1U90A

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
molecule tags Signaling protein
molecule keywords Ras-related protein Ral-A
total genus 57
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u90A00
1CRPA 3VR4A 5TVKA 2FX3A 1T9HA 1XCPA 2IYWA 1S3SA 3QVUA 4YMSA 3SJZA 5JECA 1OIWA 1NVVQ 1SVWA 1E32A 3D3QA 4KITB 2OESA 3AM1A 1E2QA 5GVRA 1RYFA 5FTKA 2J59A 1W4CA 1ZIPA 3QPWA 3AF0A 1ZNXA 3FPAA 5CLLA 4BZXA 1XU4A 2ZXUA 2ZVQX 4B3DA 2JJ2D 1UDXA 2R6DA 4G5RA 1KHTA 1QHSA 1JXMA 3AGPA 4M8NE 1EFRD 2Z83A 4AYXA 3I8XA 3U6KA 3B1VA 1ZNZA 2NPIA 3QSYA 1TPZA 1J2JA 3SQXA 2FDCA 3FGNA 2GBLC 1ZU4A 1VIAA 2P6NA 1XMIA 1FPMA 1TUEA 2OFWA 3QY0A 2NG1A 3DHWC 4HLUC 5CJPA 5FR1A 2YNMA 2FOLA 2XNSA 1MOZA 5FI0B 5IDVA 3C15C 1M7BA 2CVFA 3K09C 5BQ5A 4B76A 4PR0A 1FMLA 5CLQA 1OW3B 3QXHA 3UMSA 3M6AA 1YR9A 4CW7A 4C7OB 2GF9A 3THYA 1G5TA 3E70C 5P21A 4PSKA 1F2UA 1II0A 4NYMQ 5J4LA 4XJXA 2W83A 5CITA 3TVTA 2OO7A 4LK2A 3IBYA 1NP6A 1UBFA 2MSDB 3A4NA 4BZQA 3QUSA 1R5OA 1IN5A 2QMHA 3NTUA 3AVYA 1FUUA 4NTZA 2BM0A 4IJMA 1RFLA 4GSYA 5G53C 2ZUBA 4EAQA 4LBYA 3SBEA 3QI2A 5FFMA 1G7CA 3GP8A 1KI6B 3CH4B 2OAQ1 2HJGA 5DNYB 4JLPA 4ITRC 1OXVA 2FN4A 2X2EA 3QBVA 3SJBA 2ZAOA 1EK0A 1HQCA 4GBMA 4A6XA 1CBUA 2ZJYA 3MFYA 5EE3A 1E2DA 3GPLA 4A15A 2EQBA 5FBRB 1P5ZB 2VO1A 1ESNA 3QVVA 1SXJA 4ERNA 2JLSA 5IT5A 5EE1A 4LGMA 1SVIA 3H2YA 2VP5A 1E1RD 4DZZA 2JA1A 3IEUA 4TZ6A 2V54A 2R65A 4JLKA 4MA4A 5A0FA 4MGIR 1U0LA 4Q5IA 4Q4JA 4MGZR 2ZE5A 1G6OA 3K8YA 3OHMA 1OJLA 2YOHA 1CEEA 4IW3B 2GA8A 3AUYA 4TLDA 1OXTA 2G0NA 3RS7A 3LWNA 4GDFA 4FMDB 4MYCA 4QNRA 4GOXA 1F60A 4JLBA 5IRCD 1GKIA 4JSYA 2HLDD 3IILA 4DKXA 5L8VA 2KB0A 4HLCA 4OQXA 2REBA 1DARA 4XSGA 1UDWA 3ADDA 2JIZA 5KDLA 1G4UR 1JNYA 2ZJ8A 4MKHA 5KPJA 4MRNA 4CEJA 2HF8A 2D7DA 1S2MA 2JDIA 1KK1A 4DCSA 1T8UA 1GRQA 1E1RA 1TU4A 3WYFA 5C2JB 2Q9AA 3N2IA 3BORA 4BLRA 5AJYA 2FE4A 2GESA 2D7CA 2BC9A 2DWPA 2PCLA 4FWTA 3GLFB 4LHZA 3G0HA 5DYGA 4PC3A 3W6NA 1G3IA 2YZ2A 4TL8A 4I1VA 3RVBA 3FFAA 4HUTA 4B44A 2G3YA 2GCNA 3K09A 4FD2A 4MITA 3VNUA 1OHHA 2VF8A 4M22A 4AWXA 3THOA 2H1LA 3K0EA 4G5SA 3THWB 3HR8A 1NN3A 3LBIA 4A92A 1W2GA 4JLNA 2ZJ2A 4FIDA 1QVAA 2ZTSA 2YC4C 4TTRA 4EPYA 4H9GA 1VYUA 3LBHA 4ZI2A 4A36A 3BFXA 2A30A 2V7QA 3FMIA 4EPTA 4YONB 3QEJA 3AVTA 3OFND 2B21A 3HP1A 4U5XA 4QKQA 1GIAA 3RS2A 1HH4A 4Z1MD 4B3FX 5FR2A 1HYQA 1YHNA 2QSYA 4CVNA 5AJVB 1MO5A 2CCKA 5GJBA 1E79D 2ERXA 1HT2E 3VU9B 4Q4HB 2VSOA 2PT7A 4G0NA 5KOYA 4LSGA 4AIIA 1XJ0A 3RWOA 3KXLA 1VG9B 5BW8A 2B92A 4A1FA 4OK6A 4B73A 1NG1A 2BKUA 3EZ7A 2IS6A 4NZYA 1DAFA 3KB1A 1X1RA 3H4MA 2EVWX 4HLDA 4Q4AB 2P6UA 3ZZTA 1JECA 2W6IA 1FNNA 3GLFE 3B6EA 3CR7A 2KE5A 4RD2A 2RGGA 4QC2A 2FZLA 4Z8XA 5G3ZA 2WWIA 3AF4A 5FI1B 4CF7A 3A1TA 1W49A 2BBSA 3AV0B 3BAFA 2PBRA 1F5NA 1Z83A 4G5OA 1W0KD 5DLQC 5HCNA 3PR1A 1HTWA 3UWKA 2O8BA 2EU8A 1E6CA 4TL7A 4ZDWA 1FP6A 1M1YE 2RGNA 1QG2A 3P20A 1D6JA 1LF5A 1N6OA 4I1UA 1PVOA 3FMFA 3KQKA 2J7PA 1EFCA 2GEVA 1NJGA 2Q9CA 2IUUA 3UMRA 3W5IA 3X1WA 1YZNA 1LW7A 1QF9A 1KO8A 5JJKA 3I1FA 1T5LA 3KJEA 4LBWA 4B6EA 3I61A 5JZVA 5EP2A 5FL7A 2ZITA 4ZCMA 3TRFA 5KU1A 4CIDA 4BLQA 1GDDA 4BFVA 2D4HA 3TSWA 5FOTA 2PX0A 3MAAC 5HZHA 2N1BA 3DMDA 2ZJZA 3U7HB 4KLZA 2QBYA 2WWFA 4DUGD 3VKHA 1E69A 1OH6A 2J7KA 1W4RA 1XNJA 2Z5FA 1OLOA 1IY0A 4IXMA 1RRCA 3WYAA 2AN9A 3VFDA 2QPTA 3CZPA 4D6PA 2B7CA 2AX4A 1WE2A 1ZC4A 2CNWD 2CJWB 1XX6A 2LCFA 1KY3A 4C0QC 1E98A 1Z22A 4CRWB 621PA 1OXSC 1Z28A 1FFHA 3CF0A 4P4TA 4FMDF 3E5HA 6Q21A 4N0EA 3QIAA 3FHCB 2V8OA 4YMUA 2CCGA 4XVQA 2OT3B 1CR4A 5JWRA 2B8WA 2D06A 3SHFA 5B30A 1A7JA 2IXFA 3LVQE 4UKDA 4BFTA 1O3YA 1SXJC 1JPNA 2F9LA 2DPXA 3PV0A 4EPWA 4PPNA 4Q1BA 1O87A 2YKGA 1ZYUA 1XRJA 1EG7A 1XEWX 2YOFA 4V0OA 3CIOA 3T1OA 5JSZB 1E2NA 4A4DA 2ZUDA 3CO5A 4IFEA 3IO5A 1G19A 1N0VC 4Q4AA 5B57C 1W7AA 1UFQA 1G8FA 8OHMA 1N6IA 2CNWA 2UZ3A 2WAYA 4IDOA 1RKBA 2ZSAA 4QL3A 3TR5A 4DJTA 5JS7A 3VR2A 1NY6A 1KMQA 2ZYVX 2CJWA 2GK7A 4TSFD 2A2ZA 1NJFA 3VX4A 1XCMA 3DEFA 2ZRFA 2ORWA 5BXQC 3KZ1E 3ZZ0A 2V1XA 2P65A 3I8SA 1NY5A 4KCGA 4LJAA 1U98A 1P72A 4K46A 4CEHA 1IXSB 2QTFA 4CT5A 1BMFD 2JGNA 1EX7A 4ZDJA 1AQUA 3UK6A 2J3EA 1KI9A 3A6PC 1SKQA 3DOFA 3ZVNA 5C46F 4EDHA 2ODWA 3I5XA 2VYFA 1U8ZA 1MV5A 4BEJA 4HLQB 3GD7A 2G77B 1N0UA 3TAHA 2JEOA 4ZKDA 3KX2A 1UBGA 4LC0A 2ZYUX 1OH8A 3GLFA 5L3VA 3VAAA 4P31A 4U00A 1IAQA 2QZ4A 3UG6A 1EX6A 1JB1A 3HYTA 2BKEA 4EKDA 1IONA 3NWJA 1LB1B 3OAAD 3S1AB 3VX3A 3T5DA 4G5QA 3GFTA 1II8A 1Q0UA 1ZUHA 2RGCA 4XD7A 3C14C 4GPTA 1R5NA 1UPTA 5EXPA 1P9RA 2BCGY 4PAQA 3K0AA 4URXR 3NH6A 3GLHB 3PCRB 1P75A 3W9YA 4I99A 3TVDA 1US8B 3TUZC 1L4UA 1QG4A 3KFXA 4A2WA 1HEIA 2J0UA 2XTZA 1S9HA 1D9XA 1P2UA 2OSBA 1NF3A 3N70A 2R6FA 1YZKA 4HB0A 4Z51A 4Q4HA 5CYPA 2FNAA 4IVQA 2P2LA 4BFYA 3KKQA 4MKFA 1EFUA 1JAIA 1HA3A 4ACAA 4AG5A 2ZU0C 2C77A 2OCAA 1TF7A 1YRBA 3AP1A 2IYTA 4IDHA 2R6AA 4NONA 5DO9A 5L3SA 2ZRKA 4UNSA 5F3WB 1K5DA 1NG9A 2XXAB 2JJ8A 1KI1A 2YV5A 1VKJA 1M8PA 5H70A 3K9NA 3T34A 1JR3D 3A8TA 3CX7A 3W6PA 5LB4A 1BYUA 4MYUA 821PA 2HJVA 5SZIA 3F8TA 4KHZA 4LUCA 3E2IA 1KO7A 1SXJE 3DO6A 3GJ0A 4NCHA 1AA9A 3UIEA 3NBXX 5FPTA 3R7WA 4URZR 3WBJA 5KTYA 1YR7A 1G7SA 1JJ7A 2WM9B 3OEHA 3TW8B 3KKMA 1US8A 3B78A 4NL4H 3PUVA 2CL7X 1M74A 4KYUA 4P4SA 3VR6A 2YWFA 3CR8A 1JEEA 4RVCA 1KNXA 1RE0A 4Q1FA 2O8DA 2EWVA 3PITA 2C9YA 2PLRA 3L2OB 2WJJA 3QG5A 1UKYA 3SZRA 1M7GA 1OB5A 1CJVC 3W5JA 3QKSB 3IPXA 2GCOB 2QMUA 4XH9B 3K0CA 3MD0A 2QMEA 4YC7A 3SFZA 2X77A 1UF9A 2AL7A 4FN5A 4OBEA 2GAOA 4ZCLA 2DFTA 4Z8YA 3U7EB 4M9ZA 3EWSA 5DE3A 4TYNA 1K8RA 3THXB 3VKGA 2WKRA 1OFHA 4DHEA 4GMDA 2W58A 1X3SA 2GILA 3CNOA 3IGFA 3X2SA 4HAYA 4WIAA 1MRSA 5TY0A 4I4LA 2X1VA 1P7CA 2YC2C 4XTCS 1F2TA 4GRAA 2QNRA 1ZINA 421PA 3LH5A 1G21E 2IYSA 2BMDA 2OCYC 4Q4JB 1GNQA 1QHHB 2Z0MA 3A36A 4AKHA 2ODEA 4XTRA 4DSNA 3VR3A 2GZDA 1VCMA 1NMZA 4DIEA 3CUEF 4JJZA 3BB1A 4QHYA 1W0JD 2ERYA 3AVQA 1NIPA 5HR5A 4YDSA 1KSFX 1S4QA 1BH2A 2BEKA 3KUCA 2NIPA 4DC9A 3WRYC 1E0JA 2QORA 4JS0A 3THWA 1COWA 2DWOA 3SJCA 1G3RA 2QGZA 3VR1A 4JZKA 1TAGA 5ANRB 5C1BA 2KI5A 1YR8A 3KB2A 3PG5A 3LAWA 2EYQA 2IYLD 1DVRA 1U9IA 1Z2CA 5CK4A 2WIAA 3B13B 4A0FA 2XTNA 1X6VA 3X1DA 2ZJ5A 2Z4RA 2PEYA 5DHFA 1ANKA 4KSBA 3KQHA 2ZYWX 1U81A 3Q5DA 4YLGA 4LJ7A 3D6TB 4LC1A 3TK1A 3DZDA 3IQXA 1TL7C 2IEYA 4Q7MB 2O8DB 1YVDA 2D2EA 2FFAA 4PC6A 1NBMA 1RRPA 4C2UA 2D74A 2IS2A 3NIBA 4HAUA 4LYJA 3U6BA 1BYIA 3IKJA 1YZQA 1Z0KA 2ZVPX 4G3XA 2XEXA 3Q7PA 1ZNWA 1QVRA 4JVNA 5AR1A 3QF7A 1A82A 1LS1A 1ZM2A 3BFKA 2NO1A 3MWLA 2ZR9A 1E9AA 1ELOA 3K1JA 3T15A 2WSMA 4L5BA 1FX0A 1W0KA 4JVSB 2I1QA 2WWWA 3SU8A 1G8HA 1EXMA 1XCGB 1N5JA 4OYHA 5EZ6B 3B85A 1OXUA 4CDGA 4QRHA 4EJSA 3ICEA 4YMWA 5KDDA 3SBDA 2VHTA 2IHYA 2PJZA 4TYWA 2VPPA 1DAHA 1KTVA 1KAOA 1G17A 2FJUA 3KTAA 1RVDA 3AVUA 4LWZA 2FFBA 3EIHA 2GAAA 1HUQA 2ZAMA 3SDZA 3LRPA 3VMFA 2G0TA 2GVZC 4XWOA 3EW9A 4JL6A 4ZKEA 3ZQJA 2FSFA 1SVMA 2VP6A 4R2HA 3L0SA 1WRBA 1ONBA 1OXXK 4AKGA 1WXQA 2F9MA 3CNLA 1E1QD 2RCNA 3M4YA 1YR6A 4JT4A 4Z1MA 4DUGA 1X8KA 4JBXA 5FBQB 1GM5A 4EJSB 4L8GA 2EWWA 4PO8A 1S0UA 4NYIQ 4C0KA 2PEZA 3GLHE 1ZVQA 3ZDQA 2GDJA 4IOLA 3ZIAA 5JWHA 2DB3A 1Q22A 4Q18A 1XTRA 2QAGC 1VCIA 3T5GA 3DZ8A 2G1KA 3M1IA 3RS0A 1YJ5A 1T4GA 2GXSA 4PO9A 1Z5ZA 1A2BA 3BBPA 3X1XA 1MO6A 4MYHA 2IYZA 4BASA 2PX3A 1HURA 3OAAA 4ZCIA 2AWNA 1G41A 1BO6A 5UKDA 4PFSA 4IVPA 4RZ3A 4BRWA 5JMTA 5TARA 4B3CA 1DOAA 4YMTA 3L0PA 5E3HA 3R9XA 3RRZA 1E1QA 3HU3A 5AK0A 2GWHA 2PT5A 2EW1A 3D8BA 2BBWA 2OAP1 4JKIA 1C4OA 5H1YA 2J1LA 1CKEA 2WJGA 1RRFA 2O8EB 1GWNA 3B60A 4G5GA 2QP9X 3BH6A 3GLHA 4TLEA 4BGDA 3VKWA 4TTPA 3LXXA 5FPSA 4L4UA 4D25A 1XTKA 4NBSA 2IK8A 4PHTA 3RSLA 5LD2C 4I81A 5D3QA 3QNUA 5CB6A 1SKYE 5DIFA 1ZD1A 3BD9A 3NC0C 3OIYA 3REFA 1FTNA 2CHGA 5IF9A 3I4LA 2ATVA 5AJWA 2PCJA 2F43A 3FYHA 3MWYW 4DB2A 1P6XA 1VDZA 1Z0DA 3F0TA 3BH7A 2IYYA 1R8QA 4FCVA 2VIIA 1NVUQ 2F1JA 3OEED 4G1UC 3NHBA 1IY2A 1N6LA 2IS4A 1Q3TA 5KSPA 3GLIA 3C4JA 4WA7A 3T35A 3TIFA 3Q9LA 5HKKA 2WAXA 4DLVA 5FPHA 1EESA 1W36D 5J5CA 1GNRA 1EWRA 3BE4A 3KTAB 1KIMA 3QF4A 5FOVA 3TUIC 4QM6A 4RKFA 3R7WB 5JJIA 1R2QA 4QOSA 1RPZA 5DYIA 2AR7A 2XITA 1G7TA 4DB4A 3O8CA 3J81k 4MRRA 5DGXA 1NMYA 4MH0R 1E2JA 1VYVA 2DHRA 2XSZD 3THYB 1VPLA 2CCJA 2VBCA 2PJRA 2Q9BA 1DE0A 4NYJQ 1R0YA 2CL6X 3RANA 1QDEA 2IA5A 1DAEA 5FBLB 3W90A 1L7VC 4V0LA 2C9OA 1IY1A 1R0XA 5BYJA 2HXYA 2I4IA 4FI3C 2WSSD 1OHHD 5G41A 2GXUA 5EUMA 2FFQA 4XIGS 2VHUA 3LFUA 2ZJBA 1BOFA 2GK6A 2GNOA 3THXA 2XGJA 4OHXA 4UJ5A 4RKEA 1Q21A 1T3LA 1LNZA 2QMOA 5LD2B 1G1MA 3QF4B 1XFAA 4IEIA 1K5GA 4MKGA 4B74A 2WWYA 4LY6A 4Q9KA 1V5WA 1D9ZA 3WNBA 1P62B 3GEEA 2ZRGA 3LA6A 5FUVA 1VIYA 3I5YA 1IN8A 3RLFA 2PZGA 1AS3A 2NQ2C 3A58B 4M53A 4NDZA 2WJVA 1Q20A 4LZZA 5KNCA 2WWGA 5KSYA 2RGAA 5K8TA 4V0MA 3BB3A 1JBKA 2A3RA 4PZLA 2QQEA 4HAXA 2ZS8A 1E79A 1M6NA 3UG7A 4H1UA 4PX9A 2HLDA 1E9EA 4FXPA 5IK2D 1S9DA 3TJZA 1SHKA 5B58C 1KI7A 4W9MC 4HDQB 4OK3A 2JDID 3AH8A 2IWHA 1KGDA 2O8FB 4D2IA 1GVNB 3NC1C 2G6BA 4PQYA 4Y0AA 1XJQA 1J8YF 1GNPA 2VLIA 3IBGA 4H1VA 4M4SA 4RCZA 4CEJB 1PLLA 1SVSA 3BOSA 1X8JA 5E7MA 4DSTA 5JFGA 4WW0A 5AWFC 2DYKA 4ARZA 3C8UA 3UXMA 4EJSC 2HXSA 5JEDA 2F55A 1Q1BA 5EXSA 3TSOA 5JS8A 4AURA 3WNDA 4RD3A 4B43A 5FBWB 3KJIA 3EXAA 4XD7D 1RJ9B 1P3JA 4F38A 1DAIA 4QFMA 5HE9A 1T0HB 2DBYA 1E0SA 2J7PD 3TAUA 2BEJA 2B8TA 1OH7A 2GZHA 2SHKA 5FL7D 2FF7A 5A5GA 3CW2A 2H57A 1XF9A 2JLQA 1Q44A 4MUAA 2ZSEA 2CLCX 3OIUA 4ESVA 5FTNA 2C78A 2V7QD 4QBGB 4KYIB 3ONWA 5F9HA 2G88A 3OFNA 2WJHA 1IJEA 3LX8A 5JSZA 2JLRA 2QM8A 4LPKA 4C4PA 1ZCBA 2NTYC 1LS6A 1N6HA 4QGHA 4X8OA 1CULC 3KKPA 1W5SA 1PLKA 2IL1A 2IS1A 4UXHA 1KI4A 2BJWA 2IC5A 1TQ4A 3ADCA 1KY2A 1JALA 3KXKA 4OKSA 5EXXA 1MO3A 3U44A 4UXIA 3GJ8A 3NH9A 2VHJA 2C04A 1Z47A 1ZM9A 4B6FA 3ADKA 1W4AA 3TNFA 1YQTA 1G5PA 4HZUB 3B2EA 3MGCA 4JYBA 4KI0A 2QUZA 4KU4A 4URYR 5CDFA 2QAGB 4DWJA 3P26A 4DLUA 5GJWC 4QJ3A 1G5RA 1GTVA 4A8JB 4Z54A 1OKKD 4I1SA 2IF2A 3IO3A 2O8FA 4ZIRA 3U3KA 2HUPA 1YZLA 1TNDA 3GJ4A 4KXFB 1KI8A 4OL0A 5KUTA 4DLSA 1F2TB 1ZC3A 2OBLA 4PHFA 3NVAA 2JCSA 4MUBA 4DXAA 1MH1A 5E95A 5TXGA 2QAJA 4UNPA 4WXRA 1P60A 1KI3A 2OUKA 3AQ4A 3GEHA 4B2PA 221PA 3QKRB 4IDQA 3GJ6A 3SYLA 4EFMA 3R8FA 2ATXA 1E9DA 2C96A 2XZPA 1XBTA 5JEEA 121PA 5H8WA 1T8TA 4RD1A 1SZPA 4BLPA 2ZJAA 1CJKC 3EC2A 5FOSA 4KJZA 4MGKR 1TQDA 5AJZA 3LY5A 3FKSA 4JLDA 2O0HA 4KBFA 1VECA 2J45A 3HPQA 4IDPA 3GLGA 2ZRAA 2ZR0A 3DVLA 3I72A 4V03A 2WOJA 1G8GA 4GOKA 4D81A 1DO2A 3RDPA 4L9WA 1JEDA 1NLFA 2KSQA 2I1VB 1ZUNB 2XB4A 3NG1A 3K70D 3QKSA 1ZP6A 3AB3A 3NBZC 1QHNA 4JKYA 4Q47A 1WCV1 2OE2A 3FE2A 1UKEA 2ZE6A 3IPYA 2VF7A 4KFTA 3NKVA 2ODNA 1PUJA 4Q1CA 5CM8B 3TW4A 1TTTA 3K0CC 3T12A 4F93B 1X1SA 4RY2A 5CJ2A 4RD6A 1WDTA 3FMPB 5CB8A 4PTLA 2O8EA 3PENA 2BMJA 1E9FA 2CE2X 4A2QA 2WVJA 3ZD7A 3NBFA 4BFUA 2XZLA 1NLYA 1FQKA 1LY1A 2XOKA 4NCNA 1AS0A 1NLZA 3GFPA 4Q00A 5M04A 1FW6A 1E0KA 3LNCA 4PAOA 2MSCB 2W6JA 3MRSA 5EP3A 1IN7A 5FBVB 1IJFA 3VTKA 2CMKA 3OF5A 4BLSA 1A1VA 3TH5A 4DRZA 1N25A 1Z29A 2JATA 1RYHA 1XEFA 2G83A 2J0VA 4LJ4A 4RZUA 3FMOB 5LPNA 3U5ZB 3V00A 2F1HA 4LYFA 1G4AE 3K0AB 3AF1A 2CLSA 2AKAB 1HV8A 1BKDR 2GBLA 2F7SA 2VP4A 5HE8A 5D3MA 2ZSBA 4BZPA 1N0WA 5LB2A 2WZQA 3ZZUA 5TMPA 4GP6A 1W4BA 1G8PA 1MABB 4TMTA 4B3BA 1NBMD 2J0UB 1RZ3A 2ZM5A 3AGQA 1XZPA 2IEZA 2PZFA 1LF0A 2XSZA 1KJZA 2NGRA 2WOOA 4AK9A 4OHYA 1KJWA 1XMJA 2W2VA 2P5TB 5E4FA 1FQJA 3PEYA 1CTQA 1PLJA 4Q03A 2AD1A 4HAZA 2XNDD 3O47A 2REOA 2WJYA 3R8CA 1D8TA 4A8JC 4DLYA 1J7KA 2J46A 3Q3JB 2MMCA 1X86B 1CR1A 3DOEA 3L0IB 4TQ9A 4OI1A 4LV6A 2OILA 3RS3A 5CDFE 3HYRA 3RS5A 3BFVA 1VHLA 2QPOA 4XWAA 1RW4A 1G3UA 4URVR 3V4RA 1ZCAA 4TMXA 3U7FB 1RIFA 3CH5A 5FTMA 2DFNA 1OH5A 2B7BA 1QZXA 3ZGXA 4BFSA 1Y3AA 1E2KA 3R20A 3GMTA 4R9UC 4DVGA 4B35A 1Q1EA 1N5LA 1Z07A 4HZUA 5EE5B 2IUSA 3BK7A 3EC1A 1W1WA 2Z43A 3VHLB 2FMXA 2HYDA 1LVGA 1XD9A 4BE7B 4OQFA 3EPHA 4QBIA 4UQOA 3IEVA 2X19A 1XZQA 2WHXA 2XNDA 3CWQA 4JJKA 2IYQA 3EPJA 1QHYA 1Z0FA 4GNKA 4W5HA 5AUOB 4LCBA 2ORIA 2QENA 5BN3A 1AN0A 3CM0A 3ND9A 5KO2A 1D2MA 2IXEA 2OM2A 3NEJA 4R98A 3A1VA 2JJ1D 3EIQA 4LHYA 2QE7A 4JLAA 3WMFA 1Q57A 2JJ2A 4HZIA 2JLVA 1XD8A 4R2IA 3BIFA 2VHQA 4O25A 2QP3A 3PEVA 3WRXC 1CRQA 1EFHA 2GCPA 3OE7D 3DM9B 1W44A 2YHSA 4JL5A 4LJ6A 2CHVA 2CVHA 3HPRA 2BDTA 3DKPA 1G64A 1P4SA 1R10A 3B1ZA 4W5JA 3JVVA 4C7OA 2CLDX 3M0EA 3PVSA 4M9QA 2RH5A 2ZRDA 3ZVMA 4P4UA 2VEDA 5EE9A 2W2TA 3WXMA 4L9SA 3DKVA 3VU9A 2ZRMA 2EFCB 2FG5A 2GJAA 2GXQA 1R7RA 2TMKA 4A9AA 2WJIA 4O3MA 1KDPA 4AD8A 1ZUIA 3UKDA 1F48A 1NL3A 4LYHA 2ZRIA 5SZJA 1AZSC 1NVXQ 3EAQA 5DI3A 3SR0A 1B23P 4TLAA 3PXGA 4B32A 2Z4SA 5C18A 1CF4A 2BMFA 2MSEB 1GITA 3N5CA 2VTKA 3MUFA 2P0EA 1G18A 3OE7A 2AKYA 1XMVA 3K70B 4JVLA 3B1WA 1KDTA 4D80A 2J9RA 2EYUA 4WOPA 1W48A 1AM4D 4Q9IA 2ZREA 1ZIOA 4AKIA 2IWRA 1F6BA 4ACBA 1M2OB 4W5WA 4JT2A 2ANBA 4LHVA 4BFXA 4F4JA 2NOAA 3TLXA 3O8BA 3BH0A 1I4DD 3ECCA 1IXZA 3SHWA 1T6NA 2GF0A 4TYPA 4ZO4A 1SULA 3GFOA 3CF2A 3U44B 2V55B 3LDAA 2A78A 4QGGA 1N6RA 4RD4A 4IVRA 3HU1A 5FUWA 1TF2A 3BXZA 1QRAA 3CX8A 3UATA 2WMOB 3LBNA 1UJ2A 2BBOA 3WHLA 2ODBA 1AZTA 3B8HA 4GL2A 3PIRA 1I4TD 3U61B 2O0KA 2ZRHA 2GEUA 3A1UA 4UNQA 1IM2A 1JI0A 1GAJA 1LFDB 3RSOA 2PH1A 3CLVA 1KAGA 4TYQA 2H17A 4OQMA 3QJYA 4FWIB 1T91A 3G82C 2FV8A 3U2QA 1KK0A 2ZS9A 2J41A 4Q48A 4U02A 4DSOA 5BYKA 4DLWA 3JVUA 2QL6A 2XX3A 5DH9A 1PJRA 4LHXA 2JASA 4TN1A 2OFOA 1U90A 2A5YB 2ZRCA 4LX0A 2ONKA 1EFTA 1TQ2A 2RAPA 1ESMA 4OHVA 1T0JB 4PO1A 2O8CA 1WP9A 2NPFA 1R6BX 4QBHA 3LW7A 3ZH9B 4A82A 2BV3A 4NYIR 3U7GA 1GOTA 5EE0A 3KKOA 4RFSB 3C16C 4R71A 1P61B 3RRMA 4OK5A 2R6CA 3LLMA 4KO8A 3I73A 5L3SB 5KSOA 4R7ZA 4F92B 2XXAA 1ODFA 3SNHA 1VCNA 4LI0A 2P5SA 2QTVB 2XZOA 1C9KA 3OIWA 5AUNB 4B48A 2IYXA 1UEIA 4FINA 4M2LA 4DLRA 3RS4A 2JAQA 4MKIA 4MDFA 2O8CB 3KKNA 1YKSA 4KLNA 2QM7A 4ZDKA 2H16A 4LV8B 3CB4A 3X1ZA 2IXGA 1PUIA 3FWYA 2GRJA 2O52A 3PJRA 5J40A 1GFIA 4IRUB 1GRNA 1VG1A 5H68A 2G1JA 4PAMA 1NI3A 5L3QB 3WP0A 5EJEA 2C99A 3MJHA 1ETUA 4JLMA 3AUXA 3V9PA 3IQWA 3LO5A 3U4QA 1TEVA 3TBKA 5AUPB 4HYYA 1DG1G 1S3GA 5J4HA 3NHAA 4IOMA 1WQ1R 4DLZA 2CE7A 2WPDD 3GJXC 3P32A 4Q21A 1H8ED 4HB4A 3ZVRA 1J8MF 4NKRA 5G3YA 3C7KA 1H8HA 4DT1B 2QEQA 2J0SA 4HATA 3QBTA 2FSIA 1Z3IX 4ZV4A 3JZMA 5GADl 1S96A 4TQAA 4JVMA 4LOAA 521PA 4N3NA 1J90A 1ZRHA 4JLVA 1W36B 2R9VA 4M21A 1FL9A 3CONA 3BS4A 4E22A 2Q3HA 2ZI7A 1J70A 3CRRA 2ZJOA 4D82A 3H86A 4QBFA 3TQCA 4CYMA 4U7DA 3UMFA 1OPXA 3KDSE 5F9FA 2R62A 5AJXA 1NN0A 5BN5A 2YVUA 2RMKA 4IOJA 2IYVA 4Q19A 2X2FA 4HUQA 5HZKA 3A1WA 2KWIA 2OHFA 3FKSD 2JLWA 2IBMA 2FEOA 4A8JA 3CRVA 3CRQA 4FCWA 2LKDA 2V9PA 4RFSA 4M0LA 2PMDA 4AKEA 4M9SA 4HI0E 2ZI3A 3CZQA 4P3YA 1GL7A 4B3GA 1SVLA 1P9WA 4Q7LA 4V02A 2V6IA 1OYWA 3TUJC 1NVWQ 2QRNA 3AEZA 4GOJA 4IXNA 4X8MA 2IYUA 2W0MA 5J4VA 2L0XA 5HPYB 5CYOA 2ANCA 3IHLA 5SZKB 4D0NA 4LJ5A 4IDNA 1XXHB 4C30A 4DCVA 4EQ6B 4V0ME 4IHQA 3ICQB 1TF5A 4Q66C 2AWOA 1R8SA 2ZRLA 2E1RA 1ZNYA 4C0LA 4UXJA 5TDHA 3W8NA 1CR2A 1VG8A 1W47A 2FA9A 3R9WA 1P9NA 1XB2A 4TZ0A 1HE1C 2ZIAA 2A5GA 1R0WA 2F1RA 4MRVA 4QM7A 4F4CA 5JJLA 5SZHB 4PXAA 2HT6A 2RHDA 1L8QA 3AKEA 1FUKA 3B9PA 2ONJA 1AKEA 1U9IC 4E07A 3GLGB 4O0MA 3BERA 3NEYA 2RHMA 1M7HA 2RGEA 2QROA 4DDWA 4QJ4A 3K53A 4OHZA 5KSZA 3FOZA 2FZ4A 3SQWA 3TGPA 1HE8B 1MO4A 5GVSA 5TV2A 4Q9LA 5D3MB 2PZEA 2R6GA 4X8LA 3BJIC 4KAXA 1GRRA 1U2RA 4CT4B 3K0FA 1G3MA 1Z0AA 2H5EA 4LV5B 1D5CA 1BIFA 4D26A 4B3XA 2GHIA 1K6MA 2OBNA 1IN4A 2Z6VA 3Q5EA 4FW9A 5B64A 1XWIA 2A5JA 1KDOA 4HAWA 1OIXA 2J87A 3OEEA 3HWSA 1T5IA 4OQLA 2A7QA 2D62A 3QKUA 4NMMA 3W8RA 1G3QA 4C0JA 5JBQA 2A5DA 2DCUA 2WKQA 4IEEA 3JZAA 5HKKD 4OI4A 2J5XA 1E9SA 2QI9C 1AQYA 1NSFA 4JLJA 4RSGA 4DIDA 1UEJA 1SXJD 3LXRA 4KVGA 3GLIB 5FUXA 1GUAA 1S8FA 2BWJA 4HDCA 2DFLA 3EARA 4XSHA 3RC3A 3GLGE 1Z0JA 4N0DA 1WB9A 4PHHA 4GZMA 5FTLA 1E3MA 1VTKA 3MWJA 5EXTA 2CEAA 4F7WA 1KI6A 1XXHA 4POAA 1X8LA 3KQNA 1KMHB 4HAVA 1JXOA 1W46A 4A2PA 1GP2A 1IOZA 3BB4A 3Q85A 4YDHB 1MT0A 3EG5A 5JRZA 3ZJYA 1Z6AA 4TMKA 2ZROA 4ASUD 2QP4A 3FHOA 1VYTA 3C5HA 3RYTC 4CGZA 4BFWA 3FDIA 4PPQA 1TUIA 2C95A 2UVQA 3OEHD 1RJ9A 2Q0HA 3CPHA 2YJTD 4NE2A 4BWYA 3L82B 1IBRA 4D4JA 1XPUA 5JCZA 3CF6R 3H84A 3GLIE 3VHXA 3RHFA 4URWR 2N42A 2R8RA 1R4AA 4GFDA 2CXXA 1N5KA 5FPKA 3LD9A 2IHBA 1JR3E 3O8RA 1KSHA 3LW8A 4XVRA 2DFKB 4P32A 5K8IA 3U3RA 2OLJA 3EPLA 4Q02A 2IX3A 4NPHA 3IDQA 1IHUA 3CKLA 4E03A 1E9RA 1NIJA 2AD5A 4DBLC 3EIEA 3BC1A 1GG2A 1G9XA 3FB4A 1S1CA 4Y0VA 1HQYE 1QBKC 1Z6GA 2NZJA 3L8YA 4PPGA 3GEIA 2AXPA 5EP1A 3RAPR 1Z8FA 1AGRA 4BQSA 4RD0A 2P6RA 3WMGA 1ZD9A 2X8AA 4K8OA 4P33A 2ZSDA 4YMVA 4RZXA 4G01B 3CPEA 4JSTA 3EA0A 1ZAKA 1OKKA 4XWKA 1Z08A 3O8DA 2G9NA 3FVQA 3L8ZA 1A4RA 1YRAA 4QNMA 4PC7A 4TLCA 4JMPA 3AVXA 1GKYA 2ZUCA 3P1JA 1I2MA 4KFSA 2NZ8A 4JIMA 4S35A 1JR3A 4WZAE 2JLYA 2A5FA 2C03A 1ZU5A 3V4FA 2EFGA 4Q9JA 5J4YA 1XPOA 1QHIA 2F43B 1GL6A 4JYCA 4FMCB 1W0JA 2AXNA 2IW3A 4M1KA 3QXCA 5CIWA 1UAAA 2XB2A 4NU0A 1TX4B 3I32A 3ASYA 2KBFA 2ZI5A 3REGA 4I1OA 3B5JA 1E9CA 2DWQA 3MCAA 2PL3A 1MRNA 3IIJA 5KNBA 4BPBA 3RC8A 3AKDA 3SJAA 4GI7A 4K81B 1KDRA 1TMKA 1FTSA 1AS2A 1OE0A 4DLXA 1N6NA 3SEAA 1RRGA 5EZ5A 1SKYB 2VP2A 2MMGA 3EASA 2NO7A 3B9QA 4LYAA 1YU9A 2HYIC 4NYMR 2NO0A 4KSCA 2QQ0A 1OFUX 4B2LA 2OXRA 2OCBA 2W00A 3K0FB 1Z6YA 2RGDA 1F3OA 1MKYA 4FMBB 2FPLA 2JLUA 4OI2A 4WVFA 1U8YA 1LV7A 4D4KA 4L15A 1NN5A 1DPFA 4ZI3A 4FMCF 4CZ2A 3A4LA 1GILA 2VHCA 3MMPA 1KK2A 4KVAA 4UJ3A 2AFHE 1UBCA 4D4LA 1SVOA 4KFRA 4PSAA 5FH9A 2O8BB 4QHSA 1XXHE 2PLFA 2XOKD 1I2DA 5CIQA 1KZGB 3TKLA 3BRWD 4M1WA 4Q4LA 2GEDA 4C0BA 4NCIA 2VSXA 4QG7A 2D2FA 4Q9HA 5EP4A 1CJUC 5K8UA 2AFIE 2K5UA 1Z63A 4ZDIA 4IOKA 1DG3A 1YZTA 2ECKA 4DDVA 4IFBA 1AJEA 2C5LA 2ZETA 2CL0X 4OHWA 2YINC 4TMZA 1SVKA 1E4YA 1W36C 4B71A 4JL8A 1PZNA 2GXAA 3SYNA 2V3CC 2A9KA 1YE8A 1KKMA 4J0QA 1R5BA 5LBIA 2NO9A 3LX5A 3DL0A 3TSZA 4LJ8A 4CEIA 2FGKA 4C2TA 2BOVA 2ZI6A 1E9BA 3ZS9A 5LDDC 1GSIA 1AGPA 1C1YA 2WIBA 3QKRA 2P67A 3LQRA 4MRSA 4MGYR 3I92A 4PANA 5IHPA 5FL3A 2QBYB 3AVPA 4CEHB 3VNVA 2FFHA 2FU5C 2GZAA 3EZ6A 1UM8A 4JBYA 3SOPA 1KK3A 4DDUA 3U60B 4BFZA 1L4YA 4HSEA 2IT1A 1CP2A 1KSJA 1YZGA 1E2FA 2FPKA 3GJ3A 4NH0A 4PQRA 1E2IA 1TEXA 1JAHA 1H8EA 4IKEA 4A0HA 1FOEB 1XD2A 2JLZA 3QG1A 4PQFA 3OIVA 4BEBA 1NN1A 4TTQA 3LV8A 1VHTA 3PUYA 2V6JA 2QT0A 3T1VA 2ZI9A 5DISB 4GP7A 2ZYTX 3IIMA 1M34E 2FSHA 2IF0A 2VL7A 4TSFA 4JBWA 2BBTA 3NBYC 3W6OA 4DT1A 3C5CA 3P4YA 2LKCA 1NKSA 2OXCA 2CHQA 4QGFA 1P2SA 1KMHA 2FEMA 2H18A 4II7A 3QKTA 5AUQA 4PHGA 1P2VA 4YQFA 1NNEA 2W6JD 5L3QA 4NCKA 2GVDC 4MQBA 1RC8A 3U3JA 3DMNA 1BMFA 4MRPA 4MYTA 1XEXB 1N6PA 2RKOA 3MG9A 4O2RA 4LHWA 2IYRA 4QJ5A 1KYIA 4Q7KA 4E09A 3QQ5A 1ZBDA 2I3BA 1U99A 2QN6A 2XJ4A 1E2HA 4KBGA 2QE7D 2REXB 3B1YA 3TE6A 3F3YA 1WA5A 3AVOA 1ZW6A 4EQ6A 1HY3A 3GCGA 3SE0A 4ESHA 4M1YA 3PEWA 2V4ZA 2QAGA 5KDOA 1FNMA 2DR3A 2WKPA 1G291 4X8HA 4AYTA 1L2TA 3RWMB 1NSTA 3UANA 2XAUA 2AK2A 4ARZB 1ZD8A 5FUYA 3L43A 1KKLA 1QHHA 4KFUA 4LJYA 2WPDA 3W34A 4RZ2A 2KBEA 1N2CE 2RGBA 1JQLB 4B34A 3HR7A 2AHOA 5J47A 3B1XA 1E2LA 1N3BA 4DCUA 2QA5A 1WBBA 5TB5A 3U3MA 2C9CA 5JRJA 2OCPA 4HUQB 2Y8EA 2R2AA 4O2LA 4ZPXA 4TL6A 3SFVA 3KFVA 3EX7C 3AF2A 1CIPA 2OV2A 1VG0B 4RJLA 3D7MA 1Z6TA 4C0SA 1EFRA 1G20E 3H1TA 1KO1A 1J99A 1CU1A 1S1MA 3CX6A 1KZ7B 3MLEA 4GZLA 1QHGA 2C98A 1WF3A 4BLTA 4B47A 4A0GA 1WBDA 2EFDB 1T3SA 4WAUA 5BN4A 3KJHA 1W2HA 2ORVA 3DDCA 4RCYA 1U0HC 1IXRC 1JPJA 2WSSA 1Q1ZA 3IHWA 4QGAA 3ZD6A 1KO5A 2HCBA 4URUR 4WBSA 1V43A 1II9A 1HT1E 1F2UB 2GJ9A 2QRZA 1A5TA 5FTJA 1NKTA 2QY9A 5ELXA 3AKCA 3PUWA 4TT3D 3LVRE 3K9LA 5J4KA 3OZXA 1WMSA 3NXSA 2B6HA 2RB4A 2ZE7A 2ZU6A 3CRW1 5JWOA 2EFHB 4EIWA 2FH5B 2HV8A 5FOWA 5HCIA 4DEXA 1XPRA 1XMSA 4HEJA 4QHTA 4TQUS 4L16A 1TU3A 1CJTC 1JJVA 5EUQB 1E4VA 1XEWY 1VMAA 3MJRA 1CXZA 2OEPA 2WBLC 2E9SA 2YYZA 3WYGA 2BVNA 1JQJC 4WXPA 1E2GA 3GJ7A 2BMEA 4PC2A 4W7SA 4ZIRB 1N6KA 2YWGA 3GQBA 3KXIA 4C3ZA 2P3SA 4C0HA 5F2EA 3T1QA 1U94A 1P73A 4OQNA 4Q7JB 1DELA 2GKSA 3SI7A 4DEYA 5JCPA 4QXAA 4JLOA 1DEKA 4OJKA 3C41J 1OB2A 4XOIA 1SXJB 2ZEJA 3NDBB 4TT3A 5K8LA 3EZ2A 4KV9A 2XJ9A 5JHHB 4NP6A 5F98A 2GJKA 2WWXA 1E99A 4V0NA 1DAKA 1E94E 1OFIA 2R44A 1OSNA 1KI2A 2GCOA 1R0ZA 4DSUA 3KQLA 2F3RA 1VCOA 1W5TA 1CLUA 2ZRBA 1E2EA 1XEXA 3B7GA 2QU8A 4UNRA 3RRYA 4D4MA 1GKUB 3WP1B 1AKYA 3WNCA 2FGJA 3WBKA 3QXJA 5HTKA 3ADBA 2C2HA 5KHOC 3AVVA 3MSXA 5JLJA 3U4QB 1E2PA 1FZQA 3FFBA 4LRWA 2ZR7A 3PFIA 2GTPA 1UADA 5G40A 4EFNA 1CJMA 2WICA 1B0UA 2QTHA 2ZRNA 3G5UA 5JI2E 3ZYCA 3R9IA 1EWQA 1COWD 1Y63A 3EPKA 2QT1A 3SN6A 5KYKA 3A1SA 3W3ZB 2JJ1A 3AP2A 3HJNA 2ASEA 4NHOA 1DAGA 2WTUA 1G6HA 4DCNA 5JI3E 2XTMA 1NMXA 1Z6XA 3LLUA 4PSVA 4WZBE 3P27A 4C9BA 3GJ5A 1XD2B 2CDNA 3PEUA 3Q8XB 4XVUA 1FX0B 5EQTA 3DPUA 1TADA 1XDBA 3D31A 3KJGA 1BS1A 3WHKA 1ZM7A 1SHZA 4Q1AA 3CNNA 5GJCA 3TR0A 3EZFA 2GJSA 4M1MA 3I62A 2F1IA 3IIKA 4M1TA 2ZE8A 3KUDA 1I4LD 3E1SA 5GJVC 3ASZA 4AC9A 1KOFA 1Z0IA 1U0JA 4B33A 4MDEA 2OG2A 3K9HA 4TMWA 1PV4A 5IK2A 4Q01A 3DM5A 2OBMA 4GT1A 1Q12A 2QSZA 4EPVA 5DSZA 2YWHA 4LDJA 3NDPA 4HB2A 2VH5R 2ZSFA 4V0KA 4A6PA 4GMXA 2VP9A 4PPFA 4DDTA 4ABYA 4LJ9A 3W3AA 3CBQA 2F6RA 1P2TA 3PUXA 3PUZA 3RNLA 3UPUA 1H65A 4F91B 2J0QA 1UKVY 2LWIA 1OYYA 3L0OA 2Q6TA 1KJYA 1DS6A 3TQFA 2W0SA 3CRMA 2D3WA 2NO6A 3F5FA 2EFEB 1NBME 1SQ5A 1E0AA 4HB3A 1CS4C 1IN6A 3FTQA 3ND8A 5KPDA 4AY2A 2H92A 1ZM4A 1MR3F 3QXXA 2HT1A 5CM9C 1XTSA 2JIZD 3QOFA 4LBZA 3Q7QA 5JHGB 1Q3HA 5DN6A 1DADA 3MWKA 4TL9A 2BCJQ 5L3RA 3RRNA 5A4JA 4OI0A 3AVWA 4LPSA 3BGWA 3ZS8A 4EUNA 2HCJB 3UWOA 1Q1QA 2Q3FA 4DLTA 4HDOB 2H8KA 1E96A 4B75A 1A2KC 1NVVR 2Q21A 4D0GA 1U8AA 4UNNA 3U3OA 1LTQA 2HDNB 3TMKA 3P4XA 1KNQA 2HEIA 721PA 4EPRA 3AP3A 4M1SA 3K0SA 3Q72A 5CK5A 2ZI4A 4RFVA 1T3HA 4AG6A 2ZANA 2QGNA 2NMVA 3ETLA 4P0TA 4BECA 2C8VA 2HF9A 4TYYA 3EA5A 4M1OA 2OLKA 3B82A 5FPYA 5C4GB 1D2EA 3A37A 2ZRJA 3KQUA 5DN6D 3WMEA 4US0R 2E87A 2RGXA 1II8B 1XTQA 2VRWA 4D0LB 2UKDA 4NYJR 2W2XA 2AK3A 1TQ6A 3A4MA 4US2R 2WWHA 3X1YA 2FWRA 1UKZA 4P4SB 1Z2AA 2N46A 4TWZA 2GETA 3QE0A 1KO4A 4AI6A 5KNDA 4PZZA 2WV9A 4C0AC 4NCJA 1ZM3A 2JLXA 2F3TA 3AKYA 3K9GA 3QEOA 3EZ9A 4M9XA 4N1AA 4S2EA 4F4IA 2ZQ5A 2BIFA 4FCTA 3RABA 3SC3A 3T06B 4ON9A 3T61A 4Q1EA 2KJQA 3LQQA 2CBZA 2BM1A 1OT3A 3SS8A 4KODA 5E7JA 4A0RA 2VP0A 2O0JA 4LBVA 4DCTA 4YXWD 1DTSA 2QPAA 1DO0A 1UBEA 2DY1A 3AF3A 5E7IA 1QHXA 3ZQ6A 4OJQA 5FOUA 4AYWA 3SYKA 2BHRA 1JR6A 1G8YA 3PQCA 2CK3A 2GJ8A 3HDTA 1N5IA 3BWDD 1FMJA 2IUTA 3QXSA 3VR5A 1MABA 2ZRPA 4PZYA 3WY9A 1XTJA 3HU2A 1SGWA 2PMKA 3QPUA 2W6ID 2WMNB 2O5VA 5B2ZA 5BWMA 5DI3B 1DAMA 1GL9B 1Z06A 2UZIR 3QENA 1FP7A 1CR0A 1OV4A 3H0KA 4EPXA 1G16A 1XTIA 2VSFA 4BLOA 3K70C 5FOXA 4ASUA 2H7VA 1KSGA 2V1UA 4CEIB 3CWZA 3ZVLA 4EFLA 2YOGA 1NRJB 3T1TA 4ILEA 2RGNC 3N2EA 1ZMXA 4HLUA 1OIVA 3FHTA 1AIPA 1D2NA 4US1R 5DHAA 4Q1DA 1H8HD 1XP8A 3ZIAD 4TMVA 3ZLJA 3CPJB 1E2MA 3I3SR 3FKQA 1DBSA 2OFXA 4YXWA 1OFTA 1ZJ6A 2OZEA 5DI9A 3EWAA 4WZ6A 4BRUA 2ZPTX 2CK3D 2BJVA 2QG6A 2Q3MA 3IUYA 3S1AA 1AK2A 1GZSA 1IQPA 3KL4A 1YZUA 1G7RA 1EGAA 3QPVA 4PC1A 3OESA 4B2IA 4E5UA 2FPMA 4TLBA 2YWEA 1OF1A 2VQSA 3VQTA 2ZS7A 4BUJA 5C4MA 2FSGA 2VA8A 1XJCA
chains in the Genus database with same CATH superfamily
4EELA 2OQRA 3QFHA 2WIKA 5KKNB 3AHHA 1OWLA 4KPGA 1S3SA 3QVUA 4NXMB 5JS2A 5JECA 4ZQCB 4YRJA 5J2UA 1NVVQ 3ZHQA 4OQDA 2OESA 1DXQA 2C4TA 2I8LA 3T3IA 1E2QA 1Y33E 3OETA 1EGQA 1H0HA 1RYFA 2XVAA 2MWMA 4BYMA 5CFRA 2J59A 2IY7A 1NQTA 4UCFA 1ZIPA 4RKYA 4QQKA 3AF0A 3FPAA 3PB3A 1XU4A 2C3OA 5ELMA 2ZXUA 4I8IA 5CW2A 1AKVA 2JJ2D 3HBMA 4MLCA 1EHCA 1UDXA 1DAOA 1FFEA 2R6DA 4WN3A 4G5RA 5AP9A 5G1NA 1G98A 4S0XA 3RIGA 4M8NE 5EI5A 1SWVA 5LP6B 2Z2ZA 1IPEA 2Z83A 3I8XA 3QFCA 4L5IA 5HS6A 5A6SA 2GBGA 3QSYA 2ZYRA 2RGRA 2ZZMA 1ZCJA 4U5QA 3OZVA 5LQRA 3AEKA 3VPHA 3O83A 4ZVQA 2FDCA 3LGXA 1ZU4A 2J5KA 2WLSA 4L75A 5K0NA 3SXUB 3PX2A 1H1TA 4F4HA 5C81A 5FWYB 3M6FA 4MUYA 2X0EA 2IZ1A 2CHEA 4DF3A 2V7UA 4F5ZA 1MZPA 4TV9A 2HRQA 1NXQA 3M82A 2FOLA 4GLOA 5HKLA 2HW8A 2XNSA 1TE2A 2C84A 5MN5A 3TTSA 1T8WA 4H18A 1M7BA 3SX2A 4YRQA 3SMQA 5KTKA 4F9TA 1OW3B 3HSKA 3MLBA 3AK4A 4BAZA 2JH9A 4ETNA 1E89A 1QKKA 3MIZA 2GF9A 2BFAA 4G0OA 4C7OB 4COOA 3E70C 3MOIA 3O4VA 1SQ6A 3T7RA 1JNXX 4QUKA 4HNTA 1Z2OX 1P19A 2YZKA 4XJXA 5DOVA 2WHQA 3RK1A 5CITA 2R1VB 2C20A 3B9RA 4OLAA 2N9UA 3IBYA 1LW6E 2H2GA 3RADC 1SUCA 3A4NA 1YHYA 3KR0A 4Y6QA 1IUNA 3OLQA 5EWJB 5EWMA 2BTQB 3D3EA 2R8YA 2BM0A 3PFFA 2FEAA 4IXWA 1G8MA 4ESOA 1TIPA 2O2EA 2B7LA 3GP8A 1KI6B 1DIGA 2BFBA 2I6XA 2MDTA 3WOHA 4JLPA 5DNYB 3DEIA 1QM5A 4FSXA 1EK0A 1SPXA 3U7QA 1X38A 5A9RA 3MFYA 3W04A 5ER9A 2EQBA 1X92A 2FQWA 3IE1A 1Y5IA 1B6SA 2IIBA 3L9WA 3VPSA 4EK9A 4HQ0A 3G2QA 3AI2A 1R64A 5AVOA 4F45A 4RTJA 1Q1AA 3RBVA 3CUTA 2QX7A 5KNDH 1J33A 4JROA 5I7EA 2ZIZA 1C14A 3NFYA 1NJSA 4AF7A 5JNSA 2XDQA 1SD2A 2JA1A 2VAPA 3USCS 2RG7A 3O21A 4PLVA 2XIJA 4IZIA 5A0FA 4MA4A 5D6OA 2AEFA 4Q4JA 3ZHBA 4Q5IA 5LKAA 2P11A 2A9PA 4MGZR 3K35A 1RYYA 1SD5A 3K8YA 3HDJA 2RGUA 4CM4A 2ISSD 4IW3B 5EEGA 1JZSA 2EZ4A 3AUYA 5I7UA 2G0NA 1V6SA 4BP1A 4WJLA 1ISFA 3HI4A 2DE0X 2JGLA 4GDFA 4GOXA 1H0KA 2Z57A 2FHSA 3GLVA 2PM8A 3H2SA 4NZOA 5IRCD 1O4WA 4W5RA 3IILA 3T8YA 3R0JA 1IMOA 3QK7A 2RHWA 1T2EA 1ORVA 3H5LA 4RIIA 4OQXA 2REBA 1Q0QA 2ZT5A 4FXOA 1IPHA 2RJOA 5C7OO 2E82A 5KDLA 2Y0EA 1X1EA 2CMGA 2JAWA 3DOJA 3FYUB 3L6CA 4MKHA 2X5NA 4MRNA 4WNIA 3SS7X 3TFOA 3V46A 2HF8A 4HNAA 3ZKWA 5CA1B 4B87A 4RAQA 4GU5A 1DRWA 1GRQA 3BICA 3E4CA 4PRYA 3L40A 3UT5B 3LUPA 4B6RA 1JIVA 4DNFA 2GESA 2O4CA 4XASA 2BC9A 5AVQA 1BCSB 1FNCA 3E3AA 4EX7A 1DIOB 1Q91A 2PCLA 3EXHA 3OIFA 1M33A 3ZWOA 4LHZA 4WY5A 3TZLA 2QIPA 3P0EA 3W6NA 1JEYA 3RVBA 4TL8A 3PQ2A 2QUIA 3FFAA 1L5HA 1OI7A 3A26A 4HUTA 4MUEA 4B44A 2D5IA 2OK7A 2G3YA 2GCNA 3AR4A 3K09A 1XALA 4MITA 5HDBB 1I6WA 4F5WA 2NQ8A 1O9GA 3RVKA 4AWXA 3IAAA 3SIXA 3QV2A 5E7QA 1ZI9A 3OTWA 2UUCB 3RYHB 1B1CA 2VQ3A 3V2HA 1U2QA 4GKBA 4NHEA 1A04A 4A92A 3OCCA 5KJ6A 5L7WA 1X1QA 4F5DA 4P0QB 4ND6A 1R4NB 2VNKA 3RFTA 5BSVA 3WV5A 3LIPA 1XT6A 2HFJA 4TTRA 2GPJA 4FYVA 3K8ZA 4ZK6A 3ASVA 1PEDA 2L69A 3TINA 4A36A 3BFXA 2V7QA 4EMSA 4LDQA 2Y4OA 4YONB 4CODB 2DUNA 3QEJA 1WUJS 3HP1A 4EPTA 5CFNA 3AVTA 3DG9A 3U1BA 3LQKA 4XOUA 4Z1MD 2MJLA 1HYQA 2DHEA 4S0ZA 4Z0NA 3U9TA 1YMVA 1YHNA 2QSYA 3EGCA 4KQ6A 3S7TA 2V5UA 2P9EA 5AJVB 4MARA 4DQDA 2QVBA 4FOTA 1F6DA 2AOWA 2JCGA 2ERXA 1HT2E 2ENUA 2MSNA 4JK3A 4MPTA 1V1MA 1I36A 1TRKA 3MVEA 4G0NA 4H27A 4Q4HB 2PZKA 4NULA 1XJ0A 3KXLA 3FLMA 2G5TA 1KMCA 2WQ6A 1NG1A 1VDMA 4LNAA 5AW6A 1WJGA 4JBGA 3ZJUA 3JR7A 3NHWA 4TSRA 4YRDA 5EQFA 2EVWX 4HLDA 1OFVA 4Q4AB 1RLIA 2REQA 2ZSIA 5KSWB 2PSHA 2P6UA 3L1IA 2GK3A 2H3HA 5IAJA 3SR4A 3RRJA 3UJ7A 2EG5A 3F5QA 2RKBA 4GXNA 6GPBA 2KE5A 2YQ5A 4QC2A 1JTEA 4QREA 3UAVA 2BFPA 2EKDA 3N53A 3RLIA 4IBOA 2VPYA 1HDZA 3ICPA 1C9MA 3CTMA 4UASA 3A4TA 3VNQA 2BYTA 1JIQA 4WESB 4MVJE 2O3TA 1NNUA 3QMMA 3BWEA 4R7GA 5DTMA 5EWMB 5EWJA 4ZOLB 5HCNA 3UWKA 4B4VA 2EU8A 1OTYA 1RADA 4IEFB 4YHHB 1FP6A 1M1YE 2G9ZA 1H1DA 1QG2A 4YUVA 4CM3A 2QW8A 3ROXA 4YYEA 1LF5A 1N6OA 3KIPA 2R7NA 1IQRA 3B38A 3FJYA 2RIPA 1XTBA 3FMFA 3PHCA 4PCAA 2J7PA 4E6EA 3UMRA 1NJGA 3UFBA 3X1WA 3R44A 3KVYA 3W5IA 4AX4A 1GEGA 2Y6UA 1EFAA 2JJQA 1JL3A 4UVGA 1T3TA 2VPZA 1T5LA 1HMPA 3E7DA 3N2NA 2X3FA 3IV6A 3OJLA 3OLVA 3PC2A 4Y0NA 3TX6A 2QLLA 3TRFA 1EVKA 3VU1A 4ZC1A 3UT6A 4OFXA 5KMGB 2HY7A 4CIDA 2HRCA 3R5JA 3PFCA 4BLQA 1GDDA 1KA9H 2KQUA 3BRWA 1V6AA 3PUKA 2PX0A 4RTQA 2AC7A 3DW3X 4OMUA 3RG2A 5HZHA 3DDWA 3JQ7A 3U7HB 3TJMA 4YX9A 4DUGD 2GTHA 1C5KA 1P5FA 1P1FA 1Z25A 2CW5A 2R8OA 5FLXA 3L1UA 4MR7B 4X6LA 1HETA 4IRMA 3DNMA 3D3KA 2GPAA 2Q1TA 4EB0A 2CBGA 3VFDA 2QPTA 1TYAE 5GM2A 2AE1A 4DLLA 3ZLVA 2ODQA 1JYFA 1MU0A 1WE2A 2CNWD 3QX7A 4MTCA 3DO8A 4KIJA 5I4CA 1NJ2A 3JYPA 4C0QC 1JDPA 3NHJA 3LQ1A 1IATA 1Z22A 5HIJA 3PL1A 1OXSC 1YDGA 1FFHA 2PUJA 3CF0A 3IB3A 4P4TA 3GGPA 2IHZA 3UPDA 3QIAA 4DY6A 1WW2A 2NX2A 2F4NA 3EIUA 4XEHA 1H1LA 1CR4A 1HF3A 2OT3B 4NC9A 3TLCA 3VU3A 4BJ1A 3DB2A 4LE2A 3PFWO 3SHFA 4N03A 1A7JA 2IXFA 5B30A 4EM6A 5B3LA 1SXJC 1ODJA 3ZDAA 4GX2A 2ZVDA 4HO1X 3RAGA 1CS0B 1PFQA 2F9LA 2DPXA 3OC0A 3V6MA 2AHRA 1ODKA 2VDQB 3S55A 4ATNA 1EQUA 2YKGA 1ZGJA 3UUWA 1YF3A 2Q7DA 4HQOA 3KVNA 1XEWX 4P2BA 4H1WA 2YOFA 3CIOA 2I2AA 3T1OA 5JSZB 1TTQB 1V2GA 5F5XA 4C4YA 4EW6A 4Z7QB 4ANFA 4EGSA 1N2IA 4UTRA 1TU0A 5A71A 1U2PA 1N0VC 2NPOA 3G0DA 3LX4A 3HUDA 1U2DC 1ZH0A 2UZ3A 2WAYA 3PZRA 4HDKB 1RKBA 3OZBA 5FO1A 4X1KB 3E0XA 3W77A 3ZIUA 5B36A 4YALA 5BXYA 1PX2A 4BX0A 2JBHA 1K27A 1ARZA 1ULTA 4OUKX 5IAKA 4AMZA 2XNCA 3L1KA 3Q7RA 5ALIA 2GK7A 1IYZA 1Z5UA 2YHIB 4AX8A 3PKZA 4HPWA 4LVCA 1LSJA 2ORWA 4KQKA 2CF6A 2WIJA 2NSYA 3C3WA 3LJKA 3N8GA 4XM0A 4ZGWA 3BXOA 2BGMA 3NT5A 3G2JA 3I8SA 2AOUA 1C7IA 1T8YA 1KR2A 3O6VA 4OSPA 4TV8B 5T3UA 3WLNA 1PGQA 1U98A 2BEWB 3M4JA 2XLBA 4L08A 4TXJA 4IKPA 3L8MA 4F86A 4ZYUA 3MTEA 2JFQA 1E5VA 4CF6A 2QTFA 4CCWA 4CT5A 4TVKA 1UC8A 2YYAA 1OBFO 3STTA 2HGZA 3A6PC 4AS2A 2JRLA 2P9HA 4HH3C 3GO4A 4M83A 5G1OA 4BO1A 5H9WA 3FOEC 4N8DA 3PNMA 3I5XA 2AG1A 3ADOA 3WK6A 1WUKS 1KJ9A 1XAGA 2FN3A 1MV5A 3G1TA 3GFVA 4DJJA 1EVYA 1S89A 1XNGA 4FS3A 4HLQB 2XUHA 4G6ZA 4HWGA 4TWRA 4YPFA 3R7BA 4OGFA 2JEOA 3VNRA 4BO0A 3KX2A 1C30A 2ZYUX 4IV5A 5AHOA 3ZY4A 2NXJA 1FS4A 5I7AA 1OD6A 5KTSA 4LG1A 1A5BB 1IB0A 3AJRA 1EX6A 4YAJA 3RTEA 3HYTA 3PGXA 3R41A 4X5OA 2BKEA 2G40A 3DDHA 4O4LA 3L49A 1DWUA 3B7PA 1A9SA 3NWJA 5CLGA 3BXEA 5D7NA 5LA6B 4BDSA 3EZGA 4TT8A 4HQFA 4IZOA 4YS6A 3LT1A 3HBAA 10MHA 3C14C 5JVDB 2QJRA 2QJTA 1PEKE 3BHIA 3D2BA 3CMMA 1MIHA 1P9RA 3DEHA 1AZWA 3G8DA 5EXPA 4PAQA 4WPGA 4URXR 4YCLA 2ILVA 2PK3A 3NH6A 3RB8A 3MYYA 4Q0MA 5FJJA 3TTWA 3WAKA 4EHIA 4EO7A 1K2WA 3A7EA 5IMSA 1N1DA 2J0UA 4O6VA 1J9ZA 1S9HA 4Z51A 4LZLA 2Q99A 2R6FA 4P7BA 1WQ3A 2ZJ6A 2XWBF 1RZRA 2UV8A 3HJGA 2MOKA 3L8HA 1THTA 2P2LA 1V8DA 2HRZA 2IEDA 2OV3A 2V96A 4EA8A 4EEXA 1R6XA 3ZV7A 3UYKA 5K0JA 1J07A 1MB2A 2YXDA 5DO9A 1TF7A 1X7WB 4IDHA 3BE8A 1ST2A 1YBAA 1XNRB 3C7CB 4Y6LA 2XOXA 5LDGA 4TGLA 5JO9A 2QZJA 4PF1A 1JPVA 3OWXA 1BAPA 4RELA 4S24A 3FYUC 5PGMA 3QU9A 1V25A 3T34A 5FI5A 3G2PA 4BVKA 1BYUA 4OXYA 4CE6A 2FE1A 6REQA 2HJVA 821PA 5HHTA 3NX4A 3E2IA 3QOWA 3RUCA 4ARAA 1X1BA 3GJ0A 2VDWB 4GGPA 3UWDA 2Z3ZA 4JI4B 4GSKA 3R7WA 3ICCA 1ITZA 3IV7A 3SS9X 4OH7A 1O9BA 1G7SA 4EYQA 1B2RA 3F7NA 3W7AA 4CV2A 3QY9A 3OEHA 4B3JA 4MAAA 3G1UA 2I76A 2PKQO 3EDOA 4D74A 3W5BA 1RYZA 4J76A 4C3OB 1Q7RA 3AWDA 3PUVA 2TYSB 3DBLB 2GFQA 3OJXA 1VIDA 3IUQA 3ERCA 3P8ZA 3LL7A 3CR8A 1JEEA 1KNXA 2J32A 3WLRA 4Q1FA 4D8YA 2H1HA 3ZI0A 3PQFA 2J5BA 2AFIA 2ETXA 3DWEX 1XCLA 3L2OB 1OB5A 2XQIA 1M7GA 4B6GA 1KZ4A 3IPXA 2XMDA 2ET6A 3I1IA 3IS3A 3K0CA 4KXNA 4YMLA 2PS9A 4YC7A 3SFZA 1Q6YA 3S2ZA 4YT5A 1X19A 2VT2A 2ISCA 2NWQA 3EZYA 1H66A 3NRCA 3R40A 1M5TA 4Z8YA 1QMGA 3VZBA 3THXB 5FADA 4AIRA 4GMDA 1K63A 4MI3A 3AVUA 3WWDA 2W58A 1K97A 1XQYA 2BTEA 4LNHA 4JI5B 3VISA 5FXMA 3X2SA 2WYVA 1E1YA 4WIAA 2NZWA 3NYRA 1RM5A 3P5SA 4A10A 2X1VA 3M5DA 1R37A 3GRCA 3VVMA 4E3WA 1W75A 3OLZA 1HL7A 3LA8A 4B17A 1F2TA 5BVGA 4KE6A 3RJ5A 5J1SB 3RS9A 5KVAA 4Q7EA 1VSTA 4I1RA 3DE5X 1SMKA 3I76A 2QNRA 3DDSA 5C4MA 3C6BA 4UBMA 4D46A 3PC4A 4D02A 1G21E 5C31A 2BMDA 2OCYC 2Q1UA 2WFLB 2IKSA 3SJUA 3A36A 1W581 3OUUA 2EGHA 3T7AA 2P6OA 1CHNA 2VR1A 4OXRA 1GTJ1 1F2VA 3K1AB 3UMCA 1T0UA 1AGXA 1M66A 2J3LA 3DHNA 4JJZA 3A1EA 1FC0A 3OTHA 4O1IA 4OMFG 4H77A 3L79A 1JEQB 2E3JA 4LDAA 4YDSA 4AMYA 4KUGA 2XYRA 2AXEA 1KY5A 3KUCA 4GUDA 2F3QA 2PRYA 3MXOA 5DTQA 5LLSA 1JHAA 4NFHA 2Y68A 4X85A 4YFYA 1COWA 3ZUPA 1HLPA 2JHAA 1W19A 3TTTA 3LECA 1Q50A 3L8DA 1YFKA 1JYSA 3HZRA 3IDFA 4FLMA 4FFSA 3W4IA 4UD6A 2P27A 2EQ5A 4J7XA 1TA0A 1QB7A 3KB2A 3VC1A 3JATB 3BGSA 4ETWA 1QIMA 3LAWA 5C5CA 1DVRA 1U9IA 1Z2CA 2BKLA 3EDYA 4A0FA 5JYBA 4MEJA 2DULA 2XEDA 1GZ3A 1WZUA 2X5JO 1ADBA 3H9GA 3X1DA 2ZJ5A 4DYDA 1Y8RA 1REQA 9LDBA 1U9YA 2D1FA 5LJLA 2XXBA 4B4WA 3I3OA 3QZUA 1HDIA 2GO1A 3C4QA 2OPBA 3Q5DA 3LQ4A 4YLGA 4FD3A 1QGOA 2XKBA 3ANXA 3LY7A 4NAVA 1JHQA 3OZIA 4LC1A 4LJ7A 4UUAA 1E8NA 2UYYA 1TJ3A 3CZRA 1UJCA 3V48A 3YASA 4DA7A 5KX5F 1DLJA 4DMCA 4KDFA 1YVDA 2Z95A 5BNWA 2ZXFA 2BR5A 3A1CA 1A4IA 1GU1A 2WZBA 2Y76A 3DDNA 3G7UA 4R69A 1TDJA 2D74A 2VYND 4HAUA 1PR1A 2IS2A 1XK7A 3LDGA 4LYJA 2OPHA 3D3WB 1CYDA 4TKMA 4HGOA 3T3EA 1QQ7A 3FTDA 4MVJM 5B2EA 2I6GA 2Z6UA 3M2TA 2E4VA 1WXFA 2ZAGA 1MQ9A 4QRIA 3WO1A 4QQFA 4C05A 1P39A 3A0RB 1RZUA 2XEXA 1UMBA 3E82A 5A6VA 3BFPA 5I7WA 1Y37A 1QVRA 2C82A 4I4TA 5LU9A 4X60A 3E48A 1CUGA 2X9LA 5AR1A 1N7IA 3EIXA 3MRVA 3SR3A 1AG9A 4E5NA 1A82A 1CZKA 1S2IA 2XNJA 2A14A 3WL3A 2ZR9A 5CHYA 3N8KA 1HDYA 1FX0A 1ZK2A 4L5BA 3BG5A 3LC1O 3IOEA 3CZAA 1HFEL 4QG3A 4OYHA 5JU6A 4YUZA 1ZQ9A 1EZ1A 4DR1B 2YDYA 1QK5A 4QRHA 3DEKA 2F3PA 4JC4A 1CX9B 1AUPA 1GZDA 3ICEA 4W6QA 4YB8A 5KDDA 3SBDA 2H7YA 3IIEA 3K94A 1E8DA 2O3SA 4ED9A 2NYRA 1JFVA 2VPPA 3A11A 1DAHA 3SX0A 2VS1A 3IR7A 4RK1A 4GVXA 4PZUA 2N3ZA 4R2WA 4WNCA 5EZQA 5C5DA 4ZCPA 2FJUA 4LRXA 6PFKA 4RL6A 1PFWA 1Y7TA 3HO6A 1JEOA 1RWBA 2JFFA 4LWZA 3SDZA 2ZAMA 3FTPA 3HYCA 3LRPA 4UFOA 3EW9A 3C3EA 1J49A 2XUFA 1TZCA 5IT4A 2FW1A 5IANA 1IHDA 1SVMA 4ZOBA 1XRQA 2EIXA 4BHTA 1Q0LA 2WJ3A 2M6RA 4JT4A 1E1QD 4C5BA 4JBXA 1W94A 4KXLA 4F9EA 3AIOA 1N7GA 2IODA 1CDZA 4TX1A 3G2KA 3U48A 4EJSB 4PO8A 3A1DA 4HDSB 3ZJ5A 4C0KA 2AA3A 3AR8A 4ND4A 4QPZA 1QLJA 2OBFA 4JUFA 3SEZA 3ZIAA 2FUEA 2DB3A 1O9HA 3O26A 9ABPA 2HCFA 1T8RA 2G1KA 1XMPA 3NALA 1N36B 2BFFA 2ZUSA 4V3BA 2GXSA 4FOOA 3STWA 4C4XA 2JLAA 1LPSA 3F6SA 1T1EA 3X1XA 3BBPA 2VJQA 4Y1RB 3P2KA 2PQ6A 1SEPA 3WOVA 3H17A 3KLMX 4GC9A 1C0LA 3T9CA 2QSUA 2RGYA 4EA6A 1HURA 1CZNA 1Y1TA 4MB2A 3RSHA 2JK1A 5AW8A 2HU5A 4EHAA 2N47A 1MDBA 2OBXA 4UEWA 4C06A 4NZ9A 4QPDA 4D79A 5DULA 4IVPA 1NSYA 4LMBA 3WLAA 3I9MA 4PFQA 4X7PA 4K86A 5JMTA 4EKYA 5TARA 3ZWKA 4B3CA 3D43A 4EENA 1L9XA 3C48A 3HU3A 3IKVA 2VJBA 3OO1A 4ZT5A 5AK0A 2GWHA 1KDVA 4B79A 4TKLA 4UTZA 5ESDA 3ZV3A 2CHFA 2WM2A 3GEMA 1C4OA 2HQSA 2DG2A 2WDPA 5A3VA 2PLWA 1Y0BA 5AKZA 2WJGA 3NHPA 2O8EB 3DV2A 1DWPA 4ZO7A 1P91A 1POXA 1ZEJA 2X0JA 4L73A 4BGDA 4TTPA 5KIAA 1Y48E 4WFJA 5HK9A 4D25A 4MQLA 3F6CA 1NUQA 5HP4A 3DHVA 4I81A 2EJVA 5D3QA 4CM5A 4MIOA 2J5RA 5EXEA 5DIFA 1Q83A 1ZD1A 3OT1B 1PL8A 2BHLA 3Q1KA 3I4LA 1Q77A 2Z2JA 3AO0B 4Z3OA 1QFZA 4HN4B 2PRKA 2FWBA 1S2DA 1FFAA 3FD8A 1OZ0A 5DNUA 3FYHA 3MWYW 5EWLB 4FE4A 1P6XA 4HTFA 4DB2A 3F0TA 4BGIA 2C7OA 1RIIA 3BSYA 2J48A 3IQHX 4OXQA 1NVUQ 1JDNA 4GYWA 1IY2A 1I5RA 5E38A 2YNMD 3GLIA 4JBLA 3EGXB 1NDUA 1CQPA 2G8NA 2GCGA 5IUKC 2FPSA 3UJ3X 3K5IA 3L8CA 4ZEWA 2V7XA 2FW8A 3DO5A 5AVVA 2ID9A 3AB7A 4RQUA 1WPGA 5DLYA 5J5CA 3FOWA 1CW2B 3EQ6A 4QM6A 2Z2IA 2PX4A 4QOSA 2M6LA 2TS1A 2P69A 5T41A 2V0GA 1R16A 4CL8A 1ODIA 5K2MA 1KH3A 1FUIA 3P9RA 4K9LA 2AR7A 2C2MA 5EMNA 4MGEA 5H02A 5K3EA 4NU5A 3O8CA 3TS1A 1D6SA 2VWPA 2JHGA 3MS2A 4GWKA 5DGXA 4RYDA 4MH0R 1FMTA 2DHRA 1SBZA 1PUXA 3GNTA 1SC4A 1VPLA 1XZFA 2CCJA 4P3KA 2Q9BA 3DOIA 3KOXA 1R0LA 1DE0A 2C94A 4KAFA 5H3CA 4CMKA 4IYRA 2PMCA 2F4VB 5DBOA 5JE8A 1VKRA 3SPXA 4UULA 4BO9A 3MZ0A 4LWQA 5HQTA 2CFSA 2HXYA 4K9OA 4OU4A 3D0KA 3FCUB 1OHHD 3P2JA 3SZ3A 2GXUA 2FFQA 1OGYA 1JEYB 4UREA 3ROMA 4J2TA 1F4LA 3EULA 4DWWA 2JFZA 1BOFA 2GK6A 2Y1DA 4MV5A 3DVQX 2UZ0A 1I7SB 5DGHA 1NFRA 1K0FA 2I34A 4G37A 4AJ9A 1PR5A 1R9NA 1T3LA 1M9NA 1G1MA 4MKGA 1DMSA 3HE3A 2WWYA 3IX7A 2HA7A 2JNWA 5AKHA 3ZWQA 1V5WA 3OA2A 3GWZA 3QVGA 4TUYA 1P4JA 2X8JB 2IPAB 3GWGA 5U1PA 1VIYA 4QOFA 1NM5A 1IQUA 2HRBA 4NDZA 2UVPB 2VXOA 1PIWA 2WJVA 1NBWB 1Q20A 4NBNA 4TMFA 4XKJA 2JVJA 4YRZA 1V5GA 1R9JA 2A3RA 1VIMA 3CY6A 9ATCA 1TUBB 2QQEA 5JATA 5HRUA 2Z6AA 4WD3A 3IAEA 1EB8A 5HM8A 1HDXA 4JYAB 3A9WA 1S9DA 3M49A 4NMWA 3NM5A 5FUQA 1H3FA 5KYTA 3GZ4A 1E1DA 2GN0A 3JPYA 1CZHA 1ODSA 3ENZA 1H2BA 2VT6A 2W4QA 3Q11A 4OK3A 5AICA 5ALKA 3UH0A 5AVTA 4AY3A 3FDXA 4NJOA 4F2PA 5L45A 2ZW9A 3GG9A 4AO6A 4RLHA 2O8FB 1Q0PA 4D2IA 2G6BA 4YHBA 2WV7A 1XJQA 1TFRA 2J3DA 1GNPA 2VLIA 3R5FA 3IBGA 4PYKA 4UBIA 4Z9FA 4JMLA 5JFGA 4K9KA 5ICFA 3UN1A 1W1IA 2YQ4A 1L3IA 3A6FA 4ND5A 1ORRA 3C8UA 3DJFA 3L6BA 3O82A 4M8SA 1GFZA 2HXSA 2QTVA 1KHHA 1J1IA 1WSBA 2RHGB 5JEDA 5EXSA 3F78A 1OBOA 3IPRA 4DFDA 5FHQA 4JQCA 2RC6A 5C1IA 3KJIA 3EXAA 2J5QA 4IAOA 1F1JA 3DL4A 4XD7D 3IMGA 3BF8A 1HQDA 4J0IA 1RJ9B 3GROA 3INRA 1CPYA 2ACVA 2XQVA 1Z4JA 1T0HB 4HC4A 4JB3A 4BJ6A 3QEKA 2DBYA 1E0SA 3SX4A 1NW3A 3GLRA 2HBYA 1OH7A 1K3TA 2ZJ4A 4BBJA 1MJGA 3OLXA 2CB0A 5KNBD 2VTBA 1SOUA 3IDZA 2AVDA 2Q8QA 3QFRA 2HFKA 2OC9A 3LSYA 4OUDB 1Y8QB 1UC4B 2JLQA 2ZSEA 1Q2UA 5LQKA 2ZCUA 4KN5A 2V7QD 3WRWA 1RQGA 3WWCA 3PQ7A 1ISRA 2WJHA 3LX8A 1NONA 2IVFA 3LI2A 3WE7A 2ODTX 3MWEB 1U0TA 4JOQA 2JLRA 2QM8A 4C4PA 3EEOA 1N6HA 4ZCRA 1CULC 3KKPA 3TZ6A 5DVZA 4TUYB 5DM1A 2GS9A 1M2HA 3IP8A 1JU4A 4UXHA 1PK7A 4ZICA 3BMNA 3MJEA 4BQIA 5EXXA 1JALA 4UZFA 1H5NA 1NXVA 3NP9A 1ZO8A 2XNHA 3NH9A 1Z47A 3OP1A 4Z2YA 5C53B 4YJKA 4D0SA 3SHTA 3FUVA 1YQTA 3LCCA 1DBWA 4KQGA 1P17A 3KTFA 2DHQA 2W90A 3R5KA 2QUZA 1V3UA 4JYBA 1JA1A 4FBGA 5LIPA 1QTQA 4DLUA 4J0HA 5AW1A 1VL0A 3EFEA 3ZY6A 2G80A 1BXGA 4DV4B 2H6EA 1GTVA 3I9V6 1LJUA 4A8JB 4ZP1A 4WECA 2WHPB 4I1SA 5B7PA 2BGLA 2GLTA 3MUEA 5GGYA 2WKWA 3CLHA 1XTUA 3GDWA 4KXFB 2VH2A 4BU1A 1A7AA 2AB0A 2Y2VA 3WLTA 2BDEA 2ZUWA 2UDPA 4YWHA 3WLFA 2GYVA 4DLBA 2YIMA 5TJHA 4MUBA 5JC8A 4L8LA 3UB2A 4I9HA 4UAJA 1WDLA 4WCVA 4WXRA 1C7JA 3QEBZ 1M34A 1HFWA 2RE8A 4A03A 3AQ4A 1GKKA 1CRWG 4DNQA 3ZGZA 1JMKC 1NBAA 5F1YA 2PGAA 4IY1A 3ZE8A 3GJ6A 4DKJA 4EFMA 3D81A 4RV5A 2AYZA 4J1QA 2FHPA 2IZZA 4GF5A 3EVDA 4PCUA 4PYOA 4DV3B 5H8WA 1T8TA 1YV9A 4DA9A 4V2IA 1SZPA 4BLPA 3K9CA 5A04A 4G8JA 2NUTA 4M36A 4RXMA 1CJKC 2H4XA 1OI4A 3EC2A 2XRZA 5FOSA 1AGYA 4KMRA 3ZDXB 4AMVA 5FWNA 5AJZA 5BSTA 3LY5A 5T57A 5E8RA 3FKSA 2XF2A 4KBFA 3HPQA 3T9EA 4IDPA 4B09A 2ZRAA 4UE6A 4YV1A 5EPOA 4HBGA 1INLA 3DR5A 2GARA 3OY2A 4REOA 5F2OA 3C5EA 1TIBA 3O3OB 4GGMX 1DO2A 1K75A 1N32B 2GN9A 2JD1A 2XB4A 1PD1A 2OENG 3FIJA 3NG1A 1PHPA 3R09A 4TXHA 3UMJA 5KJCA 2AOTB 4D3YA 2O7QA 4X64B 1GLGA 2Z08A 3IPYA 4EHDA 2ODNA 1TTTA 5CM8B 3GZNB 2D0DA 4EY6A 1HX7A 4C1BA 4F3KA 4KQMA 1HWYA 3GNQA 3M6MD 3O0DA 1WWKA 1RLTA 3WLOA 2G4LA 1Y1PA 3LKVA 3V6LA 2MR6A 3PENA 2BMJA 3V3TA 4YAGA 3DT9A 1FVFA 4NBWA 4ITVA 3ELWA 3LL4A 4EH1A 3NBFA 4BFUA 3A31A 2V9CA 4AJHA 3R7LA 3PTAA 3IA2A 5M04A 1LDEA 3LNCA 1ENOA 4PNEA 3FSEA 4J9VA 1FFYA 2VVTA 3IEIA 4QGBA 5FBVB 4YRLA 1A1VA 3N7UA 3JWIA 3EZXA 4DRZA 5KTMA 3LUCA 4KPUB 3RYIA 4PWZA 3HXLA 5JC1A 4C7BA 1TJ5A 2QD3A 1ZD5A 1I6MA 1UXOA 4RZUA 3WLEA 3HXOA 1MORA 2B34A 3PQ4A 1S2GA 3D3WA 4ZYYA 1BW9B 2QUKA 5HIAA 1NMEA 2AKAB 3QE4A 2VP4A 1CQIA 5D3MA 3PC8A 2XYQA 2O1EA 2XADA 4FYIA 1D6MA 4L7VA 4WCFA 4J6FA 5CR9A 1FZTA 4ER0A 5TMPA 3LLSA 3WSTA 5JMOA 3MAGA 4B3BA 4L28A 1DHTA 2J0UB 4QTUB 1RZ3A 1YQUA 4KQEA 3K31A 1CUJA 1GQOA 2XSZA 3MINA 2H4WA 3HK2A 4OHYA 4OATA 1KJWA 5ITWA 1ZSYA 5CHEA 3RUAA 2GZMA 4XWGA 1A72A 1C1XB 2Q2QA 4UEJA 1U5BA 4Y2RA 5FEMA 4BCBA 2JS7A 1FQJA 1WUYA 1XFDA 2AQ8A 1FSZA 1PLJA 4NH4A 2O8VA 5F51A 5LQUA 4HAZA 3UUFA 2ZXEA 3O8NA 1G2OA 2AMFA 3N8NA 3O47A 5K0TA 4CLRA 5JLAA 4A3SA 3JATA 3T5TA 4WY8A 2WJYA 5AHRA 4BKQA 2M32A 2I4TA 5A3QA 4GMGA 1TMGE 1JE1A 2MMCA 3DOEA 3G59A 4CUZA 3C2QA 1L7DA 3TGPA 2ACWA 3O94A 4LXXA 2B20A 1G3UA 2PUWA 3V4RA 1YR1A 2CFRA 1Q3KA 3W78A 5K20A 2XT6A 1Q1GA 1GPYA 1OYVA 2EERA 1YS4A 4C22A 3ICOA 4AJKA 1L5OA 1NBHA 4I55F 4KQIA 4R9UC 4B35A 2I2WA 4JBHA 2CNDA 1Q1EA 3OPQA 3IELA 4BLUA 3AYZB 4HZUA 3FSRA 1IEVA 4CG2A 4I7EA 1SQGA 2YVAA 3ETNA 5B6JA 3ZTWA 4UUMA 5DX8A 5F1OA 2FMXA 3LK6A 1YTLA 4BE7B 1M10A 4I1YA 2X19A 5ECYA 3VGPA 1GCUA 4LYGA 4QEZA 5FBKA 2DOKA 3WLHA 1QHYA 4RS4A 1Z0FA 4O59O 4X1IB 1ACMA 1O08A 2J6IA 4UFPA 2INGX 5AUOB 3FWNA 1LLUA 2CDRA 2ZTLA 2A1TS 2ORIA 2E5FA 3AR6A 3HKEB 1JR2A 3MTIA 4H7KA 1GGVA 4EW1A 4I55B 1VKNA 5C1OA 3B70A 2DRIA 5BRNA 3NEJA 2Q5HA 4Z4QA 3NAGA 3A1VA 4CKBB 2NNLD 3EIQA 2BGKA 2IZ0A 1RQNA 2QE7A 1E3DA 4GPBA 5I7SA 3TTUA 4CIWA 2ZBPA 4HZIA 1WHTA 4UDOA 3SXPA 5LOVA 1PNRA 4R2IA 2JLVA 4O25A 2QP3A 1XJ5A 2EAUA 2ZJ0A 3PEVA 1EFHA 3DWGA 1SC1A 4M9CA 3ZEIA 4BTLA 4N41A 3A2LA 3OX4A 4M60A 2JFHA 5COAA 3T4PA 2F3SA 1L7BA 4JL5A 5IVPA 2IZ5A 2P9JA 3ULKA 4GMFA 4ZAWA 2BDTA 2WU8A 4Y2PA 4Y6GB 1P9OA 1Z2DA 2HXGA 3AC0A 3DKPA 4IIYA 3UCXA 3V1YA 1P4SA 2GZ2A 3WAJA 1R10A 2PRZA 3VPFA 2WTXA 5JROA 2CLDX 1G6Q1 2XE4A 1FNSA 1UMDB 2NN3C 3ZNOA 4DMGA 1DRJA 4Z7JA 3K2IA 3WGTA 5FLEX 1QAMA 3AUSA 4WRRA 3VU9A 2EFCB 5FRDA 3EXFB 3QWIA 4X1IA 3VJMA 3HXPA 1ECFA 5GP1A 4O3MA 1KDPA 5CB4F 2IP1A 1F48A 4Q24A 4INAA 2IFTA 1KBQA 3NHUA 4LYHA 3K1ZA 2ZRIA 1HBJA 3DGEC 4GM4A 4LI3X 4RPGA 3JWPA 5SZJA 2PKEA 5DI3A 5EMMA 3SR0A 4KREA 4FTWA 4TLAA 2D8AA 4B32A 2IH5A 1LNQA 1XDUA 2BMFA 1GITA 3CGWA 3N5CA 2VTKA 3MUFA 4Y2QA 2P0EA 2O2GA 1WXEA 3FDJA 3F46A 2AKYA 4XRRA 4JVLA 4ALNA 4YYZA 3INNA 4MR7A 2BMVA 2J9RA 2OLEA 1W48A 1WTCA 1YCDA 3P2MA 4N5MA 5TGTA 4BVAA 2JAOA 4CQNA 2JFUA 2R8XA 4RJJA 1LLQA 3N6VA 2WVGA 5IKMA 2YW9A 1SKAA 3NJ4A 4MVJH 4D9EA 1BMTA 2R1UA 1XWWA 2FUNB 4MR8A 5D85A 2P68A 3FPSA 2HI0A 4OHUA 1M5RA 1B6TA 3V1TC 5JR3A 4M7WA 2P0AA 3KQVA 4MVJG 1JF8A 1T6NA 1W52X 2X76A 2CEKA 2OCXA 1B6GA 4TYPA 2B3DA 2GEBA 3LDAA 4E32A 3E8SA 1IBKB 2BI8A 7YASA 1RWNA 3WR5A 3HU1A 3H9QA 1V7PC 4JENA 1TF2A 4EG6A 1BA3A 3STVA 2NNWB 1MG5A 1FYWA 2IXAA 3LBNA 5BOSB 2IJGX 1L4LA 1AZTA 4FJ2A 2XCTB 1TEZA 1GAWA 3NOXA 4AFNA 4LDNA 3NYQA 1QU3A 4IUBS 3RFVA 4UNQA 1GAJA 2VJMB 2XUOA 3S5UA 2PSDA 1RKXA 4V1CI 4MXDA 2WSBA 1K08A 4EUHA 1KAGA 2A9QA 2NO5A 4R01A