3L40A

Crystal structure of s. pombe brc1 brct5-brct6 domains
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
TNAKASKRVYITFTGYDKKPSIDNLKKLDMSITSNPSKCTHLIAPRILRTSKFLCSIPYGPCVVTMDWINSCLKTHEIVDEEPYLLNDPEKELELGCTLESALKRARAQGPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKRLARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTIFLQNYDWLIKTVLRQEIDVNDRIADEFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords BRCT-containing protein 1
publication title gammaH2A binds Brc1 to maintain genome integrity during S-phase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 72
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l40A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l40A02
1KZYC 2COUA 2LE0A 2XNKA 4BU0A 3SZMA 3K0HA 3PC8C 2E2WA 3PA6A 3PD7A 3I0MA 4N40A 1JNXX 3PXEA 3QVGA 2M2IA 3QVGB 2AZMA 2WT8A 3FA2A 2DUNA 3K0KA 3K16A 1CDZA 2ADOA 1WF6A 3EF0A 1IMOA 2VXCA 1Y98A 2XNHA 3PC7A 3K15A 3L40A 3PC6A 1T15A 3T7KA 1Z56C 3PC8A 4BMCA 3L41A 1L0BA 1L7BA 5ECGC 2COKA 3L46A 3OLCX 2EBWA 3U3ZA 4BU1A 2R1ZA 1OQAA 3T1NA 2COEA 2ETXA 2NTEA 3JVEA 2HTFA 4OFBA 2JW5A 1GZHB 3AL2A 3PXCX 4XQ0A 4Y2GA 2K7FA 3SHVA 3I0NA 1IN1A 1T2VA 3SHTA 3HUFA 2EBUA 3AL3A 2INGX 3T7JA 4XPZA 4JLUA 1T29A 3K05A 3SQDA 2L42A 3HUEA 3II6X 1N5OX 4IFIA 3T7IA 2EP8A 2K6GA 3PXAA 4Y18A 4IGKA 1T2UA 3PXBA 4ID3A 3UENA 4BMDA 2VXBA 3PXDA 3EF1A 3UEOA 4U4AA 3COJA 2D8MA 3KTFA
chains in the Genus database with same CATH superfamily
5HMLA 1AH2A 2G09A 3CT6A 3KZMA 1JTVA 5D01A 1Q1NA 3IAM1 3KYCA 5ALXA 5GINE 1T0HB 2GCGA 1OLSB 1ZOSA 4Q9KA 5AHXA 2EX4A 2JEYA 4YDRA 3JQGB 3UKOA 4MO2A 2G6TA 4AMVA 3A6LA 2AZXA 3KE8A 1VRCA 3A1WA 4R84A 3KBOA 4Z7OB 3VI4B 2HDWA 4DLBA 2JJQA 2QYOA 4ZCTA 4AKSA 1HURA 3NHAA 1D5WA 5ENDA 1WXDA 4BX2A 4DMGA 1DKRA 2D7DA 4EW2A 3D4NA 4AJKA 4QPDA 1VLZA 1KWGA 2VOJA 3NJ8A 5C32A 4FE4A 4YWJA 3QEMB 2ZPUA 3UJDA 1UF9A 1XTKA 3RANA 4FLMA 3CLRD 2QTLA 3STUA 1V41E 3I01M 4JP8A 2AQ8A 2YVUA 1J70A 1UMDA 2ARKA 2BSQA 1W4AA 3W5SA 4C7MA 3ZCPA 1WF6A 1GGFA 1B1AA 2REQB 9GPBA 1NQXA 1VSVA 4UU0A 4RFSB 3EZNA 5EP2A 1E2GA 2GAAA 2LCQA 3B52X 1JQKA 1MR3F 4M7PA 5CDTA 5JNLA 1VPWA 4LISA 2CXSA 2GZ1A 2BP7A 2BJWA 1G8PA 1CQPA 2VSNA 4KQHA 4GI1A 5CXSA 5E4YA 4WZAB 4E2WA 3VU9A 3CNHA 4K46A 4TXLA 3WV4A 4B8WA 5JJ5A 2E4ZA 4DLYA 3EDRA 2P68A 2BBSA 2OV6A 3RBZA 1X9IA 2QTZA 1T5TA 1V8DA 5HRUA 1PYDA 3IOBA 4BMCA 2WKQA 3INYA 4JQOA 1T8WA 5E95A 2A1TR 3OMWA 1VMKA 3FMVA 4AL4A 3UJ8A 3CNBA 3LWDA 4CLRA 3UBTA 1KFEB 1JFFA 4OYHA 5F1YA 2OHFA 3NX4A 5LQSA 5C8ZA 1J9EA 4F6RB 2HU2A 3AIKA 4HGRA 4I5EA 5B53A 1QYIA 5DCLA 1JI0A 1GG8A 3VSEA 2XIQA 4AG3A 2QSJA 1T6XA 4ZT3A 3ZQUA 3JASA 3FYTA 4Q4JA 2H6EA 1PZMA 2X0KA 1OX6A 3HU1A 3ED1A 3L6CA 2LIVA 5JLAA 4O4LF 1RHJA 1XN4A 3VU0A 2X77A 4X1IA 3AJ9A 1NV8A 1SPXA 1G5IA 1O4WA 3HXKA 1JDVA 1OYVA 1Z4QA 3IMGA 3IVMA 2RHBA 3NTVA 4Z51A 1C9JA 2GZMA 4NY1A 2BZ0A 3U16A 1N7IA 1UT5A 2RG1A 2GPJA 1Q7BA 5EE5B 1A8IA 2FP4A 4RA9A 1JSXA 4RTLA 2PGIA 2B83A 3B6KA 1O9HA 2EP7A 2QI9F 2X19A 1W30A 4PX9A 3NUQA 4TV9A 4BBJA 4D6XA 1OFIA 3L7DA 4UUMA 4NARA 1FNNA 1H4TA 3URMA 3MINA 1ZGHA 1AF4A 1YB1A 2B8TA 2BEVB 3MTAA 4J0QA 4LQCA 3BHNA 4TZ0A 1DJPA 1IE3A 5F7OA 3GDGA 2WWIA 4H0NA 3KWFA 4K3VA 3DVQX 3WGTA 4E6PA 3MB5A 5BPHA 5KBYA 1QYCA 1ATIA 2OHGA 3CG0A 2MJLA 3JQFC 1P2BA 5DK4A 2ZEJA 2GD2A 2R00A 2CK3D 3EDCA 1G6KA 1USVA 2FSIA 4PC2A 3U7IA 4K0RA 4M1OA 5TXGA 1VSBA 4ENPA 4EA6A 2PWZA 4UNQA 1K08A 3GRCA 3F8TA 2DQKA 1T9GS 1R4AA 2G28A 3H9GA 3NVMB 4IKOA 1USKA 5KNBH 1CZUA 3LGXA 3V48A 3VR2D 3EJ6A 1H5QA 2FN9A 4BX0A 2FFBA 5E1OA 1JRLA 1Z28A 2J1LA 2OCIA 2FZGA 3ISJA 4U6NA 5FLYA 4B6PA 6Q21A 3JYLA 4JB3A 1UC8A 3MPUA 1XKLA 2P3OA 3CY6A 4J0GA 3AESA 1DELA 1E3QA 2O8VA 3H1AA 4DYHA 3MT0A 2AUMA 2PX0A 2O3RA 4P2BA 4DM7A 3LOQA 1WBBA 3WDLA 1KE1A 4WHMA 2IW3A 4YJ3A 5TJ9A 2V7VA 3VYRB 2CXTA 2H7XA 4HDSA 3P9KA 4L15A 3ZCQA 4HBGA 2A9KA 4ZZ2A 2JCBA 2Y27A 4JLOA 4M0KA 1X8KA 2OG1A 1LPOA 3A1SA 2HY7A 2QG6A 1QV9A 2X58A 2V96A 4M55A 4DGQA 1TGYA 5K8TA 4D4GA 1NBME 2OYCA 4BB5A 4D42A 2EIHA 2D54A 4NNJA 3Q87B 1NI4B 4KDFA 1E69A 1S0UA 2Q3EA 4PW0A 4R5MA 4CTKA 4EHIA 4URXR 3PDHA 4TPKA 4BNYA 2O8CA 3L8EA 1NT2A 2VBIA 4CVNA 5BV8A 5JAZA 1SXQA 4PIVA 1CP3A 4V2UA 3MTJA 3M9XA 4CM4A 1KGSA 1CQZA 1Y34E 2GK3A 5GMOA 3THXA 3ZNOA 1T34A 1CLEA 2I7VA 2PWAA 3FDZB 3PQ7A 1BMQA 4CODB 4ZYXA 3RADC 2X0EA 1VDZA 1WXFA 3D1JA 4HDRB 2F3PA 4NBNA 4PZLA 3SNKA 4FWIB 4Q6BA 2BBOA 4HFMA 1M6NA 1V95A 5CBPA 2CHGA 3CISA 1P7CA 1DKPA 2JJ8A 4D4MA 4PN7A 2VNSA 1KJ8A 4KJZA 1Y9ZA 2XNCA 1N3YA 3VDQA 3MJCA 3GCDA 1QV6A 3CZQA 4L2IA 4OLJA 1EE2A 1KDPA 1VQ1A 4A6EA 4X1OA 4ENWA 3G2MA 5IAEA 3S2ZA 4QYWA 1GZHB 2EP5A 4F7DA 1MZPA 3VQTA 2EJWA 3OUUA 2XE7A 4FD3A 4KQEA 5IM4F 1EK0A 2O2EA 3BOSA 4QUDA 3U7GA 2OSVA 3PJRA 5CM9C 1QHSA 1FLDA 2ZB3A 4MH0R 5I9MA 4YRSA 1NOIA 1RJDA 2PCLA 4FUQA 4CDMA 5CURA 4DB2A 1HDCA 1P1BA 3B1VA 4JJZA 2NXNA 2F8MA 3KVOA 4LGCA 3V4SA 1VYUA 5C7IO 5EUQB 2J5QA 1TKRA 4NBRA 5TIIA 1N2JA 1BE0A 3HCRA 5J3JA 2WJWA 4WD3A 3CMMA 3KB2A 2BV3A 4OHZA 1ND5A 1II9A 2YW9A 1KMIY 1O96A 5G0UA 2XE6A 1NRXA 2FR0A 2YHIB 5CW2A 4DLKA 1L5SA 4TTQA 3G5UA 2ZPAA 3LYUA 4H18A 4GYKA 4YAEA 3IAFA 3PYXA 4OHKA 5FR1A 1J24A 1VCIA 2ZU0C 4CU5A 4LECA 4LUCA 3VXKA 1PI3A 1QSGA 1R9NA 2MSKA 3K70B 3B2NA 2NVUB 1RWXA 3BMCA 5M7EA 1X7WB 3CSSA 2WLSA 1U9JA 1JEYB 3V4PB 1NUHA 1QS0A 2HT1A 3A06A 1AGYA 1KFJB 2WJAA 2GUWA 4WOPA 1WQ4A 1KPGA 1PQPA 3BSWA 1CUVA 1Q6ZA 2E4AA 3C14C 4M87A 4UCQA 4ZOAA 1PE0A 4JBHA 3IEMA 5IDVA 3FUXA 2QBYB 3WK6A 5IKMA 1MMFB 1JSCA 2IYQA 3R20A 5J58A 2VPZA 3KJNA 1Y42X 3DL4A 3FHOA 3FZQA 4HHEA 4OH1A 4BYMA 4IR7A 3D5QA 3P9SA 2B8JA 1VPVA 3WXMA 3CWCA 2R4TA 5FF9A 2CVFA 4YAIA 1ISJA 3L0IB 3QPUA 2ZBUA 4FEGA 4UXJA 3BMOA 3T06B 4AWAA 5K8JB 1R4MB 3V00A 1D3AA 1N5LA 4LRSB 1GZDA 5DHPA 4B4OA 1GRCA 4CR7A 4UFPA 1NBAA 2J09A 3AF2A 3IAM6 4WXYB 1Q0HA 5C52B 1L1QA 2A57A 1NW4A 2H1HA 2KS6A 5I8WA 4Y6LA 5K09A 5D8DA 4IQFA 3RVQA 2HJSA 3EXFA 1CY7A 3TO5A 1C50A 2RE8A 4ASUD 3MEQA 1EP3B 2WDZA 3UZUA 3NHYA 4RD3A 5C4GB 1Q50A 1Y5MA 4BP8A 1GFWA 4BNKA 5JXWA 1EQAA 4DBZA 3W6ZA 3LHIA 5CD9A 4CKEB 1COWA 1R0YA 5E4JA 4Q3BA 4JVLA 2I1QA 3WGMA 3NBQA 5JY6A 4QVGA 5JZVA 3ZWKA 1ULSA 4WFKA 2AXPA 2BEKA 4MMZB 3RTAA 3HXQA 3T1TA 3GJ5A 3BRWA 2GZHA 4QDJA 4MVJA 1CLUA 2ZRPA 4KQ2A 4Z4CA 3OH8A 4MGKR 4JYAB 2CHUA 2XCUA 3QVKA 4Q9LA 2GD1O 5ITZA 2ISQA 1E8MA 1JA1A 2P78A 1YHZA 4TQ9A 1L8QA 1KI6B 1VHLA 5DNYB 1ZCFA 5L3QB 1EGMB 3OE4A 2AYXA 1XHFA 4IMJB 3U3ZA 1CRQA 2C4WA 2J3LA 1R0CA 2ISCA 2K87A 3G1TA 4G1VA 1IVSA 2YJ3A 2XTAA 3BE6A 2YX1A 1I2DA 4FHDA 1CS0A 2B0JA 2VHQA 4LBWA 1SQGA 3ROKA 5T8KA 1UJBA 4BLUA 5CFNA 1QIIA 1HDGO 2FEOA 3SEZA 3WRXA 1V9CA 1Z6QA 3JAWA 4Y98A 5EE9A 3H75A 2Y1KA 4WLUA 1IQRA 2UZ0A 4R9SA 2CL6X 2G7ZA 4RORA 4C3OB 2M98A 3KPUA 4ZKEA 1WMSA 1EJ2A 4X20B 4AB1A 1UEXC 2A4KA 4MQMA 3A9VA 5I7WA 4Q9HA 1FTYA 4MW4A 1FFSA 3GVXA 2DBYA 3TJZA 3U40A 4MW9A 4RK5A 1X0XA 5KTNA 3EZ9A 3GXBA 5IBRA 4AMYA 2PO5A 4EFMA 3AM1A 3HZHA 5J2UA 4WVFA 1ZRHA 3JALA 3W8RA 1G20E 4V1CI 1R9JA 4P7FA 4BKMA 2XB2A 2XUHA 3R44A 2AZTA 4FHGA 4KEAA 4KUGA 1XZ8A 4M1TA 3OOYA 4G85A 5BQFA 4ZVTA 5IAJA 3WFZA 5LBIA 1J5PA 1TO1E 3T7IA 4C2BA 5A1JA 2J0UA 4FU0A 1AMOA 2BN4A 3VVMA 1NW7A 1PYOA 1RKQA 5LA6A 1MDBA 5ENVA 1U4OA 1N1DA 2R7MA 1JJBA 3H8JA 2Z4RA 3IOCA 4KQ9A 2ET6A 3T4UA 1T9HA 1H8HD 2X1VA 5E6UA 1UFQA 3U39A 1ZR4A 1DIRA 1LBEA 1OH5A 3R7SA 3I9MA 3KEQA 5L95A 1JKFA 2FMUA 4DW8A 5C1PA 5F5LA 3KSBC 4F38A 3EAGA 4S0XA 4N5DA 1L5HB 2Q3JA 2GZ2A 4KFTA 5LLDA 3K6SB 5K8LA 2I4TA 4ZCSA 3RVSA 1JR3D 1AKEA 1FP4B 4DA8A 1D8AA 3OZTA 1L5OA 4FZVA 2R1VA 3DE3X 1ZEMA 5KYGA 2VYNA 4YP0A 1QTQA 2FFJA 2ZUTA 1BCSB 1V7ZA 2HFJA 4IQ8A 1M34E 4G07A 3EGCA 4G0OA 4XD7A 1W34A 4ZCQA 4BZWA 5A3QA 5LDGA 3WC4A 3ET4A 1XF1A 4P3YA 3Q9NA 4JAVC 4EPTA 4LGMA 2HV9A 3P2KA 1MOSA 4MIOA 2CJXA 3HCPA 3L7MA 3AM3A 4L5JA 4E5KA 1HL3A 2H16A 1VFNA 1HDEA 3L8GA 2OECA 4OHBA 4R40A 4EB6B 5I4IA 2FJPA 3FX2A 1N9KA 3JQ6A 1LV8A 5KSOA 2C0PA 1BD3A 1H4QA 4RK6A 4MUEA 4N8DA 3MTEA 3ZY6A 3GLIE 2VHEA 1WXHA 3UQYS 1MAAA 4BJ6A 2OWEA 3CZCA 1UXOA 4DANA 5AVYA 2IA5A 1FXWF 5EZYF 1XMPA 3RVDA 5G0TA 2O2CA 3D8TA 4QNNA 3VR4D 3WVNA 2IHJA 3QKUA 3MCZA 1DKNA 2VPYA 3B7WA 3RSOA 1DJOA 3FCSB 2FG6C 2A59A 4RWEA 4XB1A 2G9NA 4DJTA 3B38A 1QTNA 3PFBA 2MSNA 2H4YA 4KAAA 3LT4A 4R9RA 5JY1A 4DR5B 4CKWB 2C03A 1DU4A 4EO9A 3H5LA 2ZJ7A 1BHO1 1XBTA 3HXPA 3PQEA 4II7A 4JA0A 3BGWA 3PE3A 4HF7A 1BDJA 1GPYA 1UXHA 3C15C 4QUGA 3CBQA 3PDWA 1C8KA 2Y9PB 5DBFA 2DLDA 2O0MA 5LOVB 1QX4A 4MUKA 4N6GA 3HFJA 3I2FA 3EMDA 4G2NA 4F2GA 2DU8A 1R4ZA 1Y6GA 3EXG2 4GR4A 2SECE 4IFTA 4RXTA 4QO7A 1P7WA 1WV0A 4NR0A 4Y7DA 1VPLA 3QTBA 1VJ1A 3A04A 4FDVA 3FOAA 3AUTA 3WWYA 3IJEB 4Q4AB 2XA9A 2XMZA 3RK0A 3MWFA 2VJBA 2FSFA 2QIPA 2UVQA 1PTJA 1RRKA 2VWHA 4P36A 4O8ZA 3WMWA 4BV8A 4CMJA 2J67A 3CJRA 3H1PA 1Y3DE 1JSRA 4R41A 2X7XA 3FDFA 4JP1A 4ESEA 3S27A 6GPBA 2J9YB 3ZGYA 3W3ZB 1DIBA 2DYKA 1P2FA 3ABIA 4ZI5A 5IVKA 5A5DA 2E49A 2VXYA 3E58A 4FC6A 3VR6A 1N2HA 1KMMA 5CCBA 1GGNA 3R5FA 3LTEA 3HO1A 2ZIGA 1YFJA 2A4MA 2NU9B 1C0EA 3LQRA 1VE6A 5EIHA 1Z33A 1PR3A 1CUJA 3SQXA 3T7SA 1DAGA 1NPTO 1XAJA 3DDCA 3NGMA 3OIGA 3Q3VA 4OFXA 3DW1X 4OHXA 4R1PA 2XBLA 2R11A 1S3FA 3TM4A 3VO8A 3LYLA 4BLSA 2PUFA 4OGKA 1F1JA 4Y2VA 3UIEA 4DXDA 1GFIA 4B3BA 1IHDA 2W2OA 4CM9A 1WVGA 2A58A 2JAOA 3X1KA 4YT4A 4MKHA 2AFHA 3H9CA 4MCHA 2ZSIA 2WIKA 1N3BA 2JGEA 2ZRIA 4PC1A 1SH7A 2RDMA 3WKBA 1UDRA 5C4MA 5LUAA 1IJBA 3HLKA 4WNYA 2J3QA 4QGSA 1DO8A 1YR8A 1OTXA 2JRCA 3WHKA 4AUNA 1CT9A 1M8FA 2DULA 2WD7B 3HDHA 3H3FA 2AXEA 2FMFA 3PE6A 4NMXB 4DQUA 1EE9A 4A6XA 1DNPA 4D9CA 1YB6A 1O54A 3FFAA 1PEKE 3NC4A 1F8XA 4FYKA 4XFKA 1MB0A 1XRPA 5LQMA 2G08A 3MCWA 1QRUA 3LYAA 4P7BA 4WFQA 2CWDA 2W2LD 2OV3A 2XLBA 3N8GA 5HQ3B 5EIWA 4K8RB 2P2SA 1GTG1 3WLAA 3DE4X 4H17A 1J8DA 1H3NA 2I22A 5GGXA 1XRLA 2C4HA 4EJMA 5CDSA 5HOEA 4O4HF 1N36B 1FZTA 3DFMA 1JQBA 1L4UA 1XD9A 4U8GA 3U48A 5H3LA 1F3OA 1IH8A 1TQDA 2H18A 1M74A 5LOVF 5ED4A 1KYYA 1PNQA 1BXRB 5EWLA 3F6EX 1NOJA 5A0FA 3DL0A 3R7DA 4O2AF 2B1GA 5F7JA 4MPPA 1BE6A 1T6YA 2ZU6A 1T8RA 1FA9A 4WZAE 1A5SB 4JHXA 4N41A 3AKYA 2PRJA 1A8HA 4X6XA 4JLVA 5LM3A 1AV7A 1PR9A 3VAYA 2WM9B 1ISRA 1BYIA 1I2AA 2QOEA 3TG8A 1DPGA 3RTCA 4EL0A 1E64A 3NQ41 1SZJG 4JGIA 4TLEA 4HY3A 3EXEB 4UHJA 5LL6P 3RWBA 3M4XA 3E05A 1E0KA 5SY4A 2FPPB 2RHWA 3DLTA 2XUGA 4Q18A 1W581 2BE9A 2HHCA 4Q7EA 4ZFNA 4LHSA 2LBPA 2PA3A 3QOFA 3IAS1 2HWYA 2E1PA 1JPNA 2OBLA 1QFZA 4LHEA 3DZDA 3LKVA 3WICA 3KYJB 3DLBA 1WTAA 4OUKX 4MVJP 3P9RA 4TV8A 2CUTA 5CPBA 1J42A 1A04A 4BZPA 4DC9A 4A6DA 3MT7A 4XYBA 1CE8A 2LKDA 1S4QA 3PE4A 3P2YA 4LX8A 4MHSA 1TCCA 3IPCA 4EMBA 1KZ4A 3EWSA 1I7PA 1R4NB 2W0SA 1JDBC 5A7FA 3GNTA 3MJRA 2ACVA 2K7FA 3X0DA 2RHRA 1TF5A 1SUFA 1H6CA 1RQPA 2IW1A 2NZUG 4C07A 2GBFA 1TTTA 1UKBA 5H4HA 3BX1A 1ULAA 3NBAA 2I54A 4UCFA 2A9VA 5DX8A 1QANA 3MTDA 1N3LA 4N3GA 2C2XA 4GZMA 3C6BA 1WQ1R 3KLPX 3VHQA 4UUNA 4CMCA 3FTFA 3CF4A 4RD1A 1W76A 4WINA 4R9VA 3GLHA 1P3Y1 3TCXB 4DB4A 3HNOA 4RD6A 3A1TA 2QVLA 3IS3A 4XLZA 2Q0SA 2IHUA 1QPBA 1JP7A 5AOVA 5FYDA 1A8PA 1GZ7A 2MSDB 1UBTS 3I6IA 4R9NA 4CKCA 5K4AA 1V7CA 2JRLA 2RHMA 1RVDA 2I3GA 2QUHA 3GRAA 4PZAA 3L79A 5EWJB 4E88A 4WN9B 3SEAA 5JD3A 3I6QA 1KQGA 2Q9AA 4EKEA 3IR5A 4LXGA 3TW8B 2VWQA 1G8GA 3JZFA 4D4KA 3FVVA 1C7RA 1E7WA 1F2UA 1YQDA 2KPOA 4CDRA 4CEHB 2Q21A 2QJOA 3FWYA 3MWEA 4AO8A 4D96A 3WRYA 4FI3F 1X8JA 3VKHA 5DT9A 1FDRA 3QEBZ 1O5TA 1ISGA 2ZWMA 1Z83A 4DXHA 5TC4A 1F2DA 5KQLA 4RHTA 3NVDA 1M6YA 1MV5A 4IZHA 1G8JA 1Q0SA 3BDIA 2ZIZA 1HQCA 2AX4A 4MQEB 3ZBQA 3GRPA 4XIFA 2LW7A 2QGFA 1RQGA 4CQJA 3WLTA 4QJBA 3AOGA 3O38A 2R8PA 3C3PA 4M0FA 4QXPA 4LV8B 3TOZA 1IAVA 3TINA 2H00A 3ADPA 3DBOB 1B8PA 1RPZA 1C3OA 4Z1OA 2XA1A 4K6FA 1RQLA 1UR5A 1U2EA 4NZMA 4N9QA 1G41A 4MKZA 4TLMB 5B2FA 2YZ2A 3R7NA 5LP6A 3O0TA 2ZVQX 1D1QA 4WH0A 3VYWA 1ABFA 2FMTA 1QGAA 2WJ3A 4BNUA 1RYZA 3G9TA 2XGMA 3DFUA 3Q0IA 5D3KA 2RARA 2YV3A 3CH5A 5ENZA 4EX6A 1T15A 1C4WA 3B3QA 2R4UA 2ADMA 1N8TA 1O95A 1SKMA 1Q0ZA 3CWZA 1YKGA 3IQHX 3OLXA 2PMBA 1B6GA 1N5MA 4LXIA 4YT5A 5EAIA 2ZFUA 3IURA 3ZLUA 3O8DA 3C39A 1E4EB 2HL6A 3ZK9A 3TSZA 1ZONA 4RTSA 2CHQA 2V8OA 2QMUA 4FCCA 4B2LA 4E1VA 2GOYA 4ZCMA 1JEQA 1SUDA 2QK4A 1JHMA 1T9ZA 1YONA 4PZUA 1HKUA 5EMHA 1I7SB 4UVGA 3RF6A 1JN0A 2KW5A 3ZY4A 4Z1MA 1BCRA 1ULTA 1VE1A 2FK8A 2FCAA 3PGLA 4MUXA 2VNAA 2NTJA 2NV6A 3H1GA 5ETJA 3B48A 3UJPA 5HTKA 1R88A 3I32A 2A5LA 4F3KA 1ECBA 4H7DA 3EVEA 1YZYA 4LSGA 5BR1A 4M9ZA 3LBAA 3WQBA 4A9AA 3TM5A 4ZGBA 1UWCA 3KHSA 4O08A 2OZPA 4FN4A 4W5OA 4EK9A 4M53A 1IJFA 3DPSA 4G65A 3AL3A 1P9NA 3U56A 4Q7JB 1E6LA 1R5BA 1QH8B 3ZE8A 1GZ5A 3HB9A 3E9NA 3R0XA 1IHOA 5DBGA 4RESA 4UQOA 4PZYA 4J1QA 2V0GA 1AQIA 1SOUA 3D31A 1P29A 1H3FA 1D6SA 3BGSA 1JV2B 1XZDA 3VZDA 3WNCA 4GUDA 2XYHA 2YWBA 1F48A 2EP8A 3DOIA 4HUQB 4YMWA 3T61A 4C7VA 1QX3A 1EFLA 1KI3A 4QBGB 1GWNA 2YYAA 4FFLA 2KI5A 4F3TA 2FEXA 4KWEA 3MF4A 3MSXA 2B3DA 2VHUA 1SCNE 3NATA 3GLFB 1RE0A 1TRKA 1BMFA 3G6WA 4M99A 4N39A 5LU9A 2POCA 2X6QA 3B6EA 3E03A 1OBFO 4M0LA 2WF8A 2F4NA 2CLDX 1L1EA 3NAZA 3KKPA 3ACBA 3W8EA 4YACA 4IV0A 3FFXA 2QL7A 4F11A 3F6CA 2WTAA 4NCJA 2QVGA 1UDWA 4DQXA 3DVLA 4ENUA 4QU0A 3VX3A 1XFDA 4GE3A 4L5YA 2XA2A 1VMDA 2PSFA 3D4OA 1ADCA 3M4NA 3OTIA 2VSOA 1JU3A 2IEBA 3L8CA 4OXRA 4PAWA 4P08A 1O03A 4K9DA 5KYUB 3V8MA 4MIYA 4C21A 1JMYA 3CNEA 2ZXEA 3WBKA 1UWLA 4QULA 4ZYTA 4IUBS 4JL5A 3FYUA 1J9GA 4XVRA 4G5HA 4M38A 4PQYA 4EZBA 1BDIA 3QJGA 4I4CA 1KZ1A 2NVWA 3OHMA 2H08A 2ZDQA 3IA2A 1UWKA 5JQGB 4BYGA 4DLXA 2EW2A 1RXYA 1QZUA 4F3RA 3W3AA 5B58C 1C8LA 2WG1A 2GFQA 3LLCA 5EYPB 4JNCA 4K2HA 2JFOA 4WK2B 4JJFA 3M0EA 2YWFA 1AC5A 2X1LA 3TL3A 1GUDA 1VSUA 3C98A 5I7HA 1KK0A 4I50B 1NLYA 1YJQA 3IP7A 3DGFC 3SJZA 4BMVA 1P1CA 3FZEA 3QV1A 2I67A 1EP2B 4UM9B 5IJXA 1UZLA 3IE0A 4LA4A 4F4IA 4QPJC 1Y82A 3CZRA 4DZRA 1L5KA 2IIPA 1WZ2A 3QY9A 1SBCA 2ZW9A 3GJTA 3AUSA 4YRCA 5HQJA 3QI2A 1PT7A 3UK1A 1PFWA 1K6IA 4XQ9A 4C04A 1E5DA 2C00A 4KN8A 1PG2A 3RSQA 5F3RA 5F2NA 2FG5A 1YACA 2OCBA 2ZAGA 4RA6B 4MXDA 2E6KA 4MRSA 4YV1A 2BM8A 2JIMA 2Q3MA 2OGUA 1PFUA 4PHCA 1RMYA 5IXSA 5KDDA 1XZBA 1YZ3A 4GLFA 3FDXA 1ZS9A 2OO7A 5JAMA 5IEBA 4PG7A 1G6OA 2J9GA 3Q12A 3MQ4A 4CQNA 4JJ8A 4WWHA 5EPUA 1N9ZA 3IAS6 3ZK7A 3SQWA 3HGTA 1EUYA 1NBOA 3SY8A 2V65A 4EHBA 4UE2A 4RY9A 3TBHA 2R5FA 3DLAA 2MYNA 4QATA 1ZOOA 1RHQA 2GKOA 2ID9A 2ROQA 3QRWA 5D00A 5DM1A 2QQGA 1HQKA 2WI8A 1AVTA 1UBEA 2X0IA 3KTOA 4NH4A 1G7SA 3K32A 3KDSE 4PC7A 1IZ9A 1AHPA 1CV2A 3PSAA 5GGYA 2PK3A 3G13A 3KLMX 1N5OX 4P31A 3VSAA 2ZCJA 2NTYC 4AT1A 3E4CA 4UUOA 1CZKA 2I2CA 5CB4B 3IP3A 1IDOA 3I12A 3QX8A 4MUAA 3BJRA 1YBHA 3URKA 2B25A 2VCHA 3MLEA 2P0AA 1EHCA 1LUAA 2QU7A 4CQLB 4IZIA 3MMPA 4KXXA 3D3EA 5LR6A 4MUHA 4OQFA 8ADHA 1B7GO 4BFTA 3H3JA 1M5RA 5GY7A 2H2DA 3DS8A 4AO6A 5EPOA 4XTRA 3HFSA 4D9EA 2CVOA 4IBOA 4J76A 2VP5A 1IVYA 1PV1A 4BLQA 2I1WA 1H66A 2QRMA 3PENA 4J0JA 4KNYA 4MEBA 1C7EA 2WHEA 4ZC8A 3ZCSA 3R7WB 3SZMA 1TX4B 1KZHA 3LUFA 3WWEA 1XMOB 3DWIA 4TKVB 4DCPA 2FMXA 3KV3O 3MS7A 2PLFA 1G20A 3NBYC 1QVRA 4HP8A 2Q99A 4IHJA 3IO3A 3E35A 4EIWA 4MQFA 1UAYA 3NGLA 1V16B 2CNOA 5DM0A 4EMSA 1EXDA 2GRAA 1CD5A 2LIPA 1ZL0A 1EIWA 5TPZD 1NRJB 1QHHB 1XVVA 3AF6A 1GDDA 1VA4A 3HB7A 1PO7A 4R98A 5KHAA 4ZVNA 1SVMA 1T24A 1A2QA 2RK3A 1LF0A 1TZJA 3RK4A 4DQKA 2H4XA 2QE7A 3QLEA 4HQFA 3E3NA 1GKYA 4L9RA 1K97A 3T3OA 4HGQA 3H83A 2Z2ZA 3VTAA 1ISSA 1GU1A 1VJ0A 4GL4A 4HNAB 2X0FA 1D2HA 4J75A 1E18A 1UOEA 3TLAA 1IMOA 3QU5A 3U3DA 2J48A 1I0IA 4IICA 4ARAA 1ZFNA 1OA0A 4CM5A 4OXKA 1H2ZA 4BLWA 3JQCA 1IN5A 2BFBA 3FHLA 3I73A 4KE9A 4RDXA 1CZHA 4CL8A 4Y1GA 1XDSA 5JMOA 4HNRA 2UUCB 4W7IA 2CBXA 3GP5A 3S8YA 1ZZEA 2RBKA 4AXXA 1NDQA 3R5TA 3FDIA 3ZU6A 3D6HA 1LI7A 4BFSA 4EW6A 3SHFA 1WCIA 4ZOCA 2ZYSA 1EHIA 4NENB 4MI9A 2IITA 1TPZA 1U80A 1QC5B 2VNKA 1ZK2A 4INPA 1GR0A 1G1AA 2WK1A 4P9NA 2OMEA 2W6OA 4GXRA 1YB7A 4PX3A 1SXJB 3EF3A 3HDTA 4IXNA 3QLUA 2R1ZA 1TYZA 3D3NA 3NTRA 4RQTA 4AF6A 3GLIA 3SC6A 1H9CA 3AF4A 2Q0QA 3GD7A 3CX7A 1AHHA 4UFNA 4WKPA 3T3MB 3CLVA 3OE1A 5CB4F 2B4TO 2RI0A 1HYHA 1JAIA 3TJMA 1N1EA 1XEXB 2PGNA 2YWRA 1LY1A 1ZHHA 2AFIA 1Y9AA 3QZUA 1E63A 3P52A 3EOZA 3KO8A 1Y48E 3DH0A 1B3RA 3KUUA 4WERA 2QROA 1E7MA 3KTAA 2PEZA 2TRSB 1U3TA 2OZVA 4L6IA 2L82A 4HQOA 3RPEA 2NGRA 3VHXA 4NYIQ 4LFBB 2IEAA 5ALRA 3C8ZA 4YCBA 2IXAA 2WNHA 2DWPA 4HB3A 5DLDA 1RIFA 2AOTA 5HIJA 2G67A 3SMVA 3WGVA 5JISA 1U0NA 1Q22A 2NXJA 3BH0A 1RWBA 1RT9A 3B13B 3K1AB 3PUJA 5FPTA 2WVHA 2GF0A 2Z5GA 3VI3B 2BHTA 4IRMA 4LXTA 4AY3A 3WYBA 3M1IA 4MWOA 7AT1A 4IIGA 3VR0A 2ZJ6A 1WW8A 2ZB4A 3KJFA 3NBMA 4BB9A 3BJMA 4X5OA 3UENA 4IJUA 1Z74A 1U1DA 1BIFA 3AW9A 4MW1A 1CUXA 4BGDA 4DR4B 1Z82A 1T35A 2VQEB 3TFOA 1EFDN 2PS3A 4YJDA 1ZXLA 4LDRA 3N74A 1LK0A 3F5MA 5DIZA 1X87A 3V2IA 1IZ0A 1F2VA 3CUTA 1EVKA 4HPXB 4JNKA 2CNWA 4D80A 3IBSA 1BGVA 4TX1A 1JBQA 4RJTA 5HJ7A 4TYYA 4GM0A 1B23P 1I0LA 5AHOA 2FUG1 1J7JA 5JCXA 3TD2A 2O9JA 3K31A 2KMLA 2W6MA 3HA5A 2W70A 3SSAA 4PSAA 4WESB 2OO3A 1NATA 1XTVA 2Y66A 3PIDA 5KOJB 1JZSA 2EFHB 4WCVA 2A5FA 5GZ6A 4E2YA 2PUAA 4AJNA 4REQB 5F2OA 2CD9A 1AZWA 5ABPA 5HQTA 3OJWA 2G9RA 2WQZA 1ZVKA 1CULC 3ZGVA 5HUHA 3F6PA 1CX9B 3VU8A 3DEFA 4BVBA 5ITSA 3UWOA 1QGZA 2GLXA 2OK8A 3KB1A 1DJMA 2XF8A 1KNQA 1A9YA 1OLSA 1PFVA 4G4GA 2BMAA 3ESDA 4MV9A 3JQGA 4RVHA 4FLEA 2I3AA 4D57A 4XWWA 5BORA 3GZ4A 2PMFA 4AMBA 4K7JA 4LC1A 4WXEA 4DJDC 1VHWA 1BA2A 1A9ZA 1C81A 3P9YA 1V1MA 3PC6A 2OBYA 3N0RA 4OQNA 5G1OA 2OE2A 1J06A 1VI6A 2BSAA 2YXDA 3JWEA 2MTBA 2QD2A 1PAUA 4Q4CA 2Y1DA 3OF2A 1DRKA 4UEKA 3OZRA 5CFMA 4LOAA 2Q1UA 1DPFA 2FWRA 5FI1B 1I4LD 3TCKA 4A26A 2W2KB 1AKTA 1SN7A 3N5KA 4REOA 4UMVA 2ZVJA 5A05A 1ZN7A 1BDBA 2C4MA 4MV6A 4AJ4A 2GN1A 4IXDA 3SDZA 5HCUA 5DI9A 3FBTA 3RVLA 5IBPA 5KDLA 2XCRB 4ITVA 1XELA 3MGCA 2REQA 2C5EA 1OZ0A 2C29D 4NU6A 4TWIA 4XYEA 1RABA 5J63A 4D0RA 2YJTD 3ZU5A 3VA7A 2Z6QA 4EWLA 1TZKA 1U3VA 1OIWA 4RQAA 1YJ5A 1PS8A 3E3OA 1X7GA 2HQOA 5LZ5A 3UWKA 2C99A 1RVV1 3HTXA 2VHVA 2Q2QA 2A3RA 1RWOA 4MB0A 1YHYA 1AZTA 2BTEA 1ODFA 3LT5A 4WZAA 2WAOA 2ZUCA 3L0YA 1JF8A 3CUVA 3HXTA 5F3WB 1MF7A 2F9FA 1B6RA 2OORC 4XCXA 1K89A 4IH1A 1UBMS 1PR5A 5HF9A 4HEHA 1Z6AA 2HBQA 1CHDA 2HGSA 2BEWB 1WOYA 4M21A 1A4IA 4ASUA 4OGWA 4DT1B 3OF3A 5A5EA 3PI6A 3R5JA 4OJNA 1FQJA 3KQMA 4CI9A 1U2QA 3JU3A 1GILA 1VHQA 4GPEA 4KOEC 3WL8A 1YB2A 3ZLTA 4W7HA 4MEJA 1L4FA 3WO0A 2XDWA 4F6RA 3EN0A 3FGNA 2BL4A 2MYPA 4QVIA 3HYLA 4RNDB 3SYRA 3KQOA 3RYIA 3OPMA 3ZBUA 4ZI3A 4KXYA 1YBMA 4N1AA 2PT7A 3CUUA 3DJYA 3Q5DA 1RJGA 2YFHA 1E9FA 2ORIA 1I33A 4AY6A 2G6BA 1E1DA 3EGDB 4C89A 2CLSA 2QX6A 4ZVKA 5T5QA 3T5MA 2H0QA 4KN5A 3WJAA 2AKEA 3ZWVA 4HT3B 1Q3HA 4CT4B 2W4IA 3B3JA 1Z0JA 3OJOA 3VNSA 1ZK3A 2BFDB 4B1FA 5AW7A 2Q6OA 3I04A 4PAGA 3NRCA 3B6IA 2UUPA 4FYPA 4A5OA 2WMDA 3U61B 1YS4A 1WPXA 1C9NA 5ICGA 2EZ9A 5CVDA 3OOJA 3RFUA 1WNTA 2JBAA 3CIOA 4LVCA 4WW0A 5AJYA 5DYIA 5BMOA 1N0HA 3K9FC 2F3UA 2JA2A 2L69A 2IDJA 2YJZA 4L3VA 4IIXA 2B92A 4B87A 3STVA 2BEVA 2X15A 3OOWA 4DCMA 3COSA 1VBFA 4DGSA 2QYHA 2QGZA 1IAQA 3GP3A 4V02A 4MRNA 5IM4A 1QCYA 4OB7A 2IV3A 3HB5X 1GAJA 2XVXA 3DVRX 1RCFA 2IYOA 2Z1MA 3HKDB 4I9FA 1M1YB 5GJWC 2PLAA 2HLHA 2O5RA 3L0ZA 4F9EA 5BVHA 3VKFA 3FCXA 3UC9A 4FM9A 4OLBA 3QQ5A 3QFTA 2YWXA 2EWVA 1Q77A 3FNBA 3G0DA 4PQFA 4U2BA 2I6TA 1V1RB 1ZSYA 1CUZA 4BVJA 3ETLA 2XB8A 1HNZB 2IGBA 5CVJA 5KSYA 5CVVA 1C3EA 2JGKA 4OAQA 4JC4A 4AX4A 1RLJA 1MRNA 4DSNA 2YV5A 3PWTA 1AD2A 4OHRA 4NV0A 4ZGWA 1D6JA 1G7RA 3PNOA 1QDLB 2ID4A 1RQNA 1G21E 1H8HA 4KQMA 1BYUA 5LZ2A 3IAEA 1O6ZA 2DBQA 1I2BA 3JVDA 3T9AA 1QIMA 3UN1A 4V24A 5BN5B 1QWOA 2YC4C 1XZNA 2YXBA 2NWQA 3IEIA 1I2MA 3WB0A 4M3NA 4CW7A 3LW8A 3I64A 1FNSA 4EVSA 2G9QA 1V8BA 1NAIA 5JCJD 3JX9A 4NBWA 4X61A 3LD9A 2O48X 1YVUA 4LMBA 1NFFA 4PANA 4QYSA 3G5LA 5EN4A 2WZDA 3H7AA 5FQNA 1OTHA 4XOUA 2ZJ5A 3GDWA 5GONF 3WO1A 3E7PA 4CRWB 4L9WA 4ZI2A 2EG5A 2AMVA 2OL4A 4R54A 3C8HA 1SVKA 2QUBA 1NI4A 1DOAA 4CF6A 2NT4A 2HTFA 5BR4A 4O3MA 2HNBA 1RM5A 1KH1A 3ELYA 5DTIA 5F51A 1E3EA 1P2TA 1YAHA 3L9XA 3LX5A 3MMNA 2EKBA 3NS7A 4QX6A 3ROEA 5U4QA 3LHKA 1SQ0A 1RXCA 1RYMA 3MTIA 2BKXA 4TYPA 1KAOA 3VU3A 4BJ3A 3GLSA 4RYLA 1B0AA 2X8LA 4J7AA 3UUFA 3FDZA 3N0XA 1Q21A 2WYHA 3I01A 5K51A 1KMNA 1SUEA 4G84A 4LHZA 4RHUA 5I6DA 2INGX 4HDRA 2QPAA 2QRKA 1QRDA 3FBGA 1CQJB 1ID1A 1LC0A 3CB4A 4PZZA 1HNNA 1AS3A 3G59A 1KK3A 3IT1A 3OZ7A 4HWSA 2DOKA 2IH5A 5KPDA 1U63A 2YY6A 1C7ZA 3QENA 3LV8A 3TL6A 4INZA 1IZZA 5LB4A 4M9RA 3L4JA 5IH7A 2HO4A 4HMQA 2CNLA 1KJWA 3L3BA 3KWLA 4XM1A 5H3HA 4CPDA 1PJ2A 2ZB8A 3CF0A 3GLFE 1F1BA 2E1RA 4KWIA 3KRTA 4ODIA 4LW8A 1PLLA 3EF1A 4XFJA 1HRKA 2CFCA 2H52A 2D8MA 5EZSA 3QE9Y 5KQGA 3G2LA 4BLOA 3OFND 2BF7A 1XVUA 2OOSA 3NT5A 4KQXA 4BASA 3ANSA 2A5YB 3A70A 1A9XB 2FPKA 2HUPA 3TEJA 1VLHA 4ZDKA 3IIIA 5MFPA 5DSTA 4B6GA 3I2GA 3KFVA 2YHIA 1YR6A 5AJTA 3S70A 3ZDEA 5I4BA 1K4MA 4H9GA 2Z08A 3G8BA 4AUMA 2WPNA 1GHTA 3OA0A 3QU2A 4FD2A 4C0HA 1JWBB 3CUSA 3FETA 3T3IA 3PKJA 1S3SA 3D0RA 4GVXA 4YJKA 4DCTA 4X54A 1WXWA 4DLLA 4RPJA 2NVUA 1Y8RB 3ORYA 4UARA 1X7WA 2RHGB 3N2YA 4MV5A 4N5HX 4HATA 3HGMA 1EVZA 2B99A 1A7UA 1GL7A 1RLOA 2R60A 1TE2A 1WNFA 2GHQA 3AVPA 4MVWA 3TFQA 1HTBA 3FSRA 4E70A 2LCFA 2C54A 3DBRB 1LDYA 2IPAB 5KOYA 3M6VA 4YCJA 2D0IA 2FUG6 2IXGA 2QBYA 1EI9A 5KAPA 2MIIA 1G66A 4JC0A 2B9EA 2H1IA 5IKOA 1NWCA 4NU8X 1QVZA 4QEZA 5BOVA 3WAJA 1FFYA 5AICA 1QHFA 4HVAA 5THKA 1W85B 5K03A 4D44A 4E1AA 1ZK0A 1YAJA 2CKDA 3KDPA 2Z2JA 2OLEA 4L5CA 4CFSA 3D7RA 5CYGA 5LMCA 2IBTA 1ML3A 4HLNA 1V4VA 1U2RA 1QE3A 1GA4A 4PPQA 4XWKA 3IP5A 4P58A 3ZV5A 4OIMA 5CUQA 4CLHA 1JLLB 3IHKA 1U7HA 1TM7E 2VJPA 3SXUA 1YC2A 2QENA 3IUEA 4QG3A 1V5FA 5EHXA 2VJCA 1AIPA 2FJ0A 3ZLBA 7MHTA 3E15A 1M2OB 2EBWA 2A88A 2JHPA 2JA1A 2AT1A 2QX9A 5DBOA 4BVKA 4CKEA 2XMRA 3FPAA 4MUMA 2A92A 4PBRA 1KY4A 1LK7A 3QKIA 1H65A 1OLOA 4EITA 3E2MA 5JNTA 1ZNZA 2VTEA 2TMGA 1EVQA 2BHLA 2XXBA 3QWHA 3BUSA 4R2LA 3ZWMA 1HR0B 1BS2A 4OQ4A 4KGVA 3VZCA 4RETA 4Y2GA 2X9LA 4UU1A 1SUAA 2YQ4A 5DDIP 5L7TA 1ECJA 3M3PA 1D4AA 3S8MA 4G1MB 3JQAD 3L77A 4ZA2A 3A6EA 1TCBA 4PAMA 5E0KB 3JR7A 1STOA 3RG8A 3SF8B 5T7BA 1WVIA 4UMDA 5B12A 2Z57A 5JCOC 1MAHA 1XVIA 2PTHA 2NU6B 4XGQA 4BV3A 1KFBB 2AK3A 2F1HA 1NJSA 1ZGGA 3ER8A 1W73A 4QSMA 1FXWA 5EZYA 3FF1A 3E27A 2A84A 3DMTA 1J00A 4TYWA 2CVQA 2VYCA 1HDRA 3M89A 2IYFA 1G8KA 1MBZA 1PF7E 1T4GA 3I1YA 4GFDA 1RRCA 5FFFA 4WPGA 2Q9UA 4IP0A 1DRJA 4KU4A 4BRUA 4FGKA 1TW3A 2IZ1A 3O8NA 4X20A 5K3DA 4EI8A 3VYUB 2BGMA 1R8JA 2V3WA 5T8KC 1BFUA 3KTFA 1MD9A 9MHTA 4MGYR 4LYEA 2EZUA 2Q0HA 1RLMA 2QZZA 2YTZA 3AUYA 1L4KA 3HB4X 3HKBB 4O4JF 4BCCA 3A4VA 1SIBE 8OHMA 3GEGA 1NM5A 3D6MA 1X80B 1RAFA 2BMJA 2VJOA 2QTBA 5B55A 4EP1A 2C4NA 4X1YB 4B82A 1Q20A 2WFMA 4B3IA 1Z7WA 1C0LA 3UPDA 3L9WA 3MERA 4JVSB 3P94A 3VC1A 4AXBA 3CH6A 3ULKA 3FUUA 2PZ8A 4LE0A 1Z5PA 2JAQA 4QSHA 3DAHA 2W48A 4B8YA 3CE6A 4HMOA 3AFNA 4ZMRA 4M1QA 3HXLA 4B4WA 5BUZA 1C9YA 1V0JA 3E2IA 1U6IA 3F97A 2C7BA 3OQOA 3WA7A 2I8LA 3O92A 4HYEA 2EC5A 1XRJA 2NXEA 4YH1A 2VNJA 2VZ0A 4KQ6A 2QR5A 3DULA 1VG1A 3EEQA 4IDNA 4NDAA 3JQ9A 4IDDA 4KDEA 4L4ZA 3WZ2A 4BGEA 3PFFA 2UVDA 3GA7A 5KNDD 2YJNA 1X86B 5DYTA 1X38A 1ZICA 2E0IA 4ENVA 4GZ5A 4QOFA 3H9QA 1BCSA 1Y5NA 1JKIA 1U94A 3MD9A 3FPHA 3VPHA 3R77A 2GCEA 1O0SA 3D0KA 5IT4A 5KWIA 1E8DA 5DCWA 3DCNA 3GDOA 3MK31 1U5CA 1L7OA 3T7KA 3W78A 1ONSA 4CL0A 2ZBRA 1YQ9A 2FSUA 2E4UA 1W9HA 5JYEA 2G88A 5CD1A 1ZN8A 4GU5A 3SJAA 3IUNA 1K4YA 2QN9A 3BXOA 4KO8A 4CEIA 2HV8A 1CJKC 1GT6A 3AF5A 1PBNA 3D8HA 1SXJE 3ORSA 3W79A 3AIOA 2YQ5A 3AGQA 3AR3A 2QLLA 4FYXA 4S3MA 3VC2A 3WKEA 2X22A 2A78A 3OTGA 1RKBA 1EAMA 3AX6A 2IY9A 2PXCA 2F8LA 3VYSB 4AMUA 5AVVA 4BWVA 1VBKA 2B1RA 2NTEA 3HWSA 3R3YA 4KFUA 4KL8S 5E1BA 4JI6B 4JYBA 2H1SA 5G4LA 4E7PA 5JZBA 2GK7A 4G5QA 5SV2A 5KREA 2C07A 1XU4A 2I3DA 3INNA 3PXCX 3IODA 5ICCA 1UXKA 2C9OA 2P67A 4G8CA 4E4YA 2XH8A 1EYZA 2PKCA 5A4IS 2HWUA 3EZ6A 3KJEA 2VF5X 2V7QA 1W35A 4NTZA 4RMGA 4O4HA 3WIEA 3FHTA 2O3TA 2VF2A 4FR5A 2I4LA 2AJLI 1XEWX 4Q15A 1IXYA 5IK2A 2FI1A 5LOVA 4DZTA 5C18A 1G8HA 3H5AA 1QQ5A 1HPLA 4O2AA 4IS3A 3JQ8B 7ABPA 1NXVA 1W2GA 2AYZA 1QAMA 1VLVA 3AY7A 4ZXPA 4IWNA 1APBA 1R0BA 2WT9A 4OMCA 3AINA 1A77A 3EXHB 4LWZA 2R62A 3HKCB 1OWNA 1JDUA 2JI6A 2K4MA 3OURA 1MOZA 4I55F 3ZXUB 2JFHA 3ASZA 4Y0VA 3ECAA 1CETA 4JBLA 2QZSA 1EXVA 1GU0A 3H0EA 4GVLA 3E8MA 4EB8A 4DMUB 3L1VA 1JDPA 1PTJC 4C7OA 3PJGA 3U44B 2GEKA 5H0IA 4MUIA 2BGJA 2Q4RA 3QVMA 3LBYA 1E3IA 4TL7A 4CLDA 4ZHQB 3PFHA 5C37A 2VYVD 4G5FA 1VKJA 4MPDA 5EJ5A 2NU9A 4NC9A 1GFZA 2X41A 5FL3A 3WWPA 1UKZA 1XTPA 3ZZMA 1YCFA 3PPYA 2PE5A 4KOAA 2GAJA 3FKQA 4PGHA 2VF4X 4TGLA 4AJ9A 1JYEA 3TSYA 4TRNA 3D7LA 4WKOA 1NULA 1VLLA 4NHOA 4CKYA 4CV0A 1Z7EA 2J08A 4CM8A 4OXQA 5H1YA 3W2FA 1RI2A 5CJJA 5LVAA 1FFAA 3HWWA 4ZC1A 2HK6A 3EXAA 5LU8A 2QNBA 3TPZA 3L1KA 4R9UC 2Q0XA 4M46A 1R0WA 3CLTC 4H7KA 3IX7A 1YT5A 4UNPA 1PDOA 5AUPB 2PH7A 4QTUB 3UH0A 3VUEA 2WD7A 1CVLA 1T2NA 1Z8FA 3AHJA 2BPOA 2IHNA 1VJTA 2NZYA 2PVSA 1JLSA 1V11A 3KAJA 2OVBA 4N8SA 4EW3A 5GQSA 1QE5A 2YNMA 3QG1A 5AT1A 1YZQA 1D09A 1L7AA 1PK8A 1BG6A 4MYRA 4UEOA 2F1JA 5EY5B 1T3SA 4DIFA 1YA6A 1SVLA 1C30A 2BRUA 5JATA 1AMNA 1XT6A 4Y1EA 2XUKA 1BAPA 2MSWA 4IYJA 4JUBA 1EVJA 1FDTA 2ORED 2QMQA 3BGVA 3ODGA 2B3TA 3UAWA 4HLUA 4MI6A 4UOZA 4LF9B 2O8BB 1FVHA 4H4DA 2QVYX 3G8DA 4FYMA 1JJVA 3LPMA 3OOSA 1U8EA 1AKYA 2YYZA 1U8ZA 2R6GA 3RTGA 3R0VA 1BHQ1 1Y7IA 4UEJA 4JOBA 4G0UA 2GO7A 3CPSA 4IOKA 1TMOA 2E5WA 4MR9B 1EDBA 1W59A 4TXJA 3U1BA 3N7TA 4JZKA 1FJXA 3MBOA 3F9RA 4IPTA 1L6IA 4UPDA 5KJFA 3E6AA 1JVNA 3HMQA 1KO8A 1SC6A 3PHCA 4D79A 5IJ0B 1U2GA 3JQBC 4JXKA 3RAJA 1QFMA 3LPLA 2YBEA 1ORRA 1AGRA 4X7BA 3TRHA 3UCXA 1U9IA 1Z73A 5AW3A 5IZCA 4L72A 3RVOA 3EXEA 4WKGA 1QCDA 4CCWA 3FNFA 2B1JA 3LCCA 4KZPA 4HAVA 4OK5A 3RHSA 3V9PA 3H9JA 5FV7A 3HY3A 2XR1A 3FMPB 3OD5A 1YU9A 2VO1A 3CNNA 3PT5A 5KB3A 5LWQA 1O89A 1WUKS 3EISA 3LQFA 4IHQA 4ZHQF 1NR5A 5BV2P 1I7DA 1JXQA 2AFVA 3B1JA 3HYNA 5A4FS 3T1VA 3BB3A 4XAQA 5DNCA 1VPTA 4BS9A 4DUZB 5ALNA 2OAEA 4FGLA 3FW1A 5CLGA 2C0CA 3H4TA 3PF9A 3FKSD 5E8RA 3E3MA 4WOJA 1R4NA 4JKYA 1KXZA 3A6DA 3ZEAA 3AVVA 3IKJA 1I6MA 1QZ3A 2C8JA 2ZRBA 5CTJA 3DD5A 3ZGNA 4D92A 3H3XA 4G5YA 4GG1A 1JEJA 1GRVA 2EJUA 2ZB7A 3GFTA 4F1KA 1WX1A 4EZEA 2RGGA 4LVUA 4F5ZA 5EIEA 1MHTA 1NNI1 5KUTA 1KY5A 5B36A 2JH9A 3LXMA 2VZ8A 4I0WB 5JDCA 1BVYF 1G16A 2V5UA 4P0PB 3SDSA 1FPQA 4FN5A 3HABA 3C8UA 4ZO4A 4DWOA 4YCDA 1YS1X 2OXIA 1GQYA 1X39A 2RHOA 3BWVA 3N2LA 1ITZA 3ZUPA 5CFQA 1IM8A 5TR9A 4IEEA 4IHKA 2ABWA 1HETA 5AHRA 4TYQA 4WOCA 5AXCA 3SN6A 5U1PA 4ALLA 4BEBA 4F12A 4RVOA 4BB6A 4B3DA 2OBXA 4MVJG 2EWWA 5JG7A 3ABZA 1M1YE 2L19A 3LWZA 3MC1A 5EWJA 2OKCA 4O02B 5T41A 2H4HA 4C0KA 3F7TA 4NKRA 1U9CA 2E4XA 1VSQA 5KO2A 3ZTWA 5AVSA 3KOWA 1ZUHA 3TW8A 2FUNB 4QAQA 3RS3A 4A1OA 2BE7A 2I4MA 1O77A 2CL0X 4XSVA 4PQGA 4RO0A 3DHVA 1CR2A 4CEHA 1CY8A 1X1CA 2MU1A 2FMKA 4DRYA 5KDOA 2XY4A 3IJRA 3LUPA 3FWHA 1ENOA 1XLTA 5IBCA 1XQ1A 3ZIDA 2NQ2C 1U7WA 2YFYA 1J8FA 1C7IA 1MCZA 4RL6A 4G89A 2FPIB 1AU9A 3CEPB 4EPYA 2C88A 3EFOB 4JVOA 5MF6A 2UXBB 4ZZ0A 4DWJA 2WZCA 4DRXB 4MQEA 4L0DA 3IV9A 1TJYA 3DVAA 4HAWA 4DLSA 5AIBA 3D4IA 1QBGA 1WUIS 721PA 4XKJA 2C5BA 1DWPA 3MOIA 2FFRA 4RPLA 3LY8A 3RIXA 5CNMA 4Z2AA 5BXQC 5B1IA 2RB5A 1R50A 3VNQA 2PIDA 5EE1A 1M8KA 4DG9A 2LKCA 3K0EA 1OXUA 2ZRGA 1WWKA 3WLPA 4KIWA 2WD9A 3RU7A 4EKYA 2ETXA 4YFYA 3DMGA 4W8OA 4RGVA 1YJXA 5A9SA 5LMUB 1RMQA 2X5OA 3B2QA 4QWMA 4Q7KA 5LD2C 1V71A 4J0CA 1K7FB 1W36B 1Q0PA 3F67A 3UMJA 1S96A 1KKMA 1IIBA 1NF2A 4IVPA 4PM4A 3U4DA 2QN3A 3A9SA 2FRVA 3UAYA 3O8CA 1M1ZA 2NV2B 4EKIA 3OMLA 2IHTA 5CAEB 2IZ6A 1E4EA 2Q9CA 3SF0A 1QJCA 1QK4A 1SBYA 2ZQ5A 4YUZA 4N54A 1DINA 1O95C 3DT9A 3KQYA 3J80A 4CV1A 5K0GA 1GY8A 2GXUA 3ES9A 1IN7A 4OU5A 2XCTB 4CEIB 1S2OA 4CBVA 4ACAA 4RKFA 2WA2A 1WMDA 3BBLA 3GRKA 2WHXA 4HXGA 4OM7A 5E2AA 1QCZA 1VFPA 3A37A 4QECA 3Q6NA 4QPPA 2HIMA 1GN8A 1UM9B 3B5JA 4MK4A 4MYCA 1RYBA 2BW0A 2C7GA 3K0CA 4WCFA 2ZJFA 3C6QA 2HMVA 2AEJA 2VAPA 3C5CA 4M89A 5HNKA 4PNHA 3JYPA 3UGKA 3U5TA 1N1MA 2B37A 3Q0TA 1YDFA 1Y89A 3NGXA 1LV7A 3G2PA 4TOIA 1QZTA 1YZGA 2HA0A 3GJ3A 3LS2A 2VR1A 4IXTA 1QH8A 2AK2A 1SWWA 4DV3B 3C1AA 5TS3A 1DBIA 3WOHA 2VTKA 4E6EA 4WNCA 4PYRA 3FF4A 2CNDA 1GDTA 2IH2A 1TKAA 1EWYA 4HB0A 3ACCA 3EA4A 3AK4A 4B3RB 2WYUA 1J8VA 2C7QA 2FR8A 4FDAA 2E2WA 3PA6A 5IFLA 5IUNC 3D3WA 2IEYA 3AUFA 1QQTA 3PQ6A 1JIUA 3MUEA 1Y1TA 4HUQA 2Y0DA 3L1HA 4EVIA 4OBXA 2I4RA 3R9XB 2PUTA 4PNEA 4M37A 3JQQA 3FN4A 3WGYA 1CXZA 1GA1A 3W4JA 1XD2B 3PJFA 1RFLA 2XWQA 3UW3A 3P4UA 3GLFA 2B98A 1JQLB 2W00A 4QM6A 5HRCA 4GI7A 1AQJA 1IZYA 1H2AS 3TS1A 4EZIA 3LCRA 1JH8A 1WDKA 2ILTA 1J07A 1I1QB 2FPOA 2IC5A 3GRZA 1ZX1A 5ICFA 5A6SB 1R6AA 2F1RA 1XFAA 1K66A 1MXFA 1Y3AA 2BTQB 2WSSA 2Y76A 2JJMA 2VDKB 1WEKA 3FLAA 2AEEA 2P9JA 2Q1XA 3I8OA 4KVGA 4EA9A 2REXB 3ELWA 2CV0A 2JHGA 2PKWA 3DT8A 4RIGA 4D3XA 3ZDBA 1EB8A 2IS1A 2NYRA 1GYPA 1L1FA 1A2KC 4JJGA 1FDVA 1D2NA 1XLUA 3JCZA 1TU3A 3W5HA 3NI2A 4J3JA 1F8FA 5BUCA 2ATVA 4ZKDA 2WWXA 1LDEA 1R1DA 4LTMA 4NBVA 4BHTA 3QHPA 4GDFA 2PD3A 2RJOA 8LDHA 1PK9A 3LTNC 5CT9A 2A86A 4PHHA 5GM1A 2LRHA 2XEDA 2I99A 4KHZA 1KJQA 1PQYA 1C41A 1AK1A 3E9RA 2D2EA 3TQQA 4EGCB 4MW7A 3O7MA 1CUWA 1ETUA 4B71A 4BCDA 5LZ7A 1RBMA 4ZYWA 1G19A 2VQ6A 2V0CA 2QTNA 1K4KA 5AXAA 5MDHA 3SM9A 3VX4A 1VCMA 2Y1CA 4DDTA 2UXCB 3IAXA 3A28A 2JIOA 1NR7A 1W52X 3P2MA 1TC2A 5HZHA 4K9LA 3W4KA 2CB0A 3GC6A 3Q2KA 4S05A 1SBNE 3DE5X 5D7NA 1GA6A 2J9XB 1Q83A 3L7LA 3U1TA 3R1IA 4EL5A 5BRJA 3PZBA 1A7KA 4M7OA 1SKAA 4WJZA 1NBWB 4EI2A 2PKRA 1YR3A 2I6GA 4H7FA 2YVQA 2J85A 2HRRA 3B70A 3RC3A 4GKBA 1T9GR 3ZHVA 4DQ0A 1A1SA 4M49A 1KS2A 4Q6WA 1TK9A 3K0FA 3QEJA 1QHYA 3JZAA 4RXUA 1DWQA 5J2TB 3J7AC 1MJGM 2IDKA 4Q0MA 2RK6A 1XCJA 3ZGOA 3I61A 5CMLA 1NXSA 3HFRA 4QC2A 1J7KA 5AKXA 1JDBB 2E6UX 2MYTA 5EGSA 3Q88A 2Q8QA 1QLHA 5L3QA 2AG6A 2Z8YM 1NUSA 2FUKA 2PX2A 1VE7A 3SQLA 4RA6A 3UB3A 4BZQA 5CIYA 2BY4A 2EKLA 4PR0A 3G0HA 3ZQJA 4MS4A 3H5OA 2JARA 2D4HA 1XQWA 2VH1A 4JB0A 5FUWA 4EAQA 1TD1A 2JFQA 3AEKB 3MCUA 5IJAA 3PIRA 4LXYA 1DKOA 4TLLB 4US0R 3UCEA 1NTRA 1ZH4A 2QL6A 3S2YA 5DI3B 1DAPA 4RPCA 2DERA 3CUEF 2DFPA 4WY2A 1QKKA 2VJLA 3FFWA 4OP2A 4Y6GB 3CV3A 4MEAA 1Y5LA 4TTJA 4Q9NA 3LNCA 4ENQA 5DP1A 3RVRA 5FL7D 4IDBA 2AMJA 5ALFA 3E9EA 2P9EA 3DBLA 4UVDA 4JUIA 5FWXB 3BHJA 2ZT8A 2GYYA 3DMPA 3X1MA 1C0PA 4BN5A 4HSGA 5AESA 1QO0A 5K3SA 5IDYA 4GPD1 2IYSA 2Y0CA 3GGOA 4BECA 4EEZA 3H2BA 1ZD4A 5CB4A 3DB1A 4FX2A 2D4AA 4H7JA 4R16A 3KAPA 5GZ3A 4RF5A 4CQLA 4MKFA 4Q37A 5DX1A 1X8LA 1XKQA 2CBGA 1KDYA 2P9BA 1D0SA 1G5QA 1CIVA 3DEJA 3GJ7A 3PNMA 4O2LA 3SR4A 4DMKA 1CUUA 5JNSA 5EKXA 2W83A 4EAAA 1ZZGA 4AJ1A 1M66A 5SZKB 2Y8EA 3WLLA 1UJ6A 4IUDS 1I4OA 3FI0A 2RGWA 4HUJA 1OIXA 4QYIA 4D9NA 5KU7A 5HCNA 4DLTA 5JFTA 2BEJA 2FN3A 3N2NA 1UMCB 4U3JB 3SE0A 3V4FA 1Z6PA 3AETB 5I9BA 5K20A 1A71A 4G0NA 4C88A 5M29A 4QOSA 5CH3A 4DUYB 3LUDA 4R51A 1Z6XA 3R0ZA 1U0LA 1G3MA 2C9BA 1V16A 4IQGA 4MROA 2EX0A 2HB6A 4X44A 5BO5A 3L07A 3NIBA 5KVVA 1QHHA 1W8DA 1XWFA 3HRKA 1HH4A 5J2TF 1YQEA 2V9ZA 2ZPTX 3IALA 1CNFA 4MRRA 3KZ1E 4DA9A 5AVTA 4L5BA 4J7UA 4KV9A 1BC5A 5JU6A 4M22A 3C7CB 1MC4A 2VUTA 4GZLA 3SBEA 4D4LA 1JHOA 2B20A 5KNDH 2O54A 3ZE0B 1VGQA 2LZ0A 3L8MA 4XUGB 4P92A 2W8BB 1YD7A 3WE7A 4HNAA 3CF4G 1HLPA 1N5KA 1BQEA 2EZTA 3QFHA 3UA3A 5JIBA 1TCAA 2J9FB 3LCMA 3ZG6A 2WSLA 3BFXA 3ROPA 3MWJA 2QKYA 3HV2A 3WGKA 1GKIA 3SKYA 5A4JA 1HL7A 2HQBA 3ND6A 2FV8A 4G1EB 3OQHA 2H2HA 4JS0A 1MNQA 3SMQA 4EY7A 3HN6A 3ROQA 1LJLA 3TLCA 3ICWA 4Q01A 1UDAA 4RSGA 1CTQA 2X7HA 1P81A 3G7SA 2J4DA 1E0JA 1FDSA 4OQEA 4NENA 1SGWA 2CEKA 3A3OA 4YJ2F 4WCDA 1ACJA 4BMOB 2PZEA 4MHTA 4A4DA 1FRFS 1QC5A 1FUEA 5IVHA 1X19A 4OQYA 2ADFA 4JOCA 1XR3A 4WGFA 1LRLA 3F74A 3LQQA 4UHCA 4DJ5X 4EHKA 2WOOA 2VJYA 3TQIA 5A03A 2JH8A 2OGSA 1RHUA 1ORDA 2FQ1A 2GM3A 2YV1A 3O8BA 5BYKA 2CE7A 1E1RD 5CTAA 1YQXA 2GVNA 3JS5A 4GXTA 3V9AA 1J23A 1RYHA 1FS5A 1I9GA 4AFNA 5A2GA 4AKHA 2DCMA 3ZVKA 3N28A 5DEIA 5K3CA 1Y6QA 2FSPA 2OQRA 3A3PA 3OAAA 1DQSA 3HCEA 1G5TA 3Q6MA 3VAZA 1B76A 1UQUA 2HSDA 1JXAA 3RUDA 4GP6A 3ANMA 5K0EA 2HYDA 4HYYA 1PEYA 1QG2A 4KNWA 1KZ7B 1DXQA 2KBFA 2W9XA 4PNPA 5D5QA 4ZAFA 4AICA 5CA1B 2VTVA 2RIRA 2P5SA 4D8TA 2D1FA 3WLMA 3RHTA 2ZAYA 2WYIA 3HL0A 1EIZA 3RT1A 3EUFA 1ZRMA 5LQCA 4B7CA 4U9UA 2HEIA 1P4JA 4KMSA 2O52A 1WMEA 3E9DA 3JRXA 2EGHA 4OKIA 2I6QA 5B6PA 3H2ZA 4ZHSA 1ADBA 4PTZA 5EZ5A 4DR3B 1YRYE 4YUYA 3G17A 3HYTA 3GJYA 3BSFA 3DT6A 3QYAA 5HS6A 5LQKA 1KORA 2CL5A 1BDHA 2EFJA 4EO4A 1KSHA 1Y63A 2XMBA 2YHUA 3LW7A 5CLQA 4W1PA 1GTRA 5JS1A 3VHLB 1GP2A 4GI5A 1Q92A 3L92A 2VA8A 3AUUA 3DV0B 4FEEA 2G36A 1SXIA 1EK2A 5ALJA 1Q0LA 3L7OA 3UUWA 1FIUA 3OZXA 2C9CA 3FB4A 1E1YA 5IXJA 4F2PA 4HNQA 5FEMA 2BAGA 5LXTB 1S2LA 4LN1A 4CN9A 2ZTSA 2IUFA 1E5QA 1G8AA 2P5YA 2ONCA 4JYCA 4BKUA 5DW3A 4E07A 3AHCA 3F7MA 4MPRA 3PTZA 5FWYB 4ER0A 3R0IA 2FOLA 3Q8LA 4LZOA 5LQRA 1KP3A 5KINB 4FFBA 4QJ5A 3Q7SA 2OWDA 4F8EA 3TAHA 1YXMA 1Z88A 2JJ2A 3TDKA 5BT8A 2XYQA 1QHIA 1UH5A 4JI3B 3VZPA 2VJMB 3IJPA 3RUHA 1TL7C 3HY4A 4B79A 4RHCA 5KOJA 2A0UA 3K2EA 5KWJA 2BR5A 2Q28A 3VUFA 3HUDA 2WHQA 4REQA 5EOVA 3PKIA 1DX6A 1VE3A 3CNOA 2PSJA 4RZ3A 3MJ4A 4UTZA 1TT7A 2ZBGA 2ZR7A 1KQPA 4AZ3B 3V1NA 5HHTA 5BNTA 4C4RA 2X5XA 4MV1A 3WG9A 1Z4JA 2QNRA 1SCKA 5CJ2A 2ES4A 2JLQA 5DTJA 1X9HA 3ADCA 1JLKA 3V1LA 2IBSA 4UHHA 1P7VA 5F23A 2AC7A 1NYQA 1XMJA 1NXOA 1WXXA 1UK7A 1HDYA 3TRIA 5L3SB 5CVEA 4G8BA 3GQVA 4BKRA 1XPRA 4RCVA 3G5TA 3CEAA 3L7CA 2WIDA 4DMHA 2XDYA 3PGA1 1T2DA 4EF4A 4WTOA 3GWZA 1V5IA 1KDOA 1TD9A 5L6MB 4ZZ1A 4CMAA 3PNBA 5CA1F 1IY2A 4GEGA 1LDMA 2QI9C 4DWWA 1R8XA 5JYCA 1RTKA 1MC1A 3M49A 4DTIA 2WUDA 5K2MA 1S89A 4B7UA 3K8YA 3K94A 2XXJA 5HM6A 2DFTA 4ZAGA 5TJHA 4LIPD 2W42A 2W8ZA 4YO8A 2BFNA 2H4FA 4NPAA 2CYAA 3QBTA 4PLZA 5CYOA 5EJ9A 2FDRA 4XASA 5LLSA 3WB9A 4WZBB 3UMCA 3S7ZA 3VPXA 1P8JA 5JDIA 1S4MA 1MX3A 1WCWA 4RTRA 3DLIA 3B53X 4ZVPA 4AN4A 1YMUA 1ZH6A 2Z2YA 1DCTA 3NKVA 3CO0S 4ESOA 1M2VA 4HDAA 3I30X 1TAUA 2BEWA 1RM4A 3QOXA 3C45A 4LNHA 4A0QA 4DT1A 4Y2JA 4RD2A 5AI6A 3HV0A 3WL7A 4AK9A 1HQYE 3PNSA 5HVNA 3A6PC 1NP3A 2BGRA 1GPKA 3E2PA 2NV0A 1ISHA 4DHWA 4QKQA 2PUJA 3CMCO 5CNIA 2OFOA 2Z3VA 5BN1A 2NACA 2P40A 1WZCA 4DDVA 4UTRA 5AW1A 4H16A 1I10A 2O14A 1J09A 3I0MA 3UB4A 2QV7A 5H7XA 1CEYA 4LGYA 2XHEA 3IEUA 1XTRA 4EBFA 2OM2A 5D2CA 3Q3CA 1M54A 3AP1A 2BEUB 4Y2XA 4EG4A 3U3KA 2IS4A 1FFBA 2IZ0A 2O7NA 3JQAA 1IHYA 2FPXA 4LSWA 4EO7A 1ZCAA 3S8EA 3RRZA 1IK6A 2XEXA 1AKQA 2BUBA 2ZE6A 3WNDA 5EXPA 2HQSA 5FOVA 5IAGA 4B7AA 3QJYA 1OH8A 4NICA 1NIPA 1ESMA 1L3IA 1M2JA 2IYYA 2QX7A 1OZAA 1NPYA 3BYZA 4HEQA 3UHFA 1DV1A 3B78A 4IDQA 2GLTA 3MCAA 2FWPA 1N6PA 5JEDA 5EUCA 2ZM6B 2NSJA 4MW6A 1BTOA 3CKKA 3M6LA 4N0QA 3UAXA 5C8DA 3ZXYA 3PT9A 5I7UA 4RABA 4JASB 1OAOC 2OXTA 3OF5A 3WYFA 5BRAA 3RYHB 4B9AA 3CX3A 1ULHA 3B9RA 1U4SA 4P3PA 4LXUA 1V47A 3WYGA 3D3JA 4I1RA 5DNDA 5KVAA 3NOQA 3HKDA 1RW4A 3GUZA 4EMTA 3IR7A 1T1EA 2B5OA 1AXEA 3HJTA 2C98A 4UNNA 4CQMA 1EVLA 3NRJA 4CTJA 3KVVA 3QG5A 4KXMA 4PGAA 4X3CA 4ZOLB 3U9SA 5CFRA 3HDYA 5JSKA 1NVAA 1U81A 4R8RA 1IU9A 1N2CB 1T3TA 3AOEA 3LUGA 1BSVA 1IEQA 1E0DA 3EEOA 1F6BA 2XQIA 4IY1A 5CT4A 3VZQA 4TTSA 3V4VB 4GDMA 4D97A 4JSYA 2QTGA 3UM9A 3WDMA 2C4VA 2R6R1 1M2WA 3WGZA 3A3NA 3B5EA 5B6JA 3PRYA 5JD4A 3L8HA 4HFNA 5F4BA 3M70A 4JXJA 3OQ1A 3B8EA 3UWDA 1U65A 1XCLA 3KOXA 4PG6A 3WX0A 4LWPA 4ZVUA 5BN5A 3NFYA 1ZSNA 5CNKA 3UOAB 1WABA 1SHKA 1WHTB 2B7BA 3NNSA 1DIAA 2JIRA 4UZEA 4HO1X 3G82C 4RY2A 1TF2A 1UK9A 5C53B 1KO4A 1DAIA 1LEHA 1T5SA 4UBIA 4DARA 3T6KA 4JUAA 3W2IA 2ATCA 4L3WA 4L4XA 2GHRA 4A8HA 4JEIA 4AY5A 3HI4A 5CITA 3NYIA 1L7MA 1RU3A 2QAIA 3OJCA 3PUZA 4M7RA 4M9XA 2QT9A 1PZEA 4JJ4A 1WCXA 1Y5IA 1UM8A 3CJQA 2IOYA 4CGYA 1FNMA 3U3OA 2YJ6A 3V7FA 4CIYA 1VZ2A 3OLYA 4Y18A 5AW4A 4X9XA 4OHMA 5FD8A 5IASA 2AR7A 4MVJI 4DWVA 4CEJB 4FKMA 2AC4A 2OSBA 3CLUC 4WLOA 4CNQA 1N6LA 2XWPA 4CTNA 2W6QA 2BWJA 2E7ZA 2VNIA 2XSZD 4H35A 3WV5A 1AQNA 2HCBA 3I4LA 4IWXA 4UHBA 2LE0A 4FCWA 3IP8A 3VSBA 4O5OA 4YRBA 4RKRA 3RBXA 1TADA 4J1TC 2CFTA 2EQBA 4HYQA 1X7ZB 3V4ZA 2QUAA 3O93A 4I08A 3LO5A 3HVRA 1WB5A 1S9DA 1YGYA 1TZBA 4BBAA 2G5CA 4S1NA 1Z7GA 2YBDA 1KDVA 3PV0A 1CEEA 1FLNA 1TO2E 2A0FA 3UT6A 1OFUA 1Q19A 1KBOA 1RLUA 3RVKA 3G89A 3VISA 2WTMA 5CA0B 2VQFB 5HJ5A 2NAPA 1T3ZA 3QVGB 1WTCA 2EFGA 1PSZA 4UM8B 4EVRA 3C85A 2WT8A 4GT1A 4ZQCB 2W6JA 4HN9A 4PC6A 4TROA 4RX1A 1UT8A 3ESBA 1XQVA 3OA2A 3PNVA 1CDZA 3WQRA 2H65A 2X1MA 4ZOLF 3SD7A 1Z5ZA 4C01A 4F4FA 3INTA 5KS2A 5C81A 3GARA 1M5UA 5DNUA 3NORA 3DHNA 1IL0A 3ZV7A 4M76B 1S2IA 1FFDA 2NNWB 4QL3A 4ZDIA 5JSQA 3KOUA 1JU4A 1NHWA 5BWCA 2FZ5A 2GAOA 3LQ4A 1T1GA 2ZULA 3TSWA 2NAFA 5I45A 3EVGA 1XMVA 4TRMA 4I14A 1YTUA 4DNPA 1M6HA 1Y8RA 4I5DA 3WTCA 1FB5A 3I9JA 1IOWA 3ME5A 2I7XA 4MDHA 2BJHA 2PRYA 5E1DA 1MW8X 3GFPA 4DL9A 4GXQA 3DBRA 4QFDA 3F6YA 1IM5A 3ICQB 4DLRA 4XIGS 1GOTA 5JNRA 3K70C 5TQ0A 5JMWA 3G5AA 3LVRE 3R8FA 3KT6A 1XAIA 2C2BA 2JF0A 4JU9A 1DLIA 4OQPA 2RGEA 2ZR9A 5KCMA 4YR9A 4QQFA 1TUGA 1D04A 3JRWA 4G97A 3G2JA 1J0AA 1WMAA 4O4JA 4UAJA 3RIGA 1U7DA 1W85A 1G4HA 2QM7A 4EYSA 1RZRA 1OLXB 1W96A 4P98A 3TJRA 1E3DA 3MMXA 4MULA 2F2TA 3PLNA 5BYJA 3RSZA 4H1WA 1E2QA 1E9RA 2PKXA 4A16A 2C5FA 2N3ZA 3WLKX 2Z56A 3BIXA 1MX9A 1EAYA 1E2NA 2V6MA 4Z8YA 3DE7X 2I66A 3QWAA 2FPGB 2H07A 1TZ2A 2HT6A 3ED5A 2R87A 1IRXA 2A0WA 3A9TA 3EH1A 1JLLA 3OZCA 2WFZA 2ZIFA 3H86A 2CZCA 5K3BA 2WY2D 4Q1VA 4CF3A 3WIBA 4CM7A 3LDFA 3EBLA 4LTNA 2G72A 4Q7QA 3B6MA 3GPLA 1SXHA 4FJ0A 1M2OA 1Z08A 1UK6A 1OIVA 1NJ6A 3K9NA 1G2OA 1DP4A 2IQIA 5DF1A 5CIWA 4D2IA 5MHTA 3AVXA 4XYLA 3DLCA 3OVMA 4XLLA 3FVTA 1RM0A 2V45A 4W5JA 4ZK2A 1WZNA 1FRVA 1PGNA 1Z4NA 1OBCA 1A4UA 3LC7O 2GCOB 3NETA 5D3MB 4ANFA 4YLYA 3GO4A 1RBZA 4PRKA 1OKKA 1KAQA 3R3HA 4U7TB 2RGBA 4K6GA 1GPDG 1SBTA 5EQJB 4W5RA 3P0EA 3H1BA 2F3TA 3PWZA 1QUEA 1QRRA 1SAYA 1Z8DA 1K5HA 2DZDA 1U2DC 2FW7A 1LQ2A 2QG9A 3AB7A 3OFKA 3OIYA 3P45A 4X6UA 2J7KA 3V7NA 5G2OA 4O2BF 1T26A 1TA0A 3D0OA 4EH1A 2ZIAA 3FWPA 1DAOA 4G0QA 3WK4A 4UAVA 3H99A 2XUIA 2AIRA 2TECE 2OBNA 2Q2VA 1XMIA 5IF9A 2OLKA 1J1IA 3C6ZA 1DJNA 3GUCA 2Q49A 3LWNA 4QYMA 1UKCA 2QDKA 3IYLW 5FAXA 4BTLA 3LI2A 821PA 4WNIA 3IFSA 3PFCA 2PU7A 5BUSA 3A0RB 3RQIA 3PG5A 4TLDA 4EFKA 2REOA 2CVPA 3AR6A 3BA1A 4U7HA 1NE7A 2BZGA 1GGEA 1A9QA 1SVWA 2ZJ4A 1QF7A 2NSDA 3N6RA 4MI3A 1M1UA 3MELA 4C4TA 3BJZA 2J31A 1T3LA 2F9MA 4W5WA 1UEIA 4UQLA 4WDQA 3UGJA 3WRVA 1JHXA 4RPKA 5C7LO 4YQYA 1VA5A 2NTVA 1I13A 2OO5C 2XITA 3O4JA 4FDMA 1CEXA 3N2EA 4GHWA 3MS4A 3GT0A 1ZKMA 3HKBA 2MT9A 1F20A 1E3LA 1LK5A 1QLJA 1DCKA 1HO3A 2JC3A 5DLQC 3ET5A 1JR2A 1THMA 5KNCA 4YUXA 3IO5A 2X2OA 4AZTA 1CF4A 2RGAA 1E9CA 3H05A 2BBWA 3JQFA 5AUQA 1DGQA 4KXUA 1LKZA 4K0KB 1RLIA 2CFRA 4ZO7A 5EQTA 4LZJA 4JFRA 1KHTA 4X41A 5DB4A 3TNJA 1R0XA 3ZCVA 1GUBA 2QL5A 2Y4OA 4PSVA 3RVJA 3WZMA 4F84A 3AVTA 4I55A 3BSSA 4WK4B 1WR8A 3ON5A 1AZLA 3PD0A 3THSA 2XYGA 1GNTA 2C3OA 1A82A 4JI1B 2FW8A 3KCQA 1L6RA 4RZIA 3RRFA 5J4HA 7GPBA 3T1YB 1M73E 3EWNA 3A05A 2HMWA 4GPBA 5HKLA 5EJGA 5EMKA 4JI5B 4RLHA 1ML4A 3U0BA 4IFBA 1YI1A 1NI3A 4C0LA 1X1EA 2ATXA 2RGCA 1QG0A 3T1NA 3UJ7A 3N39C 4ND8B 3EX7C 1DDIA 2UZ1B 3HVUA 2G82A 2VK8A 4P6VF 1SHLA 1U7TA 3T12A 5BP7A 1XJQA 3AY3A 2P9FA 5DWQA 3RABA 2IELA 2DPYA 3CR3C 1BGWA 1H1DA 1NQAO 1WPRA 2O2SA 4YY3B 4XPIA 1GRQA 3BIFA 5HGXA 1EB9A 1PX0A 3TTUA 4OXIA 5AVXA 3FFTA 3G6KA 2QT0A 1PGJA 3ZTTA 4EI7A 3GVPA 1NC1A 5C5CA 1VB3A 4CF4A 5JJKA 4GVPA 4OHOA 5H9VA 1ZWKA 5CM2Z 1LSJA 1WD5A 3U1VA 3R3SA 3GVCA 1MQAA 4F56A 3GAFA 4C4PA 4BNHA 1YK1A 4D9BA 4P84A 4L95C 1FP2A 3AJ8A 2ZIWB 3M34A 2NUPB 2X8WA 3BD7A 3ENWA 1U1EA 4Q48A 2WUEA 4CYMA 5FXMA 2HR1A 3O03A 2PS1A 5LPNA 1YQGA 2R96A 1JKXA 4KH1A 4LQ4A 5AQEA 2GEFA 2OV1A 3AU9A 3GP8A 1JJ7A 1FYXA 2ZDHA 4J9VA 4M86A 2NOAA 1YL6A 3PGKA 4X7RA 1KDRA 2PSSA 3O26A 1TIBA 2YIDA 2C2KA 5LNK1 1I3OA 4LDJA 3UO8B 4II2A 5COAA 1RP7A 1YVEI 3FVRA 5KU1A 1ZAKA 2YUTA 4A2QA 3ADBA 2COUA 1E79A 1ZNQO 2F48A 3GWGA 3G0BA 1JH9A 4JYPA 3GEDA 4KAFA 4Z8XA 2GAIA 2JD0A 2YN0A 1M2KA 1D2EA 3LKDA 2BFAA 2I4OA 3BIWA 1O3YA 2WAAA 1FYEA 3L05A 2XVMA 4JLMA 3AB3A 5BW4A 3RUFA 2GERA 2QIOA 1GEGA 4BP9A 2GK4A 2JIDA 2JIBA 1W88B 1NQVA 3AUKA 3CPJB 3M82A 3SLKA 2D8AA 4MI1A 4ZAYA 3TTWA 4AM8A 3IUQA 4DUPA 5D3ZA 3CVUA 3S29A 3STXA 1QRAA 3CNLA 1D03A 3ELDA 1XMQB 3NVKI 2AZMA 2W2NA 3OOHA 1T9AA 4WX2B 3RROA 1V2GA 5B64A 4FIDA 1D2AA 3ONNA 3SLGA 4BQFA 1RR6A 3CX6A 3O4HA 5JYDA 2JGFA 1PJTA 3MJSA 1CY4A 1Z06A 1O94C 3OQIA 3QUAA 2CDNA 4YDHB 2IPMA 1WRBA 5F5NA 3REFA 3VVCA 4OI1A 1HZZC 1ZBQA 1TOAA 2GT1A 4ZHQA 1IUPA 3BWYA 3WNVA 4GZ6A 2B7LA 3VJKA 1E9AA 2R4QA 2VUSA 2PX4A 2YWGA 1DEXA 4A0GA 2BI4A 2O57A 3KV1A 1B2LA 2GBLC 2YINC 4C6RA 1L8AA 1MDFA 2VAWA 3G88A 3SKVA 3V2GA 4HWRA 1VRVA 3ZJ4A 4OJKA 2BGIA 2HXYA 3SC2B 4YPOA 3KXDA 4I1UA 4ZAZA 3VR5H 4ALMA 1P4HA 3AHFA 1UBOS 2OHHA 3C6YA 1H2HA 3K7EA 2ZI6A 1K8YB 4G5GA 4P33A 5FUXA 1SEPA 2A7QA 4AD8A 3KVYA 1FW6A 1HYGA 2PQ6A 4G0PA 5EINA 2Q2WA 2ZIUB 3D7KA 2DFLA 4BQRA 4S04A 5T4FA 4CJXA 2IYEA 5ECGC 3CX8A 1K6MA 2OGZA 4R83A 3WWOA 1Z3IX 3PHIA 1SKUA 5DM60 3CKMA 2H5EA 4MS3B 1Q5PA 1TYDE 1XA4A 3FPJA 1EHYA 4UVHA 1DFIA 4R2XA 2ZI7A 1P1JA 4KIFA 2AI3A 2R44A 1S7CA 1WMFA 3AH8A 2VHZA 4LMRA 4UC0A 3SZRA 2IYLD 4YWHA 4TTIA 1GZ3A 1SEVA 3PFGA 2J8ZA 1DXYA 3EXG1 3Q72A 3RSGA 4GMXA 2IE8A 2HM7A 5JJIA 4CCSA 5IDXA 1HT1E 4KR0A 1W0JA 4FSDA 2ZANA 2E82A 2OQIA 2GF2A 2YNMC 2O8BA 2D2FA 2PCJA 3HU2A 1JHVA 4BZZA 4DE5A 1I7LA 3IEXA 4IJ6A 4QHYA 3RRYA 2CLHB 3VR3A 2BRUC 2JVKA 1G7TA 3N53A 1ARZA 2JLUA 1PSWA 4PLPA 2BM0A 2OENG 1AQYA 4EFDA 2JIZA 3VH2A 3HC7A 4HLUC 4XQEA 4MR9A 5JSFA 2VDOB 5EWMB 4WZBE 1T91A 3EXIB 4DPKA 1TO6A 2WYWA 4HGOA 3RC8A 4G1CA 3ZE6A 2A9FA 5CYFA 4RVGA 5IJ0A 4YMUA 2C2OA 3AFIA 1GGKA 4IGEA 3UJ9A 3A1VA 1M2HA 1SQFA 3D1LA 4R69A 4QE3A 4R6WA 3L1IA 2VJQA 4PSUA 2Z3WA 5ALGA 2FWIA 1VM6A 5CLHA 2XAUA 4ZI7B 5AMXA 2O3UA 4F97A 1AKRA 1IWPB 3HACA 1JJIA 1HYEA 1U2GC 1XTZA 2RGUA 2B0CA 2CB9A 2P4HX 3ACDA 2ACKA 3AWDA 1U5BB 4DR1B 3A9WA 3QXJA 1ESEA 4RMNA 3DC2A 4U63A 4UBKA 3RVMA 3V7WA 3M2PA 3D81A