5HCNA

Gpn-loop gtpase npa3 in complex with gmppcp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
253
Chain Sequence
SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GPN-loop GTPase 1
publication title Structure of GPN-Loop GTPase Npa3 and Implications for RNA Polymerase II Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 95
structure length 253
sequence length 259
ec nomenclature ec 3.6.5.-:
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hcnA00
3K9GA 3D6TB 2QAGA 2GDJA 4DB2A 1E99A 4Q4JA 4IOKA 4HUQB 4B3FX 2FV8A 2QSYA 3QPVA 4Q21A 3ADBA 3FTQA 3AUXA 4Q48A 1E94E 4XWKA 5FFMA 1G5PA 3ONWA 1IONA 1KKMA 1YZKA 4AY2A 3QF7A 3FHCB 2IWRA 4L16A 2E87A 1TUIA 2ZJ2A 1S1CA 3KFXA 1XJ0A 2W58A 3QXCA 3AVVA 4C7OA 5TARA 4YONB 1Z63A 2ZYTX 3E1SA 2REXB 1U81A 4WOPA 4CGZA 5HZHA 1ONBA 4MRSA 5KUTA 1ELOA 4TMWA 3QBTA 3UMRA 1XMSA 4K81B 4KO8A 5DGXA 3SBEA 4HSEA 1OHHA 1IJFA 3BE4A 4ZI2A 2GEDA 4TZ6A 1FZQA 4UKDA 2CHGA 3VKWA 1G17A 4LJYA 3DVLA 3PCRB 3IBGA 2JLQA 4EJSA 3LXRA 4OBEA 5F2EA 3Q9LA 4JLKA 4PZZA 4MRRA 3LW7A 3TH5A 5CYPA 4LC1A 4LJ6A 1KI1A 4DT1A 5AR1A 1KAOA 1XTQA 1G3MA 2FA9A 2J46A 3BC1A 4JLBA 3U7GA 4A0FA 1Z8FA 3GJ3A 5AWFC 1M7BA 2WWWA 3DKVA 4JBYA 3LQRA 1ZAKA 1OLOA 4EPVA 1D9XA 2G88A 2WWGA 4JKIA 3PEWA 1IJEA 2C9OA 2DWOA 1DELA 1G6HA 2MSCB 2XJ4A 4C0QC 1E9CA 3EA5A 2EYUA 2FFQA 4GOJA 1Q21A 4MH0R 5DH9A 5FR1A 2GCNA 1VIYA 1KDRA 2HV8A 1P62B 5FOUA 2EW1A 1PLKA 3ZS9A 2Q3MA 3SJBA 2OLJA 1KSFX 1JB1A 1T0HB 2A5FA 1DE0A 4LGMA 4TMTA 3OIVA 4W5JA 2Z4SA 1EGAA 5FUWA 2IUUA 1X3SA 4QHYA 3FB4A 3V4FA 4TLCA 2QTFA 4MYUA 1AZSC 2G77B 2REBA 4LRWA 1P60A 5DYIA 2YWEA 1M34E 1G4AE 3I73A 4TMXA 5AJXA 3MWLA 4JYBA 4NONA 2WJHA 1MO6A 3B85A 4Q7LA 1RVDA 4P4TA 2QBYA 2XGJA 1KI9A 4B3GA 1S2MA 3L0IB 3CH4B 4I1UA 3UK6A 1OFUX 4AWXA 5DI3A 4B35A 1QG4A 3LBIA 2ZRDA 1CP2A 3CRVA 3MFYA 1G5TA 2QORA 3L0SA 2FMXA 1BYUA 2DCUA 5EP2A 1RJ9B 4OJKA 2GBLC 1W47A 1ZIPA 3B9PA 1E9RA 4KU4A 4LYAA 2GCOB 2OCYC 2OSBA 2C2HA 2VIIA 4FW9A 4BECA 4I4LA 1VCIA 1KMHB 1JEDA 4QGHA 4C0AC 3EAQA 3IIJA 3UATA 4OQLA 4TLEA 5AJWA 4DCTA 3QY0A 2KI5A 2XZLA 4IFBA 4UXHA 1O3YA 1R0YA 2JCSA 3AF2A 4I99A 1M2OB 2OM2A 4LI0A 1CJTC 4D4KA 4TQUS 2C5LA 4M4SA 1D5CA 4C2UA 5FH9A 3AVOA 3MCAA 1P72A 3HJNA 2GNOA 1KI7A 1AGRA 4C0SA 1F5NA 2RGGA 2OUKA 5G3ZA 3M4YA 4DLUA 1NL3A 2GCPA 2ZETA 4GDFA 3F0TA 2TMKA 2BBWA 4DDVA 3NBXX 1KOFA 4TMZA 2ZSAA 1XPRA 3NIBA 3AP1A 2JIZD 5JEEA 3CLVA 2Z43A 2BCGY 4G5GA 5EXPA 4MQBA 3QEJA 2ORVA 4U02A 1P2UA 1HQCA 1EX6A 2BM0A 2ODWA 1E9BA 2V3CC 3CX7A 2FF7A 2QUZA 1COWA 2JJ8A 2IYVA 5J5CA 2A7QA 3TLXA 4Q1EA 3I61A 2GJ8A 1PVOA 1RRCA 1X8KA 4PZYA 4EUNA 2FWRA 5JS7A 1XD2A 5E95A 4BLPA 4FWTA 2XSZD 3CF0A 3RLFA 4L4UA 3KQLA 2IBMA 1LF5A 2QN6A 4ZCMA 2AFIE 1EFTA 4KAXA 4HDOB 4UJ3A 1P3JA 4HDCA 1OV4A 3NTUA 1KO8A 1RKBA 1AKEA 3AKDA 2EYQA 5DN6D 1CR0A 1VHLA 3P1JA 4KI0A 1NNEA 3OFND 1UDXA 1OH7A 3THXB 1E9SA 4RCYA 1DO2A 2CJWB 4BLOA 3AF1A 4IEEA 1C9KA 4A82A 4AC9A 1QHHA 1ANKA 3C14C 3F3YA 3U44A 1NG1A 3LA6A 2CL7X 2GZHA 1E69A 4B71A 2R9VA 4HLUA 1VG0B 1Q0UA 1S8FA 1KZGB 1Z0IA 5CK4A 4LV6A 5DHAA 2GHIA 3LAWA 4LK2A 3KJGA 1A2BA 3QVVA 2DB3A 3KKPA 1KNXA 1M74A 3O47A 1UEJA 4L9WA 2NIPA 4XSHA 3LLMA 1KK3A 4QL3A 4DLSA 4Q02A 2ZI6A 3GLGA 1SXJB 2D74A 1QDEA 3IKJA 4RD6A 1WP9A 4JJKA 1XEXB 2J5XA 3TE6A 2GXQA 3ADKA 1SVKA 1KI3A 5H70A 4XIGS 3AV0B 2XB4A 3HWSA 2GILA 4Q4LA 3SJCA 4M53A 1U98A 4B75A 2B8TA 4DCSA 5EUQB 5BYKA 3B1XA 3AVQA 3QE0A 4LYFA 3MUFA 1W4AA 3NEYA 1E2KA 3VAAA 3OEHA 2BMJA 2H16A 3AUYA 3EIEA 3VX4A 1NI3A 4OI1A 2QPOA 2C04A 3RHFA 3NDBB 1W0JD 2JA1A 3QKRB 3WBKA 4ZKDA 2HJVA 2YJTD 4R2IA 5DHFA 3VR3A 5BXQC 3FOZA 1ZUNB 3K9HA 1F2UA 4R7ZA 2OXCA 4XVQA 3SDZA 4YMWA 4FN5A 4LHVA 2IYWA 4KYIB 2VSOA 4CZ2A 2FDCA 3ZLJA 3KUDA 1YZQA 3V4RA 1YR7A 4IDOA 2ZAMA 2F6RA 1I4DD 4KODA 3RWOA 4V03A 3MJHA 4AG5A 1MH1A 2DWQA 3VQTA 1II8B 4ZPXA 4BLQA 4RZ3A 4Q1DA 1H8EA 4H1VA 5FL3A 1I2DA 4FCWA 4UXIA 3RDPA 2FSIA 3CUEF 2VP4A 3KTAA 2HCJB 4MGIR 3U61B 1EFHA 2BEJA 5DN6A 2F1JA 3THYB 2QSZA 4G5QA 3U3JA 5B57C 3HR7A 1N6OA 4IDHA 4C4PA 1QF9A 4C0HA 4IEIA 1IAQA 1GRRA 4Q9JA 4URYR 1ZINA 2FEOA 4YMTA 4RKFA 1GP2A 2O8BB 1AGPA 4NYIR 3ZD7A 3VU9A 3P4YA 3U7HB 1ZM4A 1CULC 3BIFA 1GNPA 2C03A 3B8HA 1OB2A 1ZD1A 1F2TB 5F98A 1TPZA 2JLZA 2A5GA 1NSFA 3GMTA 1N2CE 2ATXA 2CCJA 2LWIA 2G83A 3KJIA 4NHOA 1EESA 2GJ9A 4MGKR 3F5FA 4A15A 4OQNA 5C2JB 5FBVB 3L82B 1JAIA 2G1JA 4OI2A 1JJVA 1NIJA 4Q01A 5K8IA 2ZSDA 1RPZA 4HLCA 2H8KA 1R0WA 4P3YA 3TK1A 4HAWA 4KSCA 1GNRA 4CRWB 1T91A 2PT7A 4AYWA 3BRWD 2BDTA 4PR0A 1J7KA 2QU8A 2PLRA 3PITA 5JHGB 4N0DA 1E9FA 4Q1AA 4TMKA 4EDHA 3TGPA 1FMLA 2ERYA 3IQWA 1NVVR 4JVMA 1E6CA 2WWIA 3G5UA 4C30A 3TVTA 4OHZA 1K6MA 1ZC4A 3X2SA 1XEWY 2WWFA 1R10A 1E79D 1VECA 2BMFA 5G40A 1SXJE 2V8OA 4IDNA 1W0JA 1JI0A 1YQTA 4UNQA 1R8SA 4A2WA 2GJSA 2QPAA 1E2HA 4AYTA 4US2R 3D7MA 3AVTA 3QG1A 3SE0A 1E1QD 4Q9LA 2J3EA 2RHMA 1F60A 1B23P 5E7JA 3LX5A 4A6PA 4V0NA 1SVLA 5EXTA 2QMHA 4P4SB 3RRYA 4EPXA 3WNCA 1FTNA 3T1VA 1CS4C 3TW4A 2GVZC 1SKYE 2OFWA 3L8ZA 2WMNB 3CNNA 1W4BA 2O0JA 3ND9A 3T15A 1KKLA 2B21A 3W6OA 2DFNA 3GPLA 2FU5C 1ZM2A 1ZNYA 2P5SA 1NN5A 2H57A 3VMFA 5FBLB 2NZ8A 1KI4A 1G8PA 1W49A 4IDQA 4AI6A 3EC1A 1JJ7A 1E4VA 1XMIA 2VF8A 2ASEA 1KI6B 2QMEA 3PEYA 3UMSA 4RFSA 3UKDA 4DLZA 1AA9A 3R7WB 2J41A 2O0KA 3QG5A 1IN8A 1MO3A 2WWHA 4AKHA 3DEFA 4KXFB 5LDDC 2AD5A 621PA 4EJSC 1ZM9A 4YMVA 2KBFA 5EZ6B 3CRW1 1T5IA 2Q9CA 1VG1A 5A5GA 2IYRA 3I5YA 4KBGA 4Q4HA 3JVVA 3D8BA 2HT1A 5HPYB 2RKOA 1OJLA 1ZUIA 1N6LA 2WVJA 3FYHA 3H84A 4Z8YA 4QC2A 5EP3A 1OSNA 2I3BA 1E2QA 3AF4A 1FX0B 1LNZA 4ZDJA 1XU4A 4AURA 2G3YA 2GZDA 2EU8A 4P32A 2AN9A 3PENA 1VPLA 4PC2A 5AJYA 2GK7A 2IL1A 3PV0A 3VNUA 2OFOA 4URZR 1W36C 4E07A 1WBBA 1GL9B 1L7VC 1OT3A 1ZU4A 2AHOA 5FOXA 4HUQA 1VCMA 2CCGA 721PA 3W5JA 4BZXA 1G1MA 3HR8A 3L43A 1TL7C 4HAYA 1UEIA 4C0JA 1Q1QA 4GSYA 3O8CA 5KTYA 4K8OA 2DWPA 4B47A 3A8TA 3KJHA 3C16C 5K8LA 1Z6YA 5J4LA 1BH2A 1E79A 1DG3A 4JT4A 4BFTA 3OEEA 2A30A 2IC5A 5JI2E 1XTRA 2ANCA 3ZZUA 5C18A 1XRJA 2OLKA 3AP3A 3RS4A 3QVUA 3I32A 1H65A 4TYYA 5CITA 1VDZA 1UJ2A 4X8OA 2HYDA 3IPYA 3NVAA 4JBXA 1E1QA 5A4JA 3SHWA 3FVQA 2R6GA 1OXUA 1X1SA 3WP0A 1OIWA 3RS5A 2CCKA 1T5LA 3ZZ0A 2BC9A 2JGNA 1L4YA 4JVLA 4UJ5A 3TAHA 5C4MA 1E0JA 4BFXA 1GRQA 2YWHA 5D3MB 3EPLA 1VMAA 2XTNA 4HB0A 2JLVA 1UM8A 1P9NA 3HU1A 4CEIB 2ZM5A 1OH6A 5SZKB 4MKHA 1VYUA 4EPRA 3BK7A 3IIKA 4X8MA 4EAQA 4IOJA 3RC8A 1XCPA 3GJ5A 4Q5IA 1G8HA 4PPFA 5B2ZA 5JRZA 4EQ6B 1NKTA 3LVRE 3P26A 5KSOA 1P6XA 2WPDA 1XEWX 5KU1A 5DNYB 1VTKA 2W6ID 3CPJB 1G3QA 2OHFA 4GMXA 1UBFA 4PTLA 3QPWA 4UNRA 4DEYA 3QJYA 2H17A 1HV8A 3K0FA 1KJYA 1AZTA 3TUZC 2O8FB 2CK3A 4PHHA 2NMVA 5DE3A 521PA 4NTZA 1NBME 4PXAA 2HLDD 1XB2A 2IEYA 3B1WA 5GJVC 3BWDD 4JLJA 2IT1A 4WAUA 1E2DA 1TF7A 1BIFA 2O8DB 2AXNA 1SULA 4YXWD 3PR1A 4YLGA 3CRQA 1YZUA 1HEIA 3CW2A 1NVXQ 2YOGA 2ZUBA 2N42A 1VKJA 1RC8A 2BVNA 3EWSA 1KSGA 3LRPA 2HF9A 3RAPR 1X1RA 3MD0A 1RRFA 2C9CA 1TF2A 3A1WA 3GLHB 2PL3A 4AKIA 1N0VC 2VQSA 3CB4A 3IUYA 2G0NA 4RZXA 1RZ3A 1KZ7B 5FUXA 3SU8A 4A4DA 4EPWA 4UXJA 4GBMA 2AKAB 3NBFA 2GCOA 4HLDA 2ZSBA 2ZYWX 2HDNB 2IUSA 2IK8A 3FHTA 4A8JB 1VG8A 2GVDC 3BAFA 1SXJD 3CZPA 1T0JB 4URWR 4TTPA 5KSZA 2VHTA 2CHVA 3TSWA 2G1KA 5E7MA 2D62A 4G5RA 3EPJA 2EVWX 4AYXA 4HLUC 1NIPA 4G1UC 4TL6A 3LDAA 1IM2A 5LPNA 1TUEA 4C0LA 5ANRB 4BGDA 1A7JA 3NXSA 2JASA 4IVQA 3BGWA 1D2MA 2VH5R 2R6DA 2ZQ5A 4AKGA 2P65A 1WF3A 4S2EA 1LVGA 3A4MA 3GFTA 4IHQA 4M9XA 3SHFA 3KQKA 3ICQB 1W2HA 2AL7A 4V02A 3QF4B 3VR5A 2ZYVX 4XWAA 3B2EA 5FOSA 4Q4AB 2FFAA 2ZROA 4IXMA 3IPXA 4LJAA 3R9WA 2PMKA 3AVYA 3BBPA 2JLWA 3TIFA 1KJZA 1WQ1R 1I4LD 1OYYA 5EE3A 2W6IA 4TN1A 4GNKA 4X8HA 3T35A 3PEUA 1ZC3A 3PUVA 4MKIA 1KDTA 1N5KA 2OCBA 4A92A 3GD7A 3RABA 4IOMA 4KYUA 4Z1MA 4BE7B 1QHXA 2ZRKA 2HF8A 2D2FA 3DZDA 4LUCA 3HPRA 1DEKA 4URUR 4RD1A 2HLDA 5FPTA 4KFRA 2WOOA 1W36D 2W00A 4Q03A 5TXGA 3SYNA 2Y8EA 1ZCAA 4GP7A 5KPDA 4UNNA 1BKDR 2SHKA 2ZJZA 4XOIA 4E22A 2P3SA 3Q85A 1MO5A 1OB5A 3IO3A 3CRMA 5HKKD 5P21A 1G18A 1PLLA 2Q3HA 3THXA 1XTJA 3HU3A 5FPKA 3EZ7A 2ZI3A 2CJWA 5G53C 2F43B 4BFYA 4LZZA 4LHYA 2OZEA 4TT3D 1NY5A 1SVSA 2OT3B 4M0LA 4ZV4A 1G4UR 3LY5A 4DIEA 2B8WA 4XSGA 3U7FB 1Z0DA 4Q19A 3NC0C 3ZDQA 2H5EA 4V0KA 1IOZA 2QGNA 5TB5A 4URXR 2YC4C 1W0KD 4PHFA 4HZUA 4N0EA 3KFVA 3AVUA 3LW8A 4N3NA 4DWJA 2XTZA 4H9GA 3B78A 1A82A 2JAQA 1J2JA 4ON9A 5E7IA 4BFUA 2XXAA 1SVWA 821PA 1EK0A 4CEHB 2RMKA 4O0MA 2XAUA 1SXJA 5J4KA 3AKYA 1JNYA 3PUZA 1N6HA 1YZGA 1R2QA 3QKSB 1FUUA 1XMJA 2I4IA 5HCIA 1KK0A 1KMQA 2OCPA 4Z51A 3BB4A 3SJZA 1S0UA 3W9YA 4ARZA 4CF7A 2UKDA 1OKKD 2AFHE 3QSYA 4A6XA 3GLFB 1MKYA 1QVAA 2IS2A 2PX3A 3RRMA 2AX4A 4OHXA 1K5DA 1KSHA 1I4TD 2OG2A 4QNMA 5L3QB 1G9XA 2WICA 2IEZA 8OHMA 2WIBA 2WMOB 2PT5A 4XVUA 5CK5A 3T12A 2WZQA 2VSXA 1EFRD 4RCZA 1G64A 3CR7A 3SBDA 3J81k 2YOFA 2WKPA 2IYUA 4A0RA 4RD2A 1GTVA 2VP0A 4ZO4A 1TAGA 4LCBA 1MRSA 4PC3A 3T34A 2R6CA 1EX7A 2WSSD 3EIHA 2WJYA 4TMVA 4KJZA 4DKXA 2GXUA 4NYMR 4TYNA 2JJ1D 1KO4A 2OBNA 1JEEA 5JJLA 3NBZC 4ACBA 5GVSA 2ZREA 1LV7A 3KKQA 2YZ2A 3H0KA 1COWD 4HB4A 1VCNA 1CXZA 1J8MF 3HPQA 2P2LA 2BMEA 1NBMD 3TUIC 2W2TA 4GZMA 1WXQA 1XZPA 5FTJA 5HKKA 2FPMA 1E9EA 3X1YA 1S96A 3NWJA 4TSFD 1CJMA 2EQBA 1AS0A 3W3ZB 4B3XA 1U90A 3UWOA 2A3RA 1DARA 5J47A 4PSAA 1U94A 4PO9A 2X77A 4MGYR 4TT3A 3ASYA 2ZTSA 1BMFA 1IXSB 4JL8A 4NE2A 4ZIRB 1JR6A 2F7SA 4G5OA 1TTTA 1HUQA 2OESA 5BYJA 1N6KA 3SOPA 2P6RA 4B3BA 4EFMA 1U9IA 2HXYA 1W0KA 1GAJA 3VNVA 4DSNA 1KI8A 1II9A 4KVGA 4TTRA 1Q22A 2FN4A 2NPIA 2PCJA 2ZRCA 4JS0A 4B2IA 2BHRA 3K70C 4NZYA 1OXSC 1FOEB 4TLAA 4D0NA 3CO5A 3C5CA 3W6NA 4B76A 2ZI4A 1W46A 4I1OA 1DPFA 2VLIA 2WWYA 2FFHA 1AQUA 1G20E 5DO9A 1YZNA 1MABB 1WBDA 1Z2AA 2QRNA 1KAGA 4JVNA 1NN1A 1NP6A 3Q7PA 3R8CA 5KHOC 2NO9A 3TVDA 1VIAA 4W9MC 2FZLA 1OKKA 1CF4A 1K8RA 2H92A 3CKLA 3CM0A 2Q9BA 3SQXA 3I5XA 1P9WA 4LV8B 2ZRMA 2P6UA 2VTKA 4FIDA 3LVQE 3R9XA 3JVUA 4YMSA 3AQ4A 2R6FA 2F1HA 3K8YA 1G8YA 4XWOA 3OEHD 2C95A 5LD2B 3UG6A 3E5HA 1DAKA 4WW0A 4C0KA 1HE1C 4R71A 1EFRA 4XVRA 3FHOA 4TYQA 3TQCA 3GP8A 3DHWC 1WA5A 2NPFA 5KDLA 3U4QB 2ODBA 4XTCS 1KY2A 3KXLA 4P4SA 1O87A 3O8DA 4JL6A 5JHHB 2W2XA 4GP6A 3D31A 2WSSA 1N0WA 4LPKA 1FQKA 4ABYA 1G3UA 2JJ1A 5G3YA 3CIOA 1CTQA 3TR0A 3WY9A 5GJWC 2PEZA 3CWQA 4Z8XA 3X1DA 5L3VA 4PC6A 2EFEB 1V43A 2D7DA 5FPSA 2OFXA 4Z54A 5AJZA 6Q21A 1HA3A 2CHQA 4DUGD 3BB3A 1M7GA 1M6NA 5JJIA 2BIFA 1NBMA 2PCLA 1H8ED 4PANA 4Q9HA 4DDTA 3W8NA 1KYIA 4O3MA 1JALA 4TSFA 3C41J 4QBGB 4YDSA 1GG2A 4HAXA 3R7WA 1ZBDA 5GVRA 1T3HA 4KLNA 3WNBA 1ETUA 4LBZA 2UZ3A 3QXXA 3RS7A 5JS8A 3K0SA 3CX8A 1C1YA 3ZVNA 1Z3IX 3FMOB 4ZDWA 3KJEA 3I1FA 3BH7A 2NG1A 4QGFA 3THWB 1CRQA 2QMUA 2ZRHA 3VFDA 4P33A 1F6BA 4IFEA 5J40A 3SN6A 5BN4A 1Z0JA 2FNAA 1AIPA 3QPUA 4WZAE 3WHKA 3TW8B 1R0ZA 1DG1G 2ERXA 2BWJA 4PX9A 4LJ8A 3ZQ6A 3BFVA 1XXHB 2VSFA 2G9NA 2A2ZA 1NVWQ 1ZMXA 1WE2A 4AK9A 2YYZA 4CYMA 4PO1A 1LW7A 1JAHA 3QOFA 4BFSA 2FJUA 2QAJA 4W5HA 3SS8A 4TLBA 4C3ZA 4DLVA 2ZYUX 1NLZA 1Z0AA 1ZM3A 4LJ7A 5EXXA 2RGXA 1NF3A 1RYHA 2ZJ8A 3GJXC 3OIWA 1Z07A 1TNDA 2NQ2C 2QAGB 4D25A 1BO6A 1ZVQA 1NY6A 3CZQA 1GILA 4EFLA 2DBYA 2KBEA 1ZD9A 2J0QA 2B7BA 1W4RA 1XCMA 2EWVA 3CONA 4OKSA 4BFWA 4NYJR 1T8TA 2IF2A 1HT1E 4MYHA 1I2MA 3QBVA 5JECA 4XTRA 3L2OB 4KCGA 1SHKA 2C8VA 1PUJA 4BUJA 5JZVA 3WRXC 2JLRA 2QP3A 3AH8A 5HE9A 1Z06A 3P32A 3QKTA 1T8UA 2OV2A 2D4HA 4LYHA 4GOKA 2DHRA 4QBFA 1Q1BA 5CB8A 4C7OB 3UG7A 5IK2D 2QY9A 3PEVA 4IVPA 1A4RA 1TEVA 3EC2A 1JXOA 3N2EA 2BV3A 4C9BA 5DISB 4BLSA 5D3MA 4FMCF 4MUAA 3U6KA 2CMKA 2C77A 1US8B 3L8YA 3IO5A 4BFZA 5F9HA 4D4LA 5K8UA 4LWZA 4DUGA 1QHIA 3AKEA 3DM5A 4DCVA 1X8JA 1C4OA 1WRBA 1KJWA 2QZ4A 4QBHA 5GADl 1IQPA 3K9LA 2CLSA 5JI3E 4HB2A 1S9HA 3I72A 1GFIA 3DL0A 1FP6A 3K70D 3LD9A 4IW3B 2XITA 3REFA 4DT1B 3DOFA 1KI2A 3HU2A 1N3BA 4DXAA 4O2LA 4QKQA 1Y63A 1J90A 1PJRA 1QHSA 1UDWA 5FTMA 2OE2A 5JSZA 4B73A 3KDSE 4OL0A 2Z5FA 4D81A 2O8DA 1G7CA 3VX3A 4Q7MB 2R65A 4OK6A 2ZIAA 2RGNA 2PJRA 3NHAA 4MUBA 2QP9X 1NSTA 1DVRA 3Q72A 2ZRPA 5KNCA 1HT2E 4YDHB 1FTSA 4K46A 1Y3AA 3T1QA 4YQFA 5KNDA 3KQUA 4NYIQ 4ITRC 2KJQA 3TSZA 4LBWA 5F9FA 4Y0AA 3CX6A 5A0FA 1D8TA 4IDPA 1V5WA 3SYLA 4Q1BA 2NO6A 1T4GA 5KO2A 3A1SA 1N0UA 1S4QA 1VG9B 3TBKA 3ICEA 4FCVA 3EXAA 1QHYA 2V4ZA 3KB1A 2F1RA 2I1VB 2GAOA 3OESA 4U5XA 3WRYC 4D6PA 5TVKA 1OFHA 4JMPA 3SYKA 1ZJ6A 1CR2A 1YRBA 5IF9A 1CR1A 3NC1C 2V9PA 3I92A 1ZCBA 4U7DA 1P73A 1Q44A 2XEXA 2IYZA 3IGFA 4MA4A 2QQ0A 4JZKA 5HTKA 1YKSA 5DI3B 1FQJA 3LBHA 4A8JA 3OEED 4IOLA 4GZLA 4RSGA 1K5GA 3QENA 5DLQC 3IDQA 2KE5A 1N5IA 3T1OA 2ZANA 3I4LA 1NVVQ 4HLQB 4PAOA 1XX6A 5IK2A 4EPYA 4NH0A 2EWWA 4DDWA 2J0UA 3TRFA 3TR5A 3I8XA 1KO7A 2H1LA 4GOXA 1CEEA 3I3SR 4PQFA 3IHWA 1GKIA 4B3DA 4O25A 4POAA 4LSGA 1KK2A 3NH9A 3QF4A 4Q4AA 3F8TA 2VP2A 1L2TA 3K0AA 1SXJC 3E70C 4RFVA 3GEEA 2OBMA 4Q66C 4M9ZA 4A2PA 1FL9A 4LBYA 1G3IA 1S3SA 4BEBA 4NKRA 3A1UA 2O5VA 2EFGA 3ASZA 2CLCX 2PZFA 4LYJA 1NMXA 1MR3F 2WPDD 1KO5A 1E4YA 3DZ8A 3PG5A 5DSZA 1ZW6A 2WIAA 2GXSA 3TQFA 3B82A 5JFGA 1Q20A 2NGRA 1XDBA 2ODEA 2O8EA 4WBSA 1AS3A 4DEXA 2CK3D 2E1RA 2ZRNA 1KK1A 4HI0E 1XNJA 2X19A 4PQRA 4QGGA 3WMFA 3B9QA 3CPEA 3T61A 1NG9A 2BJWA 3O8RA 2NO7A 2P67A 1HE8B 1XD2B 1R7RA 3HDTA 3R8FA 1WMSA 3ECCA 3B1VA 1Z47A 3AF3A 4W7SA 5FOWA 4AKEA 3RRZA 4BWYA 4OK5A 2J87A 4IRUB 3FKSD 3RS3A 1CJUC 2GRJA 1P61B 2EFCB 2NTYC 2O8CB 2Q9AA 1TU3A 1XF9A 3B1YA 5FUVA 4DJTA 1SQ5A 3KUCA 2C9YA 2ZUDA 3DPUA 5EUMA 3ZQJA 2YVUA 2FZ4A 1NN3A 1E98A 3EIQA 1VHTA 2ZXUA 1NN0A 2O52A 1UKYA 2YOHA 3FE2A 4BPBA 4YMUA 5SZIA 3C7KA 421PA 2E9SA 5TY0A 2MMGA 2ORIA 1G7TA 3TNFA 5CJ2A 3AVPA 3KXKA 3OZXA 2ZE6A 3KB2A 2IYSA 4DLWA 3SFZA 2D06A 1F3OA 2PH1A 4NPHA 4NDZA 3MRSA 3QKSA 5EP1A 4CEJB 2GESA 5ELXA 3B5JA 1U9IC 4ERNA 2VP6A 4JL5A 1N5JA 4E03A 2GF9A 1XZQA 4HUTA 3GLFA 3U60B 2XZOA 3KZ1E 3X1ZA 3WMGA 4AIIA 4OI4A 1UKEA 2YINC 1OIXA 4XD7D 4ZKEA 4P31A 4PPGA 3N2IA 3BS4A 2IF0A 2B92A 5EE1A 2ZS9A 3GQBA 3E2IA 3QQ5A 1AQYA 4QRHA 3S1AB 1CBUA 4F4CA 1P2SA 3C8UA 4DLXA 3VHLB 2GKSA 3UIEA 4LX0A 3W8RA 2IYXA 1U8YA 5FPHA 1X86B 4G01B 4UNSA 4XJXA 4URVR 2VHJA 5K8TA 4M1TA 4Z1MD 4PQYA 4LHXA 4BZPA 3DM9B 3A1VA 4MITA 4BLRA 5M04A 3GJ4A 1E2EA 1IXZA 2JLXA 5AUPB 5H8WA 1OXVA 1Q1EA 3LH5A 3VR4A 2GK6A 4PO8A 3ETLA 4JLNA 2A5YB 3BB1A 4RD0A 3JZMA 1CIPA 4YC7A 5IDVA 1MT0A 3FKSA 5HCNA 1UAAA 3TMKA 1RE0A 2W0MA 4TWZA 5EQTA 2YHSA 1Z6XA 3K0EA 3W34A 2BBOA 3BH0A 3MWJA 3UXMA 1NMYA 2VL7A 2ZPTX 2IYLD 1JPJA 3UANA 1UF9A 2ZU6A 3VU9B 4A2QA 5TV2A 1LS1A 1SVIA 4JLMA 4DLYA 1OH5A 4MRNA 3WYFA 1JBKA 3LNCA 5LBIA 4A0GA 4TZ0A 1TU4A 4EFNA 4F38A 2QT1A 2FH5B 2YKGA 2GEUA 1RJ9A 2DY1A 4HDQB 4Q47A 5KYKA 3Q5EA 4RKEA 3RS2A 1KMHA 4QGAA 3EA0A 2BOVA 2VP9A 2WV9A 3MGCA 2J0VA 1U8ZA 1YU9A 1ZNWA 1EG7A 2BEKA 1YVDA 2V6JA 2VHQA 4NMMA 1R5BA 1R6BX 2PLFA 1BOFA 3K0CA 1XTIA 4MRVA 2FE4A 1CU1A 4MYCA 1IBRA 1W5SA 2R8RA 4LJ9A 4MRPA 3WNDA 2CVFA 3LO5A 1E32A 3FMPB 5CJPA 3A58B 4TLDA 4EPTA 3CNLA 2PEYA 4XD7A 5B64A 4QNRA 3GFOA 3A37A 1JQLB 2WBLC 1A5TA 1ZP6A 3B13B 2ZVQX 3K9NA 3EZFA 4QHTA 3CRRA 1YR9A 2WAXA 5L3SB 3AGQA 2B7CA 2RGEA 2IYTA 1U8AA 1W2GA 3GLIB 5J4HA 3KKMA 4E09A 4Y0VA 2H7VA 2J45A 4US1R 3T5DA 4D26A 1YJ5A 4NBSA 1UFQA 4B34A 2OEPA 4A1FA 4D0LB 2VO1A 2D2EA 3BH6A 1GL7A 1M1YE 2BCJQ 3RVBA 1ESMA 1SVMA 3RANA 4DC9A 2ECKA 4LHWA 4M1SA 2QI9C 2DFTA 1DAFA 3ZVMA 1G8GA 2C78A 4KHZA 4M1KA 2WTUA 2UZIR 3W6PA 2JJ2D 1X6VA 3EPHA 1Z22A 1H8HA 4RD3A 2YWGA 4IVRA 3W90A 1OF1A 1T3LA 3CH5A 5C1BA 4Q1FA 3BJIC 1N6NA 1P5ZB 5JBQA 1E0AA 4CW7A 2VPPA 1ZD8A 2AXPA 2PX0A 2ZRFA 1S1MA 3GJ8A 4JSYA 4LJ4A 2VF7A 4FMCB 5CM9C 3LBNA 3THWA 1W44A 4FCTA 3N5CA 1RFLA 1XCGB 3EX7C 4G5SA 1BMFD 1GOTA 1UKZA 3SR0A 2IW3A 2O0HA 3ZZTA 3MJRA 2KB0A 1XXHA 2PJZA 3ZVRA 1IY2A 1QHNA 3H2YA 2X8AA 1NLFA 2WJJA 1JQJC 1DBSA 4GFDA 4ILEA 5LB2A 4FMDF 1FNNA 3SI7A 3PUWA 2XNSA 1NJGA 4S35A 4A0HA 2ZU0C 1L8QA 2XTMA 4TTQA 4V0OA 3KKOA 2QE7D 2PBRA 1HURA 4GMDA 3SC3A 1XEFA 4DHEA 2ZRJA 5KSPA 2ZS8A 3VR1A 1SVOA 1XEXA 2GJKA 3OHMA 4EKDA 4M9QA 1FFHA 3GLHE 4DB4A 2J7PA 5BW8A 1CR4A 2RGNC 3EZ6A 2IS4A 2ANBA 1KTVA 4QXAA 3GCGA 1G7SA 1XWIA 2X2FA 4NP6A 2F3RA 2QM7A 4LHZA 4WVFA 3KQHA 2V54A 1HY3A 2V7QD 5TMPA 2Q6TA 1Q3TA 3QKRA 4BQSA 5HR5A 5BQ5A 4JLOA 5L8VA 2DPXA 4JIMA 2WOJA 3AF0A 4KFTA 2YC2C 2XB2A 1UPTA 5KDOA 4LDJA 1OPXA 1S3GA 2V55B 3U3OA 5C46F 5IRCD 1EXMA 1US8A 2N46A 2A9KA 1DOAA 2HCBA 1KIMA 2JLUA 2F55A 1II8A 3ZD6A 3ZIAD 3VKGA 4HATA 4A8JC 1RW4A 4G0NA 2JJ2A 1KY3A 3ADCA 4ZCIA 2HYIC 3EZ2A 2ZR9A 4JKYA 4P4UA 3B7GA 3GLIE 2IYYA 2AWOA 2QM8A 4L15A 2HXSA 3THYA 5AUOB 2QEQA 3L0OA 2NO1A 3KXIA 1G5RA 2NO0A 1Q1ZA 3AEZA 3B60A 3AB3A 4NYMQ 4BLTA 1XP8A 2H18A 5KSYA 3CR8A 4MYTA 3U7EB 3OIUA 1T9HA 2W0SA 2K5UA 2O8BA 2CNWD 2IS1A 2XJ9A 1DTSA 2XNDA 2OILA 1GL6A 3UMFA 1E96A 3N70A 2AK2A 1F2TA 1Z08A 2YV5A 4DCUA 3K0FB 1SGWA 5CM8B 1UBGA 3RS0A 3LXXA 1XD8A 1U99A 4JT2A 4CIDA 1M8PA 1TF5A 1XJQA 4TQAA 3CF2A 3BFKA 3MWKA 2R2AA 1NMZA 1FUKA 1OH8A 4II7A 4M21A 5JLJA 1G7RA 1MOZA 1JECA 2QE7A 4DBLC 2C98A 1IN6A 2Z6VA 3FMIA 3SEAA 3R20A 1W4CA 4PFSA 1RRGA 4IKEA 4PHGA 4LY6A 3FGNA 2ZRLA 4KBFA 1LS6A 3WYGA 1IN7A 4F4JA 4F7WA 2VA8A 1E1RD 2QPTA 2ZE8A 1UBEA 4F4IA 4ZDIA 3U3MA 3G82C 2P5TB 4QG7A 3DO6A 3K1JA 3TKLA 4E5UA 3EARA 4BEJA 4R98A 2OO7A 4QM7A 2V7QA 4D0GA 1GUAA 1U0LA 1X8LA 3EWAA 4PSKA 2LKDA 1UBCA 4PPNA 2QQEA 2Z83A 1NRJB 3FPAA 3A1TA 2V1UA 1E9AA 4EIWA 1E2IA 5E3HA 221PA 3AGPA 2XOKD 1E0KA 5JMTA 1JPNA 1XTSA 3PVSA 1AK2A 1GDDA 2IXEA 2JATA 4F91B 4WZBE 5AUNB 5GJBA 2J0SA 5L3RA 1QRAA 2R44A 1IXRC 3NEJA 3GLFE 2RGBA 2Q3FA 1EFCA 4M22A 1ZRHA 3ZIAA 4B6FA 2ZEJA 2FOLA 3Q7QA 1R8QA 4KV9A 2FSFA 1YE8A 2GF0A 4B43A 4ESVA 2GWHA 1DAMA 2QTVB 1R5OA 2J1LA 5EZ5A 2HUPA 2R62A 1XBTA 2Q0HA 2FSGA 3LX8A 3VHXA 1KI6A 2QG6A 3X1WA 5F3WB 5JJKA 1YHNA 1E0SA 3JZAA 5JEDA 2F1IA 2W2VA 4R9UC 3U3RA 4QJ3A 1W1WA 3WP1B 2ZI7A 2CNWA 2KWIA 3MLEA 2ZAOA 2ZRAA 1VCOA 3RRNA 1UADA 4D4MA 4D4JA 4M2LA 4PZLA 3HP1A 3R9IA 1QBKC 1U2RA 3BFXA 4R2HA 5BWMA 1Z83A 1KO1A 2ONKA 3DMNA 3NG1A 1T3SA 4OQFA 5FI0B 2X1VA 1LB1B 2WSMA 5B30A 2CXXA 3KKNA 4FXPA 2XX3A 2GEVA 1D2NA 3LFUA 1FX0A 4Q00A 4TQ9A 3Q3JB 2O8CA 4DZZA 2ZRBA 3RSLA 1R4AA 4FWIB 3V9PA 4CT4B 1ZNXA 1E2NA 1VYVA 1Z6TA 3P20A 5BN3A 1E1RA 2GA8A 3MG9A 1F48A 1XD9A 1L4UA 2GETA 3A4NA 5CYOA 4WZ6A 4KFSA 4I81A 2QMOA 3M6AA 3PIRA 4OQMA 3H86A 1U0HC 3PUYA 4HAZA 3DMDA 4Q9KA 4Q4JB 2BKEA 2WWXA 3QKUA 2AR7A 1R0XA 5UKDA 1NJFA 1XMVA 5BN5A 3A4LA 5FTLA 2WM9B 2QP4A 4HZUB 1MV5A 4N1AA 4WA7A 1NKSA 3H4MA 5CDFE 2QNRA 4CEJA 5IT5A 1DAHA 5FTKA 1RRPA 2XOKA 2YNMA 2XXAB 4KSBA 1S9DA 1Z2CA 3ZYCA 2RGCA 3C4JA 3OAAD 4TL9A 3FDIA 3RWMB 2FG5A 3CWZA 5B58C 1PUIA 3BERA 2OBLA 4NYJQ 4B32A 1E2JA 2GJAA 3EW9A 4KITB 4A9AA 2CEAA 1J8YF 1W48A 2MMCA 3RYTC 4RZ2A 2JLYA 4OHVA 1XPUA 4TYPA 4D80A 3ND8A 2FFBA 4ARZB 2D3WA 1B0UA 4CEIA 4NCNA 1OFIA 4BRWA 2CVHA 1ZUHA 2PZGA 1FPMA 1EWQA 2L0XA 3D3QA 3HYTA 1ODFA 3S1AA 4MGZR 5E4FA 1ZIOA 3BORA 1HQYE 4EQ6A 3IBYA 3OE7D 3W5IA 3U6BA 3T06B 2J59A 4Q7JB 3NHBA 1SKYB 2EFDB 2JIZA 4EJSB 1DADA 3K0CC 1QHGA 3QNUA 1FW6A 1GKYA 3P27A 2JEOA 1FP7A 1KSJA 1EFUA 2OAQ1 2Z0MA 3QIAA 3ZJYA 5EP4A 4A36A 1HTWA 2IX3A 4CT5A 2O8FA 2FGKA 5LD2C 4M1MA 2FPLA 4F92B 2CL0X 1GM5A 1P2VA 4HYYA 1D9ZA 4PC1A 4PAMA 5AK0A 3WMEA 2WKRA 5IHPA 2XSZA 3M1IA 3KQNA 5FOTA 1W36B 4OQXA 5FI1B 1Z5ZA 1KNQA 4V0LA 2A78A 1LFDB 4TYWA 2QENA 1A2KC 3NBYC 5FBQB 1ZU5A 1Q57A 4OHYA 4QJ4A 3OFNA 1OIVA 3FWYA 2HT6A 3A6PC 2GZAA 3BOSA 3G0HA 2BBSA 1TQDA 5DI9A 1R5NA 2IA5A 5DYGA 1KGDA 1YR6A 5EE5B 4PC7A 1JR3E 3THOA 1E2LA 1XXHE 3GLHA 1XJCA 1PLJA 2REOA 5JWRA 4JLVA 2B6HA 4V0ME 5FBRB 2RH5A 4G3XA 2ZRGA 3L0PA 1RIFA 2NZJA 1Z0KA 1P9RA 2QBYB 3QXSA 3IHLA 3K09C 3VR2A 3W3AA 1NLYA 2PZEA 5FPYA 3V00A 2QL6A 2PMDA 5CLLA 4PHTA 2V6IA 2RGAA 3OAAA 2JDID 2QGZA 3CBQA 5JWOA 1FNMA 5FOVA 3T5GA 4B6EA 1PV4A 4M1YA 5EE0A 3GEHA 1G8FA 2ZR0A 2RHDA 1OE0A 1KDPA 3DKPA 3QXHA 4NCIA 4QBIA 5DIFA 1Z6AA 3SQWA 5J4YA 1GITA 2UVQA 3MAAC 2J7KA 4ZDKA 1N5LA 3AKCA 4TL7A 1YRAA 2CBZA 3B6EA 4QM6A 2Q21A 5JCPA 2IXFA 2ZR7A 2ZSFA 4FMDB 4RJLA 4D82A 4DIDA 4WXRA 1YZTA 3GJ0A 2C96A 3P4XA 2CE7A 2A5JA 2G6BA 3OE7A 4DSOA 5L3SA 2GTPA 1IY1A 2QAGC 2F3TA 2QA5A 3GJ7A 1OYWA 4NU0A 4DCNA 3ZVLA 2ZRIA 2IYQA 5FUYA 3GLIA 2JLSA 4X8LA 2IWHA 4RD4A 2DFKB 2AK3A 4ZI3A 4Q9IA 1IN5A 3U5ZB 3KX2A 4B2LA 1P2TA 4PPQA 2QRZA 3AVWA 3OF5A 4KFUA 2MSDB 1XTKA 1QZXA 2RB4A 5FTNA 3TUJC 5SZHB 1HYQA 4LOAA 4M1WA 4L8GA 1G41A 1TQ6A 4GI7A 5EXSA 5JCZA 2IXGA 2C99A 1YR8A 2LCFA 4I1VA 4DDUA 1RYFA 2FX3A 4JLPA 1D2EA 1NVUQ 1BYIA 1PZNA 1QVRA 3FKQA 1YZLA 3Q8XB 4Q7KA 3VTKA 4OI0A 1ZNZA 1II0A 2G0TA 4DLTA 2OCAA 1ESNA 1LY1A 1CRPA 2F43A 1D6JA 3OIYA 2QROA 4ACAA 4RVCA 1VYTA 5EE9A 1DAGA 4DVGA 2OAP1 1OFTA 1N6PA 2GBLA 2DYKA 3WXMA 5JWHA 3BXZA 3IEUA 4JSTA 1Q3HA 1G3RA 1KDOA 5J4VA 3GEIA 1N6RA 4C0BA 1SZPA 1AN0A 1GVNB 2ZJ5A 2F9MA 5C4GB 4O2RA 1QHHB 5HZKA 1GWNA 2ZSEA 3U44B 2QTHA 1TQ4A 5SZJA 5CIWA 1OW3B 1ZM7A 3RC3A 3PXGA 1FMJA 2VEDA 5CIQA 5FR2A 1AS2A 3U3KA 4CEHA 3Q5DA 4GPTA 5FL7D 2JDIA 1G291 3PQCA 4AG6A 4JBWA 4HAVA 4Q18A 1J99A 2V1XA 4DSTA 1W7AA 4B33A 2VRWA 4OHWA 3SNHA 1AM4D 1EWRA 1BS1A 3C5HA 3QXJA 4FD2A 4QHSA 4H1UA 4JLAA 5AUQA 3GLGB 4M9SA 4W5WA 4B74A 1MO4A 4B48A 1DAIA 4MKGA 4BASA 3NH6A 1E9DA 2VHUA 1G6OA 5G41A 3RSOA 3EZ9A 5L3QA 5KNBA 4IJMA 4DLRA 3ZH9B 1GIAA 1TEXA 2F9LA 2J9RA 4L9SA 3MSXA 3IEVA 2LKCA 2AD1A 4LC0A 3HYRA 4UNPA 3RNLA 1LF0A 3A36A 4M8NE 2ZITA 1LTQA 1GRNA 1WB9A 2W6JD 3FFAA 5LB4A 3TJZA 4QOSA 3VR6A 1AJEA 4GT1A 1F2UB 1P4SA 1N6IA 3NDPA 5EJEA 1GZSA 1N25A 2IHBA 5KDDA 1CKEA 4WXPA 1GSIA 2ZI9A 2BBTA 4FI3C 1JXMA 4HB3A 4NCJA 2RGDA 2GXAA 2IUTA 4I1SA 2Z4RA 3LQQA 1XFAA 5H68A 4QFMA 1SKQA 4OJQA 3UPUA 4JLDA 3PJRA 1GKUB 4IXNA 1M7HA 3PUXA 2WJIA 1H8HD 1WCV1 3CPHA 1G21E 2ZE7A 1SHZA 3KTAB 1G16A 3GFPA 4ZIRA 1DAEA 3QI2A 4B44A 3IQXA 3VKHA 1OXTA 2X2EA 2BMDA 1E2FA 2CLDX 3TAUA 1GNQA 2WJGA 2EFHB 4PSVA 3KL4A 4GRAA 3LLUA 3QEOA 2RAPA 3AP2A 4JJZA 2ZUCA 1IY0A 1KHTA 3QUSA 5KPJA 5JSZB 2NOAA 4CDGA 4M1OA 3IILA 1JR3D 4WIAA 3T1TA 2HEIA 4C2TA 4NL4H 1A1VA 1HH4A 2WAYA 5FL7A 2YWFA 3C15C 3X1XA 1Z6GA 1T6NA 4J0QA 2VBCA 1U0JA 2FPKA 4LPSA 3K53A 1MABA 5CB6A 4KVAA 1W5TA 5CDFA 3BD9A 2WHXA 4HEJA 3ZS8A 4BZQA 3MMPA 4TL8A 2ATVA 4B2PA 4ASUD 3AM1A 2ZJBA 3FMFA 1E3MA 3TSOA 3DOEA 3SFVA 5TDHA 5AJVB 3SZRA 1UKVY 3IIMA 5GJCA 3CNOA 1DO0A 4D2IA 2I1QA 1E2PA 2J7PD 3CF6R 1AKYA 3ZGXA 3LV8A 2ZE5A 2IHYA 2WJVA 4UQOA 2CE2X 1CJVC 4NCKA 3UWKA 4DSUA 1E2MA 1MRNA 4RZUA 2R6AA 1TMKA 3NKVA 3I62A 4F93B 4US0R 4ESHA 4GL2A 4LJ5A 1IN4A 1ZYUA 4B3CA 2DFLA 4JYCA 2FGJA 2P6NA 5FBWB 2CL6X 3GLGE 2BJVA 4U00A 3FFBA 2AWNA 4FINA 3U4QA 4QJ5A 2ZJOA 5H1YA 2W6JA 5D3QA 4OK3A 3WBJA 2CDNA 1TADA 5JRJA 3ADDA 1IHUA 4CVNA 2VYFA 2P0EA 4BRUA 4KLZA 2J0UB 3WYAA 2AKYA 3PFIA 4HZIA 1P75A 2BKUA 5KOYA 2GAAA 2VHCA 4BFVA 4P0TA 2BM1A 3REGA 2WKQA 2ORWA 2XZPA 1OHHD 4ZCLA 1TQ2A 3M0EA 2KSQA 4OYHA 2ODNA 4XH9B 4JVSB 2RCNA 3K0AB 1E2GA 4FMBB 2ZVPX 3H1TA 4Q1CA 3AVXA 1QG2A 2D7CA 3B1ZA 3EG5A 4AD8A 2ZJAA 3LWNA 3GJ6A 4L5BA 1DS6A 2ZI5A 3K70B 3U2QA 4MDFA 2DR3A 1Z0FA 4PAQA 3K09A 4LV5B 3EPKA 3DDCA 1TX4B 4RFSB 3EASA 2HJGA 2W83A 3I8SA 3O8BA 3SJAA 2FEMA 1P7CA 5CLQA 2VP5A 2XNDD 2FSHA 3WHLA 2ONJA 4LBVA 1JR3A 2O8EB 4RY2A 2ZJYA 4HAUA 1G19A 4V0MA 4Q4HB 4YXWA 2MSEB 4MDEA 5HE8A 1OXXK 2A5DA 2OXRA 4DRZA 1CLUA 1J70A 1WDTA 2N1BA 1Q12A 2QT0A 1XPOA 1Z29A 1Z28A 4MKFA 4ASUA 2ZS7A 4NCHA 2IS6A 3MWYW 121PA 1CJKC
chains in the Genus database with same CATH superfamily
3QTLA 3MCUA 3KJQA 5L6LB 4NBKA 1KF0A 1MJHA 1TK2A 5G1OA 4G36A 8LDHA 2IYEA 3NONA 4Q4JA 1BVUA 2FV8A 1WLSA 2P79A 4QYXA 2IP4A 5LMCA 4Q21A 2QVGA 3LMKA 1GDHA 1IE3A 1UBLS 3MLBA 3ADBA 1Q7GA 4Q48A 1P0QA 3RVOA 5FFMA 2RBGA 4RK5A 1IONA 4B7AA 5C1OA 4BVKA 1WOMA 3KZMA 2JHPA 1XYVA 2LTAA 4EW6A 5EPUA 3FNGA 3DC7A 2CDRA 1S1CA 1DJNA 1TVEA 4QFBA 2PBFA 2W58A 1TAHA 2RGYA 3QXCA 1FLAA 4WK4B 4DMKA 1SC3A 2A4MA 1MA0A 4YONB 3UT5A 1I24A 4AKSA 2V7UA 5C32A 4BO1A 1TLTA 4TKVA 1W6UA 3NWPA 4LRYA 5HZHA 3CF4A 1ONBA 3PE4A 4OIMA 5FAXA 2DTDA 1ELOA 5KUTA 4K88A 3TFOA 2FPIA 4QJBA 4ZOLB 3GUCA 4B8YA 2WDPA 2O5EA 2AOWA 4BJ6A 4PG8A 1D6MA 1EUCA 4LZNA 4AICA 2GYUA 2CHGA 1S7CA 1MLDA 1G17A 2XHZA 2P1RA 3OE4A 3ZGOA 3ADOA 4BYMA 2PKYX 4GOND 3COZA 2F8TA 4XUGB 4EGQA 4R6WA 5IXYA 5L9AA 5F2EA 1QE5A 1HSZA 1ZL0A 3SHQA 2BEWB 4R84A 3KYIB 4QVKA 3VJKA 3L8HA 3ZI7A 1T4CA 3Q9LA 4BJ3A 4RPHA 2X2OA 1RJDA 4KO2S 5LVAA 1BXRA 3TH5A 2CMDA 4LC1A 1BCRB 2Y6UA 1NE7A 2QUIA 1Q7TA 4UHFA 1KAOA 1XTQA 1G3MA 2FA9A 1KEPA 2J46A 2OSVA 4WOKA 4A0FA 3HWX1 3GJ3A 3OBBA 1R6XA 4QUDA 1C3EA 1M7BA 1OA0A 4JBYA 5ARCA 3VC3A 1DJLA 2AF3C 3OPYA 1RBZA 1X7WA 5CPFA 2II6A 3LUPA 3DG9A 1B93A 1I30A 4CR7A 4YRPA 1IJEA 1Z2EA 2PSDA 2C9OA 1ZESA 2OORC 2DWOA 1G6HA 1YJXA 1YS7A 4UBNA 2MSCB 3UFXA 3DOIA 3EA5A 2FFQA 4DJFC 5CNJA 3TMYA 1KDRA 3V1KA 4RS3A 1X1AA 4FLMA 3PGJA 3JQ8B 1KSFX 3O2NA 3ZKWB 2ADMA 4WZAB 2DX7A 3ZV5A 2Z4SA 1EGAA 5FUWA 3HZRA 2OB2A 3ECAA 2IUUA 4EUEA 4X3OA 4BC1A 1PNOA 3V4FA 4XWYA 1U1GA 1R4NA 5C8YF 2REBA 5K3FA 4FGUA 1LV8A 2J0EA 1X9GA 2QX7A 2FEAA 7ABPA 4QO7A 4TMXA 5AJXA 1S2LA 4GYKA 3WWPA 1USKA 3O8QB 4BNKA 1KP9A 2C1EA 1ADYA 1Z5VA 1K7EB 4JNKA 2MYTA 4V2UA 4BUZA 1INLA 3LC1O 2JVIA 4I1UA 1OFUX 5A3SA 3UK6A 4BP9A 5AM3A 5B7GA 4MV7A 4U4AA 1DWUA 3S1SA 1QG4A 3UJ3X 1REQA 3CRVA 5IH3A 3CZ5A 4LMRA 1IB6A 3RRFA 3M34A 3L0SA 2FMXA 3QLJA 1BYUA 3D8NA 4NDNE 4OJKA 4DIDA 5I7SA 2Q5QA 3ZQKA 2Y76A 1E9RA 3B9PA 4LYAA 1THMA 2PY6A 3QFFA 1Q7RA 2F48A 3L7LA 1DIGA 4I4LA 1KMHB 1JEDA 1Z8NA 1IOLA 3LPNA 3NT2A 1AUXA 5T4BA 2VT7A 4EGFA 3SKVA 3JQBC 1QH8B 3ZTTA 5JR3A 5AJWA 2F64A 2CUKA 1K7CA 4IFBA 4NVRA 4IP0A 5J5VA 1JJFA 2JCSA 2AUTA 4D5GA 4I99A 4LI0A 1CJTC 5LQCA 2HHAA 5BSVA 3RGWS 1K9VF 3TQTA 1KVSA 4DS3A 5C8DA 1D5CA 1JH8A 5FH9A 2Q2NA 3MCAA 1IVNA 2QYTA 3FNBA 1YIAA 1SN7A 4WDQA 1XDUA 2OUKA 2Q0QA 2JZCA 4MQLA 4YDRA 5G3ZA 3M4YA 2PZKA 3NGLA 4PN7A 5A3RA 1Q1GA 3JARA 4D98A 2DLNA 2GCPA 3BGVA 1J5EB 1J9ZA 5TC4A 3F0TA 4WK6A 4CHTA 1SU8A 4JB0A 5JAOA 4E2WA 4TKUA 3N7AA 3FWPA 2UYYA 3A06A 3I0MA 3OP1A 3NIBA 5DP2A 3AP1A 2JIZD 5FEMA 3VR3D 1ULZA 2ZBDA 2YVLA 3QEJA 3OLVA 1P2UA 2H4ZA 4J75A 5ALXA 3R44A 4XIJA 1EX6A 1HLDA 5DLPA 4DIOA 3D6UA 1LSUA 2ODWA 5MF6A 4F9TA 3MT9A 2QUZA 1ABEA 3ON5A 4MA0A 1T2UA 3TLXA 5H3LA 3I61A 3GLKA 4K28A 3U62A 1RRCA 3RUHA 3KOOA 3FSJX 4XDYA 2RD2A 1NW8A 1XD2A 5E95A 2A9QA 3UAZA 3BDIA 5CR9A 3RLFA 4L4UA 1CRLA 2H1VA 4B6PA 4HF7A 2QN6A 4ZCMA 1HZZA 1EFTA 2ZPUA 1MF7A 3TCXB 4AX8A 1SC1A 4PFJA 1F06A 2WMYA 3EQ9A 4P98A 2D1QA 1KO8A 3W5AA 3EF3A 1RKVA 4FSXA 1PR3A 2LDXA 3CLKA 1XQYA 3IKTA 1E9SA 4F3CA 3EFEA 1K7SN 3E84A 3LUGA 4BLOA 3NYIA 1Q3KA 5L7YA 1JN0A 1QHHA 1ANKA 3FPGA 5HRCA 2ATIA 3LA6A 4ZK2A 2GZHA 1YQQA 1JU3A 3DS8A 2IODA 3OE5A 1V6AA 2QPLA 4D3FA 1CEXA 3BA6A 1COZA 3UENA 4P34A 2RDMA 5DHAA 5E0OA 5KYXB 2GHIA 3LAWA 4LK2A 1LD3A 4L5AA 3TD6A 1A2BA 2FI1A 1EHYA 3QVVA 1CQIB 3OX1A 3WGGA 4D3SA 4NJMA 4DZRA 3RODA 5CDGA 1TEZA 2RK4A 3CX4A 4L9WA 4E33A 3D6FA 3HV0A 2DHEA 2ADFA 3LLMA 4WLEA 3ADPA 1N9GA 4XQEA 5TS3A 4DLSA 4KR9A 3NOQA 5K7SA 2KLBA 2K4MA 2XTAA 3GLGA 5DHRA 4ZYXA 3EHEA 2Z3ZA 3IKJA 1UPUA 4C06A 4BUJA 1EXNA 2BRUA 2AMJA 2QV7A 3KR9A 3TE6A 1SVKA 1ZH0A 5LFAA 2A1UA 3K6JA 4HRYA 5M34A 1QTRA 4QQRA 4LF8B 3BMXA 3B1XA 3RYHB 2CMGA 3MUFA 3RAFC 5KYNA 4YQEA 4JQYA 3BXPA 3OEHA 3C6BA 1JF8A 3N2GA 1ENPA 4ZVMA 3VX4A 1MXFA 1NI3A 4EENA 1XKTA 5KVSA 4HGYA 2JA1A 3LUAA 4ZKDA 3HA2A 1E6WA 4BX2A 4R2IA 4Y7DA 4BJ1A 3VR3A 4PIVA 1PKXA 2Q6IA 1VA4A 1ZRMA 3LC7O 2WG0A 4MR7B 3H11B 1HO3A 3F4BA 4FN5A 1GPKA 2JRCA 2ORYA 2ZXEA 3WAJA 2VZLA 3N8NA 2VSOA 2FDCA 1DRVA 5CPBA 1RC0A 4P3NA 1AK1A 3QFTA 3ZLJA 1T1JA 1KDZA 4ZCPA 1TCCA 5FF9A 4LFAB 1PEDA 1MDFA 4FEYA 1O6FA 4LE0A 3RWOA 3QPBA 1YK1A 2BEVB 4EBFA 3MJHA 2RAUA 3F6RA 3MB8A 4HVAA 2F3QA 5FBWB 3RSSA 3VQTA 1Z13A 4RZ3A 4GPEA 4Q1DA 1K8ZB 4D9IA 4DL9A 3V3KA 2PZMA 1OUMA 4KQGA 3BXOA 3KJFA 1HFWA 3A70A 4G2TA 4JJAA 4M87A 4R4JA 4XUDA 4M1EA 2Y71A 2JFZA 4PYMA 2B0JA 1M6VA 1NC3A 1SC4A 3U61B 1EFHA 3NBKA 4G86A 1JR2A 2BEJA 4KMRA 4PZDA 4BCCA 1THTA 2F1JA 1QFZA 4MNTA 2R1VB 4PRLA 5LQSA 1DLJA 5LB4A 2I76A 3SMVA 1C1DB 2CSUA 4YXFA 2D4AA 1M2EA 2B2NA 1ZQ9A 3CGWA 3IQFA 3P52A 1VP3A 1AGPA 3HM9A 2GZ1A 3DE6X 2O8BB 4Z49A 4UHBA 1CVLA 3P4YA 4JOQA 1CULC 2FRVA 2Y1OA 3JASB 1NNI1 1NC1A 3WLPA 4BAUA 4ODIA 2QAIA 2A5GA 2O05A 1JUDA 2V7WA 2CUTA 3DEZA 4PLPA 1FDRA 2ATXA 4K9LA 4DRXA 4LF4B 4NHOA 2G83A 2IIVA 1EESA 1UOPA 5TT0A 4I8DA 5B3AA 4TRMA 1YCDA 3NDIA 1NOJA 1F6DA 1P31A 2MSNA 3I3OA 3V2HA 3K32A 3VPCA 4BX8A 4DJAA 3AY3A 4YRBA 4JSRA 1JJVA 1NIJA 3K0BA 2GN8A 2ZSDA 5KNBH 2ZBRA 1SWVA 2EJUA 4P3YA 4HAWA 2I55A 1I6KA 1GNRA 3IALA 3TK1A 3ZHVA 4CRWB 1T91A 1C7IA 3D2CA 1RPJA 2GO1A 5BW5A 3HY6A 4HNGA 3NLLA 1BS9A 4N76A 3PITA 2C0CA 2LBPA 4Q1AA 1B1CA 2Q0SA 3JD4A 3IQWA 5HF5A 1A97A 4B9EA 2BZ1A 2QXTA 3BF7A 3MUNA 4EF4A 1XEWY 4FOPA 1YZVA 2VZ8A 1MQAA 2WWFA 4AZ3B 5G40A 3IQDB 2J9XB 1PL6A 4IDNA 1ESZA 3PL5A 4MRMB 3V4SA 1MBZA 1AF7A 4TWAA 5IMBA 4E11A 3B1FA 5FBZA 4EATA 2AR0A 3ESXA 3FN4A 3NNNA 1E2HA 1S8AA 3LYHA 4O2BB 3VH2A 2BGIA 3K94A 3ZWPA 1G2QA 1O5TA 4AYTA 4ENQA 3G17A 3CVXA 3SE0A 1FTGA 3IXMA 4E12A 1AKMA 2RHMA 1IOVA 1P2DA 4GH5A 3RS8A 1YS1X 4WWHA 5JTUA 2PQ2A 3ZE2B 4WN9A 1I7SB 1BU8A 2EQAA 2UYOA 3I39X 3UHJA 4WLFA 1RACA 2G25A 4JOBA 4Y2HA 1JDBB 3BFPA 3T1VA 5CA0F 3IX7A 2GVZC 1T6ZA 1UAYA 1QRRA 1FRNA 1F1BA 5DDIP 1YRLA 2A88A 2BGRA 2WMNB 2O0JA 1A4UA 3ND9A 2FQXA 5DXJA 4CDMA 1KKLA 2B21A 4RE6A 2H0QA 3F5MA 4G1MB 1ZNYA 4AX4A 4EMSA 1NRXA 3TOVA 2BR3A 1W49A 4AI6A 1OOEA 2H2DA 4IDQA 2VK8A 1GLGA 3C5EA 2WYUA 4WCDA 5SICE 4E88A 1IIRA 2WG1A 4YMGA 3HFSA 5IYZA 5JCJD 1K5HA 1DCTA 4HFNA 4PWZA 4U7JA 3SYRA 1OBOA 2P69A 2JI6A 1AA9A 3AF5A 4Z9YA 1NI5A 2LDBA 1IN8A 3OTIA 4RXUA 4CTOA 1KE2A 4GE3A 2WWHA 3PQ6A 2Y92A 1UKAA 4KXFB 1UQTA 4B7XA 5LDDC 4Z3KA 4URFA 2KBFA 1J8DA 1CEYA 2PLNA 2IYRA 2ZSIA 1XAHA 2OOSA 1U2GA 4Q4HA 3VDMA 4P0PB 3RW9A 4RF3A 4GPBA 4MS3A 1N6LA 3OJWA 1RWQA 2OXFA 2CLHB 1OSNA 3GGPA 4QC2A 3BQNB 4R41A 5I7FA 4X1YB 3ZE1B 4HWPA 3TFQA 1QVVA 2O7SA 2Z30A 3AF4A 4B4KA 5JU6A 4CQJA 4RC9A 3M5PA 6REQA 2G3YA 2EU8A 2WINI 3OTQA 2AN9A 5AJYA 2GK7A 3E48A 1I3KA 2OTCA 2CV2A 4Q3EA 3RTAA 2GFQA 5FI3A 1GRCA 3HXPA 2AHOA 5DB4A 3HHPA 4RYDA 2CCGA 1PIWA 721PA 3ENNA 3EVDA 3OJCA 3CKYA 3KBBA 4IG4A 3HR8A 3ZOZA 1XZIA 4XVCA 1UEIA 2VWPA 3HKCA 1KZ9A 1HWYA 4KWHA 3AO0B 3L8MA 3IMEA 1ECGA 2YXDA 3P2MA 3PL1A 4GPD1 2JIRA 2Q6KA 1V5GA 3KJHA 5K8LA 4RL6A 4IDCA 1G9TA 4DMMA 1DG3A 4BFTA 3GF4A 5IVIA 3E35A 2IC5A 2Q45A 4A16A 2ANCA 1L1FA 4E5NA 2OLKA 2BI8A 4Q9DA 1NDQA 3AP3A 3I32A 2WSIA 4O59O 5C8YB 1M66A 5HGXA 5K0BA 3TX6A 3VNRA 2C0PA 3IPYA 3WZ2A 1U8UA 4F60A 2OOKA 4KFCA 3EOBI 5BMOA 4X84A 3SHWA 3ZJTA 3TGWA 2JLCA 4NR0A 3TKAA 2R6GA 2IPNA 3AIOA 5AW6A 1B0PA 5GIOE 1VFPA 1T3GA 3WP0A 1E66A 2E5FA 2R1TB 3LYAA 2CCKA 1AX9A 1EDZA 2JI8A 3ZZ0A 1EP2B 2GQ0A 3TAHA 4Z4IA 4TKMA 1YFJA 1PQWA 4BFXA 3L05A 1ZK4A 3ROKA 4IZ6A 5D3MB 2JLVA 1UPCA 2XTNA 4FE7A 5FA5A 5BR1A 3FOEC 1U7PA 3HU1A 5B53A 1Y4DE 1U3WA 4CEIB 1LI4A 4FBLA 1L6IA 4OD0A 3BK7A 3IIKA 4X8MA 1U3CA 2WLTA 3RT1A 1QX3A 3PDUA 4BNZA 1QOZA 4KX5A 2FCRA 1ODJA 4HFRA 4R1LA 4WJKB 4B8WA 4DAOA 2LUOA 1UWVA 2JB9A 3K5PA 4OSEA 2WPDA 3I9FA 1XEWX 3IUNA 1AXRA 4M86A 4FQ5A 5KU1A 1SA0A 4XI9A 1F38A 3RSHA 3AEYA 3DJYA 3OJ0A 5IH7A 3DPIA 1YBMA 4EVQA 1TI7A 1CT9A 2IEDA 3MINB 2C1XA 2WV7A 4UNRA 2ST1A 1ZOSA 2VHWA 5K51A 4DEYA 1IATA 3D3JA 4N0MA 1YBVA 1NPTO 3A31A 3AY6A 3SM9A 4FMPA 3DWEX 3DYBA 3B1WA 2R8OA 3BWDD 4WAUA 1BIFA 5C53B 3FRJA 2GEJA 2PQ6A 3ZX5A 2QVBA 1TU0A 2AXNA 1A8PA 1DBPA 2NYUA 4PLVA 3BT7A 3ETEA 2Z1MA 3D5EA 1LWNA 4JYMA 1A2QA 4YXWD 3IVGA 2YHUA 2COKA 4YLGA 3CRQA 1V4BA 3MNFA 3VGPA 2GM4A 4NOLA 2GN1A 2C94A 1UEXC 1GT91 2K87A 3CW2A 2V97A 4WH0A 3RK0A 2N42A 2P9QA 1G2OA 3UV6A 3FBWA 2G9ZA 2QRUA 5D1NA 4BKPA 3EVNA 1YDWA 1RHUA 1RWKA 4DCGA 1QP4A 2AVNA 3K96A 1MVOA 3HJAA 5BMVB 1T5OA 2N3ZA 1IK4A 2A86A 2C9CA 4J7UA 1TF2A 1ONPA 3GLHB 4CQMD 2DUJA 1N0VC 3S5UA 3AHJA 1J42A 4C5BA 1PWXA 5TRTA 5JT1A 2VQSA 1FFYA 1DGQA 3IUYA 2G0NA 4RZXA 2Q0XA 2NU6B 1YZ3A 3C3KA 1DWPA 3OZUA 4PYIA 5DTEA 2FHSA 5FUXA 4AP5A 4KO4S 3GDGA 5JATA 4KNWA 2VKTA 3EGDB 2GCOA 3NBFA 4HLDA 5K4AA 3R3UA 1UP4A 4OPMA 1LK0A 4YR9A 2IUSA 3FDFA 3AFNA 3HUFA 4CQLA 1KIFA 4RMNA 5HUQA 1ZOLA 3BAFA 1SXJD 1X87A 1T0JB 3CF4G 4URWR 3T5BA 5KSZA 2Z6QA 2VHTA 3O2SB 2IZ0A 1Q2UA 2CHVA 3AR5A 3DNFA 3M6LA 4CLDA 4ZXPA 4MJ3A 1P4GA 1OI4A 1VI6A 4G1UC 1XT6A 3AETB 1P0IA 1PD1A 1W88A 4LY3A 2QL9A 3SZMA 4AULA 1QS0A 4KPGA 3DLTA 2IPMA 1B0AA 4C0LA 4BGDA 3RAJA 4MJXA 3W1EA 1DHTA 2PZAA 1MZVA 1M6HA 2W4IA 3QE4A 1WPGA 3Q8MA 4DNOA 2Y27A 3GFTA 2YW2A 3HN6A 4IHQA 4M9XA 3ICQB 3HCCA 2AL7A 1DBWA 4XWAA 3VV3A 3L6OO 2ZROA 3IP6A 2Y1LA 4DUZB 2VWGA 4F2PA 3R9WA 1TZ2A 1ZVMA 3BBPA 1ZJZA 1FEZA 4J7XA 5GWXA 1I4LD 2Z3VA 4LRTB 3KQVA 4X1KA 4BN4A 1IDN1 3E9MA 3LUBA 3F5SA 2R4UA 3PEUA 4FDLA 4MKIA 5AM5A 3ZXSA 4BZWA 4C7MA 4XYEA 4DJJA 2QDKA 4Z1MA 2AQIA 4M0CA 4F86A 3F46A 4XPZA 4F6RB 3OCCA 1B6GA 2FSPA 3G8CA 4G5FA 4LK3A 4RXTA 4EJFA 3GYGA 3ETGA 4UBJA 1SCBA 4L02A 5BSEA 4ONEA 1W36D 3DP9A 4HS4A 3UMJA 1MFZA 2W00A 4Q03A 3U9TA 3E9NA 1KYXA 3D8UA 2Y8EA 4D9GA 2P3QA 4II3A 1UJNA 2V65A 4GP7A 4XLZA 3OZGA 5KPDA 2ZJZA 4DYDA 4E22A 1LPMA 3HH8A 3Q85A 5FYDA 1X92A 4UMEA 3DAHA 3CRMA 2HXGA 4K1XA 5HKKD 4DPKA 1L5HB 1G18A 2RHHA 2D2VA 1PLLA 3PNLA 2Q3HA 4GLBA 3LO8A 4ND7A 4PLYA 5EHGA 5CD9A 3MA0A 5JLAA 3KC2A 4TWRA 2CJWA 2PYDA 3M1YA 1FTQA 3GPIA 2HMVA 4LZZA 2JK0A 3OH8A 3EG9B 4FI3F 4TT3D 1SVSA 4TV8A 2OT3B 4ERXA 2C2YA 4M0LA 2ENWA 4ZTBA 5CURA 3VU0A 1G4UR 4QX6A 3LT0A 5I51A 1RXCA 4XSGA 4HXGA 4MVJI 3QWIA 1Z0DA 4N82A 3S2ZA 3ZDQA 2O8VA 3HVIA 4V0KA 2H08A 4MVJD 5KTSA 3T94A 5FWXB 1W0KD 4BNLA 1XA0A 2JI9A 2O3QA 1FS5A 2GEFA 2PVPA 1AB6A 3R24A 5ADUS 3KV3O 2OBXA 5A03A 5BPHA 2XVMA 2OY0A 4H9GA 1U6IA 2JAQA 4O2AA 5K99A 2HWUA 4ON9A 2INGX 3NT5A 4BFUA 3QKIA 821PA 1IBMB 1FJ2A 3EN0A 5J2TF 4E3ZA 5AI8A 1G63A 2QLTA 1Y7HA 2X4LA 4O0MA 1SXJA 3FPSA 5I9NA 1YD7A 3LPMA 1XL1A 4JI3B 1MQ8B 1R2QA 1SIBE 3FOWA 5B7QA 5LLDA 2DT5A 2FUG1 2I4IA 2NV0A 1QZUA 1KMQA 3D0OA 4Z51A 1FU4A 3DW3X 1CEQA 2BGUA 3LK6A 3SJZA 1YMUA 1PS0A 2QLMA 2CVOA 2Z1NA 4X3PA 4X7BA 1UMBB 1YRWA 3TW0A 4CIXA 3HXOA 2VAPA 3DHYA 4ZPJA 3QSYA 3LBAA 1JG3A 3B3QA 2BEUB 3WDKA 2A58A 4D45A 1ZH2A 1I3OA 1TIKA 2IS2A 3QHQA 4B84A 4JITA 4OHXA 1XMQB 2HN9A 3TLJA 2HPZA 4MQ4A 4WBNA 2IEZA 4MR9B 4WKCA 4NFHA 1GFWA 1XZNA 2QLFA 2YYAA 5K3AA 3K9CA 5ARDA 1XKLA 3T12A 4XVUA 1KOGA 4JNCA 4FB4A 2IDKA 1OPRA 3WLRA 1G64A 3CR7A 3SBDA 4BUCA 1PFWA 3J81k 3KOUA 1JZQA 2I2FA 3SSNA 4P7JA 3FCAA 2J9YB 3FF1A 3R3WA 4RD2A 5K6TA 1GTVA 1U3DA 1XVLA 3KKLA 2H31A 1L8LA 4QTYA 4ENSA 1FNCA 4L4SA 1RM0A 1TAGA 3TQSA 9LDBA 1IVSA 1EX7A 1ZGBA 3I12A 3EIHA 2WJYA 3LWZA 1H93A 2O3RA 3EDMA 1KO4A 1DXHA 3C6ZA 3G0CA 2B69A 3NBZC 2ATCA 4ZI7A 1AXGA 1E1KA 4M54A 1K0FA 1F0PA 1I2CA 5HQTA 2W71A 4HB4A 2J6CA 4W9NC 1H2BA 2XGMA 1CXZA 3NAQA 1IMOA 3ZGLA 1NBMD 1LSOA 5HKKA 1WXQA 1H9AA 1NM5A 2G7MC 3HN2A 3X1YA 3Q3VA 3NWJA 4LXTA 3WAKA 1ZO8A 4XDHA 1A4IA 3M5DA 3NHMA 5JSFA 1CNMA 2YHBA 2AG1A 2XE8A 1Y6ZA 4MUNA 4PSAA 1PNRA 5A3JA 4TT3A 4KQ9A 4JL8A 1PDVA 3EGCA 4NE2A 4A03A 2F7SA 2OBYA 2LZ0A 3S2EA 4GD3Q 4G5OA 3VSDA 2Q4OA 2Z4TA 5CA0B 1P45A 1TIBA 3VC2A 1J8FA 2OESA 3G9XA 4LNAA 4EEXA 5AQ1A 3N6XA 5JNWA 4EHFA 3D1JA 3ZDZB 4Z7QB 1U9IA 5KWSA 1W0KA 2FSVC 3VNVA 2XHEA 3OSUA 1DC4A 1DBRA 4OSOA 3I2HA 2XDAA 1T34A 1XL0A 2FN4A 2ZRCA 3L7KA 1EVLA 4JS0A 2FOIA 4L73A 4ZP1A 4YI5A 4TLAA 5AVJA 4B6QA 5LMUB 4TROA 1X7YB 3JAKA 4DZTA 3CO5A 4BQPA 5CLGA 4C5AA 2ZI4A 1FDSA 1DQNA 1DPFA 4DQVA 2VLIA 2NXWA 2WWYA 3QNWA 2HHCA 2GB4A 4Z7NB 5E9WA 5DM2A 2W6CX 5DO9A 4BRZA 4CL2A 2HF2A 1YZNA 2AIRA 3ZHBA 1MABB 3V8QA 3C8HA 4TQGA 1WBDA 1H3FA 1Z2AA 4ZN6A 1WQ4A 1EU1A 4OLFA 1EXVA 3DTYA 1YDEA 2UXDB 3H5AA 1CF4A 1A98A 2HMTA 1BN6A 3CKLA 3CM0A 3PRHA 2CF6A 1F17A 3KLBA 4EX6A 4LV8B 3BCHA 3A4TA 4FIDA 1JYFA 2EX0A 1E3TA 3R9XA 3JVUA 1NULA 1RJFA 2PZLA 2RJNA 5BSFA 3GVPA 3K8YA 2XQJA 2FN3A 1BU5A 1MW9X 1VKNA 2DPHA 2IJGX 3AI2A 4N7JA 4BMXA 1DAKA 5A4KA 2OENG 1K06A 3PQ8A 4UU0A 2VWQA 2PSJA 2NUTB 2PA0A 2AMLA 2RAVA 4XVRA 5ALGA 3WV4A 1N5DA 5F33A 4F11A 4TYQA 1ES9A 2ZAGA 3U4QB 2ODBA 4XTCS 4HAOA 3MB5A 1KY2A 4IBOA 3O8DA 3HTXA 2A0YA 5IT0A 4J76A 3EMKA 1ZMTA 1A5BB 5FX2A 5IAEA 2I87A 3KOXA 1FQKA 4JOSA 2G7ZA 4Z8XA 5L3VA 4PC6A 5FPSA 2Z9BA 1U0TA 5AJZA 3SY8A 4EITA 2CHQA 2XBMA 5LA6A 2BIFA 1NBMA 1NHGA 2I6XA 2QLLA 4M9UA 1U1DA 1Z4KA 3W8NA 4LDAA 1H5UA 3ZCPA 5CA1A 2YXLA 4GE0A 5GMOA 3RREA 4NNPA 4OHPA 2QR2A 4QEZA 2XUIA 2A84A 1UXGA 4HAXA 5AK3A 4C43A 3WLMA 4XWTA 4TTIA 4GVPA 3ONVA 1IK6A 4BNXA 1U3TA 1YKFA 5CIYA 4HVTA 2IZ5A 4RW0A 3FYDA 2GSWA 5JS8A 3CX8A 1C1YA 1TT5A 3ZVNA 2HMYB 1E9VA 3PT9A 3MJDA 4PSUA 3FMOB 2XT0A 3HJGA 2ZWAA 3W3AH 1PV1A 4ZI5A 3BH7A 3THWB 4FJ1A 1ISJA 2ZRHA 3MXTA 1QIJA 1TGVA 2HU7A 3KLNA 3SN6A 1J21A 2GK3A 3P9IA 1F2VA 5A62A 1Z0JA 3AEUA 2FNAA 3WLAA 2D54A 1E8MA 2IUYA 1AKQA 1BVRA 1DG1G 1ZY2A 2OKCA 2VEOA 2YY5A 3HJCA 3TW8B 4ZJZA 3ZQ6A 2FN9A 4YAUA 2VAMA 1O6BA 2LPMA 1QMPA 2VK4A 4MPJA 4CMJA 3OUUA 4HC4A 2YYZA 3UW3A 2Z58A 1LW7A 3ILSA 4QTXA 1MDBA 1XUOA 2H59A 2ZWVA 4IIUA 4WX2B 1N3LA 2QAJA 3K35A 1Z18A 3SR3A 3AERB 1JEYA 4REQA 1KETA 3KEFA 1B6RA 3QWAA 3TTXA 1WW8A 2ZYUX 2H51A 3EDCA 3D4IA 4LJ7A 4Y2VA 3RAGA 4DGQA 5EXXA 1O96A 3WLLA 5L7TA 4G5XA 1U5BA 4XM0A 4KREA 3NHKA 4QUBA 1TNDA 3HSKA 5HZGA 5I7UA 3OCJA 4N47A 5JZOA 1Y80A 1PZMA 2R0QC 3LL7A 1ZD9A 2Z3WA 4QYTA 1AXEA 3KSDO 2RC6A 2QN1A 4ZGGA 3UAWA 1TJYA 3CVYA 4JZYA 7REQB 4AU1A 1I2MA 1JIJA 2JVKA 5J1TB 2C3MA 1V9LA 3FNRA 3ZW8A 4AUEA 4KCGA 4UPDA 4OB6A 5JXJA 2Z98A 4ZVRA 1FLNA 1FFXB 3RYIB 3K30A 3M89A 2QP3A 2WUGA 3NIWA 5HE9A 5JZVA 3CLHA 4CFZA 4E0BA 2AS0A 1PK9A 5KJEA 2X0NA 2COUA 3NHWA 5YASA 4GOKA 3TI7A 5CB8A 4C7OB 3WGVA 2QY9A 1V3VA 1GGNA 1O7JA 4C1NA 3N2EA 4YB8A 4WCVA 3KYBA 4BLSA 1Z6QA 5JBIA 4FMCF 3H18A 4LXXA 1K66A 2CMKA 2C77A 1JU9A 3DTTA 3JQGA 2ZKIA 3VC7A 2PUAA 2HZBA 3EYAA 4QLOA 4GPIB 2ZZKA 4LWZA 3BEDA 2WU0A 4DHWA 1QHIA 1V11B 4U7HA 3CS3A 1OU4A 3I6ZA 4K2HA 5GV8A 4K1LA 1ODCA 1YB2A 2P8SA 4PCAA 4W5RA 3J7AC 1X8JA 4I8XA 1SBYA 1WRBA 3SIXA 5GADl 2V03A 1BJKA 4N54A 2CLSA 1P2FA 1G2IA 4M0KA 2A35A 5JI3E 1GA6A 1S9HA 3I72A 3R5HA 5HFJA 1FP6A 1JQKA 4U8HA 3LD9A 2VQ6A 3BIOA 2XITA 1V5EA 2AGVA 2AN5A 2X58A 4QYIB 4RGBA 4WNAB 3QUQA 4BWFB 3DOFA 3HU2A 3I6QA 3UJ9A 1WY7A 1PSDA 5J3JA 4WNIA 3IE1A 1PJRA 5FTMA 2W42A 2OE2A 3ENZA 1HL7A 4NV3A 1A96A 4P5PA 5JSZA 4GEGA 3KDSE 2CJXA 2NVUB 1WMFA 1Q77A 5C8VA 3WGOA 2YXEA 5JVDA 3BJRA 3R23A 3RTEA 3BHMA 1VJ1A 4OK6A 1QAQA 1H22A 1XA3A 2H4JA 1L5ZA 2PJRA 2NU7A 1QIIA 1FTSA 2G67A 2UVPA 1RYBA 2JFFA 4K46A 3VKFA 3KQUA 4L08A 3WIEA 3G5MA 1SBZA 1EFDN 2GS9A 1IRXA 2KJQA 3GV0A 3IIIA 4Y0AA 4KZPA 1RJWA 2BFCA 2CNDA 4HRVA 4QYMA 2C2XA 1YMVA 3E3OA 1OILA 4NS4A 4Q1BA 4PY2A 3SYLA 5KO2A 3A1SA 2BONA 3RO7A 1YS9A 3TBKA 5EPEA 1NMQA 2B30A 3UHAA 1Q1NA 3B38A 3D3WB 3EZLA 1HNXB 1WSAA 2GAOA 1G0OA 3DVRX 2VATA 1JFFA 3TLAA 1I51A 3SYKA 2Y2UA 4WLUA 5IF9A 3K1TA 3K8ZA 4D8XA 5JNSA 2V9PA 3I92A 4F97A 1LX6A 3B2QA 1Q44A 3COPA 1YV9A 2P2CA 2ZZNA 3IGFA 4JZKA 4KTVE 1JLMA 3FOBA 3CGGA 5DI3B 3LBHA 3EOAI 3OEED 3JD1A 4NZNA 5G02A 4J9UE 1SB8A 5DLQC 3G2IA 7MHTA 1GTG1 4R9SA 1N5IA 4PS1A 2XA2A 3I4LA 3ONEA 4HLQB 4EABA 3PFGA 4Z6KA 5EHZA 3UPTA 2EWWA 1UJ4A 3RRBA 3TR5A 2JAHA 3ILVA 1SBNE 2PX2A 3I8XA 3L1IA 1KO7A 1RLIA 2ZIWB 3A1FA 3PHBE 3ROTA 3O4GA 4YUYA 2XYQA 3BD8A 4XOUA 2UU9B 5B3LA 1QH9A 5DCYA 1FJXA 4DR1B 3CNEA 1CUEA 3QZUA 1Z7YA 4M7WA 3OA2A 3HNRA 3P2YA 2GH1A 2QSJA 3QF4A 3QYAA 3WA7A 1UM9A 2AX3A 3BXFA 3G2PA 2IV3A 4BXOB 4YRLA 4DA4A 3E70C 2A7XA 1BWPA 1RVV1 5J2TB 3GEEA 1UUFA 4OAOA 1ZOPA 4LBYA 4LXUA 1A8HA 3V1YA 1IM8A 4NMXB 5DNVA 5IAGA 3RYFA 1DCFA 4BC0A 4BEBA 3L7OA 4NKRA 3DLHA 3SEZA 2P4EA 2XMBA 3A1UA 3GJZA 3N53A 1AJEA 2JBHA 3H2JA 2O5VA 4HFMA 1GZHB 2DPMA 4ZHSA 3ZDBA 5G4KA 1J5XA 1NMXA 3VHXB 1HDZA 2E6KA 4CKEB 2M1XA 5DKFA 3TLBA 2ZZMA 5A4AA 3RF7A 4NBRA 4C04A 3BM5A 4UVHA 3ZXYA 2Y0BA 1GQSA 1EDDA 1SCUB 1WXXA 4H18A 3DHEA 4QAQA 5DSZA 1CUZA 2JH9A 3NM5A 4RYLA 3OMLA 4DCMA 5CVTA 1LPNA 4YAGA 3QEBZ 3EXHA 4XJSA 3I9OA 1EX1A 1TM2A 1N0IA 5BOSA 3UGKA 1AS3A 2QT9A 2CK3D 4P81A 1Q7EA 5BSHA 2ZRNA 1W581 1WQ3A 2EZ4A 2MOKA 3I01M 4OGWA 1Y4AE 4QGGA 3CPEA 2JVJA 3WMFA 1FBNA 2PT9A 3O8RA 1TQHA 2P67A 3CIFA 2OZPA 3HDTA 3R0XA 5JJCA 5KQMA 1GDTA 3DFZA 3LSTA 4MW0A 1F8YA 1Y8AA 1KA9H 1WMSA 4LRQA 3VR4D 4E5DA 5CBPA 3AF3A 4NEGA 3RRZA 4AKEA 2J87A 4ARUA 1CJUC 2EFCB 2NTYC 2V6BA 1VLVA 1J09A 4JQOA 1QRTA 5DNAA 5GV7A 1G20A 2HU5A 2Q9AA 1ZWLA 1OXBB 3AJAA 3K2BA 1XF9A 3KXPA 3NT4A 3B1YA 4O4HF 5FUVA 2WJAA 1SQ5A 4HADA 4DJTA 2QRJA 4E4TA 2C9YA 2ZUDA 3MFQA 4IIFA 3HLYA 1EVIA 3OZTA 1RXUA 4GOLD 3CKKA 1NN3A 2L18A 1E98A 5DW0A 4EYOA 5FPPA 2ZXUA 3TTVA 4IXWA 2J4CA 1P29A 1N1GA 1UKYA 3GLVA 4IX1A 4DW8A 1XRQA 2H5LA 4YMUA 3L02A 1ESEA 5JNUA 2MMGA 1G7TA 1PVDA 4KQ6A 1JE1A 1UKBA 5JCOC 5CJ2A 3AVPA 2E0IA 4HNHA 5AKXA 3TSWA 1D2RA 3KB2A 5GTDA 4FUTA 1GPH1 2IYSA 3STHA 1F3OA 3HB5X 4QU8A 4BP1A 1J9EA 4UFPA 2PR2A 2HGSA 3V2IA 1WG8A 3QKSA 5EP1A 3H9QA 1ZMRA 3LVFO 2YFHA 2BP7B 2UYQA 4IWXA 5I8PA 4ERNA 3ZE7A 3GUVA 3TGPA 1C3VA 3Q1LA 4LYEA 4EVIA 4BQNA 4YJGB 1XZQA 4BMOB 2O9JA 2R87A 3GLFA 3TM4A 4OGLA 3NANA 3C0KA 4M6WB 4AO7A 1K68A 3RS9A 2E5LB 5SV2A 2NW6A 3ELWA 2DR2A 5IKPA 4XFKA 4ZU6X 2ACVA 1WV1A 1BW9B 4OAPA 1HDEA 2O3UA 2H48A 1Y42X 3AY7A 3HFJA 3E2IA 3E5NA 6YASA 1T0BA 1UT6A 4JJ4A 5B2FA 1P2SA 3C8UA 4RPGA 1U0RA 4YH1A 1PGQA 2BGMA 4LX0A 4LZWA 3SF8B 4YJ2F 3W8RA 1XDGA 5FPHA 4RDXA 4UM8B 4IUCS 5JFTA 2HSEA 3G5LA 1QRDA 2D7JA 2OPBA 5DGHA 3IRUA 4ES6A 2NSYA 4JA0A 3QEAZ 4MITA 4KYVA 1X19A 2NAPA 2YXNA 4E32A 3GJ4A 1EE2A 1L5YA 1SH7A 2FPGB 4JLWA 1IXZA 2AOXA 3CCCA 1XK6A 4CMKA 4YCJA 4I55A 1ORVA 3HRHA 5F2OA 1FE8A 2Q2WA