3L40A

Crystal structure of s. pombe brc1 brct5-brct6 domains
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
TNAKASKRVYITFTGYDKKPSIDNLKKLDMSITSNPSKCTHLIAPRILRTSKFLCSIPYGPCVVTMDWINSCLKTHEIVDEEPYLLNDPEKELELGCTLESALKRARAQGPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKRLARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTIFLQNYDWLIKTVLRQEIDVNDRIADEFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title gammaH2A binds Brc1 to maintain genome integrity during S-phase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
molecule keywords BRCT-containing protein 1
total genus 72
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l40A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l40A02
2ETXA 3HUFA 3T1NA 3K0HA 3K16A 3T7KA 1T15A 1L0BA 4N40A 4JLUA 4Y2GA 1Z56C 2R1ZA 4BU0A 1Y98A 2LE0A 1OQAA 3KTFA 1IN1A 3SHVA 3PXEA 4IFIA 4BMCA 2JW5A 3II6X 3AL3A 1N5OX 3JVEA 3EF1A 3QVGB 3PC8C 2VXBA 3L40A 3K15A 2COKA 2COEA 1L7BA 2XNHA 3PC7A 3COJA 3K0KA 3L41A 1JNXX 2NTEA 3FA2A 3SQDA 3SHTA 2E2WA 2WT8A 2XNKA 4ID3A 1CDZA 2VXCA 2INGX 2K7FA 2ADOA 4Y18A 1IMOA 5ECGC 3T7IA 3T7JA 2D8MA 3HUEA 1KZYC 3QVGA 1WF6A 3PC8A 3K05A 1T29A 2EBWA 3I0NA 3L46A 2L42A 2COUA 2EBUA 2AZMA 4IGKA 3PD7A 2EP8A 3UENA 3EF0A 2M2IA 1T2VA 3OLCX 3SZMA 3UEOA 2HTFA 3AL2A 3PXAA 3I0MA 2K6GA 3PC6A 3PA6A 4OFBA 4BMDA 4U4AA 3PXCX 4XQ0A 3PXBA 2DUNA 4BU1A 3U3ZA 1T2UA 4XPZA 3PXDA 1GZHB
chains in the Genus database with same CATH superfamily
1Y6JA 1NFRA 1SUIA 3BXXA 5E7JA 4EG6A 1P60A 3UO8B 3KQKA 1I2AA 4CDNA 2PN1A 4RXTA 3OJXA 4EY7A 4KHPB 3P2JA 4EEZA 3OQ1A 1O2DA 1G1MA 1J0EA 5IJZA 3OCWA 5D6OA 1HYEA 4FDTA 4Y98A 4E7OA 4Q66C 3PRKE 2XF2A 4D4LA 4JT2A 3JVVA 1W52X 3LD9A 3LT0A 5LM3A 2IWRA 2IBSA 1PL6A 4WWHA 1PTKA 2VOEA 3C3XA 3HUUA 4YASA 3CRRA 4KYIB 5KX5B 3A9CA 3WSWA 3GRVA 1YUNA 4UTPA 2ZYVX 1NVDA 1CZOA 3H3XA 1Q17A 1LNZA 4X20B 3G8YA 1QJ4A 3AESB 1LU9A 3UT0A 1E1CB 4V1CA 1AHIA 4W8HA 4BNIA 1R6BX 1NASA 4YAIA 2FCAA 4JQOA 5CA1A 2ZUEA 4BB6A 4KXQA 2VYVA 2Q4OA 3H83A 3SF0A 4HVAA 2X6QA 1NRIA 2XCIA 4YJ3B 1T6BY 4AJOA 5A4FS 1QU2A 1PQYA 1T8PA 2XHZA 3BGIA 3CSSA 4FZJA 4GMHA 3EWAA 4A2QA 3G2MA 4RVSA 3AC0A 2NYAA 2OXEA 4CLXA 1UWLA 3RRJA 4RVDA 3U49A 3OO0A 4PQRA 4F1WA 3H75A 3OT5A 3AR6A 4EW2A 1IZ8A 4NS4A 5DRYA 4O4IB 5FO1A 4Y2HA 3EVDA 1QVZA 4QQRA 5DM0A 4EB0A 1IG3A 5CVJA 2B78A 3VYWA 2GB4A 1X8JA 3B5EA 4FBLA 2I2BA 3Q15C 3DEAA 5C8YB 1F0YA 1EWKA 4GICA 1XXHA 3PG5A 3PJDA 1L9KA 1H8HD 1SUPA 3DYVA 3U37A 1EUZA 1TK3A 2CMHA 3QLVC 4MRVA 4RQTA 1Y4DE 1OYYA 4IIVA 2BGKA 1XVTA 3K0AA 5LA6B 2BRUC 4PAOA 2LWIA 3IUPA 4A82A 1D6JA 1P18A 5CX1B 2QM0A 4OHMA 2W6CX 3U4CA 3OG9A 1V7CA 2J45A 4IJWA 4JCCA 5GVSA 3AVTA 2GA9A 1T9KA 3KSUA 3LK7A 3EFEA 2M2IA 4MEBA 3BWEA 4YACA 5JH7F 3FOFC 2B2NA 1RWPA 4IIHA 5B37A 1A7JA 1HQYE 4R31A 3M82A 2QL6A 5ECDA 3UK1A 2DEUA 4RTPA 5FQNA 1W59A 1DBIA 5F98A 5CDFE 2GH1A 1HDRA 4IGIA 1EFRD 2AKEA 2HF9A 3JQBC 3ENVA 1E77A 3C5CA 3CVVA 1JFLA 1ZRNA 2UUPA 1HE2A 4BLQA 4CNQA 4WJKB 1M2GA 3DONA 5BRAA 2I3AA 4ZC1A 2YMMA 1N0HA 4J7XA 4L3WA 3EFHA 3H9QA 4GEKA 5E4TA 2XNJA 3PXDA 4RY0A 1G21B 3MBIA 2PUJA 4Q05A 5EIWA 4GR5A 4N3AA 2W2LA 1Z5OA 4JLVA 2P27A 4QBIA 4AMUA 1QQTA 2AK3A 4XYGA 3H5WA 5HCUA 3FVVA 3PFIA 5ALOA 1F2UB 1KP9A 3THOA 4U9IS 2CXXA 1DRVA 1W8IA 2ASVA 2WU3A 1I4EB 2PWZA 4URHA 3BH0A 3N2GA 421PA 3I42A 3QWAA 4NBSA 4Y2XA 2WWYA 2ZSIA 3AVYA 2AJ8A 3GVXA 1PWXA 4HGQA 1XD2B 1NL3A 1DXQA 4BFUA 5DSZA 1N25A 4ZOLB 3CW8X 2ZAGA 1VKZA 1ABFA 2X5KO 3CEJA 1N1GA 4CKZA 2DAPA 4XPIB 2CNWA 1H5NA 5F73A 1RI4A 2YUTA 1QVRA 1VL0A 4BO0A 1N7JA 1R3DA 3OZSA 4LVNA 3ESAA 4ERNA 3DQZA 2JJ2D 3ZEAA 3M6UA 3BHJA 1XF9A 2H2FA 1A04A 4JP1A 1Z5ZA 3A3OA 5DYYA 2QX8A 2D1TA 2PANA 2KI5A 1ODIA 2OORA 4IGEA 4QVKA 3H8JA 1M2EA 3DMHA 2BV3A 5E1BA 4M0KA 5JALA 3HP7A 4MS4A 3HWRA 5FPKA 1BX1A 5ITSA 3TMKA 2WIGA 3QV1A 4LYHA 3OOYA 2OQ2A 4MUEA 1TRHA 4XDGA 2BEKA 1U7OA 3QNMA 4E32A 4P9NA 3SN6A 5DH9A 1R4MA 4P22A 4H3SA 4LMRA 3A7DA 1Z0FA 1UDRA 2IOFA 1Z7GA 1BIFA 3OWXA 4LQCA 5BNFA 1A5SB 2GPBA 3LLSA 1RRMA 2GEBA 3MRVA 3OJ0A 2NVBA 1ZX1A 2PRZA 4OQEA 4ZYTA 2F4VB 2ERXA 4JBYA 1W1IA 4FZVA 4XX1A 3R76A 1WHSB 3TK1A 2DQZA 1SC1A 4RVUA 3WMWA 3X1XA 1Z0KA 2VDNB 2ETVA 3H84A 3D64A 2QU8A 4QU8A 5AKGA 1U28C 2EZTA 4BPRA 1I30A 4OBWA 5CDGA 3I0NA 2F8SA 4Q9LA 1E18A 1X7XA 3DFMA 1THZA 3R0QA 4MITA 3SIPA 3LUHA 3A10A 1CRLA 1J9GA 2B8TA 4IJVA 4IHKA 3MT7A 3P0JA 3ZGVA 4RNDB 4TXHA 1YJ8A 1FQKA 1SXJA 1O89A 3OM9A 4W5QA 2W4QA 4TT8A 3E23A 4MDEA 1L7PA 3AUAA 3IE1A 5F33A 2JLWA 5AM0A 1EUQA 1UXOA 3H8VA 2F9LA 1KYYA 3C74A 5BT9A 1UFRA 5MGNA 1U9IC 3UV6A 1TJNA 2IEAA 5SICE 4FWTA 2V7VA 1VJCA 2G77B 2JAQA 3A7EA 3LHDA 3ECAA 1Z4MA 1NE7A 1U4NA 1SVLA 2W71A 1Z4LA 2YHIA 3BL5A 4X3OA 3TQSA 2A0YA 5F9FA 4TTQA 2WFAA 1ZXXA 3OPNA 4ZYZA 1W5SA 3WIBA 4KPFC 1G8YA 1ZUWA 2FFBA 1OZHA 1RXYA 2ZROA 1US8B 5D86A 1K86A 5ECWA 3VR3D 5AM1A 5FRDA 1XJ5A 5EP1A 3RRFA 4NY1A 1YR1A 3V2IA 2C5AA 4G89A 4KKXB 4OAPA 1N5DA 1NW7A 4A6DA 3CF2A 1EE9A 1FUKA 3Q3VA 4UUPA 4D0NA 1QF6A 1TZBA 4JBHA 1ECBA 1ONPA 1ZFNA 2JFFA 5EWMB 1ZSVA 4FS3A 4BKOA 5LLTA 1KU0A 1OF1A 5D00A 4EWLA 3HY6A 3RSGA 5AW4A 3T7KA 3PKZA 2D5LA 1Z6YA 3MWGA 4DKXA 3CZMA 3GT0A 2JGFA 1R6VA 1L4LA 2A1TR 4CW7A 4TSKA 4EJSB 4UMDA 4J1TC 4K6CA 3C8DA 1ZVVA 1O6BA 2EJTA 4PHTA 1PNVA 2FXVA 1DHRA 2OOKA 4PO8A 5MFPA 1I0IA 3ROXA 3UWSA 1J8MF 3CINA 3Q2KA 4IIGA 5JO0A 2YQ4A 3JQPA 4HDOB 3WNCA 2V0GA 2QD3A 1ZYUA 1E3LA 2ZJ1A 1YAJA 4K8RB 4WNCA 3EARA 2OQIA 3RIGA 1T1EA 4DXAA 4EF6A 1NX6A 5GP1A 3GP5A 4M99A 1CRPA 5L7TA 4RH3A 1V96A 1GZ5A 2NACA 3HG7A 5U1PA 5SV2A 1RHKA 1ICIA 1OXKB 1RWNA 4KZKA 4QOHA 3K15A 4YCMA 3VPDA 1Q0LA 2HUNA 3GAMA 1THGA 1N2JA 2CBXA 2JFHA 3BMQB 1MB0A 1CCWA 2B30A 3EGCA 1E7RA 3KE8A 4OQ4A 1HE3A 3RFTA 5BT8A 3WRVA 2HMVA 1HTWA 3N0VA 1LI7A 2PQ0A 1W6UA 5DLDA 4DPMA 4M46A 5HRCA 3V1NA 3U7GA 2CXQA 3EIXA 3G0BA 1EWQA 2Q2VA 1ADFA 3LG2A 1C29B 2TYSB 3TMYA 5BSFA 3FDJA 4NLLA 2H9YA 3DO6A 1OHHD 4MS1B 1VQ1A 4OQFA 2NM0A 3F3MA 3SX2A 4CF6A 2PJRA 1NXQA 1PJ2A 2PJZA 4BAUA 2GZHA 3MTEA 1DBVO 3NVAA 1PJSA 4LQLA 2OILA 4D0SA 1TNDA 4W8OA 4UXIA 3EPLA 1LPNA 1PCXA 3DBLA 3HJUA 1E92A 5A6SB 4DLRA 1CUWA 1J2EA 4GBED 4O1HA 3UJAA 3MS4A 1V3UA 4HNTA 5B6PA 1NLYA 1IXRC 1WXFA 2FSVC 2QI9C 2WWXA 1IDN1 2HZ7A 1P2FA 3DXZA 3F4LA 3PC8A 1YL7A 1SVUA 4NH0A 4R1MA 1J8YF 1CD5A 4ZI5A 1ZITA 4X8OA 1ZZGA 1Q3HA 5KOHB 1YQQA 2J9FB 3H2JA 2YN2A 3M5CA 3WRXC 4OHZA 4CKBB 1XZCA 4GI3A 2GQ0A 2M32A 2PRIA 3SS7X 4CKEA 1TJPB 4KR6A 4FKZA 1CLEA 1G20B 1MCZA 3RUIA 1I2MA 2Q2NA 1R8YA 3QVSA 4QUIA 4WN9A 1P2GA 1V3TA 1AMNA 4HS4A 2B8JA 2IYZA 1TF7A 3FCAA 5K3BA 1HE5A 3IXQA 4EKGA 3RSSA 2OO3A 3LF1A 4ZXFA 4C0SA 4POOA 3IE0A 1YWGO 1U0BB 1FVFA 4PZAA 4C08A 4JXXA 1GRVA 4DW8A 3NDIA 1MN6A 1SFRA 3TQTA 1NP6A 3JQ9C 2I54A 1F2TB 2QVCA 4PZ0A 1I80A 3A3NA 4NSNA 5AJTA 4KREA 3VC3A 3O2QB 2X0IA 3OCUA 4KVZA 5AXAA 1ID8A 1CBUA 2RAFA 3FVWA 5TQ2A 1N6PA 3VHXB 2DFLA 3KT8A 1JVBA 5F12A 2Q2WA 3WDSA 3GBVA 1IPHA 1KKMA 4FDMA 3IQZA 4A10A 5I7FA 1WF3A 1PG2A 2WJAA 3MJEA 3WV5A 3K09C 5SZIA 1TF5A 1IRXA 4YJKA 3I12A 4KGDA 3EUWA 5FWXA 1SY7A 2C2WA 4JMPA 4UEKA 3H8SA 2VP4A 4B44A 3WJ2A 3AW8A 4UHHA 1SG9A 1DCTA 3A6HA 3UAZA 4I8IA 1WEKA 2V59A 3ZV3A 1E9CA 5J58A 3DE6X 3CVUA 4YCBA 1GR1A 2DG2A 3HM2A 4HEJA 1FLAA 1N2CB 4QICA 5A05A 4B4OA 1AQLA 3NIDB 4EF4A 1GA1A 2X7JA 2RH9B 3RRZA 2CF6A 4JU8A 1NQOA 1KI9A 3GFFA 4MV5A 1UZMA 3H99A 4LJ5A 1XJWA 2PPVA 4IHJB 2YYYA 1V7ZA 1TJ4A 2XT9A 3H2ZA 3C3AA 1LTQA 2JI6A 2AB0A 4HDCA 4D96A 1XKLA 4G5GA 3FFAA 3R5SA 2R25B 1DG1G 2VJKA 4DT1A 3STYA 1E9RA 3O0DA 1FDRA 5JLJA 3KETA 1D2HA 3A3YA 5DYGA 4BRZA 2WU8A 3BMNA 3E3MA 1RBYA 1UOPA 3D8NA 3N6RA 5P8WA 4EPTA 1R4ZA 2HJ9A 4TS1A 2V4MA 3H1AA 1UFKA 3DW3X 4G4JA 5CT9A 2GYVA 2A35A 1GRQA 3DT6A 4LF7B 4OX9B 2OV1A 1PVVA 1GZSA 1I1QB 2XE4A 1A88A 2OENG 4ZQEA 4YCCA 1C2TA 1KZGB 3R3UA 5CEJA 3U44A 4IYJA 4C5BA 3SDZA 2RH4A 4GNKA 4ESEA 3CLUD 2CBGA 3JALB 3HLKA 4J4HA 4QWMA 5BYKA 3J81k 1H9BA 2RJ3A 4GOKA 1E60A 3LHIA 3NOVA 3QU7A 4PG7A 3SJBA 7ABPA 1N7GA 5H82A 1WY7A 4IXWA 1ADJA 2H1LA 1Z74A 2VUUA 3D3KA 2WZCA 2FPMA 1Z45A 1YGPA 4JLNA 1B74A 2HJRA 3DDHA 3N5KA 5K9ZA 3P0IA 3KWLA 5GTDA 1H8EA 1QANA 3TIIA 2HJSA 3F8SA 1O7JA 1U2ZA 4LF6B 3DH0A 3OD5A 4UVHA 3W6NA 4BOYA 5GV7A 1QP4A 4NH4A 3OZEA 1SKQA 4NOJA 3WTCA 4NOMA 2VSYA 2ZWAA 4PX3A 1F38A 2E4VA 1XDWA 4GX0A 2H92A 3B7PA 2EQ5A 1H66A 3EAQA 1CJUC 2OZLB 3AR3A 1G0OA 4E03A 1WVGA 1EM6A 1H2FA 2VDRB 2QROA 4J0FA 4N76A 1DIAA 4WZBA 3PX3A 2DJ5A 4FBGA 4KH1A 1Q0HA 2GZRA 2PJUA 4BNDA 4DIFA 3U1BA 3PV0A 3OPMA 4OKIA 5K01A 5ECYA 4DA8A 1QRSA 3KUKA 3N07A 4QTXA 4F3YA 4F8JA 3W90A 1Y80A 4DILA 4L8GA 4DA6A 2H9AA 2I99A 4LI3X 5JD5A 2IV7A 4WT7A 1RXWA 3RHTA 4KQEA 3OJEA 1RI2A 1E3SA 2REBA 2XNSA 4GLLA 3SQMA 4B0PA 2HIAA 2FVYA 2JAPA 2PX5A 4DADA 1G5RA 2Y6VA 4WK2B 3H9BA 2HPZA 1PKEA 3AIMA 4WOPA 5KU7A 4J8PA 1DQNA 4FK8A 2CLSA 5FUXA 4JKOA 1VMKA 2C29D 1EU1A 3LGSA 2OPBA 5CJJA 3R9IA 4FM9A 1S2GA 3TW8A 2DPGA 3H2YA 2ZUUA 4DQUA 4A8JB 3B6JA 2Q3HA 4OEHA 3P2MA 4Z51A 2XX3A 4HSEA 2UUAB 3OAAA 5JXWA 3SY8A 1IOLA 1ZAKA 3D1JA 2I4MA 1T0JB 4HAOA 3PUIA 4RKQA 4CGYA 2HR1A 1VLLA 5BVHA 4IIJF 3RSCA 1L5FA 1RLIA 1Z82A 2AOTA 2QOEA 2C0CA 2Z2KA 3BE6A 5LBTA 3KKOA 1ISMA 4P4GA 3I1FA 4KFSA 1PNQA 3WQBA 3GLHB 4FX5A 4DJDC 3T3OA 3GJSA 4RPHA 5I5GA 3U56A 5C2JB 5CDSA 1SD1A 1K8QA 3IUSA 1E3JA 2YJNA 3SKVA 1MA0A 1LVHA 2AD5A 5JXJA 3PEWA 1G42A 1DFHA 1C0IA 4HGRA 5JNUA 3QKRB 4EYEA 1ITZA 4U6QA 3GOHA 2PT6A 4C4PA 2GEJA 3AL3A 1N5OX 2G07A 3KR2A 3PIDA 4Q4AA 4TYMA 1GNQA 4PYNA 3WE7A 1G291 2X0EA 1UFOA 3PVCA 5TPWA 3WGGA 4C4RA 2Q6TA 3IYLW 4NMLA 3SLGA 1LBEA 1W29A 5KHOC 1FNMA 3DHNA 3KX2A 4XKJA 1GL3A 1ZA2A 3PPYA 4RTLA 3WK7A 5EJ6A 2FFAA 1E2IA 1OI3A 3GHYA 4LC1A 3MXTA 1W96A 4MR8A 2BRUA 3IAXA 1I33A 1ZIPA 2IY8A 3IBSA 4KJZA 4XIFA 3FWPA 4IDAA 2XW6A 3R75A 3SC4A 4ZYVA 3B52X 2H1HA 2G1AA 3SQDA 1G8KA 5JXGA 4DLVA 1R4NA 1C7JA 4DJEC 5K8TA 1WULS 2WTAA 1AKUA 1H2BA 4KAJA 2CFTA 1JKIA 1KP2A 3H5OA 1XE3A 2VT6A 3O3OB 2YXNA 4DV0B 5I3CA 1W5EA 2BJVA 2BMDA 2GJ9A 2JZNA 1IJEA 3JQDA 4Z7OB 4XOUA 2R6FA 4EABA 3KV3O 3E2PA 3T7JA 2AMJA 1U7WA 2J5KA 4MV8A 1CS0A 3MYYA 4PQFA 1XTSA 2HA2A 2H8KA 2J9GA 1GAEO 3STHA 4C0XA 5CA0B 3ASVA 1V4NA 3E0QA 5KCMA 3WK5A 3C1TA 3DGEC 4FZ5A 3UOWA 1IQPA 1SWVA 4P0TA 4DAEA 5ALKA 4Y2VA 3KL2A 4CMCA 2CV0A 3KEGA 3GFBA 2CEAA 2XMDA 3CUUA 3I9NA 3DAYA 1NVFA 4WEOA 3KE9A 5AKZA 3SQXA 4JODA 4XTCS 2W9XA 2A4KA 3D4IA 3TLGB 1A77A 1X7DA 4RJ2A 5F9HA 3C1UA 3TRKA 1H3NA 4K28A 5DP1A 4UDOA 3UGKA 1JH8A 1G60A 3FTNA 4BNUA 2GZAA 4LFAB 3A9VA 4O3FA 5AKYA 3LY5A 5KI6A 1G2QA 2IDMA 3GZNB 2OAQ1 5G1PA 2Y2UA 3NC1C 1P1RA 1W2HA 2B9VA 5TT1A 2DQKA 4S1TA 1L5NA 3ZJYA 1B6TA 4EZEA 1ZN8A 3ZOKA 1VIVA 2PV7A 1YBHA 3H9CA 4EUNA 4XVQA 4QUEA 1RHQA 2R7LA 5ESWA 3WWCA 1EUDA 3OJFA 4MUNA 3BZBA 3HHEA 4YROA 4D4IA 1RYYA 3EIFA 4CUKA 4D7AA 1KETA 4NV1A 1OH6A 1R4AA 3QFRA 1I2DA 3CQ9A 5A4IS 4N3GA 1QO7A 2MSKA 4HUJA 1ARZA 3W1WA 2G6TA 3QIVA 3QJYA 4R9VA 4GS5A 1JUDA 3CUWA 1ZI6A 3N3AC 3LL4A 4MVJD 4TWIA 5UKDA 3UMCA 4F4JA 1T9HA 1GJRA 3KZMA 2GRAA 4HGZA 5FAXA 4AU1A 4EHDA 2RIPA 4TL9A 3HBMA 2IK8A 1CRWG 3RUEA 3LT2A 1HFKA 1Z5NA 2IHZA 2EX0A 5D3ZA 2FXIA 2H1WA 1XTQA 3CNBA 3AI2A 1UAAA 3OU6A 1UM9A 1B0ZA 2PSDA 3AEQA 1YRQA 4ZVKA 3FTFA 2QP9X 1U0JA 4UMFA 4RDCA 3AVOA 4N8EA 1PO7A 2A9RA 3HWWA 3DKPA 3TLCA 2F48A 4GLFA 2R1VA 1RWXA 2DQ4A 4OHWA 1UFQA 1Q11A 1WKVA 3DV9A 4C1NA 4DYHA 2PAAA 1NI4A 2AHOA 3V32A 2BI4A 1E69A 2HWUA 2ZXEA 3OZTA 2FMXA 2R7MA 2WUDA 5JAZA 4G5QA 1T5LA 3FNRA 1NVGA 1PGOA 1CQZA 2WF9A 5IJWA 3I2HA 2IYUA 5TARA 3FZYA 4KNYA 1XROA 3W0LB 1A8IA 4PPGA 4ZO8A 4O0MA 3ET4A 4KWHA 3RW9A 3X1JA 2ZR7A 5CCDA 4X41A 3AIIA 3OQIB 5ALVA 2RD2A 5CP8A 4LJAA 2ZSJA 4O0LA 2XBMA 1NF3A 1ZOOA 3N2YA 2QZJA 3LHKA 1G63A 2IKQA 3COVA 2OXTA 2IHNA 5JDIC 2EBFX 4ZDIA 4ROSA 1NJ2A 3FKSA 1GAQA 4FB5A 4KR2A 3H7IA 4EFMA 5THQA 4OYRA 2R5FA 3TW0A 2FUNB 3TR0A 3QEMB 1NXVA 3BTVA 3MGCA 1WXQA 3AXTA 2INGX 3QK7A 2IS1A 4WKCA 1IYZA 3QE0A 2NIPA 4AUNA 5EJ8A 2BM8A 1M7HA 4QLOA 2C4TA 1TMYA 3FGPA 4HH4A 3SYLA 1QAOA 1ML3A 1W93A 5T6MA 3WMGA 4ZT2A 4GXQA 4H3HB 3BFJA 4L4YA 2JGJA 2QJRA 4K0KB 4UDNA 4LC9A 4WBNA 3FHJA 1N5MA 1OLUA 2NP7A 1W6RA 4QU0A 4I3HA 3BSWA 4YRJA 3WZLA 1BQ4A 1MA3A 1H0RA 3AUSA 3ZY5A 5B58C 2JK1A 1TA4A 3D54D 2VWHA 2BCEA 4QBFA 1ECGA 3AF6A 5HK9A 1SHZA 2I6TA 1QKIA 4CQNA 1H6CA 4C05A 3AY0A 3IBFA 4CCSA 3T5TA 4JVMA 4ZQBA 2V6JA 3DL4A 3RF6A 1P4SA 4GUAA 1RQXA 2BM9A 1KVSA 3RDPA 4BVFA 3RASA 3SNKA 2ZIWB 3UQYS 4UCXA 4KQ9A 3S1AA 3VR2D 1IOWA 3MBOA 4Y2JA 5BYJA 2OHIA 2D7CA 1BFDA 3K0BA 1BZYA 2FYTA 4BGVA 3WL8A 4TKVA 1PZEA 3TAHA 1VE5A 5FUQA 4I2NA 1QX3A 2XWSA 4ZT6A 3RK0A 5KDLA 3A9WA 3HFRA 2Q28A 3KEFA 4J90A 3THYB 2X5JO 1IIRA 1NNI1 2QW8A 2R4QA 4J3NA 4P80A 1ZVKA 2ZAMA 5FWDA 2YV2A 2A33A 4DS3A 5AUNB 4CLRA 4HVLA 3FYUC 1IZZA 1T3LA 2Y68A 2C84A 4TKMA 3S1LA 3NDJA 1DQPA 3SHVA 2KSQA 4DBLE 1Y6GA 2BI8A 1JHRA 2JEZA 3ORYA 3PC2A 3BAFA 4B84A 4RIFA 1SIWA 1IRIA 1KBQA 2G63A 2VXYA 3VPAA 3FR8A 5D6NA 1YBAA 1ZVJA 4UHDA 1PJRA 3CUSA 1M9NA 2VHTA 1G19A 4MGEA 1CR0A 3KOWA 3V8EA 2EXXA 2A84A 4ZMRA 5L3QA 3RTBA 2HNBA 4LOHA 4MQFA 3PHLA 1XRLA 1WQ4A 1GLVA 2KMLA 3QVOA 1JMKC 4M0LA 4F3RA 3HXKA 1VPWA 2X5NA 4AX4A 4CFYA 5KTMA 1H9CA 4NYJR 2X9GA 1J21A 1ENOA 4IICA 4MAMA 4AKIA 3B7GA 4WKGA 2D13A 5HHTA 3O8NA 1MAWA 3O8OA 2GAIA 4OHUA 3TZLA 2GKSA 3PCRB 4AJ1A 1QU3A 4G1BA 3PC8C 3MRTA 2XSZD 2DB3A 2UKDA 1DWPA 3WMXA 4YTEA 4YLGA 3LZDA 5K3OA 2KLBA 1OFIA 1ZD5A 2B4YA 3TSZA 3ZH9B 1GTVA 3RS7A 2GN8A 4QPPA 3KJGA 4RANA 5KMGA 2VF2A 3CPSA 4M1MA 3U7RA 2WIDA 1SK9A 1G3QA 5EE1A 3RGGA 2V96A 3CVYA 3ZW8A 3PE4A 1WW8A 5EHZA 5I7SA 4G0VA 2LZ0A 1PV2A 3SZ3A 1UM9B 2LCFA 4HAVA 4X71A 3TRIA 3BQMB 3ZLTA 1MX9A 3SHTA 1GV0A 1NJ5A 1GTSA 1NUTA 3AERA 3FDZA 2GCNA 2I7XA 3O21A 1Y1KE 4TQ9A 3SEQA 3WNZA 4XVRA 1JXAA 4C4SA 1H4SA 1IQ0A 1U5BB 2C7BA 2HK7A 4IJ5A 2WHYA 1TX4B 4RK7A 3SBDA 3WKCA 1FUIA 4HQLA 2IYLD 3F3YA 3UGQA 4ZVSA 4B4UA 2I33A 4GKBA 1G7TA 3QLJA 5LR6A 3W5VA 1YFZA 3RU9A 1AKVA 4B40A 2NSJA 1OLOA 3FGOA 3O8QB 3LRXA 4PHFA 4RA9A 1X3SA 4JZYA 4BZWA 1OPRA 4Q3DA 1ICEA 2DECA 2CLEB 2EZ9A 3LFHA 1DNPA 2BBTA 3CPJB 2VHCA 3WRYC 2OAGA 3TRDA 3GYBA 5C34B 5F35A 2FPPA 3F5FA 3LXXA 2PUVA 1Z12A 3B3AA 3G2IA 4L73A 3M5WA 1W9HA 5TDHA 5E3IA 5EYPB 3LSYA 3D7MA 3VR5A 2AC7A 1OV4A 4AIIA 2REQA 5EMHA 3PTAA 5FNVA 2FQQA 2JHCA 5BP7A 2ZWIA 2QP3A 3GARA 4JI1B 5JJLA 3HDTA 3IQGX 2ZI3A 4K0RA 5COQA 4ZXPA 5JZSA 1SXGA 4XVCA 2PSEA 4BVEA 2I3ZA 5C31A 3PIRA 3K9WA 4XEUA 5DNUA 5FV7A 5KVCA 2ZRHA 5HIMA 4AMBA 4ZKDA 2UUBB 4TXLA 5J2TB 3NT2A 5PNTA 2PRSA 1PS9A 3JW8A 3KKEA 4DNXA 1GNPA 1TKBA 3DDCA 4V2IA 1XU7A 3JQAA 4IYRA 3K32A 2Y0BA 2YXEA 3I6MA 4BS9A 5BWLA 1JAHA 2HLDA 3K1AB 5KPDA 3GJ0A 2ONKA 4IW3B 4LOIA 3IKTA 2F67A 5CR9A 1JFSA 2RBEA 2VLIA 4RXMA 2JHAA 5IHPA 1GUDA 4JENA 1KKLA 3AWIA 4OATA 4R81A 5LBIA 4B73A 3TNJA 1H2HA 3TIVA 2GVNA 2JB9A 5CCEA 3EFOA 4BV9A 5K8JB 5LN1A 4ZPJA 4EAQA 3NXKA 1Z75A 2B35A 4FYYA 1SHJA 3R6GA 3CCCA 4I6JA 4EDFA 5ADVA 3OPYI 5LVAA 1MFZA 1XVLA 2OHXA 1W87A 4K46A 1IU9A 3AFHA 1JYFA 2H1CA 2NNLD 3H9UA 4F11A 4AYXA 4OQYA 3ZGXA 4WUTA 4MARA 5K0EA 1GAXA 1Y33E 3BXHA 3JATA 2NTNA 3CRVA 4A8TA 1VM6A 5A1JA 3OVMA 4PYOA 1C9KA 2A9FA 1XU4A 3PLNA 3BXEA 4IFIA 4QYIB 3VZCA 3CR3C 1CT9A 2X4LA 2NP6A 4IH9A 4GOMD 4JWTA 3HB7A 5CH5A 4JBWA 3FOBA 3R23A 3RIMA 2RSLA 4FCTA 5L7WA 3LYHA 1AKYA 2HN9A 3ESZA 3JAWA 3DTVA 4QRDA 5DVZA 4TSFA 3WMRA 2FG7C 4E5SA 4IR7A 3OPQA 1LW7A 2A86A 5ARBA 2ZE5A 4JQCA 2Y0CA 2F1IA 2GFQA 1G7CA 1NPDA 1KI2A 2ZRPA 4PZDA 2WY2D 1K27A 3GLFA 1LLQA 2V98A 4UTXA 4D43A 2CUTA 4F2WA 1CUIA 3AHHA 2EDCA 4KX3A 1I8TA 1U8TA 4M1ZA 1Q84A 4Q18A 1DB3A 4Q9IA 5K4GA 1EFPB 4G2NA 1GPAA 3FUUA 3IJPA 1N4AA 3BCRA 1J2JA 4DIBA 3SMVA 1YC5A 1S7GA 3NYQA 2IEZA 1CQJB 5CIQA 5E38A 2QRQA 4TYYA 1AHNA 3M3DA 3KSAC 1WHTB 2I8CA 2IE0A 1II9A 2BI7A 2WAXA 4X8LA 1B23P 3P9KA 5ERGB 5BWOA 1Q57A 4EYQA 2ZRAA 1X70A 4P53A 1SMKA 1DBWA 2RK6A 3JR3A 3LFUA 2PDAA 5JR3A 4DMLA 1WSWA 3AM1A 1IXZA 1SBNE 2XR1A 2EX4A 3NOQA 2ZYUX 3GQVA 5CRIA 1QVAA 2E87A 1E3WA 4WZBE 2TMYA 3B6KA 4EB6B 1W30A 1F6DA 2OYCA 4Z0HO 4TMVA 1S9HA 3T4UA 5H1YA 1FSZA 3CGWA 1FCJA 2HRBA 1DFGA 5EPUA 3CUEF 1T5IA 2PKQP 4O33A 1ML4A 2ZRFA 2AI3A 4JSYA 4K6KA 3SE0A 5FOQA 2J46A 3VBCA 4YWHA 1EVJA 5JVDA 4MVXA 2HM7A 4PIMA 2WQ6A 4UUNA 2KPOA 2NQ8A 3BTUA 3OLVA 3OTIA 4NJMA 2R60A 4Y9SA 2B4KA 2DR0A 2CDRA 2B4RO 5D1HA 4JL6A 4NPCA 1RD4A 1N5LA 2WJZB 4CFSA 1B6GA 2QB5A 4PPQA 3B1WA 2ZSEA 4FFPA 4H6XA 2UZ4A 4J0DA 3AKEA 4CDRA 4LJKA 1JVNA 2O2YA 2GA8A 1YE3A 1HNWB 5JQGF 4HNQA 5KO2A 4B17A 1WDLA 3V8NA 4DBZA 1NJFA 3GW8A 4OHKA 1NYTA 2QLTA 1XCOA 4L78A 2AN1A 1QTRA 3ELBA 3H0EA 4RPKA 4ZAWA 4C04A 1A8PA 3GO4A 4I55F 3RG2A 2HWYA 2BFFA 1SO8A 2O8EB 4NOKA 5TR9A 2Z57A 3AEKB 3HRIA 5JISA 16PKA 3W4JA 1UADA 2WRZA 2W4IA 1EK0A 2J9XB 2MSLA 4R7TA 5A2QA 1DXOA 4DLZA 4MVCA 4JYAB 1CC1S 2XLCA 3R0XA 4HDNB 4U9UA 4OHFA 4C01A 2IIVA 2MINA 1OGJA 1C3JA 2FRDA 1F6BA 3PDIA 4UVGA 2A8YA 4DGSA 3EPJA 1OQAA 2YIDA 5CIYA 2AG5A 3DNPA 3EG5A 2OFFA 4QXPA 2YWGA 5BW5A 5MN6A 5DBHX 4PCVA 1AV7A 3H2HA 4Q47A 4R7GA 2HNAA 3DLPX 2XYQA 3D4LA 2WNSA 3HGMA 1GZ6A 1P3DA 2UVQA 1T36B 1V16B 3A32A 3HBFA 3UB3A 2IX9A 4A23A 2Z5GA 3C2QA 2C1EA 1HFWA 1ES9A 2XNDD 4I99A 5ICGA 4M9SA 1R9JA 5I7WA 3P45A 1JH9A 2FSSA 3MWLA 1NT4A 4IJKA 5LYJF 2C7GA 2PX2A 3E9YA 3KSZO 4EJMA 1CX9B 3HBLA 5AHXA 5K3CA 1Y8RB 4M7PA 1JG6A 2OC4A 2QN1A 1AQUA 1QFXA 5HXAA 5KSYA 3D9QX 4TRRA 4AD8A 4JLPA 4QAJA 5KOIA 1EGMB 1ZCJA 4GPBA 3VU9A 1BN7A 1H1LB 3NBYC 4Y0NA 3YASA 3UA3A 3VI4B 1SUAA 3ZDEA 5JADA 5LQJA 2CEKA 5JNVA 3NASA 2X22A 1BCRB 4X1IA 1WPXA 4ZQGA 4FCCA 5KNBD 1DELA 1BA2A 1T3HA 1OE0A 1DP4A 2P6OA 5H3HA 4JI6B 3GWZA 1C4WA 4UUBA 1VE6A 3GJYA 3L0DA 3C7CB 1FRZA 3D0QA 4QJIA 5F5XA 3ZXIA 5DP2A 1T8YA 2QAGA 3G2KA 1CUAA 5K1ZA 3JAWB 2A9KA 1WB9A 3UH0A 3UFXA 4RK4A 5DIFA 3JYQA 1A8HA 2CUNA 5CVCA 4O2BF 5AMXA 1KQOA 3MPOA 1GVNB 3GLVA 2O2HA 4ZVLA 1E3EA 2X76A 3G23A 3KKPA 3WBFA 4L72A 2DBQA 2ECFA 2VJLA 3G0OA 3MSCA 4Y2UA 3U80A 1KYXA 3G1TA 1A9XB 3U1VA 2GHIA 1VGQA 3V7WA 4NESA 5FPYA 1U0SY 2FW0A 4I5EA 2ZT7A 4BNTA 3T34A 3R9WA 2PZEA 4FUTA 5GIOE 2F1JA 2OAEA 2EP8A 3L7OA 1WD5A 1ZKDA 3OECA 2ZRNA 2XKAA 3SDBA 2O7QA 7GPBA 1DGQA 4IZ6A 3RI3A 2XF8A 5L4NA 3VSEA 4CU2A 1HGXA 4OGKA 4C6RA 1P19A 1NVWQ 3N87A 1PK8A 2JFOA 3NGXA 1K75A 4M0EA 2QN9A 2Y1XA 5FFNA 1WD7A 4MQMA 2FZCA 4YJ2F 1QLJA 2WKSA 4IH1A 8AT1A 3QLVA 2I91A 3KT6A 4Z99A 1P39A 1X87A 1MO6A 3GZTB 5ALNA 2XV1A 4AZ3B 1IVNA 1EPUA 2PGLA 4NYMQ 1E2MA 1D0SA 1A4RA 2BTEA 2IZ5A 1X13A 4C0KA 4G1EB 3QPVA 2R5NA 1DKLA 3KM0A 4CL3A 5C1OA 3M1AA 2ID8A 2AJBA 4Q1BA 4NMMA 4BUCA 2C5LA 2J3HA 3VTFA 1OFUX 3OUZA 5AP9A 4HZUB 5KHLB 1B0PA 3GJZA 3SAJA 3V4SA 2CNBA 2UYYA 2QDXA 3JQQA 4YCAA 4OJMX 2OYRA 5BUZA 3LAWA 3BE8A 3ZE6A 4J0JA 4KOAA 3V1MA 1OTHA 1MX1A 1CJVC 4M9ZA 3K0FB 1RLMA 5H80A 2HPHA 4IXNA 1JIQA 1G8JA 4OQLA 2BFCB 4EW1A 5GINE 1N0UA 2G5TA 1YR6A 2XA9A 3Q8XB 4M0PA 3VO1A 5CYPA 5TPZA 3B9QA 1AURA 2QRVB 2A0KA 3OOSA 1WLYA 4MH0R 4R8MA 5LLDA 1AN0A 3SR4A 4CM9D 2FPWA 1IM5A 5AVOA 1L7BA 2XWPA 1GDHA 2H31A 3EBLA 3EUAA 3OURA 4N54A 1C0PA 1P7YA 4QODA 2VF4X 4L0QA 4GDFA 1TXGA 4WW0A 4QGFA 1RHRA 1FC0A 4BE9A 3ONDA 3C3DA 2VQFB 3FTPA 3ANMA 3LX5A 3P71T 5BW8A 3A1TA 3OUUA 5J4KA 4LJYA 2R97A 5HPYB 4XTRA 5EESA 4CT5A 2JLSA 3DVLA 1GLNA 1XTRA 4L3OA 4ENRA 1OLXA 2GCOB 2V5VA 4M1OA 3PHJA 1VSVA 1M5UA 2QSJA 2ZWVA 5F7ZA 1ODJA 1ZM2A 1NMZA 3AUFA 5FLEX 1MAVA 2CJXA 3OEEA 1GGVA 5KNCD 4MCAA 3LBYA 2HT6A 4MWCA 5KTOA 2AOUA 3B3GA 4WXMA 1WTAA 5CPFA 4GPEA 3BRSA 3OO1A 3K96A 4KJXA 4H6VA 4PU0A 5LJLA 2JBAB 1IOVA 2BH9A 1NBEA 1QQ7A 3BE4A 1Z0ZA 2JG3A 3E9EA 1KOJA 1FP4A 2B1IA 2CHVA 1R5BA 3BVPA 5HMMA 5BSKA 2ANCA 3TL6A 2BH2A 1EESA 2B92A 3GD5A 3NZEA 1ZY2A 3P2OA 2R8PA 5C5IA 3MWJA 1RIFA 3EXFA 3V46A 2IEIA 2EL7A 1QCYA 1L5YA 5TF0A 1IBLB 3G9ZA 3HB9A 1UKEA 4U2GA 1TU3A 3L1VA 4L4XA 4INZA 4UAGA 4XPIA 4JXZA 1SK8A 1JJVA 1V7QA 3B51X 3GCZA 5IF3A 1XO1A 1T9GS 2EQAA 2HF8A 1WOYA 2C2BA 4IEIA 4YJFB 2IE8A 5DHUA 3L8HA 2JGIA 3C87A 1JDZA 1VSTA 3PQ3A 1KOGA 1JYSA 3ADDA 3RAEC 4LZJA 3OESA 4B6PA 4QSMA 1Q1AA 4TXJA 1Q7BA 3K8ZA 3UBMA 1MAAA 4BQEA 5B2EA 1KBOA 1U28A 1YQGA 2OWEA 2PV0A 3AP1A 3G7UA 3RT1A 1JKFA 1X7WB 5DNYB 4AXBA 3K2EA 4P83A 2IUTA 1ZIOA 5FJJA 1EE2A 2RI0A 1WJGA 3AF4A 4GKKB 1O4WA 4C22A 4JS0A 5A2GA 1XQ6A 4B4KA 4DJ5X 3FCEA 1M2JA 5CFZA 5JNTA 4CEIB 3VR2A 2YS7A 4TSFD 3QVLA 2QX9A 4E6EA 1U2GA 2FQWA 1E0KA 1X14A 1X38A 4QXRA 2B8WA 1HKHA 3Q85A 4RA6B 3IALA 4MUXA 2MHCA 4OG2A 2B8NA 5EGNA 2AGVA 2HMTA 4Z3KA 1XX6A 3M49A 1IXSB 4QATA 3UH1A 1H5QA 3GN2A 5BN4A 5LNK6 3CVWA 1U9IA 2JBWA 3JQ8A 1A5AB 1YBMA 2JH8A 4YT4A 2LCIA 4RVFA 4KDFA 2NPFA 1PV1A 2YQZA 3RU7A 4N49A 1F51E 4X54A 4E2XA 2IHUA 2IU6A 2IPOA 2E5WA 5DTIA 1J5XA 5DM70 4BMCA 1T13A 1SQ5A 3BMCB 3LF2A 5FA6A 3OP1A 1CDEA 1P5JA 1K6IA 4E15A 3LQFA 2HBQA 2QV7A 3VZDA 4RIHA 1B1AA 5EQDA 3EPHA 1C30B 4NVRA 2AKAB 3DLIA 3OTQA 2OB2A 2ODPA 1DRKA 1EB8A 1AQIA 1ABBA 1NTOA 2X2PA 3AO0B 4H6PA 3CF4A 4WVFA 5A5FA 1IATA 4GI7A 2BLNA 2PGIA 4H27A 2QRZA 4TTIA 4X24A 3UXHA 4UQPA 2IDZA 4F93B 1FDSA 4KW7A 1A5BB 3S6JA 2J6HA 4LMAA 3SJZA 3RTCA 3SQOA 5HGXA 3T3MB 2IUYA 1O57A 4UHFA 2X58A 3UAVA 4FC7A 1DAKA 1GKKA 2BSAA 3AETA 2XAUA 4I5IA 4M6WB 2Z5FA 4WRRA 3K0FA 1T2NA 4DRXA 1KA9H 1EH5A 1T9CA 3W7VA 4QL3A 2QTNA 3NCTA 1G7SA 1O6CA 3KSDO 5ECGC 4OTZA 2M9MA 5AM3A 3CEPB 4JEIA 1LBQA 3PNQA 2QQEA 2G4LA 2H63A 4HEA6 3LYAA 1R5JA 4ZGGA 2JKVA 2ZTUA 4L5JA 4R6XA 4QC2A 2VZ8A 4BFTA 1DV2A 1QGED 5EKTA 5EWMA 3VR5D 1XNJA 2P1ZA 3QTLA 2C58A 4RHUA 3MQ2A 3K4PA 1UPBA 1E2EA 3NPAA 4NU8X 2QRJA 2MR6A 1MB2A 3RYFB 1IC6A 3FFTA 3VM6A 4PGHA 5DW0A 4LNHA 2BCGY 4I4TB 2NV6A 1NQUA 2IXFA 4MZDA 4ACBA 3LC0A 4FYIA 3B82A 1J25A 4IX9A 3ANNA 5BV2P 1Z63A 4U2CA 1MAUA 2OLJA 3PYLA 4U8GA 4UM9D 3DM9B 4AAYA 3M8KA 1NJSA 2X2FA 4D42A 2WG2A 2EG5A 1DTEA 2P4HX 1Q1QA 2NYUA 3BD9A 2N9UA 3F7MA 1W85A 2RC6A 3JYPA 4KWTA 3UC5A 3NIFB 4QREA 4JJAA 3EF0A 5CBPA 5ILGA 5F7OA 5KJ6A 1ZGCA 2P1DA 2PZ8A 5DBGA 4OOEA 2Z04A 2FG5A 4HHEA 3UEOA 3FRJA 8OHMA 1XYYA 1KEZA 2QTBA 4PC6A 4YJGB 3UOGA 4BMYA 4JI7B 2CDCA 1TIBA 2HLNA 3IUEA 2ZEJA 3DOIA 4Q6BA 4HRVA 2JCSA 4Y1RA 2D5AA 4BO9A 1JDSA 2OUIA 1KYIA 4OUDA 1IN7A 4CIWA 3EH1A 3R7FA 2ZCUA 3EXG1 2G3YA 2VT7A 2ZJ4A 4ZVMA 4CNBA 1EA7A 3DOJA 5AR1A 3JSXA 3AJDA 3GC6A 1X92A 4WA8A 1O5OA 2GJ4A 1UINA 4CCYA 1UMBB 1VCOA 2GD6A 2NOAA 2VC2B 3A27A 3L0CA 3QOWA 4HB2A 3C97A 4XFDA 4U2BA 2AFIA 3IDAA 5JSKA 3AEYA 4FMBB 2BCJQ 3EZ2A 4FEYA 4AVYA 4EL0A 4UBIA 4XFKA 2QZ4A 4DIKA 4G84A 3D8RA 6REQB 1G5HA 2ZSDA 1XP8A 3AUUA 2EV9A 4LTNA 4NBWA 1OB5A 1V8PA 4XJVA 5FDFA 1YE5A 3GLGB 2NO1A 2BJHA 2PS9A 3D6MA 4IF4A 2HCFA 4GKAA 4KPUB 1OB2A 4BU0A 4BO4A 2HMUA 5ERXA 2PZKA 3T61A 4AJ4A 1NBOA 3B3QA 5EUQB 2NO4A 3I52A 5A9RA 4OX9Y 2O8CB 2FUG6 4LNUB 3VJRA 1JIJA 4HGPA 2QUAA 4PFKA 3MLAA 3DUFB 4AJIA 2GTHA 4HZGA 3VOSA 5CD9A 4IDOA 1NBWB 1FMCA 3WGHA 3JWHA 1SKAA 1G8SA 3F5MA 3VR4D 3KV1A 3UCFA 3DD5A 4H7HA 2RGNA 3DMGA 1MIHA 5ALMA 5AQEA 3GLFE 4HH3C 5I47A 4QULA 4TLEA 5KVQA 3NJ4A 3AI1A 4PSDA 4YCNA 1H85A 3SQNA 2DUJA 2XB9A 5AW9A 4R8VA 4CDGA 3NBFA 3RVDA 8ABPA 1GO2A 1EX7A 1Y3HA 2I80A 3KZXA 4TYQA 3IQXA 5EXSA 2E4WA 3W06A 3WWDA 1I7NA 1XTPA 4QARA 2J0EA 3NJ8A 1Q0ZA 2Q5JA 3KR1A 4G0OA 1YIAA 3HU2A 2I22A 1N2GA 3ZLJA 1UQRA 3ZQ4A 2F64A 1QDEA 1BVYF 1IZ0A 4IDCA 4BCCA 4BN4A 2J07A 2BUCA 3LOQA 4P7FA 1W4BA 4G8JA 5F78A 2BHLA 4JK3A 3UT5A 1T5OA 2EOAA 2BF4A 4MRAA 3TOZA 3CH6A 2DE0X 3IAAA 1J5EB 1MP0A 3FPSA 5T41A 1OC2A 1BU8A 4F12A 1G66A 1TZKA 2GPWA 4YK7A 4BZPA 4URYR 3DHVA 5CW2A 2QUIA 3AHIA 3KYCB 1E7YA 2GPYA 4PAWA 4U1RA 3CC8A 4DWVA 1RI1A 4BNXA 4C5AA 2R3SA 4QGHA 3QPAA 1RXCA 1VBMA 4PANA 3H18A 3TRHA 4H59A 5FYDA 1GG9A 2F17A 1TUEA 1XXHB 2YVKA 4RVHA 3H11A 5JZOA 2GXUA 2Y76A 3C5WP 4B7AA 4ENSA 5TS2A 2CCJA 4TN5A 3WB2A 4W5NA 2IXBA 3JYHA 4UM9B 1QHEA 2J31A 5A7HA 3DE2X 4JNKA 4RXUA 2V7UA 2KYRA 5BVGB 5CFOA 2WG1A 3NH9A 1SGWA 2ST1A 1I7PA 1Y5NA 4BFCA 3DWFA 1ZM4A 4FYVA 3UIEA 1T4GA 2VSOA 3GLIA 4PTLA 5LMUB 5AM5A 5BUQA 4AUMA 3OE7A 5T4EA 4BZQA 2FZ4A 1XNGA 1O0BA 3ONWA 2CXUA 2FWJA 2QUJA 3WGYA 1RM0A 2DR2A 1MU0A 3NWPA 2JJ8A 1GZ7A 2PT9A 3GK3A 3PXBA 1FA9A 2D8AA 1BEEA 2FMUA 4ARAA 4FGSA 5KDOA 4O1IA 3WGZA 4R4JA 1QXSA 3SQLA 1TTTA 4MMYB 4KO8A 4N1AA 2HW8A 4RIEA 3A58B 1G17A 4NEQA 3BCHA 4I8XA 1QWOA 4LHYA 5D5QA 1MPXA 1FLVA 5K45A 5M7EA 4WY5A 4MGYR 4XVHA 1L6RA 1KK2A 3T0FA 2IOFK 1MXHA 4I1UA 3TDKA 4NV0A 4XJXA 3TIXB 4J9UE 1GA4A 3QXJA 2OCIA 4NENA 1SPXA 4RLFA 1X2BA 1GUZA 2B99A 3N5CA 4N9QA 3AWDA 3PP8A 1VE9A 5IULC 3TXYA 3RNOA 3GA7A 2Y67A 4IM7A 4KUGA 4YUVA 2Z56A 4TV9B 3WWZA 4EEKA 1JWLA 1BGWA 1HYQA 3I8XA 3I09A 1TZCA 3RFCA 3ZV7A 3ELUA 3BRCA 4KQHA 4QOJA 3CX3A 4GG1A 1UJMA 1J8QA 1FFGA 4IOMA 1PFWA 2AT1A 1E3DA 1L1QA 2PG3A 3FCUB 2C8LA 2Q8QA 1G0NA 1H8ED 1BE0A 3F2IA 4Y3UA 1YHZA 1XKXA 4PSUA 2BHTA 3I9V6 3ZI0A 5AW6A 1HL7A 4RCZA 1SIUA 1TVMA 3HABA 5K51A 4AN4A 1E2UA 2Q4EA 5L3SB 3KUUA 4MV3A 1SVSA 3OPYA 4DNPA 4F5EA 2XRZA 3EG9A 4Q9JA 4IUCS 5K8CA 2OHFA 4ZHQB 2WFLA 4OUKX 1EP2B 1Z4IA 1E9DA 2IY9A 5B1SA 5KYWB 3J81A 4NDNE 3U5ZB 5E4FA 1T5HX 3OZAA 4DBVO 5DN6A 2DUUA 4HS9A 2ZRGA 5FUBA 1RC0A 4ZCSA 1E6UA 4EA9A 3IIKA 1Q77A 1UQTA 1C9NA 1ZMTA 3A2LA 1MC4A 3D6FA 3DVRX 2AG6A 1U65A 3G8DA 4K7JA 4EG8A 5L4LA 4EJ6A 3UMJA 2VKQA 1TC2A 1UBTS 2FJ0A 3NYWA 5HE9A 2QJWA 3V97A 2RCNA 5L40A 4G0UA 1DL5A 1MGPA 2X8LA 3CLKA 5F1KA 1T4CB 2RHOA 4MZXA 2DY0A 4CR6A 3HJFA 1FLNA 1OFTA 5J5AA 3OZVA 4O2AB 4YP6A 2OC9A 4GMKA 2Q4BA 3TGPA 3CRQA 1GUFA 2ZS8A 3R6DA 2HO4A 1PJQA 5A71A 4UFPA 4HTFB 4GGPA 4RQAA 3BG5A 3JWGA 5U4XA 5EZ6B 1QKJA 4O5OA 4G3XA 5DHPA 1T5BA 1TE2A 3A70A 1HE8B 4QYSA 4ETMA 4N7MA 2XYHA 1J09A 1ZESA 4TMFA 2P4SA 2YNMC 4Q19A 3ICPA 3K72B 5CB8A 7ADHA 1JJ7A 2OZKA 2B4TO 4W1RA 2I65A 2QD1A 3QKRA 4FHGA 4H77A 4A5SA 4NS1A 3A6PC 2YV4A 4LYGA 4MO9A 1DU4A 1RXEA 4KMSA 2OD9A 3L0IB 4Q24A 4PZEA 3IQWA 3V55A 5A7FA 2WUFA 4LYJA 5IBRA 4B85A 2NZXA 5H3LA 2DBZA 2PH1A 2WVJA 3DEHA 2CLDX 5ALYA 1I36A 1G6OA 1Z4NA 3RFXA 1IVSA 3AH8A 4YAWA 2EFEB 4RACA 3ZX4A 4V24A 1E61A 2ZJYA 3KB2A 3SK0A 5AJUA 3EDOA 4JEHA 3DB2A 2PJDA 3IOBA 3TLGA 1LVUA 2H2DA 3I4LA 4A1OA 2UUCB 1FYDA 1TAHA 5ALQA 1Q7EA 3RK4A 3JVDA 4E08A 1T1SA 4PIPA 4DLWA 2HMAA 3RRBA 1OWNA 3I5YA 3NFYA 5TGTA 1CY2A 4EMUA 1BXGB 3N8GA 3I3SR 4P98A 5DHRA 4ISBA 1JBQA 4BNZA 4UUOA 1CQPA 2OHHA 5EHNA 3OM1A 4BN0A 1XK6A 3V4RA 2XZPA 3D4BA 3MJSA 1QP7A 3CS3A 5AO9A 3T1YB 5CNIA 2JAOA 1N2BA 4Q4HA 2G9VA 3WIOA 1DEAA 1IE3A 4NU6A 5KQRA 2F3UA 3DVQX 4DCVA 3BPSA 5B4UA 2JHPA 2DWCA 2Z9BA 2HHHB 1E3QA 4HDRB 2HA6A 3WR5A 3J80A 4OHCA 3CISA 1W9MA 3ZWWA 3IMKA 3NWOA 4BMPB 3RFVA 5JCXA 2ON6A 3KQPA 4N6OA 5L53A 1SBIA 3I5UA 3IEXA 1TM4E 1WUHS 3MTQA 3W8EA 3IP9A 3EMBA 4URXR 1NW4A 2NSDA 1MRNA 1NZFA 2WR8A 2VSQA 3GFQA 2W2KB 4DVGA 1ESMA 1KKUA 2I5PO 3QWIA 4CWAA 1X8XA 5CXUA 5AW0A 3SC3A 2HSEA 2OP0A 1DZIA 2HIHA 1KK0A 2G80A 4J3JA 1JLKA 4YA6A 3TNLA 2A5DA 2FEXA 3T7DA 3KXDA 1SOAA 5L45A 3U3MA 1CW2B 3VC1A 4R9UC 3NLLA 3HKCA 1DTWB 4EHBA 3RBZA 4OD0A 3KO8A 3H17A 3QFFA 5EZ5A 2WSYB 3R6WA 4NQZA 2WYWA 5ITZB 3DHYA 4Q1DA 2C0QA 4JLOA 4MICA 4L0CA 1KY2A 5JAQA 3D2CA 3Q1LA 4YXFA 2JC3A 1RU3A 4KQWA 2XZTA 2PT7A 3NEPX 2QQ5A 1SCKA 4UVIA 5DGIA 2C2GA 2R11A 3OQBA 2FW1A 1J0XO 1Q19A 2X23A 3KWJA 5CM2Z 5CMLA 5EPEA 1RVDA 1W1WA 2WD7B 3EW7A 2OCBA 3GD7A 4BGDA 3A1UA 4XA8A 4BNMA 4URVR 2CLCX 3OF3A 1NQ5A 4R05A 5AHKA 3VMFA 4ETNA 2AMFA 3PEUA 4W5RA 2OK8A 3VNUA 1ZL0A 2VK4A 1DE0A 3C85A 5A0FA 3T38A 3HCFA 1SKMA 2P9YA 1XRMA 3G9XA 3HN2A 3C43A 1RABA 1G6KA 1BRMA 1ZLYA 3N6VA 1F60A 5CH8A 1NHGA 4QUKA 1GG5A 2WEKA 4M4SA 2Y1WA 4Q12A 4PONA 3ZVMA 1DWQA 2Q9AA 5CT4A 5EJIA 3V4ZA 4K9PA 2YWCA 3UHJA 3MT8A 5FI0B 4CKEB 4MRSA 4DEVA 1U6JA 1ZUIA 3UAOA 2CHQA 5CLLA 3HNRA 5LQNA 1W0JA 4OIFA 2GM5A 5DSXA 5FOSA 4C4OA 1ZEMA 1SU6A 2H1OA 4F97A 2W00A 1KPGA 2Q0SA 3LC7O 4S24A 1Y3CE 3U3XA 3VJMA 4QIHA 3WGKA 4A27A 3VBEA 4AQ7A 3PX7A 2IYYA 1HMYA 1Z47A 2YOHA 5ELXA 3A6DA 4FONA 3DHWC 2O8BB 1T8TA 2Y1OA 3ITKA 2IUEA 4MQEB 2Q5HA 4UNRA 2V7TA 1V95A 2IPAB 1YJQA 2Y77A 3ENQA 2PUAA 1TCBA 5IMBA 1POXA 4R3WA 1E2FA 2ZCVA 3OZIA 2DH6A 2GZ3A 2C31A 2FRXA 4MUYA 1X1CA 3R09A 4MW6A 1WLSA 1B16A 1DQRA 1Y3AA 1XF1A 3HFSA 3KOOA 3QX8A 1Y7IA 4UTZA 1FNDA 4BL5A 4DMCA 1PBTA 3DJFA 4OGGA 4AKEA 4NCXA 1RZRA 1GFIA 3LK6A 1E4EB 4Z2YA 2IYVA 3LOPA 1SC6A 1BDJA 2WD9A 4FD2A 4FI3C 3E15A 3RIYA 1TKCA 1ZIXA 2O0JA 1T91A 2QIPA 4DEYA 3CG0A 3O74A 1MG0A 4R2KA 5CDYA 1ZRMA 2G0NA 3H9JA 4Q39A 2CLHB 1J07A 5CJ2A 2C57A 4V38A 4C0WA 3F67A 4IVRA 1VLMA 1WOMA 1BYIA 3MWEB 3S7ZA 2X8JB 2XD9A 1D6SA 4P32A 5K3FB 1LDBA 2RGRA 3KAQA 2EW2A 4HZIA 2X7XA 4LDAA 3ZBUA 5JNWA 4JJIA 4AWBA 1KYQA 1C3EA 2VT2A 3DZJA 3ITDA 3TD6A 3I61A 4J6EA 2HXSA 5BQFA 1AO0A 1T6YA 3BWMA 5KNDA 3O83A 2ZJ6A 3Q0EA 2QUHA 1SVMA 2ZE6A 4RC9A 4EKDA 1PSWA 1GXSA 1NW8A 3RAPR 4ZFNA 1QGYA 5AVUA 4QPDA 1QE0A 1WBBA 1NR1A 2XWQA 4K3VA 4I3FA 3T3IA 2Y0DA 5A4AA 4YI3A 4FCWA 4CMHA 1AB5A 2YOGA 4QBTA 2P2LA 4DSAA 1NXPA 3C45A 3EXAA 3LCJA 4M1YA 1JHXA 3K70B 2XDQA 1F12A 1L4KA 4ZMBA 3ZHTA 3PRHA 3RVRA 3WLAA 1AKMA 1VIMA 3B2NA 3AY7A 3I9LA 5JS2A 3WB1A 4G0XA 4PGAA 4ZHSA 3BT7A 4R8KA 4F2PA 1RWQA 5K03A 1N2SA 2IZ7A 1GQOA 2PGAA 3QWFA 1L8QA 2GPTA 1GEGA 2N0SA 3B6IA 4XEHA 4XRRA 3CYFA 4DDVA 2OFWA 1NVVR 1RS0A 4FR2A 3NWJA 5AKIA 2B1GA 1BO6A 1JQ5A 2Y9MB 3CTMA 1XZQA 4FQ5A 4JOBA 5FR2A 3V33A 5HOEA 4KK3A 4WA7A 5B2FA 2RCYA 3P0RA 2HZBA 1KI3A 1WVIA 3CPHA 3OJWA 2ZAIA 2VZLA 3GEHA 4IHQA 1IPEA 3EAFA 3CUYA 1AZSC 3ZC3A 2FFRA 5AIAA 1USVA 1JQLB 1H2WA 1UBHS 5CT8A 3BM5A 4D3YA 2Z95A 2EKBA 4C6TA 3A4YA 1RAFA 2J6BA 3WP1B 1SCAA 4D3FA 5L3QB 4QUJA 4AY4A 5KYYB 4LYYA 2V0NA 3BSSA 4H1UA 2WV9A 3D2AA 5C32A 4Q1AA 2NSYA 2R0QC 2B0JA 1Y63A 1JHMA 5CM8B 1G20E 4H16A 1XLTA 1ZUNB 1F2UA 1Y3DE 4M9UA 5IT9A 2HA0A 4RZSA 2Q9CA 4Z9YA 2V97A 3VFDA 4D9HA 1CY0A 3IP6A 4D9FA 5KAMA 3BIWA 3QELA 4HWGA 2MIIA 3P27A 1P0FA 3ENKA 5ALDA 3DG9A 4KUHA 3S2YA 3WFJA 4AKSA 2O5EA 5CNMA 4K9KA 3VUEA 2GZDA 2Q0HA 2V0CA 1O0CA 1WPRA 1ESNA 4HFRA 5FA5A 3KELA 2FZEA 3OU2A 3B78A 3K8QA 4MYTA 5COAA 4DQVA 3L01A 1I14A 3HI6A 5C4GB 1U11A 4U4AA 3PXCX 3EVBA 3WRYA 1BHO1 4EATA 2O2IA 1WG8A 2C42A 2KB0A 1PL8A 3A25A 3P7MA 2N47A 4G4GA 3NVMB 5EQTA 2GXAA 1O5TA 3FJOA 2I6QA 2C5HA 2O2EA 4FI3F 4M49A 2OV2A 3M6LA 4XRGA 1T2UA 3RQSA 2YH2A 2J3LA 4MS4B 1NAIA 2GZSA 4Y2TA 3MNFA 5KYNA 1U6KA 5LKRA 4RTSA 1KEWA 3HY3A 4DV2B 4N48A 3MTGA 3D3JA 2IH4A 2C8KA 1JILA 3LQYA 3G9QA 1SIOA 5A4MS 1I1OA 3HXTA 1EDEA 4R8LA 1B2LA 1RZVA 5F4BA 3QY9A 3URKA 1YDGA 2Q8PA 4TYNA 5CG2A 2GBPA 2XJ4A 3SF8A 1VE7A 3G2HA 3NQ41 3HCWA 1V6AA 2R1TB 1AA9A 1MABB 3V80A 4FOOA 4K3UA 3ZCRA 3KQHA 3LA6A 3PXEA 3FYUB 1YKGA 1HNZB 1W35A 1JKMA 3AR5A 4Q4CA 4R16A 3OCCA 4RORA 3CM0A 3WFIA 1JR3D 5GJCA 1YOVA 2HK8A 1C5KA 3J7TA 1AQYA 2H1FA 1DADA 3DCNA 2H3HA 4RNCA 1YQDA 3FMIA 3WLOA 5IFKA 3DE1X 2GCIA 4MR7B 2QNBA 3S27A 2BHRA 4HC4A 1SN7A 1Z36A 1KIFA 1QZXA 1DAEA 2UV8A 3ASZA 4RV5A 1L5HA 2WSBA 4HQKA 2XSZA 3VR6A 3ZCTA 5L6LB 4KFCA 2EAUA 1VL1A 1YRWA 3FYTA 3KQMA 4L4SA 3E5MA 3UXYA 1RIIA 2VYVD 3ZDCA 4QEZA 4JKYA 1QAQA 3NONA 2FPIB 4O4JF 1GTL1 1KO1A 3B1JA 4L4UA 2O54A 2NZVG 3AUXA 4JXJA 1KERA 3K94A 3O9ZA 4AYTA 1CDZA 3PEFA 3ZIUA 3E03A 3T5BA 2G06A 3UAWA 2G25A 1IJKA 3WKDA 2YVUA 4RY8A 4YDSA 1KORA 3OMXA 3BIXA 3CKMA 4FNAA 3DTTA 3GUCA 2HGSA 4R84A 2BFBB 2OQVA 3D6JA 3S3TA 1SCIA 2H7CA 2BEWA 3ADPA 4JX9A 4ZRNA 2FKNA 2YMQA 1TYDE 4HBGA 5IANA 2EKPA 1SXJD 3PQ8A 1BVHA 1HZZC 3K5PA 1Y5IA 1WQ1R 4C76A 1MENA 1US8A 2K7ZA 5CLJA 9MHTA 2EIXA 2WZQA 1T29A 1X1RA 1G5FA 2J3EA 3LUJA 3LHSA 3MGGA 1O77A 3N8NA 4BUJA 2QMYA 3LM8A 1N33B 4DB4A 3AY6A 1TJ5A 2WZBA 1M2OA 4ER7A 1ZMXA 1K8XB 4EG5A 2XUOA 5IKMA 3ONNA 1CE8A 1P74A 4OB8A 4TWJA 1BC5A 5M3BA 4CVNA 4X92A 2YMPA 5A5EA 3D6TB 4UZSA 3DR3A 3K20A 1XTBA 2IDJA 3U4DA 2PL1A 5EQFA 4Q3LA 3UK7A 4KVFA 1EQUA 4OHRA 1R6AA 1D6MA 1UEIA 2H06A 3SR0A 3PGXA 1VBNA 2B7CA 4FOLA 2QPTA 3RC2A 5BYAA 4ID9A 2EG9A 4BVKA 3H5TA 4TT3A 1ONOA 2VJYA 4ZVPA 4B6EA 4CCAA 1NP7A 1E2BA 1S89A 4NBTA 3R7WA 5E0OA 4MI6A 1X42A 1MO5A 5ILQA 2RKOA 5KJ1A 1EIWA 4JITA 4W5TA 3LX6A 2EKQA 2ZSKA 4KE7A 1UBFA 3UPDA 2VWPA 4ZZ2A 3LNCA 5KOYA 1OASA 2CSXA 1K1EA 2A5JA 4B83A 1K3UB 5K4AA 4H2DA 1FX0A 3Q0TA 3VR4H 1JLLA 2I66A 3BMQA 2JZOA 2R5WA 4LZAA 4OQZA 3GAFA 4X62B 1UPUA 1U7PA 1VJGA 3GT3A 2OHVA 3HCEA 2J0UA 2Y1KA 4FN4A 1M8KA 1QH9A 4K2HA 4ZVQA 3SS8A 5D5HA 4EZIA 1KO5A 1TW3A 1Z6PA 3B53X 4IG9A 3CGGA 3QELB 1H22A 1KI4A 3M81A 4IMPA 4GI2A 4ALMA 3QVKA 4UBNA 2J41A 3TG8A 5BN3A 1W44A 2ZB2A 3HN6A 3DFFA 4G24A 3RR2A 3LCVB 1PNRA 3LLMA 2RH8A 2XB8A 1EM8A 1YDWA 1JKJB 2J4FA 1IY8A 3ESXA 3LSTA 5EZYB 2YN4A 5B3JA 4BGIA 2MSNA 1T3SA 5FPSA 4EX6A 3CVXA 3WOHA 3JD1A 5F77A 3G1UA 2I2XB 3MJRA 4PSCA 1KYWA 3WX0A 1C14A 2W2LD 2NTYC 1IHXA 3HZOA 1FTQA 1A76A 1X9IA 3WADA 4OB6A 3JYOA 3Q6MA 1V26A 1CY1A 1PFGA 3RCBA 3ZDRA 3TECE 1O94D 3KD3A 3EIEA 4C07A 2GEUA 4URUR 5T4BA 1VKJA 5CFPA 3QX7A 3PFBA 5ICFA 4RD1A 2Y27A 4CN9A 1E7WA 1ORHA 2CHGA 3JXEA 2F00A 1T0PA 2AX3A 5E6SA 4ZOCA 2P0EA 4LECA 5EVCA 2YC2C 1FW8A 2RGCA 3R3XA 4YMTA 1JFFA 3BYZA 3NO4A 1I5RA 4IUDS 1I2BA 1KWKA 1EFDN 2V6IA 4AJLA 5EEHA 3VPGA 4PFSA 3PL1A 3ZEIA 5BSEA 2J0QA 3KCQA 2CXOA 1Y8QA 1WDKA 1VYVA 1ODKA 2LKDA 2RG1A 2ZXFA 2XITA 1VE1A 3OZCA 4O25A 3TXXA 1MIOB 5JJBA 5EKDA 4KN6A 1EK5A 4IIJB 4L6AA 1WUYA 2CL7X 2NO0A 2O2XA 4I50A 4IDGA 3BDAA 1F2TA 5HFNA 3T7SA 1WW3A 4P4NA 3KJZA 3SEFA 4NBRA 2H1RA 1KO4A 1IQUA 2QE6A 2W6MA 3EXHA 1J4AA 3IOCA 2BMEA 3PCXA 4D3SA 1YI1A 1C8LA 5KWJA 1E0AA 2OR3A 4P0PB 2O52A 4E5PA 4J76A 3E4DA 3GIWA 2IHBA 2DH5A 2QYTA 1FP2A 1VFPA 3E7DA 1JU3A 1USKA 1JMVA 1OYOA 2XTNA 3LXRA 2XOKA 5LP6A 4FJ0A 3ZNOA 3FHLA 3TUZC 1Z62A 3F9RA 3MJCA 1P4AA 1WBJB 3LP8A 1RBQA 1MOZA 2J8ZA 1L5OA 2B34A 3BGDA 3ANTA 1GHTA 4NU0A 2B6NA 1Y7PA 3VSAA 3EQZA 3KDPA 2H7YA 3RIHA 3ZG6A 3OT4A 4KDCA 1EP9A 3BRWA 4DMUB 1DG9A 3A1FA 4BP1A 3IUYA 3KR9A 1SQFA 3B1ZA 2VDWB 1A96A 1TA9A 2JKYA 1CQIB 4UEJA 2VPZA 4IHJA 3LV8A 2GSWA 1U3VA 3MWYW 1RHUA 3GGPA 2ZIXA 4BDTA 1W36C 3BGWA 4N65A 4F2DA 4JUDX 4Q4DA 3EX7C 1AN9A 1XRSB 2QAGC 4BECA 1SD5A 4RLSA 3DJYA 3M2PA 4UCQA 3CXUA 3ZCUA 1WMEA 4OXNA 4JP2A 5C1IA 5DNEA 5FBHA 3EJWA 3U3KA 2DKOA 1AXRA 4JMLA 3A6FA 1GU0A 2R7AA 4Q9HA 3IPCA 1RKQA 1XR3A 4CQLB 2HRQA 1L7DA 2W90A 5HIJA 3KQNA 2DSTA 4HFMA 2Z2YA 1TFUA 2PKQO 4R2MA 3WBKA 1KJWA 1VGRA 2LR0A 3A1DA 3QU2A 2YR0A 3RK1A 3W6PA 2PUHA 4ZV4A 2FRVA 2O23A 2QRMA 3JALA 4I36A 3ZJ4A 3VNQA 2J5XA 1L5QA 2IP2A 3CZRA 1V5WA 3QPDA 4M83A 5LBUA 4LXYA 2JZCA 2WE7A 3L4EA 3LKZA 4H35A 1PD0A 4UAVA 5G4KB 3DC7A 3ZJVA 1AKWA 2V45A 5F76A 1Q0UA 3EMVA 4Q7LA 5LXTF 5IH3A 3BQ9A 4I7EA 4P4TA 1QIGA 1Z2OX 4B34A 1WNFA 2UZAA 4E07A 1U7TA 3CF4G 5JS7A 2JI7A 3DQPA 3D8UA 4GVXA 2DETA 2P3OA 4BFZA 3UVEA 3V7NA 2PE5A 5EL0A 1WS6A 4YXWA 3PE3A 3ZD8A 3UW3A 3ZE7A 5G0TA 4IEEA 1L8AA 2PSJA 3WB9A 4S1VA 2XTZA 4ZD6A 3UCEA 3DZGA 1QYCA 1NA5A 2L17A 2VAWA 3LQ1A 5ALIA 3RVBA 3HL0A 3SPXA 3WGVA 3AEUA 3QXSA 2C2HA 1ISJA 3ZWYA 1CNEA 4YT8A 4M8IA 2P4EA 1O58A 3EGEA 1D9XA 5HJEA 1VYHA 3GQBA 4JI3B 2H29A 3N1UA 1Y7HA 3VJLA 4A0SA 1GQSA 1A7UA 4FXPA 3JRWA 4FKMA 1QB8A 4CN8A 1P45A 1UPXA 5KTNA 4DE5A 2ZFUA 3O92A 5IMSA 1U0TA 4F4IA 1EE1A 2R00A 3B1KA 1Z4PX 3CNLA 4XQGA 3ZCPA 4UTRA 1U4SA 5ALXA 3X1KA 4NDZA 4JB2A 3BIOA 5DHFA 3EQ2A 5E7IA 4PV7A 2E89A 2ENWA 3EA5A 3ND7A 5CHYA 3ROTA 2IXEA 3FIUA 3ROZA 1WKBA 3LP5A 3T99A 3U48A 5JCJD 3O93A 1P9WA 3OLXA 2P0AA 1II8B 1RMTA 1UBUS 4M89A 1WVMA 2BVNA 1NMYA 1QLWA 3EUEA 2GGSA 3HJRA 5LB4A 3WXMA 5JBQA 1W76A 3JARB 4PM4A 3D6UA 2TMKA 5DF1A 3VYVA 4ZT3A 2OLEA 3QSGA 1HDYA 2LIVA 2P90A 5GQSA 1UBKS 4P86A 1T6ZA 3MT9A 3DQQA 2JL1A 3NXSA 4FWBA 4AJEA 5CVUA 1KEEA 1ZKMA 4FU0A 5KNBH 1KZ1A 2JFPA 3KFLA 5JS8A 1RZRD 2G6BA 5KNCH 4A36A 4DZRA 3PFNA 3Q7SA 4MYSA 5HWSA 1AKRA 4MVJE 4JR0A 5SZJA 5IUNC 2V03A 1EFVB 4MEJA 2Q45A 5FNVB 1LQTA 5CT5A 1A9RA 1PDVA 4XJTA 2ZTSA 2Z8YA 1K4MA 3VH1A 3BFXA 2I78A 3UW1A 4B33A 1JALA 2NU9A 2VJNA 4EGFA 5DK4A 2X8WA 5H0IA 3F7NA 1YSCA 5BV0A 2AN4A 3BA6A 1DTSA 2RB4A 3BZUA 3HKEA 1XLUA 3AKDA 3O8BA 3VQTA 1JEQA 1OAAA 1W0JD 2VI5A 4ZO6A 2GZ1A 4DVJA 3CIFA 3PFCA 2FWIA 3AEZA 3OLQA 3LPAA 2Q3BA 4RHEA 1IUKA 1HUQA 5AOVA 1R2QA 5CLGA 1CFJA 4RWEA 5JI2E 1W46A 2I6UA 1A1VA 2RHWA 4KQJA 3GRZA 4OJNA 1G2PA 1OBCA 4XM1A 4ZI7A 2W11A 4DDUA 1TZ2A 2IYSA 2YWJA 1L4GA 3CJQA 3RVJA 4HDMB 1P2TA 4HN4B 4REQA 3KAJA 3QMMA 1UBMS 4FE3A 4GOLD 3ONVA 2HRZA 5LDGA 1EVZA 4GM1A 4MUKA 4DC0A 4J7AA 2D5BA 3N28A 2A92A 1IB0A 5TE9A 4J0QA 3HVUA 5LUBA 2ZSFA 2CWDA 3KK0A 3PRYA 1FNSA 1IUOA 3UXEA 4K1XA 4OM7A 5HX7A 3GGDA 3TPFA 5KTSA 1YRAA 3GPIA 3LPLA 2JGEA 5FUMA 1Q92A 3JATB 4GNRA 1WXIA 3H5RA 3H6GA 1TQ8A 4OVKA 3HVKA 3PX2A 10MHA 3GJ5A 5K3EA 3QI2A 4R40A 1FNBA 4DRYA 4RTJA 3R0ZA 2VHZA 5AVWA 2DWQA 2O8DA 2OBMA 3AIKA 5IP5A 4YS6A 4TMZA 2CJYA 4PN3A 3VH2A 1GYPA 2P2SA 1JV2B 2QD2A 3NIBA 4JB3A 4G01B 4CE6A 3DTVB 4N5MA 4BC0A 2J3JA 3GEGA 2Y1LA 4LRWA 1J0CA 4OI2A 1BHQ1 1OGIA 1PEDA 1W4RA 1HBJA 2WSSD 3IIIA 3NH6A 4HP8A 2WTEA 4KBFA 2X9VA 2ZGVA 1J0BA 3T35A 1XLTC 3HSSA 3I6QA 3TSCA 2R87A 4BRSA 5LOVF 3CB4A 1SOVA 1XRPA 5E9JA 3SM9A 3O26A 2IOHA 4MGKR 5A0TA 5D5PA 2ZIUB 3DZFA 3ILXA 5I7OA 3ELYA 4UCFA 3N2KA 3N53A 5DI3A 2GAJA 4AZTA 1NVXQ 4Q1VA 3WICA 1EWYA 5IUJC 3FSJX 3UJCA 4U5XA 4EF5A 4EUFA 2WTUA 3KT0A 3E9NA 1ISHA 3HDGA 4N8SA 2OLKA 1U98A 2CV1A 1CYDA 3S55A 2RHBA 3G13A 1IJFA 3THWB 1KTIA 3ZDXB 1EX9A 3AI7A 4ITRC 2BW0A 3DUWA 1XHFA 1GNVA 2WHXA 2EBUA 1B6RA 1Q1NA 4V1CB 3TVDA 2N1MA 4ZVUA 4DC9A 1N1EA 2WU4A 3CLHA 1MC8A 1OLSB 2FWAA 2JAXA 3F1LA 1WP9A 2I8LA 4LV6A 1UK9A 3GLHE 4IOKA 1AY0A 4LX8A 4YVFA 4RAOA 1PT7A 4HYEA 3V4VB 4CLEA 3U16A 3Q5EA 1C7IA 1KAQA 4FCVA 3W04A 2WAYA 1XIVA 1C3VA 2FZKA 3FSEA 3L1IA 4U2KA 4W5WA 3CFYA 2YYZA 3BH6A 2GLTA 3CY6A 821PA 1YS4A 4CM3A 2DFDA 2QTWB 3AEQB 3CMMA 2IJGX 1AS0A 3CH4B 4M1WA 1ZH0A 3WVNA 3P96A 4HXYA 1O9GA 1MXFA 2CY0A 3RYIB 3S2EA 2FTKE 2F3QA 2R1VB 3ZDZB 1TPZA 5HOQA 2LPMA 2PNFA 1Q0QA 1XJQA 3W5IA 2GNOA 5DWDA 1DBSA 1PBNA 5CB4B 1HYBA 2NZJA 2WHEA 2IUSA 3BWDD 4C30A 3FFXA 3C5VA 4H31A 3Q88A 2B5WA 1GN9A 2QXYA 5GY7A 4JJ6A 5C7IO 4GMGA 3TG2A 2WKPA 4DNOA 3UUEA 1RAHA 2HQOA 1VTKA 2QLBA 4RVCA 3ZHXA 4CHTA 5JARA 1WBDA 2VDUE 4DRXB 2YINC 3Q9SA 3MSXA 1OZFA 1HM5A 4LXIA 1Y8ZA 3U26A 3CLSD 5CG1A 4EVRA 2PS1A 3ESYA 2NXJA 3A6KA 2D2XA 2QMUA 3DV0B 3NHPA 3DE3X 1W5BA 2ZVPX 1V45E 3EBPA 3AFOA 4J1NA 4IDBA 4AL4A 4M86A 4RHYA 3AVXA 3L7JA 4LCEA 4XWOA 2VATA 2O8EA 1SCJA 2D5IA 4R69A 3NOXA 4PTYA 4WD3A 5DHAA 5IN5A 4B3DA 2FX2A 3TZQA 3GFTA 3T8YA 2E21A 5EMKA 1DZ3A 2WSMA 4OBBA 1OIWA 2BKLA 2I4OA 1HXHA 3VYTB 1RLJA 2ODWA 2OG2A 2WJ3A 4R01A 3BK2A 5BQXA 2HBRA 1JHUA 5BW4A 2QV0A 1PNTA 1TTPB 3ES9A 3NHYA 3GJ7A 1EAMA 3DB1A 2VNHA 4WBNB 1QBGA 3T7CA 2QW0X 3VC7A 3C3MA 2P9EA 3N39C 5CTAA 3JVIA 4MP3A 3RRYA 4A9AA 4B35A 1R0XA 3HVIA 4D3DA 5CBPB 4P3XA 1WV0A 1G8AA 2RHCA 3TZHA 3B6ZA 2WKRA 3LW7A 5DYWA 1T36A 5IC6A 2CXRA 5CAEA 4JP5A 1FDUA 2EFJA 4YRMA 2NZYA 1BKDR 3O95A 4MLPA 1L7RA 2Q41A 4TQGA 1OBFO 1CUGA 3U7HB 2AG8A 3HE3A 1ESZA 4DWWA 1KOFA 3V34A 1Y0BA 4UNSA 1DX9A 2IP4A 3MHTA 4FWIB 1E58A 1M34B 1NVKA 3C6KA 4OJYA 1XPUA 4JI8B 1ZGHA 2FUKA 3E1SA 4BP3A 1UKAA 3N2GB 3QNUA 3S8EA 4RTRA 4EJ2A 4LFBB 2HA5A 2PUEA 4F3KA 5IBCA 2JFVA 3ZN2A 3X43A 3KYDB 3NHJA 3FTEA 5FTJA 5KINB 1DHTA 1FBNA 1WPGA 3A31A 3FB4A 3P32A 4TOIA 4ZOLA 2XOKD 4X1YB 7MHTA 5IBQA 3T94A 4DCUA 3E8MA 1GCGA 1UBRS 2BFNA 3AF1A 3HPQA 4GW3A 4X64B 1GIAA 5KAPA 2ZB8A 3VKWA 3GGOA 4RM3A 4MDFA 4LAFA 8MHTA 1BU5A 2ZDQA 1Z2PX 3KVNA 3LQRA 5H7XA 4IEFB 3ZHOA 4FGZA 3H42B 4L8LA 4CIDA 2WF5A 2QD5A 4OGLA 1FYFA 2XVXA 2ZT5A 3G8BA 1C1XA 1E8NA 2QTZA 3D7RA 4H4DA 4BX2A 5A03A 1ZBDA 5K6RA 1VE3A 4BLSA 5ESXA 4LNUA 3VSDA 4BWVA 1VIAA 3NFRA 2H8GA 4G8BA 3QUBA 1VSQA 3DUFA 3RVPA 1XTIA 4M0MA 1JQAA 4LSWA 3VTZA 5K0JA 2NTJA 4P33A 2ZTMA 3WZMA 4F96A 3UG6A 1JQBA 1V43A 4LNAA 5EE9A 4MS3B 2JFNA 2OP1A 3MAGA 4CIVA 5G0UA 1ISSA 1SVIA 3GLSA 4HMPA 4V03A 4PZLA 1F8UA 1ULAA 4WI1A 3RC8A 3KVOA 3IPXA 4CEHA 1KEKA 4ZI2A 2BKVA 2M6LA 2ARKA 4DQKA 5J4YA 3PFWO 3IT1A 1AS2A 4FOTA 2R68A 4YUXA 2P67A 3HYNA 3UMYA 1M83A 2YWHA 3H5VA 2XE7A 4RMJA 2BEUB 2WAOA 2XUPA 4AYWA 1W36B 5EPOA 1P7CA 1Z7YA 4WZAE 4YMWA 3PC4A 3NT4A 3DZDA 1QLHA 3DMYA 4I8DA 4X65B 4COKA 1NHWA 3QJGA 4WN3A 4FLFA 1JDUA 1VJ5A 1Z0AA 2CDBA 4ZVVA 1RE0A 1KQ3A 5IDWA 4DLUA 1L4FA 2Q6IA 2BC9A 4C0BA 2GDZA 1AK1A 2PGOA 3ICEA 2C77A 5I01A 2TSYB 4E1BA 1G7RA 3DEJA 5D87A 2LTAA 3R5XA 3RYIA 3MOIA 3REQB 5AK3A 2P91A 4GC5A 1CJTC 4J94A 5LFAA 4RE6A 5JI3E 5CVTA 4ZK2A 1N5RA 3QXCA 2RHTA 2P11A 2YIMA 4EG1A 3EXHC 2BGJA 2X7HA 3Q12A 1WB5A 2GM3A 4UJ3A 3KJQA 3MMNA 2PX0A 4NCKA 4W5HA 5ICMA 1X7ZA 3LDHA 1QOZA 4RJKA 1P5RA 3CRW1 2VJBA 2W4MA 2Z6AA 1Z5PA 1K6MA 2PZFA 3RHZA 1YVEI 4IQ0A 3O03A 4ALNA 3HGTA 3CKLA 3A0UA 2WILA 2XH8A 4D99A 2OXCA 4HUTA 1WZUA 5CURA 2X19A 3NDPA 3GA0A 4GZMA 2I4RA 2JRCA 2JGNA 4M21A 4D4GA 3FNIA 3JQFC 4QM7A 4ZIRB 4QGGA 4AXXA 3R7BA 2GXSA 1DLJA 1E9VA 2VF7A 3N2EA 4PZZA 1RCFA 4UEWA 3SXPA 3OEHA 3WJ7A 4A8HA 3HKDB 1NRWA 5AOBA 2P40A 4XYLA 4ENTA 4JC0A 2I6XA 3L7IA 5DULA 1CFZA 3U7EB 5THKA 2CUKA 2ZXUA 1MO2A 3D3WA 2B9EA 5ALGA 1XMXA 1UOQA 3UQZA 3HC7A 2X9QA 4UU8A 4EQZA 4PTZA 1BOOA 1J97A 2WHPB 1E8DA 4LHXA 3WO0A 5C52B 3TOCA 3V1TC 3WNBA 1IHUA 1SUDA 4HNAA 4L85A 3OKFA 4WCDA 4MR9A 3LGAA 2ISCA 2P7HA 5CAEB 1EBBA 4GGOA 2EBWA 2GN9A 2HDHA 3MCUA 2FWRA 3ZIAA 1YUBA 3NM6B 5E4JA 5FORA 3IQEA 3SNHA 4OLHA 4RS3A 3O84A 3LKDA 4C5CA 2Q49A 2RONA 1C50A 3VU8A 3A1WA 3IP8A 4ZEXA 3GFGA 1J22A 4LJ8A 1UPTA 1YA8A 5JSZB 3MTIA 3D1LA 2YY6A 3QYAA 3H2IA 5EKSA 3T7AA 3QV2A 1FUUA 3OE5A 3OEYA 4U6NA 4JI0B 3G02A 4US1R 4ZOBA 2LRHA 2GWHA 4X1YA 3Q3HA 4G1FA 3D3EA 5FPPA 2XLBA 4CJXA 4FUQA 1K5HA 3RKSA 4RZIA 3SS9X 2I6FA 4OH7A 5F2EA 4RDIA 3GFSA 3EULA 3BN3A 3Q40A 4E1AA 2YZMA 2C2XA 2FN9A 3MAJA 2KW5A 4IBOA 3EG9B 4LTMA 3RJ9A 3EC1A 3FCOA 3TTXA 1N3LA 2N1BA 4H7DA 4NPAA 3TH5A 4ZHQA 4HJRA 5MN4A 2NUBA 3H2KA 4LE1A 1QH1B 3ST7A 1GGMA 1Q14A 2X5XA 1F7UA 2Q5LA 4AP5A 1NYRA 1KSJA 2O8NA 3GLFB 3ZIDA 4O2BB 4KP7A 3CMCO 1LJLA 1UDAA 3HUFA 3R77A 1BGVA 4N4AA 4RZHA 2XDYA 5TSDA 1V41E 4ZO7A 2C4MA 1FL9A 1A82A 1H4VB 3PNSA 1AC5A 1XNHA 2OD7A 4GFDA 5B1IA 3LQ4A 1XSEA 1TTQB 4YMVA 2BGUA 1M1Z