1U90A

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
molecule tags Signaling protein
molecule keywords Ras-related protein Ral-A
total genus 57
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u90A00
2G9NA 1YZGA 2V6IA 3KB2A 1KI6B 1KDOA 3NDBB 5AJWA 1Z8FA 1TEVA 2IBMA 4WZAE 3SYKA 2XSZD 1FL9A 4BLQA 4A1FA 1E2PA 3VR6A 2VHUA 2BBWA 1GFIA 4JBWA 2FDCA 4GZLA 5JFGA 2PZFA 1ZNWA 2F1HA 3FE2A 4AYWA 1IONA 5AUPB 2J87A 5DE3A 4EPXA 2ERXA 2FGJA 1T8UA 3C14C 4LI0A 3X1WA 4EPRA 1OPXA 3OIUA 4P4TA 2A9KA 3L82B 1X3SA 1M6NA 2WOOA 3FWYA 2C03A 4MA4A 4M1MA 1DE0A 3D3QA 3L0PA 4GOXA 4UNQA 2OE2A 4OQMA 1G1MA 2FG5A 1AJEA 2BDTA 4LV6A 2BM0A 4US1R 1FX0B 3THOA 3THXB 1MKYA 1S3SA 2VP2A 3VNVA 1XNJA 5CJ2A 5TVKA 1ZRHA 2QBYB 2PT5A 3KKNA 2FJUA 2IYRA 4PR0A 4HB0A 4LYAA 1G4AE 3ADDA 3LBHA 4RJLA 4BFZA 4P3YA 3AVXA 2O8CB 3GJ7A 2H92A 2QQEA 3CPEA 2XGJA 1YZLA 2O8BB 5GJBA 3TR0A 4YMVA 5AWFC 1E2NA 3SNHA 4B3DA 2J7PA 5F9FA 4OJKA 2RGXA 2CL6X 1HTWA 2UZIR 1E2HA 3QKSB 4Q47A 1XDBA 3MJHA 2J0QA 5FUXA 5JMTA 1OKKD 5BXQC 1J99A 4Q4JA 2F9MA 2XXAA 4GMXA 4HUQB 1OH7A 2ZUBA 1N6PA 2ZITA 3NEJA 2CLSA 3WMFA 3HP1A 1PUJA 1ZUHA 2NTYC 2Z83A 1JJ7A 1ZUIA 1OFIA 1OB2A 1JEEA 1SVMA 2F9LA 2D3WA 3OFND 4JVNA 1IXZA 2ZYUX 1N5IA 2W2XA 3AKEA 1SHZA 2QE7D 2V9PA 1TQ2A 5BN3A 1XEWX 5L3SB 2O0KA 2VP0A 2EU8A 3FMOB 4TYQA 4B75A 3ZVNA 3PJRA 2FFHA 2IS2A 2ZAMA 4C0LA 4D25A 1OXXK 2NZJA 3BERA 3ZVLA 3ECCA 1OYYA 1E99A 1P9NA 2QSYA 3UMSA 3QNUA 3S1AB 2FE4A 4X8MA 1RZ3A 1GKYA 4KFSA 1GWNA 3QKTA 2Q9CA 1CJVC 3AKDA 1DAMA 4JT2A 2QRNA 2IYZA 3U3RA 3ICEA 3VR2A 3CB4A 3WP0A 1KSGA 3ZIAA 1BKDR 1E9DA 4IDHA 2ZM5A 1XEXB 4O3MA 5FOUA 1C4OA 3CWZA 2IYSA 5FPKA 2VF7A 3VR5A 1HURA 1N3BA 4BECA 5CDFE 1R0ZA 2IEZA 4A2PA 4CT5A 2RAPA 3D8BA 4URUR 4GP6A 2ZJAA 4JLJA 4KU4A 3IQXA 3DM5A 4DLYA 5JJIA 1FMJA 3CZPA 5FBVB 4M1YA 3SU8A 3PEYA 2W58A 3K0CC 2ZUCA 1YZTA 2BCJQ 2C9YA 2QL6A 3QEJA 2NPIA 2Y8EA 4OHYA 1ONBA 2Q21A 1GTVA 5K8UA 4Q4AB 4LJ9A 3I5YA 1L8QA 1FW6A 3BB1A 3F3YA 3CRRA 3IILA 2ATXA 4PTLA 4QJ5A 1X6VA 1II8B 3IPYA 5DI3B 3OAAD 2C99A 5FTNA 3JZMA 1U0JA 4E07A 1Z22A 2ZI3A 1AS0A 3WBKA 3TR5A 4BQSA 1G16A 4TYYA 3O47A 3GFTA 1KNQA 2AXPA 4WZBE 1XXHA 1HV8A 1GRQA 2ZSAA 4JLPA 4BFWA 2I1QA 1T91A 4Q4HA 1FP7A 4XSGA 5E3HA 1QG2A 3U7EB 4Q48A 1OXUA 2ZRPA 3QOFA 4W7SA 5FPHA 3AH8A 2EVWX 3DOEA 2CBZA 5HCNA 5CB8A 1RPZA 1CJMA 4Q01A 3D31A 2Q9BA 4O2RA 1QF9A 1ZC4A 2F6RA 3X1DA 4KODA 5JJLA 3KUDA 1U98A 3BS4A 1DADA 4ASUD 3H2YA 2A5JA 4P4UA 2TMKA 2OCPA 2X2EA 2XTMA 1Z0FA 3DOFA 4IXMA 2JEOA 2WJGA 2OEPA 1QHHA 3H0KA 3KJIA 4KBFA 4FN5A 4DEXA 3QQ5A 1KI6A 1AQYA 4L4UA 2P67A 4ILEA 3UMFA 3RRYA 4Z54A 4D80A 1ZIOA 4AYXA 1CLUA 2F1IA 2QQ0A 4XVQA 5G3YA 3H4MA 1XWIA 3IPXA 5AK0A 1W1WA 1UEIA 3M0EA 3WHKA 1V43A 3OZXA 1M7HA 5BN5A 4W9MC 4GZMA 4LRWA 2CE7A 5CYPA 1D6JA 3NIBA 2B7BA 4J0QA 4LJYA 2JJ2A 3KQKA 4AI6A 2DWOA 2F1RA 4Q66C 2ODNA 5K8TA 1P6XA 3TH5A 3PR1A 1E9AA 3GQBA 3W3AA 4IVQA 2HCBA 1AS3A 2JJ2D 2ZRDA 3E70C 2DFNA 2PJZA 2NO1A 2C5LA 4R2HA 3K8YA 1XCMA 4Z1MA 2ONJA 2HXSA 4MGZR 1E98A 1CJUC 1Q3TA 2C96A 4YDHB 3T06B 4CF7A 2QAGA 2GILA 2MSDB 2RGEA 3HR8A 3TW4A 4V0LA 2O8FB 1Z6XA 4MKGA 5KTYA 1TAGA 5G41A 1ZC3A 1O3YA 4W5WA 3KDSE 4L9WA 1CULC 4JLVA 5JWHA 4OI0A 3EWSA 2PZEA 3LLMA 3X1ZA 4URXR 3IIMA 5H8WA 3W8RA 5HKKD 3FOZA 4GBMA 4EUNA 1W0KA 1T4GA 4LHVA 5FI1B 3KFXA 3NBYC 1JAIA 4PQFA 3KB1A 2R6AA 1NP6A 1NVVR 5HCIA 1TQ4A 2O0HA 1RJ9A 2ZRCA 1YVDA 4HDOB 2F3TA 3QPUA 3PUZA 4A8JB 1G6HA 1ZYUA 5JI3E 1EESA 5KU1A 3CRVA 5KNCA 2IYUA 3U6KA 1U2RA 2QENA 1ZD1A 3OE7A 1P60A 5KSOA 3PEWA 3ZD6A 3P27A 4D82A 3I72A 1SXJD 1QHNA 3GEEA 4A9AA 1SKYE 2BBSA 4B6FA 2VH5R 3PVSA 4B6EA 2MMGA 3DHWC 4IJMA 4PO1A 4H9GA 4MYUA 4B76A 1KDRA 1GZSA 2QA5A 3U44B 1OB5A 3EIEA 3FMIA 1Q1BA 3RWMB 5HR5A 1A2KC 2IS4A 2ZVPX 4DLUA 2OXRA 3K0AB 3BAFA 3X1XA 4D26A 1QHXA 1E94E 2ZJBA 3ZVRA 2EFGA 3MWLA 3FHOA 1EFCA 1U9IA 2ZVQX 2C2HA 2UVQA 3TE6A 4IOMA 4JMPA 1N6LA 1XD2B 4AWXA 1N6OA 4TZ0A 3A36A 4G0NA 2C98A 3S1AA 5L3QB 1P7CA 1W4BA 4MKHA 2QAGB 1OIVA 2GCOA 3DVLA 2DB3A 1U94A 1S2MA 3ZS8A 2QN6A 1OF1A 4ZDIA 5BW8A 4B47A 4HI0E 3ZQ6A 4C0QC 2XOKA 5DHAA 1KKLA 2BEJA 2HF8A 1ZD9A 1LNZA 3UG7A 2ORIA 4TQAA 2AK3A 3ZIAD 1KAOA 1QHYA 3U5ZB 1XRJA 1S8FA 5J40A 4DIEA 2J59A 4CVNA 2XAUA 2V4ZA 3C7KA 3WMEA 2NMVA 1IHUA 2FZLA 1Z3IX 3FMPB 1XBTA 4WA7A 2WTUA 1SXJA 3FKSD 2RGNC 2C04A 3C5CA 4NH0A 2HLDD 4QJ4A 3T1VA 4ZDKA 5HZHA 4ZKDA 4NCKA 4LYHA 2NIPA 2R2AA 1VMAA 2ZE7A 3A1VA 1A7JA 4M1OA 2CVHA 1EFTA 1OFUX 1TF2A 1A5TA 1G3IA 3PUYA 3LBIA 4POAA 1U0HC 1SGWA 2W0SA 5EUQB 1KK1A 5A0FA 2R8RA 4F91B 2ZROA 3DKVA 1HY3A 4FIDA 4LV8B 2YWFA 1G21E 3B13B 4U02A 3B82A 4XWOA 2I1VB 3L43A 4KXFB 2PL3A 1NBME 5B58C 3RS4A 2YKGA 1U8AA 4M1KA 1H8HD 3CR7A 5H70A 3R7WA 2OCAA 2P6NA 4FI3C 3W9YA 2XSZA 1NVWQ 3GJ4A 2ZTSA 3I32A 5HE9A 4LHYA 3IBGA 2JIZD 3RS5A 5A4JA 3UPUA 4DCUA 4AC9A 3EPLA 4AURA 1XD8A 1BMFD 2FSHA 1OE0A 3LX5A 4AD8A 2WWIA 2ODEA 4EQ6A 5GVRA 1QHIA 2ZANA 3LY5A 2CLCX 4JSYA 3L8ZA 3SR0A 2C8VA 2X19A 3AF2A 4Q7JB 3NVAA 3N2EA 4X8OA 2HJGA 2GBLC 4OK5A 3WYAA 4D4KA 3GLGB 2LWIA 4DLZA 2H1LA 3GMTA 4Z8XA 1H65A 1DG1G 2D7CA 2PH1A 2L0XA 3NKVA 4DCVA 4AG5A 4LC0A 4XOIA 1K5GA 4GP7A 1M74A 1FTSA 1P73A 2GXQA 5KSZA 2G83A 3G82C 1KDPA 2WIAA 5E7IA 4DKXA 1U9IC 1N5JA 3TQCA 1TMKA 1XF9A 2OHFA 1A4RA 2WM9B 4Q18A 5ELXA 3K09C 2VL7A 4JIMA 5CM8B 1U0LA 1NLYA 2QEQA 4G5RA 2Q3HA 3RS3A 3FMFA 3QKRB 4ARZB 3J81k 2XTZA 5JHHB 2B8WA 2CEAA 4HDCA 4R7ZA 5EE1A 1DAHA 1VHLA 4KBGA 3KQLA 2P0EA 4DRZA 4C0KA 2CJWB 3OE7D 4CIDA 4DCTA 1TQ6A 1W2HA 2AWOA 5LD2C 3QG1A 5CIWA 3GJ5A 1E2QA 2IYLD 4XTCS 3LVRE 4TSFD 1B23P 2QBYA 5FOXA 4G5GA 4PX9A 2IYXA 1JXMA 1G8FA 1OFTA 3MAAC 3ND8A 1EXMA 3V4RA 4LHZA 3QKUA 4HZUB 3AF4A 1W4AA 5FBLB 3PUVA 2QPOA 1RE0A 5IT5A 2W0MA 5FUWA 3FDIA 4Q7KA 1S4QA 5J4LA 3PFIA 1KO8A 2PMKA 2VYFA 4NU0A 5D3MB 1SVIA 5FTKA 4QL3A 3ZJYA 4AKEA 3I8XA 3W6NA 5UKDA 3WYFA 5DISB 5BYJA 4LBZA 1KHTA 4YLGA 1DAGA 3OFNA 4BWYA 5A5GA 4M0LA 5KNBA 4TMZA 1E2IA 2BEKA 3BC1A 3T12A 1KSFX 3UWKA 5CLLA 4MH0R 1U8ZA 4P33A 1Y3AA 3PV0A 4JZKA 1Z08A 4BASA 2EFDB 5KSYA 2EWVA 4MYCA 1DARA 3GD7A 1EX6A 3CR8A 3U3OA 4ERNA 4N1AA 4DLVA 4RD2A 1R7RA 3KKPA 2REXB 2BVNA 3OEHD 4RSGA 621PA 5FH9A 1KI2A 4HUQA 2O0JA 4NYMR 1GUAA 5IHPA 4QBIA 5D3MA 4R2IA 2C77A 3BH7A 1IQPA 1XEWY 3P32A 2EWWA 3EG5A 1DAEA 2VSOA 2BKEA 1Z29A 3QPVA 4WBSA 3BFKA 3CH5A 1N5KA 3GLIA 3UATA 1E0KA 3TGPA 3LQQA 4KVAA 4Z51A 1N6RA 1P3JA 2KWIA 2QT0A 1EWQA 4ZDWA 3I61A 2ODWA 4LBWA 4PSKA 4PHGA 4Q1CA 1Z6AA 1ZNZA 2PX3A 2E87A 1R6BX 2W2TA 2CMKA 3CRMA 4Y0VA 1UKYA 2ZJ2A 1CF4A 421PA 5C2JB 1E9BA 4JJZA 4Z8YA 2ZS7A 4FW9A 1FTNA 2RGDA 1NIPA 1E2KA 4C0AC 3RS7A 4O2LA 1Z2AA 2R9VA 4DSTA 2A5DA 1QHSA 1D2NA 2IYQA 3LH5A 2CCJA 2PLRA 2FX3A 2QPAA 4OHVA 4IOLA 1SZPA 4QBFA 2IX3A 4OI1A 1SVKA 1MV5A 4B44A 1EK0A 2FGKA 2IUSA 4LC1A 3NC0C 1F2UB 2N1BA 2ZJ8A 1OH6A 4B3FX 1H8EA 4TQ9A 2QAGC 4L8GA 2UZ3A 2GAOA 1JR3D 2D7DA 3EASA 4LBYA 3VX3A 3JZAA 1T3SA 4HAWA 3T15A 3KJHA 4ITRC 3TSOA 2B21A 2QORA 5EP2A 4QNMA 4QRHA 1BOFA 1QVRA 3I1FA 4Q1FA 1X1RA 2ASEA 4AY2A 3SFVA 4ZCLA 2ZYTX 1SKQA 2CLDX 3RDPA 3U44A 4KCGA 1JPJA 5KDOA 1HE8B 1AM4D 2PMDA 2G0TA 3OIVA 1RVDA 3UK6A 2LKCA 5EQTA 1U81A 2DY1A 4YMWA 2FOLA 1DAKA 1W4RA 2ZRLA 5LBIA 4EFLA 3IEVA 4QNRA 2F43A 2YINC 4B73A 4RCZA 2OAQ1 4HLCA 1XP8A 3D6TB 1IM2A 3AVTA 2V55B 4BRWA 1HUQA 3I3SR 1X86B 4CZ2A 2NO6A 1G7CA 1R5BA 4PFSA 5L8VA 4KITB 2ZEJA 3DZDA 4IDQA 4EJSC 1CXZA 3EIHA 4YDSA 1YZQA 4FCVA 4RD1A 1MABA 2RCNA 4HB3A 2RHMA 4E5UA 5HZKA 1GOTA 3V00A 1F5NA 4DB2A 5EXTA 4QM6A 1CR1A 4PHHA 2ZIAA 1IJFA 1D2EA 3WXMA 1HQYE 3WYGA 3B1ZA 4GOKA 2VHCA 3A58B 3RS0A 5JLJA 1YRBA 2YHSA 1Z47A 1O87A 1W49A 4I1VA 1KNXA 1Q22A 1YR9A 3TRFA 5AUNB 5F98A 3AV0B 4FMDB 3BRWD 4KHZA 1A2BA 3H1TA 4NKRA 5JWOA 1H8ED 1I4DD 1T3HA 2GA8A 3FB4A 4OBEA 5J4YA 2JLZA 2O8BA 2J0SA 2G1KA 1P2TA 3MUFA 2J0UB 4OI4A 3QXHA 2GJ9A 2FWRA 1TPZA 3QE0A 4MKFA 2NPFA 4HUTA 1KO7A 2IXFA 1Z5ZA 3Q85A 4DDUA 4GOJA 4F38A 4FWTA 4MDEA 1FP6A 1UJ2A 3EZ7A 5L3RA 1T9HA 4Q9KA 2KE5A 2Z5FA 2NQ2C 4CDGA 3PEUA 2F1JA 4FCWA 4PSAA 4P31A 3TSZA 4DLRA 2QUZA 3P4XA 1G41A 4MYHA 4PSVA 4URZR 1FOEB 1K5DA 5KUTA 4MRPA 2IT1A 4PZZA 2ZRNA 3K9LA 1OXTA 2GCOB 5CITA 1MO3A 3KX2A 1GKIA 5FL7D 3HDTA 5AUQA 3KJEA 5SZKB 1VIYA 3VKHA 4DJTA 4RFSA 1UKEA 4QKQA 1W5SA 1E4VA 1G5TA 4KSBA 2GJ8A 2ZE8A 3GLFA 1W0JD 2GETA 4CEIB 4LOAA 5K8IA 4UQOA 2HDNB 1US8B 1NSTA 1P72A 2O8DA 2VPPA 4D0GA 1KTVA 4TMKA 1OH5A 4HLUA 3PCRB 1E3MA 3IDQA 2GTPA 1OJLA 1KMQA 1G291 2R44A 3F0TA 1IBRA 1JXOA 3EZ2A 2AFIE 1KY2A 1Z0JA 2ZRJA 5DIFA 3EPKA 1F2UA 2FEMA 3QXSA 1ESNA 2PZGA 2YWHA 3VR1A 2E9SA 3N70A 1HA3A 1JR3E 2ZI9A 3IHLA 1J7KA 5EJEA 2VP9A 2JDID 2FF7A 4FINA 3QKRA 4ARZA 4URVR 4CEJA 1IN6A 3QF7A 1XXHB 3MWKA 2Z4RA 3SQXA 4NYIR 2ZR7A 1U8YA 5J47A 2FV8A 1G3RA 1OHHA 2SHKA 4CEIA 5SZIA 1N6NA 2QT1A 1II8A 2BBTA 1XTSA 2GHIA 4M9SA 4IXNA 1NY5A 2BMJA 4AKIA 4RZUA 2ZR0A 5CLQA 1KO4A 4LZZA 2DBYA 2HT6A 3A1WA 2JLSA 4F4JA 1J2JA 4JVSB 1CKEA 4JT4A 4DWJA 3A4MA 4FMCB 4F92B 1N25A 1W2GA 4TTPA 3PIRA 3RRZA 3VHLB 2XNSA 2J7KA 1E79A 2ZJZA 3U3MA 4TSFA 4DCSA 1OV4A 4EFMA 1R10A 3CM0A 2P2LA 1KAGA 1Q1ZA 2G1JA 5G53C 2O8DB 2GEUA 3IQWA 3MJRA 1U90A 4NCHA 1US8A 4Q4LA 4LY6A 3O8RA 3BB4A 2LKDA 2JA1A 1WMSA 2XJ9A 3R20A 4QHYA 2DFTA 2BM1A 3OIWA 4LUCA 1TNDA 1M8PA 2W6JA 2E1RA 1R0YA 2WICA 521PA 4DLWA 5J4KA 1W0JA 3PENA 1IN4A 4QHTA 3GJ3A 2AK2A 2KJQA 1ZIPA 3SYLA 1S0UA 3OEED 3IUYA 4EAQA 2JLYA 2KBFA 1X8KA 1S9HA 3CIOA 3MLEA 2WVJA 2JGNA 3JVUA 1CR4A 3WRXC 1CU1A 4PC7A 6Q21A 5B2ZA 2QI9C 1N0WA 4ZPXA 1GRRA 3PUXA 4HATA 1UAAA 4KVGA 3B1WA 1DBSA 2ZRMA 2IF0A 3B60A 5FPSA 1HT2E 3EW9A 1E69A 2ZI4A 3WP1B 2RKOA 1KJYA 2XNDA 5FTJA 1GRNA 4X8HA 1AN0A 2YYZA 2OXCA 1AIPA 2W00A 4C0JA 1PLKA 1YJ5A 1ZU4A 2ZYVX 4JLMA 4Q4AA 3GP8A 5B30A 1M7GA 4KFRA 5CK4A 4C2UA 1XMSA 1G19A 1UDXA 5DGXA 3LA6A 3KKOA 4HB4A 4GMDA 1RRFA 4N3NA 2QTVB 4Q9HA 2H5EA 2X77A 1LS1A 1G8HA 2WMOB 4G1UC 4MUBA 1KJWA 1Z6GA 3VR3A 3CKLA 4A6PA 4M1WA 4TYNA 5JS8A 4B3GA 2BC9A 2NOAA 4JLAA 4DHEA 1ESMA 3C4JA 3NH9A 1VCOA 2FMXA 1FX0A 2IF2A 2B7CA 1ZCBA 2GRJA 3W3ZB 4IFBA 4QBHA 2JLXA 4DVGA 4KO8A 2IXEA 1NIJA 2JLQA 1E9SA 1JEDA 3C41J 4A6XA 4Q1DA 3DMNA 2WV9A 2NGRA 2JAQA 4DT1A 4A0FA 3Q7QA 4S2EA 4YMUA 4HB2A 1CRPA 2XOKD 1DAFA 1D9ZA 3SJCA 1YRAA 5EZ5A 4V0MA 1VYVA 1Q20A 2ZETA 1DELA 1AA9A 1CP2A 3CPJB 1ZD8A 3B9PA 4NTZA 1W0KD 4Q9IA 4BFXA 1ZM3A 4GNKA 1IXRC 1XMVA 4LGMA 2R65A 2ZYWX 1OXSC 4CEJB 2J41A 4QGAA 2GVDC 3LAWA 5FL3A 5FFMA 1DAIA 1R5OA 4XD7A 3KTAA 4OK6A 5TXGA 2CL7X 5FPTA 4US0R 1K8RA 4URWR 2FEOA 4I4LA 2FH5B 5J4HA 1KOFA 3I62A 1GP2A 2V1UA 1ZVQA 5IK2D 3AVWA 3RRMA 3FPAA 3UKDA 3VR4A 1R0XA 5KYKA 3Q5EA 4GT1A 2QM8A 4BZQA 1NMZA 1BYIA 1E9EA 1J90A 1UDWA 4LX0A 4BZXA 2J5XA 2RGNA 3SEAA 4DBLC 2XX3A 1GNPA 1YHNA 4XVRA 4ACBA 2MSCB 2BMEA 4BLSA 4LDJA 3CW2A 2H7VA 4I1SA 2A30A 1KMHB 5DI9A 1CTQA 4QHSA 2V7QA 4KYUA 2WHXA 2VP6A 1A82A 1XFAA 2WBLC 3UIEA 1TU3A 3BK7A 5TMPA 5GVSA 1KI1A 1PLJA 2EQBA 1UBFA 4TLBA 1GDDA 3DL0A 2XB4A 4ASUA 3CPHA 1DTSA 4NCIA 4F93B 1Q3HA 5KPJA 2PBRA 3THYB 3NHAA 5EP3A 1IY1A 3EC1A 2VQSA 3KXLA 5JRZA 2EFHB 2G3YA 1S1CA 1Z6TA 3ADCA 2OESA 3KTAB 1UM8A 4M22A 2GKSA 2WAYA 4QBGB 1IN8A 5EXSA 1CS4C 2FN4A 4RFSB 3KJGA 3ZH9B 4NCJA 2IWRA 4DSNA 3NC1C 5CM9C 2EFEB 4XVUA 1NY6A 4MGKR 5KO2A 2WKRA 4WXRA 2XB2A 1R8SA 1SVWA 1OHHD 4A2QA 3O8BA 5CJPA 3TJZA 4BUJA 2R6DA 1FMLA 1RKBA 3MFYA 2P65A 1KYIA 3W5IA 4OQLA 4B2IA 2RHDA 3A1UA 3W8NA 3UANA 2Z6VA 1L2TA 2AKYA 1TU4A 3AM1A 3CLVA 3FYHA 2RH5A 3MD0A 1YZUA 3DZ8A 3AF0A 4AKHA 2WWFA 1AGRA 1RRCA 2WMNB 1X8LA 2GEDA 1QRAA 2XZPA 2ZS8A 3RWOA 1WCV1 1NVUQ 2VBCA 2BJVA 3WHLA 4DDTA 5JI2E 4F4IA 1N0UA 1P4SA 1L7VC 1OT3A 3LX8A 3GJXC 4E22A 1X8JA 1LF0A 3WBJA 4KFTA 3SJBA 4PAMA 1E9RA 2ZRHA 1HE1C 1KGDA 1NI3A 2Z43A 2ZRFA 4HZUA 3VU9B 4L15A 4D6PA 3KXIA 3P26A 2P5TB 5KOYA 2IS6A 2NG1A 3HYRA 2D2EA 2PJRA 2NZ8A 3LLUA 2VP4A 1N6KA 5IRCD 4NYMQ 4KJZA 4URYR 1XB2A 1W48A 3B78A 3CRQA 1F6BA 4PANA 4IEEA 3W5JA 2OO7A 2QP3A 1G64A 2WSSD 4LYFA 2ATVA 3AVQA 4M2LA 4Q7MB 5G40A 3Q7PA 2FPKA 4W5JA 3W6OA 2G6BA 2G77B 4LSGA 3AEZA 721PA 2R6GA 4V0ME 2GCPA 4H1VA 3SFZA 2CK3A 2O5VA 3AGPA 3HU3A 3R7WB 4D0LB 4QC2A 4PPNA 3ADKA 3L0OA 3EPHA 3GFPA 4ZDJA 3NBZC 4TYWA 4HEJA 3SHFA 1W36D 2JLWA 4WAUA 1MT0A 4EJSB 5AJYA 2QP9X 3Q5DA 5IF9A 2DYKA 4I1UA 1TF5A 3QG5A 4V0OA 1E2GA 3ZDQA 5LB2A 4ZKEA 3K0EA 2ZI7A 4JVMA 1XD9A 2QMOA 4NP6A 4QOSA 2BWJA 4DXAA 2YV5A 3TSWA 5JBQA 3Q3JB 4Q00A 2J7PD 4RKEA 4DUGA 1KK2A 2ZRBA 3B5JA 2RGAA 4TLDA 1RYHA 4K81B 4A4DA 4U00A 5FOWA 4IDPA 1P9WA 1SULA 2X8AA 3AP1A 5C4GB 3DMDA 4ZCIA 2VA8A 4B71A 2PCJA 1VKJA 1XJ0A 4N0EA 5KHOC 3K0FA 2JLRA 2Q9AA 1Q0UA 4WVFA 2WZQA 2A7QA 4LV5B 3ZLJA 3GJ6A 1G6OA 3FHTA 3ICQB 1L4UA 3QXJA 1JJVA 4OQXA 4RCYA 2O8FA 1PVOA 5JS7A 1XCGB 4G3XA 4BFYA 3ZVMA 4C2TA 4JLNA 2ZUDA 4MRVA 2JATA 2H18A 4KLZA 2FFBA 2KB0A 1W36B 3W6PA 2F7SA 4R9UC 5E4FA 5EE9A 4D4JA 1G7RA 3ASZA 4D2IA 3TW8B 4IOJA 1R4AA 3CX8A 1KDTA 1MRSA 2BKUA 4UKDA 2FFAA 4YC7A 2ZSDA 3PXGA 5CK5A 3EIQA 4G5SA 3CNNA 3DPUA 2WPDD 2ZPTX 1QHGA 4MRRA 2IWHA 3IBYA 2HLDA 4BFSA 3M4YA 1W46A 4NYJR 5L3SA 1CBUA 3G5UA 3T35A 4E09A 3THXA 2IEYA 3QF4A 1XEFA 4B34A 3TVDA 2X2FA 5FUVA 1DPFA 1YQTA 2OLKA 4FMDF 5FOSA 4RD0A 1DEKA 1QBKC 3BB3A 4D4MA 2ZRAA 2CVFA 3L2OB 4HDQB 4RD4A 1CJKC 1XTIA 2BBOA 2IHBA 1ZP6A 3C5HA 4YMTA 1ZMXA 3QSYA 1P2UA 3ONWA 2ONKA 3LW8A 3C15C 1NBMD 2OFOA 3IGFA 3VAAA 2XITA 4O25A 1I4TD 4M9XA 2ZQ5A 1ZM2A 3RS2A 1JI0A 5AJZA 4NDZA 1I2MA 1GSIA 1KI8A 5IDVA 3KKQA 4Z1MD 3VHXA 2RGGA 3KQHA 1TEXA 4IEIA 4M53A 3SOPA 2J0VA 3HYTA 5IK2A 1BH2A 4DSOA 2FPLA 3BXZA 1FUUA 3T1QA 4DLSA 2ZE6A 3NHBA 3PQCA 1NKTA 2ZR9A 3IKJA 3U3JA 2G88A 2QNRA 3A1SA 3QIAA 4S35A 3EC2A 3GLHE 2IL1A 4HAYA 3OAAA 1J8MF 4ON9A 4WZ6A 4BGDA 1XPOA 1GKUB 1G20E 3OIYA 1Q21A 5CYOA 1FNNA 4DEYA 3BGWA 2DFLA 5TDHA 5KDDA 5J4VA 1MO5A 1R2QA 3SDZA 4DT1B 2HT1A 3AVUA 1KK3A 3K1JA 1CR2A 1TADA 4FMCF 4Q19A 2V6JA 3BE4A 5E7MA 4DZZA 1GILA 3QF4B 1XTJA 1FQKA 4M9QA 4Q1AA 4M8NE 3RABA 2D62A 4B3XA 1DVRA 1K6MA 3Q8XB 5DI3A 2D74A 1VECA 1WA5A 2XJ4A 3BWDD 5FR2A 2G0NA 2BV3A 3GJ0A 1VCNA 2J3EA 1PV4A 1KZGB 5DLQC 3R9WA 1E0SA 1LVGA 2VO1A 1XTQA 4TL9A 3RRNA 1CR0A 4PZYA 3CWQA 1WP9A 2C95A 2PEZA 4N0DA 1SHKA 1AQUA 3HU1A 3KQNA 2IC5A 4IHQA 2YNMA 4QJ3A 3G0HA 2WJJA 3U4QB 1YU9A 3MSXA 4UNPA 5GJCA 3BORA 4I81A 4NYJQ 2WJVA 4EKDA 3RC3A 2REOA 4ZI2A 4XWKA 3T1OA 4E03A 1E4YA 3EA5A 3SJAA 3LDAA 1UBEA 1XPUA 4MRSA 4YXWD 5SZJA 2OBLA 4DIDA 2PX0A 1XD2A 5GADl 3MWJA 4DCNA 2GXUA 2ZJ5A 2ZRKA 2QP4A 5JECA 2FSFA 2OCBA 4JBXA 4NZYA 2GNOA 3QVUA 3VTKA 3BFVA 4XIGS 3SHWA 1MO4A 4OHXA 2AHOA 2PLFA 4JVLA 3TKLA 1JBKA 2ZRGA 3MCAA 4EDHA 4Q1EA 4CEHA 5DSZA 1UBCA 2AX4A 4TQUS 4HAVA 5E7JA 1OKKA 5LD2B 1NL3A 1LB1B 2ZS9A 3BH6A 3BIFA 3FGNA 1F2TB 3MRSA 2BIFA 2AL7A 3FKQA 1WF3A 4QFMA 2JDIA 4FD2A 1IN5A 1LY1A 2AFHE 1KY3A 2XTNA 4EJSA 1LFDB 2BOVA 5HE8A 1HYQA 4ZIRA 4PAQA 2XZLA 2WPDA 4W5HA 1P75A 4TYPA 1YR8A 1GVNB 2DWPA 4MKIA 3B2EA 4UNRA 2QTFA 1E2DA 2YZ2A 1R5NA 4OHZA 2GCNA 3SE0A 1R8QA 2OBNA 5SZHB 3K70C 1G5RA 2QGNA 3OEEA 2QAJA 4LJ8A 3CH4B 3SYNA 1G8GA 5M04A 1P2SA 1QZXA 1Z28A 1OIWA 3C16C 2REBA 3ZD7A 1AS2A 1KI7A 4TL6A 2QTHA 3U4QA 4LBVA 3K0SA 1H8HA 3A1TA 5L3QA 4OK3A 4Q21A 4XSHA 1NMXA 5TARA 2A2ZA 3W90A 4JYBA 3TQFA 4LJAA 2QM7A 1P5ZB 2UKDA 1SXJB 3QBTA 1M7BA 5BYKA 1MH1A 3DDCA 1RC8A 3VU9A 1P9RA 1VDZA 2Z4SA 2VF8A 4XWAA 2HUPA 4A2WA 1UF9A 2CHQA 5DNYB 1G8YA 3SS8A 4V03A 5EP1A 5FUYA 1XJCA 1XU4A 3GLHB 1JQJC 5LDDC 3O8CA 1E79D 3U2QA 4BEJA 2OCYC 4DB4A 1KZ7B 2I4IA 4ZIRB 4XJXA 1IY0A 4BFTA 4LJ7A 1EX7A 5KDLA 1S96A 3UG6A 2EFCB 3AB3A 3PEVA 3TUJC 3WMGA 4BLRA 1V5WA 1AKEA 1JR3A 2XZOA 2OFWA 2FZ4A 5EUMA 2H17A 1ZINA 1E6CA 4LPKA 1FQJA 3GLGA 2J1LA 3CX7A 4PHTA 4EQ6B 2VRWA 1Y63A 3MMPA 4AG6A 4TT3D 3NDPA 1DOAA 1J70A 2VEDA 2FSIA 4JLKA 4C7OB 5DN6D 3AVVA 2GXAA 1XCPA 4U5XA 4LJ4A 2JJ1A 1GIAA 3R9IA 2F3RA 1MR3F 2WSSA 4D0NA 3KZ1E 5JCZA 1WBBA 3WNCA 2BCGY 1ZW6A 4UXHA 2J0UA 3H84A 4X8LA 1N6IA 3VKWA 1GNRA 2GDJA 3RSLA 3LXRA 2GK6A 2C78A 3IO3A 2IHYA 3GFOA 1RIFA 3ZZTA 2QPTA 1VG9B 1NVVQ 3TAHA 2YC2C 2WOJA 4P4SA 3F5FA 1WE2A 3VQTA 2CHGA 5FL7A 5FPYA 4RZXA 3SBEA 1KMHA 1G3MA 2OBMA 1W36C 2O8CA 3RVBA 2MSEB 3K70B 1F60A 3REGA 3P4YA 2ZE5A 2X1VA 4B48A 4CYMA 2W6JD 3HU2A 3AKCA 1JR6A 1BYUA 4HAZA 1SVSA 4K8OA 1I2DA 4EPYA 1T0JB 5TB5A 3SBDA 2ZU6A 1P62B 3AVOA 3T1TA 4JSTA 2J9RA 5FOVA 4JLBA 5FTLA 3AUYA 1NG9A 1MOZA 1FNMA 1TL7C 2QZ4A 1ZM4A 3GJ8A 4C30A 3A37A 5JHGB 1CEEA 1Q12A 3MGCA 1HH4A 1M2OB 3T5DA 1D8TA 3GLFE 2ZSBA 3OF5A 1E1QA 1E0AA 1GL9B 1OYWA 1VCIA 3CRW1 1G9XA 3B6EA 4JJKA 4A8JC 1TX4B 3EA0A 2A5FA 3EZFA 1A1VA 5FBQB 3I92A 1NN1A 1EFRA 2WAXA 3NEYA 4QG7A 4TMWA 3KL4A 1NVXQ 2GVZC 4M1TA 2OUKA 4BLPA 4D4LA 3NH6A 4BPBA 4GDFA 1AGPA 5H68A 2J45A 3IIKA 2IYVA 5F3WB 3THWA 2DHRA 1EFHA 2D4HA 5B57C 4H1UA 3AKYA 5E95A 1GL7A 3TNFA 2ZXUA 3AVYA 5LPNA 2WWXA 1UBGA 4C0SA 2AKAB 2F43B 1DO2A 1P2VA 5BN4A 2ZAOA 4JL8A 3FKSA 1QVAA 3EXAA 1EFUA 1RRPA 1ZCAA 2J46A 3FTQA 4GSYA 1XPRA 3A4NA 3TMKA 4CRWB 2CHVA 4RD6A 4GPTA 3AVPA 4LHXA 3IO5A 4R98A 3GEHA 3A6PC 2OAP1 2YWGA 3N5CA 3C8UA 4I99A 1ZAKA 3CBQA 3B1VA 1GNQA 4ESHA 3QXCA 4U7DA 1MRNA 3LV8A 2DPXA 4OHWA 1AK2A 4US2R 1G7TA 2VHJA 4HYYA 1TF7A 2OFXA 5AR1A 1GITA 4IDOA 1M1YE 4HLDA 3CF0A 5DN6A 2LCFA 1RYFA 3F8TA 2R6FA 3UMRA 2W6IA 1S3GA 4DDVA 1OSNA 3W34A 4RVCA 4G5OA 4IOKA 4HLUC 2NO0A 3B85A 4PC2A 4OQNA 1HQCA 3CX6A 3QJYA 1WB9A 1G18A 4PZLA 2FA9A 1LS6A 4TMXA 3RNLA 2GEVA 4JL5A 3WRYC 3A8TA 2VLIA 4NMMA 2IUUA 1NRJB 1F3OA 5EE3A 1L4YA 2AN9A 3HPRA 4QXAA 1IJEA 2OLJA 2IYYA 4MGIR 3QBVA 4JLDA 4V0NA 1ELOA 4UJ3A 1NF3A 3LWNA 4NPHA 1MO6A 4UXIA 2BHRA 2Q0HA 2WWGA 1HEIA 4A92A 1IY2A 1EG7A 3RLFA 1VHTA 2OM2A 4CT4B 2AWNA 4TN1A 4YXWA 4PC1A 2Z0MA 1RW4A 4Y0AA 1E2LA 4L16A 3QEOA 1DG3A 1JECA 1KO5A 821PA 4HSEA 5AJVB 1VIAA 1TTTA 2P5SA 2GK7A 3SZRA 4NBSA 2NO7A 4RKFA 4PPFA 3X2SA 4R71A 4IW3B 1XZQA 4PAOA 3RYTC 3AUXA 1KO1A 2ORVA 5FI0B 1ZNXA 4Q5IA 4IDNA 3TLXA 1LF5A 3A4LA 2JASA 3NBFA 4C7OA 3M1IA 4KYIB 3SN6A 1D5CA 1SVOA 3MG9A 2JCSA 4MQBA 1OH8A 1FZQA 4PC6A 3LRPA 3SC3A 2ODBA 1NMYA 4M1SA 4XTRA 2CCKA 3EARA 2FPMA 2QSZA 4BE7B 3K9GA 1D2MA 2OG2A 3ETLA 2GESA 2EYQA 2YC4C 2ZSFA 4OL0A 5EE5B 5P21A 4C3ZA 3ADBA 4C0BA 3EPJA 3SQWA 1Z0AA 2W83A 3BD9A 3CUEF 3I73A 5H1YA 3LW7A 3UXMA 3R8FA 4MYTA 4TMVA 4TTRA 3HJNA 1XXHE 3TK1A 4EPVA 3TUZC 1G17A 2GWHA 5BWMA 3FHCB 2QMHA 2QRZA 3PUWA 4PO9A 1J8YF 1E1RA 4IRUB 2HXYA 2JLUA 5KSPA 1X1SA 4P0TA 1UFQA 1ZM9A 2BMDA 4LPSA 3QENA 3FFAA 1NBMA 4JBYA 1XTKA 2JJ8A 4LK2A 3AP2A 3DM9B 2CNWD 1NLZA 4Q1BA 4Q9JA 3CNOA 3MWYW 2O52A 4RY2A 1G4UR 5GJWC 3TUIC 1M34E 3QI2A 1NN5A 2W2VA 4TLEA 4YMSA 5TV2A 2HEIA 3NG1A 3GLIB 3K0AA 4RZ2A 3D7MA 5DH9A 1AKYA 2DCUA 3BJIC 2Q3MA 5C18A 2CXXA 2N42A 2ANCA 3K0FB 4Q02A 3PG5A 2OSBA 4P32A 1JAHA 2KBEA 3TVTA 1PJRA 4QGHA 2GBLA 5B64A 1NG1A 4KSCA 1JALA 2AR7A 3LVQE 4L9SA 1JNYA 4ACAA 1WBDA 3LO5A 1KI9A 3R9XA 3THYA 5FTMA 1Z83A 4NE2A 3NWJA 2IXGA 2WWWA 4NYIQ 1UEJA 2VP5A 1SQ5A 1YE8A 1NSFA 2V8OA 4HAXA 4CGZA 3GCGA 2A3RA 1COWD 3ZS9A 3ZZUA 4A15A 3REFA 1IXSB 1AZTA 3EZ9A 4TL7A 1DS6A 2O8EB 2OZEA 2WKQA 1XX6A 5AUOB 3PITA 4F4CA 3VNUA 1KI3A 3IEUA 1F48A 4ZV4A 3E2IA 4UNNA 5FBWB 2W6ID 2GZAA 3QVVA 1Z0IA 1WQ1R 5D3QA 1Z0KA 1I4LD 3N2IA 4Q4JB 2XXAB 2F55A 1PUIA 1KK0A 3B8HA 2EYUA 5LB4A 4LCBA 3V4FA 1E96A 1ZJ6A 2FNAA 4GI7A 3NXSA 2RGCA 3B1XA 2HF9A 2R62A 1VG0B 3IHWA 2WJYA 4B43A 1Z63A 3CF2A 1C9KA 5C46F 1XTRA 2RGBA 2MMCA 1N6HA 1FFHA 2D06A 5JCPA 2WIBA 4XH9B 1YR7A 1YR6A 3AQ4A 4EIWA 2P6RA 2QU8A 1UPTA 3L0IB 1G5PA 1WRBA 2YOGA 4MGYR 4B33A 4KV9A 3R8CA 3FFBA 3JVVA 4BZPA 2GAAA 4AK9A 3SI7A 5CIQA 1SVLA 3B1YA 4AYTA 1WXQA 1T0HB 2BJWA 3VX4A 3P20A 1BS1A 1MABB 4FMBB 1OXVA 5JEDA 2V7QD 2DR3A 3E5HA 5DHFA 3RHFA 3I5XA 2ORWA 2GF9A 3BH0A 2O8EA 5EP4A 2FSGA 4PHFA 4KFUA 1RFLA 5JSZA 4ESVA 3NTUA 1C1YA 1KJZA 1XJQA 3FVQA 4NONA 4UXJA 4A82A 3Q9LA 5JRJA 2IW3A 3EAQA 3QUSA 2ZRIA 2QE7A 5GJVC 2HV8A 2KSQA 1OIXA 1KSJA 4LWZA 1ZU5A 4HZIA 3AF3A 2ZSEA 3X1YA 2XEXA 1T5LA 5BQ5A 5C4MA 1D9XA 1QHHB 1TUIA 3L0SA 4DSUA 3THWB 1NNEA 3I4LA 3U7GA 1W7AA 3K9NA 5HKKA 4A36A 3VKGA 1VG1A 1Z07A 1RJ9B 1P61B 3EZ6A 4PQRA 1E1QD 2ERYA 4BLOA 4PPQA 2AD1A 2GZDA 4B2LA 2XNDD 5FOTA 3OEHA 3QXXA 4TMTA 2VHTA 4Q03A 2IUTA 1JQLB 4C0HA 3H86A 4KLNA 3DO6A 4TZ6A 3GEIA 3U60B 4DUGD 3K9HA 1CIPA 1KIMA 2HCJB 4GRAA 1NKSA 1T3LA 4BEBA 4ZI3A 1DO0A 3DEFA 3K53A 3LBNA 4B3BA 2HJVA 4HLQB 2P6UA 1GAJA 4NHOA 3GLIE 1ZM7A 2YVUA 4QGFA 8OHMA 5JSZB 5G3ZA 3U6BA 1NJFA 2B8TA 3RC8A 2IA5A 4I1OA 2EW1A 2HYDA 3WY9A 3HWSA 3EX7C 1KI4A 2OT3B 3BFXA 1SXJE 4YONB 2CDNA 2ANBA 1E9FA 1COWA 1NJGA 2A5GA 3BOSA 4GFDA 3TBKA 2PCLA 3UWOA 1W4CA 4EFNA 2GJKA 4K46A 2WJIA 1RRGA 4A0GA 2GXSA 3OESA 4RFVA 5KNDA 4MDFA 4TWZA 2A78A 2V54A 5JZVA 5F9HA 1Q1QA 5L3VA 1XMIA 2PEYA 4TT3A 5FR1A 4LHWA 1LTQA 4B35A 2QG6A 2GJAA 3NBXX 2JLVA 2AD5A 2YOHA 5DYIA 3WNDA 1ZNYA 4BFVA 1N0VC 1VYTA 1T5IA 3RAPR 4ABYA 1XMJA 2OV2A 4M21A 3ZZ0A 1IAQA 4DDWA 2Q6TA 5CB6A 2CNWA 1IOZA 3LXXA 5ANRB 1G8PA 5HTKA 3KFVA 4OKSA 3M6AA 2VSXA 2QGZA 5J5CA 1R0WA 3TAUA 1N2CE 1E32A 1F2TA 3QY0A 1S1MA 1BO6A 5FBRB 4PQYA 3SJZA 2WSMA 4M9ZA 3ZQJA 3ZYCA 1GM5A 1E1RD 1E2FA 2QROA 4JL6A 1IN7A 4XD7D 3LNCA 1S9DA 3B9QA 4V0KA 2CCGA 5EZ6B 3U7FB 3TIFA 1E2JA 3CO5A 4OQFA 1KKMA 3L8YA 1BIFA 2N46A 1Q57A 2YJTD 2FU5C 3Q72A 4EPWA 4NL4H 4DLXA 1VCMA 1E9CA 4IVRA 2WWHA 1BMFA 3OHMA 4Q7LA 1VPLA 2Q3FA 4MUAA 3QKSA 4IKEA 1N5LA 4IFEA 4TLCA 2R6CA 4PXAA 4A8JA 4TL8A 5K8LA 2H16A 3K0CA 4PO8A 2JIZA 1VYUA 4NCNA 2VSFA 3O8DA 2GZHA 3VFDA 4BLTA 4F7WA 4KAXA 2V3CC 1II9A 1WDTA 2RMKA 3WNBA 3K09A 4RZ3A 1UKZA 1SKYB 4HAUA 3T34A 4C4PA 2ECKA 3RANA 1LW7A 1ODFA 1EGAA 1T8TA 4CW7A 1PZNA 2CJWA 2CK3D 2DWQA 2HYIC 4TTQA 3U7HB 5TY0A 4FWIB 3GPLA 4V02A 1E0JA 4II7A 2AXNA 4YQFA 2WJHA 4JKYA 2JJ1D 2ZJOA 5JJKA 3ZGXA 3GLHA 4ZCMA 1TQDA 4MRNA 1QDEA 3GLFB 2IYWA 4BRUA 1CJTC 4MITA 5AJXA 3I8SA 3IIJA 1II0A 5EXXA 4C9BA 2CL0X 1E2MA 2WKPA 2WWYA 5KPDA 4EPTA 4GL2A 4G5QA 3T5GA 2YWEA 4OI2A 2VHQA 1JPNA 1TUEA 1Z0DA 1KSHA 3E1SA 4DLTA 2ZI5A 3LQRA 4O0MA 2ZI6A 1SXJC 3AP3A 5DYGA 4P4SB 4B32A 1UADA 1W44A 4JKIA 4KI0A 4B74A 1NN3A 1ZUNB 4AIIA 2H8KA 3ND9A 1JB1A 1Z6YA 2B92A 4LJ5A 5DO9A 4ZO4A 5EXPA 4CEHB 1G3UA 221PA 2RB4A 4UNSA 4D81A 4BFUA 1GG2A 1PLLA 1YZKA 3CF6R 3KUCA 1NN0A 2QMEA 1QG4A 2QMUA 3RSOA 4WOPA 4AKGA 1XEXA 3K70D 1ZBDA 3EWAA 2ZU0C 4A0RA 4LYJA 1W5TA 2IYTA 5JEEA 1YKSA 3VMFA 4OYHA 2KI5A 3CNLA 2P3SA 4JS0A 1LV7A 4FXPA 4Q9LA 2C9OA 4PC3A 4UJ5A 2B6HA 3BBPA 3KKMA 1HT1E 5EE0A 1U99A 2CE2X 2YOFA 4FCTA 2VIIA 4LJ6A 3V9PA 2A5YB 2ZREA 1W47A 3ASYA 1GL6A 1NLFA 1OLOA 3KXKA 4WIAA 1VG8A 3U61B 1XZPA 3HR7A 4M4SA 1YZNA 2IK8A 2V1XA 1FPMA 2PT7A 3QPWA 4WW0A 2OILA 4Q4HB 1E2EA 1T6NA 5HPYB 1Q44A 1G7SA 1OFHA 3P1JA 2I3BA 1ANKA 2QY9A 5C1BA 1Z2CA 3CZQA 4WXPA 121PA 4L5BA 4QM7A 4JYCA 2BMFA 3HPQA 2GF0A 4IVPA 4JLOA 4B3CA 2IS1A 4OJQA 5JWRA 4A0HA 5F2EA 1OW3B 1EFRD 1Q1EA 3AF1A 4PPGA 4DC9A 3T61A 1EWRA 1UKVY 1FUKA 1Z06A 3GLGE 1AZSC 3B7GA 3LFUA 2VTKA 2K5UA 2H57A 1B0UA 3LD9A 1VTKA 3DKPA 5CDFA 4G01B 2FFQA 4RD3A 1G3QA 1ETUA 1CRQA 2D2FA 2GJSA 4TLAA 3U3KA 4B2PA 3AGQA 2DFKB 3CONA 2ZJYA 2NO9A 2C9CA 4QGGA 3KQUA
chains in the Genus database with same CATH superfamily
4DIFA 3BZUA 4X20A 3I1JA 1YZGA 3MNFA 2DTEA 2GKGA 4IG4A 4MPPA 3H9CA 1JFRA 3JYOA 4IUYA 5BWCA 4G86A 4DHWA 5KINB 3MYYA 3NDBB 5C34B 3FPJA 1I3CA 2TSYB 4AZ0A 3PX7A 4DR1B 4YCMA 1DJQA 1GZHB 3TINA 5BYBA 4OAOA 4K28A 3T9EA 1IIRA 1DBRA 2BBWA 3VR6A 2QNIA 3HZZA 3D6NB 3UF0A 4AN1A 2QTMA 1ORWA 1SPXA 1BHSA 1ZNWA 4GMFA 3Q3VA 1C5KA 4WH0A 1AN9A 1RAFA 1VHDA 4BU0A 3B9RA 1EEXB 3OQJA 5E1BA 1IONA 4TTSA 2J87A 2ERXA 4JUFA 2HWKA 1P8AA 1Z37A 1QTIA 3C14C 3QMVA 3X1WA 1J2TA 1KH1A 1GFSA 3R77A 2VT7A 1V5IA 1MQ9A 3CUUA 1W85B 3RKRA 1PF7E 1M6NA 2JLBA 4AY3A 2A67A 2C03A 4M1MA 1UDCA 4HLNA 3NUGA 1B1CA 1ENZA 3TZBA 1WS6A 3JD3A 2LNDA 3LVBA 4X3PA 4BAGA 4CWAA 5I47A 1TJYA 4ZANA 1M1ZA 1DKLA 1NMSA 1UQRA 3NHJA 1DEOA 2LTAA 1EKXA 4ILKA 5GGYA 4JI6B 5K0BA 4EW6A 5DM70 4LV6A 1AJEA 1DIOB 1TZCA 3NBKA 2XAAA 2PFKA 2PZAA 2W6NA 3RUHA 2GMWA 1YB6A 2BM0A 3O3MB 4US1R 3THOA 3JQ9C 4L0CA 4ER0A 2XQFA 3THXB 2GBGA 3U3DA 1Z4IA 4HUJA 4CIYA 3HJTA 3TRIA 4JQCA 3L5KA 2JBAA 3P9ZA 3STTA 5CB0A 1ZRHA 1TUBB 1WIWA 2FVXA 2H4YA 3LPMA 1V37A 2PT5A 2FJUA 5TLSA 4HB0A 1PGOA 4J16A 5TS2A 2AVNA 4RJLA 4F6CA 3ADDA 4P3YA 3BCHA 2H92A 3EEFA 3OOHA 5CVDA 2QQEA 3R5XA 1J8FA 3OZFA 1VRWA 2DQKA 2XGJA 4LJKA 1SEPA 2FQXA 2ZYGA 1UOOA 5A6VA 1V0JA 4PONA 3PFGA 1YHZA 5K7SA 1AD2A 5J2TA 2J7PA 3H5TA 4OJKA 1TVKB 1D6NA 1V2HE 3SBOA 2RGXA 7ABPA 5G0WA 3FAZA 1UEXC 3SM9A 3P71T 1OI7A 5D86A 3WLHA 5ENDA 1XLWA 3W9SA 4CGYA 5JMTA 1A97A 3E7DA 3FLMA 4Y2VA 4BVLA 2F9MA 5GZ6A 4UEJA 2XXAA 4CM9D 1L1RA 3MGGA 1G8AA 4L72A 3H1FA 1N6PA 2D5IA 2Y6VA 3SZOA 3MUNA 2CLSA 3HJUA 3HP1A 3URKA 1X14A 1ZUHA 2NTYC 1Z6ZA 5KNLA 2UUOA 3FYCA 1PG5A 1YL7A 1P0MA 3QFSA 1OB2A 3QKWA 3GY0A 1T1SA 3WICA 4JVNA 4LGVA 4CTOA 4BOYA 1MJNA 3AKEA 2QWXA 5GADl 1EDDA 2QE7D 3EB9A 4KNWA 3AKZA 5L3SB 1XEWX 2VP0A 4B75A 2EU8A 4KXVA 4MIYA 5CFOA 2OP1A 5JNRA 1OXBB 2K2QB 5HWSA 3WLAA 3ZV3A 1OXXK 2NZJA 3BERA 4ENQA 2ZIGA 4FHEA 4FFWA 1P9NA 3UMSA 4WKOA 1C4WA 1DZ3A 1Z5OA 4AZ3B 4WJKB 5CXQA 1I1OA 1WMFA 5JD6A 3QKTA 1CJVC 3AKDA 4X9XA 3ROMA 4HDRB 3DAHA 3WGJA 1RU3A 3LQ1A 1XEXB 4HQFA 5L6MB 4JI0B 1L9KA 1W88A 5FOUA 3T5PA 2IYSA 4DV7B 4HR7A 1Z4KA 3M6LA 4OD0A 1FUEA 2VF7A 5IJ9B 3QLUC 2XZDA 1HURA 3G1UA 4X1KA 5F9MA 3U49A 4BECA 1ZVJA 5E0KB 4A2PA 4CT5A 5CDFE 3OLXA 1GQYA 4IZIA 4OBXA 3HCFA 2RKWA 2ZJAA 4GP6A 4JLJA 4O2AA 4EBBA 4DLYA 4JDUA 3ZCVA 4DPLA 5K3AA 3K92A 3OE1A 4G9GA 3NDRA 3W7VA 5JJIA 5AICA 1SU8A 2D5LA 2VJBA 2W58A 4BATA 2ZUCA 3OQVA 3MK31 5IW8A 4B79A 4EZBA 2QL6A 3QEJA 1YR1A 5JDCC 4RJ2A 4LIPD 1NHGA 3FM9A 1K27A 1LDNA 3OETA 4K40A 4DY4A 2R7NA 3TLKA 5KHLB 4D45A 1T29A 4LGCA 1V41E 3KQWA 3ON5A 4YFVA 1JEYB 1X6VA 1MNAA 5A7GA 6REQA 5EEHA 2VTEA 1GU0A 1WG8A 1Z7YA 3PQ8A 3IUNA 5EESA 3BXXA 5FTNA 5D6NA 1A76A 3T9FA 1Q7CA 4LA4A 3W7BA 2XMZA 4BQSA 4MMXB 3FTPA 1Q7TA 4TYYA 1OX4B 3O8QA 4CUZA 1DWPA 3OJOA 1DKMA 2AXPA 2X76A 1KWKA 3LQFA 3FN4A 4Y7CA 1HV8A 4E1BA 1VGRA 2JL1A 4N7BA 3ZQKA 3HCAA 4LHSA 4QU0A 2I1QA 5D01A 4Q4HA 1P77A 3GA0A 1CRZA 4MVWA 4WUTA 5DTEA 4Z4CA 1K7XB 4XSGA 3UK7A 1X42A 3MRVA 1QG2A 1TAQA 2W2KB 4EG4A 3P8ZA 5DPMA 1HDIA 1NFFA 2ZRPA 4W7SA 5FPHA 2Y1KA 4G0PA 3DOEA 1ZRNA 3IP1A 4P7GA 1ID1A 3D31A 2Q9BA 4FUQA 4Q01A 5HM6A 2HR1A 1ZOSA 3X1DA 3ZHCA 3I04A 3R1IA 2P4EA 3HZRA 3JVEA 5WRFA 4Z49A 1ESCA 3OECA 3HEMA 2TMKA 4F9GA 1QQ6A 3I05A 3RB8A 3RTDA 5B6JA 1BGVA 2DBRA 1YVPA 4UVHA 4PFKA 1OLUB 2AOVA 1TLFA 4G4SO 5KVCA 4ETNA 3DOFA 2HC9A 4XQ9A 3N3BC 1SQGA 2RHTA 4P4GA 3FPLA 1QCYA 1EVKA 1Z9BA 2F8MA 4V38A 5HQ3B 4EG7A 4LFCB 2PYZA 5ALPA 2V0GA 3QQ5A 3HUEA 4II2A 3G1WA 2P67A 2G4LA 3JR3A 3N6VA 4Q3OA 5FB3A 4D80A 1TM7E 1ZIOA 2F1IA 2VDWA 3FH0A 4FYHA 4GU5A 1FXUA 4X85A 1KJ9A 1PVDA 2IHZA 1FTWA 1JW9B 2CKDA 4KXWA 1QORA 1E4OA 5LCXA 5BMOA 3OZXA 4TKVB 5BN5A 4W9MC 1NX9A 2ID7A 4GZMA 4AO8A 1A9TA 3EZGA 2HMAA 1O97C 4MKRA 2OR3A 5LXTB 3NIBA 1YNOA 4J0QA 3ZOKA 3KQKA 3OF3A 1BVYF 1W94A 4KZPA 4MW1A 1LWNA 4Q66C 1NULA 1HMPA 4ISCA 5K8TA 3GUYA 1VI6A 3V33A 1P6XA 1QRRA 3ESBA 1Z75A 3K20A 4GZ6A 3TH5A 3BKXA 4PYJA 4YACA 4IVQA 2V7GA 4OL9A 1R8JA 3FJOA 4Y3UA 4DCJA 1IZYA 1P0IA 1OC2A 1ZA1A 1RYYA 4JUCA 3Q1LA 3ESXA 4JC8A 3UW3A 1H6BA 3FUCA 1JSZA 3O92A 4MINA 2XKJE 3VR4H 2PYDA 3NYQA 1MC4A 2VHWA 4R2HA 1V5FA 4H6WA 1W8IA 2PV7A 4M8LA 1L6IA 5TJ9A 3CSDA 2RGEA 1M34A 1KR5A 2PJDA 1KAMA 3R3YA 4HMPA 3TCKA 2O8FB 1Z6XA 5HS6A 5KTYA 4MWBA 5IUKC 1UDBA 1WKCA 1ZC3A 2HIAA 3OZDA 4YRJA 1RI2A 2VQEB 1TD1A 4OI0A 3EWSA 2PZEA 3KD3A 3X1ZA 3WYDA 3IIMA 4URXR 2PMFA 2Q0SA 3OMWA 1L4EA 1QV6A 1ZH4A 3FOZA 2I1LA 4EUNA 2FW8A 1T4GA 4LHVA 5FI1B 2Q46A 1Z38A 1W1UA 3EXHA 3KB1A 2C3PA 4MWSA 1JIQA 1MG0A 1NVVR 2AZDA 3R0JA 4GR9A 3IP3A 4J6EA 2ZRCA 5HK9A 2AJ8A 3VDNB 1J5XA 3K4PA 5IJXA 4AM8A 5KYGA 4XB2A 2Q07A 3PUZA 4ARUA 3ZJ4A 3EUFA 4IL5A 2B2CA 4IJQA 4EVQA 5JI3E 3CRVA 2FPRA 4XYEA 3U6KA 2LIPA 4Q3NA 4X00A 2X1MA 2D1SA 1R66A 1JYFA 4BNGA 1P60A 2C4UA 2OMKA 3E7XA 3GZ4A 1YT5A 1O54A 2DULA 3IXLA 2C0PA 3V55A 4BJ3A 5A1JA 3M2PA 1TW2A 3GEEA 4V3BA 2G72A 4KQMA 3NTRA 1BD4A 2GN9A 4KLRA 3J7TA 4B6FA 5I4IA 1R1DA 1L7MA 1QIDA 4LVUA 4L22A 3IP6A 4PO1A 2XWSA 2Z2KA 4BN0A 3ZU3A 1GZSA 2X58A 3K2EA 1H9BA 4LI3X 3EIEA 3FMIA 1Q1BA 1DOHA 2IUEA 3RWMB 5HR5A 5IWCA 1K88A 3HM9A 5IM4F 4Z3KA 2NSYA 3NALA 1S3FA 1C1DB 5EKTA 3X1XA 4ZPJA 5CGZA 3ZVRA 1GA1A 5ERYA 4YJ2A 4OX9B 2EFGA 3MWLA 2EHDA 3G9QA 3M9LA 3C74A 5ECDA 1EFCA 1UJNA 1Y80A 4UMEA 2UVQA 1UWVA 3PD0A 4IOMA 3KDPA 4JMPA 1XD2B 1YQDA 4D9GA 1E3JA 1UPXA 2Z4TA 3D6VA 2GZRA 4D97A 2W2KA 4KK3A 2P6PA 3HO6A 3PX3A 1FPQA 1UBSB 5L3QB 3INTA 1W75A 1VP9A 2ECFA 2GNAA 1P0QA 1RXSA 2HADA 2QM3A 3MTIA 1WXXA 5BRAA 1NWCA 2C2OA 3WGYA 4B7AA 1JXQA 1QAMA 3F5QA 3SVZA 4ZVNA 3DE5X 2ZDQA 4HI0E 1WX1A 4C0QC 2BKLA 1YI8A 4YJDA 3UMGA 4MV3A 3ZWDA 3NHZA 2HF8A 1LNZA 2WQ7A 2ORIA 4TQAA 2AK3A 5EWLB 2UYHA 4OLJA 1KAOA 1QHYA 4WV3A 1XRJA 4PGFA 3E84A 4WADA 1OILA 3TI9A 3UICA 2EP8A 1A5SB 2XAUA 2DFVA 2GPYA 3C7KA 4NBKA 3ZKWB 1CZRA 2YXEA 4UM7A 3PI7A 5HOQA 4D44A 2P41A 1XBTA 1A4IA 5GMOA 2WTUA 3FKSD 2RGNC 1J2RA 1XRSB 3G49A 4ZDKA 1NW8A 5HZHA 2GCIA 3VDMA 2NIPA 3A6KA 2X1HA 4M1OA 1H0SA 5CDHA 1EFTA 1M6EX 1P5JA 4MUYA 1P3DA 2HQSA 1NI4B 1RHUA 1G3IA 1CQXA 1UINA 3I2IA 3LBIA 5HSGA 2H51A 3NETA 5LYJA 1E7MA 4B4DA 3PFHA 2ZT5A 4FIDA 1Q2XA 4JB0A 3NO4A 2C82A 2JHCA 4GM4A 2D1TA 3CGWA 1JV2B 1CWUA 5J5AA 1KEPA 1GYRA 2EKDA 2O1EA 2Z2YA 1U8AA 4L4ZA 1H8HD 3JTMA 1UWLA 3BMXA 1S5PA 4M1KA 2QL5A 5DVZA 5H70A 3OF2A 2ZATA 2HHJA 5COBA 2C1ZA 2C9MA 1N2EA 2OCXA 3I32A 3I58A 3EEOA 2QM0A 3EQ9A 3PYLA 1FQWA 1U8XX 3RS5A 3PHIA 1P9OA 1UOEA 3HFSA 4WOBA 2YHIB 4Y2GA 2ID4A 3EPLA 2YASA 1H93A 3GJZA 3LX5A 2WWIA 5K03A 1LUAA 2ZANA 5IKXA 1MG5A 3CC8A 5FO0A 5A4MS 2IPXA 4G6ZA 3AF2A 2B3TA 4GZ3A 2GCEA 4DJAA 3N2EA 3QK7A 2LPMA 1ZGHA 3PK0A 2EOAA 2P11A 5ALDA 4CHGA 4JYPA 5AOVA 4YIHA 5CU7A 4J6FA 2VCEA 3VZCA 4DLZA 5SY9A 4H2DA 3A6ZA 4YQEA 5AVWA 3I04M 5BV2P 2V6GA 1DG1G 2IXBA 2MIIA 2DMRA 2OG1A 2JIMA 3NKVA 1EE2A 4HPWA 4LC0A 1BQ3A 4XOIA 4BJHB 1ZKDA 3S2GA 4Q3BA 1P73A 3IPLA 4BTEA 1CFZA 5KSZA 1V48A 4YMWA 3BM5A 1YDMA 1GA6A 3IAHA 4OHPA 1ECCA 3TQCA 1XF9A 2ZSUA 1TU0A 1A4RA 1JU3A 2WM9B 3IURA 3K09C 3D59A 2QR5A 3VC2A 2PL9A 4EOGA 1QCZA 1ZR2A 4XFKA 3T3MB 1XR3A 5D7NA 1AHNA 2XTZA 1N0HA 4ZU1X 1DRKA 4YRZA 3E53A 3AL0C 4R7ZA 4B3RB 4JNKA 5B3KA 2Z6UA 1KS2A 2G8LA 2PV0A 5CCDA 3VC3A 3GAMA 4CIDA 1TQ6A 3VA7A 1O6GA 2RC6A 1W34A 2AWOA 2R79A 3FBGA 3TBHA 1M8JA 1Z4QA 3JCZA 3QX9A 2YY6A 4KE6A 4LISA 2IYLD 3EJWA 5CIWA 4EY6A 3SCZA 3U0BA 3BILA 1ZOLA 1YDFA 4ES6A 1LI4A 2IYXA 4XEUA 1G8FA 1E60A 4Q3DA 1GTMA 1ZQ9A 3IVRA 4KI7A 3TO5A 3E23A 4LHZA 4HZUB 4LSZA 5CLJA 2EJBA 3B1KA 1RE0A 3M2TA 1SD5A 5IT5A 1QTQA 5FUWA 5K4HA 2FW7A 1ZA2A 3PFIA 2H4HA 2PMKA 4PGAA 3ZHTA 3RVRA 1SVIA 4UU1A 5J4LA 1EP3B 2YZNA 4PPYA 1F5SA 1UBUS 3CZMA 4Y2UA 1FJXA 2RAFA 1UZMA 3HKBB 3HRIA 4HBZA 4YJ2F 1CUSA 1KMMA 3FSRA 4C0WA 3D3KA 1FUYB 1OLXB 1DAGA 1GG5A 3ESZA 2J9FA 4U3JA 2AN3A 2C42A 2YUIA 3MJCA 3K71B 1YC2A 3N9IA 4HC4A 3JQBC 4P3NA 3T12A 1DC5A 4L1KA 5CLLA 4PSDA 5GM1A 1X2BA 3WK9A 1OT5A 1FU4A 3DTVA 1CS0B 1ISJA 1P7VA 2EWVA 4MYCA 3WTBA 3LT2A 4L2IB 4N1AA 1RHJA 1YZHA 4RD2A 3KZOA 2JFUA 1W19A 3PX2A 3UO8B 4DLVA 1J5PA 1THTA 1X77A 5F5LA 1O57A 1YSCA 3KR1A 2I71A 5B1HA 4KMMA 4YR7A 1GUAA 3PHLA 1GDTA 1KBOA 5D3MA 2C77A 1I3LA 2EWWA 1T2NA 2OL4A 2XE6A 2IU0A 1Z29A 1O58A 1TVKA 4J3JA 3IPRA 1NVFA 2H7CA 2IXTA 3GLIA 1QYCA 3UATA 1SHLA 1S2GA 1E0KA 1U6KA 1YQQA 3CF4A 5AKJA 2VTBB 6CHYA 1N6RA 4QRIA 3KPYA 3F4KA 2XTAA 5ED0A 1P3JA 2KWIA 3AY0A 2XVMA 5BN3B 1I5EA 4JC4A 2E87A 1RI1A 1T9GR 2B37A 4CMBA 1Y8AA 2ZJ2A 2IEGA 2HWUA 4K5QA 3PPVA 4I9GA 2XB8A 3TZEA 3JZIA 4G41A 4FW9A 3ZGZA 1JN0A 2Y1FA 2F3UA 4MR7B 2PSJA 3L8MA 5M5BA 2FLKA 3KPUA 4CMCA 4O1MA 4MW2A 5BN1A 5ALLA 2ET6A 5EI5A 4DSTA 4I9HA 5FV4A 4BMYA 2X4LA 2EIHA 4H0NA 3WGLA 4CU5A 3VR3D 3TEJA 4DV2B 1XZEA 4JUBA 2FX3A 3ADOA 4Q6BA 4BL5A 3O7MA 3GFFA 3CVOA 2EEPA 3PE6A 1OR8A 3A6LA 4B44A 3CY6A 2O3TA 2AMFA 1T2AA 5SY4A 5FEMA 1MBZA 2IUSA 4LC1A 4HDMA 1F2UB 4R1OA 4XVHA 4QU8A 2YYAA 4L8GA 1KA9H 4R1UA 1JR3D 4EO4A 5BR4A 1PQYA 5MN4A 3T15A 4PG8A 4YR9A 4CG1A 4NX2A 3ENZA 1BX0A 3L6EA 2Q3CA 2J5KA 5EP2A 4QNMA 4NBUA 1BOFA 4TSRA 2X5JO 2ASEA 3ZXXA 1J4AA 3L0DA 4PNPA 4YVFA 3NGMA 1FP2A 4ZCLA 1E1NA 1SKQA 2CLDX 5D7BA 3NHRA 2LGJA 3I30X 3I6BA 2EGUA 3PDCA 2G0TA 4FFRA 5KWVA 2XYRA 1RVDA 4OHRA 5DKFA 2DY1A 1YQEA 2TMGA 1W4RA 2YN4A 3KOUA 4FWBA 2F43A 2A33A 1L7EA 2YINC 4B73A 3A10A 1GAEO 5EZYB 1M6WA 2GKOA 4HLCA 2PSSA 1WMBA 3A32A 4TKUB 1IM2A 3Q41A 4U2CA 3PJGA 2IGBA 3JAKB 1Y6JA 2Q50A 3UTDA 5A05A 1AV7A 1G7CA 2NO6A 1DKUA 1NT4A 1S01A 2AJTA 3ASUA 3HLKA 1JG6A 2ZEJA 3ILYA 4XDGA 5ALMA 4R2LA 4C6TA 3L4BA 2CFSA 4IDQA 4DCGA 3JD2A 5L7WA 1H2AS 1KQOA 4XAQA 4XIIA 2BPOA 1ZGZA 4EJSC 3EIHA 2GCGA 1YZQA 2YJ4A 4B45A 3DOJA 1MABA 2FETA 3WZ2A 1DX9A 5JYCA 2UYGA 2X22A 5DSTA 4CMEA 1GOTA 2GYWA 1RXWA 4N48A 5EXTA 4UUPA 1CR1A 1VQ1A 1VLLA 4PHHA 2WHPB 1D2EA 3O1IC 1FSZA 5AK6A 1HQYE 2ATIA 1DQSA 2ZAGA 2AN4A 1XG5A 2GD0A 4GOKA 4WCFB 5KX5B 1YRBA 1O9GA 5ES4B 2HWWA 1W49A 2AW5A 3WJ7A 1KNXA 1Q22A 1AOXA 5E38A 1YR9A 5AUNB 3BTOA 3PD1A 1VGVA 4L9AA 5AVQA 3VXKA 3LPDA 2V0NA 4ZVQA 1A2BA 5B3JC 1TYAE 3IUJA 4N5LA 2O8BA 1I4DD 3BWXA 2JLZA 3PVCA 4DNXA 1XUOA 2VN8A 3TKYA 4ZEVA 2EG5A 4JP3A 2J0UB 4OI4A 3ZTTA 4G36A 3SYMA 2GJ9A 3AV3A 5DXFA 1GNTA 1RXUA 3D5EA 2BGWA 5LU9A 1RKQA 3C85A 2WF5A 1KO7A 3W2FA 3Q85A 1ODTC 4YJFB 1EXWA 1UJ2A 2COUA 3EZ7A 4P2GA 1T9HA 1DTEA 2ETVA 1MB9A 2F1JA 2R5WA 4PSAA 4GQAA 4EG8A 3TSZA 3TX6A 5K51A 1U2ZA 2WWVD 2PUVA 4MYHA 4PSVA 4URZR 1AURA 1SC3A 2VHZA 5CR9A 4D3ZA 3OTOB 1K5DA 4MRPA 5D3ZA 4DMKA 3IUQA 4DYHA 1WKVA 2CNBA 1SUPA 4ND8B 3WGUA 1AKWA 1U8UA 5ADWA 1HDGO 5KTOA 3NOXA 3KX2A 5CTJA 4DA6A 3HFJA 4TMFA 3V4LA 1ONOA 4HXYA 5EOVA 4NEGA 2YHIA 3HKBA 3FBTA 3HDTA 1OV6A 3KJEA 3NTXA 4IIDA 5AUQA 1VIYA 3UHPA 4AB1A 3PNPA 3S70A 1G5TA 4KSBA 3S8EA 1KETA 3JSXA 1E4EA 1VHWA 3GLFA 2I4OA 4IO1A 4YRKA 5BNFA 3ED1A 1QFMA 1I0IA 4QYSA 5K8IA 4HT3B 1XWWA 2DPGA 1NBIA 1US8B 2BF4A 1P72A 2VSYA 1QBGA 1RLUA 3OX2A 4PG5A 3RS4A 3NGLA 1KTVA 5E9QA 3TN7A 2XCQA 4QYXA 4WXYB 3WYEA 4EB6B 4ECEA 4W6ZA 4UOEA 4DBZA 1E3MA 1OJLA 5LYJB 2AF4C 1KMQA 1YB7A 2WG2A 1BXGA 1SCUB 3O5AA 1L4LA 5BQXA 1BHJA 2I6FA 1R16A 5DWVA 5AT1A 3GBPA 2PJUA 1KQFA 4YAKA 1Z0JA 3GCWA 3N76A 4LE1A 4XWTA 3TEMA 1V39A 1AUQA 4L8FA 2WMYA 1WMAA 1UMKA 1AT1A 1EGQA 4UUMA 2IHNA 1UPAA 3DMGA 3IRUA 1J7KA 3LT4A 4D99A 2YFQA 3KJFA 3QF7A 4D5EA 4RK0A 1FVXA 2XE7A 1XXHB 2Z4RA 2X8WA 3RS9A 4WOCA 1Z0SA 1Z18A 5BVGB 5J47A 3SKYA 1CVIA 3CJQA 3QEKA 2FV8A 1OHHA 4CEIA 1Q95A 2GHIA 3IQGX 3RAFC 4HXGA 5BT9A 1E3WB 3P0IA 4M76B 5CNMA 5CNIA 3VAZA 3F8WA 1SUEA 3MTDA 4RZUA 2H1CA 4DC1A 4CCWA 1KO4A 1QVZA 2DBYA 3GRPA 2PFGA 2H2DA 1R4ZA 4KZKA 2FMKA 4NJMA 1NNLA 4DWJA 4XJVA 4YALA 5FLXA 2RBGA 4KXYA 4BRSA 3KHUA 1N25A 4F92B 2WA2A 3VOBA 3THRA 3HN2A 3EIFA 3ZX5A 5M2QA 3LPAA 2ZJZA 2C3YA 1P7YA 1S6YA 2PD3A 3TFQA 2FI1A 3F9IA 3WA6A 4QXRA 3CM0A 1C7EA 4PXSA 3JYLA 1Q1ZA 3VYSB 3I3OA 4R83A 2D0OB 4BMCA 1MGOA 3R3VA 1NVEA 4NLLA 3L8GA 4QQNA 2WB2A 3OO1A 1D2AA 1D1SA 5KKNB 2YY7A 1O7JA 3LCUA 4H0FA 4X1OA 5K0LA 3M89A 9LDTA 1EXVA 1UFVA 1CUDA 1WMSA 4GBJA 3AJEA 3R20A 3WGOA 4ZTUB 4H0CA 1Q5PA 1DCMA 3FGZA 1A9SA 2I9PA 1M2WA 1MA3A 1M8PA 5P8WA 4E31A 5LQUA 1UMCB 1QIIA 2GM5A 4CQNA 4E5PA 3LLVA 2RK3A 3BWEA 3E2MA 4HADA 3OOSA 4C06A 1VJDA 2B35A 2VNIA 3QTTA 3NB0A 5GTDA 2AK2A 5GIOE 4H08A 1Y9ZA 2QUJA 3IQFA 1ZIPA 4HXFB 2WZDA 3IX7A 1TJ4A 4ZQFA 3SYLA 3OEED 5JBIA 5MGBA 1T43A 2KBFA 3F8SA 1HDXA 4G85A 4R40A 5ER6A 3K30A 3T38A 1H1DA 4BQQA 1QP4A 4LMRA 3DHNA 2QI9C 1N0WA 3RTEA 1XDUA 1H2BA 3CLTC 3PUXA 5JAQA 4KNVA 1KERA 4C7XA 1HM5A 4FLFA 2FE1A 4D02A 1K75A 1P4RA 2ZI4A 1SIBE 1MDBA 1NF9A 2DHQA 3GBSA 4JA2A 1P9LA 1KJYA 2XNDA 3NPMA 3RVDA 5B3LA 2RGRA 1EFVA 4X8HA 5AM4A 1ZGCA 5E7QA 2O9JA 1BG6A 1JHZA 4TRNA 4OBBA 2ECQA 2E6KA 3ITDA 3I23A 2JD2A 3H9UA 4B6GA 3R7FA 4C07A 1CDOA 2JGFA 1ZU4A 1EBUA 4Q4AA 2FP4A 3TSCA 3OUZA 4Y18A 3H5LA 4UE2A 4AS3A 5B30A 4MYDA 1P4HA 1W4ZA 2AF3C 1XMSA 3CQ9A 4KW7A 1UDXA 1W5BA 5DLPA 3LA6A 2G1AA 2NV6A 3SC2A 4GMDA 4N3NA 5JQGA 2QTVB 1I2BA 4FILA 3UUGA 1JDBB 1G8HA 2NO5A 4BB5A 4O2BB 1KJWA 2HA5A 3IJPA 3CKLA 1U4SA 4NJEB 3VR3A 2D2IA 2AC2A 2BC9A 4BXOA 1JP7A 2E37A 3UC5A 4EEZA 5INTA 1D7AA 3CLHA 3GIDA 3NH9A 4MJ7A 3AX6A 2G82A 2ERCA 5GV8A 1TA4A 2FMXA 1FX0A 2JAPA 4BZWA 4DFDA 2GRJA 2OOKA 2FFJA 5F4ZA 5CEJA 3NCTA 5HEKA 1JH8A 4DVGA 4JDPA 1FLDA 4EO9A 4KO8A 1XDDA 5EHZA 3CZCA 4U8GA 2FRVA 1E6EA 1E9SA 2QTBA 2JH9A 3USES 3GMDA 2B4KA 4OLAA 3Q7QA 4S2EA 1KQ3A 3LQYA 4FKBA 3V4ZA 1DAFA 1HK7A 1CRPA 1HDOA 3JX9A 1A4UA 1VYVA 5I6DA 1C8VB 1QLWA 5ERXA 4EA6A 1OI4A 4LHEA 1W0KD 1X38A 4ZO9A 2X15A 1I94B 5DX0A 1I3OA 2K2WA 2MTBA 2I80A 3OWXA 4JJ7A 4PAWA 1EVYA 3GG9A 4LDRA 5DMHA 1AKTA 1EK2A 5AK4A 1S7CA 4GF5A 4C6HA 3N0TA 1W5FA 1XYYA 3BWYA 5AW7A 3LAWA 3QE9Y 1DDGA 2Q3BA 4L51A 2W4MA 1DAIA 4XD7A 1FJ2A 4AWBA 5TXGA 4OK6A 3I01M 4ARAA 2CL7X 2VHXA 2AB0A 4P5PA 4KPYA 5FPTA 2VXBA 2XZTA 4EKGA 3UJBA 1NW6A 5CPBA 2PSFA 1KAEA 1DBQA 4B46A 2V5AA 3E1KA 1UQUA 4D74A 1QP7A 4QA9A 3HKEB 4K9SA 4Q16A 4HNAA 4D3DA 1Z15A 1QIKA 3IR5A 4YCNA 1ZVQA 1QZUA 1N5DA 1C3VA 3GC6A 3W9UA 2FPSA 3T7TA 2FR0A 1G5IA 3E35A 4WK0B 3RFXA 1X87A 4MUNA 2PQ2A 4R8RA 3TL3A 1R0XA 4J9VA 4HYTA 4WFQA 3VR4A 1OXKB 3Q5EA 4RSRA 4ZI5A 2X0EA 1BYIA 3BD7A 1UDWA 2DKFA 1Z2EA 2RGNA 2HIMA 4RPCA 1UPFA 2QS9A 1GNPA 1N9KA 5F7JA 2C9DA 4JJFA 4XVRA 2A92A 1SC1A 1ZK1A 4ETWA 3IA7A 3UAYA 3AETA 4MCAA 1EHCA 3O0TA 2H7VA 3HVKA 4RVUA 3IDZA 1UOPA 2OZPA 5BPHA 2Q4TA 2WHXA 5JV5A 5BN5B 1EJBA 2WBLC 2WE7A 3O94A 2R87A 2BFEB 4JU8A 2YQ5A 3KM0A 5TMPA 2R7MA 3MJ4A 1KI1A 2BTOA 2UVDA 3OQ1A 1JSCA 4X94A 5EIAA 4EW3A 4LW8A 4NECA 5EIFA 4ASUA 2KW5A 3ZHSA 4H7KA 4K26A 4O2AB 4Y1RA 4EF5A 1FSFA 2PBRA 3NHAA 1IUOA 4K9MA 4R84A 3ZV7A 1BZYA 2ZBPA 2G80A 4DA9A 2PAAA 5FPQA 4B4OA 4PZ9A 3KE9A 1PO7A 2IFTA 4IJ6A 4M8KA 4WKGA 5H4GA 2OESA 2H0RA 2Y1CA 3BDIA 3KTAB 1JBEA 3QBJA 3Q3IA 3KT0A 5THQA 4DIKA 2WAYA 2WV7A 4RPKA 5JFOA 4WT7A 3K4QA 3VBCA 5FA8A 5DYYA 5JYBA 1TUBA 5D84A 3QQPA 4NDNE 2V3VA 2HA3A 4R0MA 1L7RA 1OOEA 3MTBA 5J58A 4YASA 3EY4A 5CM9C 4PBTA 4NI5A 4IEFB 2XUZA 1NY6A 4XB6B 4D9KA 3USCS 4AJPA 1R8SA 3HFGA 1FVOA 4PWYA 4OUDA 3F73A 3L02A 4KXUA 4LZOA 2E2WA 3ZW9A 1H0KA 3DOHA 3PGVA 3FZYA 5M3BA 4CQMB 1E7RA 1RWMA 2H2AA 3LYAA 2P65A 5JSKA 4DNPA 1PR6A 2NNWB 4YT2A 2A1UA 3A1UA 3ORSA 4H3VA 3IUMA 3SLRA 4GM1A 2AKYA 4MDHA 3AM1A 1K89A 1ULZA 2RH5A 2JI9A 2OTCA 3DBOB 3SFTA 1HXHA 3L8EA 3AF0A 2NT3A 1DXYA 3INNA 2CXPA 2WWFA 3O8QB 1C4XA 3QYAA 2D0DA 4ZWNA 5KQRA 4LKRA 1RRCA 1PWHA 4GKVA 5EERA 1M2EA 1UC8A 1P5HA 2IU6A 4MP3A 2VBCA 2I4MA 2QN9A 3WHLA 3WOVA 4BO3A 5JI2E 3ESDA 4JXXA 2GO7A 5JJBA 4ZQIA 1VE7A 3GJXC 1SK9A 1X8JA 2V45A 3DFIA 3SJBA 3WBJA 1RS0A 2ZRHA 5AXBA 1KGDA 1NI3A 3V2UA 5KTSA 1GTJ1 3G2PA 3VU9B 4ENUA 2RHOA 3IP7A 4XOUA 3TB4A 3EAGA 4MQUA 2GERA 2OXEA 3OPYA 4YI5A 4D6PA 3P26A 2TS1A 4Q3LA 2IS6A 2NG1A 2PJRA 3WK4A 1A9OA 3BREA 5IRCD 1M6YA 2CZCA 3FR8A 4KGZA 5SV2A 3UA3A 3GNSA 4URYR 5TNXA 3B78A 3KXPA 3MMNA 5AKLA 1LQTA 3BCUA 5FADA 2DOKA 1ECFA 4MJ3A 5DNAA 3F6BX 3LYHA 4CQMD 2QP3A 2UZ1B 1G64A 1U4NA 3EVFA 4MI3A 4ENWA 2ATVA 4M2LA 1O6FA 4U6SA 1RVV1 4UAVA 3ZHOA 2UZ4A 4HFMA 5MN6A 3IDAA 4XJSA 4W5JA 5JNWA 5LWHA 2G6BA 4RTOA 2X8JA 3NONA 2RCYA 3P52A 1FE8A 3C7TA 1COZA 2GCPA 4H1VA 4E2ZA 2DWUA 2M6SA 1V8ZA 2PLNA 3AUFA 3O3CA 4KQKA 4ETMA 2VR1A 4WOKA 3S28A 4C5BA 4CL0A 4H1WA 3ONDA 4HRVA 1DMSA 4QC2A 4PPNA 3EPHA 4NHEA 3AHFA 3PQ4A 3HDGA 2PBZA 3QFHA 1UMDB 4OMDA 4ZDJA 4EJSB 1MT0A 3P0EA 4MA0A 1MD9A 3R8XA 4I1UA 3P9RA 3K0EA 2ZI7A 3SXJA 1IUPA 4MPRA 1BE0A 4JVMA 1X92A 1QGOA 2BWJA 3DVRX 1TM1E 4NP6A 4X90A 2YV5A 3TSWA 4DXAA 3DS8A 4MMZB 4WCFC 3BMQA 1DFIA 1KL7A 2FDRA 4Q00A 1L5HB 2Y2VA 3P2IA 1GSAA 3AR9A 4RKEA 4BJ5A 4HF7A 1KK2A 2ZRBA 2RGAA 4MVJD 5ICSA 3N7UA 4U00A 2IH2A 2XDWA 2FSPA 2EDAA 4P3PA 1P9WA 2P75A 3LBAA 1SULA 2A9JA 3GPCA 5C4GB 5BMVF 3TLMA 2HB6A 3TW8A 4DPKA 3ISJA 1K6XA 4M46A 3OJLA 4C3OB 1B73A 3FIJA 3R6GA 5KHOC 2G8NA 1C7FA 5A4FS 1Q0UA 3CNHA 5DRYA 5HIMA 4MVJI 2A7QA 3RV4A 3C48A 3CR3C 2ZZKA 5F77A 3QXJA 1JJVA 3OPVA 3QI7A 4JXJA 1CJBA 4X1IB 2J6HA 3KSUA 2JFWA 3JYNA 3C6YA 2GK4A 4J0IA 3RWBA 3UGQA 4BO0A 3ZVMA 4DKJA 1C0PA 1PS9A 1H2RS 1LFAA 2H18A 3L0YA 1SZCA 1CUAA 3W6PA 4R9UC 4RDHA 5JNVA 3VZDA 1G7RA 5IM4A 5ARCA 2GD6A 3ERCA 1XV5A 5ADVA 4D2IA 5MDHA 4KREA 3GWGA 1R4AA 4MR7A 3RBVA 1MRSA 4FNOA 4RK1A 4UKDA 1LK5A 3K1YA 5ARDA 1BQ4A 3EIQA 1UXOA 3T1HB 4EGAA 1NYLA 3HCDA 2DFDA 4MRRA 3IBYA 4XGNA 1T34A 1XXLA 4LRQA 3T35A 3G8BA 3OC6A 3TKAA 4E09A 4G0OA 4GI1A 3GG2A 4QELA 1WXHA 4KITB 5ALXA 4LVNA 3S7ZA 3DBIA 1FDTA 5IARA 3UMBA 2X2FA 1E6LA 4K2HA 5FUVA 3JATA 3LECA 1YQTA 2WIFA 2OLKA 4IICA 2QRMA 2TRSB 2FEKA 3BGSA 3H1GA 1ZZEA 3CA8A 5FOSA 3TSAA 3BB3A 1QMGA 4KWIA 5TPWA 3V32A 2D5AA 3CH6A 2CVFA 2O3SA 2BRUC 2QX9A 3MJVA 4JGGA 4LN1A 4LYYA 1EQAA 3ZCQA 4B8YA 3I37X 3UM9A 3R5SA 2NXWA 3WLMA 1P2UA 1X8XA 4GI2A 1XNQB 2C9ZA 2ONKA 3QKIA 1CVRA 1M2JA 1S3IA 2WA1A 4W4TA 1Y9DA 2OFOA 1BE1A 3DLPX 4WESB 4M9XA 2ZQ5A 1ZM2A 4FYPA 4LTDA 4OKNA 3RS2A 1KI8A 1GSIA 3HP7A 5C52B 4JVOA 4I55A 4IEIA 2J0VA 5IK2A 1IRXA 1BH2A 2C5AA 3GUCA 4RAQA 2UYYA 2OA0A 4GPAA 4DSOA 1U3TA 3SWWA 3UTCA 3WL6A 1BDBA 3PRKE 1GV0A 2PNFA 4G8BA 5JPCA 3A4TA 5HJEA 1U7DA 2PX6A 3U56A 5JD5A 4ESEA 3EC2A