3I5MA

Structure of the apo form of leucoanthocyanidin reductase from vitis vinifera
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
307
structure length
302
Chain Sequence
b'GRVLIAGATGFIGQFVATASLDAHRPTYILARPGPRSPSKAKIFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative leucoanthocyanidin reductase 1
molecule tags Oxidoreductase
source organism Vitis vinifera
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
total genus 105
structure length 302
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i5mA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i5mA02
3DBVO 2G1UA 5IN5A 4PLVA 5KJ1A 3RBXA 4CV2A 4BKRA 4BV9A 3QVOA 5CDGA 3PJDA 1FK8A 2ZJ0A 3A06A 5A9TA 3K8ZA 1EBFA 4FGWA 1YDEA 1V9LA 5IZ4A 5BT9A 1AN9A 1QXSA 1GR0A 2FZWA 2C2XA 3BMNB 4L0QA 3GFBA 2P4HX 3T7CA 4W7IA 2HO5A 4K1LA 2DPGA 1Y6JA 3H7AA 3ZHXA 4YYZA 1GYPA 2HJRA 2NVWA 4GMFA 2EEZA 3CZMA 1MXFA 1ADFA 1FDVA 2UUOA 1IPFA 3NTRA 3NDIA 1RWBA 1F8FA 3ZU3A 4CMCA 1OOEA 1SNYA 4FC6A 1YS4A 2YFQA 2DFVA 2PR2A 2AE2A 2IXAA 1G6KA 2PTGA 2X22A 4KOAA 5C7IO 4D0SA 4MKRA 4F45A 1PJCA 1CEQA 4MVJM 5B37A 4AJLA 1ENPA 1S7CA 4XQCA 2DVMA 3F47A 5I7VA 3INTA 2EJVA 1E6EA 3CPSA 4XQ9A 1C14A 3RFVA 1KS9A 1BXGB 1Y8QA 4RCVA 1B8UA 2JFHA 1PJQA 3L6EA 3ZW8A 3QVXA 5KKCA 2EXXA 3RC7A 4ZQFA 1ZVMA 4CLOB 2E37A 2P9CA 3PI7A 5AXBA 4RPHA 1M75A 1MC5A 5IDQA 5JMPA 2NQTA 1B7GO 3D3EA 3CINA 4QO7A 2C20A 1FDTA 2BD0A 2O2SA 1TXGA 1B2LA 5T8KA 2C07A 3TZ6A 2R00A 2UV8A 3DZBA 5T57A 1UDBA 2FMUA 5TGDA 2X58A 5JLAA 5HWSA 4KTTE 3PJEA 3AI2A 1A5ZA 1ISGA 4E4YA 3C24A 4YEDA 3LK7A 1YGYA 2VWGA 3DBHB 4AJHA 3FRJA 1H2HA 2NU6A 3PDUA 2P9EA 1EEHA 2YUTA 3TFQA 2RHCA 1HT0A 4ZVVA 3ROPA 3DBLA 2O48X 3WWYA 2HLPA 4FOSA 2C29D 3V1UA 2R00C 2H5LA 1WNTA 1C0IA 1DLIA 2BFPA 5DF1A 4IY1A 8LDHA 2Y05A 2Q1SA 4IDFA 4MVJP 2UUPA 3TZQA 1ZEMA 4Q9NA 4BNHA 4EI2A 4OSOA 5JO0A 4I5EA 4CLRB 1LTHR 2I5PO 3FNGA 2X8LA 4E5KA 1HTBA 3OICA 3W6UA 1GZ6A 4IGFA 4JXKA 3P5SA 1LSJA 2EW2A 4YRBA 3PYXA 3MCVA 1P9LA 3VVBA 3ZHZA 1J0XO 4F3YA 1HYGA 4OAQA 4HUJA 5DOZA 1I30A 4OH1A 1XIVA 3C3XA 4NU6A 3HB5X 1JVBA 1MXHA 3C7AA 3EC7A 4DL9A 4LMPA 2BELA 3EUWA 2NUAA 5I8ZA 1P1JA 3E82A 1ZFNA 4FFOA 4BIIA 2X5JO 1I3NA 2C7GA 5KTKA 1ARZA 2B4RO 4B3HA 3R0IA 4DLBA 1JKIA 2BH9A 2X23A 1C0LA 1QMGA 4N5LA 1VC2A 2RHRA 2GZ2A 1WPQA 2P2SA 1TB4A 1ZK3A 2NNLD 3PWZA 3UOGA 1G0OA 1K0UA 1T25A 5EMHA 7ADHA 2FY8A 1K2WA 4K26A 3RUEA 4MVJA 4ZICA 5C7OO 1LRLA 2GSDA 3GAZA 1M67A 4M8SA 3NX4A 1U1IA 4WKGA 3ROKA 4A27A 2JHGA 4GI2A 4GWGA 1SC6A 2D2IA 2VYVD 1ZH8A 4WNCA 2Q2VA 1SEPA 5AXAA 1DC6A 4OL9A 4BB6A 2H9IA 3FBGA 3PQFA 2X7HA 4DIFA 1CQIA 4D79A 1U7TA 3KEQA 5TRTA 3E9QA 4CODB 1I0ZA 5IDWA 1SPXA 1E1LA 4WPGA 1O8CA 2G76A 5DN9A 2H63A 4U0KA 4UVEA 3BMCA 3ITKA 5TIIA 3DC2A 3IMFA 3UXYA 4RQTA 3BHIA 3JQGB 4HKTA 4YAKA 4TRRA 2YHUA 3UUWA 3ZGYA 2X5OA 3ASUA 3DXFA 3HADA 1AXGA 1ZUD1 4DC0A 1NWCA 4TSKA 1J6UA 3BTUA 2YHIB 4ZQBA 5A04A 5KKAA 1IB6A 1Q7CA 3ETDA 4UEOA 1EFLA 4XGIA 2POQX 3W6ZA 1TLTA 2PD3A 3E5MA 4J2HA 4J7UA 4PRKA 4J1TA 4GKVA 2OORA 3CZRA 2PD4A 4XEHA 1XKQA 1Z75A 2GF2A 1Q0HA 5LDGA 3JV7A 4NJMA 5IN4A 3VDQA 2ZQZA 4ND1A 3ZNQA 3UF0A 4AJ4A 5F5LA 1WZEA 3BMQA 3KRTA 3V5NA 4J1SA 1N5DA 3SXPA 3BMOB 4RORA 4PLFA 4UUNA 4YA6A 4XRGA 4NMHA 4BQPA 1UXGA 1ONNA 1R0SA 4MO2A 1ZW1A 2IDZA 3HB4X 3WGQA 1YONA 1WWKA 4JNKA 4AJOA 3NDJA 4KZPA 1AHHA 4FGSA 3NYWA 1OC4A 3TNLA 1JA9A 1U2DA 2VZ9A 5HBRA 4CMEA 2P91A 1ZK0A 3GGGA 3IQDB 4OYRA 4XYMA 1HSZA 4YBZA 5LCXA 4HFNA 1V6AA 3HWRA 4ZN6A 3B1JA 3A28A 1OZAA 1X0VA 1LDYA 1YE3A 2ZCUA 3AWDA 5EQFA 1T2AA 3DHEA 1KVQA 2X0RA 4I5GA 3FR7A 2Y67A 4FD3A 1PL7A 2H1SA 2PZKA 1CF2O 1D8AA 2D1YA 3B70A 1VL0A 3VTZA 2GN6A 3M1LA 1DHRA 6LDHA 1TA4A 1XDWA 3LT4A 3KYCB 2VHYA 4FN4A 4R5MA 3TOZA 4E6PA 2QIOA 3VPFA 1PZFA 1A4UA 3DR3A 3DZGA 3PWSA 4OM8A 5EESA 4WCFB 3RUCA 5COQA 5CDYA 1X1EA 3G0OA 4BMSA 4J49A 3UVEA 3ZV3A 2WMDA 4C4OA 3MJCA 3GVXA 4NJOA 2LDXA 5TSDA 1T2FA 1CYDA 3AOEC 1LXCA 2Y0DA 1GZ3A 1GADO 2AXQA 1O6ZA 3F5QA 2P9GA 2PV7A 3PYLA 1FDUA 4BNNA 2A92A 3EY4A 3AK4A 2X0IA 2VUUA 1G1AA 3OMLA 3HN7A 5I7EA 4R4JA 3AI1A 3KEOA 2VUSA 4RZIA 1PR9A 1YH3A 2CF6A 4ND4A 1E3SA 2ET6A 3KV3O 2QZ9A 4IDBA 2Q4BA 4GX0A 3PQDA 2Z1MA 3OP4A 4GX2A 3WJAA 1GV0A 3IDSA 2EHDA 3EZYA 3H9EO 1NVGA 4F6CA 3DZKA 1VE9A 5CDSA 1EUZA 2QHXA 2PGLA 3U09A 3HDJA 3AOEA 1HDCA 3I4CA 3GDGA 1X7DA 3HFSA 1BG6A 3Q2KA 4Z9XA 4OHUA 4E5PA 3OJOA 2AA3A 3JQBA 3I9MA 1UZLA 3DEYX 3VC7A 3KSZO 4K28A 1QV6A 5AXDA 3V1YA 3JQEA 3ANLA 3DQPA 4U8GA 5CPFA 1ISJA 3IS3A 3ZHBA 3H65A 5JC8A 1NX6A 4BGUA 4NQZA 2HRZA 1LDEA 5DNAA 3GEGA 3JQFC 3D5QA 5JS6A 1HKUA 1OBFO 1YQGA 4KWHA 4WEOA 1LDBA 1NFRA 3I5MA 1ADCA 2X5KO 1TT5B 3BYZA 4YRAA 3D3WB 2GN9A 3W4JA 2BMAA 2PZLA 2GGSA 1ZSNA 1E3LA 3TN7A 1ISIA 2CD9A 5IZCA 5L4NA 4CLRA 5JDIC 1LLQA 4I9NA 1AUPA 1I3KA 2W8ZA 1IUKA 1LSOA 3GUYA 2UYYA 4J6FA 5G0WA 1GEEA 1ULUA 4RVSA 4BMNA 3OM9A 4JP3A 5GZ3A 5JDIA 3U5TA 1R37A 1MB4A 4ALLA 4BO1A 4RDIA 1T4DA 3MTJA 2EGHA 3ZZNA 4CL8A 4ALNA 2W2LA 4HNHA 5BR7A 2B5VA 3W8DA 2CF5A 5L3ZA 2DBVO 1HE4A 4PLZA 4QFDA 3BHMA 5DBGA 1L1FA 3RU9A 2I3GA 4NFYA 4CQLB 5IJZA 1HRDA 1GUZA 3GAFA 2DTXA 1I32A 3BMOA 4RDHA 3ZHYA 1HDXA 4J4TA 4YTEA 3PRJA 1UR5A 1XWFA 4IDAA 5A9RA 1B3RA 3WQSB 2XXBA 3EW7A 4BGVA 4BUCA 1CDOA 5A05A 1H93A 3WR5A 5THKA 2B4QA 3QVWA 1B14A 1HXHA 1NFQA 4O5OA 2OGUA 4BKOA 2EJWA 4IGEA 4R41A 4IDEA 4FFRA 5JDCA 3A4VA 1E3WA 4OOFA 2OL4A 2ZYAA 5L7YA 5C3MA 1IOLA 4MPDA 4MIEA 3PHHA 2B83A 3VKUA 1P1RA 1YJQA 5L7WA 1LSUA 4XWYA 1LSSA 4P8RA 3ZDFA 4BNYA 1I3MA 2W2KB 3HFGA 4E2WA 4WGGA 1E3WB 1V8BA 3NRCA 3LU1A 3GGPA 4MVJI 4ZQHA 1GPDG 4ZD6A 1Z82A 2CY0A 2AEMA 1FMCA 1N1GA 2JCVA 4INAA 1LEHA 2VTEA 4OKNA 3AM4A 3GPDG 4OQYA 3GR6A 2BGKA 1J49A 2I67A 3RROA 1I33A 5CPBA 3KSDO 4R69A 4FR5A 3GVHA 4KDFA 3WFIA 5FYDA 1X13A 4AJ2A 1TVEA 4BO6A 4EUFA 3ZWBA 4MKXA 4CM1A 2O7QA 1UZMA 1NQ5A 1V0JA 3E9NA 3F9IA 3SBOA 3V2GA 3VOSA 2BI7A 4RPKA 4BO2A 1SBYA 3VVCA 4CMHA 4O63O 4TKMA 2E49A 2OP1A 1YBAA 4W99A 4B4OA 3RBVA 4DXHA 4ALKA 3KLMX 2WJPA 3OQBA 1LA2A 5JPIA 3PHJA 5A06A 2HKIA 1V3VA 3I9OA 4JP2A 3LF2A 1NPDA 4LK3A 3OH8A 2D4AA 2DUWA 4KUEA 2DQ4A 3H2SA 5EINA 1VJ1A 4RF3A 1PL8A 3AFMA 4Q3NA 1KOLA 3AU8A 5ICSA 1P77A 3ST7A 2ZTUA 1D4FA 3AJRA 4GKBA 1R4MB 4FS3A 2BHLA 1ISHA 1U4SA 3OJFA 5EN4A 3SVTA 4IJWA 3ABIA 3STHA 4DPMA 3M2PA 3Q1LA 4YAGA 2IEDA 3PZBA 1R0KA 4YJFB 2O7SA 4QUKA 1NVTA 4II3A 5BSEA 2VRCD 3WGYA 2VN8A 3Q9NA 5EERA 5IAAA 1AXEA 2DM6A 2ZTVA 5FWNA 4DIOA 5KVCA 1ZSYA 3UGKA 1UDCA 4HXYA 2E82A 3ONDA 2OP0A 1HYEA 2VOEA 2C0CA 1O94A 1DB3A 3DMTC 1RJWA 1NPTO 1O95A 4P38A 3ZNPA 1E1KA 1GTMA 1I01A 3DBLB 4EEZA 5JNLA 1BVUA 1JU9A 1Y8RA 1BDBA 3TWOA 1L7DA 1XG5A 1LLUA 3S2FA 3IUSA 3RSHA 3UICA 4ZQGA 4R54A 4UUOA 1U8FO 3B20A 4B3JA 1J4AA 3ZCXA 1BW9A 5DZSA 1E7QA 1EK6A 1E92A 1ZXBA 3KLPX 4TROA 4A73A 2ZB7A 2FRDA 5L4LA 3I9LA 3CH6A 1IULA 4OJNA 3GHHA 2WM3A 3OA2A 2RAFA 3FWZA 3BIOA 3U0BA 1C1XB 5A02A 1N8KA 3WTCA 3JSAA 4HADA 2CDBA 1EUCA 3N74A 3W8FA 2ZTLA 4HX5A 3KB6A 2G0TA 3A9WA 1LQTA 2ZB3A 5I8WA 1I3LA 2B35A 4XDZA 3BXXA 3M1AA 1CWUA 2DC1A 3L6OO 1BMDA 1ONOA 3CMCO 4URFA 4I9UA 3RUFA 5K6AA 1K6JA 1EE2A 3EYWA 3VPHA 4DMMA 4NR0A 1P44A 4IQ0A 4MVJG 4N7RA 4NIMA 3SLGA 2BKAA 1YB5A 3KTDA 1YL5A 3LC1O 3HJAA 4GVXA 3RWBA 3SC6A 1E1MA 3AUUA 4MP3A 2HQ1A 3HNPA 4J0FA 5TC4A 4YPOA 5ITWA 1B16A 3JQ7A 4G2NA 5TJ9A 2A4KA 1KVRA 1NVMB 3HSKA 4GGPA 5G0TA 2GERA 5CEFA 1BSVA 3DBRA 4A7PA 1I10A 3V1TC 1JLLA 2VNAA 3FI9A 1SMKA 5COAA 3JD3A 3OQ6A 3AUAA 3FPCA 4W9NA 1U8XX 4G81A 1TT5A 4EBFA 4BNWA 2EP7A 2HMTA 2Y93A 3NJ8A 4BNTA 3L4BC 3GEDA 3RC2A 5TLSA 3WG9A 4NU5A 4XGKA 1ORRA 2TMGA 3PIIA 2GCGA 3RASA 4J16A 2DLDA 1UZNA 4CV0A 2FR0A 3KVOA 3W1VA 3PJFA 3VPSA 5DOVA 4OMUA 4OXYA 2PFGA 4Z0TA 2F1KA 3ZWAA 3U3XA 5C7LO 1HF3A 3H5NA 2OOSA 3E8XA 4CLEA 1PJ2A 3E48A 2C5EA 2OBNA 1FJHA 2B69A 3ICPA 4EJ0A 5EQDA 2VT2A 4YJHB 4CMAA 9LDTA 4NFSA 2GR9A 5LDHA 3K2EA 5TT1A 1E7MA 2GZ3A 1E0DA 4IMPA 2WSBA 3LLVA 4ZJUA 3FTPA 1B15A 1VRWA 2FPGA 3WNQA 3D64A 3WX0A 4CM9A 4BO3A 1P1FA 4EW6A 1U28A 4JLWA 3ZWXA 4CM5A 3DZJA 4YT5A 3DHNA 2RH4A 4BNFA 4RQUA 3FNFA 2EW8A 1U3UA 5ER6A 4BNMA 1MFPA 1H6CA 2AE1A 1UUFA 1QLJA 5IDXA 3PGXA 3T4XA 3KBOA 3ULKA 1LUAA 1UXIA 2HK9A 1XELA 2HMWA 2WD7B 3GZNB 2DTEA 4PGFA 1EZ4A 3W4KA 3HDQA 3I83A 3HG7A 4IBOA 1YDWA 3IP1A 4JJGA 5G4LA 4L73A 4D3FA 5JSFA 1O0SA 3JQDA 3C7DB 1DRVA 3HHPA 4M49A 4N54A 2O3SA 4R1SA 4J90A 3FSRA 3P19A 5A5FA 2BF7A 5BSGA 3U4CA 3GEMA 1K3TA 4LCJA 2I65A 2DU8A 4NPCA 4PG6A 3H4VA 1Y81A 5TJHA 1HLPA 5T67A 3AW9A 3WNVA 1E77A 3WXBA 3WTBA 1PSDA 5B4UA 1O9BA 3QA9A 3ORFA 3K2BA 3QVSA 1MFZA 1EK5A 4E2XA 3DTTA 2RBEA 5FEUA 2DBZA 1I2BA 2WDZA 3FN4A 4FC7A 4AJNA 3VPXA 3E18A 1Q0QA 1ZXLA 3LSYA 4L4RA 4EDFA 4TRNA 3QSGA 3JYLA 2PH3A 4IIVA 2DBQA 1YOVA 1WXDA 1GQQA 4YJFA 4YT2A 1E7RA 1NAHA 3HZZA 3RU7A 4CMGA 5COBA 2A9FA 2Q45A 5C37A 1H0KA 5K6AC 5EJ2A 2D3TA 3QWIA 3QY9A 2Y68A 3DB2A 4IZHA 3PZRA 4QSMA 4Y6PA 3PIDA 3S2EA 3PP8A 4RGBA 4E2YA 2GZ1A 1H6DA 2V7PA 4BS9A 2NM0A 1VSUA 4DUPA 4YAJA 4CMKA 2YW9A 3D4OA 4AJ1A 3ZWVA 4H16A 1ZIDA 5CG1A 4NBUA 1PX0A 3WB9A 5G0VA 3ANNA 4B7CA 3L07A 3PQEA 1WMAA 4IQGA 2HJSA 2NLOA 1N92A 3ZWPA 1NPYA 4JROA 3NUGA 3GY0A 4N5NA 4OOEA 4DYVA 5BSHA 1N9GB 4CQMA 1ZSVA 2CSUA 2YQ4A 1HYHA 1U9JA 4Z0PA 1VKNA 4MINA 2VRBA 2CVZA 2GUGA 1DJNA 4DIBA 3ZWYA 3S2IA 1WP4A 1GDHA 4WE3A 3RI3A 1OAAA 1RYEA 3W4IA 4E21A 3HQ4O 4K9DA 1CERA 2GN8A 4RJTA 1EUDA 2Y1GA 4R68A 1SZJG 3DAPA 4GSLA 4PVDA 1X7HA 5ADHA 2GRAA 4MP8A 1DPGA 2FR1A 4OIMA 4D41A 1HZZA 4IS3A 5DULA 1BW9B 4KWIA 5A3VA 1C0KA 2I76A 3ZWMA 2NU7A 2P5YA 1V35A 2BFMA 1I5RA 1KETA 4FFMA 1NQAO 1GQ2A 1JW9B 2J3KA 1IL0A 3S2GA 4BKQA 1NM5A 3TFOA 4FBGA 1Y8RB 2D59A 3AY7A 5KOIA 1KERA 3KYBA 2GASA 4E0BA 2D0IA 4WCFC 2J8ZA 3JQFA 4BNKA 1PJBA 1S6YA 4LMRA 1YB4A 2HAEA 1QG6A 4IPTA 4NI5A 4PG5A 1PGJA 2HMVA 4CMIB 2Y66A 4S1VA 2CMDA 5DCUA 4J0EA 2Y1DA 3GOHA 4EITA 4UEJA 4PIVA 5H83A 5HS4A 3PWKA 5JAZA 3NTOA 3LT0A 4IQ8A 4CMJA 3GUCA 4J1QA 3ETGA 3NT5A 1KEVA 2Y1OA 3P2OA 4UVGA 4BMVA 2FR8A 1Q1NA 2J5QA 1PS9A 4IXWA 4ND5A 2I3AA 3ZWWA 4PG8A 1GCUA 3GDFA 3EVNA 3OJEA 1T2CA 5C5IA 2Y0CA 1SOVA 3MJ4A 3CSDA 3RJ9A 2JD2A 2FZEA 2HSDA 3NV9A 1SO8A 4FFLA 3WYCA 3D1LA 5HA5A 5DCYA 1E7YA 1N2SA 3FNEA 5IG2A 1N7HA 3PFWO 4BVAA 1DAOA 1YBMA 3QP9A 5TF4A 4GGOA 1BGVA 4IM7A 1GYRA 5KVSA 4R01A 3UH1A 4M86A 4WNIA 3AY3A 3M2TA 2ZK7A 1X14A 4FDAA 1T1SA 1U3VA 4OQZA 1Y7TA 3V2UA 5ICMA 4PG4A 4W7HA 3OEYA 3AUSA 3L6DA 2DPHA 3I23A 4YQYA 2PKQO 1LX6A 1Z7EA 5HRUA 3WMWA 4XIYA 4IINA 2HDHA 1QYXA 4FQ8A 1QR6A 2Q4EA 3GFGA 4R1UA 4CV3A 3WIEA 1C1XA 1ZCJA 1DAPA 1Y1PA 2FN7A 2O50A 2PLAA 4WLFA 2B5WA 4IDCA 1L7EA 4CLOA 1E7WA 3DZIA 2VNSA 2XXJA 1I2CA 3R3JA 4F6LA 1ZZEA 2DKNA 2UDPA 1T1RA 3GRKA 2BRUA 1LRKA 3BMCB 1GYQA 1VJ0A 4QO8A 1P45A 4JIGA 4LRSB 1GD1O 3ENNA 3K5PA 2VWHA 4GX1A 4PLHA 4Z0HO 3EVTA 4QEDA 4XYEA 4YXFA 3A1NA 3Q0EA 4WEQA 3PK0A 4UVHA 5F1OA 7MDHA 1DO8A 1IE3A 1E3IA 3LDHA 4Q3CA 2DTDA 4XGNA 4D0RA 2Q1WA 4LISA 4UAGA 3QW2A 4E12A 3HDYA 1UXKA 3DAFA 2ZATA 2VRCA 3RAJA 1A72A 3QWBA 3VPGA 2Y1EA 3IJPA 3IP3A 3TDKA 4IIUA 3TJRA 2O3TA 2ZIZA 3GGOA 3K6JA 3ZU5A 1MV8A 2V6BA 2UAGA 4BNVA 3DFZA 3GA0A 2Q1UA 2W98A 3DMTA 2QRKA 4RVDA 3QIVA 1N1EA 1ISMA 4CQMB 5L51A 1SEVA 3JQBC 1AGNA 4DWVA 4HWKA 5IXSA 3GHYA 3RD5A 4B7UA 4U0JA 5AYVA 4P4GA 1DDOA 1U4OA 1E5QA 1ISFA 1Z45A 5G0SA 2DUUA 2QW8A 5IDYA 3LC7O 4QX6A 3D3WA 1QLHA 4D42A 3I9JA 3ZWOA 1R4NB 1VM6A 5HM8A 2VHXA 3GN2A 3H8VA 4EUHA 4S3MA 1ADGA 5G0UA 3JQAA 3GF4A 3MJTA 2G5CA 1RPNA 1YOVB 4MOWA 2JCYA 1BVRA 4YCAA 2CVOA 1WMBA 2D8AA 4TVBA 5T8KC 4RVFA 3WSVA 3C8MA 1NXQA 3RC9A 2QG4A 5TX7A 2AQKA 4DLLA 1R6DA 4O6VA 1YO6A 3KSUA 3UHAA 1R12A 3LZ6A 2FHSA 2O23A 1ZJYA 3ROQA 2BGMA 3GT0A 5HS6A 1YL6A 1A9YA 2FWMX 4NBTA 4CM4B 1PGPA 3FF4A 4Z3KA 1ZNQO 5JMWA 2NV6A 3DBHA 5DT9A 3FHLA 5BNFA 2VHWA 4AFNA 2IZ0A 4I9HA 8ADHA 3L77A 1UP4A 2Q49A 1NASA 3R3SA 4OSPA 3NT2A 4TVOA 5EIOA 3HDHA 4Y67A 2Z95A 1CRWG 3DOJA 2PH5A 4R5HA 4I8XA 3ON5A 3PGJA 3QHAA 1LQUA 2Q3EA 4XB2A 3R6DA 4XZ3A 2DT5A 3GG9A 3VH4A 2FSVA 2VYVA 1GUYA 3F3SA 1PQPA 4LVUA 3MOGA 5U1PA 2NSDA 4R16A 4XRRA 2DBRA 4J9VA 4GLOA 1HSOA 4CM7A 4Y6SA 5TT0A 3WYEA 4QQRA 4FPXA 2WEKA 4U6SA 4II2A 2A35A 2P68A 2ZTMA 4FJ1A 4WLVA 3PLRA 3EAGA 4TRJA 4NNJA 3ZWNA 1A9ZA 4IMRA 3GMSA 5TQVA 1XQ6A 4DBZA 1H6AA 4GBJA 3SEFA 4ALIA 5CEEA 3KYCA 1D3AA 3OJLA 5A03A 2V6MA 1DLJA 4JQCA 2JJYA 4CL3A 2W2LD 4EEXA 1B8VA 1RM3A 2RH8A 4UULA 4YJGB 5DBFA 2JAHA 3WGHA 4L76A 3WICA 1H94A 2QRLA 3FPLA 4FFNA 4CLHA 1A7AA 1NHWA 4J91A 1DJQA 1XHLA 2IEBA 1HE5A 4MKZA 1BHSA 3KUXA 1VJTA 2E4AA 4KTVE 1RKXA 1XQ1A 1NR1A 1W73A 4E31A 2B0JA 2IE0A 1CIVA 1W8DA 4BL5A 3TF5A 3ZU2A 1GQYA 3KOUA 2O3RA 3QRWA 4M87A 4TZTA 3ZWCA 4Q3BA 1NTOA 3PYMA 3UW3A 3VH2A 4C7KA 4GWKA 2VQ3A 4UREA 5JCXA 2VYND 1WW8A 1PJ3A 3GMDA 3O8QA 3ZU4A 2JKVA 5I7SA 3NAQA 1G0NA 3T7EA 4P4LA 5B12A 3NTQA 3WJ7A 5F1PA 4JJFA 4AG3A 2BFOA 2IZ1A 4R9SA 1HE2A 5I7FA 2V65A 3U4HA 1GAEO 2QRJA 3JD4A 4K6FA 5F3RA 3OBBA 3JQAD 5ER9A 1LRJA 4BV8A 3KXDA 2EKQA 3TL2A 1ZBQA 4XR4A 4BNUA 4PLCA 3ADOA 1KEPA 1A71A 2BI8A 4MJLA 3UAGA 4IUYA 2C2YA 1Q7GA 4J7CA 1GUFA 5CG2A 4EUEA 3UN1A 5L53A 3VHRA 1XA0A 4NDNE 3ZH2A 4L75A 3GRPA 5L9AA 3ZN2A 2IODA 2IXBA 2O3UA 4BOYA 3CTMA 5JBIA 1YQXA 3WGIA 1GFSA 1SOWA 1T26A 2X1HA 4RLHA 3JCZA 5BNTA 4CUKA 2X9NA 2Q2QA 5H82A 1NFFA 4LRTB 4WUVA 4W82A 1P3DA 3ITDA 4IXTA 3T4EA 4RVGA 4NG5A 3LT1A 4IZIA 1OFGA 4XA8A 4YRDA 5F5NA 3UKOA 3BHJA 5K0ZA 2PZMA 2LDBA 1GZ4A 4OKIA 4E13A 1KEWA 1LDNA 1UP6A 3BTVA 2ZKLA 2ZQYA 4DLAA 1W6UA 1KVTA 1WVGA 3KYDA 5T6BA 5JAQA 5JDCC 1GL3A 2EG9A 2JL1A 4ZQEA 1Y8QB 5L95A 5JCJD 5AVOA 5JY1A 2J3HA 1H2BA 1IPEA 4CQMD 1M66A 2OFPA 3IOYA 3GNSA 3U4DA 3H9UA 2AQHA 5CP8A 2HU2A 3C1OA 2VHVA 1HDOA 3OA0A 1DC5A 1H9AA 2AHRA 2AW5A 3JTMA 4Y98A 3KHUA 3VTFA 4I5DA 3TOXA 3B1KA 3AM3A 2AEFA 3SX2A 3ZNNA 4DC1A 4ZRNA 5IFLA 4CUZA 1MGOA 1EFKA 1H6BA 1ID1A 4MVJH 3BZUA 4JK3A 1FDSA 3O4RA 1PJTA 2YZ7A 4JN6B 1J5PA 2ZB8A 3PDJA 4QECA 2WWRA 5KJCA 1TT7A 2YY7A 2HMUA 2VOJA 4BNZA 1XEAA 5L45A 1UH5A 1HDGO 4WASA 1NBOA 3MJVA 4EJMA 1OC2A 1SCUA 4FIZA 4A5OA 1Q7BA 5JY6A 4BO7A 2VYNA 4BKUA 1ZK2A 2GYYA 4ND2A 3WGOA 3Q3CA 4FSHA 2WE8A 1VI2A 2X0NA 2Z5LA 2E6UX 4HNGA 3CEAA 2EKPA 4FCCA 3LYLA 1QYVA 3NGLA 3F6YA 4GQAA 2Q2WA 1YBVA 1SAYA 1F06A 2WE7A 3NDRA 1Z73A 3GLQA 4YVFA 4O0LA 3ZV4A 3EDMA 4DQVA 1M2WA 4FW8A 4DPKA 3OJ0A 5KJEA 3O9ZA 1LDGA 3OQ1A 1X7GA 2ZCVA 4BQRA 4XKJA 4PZCA 2PD6A 3OHSX 4D45A 4DQUA 2Q50A 2HMSA 4BO8A 2OBYA 3GNTA 4RPLA 3OIDA 2X0JA 4MP6A 3H5RA 2Y1FA 1NQTA 1P1KA 2EF1A 2EGGA 1DXYA 4J2OA 1P0CA 3VH3A 1T24A 3E6AA 3UFXA 1HDRA 2PK3A 4CV1A 4D3DA 3FCOA 3PHLA 1I36A 3BAZA 2Q1TA 1X15A 4DMLA 3U49A 2J5RA 4GX5A 1X0XA 3GQVA 4XCVA 2AEJA 3U62A 3LLSA 2VHZA 1LJ8A 2ZJ1A 2J3JA 1EVJA 2BLLA 3PEFA 4N18A 3GVCA 4WLNA 4E32A 4BGIA 5U9CA 4RVHA 4D46A 4XIJA 4J3FA 1OI7A 5BSFA 1A4IA 3RJ5A 1YJ8A 3RC1A 3RKRA 1KYQA 4YJHA 4X54A 1WDMA 4UVIA 4WJZA 1GU7A 1RM5A 2CDAA 2D5AA 3IIEA 1DIBA 1HDZA 2GN4A 3GK3A 2PWZA 1ZJZA 2HUNA 5JCJA 4BNJA 1LI4A 4PLPA 1NWHA 4KMSA 3F4BA 4E30A 3G1UA 4ESOA 2W90A 2DFDA 2VUTA 4XQGA 5ES3A 4ITUA 1QORA 3ONFA 3MJEA 1R66A 3ASVA 4PZDA 3I4FA 1HDYA 3IL2A 4FJ2A 1KIFA 2JAPA 2OZPA 2GO1A 3C7CB 4M55A 3OSUA 3PFFA 3BA1A 4F46A 1YXMA 1X1TA 4JBIA 2YQ5A 1Z7BA 3FBTA 2PGJA 2CNBA 2R6JA 4B8ZA 1N9GA 4PLGA 4ALMA 1NP3A 2EWMA 4E5YA 1NYTA 3DDNA 4RF4A 1P74A 3V2HA 1DIRA 4E2ZA 4IDGA 1DSSG 4QXMA 4XYBA 4HFMA 4YDRA 4GMGA 3S1LA 1R4MA 2QZZA 4AJEA 3DZFA 4GPD1 1QV7A 1ZMTA 2PNFA 4EYEA 3NKLA 2JD0A 3JD0A 3Q2IA 4KQWA 4ZGWA 4HBGA 2Y0EA 4ILKA 1ML3A 1XU7A 1CETA 1MG5A 1PQUA 3JD1A 4UEKA 1B26A 3GPIA 2CUKA 1BXKA 3DWFA 3H3FA 2AQIA 3OF2A 2D5CA 1EQ2A 2OMEA 5I9MA 3O26A 1DIHA 4ND3A 1XSEA 4DBVO 2WYVA 2WTBA 1JQBA 1KC1A 5EPOA 3IKVA 4JGBA 1JAXA 1LBEA 1OMOA 1PJSA 1JWAB 1Y5MA 4ID9A 4YB8A 3ROMA 4UUPA 1MUUA 3JQ8A 2QYTA 1C1DA 1GY8A 2CZCA 2B36A 3GG2A 4GLLA 4OXNA 2PGDA 3JYNA 3RUIA 1V3TA 4NBRA 3IKTA 4JBHA 4PLWA 1JKFA 1XR3A 2Q46A 4PN3A 3DAGA 4BO0A 2ZB4A 3JD2A 3UCFA 3VKVA 4CLDA 3OIGA 5DP2A 3I1JA 5IF3A 4MIOA 3U4IA 2PKQP 3HE3A 1YWGO 3F1KA 4CM8B 3H9QA 4G5HA 4H3VA 1BXZA 3WYBA 1RYDA 2DAPA 1ENYA 2GDZA 3WGTA 2FSSA 3SLKA 3JQ6A 3KETA 1PZEA 5DP1A 3TL3A 1ZKMA 4XJSA 3H3JA 3FTNA 3JQGA 4Q3EA 2VWQA 5EL0A 4WOJA 1NR7A 1QYWA 1HZJA 3GVPA 3VZQA 4L4SA 4BB5A 4E5MA 5KJFA 4LW8A 5L4SA 3CUKA 1ENZA 4RPJA 3FD8A 1UAYA 2WD8A 1PEDA 3CMMA 1Y5RA 3E03A 3JYPA 4YACA 3PHIA 3QWAA 1KVSA 3CKYA 4LSMA 5AOVA 2O2YA 1DRUA 5GY7A 3JYOA 4KUHA 3QE3A 1XYGA 4CM6A 4ZU3A 1PZGA 3HN2A 2EKLA 3NEPX 5HTOA 1XLTA 4BNIA 2GD1O 3INRA 4AJIA 4XYGA 3I9NA 4B4UA 4CQLA 1I8TA 5ITVA 3Q6IA 1QSGA 3G1TA 5F1KA 1KY5A 4Q3DA 1M6HA 4WCFA 4W4TA 5THQA 1Z6ZA 4BGEA 2IRWA 2NACA 4CR6A 1ZEJA 1KC3A 3SJUA 2HCTA 1P1HA 4FFPA 2V6GA 5ENDA 1YQDA 1K6IA 2H6EA 3EHEA 5G4KA 4Y9DA 4EJ6A 1IYZA 5FF9A 2C54A 1GEGA 3GDOA 3H5AA 3KO8A 3TZCA 4R3NA 3W8EA 4I08A 1PQWA 1XGKA 2IZZA 2Y99A 5DDIP 3WQRA 2NADA 3PXXA 4E33A 3RUDA 3E1KA 4FB5A 4BHTA 1Q2XA 4NHEA 3QV1A 5ILOA 2NVBA 4JCOA 3N58A 4JX8A 4RV9A 4TQGA 2AG5A 3GVIA 3I9KA 4FOOA 3ADPA 1R0LA 3DBRB 3HUDA 4CJXA 3MWDB 1JWBB 1P1IA 4PVCA 3NGXA 3JQ7B 3LF1A 4DA9A 1MX3A 1NHGA 4CUJA 3ENKA 5U4QA 4YAIA 4G65A 5L40A 1UDAA 2B4TO 1IZ0A 1F0YA 5KCZA 1E3JA 1KBZA 1U3WA 1D1TA 2A94A 1M6WA 4ALJA 1KEUA 1BTOA 1DIAA 4PLTA 4MIYA 2NTNA 4ZA2A 1AE1A 3Q9UA 3WFJA 3I3OA 2GLXA 4A03A 4RLSA 1DBVO 1JN0A 2AMFA 5CDUA 5CEJA 1TI7A 3K96A 5A4DA 2RCYA 1ONPA 4BKPA 1Q0LA 3DMYA 1DFGA 5JE8A 2I99A 2YV1A 3TZHA 2QYSA 3IAHA 1UAGA 3DOCA 1LDMA 3U9LA 1GPJA 1H5QA 4MDHA 2OXIA 1GCOA 1RM4A 3JQ9C 3IUPA 4QTZA 4J43A 1QKIA 1UXHA 1QYDA 3AM5A 2NVUA 2G82A 3ETEA 3JQ9A 4I1IA 3RBZA 1SB9A 1HETA 1NAIA 5KIAA 1PGOA 3EZLA 1LLCA 3DL2A 3WSWA 2XOXA 4IJKA 4HFJA 2NTJA 1DIGA 3AY6A 4LN1A 4TWRA 3GC6A 2WYWA 1C1DB 2PZJA 4B4WA 1A7KA 1O89A 2XAAA 2EV9A 3MTGA 4CM4A 3PTZA 2HRBA 1KY4A 3CE6A 4GL4A 2UVDA 4XR9A 4KUGA 1HEUA 5A3JA 1JVSA 3PHGA 1W4ZA 2ZYGA 4LGVA 3TRIA 1XU9A 3NT4A 3EMKA 3OETA 3SJ7A 3X2FA 5I9LA 3WBFA 1EMDA 4TZKA 5CFZA 3A14A 3N7UA 2I6TA 3BTOA 1E7SA 2OUIA 3K31A 3WBBA 4U5QA 5GZ6A 3QLJA 2BGLA 2JFGA 1C3VA 4QFCA 3LVFO 5G2OA 4PRLA 1YB1A 1PJ4A 1SB8A 1E3EA 2O3JA 3TZKA 1FF9A 2JD1A 2I9PA 1WDLA 3F5SA 3GNQA 4GSKA 4BO5A 3QWHA 2ILTA 2X9VA 1BRMA 3PVZA 6ADHA 3BMQB 4XDYA 5JW6A 1LU9A 1YL7A 2C7VA 2GNAA 3AFNA 3FNHA 1U5AA 3OIFA 1CQJA 2O4CA 4Y8VA 5FFFA 1ZO8A 4R3WA 1WDKA 5JC1A 3UCEA 5DBIA 1B8PA 4AVYA 2EP5A 3INGA 4Q3AA 4BNGA 4AICA 4M54A 4CMIA 4ROSA 4CMEC 2O4UX 1K89A 1E5LA 1V3UA 3H9GA 3TPCA 5LC1A 2PA3A 4OGWA 1GV1A 1ZK1A 4H15A 1IY8A 2QX7A 4K6CA 3IJRA 3SC4A 4TKLA 1IHYA 1F8GA 1VL6A 1PIWA 4B8WA 2YDYA 5CAEA 3ANMA 1U3TA 4DRYA 1B3BA 3L9XA 1FXSA 4J1NA 2SCUA 4C7JA 3DZHA 1NQOA 3NJ4A 4ONEA 3C1AA 3RUAA 2NVUB 3G79A 1VL8A 4AJKA 3AUTA 5KNLA 3X2EA 1EQUA 5F21A 1ULSA 4L9RA 3P7MA 3RKUA 3R1IA 3I6QA 1PWXA 3F4LA 1H9BA 5MGBA 2W2KA 5T5QA 4D7AA 3K92A 4WOKA 1PU2A 4YWJA 3VZPA 3B1FA 4GVLA 4L74A 1K5HA 5MDHA 1PR3A 3BTSA 2J3IA 3KM0A 3FWNA 3RCBA 1PGQA 1PL6A 2VWPA 4BO9A 2Z1NA 4R9RA 3EK2A 5B1YA 3D4PA 3EGOA 3AU9A 1E1NA 1I24A 2W4QA 5J23A 3QWFA 1B0AA 3L0DA 4IJUA 2RIRA 3WOHA 3QVTA 4HY3A 2PKRA 2XPCA 3VDRA 1Y9AA 3S55A 1A27A 1DOHA 2O3QA 2X86A 4EGFA 1MC4A 5AXCA 3WLEA 3D4NA 3MOIA 2NQ8A 3MEQA 3O38A 4Q39A 4J4BA 5H81A 3WGGA 3RFXA 3L9WA 3WQQA 4CMBA 5T64A 4HP8A 3JQ8B 1KVUA 4YT8A 4AL4A 4KP7A 1DC3A 4GAEA 1HWYA 5IZCC 4WK6A 2FPIA 3GH3A 3OFSA 4RVUA 2X6TA 3JQAB 3WLFA 3DHYA 4PLYA 4D3SA 4MVJE 2NWQA 4BNLA 1U5CA 4NJMB 4ZHSA 2R2GA 3K30A 1D1SA 1D7OA 1JKJA 3LC2O 4Y6RA 3D7LA 1JAYA 5G4KB 3VH1A 4YT4A 3GZ4A 1JTVA 4YJGA 1PS8A 4LSWA 1UJMA 4EZBA 3OECA 4QT0A 4XYLA 1R15A 3DFUA 1BDMA 3E9MA 2YHIA 4YQZA 2YV2A 1F17A 1W0CA 3O03A 5GMOA 2J5KA 5JYEA 4E5NA 2I66A 2WD7A 3GZNA 5A1TA 1DEHA 4B3IA 3Q11A 5FI3A 5I9NA 4B7XA 1HE3A 4DGSA 4A26A 3DO5A 1LC3A 4I5FA 1LNQA 4WECA 1MA0A 3D5TA 1DFHA 3RUHA 1QYCA 4O1MA 2P5UA 1HL3A 3B6ZA 4JBGA 1YRLA 4D44A 3K9QO 1JDJA 4NH4A 1PS0A 1PTJA 1BXGA 3RQSA 2VCYA 1RM0A 1HLDA 3G17A 4PZEA 5KWEA 2C82A 2Y1CA 1PZHA 1IHXA 3MWEB 4WLUA 4CM3A 4P22A 4CLXA 3ZV6A 4H7PA 4U6QA 1EVIA 4FJ0A 5JAMA 2Q99A 4WLOA 4CR8A 1T4BA 4R1TA 4YR9A 3F1LA 1Y9EA 5DCWA 2IYPA 3COSA 3AI3A 2VZ8A 4A0SA 2TMDA 1LLDA 1MG0A 2YV3A 3GN1A 3LT2A 3QQPA 4PFJA 5BNIA 2C5AA 2P4QA 2HK7A 3H2ZA 5B4VA 1VLLA 2G17A 1T2EA 5A9SA 4OXKA 1EDOA 1UP7A 4NZ9A 4N5MA 3ZNOA 5KJ6A 2AG8A 2C59A 1TEHA 4WCDA 4DPLA 3PJGA 2QQ5A 4NBWA 3S8MA 2BFAA 1EDZA 2FP4A 4RPGA 3MJSA 4JJIA 4XD2A 3I6IA 4B79A 2OHXA 4W9NC 3AOGA 3DTYA 4O59O 4IS2A 4OO3A 4Z9FA 1PGNA 1PWZA 3G49A 4YAEA 2EIHA 5B4TA 1CJCA 1K6XA 3IC5A 3BMNA 1F12A 3K73O 1ZK4A 4L4XA 1EVZA 1R16A 4YJDA 4LCEA 4D43A 4W6ZA 4Z3DA 1PJLA 4AJPA 3D0OA 3OEWA 4TMFA 1P31A 3F46A 4M1QA 4PCVA 3ZW9A 4J9UE 2NU8A 1P33A 2V6FA 4R1NA 2YYYA 1EVYA 1EE9A 3O8QB 3PPIA 3H6KA 4NBVA 1VSVA 1ENOA 1DC4A 3C85A 4RL6A 5TS3A 3CIFA 1IZ9A 5AQ1A 2B37A 1UXJA 1DRWA 1P0FA 5CDTA 3TSCA 1MLDA 2CFCA 2GPTA 4DREA 1M76A 4XX0A 1E6WA 4IDDA 1U2GA 5L7TA 5TNXA 3WS7A 4UUMA 4ZRMA 3C1TA 1YKFA 2E48A 3L4SO 9LDBA 4RF2A 3I52A 3TQHA 5IXYA 3PLNA 4Z9YA 1YVEI 2FOIA 2X4GA 4XQEA 4KQXA 2NTVA 4M89A 2JHFA 3DONA 4CR7A 5JXWA 1C0PA 3JQCA 1QP8A 2EERA 2PY6A 5A5EA 3ONEA 3WMXA 3MZ0A 5ILGA 3WGZA 2F00A 1VPDA 3VZSA 2CDCA 3VZRA 3DOOA 5ENVA 4NK5A 1MP0A 3QJ5A 4DTIA 4XJTA 2JCXA 2J6IA 3WDSA 5JYDA 1VKOA 4L8VA 4LVCA 2AQ8A 1N7GA 1E6UA 1WZIA 2JFFA 2YDXA 1AHIA 3FR8A 3WWZA 4MVJD 3RFTA 4AJJA 5GZ1A 1XCBA 4NK4A 3ICCA 1F14A 4XB1A 3G3EA 3VAZA 3JYQA 4B4VA 4R51A 4DVJA 2NU9A 5A9SB 3ZI0A 2YFHA 3P2YA 4J7XA 4HFRA 1WLYA 2OO5A 1U7HA 3KYDB 4UVDA 4DYDA 4NFHA 4CM8A 1DHTA 1DFIA 2WYUA 4A10A 1BWSA 3LQFA 4RF5A 4CM9D 5KVQA 3M6IA 2FPPA 1O5IA 3E5RA 4KDEA 3KZVA 3RIHA 4MVJF 1WAMA 3RVDA 1Z74A 1EBUA 3V8BA 5JO9A 3WIDA 4CPDA 2X9GA 4A2CA 4GH5A 3CXRA 2VTDA 4DQXA 2YJZA 5FI5A 1QRRA 4PG7A 4RZHA 3UCXA 4Z6KA 5KVVA 4E3ZA 1NNUA 1ADBA 4HV4A 3ZV5A 4RO0A 5K9ZA 2IYOA 3H9JA 4TRMA 4WLEA 1T2DA 5BQFA 2CVQA 5JFOA 4U7WA 2XF8A 5JAIA 2ZYDA 4BO4A 1I2ZA 4IJVA 5CHEA 2VT3A 4P4NA 4J4HA 1FDWA 2HK8A 4BNXA 2VZ0A 1ZMOA 1R4NA 3L4BA 1LC0A
chains in the Genus database with same CATH superfamily
4OGGA 3W2GA 3K0CA 5IN5A 3DGEC 3V7YA 1ACLA 4PLVA 4WY5A 5KJ1A 1MX9A 1ZLXA 3CLVA 4CV2A 5AW6A 1D9XA 1QM5A 4W1RA 3TSOA 5FQNA 2JLUA 1FK8A 4OI0A 4MGIR 5DHAA 1YJBA 1HMPA 2ZM6B 5J63A 1V9LA 2GJ9A 2BHRA 2GN1A 2PR7A 1MAHA 3OQHA 4TL9A 3EGDB 4XM1A 1GR0A 1JZTA 2Q5FA 2QTWB 4IKOA 2C2XA 3ED1A 3LWZA 4EHBA 4CTNA 4CTJA 1H2RS 1RTTA 2VT6A 2FX2A 3C4VA 3QF4B 1PNOA 2HO5A 4IZOA 2W2VA 2CBXA 3L18A 3WGLA 2QE6A 3ZHXA 1JB1A 2PX6A 2VL7A 2I4RA 3CWCA 1IEVA 3TEFA 2PUAA 3A1VA 1U6JA 2F8SA 5EJ4A 2NZWA 4GMFA 2C5GA 2EEZA 4BP8A 3EXAA 1KZ6A 2SHKA 1FDVA 4J1TC 2VH5R 1K1EA 3DL4A 5KSWB 4GR4A 2QRVB 1F8FA 3BXHA 1BMFA 2Q3FA 1GQFA 5JNUA 2CUTA 2L69A 4OLFA 1OF1A 3E81A 3U3RA 1YS4A 3NC4A 2D74A 2IXAA 4QPJC 3U7QA 4TSFD 5B3LA 2I8LA 1ZAYA 5C7IO 4KOAA 1T9ZA 4K6GA 1BU8A 1W4CA 3Q7EA 5EGNA 5H02A 3SGLA 1ENPA 4XQCA 5I48A 2P0AA 2Z9CA 1VL5A 1SA0A 2E85A 3HVIA 4X7PA 3KXKA 3HXOA 2VSQA 3H4MA 3B5JA 4N8SA 5CH8A 2MWMA 2NXNA 3E3LA 5DTIA 2CHEA 1PR5A 1Y8QA 4MCHA 4X7MA 3T8YA 4BN0A 2Z6AA 3RABA 1VP9A 1FX1A 3DOEA 4WBNB 3E7XA 3G7NA 3JRWA 2OXFA 5DJ5A 4U9UA 3M6AA 3CNEA 4ZQFA 5E3IA 5KNCA 4W5NA 5AXBA 4CKYA 4TVSA 3DCNA 4WQMA 2NXCA 4BYMA 1V71A 1F2UA 3GD7A 4TLBA 3KJGA 3RNLA 4B6GA 1SU4A 2YZKA 2G3YA 3BB3A 5ALUA 1DQSA 2C20A 3FSJX 3NASA 4YP5A 5TS2A 1TXGA 2WT9A 3WBJA 3DFFA 2QMEA 2UV8A 3THSA 3ZZ1A 3P5BA 2VBCA 4MA0A 3OY7A 5TGDA 3UJBA 4NENA 3VBEA 5JLAA 4W5OA 4AS1A 2O1XA 2PXCA 1LS1A 1A5ZA 1ISGA 1UM9A 2UZ3A 1XE3A 1XKLA 3HCDA 2B8TA 3WRXC 1NXWA 1MOPA 4V0LA 5E1BA 3IGFA 5EMJA 3LPNA 1OPXA 2OCLA 4KX3A 4BC1A 2VWGA 1RE1A 3PDUA 4FYHA 5C1DA 1WA5A 2WZQA 4MB0A 5HFNA 3X43A 2IBSA 4NKRA 4ZVMA 3ND7A 5HNKA 4PO9A 1USIA 3PUHA 5CM9C 3TFQA 1HT0A 4RTKA 3DBLA 2DY1A 2H5IA 2YXBA 3WWYA 2HLPA 1XMPA 2YVKA 2Z5VA 5PGMA 5TV2A 2C92A 1YTUA 2IV2X 2M98A 3T34A 2R00C 1JQAA 2VDUE 2V7GA 2H5LA 3K1YA 4RGQA 4C2BA 4G4JA 3STVA 1C0IA 2ODEA 3BJZA 2BFPA 4BXOA 1FFCA 2W2OA 3I2HA 2BVNA 3AEQA 4IDOA 1Z6XA 3AERB 2UUPA 3HBJA 1FB5A 4IDFA 4Y9SA 3T1QA 3NONA 3ZCPA 5JO0A 4CLRB 1JQ5A 1EJ6A 1LTHR 2I5PO 2XYGA 4P58A 5K0NA 3M5DA 5JQGF 2W6PA 4FUQA 2OWDA 2Y76A 3CEJA 5LJLA 3K9FC 3ZHSA 3GRUA 3R7LA 3FYUC 3UJ8A 5JCOA 3OLVA 4PQFA 1OREA 3URKA 4PZ9A 1P9LA 5EKXA 1HE1C 1N5OX 3G89A 3GDHA 3ZHZA 4FZ3A 5JPDA 5KTOA 3FYHA 1K9SA 4D3XA 3EC7A 3LYUA 2GJ4A 4OLAA 1RAHA 2FN3A 2P9ZA 2UVQA 4FZVA 4LMPA 2WMNB 1V4NA 3V4ZA 1N75A 4IUCS 4PTZA 1P1JA 1IOZA 4B3FX 1JDTA 4S1PA 1F9AA 1INLA 2O0MA 5IHPA 1U7OA 4TXMA 2BMEA 4DARA 1I3NA 4CI0B 4L8GA 4BX2A 5KTKA 1ARZA 2EAUA 3LUDA 4Q4JB 2H06A 1NN5A 1JEAA 1GG5A 4NONA 1WBJB 3B1YA 4DY4A 2JFNA 1EVKA 4M0DA 3E5NA 5LUAA 2IHTA 3KD3A 3UYLA 1G5PA 3ZQ6A 1MIHA 3RSQA 3T38A 1VC2A 2RHRA 1WPQA 2MJLA 4GGMX 5K0TA 4I4LA 2PU5A 1ZK3A 1EP9A 3PWZA 1EHIA 1BN6A 1G0OA 4DCCA 7ADHA 4PCUA 1MR3F 2FY8A 3OX2A 2VDLB 1BE6A 1QKKA 5HFAA 4MWDA 5A7FA 4HD8A 3SDSA 4CL0A 2H11A 3HRHA 4WKGA 6NULA 3SDBA 4RKRA 4GI2A 2FEXA 4L7VA 5D7NA 5GADl 2D2IA 2MTBA 4IVQA 3AF0A 2Q2VA 4OBBA 5AJZA 1QBGA 4TKVA 5AXAA 3DZDA 1DC6A 1DZIA 2B98A 3LW7A 3SBEA 3VR6A 4BB6A 5CYGA 4ARIA 1Y42X 1H65A 4M1SA 3W3AD 3PQFA 4U2GA 1GP2A 3RVPA 4X66B 1CZHA 1Z17A 5JU6A 2H1IA 2QVYX 1JI0A 1RNLA 1QVZA 1G6OA 3KEQA 3ZZTA 2G88A 4CODB 1HZZC 3IE0A 1TK9A 4MUBA 4QIHA 3RVJA 4KXUA 2G76A 1ZRSA 2VFAA 4MYSA 1J21A 5EHGA 3AF4A 4CTMA 2B7CA 1GZHB 3LL4A 2QM7A 1E8MA 2JCBA 3BHIA 4HKTA 4DJTA 4ZOAA 3JVUA 1ULBA 4TRRA 5FLXA 5A0TA 1W36B 3UUWA 3ZGYA 1Q0SA 5CVEA 3ASUA 3HADA 2Q7XA 1AXGA 4B5KA 1DX9A 2PGXA 1J6UA 4ZQBA 3ILSA 4IDXA 1ZS9A 1Q7CA 3ETDA 3G5LA 1YB2A 2VKTA 5C81A 2JS7A 4YNBA 5DVZA 2IHZA 4PX2A 1VG1A 2BTQA 4INOA 4B3DA 2OORA 1KAHA 2PD4A 1RBQA 2FTKE 3CKMA 3U40A 4MWEA 1TA0A 1L7MA 2VLBA 1BFDA 4HQ0A 3PA6A 3JPWA 1ESZA 2ZQZA 3AM1A 3O2QB 4Q9DA 2DSTA 1JEJA 5F5LA 4L16A 4Q4HA 1E5TA 3BMQA 2ZTHA 3DC7A 3DO6A 1JR3D 3CE9A 2OCPA 1Z88A 2PWBA 2KMLA 3TW8A 4OK3A 1YR9A 2AMYA 3R5KA 1JKMA 1KIMA 2D13A 1EM8A 4RORA 1ZESA 3AESA 4KYTA 3TTWA 1JBQA 2VK2A 3LGXA 4RA6A 4S0ZA 3ZCVA 3VYRB 4DNXA 1V41E 4ZEMA 4BQPA 4QGGA 1U3FA 1U8ZA 2X1MA 1ONNA 2XNHA 3K53A 4OHPA 4V1CB 2IDZA 3K35A 1YONA 2JI7A 4OXIA 3F73A 3NDJA 4CKCB 1K4KA 4IUDS 2JBAB 1IOWA 1TYCA 4KZPA 3EGDA 1AHHA 4LSGA 3PXEA 5DI3A 4YRGA 1P8JA 3TNLA 2D7CA 3VPBA 3TW8B 1AU9A 5HOEA 2P91A 1PWYE 3DXYA 3OTIA 1EX1A 4OFWA 4M36A 4AWBA 2IPMA 1V6AA 3HWRA 1G6Q1 1KMNA 3BRWA 1Y33E 3A28A 1OZAA 1QJCA 1X0VA 2ZCUA 1Y1LA 4LXXA 1EIZA 1KE2A 5EQFA 5FEMA 3LBHA 1S0UA 5TGZA 2PE5A 1CY2A 4I5GA 3CT4A 1ZIYA 3ROFA 1R5JA 3FUWA 4FD3A 1RRFA 3QLUC 4L4ZA 4PYQA 1DKRA 2ODNA 5BRNA 2NU8B 2D1YA 1RHRA 2CNLA 2Y77A 2AZTA 1VL0A 3BDVA 4D0NA 3M1LA 2FMHA 4CF5A 3EOBI 3P97A 1XDWA 2FG7C 1K6MA 4DV6B 2VHYA 3GELA 4KPUA 1KDZA 3ENVA 4ENUA 2QIOA 3GLGB 1RVV1 1JNXX 3FDZA 2PMEA 2ZB2A 2JCGA 2ZUBA 3MPOA 1VZ3A 2QE7A 3MS7A 3MAGA 2WMDA 1KZ4A 3PFKA 3GVXA 1H8ED 4NJOA 3GFTA 2LDXA 2WFMA 4J75A 5A5DA 1RMYA 2ASEA 2VPTA 2ZIUB 4D80A 3QKRA 2ZJAA 3P52A 3K8OE 4RSGA 1GZ3A 1GADO 2QRPA 3JATA 4GHWA 3RS4A 2PV7A 3NVAA 4XCXA 3O8RA 1AUXA 2A92A 3EY4A 4BPRA 2X0IA 2XW6A 3C39A 1JPJA 4CT5A 1JR3A 3M9XA 2XUHA 3AI1A 2ZULA 4EFKA 2ZSIA 4LGYA 3SSNA 1EDDA 1GLVA 2MYNA 2GZHA 5T41A 4ND4A 1E3SA 3A0UA 1Z8NA 1JX6A 1FUUA 2QZ9A 4IDBA 4HB0A 4MS4B 5SY4A 4PHGA 1X87A 2IV7A 3GB9A 3NVKI 3QXHA 4G0ZA 1L7VC 3PC6A 4I46A 4DAOA 1I9CA 1M33A 1ZIPA 1AS2A 2EFHB 2ZDGA 3WRYA 5IT0A 4LYYA 3HKBB 1I4LD 3EZYA 3H9EO 1NVGA 1RZVA 3OJWA 4KKVA 4MGZR 5ALZA 3ZEAA 1H4SA 3FOWA 4GE0A 5I7OA 3U09A 2PL9A 1MV5A 1HDCA 3TX6A 4UBJA 4PYJA 3ZLAA 3JY6A 3HFSA 3WNZA 4ZZ3A 3DL0A 3DWIA 3L0CA 3QV2A 4UZEA 4G41A 2IHVA 3B60A 4Z1OA 3GIDA 4KN6A 4E5PA 4Q4CA 5IBRA 2HO4A 2EQAA 4AY5A 3I9MA 5FOQA 3VC7A 3KSZO 3V8QA 4OHZA 4HRXA 1EJBA 1RTKA 2CHUA 4HQLA 3LFUA 4E94A 3K9BA 3DQPA 4JB0A 1Y3IA 2R2AA 4LXUA 4U8GA 1H4QA 4P1ZA 3ZHBA 5KYTA 4XSGA 4BGUA 3CC8A 5BSKA 1V5FA 1WVIA 3OM8A 5DNAA 3GEGA 2JIRA 3FIUA 4JXJA 5F7JA 3FSEA 2B4AA 5JWRA 4WEOA 2YIVX 4H2DA 1K68A 1NFRA 3DDCA 2CXTA 5EXDA 3G6WA 1M6EX 4DMUB 4MP8A 1KK2A 1VJCA 3GL9A 4D0LB 2DHDA 1ZIOA 2GN9A 1UODA 2Z3VA 3D3WB 4IYRA 4KE6A 1ZSNA 1UDXA 2EWWA 4ZDWA 3OHPA 2NW6A 2QTTA 4CLRA 3N3BC 5T3UA 3VBCA 1APBA 5JDIC 5CIYA 3VV2A 3ZHUA 1N6KA 3L8YA 4I9NA 1JEEA 1I3KA 4E2WA 1P61B 3GUYA 3IMCA 1GEEA 4BMNA 5JDIA 1N6IA 2XKJE 4JP3A 5ESDA 4F2DA 1FTWA 1Y4DE 4TS1A 3CRZA 1IY9A 4OYHA 4HMOA 4TOIA 5LYYA 2B30A 2GK7A 3NBYC 3ZZNA 2G1AA 2ECQA 1KFBB 2W2LA 4ALNA 2PVSA 3IIJA 5IDWA 4QBHA 2C00A 2FX5A 2DWUA 3HVUA 1OH7A 1TAUA 4QNRA 3ZY4A 3A9CA 5CD9A 3PNVA 2N0SA 5AW0A 2I3GA 2H5EA 4IOJA 2VTKA 3W7AA 2ZSBA 3GAFA 4X65B 1CNMA 1I32A 4QRDA 1PE0A 1UPAA 4RDHA 1W5EA 1C8BA 2Y1LA 5AKYA 5ICFA 1JXQA 5LIPA 3CPJB 4KQJA 4IJSA 3HCFA 3MYRA 1U31A 4IDAA 4S04A 3EW7A 1Z38A 4Q4HB 4BGVA 1CDOA 1PYOA 4H0NA 4KV7A 4ZWNA 5THKA 4YO7A 1IWPB 3R0XA 4BVJA 4BX9A 2IU6A 1YC5A 1RLOA 5E4FA 1AV7A 1XHFA 1G63A 4HAVA 4B6SA 5F7OA 2CL6X 4IDEA 3TSYA 1F2UB 3TIIA 2D62A 2ODTX 3EDYA 1KAEA 1JDVA 4YR7A 4OOFA 4X64B 1EX7A 3GJ4A 3WLOA 1NZDA 4IIGA 2Z5FA 1TIKA 2C4NA 4CDGA 5L7YA 3I9V6 5C3MA 2H07A 1S8OA 3QTTA 4H6WA 3PICA 4JUFA 4MPDA 1XRLA 1YDMA 3CZ9A 3IA7A 2HBQA 3QELB 2B83A 3VKUA 1P1RA 4F8YA 5KSOA 5L7WA 3GJRA 3HBMA 4QUGA 4J1JA 1Z16A 1DCKA 5C34B 3ZC3A 2C2MA 2QD2A 2O0KA 3EVDA 3UATA 4QM6A 3HFGA 1DEOA 1YS2X 3B53X 1T5OA 1XQVA 4WGGA 3V3TA 4EO9A 3T95A 3KKNA 4NV0A 3MQ4A 3GGPA 3A1EA 3LSTA 1QHSA 1GPDG 3O8OB 3T52A 4I4IA 1N25A 1Y0BA 4WZBE 3RVNA 3X0DA 2VHJA 2ZWMA 3DTVA 4YRQA 3OPQA 3AT1A 3TE6A 4INAA 2JAOA 2VTEA 2ACEA 3VYUB 3PB3A 2ROQA 3L8EA 1T8SA 3AM4A 4BRSA 4DLPA 4OQYA 1A82A 2OWEA 3HGQA 4G86A 3GYGA 4Z9AA 3VC1A 7REQB 2I67A 1AUOA 4Q24A 4URVR 2G5TA 1VIAA 3UAVA 3NWEA 3GVHA 4GL2A 4I50F 1P29A 4EUFA 3ILXA 2IOQA 2X9LA 3ZWBA 3ZU6A 3S44A 2O7QA 1V0JA 2SKEA 3KK0A 3WIVA 1X1AA 2VBGA 2GXSA 2X3FA 3RVOA 2PANA 3UGQA 2E49A 2OP1A 1FYXA 3X1YA 3O7WA 2G4VA 4ALKA 1M74A 1SD5A 4H6VA 5CJ2A 1LA2A 1AM4D 3H42B 1NI4B 1V5WA 4B85A 1KKLA 5IVHA 5GM1A 2GZRA 1GSAA 1V3VA 1GTSA 2WJ4A 2WHQA 1PK7A 3FYSA 2D4AA 2Z8YM 2FHPA 1MX1A 2QUAA 3CLUC 2ZPUA 4PEVA 5IT5A 4JL5A 1OHHA 1DQPA 3RBAA 4Q3NA 4GZ5A 5ICSA 3ST7A 3E27A 2ZTUA 1D4FA 1FLAA 3NXSA 3KKQA 3IR5A 3R7WB 3USZA 3K0AA 2PIDA 4LA4A 1Z22A 1BQ4A 3THXA 4OATA 2I3ZA 3GGCA 1E4EA 1YF3A 3G0HA 1Y3CE 5DGDA 1RKUA 4IJWA 4MW0A 1T8PA 3NC0C 1OLXB 4OP1A 5ALSA 2O7SA 4MQEB 4QUKA 5BSMA 4J0GA 4FYWA 4HATA 2GT1A 4II3A 1JJ7A 3WJ2A 2I2XB 3THYB 2WIAA 3Q9NA 3KUKA 3V9PA 1J25A 5IAAA 4IVNA 3QI2A 4FNMA 3KEGA 5LD2B 1V8FA 4HQOA 4KB5A 1ZSYA 5KVCA 1RRMA 3RTEA 4TYNA 5GVRA 4A8HA 3WK8A 4ACBA 1PF7E 2E82A 1ZCBA 1P80A 2F3RA 5IBPA 5DNDA 1PJZA 3SFZA 1GGVA 1N5JA 4D9EA 1EGMB 4XEUA 1AKVA 3ZNPA 2YCLA 1KK0A 1OXMA 5D6NA 5DLEA 5F78A 3FWPA 1J9ZA 3V80A 5FQOA 4G1UC 4BVKA 1BDBA 1PK9A 1U0GA 3H11B 4HS4A 3QEMA 1R8XA 2O0JA 3OOWA 3B6KA 4N48A 1VP3A 2LIPA 3VR1A 2BJWA 1ZOOA 4S35A 5DGCA 3S29A 3BGDA 2FLWA 2QUHA 1CJSA 3GARA 3B20A 4OMDA 3U39A 3HSYA 1J4AA 3KQPA 3WKBA 4B3JA 2PG3A 3IT1A 3IURA 4EVRA 5FH9A 1O1YA 3R0ZA 1BW9A 2OHVA 1UM9B 3QE2A 5T3YA 1Z12A 3ENZA 2WWHA 4G4IA 4R98A 4RD6A 2WY2D 3KPUA 4A73A 4KR7A 3SQDA 2V98A 3I9LA 4PO3X 3UWDA 2P0EA 2C95A 1O95D 2VJYA 4BJHB 3S8YA 1EFPB 2TMKA 3CNHA 1TKCA 4Z54A 2CMHA 1MPTA 3TIFA 3OA2A 2K2WA 1ISRA 1SURA 1C9EA 1M72A 1N8KA 4CF6A 3UK0A 1N3BA 3DFMA 3N74A 1Z2CA 1VL1A 2IYZA 3FKSA 4IWNA 5CJJA 5B1SA 5K4HA 1WQ4A 1KRHA 4HX5A 3WGNA 2UZ1A 2G0TA 4X8HA 3NHPA 4ZV9A 5I8WA 1O58A 1SC3A 2F67A 1I3LA 1PQYA 5AW8A 2WU8A 4MHTA 1Z0UA 2O2CA 2Q6KA 2D1SA 2B2XA 5CT8A 2A9VA 4EPWA 1AQYA 3EBOA 4URFA 1B0UA 1TQDA 1K6JA 1EE2A 2RGDA 3OD1A 1R8JA 2ZJ6A 3G5UA 4LV8B 2HA0A 2BFDB 5SV2A 5C5DA 3FUTA 3DLBA 1DXHA 2QRQA 4G5FA 4LI3X 2NXWA 2AJ8A 2BKAA 3IEKA 4R2MA 3FCAA 5CVVA 4QXQA 3RWBA 1YL5A 1E9DA 3HJAA 4GVXA 4O29A 1E1MA 4Y0AA 3AUUA 3SC6A 3RRJA 3UW1A 3DT9A 4ZTBA 4E08A 2Q7OE 1JKXA 1P9OA 4Y2XA 5ITWA 3SHFA 5AUNB 1PYDA 5K3DA 4ZFNA 4LJ9A 1NVMB 3UIEA 1KMHA 3VZDA 1DBWA 1NLYA 5G0TA 1BSVA 1X39A 2XMDA 4WJLA 1I10A 5BN1A 4IZ6A 2P4SA 1JLLA 5JBNA 3Q98A 3KJHA 2ONKA 3W8NA 2VTVA 4M0LA 5C1PA 1U8XX 1L7PA 2VF2A 1C7IA 1XU4A 4J2TA 5ETJA 4OFXA 5CD1A 3MTBA 3RC2A 5F2OA 3UMSA 3THXB 4P86A 2PX4A 4F93B 3R7BA 3R6LA 2BN4A 1G20A 1E94E 1XLUA 1J2RA 4C9BA 2TMGA 2BFCB 3ABQB 4KU4A 2GCGA 5CRIA 5F23A 2DLDA 4A1FA 1UFVA 3NHSA 3DMHA 3HCOA 2R1VA 3HGMA 3TSZA 5C32A 2BGNA 1AKEA 5EXXA 3AEQB 4OQ4A 2JVIA 1JF8A 2YJ4A 4YASA 4R2HA 4RKWA 3AUYA 5C7LO 4ZP1A 2VTBB 1HF3A 4BBAA 4MARA 1MBZA 3AF1A 2OOSA 2KI5A 4O3MA 4REQA 1NI4A 1PJ2A 2I71A 1BRTA 3HUUA 3ZVNA 2EKDA 4AMBA 1UWVA 3NHRA 1E0AA 5B3AA 1FJHA 1Z6PA 2V03A 3DV2A 2FW8A 3G85A 3KKOA 4JP8A 4EJ0A 5CFLA 4TWZA 2VT2A 3DBIA 5EJ9A 1YMQA 2VAMA 2GR9A 2ZSEA 3KDAA 4TTSA 3K2EA 4I9GA 3PU6A 4Y2GA 1IHPA 2OBFA 2Q2NA 2P1DA 4QGBA 2PL1A 4Z8XA 5JALA 2VNIA 2XJ9A 1C41A 1WCIB 3A4MA 3F3YA 4JYMA 5HDBB 3X1KA 2BBSA 5IS2A 1R8QA 1Z4NA 3I39X 1F4LA 3WX0A 4C6RA 3UMGA 4CM9A 2WUEA 4BO3A 1P1FA 1U28A 4JLWA 4CM5A 1FMTA 3DZJA 1QO7A 3IDZA 2W8BA 3M1YA 1RQRA 3KYIB 4Q1AA 3ZDYB 2NZ2A 3DHNA 2RH4A 2C0QA 4YT5A 4RQUA 1TQHA 4ZAWA 2ZPTX 2DLNA 1NT4A 4BNFA 1Y1KE 2OC4A 3Q3JB 4RZQA 1P7YA 2AJTA 4U3JA 3PEWA 3BF7A 4PANA 1FTYA 5ER6A 1MFPA 2R68A 1E2KA 3FYCA 5IDXA 1FP4B 1IK6A 3PGXA 5HF5A 4ZK2A 5LSAA 2A1UA 2W83A 3KBOA 3NEAA 3PXBA 3T4XA 2RAUA 4B74A 3WK6A 2AZXA 1UBSB 1LUAA 1T5DX 2HK9A 2IXTA 2WD7B 3RGGA 1GG2A 1UBRS 1J0DA 1PT7A 3I45A 3IP1A 1XJCA 5G4LA 4D3FA 1AZWA 4L73A 4LBZA 1C7FA 3JQDA 5BWOA 3C7DB 1KWGA 2F8MA 3MTDA 3ZDXB 1FCJA 4N54A 4N03A 2IXGA 4QUAA 4BV3A 3D5EA 2B6NA 2WFAA 3FSRA 2GVDC 1LV7A 1G3IA 3TGWA 3PUZA 5BSGA 3AR8A 4LWZA 2VQDA 3RK1A 1G5FA 3B3GA 4LCJA 5IH3A 3B3JA 3FW1A 5K0LA 3H4VA 1Y81A 4HTFA 3OQNA 1HLPA 4FCTA 2I91A 4AZWA 1FRVA 3KQOA 3K0BA 4EA6A 3WMEA 3ZGVA 3PL1A 1NYLA 2HXYA 3GP3A 4E5DA 3K2BA 1OW3B 1EK5A 2YWRA 3DTTA 3OOEA 5AHOA 2Y6VA 3P4YA 3SHOA 1PNRA 1IB0A 3GW8A 3ZIUA 3FN4A 4KXYA 4AJNA 4POOA 2AX4A 3QVGA 1Q0QA 2PSJA 4L4RA 4D57A 2H7XA 5LDDC 3W8RA 3JYLA 3FDXA 4ZAZA 3CV3A 3UJ9A 1QCCA 2PH3A 4IIVA 1YOVA 3GT4A 5EPEA 1WXDA 4AXBA 4YT2A 1EYZA 1NAHA 3HZZA 4X93A 1IJFA 3AKCA 5JIBA 4JYCA 2Q45A 2WJWA 3BFKA 3EG9B 3T7RA 3Q9SA 4W8OA 5AKJA 1PSZA 4IFBA 2FSUA 3DB2A 3UBTA 3PZRA 3MF4A 4A2WA 3T3NA 2FQXA 1JSXA 1QGYA 1XZHA 3PP8A 2ZRMA 1X2BA 4RGBA 4E2YA 4EEKA 4HGZA 3AG5A 2XDQA 4Y18A 4BS9A 3FSGA 2NM0A 1XEFA 4IFIA 5JTUA 2ADFA 3HA3A 3ZCQA 3IBYA 4DA7A 3D4OA 3MUOA 1II8A 3G0IA 4MVCA 2WIFA 4NBUA 3DE2X 1V5EA 5BXYA 2WP0A 3M7IA 2PDAA 2PH7A 3P0HA 2G8NA 1PWEA 2HJSA 2NLOA 3UWKA 3NUGA 4OOEA 5BSHA 1N5IA 2E4WA 3DYVA 3O4HA 3OKFA 4DV3B 1DKOA 5CTAA 2CSUA 2DETA 2ALJA 3HVHA 3OCXA 1WY5A 2VRBA 1J90A 3T99A 4HVTA 2XQJA 1DJNA 3ZWYA 2W2MA 3FMOB 3E9ZA 5B7QA 1JHXA 4L3WA 3K0CC 4HWOA 3D6AA 2ZXFA 3OZDA 3HL4A 1L5KA 1W30A 1COWA 4N9QA 1X7WB 2XIJA 1I7SB 4DCNA 2IYLD 2AI2A 3LXUX 3C3MA 3NNDA 3ZW7A 4L8FA 3H2GA 2Y1GA 3RANA 5FADA 2GXQA 4B6OA 1SZJG 1N0WA 2GRAA 3AONB 1I6MA 1SQ6A 1LD3A 2FR1A 4IICA 4M1WA 3IXQA 4JOBA 3FZYA 4HLNA 4LCBA 4OIMA 5KQPA 2ZUUA 1HZZA 1NMSA 2IIPA 3QJGA 1C0KA 1G8GA 4O4IB 2I76A 3AHIA 3WGJA 4DV7B 4DR7B 2P5YA 4M9SA 2X40A 1V35A 5DIZA 5A3SA 2BFMA 3PXAA 4F3NA 4XDGA 3E2IA 2V96A 3U3OA 1NQAO 1VBMA 2EGUA 3T7TA 1IL0A 1CE8B 2FRVA 3S2GA 1N7IA 4BKQA 4HAWA 2F1IA 3C5CA 4H7EA 2O0LA 2R1TB 2VJOA 4V2UA 3DLHA 1MQ8B 1XQXA 1FQJA 4HDRA 2F8LA 3M4XA 2QMYA 1L9XA 2OY0A 3RYTC 2BUCA 2R96A 5BQPA 3PGA1 4BNKA 1S6YA 4LMRA 2ZROA 2JGMA 4NI5A 3OT1B 1FRZA 4M9QA 1HI9A 4FILA 3BULA 4BMXA 4C87A 2HLDD 1GNTA 4B45A 2Y66A 1CJKC 8ABPA 1RIFA 1NBIA 3IDFA 1Q84A 4C4RA 4CHGA 4RHEA 1AQ6A 3JASA 1EH5A 3A8TA 3CF4G 4KQ9A 5AM0A 4J0EA 2Y1DA 2WAMA 3GOHA 4D9NA 4EITA 4QJ4A 1G20B 1SKMA 3WP0A 4XPIB 4ESVA 3NTOA 4K2HA 4IQ8A 4CMJA 2LPMA 3ETGA 4J1QA 1O94D 2I2CA 2GCNA 1FFSA 3SKYA 1QMPA 3KWLA 4BMVA 2FQ1A 2HRCA 1QJ4A 3FA2A 3NTLA 1DKPA 3U60B 1Q1NA 4ZKDA 3L82B 1W52X 4IXWA 2I3AA 3ZWWA 1GCUA 3D9QX 3SXUB 3WO1A 5IJ0B 1TRHA 1SCDA 1OZHA 2Y0CA 3D6NB 3RJ9A 2JD2A 2HSDA 1IZZA 2PKWA 1ZLYA 1EA7A 1KI6B 2Z9DA 3T3HA 2W4MA 3IH5A 1CEEA 3CW2A 3WYCA 3TS1A 3GLGE 3D1LA 2WIBA 3HDTA 1RYNA 3FNEA 1Z0FA 1XO1A 1V8PA 2WG2A 4GRIA 4JLBA 4EB0A 1OD6A 3BK7A 4U7TB 1LNZA 3CVUA 3LK6A 1DX6A 2D0PB 2FPIB 1YBMA 2NOAA 3CUWA 4GGOA 3CLRC 1GA1A 5ARDA 4DWJA 4LFAB 1SXIA 3G9TA 1QP0A 3UH1A 2H2AA 4PE5B 4M86A 3SAJA 3AY3A 4C04A 5KX5B 3TGLA 3V4RA 1E3DA 4BVFA 1OXUA 2VHCA 4MI6A 4RA6B 1T1SA 1U3VA 1AVTA 4R2WA 1M34E 3REQB 3IVXA 4ZEOA 1Y7TA 2PX5A 2QU8A 2XMQA 3V2UA 5CA1F 3NCTA 2F9LA 1UBEA 5EZSA 2DWPA 5LMZA 4W6QA 2YWGA 1ZCZA 3I23A 4YQYA 3N2EA 3C3DA 4NYJQ 1K8RA 1G3RA 1Z7EA 1E6MA 1XA3A 3WMWA 3UOAB 3TSAA 5HFJA 1Z9BA 1S7GA 1MH9A 1ONBA 3H05A 1ABEA 5A4AA 4R1UA 1E2QA 2WJHA 4OHBA 2O8DB 3OF5A 3ND9A 5P8WA 1G4HA 3DEIA 4XFDA 3OPYI 3F6PA 1U65A 2O50A 2JDID 2Q3JA 4LIPD 4WLFA 2B5WA 4GKAA 4IDCA 1E0JA 2QVZX 3OC6A 4CLOA 3AQIA 2KB0A 3L1HA 4JT8A 1E4YA 4RESA 4C3OB 1IN5A 3EVGA 4HZUB 4DCOA 4ZPJA 1I2CA 1MVLA 4LYFA 4EJSC 3UK2A 4Q34A 3W5DA 4RHFA 4QEKA 2DKNA 2UDPA 1N0UA 2XZTA 1JUDA 3GRKA 3NVDA 1J2EA 1GL6A 1UK9A 2XQKA 2BRUA 621PA 2ZTSA 1VJ0A 3NRJA 4DUGD 1P45A 5DYTA 1I9GA 3BEOA 3ENNA 1YB7A 4GX1A 3U17A 3WHPA 2IUEA 5AW9A 3A1NA 1M8KA 3KOYA 5AKZA 3WP1B 3PK0A 1WCWA 3E3OA 4IHAA 4OYYA 1KP3A 3O1JC 3LDHA 5AUQA 2BMDA 4RWEA 2VAVA 3U3MA 1CVRA 2DTDA 2Q1WA 3CN9A 1VE1A 3FFTA 2QD3A 2YWDA 3GJ7A 4JB2A 2WAXA 1VBKA 3QW2A 5AI4A 3TBKA 1YZLA 4D9FA 1UXKA 3SYMA 4ZZ0A 5CAEA 3KQMA 1QIJA 5AT1A 1A72A 1Z2OX 3VUEA 4Q05A 3UK7A 4I4NA 2NYVA 1C7RA 3TJRA 2PV0A 1E9AA 2O3TA 2QJTA 2K4MA 3QQ5A 3L79A 3V97A 1V43A 2YOHA 1MV8A 3ND5A 4BNVA 3SOZA 3R5FA 3UMRA 1W44A 5H9WA 1PV2A 2LKDA 5HCNA 1GO2A 4F92B 3C6BA 3ZZ0A 2D06A 2IX9A 2QXYA 1N1EA 3QIVA 4ZO7A 1IH8A 1K97A 1OLXA 3JQBC 3PPYA 2GK3A 3E23A 4JS0A 4JYPA 5AJYA 3RAGA 1M2OA 3O2SB 1LK0A 4UM5A 1QNLA 3CXUA 2AF4C 3ODGA 3PHBE 2ZDQA 1NRWA 4P4GA 2H1RA 4NARA 2CLKB 1E5QA 4E46A 5FL7D 4KXLA 1GKUB 5AUPB 2OFWA 1J2TA 1P2TA 3A1WA 1SBTA 4PXAA 4QOGA 1NXSA 1J09A 1VI5A 3SXUA 4KV9A 1U2DC 4B6RA 3FPEA 2AYXA 5LN1A 4FFWA 1BQEA 1RRCA 1MEOA 2CFTA 2XMBA 3D6JA 3ZWOA 4EQ6B 5JSZA 4TTJA 2QY6A 3C2QA 4XH9B 3WQBA 2VHXA 3HSSA 4BFWA 3SQXA 2C4HA 1I3CA 5AK0A 1CRZA 3EZ2A 4DSNA 2HI0A 5GVSA 1I1HA 3MJTA 3SYTA 3JQPA 3NHKA 3TB4A 4RH1A 3AR4A 5SYNA 4LKOA 1I2DA 4ARCA 5LOVF 4YUZA 1N6PA 3FZEA 1YGPA 2C9BA 1NE2A 1WW3A 3HJGA 4TVBA 3VNRA 4G4SP 4V3BA 4D56A 1T4GA 1VG0B 2FA9A 5BW6B 1O97C 3E4CA 4X1KA 2COKA 4QPPA 1NXQA 3RC9A 5KYYA 5D7BA 2V3CC 1EINA 1IAVA 3EZNA 2WF9A 4NXMB 1LJUA 2FZVA 2XITA 1R6DA 2OBLA 4O6VA 4FT2A 1YO6A 1OA0A 2O2JA 2JGRA 3U19A 4MR7A 2GAJA 2C4MA 1OI4A 1OX4B 2O23A 2VHUA 1ZJYA 1E9BA 3ZXIA 3O3NB 3ROQA 2CLHB 3H99A 1C7JA 3I5UA 1MQSA 3GT0A 1KYXA 3PR2B 4EPVA 3IO5A 1A9YA 1GVHA 1W1WA 1E9FA 1Z0ZA 2FWMX 3CX4A 3HY4A 3EBLA 4C3UA 1ZNQO 3OTQA 3DBHA 5DT9A 3O73A 2VHWA 5DXAA 2ZXEA 3QYPA 4FT4A 1U02A 2J6BA 3IHWA 4RYLA 1L8XA 2OM2A 4DCPA 3BF8A 2H8GA 2ZUEA 2WINI 5EIOA 3W1WA 5JI2E 1MO3A 2QRMA 5FA5A 2C4KA 3R0VA 4R5HA 4JY7A 3MT0A 5NULA 1YV9A 5C52B 1LQUA 3DDHA 1IM8A 1PT6A 3GRFA 4XZ3A 1E1RA 1ESMA 1GN9A 1ATIA 2FSVA 5KINB 3F3SA 4TN1A 1WXHA 3P2IA 5MN4A 1PQPA 1SR8A 1S1MA 4LVUA 2AG6A 4J9VA 2SECE 4NFLA 1T8TA 4CM7A 5EIEA 3B12A 5TT0A 5IYZF 5E3HA 4WZAE 4II2A 1Z0JA 1U0LA 2E4YA 2P68A 2CYCA 9GPBA 5I4BA 3KIPA 4TRJA 1ZNZA 1ZM4A 4LV6A 3ZWNA 1EFVA 4DBZA 1XQ6A 2XVXA 5DIFA 2I7DA 3W9UA 1H9CA 1MRNA 4GBJA 2IC5A 5CEEA 4IIJF 3O1LA 3OJLA 1VCIA 2CHFA 4M0PA 5A03A 2BTOA 4QWMA 2I6GA 4A2QA 2W2LD 3REQA 2GEUA 3IDQA 4AP5A 1RM3A 1YCHA 5D8DA 2QDKA 2NYRA 2V7BA 4QUBA 1O03A 3NS7A 3PDCA 4UULA 1JQ3A 2NYAA 2QRLA 2GFQA 3A36A 3FPLA 1IDN1 1Z28A 1L8OA 3ESRA 4X92A 5JYCA 4LJRA 3DUWA 2ZUTA 1RC0A 4Q48A 3NR2A 2EDAA 3VDMA 5JWOA 4P9NA 2Z56A 4KXXA 3KUXA 4MKZA 5G02A 1VKHA 3PXUA 1RKXA 1XQ1A 1QPZA 5CVTA 5I9SA 5K01A 2B25A 1J23A 1HG0A 1YHNA 1W8DA 4W63A 1N1DA 2CBZA 1XCJA 5D3MB 1VRCA 4PS0A 5DSXA 1KI6A 1V8OA 3ZU2A 2OHIA 3P9NA 3NPMA 4M87A 2ZRNA 4XD7A 4C7MA 3DE4X 4Q3BA 1KI2A 2R3SA 5UKDA 3HJTA 3CR7A 3L6CA 2VQ3A 5IJ0A 2PUEA 2VYND 1WW8A 3O8QA 4Q3OA 1NVDA 2KLBA 4MV8A 5E4JA 4RKYA 3TG2A 3T7EA 2R8ZA 1WUIS 3B8HA 1D0IA 1VFPA 1KYYA 1NXOA 3F7TA 3RTDA 1BH2A 4UFPA 1JSRA 4BX8A 3AUJB 5EIBC 5I7FA 2JAQA 2GEBA 3B2EA 3DD1A 4L72A 1OVGA 4QBFA 2OPBA 4WRRA 2B6HA 2YIMA 3B36A 3LUPA 2KS6A 3ZVLA 1BHO1 3JQAD 5ER9A 2Z08A 1LRJA 3RK0A 3USCS 3KXDA 1LY1A 1ZBQA 4XGQA 3GLHA 4XR4A 1O96A 4R8VA 4CKBA 4EG0A 4Y1EA 4H7FA 1KEPA 3CT6A 3VU1A 4LOLA 4C76A 2FWBA 4TTIA 4IUYA 4P3PA 1NUHA 5KHOC 2Q6IA 4QU0A 4O0MA 5CCDA 4BAUA 1GUFA 3UAXA 1Z08A 2XSZD 4AAYA 4AUMA 4JL6A 5JD3A 4KQIA 1XA0A 5JTTA 5KTTA 4OJKA 5L9AA 4ZCQA 2W2PA 4JJZA 2ZYUX 2P9JA 2OCXA 4K3VA 1T26A 4RLHA 3COJA 1T9DA 1X80B 2IYQA 2XODA 5GGXA 2R79A 5C53B 4BV2A 3Q8KA 1ZUNB 1TJ5A 2RHJA 2X9NA 5KNBD 1DJPA 1XYYA 3G59A 3H2HA 2BCJQ 4ZCSA 4R9UC 5IC5A 1N78A 4XGRA 4P3OA 2P6RA 4YJKA 4MCIA 1XZFA 2VJDA 4W82A 1P3DA 1FDOA 2H2WA 3CTPA 3T4EA 1JE0A 2C7RA 3LT1A 4YRDA 4C4ZA 1QTQA 3RYHA 3PE4A 2LDBA 4ERXA 4AB1A 3EF3A 2UUCB 1XNRB 1LDNA 1NLZA 3KHTA 3TTVA 1UP6A 3BTVA 1YIOA 3EWNA 1Z6GA 3NHMA 3IAUA 4HMQA 1YSCA 4OQMA 5J43A 3GJSA 4EG8A 1TK2A 3I28A 2FW9A 2IU4A 3TAXA 2Q3LA 5DXFA 2VUIB 1VMEA 1GL3A 2JL1A 5BXQC 1I4EB 1X8JA 1P7WA 4QDKA 3D3NA 2MSLA 1KL7A 3GLGA 3OTOB 2L42A 2J3HA 1Z6TA 3D8TA 3K0FA 2WKWA 4P54A 2J4CA 3GUZA 5ERYA 3ZDEA 4CQMD 1NVAA 3ZI7A 1Z3CA 1TD1A 3DVLA 3IQFA 1VPWA 1UBMS 2XUIA 1JNYA 4UTZA 1HDOA 1QAQA 3PTAA 3F9RA 2M6RA 2WHRA 4RIIA 2AHRA 5H16A 3SK0A 4PONA 2ZKIA 5D3ZA 2X2PA 1TKAA 1IN7A 2QXTA 4HDKA 4H1WA 1HQDA 1P7CA 1CQJB 2Q21A 2VH1A 1O6FA 1NRXA 2AEFA 4ZRNA 1C9MA 1B1CA 1JZSA 1QTNA 3BL8A 3P32A 4PC3A 1JDBC 1DE0A 3L6BA 4MVJH 3WB1A 1PCXA 1W88B 1P4HA 4JLSA 4LYDA 4I1SA 3WGMA 1QZ3A 2INGX 5JS8A 2JIDA 4P35A 1FDSA 1PFYA 2DP4E 3L0YA 3O4RA 3IP5A 1E96A 4RKFA 4Y2RA 4DRXA 3LXRA 3SI7A 5BPHA 2XBLA 2PSFA 2QPAA 5GM2A 5AVXA 1N0IA 3PDJA 1XZAA 4C3ZA 4UPEA 1XRMA 1JALA 4X97A 2GM3A 4JR2A 2HMUA