1U90A

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
b'SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Ral-A
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
molecule tags Signaling protein
total genus 57
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u90A00
2O8BB 1IN7A 2Z83A 3LV8A 3ND8A 2FH5B 1OH8A 5FUXA 5KOYA 3VKWA 1ZINA 3B8HA 4BZXA 4P33A 4G5RA 4Q4AB 3SE0A 3SFVA 2VP5A 5FI0B 1XPRA 4TYNA 2ZJAA 2ZSAA 1Z83A 3VR6A 4I1SA 4A0FA 1DG3A 2BBOA 1TAGA 2GILA 4GOJA 1FUKA 3QKSA 3G0HA 2CVFA 3WNBA 4TMZA 5AJVB 5IHPA 1GTVA 2W0MA 3L8ZA 3WRXC 1EFRD 3SU8A 2JIZA 3CH5A 4CIDA 1Z07A 2G1JA 3SNHA 1W4CA 2XNDA 2ZUBA 3UXMA 4C3ZA 5G40A 1N5JA 4Q48A 3PV0A 4JSTA 3HR7A 4LHWA 2QTVB 4B2LA 1X8LA 3WHKA 2A3RA 4TLBA 2G6BA 3NDPA 3S1AB 3Q72A 4LHXA 3FKSA 3BS4A 3OIWA 2HLDA 2C96A 1D2NA 1Z0DA 3R20A 4LBYA 4DT1B 3TUZC 4RVCA 3DDCA 1E9AA 4N0DA 1GM5A 1ZNYA 1ZCAA 2AD5A 2ZEJA 4IVPA 4ARZA 4E09A 3ZLJA 4Q7KA 4MH0R 3ADBA 1JXOA 3VR5A 5AJZA 1U8YA 2ATXA 4F4JA 3UG6A 4B76A 2BMJA 3RRNA 4KSCA 4EIWA 4QKQA 1LS1A 3TUJC 4W5WA 1IN5A 1KI6A 4P4UA 3RYTC 3OIVA 1VCIA 1XFAA 2RCNA 1XZPA 3RVBA 2HYIC 2N46A 4TL9A 5DI3B 1NY5A 1KTVA 5JEEA 2IX3A 3U3MA 3NEJA 1E2NA 1K8RA 4W7SA 1G9XA 1W36D 3KXKA 2KWIA 2DCUA 4Y0VA 2IF0A 3B9QA 3A8TA 1G3QA 3BORA 1E2KA 2OZEA 4MYTA 2OLJA 1R4AA 3BFXA 4MRNA 3W8NA 4B3BA 3AVXA 2Y8EA 4GOKA 4FMDF 3O8CA 3FMFA 2XB2A 3OEHA 4BLOA 4LI0A 1LB1B 2GRJA 4NDZA 4YMVA 2IUSA 2PMKA 4HSEA 1PLJA 2D06A 1CR4A 1W5SA 3LBNA 1XZQA 3QNUA 1FOEB 1NSFA 3BFVA 4A36A 3SC3A 1KOFA 1WCV1 1XEFA 3RHFA 3L2OB 4Z1MA 1KK3A 2ZI3A 4MKIA 3MGCA 5TDHA 4BLTA 1DVRA 1MV5A 3GLFB 4M9SA 4U02A 3K09A 5FTNA 1P9WA 1E2DA 2GF0A 1JR3D 2IYYA 4NL4H 2CMKA 2OFWA 5FTMA 2E87A 4C7OB 2YZ2A 4HI0E 4JYBA 1G8FA 2H16A 2WOOA 4W5JA 1RPZA 3W8RA 1QHHA 1T3LA 4AYTA 1AJEA 2AK2A 3IILA 2QAGA 2BKEA 2V4ZA 1ZD9A 2YWHA 4L16A 1O87A 1QDEA 1R5NA 1R0XA 1NJGA 5BXQC 5CLQA 3WYGA 4ZKDA 1DAFA 3CWZA 3REGA 4PR0A 4M9QA 1S0UA 2FOLA 4A8JB 5KU1A 4PC7A 3GLHE 1IM2A 2O8EB 1KMHA 4EFLA 1QRAA 5F9HA 2BEJA 2SHKA 2WJVA 5D3MB 3ADDA 4EJSC 4ON9A 3B6EA 1YZTA 1KNQA 2EWVA 4A2QA 2H1LA 2CE7A 4IHQA 1GRRA 4MYHA 3TVTA 5H8WA 4X8OA 3AP1A 4RCYA 4Q00A 2YWEA 2ZIAA 3T5GA 5FPKA 2PCJA 4IDNA 1QHIA 3CNLA 3W3AA 4ZCMA 5CK4A 3C8UA 3DM9B 3U44A 4A15A 4M9ZA 4YMUA 1UDWA 2ZYTX 3B7GA 2IC5A 5DIFA 1FNNA 1A2BA 2GZAA 2AWNA 4BECA 1JAHA 2QORA 4IOMA 2HDNB 1GRQA 4XD7D 4LOAA 3OF5A 4L4UA 2VBCA 3TH5A 2QM8A 4D80A 2DY1A 1RYHA 2CBZA 4ZV4A 1DBSA 2R6AA 3I92A 1E9CA 1RW4A 1W0JD 1KDTA 1CU1A 1U94A 2ZR0A 3R7WA 4ASUA 1NL3A 2VF7A 5L8VA 3IQWA 2CCKA 4QBGB 3B5JA 3ZIAD 2N1BA 4JVMA 2IBMA 2CLSA 2NO0A 1AIPA 3LY5A 2CDNA 2A5YB 4HUQA 1E79D 4LYFA 3IHWA 3FOZA 2DB3A 1J90A 4LJ8A 3Q5DA 3TE6A 4WOPA 1E3MA 1U0HC 4RFVA 2J0SA 3EIQA 1MABA 3RRMA 1DAHA 4MRPA 1YJ5A 5SZKB 4QBIA 2EVWX 1CF4A 2ZANA 1OFUX 3UPUA 2PMDA 3I4LA 3LBHA 2W58A 4DCSA 2VSFA 1E9BA 2HT1A 1H8HD 4FWTA 3V9PA 2XTZA 4Q18A 4OQNA 3LD9A 1A5TA 1SQ5A 3NKVA 1AGPA 3SOPA 4AYWA 1P61B 1SXJD 2J0UB 5EE1A 3IDQA 4B3DA 1RE0A 1M7BA 2UVQA 2QBYA 4KYUA 2PEYA 5FFMA 4IFBA 1E9RA 2OM2A 3CR8A 4U7DA 3U4QA 1C4OA 1ETUA 4MGKR 1F2TA 2F55A 2IYZA 2FN4A 4P0TA 2ERYA 1NMZA 1YR9A 3CPHA 3AF2A 4TZ0A 2GXUA 1CJKC 3AKCA 3EZFA 1O3YA 1GITA 2G83A 2XSZD 4TTRA 5GJCA 4B74A 4HAUA 4YXWD 4W5HA 4LPKA 3SQXA 4MGIR 3RANA 4PX9A 4A2WA 1H8EA 2OUKA 3P4YA 2PZGA 3CRVA 3OIYA 4FMCF 1XEXA 2J5XA 4HAZA 1UBGA 1A4RA 2VTKA 4OYHA 4PFSA 3EPHA 5FPHA 4F7WA 1W1WA 3GEEA 3EXAA 3FVQA 1RRGA 3BWDD 4ZDIA 5EUMA 4JVLA 3NBZC 4C0JA 3BIFA 2NZJA 1P6XA 4V02A 3VMFA 2W83A 2ZSBA 1GG2A 2X1VA 4IKEA 4TSFD 4IVQA 2IYTA 3PITA 4HB3A 3AH8A 2CCGA 4TT3A 4BFSA 1Z63A 3ZD6A 1EESA 2YYZA 3CX6A 3X1WA 4DSUA 3BB3A 4GMDA 4PHTA 2RH5A 2ZTSA 3W9YA 3TW8B 4LDJA 2GCPA 4JMPA 4UKDA 3AEZA 4K46A 4NYMR 1S2MA 1YR7A 4TLEA 1Z22A 3I72A 4DLVA 1S9DA 5DYIA 4Q9KA 2GETA 4KVGA 4CVNA 1Q21A 4R71A 3SS8A 1E4YA 1NY6A 2QL6A 2AL7A 2O5VA 2H7VA 5J47A 4C0KA 4BQSA 4B33A 1MOZA 5L3QB 4HLCA 1U8ZA 2H8KA 2DFKB 3PXGA 4E5UA 1Z2CA 2ZRBA 4KBFA 5J5CA 4DBLC 2O8CA 3IKJA 4TL6A 3KDSE 4PPQA 3CRW1 4ZI3A 5KNCA 4QOSA 4IDOA 5FI1B 5CYOA 2R2AA 1W0KD 1ZM9A 2D7DA 1E2IA 1E9SA 1OXSC 1H65A 1XD2B 2P2LA 4JLPA 5G41A 4GL2A 3EWAA 4QM7A 4YMSA 2QP4A 4KFUA 1WQ1R 1TQ6A 5CJPA 1TTTA 2CL0X 2BWJA 2GZDA 2MSDB 1ZM3A 2BMEA 1KI1A 1OKKD 1ZAKA 2O8FA 1GFIA 4EPXA 3ICEA 5DISB 2FFBA 1WMSA 3MFYA 4PC3A 4RZXA 3KQLA 4URYR 3QUSA 2IS6A 4PAOA 1YR8A 4BFZA 1SXJB 3M0EA 4M8NE 1OLOA 4KITB 2JJ1A 2ODBA 3KJGA 1ZNZA 1IJEA 3QE0A 4A0GA 1M1YE 3ETLA 2WM9B 3QPUA 1UFQA 4A8JC 3ZVNA 2WZQA 1ZNXA 1GILA 4MITA 4EKDA 1Q1ZA 3QPVA 4LV5B 1Q22A 3NBFA 4QGHA 3I5YA 1ONBA 4KV9A 3WBJA 4OHZA 5HZKA 3U7GA 4H9GA 1Z0AA 3C5HA 4PQRA 1Z0KA 1PZNA 2QEQA 3O47A 4L5BA 4ABYA 3ZQJA 5BN5A 3I1FA 2REOA 2XZPA 2XXAA 3IPYA 1PLLA 3A1SA 5JCZA 3KZ1E 2FMXA 3Q7PA 4LCBA 1U2RA 2P65A 4AK9A 5BN4A 3BB1A 2YC4C 4YC7A 1WF3A 4XSHA 1Z8FA 3GLFE 1Y63A 1U0JA 2CL6X 4XH9B 5K8IA 1P72A 5HKKD 4DDVA 4WXRA 4YMTA 4QBHA 4WIAA 3TR5A 4CEHB 5FPTA 3RS5A 2CEAA 2GEVA 2G9NA 2FV8A 1CJVC 3WNCA 2HYDA 3VNVA 1XXHA 2CE2X 2DFNA 5HE8A 2MSCB 5F9FA 5LDDC 1W44A 3HP1A 3SYKA 2AXPA 2DR3A 3DVLA 821PA 1OH7A 5H1YA 1NMYA 2V9PA 2Q9CA 4DLUA 1Q1EA 3A1TA 2JATA 4EAQA 2P0EA 2XJ9A 4FCWA 3WHLA 3U61B 3LDAA 2VP0A 4NP6A 1KY2A 5JWOA 3C14C 3T15A 1QHSA 3PUWA 4UXJA 2HUPA 4CF7A 4DDTA 4KODA 5EZ5A 1N25A 4A0RA 2QQ0A 2WAXA 2ZRGA 4WZ6A 1KY3A 1XPOA 5HPYB 1R5OA 4M2LA 4Q1CA 1HY3A 4OL0A 4D4JA 4B6EA 3PR1A 4DB2A 1XB2A 3HPQA 3U60B 5KNBA 5DYGA 3K9HA 3FHCB 2VP2A 1S3SA 3A1WA 1QHGA 5E7IA 3W90A 4RCZA 4ZDJA 1G4UR 1ZM2A 2J7PD 1W48A 1NN3A 2O0HA 3Q7QA 2GESA 1HUQA 4KLZA 1NIJA 3R8CA 1X3SA 3SHFA 4TN1A 4QJ3A 1WB9A 3ZVLA 1NF3A 4KFRA 1TMKA 5F3WB 2VHUA 2FF7A 1FMJA 2QMEA 3MUFA 4C0LA 4PO1A 5JEDA 1Z06A 1TX4B 5E95A 2V1UA 2C95A 2FA9A 4WZAE 4HZIA 3AP2A 3BERA 2P5SA 3ADCA 3EASA 3KB1A 4JBYA 1W0JA 1X6VA 3H4MA 1YRBA 4LZZA 1ZU4A 1P2VA 2ZJ8A 2NPIA 3NDBB 3A6PC 3U3KA 1YE8A 5LB4A 1KDRA 1P73A 2ZJ5A 4N3NA 5P21A 3EIHA 3MWYW 1CEEA 1DEKA 4LBVA 1QBKC 4YLGA 1I4TD 1E79A 5K8LA 1US8B 3THYA 5AUOB 4JJKA 1IBRA 4AIIA 3TMKA 4KVAA 4MRSA 2GVZC 3SHWA 3T12A 1RRPA 2LCFA 3LNCA 1TU4A 1QHXA 4PXAA 1EXMA 1Z0JA 5JWHA 2DHRA 3LW7A 5CM9C 1G5TA 2ZR7A 2GKSA 4G3XA 4KU4A 1C1YA 1BS1A 2XAUA 1H8HA 2ZVPX 1MO6A 2C9CA 1V5WA 2BHRA 2H18A 2K5UA 4JZKA 4LJYA 3A1VA 3BH6A 2ZS9A 2QRZA 1UEIA 2B92A 1G8HA 2JGNA 1FMLA 3THWB 4CGZA 2GK6A 2R6GA 3FHOA 4JVNA 1II8A 4NCJA 2A5DA 3PG5A 1DADA 2DPXA 4RD0A 1DELA 2QSYA 2JA1A 4IJMA 3QVUA 3CZQA 5FOVA 5DN6D 2ANBA 2IYSA 3PEWA 1BIFA 2FPLA 3P20A 2RGAA 5EE3A 2OG2A 1Z6YA 4PC1A 4LJ7A 2O52A 1TQ4A 1GL6A 4OQMA 4QHSA 4IEIA 3AF4A 4S2EA 2GHIA 1X86B 3LW8A 2P67A 5LB2A 3SDZA 4NZYA 3DKPA 1JR3E 2DFTA 2Q21A 1P2UA 4IXMA 2YV5A 2BM0A 3F3YA 3LFUA 4YQFA 4D25A 1RZ3A 2D4HA 4HDOB 4CT4B 1OXTA 2DYKA 1DS6A 1NJFA 3FMIA 1E2HA 1P7CA 1SGWA 4GMXA 4V0NA 1CTQA 3VFDA 2ZETA 3NEYA 2A2ZA 3FFAA 3T1QA 4E22A 2L0XA 3H84A 3NHBA 1JPJA 2WJJA 2BBSA 1UPTA 1PV4A 4DHEA 3B78A 3PUYA 4Q01A 4DEXA 3FB4A 5J40A 2NQ2C 4NYJQ 2Z43A 4K81B 4ARZB 3VU9B 2RGGA 1G1MA 3AKYA 4GNKA 5KDLA 1F5NA 1XDBA 4NKRA 4CEJB 4M1MA 2HT6A 4DWJA 5JRZA 2IYLD 3KQNA 1NMXA 3B60A 1CJUC 4DLZA 4XVQA 3RABA 4BFXA 2MMGA 4US0R 4PZZA 5FR1A 5GJVC 3SN6A 3C7KA 1ZU5A 1FP7A 4LHYA 4P3YA 2EFHB 2CK3D 3K0CC 1FX0A 3K9NA 5FL7A 1R8SA 4PO8A 4KFTA 2XZLA 1SXJC 2PT7A 3OEED 2HEIA 3GJ3A 5L3SA 3SYLA 2WWGA 3FMOB 4AKEA 3N2EA 2YVUA 4BGDA 1W4RA 4P4SB 2I1VB 3SJZA 3CF0A 4GI7A 1OJLA 1XTJA 3KFXA 3QKRB 1XMSA 3VR1A 4FMBB 1QZXA 2I1QA 2C04A 2N42A 4WVFA 5K8TA 2KB0A 2QTFA 4JLAA 1HT2E 5FTLA 3D8BA 4UNNA 1W2HA 5E7JA 2AX4A 4B32A 3MWKA 2QUZA 3EAQA 1WP9A 3CF2A 1U0LA 2D3WA 2HF8A 3ZQ6A 1XTIA 2HCJB 4CEIB 1DAKA 1Q57A 1ZVQA 3AKDA 5EXSA 3QXXA 2OCAA 4G0NA 4PHGA 1KI4A 1N6IA 3TQCA 2GBLC 4OI4A 4FCVA 4MKGA 4X8HA 5CLLA 4NHOA 1OFTA 1G6HA 3VNUA 1XRJA 3NWJA 4POAA 1NNEA 5TV2A 1XPUA 4IOJA 2XX3A 4KFSA 2ZVQX 4B34A 3KJEA 3B1VA 3GLHA 1SXJE 4Q66C 1G8YA 3B2EA 3ZH9B 1AZSC 4G5QA 4EQ6B 5CB8A 3R9WA 4RD6A 2GJSA 3EZ6A 1NSTA 1EFCA 2QY9A 3PENA 2FPKA 3MLEA 1ZUHA 3K8YA 3L0IB 3FYHA 1G16A 1U98A 4DLYA 3D31A 2ZJBA 2IYWA 2V55B 1FW6A 4QGFA 4D2IA 3K1JA 1P2TA 1BO6A 2R9VA 2BMFA 2IXFA 521PA 4BFYA 1S4QA 2PZEA 1P2SA 1VYVA 1PUIA 5JFGA 1SVLA 1J7KA 3BH7A 4UNQA 4OHWA 2VHJA 3JZAA 4B48A 1N5LA 2R6FA 5DHAA 3G82C 4TMXA 4OK3A 3K9LA 5HCNA 1YU9A 2W6JA 4URUR 4BLSA 2IHYA 5FBWB 4A82A 3I3SR 4C4PA 5HKKA 3EPJA 2RGXA 3DZ8A 4LBWA 5HCIA 3AM1A 1E9EA 3Q3JB 4AI6A 3QG1A 4B75A 1HTWA 3AF0A 1KZGB 1MO4A 3AGQA 3Q8XB 2JJ8A 3BOSA 4B71A 1CJTC 3KTAA 1F2UA 4E03A 1SZPA 4ZO4A 4CYMA 3KKPA 1RC8A 4M53A 2NOAA 4I1UA 3R7WB 3WYFA 3W34A 2NZ8A 3ZZ0A 1ZBDA 4Q4LA 4EJSA 1JI0A 1Q1QA 3B1XA 3K0AB 2PLFA 1LVGA 1BMFD 5HE9A 2VHTA 1R7RA 5CDFE 1LF5A 1QG2A 1I4LD 2B8WA 2JLRA 4R2HA 5FH9A 3R9IA 1SKYB 1U9IC 4B6FA 2VO1A 2J1LA 3QOFA 3VR3A 1IONA 4Q9LA 1EK0A 3EZ9A 3WYAA 1OXVA 2QGZA 3AF1A 5UKDA 2KE5A 1CKEA 4ZIRB 1EWQA 2FFQA 3VKHA 2VP9A 3AV0B 2F43A 4Q1DA 3GLGB 1XMIA 1XTQA 1A1VA 1N6KA 2BBWA 4G5SA 2Q0HA 3TR0A 1D2MA 3MSXA 4LBZA 4B73A 3DEFA 2P6NA 4EFMA 1T6NA 621PA 3AVWA 3FE2A 2R44A 4K8OA 1OYYA 4MGZR 1N0UA 5AK0A 2Q9BA 3O8BA 4Q4JB 2JLWA 4B2IA 3TSZA 1E0AA 1E2PA 4M9XA 4FXPA 3RSLA 1DE0A 3ZS9A 5DNYB 1VCNA 1CRQA 4DCNA 3WNDA 2EYQA 2KJQA 2OEPA 2W6ID 3HDTA 3O8DA 3HJNA 5JS8A 2ZRPA 1OFIA 2V54A 4OI0A 3DZDA 4Z8YA 3F8TA 5AUQA 3CUEF 3NTUA 3QF4A 5AUPB 3GJ7A 2PX3A 2ZRMA 4HLUC 4Q1EA 4QNRA 2XGJA 4BZPA 3KJIA 4Q21A 4O2RA 1G18A 1KKLA 4DLRA 4NCIA 5KPDA 3W6OA 4RD4A 2LKDA 2QZ4A 3AVOA 3BJIC 4MUAA 2CJWB 2O8BA 4W9MC 1P9NA 1RKBA 2JJ2A 2QN6A 1BKDR 2ZJOA 3CRRA 3RC3A 3TQFA 1NN5A 1HQCA 2PCLA 2F7SA 4Q4HB 1UKVY 4L9WA 3L0PA 3VAAA 3LBIA 4Q4AA 3AP3A 2OT3B 2EWWA 2Z0MA 1GNRA 5TXGA 1RIFA 2FGKA 2X77A 2GAOA 2NO7A 3SJCA 3LVQE 3P4XA 4OJKA 1Z2AA 2WV9A 4XTRA 3PQCA 4OK6A 3PJRA 2ECKA 2ZE6A 3EX7C 2O0JA 3K9GA 2ZJZA 1JJVA 1XTRA 4KXFB 3TBKA 2XTNA 5BN3A 5CIWA 3I5XA 3IIKA 3E5HA 2VHQA 1JALA 2LKCA 1Q44A 3CW2A 3W5JA 1WDTA 1HYQA 4OKSA 3I73A 2YOFA 4ZDKA 2ZYVX 4HAVA 1T5IA 1E2FA 1ZD1A 5B30A 3PUVA 1VECA 2AN9A 3S1AA 1FQJA 2IS4A 2PLRA 4CZ2A 4DT1A 3GJXC 1LF0A 2WIAA 3MJRA 1XNJA 4V0ME 1NLFA 4LC0A 1AS2A 2F1RA 3OE7D 2R62A 3SJBA 4RD2A 1KK1A 3EA5A 3GFTA 4AURA 3Q5EA 4B47A 3T1VA 4Y0AA 1LTQA 2ZQ5A 4PTLA 4WBSA 4NCKA 4GP6A 5LBIA 1CR2A 3T1OA 1VMAA 4DCVA 3AB3A 5EZ6B 1ZCBA 5EXPA 2UZIR 2VSOA 3LQQA 3SBDA 4U00A 3VHLB 1PJRA 5DI3A 3UIEA 1VHTA 1COWA 2Z6VA 2CK3A 4TTPA 1HURA 2VP4A 5FPSA 2ZU0C 1E2JA 3P26A 1E6CA 2YJTD 5C4MA 3IHLA 4YMWA 3OEEA 1E9DA 3U3JA 2ODEA 4DXAA 2Q6TA 2FZ4A 3AVTA 1G8PA 5JSZB 1YR6A 1Z6XA 4MYUA 5CITA 4R98A 1L4YA 1VCOA 4HATA 1VHLA 4B3FX 5JI3E 3NVAA 3DM5A 4ERNA 4UXIA 3HU2A 4AY2A 4O2LA 4LJ4A 4M1TA 5EE0A 5F2EA 2YWFA 1ZIPA 5FOWA 2ZM5A 3KQUA 1SVIA 2C9OA 3ZDQA 1IY2A 4HEJA 4JYCA 1UEJA 3VKGA 2BJVA 4QJ4A 3TAHA 2KSQA 4C2UA 5A0FA 3GLFA 4MRRA 2QE7A 2XOKD 1TUIA 3IO3A 2JLVA 5C18A 4C7OA 1G5PA 2ERXA 2IT1A 2ZREA 5DO9A 2X8AA 2WKRA 2EU8A 1TNDA 1FPMA 4II7A 4B44A 4I99A 4RJLA 1IOZA 2ZI6A 4PC2A 3ZJYA 1OFHA 3ZVMA 3DKVA 2HCBA 2YKGA 4XSGA 1T0HB 4B43A 721PA 4LJAA 2BV3A 5EP2A 2KBFA 3IQXA 1WXQA 4A8JA 5KDOA 3W6PA 2J59A 1KI8A 3T34A 1G7RA 4CDGA 3T1TA 3KUCA 3J81k 2O8EA 2ZI5A 2ZI4A 1YQTA 3B1WA 5D3MA 2EFEB 1EFRA 1NVUQ 2ZITA 4NYIR 1Q20A 2J0QA 1XJCA 2QROA 3HWSA 3PFIA 4A2PA 2ZI7A 4V03A 4TMVA 4BZQA 3X2SA 1QVAA 2YHSA 4N0EA 5F98A 2IEYA 3EWSA 1N6OA 1VG8A 2VF8A 4TQAA 1DAIA 2JLSA 3P32A 5KSPA 3NH6A 2IL1A 3PUXA 4LJ9A 4LX0A 5SZJA 2DFLA 1AKYA 1QHYA 4LSGA 2AD1A 1B0UA 1CBUA 4CT5A 4DLXA 1RJ9B 1UF9A 5J4YA 3BD9A 1A82A 4FINA 2WWXA 3N70A 2IWHA 4RD3A 3KKNA 1XU4A 1OHHD 3GCGA 1E96A 3T35A 1PUJA 1ZM7A 3LO5A 4DSNA 2ZYUX 4RD1A 1X8KA 1KK0A 2Z5FA 4BFWA 4JLBA 4Q5IA 1GWNA 3FPAA 4JLVA 3BXZA 4JL5A 4HZUB 2GXQA 2XEXA 1GVNB 4HB2A 4JJZA 1II9A 1NRJB 1T91A 2YOGA 3THXB 4O3MA 4F91B 1E4VA 1KDOA 4JKYA 1I4DD 1L7VC 2ZUCA 2IUTA 4NYMQ 5FOUA 1M8PA 3UKDA 1WA5A 2W0SA 4JKIA 2ZE7A 2ZPTX 3K0FB 1E2QA 1E2LA 2UZ3A 5EE5B 3TKLA 4DUGD 2OAP1 2VA8A 3QXJA 2AFHE 3VX3A 1E2EA 1NG1A 1IAQA 4EFNA 3CO5A 4DLTA 4XVUA 1SKYE 2WOJA 2D2FA 4XWAA 3RAPR 3WMEA 1MO5A 2ZXUA 3R9XA 3RNLA 5DSZA 4G01B 4JL8A 2YC2C 4JT2A 1CXZA 3IIJA 3OIUA 1KMQA 1II0A 3CR7A 1OIWA 5JJIA 2IYUA 1G3RA 4NPHA 1DTSA 1XJQA 1CIPA 1W49A 2DWPA 3RWMB 1UADA 2VH5R 3KX2A 4AYXA 4EUNA 2CL7X 3CRQA 4Q7LA 3GLGE 2QT1A 2QP9X 4QNMA 3EPLA 3U7FB 2O0KA 2GZHA 4C2TA 4RZ2A 4YDHB 1CR0A 3MRSA 5G3YA 2WAYA 3GPLA 4ZCIA 1P62B 4YDSA 3X1DA 4C0BA 5C1BA 4ZPXA 2GCOB 4QBFA 1JR3A 2FU5C 1A2KC 2JIZD 1NIPA 1XEWX 3QPWA 4MGYR 3NHAA 2O8DB 4PO9A 1S1MA 1MO3A 2XNDD 4TMWA 4LYAA 2AWOA 4QXAA 2WWWA 4TLAA 3ZVRA 4LC1A 2QPAA 4URWR 1U99A 3IBGA 3LRPA 1TL7C 4E07A 1VCMA 1JEDA 4M1YA 2GTPA 5SZIA 5D3QA 5J4VA 2C98A 1T4GA 3H86A 1E94E 4IEEA 4NCNA 1TEXA 2HLDD 2ZSEA 1U81A 1XCMA 2QTHA 1FTSA 1SKQA 1TU3A 5AWFC 1HA3A 3SBEA 3LX5A 2DWQA 3VR2A 4B2PA 1ZM4A 5IF9A 3VQTA 1G17A 1KHTA 3N5CA 5AJWA 1R2QA 1WBBA 1SVKA 2RGNC 3LX8A 4US2R 4GZLA 1J70A 1Q3HA 1VTKA 2I4IA 2WKQA 5J4HA 2AKYA 2RGDA 4BPBA 4ZKEA 8OHMA 1XCPA 2WICA 4PPNA 2ZRJA 3TVDA 1W4AA 1E98A 1HEIA 3MG9A 1P3JA 3FGNA 5KSOA 5BQ5A 1ZUIA 3MCAA 4PSAA 5L3QA 2WPDD 3GQBA 4A4DA 3C4JA 4JLMA 3MJHA 4X8LA 4JL6A 4XD7A 3ZGXA 2DWOA 5JZVA 3EZ2A 2QA5A 1N5IA 5H70A 4OK5A 4A1FA 4GDFA 2D7CA 4HB4A 1BH2A 4PQFA 1YKSA 2ANCA 3DOFA 1G6OA 3QXCA 4HAWA 5FTKA 2WWFA 1QF9A 2ZS7A 3QVVA 4UXHA 5IK2D 4WXPA 1FQKA 1KSFX 2HF9A 4TMTA 5BW8A 1E9FA 2ZSDA 3L8YA 3QKTA 2FDCA 1Z6AA 2PH1A 3E70C 3ZIAA 3FMPB 4ZDWA 1XD2A 2FSHA 2D74A 1SULA 2BC9A 4NCHA 2GAAA 2WJIA 3CPEA 1R5BA 3FTQA 4Z1MD 5DH9A 1AKEA 3SYNA 1YVDA 1EFUA 2B6HA 2FEOA 2GVDC 1V43A 3CF6R 2IYVA 4RZUA 2RMKA 4ESVA 1E0KA 2IW3A 4D26A 1GSIA 4XWKA 1GAJA 4XJXA 1W7AA 1J2JA 3V00A 2EW1A 5K8UA 1M2OB 2QRNA 3K0CA 5FOTA 4DVGA 2NMVA 2QSZA 4Z8XA 1IN6A 3ECCA 2A5FA 1SXJA 4UNSA 4HDCA 2WSMA 4OI2A 3LAWA 1CJMA 2IYQA 2R6CA 4L8GA 3ASZA 1JB1A 4AKGA 2FFAA 1R6BX 4R7ZA 1CLUA 3TSOA 5JECA 2FPMA 5FUYA 2V3CC 3H1TA 2AHOA 3ICQB 1ZYUA 1IJFA 2QI9C 4KI0A 3QKSB 3BE4A 4C0AC 1ZRHA 2XSZA 5FBLB 4AC9A 1NKTA 3CM0A 2FX3A 1MH1A 4YXWA 1HV8A 3EC2A 5CYPA 3U7HB 1N6LA 3QXSA 3WBKA 3AF3A 1GKIA 5GJBA 4P32A 3GMTA 1PVOA 4ESHA 1U8AA 1R8QA 3QIAA 2CCJA 4C9BA 3H2YA 5CIQA 4AKIA 4JT4A 2GDJA 1EGAA 1MRNA 4B3XA 5GADl 3TGPA 2HJGA 3WP1B 2XB4A 4MA4A 2OBLA 4F4IA 1TQ2A 4MDEA 2X2FA 4FIDA 1HQYE 1MR3F 4RY2A 1R0WA 2GBLA 2FEMA 3GJ6A 5EE9A 1SVOA 2WHXA 4JBXA 4CEHA 1KYIA 4LWZA 2JCSA 2ZRLA 3U7EB 1JNYA 4DC9A 3P27A 4TSFA 3ZD7A 3AVVA 5KUTA 1OF1A 1C9KA 4KLNA 2IXGA 4TLDA 1NKSA 4Q02A 4BWYA 4ACBA 3MWJA 3KXIA 4JBWA 1G8GA 4D82A 1CS4C 1QG4A 3GLIA 3MD0A 5JJKA 5LD2B 4ASUD 3I62A 4TYPA 3AVPA 4XTCS 1RFLA 1KI6B 1TF7A 2A5GA 4DIEA 5JLJA 1NVVR 5CDFA 4BRUA 4HYYA 3RS2A 4QM6A 3M6AA 5EQTA 4BE7B 1RRFA 4P31A 3DL0A 2IWRA 3M1IA 3NH9A 4TQUS 3C15C 3OZXA 4IRUB 3RRYA 2VIIA 2VSXA 1R10A 2DBYA 3ZZUA 4NH0A 4Q9IA 1XBTA 3A4NA 3F0TA 4KBGA 1G7SA 2J87A 2ZRCA 5AJYA 2IYXA 4WW0A 4D0NA 4GOXA 5JHGB 3U2QA 2Q3FA 4WZBE 3BGWA 3G5UA 1K5DA 5CB6A 4NMMA 3OESA 1DAMA 2E9SA 1W0KA 2ONJA 1FL9A 5FL3A 5FOXA 3IEUA 1YZUA 4LRWA 3GP8A 5L3VA 2OCPA 3NBYC 1G7CA 3SZRA 3RS4A 4TMKA 3CBQA 2NG1A 4OBEA 4A6PA 4DJTA 3W3ZB 1UKYA 2VPPA 3BB4A 5JRJA 1OYWA 2ZRKA 4MDFA 5EP4A 3NG1A 4DLWA 2FG5A 1OKKA 4OJQA 1P9RA 3WRYC 4QGAA 3C16C 1GDDA 1KI3A 3CX7A 4GZMA 1US8A 1K5GA 3UWKA 2XTMA 1QHHB 1G19A 1VYUA 3RS3A 5JWRA 1NVVQ 5LPNA 2J3EA 2W2TA 5EXXA 2PT5A 2QAGB 2A9KA 4DUGA 1FFHA 1AQYA 1U9IA 1G64A 3UANA 121PA 2CLCX 1Z6GA 2KI5A 2R8RA 1X1SA 4JVSB 1GKUB 1N5KA 1BOFA 4US1R 3WY9A 5E3HA 3AVUA 4D4KA 4TL7A 4R9UC 2OLKA 2ZRFA 1ZNWA 2GK7A 5A5GA 1XWIA 1IY0A 2FSGA 2REXB 3TW4A 2NIPA 1KMHB 1OPXA 3THWA 1GUAA 4TT3D 1OB2A 5JBQA 1J8MF 2GF9A 1G4AE 1M7GA 2OXCA 2IYRA 3EA0A 4GBMA 3AVYA 4B3CA 5DI9A 1Z6TA 2CHQA 2F9LA 1M74A 2V6JA 2VQSA 5B57C 1DO2A 1OIXA 5J4KA 4LK2A 1GOTA 2ZYWX 5J4LA 3PEYA 4DCUA 1E1QD 2EFDB 2NGRA 1A7JA 1KO8A 4P4TA 5EP1A 4BRWA 1LS6A 3PEUA 2C2HA 4Q1AA 3B1ZA 3OHMA 5L3RA 1T3HA 1TEVA 4OHXA 3QQ5A 1NBME 4C30A 4D81A 4C0QC 3U44B 1S3GA 4BEBA 4A92A 4BEJA 1Q12A 3EIEA 1T8UA 4ILEA 1LFDB 2EQBA 4ZCLA 221PA 1N3BA 3CIOA 5GVSA 3QKUA 1GRNA 2VYFA 4GRAA 2VHCA 3QI2A 4RFSA 2BIFA 2QG6A 4HLUA 5C2JB 2WKPA 1KO1A 1EX7A 4JSYA 1TUEA 1KI9A 4BUJA 4V0MA 3TNFA 3H0KA 4CW7A 3CX8A 1Q3TA 4CRWB 1G3IA 1S96A 4HAXA 3KB2A 5FBQB 3RS0A 2J41A 1MRSA 2XJ4A 1G21E 2NPFA 1GKYA 3LA6A 4NU0A 1KKMA 2YINC 4KYIB 4DEYA 3VU9A 4CEJA 2YWGA 4HUQB 1GL9B 3EC1A 2EFGA 3LXXA 2FFHA 3GEHA 4EPWA 1YZNA 2HV8A 2P6UA 3L43A 4AG6A 2JASA 1MABB 5TARA 3CZPA 4M1OA 4ACAA 4KHZA 1XCGB 2RB4A 2IS2A 2VRWA 2ZRNA 5EUQB 1NN0A 1VG1A 2XZOA 1KO4A 2J7PA 2QMOA 1UJ2A 1VG9B 2YOHA 4NE2A 2G0TA 5AJXA 1OV4A 2F6RA 1DPFA 2R6DA 4LJ6A 2ZR9A 4NONA 4EDHA 2WPDA 2IXEA 4JLNA 3B82A 2GJ9A 1MT0A 1U90A 1UBFA 1UKZA 3LQRA 1B23P 1ZMXA 2JJ1D 2QBYB 4P4SA 4Q03A 4IFEA 2GWHA 4HB0A 4JLJA 1NN1A 3FDIA 3PIRA 3U4QB 4JS0A 5TMPA 1W2GA 1ZJ6A 2H57A 1F2TB 4F92B 2W2XA 2CVHA 3QKRA 2G3YA 3QJYA 4DSTA 5IK2A 2OE2A 3U5ZB 5ANRB 1KZ7B 5IRCD 1JPNA 4IOKA 1VDZA 2IK8A 3GLIB 3VTKA 3VX4A 3REFA 3K70D 2OBMA 1SVMA 1IN8A 1KAGA 3QG5A 5A4JA 2OO7A 4GPTA 3I8SA 2FSIA 1KJWA 1KO5A 1XEXB 4Q9JA 2WJGA 4D6PA 2ZAMA 1HE8B 4CEIA 1WRBA 3DPUA 4Q9HA 2QT0A 4OQLA 3CPJB 1BYUA 4QRHA 2ZS8A 1GNPA 1T9HA 1LV7A 4M1WA 4QGGA 3X1YA 4AWXA 3QXHA 3GFOA 2A78A 2UKDA 3GJ0A 2VLIA 1I2MA 2F1IA 1G41A 1P60A 2GJKA 2I3BA 4IDPA 3DHWC 2PX0A 4EQ6A 2GJ8A 2PBRA 2C5LA 2W00A 2V6IA 4O25A 1Z28A 5E4FA 3SR0A 2JLQA 1EFTA 1YZGA 1Z47A 3AKEA 5LD2C 5DN6A 2ZJ2A 4G1UC 3BFKA 3V4RA 3DMNA 1Q0UA 3CONA 1Z29A 2QMUA 2Q3HA 3ASYA 4XOIA 1QVRA 2FE4A 2TMKA 4DDUA 1ESNA 1VIAA 1GL7A 2QGNA 2BKUA 4KAXA 1AS0A 3NIBA 4DDWA 5BWMA 3V4FA 4D0GA 3HR8A 4GT1A 1KIMA 4GSYA 4FI3C 4BFVA 2GJAA 1EWRA 1JEEA 3ND9A 1E0JA 2VL7A 3RS7A 2QU8A 3TAUA 5KHOC 2X19A 4PPFA 1HH4A 2O8CB 3EARA 3W6NA 1GZSA 1KO7A 3GFPA 4OQFA 2OILA 1G20E 4URZR 2GXSA 2GNOA 2ZRHA 3P1JA 2BM1A 4KJZA 1W4BA 4QC2A 1XD8A 3WP0A 1NP6A 2WSSD 4MRVA 4LJ5A 2RKOA 3MMPA 3N2IA 4HAYA 1ZIOA 1YZLA 3CRMA 3THOA 2ORWA 1QHNA 1RYFA 1XD9A 1W5TA 3DMDA 3QEJA 4LV8B 2ZAOA 4TZ6A 2OFOA 4QG7A 3BC1A 4FMDB 2QAJA 3SFZA 4DIDA 3K09C 2GEDA 2PJRA 2J46A 5JHHB 4F93B 1OH5A 3IUYA 2O8FB 1WE2A 3OFND 2BEKA 1JQJC 1G3MA 4PC6A 4RSGA 4TQ9A 1N0WA 3K0AA 3SJAA 3KKMA 3TRFA 3Q9LA 3MWLA 1S9HA 4HUTA 6Q21A 2QAGC 2MMCA 1W36B 1OT3A 1ANKA 2IUUA 3NC1C 2F3TA 2V7QD 3JVUA 4JLDA 3T06B 4DZZA 1D6JA 5EP3A 3UG7A 2JDID 1FUUA 4IVRA 4WA7A 4BLQA 4ZIRA 4FCTA 5B58C 1Z0FA 2WTUA 2QMHA 2WJYA 1GP2A 5G53C 3X1ZA 3GLGA 5H68A 4JIMA 4ZI2A 3K70B 1ODFA 1UM8A 1T8TA 4PANA 1LNZA 2IS1A 4JLOA 2WWHA 4BFUA 1NBMD 3K0EA 2XXAB 2BMDA 1VYTA 4IW3B 1UBEA 3Q85A 1X1RA 4FD2A 2B7CA 2C99A 2JEOA 5JI2E 1AZTA 3A37A 1E0SA 2Q3MA 4Q4JA 5IDVA 2JLZA 4YONB 1KAOA 2VP6A 3PVSA 1J99A 2IEZA 4R2IA 2P6RA 1P5ZB 4LYHA 3CNOA 1Z0IA 1XX6A 3CKLA 2J9RA 2OCBA 1NLZA 4HLDA 3CWQA 4DCTA 3C5CA 2HXSA 2HJVA 3LH5A 2CLDX 2J45A 4Q1BA 1XXHB 1KDPA 4DLSA 4LHZA 2FZLA 1JJ7A 3AUYA 2JLYA 2CJWA 5FUWA 4GFDA 4EPRA 3LLUA 4Q47A 4I4LA 1YZQA 5AUNB 1P75A 2C78A 5E7MA 1MKYA 3QEOA 2WVJA 2OHFA 4Q4HA 5GVRA 1LW7A 2OFXA 4JLKA 2BCGY 2EYUA 4DB4A 2ZJYA 1FP6A 1NI3A 2BBTA 2XITA 2CHVA 1KSGA 2G88A 4ITRC 3HU1A 2JAQA 2ZU6A 4IDHA 1E1QA 1NVXQ 2VEDA 4C0HA 1ESMA 1XP8A 3TK1A 3FFBA 1RRCA 4D4LA 3U3OA 1OE0A 3SEAA 5FL7D 1N6RA 4TLCA 4KO8A 5TY0A 5B64A 4FW9A 5JMTA 4EPYA 3C41J 1CULC 1FNMA 3F5FA 2A7QA 3IGFA 3OAAD 2CNWD 3TIFA 1G7TA 1E1RD 2A30A 4QHTA 4DSOA 5KSYA 1WBDA 3QY0A 4I1OA 2QNRA 2G1KA 2WMNB 1ZUNB 3B13B 3A36A 1IXSB 2QQEA 4UQOA 1KGDA 2J7KA 4IOLA 5B2ZA 2P3SA 4A9AA 2IA5A 3HYRA 1JBKA 4PPGA 3WXMA 1AM4D 5FPYA 1S8FA 4OHYA 3FKQA 3UWOA 4LUCA 4DRZA 5HZHA 5C46F 1UKEA 2ZROA 3FHTA 3TSWA 2GA8A 4OHVA 1BMFA 2GXAA 2G77B 3THYB 4NYIQ 3TJZA 1PLKA 1E2MA 3QBVA 2RGNA 4I81A 1CRPA 2GEUA 3PEVA 1E2GA 2NO1A 3KKQA 5DGXA 5FR2A 3RRZA 5KDDA 2XNSA 3B9PA 3D6TB 1F3OA 2C03A 3QSYA 3LXRA 4X8MA 4M0LA 1L2TA 3RLFA 5C4GB 3BBPA 5CM8B 2ASEA 1AS3A 2QENA 1F6BA 2RGBA 3E2IA 3UMSA 5JCPA 2J0UA 2FSFA 1DARA 3LWNA 1HE1C 1G5RA 2OV2A 2BCJQ 4V0KA 5KYKA 3IO5A 4TYQA 3GJ8A 4FMCB 4B3GA 3RSOA 4EPTA 1AQUA 1LY1A 2ZI9A 2WJHA 5FBRB 4PQYA 5JSZA 5KNDA 1II8B 2BDTA 4LGMA 4PAMA 3UATA 1I2DA 421PA 1YZKA 4BLPA 1ELOA 3HPRA 4QJ5A 3GJ5A 4XWOA 3R8FA 1JAIA 1CR1A 1XMVA 2WIBA 5DLQC 3KQHA 4LV6A 1ZP6A 2GCNA 4FN5A 5IT5A 1W47A 3KJHA 4A6XA 4QFMA 1KK2A 1OSNA 4LYJA 2OXRA 2PEZA 4OQXA 2W6IA 3CLVA 5G3ZA 1S1CA 3UMRA 3GLIE 3A1UA 3KUDA 5HR5A 3RC8A 3A4MA 4M4SA 1JXMA 1AGRA 1GNQA 4LPSA 3RDPA 1N0VC 2JLXA 2PJZA 2ZUDA 2ODWA 5SZHB 1TADA 2BJWA 1GIAA 3EW9A 3FKSD 2RHMA 2W6JD 1Q1BA 2QPTA 5KO2A 3A4LA 3PCRB 1FTNA 1XJ0A 1OB5A 1BYIA 2ODNA 2WBLC 5KTYA 1Z3IX 2OBNA 3AGPA 2J0VA 2D62A 4MQBA 2QPOA 4BLRA 5FUVA 2AKAB 2AFIE 3GD7A 3L82B 1G291 3KXLA 4Z54A 4N1AA 3QF7A 3CB4A 1FZQA 2YNMA 1VG0B 1D9ZA 3EPKA 3UK6A 2KBEA 3ZS8A 4PAQA 1ZD8A 2ZRAA 4TWZA 1AN0A 4V0OA 3SQWA 1R0ZA 2EFCB 1SVSA 1XTKA 5TB5A 1J8YF 1FX0B 1IXRC 1P4SA 1KJYA 3EG5A 1TQDA 3I32A 1W36C 1T0JB 4M21A 4RZ3A 5CJ2A 3DO6A 3WMFA 5L3SB 1OH6A 3IBYA 1SHZA 5JJLA 1UAAA 1IQPA 4UJ3A 1RJ9A 4GP7A 2F1HA 3OEHD 2E1RA 3A58B 2HXYA 3AVQA 2RAPA 5FOSA 1M6NA 4RKEA 4OI1A 3K0SA 2ZRIA 1K6MA 3AUXA 3L0SA 1SHKA 2WSSA 3OE7A 2V1XA 3K70C 4IXNA 3GEIA 3M4YA 3VR4A 4PZLA 4AKHA 1ZC4A 3B1YA 4M1KA 1EFHA 2FGJA 4UJ5A 3EZ7A 4HZUA 4Z51A 4I1VA 4TYWA 3QENA 1TF2A 4MUBA 1N6NA 4BFTA 5ELXA 4HLQB 1DAGA 3THXA 1CP2A 5HTKA 4URXR 2AR7A 3ZYCA 4Q1FA 4MKFA 3OFNA 4KSBA 1XEWY 2AXNA 2F3RA 4PSKA 1XTSA 1E69A 3K0FA 1D2EA 3O8RA 3RWOA 4QL3A 4NTZA 3LLMA 3JVVA 2FNAA 4V0LA 1T3SA 2ONKA 1DG1G 1N6HA 4TL8A 4PSVA 1OXUA 3U6BA 3GLHB 4L9SA 1Z5ZA 1EG7A 3AQ4A 1NG9A 2V7QA 1KJZA 1OIVA 5KSZA 4NYJR 2V8OA 4G5OA 2C77A 2JDIA 1OW3B 2JJ2D 3KQKA 1AA9A 2D2EA 4M1SA 3X1XA 4LY6A 2QP3A 1L4UA 2IHBA 3MAAC 1N2CE 1JR6A 4LHVA 1KNXA 3VHXA 1VKJA 3NXSA 5DHFA 4UNPA 1XMJA 1L8QA 2X2EA 1OXXK 4HDQB 1NBMA 1KI2A 1NVWQ 4TYYA 4A0HA 1D9XA 2XOKA 1IHUA 4S35A 1RVDA 3ONWA 2GCOA 1T5LA 3CH4B 3D3QA 2ORIA 5FTJA 3ZZTA 2B21A 2RHDA 5M04A 1YHNA 4F38A 2O8DA 3W5IA 3GJ4A 4D0LB 1UDXA 3B85A 2WWIA 3IPXA 4Q7JB 4G5GA 2ORVA 4O0MA 5KPJA 2QM7A 4RKFA 4PHFA 4Q19A 2FWRA 3NC0C 2F9MA 1HT1E 1M34E 3I8XA 1E99A 4RFSB 3IEVA 2NO9A 3IIMA 2R65A 3LVRE 2NO6A 4NBSA 2W2VA 4KCGA 3HU3A 3KTAB 1F2UB 4BASA 2H5EA 2C8VA 4MYCA 2Q9AA 3U6KA 1XXHE 5TVKA 4B35A 3ADKA 2LWIA 1YRAA 1Z08A 2ZE5A 1DO0A 1E32A 2AK3A 2P5TB 1JECA 2WWYA 2ZRDA 1TF5A 4AG5A 4EJSB 1R0YA 1X8JA 2OCYC 4QHYA 5CK5A 4H1UA 4XVRA 1M7HA 3UMFA 3TUIC 2ATVA 4URVR 3KL4A 1DAEA 3E1SA 2B7BA 3I61A 4Q7MB 5AR1A 1AK2A 5EXTA 3U3RA 4AD8A 2PL3A 3QBTA 1ZW6A 2CHGA 5FBVB 3FWYA 2Z4RA 2FJUA 2C9YA 3BAFA 1EX6A 4IDQA 3T61A 1KI7A 2JLUA 1VPLA 2B8TA 2RGEA 4C0SA 1COWD 1UBCA 4MKHA 1Y3AA 5GJWC 2NTYC 2OAQ1 3BRWD 3T5DA 1OHHA 2F43B 4H1VA 4FWIB 1XF9A 2WMOB 5EJEA 2CXXA 3OAAA 2CNWA 4L15A 4PHHA 2F1JA 3NBXX 1E1RA 4U5XA 3BK7A 5BYJA 4WAUA 1IN4A 4M22A 2H92A 5JS7A 3PUZA 1W46A 4D4MA 3WMGA 3TLXA 1G3UA 3SI7A 2OESA 1D5CA 1JQLB 1H8ED 2ZSFA 1D8TA 3BH0A 3KFVA 1N6PA 4J0QA 2H17A 4PZYA 4EPVA 1KSHA 1KSJA 3K53A 2G0NA 4UNRA 2Z4SA 1F48A 2QE7D 3DOEA 1F60A 3QF4B 4F4CA 3HYTA 5DE3A 1TPZA 5BYKA 1IY1A 2BOVA 2ZE8A 2IF2A 2REBA 2RGCA 2OSBA 4TTQA 1IXZA 1NLYA 1SVWA 4DKXA 3L0OA 1DOAA 3KKOA 2A5JA 2MSEB 3CNNA 3D7MA 1VIYA 3JZMA 2BVNA 1ZC3A 4XIGS 2PZFA
chains in the Genus database with same CATH superfamily
3DBOB 3KKZA 5CA0F 1IN7A 3ND8A 1K0UA 1MC8A 1M0WA 2FH5B 2H4WA 3BJEA 3KEFA 5FUXA 5TR9A 1P9LA 4GZ3A 4F21A 3GUHA 5C32A 5KOYA 2YDYA 4Z9XA 4YMHA 1TAQA 1L1RA 1PWXA 2ZKIA 2VNHA 3IMCA 4BQNA 2CXUA 4N39A 3PGMA 4P33A 3PRKE 4MVJG 5C8YF 2E89A 3CF4A 3JV7A 3DOHA 3KJFA 3PNPA 4X1YA 4A0FA 1DG3A 1PYGA 2X14A 2GILA 4GOJA 2PAFA 1F1JA 1E0DA 2Y93A 3INGA 4HNHA 2W0MA 5AJVB 3CG0A 3LYAA 4OY3A 1JG7A 4JQSA 2FSPA 4O4IB 2JIZA 3CH5A 4WCFB 3CNQS 1J9GA 1DZ3A 4RX1A 4XYBA 4ZC1A 3SNHA 5IJ9B 3QX8A 1SIWA 3BQNB 3O4RA 4HQ0A 5G40A 1YDMA 2GN4A 4F06A 4P53A 4ARBA 5BN3B 3GDWA 1CNEA 1DKRA 1E5XA 4ZXPA 4JSTA 4KX5A 5KYNA 1OC2A 1QH0A 2O48X 3WHKA 4MW4A 1DUIA 4UHFA 3DBHA 2G6BA 3ROZA 1DAOA 3FKSA 4EK9A 1ZG3A 2C96A 3ZG6A 1Z0DA 2OO3A 2J5QA 1GU7A 2R4TA 3DDCA 4N0DA 1PNOA 2AUMA 2BFWA 2CLFB 4IS2A 4LYYA 2IZ5A 4LYGA 5DX1A 1X94A 3FTEA 4E09A 1L6RA 5BOSA 3O3MB 4MH0R 3V7FA 1M3SA 3KYCA 3FAZA 5AJZA 4Y67A 1M8GA 1M2VA 2EW8A 3TLBA 1JEOA 3UUEA 1U3CA 1EE1A 3MJVA 4GLLA 4MW7A 4IQ4A 2FW7A 1JU9A 2ZKLA 3AO0B 2YY7A 3RVBA 1NW3A 2N46A 3I9KA 1IPFA 5DASA 4RF3A 4OHRA 1RS0A 2C2GA 4DNFA 5JEEA 5EZYB 2IX3A 2G36A 1E2NA 3RG8A 4W7SA 5DGDA 5E4YA 3FOWA 4PGAA 3B9QA 1ECCA 3A8TA 3GWGA 3BORA 1MPTA 2Z3ZA 3NHYA 1WVMA 4G5XA 1UMBB 4RZIA 3KOWA 3LP8A 1A8UA 4KLAA 2OLJA 4B3BA 2WUEA 3PUHA 2XLBA 4ZXFA 4FPXA 3IPRA 5L40A 3TDKA 4NDZA 1U8FO 3PGJA 4MARA 5BWOA 2LP4Y 4YMVA 2F3UA 4Y2SA 4PX5A 2PSSA 5HF9A 1YS2X 2D06A 4GQIA 2DLCX 4ZHSA 1UIMA 2ENWA 4C3OB 3LBNA 1GEEA 1FOEB 3DT8A 1NSFA 1F6DA 2VTEA 1H9CA 1WCV1 4Q7QA 3LY7A 3L2OB 3OWHA 1T2UA 1KK3A 1WUJS 2J5RA 2WD7A 3FYUB 3T3MB 5IM4F 4KDCA 2J3HA 3MGCA 5MFPA 1DVRA 4OBXA 2JFHA 4GBGA 1MV5A 3MLBA 1JFVA 5CB4F 5I5EA 3L92A 4U02A 1ISGA 5FTNA 4KQEA 4CHGA 4NMLA 5L51A 3C8HA 2IYYA 3G5MA 4NL4H 2CMKA 2OFWA 5BNZA 4WN3A 5I7UA 5TQ0A 3F4BA 5LKAA 2XKBA 2VZ8A 2HHCA 1G8FA 1M0TA 2H16A 2J6BA 2PWBA 2Q49A 2WOOA 2AG6A 1DIBA 3DJFA 4I1IA 4IG9A 1RTTA 3PCTA 4L4XA 3ZBTA 1AJEA 1O5OA 1UP7A 3L8CA 2C4NA 1MJGA 1UP4A 4KIUA 4BVHA 2JAHA 1I4EB 1R5NA 3DPIA 2V3VA 4QU8A 1R0XA 2WQ6A 3HVHA 5BXQC 4R51A 1I7DA 2ZP1A 5BV1A 1O9GA 1FFXA 3M2TA 4FOLA 1D3AA 3T5BA 3V9AA 3REGA 3WLEA 5E38A 2Q2VA 3L1HA 4HGNA 2C54A 4I4TB 5KU1A 4KPFC 2EHDA 4QTYA 4A8TA 4K7JA 5KOIA 3I1YA 1CJCA 1F8UA 4K6MA 5F9HA 2ID4A 4MR9B 4BVBA 3ADDA 4KZPA 3LP6A 3UICA 5BMVA 3OQBA 1A9QA 4CLDA 2C5SA 4P54A 2EWVA 4FGWA 2BYTA 2HK7A 1PJAA 4IHQA 2JG3A 5DMXA 4X8OA 3AP1A 5KMGA 5B7NA 3IOBA 3MIZA 5FPKA 3STTA 2WV7A 3LUKA 2L42A 3L5KA 1W30A 4IDNA 5HIAA 3JQPA 3DD5A 3WOHA 2QZ9A 2QDXA 4MP8A 3NDIA 4IFIA 1FDUA 1SKMA 3QLEA 2ZDHA 2ZYTX 1ECJA 1YC5A 1FNNA 2R8PA 2ZBEA 3HFSA 3HJHA 5IJZA 4DXHA 1ARZA 3UB3A 3PICA 4IOMA 2HDNB 1GRQA 1IY9A 4U2GA 4XD7D 1SVNA 4JFRA 3KVVA 4JXJA 5CGQB 2IEGA 3NNDA 3BTOA 3S29A 4COKA 4FNMA 4DY4A 2CBZA 3EJ6A 3VAYA 4F4DA 5IKXA 3D7KA 3C3CA 1XZMA 1CY7A 3HXLA 3G9XA 3PXEA 4WKNA 5AW2A 3E61A 1XLWA 1E3WA 3Q5GA 1CU1A 2ZR0A 4X64B 1L5SA 2G4CA 1U7TA 2YV2A 2CFTA 5L8VA 4AQ7A 3EXIA 1HSZA 1YNOA 1Z4MA 5AI9A 3V1UA 1VE7A 2VHZA 5EJFA 4YCNA 4FJ2A 3OH8A 2JIQA 3B5JA 4K9PA 4PE5B 3NLLA 4J16A 4JVMA 2BR5A 4DV2B 5HP4A 2A5YB 5HOQA 1J90A 4NBUA 3EGDB 5HCUA 4EWLA 4ID9A 1SCQA 4WOPA 3FN4A 3L6DA 2V3CC 2J0SA 3RRMA 2GERA 5IFLA 1U1FA 5SZKB 4FM9A 3WBBA 1O08A 1CF4A 4Y9UA 4Q9NA 1WXGA 4ERXA 1ETHA 4JLWA 5HTOA 4LFBB 5KYWB 2VSFA 2B25A 4REQA 2P9GA 1E9BA 4UAVA 2AZDA 1IIRA 1H8HD 1J1IA 1AGNA 3E8MA 4B6GA 1RHKA 3GT0A 3IMKA 4EY6A 2ZW9A 3SOPA 2C3YA 3V5NA 4X41A 4AYWA 1B2LA 1QCDA 1ZGBA 4QQRA 1ZWLA 4GE3A 3I53A 3WMWA 5IBRA 1MAAA 1U0NA 2QBYA 2XB8A 3EFEA 2Z5GA 1PFQA 2DUWA 5FFMA 4IFBA 1ABBA 1CB0A 1E9RA 1RJDA 3PGA1 5HGJA 1EE9A 4U7DA 1XT6A 3F2IA 2VBFA 3PDWA 4I36A 2DHEA 3EFBA 4UBKA 1GNTA 1OC4A 3KO8A 2GI4A 1S8OA 3QK7A 3RVQA 3UJ3X 1WZIA 4YUZA 3GGOA 5IN5A 1Y4DE 3AF2A 5K4HA 1BKSB 1JHXA 1Y8AA 3AKCA 2XSZD 3EZFA 4GG1A 1EFPB 2YVLA 4TZTA 5IULC 5HUHA 1H05A 4W5HA 4B3HA 1PE0A 2B35A 2Z08A 4UTRA 1BMDA 1XRPA 2Q8PA 4G2NA 2VHEA 3NV9A 4C78A 3IQIX 5B1DA 3HA5A 1EVIA 3CRVA 1XEXA 2J5XA 5TLSA 2DTEA 3EPHA 4PFSA 1E2UA 3O21A 3HUUA 2Q1YA 2VDOB 5FPHA 3GEEA 3RFVA 5TT0A 2OD9A 2PL5A 2VPWA 2HV9A 2C4UA 3STUA 1PT9A 4RMJA 1SCBA 3VYUB 2HZBA 2JEZA 1JX6A 2PIAA 4PNZA 3TTWA 5LUAA 5HEKA 3T38A 2OCIA 2V8BA 1Y3FE 2MU1A 3VMFA 3HJGA 2ZSBA 2X1VA 5CPBA 5KYYB 4KMOA 3GRVA 4AB1A 3ZD6A 1EESA 2Y1FA 2PMCA 2YWDA 1Y9EA 1PR2A 3DTVB 2YASA 1R18A 2OG1A 3X1WA 3E8XA 3EEOA 2ZTSA 4NLLA 3W9YA 3LJKA 1Y4UA 4RDIA 1CB7A 3JZDA 2ZTHA 1CZKA 5LQJA 4RHUA 2DT8A 5FHRA 1ADGA 2ZSKA 5DM70 2VN8A 1SXGA 3GXBA 6ADHA 4P6VF 3L6UA 1S9DA 2GX6A 3OG9A 4IHJF 3ROGA 1RP7A 4F97A 2GETA 1XZLA 1LJLA 3EDRA 1PJSA 2P9QA 3GF4A 4Y30A 2XUKA 3AXSA 1P45A 1U3FA 1Z2OX 3GIDA 3ITKA 3LX6A 5E9JA 1U6IA 2FEAA 5C8YA 4YRKA 2A0KA 2CXRA 4P80A 3DEAA 5J47A 4MHTA 4C0KA 4BQSA 5ALXA 1KMCA 4FCCA 1MOZA 4EHHA 5K0TA 2VPXA 4LVCA 3GQBB 3HSSA 3L7BA 1LSUA 4N76A 1JFTA 5GZ1A 4YV0A 4H0NA 4N65A 1Z2CA 3W04A 4UU8A 3VC1A 5A5EA 4RDHA 2O8CA 1LI5A 2YWBA 3IKJA 3KR0A 4WERA 3ZXSA 4B1FA 5FPQA 3JYNA 3O4HA 4IMRA 3D6VA 4HWPA 1CZUA 4IDOA 5CYOA 3DLAA 3RT7A 1ZM9A 1DWUA 3GCDA 3H6HA 1YD7A 1E2IA 3DQQA 1H85A 1QGED 3JASB 4QIHA 1OXSC 1RXYA 2HF2A 4XJTA 3B89A 3DW3X 3WA6A 4RIFA 1X80B 2P2LA 4MJ3A 3EWAA 1VL2A 5KOHA 1IBMB 2QP4A 2MSLA 2Z2KA 1WUIS 3OZFA 1TQ6A 5GMOA 3HBJA 3M3DA 1S89A 3WJ2A 2H51A 2X8WA 3MJFA 1D2HA 4D0SA 5PNTA 1ZM3A 3GG2A 1QAOA 2AXQA 1OKKD 3C3JA 1T8SA 1ZAKA 3C1AA 2E4WA 1HE3A 2FEKA 2A94A 3GCXA 4X71A 2X5XA 1PX0A 4ENWA 4I1PA 1SH7A 3R7DA 4HL6A 1V41E 3KQQA 5LOVA 4RZXA 2YWCA 1PBNA 4BMOB 1CE8B 3KQMA 5IDYA 1BGWA 5TVGA 2VPQA 4P4LA 1JDUA 1GQOA 4YREA 3V2GA 4NEGA 1KR5A 3MIIA 4M8NE 1VP3A 1LPMA 2TYSB 3RHSA 3JW8A 2JJ1A 1G8MA 3PX7A 3G1UA 1ZNZA 5IUKC 3OZRA 5KS2A 2G4VA 2R8YA 3CLTC 3G02A 3MOSA 3QE0A 4OQDA 5DXAA 1CUWA 1WMFA 4MIKA 4OKIA 4JSRA 3BTSA 3ZVNA 2WZQA 3QPAA 2GTIA 1Y82A 3A3PA 4X44A 2PKQO 1Z8DA 5LZ8A 4ARUA 2X4LA 3EQ6A 3ZR4B 3K5IA 5AW9A 5FT9A 4GO1A 4PG7A 3GMSA 3TCKA 1Z0KA 4J0GA 3EVGA 1UL1X 2QRGA 4MJ7A 5A5FA 2F8TA 1ZN7A 3LPLA 1VL6A 3I1FA 2REOA 2XZPA 1GAQA 3DDHA 3VAZA 4DRXA 2YJ3A 1I5EA 1NW6A 3DFIA 3Q7PA 3SYTA 1NGSA 1CG6A 4JUIA 2R7NA 5L7YA 5EQJB 2YC4C 5KYUB 1V7QA 1XZDA 5AVOA 2RE8A 3GLFE 5B64A 2PLWA 3GC6A 4XH9B 1E1KA 3ZCXA 1QCZA 2VKQA 5AKHA 4WXRA 4QBHA 3KLOA 2FW6A 4D45A 3RS5A 2C7VA 1N0HA 3PX2A 4R5HA 4QU5A 4BO1A 2C7QA 4PONA 4HWGA 2Y4OA 2HAEA 1E4OA 1XXHA 1ACLA 1BC5A 2CE2X 2OLEA 3MEQA 5BVGA 4QOFA 1W44A 3HP1A 4NBRA 5F9FA 5CDYA 4BAZA 3DE4X 1NMYA 4O4JA 1Q1EA 1Y42X 3OOEA 4E7PA 5JW6A 3UXYA 1IH8A 4FCWA 3SCZA 2P7HA 4A5SA 3LDAA 3U61B 5M7EA 1IU9A 3CTPA 4NP6A 1XPJA 4N82A 4C4TA 1OX6A 3KXPA 3M6MD 4JHXA 4DDTA 3CUYA 5IC6A 3SQMA 5JNLA 1SY7A 1JHQA 3OMXA 4XQGA 2I8AA 3DF7A 5EZ5A 4A0RA 4FHCA 1Z6PA 4W5RA 1KYWA 2AQHA 4G09A 1CUFA 4Q1CA 3TXXA 1PZEA 3KOMA 5CEEA 3L7DA 3EUWA 1U02A 2BMAA 3PR1A 1XB2A 4XQCA 5ALDA 3ZIUA 4BNJA 1MXHA 4NAUA 4UPDA 3RVKA 1BOOA 2RJ3A 2VP2A 4JGGA 3G85A 5THQA 3RM3A 5L4SA 2NV6A 3U4DA 1G4UR 1QH8B 5FNVA 2ZDGA 3A6KA 3W0LB 3ZLVA 3CEMA 1LI4A 1CUBA 3VA7A 3N0VA 1N7GA 1NIJA 4CG3A 3NM6B 5HG0A 2X9NA 2QW1A 4HGOA 4TN1A 3K16A 3AY0A 2FW8A 3QYPA 2VHUA 5H83A 3MUFA 4KH0A 1Y5MA 3W77A 3WKEA 3IE2A 1H0SA 4C0LA 1TX4B 5TMBA 4EDFA 5E95A 3CISA 5B6IA 1L1QA 3U7RA 3AP2A 1SG0A 2WKWA 3BIOA 4FI3F 1TM2A 3L06A 1H23A 4JBYA 4YRQA 3RQSA 4PLVA 2G1PA 4BMVA 4GPD1 1GG8A 1X7XB 1P2VA 1RIIA 2NPIA 1ST2A 1SURA 5M29A 3GARA 4YCCA 3TRJA 5DP1A 5AW6A 1X70A 3O94A 4KTVE 3UJDA 4O2AB 1DEKA 4LBVA 1CEEA 1OAOC 4YAWA 4WVLA 3R74A 1T0BA 3THYA 1NUUA 1RABA 1TQ8A 4ZU3A 5AVRA 2F4VB 4Q3OA 4ZYZA 1PG0A 2X3YA 3SHWA 3KKEA 3PHIA 1RRPA 5GPBA 4FSHA 5G4KB 3K6RA 3AR5A 3A28A 4ZHQB 4ABTA 3LNCA 3PXBA 1TU4A 1CUYA 4EATA 3WIEA 4CLHA 4QEKA 1Z0JA 4RF4A 2H7YA 2G07A 3NIFB 2ENUA 3BMQA 1AG9A 3G8DA 4G3XA 4QXRA 2ADFA 2J32A 4HNGA 4KU4A 5FA8A 4ND7A 2ZVPX 5A02A 4GVPA 1ML4A 4YRBA 5ADHA 2H18A 1GZ3A 4D56A 3BZUA 5HF8A 4WJLA 1A98A 2QRZA 2W22A 1JEAA 1FMLA 1DKLA 4YGYA 2QTRA 4BPRA 1USWA 1SOUA 4POOA 2DPXA 4D46A 2GPBA 2DT5A 1TYEB 1EMDA 4CMKA 1X7GA 1KYVA 5FOVA 3TPZA 4YYZA 2FPLA 4EITA 4JXKA 3P20A 1M2GA 2R11A 3C7DB 1BKYA 1SO8A 4QE3A 3K6SA 4Q3DA 2OG2A 4B6OA 1PJ4A 1Z6YA 4HGZA 4GLJA 2O52A 1GPWB 3O4GA 4FKMA 2O8NA 4OFWA 4UUPA 4IEIA 1JYEA 4S2EA 3ULKA 2GHIA 1Z4JA 3W9UA 1FP4A 2P67A 4F0JA 3D5TA 3FSGA 1AF7A 1UBTS 3JQAB 2R5FA 4NZYA 4RELA 3IUMA 1H5NA 1AUVA 1L7BA 2DFTA 4L7QA 4PLCA 2YBDA 4YQFA 4D25A 1W52X 4WV3A 2D4HA 4AXBA 5KWJA 2DRIA 1DS6A 3HWX1 1GFZA 1LXCA 4JJIA 4GKKB 4DR7B 3RTEA 3OP4A 5ALGA 2GKOA 3IR5A 4G0MA 2E55A 4B6SA 2YJ6A 4G5FA 3ZKWB 5LCXA 2HJHA 2WJJA 4RL6A 5J2TF 3VVBA 3M6FA 4R54A 4FFBA 3PQEA 2V59A 2UVPA 3B78A 3PUYA 1JHUA 4WBXC 3PFWO 2RBGA 2Z43A 4NYJQ 2R2GA 4WI1A 2PUAA 1NUHA 4ARZB 2KW5A 2HSDA 1Y4AE 2X8LA 1Y6JA 2HT6A 1Z12A 2FZVA 4MP6A 4QOGA 5C37A 1R88A 1APBA 1P4AA 1QFZA 2GSWA 3B60A 4JH0A 2F62A 4LXGA 1FCJA 3I12A 3L6EA 5K05A 4XVQA 5CFOA 5JO0A 1T5HX 2IPAB 3L7LA 1EJBA 1YL5A 1Y4SA 3LNTA 3QELA 5GJVC 4E5PA 1B42A 1ZU5A 4OU5A 1FP7A 2VDLB 1O95D 2EFHB 2L2QA 3AU8A 3K0CC 1H69A 2CKMA 5L7TA 2VPIA 4BN5A 1R8SA 3QU2A 1Y48E 5DHTA 3I01M 5BT8A 1YB5A 4CLRB 1SXJC 2YW2A 3OWOA 2HEIA 3HB5X 2DBQA 2XF2A 1Z15A 4YJ3B 3BSWA 4B40A 1LV8A 1Q2UA 4AKEA 3L0BA 10MHA 4GEKA 5IEJA 1Q6ZA 4P4SB 5KYTA 1NOJA 2YX1A 3L8HA 3WLJA 4QARA 1TAHA 1AHPA 1X0VA 1XWWA 4WFIA 2C1ZA 5HS4A 3WI7A 1L9KA 3L8EA 3CJRA 1RQ7A 2WYIA 3MERA 3QKRB 1TCVA 4NS1A 1UFOA 4FMBB 5F23A 4QTXA 2I1QA 4LI3X 1JMYA 3A0UA 4DQKA 4LQDA 4AY5A 3UW1A 4JLAA 4M3NA 5FTLA 1NM5C 1GYPA 1G60A 3PJDA 1IHXA 2C3UA 3AUUA 3ABOB 3OOWA 4FZ5A 5F5NA 4UM9D 4BIMA 2ACKA 2VWHA 1HDRA 1HTBA 2VNIA 2PZ8A 7MDHA 4I1RA 4ILKA 4I19A 3IRVA 3CF2A 3W8FA 1N77A 4C4YA 1HDIA 2HCJB 2DE0X 1ZVQA 3RFUA 3H7IA 2HJWA 4RY0A 5C1PA 4PIMA 2I33A 4LWPA 2DKFA 3TQCA 4HFJA 1PL6A 2AH5A 1GLVA 2GBLC 3V6LA 3IP8A 1M10A 1ZXBA 4F6CA 1TFRA 2W8ZA 2XKJE 1OFTA 4JNCA 4NHOA 5KEIA 1NA5A 1Y1KE 1YQGA 4CM6A 4HDKA 3BDVA 2HO4A 1WZEA 3FR7A 4IOJA 3PJEA 4YCBA 4YJGA 2Q5CA 4HBGA 2OYCA 1UXGA 3HMQA 2X5JO 1E3LA 3CLTD 1V1MB 2O2XA 3DFMA 5K3OA 5F51A 5B1SA 1O6FA 3VVMA 3ZH9B 1SXJE 2X3UA 4YRTA 3B2EA 3M6XA 5LQUA 4TSRA 5FD8A 1PL0A 4RD6A 2GJSA 4NJMA 1LLFA 5HF6A 4F8JA 3DR3A 2PGDA 3IBTA 4HDSB 1QQ7A 4KN8A 1GZUA 2FPKA 3DTNA 1ZUHA 3K8YA 3FYHA 1U98A 4DLYA 5KKCA 3T4XA 3P8ZA 4Z0TA 4TTIA 3LE8A 1JIKA 1U1DA 1XK6A 3HBLA 4KPUB 1BO6A 3P5BA 4F4UA 2R9VA 3CCFA 5BNIA 1HKHA 2O9JA 2M6LA 3R3JA 2VJKA 1RHRA 1ADBA 4RLQA 2AN4A 3L5OA 2OZLB 1S4QA 4WDQA 2PZEA 5K3FB 4ZZ0A 3PNLA 9GPBA 1F8GA 3GEDA 3WGKA 4UNQA 3WJ7A 2X1LA 2FFRA 4JC4A 3JZAA 4LNHA 5U4XA 3AESA 3ID6C 4L07A 4B48A 3HC7A 2C2KA 3T9FA 3G82C 3PWKA 3MQ2A 3K9LA 3L07A 3PA8A 4CQMD 1V3VA 3C5EA 4YQZA 1YU9A 4TKVB 1W2WB 4URUR 1K6IA 1ULUA 5EEGA 1XZHA 4BLSA 4W63A 5G0WA 1JNXX 2H48A 4A82A 4DV3B 1UANA 4C4PA 1VLQA 5HKKA 5LVAA 2G5GX 3EPJA 3TLZA 1GGJA 4ZU6X 3VYTB 4M36A 2R8ZA 2XQIA 4DV4B 3PKZA 5B2FA 2Z56A 3I6ZA 3QPCA 3FUXA 1MO4A 1DC6A 3OQVA 1L4MA 3A7DA 3AHCA 3K31A 4JV5B 1CJTC 2HC9A 2VF4X 5GOTA 4KV7A 4RZHA 1EWYA 4J4HA 2OGWA 3CU5A 4LDPA 1ZLYA 4OHKA 1XUOA 2X7JA 4O2BA 4P9NA 4ZO4A 2FN8A 2FPOA 1JG1A 2I8CA 4OHCA 3KKPA 4D9NA 3CINA 2V0NA 3EBLA 5FV4A 5KQPA 3T5CA 1ZBDA 3NTOA 1JN0A 4OMUA 2UAGA 1QRSA 2N3ZA 3VH1A 4EJSA 2DERA 4IX1A 1JI0A 2IY7A 3PKJA 3K2BA 5CXXA 2Q0QA 4KE9A 2PLFA 2XVXA 3G7NA 3RVRA 1PDWA 1R7RA 2QTLA 4IUDS 3ZHQA 3AR7A 1LF5A 1QG2A 1WSAA 2B4KA 2Y05A 4WT7A 2B8WA 2GB4A 3PK0A 2ZDQA 4XPZA 3OCWA 3PQ2A 4B6FA 4F46A 4IIUA 4J43A 3ZBQA 2QW0X 1E5VA 1GTRA 2AFVA 4U7FA 3MFQA 5CT5A 3AZPA 3WYAA 4IDDA 1UIRA 4BKOA 1XU7A 2GCEA 5JTTA 4BYGA 4QELA 3BCRA 5A6SB 3KUUA 3EFOB 1D0SA 5IASA 2B2CA 4OQYA 1CKEA 1D4AA 2QVCA 3C24A 3N2KA 1LZLA 1QYVA 5LOVF 3Q2KA 2VP9A 1K06A 3AV0B 1MG0A 1SXPA 2P69A 1DV2A 4K9OA 3ORQA 1WB5A 1HDZA 1MC5A 4UTPA 1Z17A 3S6JA 2C94A 2NU8B 3DEFA 3DMGA 4FSDA 3R7SA 3ZWKA 2P6NA 5K6AA 1Y7IA 3LKZA 4N7MA 2XD9A 5EMJA 1GG9A 5DNVA 3SSMA 3FM9A 5IYZA 5JNSA 3TF5A 3AVWA 1WETA 3SC2A 1NFFA 3E3LA 2A4MA 4K8OA 4OSOA 4RPIA 2DF8A 2P9TA 1CD5A 2DUUA 2Y99A 3ZHBA 1C81A 4B2IA 1I33A 1E0AA 1UQRA 1PJ2A 3IHKA 1W5EA 2A1IA 2BKLA 3MWFA 2G28A 4JD5A 1VCNA 5DNYB 3AUAA 2C5FA 3IB6A 1RYNA 1E5QA 4MOWA 3HVJA 1X14A 3HDTA 1M2FA 1OFIA 4XLLA 3QMPA 4UEQA 2WG1A 3PNMA 3UAZA 3T9CA 2MYTA 3CUEF 3NTUA 3QF4A 3EIXA 4M0CA 5C8YB 2X4DA 3EVAA 1O94C 1W6RA 1TW3A 3KJIA 3TBFA 4KO1S 1KVRA 3D2CA 5E6SA 2BPOA 1RPJA 1ZGJA 2VYNA 3OLVA 5EXEA 3SS9X 1G18A 4IIBA 1TLTA 4DG5A 5DWVA 1K7XB 2X6RA 5D51S 1ID1A 3W6OA 2LKDA 4DLRA 3CN9A 2IBTA 4EO9A 4ARAA 1ZOLA 4XX0A 3N2GB 1SC4A 3CRRA 3RC3A 3QBJA 5CHYA 2GWRA 4PG6A 4ZN6A 5K1ZA 2K87A 3ZQUA 2QG9A 4ZO7A 1P7PA 4F2PA 3OC6A 4QICA 3JWHA 4HNAA 4TXMA 1UMDA 2EBFX 2EWWA 2P7IA 1OASA 2Z9BA 5TXGA 1N34B 1IE3A 3P2MA 1SUBA 4XQEA 3I01A 1J0BA 5D2CA 4HX9A 3SJCA 4BC0A 3VH4A 4H7DA 1UQUA 1UT8A 3N3AC 4G81A 4RMIA 1BX0A 3PQCA 3PJRA 1K9SA 1SQFA 1OXKB 2ECKA 2W9XA 1MXFA 4Z7JA 3A31A 5FP0A 4X6LA 2MINA 3HEBA 4HBZA 3SWWA 2AOWA 1WKVA 3LDUA 1QHFA 3AR9A 1XMPA 5AM1A 1T36B 2QU7A 2AG1A 2CYAA 1XQ1A 2LKCA 2PKEA 2Y76A 2H85A 3C6KA 3OVMA 4MUGA 3ABZA 1WDTA 1OI2A 3LUDA 4MP3A 4MQ4A 1FPQA 3I73A 1T4MA 4U4AA 5ECDA 1Y1RA 1ZD1A 4RF5A 3I6MA 1VECA 3PUVA 4RWZA 1A1SA 1IDN1 2OGUA 4UHDA 4FHDA 2OV6A 2QV0A 5COQA 1P1BA 4NG4A 1FQJA 4NQRA 3S1AA 3ZHUA 4DHWA 5JYBA 2HEGA 4H2DA 4P1ZA 5DSTA 5EWMB 1TECE 1SC6A 3QU7A 2W2QA 4DQXA 5FNVF 5JD4A 2BTEA 4DR6B 2WIAA 2IY8A 2WDZA 4PSUA 1GDTA 2PO5A 1JLLB 1EZ1A 3LDGA 1NLFA 3AR3A 3HA2A 3OE7D 5A3VA 4TS1A 4Y6LA 2R62A 1CQJA 3VR4D 1KK1A 3BN3A 1MAVA 3OPYA 1RWMA 5IAEA 4FXOA 4EKNB 4PCLA 1WCXA 1X77A 1B14A 1ZVKA 2UZIR 5DI3A 2X2PA 2ZBFA 1COWA 2CD7A 3MJEA 1AHHA 2CK3A 2W6ZA 2XYRA 3EDCA 4CL3A 1YRHA 2GD0A 1IWOA 2Q1TA 3HCNA 3AUTA 1N2GA 2YJTD 1DIRA 1TRKA 3AWDA 1AV7A 3OEEA 3UA4A 1ZQ1A 1KP2A 3U3JA 3I2KA 3WSVA 4BP1A 2Q6TA 4JLSA 5A3JA 9ATCA 1PK7A 1QYRA 3LWZA 2E4YA 3CB2A 3H1BA 2GFHA 3RVPA 3RVMA 4O1MA 1EDBA 4GDMA 2R84A 4YRJA 5AW0A 3Q1KA 3M5DA 3BXXA 5CB4B 3DZBA 4WASA 1VHLA 1P1CA 4B3FX 1DWQA 3AJAA 1QR6A 2A86A 2PS1A 3DM5A 1HDXA 2E2WA 2ZT5A 3DBRA 3ZU2A 4B6PA 3OJOA 4P93A 4O2LA 4FEGA 2F2TA 5EE0A 3ESRA 3FWPA 5JMOA 4AY2A 1WVIA 1JDTA 3ENQA 1B8PA 3LBFA 1Y0BA 3DTYA 4MR8B 4HV4A 2X0NA 4E4RA 1OXBB 2H1IA 1IY2A 4HEJA 4YHBA 1EG2A 4Z4HA 3MRTA 5AVUA 1FFGA 1YS9A 4QJ4A 3TAHA 1X39A 4X60A 2CUTA 1G2IA 4CIYA 1BVHA 4AXXA 1LWNA 3OF2A 1ES9A 5CVCA 4MRRA 3F46A 2QE7A 4BEWA 4WNCA 2ATEA 4GI5A 3DBLA 2JLVA 3HKBA 3IVAA 1QGDA 4BTEA 4C7OA 4DUPA 4LDAA 1B15A 1G5PA 2IT1A 3QOXA 3JTEA 4N3AA 5B7GA 4FE4A 5DO9A 3NHZA 5IM5A 5I4KA 2PAAA 3EG9B 2G40A 1U2DC 3UVEA 3RKSA 3ANLA 1H5QA 2RI1A 4LF8B 1PQ4A 4PC2A 4QGSA 4CPDA 4B4OA 3DT6A 4YAUA 3OX3A 1MVLA 1S7CA 1LPPA 1Z5PA 3PDIB 4MWSA 4UBIA 3S40A 4BE4A 1J2RA 1HNNA 3GJYA 4MVWA 721PA 3LIPA 1EQAA 4G0PA 4S1VA 2BV3A 1EB8A 2CF5A 2KBFA 4W8OA 4A8JA 5KDOA 2GEJA 1KI8A 4IAOA 3T34A 4TSKA 4CDGA 3X43A 4JB8A 1JQAA 2C1XA 2EJTA 2O8EA 2ZI5A 2ZI4A 3MJ4A 1USVA 1BS9A 1QH1B 1PR4A 4NZOA 5D3MA 1NVUQ 1OBHA 2EAUA 2BP7B 3UB4A 2OV4A 3ZH2A 2AUTA 3PFIA 4G26A 2R00C 3FYDA 3B6KA 5C8DA 3PL1A 1RQLA 1N8SA 3NTXA 3OLCX 2HGZA 1CUEA 3EGXB 4R1TA 3TM5A 3X2SA 4O1IA 3TOXA 2Z57A 3ZYZA 3N0RA 2HSWA 1V7PC 2IEYA 4CMIA 1VG8A 2QD5A 1GCAA 4TQAA 3TQTA 3U1TA 1DAIA 4C7XA 2IL1A 3PUXA 1SBCA 4FDMA 4LJ9A 1QP7A 2DFLA 2CNKA 2I2AA 1AKYA 1QHYA 1KL7A 3MTGA 4LSGA 4B79A 3NAQA 1CVIA 3RSHA 1UF9A 1Q15A 4TTTS 3QU9A 4FINA 3QMMA 2AFRA 2ZUSA 3AM4A 4PWYA 4JB3A 3KKNA 4K28A 4LDQA 1K8YB 1P4GA 1IZ9A 1XU4A 2D0DA 1X1CA 2IQIA 3GCGA 1MAWA 3HBFA 1Z7EA 4WCDA 1PUJA 4YQYA 1QFJA 4DSNA 1KK0A 3ZHTA 2HR1A 3KTFA 5K51A 4Q5IA 2BCEA 1AQIA 4F9FA 3E7XA 2AZXA 1DPGA 4JLVA 4ARIA 4JL5A 4EO4A 2VDMB 1RACA 3DR5A 3HR4A 4JNKA 1QC5B 4NOLA 4ZU1X 1L1EA 2XWQA 2YOGA 3QUAA 3THXB 2B94A 1I10A 4EHFA 2XD4A 1I4DD 5CLGA 2ZUCA 5FOUA 4ZOQI 1FBTA 1ZMTA 2JFOA 4WRRA 2ZPTX 4J8PA 2BTQA 4AZWA 2CMDA 3TKLA 5IZ4A 1PJZA 4NV1A 4DUGD 4EUFA 4F1KA 1GPJA 2AI2A 1WY7A 2BDEA 1RWPA 2ECPA 3HSKA 5AJTA 3RBZA 3WFZA 4PN7A 1YIOA 2JI9A 2XEDA 3ZTTA 4RXMA 1REQB 3CO5A 1M83A 2X3FA 1JFFB 4KAAA 4XWAA 4C20A 4XVUA 4RQUA 1G8AA 3TN7A 3WMEA 4I5EA 1YIDA 3UH1A 3R9XA 5EHNA 3AJ9A 5DSZA 4JL8A 2YC2C 4CCWA 5A2GA 3DFZA 1WLYA 1VI5A 1DIOB 3PLNA 3OIUA 3OT5A 3RC2A 3U26A 2V7TA 1II0A 2X5KO 3VM6A 4F84A 3CR7A 1OIWA 5CAEA 3V4PB 2RK4A 3BWCA 4OCZA 3LO8A 1CIPA 3C3MA 4N5MA 1K4YA 3DNFA 4KQ1A 3C1OA 1ISHA 2VH5R 3VHXB 4BRSA 4EUNA 4P7KA 2CL7X 2DBRA 4RVDA 3JD1A 3T7RA 3GLGE 4BB5A 2WABA 4X7MA 2O0KA 4IRMA 3AUFA 4YCMA 1N4DA 3PPXA 4LW8A 1DCFA 1P5RA 2WAYA 4ZAWA 4G5YA 4HXYA 3TLKA 1J49A 3HEAA 3ZGNA 1RKQA 1WS6A 2GCOB 4KZKA 4UCFA 4BX9A 4KX3A 5I47A 2XMDA 2FZEA 1A2KC 5ED0A 4PWZA 3ZU5A 3NHAA 3RREA 2XNDD 4TMWA 5T4FA 4TLAA 2PKRA 2RGYA 1QZUA 3CQ9A 3DEYX 3EQ7A 1RWVA 4ZVNA 3I9JA 2Z1MA 3LRPA 4MVCA 4DYDA 3JQ9A 1PSZA 2PGAA 3ZCUA 1O94D 5K8VA 1NT4A 5SZIA 4RTPA 4FEEA 3BG5A 2D59A 1WV0A 1JWAB 3HCBA 3Q40A 2JS7A 1JV2B 1MOPA 1G21B 2BFDA 1ND5A 1O54A 1UKAA 3FNRA 4QSMA 5LP1A 1U9CA 3CEHA 4C43A 1T4BA 1G5HA 1TLLA 1NI4B 4CT0A 3HI6A 2QTHA 1FTSA 1TU3A 4MS3B 4UHKA 3SF8A 4AMBA 3SBEA 1IQRA 3G8AA 3LX5A 3HJRA 1LK0A 2XVAA 4ZRMA 2DWQA 3VR2A 3UFXA 4BATA 3PI7A 3PT9A 1RBMA 3CS3A 2HK8A 3H8JA 4BGEA 1B16A 2HMAA 1FYFA 3LOPA 1G17A 2VJAA 3IMFA 4GXNA 3TW8A 1KQFA 5AJWA 2NQ8A 1DBRA 2BZ1A 4K9SA 4NBLA 4EB6A 3ZHZA 1PWHA 4GZLA 2WKQA 2I4IA 4BNLA 5DNDA 2AKYA 4BPBA 4GL4A 2JEYA 3WLLA 1UJBA 8OHMA 1TOAA 1XCPA 1WWKA 1FEZA 4PPNA 1R6TA 5J2UB 3S99A 1K86A 3G5AA 1P7WA 1C3XA 2Z2YA 3MG9A 4M0MA 3FGNA 4YT4A 2ZBGA 5KSOA 1NVAA 5JSKA 5BQ5A 5KVQA 3UGJA 3D3JA 4PSAA 4YY3B 2JFBA 3AR4A 3P9KA 4JJFA 3ZY4A 3C4JA 4CIDA 3DV9A 4XD7A 4JL6A 4DIMA 2DWOA 5F3RA 1I32A 5HBRA 4OK5A 2X2OA 4I50A 3USES 2Q4DA 4GDFA 5F2NA 3DFFA 2R1VB 1Q0TA 3DOFA 2ANCA 3R0XA 3QXCA 1M8FA 2AJTA 1ZGCA 4MCHA 4UXHA 4MTLA 1H2HA 4TWJA 4X6UA 1CIVA 4LS3A 2PGIA 3A2LA 5F52A 1E9FA 3L8YA 1CCWA 3IJ5A 4NEQA 2FDCA 5AVSA 1Z6AA 3E70C 1P6UA 2IPXA 3K4PA 3AEUA 3MUOA 5DHPA 4LDRA 4YRMA 1U8TA 6LDHA 2FSHA 1GSOA 2VATA 4JYPA 1A9RA 1DIHA 4LQLA 5KTTA 1E8MA 5JSYA 1SCUB 1L5NA 1FC0A 2PSDA 4ND4A 2QRLA 3GZTB 1AKEA 1RHQA 3C5WP 5IWCA 1EFUA 3GZJA 4YRRA 2GVDC 3PYXA 3CF6R 3A06A 2CDRA 3EF3A 4UDNA 2ZWMA 2CVQA 5EJMA 1C2TA 5IYZF 2Z3WA 1L0BA 2DPYA 2QZZA 4C04A 2BFBA 4XWKA 5KQRA 1I94B 3OA0A 1WQ3A 3GP3A 3V00A 2XB6A 3ER9A 2X42A 5FOTA 5TGTA 4YJ3F 1E9VA 5IT0A 1H4SA