5HCNA

Gpn-loop gtpase npa3 in complex with gmppcp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
253
Chain Sequence
b'SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GPN-loop GTPase 1
publication title Structure of GPN-Loop GTPase Npa3 and Implications for RNA Polymerase II Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 95
structure length 253
sequence length 259
ec nomenclature ec 3.6.5.-:
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hcnA00
4I1UA 2CK3D 2ZREA 2B92A 3AVUA 2O8EA 4QBHA 4US1R 2A9KA 1XMVA 1W36C 4B3GA 2AK2A 4BPBA 1XPUA 2GXQA 1ZC4A 3WBJA 3SQXA 5SZIA 2H92A 1QDEA 3RRZA 2DB3A 4PHHA 2IL1A 5IDVA 1JXOA 1I2MA 1XPOA 4Q4LA 2BKEA 4LBWA 1N6PA 1OE0A 2EU8A 4B2LA 5M04A 2EYQA 2AXPA 4XTRA 2OSBA 2ZROA 5FI0B 5HE8A 5BQ5A 4OI1A 3IEUA 2Z83A 4GP6A 3QKSB 3CWZA 1T0JB 2OO7A 1F2TB 1GSIA 2N1BA 2NIPA 5HCIA 1WBDA 4ABYA 2ZSBA 4C0SA 1G64A 1GKUB 3RVBA 4BLQA 3GQBA 2ZXUA 3OEHA 1E79A 4PHFA 1D2EA 2VBCA 4C0HA 1L4UA 2OCYC 3KQKA 2GDJA 3K0FA 4BUJA 2A5YB 2ZSAA 2GJSA 2O8BB 1U9IA 4EQ6A 5H70A 1QRAA 2D2FA 3U4QA 1P2SA 5FOWA 1XTJA 4AKIA 2KBFA 2BEJA 4HI0E 5G53C 2J0QA 4NYMR 4II7A 2BBTA 4TMVA 2XOKD 5DNYB 4RVCA 5EUMA 2DWOA 2ZRHA 3QQ5A 4V02A 3W3AA 1SVSA 4PAOA 4P0TA 2FSFA 1ZCAA 3LFUA 3SYNA 1BKDR 2DPXA 2O8CB 5KDLA 2ZS8A 2VQSA 4H1UA 3U3KA 2ZAOA 3N5CA 3DEFA 5JHHB 5FPYA 1NBME 4MYCA 5IK2D 3ZLJA 4L9SA 5L3RA 2ONKA 4Q01A 3TSWA 1NY5A 3BAFA 3ZDQA 2V9PA 3UK6A 1EFCA 2IYSA 4M0LA 4NONA 4TN1A 1T3SA 1E1RA 2WJIA 2KBEA 2WWFA 4OJQA 5TARA 5J4HA 4OHWA 5DISB 4CEIA 1GAJA 3W5IA 3IPXA 1JAIA 2ZETA 4MRRA 1KJZA 1AK2A 1E69A 5FTMA 3E1SA 3VQTA 5DI9A 3SU8A 1FMJA 4C7OA 4BZQA 4H1VA 4UXJA 2O8FA 1W49A 1MO6A 1ZRHA 2ASEA 2IA5A 3QENA 1J70A 2J7PA 3QBTA 1F60A 1HA3A 2I1QA 1Q22A 4IVPA 3FHCB 4KSCA 2QSZA 2WJJA 3IGFA 5EXXA 1T8UA 2ZITA 3VKHA 3FYHA 3QPVA 4URZR 4BRWA 4QL3A 2QPTA 2J41A 3F8TA 3GEIA 3BXZA 4QBGB 3DHWC 2IYXA 1CJTC 2ZSDA 3QPWA 2Z5FA 1TL7C 3S1AB 1G3RA 3UKDA 2QBYB 1BS1A 1RYFA 3VR3A 1OJLA 1ZM3A 3RWMB 1HE1C 4JBXA 3ZD7A 5CIWA 1T3HA 4Q7MB 2QE7A 1M7HA 2QMEA 2QNRA 4M9QA 1W44A 1E2PA 1ZM9A 2CL7X 4JL8A 3Q9LA 1JJVA 4FCWA 2OILA 1CP2A 1G19A 2QT1A 1XPRA 3THXA 3BORA 1IHUA 1OIVA 1UBEA 2IYRA 3KJIA 4Q9IA 5HKKD 3D8BA 3THYA 1FX0B 1UADA 2ZI5A 1Z0FA 3RABA 3R9WA 1W1WA 2FSHA 5TDHA 2FPKA 4LYFA 1UBGA 3MJHA 2BHRA 4UNPA 4C4PA 3I1FA 3OEEA 3VR5A 3EA5A 5D3MA 1P9WA 2GJ9A 3B2EA 4IEEA 2ZRPA 2ZU0C 1CJVC 1E4VA 1JPNA 5KTYA 2FFHA 2VO1A 1RJ9A 1X86B 5CJPA 1E2IA 1NF3A 3WNBA 1X6VA 4URVR 2DFKB 1WDTA 2NO7A 1MO3A 2QGNA 4EFMA 3FKSA 4C0KA 4DIDA 2YWFA 2QP9X 1GDDA 5AK0A 4W5HA 4L15A 1VTKA 3NHAA 1N2CE 2F1RA 3QKSA 2GJAA 3LV8A 4PTLA 1F2TA 5DE3A 5JS8A 1GNQA 3ZIAD 4B2IA 1N3BA 4YXWD 3X1ZA 1ZIOA 2ERXA 2WWXA 3UPUA 5KDOA 4DLWA 5AUPB 3OIYA 1G5TA 4M9SA 3FVQA 4HB3A 1YR7A 4LRWA 4A2QA 4LPSA 4TL7A 1E2QA 3Q8XB 3J81k 2FMXA 4PPNA 1WB9A 1YZTA 1TU3A 2QY9A 1OXVA 4BLOA 4LK2A 1UEIA 1N6IA 2OHFA 2Q3HA 3GPLA 1B23P 4MRSA 2W2XA 4GOJA 4ACAA 3IEVA 1UKZA 4B3BA 2ZYTX 1VYUA 5JSZA 2GILA 2QTVB 4BWYA 1P75A 3TVTA 3VHXA 3ASZA 2CL6X 1P2UA 1E1QD 2WV9A 4RY2A 1E6CA 1QHSA 3SOPA 2F6RA 3H2YA 3M6AA 3I61A 2B8TA 1ZNZA 3CRMA 4JLNA 2CHVA 2R6DA 2OBLA 3OZXA 3FB4A 1XXHE 5FOVA 4ARZA 2OUKA 2YNMA 4JLMA 3BFKA 3OIWA 2VP0A 2KJQA 1Z2CA 3P27A 1P3JA 2W6IA 4GZLA 3TUJC 4OYHA 2ZI9A 4IOLA 1A1VA 1C4OA 1JQLB 1U2RA 1G8GA 1Z0IA 2JLRA 2WKPA 4IEIA 3CONA 4JMPA 3WMGA 4D4JA 1E4YA 4B76A 5G3YA 5KSPA 4YDSA 3R8CA 1Z6AA 1JAHA 5FBWB 3WYAA 3OAAA 2ZJBA 1ESNA 1FNMA 5K8LA 1KOFA 2Q9BA 2BBWA 2RGGA 3H84A 1I2DA 3WHKA 1CJKC 4D2IA 1VHLA 2V54A 4IOJA 4WZBE 4GFDA 2HYDA 2WIBA 2DBYA 1II9A 4TT3D 5JHGB 2IYZA 5FI1B 2BBOA 2HLDD 2IUTA 1JQJC 2QM7A 4HLDA 4ITRC 1Q0UA 4DDVA 2DYKA 4PQRA 2BMJA 5DN6D 3GLIA 1AZSC 4KFRA 2PZFA 5B57C 1H8HD 1G16A 2QENA 4BFZA 4BEJA 3H4MA 2JLXA 2VPPA 1G8FA 4BEBA 2D2EA 4XH9B 1G3IA 2AWNA 1US8A 5JJKA 1LTQA 4OQNA 4RZ3A 4NL4H 4PO8A 3BS4A 3MWKA 1FFHA 1NLFA 3FMIA 2PX3A 2ZSFA 1TF2A 3MRSA 1DEKA 3OIVA 4G5RA 4AD8A 3IBYA 2QTFA 4QBIA 4C0JA 4DCNA 5LB4A 3SFVA 2NOAA 4HDCA 4YC7A 2V4ZA 2RHDA 1W2HA 1E0JA 4B75A 3E5HA 2AKAB 2R6GA 2FNAA 1SVIA 4LJ8A 3GEHA 3LQRA 2VH5R 2IC5A 4XVQA 4BFTA 3ICEA 5E3HA 3Q72A 4AC9A 1AJEA 1JR3D 1FX0A 4Z1MA 4MKFA 4IVQA 1GIAA 3KQHA 4R71A 3EPHA 3T35A 4B3CA 5F9HA 1FPMA 5JWHA 1I4DD 1MRSA 1UDWA 2QP4A 2TMKA 1WF3A 2ZYWX 4KBFA 1A2BA 3BIFA 5JI3E 2PLFA 3VNVA 1KO8A 1R2QA 4NMMA 4NYJR 4U00A 2QI9C 4HZUB 1DTSA 1S96A 1X8LA 5A4JA 4IKEA 5BYKA 4ZPXA 1SXJD 1WMSA 2CEAA 1XXHB 2J1LA 4Q5IA 3PV0A 1J90A 1AGRA 3U7FB 4UNSA 4Q03A 4I4LA 4MKIA 2CBZA 3RSOA 4G1UC 1N0VC 4ERNA 3K0CC 3RYTC 2GNOA 121PA 4K8OA 2P3SA 1D5CA 3ZJYA 5JRZA 2ZRIA 5DO9A 3BC1A 5FL7A 2UZ3A 4M1OA 1E2MA 3IIJA 4A36A 1ZC3A 1IN4A 4JLAA 2YHSA 3W9YA 4CRWB 2ZS9A 3WRXC 3A1SA 3AKCA 5FOSA 3PJRA 4C2UA 3EZ9A 3QF7A 1ODFA 4DKXA 3ICQB 2DR3A 3LDAA 3BJIC 2IYYA 4Z8YA 1G3UA 1N6NA 3QF4B 3QVVA 1ESMA 5CDFE 4HUQB 3BE4A 3CWQA 4KYUA 3TSZA 5EJEA 2FV8A 1L8QA 4D6PA 5LBIA 3U7HB 4DC9A 3CRVA 3JVVA 3SJBA 2X1VA 3U6KA 4AYTA 4Q4JB 2GEUA 1P72A 3FHTA 3VU9B 4GMDA 2Q6TA 3CNOA 2HT1A 5EP4A 1RZ3A 1OXXK 4Q4HB 5JS7A 1II8B 1X1SA 2A30A 3D3QA 5EZ6B 3W3ZB 1F3OA 3NC0C 2QL6A 3FMFA 4PZZA 1YE8A 4E5UA 4NCJA 2WMNB 5LD2B 1Z6YA 5FR1A 4QG7A 1KTVA 2QAGC 3HU3A 2P6UA 4LJ7A 1CJUC 4BE7B 4ZI3A 4DLTA 1E9FA 3W34A 1FMLA 1OW3B 2RCNA 1JJ7A 2JAQA 2JDIA 3AVTA 1YQTA 2CVHA 2IBMA 3F3YA 1R5BA 2H1LA 4E03A 2JLYA 1KIMA 1IY0A 2EWVA 5AJXA 4Q18A 4G5GA 4MRPA 2ZRFA 4LHVA 4AYWA 2EFHB 4PO1A 3PEUA 1R0WA 4DLYA 4A15A 2GXAA 4NBSA 4NHOA 1KI6B 5BW8A 4UXIA 4A92A 2VRWA 4URUR 1FQJA 4MDFA 2A5JA 3L0SA 1N5KA 1RC8A 1DG1G 2X8AA 3PEWA 3PR1A 4JVNA 2B7CA 4KSBA 4P3YA 5JZVA 5DSZA 4EKDA 1ZD9A 3K9NA 1N5JA 3REGA 4AURA 4BRUA 5BN5A 3ZYCA 4ZDJA 5GJWC 1G7CA 3AF0A 2GXUA 4B3DA 3KL4A 4RFVA 5L8VA 3BOSA 1KK1A 4AG6A 1U8AA 4MGZR 1UFQA 2VHJA 4D81A 2XB2A 1DPFA 4LYJA 4XD7A 3QEOA 1OB2A 1X8JA 2GZAA 1G7RA 3LVQE 1DAMA 3RANA 3RS7A 1E2GA 3SDZA 1OSNA 3PENA 3AF3A 4G01B 2GEDA 1CF4A 2ZE5A 4WA7A 3E70C 4IXNA 3IHLA 3T15A 2H5EA 1BH2A 1KMHA 3B9PA 3AKYA 3LH5A 3VX3A 3CR8A 2QUZA 4D82A 3KTAA 1OFIA 3L82B 4YLGA 3TBKA 2GHIA 3GCGA 1Z5ZA 1T9HA 2PEZA 3B7GA 4WW0A 3KKMA 1KI3A 4A2WA 1AGPA 4C9BA 4B44A 4TTQA 3HU1A 2CNWD 1ZBDA 4O3MA 2YJTD 4GOKA 2JLZA 1R0YA 3RSLA 1ZAKA 4G0NA 2ZEJA 3K0CA 2G6BA 4RD6A 1Q1ZA 1KSFX 2PLRA 4M21A 1JEDA 4DDUA 3UG7A 4FXPA 5C46F 5C4MA 1XEWY 4Y0AA 3K9GA 4MRVA 1A5TA 1EFRD 1KDOA 4S2EA 2YWGA 3DKPA 3WMFA 4MH0R 3K70C 1G8YA 4TMWA 1EK0A 1SZPA 2D06A 3EIHA 4TL8A 1E99A 3GFOA 1N5LA 1P4SA 2R44A 3LX8A 4US0R 1ZD8A 3UG6A 4DCVA 3VU9A 5DIFA 5J47A 1IXRC 4B73A 4LOAA 1LS1A 2W6JD 2J0SA 1IOZA 3CB4A 1NG1A 4MUAA 3LNCA 1YZGA 2NO9A 3K0FB 4BFUA 1GM5A 1ZW6A 4JKIA 1O3YA 1E96A 1MV5A 2C9OA 3OEHD 4EQ6B 2Z6VA 3FGNA 4AYXA 3I8XA 1E9AA 2H16A 4O2RA 1NY6A 1PV4A 2YC2C 2GK7A 1Z2AA 1OH6A 3HJNA 4M8NE 3EZ2A 1P6XA 4CF7A 3GLFA 1XMSA 4JSTA 4XSGA 1R8QA 2WJHA 1DAEA 1OT3A 1DVRA 4IW3B 4N3NA 1XB2A 4O2LA 1ZYUA 2G1JA 4DRZA 5UKDA 3QIAA 3CF0A 5CM8B 2WOJA 2IYUA 1Z07A 1ZINA 2QAGA 1FP7A 1H8EA 1RKBA 3Q7PA 3NTUA 2BCJQ 5L3QA 3AP1A 3PQCA 3ADCA 4DJTA 4LY6A 4TYQA 4WXRA 4GNKA 2V6IA 5G3ZA 1PLLA 3U3OA 3RC8A 3TRFA 2D7DA 1KI6A 2LKDA 2NG1A 3DZDA 2W00A 5KSOA 2RGNC 2EWWA 4M4SA 4CEIB 2FFAA 5CK5A 5KPDA 1ZNXA 1OKKA 3I8SA 2NTYC 1DO0A 1ZUNB 3CZQA 1JXMA 4YQFA 4C7OB 4EDHA 4FN5A 5C4GB 4NPHA 2O8FB 3IILA 4KLNA 3AVVA 1G7SA 4DCSA 2P5TB 3EC1A 1XU4A 2YV5A 3RRNA 3OE7A 3GD7A 5K8UA 3TSOA 2IXGA 2B8WA 1TTTA 4MA4A 4A0HA 4DLVA 3THOA 3TQFA 3U6BA 1CS4C 2J7PD 3CX7A 1VMAA 4V0NA 4LC1A 1KKMA 3L0OA 4JJKA 3VNUA 3AEZA 5FBRB 2YOGA 3RNLA 2NPIA 3ZH9B 3I3SR 3T1TA 2BM0A 2WHXA 4FWIB 4KYIB 1XTKA 5JFGA 1M74A 2HYIC 1FW6A 2OZEA 1KAGA 3EZFA 3QY0A 1D9ZA 4BZXA 3W90A 4MKGA 1FUKA 4A6PA 4CDGA 3AVXA 2AX4A 3PUXA 4WIAA 1KK3A 3M1IA 2KI5A 4WZ6A 3GLHA 4HLUC 5EE3A 4LJ9A 3SS8A 4QHSA 4B3XA 2IWHA 3K53A 1XD9A 3UWKA 2AD5A 3GP8A 3I92A 3THXB 3LBHA 2VSXA 5C18A 4KFSA 3THYB 5H1YA 2WJGA 3KKPA 1E9EA 3H86A 4XVRA 1TPZA 4FD2A 3R9IA 3UATA 4A82A 5J4YA 3ADBA 4YMTA 2XGJA 1G21E 1N0UA 3CNNA 2IXFA 2GCPA 1KDRA 2OT3B 3CO5A 4WZAE 4FCTA 4POAA 2QQEA 4HAVA 1KZ7B 5D3MB 4FCVA 4B34A 4FWTA 1G4UR 3AP3A 2JJ1A 4RSGA 3OFNA 3V4FA 1RJ9B 1LVGA 4TMZA 2FPLA 1E2NA 2W2VA 3OEED 4FMCF 4NYIR 3O8BA 1XBTA 2OXCA 4ON9A 3WP1B 6Q21A 3KQLA 4E09A 4NCKA 1N6HA 1E0KA 4DCTA 1W36B 2ANBA 2KWIA 2P6NA 3GLIE 3F0TA 1VDZA 3R8FA 5EE5B 1QHGA 4UQOA 2BC9A 3T1QA 3ZS9A 4L5BA 3BD9A 3RHFA 1R0ZA 3FKSD 4PSKA 3ZVNA 2ECKA 1KKLA 4MKHA 1N25A 4M9ZA 5EUQB 2NQ2C 4OK3A 1LV7A 4V0LA 3TH5A 5DHAA 2O5VA 1Z08A 4QM6A 2JJ8A 3IO3A 2BMEA 2J5XA 2XZLA 2D74A 4LHYA 3I32A 4DDTA 2GF9A 3KKQA 5LDDC 4A8JC 1YZUA 3NG1A 1CRQA 3QI2A 4HAUA 3RS4A 1LS6A 1W48A 4OHYA 3RS2A 2V1XA 1X3SA 1D8TA 4H9GA 2V6JA 1E2JA 3CLVA 1BMFA 4JVMA 2IYLD 2F1IA 3MWYW 4DSTA 4V0MA 2BMDA 2FX3A 3TE6A 4ESHA 1Q12A 3QEJA 5FL3A 4JL5A 5F98A 5JSZB 4F7WA 5JWRA 2R6CA 1IJFA 3OESA 2XNDD 2GAOA 1FL9A 1T8TA 2EFDB 4GMXA 1P5ZB 2BV3A 1YKSA 3N70A 4MGKR 1QHYA 1Y3AA 2IUSA 3VR2A 2OM2A 3AF4A 1TEXA 4LI0A 3SQWA 1S2MA 2GF0A 1XCMA 5FTKA 4ARZB 5FUWA 2D7CA 2RGCA 3WNCA 3EWSA 1RIFA 1CJMA 1OH7A 3VR4A 1FZQA 1GP2A 4ZCIA 2R9VA 4UKDA 1Q20A 4DB4A 5AJWA 5FBLB 1VCIA 4M1SA 1ZIPA 2ORVA 4U02A 1NSTA 2WWWA 3LVRE 2G1KA 2R62A 4QGGA 2BJVA 5CM9C 4NCIA 3KB1A 1FP6A 4IOKA 2VIIA 2RGNA 1E2DA 1IONA 1YR9A 2YC4C 4PANA 5FTNA 1E0SA 3L0IB 5FOUA 3O8DA 2WSMA 4OBEA 4LBYA 2YYZA 4LHXA 3OAAD 2Q9AA 5B64A 1COWA 4JBYA 4R9UC 4QM7A 3WRYC 2N42A 4Z8XA 3GLIB 5EP1A 3H0KA 4KJZA 3CRW1 4N0EA 1KNXA 3JVUA 4OHZA 3Q3JB 3W8RA 3FTQA 5KUTA 1CU1A 4MDEA 4UNQA 5CB6A 1US8B 4DCUA 5SZKB 3TGPA 1RRCA 4LV5B 2DWPA 4O25A 3FKQA 1U90A 1VYVA 4YMUA 1VG8A 3AGQA 1KZGB 2QMUA 4E07A 2B6HA 2OV2A 4BLRA 3ZS8A 4Q9KA 2BEKA 4DEYA 2IS6A 3PUZA 4A0FA 3B60A 3IO5A 4JZKA 4MITA 1R6BX 1T5IA 4LHWA 1NNEA 1OFTA 1XRJA 4LJAA 1Q1QA 2Z0MA 3PCRB 2JLSA 2WAYA 2JA1A 3DVLA 1H65A 4CW7A 1A7JA 3PFIA 4RKEA 4IFBA 4HLUA 4MYHA 1W7AA 1P73A 3EPKA 2JGNA 3EIQA 5TVKA 3B78A 5E7JA 3AVQA 5AR1A 2IUUA 4CT5A 1ETUA 5L3SA 2HT6A 2Q3MA 2REBA 4NU0A 3MGCA 2OAQ1 3DOEA 4NH0A 4OI4A 5GVRA 4TMKA 2WTUA 4LYAA 4TL9A 2O0KA 2OLKA 4A0RA 5AUQA 1SVKA 3PUVA 2XTNA 1KK2A 4RZUA 2W58A 3AP2A 4IDQA 3BH7A 5LB2A 1QVAA 1R8SA 4AG5A 1M34E 4G5SA 1NBMD 4M2LA 4KV9A 1N6RA 4PQYA 3AB3A 1SHZA 2ZJZA 3REFA 4KFTA 4TLBA 2RB4A 3QXSA 1G20E 4PC3A 1XX6A 4OL0A 4PZLA 1E9SA 1KI2A 3AVWA 1W47A 2RAPA 4HATA 4MRNA 2OBNA 3MWLA 3U5ZB 4TYPA 3AVYA 4ZV4A 4NDZA 3DZ8A 3MCAA 2EFEB 3CZPA 1ZUIA 1WXQA 4L8GA 2ZRJA 4LYHA 3T06B 3JZMA 2JLUA 1DAGA 4EUNA 1KNQA 4R2HA 3I4LA 1HQYE 3CPHA 1XWIA 3PEVA 4A8JA 4RFSA 4CEJA 4I1VA 1HUQA 2VP5A 2ZVQX 4OK5A 2AFIE 4P4UA 3GEEA 4OQXA 1M7BA 1R10A 1ZM4A 3OIUA 5AJYA 1IBRA 4DSUA 3VKWA 1NG9A 4TL6A 2IYVA 2CLSA 1Z63A 1Z8FA 2XXAA 1HQCA 3GJ0A 4OQLA 2W0MA 3FPAA 3FFAA 4J0QA 1GL9B 421PA 1YHNA 4KVGA 3LO5A 2NO6A 2MSCB 3KZ1E 5EZ5A 2ZANA 1W5SA 5CK4A 3UMSA 1F6BA 3NH6A 1SVOA 1UKYA 4TWZA 3TR0A 4PPQA 3VMFA 3BH6A 4PSVA 2I1VB 2RGBA 3B1XA 4JKYA 2CXXA 2ZJ2A 1GFIA 1T0HB 3N2EA 3B1YA 3B6EA 3V4RA 4JYBA 3SJZA 1YZKA 2H57A 3A58B 4JBWA 4JLBA 8OHMA 1HT1E 4O0MA 4LPKA 1E2LA 1TQ6A 1YZLA 1Z47A 1MH1A 4Q9LA 3SC3A 3ETLA 2QMHA 3T34A 4DHEA 1M6NA 3LW7A 5IT5A 1GOTA 2WICA 2FN4A 5EE9A 1ZD1A 2IEYA 1OV4A 2Z4RA 3KB2A 2D4HA 4X8OA 1MOZA 1G7TA 2ERYA 2RGDA 2FDCA 2QQ0A 4PQFA 1LF0A 3AM1A 2C2HA 1F48A 1KGDA 3CKLA 3MLEA 2C99A 2ZI4A 4HLQB 2CLCX 5TY0A 2QP3A 3ZGXA 2XAUA 4K46A 1KO1A 2OCAA 1A4RA 5JBQA 1XTQA 1UEJA 2F9MA 3EASA 5FPHA 4PAQA 2NZJA 3DMNA 1A2KC 1XFAA 1AA9A 2B21A 4JLVA 4V0KA 2ZJ5A 3RS5A 3OF5A 5FTLA 3B13B 1CKEA 2DWQA 3TLXA 3NBXX 2WSSD 4PFSA 4AKGA 2P67A 2VHTA 2JCSA 2JIZA 3LX5A 2D3WA 1ZP6A 3OHMA 2PBRA 1OPXA 3ZVMA 2WWHA 3GLFE 1GTVA 3SEAA 4CEJB 1W0KD 2ZIAA 1J8YF 2REOA 3VR1A 2F3TA 2BKUA 3GJ3A 5G41A 2JEOA 4PHTA 4BFVA 2V1UA 1N6LA 4URWR 1NLZA 2WVJA 1XEFA 1WBBA 4FINA 3QSYA 1CTQA 1IN8A 4DXAA 1KMHB 2IYQA 1SXJC 2OBMA 4PC2A 1Z28A 2FGKA 3KTAB 3LAWA 3WNDA 3T12A 1W5TA 1XTIA 1E32A 1NMYA 3X1WA 4MQBA 4EPTA 4QNMA 1YJ5A 2YOHA 2ZE8A 1AKYA 2R65A 2GEVA 4LGMA 3AVOA 3ND8A 4RZ2A 3RS3A 3BERA 5B30A 4Q19A 3TIFA 4QGFA 3BWDD 1MO4A 2HJGA 5FBVB 2BDTA 3B5JA 1I4TD 2MMGA 1TQDA 1OXSC 3U7EB 3AF1A 2GJKA 5HTKA 3CH4B 1OIWA 3IDQA 3LY5A 5EE0A 4HSEA 4YXWA 4DLRA 3C4JA 2FZ4A 4M22A 3RDPA 1VHTA 5JJIA 4A0GA 3EG5A 1VCMA 1N6KA 4HAWA 2BMFA 3Q85A 2A3RA 2ZRBA 4Q21A 3P4XA 2GXSA 1P2VA 4OI2A 721PA 3GJ6A 3TAUA 2WPDD 5B2ZA 5AUOB 3RC3A 5AJZA 3CX8A 2P65A 3BH0A 1W4RA 3NEJA 1GNPA 1P9RA 1Z6GA 2J59A 1XMJA 4QHYA 3QPUA 4FMDB 1GKIA 4LV8B 2RGEA 3C5CA 3GLHE 4UNRA 1U98A 2C9YA 2QU8A 3SZRA 4EJSC 1DAKA 2EFGA 1DAFA 4D4LA 4C30A 2WM9B 3CH5A 3PVSA 2JJ2A 3R7WA 1ZVQA 3THWA 4DUGD 2ONJA 1AM4D 1E1QA 2G77B 2ZVPX 3BFVA 1V43A 3IIKA 3QKTA 4QFMA 4ZDIA 4CEHA 5KNDA 2OCPA 1KJYA 821PA 3GLFB 3R20A 1G41A 3IIMA 2I3BA 4TTPA 3RS0A 4DT1A 3QXCA 4CT4B 5HZHA 2J0UB 3V9PA 1GUAA 2FSGA 2ODBA 4A6XA 1KAOA 2H8KA 3I72A 2VLIA 4V03A 4BQSA 1YR8A 3GJXC 1G5RA 2ODEA 2IK8A 2QAGB 3A1VA 4L9WA 3WXMA 5L3QB 5IRCD 1RRPA 4TQ9A 1CR2A 3TW4A 1DADA 4OHVA 3UANA 5HPYB 1XCGB 3AQ4A 3LBIA 1H8ED 4HEJA 5B58C 2HV8A 3K9LA 3FHOA 2C77A 1KI1A 1XJCA 1JBKA 3KXKA 1OHHA 2ZYUX 3SN6A 1BO6A 4F4IA 2HXSA 3QXHA 4TT3A 5TXGA 2HLDA 2ZTSA 3NWJA 5C1BA 4JLOA 4PR0A 1X1RA 4FW9A 1OKKD 1NKTA 2GRJA 3MG9A 4TQAA 1H8HA 4QBFA 4B35A 4AWXA 2HJVA 4D25A 4TSFD 4X8LA 4GI7A 3K0AA 4CVNA 2E1RA 2OE2A 2CCGA 4M53A 2ZI7A 4B6FA 5TMPA 1ZM2A 4V0ME 5DYGA 3P26A 3W6NA 1BYUA 1SKYE 1WE2A 3KJHA 2FZLA 4TQUS 2AL7A 4K81B 2C5LA 1E94E 1OYYA 4JVSB 1S3GA 4V0OA 3L8YA 2F55A 4AY2A 1M1YE 5F2EA 2F43B 2AKYA 2ZJ8A 4NYMQ 4EPYA 2ZAMA 3NIBA 2OFXA 1G3QA 3WMEA 3GLGA 4HUTA 4IVRA 3B8HA 1RE0A 2ZRCA 2RH5A 3GLHB 2IXEA 1M2OB 1JALA 3D31A 1U99A 1VCNA 1VG9B 2L0XA 3QOFA 4UJ5A 3WYGA 1MRNA 3U7GA 4NZYA 4IDOA 221PA 1CRPA 3TNFA 4QHTA 3LA6A 4QXAA 4YMWA 2VSFA 2WWIA 1IXZA 3CIOA 2GZDA 2ZJOA 1JEEA 1SULA 1EFUA 1SXJA 1ONBA 3NEYA 5JCZA 4B71A 1KSJA 3KDSE 1HE8B 4Q7JB 3NDPA 2FFBA 2G83A 3VHLB 1P60A 1TEVA 2Z43A 4Q1CA 2QAJA 4A9AA 1FQKA 4Q9JA 3QKRA 2JLWA 4B3FX 2NO0A 3NXSA 3N2IA 1W0JA 1CEEA 3QXXA 2QPAA 3ZD6A 5J4LA 4LJ5A 1HH4A 1TAGA 2X77A 3Q5DA 2KB0A 2GAAA 2ZU6A 2FJUA 4QJ3A 2P6RA 1L4YA 1Z22A 1NJGA 2C04A 1KJWA 4P4TA 1S0UA 4US2R 2O0HA 5FR2A 2ZRGA 5KU1A 5H68A 3K70B 2WWGA 5JJLA 4HLCA 2CJWA 1UAAA 1EFTA 3SI7A 4LC0A 4EAQA 4WVFA 3MSXA 3KJEA 1R4AA 2VHUA 3K70D 4DIEA 1E0AA 1D2NA 4Q47A 1ZU4A 1E79D 1DG3A 3AGPA 2CL0X 1I4LD 3U44A 1OIXA 5JMTA 1SKYB 2XEXA 3SHFA 4C0LA 5FBQB 4EJSA 2J7KA 5BN3A 1NP6A 2G0NA 4JLKA 2C03A 3B1ZA 3SYLA 1HYQA 2J0UA 3JZAA 4BZPA 2HEIA 2D62A 4Q1DA 3RLFA 1UM8A 2VL7A 2WOOA 2PEYA 2V7QA 1NVWQ 2J0VA 2P2LA 3ZVRA 1S9HA 2PZGA 5HE9A 3TK1A 3BB1A 5EXSA 3BBPA 4ZIRA 1SQ5A 2W83A 2LKCA 4L4UA 1QHXA 1WRBA 2ZR9A 4Q02A 4Y0VA 1QHHA 4DLXA 3HDTA 3ADKA 1G3MA 3U3RA 5HZKA 1B0UA 1V5WA 1XJ0A 2QGZA 4KI0A 1NVUQ 5EP3A 3AUXA 4F92B 1D9XA 5EQTA 1VCOA 4NE2A 1XMIA 1IN7A 4BLSA 2AR7A 3X1DA 1F5NA 1E1RD 4IXMA 2C8VA 1VKJA 2R2AA 1GL6A 3W6OA 4ACBA 1UDXA 1QG4A 4XWOA 3BFXA 2AXNA 2CDNA 3HYTA 3LXRA 4L16A 2WZQA 1DO2A 4JL6A 4Z54A 2JLVA 5JLJA 1IJEA 2KE5A 3O47A 1XTRA 5C2JB 3TAHA 3CF2A 3BB4A 4HZIA 4ASUA 1YVDA 5EXPA 3MJRA 1OXUA 1VIYA 4U5XA 4M9XA 1E2KA 1P7CA 3BRWD 1Z3IX 1CIPA 5FFMA 1XD2A 1CR0A 3A8TA 3B82A 2AHOA 2RGAA 2UZIR 1Q57A 3SFZA 1TU4A 3DKVA 3KQNA 3EA0A 1QZXA 4PAMA 4QNRA 1NL3A 5KDDA 3MD0A 3FWYA 4F91B 3EX7C 2F43A 3ZQJA 3KX2A 2HUPA 1R5OA 4IJMA 2XZOA 5D3QA 3KUDA 4JJZA 3NBYC 1LB1B 3ND9A 2F1HA 1II0A 3I73A 2CE2X 2OCBA 1GKYA 2QE7D 2WJVA 2PCLA 2X2FA 3AKDA 4IDHA 4ZKEA 1NMXA 1EX6A 1J99A 2ZQ5A 3KFVA 1Z6XA 3EWAA 5FUYA 1S1MA 4F93B 2IYTA 4PO9A 2JASA 1G1MA 2WWYA 5L3SB 4I1OA 3U2QA 4QKQA 3A37A 2WJYA 1E2EA 5ELXA 2ODNA 4AKEA 3T1VA 3IQXA 5CYPA 2HCBA 3CW2A 1J2JA 2K5UA 4NCNA 2EQBA 1EESA 1CBUA 1JB1A 1VIAA 1LW7A 2J45A 1P9NA 2VSOA 1PVOA 1KY2A 3EPJA 2CNWA 3K09C 1AS0A 2FWRA 1TQ2A 1L7VC 2QMOA 4HB0A 4KBGA 4YDHB 4ZO4A 1U8YA 2QEQA 3QVUA 5FPTA 1TMKA 2BIFA 2G0TA 1S1CA 3VR6A 1W36D 1OLOA 1EFRA 4M1KA 1LFDB 1WA5A 3U3JA 1NN1A 1XCPA 3M4YA 4R2IA 4PPFA 3GJ7A 1AS3A 2FEMA 4F38A 3FDIA 2R8RA 4GT1A 3X1XA 4F4JA 3G0HA 3A6PC 2R6AA 2EFCB 2DHRA 5JEDA 1Q3TA 4QGHA 1GITA 2UVQA 2YZ2A 3A36A 2PH1A 4JT2A 4XOIA 1D6JA 4FMCB 2WMOB 1Z0KA 1XD8A 4A8JB 1KO7A 4M1MA 4RFSB 1K5DA 1KDPA 2W6JA 2OESA 4B43A 4D4KA 1RYHA 1HEIA 3ZVLA 4QJ4A 4XJXA 4KLZA 2GK6A 2AN9A 2XTMA 1FTSA 3EC2A 4RD4A 1KSHA 1KI7A 4DDWA 1KDTA 3O8CA 1QBKC 2DFLA 1NIJA 2V8OA 3Q7QA 2BWJA 4Q1AA 3EZ7A 2XXAB 3C5HA 5FTJA 2SHKA 2Z4SA 3A4MA 2GETA 2PX0A 2VHCA 2OLJA 4B32A 1IN5A 3HYRA 4NYJQ 5BWMA 1RRFA 5FPKA 3C8UA 4YONB 4KITB 2IS2A 5LPNA 2N46A 1ZU5A 1KHTA 2WAXA 1VECA 5BN4A 2GKSA 1N6OA 1XDBA 1K8RA 4BFYA 2XJ4A 2W6ID 2IEZA 3GJ4A 5JECA 2ZE7A 1J7KA 3I5XA 2ORIA 3R9XA 1TF7A 4NTZA 4W7SA 1SVLA 4ZCMA 3ADDA 1G6OA 1IAQA 1Q1BA 2FH5B 1KI9A 2PMKA 1EWQA 3QUSA 3QXJA 4PHGA 2XSZA 1IY2A 1MO5A 4IDNA 5E7MA 4B74A 4EFLA 1QHIA 1UJ2A 2BVNA 3U60B 3U3MA 2F9LA 2JATA 3LRPA 4Q1EA 2O8DA 2QRZA 4OJKA 4C0QC 5A0FA 1GL7A 1JI0A 4B33A 2GCNA 2H17A 3DDCA 1E2HA 2BJWA 2XNSA 5FH9A 3FOZA 2VP4A 3RRMA 2QT0A 1CLUA 3KKNA 3Q5EA 3LBNA 1E9CA 4Q4AB 3VAAA 3IBGA 4WBSA 1N0WA 4MYUA 2VF7A 4CGZA 1NVVQ 2NPFA 4DLZA 1FUUA 1KSGA 3CRRA 1W2GA 1DS6A 5CYOA 1UKEA 2C95A 1A82A 3FFBA 4DVGA 2GZHA 4KFUA 2A78A 2XX3A 1HTWA 2IWRA 2GCOA 4HDQB 1Q44A 2G88A 3GFTA 4P33A 2JIZD 5E7IA 2WBLC 3P1JA 2ZR7A 4Z1MD 2PL3A 5GJVC 4PSAA 4PPGA 5FUXA 3W8NA 1S4QA 3AVPA 3LLUA 4ZKDA 3TUIC 2X19A 3HU2A 2RMKA 3QG1A 4LV6A 3TJZA 1BOFA 3GFPA 1NJFA 4LJ6A 1NRJB 2XJ9A 4LJYA 1EFHA 1HT2E 1C1YA 1O87A 1RFLA 2AFHE 1MR3F 1MABA 2CK3A 4XWAA 4IOMA 1RRGA 1VG0B 2ZUCA 1W4AA 3EZ6A 2ZUDA 4QGAA 4QOSA 4I1SA 4R98A 3T5DA 1OFUX 3K09A 1AN0A 4KXFB 1PUIA 5K8IA 5F3WB 3BGWA 4LSGA 4BECA 1CXZA 3GJ5A 1IQPA 1OF1A 2ZYVX 1T91A 4OHXA 3KJGA 4TYNA 5DYIA 1EGAA 5JRJA 5FL7D 3SJAA 1GRQA 4IFEA 2FGJA 2ANCA 1UKVY 4P4SB 5K8TA 1XZQA 1VG1A 3CM0A 1G4AE 1AQYA 1TUEA 1ANKA 2ZR0A 1OH8A 1NIPA 2PT7A 3ZQ6A 3I62A 1E9DA 5CLLA 2PJZA 4IHQA 1BYIA 3HR7A 5DI3B 1UF9A 4MGIR 1KO4A 1KO5A 3QE0A 2X2EA 1YRAA 2KSQA 4PXAA 1XZPA 3GLGE 1GWNA 2AK3A 4JLJA 4TLCA 2HDNB 1KK0A 2A5DA 2J46A 1JR3E 521PA 1YRBA 3EAQA 1DOAA 4HAXA 2XOKA 4P32A 2XITA 2O8BA 1WCV1 1AS2A 4KAXA 1JPJA 5DHFA 1EWRA 4D4MA 1G9XA 2XNDA 3K1JA 1M7GA 3NBFA 1TUIA 3R7WB 4URXR 1OB5A 3THWB 4UJ3A 1Q1EA 4P31A 3QG5A 4KVAA 3EXAA 2Q0HA 4CEHB 2VA8A 5CIQA 4A1FA 1Z29A 1DAIA 4JLPA 2JJ2D 1SXJE 2G3YA 3K8YA 1TX4B 5IK2A 3WY9A 4DT1B 2O8CA 3QBVA 4GP7A 4R7ZA 3RAPR 2CVFA 4XVUA 1DARA 4RD0A 5DLQC 3X1YA 4G5OA 3EW9A 2QN6A 1K6MA 1VPLA 4LDJA 2GA8A 4W5JA 2IS4A 1G6HA 3PXGA 2VHQA 4BFXA 4B2PA 2JDID 4QJ5A 1F2UB 3TQCA 3GJ8A 1AQUA 4PC7A 4FMBB 2WKQA 2GBLC 2PMDA 1G17A 2CLDX 3L8ZA 3M0EA 1X8KA 3IUYA 4M1WA 1QHNA 2ZJYA 2MSDB 3WP0A 1JECA 5GJBA 1LY1A 5TV2A 1AKEA 1DBSA 2YWEA 4DLUA 4Q4AA 4HYYA 1OHHD 4JS0A 5DH9A 3UWOA 4Q1BA 2GJ8A 4JIMA 3C7KA 1HV8A 1Z0JA 4TYWA 2JLQA 2FSIA 3K0AB 2HF9A 4KO8A 4XSHA 3K0SA 3MWJA 1WP9A 2VP2A 2VTKA 4EPWA 3E2IA 3S1AA 2O0JA 4RKFA 4GOXA 2FF7A 4GPTA 2QBYA 2NMVA 3KXLA 1GRNA 1R0XA 2AD1A 5CLQA 3DOFA 1NSFA 1AIPA 3P4YA 3FMPB 4DWJA 4LHZA 3GLGB 3DMDA 5HKKA 3HPRA 4OKSA 2OFWA 1NMZA 2WIAA 4XD7D 4N1AA 1K5GA 1IN6A 1G8HA 2RGXA 3H1TA 1EX7A 1GG2A 4BASA 4UXHA 4LBVA 1KMQA 2IHYA 4RJLA 1FOEB 1L2TA 1NN5A 2QTHA 3IKJA 4S35A 2YKGA 5P21A 3V00A 2BOVA 2A5FA 2H7VA 1GRRA 1T4GA 3HPQA 1PJRA 1U0JA 2OEPA 5KSYA 1PLKA 2QG6A 2QRNA 2CCKA 3NHBA 4CZ2A 1SXJB 4JYCA 4JVLA 3KUCA 1E9BA 3D6TB 3LWNA 4TZ6A 2F7SA 2V3CC 2J3EA 2A2ZA 4NCHA 4NP6A 1KYIA 1NBMA 2ZSEA 2F3RA 4YMSA 1C9KA 4W9MC 3P32A 3QKRB 3ZIAA 4G3XA 3ZZUA 3MMPA 1Z83A 4IDPA 4P4SA 2QZ4A 5CJ2A 5E4FA 1QG2A 1TQ4A 1FNNA 1QVRA 3B9QA 3RRYA 3W6PA 2Y8EA 4D80A 1SVMA 4TYYA 4NKRA 4FMDF 3SBEA 4JSYA 1W0JD 2GESA 1Z0AA 5DI3A 5FOTA 3B85A 2ORWA 2IF2A 4U7DA 3D7MA 1R5NA 2XTZA 3GMTA 2CJWB 1UPTA 1XJQA 3T61A 3WYFA 2IF0A 5JI2E 3TKLA 1TF5A 3VKGA 1YU9A 2NO1A 1E3MA 2HF8A 5EP2A 2RHMA 3C41J 2E87A 4WXPA 2EVWX 1U81A 1KY3A 3CR7A 1XTSA 2PCJA 4RCYA 621PA 1MT0A 3AKEA 4BGDA 1Z6TA 3B1VA 3U44B 3HR8A 2O52A 3WBKA 5JEEA 4I99A 5J4KA 4TLEA 1NVVR 4EJSB 3KFXA 1XEXB 4RD1A 3ZZ0A 2XZPA 4PC6A 1U0HC 3TVDA 4ZCLA 3KXIA 4ZDKA 5LD2C 1YR6A 2OXRA 5ANRB 3SBDA 3MFYA 4KU4A 2DFNA 3C16C 4KHZA 4ZIRB 4TTRA 2YWHA 3CPJB 4TMTA 5GADl 3A1TA 2ZS7A 3DM9B 1F2UA 1QHHB 2V7QD 4GDFA 4XWKA 4EPVA 1Q3HA 4NYIQ 4FIDA 4EIWA 1G8PA 3VTKA 3A4LA 1P2TA 3K0EA 2Q9CA 4GRAA 1XP8A 4PC1A 3AF2A 4A2PA 2EW1A 1TADA 1T5LA 3LLMA 3TW8B 4TLAA 4N0DA 1AZTA 4LJ4A 1N5IA 2WKRA 4W5WA 1HURA 4BFWA 1T6NA 2GBLA 2XB4A 5DN6A 2ZRAA 3LW8A 1PZNA 3CNLA 4TLDA 2ATXA 1DELA 2C98A 5F9FA 3DL0A 4LUCA 5FOXA 3KQUA 2V55B 3NH9A 2C96A 1R7RA 4MGYR 3DM5A 4M1YA 1G18A 1SKQA 5KPJA 2CCJA 2CMKA 1IY1A 2FE4A 1ZUHA 1NLYA 3OE7D 4E22A 1XD2B 4WAUA 4C0BA 1S9DA 4Q00A 4ASUD 1J8MF 3ASYA 1KI8A 4C0AC 1CR1A 5G40A 2J87A 3F5FA 4Q7KA 4X8HA 2H18A 2W0SA 3C15C 4D26A 2WSSA 3ZZTA 4M1TA 2OG2A 3EIEA 5EXTA 2QSYA 3K9HA 2ZI3A 1JR3A 5KO2A 3CX6A 4HB4A 3TUZC 1NKSA 3KKOA 5KHOC 3PITA 1W0KA 3G82C 3SNHA 3CBQA 2FA9A 2ZRLA 1NVXQ 3LD9A 4DBLC 3G5UA 2IS1A 2DY1A 5KOYA 1WQ1R 1GILA 1E9RA 3AH8A 4MUBA 2ZUBA 1ZMXA 2FOLA 3TR5A 2ZRNA 4OK6A 3SE0A 4QC2A 2A7QA 4GL2A 3SYKA 3C14C 1M8PA 1XF9A 4GBMA 3IQWA 4AKHA 4KCGA 2QROA 1ZM7A 4IRUB 1YZNA 4A4DA 1DAHA 1T3LA 3UMFA 2VYFA 4HB2A 4DLSA 4RCZA 4B47A 5CB8A 3ONWA 4HZUA 1E2FA 3LQQA 3L2OB 1BIFA 2GVZC 2EYUA 1EXMA 4HAZA 1SHKA 1XXHA 2NGRA 4MYTA 1Q21A 1OFHA 1U94A 2CHGA 2QM8A 4LZZA 3A1UA 3UIEA 3L0PA 4ESVA 2JJ1D 3OFND 3NDBB 4LX0A 3RWOA 4XTCS 5JCPA 4GZMA 4D0NA 1SVWA 3QKUA 3MAAC 5AUNB 1W4BA 2OFOA 4TMXA 2O8EB 1JNYA 1S3SA 3ECCA 1ELOA 5JWOA 2IHBA 3CUEF 4OQFA 5SZJA 1OH5A 2FU5C 1UBCA 4YMVA 1RVDA 2J9RA 3T1OA 4LBZA 2FPMA 1P61B 3SR0A 4URYR 2WPDA 3NBZC 3QF4A 4HUQA 1S8FA 3X2SA 4AI6A 1HY3A 4JT4A 3SJCA 2C9CA 1IXSB 5H8WA 1P62B 2E9SA 4WOPA 4Q4JA 3HWSA 2ZI6A 3DPUA 3VX4A 3PEYA 1UBFA 3UXMA 5TB5A 4Q7LA 2PT5A 1BMFD 4DSOA 1XEXA 4F4CA 1U9IC 4BLPA 5KNCA 2HCJB 2ZRMA 5AJVB 4TZ0A 3PUYA 4Q4HA 2GVDC 4UNNA 4B6EA 4BLTA 2W2TA 4CYMA 2ZRKA 1II8A 3PUWA 4DUGA 4C2TA 2B7BA 3HP1A 1GVNB 4EPRA 3O8RA 3A1WA 4ILEA 1W46A 2BM1A 1GNRA 5GVSA 1JR6A 1OYWA 4AK9A 5HR5A 1G291 3U4QB 2BCGY 2UKDA 3BK7A 1PLJA 5GJCA 2ODWA 1FTNA 3PIRA 3CPEA 4PX9A 3AV0B 4RD3A 2HXYA 1W4CA 1ZCBA 2P5SA 1Z0DA 2QA5A 1IM2A 3FE2A 4Q48A 3SHWA 3CF6R 1SGWA 1EG7A 2GWHA 1LNZA 2FFQA 2FG5A 3A4NA 5BXQC 4ZDWA 3W5JA 4Q9HA 2YOFA 5FPSA 2I4IA 4LWZA 3FMOB 2MSEB 2REXB 3NVAA 1TNDA 5A5GA 3DO6A 4FI3C 1CULC 2OAP1 3AUYA 2CHQA 3NKVA 2C78A 3L43A 1NN0A 2A5GA 2LWIA 4Z51A 4ZI2A 2ZPTX 2IW3A 4B48A 2Q3FA 5E95A 4CIDA 5J4VA 1CR4A 3LXXA 3T5GA 1U0LA 2G9NA 5KSZA 5DGXA 1ZNWA 4EFNA 1PUJA 1GZSA 2O8DB 3WHLA 1RW4A 2XSZD 4TSFA 2NZ8A 3P20A 1COWD 2VP9A 2IT1A 4D0LB 5EE1A 2DFTA 1LF5A 2YVUA 3CRQA 5L3VA 1Z06A 1VYTA 1ZJ6A 1NI3A 2AWOA 1NN3A 2GTPA 1ZNYA 2BBSA 4I81A 1RPZA 1XEWX 2P0EA 4X8MA 2IYWA 5J5CA 4KODA 1U8ZA 3PG5A 4QRHA 4D0GA 2Q21A 1G5PA 5FUVA 2PJRA 5J40A 3EPLA 1DE0A 3B1WA 4DEXA 5CDFA 5CITA 5AWFC 3U61B 4DB2A 2CE7A 2R6FA 5SZHB 3UMRA 3IHWA 4BFSA 2FEOA 1YZQA 3IPYA 4RD2A 4RZXA 4DSNA 2ATVA 1MKYA 2GCOB 4JLDA 5IF9A 5KNBA 4DZZA 1OXTA 3I5YA 2ZM5A 5KYKA 1XNJA 2ZJAA 2LCFA 2QORA 4HAYA 4GSYA 2IX3A 2PZEA 2VF8A 4Q66C 2DCUA 1QF9A 3NC1C 4OQMA 2RKOA 3TMKA 3VFDA 2ZE6A 1KI4A 2YINC 2F1JA 2MMCA 3QJYA 3EARA 4XIGS 2QPOA 4G5QA 5HCNA 1D2MA 4EPXA 2VEDA 1MABB 4PZYA 4Q1FA 5BYJA 4OI0A 4C3ZA 1E98A 3QNUA 5IHPA 4AIIA 4HDOB 4LCBA 2VP6A 1Y63A 2ZRDA 3BB3A 3MUFA
chains in the Genus database with same CATH superfamily
3CGWA 3QLJA 4MWZA 3CC8A 4QBHA 1JVNA 4N3GA 2F1OA 2PSJA 3UMMA 8MHTA 4ARSA 3WB1A 4M9UA 1W6UA 1W36C 4B3GA 4F5ZA 4I55A 3UAXA 4BPBA 5G0VA 3ZWYA 3B3FA 1XPUA 4F2HA 4M0DA 1JKMA 1MBZA 4FHCA 3WBJA 1EEXB 2R96A 5SZIA 2H92A 3RU2A 1XDGA 3HSYA 3RRZA 3FUVA 2B25A 13PKA 2ZXFA 1KBOA 2BDUA 4UFNA 5TT1A 1XPOA 5AW2A 4JD5A 2YVLA 4LBWA 1N6PA 1OE0A 2Z8XA 2QW0X 1R4ZA 2BFEA 2Y1GA 3DW1X 4P7BA 5FI0B 5BQ5A 3SXJA 3KVVA 3R5SA 3ZLJA 3HDHA 1WKBA 2ID8A 2Z83A 1ZOOA 2KX7A 2QYSA 1JBEA 4GP6A 3KCQA 3ZXSA 2N1BA 1KMCA 4NH4A 2COUA 2Z2ZA 4XKJA 5EMKA 1WBDA 4TV9A 5JAQA 3H7IA 3I01A 3IXMA 1D6NA 1GKUB 2WFMA 3H5NA 3RVBA 1MP0A 1WVMA 1QZUA 2PKQP 2C2BA 2PXXA 3GQBA 3OEHA 4IZIA 4FNGA 3A1NA 1MA0A 3L40A 3HNOA 4MUXA 3ORRA 4WEOA 5D7NA 4C0HA 4HV4A 2IIPA 3K1ZA 3OJXA 2OCYC 4QRDA 2PSFA 2O5RA 2A5YB 1LLQA 1OGYA 4MV1A 1GEEA 1S4MA 1SBTA 3GNSA 1B4DA 4GH5A 4E6EA 1XU9A 1A9RA 3OZCA 4EQ6A 1ODCA 2VF5X 5ITZB 3GPLA 1WUYA 2Z56A 5DRTA 1BFUA 2BGIA 4YLEA 1CK4A 4I2NA 2Q41A 3I1JA 3C1TA 3DUWA 5F23A 3VNUA 2XOKD 4NABA 1XPJA 4MV7A 3TQHA 5EUMA 3WQQA 1VBMA 1WUHS 4XPIB 4AWAA 3TZBA 3EF0A 3IAS6 4A3SA 4DIMA 5LBUA 2E0IA 1FXUA 4D8XA 4PAOA 3DAOA 1I7LA 4CGYA 2YNMC 2FSFA 5FAXA 5FOWA 3RUDA 4KIGA 4XR9A 2DPXA 3R7DA 3UF0A 2ZS8A 2VQSA 5H02A 3U3KA 1TFRA 1NOIA 3N5CA 1NFRA 1TGYA 1V1MA 3PDJA 3WZMA 3NOQA 1KRHA 4B7ZA 2ZPUA 2UV8A 4MYCA 2I1LA 3O4IA 3ZIUA 3TQIA 3HA3A 3FGOA 3TSWA 3BAFA 2DRIA 4HF7A 5E6SA 5IYZF 4G0ZA 5I9NA 1EFCA 1Q5PA 1ZICA 2Z4TA 3AL0C 2WJIA 5TARA 2B35A 5J4HA 3IDSA 3MNFA 1CY7A 4QPZA 1HXHA 4R1LA 5TSDA 2P9GA 4NS1A 2ZETA 1QONA 3GT7A 1KJZA 5D51S 1ZUNA 3VQTA 5AVZA 4PYQA 1U2GA 1C2TA 1L5KA 2M98A 4G8BA 3SU8A 4BB5A 1C9MA 4BBJA 1SEVA 4ZQCB 1MO6A 2CNDA 1BEZA 2ASEA 2E4WA 4U2GA 4DWWA 5KQLA 2WIFA 1N5OX 5CJJA 5FO0A 1J6UA 1Q22A 3U7QB 4ZOCA 5AVXA 4XARA 2WJJA 5EXXA 4FEAA 3ROGA 1Z4KA 4EBFA 3ZBPA 2VAWA 3QPVA 4BRWA 3UGTA 1N77A 3P9YA 2BH2A 3DOCA 1ISIA 2LVBA 3F8TA 4DL9A 4L27A 3EQ2A 3DHWC 3M9WA 4BMPB 3E7XA 4TKUA 1HYBA 2GN0A 3RARA 2DSTA 3FDXA 2XVXA 5K0LA 1X19A 4G36A 4BMVA 4ZGWA 5CEFA 3R41A 2OHOA 1M1UA 3R5KA 4OUDB 1LJLA 4YRGA 4X3PA 2QBYB 1RYFA 3I04M 2H1HA 3C4VA 3GMIA 4JBXA 4XSVA 1T3HA 1WDMA 2BKVA 2QE7A 2FXIA 1GJRA 1OUMA 1GCUA 1A0OA 1L5SA 5F5XA 1TIPA 1H4TA 2CL7X 4JL8A 1GZDA 4PYIA 4GI5A 3Q9LA 4GPAA 3REQB 2XQGA 3SCZA 4FDLA 3LWBA 1XR3A 1WKVA 1FXWA 1PNTA 5BOVA 4EHNA 1Y6FA 1TCUA 1C7ZA 5JQWA 2IBSA 2IGTA 3IYLW 4EGCB 5I7RA 5L6LB 4IINA 1D1QA 4FQ8A 5HKKD 2G5GX 5KREA 2I2XB 2Q5OA 3AFGA 1ZOSA 5HJ7A 1ULUA 1W1WA 2FSHA 4LYFA 1YQUA 2BHRA 1PG0A 2XDQA 3FG9A 3I1FA 3ZTTA 4UOEA 3EA5A 3GRCA 3RV4A 1L0BA 4Z6KA 4TRJA 1CJVC 1BMTA 3UMVA 3ZCRA 5BURA 3SHQA 5KTYA 5AKLA 4LDPA 5CJPA 1X86B 1NF3A 1R6DA 1LDGA 4K9PA 3UV6A 1KEKA 2WI8A 5ALGA 4PGGA 3M4ZA 1TO1E 4JEHA 2FZVA 2IODA 3MQ2A 3MTEA 3FOAA 1QGAA 4TROA 5IAKA 5K2MA 3A2KA 4ZZ2A 2YWFA 4EQZA 5AK0A 1Q0LA 1Y7LA 4L15A 4II3A 4JXZA 1N2CE 4FZRA 1KEUA 1VRCA 2JRLA 3L3BA 3NDJA 1NP3A 4KI7A 4B2YA 4DV7B 3AWDA 1GNQA 3DA8A 2D0OB 3ZIAD 4ESOA 3F46A 1CZHA 4BNVA 4B2IA 4KFCA 3FCEA 2XUQA 1UK8A 3X1ZA 5KVAA 5IUKC 1A8SA 1A4XA 1CZRA 5AUPB 2NQTA 3KJZA 3QUAA 4H2DA 5E1MA 4HZGA 4HB3A 1YR7A 3FLMA 4G5FA 4NFSA 4A2QA 1CFJA 4TTSA 3LHKA 4M38A 1OWMA 1YDFA 4PFKA 4U3JB 1YS4A 1V16B 3Q8XB 2R1UA 3PQ5A 1XQVA 1XYGA 4PPNA 2O57A 4X84A 2HDHA 1CQWA 1TU3A 4R81A 4M0KA 1VHQA 2JCVA 3LOUA 4LK2A 4P6VF 2LZ0A 5H3LA 1YS9A 1GG8A 2OHFA 2Q3HA 2AJLI 2YYYA 3EZGA 4RUKA 4FYHA 5MFPA 1NTOA 2A33A 4YRFA 4ACAA 4YT4A 9ATCA 1MX5A 4HNAB 1JG3A 2ZYTX 4D02A 5JSZA 2ZYSA 3CT4A 2V7GA 2ORED 3GV0A 3TVTA 2CL6X 3JQFA 4YGXB 1F17A 1UPCA 4KE9A 5H59A 1A8PA 1P2UA 3DL2A 4G84A 2BEWA 3LIIA 1JAXA 3NT4A 1QHSA 4PLGA 4RK6A 3SOPA 4UHDA 4M0MA 3I61A 1EYZA 4YT2A 1RXCA 2FAXA 1ZNZA 3I5MA 1ZONA 2CHVA 2IZ0A 3F4KA 4JLNA 4B6GA 1VL0A 5LZ2A 2UYCA 3KP1A 4QD3A 2VDPB 3BFKA 5J5VA 2KJQA 4RACA 2YY6A 3O8OA 1Q14A 4YJDA 3A10A 4Y6SA 4DNQA 3SEQA 1QO0A 1SC6A 4I9GA 4OYHA 4N48A 5LIRA 4IOLA 2VJLA 3F97A 4RENA 1S2LA 4RZ2A 1JQLB 1U2RA 1Z0IA 2IXBA 2JLRA 2QLTA 4JMPA 2FWNA 5G3YA 2JD2A 3PRHA 2O20A 3RC2A 1Z6AA 5LZ4A 2XCRB 1TYBE 1NNSA 1JAHA 2CJXA 1EBUA 3EDMA 3LCRA 5CA0A 2W2NA 1ESNA 4BZWA 3QPDA 3BULA 5K8LA 3THRA 2RGGA 4HP8A 1C0IA 1P4AA 3DEIA 2E4XA 3X0DA 1EFKA 4G07A 3PCTA 2CF5A 4D92A 4R05A 5JCOA 4BO3A 2HLDD 4EBBA 2IUTA 2QM7A 4HLDA 2OYCA 4OQDA 3QVOA 4Q82A 3TDKA 1BEUB 3QVSA 1LA2A 5JSFA 5M5BA 4DDVA 4C03A 3WGYA 3OJFA 1I2CA 2EP5A 1VGRA 3GLIA 4WV3A 5B57C 1LRJA 1U28C 2QENA 4BFZA 1UIMA 3H4MA 4CNBA 3T94A 3TLGA 4OV6B 1EH5A 5LDHA 3P0EA 3AHDA 1AUOA 1JIQA 1XROA 5JYDA 2ECFA 3U1TA 3BS4A 3INNA 3MWKA 2HA4A 3IPCA 5FFNA 3CLTC 3LXUX 5I4KA 4B8YA 1TF2A 2Q4BA 1PZGA 5DLDA 3OIVA 4JX9A 3PYLA 3BFPA 1YUNA 3IBYA 2NYVA 3HUDA 3GDGA 4A8PA 1V26A 3A6ZA 5LB4A 5CXUA 5EXEA 5C51B 1E1NA 4OO3A 2OGUA 3LQRA 3OE5A 2VH5R 2IC5A 1FFYA 3OQ1A 4CCYB 2II6A 2WQ7A 2C0PA 3RS8A 4JFRA 4Z1MA 2ZYRA 1CY8A 3D4PA 4HXYA 2ALJA 4MKFA 1P74A 1RQ2A 3K6SB 1EM8B 3T35A 1RXWA 4EA8A 4R7TA 3SK0A 5I9SA 2X0JA 4JA0A 4S1TA 1FPMA 3NUQA 4FHDA 1UDWA 2TMKA 2QP4A 1QQTA 1E63A 4B9EA 1A2BA 1NM5C 2JB9A 3BIFA 4U0JA 5JI3E 5DM0A 2XDYA 5CA1F 1LV8A 2BFBA 3ZGNA 2B5VA 5J3JA 1B3RA 4IKEA 4L5YA 4ZPXA 1QRUA 1SXJD 2C5EA 2AG5A 3GVPA 1XXHB 1J5PA 4BP9A 4D7AA 2IDJA 3PV0A 1JGTA 1AGRA 5DFAA 5J2TA 3U7FB 2I0FA 5FPQA 2H11A 1ONPA 2HFJA 1QP7A 3STWA 3ZV4A 5TPZD 4ERNA 1HQDA 2R3SA 3T3PB 5JZBA 2A9OA 5DLPA 3ZJYA 1D5CA 1PQ4A 2XGMA 3BIXA 4RF2A 3WLQA 2ZRIA 3S99A 2FEKA 5DO9A 1TRHA 4Q6BA 5FL7A 2UZ3A 4J16A 1E2MA 4A36A 1E1DA 4JLAA 2FPSA 2ZS9A 3QW2A 2JFQA 1NR5A 3PJRA 1ZIXA 1Y8AA 4MWSA 4ID3A 5ER9A 1VZ3A 4HXEB 2IH2A 3ICQB 4D98A 5B5SA 4N03A 1GUFA 5JD3A 3ZWXA 3TGLA 3OLCX 2IYYA 2PAFA 1I9GA 4Z8YA 2BT4A 3M5PA 4R8KA 4D9FA 5JASA 5KVVA 1ESMA 2JH9A 3ZGZA 3KOMA 3H6HA 2G71A 4NC9A 4DC9A 2QYTA 3PNKA 3PXDA 3TB4A 2WIKA 5TT0A 2P2DA 4AYTA 1I36A 3EFEA 4JEMA 2CNNA 2HRCA 2R6HA 3VU9B 1X9GA 4DBLE 4LHEA 1NSYA 2MCFA 1L5RA 2CUZA 2QQFA 3PD0A 3RG2A 2B83A 2B7LA 1DU4A 1PR0A 3HQ4O 3P2KA 5HFAA 1II8B 1X1SA 2ZBEA 5EZ6B 3AR8A 4D3XA 4G81A 3W9BA 3ZKAA 1Q16A 1WUJS 1YE8A 3LU1A 2QN7A 4MRMB 3EXIB 4NCJA 3ZWQA 3L6EA 2ZCJA 2EHDA 1L7AA 4ESEA 1T36B 4BQIA 2QAGC 4XZ3A 2G8NA 2P6UA 4YB8A 5KC9A 1FF9A 4ZI3A 1J1ZA 1E9FA 1FMLA 2Z2YA 1TYAE 3BZBA 3M4NA 4IRXA 2PSSA 1E0DA 4NI5A 2D5CA 5KBYA 4BEVA 4MVXA 2Y1OA 3GG2A 1Q7RA 2WUEA 1D2AA 3NV7A 3OPXA 3AVTA 1YQTA 2J3IA 4FC7A 5INTA 2H1LA 2JLCA 5DWQA 1Q77A 5BXYA 4GAEA 5DIZA 2EWVA 5A3SA 4Z4FA 3NNSA 4Q18A 5BNWA 5KS2A 2HAEA 3P9RA 1EJ6A 4L9AA 4LHVA 1I0IA 1OZ0A 2BSAA 3FJYA 3NHRA 4MWOA 5C8VA 1D1TA 3VVLA 3PEUA 5ALLA 3HXQA 4DLYA 4A15A 1YHYA 1KMNA 1GGFA 1Y6JA 1Y7PA 1XQWA 3WIEA 4X0EA 2REQB 2MHCA 3FCCA 4G89A 2DAPA 2TYSB 2WHRA 3GXBA 1DKPA 3KQMA 4FYYA 4O8CA 4XCVA 1YVEI 3TXAA 4LSWA 4PZDA 2ZWVA 3H05A 2Q3BA 3JQBC 1N5KA 3I76A 4AFNA 3COJA 1Z33A 1BCSA 2FN8A 3EIXA 4QOHA 1F9AA 3GFGA 4RHUA 4EB0A 1JR2A 3GH1A 3NJ8A 4P3YA 1X7YB 2HBZA 4WN9A 5I9IA 4RQUA 1Q6ZA 1ZN8A 9GPBA 1REQB 4PG6A 1P45A 4BRUA 2AIRA 3LUGA 3MGKA 4HC4A 2J48A 3DE2X 3ZYCA 5BN5A 2CWDA 1DKOA 1O1YA 2C3OA 2Q5CA 3HBMA 1G7CA 4LSZA 4AJEA 2Z58A 2FN3A 3AETA 3IE0A 1BGVA 1C3VA 4BWVA 1LI4A 4L73A 4N9WA 4R8VA 3SSNA 5I9LA 1G63A 3WWEA 1MDFA 1KK1A 4P08A 1Q83A 4F6RA 1LJ8A 5L8VA 4MJ7A 1LPMA 3F9RA 5IM4A 4MGZR 5JNUA 1TEZA 4WBNF 4EPWA 4GI1A 2I8CA 4D81A 5DGCA 5B2FA 5ALKA 4BNUA 1HYHA 5A0TA 3H13A 2AFIA 3TQSA 1FUEA 5EZYF 2UZ1A 1FSGA 2GZAA 4R3NA 5G4KB 1G7RA 5BN1A 2HWXA 4LJLA 4KDCA 4UVDA 3EULA 1USKA 1USWA 3UUFA 1SCKA 2FRXA 1E2GA 1VB5A 4GPEA 1YT5A 2PMWB 1H1TA 4FYWA 5K6AA 4MP6A 4JI7B 4JB2A 4H0FA 1MPTA 4NENB 1H6BA 4WA7A 3LQ1A 4YUVA 5TQ0B 4IXNA 1CNFA 3VPBA 3T15A 4N40A 4HXGA 5I7OA 2C84A 2Z8ZA 3K92A 3LX6A 4PIVA 3VX3A 3ZY5A 5BWOA 3FWNA 1FS6A 4DG9A 5ENDA 3JQAA 4GWLA 3L82B 4UBMA 2JKYA 4RANA 3TBKA 4EB6B 3G59A 5A3QA 4DY4A 4YRDA 1UXOA 2JKVA 1M2KA 2B69A 1KI3A 1QE3A 8AT1A 1ZW1A 1OA1A 1TC2A 2QTAA 1L4MA 4K3UA 1SWWA 1Z8HA 1W8DA 3HN7A 3KNZA 3EFOA 3QOXA 4MOWA 4PRZA 2XDWA 5IUNC 4TTJA 2JLZA 1EFLA 1AHHA 1JLRA 4RD6A 1CRLA 2G6BA 4ZXPA 2PLRA 4QEKA 1JEDA 1HKUA 1WABA 3UG7A 1IBLB 4RM2A 3VDNB 2Z5GA 2DY0A 3GARA 3K9GA 4S2EA 2H07A 5K01A 4P3PA 1FCJA 2J5RA 2JFPA 4RPLA 2C8KA 3WMFA 4BMSA 1H5NA 4IKOA 3K70C 3SC2A 2P8JA 3PYMA 1P44A 3IMCA 1K9VF 1QR6A 1EK0A 1SZPA 4LVOA 3WLIA 2VDVE 1JQ5A 1E99A 1XKQA 3A3PA 1N5LA 1P4SA 2ZB7A 3EVGA 3QE4A 3D1VA 1Q95A 4KGXA 3UG6A 3ZWMA 4EP1A 2YJNA 2B8EA 1NPYA 2CLMB 1DKQA 1DRVA 3L7BA 2HGZA 1HDIA 2QTWB 2VA9A 1YI0A 2AJTA 3NHFA 1YKGA 2XRMA 2VJQA 2V6BA 3SS7X 3LNCA 5JO0A 3OLXA 1XQXA 5T4BA 2SKEA 1R6TA 1ZW6A 1B0PA 2W2LA 4JKIA 4LAFA 1TKAA 1ONNA 1U7DA 3GUUA 3O3CA 4BMYA 4EYSA 4ZTZB 2HIMA 2I4MA 1IU9A 1TCCA 4F3KA 4QOFA 4RJTA 2GZSA 5AVVA 2QUHA 2QUJA 3GRPA 3HI6A 3VR5H 2EXXA 1BDJA 1E62A 4XEUA 3HJNA 4CUKA 1EP3B 3EZ2A 3E9NA 5CMLA 1P6XA 3FTDA 2P78A 4ALKA 2O7RA 3O4GA 4YMHA 1Z2DA 5ILGA 4IW3B 1C7JA 3N7TA 3C3EA 4W63A 4DSZA 1GGKA 1M1YB 1W581 1ZYUA 4JXJA 3O8QA 2WB4A 3KQOA 4R2KA 2GYYA 3QIAA 5CM8B 5KAPA 1U9YA 4IGKA 3V2IA 3LYLA 1H8EA 3BGDA 4HEA6 2HV9A 3NTUA 4I4TB 4E5VA 3IEMA 3EDYA 5EERA 2BCJQ 5AVWA 5L3QA 4BU0A 5BNFA 5HX7A 4DJTA 3WRVA 1KH1A 2ETVA 1NXPA 5G3ZA 1CVLA 4R3UC 2D7DA 4XXHA 1L7QA 1YCGA 2O4CA 2PKXA 2PRKA 5DHUA 1ZITA 3DZDA 3NBAA 3TI9A 2LW7A 4V24A 5KSOA 3QKIA 1OAOC 5I4BA 5ITVA 4CEIB 2FW6A 3D8TA 5KPDA 1FMTA 3QVMA 5K0EA 2C97A 4G0XA 4KMRA 4LNHA 4YQYA 4P84A 3PQ4A 5EWMB 3TOZA 4YQFA 5G1OA 4ZHQA 1CUDA 2EF0A 4IWYA 3BMNB 1RYMA 5C4GB 3K4QA 1SCJA 2DKOA 1G7SA 2O2JA 4K28A 2E18A 3JXEA 3FCAA 4PNZA 3EC1A 5LFAA 1XU4A 3RRNA 1I7NA 3DD5A 5B3LA 3G2LA 3TSOA 4ZVNA 3UJCA 4JU8A 5KJCA 3NAQA 1TZBA 4QVGA 4A0HA 1QB8A 1ODLA 3THOA 2QYOA 3H2JA 3TQFA 2A6PA 2GEKA 1CS4C 5LR6A 2PUJA 4LC1A 1I7QB 1IL0A 1E3SA 2EAUA 5TQ2B 3ZG6A 3O26A 2JARA 2WHXA 4FWIB 2YV3A 5LZ8A 1XTKA 3CUKA 1FU7A 5JFGA 1Z4IA 3DXFA 1FW6A 2OZEA 1SD1A 3IS3A 4H59A 4KWIA 4BKOA 2G5PA 4A6PA 3AVXA 4IAOA 1JN0A 4WIAA 1OLUA 3M1IA 2KYRA 2O0MA 3UGQA 3ZK8A 2PGXA 4JUCA 4BX0A 2GBFA 5DNDA 4B3XA 1KTIA 4GOMD 3KQNA 4H6PA 3KR1A 4JC0A 2IWHA 3R3SA 3PX7A 3IR6A 3OO0A 3I92A 2DUJA 1P6UA 4K6MA 3GP8A 3THXB 3HE3A 5IANA 1ADBA 4XLTA 1E3IA 2QTMA 1F51E 2WJGA 4QLBA 3UJHA 2VYQA 3F3MA 3MGAA 5BPFA 5GTDA 5EMLA 4YMTA 1BXRA 2GD2A 3K0KA 3DBLB 3WDSA 3ADBA 4N5NA 3CNNA 2IXFA 3IVAA 3PP8A 3T8YA 3IP8A 3CO5A 4DADA 3T7KA 1T3GA 2QQEA 2ZJ7A 1O95A 1KZ7B 4HAVA 4LCJA 4MUKA 4B8ZA 4FCVA 5FTWA 4AS2A 1T5SA 1ZBQA 3WQRA 4RSGA 4ERXA 2H08A 4RIGA 3V4FA 2C20A 5IH3A 1LVGA 4L1KA 3PDUA 4I9HA 3GAZA 3OEED 3VR5D 4F2DA 3J80A 1U2EA 1DQPA 1XVVA 1XBTA 2XY4A 2F9FA 3WP1B 5KTKA 2MSKA 3QE9Y 4RO0A 3KQLA 2FUEA 1FP4B 4I08A 4K6FA 5ESRA 3VDMA 4DCTA 4R54A 2VS1A 2VBFA 2NP6A 2ZBGA 2AHRA 2KWIA 4PIPA 3JR7A 2W4MA 5GONA 3O2NA 2R1ZA 4HDNA 2LP4Y 2BC9A 5AW4A 2WJZB 2AQKA 5LOVB 5KNLA 1QP8A 2A9QA 4XIJA 3ZVNA 1DMSA 2ECKA 5EUQB 3E48A 1BD3A 4MICA 4ZEWA 4BS9A 4OK3A 3HRKA 1L6IA 4YP5A 3CSSA 3STHA 1AUPA 4D8YA 2C4WA 2A35A 1TJ3A 2O5VA 1Z08A 5JZ9A 4O0LA 4CXMA 1EK6A 2JJ8A 1ZJJA 3DAFA 2XZLA 5H0IA 3L41A 3OKPA 1CUUA 5A5DA 1GYPA 3GUZA 1UJNA 2YZKA 4DWOA 2XNKA 4PQEA 1K7XB 4X45A 1SJ9A 3BL5A 3E82A 2OB1A 2V1XA 1X3SA 1D8TA 1Z5OA 3BMOA 1EVIA 2IHVA 2X3FA 4H9GA 4OMFG 4Y6PA 1SQ0A 3CLVA 4EA6A 3NAZA 2F1IA 3AHIA 3V1MA 3MWYW 3N8KA 3OIFA 5HRCA 3DJYA 1VSQA 3GHHA 3O0DA 4E14A 3P2IA 2Q46A 3DHNA 4JL5A 3Q4GA 3G2NA 4LRSB 4Z7NB 1PR9A 4YCLA 1JU3A 2JIPA 1EIZA 3QWIA 1V5GA 1IJFA 2YZMA 3DW3X 3OESA 3OUUA 4GMXA 5JH7A 2KLBA 1V3TA 3JQGB 3PYXA 3QX9A 4XLZA 2A4KA 2MINA 1YKSA 3G1UA 4FE4A 2ASVA 1NC3A 1A8UA 1RLMA 2NSLA 3L1JA 4CV3A 4EVIA 4Y2PA 4N7MA 4G0VA 2BW0A 1TEXA 1E7YA 1S2MA 4WFQA 4EG0A 1I10A 4TRMA 2FHSA 2D7CA 1V1RB 2R97A 1BNCA 2RGCA 1RIFA 2SKDA 3B5EA 3AR3A 3PNVA 3G5MA 3VR4A 1DEOA 1RHQA 1PT9A 2DBVO 2Z2XA 4AUEA 8ADHA 1Q20A 5IABA 5FULA 1VCIA 4FWBA 3DE6X 4GD3Q 4U02A 2WWWA 3QUBA 5FXMA 1E3LA 1GKKA 2R62A 1P2GA 4ZYWA 1E1CA 2OZLA 2BJVA 5CM9C 3UQYS 1PO7A 5AXCA 1U3GA 3KB1A 2OCIA 4FT2A 1MJHA 5FRDA 4IOKA 2VIIA 2RGNA 2N3ZA 3SWWA 2UU9B 1IONA 1YR9A 2YC4C 2GR9A 1JEQA 3CKKA 4R4JA 5KTRA 5EHZA 4EW1A 4U2DA 3AIIA 2C7VA 5CYGA 5T67A 3AUAA 3H8VA 2ZUVA 3AR2A 3CFYA 4LHXA 5KYYB 1JFSA 2Q9AA 4PFJA 1COWA 4JBYA 3KFLA 3BICA 3NM5A 4C06A 2PM8A 4E51A 2NV6A 3OPQA 3LFHA 2N42A 4QUHA 4EO7A 3RYFB 3G1WA 5C5EA 1AQJA 2C88A 1ZSVA 3H0KA 4KJZA 4FP9A 4W1QA 3R6WA 1NUSA 4B6OA 3JVUA 2VTBB 1QH1A 5IYZB 1IOVA 1AGXA 2Z08A 4WUTA 2WU1A 1JYEA 5CB6A 5SZKB 1RRCA 4LV5B 3L6RA 2G36A 4HFRA 3TQQA 2V5VA 3HJBA 3B6JA 3P52A 1TYDE 4YRMA 5AVOA 4LFCB 1RZVA 4YR9A 3ZDAA 1HI9A 2NAFA 2P69A 4E07A 4EYKA 5EJIA 1X7GA 4NEQA 3ZS8A 3L4BC 4DEYA 5IJ9B 2IS6A 2E4ZA 3PUZA 4HMOA 3FSJX 5KOJA 3IO5A 2DTEA 4JZKA 3I0MA 4LXHA 2RFLA 4MQEB 5DLYA 1ADFA 5I9TA 4BZZA 2PBLA 4CM1A 4BMZA 4EG5A 1YU6A 2O1SA 4ZO6A 3VC3A 2RHOA 2WAYA 1H94A 3DNFA 1H65A 3DVLA 1GUZA 3N7UA 1WY7A 3O91A 3ZXXA 1Z17A 4IFBA 5J5AA 1W7AA 2Q3DA 1WCIB 3EPKA 4PSCA 5F51A 4OHBA 1XALA 3AHHA 3F9IA 1BHSA 1VJGA 4V3CA 5E7JA 4QQRA 2HT6A 4R41A 2REBA 3RU3A 1YS7A 4D79A 1EAMA 4BN0A 2WFAA 4I3HA 4NH0A 2BTOA 5GVRA 2RG7A 4E12A 2WF5A 2WTUA 1MPXA 4LYAA 4ARIA 4FFLA 4B8WA 1ZH8A 3TBHA 2JGMA 5AVQA 2UXCB 1SVKA 3AEKB 3PUVA 1MJFA 5A1TA 5EINA 2W4QA 3RIHA 4G23A 4JN6B 3B6IA 4JODA 2P9HA 5AHOA 4DGSA 1GPAA 3AP2A 5DW0A 4C3OB 5TQJA 1RQLA 3H5OA 3PGXA 1HC7A 3QIVA 4NCXA 5C3MA 4CIWA 2PWYA 2ZDGA 1U0BB 1XP5A 3IRUA 3T4XA 2VUTA 3LWDA 3Q8MA 4KV9A 3TOCA 1N6RA 4EAAA 3AB3A 2TSYB 3FSGD 3L7DA 3MBIA 1G5HA 3REFA 3AUUA 4M8KA 1EI9A 4U1RA 1G20E 1V96A 2IOFA 4L8YA 1TVMA 4B0OA 2OB2A 4MRNA 2OBNA 2XLCA 4TYPA 2VLBA 4HAIA 1XT6A 1O6FA 2UVPB 2O3SA 4LXQA 4JGIA 1P2DA 2I99A 3E03A 4HCJA 4KLCA 1EHIA 1TB4A 2JGAA 2VYND 2NU6B 1M2VA 2XT0A 1TI7A 4MV8A 3T06B 2JLUA 3COYA 3OQ6A 3LC0A 1M2NA 1DAGA 3JWJA 1KNQA 3M83A 2IY7A 1XWIA 2GOYA 2J85A 4C2AA 4FEGA 2C83A 4UVHA 1QGUB 4I1VA 3BUSA 3HUTA 5TEVA 4C1NA 1CF9A 2C4TA 3ZCQA 5DM60 1YI8A 4OQXA 5E9JA 2AOUB 3KEMA 5DLEA 3R6GA 1DZ3A 1ODKA 3GK3A 2W4IA 3OIUA 4KE6A 4HGZA 4RY0A 3RAJA 1NG9A 2RK4A 2L17A 2IYVA 3GFVA 1CR6A 4O4HF 3OPNA 4J07A 1HQCA 4FHFA 3VXKA 5KB3A 1I80A 2GAIA 1PEAA 2W0MA 3FFAA 4IGFA 4N5MA 4TTVA 5CVTA 5IASA 421PA 4KVGA 3WGKA 1ECPA 4GI3A 1ZVVA 2MSCB 1H4SA 1JMVA 4X93A 5BVHA 3HRIA 1W5SA 2SECE 4YJFA 1F6BA 4U2EA 1UKYA 2PD4A 1IXKA 4CQMB 4PSVA 5B1SA 3I39X 3TEMA 3ETDA 1IYZA 3TW6A 3BF7A 3B1YA 3B6EA 3NHUA 4W8OA 4DM7A 3ABSB 4LEIA 3SJZA 1YZKA 1ES9A 3A58B 4JBWA 4JLBA 5K0ZA 2AVNA 5D1HA 3KAKA 4CKZA 3MTDA 5JPCA 1K1EA 2N0SA 4F12A 3H5AA 3F73A 2PKRA 2V6GA 4PAWA 1T5TA 1Q7TA 4RELA 2QMHA 3B3GA 1URPA 1UC9A 2IOHA 1FLNA 3QUQA 1Z5VA 2FSVA 4V2IA 2WICA 1E5LA 3DB2A 4ALJA 1DCMA 3UW3A 2B1GA 5FV4A 4FOSA 2C5FA 2QN8A 2VZ0A 4EHKA 4IF4A 2VT2A 4X8OA 5CM2Z 2A9PA 1M34B 3AM1A 2GPBA 1COZA 1KGDA 3CKLA 1SHLA 3B3JA 1IK6A 2C99A 1MQSA 2C3MA 2G04A 3AB8A 1A1SA 2OMEA 3CTMA 4HLQB 3BTVA 4MVCA 4WASA 1CE8B 3ZE1B 1DWPA 3GEMA 4L7VA 4RLQA 2OCAA 1ZRSA 4S05A 3NUZA 3B36A 2WJ3A 3BSWA 2HU5A 3O4JA 3V2GA 1Y6RA 1N8SA 2X15A 4JNKA 3VC7A 3EHDA 3DMNA 1AA9A 1ZI9A 2B21A 4JLVA 4V0KA 2ZJ1A 4W9NA 4Z7JA 3GP3A 2OSVA 3FOCA 1ILEA 4KPGA 4PWYA 1QYRA 4OI0A 3G85A 3IA7A 1X1DA 3H3FA 3P0HA 3QA9A 3SBOA 3CN7A 5I48A 1VRVA 2IZ1A 5CDGA 2GBCA 4NU5A 4PFSA 4PLPA 2VHTA 5GGYA 1F9EA 2JCSA 1N2IA 2B82A 2GD1O 4P8RA 4ZFNA 2Q7XA 3ZVMA 3MLBA 2F8SA 1L5LA 3SEAA 4X20A 2ZIAA 2REOA 4G9GA 1X38A 3KLPX 1UMBA 5G41A 4J7UA 1R9NA 2JEOA 4RJ2A 3AERA 5EMHA 3CVYA 1USIA 5JROA 1F4PA 2J5KA 2YDYA 1NT4A 1B93A 2O2DA 5LQNA 3X1MA 4RESA 3QSYA 2K2WA 1CTQA 4TZTA 3OFKA 4JR1A 3OT1A 1NDQA 3T9BA 2FGKA 1DFHA 3UAOA 1QIHA 2JCBA 4NZNA 3KTAB 5TS3A 5J2UF 1VLMA 3GJRA 3G0GA 1Q3KA 1U80A 1E32A 3TEFA 3X1WA 3FTFA 2VXYA 1Y48E 3N87A 5BSRA 1V8OA 1AKYA 4LGMA 3H4TA 4MW4A 3DVSX 1JFFB 1T9GR 1ZLXA 2JGFA 3HR4A 3RS3A 4YCCA 2FPPA 5B30A 5T7BA 2FX2A 3K5PA 1FSSA 3BWDD 3C5WP 4KQIA 1MO4A 3CRNA 1LNQA 2G40A 4TMYA 3RIGA 3U7EB 1NKVA 1OXSC 3TLCA 1EAYA 5LYJA 4P35A 2A9VA 1OIWA 2DQKA 3CH4B 5EE0A 5LVAA 1QUFA 4NV0A 5AVJA 4YXWA 4DLRA 4V0SA 5H81A 3WK6A 2FZ4A 2H85A 4YAFA 1VHTA 3RDPA 4A0GA 5KNBH 1VCMA 1N6KA 3KT3A 1WHSA 2YJZA 4ZRMA 1CY1A 4WCFA 5DGIA 4CKEA 3LPLA 5CD1A 3W0LB 4Q21A 3CW9A 4XGNA 4G0UA 4OI2A 2IIBA 3S4YA 4BL5A 3GJ6A 3KR2A 3D2AA 5DSXA 721PA 5B2ZA 1SXIA 3FYUA 5LYYA 3RC3A 1SBNE 3CX8A 3V7WA 5LWQA 3BH0A 3RFUA 2IPAB 4JVOA 1W4RA 1JL3A 3FZYA 1TVCA 3NEJA 2J59A 3I01M 3Q7EA 1JAYA 3QPUA 4LV8B 1PVVA 3LUAA 4WN3A 4XQCA 1U98A 4FZ3A 3K73O 4YQZA 1F0KA 4GOOD 5DB4A 4FR5A 4EJSC 1BDHA 4PYRA 1DAFA 1YD7A 4AN1A 1DBWA 1KE1A 3W9SA 3DS8A 4G6ZA 5GZ1A 2HADA 3NGLA 2CF6A 2D2VA 1ZVQA 4GXTA 5IN4A 3RQIA 1P80A 1YZFA 3IIIA 4GGOA 4TUYA 1AM4D 1E1QA 2G77B 2RKBA 2HA6A 3RIEA 5KNDA 4H77A 3EVCA 1UBUS 1C3EA 1X7HA 1B6SA 1WXDA 2EARA 3ER6A 4G26A 3GLFB 4DV6B 3FTEA 3IIMA 1IUNA 4L4XA 4PCVA 3H4VA 3RS0A 4HQFA 3UYLA 4F72A 1IY9A 5L4LA 2FSGA 2I1WA 3D6MA 3MWFA 2VLIA 4V03A 3U56A 1G5RA 2PT6A 3L4SO 2ZKIA 1YQDA 1USVA 2V6FA 1UPUA 1L5ZA 3SJUA 3N58A 2PUAA 2HU7A 1EB8A 4OYLA 3TW4A 1NONA 1IQRA 4OHVA 2QRQA 3AWIA 1P2BA 2PD6A 3ODPA 5CRIA 3T5BA 3VKFA 2RGWA 5HPYB 5IT0A 3GZ4A 1LBIA 1QO9A 4IX9A 4OYRA 3C3AA 1ZOLA 1B43A 3GQVA 2R00C 3M81A 4DTIA 1M6VB 3FHOA 1GADO 1N9GB 2C77A 2H1IA 4MRAA 1AXEA 2PZAA 1PYDA 5F5NA 4BX2A 4B3MB 4KREA 3LY8A 3ICWA 1OHHA 3OJEA 4ZAZA 2C2YA 1XZEA 4Z9FA 3BG5A 3QXHA 4TT3A 1X0XA 2O2SA 3JARB 4BGVA 4OGFA 4KO4S 5C1BA 4PR0A 2AKEA 4YCAA 1OKKD 4AP9A 3MG9A 4B0PA 4UOZA 1D4AA 3RBZA 5C4IA 3JAWA 1Y0BA 2HJVA 2I2DA 2MSWA 1APBA 3EGDA 4GI7A 2PSEA 3K0AA 2CCGA 5AI6A 2BFCA 4V0ME 1EWVA 5DYGA 1P1KA 1RXSA 4AJ9A 4Y1GA 2GPAA 4BE4A 3G9QA 4M9CA 4C87A 1KXZA 3IUSA 3W7BA 5FIUA 4TQUS 5FWYB 4K81B 1H3FA 1E94E 1FNSA 1OYYA 3G7SA 4CT0A 2EFYA 4AROA 3L8YA 5JJBA 2WZBA 3GYGA 2JF0A 2R1TA 4MDYA 2F55A 1JH8A 1TD1A 4TXMA 3UBTA 1M1YE 3OTIA 4J1TA 3MJDA 2ZJ8A 3CZAA 4QASA 1X70A 4E31A 4CKCB 4UHKA 2HD4A 1Z88A 2ZAMA 4FCCA 4FGLA 1RHJA 4BDTA 5KNBD 1RE0A 2PJUA 3A05A 2DQSA 3FZNA 2IXEA 3I58A 3JASB 3MIZA 3DLBA 4JHLA 4OAPA 2OVBA 3VOTA 2OHJA 4L8LA 3R7FA 3WYGA 3E61A 4UFOA 3WLOA 1O8CA 1YIAA 2F3UA 4BATA 5TF4A 1XZCA 2H4WA 5FUBA 9LDBA 3L9XA 3SX0A 2G7ZA 2HSGA 2ATCA 3SLRA 1SULA 4XVUA 1QCCA 2IHZA 3KR0A 1X7XA 3NEYA 4IGAA 4TX1A 1OBVA 4MA5A 4LE2A 4N3BA 3V1NA 4B71A 4ZO8A 1K4KA 2VVTA 4O1MA 1S3FA 3NDPA 2FFBA 4WBNB 3C85A 3URMA 4BNNA 4BX8A 4GIBA 1P81A 3QMMA 4BNFA 3CLRD 3JRXA 4JY7A 3SZOA 1PFGA 1JAZA