3KKZA

Crystal structure of the q5les9_bacfn protein from bacteroides fragilis. northeast structural genomics consortium target bfr250.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
256
Chain Sequence
KTIHDFELNLICDFFSNMERQGPGSPEVTLKALSFIDNLTEKSLIADIGCGTGGQTMVLAGHVTGQVTGLDFLSGFIDIFNRNARQSGLQNRVTGIVGSMDDLPFRNEELDLIWSEGAIYNIGFERGLNEWRKYLKKGGYLAVSECSWFTDERPAEINDFWMDAYPEIDTIPNQVAKIHKAGYLPVATFILPENCWTDHYFTPKVAAQKIFLTKYAGNKIAEEFSMLQSIEEELYHKYKEYYGYTFFIAKKIRLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Q5LES9_BACFN protein from Bacteroides fragilis.
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Transferase
molecule keywords uncharacterized protein Q5LES9
total genus 86
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kkzA00
5C1IA 3S68A 3KQOA 4CXMA 3B3FA 4E30A 2OZVA 3HCBA 1KXZA 2ZZNA 3OZTA 1YB2A 4P58A 4O29A 3UZUA 5K09A 5HIMA 1ZQ9A 2A14A 3K6RA 2PWYA 2EX4A 1KIAA 2IPXA 1X1CA 4IKPA 3R9XB 4E2XA 1QYRA 2WA2A 1O9HA 1JG2A 1DL5A 1R00A 3LCCA 3P9KA 4FS8A 4MIKA 4U7TB 1JR4A 3UJ8A 2UYCA 1IM8A 4IV0A 3FTDA 5F2KA 5JR3A 3KKZA 1SQGA 2IH4A 1NE2A 4OQDA 2NYUA 2AOUA 3EMDA 4HRAA 4RWZA 3TMAA 4QTUB 3JWGA 2G72A 2AN3A 4GOLD 3SXJA 5K05A 1XXLA 5LQAA 2FRXA 3EEOA 2UYHA 2IBSA 2I6GA 2AN4A 3PLAE 1HNNA 2CMHA 3KQMA 2PX5A 5EMKA 1VP3A 3F4KA 3NDJA 4GBED 4PIMA 4DKJA 2ZVJA 1AV6A 2AZTA 4DMGA 3EVFA 1JTEA 1VL5A 3IV6A 1KHHA 2GA9A 1UFKA 3HVHA 4NECA 4BLUA 3G5LA 1YFLA 1YZ3A 2GB4A 2UYOA 4P7GA 2IH2A 1D2GA 4XUDA 3ME5A 3RIEA 2R6ZA 4AZWA 2P41A 4GOMD 1FJXA 3A25A 3G2QA 4KDRA 5F2NA 4KIGA 1N7JA 1HMYA 2IH5A 2PVCA 2H00A 2QRVA 3SMQA 3UJDA 3KPWA 3MTIA 1D2CA 5CVDA 4DCGA 4ER6A 1WZNA 2F8LA 1I4WA 3AXSA 5D1NA 5LQCA 3LCUA 1KYWA 3G8BA 3HEMA 5EHGA 4L7VA 3T7SA 5KVAA 5E1DA 5HOQA 2YXDA 2FK7A 2JH8A 4CKEA 5FWAA 3NTVA 3THSA 4GF5A 1NBHA 3DXXA 5C9ZA 1FP1D 2QYOA 3ELWA 2H1RA 5JUWA 2OPBA 2ZCJA 5DRYA 2ZIFA 3P9IA 3MB5A 3KR0A 3HCAA 3A26A 4GOOD 4QPNA 4R8SA 5DLYA 4BP3A 5IKMA 5BW5A 3NVMB 4RTQA 3KPUA 3E05A 1SUIA 5DX8A 2BM8A 2AS0A 2Y1XA 4C4AA 2AOTA 1U2ZA 3EGEA 4ER0A 1YZHA 4E2ZA 1P1CA 2GLUA 2I7CA 3FUXA 2C7RA 1PRYA 5EKXA 3JWHA 5DTMA 2N47A 4C06A 2OKCA 3BUSA 4E31A 5K03A 2O06A 2ONYA 1O54A 5LSAA 3TQSA 2BR5A 2GH1A 1R18A 2OBFA 2ZSUA 4IV8A 2QM3A 5EVJA 2ONZA 5U4XA 10MHA 3VC1A 4POOA 3MERA 3EVDA 3FPFA 3MTEA 5K0NA 2VDVE 4PCAA 3X0DA 1EAMA 1VIDA 4V0RA 2JJQA 4HSGA 1Z3CA 3P71T 3UWPA 4RVDA 4C08A 4X61A 4ER7A 4DA4A 3OZSA 1BOOA 3I5UA 5E1MA 5FADA 5BP7A 4FSXA 2DULA 2PLWA 3B89A 3BZBA 3PB3A 2ZZKA 3B5IA 5HIKA 5LR6A 5CCXA 4F84A 4QQNA 4OBXA 4C05A 2NP7A 4HTFB 4YV2A 5FUBA 3PFHA 1L3BA 1DCTA 3LBYA 1QZZA 2P3OA 4R6WA 3CJTA 3UJBA 3JWJA 3PVCA 4IWNA 2NXCA 1P91A 1WG8A 3FZGA 3GDHA 3OPNA 3HVIA 4BLVA 2O07A 3M33A 2ZTHA 4GUAA 3DXYA 4GC5A 3NMUF 3FPEA 3G2PA 2C7PA 1OR8A 3PS9A 1FPQA 3DLIA 4FP9A 1X1BA 2YUIA 4ISCA 2AOXA 3EEYA 3LKDA 1UIRA 2YQZA 4YUVA 2OY0A 2YX1A 3BWCA 1WY7A 2GPYA 2G8NA 5EG5A 3D2LA 3M70A 2IP2A 4RVGA 5H02A 5HIJA 2ZBQA 1IXKA 2ERCA 4A6EA 1G8SA 3V8VA 3BKWA 1RI3A 3HCEA 5DPMA 4GEKA 5FHRA 3DH0A 3CBGA 3G7UA 3SGLA 5DM4A 3HCFA 4PYLA 1G55A 5E9WA 3C6MA 1AF7A 3GRZA 1UWVA 2B25A 2ESRA 3CGGA 2XYQA 3KU1A 2ZWVA 3WSTA 4F85A 4RTSA 3HNRA 2PV0A 4MHTA 3ER8A 1NKVA 5CVVA 1NBIA 2OYRA 1L1EA 3T7RA 3P8ZA 4OA5A 3UFBA 4PYJA 1ORHA 3FPJA 3DMHA 3EGVA 3ELUA 3GNLA 3FUWA 5K0EA 4RTKA 3G2MA 3LDUA 5K0CA 3PT9A 3U81A 2QY6A 4EMSA 4ZTBA 2BR3A 2EJUA 3AJDA 3G89A 5EMLA 1TW2A 2P1DA 3OZRA 1NW6A 3GWZA 4RTNA 2C7QA 3LKZA 5M5BA 3I53A 1FP2A 1M6YA 3SM3A 3KPYA 3G88A 5EMMA 4PCLA 3IHTA 3KR2A 3MQ2A 4LWOA 5GM2A 4RTJA 1P1BA 4ER3A 2B2CA 4FSDA 5DTQA 2EG5A 4AUKA 5CVJA 5BW4A 3FTEA 3ID6C 9MHTA 2P7HA 2B78A 1YF3A 2R3SA 1ZGAA 1NT2A 2IDKA 5CD1A 5HILA 3LSTA 2PY6A 4RVHA 1O9GA 3DTNA 2BH2A 3TKYA 2YXLA 1WXWA 1JTFA 3A27A 4DQ0A 7MHTA 1NW8A 4HG2A 4EK9A 2AR0A 3M6VA 2PT6A 3EVZA 3DUWA 1G8AA 4A6DA 3UJ6A 2E5WA 4PGHA 1YFJA 2P40A 2PJDA 4HGZA 2NXNA 1RI1A 3IYLW 4KW7A 3FRHA 4RTMA 1BHJA 3Q7EA 3GIWA 1XDUA 2IBTA 5CVUA 3GRUA 4CTJA 3NVKI 4PNEA 4C03A 5LQKA 2GAFA 5GOZA 1F3LA 4GQBA 3UJ9A 4RTOA 1RJFA 3O4FA 4H0NA 3JWIA 5KS2A 2NXEA 1MHTA 4PINA 2FK8A 4C04A 2CKDA 3SSOA 3TM5A 5ICEA 1RJDA 2PBFA 2IIPA 3P9NA 4OA8A 3HVJA 3LCVB 5CVEA 3SR4A 4Y2HA 4B17A 3FYDA 3BT7A 5CUQA 3NJRA 1G60A 1XCLA 3CCFA 3KQWA 3THRA 3FUTA 5E2AA 2FYTA 5EOVA 2PSSA 1D2HA 3LX6A 4QDJA 1SQFA 3B7PA 5E2BA 3C6KA 2ZBPA 4QQKA 3VYWA 2HWKA 2AOTB 5EKUA 3PX3A 4CWAA 3VSEA 1N2XA 4E32A 3PTAA 1R8YA 3UJCA 2AOUB 3PFGA 4LG1A 2AOWA 2LD4A 4CKBA 2XVAA 3LDFA 2BZGA 3QOXA 4P7FA 4YV0A 3L8DA 5ICGA 4ER5A 4P7JA 3BGDA 5EGSA 5LQNA 2ZZMA 4Y30A 2VDWA 2PX8A 5C0OE 5HZMA 2Z6QA 2UZ4A 2I9KA 4YMGA 5LQJA 5B1SA 4WXHA 2EJTA 2G71A 4QVKA 3UJ7A 2IDJA 3R3HA 1I9GA 5DXAA 5GIOE 5MHTA 2XVMA 3ORHA 2IGTA 2JH9A 4P7KA 3GXOA 2OO3A 5FQNA 1ZHFA 3VC2A 4DZRA 1INLA 3I58A 4HTFA 2PKWA 3P2EA 2Z6AA 2P3LA 4GOND 3FTCA 4YV1A 2G1PA 5E9JA 2B9EA 2YTZA 1TW3A 4K6MA 4PYNA 3NWEA 4AZTA 4EQZA 3REOA 3TM4A 2UYQA 4C07A 3OU6A 4PYOA 5EIWA 3MHTA 1TPYA 2ZULA 4AZSA 3ELDA 1KPGA 2P8JA 3A4TA 2VP3A 4YUYA 5EMJA 1VLMA 2Y1WA 4AX8A 2BR4A 5GWXA 4RTLA 2OXTA 1FBNA 3LHDA 3BGVA 4M37A 1F38A 4RVFA 3SVZA 1R6AA 1JSXA 4YUWA 1RI4A 4M36A 4QVGA 4U7PB 3KQPA 3LBFA 3O7WA 3TLJA 3G2OA 2PX4A 2HV9A 3QOWA 4KWCA 5ICFA 4DM3A 3M4XA 4OX9Y 5EEHA 2P35A 3R6TA 4PIPA 2PT9A 5LQUA 1L3IA 3A7DA 3BKXA 3DOUA 3FTFA 3ERCA 1VBFA 2FCAA 1V39A 3FUVA 4KDCA 4E2YA 1XDSA 2DPMA 2OB2A 3OE4A 3MCZA 5FQOA 3LL7A 3OFJA 3HA3A 3NW9A 8MHTA 3K0BA 2BM9A 3RW9A 1SUSA 5GM1A 3UJAA 4QTTB 1JG1A 4CTKA 1JQ3A 1XTPA 4XUCA 1JQDA 1WS6A 3HA5A 1SVUA 3M6XA 5FULA 3HP7A 3P2KA 1QAOA 1Y8CA 1KYZA 1VQ1A 4HC4A 5E1OA 2ZBRA 3P2IA 3E8SA 3KPVA 4X41A 5ERGB 5GIPE 4KRGA 2B3TA 5DSTA 3DLCA 3EGIA 4OQEA 5EC8A 3A7EA 1H1DA 3V97A 1NW3A 5DXJA 2PXCA 2YR0A 5CCBA 5EIFA 3CC8A 4BLWA 4X60A 1EJ6A 4RX1A 2V7EA 2CMGA 4GC9A 1G6Q1 1XVAA 2KW5A 4R05A 3BWMA 2GS9A 1NV8A 3GU3A 1VE3A 2AVNA 2OB1A 3HM2A 3MAGA 3OCJA 4FT2A 5FCDA 3ELYA 5DM1A 3SX0A 2NNWB 3GO4A 3GRYA 3T0IA 3TOSA 4M7RA 3NWBA 5F2OA 5FA8A 4XUEA 4EKGA 3UBTA 3PX2A 1JG3A 3EVCA 2Q41A 4RYLA 1DUSA 2K4MA 4G56A 4QPPA 3FUUA 5IH3A 5P8WA 4FGZA 1R74A 4HGYA 1VPTA 2XYRA 4BP1A 3G5TA 5K0GA 2HR1A 3LGAA 1ZG3A 2G70A 2IFTA 3ANXA 2QE6A 3LPMA 1EJ0A 3LECA 1RJEA 3E23A 4E70A 4RV9A 2PXXA 1SG9A 4PONA 5EZSA 1X1AA 2H11A 4M38A 1BKYA 4KIFA 3C0KA 5FWDA 4MWZA 4E2WA 4QDKA 4YUZA 5FA5A 1WXXA 3P9CA 5E1BA 5K0LA 3MCTA 5T6BA 4AZVA 3OU7A 5HEKA 2V74B 5EZQA 4LWPA 3DP7A 3KQSA 1KPIA 2O05A 3M6UA 5EPEA 3P97A 2AVDA 1EIZA 3I9FA 3IEIA 3T7TA 3DMGA 4MTLA 1M6EX 4YUXA 3EVEA 2CWWA 2VZ9A 2JHAA 5DTRA 2YXEA 3CJQA 5GINE 1M0EA 3NDIA 5CM2Z 4RSRA 3O31A 2HMYB 1VP9A 3R24A 3QV2A 5ICCA 3ER9A 3LDGA 3DMFA 2FHPA 3EVBA 5K0JA 5E9QA 2QRVB 1YUBA 3CKKA 1JG4A 3FPGA 1PJZA 4YMHA 3SSNA 2PXAA 1B42A 3EVGA 2XBMA 3TR6A 1RJGA 3OU2A 4OBWA 4ATNA 3UA4A 2O57A 2O0LA 2ZIGA 1KR5A 1T43A 1JSZA 5K8VA 3B3GA 4XCXA 5G02A 3KPJA 2ZIEA 1EQAA 1N7IA 2ZW9A 1L9KA 4KVZA 1Q0SA 2PGXA 4DCMA 4DF3A 1P39A 1X1DA 3BWBA 3EMBA 4EVIA 2JHCA 2ORED 3KQTA 5D1HA 5DWQA 5DM2A 4R6XA 5DT2A 3TRKA 1R8XA 2ADMA 3DULA 3KHKA 4UOEA 3GRVA 1Q0TA 5BXYA 5KQSA 4WVLA 3GGDA 5EQJB 3RODA 3FPHA 3KR9A 3M6WA 1XDZA 3KQVA 3GJYA 4LECA 1NW7A 3MGGA 4PYKA 3TKAA 3R0QA 2WA1A 4F86A 3OE5A 5HFJA 4E33A 4PYIA 4X1OA 3G8AA 2NP6A 5GP1A 3UA3A 5EHIA 3CVOA 5DX0A 3OFKA 1NV9A 3GRRA 1G38A 1MJFA 5K0BA 3B3JA 4HH4A 5EEGA 2VS1A 5KYGA 3BWYA 3AY0A 1RI5A 3DXZA 5FTWA 3EVAA 4FT4A 3SSMA 1ORIA 2C7OA 5DX1A 2YVLA 1XJ5A 3TFWA 1NW5A 2VDUE 5KQRA 3KQYA 3FRIA 3AXTA 1I1NA 1RI2A 2AN5A 3Q87B 5LQRA 5K01A 5T64A 2AOVA 2ZWAA 5K0FA 1IY9A 5DM0A 5CIYA 3E7PA 2NXJA 3CJRA 2P7IA 4PYQA 5E8RA 3BGIA 4R8RA 2WK1A 4Z2YA 2ZLBA 1X19A 2CL5A 1QAMA 4V0QA 2ZFUA 2JG3A 3HCCA 2HTEA 5FHQA 2FPOA 2HNKA 3BXOA 1ZGJA 4CKCA 3C3PA 4PGGA 4RTPA 3H2BA 3TPZA 4FR0A 2PX2A 4PYMA 3HTXA 2PWPA 3AWIA 1BC5A 3EPPA 3FYCA 4X63A 1EG2A 5DRTA 5E8JA 3DR5A 1QAQA 1KP9A 1L3CA 1SKMA 1JQEA 3HA7A 2I62A 5T67A 3KQQA 5HIIA 2P3QA 1QANA 4JXJA 3HCDA 4RTRA 3HVKA 2Z6UA 5DSXA 4MQ4A 2JHPA 3I64A 1KPHA 4PWYA 2XYVA 4BY9E 3GCZA 3KR1A 2EFJA 1ZKDA 3C3YA 1AQIA 4EKIA 1XCJA 1AQJA 4FZVA
chains in the Genus database with same CATH superfamily
3BIJA 3DHVA 1PQYA 2JAUA 1P1IA 2HL6A 4RDHA 1AV7A 3FTNA 3I1IA 1XZLA 3OZTA 1C50A 3S1AB 3GP8A 1TX4B 1HYEA 5BT8A 1FVHA 1BU8A 2A9VA 2J7PA 2H17A 3EAQA 3HL4A 4RVUA 1W76A 4HEA6 1C3JA 2A4KA 2QTRA 4LZZA 4INZA 4XDHA 5BYAA 1RC0A 2B9VA 5LYJA 3KWLA 4U7TB 3PR1A 2JLUA 4RDCA 5HE8A 3CEMA 1FDIA 2BFBB 4TZ6A 1Q6YA 1TA9A 1NE2A 4NYJQ 1ACLA 1UCFA 2NYUA 3RC7A 3DHWC 3FCYA 3K53A 4L5IA 1S3SA 4XCQA 1QOZA 3DPIA 3K94A 4CFSA 2FRXA 3EEOA 1BG6A 1YAJA 3E81A 5K3SA 1MMFB 3LL4A 1YCDA 2C98A 2CMHA 5IXYA 1HV8A 2Q3DA 4NCBA 2JJYA 3BGWA 5ED0A 3FNGA 3V1MA 1NLMA 4BQIA 1GIAA 1KBZA 4C4TA 4V0MA 1J39A 3E7XA 3IH5A 2HCTA 4LRSB 1G1MA 1EDOA 5F12A 5FPYA 2SHKA 1IWPB 2WNHA 3L01A 2HGSA 4BKUA 2J9YB 2HQBA 4B6FA 2AKAB 4G0PA 3R8FA 3R09A 4ZOLA 4EHHA 1IN6A 2R6ZA 1GZ3A 3H1GA 3HSYA 1BDHA 4OXRA 3N8DA 3C8HA 3FHTA 1EK2A 1A50B 3MJSA 2BT4A 2QPAA 3GQBB 4GM4A 4EF4A 4BN4A 1SC1A 1KMHB 3KPWA 3EDQA 3ZV4A 1VJ1A 4H7EA 1OBOA 1JR3E 1QHNA 2SICE 1TJYA 2EF0A 3DZHA 4G5OA 4Y6SA 3B2QA 2W2LA 1T1EA 1X92A 3LCUA 1YONA 1E1QD 3T7SA 3NOQA 4YJHA 5C5DA 3ESXA 1YR3A 5JFOA 2XZDA 1O94A 4FVTA 2OCGA 3KYCA 3W9YA 3Q88A 2BUCA 2ZAYA 3GFQA 5L6MB 1J9ZA 3A2KA 1X7ZB 3HCAA 4JI5B 4JSYA 4QGFA 4DJAA 1ZK3A 3NVMB 3C5EA 4L0CA 3F6SA 2JFXA 4R3NA 4MYCA 1S9HA 2QMOA 3SIPA 1U2ZA 3SYRA 1II8A 4BBAA 4ER0A 7MDHA 4NICA 2GLUA 4H3HB 1ZK0A 2FEAA 3BB4A 4P5PA 2ZE7A 2I2WA 4DLZA 2D0DA 2E2WA 4EA7A 1I2AA 5JS1A 4TRNA 2M32A 1KO4A 1DEOA 2JFZA 3FYUA 5CURA 3ZLBA 2H65A 5MHTA 1ESMA 4U7HA 2ONZA 2K2WA 2RHGB 3MS7A 4D3ZA 4N1AA 4NEHB 3D7RA 4R9NA 3RNOA 3X1ZA 1KZ7B 4BOYA 3ECSA 3NAGA 1DG9A 4LRYA 2WU8A 1QV7A 3D3KA 4YP7A 1DLJA 1TGVA 3D02A 2ONJA 5IKPA 3MXTA 1NVXQ 4ILKA 4N3NA 3LPDA 1RWPA 1ICEA 4L15A 2HUNA 1R0BA 1MZVA 1DT5A 2QN2A 3SZMA 2RIRA 4EG6A 5KNCD 4BO2A 4HSEA 3FDZA 2KS6A 3KAPA 4D9CA 3DJYA 1QTIA 4QGSA 1E1CA 4BX2A 1DT3A 5JCOC 2N46A 1E0SA 2O3UA 2C9ZA 2Z2JA 1M2KA 1P91A 1JH8A 3I5AA 4I2VA 4MB0A 3QYPA 1P9NA 3CRNA 1HEIA 5J4HA 2C7PA 1FNCA 2I66A 2JK1A 4HWGA 4ISCA 3N8GA 1OXUA 3K6JA 4JXKA 1UR5A 1UC9A 1JDZA 1K75A 2Q9UA 2WSLA 4R16A 3SF8A 2QI9F 2YWHA 1E3EA 3BE6A 1A1SA 1H5QA 2GAJA 5CFPA 3VH3A 3H97A 1EE9A 1TZMA 1T2CA 1Z17A 4FZRA 4RVGA 2UXDB 1GTMA 4G6ZA 3CXRA 4OATA 3K1TA 1U6JA 5I9NA 4OUDB 1ST3A 2PZGA 4NK4A 1S0UA 4J3FA 2YMMA 2WWYA 1AF7A 3ETEA 1OPRA 1I4TD 5B1DA 4YQEA 4OHWA 3WYFA 4LTMA 4L0DA 2JIZA 5TQ2A 2NUAB 1A88A 5CVVA 4ACAA 1KVRA 3H16A 4O63O 4OHUA 1AXRA 5ELMA 1ZR4A 1C41A 2B8JA 2X9QA 3LFTA 5JD4A 3ENQA 4HDNB 4EY7A 1O95A 1LBIA 1M8PA 4OKSA 3SNKA 1NG9A 3CNQS 2BC9A 2QLMA 1MPTA 3LDAA 4JOCA 4ZTBA 1ZBQA 3LXXA 1PZGA 1ZU4A 4Q9NA 3OEWA 4R1MA 4L73A 3ACBA 3U0BA 4OOFA 5DBIA 1F6WA 2JIRA 3Q8MA 1TK9A 1I0IA 3FWHA 5KKNB 2QUIA 3NVAA 5UKDA 5MGNA 2IUFA 1SOAA 1EFPA 1UM8A 4MITA 1Z08A 4Z0PA 3T9EA 2NU8A 3UAOA 4D9FA 1E6UA 2R68A 3BXXA 1XVUA 3QVKA 4B5LA 1QZUA 2NO5A 3QUSA 3ROTA 3LSTA 5BPHA 3DTNA 2HZ7A 3ABIA 3LNCA 4RABA 2C4TA 4HRYA 5TF0A 2PT6A 5EIBD 4HXEB 1WOYA 9ATCA 4KNYA 2VWHA 2DE0X 2P40A 5LDHA 4J0KA 3VPFA 3WLAA 2GXQA 2Q1WA 2QSZA 1S3GA 2FG7C 3KTDA 3PIIA 5TX7A 5BNTA 3EZ6A 4R69A 4UE6A 1L5HA 4D9BA 1RWXA 2JLVA 3CINA 1JXMA 4JY7A 3HI4A 1YVUA 1A7UA 4ML3A 4XFDA 1I4EB 4YT5A 3TYXA 3LO5A 3VRHA 2HT1A 5EXTA 3U3ZA 1DKMA 1OXVA 1V0JA 3C7CB 3BMOA 4BQNA 1MHTA 4F4FA 5LIRA 4Q48A 1G63A 4GYWA 4KQJA 3GGGA 4YC7A 1U2TA 1YIDA 2R00C 3FRJA 3OFVA 1G5FA 3ZXXA 3FETA 4AMUA 3ZJ5A 3RLFA 3AFNA 4ZI7A 4EWLA 1JB9A 3WJAA 2RB4A 3BILA 3CCFA 5KI6A 3VV3A 4HBGA 3QMWA 1EVZA 3FUTA 2Z5FA 4PQFA 1FX1A 1RYYA 1FC0A 1Y4SA 4KIWA 4OI4A 1L5HB 2HBRA 4S24A 4BNKA 2AOTB 1JEDA 1MIOB 3KUUA 3DWGA 3OZDA 3W3ZB 2DFLA 3R3YA 3ICPA 1X1TA 2JA1A 2J3JA 3T9AA 4EYGA 4JHLA 4OJMX 4WKPA 5J5AA 4YV0A 1SB8A 2BZGA 4P0TA 3QTTA 3WAGA 1E66A 3FNEA 4P35A 1BWSA 1U0OC 1RFGE 2I8CA 4E5SA 1IAVA 4J0JA 5HHTA 1EYZA 1G18A 2JEYA 3UMJA 1Q77A 1TQ4A 4LFAB 3JQEA 1W44A 5JSKA 3L8FA 2V54A 4FBMA 3WL7A 3QWFA 1LJLA 2OFFA 1CUGA 5LXTB 3WGNA 1AGPA 5LMNB 3UIEA 4BKOA 3RT1A 1FU4A 2EFCB 5LM3A 1YL6A 3D5TA 2A33A 2H9IA 2MINB 1RAFA 2GZSA 3A1NA 1SC3A 1I7NA 3P7MA 2YZMA 4MHOA 5DZSA 3VMMA 4O4JA 3JY6A 1BD3A 4JC4A 3W90A 4COKA 1UAYA 2XXAA 3T5BA 1Z39A 2IODA 9GPBA 5B37A 1LDEA 7YASA 5LLDA 2GN0A 2B3DA 3FCXA 2WIKA 3MHTA 3O94A 3H2JA 1O1YA 4UDXX 1N3LA 3ACCA 3KX2A 1XQYA 3CQ9A 4L72A 3A4TA 1BN6A 1H23A 5F5NA 3P9YA 1YKGA 5KU7A 1HTWA 2BR4A 1DDGA 2HBZA 4GZ5A 4BJ3A 3NOXA 4M37A 2HA7A 3G0IA 4RZSA 2QD2A 1QC5A 4ZXFA 3UCXA 2C7BA 5JSQA 2HJRA 4DLSA 4QATA 1OVMA 4NV1A 1TB4A 5F51A 1V2GA 2XRYA 2DG2A 2HQOA 4NOLA 4IL5A 1RQ2A 2PZ8A 3LTEA 3VDRA 1FE8A 1SVWA 5KNLA 1LZLA 2V7PA 1M5UA 3D6MA 3BRSA 3MCZA 4X85A 4IMIB 1UOQA 2X7JA 3HKBB 4IQFA 4K87A 3WGHA 2OCLA 4EQ6B 3L40A 4IOKA 1KAOA 5HUQA 1HZZA 3EZNA 3UV6A 1MT3A 3P4XA 1COWD 1N0UA 3B1ZA 4AMBA 2XUKA 4XUCA 5U4QA 2ICAA 2ZRLA 4YMLA 1UBEA 2VSOA 1F1BA 1NYQA 2FSFA 2FZWA 4Z7JA 4R9VA 4G85A 2MJLA 3V32A 2V96A 4MYTA 1EX9A 5KHOC 4WDQA 4Q9DA 4HFRA 4X60A 1VIMA 3EZ2A 4MV6A 4N9QA 3BPSA 4DMLA 4E5YA 4JXXA 1F51E 2GS9A 3ESQA 3GU3A 3RBXA 4F5EA 1HE1C 3KUDA 4HAWA 4YRQA 3LFHA 3SX0A 1HDEA 4BVFA 3QVLA 2WLSA 2QTLA 4N0QA 4D79A 1CRWG 3IS3A 4D42A 3RRNA 1OKKD 1L2TA 1O58A 3COYA 3H3XA 3LA6A 3QLVC 4HTAA 3E53A 5JWHA 4DWJA 2Q3JA 5IEBA 3WIDA 5IH3A 4TRMA 3F1LA 4IKEA 4BEBA 2ZUUA 5JQWA 3VU1A 1FSZA 3KLBA 4A26A 4EJSA 1FTNA 3HN6A 4NZZA 1NIPA 4XYGA 4U9UA 4IOLA 2Z5GA 3TBKA 2WD7B 5K3CA 3CX7A 3EGXA 2BFDA 2Z2IA 6YASA 4WOCA 2HLDA 3DW1X 4HDOB 4KEAA 1RPAA 1X7XB 3NHLA 1VMAA 1T6YA 5CW1A 4L3VA 1MRSA 2DPLA 4W1QA 4MWZA 4MPPA 1GRRA 5EUBA 4W1PA 4A15A 5HCNA 1UINA 1T4MA 1IBCA 2VP5A 2ZIXA 4UMEA 5DBOA 2ZBFA 2NYAA 4L4SA 4W5TA 3DQPA 1V16A 1WUYA 5DHFA 2OHJA 2UAGA 5CD9A 1WVMA 1S8FA 1Y1SA 1D6SA 4JOSA 3SAJA 2WJ4A 1T26A 3K05A 3GRAA 2V45A 4L76A 1ORRA 4FFOA 3WADA 4X7PA 4QXOA 5C34B 4ZI7B 1KRXA 1B73A 1W9HA 5JYBA 4MP3A 3FPGA 5BYJA 4U0KA 5JYDA 3R3XA 1BEZA 2PXAA 1XLVA 4RZUA 2M6LA 5DM70 1JLMA 4ZREA 4UAGA 2DBYA 1AS0A 1TKRA 1VFNA 1GTG1 2ZCUA 2PSDA 4IHQA 1K4YA 1C7JA 2O7NA 3FNBA 3QEMB 4NG5A 1JR3D 4OXKA 4R1QA 4WJZA 3SQNA 5BR7A 3AF6A 2V4UA 3E0QA 5IWCA 1M72A 2CE2X 3A3NA 2RAPA 2YMPA 5I3ZA 4J4TA 5F4BA 1SELA 4E88A 5A02A 4NFHA 2O3TA 2FPIB 1F8UA 3B82A 1OGJA 1LVGA 2JFOA 3DBHA 1WABA 4ITUA 2H7YA 2BMAA 3CWCA 2CYAA 2F1JA 3DFZA 4JP3A 2F3RA 3R5XA 4B9EA 4CCSA 2RH8A 1J8FA 1RCUA 1SXJE 1GNPA 1HRDA 2ZRBA 3GJYA 3E15A 3KQVA 1N9GB 2YWRA 5BO5A 5BW6B 1ZIYA 3QX3A 2Z30A 2WA1A 3O4HA 4XVUA 5KVVA 1W5BA 1ZJYA 4N41A 2NP6A 2BLLA 1OYWA 1UP6A 1NJFA 2EJVA 2WFMA 4JN6B 4YJ2F 5G0UA 2IV2X 5DX0A 4OV6B 4Q6WA 4HQFA 3KVVA 5CM9C 1E0KA 1EPUA 2VP4A 5A06A 3UWDA 2M9MA 2BKUA 4Z6KA 2E85A 4L50A 3BWYA 3IIMA 3DXZA 1O87A 2ECPA 2I6QA 4Q03A 3BZWA 2JIZD 3JZMA 1KK1A 4KRYA 1JNXX 1OA0A 3SSMA 5DX1A 5EHZA 2QGZA 3FMOB 2B4TO 3TFWA 2E5LB 3T1VA 2J09A 1C9DB 1P5HA 3BIWA 3E18A 2RHBA 3EJWA 4JD5A 4PO8A 1C7RA 2WHPB 2X0JA 3G02A 2ASVA 2NX2A 4MVJE 5AJZA 3K96A 4G65A 1IZ7A 1MQ8B 2NXJA 3H1FA 3QLTA 3MAJA 4LYAA 4D74A 1DC7A 5CFRA 3VJMA 2VK1A 2JL1A 3CNHA 1YVRA 2RCYA 3VYVA 3WDKA 4D9KA 5B30A 1TYDE 6NULA 4Q0MA 3SBEA 3L06A 2YN2A 2ZJ2A 4XD7D 1R8SA 2CLSA 2IYWA 5EFZA 1DU4A 2OG2A 1RWNA 2J33A 3U1VA 3U7QB 4XGQA 4EEZA 1T6NA 2DXIA 3K9FC 1YTUA 2GT1A 4BMZA 2VRBA 4YRDA 3H5TA 2QMEA 3OCXA 1O0BA 1U1GA 1TFRA 3HCDA 1E6CA 1JQJC 3LZ6A 1O89A 3NRCA 4DN6A 3KYBA 4GFDA 2EFJA 5I9IA 3RE1A 3GLFE 1UBNA 5K09A 3M1YA 3ZGXA 1CVIA 2I0FA 5ITZA 1ISSA 3KQOA 1E7YA 3GRCA 1AUOA 2P27A 3ZHBA 3CYFA 4GYKA 3C5HA 3SS8A 3RVDA 5JR3A 2Q6VA 5GJVC 4O29A 1V5IA 5BMVF 1A8SA 4DAEA 1MB9A 3K6RA 4Y1EA 3TMKA 4C6TB 4JLKA 1MNQA 3FB1A 5FI5A 4DBLE 2PLRA 2CMFA 1R00A 3L0PA 5FRDA 1NXOA 5KNDH 3QKWA 5HKLA 2PS0A 1X8XA 3IUEA 4CU5A 1TJPB 3R7WA 4FD2A 4P36A 5MN5A 3EXEA 2EWWA 2XTMA 4DRZA 1XMIA 2AOUA 3CZMA 2ASEA 2K7ZA 3GPCA 4M8NE 4BWYA 9LDBA 1BW9B 1UF9A 4GOLD 3W04A 2UV8A 1P81A 1PFWA 2FX3A 5A3VA 3FH0A 2YH2A 2W70A 3B3QA 4BVHA 1HNNA 1VHQA 3HQ4O 4B85A 3LOPA 1H9BA 3IUPA 4PIMA 4PLCA 3ETJA 3ZDCA 2FPPA 2ILTA 4K8RB 3H1PA 3NNSA 4RJIA 1AV6A 4WY8A 1SHJA 4PZLA 4FGLA 3D6HA 2GA9A 4BLUA 1UT8A 3G5LA 3HU2A 2GYVA 3SD7A 4YJ2A 4PU0A 1QPGA 3LCJA 3AR8A 3MOSA 1AURA 1J2RA 3NM6B 3LZDA 2W6CX 1HG0A 4M7PA 3A25A 4NPHA 3MWDA 3ZJUA 2AB0A 2HPAA 4S1VA 5F2NA 3COSA 3CUVA 4CLHA 1B0AA 4V02A 1SNYA 4KMOA 1RMYA 5DHTA 2ROQA 1XMXA 3Q6IA 4Z0NA 4DCGA 4XRGA 3ZS9A 5HR5A 1UKZA 4WGGA 5ALWA 1W2GA 2NSLA 1I4WA 3AXSA 3W9BA 5JY1A 3GCWA 2FXIA 2B5OA 5EHQA 1M83A 2ATXA 1TGYA 2BGTA 2IYXA 3L18A 3TFOA 2JLYA 3EEIA 4RMIA 5FLXA 2YHBA 3VTAA 2EHDA 2CL7X 5CDUA 4OQPA 2FDCA 3MUFA 4DQVA 3I92A 5G41A 3SBXA 5JUWA 1PR1A 2QN8A 1N6OA 3WIBA 4BU0A 3SFVA 1OFVA 4TMKA 3N3AC 2DHEA 4ZRDA 1M2EA 1VRCA 5CIWA 5IC6A 2H0AA 3K8QA 1K97A 4TLEA 3HKCB 4G89A 4GX5A 2VPTA 4PV7A 3FUXA 1WMDA 2D5BA 4GX2A 1QR6A 1MVOA 1TVKB 3PDHA 3PRYA 4H7PA 3PC7A 2I4IA 2BFCB 2F1IA 2QU7A 4D0NA 2H0QA 5C81A 1Y5RA 3PC6A 4R4JA 1ZRNA 3HRHA 2VG8A 3QUBA 1RZRD 1M7BA 2G1PA 2BR5A 2QTNA 4ZOCA 3LIIA 3U7FB 1ML3A 2JB9A 1GG9A 2N3ZA 1VHDA 5JH7A 5JW6A 1CLEA 3HL0A 3A1VA 3ZKWA 3HP1A 3AF3A 3P71T 4W8OA 3K71B 3IBCA 2GYWA 3C8UA 3I1YA 4MKIA 1CW2B 3N6VA 8ATCA 2H06A 2V6BA 3GIDA 3IMGA 2W2VA 4AB1A 4D9HA 4F9GA 5HM6A 1T8TA 3WNBA 3WGUA 2UUCB 4C4XA 1GWNA 1UBHS 3O9VA 5JJ5A 5FTMA 1KETA 2D00A 3KB2A 4OYHA 5L3VA 4G5GA 2O1SA 4U7WA 5IARA 4XSVA 1B8NA 4LEIA 4C3UA 1Y9AA 1YQQA 1NMYA 3MSXA 4JI6B 4A8PA 2EJBA 4M53A 3C6QA 1XTVA 2IITA 4LMPA 1Y3CE 4EATA 3PKIA 3L9XA 1IQUA 1C80A 1GTZA 4ZHSA 2DECA 4F3NA 3L6CA 3FNHA 4CM7A 2Y66A 4HRVA 5KKCA 2Q6OA 2XMZA 1YVDA 2YY5A 4N01A 3U17A 3ULKA 5BV2P 3DD5A 4MDFA 3R44A 1SBNE 4KQ2A 3BAZA 2G9RA 1XEFA 3MGBA 3O8NA 5AJWA 3WL8A 5D7NA 2O7RA 3B1YA 4MARA 4OGFA 5CXQA 2WM9B 1P75A 2IYNA 2RGNC 5JNSA 2WVAA 1OWOA 1SVIA 4RESA 4G5HA 4XYEA 5ILQA 2W2OA 3QF4A 3CB4A 4PYLA 4FEAA 3GJSA 3KNZA 3PG5A 3ESAA 2YC2C 4OAOA 5FPTA 3F5MA 2EARA 4U2DA 4UUBA 2LIPA 4EL5A 3SDBA 4ND8B 4PR0A 1VGVA 1NKVA 5GONB 4AJJA 1P33A 5DP1A 4CV3A 1G16A 1NDHA 1KS9A 4M46A 3EYAA 2OD7A 4C1BA 3K0AA 4W5QA 4OA5A 4CV0A 1X80A 2BFFA 1QTQA 1QIDA 3O92A 1HK7A 3HHEA 3UB4A 1FNDA 3U81A 2QY6A 3BQMB 3N7TA 2ATCA 2AI2A 1FDUA 1TW2A 1U94A 2G0AA 3GOHA 3O3MB 3ZHVA 3Q0EA 2O3SA 2EZ4A 3NC4A 3WS7A 5ALHA 1DP4A 3NR2A 1FB5A 3FSRA 1RZRA 5EMMA 1HEUA 1NKTA 3FCAA 4DLXA 1PLLA 1M1UA 4RPLA 3FOAA 1HQYE 1P1BA 4RHFA 5BN3B 2WF6A 3N75A 2B2CA 1DG3A 3QFSA 4TMZA 4ER3A 2F6RA 1RYDA 4TSFA 3FTEA 2I99A 3WGTA 2WJAA 2VPXA 3F9CA 1SC4A 4LGYA 2VWGA 1LSOA 3GJ0A 3NBQA 1QGOA 2C3UA 2CB9A 3MMPA 5KMGA 2AXEA 1U4SA 1W46A 2R79A 3J80A 4MR8B 4XQ9A 3BE5A 2DLDA 3FDXA 4B9AA 2K5UA 1ZX1A 2DTXA 2Q5IA 1V5EA 1D1QA 3REQA 4JLVA 2JFVA 4AXXA 3ITKA 4GRIA 4C6TA 1ZLYA 4E22A 1B23P 4MX8A 3GLHA 1LH0A 3UUEA 4HNGA 4O4LF 1G2OA 1N4AA 1YC5A 2FPUA 1QRSA 4M0EA 2H54A 1T1SA 3H8SA 4IXNA 1NVVR 2GHRA 1U0HC 1C30A 1CUEA 5I4BA 2AUMA 1OA1A 3CMCO 1OCEA 2ECKA 4H0NA 4X90A 3V4PB 1WPQA 5K0TA 3M7IA 4WLNA 1A5SB 2CHFA 2I6TA 2X6QA 4H59A 5A71A 1ADYA 1Z7YA 3B6JA 4S05A 1YRWA 3HUFA 4OA8A 4Z9AA 5JWRA 5KEIA 1KJWA 2AMFA 3NS7A 4MQFA 1L5FA 3A6ZA 5K0ZA 1U8AA 3EEQA 3NJRA 4UUOA 4G26A 3DCJA 4XDYA 3ICEA 3JD3A 5AUQA 3FYUC 1JHPA 3WWEA 2CT8A 2QUJA 2W8BA 3UMCA 3LRTA 3VYWA 1WTAA 2ZJ3A 4YIHA 3E48A 1HLFA 1AY0A 2FUG6 2JAWA 4RK0A 1TVCA 5FNVB 5AWFC 2HF8A 1T35A 2ZS8A 4J8PA 1WDMA 5E3HA 1K86A 4GYJA 2FR1A 2FLWA 3ZWVA 2Z9BA 3PR3A 5DEOA 3WGGA 4ZO9A 2QHXA 4RIEA 3CF4G 3EZLA 1PN3A 3JU3A 4ZO6A 2D62A 5T3YA 4WLOA 5IXSA 3LM8A 4R1TA 2C77A 3OEEA 2JKVA 4FB4A 2G71A 3C39A 3GLIB 2MR5A 4XWKA 1U2EA 2A5GA 3FCOA 3R3HA 1KAEA 1QX4A 3TNYA 4KLNA 4DDKA 2OV4A 4Q82A 2RIPA 4KYUA 1NBMA 3MJCA 2NT4A 4ETWA 4Z7QB 3ZZTA 2UYGA 2DTDA 4A2WA 4KN9S 2XMPA 4IDAA 2PAFA 3WXBA 3IQZA 4JLNA 2HJHA 2RHLA 4MH0R 4A0HA 4F3CA 4DGSA 1HR0B 1P9RA 2HLNA 3EDMA 4LKOA 4Q4JA 3KJEA 2V7XA 2HREA 3KJIA 3C6BA 3RSFA 4BPBA 1F2DA 3GNTA 4GP6A 3VH2A 1RABA 1T9GS 2Z3WA 4FFMA 1SBQA 2R25B 1IWBB 3BYZA 2RHDA 3QHQA 4AWXA 2EV9A 4BWVA 4CDMA 2CVZA 2IOHA 2Y1WA 3AW8A 2VSYA 1XVIA 4FDVA 3STHA 4BFUA 1LVHA 2OXTA 4CKWB 5IG2A 3PC3A 3SVZA 1F8YA 1G5TA 1CJKC 1HDCA 3CX4A 4M83A 4BB6A 3NXSA 3UWMA 1U1DA 1UDCA 4CCYB 1UBRS 1HDZA 4UEKA 5TSDA 1H3NA 4CIXA 3QOWA 3RIXA 2R5FA 2ZJYA 4K86A 4M0LA 4CM9D 1MC5A 2OBXA 2P35A 1N2HA 2PT9A 3EE6A 3IOCA 3MOGA 4QUJA 4JJEA 1BE8A 3FUVA 3LK7A 3PJDA 5E0KB 4BE7B 3U3OA 5KC9A 5L53A 3FVVA 1PG0A 1PUXA 3OLWA 3QY0A 4ID3A 4YAOA 3NW9A 4XZ3A 1NQXA 1ZXBA 2YV2A 1YOVB 4K6FA 4X8LA 2GESA 2BM9A 4TKUA 5ALSA 2IXTA 3L0YA 4C22A 2GASA 1JJFA 2J3DA 4JIGA 4E0BA 4OHYA 4KR6A 3K0KA 3GOQA 1M1NA 4X7RA 1EVQA 3AR7A 4GMDA 1WZ2A 3EIXA 1G38A 1XZFA 3O82A 3QOFA 4Q9LA 2WF8A 1C4KA 4PR3A 1L5RA 2FPXA 4RIIA 1RQRA 2WHEA 1CP3A 2R4TA 2X4DA 2YNMC 5I6DA 4Q24A 3CVYA 1ML4A 1QB7A 2AFIA 1H2XA 1S02A 2AD1A 1PHRA 2PUAA 4IJUA 4KN8A 1QO0D 3E1SA 1GNQA 1AUQA 3L93A 1LI7A 1YA8A 3K5HA 3QU9A 1JXOA 2CXHA 3DTVD 1OZAA 2R7NA 4RCZA 3DYBA 1VLQA 3NX4A 4B3SB 1YL5A 1PWXA 2KM1A 2I71A 4YWHA 1GR0A 1K6JA 4BNZA 2R96A 2DH5A 1SHUX 2XLCA 1KQ3A 3ANSA 4TXNA 3L2OB 1PVDA 1QYWA 5EGNA 4RQTA 3UMVA 2A7QA 5CW2A 4BUZA 3WA7A 1B1AA 4JP1A 4W9NC 4LWQA 1E6WA 1RJEA 2GK3A 3DG9A 3GEPA 3FE2A 4IZIA 1J90A 4WESA 2GZMA 1PNOA 3KEOA 4REQB 3W79A 1XCOA 3AOEA 4EFKA 5HQ3B 3FXAA 1DBIA 5B1IA 5TPWA 4B8YA 4QDKA 4EB8A 5CB0A 3O90A 1SCIA 4GMGA 4NZYA 5K0LA 3HWX1 4QHSA 4WKOA 2PYZA 1A8QA 4IEIA 3WFJA 2O3JA 3B1XA 3N3BC 3IUJA 4LMRA 4RK5A 1OAOC 5EPEA 3WKDA 2AVDA 4DHWA 5FLKA 1HL7A 3OA0A 1MX3A 1E2UA 1IBRA 4MTLA 3ZOZA 2ZT8A 3L8YA 1W8DA 4JLPA 2GARA 4FHFA 4UTXA 4Z99A 1UH5A 1KE1A 3VU8A 5A3RA 5KREA 2P0EA 2LCFA 4WA8A 1ZI8A 2BM0A 4FW8A 4INPA 5FWNA 4DJTA 1H3FA 3F98A 2QRVB 1N1GA 1JG4A 1KARA 3PSAA 2FI1A 1B42A 3HXMA 3GFOA 1OB2A 2O0LA 2WIBA 4PC2A 2O8EB 3ZIAD 1RYZA 1FFWA 4AUEA 3K6SB 2HWUA 1MIHA 3BMNB 3AINA 1RLUA 4MRRA 3DNMA 3AERB 4EGQA 2QLNA 3E9RA 1ZJ6A 3LP8A 4WERA 1H85A 3DV0A 4FD3A 2C61A 1ZD9A 3BJMA 4MW4A 1Q1QA 4C4OA 3LCRA 2CZQA 3KYIB 4QRHA 1E4OA 3NO4A 2W0SA 3CU5A 1YRYE 5K3EA 4YMVA 1A9RA 4LK2A 4PZCA 4O4JB 5U9CA 3NEPX 1CSEE 1BRTA 4II3A 2EYUA 5T5QA 5JOQA 3KXKA 3MGGA 3NUGA 4LX8A 1QFSA 3N0WA 1N7HA 1TAQA 3FNIA 3KVNA 4O2RA 3EWNA 3STVA 3WQSB 1UBJS 2WD8A 3QE3A 3RU3A 1BHO1 1IM5A 1LNSA 2GBLC 2VF5X 3CVOA 3HZZA 3UJPA 4AI6A 8ADHA 5KOHA 5E4JA 1T9ZA 4PQGA 4MVYA 3AJ9A 4EJ2A 2QK4A 4REQA 4FYIA 1C9EA 4AJOA 3PEEA 4DC0A 2ECFA 2EBUA 1DIRA 1W9MA 2Q2OA 3HJAA 2QKYA 2HU7A 1REQB 3UM9A 4K0RA 4B7ZA 1U9IA 1XZGA 1RXEA 2OTCA 4WMLA 4XLTA 3KQLA 1TC2A 2LXNA 3E7PA 2Y1LA 1P2BA 4LV5B 1OYOA 1L6RA 4O2LA 3RG2A 1CUFA 2VNAA 3I4LA 1K5HA 1K88A 1Z4QA 2NAPA 1KEEA 1MZPA 2HNKA 1VJ5A 4MAFA 4MQEA 1DZIA 1GQQA 1SY7A 4W9NA 1F5NA 3RJ5A 3DAFA 4ZMBA 4GPTA 1N2EA 1X15A 4XIIA 1ZXLA 2CNKA 4IIJA 1C7ZA 1P7VA 1A1VA 1QAQA 4A8TA 4ME6A 2HV8A 4QJBA 2R7LA 4TVOA 4U5QA 4JB8A 1D5WA 2DLCX 1E3DA 3I9KA 221PA 2M1ZA 5FFNA 1IY8A 4QYSA 1P4GA 2CUNA 2F43B 5I7WA 1ENPA 3SZRA 4OFZA 4V0OA 1GA6A 1KH2A 3I6QA 1EGQA 2VBFA 4FFNA 4FI3C 4TV8A 4Y6OA 4KJZA 5CT4A 4LHVA 4W5JA 4ZRNA 1FUIA 1XRLA 1YE3A 1SIWA 4FOSA 4J49A 2Q6IA 5G1NA 3TBFA 2VT3A 2BYTA 1J2UA 1MJGA 2R1TB 2ZYDA 4GRDA 2CGEA 3Q3EA 4GL4A 4R31A 2F4NA 4D9GA 1W7AA 4M88A 4JENA 2ALJA 4PZ9A 2X9NA 4R8MA 3N59A 1BDBA 3FWZA 4G5FA 2IXEA 4PFKA 5KCMA 3GARA 4BQFA 3MJ4A 3F3YA 1DWUA 1ZSNA 2PHZA 3DO5A 3CUTA 4PGAA 1IHOA 1BHQ1 1R0LA 2A59A 4JB0A 4Z9FA 3EMDA 4HRAA 4WK2B 1QQ5A 4CKWA 2HX1A 3K16A 4EJFA 1XUOA 1H42A 4GVXA 3REFA 5K05A 1GHTA 3D8SA 4KDEA 4MGIR 3MPOA 4NNPA 4XX0B 4Z54A 2C5AA 5IW8A 3OOYA 2RGWA 3IAS1 4EENA 1QJCA 1EX6A 3N1UA 2DR2A 2GBIA 2Y6VA 3CNEA 1GZ5A 1Q83A 1SFRA 3HU3A 3KWFA 4P9NA 4YI3A 5BWLA 1U1FA 2CNWD 1LPOA 4PXAA 4RH0A 1COWA 4BJHB 4Z4FA 1E79D 2UVDA 3HVHA 1Z56C 3KE9A 4ZPXA 4GSKA 3CXUA 1A4IA 4IJKA 5KYVA 3U4QB 3CNBA 1H0SA 1MKYA 2ZUTA 5IT5A 1R8JA 4AZWA 2GD2A 2C78A 1GFIA 3I2HA 2JI4A 2H51A 3U62A 3ZHCA 4CF7A 5CU7A 1Q7CA 2FP3A 1GKUB 1E9DA 2WQZA 1RLOA 2YV1A 3EK2A 1R6VA 4MINA 4WLFA 3STXA 2NVWA 3M49A 4FFSA 1W36B 5AXCA 2F4VB 4GLJA 1RS0A 1R6BX 2IW1A 3FZNA 3L7DA 2PEZA 3OQNA 1DSSG 3FPKA 1XK6A 1CYEA 4X20B 5BT9A 5F3DA 4RXUA 4NMLA 1MB0A 2QM7A 3QG1A 5T8KA 3WMRA 5LWHA 3HEMA 2PKCA 4TV9F 5H68A 1QHEA 3OZFA 4PZ0A 5BV0A 2Z5VA 4M1ZA 3F6BX 5FWAA 3WR5A 5C9ZA 1NBHA 4OL9A 4NE9A 4US2R 1FP1D 4OB7A 4YMWA 1VL0A 4RFVA 1FTWA 4G84A 3UMRA 3U3DA 3LDHA 4EZBA 3P9IA 1Z13A 2R44A 1L5VA 4HEA1 4XGKA 3SX4A 4YEDA 1GZSA 2A7XA 4DXDA 1CHNA 4HQRA 1B15A 5JSZA 1UOOA 1ZGBA 1LS6A 3DDOA 4D56A 3IDSA 2R87A 1F6DA 2X23A 2ILVA 5FJIA 4E1AA 5KHAA 1UBSB 4KTVE 4DLBA 4JV5B 5H80A 4E31A 4D43A 4CM8A 1MC8A 5EUQB 2OV3A 2QM3A 4LRQA 1G21E 3LAWA 4CYMA 5BN4A 10MHA 1VPLA 1Q19A 3DE1X 3EVDA 4EDFA 3L6DA 4XDZA 1EAMA 3VR3A 4YPFA 4BNTA 2PGDA 4MP8A 3L7YA 5FT9A 1N6LA 5C8YB 4LY9A 2VK8A 4RCYA 4OL0A 5LQSA 3ZWQA 4E4RA 2PVSA 2ZZKA 5C3UA 5K45A 5LR6A 5ALNA 4DV5B 3CLUD 1II8B 3ZCTA 4X66B 1S01A 1KMNA 1V4NA 3N0RA 3NHJA 4LJ6A 1HM5A 3QUTA 2AKYA 5GMOA 2DWOA 3KUCA 5H4HA 3DL0A 3JWJA 3Q41A 2QRNA 1YIOA 4OHKA 3QE4A 4F6RB 3KBOA 3M6LA 1RSZA 5J2TA 1DE0A 2GJSA 2VH5R 2AG1A 2WTMA 3QFCA 1CYDA 4I5DA 3EQ2A 1DJPA 1U8FO 2HA5A 3KXLA 3PD0A 2ZKIA 1DAGA 4M98A 3MVEA 4UJ5A 3LPAA 4U7GA 1B7GO 1JIUA 1DS6A 1J1UA 1J7JA 3HKDB 5A2QA 4KQFA 4C7MA 2G9NA 4EJ6A 3C1AA 2VYFA 3OPXA 4DIBA 2G0TA 4DXAA 1W2WB 1UWKA 3WAJA 2JFUA 1KZ4A 1G8SA 4R84A 4UHKA 5DPMA 1FIUA 5AM0A 2VRCA 1GV1A 2FRDA 3LQRA 5BV8A 4WXPA 1UPUA 2A9PA 1RXSA 1YMVA 4QUHA 3TW6A 1RJ9B 5IVDA 1BE0A 1XJCA 2OGTA 3SLKA 4C87A 3MG9A 3E1KA 1NSFA 1L4FA 4FILA 5TQVA 3O93A 5AVVA 3G59A 4FHDA 3NHUA 4ZOLB 4F92B 2GHQA 2BGGA 4LE1A 2XUJA 3STWA 3RPEA 3SYTA 4RFLA 3CHYA 4B31A 2ZRGA 4A27A 1I13A 4WXEA 1XXHA 3QKRA 5ECDA 2ORIA 3WYNA 5ADHA 3DEJA 5LA6F 1G6OA 2XCRB 5KNBA 2NOAA 3F71A 5B36A 2TS1A 3R8CA 3TE6A 3QNUA 5EINA 3MIZA 3PUXA 4NAVA 3AJDA 2EJUA 3CX3A 3OQBA 5EMLA 1YRHA 1PZHA 1W4AA 1DWPA 1N6RA 2C4MA 4NJOA 1ZGGA 2C7QA 2GM4A 5IYZF 3W5AA 1QONA 3KUKA 4FFLA 4J1QA 6CHYA 1SEPA 1FUKA 5A1TA 1JILA 2X2OA 3MQ2A 4RTJA 1PR4A 4ND6A 3AFIA 4QGAA 4RLFA 4MV5A 4R71A 3ADOA 3IERA 2YL2A 4NU5A 3KJNA 9MHTA 3GLGB 1MOZA 2ENUA 2JS7A 1AK1A 1GKKA 1RMTA 4U2KA 5H59A 3WNQA 1RAEA 4DY6A 5GONF 5BQPA 3ZD8A 1WHSA 3CLKA 1US8B 1O9GA 4R40A 2V03A 4L16A 1XFAA 2G17A 5EJFA 1ZKMA 7MHTA 5KTRA 1NJ8A 1NW8A 4CMBA 3EVZA 1N77A 4TMTA 2PMWB 3MK31 2O19A 2JDIA 4DLLA 5EZ5A 2V7UA 5HF5A 2XZTA 2C2HA 3WBJA 3ABSB 2I2AA 3HGQA 3QU2A 1WLSA 4DIUA 1KEKA 3DVSX 3LHFA 3V5NA 4DNOA 2XZLA 3RVOA 5A03A 3TJRA 4LXHA 1SU7A 1OROA 3KAQA 4KQXA 3GRKA 4AJ1A 4KITB 1Z6ZA 4RS3A 4C03A 5JDIA 3ORFA 5JH7B 1DVRA 3KQHA 3L7AA 3I8XA 4RTOA 4DV1B 3S0JA 1MO3A 3ZQ6A 5IDQA 4ZAFA 2R00A 4ZN6A 2GPNA 2WF5A 4NATA 4EPTA 4UHHA 4FWIB 3MLAA 1C8VB 4KSYA 2PBFA 2C4WA 2KHZA 2P5SA 2XB6A 4WJKB 1JKMA 2HK8A 3UN1A 2P2DA 4F4HA 3HVJA 3K1AB 5AH0A 3PDCA 4EAAA 2V7VA 4B17A 3FYDA 3SS7X 5I9MA 1SIBE 3OJXA 1ZESA 1T9GR 3GNSA 1EVLA 4JEHA 2PQMA 3PXCX 2PSSA 4JP5A 2HLHA 5AKYA 4R83A 3U9LA 5KBYA 4JXZA 4EKDA 3A6DA 2WY2D 1CXZA 4DUZB 2GCEA 2X5OA 2FHSA 4RSGA 1FS6A 4LJ7A 4DOMA 5CDFE 1R8YA 2OFXA 5WRFA 3U3XA 3P5SA 4MR9A 4MB2A 2UVPA 1G6HA 4AURA 4WOPA 4FJ1A 5KVCA 5C8XA 4HGOA 2ZXEA 1DOAA 1BX1A 4M1QA 3QA3E 1ZOOA 2XQKA 5IF9A 2CXNA 3V3TA 4YMGA 4ODIA 3CVXA 3EISA 3LT4A 4QPJC 5EKSA 2QLTA 1WZIA 5FKJA 1VFPA 1MT0A 5P21A 2OZLA 2E48A 2IDJA 2W00A 3FBGA 3PRKE 1V5WA 5DXAA 1MD9A 3GCDA 4Q7LA 3VSAA 3KALA 4ZDKA 2JBWA 1Y1TA 3VC2A 4Q37A 2KQUA 2LIVA 1ZYUA 3ILVA 3QWIA 4IYJA 1TT5A 3O1LA 3FCUB 4LRUA 3ZBUA 3ZZNA 4BIIA 1KK0A 1NF9A 2WJPA 3C87A 3D8NA 4BMOB 4PSKA 5AESA 1FW6A 2BUAA 2RK6A 2QRJA 1ZVMA 2Y1EA 2BY4A 5B53A 4NBKA 1XIVA 1TCBA 3IEXA 4WZAE 4KVFA 5EWJB 1L4UA 4R7GA 2BP7A 4FFWA 5E7QA 1AUPA 4X20A 1M7HA 4FKMA 4XD7A 4P53A 4PYOA 3M5WA 5JIBA 3IR6A 1VCNA 3FWKA 1EFRA 4J29A 1RYNA 5AT1A 3I9LA 3W3AA 2ZRAA 3CUWA 3KB6A 3AGPA 2IL1A 1XKXA 5EHNA 4JNCA 1GN8A 1FJGB 4FN5A 1TK2A 3W7AA 4QVGA 2G88A 1QORA 3H2ZA 3PYLA 5IYZA 1FMCA 1B8OA 3HEAA 1BXRA 5TVKA 3PUIA 3R6TA 1J2YA 1RC1A 2ETXA 4N0EA 4F9TA 2P5TB 3A7DA 2FG5A 3FTFA 2J3MA 1J5PA 2FCAA 2P9HA 2VHTA 2ZYTX 2AV6A 3D59A 3Q5GA 3NKVA 1PDOA 1DV2A 2ENWA 4IY1A 4CM4A 5JPCA 4FM9A 5KO2A 1JKJA 3OIUA 1I6LA 1YS6A 4NBLA 3BGSA 1Z6QA 3UV3A 4BFTA 3HXKA 2XGMA 1EXMA 1RPTA 1BJTA 4IFTA 3FOZA 1BO6A 1KJJA 1MH1A 1FRFS 1YJAA 4YJGB 3KFXA 4NZOA 2CLFB 1E9AA 2W6ID 3UMMA 3J81A 1TUEA 1R6DA 4NPAA 3M6XA 1IOVA 4ZJPA 3SHFA 4BMVA 1WXIA 2ZRFA 5CG2A 3ITNA 2AFVA 2CVFA 2B2NA 1VPVA 1THMA 2AJ8A 2BFPA 2GN8A 2O2JA 3AESB 1XYVA 3FKJA 4JEIA 1UFQA 5DSTA 1G0OA 3HADA 3T9BA 3SYMA 1QVVA 3UAGA 3ZWAA 4PIVA 3F2IA 4PLGA 4LKRA 1G20B 5I7VA 1C1XB 1D8AA 1NV8A 4H3SA 2AI1A 1YULA 3O7MA 2OB1A 5EIBC 4F5WA 4FT2A 3GQVA 1IEVA 4WIAA 4JI0B 2AZXA 4UEJA 2DZDA 3RU7A 4BGEA 5K8UA 3UKOA 4N7MA 1UC5B 4J16A 1D9ZA 2GM9A 3RIGA 1Y5MA 5J2TF 5FFFA 5EN4A 2J31A 4L07A 4BQRA 3MINB 4LZPA 3ZLJA 1R3DA 1NVGA 1YZVA 1CQWA 3IIJA 3OIVA 3WB0A 4E1BA 4YCNA 2HR1A 2QW1A 4OLAA 1XZJA 3PNSA 3SKVA 3SEAA 4OMFG 3TQFA 4YRNA 3FAKA 3V2HA 2O2DA 1ZJ5A 2Q5LA 1YHZA 3CSUA 4RV9A 4OKNA 4FDMA 5GAJA 2VSQA 3ZWYA 4UW9A 3AEUA 3OQVA 1DKQA 1E8MA 1SVKA 3O3NB 3O75A 4WV3A 5A9SA 4GSYA 2BI7A 5FWDA 4E2WA 4TZTA 3I4CA 1K1EA 4KQ1A 3OU7A 4J43A 1RADA 4E3WA 3KD2A 4MUIA 3R6LA 2BBOA 4FYVA 3GP3A 3GFVA 1K3TA 2ZUWA 2II6A 4YUXA 3ZQKA 1QDUA 3CPEA 3MMNA 2ZBEA 2UUOA 3CJQA 3PXUA 1OE0A 1K68A 5GINE 4RSRA 4A91A 4L6CA 3QENA 3IQWA 4UNNA 4YBRA 4ABTA 1QHHB 2HLDD 3EMVA 1U1IA 3FIJA 3K8OE 5AFSA 5ADWA 2Q45A 1N5LA 1XLTA 3UKJA 3TR6A 1V95A 4ATNA 3WK6A 2G3YA 2Q6LA 4FIZA 1X77A 4LV6A 2F43A 2EFDB 1EUDB 5KOHB 1JDJA 4UMDA 3S2YA 1W34A 2WD9A 3OPYB 2ZIEA 1EZZA 2RI1A 4P33A 4F93B 2E4UA 2Y0CA 1Q95A 1CZLA 2PUBA 4PZAA 1ZN9A 3C7TA 1Z2DA 2HCFA 4N54A 4HJXA 1PR2A 1B2RA 2IZ0A 2Z2ZA 3HBFA 1T91A 1K8ZB 3W6ZA 3OZWA 5BR4A 3QP9A 4ILEA 4ZYTA 4A03A 4BNLA 1T5SA 1MV5A 4HDSA 2OXEA 3IUQA 1XDZA 1RAIA 4MVJH 4JBGA 4FGJA 1ZUIA 2DY1A 3O84A 1QDEA 1CJUC 4E33A 1UOEA 4EG3A 2FGKA 1M8JA 3IOYA 4KMMA 1KQOA 2YJTD 3HSSA 3JRXA 3RFTA 2Q1SA 1CRPA 2FUG1 4XIJA 4OXQA 1M0WA 2XXJA 3LPNA 2FKNA 3SEFA 1A8UA 1QK3A 1ZVQA 4M9QA 2VS1A 3OUZA 3ZNQA 4I55A 5CLIA 4BFSA 5FUQA 3B13B 2WJ6A 4A0SA 3FOBA 3B52X 4JLUA 1U98A 3HI6A 5A3QA 2ZJFA 5EI5A 5K8CA 3AZQA 2F7SA 4F06A 3QF7A 2QM8A 2VPZA 1QIMA 1UQUA 4Y9TA 3ROQA 3UGQA 1YXMA 3S2EA 1WXHA 3JYHA 1T4BA 5K0FA 3FNFA 3GA7A 3D8UA 4YP5A 1I3CA 3PDIA 3RAPR 3SSAA 4WPGA 1T8UA 2C95A 4OK5A 3TLBA 1KWKA 2JG3A 1PFQA 2RGCA 3KXDA 2Y6UA 4N3AA 3GLHE 2FPOA 4FBGA 1HC7A 2R65A 2W71A 3BD9A 4RTPA 3RAFC 2V0GA 1MORA 4BKPA 4C3OB 1EDBA 1RRFA 1QV9A 5B1HA 5F9MA 1D6JA 4EJSC 3FJ1A 4G0WA 2A0YA 2QF7A 3A04A 1C2YA 1TRHA 3I2GA 3HA7A 3Q3GE 1C7EA 4J7CA 5LPNA 3KQQA 3QTBA 3O83A 1GNLA 5LJIA 1KWGA 4PN3A 4JJ8A 1HTBA 4DKXA 4WJLA 3K9HA 1KPHA 1XQVA 3RQSA 1PUIA 5L6LB 4NZPA 4HZGA 4KN6A 1NYTA 2PQ6A 4DMMA 1AQJA 2WP8J 4UFPA 3NHYA 4OIFA 4CXMA 2Y3IA 1I4LD 2Y27A 1WW2A 3VSBA 4IVRA 1QR2A 1V9CA 2OGSA 2ZZNA 3ZHQA 2K6GA 1L1QA 4W6QA 4OI1A 4RE6A 1PV2A 5B6IA 5CFOA 1ECBA 1XX6A 1N5MA 1LPSA 5FAKA 3HJFA 2WA2A 3EXFB 5IFLA 2FQWA 1NU8A 3LCCA 4HAUA 1XNHA 5F64A 1Q22A 2X0RA 2Q0SA 3O9ZA 1LNQA 5DCLA 4IH4A 2H2IA 1U5AA 4WLEA 4RSMA 4WKBA 1WB9A 3RS0A 4BFWA 5BSFA 1JPNA 2NZWA 1B8PA 3BDAA 3FVTA 2ISSD 4GQIA 4ETIA 5MN4A 1GGKA 3R9IA 2YDXA 2C8JA 4I8DA 1L8AA 2R1VB 4L9SA 4M22A 3L82B 3AHEA 1OH8A 1FFBA 1U2PA 4Y2GA 1QWSA 2VSFA 1SRQA 4IIYA 5H3LA 4WUTA 1XC7A 4UHFA 5ARBA 2VQFB 5HBRA 2G7ZA 1W4BA 3RUEA 1CUIA 4FHEA 1ZK4A 5JZMA 1VL5A 1XEAA 1LJ8A 1WB5A 2FWIA 3I9V1 2ZCVA 1RLJA 1YZ3A 4OQQA 1H9CA 4R7TA 3L7OA 4C6RA 3ZHXA 4IDGA 5BPFA 2MINA 3ME5A 3D7MA 5IJWA 1CIJA 3SHVA 4PG7A 1RCFA 1QHXA 1L7BA 5THKA 1BDJA 1TCAA 3ZH2A 1TXGA 2V9CA 3SLGA 1OB5A 4KIGA 1Z7BA 1FP4A 4G67A 1Q12A 3P26A 2HU2A 2NXWA 3JQ8B 1OTHA 4DZZA 2P9BA 3NONA 3GR6A 4AKEA 3GEIA 2PJZA 5BQXA 5K8LA 1WXDA 2QQGA 1Y80A 3IVMA 4L7VA 5E1DA 3C3XA 4DV0B 4CKEA 4FGWA 3C41J 4QRDA 1JFLA 4GF5A 5EIHA 2FW7A 4G07A 4Y2SA 3ROZA 1DTSA 1U7DA 4EYOA 1DC6A 1YZGA 4HO1X 5DRYA 2EEZA 3URKA 4AL4A 5AUPB 2GXAA 1AG9A 2A1TS 2DUUA 4OGWA 4QPNA 4R8SA 4GOOD 3VBCA 5IKMA 4R3WA 4U2EA 5REQA 3UKDA 5DX8A 1E2QA 4G1FA 3UAVA 1TCUA 4ZCRA 1EGMB 3LYAA 3IJEB 1JPUA 5KYTA 5FWXA 5KZMB 1TQDA 2G9VA 2IHZA 4LC0A 5H9WA 2DHQA 1ETUA 2BVNA 1VTKA 5IUKC 1RYHA 2N47A 1O6BA 2XHEA 3GX1A 4H1UA 4LZOA 1U2DA 4H77A 4J0EA 4BO3A 1MGPA 3VHRA 1DQZA 5LSAA 2MTBA 1EGHA 2P9ZA 4NYMQ 3O4RA 2AEJA 4ZT4A 2IXGA 1Z4MA 5F1OA 3ADBA 2BF4A 2GUWA 2RG7A 1T0IA 3TQHA 3ZCQA 5FI3A 1WUIS 1MQAA 1Y1LA 4B34A 4B3TB 1ZJJA 3I5UA 4I19A 4YGXB 4FSXA 2FP4A 2PLWA 4R2KA 1QK5A 4QTZA 2XE6A 4CTNA 1WNFA 4URZR 3RUHA 1IBLB 4CN8A 1KH1A 3P9RA 2X2EA 1DBVO 4FMDB 4ESEA 1GTRA 2WT4A 2XMSA 3JATB 3OIYA 3TVYA 1QQBA 1Y42X 2V6IA 1JHXA 1SHZA 3VA7A 4KE7A 3OPNA 4U2BA 1BFDA 1YMUA 1Y37A 2IYRA 4GUAA 4DMRA 2A3NA 2HKIA 1CQPA 3DXYA 3ZGZA 2UZ1A 1NXXA 2V7BA 2JHGA 2V0CA 1SXJB 4M8SA 2Q1TA 1QQ7A 3GAZA 3LKDA 5LB4A 1BTOA 4XQEA 4DM4A 2XNSA 1D8TA 1UPXA 4W5NA 1P3DA 3LA8A 5CFNA 3HP4A 3L05A 4Q3OA 5D84A 1NMZA 2Q3HA 2XUIA 5DMXA 4J16C 4BO9A 1WUTA 3HCEA 1CDOA 5FL3A 3SGLA 3G2JA 4AP9A 3WQHA 4B40A 4EG5A 1QIHA 2Z2YA 1JSRA 2HK7A 1W30A 1PFYA 2JGKA 1PJTA 5JCJA 1JKJB 1YBAA 3DDSA 3F47A 4HYYA 5CB4A 3FF4A 2D2FA 2ESRA 3KFLA 2XYQA 4H7JA 1IOLA 1F4VA 2O8NA 1J4AA 2X1HA 5KTYA 1OFUX 4HLDA 2AEMA 3HY6A 3GMIA 3SPXA 1BXRB 1J22A 2JIBA 1L8QA 3FLBA 3B6ZA 4I1RA 3OKPA 3SE0A 3ZHYA 3O91A 3WJ1A 4AKSA 4BNWA 5INTA 2FWAA 5CYFA 1YCHA 3MIIA 4I9NA 4MLDA 2HA3A 2QMUA 3PEFA 3I42A 1CVLA 1OGYA 4TXJA 1HURA 4DQXA 1FP2A 3MRSA 1E6EA 4MW2A 3U9TA 4QHTA 4NDAA 4JJZA 1ZNQO 4ZHQA 3DL7A 1C8LA 1IULA 4HNAA 3WJ2A 1GLNA 3BSFA 3M3HA 1GV0A 1Y3AA 2GZHA 2J41A 4KNVA 3ZK8A 2BDUA 2ONKA 2WG0A 4G0NA 4NCJA 4P0PB 3TE7A 4ZEMA 3IV7A 5AVRA 4QE3A 3KFVA 1SHLA 3R7LA 4NR0A 1XRNA 5HILA 3WLNA 5HJ2A 4FEYA 2RHCA 4ESVA 2R6R1 1RHQA 4LXXA 4A16A 3K09C 2QMYA 3HWRA 3WC4A 1JDBB 1K2VN 2DTEA 2ZSBA 4EHNA 1ZR2A 3HB0A 3WMEA 3VNVA 3ENVA 2XSZA 1BHJA 5EP2A 2GZ3A 3G0GA 2DSNA 2J3HA 3RFFA 1CUDA 1KI7A 4IDDA 2F1HA 4TSFD 1BKSB 2WJGA 5LKAA 1IUOA 2A57A 1M33A 4AMYA 2D2VA 2Z04A 3BQNB 3FMIA 4NDNE 4YRPA 1ORTA 3SMVA 5E7IA 4FJ0A 3I5XA 2J0SA 3QVXA 2C03A 2NO0A 3RIHA 2Z8ZA 3VJLA 4W5HA 1M76A 2D7DA 4ARUA 3Q3CA 4BNDA 3BERA 4A0GA 3T9FA 3VR5H 4IQ4A 1R4AA 4K6HA 3WLHA 3B5EA 2Z9DA 3KK0A 1JEAA 5A4MS 4D2IA 3Q1KA 2P1RA 1PG5A 3L7IA 3URMA 5BN1A 1IONA 2QXUA 1GG8A 2V8BA 3LX6A 2Q27A 4F2HA 5LFAA 2P6PA 3B7PA 3HNOA 1IL0A 1U9JA 2HA0A 1EA7A 2XJ4A 4HNSA 5EZYF 3SK0A 1RWQA 3AIIA 4F3YA 5J2UF 2DHDA 2Y0BA 3OOJA 3VSEA 3Q72A 4UU1A 3O95A 1Y6JA 3CRZA 5BRAA 1ONBA 2HMTA 1GUYA 3AQ4A 4EHJA 5KSWB 1SBYA 2I6UA 4MWEA 4Q9HA 1GA1A 3UJNA 1W6UA 4LOIA 4WAUA 5EFOA 4DG9A 4HVCA 1NONA 5C0OE 3AFHA 1EM6A 3V1TC 1AUVA 2DY0A 4S2EA 2G1KA 4OO3A 5FO0A 1M10A 3UOAB 2VHXA 3BJEA 3M6MD 4WXHA 4BQEA 2EJTA 5CPFA 1E5DA 3I9MA 2FEOA 4URWR 4CCYA 1DBRA 1GN9A 3PUJA 4ZZ0A 4V3CA 1Y1QA 4FYMA 1GQYA 2IGTA 1AKUA 4WFJA 3DA8A 4M76B 4YFYA 4YUAA 3O8OB 2H0RA 1VXOA 3OAAA 3PNVA 1F20A 1A71A 3GFTA 3P2EA 1GZUA 1I3KA 1HOXA 1XHEA 2X86A 3WNZA 1KYYA 2JGDA 2GFQA 1CR2A 5CTAA 1BE6A 2PQ2A 2XCUA 3MCUA 5JS2A 4OJQA 4KI0A 1TW3A 3OZUA 4DVGA 4N5NA 2HXGA 2FMXA 3LYUA 3LBNA 3R5JA 1JJBA 3ELDA 3Q1LA 3P5BA 2VP3A 3NIFB 2FEXA 4IH9A 3LJKA 3DHNA 3L0OA 5F73A 4IS3A 2X40A 3N2IA 3BDVA 5DF1A 2CFCA 4YUWA 1ZNWA 3RGGA 3ZCSA 2HPZA 1V1JA 2PCLA 3NJ8A 4U7PB 4TWRA 5L3QA 1EUZA 1ZL2A 3LCMA 5ICFA 3WGOA 2VJBA 3E3MA 2HU5A 2CN1A 2ZYSA 2QD4A 3IIEA 3MJVA 1E60A 3OI7A 3W2GA 4C0WA 3HKCA 4YJ2B 5SZJA 1KJQA 2O2ZA 1I32A 1XDSA 2P90A 2BP7B 3T12A 2C07A 3ROKA 4JT8A 4LJ8A 4NH4A 3RYTC 4NSNA 2WJJA 1YZKA 3LG2A 1BRMA 2I7XA 4XA8A 1C9NA 1J07A 2ZSAA 4YJGA 5CXSA 2XVZA 3H19A 2WTNA 2GMWA 2XNJA 4LUCA 3U1TA 1PFKA 4QM6A 3LGXA 1JG1A 4ARSA 3B20A 3PQ3A 1EFCA 1MHPA 2XNHA 1V7ZA 1I3MA 4OPMA 4YK7A 1DKLA 3HP7A 4CM8B 1VJ0A 5H4GA 4CLEA 5IC5A 2ZBRA 1LQTA 1QVWA 1OGIA 1E3WB 2B61A 1YZUA 1AKVA 2BEJA 3EHDA 3EZ7A 3OKFA 4LDJA 4UBMA 3RHZA 1J21A 3HBAA 4E30A 5ALUA 3V48A 3CIOA 2XUPA 4BKRA 5ECGC 3H0EA 3UK6A 4D44A 2JCSA 1I0LA 4DREA 3I9V6 1JS1X 1MVNA 3OO0A 2REOA 4KWHA 3TLYA 1LDBA 4DUPA 3ZBTA 2O5VA 3PJEA 3W5BA 2VDJA 2WZCA 1XROA 3GO4A 3IA2A 3IQDB 4RPHA 1T9AA 4M7RA 4YCAA 3FYHA 3H9JA 4IIEA 3FR8A 1NZDA 2O8FA 4BB9A 2YWGA 2O2CA 3ZDZB 4R8VA 1ULUA 2ANCA 2P8SA 3LP6A 5P8WA 4WBNB 2EHJA 1HG1A 2Q3EA 2VJNA 3MNFA 4U8GA 2Q28A 3G5TA 1XLTC 1MXFA 1V41E 2FAXA 3LGAA 4EKNB 3ANXA 3LECA 3ZHTA 1W4RA 4X62B 3U7IA 1GFWA 4RD1A 1E77A 3RVNA 2UXBB 4IMPA 1UBKS 2WT9A 4FNOA 3RT9A 4OK6A 2A6PA 4EX6A 2ZYUX 2HRCA 3D2CA 1ZOPA 2H1FA 3CT6A 2VYNA 1LTQA 1WXXA 4QC2A 3R3ZA 1Q1EA 1VKNA 4ZVUA 4WZ6A 4DYVA 1V25A 1AKRA 5EXDA 1KPIA 1OLSB 2PL9A 2UZIR 3HV0A 1VLVA 3OFSA 4TSRA 3T4XA 1QQAA 3EIOA 2G5CA 4NBUA 2HCRA 3GP5A 3VNAA 4BZPA 2BTEA 3TNLA 5AKZA 2FP4B 5MFPA 5ALTA 3I12A 4PLWA 1PJCA 2RJ3A 2ZJZA 1CQXA 1WVGA 3HCWA 4R51A 5CM2Z 1YIAA 3E4DA 3KDPA 2P2CA 3U4IA 3RH0A 2JGDB 3JYOA 4B6QA 1DTWA 5E9QA 5JDCA 4MW1A 1T10A 1PJZA 1G64A 3LC1O 4MVJI 5KYXA 2QRLA 3HLKA 3EVGA 5K3AA 4HQNA 5SZKB 1KI3A 5A6SB 4KBYA 1T43A 3GRFA 2VHQA 1KOFA 4OGKA 3ZQ4A 3L1JA 2LWIA 2OHHA 5ESRA 1WETA 3T7JA 2XGSA 3GLGA 3SHQA 1SXJA 1N8NA 2RH9B 2Q5CA 6Q21A 1NATA 1E4YA 4XB2A 5IBRA 1JMYA 2PGXA 4DCMA 2COEA 4MDEA 2BHNA 1EINA 2QZ9A 3LF2A 4QT0A 2EL7A 5REQB 5M5BA 1RHRA 3C8ZA 2X15A 3PDJA 1W8IA 2XDYA 2ZDHA 4NS4A 1TEVA 5FOUA 1SCQA 3NHPA 2IEYA 2DUJA 1M2JA 1XCMA 1ZD8A 3TH5A 3USZA 3IE1A 2MR6A 2QN1A 3EVNA 3FCEA 4N8DA 3FPHA 4E12A 3SC4A 3QUQA 4PSCA 3WIEA 4ZGBA 3UUGA 1XMPA 3U4QA 2R62A 3C24A 1GPWB 4PYKA 5ARCA 1CE8B 4BTEA 1SOUA 2BSXA 2P62A 3V4ZA 4F86A 4DR5B 3C85A 4QT4A 4J3NA 5I47A 2PR7A 1U3DA 3KT0A 3OFKA 3R7AA 5LMUB 1QFMA 2XHZA 3QEMA 1DJMA 2D0OB 4XTRA 4URVR 3QWHA 3FPAA 1NMEA 2YWCA 1H2BA 3I2JA 2E1PA 4D8XA 4DPMA 2YZ2A 2BOVA 3CLRC 1GPYA 2V4ZA 3I2FA 4J0DA 5B3AA 1A9XB 1P62B 2XQVA 4DUGD 4UFOA 2YVLA 3T7IA 1I80A 2HRRA 3KQYA 4YCSA 3UTCA 1DXOA 4IGKA 2JI6A 1VCIA 1HYBA 4BNJA 1UFOA 1QLJA 5CG1A 4F3KA 5K4HA 3T06B 2GJ4A 4M9SA 4UVEA 2YKGA 1VJRA 3RUIA 4JYPA 2F00A 4I36A 1ZIOA 1USUA 1M3SA 3C7KA 4MGKR 3DDZX 2XTAA 2YIJA 4IDOA 1F0NA 2PX2A 5DXFA 3FYCA 3GELA 1ODIA 4Q21A 5EJ4A 1BS9A 1X1QA 1X7XA 1WSBA 1KP9A 4I5FA 1IN5A 3R76A 1I5EA 2XUGA 4FUQA 4Y2YA 4NYMR 4BHTA 5B2FA 4JXJA 3CKMA 5ELXA 1HORA 1AVTA 3L49A 1TNDA 3IB6A 1F5SA 4MUMA 1QIKA 4PO3X 1A2QA 3AETB 4PWYA 3EWAA 1Y6RA 2JFYA 1U7WA 3RU2A 4ZHQB 1PGNA 2VQ3A 1UXGA 1ISPA 3RRMA 2PLFA 4PRKA 2WVJA 4AKTA 2MWMA 5DCWA 2QZ4A 2D2EA 3RTCA 2OCKA 1UEIA 4GICA 3EG5A 3F7NA 3M8KA 5GY7A 5HIMA 4C30A 2QIPA 4CRWB 4EZEA 5BVGB 4OQNA 1XU9A 5JARA 1ZO8A 2EDAA 4HH0A 4OFXA 2BUBA 2IYOA 1PQWA 4F96A 1ETHA 1I2ZA 4MIKA 4BATA 2V58A 1GG5A 1NC1A 3CUKA 4DT1B 4Z7OB 1IM8A 3AVQA 5DHRA 3ADPA 1FYFA 3LVFO 3BXHA 4ZVNA 4U1RA 3FMPB 3KV3O 1YZYA 2VNIA 3ZDEA 4BZQA 2O8EA 2JFGA 1H5UA 2G72A 4YI5A 4JVLA 5LQAA 3B7WA 2PWZA 1WDLA 2DHCA 2VQDA 3GLKA 3AVOA 4E4YA 4CIBA 3KC2A 3PLAE 1UP7A 4RBNA 5ALVA 2XCOA 5EMKA 3NDJA 4MNTA 2ZOSA 1H8ED 3PJFA 2NZUG 2GRUA 4L5AA 1GCUA 2X3YA 4P4GA 4F9FA 1GTVA 4JASB 1WRBA 1KHHA 5DOVA 1PL7A 2QAJA 2BWJA 4U00A 2HSGA 3F3SA 4RS4A 2HW8A 4NBRA 1Y5IA 2Y67A 1LSSA 1GAXA 2IXAA 5DIFA 1HYGA 2A92A 2G1AA 2ISQA 2JAOA 4GOMD 4ZAGA 2GXUA 3H5LA 2DPYA 2B0JA 2WNIA 1TZBA 3BX1A 4PCUA 4AKHA 2WYWA 1N7JA 1P3JA 2BEVB 3VTZA 4DW8A 4DJEC 5KCZA 2PVCA 4JWTA 1JH9A 5F98A 3Q8KA 5JSZB 2FMFA 4Y6LA 3VUFA 4WESB 3RAJA 1GRQA 1P7ZA 3BMNA 4JVNA 1AKWA 4MPTA 5KTSA 3LYLA 1UBUS 1UOPA 3UAWA 1WZUA 2J9XB 2P11A 2ZRDA 4OQXA 5JI3E 3PXEA 4RKFA 4J1TA 4UM5A 4YB8A 4FIDA 5DNWA 2D74A 4B3MB 1LFAA 3MMSA 1PTJA 1LDGA 3ND8A 4B2IA 1TU0A 1W88B 2H08A 5B58T 3BFPA 3FPCA 3EZ9A 1R88A 4I99A 1DIGA 1VBKA 1POWA 3PNLA 3BBPA 1LLUA 4JKOA 4H4DA 3PIDA 2WNSA 4IIVA 5MGBA 1BWQA 1I1OA 3TRHA 3EF0A 1RAAA 4BP3A 3NHRA 3NRJA 3PUKA 2OHFA 3AEQA 3CLSC 4UUQA 4YT8A 3V8MA 4UHCA 3A9WA 1E2GA 2B20A 5FWXB 3EGEA 2NO9A 5EPOA 1E98A 2WDZA 4DQLA 2X0EA 3IOEA 2UZ1B 4OLBA 1JHAA 1GR1A 3NGLA 1XNQB 4YP0A 3U9SA 1PE0A 4LHYA 1YR9A 4ZU6X 3F6CA 3ACDA 3VDQA 1M8GA 2ONYA 3PRHA 5CJ2A 3IBSA 1AKMA 1U2RA 3WQBA 1W19A 5LZ8A 2C88A 5K0NA 3LUFA 4J6FA 2PZKA 2WICA 3M5PA 3V4SA 1JR3A 1KZGB 2ACVA 3HFSA 5A3JA 2GEVA 3RT7A 1MG0A 3HBNA 3G2LA 4JUAA 4CM9A 3AZOA 4HDAA 3NFRA 3C3EA 1BOOA 1MO5A 1XTJA 3OZSA 4CDNA 5BSHA 3WLQA 1E59A 3P0JA 2IW3A 5L3SA 5HIKA 3C7DB 4CV2A 2VYVA 3MT8A 2CLOB 2P75A 4P4TA 4EG0A 5KWJA 4J1NA 3Q15C 1D1SA 4KRXA 4RFSA 4YV2A 5FUBA 3FA2A 1L3BA 3EDRA 4IUCS 3R5TA 2AFHE 2O3QA 3DOFA 3I3OA 4RVOA 4TYNA 2QTWB 1XKLA 2PSJA 2LCQA 2Q21A 1VJDA 3PNKA 3RTBA 4BASA 4NBWA 4CGYA 3M33A 5AW2A 3U48A 4V0ME 1DKUA 1PEDA 4FZ3A 3ZBQA 5DLPA 3U56A 2F8MA 4FSHA 2VBCA 4I9HA 4X44A 4H60A 5AKGA 3RJ9A 3TEFA 3VAZA 2VEOA 4JR1A 3OPYA 4RHCA 1H2EA 1QGAA 2OY0A 2K87A 2QV0A 4PZEA 4TLCA 3S2FA 5IM4F 2PX6A 5B4UA 3D2LA 3RASA 3OF5A 1WVIA 2R1TA 3R4CA 4X3PA 5HIJA 1LNZA 2IPNA 4MUJA 1EXWA 1OASA 1SA0A 2WPDD 4X97A 1Y89A 3DBHB 1FDSA 1P80A 2FN3A 3DH0A 1UMBA 1VG0B 4GEKA 1IVSA 3UPUA 4D8YA 1Q7EA 4DLWA 1UT5A 1KGSA 5ALEA 5LZ5A 3C6MA 4L08A 3ZU5A 2F8TA 2N42A 3MYYA 1M6VA 1CX9B 3Q6MA 2HH9A 2IOQA 4RTSA 2XMQA 1XV5A 1VLLA 2D59A 3GJ3A 5DP2A 3X1MA 1OKKA 4UZEA 5KC8A 3Q11A 3SI7A 3UFBA 1L5WA 3OIDA 3ZPXA 2AX3A 3FPJA 4LQDA 1O5OA 1ZD1A 2WM8A 5COQA 5ICMA 5K0CA 2G7MC 3I6ZA 3CURA 3U1BA 3EXHC 4ID9A 1HKUA 2WTAA 1AN9A 3I30X 4AP6A 2R7KA 2ZE6A 4KQIA 4RULA 5TMPA 3KEQA 3PC2A 4RPKA 2E9SA 1U80A 1W88A 2CVOA 3I0NA 2AW5A 2QNIA 2DRIA 1DI0A 3QNMA 3WG9A 1KI6B 2EG5A 2FH5B 5DBFA 3K1YA 1JVBA 2WC1A 3ID6C 4QOHA 4P3YA 5LYJF 1I0ZA 1ZI9A 5C37A 1ZWKA 5DLDA 4OTZA 4CVNA 1RQ7A 4RAOA 2D5CA 4GMFA 4RV5A 4MQFB 5KSYA 3AVUA 4I1IA 4P86A 1UJNA 3MTGA 1DRUA 3CZPA 2FSHA 1GLVA 4PAGA 4F5DA 3LBHA 5IT4A 3M6VA 3UCEA 5HNKA 2GO1A 1QGUA 4J0GA 4KZPA 1I24A 1G8AA 4JVOA 3HABA 4L9AA 5J23A 3DTTA 2PJDA 3V42A 3BORA 1RXUA 4MS3B 1F2TA 4BB5A 1I9CA 3C3BA 3G3EA 4D8WA 3O73A 2Q3LA 3CE9A 1H8EA 2J87A 2ODEA 3S70A 1N5IA 1RWVA 1F60A 4HLNA 1D5CA 3ZI0A 1NSYA 3I6MA 2AUTA 4Q1BA 1KYTA 3WGLA 4MO2A 1DHRA 1PEKE 1RP7A 2JGFA 3O4FA 5E95A 3HCOA 5KS2A 2OCDA 3PGKA 1JX6A 3MTDA 3MWLA 4UQOA 2AMYA 1CFZA 4FHCA 3TM5A 2FPLA 3QQ5A 1FSGA 2IIPA 3OP4A 3P9NA 4DDWA 1ZUD1 1YL7A