5HCNA

Gpn-loop gtpase npa3 in complex with gmppcp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
253
Chain Sequence
SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GPN-loop GTPase 1
publication title Structure of GPN-Loop GTPase Npa3 and Implications for RNA Polymerase II Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 95
structure length 253
sequence length 259
ec nomenclature ec 3.6.5.-:
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hcnA00
1ZUNB 2VP2A 2ZS8A 4WOPA 5KO2A 3BH0A 1UDWA 2J0UB 4DXAA 1UKVY 1E0KA 1W2HA 2W6JD 2NO1A 2VQSA 1KAOA 5EQTA 1OJLA 4WA7A 5K8IA 4KVGA 4OK6A 2R8RA 4LX0A 4CEIB 1YZGA 3FKSD 4F92B 2R2AA 1KY2A 1N6NA 1P60A 3QEJA 3FOZA 3EA5A 4HB4A 1RJ9B 1GKUB 4AKGA 4XH9B 2ORIA 2ZITA 5D3MB 2OCAA 2ZVPX 1EFCA 2JDIA 3DZDA 4XSGA 1O3YA 3T1OA 3QI2A 3I4LA 3T5GA 2OLJA 3AVYA 1F3OA 1M1YE 4POAA 2OFOA 3B5JA 3GJ0A 4N0EA 4WIAA 821PA 4TLEA 3AKCA 3MGCA 3GJ7A 1NLZA 3NBXX 3AGPA 3T1QA 4W9MC 4A2QA 3A4LA 1DAMA 1S0UA 5EE5B 4A4DA 1GNQA 4D81A 5JHHB 2PZGA 2DWOA 4OQNA 4BRWA 5LD2B 5G53C 1XD8A 4OHXA 4M1YA 2BC9A 3K9NA 4DLSA 1Z6AA 4ZKEA 1VCNA 1JJ7A 1D6JA 1IY2A 4QOSA 3RANA 1J70A 4X8OA 3QY0A 5HKKA 3VKHA 2JASA 3HWSA 1JQJC 3C14C 1JPJA 2V6JA 4TMVA 3X2SA 5KSZA 3GLIB 4PPFA 4LJYA 4LHYA 2ZM5A 4NBSA 1YR9A 4KCGA 1GIAA 4PAMA 4JT2A 3WBJA 3X1XA 1HT2E 1II9A 3TR0A 4B6EA 4U7DA 1I4TD 1VG1A 3K9GA 2MSCB 2FX3A 3QXJA 2BDTA 1Z07A 1DG3A 2BEJA 1EX7A 1VG9B 4HAXA 4MYCA 1AKYA 2XTMA 3KXKA 3DMNA 3LO5A 2QRZA 5CYPA 4PPGA 1P6XA 2N1BA 4HAWA 2CK3A 2JIZD 1VCMA 2QA5A 4JLBA 2FE4A 1SQ5A 1MO6A 2ATXA 2CL7X 4HLCA 1KTVA 2ZUCA 1US8B 3W5JA 4PANA 5JBQA 2CHQA 3KJHA 2AHOA 3E70C 2B7CA 4LZZA 4DSUA 3CX7A 1XF9A 2GZAA 3FPAA 3GLFB 3VU9B 2QNRA 4BLRA 2ZJOA 1JAIA 2ZIAA 3EIHA 2JLVA 3OHMA 3HDTA 1QHHA 2GA8A 4MUAA 5HE9A 3U5ZB 2FSGA 4KVAA 3CPEA 2A5FA 3GLHB 3K8YA 1G8PA 5JWOA 1P75A 4TYYA 2OCYC 1VYVA 2OCPA 4NYMQ 2I4IA 1KI3A 3RHFA 1XJQA 4LPKA 2F9LA 5FTMA 4FN5A 1X8JA 4QGHA 3B78A 3THWA 3SQWA 4M1WA 1K5GA 521PA 2ZREA 3CX8A 3FGNA 1OXSC 1Q3HA 5ANRB 5IF9A 1P73A 3NH6A 2C5LA 4PSAA 1OXXK 3CW2A 3H0KA 5JMTA 2GZDA 1E2HA 4MDFA 1YR7A 4ZO4A 3DOFA 4DLTA 1XMJA 4HDCA 1AQUA 1CJMA 2IYYA 4HDOB 1SVSA 1CS4C 4WAUA 4B3DA 4QJ4A 3PUVA 1XTQA 3DOEA 4NMMA 4URVR 1W36B 4DIEA 1SHKA 2H1LA 3MFYA 2OEPA 3Q9LA 3BERA 1RZ3A 4OI0A 1DO0A 3RS7A 1OFUX 4JVMA 1F60A 4TLDA 2EFDB 1W48A 2JJ2D 2ZI3A 1EGAA 2YJTD 4LJ6A 5HZHA 1XEWX 1UBEA 2ZRMA 1IXZA 4LHWA 5F9HA 1N6RA 4EPVA 2XSZD 1IOZA 5HTKA 1SULA 2V1UA 5E7JA 1R0YA 3R9XA 1KJWA 1R5OA 4YMWA 2IYQA 4C7OB 1A7JA 1SXJD 4RD1A 3K0AA 3ZIAD 2AD5A 2UKDA 1WP9A 1W46A 3PQCA 2ZSDA 4I99A 1PUIA 1FQJA 3KJEA 4WW0A 1SVWA 1E79A 3H1TA 2GXQA 4B32A 1M8PA 3BAFA 4TSFD 2WKQA 1R0XA 4RFVA 4RCYA 4JYBA 4WVFA 3SJAA 4DIDA 1W4CA 2PEYA 2RGEA 3PENA 3FMIA 2ONJA 3W8NA 1TADA 1N5KA 1DAKA 3PR1A 1VIAA 4D4JA 1KZGB 3ZGXA 3H4MA 1DAEA 5HPYB 2QPTA 5LB4A 5CB6A 4ZV4A 2FDCA 1AN0A 1KY3A 1I2DA 2CNWD 4TZ0A 4CYMA 3PG5A 3GEEA 3DKVA 2TMKA 3A1WA 3LRPA 1KO4A 2GHIA 2VF8A 2NOAA 3VHLB 3ZH9B 1KDPA 2OESA 2X19A 1BKDR 2NO9A 4L8GA 4N3NA 2WWWA 4QHTA 1GVNB 2NO7A 2FU5C 3DMDA 3OE7A 4P3YA 2PLRA 2FA9A 3K9LA 2O52A 2PJZA 2ZEJA 5BQ5A 1LS1A 3U44B 2BBSA 2F1HA 3AVXA 1L4YA 2OLKA 4Z51A 1OF1A 4GZLA 5EZ6B 1KSFX 3K09C 2GVDC 2IYRA 2ZRJA 1ZCBA 2IYTA 1AKEA 4TMXA 2A2ZA 3CNOA 3DEFA 4HAZA 1E2LA 1G1MA 1RYHA 3M1IA 3CPJB 2A3RA 4ON9A 4KI0A 2JLUA 4M4SA 4NCKA 1S4QA 3HJNA 5SZHB 4PFSA 3RABA 3RNLA 3QXSA 2GXUA 3M0EA 5DYGA 4A0HA 1P9WA 2ZYUX 2D2FA 3QF4B 2WTUA 1HQYE 3W9YA 3EX7C 2HYDA 3B1VA 2FFAA 2KI5A 1OW3B 2NO0A 2GK6A 3VHXA 1JR3D 1OHHD 3R9WA 1OSNA 1I4LD 3VMFA 5CK4A 1ZC4A 4L9SA 4HEJA 3TUJC 4F93B 2KWIA 4TLBA 2BMDA 1DPFA 2JAQA 3IQXA 1L2TA 2RGDA 2GCOA 3MAAC 4NYIR 2LKCA 2OZEA 3CF6R 1L4UA 1NP6A 3W5IA 1IAQA 2ZJAA 3NHAA 1GL6A 4DLWA 4RD2A 5BYJA 4NTZA 1VECA 5EUMA 2GCNA 2KBFA 4DB2A 2YWHA 4UNSA 2ZI7A 1XWIA 1XTIA 4IFBA 3K09A 3Q7PA 4JBWA 3MUFA 2JLRA 2DFNA 5L3SB 5FPTA 2JLWA 1CR0A 1R6BX 1A4RA 2BJWA 5F3WB 4FMDB 3IPXA 3LD9A 1VDZA 3AF4A 2AFHE 1W4BA 2P6NA 3SEAA 1UAAA 3X1ZA 2XNSA 2RGAA 4PX9A 1ZUHA 1SVKA 2PZFA 4DCUA 1JECA 2QM8A 5FBLB 3TQCA 4FI3C 3GJ8A 4UKDA 3NEYA 1N5IA 1AK2A 1VIYA 1U8YA 5E95A 2I1QA 4LI0A 3AVTA 1PLJA 1QZXA 4HZUA 3BRWD 1WCV1 5AWFC 4EPXA 1XX6A 3ICEA 2WWHA 4LC1A 4HYYA 1RE0A 2DR3A 3T5DA 2V7QD 1FX0A 3OF5A 1LV7A 4BFZA 4IRUB 1G3RA 4ZPXA 3IHLA 1ZU4A 5M04A 2IYZA 1J90A 2REBA 2VA8A 4QBIA 4F38A 2FH5B 5FL7A 121PA 2WJHA 2ZRLA 3KKOA 3BIFA 1QG4A 2ZJ8A 2OBMA 3PCRB 2J5XA 2ZAMA 3K0AB 1E4YA 4AK9A 4TTPA 1OYYA 2QE7D 2ZQ5A 3D3QA 3FVQA 1CULC 1ZIPA 5KNBA 5KYKA 3W90A 4YMUA 2GETA 3OEHA 1ZAKA 2R6FA 3CO5A 2QMHA 1YR8A 2ZETA 1GILA 1ZBDA 1H8HA 1D9ZA 4QGAA 5HCIA 4YMVA 2QMUA 1A2KC 1OT3A 4JJKA 2BV3A 1R2QA 2XZLA 4C0HA 1XTRA 1NN5A 3AF3A 2PT5A 1T5LA 4JYCA 4PR0A 3GJ5A 4LBVA 4LJ4A 4QHYA 2AXPA 4ERNA 3Q7QA 4K46A 2AWNA 1RFLA 1OB2A 5AR1A 5K8LA 3T06B 3L43A 4C4PA 3AKEA 1DEKA 3NBZC 4E03A 2JLYA 1MR3F 3F8TA 1PJRA 4P32A 2GILA 1GFIA 3ZQJA 4RD0A 3KQHA 3WMFA 5BN3A 1KDRA 1XEWY 2VTKA 4NP6A 2K5UA 3BXZA 4UNNA 5F9FA 4A8JA 2XITA 1WE2A 3TSWA 2BCJQ 3W3ZB 2J9RA 4PAOA 4RJLA 2Q9CA 1DO2A 2W6JA 1DOAA 4M9QA 4Z1MA 4R98A 3THXA 3D7MA 4R71A 5JHGB 1OH8A 2WWYA 2CVFA 2GJAA 4JSTA 1NLYA 4D4KA 1Z2CA 3U2QA 5AUPB 3PVSA 1E98A 1JBKA 4DSNA 2Q3FA 2CHGA 3NXSA 1LFDB 3PUWA 3VU9A 4O25A 2R6GA 1KK2A 4W5JA 3OFNA 2GESA 4S35A 2DPXA 3QVUA 1JAHA 2J7PA 4Q1FA 1GL9B 1G7RA 1NBME 5FTKA 4TT3D 2FZLA 5IK2A 4EIWA 1GKIA 1NMYA 2VYFA 1AS2A 5C4GB 3IIJA 2RGXA 3ZS9A 4XWOA 1KI2A 2VP9A 4L5BA 2IWRA 3HR7A 1X86B 2FFBA 4LOAA 2YC4C 2Q0HA 4UXJA 5HCNA 4HUQA 1N2CE 2WPDD 4XIGS 3A1VA 3CONA 1ZC3A 4LJAA 1E2NA 4XVRA 3CKLA 1E2GA 4D26A 4MRSA 3FHOA 1YKSA 3B1ZA 5B57C 1XD2A 2NZ8A 4J0QA 4DLUA 2C95A 4RD4A 1NIPA 4FCWA 4Q1AA 2QT1A 1S9DA 4HB3A 4KLZA 4UJ3A 1YVDA 1E9DA 4YXWA 5FUXA 4LBYA 2IS1A 2VO1A 3C4JA 3P4YA 1T3HA 3QOFA 1ZM4A 3EIQA 3K0FB 3REGA 2F3RA 1BH2A 1WXQA 4V0OA 2GJ9A 4FWIB 5KSOA 2WIBA 1TF2A 3A1SA 5SZJA 1IN4A 4GDFA 2BHRA 3R8CA 2ZYTX 2VLIA 4LV6A 3CH5A 4PC6A 4QBGB 1S9HA 1OXTA 3B8HA 2WOOA 2W83A 4EUNA 2RKOA 5EXSA 2QU8A 3QVVA 4HZUB 2IL1A 4BQSA 4G01B 5B58C 2BCGY 3LY5A 4X8LA 4Q02A 5DN6A 3DHWC 4GBMA 4DCNA 2QP3A 1FX0B 2XEXA 2ZR7A 2NPFA 1XP8A 1G3UA 3EASA 3U4QA 2E87A 4MKIA 3ETLA 2F3TA 2IEYA 2RGNA 4R2IA 2ZRGA 3A8TA 1FMJA 4D0LB 2GF9A 3U7HB 4RD3A 2BVNA 2OFWA 1ZM9A 2VHJA 2GKSA 3L0PA 1NLFA 5FPKA 3U6BA 1XZPA 2YC2C 1ZNWA 3H86A 1OH5A 2XTZA 2I3BA 1CRQA 2AR7A 3AB3A 1MOZA 3IEUA 3LH5A 4RFSA 5JJKA 1HE8B 2IF0A 3F3YA 1U8ZA 3IO5A 1LTQA 3VR3A 1MABB 4MYUA 4F4JA 3QPVA 2ZXUA 4ZIRA 2O0JA 1XFAA 2JJ8A 4C0LA 4HLUC 3U3JA 2P2LA 1DS6A 5FOXA 3AVOA 1L8QA 3RS0A 4BASA 2WSSD 1G17A 1T9HA 4FMBB 5KNCA 2HV8A 4KSBA 2A30A 4UJ5A 4PQRA 4ZCLA 5GJBA 2Z4SA 1QDEA 1JNYA 1G3MA 1Z0AA 4LRWA 4BGDA 2JJ1D 1WBDA 2EYUA 1Q21A 3NWJA 1NIJA 1TUIA 1EFUA 3CPHA 1E1QD 2O8CA 4D0GA 5FTJA 3P4XA 4V0NA 2D7CA 1I2MA 4TN1A 4BZQA 2ODBA 3HR8A 3REFA 2VP5A 1ODFA 4Q7JB 1QF9A 2BEKA 2EFHB 3W6NA 3QBVA 1JQLB 4FMCB 2QTVB 1K5DA 1UBFA 2HJVA 4GMDA 1DAHA 1VPLA 3KQUA 1LW7A 2ZI6A 2B6HA 4BFTA 3H84A 2GNOA 1FZQA 4QBHA 2HLDA 2O8BB 5CITA 5GVRA 2V55B 4Q7LA 5C4MA 2VSFA 4HLUA 1ZVQA 3U7GA 4RSGA 2O8EA 1SVLA 3KQNA 3CUEF 2GCPA 1KIMA 1G6HA 4LYAA 4Q4AA 2DWQA 2WZQA 4A36A 5L3QB 2QG6A 1DE0A 2YWGA 4IDOA 1GNPA 1XD9A 5D3QA 1OFTA 3GCGA 2J0QA 1Z2AA 1IM2A 1ZRHA 1GITA 1SXJA 3N70A 3ZIAA 3CZPA 4Q1DA 2BKUA 3I8SA 1COWA 1E9FA 3U3RA 4B33A 2JLXA 4FMDF 1JI0A 4BPBA 5H8WA 1TU4A 2X8AA 3MWYW 1UKEA 2W6IA 3I3SR 4B47A 4PHHA 4LY6A 1C9KA 1UM8A 3HP1A 4WBSA 2SHKA 4UQOA 4HUQB 2YYZA 3GFTA 1H8EA 1JXMA 1NVUQ 3QXCA 2XOKD 2JGNA 4LJ7A 1Q20A 1S96A 4QC2A 4OK5A 2RB4A 1WDTA 4PPQA 4URYR 1SKYE 1XD2B 2PJRA 1V5WA 2HCBA 4NDZA 2WICA 3R7WA 3CX6A 5IT5A 1OFIA 2IS4A 4YC7A 1KMQA 1S1MA 2ERYA 2IYWA 2GF0A 1E2MA 2G0TA 3EC1A 4IDPA 5J4YA 3ZYCA 2O8FA 3QG5A 1TX4B 1QHNA 2C78A 1N5LA 3I8XA 3OIVA 4Z8XA 1S8FA 3HU2A 3QF7A 4PZYA 4QBFA 4BLSA 4DT1A 5B64A 5CYOA 3SE0A 4IKEA 1FFHA 2Y8EA 3TAHA 2RCNA 1KSHA 2O8DA 2BBWA 3VNVA 3E1SA 2OXCA 2PEZA 3DPUA 3FTQA 4Y0VA 4B44A 3EPKA 1F2UB 3ICQB 2FFQA 1EFRD 4BZPA 4GL2A 1E1RA 1ZCAA 2QORA 3MWJA 3TMKA 2C04A 5GADl 1MH1A 1PV4A 5EP1A 2GEVA 1OXUA 2R6DA 3U4QB 3K53A 5IHPA 2OV2A 4KFUA 4ZDWA 1G41A 1RW4A 2GJSA 4DLXA 1MT0A 1KO1A 2LKDA 2HYIC 1G6OA 1CU1A 2QEQA 2ERXA 4LCBA 3VR5A 5B2ZA 5KOYA 3BS4A 2QBYA 1W0KA 4NYJR 4OQMA 5EE9A 3EA0A 1F2TA 1AZSC 1M34E 1KO8A 1UFQA 4OHYA 1VCIA 1CJTC 1G5RA 3PITA 3OEED 3AVUA 4RFSB 4B3GA 4Q1CA 4N1AA 5EE1A 2W58A 3W3AA 5CLLA 2QSZA 2XGJA 3UWKA 1IHUA 3CR7A 2G88A 1Z0DA 4ZIRB 1IN8A 2AX4A 1E9SA 2ZRIA 3B1XA 4URUR 221PA 1XB2A 3ECCA 4AG5A 2OXRA 4MKFA 1DADA 3GQBA 3UG7A 2FGKA 4HI0E 1Q0UA 2WBLC 3DDCA 4Q9KA 1MO4A 4XD7D 3WYFA 4RD6A 3K1JA 4OKSA 3QIAA 3V9PA 2PMDA 1ESMA 1RRFA 4PC7A 4ZI3A 4B3BA 5A0FA 1P72A 2ZSFA 2EYQA 2N46A 2O8CB 3AGQA 3WY9A 3EPLA 3IIMA 5EE0A 5BN5A 2ZJ5A 2RGCA 1NBMA 1TF5A 1NY6A 3C7KA 4B34A 3EZ6A 4FINA 2O5VA 2WAXA 4LC0A 4Y0AA 2G1KA 1FQKA 3T61A 3TRFA 3EG5A 5KDOA 1ZNZA 1T6NA 2ZU0C 4OQFA 2WWGA 1YU9A 3CRRA 2ZE7A 2FPLA 1IXSB 1CR2A 4QJ5A 1KI8A 3PUYA 2ZI4A 3OAAA 5H68A 3RVBA 4Z8YA 2OAP1 2D62A 2O8EB 4Q19A 4OQLA 4U02A 3T15A 4AC9A 1XEXA 4PQFA 2FSHA 2ZRHA 3CH4B 4AD8A 1AZTA 2Q3MA 1II8B 1XMSA 2FFHA 1Q1QA 3GJ3A 2ANCA 3THYA 5BWMA 2JLZA 2YWFA 4NYIQ 2D4HA 4TYPA 3K70C 1Z63A 4Q9IA 1W44A 5IDVA 1GP2A 1JXOA 2WJJA 2CMKA 4IDNA 4P4TA 5J4HA 2MSEB 1W0JD 5P21A 2BMFA 1DG1G 1XNJA 1QRAA 3QKTA 5AUQA 5JWRA 1RKBA 1NG1A 4Q4JB 4IXMA 3Q5DA 1G8GA 2REXB 4OHVA 2ZRFA 1W47A 2FWRA 1I4DD 4IW3B 2OFXA 5JJIA 2Z83A 1M2OB 4QNMA 3IUYA 3V4FA 4DLRA 3R7WB 5FL3A 4NCHA 2NGRA 3Q85A 1N0VC 3L0IB 5DIFA 3SJCA 5CB8A 3CF0A 4MGIR 1NVVR 1N6IA 3O8BA 1Z5ZA 4JL5A 3PJRA 2X1VA 3GJ6A 4KYUA 4HDQB 3X1DA 3U6KA 2O8FB 4OHZA 4AI6A 3IPYA 5DSZA 1R7RA 2ZI5A 1AS3A 4CEHB 4DT1B 1E9CA 4MQBA 5KNDA 1Z47A 1MO3A 3TSOA 3ZQ6A 2OAQ1 4PHFA 2O8DB 2ZRAA 4BFUA 1TPZA 4HAVA 2GXAA 2OBNA 4B48A 1T5IA 2CDNA 5E7MA 4G1UC 1Q1BA 3P1JA 3I61A 4A2PA 2ZJYA 1AM4D 5DO9A 4DEYA 3NBFA 2F6RA 2IEZA 4ASUA 5JSZA 1WB9A 2HEIA 5SZIA 3LWNA 2ZUDA 4GP6A 3ZZ0A 1BO6A 1KNQA 4TMWA 1DELA 3W34A 3GLGE 3IILA 2WJVA 4M1SA 4TYQA 4RVCA 4AYXA 1TU3A 3KKQA 1F2TB 2G77B 3MJHA 2XNDD 1P2SA 2V3CC 1YE8A 2D74A 2QP9X 4DSOA 5AK0A 3NHBA 1QVRA 2F7SA 2NIPA 4AY2A 3CNNA 4FCVA 5FR2A 2FV8A 3UMRA 1NJGA 3QUSA 2VHCA 3NG1A 1YZNA 1G7CA 1GG2A 4OL0A 3JVVA 3O47A 4ZCMA 3KFVA 1QHXA 3QEOA 1J7KA 1HA3A 1BMFD 1OB5A 3QQ5A 5SZKB 2OUKA 3UWOA 4ABYA 4DUGD 4FMCF 3CZQA 5EXXA 2Z6VA 3SR0A 4IJMA 4H9GA 2VIIA 1P7CA 2E9SA 3RAPR 1UDXA 2J45A 3GJXC 5AJVB 1U0HC 3VX3A 4YMSA 4A92A 3MWKA 3W6OA 4B75A 3SDZA 2IXEA 1NSTA 4M8NE 2IUSA 1A2BA 1G9XA 2G9NA 1WRBA 1IY0A 4G0NA 2KSQA 4MRNA 2V1XA 5FPYA 3U3MA 4HB0A 3WRXC 1W36D 3QNUA 3P20A 4OBEA 1XXHA 4DRZA 3MD0A 1T0HB 2P6UA 4XVUA 2YINC 3GFPA 1NN1A 2EQBA 1ZU5A 4OI2A 4F4IA 1RPZA 4CDGA 1KI7A 3QSYA 3LFUA 5KDLA 1TUEA 2NG1A 3ASZA 1TQDA 5CM9C 2ZE8A 4RZUA 1N3BA 1P3JA 5LDDC 4V02A 3QE0A 4ZI2A 1BS1A 3PXGA 1AGPA 2P67A 2AL7A 2DHRA 3HYRA 2D06A 2ZTSA 4JL6A 3MJRA 4LJ9A 5BW8A 1PLKA 4M21A 1QHHB 3QBTA 2X2FA 3O8RA 2BBOA 2JDID 4W7SA 3OIWA 1QHGA 3A1UA 3ADDA 1T0JB 3FDIA 3JZMA 3JVUA 4PHGA 1P4SA 1Z29A 4A2WA 2IYXA 1ZD9A 4D2IA 1G5TA 1KK3A 3C5HA 4DLYA 3SOPA 4XWKA 3DO6A 1QHYA 5DHAA 1E2FA 4EQ6A 5JEDA 3RRNA 1D8TA 1UBCA 4GOKA 2IWHA 1O87A 1AQYA 3THWB 1FUUA 3LX8A 2QZ4A 2QP4A 4OK3A 1P2VA 4KV9A 3LXXA 3O8DA 3Q72A 3GEIA 3TR5A 4NYMR 2VP6A 4ARZA 1SXJE 1MKYA 2IW3A 4BFVA 1UKZA 4LV5B 5CJ2A 4ZKDA 2C9OA 4C9BA 4V0LA 2RGBA 5EP2A 5H1YA 3S1AA 1NL3A 3SHWA 4NCNA 2D3WA 4BFXA 2BJVA 1U99A 2OCBA 2F1IA 4WXPA 1E2IA 2ANBA 3RS3A 2H5EA 1KOFA 5TMPA 1HQCA 1G8FA 2PH1A 2G83A 2GVZC 4LJ5A 3SBDA 2R9VA 1YRAA 2G0NA 3OIUA 5TVKA 5KHOC 4EDHA 2QENA 4O3MA 1RRGA 2FN4A 4TL7A 3K70B 2AKAB 1OKKA 5FPSA 3T34A 1EFTA 1N6HA 3SI7A 5FI1B 2VHUA 1E3MA 2W0SA 1XPRA 3LNCA 4O0MA 5BN4A 4A6PA 2FNAA 4QJ3A 4US1R 2CK3D 2X2EA 4AKIA 1BYIA 1XTKA 2QL6A 4G5GA 4PO1A 1N6LA 5A5GA 3AF2A 1E2PA 2G6BA 4Q48A 2CLCX 4PHTA 1NKTA 4BUJA 5JSZB 1CXZA 3G0HA 5FTLA 4M53A 4A8JC 3AM1A 1G8YA 3RRZA 1XCMA 4DB4A 3VNUA 2ZSEA 1JB1A 1MV5A 1DAFA 1U98A 1UADA 2FPKA 2PT7A 5KSPA 1G5PA 2W00A 2BMEA 1NNEA 1OE0A 3FHTA 3IBGA 1CIPA 3A37A 3HU3A 3A1TA 1Z22A 2RAPA 1EXMA 2IUTA 4KODA 3WXMA 1XEFA 3UMSA 2PLFA 3VAAA 1R8SA 1KNXA 3OESA 4Q4LA 3KL4A 3FHCB 1ZNXA 1R10A 4OJKA 2VPPA 4OI1A 1Q12A 3I72A 1KI1A 3BH6A 3WBKA 1P5ZB 2OHFA 1JR3E 2GJ8A 3FFBA 4AYWA 4CZ2A 2G1JA 1KHTA 1ZW6A 3UK6A 3VQTA 2QQEA 2AN9A 4OHWA 3UPUA 1EWRA 2V9PA 3ZZUA 1Y3AA 3KKPA 3O8CA 4Q9HA 3ND8A 2BKEA 4M0LA 2FGJA 2CBZA 3AVPA 2WJGA 3BH7A 4QKQA 3TKLA 1JALA 1BOFA 3T1TA 2QAGC 4B43A 3SYNA 4MDEA 2XXAA 2ONKA 1D2NA 2P0EA 2BBTA 1ZNYA 3TE6A 4BRUA 1LVGA 1VYUA 5AJXA 3FKSA 4DC9A 1KK1A 2GEDA 2BIFA 3MCAA 4D80A 4GRAA 4DKXA 3AV0B 2VH5R 2ZYWX 4MYHA 4EPTA 1RC8A 1J2JA 4AWXA 2PCJA 4NU0A 5F2EA 1XU4A 1RIFA 2V54A 5J4LA 3C8UA 4P4SA 3B60A 1FNMA 2V8OA 5FOSA 4MITA 3BFVA 4DDWA 2IYSA 3RS2A 4KITB 3DZ8A 1R5NA 5FR1A 1SKYB 4EPRA 3EW9A 2CCGA 3NDBB 4FIDA 3TAUA 4F91B 2I1VB 2WJIA 4JLAA 4ACAA 4MGZR 2A78A 3BFXA 4QFMA 4D6PA 3PUXA 4TYNA 2GCOB 3RSLA 4IOJA 4BFSA 4M1MA 4B3FX 3ZJYA 1U9IC 2WV9A 1E79D 2RGNC 4B76A 3A36A 5TXGA 4IDQA 1EESA 1SKQA 3SHFA 1NMXA 4B35A 1OPXA 1WF3A 3GMTA 4AURA 2QAGA 4GFDA 3WP0A 1NRJB 2KE5A 2QT0A 4ESHA 1UF9A 4CT5A 2BWJA 3WHKA 3TVTA 3RRYA 5KUTA 4Q7MB 5KPDA 1PLLA 3AP3A 1E32A 4AKEA 3NBYC 2DY1A 3SJBA 1G18A 1ZM2A 4K81B 1ANKA 1DBSA 3RWMB 2KBEA 5J40A 5EUQB 1MRSA 2IS2A 4PTLA 4G5RA 3TUIC 1KI6A 1X8KA 4V0KA 3K0EA 4DCTA 3GLGA 2B7BA 2DCUA 3OE7D 3ONWA 1TEVA 2F1RA 2IT1A 2H7VA 4FXPA 3FMOB 3CR8A 3N5CA 2RHDA 3CM0A 5BYKA 4PQYA 1HY3A 4CF7A 1OFHA 1AS0A 1G21E 2CXXA 4EJSC 4CW7A 4EKDA 1U9IA 2J0UA 3LXRA 2JIZA 3LX5A 3FKQA 4Q47A 2ZRDA 3KTAA 1E2DA 1W4AA 5EXTA 1EK0A 4YONB 2KJQA 1KGDA 1ELOA 3QXXA 4LV8B 3EIEA 3B13B 4Q7KA 5KSYA 2OM2A 1W5SA 4B3CA 3EC2A 2CL0X 2ZRNA 2J3EA 2R6CA 3MLEA 4NYJQ 1IXRC 5D3MA 3UMFA 2A7QA 1JR6A 4RCZA 4Q00A 3FWYA 1LS6A 3IKJA 3KX2A 4IDHA 2R65A 4F7WA 3CRW1 2VEDA 1DAIA 4Q18A 1FPMA 3LBHA 1HT1E 3WHLA 3TVDA 2WMNB 6Q21A 2YOGA 1EG7A 4E5UA 1FP7A 3K9HA 1KAGA 1Z6TA 1S3GA 2HXSA 4GMXA 1CR1A 1GNRA 4EJSA 1SXJC 1ZD1A 2FF7A 5JCZA 1RRCA 4AG6A 1VYTA 4BLTA 3BB1A 5UKDA 1ZJ6A 3AQ4A 1D9XA 2QQ0A 1DVRA 1QBKC 3NH9A 5DH9A 3CRQA 3PIRA 2IHYA 5AUNB 1GUAA 2RHMA 4WZ6A 2PX3A 4DDTA 2C77A 4FD2A 5J4VA 4PAQA 4Q1EA 4QG7A 2C99A 4QNRA 3CF2A 5CK5A 4H1UA 1P2UA 4A0GA 2IXFA 3FYHA 3KKNA 3LVQE 1P2TA 1IN5A 4I4LA 3UKDA 2QY9A 2IF2A 4A8JB 3RS4A 2GXSA 2ZAOA 2P3SA 4ZCIA 1X3SA 1AGRA 2QAJA 2JJ2A 4JKYA 5DHFA 4RY2A 3VX4A 4DCVA 1OIXA 4KFSA 3THXB 4URZR 2XSZA 4C2UA 3E5HA 1TNDA 5EXPA 3GD7A 3SJZA 3CRVA 1GRRA 3KKMA 3K0CC 4DBLC 4B71A 1US8A 1CEEA 1XZQA 5CIQA 1T8TA 1S2MA 3BWDD 2QROA 4Q4HA 5FL7D 5FTNA 5G3YA 2HT1A 2PCLA 1ZUIA 3IQWA 1SVIA 4WXRA 3L0SA 1XXHE 2QPAA 5JS7A 2IS6A 2RMKA 1HURA 1BYUA 3MG9A 4NPHA 5AJZA 4I1SA 2QN6A 4RKFA 1KKLA 1XTSA 4TSFA 4QL3A 5C1BA 3FE2A 1T3LA 1NMZA 4UNPA 2VP0A 3B1YA 3GLHA 3OEHD 2WVJA 5KPJA 4E22A 3ADCA 1H8HD 2ODEA 2E1RA 2F1JA 3FMFA 3KZ1E 2R6AA 2G3YA 1VG0B 2B8WA 1FTSA 4G3XA 1P9RA 2ZANA 2C8VA 2C98A 4LHVA 2CNWA 4NH0A 2DB3A 5EP4A 4UNQA 1B23P 2QAGB 5GJCA 2DFTA 4NCJA 1HTWA 4LHXA 2W0MA 1VTKA 2JATA 3ADBA 5EE3A 1GRNA 4BWYA 2GAAA 2ZROA 3U7FB 1KSJA 1CKEA 2YWEA 1UEJA 1XDBA 3LVRE 3ZDQA 1NVVQ 5AJYA 2J1LA 2WKRA 3WMGA 3K0CA 1XJCA 3TNFA 3UANA 3E2IA 1NI3A 1R0ZA 3CLVA 1KI4A 1Q3TA 1E0JA 1X1SA 1YZKA 3NKVA 1KI6B 4ZDIA 3GLGB 2MSDB 1FUKA 5DISB 5E7IA 3X1YA 4TYWA 2EU8A 2ECKA 2GTPA 1RVDA 3EZ2A 4CEHA 4A1FA 4B73A 3A6PC 4Q9JA 3Q3JB 4QGGA 1OIWA 3LQRA 1Z6GA 3QJYA 2YZ2A 4RZ2A 3TSZA 1U2RA 2ZRKA 4Z1MD 4MYTA 2UZIR 3KTAB 3LAWA 3NVAA 3QKSA 5GJVC 5JJLA 3B2EA 1E9EA 4II7A 5JEEA 4D4MA 4JT4A 3TW4A 1JR3A 1OHHA 3LBIA 4XVQA 5FUYA 4AYTA 5J4KA 3D31A 1R4AA 2ASEA 2QMOA 2J0VA 4C7OA 2J59A 4BFYA 2FEOA 1AA9A 5EZ5A 2ZSAA 2UZ3A 3OFND 4P0TA 2J7PD 2Q3HA 3B85A 5IK2D 2P5TB 2WWIA 3RWOA 2BM1A 2VBCA 5FH9A 2F55A 1T4GA 1KJYA 3CWQA 2ZUBA 3VTKA 4I1OA 2OBLA 3EZFA 4JMPA 3ZVLA 3ND9A 4PC1A 1F5NA 1E2JA 1FTNA 1VCOA 1Z83A 2ZRPA 4XJXA 4BLOA 1JPNA 5JLJA 2GAOA 4GSYA 1GTVA 3AKYA 5FBWB 3EXAA 1Q1EA 1Z28A 4UNRA 5LPNA 3A4MA 3DM5A 2AKYA 3GJ4A 4DHEA 4NE2A 4EJSB 2C03A 4IOLA 4XTCS 2YOHA 2CVHA 3AVQA 2Z4RA 1F6BA 4YXWD 2DBYA 3X1WA 2WHXA 2IYLD 4YDHB 1AIPA 1G3IA 4RZ3A 4GPTA 1RRPA 2O0HA 3EZ7A 4LWZA 4ZDKA 4JZKA 3J81k 2NPIA 1HV8A 2O0KA 2LWIA 2W2XA 4JLNA 3G82C 1G7SA 3JZAA 1YR6A 1XMVA 2V7QA 3D6TB 3P27A 2QTHA 5DLQC 2DWPA 3TW8B 4E09A 1U0LA 4ACBA 2IX3A 4C0KA 3U44A 3IGFA 4D4LA 1XPUA 5DNYB 2NQ2C 1U94A 2IBMA 2MMGA 4MKHA 5A4JA 2JLQA 3U61B 5DN6D 2V6IA 4UXIA 1Z6XA 3C15C 1A82A 3V4RA 3CIOA 4LSGA 2QSYA 4NL4H 4Q4AB 3ASYA 2Z5FA 4DZZA 4MA4A 3WYAA 3LA6A 2B92A 5FOUA 1GRQA 4QXAA 4XTRA 4IXNA 3PEVA 2WKPA 2EWWA 4N0DA 1XCPA 3TGPA 4URXR 1SXJB 3QF4A 1WQ1R 4DEXA 3KQLA 1KYIA 4Q4HB 2LCFA 2QE7A 5C46F 2D7DA 721PA 1HEIA 2CLDX 2ZR9A 2XJ9A 1XPOA 2AK3A 5FPHA 4FCTA 3ZVRA 5GVSA 1OH7A 3GFOA 1D2MA 4TL8A 1IJEA 621PA 3IDQA 4M9SA 3GEHA 4KXFB 5DGXA 3R8FA 1G7TA 4HATA 1YZLA 3LQQA 2YV5A 1WBBA 3P32A 3KUCA 2EVWX 4S2EA 4FWTA 1E2QA 2JEOA 3IIKA 4KU4A 2PBRA 4PZLA 4KFTA 1GDDA 5L3SA 3HU1A 1QG2A 4XSHA 3PUZA 3AP1A 2GEUA 2CCKA 3R20A 4OJQA 2WOJA 5DI9A 3N2EA 1A5TA 2QUZA 1KK0A 2FEMA 2FG5A 3PFIA 4M22A 3ZVNA 4CGZA 2QRNA 1SVOA 4WZAE 1S3SA 1NG9A 1F48A 3WRYC 2Q6TA 1VHTA 3L2OB 5E3HA 4PZZA 1TQ2A 3CB4A 4C30A 1Q44A 3TJZA 3CNLA 3LV8A 3RDPA 1Z0KA 1KO7A 2H18A 3KB2A 1OXVA 4LYFA 5H70A 4A6XA 4I81A 3QPUA 5L3RA 5JECA 5GJWC 4C2TA 4YQFA 1ONBA 2R44A 4V0MA 2A5JA 2HLDD 1OH6A 5G40A 2WIAA 5K8UA 4DJTA 1E69A 1UEIA 2P6RA 3PV0A 3QKSB 4B2LA 4LBZA 3N2IA 2QBYB 3LW8A 3FMPB 1JEDA 1YZUA 4PC3A 5LBIA 1ZMXA 3QENA 4TT3A 1E6CA 2XX3A 3B6EA 4GP7A 2JCSA 3W8RA 3U7EB 3V00A 2J7KA 4F4CA 4A0RA 1QVAA 2ATVA 1COWD 2WPDA 4DLVA 5C2JB 3BJIC 4BLQA 5HR5A 4KSCA 5DI3A 4D25A 2H92A 4JBYA 4HLQB 2W6ID 2ZYVX 1T3SA 3TK1A 1JJVA 1QHIA 5E4FA 4RZXA 3SU8A 4LBWA 4M1OA 1YJ5A 1WA5A 3EARA 1T91A 2ZS9A 1H8ED 4JL8A 2QI9C 4L9WA 3RLFA 3GPLA 2NTYC 2A5DA 4JLKA 5J47A 5FBQB 1HUQA 1TAGA 4JLJA 1NSFA 1WMSA 4CVNA 2FSFA 5HE8A 3VR2A 3F5FA 1UJ2A 2NZJA 2WAYA 3AKDA 3BB4A 3B9PA 1D2EA 2OG2A 2L0XA 1FNNA 1M74A 1C4OA 3PEUA 1NF3A 4TQUS 2D2EA 4YDSA 2PZEA 1KMHA 2EFEB 4IVQA 5CDFA 4A9AA 1VMAA 1N0UA 1MRNA 1E96A 2ODNA 3M6AA 4A82A 1FMLA 3BBPA 1RYFA 3DVLA 2XB4A 1CJKC 3RC8A 3I92A 3SFZA 4TMKA 3VR6A 1SVMA 4GZMA 1Z0JA 2BOVA 1GSIA 1Z6YA 2YNMA 4W5WA 1E1RD 2IC5A 4XOIA 4HUTA 2GDJA 4GNKA 4CT4B 1IY1A 1OLOA 2CE7A 2ZPTX 3CWZA 2AK2A 2HDNB 2GJKA 2VL7A 4TLAA 3GLIE 4QRHA 1XTJA 1XEXB 1DAGA 4NZYA 3TQFA 3AVVA 2EFGA 5FBVB 4DLZA 1J8MF 3FFAA 4G5QA 3NC0C 4JIMA 3BB3A 4IVRA 4KBFA 5J5CA 4ZDJA 3RRMA 2WWFA 4I1VA 4C0BA 1M7GA 4LYJA 3SS8A 1LB1B 2H8KA 4KLNA 3THYB 2YVUA 4JJZA 4MH0R 1W0KD 3NTUA 4KBGA 3R9IA 3RS5A 1N5JA 3ZVMA 3U60B 4IOKA 2OILA 3SNHA 2FZ4A 2XZOA 5FFMA 2ZJ2A 3CRMA 4JVSB 1TF7A 2ZU6A 1HYQA 3KUDA 4JBXA 2H17A 4JLPA 5AJWA 2C2HA 3IO3A 1K6MA 3VR4A 2WSSA 3H2YA 2ORVA 3UXMA 4D0NA 2CJWA 4MRVA 4U00A 2PL3A 2IYVA 2ZJZA 2J0SA 5HKKD 3DL0A 3WNBA 2XAUA 3PEYA 4M1TA 3GLFE 2JJ1A 1C1YA 3FB4A 2QM7A 3WMEA 1N0WA 1HH4A 5EJEA 2QPOA 1E1QA 4MRRA 2WSMA 2JLSA 1VG8A 3ZLJA 3K0FA 3GLHE 4LK2A 3BGWA 4OQXA 1ETUA 4R9UC 1AJEA 3LW7A 8OHMA 4TTRA 5CJPA 5JCPA 3RSOA 4DDUA 4JLVA 1CTQA 2WM9B 4L4UA 5L8VA 4KJZA 3BFKA 2AXNA 2CCJA 4Q5IA 3QPWA 3U3KA 5BXQC 1II0A 3SFVA 4LJ8A 1P62B 1NBMD 4HB2A 1K8RA 1Z08A 2Q9BA 1R8QA 2DFKB 4TQAA 1EX6A 4M9ZA 1YHNA 4CEJA 3QKRA 2ODWA 1LF5A 4Q01A 5TV2A 5FOVA 3VFDA 1TEXA 1GWNA 1PZNA 4V03A 2ZJBA 3B9QA 4ILEA 1T8UA 4DSTA 4PC2A 3BK7A 1BIFA 2H57A 4EFLA 1P9NA 1Q1ZA 4Q03A 3OAAD 4PO9A 1PUJA 1CRPA 4PSKA 2X77A 1KDOA 2B21A 4M1KA 5ELXA 2QTFA 3I5YA 1FL9A 4EFNA 3BORA 4HZIA 3C5CA 2XB2A 5HZKA 4L15A 3UG6A 1LY1A 3BOSA 5DE3A 2YHSA 3VKWA 2CEAA 4C0AC 3C41J 3SYLA 1LF0A 4PPNA 1KKMA 3TIFA 1M6NA 3Q8XB 1HE1C 5DI3B 3SBEA 1MABA 2XOKA 5G3ZA 3NEJA 4IOMA 2NMVA 4MGKR 4G5OA 2A9KA 3C16C 5F98A 4PO8A 1JEEA 2J87A 2WWXA 3L0OA 1XCGB 1KI9A 4YLGA 2CL6X 1KSGA 3D8BA 4Q21A 4Q66C 4CRWB 3W6PA 4JLDA 4X8HA 3BE4A 3DM9B 4EPYA 2VP4A 1NN3A 4EPWA 3IHWA 5JI3E 1IQPA 1D5CA 1G19A 1NY5A 1Z3IX 3DKPA 3AF1A 5EP3A 3WNDA 1XJ0A 1G4UR 2FSIA 3THOA 3A58B 3QG1A 3UATA 2PMKA 5LB2A 4GOXA 5FUVA 3TUZC 4OYHA 1FP6A 4AIIA 2F9MA 2HF9A 1XRJA 1GL7A 1X1RA 3MMPA 3T35A 2HCJB 2GBLC 1XXHB 2VF7A 1FOEB 1KMHB 4P31A 5B30A 4O2LA 2F43A 1MO5A 4FW9A 3EPJA 2QGZA 4Q1BA 3EPHA 1EFRA 3CBQA 3NC1C 3L82B 1Z8FA 2HF8A 1N6OA 1U81A 2EWVA 1OIVA 4KYIB 3K70D 1XMIA 1E99A 4B74A 1UPTA 4TL6A 2O8BA 4LPSA 1CR4A 4TL9A 2P65A 5TDHA 3SC3A 3QKUA 1IBRA 1CJUC 1XBTA 2VRWA 3QXHA 1J99A 1R0WA 2BM0A 4QM7A 1PVOA 5CM8B 5FBRB 1SZPA 2HJGA 1KZ7B 3NDPA 2FMXA 4ASUD 3BD9A 3L8YA 4B6FA 4L16A 4IEEA 1GOTA 4BFWA 5L3QA 1W7AA 2CHVA 2CLSA 3AUYA 3AEZA 4HAUA 2IUUA 1E4VA 2MMCA 2ZI9A 4DWJA 4A15A 4TZ6A 3TH5A 2ZRCA 4TLCA 2WJYA 3I73A 3OEEA 1YRBA 2Z43A 4B2IA 4QM6A 3AVWA 4DDVA 4B3XA 2H16A 4EQ6B 2GBLA 1NJFA 3MWLA 1R5BA 4HSEA 2Z0MA 2HXYA 3NIBA 4M9XA 4TQ9A 4BEJA 3ZD7A 3HPRA 2QGNA 2W2VA 1V43A 2ZE5A 5KU1A 1CF4A 4URWR 4ARZB 1G291 4NONA 3BC1A 2WMOB 4I1UA 2EW1A 3KXIA 4EAQA 4DCSA 5JRZA 2CJWB 4XD7A 5CLQA 3SYKA 3S1AB 3KFXA 1UKYA 3SZRA 3EAQA 3EZ9A 4NKRA 4Z54A 4RKEA 3LBNA 1B0UA 1KDTA 2ZE6A 4H1VA 3ZZTA 5DYIA 5KTYA 3M4YA 1G8HA 3VKGA 1U90A 2KB0A 1ZD8A 2HT6A 4WZBE 4TWZA 1G4AE 1Q57A 4BE7B 1Z0FA 3LDAA 5L3VA 1TMKA 4OI4A 1UBGA 4JLOA 4TTQA 2IXGA 5LD2C 4BEBA 2XJ4A 5TY0A 4QGFA 4GI7A 2GWHA 1LNZA 4R7ZA 3KJIA 3MSXA 1NVXQ 3HPQA 4BZXA 2CE2X 1ZIOA 4LDJA 4QHSA 1F2UA 1Z0IA 1G16A 4CEIA 1SHZA 5JWHA 2B8TA 1CJVC 2FJUA 3B1WA 3B7GA 4GOJA 3OZXA 2FPMA 5JRJA 3QKRB 4CEJB 2IA5A 4ITRC 5TARA 3I5XA 1Y63A 1E2KA 1SGWA 2ZS7A 4P4UA 4Q9LA 1RJ9A 3KJGA 4PXAA 3G5UA 4O2RA 2OE2A 3PEWA 4XWAA 1GM5A 1G3QA 1E0AA 1YZTA 2PX0A 1N6KA 4K8OA 4KFRA 4LGMA 2DYKA 4IHQA 1TQ6A 3KB1A 4US2R 3LLMA 2JA1A 3ZS8A 1E9AA 4V0ME 4C0QC 2HUPA 1ZM3A 2QMEA 4GT1A 4JVNA 1W0JA 1CP2A 4MGYR 4MRPA 1CLUA 3TLXA 4LUCA 4EFMA 3EWSA 3SQXA 2EFCB 1GKYA 2VSXA 1ZM7A 1W5TA 1G20E 4IEIA 1QHSA 3KQKA 4BLPA 1GZSA 1U0JA 4IVPA 1W2GA 1W49A 2AWOA 2ZR0A 3SN6A 1H65A 2ORWA 1E94E 2VHTA 3IBYA 1IONA 2NO6A 4JVLA 4MKGA 4PSVA 3VR1A 1NVWQ 3RC3A 2DFLA 4JKIA 2ZRBA 4NCIA 5K8TA 2J41A 3GLIA 1FW6A 2V4ZA 1E9BA 4E07A 3F0TA 4KAXA 4JSYA 2C96A 4B2PA 1GAJA 2J46A 2ZVQX 1X6VA 4D82A 2AFIE 3P26A 3Q5EA 3I62A 1G64A 3B82A 3LLUA 3T12A 3U3OA 4IFEA 5FOWA 4CIDA 5JZVA 3K0SA 2BMJA 3I32A 3T1VA 3AUXA 4DVGA 2GK7A 2XXAB 5AUOB 4JS0A 4KO8A 2F43B 1NKSA 4P33A 2N42A 1E9RA 1ZP6A 2OT3B 5FI0B 5TB5A 2YOFA 4BECA 1ZYUA 2XTNA 1S1CA 1M7BA 2W2TA 1W1WA 1W4RA 1EFHA 1OKKD 3EWAA 3AF0A 4HLDA 3WNCA 1CBUA 4UXHA 2R62A 1YZQA 3KDSE 3KXLA 4P4SB 3AH8A 3TBKA 3AP2A 3IEVA 2AD1A 5FUWA 3MRSA 4G5SA 2A5GA 5CDFE 1U8AA 1OV4A 2FOLA 4LHZA 4AKHA 3I1FA 3GLFA 2A5YB 1E0SA 2Q21A 5CIWA 1W36C 1X8LA 1NN0A 5JFGA 2Q9AA 2XZPA 2C9CA 1TL7C 1KO5A 3A4NA 5G41A 4X8MA 4YMTA 1DARA 2RH5A 4JLMA 1II8A 2XNDA 1N25A 4M2LA 421PA 4LYHA 3ZD6A 2IHBA 4TMTA 4U5XA 5C18A 1KJZA 3L8ZA 2P5SA 4TMZA 1YQTA 2GZHA 3UIEA 1L7VC 1IN7A 1M7HA 3GP8A 1A1VA 1BMFA 1J8YF 2REOA 1VHLA 2IK8A 2ZSBA 4C0SA 1VKJA 1ZINA 4DUGA 4Q4JA 5FOTA 1OYWA 1ESNA 4HAYA 1P61B 1EWQA 1E2EA 1Q22A 1IN6A 2IYUA 4R2HA 4US0R 3WYGA 5JI2E 4ESVA 2RGGA 1TTTA 4C0JA 2OSBA 3OIYA 1N6PA 3WP1B 4NHOA 3HYTA 4KHZA 4A0FA 2GRJA 2OO7A 2YKGA 5JS8A 4W5HA 3ADKA 3RYTC 1TQ4A 2C9YA 1DTSA 2VHQA 1Z06A 5KDDA 4C3ZA 2VSOA 5IRCD 2UVQA 1IJFA 4MUBA
chains in the Genus database with same CATH superfamily
1ZUNB 4B6JA 5IG2A 2WV7A 4GR5A 3ZDEA 5ERYA 4JKOA 5FFNA 5BVGB 5C32A 1CEXA 2OVFA 2HH9A 4MW6A 1QUEA 2J0UB 1F12A 1Z34A 1E0KA 4D4GA 3DZFA 3C24A 4GLJA 2VQSA 1EINA 5BW6B 4HC4A 2SECE 5LOVB 5K8IA 1JDTA 2PLAA 4OK6A 5IAJA 1V8BA 1AURA 3DKRA 4U7TB 3IPCA 3FPKA 2HWXA 3IVRA 3MLAA 2GPWA 2FTKE 3LM8A 1SELA 2I3ZA 5EJGA 1TFRA 5A3JA 4YAOA 4CIWA 3OU6A 1X7WB 3QEJA 4UUPA 3EA5A 3H1AA 2PA0A 1MIHA 4EVQA 3PFCA 2ORIA 4XH9B 5D3MB 3DOOA 4JWKA 1EFCA 1KP3A 3U31A 4BWVA 1O3YA 3QX8A 3QI2A 1MB2A 2C2KA 2NU7A 4K9NA 4M7RA 3T1OA 2W2OA 1PDVA 3HY3A 3T5GA 1XMOB 4WLOA 3P4UA 2ZTUA 2R7LA 4POAA 5IZCA 1JA0A 2ATIA 5AIAA 4UTPA 2FAXA 5KREA 2PRJA 1XROA 2FRDA 4CM3A 2XD4A 1GLNA 2Q8NA 2EP8A 4IQ0A 4A2QA 4QASA 3U40A 2FW7A 2Q50A 2I91A 3AU9A 2FSVA 3JY6A 4OO3A 2H7YA 1SUWA 2ZIWB 2FP4B 1XQ9A 3NANA 1FFGA 3JWHA 1UDRA 4IHJB 5EE5B 3RYCB 4B3TB 2PZGA 3WR5A 4OQNA 3FSJX 5IJ0A 2JGRA 3MFQA 2DHCA 4DLSA 3Q40A 4GLFA 4D5EA 2X5KO 4FQ8A 1QGUB 1Z6AA 4HWRA 4JSRA 1WAMA 1YIOA 2DTDA 1CUWA 1JJ7A 1CE8A 5F7OA 1D6JA 3RANA 1J70A 4P5EA 3VKUA 3QY0A 1T8WA 5HKKA 4JD5A 1W85A 4FDUA 1UMDB 1J25A 3FMGA 1TGYA 1B14A 1BKSB 3IT3A 1L5SA 3GLIB 1XZEA 4NBRA 1FJ2A 3DUFA 4R2KA 2PJDA 2ZM5A 4A10A 1K66A 5A5FA 4HQLA 1Q7RA 4PAMA 1LRJA 1L7QA 1UXIA 3ECSA 3EMDA 4JT2A 3LNTA 5FBHA 4B6EA 2EJVA 5ICCA 4IJVA 4U7DA 3KDPA 4M0EA 2XTJA 3KT0A 2WA1A 3QXJA 2BDTA 3CUKA 1LV8A 1ZVJA 2BEJA 1WXEA 4D99A 3L6RA 1K7EB 1M54A 4IIFA 2G1UA 3IR7A 1D2GA 5LBUA 3LO5A 2QRZA 2NNLD 3E9QA 2UZAA 1P6XA 1VRCA 2R60A 4HAWA 2JIZD 4L3VA 3V2HA 1F14A 2FEWB 2H9AA 2BE7A 2IYEA 4O0LA 1BVRA 2CL7X 2ATXA 1HI9A 1YJXA 1KTVA 2H1VA 2ZUCA 1C7IA 2D54A 4HPJB 4M1EA 1EGMB 1S8AA 1ZGBA 4WK4B 5JBQA 2P9TA 4MUKA 2QWXA 2CHQA 3OC6A 4N0PA 4H60A 4OH7A 3VR4H 3WFIA 1KOGA 2O2JA 3E70C 4EQZA 4DSUA 1XDSA 3KLMX 2GZAA 1G5FA 3FPAA 1XT6A 3PX3A 1LD3A 1WUIS 2G9ZA 2Z8ZA 5GV8A 3KJQA 1PHRA 1U5CA 1IL0A 1U8CB 4M9UA 1O9BA 4RTQA 3KYDB 2FSGA 4QUGA 4OLBA 4YRGA 3RSHA 1Y5NA 2G28A 3CR3C 3GN2A 3LP6A 4AJLA 1RQNA 5JWOA 4RY9A 5EJ4A 2WYUA 2C4MA 2I8CA 2JK0A 2OCYC 2XMBA 1FFEA 4TXMA 1IQRA 4CI9A 4M89A 4HV4A 5CVTA 3KO8A 1FC0A 2F9LA 5FTMA 1ZGCA 3SYMA 3B78A 3F5DA 3M5DA 4JFRA 4M1WA 3JQ7A 1QE0A 3N1UA 1SWVA 1HMPA 1P73A 5JALA 1LK5A 2H4YA 3DLTA 5FIUA 2NADA 4IIDA 2GN9A 3TZHA 2GZDA 5JMTA 5KTMA 2AZXA 1YR7A 5G4KB 3NEPX 3VU1A 3DOFA 1N2GA 3KALA 4UVEA 1WUTA 1V3UA 1XMJA 4HDCA 4MYDA 4OLAA 1TM1E 2GNAA 3WWEA 3ONEA 2HRDA 3K1AB 3OE1A 3GA5A 3L8FA 3WIUA 4A5SA 3OO0A 3F71A 2VK8A 2TMYA 1UBLS 4F1WA 5HUJA 2H00A 4NMMA 4URVR 3QX7A 5KMGB 1KEWA 4DQXA 2H1LA 4NCBA 1KFKB 3UJCA 3UMGA 4AJPA 4CMEC 2PGOA 4D6XA 3BERA 5I4CA 4CLDA 3L7CA 4CM9D 3VTAA 2IEIA 3LUAA 2EIHA 3BMQA 4JVMA 3JYLA 4LKOA 1WZIA 1F60A 4TLDA 5K6TA 1OJ7A 2X6TA 5TQ2A 3GBSA 4JBLA 1W48A 4WK2B 2ZI3A 1Z18A 3CS3A 4LJ6A 2YZMA 1G20A 3VR0A 2O2ZA 1UBEA 2YWCA 3LCUA 2QHXA 1KAMA 3R40A 4XXHA 3T7IA 2XSZD 5KYWB 3ET4A 2GD2A 2W22A 3A4YA 5HVNA 1DKRA 4YS6A 3PTLA 1JJIA 3D4PA 2NU8A 4F3RA 5KB3A 3R9XA 3OETA 4S1NA 1OWMA 4YRCA 4C7OB 1DPGA 3IAXA 5I9BA 1SXJD 1YS4A 2HMWA 2NZWA 4HRXA 2AD5A 2NTJA 4G37A 1Y6JA 3C3YA 3H2IA 5C8YB 3RTDA 4HL6A 4I99A 5KC9A 4RSMA 1WPRA 2BKAA 4EHIA 3GU3A 5BNIA 1GLVA 4KR0A 3PJFA 4NS1A 5K20A 4B32A 4DWWA 4LF9B 2RJNA 3ZCRA 2Z09A 3G0CA 3GK3A 3BEDA 4QJIA 3DTVA 1R0XA 4RCYA 4WVFA 1L7XA 1U7TA 5EY5B 1ADJA 3ZHVA 2RGEA 5BNWA 1P7VA 4A6DA 1N5KA 1DAKA 4D4JA 2P8SA 1N2SA 1KZGB 3EXIB 3MYRA 8ADHA 3G7UA 3ZTWA 5HPYB 2QPTA 2Y1XA 4RPHA 4X60A 1XDWA 2I9PA 3UCEA 4ILKA 1MC4A 2AH5A 2FP3A 2FQ1A 2P2YA 3DR5A 3SXUA 4G0OA 4UC0A 1X2BA 2GHIA 2NU6B 2WD8A 1PQWA 4WK0B 3VHLB 3WGYA 1DMSA 2J85A 2X19A 1BKDR 3EEQA 3R4CA 4JXKA 3Q11A 2WEKA 2PRKA 2WWWA 3G85A 3WYEA 3B3AA 4TTVA 1GVNB 4AROA 4EL5A 3OBIA 4ZT2A 4YAGA 3K9LA 2FPWA 1T8YA 4QULA 2GAFA 2FB9A 2O3JA 4LTDA 3UCFA 1TK9A 1JKFA 2F1HA 4DC0A 4N76A 1SG9A 3CZ9A 3AVXA 3C3CA 2OLKA 3ZKAA 4QUAA 2PD6A 4FZRA 4F2PA 3ZUPA 3OE4A 1EFVB 5MF6A 1I6MA 2GVDC 2ZRJA 2G76A 3T3OA 3FTCA 4V0SA 3CNOA 4PLCA 2JI6A 3IUEA 4DZRA 3F96A 4N41A 4UMDA 3M1IA 2IY9A 4MARA 1P77A 3H2JA 3HQ4O 4X84A 2QJFA 4KI0A 4C4XA 1L7RA 4RETA 2OBBA 3N8HA 1S4QA 4OHBA 4QSHA 4GC5A 4E0BA 2YWRA 3QXSA 4A0HA 3K2IA 1YF3A 1G0NA 3DE0X 1XJWA 2ZYUX 1A5ZA 2XF2A 2D2FA 1DIBA 1EJ2A 1KZ4A 3NHUA 3QF4B 3HV0A 1XMXA 4CWAA 5JZSA 1R00A 1AKUA 2JBAB 2KI5A 3LWDA 5DBFA 3IOCA 3TOZA 1IUOA 4WQMA 4GSKA 1BN6A 1W88A 2BGJA 4RO0A 3VMFA 2X15A 1WKBA 3HG7A 4LA4A 1XTTA 4R40A 1C5KA 1RCUA 4C2BA 1E1CB 5LWHA 2BMDA 2JLCA 1L2TA 3MAAC 2A0WA 1L4UA 1YK0A 2XV1A 3EA4A 3KS9A 4H7IA 1IAQA 1ESZA 2B9VA 1OLUA 5G1OA 2XUPA 3B7WA 3NPMA 4D02A 1DFIA 1HOTA 3TX2A 4NTZA 1VECA 4CLRB 5LSAA 2YMPA 4GEGA 1PJBA 2KBFA 2RG7A 3TSYA 2IH4A 2YWHA 2FLWA 2ZI7A 1E0DA 3EMBA 2M2IA 4IFBA 4UNSA 5K0ZA 2JLRA 3QBDA 4NBNA 5GIOE 3ITNA 4OL9A 2JVJA 2VHZA 1R6BX 5F51A 2V7TA 6ADHA 3CNQS 3MUOA 1VDZA 3CT6A 2AFHE 1W4BA 2P6NA 3DPSA 4RV9A 3G0IA 1XPJA 2XNSA 4TKLA 1YDEA 5K2MA 4GG1A 2C0PA 4B2YA 3KJZA 1ZUHA 1JECA 3AERB 4FI3C 2VQFB 3DMRA 4KO4S 3NEYA 4UKDA 3SM3A 1VE3A 2VEOA 3GEGA 1VIYA 2CUZA 2I0FA 3O8LA 4OHCA 3TLBA 3I0ZA 3ZJTA 3AVTA 1XMQB 3KOUA 4AUEA 2WHQA 1FTWA 4IIHA 3FPBA 4LC1A 2FXIA 1XG5A 1RE0A 2DR3A 4RDIA 2HHLA 3OF5A 3QX9A 1FF9A 1E6LA 1KBOA 3DD5A 3ORQA 4BFZA 5CLFA 2J33A 4W5QA 1SCUA 3DDZX 2JJQA 3QMVA 4LZAA 5I45A 1D1QA 4X5OA 2XUIA 1X38A 4BDTA 2REBA 1GZ3A 1U4SA 3NZEA 2VA8A 4B5LA 4QBIA 4F38A 3OX3A 3PQ6A 2SCUB 1NVBA 3QEMA 1HDCA 2FH5B 3L5OA 4GI3A 4OUDB 5JS2A 4RMGA 3FCUB 3E82A 2ZRLA 1CHNA 1Z73A 1N2BA 2EZUA 3KKOA 1XRNA 4Z0NA 3TIVA 3M70A 3QHQA 3BIFA 4IGEA 1S2GA 1T9BA 1UL1X 3LUJA 5LMUB 4L07A 2J5XA 1B2RA 2ZAMA 5L6MB 3EG9B 5CH3A 1UPBA 3K0AB 1NVAA 4UU8A 2ZDHA 2F48A 4PAGA 3WLIA 5JVDB 1ZIPA 3IERA 1I4WA 3OEHA 4R1TA 2PE5A 1IPEA 1NW4A 3CO5A 1VL8A 2AFIB 2IV3A 3NHPA 2VDWA 3ZKWA 1H8HA 1T2FA 3LBYA 5F1KA 4H2DA 4C88A 3F98A 2G4CA 2J5QA 4GYWA 2YY5A 2I80A 1P0IA 4ENVA 2BV3A 1PN3A 2ODPA 1R2QA 5IH3A 3Q2IA 4JGGA 4C4OA 4EZBA 1I3NA 2KPOA 2XZLA 2C4VA 3WKAA 1O89A 2JHPA 1JDVA 4QHYA 5A2GA 1G0OA 2O3RA 4Q12A 5KTOA 2DBZA 4JX8A 2XWJI 3M6IA 3QKWA 2C2BA 1V9LA 4NESA 4D8YA 2WHRA 3T3HA 4PG4A 1DIAA 3GC6A 5AR1A 4WH0A 3DFMA 3L43A 4TROA 1PNQA 3ZCVA 5EWMB 1O94D 1AV7A 4KIUA 4E13A 2ZIFA 4W9NA 3HKCB 2NVWA 3ZU5A 4CODB 4E03A 4RF4A 1MR3F 1HNXB 2FKNA 1SQ6A 2J3JA 4MK4A 4RLFA 5E4TA 2QYHA 5L53A 2IEAA 1PRYA 3KWLA 3OQMA 4PHCA 1KDRA 3N0WA 4H16A 2FSPA 1WE2A 1VE5A 4PFQA 3LYAA 3TZQA 3R3YA 1ZXBA 2VK4A 2HQSA 1X0XA 4HNSA 1DO2A 1WCIB 5AM0A 2NYRA 2JZOA 3DE3X 4PG7A 5ENZA 4Z1MA 4EKGA 4F0JA 1FBTA 1GTZA 3JZFA 3OKPA 5CRIA 3PFGA 1OH8A 3QU2A 1F20A 2CVFA 2WWYA 1NLYA 2JC3A 4GC9A 1HDRA 1OXMA 1TYDE 7ABPA 3U2QA 2IW1A 1BCRB 2Q3FA 3PJDA 3FBTA 1ZMOA 3PUWA 4YUZA 4FEEA 3VTZA 4MAMA 2WQZA 2Z6AA 3JWGA 3WZ2A 2DPXA 4X63A 2YXEA 4D3ZA 1G7RA 4XFDA 4ZO8A 5G0SA 1GKIA 4WLNA 5C4GB 1P6UA 1Z15A 1C9DB 5DKFA 3ZS9A 4L5BA 3HR7A 1H2EA 5EKXA 5AM2A 2Q0HA 4UXJA 1M0WA 4N5MA 3MMNA 2HZBA 2Q6KA 2GLTA 4HUQA 3TCKA 4LPSA 1RQXA 4F2HA 5L4SA 4EMTA 2H1SA 4HFJA 3ENQA 3H17A 3CKLA 1K8XB 1U4OA 4D26A 4ALIA 1VL0A 2D6FA 4KRGA 3ZX4A 1PJCA 3ZIUA 5C8ZA 1GPNA 4XLTA 5LP6B 1QPZA 1NIPA 2P91A 1MHPA 1WUHS 4QOHA 4WMLA 5KWVA 1LBEA 1PU2A 2DR2A 3ZHYA 4NXMB 1YVDA 5I47A 1E9DA 3S2EA 5JYBA 2VNHA 3NW9A 5J58A 5K1ZA 4YXWA 4ZALA 1E3EA 2I62A 2QM3A 2VO1A 1T3HA 5K6AA 3K0FB 2IDMA 3D8SA 2F3RA 2O2XA 3EQ7A 1TCBA 1T3GA 2FW6A 3CGGA 4RSHA 4B81A 4WXMA 2JB9A 5SZJA 1IN4A 3NDJA 4J4TA 5JO9A 4LV6A 4OATA 5C53B 4JJ4A 3MCWA 5ALJA 1HBJA 4YQEA 4CDNA 5G1PA 3G1WA 4BGEA 2P40A 3KEFA 3QVVA 2ZWIA 1SBQA 1GYQA 4GM0A 1LDGA 2J6IA 1QX3A 1U8XX 5B58C 1FUIA 1KARA 1V4BA 1PGOA 2EF0A 2NXEA 3DHWC 2ATEA 3CC8A 3DV9A 4GBMA 4JOQA 1N33B 2GN8A 3PFHA 4HWKA 1IBLB 3BEOA 1G3UA 2YNMD 4MO2A 5GGYA 1OBCA 3Q4GA 3JD4A 4LXXA 1OI7A 3CSDA 2RONA 5KQGA 2IEYA 4RWZA 4UDXX 4MWZA 5FWNA 1U8FO 3LUHA 4Z99A 5A3RA 3G7SA 3AQIA 3AUAA 1T2VA 2RBEA 2FPUA 1I4OA 4J76A 1GRCA 2Q28A 1U7XA 2OFWA 5KYYA 3U7HB 5BMOA 1ZM9A 4P5DA 2FSSA 2E21A 3RYFB 1A7UA 5JYEA 3V80A 3U6BA 2JARA 1XZPA 4GGOA 1NJ1A 3LQ2A 1KVTA 4F9TA 1OH5A 2V6BA 5BOVA 3RHTA 3TB4A 1VPTA 4J7UA 5T41A 3T5BA 3X1KA 3TF5A 1UDBA 2VJCA 3L8MA 5EQFA 1D7OA 1L4FA 1I33A 1IZ0A 3P96A 4PY2A 5JAIA 3DVRX 3OZSA 1U8ZA 2OYCA 3T4EA 3IO5A 4AQDA 3FPFA 1OD6A 4EO7A 2CXTA 3G8DA 1I14A 1RTKA 4MYUA 4F4JA 3N6RA 3JD1A 1XNHA 4CLOB 4FDLA 4Y67A 4HLUC 4RF2A 4ZEXA 2P2LA 2QRUA 1DS6A 1NI4A 3AR3A 2JGLA 3MIIA 1M2NA 2PH7A 3MJ4A 4LNAA 5F64A 3IV9A 1TW2A 1G17A 1T9HA 4G0XA 3VR4D 3WTBA 4OFBA 3LLVA 3IOMA 5C5CA 3O3CA 4EMBA 2ZJ7A 3L79A 3GWZA 4FZJA 4ZCLA 4ZEMA 4EHFA 4JELA 1JNYA 1G3MA 2FRVA 4LRWA 4XDYA 1V7ZA 4WY5A 3NWJA 3REQA 3VPHA 1VSVA 2IOHA 2I4MA 4D0GA 3IQZA 1U0GA 5K09A 3ORFA 3EWIA 4K0KB 3F90A 3NUGA 1Z2DA 2ODBA 1LCIA 1QLHA 3BWVA 4REMA 2PU7A 3RSCA 3W6NA 2A1IA 1GJRA 3FWKA 1D4AA 1I1QB 4NBWA 3A2KA 1FMFA 1L4HA 4FNMA 2DKNA 2QTVB 1UBFA 4MB6A 3G49A 5HP4A 3ZHZA 1AUVA 3NFRA 4ID9A 5E4JA 4EB6B 3R5FA 4Y0NA 5C1IA 3V6LA 4QBHA 1JR2A 1DC6A 1JHOA 2GKOA 2YV4A 4JVOA 3CT4A 4KL8S 5K4AA 3IHTA 5AKIA 5C4MA 1WSWA 1A96A 2VSFA 2GCEA 2I99A 3A9VA 1XVAA 1YH3A 2Q45A 1PJ2A 3KOOA 4B7AA 3LIIA 1YNSA 3E3LA 4O5OA 5L3QB 4A36A 3BE8A 1NE2A 2A0XA 2XUFA 3A6DA 3P52A 4IDOA 4HWOA 1GNPA 3EXHC 4QDTA 4R54A 3HXTA 3NUZA 4IDAA 3G59A 4E70A 1Z2AA 1S2NA 1JJAA 3MCTA 1NJ2A 2X9VA 3VU3A 1T1EA 3QUQA 3CQ9A 2MINA 1C8KA 1YMUA 5TJ9A 2BTQA 3S68A 3U3RA 2BF4A 5FA6A 2JLXA 1L5FA 1FS4A 1Z7GA 3OA2A 1YRYE 1A9QA 3SY8A 3KETA 2BGTA 1M2VB 4MYSA 1TU4A 3KSDO 2X8AA 3MWYW 5H8WA 1OZGA 4P54A 4NULA 3HXLA 1ORVA 1RXUA 2ZGVA 4V2IA 5JE8A 1B26A 2OCKA 4WBSA 4B47A 4L5CA 4NAUA 2D5LA 3MBKA 1T5OA 3CZMA 2GWRA 3GFTA 1H8EA 5C35A 5AKZA 4HJRA 1AHIA 3DLCA 2WSLA 4Z6KA 1R8JA 4QC2A 3QNMA 3GZJA 1CUVA 3VYTB 2RB4A 4PPQA 3NLLA 3CSUA 4EYSA 1VBKA 2MYUA 2EATA 4QO8A 4WGGA 1JQDA 3A2LA 3ONNA 5B7GA 5IT5A 2ZUEA 5I3ZA 3I2JA 1TFUA 3AR5A 3FFWA 2H2FA 2B99A 2CUKA 4FNAA 2GF0A 5I8ZA 5TPZD 1E6MA 2AYXA 3HBFA 3PYLA 3O6VA 1SHTX 1AHHA 1NVTA 4LNUA 1ZL2A 3PA8A 4QWMA 2FQYA 3NCHA 1F6DA 3K5IA 1QHNA 1ZRNA 4P35A 4ZVOA 4JXZA 3W5HA 5DBHX 3I8XA 1N5LA 1QGOA 3OIVA 1Z17A 5B64A 4MKZA 1T2DA 1R5JA 3WTCA 1WCXA 2NUAA 1T24A 5IULC 3RSGA 5JNSA 3I3OA 1GV1A 3TAHA 2PUHA 2FKAA 1NMSA 1O58A 1TVEA 4N18A 2BBWA 3UOGA 3E1SA 2BPOA 5THQA 3WGUA 3VNVA 4Y0VA 2QLMA 1I1HA 2VDLB 1F2UB 3LF2A 3IE1A 1EFRD 1E1RA 2QORA 3WAJA 4G1MB 2Q7DA 4IF4A 4URFA 3A06A 4YO7A 3ZU4A 2O7SA 2EIXA 1R12A 4ETIA 2ZJ6A 3WGQA 2I67A 3U4QB 4XSVA 5E9JA 4KFUA 1RW4A 2GJSA 5CDYA 3CF4G 1PWYE 1MT0A 1CZUA 2CXHA 1JFRA 3CURA 1JKJA 2LKDA 4X1YB 5KTRA 6CHYA 3C3KA 1A7AA 4NZNA 2QEQA 2IZ7A 2PIAA 3PVCA 6NULA 1M66A 4G0QA 3VR5A 5KOYA 3BS4A 2EGUA 3I4CA 1KEZA 2QBYA 3DOUA 3OJWA 1XEAA 5TS3A 5F4BA 3BCSA 2Q41A 3CYFA 1VCIA 1RXVA 1G5RA 1A9PA 2QN3A 4U6NA 3AVUA 4RFSB 3ZC3A 1R4NA 2LTAA 2VUTA 4E31A 4B3GA 3IODA 4J0IA 2AG6A 4AZ0B 3HKEB 1JEOA 1SU8A 4PRKA 2Q5EA 2VRNA 1Z0DA 2YBEA 1XL0A 3ZG6A 2DPMA 2I4RA 1E9SA 3F49S 4URUR 4TV8A 2EBHX 221PA 2BFFB 3AYZB 4QWWA 1E6UA 1NLUA 3GQBA 2W8BB 4G2NA 5DLPA 3DDCA 3KSZO 1MO4A 1MCZA 1A88A 1O5TA 1LDYA 3D4NA 1YAHA 1IBSA 4OKSA 3TWOA 4EB3A 2OGWA 3PCXA 2AOVA 2B1GA 3QMMA 1ESMA 4PC7A 3DHNA 2LV8A 4ZI3A 3QE4A 4RABA 3DEJA 5F7XA 2X7XA 1P72A 2ZSFA 5A0FA 3BXGA 4WTOA 1R15A 4YRJA 3TQRA 3O4GA 3HDJA 3L7MA 3OPNA 3PSHA 3RU2A 5KYTA 2JA2A 1NPTO 2ZJ5A 3ZW7A 1ID8A 1EUDA 1QVVA 2DQZA 2X8JB 3OQHA 5A9TA 3WKDA 2OXTA 3ROEA 4UE2A 2DETA 2O5VA 4HVAA 1FQKA 2G1KA 4LKRA 1N2CA 1ZNZA 4XJSA 4OQFA 1CQIA 3OUTA 3CRRA 1KZ9A 1J8DA 1QO7A 3I9NA 3ZE2B 3C6KA 1DV1A 3AJ8A 2VTBB 2VHYA 1PIWA 2FPLA 2O5RA 4PO3X 3RG2A 1ZGHA 4LF8B 1CR2A 1EG2A 3RVJA 5EXEA 1O0SA 1ADFA 3N2GA 1AQLA 2ZI4A 1NMEA 5AMXA 3BQNB 1O4WA 2A3NA 3E2MA 5H68A 3GRAA 4AS2A 3RVBA 4C6TB 4FZ5A 1EFLA 3EIFA 3KOYA 3U4HA 2TMGA 3JATA 2IUEA 2CZQA 1SQ0A 2ZYSA 1JHXA 3PVZA 1VJ5A 2JFPA 2PRZA 2F8MA 2JFZA 2Q3MA 4BEWA 1XZGA 3GGOA 3B6ZA 3SE7A 2UVPB 3GMSA 4UZFA 2O2SA 2FFHA 4HXGA 6PFKA 4NCAA 3WDLA 3UY4A 5BWMA 2YWFA 1DKOA 4MUIA 4EHBA 4X62B 1UOQA 1W44A 4ZEOA 4B9EA 1JXOA 1LC3A 1U7WA 3SGLA 1PZHA 5BUCA 1Z74A 4IDCA 2VWQA 3KXDA 4CNQA 1JMVA 2Z04A 1IJBA 2ZUUA 1FTYA 2WD7B 2DJ5A 2K4MA 5JNUA 2W6MA 4N7BA 1NR1A 5CLJA 4FM9A 3QKTA 4JC5A 1RKBA 4Z9BA 2D1TA 2RB5A 3DMHA 4LXUA 3BRQA 5DLYA 2R96A 3HCAA 1RSZA 2VT6A 1FJXA 2WSIA 1J0XO 1I3CA 4OHVA 2PV0A 2X9QA 2ZRFA 3IKMB 4NF2A 4J9VA 2FWRA 1I4DD 1QH1A 4IW3B 2WFLA 3HZRA 4JEIA 4KO3S 3JW8A 3COVA 5EEGA 5ES3A 2M1ZA 4QNMA 3IUYA 3N7UA 4BB5A 1YJAA 1K6XA 1UANA 3EVBA 1RAHA 3RIXA 4J1SA 3SICE 3AI7A 5G0VA 2FR8A 1UMBB 1BE1A 1N6IA 1DRVA 2X3YA 1Y4SA 4JL5A 4L3WA 2JL1A 1JMYA 3HMKA 2C9BA 4HJXA 3GJ6A 4IMPA 5JV5A 5DDIP 2XQGA 1U7DA 2O8FB 2IPAB 1I6LA 3ZBUA 3K4PA 3W4IA 4HNAA 4KDCA 2O0LA 1Z7WA 4DT1B 3E48A 1MX9A 1A95A 3DVQX 3MB5A 2NVOA 3V32A 3KU1A 3SEZA 3ZQ6A 1P17A 2VNJA 2O8EB 3KK0A 1DWOA 4UEQA 4KP7A 4H08A 1YQGA 3MTGA 4FOLA 4UHFA 2OBNA 3DZHA 4MWCA 2QTMA 2CDNA 1I24A 1U28C 4ZYXA 3B48A 2I2AA 3G2MA 3MWEA 3PIDA 3E4CA 5EVJA 4K2HA 3I61A 5HWSA 1XA0A 1YL7A 4WN9A 4CT0A 3H5RA 5DXAA 1TA4A 1BH6A 3NBFA 4DA8A 3KQTA 1EWTA 2AN1A 1Z38A 3M33A 4RTLA 1PDWA 1NVDA 4RMIA 3STHA 1MAVA 1N2JA 4M46A 5SZIA 1T1GA 2NU7B 3BGOS 4QXOA 2CZCA 3LRTA 4QQFA 1BO6A 3QPBA 5I9MA 1JHPA 3LGSA 1QO0D 1DOHA 2RH9B 4TMWA 5HG0A 4KXLA 2G09A 2EWMA 3HXPA 4G8BA 3W34A 1DB3A 1TD1A 2TS1A 3SX2A 4M1SA 2DF8A 2HHCA 2R87A 3AR9A 3R3VA 2Q2QA 4RVCA 3ROMA 1U0SY 3AWDA 2F17A 1TMYA 2DVMA 1BNCA 1F2TB 1W35A 3F4KA 3ICWA 3MJHA 2D74A 1CDOA 1FNSA 5F73A 1QVRA 3DDNA 1M6VA 3Q7IA 4AY2A 5FR2A 2R4TA 1R27A 3UMRA 4F5ZA 3QUSA 4FHCA 2VHCA 3GMDA 1YZNA 1WOYA 1EVLA 1GG2A 3GDGA 3GNSA 4GR9A 3JVVA 5IJ0B 4GKAA 3W7BA 2KMLA 2DM6A 4YUWA 1J7KA 3K6KA 4HEHA 1VBNA 4AJNA 1CE8B 1KS2A 2IJGX 3RT7A 5BMVA 4G4GA 4NU5A 3H9QA 1EWKA 1IVYA 3UWOA 4QARA 4QYMA 1W85B 5EXXA 4C2AA 1PV1A 1FSSA 4H9GA 1U3FA 1H69A 3BJMA 1CEQA 1SJ9A 1SBHA 2GHQA 3BTOA 3TI9A 5CBKA 1KWKA 3BSSA 3DUFB 5E8JA 3TG2A 3R0QA 3CX3A 3ZOKA 4YMSA 3MWKA 2XNKA 2HDOA 3DOHA 3TINA 4RMNA 4BYGA 3A0UA 4IYRA 4I8XA 2MSNA 1XTBA 2B4YA 1QZUA 1A5BB 2PYIA 3HVKA 3OM1A 4OBXA 3WLQA 3F6EX 2WYWA 4CV1A 2OUIA 2XXJA 1WLSA 3P20A 3FZYA 5B36A 2BY4A 5DBEX 5L9AA 5F5NA 1J1IA 3GFPA 1YHYA 1ZU5A 5F1YA 5EIWA 4M98A 4OI2A 5A06A 4F4IA 3OTWA 4CDGA 2X42A 1OUMA 4QDJA 2X9LA 4PR0A 1TUEA 3NXKA 4JEUA 4WJLA 1R50A 5CM9C 4YLYA 1T4CB 1WULS 3EXG1 2XMPA 5ADWA 5LDDC 1CG6A 2H07A 2HU8A 2XT9A 4MQLA 1SVUA 2AL7A 3ETHA 1MVLA 4FBLA 3COSA 2CMFA 1W52X 2R1TA 5AVRA 1NT2A 1EXWA 3CIFA 3CN9A 4J16A 4JL6A 4MVJE 4Z7QB 5BW8A 1ZL0A 4M21A 3WAGA 1USIA 3VPFA 4DFDA 3O8RA 2OV1A 4A03A 1RYDA 2OORA 3WRVA 5TLSA 1C0PA 2BGUA 3ZQ4A 3ADDA 4RK5A 1T0JB 1KU6A 4IJWA 3CUWA 3JZMA 2VQ3A 2LRHA 2IYXA 1ZD9A 1K92A 1G5TA 4DLYA 5J5AA 2F64A 4J6EA 4XWKA 3BULA 1J23A 4RTPA 2HLPA 3LQFA 2FPSA 3WRXA 4EQ6A 3U56A 3UBTA 1K0FA 3TIIA 1O87A 5BT8A 4YUVA 3RQIA 3OEYA 4HAOA 4HDNA 2QP4A 1DCFA 1P2VA 4KV9A 1K06A 4L2IA 3O8DA 3TR5A 4Y6LA 1T0UA 1ZA2A 2VP6A 4NYMR 3ZE7A 5SY9A 5JMPA 4EDFA 2C9OA 1DXHA 3TS1A 4C9BA 1ISGA 2JCVA 1HDIA 2YHBA 3FF1A 4V0LA 1OLXA 5EP2A 2CYBA 2H63A 4EJ6A 4P1ZA 3PPYA 2WUDA 1LSJA 1PT8A 1BXKA 4IICA 3I34X 4TV9F 2OCBA 3BGDA 4I55A 1E2IA 2R1ZA 4I6GA 4U2GA 5KYXB 4RACA 1X9IA 5BVHA 3LTEA 1LDEA 5FO1A 2DECA 1HQCA 3O03A 4FKMA 5ARBA 5EIBC 1JI3A 1G8FA 4LJ5A 2GVZC 4GMFA 3SBDA 4CMAA 4ZAGA 4QFCA 3BMQB 5TVKA 2REQA 3SSMA 4PCVA 4LS3A 1LK0A 4QYIA 4D57A 5TQ2B 4DRYA 1J33A 1RRGA 2OHGA 1PG2A 2R8XA 3EGVA 1YR2A 2HU7A 4F7DA 4RTOA 2AKAB 5HXAA 5CLIA 1N4AA 1J0BA 1D09A 1EFTA 1N6HA 2PU5A 3FHJA 5AVOA 2ODAA 2ZT8A 1D3AA 1N5DA 1QCDA 4KYVA 1E3MA 4AWAA 4FOPA 4KGZA 4ZZIA 1V1RB 2CK3D 1W75A 2V5VA 2XGOA 1N7HA 2NU8B 3R9XB 1BYIA 3C2QA 2QL6A 1L5MA 3RFUA 1ZEJA 3AF2A 5I7AA 4Q48A 2RG1A 1VI5A 1X7HA 3R7DA 4MOWA 1CXZA 1NUHA 4PLYA 4YJDA 1DTWA 1TZ2A 3MJTA 2O3TA 4M53A 1JEYA 2GM4A 1G8YA 1SBIA 4JWTA 2A14A 1EH5A 5E1BA 2AXQA 1B74A 2ZSEA 1MV5A 1GR0A 1U98A 4UAGA 3WMWA 4BTLA 5A9SA 3G5LA 3GBVA 4I4TA 3D3WB 3MCUA 1NUAA 1YQWA 2BMEA 3ANNA 1QUFA 3DTVB 3URKA 1V35A 2GD0A 3FHTA 3H5AA 5EHQA 4B4KA 2QRGA 3A1TA 4G89A 1WPGA 2XA9A 3C7CB 5CJJA 5DHUA 3PNBA 4X1IA 2Q4OA 3TW0A 1X15A 2PLFA 3ED1A 3NDIA 3PQ4A 5FTWA 1R9GA 2FMIA 2FK8A 1IM8A 1PFQA 2FZVA 2ZB3A 3FHCB 1R10A 3GLTA 3L6CA 4UMEA 3IUBA 5CNJA 3RS9A 5L51A 3BFJA 3ABQB 3GT3A 3Q2OA 2CFSA 4OHPA 3AIKA 1KI1A 2NTVA 1GZ6A 3SC4A 3GP5A 4LRTB 2C5EA 3FFBA 5FAKA 1XZFA 1GZUA 2E37A 3UCXA 2Q0QA 3TZLA 3GAFA 2XQKA 2QD5A 4D6YA 2AN9A 1PWEA 3B1FA 3TBFA 4UUMA 3BXPA 1A98A 3U4IA 1M1XB 5LQSA 5TX7A 3UWPA 3ZIDA 3SZOA 1DNPA 2YBDA 3KKPA 4MWDA 3BD7A 2BKEA 4D74A 1P1HA 3AVPA 3KTDA 2IUFA 1Y98A 3BH7A 3O5AA 1TAHA 4GYJA 2C7VA 4R8KA 3TKLA 2Q5IA 1JALA 2GRUA 3F6CA 1UIRA 1BOFA 1CSEE 5DGIA 3CTMA 2HFJA 4I3GA 5H82A 5I9TA 1B8UA 1ZH8A 3E0XA 3FUTA 5D00A 2G67A 4EYEA 2ONKA 3HRKA 4G23A 3H05A 1XAGA 2QR3A 2BBTA 1C1XA 3L8EA 3MT0A 2JFUA 3PIIA 1LEHA 2I6TA 4UUQA 5AJXA 2GEDA 2G80A 3EJWA 4MQ6A 4RXUA 2CDAA 4GRAA 2Q0XA 4DKXA 1ZFNA 5DIZA 5FV4A 2BM9A 4EPTA 2O48X 4RMJA 3RYIB 4B17A 3DGEC 1O6GA 3SF0A 1PEKE 3EFHA 4B79A 4B5KA 3TL6A 1KORA 2A0UA 1FRFS 3R6DA 1N3YA 3C8UA 1TEZA 3DL7A 1GO2A 2G5TA 2IYSA 1YOVA 2O05A 2QJTA 1GTL1 1HFWA 3QEKA 1C0KA 4MUHA 4IIUA 1W88B 3U0VA 3BRCA 3NDBB 1JZSA 3WA6A 4FIDA 4Q3LA 4F91B 2JW5A 3QJ5A 1AXRA 3UB2A 1QKIA 2IVFA 4RTKA 3FH0A 3G2LA 1AA6A 4MUJA 3FYSA 4RE6A 3RSLA 1TZKA 3T7EA 4Y2PA 1USGA 1TQHA 3I5AA 4IOJA 2ZBGA 1OLUB 1SG0A 3WB2A 5FLYA 4G9GA 3VKFA 3MCVA 2RGNC 3D6JA 5TXGA 4EGSA 1PVVA 1VMKA 4QPJC 4WZAA 3SHFA 5CD1A 2GEFA 4TTAA 1TM3E 4PCLA 4EYGA 5JBNA 2PTGA 3WFZA 3WHIA 3P9QA 2NN3C 5JCJA 4EUKA 1CQZA 3TG8A 1FRNA 1LBSA 3FLEA 4FXOA 3P8ZA 1Y8ZA 4JLUA 5E6RA 3GCZA 2Q4BA 1Y4ZA 4L8VA 4CT5A 4DM7A 4AP5A 4IIGA 2PUFA 1BGVA 4JJ7A 5TIIA 5KJ1A 2N9UA 3HHPA 4QNNA 1BCSA 2HBZA 1S3IA 3A27A 3NBYC 4AKEA 3ZQKA 2RI1A 1G18A 1ZM2A 4KGVA 3H99A 2O7RA 1DBSA 5LZ2A 4I9HA 3DAGA 1QH8B 2HXGA 4C1NA 5LA6A 1XZJA 4PNPA 4MQ4A 5ARCA 2XIJA 3ZTTA 3HLYA 4NOKA 4QXMA 1H1LB 4JB8A 1K86A 1X8KA 4C4YA 2C3PA 4DBVO 3K0EA 5ALZA 2ETXA 4MJ3A 3WYNA 1Q2XA 1TEVA 2F1RA 5AHKA 2HC9A 1XSEA 4FXPA 1RT9A 4R5HA 1PJQA 1Z7YA 2QLNA 4UM9D 4CN8A 2MOKA 2ZCVA 1UXGA 1SCUB 3N2KB 5D1HA 1E3TA 4GMHA 5KWJA 1AS0A 1U9IA 3I58A 2VCYA 2OBXA 3T7JA 4ER7A 1XELA 3OUUA 2XDAA 3IEPA 1JVNA 3D0KA 4DN6A 4E5YA 1ISPA 2QN7A 2ZRDA 3KTAA 4QO7A 4HX9A 1JF8A 1W4AA 1HZZC 1R0KA 1EK0A 2DWUA 3DTNA 3QEMB 1Y1SA 1U5BA 4K6FA 3RG8A