1U90A

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related protein Ral-A
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
total genus 57
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u90A00
4C30A 1US8B 3ZH9B 3TE6A 1BS1A 2BDTA 1T5IA 1UKYA 4Q5IA 1KK0A 4EUNA 1ZM7A 5EP4A 5EXXA 2RCNA 5FOVA 4IFEA 4DJTA 3P1JA 2DFTA 3IIMA 1OIVA 5EZ6B 2MSCB 4DDUA 2ZI4A 3B78A 2KSQA 2OG2A 2NPIA 4FIDA 2I3BA 2WICA 4BFXA 2OXRA 2Z4SA 3BB4A 4MRSA 1W4RA 3WP1B 1Z3IX 4L4UA 1R10A 1QG2A 2AR7A 2R6FA 3LXRA 2P6RA 1JBKA 1RYHA 2GDJA 4NCHA 1E0KA 2EWWA 4V0MA 5B30A 2IYTA 3KJGA 4LPSA 2JLWA 1KGDA 4B44A 2MSDB 2Z43A 4AYXA 4CEHA 4KXFB 1NMZA 4LHYA 4JLDA 1KDPA 4IEIA 4QJ3A 5KOYA 1MABB 1N6LA 2QTHA 1XWIA 2DWPA 1VMAA 3LNCA 3P20A 5C4GB 2BHRA 5C2JB 1S4QA 3DM9B 2DCUA 1Z0KA 4NZYA 3QUSA 1ZYUA 4K8OA 5JEEA 1ZAKA 3EASA 3VFDA 4OQXA 1W1WA 2QNRA 2PCLA 3CX8A 4NBSA 3DZ8A 3KKQA 3U5ZB 3X2SA 3QPVA 2GJSA 1KO5A 4QJ5A 1F2TB 4FMCB 1WB9A 3C16C 4JIMA 4WW0A 1BMFA 2H16A 3GJ6A 1KTVA 4HI0E 2FU5C 2XAUA 4QNMA 3R9WA 5UKDA 2O5VA 1L2TA 3QVUA 3A8TA 1G8YA 4F91B 1DELA 1MKYA 1FQKA 4PC2A 2VQSA 4IVRA 1SXJA 2Q0HA 5FI1B 4G5QA 2ERXA 4L9WA 3MAAC 2WIAA 2IYVA 3A6PC 4QHTA 2QRZA 2DWQA 1JPJA 2ZS9A 3RDPA 3QEJA 2A5GA 1D2EA 2O0JA 1OXTA 2QTVB 2OILA 3TBKA 3SJAA 4AY2A 4BWYA 2W83A 4D25A 3AVXA 1AKYA 1SKQA 2BIFA 4KLNA 3TSZA 2IUSA 3MWKA 3P4YA 1G16A 4RD6A 3CW2A 5AUOB 2Q9CA 4ZDKA 3GEEA 3SNHA 3T15A 1ZNWA 5EP3A 1FTSA 1XXHA 4ZIRA 3BJIC 2DY1A 4EJSC 2XJ9A 3AF3A 3E2IA 2D62A 5K8LA 1G7TA 1SHZA 1KDOA 2VLIA 4M9SA 1FFHA 4D2IA 4C0HA 2HT1A 2E1RA 4IW3B 4TLBA 3QG5A 4OK5A 4CT4B 3JZAA 3R9IA 1CBUA 3PENA 4LPKA 3RRMA 4NYMQ 4M9QA 2VYFA 4TQAA 1GG2A 4RSGA 4Z54A 4G5RA 3QF4B 4Y0VA 3RS0A 4TQUS 1WBBA 4EFMA 2JJ1A 4LC0A 3BC1A 4RKFA 1XPUA 2L0XA 3PUZA 5JCZA 1DVRA 1CRPA 3CR7A 4C0LA 1FZQA 2CBZA 1Z07A 4MKFA 4NKRA 1AJEA 2FN4A 1Q3HA 3EWAA 1M6NA 5HZKA 521PA 3EZ9A 5G53C 4YMSA 3THYA 1CIPA 3NEYA 4MRVA 3D31A 1E79D 1CTQA 2JLRA 3D6TB 3SE0A 3KKMA 1QHXA 3FB4A 3NBYC 4CT5A 4W5JA 3TNFA 4TZ6A 2V8OA 3VR2A 4AWXA 3SS8A 5EE1A 1G3QA 1TF2A 2YKGA 1W36C 3TIFA 3SJZA 2WWYA 1CR0A 3ZVNA 4G3XA 1E99A 2FFQA 1JNYA 1IBRA 3TVDA 1Z28A 1E9RA 2OAP1 4Q4HA 2ZI7A 4MRNA 4A82A 2OUKA 1HE1C 3TUIC 1Z6YA 2IL1A 2WWXA 3E1SA 3FMFA 1GSIA 3JVUA 4OHWA 1QVAA 3HR7A 5C18A 2W58A 5AJWA 1G5RA 1VG0B 2Z4RA 3LW7A 4QG7A 4URUR 2ONKA 3UKDA 3L0SA 1MR3F 1RJ9B 1YR7A 3U3JA 5CB8A 3V9PA 1ZC4A 3U6BA 2O8BA 2CL0X 1II9A 3L0PA 4JT4A 4TYPA 3RS4A 3RANA 2EW1A 1T3SA 2G6BA 4RD2A 1WDTA 3MWLA 4HEJA 1DS6A 3KTAA 2W6JD 3KZ1E 5JWRA 3R7WA 3DO6A 3EC1A 4Z8YA 1G20E 1VCNA 1YVDA 1CJUC 1XD2B 4GT1A 4LHVA 4RFSA 3TQFA 1R2QA 1NIJA 1RRFA 3HU1A 4M8NE 4IOMA 2A78A 2QP3A 3KB1A 5H1YA 4NP6A 5E4FA 3K9GA 1E2KA 4A8JA 2REBA 2GZDA 4KBGA 3I72A 1NP6A 1RW4A 2JLZA 1WRBA 1P6XA 4MQBA 3GLIA 2EYQA 1WMSA 2JIZD 1SHKA 1YZLA 1QHNA 3OE7A 1Q1ZA 2LWIA 2AWOA 1XU4A 1YZQA 1W0KA 4FMBB 4HLCA 3PITA 4OJKA 1YRBA 4Q4HB 5IDVA 3T1OA 1XCGB 3H0KA 4A6XA 1B0UA 4MKIA 2GILA 3BD9A 4OHZA 3WHKA 2O8DB 5SZKB 4KSCA 3NC1C 3QOFA 4DSTA 4D4KA 4AYTA 1NBMD 1X8JA 3LVQE 1LF0A 4BLPA 3OF5A 3CBQA 4PC6A 3GMTA 3X1XA 2O8BB 3WYAA 1N5LA 2GA8A 3LRPA 4A15A 1OYYA 4CF7A 2OCBA 1SZPA 4PQYA 3EZ7A 2B7BA 4A6PA 1C9KA 1DOAA 1JPNA 1IN6A 4QFMA 3DDCA 2ZR7A 3U7GA 4RFSB 3BFXA 3B9QA 3B5JA 2C03A 5B57C 2WMOB 4U5XA 4KYIB 3CH5A 2V7QD 5AUQA 1R6BX 3SJBA 1RRGA 1ESMA 3TQCA 1GL6A 5H68A 3BRWD 3EZ6A 4KLZA 4MYTA 4UJ3A 1S0UA 4I1UA 1P61B 2ZRBA 3X1DA 3LBIA 4OK6A 4WBSA 4DIEA 3FPAA 3GLIB 4E5UA 2HLDD 3REGA 3U3KA 1SVLA 1TF7A 3CM0A 3H84A 4A0HA 3ND9A 2G0NA 2W0SA 4DEXA 5EQTA 4Q02A 1W4BA 5CJ2A 1F3OA 5ELXA 3AUYA 4LHZA 2VEDA 1DAEA 1S3GA 4L15A 4YMUA 2OBMA 5F98A 1Q1QA 1CLUA 4LBZA 4HB3A 1ANKA 4TSFD 2N42A 4CYMA 1E0SA 3KKPA 2R62A 4AG6A 3I3SR 5J4KA 2GCNA 4WVFA 5FPYA 1SVSA 1W2GA 3MCAA 4E09A 3L0IB 3SOPA 3CRW1 2JDIA 4GBMA 1OXSC 1OIXA 2HF9A 3SBDA 1I2DA 3VX3A 2AKAB 4DEYA 3N5CA 4PXAA 4PSAA 2C9OA 4PC3A 2HDNB 3TW4A 3ZGXA 1ZMXA 4HZUB 5LD2C 4DB2A 4D82A 1SVWA 1S8FA 1XRJA 2AFHE 3EW9A 3K0EA 4BFUA 3KQNA 1N6RA 2KE5A 3HPRA 3QXSA 4BEBA 1G6HA 4UKDA 1AGPA 5DYIA 4HLUA 2AD1A 1OLOA 2ORWA 3IKJA 4JLMA 2CLSA 2ZJ8A 4Q19A 2B7CA 3I73A 4JS0A 1RE0A 1TQ6A 3QXCA 4HYYA 2HXSA 1ZM9A 1P2SA 3CF2A 1Z0FA 1T3LA 4IVPA 4P4TA 2QBYA 1FP6A 2BBSA 5L3SA 5FUVA 4Q7LA 2HJGA 721PA 4Q48A 2FGJA 1DBSA 1YKSA 2QAGA 5CIWA 1XF9A 121PA 3AQ4A 2QSYA 3QKRA 4ZO4A 5BN3A 1BMFD 2HUPA 2P65A 3GJ5A 3C5CA 4UNRA 2QI9C 2ORIA 1JXMA 3FVQA 3VX4A 3ASZA 4DCTA 4NDZA 1Z08A 2W00A 4DXAA 1NN5A 2IEYA 1NKSA 4DLUA 2JGNA 2ZJYA 1DAMA 1E2PA 2J59A 2QL6A 2F3RA 5TARA 2Z0MA 5JSZA 1DO0A 2OE2A 2VIIA 1TQ4A 3EARA 1SVKA 2BKEA 3RS2A 4Q18A 2C98A 4H9GA 3QBVA 4QNRA 1XTQA 3PG5A 1AQYA 2H17A 1EK0A 5IK2D 3W3ZB 3Q72A 3FKSD 2FF7A 4HAYA 3PEUA 4M0LA 4N0EA 3MG9A 4B6EA 3VMFA 2RGCA 2NO9A 3KQKA 3SJCA 1E9AA 3KL4A 2OFWA 3KKNA 4D0LB 2WWWA 1BYIA 2ZVQX 3LAWA 3I1FA 4PO8A 1ZIPA 3WMEA 2BCJQ 4B3BA 3HU3A 4BLTA 4EAQA 1XPRA 5GJCA 1OJLA 3RRNA 5L3SB 1GP2A 3AP1A 2QAGB 5EE3A 2JJ1D 4JBYA 4B32A 2DFKB 1QVRA 1II8A 2CVFA 1FOEB 3THOA 3TR5A 2KBEA 4JJKA 1NBME 2PMDA 4OQLA 3QPWA 3MJHA 3W90A 3TAUA 3NHAA 1E98A 2GJ9A 1NSTA 3CNLA 5L3QB 5JHHB 1XP8A 4NL4H 1TPZA 1GKYA 3ICEA 1TQDA 3IBYA 4LY6A 4O2LA 3TVTA 4A1FA 3LBHA 2WAYA 3CRQA 5E95A 4C3ZA 4TN1A 4AC9A 3K0SA 1PUIA 5EUMA 1BO6A 1F2UA 2JLXA 2VHTA 3LY5A 2C95A 1G1MA 3E70C 2Q3MA 2GK6A 2WIBA 4KCGA 1UDXA 5J5CA 1E1RA 1HEIA 3W34A 1P9RA 3K0AA 3RSLA 1TNDA 2ZAOA 2YZ2A 4QC2A 2O8CA 2H18A 4CZ2A 2LKDA 2ZRGA 1P9WA 3SBEA 1TUIA 2XTMA 3BBPA 1ZP6A 1KJYA 3AF0A 2VP9A 3SQXA 2A5DA 4DZZA 3FMPB 1M2OB 1E9CA 2RMKA 2JLVA 1XFAA 4G1UC 2VP4A 5ANRB 5KDOA 3UPUA 4BQSA 1G41A 1OHHA 3TSOA 3VNVA 4FWTA 3DOEA 2YHSA 4Q4AB 1DG3A 2IYQA 3AVUA 4Q1FA 1YZGA 1LV7A 4V02A 1MO5A 2XEXA 3KKOA 4ZI2A 1U9IA 4BASA 621PA 2IYZA 2NMVA 4Z51A 4YMWA 4D26A 2H92A 4URYR 5CYOA 2FG5A 2BVNA 1UKEA 2IYUA 2O52A 2ZYUX 1DG1G 4BFZA 3K09C 4ABYA 4MDEA 3CRRA 1W44A 1SVMA 1XEXB 1NLYA 5L3VA 1JR3D 1N2CE 2GXAA 2QSZA 2RGGA 3CIOA 1W46A 2PLRA 3THXA 4EQ6A 2VHCA 4HB0A 3CRMA 3I32A 4FN5A 2QM7A 3SHWA 1IJFA 3SZRA 4RY2A 1N6HA 4C0BA 2BBWA 1G8FA 3PFIA 3S1AA 1YR9A 4IDNA 4QJ4A 4RZ2A 3W8NA 4EIWA 2QORA 4TLEA 1R0XA 2AFIE 2NO6A 4LJAA 5DE3A 3C14C 4FCVA 5SZIA 2IUUA 4V0OA 1IXZA 4NYJR 5J4LA 1R0ZA 5FOWA 1S1CA 1Z8FA 1COWD 1W4AA 2BJWA 3OFND 5FBQB 1KZ7B 2R8RA 2ZJZA 3M1IA 4DSNA 1OPXA 4TTRA 4Z8XA 3TK1A 3B85A 4Z1MA 3DKVA 3EX7C 2VPPA 4U02A 3TLXA 2VA8A 4BZPA 3K70C 3GLFB 2RGNC 1EFTA 2A7QA 1P75A 3QKSB 2GCPA 3CRVA 4NYJQ 1AS0A 3B1WA 2GKSA 1C4OA 3AV0B 4AKEA 5G3YA 2GXSA 4OI2A 2AXNA 2ZRMA 1RYFA 2GJ8A 4DLZA 4LJ9A 5AUNB 1E0JA 4AK9A 3NBFA 5KNCA 1CR2A 1T6NA 4BFYA 4IOKA 3K1JA 1T3HA 2QROA 3W9YA 4UNQA 1G8HA 1Z0AA 2C96A 3HPQA 1IY2A 4I99A 1US8A 4JVLA 1LS6A 4B2LA 1FNNA 1NBMA 1OXXK 3U44A 4IOJA 2CJWB 4A4DA 4C0KA 4W5WA 5H8WA 5IHPA 1UFQA 2FOLA 1ZJ6A 3K9NA 4TT3D 5JJLA 3TJZA 3S1AB 2AN9A 3SDZA 5GVRA 4I1OA 1HQCA 2QMOA 2BEJA 3BERA 3TW8B 4D4LA 1KNQA 4JBXA 1N6OA 1U99A 1RZ3A 2J46A 4JZKA 1NY5A 4P31A 1X8LA 2VP2A 4PHTA 2V7QA 4KYUA 3KXLA 2QUZA 2OLJA 3NTUA 5J4VA 2XNDD 1YU9A 3SN6A 3FMOB 3KQLA 1MABA 2WSSA 2IYRA 2J7PD 5EJEA 1BKDR 3B60A 2IYWA 3DKPA 3U3MA 1DE0A 3H1TA 4QGGA 2EFGA 3AGQA 4B3CA 1ZM4A 2Q9BA 4Q66C 4BPBA 2HLDA 3L0OA 5EXTA 2YYZA 4ACAA 1Q1EA 2EU8A 2DBYA 3GFOA 3NVAA 3PQCA 1YRAA 4KFSA 1UKVY 2KBFA 2H7VA 2ZYVX 1FNMA 4QOSA 1W48A 2ECKA 2NOAA 3PEVA 2ZE5A 1J8MF 4XTRA 3Q85A 1W5SA 3I92A 2QN6A 3T12A 2WPDD 1F2TA 2IBMA 2ZI5A 1NY6A 4TSFA 3GLGB 3U44B 1U2RA 4MRRA 3OAAD 1U8ZA 4GRAA 2D06A 4QBHA 4ILEA 3U7HB 2GWHA 3OIUA 2Z5FA 1S1MA 4Q1EA 1Z0IA 4YDHB 1S96A 2JATA 2OBLA 3KQHA 4DLWA 4TLAA 1R7RA 2VO1A 3QVVA 2IWHA 2WAXA 2ZE6A 2R2AA 1YZUA 4BZXA 4ACBA 1JAHA 2WWHA 1Z0DA 4Q9KA 2F9LA 1XJ0A 1Q57A 2D2FA 2V1XA 4Q1DA 4RZ3A 1XD8A 4LDJA 3AB3A 1KO1A 5FUWA 4PC1A 2QG6A 3AVOA 2EFEB 1XEWX 1LNZA 3T34A 2XZLA 2QP9X 5FPHA 4C0QC 1W5TA 4OHXA 3BE4A 3N70A 3CX7A 4AKIA 1V43A 2F3TA 2ZROA 3M0EA 3U3OA 3QPUA 3LWNA 3LD9A 3C7KA 4L9SA 5JMTA 1VECA 2R6CA 1YZNA 1L4YA 4WZAE 4NCIA 2OEPA 2ZRNA 1G5TA 3O8DA 1QHIA 2UVQA 3AGPA 3LV8A 4EPYA 4JVSB 4RD4A 3MWYW 5TXGA 3QF4A 2X8AA 2J0UA 2BMDA 4F4IA 4URZR 1EFUA 4FCTA 3BFVA 1JQLB 2ZR9A 4R9UC 1JR3E 1S9DA 1VYVA 4S2EA 2HJVA 2X1VA 4HZIA 2C5LA 4K81B 5DI3B 3RC3A 4IDPA 3GLIE 2CLCX 2BMEA 5BN5A 1CJVC 1AS2A 2NPFA 1IHUA 5KSZA 3NDBB 1DAFA 5FOSA 2ZPTX 3EA0A 1GVNB 4XWOA 3THWA 2ERYA 4HATA 1N6IA 4XD7A 4B33A 1XCPA 3AH8A 5M04A 1E2NA 1KI8A 1BOFA 4LRWA 3TRFA 4JYCA 1KO8A 5BXQC 1P2VA 2W0MA 4Q03A 2F43B 3I8SA 5IK2A 4FD2A 1N6NA 3W6PA 2XJ4A 3FKSA 3WNCA 2QA5A 3FHTA 4A36A 2J7KA 4NYMR 4DHEA 5DN6D 3K0FB 2X19A 4EJSB 5HCIA 1QHGA 3U7FB 4TL7A 3IPYA 3A4MA 3N2EA 2ZRLA 2ZU0C 5FOXA 2FJUA 4W7SA 4B2IA 4FXPA 4NCJA 3FHCB 2VF7A 4I81A 2GAAA 4TMXA 2VHJA 1RJ9A 5A0FA 1VIYA 1BH2A 2C9CA 3SFVA 4LX0A 1NSFA 4EPWA 4ESHA 4PO1A 3B1XA 1M74A 2KI5A 4WOPA 2J0UB 4OI0A 2HF8A 1NN0A 1ZUHA 2GEDA 3NG1A 1E1RD 1J90A 1U98A 2UKDA 2ZRIA 3UG7A 1M7HA 4LK2A 4I1SA 4TL6A 5JECA 1X1SA 1W49A 1XD2A 1KIMA 5KNDA 2BV3A 4V0LA 3RNLA 3BS4A 2EQBA 2XZPA 4L5BA 1VYTA 3C8UA 1OH5A 2FFAA 2PZFA 1E1QD 5DHFA 8OHMA 3C4JA 1Z5ZA 3RLFA 2X2EA 2FGKA 5CM9C 3HR8A 4JSYA 3THWB 2XGJA 3A1VA 3L8ZA 4OHVA 1OHHD 1NI3A 2NGRA 1X3SA 2ANCA 2WKQA 1KSFX 4A2QA 2ZRJA 2DHRA 4GL2A 3Q8XB 3FMIA 1VKJA 2CXXA 3KQUA 1W36B 3HYRA 1GRRA 2A3RA 4Q9IA 2G9NA 2DFNA 1OIWA 4X8MA 4BFSA 2ODNA 1UM8A 3A1UA 2ZANA 2IYXA 1HT2E 2D4HA 3IQXA 2R6AA 3CZQA 3FWYA 1SXJC 3W5JA 4C0JA 2O8DA 4QBGB 2CNWD 1LW7A 1L8QA 1T0HB 2N46A 4C7OB 3MGCA 4EPXA 4JVNA 2QM8A 1A5TA 4QHSA 2QPAA 4MRPA 2FH5B 4LBVA 4W5HA 5J40A 2QENA 3P4XA 1DTSA 3DOFA 3Q5EA 3ICQB 2GK7A 3GJ3A 1TL7C 1JI0A 3BB1A 1TAGA 5KYKA 3V4FA 1CR4A 1VHLA 1Y63A 4ZCIA 4KVAA 5JFGA 1GNRA 1OFUX 5DISB 2WWIA 1E2DA 3UIEA 4JLVA 1Z6TA 4JT2A 4R71A 4PX9A 2IHBA 1ODFA 5AJXA 4HUTA 2IXGA 3VR3A 3ZIAD 3QI2A 4JLKA 3BH7A 1IAQA 3B7GA 4IDOA 5FR2A 1NLFA 3WYGA 2YINC 1RPZA 3U6KA 4NCNA 2VL7A 2HYDA 6Q21A 4Z1MD 2MMCA 5JBQA 1JR3A 1CJKC 1XJQA 3LFUA 5FBLB 4KVGA 2B6HA 1IXRC 4QGAA 1AZSC 2BMJA 4GI7A 1N25A 3WYFA 5HE9A 4AURA 4CRWB 4PAQA 3H2YA 2K5UA 1LVGA 5EE0A 2G1KA 1QHSA 2RKOA 2CL6X 4WA7A 1E9DA 4ZDWA 1KKLA 3LLUA 3H4MA 3SI7A 1YZTA 1D5CA 4XVUA 1RRCA 3FTQA 2OCAA 4YXWA 5CLQA 5KSOA 2GXUA 2ZSAA 3A1WA 2FSHA 2PZGA 1EGAA 3WXMA 1YE8A 3LVRE 1PLLA 5FR1A 2WOOA 4A0FA 1GITA 2F1HA 4MUBA 4PZZA 4AG5A 1KSHA 4ASUA 2QMHA 4MDFA 5TDHA 2PBRA 1II0A 5EE9A 3T06B 3ETLA 1COWA 1E0AA 3OFNA 1NLZA 4K46A 3NH9A 2VSFA 3R9XA 5CJPA 3RSOA 2B21A 4IFBA 3LA6A 5HTKA 4D80A 1DO2A 2IUTA 1PUJA 4BLOA 1ELOA 1P60A 1RIFA 2HV8A 4QL3A 2O8FA 4TLCA 4Y0AA 2FNAA 5DNYB 2B8WA 4Q9LA 1M7BA 5FTJA 3RAPR 2P3SA 4LJ6A 4IEEA 2JEOA 4HZUA 4E07A 1N0VC 1P3JA 5DI9A 5JJKA 3ZQ6A 1Z83A 1WQ1R 3CR8A 3SYNA 3MD0A 2R65A 1OV4A 4TWZA 2ZE7A 2WSSD 4B75A 2PH1A 4XJXA 3CWQA 2PZEA 3U4QA 3LX5A 4TZ0A 3GJ4A 1GOTA 3RS3A 2J41A 1E4VA 4DLTA 1E69A 1TQ2A 2I1QA 4HB4A 4B34A 4BUJA 2GAOA 3Q9LA 2V9PA 2A30A 1OT3A 2QQ0A 3HWSA 3KJHA 4DDVA 4NCKA 1F48A 4MH0R 4TT3A 2FSGA 4O2RA 1ZNYA 2V6IA 3K8YA 4GFDA 3IDQA 3CWZA 5AWFC 4B3XA 5JI3E 5FBVB 2EFHB 4A8JC 1LFDB 2YJTD 5AR1A 3QKUA 1Q0UA 4OK3A 4IVQA 3CPJB 4UXHA 4LWZA 3RS7A 1TEVA 4Q9JA 1TX4B 4HUQA 4EFLA 5EUQB 1CJTC 1GL7A 4JL6A 1FX0B 4IHQA 4TQ9A 4LI0A 1MOZA 4M1SA 2XNDA 4FINA 2ZS8A 2J7PA 1RVDA 3TSWA 3PEYA 3IILA 5E7JA 1E2LA 4M9ZA 2PX0A 2IEZA 2OFXA 2O8FB 1KI7A 3CH4B 1ZU5A 1DAKA 3EG5A 4GOJA 1UEJA 5CB6A 2V4ZA 2ZVPX 3RABA 3EPKA 5LD2B 1IM2A 1F5NA 1E9SA 3K9LA 5C1BA 1KOFA 4ITRC 4ERNA 2ZJBA 3ZLJA 4YMVA 4GMXA 1A7JA 3G0HA 2ZRKA 3GLHB 3U4QB 2WHXA 4D4MA 2ODBA 2QT1A 3A4NA 2WPDA 4DDWA 5GJBA 2P0EA 1KI4A 3KB2A 4YDSA 5CK4A 2WJVA 5E7IA 1NJGA 1Y3AA 4IKEA 3GLFE 1UBFA 4G0NA 2ZS7A 2ZXUA 3OAAA 4CEIB 1FL9A 4R2IA 4GZLA 1TUEA 4G01B 3WNBA 4A0GA 4AKGA 2JJ2D 3X1WA 4V0KA 2GBLA 3KUCA 1IXSB 3BGWA 2IYSA 2REXB 4B3DA 2F1IA 4L16A 2PCJA 3VHLB 1OE0A 1MRSA 1P62B 3QXHA 1U90A 4MYCA 1AIPA 1KY2A 1HV8A 3G5UA 1X6VA 4NTZA 4GP7A 2GJAA 4HUQB 4Q9HA 2GCOB 2ZSFA 1KK1A 4B71A 2ZIAA 2GTPA 2OT3B 1R8QA 2P2LA 3OIYA 3LH5A 5D3QA 2QPTA 1IQPA 3LXXA 1J99A 2I1VB 4KJZA 3HYTA 1SQ5A 4UNSA 4JL8A 5L3QA 1BIFA 1P2UA 2G0TA 4US0R 1JXOA 1QHHB 4ZI3A 3VKGA 3CNNA 4KFUA 4LHXA 2VP6A 2YOFA 3B1ZA 4NHOA 5BYJA 2IS1A 2W6IA 3PV0A 4RJLA 1N5JA 4LV6A 1P9NA 1G7CA 1JJVA 4XD7D 3VTKA 1TMKA 1KYIA 1G3IA 3CNOA 5FFMA 1W36D 1EG7A 1GL9B 5DGXA 5D3MB 2AL7A 1M8PA 4Q7KA 2BOVA 1G7SA 2EVWX 4Q1CA 4UJ5A 5FOUA 1NG1A 1T0JB 2GZAA 3QJYA 4GPTA 3ZD7A 2GZHA 4POAA 1KDRA 3BK7A 5DH9A 4JJZA 1EFRD 1AM4D 2QMEA 2P5SA 3GJ7A 4DCSA 5JCPA 2OBNA 1D2NA 1Q21A 3A37A 3Q7PA 1PVOA 1IY0A 4OI1A 4F92B 1K8RA 3DEFA 1E2MA 2ZRAA 3CB4A 2PL3A 1GRQA 2JLSA 3IO3A 3AKEA 5CYPA 1R4AA 5FH9A 4TL9A 1RKBA 3R20A 4OQMA 1AKEA 2XSZD 3B8HA 4HSEA 1DADA 5TY0A 1X86B 2GRJA 5FPKA 4RZUA 1NMYA 2V6JA 2Q6TA 1E6CA 1CF4A 5CLLA 2KB0A 4PR0A 2QGNA 2ZSEA 2PX3A 2CHVA 1CRQA 4P0TA 4HLUC 5TMPA 2YWGA 1GILA 4Q4AA 2LCFA 4US1R 1G3MA 1IONA 1CULC 1M34E 3BIFA 3RVBA 1TTTA 3GLGE 1KMHA 3CX6A 1JECA 1WXQA 3UMRA 4LZZA 3PEWA 2J0SA 2IS6A 5DN6A 1ZUIA 2ZI9A 3K09A 4PZLA 5CK5A 1K5DA 5A4JA 3EIEA 4KFTA 4M22A 5AJYA 4D0GA 1XEXA 2F9MA 4DBLC 2QEQA 3FOZA 4DT1B 3Q7QA 3B2EA 2WBLC 3FFBA 4LBWA 4RCYA 2RHDA 2O0HA 5FBWB 2V54A 5KNBA 4N1AA 2XTZA 4Q4JB 2WSMA 5IF9A 3PUXA 3GPLA 3GP8A 3AF4A 3IQWA 1T8UA 2VH5R 4MGZR 2B8TA 3KXKA 4LGMA 1PZNA 3W3AA 3FHOA 4GMDA 3TUZC 4QKQA 3EPHA 4YONB 4F38A 4GZMA 5J4YA 3ADKA 221PA 2C9YA 2WOJA 3PJRA 3CUEF 2FFHA 5EE5B 3ZVLA 5BYKA 2ATXA 1GKUB 4GDFA 2H5EA 2JA1A 3UMSA 2GJKA 4P4SB 2XXAB 3I5YA 5HE8A 1ZNXA 1KSGA 1NL3A 1E1QA 3W5IA 2YWFA 5J4HA 1VTKA 3HU2A 2GVZC 3CKLA 1GKIA 1E9FA 1NF3A 3NBXX 5TVKA 2DPXA 2YNMA 1W47A 2MMGA 3SR0A 5K8TA 2ASEA 4DLRA 3GLFA 4QRHA 3LO5A 2ZAMA 3M6AA 3QKSA 4LCBA 4PO9A 5FL3A 2V1UA 3U61B 5AJZA 1KMHB 3GEIA 1A2KC 3PR1A 3Q5DA 1N6KA 2GVDC 4HLDA 4M53A 3EZ2A 1GWNA 2RHMA 1FQJA 5DO9A 4PAMA 2OO7A 4QBFA 2CNWA 2EWVA 1KI9A 3MMPA 1B23P 1NRJB 2ZUBA 5HKKA 1XTKA 4NE2A 3T5DA 3VR1A 5GVSA 1YR6A 3ONWA 2JLUA 3H86A 2JLQA 4BRUA 1L4UA 4UXJA 1RFLA 2IW3A 5KU1A 4MUAA 2CJWA 4UNNA 3KJEA 3RWMB 4C0AC 4S35A 5GJVC 1WBDA 2Q3FA 4FMDF 4PSKA 2F1JA 4O3MA 2WM9B 2WKRA 3BORA 4DKXA 1NIPA 2C99A 1UAAA 5KSPA 4YXWD 1HURA 3P32A 2RGAA 1P2TA 4A2PA 4PTLA 1A4RA 4ASUD 1Z6AA 3IO5A 1Z2CA 3ZIAA 5HPYB 1CKEA 1HA3A 2X2FA 1NN3A 5L8VA 2AD5A 1J2JA 3AF1A 4G5SA 3BXZA 2F7SA 2OLKA 2ZYTX 4QGHA 4B35A 4DVGA 1CP2A 4TYQA 1GDDA 2BM1A 2XOKD 2IF2A 1RRPA 1VG9B 3BH6A 3K70B 2BJVA 4HB2A 4DSUA 2WWGA 1QBKC 1N0UA 1S2MA 2CVHA 1MH1A 3PUWA 4RCZA 3DHWC 3EA5A 1O87A 4TMWA 1R0WA 1DARA 4EPVA 5A5GA 4V03A 3WBKA 2YC2C 4Q4LA 2AX4A 5KSYA 1A2BA 4DCNA 2X77A 3K53A 4YQFA 3P27A 3VAAA 5IRCD 4TMVA 3DPUA 4D4JA 1N6PA 2ZRCA 2ZUCA 1G8PA 4W9MC 2DR3A 1E2QA 1KI2A 4JKIA 3CPHA 4MITA 1Q12A 4QHYA 3GLGA 2ZITA 3UG6A 4DCUA 4MKGA 5KTYA 5JS7A 4PPFA 1UBEA 1X1RA 1U9IC 2JCSA 3E5HA 4KODA 4DC9A 5F3WB 1OFTA 2QT0A 2IS2A 3NEJA 4XIGS 1QDEA 1GIAA 4HAVA 2XZOA 4BLSA 1L7VC 2R44A 1SVIA 5CM8B 1EX6A 4BFWA 1ZVQA 2XNSA 2ZI3A 2ZI6A 1AQUA 1XZQA 2CHQA 3CF0A 1G7RA 2GEVA 2YWHA 2NZ8A 2LKCA 5FUYA 5JHGB 4BLQA 4RKEA 4LJ8A 3A58B 2CCKA 4L8GA 1DPFA 2A2ZA 2D74A 2CK3D 4FCWA 4CEJB 2V3CC 3U3RA 1WF3A 4LJ7A 1K6MA 3CO5A 1S3SA 1U0JA 3VR6A 3MRSA 2W2XA 2YOHA 3K0CC 4NPHA 5KPDA 5F9FA 1TADA 1CXZA 2QU8A 1KI1A 3VNUA 1F6BA 2JLYA 5KPJA 3G82C 4OL0A 3WRYC 2IXEA 4QBIA 5FTKA 3V4RA 2OXCA 3BFKA 4M1YA 5HR5A 2WTUA 3AVWA 2PMKA 1E2EA 1H65A 2FX3A 2A9KA 3EXAA 3QBTA 3T5GA 4A2WA 3UATA 1FMLA 3I4LA 5LB4A 3IEUA 1G8GA 5DI3A 2GNOA 5KO2A 2CEAA 3JZMA 2R9VA 4P3YA 2IF0A 2HYIC 1XEFA 2PEZA 5JS8A 2FA9A 1ONBA 2B92A 2D7CA 2J87A 3LQQA 1AK2A 3NH6A 4NU0A 4QGFA 5FL7D 3T1QA 5JEDA 2AK2A 1UF9A 3AP2A 3SYLA 1X8KA 3L82B 4KO8A 1JQJC 2PJZA 4WXRA 3REFA 3QSYA 4KITB 2FMXA 3F0TA 3F3YA 5EZ5A 3TAHA 3NC0C 4TL8A 1HY3A 2JASA 2F43A 3X1YA 3MJRA 2NO7A 3ZD6A 3CPEA 4F93B 4MGIR 4RFVA 4EPRA 5BW8A 1H8EA 1HYQA 5LPNA 2WMNB 2BC9A 1HH4A 1P5ZB 1XX6A 4M4SA 3K0FA 4EJSA 4XVQA 1XTJA 4XWKA 2YVUA 1MO6A 2W6ID 4LUCA 4Q00A 4HAXA 4TTQA 1Z6GA 2QE7A 2RAPA 2OCYC 3C5HA 4B47A 2FPLA 3CF6R 2REOA 4RD3A 5B58C 1O3YA 2JJ2A 3A1SA 5CIQA 4IXNA 4RD0A 1HTWA 1I4TD 2A5JA 4V0NA 1G3RA 2NG1A 4XTCS 4G5OA 5K8IA 4DDTA 4ARZA 4O25A 1Q1BA 4B3FX 3QG1A 1NVUQ 4P33A 2NIPA 3KDSE 3QEOA 4UQOA 3RS5A 4DLXA 5DYGA 3I62A 4TMKA 3Q3JB 3U7EB 3P26A 1T8TA 4B3GA 1P72A 1GNPA 2ZETA 2FSIA 3C15C 4MYHA 1E96A 1E9EA 1T5LA 4Q47A 3IIKA 2ZEJA 3NHBA 1U8YA 2ZJ5A 2P6UA 1XCMA 4WZ6A 3OEHD 2QAJA 2ZM5A 2QY9A 4DLVA 2AWNA 1FUUA 4FMDB 2GETA 1GUAA 3VR4A 1YZKA 1W4CA 1LTQA 2YOGA 1VHTA 2E87A 3AUXA 2HT6A 3EIQA 1EFRA 5LB2A 3A4LA 4KI0A 1GM5A 3NXSA 4J0QA 4C7OA 4C0SA 3GJXC 5DSZA 2IYLD 1ZD8A 1KJZA 4LBYA 4PQFA 4JVMA 2KWIA 4P4UA 2IHYA 3IBGA 2XSZA 2HCBA 1YHNA 1V5WA 5E7MA 3U60B 4HAZA 2QGZA 1AN0A 1XB2A 4CEHB 2MSEB 4YLGA 4JYBA 4PHHA 2BMFA 3AVPA 1E2FA 3GLHE 3A1TA 3FFAA 1SKYB 4ARZB 1T91A 3MSXA 1E2HA 2FE4A 2OAQ1 3D7MA 2G77B 3GJ0A 1Z47A 1NVXQ 2C8VA 3TKLA 4M9XA 2DWOA 1VPLA 2A5FA 2J5XA 3IEVA 1KO4A 1YR8A 4DCVA 3OESA 4TYNA 1R5BA 3B1YA 5E3HA 1IN5A 1KAOA 1ZBDA 3B6EA 3ASYA 2EFDB 1J8YF 3A36A 3K70D 2E9SA 1ZINA 5AUPB 2Q9AA 4JLAA 1G4AE 4C9BA 1QZXA 4PANA 4PPNA 1E2JA 3AEZA 5CDFE 4KV9A 1VCOA 1M7GA 5JI2E 2D7DA 1SXJB 1JAIA 2O0KA 4YC7A 2IC5A 3OZXA 4D81A 1ZCAA 2ZJAA 5G3ZA 5HKKD 4LSGA 4QM7A 4KBFA 3AVVA 3OHMA 2WZQA 1D9ZA 1ZU4A 2XB4A 1N5IA 1PV4A 1I4LD 2FZ4A 4DB4A 3EPLA 2SHKA 5HZHA 2DFLA 4NH0A 3HDTA 2G3YA 3LDAA 2GEUA 1AA9A 1OH7A 3FYHA 5KHOC 1MO3A 1OSNA 1R0YA 4B43A 1XXHB 4HLQB 5GJWC 1EWRA 1IJEA 1F60A 4X8LA 1E2IA 4CW7A 4ZIRB 3ADCA 1NKTA 2OHFA 2IWRA 4BZQA 4LOAA 1U94A 1SVOA 4Q1BA 4GSYA 1I4DD 1W0JD 1JR6A 3GEHA 4XH9B 4O0MA 5FTMA 4OYHA 1OXUA 1XMSA 4AIIA 5KDDA 2BBTA 4DUGA 3TH5A 5DIFA 1LY1A 1TEXA 4ZKEA 1NJFA 2FWRA 3ADDA 2CLDX 3X1ZA 2H1LA 3AF2A 4B73A 1CEEA 2H8KA 1KI3A 1E32A 821PA 5CITA 4DWJA 2VTKA 2WV9A 3ZJYA 2VSOA 1T9HA 4JLOA 1JJ7A 2I4IA 4BECA 2VP5A 4F7WA 5L3RA 1KNXA 3IIJA 2DB3A 4KFRA 3J81k 1OB2A 3RYTC 3T1TA 3UWKA 1WCV1 3FGNA 1M1YE 2Q21A 3WMFA 1I2MA 1E2GA 1FW6A 3THYB 1KK3A 1LS1A 3BAFA 1GNQA 2OZEA 3KFXA 5FOTA 1XTRA 1U0LA 3VU9A 1UEIA 3QXXA 4M21A 3WY9A 2BCGY 4IJMA 1MV5A 1XJCA 2RGXA 5EXPA 3VKWA 3K9HA 1FX0A 3WNDA 4X8OA 5JWHA 3ND8A 3F8TA 1GTVA 2JJ8A 3LQRA 4XWAA 1A1VA 4M2LA 4DLYA 5G41A 4BFTA 5HCNA 5KUTA 4EPTA 1MT0A 3IPXA 3QKTA 3ADBA 2ZSBA 1G9XA 3ZVMA 2XOKA 3O8BA 2ZTSA 4LJ5A 1ZNZA 2ZRFA 1QG4A 2DYKA 3AKDA 1OFIA 1XD9A 4XSHA 1Q22A 5P21A 3RRYA 1Z29A 3OEED 5SZHB 1S9HA 2F1RA 2QTFA 3GJ8A 4JLNA 4IXMA 2VRWA 4C2TA 1LF5A 2AK3A 2WKPA 4AI6A 2IXFA 4FI3C 4JLPA 5H70A 2VSXA 2CMKA 4N3NA 3BOSA 3BB3A 3GLHA 5LBIA 3QIAA 5FPTA 4DSOA 2W2TA 1D9XA 3O8CA 2IX3A 2XB2A 4PFSA 3C41J 1FMJA 4XOIA 3KTAB 5BN4A 2ANBA 4LYFA 3R7WB 1YJ5A 1XBTA 4LHWA 4B74A 1WA5A 3TMKA 4CEIA 2ZU6A 1N0WA 4TYYA 1CU1A 2ZJ2A 4QXAA 4ON9A 2BWJA 3F5FA 2QRNA 1IN7A 3SEAA 5FBRB 3QY0A 3IHWA 3B13B 1VCIA 4A8JB 4MGYR 4Q1AA 1VYUA 3VU9B 1NG9A 3WRXC 5TV2A 3L8YA 1PLJA 2D3WA 4G5GA 2R6GA 3T61A 2GCOA 4EKDA 3PUVA 4GOXA 5CDFA 5BWMA 3LLMA 1WP9A 1H8HD 2FV8A 5JZVA 3PIRA 4RD1A 1OKKD 3EZFA 3FDIA 4Q01A 1AZTA 1QHHA 3PUYA 4R2HA 2J9RA 1LB1B 3JVVA 3W6OA 2CK3A 1ZC3A 2A5YB 3GQBA 2BBOA 1KAGA 4DLSA 4JBWA 3TGPA 1VG1A 3L43A 5KDLA 3I61A 2C78A 2GESA 4WIAA 5D3MA 4MKHA 4LJYA 1Z0JA 2J45A 3ZZTA 1H8ED 4A92A 5LDDC 2D2EA 2JAQA 2WJHA 1XPOA 4M1WA 1KMQA 2NO0A 2XITA 5FTNA 1KK2A 2ZR0A 2QP4A 1AS3A 4TTPA 1G4UR 2HCJB 4NYIR 2QE7D 1T4GA 3SQWA 4II7A 1Z6XA 1FTNA 4GP6A 1CJMA 2UZIR 2TMKA 3QQ5A 2ODEA 1UJ2A 1EFCA 1Z22A 5JLJA 4WXPA 5FL7A 4TLDA 2C04A 1VDZA 1DEKA 2IK8A 2OCPA 1NNEA 3LBNA 3N2IA 4NYIQ 2BEKA 1FUKA 4B76A 1TF5A 5B2ZA 2J0QA 2QQEA 4OQNA 2RGEA 4H1UA 5JRZA 3MWJA 1ZW6A 5FI0B 3ZVRA 4JLBA 1IN4A 4I4LA 4KAXA 2EFCB 2OESA 4M1OA 1HE8B 1EFHA 4R98A 1J7KA 3KUDA 4Q7MB 4M1TA 1XTSA 2BM0A 4HAUA 4IRUB 1OF1A 4D0NA 1KSJA 3PCRB 2VHQA 3VQTA 5GADl 4FWIB 4DT1A 4JMPA 1P4SA 4CIDA 4OI4A 1AGRA 1MO4A 3MLEA 2VF8A 4XSGA 4URVR 4YMTA 4Q4JA 1OH6A 5EP2A 1WE2A 4KU4A 1G6OA 5FUXA 2ATVA 1G17A 3EAQA 3ZZUA 1A82A 1U0HC 1PLKA 4AD8A 4QM6A 2VBCA 1D6JA 1Q44A 1SXJD 2ZSDA 2ONJA 4D6PA 4F4JA 2FPKA 1OH8A 1JB1A 2NQ2C 3I8XA 3VKHA 4PQRA 1VG8A 2KJQA 2EYUA 4TMZA 2GXQA 1KZGB 4LYJA 4BLRA 2ZE8A 4CGZA 2QMUA 2CE2X 4HDCA 4P4SA 2QPOA 4ZKDA 1XTIA 3R8FA 4IOLA 2XXAA 3EIHA 5F2EA 421PA 2IT1A 4PPGA 3LW8A 1KJWA 4MA4A 4WZBE 3ZYCA 2Y8EA 3AVTA 3AKYA 4GNKA 3OEHA 2J0VA 1P73A 2Z6VA 2CHGA 4ZPXA 3UWOA 3SHFA 1CS4C 4TMTA 5FPSA 1DAIA 4HDOB 2XX3A 3DMDA 4DRZA 4OHYA 2OV2A 2QBYB 2G88A 2GBLC 4M1MA 4HDQB 1DAGA 3QF7A 4URWR 2QAGC 1ZD1A 3RRZA 1D2MA 4PC7A 4BE7B 2WVJA 2IA5A 3OIWA 2GHIA 3QKRB 4HAWA 4LYHA 3QXJA 1Q3TA 3L2OB 3UK6A 1XMVA 2P5TB 5EP1A 2WJJA 2CL7X 3M4YA 5G40A 1D8TA 3SFZA 3WHLA 5BQ5A 3ECCA 2J1LA 2UZ3A 2C2HA 3D3QA 5JSZB 1R8SA 2FZLA 3VR5A 4F4CA 3DL0A 2H57A 3DVLA 1EXMA 2RB4A 2ZRDA 1EESA 3KX2A 1UBGA 4OQFA 4E22A 5JRJA 1NVVR 4URXR 1XZPA 2FEOA 4PHFA 1GRNA 3SYKA 5B64A 3AKCA 3AVQA 1ZM2A 4ZV4A 1SGWA 3W8RA 3PVSA 2N1BA 4ZDJA 1GFIA 3BH0A 1VIAA 3TUJC 3WMGA 3O47A 5AK0A 3QE0A 4C2UA 5AJVB 1C1YA 1OXVA 3LX8A 2RGNA 5C4MA 3AM1A 5J47A 1NVVQ 2P6NA 3HJNA 5SZJA 1FPMA 3MFYA 2FFBA 4EFNA 5C46F 2NTYC 2Z83A 4JKYA 4WAUA 3T35A 3W6NA 3WP0A 4DUGD 1W2HA 1ZCBA 2R6DA 3ZZ0A 4AYWA 1XEWY 4BRWA 4TYWA 4PSVA 4N0DA 1E79A 3CONA 1EX7A 2RH5A 2O8EA 1K5GA 1ZUNB 3AP3A 3OIVA 1JEEA 4M1KA 1ZM3A 4FW9A 3IHLA 4CVNA 1OB5A 3R8CA 2OFOA 4MGKR 2AKYA 1II8B 4FMCF 4LV8B 2W2VA 3NIBA 1UBCA 2ORVA 1P7CA 1Z2AA 2F6RA 3NKVA 4IDQA 4Q7JB 1SULA 4PPQA 2AXPA 2FEMA 2PEYA 4JL5A 2O8EB 1R5OA 4RVCA 4U7DA 5DLQC 2NO1A 3RWOA 1XDBA 3HP1A 2ZYWX 3U2QA 1IY1A 2RGDA 2CE7A 1JEDA 3B1VA 1Z63A 1E3MA 1UDWA 4MYUA 4C4PA 1W7AA 1W0JA 3ZS9A 1F2UB 2OSBA 3OE7D 2WJIA 5JWOA 1W0KD 3QNUA 1QF9A 4V0ME 2YWEA 5FTLA 3FKQA 3FE2A 1Q20A 4PAOA 4CEJA 4JSTA 1KDTA 1J70A 1U8AA 1ZIOA 1OW3B 2RGBA 3K0AB 1BYUA 2W6JA 4X8HA 3VHXA 4AKHA 3K0CA 4EDHA 1SKYE 2FPMA 4PZYA 1RC8A 2O8CB 1KY3A 1R5NA 3GCGA 5F9HA 4B6FA 1EWQA 4LYAA 1GAJA 3UXMA 4DIDA 3EPJA 1KKMA 3UMFA 3DMNA 3EWSA 1E9BA 1HUQA 2YV5A 3MUFA 4LV5B 5EXSA 4CDGA 1UADA 1YQTA 2ZQ5A 4PHGA 3IUYA 1G21E 2OM2A 1KI6A 1XMIA 2QZ4A 2YC4C 4A0RA 4ZDIA 1IOZA 1N5KA 4R7ZA 1GZSA 1CR1A 1E94E 1NVWQ 1ZRHA 3RHFA 4ZCMA 5K8UA 2HXYA 1TU3A 2GF9A 1G291 1E4YA 1G64A 2AHOA 2NZJA 4BEJA 2JIZA 4U00A 2ZREA 2ZJOA 2WJGA 4UNPA 3D8BA 2PT7A 1G5PA 4OBEA 3GFPA 3KFVA 3O8RA 4ZCLA 4RZXA 2CDNA 1SXJE 2VP0A 4OKSA 3TR0A 2FDCA 3WBJA 2PLFA 3KJIA 2ZRHA 4IDHA 2XTNA 1NN1A 1TU4A 3DM5A 5IT5A 3OEEA 2CCJA 3THXB 4EQ6B 1HQYE 4JLJA 2G83A 2Q3HA 3B9PA 4I1VA 4BGDA 1FP7A 4KSBA 4BFVA 3EC2A 3AVYA 2F55A 2G1JA 4B2PA 2FSFA 2V55B 3NDPA 1ESNA 3UANA 2VHUA 2WJYA 1MRNA 2HEIA 4GOKA 4KHZA 1XXHE 2GF0A 3SU8A 2PJRA 1U81A 3SC3A 2P67A 3QENA 4US2R 2ODWA 3ZS8A 1XNJA 3NWJA 4P32A 5DHAA 2C77A 1KO7A 3KXIA 1IN8A 4XVRA 3RC8A 1KHTA 1G19A 1PJRA 3B82A 4OJQA 4A9AA 3T1VA 3GFTA 4NMMA 3I5XA 1JALA 1QHYA 1N3BA 4ESVA 2JDID 1KI6B 1VCMA 2CCGA 4NONA 3DZDA 3V00A 4B48A 4E03A 2J3EA 2IS4A 3ZQJA 2BKUA 1NMXA 3BWDD 1OYWA 4H1VA 2PT5A 1XMJA 1Z06A 3CLVA 4Q21A 2IYYA 2WWFA 1H8HA 4UXIA 1DAHA 1G3UA 1UKZA 1HT1E 3GD7A 3CZPA 4LC1A 3ZDQA 5JJIA 2ZUDA 1G18A 1OKKA 1UPTA 1ZD9A 2ZRPA 5TB5A 1ETUA 1OFHA 3NBZC 3PXGA 3IGFA 1QRAA 4LJ4A
chains in the Genus database with same CATH superfamily
4C30A 5K8CA 3UNXA 1YTUA 3DYBA 4PIPA 1BS1A 2BDTA 1T5IA 3NWPA 1UKYA 3N8DA 3S2UA 4QQKA 1X7WB 2GCGA 4LXTA 5FOVA 2OENG 3P1JA 2B9VA 1X19A 2CNBA 3TPCA 1MEOA 1DRKA 2DFTA 2YS7A 4EDFA 3SKVA 4KIGA 3WJ7A 4QDTA 1L5QA 1D07A 5CB0A 2V45A 4R0VA 1WPXA 3ZI0A 1U0SY 3M4XA 2ZI4A 5DW0A 5HF5A 4CF3A 2NPIA 5KQSA 3QMWA 5BRNA 2I3BA 2JANA 3PC8A 4BFXA 3L5KA 2D1TA 2XYPA 3AY6A 3ZCUA 1WV1A 1ULHA 3ENNA 1XL0A 3BB4A 4MRSA 4UVGA 3WP1B 4G6ZA 3H13A 1VLHA 2HA3A 4L4UA 1R10A 1QG2A 2AR7A 4GZ6A 2ZJFA 4RSRA 5JQGA 3GY0A 3WGKA 2I4NA 1N1GA 4MDYA 4V0MA 5FDFA 2XCSB 2VKQA 1UWLA 5ALNA 1C3OA 1EM8B 1KGDA 4B44A 2MSDB 5BR8B 1EH5A 2SICE 3CY6A 3PFKA 4M7RA 3ZHTA 4Z2AA 4CEHA 4H6PA 4D3YA 1WUYA 1IPHA 1UBTS 3G23A 1SD5A 2BUCA 1OXKB 4C29A 4F8EA 1FJGB 2I7VA 1XWIA 2DWPA 2G80A 5AP9A 2GPJA 2EGHA 3H8JA 3O2QB 2DT8A 3TQRA 3LNCA 4BLWA 5K3EA 3OCUA 2AG1A 1KPIA 1S4QA 3KD2A 5T4EA 3DM9B 3ZWMA 1Y3HA 1Z0KA 1B42A 2IQIA 3C7DB 3U4DA 4BU1A 1DIOB 2W8ZA 3EAGA 2RHLA 3AFMA 1ZAKA 4MJXA 4TM8A 4TROA 1GGMA 1SQGA 4LW8A 4R3NA 1XO1A 4HH0A 2WTXA 3U13A 2OFFA 2I6TA 3NBMA 1JXAA 1OU0A 4LOIA 3T4XA 1P6QA 2BM8A 3TOCA 5AH0A 4M9UA 5IG2A 2AXQA 3NT5A 2PD4A 2HNKA 2IITA 3IUJA 4GH5A 3AESB 1ZGZA 1H0KA 1O0BA 3UXHA 4CM5A 4FMCB 1WB9A 2VBFA 1G4HA 1K2WA 4PLZA 3QVOA 2NYRA 1EWVA 2DLNA 2D5BA 2QD4A 5AT1A 5HRAA 3A1DA 4HI0E 3OCVA 5KAPA 2DM6A 5CNJA 4IHJA 1MKYA 1ZRMA 4P7GA 5TQ2B 5BPHA 4PC2A 4F91B 5KYXB 3C2QA 4BNWA 4TM7A 4X84A 1DX4A 2EJCA 1N2CB 4PLGA 3ZJTA 4EJFA 5KKCA 4M37A 1NVGA 1L4BA 4MW5A 3FBTA 2O0JA 1NDQA 1JHMA 2J9XB 3OZEA 3GT0A 3N2LA 3URKA 1F4VA 3N39C 4B3IA 1C0PA 4BWYA 4U2GA 1BDMA 5DK4A 3ZHZA 3M6VA 1SKQA 3HRKA 2IUSA 3MWKA 3OQ6A 4FB4A 4OLAA 1FRVA 1O96A 2FVXA 4RD6A 4JI2B 2FSSA 1PFUA 3HUUA 2DGDA 3SNHA 1EHIA 1E3LA 3DVAB 5KYWB 2NAFA 1A9ZA 1TJYA 3IUMA 3BJIC 2VHZA 3E2IA 3RVRA 1G7TA 2VLIA 1CUDA 3UJCA 4LOJA 2QLNA 1FFHA 2BSQA 4ZTBA 3SZLA 2E1RA 3FX2A 3S4YA 4TLBA 3QG5A 4WCVA 5TGZA 2CZCA 5JAMA 5CBKA 3I34X 4LPKA 3F96A 1Z2DA 3RRMA 2Y6VA 4NYMQ 2AEJA 3BCSA 4O08A 4R8SA 5CFRA 2VYFA 3A6ZA 1GG2A 2I7TA 3KKEA 4RSGA 4W1RA 5FV7A 1RLIA 8LDHA 2BZ1A 2VTBA 1A1SA 4G56A 4TQGA 5DIZA 3VR4H 1RSZA 2JJ1A 3EHEA 3HFJA 1Z56C 1OLSB 2HNBA 5H3LA 2PGDA 3N8GA 1DVRA 5CCEA 4XPIB 3CR7A 3NV7A 2CBZA 1NXWA 1E8MA 3EWAA 1XDGA 5I7HA 1YE5A 4E4RA 2AE1A 3CPSA 4HGYA 2Q8PA 3U16A 2PJRA 4DOMA 4MRVA 1PZFA 2IHJA 3MJTA 2X6RA 3ZHVA 2FJ0A 3NALA 2R11A 2ZIEA 4O02B 3KKMA 3DLPX 2AMFA 3FB4A 4TZ6A 2I8CA 1LK0A 5I7SA 3SS8A 1G3QA 5HK8A 4NZMA 4FDLA 1AKUA 1YXMA 1FS4A 3LNTA 1ZGGA 3SJZA 1Y6RA 3U4IA 1M0EA 1KVRA 5AM5A 4BX8A 3ENWA 4XQCA 2H52A 4Y2HA 5TRTA 1E9RA 4UUMA 3D4PA 4JODA 1LW6E 4NENA 2ZI7A 4NULA 4OQ4A 1RAIA 4Q4HA 4A82A 4TTJA 4EG5A 1I3NA 2H4JA 1Z6YA 4ENTA 3IBTA 4OHWA 2GH1A 3MINB 1ZUD1 5LIPA 3TFOA 4Q16A 4DRYA 3WSWA 2QZSA 5C18A 5KTPA 3CA8A 4G86A 1NM5C 1VG0B 3LW7A 5ALZA 2G63A 4QG7A 3WA6A 2ONKA 3B89A 3RM3A 1JLSA 2B5WA 2Y4NA 5F76A 1H93A 2RC6A 5FNZA 4QDXA 1HL7A 4UM9D 5FNVB 2O8BA 4E6PA 5I9LA 1IG3A 1LPOA 4FGZA 2EW1A 4RD2A 1BCRA 5ALMA 2OHGA 2PANA 1K6EA 3VZRA 4B3TB 4DR6B 5LIRA 3W8EA 3KZCA 3MWLA 4HEJA 4M38A 2ZDGA 3QUTA 2P9HA 1DS6A 4BVAA 1EFVA 1CUYA 3A0RB 4GX5A 4O8CA 4PLYA 3R7WA 5BYAA 1GLNA 4ZVLA 1SKMA 1G20E 2FLWA 3DTNA 1NGSA 1USGA 4FJ2A 5FO1A 3WLSA 5KJ1A 1UOPA 2AC4A 2JVIA 2Y93A 3MJSA 4IOMA 5JSKA 4B09A 2QP3A 5LYYA 5H1YA 1RPNA 4KXYA 3P7MA 5LQJA 4JWTA 5AJHA 1BSVA 3AUFA 5LKAA 5AIAA 3TR6A 1BXZA 2DUMA 2FR0A 1NP6A 2PUHA 1RW4A 3BMNB 3I72A 3JW8A 3UA4A 3WK7A 2O5RA 5BWCA 3HHPA 2V7PA 3FMVA 5D7BA 5GMOA 3JATB 1O95A 2EYQA 1SHKA 1YZLA 1Z8HA 2CYAA 2ZIWB 3MJ4A 3OE7A 4JK3A 3G79A 4L5IA 4QXPA 3KUUA 3UJAA 3UH0A 1H2WA 4FMBB 4PYJA 4HLCA 5IDVA 5T67A 1XCGB 3UMMA 4IIVA 2Z08A 3H0KA 4A6XA 3AF6A 2GILA 1SVUA 1U2ZA 3GUVA 2O8DB 2YBEA 1P8JA 4KSCA 1QFMA 4L4XA 2NU8B 5T41A 1TZJA 1ADFA 2JCXA 4J4TA 4FGKA 5FYDA 4DSTA 2D5AA 4K9NA 1JHPA 1WU8A 1KP9A 1YSCA 3AZOA 2ZIGA 3BF8A 1NBMD 1X8JA 4E2WA 4EMTA 2C9ZA 3IDOA 1C8KA 1GADO 1NQWA 5EI5A 4ZV7A 2ZSHA 4ZODA 2BFOA 1OYYA 5ALVA 2PWZA 2EIHA 2OCBA 4IZOA 1SZPA 1R9NA 1CLEA 1VHDA 1XLTC 3EZ7A 1LPAB 3A3OA 1OOEA 4PQYA 2Q4EA 2V6GA 4WE3A 1DOAA 4QFMA 1N32B 1IN6A 2BKXA 2VAMA 5B37A 2JKZA 5DV9A 3WGQA 1WW8A 3U7GA 3WFIA 3CC8A 4X44A 4P84A 3BFXA 3B9QA 3B5JA 3MLAA 3DR3A 3H8SA 4NJEA 1BRTA 4K6KA 4S2UA 3DP7A 1YF3A 2V5VA 1XKQA 2PV7A 3AFOA 3CH5A 2V7QD 4JU9A 5AUQA 1BMDA 1R6BX 3EXFA 4OXRA 4JI1B 4C6TB 4RTPA 3WK6A 3EZ6A 2Y1WA 1P61B 3X1DA 1N2GA 2E4YA 3DBLB 3KVRA 2QF7A 5J43A 4GZ3A 2B36A 3FPAA 2OAGA 3DDSA 4LOHA 2Z1DA 3BMCB 3SF8B 4DE5A 2R2GA 3U3KA 1MBZA 3EQ6A 1MVLA 5IW8A 3QUQA 1SVLA 2MR5A 1JWAB 5KBYA 4A0HA 4OGGA 2LD4A 2G0NA 5EQTA 1W4BA 5EWMB 1Z73A 2BFMA 4QDUA 1DAEA 2PIDA 3UWDA 3DUWA 2I33A 4L15A 5JC8A 2WNSA 5BURA 4FYPA 2EX4A 3CUVA 5EEHA 3R5XA 1GR0A 1R12A 4NV3A 1T5SA 5EJEA 1VJTA 2N42A 2QPLA 4GOND 1E0SA 4INOA 4JB2A 1IE3A 3PXEA 4OH1A 3CGGA 2GCNA 2EV9A 4YCCA 1QRSA 3NRCA 5CMLA 5FPYA 1PL7A 1W2GA 1RJEA 3A10A 5B7NA 3MMSA 3PNSA 4C7VA 3RYFA 3MPUA 3SIPA 3R9XB 1FNCA 2OCGA 4PW0A 1C0IA 1RXCA 1B00A 3SIWA 3ZJ4A 3V8QA 1I2DA 1NLMA 1N0HA 1MDFA 3GH3A 2YMMA 1YA6A 1OWOA 2RBGA 3TTTA 5LMUB 3M1YA 2BEUB 1IVNA 1KVUA 2CY0A 3O83A 2JFOA 2JW5A 5EIFA 1CC1S 4LE1A 1H23A 1XRJA 1XZGA 2AFHE 3EW9A 3QFRA 5EPUA 5ER6A 2X0DA 4BFUA 4XIIA 3T7TA 2QMQA 3U4AA 1SAYA 1XZBA 2CL5A 4HQNA 1CW2B 2B3TA 2QN7A 2A1IA 4N0PA 5EJ8A 1G6HA 3LS2A 4EG3A 4UKDA 4D46A 1AGPA 3EOZA 5DYIA 3DCYA 2C82A 1FSSA 1OLOA 1O97D 1W75A 2AH5A 2ORWA 1Y1TA 2VAVA 2VAXA 4QREA 3S8EA 1Z7GA 4Q19A 2B7CA 2BRUA 2IU3A 3UB3A 4HYYA 2WA1A 4KB5A 1XFDA 1ZM9A 4MK4A 4G0QA 3ZV3A 1H69A 2X15A 2J9GA 3VV3A 2YHIB 3NWEA 4ESEA 4IVPA 1ZJZA 4TT8A 1L5VA 4KAFA 3I1IA 1L3BA 4RH0A 1MAHA 3STUA 1E6KA 2HJGA 4OJMX 3CX4A 721PA 3QUBA 5FRDA 3OQNA 4HJXA 5DF1A 4YPOA 2ICAA 1RLMA 1KL7A 121PA 4M0KA 4ZD6A 1SBCA 5A3RA 1S8NA 1BHQ1 4C4XA 1YFKA 3WADA 2X76A 5JAZA 2XDQB 2I2BA 2P65A 4YXFA 1X13A 1JG6A 2PK3A 2R1UA 2WE7A 5FHQA 5KMGB 4ZQFA 1R0SA 3FVQA 3A2NA 1M1NB 3AIKA 3ASZA 3L4BA 2W7TA 3P4UA 3QI7A 1Z08A 3DEKA 3HUFA 4O3FA 2GD0A 4C03A 4DLUA 2B4AA 5ESDA 2H3HA 2BGJA 4D4GA 2QL6A 5TARA 3KV3O 3NKFA 5JSZA 3Q1LA 5BT9A 3WB0A 3Q3IA 1P17A 1T1GA 2V7XA 2ZJ0A 3IJEB 4NIMA 5JY1A 1M6EX 2QTMA 4NZNA 2HB6A 3IESA 1AQYA 1BROA 1ADJA 1PT9A 1D3AA 2H17A 2V98A 3EDRA 2VZ8A 4R0NA 4YPFA 2B20A 3FKSD 3VPDA 5JAIA 3PEUA 1NNI1 3HZOA 1U0BB 1AHNA 4G1CA 4B6EA 4NXNB 1XV5A 1RR6A 2Z09A 3KQKA 3LWBA 3KETA 1G59A 2EL7A 1RKXA 3N53A 2IV2X 5JUWA 1E9AA 4B85A 1V7QA 4KW7A 3R0ZA 3DW1X 4N82A 3FJ1A 4D0LB 3D4BA 1A72A 3LAWA 2C9BA 2E4UA 3OHPA 5ITZA 3N0XA 4Y2QA 2H4YA 4OAPA 2HO5A 2UDPA 2J08A 4D57A 1ZUWA 1MJ5A 3FVRA 4HVAA 1XVIA 3DFFA 1GD1O 1X42A 4ITUA 4YAUA 2DF8A 2GCIA 2NX2A 2ZIUB 3IDSA 4HWKA 2H7XA 2OG1A 5L3SB 1VSTA 1WDMA 3DOUA 3TDNA 5EE3A 4HNVA 2JJ1D 5KVAA 3C6ZA 3GRAA 2FZGA 4D9EA 3CNHA 5JMPA 1MPXA 1JI3A 4IIHA 3D6AA 2GKOA 4ZQIA 2F8TA 2Y1OA 1VJ5A 4FW8A 3AY0A 1XAJA 2PX6A 1I2AA 3THOA 3TR5A 2ARKA 4RA6B 3W5UA 2DJ5A 1NBME 2DTDA 5IAJA 5KX5A 2P2SA 4OQLA 2PL1A 5G0WA 2HA2A 2BELA 3SSNA 3TBHA 5IKEA 2ISCA 2ZQZA 5L3QB 3LCRA 1KEWA 5JHHB 2CBGA 1H6CA 1DQZA 1YB4A 3UXEA 3ICEA 1YIAA 3LUJA 1XAGA 1PJZA 2EBUA 1P1CA 1EGHA 4FDTA 3IQGX 4QPNA 3TVTA 1UJMA 5E95A 4TN1A 2DERA 1KEEB 4MVJM 4OHCA 4XB1A 3K0SA 1PUIA 2MSWA 1SK9A 1TK2A 1BO6A 1M1UA 1F2UA 2PH7A 2YZ7A 2FRXA 4OFXA 4OM7A 3LUAA 3S3TA 3VPGA 4DL9A 3UAOA 2VHTA 3NKLA 1MEJA 4HFJA 3WJ1A 5L7TA 1UMBA 2YMQA 3LZDA 2ODPA 3KLOA 2IHVA 4JP3A 4V2UA 3B1JA 4HX9A 2FCAA 3MWEB 1W4LA 1FFSA 2B8EA 3RRJA 3OSUA 3K0AA 1MTOA 5JATA 3FWZA 4OHFA 1BJTA 4QT0A 4ZYYA 4WN3A 1QTNA 5JAUA 1FFAA 1Q0ZA 4C4RA 5J23A 5ELLA 1A98A 1KYTA 3X1KA 1P9WA 1I5OA 5KOIA 3R1IA 1ZP6A 5F64A 1RI2A 3ZIUA 4C04A 1P0MA 3SM3A 4BJ5A 2YVKA 3HO1A 3PXAA 3P97A 2RMKA 3HJHA 1XZKA 4QUKA 1R6UA 1XFAA 2ATCA 4G1UC 1E7MA 4L8FA 4LWOA 5ICFA 3ZHOA 4AP9A 4BQSA 1G41A 1OHHA 1EZZA 2O2ZA 3TSOA 1HL3A 5JNLA 3VNVA 1QUEA 5G02A 4Q4AB 3VZDA 1DG3A 2EZ4A 4N40A 4NC9A 2LE0A 4DM7A 4V02A 1MO5A 1VM6A 2R48A 1PSZA 2XEXA 3VR5H 4RKQA 4KR2A 4BASA 1E5LA 5I3ZA 2OWEA 3MWFA 4HBGA 2VPQA 2XUHA 3R3WA 4MVWA 4V39A 2IYUA 4YMWA 5TR9A 1ZJWA 2O52A 4OXXA 4R8RA 3ZY4A 3K09C 3UMGA 2DQ4A 1W44A 5JCOA 2PWBA 4MYDA 3NBKA 4QYMA 1KY5A 3LDUA 5L3VA 4CQMA 1G8AA 3TI9A 3E61A 5TPZD 2KMLA 4KR7A 1HDOA 3S2GA 5JPCA 2DQYA 1LDNA 5COQA 2IXAA 1Y8QB 2VHCA 1AQ6A 1I10A 3CRMA 4FN5A 2P1RA 1XJWA 4Q1VA 3SHWA 4RVNA 1G55A 1X1DA 2ORED 4MUMA 2BJHA 1Z88A 3HA7A 1CUHA 4C22A 2K2QB 1G8FA 1WUKS 2XKBA 3FBWA 3S1AA 3HA3A 1OBOA 2H8GA 2KYRA 1ICEA 4F3NA 1I7NA 3LKBA 4MVJG 2CLHB 4QPJC 2HK9A 3H11B 1EAYA 4ZAWA 2NO6A 3U7QB 1YB5A 4LJAA 4AMGA 5FOQA 3GJTA 5DE3A 3S5UA 1HYGA 2F1OA 2HGSA 4V0OA 4U0KA 3H1AA 3VYWA 1PEYA 3PEEA 2QW1A 5J4LA 4R54A 1PG0A 1S1CA 1JW9B 2QRKA 4WXEA 3OKPA 2BJWA 5KYUB 2UUOA 3AHCA 2XXBA 3GCDA 2R8RA 4EHNA 4WZZA 3TK1A 4DILA 4REQA 1JE1A 1VBMA 1EJBA 3BE6A 3BUSA 3TEFA 4YCSA 3O7MA 4FYJA 3EX7C 5ALKA 4XB2A 1FTWA 3JQRA 3K1YA 3QUCA 3K70C 3G2QA 3V4ZA 1EFTA 1WIWA 1T1JA 4N3BA 3UB2A 1AS0A 4O4HF 2GKSA 1TPYA 2QM3A 3AERA 4MUIA 3UT5A 4AKEA 2AT1A 2ZRMA 1QGDA 2YY6A 3L6DA 4LHEA 1VE5A 2ZT6A 4HNAB 4FFDA 3WTBA 3MSCA 2DBQA 5KNCA 5DX0A 4EVSA 1T6NA 2L17A 4BE4A 4IOKA 2QROA 2Q2WA 4UNQA 1G8HA 1Z0AA 4I99A 4RMGA 3EGDA 4RLFA 3A31A 1D4ZA 1ZGCA 3X1YA 5A1TA 2ZDQA 2BP7A 1VKHA 4KE7A 1CUIA 4B2LA 1OXXK 4ZJPA 3ZOZA 3T1YB 1BN6A 4R8LA 3HEBA 1L5ZA 2I4RA 1S2NA 2Z2IA 5F1PA 4A4DA 1CVIA 1GXSA 4W5WA 4D9GA 1CNFA 2XA1A 4ZGWA 3G2KA 1UL1X 3E7WA 2GUGA 4BNHA 1NW3A 4UOZA 3L8HA 2VPYA 5G0VA 2AN9A 1ABEA 4GDMA 4D42A 1K8QA 4RACA 3HB5X 1QH1A 3PRJA 4JX9A 3TW8B 3ZWNA 1GZDA 3DE1X 3DBHB 3E9RA 2J46A 4KPUB 3HJBA 4JZKA 4QU5A 5DFAA 1EE9A 1XPJA 1UJBA 2VP2A 1EP3B 4Z4QA 4FYMA 6ABPA 4G5HA 1NRIA 1PVDA 3SN6A 1EFLA 1U8FO 5CB4A 4R1UA 4MW4A 3Q7SA 2IYWA 3AJDA 5IZ4A 5HVNA 4ZREA 4B3CA 2AJCA 2K7ZA 1ZM4A 3OX2A 4KO3S 1SQFA 5D7NA 4BPBA 3VM6A 2DH5A 4ZQGA 2BH9A 1Q1EA 3EAFA 3H6KA 3NYIA 2YX1A 3GFOA 3C1OA 1Q7CA 3U39A 1UT8A 2XW6A 1C4KA 1UPFA 1X3LA 4PY2A 1X1EA 3VPBA 2Y2UA 4E5MA 2WU4A 2ECKA 5LOVB 3EFOA 1PGOA 2HV9A 1MB4A 1G8SA 2Z8YM 4XTRA 4BGEA 2F17A 1C81A 3T12A 3UBTA 5HIIA 2X5OA 3O03A 3W6ZA 5CH8A 3FFTA 4AS1A 4TSFA 1IEQA 1I6LA 1DOHA 1U28C 4IDAA 3HXMA 2IOHA 3ITNA 4I4NA 3D8NA 3DKKA 1Q7TA 1Q7EA 1SKBA 1EVIA 3QE3A 1Y9DA 4P7BA 4QAQA 5LYJF 2O2JA 4DPMA 4F6RA 4ILEA 3U7HB 1WUTA 2GWHA 1BVUA 2PFSA 3E0XA 1BFKA 1JKXA 2Z5FA 4ZZ0A 4RO0A 5E4TA 1UT6A 1MF7A 2POQX 4BQEA 3ACBA 3F6SA 3D8UA 3THSA 2JATA 4BJHB 1PT7A 1JH9A 3WO1A 1GGEA 5EJ5A 1R7RA 3QVVA 4HYTA 2IWHA 5JT1A 3WGOA 1BX3A 5K9ZA 2ZE6A 5KINB 5ULLA 2ZUTA 1C9YA 1ULSA 2ZT7A 4OOFA 3TD2A 2WWHA 4Q9KA 1Y80A 1ZX1A 5TF0A 1EX9A 3K05A 3FSGD 3OLCX 2B5VA 3RVOA 1E7QA 2VPXA 4PRZA 3FGOA 2L82A 1JDBB 3RC7A 1DU4A 1TDJA 2Q4DA 2BMWA 2QG6A 4RZIA 5GTDA 1LNZA 3Q11A 3C0KA 1A9XB 1D2AA 1E61A 3LK7A 4NX2A 1L7XA 1W5TA 1XN1A 4XW2A 5FPHA 4PN3A 5CT8A 2WYHA 3U3OA 3NCHA 4DSAA 3C7KA 4FLFA 2AQIA 4G5FA 1SIWA 3IEPA 2DUUA 4NCIA 1WXWA 4E21A 2HRRA 1U7OA 1NUAA 3GNTA 3AYXB 4KTVE 4MV0A 2GT1A 1SXGA 2VQDA 5JXWA 1C9JA 2Y1GA 1P0QA 3MCTA 2XEDA 1U7DA 4K3UA 1C8BA 4QXOA 4JVSB 4YFVA 3ZCSA 5A5DA 1BXGB 5F1KA 2X8AA 1P9OA 2BMDA 2F3SA 3SBOA 1EFUA 2QJFA 1CZUA 3OPXA 3LQ2A 5AKZA 5AXDA 1JR6A 1ZI9A 2ZR9A 4KXXA 4R9UC 2C0QA 2WT9A 3PXDA 4ZU6X 1CYEA 4G67A 3AFHA 3E7XA 4S2EA 1QZ3A 1YC2A 1RBZA 2C5LA 1C1HA 1LPBB 2ID7A 4HZIA 3ZZNA 5KIAA 2CLCX 3M1LA 3WGMA 3COJA 5BN5A 2C83A 4FOLA 2Q5LA 3WKAA 1MO2A 4MP3A 5EIXA 1Z5PA 5JCJA 4NEQA 1IHUA 4E94A 5ALRA 1DAFA 4LE2A 3Q7EA 4LK3A 4ZXPA 5FOSA 1HETA 2ZPTX 1G2IA 3H2JA 3EA0A 2SCUA 3MUNA 2N3ZA 4J03A 4B33A 1RRMA 1XCPA 3G02A 5IFKA 1E2NA 1U3FA 3HGTA 3JQ9A 5FP0A 4J8PA 3WL8A 5BXQC 4J3NA 1CRLA 2UYGA 4C1BA 3W6PA 2XJ4A 3PPXA 1YUMA 1TCCA 1CY1A 4NS4A 3WNCA 3OH8A 3BDVA 3LIIA 2J7KA 3GZNA 4XJSA 1ISIA 4PYLA 1K08A 1OAKA 4DG9A 3K0FB 2X19A 5AI8A 1DKOA 4NESA 4Y0NA 5GP1A 5SYAA 4P0PB 4FP9A 3N2EA 1HFEL 2A5LA 2GHQA 2FLKA 1PZGA 3FHCB 4N7RA 1PT6A 1RC1A 2W2OA 4IZHA 3K4QA 4CG2A 5C1OA 2VHJA 1FFYA 1ZG3A 4DJAA 1BH2A 2I34A 3LLSA 3ZHBA 5H4HA 3QPCA 4UTOA 1GSHA 1LSUA 5IVDA 3K0HA 3PEFA 2ATIA 4B6GA 1GN8A 4QQFA 3SNKA 1B6TA 1E66A 2KI5A 3LPAA 4OI0A 2HF8A 1NN0A 1ZUHA 2GEDA 4BV9A 3NAGA 1MZPA 5JMOA 1M7HA 4C78A 5KC9A 5LNK6 3QVTA 3BZWA 4CM7A 5LL6P 4I1SA 4TL6A 5I8ZA 4AP5A 2CJFA 1W49A 4JBNA 4YIHA 2WYWA 2BV3A 2YWXA 2FPIA 4CQLA 4EATA 4AB1A 4BXOA 1NWCA 3CN7A 2EZ8A 1VYTA 4L5BA 4ER5A 1OH5A 1J2TA 1E1QD 3AR9A 2WVGA 3CEAA 4JOSA 3RLFA 3NNSA 1YNSA 4X9XA 2GZ2A 4D79A 4F85A 2SKDA 4EJ2A 1EDBA 3OZSA 4JSYA 4AX8A 1XDDA 4FGSA 1OHHD 4OHVA 1L6IA 5AK6A 1E9VA 1KSFX 1N77A 2DHRA 4GL2A 1OBVA 3Q8XB 1HMPA 1VKJA 2BUBA 5FWAA 3DV2A 4S05A 2QT9A 3SVZA 2DUNA 3GZJA 5L45A 2RONA 3K5WA 5GV8A 3H0CA 1OIWA 1OWPA 4BFSA 4YCLA 3N28A 1UM8A 4P81A 5FUMA 4BP3A 1N1EA 2IYXA 3N07A 2I4TA 4OL9A 3IQXA 3CZQA 1SXJC 4HGNA 3VTZA 5ARCA 4DMRA 4YPVA 1KRXA 1LW7A 3TFQA 3IUQA 4P3OA 3RTEA 1T0HB 2N46A 2P0YA 4AMYA 2ZBQA 3IT0A 2GLXA 4EPXA 2C4NA 2QHXA 3T7KA 2QM8A 2WF6A 4DTIA 4QHSA 1Z6ZA 1LBIA 2QPAA 4MRPA 3I6YA 4QDJA 4RTOA 2AMJA 4UMEA 1UQUA 3L02A 3PE3A 2E85A 3L7OA 3OUTA 4E2ZA 3HXOA 2EX1A 2HCTA 1TL7C 3BB1A 4EW3A 1SCIA 2G70A 2Y99A 3PXXA 3V4FA 3BILA 3TRJA 4ZCIA 1IMJA 1P7ZA 1OFUX 4RVUA 3UMCA 1GEEA 4B6OA 1E2DA 3SJUA 3TIXB 1Q0PA 4B6QA 4QARA 2EATA 4JT2A 2XMZA 4WZAA 1QS0A 2QRJA 3N8NA 4WXHA 5LMZA 1PV1A 5GQSA 2J09A 4ME6A 1J00A 3KLNA 3RUPA 3VR3A 4CM9A 2W90A 3W7BA 1O6FA 1THMA 2I2XB 3A6HA 1NMEA 4IDOA 4Y1FA 3SX2A 4EO7A 3C6MA 5JD4A 5K6TA 2YINC 1O5IA 1ZZGA 4EHAA 5ADUS 4KN8A 1LXCA 3CQ9A 3NRJA 1GQ2A 2HYDA 2YWCA 5FFNA 4YHBA 1RM3A 3HZZA 4EL0A 1WKBA 3L8FA 1QGUB 1QGED 4KVGA 5DXJA 7REQB 4UCXA 1AZSC 2NVUA 4GI7A 1VLZA 1T2EA 5HE9A 5BSMA 3R23A 4ARIA 2ZK7A 1E5XA 1SB8A 1AZWA 3NIWA 3JS5A 1QOQB 1UH5A 2K5UA 1NXQA 2O06A 2FPGA 4R6WA 2BGNA 1QHSA 1KKLA 5T6BA 1QXSA 1CUBA 4MYSA 3H18A 1JA1A 2UZ0A 4QLAA 5A06A 3RC9A 1DQYA 1ZD5A 1U8TA 3IHTA 3Q7RA 3LHIA 5KSOA 4KXWA 4Q3NA 4OHPA 4J7AA 3N2KB 4WBNA 1VGVA 2X8JA 1FIUA 4QX6A 4A0FA 2HK6A 3V7FA 4L7VA 4GVLA 2XKAA 5CX4A 1JIKA 1KSHA 3QSGA 1Z16A 2EJBA 3VPXA 4KPEC 3QEKA 2P4QA 1E63A 2PBRA 4DCPA 3WA7A 4GC5A 1H22A 3VISA 4I7EA 1NLZA 4K46A 2VJCA 4OMFG 4FSXA 2EERA 3EGOA 3LC7O 1YGPA 2C29D 5CJPA 3RSOA 2B21A 3TD9A 3LA6A 2NPOA 3C8MA 3KWJA 3AT1A 1RIFA 1XN4A 4M8LA 2HV8A 2NZVG 4ZALA 3KVNA 1IBCA 3FAZA 5F52A 2FNAA 5B1SA 5E4YA 4YRLA 2BZGA 5FTJA 3T3MB 4BCDA 2MU1A 4E07A 4TPKA 3NTXA 1QJ4A 4WXYB 3QOXA 3WK5A 1VKOA 2HBQA 1WU7A 2FRDA 5GWXA 3SYNA 3MD0A 1PGJA 1IN1A 2RIRA 1OLXB 4KXUA 2ZE7A 4BO9A 3PL1A 3UBMA 3UJ3X 3EXHC 3ADPA 4B75A 4IGFA 4KHPB 3QVKA 4BFLA 3LX5A 4ZOEA 1GOTA 2FMUA 4RPHA 3ROGA 2FPOA 4KUEA 4UM8B 2DCMA 4MR7B 1QDLB 5L6MB 3QHPA 4QFBA 2W8BA 3QJ5A 4RF3A 5T8KC 1E4VA 1TAQA 2BF7A 2PLWA 2F00A 2I1QA 3GFBA 5THXA 3F97A 1L4NA 5TT0A 5TMBA 3M4NA 5E8JA 1KBZA 2IBSA 3GG9A 4I4TA 1OT3A 2V96A 2ZSKA 4QNNA 1F48A 4TT3A 4W8HA 1P2FA 4O2RA 3K96A 5AI4A 4GFDA 1E1DA 2WLTA 3GRYA 1AQJA 5AWFC 3HKCA 4B3XA 3IE0A 5FBVB 4ICIA 4PLFA 1LFDB 2WFMA 3D3WB 4MAMA 5BOVA 1HOXA 1C5KA 1UBRS 2QW0X 4OK3A 3IKTA 4UEKA 1N2IA 1OBHA 8MHTA 4HUQA 4EFLA 2AA3A 4N5IX 2PZ8A 4HQFA 4RPKA 1OTYA 1GL7A 4FFWA 4C7XA 1YBAA 4Y6GB 3G0DA 1H2ZA 4H31A 4TQ9A 5KWJA 2JHPA 1CVLA 1UPXA 2PD3A 4HQ6A 4AKTA 5I47A 4IAOA 2R96A 1EXVA 1EZ1A 1LDGA 4K6MA 4BB0A 2J7PA 3TSWA 3F5DA 2A9VA 5E7JA 3T9FA 1E2LA 2BEVB 1I0LA 3QP9A 4EY3A 2O8FB 1XRNA 4PZDA 4NI5A 1ZU5A 4RMHA 1JKJB 4BZZA 1NUPA 1ZA1A 4E3ZA 5IVHA 4IIEA 4BTEA 3I30X 3HXLA 3KYCA 4WUTA 2C5GA 1AMOA 1F7UA 1IM2A 3RARA 4AUKA 1F5NA 1E9SA 3YASA 1KOFA 4ITRC 3SXUB 1JT9A 2ZJBA 4BDSA 4ROTA 4GM1A 5TMEA 4GMXA 1A7JA 3WOHA 3G2MA 2ZRKA 3EOBI 3GLHB 3RROA 1Y4SA 4EGCB 4LRSB 5I8PA 2QTLA 2DQSA 3HCDA 2B6NA 2PJUA 4CLOB 2O2IA 4NPAA 1KI4A 3KB2A 1QF7A 3R6WA 4CIBA 5BN4B 2OGZA 2WJVA 4NH4A 3JQDA 2XZDA 3AR5A 2QRQA 2WE8A 2O50A 4IR7A 1E7RA 2IKSA 1UBFA 2ZS7A 1FL9A 3ABIA 5LP6C 2HO4A 4GZLA 3NW9A 1EFPB 2PD6A 4A0GA 2JJ2D 1DTEA 3X1WA 5ALHA 1NQUA 4EB6A 4ZN6A 5HYVA 1UBHS 4FNAA 1TI7A 1WHTB 3CLSC 3GJZA 1IXSB 1OVGA 1VHJA 3HP7A 5D8DA 3Q3HA 3CLTC 3VHLB 1RJFA 2ID9A 2C3UA 3QXHA 4I55B 5KYGA 3G5UA 4P08A 1U31A 2RD2A 4KE9A 1UWCA 2CZQA 4GP7A 4OREX 1D6SA 2BPOA 3GXBA 2GCOB 1NOJA 4B71A 1XALA 2H1SA 4OA8A 4DAOA 4EEXA 1I9GA 2I1VB 3RIHA 3HYTA 1E3WB 2O3TA 2AC2A 2ZBGA 4OMDA 4PSUA 1P2UA 2G0TA 1RYDA 3AY7A 1VMEA 1NX6A 2JJQA 1MX9A 1YB7A 3CNNA 3LY7A 3MBOA 4KMOA 4WCDA 4C4ZA 5B7QA 2CLLB 3GX1A 4N0QA 1G7CA 1SOUA 3KEQA 4TKMA 3PQ5A 4CTJA 2PBLA 4X91A 3ZJUA 1DCMA 2FPWA 1TW2A 1P3DA 4I19A 1PR2A 2Y4OA 1SCUA 3QHAA 4G0XA 4ZAGA 2XT9A 5JARA 2NXNA 2IODA 3QJYA 1A4UA 3UQYS 2GZHA 4PGHA 3VR4D 4JDUA 2G08A 3ABSB 2IZ5A 4BVBA 1OXMA 4JJZA 1A8HA 1EFRD 1ZISA 1AM4D 5JTTA 1OD6A 5DEOA 3IXQA 3K5IA 4M1ZA 5HA5A 4G0MA 3Q7PA 3W8DA 1IY0A 4I3HA 1E2MA 3CB4A 4HNHA 2JLSA 4GC9A 5DNDA 1RAFA 3AKZA 4ZHQF 1AKEA 2XSZD 4E30A 3R0QA 4EUFA 3W05A 2H00A 4O5OA 2L69A 4D9HA 1NMYA 1E6CA 3RIXA 1CF4A 3C48A 4NV0A 1AMUA 4UFPA 3S8MA 3LCCA 1DUIA 2CLEB 3NS7A 1CRQA 3P9RA 3TLCA 4GGMX 1AKQA 3BA6A 3WLHA 1GPLA 1M2EA 4OF4A 1PFQA 1QK4A 3HEAA 1VLVA 4E5SA 3ZY2A 1S5PA 1A9SA 1V95A 2A9PA 1Z7YA 2W2LD 3E3OA 1IONA 1CULC 3N86A 4QVKA 3RVBA 5HXAA 3L92A 3KB8A 1VDMA 5A4MS 3BL8A 2J3QA 1HBJA 3CX6A 1V2GA 2C59A 3UMRA 1CDEA 4LZZA 4IX9A 1RLUA 3PEWA 1F17A 2IS6A 2PUEA 3RV4A 4DYVA 3PSAA 2GFIA 2B98A 3R5FA 3NO4A 5DN6A 2WDPA 3K09A 1CRZA 3O0TA 3T7RA 2XRZA 4M22A 4MLDA 3W78A 1PYGA 4DBLC 1UBSB 3T9CA 2FMHA 1Z26A 1WG8A 4ND4A 4Q7EA 3P9CA 1IZZA 3OO1A 4DT1B 4I8DA 3FOZA 3JQ7B 3C87A 3G0CA 3Q7QA 4ZOLF 4O4JF 3E6AA 1F9EA 4DA9A 5CA0F 5FBWB 2VTVA 4MV6A 4MVJA 3RVNA 4IIXA 1TKBA 2O2YA 3IDAA 4B8WA 4BP9A 4Z3DA 3BJRA 3V1KA 2Q49A 1GPAA 3PUXA 2IDZA 4CMIA 3B2QA 1LVHA 4DIBA 5IDXA 3D6NB 4DA4A 3E81A 2B8TA 3HRHA 2QXYA 3TUZC 3FHOA 1VOTA 3HDHA 4EECA 4XX1A 4NNPA 5JH7A 3NHWA 3EVGA 3FFWA 4KQEA 1OUMA 2JAPA 2Q4TA 1JYEA 3DDHA 1TXGA 2ATXA 5BYKA 2P6RA 5AOBA 2H2HA 3FLMA 2HRZA 1CQJA 5CLHA 2IP2A 4EELA 1UMCA 3ZNPA 3L4EA 3KSMA 1QIGA 1U0FA 1U6KA 1R1DA 3PZRA 4LDQA 2BGGA 2Z3ZA 4QASA 3VPHA 5C5CA 3VDMA 3PPVA 4YCNA 2YWFA 1M33A 4O8ZA 2GVZC 3UAZA 1F8UA 1GKIA 3BL5A 3R7FA 5ITVA 4KQ2A 2FR8A 2DPXA 3SR0A 4RORA 4BQOA 2Z2ZA 3K8QA 3LVBA 1XIVA 1P29A 2A86A 5FAXA 1SHUX 1E1CB 3NAQA 3QKSA 3OFJA 2O57A 1KYYA 3OWOA 4KR0A 3RVQA 1R64A 3VR3D 1QRUA 1N7GA 3GEIA 4N6GA 4CM9D 5DBHX 4S1OA