHDA 4FD3A 3M4ZA 3MMSA 4LTMA 8ATCA 4AMGA 3UYKA 1UXOA 2I1VB 4INOA 1ZD1A 1MTOA 1ZGGA 3ASYA 4U02A 2A4MA 3V5NA 3LG2A 4M9UA 3ZW7A 1M2OB 3JQ9C 1XMXA 2GETA 2QLNA 1C0LA 1NUTA 2HWYA 4LZOA 1UQTA 4LVOA 4WY8A 4QXPA 1OV6A 4E32A 1MB0A 4NG4A 2D1TA 3VDQA 3UAGA 3OTOB 2M2IA 5A3RA 2XHEA 2Z8ZA 3RF6A 2HWXA 3KZ1E 4M60A 4DXAA 3N6XA 2CXOA 3PDIA 1B6RA 3UEOA 2HEIA 4RTOA 4FKBA 1H8HD 1N3BA 2QRVA 1UBMS 2NSDA 2RGUA 3ZGYA 4TSKA 1RYDA 4K6KA 2V03A 2WU0A 2GPSA 1HG1A 5ENVA 4FKZA 5EMKA 1V1RB 3K09A 5LDHA 5AHOA 1NX6A 2C3MA 5DNWA 4ZAGA 1J0CA 3MBIA 4EF6A 4AG6A 5LQJA 4FQ7A 1ZIXA 2F3PA 5DKFA 1X3LA 4CEHB 4P7JA 4ETIA 3H5VA 2I3AA 1H66A 2J7PD 2NV6A 1U9YA 4DDHA 1MG5A 1I2ZA 2X15A 4P4LA 4GWGA 1BU5A 2JCYA 1KZ4A 2HAEA 2JIZA 1T13A 2WUGA 3MVEA 3NHFA 2D54A 4G5GA 4RY8A 1AK2A 2YFHA 3TQSA 5AESA 5G3ZA 2OGWA 4OYHA 5J59A 5JASA 3TFOA 4RE5A 4X63A 3CKMA 1HEUA 4N8DA 2XSZA 1E2EA 5C2JB 1JBQA 1XPUA 5AKZA 1Z2CA 1M2OA 1RXSA 3QIVA 4QQNA 3D6AA 1Q1AA 3S3TA 1N57A 3IH5A 3ORYA 2C3OA 1JUDA 5FNZA 1R5NA 3O8BA 2A94A 4PC3A 4PCUA 3V2HA 2VFAA 3KU4A 1IHUA 4JT4A 4M9ZA 5GGXA 5LQAA 2R5NA 1F7VA 2HUPA 4TWIA 3ERCA 2JGIA 1K4MA 2GN8A 1UJ2A 4G24A 4KXUA 3OO0A 2AW5A 3IBCA 4N3NA 3H3JA 5K9ZA 3KQPA 1NN3A 1ODSA 4PFJA 3OURA 3N2GB 3SQXA 1YL7A 2EGGA 3OEHA 1GLNA 4KE9A 4P5DA 4FFRA 4X8LA 4TMKA 1P2DA 4W63A 1USVA 3GMTA 2DLDA 3UANA 4O0MA 5IFLA 4H7HA 1AZTA 3GEHA 4ZZ2A 4BLTA 1JBEA 3GG9A 4G9BA 4BPRA 1DAMA 4OQZA 1Z88A 3SQDA 4CEHA 1XMVA 3DGEC 3AG5A 4BNYA 4B1FA 3IP9A 5SY9A 3AHHA 4M1TA 4MWSA 4QAJA 2EF0A 2J3HA 4KFRA 1GPYA 1XK7A 3TLMA 2XVMA 4RX1A 4MYCA 2WB4A 1TYCA 4WVFA 5JVDF 5CFMA 1AQLA 1AKTA 1T9KA 3ECSA 4G85A 3DBVO 1E9AA 1ZK0A 1T1SA 2P4EA 3H8SA 2PLFA 3KUDA 3MQ4A 5AW8A 3KUKA 1M74A 1KQNA 2OAEA 3OUZA 1EDBA 3BRWA 3KK0A 2IPNA 4KXLA 4LDPA 1IWBB 4QQKA 1N5JA 5J3JA 3LXUX 1I2CA 1SULA 1FFGA 4C7XA 3TB6A 1UMCB 1TM3E 4BZWA 4IINA 3MRXA 4CWAA 4EKGA 1EXMA 2XRFA 2Q3FA 1QIMA 2FW7A 5A06A 3MTBA 4FE7A 3ZZ0A 1WUIS 4Q9NA 4RK0A 4BEJA 5TS3A 3BGOS 4F85A 1YI1A 2CHVA 5IARA 3N2GA 4EMUA 4YJGB 4BY9E 3NWEA 1I0ZA 2PNFA 3TRHA 1A69A 2H1IA 3T9BA 2NO9A 5PNTA 4QT0A 1VKZA 1LXCA 4RVGA 4V3BA 4Y98A 1Y0BA 3JD3A 3THSA 1NVDA 1QAMA 2MINB 3C5CA 4R54A 3GPLA 2NYUA 1A9XB 3KSZO 1JJIA 5H81A 3JVUA 4MXDA 2FX5A 3P9RA 5ALUA 1UAAA 4QECA 3ROGA 3T5PA 3E61A 1TZ2A 1T4BA 4L27A 1ZD2P 2FLVA 1XRJA 2Y1DA 4XEHA 1VJRA 1QYVA 1X9GA 3EW7A 4PEVA 1NUSA 4NLLA 4MVYA 2VKTA 3E2PA 3W2TA 2X3UA 1S2MA 2PANA 4BJ6A 1WDLA 2MWMA 1UZMA 2Y1FA 1J06A 4OQMA 5EE0A 5SZIA 3PT5A 3SZMA 1B73A 4CF5A 4G0UA 5DNCA 3ET4A 1CVLA 3W6ZA 4L78A 3BEDA 5EAIA 4BE4A 1X8KA 2GBLC 3D43A 4IDBA 4MW5A 2P4QA 2WHRA 2X2FA 3FHLA 3F8SA 1H2AS 3PFNA 4QBIA 3UCFA 3WLKX 6Q21A 4IZ6A 2KPOA 1UMCA 2B5WA 2QXTA 3PUKA 3DWEX 3IOEA 4DV2B 3R3VA 3GI1A 2EW8A 3TZQA 1BEUB 3AQIA 1HLFA 4P4TA 4EW6A 3GN2A 5IDWA 4CEIB 1ARZA 1E1DA 2GTHA 2P27A 1W5EA 3FR7A 5EHGA 3CNNA 3UHAA 3FTPA 3CLUD 4HNHA 3FSEA 3ANXA 4JN6B 2DQKA 1IHYA 4HN2A 4PLTA 3OA0A 4JH0A 3WWYA 1XX6A 5JAMA 4LDZA 2KM1A 2QGZA 1A4UA 3KSBC 4AYXA 1COWD 2EW2A 2QMOA 1RT9A 3IMKA 2AFHE 2C8KA 4PNZA 2HDOA 2PSEA 4B5KA 4PIVA 3O9MA 1CRZA 4C4AA 3A0RB 1R0RE 3ND8A 5GGYA 1TYBE 4N7JA 5LP6C 1DKPA 1OF1A 1GNLA 4OU5A 2VTVA 4PSAA 4RENA 3QKRA 4CDRA 1LQUA 4TXMA 2RGDA 3EQ9A 1T1EA 3DCIA 4KSBA 4G5OA 3F5QA 2R7AA 3QEKA 2TRSB 1PFQA 4B3HA 3GC6A 5K6AA 2AC2A 1BG6A 2OO7A 3AESB 4LRXA 2HZ7A 1Q7EA 3NDPA 3H9UA 2FPLA 5HEKA 3RW9A 5K0ZA 4FDVA 3GOHA 2P4HX 4R2HA 5C3UA 3VBCA 4K9PA 3PE6A 1E61A 4QXAA 3Q0EA 1QTQA 1AKWA 5B5SA 1SUSA 3W3ZB 1NQAO 5LQNA 5EQTA 3AFNA 3NHJA 4GI3A 5BYKA 1TJ4A 4MPPA 4FXOA 5JYBA 1DJMA 4EZIA 1U9IC 3UXHA 3HJCA 3WGHA 3E1KA 5IC6A 4CEIA 1PU2A 4L85A 3S8YA 1DBVO 5JI2E 1G5PA 3ICQB 4YDRA 1LTQA 4WNAB 3CZMA 1YR2A 1M33A 2XUDA 3E84A 4BMXA 4DBVO 5LDDC 4NNOA 1Z15A 1KAGA 3T9DA 1A71A 4PSVA 3SNHA 1P4SA 5I9BA 3ITDA 2Z9BA 2FSGA 3PHLA 1SUIA 4FYVA 4GAEA 2D1FA 4IRMA 3OLWA 2PKYX 5AI4A 4BDSA 5HUHA 2VSYA 3B36A 5AKKA 2V97A 2AC7A 1AKNA 3OZIA 4Q1VA 1U2TA 2FUCA 1Z0KA 2DUNA 3FHCB 3D7SA 1R37A 3MOGA 5E8JA 1EMDA 4TWJA 1BXKA 2R6JA 1B0ZA 3L4BC 3N0WA 3HYLA 2FR0A 2O2DA 4ZV9A 1OAOA 2VNHA 2QM7A 3UK1A 4CTNA 2CBGA 5BP7A 3NOVA 3GDGA 1L5RA 1NM5C 1T8UA 1GNRA 4PCLA 1GQ2A 5LCXA 2QD5A 2UYYA 4F9TA 3CX3A 1BGWA 1CUDA 2AN5A 3PJEA 1UEJA 1Q0PA 3PI6A 5DIFA 3CR7A 3KX2A 4DIDA 4NCBA 2O5EA 1S4MA 3CZPA 3I30X 4LYFA 4TZKA 1Z6TA 2RIPA 3RV4A 4BO9A 3WJ1A 3MD9A 5EJ9A 4XCXA 1M2VA 2N46A 1CEYA 4CM7A 2J31A 3B89A 3EFHA 3HYRA 4JMLA 1KK1A 4DBLC 3GF4A 3GJ6A 3G2IA 4KBGA 4EK9A 2W37A 3MM4A 2C07A 1W88A 3HJGA 1JG4A 3F74A 5DPMA 2IOQA 1DV2A 4G07A 4QA9A 1PL8A 4WL0A 3EAFA 1RKXA 2PL1A 3ZIDA 4JLJA 1EJBA 3S7ZA 2ZUEA 3DTVD 3GLHB 1YB4A 5A4DA 4CIYA 1YRHA 3X1MA 2WWXA 1TF7A 5IAEA 5MN6A 1ZN2A 1DXOA 4CIDA 3LC0A 3M70A 1XAIA 4FYYA 2VRNA 2PFSA 4HTFB 2BKEA 3PI7A 3N0XA 1UAYA 3QE3A 4HRVA 3AY0A 4D98A 1GCUA 1ZIOA 2ZWOA 5FBKA 4B43A 3LY8A 5REQA 2BLNA 3A6GA 4Z9FA 5EE5B 1EWQA 1Z3IX 3AKCA 3RROA 5FKJA 3N6VA 5JD4A 4EVSA 1WXXA 2D4AA 4WFJA 5SY4A 3AIOA 1ZP6A 5EUBA 3R7LA 5KX5B 4B85A 2O7QA 2ZBFA 1TVMA 1D4AA 3HKBB 3I61A 1G4AE 3RVBA 3CJTA 3NBQA 3ACBA 4RMIA 5HOEA 3K31A 3IHWA 3WYNA 2CCJA 1NULA 5DRYA 2WF5A 2WJJA 2C98A 4B3BA 2J6BA 2C4TA 1L4KA 5F2KA 4CIWA 3JCZA 4BZQA 3JQ8B 1LJLA 2YIVX 3Q10A 3T9EA 1UH5A 3NEJA 5CH5A 1E9FA 3U1VA 5I3ZA 4K9RA 1V9CA 3VO9A 1NUAA 3PUJA 4R3WA 3NHWA 1XZBA 5E3HA 5KQRA 5K0SA 1FK8A 3VISA 4BX9A 1U9JA 2X7XA 1TNDA 3DAHA 2WYIA 3DZGA 2UYOA 3QOWA 4UOQA 1WQ1R 3QXCA 1JI3A 2WAYA 5JWHA 3NMUF 4BMPB 3OH8A 1M1UA 4MOWA 5FYQA 3IELA 3QLVA 1ZQ1A 1XZIA 1RC8A 2BCJQ 4E2XA 5BR7A 4CF7A 3S40A 4DXHA 2HSGA 2VTDA 2AJBA 2XYQA 4HTFA 1KSGA 4UE3S 4ZYVA 1J2UA 4MVJP 3H2IA 2PUTA 1RYMA 3BD6A 1WSDA 1H69A 2AUTA 3LF2A 3SIPA 1DU4A 5JYEA 2XTMA 4Q3EA 3D8NA 1D0IA 3DE0X 1GQYA 9ATCA 4AKSA 2FRDC 1N2CB 1U3UA 4NAUA 2XGOA 3Q9UA 4UTOA 4O8ZA 3E15A 4M1EA 4MITA 1N2GA 4UXIA 2NO6A 4BB5A 2PRKA 4KBFA 1TA9A 4ALMA 3AP1A 3EA4A 3IP1A 2RE8A 3MUEA 5ADUS 5JRJA 2ZUBA 5C7LO 4H2DA 1LB1B 1G66A 4K9LA 1TECE 1W29A 1P2TA 3A06A 3LZDA 4WNYA 3S99A 1DT5A 5FWXA 1EZZA 1RHUA 4IIUA 2VLIA 3QYFA 4RHTA 1T29A 5EZ5A 1W36D 1DCMA 2VT3A 2Y0PA 3BJEA 3ZK9A 3H1GA 3KD2A 4G1MB 3VZCA 4CUJA 2WJ6A 1GIAA 3HPRA 3IMEA 4L8LA 4G5FA 2ADMA 4J6FA 5H1YA 4P53A 3ROKA 2I2WA 1V2GA 2P9FA 3TEJA 2MYNA 5KJFA 1TI7A 2QG4A 1ZG3A 4OJKA 2PE5A 1B16A 1UMKA 1VL2A 1KGSA 1U7WA 2YFYA 3K9WA 2LW7A 5E1DA 3ZCTA 4V1CI 5C7YA 1P62B 3ML1A 4PZLA 4ZYXA 1D8AA 4QDJA 1ODTC 1MNQA 3PEWA 5HKOA 4MUGA 1E1KA 2CB9A 3A04A 1DEKA 1VBFA 4L4XA 4MLCA 1WB9A 2HDNB 4N8SA 4I36A 2V7EA 4FN4A 1B23P 2CZGA 2HHLA 1SM4A 4YECA 1D6JA 1F6DA 4NYIQ 2Q7DA 4UPVA 3VO8A 2B37A 4R16A 2XCIA 4A6XA 1YAJA 3GEGA 4O4IF 2VQDA 4LS3A 1HURA 1T8WA 1QH1A 1MZVA 3HXLA 3IIMA 3OZUA 4ZT2A 1XPOA 2E89A 4L07A 3VC2A 4F3YA 2R6R1 1O0SA 2ZR9A 3JQRA 2ZSEA 3Q2KA 4M9CA 4OH7A 5H82A 4BVAA 1QWSA 4YRQA 3CTMA 3ASVA 2XUHA 4K9MA 4X60A 2ETXA 3QHPA 2HL6A 4UJ3A 4X0EA 5CNJA 2NTVA 3U4QB 1TMGE 4CFZA 3SNKA 3TPZA 1WO8A 3ZJ5A 4BGVA 5EFZA 3WQQA 2IPAB 5FBRB 1Z4IA 2CEAA 4K40A 4CR8A 5BWOA 1ZDMA 3BA1A 3BH7A 3DE4X 4QPDA 4ZN6A 1AGPA 1M8GA 5B1IA 3SSNA 3Q8WA 4L28A 4X54A 1YBHA 2OCYC 4G09A 5KKCA 2QDKA 3HK2A 1BMFA 4FFBA 4OHWA 1Y8AA 3KQQA 3J80A 4JT9A 5D7NA 3MQ2A 5ELMA 2EZTA 2W0SA 5AKYA 1S3SA 3B5EA 2GCGA 4ND8B 3ZHUA 5B12A 5IT4A 5EWMB 1FJHA 4Z7QB 1OLXB 2ZR7A 2HJ9A 2ID9A 4K6FA 4UPDA 4C7KA 3KQWA 1NUQA 4DHWA 4EI8A 3P9ZA 4KRGA 2IXEA 1HNNA 1PJQA 1S0UA 2ZI7A 1SHJA 4YFVA 3SU8A 4WN9B 5EJMA 1EZ4A 5GIPE 3BD7A 1L4YA 5GP1A 2IV2X 3KSUA 1LLDA 2YCLA 4LBVA 1W2GA 3SC6A 3FMFA 2GA9A 3H3FA 3W1EA 2IV3A 2QRLA 4YUVA 3SQOA 1VL5A 2CWWA 2HU8A 2NUPB 3KQOA 4DE5A 1X13A 2YWGA 2G6BA 3H5WA 4TXNA 5I7AA 1NP7A 5DM4A 2ZZMA 3C4QA 4UATA 3UBMA 4HDKA 5ARBA 1LWNA 1N8KA 2CYCA 1PO7A 2D1YA 3C87A 4KGZA 3V33A 1SBIA 3HR4A 4EEZA 3U4QA 2IHBA 2DOKA 3BC1A 3PGJA 2GSDA 5A9SA 5HKKD 3LY9A 4QDTA 3KB2A 1IXSB 4GEGA 4FIDA 3UG6A 1VDZA 3QJGA 3ZCRA 4BO5A 3X1WA 3WRXC 3WIUA 1EFDN 4M8IA 3HXOA 2IV7A 1DDOA 2NV2B 1U1FA 5C37A 1KPHA 1PIWA 4FR5A 1L7PA 3ZWWA 4J1QA 2QD2A 2VF8A 3P0IA 4CIXA 5LP6F 3O8CA 2DBVO 4UNPA 5ISMA 3QV1A 3FOZA 4GUAA 1IVNA 1NXPA 2AN9A 4ND8A 5E9WA 1P0CA 1FQWA 2D2XA 1QCDA 4US0R 5ENZA 4Q82A 3IYLW 2QNRA 5HW0A 3I2IA 3KKKA 5TC4A 3WGZA 1OYWA 4E6EA 1KBQA 3ZU3A 5C4IA 3AF2A 1RYFA 4QUJA 2F6RA 2CLOB 2OCGA 1GYRA 4Q1CA 2XMRA 3DBOB 4PGHA 2Y6UA 1UMDB 2GMWA 3GNSA 1NT2A 4PAQA 4HQRA 2ZB2A 5EJ5A 2HW8A 2EL7A 2IY7A 2O2ZA 2CB0A 5AOBA 1XTRA 4PONA 4BFLA 4JWTA 4QGSA 1M2GA 5KNBD 1O3YA 4A26A 2VUIB 3WVNA 3IE1A 4PYQA 2OBNA 1J1ZA 2VJQA 4EI2A 4OA8A 1R0KA 3WYEA 1KMIY 1RWNA 2HU2A 1P77A 3BL5A 1ZRNA 3F7MA 1NY5A 3WK8A 3JWGA 5ED4A 5JE8A 2H3EA 4DA7A 2GBCA 2VAVA 4Q18A 2Y67A 4HFRA 2IF2A 4TM8A 3RVJA 2CNWD 3AHCA 3G02A 4Z0PA 4F4UA 1IXYA 4YJFA 4IG4A 3ZCUA 2J3JA 3TSCA 1PR1A 4EZEA 1BRMA 1O57A 2X0IA 1J0XO 1AGYA 1G42A 4BWFB 1MV8A 4D6XA 3SS7X 2RHHA 1KEEB 1EVIA 1U5CA 3KKLA 4H08A 4BCCA 1DBRA 1P0PA 4DLYA 4GKJB 3ZWOA 1RI5A 2CJXA 5JS7A 4IKPA 2CKMA 5CYOA 1HE8B 3AVYA 3OPQA 2FZWA 3NONA 4MV9A 5JCPA 4TMZA 1LK0A 3I5MA 1RW4A 5FWYA 3RBVA 2EHDA 4KTTE 4JP8A 1EK2A 4YRLA 4HVTA 4LPSA 3TTTA 1PK8A 1SKYB 4NU8X 5C4MA 2O7NA 1PSWA 1ZJ6A 1EFCA 1RCTE 1ULUA 2FWBA 3CKKA 3EGCA 1VJ5A 4QPNA 3ZV3A 4MV1A 4EPVA 4LPKA 4MCHA 4EJ6A 1XXHA 4DZRA 1TU4A 1FRZA 3VUEA 3DB1A 4YAKA 4KQJA 4B7ZA 2OXFA 3UXEA 3BZUA 2FFBA 1UDCA 4FYWA 3TOVA 4EKYA 5AVWA 1W4CA 5EGNA 2Z30A 1BRTA 2C2YA 3D2LA 2BYTA 3IURA 1UWCA 4FILA 2VSQA 4KK4A 4RZQA 2G6TA 2V7VA 3F5MA 3LK6A 4DC9A 5JHHB 4EG5A 3FTEA 1H05A 3R8FA 2X8WA 5IT0A 5BPHA 4C5CA 2RI1A 3H87A 2A7XA 3IALA 1KYIA 2V5UA 3HB4X 1Q0LA 4AU1A 3C6QA 4JD5A 4PW0A 3FPJA 4YCJA 4TMVA 3V8BA 1P9RA 3VPAA 5TRTA 2H5JA 2QK4A 4JDPA 4ARZB 4BO8A 3VH1A 1ZD9A 5TNXA 3O8RA 1IEQA 2PGXA 3STHA 3B8EA 2B1RA 2BTQB 1DELA 2BGWA 1IBSA 4HNRA 2QN9A 4BVFA 5JI3E 4U7FA 5G0SA 1BROA 5HR5A 5KTMA 4LF6B 4WSOA 3R3YA 1U2GA 2J9FB 4DCJA 5BV7A 2O0LA 3R4CA 2Z9DA 1U6IA 1ZGBA 2ZSHA 3L0CA 4LXYA 3SE0A 3TS1A 3C24A 3DEIA 3V46A 3MOSA 1XMOB 2Q5CA 4K86A 3ZV6A 1JEEA 3ZYZA 2QMEA 1LI7A 2IVFA 4L5IA 1FUKA 1C4WA 3BERA 3ETNA 4QBTA 4RD3A 4A5OA 2A1UB 3UT5B 4AF6A 1XBTA 2MIIA 1GG9A 1ZZEA 2EQBA 4DVJA 2X1VA 4GPD1 3DWGA 4GC9A 3ZHYA 1BOFA 2PUHA 1B4DA 3Q7SA 4TL7A 4FGSA 1J8QA 3RNOA 4UTPA 5ALHA 4Y9RA 4AUNA 2XT6A 3WHKA 2OAQ1 1EYZA 2JEOA 1CYEA 4JX9A 4NTZA 3F6CA 2P0YA 3EQ6A 1UBGA 2C92A 4JBGA 1X77A 2Z4TA 2Q41A 5DHRA 4A8TA 4JYMA 4BP3A 4PN3A 1ECLA 2VRWA 4BBJA 3MCWA 2FSIA 2V9ZA 4MRNA 4NBTA 3D31A 1PSDA 3ESDA 4RVNA 1LBEA 1GRRA 4F2DA 3D54D 5AHWA 1H6AA 1XZFA 4AZTA 4C20A 2WJGA 5EYPB 4UM7A 1JVNA 2XIQA 2EBHX 3TVTA 1I6KA 2P3LA 4LMRA 2DWOA 3ESXA 4PC6A 4PSUA 4Y2UA 4ARZA 1T0PA 5I47A 1PGPA 4ZCMA 2O05A 3LUGA 1G9XA 3G2NA 4CETA 2Y0EA 5BUCA 2OXCA 2AKEA 2PSFA 1IUNA 1XEWY 2BTQA 4KIWA 3QVKA 1AB5A 2EKBA 3JQ7B 4ZRDA 1DRJA 2JDID 4OQNA 3PUXA 2RHOA 3R76A 2CT8A 5IKEA 1MXFA 1Y4ZA 1XU4A 5ALMA 1P6UA 5FULA 5JR3A 5COQA 1N1DA 1YVEI 3HP4A 3A1FA 3RKRA 1QF9A 2FMXA 2E5FA 3K4QA 1DFHA 1JVSA 4Q19A 1MJ5A 3RC2A 3SKXA 5GV8A 3U9LA 3PP8A 5DI3A 3Q3HA 3V34A 4CTKA 2OORC 3BE4A 4HLNA 4IIGA 4BYGA 1DI0A 1CZRA 5T41A 1N5OX 3WNZA 3FYUC 2G04A 1ZM3A 2A1UA 1JJAA 4C4SA 5JLJA 1UR5A 2PPVA 3N0TA 3HV0A 2EGUA 4JUBA 3HUTA 4GOND 3HEMA 1RYZA 4OU4A 1DLIA 4DG5A 2JK0A 3T1NA 1A2BA 1I6WA 2YNMA 3PX2A 3B78A 3AERB 1RJFA 3HU2A 4ZO6A 3HFSA 3NPMA 3GT7A 3O47A 1O8BA 3H9CA 4W1PA 4DA4A 1K8XB 2WFLA 5EYPA 3K9BA 1R6DA 3GR6A 4UCFA 1QCCA 5LBUA 2YFKA 4G97A 3WB9A 4AKEA 4OI0A 1JHPA 1I10A 1U1DA 3VSDA 3ZGVA 4JVMA 3VOTA 2PMFA 4FMCF 3L18A 2VT7A 2RARA 3M3DA 2WSBA 4BNNA 5CA1B 3ZE6A 3RYFB 3A2KA 3V00A 3D8SA 4P08A 1JLMA 3JQ7A 4AF7A 5IVIA 4U2KA 5ICFA 1GEEA 4GBGA 2GZ1A 1RWOA 2Z2KA 5DV9A 1S02A 4I66A 2IZ1A 4FQ8A 4LY6A 3R74A 1M6VB 3QMVA 4B81A 5KTRA 4TKVB 3CLRD 5AKIA 4H1HA 2QT9A 1KYYA 4CIVA 1NMSA 4PFSA 5IHXA 2BPOA 3O9ZA 3WYBA 3IDFA 1YZ3A 4IHAA 4A0GA 3K5HA 5CH3A 2C78A 3ZV7A 3QTBA 4PIPA 4BEBA 3AHGA 1M0EA 1J0BA 3U9TA 1W8DA 5A7HA 3IE2A 3M4YA 1HDGO 4LZZA 3G59A 1LKZA 2MR5A 3OF3A 2AUMA 1NNSA 1VPEA 2SBTA 2HT1A 1QM5A 5AFSA 2RCYA 3ELBA 3PUWA 3B60A 2W6IA 4CDMA 2FR8C 5G40A 2O8BB 2EYQA 1WUHS 3WGTA 3E5NA 4K9QA 4PZPA 2JI8A 1ST3A 3FGOA 3O7WA 3EF0A 1XTUA 4WI1A 5IZ4A 10MHA 2W6JA 3VVMA 2LP4Y 2PKQO 3ZOZA 2K2WA 3CLKA 3B82A 1EJ0A 3FROA 2XOKA 3OHMA 2D59A 5E2BA 3WLIA 1XJ5A 2P40A 1N9ZA 3T3MB 2P1DA 1W36C 4EMSA 1TEVA 1JQDA 1YHZA 2H4FA 4A6EA 2H59A 3EXHB 4JBHA 4AMBA 3H1BA 4UAUA 4K1LA 3UJBA 2VYNA 3FJYA 4GXNA 1WNFA 5C52B 1PGQA 3A9CA 5C0OE 5HTOA 4NBLA 1TVKA 3A6JA 3GRKA 4BAGA 4OB8A 4TOIA 3L02A 3T4PA 3CUUA 4K26A 4IQ0A 5EPEA 2IYUA 5T8KC 4BLRA 5KYKA 1XRQA 1QO0D 4HDMB 1CR4A 4RZIA 1LPNA 1LEHA 1FEZA 1STOA 2DHCA 4U9HS 4R1PA 4XSHA 5CNIA 3VR5A 4AWAA 3PXBA 2G08A 1NNUA 3BFVA 4PFKA 4LBWA 2IE0A 2KS6A 3RG8A 3GLIA 5DMXA 4BQRA 4WCVA 3P0RA 3OQJA 5JU6A 5CAEB 4MQ6A 1SG6A 1TZMA 2V7QA 2G72A 2AZ4A 1GV0A 3EXFA 4KMSA 1B1AA 1B6GA 1WTAA 3L1JA 3N0RA 4KE8A 2W9XA 5B30A 5TGDA 2Q4BA 3T1QA 4BV3A 1GKLA 2P6UA 3L0IB 4TUYF 5EN4A 4RM2A 4X6YA 2MSEB 2HCBA 5A4IS 1YV9A 1ORWA 5ALZA 2YQZA 4O4LF 4XWAA 4PHTA 1Y42X 2DH5A 1KH1A 2E9SA 5DHUA 4RD1A 3C6BA 3WADA 2PSSA 4J4BA 1L5GB 1ZOOA 4B31A 1JR3D 4LF7B 3K92A 3IMCA 1QQ6A 1HK7A 3WGJA 4X8MA 4YP6A 4B45A 1XQVA 1FU7A 1YJXA 4M9RA 2E4ZA 3EVDA 3LXRA 2IEYA 2YINC 1WD5A 1ZGAA 1C9NA 3D8BA 3T15A 4WBNB 1NU6A 1AQUA 1OU0A 2QA5A 1X14A 1H9BA 5TB5A 5ENDA 3GLHE 2GEFA 4MRRA 2JI4A 1T1RA 5BN5B 4RXUA 4FPXA 2KBEA 3AOEC 4R7GA 4BLWA 2VJDA 1KOJA 3IXQA 3GD7A 2H1SA 1X1SA 2AR9A 2ZT6A 4OY3A 2OV2A 1KEUA 1RXWA 2DYKA 4A6PA 3HJUA 3JWEA 1DIBA 5CAEA 5L6LB 2IUYA 2IKSA 3E5HA 2BJWA 1K86A 2QQEA 4C0LA 1AKVA 1HDCA 5EIFA 1UDWA 3IT1A 5FI0B 1T35A 3TTSA 1H4QA 1F6WA 2HNKA 1Z5OA 2ZTSA 3SMQA 3NTOA 4XUDA 1GZ3A 2VJMA 4FMPA 3RT9A 4C7VA 5CDSA 3LT0A 1YDMA 3F90A 3INYA 5COBA 3R5HA 3HYSA 2OV8A 1SXJC 2Y2VA 5IANA 4BCDA 2JAQA 1DFGA 2SKEA 4BRWA 2VDRB 4C2UA 1OILA 1HNXB 3D8UA 1B15A 1A8HA 5GJVC 1NU8A 3HJNA 2BGGA 1O7JA 2OBLA 4NENB 4DB2A 1W96A 5EQDA 4HX9A 1IOWA 1YK1A 2B36A 2Y1LA 1NVBA 3B12A 4UMDA 1G3IA 2UU9B 3O4FA 3JZMA 5IABA 3BXZA 5IP5A 2F55A 4HWKA 4OQFA 3K0SA 2Y9PB 4WBNA 4FHFA 1KOLA 1QKJA 3S0JA 3SJ7A 4IVNA 4H1TA 5HILA 2FFAA 4NCJA 2BN4A 3GMDA 3MAGA 5F2OA 4DMLA 3B9PA 3C39A 1J7KA 2Z08A 1Q7RA 3DVRX 3GQBB 1Q7BA 2ILTA 1NF2A 4LC9A 1K4YA 1TT5A 3JQQA 1J24A 1QIGA 5DN6A 2MSCB 1PL7A 1SCAA 2VPTA 3O38A 2D13A 4MI6A 1R4ZA 1JXAA 5JCZA 4LX0A 2RGRA 4KHPB 2I6TA 2BZ1A 1J8MF 1R4NB 4BAZA 1QGUB 3D2BA 4B33A 4JEUA 3IP7A 3HY3A 4XW2A 5H0IA 4RSMA 1N2CE 5JC8A 2O0JA 1FX1A 3BYZA 5CDFA 4QGFA 2GD6A 5FA8A 3T7SA 2XNDD 1Q20A 4NZZA 2IIQA 2GR9A 5EL0A 2HT6A 3NM6B 1VFNA 3AIMA 3W9SA 3AB8A 4HVCA 1NA5A 2IC5A 2JBAA 2O3RA 1PYDA 3H18A 4PZDA 2JIPA 1LTHR 4XI9A 1U7TA 3EULA 3K9GA 3AJ9A 4QJIA 4TT3D 5JZ9A 2QUKA 1SC9A 1Z6QA 4F6CA 1MEOA 5F35A 2ZTUA 1HLGA 1O03A 3N6RA 3T54A 4N1AA 1UXHA 5BORA 1QONA 2WU3A 3MMNA 2IYSA 2YDXA 2A5GA 2YXDA 4NJMA 4R6XA 4DLRA 4Z5XA 3L7YA 1GPBA 2X9GA 4E7OA 2QNBA 3BWVA 2WWYA 3AHJA 4QPZA 4RHCA 4BNLA 1JE0A 1G8FA 1YHYA 3E05A 3MGBA 4TYNA 2FLKA 3BIOA 2E5LB 1CEEA 4KXFB 3TRFA 3BX1A 3U7FB 2V3VA 1HF3A 5L95A 5KB3A 2VBGA 1CQZA 1TUBB 4G5XA 4YAGA 2AVDA 1FP7A 4V0LA 3H6HA 4TKMA 4PX5A 1NBHA 2J8ZA 2YTZA 3ABSB 4MAAA 1QIHA 3OQNA 2EXXA 2EC5A 3IAAA 1ICIA 2VUUA 5A05A 1OASA 3V3TA 1OH5A 1R4NA 4JJIA 5AI6A 1WUYA 1QGUA 3A7DA 4ZPJA 3ZDAA 3TZCA 2HQRA 4X1YB 2OMEA 1CDDA 1S3FA 3DV2A 4UUBA 2CN1A 2YUTA 3LVFO 4RLQA 5TSDA 4F45A 2Z2YA 1PD0A 3VNUA 4WHMA 5LQMA 1GSAA 1ULHA 2Z58A 1L1FA 5LM3A 1F17A 2CUNA 5JY1A 5TGZA 1HZZC 4INPA 3ZOKA 4KUEA 2BMDA 3VDMA 4B3FX 1YS2X 5JJIA 3I9JA 1A0OA 3RABA 4TYMA 2WE8A 3S5UA 1VZ3A 1TZCA 1RI4A 3R5JA 2XRZA 3NGLA 3T06B 2YHBA 3ZDZB 4RWEA 2N75A 3SX4A 1JZTA 4MW7A 2PBRA 1V16A 1GGMA 2PX4A 3U80A 3GRZA 3D81A 2DQZA 3IB6A 4M37A 5CRIA 4HMQA 3CMMA 3ANTA 3E70C 3B3AA 1U7OA 3LZ6A 1Z4KA 4GZ6A 5F4ZA 4EDFA 5JATA 5L4NA 1SU7A 2WJYA 4TLLB 2IPOA 1KC3A 4ZHSA 1ONOA 1TUBA 1VCHA 2XUFA 1R6XA 1UKBA 1XFAA 3M49A 1RRVA 5F52A 1JF8A 4QIHA 4NAVA 1I4DD 3AW8A 4TWZA 3WZ2A 5HPYB 4AQ7A 4MVJF 4WCFC 4QHSA 5CDHA 5B36A 2MYPA 3M8KA 1T0IA 5BPFA 2CDNA 5A9RA 1SBHA 2G40A 4URZR 1XWWA 2VBFA 2JJYA 3AXTA 1VSTA 4X1YA 4YHHB 1R50A 1Z0JA 4JYAB 5I6DA 2PL5A 4CCAA 1I4LD 4LZNA 3V1TC 3GPIA 3W5UA 4MWEA 4EHKA 3OETA 1KMHB 4RPGA 2AK3A 1LGYA 4Z0NA 1M76A 1XEAA 3D6UA 4C43A 2NVUA 1EIZA 4HX2A 1Z4NA 4YMIA 3ZIAA 3ZHTA 2Z4SA 4FB4A 1YBMA 1WCV1 3FAZA 2ACVA 5M7EA 2G70A 5H9WA 4IF6A 1SMKA 3G8DA 5T4EA 3L1UA 5H3CA 3LKDA 1N7GA 3BHIA 3SEFA 1KMCA 1QIDA 4GRAA 4PBSA 4C4ZA 4YLYA 4MI9A 4L50A 1FIUA 1PUIA 1KY3A 1AIPA 3RM3A 8ABPA 4FU0A 2A5YB 2WYVA 4HGQA 4RF2A 1CY4A 2B99A 4B2YA 5FTLA 4ITUA 1ENPA 2ZR8A 4HXGA 4ZZ1A 1LZLA 1L5VA 4UJ5A 2OILA 4JXXA 2YS6A 3N7TA 3WRVA 2N47A 3TI7A 1JQ5A 4JKYA 1L6RA 3F9IA 1VL6A 5B1EA 1I0LA 1MR3F 1N5IA 2MDTA 1XAGA 3ETJA 3QFSA 3GFBA 5AHRA 3D7NA 1LU9A 2HM7A 3GFVA 5BSRA 4ZC1A 2Q29A 5TT1A 4DM3A 4EKIA 1CEXA 1E5DA 1FNSA 1N1GA 1WSAA 4KKXB 1WCYA 3OZSA 1ZW1A 4R1UA 1T5DX 2DX7A 4O4JB 2VYVA 5B1HA 1Y3AA 1Z5NA 1Z62A 1GA1A 2DWQA 3MG9A 1HGXA 2XGSA 4CVNA 2O9JA 4DLWA 4ER7A 1EJ6A 13PKA 4KTVE 1ZNWA 4MV6A 3SQNA 3DO6A 1P7CA 1KMHA 5CT9A 4A8JA 1JH9A 1YQXA 3DOEA 4HAWA 4HWPA 1IVSA 1B8NA 3V1YA 4NE9A 1ZGCA 1UXGA 2XGGA 4DF3A 2ZUCA 1IU9A 2C2HA 1FBNA 3F6SA 3MWEB 4G8CA 4TWBA 3ZZ1A 2V8BA 4HYYA 1B74A 2ZIEA 4KOAA 2CMKA 4HLUA 5TEVA 1SB9A 1Z25A 2JIZD 3OHPA 1QQBA 2VYQA 2XUOA 2I03A 2JH3A 2A1TR 2A9JA 3M34A 4JS0A 4LTNA 1WCIA 2WRZA 4RTRA 2UZ4A 1U2PA 2CLDX 4HKTA 4R51A 4YP0A 3BE6A 4D4KA 3LO5A 3VQTA 2VI5A 1FUEA 2X0KA 3M6FA 4Z0HO 4GYYA 5F51A 4M99A 3TE6A 1FRNA 4D9JA 2OZVA 2BFNA 5ESWA 1XKXA 3GEDA 3SXPA 4TRNA 1JQAA 4YRGA 3K2EA 3V8NA 1JKJA 1NF9A 5DXAA 3NO4A 1B0UA 1E9SA 5IXJA 1ZJJA 2XAAA 1CJCA 2C9ZA 3AM1A 2SECE 4KHZA 1B8OA 1MENA 2CJFA 3FGZA 3X0DA 2EIXA 5AVXA 4BO4A 3PPIA 5JNVA 2ENWA 1EBFA 1GUBA 1C9JA 3AUKA 1U3WA 4RKRA 3VPDA 3OEHD 4LJYA 1KJJA 1JZSA 3GRFA 4O4JA 1Q15A 5JG7A 3ST7A 4EHHA 1LK5A 1RHJA 1YUBA 5JFGA 3DLPX 1FU4A 4WKOA 3VO2A 4Y0AA 3K0AA 2N1MA 4Q4HA 4BFYA 4U7PB 5BN3B 4PZAA 3LE8A 2ZWPA 4YMTA 3V1UA 2PXCA 4IP0A 4DR7B 4CODB 3OLXA 4QRDA 5F1YA 2VDWA 2ZJAA 1A4IA 4Q9DA 4N8EA 3Q1KA 5ICMA 4HGYA 1FPMA 3LBHA 4C2AA 3QU7A 1DKNA 3BJIC 5EXDA 3VV3A 2GX6A 1EBUA 3ABQB 1J5XA 1M1YB 2REBA 4MQFB 5EA2A 3W1WA 3KNZA 3T99A 5LMCA 1MW9X 4H7JA 1DO0A 3RC9A 4C22A 2EGHA 1EUCA 2AMJA 7MHTA 1VOTA 2C0CA 4NS1A 5FUVA 4AJOA 4Y7CA 3PLAE 3G3EA 2Y8EA 2VLBA 4PLFA 5EHZA 5IH3A 1OXSC 2ONYA 5BYBA 3OLVA 2FOXA 2VOEA 2B3DA 3RFTA 3P97A 4WIAA 5TQJA 1WBBA 2X42A 1P29A 3K0EA 2ZSDA 2VEDA 3CURA 4HNSA 5THQA 2G0NA 3A4MA 4FMDB 4TT8A 1QG2A 3NH9A 5HK9A 3A9UA 3WFIA 5CB8A 3CX8A 1UEIA 4B4WA 2PQMA 2Y0DA 5AKHA 1T25A 5G4LA 1ABFA 4MS1A 4CN8A 4HWSA 1M7GA 4IJVA 2HGZA 2HXSA 3GCDA 2LUOA 1XLWA 4S12A 2AA3A 2DFVA 4Q9IA 1Y5RA 4ID3A 5HIJA 2ZP1A 2X2OA 3PC3A 2IS2A 4NSNA 2CL6X 5BN3A 3CNEA 4L08A 1N5DA 3IQIX 4JUIA 5P8WA 3SX2A 1R2QA 1W6UA 2OWEA 2KW5A 5FUBA 1C5KA 4MYSA 5HKLA 3UKDA 1DTSA 5MFPA 5JSQA 1ZSVA 1FFSA 4OLHA 4TWRA 1U81A 4R3UC 5KYXB 4MQFA 5G02A 5EWJB 4PY2A 3RUCA 2RJOA 1GZDA 2ZRHA 1SPBS 3EXEA 1A50B 5F3RA 4J76A 2D2FA 1FLDA 1XCBA 2J5BA 1S8AA 5FADA 4F9GA 2PXAA 2HRBA 1WHTA 1MF7A 3ND5A 1E3TA 4GQIA 3W78A 1V0JA 2CFOA 4ZYLA 5CXXA 2I8CA 3V48A 1R4AA 2DCUA 2OO5C 3AETB 1GVNB 2BP7B 2A0XA 3BIFA 3JATA 2CLFB 4XOUA 3IKMB 2ZU6A 2PT9A 3ZC3A 3WQBA 4ZYTA 1LH0A 1Q22A 4QICA 1JFFA 4JSTA 2P75A 1DADA 3W6PA 2ONZA 3I4FA 2MMGA 2NNLD 5DSZA 4N9WA 3M83A 4JBIA 2E4XA 1ML4A 2YOFA 3KKNA 3PHHA 1C30B 2QV7A 2H2IA 5CYFA 1GT91 1JDPA 2D06A 2H4XA 2OD9A 3LHDA 2K2QB 2ODPA 3ABZA 3LXXA 4R9VA 1MU0A 4JB2A 4D41A 4JI0B 4MVXA 1OC2A 5M29A 4LDNA 2HF8A 1GA6A 1ATZA 3H2JA 1EUQA 2PRYA 3AK4A 2P7HA 2QJWA 4ZVQA 4DCVA 2ZYDA 2FJPA 4NE7A 1CUHA 2ZPUA 1K06A 1GDHA 3OOYA 1XZAA 3AZQA 4BJ3A 5KREA 5FB3A 3FGNA 3L3BA 2A1IA 2BGLA 2FPUA 2GK3A 2OQ2A 2F9MA 3UV7A 5JQWA 5LOVB 3PCXA 2BSQA 3KJEA 2XQKA 2WKPA 3HBJA 4KWEA 1LDYA 3DE2X 5JMOA 3OPYI 1F38A 1AKEA 1NI4B 2IBMA 3FWNA 5FV4A 1NJ6A 3TJZA 4F6RA 3LWNA 3FSGD 4D8VA 1OYYA 3L6RA 4JA0A 4IM7A 2A3NA 4X1OA 4AY5A 4EX7A 1THGA 3U60B 4ML3A 1TUGA 3T95A 2O8EB 1KKLA 3I53A 5FD8A 1F12A 4UDOA 4HP8A 1Z6PA 2E6KA 3QPBA 2IYZA 2WUVA 4IOKA 2QTLA 4CKWB 4FYXA 4GW3A 1MB2A 4JOBA 5BQFA 2VAWA 5DULA 4D80A 2IS1A 3T5BA 1E9EA 2L0XA 4JLWA 2KSQA 4URWR 3DH0A 1U8AA 3GLIE 3C7KA 2BI8A 4H0FA 4N5DA 4BTEA 3THWB 1SCDA 1VE1A 2QX9A 2YL2A 3AR6A 4ZVOA 5ADHA 4DIEA 1P2SA 2HMUA 2QT0A 3EK2A 4PG8A 4WY2A 1SQ5A 4N48A 1PZMA 3LFHA 4LBZA 3T94A 2Q4EA 2UUCB 4DIMA 4GLFA 1H6CA 3FPFA 4UTVA 5FJIA 3PD7A 4CEJA 3PFCA 1BHQ1 4JB3A 4XQGA 2ACEA 3A4IA 3TDMA 1EFVA 1BDHA 1YMUA 5LOVA 2P6OA 3H19A 3OMLA 3Q5DA 4DCCA 4YRSA 1U2DA 1E2FA 2EG9A 1RYHA 5U9CA 4O2RA 4IW3B 1DCFA 1KI3A 3U7HB 4OBBA 3BJMA 1DBIA 2I66A 3W0LB 3S1AB 4EM6A 4HB2A 5KTSA 4ZVPA 5BSVA 2I9KA 3MAJA 4V3CA 5DX1A 4ZHQB 4CNBA 5KVVA 2EKPA 4RNDB 3IV6A 4KLNA 3SR0A 3T52A 1Z63A 1Y8CA 3LLVA 2JD2A 1ZMBA 2Z1DA 2KBFA 3N86A 4JLNA 1RWXA 1H2EA 1R74A 4RKQA 4BS9A 4AMYA 4AXBA 3PVZA 4KP7A 4AJKA 2P11A 2HJVA 1ZO8A 2GN1A 1IJFA 1I24A 1QQ7A 3H2YA 4E08A 2O59A 1IYZA 1RBZA 3GJXC 1YL6A 3PFFA 9LDBA 4JJFA 2WM2A 2FWNA 4ZQGA 1RDFA 3BS4A 1B93A 1SEPA 1WF3A 3FCYA 4UTZA 1RVV1 3L7NA 5DM1A 2HHAA 2VC2B 1FMCA 4MI3A 1MB4A 4NDZA 3BFJA 4IHJB 2AFRA 3PIDA 2H2GA 4YAUA 3HTXA 1CRWG 1VP3A 5A9SB 4OGKA 2IHZA 1HL3A 5J2TF 3FBTA 3R5FA 5TPZD 5IK2D 1JS1X 1NGSA 4KXVA 2AXPA 3H5LA 4ZXFA 1IN6A 3VJKA 3L4KA 3AKDA 3E7PA 1TEHA 2IZZA 5ESXA 2WSYB 3WL6A 3EUWA 1KHTA 3OA2A 1R0WA 2FFRA 3L7LA 4I1VA 1CK4A 2Q9AA 5AJZA 2J3KA 3AKEA 1NBMA 1U9ZA 1CY2A 4AZSA 5KWIA 2P6PA 5D85A 2PA0A 3AFOA 1J1IA 3AFIA 1QDUA 4FE4A 3S1AA 4P8RA 4F86A 3QBTA 1G8GA 3FWZA 4ZHQA 3NBZC 2I62A 2WTNA 3L04A 4AS3A 2W43A 2JGLA 3LV8A 2VQEB 5K0JA 1K5DA 1XEFA 2OV6A 4L02A 3HZOA 1LBQA 1WL8A 1RPNA 4KQ1A 3RS2A 4ER3A 4Y6LA 2PLRA 4S2EA 1EFAA 1IZ9A 4CM9A 2QX6A 2Z6VA 1LLFA 2VHQA 4C1BA 5ALJA 2C2OA 4YMVA 4RVFA 1SZDA 1QKKA 4EHFA 5B3JC 3K9FC 4AAYA 2C9CA 2CUTA 1H2FA 4JI7B 5KVSA 1OPXA 3C8ZA 4B7AA 3Q8XB 2DKNA 4XXHA 2P41A 1CZKA 2X76A 1SVWA 1PR4A 3D2AA 3H4VA 3ND9A 2VWHA 3QYAA 3UAXA 4DNQA 1G1MA 1I32A 2PGOA 3WO0A 1CIJA 1LNZA 3JYHA 4PO8A 4WUVA 4M0DA 2VF5X 5JS2A 4FSXA 3OBIA 4I55B 4YASA 5CEEA 4MEAA 3AY7A 3O93A 1KGDA 4K05A 2JJQA 4UFPA 4QVGA 2GD1O 4TLDA 1JAHA 1SUWA 1CUJA 3QUTA 2JFXA 4PXYA 3FUXA 3KP1A 1TYZA 3KIPA 3PXCX 3U26A 4A8PA 2IEGA 1GGEA 1I5OA 2HQ1A 3EUEA 4MS3B 4ZXPA 1R9GA 1ZD5A 2W48A 4PLGA 4O2BB 2R6ZA 3HS3A 3QXGA 3C7CB 3EVBA 4UBKA 2WZBA 1B0PA 2HKIA 3L8ZA 1QFZA 2OHHA 1F4LA 2WHPB 3W4JA 4BASA 1PFVA 2Q5OA 3IMFA 1YDEA 3LCUA 4OHMA 3I42A 4PSDA 1GEGA 1VE5A 2H8KA 5EINA 3EUAA 3URKA 1DKRA 1L7BA 2ANBA 3UMRA 1BCRA 5E7QA 3MJCA 1NN1A 2UZ1B 3UWSA 3FNFA 4OKSA 1TQHA 3Q3GE 1RZUA 3EPJA 1GTG1 1U7XA 1KC1A 2BKUA 3TR6A 3QU9A 4JP2A 4B2IA 1U2RA 1E0KA 1NI3A 2ORYA 4JP1A 4EDHA 1OTYA 3TR5A 4MKFA 5A6VA 1W1IA 5EEHA 1C81A 1KZ9A 3HCRA 4ND4A 3VR3D 4GBMA 2GH1A 3IAXA 1Z37A 2A9OA 3NP9A 4OFZA 3GDFA 5DBHX 2HXYA 2C04A 2RDMA 3ECAA 4G01B 2CXQA 3T1VA 1W2HA 3QKWA 3K09C 5L3ZA 2GPNA 1KJZA 1SK9A 1BVUA 2GYUA 4GI5A 4I55A 2HLHA 5IXYA 1GDTA 5I4CA 4E33A 4FZ5A 5EG5A 5H9VA 4C01A 2HC9A 5I4KA 3OVMA 2VHUA 4OSEA 1MEJA 4CM8B 1YIDA 3NEAA 2VP3A 1NYQA 4IMPA 5EE1A 3MTGA 3QXXA 4PLWA 1ZGJA 2DGDA 3CBGA 3H5RA 2IXFA 2CXXA 4Y2GA 3U7EB 5FOSA 2Q6TA 3ESAA 2XKAA 3R5TA 2W2LD 4IIVA 4CR6A 2W2TA 3TLZA 5C35A 2I54A 3B2EA 3KSRA 3NDRA 3SLRA 3BF8A 1WJGA 1XQ6A 2AS0A 4GX5A 1RLJA 1OBOA 3FY4A 4HQ6A 1E1CB 1KI7A 2AB0A 2WHPA 1D1TA 2VDLB 4JMPA 1YE5A 1Z9BA 4XAQA 4Z49A 6CHYA 3NCTA 1U8ZA 3LWZA 3WA6A 2I0FA 3Q3JB 3T5AA 4LQ4A 5GOZA 5BWNA 4BLPA 5KINB 5FPYA 2PO5A 4DS3A 2PUAA 2ZWIA 2ATVA 4HLQB 3O4IA 5FORA 2FN4A 1EP2B 1QWOA 1U0SY 2XVZA 3PC8C 2PUJA 2V0NA 4LJ4A 2FR1A 1NW4A 2A30A 1DSSG 2BH2A 1QS0B 1JEDA 3C3BA 2RJ3A 2IEAA 1YFZA 2VK1A 1XMQB 5ELXA 3ECCA 1F9AA 1RJDA 5F98A 2VCHA 1XHLA 2PBZA 1CUEA 1OCEA 3H42B 3B85A 3S70A 4O4HF 1S6YA 4EG7A 2C7PA 1AK1A 2YC2C 1EE2A 1WW8A 1A5AB 3V3KA 5AQ1A 2W22A 3KQHA 3TX2A 1XN4A 4N0QA 2YVLA 4JHLA 1VZ2A 5LZ5A 2PN1A 3A1SA 3PHBE 1MNAA 4CM8A 2H7CA 4MIOA 5FOWA 3ZQ4A 1UPXA 2PKEA 4AO7A 2XF2A 2J6CA 5HUJA 5HJEA 1BQ4A 3WYDA 4X6XA 3D5EA 4EFDA 1WBDA 1FSZA 1H3EA 2F00A 1DT3A 2G9RA 3EGIA 4IV8A 1PRYA 2WHQA 5TE9A 5EPUA 5A7GA 8OHMA 1LDMA 3DEKA 3U7GA 3Q12A 2YW2A 3E4DA 3VR4A 4QLOA 3CVUA 1W73A 4H0NA 4ZOLA 4JQSA 3SOPA 3T7DA 4W5JA 1CW2B 1I7QB 2FPGA 4OSOA 3I23A 1Z75A 4N3CA 4ZT6A 3JD4A 3KJFA 1QRTA 2C3PA 4BFWA 2RGBA 4GGPA 1X74A 1WKBA 2OC4A 3GA0A 4MI1A 4QTUB 4AMUA 1PG2A 3O9VA 4QVKA 4PPYA 1QS0A 1ZXBA 4RY0A 4NV0A 4ZI7B 5FLXA 1WR8A 4Q0MA 1ZSYA 5DASA 1RE1A 1WZ2A 5HIKA 1MUUA 2Z2XA 4J1NA 4MA4A 3ZZUA 3ZIUA 4D82A 1W0JA 5BR4A 3BPSA 4HEQA 4WKNA 2QMYA 2NYAA 1IIRA 1K3TA 1QH9A 1Y3FE 3ZI4A 3K1JA 3QGMA 3VPSA 1O5TA 3UJ7A 5C51B 1RLTA 3FNGA 2ESRA 4RZ2A 3SLGA 2H9AA 3SFZA 3W3AD 2IFTA 2NZXA 2BUAA 4YV2A 5CFZA 2P3OA 4Q15A 1VBNA 2OKGA 1NPDA 2ERXA 3NYIA 3F9RA 4GI2A 2QTGA 4UQPA 5JD3A 5THKA 4AUKA 6AT1A 4CM5A 1DAFA 4NDAA 4OFBA 1YD7A 4XZ3A 4MDFA 1EXWA 4QNNA 4NBRA 3UIEA 2IOFA 1JA9A 1W4ZA 4GRIA 4HN4B 1JDUA 4GQAA 3KT0A 4DTIA 1QOZA 2YIDA 3QKIA 1UPUA 4U63A 4U7JA 3CB2A 4Z9XA 1VCMA 1YQEA 5H80A 3T7KA 4RTMA 3QI7A 3IJRA 2CVQA 5HZKA 1MAWA 1RZRA 3L84A 3FI0A 5CM8B 4XSVA 1Y3DE 1REQA 2OD2A 2ROQA 1NVVR 4L76A 4UHBA 1P4HA 5DP2A 3RBZA 3VR6A 4B2PA 5SYNA 4J3NA 3IJ5A 1G2OA 3BICA 3LYUA 1IB0A 1GJRA 5B4TA 1A3CA 2P3SA 2GM5A 4EYKA 2QSYA 4OXQA 2H2DA 3PXDA 3AVPA 3EC7A 3NYRA 1NXQA 3G2KA 4H7FA 3EJ6A 4LXUA 4U7WA 4DV3B 2YHIA 4RCZA 4LRTB 2HMAA 2R4QA 2VPWA 4OQQA 3TQOA 4A2PA 3E3MA 3EY9A 2P35A 4OUDA 3SHFA 5LLDA 5JSFA 4DIKA 5KTKA 5KIAA 1DHTA 1PKEA 1NVEA 1KP2A 1UANA 3VXKA 2J6IA 1NVFA 1Z4QA 2DTDA 4URXR 4NV1A 1IAVA 3MOIA 4L8YA 4ZGGA 1Z4JA 4BJHB 1XGKA 2BFPA 4RELA 1WAMA 4UBNA 4XDYA 3LC1O 2ZRLA 1ZI9A 2QZPA 4A9AA 2ATXA 5JSUA 4HRXA 4PZYA 3WGOA 2XB2A 3SX0A 2XH8A 4XX1A 2FRXA 4NBSA 1UWKA 3TL6A 1E32A 1GXSB 2R97A 1PWZA 4P80A 1CFJA 2EZUA 4QNMA 1JDNA 1DRVA 1WZIA 3RT7A 4GT1A 3ZZMA 3CZQA 1G21B 1NW9B 4EIWA 3EJWA 2IUFA 4YBZA 4B9AA 3C6KA 3KYDA 4JR1A 1GQSA 5GJWC 2YJZA 3A32A 4G1BA 1ADBA 3JQDA 4NK4A 4D8UA 5KJ6A 3BD8A 1JEQB 1N3IA 5K6AC 5AMXA 3PRJA 1M8FA 1KL7A 1LWOA 3K30A 3QU4A 2NTYC 2OCIA 3LZCA 4P82A 4NHEA 4AVYA 3UPTA 2GJ8A 3GLGB 4R8VA 4G2TA 1P1HA 4KR2A 3U17A 4B76A 2VG8A 3AFMA 1ECGA 2H4ZA 4HG2A 1O0BA 1E18A 2C4HA 2YOHA 4DMFA 4AB1A 4O2AB 4TVSA 4W5QA 3NWJA 4WLVA 4TKLA 4JI1B 1E64A 1MRSA 1T24A 3ETLA 3NH6A 2AXNA 3TNYA 1NQTA 1O87A 3QEMB 3DTNA 1XIVA 2OTCA 3LPCA 1GPJA 3EPPA 5CB6A 4KWTA 1Y6ZA 1CR2A 1EFLA 1QJCA 2HH9A 2HMTA 2LR0A 2YVKA 5IS2A 2QR3A 1PS9A 1CQJA 2NOAA 3UAVA 1MJFA 1L5MA 1YULA 3QNUA 3LGXA 1L3BA 4IH4A 1GKKA 2ZU0C 4A1FA 4AJ4A 1BXZA 4Q7EA 3DD1A 2BEVB 2J5QA 2XPCA 3EWNA 1E5TA 5LIPA 5FTJA 2DUUA 1Z2NX 3B1JA 3P2IA 1G21A 5AH0A 4J7CA 1WULS 3PNVA 2J33A 3LUBA 4Z1OA 3IA2A 5CA0A 1KPIA 2PUBA 5HKAA 3NPAA 4RIHA 1R16A 2R48A 1KI6B 1E1QA 4B6QA 4DMKA 2NZWA 2J4DA 1WPQA 4ZP1A 3NC4A 3VZPA 3OT5A 3A31A 2DJIA 3NAGA 3UW3A 2W8ZA 2JD0A 1T2NA 2AN1A 3HCWA 1C3OA 4IQ4A 4P83A 1W6RA 5AM4A 4FFMA 2HPAA 3VMMA 4B09A 1TU3A 2ETVA 4B3CA 4XFJA 1KORA 1YUNA 2XVYA 3ANMA 3Q9SA 4Z8XA 3U81A 1HYEA 1U0FA 1KYZA 3KB1A 1I2MA 3CRW1 3DPIA 4BL5A 1EE1A 3ZD6A 1QVWA 4O2AA 2B69A 2LD4A 5EJ2A 1Z2PX 2QRUA 2EATA 2WTMA 3N39C 4LMBA 4NCHA 3UHPA 1EWRA 1DDGA 5FJJA 3U56A 4LYJA 2FSPA 2GCNA 3LQ2A 4JL8A 2A9QA 1Q7TA 3N2ZB 2DPGA 8MHTA 1T3LA 1M5TA 4IWNA 3TSZA 3V8PA 3GUVA 1I7PA 3ZH2A 4M53A 5CM2Z 1PJTA 4DXDA 3EW9A 1G8AA 4C4YA 4G23A 2ZS9A 4OQDA 4CV3A 2FWAA 1Y5LA 3CVXA 3I9V6 1RWPA 3ZXUB 3RSZA 1CWUA 2WIAA 4CM1A 1AA6A 5FAXA 3FPBA 4DLNA 2V5VA 5E9AA 1C41A 3GB9A 1O96B 2IX3A 2X6RA 3PQDA 3ZY4A 2IU4A 3TLBA 1LC0A 4XD2A 2FJ0A 1RHRA 3EXAA 2AFVA 3STWA 4TV8F 1FOEB 4FQ5A 2EF1A 4XQ0A 3SF0A 1GILA 5AK0A 3JQFA 2XA9A 4IJQA 1KI6A 2FPSA 1PEAA 5L4SA 1US8A 3CA8A 4EUSA 4GG1A 4OL9A 3N76A 1WW3A 4DLKA 1C8BA 2INGX 3GV0A 4CT5A 4KDRA 1RBYA 3QUAA 3TJRA 3ZK7A 4ZKDA 5K8VA 3X1YA 3RWMB 2HWWA 2ZI4A 3OG9A 5TR9A 1O6CA 1K1EA 1X86B 1JIKA 2G17A 2XODA 3DS8A 4HAXA 4I46A 5GIOE 2Q0HA 1A04A 5DDIP 2DEUA 1MT3A 2PMKA 4IHQA 3RS8A 4AFNA 1E7RA 1FYWA 2Y1OA 3UW1A 3GDWA 4CCYA 2HU5A 1U2ZA 1YFKA 4B34A 5IBCA 2JATA 4I6JA 2PRSA 1E9CA 3LL4A 2FOIA 5A02A 4DJDC 3L4SO 2XUIA 5FNVB 4EARA 3EPHA 1U3VA 2I2FA 2VJLA 2R1TB 2D5IA 2VK8A 4IDDA 1JQ3A 1W4LA 4WE3A 4O1IA 1X7XB 4R9SA 2ZATA 3QLVC 3CGGA 2B1IA 5F5LA 3WGVA 4HNVA 2O2EA 2QF7A 1E96A 1Z39A 4TTSA 2OYSA 4EGAA