3I5MA

Structure of the apo form of leucoanthocyanidin reductase from vitis vinifera
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
307
structure length
302
Chain Sequence
GRVLIAGATGFIGQFVATASLDAHRPTYILARPGPRSPSKAKIFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative leucoanthocyanidin reductase 1
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
total genus 105
structure length 302
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i5mA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i5mA02
1LC3A 1X13A 2HMVA 4HFRA 4ALNA 2QG4A 4WGGA 4HBGA 1WDKA 3FF4A 1FMCA 2FHSA 2H63A 3QWHA 1PQPA 2ZB8A 2VYNA 3FNGA 1ENYA 4E0BA 2Q4EA 1PJQA 3IKVA 3OJ0A 3UKOA 4AL4A 4MOWA 5ILGA 3WR5A 1D7OA 1HE5A 4Z9XA 5IDXA 1FK8A 1W4ZA 2UUOA 3WQRA 4CMCA 3CKYA 4M1QA 1HDCA 3L0DA 1ZMTA 2PNFA 1Y6JA 3DZGA 4UUOA 4AICA 3IC5A 1I10A 4M55A 1PJCA 1IZ0A 4D3FA 3ZNPA 5HBRA 1LLQA 1ISMA 1YGYA 5TSDA 4JIGA 3DBRA 3PHJA 1KY5A 3BIOA 1DIAA 1Q0QA 4KQWA 4W7IA 4R5MA 3RUEA 3OIDA 3RQSA 3WGYA 4CV0A 2Q1SA 1E1MA 4P22A 3NT5A 2B36A 4JBIA 4FFNA 4YRDA 1AUPA 1TB4A 2GCGA 4R54A 3ZU2A 3ITDA 5JDIA 4ZRNA 4RVFA 4Q3AA 2CVQA 1YL5A 4WLUA 3X2EA 3DOJA 3CZMA 1JW9B 1O5IA 1YDWA 4C7KA 5F21A 1LLUA 1C1XA 3HSKA 5TNXA 1OAAA 5IN4A 1ZJZA 1LA2A 1LSUA 2EJWA 3KETA 2FR0A 2DFVA 1XU7A 5JDIC 2HDHA 2I66A 1ISIA 4ZRMA 5T8KC 4KDEA 5FEUA 1WW8A 3GNQA 1RYDA 1RM4A 4DIOA 1PS0A 2C59A 1T24A 3F46A 2VRBA 1B16A 3LC1O 2DTXA 1P9LA 4N7RA 3QVTA 3DR3A 2XAAA 4R69A 5T5QA 3ICPA 3JQAB 4M86A 1UXIA 3O9ZA 1NVMB 2OZPA 3DC2A 1MX3A 1PSDA 1YQGA 3PP8A 5LDHA 4OL9A 3MJSA 1R12A 2QHXA 4YT8A 4P4NA 2WWRA 2NADA 5IDQA 4R1NA 4FSHA 3SJ7A 2JHFA 3U4CA 1IYZA 4YB8A 2X86A 5AOVA 3TZ6A 4CV2A 1QYDA 4FFRA 3ZWYA 2YDYA 1GADO 4Y67A 1ZCJA 4YT5A 4BO8A 2EP7A 1KEWA 3OEWA 1GV0A 5A9TA 3FWNA 4I5DA 4CMAA 3INGA 3RIHA 4E2WA 1CDOA 1MG0A 4NJMB 1I01A 1ML3A 3K5PA 5JSFA 4CL8A 4GWGA 4GLOA 5H83A 1DPGA 2X58A 2W2LA 3F9IA 5F1OA 1HDXA 3HE3A 1QYWA 4J1TA 3D0OA 2AQ8A 5AXAA 3I83A 2X22A 5JMPA 1IHXA 4IY1A 2DPHA 2FR1A 5CEJA 3HQ4O 3JQAA 3E1KA 1WAMA 3PEFA 4EUEA 4YJHA 1F14A 4CMEA 4BHTA 4BNGA 1Z74A 4IJUA 1DC3A 3KTDA 3S2IA 4TROA 3DBVO 4MINA 1EVJA 3LF1A 5JPIA 4XQ9A 3RSHA 4YQYA 2W98A 4AJOA 4DBVO 5L95A 1EUDA 3EVNA 3GVXA 3DZBA 3ETDA 3N74A 4EUHA 2GUGA 1Z7BA 5JFOA 4ZU3A 4N18A 1LDMA 2DLDA 1A9YA 1CIVA 2Y93A 3MJEA 1GTMA 4Q3CA 3U09A 3TFQA 1YBAA 3WTBA 1T4DA 5G0WA 4LGVA 1KEUA 4MVJF 2C2XA 4J0EA 5F5LA 1J4AA 5KVVA 5F1KA 2I99A 1EQUA 3H2ZA 2GZ2A 3W4KA 2WEKA 4LSMA 4C4OA 2FMUA 1PJ2A 4F6CA 1E6WA 2YJZA 1HXHA 3GGOA 2PH5A 2Y68A 1BDMA 1R4NB 4Z6KA 5DN9A 3FD8A 2VUUA 1D3AA 3AM3A 5A5EA 4QXMA 1UXGA 3W8DA 2JD1A 3DEYX 1Q0HA 4INAA 3CE6A 2Q50A 3ZDFA 4DREA 4OGWA 3WDSA 4DYDA 1R0LA 1ZEMA 3HUDA 3FNHA 4IIUA 1MUUA 2YHUA 1EMDA 2JD2A 2X7HA 3BA1A 3JYQA 4WASA 5KJEA 3U49A 4PG8A 1KBZA 1MXFA 1RM3A 2GN9A 3GK3A 4GX5A 1NPDA 1DHTA 1UAGA 1PJTA 4IINA 5FI3A 3DMTA 4P4GA 1B7GO 3CMCO 1C1DA 5JC1A 2LDBA 5TLSA 3PJGA 4JX8A 3PYLA 5DDIP 3JD4A 2GDZA 4B4OA 2Y0EA 2X4GA 1SZJG 2XXJA 1QKIA 4UVGA 4WLEA 3UVEA 3WXBA 2CD9A 4YXFA 3U62A 2OBYA 1OI7A 1LRKA 1PL8A 4OXYA 1NAHA 1FDUA 1XHLA 4YYZA 4E5NA 1I3NA 2FSSA 5G2OA 4B4VA 4GBJA 4RPJA 2D2IA 1ZEJA 2POQX 3DHYA 1A71A 4CQMA 3U0BA 5HTOA 3JYOA 2Y99A 1T2AA 4FC7A 3Q2IA 4IZIA 3JQFA 3FNFA 3TZHA 1EDZA 1QLHA 1PQWA 3I5MA 3C24A 2DKNA 1J49A 5JYDA 4EITA 3RUIA 1K2WA 1NFFA 1UZNA 2HSDA 2Y66A 2E6UX 3QWIA 4BO0A 4BNFA 1HDYA 5JAQA 1U5AA 1F0YA 5CPBA 3JQFC 2EGHA 4OH1A 5IDWA 1VJ1A 2IEDA 2WJPA 4RORA 5IZCC 2GERA 3HFGA 3K31A 1ZNQO 5LCXA 2C5AA 3JQBA 4XJSA 5AQ1A 1P31A 2NV6A 3OQ6A 4R1TA 3RUHA 2HMSA 1SMKA 1GEEA 2JFGA 3EAGA 3CMMA 2CF6A 2NU9A 5IJZA 4DLBA 1Y8RB 4EYEA 4I9HA 2HMUA 1C14A 3ZHZA 1VM6A 2D4AA 3C7AA 3RFXA 4EJ0A 3L07A 3C7CB 3JQBC 1ENPA 3PHLA 4WCDA 5JAIA 2PZJA 3ZNOA 1YKFA 3F1KA 3H8VA 3BMCA 1LDNA 2EHDA 4KWIA 5JXWA 5L53A 1LRJA 1WPQA 3PZRA 3DZKA 3ZHXA 4PLCA 2Q1WA 2OUIA 3MCVA 1IZ9A 2X0NA 3C7DB 4JBHA 5IFLA 2Q49A 1B0AA 4E6PA 4RQTA 3Q2KA 3MTJA 3UUWA 4XYMA 3OJEA 1PJSA 4J49A 4MKRA 3FBTA 2YV2A 3QE3A 3B1KA 4CUZA 1JQBA 2HUNA 2CF5A 4ND5A 3H4VA 4YACA 2A94A 1ZKMA 1W6UA 2CDCA 2HQ1A 1I3MA 3ROPA 1ID1A 1I30A 2B4TO 1N9GB 1PWZA 1PU2A 4CLHA 4EI2A 1PL6A 4H7PA 4BKPA 4OKIA 1H2BA 3CINA 4BKOA 2BKAA 3ABIA 5BNFA 3K73O 2ZYGA 1GYRA 2NUAA 2VNSA 1U4OA 2GN6A 4PLYA 1VKNA 4W6ZA 1HZJA 3EVTA 1YQDA 5DZSA 3Q11A 5JLAA 3PTZA 1E92A 3K92A 4B79A 3R6DA 4QTZA 4GVXA 3QJ5A 4RCVA 5GZ6A 3Q0EA 4CM9D 4UVHA 1CEQA 2BGMA 3S55A 1A72A 3VZSA 4BKUA 3JQEA 4WJZA 5L9AA 4RPGA 1HDGO 2BLLA 1PTJA 2G17A 3ZWVA 1ZIDA 4CMJA 4D79A 4L4XA 5HA5A 5JW6A 1KVRA 1CERA 2IRWA 2QYTA 1GAEO 1UR5A 3PLRA 3D5QA 3GZ4A 1J5PA 3QIVA 4WE3A 5AYVA 3HN2A 4GMGA 1RM0A 5CP8A 5BSEA 1U2DA 3DZJA 1DRVA 1NBOA 4RPHA 2QZ9A 3ANMA 4CM8B 2B5VA 3HADA 3CZRA 4RPKA 2O3TA 5DBGA 2AXQA 2G76A 2PGDA 1V3TA 1YH3A 5FF9A 3KBOA 5ADHA 4OXKA 4UVEA 4A26A 3D3WA 1PGPA 3DOCA 1X7HA 2VUTA 4W82A 1YB1A 2BD0A 2GLXA 1PQUA 2YQ5A 2ZB4A 4TRMA 4HY3A 1GUZA 1I3LA 1I3KA 3QV1A 3T4EA 3BXXA 3WQSB 2VWGA 3VTZA 1L7EA 2EW8A 4TMFA 3VZRA 3NGLA 2D0IA 1VL0A 3PVZA 4G5HA 3BHJA 4HFNA 1M66A 2YDXA 4OIMA 4O0LA 4TRNA 2DT5A 2FWMX 4IQ0A 5JAZA 3C1TA 4ID9A 5KOIA 3N7UA 1PZHA 1UDBA 3GAZA 3ZNQA 1E5QA 3EY4A 2OXIA 3KYBA 4L76A 4GX0A 5AXCA 4CM8A 5IZ4A 5K6AA 2JL1A 3GOHA 4J2OA 2BMAA 3GPDG 3B1JA 1R66A 3GNSA 3I4CA 4TKLA 2FPGA 5CEFA 2VOJA 4IDCA 3K30A 3BYZA 3UW3A 4WLNA 1E5LA 1ZK2A 4UEOA 3TJRA 5EJ2A 1HYEA 5TJ9A 4Z0TA 4NR0A 3S2GA 3HDHA 4L4SA 4EJMA 1I2BA 3GDGA 4MVJD 4PZEA 1Z45A 3WGTA 2UAGA 2IE0A 1LU9A 1U3UA 1UP6A 3G17A 1ADFA 3RJ9A 3I1JA 5JY6A 2CY0A 2NU6A 1AXGA 5H81A 3AI1A 5CFZA 2Q1TA 4RL6A 4O6VA 4YRBA 1Z73A 2FOIA 3OMLA 5JO9A 4BVAA 4CM4B 3DXFA 1FDTA 3UICA 5MGBA 1B26A 3PIIA 5DOVA 4AJJA 2CFCA 3DQPA 3E8XA 4KQXA 3GC6A 1K5HA 1V35A 1KS9A 2GZ1A 3IKTA 3PWSA 1E3SA 4DIFA 1BGVA 3D3EA 2WD7A 3JCZA 3UF0A 5A03A 1Q0LA 3ZWCA 3SBOA 1LTHR 5JBIA 1KOLA 1RKXA 1FXSA 1TLTA 3CPSA 3NT4A 2DUWA 2WYWA 4DGSA 1LXCA 1TT5B 4P8RA 4RV9A 1IULA 2QZZA 2VHVA 4L0QA 1U3VA 2O3SA 2BH9A 2VT2A 5EL0A 2QIOA 3COSA 3RBZA 4D46A 1MG5A 3GZNA 3OECA 2QRLA 3OIFA 4GSLA 3MTGA 2D5CA 3JD3A 2EG9A 1IHYA 4ND2A 3DBLB 4M54A 4ZD6A 2ZYAA 3E9MA 5TX7A 2GF2A 4FJ0A 1P3DA 4CM4A 3C1AA 4RVHA 5JCXA 2GPTA 4BNKA 4R01A 2A92A 4UVDA 1KEVA 3O26A 2A9FA 4A7PA 4OOFA 2PGJA 3ENNA 3HJAA 5HS6A 1KETA 2H9IA 5KJ1A 3UHAA 2W8ZA 2J6IA 3OBBA 3G0OA 3KZVA 4CPDA 4NIMA 1GR0A 3SC4A 3U5TA 3W1VA 1JTVA 4CMIA 3GVCA 3SVTA 4RGBA 4W9NA 5TF4A 4IDBA 5EESA 4WEOA 1DJQA 4DLLA 2XPCA 3VPHA 4EZBA 3F3SA 3JQCA 4GI2A 3OF2A 3TL3A 3TL2A 1PZGA 3KHUA 2X9VA 4J90A 4FIZA 5DT9A 3PZBA 4CL3A 3F4LA 3FRJA 2E4AA 2HRBA 3OQ1A 2XF8A 3CIFA 3WBFA 2R00A 1BHSA 1LBEA 4J7CA 1ONPA 2YYYA 1E0DA 4NDNE 1ADBA 1HE4A 2Q3EA 2VHWA 2HK7A 2OFPA 3VH2A 1XYGA 2FN7A 1HDRA 4RF4A 1YXMA 4HWKA 1CQJA 2V6GA 2GO1A 5MDHA 2OO5A 3ZU3A 2NLOA 4XX0A 3KSDO 3BMOA 4TQGA 1XIVA 2H1SA 4DL9A 4E12A 3O03A 1HL3A 3M2PA 4YAJA 4II2A 3RFVA 3RVDA 2PLAA 3HN7A 5JCJD 4RO0A 5BSHA 1H5QA 4CUJA 1JAYA 2YHIA 1PWXA 3SXPA 4DBZA 3DHEA 4LCEA 4S1VA 4RF2A 2RCYA 3OJOA 3H9GA 3WMWA 3WYEA 4R5HA 1QYXA 3RC2A 1ADGA 5F1PA 2E48A 3NAQA 2R6JA 4XQGA 4ZA2A 1JDJA 3FTNA 3TFOA 4BQRA 4YPOA 3LF2A 4NU5A 4HFMA 1JAXA 5TS3A 3DZHA 3WGOA 4BO9A 1HWYA 4MVJM 5KKCA 3WGQA 1U1IA 4HNGA 2E49A 2EKPA 2Z95A 3DO5A 4YAKA 3U3XA 2AEMA 1KEPA 2YW9A 5EQDA 2BELA 3ST7A 3DONA 1DIBA 4PVCA 3BHMA 3ZV3A 3H3JA 1WZEA 3D4NA 3HDJA 3P2OA 5U1PA 4AJ2A 5CG1A 4QEDA 2NTJA 2B83A 1NQAO 2BF7A 2DU8A 1Q1NA 3VHRA 4BNWA 1GQYA 1E77A 2I6TA 3DHNA 3U4DA 5CEEA 1HF3A 3K96A 4AJPA 2GD1O 2X5KO 2J5RA 1U7HA 4GWKA 5DCUA 3OSUA 4ZQGA 3KYCA 4ZVVA 3VH4A 1CWUA 1LC0A 1K3TA 3VVBA 2YFHA 4LRTB 2O2YA 1YB4A 4GVLA 4NBVA 3QWBA 5DP1A 3LYLA 3HB5X 3O8QB 1PL7A 5I9NA 2W4QA 3GMDA 4U0KA 2FZEA 5G4KB 2PH3A 3T7EA 3ZWBA 1C1XB 1R0SA 4Y8VA 1ZBQA 1EE2A 2VYVA 3V2HA 3VPSA 5C7LO 2VRCA 3KOUA 1R4MA 2VHYA 4GKBA 1X15A 2D59A 3E03A 1F8GA 2IXAA 3HG7A 4KUGA 1PEDA 1OC2A 2P2SA 2ZJ1A 3JQ9A 3PGXA 3T4XA 4D0SA 2O3RA 4U8GA 2R2GA 5C3MA 4GPD1 1NR7A 1XDWA 1Y8QB 2JCXA 4F46A 4EDFA 3O4RA 5DOZA 4L73A 4YJGB 1YS4A 1H6CA 2EF1A 1H6BA 4XR4A 3GEGA 4IM7A 3JQ9C 4HFJA 4QT0A 1BRMA 5TQVA 4Q3NA 3I9JA 5JO0A 2OOSA 4TVBA 3VC7A 2RIRA 4UEJA 3O8QA 1GFSA 3AUSA 1M6HA 3TOZA 5G4KA 5IG2A 4E2XA 3VKVA 4B3HA 3F6YA 4NNJA 1LQUA 3A9WA 1LLCA 4ZQFA 1XQ6A 1Z7EA 3RAJA 4DPLA 3GA0A 3WIDA 3MWEB 3NUGA 4ZGWA 4DUPA 1AN9A 1C3VA 4F3YA 5G4LA 4DWVA 4O63O 5L51A 4IJKA 2X8LA 4K1LA 1DC4A 3LC2O 3DB2A 5K0ZA 1N1GA 4K26A 1TEHA 1UXKA 3TNLA 1AGNA 2GZ3A 3HWRA 5BR7A 5A3JA 3E48A 4GQAA 1HTBA 1Y8QA 3PJDA 3NTOA 3RJ5A 4IDFA 3I6QA 4M49A 2DBZA 3X2FA 3AI2A 4J1SA 3LLSA 3AUUA 4PLZA 4YJGA 3ZH2A 3ITKA 3G49A 3H9EO 4XGKA 5ITWA 1PS8A 4YJHB 2Y1GA 3G3EA 1UDCA 3RFTA 1LDBA 3NKLA 2DC1A 1ZO8A 4WNIA 3BAZA 3D4OA 3LU1A 4E30A 2BFMA 5BSGA 3OJLA 2OP1A 3TN7A 4CMHA 3MZ0A 2ZTMA 4H16A 3ZWXA 5JNLA 2EEZA 1VL8A 4K9DA 2O4CA 3TPCA 3DOOA 3M1LA 1I2CA 4GKVA 4TZTA 3SLKA 1QV7A 4Z3KA 5CDTA 1ENOA 4BGUA 4BO1A 4CR8A 1IB6A 3W6UA 1GV1A 4BNTA 1RJWA 5KVCA 1VI2A 3AU9A 3VZPA 1M2WA 3ONFA 3H2SA 1H9AA 1RYEA 4J4TA 5TGDA 1T1RA 4OOEA 4E33A 4E4YA 4Y6RA 3M6IA 3ADOA 2ZIZA 1A7KA 3VDQA 3RASA 3PI7A 3UN1A 3W8FA 4UAGA 5JY1A 4DC0A 4LISA 3WLEA 2HJSA 2PKQO 3QVXA 3NDRA 1KVSA 2Q2WA 5DCYA 4YR9A 4ILKA 3GDOA 3GGPA 1CETA 3WGIA 2Q99A 3F5SA 2C7GA 2P9CA 4OYRA 3HHPA 4ND3A 4ALKA 5KVSA 3ZU5A 3AUAA 3LDHA 4XIYA 1WDMA 5KJ6A 4J4BA 4CMEC 4IS3A 3IMFA 2O3JA 4JXKA 3WWYA 1C1DB 4N54A 4NH4A 4FFMA 3NJ8A 4AJNA 1GCOA 3KSUA 3TDKA 4BGIA 3ANNA 4NBRA 5L7YA 3A1NA 1OZAA 1N2SA 3IP1A 5ER6A 2TMGA 1LSOA 3PQFA 1OFGA 1ZK3A 4BNVA 3S1LA 1R6DA 4LW8A 1H9BA 4RF3A 2X5OA 4H15A 1VC2A 2Y1CA 1A9ZA 3KLPX 5KNLA 3ON5A 1V9LA 4H3VA 2FZWA 2IODA 2WE8A 4CQMB 5H82A 2GRAA 4L8VA 3UCEA 4IGEA 3WBBA 5U4QA 1MB4A 1Q7CA 1O89A 5BT9A 4IDDA 2PKQP 1E6EA 1BVRA 3EZLA 4GH5A 4AJHA 3WQQA 2P4HX 4E5MA 2WE7A 3WYBA 1VPDA 3CTMA 2V65A 3QP9A 5COAA 4WLOA 4ALMA 1HT0A 5A4DA 2ILTA 4WEQA 2PD3A 3GNTA 1P77A 3GGGA 3ZHBA 3KLMX 3ZV5A 1DDOA 1OC4A 2V6BA 4QECA 2ZTVA 2VHXA 8ADHA 3RROA 1ZK1A 1HZZA 2GNAA 3OP4A 2W90A 3QHAA 1KERA 1GEGA 4AJKA 4FN4A 2UVDA 3RU7A 4NHEA 4FQ8A 1NWHA 5I7EA 5B1YA 2D3TA 2Q2QA 3WFIA 3A28A 1O0SA 3GVPA 1YJQA 3NT2A 1HSZA 1KVUA 4FB5A 4J1QA 1EVIA 3DMTC 3OICA 4IIVA 3H7AA 1T2EA 1UZLA 2X23A 3JD0A 3AOGA 4PGFA 3M2TA 5AXBA 1R37A 4BNHA 4UUNA 5K9ZA 3HDQA 2I65A 3MOIA 2AG5A 2AHRA 3KRTA 4Q3BA 3BMCB 1N92A 4E31A 4XIJA 4LSWA 2WDZA 3RUAA 3WX0A 1ZVMA 4E21A 4GMFA 1NWCA 3L4BA 3LK7A 4G81A 1ZJYA 2PV7A 5I7SA 1EFLA 3I9LA 3GH3A 4LMPA 1LLDA 4NBWA 4A0SA 4CUKA 4BO6A 3P7MA 4YWJA 1WLYA 3ROMA 2X9GA 3GDFA 1BW9A 2H5LA 3OQBA 5TC4A 3VVCA 2GR9A 1H94A 2O7QA 1V3VA 2FPPA 5HWSA 1VJ0A 1C0IA 3WNVA 3KV3O 3GQVA 3H9UA 4ZJUA 1SNYA 1S6YA 4WLFA 6ADHA 1B8VA 4BKRA 3I9OA 3QVSA 3BTSA 2I67A 5JAMA 1LJ8A 1IE3A 1ONOA 1YOVA 2X0JA 4LK3A 4BQPA 5AVOA 3L4SO 1I33A 2C29D 4RLHA 1Y7TA 1KC3A 4XDZA 2I9PA 2O2SA 2PZKA 3B6ZA 3ONEA 1G0NA 2D5AA 5J23A 2JAHA 5KKAA 2ZB3A 3RC9A 5L7WA 1A4IA 4IJWA 3RI3A 2B0JA 1RWBA 4U7WA 2B35A 1MA0A 1E3LA 1UXHA 2J3IA 1XWFA 3TZCA 5C37A 4ZHSA 1L7DA 4OAQA 3EHEA 3Q3CA 4HV4A 2PTGA 4R1SA 3ZN2A 5JDCA 4YA6A 4JP2A 3WWZA 1PR9A 1P1HA 1XA0A 1DAOA 2C82A 3Q9NA 1E6UA 4Z9YA 3H5RA 2DBRA 1O9BA 2Z5LA 2FP4A 4UVIA 4E2YA 4TWRA 4A2CA 3PDJA 3LSYA 4CLDA 4L74A 5JMWA 1PJ3A 2HU2A 2WTBA 4PG6A 2AG8A 5DBIA 1CYDA 2DBQA 3GEDA 2FR8A 1B8UA 3CEAA 5L45A 3OH8A 4OJNA 2P68A 3I9MA 1O95A 3EYWA 4XA8A 1MV8A 3D3WB 3EUWA 3ULKA 1E1KA 2HLPA 1D1TA 2VYND 1T1SA 1GZ6A 4FC6A 1X0XA 3DL2A 4M8SA 5EN4A 3WB9A 3QSGA 4CLOB 2WM3A 1TT7A 5B12A 1W0CA 1WZIA 1XCBA 3WG9A 2GGSA 1U4SA 3GF4A 4DIBA 3ZWOA 2ZCUA 1E1NA 1DSSG 1YO6A 1ZMOA 3VH1A 4EUFA 4JJIA 4E5PA 2CNBA 3PGJA 4WECA 5KTKA 1NHGA 2DTDA 4BNJA 2C54A 3ASUA 3WOHA 1MC4A 1IPEA 4Z9FA 5ES3A 2RH4A 4XJTA 5A04A 3BZUA 3KEOA 2NSDA 2AQHA 2FSVA 4A03A 3GUYA 2VHZA 3TZQA 4B8WA 3E82A 4QSMA 3JTMA 5HM8A 5ENVA 5GZ1A 9LDTA 1DAPA 4XYEA 2IYPA 2V6FA 3N58A 4BV9A 3HFSA 1OOEA 4JROA 4GL4A 3PRJA 4Q9NA 3AOEA 5DP2A 3S2EA 1DBVO 1U9JA 2NVBA 2VOEA 4HKTA 4U0JA 1OBFO 4CLOA 3GG2A 2I3AA 4AFNA 4CV1A 1CF2O 4YAGA 2HJRA 1J0XO 1VE9A 3WGGA 3JD2A 1F12A 4BGEA 1UJMA 2B5WA 4ALLA 1QLJA 1PJBA 4QX6A 1HLPA 2P91A 4NBTA 5C7IO 1MLDA 1UXJA 4RJTA 3DAPA 4B7UA 1IPFA 4U6SA 2J3JA 3ONDA 3AOEC 5CG2A 1K0UA 1HKUA 3FSRA 3EGOA 1DRUA 3MJCA 3IUSA 3PFWO 1KY4A 2P9EA 1ORRA 4FFOA 1EEHA 2ET6A 4BKQA 2RHCA 1HRDA 4YBZA 5B4TA 5HRUA 1Z82A 3VOSA 3IJRA 3PK0A 1MC5A 1YRLA 3OEYA 1QR6A 1GD1O 1U5CA 4PLWA 2YV1A 1WXDA 3VKUA 3JYLA 1C0KA 3QLJA 4J2HA 3A06A 1AHIA 1P1IA 3VPFA 2WD7B 3AW9A 3MWDB 3PPIA 4XWYA 4DPMA 1DIGA 4I8XA 5BNTA 4A5OA 1QMGA 4BNUA 5K6AC 3ZHYA 1X1TA 4Z0PA 3C1OA 2NVUA 1BSVA 3AY7A 2EKQA 1CRWG 4PFJA 1ZZEA 1NPTO 3GZNB 3H9JA 4DTIA 3GAFA 7ADHA 3NRCA 2GN4A 4BGVA 3H6KA 4Z3DA 1ARZA 4GGOA 5DNAA 2W2LD 1B14A 4IDGA 2PKRA 3ADPA 3JSAA 3OJFA 1C0PA 3AK4A 4CLEA 1HSOA 2UDPA 4XZ3A 3JQAD 4KP7A 3FWZA 3WGHA 3I4FA 1KIFA 1O6ZA 2JCVA 4JNKA 5ITVA 1DFHA 1NQ5A 4AJIA 5JC8A 5L7TA 1SEVA 4XGIA 1SO8A 2F1KA 2DTEA 4IDAA 1I0ZA 1SOVA 3TQHA 4XRGA 1A4UA 3L6EA 2RBEA 1P45A 3GHHA 3QRWA 4MIOA 4TVOA 5CDSA 2XXBA 1T26A 3PWZA 1ZFNA 3NX4A 5B4UA 3W4JA 3UGKA 4CMIB 5C7OO 4DQXA 1HDOA 3QY9A 4IDEA 4BMSA 1UH5A 4AVYA 1HE2A 4I9NA 3PWKA 1A5ZA 4FOOA 3I9NA 3RUCA 2Y1FA 1E7WA 4RVGA 1LDEA 2JD0A 3DDNA 1SAYA 4UUPA 4NZ9A 5EPOA 5I8WA 4ITUA 2C5EA 1EZ4A 3IJPA 2EWMA 3FR8A 4LVCA 2CZCA 3ZV4A 4DC1A 3BMQB 3KEQA 4MJLA 4IZHA 4WCFB 4XRRA 2EV9A 3U4IA 3FBGA 4BUCA 1NFQA 3F5QA 4EEZA 4ALJA 4EGFA 2Q46A 2VZ0A 3AI3A 5CPFA 1Y1PA 2X9NA 3E6AA 1GUYA 3R3SA 4M87A 2UV8A 3BMOB 4JN6B 3R3JA 3RWBA 2E37A 3EMKA 4KWHA 3DBHB 5HS4A 1HYGA 4BO3A 2W2KA 1QYCA 2WSBA 3L6DA 4L9RA 2ZATA 3FN4A 4I5GA 4R41A 2YHIB 1ZW1A 2V7PA 4I9UA 1YJ8A 3ZWMA 3FPCA 1ZSYA 2RHRA 5EMHA 4C7JA 4TRRA 3GFBA 5KJCA 1QSGA 5IF3A 3F4BA 2E82A 3VH3A 2ZK7A 3VDRA 1JU9A 2O3QA 1B8PA 2QYSA 4D42A 2YQ4A 3GG9A 4FCCA 8LDHA 3ZV6A 3MJVA 4CV3A 1ZXBA 1E3EA 3TF5A 1P1JA 4W9NC 3ROKA 4EW6A 1G0OA 2QX7A 4DVJA 3QW2A 3H5NA 4CQMD 1NM5A 1LDGA 2BFAA 3BMQA 4WUVA 3MEQA 4WCFA 1GQ2A 2Y0DA 1TI7A 3FHLA 1ISGA 4QO7A 1NP3A 4DYVA 2BGKA 1M6WA 4FD3A 4MVJE 1LI4A 2R00C 4BB5A 1NVGA 3UH1A 3ZW9A 4UREA 4B3IA 5DULA 3D7LA 3DBHA 1JVSA 3RD5A 5IXSA 1ULSA 3KYCB 4OSOA 5FI5A 4BO7A 2CDAA 1K6XA 5A05A 4HNHA 4PRLA 4BS9A 1H6AA 1NQOA 3NTQA 1YONA 5I9LA 4DQUA 4D43A 5LC1A 1DC6A 1H0KA 4AJ4A 2I5PO 4PLHA 4OMUA 1JVBA 1XQ1A 4WLVA 1N7GA 3AJRA 4FPXA 4J1NA 4BIIA 2IYOA 4JJFA 4ND4A 4IQGA 1S7CA 4MO2A 3IDSA 5EIOA 3GFGA 1CJCA 1ZSVA 1P1KA 3R1IA 5A5FA 2ZJ0A 3GRKA 1R4MB 4D44A 1JWBB 2Y1OA 5DCWA 1BXZA 4GX2A 3GRPA 5BQFA 1HEUA 1O94A 4OO3A 3V1YA 5JYEA 4KDFA 4YAEA 1MGOA 1M76A 1E1LA 1UP7A 1YL7A 4JP3A 1XEAA 3MOGA 4CLRA 3UCXA 1E7SA 1LRLA 1NYTA 4R51A 1PJLA 3RC7A 4LCJA 3BTOA 4MP6A 3MJ4A 1LUAA 3IAHA 3CUKA 3B20A 4BNYA 2EGGA 5GZ3A 1EE9A 3C85A 4EEXA 4PLTA 4CM6A 1WMBA 3R0IA 3RU9A 3LT0A 5ICMA 1BXGA 5T67A 2BFOA 1X14A 1F8FA 3V5NA 4XYBA 2AEJA 4RVDA 3V1UA 1JKJA 1NVTA 1WWKA 4DA9A 4Q3DA 1TA4A 1ZSNA 4BO4A 3QWAA 2A4KA 3CSDA 1E7MA 5EQFA 4LRSB 1Y5RA 1ZK0A 3HB4X 1GPDG 1LQTA 9LDBA 1DC5A 1EUZA 3JQ8B 4ESOA 4CR7A 3E18A 3L9XA 1NAIA 3GR6A 2VNAA 4JCOA 3HNPA 1ENZA 2DM6A 4XD2A 4BO2A 1BMDA 3PHIA 2WYUA 3C8MA 5T64A 4D3SA 1N8KA 1U8XX 3V2GA 1B15A 4A10A 2VQ3A 3I3OA 1HDZA 4IPTA 4CM9A 1X0VA 4GSKA 2AEFA 1KVTA 1QG6A 4NI5A 5B37A 4JBGA 3W4IA 4B8ZA 3WGZA 3Q9UA 2ZTUA 1LEHA 1LDYA 5THQA 1QORA 4BL5A 3KSZO 2BI7A 2Z1MA 4FR5A 4M89A 4WPGA 3NDJA 5KVQA 4YDRA 1K6IA 2BFPA 3OA2A 1DLJA 1ZK4A 3IIEA 2VTEA 5L40A 1F06A 1EDOA 3A14A 1V8BA 2Y1EA 2BI8A 2OBNA 3BTVA 3LC7O 3PYMA 2ZYDA 4J7XA 4K28A 4BNMA 3INRA 2B4QA 1V3UA 2I3GA 5DF1A 2CVZA 4J9UE 3JQ8A 1E7QA 1AE1A 1P1RA 5GMOA 1IY8A 2PR2A 1VRWA 3GPIA 1DIHA 4UEKA 1E3WB 5IN5A 3UAGA 2RH8A 4XQEA 5T8KA 4ZQBA 3KUXA 3LLVA 5THKA 3F47A 2ZKLA 3B70A 4O1MA 2AW5A 4D3DA 1GPJA 1SBYA 2PA3A 4XCVA 4E32A 4ZICA 4PIVA 1PGJA 4OXNA 5LDGA 2QQ5A 3F1LA 2OP0A 1TXGA 4J7UA 3OA0A 2VZ9A 2UUPA 4J43A 3P5SA 1XG5A 2X1HA 3S8MA 1C0LA 4DXHA 5JS6A 3P19A 3UCFA 1JWAB 2EP5A 5U9CA 3LZ6A 1DB3A 2AA3A 1I24A 4KUHA 4GLLA 2PK3A 1WDLA 4R4JA 3L9WA 4BB6A 4RLSA 4BOYA 3HZZA 4I5EA 2AE2A 4CLXA 5GY7A 2VT3A 2AE1A 3QVOA 2NWQA 4E5YA 1TVEA 2EKLA 3G79A 3RUFA 5BNIA 4D0RA 2VWQA 1U2GA 3C3XA 3LVFO 1E3WA 3WLFA 5AXDA 1NX6A 3W8EA 4Y98A 5B4VA 3E9NA 4RZHA 1QP8A 4BNXA 3AY3A 2JAPA 2YFQA 3LT4A 2EW2A 4IQ8A 4OKNA 3ZI0A 2C2YA 3VTFA 4NU6A 4MVJA 3OIGA 3ZWAA 5G0SA 2G82A 2CUKA 2HCTA 2UYYA 4PLFA 4FGWA 3KM0A 4RDHA 2G5CA 1DHRA 1UP4A 4NMHA 4QFDA 1I36A 3SC6A 1B3RA 4PLGA 5I7FA 2O48X 4IXWA 3ENKA 3K9QO 4JJGA 2QW8A 4D41A 3ZWNA 5IAAA 1EK6A 4B4UA 1YDEA 1PJ4A 4GAEA 2J8ZA 4YJDA 3I23A 3PQEA 2EXXA 2G0TA 2Q4BA 4HP8A 5TT1A 4E2ZA 2HO5A 1T25A 1Q7GA 4J16A 4NK4A 2V6MA 1XELA 3ASVA 1GDHA 1BTOA 3A4VA 4TZKA 2OGUA 1DLIA 4YEDA 1YWGO 3ZCXA 3GLQA 2ZTLA 2F00A 4WOJA 3OFSA 1H6DA 3IUPA 3KYDB 2VTDA 4E13A 1Q2XA 4Q3EA 1NPYA 4XDYA 4YRAA 5KCZA 4GX1A 2J3HA 3P2YA 1LSSA 4NJMA 2Y0CA 1P74A 1LNQA 4TSKA 1XU9A 4IS2A 1ISFA 1FDSA 2NU7A 3JYNA 3PYXA 1SEPA 3ZZNA 3I9KA 4YT2A 1D8AA 3EZYA 4RQUA 2HRZA 3WJAA 4ALIA 1RM5A 4BNLA 2HKIA 2VZ8A 4DMLA 3VZQA 4D45A 1R0KA 4P38A 4FDAA 3PHHA 1JKIA 4NBUA 3H9QA 4YTEA 1Y81A 1BW9B 4IJVA 2C7VA 4J6FA 4YVFA 1IUKA 2TMDA 5BSFA 1E7RA 1U8FO 2XOXA 3V2UA 1U3WA 3SLGA 3KB6A 3JV7A 3L6OO 1PGQA 1GZ4A 1Y5MA 1VKOA 4NG5A 4OHUA 1DOHA 4KTTE 5ENDA 3GN1A 5CHEA 3KYDA 5L3ZA 1GU7A 3PXXA 1NTOA 2P9GA 1YOVB 4IUYA 4MDHA 3AM5A 2NTVA 4B7CA 4L4RA 5A06A 2PY6A 3JYPA 4PLVA 4A73A 2CVOA 4AJLA 2WYVA 4JLWA 4W7HA 4CM1A 5G0TA 1H2HA 1UAYA 2P5UA 3NYWA 1F17A 3H3FA 4GGPA 4EJ6A 4YAIA 1XSEA 2P4QA 1Y9EA 2JHGA 4DMMA 1P0CA 4TKMA 3E5MA 1O8CA 4O5OA 4RDIA 1NASA 4PZDA 1R4NA 2Q1UA 2C0CA 4UUMA 4B3JA 1K89A 4KZPA 4N5LA 3WFJA 1XGKA 2H6EA 4QFCA 5G0UA 2ZB7A 1QYVA 2DAPA 3L4BC 3RBXA 4O59O 5IZCA 3EW7A 3PHGA 1EBUA 1NHWA 2RAFA 1NR1A 1DFIA 4FBGA 3UXYA 2DVMA 4Y6PA 3GN2A 3WSWA 2NQTA 3PFFA 3STHA 5ILOA 5COBA 3AU8A 4PN3A 1GYPA 2DQ4A 3DZIA 5JCJA 5A02A 4MP8A 1ZH8A 3UFXA 2GN8A 1E7YA 3GUCA 1X7DA 1ADCA 4G2NA 3TZKA 4NFSA 4A27A 3ETEA 3G1TA 4MKZA 2CDBA 1EUCA 3W6ZA 3G1UA 4KOAA 1GUFA 5CDYA 1NFRA 1VSUA 1DEHA 2DPGA 4LN1A 1JKFA 1Z6ZA 4R3WA 3AFMA 4KMSA 2VCYA 4QO8A 1MFZA 2OHXA 2PWZA 2GYYA 2HK9A 5IXYA 1T2DA 3IL2A 4OQZA 5A9RA 4DRYA 4II3A 3DAGA 4U6QA 1KVQA 4R68A 5L4SA 5COQA 4J0FA 1GCUA 4DLAA 3PIDA 2DFDA 4I1IA 2O7SA 5T57A 4MP3A 1VSVA 4XR9A 4I08A 4NJOA 4WK6A 2EERA 3GMSA 3WIEA 3WNQA 2DBVO 1EK5A 3QA9A 3U4HA 1W73A 4I5FA 4URFA 3ZW8A 4NPCA 3KVOA 1P0FA 3MJTA 4HXYA 4B4WA 1DRWA 2G1UA 2FRDA 4FJ1A 1DJNA 2B69A 2X6TA 1YL6A 5JDCC 2HMTA 1RPNA 3DWFA 1UDAA 2DUUA 1MXHA 3H5AA 1L1FA 3TOXA 1N1EA 1BG6A 1EQ2A 4CM3A 1WVGA 2D1YA 2ZQZA 2Z1NA 4MVJH 4N5MA 3UOGA 4XQCA 4FJ2A 4QQRA 1A27A 5TJHA 1SPXA 1YQXA 1Y8RA 5ER9A 4Q39A 1DXYA 1KYQA 2VYVD 2BRUA 4RVSA 3M1AA 1K6JA 4S3MA 4LVUA 2VRCD 3PDUA 3ZWPA 4AG3A 1B3BA 4PG4A 4L75A 4RZIA 1IOLA 1W8DA 4BV8A 1ONNA 2YY7A 2CMDA 4BNIA 4PLPA 3NTRA 1AHHA 5FFFA 4BNNA 2IZ0A 3KO8A 4HADA 3BHIA 3FPLA 3GVHA 2IEBA 5I8ZA 2PGLA 1FDVA 2QRJA 4XGNA 1T4BA 1YBVA 1OMOA 4R9RA 4XKJA 2B4RO 1GY8A 1GL3A 2X5JO 3AFNA 4BMVA 4WOKA 5C5IA 1N5DA 2EIHA 2HK8A 4U5QA 3GHYA 4J9VA 3OM9A 3TRIA 3Q1LA 3WS7A 3V1TC 5TRTA 1AXEA 1EVYA 3FTPA 4PG7A 3GT0A 4UULA 3ZGYA 1ULUA 1N9GA 4FW8A 3DTTA 1H93A 1T2CA 4IMPA 4K6CA 3SX2A 1NQTA 2CSUA 2LDXA 2NVUB 2VWPA 1HE3A 2O50A 3H65A 3O38A 3IS3A 1GQQA 3ZU4A 5A9SB 4BNZA 4QUKA 3VAZA 1ZUD1 3JQDA 1LSJA 4JK3A 4X54A 2O3UA 4CMGA 3IOYA 4MVJI 2IZ1A 2BGLA 2PZMA 4FGSA 5KWEA 1SB9A 5CAEA 2PD6A 1G1AA 4E5KA 3WTCA 1P1FA 4FS3A 4CJXA 2YUTA 3ANLA 3I6IA 3L77A 4PZCA 1X7GA 3EDMA 2JKVA 3AY6A 3IP3A 1VL6A 3K8ZA 1G6KA 3JD1A 2O23A 1J6UA 1D4FA 1EFKA 2YZ7A 4R16A 2VUSA 1BXKA 3ETGA 2J3KA 1QV6A 1NNUA 5JE8A 4Y6SA 4AJ1A 1YB5A 4CQLB 4IBOA 1PGOA 2P5YA 5FWNA 1XLTA 4KTVE 5TT0A 4N5NA 2X0RA 4CM5A 2IZZA 5A9SA 4W99A 3B1FA 4R1UA 5G0VA 1P44A 3CH6A 4JGBA 3RBVA 3K2BA 2WD8A 3K2EA 1X1EA 1N7HA 4JQCA 1UUFA 3BMNB 3ROQA 2HMWA 1FJHA 2JFFA 3E5RA 1R16A 3PLNA 1CQIA 1P33A 2B37A 3K6JA 3NV9A 4RF5A 4XYGA 4ROSA 4BO5A 2BHLA 4CR6A 5T6BA 2EJVA 1U3TA 1NXQA 1WMAA 1FF9A 1VJTA 3D64A 2PFGA 1PIWA 4ZQHA 3BTUA 5TIIA 3JQ7B 1WP4A 3DFUA 1YBMA 4HUJA 1QRRA 3PJFA 1ISHA 3DAFA 3EK2A 4Y9DA 2PD4A 2AQIA 4D7AA 1I8TA 1FDWA 3FI9A 2J5QA 3JQGB 5FYDA 4PRKA 4PCVA 4CQLA 2W2KB 2X0IA 1KC1A 5EERA 2Y05A 5CDUA 4ND1A 2AMFA 1VLLA 4XB1A 2O4UX 3DMYA 1MP0A 2SCUA 2JJYA 2A35A 3BMNA 4IMRA 1I2ZA 3FR7A 3NEPX 3RC1A 1HYHA 2NNLD 4G65A 4J4HA 3HDYA 1MFPA 2AQKA 5CDGA 2OL4A 4NQZA 3JQ6A 3LQFA 3TWOA 3OHSX 2JFHA 3D5TA 1PGNA 3RKUA 4XEHA 2IDZA 2VWHA 1I32A 1V0JA 3JQ7A 4YJFB 4CMKA 4FFLA 1YVEI 1A7AA 4P4LA 1EVZA 3ICCA 5I9MA 1U7TA 5A3VA 1SB8A 2FY8A 1M75A 2OORA 1QXSA 1U28A 1XR3A 1Z75A 4CM7A 4J91A 5KJFA 3TSCA 1DFGA 3JQGA 1HETA 2NU8A 4FOSA 1PS9A 2ZQYA 3RUDA 4EBFA 3E9QA 3ORFA 5IDYA 5F5NA 4IGFA 1ISJA 4J3FA 2J5KA 5F3RA 4B7XA 1IL0A 3AUTA 3D4PA 3QQPA 2Y1DA 3KXDA 2GSDA 1PR3A 4TRJA 1Q7BA 1JLLA 4BMNA 2NM0A 3NDIA 1ZXLA 4MKXA 5DBFA 3D1LA 5L4NA 2HAEA 4K6FA 3INTA 1XKQA 4OSPA 4Z0HO 3WMXA 4HX5A 1T2FA 4XYLA 5ICSA 1TT5A 2WMDA 4NK5A 5I7VA 2NVWA 1WNTA 3T7CA 1DO8A 1JA9A 4MIYA 1E3JA 4YJFA 3DTYA 4CMBA 1GYQA 1BVUA 4WNCA 4CODB 4FFPA 3QVWA 1HLDA 7MDHA 4PG5A 3VPXA 2D8AA 4OQYA 4CLRB 3DBLA 3NGXA 3QWFA 3RCBA 3ZWWA 4ONEA 3AM4A 3PJEA 3EC7A 1YE3A 4WCFC 3GVIA 3GEMA 3FNEA 4E3ZA 1B2LA 2JCYA 1BXGB 3DZFA 3S2FA 3FCOA 4DQVA 1M67A 4OM8A 4NFYA 4YT4A 1PZFA 2Q2VA 3SEFA 3CXRA 3OETA 1Y9AA 3WJ7A 2C07A 4PVDA 4XB2A 3WYCA 3IQDB 1D1SA 1GZ3A 3I52A 4R3NA 2NQ8A 1LX6A 1PZEA 2YV3A 4F45A 1R15A 3WSVA 4IXTA 4W4TA 1SOWA 5EINA 2GASA 1SCUA 3V8BA 1BWSA 3DFZA 2FPIA 4RPLA 2NACA 4WKGA 1EBFA 1UZMA 4ZN6A 4R9SA 2OMEA 3GY0A 3LT1A 3Q6IA 2QRKA 2PZLA 5L4LA 3ZNNA 3WICA 4YQZA 4DPKA 1BDBA 4AJEA 4F6LA 3NJ4A 1E3IA 4RVUA 5KIAA 1DIRA 4YCAA 2VN8A 2C20A 3U9LA 4MIEA 1SC6A 1I5RA 4MVJP 3LT2A 4MPDA 3SJUA 2IXBA 2Y67A 6LDHA 5A1TA 4ZQEA 3DBRB 4LMRA 3PQDA 2NTNA 2Q45A 4MVJG 3RKRA 1PX0A 1V6AA 2I76A 3AWDA 4KUEA 2ZCVA 3VPGA 4NFHA 1JN0A
chains in the Genus database with same CATH superfamily
1LC3A 5G3ZA 4LYYA 3I0NA 5CITA 1SWWA 1C1YA 2QOEA 4US0R 1ODSA 2XAUA 4HBGA 2BUAA 4XPIA 5BSMA 4UM8B 3VU1A 1M5TA 4PZ0A 1EWRA 3FF4A 3E4CA 3L1UA 4H7EA 1JT2A 1Z8HA 4C0HA 2H1CA 1X1QA 2VJOA 3QWHA 3LUPA 4BFVA 4CGYA 3UV6A 3TTVA 1Z4KA 4QYIB 4RZ2A 2VT7A 1O95D 3N70A 1ENYA 4OL0A 2ENUA 3TCKA 4MKFA 4E0BA 3RHZA 1I1OA 2ZZMA 1OFTA 1ZNZA 3UKOA 4AL4A 2H31A 4DLZA 2O8NA 1FK8A 1H8ED 1W4ZA 2YWDA 1FDOA 3KTAA 3OCVA 4QDTA 5FPQA 2AYZA 3OTIA 5C34B 1KH2A 1HDCA 3RK0A 2ZPUA 2GEDA 3DZGA 4AICA 1MENA 4R2HA 2AMJA 4G8BA 4M55A 1IZ0A 4EHKA 3W5HA 4HDKB 1G38A 1CS4C 4CKWB 2XYQA 1YGYA 1WA5A 1OXVA 1GU1A 3CRVA 2IDMA 1VHQA 1YK0A 1K6EA 1OXUA 4BCCA 1R6TA 4KQWA 4XUGB 1NYRA 4W7IA 4Q01A 1QJCA 1FTNA 1AMOA 2QJOA 3OIDA 5CX4A 5BW5A 1PYOA 2CXXA 1Y7IA 2Q1SA 4ESEA 2C9DA 3NT5A 4JB3A 4JBIA 4ZZ1A 2H1WA 4FFNA 1AUPA 4FUTA 2OCPA 2P41A 2BTOA 2GCGA 1KKLA 2N1MA 3ZU2A 2CLDX 3RAGA 4GI5A 3RSZA 1TF5A 3O31A 4PGAA 4WBNA 1TTHA 1W5EA 1E59A 2R86A 3JTEA 1YDWA 1QC5A 3QPUA 4OXXA 3V8QA 1OAAA 2V6IA 3SBXA 3W5CA 3MCZA 2QGFA 3DMHA 4GPZA 1Z6TA 1XFDA 4JVSB 1LSUA 3UJHA 3KETA 1Q21A 2FSGA 1F9EA 4RH0A 4GYWA 3VHQA 4EB6B 1ZOSA 1XU7A 1YIOA 5JJCA 1KAQA 2HDHA 5TV2A 1OYYA 1UMCB 3WB0A 4RJJA 3NBUA 2X5XA 1GCAA 2H7CA 3KZXA 1K7YA 2CJXA 4HBZA 1DKOA 1WW8A 1ZCZA 1QG0A 1UFKA 2J0UA 1P2UA 2FFHA 4M9CA 1ZR2A 1TUGA 3G82C 1FW8A 2C59A 3T5DA 2ZBPA 3F46A 3RVKA 4AP6A 1TC1A 2V55B 4LX0A 4B35A 1PK9A 4N7RA 4D26A 1QFMA 3DR3A 2O05A 2XAAA 4R69A 5KSOA 5T5QA 4D8YA 3VHXA 3EG9A 1TA9A 5I9TA 1YDGA 1KYXA 5BO5A 1UXIA 1FP2A 1P9WA 3UATA 1F20A 4QPJC 5AHRA 3PGA1 4BYMA 3NVMB 5KU7A 2C7QA 1MX3A 1PSDA 4LZWA 5LDHA 4N8DA 1NLMA 4OL9A 3Q41A 3WB2A 3VOBA 4YT8A 4C3OB 3LKBA 2C00A 3DEJA 1G2IA 2H0QA 2NADA 2WWRA 3UKJA 3GFRA 3HYLA 1JDSA 1EDBA 3TQCA 1GNQA 3UK1A 1S4MA 1KL7A 1JA0A 2FJ0A 4GPBA 1CY8A 2SECE 4CV2A 1GADO 4L9AA 5BWCA 3KS9A 1ZCJA 4BO8A 1WE2A 3ELDA 3MB5A 2QPLA 3FDFA 2JIDA 1DC8A 2F3PA 1N6PA 4JV5B 4GQIA 3WKCA 2PX0A 1CDOA 3AEKB 5FPYA 5EE9A 5CJ2A 1KAHA 2H1HA 3F7MA 3KQKA 5JSZA 1ZD9A 4OJQA 2CJFA 4FZRA 1RLIA 1ZOOA 2WJIA 2PL9A 4CT5A 1E1DA 1UBHS 3U3DA 3CR8A 5CT5A 4C0SA 2WT9A 4LDJA 4TUYF 5K8VA 4DB4A 4F38A 3T3OA 4I9GA 1Z5ZA 1NRJB 3O91A 5FFMA 3DE2X 1GQRA 1HDXA 1EJ6A 4J1TA 4UQOA 3D0OA 3OCXA 4UTZA 4V38A 5F1OA 3LGSA 4ISCA 4WFJA 5BVGB 1AMNA 1FW6A 2BYTA 3TLMA 2DPHA 3E1KA 2F7SA 1PG5A 1XZBA 3PCXA 4Q16A 5BN1A 1N2CB 4OHRA 2B34A 1F14A 2OOKA 3DE0X 3RV4A 4ZJZA 1II8B 3Q9SA 4D56A 2R4UA 4P4SA 3VO2A 4ENPA 5LOVB 1Z74A 3I58A 3K1JA 4KB5A 4V0LA 2JI6A 4IGAA 3A6DA 3LF1A 4B87A 2AZTA 3LNTA 2BEWA 4Q9AA 1QX4A 3RSHA 3TLZA 5BW8A 2W98A 4KL8S 3RRBA 4QE3A 3KYJB 2ZP1A 1CUEA 4FW9A 3R4CA 4IDXA 5GJCA 3KSMA 1N34B 2F3TA 2DLDA 1CIVA 3T35A 1GA1A 1NOIA 2Y93A 3QE2A 4EPWA 3GJQA 3E8SA 5IVDA 4HWGA 5AVXA 4CIWA 3OOJA 4CCYB 4M0MA 5KU1A 3HCEA 4YP5A 3MYYA 5CB0A 2YHSA 3AH8A 1OKKD 1NW5A 3HRKA 2C2XA 4G1FA 3REOA 2GM3A 2QVXX 4B76A 1CIJA 3RU2A 4B84A 1DG3A 4ZP1A 3ZI7A 2I99A 1GRNA 1EQUA 3NHZA 3H2ZA 5YASA 3GJRA 2GZ2A 3AQ4A 2WUFA 1QCZA 2O1EA 2WEKA 4LSMA 3MSCA 4C4OA 4P4TA 3CSSA 1US8B 5HQJA 3DT9A 1HXHA 5JAPA 2IC5A 3GROA 2Y68A 1SKYB 1R4NB 2ZBEA 5DN9A 4PGHA 3DV2A 4JI1B 2VDMB 5DEIA 3M6LA 4BQEA 5HM6A 1SU7A 2RMKA 1QHFA 1UXGA 1W2GA 2WYIA 3BFXA 4FCTA 4DDMA 2QGNA 3UB2A 1YZVA 2GX6A 4INAA 3RADC 2QAGB 2AK3A 2NZJA 3EUAA 5I4IA 3FNHA 2J0QA 1QM5A 2JD2A 3U49A 3G89A 3W9UA 3CJTA 5JZBA 4NMXB 2OENG 3DVRX 3CLTD 3I09A 4Z4CA 2BFCB 2QWXA 3CZ5A 4NAUA 1UEIA 1NPDA 2C5SA 1E2BA 1PJTA 4IINA 3ZR4B 5MN5A 4CKXA 3DMTA 3BB4A 5EUMA 3AVUA 2OD2A 3R7FA 1MRZA 3NVKI 2RAUA 1EWKA 1C1DA 4C4PA 5LU9A 4TM8A 3MAJA 4E70A 3JD4A 2GDZA 4MPPA 5TQJA 3BJRA 4H7KA 1RYMA 2Y0EA 4P81A 4B4OA 1CUHA 1Z5WA 2XXJA 3B89A 5CVTA 4DMHA 2VK4A 2HLNA 3U62A 2QTGA 4MKHA 1OI7A 1LRKA 4HF7A 4OXYA 5BN4A 4B1FA 1KF0A 2X7XA 4IDNA 4Q1DA 2F1HA 5L6LB 3EZFA 2G4LA 1I3NA 1RD4A 3AILA 4B4VA 4YV1A 4RPJA 4F3TA 2QXYA 3DL0A 3S2SA 3K70B 1ZUNB 3MWJA 5BP7A 5K3AA 3RJZA 4AMUA 1G64A 2XGGA 3AR2A 1FZTA 5EHXA 3C24A 1R0YA 2DKNA 4C3ZA 1RJGA 4C88A 5BYKA 1DRKA 2AHOA 2JGRA 4NE9A 4RNCA 3KL4A 2Q7DA 1UFOA 3A1WA 1HQYE 4U9IS 5F33A 2Q0QA 2BISA 1XF9A 3HM9A 5JAQA 1QR2A 4KBGA 4RTMA 3D8BA 4D9IA 1JDBB 3JQFC 4OH1A 2IEDA 3EARA 4AZ3B 1GKYA 2WJPA 2W6MA 2GERA 4TMTA 4JUBA 5FWYB 4EY5A 4R1TA 2IUUA 2R85A 3PEVA 2HMSA 2JFGA 1GEEA 1WXWA 5CH8A 3SM3A 4BBZA 5KSYA 5AW6A 2BM0A 4DV7B 4PNEA 2FE1A 3BFPA 4M0FA 5EMLA 2EZ9A 2NU9A 2ZT6A 3BZWA 1Y8RB 4DWOA 4IDUA 4EFDA 1C9KA 4TV8A 3NLLA 4OIFA 4NCBA 3FLEA 3HZOA 2V7XA 3C7AA 4D8XA 1XROA 2QP9X 1ENPA 2ATEA 2CHEA 2PZJA 4URYR 1E66A 1NP6A 3H8VA 3N0WA 1B41A 1IEVA 1LDNA 5ERGB 3HBMA 5DBEX 3PDCA 4P6VF 2OUIA 2I1LA 4EF4A 5EFOA 3C7DB 1UJ6A 3FVQA 4RK0A 5IFLA 3UPUA 4JFRA 1XD8A 4DEVA 2O5EA 3UAXA 1QGUB 1H5UA 3UUWA 3K9CA 1PO7A 3OJEA 3DOFA 3KKNA 4B2LA 3SHVA 3RSFA 1JYSA 3I42A 1R4AA 4JHXA 4UXHA 2AJ8A 3QE3A 1R9MA 4C0WA 3HXMA 4BFUA 2BR4A 1QIKA 3J7AC 3ZEIA 1L8LA 2GBCA 5AVVA 2HUNA 3TE7A 4GGMX 2UZ3A 4YACA 5JR3A 2HQ1A 1ZKMA 1W6UA 2B1RA 4BDTA 1Z0FA 1YS6A 2HYIC 1E2DA 2ATIA 1DQZA 1ID1A 2QVGA 3KEMA 1Q57A 1KHHA 2J0EA 2QMHA 4ZVSA 4MR7A 4CLHA 2ZTSA 3BIWA 4BUJA 4EI2A 1Y3FE 3IDQA 3K0CA 3L7NA 1RWXA 5D6NA 3VR4D 2QMYA 3AONB 3U13A 3UC5A 1K4KA 1LFDB 4BKPA 4HB3A 3UJ8A 2P3QA 4BKOA 4YUXA 1Z0ZA 2BKAA 5GPBA 1NLYA 3ABIA 3GEHA 5BNFA 4CG2A 1ZC3A 2OLKA 2Z2IA 3K73O 1JX6A 1JYEA 2H9AA 2NUAA 3D0QA 2W2VA 4HMOA 4D2IA 1IRIA 2VNSA 3AB8A 4DR2B 4YMHA 3WIOA 2D0DA 5DZSA 5GP1A 3M6UA 4BVGA 5AKIA 1P5FA 1V2GA 3AKYA 3PTZA 1MEEA 1G7RA 3HKEB 4X1OA 2VXCA 4MJXA 4GVXA 3TTXA 4ZOLB 3I8SA 5AHKA 3R7BA 2GETA 1JU3A 2NUPA 2QNBA 4CM9D 1JFRA 5CCXA 1Q14A 1CEQA 2BGMA 1PLKA 5FHQA 3VZSA 2I34A 3PNMA 2BLLA 3VTAA 1PTJA 1ZC4A 2BIFA 3EQ8A 4WKPA 4QLBA 5FJJA 3D2LA 1SWVA 2V97A 1XQVA 3VFDA 5KNDD 1E2LA 4CIDA 2ZRHA 5HA5A 4M9XA 2Q8QA 4RKWA 2QYTA 3MT7A 2IRWA 5JW6A 1GAEO 4BIMA 4C4SA 1T9HA 4EDHA 3D5QA 5AJYA 3ZDXB 4AECA 1XMJA 1EVEA 1AXRA 1M6YA 1W4AA 4DIMA 1PT7A 1IVYA 2VYFA 5CYPA 4CFYA 1Q22A 1U2DA 3RHTA 2MSEB 2QDKA 4LY6A 2PUBA 1GWNA 4S0ZA 3OKFA 1M9NA 1JZTA 1VKJA 1MV5A 2O3TA 3HXTA 4EG5A 4YECA 1IBMB 2AXQA 1RE1A 2G76A 2PGDA 3WRWA 1U6JA 5FF9A 1OA0A 1YUMA 2AOVA 4OXKA 4UVEA 4U7PB 1PGPA 2BP7B 2EKBA 2GNPA 1X7HA 1P80A 3M4JA 4UCFA 5EZQA 5I51A 4W82A 1YB1A 2BD0A 4O02B 1PQUA 1E98A 2YQ5A 2ZB4A 4JB2A 1RXSA 1ZHOA 3EVCA 1GUZA 3JX9A 3LFHA 3QU9A 2JIRA 2PUAA 1R8JA 1G20E 3T0GA 3WQSB 4PF1A 2EW8A 4Q1CA 4TMFA 1GSHA 4TWZA 1GPH1 3NGLA 4AS2A 1K5PA 5D5PA 2OT3B 5BRNA 2C1ZA 5LA6A 3THWB 3RDPA 5BQ5A 2Q4TA 3GH1A 3QNMA 1GQSA 3FTQA 3T3HA 4D6YA 1CUXA 2RHOA 1YQTA 3NPMA 4LA4A 4TXHA 2UZ4A 3G2KA 4HTAA 5DI9A 4YRIA 1N77A 5KOYA 5SZKB 2HBQA 1ORVA 5JAZA 1PZHA 1JPUA 1XZIA 2AN3A 2NG1A 1CRLA 2QR2A 3C5EA 5MN4A 4JP1A 2OXIA 4KGZA 2CL7X 1YE8A 3BKXA 3EZ7A 4EL5A 1HA3A 4ZVKA 4WFKA 5E6UB 4KPFC 4AWAA 5K6AA 1PTKA 4YRNA 2FQ1A 2X5NA 1HOTA 4ZCPA 4NS4A 5IYZB 5BN5A 5IS2A 3SVLA 3GNSA 1UJ4A 4G5OA 1Q17A 3RR2A 1SBCA 2FPGA 2PTHA 4JLSA 5CEFA 1GLGA 2H9YA 4OK5A 4D9KA 2YXBA 1XZFA 2XV1A 3BYZA 3EOBI 2D7CA 2WJ4A 4M1OA 4WLNA 1ZK2A 1Q1QA 1HYEA 2YY5A 2MCFA 1OY1A 4NCIA 4JI8B 1N0IA 3GEBA 1U9IC 2GPNA 1JDTA 2F3RA 3IDZA 3Q40A 4L4SA 3GDGA 4ES6A 4PZEA 4L8YA 1FA9A 4OG2A 2RGEA 3WGTA 4RTPA 3D8HA 3FCYA 1U3UA 1KRHA 4CDGA 3AUYA 1JQ3A 2EU8A 1VRCA 2UUCB 4MXDA 3TI7A 3OO1A 2XKJE 3IJ5A 2F3UA 2X9QA 5JY6A 2CY0A 5H81A 1AXGA 4BYGA 2NMVA 3JZFA 3R6TA 3C3BA 4DV5B 1XA3A 2Q1TA 3TDMA 2YZMA 1MB2A 4L9WA 3GRZA 4CZ2A 3CVVA 3BEOA 5JO9A 1QVWA 3ZUGA 2Z5VA 1SCNE 1WY7A 2BFFA 2CNNA 2XZPA 4NBKA 4CM4B 2JIZA 2R1VA 4WH0A 1QRAA 2L17A 4JT2A 4AJJA 1CXZA 2DPXA 4ZK6A 3DQPA 5ECWA 1QHHB 3KD2A 3TQQA 5F98A 1J9EA 2QK4A 3FY4A 3G8CA 2IXDA 4MUEA 2UUAB 3D6FA 3OT1B 4GDFA 4HLUA 4WNAA 5AK3A 4B34A 4N76A 1NMXA 3LECA 2H7XA 4QASA 4DIFA 3OF3A 1BGVA 4B81A 1C9YA 4LQDA 1USWA 1XMXA 1PVVA 1ECBA 3AR9A 3EAFA 3B3JA 2WTEA 3EC2A 4RM3A 3KV1A 4WW0A 2EX4A 3TRJA 4YROA 1YZKA 3QPDA 2P35A 3U3KA 4G0YA 3PUXA 3OM8A 5T3UA 2PUHA 1TLTA 2CLLB 3G2MA 3G2LA 2RHDA 2DUWA 1G6Q1 3PVSA 1M2FA 4ND7A 4EWLA 1XPOA 4UM7A 1CB0A 1TT5B 2I6QA 4P8RA 1IULA 1THZA 2VHVA 2YIVX 2AUTA 2O3SA 2QUBA 5EL0A 3FX2A 2QIOA 5HQ3A 2OEPA 3B52X 3HCNA 4I55B 2POCA 2XCIA 4R0NA 2QRLA 2PDAA 1XCOA 2HNAA 4BCDA 1UJNA 1Y89A 2D5CA 3TEMA 4CF7A 1SK9A 1UM9B 5K99A 5DNVA 3BGVA 4DNPA 1YT5A 2FQWA 1K97A 3DBLB 2JFOA 3E8MA 3E9MA 1NQWA 3F71A 3OZEA 4K9KA 2Q1YA 1R9GA 4M54A 5LBTA 1WKBA 4MX8A 1CEXA 4LOKA 1Z6QA 2G80A 3JALB 3BE6A 4GXRA 4LJAA 4CNBA 3ND7A 2LP4Y 3A9VA 5JCXA 4GZ5A 2GPTA 4LYFA 2ACVA 1W0JD 2A92A 1LNSA 5CXSA 4BNKA 1J97A 2LIPA 4KQ2A 5DIZA 3THSA 1AZWA 4W1QA 5L8VA 5ESXA 2A9FA 4OOFA 5A5VA 1JMVA 1NBIA 2JARA 2XNJA 3W5SA 3RVMA 2OORC 1IN7A 1TA0A 3FROA 4WKBA 4F1KA 1GGHA 1ZIXA 4K9MA 1U0GA 3CNBA 1YR2A 4RGQA 5DHTA 4F8YA 3SJAA 5IM5A 3GLGE 1EJ2A 2VJQA 1JKMA 2RBKA 3IO5A 3K6RA 4FZ3A 3EVAA 2IWRA 4B80A 4FEYA 3SVTA 2I4MA 4ZYZA 1RMYA 5LBIA 3QLVC 4F2DA 1DU4A 5ICFA 4BZQA 1TLLA 3FKSD 4WEOA 2J9FB 2J1LA 4YHHB 4WA8A 3VYVA 3A26A 1SKMA 2XPCA 3GJ6A 3AXTA 1UQTA 1OJLA 1KPIA 2R11A 3JQCA 3KHKA 3RTGA 1YC5A 1PFVA 1W9HA 3OF2A 4ZTBA 1C9MA 2P4EA 2O07A 2VP5A 3KKQA 4KN5A 3LV8A 4M6WB 3KHUA 2CBXA 1YJXA 4EM6A 4K9NA 3FMFA 3FRJA 4EFKA 4CYMA 1CNMA 1DKNA 2EEPA 3ZOZA 1ECJA 4J0KA 5KAMA 3OZGA 4PQEA 4W1RA 1E0DA 4NDNE 1HE4A 1ZS9A 4FYYA 1KSJA 1U3FA 2BGRA 4TS1A 5FLXA 1XYGA 1G5HA 1LY1A 2BZ0A 2FN7A 2I1VB 1HDRA 2EQBA 3LQ4A 4QUDA 4RF4A 2FPRA 3VU9B 3WL5A 1GRVA 2E6KA 1SIUA 2V6GA 4FYJA 3C5HA 1WQ3A 4EGCB 5MDHA 4P7GA 2OO5A 1C7RA 1CY2A 1JQKA 2QZPA 1W4RA 2YMMA 3Q8WA 3CUSA 3OPYI 1QH8A 1NULA 1HL3A 3RFVA 3RVDA 1UBSB 3LW8A 3HN7A 5DYGA 4IOJA 4XVHA 1U0HC 2VSNA 4RO0A 3T7TA 1JAYA 2JGEA 1T8PA 1PWXA 2DKFA 5LXTF 4S1VA 5C8XA 1G20A 4LDQA 5DMXA 3WYEA 5K8LA 1U1GA 1ADGA 3PX3A 5F1PA 4DLRA 1C2TA 1EPUA 3GQBA 3PB3A 5BT8A 4XQGA 3FTNA 3TFOA 3EMDA 3TTYA 1YFKA 4BQRA 2NP7A 3UT5A 3IURA 2IGTA 3NUQA 2E4ZA 1JAXA 4ZVMA 4BO9A 4QTXA 1KEEA 4YP9A 1FUUA 4DSAA 1IBRA 1IOZA 2EKPA 3PT5A 4WFQA 1X8XA 1GNTA 5EQDA 5IF3A 2BELA 5MGBA 1DIBA 2UYHA 3BHMA 3L1JA 2PO7A 5DXFA 3IBFA 2VK8A 4D4GA 1RIFA 4QEDA 5CFLA 3MRXA 1M34B 4MVCA 1JG4A 1NQAO 1W581 2IEAA 4IG9A 2ZT7A 4KIUA 3W3AD 5DNCA 2QMQA 3LQQA 2I6TA 1YRQA 3U4DA 4BQQA 4EA6A 1G8AA 4RK7A 4DLPA 3K96A 3A0RB 3CT4A 2GD1O 1GT6A 5FORA 3PEUA 4B09A 1T2NA 5K3EA 1CWUA 2NQ2C 2F64A 4HQ0A 4I50B 1KPGA 3S29A 4A1FA 1JTEA 1YC2A 4Y2RA 1G55A 3REFA 1M6VA 3HY6A 3VKWA 5CD9A 5BRAA 2O2YA 1YB4A 2Q5OA 2SKEA 2ZRFA 4GVLA 5E7QA 2RHJA 3AHIA 5B3AA 3G5AA 3E35A 3MXTA 5HGJA 4EO9A 3LYLA 4KRGA 3QFRA 1RHRA 2EJTA 1IATA 1UT6A 4UBMA 2J7PA 2FZEA 2N3ZA 4M1YA 1QF6A 2XTAA 1C1XB 2GM9A 5M3BA 2G8NA 5EGSA 4YV0A 1Q16A 2NAPA 2I8AA 3EFEA 4OMCA 3EQZA 3SEAA 3VPSA 1J21A 5C7LO 1XHEA 4JWTA 4Y0AA 4F84A 1A5BB 4YJ3F 2GPYA 4MGHA 3KTFA 1PEAA 5IFKA 1X15A 3W1EA 4V0KA 4HDOB 3E03A 5E7JA 3FYSA 3ZCPA 4TYWA 1PEDA 3SIWA 3JQ9A 3TXXA 4JJEA 1W6RA 4D0SA 3D54D 3TTTA 5LQRA 3RANA 5BYJA 4JLPA 1NF8A 2K7ZA 4U8GA 2R2GA 1GFZA 2BKEA 2B99A 1S01A 3VX4A 4MCIA 1XDWA 2Y0BA 3AC0A 3AI7A 2WIJA 3DQZA 4K7JA 4RKRA 3SSAA 2LRHA 4F46A 3O4RA 4OLHA 2IHUA 1RQNA 2JZCA 4EGAA 1Y3CE 1N4DA 3BFJA 4JI3B 3TF5A 4DR5B 1ZDMA 3NWPA 3L40A 4DLTA 2Y71A 4XR4A 2WFLB 3GEGA 3WLIA 3ZKAA 4DOMA 3AEUA 3ITEA 4DG9A 1E8NA 3WDMA 1JHZA 4KEAA 4TLCA 3U1VA 2OOSA 1U0FA 2AN5A 3V6LA 3IV9A 1NZJA 4R2LA 2WVGA 1PR6A 3IIMA 4N0MA 4UM9B 5JAOA 3KNZA 4ZANA 2RIRA 4UEJA 1SN7A 1NW9B 2IIQA 3O8QA 1GFSA 4AW9A 4LE1A 4ABTA 2HBRA 3TSWA 1QZ3A 1WPRA 4Z9AA 4E2XA 5IG2A 4L16A 3F6YA 2Q3JA 4MW9A 3E3MA 3HB1A 2VPZA 2AXEA 3N8DA 2P3SA 3RAJA 4DPLA 3RRYA 3WIDA 2XCLA 3LBNA 2D0OB 4OMFG 3LC0A 4JP8A 3EXFA 1C3VA 3MBOA 5G4LA 1DQRA 1K98A 1PR1A 1SBNE 1KTVA 4O63O 3WGUA 4EVSA 5AO9A 4Z49A 1KMHA 1CZKA 2O2DA 4CG1A 3DFMA 1LB1B 2XR1A 4GM4A 4MQ4A 5HUQA 1DC4A 2PQ0A 1WVIA 2G72A 2PXHA 3LC2O 5IH3A 1N1GA 1JPJA 2OBBA 3RVRA 3U4AA 1QZTA 4DCTA 4ETWA 1AGNA 1XALA 3BS4A 3E48A 3QMVA 1JP7A 5IKEA 2DHEA 1NI5A 2ZWPA 1Y7PA 3E0XA 3ZI4A 3TSYA 1EWTA 3QPWA 1JQAA 2C3UA 3AUUA 3EF0A 3ITNA 4PLZA 1RKUA 2H2AA 4DA4A 4GI3A 3G49A 5JFTA 5KYTA 5CW2A 1PS8A 1MPTA 3HVUA 1UDCA 2UZAA 3BORA 1T3GA 3FZNA 3W5IA 3NKLA 3WL7A 4OX9Y 2DC1A 1Z4QA 5B7NA 3GLGA 1VCIA 4JP5A 4LBZA 5LP6A 1CUBA 2G40A 4E30A 1ACMA 2BFMA 1ZJ5A 3GMIA 4H1VA 3OJLA 4W6QA 4X20B 5AJHA 3MZ0A 2AJLI 3MJRA 4H16A 4Y2XA 3KOWA 5JNLA 2EEZA 2Y2UA 4X97A 2HRDA 2O4CA 3DOOA 1KQPA 3CBQA 2OGSA 2WW8A 3VPAA 1OH7A 2WZQA 5KYNA 3ZIAA 3SLKA 4P3NA 2C4KA 2HTFA 4WX2B 4FFSA 1U8UA 2WF7A 5K7SA 3UMCA 2BKUA 4FKMA 1M1NB 4RAOA 4YRCA 2VFAA 3D59A 3KAPA 1DXHA 3DCJA 4W9RA 3W6UA 4EY3A 2F3SA 1GV1A 3EQ6A 5PNTA 4JFAA 5KVCA 3JQRA 1UC9A 2OXCA 3AU9A 3VZPA 4XI9A 1SCDA 1DKLA 2B4KA 1OLUA 5IZCC 5DM70 3ZH9B 1T1RA 3GT7A 4OOEA 2VK1A 4IJ5A 3EPJA 4TSFA 4I19A 3PEEA 2FSPA 1Z15A 2GHRA 3CGGA 2GB4A 3FYUB 4UAGA 1J8MF 2H51A 2P62A 2JJ8A 2W58A 1V4NA 2HN9A 2RHHA 3QVXA 4KJXA 2G4VA 4YR9A 3KAKA 3IOMA 1XCJA 2C2OA 1JLKA 3GDOA 1J70A 1QFZA 3ODGA 2Q99A 3F5SA 2C7GA 4OYRA 1N2EA 4BNDA 2ZDHA 2YMQA 4ND3A 1XRPA 4MRPA 4ZO6A 3ZU5A 3AHFA 5BVHB 1U2RA 4MKIA 4FDLA 4Y3UA 1L8AA 3LDHA 4NE7A 1M1ZA 5BMVA 4FM9A 4ZO9A 1FFBA 2VBIA 4QSHA 1XXHE 2E18A 4J4BA 1MO5A 1Q77A 1V25A 3M1YA 3QUQA 3O9MA 4Y18A 3IMFA 1OZGA 2EFGA 2FPKA 2J9YB 4ZV7A 3NONA 1WV0A 3HJGA 4FYMA 3WWYA 4LYHA 3TAXA 4N54A 4NH4A 1HQKA 3ML1A 4PAMA 4FFMA 4Z54A 2SBTA 4EJSA 3NJ8A 4AJNA 1KJWA 2QRNA 3TDKA 1Z2CA 3ANNA 4DV4B 1HTTA 3ACDA 3A1NA 4MUGA 1IY1A 4EUNA 2LR0A 4KNVA 4AY3A 4ZCMA 4KV7A 1KJ8A 3DEAA 4RF3A 5CCBA 3IAXA 2Y1CA 1A9ZA 2XT0A 1KP9A 1R74A 3LQ2A 4IIJA 4OFBA 1V9LA 3GMTA 1G7CA 1TF7A 5KNLA 2K2QB 4RTNA 3SXUA 1PJZA 4G5XA 4JBYA 4M98A 5H82A 3EXHA 2A59A 1Y98A 4IGEA 1B43A 1JHUA 4QARA 4O2LA 4WERA 1Q7CA 1YQUA 5HCIA 3VNRA 1O89A 5BT9A 3FETA 5FL3A 2PKQP 1E6EA 1BVRA 1YA8A 3FGPA 2PZBA 4QDXA 4A6DA 2P4HX 4PIMA 4NMLA 3TXAA 2ZR8A 1H65A 1L4GA 3DHVA 4MV4A 1LJLA 4PYIA 4ALMA 4ZTZB 1H2WA 2X41A 4E22A 3T4UA 4OU5A 3GNTA 1XK6A 2R7KA 3K1ZA 2HF2A 4QECA 2ZTVA 2F9FA 1T1GA 3RROA 1P5JA 3IULA 4GLFA 3X1JA 1CBUA 3BULA 4MW0A 2W90A 4MS3B 3MT9A 4FN4A 3GLFE 3T7KA 3W77A 4ZI7B 4WADA 5K0SA 1YI0A 3IPAA 4Q03A 5DSZA 1G8GA 4C07A 5I7EA 3I6MA 3TZLA 3FLAA 1L1EA 2CJWB 4QQKA 2P11A 4PZAA 1XNGA 1YJQA 1SBQA 3L06A 4H27A 1V16B 2ZULA 4F4DA 4LBYA 4IIVA 6GPBA 1T2EA 5HIKA 5K51A 1NSYA 2FLWA 1QRTA 2E1PA 4PGFA 5AXBA 4ZYUA 4C29A 1X7ZB 4C5BA 1N8SA 1YAJA 1UBLS 2ZIGA 1E2QA 4QBFA 2IIPA 2BCJQ 2I65A 1FYDA 1PV2A 3RODA 2O1WA 4DWWA 2AG5A 1AKTA 4Q3BA 5FBLB 3BMCB 2PUEA 3RRNA 3TD2A 1ZISA 4AZVA 4Q24A 3ZVKA 1I1NA 1Z3CA 4NX2A 1ZVMA 3T9CA 4E21A 4EI7A 1IUPA 2IPNA 3RJTA 2XADA 4G81A 1YBFA 2GO7A 1EFLA 4WESB 5ALFA 4MS1B 4HXFB 3IAEA 3I9LA 3NRBA 4GLBA 1K7CA 3AB3A 4WZZA 2ZI5A 3P9PA 4A0SA 2PXXA 4XFDA 2EL9A 2NYAA 2W5UA 3MIZA 4P83A 4PTLA 4YWJA 1RADA 1WLYA 2BFWA 2CBZA 4ZC1A 3MERA 1KR5A 1OXSC 3LHKA 4JZYA 4ZAGA 5TC4A 4BVJA 2WIGA 2GXAA 2J09A 3OPYB 5AJUA 1V8DA 3B3QA 5HWSA 4NXNB 2QRVB 3GQVA 1TUEA 3F5DA 3H9UA 5TMDA 2VJDA 1P2VA 4WLFA 1VQ1A 5LLDA 3QVSA 2D5BA 4CN8A 4UTVA 2E5FA 2I67A 4B48A 5LYJA 4EMUA 5JAMA 1LJ8A 1P75A 2MWMA 5JJBA 3G13A 4MEJA 1KTIA 2FN8A 2X0JA 3ABRB 4AZWA 2VKTA 4HZGA 4OBWA 4RIIA 3RE1A 3R76A 2GT1A 3ZE9A 3L4SO 2YBDA 1I33A 2C29D 4CW7A 1FFYA 1X9IA 1Y7TA 2LKCA 2NSLA 3ER8A 4AF7A 2IUFA 3BERA 5M29A 3T34A 4KDRA 3QEOA 3CUUA 2J45A 3A37A 3KKOA 4H7FA 4DN6A 5J23A 1NMSA 2JVIA 1CE8A 1LBTA 2B8NA 2PKEA 3L8GA 4X8MA 3RI3A 2BGJA 2VF7A 4PX3A 3N6RA 2C7RA 1YIAA 4U7WA 1MA0A 3DMFA 3QUSA 3K70C 5DV9A 1UXHA 1CZNA 5HJ2A 1GQOA 4F5DA 1L7DA 4FD2A 3EHEA 2HJ9A 1EJ0A 4HV4A 2PTGA 1Y5LA 3AP3A 1CIPA 2GOYA 5ULLA 1DADA 2ZIXB 1RTKA 5IKOA 3V7NA 5EXSA 3WJ2A 4CHGA 1XDBA 2E4WA 4D9NA 4BBAA 3KT0A 1UWCA 4KPUB 5C8YA 3HUTA 2QN7A 1XA0A 4RTRA 1RJ9A 3BD6A 2R751 5G3YA 2ZWMA 4B3DA 5L3QB 1U02A 3GRVA 8ABPA 1CJMA 4ILEA 1IQUA 4JI4B 1VL1A 4G0PA 2O1SA 4AMBA 4CHTA 1LS6A 1G4UR 1OJ7A 4AM8A 5BN3A 2IS2A 4OBBA 4A2CA 1R0CA 3PDJA 4CLDA 5EWLB 3N2NA 3ROEA 4L74A 2J9RA 2W2QA 2WTBA 1YASA 3ZW7A 4JEMA 2IK8A 4LI3X 4HAYA 4LJ9A 4OQPA 3WYAA 4DIUA 3QKRB 5T4EA 2G67A 1B8UA 4RFVA 1KRWA 3OH8A 2HV8A 6REQB 3FTCA 4ZAYA 3D3WB 5ITSA 1E1KA 3K71B 4Y2VA 1KNQA 2VYND 5F77A 1LTKA 1X0XA 1MOSA 4O29A 3PL5A 5EWJB 3I8OA 2V7EA 3I45A 4U7FA 1NXPA 5B12A 1PUJA 2C4WA 1XCLA 2WU1A 4OA8A 1TL7C 4N6GA 2C4UA 3ESRA 4FGZA 3A6JA 4DIBA 3GLIE 3M1IA 3ZWOA 1E1NA 1T0HB 1ZMOA 1RS0A 1XXHA 3H87A 3ORHA 4P0PB 4RS4A 4B74A 3WWPA 3WMGA 1APBA 4LY9A 1NHGA 2PQMA 2OCKA 3G59A 4WXRA 2D6FA 2GDJA 1Q15A 3MBIA 3IT0A 5DTQA 3WOHA 4D4IA 7REQA 4BECA 2WJ3A 1RLTA 2GFQA 3MQ2A 2NPIA 3KEOA 1EWYA 1IN1A 1DJOA 2ZITA 3E61A 1QFYA 5JD5A 2J3EA 3VJKA 5FI1B 3WZLA 2AZMA 1CTQA 2YRXA 3GUYA 4MAAA 5EY5B 3TZQA 3MCAA 2YNMA 5JNUA 1E58A 5ENVA 2V9CA 2NAFA 3TW0A 1R6BX 4FHDA 5FV7A 3LPNA 4Q1EA 1DAPA 3TYXA 1U11A 3FUXA 4H7JA 4MQFA 2AF3C 2ZSJA 1EFHA 2XT9A 3AF6A 1MO3A 2PX6A 3PGKA 2GD0A 1OFHA 3BBPA 3FUWA 3OLQA 5G41A 1P29A 3A1TA 5JQWA 5KQLA 1GJRA 4TTVA 3TKAA 3AOEA 3LY5A 1U9JA 4HKTA 3TG8A 1OBFO 2IOYA 3GG2A 4G8CA 2REQA 2VPIA 3VR3D 1IZ7A 2XVYA 2FKNA 2HJRA 4NF2A 2HXGA 4BGEA 1DQPA 1F12A 4F1JA 1JHXA 4AN0A 1WETA 4ALLA 1QIFA 4IV0A 2EZUA 3ZCUA 4ERNA 1CY4A 5AVUA 4FWBA 1FDIA 3AF1A 1UT5A 1RLUA 4GECA 4RJTA 1Z5VA 3DAPA 1M8JA 3W7VA 1G60A 1TCUA 4U6SA 2MINA 2GBFA 4ZEVA 1CFZA 2C4VA 3EGOA 1WU8A 1RVDA 3IUSA 3PFWO 2P9EA 4FFOA 3QVGB 4LQLA 4RZUA 4DADA 3V33A 2RHCA 1HRDA 1FTSA 1G8MA 1MIOA 2R60A 4BKQA 3URKA 4NDZA 4RJIA 2JZOA 1KFBB 2X4DA 3JWEA 1GDTA 1DJPA 5FEMA 2SHKA 2Z8YA 1QUEA 4F12A 1MC5A 1WV1A 1YRLA 2GMWA 4FE4A 3U7FB 1C4OA 4LHZA 5KNCH 2B2XA 1GD1O 1ISPA 4G4JA 4PLWA 2YV1A 4YALA 4DJFC 4CKEB 2F59A 4QGSA 2VHEA 2WYOA 1C0KA 4C05A 4QOHA 3QLJA 1L7NA 1X80A 4HDAA 5C8DA 1BCRB 2FWJA 4KQIA 4IVPA 2WD7B 2D7DA 4E09A 4L95C 4L5AA 3G9TA 4L6IA 4LJ4A 4DPMA 2LIVA 3M3HA 4TS9A 1CR4A 2B5OA 5K09A 4I8XA 5B1IA 1QMGA 3UMMA 2QNRA 3KJHA 2DUNA 4LJRA 4KACA 3VX3A 1BSVA 4HAVA 2EKQA 1R0RE 1CRWG 1MNQA 1O5TA 4MPRA 4PFJA 1Z4IA 1NPTO 4EW2A 2DERA 1Z2AA 2C42A 1NW8A 3GZNB 2WNSA 2WZBA 4I36A 3B8EA 5KNBA 3AR4A 2OM2A 4UNQA 3AF3A 3D6JA 4R6WA 4ZT4A 4JQOA 2OCYC 3AF5A 3I4LA 4HMPA 4P9NA 1O0CA 2O8FB 2JC3A 4JYPA 4CF6A 4LOHA 2DFKB 4IIDA 1KSFX 3G0BA 1C0PA 2VF5X 4KLRA 4Y1FA 3RS0A 2FDXA 4BJ5A 2UDPA 4CLEA 1XTQA 1IHPA 1T9BA 5JBNA 4D82A 3CVOA 4BMPB 2H11A 3JQAD 4MV8A 2PSSA 3HO8A 2NN3C 2C2GA 1O6ZA 1FE8A 4INPA 4B71A 5AVZA 3JVEA 3QF4A 4JNKA 3GEPA 1BZYA 2GBPA 1LW7A 1NQ5A 2OCLA 4G1UC 4NSNA 3UXHA 1W1UA 5JC8A 5KX5B 1IWBB 1XNHA 2WVJA 1NF9A 1I0ZA 4IFBA 2WF8A 4DV3B 3ZL9A 1A4UA 1DG9A 2DY0A 2R6AA 3H19A 3BICA 5ALHA 3SPXA 3EWAA 2XXBA 2XVAA 4JR1A 4S1NA 4BAGA 2IX3A 1VGRA 4TKVA 3INNA 3P96A 4D0GA 4LFAB 4HJXA 5B4UA 5A7GA 5C7OO 4R7GA 1ZJ4A 3UGKA 1TZBA 2KBFA 3W4JA 4OLBA 4MR8B 4KHZA 4UNSA 4CG3A 2PX5A 3FXAA 3GT3A 4N0DA 1KFJB 4QUGA 4X94A 3CLRD 3Q10A 3RV3A 4AVYA 1E79A 2G28A 4NAVA 1YI1A 3LX6A 4URUR 4F4HA 5ALJA 1PT5A 1UFVA 3LTNC 3EXIB 3NVDA 2GPAA 3GFTA 1A76A 1N5MA 4FOOA 2APJA 1Z62A 2JH9A 4LXXA 4HTFB 2XRZA 2CW5A 1NP7A 1VJGA 1V7ZA 2GK4A 4QXAA 4RVGA 1FP4A 5EE0A 3DDNA 2O5RA 4Q9KA 3BWBA 1AC5A 3L6RA 4UNRA 2RAVA 3I76A 1L4NA 1EZ4A 4KAXA 4O4HB 3LUJA 4GM1A 4I4TA 4JLAA 3ZJYA 1QYRA 1L3IA 4ZAXA 1R0WA 1P7YA 1I4WA 4RYDA 5KHAA 1NVXQ 3O94A 3ZCRA 1NMZA 3Q5GA 5DWQA 4KQCA 5AI6A 3UMVA 2X8JA 3C98A 1BKSB 2OLJA 1SJ9A 3F3KA 1GSAA 3BH6A 1NUQA 1DUSA 4MJLA 5FBWB 4ZHQB 1EG7A 2Y9PB 4RSHA 3RHFA 3GP5A 5FKJA 3ZLTA 1CQJB 4EEZA 5TY0A 2IYFA 1SVIA 3AI3A 1OE0A 4U2FA 1Y1PA 2X9NA 5LWQA 3DYIA 4KWHA 3ED1A 4O4IA 2Z9DA 5FOXA 1JWLA 1YTUA 2ISCA 1HYGA 4DY6A 4GZMA 2W2KA 2WSBA 4IP0A 4KFSA 4L9RA 1D4OA 2Y1KA 1WL8A 1SOMA 2YHIB 4OA5A 3RVNA 5JZVA 3AO0B 3CLSC 1LWNA 2IVFA 1HL7A 1NUHA 2OV4A 2RDMA 1AURA 2BFNA 3O83A 4MV6A 4QL3A 3SSOA 3F9CA 3GLIA 1TECE 1QSGA 2QN3A 3F4BA 3TUJC 3LUCA 4WZBB 2ZK7A 2WUDA 2O3QA 2YQ4A 2DBYA 4CV3A 3WO1A 3PGMA 2OPHA 1P0IA 1PNOA 1G0OA 2QX7A 2C97A 1EM8B 4JU9A