1U90A

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Ral-A
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
molecule tags Signaling protein
total genus 57
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u90A00
2IHYA 3A4NA 2FGKA 1Z83A 1FMJA 2GF9A 1KDTA 4PXAA 5BW8A 4L16A 4QHTA 2XXAA 3P20A 1YZLA 2OBLA 2Z4SA 3CRMA 3PENA 2QL6A 4Q1CA 3D8BA 5FL7A 2DR3A 2PLFA 3SYKA 5CM9C 2BIFA 3HWSA 2REOA 1XB2A 2ZI3A 3SBEA 3V00A 2XZOA 3SU8A 4DIEA 4IDNA 1ZIPA 4RKEA 2IW3A 5BN4A 1X8JA 1NN0A 4JLJA 3U6KA 1OV4A 1UADA 1Z2CA 4MRVA 2WSSA 4N0DA 2Q6TA 5D3QA 1G7RA 1IJFA 1LV7A 2EW1A 2G0NA 1U0JA 2O52A 4IDPA 3MSXA 4W5JA 1ZM9A 4PAMA 2P67A 3ADDA 3U7FB 4LV6A 3AVVA 3G5UA 4H1VA 4KBFA 1ZUNB 1KYIA 1PUIA 4LJ8A 4Z51A 4OBEA 3AQ4A 4HATA 2ZS9A 3C4JA 3OFNA 5M04A 3CZQA 1UBCA 1YHNA 3UIEA 3RS7A 4YMVA 1LS1A 3WP1B 1NL3A 4XWAA 4B47A 3OF5A 2J0UA 2H57A 1YU9A 2XTNA 1CR4A 1E2FA 1JJ7A 1AS3A 2OXCA 1W4BA 5DYIA 1XTQA 3DPUA 1JALA 3LVRE 1CTQA 3K0CC 4WXRA 5HTKA 4URVR 3ZIAA 3ICQB 2AXPA 2QQEA 3SFVA 3CLVA 1DEKA 3PFIA 4YQFA 3CPJB 2JLSA 3OIUA 4Q03A 2GILA 2A78A 4JBYA 1P9RA 1MR3F 1M7HA 3OFND 4GZMA 2LWIA 2ZI7A 1KJYA 1TQDA 3CWZA 4ACAA 2GBLC 1ZW6A 1RKBA 1VG0B 1KAOA 2QPAA 1KI6B 1P73A 3AUXA 2G1KA 3DDCA 4QBIA 5GVRA 4O3MA 1XXHB 3WMGA 2NO7A 4JT4A 3U6BA 2JIZA 4P4SA 1KK2A 4JKIA 1G64A 2FWRA 4QRHA 3HJNA 1KI1A 1AN0A 4NONA 3QNUA 4OK3A 1W2GA 3MWJA 5AJXA 3EWSA 4NCKA 3TSOA 1G3MA 1HT1E 1YR8A 3U3MA 4HUQA 3ZD7A 1MABA 1RVDA 1IXRC 5AJYA 2G6BA 3U3JA 1XEXA 2IYTA 1FQKA 4LI0A 5CITA 1XD8A 4HLCA 3LNCA 4KHZA 1FL9A 2O8CA 2Z5FA 4B2LA 1GSIA 4YDHB 4LHVA 4TMKA 1MRNA 3ZZTA 2ZRKA 4HYYA 3VKWA 1AGRA 3Q5EA 4UXJA 2HF9A 5EJEA 2QPTA 3HPQA 4Q7JB 1WBDA 4HSEA 4C0QC 3H1TA 2ZVQX 5CM8B 4WVFA 3RC3A 4WZAE 1NP6A 1XXHE 1H8ED 3TAUA 3KKPA 3DOFA 3TE6A 4MUAA 1EFRA 1CU1A 2MMCA 1YE8A 1XMSA 1RRGA 1XX6A 2ZRDA 4NZYA 3CRQA 4DRZA 3I4LA 4EFLA 4M1KA 4IKEA 2MMGA 3W34A 1FX0A 5KYKA 4IJMA 3H0KA 2F55A 3U3OA 2C99A 3PUZA 3NWJA 1JPJA 3WRXC 3FMFA 1F2UA 3FMOB 3SJAA 1IQPA 5KPJA 1XCMA 4DKXA 2WBLC 3ND9A 4NE2A 4C0LA 2JCSA 3FYHA 4ZI3A 4W5WA 3TVDA 4AG6A 1RPZA 3VX3A 1KKMA 1M74A 5K8LA 4HDQB 3AVWA 2BEJA 1F60A 2N1BA 2C2HA 3MMPA 3VHLB 4C2UA 4LY6A 1OFUX 1P60A 3QKSA 1W4AA 2SHKA 1W46A 4D81A 1OXTA 4JLAA 5HKKD 2KBEA 1W49A 3FFBA 1U9IC 3AKYA 1NY5A 5H1YA 4DLWA 4GZLA 4ESVA 4KYUA 4BWYA 3FKSA 1ZIOA 2J5XA 2QRZA 2FZLA 4M22A 3R9WA 4AY2A 3IQXA 3MFYA 3D3QA 1HEIA 1M7GA 4GBMA 2WMNB 4MRPA 4ZV4A 1JR3A 1E94E 5EP4A 3DOEA 4DLVA 3IQWA 2ZE7A 4BZQA 1OXUA 3N5CA 2FX3A 3OEHA 3ETLA 1AZSC 1UDWA 3RDPA 4B73A 3PEVA 3LW7A 3W8RA 5SZHB 4CW7A 2NMVA 3JVUA 3DZDA 1U81A 4W5HA 3QEOA 1E1RA 1CULC 3BFVA 1GL9B 4MDFA 3QIAA 5JFGA 4XVRA 4A1FA 1KI9A 2VP4A 3BOSA 1UDXA 5FTLA 1Q1ZA 2IWRA 4XTCS 3OE7A 4WAUA 4JJZA 3O8DA 3EW9A 4LJAA 4BRWA 1WF3A 1FTNA 3CRRA 1TF5A 2NQ2C 1I2MA 2OLJA 2VEDA 5DNYB 1QHNA 3CIOA 3MG9A 3QPVA 4DLRA 4ABYA 1N3BA 1PLJA 2ZJOA 2J7KA 2A5JA 4NU0A 2FSIA 5EE9A 5LD2C 1AZTA 5FBVB 1HA3A 3HR7A 1Z2AA 1E2EA 4PPFA 3WMEA 2J9RA 4TSFD 4H9GA 4Q9LA 4EAQA 2OCPA 5G40A 4XVUA 4P31A 1TAGA 3CH4B 3L2OB 1KK3A 4HDCA 1QZXA 3IIJA 4M53A 1KK0A 1M1YE 4P32A 5HZHA 1W36B 2IEZA 3OE7D 1NJGA 1II8A 1W0KA 1D6JA 2AFHE 2KJQA 2FNAA 4PO1A 1P75A 2OFXA 4LPSA 1E2JA 1MO4A 4MRSA 1VYVA 3NVAA 4HLDA 4JSTA 4LC0A 1NMZA 2NZ8A 3QBVA 2V6JA 4WBSA 3QXJA 2IX3A 4TZ6A 3LBNA 4LWZA 4TYNA 2BVNA 4BEJA 3QY0A 5J47A 1GNRA 1ZINA 2XSZA 4RD6A 2JLVA 1QRAA 4MITA 5EUMA 4BFTA 4HUTA 3PEWA 2PEZA 3HYRA 3B85A 5E7IA 1JECA 2AHOA 1N5JA 1SVOA 1VG9B 3U4QA 1NIPA 2P6NA 4BECA 1E2GA 4F38A 4DDWA 1NJFA 5KOYA 1EX7A 2QA5A 1WBBA 3L82B 4DLTA 2ZTSA 3G82C 1BO6A 1U90A 3A1VA 2VIIA 2H8KA 1E2QA 4TWZA 1KO1A 2EFHB 3B7GA 2R44A 4TQAA 4JS0A 1IONA 4AYXA 2OZEA 1VKJA 5FBRB 3K70C 1Z28A 5CDFE 4LHZA 5EXTA 3ZDQA 3A1UA 1IXZA 2GEVA 4DLSA 1F6BA 2VSFA 1E98A 2D74A 3DKPA 3V4RA 2JJ8A 1KZGB 3VTKA 1OH5A 1W0JD 2F43B 2X1VA 4EPRA 4BUJA 4PPNA 1DPFA 1U2RA 4OJQA 1R5BA 4LBZA 2ZRCA 4RZXA 4XSGA 3GLIA 3AVYA 2Q3HA 1T5IA 3NC0C 2F3TA 2IUSA 4Y0AA 3AVOA 2OEPA 1TTTA 1XMJA 3P27A 2KB0A 1L8QA 4GPTA 5BYKA 2Q0HA 1DVRA 1NLFA 2ZE6A 4QBFA 1NY6A 1ZC4A 1QHHB 4A2WA 4Q66C 3TSWA 3X1DA 4DLZA 3KTAB 4IXNA 4ERNA 1G3RA 3T12A 1J90A 2A5YB 2YC4C 2H18A 2NTYC 1SQ5A 1P4SA 3MD0A 2PJZA 3MJHA 1YQTA 1E9FA 1Z0DA 1NBMD 4M4SA 2E1RA 4LZZA 3BFXA 4NL4H 2GWHA 4URZR 2OAP1 4OK6A 4NYIQ 1N0WA 3RYTC 5CK5A 1WMSA 1NVVQ 2CHVA 4V0MA 3SYLA 4NMMA 3ZYCA 2CL6X 1QG4A 5HE9A 3QKTA 3BXZA 2GZAA 1LFDB 1D2MA 5EZ6B 2L0XA 4LDJA 2WIAA 1R0YA 1OE0A 2QNRA 1HURA 5A5GA 5JSZA 1DAGA 2V9PA 3M6AA 3LQRA 1ZD1A 4G5SA 4OQMA 4IXMA 2YOFA 3S1AB 5AUOB 1XD2B 2J0VA 1K5DA 2W2TA 4Q4JA 4ARZB 1XEFA 4LBYA 3DM5A 4MGIR 1VCOA 3FMPB 3RRNA 2NO9A 3KXLA 2W0SA 4AD8A 2ZSFA 4Q9HA 1Z6TA 5EXSA 3TJZA 4W9MC 1YZQA 4JL8A 3K0EA 5CLQA 4HAUA 3SS8A 3P4YA 4A92A 2FDCA 4LYAA 4D0LB 1UEIA 1ZRHA 3P1JA 4RD2A 1Z22A 2RGNC 3QSYA 3QE0A 5E3HA 1GTVA 2P0EA 1UAAA 1DAEA 3U5ZB 1R2QA 4LBVA 4OQXA 1ZNWA 4LGMA 4F4JA 3KJGA 5P21A 1OFTA 2JEOA 2EFEB 3NG1A 4ZPXA 1F2TB 3PXGA 1E79D 3A37A 1E9DA 3TW8B 1E0AA 1G17A 1RE0A 4MYUA 4ZDKA 3KJIA 1ZP6A 1AA9A 4FCWA 3CO5A 3KJEA 3QVUA 4QL3A 2YVUA 4B33A 4QNMA 1XPUA 2P6UA 1TPZA 2G0TA 1ODFA 4R7ZA 1P2SA 1EWRA 3CRVA 3TBKA 4C0HA 4PHHA 1Z07A 2ATVA 5SZJA 2QP9X 2BC9A 4EPXA 4PPQA 4PQYA 4YMUA 2WWGA 1GRNA 3TGPA 1U99A 5DGXA 2FPKA 2ZXUA 1LW7A 3A58B 2GTPA 1MH1A 3QXCA 1AGPA 3EPHA 2RGCA 2F9MA 1E0KA 2WSMA 4DT1A 2WAYA 4CEIB 4IW3B 3VU9A 1WA5A 3PG5A 1BIFA 2YC2C 3KKQA 5FL3A 4CT5A 5F9HA 3MGCA 4LHWA 1Y3AA 3F5FA 5LD2B 1OH8A 1NIJA 4BFZA 1OKKA 2WKPA 1RJ9B 4POAA 2FGJA 1N5IA 4OHXA 1J8YF 2C96A 2QT1A 1TQ2A 1L4YA 3PUVA 3PITA 3L43A 1WXQA 5FI0B 4I81A 1GL7A 3WRYC 2OT3B 3F0TA 1A7JA 5J4HA 3NBXX 4DVGA 4IEIA 5L3QA 5FTJA 5G3ZA 1BYUA 4QM7A 1DAHA 2G88A 2PL3A 5KSPA 3SDZA 1TX4B 3TR5A 3THOA 3GLFB 1D9XA 1YZGA 2O8EA 1S0UA 3SE0A 1P2VA 4LC1A 4YMSA 2ZYUX 4L8GA 2CEAA 5B2ZA 1TEXA 4OHVA 5J4VA 4QGHA 5EXXA 2A9KA 1E6CA 3DZ8A 4ILEA 1SVIA 4GFDA 4B44A 2CXXA 3KB1A 4KFRA 2G9NA 1A2KC 2VH5R 1M8PA 3KUDA 2CVFA 2WHXA 3SJBA 4DLYA 3UWKA 3R7WB 1DAIA 1RIFA 1P9WA 2AKYA 4N0EA 2QAGB 4TL8A 1DO2A 3FGNA 4ACBA 4QJ5A 4QC2A 3SJZA 1S1CA 4L9SA 5FFMA 5FOXA 3BJIC 5EZ5A 1M34E 1RFLA 3K1JA 3RLFA 4X8HA 1ZBDA 3ASYA 5CYOA 3VHXA 4D80A 2EYQA 4BLRA 2AD1A 1OH7A 4GRAA 3KXIA 4QBGB 3GLFE 2PZEA 1EFHA 1KO4A 2GJ9A 4L15A 3X1WA 4UNQA 4PTLA 4TL9A 4ESHA 3KQHA 4CZ2A 4HDOB 2V3CC 3BK7A 4ZCMA 2BOVA 1ZCBA 3VR5A 1G3QA 4RSGA 2X2EA 3FKQA 4TLCA 4A8JC 4Q4AA 1N6LA 5TARA 4C3ZA 2GXQA 2HEIA 4EJSA 3LWNA 4Q02A 3WXMA 2ODBA 3GJ0A 3I8XA 4PR0A 1SVLA 2UVQA 2CLCX 3EZ7A 3IHLA 1E2MA 1O3YA 5JS7A 1VHLA 4HB2A 1ESMA 4RZUA 1ZUHA 4KITB 1FTSA 4URUR 3X1YA 1TQ6A 3FMIA 1E32A 4RD4A 1J99A 1IOZA 1ELOA 3GCGA 1NVXQ 2Q9CA 4NYJR 3U44B 2QMOA 2V4ZA 3LO5A 4AC9A 3AVUA 5JRZA 2HJVA 4RFSB 4BQSA 1OT3A 3BB4A 5C2JB 3CF0A 1TL7C 3MWLA 2IS2A 3NHBA 2OLKA 4IDOA 4QBHA 4ITRC 3RSOA 3NDBB 4PSKA 4GMXA 4ZI2A 1Z08A 3EIQA 4O0MA 4MGYR 1OIXA 1W44A 2YOHA 3AVQA 4BLSA 4CRWB 1IN5A 4M2LA 3L8ZA 4GDFA 1UBGA 4DDTA 5D3MA 2WM9B 1VDZA 1ZAKA 4MQBA 4F92B 4M9XA 4B34A 2F7SA 2QMUA 2LCFA 4TTRA 4QFMA 3PR1A 4H1UA 1OW3B 3RS0A 3QKRA 2IYZA 4KSBA 2HYDA 3WYFA 1SXJA 3CRW1 4M0LA 1E1QD 1ZC3A 4HLUA 3EAQA 3RSLA 1C4OA 1OHHD 3BH0A 3TUJC 4LSGA 4DCUA 1YR9A 4RCZA 3ONWA 4NP6A 2R9VA 3AF0A 2HJGA 1BMFD 3JZMA 2DWPA 3NHAA 3BC1A 1WP9A 2F1JA 1KDOA 1OLOA 3WY9A 1Z6GA 1ZM7A 2NO1A 4HZIA 3EPKA 2I1VB 3LLMA 4HI0E 3QG5A 1SXJD 2WJIA 4JMPA 3F3YA 4PO9A 1K6MA 1S9DA 1E2HA 1SVSA 2FE4A 3U3RA 2UKDA 1E99A 4BFUA 2GEUA 5FH9A 2O8DB 4Q5IA 3LW8A 1D2NA 1L2TA 4CEHB 1G1MA 3HPRA 5E7JA 4IFEA 3BH6A 3RS4A 2CDNA 5H70A 2IUUA 4A2QA 4ZCIA 5K8TA 5K8UA 4QHYA 4MUBA 1W36C 4JLDA 1KNXA 4FWIB 4Q00A 3K0AA 3AGPA 2B6HA 3W3AA 2RGNA 4F91B 4TMTA 1E69A 1CEEA 4TQUS 1GRRA 5DYGA 1L7VC 4IVPA 3ZZ0A 2CCKA 4YLGA 3A1TA 4Q18A 3T06B 1FQJA 1AQYA 1RZ3A 2I1QA 4OI1A 2ZANA 3N70A 3K9GA 1TQ4A 4F4IA 3GEHA 1IN4A 2RGBA 1XTSA 2QEQA 2VTKA 1XJ0A 3NDPA 3BWDD 2ZS7A 2WOJA 2WWWA 3KB2A 4Q1AA 2FFBA 2BJWA 2IYLD 3K8YA 2VRWA 2WPDA 2IF0A 2HT6A 3AKDA 5FL7D 1IY1A 2ORVA 4B74A 1XDBA 4S35A 4D2IA 3B9PA 2PZFA 4M1MA 5DLQC 3K9NA 1E2DA 5B57C 2F3RA 4FD2A 1ZD9A 4YXWA 3BBPA 4TLEA 3W9YA 2Y8EA 2CJWA 2BJVA 2ECKA 3Q9LA 2VPPA 5FUYA 1H65A 3TUZC 2WSSD 3L0SA 4UNRA 5FUVA 1N6PA 2I3BA 5FTNA 1EGAA 3QQ5A 3ZD6A 3CR7A 1Y63A 2C5LA 4B3GA 1Z0IA 2GCNA 5FOUA 1GL6A 3IHWA 2IS1A 2PT5A 2WMOB 3IIMA 2QM8A 2WPDD 2ZRNA 5DE3A 1W7AA 1Z0AA 2GNOA 2ZUDA 3HR8A 4LYFA 1EFTA 4LYJA 5AUNB 1YJ5A 1OIWA 2EQBA 3Q72A 4JLMA 5A4JA 1LB1B 2H16A 3AM1A 1S3SA 2OXRA 4B2PA 4YXWD 421PA 4TL6A 2C98A 4FMBB 2J45A 5FPTA 4DEXA 2EYUA 1PVOA 4B35A 1MO5A 2VLIA 2WIBA 1GIAA 4TYYA 1XRJA 4XH9B 3SI7A 3RAPR 1HV8A 3QG1A 2ZSBA 2NG1A 5AJZA 3ZIAD 2DFKB 2OESA 4AKGA 4AI6A 4JLNA 1P2TA 2E87A 1P5ZB 3O8BA 4C4PA 1NKTA 4CIDA 4Q48A 1NRJB 2GJ8A 1Z6XA 2QY9A 4RKFA 3CNNA 4CYMA 1COWA 3DL0A 1XTRA 1XXHA 1QHIA 4B3FX 5GVSA 3RS3A 4DSUA 3LBIA 3LBHA 2JIZD 5FR2A 2YYZA 3VNUA 4PANA 3D31A 2QTHA 4M1TA 4A8JB 3OEEA 3THYB 1HUQA 4CDGA 3EPLA 1T0HB 2NGRA 4E07A 2KI5A 3UANA 1CJVC 1KDRA 1P7CA 2C03A 1FNMA 3CF2A 1X8KA 4MDEA 1A82A 3GJ3A 3IILA 2AWOA 3ZVMA 1IY2A 2QGNA 3ZS9A 2GAOA 2C04A 2WJGA 2REXB 4AK9A 3FHOA 3SR0A 3QOFA 1Z3IX 4R2HA 4TN1A 3I8SA 4BFXA 4KFSA 1KSGA 4MYCA 2FFQA 4KODA 3OEED 1EFRD 1R5NA 4UKDA 2QP4A 3REGA 1E0SA 2YWHA 2R8RA 3N2EA 4ZKDA 5JWOA 3SJCA 3TR0A 4K46A 3OIYA 1UFQA 2ZJ2A 3VR1A 4FWTA 2QTVB 1QVAA 2ZI4A 3DO6A 4PZYA 1Q12A 2ZREA 2JLQA 1QHSA 1G3IA 4C9BA 5G53C 1ONBA 1NF3A 1CIPA 2Q21A 1P61B 4BGDA 3QPUA 3I5XA 3ASZA 3X2SA 3KQUA 4TZ0A 2ZE8A 4EFMA 4HAZA 2GRJA 4PO8A 2VHJA 4C7OB 2E9SA 2ZAOA 2YWGA 5F2EA 3TKLA 5DI3B 1BH2A 1OXSC 3GMTA 1OIVA 3B60A 2HLDA 1H8HA 4S2EA 3DM9B 4R2IA 4ZKEA 3SZRA 2G83A 5BWMA 5L3SB 2AK3A 4LJ6A 3RRMA 1GG2A 1ZVQA 4R98A 2HXSA 3LRPA 3I32A 2ZI9A 1XEWX 4G5RA 4EQ6B 2Z0MA 4TLDA 2CCGA 2ZSAA 1X1RA 3GJ7A 3ZQ6A 2IYSA 2BCGY 1XBTA 1YZTA 1D9ZA 2O5VA 4V0KA 3EIHA 5L3RA 2J0QA 5L8VA 2VA8A 1E3MA 3FKSD 3KQNA 4MKHA 3I92A 1A5TA 2ODNA 2V1UA 3CPEA 3W8NA 4CF7A 1JR3D 1QF9A 3CUEF 2XZLA 2OFOA 2JDIA 2HLDD 1H8HD 3AEZA 3JZAA 1G7TA 1T6NA 1ZYUA 3OEHD 4DCSA 3NBZC 4MKGA 4MYHA 5H8WA 3KX2A 2WWHA 4XWOA 2GHIA 1G7CA 3EC2A 3LD9A 2BKUA 1E1RD 1Z29A 2W00A 2GK6A 2RGAA 1XMIA 4UQOA 2ZIAA 3THXB 4BLTA 1KSFX 2VF7A 1OFHA 1U8AA 2ZRGA 5DN6A 1BS1A 3GLHA 4OJKA 2B21A 4LJYA 4OL0A 3T5DA 3UG7A 2OUKA 4ZDJA 1R0ZA 2JDID 1QG2A 3OIWA 4JBXA 2AN9A 2BWJA 5DIFA 2BBOA 5C18A 5J4LA 2QI9C 4YONB 2PMDA 821PA 1AKEA 1C1YA 1EG7A 1GNPA 2OFWA 2AR7A 2PCJA 2IWHA 1G8FA 1JBKA 2ZJYA 4GT1A 2FSFA 1AS2A 4YDSA 1X8LA 1G4UR 3VNVA 1CR0A 2W58A 4C0BA 2J87A 4D0GA 4WIAA 3I5YA 5DHFA 4TMZA 1E9SA 1VECA 4TLBA 2ZU6A 5JBQA 1TEVA 4HZUB 1PLKA 5JHHB 4Z8XA 5JLJA 3W90A 3O8CA 1W0KD 1GWNA 1KO7A 3CZPA 2R2AA 1V5WA 2QAGC 4KJZA 4KFUA 1Q1EA 1NNEA 1FUKA 2JLZA 3K09C 5FOVA 2R6FA 3I72A 4KO8A 2QENA 4NH0A 1V43A 4PFSA 3QEJA 3VR4A 3PUXA 1VG8A 2ZM5A 221PA 6Q21A 4C0AC 1XJCA 2ZUCA 2JA1A 4D4KA 1XTKA 1EX6A 1HQCA 3AF4A 3B2EA 1HE8B 3K0SA 2CNWA 2F1RA 3T5GA 4KLNA 2XSZD 1FFHA 4XOIA 4EDHA 3QF7A 3C16C 3L8YA 4CGZA 3VX4A 2ODWA 2Z83A 2ONJA 4EPYA 3W5JA 2IT1A 3B1VA 2RGEA 4XJXA 4NYMQ 4PC1A 1ZU5A 3AVXA 2CE2X 1S2MA 2RMKA 2B7BA 2BV3A 2C9CA 1GAJA 5KSYA 1TF2A 3GJ4A 3SEAA 5DHAA 3ZGXA 2O8BB 3ECCA 2QROA 1ZM3A 5E4FA 3NTUA 3RHFA 3EG5A 1Z0KA 2ORWA 2EWWA 4JLVA 5HCNA 3EPJA 2IXGA 3UG6A 2R65A 2GCOB 721PA 1KI3A 3K0CA 2IYXA 1SKYB 1Q3TA 4KBGA 2GCPA 3MWYW 1IAQA 1A1VA 1R4AA 2WJHA 4IVQA 2F43A 3BRWD 4PAQA 2PLRA 4UXIA 1GKUB 5AWFC 5TDHA 3GLGA 4Q9IA 4ZDWA 3VR3A 4I1OA 2GBLA 2JAQA 1KSHA 1G8HA 3CR8A 4A2PA 1I4DD 2BM0A 5GJVC 4O2LA 2N42A 2H1LA 3T1OA 3LY5A 1N6RA 2O8FB 4DCVA 4ZCLA 4LYHA 4Q19A 1OJLA 4IVRA 3AF2A 4KYIB 1QHHA 3THWB 3H4MA 4DDUA 1NBME 2ZYTX 2FH5B 2JASA 4Q7KA 1XPRA 3KTAA 3KKMA 3EZ2A 4Q9KA 1II9A 1M2OB 2FEOA 2QM7A 1R6BX 3W3ZB 4JJKA 3KFVA 4NYIR 1SKYE 4A4DA 4IEEA 1NVVR 1KJWA 1XP8A 2BKEA 1UM8A 4TMVA 5AJWA 1DS6A 4PHTA 3KXKA 4MRNA 4DEYA 1Q20A 4Q4LA 1U0LA 3CB4A 3TIFA 2NPIA 1VYTA 4KU4A 4ZDIA 3ZH9B 4P0TA 4MH0R 3J81k 4G0NA 1NKSA 2VP9A 1DG1G 4JL6A 4B2IA 1FW6A 5TY0A 5IDVA 4E03A 1JEDA 1F5NA 2VF8A 3PVSA 2Q9BA 5J4KA 2FEMA 1D5CA 2CHQA 2PCLA 3L0PA 4OYHA 3AP1A 3S1AA 4DB2A 1XD2A 4Q7LA 4QHSA 5CLLA 1Z5ZA 3B1YA 3A4LA 4A82A 3I62A 4ARZA 2QORA 3IUYA 2EWVA 1G5RA 2ZSDA 3GFTA 3CH5A 3B13B 3PUYA 3SYNA 2EFDB 4A0FA 4NPHA 4WW0A 3KDSE 1XEWY 1NVWQ 2QGZA 5FOWA 2XNDA 2H92A 1CR1A 4PZZA 2WTUA 3UPUA 1SZPA 2ZEJA 1CBUA 4JT2A 3HYTA 2MSCB 2CLDX 1MO6A 4D0NA 3GFPA 4BASA 4MGKR 3O8RA 1T9HA 2WWXA 4PC2A 5JI3E 2IYYA 3LVQE 4UNPA 2RHDA 4BFYA 2CK3A 3CX7A 2FZ4A 4TYPA 1G8PA 3EC1A 3IBYA 4KXFB 1XF9A 2YHSA 3L0OA 1XCGB 2X19A 3LXXA 2CE7A 1F2TA 1RW4A 2B7CA 3RWOA 1OF1A 4CT4B 1U9IA 4CEJB 3U3KA 2B8WA 5KDOA 2PEYA 3PEUA 1SULA 5JS8A 1J8MF 1SHKA 4PZLA 4II7A 3Q3JB 1E9BA 2REBA 2J59A 1N0VC 3EXAA 4C30A 4RJLA 4DT1B 5KNDA 2HCJB 1NN1A 4X8LA 1OSNA 2QTFA 4PQRA 2PX0A 4DSTA 1PV4A 8OHMA 4KSCA 3TAHA 5JHGB 4BZXA 1P9NA 4MA4A 3WNCA 3AVTA 2IYRA 2D2FA 2ZI6A 3OESA 4A6XA 1G5TA 1EXMA 3ADKA 5TMPA 4KI0A 1CRQA 2QBYB 3CWQA 2P65A 1XTIA 2IS4A 1I4TD 1S4QA 1HQYE 4XIGS 1PJRA 1XNJA 2KBFA 1VIAA 4ASUA 4TTQA 4W7SA 4CEIA 4ZO4A 1T5LA 1GKIA 4JLBA 1ZM4A 1P72A 3C5HA 3A8TA 1DARA 3GJXC 3TQFA 2XB2A 2KE5A 5JWHA 1KMQA 1GM5A 2Z4RA 1DELA 1RJ9A 1KI4A 2FG5A 2V8OA 4TL7A 1UJ2A 5KDDA 3AGQA 1OKKD 3UMFA 2ZU0C 3Q7PA 1R0WA 4LHYA 3FB4A 2C95A 3QENA 4KVGA 4A0RA 2ZVPX 1W5TA 3W5IA 2XEXA 1U94A 4IOMA 3SOPA 3MRSA 2HV8A 1KOFA 1DTSA 4ZIRB 1J7KA 3GLFA 3EIEA 4MRRA 2XAUA 1K5GA 2JLYA 1IHUA 1N6HA 3PCRB 4FCVA 4R9UC 4Q9JA 4FW9A 5KU1A 2EU8A 3QF4B 2RGDA 5AK0A 5FTMA 1FOEB 2QAJA 2YZ2A 4XVQA 1IBRA 3SQXA 1OYWA 4AURA 3LXRA 3NXSA 4F4CA 1NN3A 4FN5A 2H5EA 1XCPA 3EA0A 4OQLA 4RZ2A 3U7GA 3IO5A 3NC1C 4G01B 3R8FA 3M1IA 1CKEA 4LBWA 2W6JA 2YINC 3A4MA 4US1R 4NCJA 4EPTA 1J70A 1NSFA 1LF0A 3G0HA 2QAGA 3QXSA 1DBSA 1US8B 1CJTC 1JAHA 4LUCA 4B3DA 4O2RA 1KMHB 5CK4A 2CL0X 1VIYA 2XNSA 2ZSEA 4PSVA 2ZE5A 4NCIA 3VQTA 2V1XA 2A5GA 1F3OA 4HB3A 3I61A 2X77A 3CM0A 4JSYA 2WWFA 3U7EB 3RS5A 2CLSA 4RCYA 4E5UA 1KZ7B 2GJSA 1UKZA 1FZQA 2RH5A 3IIKA 1G20E 1W4RA 2ZJAA 3BGWA 1Z0FA 2BDTA 1MOZA 2GVDC 2R6AA 3CX8A 4GOKA 4JL5A 5FBQB 1T3SA 1FUUA 1G8YA 2IYVA 4GI7A 4XD7A 5UKDA 3WYAA 2JLUA 1M7BA 3F8TA 4C2TA 1OPXA 2NOAA 3T1TA 2IYWA 2QRNA 4TTPA 3VR6A 3EASA 1B23P 2O0JA 4QGGA 4Q1DA 1XJQA 1KI2A 4URWR 4YMWA 1E96A 3KFXA 1XFAA 1Q1QA 2ZJBA 3WHLA 2DFTA 3CKLA 1K8RA 4Q4HB 1CJMA 3K70D 2PJRA 2GDJA 5SZKB 3KZ1E 4HEJA 4LHXA 3IEVA 3U44A 1G5PA 2H17A 2IL1A 4QM6A 4PHFA 4RFSA 4AYTA 5FPSA 2XGJA 4XD7D 5DO9A 2A5DA 4KFTA 4MKFA 1Q3HA 5BN3A 2IEYA 3KKNA 1XPOA 3OZXA 5FBLB 4QJ3A 3REFA 3RRZA 4EUNA 5GADl 2AK2A 2DBYA 1AJEA 1NSTA 4UJ5A 4WXPA 4N1AA 5BYJA 3WP0A 1VTKA 4JLPA 1E2KA 3WNDA 2GK7A 2VP6A 4DBLC 5FOTA 3NH6A 2DY1A 5FPYA 5JEEA 3GJ5A 1AQUA 1AK2A 2Q9AA 1E2IA 4B48A 3I1FA 3MWKA 1YVDA 5CJ2A 3B1WA 1FP6A 3K0FB 3PEYA 1CXZA 3D7MA 4D82A 3LAWA 1W2HA 2LKDA 4IDHA 4A0GA 2V55B 2RHMA 2OCYC 4DCNA 1C9KA 1M6NA 3TQCA 2VHTA 3PV0A 3QXXA 3K53A 1ZNYA 3E2IA 4B3CA 1MV5A 4LK2A 2XXAB 2WJJA 4GSYA 5FI1B 5HCIA 5EE5B 4RD1A 2XJ4A 2RB4A 2RKOA 2WAXA 1WQ1R 4FMDB 1T4GA 5KSZA 5BQ5A 1OB5A 5C4MA 1S9HA 3L0IB 4PC7A 4PPGA 1SGWA 3E5HA 4UNNA 2V54A 3PUWA 4Z1MA 1OFIA 3I73A 2W6IA 4WZ6A 2LKCA 5FTKA 4PC3A 2O8DA 5E7MA 2YKGA 3DVLA 2ZJ5A 4CEHA 1G6HA 3FTQA 2CMKA 2DFNA 2HXYA 1VHTA 4KAXA 1JAIA 1E2LA 2R6CA 3HDTA 4V02A 3UMRA 2BMDA 4QGAA 3X1XA 3TNFA 1U8ZA 1ZMXA 4DHEA 4AIIA 3TK1A 3K9HA 4E22A 1KNQA 5IT5A 3NKVA 2GXAA 5FR1A 5FUXA 4DCTA 3B9QA 3LQQA 1MRSA 2KSQA 3SBDA 5IHPA 3AP2A 1CLUA 1CP2A 4FMDF 5SZIA 2VHCA 1E4VA 1OB2A 2OCBA 4CVNA 4GP6A 1E4YA 4FCTA 4ON9A 5CIQA 3BIFA 4Z1MD 2W6ID 5B58C 2D7CA 2OBNA 2VBCA 5L3VA 4DZZA 2RAPA 5JJIA 3LFUA 2CJWB 2J0UB 3BS4A 1E2NA 2RGGA 2MSEB 4QKQA 5C1BA 2BM1A 1SVWA 2PH1A 1VG1A 3KL4A 4QGFA 1LF5A 4NCNA 2AWNA 2F6RA 5F9FA 4GNKA 5CJPA 5AJVB 3RWMB 4NTZA 1LNZA 4Q21A 2BHRA 2DWOA 1N5LA 3M4YA 4LJ9A 2DB3A 3EZ9A 4KLZA 4D26A 2GAAA 1NG1A 3CNOA 1RRFA 4NHOA 1PZNA 2P6RA 3AUYA 5JCPA 1G7SA 2QSYA 4GOJA 2D4HA 2ZR0A 2G1JA 2A7QA 2OM2A 4V03A 4NCHA 5EUQB 2WICA 4WA7A 2ANCA 1E9AA 3LX8A 2A5FA 4PSAA 2DPXA 5FBWB 1BKDR 1KK1A 1NLYA 3DMNA 3HU2A 4PAOA 4TMXA 5DI9A 2C77A 1ETUA 4G3XA 3DKVA 4P4SB 2Z43A 4JVMA 4P3YA 5J5CA 1TUIA 3BERA 4DC9A 3O47A 4Q1BA 4RZ3A 1YRAA 4UXHA 3SNHA 3AV0B 4TT3A 1EK0A 2ZR9A 1KGDA 1JB1A 4C0SA 3QPWA 1TADA 4JBWA 3KQKA 2ZR7A 4HUQB 1PUJA 1MABB 3BE4A 4Q47A 3W6OA 5J40A 4B32A 2IS6A 1G16A 3SN6A 3WYGA 4A6PA 1XEXB 1RRCA 4BFVA 3NH9A 4OHWA 2BBWA 3W6NA 3W6PA 1Q44A 5KHOC 2O8CB 2HCBA 1KI6A 3TH5A 2RGXA 4Q7MB 3CONA 2IC5A 3FPAA 4DB4A 1YR6A 4A9AA 2ZRFA 3TLXA 2IYUA 1N6KA 3KJHA 4XTRA 4IOJA 5EQTA 1RC8A 3AH8A 3M0EA 2P5TB 1H8EA 4RD3A 4DLXA 2YWFA 2WJYA 1QVRA 2QN6A 1JXMA 3MUFA 4JYBA 4TT3D 4A36A 2BMFA 3P26A 2D62A 1NVUQ 2K5UA 4GL2A 3MJRA 1OXVA 1OXXK 2VHQA 4KCGA 4DSNA 1XZQA 1Z63A 1NI3A 1E9EA 1KO8A 1FX0B 5IK2A 1UPTA 4GOXA 4G5OA 5K8IA 4I1VA 2OAQ1 4I4LA 3SFZA 1HH4A 1COWD 2GEDA 4L9WA 1R10A 1WE2A 3AP3A 3BD9A 1GNQA 1Q0UA 4LJ5A 2GKSA 2W2XA 1F2UB 3R9XA 5EP3A 2H7VA 4GMDA 2FU5C 5LB2A 2ZRLA 3TMKA 4A8JA 2GJKA 4AKEA 3THYA 3RS2A 5G41A 2N46A 3AVPA 2ZQ5A 4Z54A 3IPYA 4NKRA 1JI0A 1CJUC 5CIWA 2ZI5A 1RYFA 2ZROA 4AYWA 1ANKA 2I4IA 1ESNA 1N0UA 3K9LA 5HKKA 3QKSB 2ZS8A 1N6IA 4K81B 4HAWA 4HB0A 5IK2D 2QG6A 5DSZA 3R9IA 2J1LA 4RD0A 2BBTA 2A2ZA 2IXFA 4TYQA 1UKVY 1KY2A 1OH6A 3T61A 3WHKA 2B8TA 2BMJA 3ZS8A 1PLLA 5GJCA 1I4LD 1N2CE 2GXUA 1KY3A 2NPFA 2BMEA 4QG7A 2JLRA 5E95A 2XZPA 1G21E 4QOSA 4PHGA 4OKSA 3GEIA 1XZPA 4P4TA 4BFWA 1UEJA 1DG3A 4PC6A 4D4MA 1IM2A 2ZRAA 3LDAA 3Q5DA 5HE8A 3E70C 4BLOA 3SHWA 2IUTA 2O0KA 4M1WA 2XOKA 1Z47A 3B78A 4C7OA 2Z6VA 4B75A 4BPBA 5JJKA 5JRJA 5DI3A 5GJBA 1Z06A 1CS4C 2VL7A 2PT7A 5CYPA 1KIMA 1HTWA 5L3SA 3R20A 2QZ4A 3TSZA 2XTMA 5C4GB 2OG2A 2WV9A 1X3SA 2PZGA 3C7KA 4FINA 5G3YA 3SQWA 4AG5A 2X8AA 1JR3E 4EQ6A 4TSFA 2TMKA 2Q3MA 2ZRPA 1OYYA 1YZUA 4DSOA 5BN5A 4HLQB 1S96A 1WCV1 2ERXA 1R8QA 1Z6AA 1S1MA 3IEUA 3WNBA 2A3RA 1G18A 2XOKD 3ZJYA 2AXNA 4M21A 2C8VA 1MKYA 4HB4A 4FIDA 3D6TB 3PIRA 2FN4A 3GLHB 1II8B 2ZRMA 2FOLA 4BLQA 3GEEA 3HP1A 5JECA 3B8HA 4B6EA 4HAXA 1KDPA 3MLEA 2ANBA 2ZITA 5FPKA 2XITA 1YKSA 1UKYA 3AKEA 3TUIC 2XB4A 2WKRA 5F98A 2VYFA 1KHTA 3THXA 5B64A 4I99A 4MKIA 4F93B 3ICEA 1GFIA 3QBTA 4QJ4A 1R8SA 2VP2A 5DN6D 5BXQC 1TMKA 4RVCA 1GP2A 2V7QA 1UKEA 3V4FA 3KQLA 1Q1BA 3U4QB 1GITA 1BYIA 1JPNA 3GFOA 5HR5A 5JJLA 1N6NA 1T91A 3GLHE 4D4LA 4N3NA 3Q85A 1U8YA 4U5XA 5TXGA 3H84A 3ND8A 3ZVRA 3UATA 5CDFA 4YMTA 1Z8FA 5ANRB 3VKHA 3IO3A 2PMKA 2YJTD 1R7RA 1DAMA 1Q57A 3FVQA 2ZRBA 1GKYA 1KAGA 1T3HA 1YZNA 3ZZUA 1W36D 1NLZA 4HZUA 1G19A 2W83A 1TU3A 2WWIA 3B82A 2D2EA 2FJUA 4LPKA 3Q8XB 3CPHA 4BRUA 3FOZA 1TU4A 4A15A 1DAKA 1W0JA 2V7QD 3ZVNA 1DADA 1ZD8A 3AF1A 3CX6A 3DMDA 1S8FA 4EJSC 4PX9A 4TQ9A 1SHZA 2AKAB 3LLUA 4Q1FA 2DWQA 5C46F 3QI2A 3GLIB 2D06A 3SC3A 4BZPA 2KWIA 4R71A 4US0R 2ATXA 2IK8A 5EE0A 3RRYA 4NYMR 1IN8A 1S3GA 3FFAA 4OQFA 3EA5A 3MCAA 3T15A 1RRPA 2NO0A 3RC8A 3FHCB 4D25A 4RY2A 2J7PA 1N25A 4C0KA 2CNWD 2C78A 2HDNB 1E2PA 1N5KA 3N2IA 1XTJA 2JLXA 1NG9A 1G41A 621PA 1W4CA 4TYWA 2B92A 4BFSA 2W2VA 3ADCA 1EFCA 1T8UA 4X8MA 4EPVA 4IFBA 3LX5A 4M9ZA 4BE7B 3GLGB 3VAAA 1JNYA 2GJAA 3JVVA 3P32A 4B76A 4F7WA 4U02A 3U60B 2O8BA 4OI4A 3NEJA 3WMFA 1NBMA 5H68A 3EZ6A 3NIBA 4EPWA 2FSGA 4OHYA 2FPLA 1T8TA 2DCUA 5KO2A 2G3YA 2VP0A 4UJ3A 3UXMA 3CW2A 3ZQJA 1P6XA 2ASEA 2GCOA 3GLIE 4Z8YA 3EX7C 4QNRA 1QDEA 2J7PD 3VR2A 1II0A 4KVAA 3AB3A 4M1OA 3WBJA 5F3WB 2JJ2A 2GZHA 3VMFA 4E09A 5JI2E 1W47A 1AIPA 1SVMA 2FV8A 4DXAA 2GZDA 2Q3FA 3BFKA 1VYUA 2YWEA 3B1XA 5JSZB 2BCJQ 3UK6A 3GJ6A 2CL7X 2J46A 1SXJC 4MGZR 2VP5A 1GILA 2OBMA 4XWKA 2VHUA 3QXHA 4DWJA 2O8FA 4HLUC 3GLGE 1Z0JA 2ZETA 1W1WA 4Q4JB 2BEKA 2ZJZA 4DIDA 3SHFA 1U98A 1Q22A 3THWA 2F1HA 5LDDC 1JQLB 2QQ0A 3BAFA 1FP7A 1EESA 5AR1A 2VSXA 3IDQA 4JKYA 2JJ2D 3LV8A 1LS6A 2D3WA 4IHQA 3UMSA 1X86B 4OHZA 1XD9A 2QE7A 4FI3C 1CRPA 4V0ME 5KUTA 5CB8A 5JMTA 2JATA 4JIMA 4J0QA 2G77B 4AKIA 3C5CA 3IBGA 2QU8A 2OSBA 1JJVA 1JQJC 1E79A 2WOOA 1A2BA 2FA9A 2GESA 3R8CA 1EWQA 4DUGA 2ZJ8A 4IOLA 3A1SA 1LTQA 2AFIE 1A4RA 3AF3A 5FPHA 2FFAA 1KI8A 3B6EA 3T1VA 1GZSA 2C9YA 5LBIA 4NDZA 2HYIC 2ORIA 1KKLA 1YZKA 2IF2A 4P33A 5EXPA 4JVSB 4M1SA 3IPXA 5DH9A 2QE7D 3BH7A 3DHWC 4DDVA 2ZRIA 1IN7A 2J3EA 1Q21A 5EE1A 4LX0A 2IBMA 1UBEA 3HU1A 4I1UA 2CHGA 2R6GA 3U61B 5EE3A 3WBKA 5EP2A 2OV2A 1E0JA 3RVBA 2HF8A 3B5JA 4Q01A 3KUCA 3CF6R 4DUGD 2R62A 1T3LA 2P5SA 3GP8A 2JGNA 4BEBA 1TNDA 3T35A 2DYKA 4I1SA 2XNDD 4B43A 5HZKA 5AUPB 2ZPTX 1WB9A 1J2JA 2ODEA 5JZVA 1HYQA 2QT0A 1YRBA 3A1WA 4WZBE 3RANA 2GVZC 3FWYA 4URXR 1IXSB 2F1IA 5B30A 3VU9B 2UZ3A 2UZIR 4XSHA 5KNBA 2D7DA 2CK3D 1D8TA 2AD5A 4IOKA 4CEJA 2OCAA 1R5OA 4EIWA 3GJ8A 2NIPA 1MO3A 3X1ZA 2QSZA 2WJVA 3MAAC 1DAFA 3T34A 1VPLA 3U2QA 3H2YA 4B6FA 2OE2A 1Z6YA 1BOFA 3CNLA 5JCZA 5JWRA 4HAYA 5KPDA 2JLWA 3C8UA 5TVKA 1FPMA 5CB6A 3BB3A 3OAAA 4IRUB 121PA 4DJTA 1L4UA 5KDLA 5L3QB 2QUZA 1X1SA 3HU3A 2NO6A 3PJRA 4B3BA 1KO5A 1X6VA 1XMVA 4JLOA 5KSOA 4OQNA 1E9RA 2VQSA 2O8EB 2WZQA 2P3SA 3Q7QA 1GUAA 3UWOA 4YC7A 2QBYA 2FFHA 2DHRA 2OILA 2O0HA 2AL7A 4OK5A 2ZAMA 3T1QA 5IF9A 1GRQA 2WWYA 4LCBA 1WRBA 1QHYA 3AKCA 2HT1A 5IRCD 3IGFA 2IYQA 3OAAD 4Q1EA 2AX4A 4ASUD 2CBZA 4LJ4A 1CJKC 2DFLA 3EWAA 1QHGA 3TRFA 2YOGA 1TUEA 1AS0A 4OI0A 1T0JB 3LA6A 4LJ7A 1SKQA 1I2DA 1P2UA 1VCNA 2ZYWX 4TMWA 4IDQA 2ZRJA 1G8GA 1G6OA 3DEFA 2VSOA 1ZUIA 2CCJA 1P3JA 4JLKA 5KTYA 1JXOA 2ONKA 1ZNXA 4O25A 4EKDA 4ZIRA 5GJWC 3VKGA 3QKUA 4JVNA 3PQCA 3R7WA 1E9CA 4G5GA 1FMLA 3P4XA 1EFUA 5DISB 5LPNA 1UF9A 2FSHA 1B0UA 1ZM2A 1HT2E 4Q4AB 1NN5A 1JEEA 4EJSB 3ZLJA 3QF4A 4BLPA 3K09A 1VMAA 4Y0VA 3OIVA 2PBRA 521PA 2EFGA 3A36A 2QMHA 2YV5A 3QVVA 4AWXA 4FXPA 3EARA 4US2R 1KTVA 1UBFA 3GPLA 3C41J 1DOAA 3E1SA 3QUSA 4UNSA 1G4AE 4OI2A 3K70B 2QPOA 5AUQA 4GP7A 3VFDA 2IHBA 1G9XA 2GXSA 2GETA 2W6JD 4D6PA 3BORA 2RCNA 1US8A 3C15C 4P4UA 2JJ1A 4LRWA 4U00A 4C0JA 1CR2A 1IJEA 1U0HC 1KMHA 1RYHA 1ZJ6A 1ZNZA 1KI7A 2VO1A 4LV5B 4B71A 4V0NA 1NMYA 2OO7A 1G3UA 4HAVA 3U7HB 5TB5A 1XWIA 5JEDA 3QJYA 4RFVA 1VCMA 2J0SA 4NYJQ 1QHXA 1D2EA 3FDIA 2IXEA 1JR6A 4D4JA 1CF4A 2OHFA 1W48A 4LOAA 1ZCAA 5HPYB 5D3MB 5FUWA 3C14C 4A0HA 3V9PA 1IN6A 3FE2A 4FMCB 1G291 1GVNB 1NMXA 2JJ1D 1KJZA 1F48A 4NBSA 4QXAA 2BBSA 1W5SA 3H86A 2FF7A 1IY0A 1DE0A 2IA5A 3QKRB 4V0LA 1GDDA 1SXJB 1E1QA 3OHMA 1LY1A 2NZJA 3GD7A 1OHHA 4X8OA 3TVTA 3ZVLA 1LVGA 4Q4HA 5TV2A 1HY3A 4L5BA 4URYR 4JVLA 2ERYA 5LB4A 2FMXA 4PQFA 1BMFA 3UKDA 3CBQA 1MT0A 1N6OA 1O87A 2P2LA 1AKYA 2QMEA 4EFNA 2GA8A 1QBKC 1WDTA 4JZKA 4M8NE 4WOPA 4FMCF 5A0FA 2ZRHA 3KKOA 3ADBA 3B1ZA 2J41A 4M9QA 1P62B 2R6DA 2WVJA 3RABA 1YR7A 4AKHA 2CVHA 1GOTA 4KV9A 2ZYVX 4M1YA 5ELXA 3RNLA 3A6PC 2FPMA 2EFCB 4G1UC 3GQBA 4U7DA 5J4YA 4B3XA 1DO0A 2XX3A 1XU4A 4K8OA 4V0OA 4M9SA 2YNMA 1SXJE 4G5QA 4L4UA 2W0MA 1AM4D 2PX3A 1HE1C 4DLUA 1FNNA 3LH5A 3NBFA 1ZU4A 2C9OA 2GF0A 3NBYC 2XJ9A 3I3SR 2V6IA 2F9LA 2XTZA 1KSJA 2MSDB 2HUPA 3K0AB 1SVKA 5EP1A 3TW4A 3K0FA 3FHTA 1VCIA 5KNCA 4TLAA 4LV8B 4JYCA 1TF7A 3EZFA 5FOSA 3BB1A 2X2FA 1R0XA 3IKJA 2QP3A 2WKQA 4MYTA 2ZUBA 3NEYA 2A30A 2EVWX
chains in the Genus database with same CATH superfamily
2IHYA 1GG5A 2FGKA 1UK7A 3E2PA 3WX0A 1Z83A 1GUZA 2NV0A 2GF9A 1AHHA 1NX6A 2OKGA 1O08A 1CLEA 1QVVA 4WKCA 5BW8A 2G7ZA 2QWXA 4N9QA 3EWNA 4ZQCB 4OQZA 2I33A 3UJ7A 1J5PA 2QL6A 4QOFA 5EN4A 1G63A 5CLGA 3RC7A 1NM5A 3SYKA 3DL2A 2A4MA 2G07A 5CM9C 1JN0A 4ZC8A 4LDQA 5CFRA 5JZBA 1GDHA 1XB2A 3SBEA 1YJCA 5KNCD 2XZOA 1VL8A 5CU7A 1P6QA 4GRIA 3SU8A 4DIEA 1ADGA 1GPJA 4MYSA 5I6DA 1QO9A 1MMFB 4N48A 1PR3A 1YI8A 3ANYB 1NN0A 4JLJA 1TZKA 4BQEA 4CMBA 4EJMA 4MRVA 2ODPA 5LLSA 2XUIA 3CV3A 1IJFA 1G6Q1 1U0JA 3V2GA 3MSXA 2C7VA 5BR4A 4Y0NA 3D02A 4G86A 2YFKA 4ZVUA 3RE1A 1N3IA 2XNCA 3U7FB 1THMA 3I9V6 3LCMA 3G5UA 3L5KA 4IXWA 4NXMB 3UWPA 4HGNA 4KBFA 1DRJA 1AT1A 1ZUNB 5TMBA 4PZ9A 1ZIYA 1NP7A 2PT6A 4LJ8A 3B7PA 4H4DA 4O4LF 3DBOB 4OFWA 1L5QA 2KX7A 3C4JA 3KYCA 3OFNA 4TYMA 2XKKA 1UBCA 1YHNA 4IHJB 1TZ2A 3RS7A 4K9MA 2I4MA 3L7LA 4KXUA 1NUQA 3KB8A 5ALXA 4XDYA 1E8DA 2ZUSA 3ABIA 4DY6A 1XKQA 4LMRA 1CR4A 1JJ7A 3MT9A 4KB5A 4X1IB 4WBNF 1AS3A 3SKYA 4E5VA 2JFQA 3N58A 4UAGA 1HDXA 1N7GA 2EX4A 3OCYA 3HI6A 4RMHA 1UIRA 2VPTA 1TXGA 2Y99A 3DPUA 1U6KA 4M37A 5HSGA 3KTFA 1D1SA 3UICA 1EUCB 1XRSB 1QX4A 1XTTA 2QQEA 1PQWA 3GIDA 4J75A 2OHJA 1DEKA 2I6FA 3BZWA 1NZJA 4N0QA 4B7ZA 2QJRA 3UMVA 3W78A 4YQFA 5IYZB 4QUKA 1L7NA 1RBQA 2A78A 2PX5A 1OWPA 1VI2A 2AR9A 1XQVA 1QQBA 1M7HA 2PZAA 2Q5EA 3ZW7A 3EF0A 2XGOA 4TKVB 2OFPA 4R51A 2PH5A 1HSOA 3F5QA 3JQFA 4GX1A 1KHHA 2GBLC 4C29A 4WDRA 1EVIA 2BKVA 4YAIA 1W93A 1KI6B 1XTUA 3AUXA 3DDCA 4QGBA 1C0EA 1EVQA 3JTMA 3KT6A 4O3MA 1XXHB 4J2HA 2W7TA 2X7HA 1PL8A 1N9GA 2JIZA 4DQDA 3A4YA 1JLHA 1JYEA 2J33A 1UQRA 2VQDA 4JJIA 3ENKA 1EYZA 3HJNA 3A2MA 3O1JC 1U7UA 1W2GA 3QVSA 3FUVA 2V7XA 3TSOA 1EDZA 3KEQA 4XOUA 2QIPA 3U3MA 4BNFA 4FGJA 1MABA 1K6JA 2AMYA 1TYDE 3S44A 5AHWA 2G6BA 3KPVA 4XIYA 4H59A 1XEXA 2C61A 3NTXA 1ESDA 4LYEA 3A4TA 2XMPA 1ZMRA 1FL9A 3DB2A 3KWFA 3NORA 3ZCUA 3GGDA 2J9YB 1V8FA 3AF6A 3LWZA 1U2PA 1AKTA 1YL5A 2VUUA 3MFQA 4ENSA 4X1YB 2AJDA 2HF9A 1VJTA 3W2TA 2J6HA 4L4YA 4DR6B 5M3BA 2O8EB 5F7ZA 2YVLA 3HUDA 3HBNA 4LOLA 5CM8B 4WVFA 3RC3A 3W7VA 1U11A 2HJWA 1H8ED 3TAUA 1Y6GA 3TE6A 5G0WA 1TCBA 2C31A 2AUMA 1CU1A 2NVUB 1C8BA 3TX2A 3NUQA 3CMCO 2IKSA 4NZYA 1XX6A 1YV9A 2DOKA 4V24A 1D8AA 5KHLB 3B5EA 1YNSA 4M1KA 3W34A 2MMGA 3ZV5A 2JGEA 2C9ZA 1RM3A 1S3IA 3ROPA 2F55A 4CL8A 3L9WA 2NADA 1WZUA 2OA0A 4EKIA 1NF8A 3DYIA 5IAEA 3FTNA 3PPWA 1PZEA 3PUZA 2ISQA 3RUCA 3DFMA 4AKTA 3WRXC 2YV3A 1SOAA 1C50A 3FMFA 1F2UA 3R44A 4UATA 2DWCA 3UJPA 5I7RA 1C3OA 1IBCA 5DHRA 3MINB 1QP8A 1ZH4A 4F60A 1P33A 2FPPA 3O3NB 4QFBA 2VXYA 4JC5A 3FUXA 3BMCA 3VX3A 3F8WA 2GTHA 3ETJA 5G4LA 2XRYA 4HDQB 3JVEA 4XGIA 3WKAA 5F5LA 3ZEIA 4AMGA 1CQZA 1IIRA 2N1BA 4AW9A 4IH4A 1YTUA 1JQDA 2C2HA 2GZMA 1QMGA 3AR7A 3NM4A 1OYVA 2VDNB 3BD7A 4MA0A 3DZFA 3ECAA 6NULA 3QKSA 1UBOS 2NU8A 2QB5A 3KJNA 2SHKA 1W46A 3I4FA 3HYLA 3RKRA 4JLAA 3FFBA 3ZDDA 3V4ZA 1ABEA 2QYOA 3BWCA 1CW2B 4GZLA 4DLWA 3KVVA 3FKSA 2J5XA 2QRZA 5F64A 3CU5A 4JSRA 3IQXA 5TMDA 2WMNB 4MRPA 3TVYA 3T3HA 3AJ8A 1M76A 3LK6A 3M1YA 1YDMA 4Z53A 2DUWA 5EP4A 1VDMA 1TOAA 1ZLYA 4JGBA 4Y9UA 1RAFA 2CC2A 3U39A 4DLVA 1P0MA 1EZ1A 4QIHA 2Q0XA 4FB5A 4BZQA 2FX3A 5BW6B 3OEHA 3TCNA 2NVBA 1GGVA 3GI1A 1UDWA 4DWVA 4O1HA 2G25A 4IH1A 4OBWA 4J29A 3RDPA 1LDNA 1UBNA 2CXOA 4YRDA 5SZHB 3JVUA 4LF7B 4IL5A 1TUBA 1MNAA 2G67A 5ECYA 3MYRA 3I23A 3BFVA 3MOIA 3PC7A 3OQOA 1UK9A 2AFHB 4ENTA 5MF6A 4JIGA 1N2OA 2E5LB 3BOSA 3ILSA 4XM0A 3T5MA 5FTLA 1Q1ZA 1EUDA 2D59A 1JKFA 1R8YA 3M4NA 4BRWA 1BGWA 1WF3A 2DBRA 1OX5A 2BMWA 1VIMA 2VEDA 4G4SP 5DNYB 1QLJA 3BMXA 2P4EA 4UEKA 2B3TA 3QPVA 3DE2X 2P2YA 4ABYA 5A3VA 3ZBTA 4GBGA 4CKEA 1YA8A 1E59A 2J7KA 3U0BA 4ENUA 2FSIA 4HQFA 5FBVB 3JSAA 2AV6A 2Q2NA 1UJMA 2ORYA 5DHTA 5TEWA 5CEJA 1QJ4A 1Q0LA 2ZIVB 5HOQA 3O38A 2J9GA 3L2OB 5T7BA 2C07A 1RYDA 1NSYA 2YJNA 3ROXA 1UODA 1L7OA 1TPYA 3P9PA 1M1YE 4KR2A 3C0KA 2PD4A 4PHCA 5D2CA 1E5TA 1PSZA 2JD1A 5IJ9B 1NJGA 1A8QA 1A9TA 1QZZA 2EX1A 1QH1A 4OXRA 1XJWA 1YB5A 2FNAA 2ZJ4A 5HVNA 2OFXA 4IXTA 3D4LA 1KBOA 3UJ9A 1FP1D 1ND5A 1VYVA 1XCLA 2H51A 4LZWA 1BX3A 1PJ2A 4QUGA 4QUBA 5EERA 2X3YA 1QV9A 3INNA 5LWHA 3QEBZ 4ISCA 4PICA 4C4XA 1SVNA 2HN9A 4HX9A 1NMZA 2JFVA 4JN6B 4Z3KA 2NZ8A 2QTGA 1QR6A 1VJ1A 5AKXA 1X7XB 3QXJA 4WBSA 3WLAA 2P3OA 2NXEA 2BFFA 2RFLA 4IZHA 1DC6A 3JV7A 1JDJA 3K4PA 4ZREA 4AZSA 1T8YA 3MAJA 2PZKA 1L8OA 2IXTA 2P91A 4G5FA 3S2SA 1P2BA 1ZINA 1QRAA 4FHEA 1ZIXA 4MITA 5BV0A 2R1VB 1JG6A 2M32A 5EUMA 3UT5A 3TLGB 3IAAA 4ZJZA 3MT7A 1JVBA 1VPTA 3PEWA 5E7IA 1V1JA 3B52X 3N76A 3KD3A 1N5JA 1CG6A 1PRYA 1GKLA 1VG9B 2W9XA 2XMSA 3U4QA 1NIPA 4B2YA 4EHFA 3MHTA 2P6NA 3LBYA 4S1VA 4BECA 1J0BA 1X1TA 4DDWA 1J20A 5C1OA 4OM7A 1EX7A 3WAJA 3EZGA 4BX3A 2OCIA 5KCZA 3KOOA 4HOYA 1U90A 3UW1A 1H2EA 1FNSA 1XZMA 3A1VA 3GHHA 1XDDA 3AY0A 3M3PA 3NRJA 1KO1A 3B7GA 3H04A 3OQJA 5JCJD 3NMUF 4IDEA 4D9EA 5FXMA 4ANFA 4G0MA 1Z7YA 3MJFA 2OZEA 1VKJA 4C21A 3K70C 2CJYA 4X84A 2PGNA 4PZEA 2WW8A 3OSZA 1JA0A 1R6DA 2WZDA 4LDAA 3LQKA 2VSFA 3R4VA 3TGWA 5JXIA 4OM8A 4ENVA 4GR4A 4J3JA 2RBEA 3CUYA 4KVFA 4F4HA 5JDCA 1I6LA 2I7XA 1P2GA 2PQ0A 4FFDA 1W0JD 3NYIA 2JZCA 1K3FA 2P62A 4EPRA 2I29A 3MXTA 3UUWA 4BUJA 2CLEB 2QVLA 4XSGA 4LHEA 4RZXA 1IUOA 4PFKA 4W9RA 3NC0C 2F3TA 3IOYA 3AVOA 1JKMA 4LVOA 1XMJA 5BQXA 3R09A 1KJQA 1FSPA 1OZHA 1U0FA 5JXJA 4K6CA 3DZHA 4WLVA 1CCWA 1DVRA 3V5NA 4QDJA 3ELUA 3OC6A 1MX9A 2PV7A 1I13A 3LPDA 4QWMA 4QOHA 1CQJB 4YUYA 3V4VB 1PNQA 1IN1A 1G3RA 2B1JA 4GNRA 4MEJA 3VBCA 5B1YA 4WN3A 1J90A 2A5YB 2YC4C 1W85A 4GH5A 4GVXA 1GRVA 5B1SA 3RU2A 2H18A 2NTYC 3GJTA 3M33A 1RM4A 1P4SA 2NSYA 2PJZA 3RJTA 1MB3A 1A8PA 1O54A 2GOYA 3WL3A 3H3XA 5L4SA 1BWSA 5FBKA 1FUEA 1ZGJA 1GCOA 1HE2A 3BFXA 1ARZA 1H2FA 3T9BA 2GWHA 2H2AA 3H1BA 1PFYA 4ND4A 4BBJA 2OAP1 1QGUA 4OK6A 1PZHA 1YHYA 1N0WA 2AN4A 3QU5A 1QE0A 5E8RA 5CK5A 3UV6A 4B4WA 1WMSA 1NVVQ 4MVJH 5IG2A 3J81A 5L9AA 2I99A 2XYRA 1M1ZA 2DT5A 4NHEA 4B4OA 2OZLB 2YMLA 5EZ6B 3A3KA 4EGFA 5JSHA 2HNAA 2BFMA 1EZZA 2WVGA 3QZUA 1OE0A 3A32A 3L7KA 1HURA 4KWTA 4UZSA 1QB7A 4PWZA 4BWGA 2B2NA 1E61A 3H2SA 4B6QA 3LQRA 3O8OB 3F6EX 4A5OA 2RK6A 4G5SA 1R4MB 4V38A 1OROA 1TT7A 2Q4BA 2YOFA 3IUBA 2J0VA 4L6AA 4QWWA 4YAOA 2ONZA 5FFNA 2FZEA 4MKRA 1B6TA 3U1VA 2PUEA 1Z4JA 3B1KA 4MGIR 3VR0A 3HNPA 3TRHA 1C4KA 2AG6A 5ALNA 3WDMA 4RVGA 1TD9A 2QNBA 5EJ8A 3HJUA 2OV8A 2Q46A 2Z2XA 3EHDA 3EIWA 3UTDA 3JQEA 5CLQA 1QKIA 1E8NA 4P81A 4XXHA 1SXIA 2Q4RA 2JI9A 4EG3A 5J2UF 3DF7A 4D0LB 3G0GA 3Q40A 4CMEC 3N2NA 3TGLA 1Z22A 4GI3A 3NVKI 2P0EA 4L28A 3U5ZB 1LA2A 5ALWA 4GLLA 1ND6A 5CT9A 4OQXA 4QT4A 5ER9A 2B9EA 4JD5A 3VYRB 1JFFA 2JEOA 4FFOA 3RT9A 2AZXA 3MS4A 4E2XA 3ABZA 5LBUA 1KYWA 2QRKA 1L5SA 1CETA 3Q3IA 4HZGA 4K40A 3ZWPA 3M83A 4WZBA 4BE4A 4OUDB 2BSAA 4AMBA 4AN0A 4FCWA 6LDHA 8ATCA 3A9SA 4OQ4A 1IFXA 3CO5A 1S2NA 3E8SA 1DKNA 3KJEA 3OLWA 3TZKA 1JHVA 2YVUA 2VJBA 1DNPA 1TPZA 1TTPB 2HEGA 3BSYA 2NQTA 4CMHA 1EWRA 3OLQA 2LBPA 4V3BA 1N2SA 4IDAA 4L3WA 4H3SA 3S1SA 3IH5A 2N47A 2ZK7A 2FRDC 3EHEA 1NVFA 4B8ZA 1HLDA 4PPQA 5A3QA 3K9FC 4YMUA 3UQZA 4CU2A 1Z18A 1U99A 5DGXA 3EDMA 2CY0A 2O8VA 4B0OA 5I5GA 2E49A 4BX0A 3A58B 2GTPA 3WKDA 2DFVA 4D46A 4CKWA 3WK6A 1Q7TA 4N7MA 5CBPB 2H4JA 1AGPA 2I2DA 1P4AA 2JVIA 5A4IS 4DT1A 4PR3A 2WAYA 5IFLA 1T5DX 1DQYA 4JR1A 2VPZA 3SHVA 4Q4DA 4IW3B 3VU9A 5BSKA 4QQRA 1ZIDA 2PGXA 3MWGA 3PG5A 3EXHC 4HS9A 2YWBA 8AT1A 1V4VA 1P1KA 2YC2C 3B5IA 1BA2A 5ILGA 2OOSA 3MGCA 5H82A 4P0PB 3F5FA 4PLYA 2PWPA 5LD2B 1FMFA 1J97A 3R77A 4FHCA 4BFZA 1PZMA 2WKPA 3DLTA 1JTVA 2B98A 3GV0A 2B3DA 4FYPA 2VNIA 1J8YF 3EMVA 3RSHA 3P9YA 1TQ2A 1NV8A 1L4YA 4ZYUA 1HK7A 3GB9A 4JC0A 4GM4A 4R54A 1IMJA 1ZOSA 3WRYC 3IEIA 2OT3B 3N0TA 2I4RA 2ZXEA 3E27A 4X24A 3F3MA 3E7FA 4XM1A 3PRKE 3VDQA 1ZL2A 3NBXX 4RHYA 4IEIA 2OXEA 4RWZA 5CVEA 4D97A 5L3QA 2CMDA 3GLTA 1GPUA 1DAHA 2G88A 3VM6A 3SDZA 3ONVA 1D1QA 4CGYA 4EBFA 3TR5A 5FFFA 2BFBB 2JFBA 2WT9A 5IAJA 4EYOA 3CG0A 5CB4B 2O8EA 1ZK3A 2QRUA 4LC1A 4JQZA 4KQ9A 4OUKX 2WK1A 2EQAA 2I65A 5G1PA 3PHJA 5CTJA 4L8GA 2QDKA 5B2ZA 2BZSA 4H7KA 5A04A 1W35A 1X7YB 5J4VA 2E0IA 4N8SA 4JJ7A 4YRNA 4ILEA 3FDJA 1SVIA 4GFDA 4B44A 1YA6A 4KFRA 4B3SB 5IM4F 1JIKA 2WHEA 3S40A 3PQ5A 4NEQA 2CVFA 5I9LA 1B8NA 1X15A 4BAGA 4FFBB 3IDZA 4K28A 2VHEA 1DAIA 3U37A 1KH2A 4NJEA 4TKLA 1P9WA 4R05A 1WOMA 2AKYA 2GAFA 2W4IA 4N0EA 4TL8A 1DO2A 3UB3A 4URFA 5CA0F 4XEUA 1ZOOA 1S1CA 3FGOA 4ZT4A 5FFMA 5J5AA 3SJZA 1M34E 2QI9F 3DQPA 3K1JA 5C8YA 4ZEVA 4M0FA 4ZRNA 4GRDA 4DL9A 1Z36A 3QWFA 1KY4A 1JDBB 5J63A 2CNDA 4BLRA 2AD1A 5LP6B 1OH7A 1JAYA 2KYRA 1NBHA 3VOBA 3FZQA 5J1TB 3SQDA 1RI4A 1G59A 2XVXA 1KQOA 1Y1QA 2GJ9A 1MU0A 3I2YX 3IQFA 3KDAA 4L15A 2OYRA 1PD1A 5CX4A 5KAMA 4DLPA 1H94A 1RRMA 1SHUX 2PU5A 1GO2A 2PWZA 4PTLA 4CZ2A 1X70A 2IHVA 4UPEA 1LXCA 1ZVJA 3F5DA 3OCJA 3AM4A 5DPMA 1JEYB 2JGJA 2W2KA 1DUSA 1M8JA 4OYYA 1NBEA 2FDXA 4LXXA 4RSGA 1RYEA 4XIFA 5BWBA 1IEQA 2GTIA 4BNMA 3ZWDA 2YV4A 4A8JC 4EJSA 3I05A 1JLMA 3E9MA 1QIGA 3WXMA 1Q2XA 3T5PA 4QE3A 4PR0A 1Z88A 1ZWLA 4WN9A 2G9QA 5JAQA 2VVTA 3QFFA 1P4GA 4Q93A 2UVQA 2H5IA 4PZUA 1A5SB 4LMPA 1E20A 2BI4A 3FWHA 3ZDCA 1V7PC 1E1CB 3EZ7A 3PS9A 4WJKB 4DYVA 3NS7A 2ZZNA 1O3YA 4MR7A 1EFAA 1ZCFA 5JANA 2KLHA 3L06A 1ZUHA 4FYHA 3MRXA 4YPFA 1WVGA 3W6UA 3FM9A 5LU8A 4FC6A 5ALZA 1E32A 2RIRA 3HSSA 4MUFA 1FNDA 5D00A 2X4DA 2V4ZA 3LO5A 4D3YA 3AVUA 3CRZA 5CFPA 1R8JA 2FSVC 3EFOB 4MVJP 4BQSA 4MUNA 1OT3A 3E9RA 2YQZA 3CF0A 2IS2A 2I62A 4B73A 5BN3B 1BDIA 1ZOPA 1F4VA 1DTWA 1H1LB 1E2UA 1QZUA 5I8WA 3O5AA 3MMNA 2ZGVA 3G1WA 2PKCA 4UBNA 3NDBB 1F7UA 4ZI2A 3IPAA 4I55A 2Z5LA 3EIQA 2AR0A 1NVBA 1W44A 4XKJA 4BLSA 4IIFA 5CT5A 4M2LA 1B42A 3T7SA 2X5JO 1HMYA 2Y1CA 4QTUB 4GDFA 1UBGA 4U2FA 5D3MA 4DDTA 1ZAKA 4YHHB 4MW4A 1LSJA 4MS4A 4F92B 1ID8A 2RDMA 1OX4A 2F7SA 3UEOA 2LCFA 4QFMA 3CFYA 4LWQA 1BD4A 3UT6A 2V65A 1EA7A 1OW3B 5D6OA 5LQMA 1USIA 3C6MA 3AQIA 4UU7A 4DCOA 2HYDA 3WKEA 3G7UA 3CRW1 3LL7A 1FK8A 3I0ZA 1JYSA 1K86A 2LIVA 3HWWA 3O4FA 4RGBA 1E1QD 4W6ZA 1RE1A 3EAQA 1YI1A 4G4GA 3FN4A 5DFAA 1N3LA 1ECCA 1Y0BA 3BH0A 3D6MA 4FJ1A 3HJAA 3KXDA 4LSGA 4RZIA 4DWOA 3GT4A 1QPZA 3G79A 2ZUWA 4G9BA 1KZ6A 3ONWA 3AR9A 4O4JA 2PMEA 2R9VA 5H9VA 1Z6QA 2HJGA 2IELA 3IRVA 5I01A 3C5WP 1CNMA 3QHAA 4FKBA 4F04A 3OOSA 4MUJA 3NVDA 4BTEA 2QR2A 3RLIA 1DIOB 3AJAA 4C4ZA 3EDOA 3EVNA 1E63A 1BGVA 4ZODA 4UUMA 1KC1A 2EG9A 3FPFA 3Q2IA 1ISIA 1JFLA 1W0CA 2NO1A 2Q0SA 4H6VA 3LLMA 4HZIA 9GPBA 1AN9A 3R0VA 4J6FA 1CY8A 2OSVA 4FSHA 1GYQA 3K8QA 1FW8A 3VU0A 2WJIA 3F3YA 3K5WA 1XN4A 4Q16A 2FE4A 2NU6B 2C2ZA 2WFZA 2UKDA 4BFUA 5FH9A 4RESA 2O8DB 4Q5IA 3BDIA 3L0DA 1L2TA 2BT4A 3LW8A 2O5CA 4R0VA 2WZCA 2YNMD 4X60A 1NXVA 4ZCIA 2BHSA 3IVMA 3A27A 1BZYA 4QHYA 3RVRA 3BHMA 3GA7A 1L5WA 3HJGA 1QORA 4L7QA 4MUBA 4CUZA 1P0FA 3G6WA 1F14A 4Q4CA 3HRHA 1B26A 4HADA 2QXTA 3DULA 4JI6B 1D2GA 1OLXB 1SK9A 5JR3A 1IZYA 5ALSA 1YGPA 4L0DA 4TQUS 3I6BA 1J2EA 3VR5H 2VAXA 3A3YA 3ACBA 1JKXA 1LV8A 4P53A 3EEYA 1KDVA 3BFJA 3H0EA 1FQJA 4DV7B 3TI9A 3PXXA 2XHEA 2QTWB 2ZANA 3ZY6A 5JUWA 4OLBA 4F4IA 1TCUA 1ZR2A 2HK8A 2OXIA 3CZRA 2QEQA 1C29B 3NDPA 1RAHA 3EH2A 3FWNA 1VLHA 2WOJA 4IZIA 3JQQA 3W04A 3ZE7A 1RRKA 5ENDA 4D8TA 3KYIB 1K2WA 3K8YA 3D6HA 4NARA 3AKDA 1G8SA 2IF0A 5FQNA 5FL7D 1TTQB 2ORVA 4B74A 3M6LA 3JW8A 1AVTA 4H4EA 4D2IA 2XHZA 2JCBA 4BGIA 1O57A 1T1EA 4AJLA 1FJXA 4DPMA 3KQOA 5AH0A 5HIJA 4F6RA 3K9NA 1E2DA 4HNGA 1VKNA 4AUEA 4BB0A 4ETMA 4YXWA 1QS0A 1SKUA 2R8EA 3BBPA 1Z2DA 1IZ9A 3W9YA 4AQYB 2ZYGA 1F0YA 3R5SA 5TPZD 3HVRA 3TUZC 3CVWA 4IMRA 3IAM1 4INOA 4V0RA 5G02A 4AY4A 2BGKA 4FZJA 4RF5A 3VHQA 4J0KA 5IX8A 1T8PA 2CDRA 2HU8A 5K03A 2ZLBA 5FOUA 5E1MA 4EHDA 1NUAA 2QQGA 3IHWA 1GTZA 1OAKA 2E5WA 1YH3A 1BVYF 4GL4A 3VVCA 3G2KA 1T5SA 4M7OA 3GCDA 2GNOA 4UBJA 5DW0A 1NVKA 1POWA 3HR8A 2O20A 1NMSA 1OIWA 3GU3A 2PYIA 4ALJA 1JVSA 1HE5A 4J43A 5A4JA 4YB8A 1LB1B 2QYSA 5G4KA 1S3SA 2J08A 3U7RA 5DTIA 5AM2A 2O6LA 3UJBA 5E2AA 1EINA 1B8UA 3F74A 4FMBB 5FPTA 1DBWA 5KYWA 3E8XA 1EI9A 2EV9A 5HEKA 4B35A 3LF2A 1IJKA 3DNPA 2Q5JA 4RCVA 3U81A 1MO5A 3GRYA 3UHJA 1EK5A 4YRAA 3EGXA 4Z9AA 1RKXA 1X92A 2Y27A 3RAPR 3RBVA 5U9CA 1B6GA 4ZT6A 2QRGA 1K1EA 3DGFC 2DFKB 5F9MA 3S7ZA 2OPBA 2C9BA 5C7YA 3SXUA 4JLNA 1P2TA 2GSWA 1GADO 4IIJA 4MDHA 2HMYB 2E87A 3WADA 3O8BA 2FTKE 1NKTA 4HXYA 4RELA 5EMHA 1F9EA 5EJ7A 3ENZA 2XUGA 2PNJA 1NRJB 4IQGA 3GN2A 3K94A 4DLKA 3CNNA 2ZQYA 1BS9A 2ZYDA 1DC5A 2H2HA 2W71A 2P9EA 2X5NA 2ZSJA 4FN4A 4B3FX 5CURA 2V6MA 3DV0A 1FFYA 3HCNA 1YOVB 4KDCA 3LBHA 1DJLA 1TT5A 4HGRA 1CEQA 4U39A 5FR2A 5C35A 3VNUA 4PANA 3CEJA 2M98A 3C7AA 2D5CA 2QTHA 2O14A 2Q99A 3VDXA 3FYSA 3DO8A 1ZZEA 3R7NA 5KX5F 1U7TA 4WUTA 4CDGA 3ESDA 3UC9A 2QLNA 3EPLA 4OB6A 2CDCA 3QVGA 3P0RA 1GEEA 5C9ZA 3UANA 4KWEA 1CJVC 5A5DA 3K73O 1YMVA 4UTVA 3HZRA 1FNMA 4O2BB 1X8KA 1V35A 1A82A 1JPUA 1UMKA 3TD6A 1YAHA 3SSOA 3ZS9A 1BMTA 4L7VA 4NCBA 1S7CA 4R8LA 3IAS1 3ER9A 1W1UA 4PGFA 4AK9A 3L0BA 4MLCA 1ENOA 2F62A 2X3UA 3O0TA 4YJ2F 5DBHX 5A06A 3NI2A 5CXSA 3WI7A 3WWPA 3VYSB 4X6XA 1Z3IX 4R2HA 3HFSA 3VH1A 2VTVA 2F48A 3ZWCA 4BFXA 3M89A 3PLNA 4MYCA 2UZAA 1KSGA 2FFQA 3NT5A 3O4VA 4RVNA 4LVUA 3V32A 3P0JA 2QP4A 4LXUA 4M76B 4UAUA 1PKXA 4RBNA 2DH6A 3JQGB 4ZKDA 1T35A 3UGJA 1ICIA 1I6WA 2IPXA 4XD2A 3VR1A 1O96B 1I7NA 1V9CA 3EW7A 5KOJA 5J3JA 4BXOA 3DO6A 4LF6B 1Q12A 2ZREA 4HH1A 1QHSA 2GEJA 4OGWA 4YRTA 1A04A 2WKWA 3H11A 3VC7A 1UFKA 3IV9A 4DAEA 1NF3A 3H5TA 4B6OA 2GM5A 4UAJA 4F2DA 2G5CA 2WIGA 5TIIA 4D9NA 3VPFA 3L1UA 2VHJA 3ABRB 4DCCA 3L7NA 3COZA 1W94A 1E3WA 2VDJA 1Z16A 1OXSC 2FJPA 3GMTA 1OIVA 4F9FA 3B60A 1JHQA 1H8HA 5GIOE 3DM9B 2FR0A 2LE0A 5BWMA 5L3SB 4MWDA 3LY8A 1GG2A 4R98A 3HB9A 1P4JA 3AI7A 3HZOA 4OXYA 3QFSA 2NO5A 4G5RA 3P9RA 1D04A 3O7WA 4EQ6B 3KT0A 1ZMBA 2ZSAA 3WIEA 1X1RA 3ZQ6A 2EXXA 3MK31 1UMDA 2WU8A 2HLPA 8MHTA 1D9ZA 2FN3A 2GFIA 4RETA 4V0KA 2PGIA 1WCXA 5FF9A 1A96A 2FUG6 4NU5A 4UOQA 3HB7A 3P8ZA 4YJ3A 4BVJA 2Q4OA 3I92A 3L6BA 1A5TA 4XCXA 4RA9A 4IIHA 3RASA 3JQCA 3CPEA 4FHZA 4CF7A 1I14A 3KXPA 1H23A 3T7AA 3JZAA 3FPBA 2YS7A 1ZYUA 3B53X 3NBZC 4MKGA 1JXAA 1XK7A 3Q15C 1M1YA 1GPYA 2ZJFA 1HYBA 4QXPA 4UU1A 2WWHA 2Q1WA 4HNSA 4PG7A 3H6KA 3LD9A 3GFBA 1INLA 1DXQA 3BYZA 1QZ3A 2FP4A 1YD7A 4MRMA 4D79A 2GK6A 3CJRA 4BAUA 2OZVA 1MUUA 2E7ZA 1L5OA 4UQOA 2BE9A 5CGQB 1NVAA 3EQ7A 4C6SA 1KSFX 5AI8A 3TIIA 3TCKA 2A0KA 1SCUB 4EW6A 1X39A 5M29A 3C3AA 4JJGA 2OP0A 1MQ9A 1P91A 3I9KA 3T5DA 1G1AA 3UG7A 2OMEA 2M1ZA 2OUKA 3A2LA 4KAAA 1DFGA 1L5ZA 4O08A 4JBXA 5KVSA 2BWJA 4AO7A 4IO1A 5J4LA 3QE2A 3ZU3A 1WCIB 2PMDA 4GWGA 2P9BA 4MV1A 3FTFA 1Z68A 3QNMA 1C1YA 3BT7A 3L8MA 2OB2A 4CKBB 1ORHA 5D87A 3RYHA 4LXIA 1G8FA 2Y6UA 4KVGA 4PLPA 5IMBA 4GT1A 5JNWA 4MVJD 2GZSA 2A35A 3VNVA 3IUPA 4BNNA 1GYRA 2W58A 3EDRA 2PM8A 1K08A 4KZKA 3ESXA 5T3UA 1W88A 3T3IA 4E5YA 1YRYE 2HXGA 1DX6A 3BXHA 1E9SA 2B83A 4TLBA 1ABBA 2ZU6A 3DR5A 3ZWQA 1Y1SA 3DMRA 3VU1A 4F2WA 1FUYB 4Z8XA 3W90A 1WW2A 2ID8A 1KO7A 2AOXA 3CZPA 4BO4A 2A84A 2R66A 1I9GA 2PGLA 1KBQA 4PQGA 4FHDA 1ODIA 1TGVA 3N05A 3FI9A 3UK0A 1FUKA 2PGOA 1V25A 1MD9A 5FORA 3ZCQA 3K09C 2X5KO 5F12A 4IGAA 4DV3B 3UJ6A 1KP3A 4KO8A 3CNEA 4WESA 1V43A 1NULA 2EJWA 2H7YA 2PTHA 3QEJA 3UXHA 4L8YA 6Q21A 5LJIA 3N9IA 4D4KA 4R1OA 1HQCA 1EQUA 1QWSA 2O2SA 3B2EA 3REOA 3FUTA 3UFXB 2CNWA 3O73A 6YASA 2H08A 1L5RA 1FFHA 2XSZD 3ZDXB 2IXAA 4CGZA 1MJHA 3ORSA 1S89A 4KQHA 3VX4A 2ODWA 3NDJA 2ONJA 4BEWA 3HY4A 2IUEA 3OZAA 3SXJA 4C04A 2AMFA 1FS5A 2IT1A 2W2MA 3AT1A 2PR7A 1UL1X 1Q0QA 1XVLA 3KZNA 4HNQA 4NYMQ 4PC1A 2ZB3A 2VJQA 4J0HA 3TZEA 3WTCA 1F1BA 3AVXA 4W1SA 3SSAA 2PA0A 2B7BA 4F2GA 2WY2D 4WBNA 3AL0C 2E4ZA 4IV8A 2WUDA 1E1LA 4GZ5A 3GJ4A 3TLAA 2QN3A 4H7FA 2J9FB 4ZI5A 1UANA 3M4XA 4D9MA 4AJOA 1W6RA 3WK8A 2QROA 4ZK6A 3CVJA 2HNBA 3RHFA 4MPDA 3WGOA 1IY9A 4B4UA 3CUTA 2J5QA 1YR2A 3UG6A 1F2VA 5EIEA 5JSUA 721PA 1KI3A 2QGFA 3O1LA 2QUHA 1WPRA 1SKYB 4H27A 5AT1A 2XIQA 1C0IA 4FNAA 1B1AA 5EZSA 4BO9A 1H9BA 3FKJA 2QZJA 1A1VA 3M4ZA 4XUDA 3Q1LA 2WU4A 4E70A 3FWPA 3IDOA 1PWXA 2PLRA 2Q50A 4TVKA 5TDHA 1XGKA 3TOXA 4XB6B 4PONA 4K6OA 4LG1A 3VR3A 1LLUA 3OFSA 1EDOA 2GBLA 4MW5A 1G8HA 3NBUA 4P5DA 4PGHA 1XVAA 5B58T 1SPBS 4L95C 5ITZB 2BM0A 2HC9A 5GJVC 4KUHA 13PKA 1FY2A 2N42A 3DG9A 1EXVA 1N6RA 2O8FB 3ONDA 3C4VA 4Q7EA 5FTWA 5E6SA 4IVRA 3OCCA 3JZIA 4HT3B 1VLMA 3ICCA 1PFKA 3HSYA 3K72B 4D4GA 2ZYTX 4QU9A 1JRLA 1MN6A 4HQKA 3V8MA 5AHKA 5G1NA 3KU4A 5GZ3A 1MX5A 3MTAA 4M0EA 1XPRA 3EZ2A 4Q9KA 5AI9A 2FEOA 5IC6A 3ZE8A 1E3SA 3DFKA 4ILKA 4DJJA 3RVSA 1QOZA 2NTNA 2BKEA 2FK8A 2PIAA 3F4LA 2IZZA 3EISA 3JR7A 2C3PA 4CHGA 1UM8A 4Z7NB 4FJ2A 3GA0A 3HDVA 1Q15A 3CUVA 1ZJZA 3GFSA 5F35A 3TNJA 4MRNA 1TMYA 4DMLA 5AD1A 3CC8A 3BWBA 2Q5LA 4Q4LA 4ZANA 4F0JA 1UBSB 2AJTA 2YNMC 2O4CA 3HWX1 4CM4B 4CJXA 1XZNA 2ZCUA 1VYTA 1IJBA 4DMUB 3LQ1A 4KU4A 5C32A 2AT1A 2H2WA 4OXXA 3IB3A 4MH0R 4P0TA 5A0VA 2A88A 3U7IA 3KHSA 1AKVA 3JYNA 1J2UA 4R01A 2MIIA 1KYTA 2VAPA 3TXAA 1DLJA 1JEDA 1S2DA 3CYFA 2Q9BA 3NHSA 2GPAA 4NULA 4F3YA 2PCLA 1WLYA 3BUSA 4CNBA 1HBJA 1ZH2A 1K89A 3AHCA 1KAQA 4MCAA 3BTOA 4Q7LA 3CINA 4QHSA 1KEEB 1Z5ZA 2BONA 3A4LA 1WL8A 1BE0A 2NSHA 3OZFA 2KPOA 5EMJA 4EX7A 1IIBA 4KMMA 3BF7A 3IUYA 4OFZA 4EG8A 4G67A 3WRXA 5LCXA 3PUYA 3SYNA 2IDZA 5FLEX 3TOZA 1VSTA 1ULZA 1UJ6A 2X6QA 4G23A 3AEUA 1DWPA 1AKMA 3QVTA 1R18A 3DJYA 1LI4A 1Y5MA 3OJXA 3KQWA 4TXJA 5H3HA 4O3FA 1N4AA 3VR4H 4CG3A 5LZ5A 4B3RB 4YRZA 1BAPA 4D0NA 4MUGA 4Y7DA 2FWAA 4BASA 3O8RA 1C14A 2GH1A 3SP1A 1T9HA 5JZMA 5A7HA 3ZCSA 2IHNA 1YT5A 5JJBA 2A59A 1WZEA 2DHQA 4FOPA 3S2GA 3SC2B 1Z4NA 1RYMA 3AR2A 4TYPA 3ZHZA 1G8PA 2FW9A 2PUWA 4JDUA 2HSZA 3L0OA 1F2TA 5LQKA 3TQQA 3KVOA 4CEJB 2QLBA 3U3KA 4E4YA 1CVLA 2REQA 1OZAA 1DBQA 3IMKA 1N7JA 1TD1A 3ZI0A 2GK3A 4FDMA 1ULBA 1ESCA 3PEUA 2J67A 2CFOA 1HZZC 1K7EB 3NBAA 3RK1A 1SHKA 3DPIA 4CTOA 4TSKA 4II7A 2C82A 5DV9A 1ZMOA 2J59A 1N0VC 2B4KA 1GAWA 1M6YA 2OV4A 3EXAA 1D1TA 1RWPA 5IVDA 4OX9Y 2D1SA 3FLAA 2C7BA 5DHSA 4EHAA 1HNNA 1DX4A 4Z4GA 3OVMA 2O3SA 3T6KA 3ORFA 4PQRA 1P29A 1M0TA 4H7EA 3GAFA 1KVQA 4CV0A 1N8TA 4DSTA 5DXFA 4E12A 8OHMA 9LDBA 1PR4A 4KSCA 5D6NA 5JY1A 2CVQA 3TAHA 1VL0A 4BZXA 1EA5A 3WNCA 2VQEB 1USKA 1TCAA 5E6UB 1SKMA 4J3NA 1JHPA 1LDBA 4P36A 4KI0A 3UOGA 3VC3A 5HJ2A 1FS6A 5TT0A 2P65A 1XTIA 2R00C 2ADFA 3V8BA 1I4TD 1S4QA 2R87A 3X44A 4OJYA