5HCNA

Gpn-loop gtpase npa3 in complex with gmppcp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
253
Chain Sequence
SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GPN-loop GTPase 1
publication title Structure of GPN-Loop GTPase Npa3 and Implications for RNA Polymerase II Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 95
structure length 253
sequence length 259
ec nomenclature ec 3.6.5.-:
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hcnA00
1WDTA 4M0LA 3PCRB 4EPRA 3ZVMA 3TVTA 2QSYA 3D6TB 5IHPA 2AWNA 3AVPA 2RKOA 3ZJYA 2REXB 1XD2A 4P4UA 3X1YA 3RS3A 4RZ2A 2B92A 2CNWD 1JBKA 1Q22A 4IOLA 4OL0A 3AVTA 4TL9A 4C4PA 1AGRA 4EPVA 4BFSA 1JALA 1L8QA 2YOFA 3VAAA 4XVQA 1U0JA 2FEOA 1Z2AA 1DTSA 1F48A 3N70A 3TE6A 1KI6B 2J1LA 1T0JB 1US8A 2FFBA 5DH9A 1R5BA 3ZVNA 5E3HA 2ZJBA 4IEIA 5UKDA 1GNRA 4Z54A 2W6ID 4L16A 5CLQA 1KMHB 1CBUA 4D4KA 1R0ZA 2D7CA 2R6AA 1RKBA 1KZGB 2VHCA 1S9DA 4OHWA 5JWHA 1KI9A 1NJFA 5AUPB 1S0UA 2ODWA 1ZU4A 1Z6AA 4WVFA 1JXOA 1FP7A 2Z6VA 4MYHA 4QHTA 3W6OA 3L43A 2GTPA 2EWWA 3QQ5A 1VDZA 5G53C 2UZIR 4TQ9A 3VTKA 4LK2A 1S3SA 3ZDQA 2IYLD 1N6IA 2WPDA 2ZRIA 4JS0A 3JVVA 3C4JA 3LNCA 4NE2A 4NU0A 1FP6A 4NYIQ 4XTCS 2OBMA 5FPYA 3FHCB 3X1WA 3FMFA 4QXAA 1II8A 4QL3A 1ZCBA 2FX3A 1AQUA 3MUFA 4QJ4A 4DLXA 3A58B 3U6BA 3DEFA 3GJ0A 2BBTA 4OK3A 3UWOA 4LYHA 1OJLA 2FSHA 2H5EA 4DUGD 3OEEA 1AJEA 2FV8A 1G17A 1EFRD 2J9RA 2G1KA 2XSZA 3GLHE 3EIHA 3IO5A 2DB3A 3M4YA 5C18A 1XTRA 1AQYA 4PSVA 1TF5A 3CX8A 3EASA 3T15A 2C96A 8OHMA 1UKZA 4EQ6B 2CJWB 3TQCA 3AM1A 1OFIA 1NLYA 1FUUA 4HLDA 2PT7A 4FMCF 4JMPA 4A0RA 4C9BA 4PC1A 3CM0A 1P62B 2OAP1 3NC0C 4UNSA 1NVXQ 5DHAA 4N0EA 3QKSB 4RVCA 1GSIA 2ZI3A 3PIRA 2UZ3A 2Q21A 1E94E 2ZRJA 3W6NA 3A1UA 4FCWA 4JT2A 3A6PC 1PUJA 1KY3A 2G0NA 2VHJA 3GJ6A 4IOKA 3PEYA 2ZETA 3K0FA 4DKXA 2Q9BA 4WZAE 2GAAA 1GP2A 2JLYA 4LC1A 1S2MA 2OESA 2BDTA 2O5VA 4UXIA 1ZNZA 1HEIA 3VR1A 1B23P 2FPMA 3T35A 1LVGA 4EIWA 2QMHA 2C03A 4MUAA 4BASA 1OB2A 4GPTA 2DFNA 3GLFB 4UNQA 4XWKA 2RGCA 1SVIA 1GVNB 4ZDWA 3HU2A 3UMSA 2FPKA 4TMVA 3WP1B 1QVAA 1HTWA 5FBVB 4NP6A 5L3QB 3F5FA 4Q1CA 1BIFA 1CIPA 1R0XA 5BW8A 2ZUDA 3U6KA 1UEIA 2SHKA 3R7WB 4LHWA 4I4LA 4DIDA 3AVWA 1A5TA 1Q44A 3LBNA 2IS4A 4KVGA 1CP2A 4QJ5A 2PEZA 1LB1B 5SZHB 3TSZA 5M04A 3QI2A 4R98A 5JWOA 4JLKA 3QIAA 4TWZA 3ONWA 4TT3A 5TARA 2ZREA 1QBKC 1VKJA 2IYYA 3KZ1E 1J99A 2IYVA 5DGXA 4V02A 3C16C 3ND8A 3LVQE 1U81A 2XNDA 4AG6A 4IXNA 1SXJE 1ZNYA 3FDIA 3U60B 2JIZA 4V0LA 4URYR 1JJ7A 4HAUA 1XTJA 5AJVB 1EWRA 3Q7QA 2ZSFA 3KFVA 4NH0A 2RGEA 4PO8A 1DAIA 2ZS7A 4FI3C 5G41A 3TR5A 4KXFB 3L0OA 2ZR7A 4RCYA 4K8OA 3CF2A 2BKUA 4Q9HA 3Q8XB 4LJ4A 5G3ZA 5EXPA 2AN9A 4DCSA 2RGXA 5C4GB 3I61A 4AYXA 4B2IA 4HB0A 5JHHB 4Q00A 1UKYA 2IUUA 1ZNWA 2TMKA 2AWOA 3AKCA 3NC1C 3IHLA 4MGZR 2IS1A 3KFXA 4PZLA 2KSQA 4GP7A 3AVVA 1LS6A 3DKPA 3EW9A 5J47A 2BIFA 1R8SA 2PJZA 2AFHE 4OJKA 1L4YA 1AS3A 1OH6A 3ZS9A 2MSCB 1CJTC 1T5LA 1IY2A 3GFPA 1P75A 1SVOA 1T6NA 6Q21A 2Q9AA 2DWOA 1J8MF 2FSFA 2OILA 1N3BA 3FMPB 5KPDA 4A92A 2PZGA 2WICA 3AB3A 3HR8A 1NY5A 3A36A 1L4UA 1G8HA 2EYQA 1KJYA 1Z2CA 2AKAB 3VQTA 3DZDA 1YQTA 4HAXA 1W0KA 1E4YA 4Q66C 2HCBA 1SKYE 2RAPA 1OXTA 2Z4RA 2LWIA 2QY9A 1QHIA 2J59A 3Q5DA 5A4JA 3V00A 3F0TA 2J87A 2C78A 3TUJC 3MGCA 1LF0A 1Z28A 2QA5A 5A0FA 5IK2A 2H16A 4MRRA 2FDCA 2VHUA 1AN0A 3ZVRA 1UBCA 4JBXA 1UBGA 5EP2A 4HDOB 3X1DA 1A4RA 2GHIA 4B2PA 2O8CB 4M1MA 5FOWA 1FMJA 1ZUHA 3REGA 4JJKA 1C9KA 3LY5A 1DOAA 2BEJA 4G5SA 5J4KA 1MH1A 1I2DA 2R8RA 4L4UA 3KKNA 4Q4HA 1GRNA 2Q9CA 3IPYA 4PHHA 5FBLB 1VECA 2VP5A 4HB2A 2FZLA 1FL9A 5DO9A 2ZI4A 3TJZA 4Q21A 4GOXA 4Z51A 1N2CE 1Q1QA 1GNQA 1BYUA 1RYHA 2FF7A 4HB3A 3RWMB 3I72A 5J5CA 3PUXA 3B7GA 3DMDA 2NMVA 1DELA 4A6XA 1U9IC 3RHFA 5HPYB 1CR1A 4MH0R 1BH2A 5GJBA 4B43A 2QTVB 4D6PA 4B71A 2WBLC 2QNRA 4JYBA 4DLVA 4TYYA 2C95A 2ZROA 5CITA 5KU1A 5CK4A 3SE0A 1D2MA 4KYIB 2YKGA 1RYFA 1X1RA 2F9LA 4JVSB 3CWQA 5B64A 3IQXA 4LGMA 4WW0A 4Q5IA 1AKEA 1VG8A 1XZPA 2QTHA 1R7RA 2VSXA 3NXSA 3CRW1 2RGNC 5AWFC 3BORA 1DO2A 1IN4A 2NO1A 1DAMA 2PZEA 1OXXK 4B33A 1E9CA 3VFDA 4A82A 4C0BA 2DWQA 1Z5ZA 5EE5B 1XF9A 1S9HA 3OIYA 4ZKDA 1G3QA 3THYA 2C9OA 1EFHA 1XEFA 4JLAA 3TUIC 2JAQA 4ZPXA 4DLRA 1Z0FA 3K9NA 4XWOA 4C7OA 2ZRMA 4M21A 2A5DA 4M53A 4HEJA 1GIAA 2X19A 3THWA 2ORWA 3SOPA 1E9BA 4RFVA 2JLQA 2VPPA 4Q19A 1IY1A 4TZ0A 2CEAA 2F1JA 1NJGA 3T1OA 4B3CA 3HYRA 4EFNA 1G6OA 2QP9X 5GJVC 2OM2A 1W36B 3GD7A 4S2EA 3GLIB 4LZZA 1W4CA 1CU1A 2FFHA 4YONB 2IYTA 1OB5A 4V0KA 5EE0A 1OXUA 4KU4A 4A0HA 1ZD8A 5H1YA 1BOFA 2YZ2A 4D26A 4JL6A 4O3MA 1E79A 4PAOA 4LCBA 2F43A 1ZM3A 4XJXA 2BMDA 2VL7A 3GLGB 3OE7A 4ARZB 1NLFA 3GEHA 1G3RA 1BYIA 2A5GA 2WKRA 4UJ5A 4DWJA 3G0HA 2WWWA 4QBGB 2X2EA 4US1R 3EPJA 4HLUC 3D7MA 1BMFD 3EA5A 1P4SA 4JLPA 1F6BA 1F2TB 4LPKA 2ZM5A 1KZ7B 1G19A 4DSTA 2HLDD 3L8YA 1XTQA 4XSHA 3VX4A 1CF4A 3TSWA 1W0JA 3WMGA 2X1VA 3TQFA 1U0LA 3TW4A 2YHSA 4MKHA 1CRQA 4R2IA 3ZD6A 1UKEA 1M7BA 4CW7A 1KO1A 4U7DA 4ESVA 1XP8A 4OHYA 4Q01A 1MRSA 3ADKA 2DFTA 1E2DA 2H18A 1QF9A 3WRYC 1GITA 3B78A 1G8FA 1I4TD 4PX9A 3QKUA 4CF7A 3U44A 1X8KA 1AM4D 1R6BX 3CO5A 5HTKA 4O2RA 1XD8A 1HA3A 2CDNA 5DSZA 2C5LA 4AYTA 1ELOA 1ZNXA 2FGJA 4NCHA 2QE7D 5KDOA 2XZPA 1IAQA 3TRFA 5TB5A 4IFBA 2DPXA 1SVMA 5FI1B 1G5TA 2F3TA 4CEHB 4RD4A 1T3HA 1CJMA 3A37A 4MRSA 5TXGA 2P5TB 3UKDA 4D80A 2V4ZA 2XTZA 1J7KA 4F7WA 1XEWY 3A8TA 3KXIA 4B48A 1GILA 2QN6A 1FUKA 4LBYA 2B7BA 3QENA 2BMEA 2R62A 3CNOA 2WAYA 2IWRA 1SVSA 4TTRA 5LBIA 2JLWA 1G1MA 4N0DA 3B2EA 4TSFA 3I5XA 1P61B 2VP6A 3LXXA 2OT3B 4JBWA 4IOMA 4JZKA 4OQLA 1GG2A 1TX4B 5EXSA 1MRNA 2J0UB 4G3XA 4BLSA 2PT5A 3NHBA 4HB4A 4M1WA 3KKQA 4HUQA 1TUEA 2HJVA 1G3IA 2VP4A 3OIUA 1G7CA 3HYTA 4DLZA 2YWGA 3NVAA 2OCYC 1G18A 2OO7A 3SBDA 2FA9A 4Q18A 3MD0A 3SBEA 4DCUA 2RGDA 3SYKA 1G5PA 4CEIA 5B58C 4BPBA 3Q7PA 2J41A 3WP0A 5JJIA 1G64A 5J4HA 4B3DA 1DAFA 2GBLC 2O8EB 4OKSA 3ND9A 5BXQC 3I32A 2OXCA 2G1JA 1KMQA 4EFLA 4HATA 3QG5A 4V03A 1OXSC 4S35A 5E4FA 5F98A 1TADA 2F1HA 4AKHA 1UDWA 2VRWA 2C2HA 1FPMA 1ODFA 4OK6A 1G9XA 2ZS9A 2GCOB 3PVSA 2OG2A 2WVJA 3KQKA 1P2TA 2ZYUX 2R9VA 2ONJA 3K1JA 2IXFA 3LDAA 4QG7A 3I3SR 3B1YA 1NSTA 4KYUA 1JNYA 3CONA 2WTUA 3O8CA 1DADA 2NQ2C 1TQ2A 4DB4A 1YZKA 1BKDR 4FCTA 4G5GA 3UG6A 2O8FB 3RRZA 4P31A 1LW7A 5DISB 2QORA 5FUVA 1N5LA 4TQAA 1B0UA 5AUOB 4ZIRB 3DO6A 1IN8A 4EPYA 2GXQA 2GA8A 3S1AB 1QHGA 2WIBA 3IGFA 4GSYA 2IC5A 3LH5A 1Z6XA 1YZQA 2NZ8A 1RW4A 4XTRA 5D3QA 4BRUA 3W90A 4A0FA 5DNYB 4TMXA 2OHFA 2V8OA 2G9NA 3I92A 1IN5A 1DAGA 2R6DA 4HAYA 3AGPA 1NN3A 3MJHA 3EC2A 1DAKA 5FR2A 2W00A 4OK5A 4WBSA 4B73A 621PA 4FXPA 2V3CC 1JEEA 2ECKA 4FMDF 4W5JA 1G6HA 2WMOB 3WNDA 4W5HA 3QE0A 1WB9A 1QRAA 2BMFA 1OYWA 3C15C 2I4IA 3EZ6A 3RC3A 4MUBA 1XXHE 1J8YF 4JKYA 5CDFE 2ZR9A 4NYJR 2MSDB 2X2FA 4Q1BA 3ZZUA 2WKQA 3SEAA 4DCVA 3REFA 1VIAA 3R8FA 3EPHA 1VCNA 3JVUA 2AD5A 5FL7A 5KSOA 2ZI6A 2WPDD 4X8LA 3AEZA 5KPJA 3CUEF 4AURA 3QPUA 1ZW6A 1XJCA 1U99A 3VKWA 2NTYC 5DLQC 4GL2A 1XNJA 3U3JA 5JRZA 1XD9A 3QNUA 3WY9A 1U0HC 2JJ2A 4NCKA 3OEED 3QEOA 1NI3A 4LDJA 4OQNA 3SNHA 3B1WA 4BZPA 1Z6TA 2XSZD 4UKDA 4PO9A 1NVVQ 3DVLA 1HUQA 5CYPA 3W5JA 1UBEA 2ZVQX 2D2EA 5KNBA 5FOUA 5JZVA 1W5SA 4YDSA 1HYQA 2V55B 1D2NA 1W47A 1RIFA 1OFHA 1Z08A 3LXRA 2IYQA 5KSYA 1OT3A 1G4AE 3GEIA 3OHMA 4Q4LA 1U8AA 3E1SA 4BFUA 4IFEA 2WWFA 1NRJB 5B30A 3FMOB 2EFGA 1O87A 2EQBA 4FIDA 4IHQA 5DI3B 5BYKA 1OKKA 1DE0A 2JJ1A 4QGGA 4JVNA 5SZKB 3X1XA 4PQRA 1FFHA 1S1MA 3KDSE 4AD8A 1Z6YA 2HDNB 2ZJ2A 4C30A 4G0NA 1KGDA 1SXJC 2GXSA 4JIMA 1SKYB 1Y3AA 4HAWA 2WWGA 4KFRA 3RDPA 3V9PA 4IDNA 3OIWA 1NVVR 3AUXA 1HY3A 5L3SB 4YC7A 3M6AA 3U4QB 4OI4A 3P27A 2F6RA 4JLDA 2ZAMA 4EJSB 4MYUA 1T3LA 4BFXA 3QBVA 5FBRB 1P73A 1T3SA 4ERNA 2HYIC 2HF9A 2Q0HA 4HAVA 2X8AA 2PZFA 2N1BA 3QVUA 4C0KA 3NBFA 1E99A 2C9CA 1MABB 1UFQA 4ZDJA 2IW3A 4JSTA 4TT3D 2FOLA 1EFUA 4CEHA 1KI7A 2J0VA 1KI1A 2QMOA 1NVWQ 2D62A 3FMIA 5G3YA 2AFIE 2BCJQ 2XNDD 2XB4A 3BH0A 4TYNA 2GJKA 5EXXA 3NH6A 4QNMA 1MO5A 3L0SA 4TMZA 2A78A 5AR1A 2XOKA 4P4SA 5BN3A 1UAAA 1G4UR 4JLOA 2DWPA 4M1KA 1W48A 4BGDA 1S4QA 1IXRC 1TF2A 2QP3A 2KE5A 2HXSA 2O8DB 2V1XA 3C7KA 3KUDA 5HCIA 1FZQA 1V43A 1YZUA 3T34A 4TN1A 2J45A 4E22A 5F9HA 3CH5A 2WV9A 1RRGA 4Q9JA 2QGZA 3T5DA 1E98A 2IHYA 4OBEA 4PZYA 4UNNA 4LX0A 2GRJA 3WHLA 1II9A 1II0A 1G16A 3GJ8A 3TBKA 2REOA 1QHXA 1BS1A 4DLWA 4NCNA 4E03A 2CLDX 4MDFA 3U3KA 3FOZA 4B75A 1Z0IA 3UANA 2JCSA 4EJSC 1SHZA 3NEYA 1A2BA 5JFGA 5JCPA 2IK8A 5JSZA 4WXRA 2OXRA 4B3FX 4F38A 1OXVA 2WAXA 3B60A 4I81A 4FWTA 1RPZA 3C5HA 3AKEA 1EESA 3FKQA 3N5CA 1RRPA 2VHQA 1E1RA 1VG9B 4LC0A 721PA 5JJKA 3ICEA 3AKDA 5FUXA 5EE1A 1E69A 3K70C 1W2HA 2O8EA 5CJ2A 4TYQA 4D4JA 2FH5B 3U3MA 2P0EA 2ZAOA 3GP8A 3U7HB 1M1YE 1W0KD 3K70D 1U8YA 1JQLB 2OLKA 3D31A 3EWAA 4GBMA 1IXSB 1CR4A 3O8RA 4TMWA 3TIFA 1E2IA 1E0AA 3PR1A 4G5OA 4PHGA 4GOKA 3TKLA 2BEKA 3NG1A 4D0LB 3I73A 1S3GA 3IDQA 1IBRA 3K9LA 5IK2D 4NYIR 1PUIA 4AC9A 1QHSA 4RJLA 1YU9A 3BJIC 2Z5FA 3OEHA 3ZZTA 1E9RA 4QHSA 1VG1A 5FTMA 3T1VA 3SQWA 3P20A 1NN0A 5LDDC 4FN5A 3WBJA 3ZLJA 1SVKA 4Q4JB 5LPNA 3QPWA 2C99A 4BFVA 3C5CA 1U94A 4C0HA 3T61A 2GCPA 2W0MA 1T4GA 5A5GA 1XMIA 3BE4A 4UXJA 1W44A 1G5RA 1OV4A 3AVOA 1TL7C 1W49A 4A8JA 1Z06A 1K6MA 3TMKA 2BVNA 5KYKA 3T06B 5KSPA 1YZLA 3LFUA 1XEXB 1GTVA 1VYTA 3K09A 5G40A 3RSLA 2Q3FA 2XEXA 3FHTA 5DI9A 3PUWA 1EXMA 3NHAA 1PLJA 4IVPA 1EG7A 5EE3A 1NN5A 3HP1A 4RKEA 4DIEA 3SJAA 2V1UA 1DO0A 3OFNA 2VHTA 1U8ZA 4NBSA 2VSFA 2WIAA 5AJWA 5FOTA 4CT5A 4ZDKA 4MRVA 1EFTA 2IXGA 1COWA 2CCJA 1GUAA 1YZNA 2B21A 2QBYA 1TAGA 1VTKA 3K9HA 2F1IA 4P33A 5FTLA 3NH9A 3KL4A 5H70A 1NG1A 1GFIA 5FFMA 2QU8A 2OCBA 3EIEA 4KV9A 3V4FA 3EZ9A 1GL6A 1J90A 4EKDA 4F92B 4QBIA 3WNBA 2IUTA 5LD2B 1KIMA 3I1FA 4ZCLA 3PEUA 2OFWA 4US0R 4PAQA 1SQ5A 4LJ5A 3OF5A 4GZLA 3TH5A 3VU9B 1NIPA 5TMPA 1CTQA 4Z8XA 4EDHA 4LRWA 4A2WA 2J7PA 1XRJA 3L0PA 1KNQA 4ASUA 5K8IA 1KK1A 1KSJA 1T8TA 1OPXA 3WHKA 3KKMA 4KSBA 3RC8A 3OIVA 3B5JA 3HDTA 5FOSA 2W6JA 3EZFA 5K8UA 4YMTA 4DCNA 3CPHA 4W7SA 2OFOA 3UPUA 2NO9A 3KJIA 1D9XA 3BH7A 4UJ3A 3KQNA 1KY2A 1N6LA 4WZ6A 4GP6A 4L8GA 1W1WA 2O8BB 4PSAA 4BEBA 1MV5A 1SULA 2QROA 3DPUA 3H1TA 4Z1MA 2R2AA 1M6NA 4M1OA 1QHHB 4F4CA 2OLJA 1E79D 4MA4A 1Q3TA 3UMFA 3W5IA 4DDTA 4D25A 4URVR 2EFEB 3WYGA 4US2R 3OE7D 2OUKA 2FSIA 2IYWA 1VMAA 2JLSA 2VA8A 4M9SA 2XXAB 1FTNA 2FGKA 3QF4B 2GZHA 4G1UC 4MITA 1Q1BA 3K9GA 1PVOA 2QMEA 1YR8A 1RJ9B 4URXR 2FEMA 1Z0AA 1M7HA 4I99A 2DY1A 4HZUB 5LD2C 2X77A 4Q7KA 4DB2A 1G7RA 4XD7A 2WJGA 1P9NA 4L9WA 1NVUQ 1DBSA 3H0KA 2UKDA 1HT1E 5J4YA 1W0JD 1F2UA 1E0SA 2RGAA 4Q1AA 4DVGA 1FTSA 3IEUA 4K46A 4NL4H 5JHGB 3B9PA 5AK0A 1Z0DA 3ZIAA 3ZYCA 1W46A 4BLPA 1ZUNB 2A5YB 3RLFA 3SHWA 1OIWA 3WXMA 1JXMA 4Q9LA 1DPFA 3ZS8A 4LI0A 1P2VA 4JL8A 4C2TA 3QXXA 1SHKA 4AYWA 2G0TA 1KI2A 1N5KA 4LSGA 4IDQA 2GAOA 4URUR 2AHOA 2P65A 1Z83A 2ZSBA 2H8KA 4KAXA 1P2SA 1KI6A 3AVXA 2C77A 2O8DA 5KSZA 2B6HA 2WSSA 5F3WB 4I1VA 4RCZA 2B7CA 4HZIA 1KMHA 4JVLA 2DBYA 1KDRA 3BERA 1OHHA 1PJRA 3N2IA 2Z83A 4A36A 4LHXA 5JJLA 1CJKC 4BRWA 4CRWB 1TQDA 2CHGA 1N0WA 1J2JA 1LF5A 4PC7A 3EPKA 1KNXA 4PO1A 4IRUB 3AGQA 5D3MB 2W2XA 2B8TA 2LCFA 1LY1A 4ZO4A 3THOA 3L2OB 2XB2A 1R5NA 2Q6TA 4M8NE 3UK6A 5IDVA 2OFXA 4TSFD 2VO1A 1NBMA 3EARA 4PC3A 2AK3A 1I4LD 1Q21A 3RAPR 1D6JA 4WZBE 4P32A 1XXHB 3HWSA 2NGRA 1H8EA 2D3WA 3CR8A 2LKCA 4BLQA 2R44A 2IYRA 3AF1A 3CPJB 4RD1A 2HV8A 4JLJA 2ZPTX 2F1RA 1M2OB 1NF3A 1X86B 4QRHA 4V0MA 2QSZA 2FG5A 2EFDB 4NCJA 3T5GA 3LRPA 3O47A 3W3AA 1LNZA 5TV2A 4ABYA 1W4AA 3SU8A 1E9DA 1HE8B 4AG5A 2QAGC 1QDEA 4BZXA 2FU5C 5KTYA 1M34E 1N6PA 3A4MA 3E70C 4EQ6A 3LA6A 1G7TA 2CJWA 2IA5A 3KXKA 2ZRPA 3EZ2A 3K0EA 4Q4AB 1NBME 3AF0A 4F4IA 2ONKA 2GZAA 2ZE8A 2CLCX 1CS4C 2YJTD 3QKSA 3MAAC 3R20A 1CJUC 4OQMA 2QT0A 1YE8A 1N5JA 1E2PA 4B34A 5EUMA 4BFTA 2FWRA 4BQSA 3F3YA 2HUPA 2P6NA 1N25A 3VHLB 3IKJA 5EXTA 2ZQ5A 1OLOA 5JEDA 1A1VA 1YZGA 4JLNA 3LVRE 2ZJ8A 3RS0A 1OSNA 5KHOC 1W5TA 4HI0E 4OHXA 2ZR0A 4DLYA 5DN6A 1CJVC 3GLFA 4IDPA 1KKLA 2A3RA 2HYDA 1OIXA 5C46F 1FMLA 3KJHA 4BLOA 2VP0A 3TR0A 4PFSA 3KTAB 2OBLA 1Z63A 5FUWA 2ZSDA 5L3QA 1GDDA 5ELXA 5DYIA 4FW9A 1G3UA 1GNPA 3Q85A 4O2LA 4KSCA 1R2QA 3P32A 1M8PA 3LV8A 1CXZA 3CRRA 5CYOA 3R7WA 2YWHA 1IJEA 121PA 3O8BA 2NG1A 3EC1A 3H86A 2CL6X 3U2QA 1RRFA 5FTJA 1K5DA 1AIPA 3NBZC 3I4LA 1GKUB 2CL0X 3K8YA 1P72A 4YMUA 3DOFA 2ORIA 3W8NA 1XWIA 2HT1A 3SC3A 4LPSA 3W8RA 4UXHA 2A5JA 3BC1A 1N0VC 3RWOA 2VSOA 1N6NA 4CDGA 2V6JA 4LOAA 4RFSB 3FYHA 1XPRA 3CLVA 2IEYA 3RNLA 4O25A 3PUYA 4BFZA 4QGHA 2CLSA 2ASEA 521PA 4AKEA 3CF6R 3I8XA 5FBQB 2VH5R 1VHLA 2FJUA 5HZHA 4W9MC 3PITA 1TQ6A 4IEEA 4RD2A 3BFKA 1ZAKA 2ZRKA 3QXHA 4Q47A 4MKFA 2NPFA 2KI5A 1XCGB 2NO7A 3KKOA 1KYIA 1JB1A 3W34A 3KQLA 1JR3A 1L2TA 5FL7D 3T1QA 1NP6A 4Z8YA 4IXMA 3CWZA 4MKIA 1MO6A 3MSXA 2QM7A 2HCJB 4H1UA 2YC2C 3DOEA 4BECA 4DT1B 4QKQA 3KQHA 1YJ5A 2F3RA 4ACBA 1JAIA 4LY6A 3RYTC 1ZM9A 3BGWA 2BWJA 3IBYA 4IVRA 4YXWA 1NMYA 4RKFA 2JJ2D 2CHVA 4YMSA 5B57C 2ZJAA 5GADl 3A4NA 1N0UA 1OH5A 5FTKA 4MQBA 3GJXC 3VR5A 1P3JA 4DEXA 1UADA 2J3EA 1E9EA 2WM9B 1MO3A 5EZ6B 1E2KA 1L7VC 3DHWC 4TQUS 3PUZA 1US8B 3PG5A 4KBGA 1W4RA 1CULC 4RSGA 4G5RA 4TLAA 2XXAA 3QF4A 5BQ5A 3U7GA 4O0MA 1KSGA 5IF9A 1NKTA 4TLBA 4QNRA 5EUQB 1MR3F 1NMXA 4JLMA 1OKKD 2JJ1D 3GLHB 3QF7A 3VHXA 3AF3A 4PQYA 2VP2A 2ODBA 3FHOA 1E0KA 4XH9B 3SR0A 4EPWA 2V54A 1NLZA 3TUZC 4TLDA 4TTQA 2XZLA 1ZBDA 3KJEA 3C41J 1JEDA 4ILEA 2GF9A 3SQXA 2O8CA 1E2HA 1E1QA 2GJAA 2CE7A 1KKMA 2IS2A 1X1SA 2PX0A 3B1XA 1II8B 5TVKA 2J0SA 3CPEA 1C4OA 3BK7A 1R5OA 1NY6A 3CX6A 1TMKA 3QXJA 1JPJA 3MJRA 5LB2A 1KDTA 4CEJB 3CX7A 2PMDA 1SKQA 2EFHB 4URZR 4TL6A 2NO6A 2WOOA 5CM9C 1N6OA 1TPZA 2C04A 1WBBA 2FNAA 2OCPA 5CB8A 3MLEA 4F91B 3IPXA 4R7ZA 1U2RA 5CIWA 2YNMA 5JCZA 4DLUA 3KB2A 3TGPA 4TZ6A 4QM6A 3Q72A 2JDIA 2QUZA 1X8LA 3CH4B 3SJZA 1Q12A 4KVAA 3A1TA 2AD1A 2VTKA 1UPTA 1AKYA 2VQSA 4PQFA 1YR7A 2A2ZA 3EG5A 5J4LA 2BBSA 2DCUA 3K0FB 4P3YA 4OYHA 3H4MA 2QGNA 3K0CA 1HT2E 4MKGA 4P0TA 2V9PA 4LHYA 4DDWA 2FZ4A 4X8HA 3LLUA 3VX3A 2CVHA 2ZRFA 5F9FA 3QY0A 1EGAA 1RZ3A 4GDFA 2YV5A 4PPFA 4X8MA 4IKEA 1R0YA 3VMFA 4PR0A 4OI2A 4LJ7A 3ZGXA 3KUCA 1HH4A 5CB6A 2IT1A 1N6KA 3UATA 5SZJA 1SXJB 3VKGA 2RHDA 1M74A 2OE2A 4BLTA 2ZRHA 2F7SA 4RD0A 3CB4A 1NL3A 1OFUX 1Q0UA 3FB4A 1P9RA 3QG1A 1IN7A 4I1SA 3EAQA 3P1JA 1ESMA 4PC6A 1DAHA 1E1RD 2HEIA 4KCGA 1H8HA 4MYTA 4OI0A 3OESA 4LV8B 3Q9LA 2IYSA 2ZRNA 2IYUA 2ZSEA 1Z47A 4HLCA 3QXSA 1SGWA 2CK3A 5E95A 3GLIA 1VCMA 4Q9IA 2NIPA 2JJ8A 1Q57A 1WRBA 2RH5A 5E7IA 1VCIA 3BOSA 1ZC4A 1R10A 3FKSA 2QI9C 4ITRC 1E32A 4AKIA 2VEDA 2K5UA 1E9SA 1E2GA 3EPLA 1GAJA 3GLGA 4ARZA 4LWZA 2BOVA 2G6BA 2FN4A 1LTQA 2VBCA 1DEKA 2XJ4A 3H2YA 1ZIOA 3LWNA 3RS7A 3OAAA 3ICQB 1FNNA 3SI7A 1SVWA 5HKKA 3OEHD 1IM2A 3BFXA 2F9MA 2QP4A 3MWYW 4FD2A 4M1TA 3SN6A 3TAHA 1FNMA 2ZRAA 1F2TA 4FMCB 2E1RA 5DIFA 1NSFA 1E2QA 2QQ0A 4YQFA 2EVWX 4TLEA 4PXAA 2BHRA 1TTTA 2ZTSA 2WJVA 3ADBA 4WAUA 4Q02A 4OQFA 4QFMA 2ZYTX 1F3OA 1GRQA 3PEWA 1ZC3A 4ZCIA 4F93B 1KDOA 1S1CA 5KO2A 3P4YA 3AP1A 4EPTA 1S96A 2CVFA 2NOAA 2J46A 2OEPA 5HCNA 3AVUA 2CE2X 3DM9B 1IOZA 2YOHA 3RSOA 3W6PA 3OFND 3M1IA 4MDEA 2GBLA 3K70B 1CR2A 2E9SA 2Z4SA 1ZM2A 2ZE7A 5EP1A 3VR6A 1R0WA 4GMDA 4XVUA 1A82A 1KJWA 4MYCA 4Y0VA 2ZIAA 1S8FA 4RZUA 1VHTA 1XB2A 1IY0A 4PPNA 1COWD 1E2JA 5BWMA 5JWRA 1XEWX 2UVQA 1IHUA 2V6IA 5HE8A 4D82A 3NTUA 2XNSA 1XFAA 1MT0A 1MKYA 2JIZD 2QPTA 4TMKA 5C1BA 2GJ9A 1PLKA 3UWKA 2C8VA 2OV2A 4QGFA 1XDBA 1GRRA 5AJYA 2BJWA 3SZRA 3VR4A 2FSGA 1TEXA 3GPLA 4AWXA 1TU4A 1D8TA 3HR7A 4JBYA 1CKEA 3TW8B 2Z0MA 4E5UA 2ANBA 1E9FA 4WA7A 2QG6A 1Q1ZA 3PUVA 3R9XA 2P3SA 4CT4B 2QAJA 4U5XA 4C3ZA 1XTIA 4W5WA 2A30A 2KWIA 5AJZA 5GVRA 3SDZA 4Q4HB 3WYAA 2J0UA 1OW3B 2CMKA 3BS4A 2J7PD 3L82B 2LKDA 1MO4A 1QZXA 4ASUD 2D4HA 3AVQA 2JGNA 2QENA 1KJZA 4D0GA 1R4AA 3K0SA 1VIYA 1XU4A 3LX5A 4RZXA 2G88A 2W6JD 4B76A 5GVSA 4XWAA 1KK0A 4V0NA 5P21A 2YWEA 2Q3MA 2DFKB 5AUQA 2V7QA 4BUJA 2XAUA 1VG0B 3GFTA 3AV0B 2I1QA 4L9SA 4Z1MD 2YOGA 3UXMA 1VPLA 3T1TA 3AUYA 3D3QA 3GLHA 3ASZA 3UG7A 5L3VA 2XZOA 3RRNA 1ZIPA 1RRCA 3G5UA 4NHOA 4L5BA 2IHBA 4QBFA 4Q9KA 5EE9A 4M9QA 4IDOA 1DS6A 1XTSA 3BFVA 1UJ2A 2H57A 1VYVA 3LD9A 5ANRB 3SFZA 2PMKA 2REBA 3X1ZA 1G291 1D5CA 4NCIA 2GCOA 3HPRA 1ZMXA 2O0HA 3BB1A 4TYWA 4GI7A 3I5YA 5B2ZA 2G83A 2H7VA 3NEJA 3RRMA 2GK6A 1DG1G 4M2LA 1FX0B 4XD7D 1ZUIA 3N2EA 4BZQA 1E2FA 4CEJA 3THYB 4ZI3A 2XTNA 1IN6A 3AF2A 2P6UA 3ZIAD 2DYKA 2ODNA 2WJHA 3MRSA 3PQCA 5K8LA 3EA0A 4C7OB 2O8FA 4C0AC 1WCV1 4II7A 3THWB 4ZIRA 4LJ9A 4F4JA 4Q48A 1QG4A 2R6GA 3X2SA 3S1AA 2IWHA 1P7CA 2GCNA 3EX7C 4B6FA 2PLFA 4BLRA 3DM5A 2YYZA 4XOIA 2F55A 5J40A 1GWNA 5HZKA 5KNDA 2JASA 1OH8A 1UEJA 1NG9A 4GNKA 2WSSD 2GVDC 4YDHB 2FPLA 3I62A 1E96A 3WNCA 2F43B 2ZYWX 4KO8A 1UBFA 1TEVA 2MMCA 3BBPA 2RCNA 3AF4A 5HR5A 4JT4A 1OHHD 5FPHA 1AZSC 2Y8EA 2ZANA 3FPAA 4Q1EA 1G8YA 4D2IA 2IXEA 3GFOA 5JS7A 2GJ8A 1SXJA 3EWSA 1WE2A 5DYGA 1UF9A 3NBXX 3SYNA 1WMSA 4AI6A 4R9UC 2PEYA 3FWYA 3H84A 3CNLA 3ECCA 4K81B 2J5XA 1R8QA 3B1VA 3LQRA 1HQCA 1NBMD 4XIGS 1YRBA 5JEEA 2QM8A 2ZRDA 1ZCAA 4WXPA 3R9WA 1H8ED 3B1ZA 2GESA 5BN5A 3DMNA 1EFCA 1Z22A 4TYPA 3A4LA 4OHZA 3WBKA 1KTVA 4A4DA 2CNWA 3BRWD 4TL8A 3U44B 2GNOA 3QPVA 3UMRA 2OBNA 2CCGA 3R9IA 3KB1A 2NZJA 2RGGA 1Z0JA 3LO5A 5JS8A 221PA 3RVBA 4DSUA 2WWHA 5JMTA 1K5GA 4RY2A 2VLIA 1T8UA 4FMBB 1VYUA 5J4VA 3B85A 4DXAA 1GKYA 2EFCB 2A5FA 3AP3A 2W6IA 1P5ZB 4QBHA 3AQ4A 1HQYE 1T5IA 2FFQA 1FW6A 2GEVA 2I1VB 4H9GA 4CIDA 1WA5A 5H8WA 2IYXA 4FINA 5SZIA 4KLNA 1TUIA 1WXQA 1EK0A 1SVLA 2A7QA 4A0GA 4PPQA 5DI3A 3KX2A 5BYJA 4WIAA 3DL0A 2RHMA 4DDUA 5FPTA 1XMVA 2C98A 1CR0A 3L0IB 3LBHA 1NIJA 1KSFX 3KQUA 4B3BA 1QHYA 4LBZA 2D74A 1NNEA 5DN6D 3A1WA 1OFTA 2PLRA 1X8JA 3THXB 3CRVA 5L3SA 3U4QA 3AKYA 1TQ4A 2JATA 2ZRLA 4FCVA 3NDPA 4EJSA 3E5HA 1F5NA 1OH7A 1NMZA 1FQKA 1X3SA 4URWR 3GMTA 2ZS8A 2QT1A 5GJCA 4D81A 3E2IA 1TU3A 4HUQB 4PSKA 4DSOA 2CHQA 3TAUA 4DUGA 2ZI5A 1JAHA 2KJQA 3U5ZB 3AH8A 1MABA 2VP9A 1EFRA 3G82C 5CJPA 3M0EA 4ZDIA 5FOVA 1W2GA 4KITB 3LW7A 1YZTA 3QXCA 4MGKR 4DCTA 2AXNA 3ZZ0A 1YKSA 3I8SA 3ZVLA 2PCLA 2GEUA 4CEIB 4PANA 1GL9B 5IRCD 2QRZA 5CLLA 2PCJA 2QAGB 1A7JA 3U61B 1G8PA 1I4DD 2WWXA 1D2EA 2OCAA 4A15A 1EWQA 2QPOA 3ZH9B 3J81k 2RB4A 3ASYA 1DVRA 4HYYA 5FI0B 2DR3A 2BKEA 4Q1FA 4DZZA 1KI3A 4U00A 3BXZA 4QHYA 1E0JA 1OYYA 2ZEJA 1CRPA 4LJ6A 2OSBA 3QEJA 4B3XA 4HUTA 4A9AA 2GXUA 1Z07A 2W0SA 2PJRA 2GILA 3TSOA 4DDVA 4CGZA 4B74A 4C0LA 1JR3D 4C2UA 4ZKEA 3SYLA 4LV5B 2IX3A 4D4MA 2R65A 1CEEA 1IONA 3B9QA 5EJEA 1SZPA 2IF0A 2JLRA 4ZV4A 1YHNA 4TL7A 4NPHA 4QM7A 2R6FA 1TNDA 2XGJA 2GF0A 3IIJA 5JRJA 4BEJA 3QKRB 1QVRA 4YXWD 1Z8FA 2IL1A 2KBEA 1ANKA 2VF8A 4IVQA 4KI0A 4A1FA 1Z29A 1P60A 2XX3A 3K0AB 4IDHA 5K8TA 4V0OA 2D7DA 5JI2E 4PAMA 2W2TA 4KODA 3CRMA 2ATVA 3Q5EA 1CLUA 1ETUA 2AKYA 3B82A 2IS6A 1OF1A 1PV4A 5FOXA 2PH1A 1KO4A 2P67A 3DKVA 3IIMA 2GJSA 4Q7JB 2BBOA 2CCKA 2FFAA 1W7AA 4IJMA 3GJ3A 2L0XA 1LS1A 2Z43A 2FE4A 4AK9A 2GVZC 1E9AA 1W4BA 5EZ5A 4BE7B 1E2LA 1RE0A 3BWDD 1ZU5A 4LHZA 1V5WA 821PA 2KB0A 2XTMA 2HJGA 4LBVA 4B35A 5BN4A 1XCPA 1FX0A 1YR6A 4JLVA 5CIQA 4C0SA 3IBGA 3VKHA 1E3MA 2YWFA 2G77B 2ZRGA 2HF8A 4GMXA 3U3OA 3QVVA 5EP3A 1TF7A 4DC9A 3MWKA 1G7SA 1G21E 2HXYA 3B13B 2H17A 4V0ME 1E2MA 3WYFA 1XX6A 2P6RA 4Q4JA 1E1QD 1HV8A 3CIOA 4FWIB 2AL7A 3GEEA 4XVRA 1AA9A 2BC9A 4KLZA 3IEVA 1XJQA 4JSYA 3IHWA 4B47A 3AP2A 1UM8A 3IUYA 2JLUA 2GETA 2GWHA 2O0JA 1E2EA 4PTLA 5FR1A 2VIIA 4QGAA 3F8TA 1XEXA 4GFDA 4HDQB 2IEZA 3IIKA 2BM1A 1PLLA 2YVUA 2N46A 2ZJYA 4HLQB 2E87A 4KJZA 2ODEA 3QBTA 5KDLA 1ZYUA 3LQQA 4R2HA 1D9ZA 2ORVA 4L15A 4M9XA 2BBWA 3L8ZA 3OZXA 2JDID 2IUSA 3RANA 1AS2A 2JLZA 1E6CA 4DLTA 1AZTA 4NDZA 1Q1EA 4UQOA 5L3RA 2EWVA 4KFUA 2ZU6A 4D4LA 2ZXUA 3RABA 3K0CC 2PL3A 4PC2A 4ZCMA 2ATXA 3EXAA 3GLFE 3P4XA 2BV3A 3B8HA 4BWYA 5FL3A 1XPUA 2W58A 1WBDA 2IBMA 3RRYA 1E2NA 2WMNB 2ZVPX 2GEDA 3ETLA 3FE2A 4NTZA 5EQTA 2W2VA 2I3BA 1N6RA 1XZQA 2QPAA 1AGPA 5GJWC 1KAGA 5FPSA 5JBQA 3NDBB 4B44A 2WKPA 2DFLA 4NKRA 2ZJOA 4JLBA 2JLXA 4LYJA 3VNVA 5JECA 1QHNA 3PJRA 3NWJA 1KK2A 3LBIA 3FFAA 4WOPA 3P26A 4YLGA 2QZ4A 3IQWA 4ON9A 3U7EB 5E7MA 1XMJA 3C8UA 3LAWA 3PXGA 3NIBA 5CK5A 4ESHA 3VU9A 3MWLA 5FPKA 2ZE5A 1HE1C 1P2UA 4OI1A 4NONA 2C9YA 1XMSA 1Q20A 2H92A 3GJ7A 3QOFA 3B6EA 4LBWA 4FMDB 1LV7A 1ZM4A 3CR7A 4JYCA 1J70A 1PZNA 4LYFA 3GJ4A 2W83A 4YMVA 4UNPA 1W36C 2J0QA 3QUSA 3BB3A 421PA 2WWYA 2XITA 3T12A 1RFLA 1H8HD 2IF2A 1XD2B 2BM0A 1W36D 1YR9A 1KO8A 2H1LA 2O8BA 1KOFA 2CK3D 4BFYA 1IJFA 1UKVY 1U9IA 4N3NA 2AR7A 1QHHA 2RMKA 4RZ3A 4G01B 4MGYR 4HAZA 4P4SB 3FKSD 2B8WA 1EX6A 3EIQA 3PFIA 1JI0A 3RS5A 2ERYA 4BFWA 4JL5A 5AUNB 1NN1A 1JR3E 1OIVA 1GOTA 3TLXA 3MCAA 5C4MA 1T9HA 3IILA 1YVDA 2BMJA 3SFVA 1VCOA 5JLJA 3THXA 2OZEA 2MSEB 1ZJ6A 1Z0KA 5H68A 2JEOA 3PEVA 3UIEA 4EFMA 3OAAD 2ZJZA 4JJZA 4ACAA 3CKLA 1RJ9A 5HKKD 1Z3IX 2YC4C 4GT1A 3QSYA 1ZD1A 1XTKA 1ESNA 4R71A 2P2LA 3CZPA 4HZUA 4P4TA 3SJCA 4LHVA 4TLCA 4DRZA 4LV6A 4IW3B 4GZMA 4LJ8A 2VF7A 1ZM7A 2RGNA 4Q7MB 3VR3A 4E07A 5JI3E 1X6VA 4B32A 2GXAA 4M1SA 1A2KC 1M7GA 2ZITA 1KI8A 1G20E 5JSZB 4Y0AA 2JLVA 3LW8A 2Q3HA 2MMGA 1FOEB 4MGIR 3A1SA 3MMPA 4PHTA 5C2JB 5FUYA 1YRAA 1NKSA 4GOJA 4D0NA 2ZE6A 3ZQJA 3ADDA 1DAEA 2KBFA 2BJVA 2IYZA 5CM8B 2QAGA 2VYFA 2WJJA 3HJNA 4I1OA 4KBFA 5HE9A 1ZINA 5IT5A 4HSEA 4CZ2A 1JQJC 4IOJA 3MG9A 4MRNA 2ZI7A 3JZMA 2ZU0C 4PZZA 4DHEA 3O8DA 3BAFA 2RGBA 1G8GA 1P6XA 3TVDA 2WOJA 1KHTA 2BCGY 3U3RA 3FVQA 3SHFA 2GZDA 3GJ5A 4Q1DA 4A6PA 5KNCA 2PBRA 2QL6A 3R8CA 4G5QA 3DDCA 4OQXA 4NYMQ 3AVYA 2OAQ1 2NPIA 4AKGA 5FH9A 4DSNA 1IQPA 1QG2A 2ZJ5A 4ZI2A 3D8BA 1ONBA 3CF0A 1KO7A 4X8OA 3LLMA 2DHRA 1KDPA 4JVMA 2XOKD 5E7JA 5TY0A 2QRNA 4Q03A 3TK1A 4OHVA 5D3MA 3W9YA 4TTPA 1BMFA 3NKVA 2WSMA 3BB4A 1KAOA 2GDJA 4NZYA 3ADCA 4DLSA 3K53A 1P9WA 3WMFA 2J7KA 3FGNA 2HLDA 3QKRA 1ZVQA 4HLUA 1ZP6A 4QJ3A 1Y63A 4NYJQ 1ZRHA 3PV0A 2QMUA 5EP4A 3FFBA 1K8RA 1KO5A 1XXHA 4EUNA 4C0JA 5CDFA 4A8JB 3K0AA 1OE0A 4POAA 2CBZA 5F2EA 3DZ8A 4GRAA 5DE3A 4M22A 4NYMR 3JZAA 3IO3A 2JA1A 4MRPA 3SJBA 1JR6A 4J0QA 3W3ZB 1FQJA 4LJAA 4XSGA 1G41A 3NBYC 2V7QD 2QE7A 2ERXA 1U98A 1E4VA 1RVDA 2ZUCA 2N42A 1GL7A 2ZRBA 3Q3JB 2WZQA 3KKPA 1N5IA 4Q4AA 1IXZA 4CYMA 4CVNA 1KK3A 5DHFA 3GCGA 1Q3HA 2QBYB 2ZYVX 3CRQA 2P5SA 2ZRCA 4N1AA 1Z6GA 4KFSA 1WF3A 1N6HA 2QEQA 4RD3A 1WP9A 4QOSA 3VR2A 4AY2A 2WJIA 4LYAA 4QC2A 3C14C 5KUTA 4KHZA 1MOZA 2EYUA 4KFTA 2WJYA 4YMWA 3CNNA 4UNRA 3HU3A 4DEYA 1H65A 3QKTA 4A2QA 3V4RA 4DBLC 2G3YA 1U90A 2A9KA 5KDDA 2XJ9A 4LUCA 4M1YA 2CL7X 2FMXA 3KTAA 4TMTA 1RC8A 1BO6A 1I2MA 3BH6A 4DJTA 1WQ1R 1DG3A 1GKIA 1JPNA 4Q7LA 1HURA 2HT6A 2O52A 3HU1A 4RD6A 1GZSA 2D06A 5TDHA 3ZQ6A 2ZI9A 4JKIA 3GLIE 2YINC 1UDXA 4A8JC 3VNUA 3CBQA 2PX3A 1KI4A 2ANCA 3EZ7A 1AK2A 1JJVA 2QQEA 4C0QC 3KJGA 3HPQA 3QJYA 2ZSAA 1DARA 1O3YA 5FTNA 4A2PA 3K09C 4B6EA 2D2FA 4U02A 1G3MA 2GK7A 2O0KA 3MFYA 4M9ZA 5L8VA 4EAQA 3ZD7A 1JECA 3GLGE 1C1YA 2R6CA 4E09A 3WRXC 4B2LA 3FTQA 3TNFA 3WMEA 1F60A 1T91A 2QTFA 3BD9A 1KSHA 1XCMA 2EW1A 4M4SA 4PHFA 3CW2A 4NMMA 3A1VA 2CXXA 4RFSA 4H1VA 2ZUBA 3CZQA 4HDCA 3RS4A 3BIFA 3SS8A 2AK2A 2AX4A 2GKSA 3MWJA 3PENA 4PPGA 4EPXA 2WWIA 4B3GA 1XPOA 4OJQA 1XBTA 4I1UA 5LB4A 1GM5A 1AS0A 3KXLA 1SXJD 2EU8A 5FBWB 3U7FB 1T0HB 1EX7A 2NO0A 3GQBA 1ZD9A 5AJXA 1XJ0A 5KOYA 1LFDB 3LX8A 2AXPA 4LJYA 4DT1A 3RS2A 4AIIA 1F2UB 2WHXA
chains in the Genus database with same CATH superfamily
3DUWA 4GI3A 3KOUA 3P2MA 4JQOA 3V97A 3WKCA 2QSYA 4AAYA 3EEIA 1JFRA 1PG2A 1V96A 3NRBA 1QLWA 2Z8YM 4CQNA 3RS3A 2Q27A 2B92A 2AEMA 1JBKA 2CNWD 2OPBA 4DREA 4V1CI 4OL0A 5H3LA 3V4OA 3DEYX 3HLYA 1AGRA 3MWDB 5DYTA 2NU9B 2HU5A 1AE1A 3VV3A 4BFSA 5BRJA 1LLDA 4RNDB 1MO2A 4XVQA 5CT9A 3CUSA 1QQTA 4EEXA 4CNBA 1HT0A 3N70A 5GONF 3DF7A 1JEAA 2C0CA 5F51A 3H4VA 3COPA 3Q9UA 4HMQA 3DXFA 1T0JB 3RR2A 3QVGA 4KE8A 1T2FA 1HE4A 3WKDA 4BKRA 1TFRA 3N58A 3ZVNA 1BNCA 3FROA 1D0IA 2FTKE 2ZP1A 1JEYB 4G81A 4P34A 2UUBB 1CJSA 5ECDA 4MS1B 1Q5PA 1KZGB 1L7MA 4LAFA 1PJBA 3L6OO 4D6YA 5CDHA 4OHWA 3BTVA 3IL2A 4B85A 3K2IA 5JWHA 1KI9A 1MQAA 4R0NA 1UUFA 4ZQIA 3ELUA 1M66A 4MO2A 4AO6A 4JUFA 2MJLA 1Z6AA 1GCAA 4DRYA 3V7FA 1SD5A 1WQ4A 2EWWA 1L7XA 3N05A 2Z6AA 3LGSA 4JP8A 3CUUA 1ISHA 4TQ9A 4XJVA 1AXGA 5DTMA 4R8MA 2GTIA 4XB2A 2HRRA 1N6IA 1HTTA 4JS0A 3JVVA 4NYIQ 4OHPA 3AHEA 4PZDA 3WAKA 1BDMA 2OBMA 5FPYA 3SBOA 1SN7A 2OHIA 4JR2A 4C7BA 1E1CA 2GYVA 3PX3A 4XQ9A 4IG4A 1II8A 1UMDB 4E4TA 1PGOA 1J0AA 3MUFA 16PKA 3N9IA 1ISFA 1X7ZB 4QJ4A 3RYIA 1N9GA 2E1PA 1Y0BA 3L8DA 4INJA 4Z4QA 3GJ0A 3MJFA 2BBTA 3OWOA 3UWOA 4LYHA 2FN8A 3IH5A 3HZOA 2NUTA 2P5YA 2W4MA 4FU0A 1AJEA 5EHZA 1G17A 4Z2AA 1EFRD 2XYPA 2J9RA 2NSDA 3SBXA 3IO5A 5IWCA 4AY6A 4ZC8A 1COZA 3UAVA 5AVTA 2YUIA 1V8OA 3EASA 5HA5A 3RK4A 5LXTB 4P4LA 2BHLA 2AFRA 4DW8A 1C1DA 1DQNA 3TQCA 1OFIA 1NLYA 1FUUA 5NULA 2PT7A 4FMCF 2DECA 3RV3A 3WMRA 1EWKA 4PC1A 4C3VA 2IHUA 1A71A 3RNOA 2DPYA 1NVXQ 3QHAA 1Y3BE 2JRLA 3CY6A 4MEBA 3UJ8A 2ZI3A 3P0RA 3PEFA 2Q21A 1E3DA 2I9KA 5F5XA 3HFRA 3W6NA 1VGRA 4FCWA 5TQ2A 2XMGA 5F77A 3DL2A 3L7AA 4ALIA 4E5DA 5CFLA 2BI8A 2C00A 3PEYA 3DT9A 2Q9BA 2OD9A 5IJ9A 4JNKA 3GMDA 2IVZA 3KIPA 4LC1A 2R1VA 3I64A 4N4AA 3T7RA 3WLRA 2EZTA 2W98A 3BZUA 4LXXA 4UXIA 3ADPA 3IQIX 4DABA 2SKCA 3KB6A 1QTQA 1S2IA 5GY7A 3ESDA 4MUAA 1XAGA 4MHTA 2H7YA 3SXJA 4C05A 3H6KA 1PR4A 3M1AA 3PRJA 4ZAFA 10MHA 2WF8A 1RKQA 1LEHA 3B1JA 4W1QA 1LC0A 1FDVA 4O29A 4AX4A 4XWKA 4Z7QB 4X9XA 4ZDWA 3UMSA 1GAXA 3WP1B 5JBIA 1Y4DE 1HTWA 1K9SA 2IHJA 2P4EA 2WIDA 2EATA 3EDQA 3ZE0B 3ORHA 6CHYA 1BIFA 5BW8A 3U6KA 1UEIA 4IUCS 4OQ4A 1FCJA 5KYUA 1JU4A 3AEYA 4MVWA 1HM5A 5SZHB 2J8ZA 3TDNA 3A9CA 3QI2A 2Z5GA 5JWOA 1RWXA 4Y2YA 3ZOZA 4TWZA 3ONWA 4CM4B 1W4ZA 3GUZA 1VLVA 5BSEA 3LKDA 2WD7A 1QBKC 4XIJA 1GUBA 1MA3A 3CCCA 2YJGA 4CCWA 3DW3X 3D54D 3V1LA 4QPDA 2WDPA 4PFJA 3KQWA 5K1ZA 5JSKA 3FNGA 3A6KA 2HRCA 4IXNA 4P58A 1T3ZA 3P0HA 1B15A 4OF4A 3ZXUB 4IHJF 3AI7A 3U60B 4K5QA 4V0LA 3W1WA 4W5QA 4ZD6A 4B9EA 1OROA 1WX1A 5I7HA 4URYR 5IS2A 1USWA 1JJ7A 3QV1A 4HAUA 1T0UA 2X0RA 4LK3A 5AJVB 4ZCTA 2FKNA 5IDWA 3OEWA 4LFCB 3RK0A 1ST2A 4UUQA 2O3TA 3E8MA 4FGKA 1G9SA 2JB9A 3E81A 2YMPA 1AX9A 3FETA 4I1YA 3VPBA 4UU7A 2QK4A 2GRAA 1Y8RA 2IUUA 4MEAA 1ZNWA 3SSNA 3L7MA 4NENB 1TRHA 1VLMA 3ASVA 4ALMA 1B2LA 1ZH6A 3OCJA 1JGTA 2H2GA 1QIGA 3NHRA 3VOBA 4PZLA 2KSQA 2HDHA 2M32A 3DOCA 3R40A 4M86A 4UVHA 3R7AA 3EW7A 5BUQA 3DKPA 3EW9A 2HNAA 3RYFA 4J94A 4KVFA 1HE5A 3Q7SA 4HNGA 3S29A 2FCAA 1CQXA 3JALB 3N76A 1L4YA 3NEPX 1OH6A 1Z12A 5LQUA 1CJTC 1JDBB 4EENA 1U9ZA 4RPIA 1YAHA 4IX9A 3ZEAA 2NXWA 5CTJA 3CQ9A 4DV1B 1NAIA 2R48A 3L9XA 4DTCA 2Z57A 1SVOA 2QPLA 1A9RA 3DHYA 2Q9AA 3G2KA 3KQPA 2Q2VA 2DWOA 3LUDA 3N6XA 4AQDA 5C8XA 4E5KA 4QYIB 1Z4OA 5I4BA 3V4ZA 3EZGA 3SX0A 3CF4A 2G71A 2JC3A 1G20B 3EQ2A 3HR8A 4JI8B 3HM2A 3K32A 1NY5A 3PXXA 2EYQA 4H16A 2GPYA 4QVGA 1FU7A 4G5XA 3VQTA 5I4CA 1YQTA 2WFLB 1ZRMA 3RLIA 1W0KA 1E4YA 2X0IA 1T1JA 4MUYA 1ZR2A 1M6VA 4NVRA 3E27A 3Q2OA 4B83A 2ZYSA 2G40A 4CMCA 4E13A 3ZJUA 2QY9A 2J59A 4HYEA 5A4JA 2XB8A 2Y68A 1WSBA 1B1CA 1GPMA 2X4DA 3QLVA 3V8RA 2WVHA 4J6FA 4CTOA 3U4GA 2ZM6B 3S2UA 5DX0A 5JYDA 4YR7A 1PJAA 2FDCA 1JDPA 3KQSA 3HV2A 3P45A 2Q6KA 1WDKA 2ALJA 1FTYA 1UBKS 4C7XA 2ZT5A 5C9ZA 5KTMA 4NS1A 3ZVRA 1QWOA 3ZV4A 1QANA 2J30A 2XYRA 1IBMB 1XRLA 3QVLA 3IUEA 1IM8A 2IW1A 1A4RA 4HDOB 3X1DA 1PN3A 2GHIA 4E5SA 5CYGA 3LPNA 4FFRA 4EW1A 3C3EA 4WLEA 5D1HA 5K6AA 5FOWA 2RHRA 1RWPA 2VC2B 4WESB 3RO7A 1JQBA 3GJZA 2GMWA 5J4KA 2HD4A 4ND5A 3KC2A 4BP3A 4J9VA 3AKZA 1M1NA 2R8RA 2DHDA 5ALTA 3RYHB 4ENVA 3HB5X 3VR5H 5K05A 3SMQA 2VP5A 1YD7A 2FZLA 1FL9A 5DO9A 2ZI4A 2XUKA 5FA6A 5J43A 4F8JA 3BCUA 1NQVA 3KAPA 3VDNB 3PDIB 4Z51A 1UP4A 1L5QA 3RIYA 3ABOB 3I72A 3L4SO 1QYWA 3JQ9C 2O5EA 2EKBA 1UXKA 3QYAA 5IWAB 3B3JA 3RHFA 5J58A 5HPYB 3EMDA 4O1IA 5LWHA 1T8WA 4O2AF 1BH2A 5J59A 1DT5A 1CUBA 3JATA 2WB4A 4B0OA 4HNAA 1RJFA 3ZW9A 1G6Q1 3G0BA 4YIKA 4REMA 1QORA 3S0JA 4X1YA 2WBLC 4TYYA 2FW1A 3M9WA 2GN1A 4LMPA 2IUYA 3K96A 2F9LA 1Y9ZA 3ESQA 2FEWB 2XRMA 5HF6A 4M89A 1BVUA 2J6HA 1N0HA 4G1CA 4DQ0A 4E1BA 1VG8A 3MGBA 1DBWA 4MHOA 5BSKA 1TW3A 3TBFA 2QTHA 2CN1A 1TUGA 1VIMA 2W4IA 3DEZA 1WZEA 3NXSA 4CFZA 1JLKA 3CUWA 3M6IA 2QJWA 4IF4A 4WPGA 5BSWA 3BORA 4BPRA 3AUAA 3FBTA 4OB6A 4C08A 1IN4A 2NO1A 1KWGA 3IAEA 4UBOA 1UXJA 1V71A 2PZEA 1OXXK 4TGLA 1E9CA 5AKGA 3VFDA 1Z56C 1K7FB 2DWQA 4A82A 3PFBA 1XF9A 1S9HA 3OIYA 4ND1A 4ZKDA 1W88B 2YHIA 3THYA 1JHVA 5HIKA 1JQ3A 1NW9B 1GTSA 3H87A 4ND7A 3IPAA 2I4TA 4OXKA 2JAQA 3LUPA 4JA2A 4KMRA 3A25A 1J33A 3I39X 5B53A 1BWSA 4GKVA 4M53A 1GIAA 3OZUA 4INZA 2VJNA 2VTBA 1EBFA 1LSSA 2OBFA 3IDZA 4Q19A 4YRFA 5E0OA 5H16A 1NW7A 1JW9B 1Q0SA 3BJZA 2BY4A 2QLMA 4LQ4A 4A8TA 2ZQYA 3T1OA 3ZHVA 4B5LA 1V9CA 4EFNA 1MT3A 5GJVC 1N7IA 2B34A 1A9SA 4H0FA 3OPVA 2XA9A 1W4CA 2FFHA 4WCFA 4YONB 1JDUA 5IP5A 3E4CA 3H99A 4BO9A 1OXUA 2P7HA 3NAQA 1ZD8A 4D26A 1BOFA 2YZ2A 3SKYA 4M0UA 3MGKA 1G5HA 1WTAA 1IOLA 3PC8C 2VL7A 4D5GA 4H4DA 2O7VA 4MV1A 5AHXA 4F11A 2C88A 1GARA 2ZIEA 3HABA 1YJXA 4GXTA 4J6EA 1NLFA 3SHTA 5ARBA 2R1ZA 1ND5A 2RE8A 2X0EA 2WKRA 4UJ5A 3PT5A 1Q0HA 4KHPB 3WOVA 4QBGB 1FW8A 1L6RA 2X2EA 3H0CA 3EPJA 5L51A 1Y6FA 1GY8A 2ACKA 4RW0A 3ANSA 1HZZA 1BMFD 1V6SA 2LCIA 3MT8A 3WLEA 1I4EB 2E4XA 2HK6A 3F96A 4AF6A 3UWPA 1BJTA 3C4VA 2PGDA 4JLPA 1F6BA 4E5VA 1RHRA 1WV0A 3FZQA 4MW0A 4Y2SA 1AQLA 3F6CA 3JQAB 3GZNA 3NU1A 4O4LB 1OPRA 4FM9A 1JMVA 4I3HA 4JGIA 4BVBA 4UHHA 1QR2A 4ZZIA 1VCHA 1CRQA 1YZFA 5AKYA 1I2AA 5J23A 1OWNA 4R2IA 4TXHA 2RG7A 3E35A 4UTZA 5CVJA 1I7NA 4CW7A 4E2ZA 4H3SA 3H7IA 3L8HA 1MRSA 1ICEA 1E2DA 2C2OA 2OK7A 3NNSA 1P77A 2H18A 4GEKA 1GITA 2QTAA 3B78A 3PNQA 1MQSA 3AEUA 3QLTA 4L3VA 2G5TA 4PX9A 3EUAA 5H9WA 5EHXA 4CXMA 1UWVA 1J0CA 3CO5A 3LCJA 4LRSB 3LL7A 4F5YA 3USCS 1HA3A 5HOQA 1PS0A 2PGXA 3UJBA 1LX7A 2FSUA 4RLFA 4AYTA 5AM4A 1I0IA 2H5IA 2QE7D 4N0QA 1BXZA 4QARA 3TTTA 5KDOA 1IAQA 4ENUA 2H08A 3NTOA 3FYUB 4IFBA 5FI1B 4RDXA 1EP2B 4DV5B 4CEHB 1ZDMA 1MDFA 3NHLA 4Z7OB 3I12A 4YQZA 4MRSA 2VRCD 1VKZA 3F3KA 5JUWA 1TJ4A 4ENRA 1J7KA 2ZAYA 1XEWY 4F7WA 3L92A 4B48A 4IDGA 4HQ6A 4Z0PA 5ALQA 2H51A 2UYGA 1PS9A 2QN6A 3G0DA 1GPBA 4O59O 4ND8A 1CLEA 3JYHA 4GNRA 5IANA 2PL1A 3HCNA 1KZ9A 2AKEA 2FE1A 2R62A 4P8RA 1GZ4A 4KX5A 2XV1A 3PI6A 1YDMA 1SVSA 4H59A 2IWRA 3VO2A 2YIDA 5JVDB 4N0DA 3B2EA 1K2VN 1P61B 1RYMA 3EBLA 4ECAA 1JJIA 2VBGA 3I30X 2VPTA 4IDFA 1VFPA 4RVOA 2DTXA 4JZKA 5EXSA 1KZYC 2J0UB 4MO9A 2PT5A 1T5OA 1U5BA 2EF0A 3DMTC 3NHBA 4CUJA 1C0IA 5JTUA 3ZHZA 4YPFA 2Y9MB 3KKQA 1OX4B 1JHMA 5TT1A 3WFIA 4DA6A 2OP1A 3ZCRA 1KPIA 1N75A 1QCCA 3ZJ4A 4E2WA 2YV4A 2NZUG 5TF4A 3JYNA 1JH9A 1EX1A 3SBDA 1I6LA 1YI8A 3MD0A 1YZHA 1Z73A 5FWNA 4TKZA 2FZKA 2F8MA 4EJ2A 3QU5A 1RLJA 4GYYA 3GVIA 1TMGE 2J41A 2YWBA 3WVNA 5JJIA 2WRZA 1JSRA 3GMIA 3UOWA 1SXGA 2GBLC 1GU0A 3EB9A 4B3DA 3M81A 4NICA 5BXQC 2NU6A 3C85A 3DG9A 3LMKA 4QRDA 4KXXA 5FLYA 3UTCA 4C7VA 2OXCA 4D5EA 2G1JA 5FBKA 3N39C 4YUZA 4V03A 3NWBA 3TNLA 2E6UX 2DPGA 3F9CA 4HNVA 3UJHA 5EIXA 1DQRA 4LDQA 5FWYB 1B8OA 1Z82A 3P2OA 3WLLA 1ODFA 4OK6A 4BNVA 2I7XA 2NSLA 1GTJ1 1G9XA 2ZS9A 3TSCA 1KQNA 2AJBA 2OG2A 3ZJTA 4IDBA 5KVCA 3KQKA 1JFVA 4AY5A 1ZN2A 2O2DA 3LDAA 4J1TA 3S2SA 3TI7A 3B1YA 3JQGA 1QNFA 4KYUA 4LWPA 3CONA 4IJQA 2WTUA 1BHJA 3G2NA 3EGEA 3ZH2A 3WBBA 4ZCPA 4DB4A 5BXYA 1BKDR 4P3OA 4P31A 2CT8A 5DISB 2GEBA 1RRKA 2V5AA 2XNKA 3H9CA 3DO6A 3D2AA 4EPYA 2GXQA 1V2GA 1QHGA 3G59A 2WMDA 4I3GA 3D4NA 3ZCSA 1A9QA 3K94A 5FNVB 3N2KA 4OHBA 5D3QA 1UMCA 1J24A 2AG5A 3OZVA 5JPCA 4PWYA 2V4MA 3OE4A 5KVAA 4TMXA 1M72A 1U8XX 3AUJB 1X8XA 2PXXA 3AY0A 1QLHA 1IN5A 4F21A 1J56A 2ISQA 3OP1A 3NHFA 5ED0A 3AGPA 4D9CA 4I1RA 3EC2A 1JLSA 1OBFO 1AD2A 2VNJA 5FR2A 2JI6A 3BIWA 4WBSA 1R16A 1U80A 4O5OA 4OXIA 2V3CC 4B3MB 1JEEA 1EWVA 1A8IA 1K8XB 4MYSA 2G7ZA 4RCVA 2WJPA 2WMOB 4CJXA 4W5HA 1XVLA 5A9SB 2XY4A 1WB9A 1VBFA 1YBVA 2C5SA 3H2IA 4YJHB 1Y33E 5LP6C 3VGJA 4KJXA 4BO8A 2Z2ZA 4CV3A 3RC3A 1S5PA 3BRCA 4XDZA 5AP9A 4LSMA 5HIAA 1SCAA 3ZE6A 1HMPA 1E3IA 3IBTA 4JITA 4BKOA 2MSDB 5B7PA 4UD2A 4Q1BA 1UJ6A 1K6IA 3SEAA 1VIAA 1HFWA 5P8WA 2YWJA 1KQOA 2M6LA 3RI3A 1WEKA 3IDAA 4L4SA 2V97A 1RBMA 3MS4A 4RSRA 5FL7A 1YAJA 5JAZA 2ZI6A 3RD5A 3C70A 2WPDD 3HUEA 4X8LA 3IS3A 1ZCJA 1ZRSA 2E2WA 3CUEF 1IFXA 5TRTA 1ADGA 5JJBA 1S3FA 1ZW6A 3NHKA 4JELA 1GYRA 3QHPA 3VKWA 2EP5A 2XDYA 5IF3A 4DQXA 1ULAA 2EJTA 4MNTA 4GL2A 3W5HA 3WY9A 5KMGB 1U0HC 2JJ2A 1RWQA 3OCVA 4JASB 4TXJA 1Y4AE 2QIOA 1T5BA 2ETVA 3P4UA 4OQNA 4B3JA 1YS4A 3EGDA 3B1WA 2IYFA 3DD1A 1IQUA 5DXFA 4LXIA 5AM3A 3QU4A 1KFEB 4RF5A 4WBXC 4H60A 3RUAA 4IXWA 3W5JA 2IU0A 5F76A 5ICMA 5FOUA 5DXAA 4FDVA 2YY7A 4HX9A 4K9NA 2EG9A 4DPMA 2GM5A 1OZFA 2V7XA 2EKZA 1RIFA 4WFQA 5DCWA 5L6MB 1D5WA 4LA4A 3FDZB 3ZTWA 3ILYA 4RK7A 1OT3A 4DNFA 1G4AE 3GEIA 3OHMA 4GLLA 1U8AA 1DXOA 4IFEA 1NRJB 3LHSA 4KR0A 4IGFA 4IHQA 2NSYA 1D3AA 2RHTA 4D43A 3D8UA 2J6IA 4FGJA 1S1MA 2R1TA 3KDSE 3PD7A 1NU8A 2HDNB 3E3MA 1ZD3A 4Z3DA 2GXSA 4DHEA 1SKYB 1SG9A 2J5BA 4HDKB 3PVZA 4N9WA 1VSBA 3RDPA 5CFOA 5KTPA 1EVIA 3PUJA 3PQ8A 5DNVA 5C53B 1H2AS 1GLNA 1TA0A 2QV0A 4OHOA 2C2WA 1F1JA 3UGJA 3U4QB 4OI4A 2I4LA 1G66A 1IULA 3G9ZA 4WFKA 2ZAMA 4PW0A 4BWGA 3NO4A 5LA6A 3QBVA 4L0MA 4ERNA 4HDNA 2E0IA 1XQVA 4HEHA 1UZMA 2FPSA 2GBFA 2HF9A 2PSDA 3OCUA 1X42A 3IYLW 3QVUA 3NBFA 5IYZF 1V4NA 3HRKA 4HXEB 4QOGA 1JWAB 4ZK6A 1BRTA 4MUFA 2J4FA 1P5JA 1AUVA 3CX4A 5BQPA 3PA6A 4YCCA 1KWKA 2FOLA 2HA6A 4NMHA 1EFUA 1A3CA 1Z4QA 1C1XB 1KI1A 3FD8A 4E70A 2QMOA 5FKJA 3PS9A 3AIKA 4MYRA 1NVWQ 5JPIA 2AG6A 1E3WB 2AFIE 2XNDD 1TRKA 1JIVA 1DKUA 1JSLA 1K3TA 1N2CB 1KP3A 3NH6A 5BO5A 4DT1A 3OQBA 5K0JA 1KU6A 5K99A 5AR1A 2XOKA 2QVYX 3D4PA 4P4SA 2GD1O 4C7JA 4BGDA 2CFCA 3EEOA 3ZWKA 3KHSA 2GAJA 3VTAA 4EG5A 2QP3A 3H5OA 1GYPA 1WWKA 1YOBA 2O8DB 3C7KA 4GC5A 1P9LA 4ZALA 3T34A 5CFQA 2QUIA 4Q3DA 2J45A 4P4GA 2PKRA 5ITZA 4EFKA 2KLHA 3DLTA 1E98A 2IHYA 4FHEA 1FYVA 3K30A 4L6CA 4UARA 1TFUA 4LX0A 4FZ3A 1P1CA 4JJ7A 2B3DA 5HILA 4BVKA 5F1PA 2HSEA 1QO7A 3TGLA 5MFPA 1HT3A 4RTJA 1DKOA 2JFWA 3AIOA 5HQ3A 1U9YA 3QUQA 3FOZA 1E58A 3EJ6A 3OVMA 1TM7E 4PN3A 1PR2A 3BUSA 3PDWA 2EJCA 1EUDA 2JCSA 1SHZA 1E1MA 1ZGAA 1GGFA 2QOEA 5AI8A 2IK8A 2NVOA 2HWXA 4EJ0A 4EB6A 2O57A 4F38A 3V48A 3W7VA 1KXJA 2WQZA 2Y2UA 3WAGA 3CPSA 1KAEA 2WAXA 3D43A 5FWXB 5B6JA 2CF6A 1JDNA 3DKKA 3N5CA 2VHQA 3R6GA 1I2CA 5NLLA 3AB8A 2UXBB 2ISSD 3O92A 3KJQA 1QZ3A 5EE1A 3RJ9A 4DPKA 4K6KA 1YJAA 2YBEA 2J5RA 4MHSA 2X0JA 4OPMA 3G1TA 4Q6BA 4TYQA 3SZLA 3UB4A 4MIKA 4CM5A 4D4JA 3QLJA 3UICA 4EHBA 3KSAC 2CB9A 5DJ5A 5E2BA 1OREA 1CQIA 2BKLA 3I6ZA 5C3MA 3TW6A 4PCUA 3STYA 3GZ4A 5IZ4A 3DLAA 5CA0B 3IIIA 4G37A 3UFBA 3IAFA 1KBQA 3TDMA 1ZICA 3IP3A 1O96A 4RPLA 3FZEA 4YUXA 3NDJA 1E2IA 5K2MA 3HADA 1ZKMA 3WRYC 4I55A 4G5OA 1HOTA 3L4EA 3DR5A 2Y1WA 4GOKA 4Z99A 3S99A 3M89A 1SCQA 2DWCA 4MS3A 3RS8A 4XZ3A 1S3GA 3K6SA 2RH4A 4NYIR 1YHZA 4QNNA 3H8JA 1QHSA 3A11A 1YU9A 1V6AA 3B3GA 2HIGA 2Z5FA 4LCEA 4F6CA 3ZZTA 4EUKA 3HVUA 4QHSA 3H2BA 4JDUA 3KRTA 3N0XA 2WPNA 4YJFA 3WBJA 4Q4JB 3QPWA 4OG2A 5B3LA 4MYDA 4BFVA 1B0PA 2W22A 3TNJA 2EHDA 2CXQA 1SUSA 2GCPA 3C87A 5CT4A 5IUKC 1T4GA 2UZ0A 2ZJ1A 3STXA 5A5GA 2FQXA 1VI6A 2H4HA 1R6AA 4A8JA 1RC1A 1KYYA 3G9XA 2WYUA 1P0QA 4EW6A 5IG2A 4JAVC 3T06B 1YZLA 2PS3A 3CG4A 3Q15C 2C7GA 1DV1A 5T4EA 3DE0X 3HDHA 2PH3A 4OM8A 4PYKA 1NA5A 3CTMA 2DPMA 3BMOA 4BNLA 3RPEA 1SHLA 3NHAA 4EK9A 1PLJA 4X64B 3AF6A 5KKAA 3FSGD 2WU4A 2RKBA 1AQJA 1VPTA 2G70A 2Z56A 4YRZA 4DIEA 3OQ1A 3VTZA 2OCXA 3R41A 3TNDA 5HUHA 3WLKX 2VSFA 2E7ZA 2WIAA 4R9RA 4RYLA 5KTTA 1PF7E 4ZOBA 5IM5A 2P9HA 4C22A 5CA1B 1J8VA 3KNZA 5DT9A 4JYMA 2QBYA 1CQZA 1TAGA 1VTKA 1SUIA 4OJYA 2F1IA 1YS7A 2HH9A 4P33A 1N2XA 1J23A 3NH9A 3L8EA 3P9QA 5H70A 4FR2A 4CU5A 5FFMA 4HJXA 1EFVB 2BGMA 1YS1X 2KLBA 3V4FA 3OTOB 5E9AA 1HDEA 1EM8B 1Y82A 5JAPA 4QBIA 1RHMA 3SVZA 3WNBA 1NXTA 3AJAA 3AHDA 2X0FA 3USZA 4F12A 3WR5A 5ALVA 3QKIA 1DBPA 2HSZA 4KO4S 5H7XA 4DR2B 1C30B 1J00A 1J09A 3OF5A 4OY3A 2A1TS 3BWVA 3PA8A 4GZLA 1V3UA 3O1LA 4P7KA 4UHJA 3T94A 2I66A 4C29A 4F84A 2PUBA 1KEWA 3UV3A 1T8PA 2PO7A 4LRWA 4AICA 1UR5A 3G49A 3ZY2A 2YR0A 4MW6A 4QPNA 3V6MA 2QTTA 3GHHA 1T8TA 4C2AA 2WR8A 3OI7A 4H6WA 3RC8A 4KSBA 5AVOA 1O2DA 4Y2UA 3B5JA 1ZH2A 1TECE 2W6JA 3EZFA 4AY3A 5K8UA 4YMTA 1DL5A 3CPHA 4NAUA 5E8JA 5BPFA 3OA0A 3PPVA 4OHMA 5DP1A 3BH7A 5CBKA 3LTNC 5CEEA 3LDGA 1OI3A 2ES4A 3Q7IA 3BZWA 4ZQCB 2E4AA 4MW9A 2V0NA 5EHIA 3L8FA 3DPUA 4B3SB 2R2AA 1D4FA 1PYOA 3D7RA 3C45A 3KYJB 3M70A 3DTVB 4MQFB 3X0DA 4E1AA 1K63A 5ALXA 5AXBA 5JY1A 4LVNA 1E79D 4BQFA 3RVOA 3RV4A 1LX6A 3UMFA 5TJ9A 2EJVA 1XA0A 5EJIA 5B2FA 1J8FA 1AQIA 4QTTB 4BMNA 2JHGA 3W79A 1V11B 4CUZA 4DHWA 1WUTA 2Y1XA 1IZYA 4EY7A 4BRZA 5G0UA 7REQA 4XJSA 4IIFA 4M9SA 5CX4A 4LCJA 3QF4B 2FGKA 3VO8A 1RXWA 2XXAB 1I6MA 2H54A 1XRRA 3IEKA 1D4AA 4RPGA 4NBTA 5EEGA 5IKEA 3AIIA 5LXTF 1V25A 4IIBA 3ZBUA 1CYEA 1Z0AA 4OGWA 2DY1A 3QX3A 4MAAA 2X77A 1CY4A 1EDZA 4Q7KA 5EVCA 4YUAA 2XNHA 5CD1A 1H5NA 1P9NA 3OPYI 3OZCA 5AW4A 5GZ3A 3H0KA 2PD4A 3LUCA 4IHKA 1U2TA 4K87A 4S0XA 1F2UA 4DVGA 2PFSA 1L4LA 1FTSA 1W5EA 3NPAA 4CPDA 2V0CA 3E0XA 5EWMA 5BR4A 1E7MA 5AK0A 5GIPE 1FFBA 3LI2A 3CVUA 3Q0IA 2LCQA 4PM4A 3RLFA 1JI3A 3H8VA 4Q9LA 4EP1A 1Y3DE 1ILEA 1DO8A 1YC2A 3LQ2A 3W7BA 4EJ6A 1P2VA 1SCJA 1DAOA 4RMIA 1LUAA 3JZIA 1A8HA 4UM9B 5KQSA 1N77A 2G0TA 5CX1B 3SS9X 4MQEA 5DGCA 2JW5A 2GAOA 4IDQA 3RVKA 3SFTA 4C6RA 2AHOA 2H06A 3R6WA 4E12A 2ARKA 1Z83A 2OCLA 1L3BA 5G0SA 1WTCA 2BTQA 3BEOA 1P2SA 2AG0A 1PO7A 5HMLA 3FNIA 4KMOA 1LBEA 3P19A 3ZXIA 4CKCB 2ONCA 3DZGA 1XNHA 3RT7A 3FNBA 4JVLA 4XI9A 4W8GA 2VJYA 2HHJA 3PQ3A 4A36A 4LHXA 5BWOA 4BRWA 5LQSA 1ZWKA 1EDEA 3GQVA 3FRIA 2K2QB 3I5AA 1V37A 5DULA 3JXEA 3TQSA 4ALKA 1Q0TA 2FMFA 4IFTA 5J2UB 3WB0A 3HBLA 5BW5A 2Q99A 1GV0A 3OQVA 2P77A 2WC1A 3HU5A 1LPBB 4PRZA 4PY2A 1A04A 1ST3A 3FTNA 1Y1RA 1PNTA 2VO1A 1NBMA 1RACA 2XLCA 4BE4A 2AK3A 3ANTA 1I4LD 1DEHA 1Q21A 4K2AA 3RAPR 3WSWA 4QYTA 4RELA 3B12A 2XGOA 4K6CA 4P08A 5HKOA 1XXHB 1AH2A 1P44A 2NGRA 4A16A 1X1TA 5T6MA 4DQUA 4EF6A 4MIEA 1NQUA 3D9QX 4ZXFA 2YRXA 2HV8A 5JZ9A 2I8LA 2GO1A 3L4BA 1NF3A 4KRGA 1X86B 5JQGA 2QZZA 4V0MA 2QSZA 2EFDB 4FIZA 5C8YB 3ZCUA 1GPLA 1W4AA 4MIOA 3WB2A 3O31A 1V1MA 4AN0A 1C7ZA 3HCFA 3E1GA 3KR0A 4QGSA 1M34E 3E70C 1KPHA 4I9GA 3KXKA 4LYEA 1E5QA 2P30A 2Z8YA 4NJOA 4Q4AB 1JRLA 1NBME 4L3WA 3JW8A 4G1FA 3HKCB 3IHTA 1BVRA 1PTJC 3O8NA 1JS1X 1SOVA 2CLCX 1CS4C 3OQIA 2YJTD 4OQMA 1CY0A 3V8QA 1EXDA 2UU9B 3D3KA 1YIOA 3QE3A 4WNCA 2J85A 1WSWA 4NLLA 2GN0A 1I3NA 2N75A 3ONDA 4BQSA 2HJRA 2HUPA 5AVKA 1YVEI 3MJTA 3R75A 3GA7A 3MQ2A 4DLPA 5TLSA 1M0EA 4QULA 3VHLB 5EXTA 5JEDA 5A6SB 1Y9DA 1YZGA 1FVHA 2R7NA 4BMOB 2ZJ8A 3RS0A 3BREA 1F4LA 3KJNA 1O97C 5CBPB 1ENPA 3FCOA 3R77A 1QE5A 4RH3A 1TCAA 1CJVC 4JB3A 4OLAA 1KKLA 3O8QA 2HA7A 3BWCA 1L5HA 2AC4A 1UC4B 3C74A 4OIFA 3LP5A 5C81A 5CDTA 1RAAA 3TR0A 5LN1A 1PIWA 4PFSA 1FFCA 3W5SA 3ORYA 3WA6A 4DANA 5C7LO 5FUWA 2IIVA 1SIWA 3KE9A 4BWFB 3AQIA 1UPAA 1CB7A 3DFMA 4BV8A 4J3NA 3F6YA 3UJNA 4M8LA 3P32A 4W1PA 1ZK1A 3GLTA 2WJ3A 2GEFA 2EX0A 3ORRA 1U2GC 2ZYDA 3WLQA 5HP4A 3U2QA 4ARCA 3EYWA 3QUAA 5FTJA 5PGMA 1PK9A 1P72A 2BKXA 3CRNA 1T9CA 4MWOA 4R0MA 5IDQA 4NNOA 3GP5A 5E8RA 4LPSA 4UXHA 3KPJA 2ZYRA 1LJUA 1N0VC 2ZUTA 2VSOA 4F4FA 2AJTA 1ORVA 2V6JA 5AK6A 1FFGA 4FJ0A 3FYHA 4RFSB 1XPRA 3CLVA 2ZWMA 4HDSB 2QNIA 5EMLA 3KLNA 1FRQA 2CDCA 3I0NA 5DM0A 2QUKA 3RSGA 3W06A 1K0FA 1SC9A 2CLSA 4PGHA 4WACA 1D0SA 2B82A 4AKEA 2ZVDA 4D41A 5FBQB 2VH5R 2DRIA 2BRUA 5DVZA 3LDUA 1HBJA 2IZOA 4RIFA 5C34B 1ZAKA 4OMDA 4OREX 4Q47A 4EG0A 1DXHA 1O6CA 3O83A 5A3VA 5A5DA 5GAJA 3OTHA 2KI5A 3FZYA 4Q3KA 2LTAA 4X62B 2B30A 2HLHA 3KQLA 3W8EA 3CEMA 2BMWA 3PX7A 4DAEA 2P9ZA 5KX5B 1BG6A 3B1KA 2WP8J 3OWXA 5E4YA 4D45A 3A6FA 4MV3A 2Y0EA 3Q9SA 5JMOA 3DMYA 3MSXA 1T6XA 3IR7A 4BECA 4O1HA 2OTCA 4EW3A 3CKMA 3D2CA 1ZGGA 4RH1A 2XMSA 3CXUA 4QQRA 4ZO7A 4ACBA 3AMVA 3CEHA 4ZANA 1JAIA 1KEEA 4QJBA 1CY8A 3IBYA 4YXWA 1BD3A 1NMYA 5A6VA 4DMMA 2E4ZA 2GHRA 3FYSA 3NTLA 2CHVA 3AEXA 1G55A 3L1VA 2GD2A 2X1MA 3RHTA 4Y1GA 2H7XA 1Q7BA 5J5AA 3HJGA 3VR5A 3ZEIA 3EZYA 4JOBA 1O89A 4AUMA 1J42A 4S1VA 4UNRA 5AVSA 2B9EA 4BBJA 2PS9A 1G8AA 3O2SB 1MO3A 4MPTA 5EZ6B 1E2KA 1WF6A 3DHWC 4TQUS 3MBKA 4NBKA 1NU6A 4INAA 5KNBD 3PG5A 3QVGB 3FPKA 4G0VA 1W4RA 4RC9A 1CULC 2X1HA 4TTSA 4L5IA 4S0ZA 2FW0A 3P9XA 3QA3E 4MW7A 3QX9A 1U5CA 2XYHA 4FYPA 4JP5A 5IF9A 2FMKA 1THTA 1OKKD 2JJ1D 3PXCX 4E2FA 3W8DA 2FWPA 2FZEA 3R3XA 3KQYA 3RSSA 3FHOA 5HOEA 3NCTA 4JI4B 3SQNA 3NGLA 1JYFA 4EB0A 2NO4A 4TLDA 3DC7A 2PNFA 3OU2A 2V98A 1I7LA 2WYVA 3KJEA 4DV7B 2FHSA 2H3HA 1Z74A 3E6AA 2GJAA 3PFGA 1R9GA 5LR6A 2PX8A 2F3UA 1SK8A 3T3OA 2IS2A 4N82A 1X1SA 1ZMRA 1E1CB 3B1XA 3ICPA 1ENOA 3JWPA 1II8B 2PL9A 3LBFA 3OMWA 1SOMA 4PIPA 3RYIB 3F3MA 3QFSA 1RJWA 4AJJA 2Q6OA 5KINB 2XQFA 3JAWA 1NY6A 3P96A 1DT3A 4DSZA 4W99A 1JPJA 5LB2A 1N8KA 1YB4A 3CX7A 3EIOA 2XMDA 3FOCA 1DOHA 2EFHB 2I62A 4D79A 1BDHA 2MSKA 3CUVA 4OOFA 2WOOA 4RQUA 5CM9C 1QM5A 2C04A 2OO5A 1K5HA 3CV3A 4ML3A 4I14A 4XFDA 3L6RA 3HV0A 3DYIA 4Z9BA 5AKLA 4F91B 3DD5A 1OFUA 4MS4A 1U2RA 4DLUA 1Z5WA 3AY3A 4FEAA 5MGNA 4BAUA 3Q72A 1C1DB 1ZOSA 1EFKA 2EP7A 1V9SA 2YXBA 3SEZA 3TS1A 5HM6A 3CH4B 5EYPA 3SJZA 3STHA 1QQ7A 3KQQA 4CM7A 1FXWF 3LWZA 5AHRA 2Q1TA 2PM8A 1SWWA 4U7GA 3OQMA 1RXUA 4MPRA 3KYIB 2BBSA 2VPWA 4XYGA 5IAGA 5IJ9B 3H4MA 2QGNA 4P0TA 4UTOA 5JXWA 1K9VF 3SOZA 2V9PA 4DDWA 1E66A 2E4YA 3OC0A 5I9TA 2WAMA 4TZ0A 1GKLA 4IIGA 2ZRFA 3OLCX 3QWBA 1VL2A 4E2XA 3QY0A 1RZ3A 3OMLA 2AMVA 4WKOA 1RMTA 2HNKA 4BFCA 3W2GA 1LD3A 4X8MA 3OZEA 3QIVA 3BXEA 2PUDA 4JK3A 3P97A 4Z2YA 3EGXA 3PNYA 3QVTA 5EY5B 2NWQA 4DY4A 2BH2A 3E9MA 1TYEB