3KKZA

Crystal structure of the q5les9_bacfn protein from bacteroides fragilis. northeast structural genomics consortium target bfr250.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
256
Chain Sequence
KTIHDFELNLICDFFSNMERQGPGSPEVTLKALSFIDNLTEKSLIADIGCGTGGQTMVLAGHVTGQVTGLDFLSGFIDIFNRNARQSGLQNRVTGIVGSMDDLPFRNEELDLIWSEGAIYNIGFERGLNEWRKYLKKGGYLAVSECSWFTDERPAEINDFWMDAYPEIDTIPNQVAKIHKAGYLPVATFILPENCWTDHYFTPKVAAQKIFLTKYAGNKIAEEFSMLQSIEEELYHKYKEYYGYTFFIAKKIRLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords uncharacterized protein Q5LES9
publication title Crystal structure of the Q5LES9_BACFN protein from Bacteroides fragilis.
rcsb
source organism Bacteroides fragilis nctc 9343
total genus 86
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kkzA00
1D2GA 5KQSA 2ZTHA 1NT2A 1XDUA 3OFKA 3SMQA 3KR2A 5JUWA 2FK7A 3Q7EA 1KIAA 3NW9A 1NBIA 3E7PA 3FUUA 5EKXA 4C07A 1QYRA 1XDSA 1JSXA 3P71T 4QPPA 3EEOA 1VP3A 2YR0A 1G60A 3G7UA 3M6VA 4PYNA 2I7CA 4DM3A 2IBSA 5DM4A 2Z6AA 3P2EA 4CXMA 2XBMA 1BOOA 4AX8A 3FTEA 2LD4A 1KXZA 1JTEA 5KVAA 1FP2A 2PX5A 1I9GA 1RJEA 2DULA 3HCEA 4AUKA 1NW6A 2VDVE 3LDFA 5LQRA 1XTPA 3HCAA 3C6KA 3OZTA 5K0EA 4R6XA 5EZQA 5ICCA 2YXEA 4HC4A 3HA5A 4A6EA 2EJTA 4FSXA 2ZW9A 4CKCA 3HVJA 2AOTA 1YFJA 3QOWA 2PV0A 5MHTA 2R6ZA 5G02A 4C06A 2CL5A 3UJ6A 1NW8A 2AOVA 4RWZA 4PYQA 2JH8A 3BGIA 4U7TB 7MHTA 3TRKA 2C7RA 2ZULA 1OR8A 3HCFA 1HNNA 2YTZA 5E2AA 3G8BA 2P7HA 5EMMA 4ER3A 5K09A 3B3GA 1FPQA 5E1OA 2ZZMA 5E8RA 3UBTA 1IXKA 4BP3A 5GINE 4RTRA 2HNKA 1EQAA 3LKZA 3DP7A 3HCCA 2OY0A 3GRRA 4RVFA 4AZWA 1N2XA 2ZWVA 4OX9Y 3ER8A 3FTDA 5C0OE 1ZG3A 2FPOA 2UYQA 4X41A 5E8JA 3TKAA 2CMGA 3EPPA 2O06A 1X1BA 3QOXA 2QY6A 4PCLA 2EFJA 4G56A 3B3FA 4WVLA 5EEGA 5EMJA 5GP1A 3RODA 1TW3A 3TKYA 3KQQA 4FT2A 5LR6A 3DOUA 4OA8A 2IFTA 1QAMA 1SVUA 1F38A 1RI4A 3U81A 1KHHA 3AJDA 5K0FA 3I53A 2P3QA 5EIFA 3E8SA 3LCUA 5BP7A 5EEHA 3LHDA 3EVAA 4RTQA 2ZZKA 3PX3A 3FYDA 4IWNA 4GOND 3ELUA 3KQVA 1X1AA 1YZHA 3DLIA 4PYIA 4RTLA 1SQFA 3S68A 3A25A 1YUBA 3A7DA 5GOZA 1QANA 2PKWA 3CJQA 3K6RA 1JG1A 5T64A 3G2QA 4R8RA 2WK1A 2P1DA 4YUXA 1G8SA 3OFJA 4KDCA 2CKDA 3KPYA 4QDJA 3P8ZA 4HTFB 3LGAA 4KIGA 3NJRA 5FTWA 3I5UA 3LBFA 2H00A 3TLJA 1P1BA 3BWYA 1TW2A 3EVCA 4X63A 2N47A 5DRYA 2HWKA 2EJUA 2VZ9A 4PNEA 5EG5A 1G38A 3KQTA 2PXXA 2WA2A 1VIDA 3FTCA 2AVNA 2IGTA 2IP2A 5LQUA 4P7JA 3FZGA 5DXJA 5DTQA 4A6DA 3EVZA 5EMKA 3MQ2A 4GQBA 2GS9A 3DMHA 3HP7A 3BWMA 2A14A 1WXXA 5FQNA 1SKMA 3HVKA 2NXEA 3ERCA 1RJGA 1NBHA 3BUSA 4X1OA 3LBYA 2OXTA 3P2IA 3KPJA 1IM8A 3I64A 4BLWA 3A26A 3FRHA 3IHTA 3BGDA 1YB2A 4L7VA 3CKKA 3HA7A 3MCTA 2AR0A 2C7PA 1EJ0A 5JR3A 2B9EA 4F84A 3L8DA 2BM8A 5D1HA 3G5TA 5HZMA 5CVUA 3T7RA 4EKGA 5GM1A 1NKVA 4WXHA 5T67A 2BR5A 5FA8A 3NVMB 3PTAA 1MJFA 2H11A 2ZBQA 3KR1A 2NXCA 3MERA 2ZCJA 3TMAA 2FCAA 1MHTA 3LDUA 3DTNA 3KQSA 3P9IA 2VDWA 4POOA 4RTMA 4HH4A 4EK9A 1BHJA 1WS6A 2E5WA 2FYTA 2DPMA 2NXNA 2P7IA 3KU1A 2PXCA 3SGLA 3HA3A 3EGIA 4PYLA 3UFBA 4EKIA 1ORHA 3NWEA 5DM1A 3LSTA 5DRTA 3B7PA 3PFHA 5K0JA 3FYCA 3HTXA 4U7PB 3QV2A 5DX8A 4YV0A 3GRUA 1L3CA 1NW3A 1B42A 5DTRA 5DM2A 5K0BA 1AQJA 3LDGA 4QPNA 1JSZA 3DH0A 3GIWA 1EAMA 1DUSA 1P1CA 4ER7A 5CM2Z 3ANXA 3MAGA 1DL5A 3LCCA 1I1NA 1JG4A 1ZHFA 1M0EA 1X1CA 3CJTA 3VC1A 3BWBA 1VP9A 2F8LA 2AOWA 1SQGA 3ELWA 3F4KA 3HCBA 1R18A 4PYKA 4BP1A 4PIPA 2BR4A 1PRYA 3G2PA 3ORHA 4QTUB 1O9GA 4C04A 1BKYA 5K0CA 5EIWA 4CTKA 4P58A 2R3SA 2OPBA 4QQNA 5DXAA 1SUSA 4XUDA 5EZSA 4PGGA 2OYRA 2ZIGA 3T0IA 1YF3A 3NMUF 1EIZA 1VL5A 4PINA 4HTFA 1QAQA 4MHTA 1JQDA 2JH9A 5ICEA 5BW5A 4E2ZA 1WXWA 3G5LA 5E9QA 5ICGA 3UJBA 2OBFA 3GRYA 2JG3A 4C08A 4BLUA 3VYWA 3MHTA 1O9HA 4FGZA 1RI1A 1RJFA 4E31A 2GB4A 1RI2A 1AV6A 2BR3A 4HGZA 1IY9A 3M70A 1SUIA 4RTOA 2FHPA 3IV6A 2QYOA 4QQKA 4F85A 3NDJA 4MQ4A 3FUXA 4RTJA 2UYCA 3OU6A 2AOUB 4YUYA 3PT9A 1KPHA 1L1EA 4ISCA 3DMFA 2ONZA 1JR4A 2XVMA 2B78A 3P9KA 1RJDA 3OE4A 4OA5A 1ZQ9A 2ZBRA 3CJRA 3IYLW 4H0NA 5E2BA 2Z6UA 3KQWA 4KDRA 5CD1A 1QZZA 4QVKA 3B89A 3O7WA 3KKZA 3PB3A 5ICFA 3HVHA 4ER0A 3ELYA 2PX2A 5FCDA 3V8VA 3M33A 3X0DA 4KIFA 1VE3A 2ONYA 3FUTA 3GWZA 3SXJA 4IV8A 2ZZNA 2OO3A 3JWHA 2GPYA 5CIYA 3AY0A 5P8WA 1DCTA 1WZNA 2ORED 4PIMA 4YUWA 4XCXA 4B17A 1M6EX 3EGVA 3O31A 4DMGA 3FPHA 2YQZA 4BY9E 1XCLA 2P3OA 3MTIA 3I9FA 5C1IA 4Y2HA 3KQPA 4DCGA 4AZVA 5KYGA 3FPEA 1UIRA 3M6UA 3P9CA 3Q87B 3EMDA 4E33A 2IBTA 2C7OA 3FTFA 1O54A 5CCBA 5K8VA 3BWCA 2BH2A 2HMYB 4YUVA 1XDZA 4GOMD 3FRIA 4KW7A 1F3LA 5IKMA 4EQZA 3CVOA 2NYUA 5FWAA 4GUAA 4KRGA 3BT7A 5K03A 1RI5A 3KPWA 5FULA 3GJYA 1KPGA 3DXYA 3OCJA 2QRVB 4RTKA 4OBXA 5U4XA 3TOSA 1AF7A 1NV9A 1N7JA 3BGVA 2NP7A 2IH5A 3EVEA 1N7IA 3JWJA 5DM0A 9MHTA 3UZUA 2G72A 5DX1A 2OB2A 3R6TA 3V97A 3LKDA 5T6BA 3RIEA 4XUEA 2BZGA 2O57A 5CVVA 3SR4A 3UWPA 3LPMA 5DSXA 4FZVA 3DLCA 1Q0SA 3UJ9A 3EGEA 2QE6A 3KHKA 4KWCA 4OBWA 2IDJA 5HIJA 4C4AA 3OU7A 5EQJB 2VS1A 4AZTA 3P97A 2PX4A 4RVDA 2HR1A 1QAOA 4K6MA 4FT4A 3PX2A 5EGSA 5LQAA 3MB5A 1WY7A 2GH1A 2PWYA 4RTPA 5HFJA 3TM5A 4PCAA 3P2KA 2B25A 3OU2A 2HTEA 5K05A 3RW9A 3DMGA 3OPNA 5IH3A 4C05A 2AN3A 3G88A 5BW4A 1T43A 2ESRA 5EPEA 5B1SA 4DZRA 3FPJA 3GRZA 4GOOD 4QVGA 2P8JA 1JTFA 5EHIA 5LQJA 3P9NA 2AOUA 2K4MA 2VP3A 2NNWB 3T7TA 5KS2A 4XUCA 3UJAA 5LQCA 1ZKDA 4E2YA 5EMLA 4JXJA 5K0LA 2ZIFA 2YVLA 3EVFA 3FPGA 4FR0A 3KR0A 2OKCA 2O0LA 5KQRA 5GIPE 5E1MA 1ZGAA 3GO4A 4ER5A 1WG8A 3MGGA 1KPIA 1INLA 3MCZA 1X1DA 3C0KA 4AZSA 5LQNA 1U2ZA 3TPZA 4C03A 3TFWA 4YUZA 1G6Q1 1D2CA 1XVAA 3ME5A 5DWQA 1NE2A 1ORIA 2VDUE 2V7EA 4MIKA 4CKBA 5LQKA 4HGYA 4RVGA 3EVBA 4E32A 1L3IA 2FRXA 1X19A 3AXTA 1I4WA 3R3HA 5LSAA 2IIPA 2PGXA 3HM2A 3SSMA 1YFLA 2IH4A 4PYMA 4P7FA 5H02A 4E2XA 4DKJA 2G70A 3BKXA 2PT9A 2Z6QA 3R24A 2G1PA 1NV8A 4ATNA 4RTSA 4HSGA 2PVCA 4O29A 4QDKA 2YX1A 3EMBA 4DCMA 3G2OA 4LWPA 4DF3A 3R9XB 2PSSA 1EJ6A 2ZLBA 4MTLA 5K01A 3KR9A 5DT2A 5FHQA 3THSA 1G8AA 3LECA 4M38A 5DSTA 5F2OA 4DQ0A 1R74A 1R00A 5FA5A 1Z3CA 1BC5A 2GA9A 3CCFA 3TQSA 5HOQA 3T7SA 2ZIEA 5CVJA 3DULA 5GIOE 3LCVB 2PT6A 3O4FA 2ZBPA 4LECA 2QRVA 5E1BA 3FUWA 4V0RA 2JHPA 3G2MA 3D2LA 3BXOA 4PYOA 8MHTA 1ZGJA 4GF5A 4E70A 3UJ8A 1Y8CA 2QM3A 3C3YA 2O07A 3DR5A 1FJXA 1VBFA 5ERGB 3M6XA 5EHGA 5CVDA 3OE5A 4E30A 2PBFA 3DXXA 4RSRA 3LL7A 1KYZA 5EOVA 1HMYA 2G71A 3PS9A 2FK8A 2XYRA 4IKPA 5DTMA 3KQOA 1AQIA 3UA3A 2AN5A 3WSTA 1SG9A 2PWPA 3GRVA 2GAFA 1NW5A 2PLWA 3PVCA 3NWBA 2UYOA 3R0QA 4CKEA 2BM9A 2P41A 2I62A 3SVZA 3GGDA 4FSDA 4YV2A 1XJ5A 10MHA 4FP9A 2KW5A 5F2KA 2PY6A 2B2CA 2YUIA 2CMHA 4M37A 4RX1A 5CVEA 5C9ZA 4P7KA 3HCDA 3FPFA 3EVDA 5HIKA 5FQOA 4RV9A 2P35A 1KYWA 2H1RA 2I6GA 2YXLA 4GC5A 4X60A 5FUBA 2AVDA 1R8XA 4YMGA 2OZVA 3PLAE 2UYHA 2O05A 3A27A 3OZRA 3LX6A 1VQ1A 3UJ7A 2C7QA 3ELDA 5M5BA 2JJQA 4DA4A 1VLMA 4GC9A 1P39A 3E05A 3GNLA 2ZSUA 3NTVA 3BKWA 4NECA 4R6WA 3SSOA 3OZSA 5K0NA 3SX0A 4X61A 1JG2A 2ZVJA 2IH2A 2AOXA 4HG2A 2AZTA 1TPYA 3DUWA 5EKUA 5E9JA 3VSEA 2YXDA 3MTEA 5E9WA 1FBNA 3KQYA 5HEKA 2XYVA 2I9KA 4LWOA 5E1DA 4HRAA 1YZ3A 3AWIA 3KPUA 2CWWA 2PX8A 5DX0A 2Y1XA 3I58A 2Q41A 2PJDA 4EMSA 4EVIA 3B3JA 4Z2YA 5F2NA 1D2HA 3HEMA 3H2BA 1P91A 2B3TA 4YMHA 5CUQA 4BLVA 2NP6A 3TM4A 1R8YA 3M6WA 3JWGA 1EG2A 5FADA 4Y30A 2EX4A 4R05A 1XCJA 4GEKA 3THRA 4RTNA 2IPXA 1L9KA 4PWYA 3NDIA 1KR5A 2G8NA 1L3BA 2XYQA 5HIIA 1G55A 3PFGA 5DPMA 3TR6A 4FS8A 4GOLD 3SSNA 3CGGA 4E2WA 5GM2A 2AS0A 3HVIA 3SM3A 5BXYA 4M7RA 2ZWAA 2NXJA 1JQ3A 2AOTB 2EG5A 3VC2A 2XVAA 3CC8A 1VPTA 3C3PA 3UJCA 5CCXA 2P40A 1XXLA 3G8AA 5EC8A 4RYLA 4IV0A 3HNRA 5D1NA 4RVHA 4GBED 5DLYA 5GWXA 3BZBA 3GCZA 1M6YA 3DXZA 2Y1WA 4UOEA 3UA4A 3KPVA 3GU3A 1H1DA 2ZFUA 5HILA 4R8SA 2JHAA 4ZTBA 2HV9A 1UWVA 3REOA 3UJDA 3A7EA 2JHCA 4PGHA 1V39A 1R6AA 5HIMA 3A4TA 3C6MA 4F86A 2PXAA 4CWAA 1PJZA 2WA1A 4OQDA 2GLUA 3JWIA 2ADMA 4M36A 4CTJA 2P3LA 2UZ4A 1RI3A 3NVKI 4P7GA 5EVJA 3ID6C 1JG3A 4LG1A 5FHRA 3K0BA 2IDKA 2ERCA 3AXSA 3GXOA 4OQEA 3CBGA 3KQMA 4QTTB 3FUVA 4V0QA 1NW7A 1UFKA 3GDHA 4YV1A 1JQEA 4ER6A 4PONA 1KP9A 5K0GA 5FWDA 2V74B 1FP1D 3ER9A 3EEYA 3B5IA 4MWZA 4PYJA 3IEIA 2OB1A 2AN4A 3M4XA 3EVGA 1Q0TA 3E23A 3G89A 4KVZA
chains in the Genus database with same CATH superfamily
1C1DA 3DYIA 5KQSA 3ODGA 2XDWA 1LPPA 1E6UA 3FB1A 1ZNZA 1GPLA 5BN3A 1Y1QA 1WP4A 4Q4HA 1NUQA 3NW9A 4G9GA 4DIBA 1KAHA 1AKUA 1NBIA 2JAQA 5J40A 3W9BA 1KMMA 4E07A 2UDPA 2VF2A 4MV9A 2FJ0A 4DCOA 4WINA 3DMNA 1GRCA 1QX4A 2YVKA 3KL2A 3FHTA 4RETA 3SVLA 1GL6A 5JOQA 5JEDA 3MWJA 4R2MA 1LJUA 2I7CA 5IT4A 1A5BB 1E1YA 1KY2A 2OR3A 2VFAA 1NQXA 5E3JA 1E4OA 4B81A 1Z8FA 2IE0A 2PSEA 4MW7A 3QI2A 1ENOA 4PCUA 2DULA 5JSQA 1NW6A 1PT8A 4Z54A 1XTPA 3IAHA 1D9XA 1SHLA 2C4KA 1PR9A 3G59A 4EW6A 1DKPA 5L3QB 4MEJA 3W5DA 1BS9A 5FL3A 1P72A 3U0BA 4WFKA 4O1IA 3RF7A 1LJ8A 1HE2A 2ASVA 4WZBA 2WMOB 2C3YA 1KOJA 2JK1A 2YY6A 3PSAA 3BCHA 1G21A 3BYZA 3JASB 2QAIA 3WRWA 2Q3BA 2NZXA 4Q0MA 4DA8A 3GF4A 1J2YA 4L73A 2I2DA 4BMSA 1BS2A 3BMQA 4MA4A 3ZE2B 3G8BA 4MRNA 1IZ9A 5AHWA 3T0FA 3ZCXA 2FSIA 4QHYA 1CQWA 3I6MA 1FK8A 4KL8S 4YJGB 4BYGA 4MVJI 1KDPA 4GI2A 4KGXA 2ICAA 3BQMB 4UAVA 4E88A 3ZWVA 1IOZA 1OPXA 4X8OA 3GIDA 3GUVA 5DYNA 4C87A 4TS4A 1QKKA 3A37A 3VUEA 5AI0A 4AMYA 2C7BA 3GY0A 4OTZA 4YQEA 5ADWA 3TFOA 2B8TA 1FXUA 2YHAA 3GFFA 1S6YA 5H81A 5C0OE 4M54A 1J21A 4CL3A 3EPPA 5ICMA 2AKEA 5EEGA 1LVGA 2EFJA 2V9PA 2ZRBA 3L7MA 2MWMA 4UZEA 3ZTTA 4DREA 5REQB 1RLMA 1PDWA 4FZ3A 5FPHA 3LHFA 3QXSA 1CUXA 1V1RA 4W6QA 4ABTA 2QUKA 1KVTA 4UPDA 5M7EA 1E3JA 3C2QA 3SIXA 3SHQA 1KMHA 5F5XA 1ODTC 1MAWA 1N4AA 4E7PA 1Y3BE 3MLEA 4OM8A 4V3CA 4US2R 3B8EA 3KO8A 3SBEA 2Y1EA 2Y4OA 1DWPA 2Q1TA 3OZEA 3TEJA 4H3VA 2AW5A 4CIVA 3CMMA 3LNCA 4GI1A 3ANMA 4EA8A 5DBGA 5BQPA 1U3WA 3ENKA 4EG8A 1VBNA 1Q0PA 4QNRA 5CBPB 1R0ZA 4DV6B 2QRKA 5EAIA 1QANA 3CJQA 3WX0A 1A9TA 2ZRJA 3KKEA 1MOSA 3HUDA 1TYEB 3G2QA 3QYAA 4GMDA 4JNCA 4MGEA 2Y9MB 4NMMA 1PYOA 1XKTA 3LQ1A 3ICCA 1Z0JA 2C2ZA 1CR0A 2VYCA 3R09A 1IOLA 2IEIA 1TDJA 4G97A 1JBQA 4MQMA 5LM3A 1SMKA 3TLJA 1BEUB 4HPXB 2FW7A 3N2GA 3RS4A 3H9BA 4KQHA 1Y98A 3OPVA 3EXEB 5AW9A 3KL4A 3HFRA 4O4LA 3NDPA 1KZ7B 2BIFA 4LHYA 3RD5A 1LI4A 3BJIC 4P7JA 4G65A 2ECPA 4JI2B 2IF2A 4GOXA 3MUNA 2W6OA 1X42A 2OCDA 2F1KA 2RH4A 2R4UA 2WTAA 3RS8A 2H08A 3DUFB 4JQYA 4ZA2A 4E09A 3VMMA 4J1TC 4GPD1 5JO0A 5LP1A 1FLVA 1PBTA 3GGJA 4HMQA 4C7KA 1Y34E 4URVR 1LPAB 1SBZA 2PH1A 5EP1A 4YJ3F 2ZUCA 3CKKA 3C5HA 1XZEA 1YMQA 4LS3A 4M83A 2JVJA 4JU8A 5JMWA 2V1XA 4R71A 1NBEA 1SD5A 5F9FA 3J80A 2BGWA 3W2EA 2HUPA 4HLUA 5T67A 2JASA 1NP6A 1WKCA 4LVOA 3H97A 2DFVA 5IZ4A 2PZGA 1Y1PA 1E1LA 1ZNYA 1EM8B 1WUJS 1C9DB 3QFFA 4PAQA 4RIGA 1S3IA 3MS7A 5TPZD 3UWDA 4DAOA 2V9ZA 3E81A 2FYTA 3B7GA 2CJWA 2GR9A 4G84A 3V8EA 3OJ0A 5TF4A 4L5IA 3UVEA 4WN3A 3PGKA 3PJGA 5DM1A 5K0JA 2CFRA 2WTXA 5I8ZA 2J4CA 2QR2A 3ABQB 4EY7A 2VYNA 4Z0HO 4LCEA 2C4MA 3HI6A 2IZ0A 3TYXA 4CKXA 4MUAA 3T5DA 2XE6A 3DH0A 4JKYA 2WUWE 3GPBA 4JI1B 4GBGA 1EAMA 4M7WA 4JYMA 3RUIA 4EEXA 4G0WA 4F3TA 4FIZA 5EA2A 2J7KA 1AQUA 3Q40A 1IM2A 1BQEA 2XUDA 3NVAA 4PQEA 1OFTA 4P5DA 3EIOA 2O2GA 2QYSA 4AP6A 3KVRA 3TN7A 1WCIA 2QQ0A 2AMLA 3QLVC 2UZ1B 1S89A 3KJZA 2GVZC 4PIPA 4RMGA 4NZMA 5AI6A 1QH1B 4GR5A 1PFWA 2R3SA 4HPJB 4TMVA 5JH7F 1OV4A 3IV7A 3IEPA 4MIOA 5H70A 1V8FA 4D9HA 2AMFA 2QJOA 1V96A 3ZCUA 5JHGB 3PNMA 1C7FA 3N6RA 1K0FA 2YS7A 3CLUC 4IDPA 4NVRA 4YFYA 3UHJA 1N6NA 2J8ZA 1K4YA 2JG3A 1NASA 2Q28A 4TSFD 5LLSA 3O4GA 1IQRA 4ARZB 4G0YA 5ELLA 1KOLA 1SC4A 1XHLA 5CNMA 2NPIA 5DGDA 5FI0B 3VPAA 3LF2A 1FXSA 3Q2IA 1IY9A 2KM1A 1UC8A 2AFRA 2ID7A 4MQ4A 4L8WB 3FUXA 1O89A 3K9LA 4ISCA 3QPAA 1JR4A 2XVMA 4RZSA 4TXNA 1NJ6A 2ZBRA 4OA5A 5L3ZA 3BXHA 3OY2A 1PT6A 4B40A 2JHFA 5AI9A 7AT1A 2UU9B 1K8RA 2Z6UA 3CVUA 2F9MA 3IEKA 4ZT2A 3B89A 5D00A 3RTDA 3B82A 2YWRA 4HLQB 5IAGA 5IFLA 5I01A 1T1JA 4M53A 2HPZA 3HB7A 4M1OA 2JIZD 2AJTA 4PPYA 4HGOA 3QKRA 4RF2A 1P1HA 2RJOA 4GBMA 1W36C 4ZYLA 1SULA 3WKCA 5GONB 4UUPA 2BJWA 2WR8A 1PR1A 3ZDXB 1BMDA 4Y0NA 4AF7A 5CIYA 4GKKB 1I01A 1T9GS 2B7BA 1XU7A 4ZCRA 3A58B 3AY7A 4LYAA 3RRMA 1XCLA 3CINA 3GV0A 3ND6A 2DZDA 3DFIA 3MMNA 4RVUA 5DT9A 3IBYA 1C1HA 4H17A 1KYIA 2DCUA 4QDOA 4AZVA 1EG7A 1OXTA 3DVQX 2C97A 1RYNA 3N9IA 4LRQA 4XIJA 1VFPA 1QF9A 1GPNA 5CCBA 4N41A 3BFXA 1GU7A 1TIPA 3KWFA 5JFOA 2PGOA 5ANRB 3FDFA 1TQ8A 4JUFA 1U9CA 3V4VB 4NCKA 5CYOA 4XH9B 1J22A 1A98A 1DDGA 1JDVA 1KFJB 2EX1A 2H7CA 3DEJA 4KIJA 5EJMA 5AVUA 1DC7A 2POQX 2ZPUA 1OAOC 1U7ZA 3BH7A 4QEDA 3KLPX 1Z5VA 3H5OA 1IOVA 2PAFA 4UREA 1ZI9A 3VU1A 3F9IA 5CVVA 2OZEA 2CZCA 3Q1LA 1Y37A 4F2GA 3FIUA 1X7XB 1Q0SA 3DLCA 2Q9CA 1AU9A 3E5NA 4HTAA 4AG6A 1Q6YA 4GW3A 2HRQA 1JYEA 4EYQA 4RVOA 5TS2A 4D82A 3GCWA 2GBPA 3FB4A 5M2QA 3E9MA 5AVOA 2XXBA 2DTXA 4LNAA 2GN1A 5FIUA 3C3CA 5HQJA 3TIXB 3WK5A 2P4EA 3EZ2A 2H5LA 3KYDB 5G1OA 1UK7A 3DZCA 4NU8X 3C3JA 1RKQA 3VFDA 2QAGC 4A8TA 1BDIA 1U8EA 3CGWA 5G4LA 1N1MA 1MNQA 3H8WA 1Q7EA 2HMAA 2W98A 2CUTA 2H1WA 3F0TA 2IE8A 1EWYA 1VKRA 4GOOD 4MB0A 1KSGA 3OQOA 2VRNA 2Z57A 3R0JA 3SZLA 3T7TA 1P60A 1TM3E 1B74A 3K9QO 3QFTA 4N5IX 3JATA 4JVSB 3S7TA 3HXMA 3DMDA 2VDLB 3PEYA 1EFTA 1WUIS 5LBUA 1KMIY 4I8XA 1RMTA 3LC1O 3VR4H 3K6SB 1JJVA 4OLAA 4RHEA 3BFKA 3ILYA 2QZZA 4X3OA 3HV0A 4G89A 5TQ0A 5A4KA 2ZJ0A 4YJFA 1U4SA 1Q91A 3BEOA 1MC4A 4B84A 4MWOA 4CIXA 1KDRA 1VMKA 4BAZA 1WV1A 2O2CA 4NCJA 3VAYA 5LQKA 1X8JA 2I6UA 4NAVA 3K1YA 5TE9A 3U56A 4PQGA 3SVTA 3FDZB 4EW3A 1B6TA 1QR2A 2RI0A 3ITKA 3ZV6A 4XUGB 3VR6A 1AVTA 2PT9A 1J99A 1KSJA 2CUNA 2N46A 4ATNA 5JNRA 2PZMA 2YFKA 2ZRPA 4LHSA 2YX1A 4BIIA 3EMBA 3QRWA 2E0IA 3EDMA 4LWZA 4UULA 1GQYA 2WDZA 4RJLA 4BV3A 1FBTA 3BMCA 5KVCA 2DUNA 2QD4A 4B3SB 3KR9A 4EPTA 3A1TA 3NEYA 1EHCA 1PQPA 1DOZA 3H1AA 1F1BA 1KQOA 4R3UC 5L4NA 4CDMA 4I5GA 3ZW9A 1QTQA 3RRFA 2R65A 3VU3A 1E20A 1GFIA 3UXEA 4F45A 1GAWA 2VT2A 4IGFA 3Q3CA 3R7LA 4BV9A 1XZNA 1NN3A 5FUVA 4Z0TA 3U44A 4GX0A 1RP7A 4K9LA 3K2BA 4KPUB 1MW8X 1EK1A 1Z0FA 4BKMA 3NATA 4TTRA 2PNFA 3DKKA 3UOWA 4M0KA 3I04A 2B8EA 2PSDA 4IFIA 3WQSB 2NXWA 2O07A 4D0NA 2PUVA 1VKZA 3F74A 1R0LA 4HFNA 1FQWA 5F23A 4H35A 4MW4A 4D3ZA 4W9MC 1RAAA 3ROEA 5JBNA 2SECE 1OBCA 1ZO8A 4HN2A 5IH7A 2H1FA 4WK4B 5J59A 4DLVA 1RJWA 3RUEA 1W75A 1R5OA 4K9RA 3WQHA 3OUTA 1CUAA 4MPDA 4OHZA 2P77A 1KRXA 1B0PA 3ZXYA 4L16A 1BJTA 2FG7C 2BY4A 1TT5A 5F73A 3STTA 3OM9A 1KEEB 1RP1A 3V4SA 4CKEA 1N6KA 1JLRA 4NBUA 1O95A 4DQKA 2ACWA 3A6KA 2IXDA 1HSZA 3HCOA 4JLPA 3Q3IA 3W1VA 3F7NA 2B34A 4Q3CA 3ZLTA 3TRDA 5T4BA 1P2BA 3EVDA 1IY1A 4GEGA 1C2YA 3MD0A 1BX1A 2Q3CA 4WA8A 3M7IA 5FKJA 1CTQA 4DLWA 5CT6A 2FEKA 2IZ5A 3JD4A 5JJLA 1T5SA 3RKUA 3G23A 4HB2A 1DC3A 2A1UB 4LJLA 3SS8A 5HS4A 4UVGA 5FLYA 3BIFA 2QUHA 5TMPA 2ARKA 2AK2A 1HY3A 4YCJA 3QBJA 3NTVA 3I5AA 1KK2A 3H2ZA 4EVRA 4YT2A 3QE4A 2UZIR 2FPMA 2VF4X 1FB5A 4LHXA 3W5IA 4YAOA 3AEQA 3H5VA 2ZJYA 3KOXA 3CZ9A 3MWEA 5E9JA 2AXPA 2GLTA 5KCZA 5IT9A 4LWOA 3DWEX 4HRAA 4BQNA 4MV4A 1KU0A 2N3ZA 2W6MA 2XBLA 2ZVQX 4AECA 1PK8A 4I9NA 3WOVA 1Q95A 4EY5A 5BPHA 2QTGA 1W4BA 2YY5A 5L9AA 2PJDA 1F14A 4Q9NA 2QG6A 4B3MB 4D2IA 1Z07A 2X6QA 4C0BA 3OQIB 5CUQA 3OPMA 3IOCA 7ADHA 1PUIA 3LMKA 4GEKA 1JFFA 3THXB 1P4SA 1WTAA 2JGMA 4JYBA 2JBHA 2XNDD 3HRIA 3QNUA 3INGA 4YAWA 1E7QA 1G2QA 1MJNA 2NXJA 5EE0A 1J8QA 2XODA 3VOBA 3UJCA 4CT5A 3AO0B 3O83A 4FB4A 5BN1A 3A1DA 2BBWA 1Y5MA 2C04A 3VR3A 2UUAB 1YNSA 2EL9A 1CUBA 3DKVA 5JJIA 3QP9A 5LJLA 2ZK7A 2ORVA 2LZ0A 1TCAA 2PTHA 2WSSD 4F71A 4W5WA 3W05A 3PEEA 3X1XA 3ZYZA 3CWCA 3L9WA 3O8QA 4KUGA 5AJHA 5BSTA 1P1RA 2ZE7A 5TGTA 9ATCA 1BG6A 1YZKA 2C0CA 4ZO9A 3COJA 1KE2A 1Z56C 4UU0A 3X1YA 1L1FA 3A4TA 4LBWA 3ZXIA 5KJ6A 3AIMA 3I2GA 4B4DA 3O0TA 2Z5GA 5F7ZA 4ZIRA 5C31A 1QJCA 1WLSA 2R8YA 2HPAA 3SZOA 5KYWB 2DF8A 4KGZA 5CFPA 2YFHA 4L76A 4UBJA 3WK9A 4P7GA 3CLTC 4DJFC 1AZLA 3AR2A 3RRYA 2Y92A 3AVXA 2WM8A 3Q7TA 2WFLB 3S29A 2CEAA 3L4BC 1BN7A 3VZBA 2A8YA 2BEWB 4NHEA 2P6PA 3IP1A 4V0QA 3S0JA 3ND9A 3K6KA 1O7JA 2VDNB 2F1OA 4CMHA 1WNTA 2R47A 1MX9A 1SXJC 4KRYA 2B4KA 3LXRA 4K5QA 4Q3BA 4RAOA 4XQ0A 5DU2A 1OX5A 3VMFA 5AVRA 3DVLA 4LOHA 1VE5A 5DCYA 1X6VA 1CE8A 3BVPA 1HORA 1B0UA 1DDOA 1FFEA 1U4NA 4OHRA 4XLZA 4BFLA 1JIJA 5C5IA 4QM7A 1HGXA 2WAXA 2G0AA 3K9CA 2X76A 2BEUB 5EKXA 1Z4QA 3COPA 4D8WA 1YONA 1JR2A 1TD1A 3PR1A 3O91A 1B15A 1T2DA 3VH4A 3WRVA 4HNQA 4IIGA 4P83A 3WQQA 2YR0A 1ULAA 3ERCA 1KY4A 1YR7A 3OKAA 1R64A 4TQGA 3CR7A 4XPZA 5ETJA 3X2SA 3OZCA 1DCMA 1QIFA 4ZREA 1D9ZA 3LDFA 3RVRA 2VAMA 4UTOA 4GVXA 1JHAA 3AB3A 3PQ3A 1KI9A 2QD5A 5KYYB 2UUBB 1SHTX 2J6CA 4FSXA 1KK0A 4R3NA 3ROGA 4TL6A 1DQPA 4G0NA 5JQGB 2QMUA 3K0FB 2AH5A 4C06A 4ZU1X 4QE3A 1RQ7A 1TAHA 1TTPB 3BMNA 1DKMA 1ZLYA 1OLOA 1TADA 1G0NA 4DZZA 3GFOA 1RRFA 2E1PA 5K8IA 4TKVB 1L5WA 1V45E 3DMTA 4KRXA 2B35A 4KO4S 5BN5B 5CCEA 2HB6A 1QR6A 1GPJA 2C0PA 2XQGA 3ZV5A 3AFHA 3PFFA 1HPLA 1GG2A 5FBQB 3ZDYB 5H3CA 4IW3B 1LDNA 1Z06A 2A0FA 3LKZA 4KMRA 4MJ7A 1GAXA 3ZV4A 3PCRB 4A16A 4BNVA 4RVFA 2C2OA 2QJWA 4Y6RA 2VDWB 1H2YA 3B1WA 5FFNA 3ETHA 2WJVA 3RFXA 5D85A 4CM8A 4JC8A 1LPNA 1V71A 3AQ4A 1JS1X 3D4IA 2GVDC 1TCBA 2V98A 3EPKA 1KI8A 3C1OA 3SC2A 1LRLA 5LR6A 1NQTA 5DULA 1CJSA 5H59A 3KZOA 1UCFA 3N5KA 1CZLA 1HLPA 3WMWA 1GKYA 3ZGOA 1NUAA 1SAYA 2P3QA 3I53A 5CCDA 4RCVA 4MGHA 2C4NA 1YCGA 2AHOA 2VPTA 2Q3MA 5KVQA 1NVTA 3KSMA 4KKXB 5IK2D 3EF0A 4EABA 3DYBA 3PE6A 5H16A 4PZCA 4OB6A 3KHUA 3QE3A 4ENVA 4EIWA 4U63A 3Q5EA 1WUHS 2WWWA 4EOGA 1YMVA 5GOZA 2PKWA 3V1YA 1BFUA 4OD0A 3ITNA 3OZ7A 4R8RA 3TTWA 5LWHA 5LYJF 4YUXA 3RSLA 1G8SA 2BTQB 2FX5A 3RKRA 2FWIA 4GYWA 3RU9A 4NBSA 2IYNA 4EHIA 3UGTA 2BLLA 3TLMA 2P1RA 3QLVA 4GBJA 3TL2A 1P2FA 3LA6A 4Q24A 3UKJA 4TZ0A 2WA2A 1EYZA 3FTCA 2D4HA 2BF4A 1RBYA 4B09A 3GAFA 2BFDB 3LYUA 2FFAA 4G9BA 1K9SA 2W48A 3HP7A 1QUFA 2QYHA 3LD9A 1XQWA 3CY6A 3QVGB 3CVVA 3W1WA 2NXEA 3HKBA 1XZQA 4HWSA 1SBYA 4E6PA 2AFVA 3A2NA 3JTEA 4NLLA 3AUAA 1VCNA 5DXFA 3VR4D 3CRVA 1I2DA 2IOFK 1AUPA 1YQ9A 2NU6B 1M2EA 2EDCA 2XTJA 1P44A 4FMPA 3KSRA 1E8DA 4W82A 4N8SA 3TKLA 2YVQA 3HFGA 4ID3A 5D1HA 1MVLA 2CK3A 1Z7YA 3MPOA 4GLFA 1UK8A 1XVUA 2R8XA 2OHHA 1N2CA 3K1AA 3PL1A 5SV2A 3S8EA 3K5WA 2NXCA 1XZDA 1V2GA 4O3FA 4PS1A 4RKYA 4I55A 3WLRA 3PEUA 1MOPA 4UU8A 5IJ9A 2KHZA 4RQAA 3CRRA 4HH4A 1BW9B 1W0JA 2FZEA 2D1YA 3VSCA 4KOEC 5JTTA 6CHYA 4H3HB 4MCIA 4HX9A 1I3CA 3EE6A 3DOEA 1VPLA 4IDCA 4JKIA 3P4YA 1D3AA 3H9GA 4FD3A 3UFBA 3FPLA 4XW2A 1ADJA 2JZNA 4EO4A 3L8FA 2XKJE 1I7PA 4N48A 2P67A 5DM2A 3EXHC 1VLHA 4MI9A 3RC7A 1T9HA 5C4IA 1GR0A 1KK1A 1XXHA 5BOSA 3U7RA 3L46A 3L84A 1KJIA 3SKVA 4RD6A 4FN4A 4LKRA 4YP1A 2HSEA 2VZ8A 4IGKA 5IC6A 4Z2AA 1JAZA 2D1QA 1DWOA 2B4QA 4PRYA 1MABA 4TT3A 4ZQHA 1KMQA 2JF0A 4MULA 4ZAZA 3WNDA 2YMMA 4DYDA 1J39A 1YE5A 3NAGA 4XIGS 2XT9A 1K98A 1Q0HA 2XGOA 3HP4A 3OT1B 3OWHA 3RARA 4AJ4A 1YKGA 4ANFA 1EDDA 1NVFA 2HRZA 3Q12A 4PINA 4D8TA 3B78A 4IEFB 3RYFA 4Z3KA 2OUIA 3WQBA 2D2EA 2LCFA 4U3JB 4H0FA 1JQBA 2GFQA 3V2GA 4OUDA 2VJCA 1ZD5A 3GLHE 5EJFA 5J4LA 3A36A 4BLOA 3MHTA 4RF3A 1JL3A 2PDAA 3P4XA 3RT7A 4MR9A 1RJFA 2V8BA 2X8WA 5DVZA 3KZMA 4FE4A 3UICA 1VJ0A 3P5SA 2AQ8A 5CT8A 3TECE 3ROFA 3AU8A 1CFZA 4OJKA 2CNLA 4UBMA 1XGKA 1D2AA 2VYQA 4YT8A 2VRCA 4AQ7A 3VC3A 4OGGA 4ZVNA 4JXZA 2R68A 4KLRA 4Q6BA 1DJLA 1NF9A 3EXIB 4CFZA 2J3JA 3PT9A 5KYVA 1FDIA 2ONZA 2NV2B 2B78A 1N0UA 1ZXXA 4HDRA 5BVHA 2QAGA 3B1JA 1H8HA 3B9RA 4NU5A 1D7OA 3R7AA 5BRJA 4B79A 2Z2ZA 5IC5A 5TF0A 2RK6A 4DQXA 1L6IA 3EFEA 2DCMA 1J8MF 4WK0B 3ZWCA 3IEMA 4BO8A 3EGDA 3RVPA 4Q4AA 1OWOA 1UBFA 4RK4A 2BF7A 1VSVA 2O3TA 1TTTA 2ZIXB 2I2WA 2ZTLA 4S2UA 3I9OA 1G4HA 3HXPA 4FYVA 3GWZA 1UOPA 2YZ7A 1PKXA 4INPA 4KXMA 4X85A 3EA4A 3L02A 4CEHA 1O9BA 3AZPA 4DEYA 2FP4A 1FYXA 4NR0A 4DLPA 1IB0A 5DASA 4WOKA 3ZTYA 1JA1A 4A10A 3IQDB 2X0FA 3ILSA 2HDWA 2EP5A 3NNNA 2OHXA 4X7MA 3VR2A 1M1XB 5HCNA 3OLYA 2O2DA 4B3JA 4HWKA 2AZMA 2QWXA 5E4JA 1NR5A 1Q0QA 2N1BA 1Y80A 4HO1X 3DO6A 1BVUA 5JAPA 3VPCA 3P0EA 5TQ2B 1RI5A 3PX7A 3DXYA 4UNIA 2A9PA 3DF9A 4BKQA 3R9XA 3PKZA 2OYCA 2IELA 1N7JA 2XCTB 1NVMB 4P7BA 4QHTA 1GCAA 4DMMA 9MHTA 2X5NA 3C16C 1NUPA 1RZVA 3EC2A 4Y2PA 2BZGA 1N5JA 2BM1A 5AOCA 3F3MA 4DRZA 4J4BA 3EGEA 4MUMA 4ZKDA 1JPJA 2RHMA 3VOTA 3WGTA 3WGIA 1OTHA 4Z99A 4P08A 3P97A 4FXOA 5C81A 1P3DA 5TGZA 4G0XA 1ZOSA 1E1RA 5DEIA 5F1KA 1AK2A 3ZGYA 4F9TA 3OEHD 1JQAA 3AIIA 5A5EA 2B25A 3F5QA 2E7ZA 2D7CA 2IYAA 3PRKE 2PU5A 5DGXA 4M6WA 3PDIA 3G88A 4YDSA 3F5SA 3DV2A 3BSFA 2WDPA 5FEMA 1XZMA 1YOBA 4GQAA 4QVGA 2H4WA 4MDEA 3SQXA 3ZX5A 5KI6A 1CQIA 1Z6QA 5FOSA 3L6CA 5P21A 1A2OA 2IQ5A 1EJ2A 5AJXA 1NONA 3UGJA 4Z4FA 1LEHA 1HXHA 2ZSAA 4QJBA 3IDSA 2IHTA 3K2IA 1LC3A 5EXXA 3NEPX 1KPIA 3KJGA 3MCZA 4WKBA 5B1DA 3ZDZB 1EFPA 1NULA 5G41A 1S9HA 4JYCA 5A4IS 4HX5A 4X7RA 4JCOA 1VDZA 4YUZA 2GESA 1EX7A 1T3GA 3LT0A 4H7FA 4NZPA 3ZC3A 1VG0B 5CDTA 4LGCA 4UZSA 5C34B 1ORIA 1TCUA 2QW0X 3QA9A 4Q4LA 1GDTA 3REQB 3KD3A 4QXOA 3HLYA 3BZUA 4JLNA 2IH4A 3E9EA 4GX5A 4PYMA 4P7FA 2DECA 4GUDA 5ICSA 2ZAMA 4HSGA 3KT0A 1PVDA 1FZTA 3CUYA 1T6YA 4DCVA 2JAXA 4PO3X 4PTYA 5K8JB 4A0GA 4ECAA 4UQPA 1B8NA 2PSSA 3AVPA 3F49S 3JWEA 3N39C 1DMSA 3DAYA 4KK3A 2YJ3A 5DJ5A 5DT2A 1KFBB 5FHQA 1G8AA 3LECA 5F2OA 2W71A 4QHSA 5J2UA 1R00A 4YALA 3VDNB 1XJQA 4OL9A 5GOTA 4HNVA 2WTUA 3HB9A 1OA0A 4QSMA 1Y0BA 3DFUA 4LV6A 4BLRA 4TMFA 3HE3A 4EARA 4ZD6A 1XD8A 3VZSA 1F3OA 3B2NA 1MO2A 3FTEA 1G64A 3MT9A 3A32A 4KQWA 3WLIA 5E1BA 3EDQA 3RYTC 1Q1AA 2BD0A 3D81A 1QHHA 4RLQA 2HHJA 2XWPA 4PYOA 3QX9A 1DO0A 1DCFA 1NTRA 4YCDA 1XALA 2VPWA 1XE3A 3HVUA 3OM0A 4NCHA 3JAKA 3QUCA 1VBFA 3M6XA 5DNDA 5LWQA 5CVDA 3ESRA 1GQSA 1M67A 1ZK4A 2AFHE 2CW5A 3ZKWB 1SB8A 3LL7A 5EKSA 3AKDA 5EOVA 4CKWA 3R5JA 1YS7A 3IVRA 1TM2A 2C83A 2EFDB 1NVBA 3GJXC 4PAOA 3KEOA 5DNEA 1NXQA 4BFYA 1DBVO 1N7GA 4BNFA 5F52A 1KBZA 4DN6A 2ID8A 2R7AA 1YJ5A 4MQUA 1SHZA 3BD7A 3KJIA 3NM5A 4IXWA 1YHNA 1JIXA 3HN6A 3I92A 3RO7A 2JD2A 5FB3A 4HV4A 3VPHA 5CLFA 3R7DA 1WETA 3NH6A 4FSDA 3QVJA 4BZWA 3RAJA 4MR8B 3PR2B 4D57A 3QU2A 1UQUA 3FTPA 1UADA 2GOYA 1DC5A 2C9OA 2IHJA 4S24A 3VOAA 4A36A 3UXHA 3QZUA 1ISMA 3FWHA 6AT1A 1QZUA 2GAOA 1PG2A 2I6GA 5LD2C 3E0QA 2GPJA 5FUBA 2KBFA 1DBQA 3QWBA 1LSOA 1KSFX 4R2JA 5THKA 4X7BA 1WZEA 3BHMA 1MB0A 3GL9A 1E2GA 2XH8A 3V48A 4H6WA 1VLMA 3E05A 3DTYA 1RYBA 2ZSUA 4NENB 5L4SA 3L4BA 3N0TA 1HOTA 4EPYA 5K0NA 5ALKA 3SX0A 3B51X 3GLGB 1F06A 2OORA 4RJ2A 4CQMD 4OYLA 2O1SA 2X0JA 1A4RA 3DBHB 4S1VA 1JJFA 2WFMA 4GZLA 5HA5A 4ZEXA 1VLJA 4WX2B 3FYUC 3WRXC 3HPRA 3B6ZA 5FWXB 4HZIA 1IVYA 1FTSA 2CFTA 2PSJA 4R9NA 3CLSC 4HH0A 1WOMA 2LIPA 2QX4A 5C1BA 4GKBA 1NJGA 3LBIA 4P9NA 2CV2A 2FWNA 4HAIA 1JFSA 2PKRA 1OF1A 4ZDJA 3OJWA 2JRLA 2FWMX 2XNCA 1UIMA 2HBZA 5F7JA 1H66A 1XMSA 4TKUB 3ZGNA 1IXSB 3A1VA 2LRHA 2Z2YA 2CT8A 2D5BA 2RGRA 4AKTA 5E6SA 2EFCB 2E4ZA 2HTFA 4Q3EA 4GDMA 1VPTA 1FQJA 4PXSA 2HJVA 4JEIA 2P9EA 2C58A 4XFDA 1VE7A 1WQ3A 2NZJA 3I3SR 4RGYA 4ZVOA 5KTMA 4HZUB 1S9DA 2FPGA 2V0NA 3HNRA 1S01A 1SCNE 3ILVA 5GWXA 4LTDA 4B7ZA 1I7QB 1ZOIA 3E4CA 1EI9A 1EWKA 4RDXA 2QMEA 5IJ0A 2C2WA 3VTAA 4B4UA 3Q0TA 3AUTA 3T7AA 1DRJA 3A7EA 1V8BA 2JHCA 3N7UA 2WQZA 1E66A 1R6AA 2OZPA 2Z6VA 4U6SA 2EGGA 4QFMA 1WSAA 2C4VA 2WSYB 1F1JA 3BILA 4F1KA 1JLKA 1UQTA 4A7PA 4AN0A 3V4PB 1KQFA 4HQOA 1D1TA 4ZOBA 3R3UA 1TM7E 2ORIA 3E2IA 4G8DA 3WV4A 4BMXA 3K0BA 4N03A 2X15A 1G20A 4CODB 4QG3A 3CW2A 3IQWA 3ZE8A 2W8BA 3F98A 4I81A 5B53A 4OQFA 2R8BA 1S8AA 3SHTA 4CDRA 4BNDA 4B3GA 1UFKA 3EGXA 3F78A 3B36A 1TYBE 1VKOA 4CR8A 4MKFA 1FUIA 4IHJF 3HWRA 3KLNA 5DWDA 3ICQB 2V74B 3BSYA 5EMNA 1WE2A 3LKBA 5TPWA 1Y8RA 5JPDA 5ARBA 2ZITA 1CRWG 1ONPA 1KJNA 5K3DA 8AT1A 3M2PA 4XJVA 1R0YA 1YR2A 4EW2A 2HK7A 2EXXA 3QKWA 3ST7A 1SOVA 2PD6A 4JX9A 5CDYA 4NYJQ 4FSHA 4IQFA 3MGAA 2IYWA 4OATA 1OXMA 3L0ZA 3REGA 4UTPA 4Z4EA 1SKUA 5AJTA 3M6AA 4JI0B 2D5CA 1HFEL 1GPYA 2OAQ1 3KQKA 2PMDA 2JRCA 2HEIA 2ZP1A 1ZICA 4E7OA 2C1XA 1G60A 4HWTA 1KI7A 1W581 1X9GA 2Q3FA 4QXPA 4DM3A 1NNEA 3QH4A 1JTEA 3SXUA 3CG4A 1X15A 3B6MA 4C0WA 4EZEA 3O8BA 2A9JA 2ZYWX 2QZPA 3OX4A 5G3YA 1XN4A 4MR7A 3UW1A 3KOMA 4QZVA 3KEGA 3N8DA 2J46A 2BFNA 1XHFA 1VHLA 2IEAA 4LSMA 2OESA 4MVJF 3K8QA 1WJGA 1ND6A 2ZKIA 3H5IA 4L28A 2ZM5A 2UUOA 3NAMA 1NBAA 2CZGA 5HK8A 3PNSA 2QQFA 3GA5A 3HGTA 5I7SA 2CL5A 1FLAA 3UJ6A 5M04A 4LI3X 2QRQA 4M9CA 1RPTA 4PYQA 4YH1A 1XROA 2J6HA 4C3VA 5AO9A 4MIYA 4D79A 4UXHA 3TRKA 1PLLA 1US8A 3HCFA 4IQ0A 1HNNA 4PLVA 5FNVA 5SZJA 4R2IA 1PF7E 4PHCA 1PD1A 5I9BA 2NZWA 1BE6A 4H3KB 4UEQA 4PO9A 2DQSA 4RTRA 4GPZA 1ISSA 2WZDA 1MJGM 4BCDA 1BZYA 2E82A 4EVQA 3PP8A 3ABOB 4WE3A 5B3LA 1UBTS 1N2XA 2LCIA 2RHCA 2WIAA 3TS1A 5TX7A 2GXAA 3FMIA 3BE5A 1I6MA 1U5BB 3WWYA 2K7ZA 2JHGA 1JN0A 5TNXA 2AZDA 4UXIA 2XIJA 4G36A 5C8YA 1FDTA 4KNWA 2YOFA 1G5HA 2F4VB 2ZJAA 4B3TB 3QG1A 3LQ2A 3R6LA 4IWNA 4LGYA 4JOCA 5JZBA 1QC5A 2YHIA 4NKRA 4DDMA 4WRRA 2GPAA 5CFZA 3L0PA 2ZRQA 1RTTA 2R11A 3QF4A 1OB2A 3DL2A 3JTMA 4ZO4A 4RIHA 3EXHA 4L8GA 4WZ6A 4Y2GA 5ALJA 4RQBA 1RCTE 2Y1OA 2BSXA 3ZE6A 6ADHA 1HL7A 3MCWA 5E9AA 5ALXA 3RANA 1TMGE 4DWJA 2CKDA 3GQBA 2P2ZA 4CLRA 3LGAA 4HD8A 4WW0A 2QTHA 1NQUA 3I5UA 3R7SA 1H2WA 1EQ2A 4CGZA 4JLUA 4YAJA 2LR0A 4C0KA 2GLXA 2N47A 2VZ9A 4CCYA 1G98A 1Q57A 1PSDA 3GJRA 1JLMA 2Q0QA 2SCUB 5AW5A 3B13B 3CTMA 4JBWA 1TU0A 5AESA 3BD8A 2XB2A 3O8OB 5ITZB 3PHHA 1DEOA 1J8DA 2ZBVA 4JP5A 3M0EA 5A5FA 3G5UA 2HQRA 4BTEA 1H3NA 2A14A 4CLDA 4EJFA 4B0OA 3B2QA 3HMQA 2WG1A 3AFIA 2Q8QA 2H4HA 5I6DA 5IPFA 3T3GA 1NBHA 1WB6A 2ZM6B 4FJ1A 1K27A 2O14A 2RJNA 2NSHA 3H4VA 3HDVA 4UJ5A 3TO5A 3I64A 1CIJA 4XB6B 3IHTA 3ZNPA 4E6EA 2GJ4A 5LZ5A 2JARA 3TW8B 5JR3A 2J41A 4RZXA 1A69A 3SD7A 9GPBA 1Y4ZA 1ORTA 5SZKB 2DHCA 2H11A 5TSDA 1M83A 3SX4A 1WU8A 4C4SA 4IIFA 3JAMA 5EZ5A 3P9IA 4X8MA 2NYRA 2F8TA 4XQGA 2QZSA 3H5LA 3ZEAA 4E14A 1X77A 2Z9CA 1BKDR 4ETMA 2GEUA 4BJ1A 1PR4A 1SCJA 1JA0A 2TMDA 3OQBA 3TTSA 5AW8A 2I2BA 3IPYA 1LPSA 1EVQA 4UEOA 5EUMA 1PJLA 1GP2A 3S70A 3CPHA 4D9GA 4EKNB 1TQDA 3BHJA 3FPAA 2V6JA 3ZQ6A 1XZAA 4K6OA 1I8TA 2BCEA 4B7AA 3ZZNA 1U0NA 3O26A 2G9ZA 1L5NA 2GX6A 2Z56A 5KNDH 1EEXB 2QL7A 3DZHA 1Q14A 4QAQA 4NCBA 3AT1A 1JG4A 3EK2A 3V1TC 2OAEA 2RAPA 5JD6A 2NGRA 1XK7A 4IMPA 4XRRA 2ZJBA 1E61A 1AHNA 2ZB2A 3CJTA 3GLKA 1J6UA 1NX6A 3M2TA 1T36B 1X1TA 4FINA 4G1MB 2YJ6A 3VR6H 3WYAA 1R18A 2J45A 2VJLA 1PGPA 4TS1A 5CB8A 2PSHA 3IMKA 4UTXA 4AYWA 4CF4A 4CF5A 2EV9A 4NCNA 4I50A 4BLQA 3D6JA 1MR3F 2OV4A 4EY4A 1NDQA 3FCOA 3BTUA 1GXSB 1P0CA 2E49A 3AUKA 2AN9A 3M1YA 4YWJA 3V9PA 3BK1A 1Q7RA 4LSGA 2QN7A 2IEBA 3C8DA 4IP0A 2ONJA 1GARA 3FNIA 1BMQA 3NFRA 4QARA 2A3RA 4BLUA 1UBEA 4LNUB 1S2IA 1TD9A 2IIVA 1QIGA 3EFOB 2RC5A 1DAFA 2WT4A 3GX1A 5DK4A 3NBXX 1QH8A 3MK31 4NZZA 3VKFA 4AICA 2XD9A 2CNKA 2GD6A 1SCBA 3AR3A 4FHZA 5HKLA 5JAUA 2UYCA 1USKA 4JA0A 4JSTA 2XF2A 3OU6A 2EKPA 1HURA 1AK9A 3I23A 4FYMA 2LKDA 1SVNA 3PJRA 1X80A 1RJDA 2NQTA 1F7VA 3K92A 2R6GA 1PYDA 2EWWA 2XNHA 2J3IA 2YRWA 5DNAA 2IS2A 1LDYA 4QPDA 1Y4DE 3T3OA 3CIFA 4KDRA 4HB3A 1C0PA 1H8EA 2M2IA 3P19A 3PI7A 3PNKA 1W5FA 1IN8A 1LWNA 2W2TA 2VAXA 2OZLB 3AI1A 3FZQA 1G9SA 1Y6QA 4N3GA 1MTOA 3JVUA 1ONBA 3P0FA 4BNIA 2C2MA 3AM4A 4NH0A 1XA4A 16PKA 2AUTA 2OO3A 1X8KA 3DW1X 4A0FA 2B8WA 3RBAA 2Q6KA 3AEUA 4NCAA 2FSUA 5P8WA 4LMBA 4ND8B 3K30A 1LK5A 4XCXA 3ROXA 4O2AF 4B17A 3EGVA 5A4DA 1IWPB 4C3ZA 3NGXA 3TX2A 1YRYE 4ZI7A 2GEDA 2OYSA 2QSZA 3I05A 2XXJA 4M9UA 4EGQA 1DKQA 4HNGA 5B12A 2Z2IA 4MW0A 3UQYS 3P9CA 2ALJA 1HT3A 2DPLA 3EMDA 1JEJA 2DH5A 4ESOA 5CXSA 2M98A 2IOFA 3UUGA 3I0NA 4EUKA 3ABIA 1JG6A 2B0CA 1D4AA 3QEBZ 1AO3A 2QRVB 3I2YX 1G9XA 3N76A 4NBKA 1S2GA 2BMDA 4GX1A 2VLBA 2P6RA 2IQIA 4HPWA 4TV9B 2ZBDA 2AXNA 4RZIA 3I62A 4YJKA 4K05A 4R51A 1NGSA 3C7CB 2E1RA 2CBGA 1Z15A 2BOVA 2R60A 5IAKA 1FY2A 3MHPA 5A3QA 2JFQA 5DSXA 4FZVA 5BNZA 1A96A 1RHQA 2C7GA 2HAEA 1RWNA 5HIJA 1X7WB 4NPCA 4YT5A 3QIAA 2OQVA 5JJKA 3D6TB 1FW6A 2XR1A 4YP0A 1EX6A 3HJCA 3QLTA 4MYTA 2YCLA 1V9CA 4XIFA 1QIJA 1Z2OX 2H59A 2GH1A 3MB5A 3U3RA 5JAZA 1LBIA 5HFJA 1I2ZA 3EIXA 4PCAA 1A0OA 4GMHA 4OG2A 3NBUA 4YI5A 1YD7A 3RW9A 1AM4D 2Q3LA 4YRAA 4ZHQB 3DLHA 4NULA 4NWIA 5BW4A 1T43A 3JQ7B 5A5VA 1MFPA 3FPJA 4FQ8A 4NQRA 2O8BA 4LY9A 1GM5A 2QHXA 5D01A 3FDIA 1HTBA 3EVFA 4CF6A 1WHTB 3L7CA 1C8VB 2JFGA 2JLBA 2UVQA 3LC0A 3E2MA 2F8SA 3D3WA 3QBTA 4KQ6A 3GO4A 1I3KA 2G5GX 1HWYA 1O3YA 5EIBD 3KS9A 1TUBA 2G5CA 5KJ1A 3QPVA 1T6XA 2MSEB 5EE9A 1ZHOA 4PXYA 4REQA 2JKVA 5AKGA 4CEJA 4MUYA 4NL4H 2VDUE 2XLCA 4QNMA 2D13A 1AURA 1QLJA 4PF1A 3UAGA 2VYND 3AXTA 1Z2NX 3IA7A 2IIPA 1E0KA 3IVAA 1QZ3A 3FX2A 3HN7A 4MI3A 2WY2D 1V2HE 3BN3A 1PQ4A 2G1AA 4UAGA 1GGNA 4PSUA 2H92A 4ROSA 1RLTA 1UR5A 2P68A 4QTXA 1NN0A 5D6OA 5JLAA 3A31A 2DQ4A 5CX1A 4AN1A 4RM2A 3IDOA 5JAIA 3D7RA 2X19A 2V4UA 3D6MA 3H11A 4J4HA 4LQDA 2X9LA 5AR1A 3RADC 2RKWA 1QFMA 2X22A 2ZUBA 4KAFA 2JAHA 1FTQA 2P2LA 4MB6A 4YN3A 3WRXA 5AW4A 5I7UA 3A2KA 5HKBA 4KFSA 3LCVB 3RC1A 3T6KA 4O4IB 4LHWA 2DFLA 4JZKA 4JT2A 4JA2A 1GZ4A 3TI9A 3ZWPA 4AJKA 2I91A 1HFJA 2Y1DA 3CA8A 3I0ZA 3OOSA 3GMDA 4GR4A 2D00A 2VOEA 3LWZA 3RSCA 2XKKA 1YQDA 4QUHA 1K68A 1VMIA 1CT9A 2Q7XA 4EUEA 3TJMA 1V4BA 3TWOA 5I7VA 1M66A 2HO4A 3OE5A 2ZJ8A 4M1MA 3SLKA 2HQSA 5KSWB 1V6CA 3MINB 2F1HA 2BUCA 2YYYA 2QP9X 1W5AA 3DAGA 2VEOA 3HUEA 3CZAA 5DTMA 3S27A 1AMNA 3GLFE 3KQOA 4W9NC 1X7GA 5AK0A 3AHEA 3GP8A 1P2TA 3EF3A 5TB5A 3OMXA 4RJKA 2LWIA 1XCOA 2RIPA 4ALLA 1E99A 3GGDA 3LM8A 4HQ6A 4KV7A 4L0MA 4L4ZA 1UJ2A 1YT5A 3N6XA 2MMCA 2EFYA 5HIKA 4D8VA 1H1LB 1AGXA 1JF8A 1JEAA 4EPWA 3CF6R 4URZR 3TSWA 2WD8A 4JLAA 5J47A 3OJLA 2VDPB 2UXDB 2JA1A 5J2TF 4MV7A 4M86A 1Q20A 3OZXA 4JC5A 3FAZA 1V7ZA 1OOEA 2DR0A 1IG3A 3VHXA 1U3TA 5JAOA 3HKEB 2O2JA 1YVUA 2APJA 3HJRA 3RSHA 1KJJA 3G02A 3UKDA 5IX8A 3BIOA 2FVXA 1GUDA 3AHDA 1R4ZA 3BE8A 3GNLA 2WZQA 5JDIC 1NI4B 4XTRA 1E1KA 3KV1A 2PZFA 2PGAA 4JEMA 4JP3A 4JP1A 4A0RA 5BN3B 2AZTA 5DI9A 5JBQA 1T13A 4Q4HB 1ZESA 3KNZA 4RS4A 4AUNA 2V96A 1U63A 2PQ0A 1YZ3A 4RUKA 3AF6A 2I4LA 1IUPA 3LA8A 3L6DA 4C4TA 4KR3A 3QMWA 3AR4A 3ONVA 3HBJA 3H2BA 3P2OA 3K72B 2JLSA 5G1NA 3TM4A 2K87A 5FADA 2WUEA 1SXQA 2H2WA 1I7NA 3FFAA 3OT4A 1IIBA 3OEWA 2XHEA 4PWYA 3CCCA 1PJTA 1S1MA 1L3BA 3OEEA 4O1HA 4GOLD 2RSLA 3I04M 4HFJA 1I30A 3GEEA 3I52A 4ZXFA 4IS3A 1XP5A 4ACAA 2XAAA 3TOZA 1N9KA 1JQ3A 1Z4IA 3TTUA 3T3NA 4WZBB 3VHRA 5F5NA 3P2YA 1E77A 5C1DA 1UEXC 4LSWA 5TLSA 4RYLA 1G21B 2OM2A 1JAHA 3DO8A 1YRLA 3A9WA 5C37A 5JADA 3O3NB 5JU6A 4IF4A 3QFSA 3X1JA 2VIIA 1UP4A 1XAGA 1YGPA 2O7VA 3BMQB 3DXZA 2WQ6A 4XQ9A 1WVMA 3KZXA 4FX5A 2H51A 2Z08A 3SSAA 4FDTA 3WB2A 4EL0A 1QBGA 4UD6A 4CM4A 1M5TA 3H2SA 1G2IA 4V0ME 1BXGA 4FJ0A 3WLPA 4UATA 4DIDA 1QE5A 2C78A 3Q15C 1EJBA 4LDZA 4O2BA 1ZBQA 4KPEC 3L8MA 1AQ6A 2QRPA 3ZGVA 4DIMA 4Q7QA 1YQQA 4YJ2F 1FS4A 2R2AA 1YUMA 4YA6A 1KH2A 2ERCA 2I67A 4GZ6A 5KHAA 2FWJA 3WFIA 4BQSA 2PT5A 1K6EA 3NJ4A 3R6WA 4RORA 4UE3S 1FE8A 1R9GA 1V1RB 1NVVR 5KWVA 1TGVA 1DQRA 4PU0A 5AJWA 3GCDA 4C3UA 4ER6A 1DJPA 1Y48E 2QVZX 5K2MA 3CLKA 1YXMA 5JQWA 1D4ZA 1KMHB 3COVA 2VTEA 5GADl 3EEYA 4KH0A 3LG2A 3VR6D 3NYQA 2V6MA 1U0TA 3ABSB 4K6KA 4UM9D 4MXDA 4DXDA 1ZNXA 3SBXA 1K63A 4B3HA 1PUXA 3SMQA 2G67A 4EITA 4UZFA 2FZKA 1UJCA 3WYGA 1G1MA 1FDSA 2WYOA 3OIGA 1YR6A 1NQVA 4EW1A 5FR1A 5EPUA 2O0JA 3KCQA 5HCUA 3LCMA 1V7PC 2QUJA 1JSXA 2J31A 2XQFA 5SYMA 1KYYA 2YMPA 3TI7A 4DA9A 3AGPA 1HDZA 4BN5A 3KC2A 2Y66A 3N2GB 2FZLA 4P2BA 4UCFA 2P5YA 3STXA 3WJ1A 2LD4A 1FJGB 2PX5A 3WB0A 1I9GA 4O4LB 2D2VA 3PEWA 3V32A 1TYZA 2W42A 3OZTA 3QJGA 1ZIXA 1AOXA 3EMKA 3GDFA 2Q8NA 1KO8A 3PQFA 4WKNA 3IAXA 4UMEA 3UAVA 1Z5UA 3JD3A 3VU0A 1IQ0A 2ZTSA 1WB4A 1OIWA 4R9VA 3H0CA 5DM60 4J0CA 3DV0A 2IV2X 4BMYA 4F46A 1QUEA 1YGYA 4RE5A 3HL0A 1IM5A 4N6GA 4X71A 4AJIA 2IYPA 2Z95A 5DE3A 5KTNA 3VDMA 5LOVA 5C32A 2M1XA 2VPZA 3N59A 1L5ZA 7MHTA 4E51A 2VP4A 3K94A 1NW9B 3MS2A 1O95D 4QAJA 4HS9A 3PPVA 1X9HA 3DLAA 4KQMA 5SZIA 3ZIDA 5HS6A 3EOBI 3ANLA 4J90A 2PMKA 4C5AA 3B1YA 4ZRNA 4BZQA 1HDEA 1HLGA 4BP3A 4G0QA 4J0IA 6REQA 3OOJA 4MMZB 1DFGA 2H9AA 3C3AA 5K51A 1ZW6A 1ES9A 3DP7A 3HCCA 3ZE7A 3DE4X 3B9QA 3UMCA 3TEMA 3VO8A 5A2QA 4LMPA 3RUPA 1PJ4A 1ZG3A 1RQ2A 2CJWB 5E8JA 4D3SA 4CF7A 4HDOB 4G56A 5BQOA 1TVCA 4Y1GA 4D0SA 5I3ZA 4WERA 4C7JA 4GZ3A 1EHIA 1HDOA 2ZUUA 1TPZA 3SC4A 4FQ5A 3G2JA 4G8BA 5BURA 1QM5A 2C88A 1JBKA 4KX5A 3UV6A 3U81A 1N6LA 3AJDA 5LUAA 3BWVA 4RJIA 4HP8A 3BA6A 2W8ZA 2IF0A 3GYGA 3LHDA 1CUUA 3W6PA 4UQLA 5ER6A 1XPJA 5JS7A 2GK6A 1GGHA 3F4LA 1JNXX 3KQVA 1MQ8B 2Z8YA 5AH0A 1XTVA 3R3WA 2BGRA 3EGWA 1WCIB 1FVOA 1HO3A 2HUNA 4C0HA 2R48A 1U8TA 1T1EA 3FLMA 1XC7A 1Z5PA 3O1JC 3TOXA 3EZLA 1C3LA 2TMYA 3RGWS 1TAUA 5JT1A 1T6ZA 4OFZA 1J7KA 3LUHA 4NNOA 4NFYA 5A4AA 1J9EA 2C00A 5JFTA 3E1KA 3G9ZA 3W5SA 1ZDMA 2HGSA 5IM4A 4PNEA 3L4KA 1G38A 1K6JA 1M2GA 2WJZB 4NH4A 1EVJA 3VR3D 3M82A 2C8KA 1WY5A 2AVNA 5FF9A 1QQTA 4QYIA 3UWMA 1KO7A 1L7EA 1SKYE 2Z4TA 3TQIA 2FMUA 4WZZA 4CT0A 5JPCA 3MQ2A 1GKLA 2ID4A 2ZOSA 5HQTA 3PQ4A 2ZJ7A 1XRJA 2CVZA 3DJYA 3KCNA 3OURA 3EPHA 1UPCA 3HP1A 1ACLA 1HV8A 4YLGA 5BV2P 2H1OA 1BWQA 4LY6A 1XJWA 2MJLA 2GTIA 4BB9A 1U5AA 4BRWA 4QT4A 1K9VF 1PR5A 4GKVA 4FGLA 3MCTA 5FAKA 1Q3KA 4F84A 5KAMA 3OC0A 1N8TA 1ZGBA 3ROPA 1WCV1 3FVWA 2J67A 1UPTA 5HF6A 8OHMA 4TUYF 1MG0A 4ZRMA 2FKAA 3QKRB 4P82A 1VIMA 3WQRA 2FCAA 2ZYGA 3RC3A 2I54A 4KVGA 4POOA 2X9VA 5FFMA 1E6CA 3WRYC 4ZU6X 2X1MA 1GQFA 4L3VA 5ELMA 4FYXA 1LDBA 2P2CA 1M2OA 3ZY3A 3ZDAA 4KIUA 4PYLA 2AI2A 1VMAA 2MMGA 1SY7A 2W6CX 1ZL0A 3HXTA 3GA0A 4BFCA 4P81A 3QYFA 2JIMA 1NDUA 2QP3A 1P2SA 1Z0KA 2H1HA 2JGLA 4LE1A 4XR9A 2XYGA 1M8PA 1XZHA 5D5QA 1EE2A 4KQXA 3ZDQA 3ZVNA 4LF9B 3HEAA 1QHXA 3AERB 3KSUA 1ZAYA 4WT7A 1M0EA 3P9XA 2RHRA 3TSAA 3W4KA 2ZAGA 2VDKB 1O57A 4LJRA 1T91A 3LX4A 2C31A 3TQTA 3ADDA 3KVYA 1OKKA 2F8LA 4UQOA 1T8TA 3A1EA 3FTNA 1YBHA 2I1LA 1CIPA 4PANA 4UHKA 5IZCA 1E6KA 1YF3A 3FOWA 2YJTD 4YRIA 3AINA 2WHQA 1BA2A 4B34A 3OQ1A 1NJSA 3SDSA 5IRCD 2HA5A 2KLHA 4MMXB 3K70B 2YIDA 4I9GA 3KX2A 3B1FA 1S2LA 5ECWA 2O5EA 4FGJA 1Z68A 3TOCA 2DFDA 3L2OB 3AUSA 3RS3A 3CKLA 4ARBA 1IB6A 1U2EA 2JGIA 4RD2A 3VYRB 5KNCA 3R3VA 5L3SA 4E3ZA 4AQDA 5EIXA 2CXUA 3DEKA 1K7YA 2VYFA 3LIIA 5TQVA 4PLPA 5T4FA 3OLCX 3NUZA 5HPYB 1TO6A 4PYRA 4YRFA 2V4ZA 3BF8A 2FLKA 3NIFB 2B82A 3DZIA 3PXCX 3ZQUA 4ZYVA 1YVPA 1NDHA 3JATB 2XNKA 3P9KA 2XUQA 1PSWA 1MDFA 1YU9A 2G4CA 3ZE0B 3LY8A 3UT0A 3SS7X 4K3UA 1ACJA 9LDBA 3H0KA 1ZR2A 2IEGA 5A3VA 1JKJA 3BIJA 1XZBA 4LRYA 2WYIA 4C29A 2G09A 5TQ0B 1GZUA 2BFBB 1I5RA 1SN7A 1Y1LA 3NIWA 4YJFB 2NUPA 3JX9A 4Z0NA 3MRTA 3B1VA 3X0DA 3IA2A 1HRDA 4RJTA 5FOQA 3ZJTA 3USCS 4MQFA 4Z0PA 1YJQA 3U4IA 3SYKA 2ZZNA 3NALA 2SKEA 1GNSA 4B87A 2BKXA 1LKZA 1ZIPA 4A2CA 1YULA 4Q93A 4L4RA 2JI6A 2QRUA 3D5TA 1IIRA 2E9SA 2QMOA 2FEOA 4M7PA 1XSEA 1XTUA 2E5FA 1AA9A 2F90A 2Y68A 3A1FA 3C4VA 1Z0DA 3IDZA 1Z29A 4KQJA 3PFBA 4HLDA 4NS1A 3BMCB 3QVOA 4OXYA 3JPYA 4UJ3A 1HG1A 2XMDA 3KM0A 1TUIA 1QIMA 2VQDA 2VXBA 4LRXA 4MS4A 3OUUA 2RH9B 2HI0A 2BI7A 2Y0PA 4EG1A 1Q7BA 3RFFA 4LXGA 4DDUA 1E2BA 3IB6A 1PDVA 4EQZA 2WHPB 3BBLA 5F4BA 4WZAE 3FZNA 3LTNC 1WVIA 3B2EA 4TYQA 2ETXA 2CJFA 8GPBA 1VI6A 4TSKA 5BR4A 3F1KA 4DJEC 3HVRA 1JH8A 1N2OA 3DE5X 5FH9A 1CBUA 2AQHA 4ADSG 5BWMA 1D6MA 4K9QA 3ND8A 3UJ9A 2HK8A 2OQIA 3L8YA 3ZHYA 2X58A 4K6FA 4FDMA 5KWSA 3PITA 5BNWA 3ZH2A 4BATA 2INGX 5EQJB 1UP6A 3A6JA 4K6MA 1ODSA 2VYVA 4M9XA 4TLCA 5AHXA 4MRSA 4FJ2A 4QOHA 2PWYA 4QLOA 2FZWA 2BV3A 3L49A 3SBOA 1KDZA 3SZ3A 2YWHA 4BOYA 1TT5B 3IVXA 4CKEB 1JIIA 2OV6A 3C98A 3HKDB 4I08A 3L92A 2B2XA 2CK3D 1A88A 4W9NA 4PVDA 3WMRA 1M6VA 1AX9A 1WDKA 1ADGA 1USIA 3AH8A 2ZUVA 3KR0A 2IPMA 5HW0A 4X9XA 1R9JA 2PJRA 4OQNA 2VVTA 4TVBA 1W0JD 4JFRA 4C21A 4C2UA 1ZA2A 3C0KA 2EKZA 3EUFA 1MEEA 3IKLA 1B76A 2DUMA 1MA3A 1V9SA 2FEMA 4L1KA 4M1QA 1GZ6A 3TZKA 5JNTA 1L7OA 3UMFA 4WKOA 1HDCA 1W36D 3F6CA 3AEQB 4HGYA 5EWLA 4ZC8A 3RS5A 1CJBA 1L3IA 4UUNA 3MWEB 4KXQA 5EKDA 3UWKA 1F12A 1TO2E 2Q6TA 3ZNOA 4IICA 1IQPA 3OETA 1PWEA 1NUHA 3S4YA 1QLHA 1XD9A 3OIYA 1D1QA 1NUSA 3MOGA 2QLFA 4MWBA 3W9YA 1OZAA 3ZXUB 5JDIA 5DNCA 1ZR4A 2I9PA 1YQUA 2GCPA 4S0XA 2NX2A 1T2AA 2VSQA 1E1NA 4KLZA 5DSTA 1BGWA 2R66A 3HZHA 1UEIA 4TT3D 1PL8A 1OVGA 1UBLS 4W8GA 3WGHA 1YZUA 3EEQA 1JFFB 1DO2A 4X8HA 1JHZA 1ABFA 1XL1A 2XTZA 3K9HA 1HE4A 2ERXA 3AYZB 2WIJA 5GIOE 5AHKA 3AK4A 1R9MA 1W19A 2NUAA 1I2MA 2GMWA 5CK5A 5BRNA 5KC9A 3PFNA 3PPYA 4XVHA 3LWDA 1CF4A 2JHPA 2D6FA 1CZKA 3D2LA 3BXOA 1ZU4A 5DEOA 1K7SN 3KAJA 1RU3A 4BRSA 1CUDA 1HDIA 2B2NA 4AIIA 1FJXA 1NC3A 5EHGA 4Q12A 3WLQA 5CA1A 5A9TA 4L74A 4A8PA 5G0TA 3ASVA 4F4IA 3G2IA 2OFXA 2R87A 2VRCD 1BXRA 4IKPA 3TTVA 2ES4A 1NPDA 2J3DA 1BE1A 1LPBB 1A4UA 4NBWA 4WUVA 1QO9A 2CE7A 3WO1A 5KTPA 4ZOQI 3G8CA 1QCCA 5FNZA 4BVLA 4CMJA 1H4SA 4ZIRB 1H8HD 3OMWA 4LCBA 5IKPA 2BONA 2FW8A 3G8YA 3P9SA 1W76A 1D07A 5D5HA 5HGXA 2PY6A 1PCXA 1MIOB 2ZRNA 1A3CA 4MO9A 5E95A 3RRNA 1ZMOA 1PLKA 3M4NA 1KYWA 4OMCA 4UM5A 2H4JA 1TIBA 3DZBA 1A9ZA 2WFZA 2DVMA 2C9DA 4MZXA 2XVXA 1SNYA 2NZUG 5LA6F 3C1AA 3GFQA 1PWZA 3OZRA 4KI7A 3RLIA 4Z4CA 1ZM9A 4HF7A 5EWMB 5KNLA 4N76A 2CLOB 1SQ0A 2V4MA 1R9NA 3Q3VA 5DIFA 4NECA 4YRSA 1CE8B 3DCYA 5IBCA 2P6NA 3ZD8A 4A5SA 4FEGA 3T9FA 4EKEA 1WDTA 3CZ5A 4G41A 3VR2D 1DEKA 3I45A 3VSEA 4ZMBA 3MTEA 3S8MA 3HRKA 1I6LA 1QYDA 3PQ2A 2I6XA 3ER6A 4BVBA 1ZK3A 2ZJ3A 4WD3A 5E1DA 3ROQA 1Z2DA 2C61A 3BXPA 3U7QA 2QQ5A 2NO4A 1LZLA 4QOFA 4INJA 3RS0A 1I4TD 2ZSHA 4IQ8A 2FRVA 1CWUA 1K8QA 1I3MA 3CCBA 2W6ZA 4OI2A 4R3WA 4B3CA 3GLHA 2QV0A 4HJXA 4Q34A 5CH5A 3QW4B 4KR2A 2JGAA 4BLVA 3TQOA 1XMIA 4DYVA 4QUGA 2GCGA 2C8VA 3FZYA 1Y6JA 2X86A 2Y27A 1TCCA 3FCCA 3FUCA 1PQWA 3FOAA 4R05A 3UGQA 4CCAA 3KG2A 4UNRA 3KSAC 1OX6A 3LO8A 1VE9A 3B7WA 3I1YA 1WPRA 1MOQA 5DPMA 2YJNA 3OPQA 1Q17A 4WUTA 4IFEA 1X7ZA 3B5JA 2BUBA 1ID1A 3IC5A 2AUMA 1JFRA 4OMDA 5GZ6A 4Q4CA 2VQSA 3A28A 5AUQA 2XWBF 4RIFA 3UC9A 3WI7A 2Q9BA 3BRSA 2J0SA 4IDEA 4DLZA 3ZH9B 1G3UA 4NJEA 1E1RD 2IHZA 5GY7A 3JS5A 3I9V1 3L1JA 4PR0A 3BMNB 1SCKA 1GRNA 1NJ8A 1U94A 2XEXA 5FBZA 4JOQA 4LBYA 1A5SB 4R0MA 2ZI9A 5L3QA 4HCJA 1RRGA 2CL0X 1CDOA 2OSBA 4RK0A 4TTVA 4XZ3A 2BE9A 3U3JA 1IWBB 3WSWA 2WSIA 5BSHA 3W8DA 3REOA 4UCWA 3H84A 4KWIA 2CXHA 3KDPA 1KNXA 5AKHA 4BNMA 2IYUA 4AKSA 3Q72A 1LVHA 1I3OA 3L7DA 4TZTA 4CM8B 1GT6A 1V5GA 3H3XA 1FL9A 3IAFA 5EI5A 5J3JA 4HK4A 2AMYA 2GD0A 3QYJA 4YRLA 3NVKI 1QRRA 3O21A 4B46A 3SC2B 3WISA 1WMAA 3JXEA 1AXEA 4YRQA 1IZZA 3MWGA 3OFVA 1THMA 2Q1YA 3D0OA 1QCYA 2IJGX 1JQEA 2J9RA 4LAFA 2HNBA 3PR3A 3WL5A 3PUKA 2IUYA 4RJJA 3TGWA 2HMTA 4LC1A 5FWDA 3EG5A 3MAAC 1X86B 3LQQA 1SZDA 1JZQA 5HF9A 3WGNA 3PRYA 4DB2A 3TCXB 4C2AA 2A88A 4URHA 2FSSA 2N75A 4R2HA 2ZTHA 2A58A 2CF6A 4C4YA 4DMCA 3P9PA 2ZANA 2IX3A 3DCIA 3OTQA 5K99A 3PUWA 3BORA 1K8YB 3NV9A 1B4DA 4I4IA 4MARA 3WWPA 1PZEA 2VJPA 3E7PA 1M2JA 5JZMA 1AGYA 5KTRA 4MQEA 3VYTB 1DJQA 4Z4GA 4NE9A 4P93A 3DD1A 2BCGY 3K20A 2JJMA 5LU8A 3VRHA 3ESCA 2XMCA 1THZA 1MAHA 4KSYA 4I5FA 3M6VA 4PYNA 4UDOA 5TT0A 2XOXA 2WB4A 3U3ZA 2XBMA 2FF5A 4H1UA 4KWTA 5BW6B 4ZQCB 1FP2A 4JXXA 4QXMA 3ABZA 1MC8A 2P0EA 2LV8A 4V0OA 1PWHA 4Q6WA 1FFXA 1W9MA 1RWPA 1UDXA 2OP1A 3OQJA 4XX0A 2VJNA 1AG9A 4A6EA 5G0UA 3OCZA 1J5PA 3O7MA 1FYWA 4U8HA 1A8QA 2ZUDA 2WWTA 3ICVA 4EI7A 3W5BA 2BMAA 5CM9C 3DO5A 1QMPA 3SX2A 3IURA 2Z2XA 7ABPA 2Z9BA 4D9MA 3EFBA 1QV9A 3EXEA 4WKCA 1P4GA 1ADCA 4ILKA 4KG7A 2D5IA 4II2A 1XAIA 1YB5A 3FJYA 4FDUA 2D3WA 2QDXA 1E6WA 2KSQA 3AP2A 4UUOA 1F7UA 1J9ZA 1RXEA 3FSRA 1K1EA 2NADA 3B3GA 1KGDA 4WY2A 3UBTA 2NVWA 4JJ4A 2IUSA 3DUFA 3K1AB 1N2CB 2GBGA 3ZGXA 5GINE 4XB1A 3HXKA 1J8YF 3JQEA 4I3GA 1L5GB 4I55B 1V8PA 4MB2A 3TLGB 1U98A 2PFSA 4AZWA 1C29B 1Z37A 2AKYA 2SKCA 1RYYA 2ZWVA 3EN0A 4ZCPA 4J43A 5HTOA 4IWXA 2TMKA 2IXAA 2HYDA 2FFHA 4XDYA 4EMUA 5J2TB 4RTMA 3RODA 1IBRA 3H42B 2IH2A 4I0WB 1W0CA 2OHGA 3K96A 4FT2A 4TKZA 5KTKA 3FFWA 3MM4A 4IUBS 4ME6A 3RUFA 1W36B 4OQLA 2DQKA 1F38A 1JPUA 2XITA 3NKLA 3QELA 3IIMA 4R5HA 3KKKA 1KVRA 3HUTA 2H52A 4JK3A 1Q0ZA 4U2GA 5LC1A 4MHOA 4CV0A 3VOSA 2G6BA 2YICA 1XXHB 1A1SA 1NQAO 2CXQA 5BOSB 4D42A 5C53B 3PVSA 3RJ5A 5B4TA 3PNBA 1G3IA 4GOND 3OE7A 2HPVA 3K4QA 2FETA 5JYBA 5HDBB 1KQ3A 1QE3A 2BHSA 4HX2A 1P1IA 4I1UA 2PQ2A 4TVKA 3EUAA 1QB8A 4RVSA 4F06A 3NBFA 2B61A 1S4MA 3AKCA 1QK5A 4P22A 4ZGWA 2ZQYA 5FI1B 1MABB 1WBJB 4B8YA 1P1JA 3D59A 4G85A 1Y9AA 3MSXA 4Q1CA 4D46A 3VO2A 4AIRA 4D9BA 5ILGA 4BV8A 4HS4A 5ILOA 4MVCA 2ECKA 1Z18A 3CH4B 3LT4A 3DR3A 2PRIA 1KDTA 3DDNA 1SURA 2A5FA 2DC1A 2ZS9A 4YRKA 2Z5VA 4LF7B 4MWDA 3RYFB 5FTWA 2JLVA 1PS0A 1UBMS 2H00A 4U2KA 2G9RA 5ECGC 2P78A 3T4PA 1RC8A 3Q5GA 1YIAA 4OUDB 2VL7A 4ZYTA 4MA5A 4DM7A 4RPIA 1VIDA 2R44A 4PO8A 2UZ1A 4KMMA 4QDXA 1T29A 2BKAA 4MR9B 4US1R 5TC4A 1T6NA 4BHTA 3ZY6A 5AK4A 1M72A 1QH1A 5IN4A 1JU3A 3GGOA 2WVJA 4D4LA 2ZG6A 4N0QA 1DT3A 1XCPA 3BHNA 4KBGA 5FQNA 3UK6A 5ALRA 1P2DA 4OV6B 2OHJA 2BW0A 1XQVA 2W2KB 1SKMA 1XZGA 1OBVA 2PUJA 2GJAA 3E9NA 4KBYA 3LSYA 3S8YA 1I3LA 3WL4A 5CAEA 3F9CA 5IABA 3TIVA 4XWTA 2ZBUA 1DUIA 3R7WB 4YLEA 1EXNA 2GHIA 3PIDA 4HDRB 1QP8A 3WO0A 1DEAA 2QAGB 2VPQA 4UM7A 3ZZ0A 4ARZA 2ZT6A 3FOFC 3HB0A 2H1CA 2JFBA 3VVBA 5DP2A 4AI6A 4K81B 3T7RA 3EGDB 4QDUA 3MTJA 4Q4AB 2O2YA 1DBWA 2AE1A 5FA8A 2ZCJA 4G37A 4AJ9A 4KSBA 4RXUA 1BIFA 1QDEA 1RC1A 1T8PA 3LLUA 4Q01A 1XMVA 3UHFA 4QG7A 4DA6A 2AWNA 4HYEA 1ZH0A 2WNHA 4CEHB 3NZEA 3ESYA 1WS6A 4U5XA 2FP4B 3MXOA 1MAAA 4OYRA 1Q2UA 4NCIA 1KQPA 4B6JA 6NULA 2VXOA 3EGIA 3F96A 2JLAA 3DV9A 3QUAA 3F71A 3E9RA 3A8TA 3PFHA 3FYCA 1DQYA 2CXXA 2UZ3A 2AC2A 1NMSA 4ARVA 1KETA 3A6ZA 1FMFA 2AG1A 3ETGA 3KYIB 4N39A 4HR7A 5GONA 4X54A 5I9SA 3GIWA 1E4EA 3ZUPA 3PJDA 1UKCA 4PAMA 3BB4A 3RWOA 4F12A 1SXIA 1GD1O 3PFKA 3UMBA 3D0KA 2YFYA 2NUBA 2ZUSA 3AM1A 3GT4A 1DIHA 3IILA 4CF3A 4H7JA 4XAQA 4CDNA 3H5WA 3CR3C 4FMDB 4KO1S 5ALQA 4YPVA 2A33A 2JA2A 3E3MA 3N74A 3PDCA 1I2BA 3IPCA 5JLJA 3L1IA 4CMBA 4DVGA 5DFAA 2WJHA 4J0QA 2XRYA 1KORA 1OYWA 2X2EA 5ED4A 2VATA 3NMUF 2DHEA 1NSFA 1QQ5A 4HGPA 1GLNA 1ZUHA 4DCPA 1WXIA 2F48A 1JLHA 4J8PA 2PFKA 2XA9A 3AHHA 4GYKA 4MUXA 1NUUA 1O9HA 2XQIA 3G0CA 5JC8A 4S04A 1J49A 3A9VA 3F5MA 1UPFA 1U2DC 2FE4A 2GB4A 4BNWA 5BWCA 1N0VC 2O4UX 2ZBEA 3B5EA 1JEEA 1VGRA 2O54A 3PDIB 2PRKA 2UZ0A 3IB3A 4HGZA 4AO6A 5K5EA 3OQPA 3UT6A 1NVVQ 3R76A 4F85A 3EVNA 2OV2A 4PSCA 4YIHA 5CFNA 3T3PB 4Y6LA