1U90A

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
molecule tags Signaling protein
molecule keywords Ras-related protein Ral-A
total genus 57
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u90A00
1D2NA 2HT1A 3CPHA 1GNQA 1HH4A 2F43A 2GCOA 4YDHB 2EFHB 3LDAA 5FBVB 4UXIA 1FTSA 3N70A 1GSIA 5GADl 2GZHA 3U3JA 3BB4A 4Z1MA 2GAAA 4M1WA 2OO7A 1MRSA 4IVPA 2EFDB 5G3ZA 3ADCA 4BFYA 1AN0A 2ZRDA 5IK2D 2VO1A 2F7SA 5JEDA 3OFND 3QBVA 1H8ED 3IIJA 4DB4A 1I4DD 1E9SA 4EJSC 1GM5A 2CE7A 2J0UB 4FMBB 2W00A 2BWJA 1E9RA 1CP2A 2C03A 4Y0AA 5L3SB 4KBFA 4TLCA 2AK2A 2GNOA 3VAAA 1GVNB 4F4CA 4I99A 5FUXA 2Q0HA 3MAAC 1U8ZA 3SBDA 2AN9A 3C15C 1E2IA 5GJVC 1EK0A 2EWVA 2H92A 5KPJA 5JECA 3GLGA 2V55B 5JZVA 1PLJA 1Z6GA 1ZD1A 2ZI9A 1KIMA 1IJFA 2WMOB 5JLJA 1D2EA 1ZIOA 2OAP1 1E9EA 4PHFA 5JI3E 1Z6XA 2H5EA 5IF9A 3RS3A 3QKUA 2BDTA 2NMVA 2DWOA 4BE7B 4W9MC 2ZSEA 4GT1A 3T1VA 2PX3A 3EPJA 1N6PA 1QHXA 4G5RA 4Q7JB 4RZ2A 5BQ5A 3OZXA 4CEHA 1G6OA 2NO0A 3AF4A 4KSBA 3NKVA 3OIYA 821PA 3THYA 3MG9A 5BN5A 4WA7A 4URUR 3BOSA 1FUUA 3FHOA 2FGJA 4DCNA 4K46A 4RCZA 1TEXA 2QT1A 3RC3A 1QVRA 2GXAA 2QE7A 4HZIA 2V1UA 3ZQ6A 2CBZA 1WP9A 2AXPA 2EU8A 2WKPA 2CL6X 2WWFA 3CR8A 3LV8A 3UMSA 5CJPA 2OILA 2GJKA 4TQ9A 2QU8A 1ZAKA 3H0KA 4EJSA 2WV9A 4L15A 4DCTA 1RZ3A 1DO0A 1N6OA 4LYHA 2J0SA 2HLDD 1T5IA 1OFIA 3I5XA 2PCLA 1BYIA 2NZJA 2HV8A 1TNDA 3OIVA 3GQBA 5G3YA 4MYUA 2XGJA 1QG4A 3SR0A 4HUTA 1QG2A 4ZV4A 2W2VA 3TLXA 4C0LA 5KNDA 3K09A 3MWLA 4RSGA 1ZINA 4V02A 2WJIA 1U0HC 1ZD8A 3ZDQA 4BECA 4RD0A 3QF7A 2YOFA 4FCWA 4C0SA 2OXRA 3CF6R 2BBSA 1DO2A 2RGGA 1YZNA 2VSFA 1BMFD 1SXJD 1KDOA 1VG0B 4C0JA 3MJRA 3ICEA 4P3YA 1XXHE 1HQCA 3R9WA 2MSEB 1WMSA 3AB3A 3ZQJA 1FQJA 1VG9B 3K0CA 3GLGB 3L0OA 1NBMA 2ODWA 2P2LA 4LOAA 3EA0A 4LV6A 2G6BA 4JLNA 4BLPA 2O8FB 2ANBA 1DE0A 1CJTC 3VR2A 2J0UA 1SVIA 3OAAA 4B34A 1TPZA 4PSAA 4OI0A 1WDTA 4IOJA 2ECKA 1NNEA 5K8TA 1IJEA 3PEYA 1IBRA 3SE0A 4HAWA 1XD8A 2ZU6A 1XEWY 1KGDA 3Q72A 2MSDB 2O0HA 4QHTA 4URXR 5BN3A 1G8FA 3KZ1E 5J5CA 4M1OA 5D3MA 3IEUA 2ONKA 5A0FA 4HZUA 1GUAA 2ZU0C 3UWOA 2IBMA 2B8TA 1E69A 3EWAA 2PJRA 2ZM5A 5AR1A 3MWKA 1US8A 4B74A 1Z3IX 1X1SA 2JA1A 1KNQA 4AG6A 3BK7A 3EZ9A 1G16A 4BZPA 4R71A 1NY6A 4EPTA 4L4UA 2VA8A 5FOTA 2BCJQ 2RB4A 1OIWA 1M1YE 2F43B 3DVLA 4EFLA 2QENA 2DFKB 4UQOA 1CJKC 1R6BX 3CPJB 4ARZB 4X8HA 5FFMA 1XTIA 1IOZA 4QKQA 3U6BA 2ZVPX 4PO1A 1OXVA 1D9ZA 1M7BA 1FPMA 3BORA 1E96A 4GZLA 4P33A 4KFRA 4PAQA 4OQNA 1WF3A 2BCGY 4E5UA 2YC4C 1C4OA 1K5DA 4AD8A 1HY3A 4DDUA 4K81B 3LW8A 1LV7A 3UPUA 3EZFA 4OHWA 1S8FA 5JSZA 2FN4A 1V43A 1WA5A 3MD0A 3HU3A 1HA3A 1RFLA 3QKTA 3NDBB 1YQTA 1Z47A 4DIEA 2WOOA 2VL7A 4RZ3A 5DIFA 4AWXA 1R4AA 3C7KA 4NONA 4WAUA 1E0KA 3I73A 2ZI3A 4LJAA 4OKSA 2IEZA 4UNPA 3TUZC 2PZGA 3ONWA 3PG5A 2KBFA 2OESA 4TMVA 4DSOA 4NDZA 1NVVR 1E9CA 3WMEA 2E87A 4Q4AB 3VR6A 2IF0A 4BPBA 4NPHA 3WNDA 1VIAA 3KKNA 1ZM3A 2GXQA 3LAWA 4HB0A 1U2RA 4MA4A 5JJIA 4TSFA 3D6TB 3QXJA 4DJTA 1VCOA 1W7AA 1LS6A 4B48A 4YONB 2QAGA 1IN4A 1PUJA 1B0UA 5FI1B 1N2CE 1ZU4A 4WZAE 4LBYA 2J1LA 1F2TB 2H17A 1Z6TA 2UZ3A 5DE3A 5SZHB 2CEAA 2CL7X 2QRNA 2R62A 1XEFA 1UM8A 1E79D 4I1UA 4MYTA 1KI9A 4I4LA 3SS8A 4B2IA 1C1YA 5F9HA 5FPSA 3AVOA 1WB9A 3EG5A 3NIBA 4XD7A 2FOLA 1SKQA 3KB1A 2ZI5A 3DEFA 1P61B 4R7ZA 4PANA 2LKCA 3KFVA 3O8RA 1L7VC 1E32A 4TWZA 4JT4A 3GJ4A 2NO9A 3GJ5A 1NRJB 4MRPA 5CK5A 4ZDIA 3FHCB 2GTPA 2A5DA 4DCSA 4D25A 3QIAA 3UMRA 4O0MA 3QF4A 5AUPB 4PC1A 2K5UA 3DM5A 1R0YA 521PA 2F3RA 1WCV1 5EXTA 3FE2A 2WAYA 4TLAA 4MUAA 5KPDA 1DAIA 3U61B 2IC5A 3AV0B 5H68A 5HE9A 1HYQA 1EFUA 3DOEA 2OZEA 5IHPA 1SXJB 2QROA 1UBGA 2CCKA 1W1WA 1MT0A 3RHFA 5AJXA 4JLOA 4M53A 2HUPA 2Q21A 2ZJZA 4DLYA 1A7JA 3TBKA 2XB4A 3V4RA 3KKQA 2A78A 3LD9A 4CEJB 4QBFA 1GP2A 4L16A 2BMFA 1UDWA 2JLRA 2DY1A 4E09A 4URWR 2QBYB 1XEWX 2QAGC 1FX0A 1FZQA 1S0UA 3B7GA 1G41A 3KTAB 4LK2A 4GOKA 2G88A 1B23P 4G5QA 5EXSA 3ZYCA 4NYMR 4PSKA 2ZJAA 5BWMA 2AK3A 4WW0A 3UATA 3QSYA 3QPUA 4PR0A 3ZVRA 1UKVY 3ZLJA 1NG1A 1FMLA 1M34E 2CLSA 2XNDD 3ASYA 1T3SA 1X8LA 1KJZA 3TIFA 4JMPA 4MYHA 4YDSA 4Q47A 2B7BA 5FL7D 1XNJA 2PL3A 1GFIA 1AS2A 5JBQA 4D4MA 4CEJA 2W0MA 4NYIQ 1ZC3A 1MR3F 2CNWD 1E99A 1NVWQ 2CE2X 4RD2A 3AUXA 3R8FA 4RFSB 3TJZA 3ZZUA 4LHWA 2GHIA 2B92A 3G5UA 3PEUA 4DIDA 1ANKA 1KO1A 3K8YA 1VYUA 221PA 4NE2A 4DB2A 2YOHA 3A1TA 1G3MA 2VHJA 5J47A 2R65A 3R8CA 2P6UA 4PPQA 3K0CC 3TMKA 5EUMA 2AFHE 4MKGA 1XCMA 4R9UC 2IS6A 1OXSC 2PCJA 3RVBA 3X1ZA 4Q7MB 4XWOA 1OKKA 5H8WA 4NCNA 1EX6A 2TMKA 4HLUC 1JI0A 3I72A 4H9GA 4TMWA 4EPRA 3OEHA 4NU0A 5KSPA 1NKSA 5GVSA 3BWDD 3CNLA 2ZR9A 4IOMA 4G0NA 4UJ5A 3SYNA 4ASUA 2G1KA 3TK1A 3QENA 2WJYA 3CKLA 4AKHA 4M4SA 1RE0A 4MITA 2G77B 5TARA 4TTPA 4PTLA 3SBEA 1TQ2A 4S35A 4NCIA 5FI0B 2X2EA 2GK7A 1U94A 1AM4D 3SOPA 1ZVQA 4GL2A 1DG1G 3TH5A 4A2WA 1M7GA 1CJUC 3SJAA 4IJMA 3QKSB 1XTJA 3KJHA 2QTFA 1T9HA 3AF3A 1RRPA 1P2VA 4DEXA 1OYWA 3RSLA 3HPQA 3E5HA 1N5JA 4IKEA 4DUGD 5KSZA 3MJHA 2ZYWX 4TL7A 4FCVA 2V6JA 4QJ3A 1XMVA 2R6GA 1LVGA 3L43A 2AD5A 1ZM4A 2XOKD 4GNKA 4B33A 1IQPA 2XEXA 1ZP6A 1C9KA 4URZR 4NZYA 3DKVA 1P9NA 3K9NA 2FNAA 1KI3A 3Q5EA 3WMGA 3LQRA 5EP4A 3T1TA 3BBPA 2W6ID 3MCAA 4P4TA 1ZM9A 1OF1A 4RVCA 1E98A 1XMIA 3NC0C 2Q9BA 3CWQA 1DAEA 4PHHA 3RAPR 2ZXUA 4KYIB 3SYKA 3EXAA 1OH8A 3BH7A 3PFIA 2RGBA 3BRWD 2F55A 3R9XA 4LYAA 2V6IA 4DSTA 1Z0FA 1XB2A 5HPYB 1P9RA 1NN1A 1WQ1R 2HYDA 4M21A 5DI3B 4Q4LA 2P65A 1XP8A 2FGKA 4TT3D 3Q9LA 1G5RA 1RRGA 3N5CA 3REFA 4BFTA 4JZKA 2ZROA 1H8HD 5FH9A 1ZMXA 3CZPA 4WOPA 3EIHA 4KSCA 1AK2A 1IXRC 4GP6A 1GL7A 2VLIA 1SGWA 3LA6A 3QKRA 1F6BA 4KV9A 4Q19A 3UIEA 5KDOA 2ODNA 1K5GA 2HXYA 1E0SA 5FOUA 4FIDA 1YRAA 3EW9A 4P31A 1P2TA 4UNSA 3RRMA 1ZNXA 4L9SA 4JLDA 2QPAA 3A36A 4GPTA 4V0ME 4KODA 4FINA 1DELA 2HXSA 3CRQA 2GCOB 4XWAA 2WIBA 2ZSDA 4FW9A 2F9LA 4B3GA 3I5YA 4WXPA 4JKYA 4Q66C 4BWYA 4MRNA 1NVVQ 3K09C 2LKDA 2JATA 1UEIA 2OBLA 3QXCA 2XB2A 1KY2A 5FPYA 2GBLC 2NGRA 4EIWA 1N6LA 3CLVA 4MRVA 1R5NA 1OH5A 4NKRA 3OIUA 3GJ8A 4MGYR 4JLPA 2G9NA 1XTRA 1QDEA 4DLUA 3RRNA 4A1FA 4DBLC 4M0LA 1E94E 4A8JC 3P4XA 2VBCA 1U81A 3K9HA 3Q8XB 4PC6A 3H86A 421PA 4HDOB 3R7WB 4AKIA 3HDTA 2KE5A 1ZUNB 1CF4A 1ZJ6A 4IVRA 2H18A 2Z83A 4KBGA 2VHQA 5KDDA 2IX3A 4LUCA 4I1SA 1VIYA 1JEDA 2NOAA 1Z63A 4FI3C 5AWFC 5L3VA 5LB4A 4W5HA 4A8JA 1M8PA 1GNPA 4DLRA 4LHXA 3WBJA 5HZKA 4CEIA 2XXAA 2QP3A 3W6OA 4NH0A 3AKEA 2O8BB 2NG1A 3EZ6A 5FPHA 4IFEA 4JIMA 1KDTA 2ZAMA 4WZBE 4W5WA 3GLIA 2D62A 3LXRA 1X86B 1Z6YA 1BYUA 2CNWA 3EIQA 1JBKA 3KUCA 2GJ8A 2PZEA 1DAHA 1DAKA 1UAAA 2QMUA 1NP6A 5CM8B 3GJ0A 2PH1A 4TQUS 5CB6A 3VKGA 4V0KA 3VNVA 3EPLA 3U7GA 1UDXA 1KHTA 3MMPA 1NSTA 5C46F 2BBOA 1MV5A 1Z2AA 3QBTA 3L2OB 1G8GA 5E7MA 1N6RA 2WWHA 3LBHA 3UK6A 1X8JA 2WJHA 1YU9A 1CRPA 4HDCA 2CDNA 1Z6AA 3NC1C 2HCBA 2JDIA 3ASZA 5FPTA 3AVTA 3OEHD 3QNUA 2P6RA 3EARA 4PAOA 4TTQA 1XPUA 2RAPA 1CEEA 3GLHB 5BYJA 3DKPA 1FMJA 3GEHA 2YINC 1T3HA 1KZ7B 2WSSD 3KJEA 5DH9A 4HUQB 4OJKA 3SHWA 5HR5A 5IRCD 2C5LA 4QNMA 1IAQA 3QE0A 1Q0UA 2OLKA 3LRPA 1E3MA 4YMTA 3CRRA 4F93B 5FL7A 3AVPA 1N6KA 1OHHA 2Z43A 3AEZA 4PZLA 3TRFA 4ZCMA 3K0AA 3WYGA 1OIXA 1OXXK 2XSZA 2P5SA 3AP3A 4KJZA 2YKGA 2VQSA 4OBEA 2ZRJA 2WTUA 4RCYA 5F98A 3QVVA 1NN3A 1KI7A 2N42A 1E9FA 2XZLA 1G7TA 2D4HA 1ONBA 1NVUQ 3KQNA 2DPXA 4JSTA 4AIIA 4OK5A 1KI6B 2XX3A 1GRQA 4XJXA 1NLFA 3WMFA 1FW6A 3ND9A 1AKEA 1G17A 4LY6A 4B3DA 2RGXA 4CVNA 1RJ9B 2XJ4A 3W6NA 1QZXA 1UEJA 1GRNA 3EA5A 3NH9A 4TMTA 1S9HA 5SZJA 3ADBA 4Q9IA 5KNCA 3TGPA 3ADDA 1TUEA 3CM0A 1ZYUA 1BO6A 2EVWX 1U98A 3P26A 4A8JB 2ZE5A 4US0R 2C77A 2ERXA 2O8CA 1NMXA 1TQ6A 3A4LA 3VTKA 4BFWA 3V00A 4F7WA 3PXGA 3CUEF 1E79A 1ESNA 1N5KA 1IXZA 1VYTA 4Q4JA 1DEKA 5C4GB 4DLVA 2YWEA 2OLJA 4HYYA 4WVFA 4M1SA 2HF8A 4ZPXA 2JLQA 4O25A 1OH6A 2GKSA 2PEZA 1P9WA 3F3YA 3IO3A 1G3UA 1ODFA 1OE0A 1XD9A 1KDPA 1JJVA 1Z0IA 1T3LA 2AL7A 1T5LA 4F38A 1COWA 3D7MA 1KZGB 1SVMA 4HAUA 2J0QA 4PXAA 4NYIR 2WBLC 1EG7A 5G53C 1M7HA 3F8TA 5EXXA 1P60A 5JEEA 4KVGA 1D2MA 2EYUA 3CRMA 3BAFA 4LJ8A 5L3QA 2BMEA 2QAGB 2WICA 4RD4A 3RS4A 3T5DA 3SFVA 3VR4A 3N2EA 2EFEB 5FOWA 2QGNA 1N25A 3GLIB 2J7PD 1JXOA 2X19A 4MGZR 3W5JA 8OHMA 5CJ2A 5DNYB 2Y8EA 2FPMA 1P62B 2VSOA 2BEKA 2KBEA 3AP1A 1W0JD 2LCFA 1VTKA 2IK8A 4LC1A 1DTSA 1KO4A 1DAFA 4HAYA 5TY0A 1E0AA 4AK9A 2QZ4A 3DMNA 3A6PC 4QBHA 4TL9A 2QL6A 1NBME 4NL4H 1UBCA 4JT2A 3O8BA 3DM9B 3HPRA 4JBYA 1ZM2A 2OSBA 5J4LA 2BJVA 3PJRA 3FWYA 4Q01A 4KVAA 4RZXA 4OHYA 2JJ8A 4K8OA 5AJZA 4TT3A 2ZRAA 1YZLA 2F1IA 2OBNA 3KXIA 4FMDF 2ZIAA 2ZRNA 2ZVQX 2IEYA 2IYXA 5JSZB 2QN6A 4BEBA 4CT5A 3P27A 1D5CA 1H65A 1AIPA 1E1QD 2GBLA 5CM9C 3S1AB 4LJ4A 3CRW1 1SHKA 3TAUA 5JWHA 2VF8A 4N3NA 3TQFA 2AD1A 4YLGA 4ACAA 4L9WA 4C2TA 3PUXA 2C98A 2IS1A 2YNMA 3BGWA 2PJZA 3M0EA 3P20A 2PLFA 4RKFA 1KK2A 1AGRA 4M2LA 1HV8A 1LY1A 5DI9A 5TV2A 2ZI6A 2JLWA 1WE2A 1X1RA 3QKRB 5IT5A 1T8UA 1E2PA 2R6AA 3TE6A 4HZUB 4QM7A 3LX8A 1OH7A 3A4NA 4JLJA 2VF7A 1X8KA 3K9GA 2VHCA 4KHZA 3AF1A 2GILA 2YWGA 4M9XA 3GLFB 2ORIA 1XBTA 1R2QA 3BXZA 3L0SA 3QOFA 3FKSD 4Q02A 3U3OA 3VR3A 5AUQA 2JCSA 2A3RA 4BFUA 3NBXX 4RZUA 2W2TA 2CK3D 5A5GA 2AR7A 3I61A 2KJQA 4ZDKA 2CJWB 3OAAD 2HDNB 1OV4A 3A1WA 4ZCLA 3I3SR 4IDQA 1M74A 1F60A 2MSCB 3SJCA 3BFKA 1J90A 2WKQA 1XFAA 5EZ6B 1N5LA 3R9IA 1GILA 3L82B 3MWYW 4CZ2A 3LLUA 2HYIC 1XTSA 4EKDA 4V0NA 1N0WA 4D82A 5CB8A 1T6NA 4EQ6B 2A7QA 3C5HA 4LJ9A 1MH1A 4G5OA 1KI6A 3VKWA 3P32A 3I1FA 2Q9AA 1O3YA 2HF9A 3BH6A 4Q9KA 1BKDR 3EZ7A 4KI0A 4WIAA 1VG8A 4XTRA 1VYVA 4D80A 2RGEA 4B2LA 1KI4A 4W5JA 2IF2A 5D3MB 4DXAA 2IYTA 2W6JA 2YV5A 3BB3A 2GETA 2ORWA 1Q20A 5JS7A 2ZYTX 3CO5A 4JJZA 1K6MA 1G8YA 2OG2A 4JVSB 4TLBA 5CYOA 3QKSA 3Q7PA 4PFSA 1YKSA 5F9FA 2GEVA 2FZLA 3IHWA 4Q4HA 1UKEA 4D4JA 1TMKA 3ND8A 4ITRC 3KDSE 2X2FA 1CBUA 1HTWA 2A2ZA 2C04A 1CJVC 1CS4C 1HUQA 1R10A 1NN5A 1EXMA 5DGXA 3P1JA 1K8RA 3U60B 2HEIA 2EQBA 3RNLA 1NL3A 1COWD 3SU8A 4KFSA 5HZHA 5J4HA 2H16A 2A5YB 3VMFA 2R8RA 4OI4A 1YR8A 1M2OB 4MKFA 4DSNA 2QMEA 1W47A 3FKQA 4DZZA 5EJEA 4LGMA 5JHHB 2NQ2C 4FMCB 3FB4A 4CRWB 2IXGA 2YOGA 5GVRA 2ZREA 5JJLA 1CJMA 2QP4A 1Q1QA 4LV5B 2FMXA 2RGDA 3DZDA 2R2AA 1N6IA 4KLZA 3EPKA 2J46A 2O8EA 3A4MA 2V8OA 3TSWA 5DYIA 3KKPA 3C16C 4B6FA 2QG6A 1G7CA 3U44A 2YZ2A 4QC2A 3PEVA 5EZ5A 4EPVA 1DAMA 1IN7A 4DSUA 4XIGS 3VKHA 1OLOA 3SDZA 3TR0A 1YR9A 5DHAA 4G1UC 4JLKA 3HYTA 3B9PA 3FOZA 2O0JA 5CDFE 3NHBA 3U7FB 3X1YA 1U9IA 3KQUA 1JQJC 1L4UA 1XDBA 3LBIA 1KOFA 3T15A 1Q1ZA 3KJGA 1E2JA 1T0JB 4MYCA 2ZRFA 2W83A 2YJTD 1W49A 2IYYA 1HQYE 4TMZA 3LX5A 2ZUCA 2MMCA 5B57C 1UKZA 2QTVB 1QHIA 1S3GA 4E07A 1QHGA 3AQ4A 1FX0B 2ORVA 1RIFA 3JVVA 4QGAA 4QGGA 3AF2A 4Q4JB 1OFHA 4D6PA 1Z22A 4JKIA 4PX9A 3LXXA 2IYWA 2JLZA 2ZRPA 3UG6A 1G7SA 1FOEB 1KTVA 2EYQA 2VHTA 1GKYA 4FMDB 1L4YA 1WBDA 1NMZA 3AVQA 2WVJA 4FXPA 2D7DA 2B6HA 1Z07A 3E2IA 4B3FX 3KQHA 3VQTA 1F3OA 5LBIA 2JJ1A 3LNCA 3OEED 4M1KA 2FFAA 2JLVA 1N3BA 4DLZA 4ESVA 2D06A 5J4KA 2ZRBA 5EQTA 4EQ6A 3ZIAA 4IEIA 4Z54A 2F9MA 2H57A 3A58B 3NEYA 2ZR7A 4U5XA 2DWQA 1UADA 3VNUA 2GWHA 3OHMA 4IDPA 1CKEA 2UVQA 2PT5A 1ETUA 2GJ9A 3DZ8A 4A4DA 4DWJA 3QG5A 1T4GA 2F1RA 4GZMA 4IDOA 5DN6D 4IFBA 3T34A 1GOTA 1E1RA 1KMHB 3T1QA 3MFYA 3ZH9B 3M4YA 1W4CA 2FPKA 2R9VA 4DLTA 3CONA 4PC7A 1G291 3CB4A 2IYLD 5C1BA 2JDID 5BYKA 1AA9A 1RYHA 2A9KA 3QEJA 2XXAB 1WRBA 4LHZA 4P0TA 3U7HB 4EAQA 1TQ4A 4PAMA 2IYRA 5CIQA 1P6XA 2J3EA 3PCRB 1XCPA 4PC2A 1Z29A 5TDHA 2FF7A 3A8TA 4BFVA 2O8CB 3U7EB 4Q03A 1E2HA 4Q1AA 4LX0A 1CU1A 4E22A 2ZYUX 4Q00A 1OHHD 3L0IB 4FMCF 4OI1A 3L8ZA 1P4SA 3A1VA 5K8IA 1F2TA 3PUZA 1TAGA 4PQRA 4EPYA 2AWNA 3AKYA 3GJXC 3ZS8A 4AYWA 2IYQA 3WP0A 121PA 1DBSA 1YVDA 5AUNB 2GF9A 3PENA 1US8B 3W5IA 1SHZA 3N2IA 2XTZA 4MDEA 3QI2A 1G18A 3UANA 1JR3E 3PV0A 4Q18A 1A1VA 4TSFD 4ZDWA 3B9QA 4MRSA 1OKKD 1JECA 4CYMA 5FBWB 2GDJA 4KFUA 3JZMA 4ACBA 4P4SA 4FD2A 1F5NA 1DG3A 4DT1A 3BERA 2H7VA 1Q57A 1LB1B 2QEQA 4NP6A 1W44A 1G19A 1II0A 3AKCA 2FU5C 4N0EA 4NHOA 4RD3A 4BEJA 1WXQA 3QG1A 2O8FA 4BFXA 2QQ0A 1R7RA 1PVOA 5D3QA 1Z0AA 2QI9C 5FBLB 4BFSA 1OB5A 3IILA 4A2QA 2P0EA 4C4PA 2PMKA 2HCJB 3BD9A 2BC9A 4EPXA 1E9DA 4XSGA 3FHTA 2CCJA 2WMNB 1SKYB 2IUTA 3EZ2A 3WYFA 4M9ZA 5DI3A 1DARA 5EP1A 4ZDJA 4LPSA 5HCIA 4XVQA 3U5ZB 1NLZA 2J59A 3OESA 2Q3HA 3K0EA 1U99A 1DS6A 2NTYC 2VPPA 3RANA 4DDVA 1OJLA 2GXSA 5KO2A 4ABYA 1W48A 2L0XA 3H4MA 1II9A 5LD2C 3CPEA 2YVUA 4O2LA 1XU4A 2FSGA 1FQKA 1JR3D 2WSMA 4NCHA 4YMSA 4ARZA 4QM6A 2R6FA 2ZJBA 4GOJA 4BRWA 2V3CC 3V9PA 3K70D 2O8BA 4JLMA 4P32A 4O3MA 2I4IA 4FCTA 1NVXQ 2E1RA 4HAXA 1KI8A 2W0SA 2ZSBA 3RC8A 2JLXA 1SZPA 1U0LA 1XMJA 3VHLB 3ZGXA 4KLNA 4OQLA 1MO6A 4QJ5A 4A82A 4PQYA 1ZIPA 3W34A 4IW3B 2RKOA 4UKDA 2N46A 2SHKA 4RD6A 5E3HA 2NO6A 1VDZA 4Q1FA 2RH5A 1G3IA 4B3XA 2OFWA 3PUYA 2OCAA 1UBFA 3FTQA 3O8DA 2ZI4A 2O8DB 1M6NA 4LCBA 3RS2A 4B3CA 3SQXA 1U0JA 5FTJA 4QG7A 4U00A 1D9XA 5CDFA 3GD7A 3B1ZA 2ZRKA 1KK1A 1IHUA 2VHUA 1ZNYA 1DOAA 2NIPA 3K0FB 1T8TA 3L8YA 5P21A 1J7KA 1E6CA 1KKLA 5E7JA 4A15A 1W4BA 3AUYA 3LLMA 2DHRA 2Z4SA 4KFTA 3VU9A 2WJGA 3BC1A 2XNSA 4TQAA 1KO7A 4AG5A 1I2MA 4M9QA 1RJ9A 3M1IA 4HDQB 5FTMA 4DLXA 3GLIE 1GG2A 2ZRLA 2OFXA 2XTNA 3FDIA 2ZR0A 5FTLA 2BMDA 2GCNA 2ZS9A 2Q9CA 2QUZA 2VIIA 1E2NA 3FFAA 1G4UR 4DRZA 2BJWA 2FE4A 4P4UA 4BLQA 2CJWA 2XNDA 2AXNA 3C8UA 5B64A 1YJ5A 1N5IA 4ERNA 4B73A 3HWSA 5EXPA 1NY5A 2RCNA 4WXRA 1KK3A 2JJ2A 3HJNA 3NWJA 3QQ5A 4LV8B 4OHXA 4BZXA 5B30A 2JEOA 1F2UB 2OCPA 4TYYA 1CRQA 1E0JA 3B1WA 3Q5DA 3EPHA 1E1RD 3TNFA 4ZCIA 2FZ4A 4OQXA 2R6DA 1I4LD 2ZSFA 2O0KA 3DO6A 4GMDA 1RYFA 1Q44A 2F6RA 3KX2A 1AQYA 1IN5A 4GSYA 1YZTA 2UZIR 1CR4A 1Q12A 1Z0KA 2GVDC 2YWHA 4TZ0A 2Q3MA 2FSFA 2XZOA 3T61A 2RGCA 4Q7KA 4H1UA 4B32A 3LVRE 1G1MA 2WKRA 4Q1CA 4TL8A 4EFMA 3FGNA 2ERYA 1SVSA 5FTKA 1ZRHA 4POAA 1S2MA 1J8YF 1ZCBA 2ZJ8A 5BN4A 3NBZC 1GNRA 1TF7A 1Z06A 2RGAA 3GFPA 1U90A 3TW8B 2I1VB 4ASUD 1VECA 4A6PA 3IGFA 3TSOA 5JS8A 2W6JD 2DWPA 3DHWC 2RHDA 4YC7A 4V0MA 4QXAA 5H1YA 4I1OA 1ZNWA 3SNHA 2VP6A 2WJVA 3EC1A 1XJQA 3MRSA 4QNRA 5JRZA 3VR5A 1E4YA 1R0WA 3EWSA 4DCUA 1SXJC 1OT3A 2PEYA 1U9IC 3FMIA 1QF9A 4AKEA 4D0NA 1NF3A 1KYIA 2IYZA 3LFUA 4C9BA 4F4JA 5B58C 1AS3A 3W3ZB 3DL0A 2D2FA 3L0PA 3WHLA 4MDFA 3OE7A 2O8DA 2I3BA 4Q9LA 3KKMA 1Q1BA 1TF2A 4V0LA 2X8AA 3CH5A 2IYSA 2V9PA 3QPWA 1SULA 1MO3A 1QVAA 3JVUA 3TSZA 3O47A 4B3BA 2BVNA 3FMPB 4II7A 2QP9X 5ANRB 1CTQA 1YZQA 3B78A 5DSZA 4TLDA 1XJCA 4PC3A 1YZKA 2W6IA 3AVWA 4C7OA 1DVRA 2XJ9A 2G83A 2IWRA 2G1JA 4YMWA 2WM9B 2C9CA 2JAQA 1ZUIA 4LHYA 4AY2A 2OM2A 5AJWA 5G41A 4PPNA 4Q21A 1G3QA 4GI7A 1LFDB 4Z51A 4DDTA 3DMDA 4IXNA 5TXGA 4DKXA 1E2LA 1XWIA 4OHVA 1G7RA 2RGNA 5AUOB 3RYTC 1W2GA 2JIZA 3CNNA 3VX4A 5KUTA 4NYMQ 1E2EA 2CL0X 3GFTA 2KSQA 1ZW6A 1W0KD 2P67A 5EE9A 4DDWA 2IT1A 3IHLA 1P2UA 1Q21A 1H8EA 1XMSA 5L3RA 1TF5A 3ZVMA 3CF2A 3UWKA 2ZE8A 4GP7A 4W7SA 4TZ6A 4HI0E 2HLDA 2J9RA 3CZQA 2BMJA 1P73A 5JCZA 2EW1A 4CIDA 2P5TB 1J99A 3B2EA 1MOZA 2IXFA 3GLFE 2AKAB 2ZJOA 4IEEA 4L8GA 2ZI7A 1Q3TA 2WOJA 1Y3AA 2DBYA 3AKDA 5GJBA 3TVTA 3G0HA 3X1XA 4HAZA 1EX7A 4XWKA 1KI1A 2ZYVX 4LPKA 3AP2A 2REXB 2DFLA 3TUJC 4DCVA 5JJKA 2GJSA 1KKMA 1P2SA 1N0VC 1LS1A 4IDNA 4IOLA 3RWMB 1NIJA 5KYKA 3I62A 2KB0A 1JPJA 2WJJA 4PPGA 3WHKA 1XXHA 2WWYA 2GJAA 3GP8A 1ZCAA 3MGCA 1KNXA 1EFTA 1DPFA 1FTNA 1OXUA 1Y63A 3WXMA 4AC9A 2DFNA 4ZO4A 4LDJA 2GVZC 4CT4B 2WWIA 4WBSA 4LJYA 3KXLA 1TUIA 4JLVA 3GJ6A 621PA 3SQWA 4TN1A 3AVUA 1Z0JA 2KI5A 3IEVA 3CIOA 4A6XA 4LSGA 3NEJA 1ZU5A 3NG1A 4RFSA 1IY2A 5EUQB 2DYKA 4WZ6A 5TVKA 4BLOA 3RS0A 3WP1B 2W58A 3B85A 3MLEA 4X8LA 3ADKA 5CLQA 2WSSA 4QJ4A 2OT3B 4Q4HB 3IIMA 1VCNA 2IXEA 3KQKA 1YHNA 1NBMD 4C0BA 3AVYA 1UJ2A 5LPNA 1RC8A 1S1MA 2JJ2D 2QT0A 3ZD6A 4NYJR 4ZIRA 5DO9A 2ONJA 1MABB 2OUKA 2QGZA 5FOVA 4B35A 2RMKA 2IUUA 1A82A 4HAVA 2FDCA 1RW4A 4BFZA 4BASA 1ZC4A 3CBQA 3H1TA 2C78A 1EGAA 5G40A 5LB2A 1YRBA 1KJWA 3UXMA 3FVQA 4RFVA 2CCGA 1AQUA 2YHSA 4YQFA 1KAOA 5HE8A 4TYWA 3QY0A 4V0OA 1XRJA 2WWXA 2ZRCA 2C8VA 2Z0MA 3VFDA 4IXMA 1PV4A 1XEXB 1UF9A 4F4IA 1NMYA 5CLLA 2CMKA 4A36A 3LH5A 4ZI3A 4AI6A 2FSIA 3SYLA 2QA5A 4B2PA 2QPOA 3OFNA 3QF4B 3D3QA 4OK3A 2O5VA 2XZPA 3E1SA 2OHFA 1MABA 2F1HA 1CR0A 1LF0A 3ICQB 3NBYC 3BE4A 3X2SA 2HJGA 4HLUA 2HJVA 3CX7A 1ELOA 1GL9B 2XAUA 5C4MA 4R98A 4HUQA 1YR6A 3CR7A 2FX3A 3X1WA 1KAGA 3GLFA 4QL3A 2D74A 3U3KA 4PPFA 1W5TA 2RHMA 1IONA 3K1JA 2V4ZA 3M6AA 1L8QA 1NSFA 2ZPTX 1R8SA 2ZSAA 2FJUA 3ETLA 1GAJA 3RRZA 2ZJ2A 2V54A 3B6EA 2G0NA 3BFXA 4NYJQ 5DYGA 4OK6A 1UKYA 4MRRA 3AVVA 2AKYA 2P3SA 2ZQ5A 4ILEA 4CEHB 1R5OA 2PZFA 2ZRMA 1AS0A 2D7CA 3NVAA 5CITA 2BM0A 4JL5A 2B7CA 4EFNA 1SVOA 2QM7A 1RRFA 4JLBA 1G6HA 1FL9A 4PZYA 2BKEA 4M9SA 4C0QC 1QHHA 3WY9A 3CWZA 4US2R 2OV2A 4OI2A 2WWWA 1XZPA 5E7IA 1DADA 4M8NE 4XD7D 4BRUA 3QXHA 1CR2A 1W36D 2VRWA 2IYUA 3S1AA 1RRCA 1JAHA 1GITA 4QRHA 1NG9A 1XD2A 2OEPA 2R6CA 4ZKEA 2GRJA 2AX4A 3K70C 3D31A 4JL6A 1G21E 2QNRA 1E2MA 5UKDA 3Q85A 1JPNA 2REBA 1Q1EA 1W0KA 3EIEA 2FFHA 3B1YA 5FOXA 4DC9A 4BGDA 1IM2A 4UNNA 4Q9HA 3PQCA 1J70A 4B75A 1ZD9A 3B13B 2BIFA 1OXTA 1MO4A 3ZJYA 3W9YA 5F2EA 1AJEA 1P5ZB 1XEXA 4LC0A 3I4LA 5JWRA 3IPYA 1KI2A 2ZEJA 2ZITA 1OW3B 2RGNC 3SC3A 1SXJE 2A5JA 2OFOA 3LO5A 1XTQA 4TTRA 2IS2A 1MKYA 2J7PA 4D0LB 1TEVA 1HEIA 1FNMA 3CW2A 4AKGA 2WZQA 1Z8FA 3AVXA 6Q21A 1LTQA 2PLRA 1W0JA 2V1XA 2GCPA 1GKUB 5KDLA 5KSOA 4GDFA 2O8EB 2W2XA 3IQXA 3A1UA 3T35A 3B1XA 3GPLA 4GBMA 2ATVA 3UKDA 2C99A 4QOSA 1NJFA 2JIZD 4IRUB 1GDDA 2OAQ1 1FUKA 4FWTA 1E9BA 4LYJA 1NLYA 2UKDA 4HSEA 4BLSA 1W5SA 2QAJA 4EUNA 1P7CA 4DLWA 5FR1A 3HP1A 4GRAA 3I32A 5FR2A 2VP9A 2JGNA 1KMHA 4Y0VA 3QJYA 2X77A 3NXSA 1XCGB 4HEJA 2QMHA 3IKJA 4IHQA 1J8MF 1S3SA 1E2QA 4JVLA 3PVSA 2ZRGA 2BKUA 2FG5A 1N6NA 3K53A 2CHGA 4JSYA 3T12A 2GA8A 4Q1DA 2ZJ5A 3IPXA 2H8KA 2PT7A 2ZRHA 3GFOA 1S96A 2CVFA 5BXQC 2JJ1D 3OEEA 1UFQA 2JLSA 4A2PA 4DHEA 3CRVA 5FL3A 4D26A 2FWRA 5LDDC 1UPTA 1G9XA 3TR5A 3GLGE 1P3JA 4ZI2A 3WBKA 1GWNA 5HTKA 2N1BA 2QBYA 3U3MA 4US1R 2ZRIA 3WRYC 2PMDA 5K8LA 1TADA 1PLLA 3Q7QA 4UJ3A 5SZIA 3UMFA 1XPRA 3EASA 4MQBA 1QBKC 4G5SA 4HLCA 2JLYA 2FH5B 2F3TA 3AH8A 4A0HA 2B21A 4B6EA 4Q1EA 3QPVA 4D81A 1CR1A 1XTKA 3VR1A 1A4RA 2IUSA 3THXB 5M04A 5FUWA 4CGZA 3QUSA 2Z6VA 2ZANA 4GMXA 3IDQA 3F0TA 1EESA 1FP6A 3QXSA 2VP4A 4XOIA 5CK4A 1KSGA 3OIWA 4NCKA 3RWOA 2ZTSA 1TTTA 2VTKA 4LJ6A 1G3RA 1A2BA 4CDGA 3ZD7A 5FPKA 4BQSA 4F91B 2AFIE 2WWGA 3HR7A 3EAQA 2CK3A 1E4VA 3HU1A 5K8UA 2FFBA 5A4JA 1E2FA 2V7QA 1ZUHA 1E2DA 4D2IA 4OJQA 1U8YA 2VSXA 2ZUBA 1BH2A 1JJ7A 5JI2E 2X1VA 1EFRD 3DDCA 2GZDA 3QEOA 4MUBA 3SHFA 2VP5A 2QORA 2QQEA 2R44A 3QXXA 1GTVA 4BLTA 3PR1A 3R20A 1D8TA 1IY1A 5AJYA 3T1OA 4TL6A 2ASEA 5E4FA 2VP0A 1NN0A 2IS4A 1FP7A 2OCYC 4NBSA 4R2IA 2KWIA 3DOFA 1OPXA 3W6PA 4C0HA 4BZQA 2A5GA 4FWIB 2GEUA 2IA5A 2E9SA 5DHFA 1LF5A 2XITA 5KHOC 1BIFA 1SVKA 2ZAOA 2ODEA 3SN6A 5IK2A 3KB2A 2BHRA 2ZJYA 3ZZ0A 1R8QA 2G0TA 1Q22A 5C2JB 1DAGA 3V4FA 4NMMA 1BOFA 1O87A 5B2ZA 3SJBA 4B47A 4CEIB 3RABA 1BS1A 3LWNA 4S2EA 3B8HA 4N1AA 4OHZA 4IOKA 4UNRA 4KO8A 2ZS7A 3GJ7A 4M1YA 4LBZA 2ZE6A 4MGKR 3FYHA 4JJKA 1TU4A 1YE8A 2D3WA 2WHXA 4X8OA 1G64A 1Z28A 2D2EA 1J2JA 1R0ZA 1SKYE 3CH4B 3D8BA 1G5PA 3KFXA 3KXKA 4C2UA 1JB1A 3FPAA 2IHBA 1S9DA 4ZKDA 4XVRA 3SI7A 1CULC 1MO5A 3BIFA 3KQLA 4HATA 2VEDA 2WAXA 4LHVA 4DUGA 1JXMA 3KL4A 4JVMA 1OIVA 5HKKD 1N0UA 2DFTA 4RY2A 4TYQA 3TW4A 4HB4A 2C95A 4LJ7A 4NTZA 4D0GA 2PBRA 4QBGB 2O52A 3B5JA 3Q3JB 1X6VA 3TAHA 3AM1A 1XX6A 1CIPA 3C41J 5J4YA 4C0KA 2PX0A 4PHGA 1NKTA 2FV8A 3I8XA 5SZKB 3GJ3A 1KO8A 2IHYA 2IW3A 1II8B 4A0FA 4B44A 4LI0A 1XZQA 4TMKA 1R5BA 3W8NA 4ZIRB 1KSHA 2C9YA 4AYXA 4LWZA 3LBNA 2QTHA 5TMPA 1IN8A 1GIAA 3U2QA 1Z08A 1KMQA 4JL8A 1TX4B 2Q3FA 3VX3A 1HT1E 1VHLA 2C96A 5FUYA 1IY0A 3NBFA 3CX6A 1P75A 3GLHA 2EFGA 4A9AA 3A37A 2QY9A 4URVR 3E70C 1QHHB 1II8A 2EFCB 2WPDA 3REGA 1PLKA 5C18A 2ZE7A 3TVDA 3ZIAD 3ZVNA 1QHYA 1NI3A 3NH6A 4E03A 3THYB 1JQLB 4RKEA 3BS4A 3LY5A 3SFZA 1GRRA 3VHXA 4LJ5A 5KNBA 3RLFA 5AJVB 3RS5A 3TQCA 4M1TA 1JALA 4QBIA 4EDHA 4B43A 4MH0R 3IIKA 3KKOA 4OYHA 5JCPA 4DT1B 2FFQA 4C7OB 3C5CA 3H2YA 2YYZA 5KU1A 3SZRA 3LQQA 4OQMA 1VPLA 4GOXA 4B76A 2HT6A 2J0VA 1CLUA 1OFUX 4JBXA 3VU9B 4EPWA 2IYVA 4NCJA 4XTCS 1AGPA 4ESHA 3THWA 4G3XA 4LBVA 5EP3A 1Z83A 1E9AA 4F92B 1PUIA 4Q4AA 1LNZA 4PQFA 4RJLA 1EWRA 1GKIA 4IDHA 4GFDA 1XJ0A 3PEWA 2FPLA 3GEEA 5J4VA 4LYFA 3T06B 3W3AA 1A2KC 5FBRB 4QHSA 2NZ8A 1RPZA 2Q6TA 3JZAA 3PUVA 4DVGA 3T5GA 5IDVA 4KITB 4CW7A 3AGQA 1EFCA 3EX7C 5GJWC 4A0RA 1V5WA 2IL1A 5EE1A 2NO1A 3HYRA 3MWJA 5DN6A 3RS7A 3IQWA 1Z5ZA 5AK0A 5FTNA 4URYR 4H1VA 1X3SA 5L3SA 1W2HA 3C4JA 1W46A 4JLAA 2CLDX 2WIAA 1VMAA 1E2GA 3CF0A 3HU2A 4L5BA 4MGIR 4X8MA 3R7WA 1JAIA 4JYCA 4KAXA 4QHYA 2IWHA 3WNCA 3PUWA 3J81k 3IBGA 2QSYA 2C9OA 4YXWA 1I2DA 4DLSA 4FN5A 4M1MA 2GK6A 4J0QA 2CHQA 2CVHA 4UNQA 1FNNA 4TMXA 4C3ZA 4BUJA 5KOYA 1A5TA 2GXUA 1HURA 2XOKA 1ZM7A 2LWIA 2VP2A 2VYFA 2J7KA 1W36C 4Z1MD 1QRAA 1G5TA 1VCIA 4HLDA 1UBEA 1XXHB 5FUVA 5JWOA 1QHNA 2XSZD 1PZNA 5EE5B 3IBYA 3IO5A 2FEOA 2DCUA 3U4QB 2QSZA 4LZZA 4BLRA 5L3QB 1KSJA 4HLQB 3FFBA 4QGFA 5FOSA 2B8WA 4C0AC 4YMUA 1ZBDA 5EP2A 1JNYA 2BOVA 4C30A 3WYAA 3K0SA 5E95A 2BM1A 1P72A 3MUFA 4RD1A 4M22A 1YR7A 2NPFA 4OQFA 4Q7LA 3KJIA 4U7DA 3K0FA 1IXSB 1T0HB 4KCGA 1FFHA 1KJYA 1NIPA 1VG1A 1NJGA 4QFMA 1OFTA 2QM8A 1XF9A 1HE1C 3LVQE 2J5XA 3GMTA 5FBQB 4A0GA 3KUDA 4ON9A 1L2TA 2NPIA 4PO8A 3CX8A 1H8HA 1SVWA 2REOA 1JR6A 5BW8A 4Z8XA 2A5FA 1QHSA 1Z2CA 4I81A 4OL0A 1JR3A 4V03A 3RDPA 2XTMA 4Q48A 1OYYA 4XH9B 3NDPA 4JVNA 2JLUA 5GJCA 2DB3A 4A92A 4DEYA 3GCGA 4KU4A 4MKHA 3TKLA 5JRJA 2EWWA 2GESA 2MMGA 3BB1A 3HR8A 4B71A 4HB3A 4XSHA 1R0XA 5JFGA 5KSYA 5ELXA 1YZUA 1AKYA 1TL7C 1U8AA 3K0AB 4JYBA 3LW7A 3B1VA 1AZSC 1G4AE 3A1SA 1BMFA 1SXJA 2YWFA 1KSFX 1VHTA 5CIWA 2ZS8A 1Z0DA 3OF5A 2GAOA 3ECCA 3GLHE 4HB2A 4IVQA 2G3YA 3U6KA 1EFHA 4PSVA 3BH0A 1IN6A 3CNOA 1F48A 2BEJA 2DR3A 1I4TD 1GZSA 1RKBA 5DISB 3IUYA 4Q1BA 1SQ5A 1WBBA 1S4QA 5KTYA 1KY3A 3UG7A 1G8PA 4EJSB 4D4KA 2JASA 3FMFA 3NHAA 1E1QA 2ZETA 1S1CA 3F5FA 4TLEA 1YZGA 1VKJA 3H84A 5JHGB 2OCBA 2AWOA 4D4LA 4G5GA 2ANCA 3K9LA 5J40A 2QE7D 3BFVA 2GEDA 3TUIC 2FEMA 3PITA 3X1DA 3P4YA 2BBWA 3W8RA 2P6NA 3ZZTA 3U4QA 3WRXC 4YMVA 4O2RA 3NTUA 3PIRA 1W4AA 5LD2B 1TU3A 3THXA 3I92A 4UXHA 1W36B 4N0DA 1KO5A 3B60A 1VCMA 4TYPA 5HKKA 1LW7A 1OSNA 2FSHA 1RVDA 3U3RA 2VH5R 2Z4RA 3MSXA 3SEAA 1ZNZA 2BV3A 3THWB 1G8HA 3SJZA 4LBWA 4U02A 3I8SA 3ZVLA 3GEIA 3G82C 2GZAA 3B82A 1KDRA 4TYNA 1XPOA 1HE8B 3FMOB 1E2KA 1AZTA 2ATXA 2H1LA 4PZZA 5HCNA 3EC2A 4XVUA 1ESMA 721PA 3DPUA 2FA9A 1W4RA 2J41A 2ZUDA 4Q9JA 1GL6A 4AURA 4KXFB 2C2HA 1Q3HA 1OB2A 1T91A 1TQDA 2I1QA 5CYPA 1EWQA 3C14C 5F3WB 1PJRA 2OBMA 1F2UA 1MRNA 1XD2B 4QGHA 3OE7D 3WNBA 1KK0A 5EE0A 1HT2E 2YC2C 2OE2A 4PHTA 4YXWD 4Z8YA 3W90A 3FKSA 3ZS9A 3O8CA 2F1JA 4JBWA 2OXCA 1G20E 2BBTA 2ODBA 4P4SB 4KYUA 5L8VA 2AHOA 2CXXA 4Q5IA 2NO7A 2GF0A 2WPDD 3AGPA 3RRYA 5DLQC 3KTAA 3AF0A 2V7QD 3K70B 2QMOA 4G01B 4JS0A 5H70A 2J45A 5TB5A 5EE3A 2QPTA 4MKIA 4R2HA 2CLCX 4LRWA 1N6HA 2CHVA 1EFRA 2J87A 2QRZA 2Z5FA 1JEEA 3QVUA 4I1VA 4UXJA 4PO9A 4AYTA 2A30A 5JMTA 1CXZA 1D6JA 1SVLA 3U44B 3THOA 3RSOA 4CF7A 3BJIC
chains in the Genus database with same CATH superfamily
2HT1A 4S1PA 2QJRA 1RI4A 3CPHA 1GNQA 3MT9A 5FPPA 3OQIA 1GTRA 4GKVA 4FHEA 4YDHB 4LMPA 3LDAA 5FBVB 3PK0A 3LJKA 3IB6A 1GSIA 3N70A 4IIHA 2IP4A 5AHKA 5GADl 3UHAA 1WXGA 5B3LA 3UY4A 4DQ0A 2N47A 3IHKA 1QJCA 1MRSA 5AKEA 1HI9A 2QN1A 5FKJA 1THGA 4QPNA 1CUCA 1Z2DA 1AN0A 5FULA 3DVAB 2V97A 4EHKA 5IK2D 4D0RA 1GYPA 5JEDA 5EWMB 3H5AA 3I8OA 1BVYF 3QBVA 3QUAA 1H8ED 3N5KA 3KEQA 1BCRB 1F8FA 1UMDB 1E9SA 3ESRA 4MIYA 2LD4A 4YJFB 2J0UB 1KARA 2BWJA 2XUQA 3GCXA 3U48A 1CP2A 1DKLA 5D5HA 2C03A 5AW3A 4QUAA 2W6QA 2C3PA 3LQ1A 5DMXA 3OPYA 5JAOA 3ZWKA 2N75A 3EOAI 1N2EA 4XWGA 3DT8A 4J0HA 2C0QA 3MAAC 2FOXA 2PWPA 2VZEA 1KBQA 4G67A 1U8ZA 3GV0A 4KWCA 1IZ9A 2AQKA 2TMYA 2AN9A 4L0CA 4ND8A 5CXXA 5CAEA 1G5IA 1E2IA 3CKYA 2EXXA 2PU5A 3R23A 1U2TA 3GDWA 3FH0A 2EWVA 3SQOA 3QVSA 3KOUA 4YMIA 2VJBA 3NFRA 2OC9A 1PLJA 2WSYB 1H2HA 2BD0A 3TOCA 2X6QA 2ZI9A 3DUFB 3H05A 2HIGA 3KPJA 2PM8A 4ABTA 1QV7A 1YBHA 2BL4A 2P3QA 3H2IA 3Q7IA 4GIBA 3X1KA 1E9EA 1A5ZA 1Z6XA 2XUPA 5A3QA 1PZXA 5SICE 3ZGVA 1TO1E 2QN8A 2PZMA 3NLLA 4RVSA 1J25A 4L0QA 2BDTA 4UVHA 4QYIB 4QOJA 2ZSEA 1G6KA 1WTCA 3PVCA 1PGNA 4G5RA 4Q7JB 3BCHA 1TIPA 1XMQB 3ZJ4A 5I9IA 3THYA 1J0XO 4J0IA 3VYUB 1QZ3A 1FUUA 3FHOA 3OZWA 1ODSA 3I04A 3FMGA 1VB5A 3KT3A 4NMLA 3RUCA 3LE8A 4IHJB 5LM3A 1P1IA 1NR1A 3L84A 1TEXA 4RCZA 4CKWB 5A5VA 2QVCA 1DZ3A 1QM5A 2VT3A 1M75A 1G9TA 1ZKMA 5EA2A 3H1BA 5IAGA 2FPPA 3BHJA 3PSHA 3RJ5A 2WFLB 3TEJA 3ZHXA 2VNAA 5NULA 2DBVO 4LMBA 5HIMA 2K7ZA 1K97A 2OFPA 2QU8A 4IX1A 4EJSA 2BTEA 1O9HA 4HWGA 3I30X 4DCTA 3A0UA 3IBTA 5G0WA 1G60A 4LYHA 5I9LA 4MUEA 3LX4A 3N0WA 4BJHB 2HLDD 3QKWA 3OF3A 1N7HA 1WB6A 2VJYA 3H4IA 3IUPA 2J09A 4YFYA 1TNDA 5LBTA 5JTUA 3HB4X 3WK9A 4AO7A 1K3FA 4ZV4A 2W2VA 2VF5X 3KT8A 1T3ZA 3TLXA 1YQXA 3ELUA 2M1ZA 3B7WA 1LH0A 4NI5A 1XLUA 4P3NA 4S1VA 2WJIA 4V02A 3MXTA 5JSKA 1FVHA 1PL7A 1CE8B 1XZKA 1ZD8A 3CKMA 1GGFA 4BECA 3T6KA 4RV4A 4YJ2B 5IUKC 2AS0A 3DWEX 2YUIA 1GQRA 1SBHA 5H81A 3RHSA 1FDIA 1DO2A 1KH1A 4JDUA 1U0GA 5ECYA 5C1IA 2VSFA 4YJHB 1BMFD 1O1YA 1SXJD 3B3QA 4K9KA 4U2GA 5I7SA 3CO0S 5A4DA 2BFFA 1RPJA 3UXEA 1K0UA 1SOAA 5AVSA 1VJTA 1LZKA 2C7VA 4LHSA 3EGXB 4ND8B 3ICEA 1AO3A 1U6IA 1XXHE 4F9TA 1HQCA 4KQIA 1CT9A 4BNFA 2BFCB 3AB3A 3ONEA 4PYMA 1FQJA 5CA1F 3WYBA 4DREA 2CZCA 2XKJE 3QLEA 4UREA 2V6MA 3IVGA 5FNZA 5LQKA 1M6VB 4ZT4A 1Q84A 4QULA 3ADPA 4D1YA 2G6BA 4YR7A 5AW0A 4BLPA 1D1PA 1EUDB 2QR5A 3CLSC 5EUCA 3FVWA 3DWIA 4PSAA 3RS9A 2P77A 1O77A 1TLFA 4IOJA 3VPSA 5BUQA 5K8TA 1NNEA 3MTJA 3PEYA 5IT9A 4DA9A 1GZ4A 3AFIA 4W6ZA 2DP4E 2MSDB 1NQUA 2O0HA 3E35A 1KZ4A 4P7FA 4QHTA 1VZ2A 5BN3A 1UAYA 5P8WA 1YRYE 5A0FA 1QKIA 3YASA 4CR6A 2OO5C 1P9LA 2ZU0C 3DF9A 4EY4A 1MA3A 1BX3A 4ZU6X 1Y9EA 2HD4A 2PJRA 4AUMA 3UJAA 1EDBA 1GT91 3E7XA 5DGIA 1U0OC 2FHSA 3VM6A 4F9EA 4Y1GA 4B74A 5B1EA 1Z3IX 4YCJA 1X1SA 1KNQA 1CS0B 2IUYA 5I4BA 1U5CA 5HNKA 2EKQA 1NY6A 2NWQA 1A5BB 3HL4A 4ARUA 4AU1A 4RH1A 4EHNA 8AT1A 5HFAA 1ACLA 2GRUA 1XYYA 1LK5A 2HCTA 3R77A 5IXYA 1OIWA 4MW2A 1J2UA 1RWNA 1H0KA 1UP4A 2F43B 5ER9A 4ND7A 2WJWA 2HY7A 4Q1VA 3IT3A 4E08A 1V16B 3IUQA 1I1OA 1Q1AA 3DFUA 4X8HA 5FFMA 1C4XA 2QTLA 4U2FA 3RSFA 4QKQA 5I7FA 4BNVA 2CNKA 3GUUA 3R3SA 3RSCA 4MV0A 4PONA 1FPMA 3K7EA 4LSWA 2HB6A 2RH8A 4PAQA 1A69A 3CCCA 4E5UA 3MT8A 2YC4C 4H15A 3R7AA 2WF8A 4AD8A 2OUIA 1NAHA 1EDDA 1XAHA 2H52A 4L75A 5T4FA 3TCKA 3LW8A 3PE3A 4FFBB 3KZXA 1G55A 1MV8A 4ZOBA 3H19A 2HV9A 1IVYA 2BGWA 2XMRA 4TTJA 2M6LA 3LCJA 3C3MA 3JD3A 1RFLA 1HE2A 2CXOA 1T4DA 4KUEA 1Z47A 1I5EA 2Y2UA 4HTFA 3PHGA 5IBPA 1QYRA 1JGTA 4RZ3A 5DIFA 3EN0A 1R4AA 4NONA 3AHCA 1Z9BA 2VQ3A 2QYTA 4FZ5A 4X3OA 2I7VA 3DTVD 3BF8A 4MJLA 3I73A 2ZI3A 3LYHA 3MRXA 2YZ7A 1AF7A 1GA4A 4JXXA 1EUZA 2A35A 2P9ZA 1BEEA 1JLSA 4C07A 4E88A 1X3LA 2FFJA 2OESA 4TMVA 3IMKA 4RA9B 1TK2A 3G0DA 5AVVA 3JAMA 3PFHA 3C70A 1E9CA 9ATCA 1JXQA 5TGZA 1U0NA 3VR6A 4Q4AB 2VYVA 4I4TB 4DV3B 1RM4A 4RZIA 3U7RA 1FS4A 3KQTA 1ZM3A 3LAWA 4HB0A 3T5TA 1U2RA 3NALA 2A7XA 4DV4B 1T10A 4BIIA 4DJTA 2YHIA 4KN6A 4EKIA 1B0UA 4DLNA 4NBRA 1W1UA 1V37A 3K32A 2P5YA 2UZ3A 3S55A 2OZKA 2ECFA 4QDUA 4WKOA 3UJ8A 1IOWA 5DXFA 1UM8A 2OC4A 4I1UA 2E4VA 1KI9A 1M34A 2G36A 2QJFA 2WP0A 1C1YA 3OZUA 2HH9A 6REQB 2DH5A 1BGXT 1XTUA 3H99A 4MKZA 4QEKA 5EWJB 3SEQA 3WI7A 4DMCA 2G28A 2IELA 4ZT5A 2ZI5A 3F90A 3IBSA 4ZOLF 4MS1B 1PSZA 1PWHA 3CPSA 1JT2A 1L7VC 3KSBC 4RPLA 3SC4A 1Y6QA 3ANYB 3H75A 2QSUA 1J39A 1U0EA 1TU0A 1JS1X 1NRJB 2AJBA 4NC9A 3BG5A 1BWRA 1H0RA 1IUOA 3PEFA 2INGX 3DKIA 1PEKE 2GN2A 1FLDA 1H1TA 3DVAA 3N8KA 3QIAA 2XCRB 4D25A 3UMRA 2GSDA 4HDSB 3CH7A 3IJ5A 4PC1A 1WWKA 1R0YA 2DPLA 4FONA 5DJ5A 2TRSB 5EXTA 4MR9A 3W5UA 4I9GA 3ZCRA 4LY9A 5EJ6A 3KHSA 2DMRA 1XEAA 3UKOA 1C9MA 2O2DA 4CM9A 4Z49A 1DIHA 3L6EA 3QLTA 5IHPA 1DKRA 1NQTA 1A4IA 2VYNA 2Z57A 2BTOA 2QROA 4GX5A 1W1WA 3LHDA 1I1NA 4I46A 2V65A 2PWZA 4L6IA 4D9EA 4M53A 3WGUA 2Q21A 3FPLA 4ALMA 3PDWA 3DZFA 2V4UA 4LY0A 2NZYA 3C3CA 3LD9A 9LDTA 4HVAA 4QBFA 3ER6A 4L16A 5ITSA 1QZTA 2DY1A 2X8BA 2VYQA 2VPXA 2Y2VA 4UE3S 3VNQA 4GMGA 2A94A 2OD7A 1JEJA 3AHFA 2BJHA 4D3ZA 4BGDA 3FZYA 4WXMA 2H4JA 2QRUA 3LYLA 1IIBA 3OEWA 2F3QA 3LL4A 4R1UA 2Y6VA 5EXSA 4B79A 4LQDA 5BP7A 2ZJAA 4KR6A 4AP6A 2OV4A 4Y6QA 2VQEB 4F5EA 4WW0A 5CLGA 3F71A 4BDSA 4FC6A 4PX3A 2J4DA 4YAWA 3BCSA 3ZVRA 4DXHA 2ILTA 1DP4A 2DZDA 2X58A 3LHIA 2IOQA 1JIQA 1JHAA 3TIFA 2IXDA 2FLWA 4KKXB 4YDSA 4E46A 4G0WA 2XNHA 2B7BA 5TJ9A 3MWGA 1C7ZA 1XNJA 1GFIA 5FL7D 2W0MA 4AMUA 3OCYA 3AM5A 3BA6A 4LZJA 1ZC3A 2B36A 3KPUA 4GQAA 2CNWD 3JZIA 4CM8B 3JQGA 2P9GA 4RD2A 3AUXA 4ZVLA 2VT6A 4AUEA 4EVSA 1HFWA 1EEXB 3RRFA 4K2HA 1KO1A 4QBKA 4CMHA 2YOHA 4ZVSA 1MF7A 2JZNA 5KTKA 2VHJA 5KNDD 1PGJA 2AJLI 2AG6A 3R8CA 2C5AA 3K0CC 5ILQA 3TMKA 3GI1A 3HMQA 3VSEA 2ONYA 3TX2A 1R4MA 1ZRMA 5AIBA 3JQAA 1XCMA 4UHJA 2FSPA 1NBAA 3RVBA 1TAHA 1TVKA 1ZA1A 2ZUVA 1ZPDA 5JY6A 2YASA 1JI0A 3AOGA 1SUEA 3Q3VA 1GZ3A 1SG0A 4EPRA 3WIEA 3OEHA 1Y33E 3D1LA 3ICWA 3RK1A 1ULSA 5DN9A 1EUQA 3UF0A 1NRIA 1O94D 2OCKA 1PGPA 4IOMA 4UJ5A 3WSWA 2XUGA 4ASUA 2PXCA 4MWTA 4D4IA 2BZGA 5C31A 3WKAA 3KC2A 3WQRA 2PSDA 4OXIA 4M4SA 2ZIEA 4AQYB 2G25A 3ECAA 3SBEA 3WJAA 3P45A 4FP9A 1TQ2A 2QIOA 3Q7RA 4QPJC 4S35A 4MUNA 2TMGA 4MCJA 2DF8A 4KMSA 2D5BA 3KT0A 4X45A 1Q50A 3W2HA 2VPWA 1IWPB 1L7AA 1BA2A 1M8FA 2BUCA 4A2WA 1DJLA 4UM8B 2OOSA 4NFSA 1EJBA 3U62A 4IJMA 3GRVA 2QTFA 3KM0A 3O3CA 1RRPA 4DRXA 4LOHA 2Z2KA 3A1EA 3ETDA 1OYWA 2FN9A 1BWSA 3HE3A 1GSHA 4QXOA 3V32A 1PR5A 4M89A 4RM3A 1TUGA 2B4QA 4FCVA 5FFFA 4L1KA 1XNRB 1T1JA 2R6GA 3L43A 3JWEA 3EG9B 1VIMA 2B6NA 3OPQA 1IQPA 4MR8A 1QMGA 2FR1A 4I9NA 5HJ7A 1V9SA 4K6CA 4Y9SA 1P9NA 4MPPA 3K9NA 2FNAA 1T36B 3R09A 3TIIA 4BP3A 5EP4A 1QK5A 4BMNA 2B8JA 1RS0A 4RF5A 1QS0B 1XWWA 2KS6A 3ZV6A 2I6TA 2CHEA 3ZBUA 1MX9A 3CWQA 3RAPR 1V25A 4FT4A 2XWPA 1M33A 2RGBA 2VDMB 2F55A 1Y1LA 3UICA 2BGNA 1DFHA 3AUKA 4UEJA 2F62A 5CTJA 4WSOA 1A9RA 4TLLB 3K9QO 2X3UA 1YOVA 4FFBA 4LDNA 2WM2A 3O8OA 4YY3B 2PO7A 5DI3B 4WADA 3ILXA 4Q4LA 1AG9A 2VTVA 4OSPA 1M72A 4JEMA 1XP8A 3B20A 4NOJA 1MPXA 1ZGCA 2V58A 3LSTA 3REFA 3GT7A 3WE7A 4BFTA 4JZKA 2NSJA 3CZPA 1FSFA 1JDJA 1WU8A 5A4FS 4KIUA 2HK8A 3FYUC 1E3SA 1P5HA 2Z30A 2VLIA 1T4MA 4KV9A 4NE7A 1BKYA 4PLYA 2E85A 4ZODA 3RW9A 5FOUA 5EIOA 2WHRA 1YRAA 2GEKA 4KIJA 1QS0A 2IPOA 4UNSA 3BSYA 3V7UA 4JLDA 3A36A 1N4DA 5FX2A 2FZVA 2VJOA 4CM4A 1YC2A 1WO8A 4RX1A 1OX4B 1DC8A 4N3CA 1S7CA 1G38A 5HF8A 1F20A 3I5YA 2HSJA 3L1IA 4JKYA 4Q66C 2QL5A 4YP9A 3T9BA 3GQVA 5L40A 1XLWA 2GBIA 1QIFA 1ZWLA 3AR7A 3E0QA 4ZQEA 4UM9D 4EDFA 3SEFA 1KY2A 2BR3A 3KJNA 2CV0A 3LP6A 3DBLB 1SPXA 3CG4A 3KYCB 2ZUEA 3KQPA 4NKRA 1MAWA 1WKVA 4DLUA 5F2NA 2OZVA 4M0LA 4A8JC 3WADA 1IMJA 3K9HA 3HY4A 4PC6A 4BNZA 3R8XA 3FUWA 3H86A 4D8UA 1N34B 3KLBA 2VNIA 6NULA 3N59A 4IVRA 5LP6B 1HZZA 7YASA 5KDDA 2IX3A 2JD0A 1P31A 2Z6QA 3PFBA 5E0KB 1VLZA 2G04A 2OHXA 2ENUA 2RHOA 4G4SO 9MHTA 2JAPA 3BJMA 1RZVA 2VK1A 4A8JA 1CWUA 4LHXA 3WO0A 5M29A 2VUSA 3U17A 2PS9A 3BWXA 1CQPA 3I05A 3W6OA 4U63A 3N74A 4MUYA 2XUDA 4UHFA 1ZY2A 2FLVA 3EULA 3O7WA 2SNIE 2QU7A 4LZPA 3TB6A 4EUEA 4QFCA 4GZ6A 1QANA 4H0CA 1M6WA 1MC4A 1KJIA 3NWBA 3LXRA 1OLUB 4OVKA 1M3SA 1T9BA 3EIQA 3FCCA 1JBKA 1KH3A 4YAOA 5E1BA 3U0VA 2PH5A 1MC5A 5BW4A 1DAKA 4JLSA 4ZT7A 5DM4A 1K7YA 2NU6B 5CM8B 3GJ0A 1VHJA 1A88A 1P1FA 3VKGA 4V0KA 3U7GA 3F9CA 5GOTA 4E2YA 3MMPA 3KZNA 4QYXA 5C46F 1QP4A 4OHMA 2BBOA 3VH1A 4U39A 1PYGA 1TCAA 1EA5A 2ATEA 4V3CA 1AXGA 4AVYA 1DIOB 1N6RA 2WFLA 3UK6A 2QL9A 4J4BA 1YU9A 4CV3A 3DQQA 1I5OA 4Q4DA 4CV2A 3PYMA 1Z6AA 3NC1C 4B4OA 4DCOA 4P3XA 5FPTA 1NXXA 4CKBB 3QNUA 2OA0A 1D09A 3INNA 3N8IA 4N41A 4CBVA 2VJPA 4QXRA 3EDRA 1FMJA 3GEHA 1JKJB 3N0XA 5D3ZA 3QYPA 3SHWA 5BSUA 3W3AD 5IVPA 4PQGA 3NHJA 2XUHA 3NS7A 2C5LA 3KNZA 3DEHA 5KYGA 1IZ7A 3NKFA 1YJAA 4BVKA 5T4EA 4YMTA 3TGLA 3HVHA 1HYEA 1W88A 1ULUA 2W2KA 4G24A 4J2OA 1Z7EA 1ZXXA 2Z43A 3AEZA 3P9IA 3QH4A 4ZCMA 3K0AA 4OH7A 1OIXA 1FC0A 4ZO6A 4KJZA 5H5JA 4RIFA 3RIEA 3CVWA 3A28A 5D7NA 1J8DA 3LHFA 5FV7A 1B43A 1NN3A 1CUSA 1PZMA 2R48A 2B5OA 1G7TA 2D4HA 1ONBA 2ZYDA 2CT8A 3RARA 1AO0A 1UFOA 5AKJA 1YS6A 3UJ9A 3DDWA 4XJXA 4HXGA 1FW6A 4CVNA 4B3DA 1W5EA 3EIOA 2MSWA 2XJ4A 2JK1A 4Z5XA 5IX8A 4CMIB 1P4JA 1UEJA 1VJGA 3V4LA 2MDTA 1AMOA 3EA5A 1KIAA 3NKLA 4DIMA 3ADBA 4Q9IA 3WDLA 3UT0A 4Z1OA 2ACKA 1FXWA 3KEMA 2ZE5A 4O4HB 1XJ5A 2ERXA 4QVGA 1QCCA 1NMXA 1TQ6A 1ISIA 3F8SA 4BFWA 1H0SA 3QA9A 2YBDA 4GX1A 4F7WA 5JD3A 1Q0PA 3UH0A 1K2VN 4R0MA 1N33B 1AKUA 4JOQA 2P7HA 1HM5A 5ITZA 3MNFA 1K75A 4UVGA 5DYWA 3L9XA 4E5PA 3Q2IA 1L7RA 1W59A 2OD2A 3I04M 3KXPA 1GPH1 4KQMA 3R3JA 4KUHA 4DLVA 2J5BA 2YWEA 4CM5A 2OLJA 4WVFA 1HNNA 1C3OA 1EZZA 1M2OA 1O96B 1Y4ZA 4U5QA 4XWTA 1E3EA 2PS0A 3BAZA 2HF8A 3CQ9A 1C3EA 4MV8A 3PE4A 2ZB4A 1JJBA 5LP1A 3IJRA 1NC1A 2HNAA 1OE0A 3OKFA 4HWPA 5L95A 4X6LA 2IHUA 1XCOA 1PSWA 3AW9A 3LKBA 4TZTA 4BMZA 1UMBB 1DXYA 1MW9X 2Q62A 3OWXA 4TN5A 4CKWA 5KX5A 3TG8A 1KZGB 3WFJA 4DY4A 2DG2A 3K0KA 4AT1A 2B37A 1SVMA 4HAUA 1WZ2A 4PXAA 2J0QA 1P81A 5BNZA 3P9QA 2HA3A 3VRHA 5G53C 4U2BA 4CUJA 5FI3A 5EXXA 1Y98A 3LA8A 2EJTA 4XB6B 4J75A 3STXA 1H0HA 3G5MA 2D1SA 2EYUA 3TDKA 2VAVA 2HPVA 1F5SA 4EHAA 2BMEA 1ZLXA 1EVQA 1NT2A 2XIQA 3RS4A 1JU3A 5KTSA 3T5DA 1LZLA 4A03A 3VR4A 3RAFC 4HDKB 5FOWA 4RQAA 3X44A 5I4KA 3PVZA 2ZTVA 2X1MA 5GWXA 1C0PA 1DKOA 1JXOA 5IMBA 3WTBA 2Y8EA 1L4EA 4FGLA 3UH1A 4ZYYA 1GGVA 2KBEA 1UK9A 4DRYA 3UTCA 3KLOA 1UANA 4PG4A 4CM8A 2PTGA 2OFFA 1KO4A 4FDUA 2CHFA 4HAYA 4KOAA 3TSYA 4D8WA 3DMNA 4WNYA 3FZEA 3I12A 4O2AB 3A6PC 3SQDA 4MLDA 1JSRA 3KJQA 1JSLA 4F2GA 4IH9A 3O8LA 2WUGA 5EIFA 4A3SA 2AYXA 1IUNA 1IQ0A 1FUEA 1Y48E 3GRZA 4FZVA 4JBYA 4PG6A 1RXIA 4DV6B 3CIFA 1EIZA 3C8DA 3FWYA 4Q01A 3PJRA 2O1WA 3R3HA 4RZXA 4K8OA 1UUFA 4DS3A 2O54A 1LI5A 4AXBA 4BN4A 3JRNA 1YVPA 2OBNA 3COYA 3DXYA 3FPFA 4XDGA 5YASA 1JLHA 3FHJA 2IEYA 1O03A 4CT5A 1Q7CA 5K3AA 2DHCA 1YBFA 1D5CA 1P4AA 3D6HA 3HCBA 4G8CA 1JAXA 3AM4A 4C1BA 4YEDA 1OU0A 3AEKA 1IM5A 3S1AB 1OCEA 4I4TA 3TQFA 4EG6A 1MJGM 4YLGA 2P30A 1MD9A 3CS3A 3PUXA 1D7AA 1UBRS 2JH8A 1ZH4A 2ROQA 3BGWA 4L9WA 1QF6A 2MIIA 3P20A 4Z3DA 3O1JC 4KLAA 1ZJYA 1GPDG 2PLFA 4HYTA 2YW2A 3MUNA 2GLXA 5FEUA 3LQFA 4GHWA 1Z5OA 1UBHS 1OYVA 2GAFA 3M3PA 4J4HA 1LY1A 2ZWVA 3O4HA 6LDHA 5DI9A 5IAKA 1ULTA 1VLHA 3F96A 2ZI6A 3DTTA 4PTYA 4WZBA 2G4CA 1JLRA 4XYEA 5KVQA 3WGTA 1AMUA 2WABA 3BIOA 3OMWA 4IJ6A 3WGGA 1ZHFA 4C7BA 2B30A 1X8KA 2UZ1A 1V6CA 3KETA 3CMCO 3VJRA 4AY4A 3AF1A 2GILA 1RYZA 4M9XA 2ORIA 1BX1A 3OFVA 3BXZA 1PSDA 3O9VA 4WFKA 3GWZA 4EO9A 1RCUA 5AUQA 3O9MA 2CK3D 1CUFA 4QODA 5AVWA 1LQUA 4FWBA 3BXFA 1DJPA 3VKFA 2IVZA 2VCYA 1Y5NA 1IZZA 3VTAA 2AR7A 3DGFC 3BMCB 3QE4A 4FVTA 2WB4A 3SF8A 1W34A 2HDNB 4JOSA 4MQ4A 4AJ9A 3A1WA 2CFRA 2DHEA 4ZCLA 4N5LA 1M8GA 1IZ8A 2IZOA 2MSCB 3NAQA 2BFCA 4NATA 2HGZA 3T5BA 3JWJA 4JR0A 2PUVA 4Y1EA 3Q2KA 5K0BA 4RDCA 3ZU4A 2XQKA 3ZNPA 3OO1A 4F04A 1VJRA 1ZJJA 4EKDA 3L7CA 4YJHA 1PIWA 2GN4A 1GAEO 1N0WA 4D82A 5CRIA 2WFAA 3TLKA 3G9QA 3G5LA 4GPIB 4L8FA 1UWLA 1RE1A 5ELXA 4KE8A 2A7QA 4LJ9A 4ZHSA 3ZC3A 1KI6A 3T7AA 2XGGA 3RK0A 3I1FA 1O3YA 3HBNA 4KQWA 4Q9KA 2ZJ6A 1BKDR 3EZ7A 4KI0A 5KAMA 3PWTA 3WSTA 4AKSA 2Y68A 3KAPA 1VL8A 1VYVA 4XTRA 4EX7A 1V71A 2MJLA 3JAWA 3KTOA 4KACA 4LQLA 1D2AA 3QU4A 5D3MB 4AXXA 5KNCH 1EVYA 2X6TA 2W6JA 4YMHA 3GPIA 1J0AA 2LV8A 2ORWA 2A9OA 2I4TA 3IXQA 4RPGA 4E1VA 3HACA 5JS7A 2QT9A 2A57A 1ZZGA 4BXOB 3GJQA 3CN9A 3CO5A 3R7BA 1L5OA 3UENA 4KXQA 2IBTA 4FM9A 2RJOA 3N2YA 2QVYX 4MO9A 3AFOA 4YCSA 4PFSA 4NEGA 3VUFA 4MWZA 4GI5A 5LSAA 5CFNA 1ZN8A 2GEVA 3Q5GA 1YI1A 2PLWA 1UKEA 3HM2A 1TMKA 5DNWA 3ZX5A 4CUKA 4LRYA 1N9GB 2J3MA 2WLSA 3G7NA 3HO1A 1ISPA 1CS4C 1E3WB 1R10A 3MN1A 2I3ZA 2JIBA 1EXMA 4AWBA 1H93A 1JHRA 3U60B 3WIVA 2EQBA 1J49A 3V2HA 1NL3A 4BDTA 3MBKA 2JLVA 5AOCA 5DT2A 4DQLA 5J4HA 2H16A 3VMFA 1ENYA 3W2TA 1V35A 2R8RA 4OI4A 1YR8A 3ZQKA 2IY8A 1QH0A 2AMVA 2NQ2C 4OUKX 2BH9A 2IDZA 2HAEA 5CA0F 2ZUFA 1Z6ZA 1C30A 1CJMA 1NPTO 2QP4A 4WY2A 4XJTA 2FEKA 1L7EA 2GR9A 4JI8B 3HTXA 1X7ZB 1K63A 2RGDA 4L4YA 1JHZA 2WAOA 4O2BB 4UBIA 4D8TA 1N6IA 4DCPA 2C2XA 4QGBA 1X9IA 1M6YA 4XX0A 3OSZA 4LC9A 4ZZ1A 1HKHA 4IXTA 2GZMA 4KDFA 5HIKA 1GFWA 2XQFA 4FOLA 3G2MA 2WK1A 4B6FA 1AVTA 1ZONA 2QG6A 1PT6A 1N7IA 2QVGA 4QC2A 3FR8A 3ULKA 3T0GA 4K9LA 5E6UA 2A0XA 5AI9A 1P6UA 4LXXA 4XIGS 1XA0A 3VKHA 5DHAA 5LC1A 3ZNOA 2J5QA 1G6Q1 3OUUA 1P8AA 1V6SA 1FF9A 4FX2A 4B82A 4PG8A 1AMNA 2OHHA 1Q1ZA 1LNQA 5BYBA 1TVMA 2B1IA 3A70A 4YRDA 1QTNA 5LMUB 1NFFA 4MYCA 5FA8A 2VR1A 4QOHA 4TWBA 4OGLA 2O4CA 1JJFA 2EGGA 2CLLB 1Y4UA 2MMCA 1J8FA 3NAZA 1CY1A 3S1LA 1UKZA 2XKAA 4CMCA 2QTVB 1TIBA 1FJGB 4ZP1A 3H5OA 3WR5A 3KLMX 1OX6A 1Q77A 1UMDA 4HQFA 4YJFA 1X7DA 4ZCPA 5BNTA 1P74A 1RIFA 2AZMA 2YXEA 3JVVA 3KOOA 5DHUA 4ZAYA 1O9GA 4QGAA 3EODA 4Q4JB 3BIXA 2I29A 1V3UA 3LXXA 2IYWA 3NBAA 4F0JA 3GFQA 1U7ZA 1WOYA 2ZRPA 1UWKA 2X4GA 1U8XX 3FIJA 1FOEB 3PGA1 1U0BB 3EC7A 3JD4A 3ETJA 3LZDA 4AN0A 1NMZA 2LNDA 2IOFK 2HWWA 2VZ0A 1L5YA 3AVQA 4HX2A 3U9LA 3C98A 3KQHA 2JJ1A 3LNCA 4M1KA 2PA0A 1SBIA 1DLIA 3L46A 4QXQA 4ESVA 4EHHA 1G59A 2XNCA 2JGMA 5F73A 1DIAA 5EZYF 5B7GA 5EQTA 1PK8A 3ZIAA 1VJDA 2CDBA 4ZXPA 5H0IA 4IEIA 4GXTA 4JHLA 5C9ZA 3NTOA 5ALSA 1EHYA 2DUWA 2H57A 3EVZA 3L06A 1YV9A 4GZ3A 5LZ9A 5HKAA 3KFLA 3F3MA 1UADA 5DNDA 2GWHA 5DHTA 2B5WA 1NR7A 4BP1A 2I2CA 2VDPB 4KR7A 1EYZA 1JDBC 1XYVA 2J9FA 4H3VA 1FXWF 2ACVA 2XDYA 1KMHB 2XRMA 3DEAA 3ORYA 1GNVA 1YCGA 2FPKA 2IOYA 3ZXYA 3ZDCA 2WUDA 3NXKA 2L18A 4AZWA 5EHGA 2IYLD 3M4JA 2FLKA 1ICEA 1G8MA 1YC5A 2W5UA 1L8AA 5HTOA 2PKYX 5FBZA 1KVRA 2Z1NA 4RQTA 3IP1A 4LHZA 3F5QA 1WPRA 4PAMA 2IYRA 4ZOAA 4YFVA 3AERA 1IIRA 2J3EA 2B0CA 3KG2A 2VJDA 4Q0MA 4Z99A 5TDHA 1DX4A 3GJZA 1UIRA 4X3CA 1U5BB 3OU6A 5C53B 2YWDA 4RTKA 4GX2A 3SR4A 3GA0A 2ZYUX 2JLUA 1BFDA 2OLEA 3L0IB 3FRIA 3OQIB 4Q00A 3R5HA 4OI1A 1CDDA 1HMYA 1TA9A 4QA9A 4DJFC 5K8IA 4OQQA 5CXQA 1OC2A 2UYCA 3TGPA 3UKJA 1O0CA 5ERYA 3TZHA 3I83A 2PGJA 1DBSA 2YHIB 3RT9A 4MLCA 2FZKA 3UA3A 2DBRA 4R6XA 3BGOS 1ODKA 3C48A 3DBLA 2DFPA 1B41A 3GEDA 3UANA 1T9CA 2AFVA 3QVTA 4IGAA 4XVCA 4GMFA 1A1VA 1XLTC 2QTNA 3DE4X 5AHRA 4N76A 3QEMA 4K26A 1PBNA 2DKOA 2C2ZA 3HLTA 4ACBA 1O2DA 4WK6A 4P4SA 1KF0A 3RFUA 1DG3A 4O2AF 2OV8A 3UYLA 4H27A 4Q05A 3ES9A 1Z4QA 1II0A 1SU4A 3AKCA 2YWCA 3OLXA 4NHOA 2J6CA 5EMLA 5FJIA 3URKA 3V6LA 4BEJA 1GGKA 4WOBA 2O8FA 1MQSA 2QQ0A 4Q3OA 1PVOA 2Q27A 1N3LA 3AR5A 1KQOA 4NJMA 2IZ0A 5LQAA 3JQQA 3V8BA 4YT4A 2GAJA 1T5BA 4A2QA 1V3TA 2PMKA 1EU1A 2HCJB 3NHYA 5TSDA 4DIUA 3QHPA 2BC9A 5KS2A 4MEAA 1ZGBA 2P2YA 2R85A 2YIJA 4QEZA 3WMRA 2CCJA 2WMNB 4CL3A 1SKYB 5DW3A 2Z3ZA 4M9ZA 4B8YA 3HXKA 1TVKB 1YOVB 4H4CA 1SCUA 5U4QA 4MVJP 1YB2A 1MNQA 3U5ZB 3KPYA 4HR7A 1ZGAA 1PJZA 2J59A 1JEQA 3PDUA 4FLEA 2QB5A 3E0XA 1R4NB 5TGTA 3OQ6A 2VAPA 4KQ2A 2OKCA 1DRJA 1W48A 2ZCVA 2YY7A 3MMNA 2CXUA 2L0XA 2GEFA 2R1TA 2RBGA 3H4MA 3HDYA 3CPEA 3K31A 2P1RA 4U7HA 4EI7A 4O2LA 1XU4A 2WSMA 2OWDA 4QM6A 1XVVA 2R6FA 3CW8X 3I6YA 3IH5A 3DLHA 4Y2TA 4BRWA 1NV8A 3OMLA 3T7DA 1TKCA 2YIMA 3V9PA 3URMA 3K70D 4JLMA 2O8BA 1NW6A 3QUTA 1TTQB 2VLBA 4MAAA 1Q0RA 4O3MA 3IQHX 1NVXQ 3RC8A 4OHFA 5DBIA 5K09A 5FLKA 4QREA 2CXRA 3QLUC 3TZKA 2IP1A 1GZ5A 2RB5A 1XMJA 3CWCA 2HWXA 3IV6A 3VHLB 2HADA 2W8ZA 1KY4A 4B9EA 1IBSA 1KAEA 3ZGXA 5IAOA 4Z7NB 5JIBA 4QJ5A 3V7YA 4PQYA 1TIKA 3F5DA 1ZIPA 4G56A 1CEYA 4IW3B 2DHQA 3DLPX 5IJAA 2R11A 4JI0B 2N46A 5E3HA 3COSA 2IV2X 4F06A 5JSUA 4M76B 1U31A 4P5EA 4X61A 5CH5A 2C2KA 2XWQA 4Q1FA 2RH5A 5EJAA 7ABPA 4B3XA 3PUYA 1F9EA 3DL4A 4FT2A 1U80A 3D2BA 3O8DA 4H3KB 3G0IA 2ZI4A 2FMTA 1M6NA 2CKDA 4B3CA 3SQXA 4RK1A 1Y1TA 2YV1A 2YCBA 3VHQA 1U3FA 5IUJC 2A9FA 1CQXA 1QNFA 2QXYA 2OVBA 2XWBF 2ZRKA 4J16C 5C8ZA 3W5BA 1KK1A 2XUIA 5BW5A 1GCOA 3F1LA 1YJXA 3I62A 1NM5A 4X93A 2I87A 1ZNYA 2NIPA 4KVFA 3V4ZA 2I2XB 1DXOA 4BZWA 4DMHA 5KZMB 4MARA 3FYSA 5T5QA 3U7JA 1P4HA 1TM1E 1KDYA 1J0BA 1KEZA 2YJNA 2DHRA 1PFUA 4KFTA 5CFMA 4JUFA 5DSTA 3M6MD 1XZBA 1BXKA 4KDRA 5JSFA 4D99A 1KVQA 3JARA 3BXOA 1UXKA 1I2MA 3W4KA 3LECA 4A7PA 4I2NA 2OCLA 4DYDA 4Q9AA 3EUAA 4MIOA 3OCXA 5JSYA 2AOTA 4F2WA 2DULA 3QYAA 3A9SA 4R8SA 4BKQA 5JZMA 2ZRLA 4QPPA 2F8TA 5JVDB 2ZDQA 1DBRA 2YYYA 3UAZA 1RLIA 2VTDA 3FSJX 2BFDB 2WDPA 2Q9CA 1GPWB 4MUIA 3SSAA 1E2NA 2CL5A 3FFAA 5D8DA 2PH3A 5K4GA 1UJNA 1NVFA 5L7TA 4P7KA 2AXNA 2MYPA 2JI4A 3NP9A 5B64A 1V9LA 1YJ5A 5CFRA 3CGWA 3DEZA 3HWSA 4UEOA 4UHDA 3RIHA 1MB2A 1SQGA 2RCNA 3QVJA 3ZOKA 3QQ5A 5JH7B 3HUTA 5LWHA 1F8GA 5B30A 1Z13A 2X0RA 1ADCA 2OCPA 5IEJA 2WF6A 2XVMA 1RLJA 4DUZB 1E1RD 3IJEB 1Y8AA 4ONEA 3UJDA 3ZCUA 3PQ2A 2AF4C 2FZ4A 1T0BA 2P6MA 3M9XA 4OQXA 4XQGA 3WL5A 3S1SA 2O0KA 4P4GA 3DO6A 2J8ZA 3KJXA 4GMDA 4RABA 5TQ2A 1Q44A 2H7XA 1GZUA 3KX2A 3LX6A 1KE1A 4LF4B 2H1CA 4IRMA 2OG1A 5ITWA 2UZIR 2IP2A 1Z37A 1K9VF 1RBQA 2HPHA 3P2IA 3GAZA 2FUNB 2YWHA 4LFCB 2Q3MA 5BR7A 3O4JA 1PGOA 4HDMB 3O4GA 3PGKA 2H5LA 1YQEA 2XZOA 1SQ6A 5GP1A 2D6FA 2LE0A 2YRXA 1MB3A 3LVRE 2WKRA 4GPD1 3L7AA 1CUAA 2OQIA 3OKCA 4Q1CA 4Y30A 4EFMA 5BQPA 1WZCA 3R4VA 4JU9A 5JV5A 5FTKA 4POAA 2XAAA 5JCOC 3M8KA 2W6ZA 2BDEA 2BSAA 4ITVA 2A58A 4I9UA 3WNQA 2Y1CA 3FUVA 1RWBA 3PC3A 4XIIA 2RGAA 3L3BA 3ZHOA 2I1VB 2IHVA 3PC4A 4NFLA 5JS8A 2W6JD 1WOMA 4QDZA 4CMBA 1TI7A 2RHDA 3AHDA 1BN7A 4ZAFA 5JMPA 5BUSA 5H1YA 5BV8A 1T2AA