1U90A

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Ral-A
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
molecule tags Signaling protein
total genus 57
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u90A00
3KJGA 1D9ZA 2JAQA 3HR8A 1CXZA 5CITA 4F4CA 3P4XA 1F6BA 4O3MA 2OUKA 3UATA 5M04A 5EUQB 1FTSA 1T5LA 1R8QA 1YZNA 2HEIA 5DH9A 4DIEA 4MDEA 3RWOA 3PQCA 2O8EA 5FR1A 3ZDQA 4G5RA 3KJIA 1HV8A 4TYQA 3QENA 5FL3A 3AVPA 4NYMR 1W4CA 2RHDA 2XXAB 3I62A 1DAKA 1Z6XA 1E2KA 4JS0A 3GEEA 2D2EA 3AKEA 2YC4C 3BK7A 1MRNA 3UXMA 3DEFA 3WHKA 4Q66C 5J4HA 3D6TB 3TIFA 5GJCA 1EK0A 4PQRA 4QJ4A 5AR1A 3TMKA 3TR0A 3VR3A 3FB4A 3VR5A 5FFMA 3CZQA 2QN6A 3IO5A 5DI3B 1G8FA 4B74A 1LY1A 1WMSA 1OYYA 4BEJA 1KK2A 1L7VC 1JQJC 2N46A 2W2VA 2OHFA 1GNRA 4P3YA 4PPQA 3RHFA 4Z54A 1HE8B 721PA 4DLWA 1E0JA 1SVMA 1E2LA 4DVGA 3QUSA 2HCBA 3U4QB 1W49A 1G5PA 3MAAC 4G5OA 4TLBA 4JLMA 2E9SA 4POAA 4AKEA 1ODFA 3WY9A 2W2TA 4Q9HA 1NG9A 4C2UA 4NMMA 2DR3A 2V9PA 2WWIA 4RZ3A 5FOVA 1NF3A 3AVXA 1MR3F 5JLJA 1KAOA 4HSEA 4A6PA 3NC1C 4LC1A 1U0HC 3EASA 1JEEA 1DO0A 3CF0A 2ZRMA 1XTJA 2Z6VA 2ZVPX 3IEUA 3LBIA 3QPVA 4R2IA 1Z06A 3GLGB 1SKQA 1W4AA 2ZUCA 3AM1A 1T0JB 1ZNXA 5JJKA 1XEWY 3AQ4A 5EXSA 1SULA 4QHYA 3LBHA 2A9KA 1Z63A 4WVFA 3TUIC 5DE3A 4PC6A 4EJSB 1N2CE 5AJVB 4BWYA 2ZE8A 3K0AA 2IA5A 2ZI4A 1P6XA 2AR7A 4B34A 4W9MC 1Z47A 2GXUA 2Q9CA 1W0KD 1Z0JA 4PFSA 4JSYA 1MT0A 1T3HA 4DIDA 2NZJA 4M1SA 2XZOA 2W0MA 4UXJA 4KFUA 2EFCB 5CM8B 2GXAA 2QZ4A 3EPHA 1E99A 1E1QA 2G0TA 5BWMA 1G6HA 4M1WA 2ZE6A 1JR3A 4MKFA 1FX0A 3SOPA 3I1FA 4RD6A 1OV4A 821PA 3SDZA 4MKHA 2EW1A 4ZDKA 3BC1A 4HLUC 1UKZA 4I1UA 1XJ0A 2RAPA 3C5CA 4PC1A 5AUOB 1VG9B 2Z0MA 4CEHB 4D2IA 1QF9A 4KHZA 4DLUA 2XTZA 2Q0HA 2XTMA 3KFVA 4MKGA 2V8OA 1HTWA 4I1VA 4EQ6A 4IKEA 4JKYA 3G0HA 2C99A 3NKVA 4MGZR 1KTVA 3FFBA 2WSSA 1YR9A 3FWYA 3NBYC 3I5XA 1BMFD 1IXZA 1ELOA 1GL6A 4M53A 4NDZA 5C1BA 3K70D 3U44A 1OXUA 4XWOA 4D4MA 3BRWD 5KNBA 3SS8A 4LDJA 2W2XA 1OE0A 1WE2A 4RD2A 5TMPA 1TQDA 4YXWD 1GDDA 4KSCA 2Q9BA 4C7OA 1CF4A 1S0UA 4PC7A 1B0UA 3GJ7A 5F98A 3ZQ6A 2HXYA 4IVPA 4WXRA 4FIDA 1S3GA 121PA 4ZCMA 2P6NA 1W5SA 3SI7A 3TW8B 3SYNA 2JATA 3IHWA 1F5NA 2PH1A 1GL7A 3B85A 4V03A 4BLRA 1G4UR 5JI2E 4A0RA 2FU5C 4PO9A 1XTSA 3ADKA 2DWQA 5D3MB 1WCV1 2ZREA 1VCIA 2R6CA 1JNYA 1OB2A 2IYQA 4M22A 3ASYA 2RHMA 1X3SA 4NYMQ 2FX3A 2WJVA 1NBME 1XD2A 5K8LA 2WHXA 3ONWA 2B92A 3GFOA 1XX6A 2FGKA 1M2OB 1IM2A 6Q21A 4MYUA 3E2IA 4C4PA 4JBYA 4Q9IA 1EGAA 4QKQA 1X1RA 3W90A 3JVVA 1DAMA 3REFA 1II0A 4N3NA 1NBMD 2YWFA 2FV8A 3TRFA 4EKDA 5GVRA 1MO6A 2NZ8A 3A4LA 2KJQA 1G8GA 3NXSA 1XPRA 4AKHA 2JLSA 4P4UA 1G18A 4XD7A 4Q9JA 2W6IA 4PAOA 3UIEA 2F43B 2PJZA 5JCZA 5B2ZA 1DAGA 4W7SA 5JWOA 3ECCA 3BD9A 4TZ6A 3ETLA 3QY0A 1N5IA 5HCIA 4LBVA 5E7IA 3SBDA 3W6PA 4AK9A 1D8TA 2DPXA 3L8ZA 1DAHA 1PLKA 4KITB 2C78A 5FUVA 2ZTSA 3NBXX 2JDID 2H1LA 4I81A 1VIAA 4DRZA 1G64A 3AGPA 3CUEF 1A7JA 2WZQA 4Q21A 3GPLA 2OXCA 4Q9LA 3O8CA 4TLEA 4IOLA 4IHQA 4B44A 2FWRA 2WWXA 4XH9B 5AJYA 4IRUB 4Q4JA 3ADCA 1KK1A 3A37A 4NCKA 2ZRGA 2OXRA 4NZYA 4XJXA 4CYMA 3I8SA 4GP6A 5EUMA 5KDDA 4YDSA 4TT3A 1Q57A 4DDTA 1WXQA 5DYGA 3VAAA 3AVVA 5B57C 3B6EA 3U3JA 3CWQA 4QM7A 2QSZA 3AVQA 1AS3A 2GCPA 4P0TA 2QAGB 2BEJA 3P27A 3O8RA 1OFUX 1DBSA 3OEED 3PR1A 4M1OA 2KSQA 3ADDA 3A8TA 2JLRA 3U3KA 3BXZA 4R2HA 1PLJA 3QKRA 1AJEA 4FI3C 4A82A 3L8YA 2XSZA 3CB4A 4LY6A 2REOA 2YINC 1E9DA 2HLDA 1SKYB 3A6PC 3U5ZB 1VDZA 1SXJB 4HAVA 3PEYA 4HDOB 1MO5A 3QKTA 3QXSA 3CF2A 1I2DA 2D2FA 2GCOB 3EZFA 4MQBA 4ON9A 4XIGS 1G7CA 2QSYA 5E3HA 1Q1ZA 1DADA 4BEBA 1EFRD 4JL6A 2GEDA 4EPXA 3TLXA 4GOKA 2D06A 1XBTA 3DHWC 4IOJA 4JBWA 2O8CA 1LTQA 4JJZA 5HE9A 4B3FX 5TXGA 3MWLA 4PANA 3IGFA 2NTYC 4LV6A 4TTQA 2HF8A 4BQSA 3EPJA 3UK6A 1JJVA 3B78A 5J4KA 2C8VA 2GDJA 4BLQA 4DCUA 1XCMA 4JVMA 3PG5A 5FUXA 2R6DA 1Z6GA 3P20A 2ZJ5A 3AP1A 4TMVA 5GADl 3CNNA 2IXGA 3N2EA 3U2QA 1KO1A 1P3JA 4JYBA 3VKHA 3VNUA 2ZXUA 3ZIAA 4AY2A 1W4BA 5KYKA 2TMKA 3EAQA 3TUJC 4GOXA 4NCIA 2P6RA 1OKKD 2AWOA 4QJ3A 4AYWA 2FNAA 1H65A 4Q7KA 1P4SA 3PENA 2ZJ2A 2P2LA 3FKQA 4OK3A 2CVHA 5EP3A 3QBTA 4B3DA 2A5GA 4NL4H 5A4JA 4KO8A 3AEZA 2GKSA 4M9QA 1N6NA 1XEXA 1JECA 4CW7A 1DAIA 1YKSA 1XMJA 3LVQE 4YMWA 1N6IA 2HF9A 2BEKA 2F9LA 3AB3A 2XJ9A 2O52A 4S2EA 3VR6A 3C14C 4ACBA 2J0QA 2JLVA 4A36A 1CR0A 5AJWA 3IPYA 2IYLD 1BS1A 2R2AA 2ZU6A 4FD2A 4KODA 3ZS9A 1PVOA 1NJFA 3IIKA 2GK6A 2GEVA 2GHIA 1E2QA 1GZSA 2YV5A 3U7GA 1AS0A 3FVQA 2OLJA 1CRQA 2AK2A 2JLXA 3GLIB 4JVSB 3NH9A 3TJZA 2FSIA 1FNNA 3VMFA 1G8HA 5EZ6B 4V0OA 4HAWA 4M1MA 5EP1A 1JR3E 4F93B 3U44B 3THYB 3DKPA 1R0WA 1ZUHA 4X8LA 3UG6A 1P9NA 3OESA 1KSJA 4YMTA 2QBYB 1OH6A 4B33A 1RRGA 3NIBA 3THXA 3I73A 3LLUA 3CM0A 1E2HA 1JR3D 4LYJA 4B35A 3N5CA 2ZSFA 1SZPA 2BMJA 4JIMA 4N0DA 1II9A 3RC3A 2OFOA 4FCVA 4I99A 3LY5A 3SN6A 4QXAA 4DB2A 1F3OA 2G1KA 3TSZA 2B7CA 4NCJA 4GP7A 4Q18A 1KDOA 3GJ3A 5EP4A 3OF5A 5AUPB 2R65A 3J81k 1G21E 1OF1A 1XD2B 2PT7A 4ZCIA 2ODEA 4IDPA 3JZAA 5JHGB 2JLWA 1COWD 2ZI7A 1QHXA 3TH5A 1BH2A 3JVUA 1XCGB 8OHMA 3L0PA 2GXQA 4MRVA 2ZRIA 3KQUA 3LWNA 1FMJA 4DC9A 1KSFX 2ZJZA 1ZYUA 2Y8EA 1J99A 2Q9AA 2VF7A 2WKPA 2Z43A 2ZJAA 4QG7A 1GIAA 4QHTA 1T3SA 3RVBA 2J0VA 2EYUA 3RS7A 3LX5A 3QJYA 4K46A 3FYHA 4OI4A 1UDXA 2BBSA 2YHSA 2UVQA 3THWA 4DLRA 3OIYA 4AC9A 4PHFA 1ESNA 5SZJA 3PUWA 4IOKA 2A2ZA 1IN5A 4A92A 1W36C 4LC0A 4TWZA 2W6JD 2X77A 5JJIA 2FEOA 4MRSA 1BYIA 1E2FA 3C15C 4DCNA 1JQLB 4Q4JB 1P62B 2WJHA 2JLUA 5LD2B 2F9MA 1XU4A 1O3YA 2CJWA 3KQLA 3ZD6A 4HLCA 4DSUA 3EZ9A 1S2MA 3CX8A 1R5OA 4Q48A 2JCSA 4XOIA 3EZ6A 2KI5A 4E09A 3AF3A 5C18A 2XZLA 4JLPA 4FWTA 1EFHA 3ZLJA 1G7TA 5FOWA 2W6ID 1Z6AA 4BE7B 4AD8A 1JAIA 2IK8A 2IYRA 3TSWA 4HLUA 1E9CA 3S1AA 2ORWA 2OCPA 4MA4A 1C9KA 5GJWC 5KNCA 3VTKA 1NVVR 2QPAA 3DVLA 4TQ9A 3VX3A 3GP8A 1PJRA 2IUUA 2XNDA 3P1JA 1PZNA 4HB2A 1L4UA 1VIYA 4EFMA 3KTAA 1ETUA 2V4ZA 4H1UA 5J40A 3T12A 3FHOA 2ZUBA 1W0KA 4EPTA 4H1VA 4ZDIA 3KB1A 3M4YA 3O8DA 3EARA 3Q85A 1K8RA 3THYA 2FPMA 4RCYA 1S9HA 2VP2A 4N0EA 3TQCA 2FG5A 4GZLA 2GJ9A 1Q3TA 4BFXA 3IO3A 1E1RA 4BZQA 2V55B 1NLFA 3E5HA 3T61A 4P33A 3NHBA 2A78A 2PJRA 421PA 5IK2D 1ZUIA 3RRZA 2QMUA 2R44A 5AJXA 2BBTA 4ARZA 3B9QA 5JBQA 3GEHA 3FOZA 1TQ6A 2VHQA 4KCGA 3QXXA 3TVDA 2ONKA 5E7JA 1Z0IA 2HLDD 2RMKA 2WPDA 1UKEA 2KBFA 4EIWA 1CIPA 1U90A 3K0SA 1E94E 1CJVC 1PUIA 1SVSA 1GUAA 1TF2A 3T34A 1XP8A 1BMFA 3GJXC 2QQEA 2VP4A 1NN3A 4B2IA 2QMHA 2E87A 4XSGA 1OT3A 4YXWA 4DEXA 1OIXA 1KK3A 1R7RA 2GA8A 2PCLA 4DT1A 1EFUA 2YWHA 4JVNA 4LJ9A 1UDWA 2X8AA 4TMTA 2ZJOA 2O8DB 2RGNC 4TTRA 3W8NA 1G8PA 4OHXA 2CNWD 1GWNA 2CCGA 2CL0X 1TX4B 2HXSA 4V02A 3ND8A 1KI1A 4Q02A 2ODBA 2F7SA 2J45A 3ZH9B 1FW6A 4DHEA 3F8TA 1KO7A 1KKLA 1T6NA 1VCNA 3ZIAD 4CDGA 4LUCA 2F1IA 4NP6A 1QG2A 2J3EA 3R7WA 1VYTA 3SU8A 4ZDJA 1II8A 4ASUD 1J8MF 3TAHA 2IS6A 3KB2A 4RSGA 1G7SA 1GRRA 2QM8A 1NBMA 2GVZC 2F1JA 3ZYCA 2A5DA 1TF7A 2VHCA 1U8AA 5JWHA 3THXB 1YQTA 2G3YA 5CDFA 2Q3FA 2PLRA 4TLDA 1IN7A 1G4AE 2QNRA 2VQSA 2AN9A 1VCOA 3ICEA 1XMSA 2VHJA 4LJ8A 2CL6X 3EWSA 1N0VC 4Q1EA 2WICA 4DCSA 1NVUQ 4Q5IA 2ZSEA 5C4GB 2O8BB 1E98A 1Q3HA 4OHYA 3OIUA 2VF8A 2JDIA 4Q1DA 2ZRLA 4CRWB 2IEYA 1D6JA 3DOFA 2X2FA 2QI9C 3CZPA 4IW3B 2GZDA 1Z0KA 1G19A 521PA 4RZUA 4PC2A 4TL9A 1U98A 2WMOB 4DLSA 1E2GA 2QL6A 5FPTA 4WZAE 4TYNA 1HQCA 4CT5A 1MV5A 2ORIA 3IDQA 3PUXA 2JA1A 4X8OA 3EC2A 2ZYTX 5BXQC 2AX4A 2ZI3A 2BDTA 1G41A 1XB2A 2A5JA 4D82A 1DAFA 3U6KA 4RVCA 1DE0A 4WA7A 2C04A 2RB4A 5BN5A 1XEWX 2OILA 4S35A 4IXMA 3ZVRA 4WZ6A 4G5SA 2QPTA 2WJYA 3PITA 3KKQA 4A4DA 1M34E 4TLAA 1Q0UA 2EFEB 3R8CA 2GXSA 5EXXA 4W5WA 3LX8A 3OEEA 1CULC 2ZANA 1VYVA 2AD1A 2IYYA 5KUTA 3Q5EA 4V0NA 3AUXA 4A8JB 5CK5A 3TGPA 2IXFA 5G53C 5FTLA 1OLOA 1ZM7A 4ZCLA 1G5TA 1IBRA 4DSOA 2ASEA 1GNPA 4C2TA 3M6AA 3VQTA 1SQ5A 4CEIA 2GZHA 2CJWB 4JLAA 1E6CA 1K6MA 4EFLA 3WNDA 3NTUA 4PHHA 4TQAA 3X1XA 3EA0A 1EFRA 1U0JA 2Z4SA 4RD1A 1XCPA 1WBDA 5AUNB 4TTPA 4Y0VA 1T91A 5DSZA 2QP4A 5FOSA 3I5YA 1BKDR 3SYLA 2GAOA 1ZCAA 1JXMA 3VR4A 3HPRA 4Q4AA 2WBLC 5H70A 3S1AB 4Q9KA 1DO2A 5L3SA 1KI7A 1NJGA 2F3RA 4DDUA 2YVUA 2RGCA 1ZD8A 2ZE5A 2C9CA 2QG6A 2QRNA 1WP9A 2J7KA 1E0AA 2WOJA 2IT1A 5FBRB 1OKKA 3KTAB 4GFDA 4NU0A 3IUYA 2EWVA 3FMIA 3RNLA 4C0KA 3F5FA 2WTUA 2BMDA 4EPYA 2BOVA 1H8HD 1M8PA 1XRJA 1IOZA 2JEOA 4BLSA 1KMHA 2WOOA 1Q1QA 3LQRA 3QF4B 2W0SA 4OL0A 2DWPA 3IPXA 4BUJA 5JHHB 4CVNA 1SVKA 3U6BA 2HJGA 3W34A 4C0AC 1GP2A 4BGDA 2OT3B 3MUFA 5E4FA 1KNXA 3K53A 4DJTA 2BBWA 4LBYA 3HU3A 1KO8A 4ABYA 2VEDA 2NO1A 1J7KA 2FSGA 4PQYA 1ZMXA 3DL0A 3A1VA 1HEIA 4A0GA 1LF0A 2OV2A 2YZ2A 3QI2A 3QKSA 4LPSA 2VA8A 5JCPA 5JS7A 1ZBDA 1DG3A 5KSOA 4GRAA 4ZKDA 4B32A 1KSHA 2R8RA 4CZ2A 4MDFA 1S1MA 1QHHB 1ANKA 1JB1A 3X1DA 2OFXA 2XNDD 1KDPA 4D25A 2J0UA 3K70B 3GFPA 1UF9A 3UMSA 4IDHA 1T9HA 2BBOA 4BLTA 1NY5A 3H0KA 4KAXA 5JMTA 5L3RA 1A5TA 3Q9LA 1N0WA 1ZM3A 3RRNA 3E70C 1RJ9A 1SVOA 4Q01A 1VMAA 1Q20A 5DGXA 2VP0A 4O25A 4DSNA 1N6OA 1QHSA 4V0LA 4P31A 1E1RD 2YYZA 2R62A 3VKWA 4C0HA 4LYFA 2FPKA 3AF4A 3TVTA 4QGAA 4WBSA 2HT6A 3WMGA 4OJQA 4CEJA 1JEDA 3B1XA 5DIFA 2FN4A 4HZUA 1CJMA 2BMFA 1J90A 1T0HB 4QNRA 4O0MA 2PMKA 2DB3A 4CF7A 3KKMA 1NIPA 4M21A 2OBLA 3B1ZA 4TL6A 4E07A 3IILA 1XTKA 3ZZ0A 3CPEA 2WPDD 3KJHA 1I4DD 2QROA 4HAXA 2NPFA 1COWA 4MUBA 4A0HA 1XEFA 3LW8A 1F2UB 3N70A 3F0TA 3OIVA 5EQTA 1JPJA 2CBZA 4KU4A 3SEAA 2QRZA 5CYPA 2C9OA 2FZLA 1SGWA 3BE4A 3WRXC 1H8ED 3WNCA 3T15A 2H92A 5JJLA 1AM4D 1R4AA 1R0XA 3FKSD 4RCZA 4XVQA 3T35A 3KUCA 5EZ5A 4F91B 3W6OA 3SJAA 3PVSA 4KVAA 4U02A 1DEKA 2X1VA 3TR5A 1MRSA 2J9RA 4TLCA 2CHQA 3BH0A 4B2LA 3SFZA 4IDQA 3EPKA 4CGZA 1FZQA 4OI2A 1ZIPA 4FW9A 2HJVA 3TSOA 5CIQA 4IFBA 2W6JA 1X86B 1MABB 4GZMA 2ZRFA 4LHXA 1IN6A 3ASZA 3CW2A 5JSZB 4R71A 1IHUA 1WDTA 4KBFA 1AQUA 2REBA 4M9XA 1UPTA 1ZD1A 1RC8A 3R9IA 4C0QC 5L8VA 2EVWX 1Z2AA 3T5GA 2CXXA 5KSYA 3ZVNA 1QHNA 2V1XA 3D3QA 5GJBA 1HT1E 4I4LA 5CDFE 3RC8A 2E1RA 3FMFA 3IIMA 4AYXA 2CCJA 4TMXA 3C7KA 3Q7PA 5FTJA 4JLOA 5DHFA 4M0LA 4F7WA 1DS6A 4G1UC 5FI0B 2FSHA 1AIPA 1X8JA 4BFTA 1RPZA 4M9ZA 4EJSC 4LJAA 1NVWQ 3ND9A 4IXNA 2XTNA 5CLLA 4KXFB 1P5ZB 1K5GA 3KX2A 5CIWA 1YJ5A 3K9GA 1AK2A 1N6HA 1ZCBA 3TK1A 4Q1CA 3B13B 3RS2A 2OAQ1 4LV8B 3MSXA 1UJ2A 1VECA 3VHXA 4C0LA 3FDIA 3AVYA 3RS5A 3PEVA 1QRAA 2N42A 3QQ5A 2WIBA 3CRQA 4NE2A 1L4YA 5HTKA 5KHOC 1PV4A 3AF0A 1F2TB 2IF2A 3AVOA 3G5UA 1M6NA 4OYHA 1R8SA 2G0NA 3EZ7A 1WQ1R 1OHHA 3JZMA 5CYOA 3MJRA 2PL3A 4F92B 5J5CA 2IBMA 3LA6A 3KKOA 5IRCD 1I4LD 1N6PA 2BMEA 1Z3IX 4G5QA 4JLBA 2ZRDA 1KSGA 3FHCB 1Z29A 1NY6A 1G3RA 2DY1A 1E96A 4Q00A 3NDBB 2O8EB 2J5XA 2PT5A 1LVGA 1NMXA 1TU4A 2UZ3A 4NHOA 2ODWA 5IK2A 4DB4A 4IVQA 3QSYA 2FFAA 3QPWA 4Q4AB 1AZTA 1EWQA 2FFHA 3L43A 3OFNA 4KFTA 1ZW6A 3EXAA 2RGNA 2NGRA 1G3MA 5L3SB 1FQKA 5A0FA 5CB6A 5CB8A 4L4UA 1SVLA 1US8A 1GAJA 1Y63A 1P60A 2GWHA 5F9HA 4PHTA 3T1OA 4A2PA 1UBCA 5IHPA 3GLHA 1R10A 1RKBA 3QG5A 1IXRC 2RGEA 2ZEJA 4D26A 5LBIA 2EWWA 1Q22A 3SJBA 5JRZA 3CF6R 4DBLC 4C3ZA 2BJWA 4ZV4A 2VPPA 4PPFA 3CLVA 2J1LA 1OH7A 1JXOA 3V4FA 3AKCA 1NNEA 1RIFA 2FH5B 2ZS9A 4MYCA 1NMZA 3NHAA 4JBXA 4AURA 1XMIA 3DOEA 2F55A 2XGJA 3L0IB 2ZJBA 3HU2A 4LHZA 3V00A 3KQHA 4BFSA 1WBBA 3KJEA 5EE5B 2CNWA 2IEZA 1S8FA 2NMVA 5GJVC 4HLDA 4FMCB 4F4JA 2Z4RA 1TAGA 3H2YA 221PA 2P67A 1KNQA 3Q5DA 3LBNA 5CK4A 2QORA 3NEJA 1XF9A 2OEPA 4MUAA 3TAUA 4Q1FA 1OW3B 3TBKA 1TADA 3K0AB 1W48A 3WRYC 4UNSA 5HPYB 1XFAA 4M4SA 4V0MA 4CT4B 4ASUA 3DM5A 2CK3A 1G291 2IHYA 4UJ3A 1VCMA 1P9WA 2GRJA 1RJ9B 3K0EA 1J70A 2W58A 3SHWA 3AKDA 4OBEA 3AF1A 1TEVA 4HLQB 1FX0B 2PBRA 4HDCA 1EFTA 1N3BA 5CJ2A 1TPZA 3BB3A 4HUQA 2G83A 4JL5A 4R9UC 4F4IA 5AUQA 3RS4A 2WVJA 1SXJD 1VTKA 1KI2A 5F2EA 2GJSA 2J0SA 1OIWA 4MGKR 5FPKA 4WAUA 2ZS7A 2I1VB 4XTCS 3CRRA 4LV5B 3VR1A 2OFWA 1FL9A 4IVRA 3R9WA 4QGFA 1W2GA 4EUNA 4EQ6B 4PZZA 2PX0A 2ZYWX 2O5VA 5E7MA 4A2QA 1N25A 3CNOA 1GTVA 2QAGC 4X8HA 4HEJA 1W47A 1KO5A 4LBWA 4LOAA 5JFGA 1W5TA 1CP2A 4AG5A 1YRBA 1QHGA 5FTNA 5B64A 5TV2A 1ZM2A 1W7AA 1R6BX 1EX6A 2RCNA 4C7OB 3SBEA 3FMOB 4FN5A 4JJKA 4HUTA 5IF9A 1SXJC 1Z5ZA 4JYCA 1FUUA 1GSIA 1P2TA 4C9BA 5B58C 4RD0A 1R5NA 5BN4A 4XVUA 1D9XA 4MH0R 2EU8A 4PR0A 3AKYA 3LW7A 1S96A 4TQUS 3EPLA 2EFGA 4EPWA 1GL9B 5HKKD 4IOMA 3CR7A 3CWZA 3DZ8A 2ZJ8A 3B2EA 3FMPB 3K1JA 3LH5A 2CLCX 3HU1A 4NBSA 1W36D 4Q4HA 3SE0A 3AUYA 3B60A 2P65A 4BFZA 2XJ4A 4Q03A 2DBYA 2R9VA 3CR8A 2BCGY 3SNHA 5JS8A 3EC1A 4IFEA 1Y3AA 1GOTA 3FPAA 3QF7A 3WBJA 3P26A 2H7VA 5K8UA 3FGNA 1KDTA 1M1YE 3LDAA 4JLNA 3WHLA 3PJRA 2CE7A 4R7ZA 5JWRA 2AXPA 1DOAA 3QVVA 5FBQB 4I1OA 3QIAA 5C4MA 1RFLA 4HDQB 3QOFA 3CIOA 2XOKD 4US2R 2PZFA 4M1TA 2F3TA 4PZYA 1M74A 4EPVA 2YC2C 2EFDB 2QAJA 3WNBA 3TE6A 4ZIRA 2VP6A 4Q47A 2WAXA 4O2LA 2YOHA 2ZS8A 2J7PD 5FTMA 4DKXA 3B1WA 1AQYA 4NKRA 5SZHB 2BJVA 1CEEA 3DZDA 1FMLA 3LQQA 3BWDD 1AZSC 5EE3A 2IS2A 3LFUA 5EE1A 1KHTA 2PMDA 1R0YA 2ZSBA 1DAEA 2F1RA 4TYYA 1A82A 1TMKA 2J87A 2VHUA 2VIIA 1H8HA 3PUYA 3RDPA 2ZR9A 3CBQA 4GL2A 5G41A 1D2MA 4RZXA 1D2NA 4B43A 3KKPA 4ITRC 2N1BA 1OH8A 4D0NA 1VPLA 4US0R 1E69A 5L3QA 1XTRA 3U3RA 1OFIA 3BAFA 4JL8A 5HCNA 3RS0A 4D4KA 1QBKC 2AFIE 4NYIR 4KVGA 4Z1MA 4OJKA 3RSLA 1FTNA 2BWJA 3ZZTA 1TUIA 4KYIB 1WF3A 3CONA 4MYTA 1CS4C 2HYIC 4URXR 2JLZA 1GRQA 3QKRB 4LYHA 3X2SA 3GLFA 2FE4A 1DELA 1RYFA 4FINA 2QTFA 2A5FA 3BERA 3K8YA 5EXPA 3RABA 3UG7A 3Q8XB 1CR1A 1DG1G 4NPHA 3GLHB 2WJGA 4OKSA 2B8WA 4AWXA 4DUGA 4II7A 1HQYE 3CRMA 1FFHA 5KSPA 1HA3A 4Q7LA 1EX7A 4IEEA 3SHFA 1EFCA 2CHGA 1P72A 2GVDC 5BW8A 3O47A 1OHHD 3CRW1 2XXAA 2V1UA 1GKYA 4JSTA 3ZGXA 1Z8FA 2JJ8A 3SR0A 1IONA 3NVAA 2ZRPA 5C2JB 3I61A 2O8CB 3QXJA 3ZJYA 1G16A 4GT1A 1GVNB 4PAMA 2NPIA 1QHYA 2A5YB 1U2RA 3TQFA 4LJ4A 2IS1A 2D74A 3ZVMA 1NL3A 2CCKA 3LXXA 4ILEA 3ZD7A 3VHLB 3GLHE 3OFND 1NIJA 2QQ0A 3E1SA 4JLDA 1WA5A 4LGMA 3REGA 1JJ7A 2FPLA 4NYJR 1JBKA 1UEIA 2XITA 2ZETA 1G8YA 4OQNA 1UBFA 2GJ8A 4HZIA 4W5JA 3H4MA 3VFDA 5JEDA 1ESMA 1OSNA 1RVDA 1Z0AA 1XXHE 1UKYA 3QXCA 4LYAA 4PO1A 3RAPR 4KFSA 2MSDB 1EG7A 1G5RA 1KI3A 2O8FA 1IY2A 2HT1A 1E9EA 1H8EA 1Z07A 4A1FA 3GLGA 4LPKA 4RY2A 3EIQA 3FKSA 1UBEA 3K0CC 3L0SA 2P6UA 1XEXB 4EJSA 1QVAA 1GILA 3A1UA 3I92A 5LD2C 2AHOA 1FPMA 1U8YA 1YZKA 4R98A 3ZS8A 1SVWA 3U61B 2QGNA 2IYUA 4DSTA 1YE8A 4B3GA 4V0ME 3KXKA 3UPUA 2ERXA 2J46A 2JJ1D 1U94A 3P4YA 2FJUA 2SHKA 2MMCA 1HH4A 2QA5A 4JKIA 5E95A 4KLNA 2ZU0C 3QNUA 5DI9A 1N6RA 3A1TA 5HE8A 2BKEA 1P61B 2NO9A 2CK3D 1Q1BA 1Z2CA 2XNSA 4K8OA 4NONA 4MGYR 3B9PA 5KTYA 2JJ2D 1PUJA 3GJ5A 3W3AA 4XSHA 3U3MA 1GFIA 3EZ2A 3MWKA 4CEHA 3NBZC 1LV7A 3A1WA 4DDWA 3IQXA 3OE7A 4LJ6A 4M1YA 4PC3A 3BB1A 3UANA 2GESA 4BZPA 3U7FB 1PLLA 5B30A 4WZBE 3QBVA 1JPNA 1TUEA 5BYKA 4ZI2A 4TYPA 1ZNWA 2Q6TA 4QHSA 1MOZA 2AFHE 2X2EA 4KJZA 4AKIA 1MKYA 5KDLA 4ESVA 3AVTA 1TL7C 1N5LA 2V6IA 4YMVA 2FMXA 4M8NE 2K5UA 3TW4A 2ZROA 2GF0A 2YJTD 3DMNA 1ZD9A 3SC3A 1FQJA 4NYIQ 2GILA 5L3VA 5F3WB 3VKGA 5KU1A 5FPHA 5C46F 3CRVA 4OHZA 2MSEB 4OQLA 3ADBA 4M1KA 4FWIB 2I4IA 3CNLA 3KXIA 1YR7A 4RZ2A 2IUTA 1Z0DA 3UWKA 1R5BA 2BIFA 3EIEA 4G01B 4DEYA 2ERYA 2WM9B 3KDSE 2QENA 3BORA 1OFHA 3HDTA 4IEIA 3IIJA 2XZPA 4OQMA 5KPJA 4QGGA 3H84A 5D3MA 4UNRA 2FEMA 1HT2E 4BFVA 5FPYA 3GEIA 5A5GA 3THWB 4WIAA 1TQ4A 2Q21A 5KO2A 2B8TA 2CLSA 2V6JA 4ZIRB 3CH4B 2WKRA 1VHLA 1WRBA 2PZEA 1ZVQA 1BOFA 2IHBA 4L9WA 2ZRCA 3QVUA 3BOSA 2LKDA 4OI1A 1XDBA 2QEQA 4URVR 2DYKA 2LWIA 2F43A 3NEYA 2EQBA 2OM2A 2NO0A 2DFTA 4PSAA 4GMDA 2IWRA 1AGPA 1QZXA 2AD5A 4BRUA 4NYJQ 1TTTA 2PZGA 2R6FA 1Z0FA 1KIMA 3ZZUA 5L3QB 2WJJA 5FBWB 2CEAA 3TNFA 1DARA 1YVDA 3GJ8A 1AKYA 1YRAA 1OXVA 1E2MA 3FTQA 1IQPA 1UADA 2ZRAA 3VU9A 4N1AA 1W0JA 1YU9A 1F60A 4DZZA 3R9XA 4ZI3A 4B3CA 3D7MA 3EX7C 3T1VA 1D5CA 3O8BA 4FMDB 2BM0A 2C77A 4UNPA 3X1WA 1KGDA 1RYHA 3NH6A 3B1VA 1LF5A 3WBKA 4OI0A 4JVLA 2H57A 1M7GA 2IYVA 3K09C 3QE0A 1V5WA 1VHTA 4QBGB 3FHTA 4WOPA 3BJIC 4D4JA 1T8UA 2QAGA 5AK0A 4KV9A 1KMQA 5FPSA 2GF9A 1QVRA 5H1YA 4X8MA 2O0JA 3PUZA 1VYUA 3RSOA 1YR8A 1GITA 3UMFA 1Z08A 1RE0A 1ZP6A 4BASA 2D62A 2RGDA 4UXIA 3GLFE 4QL3A 3QPUA 5EP2A 3IBGA 1D2EA 1SXJA 4QJ5A 3EW9A 4ARZB 4Z1MD 3A58B 1L2TA 2V7QD 2ODNA 3X1ZA 2BC9A 3KKNA 3OAAD 2GCOA 5LB2A 3F3YA 2IYSA 5LB4A 4KFRA 2YWEA 3U7EB 2JASA 4TSFD 2P3SA 4LHVA 2C2HA 1IJFA 1KJZA 3KXLA 1E4VA 2ZSDA 3C5HA 3QEOA 2ZYVX 4DUGD 5JEEA 1EESA 3RRMA 1OJLA 2XAUA 3OZXA 4DLXA 1J8YF 4G3XA 3L82B 4HAUA 4Y0AA 5HZHA 2NG1A 5KDOA 1X1SA 1LNZA 3GCGA 2A3RA 2GETA 2O8FB 4B3BA 4GPTA 4A8JC 1AN0A 1G17A 2D3WA 3IBYA 4L16A 4DT1B 4D80A 1G7RA 1NI3A 4BECA 1DTSA 2VO1A 1MH1A 2C9YA 4CIDA 2NO6A 5AJZA 1R2QA 4D0GA 2PCJA 1OXSC 1N0UA 4MGIR 3MRSA 2MMGA 2Q3MA 2WWFA 2F1HA 3L0OA 4RJLA 4Q19A 3HR7A 5HKKA 1MO3A 2PEZA 3C16C 4US1R 2BCJQ 2FSFA 5BYJA 5JRJA 3H86A 3VR2A 4QRHA 4OHVA 3B1YA 2G77B 4NCHA 4TL7A 4P4SA 1KZGB 1JI0A 4TL8A 2ZM5A 1SVIA 1S1CA 4JLVA 3FFAA 3GLGE 4FCWA 1ZU4A 2QU8A 1J2JA 3R7WB 4M9SA 4B76A 2ZAOA 3AVWA 1II8B 4GI7A 4U00A 1ZNZA 2RKOA 3T06B 1JAHA 4PPGA 3W3ZB 5IT5A 2HV8A 4Q1AA 3BBPA 4WXPA 5FI1B 1N5JA 4FMCF 2IC5A 2WSMA 3G82C 2FOLA 4AIIA 1W46A 3UMRA 4OHWA 1ONBA 2ZSAA 3MJHA 2CHVA 4EDHA 4Q4LA 3I3SR 3PCRB 4B75A 2GK7A 4Z8YA 2XOKA 4DXAA 1FNMA 4B73A 2VYFA 1E79A 2D7DA 3SQXA 2YNMA 2ZR0A 3MLEA 2PX3A 2V3CC 4DLYA 3C4JA 3GLIA 2GJAA 5GVSA 3BS4A 3N2IA 4URYR 2UZIR 3K9HA 1ZC3A 4UKDA 1NN5A 2FA9A 3A36A 4DWJA 4FXPA 2B7BA 4JT4A 2J7PA 2ANCA 4MYHA 1FP7A 2WWHA 5TB5A 1VG1A 2H16A 1KJYA 2YWGA 2QBYA 2JIZD 3KL4A 4C30A 1P7CA 3PXGA 2QT1A 4AKGA 5J4LA 1U9IC 1S9DA 2WKQA 4HAZA 1JALA 2ZRNA 4YMUA 2WIAA 1CJTC 4YONB 1NN0A 2IYWA 4PTLA 2C98A 3SFVA 2L0XA 1IN4A 2J59A 3RWMB 4BZXA 4Z51A 3K9NA 2FDCA 2VP9A 5ELXA 1RRPA 2VSFA 4GSYA 3UWOA 1EWRA 2B21A 2QP3A 2LKCA 3OEHD 1WB9A 2CDNA 1Q21A 3TKLA 4B3XA 4AYTA 4O2RA 4Z8XA 3OE7D 4NH0A 2A7QA 4HYYA 5BN3A 4PQFA 1DPFA 3GJ4A 1KI9A 3AVUA 3PFIA 3K70C 5F9FA 3CX7A 1NKSA 4M2LA 4D6PA 1GG2A 1ZAKA 3Q7QA 1W44A 4DCTA 5DN6A 3W8RA 4BLOA 4B48A 4HB4A 1XWIA 3RYTC 4RKEA 4IJMA 1F48A 2ONJA 2ZI9A 3MG9A 4OQXA 1KYIA 3X1YA 2IXEA 3GJ6A 3MWYW 2GBLC 4BFYA 4CEIB 3LLMA 4ESHA 2OSBA 1L8QA 3HWSA 5HZKA 5KNDA 1HYQA 2DCUA 5FUYA 5G3YA 2WWWA 3BB4A 2QE7A 5BQ5A 1G3QA 1IY0A 3DM9B 3C41J 1ZINA 2FZ4A 3THOA 2DFLA 2IF0A 3AP3A 2AKAB 3V4RA 3U60B 4BPBA 2VBCA 3VU9B 3D8BA 3K0CA 3RLFA 3D31A 4Q1BA 5EXTA 1DVRA 4ZPXA 1YR6A 1ZM9A 2IYZA 3LXRA 2C5LA 5J4YA 1N5KA 2JGNA 1KI6A 4ZKEA 3MMPA 2CE2X 1LS6A 1TU3A 2OG2A 5CM9C 5LPNA 5DNYB 3AF2A 1P2VA 2HUPA 4YLGA 1G6OA 1VKJA 5DO9A 1XPOA 3B5JA 3MD0A 4MKIA 3A4MA 2IS4A 5SZKB 5FL7A 4QNMA 3DDCA 2F6RA 2VTKA 4F38A 5H8WA 4QFMA 2AKYA 1E0SA 1KMHB 3AH8A 1NMYA 5G3ZA 1Q1EA 3BFXA 4E5UA 1IN8A 3WMEA 2IL1A 1XXHA 4B6FA 5DLQC 1AKEA 1NN1A 5FOXA 4LSGA 1OXXK 2G1JA 1VG0B 1C4OA 1XNJA 3PV0A 2QMEA 1BYUA 2EYQA 2BVNA 1I4TD 1KO4A 1W0JD 3CO5A 3EIHA 1E2NA 2HYDA 3IKJA 1X8LA 3LRPA 4B6EA 4GMXA 1CBUA 4L9SA 1EXMA 2VSOA 1T3LA 2Z83A 4C0SA 1XZQA 2DFKB 2ATXA 3QKSB 3K0FA 2KBEA 2JJ1A 4LBZA 2NOAA 1NLZA 1CKEA 5FOTA 3L2OB 3BH6A 1UFQA 2QTHA 1E32A 4RD4A 3KZ1E 4JT2A 5J4VA 3GMTA 1OXTA 2J0UB 4D4LA 4YQFA 4XTRA 1XJCA 3HJNA 2QT0A 4URZR 2VRWA 2QM7A 3LV8A 1RZ3A 1AGRA 1SKYE 4EAQA 2C96A 4EFNA 2JJ2A 1TNDA 2VH5R 5DHAA 2JLYA 1SXJE 3OHMA 4BFUA 4U7DA 1P2SA 2UKDA 4LJ7A 2GTPA 3PUVA 4E22A 3A4NA 1OYWA 1Z28A 3SQWA 4AI6A 2AK3A 2P0EA 4CEJB 5D3QA 1NSTA 1XMVA 1HUQA 2CLDX 4HZUB 1UBGA 1ZM4A 2OO7A 1NVXQ 4ZO4A 5UKDA 2OCYC 4K81B 3CX6A 4FMBB 1OH5A 1Q44A 1W36B 1AS2A 1UAAA 4P4SB 1N6KA 2WV9A 3OIWA 4OK6A 1P75A 1CU1A 2R6GA 2ORVA 4PHGA 4MITA 2VL7A 3SJCA 5H68A 2GNOA 1U0LA 2OBMA 3NG1A 4DDVA 1T5IA 2NO7A 4NCNA 4URUR 2VLIA 1R0ZA 1Z6YA 2OAP1 4YDHB 1W1WA 5KOYA 1E0KA 2O8DA 2VHTA 1K5DA 1Z6TA 2KWIA 3PEUA 4UQOA 2G88A 3UKDA 5FOUA 4FCTA 5P21A 1GNQA 5FTKA 4BFWA 3KUDA 1CJKC 4MRNA 4DLZA 1G1MA 5J47A 4QBIA 1S3SA 1VG8A 4Q7MB 3RRYA 2Z5FA 2DWOA 4J0QA 5EE9A 4RFVA 4HB0A 4L8GA 2CL7X 1BIFA 1KY2A 2NQ2C 2O0KA 4A15A 1QDEA 4YMSA 4LI0A 4QBFA 4GNKA 1V43A 3VX4A 1KKMA 3SZRA 4KBGA 1KDRA 4ZDWA 3T5DA 3K09A 4PSVA 1NP6A 1E1QD 1GM5A 4P4TA 2ZI6A 4HI0E 1HURA 2H17A 2ZRHA 4HB3A 2REXB 1A1VA 4PX9A 1TQ2A 2IYXA 3W5JA 1MO4A 3AGQA 3GFTA 2FGJA 3B82A 2H5EA 4UNQA 2O8BA 2G6BA 4LZZA 1IAQA 3QKUA 4ERNA 3GLIE 4MRRA 2A30A 3LNCA 1KOFA 5FR2A 4RKFA 4LHYA 4KSBA 2QMOA 1KZ7B 1KAGA 1GKIA 1Q12A 3WYGA 1E79D 2X19A 4ACAA 3WYAA 2WSSD 3R20A 2NIPA 3SJZA 4LJYA 3KQNA 1E9BA 2IUSA 2CVFA 3DPUA 4W5HA 4TMZA 3MWJA 1FP6A 2DFNA 2FF7A 2AXNA 2WJIA 4G0NA 2VSXA 1IXSB 1LFDB 3QXHA 1U99A 4TMKA 3KQKA 2XB2A 1OIVA 2YKGA 3W9YA 3A1SA 4AG6A 2VP5A 1X6VA 2PLFA 2C03A 1U81A 2RGXA 1UM8A 3BH7A 4QOSA 2ZITA 3I72A 5FBLB 3I32A 2I1QA 2XX3A 4RFSA 2QGZA 4TN1A 2HDNB 3MCAA 1G3IA 4A8JA 2GAAA 1ZIOA 1NRJB 4OQFA 2ZRBA 2P5SA 2ZJYA 4GOJA 2ZPTX 1QHIA 4QC2A 1YZLA 2QPOA 3K9LA 1LW7A 2V7QA 4LRWA 2V54A 2D4HA 1KI6B 3OAAA 1CR4A 1E9RA 2R6AA 1HE1C 2DHRA 3LD9A 5DN6D 4TSFA 3M1IA 1US8B 4DLTA 3HPQA 1TF5A 1OFTA 5TVKA 2WWYA 1N6LA 5EJEA 2KE5A 1BO6A 3I4LA 4G5GA 3B7GA 2OE2A 3PEWA 5K8IA 3T1QA 2LCFA 4C0JA 4LCBA 1KI4A 3BFKA 4XD7D 1HY3A 1SHKA 5G40A 1XTQA 1E4YA 2ZE7A 3ZVLA 2BHRA 1NG1A 3W6NA 4DLVA 2OLKA 4QM6A 1E2PA 2QE7D 4PPNA 1E2JA 1XXHB 1ZUNB 2ZQ5A 2QY9A 4UNNA 5KPDA 1A4RA 4NTZA 5DI3A 2ANBA 2GJKA 2ZUDA 2QTVB 3Q3JB 4B2PA 2IW3A 2QUZA 2WMNB 3K0FB 2ZRKA 5CLQA 5TDHA 4PSKA 5JZVA 4TT3D 1E9FA 1E9AA 1P9RA 3LVRE 3U4QA 1E2DA 1ZU5A 1E2EA 3EA5A 1IJEA 3IHLA 3QF4A 2YOFA 4GBMA 4C0BA 2HCJB 1T4GA 4PAQA 1P73A 4LWZA 1E9SA 1NLYA 3LAWA 4P32A 3ZQJA 1KI8A 2W00A 1KK0A 5DISB 1CR2A 5FL7D 4L5BA 3PIRA 4LK2A 1U9IA 3U3OA 3C8UA 3EWAA 4FMDF 5FBVB 2ZIAA 3WYFA 4I1SA 4A9AA 3M0EA 1SHZA 1NSFA 1U8ZA 2OCBA 2XEXA 1LS1A 4A0FA 4HAYA 3P32A 3BGWA 2RGGA 3HP1A 1GRNA 2XSZD 4HUQB 3BIFA 3TUZC 2I3BA 3T1TA 1W2HA 1QHHA 1CRPA 1T8TA 2MSCB 3GQBA 2RGBA 4XVRA 1RRFA 5FUWA 3NDPA 4Q7JB 3NBFA 2RGAA 1FUKA 5TY0A 1OPXA 2OCAA 4B47A 2JIZA 1ZC4A 3B8HA 4HATA 1QG4A 2OZEA 4KYUA 1RW4A 4LX0A 4PO8A 5DYIA 3H1TA 1KY3A 2G9NA 3DKVA 2GBLA 2H8KA 4IDNA 2IYTA 1E2IA 1M7BA 4U5XA 2IWHA 2IX3A 1P2UA 4LHWA 3NWJA 4D0LB 2ZVQX 3ICQB 3CPHA 3IQWA 2B6HA 5JECA 2JLQA 4KI0A 1YZQA 3W5IA 3OEHA 1Z83A 4V0KA 3CH5A 2FFBA 2W83A 1CTQA 3WMFA 2ZRJA 3CKLA 2P5TB 4JLJA 5KSZA 3QEJA 2O0HA 4QGHA 2GCNA 4TMWA 621PA 3KFXA 2ATVA 3MFYA 4H9GA 5EE0A 3BFVA 3WXMA 3EG5A 1G9XA 4EPRA 2H18A 4E03A 5FH9A 1ZNYA 5JI3E 4JLKA 4YC7A 4D81A 4MRPA 3DMDA 1F2UA 4QBHA 4JZKA 4A2WA 1IY1A 1UEJA 2XB4A 1XD9A 4XWAA 4PZLA 4Q4HB 2AL7A 1E3MA 2OESA 1UKVY 3CPJB 1YZUA 1JR6A 3U7HB 3SYKA 1XZPA 2Q3HA 3RANA 1X8KA 4URWR 5K8TA 2BKUA 1FOEB 2ECKA 3FE2A 1B23P 2ZR7A 1KJWA 3RS3A 2ZAMA 1O87A 2ZYUX 4XWKA 2BV3A 1XJQA 3MGCA 1YZGA 3I8XA 2KB0A 1CLUA 2YOGA 3GD7A 1W4RA 4TYWA 1GKUB 3VNVA 2BM1A 4L15A 4BLPA 2AWNA 1MABA 5JSZA 4UJ5A 3V9PA 3GJ0A 1NKTA 3LO5A 3DO6A 1YHNA 1M7HA 4IDOA 4GDFA 3HYTA 5IDVA 1XPUA 3IEVA 1RRCA 3AP2A 4UXHA 4JMPA 1TEXA 2EFHB 2OBNA 1XD8A 5SZIA 4LJ5A 5ANRB 2J41A 5TARA 1NVVQ 1XTIA 1S4QA 3Q72A 5LDDC 1LB1B 4KLZA 5CJPA 2QP9X 1G3UA 2C95A 1I2MA 3WP1B 2WWGA 4WW0A 2WAYA 1OB5A 2GEUA 2ZI5A 1YZTA 4DCVA 1G20E 1Z22A 4RFSB 3NC0C 2RH5A 4RD3A 4B71A 5AWFC 1C1YA 4BRWA 2D7CA 2PEYA 1CJUC 3AV0B 1AA9A 4OK5A 2GZAA 1A2KC 1ZJ6A 3QG1A 3WP0A 4PXAA 2CMKA 1A2BA 3R8FA 4TZ0A 1ZRHA 1F2TA 3GLFB 5HR5A 2FFQA 3HYRA 4A6XA
chains in the Genus database with same CATH superfamily
1PFWA 3HR8A 3PHLA 3ZDEA 4EW2A 4CCYB 1B00A 2XNKA 1F6BA 3Q0TA 2WM8A 4QSMA 4R8MA 2LZ0A 4RUKA 4BQIA 3UATA 4YRMA 4ZT3A 1QRDA 3TL6A 1TZKA 4RZIA 4O2AB 4CF3A 3Q11A 4UW9A 4ZCSA 3C4QA 3KJIA 5B1EA 1PNOA 1HV8A 1AHHA 4TYQA 5FL3A 4NYMR 1W4CA 2DTEA 2VCEA 3MPOA 4RAQA 5DZSA 1E2KA 3AOEC 4QX6A 1Y42X 3A6KA 2RBKA 4EB6B 2W8ZA 3QVGB 3AX6A 3BK7A 4Z7OB 2V5VA 5BMVF 1ZCZA 3L7BA 2V6MA 2JANA 2W6QA 2P78A 1V26A 4HEA6 1XKTA 4BKQA 5EFZA 1EK0A 5AR1A 4R0MA 1MZPA 1YQ9A 1J21A 3KHKA 3VR5A 2AEMA 3JD0A 4XXHA 5B7NA 5FFMA 3CZQA 3T38A 3DO5A 4FM9A 1YIOA 4C7XA 2EZ9A 2RHWA 5DI3B 4QODA 4ZT6A 4EI7A 4HDMB 4NU8X 1OYYA 2CKDA 5KTOA 1L7VC 1YQEA 1JQJC 2N46A 2ZSUA 4G67A 3ESCA 3IKMB 2OGSA 1KOLA 4PPQA 1D1PA 1SXGA 1HE8B 1X39A 3IEIA 1E0JA 3RHFA 1SVMA 1IUPA 4ZN6A 3REQB 2HCBA 3KLPX 1W49A 3NAGA 2A9PA 5TIIA 1PDOA 2Z09A 3GWZA 4JLMA 4LY9A 2Z56A 4Q9HA 2IV2X 1JSCA 1QLWA 2HFJA 3CLSD 3N0VA 4L7QA 4RJKA 4C2UA 3KD2A 1JSLA 3ANXA 3HSKA 3GDFA 2DHQA 5JLJA 1KAOA 4OIMA 1RZUA 3ROMA 2C8JA 3M33A 4L5JA 1U0HC 3BEDA 3EASA 4PZEA 1JEEA 3BWVA 2ZRMA 2ZVPX 3IEUA 3ZWKA 1NI4A 1UBJS 2I87A 3QPVA 4L57A 4XUDA 1DEAA 2W2LA 4AT1A 3KZCA 4KE8A 3D2BA 3OWXA 3C4VA 2OXTA 3V4SA 4G4GA 4ME6A 2NVUA 5BWLA 1JKJB 2A9KA 2OL4A 4MQLA 1PFVA 3K1TA 1ZRNA 4YP6A 1KYYA 3WLIA 1SKAA 4RYDA 4DQDA 4EJSB 5KNCD 2RJNA 3DE6X 3L18A 1VE9A 3GGOA 2BR4A 1QPZA 4ZI7B 1DBVO 4BWYA 3QY9A 4IIJB 2IA5A 2Q4BA 4YFYA 4MUHA 2QNBA 4C22A 2PDAA 3Q0EA 2YDYA 4B84A 1GLGA 3K0HA 1Z13A 1W0KD 3ODGA 4LJRA 1B93A 5JTUA 1QH9A 5KYXB 3NU1A 5DCWA 1SG9A 3ZWCA 3UV6A 2XZOA 1NFQA 3WHIA 4PAGA 5CM8B 2BM8A 3DOUA 3SFTA 3WWZA 5C8DA 3SS9X 2GXAA 8MHTA 4A23A 1E59A 3I0MA 3T7CA 4CIXA 5H16A 2ZE6A 3A9TA 3NRBA 4MKFA 4JT8A 2QY6A 3WIUA 1RXSA 3MVEA 2IEDA 4S1NA 1VMIA 2Z8ZA 1OV4A 4FQ5A 7ADHA 4MKHA 2C4WA 4MJLA 3VM6A 3I6YA 3IOBA 5E6SA 4ZDKA 3BC1A 4HLUC 1XJ0A 4PG6A 4A5SA 2J6CA 2PZKA 1QGAA 2XADA 2Z0MA 3DBHB 5CT6A 3DQQA 1QF9A 1BDIA 1FC0A 2Z5LA 2J8ZA 2VWHA 3KFVA 2J6IA 2V8OA 4EI9A 2QD4A 4M99A 4IKEA 1PWXA 1Y3FE 1Z34A 2VNJA 2C99A 3FFBA 1MAUA 4XRRA 5ALGA 3DTVB 1FDRA 1YR9A 3WFZA 2IU4A 2HRBA 3PC4A 3NHUA 2IPMA 4N12A 4N9WA 1YRWA 4JJGA 1GL6A 3C3PA 3T8YA 1RRMA 2JRLA 4R1UA 1OXUA 2YIDA 4TQGA 3WLPA 1MENA 2DT8A 1C29B 1OE0A 1WE2A 5ARBA 1LWOA 5CB0A 4NCAA 4YXWD 4DGQA 3BX1A 5CFNA 2Q9BA 3HJTA 2AC7A 3GJ7A 5F98A 4P86A 2VQ3A 3SF0A 3T0GA 4OIFA 4B7AA 2ID9A 2GK3A 3UQZA 4FFDA 1WW2A 1QQ6A 4DQLA 4LX8A 1W75A 1Q17A 1VE3A 4QSHA 1GL7A 3O95A 1GRCA 4V03A 4K9QA 5JI3E 1E77A 1RWBA 2XWPA 3AM3A 4MINA 1XTSA 5AW5A 5M3BA 1XDSA 4U39A 1QQ5A 4V0QA 5D3MB 4MV0A 1GNTA 2OORA 2HBYA 1NU8A 5GINE 1YC2A 4UTXA 1ZK3A 5TT1A 4NYMQ 4NJMA 1NBME 1XD2A 1JQAA 1A2QA 1QMPA 3ONWA 2BMWA 3AESB 4LCJA 1XX6A 2BGKA 1M2OB 1U1EA 1HQDA 1CY7A 2HX1A 3E2IA 4MA0A 1MJGA 2YXPX 4BLUA 1X1RA 3W90A 3JVVA 3REFA 4N3NA 3A04A 2YWFA 3PJGA 5AKZA 1J00A 4E7PA 2NXJA 1MO6A 1ECPA 4K9DA 3EXEA 3T1HB 1JR4A 2C7GA 3CJQA 1G8GA 2Z8XA 1H0RA 3NXSA 4P4UA 1DIBA 1G18A 4J0EA 1W0CA 2PJZA 4W7SA 3BD9A 2WZCA 4R68A 5JH7A 3H7AA 4N7JA 5A02A 3LNTA 2VKTA 1Q77A 3Q3GE 4LFBB 3IAS1 3G13A 1LK5A 2BFDB 2BJHA 2DPXA 3H9JA 3OMLA 4XARA 1V8FA 1HYBA 1BXRA 2BFCB 2C78A 1V1MA 4RVOA 1NF8A 3PQEA 5FUVA 2JDID 3GJSA 1E7SA 3SDSA 1G64A 2X4DA 3K9FC 3F6SA 3PQ5A 1JXQA 1UPAA 3BSFA 4Q21A 5B1IA 2OXCA 3L7DA 3O8CA 1A9OA 4ETMA 5MFZA 5AYVA 4DNQA 1VKRA 4MVJA 1QS0A 1DKLA 3UH1A 2X8LA 3FNQA 2OXRA 5ECDA 2C3UA 4CYMA 2Q07A 3I8SA 4JSRA 4ZYUA 1M6EX 4G0QA 1BTOA 1Q57A 1W59A 1Y1RA 3OZEA 3PK0A 4TT3A 5DT9A 3L7OA 1OTHA 1T9ZA 3E15A 1N75A 3AVVA 3VAAA 4YCCA 4WEQA 3WLHA 2J3QA 1R64A 2QN8A 3Q2OA 5B57C 1AZWA 2BISA 3SLGA 2Q5IA 3CWQA 3JAKA 5COAA 5EWJB 5C53B 3CSDA 2QSZA 3AVQA 5HOEA 3B8EA 2FG6C 4BKRA 2FEWB 2PUBA 1BFKA 3IDZA 2QAGB 2X9QA 3CB2A 3IDAA 4B4VA 4O4HF 5B53A 5B6IA 3ADDA 4PZUA 3U3KA 3IUEA 1QIHA 1EGQA 3IFSA 2H3EA 1CX9B 4B83A 4R1LA 1HFEL 4N49A 2QQ5A 5EJ6A 3A6PC 1RQGA 4IQ0A 2HLDA 4LMBA 3W79A 3ZS9A 4R9SA 4J16C 4A5OA 1YQWA 1RYBA 1WUJS 5HQJA 3RRBA 1NJ2A 4PX5A 5D51S 3WGLA 1TVKA 2GCOB 3L6CA 1GGFA 4XIGS 2XUJA 2WR8A 4Y18A 4YBZA 1B4DA 1Q1ZA 4O8ZA 3C3MA 4CF6A 2UVDA 1PSZA 1XBTA 3NWEA 2BI7A 5HKBA 2TYSB 4MK4A 6PFKA 2NSDA 3AKZA 4ERXA 5HE9A 2XKJE 5TXGA 1OBOA 3G9QA 3MWLA 3IGFA 1RD4A 2NTYC 4JYPA 1QYIA 3LFHA 3Q4GA 4BQSA 4RMGA 1NI4B 3B78A 3SHTA 5J4KA 2C8VA 3R3SA 3ZXSA 7GPBA 4REQA 4X1YB 4JVMA 5IM4A 4ZCQA 3HB1A 4BDTA 2YUIA 3EVEA 1UK6A 1GCAA 5GADl 5FD8A 2IXAA 1PCXA 1POXA 5GGXA 2ZXUA 1GAEO 1HZJA 4RADA 5FAXA 1WHTA 4ZRDA 2P6RA 3EHDA 4UTPA 3TRDA 1SUSA 4QJ3A 1TQ8A 5AXBA 4B7XA 3LGXA 2Q49A 1VGQA 2P2LA 3ED1A 3FKQA 4OK3A 2HF7A 3QBTA 4GOLD 1PRYA 1IJBA 1OMOA 1VE7A 3QLVA 4WLFA 4OSEA 2WWVD 4KR6A 2FFRA 4BQOA 1BVHA 2P3OA 4QG3A 3VA7A 4COOA 5K0FA 3A7EA 5A4JA 4NJEB 3AEZA 5CBPB 3MT8A 5I7AA 4QO7A 2A33A 1YKSA 1NATA 3CEHA 4R6XA 2XUAA 3D3EA 1JDTA 1LJ8A 2F9LA 3BCRA 3PLNA 2XJ9A 3VR6A 3EVGA 5AVQA 3QE9Y 4ACBA 1YTUA 4A36A 3P9PA 2UXCB 4RVFA 4KTTE 4ZC8A 1BS1A 3R6TA 3ISJA 4FD2A 4FEEA 1NJFA 4H3KB 2C9MA 2GGSA 3IIKA 4DXHA 3DMTC 2GHIA 2WFMA 3NS7A 1TKRA 2PXCA 4I3HA 1GTG1 1CRQA 1EBFA 2V7TA 3K1ZA 4K05A 2JLXA 4G2TA 2Z58A 3D3NA 3II6X 3S7ZA 2YY6A 5C4IA 2PX2A 1FNNA 3JYNA 4C03A 4E31A 4V0OA 3FGOA 1HT3A 2VDQB 5FA5A 5I47A 1MD9A 4EB8A 2O3SA 1ZUHA 5CDSA 3EG9A 1N2EA 2FOXA 4WZAA 1GZUA 3OESA 1KSJA 2ZIWB 3OCZA 4L6CA 4YMTA 2QBYB 3KC2A 5JAPA 3OT5A 1XP5A 5JZBA 2X13A 4X1KA 5FO0A 1K86A 2W71A 1H05A 3KQSA 1JYSA 4WCVA 5TMDA 3CM0A 1JR3D 3EEQA 2N75A 5EIBC 3EFOA 3H3XA 4NBKA 1SZPA 4AO7A 4GEKA 2BMJA 4KGDA 4TRNA 5D1NA 3ZWBA 4N0DA 3V1MA 1DBWA 3LIIA 3W6UA 1M6VB 1QR2A 5C8ZA 4I99A 4FCVA 5HJ7A 5JZOA 4RJ2A 5EJ2A 1FNBA 3IQDB 2AMYA 4LY0A 5ARDA 5HDBB 3TSZA 3TTTA 1NYLA 1QYXA 1KDOA 3L1IA 1V3UA 2YHIB 4MW1A 3OF5A 1AO3A 3PP8A 4EMTA 5AUPB 1JFTA 1VZ3A 3WYNA 1A5ZA 1OF1A 1XD2B 3CLRC 4UMDA 3JZAA 3OOHA 5JHGB 1ACMA 2JLWA 4QO8A 1XZEA 3VSAA 1COWD 1S2DA 1T43A 2ZI7A 4Z3DA 3TH5A 1BH2A 4X41A 2WHQA 5BWCA 5JYEA 2A86A 1QYDA 1SCIA 2GXQA 4MRVA 4M7RA 2EBHX 1NBAA 4ZT7A 5A9SA 3KQUA 3LWNA 3GLVA 1FMJA 1WL8A 5DW3A 5AK6A 2ZJZA 3CU5A 2Y8EA 2OY0A 3R5FA 4CF5A 1I4EB 4GI1A 1J99A 2ABWA 2OV6A 2VF7A 2WU4A 1C1HA 2ZJAA 1VJDA 4NQRA 2XCRB 3ZDAA 2J0VA 3CKYA 4FILA 4BNJA 3PCTA 2XUOA 3RS7A 1M9NA 4WINA 1UINA 2W2KA 3T3IA 5C81A 4H1TA 4JJ7A 4WZZA 5JH7B 4K9NA 3WZLA 2BBSA 4MAFA 5MDHA 3QE4A 4P6VF 3QYPA 3OIYA 4ITUA 2RHHA 4AC9A 4DLRA 3HVHA 1ESNA 1N0IA 1V1MB 2JGAA 3GRVA 3OD1A 4YJ3B 2A2ZA 1IN5A 4NMWA 1VHWA 4V39A 1X7ZA 4LC0A 1G0NA 1AG9A 1WUKS 4HGNA 5JT1A 4QGSA 3EE6A 4LXGA 2GM4A 1EDOA 4U9IS 5JJIA 5BY2A 1VL1A 1W85A 3H1EA 3DB1A 4INOA 3HRHA 4II2A 3E8MA 1O95A 1V39A 2FXVA 3F5DA 3H8VA 2TSYB 5AFSA 3PRJA 3EZXA 3IVGA 3FHJA 1U9JA 2WJHA 4HK4A 3MJFA 3WK5A 3ZD6A 3MS4A 4EJ0A 2WVGA 3O82A 1T2NA 5F5XA 3CW9A 2OV3A 1S2MA 3EZ9A 3DR3A 4EUFA 5B1DA 4LGCA 1UBOS 3TD2A 2I8CA 2JCSA 4AVYA 3G1UA 4AULA 2ZCUA 2W4IA 4G1FA 1L7XA 3PHBE 1GEEA 4R9VA 1JQKA 4E09A 5IBPA 1HM5A 3ANYB 5A5VA 1KJ9A 1I6LA 3M6XA 4Z9FA 2XZLA 1ZHFA 2XF2A 3ZLJA 3AEQA 3GFVA 3KV1A 3S55A 1A76A 1H1DA 3BF8A 5DASA 2QN9A 2XVZA 3H05A 5DIZA 1V6AA 3VC7A 2PXXA 4JVOA 4YJDA 3IBCA 1J8DA 4NAHA 4P5DA 2HRQA 2IYRA 4J49A 1JG7A 3TSWA 4MICA 3CXUA 3H19A 3KB8A 1E9CA 3PC3A 3S1AA 3VV3A 3OQMA 2OCXA 1JEQB 5E9QA 2ORWA 1ICEA 1SWVA 3DMHA 3GXBA 4MA4A 4R9NA 4UQPA 3AJEA 1GSAA 1C9KA 5GJWC 5KNCA 2RD2A 1ZGGA 1NVVR 2QPAA 4J91A 2BKXA 4OHUA 4RQBA 1WXWA 4TQ9A 3V8QA 3GP8A 4D9EA 4WK6A 4G85A 4EFMA 3T12A 5ALFA 1EP1B 3FHOA 1UBUS 1E58A 1W0KA 1QP4A 3F9IA 2JPDA 3KB1A 4Y2RA 3M4YA 3UEOA 1ENPA 1PSDA 1H5NA 2R84A 1K8RA 3EARA 1MPXA 1AQJA 4RCYA 2CW5A 4BMYA 4CLRA 2CLFB 1GZVA 2UVPA 1LC0A 2VP2A 3A4YA 2HO4A 4I2VA 4JB3A 1FSFA 3TLEA 4GZLA 4PLPA 1XQXA 4JI0B 4LNUB 4XA8A 1T8SA 3E84A 5H80A 3NAMA 5I5EA 4Q16A 2ISCA 3GVHA 2DQKA 3G59A 3DA8A 1NLFA 1YDGA 1I3MA 1XZLA 3A4TA 3E5HA 2A78A 3GRFA 1U6KA 4IV5A 3T7TA 5IK2D 3IVAA 2IX9A 1A9PA 1YCGA 1I0LA 2R44A 2VK4A 1FJHA 1XZKA 2BBTA 3B9QA 4I1YA 4K40A 4V3BA 4D4GA 1TQ6A 2W2OA 1IRIA 5K3CA 4WEOA 1C9YA 3BSSA 1C81A 1EQ2A 1E3EA 1U1CA 2DTDA 3HXOA 1RHJA 2XMZA 1Q16A 1Z0IA 5EJ4A 5CNIA 3ROQA 2H11A 1WZNA 1R5JA 1YSCA 4DAOA 4EIWA 4Q7QA 1BDMA 1E94E 1NR1A 2Q1TA 1N7HA 3R24A 1E3WA 1CJVC 3G88A 3R44A 3VTAA 3DOCA 4R3NA 3DLIA 5J63A 4F96A 3SJ7A 2POCA 3TTWA 4UFOA 1P17A 2WUDA 4PM4A 4WBXC 2QMHA 4A1OA 2QTNA 3LCVB 1OZAA 5FA6A 4HJXA 3LQ2A 4YXWA 2I2AA 2PCLA 3QHPA 3KJZA 2YASA 3ET4A 1O6ZA 1E18A 1YDFA 1Z25A 3MTIA 4JVNA 5K6AA 1SCNE 1UDWA 3C3EA 1C3JA 5DGCA 3DYIA 2ZJOA 1NJ6A 3OPVA 4BBJA 2O8DB 1USGA 3SX0A 4LOKA 2FPGB 4ZVOA 3C7TA 1U4SA 4PGAA 1KP9A 2BEVB 4IIVA 3W8NA 5EJ7A 5J43A 4UD2A 4B3RB 2CL0X 2VEOA 4QNNA 5BNIA 1JU4A 3ASUA 2IDKA 4OQYA 1N1EA 1Y3IA 1UC4B 3ND8A 4R1NA 4OLAA 1BHO1 5JVDA 2F7SA 2PQ6A 3SM3A 1SMKA 2Q41A 3FWZA 3INYA 3VNSA 1V8BA 1KO7A 4CDGA 1VCNA 2RGRA 4LUCA 4Y6GB 2F1IA 2B2XA 4WLEA 1PTKA 1G8AA 1MDFA 1L5QA 1WNTA 2PXAA 2VTDA 3K71B 4QYIA 3KYCB 4FFRA 2IS6A 3KB2A 4AN1A 1G7SA 4QIHA 5EL0A 3IURA 4FFVA 1H2AS 4WZAB 4QYWA 4FHGA 2F1JA 1BWPA 4FFOA 4EY3A 2XW6A 5JDCA 1YUNA 2JAHA 1UT5A 4WFJA 1WLSA 2VHCA 3RPEA 1U8AA 5AI4A 1VLQA 2VA9A 2WTXA 3QK7A 4K9LA 5DLYA 1IN7A 2JK0A 2QNRA 4UVIA 5G4KB 4ZI7F 4IIJF 1PJTA 2VHJA 3CT6A 4RK7A 3WSVA 4C06A 3EWSA 1KE2A 4YJHB 3ANLA 1CDOA 1CQJA 4QPCA 3LF2A 4Q5IA 5C3MA 2ZSEA 4EG8A 1TOAA 4FYIA 4OHYA 4EJFA 1TAHA 2JDIA 3SC2B 2YIVX 1U0BB 2PS1A 3R5TA 4C2AA 3BMOB 3DOFA 3KP1A 4J1QA 1G20B 2H8GA 4PBSA 4QOJA 4RS3A 2GZDA 2X14A 1G19A 3EEFA 3L0YA 4TL9A 2XGMA 4WACA 1QKIA 4B81A 4DLSA 2AG1A 4WZAE 2E0IA 1ECBA 4BKUA 1HDEA 2E48A 4TYNA 4R69A 3MHTA 1NLUA 1MV5A 3IDQA 2JA1A 1SC3A 5J9FA 1ZH6A 2VRNA 2AX4A 5LU8A 4DS3A 2BDTA 1G41A 5F3RA 4D82A 4Y1GA 1F7VA 3P4UA 1E1CA 2C04A 1JZTA 5BN5A 3OOSA 1E1MA 4S35A 1UMCB 5D2CA 5F21A 2RBEA 2XIQA 4G5SA 3PUJA 3EZYA 5KJ1A 4A4DA 3ELUA 1GR1A 4GQIA 5AO9A 5K0ZA 2GZSA 1T6YA 4RO0A 1F3LA 2FPSA 2BGGA 1XAGA 5LBTA 5LM3A 1M0WA 1CULC 4F9GA 3G5AA 1FYEA 1SUAA 4IIBA 1F8FA 4OGLA 5IKPA 3DEHA 2GN1A 2PPLA 3TGPA 2Q4DA 4CFYA 3CCBA 1W85B 3I3OA 3IH5A 3NM6B 5LR6A 1G5TA 3P9KA 1MBZA 4DSOA 4B4DA 4J29A 4L02A 5IEJA 4RLQA 5I9SA 3HV2A 3M6AA 2VZ9A 1QJ4A 2WD8A 4M6WB 1W9HA 2GZHA 3WNZA 4W82A 3UHFA 5CGZA 4UAGA 1NU6A 3NYIA 3WNDA 1IHPA 1SZDA 4PHHA 1BCRA 5ALNA 3EA0A 1WEHA 5LLTA 1XAJA 3KDAA 1AKNA 2G8LA 2Z4SA 4QUGA 4RD1A 1CC1S 2I5PO 1ZJYA 4UAJA 4TTPA 4HAIA 5DRYA 3OQNA 1DJPA 1OYVA 5LMUB 1I3OA 2VXBA 1WCIB 5FOSA 4YO7A 3N0TA 3TNYA 1MHTA 1RYNA 2E7ZA 2H00A 2J0EA 1EAMA 1JHMA 3SYMA 3PLRA 4N9QA 3SHVA 3HPRA 5IKMA 2RG7A 3NCHA 5EMMA 1X7GA 4F84A 3FWHA 4YP1A 3BPSA 1O9HA 3E4DA 3S1AB 4Q9KA 1JHUA 1A9TA 4R51A 1B1CA 2V0GA 1EFPB 3VJRA 1MNQA 2F3RA 4XFJA 1WD5A 2ZE5A 2C9CA 3AFHA 1NVDA 4ZD6A 3VHQA 4G23A 2YN2A 1D0VA 2FYTA 3NDRA 4FUTA 2BFFB 1U7UA 1ARZA 1SCBA 4LDPA 5CTAA 3TJRA 4BBAA 4OPMA 1LRKA 2OB1A 3E5MA 4DMMA 3YASA 2IZ0A 3NTLA 3ECAA 2BMDA 1IDN1 2H3HA 3ZXUB 4YYZA 2P27A 3AR8A 4MNTA 4QASA 1NX9A 1AHIA 8LDHA 3WLSA 4PU0A 3ZX5A 3DFUA 1U3FA 2G09A 2WOOA 2C4VA 5KS2A 1FBTA 4M0EA 3TDKA 1U7PA 1MORA 3STUA 2NTEA 1SVKA 1QAOA 3JQGA 4XX0B 4PYLA 1XRLA 4BGDA 1PJSA 1GYPA 3MUFA 3JQ9A 4WD3A 3E6AA 5AVWA 2AF3C 3K53A 4TZ0A 1ENOA 1Q84A 4A0SA 2XCIA 3HY6A 3QX9A 2IEBA 4M0MA 2AF4C 4W1QA 1J7KA 1U3TA 1MVOA 2FSGA 3I42A 3P2OA 2JGEA 5DX8A 2AVDA 4RU1A 3FOCA 1HEIA 2QRMA 3ENQA 4NI5A 2OV2A 3QI2A 4FUQA 2VA8A 3WWDA 1ZBDA 2ZYDA 1DG3A 1O77A 1G5QA 2BLNA 2GFHA 3GUHA 4HGYA 4F11A 2E21A 4KOAA 1L5GB 5KQGA 4CZ2A 3MW8A 5CNJA 1FJGB 1QHHB 1T26A 4NARA 4XD2A 3LKVA 1S5PA 1BGXT 1I2BA 3GQBB 3L6UA 4LWPA 1RKUA 4FGLA 1QH8A 3B6ZA 3D0KA 3I2IA 2NUBA 3KTFA 1XA3A 4IDHA 3RJ5A 1T9HA 4BLTA 2VF5X 3EQ6A 5L4NA 2GX6A 1JFFB 2B4QA 1DZIA 2H5JA 2Q6KA 5LNK1 2VK1A 1GTSA 3OOYA 3Q9LA 4NE9A 3RQIA 3OM0A 4GI5A 4Q01A 5DGXA 3EVTA 1MQSA 1NP3A 3A27A 4OHPA 3BICA 1DJLA 5KTYA 2B34A 5DX1A 4E5SA 1RABA 4C0HA 4FGJA 4LOJA 3AF4A 3CRZA 3TVTA 4KWIA 4WBSA 1QDLB 2HT6A 1YFLA 2H2HA 4HFJA 4JUFA 2P4HX 3CLUD 3KK0A 2FN4A 3ZQUA 2BMFA 1EBBA 4PQGA 4RV5A 5D6NA 2V0NA 1DQPA 3RAEC 1C9DB 1SUFA 4X93A 2F62A 2CDCA 3G2OA 5L7WA 2DB3A 3A31A 4I5IA 5DBHX 3QJGA 4ID3A 4M21A 3PHJA 2HNKA 1VRWA 3MWDB 3VVBA 2WHEA 3JVIA 2ZUTA 3KLNA 4HLNA 2BE9A 3U9LA 2G06A 4PYJA 1Y37A 1COWA 4JJ4A 4KB5A 4QYIB 3WTBA 1ATZA 3OIVA 4H77A 2IIPA 2HDWA 2CBZA 3FROA 3PWSA 2QRZA 1W94A 1ZMOA 1SGWA 3UV3A 4MR7A 2IV7A 3WRXC 4OQQA 4ZTBA 4GZ6A 1R0XA 4FZ5A 4UHHA 3TOZA 1OJ7A 3MB8A 1GV0A 4UE2A 3PVSA 1DEKA 2HM7A 2X1VA 2WAOA 1QUEA 1WDMA 5EMNA 2QW8A 3R6GA 1QGED 3LFTA 1YC5A 1EM8B 1YL5A 4L72A 5BWBA 4FW9A 4RGBA 2UXDB 3I45A 4L22A 3ANNA 1H2BA 2C4UA 4L5IA 4MVJP 1PJ4A 3G8CA 1DRVA 4GYYA 2EJTA 2OXIA 1MABB 1MJFA 3H2HA 3NNDA 4GZMA 3ASZA 3RTDA 3ZKWB 1IHUA 1NWHA 2G7MC 4E4TA 2MIIA 3MCUA 1UPTA 4XGRA 1RC8A 3R9IA 4C0QC 5H3CA 4EI8A 4LGYA 1SK9A 4L0QA 3JPYA 1YDWA 2R8XA 1YB6A 4MQUA 4X60A 3ZVNA 3D3QA 2V1XA 3IJRA 3FVTA 4LF8B 4I4LA 1E64A 2E1RA 4D9BA 1QK5A 4AYXA 1ZJZA 2CCJA 1N77A 2C0PA 2P4SA 3F7TA 5DCLA 4JLOA 1JHXA 4X1IA 2JBAA 1MB0A 1FNDA 4DR2B 1OWMA 5KAMA 5LQDA 1A8PA 2GH1A 3GN2A 4DPLA 3ANMA 4EJSC 4LJAA 1TAUA 1NVWQ 3ND9A 3T7DA 5DM70 2VJDA 4IXNA 5CLLA 5ALLA 2ZUVA 4G1VA 5LYJA 3KX2A 4PVDA 3MMZA 3K9GA 1QV9A 1N6HA 3TK1A 1ODKA 2WM3A 1VLVA 4RE6A 3CUSA 3F4LA 2F3PA 1UJ2A 2AFIA 4LXQA 5BYBA 3GRPA 1U5AA 2GCGA 3AIMA 2XBMA 1CR6A 4JUDX 3MQFA 4OMCA 1H69A 5A1TA 2QYHA 4ENWA 3LTEA 4BNWA 1E5QA 2WIBA 5GOZA 2C2XA 2H0AA 3AF0A 1N2SA 2HSZA 2CJPA 1WMFA 8ABPA 3V42A 1A8IA 2FP4A 2D1SA 1C3OA 1F2TB 1WJGA 3IIIA 1M6NA 3O26A 3EZ7A 4OYHA 1RM0A 1WQ1R 1OHHA 3TW6A 1XI2A 2WFZA 3I6QA 3LZDA 4JENA 2IBMA 4YV2A 3LA6A 2W93A 1UOPA 1UK7A 4NMLA 3S44A 2OA0A 3PNBA 4G5QA 4PCLA 1ZW1A 1S01A 3F71A 1QWSA 1G3RA 1VPVA 2FZKA 2O8EB 2J5XA 4BO9A 5IK2A 4FVTA 4AF8A 3RADC 3CF4G 4YJGA 1FLDA 1V37A 4G36A 4J0FA 1Q50A 2PO7A 4C5CA 4UBIA 4F86A 2HMSA 3L43A 2A6PA 4L08A 5TMBA 4R83A 3LXUX 2P2GA 3EXAA 1G3MA 3UJ7A 2YZGA 1FQKA 1QNFA 4L8WB 5A0FA 5CLIA 1JIKA 4UASA 1SVLA 3IUMA 8OHMA 4XUEA 5F9HA 1FXSA 5ED0A 2WYVA 3T1OA 4MOWA 4E94A 4X66B 1SPBS 1UBCA 3K4QA 1R10A 1WLYA 2IY8A 2JGRA 2WFLA 4O8CA 1MB2A 3M5DA 4FGKA 5JH7F 2FE1A 3L1UA 4MO2A 1J5XA 2ONYA 2GPWA 3HYSA 3Q9SA 3DE5X 2EP7A 2F67A 3I9JA 4YJ3F 4DBLC 4MS1A 3OEYA 4I2NA 2BGUA 2YJZA 4MB0A 2O5CA 1NPDA 3IYLW 4PPFA 1GLVA 5DJ5A 3RUIA 3CLVA 1SXIA 1SUWA 3OQBA 4G84A 4YAJA 2IELA 5IZCC 1NONA 1NNEA 1TW3A 2R6R1 5JFTA 4FQ8A 3UJNA 3LPLA 2J9XB 4MVJF 3Q3IA 1PJQA 1K9SA 1YK0A 2A14A 3IJEB 3JD3A 2XGJA 2O50A 3HU2A 1LWNA 2ES4A 3F7MA 1AE1A 3AXTA 3KJEA 5EE5B 3IERA 2EC5A 3DE4X 4S12A 2VT7A 4HLDA 5GJVC 2Z6QA 1MCZA 4HX5A 1UODA 2AUTA 1LRLA 1Z4KA 3ESAA 4ZYVA 5JCOC 3Q5DA 3LBNA 4Y2VA 1XTBA 5CK4A 5LOVF 1ZUWA 2QORA 2HHJA 2QRVA 3F1LA 4I8DA 4MDHA 3TAUA 5E3IA 5HSGA 3F98A 4LRXA 3TBKA 3DH0A 4HNSA 3VDRA 3WL3A 3ZWOA 1BVUA 1XFAA 3KOUA 1TECE 4QYSA 3VKGA 3DE7X 1B8NA 1QH8B 4KDEA 2PTGA 1E62A 3BJZA 1L5ZA 1Z3CA 3K96A 4CT4B 2ACWA 2X0NA 1XZDA 3UFBA 5A2GA 5KCZA 1WMEA 3Q3VA 3D54D 1YV9A 2DUNA 4UJ3A 4YQZA 3ZZ1A 3IR6A 1K6JA 1VCMA 4B3IA 5JAUA 3AF6A 1RXIA 3JW8A 1MTZA 3K0EA 2PRKA 4JA2A 4R8KA 1GDHA 3T3NA 3SHWA 4G8CA 1ADYA 4OBEA 2AJBA 4F8YA 1KJ8A 1SXQA 3LLSA 2BW0A 1KH2A 1FX0B 1M6HA 3EUAA 1EFTA 4HY3A 3A6HA 3AO0B 3AHFA 4HUQA 4IQ8A 4L28A 5IFLA 5JYCA 3P9YA 1JT2A 1XZBA 1YS9A 5ER9A 2DC1A 5EQFA 3RS4A 3BIJA 1SXJD 4C1BA 1M2JA 4EY4A 5F2EA 3LUFA 2J0SA 2H9AA 1OIWA 5IAEA 4MGKR 1OCEA 2L69A 3CUVA 3RHSA 3TS1A 3OE5A 2R60A 3O1JC 4M60A 4Q3LA 4EY6A 2OHJA 4C4XA 2H2GA 1ZZGA 2PGXA 3PDCA 4NZNA 4QGFA 4YUXA 3FCSB 5HW0A 2DR2A 1HKHA 3ZE0B 2PX0A 1Z2OX 2O5VA 1TJ4A 2ZYWX 4PW0A 3RBZA 3HNRA 3BA6A 3KR0A 4BNZA 5K3OA 5E6RA 4UATA 5HJ5A 2QAGC 1KVUA 1UAGA 1KO5A 2AQ8A 3TTUA 4BAZA 3N6XA 4QUAA 2PWYA 1KWGA 3RU3A 1PR2A 4NZPA 3P9ZA 5IM4F 5AIAA 3QOWA 2R4QA 1ZM2A 3UGKA 1EUDA 1HL7A 2E85A 3AYZB 4MR7B 1RJFA 1EX6A 1NJSA 3IKLA 2A1UA 3PSHA 2NQ8A 2O0LA 3D5EA 4ZU1X 2Z9DA 4H35A 3L01A 3JZIA 4OAQA 3FMOB 1XL1A 4RGVA 3UCFA 4QAQA 1GGEA 1V48A 1N1GA 5JJCA 5E0KB 1EUQA 2R1UA 5KKAA 4XVUA 4MWDA 2DFDA 4MH0R 3AUAA 1M2KA 4MMZB 3ZTTA 1A71A 3CR7A 1JT9A 3BXHA 1JILA 5HKKD 1DKOA 2EW8A 4MUYA 4Q9NA 3BK2A 6ABPA 4ZTZB 2HU8A 3IP1A 2OGWA 2VOEA 3LH5A 3P9NA 4Z0PA 2WYHA 2CLCX 3HU1A 1K4MA 4Q4HA 3COVA 4YK7A 1IH8A 3SE0A 3AUYA 4QVIA 1NVEA 3CV3A 2XJ4A 4UPEA 3D0RA 1Z7WA 1UPBA 2X0JA 1HFKA 1TA4A 3CR8A 3H1GA 2BCGY 4ZVPA 4V1CA 1OZGA 1WSAA 1GOTA 4J7UA 3S28A 1ZR4A 5C8YB 1SKUA 4O6VA 1GKKA 1W93A 3K2BA 4P82A 3FGNA 3ZX4A 1Q92A 4FHDA 3HXMA 4J1TC 3RFFA 1QORA 2JBAB 2KLBA 1M1YE 3LDAA 4Q34A 3SXUA 4DV7B 2DRIA 3WHLA 1OC2A 1JIUA 2CE7A 2IOFA 2QD3A 3ETCA 4R7ZA 4I1OA 1R9GA 3DXYA 1CJSA 4HDQB 4UAUA 3H1FA 4US2R 2DBZA 2PZFA 2YHAA 1OAOA 4M1TA 4K9RA 6YASA 2B36A 5I8ZA 4PZYA 1M74A 5AT1A 4EPVA 3V4PB 3E3MA 3GBPA 4DILA 1P45A 2YC2C 2LR0A 1ORVA 4M88A 3JVEA 4XX1A 2O6LA 3LBAA 2DPMA 3UAOA 1WPRA 1U5BA 4ZIRA 2N47A 3WC4A 2A9OA 4LOHA 2XCOA 2YOHA 2J7PD 4QTZA 4DKXA 2MYPA 1TC2A 3FZGA 3UQYS 3DZDA 3WWPA 1NFFA 1T2VA 1XN4A 5EWLB 5EE3A 1PYGA 1UZLA 3PFFA 4EX6A 3E1GA 1KHTA 5CPBA 1Z39A 2ZSBA 3CZAA 4K9SA 5KWJA 3KR1A 4TKZA 1A82A 2J87A 2VHUA 2OHGA 2VIIA 3W2EA 1FCJA 1MJ5A 2VYNA 3GGSA 3UJBA 2BSXA 3N2GA 5EKDA 1D2MA 4RZXA 3KKPA 3E27A 2HQ1A 4ZZ0A 2QMZA 1E69A 2OOKA 4RLFA 4B4OA 5LZ9A 1OFIA 2GEBA 2Y1CA 2BFBB 2KMLA 5HCNA 3UT5B 3ZHBA 1Q1AA 2AFIE 3CQ9A 5LLDA 3RSLA 2HD4A 5I4KA 1Z7EA 1FTNA 2BFOA 4F46A 2L17A 2VJOA 1P7ZA 2ZFUA 4MYTA 3K6KA 1EXNA 1X80B 2CWWA 5TPWB 2OVBA 4URXR 2ZCJA 5LFAA 3OY7A 3X2SA 3GLFA 2FE4A 1LSUA 1T8YA 3BERA 2ZULA 4FFBA 4RC9A 3RABA 3UG7A 1RKVA 3Q8XB 5CP8A 1DG1G 2B78A 2WFLB 4EVSA 5B2EA 4J7XA 2FZ5A 2ODQA 1JWBB 3S3TA 1MLDA 3VSBA 1PJZA 1HQYE 4II7A 1FFHA 2NP7A 2Q8NA 3V55A 2FWPA 3UJ6A 2RIPA 3SHFA 2CHGA 2W4MA 3AUFA 1NM5C 1P5FA 4DJFC 5BW8A 1GU0A 2OENG 4F93B 2W2QA 3JWJA 2I8LA 4MS1B 3SQOA 4CCWA 4EJMA 3LDFA 1N5OX 1GKYA 4JSTA 4C6RA 2JJ8A 2PLWA 4I4TB 3NVAA 4LZWA 4C7BA 1XROA 4FJ2A 3T52A 2DUUA 3C1UA 3CNEA 1NF9A 2HHHB 1O6BA 4EENA 3I61A 3E8XA 3QXJA 3ZJYA 1T4DA 5KYUB 1HTTA 4ZREA 2IXBA 1O0SA 4UBLA 4BLWA 4F1JA 2D74A 3ZVMA 1J20A 1NL3A 2CCKA 3LXXA 3ZD7A 2C20A 3A3NA 1KEWA 2QN1A 3K1AA 3IRUA 3MTQA 2I03A 2QQ0A 1NFRA 2PGLA 5ABPA 4D56A 4D92A 1DBQA 4L8LA 4RK4A 1URPA 2M6RA 4LGMA 5TT0A 1JNXX 3DMRA 2FPLA 4KTVE 1PL0A 1NVTA 1UEIA 1GT6A 2DUJA 5JEDA 1UBFA 1D2RA 2GJ8A 5F1YA 4GD3Q 4MKXA 2IH4A 1T4CA 4LYAA 2CXUA 3B2QA 1QIKA 1AGYA 3QXCA 3RAPR 1NQTA 3OC0A 2NYVA 3O93A 3PPXA