5HCNA

Gpn-loop gtpase npa3 in complex with gmppcp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
253
Chain Sequence
SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of GPN-Loop GTPase Npa3 and Implications for RNA Polymerase II Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords GPN-loop GTPase 1
total genus 95
structure length 253
sequence length 259
ec nomenclature ec 3.6.5.-:
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hcnA00
2V7QA 5FUYA 4HLUC 2ZEJA 2C95A 1A2BA 4JLPA 4JVMA 4C0QC 1P3JA 2IHBA 3PEYA 4B3XA 3TRFA 4PPFA 1XJ0A 1JXOA 2R6FA 2YOFA 4HB3A 2ZI5A 3W8NA 3CZPA 2YZ2A 1S3SA 5LD2B 4Q4AB 2IYSA 2VHTA 2W6JA 1MO5A 2GK6A 1TL7C 2WKPA 1D9ZA 3OIVA 4A9AA 1GG2A 1IBRA 1KO8A 3CH4B 5KSYA 2ZRKA 1YZKA 3DKPA 4JL8A 1E9RA 3LY5A 1BOFA 1Q1BA 1N3BA 4BEBA 3NBXX 3U6KA 2MSEB 2F9LA 2WPDA 5K8LA 1OW3B 5TDHA 6Q21A 5C4MA 4BFZA 4IDNA 4A82A 4TQUS 1TPZA 3GFPA 1JR3E 5JRZA 1QVRA 1N5LA 4EPRA 2AFHE 2OE2A 3BB4A 3K53A 2VLIA 4POAA 3VKWA 3KZ1E 4MQBA 1NN5A 1HQYE 1HUQA 4IEIA 3W6NA 2B92A 2QRZA 1XEWX 2FOLA 1HURA 1L2TA 2ZR0A 4UNQA 4KXFB 3U61B 1GFIA 3PQCA 3AF4A 2ZANA 4IDHA 4U5XA 1TTTA 3I92A 2WTUA 4GZLA 4WIAA 1E0JA 5G41A 5CDFA 3NVAA 2A5FA 2A2ZA 2V54A 3WNCA 1D8TA 2WMOB 1VTKA 4ARZA 1OIVA 3OHMA 4RD3A 4PHGA 2O8EB 3RRYA 3DL0A 3VAAA 1TU4A 2ZRFA 4LI0A 4Q1EA 5FBLB 1HT1E 4LV6A 4LJ5A 4UQOA 3UXMA 5L3QA 3I5XA 2IYWA 2WVJA 2ZYVX 3DOFA 4Q18A 5AUPB 2ZJ5A 5KTYA 3PG5A 2QP9X 2O8BB 3LXXA 3X1DA 3VKGA 3OEHA 3LBIA 1SVOA 3B5JA 1BKDR 1G8FA 4IKEA 2A5GA 2VF7A 4QHTA 3L43A 5KOYA 1XTIA 2HF9A 1XF9A 5HCNA 3OE7D 2O8DA 2WJGA 1YE8A 2A9KA 4AYTA 3PXGA 3OIYA 4E03A 4GP7A 4BASA 3WYFA 4W5JA 1Z07A 2GTPA 4URWR 4A2PA 2IYYA 5JI2E 1OSNA 2EFDB 4JLDA 1ESMA 4AD8A 1KI6A 4AWXA 1AKYA 3PUVA 3AUXA 4EFMA 2P67A 4LJ8A 2W00A 3QUSA 4IOJA 3QSYA 1ZD9A 1A4RA 1P61B 4TLDA 3D3QA 3RHFA 1GL6A 5BQ5A 4LUCA 1NL3A 2FSFA 5CK5A 3TMKA 3WRXC 3H1TA 3GEHA 3FDIA 1ZP6A 5KSPA 1E0AA 1CS4C 1JR3A 2J59A 1CKEA 2VL7A 5EZ6B 4EJSC 2JLSA 1VCIA 2C77A 4HB2A 5TXGA 5DGXA 3B13B 3BK7A 1S9DA 1KMHA 1GM5A 2CK3D 3ASZA 2QT0A 1GSIA 2F9MA 3C5CA 3R7WA 5GJBA 4FMDF 2V9PA 2DFKB 3FMIA 1JAIA 2ZI3A 3AF2A 4OI4A 3THXA 1WCV1 3KJHA 4QOSA 3C41J 5DNYB 3PVSA 1HT2E 2BJVA 1NNEA 3A4NA 1FTNA 4EUNA 1U2RA 1P5ZB 4TQ9A 4B3BA 1CXZA 1XXHA 4W5WA 1CR4A 4PHTA 2HLDA 2VP2A 4BECA 3OEED 4Q4LA 3WBKA 5GADl 2I4IA 3ZDQA 1P72A 1E98A 2XTNA 3WMFA 3B1YA 2IWHA 4KYUA 4H9GA 1F2TA 4RKFA 3TAHA 2DWQA 2LCFA 3WYGA 1HEIA 2W58A 4LHWA 4Q66C 5JEDA 4FN5A 4ZCLA 1DPFA 2QT1A 3L8ZA 2RH5A 1A5TA 4DIDA 4BZXA 3KQNA 2FV8A 4JLVA 5FH9A 4QXAA 4JLKA 1JPNA 4KFSA 4BFWA 4FMBB 4WW0A 3PUYA 1A82A 3B9QA 3PCRB 3KKQA 3D6TB 3NBFA 1N6LA 1PJRA 2EFGA 4RD0A 2NZJA 1E96A 5IRCD 4Q4HA 3OFNA 1JPJA 1D2NA 2RGDA 2ZS9A 1AZSC 4QGGA 1P9NA 2LKCA 1W36C 4NP6A 4OI0A 5EQTA 5H8WA 2GEDA 3EARA 1KI9A 2JIZD 2QTHA 3ZQ6A 3MUFA 2CE7A 5B64A 4C4PA 2Q9BA 2WKRA 4AKEA 1FMJA 3P27A 1E1RD 1MV5A 1G5PA 2QA5A 3B9PA 4LV5B 4KSBA 1EWQA 1KSHA 4B47A 3OIUA 4F38A 2WJHA 2ZYWX 2OXRA 1TMKA 4ON9A 4NL4H 4M8NE 1WB9A 3T1VA 5KDOA 1S0UA 2CXXA 2BIFA 4A36A 1AIPA 2YOHA 4AY2A 3W9YA 4A2WA 4EFNA 4B44A 1CJTC 4HZUA 3R7WB 1NJGA 2BKUA 1R0XA 2XJ4A 2OFXA 1XBTA 5FL3A 4KBFA 1ODFA 1LNZA 2FGKA 3K9GA 3T34A 2J7PD 4G5RA 2QPTA 2ZJZA 5E4FA 4B6FA 1U90A 1W2HA 2O0KA 2ZS7A 3QXJA 4KHZA 2AD5A 1DE0A 2GBLC 2IEYA 2R6AA 1E2EA 2REOA 3PEUA 4CDGA 5K8IA 3FE2A 5IHPA 3RYTC 1OE0A 4MKHA 3SQXA 5KPJA 3NWJA 3SFZA 2B8TA 1N25A 1W4CA 3LQQA 1E2MA 2RCNA 1G18A 1QHIA 3S1AB 2Z5FA 2LWIA 3DO6A 5TARA 1BO6A 5J4HA 2UZIR 5FI0B 4A6PA 1YZGA 5HPYB 1J8MF 2VSFA 2ZI7A 1H8EA 2F7SA 1DO0A 3MFYA 3TSZA 2LKDA 3ICEA 1E2DA 1G7TA 4C2TA 3QENA 4OJQA 3RS2A 1S9HA 2REXB 2GF9A 2WJYA 4CF7A 4PSAA 1YVDA 5JMTA 1ETUA 3FYHA 1X8LA 2B8WA 2FFQA 1TQ2A 1W4AA 4Q4JA 3UK6A 4B3CA 1QRAA 2RMKA 4CW7A 2D06A 4EIWA 2FEMA 5IF9A 2BVNA 3DEFA 3CNLA 3QXHA 3ADCA 2AD1A 2H5EA 4WOPA 1J8YF 1SZPA 4B33A 4KCGA 2QNRA 4WXPA 1NIJA 1NBMA 2GEUA 2OXCA 2FA9A 2X77A 2D2FA 3EZ6A 1E69A 5F2EA 4WVFA 4P31A 1Q1EA 3NHBA 1OPXA 1ZAKA 4C7OB 3VHXA 1GRNA 2QAJA 2Q21A 1OJLA 1KTVA 1W4RA 4DSUA 1CR2A 4D4LA 3CX7A 4PAOA 5AUNB 1NVUQ 2OCYC 1EFTA 2RGEA 5JJIA 4LHYA 3GQBA 4V0MA 3QPVA 4DUGA 2IUUA 3V4RA 3RRNA 3QVVA 4J0QA 1AQUA 3AVTA 4RD6A 3VNUA 1WRBA 2VSXA 2WIBA 1F5NA 3RVBA 3GLHB 4US0R 4NYMR 4Q02A 4A1FA 5KSOA 2XGJA 1KJZA 2HLDD 5IK2A 1W4BA 2H7VA 4IW3B 4A15A 3THYB 3KB2A 1R8SA 2A78A 3K0SA 2B6HA 1M2OB 1K6MA 2Y8EA 1T0HB 1G8HA 3AF3A 2BCGY 3KQUA 1R6BX 2F43B 2EVWX 3B6EA 4DCVA 2RGBA 1DO2A 4A8JC 2E1RA 1BYIA 2W6IA 4PTLA 1SVLA 2IWRA 2WV9A 2J0UB 1QHGA 1IXRC 1Z2CA 2C03A 1XMSA 3PUXA 3VFDA 2QRNA 5HZHA 2D7CA 1QHXA 2WWIA 1GUAA 3QBTA 3FHCB 3F3YA 1UDWA 4PPQA 3MRSA 4AG5A 4Q9KA 3I3SR 5KNCA 1OLOA 4Q1DA 1WBBA 3EC2A 2ZITA 1NMYA 5LB4A 4M1TA 4LHVA 1OYWA 3QKTA 1M34E 2GVZC 4C0BA 2HT1A 3B60A 4HAZA 1NN1A 2CBZA 2DFNA 5BN4A 1IQPA 3DM9B 1KK1A 3Q7QA 3WMEA 2B21A 2IS1A 3K0FA 1FX0A 1U8ZA 5J4KA 4MITA 2HXSA 2QAGB 3OEHD 3KQHA 1D2MA 3THYA 1XZPA 4L9SA 1YR8A 2ODNA 3IBYA 1XXHE 2FE4A 4QBHA 2QMOA 2J5XA 1XEFA 4Q7MB 2VP9A 3FKSA 2FN4A 4BFTA 1I4TD 1Z28A 3BERA 1YHNA 4GZMA 2EWVA 3SE0A 3Q5EA 4PZLA 5E7MA 2TMKA 1I4DD 1KSFX 2P5SA 2FMXA 2VF8A 4NMMA 3RRZA 1FOEB 3DOEA 5L3RA 2IT1A 5DN6A 1KSGA 2ZREA 5BYJA 2Z83A 3PEVA 4LYJA 4TT3A 3SR0A 3BS4A 1Z06A 2AXNA 3BORA 4LC0A 1Q21A 4PR0A 4ERNA 3B2EA 3LD9A 2BHRA 5LDDC 1TEXA 1W0JD 4M22A 3IDQA 4LV8B 1UBCA 2GCOA 2EU8A 4LGMA 5JLJA 3UWKA 4LX0A 5JWHA 3A1WA 4QC2A 2I1VB 1G9XA 3FKQA 4CEIB 4XVQA 1X6VA 2ZSFA 5KDLA 4P3YA 3W90A 3TVDA 4LHXA 2CHQA 4ESVA 3BJIC 1PV4A 4DB2A 4LHZA 4LJYA 4DCUA 4MYTA 4OHVA 4D26A 3SNHA 1KK3A 2V4ZA 1HA3A 4OK5A 2VQSA 2ZVQX 1G8YA 3CONA 4ASUA 3D7MA 1KGDA 2BBSA 1TQDA 1U94A 2FFAA 4KAXA 1WA5A 2GZDA 1F48A 2ZRIA 4RCZA 1EXMA 5JS8A 3AVUA 1DADA 1FP7A 5FOVA 2X8AA 5JRJA 1Z2AA 4OQLA 3VHLB 1XMIA 4B32A 1NY5A 1SXJB 1GTVA 2C9YA 2J0UA 2VP5A 3OZXA 5SZHB 4PQYA 5BXQC 1E0KA 1OF1A 2Q6TA 3GJ6A 2Z0MA 4LCBA 3NBYC 5FPTA 5JECA 3NH9A 2C04A 2GHIA 2WSSD 2XNDA 3UG6A 4ZDIA 3GJXC 3CR7A 1EESA 1IONA 1DS6A 2I3BA 3WNBA 1CIPA 1MOZA 4JLOA 4D2IA 1Z0FA 1SVIA 2ZXUA 1RVDA 2A5YB 1ZCAA 2L0XA 2P6NA 4DIEA 1Z6GA 3X1WA 5JCPA 1N6OA 1D5CA 1CJUC 3LW8A 4UXHA 1E4VA 4NYJR 2WMNB 1I4LD 4LYAA 2RGGA 4ESHA 1Z5ZA 3BGWA 2GCPA 1ZNYA 1Q1ZA 3QXCA 4ZIRB 2E87A 4TLAA 3B1ZA 1F2UA 3BC1A 3QE0A 4JMPA 3CUEF 2DCUA 5EP3A 1K8RA 4CEJB 2FSGA 1ZIOA 1UKYA 3OAAA 3PIRA 5EE1A 5FUVA 5DI3B 4TMWA 4B74A 1Z22A 3CF2A 1FMLA 1SVSA 3GP8A 3LRPA 1OXXK 1CTQA 1T3LA 4V0ME 1R0ZA 3CWQA 3QEOA 1KO4A 3W3AA 4JYCA 3K9NA 2G0TA 4M53A 4B48A 4Y0VA 4UXJA 1S96A 2ZRDA 3UWOA 3TK1A 4QL3A 4KYIB 2XOKA 4UXIA 1L4UA 4MRVA 1RRGA 2ZI9A 4YC7A 4DDVA 3VQTA 1ONBA 4LJ9A 4WZAE 4RKEA 5DIFA 5BN5A 5BYKA 3CIOA 3UMSA 3K70C 4KFTA 1XRJA 3X1XA 1KZ7B 4CEHB 4GSYA 3QKSB 3BXZA 5FTJA 3AKDA 4DSOA 1U9IA 1J70A 3RABA 2O52A 1W2GA 3TIFA 1N5KA 3O8DA 4QNRA 4S2EA 1R8QA 3MWJA 5ELXA 4CT4B 2ZU0C 1ZNWA 5DI3A 2QQEA 1E94E 2ZYUX 2ASEA 4LBVA 1NJFA 4HLCA 4MYUA 3ZVMA 2JDIA 1W46A 4QBIA 2O8FB 1G3MA 1QHYA 2UZ3A 5SZJA 4B43A 3U4QA 2QZ4A 2HT6A 2ZI6A 2BM0A 3K0EA 3DVLA 2QBYB 1QHHA 1EFCA 4F7WA 4M9QA 3KXIA 5J47A 3BE4A 4ZO4A 1XXHB 2V3CC 5SZIA 1C9KA 1E2KA 1DAKA 3AP3A 4OHWA 3GD7A 4NTZA 3THWA 2GCNA 1T3HA 3E5HA 3E2IA 3QOFA 1T9HA 3B78A 4NU0A 4LJAA 3VR5A 4E09A 2QGZA 1T8UA 3EX7C 5AJVB 5DN6D 4XIGS 2IF0A 2QPOA 5IDVA 4X8HA 2A7QA 3KTAB 1X8JA 5JS7A 1G3QA 3HU3A 4A0GA 1JECA 5J4VA 1GILA 2GNOA 1KO7A 1P6XA 3Q72A 4HLDA 2ZIAA 3VMFA 2WWFA 3VR6A 3L0PA 1IY2A 1UDXA 1CEEA 3EZ7A 3U3KA 1N5IA 1UKEA 1Z08A 1Z0DA 3FTQA 4HZIA 2H18A 4C0LA 2QORA 4AKHA 2W0MA 4PSKA 1Q57A 5GVRA 4BFUA 3U6BA 3UG7A 1PUIA 3WMGA 4MDEA 3M6AA 1IN8A 1G64A 1XB2A 3M0EA 5LD2C 5EE5B 3QIAA 1NVWQ 4XVUA 3HPRA 3SYKA 1ZM7A 1ZNXA 3ZJYA 1AK2A 3K09A 2IYVA 2FSHA 3CX8A 5FBVB 2WWYA 5F3WB 1YU9A 2WIAA 3U7GA 5A4JA 1F2UB 4IVRA 1M8PA 3BH6A 1CRPA 3EIQA 4Z51A 5E3HA 3TR5A 1KJWA 3TSOA 1KAGA 1CJVC 1NY6A 1JJVA 4FD2A 4O25A 5FL7D 4BLOA 1CJKC 4M9ZA 2YINC 1Q3TA 1T4GA 2BBTA 2GEVA 2VP4A 4BFYA 4EJSA 1TF2A 3RSLA 2JJ1A 4TLCA 3EZ2A 4B2PA 2EYUA 4TWZA 2O8BA 4TZ6A 3B7GA 4PANA 2VO1A 2NQ2C 1XD2B 2QAGA 4XJXA 3X1YA 1XDBA 3ZH9B 1N6IA 1U8AA 2OILA 2P2LA 1FP6A 2X2EA 3BAFA 4IDQA 3FOZA 1G4AE 4TTPA 3LLMA 2PJRA 2KB0A 3AP2A 4I99A 4IRUB 3AEZA 4C0AC 1OB2A 2VP6A 4PC7A 1BS1A 2P6UA 3EA0A 4DDWA 3AP1A 1SKQA 1TQ6A 3ND8A 1US8A 4BE7B 4DLVA 1RRFA 2IF2A 2QQ0A 4PX9A 3OFND 1E9EA 3PJRA 3GJ0A 3FFBA 3QQ5A 4AK9A 5DSZA 2OFOA 4EDHA 3CO5A 1S1CA 3U44A 1XTQA 1H8HD 3QJYA 2QMUA 3VR3A 1O3YA 4DLXA 4JKYA 3BIFA 1VCOA 3KQLA 5HE8A 4GT1A 2CVHA 1TX4B 4EPTA 4CEIA 1HQCA 2PLRA 5CYOA 3PFIA 1AA9A 1VG0B 4Q7JB 4BRUA 1T5IA 1NRJB 4US1R 2WJJA 1XP8A 3BD9A 3KJIA 4GRAA 4LBWA 2FEOA 4DLTA 4R2HA 1KAOA 3TKLA 3K8YA 4TLBA 2JLYA 1QHNA 1Q44A 3EPJA 4LBYA 3V4FA 1S8FA 1II8B 2OFWA 2R44A 1FW6A 2MSDB 1SHZA 3RWOA 1OHHD 4NYIQ 4BPBA 4Q03A 5GJVC 3LVRE 1IN7A 3ONWA 4BLPA 2YWHA 3ADDA 2QEQA 3ZZ0A 1Q3HA 1N0VC 2CCKA 1AN0A 4M2LA 2D62A 4TLEA 1AZTA 2IYZA 2AWOA 5CM8B 1NLZA 1FNMA 1KI3A 3LDAA 2E9SA 2G1JA 4TMVA 1KZGB 4TL7A 2V6IA 2FZLA 4C30A 2XNSA 3K0FB 2ATXA 3K09C 3OESA 2FNAA 4N0DA 3FMFA 4GP6A 2O8EA 5L8VA 2HYIC 4WZBE 3MWKA 4KV9A 1SGWA 1SKYE 2IEZA 2PZFA 2VPPA 3BBPA 2WKQA 1EFHA 1V43A 2XB2A 4WAUA 1IJEA 5FI1B 1W0KD 2X19A 3UATA 4DSNA 1KKMA 1QHHB 1FUKA 4V0LA 4TTRA 2FPMA 1RIFA 1N0UA 2JEOA 1CULC 2OAP1 3ZVRA 2OG2A 4CIDA 2H16A 1S4QA 1KI2A 2ZE5A 2BJWA 3CF0A 4KFRA 2MSCB 1XPOA 1E2GA 2IBMA 4TZ0A 3SHFA 4DEXA 1GIAA 4IDOA 4BFSA 4IXNA 3THOA 3CX6A 5CK4A 1RRPA 1IY0A 3F8TA 2YJTD 4C9BA 4DWJA 3AVYA 4ABYA 1O87A 5FPKA 1ESNA 2GETA 1EGAA 2DR3A 2OT3B 4Q19A 3IQWA 5H1YA 3TNFA 1OIWA 1LS6A 521PA 3P4YA 4OQXA 3SFVA 1RYFA 1XMJA 2J3EA 3CNNA 3IO3A 5FPSA 2G83A 1WE2A 5CLLA 2NIPA 4Q48A 4PO8A 1GKIA 4LWZA 1WQ1R 1ZYUA 3RANA 4JT2A 2BKEA 4DLSA 1Z0IA 2XOKD 3AVWA 3D8BA 3OAAD 1JI0A 1M7GA 5L3SB 4FINA 1II8A 3BOSA 1OYYA 1AQYA 3KFXA 3SYNA 4DB4A 3T1QA 3AKCA 1PLJA 1OXSC 4PAMA 4Q4AA 5LBIA 1BMFA 3SQWA 1NP6A 1UEJA 1N6PA 1QF9A 3IEUA 4TN1A 2ZRAA 2PCJA 3F0TA 2F1HA 1YR6A 3TR0A 2HF8A 5IK2D 1G6OA 3MSXA 4BGDA 3IHLA 1N6HA 1VIAA 4R7ZA 3GFOA 4BZPA 1W47A 1MO6A 3M1IA 4AYWA 2ONKA 1P7CA 3ZVNA 1FQKA 1N6NA 4YLGA 2CCGA 3T35A 4DUGD 4GMXA 3A1UA 3K1JA 3CKLA 2IUSA 4EFLA 4D6PA 1VCMA 2BMJA 1RFLA 1OT3A 4KU4A 2AK2A 1HH4A 1US8B 2OSBA 1E9SA 3BFKA 3TUIC 4YQFA 4IEEA 1XCGB 3CM0A 4HYYA 3AVXA 1DBSA 2OLJA 3O8CA 1YZTA 1ZCBA 2BC9A 3NKVA 3L2OB 5LPNA 3HP1A 3FWYA 1EG7A 1ELOA 2CNWA 4KFUA 2KWIA 3ADKA 3KX2A 2XXAB 2F3RA 2F1IA 1KK2A 3LX8A 3UMRA 4HAWA 3QPUA 5E7JA 3QF4A 4A2QA 4C0KA 1XTSA 4YXWD 1RC8A 1KI7A 1KK0A 3QI2A 4K81B 4O0MA 5DH9A 3ZVLA 1DG3A 4OL0A 3AVOA 2FZ4A 3FKSD 3SZRA 1G5TA 3EC1A 2GILA 1A7JA 3FB4A 4B6EA 4N3NA 3ADBA 2NZ8A 4TMXA 2VA8A 2XZPA 4ACBA 1MH1A 2H57A 4XVRA 2P0EA 1NIPA 4M9XA 1G6HA 2FDCA 3IEVA 1TQ4A 1RRCA 2HCBA 2QROA 1W0JA 2JLQA 2GCOB 2VYFA 4P33A 3H2YA 2EQBA 1OKKD 4GMDA 3LNCA 4PC1A 5A0FA 3HYRA 1E9FA 2HJGA 4XSGA 4DT1B 1KY3A 1NSFA 4QHSA 2FH5B 3ETLA 2W83A 4OI1A 3CZQA 4TL8A 4AC9A 1M1YE 3EWAA 1VHLA 2XSZD 3QKRB 2VP0A 4M1YA 5HKKA 1W36B 4IVQA 1X3SA 5M04A 4ASUD 1DAHA 4DT1A 2QM8A 221PA 1SKYB 2D2EA 4V0NA 4XD7D 4GDFA 4LJ4A 3U7HB 4F91B 2WM9B 2W2VA 4HATA 2X2FA 4G01B 4DEYA 1VCNA 1FPMA 1G21E 1R5NA 2HEIA 3B1WA 5KDDA 2ZJ2A 4NCKA 4KLNA 3QVUA 4G1UC 2DWOA 1OXTA 2R62A 4NCHA 4TYQA 5L3QB 1FQJA 1NG9A 5FOUA 1KI4A 1P75A 1VIYA 1GDDA 1QG4A 1SXJC 1XD2A 4N0EA 5J40A 3GJ7A 3Q7PA 3KXLA 4E5UA 1CBUA 1U99A 3Q9LA 3OIWA 3ZQJA 2OZEA 5EXXA 3D31A 1OFHA 1TU3A 3CPHA 4NYMQ 1ZU4A 4BUJA 4EJSB 2DYKA 1VYVA 4F4JA 5JJKA 1E9BA 2QP4A 2GKSA 3DM5A 3A1VA 5EP2A 3C8UA 5EXSA 5TMPA 4OHYA 1XJCA 2A5JA 1XX6A 1JAHA 1ZM2A 1KDTA 4U02A 2VH5R 3LO5A 1R2QA 1VDZA 4X8OA 3AKEA 1TUEA 3DKVA 5EUMA 1H8HA 2F43A 3T1TA 5C1BA 2F55A 1L4YA 3AQ4A 3IIKA 2IXGA 2OBMA 2ZROA 4QGHA 1UF9A 2CLSA 2R8RA 5AJWA 1Z63A 3TUZC 1JXMA 2Q9CA 2ZUDA 2XAUA 3I1FA 2BDTA 3FVQA 3U3OA 1YR7A 3BFXA 4QM7A 1FNNA 2PMKA 2NO1A 4R98A 5TY0A 2J41A 4QM6A 2CLCX 4QJ5A 4YMSA 1Z8FA 1ZC3A 1JR6A 2YYZA 4JBXA 3ZGXA 4BFVA 1R10A 3L82B 3UIEA 2CJWA 4PQRA 4U7DA 1C4OA 2W2TA 3CBQA 5FTMA 3JZMA 1NF3A 2ANCA 2ZAOA 4MGIR 5H70A 1KNXA 4XH9B 2OBLA 1P2SA 1Q22A 3A4MA 4E07A 4RY2A 1WDTA 4LY6A 2C99A 1DAGA 1UM8A 4V03A 4HAYA 1ANKA 1G7RA 2OM2A 3GJ5A 1NLFA 2O5VA 3VX4A 2DFLA 2DHRA 3G5UA 3VR2A 5L3SA 1E4YA 1JEDA 1GZSA 4CGZA 4OBEA 2JASA 1S3GA 5ANRB 4B71A 4MGKR 4K8OA 4NHOA 2Q3FA 2JDID 4RJLA 3W5IA 1TNDA 5CJ2A 3KJEA 3AGPA 4A0RA 4HEJA 2BEKA 3EWSA 1E2JA 4OKSA 2ZJYA 4M1OA 1E2NA 3QF4B 1U98A 3A36A 1NVVQ 2QMHA 3ZYCA 3T5GA 2NOAA 3AKYA 2QI9C 2WSMA 4RZXA 2XXAA 1U9IC 4GOXA 4MKGA 4ZI2A 4LC1A 1W5TA 3W6OA 1W1WA 2VSOA 1P73A 1FL9A 3ZS8A 1OH7A 4BLTA 5CYPA 2AWNA 4EPVA 2QUZA 3HPQA 3WP1B 1ZBDA 3K70B 2P3SA 4DLZA 2XX3A 1B23P 4QBFA 1NG1A 4Q1FA 4DCSA 3ICQB 3A4LA 1L7VC 1E2PA 1U81A 2AKAB 3DDCA 3O8RA 2ZJ8A 3VR4A 1G291 4JLAA 5C4GB 4Q9IA 1B0UA 1J90A 4MUAA 3NTUA 3T1OA 3FPAA 4LDJA 1KDRA 1K5DA 2DBYA 1KY2A 4HI0E 1IHUA 3CRRA 1A2KC 8OHMA 1N0WA 3EZ9A 1XPUA 4G5GA 1IOZA 2AX4A 2YWFA 1N6RA 2QMEA 1VYUA 1P4SA 3CR8A 5CDFE 3LBHA 2ZJAA 2GZAA 2DB3A 2PCLA 1NMXA 5BN3A 3WY9A 3ZD6A 4II7A 2BEJA 1G20E 4BFXA 1Q1QA 5FFMA 4KLZA 1GRRA 3U3MA 721PA 3VNVA 3LLUA 2GAAA 4G5QA 3CPEA 5B58C 2VTKA 1GP2A 2IYQA 2GJ9A 3OF5A 3UMFA 4MRNA 4TYYA 4OJKA 2CK3A 1VPLA 2D3WA 2BCJQ 2ZR7A 2GXUA 5FUXA 4Z8XA 1DAEA 3C16C 4YONB 1UAAA 1ZW6A 1IY1A 4OQNA 1NVXQ 3HR8A 4W9MC 1IN6A 3LX5A 5FR1A 1E9DA 4PHFA 1COWD 2CE2X 2CMKA 3M4YA 3R8FA 2QP3A 1TUIA 3TQCA 1G8PA 4ZI3A 1LVGA 3QG1A 3TVTA 2WOOA 2AHOA 4NCJA 4MKIA 2EWWA 3GCGA 4L4UA 2IA5A 5FTLA 3I61A 4FWIB 4FCTA 4CZ2A 2JJ2A 2OLKA 4UNRA 1EWRA 3LA6A 1F6BA 1L8QA 2A30A 5FTKA 2PJZA 2Z43A 2FPLA 3I4LA 1DAIA 4JZKA 1MO4A 5TV2A 4GI7A 2XTZA 3GLGA 3R9WA 3QNUA 4Q9HA 1EK0A 2GBLA 2CLDX 2JATA 2IS4A 1Z6TA 5F9HA 4WBSA 3JZAA 2HUPA 4RZUA 4D4KA 2ODBA 5JHGB 2ZR9A 4DLYA 2N46A 1T3SA 2YV5A 1PUJA 2FU5C 3G82C 4OQMA 4L16A 1LB1B 4DCNA 4IXMA 4L15A 2RGCA 4DLRA 5JI3E 1IXSB 3V9PA 1KOFA 2MMCA 3KL4A 1YRBA 2FX3A 4A8JB 5TVKA 2QAGC 2QE7A 5FPYA 3NXSA 4Z1MD 1U0LA 2PX0A 2JLXA 5KPDA 5EE9A 3KB1A 1SQ5A 4RFSB 1SVKA 2Z4SA 3CF6R 1KYIA 5D3QA 4FCVA 3B8HA 2WJIA 4P32A 4GFDA 4F92B 4YMVA 4HB0A 1MABB 1GRQA 2H17A 2NTYC 3AB3A 1T0JB 2Z6VA 4QGAA 4A0FA 3SOPA 4Q7LA 2R2AA 3W8RA 3HU1A 4DRZA 3GLIB 3A6PC 2YOGA 3IGFA 3KFVA 2XSZA 2FG5A 3HYTA 4D80A 2OO7A 4JVSB 4ZDJA 1E1QD 3GLFB 2C2HA 2NO0A 3L0IB 4QRHA 1VKJA 4UNSA 2G0NA 4HDOB 1AM4D 1TAGA 2PLFA 1PZNA 1RPZA 2IYXA 2J7PA 3NEJA 4DKXA 1FX0B 4BLQA 2C9OA 2V55B 3IILA 3Q5DA 2C78A 1LY1A 3IKJA 4B3FX 2GESA 3MG9A 3FGNA 3GLFA 1G7SA 1EX6A 4C0SA 5HR5A 3W6PA 1E9AA 2KBFA 3N70A 3P1JA 1YJ5A 3I5YA 4RD2A 1G4UR 1VHTA 5HKKD 2OAQ1 3K70D 3H86A 2UVQA 4Q4JB 3KUDA 1CR1A 1VG9B 4DJTA 1XPRA 1XJQA 4MRPA 3VU9A 4FIDA 1W0KA 1BYUA 4LPKA 1MKYA 4I1VA 4WZ6A 4IOMA 3JVVA 1UKZA 3EA5A 4BZQA 5CLQA 1JQLB 4O2RA 2VHCA 3AF1A 4G5SA 4BLRA 2W0SA 2IX3A 4JLJA 1WBDA 4NH0A 3A58B 4D4JA 4A8JA 4PPGA 2NGRA 2ZRPA 1N2CE 3EPKA 4HDQB 4UNPA 4A6XA 1AS2A 3KKMA 1CJMA 5K8TA 3R8CA 1E6CA 3E70C 2QGNA 5FBWB 5EZ5A 3PUZA 1R5OA 2PBRA 1DOAA 3C4JA 1XEWY 4Q01A 2QBYA 4OYHA 3CRQA 2V6JA 1K5GA 4B3DA 2IS6A 4OQFA 2B7BA 3PR1A 2WAXA 2JLWA 1NBMD 2ZRCA 4CRWB 5C46F 1VG1A 2G1KA 2O8FA 4TYPA 3REFA 3WYAA 2NO7A 4I81A 3B1VA 4JKIA 4CYMA 4DDTA 2ZE8A 2V1UA 1E2QA 3CH5A 1S1MA 2QSZA 2QSYA 5CM9C 1RJ9B 2GDJA 2YKGA 4Q1BA 2EW1A 1E3MA 1WP9A 4JJZA 2BM1A 3CRVA 4N1AA 2PEYA 2WWXA 3J81k 2H8KA 1VYTA 4Q5IA 4QNMA 3QXSA 2J9RA 2KSQA 4O3MA 621PA 4XWAA 1PLKA 3W3ZB 4URUR 2ECKA 4UJ5A 3UKDA 3EPLA 2VBCA 4FCWA 4MGZR 3RC8A 2CHVA 3EASA 2GF0A 2PH1A 2X1VA 5AUOB 3PENA 4M9SA 3P20A 1WMSA 2RKOA 3GEIA 2UKDA 2FSIA 3F5FA 1ZJ6A 4TQAA 3AUYA 3MLEA 3I8XA 1ZMXA 2IYRA 3B85A 4JL6A 3RRMA 2Q3MA 3TUJC 2FF7A 2OUKA 1M74A 5JWRA 2IW3A 1F60A 1Q12A 3THWB 4WA7A 5FTNA 1E2HA 4MGYR 1KMQA 1ZU5A 3KUCA 2KI5A 3SU8A 4F93B 2QPAA 1Z3IX 3LH5A 1DTSA 1OFIA 1XTJA 2YC4C 3O47A 4CT5A 1EFUA 1FTSA 2ZUCA 3VU9B 4Q1AA 1E9CA 4B2IA 1N5JA 3UANA 2EFCB 3SDZA 2BMFA 1SHKA 2HYDA 1IN5A 4C0JA 3GJ4A 2JLZA 5FBQB 4QHYA 1CU1A 3U4QB 2JCSA 3PV0A 4TT3D 5EUQB 1UJ2A 5DISB 3FMPB 2XEXA 3H4MA 4XSHA 1G1MA 2QG6A 4HZUB 1VECA 4D0GA 3RS5A 3K0AA 2ZRNA 4YMTA 1AGPA 2CNWD 3EG5A 1AGRA 5CB8A 3CNOA 4QJ3A 2H92A 5FBRB 4R2IA 3S1AA 3R9XA 1RKBA 5HCIA 2RHDA 3ZS9A 5KSZA 2IL1A 1ZD1A 1H8ED 5AWFC 3PITA 3THXB 2YVUA 3HJNA 3QPWA 4Q00A 1H65A 1W44A 2WICA 4LJ7A 2ZRBA 4YXWA 3T15A 1Z29A 4JT4A 4CEHA 4PC6A 3B1XA 3QY0A 4TL9A 1KJYA 1E1QA 1X86B 3E1SA 5AUQA 3GLFE 3IPXA 1LFDB 1UBGA 2C9CA 4IDPA 3K9LA 4URVR 4RFVA 1NI3A 1T91A 2C96A 3IHWA 1WF3A 4LYFA 3ZZUA 1M7BA 4X8LA 5FOTA 5DLQC 1XD8A 1KIMA 2RB4A 1Z0JA 2REBA 4QBGB 4TMZA 2IYUA 3VX3A 1P62B 2CL0X 2O0HA 4IJMA 3BRWD 4XTRA 1IN4A 4B76A 3QF7A 1YZQA 3RS3A 1COWA 2ATVA 4EPWA 4Q9LA 2F3TA 4B73A 2EYQA 3EZFA 4XD7A 5AK0A 4HAUA 4US2R 1E79A 3I73A 4C3ZA 1UFQA 2OBNA 4ITRC 2WAYA 3RS0A 2RGNA 2J0SA 1T8TA 4TMKA 4M1SA 121PA 3FHTA 4NCNA 2A3RA 3C7KA 4M1WA 4KBGA 3AM1A 2W6ID 2G77B 4M1KA 5FOSA 3ZD7A 1XNJA 1U0HC 3BH0A 4NYIR 3GLGB 1F2TB 5F98A 2O8DB 4YDHB 2OV2A 1M7HA 3RAPR 3LV8A 4Q9JA 1G8GA 3Q3JB 5IT5A 1FFHA 5KUTA 3L0SA 2GRJA 4HDCA 4Q4HB 1CP2A 1ZIPA 1Y63A 3NDPA 4NCIA 5E7IA 5EXPA 3SYLA 5H68A 1CF4A 1TF5A 2ZSAA 4P4TA 2NO6A 3EPHA 1YZLA 1UADA 4IFEA 2BMEA 5DHFA 1GKUB 2IK8A 1OXUA 1M6NA 1WXQA 5DYGA 4FMDB 3LVQE 2QE7D 1T5LA 2AL7A 2C8VA 2GA8A 4RZ3A 4ZCIA 1NKTA 1I2DA 3NH6A 1KI1A 1SXJA 4LRWA 5AJYA 1GITA 1KDPA 4AYXA 2GXSA 4F4CA 4I1SA 3MD0A 1AJEA 3SJZA 2QTVB 3L8YA 2KBEA 4E22A 2ZE6A 4U00A 4FMCF 1XZQA 3AVQA 5DE3A 5FR2A 3SJCA 3CWZA 2PL3A 3C14C 4M1MA 4B35A 4DXAA 3NEYA 2OESA 1EX7A 3WRYC 4HSEA 1MR3F 1E1RA 2ZSEA 3BFVA 3DPUA 1QVAA 4K46A 5FOWA 3SJBA 1YR9A 3NC1C 1LF0A 2BMDA 4CVNA 3RSOA 4RVCA 4L8GA 1KMHB 1GWNA 5D3MA 1BH2A 1NKSA 3GMTA 2JA1A 1XEXB 4KVAA 3GLHA 2Q9AA 3LBNA 2ORVA 1R0YA 3RC3A 2G9NA 3TAUA 4PXAA 1DELA 1KHTA 1NBME 1ZM9A 3FHOA 4URXR 2EFEB 3N5CA 4KSCA 3JVUA 4RD4A 4IFBA 5SZKB 2RHMA 5E95A 2CCJA 4HUQB 4AG6A 1KKLA 4MUBA 5G3ZA 2PZEA 2G88A 1G41A 1J7KA 4LJ6A 3DMDA 5JHHB 3MWLA 1NSTA 4YMWA 2ZRLA 3I8SA 3Q8XB 2YWEA 3CB4A 5HTKA 1KI6B 3AGQA 3VTKA 1Y3AA 5KNBA 5F9FA 3AVPA 1JJ7A 2R6DA 2XZLA 1IJFA 1U8YA 1T6NA 2WSSA 4L9WA 3RWMB 4XOIA 4PQFA 1UPTA 1HY3A 2B7CA 4BWYA 2AFIE 1F3OA 2HV8A 2V7QD 3RDPA 2XZOA 1YRAA 3LQRA 2BBWA 4Q7KA 4HB4A 2I1QA 3ND9A 2J46A 3AH8A 2RAPA 1X1SA 1XFAA 2QU8A 4ZKEA 2Z4RA 3CPJB 1CRQA 4TSFD 1OFTA 5CIWA 4Q47A 2H1LA 5KU1A 4P4SA 3U60B 3IIJA 1MT0A 2NPIA 3TH5A 3G0HA 4KJZA 5FUWA 1U0JA 2ZAMA 4A4DA 4GNKA 2G3YA 2BV3A 1GNRA 5P21A 2DWPA 2IXFA 2P5TB 4BEJA 2ZRGA 4H1UA 3GJ8A 4B2LA 1GL7A 1Z6AA 2ZS8A 1LS1A 4NBSA 1RZ3A 3SC3A 4Z8YA 4OK6A 3IO5A 4KODA 3TLXA 4OHXA 3GLIA 1FZQA 2V8OA 4EAQA 1J2JA 3KQKA 4LK2A 2VHUA 1SVMA 1MABA 2NG1A 2XJ9A 2WZQA 1E79D 1XCPA 4TYNA 4GL2A 5J4LA 2JJ1D 3EIEA 3WBJA 4JL5A 1KSJA 4OI2A 3TGPA 3T5DA 2C5LA 2ZRHA 3ZLJA 1NLYA 2P6RA 2GXQA 3EIHA 2ZETA 3SJAA 821PA 3Q85A 4GPTA 3SHWA 4C2UA 5DHAA 4MYCA 1UBFA 4ZPXA 1LV7A 4Y0AA 3AVVA 4JYBA 3GLGE 3MWYW 1Z6XA 3QKUA 2VEDA 4MRRA 2BBOA 4KITB 4MA4A 2YWGA 3MAAC 2ZSBA 1R4AA 2OEPA 4CEJA 2YNMA 3WHLA 5JBQA 4ZCMA 2VHQA 4H1VA 4FW9A 4EPYA 3KJGA 2JJ2D 1XTKA 1E2LA 4DVGA 4TMTA 5K8UA 2CL7X 1W36D 1KO5A 2DY1A 1FUUA 2JLVA 3GJ3A 1ZRHA 3C15C 4G5OA 1DVRA 4F4IA 3NG1A 4IOKA 1OH8A 5FPHA 3RLFA 3HWSA 1RE0A 3AF0A 3QG5A 5KNDA 1G3UA 2CL6X 2ZTSA 3O8BA 3ZZTA 1SXJD 2XB4A 5JJLA 4P4UA 4QGFA 5BWMA 3NDBB 3DHWC 2GVDC 3MJRA 1TF7A 2K5UA 5BW8A 2ZPTX 3ASYA 3TSWA 3OE7A 3TE6A 4UKDA 3SBDA 4M4SA 3TW8B 1GNQA 1HTWA 4JLBA 4GBMA 2W2XA 3QKRA 4TYWA 2ZSDA 4URYR 1DG1G 3A37A 2ZJBA 5J4YA 3LXRA 2PEZA 4TL6A 4B75A 5JSZB 2PT7A 3VKHA 3GFTA 1JR3D 1OHHA 1E2IA 5G3YA 3SBEA 5CJPA 1XTRA 4NPHA 1R5BA 1LW7A 2F1RA 3FMOB 2DFTA 1R7RA 3VR1A 1G5RA 1N6KA 4LSGA 2CEAA 4XTCS 4BLSA 1NN0A 4LZZA 4BQSA 1TADA 3DZDA 4PO9A 3SI7A 3U5ZB 2ZI4A 2GJKA 4PC2A 4XWKA 2QN6A 5C18A 2OCPA 2J1LA 4Z1MA 3KDSE 1AS0A 3NBZC 4FI3C 4O2LA 1IM2A 3IBGA 1E0SA 4LYHA 2QY9A 3GLIE 2OHFA 1KO1A 4KI0A 4V0KA 1Z0AA 1LF5A 2VIIA 5J5CA 4ZDKA 2YC2C 4NE2A 5DYIA 4B34A 1X8KA 1GL9B 3OEEA 1TEVA 4YDSA 3MGCA 2J7KA 2IS2A 2KJQA 2R6CA 1JALA 2ZRJA 1OB5A 1ZC4A 1ZINA 2RGAA 1SVWA 1P9RA 1P2UA 3LW7A 5A5GA 3TW4A 1W49A 2HDNB 2A5DA 4URZR 2AK3A 1W7AA 4HLQB 1CLUA 4JSTA 3A1TA 4Z54A 2GJ8A 5AJXA 4NONA 1JQJC 1OIXA 1XMVA 4I1UA 4V02A 3T61A 4W5HA 5B30A 3P4XA 1D6JA 1EFRD 2FFHA 1G7CA 2IYTA 1ZVQA 2NO9A 2QTFA 3BH7A 3HR7A 4PAQA 1XWIA 5EXTA 3T06B 2GJSA 1ZNZA 4B3GA 1MRSA 4ZV4A 2GAOA 4TSFA 1SULA 2DPXA 2FJUA 1GVNB 5TB5A 3H84A 2FPKA 1YKSA 5FL7A 3EXAA 3TBKA 1QBKC 2YHSA 1Z83A 2ZE7A 1BIFA 3IIMA 2ODEA 3WNDA 4HAVA 5JCZA 3U3RA 4M21A 3A1SA 4R9UC 1Z6YA 1D2EA 4HLUA 4PFSA 1GOTA 4D82A 1HE1C 2JAQA 3C5HA 5CITA 2WBLC 4PC3A 1OV4A 3DZ8A 1BMFD 2PMDA 4M0LA 4QJ4A 5UKDA 1OH5A 4FXPA 2GK7A 1J99A 2WPDD 2JIZA 3NHAA 4EQ6A 4MKFA 3X1ZA 4IVPA 4PZYA 3KKOA 1NVVR 4LOAA 3WXMA 4D4MA 3P32A 3R20A 2F6RA 4RSGA 2AKYA 2FGJA 2J0QA 2R6GA 2PZGA 4NZYA 4ZIRA 1YZNA 2IUTA 2MMGA 2WOJA 3N2IA 3FFAA 1HYQA 1LTQA 4JVLA 5C2JB 1A1VA 1YZUA 1OFUX 1KNQA 1VMAA 2FWRA 3LWNA 5EE3A 1RJ9A 2J87A 3RS7A 1XU4A 1G17A 2WHXA 5GJCA 4ACAA 4JVNA 1OH6A 5G53C 2BOVA 2CDNA 3I62A 5CB6A 1ZUHA 2ZUBA 4G3XA 4JJKA 3CW2A 3HU2A 1S2MA 1NMZA 1ZD8A 4P0TA 5L3VA 1I2MA 4QFMA 3NC0C 3A8TA 2OCBA 2J45A 4QG7A 4UNNA 3R9IA 1QZXA 3BWDD 1G3RA 2ODWA 3TJZA 4DHEA 4UJ3A 421PA 4NKRA 3IPYA 2PX3A 4G0NA 1Z0KA 2O0JA 2EFHB 4FWTA 3U7FB 1RW4A 1AS3A 1PVOA 2GJAA 3IUYA 2JLUA 5EP1A 3CRW1 4AIIA 1JEEA 1UBEA 1YQTA 4L5BA 3P26A 3AV0B 4RD1A 2WJVA 3ZIAA 4YMUA 3N2EA 1ZM4A 2IHYA 2BWJA 1JNYA 2AN9A 2WWWA 4I1OA 4AI6A 4OHZA 3CRMA 3GPLA 1P9WA 5JFGA 2GXAA 4FMCB 2CJWB 4D81A 4ARZB 2VHJA 3V00A 4HUQA 4HUTA 2G6BA 5EE0A 4Q21A 4EKDA 4DSTA 2GZHA 3BB1A 4DLWA 5CIQA 3KKPA 3SS8A 3QXXA 4GOKA 4JBYA 2ZQ5A 4ZDWA 2W6JD 3U2QA 4QKQA 5D3MB 5JEEA 2QM7A 1XEXA 4I4LA 5HZKA 4AKGA 3ECCA 5B57C 3U3JA 1V5WA 1CR0A 3X2SA 1VG8A 2QL6A 3K0CC 3GEEA 1OKKA 4NYJQ 4X8MA 4IOLA 1C1YA 5GJWC 3REGA 4DBLC 3W34A 5JZVA 3EW9A 4JS0A 1UEIA 3KKNA 2D4HA 2J0VA 3GLHE 2O8CB 2Q3HA 2HCJB 4C0HA 3U44B 1Q0UA 5GVSA 3BB3A 2Q0HA 3NIBA 4JSYA 3WP0A 5KYKA 3QKSA 2JGNA 2F1JA 3KXKA 4BRWA 2CVFA 4D25A 3K9HA 2P65A 3MMPA 5EJEA 1E2FA 3LAWA 3TQFA 2ZM5A 1ZUIA 4D0NA 4LPSA 3RNLA 5B2ZA 2ZU6A 2JLRA 1PLLA 4JBWA 3W5JA 3EAQA 1EFRA 4DC9A 4NDZA 1AKEA 5JWOA 4S35A 3L0OA 4RFSA 2WWHA 5FOXA 2ONJA 4A92A 4EQ6B 5DO9A 3PUWA 3WHKA 3H0KA 1JBKA 4A0HA 1QHSA 2QENA 1QDEA 2C98A 4MDFA 1G3IA 1GAJA 4IHQA 2KE5A 1MRNA 2ZRMA 1II9A 1E32A 4Q1CA 1GNPA 4MYHA 3U7EB 1P2TA 2VRWA 4GOJA 2RGNC 1Z47A 2RGXA 3LFUA 4KO8A 4DZZA 1G19A 3T12A 4PSVA 5G40A 2CHGA 3HDTA 3MCAA 2NMVA 1X1RA 4PPNA 2ANBA 1KI8A 2FFBA 2GWHA 2SHKA 4XWOA 2N1BA 2ERYA 4PHHA 4AKIA 4C7OA 2HJVA 4PO1A 1XCMA 3DMNA 1DEKA 3I72A 1W48A 1UKVY 5AR1A 4ZKDA 1QG2A 5KHOC 1DAFA 2AR7A 1W5SA 1ZUNB 4MRSA 1DARA 4AURA 3IQXA 1IXZA 2IC5A 1E99A 4RZ2A 3SN6A 2ZJOA 2ORIA 3UPUA 2R65A 1II0A 4W7SA 2ZVPX 3PEWA 3QBVA 2V1XA 1HV8A 3MJHA 4R71A 1RYHA 2IYLD 2WWGA 4ILEA 2JJ8A 1KDOA 1NN3A 1OXVA 2N42A 2XITA 4TTQA 1GKYA 2IXEA 1HE8B 4V0OA 2ORWA 5KO2A 5JSZA 4WXRA 3QEJA 2NPFA 2ERXA 3K0CA 3KTAA 4MH0R 5EP4A 1G16A 4OK3A 1P2VA 3B82A 4HAXA 4JIMA 1ZM3A 4DDUA 2ZYTX 2O8CA 2AXPA 4DLUA 4D0LB 3SEAA 4KVGA 2D74A 2XNDD 4PZZA 4DCTA 2PT5A 3K0AB 1JB1A 3CLVA 1SXJE 2XTMA 4JLNA 1R0WA 4LBZA 4P4SB 5DI9A 5HE9A 1XD9A 3I32A 2R9VA 2HXYA 4RCYA 1P60A 3ZIAD 2D7DA 1MO3A 1Q20A 5LB2A 5AJZA 2OCAA 4EPXA 3RS4A 1D9XA 1DAMA 4JLMA 1IAQA
chains in the Genus database with same CATH superfamily
5FUYA 2YWXA 4JCCA 1WMAA 1WMBA 3M1YA 1CY2A 3CZCA 1A2BA 4J16C 4EA7A 5EPOA 1RCTE 3L1JA 1HTTA 4EDFA 5A4IS 3T9CA 3S4YA 2HMTA 1MAHA 1QHEA 1FUIA 3BXGA 4IV0A 1ZJJA 1TJNA 4WGFA 5BUZA 3IA7A 2QN2A 3LL4A 4PSCA 2ZULA 3TFWA 5JTTA 1CYEA 4XASA 4ARAA 5IVKA 4NOKA 1Z4IA 2Q0QA 5AVKA 4H7EA 5ENDA 1XDUA 4KAJA 1IM8A 3ICWA 3OIVA 1AKWA 5FQNA 2EQ5A 2FLVA 4MVJM 1IOLA 3S29A 1U1EA 4J0CA 5KSYA 1DNPA 1PNTA 1U65A 3ENQA 3WB1A 3HB0A 3GFQA 4CKZA 1GEEA 2ZRKA 1T9GR 3DBRB 1QCZA 4MMZB 2PXAA 5EVJA 1E9RA 3E9DA 5HRAA 1RQ7A 4OQPA 1N92A 3ICOA 5CT4A 4BEBA 2E3JA 3DB2A 3JQFA 3NBXX 3U6KA 1YK0A 1MG5A 4YH1A 2WPDA 3BQNB 4MI1A 5K8LA 4JJIA 5DLYA 5TDHA 2BUBA 2Q3DA 3HDQA 3AFGA 3LCJA 3GCWA 2XF2A 4IDNA 4A82A 1F1BA 2NVWA 4TQUS 3W2GA 2F62A 1QVRA 1L7RA 1QIIA 1RPJA 1QDLB 3PBKA 5F77A 4POAA 3VKWA 3R6TA 2Q5FA 4AW9A 1HUQA 3KUUA 3W6NA 3ZKAA 5E1OA 2FOLA 5H80A 3SVTA 4GO1A 3AJRA 1Y42X 3D3WA 4S1WA 4NMWA 4E5MA 4XWYA 2ZR0A 1BQ4A 1BE1A 4UNQA 4CPDA 5K6TA 3U61B 1KZ9A 3RFVA 2PGJA 5FA5A 3DMFA 4U5XA 4N8EA 4ZVQA 4E3WA 3ZJUA 3KFLA 3G5MA 5CDFA 5LSAA 3WV4A 1RIIA 4K6GA 2A5FA 3KEQA 2V54A 5ECDA 1HEYA 3VKFA 4GIBA 3DDOA 2R6ZA 1Y4SA 2ZSUA 1LDMA 2D1YA 1OIVA 4A2CA 4ROSA 1A5ZA 3DYBA 5CVJA 2O8EB 1E1CA 1HL7A 1QIKA 3LX6A 4Q1EA 4LI0A 2Y99A 4R54A 4ZVSA 3PD0A 3SGLA 1XCOA 3FUVA 4G4SO 4PGAA 1OQAA 3DS8A 3EEQA 3TL3A 2W2MA 5JYEA 1GNLA 5HEKA 2WVJA 2C3OA 1NNUA 1SOWA 4Q18A 1X92A 4NBTA 2P1RA 3PG5A 4MS4B 5KTYA 5IUNC 2BTQA 1SOAA 3HABA 3AL3A 3EQ7A 1B2RA 1BE0A 1Z6QA 3B5JA 3H83A 1BKDR 2BEWB 2Q4DA 4G6ZA 2VF7A 1NJ5A 4W1QA 2WJGA 5C8YA 1J2UA 2XQKA 2HQRA 1DJLA 3V6MA 1CCWA 3OIYA 4GP7A 4XQEA 1RCUA 2LUOA 2IYOA 2G1PA 5LQSA 4JEHA 4PSDA 2GPAA 4TWAA 4A2PA 1ECGA 2R1UA 5E6UA 5JI2E 2ODQA 1RP1A 1ECLA 4JLDA 3V8EA 1F8UA 4AD8A 1VXOA 4AWXA 2G36A 4CIYA 1OWLA 4UM9B 1L9XA 1RQRA 3EXIB 3PUVA 2EZ9A 1SQGA 1NE2A 3LFHA 3COSA 2P67A 2GF2A 5PGMA 1JDUA 4IOJA 4DA8A 4JNCA 3HACA 3IDOA 3RRXA 4RZHA 4FZJA 3WKAA 4BO5A 3L06A 4M6WB 2W2KB 2RHRA 4TV9B 1YQXA 2QUHA 2HJSA 2CFOA 4XEHA 3TMKA 2YWJA 4P80A 3VTFA 4RVHA 4MMXB 3FDIA 3DTYA 4CDMA 3KLOA 3G9QA 2BSAA 2CFCA 2C3UA 1MOQA 4ZOLF 2OV8A 1NVFA 3G23A 3IUQA 3R3YA 3E5NA 5DGXA 5K4GA 2WJ6A 4P3XA 5ARBA 4LXUA 3I2JA 3GXBA 2VQFB 3R7WA 2PFSA 3UT6A 3LKVA 3AU8A 2AVNA 4DE5A 1JAIA 4M9RA 1Q50A 2OORC 2ZI3A 3FPHA 3L8FA 4OI4A 3THXA 3MW8A 4QOSA 3C41J 3F3SA 2UYOA 3RIYA 5DNYB 2PUTA 2WT8A 4DV5B 2RGWA 5KQMA 3AM3A 4NFLA 2WSLA 3BAZA 4B80A 3OPYB 4BYGA 5L51A 4PHTA 4QODA 3FSEA 1Z4OA 3EQ8A 2PO7A 3OEED 3WBKA 3IPLA 1P72A 2W6QA 2XTNA 1P7PA 1YONA 4Q3AA 3B1YA 1MGPA 1V3VA 1Z8HA 1Z68A 3OUUA 3H1BA 2YJ3A 3NHZA 4WY5A 3TAHA 3WYGA 4EB6B 1HEIA 5BURA 2W58A 1VFPA 3GMSA 4LHWA 5D51S 3LHFA 1ZZGA 1Z35A 2P40A 2WWVD 5JEDA 1MQAA 1DPFA 1PFYA 3WLQA 1Y7HA 4BNTA 4OUKX 3K9QO 4Q12A 3KQNA 2LTAA 3V1NA 4NZOA 3MCTA 1CUXA 4JLVA 5DX0A 4CBVA 3AFOA 6YASA 1OGYA 1BTOA 1DUVG 1JPNA 3EDYA 4WW0A 4MPRA 3LT2A 1DKUA 4MW9A 4PX2A 4RH1A 4JWKA 3SD7A 4RD0A 3T5PA 4FQ7A 1FSPA 1JLLB 3N2GB 3DPIA 4NBRA 2FMTA 3OFNA 3C97A 1BXGA 1JPJA 2B8NA 4RIEA 1D2NA 3SEFA 2B98A 4AQ7A 2Z5LA 1OI3A 1JG2A 4BVJA 1G38A 1Q2UA 2NU6B 3ACCA 3OLVA 4NP6A 1BA2A 2YIJA 1KOGA 1YS2X 4P22A 1IHOA 1H05A 5EQTA 5HNKA 3DAPA 1LX7A 3DBRA 4BTLA 2O2CA 1QKKA 2ACKA 4QAJA 4C4PA 2WKRA 2IH2A 3GUHA 5CXXA 4RQBA 4UHHA 2D0DA 4GPEA 1FMJA 4FXOA 4KSBA 1UQRA 2X8JA 3TRKA 2FZKA 4GYYA 4MV4A 1UODA 5TGTA 4KGDA 4BZZA 4QPCA 1YB1A 3TFOA 1E3EA 4ON9A 2LR0A 2YFKA 5DCWA 4RFLA 2YV1A 4CV1A 2ZJ3A 1LPNA 3V55A 3F6EX 2A88A 5IJ9A 1WUKS 3T0IA 2NSDA 5A1JA 1D0SA 5JANA 4A36A 1KH3A 2YOHA 4P7FA 1M1YB 5IDWA 4AY2A 4G1EB 3L4BA 2AZTA 3DNFA 4I9HA 4R8KA 4ISBA 3WB0A 2H2AA 3R7WB 3MXTA 3EEBA 5I9MA 1WF6A 1YIAA 2HSZA 3UVEA 2XJ4A 1OR8A 4BX9A 3GRVA 2B37A 1ODFA 1JE0A 4UZEA 1YDEA 2OWDA 5MDHA 4HGOA 2JHGA 3B9BA 4B6FA 1PK7A 1XNGA 2WJZB 4HRYA 2IOFK 4KHZA 4YP0A 3VYRB 1DE0A 1ZHHA 3WL4A 4DCOA 2EEPA 1CHDA 2VUHB 4MWOA 4P86A 2Y6UA 3RS9A 5IHPA 1OE0A 2R7MA 1L4FA 1NHWA 2VUUA 2WY2D 3K72B 4K87A 4X0EA 5KPJA 3SFZA 4XVCA 1N25A 3F5QA 1QFMA 2YQ4A 3GAMA 2KS6A 2AJTA 2PX4A 5JXWA 4P5DA 5JCJA 3S1AB 2J3MA 4HFRA 1YVRA 3DO6A 1QGDA 3KHUA 1SWVA 1NWCA 2ISCA 4QQFA 4DLPA 5K5EA 4H31A 4A6PA 1YZGA 4C5BA 1B41A 1YMVA 2A4MA 2HKIA 2VSFA 2ZI7A 1BW9B 1X7GA 3G9XA 1DO0A 2P9HA 3R3HA 3NGXA 4EO7A 4HC4A 1UXHA 3FG9A 3AR6A 2PX8A 3IBTA 1S9HA 4OJQA 2C7OA 4IXTA 2GF9A 3ENWA 3D4IA 3KM0A 4FEYA 4ZT2A 1XV5A 3SLKA 4BGUA 4B3MB 1O94A 1YOVA 2ASVA 3ZE9A 1SA0B 2Y2VA 3FYHA 3FFTA 3QX7A 2FFQA 1P1BA 1TQ2A 4MVCA 3UK6A 4EIWA 1QRAA 4FLEA 3IHKA 1LPSA 3OKAA 5DM1A 3ZW7A 5ADVA 4DQXA 3FDXA 3ADCA 1XXLA 1GFZA 4Q1VA 4XB2A 1PYDA 1J8YF 5A04A 1CF4A 2PR7A 3TQQA 4DRXB 4K9KA 4I2NA 3OPNA 2QNRA 1OLXB 1JR4A 2Q27A 5T4FA 4DY4A 4QXQA 1PTJA 3OZVA 1DSSG 4RNCA 4ZT6A 2QTWB 4NWIA 2P9CA 1E69A 5F2EA 3L79A 4P31A 1Q1EA 3NHBA 3NRBA 4S1OA 5DHRA 2E89A 1Z7YA 4F7DA 1MG0A 1KU6A 4C4TA 4DSUA 3JZIA 3BDIA 2HBRA 3A4TA 4D4LA 4CLRA 1I2BA 2RGEA 1EFTA 3OZAA 1E92A 5E9WA 4UCFA 2D54A 3DJFA 4V0MA 3QPVA 3CCCA 5SICE 3T54A 2WU0A 2PU7A 1UQUA 3LC0A 4KDRA 3AVTA 4RD6A 5BR1A 4KE6A 3RVBA 2DHEA 1YH3A 4Y9RA 2Z3WA 4QXPA 2WIGA 3DC2A 5DB4A 1TVEA 4A1FA 2XGJA 4QTXA 1PFVA 3WGTA 3QZUA 3GAZA 1KJZA 1ZK2A 1ZKMA 3OQIB 3LZ6A 1W4BA 1X38A 2H7VA 3GA5A 1HFKA 3C6ZA 5D1HA 2BM8A 1NQUA 1QIEA 2A78A 2WA1A 2PJUA 1M2OB 3G1UA 3CG4A 3CS3A 5DCUA 5EHNA 1G8HA 3PFHA 3CLRC 1DC3A 1KYYA 1Y6QA 2BCGY 4UU1A 1I3LA 4DCVA 4DQ0A 1SQ0A 2O7NA 2W6IA 3NQ41 2WV9A 2J0UB 4QE3A 5JASA 2WMYA 2C03A 1Z2CA 4MVXA 1XMSA 1PDWA 2PMCA 4YMIA 4ZRMA 1QHXA 4U39A 1GUAA 4ZV7A 3FHCB 5L6MB 1UDWA 2YRWA 4LVNA 4Q0MA 1OLOA 3T7JA 1OMOA 1IVSA 2RHLA 1V3UA 4Q1DA 2EEZA 3NV7A 4LWQA 2ZKLA 2EG5A 3KE9A 2DSNA 3H5NA 4B45A 5F23A 4LHVA 1V47A 2G08A 1LLQA 1M34E 2GVZC 3I53A 4BMNA 3B60A 3L4SO 4EG4A 2CBZA 4RTPA 3T5CA 3TQOA 3RKSA 3WMEA 2CVPA 2WI8A 2ZUSA 3AUAA 3C6MA 2IS1A 1JHYA 4TKVA 4KQ9A 1ZRSA 1RAAA 2JFQA 2J9GA 4M9UA 1C9MA 3PC3A 3R5TA 2QAGB 3WTCA 3THYA 3OTGA 4KZPA 1XZPA 5TPWB 1U0NA 2PIDA 4QBHA 3IOEA 4INZA 1TYAE 4HNAA 2Z8XA 2CJPA 1LBTA 5J63A 3FKSA 5DW0A 1W85A 5ICCA 2FN4A 1TM1E 2XQGA 1I4TD 1Z28A 3KSZO 4IHJA 1JAZA 3R1IA 2DSTA 4KX5A 1GADO 2Q7DA 4E1VA 5L7TA 4G67A 4KFCA 4GZMA 1M6EX 2JHFA 3NAMA 4RK6A 4KE9A 5HF5A 3Q5EA 2B2CA 3RCBA 2TMKA 1KSFX 2AFHB 2VF8A 3AU9A 5IM4F 2IT1A 2D59A 3R0VA 4JD5A 1UOEA 5DN6A 1KSGA 4F04A 2MR6A 5F5LA 3FUWA 4LYJA 2X0FA 3SR0A 3BS4A 4RIHA 5LFAA 3BORA 4LC0A 3MBIA 2NWQA 4QO8A 4KMOA 1ZH8A 5LDDC 3CLUC 4X1YA 1OWPA 1TEXA 1W0JD 3HRKA 4BNJA 3C6KA 3H2BA 1ZL0A 3D8SA 3H19A 2GCOA 5GIPE 3RR2A 1JKJA 2Y4OA 4KQWA 4AULA 4LX0A 4RANA 5IBPA 1ICIA 1K3UB 4CEIB 2Q5OA 1XRNA 3SC6A 3VC3A 2ZSFA 5MFZA 1W5AA 3TVDA 2CXOA 3BZBA 4O4JA 4DSZA 2WFAA 3CINA 3FJYA 3H1GA 4KXWA 1DTEA 2VKQA 2FP4B 2P90A 4DCUA 1ETHA 1C3VA 4XFJA 2V4ZA 1S8OA 1HA3A 2B4AA 5JQGA 3ET4A 5EIXA 1Z88A 3UA4A 5DV9A 3ZNQA 3SZUA 4FCCA 1WA5A 4J1NA 4WMLA 2PGDA 2ZRIA 1EXMA 3IEKA 3MRVA 4Y2YA 3Q1LA 3STUA 4RDIA 1USVA 3PUHA 1YCHA 5JPIA 1QHFA 2X8AA 5IZCC 4R1OA 5JRJA 1D07A 2HN9A 4OQLA 3BIWA 3L7OA 4H17A 4QARA 4FB4A 1B00A 1NY5A 4L0QA 1GTVA 2W11A 1AHIA 4MCIA 1HSOA 4PQYA 3ENNA 5CBPA 2RKWA 3F6CA 3AEKB 4DFDA 2RJ3A 4TMFA 5FPTA 3NBYC 4I1PA 5JECA 1RMQA 2C0PA 2O5RA 1GGFA 4J07A 4NFHA 3CZ5A 2CYBA 3MJDA 2X8BA 3T3EA 5KX5A 4G07A 1NTRA 3VOSA 4CKCA 2FR0A 1CIPA 2JRCA 3H04A 4I55A 1DHTA 3G2IA 4WACA 4XGIA 1SVIA 4I1IA 4CCYB 1RVDA 2L0XA 4D2IA 4DGQA 2ZXUA 2QRPA 1Z6GA 3X1WA 4K5QA 5JCPA 3O1JC 3Q9UA 4HWPA 3LW8A 4TROA 4NYJR 2H9AA 1QQBA 1NUPA 3PVZA 4MYDA 2CKMA 4ESHA 3FPFA 4MHSA 1U02A 2HPHA 3PF8A 4PWZA 1ZNYA 1JDBC 2PKXA 3HXPA 4WNAB 4ZIRB 5IM4A 4K8RB 4TLAA 1FFXB 1F2UA 1OAKA 1XVAA 4IM7A 3IV6A 3DZHA 3SM3A 3CUEF 3JYHA 3ZLVA 1MLDA 5FXMA 4NK4A 1NR7A 1X0VA 5C8ZA 2VPXA 4FC7A 3OAAA 5EE1A 4EYSA 4B74A 4HTAA 1DIGA 3EUWA 4HDNB 4AJIA 1IZ8A 3FRJA 1T3LA 1CTQA 1QYXA 3WWZA 3LXUX 3ZWBA 2OV4A 1V5FA 3BCHA 3CWQA 4KH1A 5YASA 2DUJA 4JYCA 5DT2A 5LU9A 3ZE8A 2YCLA 3DLBA 2OYCA 3DR3A 2GASA 2C82A 3LWBA 4IYJA 1PYGA 1NUHA 2Q1YA 2ZRDA 3QBDA 3UWOA 2EX1A 1MB0A 2AG1A 2HL6A 1FVFA 2OHXA 2VYVA 4MVJG 5FBKA 3U4HA 3ZWMA 2LW7A 5CDTA 1WMFA 2H2HA 1VRCA 1R8JA 2ZI9A 2PRIA 1NQAO 1COZA 3BGVA 3IDAA 1PD1A 2Z6QA 3VSDA 1N57A 3VQTA 1UZNA 2EKLA 3M81A 3P52A 3F3MA 1AOXA 1I6KA 2O50A 4RC9A 5B37A 3JU3A 2LPMA 1JWBB 2ZVJA 4FDTA 1T1GA 1S89A 3BZWA 4ARBA 4E31A 2IY8A 3RABA 1W2GA 3N7UA 4DAEA 1P1RA 2R7LA 3CUVA 4H3SA 3TIFA 4QNRA 2XQFA 5ALVA 1ZJYA 2YV3A 2W6MA 3I12A 4CT4B 1D4OA 3JQ7B 4ZI5A 2BKLA 3T9BA 5IANA 2WYOA 2GTHA 2QV7A 2CXHA 3PQ2A 1M67A 3P5BA 4R68A 4U3JB 5BVGA 1STOA 3ND5A 2EBWA 3VVBA 2DWUA 3VDRA 1NV8A 5IG2A 1W46A 2BRUC 5BNWA 4F5DA 3OWHA 5CH5A 1G3MA 3HA7A 1WPXA 5KJFA 2UZ3A 2VPZA 1M33A 1QH8B 3F5DA 3ELYA 5K8VA 1GTL1 2JF0A 2QZ4A 3VH3A 3U4QA 1FTWA 1F38A 3OOSA 4WDRA 3ND7A 4OMDA 4B4UA 2G9ZA 3QJ5A 4KTVE 2EW8A 3DVLA 4PR3A 5TPZD 4O59O 1GQFA 1W34A 2QRVB 2IKQA 4P36A 4EI7A 4Z1OA 4K88A 4F7WA 3ROZA 3JQ9A 2R5FA 5CPBA 4UCXA 4IDGA 1T2NA 1QFXA 3PNKA 1XXHB 2P3LA 4RENA 5COBA 3ORRA 5BNIA 1C9KA 1FS4A 1E2KA 4LY0A 3IKVA 1DDGA 1DAKA 3KAPA 4TWRA 3F1LA 4NTZA 1ZOOA 1QAOA 1YMUA 3DGFC 3HKBB 4NMHA 2OXFA 1MB3A 4L8LA 1XAJA 4OXQA 3DR5A 2G5PA 3QOFA 4H16A 4YJHB 4BNNA 4FOSA 4CKBB 3VR5A 1IN1A 3IEIA 5E7QA 3P2YA 1IHYA 1NOIA 4IHKA 4OL9A 3IDSA 5IDVA 5DN6D 2EJWA 3LY9A 3KTAB 1T5SA 4IG9A 4KOEC 3CMMA 2AQHA 1OC2A 3SS9X 3HU3A 4O4HA 3STVA 1G2OA 4F4UA 4MPTA 3VPAA 1W76A 4KNWA 2APJA 4M88A 4QT0A 4TMYA 3ZGNA 4FGUA 4M46A 1A04A 3VMFA 1E1DA 3VR6A 2EL7A 3QUQA 4X1IA 2HZBA 3JPWA 3L1VA 4RU1A 3VTZA 1N5IA 2AR0A 1Z08A 3LGXA 1P9LA 1X19A 2PUDA 4HZIA 5EHQA 4ZQIA 1XCBA 2UYYA 4FOOA 1R4MB 2CL5A 1GPDG 2QORA 3NANA 4YV2A 5FIUA 2W0MA 4PSKA 4CLEA 1R6VA 4HUJA 3DLHA 2ZR8A 5COQA 3UG7A 5K0CA 4RVOA 4Z5XA 5C3UA 1UJ4A 4MDEA 1IN8A 3IPAA 4P92A 4CMAA 1NT4A 2VSNA 2W4MA 3M0EA 3TX2A 3GIDA 3JPYA 4UCWA 1GRCA 5IS2A 1C9EA 3T9DA 1ZD2P 1ZM7A 1ZNXA 2NYUA 2B4QA 4YIHA 1VL6A 2FSHA 1X77A 2IYVA 4LDNA 4N6OA 3WYDA 3U7GA 4IVRA 1M8PA 3BH6A 1F2VA 3I2FA 4OB8A 1X9HA 2HQOA 3E35A 3VYTB 1YTLA 5E3HA 3C3JA 2CVQA 3DH0A 3TSOA 2VLBA 1VE3A 4FD2A 3ACDA 1SUFA 4AT1A 4EZEA 1CJKC 3WRWA 5I4CA 1C9DB 3OWOA 3V7NA 1GT91 1T4GA 4AJPA 4EJSA 2GEVA 1SOMA 5KAMA 3P9ZA 5EKSA 4Z7NB 2JZNA 4J7AA 4TLCA 4DNQA 4LTMA 3ZTWA 2O8BA 1L6RA 2VQ6A 4PANA 5KX5B 1VMDA 2Z9BA 3KJQA 4GMGA 2QK4A 3Q5GA 4IJ6A 4XJXA 3X1YA 3TG2A 1ZXBA 4BU1A 5A0VA 2GD6A 2PV7A 1YS4A 3N6RA 1ECPA 1N6IA 1U8AA 1RFGE 1U3WA 1FP6A 1RHQA 2OILA 3CUSA 2F00A 4L5YA 1CZRA 1MZVA 5KVQA 3FOZA 3OD5A 3AEZA 1Y34E 1C4KA 2WTNA 3EEOA 2O2HA 1A7UA 4WLEA 2WIKA 2ZBFA 1JEYB 3R3ZA 1RMYA 3LUGA 1SKQA 1TQ6A 3H2SA 5ER9A 4BE7B 4E6PA 1MB9A 3FOEC 1D4FA 1E9EA 4CKEA 4YPVA 4MWGA 2UZ0A 3RIXA 3GJ0A 4Q9DA 5JAUA 1GLGA 3N86A 3PL5A 2DFPA 5DSZA 4C06A 1J2EA 3W3AD 2IDZA 3TX6A 3CO5A 2NU9B 3FDJA 4M86A 1LCIA 3M4JA 1XTQA 2PKWA 2O7VA 1FDRA 5U4XA 4JKYA 1U7OA 1R6AA 3SAJA 3A6KA 3KQLA 3E9RA 4BCBA 4F4FA 1P6UA 3DBLA 3OJOA 3SX2A 2PLRA 1TKRA 1NXSA 2X1HA 3HKDA 5CYOA 4HEA1 1AA9A 1VG0B 4Q7JB 2IV3A 4BRUA 5M34A 3NHPA 2FB9A 3E53A 1NMQA 2WAOA 3EG9A 1XAHA 4RH3A 1I7DA 4E94A 5JZBA 1VSQA 3FB1A 1L4MA 4EA8A 4HX5A 5C7LO 2JLYA 4JBNA 1N1EA 1KJQA 1Q44A 4WLUA 3HCOA 1G2PA 1SUAA 1II8B 5L4NA 3FNHA 4DLBA 5CP8A 3OOWA 3PSAA 1OHHD 4XCXA 3ZV4A 3PC6A 1UR5A 4NYIQ 5C1IA 2FX2A 1QJCA 5GJVC 4BPBA 3LVRE 3KQYA 3ONWA 5E4TA 2P1DA 2YWHA 3C3MA 3QH4A 1ZKDA 4N8SA 4PQGA 3ILXA 1N0VC 3G85A 2CCKA 2EV9A 1AN0A 3OCUA 3WMXA 2PL9A 4K2HA 2D0IA 4L07A 4KDEA 2IYZA 4RMIA 4TLEA 4JH0A 1EJ2A 2AWOA 2N9UA 5E3IA 1NLZA 1ULZA 4RYLA 3W5DA 5LOVF 2FVYA 3V4OA 4NNPA 1TM5E 4D7AA 1GQSA 3R5FA 4HDAA 2UUCB 2FZLA 2P2YA 1QNFA 2IHKA 4PYLA 1GGEA 4MK4A 4KR0A 2PQ2A 3JQ8B 2O8EA 2HYIC 3PXUA 1HPLA 2C2OA 4KV9A 1DCKA 1AXRA 1SGWA 3ZCRA 3ILSA 2B5WA 3DLCA 3AJAA 3QU2A 3IALA 2CNLA 2H1VA 2PJRA 1TQHA 4R8RA 2X4IA 2BEUA 4K26A 2WJPA 5FI1B 1B7GO 4DSNA 4F71A 2QTTA 1T5OA 1JJIA 2DQYA 3OBBA 2W5UA 4TTRA 1OBVA 1RIFA 4NNOA 5FYQA 4FEGA 1CPYA 2XUPA 1CULC 3SF0A 2RHGB 4UM7A 2OG2A 2H16A 3CEHA 4FM9A 1KI2A 3GNSA 2BJWA 3CF0A 1W88A 4KFRA 4C4YA 1E2GA 2IBMA 1E4EB 1GPLA 2ACEA 3LZDA 5H3HA 3AESA 1GIAA 2JH9A 4I4TA 4KDCA 3P97A 1UFKA 1PR9A 1Y5IA 4IDOA 2I3DA 2RJOA 3THOA 2CHUA 1YCGA 3A3KA 3H8VA 3LYAA 5CK4A 4CM4A 5B3JC 3EVNA 4C9BA 2ECOA 2DKOA 1MB4A 1NUAA 4ZK6A 5FPKA 4FI3F 1ESNA 2IOHA 2OK8A 4MQEA 1WDKA 2EBHX 3IQWA 2BFEA 3DUFA 3WFJA 2AW3A 4MKXA 1THGA 5LR6A 1Y7TA 2AFRA 2HTFA 3VU8A 1LS6A 4BNLA 1OWNA 3PR2B 4JN6B 3SFVA 4OQXA 2C4HA 3FYUC 2J3EA 4HEHA 5KKCA 4QICA 3TD2A 2EJUA 5LA6F 4KIUA 5DTMA 3DA8A 2NIPA 2I71A 3O8QB 2OZVA 2Z2IA 3UAOA 2NU7B 3A28A 3V7FA 1T2CA 4BZWA 5LJIA 5CAEB 1ZMBA 1WQ1R 3CNQS 1A71A 1ZYUA 4HQOA 4JT2A 4FW8A 2C59A 5HILA 4LRXA 5CT9A 3OAAD 2ZKIA 3HH8A 4PG4A 5L3SB 2VPYA 1II8A 3BOSA 4GEKA 1OYYA 1ZESA 1DX4A 1PZFA 1XK7A 1MOPA 3WC4A 1YGYA 3T1QA 1T9GS 3WGLA 1PLJA 2JCYA 1ZRMA 3PDIB 3A4IA 3FYCA 5IVIA 3SQWA 1UEJA 2V59A 1N6PA 3GGGA 3VOAA 5HHTA 4TN1A 2HC9A 2ZRAA 2IOYA 3ZTYA 1XZGA 1B42A 1BWPA 1E63A 3C1OA 1XTUA 1YR6A 1PG2A 1QZTA 2GVNA 4XE5A 3PC2A 1EH5A 1RRKA 3MSXA 3IHLA 3WNVA 4FIZA 3GFOA 1CUDA 2VZEA 3KR9A 4UMEA 3M1IA 1ZFNA 2ONKA 5CBKA 4UOQA 4E1BA 1N6NA 2AEEA 4RLSA 1Z38A 1YC5A 2BM9A 2CCGA 3H5WA 2VHEA 5EMLA 3TLGA 3M6LA 3BX1A 4DUGD 2FXIA 2ZB2A 3CKLA 3H97A 3DE5X 5JIBA 4C4ZA 1G9TA 4D92A 1OT3A 5TT1A 3Q40A 1L8LA 2XVYA 1US8B 4L85A 3F98A 2VBGA 4N9QA 3TUIC 2FK8A 1GFSA 4IEEA 3UJ7A 3RRBA 4HNSA 5J5AA 1AB5A 2OLJA 2VKTA 2BFEB 2BC9A 2DBZA 1U0FA 2QTGA 3L2OB 3E7PA 3VDQA 4WECA 1A9QA 2FRXA 4QU0A 5BW5A 2JIMA 4PICA 1TDJA 3ADKA 3UNXA 2F1IA 8ADHA 3H1PA 3AETA 1RKXA 5KOJA 3UMRA 2RDMA 4G5HA 4PW0A 3LVBA 5JE8A 3DDHA 3QPUA 5FNVB 5A7HA 4ONEA 1XTSA 2YTZA 4UZSA 4MB2A 2WU4A 4YXWD 1KI7A 1RC8A 1Z4LA 4O0MA 4I0WB 4ZJYA 4MW5A 5A4AA 3MIZA 5DH9A 1DG3A 3BTVA 4J2TA 1C0PA 1EBFA 1KC1A 1HLGA 3EC7A 3Q8WA 3SYMA 1D2GA 5I7FA 1EYZA 4WL0A 1JVSA 3AVOA 3TI9A 3FKSD 4L5AA 2Z5GA 3UV7A 3PHJA 4AMGA 2HW8A 4E32A 2HBQA 4N3NA 4CDNA 4PGGA 2NSYA 2NZ8A 4XR4A 3O26A 1UBNA 3ABRB 1S2DA 3R76A 3ZY3A 4YAUA 4FNGA 2O3RA 1XDWA 3AZPA 4GZ5A 2DUUA 1W1IA 2AT1A 3JYOA 2P3OA 4DM7A 2ZRQA 5J1SB 1BJRE 1I4WA 2G4LA 2AOUB 3FCYA 2LCQA 1U8CB 2FDCA 2B82A 2HZ7A 4HCJA 4EL0A 1HMPA 2C92A 2JAWA 2WF8A 3CU5A 4L22A 3I76A 1EXNA 3JZDA 3LSYA 5A0FA 5LZ5A 4DMRA 3N74A 1FQWA 3AUUA 3HYRA 4CG0A 3N2YA 4R1NA 4Z7JA 4F5YA 4ZMBA 4QHSA 5HGJA 2WZBA 4M7PA 2O3QA 4RM2A 4KAAA 5AM0A 2JB9A 1Q83A 4ZICA 5LZ4A 1JP7A 4IX1A 3TZLA 1P1KA 4RLQA 1RHUA 3OJXA 1MTZA 2VP0A 2Y1CA 4KNYA 1W36B 3PWZA 2JK0A 5ESWA 3KUXA 4GQIA 2X8LA 4HDKA 3OI7A 1SKYB 3AT1A 1ZN7A 1ZQ9A 4KK4A 4MQ5A 3BMNA 4V1CA 3CUUA 4G01B 3RC7A 5HQ3B 2VT7A 5G0SA 4II3A 4N5IX 1BFDA 1G1AA 2UXCB 3FVTA 3HCCA 2GHTA 4G1UC 1OXTA 3GPIA 4NCHA 4RIGA 5JATA 1FQJA 3GMDA 3SEZA 5LVAA 4Z53A 3FN4A 4MVWA 1HE4A 5FOUA 1KI4A 3L6EA 3C8HA 3T7SA 2VUTA 1IRXA 1GDDA 3DD1A 5IBRA 5J40A 4N0EA 2CLOB 3RSFA 4BMDA 3Q7PA 2IHJA 3EVCA 5KZMB 1CBUA 1SZJG 1U99A 2MYUA 2PUVA 3OIWA 3Q9LA 2C42A 5T5QA 1QX3A 4WBNB 1PNQA 1OFHA 1R6UA 2WSYB 2XQJA 3CPHA 3GJQA 1ZSNA 4LS3A 4RTLA 1RBZA 3W5CA 1QUFA 5T3UA 1RI1A 3HC7A 2H9YA 3OH8A 4LF4B 5JJKA 4PX3A 5EP2A 2COKA 2QTVA 3DXZA 3AUKA 4CL2A 1RJEA 1XJCA 2C4NA 5TMPA 4HQ0A 4UFNA 4N5DA 4BKOA 1LWOA 2GPSA 4TXNA 1R0LA 1XHLA 1XX6A 1JAHA 3W7VA 1ZM2A 1JDTA 1MFZA 2X6RA 1IOWA 1HRDA 1WW8A 1XA3A 1S8NA 2FZCA 4YJGB 1YUBA 2QD3A 1VKHA 3LT4A 4L72A 4N7BA 5DXJA 3AKEA 1TUEA 4GGOA 1HM5A 4RACA 4RK5A 1H8HA 1KE1A 3UB4A 4EG7A 1V7CA 1QH0A 1LQTA 2P9QA 1L4YA 1RD4A 1SIBE 3B2QA 3UMBA 2IXGA 5J5VA 1T0IA 1RWKA 4CQMB 2R8RA 3PD1A 5F76A 5AJWA 1A9YA 2YWRA 3H7IA 4ZYUA 1Z63A 4XGQA 5JAOA 1GGNA 2Q9CA 3I1FA 1A98A 3BGIA 4S2UA 4X6YA 4P83A 1YR7A 1NBWB 1VDMA 3C6XA 3EIWA 2P5UA 4U63A 5DYWA 4QM7A 2DRIA 4QUDA 3I9NA 1Z8DA 3PGLA 2J41A 2J9XB 1JX6A 2QLTA 4XX0B 4QM6A 4UMFA 2JFUA 4C05A 2VDLB 3E9NA 4YMSA 1Z8FA 4S24A 5ITZB 1ABBA 1JR6A 4HNHA 1GV0A 4UAJA 5C5DA 2BHTA 2BH9A 1Z2EA 5F1OA 2WRZA 4YR7A 3K9BA 1Q77A 5FTMA 1UJBA 3KYJB 2QIOA 1JEJA 2GN4A 3ODGA 2OTCA 4A3SA 2ANCA 5H70A 4MGIR 1JG3A 1KNXA 1P2SA 5K3FA 1B1AA 2AB0A 4HLNA 4B3RB 1XLVA 2Y0DA 3U37A 2NQ8A 1SU8A 3OQMA 1C14A 3LF1A 3VJRA 1WD7A 1MVOA 3K35A 1UM8A 3OLZA 4WK4B 3U16A 4KREA 1G7RA 4WZAB 3DBHA 3NT2A 3UYLA 1LC3A 3OC0A 1REQB 3BWXA 4FX2A 4GOOD 5FRDA 3VX4A 4BLVA 4TRMA 5ITWA 3S2IA 2DHRA 5IAJA 2QDKA 1JUDA 3G5UA 1IG3A 2X6TA 3VR2A 4YT4A 5L3SA 1E4YA 1RDFA 2XMRA 4OBEA 3IRVA 1S3GA 2QRVA 4AL4A 1LUAA 2HU7A 1UK7A 2JFFA 5HF6A 2JDID 1QNLA 3U7JA 3WGYA 1TNDA 4FP9A 3AGPA 4D5EA 3A6GA 2BGTA 4DR7B 3GGDA 3P9KA 2BEKA 1JJBA 1CUVA 3EWSA 1DX9A 2RARA 2XY4A 4IIVA 1M0TA 3BG5A 4LOIA 4M1OA 3QF4B 4QAQA 5K1ZA 3URMA 1RHMA 2AFIB 4JLUA 1NVVQ 1SVNA 4Z4HA 4MVJA 3UGTA 2QX4A 3AKYA 1HZZC 4EL5A 5EA2A 1KWKA 3O2JA 1JHQA 2XXAA 1V95A 1W1WA 1C7ZA 4UMDA 3MBKA 5CYPA 5LLDA 3AFMA 3WP1B 1GA6A 3ONVA 2PYIA 4IKPA 3K1AA 1K2WA 4OM7A 2I9KA 2AFIA 4LMBA 5HF9A 1GGJA 5I9NA 1M6VA 4JXJA 4DCSA 3A4LA 1GYQA 1L7VC 2P7HA 1RMTA 1U81A 4X71A 4AZ3B 1GSOA 2PRKA 3KCQA 4O4LA 3NFYA 3VPXA 3WMWA 4Y98A 3VR4A 1G291 4QUBA 3BFPA 2BGNA 4DPKA 2GZSA 4MUAA 3NTUA 4QWMA 4MP8A 1HZJA 3T1OA 3IA2A 1RJFA 3N2KA 1TCCA 1Y98A 3FPAA 3T7KA 2B30A 3UWDA 4AMYA 4LDJA 1W59A 1K5DA 4HI0E 1A2KC 1EE2A 2G5TA 2VSYA 3L7KA 3W2HA 8OHMA 3EZ9A 2H1OA 3KV3O 5B53A 1G8SA 2B1IA 2AX4A 3G0BA 2RHCA 4QASA 2DMRA 1VYUA 1P4SA 2DPMA 5LQUA 3LBHA 4IIXA 4ZQHA 2GYWA 1A9ZA 1PJ3A 3Q3IA 5AHKA 3TPFA 2JG3A 4NU6A 1CDEA 5JVDA 3BE8A 4GZ3A 1PT9A 4KPYA 1I14A 2C5FA 3EJWA 4KLZA 5G4KA 3VYVA 3T3HA 1BWRA 4I46A 2GAAA 3D3NA 3K6RA 1EJ0A 1H9BA 2BISA 2XUAA 3QI7A 4MQFB 1AE1A 3HJRA 1GP2A 2CSXA 3BL8A 3V8MA 2ONYA 3OOHA 1NVBA 3LKZA 1K97A 1KXJA 1J97A 4D5GA 1W5EA 3D1JA 1UP4A 3IS3A 1XN1A 3TIIA 4NLLA 1JDVA 1RLUA 2JAXA 2UZ1B 1MXFA 4YONB 4WX2B 3C16C 5BMOA 2UUBB 1VJ5A 3NJ4A 1Z73A 5JNWA 1UAAA 1Y4DE 4OB7A 3OVMA 4PWYA 3TIGA 3HR8A 2GWRA 3KLMX 3IC5A 2O5CA 4PHFA 1COWD 2N47A 1AQ6A 1I9GA 2IEBA 2CMKA 3KYDA 1UC9A 1FP2A 2QG4A 1Y0BA 2TMGA 3MK31 2R7KA 4HP8A 4ILKA 3VAYA 1EQAA 4AJOA 2YZKA 1LVGA 3QG1A 3TVTA 2WOOA 4IP0A 4PBSA 3TM4A 4MKIA 3F8SA 4C21A 4KNVA 5IABA 4HADA 1MHTA 2JJ2A 4C03A 3HB9A 1EWRA 1FDIA 2ZZKA 1F6BA 4EW2A 2GZMA 1ORVA 2BW0A 4MV5A 1DO8A 3I4LA 1P4RA 1DAIA 2FZWA 1WVIA 5EVCA 4Q9HA 4ZAVA 1F3LA 1BKSB 3AW8A 3BXPA 3D3JA 1JYSA 4M8IA 2PXHA 4OQ4A 5L3ZA 3WLPA 3ZU6A 2XDQB 1JH9A 2OO5C 2D1TA 2IIBA 3FPKA 1Y6ZA 2ODBA 3JD1A 2ZR9A