3KKZA

Crystal structure of the q5les9_bacfn protein from bacteroides fragilis. northeast structural genomics consortium target bfr250.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
256
Chain Sequence
KTIHDFELNLICDFFSNMERQGPGSPEVTLKALSFIDNLTEKSLIADIGCGTGGQTMVLAGHVTGQVTGLDFLSGFIDIFNRNARQSGLQNRVTGIVGSMDDLPFRNEELDLIWSEGAIYNIGFERGLNEWRKYLKKGGYLAVSECSWFTDERPAEINDFWMDAYPEIDTIPNQVAKIHKAGYLPVATFILPENCWTDHYFTPKVAAQKIFLTKYAGNKIAEEFSMLQSIEEELYHKYKEYYGYTFFIAKKIRLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein Q5LES9
publication title Crystal structure of the Q5LES9_BACFN protein from Bacteroides fragilis.
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Transferase
total genus 86
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kkzA00
2PX5A 4OQDA 3NMUF 4YUXA 4MHTA 4ATNA 5HIMA 2O06A 4V0QA 3T7SA 5G02A 1X1DA 3ELWA 4BLVA 4FSDA 1X1BA 2PWYA 2CWWA 4WXHA 3GRRA 3NDJA 3EVZA 4E2WA 4M36A 4P7JA 5FUBA 5U4XA 9MHTA 2Z6AA 2EX4A 1QZZA 4AX8A 3HCBA 4HC4A 1R74A 5FWAA 5K03A 1T43A 3G2PA 4QPNA 3I9FA 1WG8A 3I64A 3CBGA 4ER7A 3UJAA 3G2QA 3M6UA 3MERA 2YVLA 4JXJA 3G5LA 3LECA 2PT9A 5EPEA 3GO4A 4QVKA 3TKYA 3HCDA 5E9JA 3SSOA 5ICGA 1NW6A 4XUEA 5ICCA 1YZHA 4K6MA 3M6WA 4RTMA 2UZ4A 4C08A 1KXZA 3FTCA 3HA7A 4C07A 3KQYA 2ZCJA 4X41A 2WA1A 3THRA 1YFLA 2G1PA 3I5UA 3QOWA 4FR0A 5EHGA 2H11A 4DKJA 3RW9A 3P8ZA 3SM3A 2AVDA 3UFBA 3VC2A 4DZRA 3CC8A 3FPGA 3GRVA 3PX3A 3VYWA 3OU7A 4YV2A 4FZVA 5GWXA 3OE5A 4GOND 1X1AA 3A25A 3DXYA 1F38A 2PJDA 1X1CA 3E7PA 5EZQA 2JJQA 3BKWA 3R6TA 3LL7A 4FGZA 2O57A 5DSXA 3UA4A 3LPMA 1HMYA 2HTEA 2OBFA 1M6YA 3BGVA 3JWIA 4DF3A 4F85A 5T67A 3Q7EA 2UYOA 1JSXA 3EEOA 3HCCA 1NW8A 3JWJA 4PYNA 5BXYA 3BT7A 2AN4A 4QQKA 3HA5A 3RODA 2ZIEA 2JHPA 4GOMD 3TRKA 1KYWA 3EGIA 5K0FA 2B2CA 3C6KA 3LDUA 1RJEA 2BR5A 2P3LA 3DMHA 2EJUA 1KYZA 4F86A 1KPHA 2EG5A 1R8YA 4QQNA 1VE3A 2NNWB 4PYQA 1WY7A 4PWYA 5DLYA 5DWQA 3KQTA 3UJ8A 4E32A 3L8DA 2AOXA 4BLUA 5K09A 2BR4A 3CVOA 4U7PB 3SX0A 5KVAA 2JH9A 3KHKA 1NBHA 3JWGA 5C1IA 3K6RA 4RVGA 4ER0A 3D2LA 1RI4A 2VZ9A 5CVVA 4H0NA 3ANXA 5LQUA 1QAOA 3LCCA 1V39A 3RIEA 4DMGA 3FPHA 5EIWA 2JHAA 1INLA 2N47A 4GC5A 5K0LA 3ELYA 3UJCA 3PLAE 5FHRA 3O4FA 1UWVA 3C3PA 5DM2A 3SMQA 2OB2A 4KVZA 3LKZA 4CKEA 2NXNA 1WS6A 2QRVA 3E23A 3KPVA 5E1DA 5ERGB 4LWPA 3BWYA 2IBTA 5EHIA 2JHCA 3AXSA 4POOA 5K0NA 4E2XA 2P1DA 1ZGAA 3M6XA 3DH0A 1PRYA 3OU6A 1VIDA 4P7FA 3VSEA 3GDHA 5K0EA 1KPGA 3KQVA 4YMHA 2YQZA 7MHTA 1R6AA 3KQMA 3M70A 2P7HA 2FK8A 4X61A 2OY0A 3KPWA 2HR1A 2IH4A 1KR5A 2QM3A 4YV0A 3IEIA 2ORED 5FQNA 4EMSA 4RV9A 3MGGA 2OZVA 3DULA 3P9NA 3P71T 3UJDA 3PVCA 1SG9A 1AF7A 1JG2A 2BZGA 3C6MA 4GC9A 4GEKA 5DPMA 2O07A 4MWZA 4WVLA 3QV2A 2ZFUA 3B5IA 5CUQA 3JWHA 1I1NA 3EVAA 3TR6A 3DLIA 5DRYA 3UA3A 4C05A 4RTKA 3UJ9A 2I62A 4X1OA 5FHQA 3SXJA 4HTFA 3KR1A 2G70A 1EJ6A 2EJTA 2GAFA 1P39A 4E33A 1NKVA 2O0LA 5C0OE 4NECA 1L3BA 5K0JA 1Y8CA 2YXDA 4M7RA 1O9GA 2XVAA 3A4TA 3E8SA 3P9KA 5DTRA 3OZTA 4AZTA 2V74B 5CD1A 2OB1A 3EMDA 4DQ0A 4GF5A 2PWPA 3V8VA 2CL5A 3B7PA 3KR0A 3A27A 4HGZA 2XYRA 4E70A 3B3JA 5F2NA 2F8LA 1RJFA 1IM8A 3AJDA 5EMMA 1DL5A 5ICEA 3SSMA 3GJYA 4X63A 1Q0TA 2GA9A 2XYQA 2IP2A 3P2IA 3H2BA 4PINA 3AY0A 3G2MA 3LDFA 1RI3A 2FYTA 3UJBA 3R0QA 2YX1A 4E2YA 1IY9A 1XCLA 2WK1A 3UJ6A 1JTEA 5FA5A 2ZWVA 3MTIA 5DM1A 1XDZA 2AOTA 1G38A 4KW7A 4X60A 4E2ZA 1D2GA 2NXJA 2IDKA 3DXZA 2YUIA 3P2EA 1YF3A 1L3IA 1SUSA 2C7OA 2EFJA 2FPOA 3UJ7A 1YZ3A 3A7DA 4DCGA 2ZLBA 4G56A 5HIKA 3C0KA 2LD4A 1WXWA 4RVHA 5E1OA 4CXMA 3IV6A 4CKBA 2JH8A 2YXEA 3TLJA 4R6XA 3TPZA 5EMJA 3FYCA 3R24A 3EVFA 5E1BA 2QRVB 2ZULA 3A7EA 3DTNA 2FRXA 2PX4A 3OU2A 4UOEA 3M33A 5T64A 4YUYA 3FTFA 2NYUA 2PLWA 3DR5A 5E8RA 3HTXA 4HG2A 2IDJA 1RI2A 3KQPA 2CMGA 4RYLA 1O54A 2BM9A 5LQRA 5KYGA 3KQSA 3CGGA 1I4WA 2R3SA 4FS8A 2P7IA 5DXAA 3MCTA 3I53A 4KIGA 1NW5A 3T0IA 1VPTA 3B3GA 4RTPA 4BP1A 1M0EA 5F2KA 2YXLA 3HP7A 2IFTA 2QYOA 3O7WA 3GRUA 2P40A 3G88A 4CTKA 2UYCA 2ZIGA 1JSZA 3E05A 4PONA 3IYLW 3ERCA 5FTWA 3FUUA 5GOZA 1O9HA 4XUDA 3SSNA 2GB4A 2R6ZA 4HTFB 2G71A 4YUWA 2IH2A 3DOUA 2UYHA 1P1BA 2ZZNA 3FPEA 2PXCA 3KQWA 2OYRA 3WSTA 3MHTA 1VLMA 2ADMA 1XJ5A 3AXTA 4P7KA 5K0GA 2C7QA 1ZG3A 1ZKDA 3Q87B 5K8VA 3B89A 4MTLA 4FT4A 2GH1A 2GPYA 2HNKA 4IKPA 3EEYA 3HA3A 3OFJA 1FP2A 3HVJA 5BP7A 2ZBPA 1ZQ9A 3KQQA 3T7RA 3G2OA 3P9IA 2PSSA 2BM8A 5E2BA 1JTFA 2PX8A 3OZRA 2PVCA 4GUAA 5T6BA 5F2OA 3KR9A 4AZWA 1N7JA 3EVDA 4IV0A 1TPYA 1NW3A 4Y30A 2P3OA 3BWBA 3EVCA 2FHPA 3DUWA 4ER6A 1RI5A 4B17A 4HSGA 3KKZA 5EG5A 4R8RA 2P8JA 5LR6A 4R05A 3THSA 1VL5A 3TQSA 2AOTB 3HVHA 2ZWAA 5K0BA 4LWOA 1H1DA 8MHTA 5JR3A 3PS9A 1FP1D 2GS9A 4PYMA 1L9KA 3EPPA 4QVGA 4M37A 3HNRA 3PFHA 4V0RA 1UFKA 5EMLA 2DULA 3DLCA 4PNEA 1BOOA 5DSTA 5IKMA 4OQEA 4F84A 3FUVA 2PV0A 3PB3A 5E8JA 3KR2A 4HRAA 4DM3A 1EAMA 1ORIA 2AOWA 3ME5A 5CCBA 4C06A 3TFWA 4RTOA 3MTEA 5EIFA 5GM2A 1RJGA 1TW3A 3OCJA 2ZBQA 4CKCA 4GBED 3NWEA 4RWZA 3FRHA 1SVUA 3G5TA 4RVFA 5EC8A 2ZZMA 1WZNA 4PYKA 3LBYA 5EKUA 4L7VA 3KU1A 2PGXA 3EMBA 4OBWA 1YUBA 3CJRA 2DPMA 3FPJA 1EG2A 5E1MA 3S68A 1YB2A 5EMKA 2HV9A 3LGAA 3PT9A 5DRTA 2C7PA 1M6EX 4IWNA 4OBXA 4A6DA 4QPPA 4RTSA 2PT6A 2PXXA 1IXKA 2IPXA 3CCFA 1G55A 3KPYA 1XXLA 2B25A 3HM2A 3MB5A 2IIPA 2PX2A 4KRGA 5CVEA 3ER9A 1NV9A 2CMHA 3P9CA 5GINE 3REOA 1NE2A 3HVIA 2ZTHA 2BR3A 4KIFA 3EGVA 4PIPA 3LCVB 4EVIA 2OPBA 5ICFA 1KIAA 5FWDA 5DX8A 3HCFA 4C03A 1B42A 1JG4A 4R6WA 1VBFA 4YMGA 3EVEA 3K0BA 1JQDA 1ORHA 4PCAA 4C4AA 4EKIA 4DA4A 3BXOA 5BW5A 2FK7A 5K05A 5KQRA 2P3QA 5HILA 5M5BA 3GGDA 2PY6A 4RTQA 4PCLA 1BC5A 4LECA 1AQIA 3MQ2A 2ZSUA 4QDKA 3ELDA 3GNLA 5K01A 3TM4A 3ER8A 3I58A 5E9QA 4PYIA 4AZSA 1RI1A 2XVMA 5KQSA 3MCZA 1P91A 4KDCA 1L3CA 1TW2A 3CJTA 4XCXA 2XYVA 4QDJA 1MHTA 3EVGA 3LHDA 2B9EA 1L1EA 2ONYA 2YTZA 5CCXA 2HWKA 5IH3A 3BKXA 3G8AA 2AOUA 1XDSA 3P97A 3GCZA 3DP7A 5LSAA 3P2KA 3DMFA 3FPFA 5EVJA 2AN3A 3NWBA 2Z6UA 4PGHA 5CM2Z 2AOVA 2I6GA 2H1RA 2PKWA 2VDWA 5CVJA 4P7GA 5DM0A 3SGLA 5HOQA 3LX6A 1G6Q1 4RTJA 4PYLA 2C7RA 4QTTB 1MJFA 2VDUE 5CVUA 5DTQA 1FJXA 3BWCA 2IBSA 2OKCA 3HVKA 4M38A 1UIRA 1XCJA 5C9ZA 3OE4A 4LG1A 1FBNA 3UWPA 4BLWA 3B3FA 4RVDA 3HCEA 2Q41A 3BZBA 4RX1A 5DX1A 3PTAA 1QAQA 3A26A 2VP3A 3EGEA 3TM5A 2NP7A 3AWIA 1JR4A 1JG1A 1KPIA 4OA5A 2PXAA 3BGDA 1EIZA 4MQ4A 2O05A 3C3YA 3IHTA 4U7TB 2OXTA 4BP3A 2P35A 4GQBA 3TMAA 1ZHFA 1NT2A 1XTPA 3LCUA 2ZIFA 3FYDA 5KS2A 4KWCA 5DTMA 5H02A 5BW4A 2AN5A 3V97A 5HIJA 1YFJA 4RTRA 4CWAA 4YUVA 3FRIA 5P8WA 4FSXA 4IV8A 5MHTA 4FT2A 1I9GA 2QE6A 3NW9A 2QY6A 3GWZA 4GOOD 4HGYA 1BKYA 2AZTA 3UBTA 3FTEA 4AZVA 2WA2A 5HEKA 5EKXA 5K0CA 1DUSA 2CKDA 1P1CA 3HCAA 4OA8A 1U2ZA 2E5WA 2IGTA 2I7CA 3BGIA 3R3HA 5EEGA 5FQOA 3HEMA 5LQAA 2Z6QA 1Q0SA 3O31A 3OFKA 3X0DA 1QANA 2OO3A 3T7TA 3FTDA 3ELUA 5D1NA 3BUSA 3ORHA 3PFGA 4KDRA 4E30A 1R00A 4PGGA 2IH5A 5E2AA 1N2XA 3SVZA 3FUXA 3GIWA 1AQJA 3NJRA 5E9WA 3GU3A 4AUKA 2JG3A 3GRZA 2NXCA 3NTVA 4ZTBA 1QYRA 2K4MA 1NW7A 1G60A 4YUZA 2ESRA 2I9KA 5FCDA 3LDGA 2KW5A 10MHA 3BWMA 5GIOE 4HH4A 3M6VA 4GOLD 5GM1A 2ZW9A 2NXEA 1Z3CA 3FUWA 1SKMA 5HIIA 5CVDA 1G8AA 5FA8A 4QTUB 4EKGA 4Y2HA 1QAMA 1ZGJA 2ZBRA 5EGSA 1WXXA 2B78A 3G89A 2AR0A 3LSTA 2AOUB 3F4KA 3ID6C 3G8BA 2HMYB 3KPJA 4XUCA 5LQJA 3GXOA 5LQNA 4BY9E 1JQ3A 5GP1A 1SQFA 4Z2YA 4CTJA 1N7IA 1XVAA 2YR0A 5LQCA 2NP6A 3PX2A 2A14A 4OX9Y 2BH2A 5HFJA 1EQAA 1D2HA 3MAGA 4RSRA 1JQEA 5GIPE 3DXXA 5FULA 4FP9A 3UZUA 1F3LA 3QOXA 3KQOA 5EQJB 3U81A 5HZMA 4EQZA 1HNNA 5DM4A 3CJQA 2GLUA 2V7EA 3NVMB 2Y1WA 5JUWA 4PYOA 1NBIA 3M4XA 3TKAA 1FPQA 3KPUA 3TOSA 4ER3A 5DT2A 5B1SA 2B3TA 5EEHA 1JG3A 3EVBA 2ZZKA 1G8SA 2AVNA 3SR4A 3DMGA 3NDIA 4ISCA 5DXJA 4DCMA 1AV6A 2AS0A 2ZVJA 2Y1XA 4O29A 5EOVA 1KHHA 3LBFA 1R8XA 3CKKA 3NVKI 1R18A 1SQGA 2ONZA 3G7UA 4EK9A 2G8NA 2VDVE 1X19A 2PBFA 4YV1A 1NV8A 3FUTA 3OPNA 1BHJA 1XDUA 3R9XB 5DX0A 5EZSA 5LQKA 5CIYA 1OR8A 3OZSA 2VS1A 2UYQA 3GRYA 4RTNA 4R8SA 1KP9A 4C04A 4PIMA 3FZGA 1EJ0A 4ER5A 1VQ1A 4PYJA 4P58A 2ERCA 5FADA 3VC1A 1D2CA 5D1HA 1SUIA 4MIKA 4A6EA 1VP9A 1RJDA 1DCTA 3LKDA 2G72A 2FCAA 2H00A 2XBMA 1PJZA 4RTLA 4E31A 1VP3A 2P41A
chains in the Genus database with same CATH superfamily
2ACVA 4J1TC 4EHHA 4JLUA 4TVBA 4R40A 5F4BA 2PMDA 5C7OO 1WHTB 3ZY4A 4A0GA 3KEFA 3KT0A 2KI5A 2P1ZA 2H31A 5JXIA 4EX6A 1GRQA 3B1KA 5DI3A 4J9VA 2GM9A 3F7MA 4RKYA 2A67A 1TJYA 2GN4A 2B7CA 1U3DA 4ZOLF 1X74A 5CRIA 1POWA 5IBPA 4R2JA 5L8VA 3CRQA 3BORA 1HFEL 5COAA 5IMSA 1EZ4A 5KYWB 5FTMA 2UZ1A 4AU1A 1UBRS 2EWWA 3BGWA 3VOAA 1E9CA 4ER7A 1PNTA 4B6PA 3VKFA 4PX5A 2KM1A 4WDRA 4EPYA 3FR8A 5DHSA 1SWVA 1H2HA 4Z53A 4NL4H 2HZ7A 2G67A 4YB8A 5CT9A 4A27A 2IZ7A 1N3YA 4ZVUA 4C08A 3HA7A 1C80A 1ZD5A 5EIHA 3KQYA 5KJ6A 1WD7A 3Q11A 2AN1A 1RU3A 3RVQA 2NU6B 2VDLB 1Y3CE 2PZFA 2GZHA 2WICA 2VQFB 2WM8A 1Z08A 1NXQA 2AJCA 3CC8A 3Q6NA 2OV8A 1L5OA 1E69A 1RQ7A 2O2XA 4TKLA 5IDVA 3ZNPA 2D0OB 1GYQA 4L22A 3V4PB 4R2IA 1TQ6A 4NMWA 2BY4A 4DS3A 5IVDA 1FZQA 1Z7WA 1QH8A 3F7OA 3QU9A 1I3KA 1I8TA 1T25A 3A25A 2O2HA 2WKQA 3BKWA 1YB1A 1KFKB 4XB1A 3UXMA 4B5KA 3SSAA 1U0HC 2J46A 4MYSA 5DSXA 2HTEA 5FUVA 3U7GA 3BGVA 4CIVA 5IABA 4O4JF 4W6QA 2VJMB 4KR3A 4BQSA 5DNUA 2GCOB 1W0JA 4WXPA 3CW2A 4I8DA 3LIIA 1AZLA 1Z0DA 3ADPA 1SELA 3IUMA 1JALA 3AEZA 3BJEA 2FSIA 3R9KA 1MGPA 4LDQA 3COSA 3W8RA 3U4GA 2FNAA 2CGEA 3BOSA 4KH1A 3EXEA 4TLEA 5DTRA 3AF6A 1KO7A 1QH1A 2GBGA 4ARUA 4V0OA 4RXUA 5FL7D 5H9VA 2BR4A 1U3CA 3PUHA 4BC1A 2J5BA 1DKNA 2NSJA 3MVEA 2OQVA 4Q66C 2RGAA 3R75A 2GFIA 3WAJA 2FUG1 2H63A 1FW8A 2JHGA 3CH6A 4DDTA 5CVVA 2G36A 3FMOB 2WLTA 4R81A 2YHBA 3M4ZA 3V5NA 3F5DA 2OBYA 2ZWIA 3LKVA 4MGKR 1QHGA 1ARZA 1E32A 2JLUA 1OC4A 2W9XA 5FHRA 2EBHX 4YJHA 3N74A 1UWVA 1U8XX 1SQSA 3C3PA 4GI5A 3KYDA 4JC8A 3SMQA 1JR3D 1Z2DA 3SC4A 4D0RA 5A3RA 3L4KA 4G0UA 4U63A 4LWPA 1AMOA 2ET6A 2WJHA 3I52A 2QTTA 1ZOPA 3U1BA 1K6MA 3MQ4A 4B1FA 3NT4A 2ZQYA 2JBAA 3DH0A 1Z2EA 1DB3A 1KPGA 3KQVA 3BXHA 2XZLA 1DXOA 1MORA 3FKSD 3F5MA 5DMHA 1FDTA 3S0JA 3FMVA 4H2DA 4AO6A 3EEBA 4ILKA 4HP8A 1OLXB 4WBXC 4FCCA 3N8DA 2NACA 4KUHA 2EFCB 4K03A 3W9SA 2WZQA 6YASA 1PTKA 2OZVA 1MH1A 4HBZA 3QLVC 5F5LA 2DQYA 1YS6A 4RZSA 4NBRA 1AF7A 4FI3C 1KK3A 1AF4A 3CLHA 3AY3A 5CUQA 1T9GR 1VBKA 1X7HA 1X38A 5JNLA 3DM5A 3W04A 3UJ9A 4C05A 4JL8A 5A2QA 3KSAC 1S2NA 1DAHA 1T2EA 3IPRA 1EWVA 2IOFK 2XYHA 3ANNA 3CPEA 4IQ0A 4G4GA 2LVBA 1Y8CA 1OXVA 1EE2A 4DQVA 2XYGA 2YN4A 4OLBA 3NP9A 2HSDA 3OQJA 1T5LA 4QNNA 2HEGA 1S2GA 3NTOA 2RIPA 1A04A 4X71A 3MWEA 2XOKA 1E79D 1J7JA 4HDAA 2J9RA 4P5PA 5IAJA 4LBYA 1TIPA 3B1YA 4RJIA 2CL0X 3Q5EA 4UU7A 4UREA 3GCWA 1EH5A 3SSMA 3WRWA 5HF5A 4BDTA 5LP6F 2X9GA 4GPZA 5JAQA 5BR8B 4H7IA 1L4HA 3EK2A 4OXQA 4Z0TA 4R41A 4LMPA 3IUQA 1QP0A 1SHZA 3FCCA 2LKCA 2ZQZA 1ILWA 1YH3A 1CJTC 3FVWA 3QEMA 5K4AA 1AUPA 2VJKA 2GVZC 2BKAA 5I9NA 4P3KA 3QP9A 5ICMA 2PL5A 1FDWA 1RXEA 4LDRA 2HX1A 2ILTA 4X97A 3WMEA 1NIPA 4JLKA 1SA0B 2PO7A 4PC3A 3VISA 2FCRA 2DUWA 3ESYA 3EVNA 3IRVA 4FKZA 1MIOA 1DFIA 1TL7C 4MS4A 2YBEA 2G0TA 1B41A 1DBSA 1TCCA 2B0JA 3BIOA 3R3SA 1UJCA 1Y9AA 2JVIA 2ZB8A 1B93A 3LGXA 1O8CA 3KLOA 2O1WA 2OMEA 1IHPA 5U1PA 1D6MA 4FEGA 4HLNA 4TRMA 3RVKA 3VZQA 3W5SA 5G0VA 4UOEA 1DC6A 2NYUA 5BMVA 1DJPA 1OXMA 3UB3A 3FWPA 1KZ6A 4G0VA 2VUSA 4TQGA 2HK7A 3W5CA 1OSNA 1VL1A 4GZ6A 3WYFA 3PU6A 2JCXA 3WX0A 3KLPX 4Z7NB 2Q5IA 1Q84A 3UTDA 1L7MA 3OJOA 3QYJA 4TV8A 4AWAA 1VPTA 3W9YA 4AN0A 5F2KA 3OIDA 3MK31 4JC4A 2PNFA 4MYUA 4HDSB 5B3LA 3OCWA 1ZVQA 1U6JA 3R40A 4E46A 1DU4A 5H5JA 4ZEXA 4TV9A 1XRJA 3BDVA 3CUTA 4BBAA 4H6PA 1OASA 4K05A 1P9RA 1E8MA 2R6ZA 4RJKA 2G07A 4RS4A 3SEFA 4AP6A 2ON6A 1HV8A 1OX4B 1YQTA 2DT5A 3GFFA 3NM4A 3OUTA 4G9GA 2QY9A 4ND7A 3ZJYA 3BA1A 3IT1A 3CUVA 3W34A 4L8WB 1VLMA 1XKLA 2ADMA 1IATA 2A9PA 3Q87B 2J85A 4ROTA 2Y93A 3D6VA 2ZRNA 2QROA 1W75A 3LWNA 5EFOA 5KOHB 1M0WA 3U44A 4MMXB 4NXMB 2O2SA 1DOAA 2RHDA 4AMZA 1CRLA 1TU0A 3KQQA 4CT0A 5AW2A 1N7HA 4FFBA 2ANBA 4EYEA 3HRIA 4U7WA 1T4GA 3F4LA 3C4VA 4W7SA 1KMIY 1SM4A 2HQOA 5G3YA 3K5WA 4M0FA 1U6KA 3HE3A 3DDUA 2BMEA 3K31A 5DEOA 4CMGA 1OAKA 3BMXA 1ONOA 2JDIA 5A7FA 1R9JA 1L1RA 3OX2A 4R2XA 3Q0IA 5JZSA 4EMUA 1YI8A 2RGUA 3LSYA 1GT91 3D6TB 1O6ZA 1IM5A 1NDUA 3AU8A 1WB4A 4QYIA 5ALZA 2RI6A 4DG5A 4TXMA 1R6XA 1ZI6A 1H1DA 3OICA 4XCQA 4S12A 1NLZA 3PS9A 5JSYA 3PFHA 1WKVA 4MRPA 5ALWA 4KGXA 1T26A 2A94A 5GY7A 1NVVR 5CPBA 4ETWA 3VYTB 1V71A 3TOZA 4AJPA 2ATCA 3R7NA 4F84A 3OEWA 1EUQA 4LPSA 4IQGA 3OQVA 4TWBA 2XGOA 3IILA 4D2IA 3NOQA 3SXUA 4ZAGA 4B8ZA 4RTOA 4P7BA 3PHCA 3OCJA 3A04A 3JWEA 4KE8A 1GRVA 5EJIA 3HJNA 3KVNA 5KNDH 3H2YA 2I3BA 3PXXA 3UB2A 3S8EA 1Z6YA 2F6RA 3SPXA 4LV8B 1IIRA 4EHAA 3CZ5A 5JS1A 3CX6A 2IUFA 2VLIA 5T4BA 1Z5GA 1ADJA 5EMKA 4ZHQF 3NHAA 1SBIA 1YHYA 3HDTA 1HXHA 1Z12A 2FLKA 3FHJA 4LSZA 3DE7X 4CV1A 1SVNA 2HDNB 1RQNA 3EYAA 2F9MA 3OT5A 3M6AA 1SUDA 2BFEB 3C5VA 2G0AA 3HV0A 3JQ9C 3C1AA 3P9CA 3PEEA 5ESRA 4YMTA 1WZCA 3HGQA 2BHLA 1BIFA 2NM0A 3JRNA 3R41A 4TS4A 2IU6A 3ESQA 2QBYB 2DTEA 1PWHA 1FLAA 5AXDA 1OB5A 1USIA 2BZ1A 2W8ZA 3DEYX 4DA8A 2RH8A 3AB3A 3VBEA 3OTIA 3WJAA 1JAXA 2P91A 2FOXA 5AFSA 3GELA 2DBQA 2TS1A 2WIAA 1ZNWA 4MVCA 3NHLA 3R1IA 4RZUA 5IYZA 4G1UC 3UCXA 1SR8A 2PZLA 1E2MA 2PY6A 2Z9DA 4PCLA 2BP7B 3DHYA 1YCGA 5LMNB 4ED9A 2C95A 4IDGA 3H5VA 2EGUA 4LXHA 4F46A 2R44A 3DOIA 4M60A 5E9QA 1GSIA 2N42A 3R6DA 1BMFA 2VLBA 4AWBA 2RJNA 1SXGA 2XYVA 1PNVA 3MOIA 4RMGA 4Z99A 4RHFA 2VVTA 1L7VC 3NIGB 4MV9A 5DGCA 1L1QA 3SJCA 3AV0B 4YRDA 5H83A 4BWVA 4K0RA 1XDSA 2IITA 3R7LA 1U5BB 3F78A 1ZRMA 5KINB 4IXMA 1R37A 2NQ2C 1K6JA 2BRUC 1C7JA 4HH3C 4JJKA 3UV6A 2JARA 5TSDA 3QVUA 3H8VA 3GP3A 3RV4A 5DTQA 2GKGA 2CE7A 2E37A 1P6XA 4XGIA 3VTAA 3OUUA 2C3MA 1EGAA 3ZNOA 3OE4A 1FBNA 4PAWA 2FP4A 2ZSAA 2I78A 5F3RA 1AKTA 2Q5FA 3H1TA 4LX8A 2ZOSA 3H97A 4X6LA 1N0IA 4XWKA 3RNOA 4MIOA 1JG1A 4H15A 4HPWA 1C30A 4B7AA 2O05A 3KUDA 3VC3A 1ZD4A 2NADA 1ZGCA 3E2IA 5J59A 1N5DA 3KSRA 3LF2A 4JI2B 1COWD 4MWDA 4OQFA 1XTPA 3UH0A 4ERNA 4NEQA 3NVKI 1U8EA 1XTJA 1RYNA 1GSOA 1NM5C 3PNSA 2W4MA 3QELB 4HH0A 5JMWA 3PUZA 3H13A 4F4CA 3TXXA 4EBFA 5JSZA 1FRFS 1UKCA 3B8EA 1POXA 1OIXA 4NYMR 4X95A 5JDCA 1JVBA 2P77A 5IT0A 4CM9A 1V7ZA 1JDJA 2EP5A 2QSYA 3SC3A 1OV6A 1ZCFA 4B8YA 4JU8A 5B6JA 4UTVA 3UBTA 3DM9B 2OCAA 2PBZA 1EP9A 3M6IA 2GN0A 2PR2A 1WPXA 2NSHA 1P1CA 4RF2A 1M2FA 3QLJA 3DMRA 3R3HA 1CUJA 1MJGA 1Y0BA 2VF5X 4WNAA 4J3NA 1N3BA 3SEAA 2QLTA 1OY1A 2XY4A 3O31A 3X0DA 3INGA 4LXXA 4K6HA 1B14A 3PFGA 3PGMA 1UANA 4KODA 4LDNA 4UU8A 5G40A 4ENTA 5I7UA 4PHCA 5AVQA 5E2AA 5G1NA 2FJ0A 1XD9A 1QK3A 3GU3A 4PAMA 1M6NA 1V6CA 1RJ9A 2PS0A 1QYRA 1NTOA 1R8SA 2IPNA 3FHCB 3PFBA 1K4MA 3QFTA 1QCZA 3TGPA 1URPA 4KZPA 1JYEA 4JT4A 3BWMA 4NRDA 4RVOA 1KVSA 3LQYA 3ASYA 2QRPA 3FUWA 1HF3A 1Z3CA 3RGGA 1YHNA 1JPJA 4TUYA 4D3XA 1H0HA 5DTIA 5BOSB 1R4NA 1RM4A 2AOUB 3IB3A 1CR2A 4MMZB 5ETJA 2J7PD 1IN6A 1EZZA 3PF8A 2V5AA 4RFLA 1VPDA 4CUZA 3EXG1 3CX7A 3DVAB 1EIWA 3AHDA 4BE4A 2VZEA 4KPUB 1GSAA 3SFZA 2NP6A 4ND6A 1FMCA 3Q3GE 1RVV1 4X9XA 1CUIA 2A14A 2WG1A 3ND6A 3HS3A 2COUA 1T1EA 3ACCA 3EIOA 2HTFA 3O3CA 2AIRA 4M1MA 4NAHA 1EEXB 1EQAA 2O3UA 3CT6A 3TZKA 2OFWA 4FZ5A 1G8JA 1U3TA 3H05A 2QR2A 3KJHA 1PFUA 1KNXA 1R3UA 1W4AA 1HNNA 3AC0A 4K9LA 1MOQA 1ORRA 3S2YA 2C8LA 4KXYA 4D42A 1XPJA 4X0EA 3FJ1A 1PJ3A 4EZEA 5I9IA 1PD1A 1NBIA 3ELBA 1WOYA 3CVVA 2H17A 4KREA 3A9TA 3N9IA 2XD9A 1G8SA 4L4UA 1AQNA 4HWTA 2JK0A 4XM2A 3DMGA 4LV5B 4MUYA 4W7IA 3KUXA 3RVNA 3K1JA 3TQRA 1PU2A 2IZOA 3SBDA 5AKYA 1U0EA 5D3QA 1QIEA 1P2GA 2BFWA 5GONF 3LK6A 4ZI7B 3QVTA 5HJEA 1CUCA 4FW9A 5A03A 1R5BA 4F3TA 3MIZA 3PPXA 4JC0A 2IUYA 1GRCA 2CFIA 2C42A 2IYSA 1P8AA 1ZC3A 2R00C 3CNEA 3QYPA 2A6PA 3AUJB 2EW1A 2NVUA 4RHEA 1OR8A 2X0KA 3FWZA 2QUHA 4WXRA 4BLQA 4EEXA 1CY6A 1YJ8A 1VKOA 2Z3WA 3DTTA 3ZE8A 2QORA 2VSFA 5HUHA 3QM1A 2G7ZA 3F8TA 1J7KA 3CG4A 3VC1A 2P67A 1E5LA 3SQWA 1C0PA 1QQAA 3THXA 2LCFA 2W0MA 3GBVA 1L7PA 3L4BC 4FDUA 3TEFA 3W8DA 3AJAA 4F5DA 3KG2A 5C8YA 4UD6A 4E31A 4P93A 5EIBD 2I91A 3EGDA 2LR0A 1U28A 2O1XA 3T7SA 4WZBE 1VL8A 4BRSA 2W4IA 4XZ3A 4BVJA 1E9SA 1L8OA 1L7NA 3FI0A 4KX5A 1SVMA 4WXHA 5KSWB 3TECE 4BO8A 1DJMA 4KE6A 3DLBA 3NAQA 4CMEC 3K9FC 3BK2A 1HR0B 4WVFA 3EF0A 3CX3A 3KL2A 4K9KA 5CDHA 2GFQA 3BFVA 3IP5A 4M1ZA 2P5YA 1O6GA 4CKZA 3DAGA 1IEXA 2FMKA 4XB6B 3E53A 3QE2A 5EMHA 1JBEA 4IGKA 4JKYA 4ZAVA 4HNTA 1P1FA 3BB1A 3HN6A 1Y3AA 4RXMA 4R3WA 4YONB 4Z1MA 5TQ2A 4EENA 4Z49A 3B9PA 3S55A 5E95A 2Q3MA 2RHTA 1XCPA 2ZCUA 3MWDB 4F1WA 4BVGA 3G6KA 3THRA 3PEFA 1C0LA 2WT9A 2H1SA 1DC4A 5BWLA 4II2A 3JVDA 4FR0A 1DAGA 1M74A 4Q02A 3DCJA 2IZ1A 3WB0A 1EK6A 2JLQA 1V47A 3ZS8A 2JLWA 4RW0A 1J8DA 5KDLA 3C15C 3L7OA 3LIPA 3NEPX 5B1DA 4BMSA 2FGJA 1PF7E 3QU2A 3TBFA 3PX3A 1U8YA 1XLVA 2RC5A 3G0GA 4LOJA 3ZVLA 5CB8A 3AI3A 4I1OA 4ZJYA 1HYQA 4UDOA 4LCEA 3RYHA 1BDBA 1BHO1 1A1SA 1NR1A 3CR8A 3QKSA 4KQ1A 4TWJA 1OFUX 3S28A 4O2LA 3W5JA 3AVTA 4ITRC 5BV8A 5IDXA 3N0VA 3T9CA 1Z5VA 4R84A 1M7GA 1XMPA 5BORA 1U0TA 1W1IA 1H2BA 3LC2O 5C1BA 5UKDA 1GUZA 1P60A 1RXYA 4IOLA 2XEXA 4Q9KA 4HI0E 4L76A 3UOGA 2WC1A 1MT3A 4PZCA 2VK1A 3ZDAA 5C8DA 1VYTA 3ETLA 3IMFA 2BUCA 1FFYA 1RJEA 1WB5A 4FFRA 4F86A 1YZYA 4YGXB 4IIJF 3TL6A 1PBNA 1UCFA 2NNWB 4BFXA 1DKPA 3OFVA 1TNDA 1NJ6A 2ZWOA 3GOQA 2F67A 3JQFA 2CDCA 3SF0A 3BQ9A 5BRNA 2Y76A 5C1IA 4WCDA 4H4EA 5CTJA 1Z4NA 1GEGA 3U4IA 1O7JA 1Z6XA 2J6BA 1QAOA 3ANXA 2QX6A 3NBUA 4J07A 3FPHA 3R3JA 1KRHA 4Q9DA 4D4IA 4DV4B 4G24A 4X45A 1QHIA 2IV2X 4IXDA 1TVEA 3PPYA 2WEKA 4U7JA 4BWFB 2D74A 2ZT6A 2QZSA 3QVKA 1M54A 4JJGA 2HADA 3MRSA 1ESCA 3F73A 3QBJA 1QLHA 2XUQA 1DTEA 4ZOAA 2D1SA 5FOSA 5ARCA 5DYNA 3NB0A 3M1AA 3ER6A 1EESA 3RSCA 2OM6A 4HMPA 1IBSA 3PNQA 3M6XA 1JLRA 4C4YA 5DGTA 4GI7A 3IR5A 5TS2A 5CH5A 2AUTA 2Z1NA 2ID9A 4DA7A 2YIDA 1QVRA 3OZXA 2EKQA 4XOIA 2IH4A 1MG0A 4PZDA 1E2IA 3RSQA 3GUCA 3W5IA 3T7IA 1V8PA 2BN4A 3NTUA 1ECJA 3RSOA 2FZEA 2OO5C 2WSSA 1U7ZA 5FFNA 4P9NA 3W4KA 1IBMB 1MRZA 1W0CA 2IEGA 3P9NA 2B7LA 2J41A 4Z0NA 1V11B 3P71T 4Q7KA 3DKVA 5TF4A 4CM3A 1SG9A 1JG2A 1VFPA 2BZGA 2QMQA 4H59A 7ADHA 4YEDA 4EJMA 2D5CA 4F04A 2WMDA 3DEHA 4R1SA 2OMKA 4PZYA 4OP3A 3A3PA 3DZJA 1ENOA 1P8JA 1A4IA 4NZOA 4OHOA 4AG3A 3TOCA 1XZBA 3R23A 1HTWA 3QI2A 5C34B 4EJFA 2HIHA 1G5RA 1BHQ1 3A4TA 2UVPB 3D8HA 2DTDA 2EQAA 4YECA 4CG0A 2O54A 2VAVA 4HS4A 5B3KA 1QM5A 2FQ1A 1Z0FA 1CUZA 3C8DA 1DSSG 5ILQA 4E70A 1CF9A 4EX7A 1E18A 3CZ4A 2QNBA 3JARB 3NBKA 3QNUA 2DQZA 3FWYA 2X19A 4AL4A 2I22A 4WK6A 1KF0A 1QONA 2XYQA 3STYA 5DK6A 3TQHA 3AY0A 2HBRA 4OK6A 3BMCA 2Q3JA 4GU5A 1W25A 4DARA 3IAS1 4ACBA 1C7ZA 1BJTA 1Z38A 3I8SA 3IEPA 1XXHB 3LD9A 2JFVA 1XCOA 3PYLA 1LPMA 4NG4A 1YRYE 1WUKS 1UP7A 4IINA 1O8BA 1YCHA 5DM1A 2YS6A 4YHHB 2EP7A 2X1VA 4DMUB 1RQGA 1KP3A 1J06A 3X1MA 1IL0A 1IHYA 1L3IA 4CCSA 3JQBA 3WOVA 1T6NA 2OL4A 3SAJA 5GV7A 1KAQA 4BLOA 1CUDA 4CDRA 3EEIA 2NZVG 5EJ7A 5HIKA 5IXSA 1I7NA 4LJ6A 3H8WA 3WLNA 1XEWX 4UTRA 2UUAB 2HJGA 4LHVA 4CKBA 3GLFE 3LT4A 3SHQA 3QMVA 2A9OA 3DVSX 1Z8HA 3FYCA 3W6OA 1DJNA 2BCGY 3OU2A 4G9BA 1P5HA 3VHLB 4CIDA 5KWEA 1UKAA 3L49A 3H2GA 1FRVA 4PPNA 1OZFA 5AI8A 3A70A 4CYMA 2GPSA 1P7WA 2V5VA 3L04A 2ZRLA 3ETNA 3IHLA 1T3SA 1XV5A 3D8SA 4RYLA 4TKMA 4QQRA 3KWMA 3ZIDA 3WA7A 3CUWA 3OZIA 1T36B 2HKIA 5DJ5A 2JLXA 2NPFA 4H4DA 1JEEA 2HQSA 2FEPA 1UBUS 2I1VB 2WNHA 3PKIA 4HDNB 3OC0A 4ICIA 4CKCB 1CQZA 2Z5LA 4LBZA 4RA9A 4I8XA 3S7TA 1N4DA 2X23A 1GTVA 2AQHA 3W0LB 4NAUA 1ZC4A 2PM8A 1NQTA 1P80A 2FUG6 3OHMA 1QIKA 4JL6A 1F0NA 5KZMB 2GB4A 3OFND 5TDHA 1JXOA 1FNSA 1QDEA 2WD7B 3EY9A 4J1SA 3CUUA 1X87A 3FFXA 3TRHA 2DXIA 1XNQB 2UYHA 1W94A 4N5LA 2H29A 4XGKA 4TT8A 2ZP1A 1SVWA 3GG9A 1C1XA 4XKJA 2X2FA 4JDUA 1VL2A 1X0XA 1RRMA 1YJAA 3I2YX 3OKAA 4LE1A 4S3MA 1PL8A 4X1KA 4Z86A 4L8GA 4N41A 4MTLA 2GO1A 2BFFA 4EB6A 3CEJA 3EEQA 2CHEA 1GPUA 3Q3VA 3AILA 4BEWA 4UEKA 1M9NA 1E99A 1JKFA 3IT2A 5I4CA 2IODA 5FO1A 4NBWA 4H3SA 3D2CA 4CZ2A 3M81A 2GEBA 4X1IB 4BNWA 3ZIUA 2ZAYA 5L3VA 3SVTA 4PO9A 3TAXA 5FRDA 4AKSA 4KGVA 1FLDA 1EP1B 2O9JA 3D7SA 1M8FA 3T1HB 4HNHA 1TYDE 2HLDD 4PCVA 2I87A 1A4XA 2E4UA 4YLYA 4CHGA 3EH2A 1FXWF 3INRA 3QFHA 4LOLA 4R2MA 3C3AA 4QVGA 3S1LA 4TTSA 1WPQA 5CR9A 3RVSA 5IASA 5AJVB 2EX1A 4RD1A 5I51A 3IQEA 1EVZA 2OZPA 3KQLA 4HQOA 1EM8B 1JH9A 1T3HA 2HIAA 5JY6A 1HL7A 3FMFA 2AFIB 1ML3A 2HWYA 1XTRA 2CLIB 3WYBA 1YR9A 4KYUA 3AEUB 3FUCA 1GGVA 3D02A 4CGYA 3WFJA 1Y7TA 5L7YA 3TZHA 5SY4A 2DWQA 3ITKA 1I2ZA 3ZE9A 2ZZMA 1NI5A 1SXJB 4RVCA 2RGBA 3KV1A 4M9ZA 4X93A 1VMIA 4YJGA 3R7WB 2A84A 3FFAA 4WRRA 5KQPA 1GG2A 1OJLA 1VJDA 2G28A 2YFYA 2QJWA 2PYDA 1ISFA 2AK3A 3JYLA 4JNCA 4HSEA 1RBZA 4JWKA 4E5VA 1KH3A 1V8ZA 2VHEA 2X7HA 2ZBFA 2JIMA 3OAAD 3RKSA 4C4TA 3HBFA 4P4SA 4QOEA 3CCFA 2VCEA 3AV3A 3D7KA 1CW2B 4DEXA 5BSWA 4ZGWA 1NV9A 3QA3E 3LNCA 3DFUA 2JGJA 3E0QA 2YZMA 4AULA 4YRZA 1JX6A 1JUDA 1M6HA 3EGVA 2NW6A 2GEUA 1NZJA 1B16A 1FMTA 4X5OA 4BE7B 2GHRA 5ALQA 4L0CA 3EHEA 3SZGA 3U0BA 4E5UA 4DQXA 1OT3A 1W29A 1II8A 4OUDA 4LZLA 2XNKA 1AKEA 2ZROA 4KMRA 5CA1F 1H0RA 2K2QB 1W85A 3HEBA 4QXMA 3ZNNA 4EPVA 3ZHTA 1ZUWA 1G8FA 4DGQA 2FMUA 3BZWA 3B6EA 3IPCA 4TYMA 1PHRA 4F60A 3OZFA 1XVIA 2XWBF 3O21A 3UOAB 3GT7A 3O8BA 2UAGA 4OHYA 3ER8A 1CUVA 3U49A 2VZ0A 4F2GA 3CJTA 2DC1A 1DDIA 1K5PA 2FEXA 3KKOA 3ICVA 4QDJA 4DNPA 1HLPA 3PC3A 4QOHA 5EIBC 3PNBA 5CIWA 1X1RA 3GCZA 4KRXA 3LRPA 4IZOA 3AW9A 4KU4A 5KTTA 5AK5A 3QA9A 1OREA 1JU9A 1NR5A 1VXRA 4IHJA 3RPEA 1MPXA 1CPYA 1VJ0A 1W9HA 1HRKA 2X7JA 4B74A 3C48A 1DNPA 1NUTA 2F17A 2DLNA 1W5TA 3VR5D 3NZEA 5KOJA 2OCDA 4Y6RA 1WZIA 4A1OA 3AVPA 3UBMA 4TQUS 1JBKA 1UJ4A 3ET4A 3BWCA 1B8NA 1C3XA 2VYCA 4G8CA 5I9SA 1UPTA 2H2WA 3RIHA 1Q15A 1QFYA 2AUNA 1GTSA 4X1YB 2W2LD 2X5JO 3DTVB 1R2QA 1F9EA 2NQTA 1BE8A 2IC5A 4QGAA 1O94C 3GB9A 2H6EA 3EB9A 5KCZA 2ODTX 2W2QA 1AGYA 1DIBA 3JQDA 3D6MA 3BMOA 1WNTA 3EGEA 2VP3A 4DXDA 2AR7A 3HJTA 3OJEA 1Y8QB 4W1RA 5ENDA 3PXBA 5AH0A 2O23A 3DHNA 2A1UB 1PWZA 4G23A 3OUZA 3ONWA 1M2NA 1ZHFA 3LCUA 4I9NA 4DB2A 1PFVA 2GD2A 5EUBA 1IEVA 1ULTA 1W96A 2VO1A 4ZAWA 4ZXPA 3WLQA 5K6RA 4KWCA 4TM8A 1CEYA 4ARIA 2PD3A 2IX3A 1HNXB 1CJUC 2AB0A 2R7AA 2V9PA 3AG5A 4MUAA 3PWKA 2RBGA 4BE9A 5C80A 5BR4A 3DKPA 5JJBA 1H4QA 2ERYA 3GRAA 4GOOD 1B0PA 1JA9A 4AG5A 4LYAA 3D6FA 4MVJF 1OC2A 4IVRA 1E5QA 4AO7A 1FLVA 1Q0SA 1YZLA 3D0KA 4WCFC 4ZQBA 2BFCB 3LDAA 5AVOA 5IZ4A 2WTMA 4YDQA 4N7MA 5LWHA 1RE0A 1QIHA 3C5WP 3OZBA 4NS4A 4PGGA 5ECYA 4ZANA 2IH5A 3FUXA 3C1TA 1BEUB 3SX4A 2DBZA 2PX3A 3KSDO 2EHDA 4JGIA 1NX6A 3T99A 4PANA 4RELA 3ZXIA 5HX7A 1ZVKA 2ZSIA 4WGFA 5I4BA 1I7SB 1YI0A 3EZ2A 5A6SB 1T0HB 5A2GA 3LT2A 1XZGA 1J56A 5J58A 221PA 3IXLA 3DPSA 1VE9A 4Y2HA 4BNIA 3V4FA 2VPQA 4N5MA 2A5LA 2Q6LA 1H5QA 1U80A 2EL7A 3GXOA 4LYHA 4MV7A 5CA0F 5KQLA 4UNQA 4CKWA 4WJKB 3OG9A 4DNQA 4QBTA 4HEHA 4HYQA 5E2IA 2DR2A 2Q1YA 3JQRA 3HKEA 4OSOA 3UPUA 5EE9A 3L8GA 1QORA 4JELA 3STHA 5K7SA 2PWAA 1P0QA 1ODIA 4MI1A 1LH0A 4C4XA 3A6HA 1NXOA 3T9BA 5LQDA 1C7QA 4OOEA 5TIIA 1HT2E 4FP9A 2RHHA 3TQIA 3C87A 5AK3A 3R5FA 2J0QA 1RWNA 1DV2A 1J33A 4I4LA 1K98A 2RFLA 4RCYA 5KYNA 2ZB3A 3FVQA 5CT8A 4J1TA 3O1IC 4QICA 3EVBA 3GJSA 3M1LA 1OX6A 3OQ1A 3ZI7A 4QFCA 4UEWA 2NUPA 2ORIA 2PCJA 3SR4A 3ZJTA 5DXJA 3SG0A 3NX4A 3DV0B 3JYNA 5L3ZA 3K2IA 2XE7A 3KCQA 2CBGA 3ZCXA 1GZ4A 1ZNXA 1TKAA 5JC1A 4JUFA 3AEKB 2P6NA 3VMMA 1FDUA 2X9NA 1MR3F 1ZVJA 3ZQJA 3IPAA 3R0ZA 2O8VA 5DX0A 1HDIA 4PZ9A 2HSZA 4KYVA 3WGJA 2M1XA 5JBIA 4ER5A 1D5WA 1SC6A 2VT7A 4PYJA 3MMSA 4DCCA 4YS6A 2JIZA 2JIDA 3HV2A 4A2PA 3KHSA 3C5EA 4BVEA 5HK9A 1HETA 1VP9A 3CEMA 3ANLA 3BJZA 5EJFA 2G72A 2WSMA 2ZITA 3NHWA 5EJ8A 4FW8A 2CNDA 2ZG6A 3RUEA 2DQKA 3K6SB 2Z6VA 1CUAA 5FI1B 1IVNA 1I3LA 1XRQA 2GN1A 3HSKA 5JADA 5MN4A 2WIJA 2PZEA 5DOVA 3OIUA 1J0CA 3IFSA 5ALLA 1JQBA 4GRAA 4OLHA 4ZPJA 4F3NA 3PYXA 3OP4A 1WLYA 4KXVA 4KOEC 2KB0A 4QPDA 3TTUA 3UXEA 4P31A 4QFBA 1RBMA 2J4CA 2XXJA 3N8GA 3D7MA 2HU5A 4ZAFA 3ADDA 4JR0A 5DIZA 3ZV5A 3O3OB 1YDEA 5JIBA 3LLVA 4KXWA 3CBGA 4B6SA 1UADA 1L7XA 2W6PA 2PT9A 3IVRA 1OLUB 3HCDA 4OXYA 4LK2A 3ZJVA 3PEYA 1OKKA 2FEMA 4G2NA 1P6QA 5FL3A 5JSKA 3ZYZA 2P2NA 3HXMA 4P81A 1ZRHA 3JS5A 3UATA 2WPNA 4TKVB 1PI3A 5CYGA 3LCRA 4URXR 5ALXA 1QRSA 4OI0A 4Q1FA 3T3DA 1EDDA 3RO7A 4W8GA 1VB3A 2PYIA 4BPBA 1Y9EA 1V8DA 1Q57A 2YXNA 1EZ1A 2NSDA 3GIDA 4FQ7A 4MARA 4WNCA 3RK4A 3KT8A 3GRVA 4NBVA 2DPYA 3UWMA 3EXHA 1CUWA 3A1FA 2NU9B 3U7QB 3OE5A 1ID8A 4YRCA 4TT3D 1U9JA 2N0SA 2IVFA 4A5OA 3NETA 1ND6A 2ID8A 1NUHA 1Y63A 1R1DA 5KOYA 3KTOA 4PQFA 5BWCA 4G0MA 4OU5A 3BT7A 5JLJA 3IELA 2O2JA 4WEQA 5JALA 4F1KA 1YDMA 2GOYA 5FNZA 4GRDA 2ZIEA 3M83A 4Q7QA 1ZUHA 2WNIA 3H9JA 2NPIA 2D4HA 4OFZA 3DMTC 1JLKA 3NBMA 5K3AA 2B2CA 2QUJA 4K1LA 3C6KA 5KYKA 3RQSA 2F55A 1FP6A 3VVMA 3U60B 2I8CA 3RB8A 3I12A 4PYQA 1V5FA 2ZYSA 3CUSA 3CEAA 5TXGA 2XRMA 1B6SA 1KXJA 3V8QA 1NVMB 3G0DA 4OHUA 3SX0A 3GARA 1EQUA 2PTHA 3MWJA 2FWAA 1AM4D 1C8VB 2ZPUA 2V8BA 4UEJA 4RVGA 1PR1A 3D2LA 4DBZA 3B78A 3CF2A 1GDHA 2AJ8A 2D1FA 1XALA 3M1YA 2ZYDA 4HR7A 4C7KA 1FYWA 1FXSA 1N0WA 4LZOA 4ZI7F 3QLVA 4FNGA 1H05A 3S2GA 3VXKA 1ZR2A 4FWTA 2UYGA 5ITVA 1MMFB 3AJ8A 5KWVA 1VSQA 3I0ZA 4IJUA 2YV2A 3HZZA 3B85A 1N0HA 2OQ2A 2P30A 2X4GA 3NALA 2PPVA 3IGFA 3P2OA 1JXAA 1E0KA 3KSUA 4QUEA 3WZLA 3BWYA 1IUPA 1LTHR 2I1WA 3OTHA 1N36B 3U3DA 2MYTA 4E2XA 3P0RA 2VTDA 1JHOA 4OXRA 2O3TA 1WV1A 1TTPB 3G68A 3TINA 3TZQA 1YUMA 3NU1A 3PIRA 4E5KA 3M70A 5EHNA 3UCEA 1E1LA 3VZDA 1HC7A 3O93A 5ADVA 2J87A 4CPDA 3DLTA 3JQQA 1E9FA 2Q1XA 3EIFA 3LHKA 3KUKA 2JNWA 4OXXA 2A9RA 2FOLA 3BFPA 3ZG6A 4M1SA 1H0SA 3NHRA 4DIFA 2ZSFA 5AKIA 4GI3A 1NRXA 3K8OE 1U7XA 4IQ8A 4N3AA 2YN0A 3AM5A 3P2YA 2XUHA 3L7JA 1ZH4A 2A88A 4ALLA 5FHQA 4COOA 4QAJA 1QXSA 4BJHB 4PPQA 3RLFA 1ODFA 2GHQA 2MYPA 5A0VA 3GLUA 1LLUA 2BTQA 2C9BA 3Q5GA 4QC2A 2VWHA 4HNVA 4CMKA 3HUTA 5JG7A 3QE4A 4AZTA 1VI5A 4ZO7A 2ZDGA 1I3MA 1XMXA 3A1EA 2I55A 4M46A 4KL8S 2OVFA 2H1IA 3O4HA 2FZGA 1VSBA 2A7XA 3B3AA 2XUKA 4OQYA 1RXSA 5LLSA 1WU8A 4LYEA 2FPPB 2LBPA 4EFMA 1LDYA 4JYAB 4E51A 1VCNA 5I7WA 4PR3A 5FWYA 2ZR0A 3DF9A 2C9YA 3R0IA 1E20A 1GILA 5AIBA 1CFZA 2P2LA 5MFZA 2ADFA 4M21A 2IT1A 3HKCB 1PR5A 4E2ZA 2XB8A 1ZN9A 2R2AA 4MWTA 3AU9A 3IBGA 5LN1A 4G86A 4C2AA 3L6DA 2C9ZA 4MW6A 4P22A 2H54A 3OETA 4IXNA 4QG7A 4FWBA 4NCHA 1N6OA 3D0QA 3I61A 1G98A 2PUCA 3JX9A 4FFLA 1I1HA 2ZQ5A 1J8VA 2O7SA 3RT1A 1MB3A 3AT1A 2BI8A 2LD4A 2Z5GA 4O59O 1NI3A 4RQAA 4UXIA 1TM7E 3OJLA 4WHMA 2HBYA 5E1OA 5CLLA 3KOYA 3GFOA 5TE9A 3TLJA 3EHDA 3TPZA 3ZHSA 2FUEA 4BRUA 4F3CA 4UBLA 2IYFA 1M75A 2BBSA 2PX4A 3LW8A 4H16A 4O33A 4RIIA 1NJGA 3JR7A 3P19A 2CC2A 4GXQA 2B9VA 4O6VA 3PHBE 3U3ZA 4B2YA 3LZDA 3HWWA 2ZB4A 4M54A 4Q3KA 1UFVA 2IE8A 3DB1A 3LHSA 3BG5A 2O7QA 1JMKC 4FS8A 4J0GA 5FEMA 2BFNA 1GNLA 4GLBA 1IBCA 1R88A 4KKVA 4KQMA 2GNAA 2VATA 1JF8A 3FLMA 3PENA 1H8ED 1KIFA 3PJDA 1J1ZA 2AA3A 4G4JA 4MKGA 3ZI0A 2YJZA 1NKSA 1KMNA 1L4EA 1O9HA 2EATA 2HSEA 3L79A 3K9NA 1OMOA 2HA6A 1ONNA 1O4VA 4JLNA 1WBDA 4EBBA 2PXCA 2EBFX 1JI0A 2VYND 5BYBA 5CBPA 5IFLA 3PPIA 3IEMA 1ZKDA 3NXSA 3W1EA 1P72A 1SXHA 2VDMB 4N0MA 4TXNA 1QTRA 1LS1A 1ZHHA 2GMWA 1EVEA 4QKQA 2HNKA 3H4VA 2PDAA 2PMWB 4M98A 3LQFA 3OFJA 4Y0VA 3NTLA 4KQIA 1I0IA 5BP7A 3BN3A 1DVRA 1E1CA 3K32A 2B98A 4JX9A 3FPBA 3NH9A 2PSSA 5CU7A 4BGVA 1B2RA 1J9EA 5LZ9A 1KI4A 4RE5A 3E5RA 3FDJA 2JAXA 1RKQA 2C2KA 1MX5A 3QK7A 4MKZA 1A5BB 1L8QA 4IJ5A 4UFNA 1TPYA 4RE6A 1R0KA 3V3TA 4DEVA 5IKEA 1OIWA 2FHPA 4UC0A 1A96A 3C3MA 2ETVA 2YV5A 1BRTA 4I4IA 2NYRA 2QXTA 3KEOA 3CIFA 3KKZA 4I50B 1DTSA 3TQSA 1VCMA 4JP8A 1LUAA 1D0SA 2GEFA 3K9HA 1GKUB 4F5WA 5BURA 1KVRA 4WZZA 1M10A 1PKXA 3JQ9A 4PQRA 3RRBA 1HUQA 1GZ6A 3JZAA 3VU1A 2B1QA 2B1GA 1LFDB 4JI6B 5CD9A 3CO0S 3WWDA 2QD4A 3IIEA 1WTCA 4K26A 3WL5A 4A8JB 3RBXA 2Y0PA 4BHTA 3FPSA 1IXSB 4LXYA 5BN4A 3U09A 4KQFA 1I2CA 1A97A 2FJPA 4JOSA 5EWJA 1T4BA 4F2WA 2D00A 4RJLA 4M49A 3SIRA 1GUFA 2TECE 4RVFA 3LVRE 3M9XA 3LJKA 4J1NA 3E3MA 1E1YA 5JH7B 2HHAA 3S2ZA 1N5OX 1T13A 2DPMA 1ZK0A 2J32A 3CJRA 4EO7A 4JEIA 2Z09A 3CVWA 1RFLA 4OBXA 1S6YA 3AJ9A 3AR6A 3EZ9A 3BYZA 3LFTA 1YKSA 1N2EA 4FR5A 4RADA 1IXKA 1PZFA 4G4SO 5SV2A 3ZHBA 3IAS6 4HT3B 2PX2A 4CF4A 3EFBA 1SVKA 1UIMA 3P0IA 1WXIA 2AX3A 4ZOLA 3MJCA 1XQ6A 3TNYA 3RUDA 3E3AA 3KB8A 3MTDA 4JBIA 2JI4A 5SICE 4NMLA 4FZJA 2ZIXA 4A2WA 2C29D 3HCFA 5AHRA 3WIUA 1KZYC 2FPIA 5T4HA 1RD4A 1OLSB 4C9BA 3IRUA 2ZJYA 1KOLA 3EVEA 2ODNA 3PK0A 5EAIA 3R0XA 3RVLA 5L9AA 5KQRA 1Y8RB 1NVAA 1U9CA 3F9RA 1O4WA 1K4YA 2E87A 1BC5A 3JQEA 2DERA 1SZCA 3EXIA 5KYVA 3UK0A 4EG5A 3FZEA 2J9YB 3HXTA 4MZXA 2COEA 2PZKA 3OQPA 4CTMA 1F60A 2C0PA 3GNLA 4FMBB 4YMLA 1PG2A 1ZBQA 5B6IA 2VH1A 1EFPB 2ZYGA 2I2FA 3MINA 3IVCA 3QG1A 4M1TA 3ZVRA 1DWOA 4WQMA 2C5EA 2AQKA 4DBLE 4UVEA 4X7BA 2FZKA 3L6OO 1KI3A 2R87A 3W3ZB 1G4UR 1X1TA 3A4YA 4JC5A 3UGQA 3WLJA 2OHXA 1AZWA 1NM5A 1EK5A 1RP1A 2QUAA 2CJWB 5CDTA 4OJNA 1QX4A 3TYXA 3SGLA 3GF4A 2H4JA 4QDOA 4TYQA 3TX2A 4O4JA 5GJWC 1Q0PA 2AE1A 5IN5A 4Q4AB 1KSGA 2C7RA 4LQCA 3LWZA 2VDUE 3U80A 4CIAA 2Q7XA 2QL5A 2A92A 1E4EA 2BBWA 2OLJA 2FG6C 2PFSA 4KBYA 4M2LA 4C5BA 5HRAA 2XE8A 1UIRA 2XE4A 2BEUA 3SZUA 1R6TA 1YR8A 3HY4A 3R3VA 3RIYA 2Q4DA 4J0HA 4N47A 1JQLB 4KZKA 1HMPA 1LZLA 2PR7A 4ECEA 1JV2B 3E7XA 4IUYA 3NOXA 1JR4A 3BTVA 2H1OA 2F3SA 5CK5A 1NXPA 2OCGA 1HYBA 1Z4IA 3B1WA 3N75A 4GXTA 3WNCA 4J0JA 4N9WA 3VKVA 1V8BA 5J2UB 1B15A 1Z4OA 4Q3LA 2AMYA 2VUTA 4XYLA 4B7UA 1HE3A 1ZXXA 1LY1A 4JLJA 4QARA 3FXAA 1Y3BE 1XYVA 4BB0A 2G40A 3COWA 1ZN7A 2UXBB 1U2RA 3VZCA 3SHTA 1Z0IA 3NUQA 4YPFA 1SXJD 4A03A 4OD0A 2FKNA 5IT5A 3ADOA 4K6KA 1YZFA 3IKJA 1CU1A 1V26A 1YOVA 1N32B 1E9EA 1GZVA 3ETCA 1YK1A 2P2YA 3PR3A 4KQWA 2D1RA 4N7BA 5FQOA 1IAVA 3T52A 3TDNA 5LQAA 1CQJA 4DSTA 2WAXA 3IAFA 3KEGA 1H2RS 2FXIA 3INYA 3I39X 4JFAA 2PFKA 4JL5A 4IVNA 4PPGA 2F3UA 3GYGA 4QRIA 1MEOA 3JTEA 4ZAXA 4B0PA 4BB9A 1JR3A 1HDXA 4LNUB 2H18A 4DN6A 3U7EB 2F9LA 1OX5A 1QX3A 5AVYA 1QQ6A 1ZHOA 2KWIA 1HTTA 3FNHA 2H4ZA 1Q7BA 4HJRA 3HJGA 3O94A 2BEWB 2WYOA 2XQVA 4J29A 4AYWA 4D9BA 4YUAA 3Q8MA 4PNHA 4QULA 3SS8A 10MHA 1G6HA 5GIOE 3GVIA 2I3ZA 1YASA 2NXEA 1H93A 3VH2A 1JLHA 1II0A 4QDZA 3MTQA 3WBFA 5I6DA 4W5NA 3QLUC 2SNIE 1Y81A 2PUTA 1E6MA 1E2KA 1EUZA 1VA4A 1VPVA 4HOYA 1D3AA 2V8OA 4C7OA 1F1JA 1A7KA 3ZV6A 3ZKWA 1UM9B 2FX2A 4ZMSA 3EQZA 2FGKA 3GP8A 1I6KA 3HPRA 1KL7A 5THQA 3WBKA 4E88A 5IWCA 3IEVA 1XJWA 1JHRA 2R00A 4NCAA 4UTNA 4DA0A 4IAOA 1KDVA 3CRRA 2BLNA 2X8BA 2MOKA 4MQEB 1SRRA 3O9ZA 1BWRA 3FG9A 1JQEA 1EVYA 3OO1A 3I0MA 1UDRA 1ZJ4A 1N5KA 1PR4A 3A9WA 2RHBA 4EQZA 3AL0C 4G36A 5DM4A 3ZI4A 2AD1A 4QUHA 4TYPA 4H1WA 1U2DC 2DE0X 1QVWA 1YCDA 3CJQA 1BH2A 3L4BA 3NGMA 3TOXA 1EVQA 2C4TA 4QWMA 1GNQA 1Z7EA 2G76A 5L7WA 2RGDA 1C7EA 1Q22A 4ZREA 5KYXB 1TJPB 1FRQA 1YWGO 3E4CA 1M6VB 4KO8A 3GGJA 4X85A 1C9NA 3QHQA 5KNCD 1P0CA 3DTVD 1G8HA 4J75A 3VJMA 1PWYE 4KO4S 4H3KB 1YZUA 2ZVJA 1X7YA 1DMSA 2JKVA 1TLLA 2H4XA 3HJHA 4JP2A 4NCXA 1R8XA 2JI8A 4B3JA 4P2GA 2ONZA 4FINA 1CDDA 3B3QA 4KXUA 2BI7A 4E6EA 4EK9A 1SQ5A 1NV8A 1WW2A 3MGBA 3SDBA 2YZGA 5L95A 1NU6A 3VV2A 4ZI2A 4E22A 1A8QA 1GXSA 2UYQA 5JROA 2C97A 4P4LA 1WULS 2HFKA 4G0NA 4BC0A 3I2GA 2P2ZA 1L5YA 2CL7X 2F3QA 3PRYA 4WFQA 1JEQB 4D6XA 2G4LA 3QVXA 1SOAA 1YRLA 3BDAA 4L0QA 3JQ6A 1UK6A 3P7MA 3LCMA 4MIKA 1XU7A 4P3YA 1I2AA 4RJJA 1I32A 1YB5A 2CCGA 2B8TA 2PVPA 3H1EA 2VTVA 1GDTA 2QMHA 3AUSA 5LPNA 2QSUA 3EWAA 4HAWA 4MQBA 2JIBA 4NBLA 1X1DA 4OREX 4RLQA 2XRFA 2CLOB 4U9IS 4DJFC 4MINA 1MJHA 4A2CA 3ITDA 3WLTA 4P7JA 4DRXB 1OI7A 3C8UA 4JVOA 1I33A 4FU0A 3I6BA 4Z2AA 2FZLA 5ALIA 5K03A 3ZCVA 5AK0A 4XD2A 4DLPA 4MVJP 4O08A 4D4GA 3O8RA 4J3FA 3K70B 3KJQA 5A5GA 4FJ1A 4O2AF 5JV5A 5G4KB 3TUIC 5E9JA 3PV0A 5AUQA 4HB2A 4F3RA 2D2XA 3QEOA 3Q3IA 5CGQB 1HYEA 3CW8X 4X41A 1HSOA 1CHDA 3OOJA 5AW3A 1YTUA 4XQGA 5LA6B 1UJBA 4LF7B 3IUNA 4F97A 3CVXA 1IZYA 1TVKA 1WXFA 3E5HA 1EWYA 2I2AA 3C5HA 2G5TA 1QHHB 5DWVA 5JPDA 1J2YA 1JFRA 1W5BA 2JZOA 1N2ZA 3FKQA 3LO5A 4CETA 2HF8A 4M6WA 3T7JA 1B1CA 5KHOC 3GLHB 2CT8A 3W6ZA 5FOWA 4EF6A 1G7TA 3L82B 3O84A 4HO1X 3G6WA 3IE1A 4I4TB 5GWXA 4RKFA 2I4IA 1DKUA 1X1CA 4BTLA 1THZA 1A9ZA 3M0EA 4IHQA 1TI7A 1DIRA 1KMHB 1Q7RA 3QQPA 1R4MA 5HE8A 5F9FA 1KJ8A 3ZTTA 2GJAA 4HXGA 3ZHQA 5KDOA 3IBSA 3C6YA 1KIMA 1Y1TA 1HX7A 1SBHA 2H2AA 3RS0A 3IDFA 5ELLA 3GPIA 3RNLA 1AKQA 3QNMA 1HDYA 4R54A 5DH9A 1A76A 3D4NA 1U31A 1KPHA 2R47A 2VJLA 5DWQA 2EG9A 1I14A 4RH1A 5FWXB 5ICSA 3FNBA 3KQTA 5DMXA 1W36C 4NXNB 3L0IB 4UATA 1GZ5A 2Y27A 4RDCA 3JWGA 3FBWA 3H0CA 4DSOA 5BUZA 4ZHQA 4IRMA 1T29A 2XCQA 1Y80A 4Y6SA 4D9EA 1L4GA 2OO5A 3UT6A 2AF3C 2VZ9A 4KGZA 2NU8B 4AN1A 4DMGA 4U7GA 5I48A 2BDEA 4RKEA 3ZZMA 4DWOA 3K96A 2C54A 2MR5A 1QCCA 3EW9A 4G6ZA 1V1RA 2XHEA 4WXEA 3GLFB 4B3RB 3V9PA 2OHVA 2PRYA 3SX2A 3TIGA 1U8FO 3B38A 3LYHA 1JHMA 3O4FA 4LZNA 2PGJA 3PL5A 2HL6A 3I05A 3V32A 1PLJA 1QU3A 1HG1A 2G7MC 2QZ9A 4LA4A 3VNAA 4OHXA 3CIOA 2M2IA 4A6PA 1BVRA 1QF7A 4P7FA 3JZFA 4ZYZA 5JTUA 4YP1A 1SQ6A 1VJRA 1VLQA 4JP1A 3P94A 1KI7A 2D0PB 1ENYA 2WSLA 3KQMA 4JSRA 5TY0A 2XMCA 1EX1A 2XPCA 1Y1PA 1ISIA 4F4UA 4HNAB 1EFCA 2INGX 2CJPA 2ORED 3IJEB 2XMDA 2J5XA 3KKMA 1KEPA 4I8IA 2AFRA 2WI8A 1J2EA 2ZI6A 4OP2A 4X90A 3FCEA 4EUNA 3FDIA 1WM1A 2Y1CA 3D8BA 5CMLA 3T5TA 3BHJA 5JS8A 3TR6A 2W6ID 4MP6A 4KQXA 2Q4EA 3JXEA 2LUOA 3ENVA 3PI6A 5IFKA 2X13A 3R74A 2UUOA 4NATA 5ILGA 4PG5A 2HK6A 1P39A 3KHUA 3OJXA 1NKVA 1QH0A 3ONFA 4IH4A 1C0KA 1WW3A 4WKOA 4YP6A 4YA6A 3PNMA 5GJVC 4A23A 3LGSA 2NO4A 1Z18A 1LF0A 4ZIRB 3I2KA 1G4HA 3A6PC 4EITA 1BDMA 1EKXA 1JXQA 2HLNA 2JGIA 1TM1E 1E8NA 1Y9DA 4TV9B 5JMOA 4FDAA 1K9VF 3RTEA 2C2GA 3RRXA 4A3SA 3A27A 5JRDS 4HDMB 5D5QA 1OAOC 2A0FA 2F8LA 1S8FA 5LLTA 4DR3B 4Y9TA 1NC3A 1ADCA 1QGUA 1S2MA 5EMMA 4P54A 1DL5A 3PBKA 3SS9X 4B43A 3MYYA 4DWWA 2JIPA 2QW8A 4P35A 2EFHB 2IEDA 4AS2A 1YDFA 1NVTA 1XN4A 4NOMA 3CF0A 3A2LA 1NE7A 3ZDCA 1E4VA 5AKZA 4G8BA 3JQ7B 1IY9A 1J42A 1I4EB 3GBPA 1ZNZA 3PKZA 121PA 2YJ3A 3SNKA 2AOTA 4UBJA 3I9OA 2NPOA 2YYZA 3N86A 2IF2A 5J1TB 2WVGA 1RAHA 1N75A 2W00A 1UP4A 3K30A 1N2IA 1RXUA 2VSYA 3HDYA 1S5PA 3KT3A 1IHOA 2D8MA 5AJYA 2XCLA 1P5JA 1Z4KA 4CE6A 4WNYA 3A7DA 3ZZUA 1COWA 2VWPA 1VGRA 1JILA 2XYPA 2X6TA 4B45A 1GL6A 5F7JA 2QPOA 3NFRA 1ZIXA 4HYYA 4QYIB 3UT5A 1KEUA 1LWNA 1Y89A 3D43A 5FTLA 2WU4A 3RYCA 1QF6A 1NMEA 3BE8A 3TW0A 4Y1RB 3PDHA 4FOPA 2V7PA 4UAUA 3KQPA 3DBLA 3RK1A 3NHJA 1CJKC 4UCFA 2OGTA 6PFKA 2QDKA 4KQ2A 2PGNA 1RC1A 4JKIA 4DC0A 4DGSA 5ITZA 3C7TA 2PGOA 3BCSA 1LV7A 1T4DA 3LAWA 4EWLA 4EB8A 4PG7A 4W8OA 4FMCB 2WUDA 3RM3A 2B6HA 3WGZA 4DCPA 5CLJA 4K9DA 4J49A 2P79A 3P9PA 4ZKEA 3STWA 5I3CA 2ATXA 3PDJA 4PFJA 3TNJA 1P29A 1WLSA 1KC1A 4L28A 2P40A 2RJOA 4QUJA 2WP0A 2D5IA 1C4WA 4PONA 5LUBA 3KQNA 4Q37A 3X43A 1DJQA 3PXAA 4EUEA 2JBHA 2WE8A 3W2HA 1FJ2A 1UPAA 5A4DA 2B2XA 2IWRA 1ZSVA 1KSFX 2CYBA 2F1IA 4LYFA 4MKXA 3F9CA 4PC1A 4ZTZB 2DH5A 2HNBA 1Q1BA 3WI7A 4HAXA 1OWMA 4LCBA 1SXJC 2PUHA 2ZYTX 3UC5A 2OFFA 4EHNA 3ROQA 5JISA 4OX9B 3PGVA 3IDZA 5FTJA 3TG8A 4ZZ1A 5BVHB 2J7PA 2IRWA 1GKKA 1E3WA 2VI5A 2WTEA 3T7AA 2ONKA 4GOKA 4DUGD 4ZA2A 2H2DA 3R9WA 3KNZA 2BFMA 4MQUA 3I1IA 4FZRA 3QE3A 4XYBA 3SXPA 4GGOA 2YWFA 2ZJFA 4I9GA 4ZODA 1MX3A 4RF4A 3BMQB 1PIWA 2IYPA 4OSPA 5NULA 4IILA 3LUBA 3UB4A 1S1MA 3FFWA 3IPLA 5L3SB 2FF5A 1PNRA 3DUWA 2OTCA 3CKMA 1C4OA 4TTQA 4FGLA 4FBMA 1UMKA 3AJRA 2NSLA 1SVIA 3THSA 1UAGA 5KNDD 4QUBA 1H9CA 4YCCA 4Y9DA 3ZXUB 1ETHA 2FEOA 4RL4A 5JECA 8MHTA 1PNQA 5BN5A 1FP1D 1Q3HA 2AN9A 4QXPA 3CLRD 3Q5DA 4V0RA 3DB2A 2F4NA 1II9A 5BN3A 2VP0A 1TQDA 3AESB 4HYTA 5AJTA 4ZZ0A 1M67A 3QVGA 2Q3HA 2WZCA 2C2WA 2HRBA 2QV7A 2JI6A 4MV8A 2PRIA 4H7JA 5JD6A 4OGLA 1PWXA 4PLWA 4W5RA 4QT0A 2QL7A 3H5AA 1I5OA 4MR9B 1KR2A 1F0KA 3TD6A 3PF9A 4BMNA 4DNFA 1XBTA 4B3XA 1YDGA 1WQ4A 3DZGA 4EHKA 1KKLA 4HY3A 3DFKA 4J7XA 3HR4A 5DYIA 1LRLA 4DMKA 2C03A 1JMVA 1W30A 4UTXA 2FFJA 1YVEI 1Y5RA 4PZEA 5G2OA 3U3KA 5CAEA 5SZJA 3WB9A 4PC6A 2CHVA 2FDRA 4G1EB 4AF7A 2QAJA 2W6ZA 4RTSA 3DPUA 3FIUA 3JSXA 4Q4LA 1Z6GA 3WDMA 5J23A 1V0JA 1G5TA 1FU4A 1S8NA 1DAEA 2O0JA 4ZJUA 5HF8A 1FFEA 3HVIA 3TLBA 3ABZA 5LBIA 5SYMA 1BFKA 5HBRA 3STXA 4E4TA 1QU2A 5AKLA 4RUKA 1YXMA 1YJBA 1F2DA 2F9FA 3N0XA 4G0YA 1YJXA 1FMFA 3TVDA 4H0CA 5EWMB 2B8EA 4OFXA 5G0SA 3U3RA 4YMGA 3DW3X 1LEHA 2J7KA 2NO0A 4KVGA 4MS3B 1EXMA 4K8RB 3AR4A 4PCAA 2YBDA 3C24A 1YE5A 2WY2D 3UWSA 3GGDA 5JCPA 4XWWA 3GDGA 3BZUA 3KL4A 4LECA 3UEOA 1MAHA 1AQIA 1PK7A 1QR6A 4ND4A 1O94A 1FVHA 2R6JA 1K08A 4YDHB 1WTAA 2XVMA 4QM7A 1SIOA 3NUZA 1TOAA 5F35A 3UG7A 4CIBA 4O5AA 3LHDA 2GF9A 4YO7A 2JFGA 5A0TA 4DKXA 1EB9A 1JWBB 1Y4SA 3QENA 4C78A 4BZQA 3UAGA 3WQSB 5LD2C 1TF7A 2I4LA 4K7JA 4F91B 2H1RA 1FX1A 4DIUA 1DAPA 3QSYA 1QE0A 4DLZA 1MO5A 3MWFA 3L18A 2ORVA 3AZOA 3V34A 2O8EA 3UYKA 3ANTA 5C7IO 3C1UA 3GLIA 3FNGA 4BNGA 3RFUA 5K3FB 4CM4B 4YVFA 4AXBA 4YRLA 1LPSA 3OHPA 2ZT5A 1NGSA 1FTSA 1RMTA 1SBTA 1HYGA 4GLJA 5EYPB 3HL0A 3DJYA 4DM7A 3UK1A 2RI1A 4QPZA 4OH7A 3FROA 4HL6A 1GUBA 3RYTC 3H5OA 3TTSA 3A26A 3QF4B 5JANA 3IOMA 2GQ0A 4R69A 4OA5A 5M3BA 1EVIA 3BK1A 3ZEAA 4I50F 1J09A 1KAEA 5LCXA 2GNOA 4CG2A 1RWBA 3TIIA 1UKZA 1B8UA 5ECDA 3RSSA 1KJIA 2PZJA 4OHFA 3FAZA 5H02A 1T6XA 3Q1LA 3V4RA 2ZUUA 3H1AA 1ORTA 1PYOA 2F8MA 2ZU0C 1YFJA 2IIQA 3LQRA 4B32A 1QG0A 3UMGA 2NAPA 2CMKA 5LZ7A 4QZVA 2X58A 4IDHA 2FH5B 1I9GA 4Q82A 4MRNA 1KYTA 5KYUB 5EKXA 4A73A 1XTBA 5B7GA 4XVQA 1PUJA 5KSYA 3R0VA 5A1JA 2HF9A 3HEMA 4ID3A 3SDSA 3K9BA 3VR2D 2IUTA 1CHNA 1EFRD 3G5MA 4URZR 5AM4A 1M2VB 1RAIA 2V6MA 5IJ9B 5JH7F 3IAHA 3ELUA 3L92A 2DPXA 1FDSA 1QO0A 4XFKA 3GR6A 2QAGB 4Y1FA 4BNMA 2Q5HA 5MDHA 3HR7A 1TU3A 5CVCA 1WHTA 2R85A 3NLLA 4R8LA 3WK4A 4AJ9A 1BXKA 1EDOA 1PUXA 4HRYA 2QTGA 2NXCA 1BD4A 4M0KA 1XTIA 1LCIA 4KNVA 4YUZA 3OD1A 2CLDX 1JPNA 1YULA 2I6SA 4L4XA 4TVSA 3H5TA 2F7SA 4KVAA 2FPKA 2VBIA 2WFAA 1I13A 1HZJA 1DCKA 1RHJA 2P9CA 3MD9A 3PNLA 3ZDEA 3LZCA 5HIIA 4D8VA 2K2WA 4EDFA 2FFAA 5KYWA 4UVDA 1XKXA 1UC9A 1UKYA 2CJFA 2CK3D 2PUDA 2R62A 3A2NA 1NPTO 2HIGA 4O63O 4PAQA 5JNSA 2XKBA 1R0XA 3D2AA 3TQFA 1JTVA 3UFXB 5GP1A 4B2IA 3OPYB 5ER9A 3UAVA 2QYTA 3RIMA 2VDWB 2RG7A 5TPZA 2NTYC 3UK2A 4DTCA 5FLEX 1MZVA 3RVJA 5JOQA 3CPHA 3FNFA 2O0KA 4RYDA 4TXHA 1QRTA 4Q1CA 3HYNA 4BO9A 4KQ6A 2NU6A 4EL0A 3LWDA 2B1RA 3AY6A 4R3UC 4YV7A 5BRJA 1OTHA 4X20B 1SJ9A 1I4LD 5GAJA 3L6UA 4IEFB 1L5NA 3RJ5A 1VE1A 4BGDA 2ILVA 3HHPA 3LVFO 3MN1A 4CV0A 5JUWA 2Y1WA 3TKAA 3GMDA 3I9NA 3IQZA 5IX8A 1T0BA 2PX0A 3DT6A 4Z5XA 1HDRA 4PR0A 4PYRA 4Y6QA 1Z6AA 4B7XA 1ZUNB 4EGSA 5JS7A 2V6FA 4LGVA 2Y1XA 3L1JA 3VR4A 2I34A 1IQPA 2VJMA 3CGWA 3K35A 1XEXB 4IIVA 2XGGA 4K2HA 4J3JA 3G7UA 2GCOA 2G8NA 2VDVE 3NIDB 2ODAA 1Y1SA 3FWHA 5LBUA 2C82A 1U8UA 1XTQA 3GA0A 5EZSA 2WSIA 3QYFA 4R5MA 2F4VB 1T4MA 3ZJUA 1W46A 1CBUA 3CUYA 1C8BA 3OX1A 4PIMA 1KH1A 3V8MA 4EOGA 5KTOA 2L17A 4TTJA 1QRRA 2PZMA 2CXXA 3HDQA 4A6EA 5B3JC 1HLGA 5A6VA 4EJSB 4PZPA 2JASA 3DEZA 2C98A 3KRTA 1MUUA 1AS0A 3HWX1 4CLRB 4YI3A 3QX8A 4R2HA 5J2UF 2AMJA 4GZMA 5A5VA 2O06A 4V0QA 5JARA 2Z0MA 4WN9B 4JP3A 3OE1A 3NIWA 3ETDA 1RWQA 3EXFB 4QEDA 3EZFA 3TPCA 3X1ZA 1M1UA 2W71A 3TZLA 1KOFA 4MA5A 1TA9A 2HLPA 3NDJA 1JWAB 3GHHA 1NQVA 3L84A 4X7MA 4X64B 1DARA 2AG6A 3CRVA 1FUEA 1OH7A 2EX4A 2F64A 1YR1A 4ZO9A 3IB6A 1XKQA 2WYVA 2YN2A 4LY6A 2ZAOA 3N1UA 1R74A 5C46F 3LUFA 3QLTA 3V4SA 3W5DA 4G01B 3O4GA 4WA7A 4YIKA 1T43A 2CF5A 1LDBA 1TC1A 1RCUA 2J48A 1LSSA 3Q9SA 1W5EA 4MQ6A 4Q6BA 5TX7A 1NXXA 2BGKA 2BL4A 3HYTA 5EPEA 1G1MA 2W2TA 3GNTA 3T54A 5TVKA 5HUJA 1K88A 4Q1EA 2WWXA 1K8QA 4NR0A 4ETNA 2AT1A 4A10A 5CJ2A 1VLVA 2IUEA 5HIAA 2C59A 3H65A 1CY8A 4GMFA 1OLXA 1USVA 1YDWA 2VJBA 4FDLA 4KTVE 4KTTE 4BYGA 4IFBA 2GTPA 1UJNA 2RC6A 1NBWB 4U39A 6REQB 2O3SA 2AVDA 4QIHA 4E5SA 4QLOA 3G9TA 3UFBA 3VC2A 4F6RB 3WRXC 4A0SA 5J2TB 2YQ5A 1SVSA 2E4ZA 4Q48A 4PC2A 3PA6A 2NUTB 4CQLB 4J4TA 3QE9Y 3HP1A 1X1AA 1P81A 3R3YA 2PUWA 4BIMA 4J1QA 4MRRA 1P9NA 4ZK2A 1RWVA 5GV8A 4BO1A 2R8ZA 2DZDA 5EGNA 1KGDA 1VGVA 1FXWA 3ITEA 3VX4A 4FYPA 3AYXB 4RZIA 2Z4TA 5T67A 1ID1A 4YO8A 1E2UA 1DOHA 2O7RA 3RC7A 3PWZA 3BF8A 3WR5A 5BXYA 4B6EA 1N1GA 2Z43A 2IYWA 1WP4A 3BM5A 4K9NA 4PO8A 1EHIA 1FQJA 2BGNA 6NULA 3HKBB 2Y1GA 3IVAA 3OE7A 4JSYA 4N5NA 1E7YA 4Y9UA 4LNAA 2Q0SA 1EB8A 2DPHA 2CNWD 4WKGA 5IDYA 1D1TA 1PDOA 1LXCA 3L1KA 1QV6A 5DLEA 4U7PB 4DJDC 2NV2B 3FZNA 1IHXA 3KFXA 3O3NB 2IKSA 3N87A 4EG8A 1UINA 4HWPA 3UMJA 1WXEA 3K2QA 13PKA 4YT2A 5FV4A 1C1HA 1SA0A 3N0RA 1TUEA 4X84A 4ZOBA 1L6IA 5EIWA 4C4OA 1P9WA 1ELOA 1XG5A 2PSJA 3L4SO 4FYVA 2R1ZA 1B0ZA 2GERA 2HMUA 3RFXA 1VIAA 2OCYC 1RWOA 2X8AA 3OAAA 1Z63A 4V0KA 2C4KA 3GT0A 3PQEA 1EDEA 1ZJZA 1SPXA 3R4VA 4TKUB 1W4CA 3A4VA 3A8TA 4IFTA 5JNVA 1XMJA 3TSZA 3CLRC 1OWOA 2B37A 4HXEB 4ENWA 2W2KB 1KHTA 4G5QA 5AXBA 4B8WA 1NDQA 2XNCA 3AR3A 2ECPA 4FQ8A 3TMKA 3IIMA 4BZPA 4MV5A 2X3YA 4RPKA 4QXAA 4HPXB 5DTJA 3K70D 4HDSA 4CCYB 1CP3A 1XFDA 821PA 4W5OA 1F4PA 1XVLA 5K5EA 2WABA 1ENPA 4QBHA 4G63A 2PCLA 4TLAA 2JIQA 1KS2A 4LYDA 5ELMA 1U81A 2H4FA 3EVAA 3RTBA 2I03A 1OW3B 2QP4A 3B52X 4YAEA 5AKJA 2W2XA 1IVYA 1OX4A 1WHSB 4DCJA 2VNKA 5AK6A 4OKIA 3F5FA 4UE2A 3F96A 1L3BA 3QJYA 4GBJA 3FGNA 2ODPA 4U5XA 4S1VA 5CJPA 2GJ8A 1WSBA 2Q7OE 1RM3A 1RLIA 1BCRB 1AHPA 3E5NA 5KOHA 2AUMA 4TTIA 5SZHB 4Q3OA 1O77A 2CFTA 2QIOA 5CEFA 2GCGA 2JFWA 3KR0A 5LA6F 4QBKA 3HN7A 3O47A 3KKQA 4JZKA 4MQFB 5H3CA 2GPWA 3R3WA 4KLCA 4EKEA 3FF1A 4CLHA 3THOA 3GLFA 1ISMA 5LNK1 3VR5A 2HQBA 3BFKA 5AOAA 1IUOA 1E6KA 3NHZA 3LDFA 3KP1A 5ER6A 3DDZX 3OX4A 4DBVO 4I4TF 3BXXA 4PF1A 1XTKA 3H2HA 1UDXA 2Q9UA 2W83A 3BMNB 3UXHA 1UFRA 1JW9B 3R8FA 1FSZA 5K51A 1KY3A 1ZLYA 2QUZA 2VPTA 3TLCA 4UVIA 4FYYA 4ZWNA 4BNDA 3T1QA 3BE4A 4UM9D 1BTOA 5JZBA 1GG8A 5I7SA 3ZHZA 4NMMA 4M55A 3DL0A 1W93A 4B44A 3ROGA 3UAZA 4EDHA 4PN7A 4U6SA 3NPAA 1E89A 5FB3A 4IDAA 2MSNA 2WUWE 2ZLBA 1KJNA 2XOKD 2O8BB 2IOFA 1GQ2A 1HDEA 3AH8A 3RVPA 4R6XA 2QRJA 1L7DA 2IPOA 4MVJA 3ZWBA 4CKEB 3CY6A 1ZH6A 1O0CA 4GQIA 3OT4A 2LPMA 3MJ4A 2EZ4A 4I9FA 1J8MF 1KDPA 1T91A 2FVXA 2G8LA 3H9BA 1SUBA 1XZEA 2CXTA 3LP6A 4HWOA 1XOIA 2IL1A 1NWCA 1O54A 2AF4C 2WHRA 3HI4A 4HAIA 1MIHA 3V4ZA 3SD7A 3M4NA 4JMPA 4LVOA 4W5QA 1Z17A 3GFQA 1U1FA 3T0IA 3VUFA 2QT9A 3GJ0A 3MF4A 4FEYA 1MJGM 1P2DA 4JI4B 1RC0A 1BXGB 2PZGA