3L8FA

Crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli complexed with magnesium and phosphate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
183
Chain Sequence
SVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
publication title Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 183
sequence length 183
ec nomenclature ec 3.1.3.82: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l8fA00
3U7HB 2B0CA 2HO4A 4NAVA 5AKJA 4UASA 4XOUA 1N8NA 5ALUA 4EZEA 3OTQA 4BX3A 2FPRA 2VKQA 5T41A 2CFRA 2YJ4A 3ZTYA 4BEVA 3QU4A 1U02A 3E8MA 1Z4PX 3A1CA 3ZVMA 4FYPA 3KC2A 1SWVA 1MH9A 1YS9A 2G09A 4L57A 5ALZA 4L6AA 1SU4A 3P96A 5ALHA 5AVUA 2MSNA 3DDHA 3J7TA 4BBJA 1RMQA 3DAOA 3ZX4A 4YGYA 4RETA 2HSZA 3MPOA 2AH5A 2IOFK 3AR9A 4BYGA 2RBKA 5ALOA 1WZCA 2HCFA 4KYTA 3OCZA 3ZVNA 4OCZA 4UAUA 2CN1A 3N28A 4ZEVA 3U19A 3PCTA 1QQ6A 1T9ZA 3W5CA 5ALFA 2ZXEA 3I76A 4KX5A 2IYEA 1Y8AA 4CE6A 1RKQA 4UMDA 5AKLA 5AKKA 1ZS9A 3NUQA 5ALNA 4Y2RA 3W5AA 3B9RA 2ODAA 3N8GA 4HGOA 3UMBA 2X4DA 4Y2TA 4AS3A 2ZG6A 2C4NA 2O9JA 3BA6A 4BNDA 4YIKA 1Q91A 4E88A 3MC1A 3FGOA 5AESA 2P11A 1ZD2P 3E58A 3I6BA 4Y2QA 2WF9A 2W11A 3QU2A 2W4MA 4H1WA 4OD0A 4UW9A 1YDFA 2WM8A 5AVTA 5AW9A 4CF3A 1RDFA 4OHFA 1QH9A 5ALXA 4F72A 3QUTA 1RPZA 1T5TA 4ZEWA 4UM7A 2JAOA 5AKGA 2WF6A 5AK5A 3SKXA 3SMVA 3ZVLA 3KOOA 3E84A 1U7PA 2CFTA 2PKEA 5ALLA 2FPXA 1RMYA 3PDWA 1YNSA 4DFDA 4F71A 3AR3A 2WHEA 1VJRA 4MWOA 4UMFA 3B8EA 3HYCA 3OCYA 3L1UA 3R09A 3ED5A 4KNWA 1L7OA 1LTQA 3WK6A 1ZJJA 2G80A 3U7GA 1TA0A 5ALGA 4AS2A 2G0AA 2QLTA 5ALJA 4NV0A 4HGPA 2YJ6A 5A3SA 3WKBA 4UATA 2P27A 4AP9A 4NWIA 2FI1A 1L6RA 4DWOA 4QQFA 1RC8A 3ZX5A 2RAVA 1Z4NA 3E81A 2I33A 3CZ4A 2G06A 3UMGA 4JDPA 1NRWA 2GHTA 1ZRNA 3QNMA 3ZW7A 1SWWA 1Z4IA 1QQ5A 3L5KA 2YJ5A 5AI4A 5A3QA 2PQ0A 5AW0A 3RFUA 1Z4MA 3SF0A 3L1VA 3OCUA 3A3YA 2WF5A 1RQNA 2OM6A 2I6XA 1L7MA 4BKMA 4L6CA 4CNQA 5ALQA 4YH1A 3L8GA 5AKXA 2D2VA 5AW5A 1Q92A 3ZU6A 5AM4A 4I9FA 2Q4RA 4EENA 3F9RA 4EX6A 2OYCA 4IFTA 2BDUA 2GMWA 3A1DA 2EAUA 3WK5A 3U7EB 3U7FB 2ZBGA 2HF7A 3KZXA 5AM1A 4MUMA 2G08A 2CFSA 2BDEA 3WGUA 5AICA 2YY6A 5AI9A 3R9KA 5AW6A 4JB3A 5AVZA 2C88A 2O2XA 5AW3A 5AI0A 4FFDA 1YV9A 4BX0A 5JJBA 3ZI4A 3M9LA 1ZD3A 3ZWKA 3L0BA 3U13A 3TLMA 3OPXA 1AQ6A 3DNPA 1Z5GA 1QQ7A 2Q4TA 3AR6A 3AR7A 1EK1A 1KYTA 3QX7A 2IA5A 3QU9A 3L8FA 3QU5A 4UU0A 4GXTA 3DV9A 5AW1A 5AI6A 3ONNA 4CF5A 4XQ0A 4J03A 1K1EA 5AHXA 3EWIA 4FE3A 3KBBA 4EELA 5AW2A 1Z4QA 4DCCA 3SLRA 1S8OA 3NALA 4RESA 3OCXA 2HDOA 3ZTWA 2AGVA 3L8EA 3W5DA 1PW5A 2ZBDA 2G07A 3HLTA 5ALTA 1YJ5A 3EPRA 5ALEA 4OFZA 1F5SA 1Z88A 4Y2YA 3FM9A 3I1YA 4HGRA 2QYHA 4G63A 1WPGA 4YCNA 5AW8A 4UU1A 4Y2UA 2EATA 2YMMA 1RMTA 5AW7A 3W5BA 4KX3A 4Y2JA 1U7OA 2FUEA 5ALMA 3WKEA 2YBDA 3KDPA 2HF2A 1Z5UA 4UM5A 3SKYA 1TJ3A 1RRCA 3SD7A 1ZOLA 2JAUA 3MMZA 2YN4A 1CQZA 1S2OA 4EEKA 4YCLA 2R8ZA 5ALRA 2C8LA 3ET4A 2OBBA 5AVQA 3GYGA 2I34A 2JARA 5ALWA 1RLMA 1L8LA 3EF1A 5ALIA 1Z4LA 3IB6A 3ZUPA 5AVSA 2HX1A 4UAVA 5AIAA 2BY4A 1L7NA 4NABA 5ALSA 4UMEA 1XP5A 3FVVA 3RF6A 3WK9A 2OA0A 4C4RA 1O08A 1ZRMA 2R8XA 3IJ5A 1IWOA 3U26A 1JUDA 1L7PA 1FEZA 2JAWA 4EX7A 1J8DA 2NO4A 5E0OA 2NYVA 4UARA 4ZEXA 5A3RA 2FPWA 5ALVA 5AK6A 1U2TA 3QLEA 2R8YA 3PGVA 4XPZA 2EARA 4I9GA 1TE2A 2WF7A 4KNVA 1NNLA 1U2SA 3EF0A 5AK3A 1WVIA 5AM0A 5IT0A 2P69A 3ET5A 2FUCA 4PNHA 2HI0A 1YMQA 3N5KA 2GFHA 1TJ5A 2B30A 2B8EA 2DQSA 1CR6A 2WFAA 2R8EA 3PGLA 3L0CA 4HAIA 3WK4A 4BX2A 2C8KA 3I28A 5AVWA 3WKAA 4HGQA 2AMYA 3L7YA 4NFLA 3NRJA 3AR8A 1NF2A 2I54A 3WK8A 4G9BA 5ALPA 3OCVA 1L8OA 3FPBA 1X42A 3B9BA 2B1RA 1RLOA 2G1AA 2GO7A 3AR4A 3N07A 3QXGA 5AKZA 3QUQA 3OCWA 1XVIA 5AI8A 4DW8A 4O8CA 1O03A 5AK4A 5AM3A 1Z4OA 4BEWA 3WK7A 1T5SA 4GIBA 1ZD4A 2NO5A 2GHQA 3QGMA 4UMVA 1ZD5A 2B8JA 3QUCA 4Y3UA 2FEAA 2YFYA 3N1UA 3R4CA 4C4TA 3S6JA 4QJBA 1RKVA 4Y2XA 2P9JA 5IT4A 2Q5EA 3L8HA 2YJ3A 1J97A 1QYIA 2B82A 1Z4JA 2I7DA 3NIWA 4Y2SA 1Z4KA 2FDRA 2YMLA 5AI5A 2HEGA 3NANA 3D6JA 4J2TA 3L0YA 2IOHA 3ESRA 2ZBFA 3AR5A 1N9KA 3AR2A 3ZWDA 5FP0A 3A1EA 4Y2PA 5AKIA 3VAYA 3NASA 2HOQA 3ESQA 2YMQA 3CNHA 1VFPA 5AKYA 1TJ4A 5IS2A 5AKEA 5AM2A 4C4SA 2ZBEA 5AVVA 4Y2VA 4BNDB 5AIBA 2FPSA 4HYTA 5AKHA 2HHLA 3SHQA 3WKDA 1RLTA 3UM9A 4CF4A 2RB5A 3IRUA 2I55A 2IOFA 2JGAA 3NAMA 4B6JA 2MU1A 4HGNA 2YMPA 3UMCA 5AM5A 5ALYA 2B1QA 2FPUA 1LVHA 2AUTA 2ZOSA 1RKUA 3BWVA 2RARA 5AVXA 4XE5A 5AVYA 4KN8A 3KD3A 4YCMA 1XPJA 3QU7A 3K1ZA 3WKCA 2C9MA 4IG4A 1EK2A 5AVRA 5ALKA 3FZQA 3WGVA 1RQLA 3FPSA 4YIHA 2WF8A 5AW4A 3M1YA 1VJ5A 2W43A 3MN1A 2PR7A 1WR8A 5ALDA 3QUBA 3QYPA
chains in the Genus database with same CATH superfamily
4BCCA 3RSFA 3SFZA 4NAVA 1G6HA 1IEWA 4C03A 3RI3A 1DC3A 3SQDA 3LA6A 4H6VA 4UASA 4B3XA 1FL9A 1VMIA 1KOFA 1U1FA 1X9HA 5LZ5A 3W9UA 2DLNA 2W6ZA 3ZNPA 4C2BA 1L7BA 2XUQA 4OXIA 3WWCA 4Z4EA 4PYKA 2JKZA 2B69A 1LX7A 2FF7A 1AK9A 1JHQA 5KNDD 2PJZA 1L3IA 1HQKA 3KTDA 4I50B 1PWZA 3KC2A 1H2BA 2XI4A 3A3OA 1EVJA 3OQ6A 4NQZA 4P3PA 5DGXA 3VFDA 2G09A 5J4YA 2IV2X 3K2QA 3EMDA 1RRMA 4Y6OA 4ALNA 1SVKA 4RY8A 2HMUA 2I4IA 4H16A 5G40A 5JISA 1Q0QA 2A3RA 3KLMX 3PU6A 1BFUA 3QMPA 3BHIA 3RKSA 4CDGA 3MILA 3M70A 1WMAA 1E18A 4Y18A 4Y6PA 4B45A 4DMLA 1XRLA 1IHUA 3KPYA 4PPNA 3UMVA 5LVAA 4MWDA 5HR5A 3TUIC 6PFKA 2JGDB 1CXZA 1C41A 2PANA 2NU9A 4I4TB 4IIJB 4KYTA 4O59O 6GPBA 4UAJA 5H4HA 1ZUHA 1MIOB 5CGZA 4M7PA 3TGWA 5HXAA 3K53A 1T0JB 1MQ9A 1NFFA 3OLZA 4YP1A 4I1IA 1ISFA 1QC5B 5JCOA 3FF1A 4LV5B 4CE6A 4JN6B 1RYHA 4DT1A 1AV6A 1JQAA 2LNDA 3EDOA 4AZ0B 1YSCA 3OEWA 2FPGB 2B8NA 2ASVA 2GI4A 2J8ZA 2W2PA 4B48A 4RTPA 2H07A 3WGHA 1YOVB 4RGQA 3RT1A 5KSZA 5FULA 4DV1B 1LS1A 3D0KA 8AT1A 3IKJA 3A4YA 1J33A 2JRLA 3RHZA 3L0OA 1QHYA 5TS3A 1PN3A 3RYHA 1M6VB 2OD2A 1ZD1A 2JI8A 2GX6A 4JLNA 4I6EA 2H6EA 4B85A 2BGGA 2QV7A 4QFDA 2GASA 2GKGA 4HFRA 1RZUA 2JGEA 2CVHA 3M33A 4N3CA 4F8YA 1ZD2P 4HDRB 4B3DA 1P4RA 1M0EA 3GLSA 3K0KA 3SHWA 1FYEA 3K6KA 1M2OA 4FMCB 1LDEA 4JJGA 3VO8A 5HQ3B 2EFCB 1M8PA 1N0HA 2W2TA 4GHWA 4QLOA 4B74A 1KSJA 2A84A 3H5VA 4IDOA 1U4SA 2R6HA 4XQGA 2EWWA 1NKTA 2ECPA 4I81A 4MWSA 3QUTA 4RHXA 3WRXA 1RPZA 4AI6A 2XRMA 3TIGA 3JWJA 1T5TA 2J9RA 3BD8A 1MQAA 1KGDA 2EFJA 4AB1A 2F1RA 4KB5A 4NBWA 1T36B 4REQB 2QMZA 4L6IA 4DCMA 3QWHA 3VHQA 4PHCA 1IY2A 4EJ2A 1UKZA 5KX5F 1KVSA 3BEDA 3DKKA 4M0DA 2PXHA 4YMIA 4IHAA 1OZFA 1KKMA 2NUPA 2GZHA 2GAOA 2J6HA 3BN3A 3DMFA 3ETCA 3N8NA 2ZAMA 3QVUA 4E5KA 2NZ2A 1S0UA 1TUGA 4WXPA 1CHNA 4F3NA 1EBUA 2IYOA 1CZLA 4NZZA 2J3KA 5IAEA 2BGKA 1YGYA 1F5NA 3EG9A 3KM0A 4XB1A 1LUAA 1SUCA 4YLEA 1NWCA 4ZJYA 5CX1A 5GVSA 4D9CA 1EP2B 3F8TA 1Y3FE 1W4ZA 3IDZA 1UM9B 8OHMA 1S02A 3N2IA 1OIVA 4RJJA 1BNCA 4CT0A 2OCKA 1PNTA 2VHXA 3MTDA 3V8PA 4PBSA 3ZI0A 2H9AA 2DPHA 1XJQA 4HAZA 1KBQA 3IQDB 1WMDA 3DW3X 4JIMA 3VH2A 4DDUA 1H42A 2PT7A 3GCGA 1CJBA 7ADHA 1E0DA 2V9CA 4MR8A 1N33B 2Q6VA 4NNPA 1BE0A 4AP9A 5KU1A 2R1TB 4NWIA 5K0SA 4BVLA 3EIFA 4IQ8A 2WKWA 3VTKA 4INZA 1RC8A 2CNOA 3QMWA 1BXRA 1GRVA 2G77B 1FYFA 3CZCA 3PQ6A 5KYYB 1SHZA 4PU0A 3WX0A 1JSCA 1ULTA 4DSOA 4EW1A 4OHWA 2VBGA 3WXBA 1Z5OA 2ZVQX 1W46A 1F8XA 2Y92A 1ONOA 1X87A 4B7XA 2F8LA 5JHHB 5KYXA 2J09A 2Q1XA 3J7AC 2VWGA 2AUNA 1MC5A 4YQFA 1REQA 1L9KA 1YQWA 4ZZ1A 4DREA 5D1NA 4CEHA 1SVLA 2W37A 4X41A 2OO3A 1JEAA 2ONCA 2BOVA 5AXAA 4BTLA 1B6GA 1KZ9A 3QMMA 1JPNA 3N6XA 1A4IA 4D81A 1XRQA 1UBOS 3U0VA 4LF9B 3SE7A 2J3QA 4HPJB 3PNPA 3PQEA 1S3SA 4ZQBA 2V0CA 2JIZD 2AW3A 2X1LA 1XXLA 2N0SA 4GZ6A 4IFBA 1EE1A 2XYVA 4EHLA 4DLRA 4JLSA 1FQJA 1R4NA 1TJPB 4KV7A 4NPCA 2IHKA 5K2MA 1IM8A 5EJ2A 4CUKA 4L73A 4X6XA 1VE9A 5TSDA 3U39A 2GN1A 4DR6B 2ICAA 5IJWA 3R6WA 3W6NA 5JIBA 2AOUA 3KZXA 1L5NA 3VR6H 4X3PA 5BSTA 2ISSD 2SKEA 2XWPA 1K7CA 3TNLA 2FEKA 4Q0MA 1MJGA 3QTBA 4B81A 3QKIA 4M76B 2VYND 4O2BB 3HN7A 5KDDA 1L0BA 1SIOA 2XNDD 3DP9A 1QQAA 2QLFA 5T3UA 4G4SO 4B2YA 1G8SA 3L8ZA 1CUCA 3NCTA 4NBRA 4LXXA 3NT2A 1JDVA 5BWOA 1D2NA 1BFKA 1E2FA 2ZPTX 2M6KA 1I3NA 3IPLA 4I55A 3U3DA 3IV6A 4DARA 5TJHA 4HEJA 2DR2A 2PWZA 4RCYA 3W5IA 4C6RA 1KI4A 4D82A 4F7DA 1B0ZA 3RYTC 2NZ8A 3R0ZA 5B64A 1YWGO 1P80A 1YZYA 4NP6A 3ZHSA 2FMHA 3OJCA 4AY4A 1BJKA 2HT1A 4MHSA 1V39A 2XYHA 2QPTA 2IA5A 2QTFA 1EA5A 1U0RA 2TSYB 2AVNA 3NJ4A 3BEOA 3SF8B 1UZMA 1YS2X 3OQHA 7ABPA 1R1DA 4TTIA 1NFRA 3IVRA 2EGUA 4YK7A 5E1OA 2YQ5A 3D9QX 4L4UA 1J56A 2MINA 5DNDA 4AC9A 2CYAA 3E1KA 3L6RA 1L5SA 1XEAA 1L6IA 1U94A 2WHPB 3A31A 3EWIA 3Q6MA 3RAGA 2OORA 2QVXX 1J8VA 1ODIA 2DH6A 5G4KB 5LWHA 3NBMA 1GAQA 1Z6AA 1FCJA 3F7OA 5C1OA 3DO5A 5HMLA 3OCXA 1EUYA 2P79A 4ADSG 1APBA 1KERA 4JJ4A 1KSFX 1CLUA 4YV7A 2I2DA 1GA1A 2HSWA 1YRHA 3GEPA 1TPYA 4PPGA 3VNSA 1FZTA 5KJEA 1T5DX 2WB2A 3FPAA 2QL9A 4CG3A 1W44A 3LTNC 1AA6A 4V0KA 4IYJA 1B8VA 4W82A 4KKVA 5IC4A 2OFXA 1T9AA 4DLPA 3ICEA 2PAAA 4JZKA 4FLMA 4OH1A 4UNNA 3WGOA 2OZLB 3E1GA 1DAIA 3OUUA 5A3JA 2AZXA 1B26A 1NFQA 2ZXFA 4EG3A 1XSEA 3B5EA 2H11A 2RJNA 3O0DA 3G2MA 1YR3A 1WP4A 2BE9A 4LJLA 4QU0A 1RHMA 3OOSA 3QF7A 3CIOA 5D7BA 3VUFA 5EKTA 1QX4A 3DC2A 3WKEA 5JNUA 4MRNA 1FP1D 4FWIB 3EXHB 1YK1A 3ILSA 1MOSA 3AEZA 1BGWA 5DTQA 2F4VB 1XFAA 3QV2A 4HYQA 5J1SB 2D5BA 2R8RA 2XB9A 2R8ZA 4Z6KA 1M2VB 2DHRA 2IPNA 4B3HA 1H2ZA 4E6PA 4IOMA 2PZFA 3KTOA 1E6CA 3HB5X 4CFYA 2G9NA 4ENVA 2ZLBA 1U0BB 1G2OA 3FN4A 1M34E 1RLMA 2PRSA 3OPMA 4ARSA 1N0UA 4K6KA 2EV9A 3SC3A 2CL5A 3K0AA 2JFPA 3CMMA 3FCUB 1OGYA 2OAEA 3DM9B 4YXFA 2VBFA 4FT4A 1VGVA 3RK4A 2K87A 3O8CA 4O4HA 1QPZA 1DKOA 1TUIA 3HBLA 4FFRA 4QRHA 1TUBB 3VZCA 3GF4A 1WPXA 2NYRA 3NT5A 3NKVA 1DDGA 1DJMA 1SD2A 1QH8A 1FK8A 1QYRA 1ZRMA 2NVBA 2DPYA 2RE8A 3D6FA 1QRAA 4G5OA 1Q3HA 4PFQA 1Z5ZA 4QOIA 4RELA 5KINB 4F3RA 2FGJA 4BB9A 5FLKA 1II0A 2KW5A 3VPFA 1JUDA 2NTVA 5TS2A 4R2WA 3SJCA 5JXWA 2IITA 5F2OA 2QGZA 2Z3WA 5KQSA 3UHAA 3NWOA 1GZ7A 1VJ0A 3MF4A 3ZNQA 3FWPA 3K09A 4PYMA 5JROA 4M1WA 3G0OA 5FQOA 3I6ZA 1QVVA 1H2YA 1GSAA 4ZOEA 3P9XA 1UP6A 4R2HA 2PUDA 1I01A 1ZNQO 2WWHA 4K9DA 4P86A 2JJ2D 3RU9A 4GP7A 4M1KA 5C3MA 2E5WA 4L4RA 3DL0A 4DUGA 1JDTA 1JJBA 3H5OA 5BSMA 2E82A 4S3MA 3GBSA 5HP4A 1H93A 1QZ3A 4FW9A 4FYMA 1R16A 4K5QA 1D4OA 4FB4A 2BKVA 1C9DB 2HN9A 3GJZA 4PNHA 3O1LA 4F3YA 1YMQA 2GBLA 4OQMA 3OHSX 3WL7A 5KYWB 2FB9A 4G1FA 4IR7A 4QYWA 5KVAA 2FCRA 2BELA 3GGCA 3ELDA 4HAIA 3MGCA 4C0QC 4DHWA 5CFOA 4PCAA 2HIHA 1SD5A 2HDNB 4BBAA 3I28A 3TRDA 1U5CA 3L7YA 3WLAA 2WRZA 3HTXA 1U0GA 1MA3A 4IZOA 2RGCA 4FCWA 3AR8A 4YRCA 1GUFA 1HTWA 1RYBA 2A92A 2CDCA 2RBGA 2ZYUX 3LLCA 1NJ1A 5AR1A 4D43A 3DPIA 4X45A 4DYVA 4X7BA 4G8JA 4MVJP 221PA 1OTHA 3M1YA 4GWGA 5KPDA 3GJ4A 5HFAA 4UD6A 1AUOA 1GL6A 1NXTA 2VSOA 5BMVF 1B15A 2B9VA 2HJRA 1Y9DA 4URFA 1XVIA 4RKWA 2C4UA 2F7SA 2P62A 4O8CA 4E33A 1IBLB 4PC6A 4BMVA 3EJWA 3EQ6A 5CLHA 2A5YB 4FLEA 3TQSA 4R31A 2V3CC 3CCCA 4ZVNA 4HDCA 4ID3A 3WK7A 1KQNA 3NHBA 1AGNA 1IUNA 2I6TA 5AUQA 1F2DA 5K0LA 2QP9X 1ZVQA 4DLVA 4EUKA 3QGMA 4N39A 2CC2A 1QGDA 3JPWA 3ZBUA 3DMDA 5MGBA 5FBWB 5DW3A 3KOMA 4M6WA 4E4YA 4HY3A 4C7OB 3LAWA 3QUCA 2B4AA 4DJJA 1CUBA 6ABPA 5ISMA 3RUDA 4YAEA 3ZGLA 5F2EA 4WBXC 2KJQA 3E9EA 5B3KA 4KIUA 1T3SA 3VR2D 4I6JA 3BDVA 4UJ3A 2FV8A 1IL0A 4IRXA 4RLFA 1R2QA 3TLYA 4H60A 1VMDA 1VCOA 1H05A 3D6JA 3MUFA 5B2ZA 1BH6A 1ONNA 2C5FA 1ZN2A 2A1TS 2HHJA 3ER8A 2WJ6A 2ZBFA 5HIJA 3VR6D 2G1UA 1WV1A 3RVRA 3T7TA 1NTRA 4MNTA 2NO1A 4O1HA 4WKGA 5CUQA 1T1EA 2ZJBA 4X20A 2VJNA 4EEXA 3PUIA 1P1RA 1YU6A 4MS1A 1DX4A 2WTNA 4EB3A 3UFXA 3S1AB 5D5HA 3OG9A 3AJ8A 4RF5A 1IN6A 1PX0A 5E1DA 5C7YA 1QAOA 2CK3D 3B1VA 2ZS9A 3PA8A 3X0DA 1YDGA 2GJ9A 3Q0TA 4K7JA 2NTEA 2OB2A 4JOQA 4DLNA 4HUQA 3GL9A 4AU1A 2BEVA 1H2XA 2L42A 3THRA 2P1DA 1CUSA 1VPTA 3IDQA 4PV7A 5FWYA 1WMBA 1FFGA 1OGIA 1F17A 1F2UB 2JGIA 2UVDA 2IZ0A 2Z98A 3P19A 3CFYA 3SZ3A 1R15A 4TKUB 4AP6A 5AM5A 2VHEA 3R7AA 1WEHA 1QHGA 2FMIA 1LH0A 4LDAA 5BNIA 2Q5IA 3DVSX 3TD9A 4PWYA 2DWUA 5DXAA 3P52A 5B12A 1P0FA 3LPAA 5DTRA 3CEAA 4RNDB 2D5LA 2FPPB 1X1BA 2QUHA 1D2CA 3A3NA 1BA2A 1WZNA 3G2QA 3IV7A 3OOYA 5BV0A 4AO7A 1GCOA 3D5TA 4DSTA 3WLHA 4EW2A 4M54A 4HAVA 5LM3A 1EGVB 3COJA 3QU7A 1U3TA 1DT3A 1PG5A 1TO6A 3H13A 1Z2AA 4IFEA 4DSAA 1L7QA 4BMDA 3PNKA 5AVRA 2WT9A 4RO0A 1LKZA 1FY2A 1XZLA 2ZS7A 2W2VA 3NNDA 2Y66A 1O96A 2BFFA 3F3MA 2AKAB 4MMYB 4EMTA 5AW4A 3CVOA 5CDHA 4GZ5A 4NATA 1L7DA 2NADA 4GPIB 3O4JA 4XVHA 1RBMA 4Z1MD 1ZH8A 3QUBA 4S2EA 8GPBA 3C15C 1BC5A 3MA0A 5H8WA 2PGLA 3L1KA 4IEEA 1D2RA 4LQ4A 4W7HA 3RTEA 4OM8A 4AKGA 2UZ0A 3A04A 4QOJA 1PNOA 1WV0A 5TEVA 2JC3A 3GT7A 4G56A 5T41A 1QTNA 1KAGA 3NB0A 3PF8A 2SCUA 3N3BC 1FB5A 3UKJA 1TM4E 1WW3A 3FDJA 2PX5A 4NEHB 4D02A 2XEXA 3F6SA 4L8FA 4GMDA 1A7JA 2QN3A 1D7OA 2TS1A 4CNBA 1WLYA 4D3XA 1H66A 3NATA 3NEAA 2ES4A 4HB0A 3UC5A 2FYTA 5DPMA 3HACA 4EPXA 4WTOA 3ENVA 2TMYA 4RK0A 4RWZA 4UD2A 4RJ2A 3TOZA 3GRAA 3P5BA 4M1TA 2HQOA 1HGXA 3L40A 5JAPA 4MUEA 1G5FA 1U3WA 4INJA 3JZFA 2J3DA 4IW3B 1Q84A 4Q3CA 1I7PA 1RMQA 1H2FA 2PL5A 2ZI3A 4XVQA 3FYTA 3NYRA 1BVYF 2HSZA 3HI6A 5CXQA 4QWWA 4ANFA 1UKYA 1W0CA 1U5BA 3IT1A 4IZIA 4GDFA 1L5FA 1LLUA 3HA5A 3F7TA 5GM2A 3OFND 3X43A 2X6RA 2VSYA 1E0KA 3B53X 3U7IA 1T3ZA 4MRAA 4R1PA 2M6LA 2N75A 3F6PA 4V3CA 3W5CA 2BGUA 4LJSA 5J3JA 5ALFA 3FMOB 1EUCB 3IR6A 1VKHA 3I32A 4FQ8A 4JS0A 3TZKA 1FRNA 1T5HX 5AKLA 3OD5A 3HWSA 4O4JB 4CL3A 4HB3A 3R3VA 4X00A 5FOQA 4B5LA 1MW8X 3B9RA 1DG9A 3GNSA 4GGOA 4ETMA 3A2MA 3OP4A 2NZWA 4LYAA 5GZ6A 3OX3A 2F1IA 2HLHA 1U8UA 1FQOA 4W1SA 4P6VF 2XAAA 4YRMA 3N0RA 5ED0A 1MC1A 1UOPA 3D4BA 3FSJX 1OT3A 3KQMA 4YJ3F 4BNDA 5IUJC 1G21B 1PTKA 4U5XA 3LBIA 4C14A 3LKDA 1OXKB 2OCDA 3DMNA 3PUZA 5CU7A 2BJHA 3VR5H 2OL4A 2AT1A 4E7OA 1A8SA 3K4PA 4JXZA 1TCUA 1QR6A 4M1EA 3PEWA 1EU1A 3SXJA 3QBJA 3R6LA 5IC5A 1GGVA 1ZLXA 1XDGA 2EJWA 2QBYA 5AVTA 3PC6A 3OQ1A 3EVCA 1RDFA 3IOEA 4JGIA 3FFTA 3BORA 4OAPA 1YZFA 4J1NA 3B51X 4X61A 4TMTA 1ID8A 2GCIA 3HXTA 3PDIA 3B5JA 1R88A 1YE8A 2ZXUA 4B4UA 4EJ6A 1XKTA 4G1BA 3HA2A 3HDTA 1GRNA 2XF2A 2G67A 4LRYA 4FJ1A 4E22A 4WCFA 1WU8A 4DCJA 3P71T 5CAEA 4UM8B 1QYDA 3HCEA 5J2UF 4BFLA 3FUUA 1KEWA 5LD2C 2A94A 2F1OA 4G1MB 3O3OB 3ZVLA 4O4LA 3N2ZB 2GFQA 2MR5A 1YVDA 1PR1A 2ZB3A 3TKLA 5BSUA 4ZC8A 1FDTA 3SP1A 1IXZA 2E1PA 4QEKA 4C0LA 3QLTA 4YPFA 4I7EA 2ZTSA 2GRAA 3WOHA 4HHEA 3PWSA 4MWOA 4NCIA 2UXBB 4KIFA 5ILQA 4KEAA 3JQ8B 4H3HB 1U7TA 5L3QA 3ELUA 4RZQA 3H1BA 4C07A 3S2ZA 4RD4A 3T7AA 5KQMA 3FOAA 1VHJA 1LNSA 2QDXA 2XZPA 3PUWA 3RANA 3SIXA 1B14A 2ZUDA 1RBYA 1QLWA 3IUEA 2FLVA 1JV2B 3KHTA 1DOAA 3LVRE 4CR6A 3C5CA 4DLKA 3DE7X 2HEIA 4BE9A 1R8YA 3WLRA 1U9CA 1EJ2A 5GGXA 4AG6A 5DNAA 1HNXB 3MTIA 4MGZR 1E66A 1Q6ZA 4O2AF 1G1AA 2DUWA 5BW4A 2IU6A 3N53A 4S04A 5BXQC 3PXDA 1GLGA 3P8ZA 4KLZA 1SXJE 1Z62A 1NDQA 2EYUA 1P0QA 4YJGA 1OX5A 3IIKA 3CX8A 2ZIXA 2JGFA 4Z4FA 3E7DA 2WJWA 3UWDA 4Q7EA 1E0AA 3VYRB 3OKCA 3AEQA 1C0EA 1TNDA 1UK8A 1XT6A 3GUYA 3UV3A 4LBWA 3NHJA 4M98A 2PUCA 5L3ZA 4LOAA 2HRCA 1P4AA 3SMQA 4YMTA 4B84A 3FHLA 5HKKD 3LUCA 4OHUA 1XPUA 3QFRA 3SOZA 4YRQA 1FVOA 3ME5A 2VK2A 3UAVA 5JFTA 2BP7A 3IP9A 5TQJA 2AXPA 2X8BA 3ND9A 2C58A 2QHXA 1A50B 4L6CA 4MOWA 1ZSYA 4LMPA 4UAGA 2O4CA 3E3AA 5DHUA 5EXDA 5DEIA 3G89A 3MJRA 4PSAA 3DKRA 5DKFA 1SJ9A 4DKXA 4D25A 1TKRA 2C3PA 1U1CA 1YR6A 3B3JA 1YTLA 1UBJS 3HYSA 1VYHA 1G19A 3QKWA 4TLLB 5LB4A 4MPPA 2NP6A 3O3CA 3VC3A 5G1OA 4A6XA 1IVYA 2V6FA 2XV1A 3T5TA 4LOJA 5CXSA 4A3SA 1Q44A 1VYVA 3KE8A 1KYYA 1CY7A 1KJYA 1O97C 4NDZA 1ENZA 4MQEB 2ZBGA 4KR9A 1KAQA 1CUJA 3KYCB 4RHTA 4DQXA 8MHTA 1N6OA 2A0UA 2VK4A 2ODEA 3LYLA 4DIOA 1JIVA 4K03A 1LD3A 2EWVA 1M2NA 4JHLA 1KFJB 2A67A 2PXXA 3OZSA 5K8LA 3R5KA 2RI6A 4AZVA 2B36A 1JQEA 2XNHA 4XX0B 5AT1A 4OVKA 1E1LA 4A6DA 3EZGA 1B93A 1Q83A 2ZWOA 2QVYX 2X3YA 4LGCA 4CLDA 3UKOA 4PLPA 3DO8A 4HN4B 4L5YA 1BX1A 3ZHRA 4HJXA 3QEJA 4CMHA 4UTPA 3A36A 1V41E 4AJKA 3ZI4A 2XKAA 2QVGA 3L7AA 4PCUA 2XH8A 2Q50A 3T94A 4RTKA 1GDDA 2WD7B 4UHEA 1D07A 1AQ6A 2WSSD 3FNHA 4QE3A 5EKSA 3TW8B 4FINA 4OHCA 2RHBA 2QVBA 1T9GR 2DBYA 1KYTA 3GGJA 2OLJA 4C7KA 4ZYZA 2G1KA 1ECCA 3SC4A 5ENZA 3HO1A 2ONZA 4ZQHA 4URZR 1I4DD 1D1PA 1S8FA 4GMXA 1PG2A 1RQRA 3UBMA 2FEMA 1J2YA 1I30A 4Y9DA 5IVHA 2Z2KA 5T6MA 3M1AA 1H8EA 4GOMD 4OBXA 4LGYA 3SHOA 1IBKB 1L1EA 1NOJA 1PD1A 4MRMB 3ITKA 3LC1O 4RYLA 3VQTA 2P90A 4P5EA 4RW0A 4M38A 4UBIA 2XA1A 2EVWX 3MRXA 4FI3F 4PLFA 2VG8A 4ZXFA 2QX7A 4XKJA 1E3WB 2Z56A 3WA6A 2P6UA 3GEGA 5AOCA 3R8CA 1KEEB 2HU8A 3P0RA 4R69A 2PX4A 2HBRA 5EP2A 4F8JA 1ODJA 1YVPA 4QZVA 2BM0A 2Y1LA 2FUNB 1FW6A 1CW2B 5F1YA 2J9FB 1Y89A 3SR0A 1Q7EA 2Y2UA 4EVRA 1U8AA 5HUHA 1G5HA 1SBIA 1JIJA 1WDKA 2YY5A 3EGXA 4MIYA 4RVNA 4D0RA 3EQZA 4BRUA 4JK3A 4Y2YA 1V3QE 3G7SA 2WWIA 3N05A 3QLVC 3E35A 1HYBA 4X8OA 1A7UA 2G25A 4KSBA 2AR9A 1NBEA 3GPCA 4R6WA 1DIAA 3E15A 4IH4A 1WQ3A 3R7DA 2X9GA 2YMMA 1WX1A 4PSKA 3RYCA 1AZWA 2DM6A 2QGFA 3D3QA 2WEKA 3KQWA 4DYDA 2HYIC 4IJMA 3WSTA 5IMBA 3KYJB 1JG2A 3CRW1 5FEMA 2VT3A 3JAKB 2AHOA 2C84A 3Q8WA 1ZAKA 2QT9A 5B3AA 5JWHA 4P84A 4L8YA 4PR0A 2L17A 1SU6A 5PGMA 1MOZA 3P9ZA 4JUDX 2AR0A 3HV0A 3R7BA 4JI0B 5JAZA 4FB5A 3CB2A 4QUEA 1DKMA 1GFSA 4K3UA 3IODA 2AZ4A 4M1SA 2PFGA 1ZXBA 5LFAA 3DXFA 2ID4A 2YXLA 2BFEB 2BAGA 3B20A 3I2KA 2BEKA 4MYHA 5E9JA 1UPFA 2QSYA 4DXAA 5G0UA 1GTVA 3PJFA 1U81A 2JLRA 4IMIB 4RAOA 3KZOA 3H7IA 3VR5D 4FHCA 3C1UA 3HQ4O 3K31A 1XAHA 3QVGA 3V4VB 4KFCA 1KH1A 4Z2YA 4Q39A 1H3FA 1AK1A 2HPZA 4R6XA 2VZLA 5TQVA 2CMGA 3ZZNA 1R6DA 3SEAA 3VKHA 4D4MA 3HB7A 4PZZA 3GHYA 3GY0A 5JFGA 3AVOA 1O08A 2VHJA 4HCJA 1JR3E 1EX6A 2WTUA 2F3PA 3USZA 4CMKA 2CHVA 1VL2A 3EQ9A 4KPYA 3DSRA 4JVOA 1GZUA 4HQLA 3KG2A 2W58A 2B2NA 3DL4A 1DC6A 4QM7A 3JX9A 3HA7A 3VOSA 4BVBA 2AFIB 2AOXA 2VJPA 4DLAA 4EIWA 5MDHA 4Z4QA 2O2EA 2EBHX 4AF8A 2QRNA 2IS4A 2X7HA 1G59A 1GCUA 3L6OO 1M34A 4CMCA 3C0KA 2HLNA 3N70A 1WB6A 2WE8A 4GEKA 3VI3B 3MUNA 4QHTA 5L95A 1V45E 3OF5A 4UTNA 5K3OA 4PSVA 2W98A 1Y8RB 3FW1A 1IN7A 2EZ4A 4EJMA 1YFLA 5B1HA 1G5TA 4EKYA 2QRHA 1LB1B 3GFGA 1BEZA 2IBMA 5LZ2A 1C3LA 3OM9A 4I50F 3H1EA 1UC4B 2VK1A 4GX5A 3IE2A 3PD1A 4Q7KA 4URYR 2YQ4A 4B44A 5IT0A 3ROQA 1XLTA 1QMGA 1U1IA 3GLKA 1K27A 2ON6A 2CE2X 2HT6A 5FPYA 4ESEA 4IILA 1JIXA 4XDHA 1A4UA 4AJPA 5F7ZA 3C5HA 1NYRA 1A7KA 1I7NA 1ZXLA 4EPVA 3MMPA 5E2BA 4UEQA 1PV1A 2GXSA 5DT2A 1RCUA 2AMYA 1FSFA 1A5TA 1G4HA 1VPEA 3BGDA 4I4TF 4UU8A 4WZ6A 2IHUA 4RTSA 4RVSA 1V4VA 4UTVA 2JG3A 2XBMA 1O97D 1BE1A 3CE6A 2P3OA 1ISJA 3WS7A 1IBSA 5FFFA 5G1PA 3W9YA 1ONBA 3MW8A 1LNZA 5TXGA 3OA2A 2PKWA 1YZ3A 5FA5A 3L41A 3VTFA 1FFAA 3IHTA 2YV2A 4R1MA 2HBYA 1A69A 2IE0A 2VNHA 3H84A 4M9QA 4JYAB 1EK6A 1KDOA 1QCDA 1J00A 3CZ9A 3GFBA 2GBPA 1JF8A 1LBIA 3ANYB 2WYIA 4IDHA 1YD7A 3W1EA 5FIUA 1ORRA 5I8WA 4DC9A 2WA2A 4XWYA 2VJYA 1CUFA 3ADBA 3LX6A 1GNSA 3LT5A 1QE3A 4ZAYA 4UBKA 4F96A 2V7UA 2HMTA 4LYDA 5IWCA 2H1CA 4LECA 1A9ZA 1B8NA 2I8AA 3SVZA 2JD1A 2NU7A 4FMCF 4FNMA 5FADA 2J4CA 5BYJA 1Z4JA 3SSNA 1U1EA 2I1LA 1WSDA 2VJMA 5K05A 1X0XA 4TKMA 2X2FA 5I7RA 2VDOB 3MWGA 2HEGA 4V0RA 4ZI7B 2EX0A 1J5EB 3V1LA 1BU5A 3FHCB 1PEKE 4DT1B 3ZDBA 4KBYA 2JFZA 4KVZA 2VO1A 1W0JD 3G0BA 3LK7A 3M49A 2A5GA 2NVOA 4U8HA 5TY0A 3FSEA 3B9PA 3C6XA 4DDVA 4LDRA 5FO1A 5B7NA 3I5MA 1QFYA 2QRVA 4C06A 4ECEA 1Z38A 2YXNA 1KSHA 2AA3A 2BIFA 2POQX 3O2QB 1E60A 2VTBA 2GEJA 3UGKA 1SD1A 2LTAA 1G2QA 2EP8A 2MYPA 3GN1A 5K6TA 4KXQA 3RYHB 2WIJA 4XWWA 1MUUA 1KAOA 1YOBA 2ZJ7A 2V7PA 5KHOC 1Z45A 1GL7A 1Y8CA 3LBYA 4PTZA 2YRXA 3QQPA 3WKDA 3DB2A 4LXIA 1RTKA 3EDQA 4HX5A 4CUJA 4RH3A 2QE7D 3TLXA 3IXMA 5EKXA 3NYIA 1L4BA 5JT1A 1Z0DA 4MULA 1PG0A 3HMQA 2X8WA 3KZVA 4YECA 5BNTA 2ZGVA 5HS6A 4NXNB 2G36A 2BMDA 1YJQA 3UENA 3EXFA 3EIUA 1TQ2A 3D1JA 3MD0A 5EJ9A 2A59A 2I3ZA 3R3ZA 4CM4A 3E7FA 1XALA 3KOYA 1VGRA 1F8YA 4BMPB 1P0CA 3BAFA 1G38A 2E6KA 5E95A 4WOCA 5CLIA 3RUCA 1YI0A 3K8ZA 2A2ZA 3L7LA 2BEWA 4EGCB 5KTMA 4CDMA 2QM8A 3N0TA 3F6CA 1D6SA 2OEPA 3E7PA 4IDNA 4RD2A 4DIDA 2GEVA 5DBHX 2XB6A 1TQ8A 4BLWA 3EZ7A 4K87A 1NM5C 3NTQA 3H8SA 2O0KA 3F6EX 3CUYA 4PAWA 3TINA 4A2CA 4H3SA 3PRHA 4J0CA 3LT1A 4QDJA 1B74A 4V2UA 3WGVA 5JZOA 4Z2AA 1SUSA 1W4RA 4H7HA 1XWIA 2XUDA 1LI5A 1GG9A 3ZQJA 1MPXA 2E2WA 1EX7A 2H4FA 3UMFA 3Q88A 1O3YA 3C16C 1GPDG 1KMQA 1VCHA 3IPCA 2QTGA 2VRBA 4Q4HA 3EG9B 4U7JA 1MAAA 1QKIA 1XQXA 3L9XA 3LO5A 3OFKA 4GLLA 3Q7PA 4C0AC 5EMHA 4CQNA 4FBLA 2Q0QA 1XTRA 4X7MA 3EPJA 3U1VA 4BX3A 3UJ7A 4M7RA 5B2EA 5BUSA 1EKXA 3QHQA 2E18A 4DIFA 1GOTA 5B57C 3KQPA 3W5JA 3V7WA 1T4CA 2O2DA 4FCVA 4BLTA 5BN3B 1SURA 2ZIGA 1OWOA 3ROGA 3ISTA 3ZWCA 3WJAA 4BQSA 1A8IA 1TU3A 1WUJS 2W7TA 3BERA 4MR8B 4R1LA 1N8SA 3EWNA 3VUEA 4WOKA 5FL7D 4L57A 1XN1A 1IAVA 2TECE 1VB5A 4HRYA 2OHJA 1FMCA 3VPCA 3BSWA 3GRZA 2YXPX 4AZSA 3ZE6A 2I6FA 3ASZA 2H1VA 3ZDZB 1LC0A 4GXRA 4P4NA 4TLDA 1OI4A 3ZJYA 4YWJA 4JBYA 3T7KA 4DXDA 4O2BF 3G5UA 3A3KA 5KYXB 4G3XA 4GFDA 4O2LA 2QLMA 4QPPA 5LXTA 1WRBA 2ACKA 1REQB 3UAZA 1SPBS 1GXSB 3SQMA 4OGKA 1KMIY 1QYVA 3W7VA 4NCBA 3S28A 3KSUA 4D8YA 4I3HA 4A0GA 4CEHB 3D1VA 2IX9A 4ZAWA 3DFZA 1X2BA 4ZC1A 4EHKA 1J4AA 1TDJA 2WSIA 3RJ9A 2WB4A 1OHHD 1P1BA 2AD1A 3R7LA 4GI5A 1R8JA 2IU4A 1QVAA 1T1JA 1NDUA 1AS3A 1QUEA 1UADA 2DWPA 1DIGA 1E2IA 1N1EA 4ZQIA 1THMA 4WNIA 1VHWA 2GTPA 2EOAA 1R4NB 3NP9A 4BNYA 4KUHA 2DU8A 2YIDA 4OFXA 1F6WA 2PZKA 2OQRA 4KW7A 4MI1A 3AVPA 4I0WB 4CI9A 3WISA 2YH2A 4G5FA 4Z9BA 4IVQA 4FD3A 4K40A 2CMKA 1SKMA 3BHJA 3BA6A 4Q01A 1BS9A 2AOUB 2HMWA 4CFSA 1HT1E 3CUWA 1SMKA 3HY4A 2N42A 3GT0A 1Y48E 3NX4A 4A27A 5LOVA 3ZY6A 3HVKA 1N5JA 4NBSA 1ATZA 3V9AA 4ARBA 3TKAA 4TLEA 1O8BA 3A6GA 1PR5A 1NXQA 2XGMA 3CR7A 2PMCA 3G59A 4GWLA 3B1YA 1GILA 5AW9A 1S5PA 2JJQA 3C5EA 1YB7A 3E9DA 4KMRA 2IW1A 5DHTA 3VSCA 2PMEA 3IP5A 121PA 3C43A 2OILA 4OQYA 5KTTA 1GZDA 1E9DA 3K94A 4KI0A 4I55B 5GINE 1LLQA 2G6TA 1KJNA 3KQQA 4G81A 4GYYA 3RFVA 2GILA 3ZG6A 3IHWA 2A9QA 4I1SA 4YBRA 1K2VN 1L4GA 2A78A 2ZRKA 3HVHA 4JLBA 1XZAA 1DJNA 3IXQA 3RTGA 3C97A 3OX2A 1TD1A 5A7HA 4XFDA 4MVWA 4US0R 4I2NA 1L5RA 3DZIA 5PNTA 1U7PA 2YNMD 3TTUA 4BLOA 5L7WA 3RUHA 4D79A 4NONA 2DG2A 4HNGA 1CWUA 1XNHA 2QAGA 1Y6JA 3PRYA 1TAUA 4KLNA 1PBTA 3TKYA 2EQBA 4BNTA 1KIMA 3O47A 3LZDA 3V8QA 1Z7EA 1V96A 3MZ0A 1AHPA 2PPLA 5G0WA 4ZZ3A 1CUGA 1XV5A 4PZ9A 4S1NA 2OUKA 1YDEA 3H9QA 4HBGA 4M1OA 5CVTA 4DABA 1UZUA 1L7OA 1Y1TA 3DT8A 5ADWA 5KSOA 2B7CA 1QDLB 3CVWA 1QRRA 3OOWA 4HYYA 2AOVA 1XTTA 1HORA 3I9V6 3ZCVA 4MIEA 2WPNA 5DM0A 2H9IA 1G3UA 2X5JO 4JI1B 1E5QA 2ZPUA 1BMFD 4WDRA 4AKHA 1Y6GA 1I1HA 1U31A 3F2IA 1OI2A 2ZT6A 4GLBA 1PLKA 3LCMA 1RXSA 1AUVA 4WRRA 5J40A 4X8HA 1GG5A 4L08A 3PEYA 1G2PA 3TH5A 4C3ZA 2ENWA 3PUXA 1H85A 3NHMA 5E4TA 2VDPB 3UOWA 4FGKA 3ZH9B 3O74A 5C51B 4LHSA 1K88A 3GRUA 1JBQA 1NTOA 1Z5WA 2VPTA 1Y8QA 1BCRB 3E81A 4EJSA 4RD0A 3K0FB 4D4IA 1AMUA 1NF3A 1N2CE 3BTSA 4CMIA 3QRWA 4DS3A 5JRDS 4Z86A 4ZYUA 2YASA 3CC8A 2XTAA 3ZV3A 1AB6A 3TZCA 4IHJA 5DM2A 3Q4GA 5MF6A 1RCTE 3RBXA 2WPDA 4ZT6A 2ENUA 2J3EA 2EKPA 2VRCA 4Y9SA 2ZTHA 1NASA 3C8ZA 2WD8A 3S5UA 5CA1F 1LI4A 4HH1A 3PRJA 2I6XA 3AM1A 4UVGA 5KNCH 3WBFA 1R27A 1M1ZA 5F9MA 4V38A 4EGQA 4MWCA 1Z2PX 1P1JA 2FR1A 5AKXA 1EG7A 1ZH0A 2QF7A 4YMWA 4KRXA 5DN6D 4KZPA 2FU5C 1NVKA 1LPPA 1SXJA 2EFHB 4P5DA 2GCEA 4CG1A 3FCOA 3F67A 2Q4RA 3FYSA 4LXHA 3IURA 5CVCA 4Z99A 4YR9A 1Q7BA 3HPRA 3JQ6A 5L4LA 4Z4IA 4DIEA 1N6HA 4QD3A 4MYRA 3A1DA 3AL0C 3NMUF 2EAUA 1Z6ZA 3QM1A 4IKEA 4MX8A 3OM8A 4PGHA 5ED4A 1NSYA 1ZPDA 2X5XA 4PLGA 4CLRA 2PXAA 2CFSA 3OZCA 1W8IA 1QH8B 3RD5A 1L5HA 4QG3A 1OB2A 1XZHA 1Y5RA 3FBGA 4DIKA 3QUSA 4CBVA 1XMQB 4EO4A 1I2BA 4H15A 1CRQA 1N1MA 1P1KA 1FVHA 1K2WA 4YP6A 3DWEX 4B4VA 1XTJA 3SKVA 4Q16A 3F9CA 2GYWA 2BZSA 2CDNA 5A4FS 5CBKA 2JLBA 4V02A 5CA0A 3TRJA 5JNRA 1D9ZA 3L8MA 2GBGA 2RCNA 2HV9A 3IFSA 2SHKA 4FUQA 2SNIE 3VYVA 1W85A 2IEAA 3KLPX 4AKEA 2CD9A 4BLRA 2FGKA 3M9LA 3G0DA 4D0SA 1SC3A 1XX6A 4GBGA 3ZWVA 2XUZA 1SVUA 5DTIA 4WW0A 4EUEA 1GRRA 3O4RA 1IY0A 2VAPA 4EKEA 3PFCA 4MEBA 1TIBA 3ZWAA 1WXQA 4GYJA 4RAQA 2WFZA 3W7BA 4P98A 1BS1A 3QXCA 4H1UA 3CG4A 4NU8X 3RSZA 2B7BA 3K15A 4OI0A 4RPKA 1E2PA 3VH1A 1U2DA 2VJDA 4WK6A 1MC4A 2AFRA 3PEFA 3UBTA 4QL3A 2C7QA 1WIWA 2PBFA 3KT6A 4HRXA 5JAIA 1VCMA 3M4ZA 2O8BB 3WIDA 1IG0A 1NT2A 1Q20A 3ZWBA 2G63A 2C78A 2RGGA 3GLRA 1S2IA 4HNVA 1KNQA 1O77A 2ZAYA 1QHHA 3V7UA 3U5ZB 2R11A 1GP2A 4E2WA 4LSMA 1UBEA 3KPUA 3H99A 1V3VA 2O6LA 2VR1A 1HNZB 1F8GA 3PDHA 3LBNA 1KMCA 1EVKA 4WKNA 4JLPA 2FQYA 2J59A 3KCQA 3PXUA 1VKNA 2A9VA 1G16A 2O8FA 4GQBA 2RGNC 3PGA1 2GA8A 1ZNZA 4W5WA 2WT8A 1U0HC 1UK7A 2EKQA 1HYQA 4EFDA 2I3BA 3LIIA 3RIMA 3VC1A 1U8TA 3SC2B 5I9SA 2WVJA 5A04A 3EIXA 3NUGA 1ECLA 4UU1A 4MKXA 5HJEA 1RPAA 1KEUA 1PFGA 1FMJA 1ZOSA 2X5OA 3BB1A 3L0PA 5H70A 1NVWQ 1O89A 1N34B 1U7OA 5JPIA 1GFZA 3GUUA 1KPIA 1RJFA 4M9CA 2MDTA 4WX2B 5IBQA 5F64A 1ESMA 2INGX 3FMVA 1MKYA 1OX6A 3ZXUB 5JYCA 5JXHA 1DZ3A 4X1KA 2X0FA 3OQMA 1N1DA 2OFWA 5I7UA 1JIKA 5CBPA 4LTDA 4XIIA 1Y6ZA 4CKBA 1EQAA 1NOKA 3HKCB 2GZDA 5ALRA 2NO7A 1CCWA 1WZUA 4HEA6 2VSNA 3TXXA 1NIPA 3AKZA 1P61B 2VUSA 4B17A 1E2BA 2ODTX 2WMYA 2FZCA 2VPWA 3DKPA 4RORA 3FCAA 4D3DA 5J23A 2D00A 3OLWA 5EC8A 4E1BA 4LYJA 4X20B 4BMCA 5E9AA 4RC9A 2ZEJA 4NABA 4S2UA 2APJA 3O91A 3UK2A 5E3IA 4H3KB 1DXOA 3PQ4A 2E55A 4XLZA 1WAMA 4UPEA 1SXPA 2P3LA 3DBLA 1RAEA 3U37A 4N41A 1U7UA 1Q57A 1V6AA 1UCFA 3IJ5A 4O3FA 4LFCB 2RSLA 4QBIA 4AUNA 2V6MA 4QDZA 2DWOA 3QVVA 4HUQB 2OBLA 1T9KA 1X80A 2QT1A 3FCEA 4LJ5A 3BZUA 1UJMA 3OO1A 1KEVA 1P7CA 5IDVA 1Q2XA 4CV0A 3BZBA 4GD3Q 1N6RA 4UNIA 5A3RA 4PO3X 4CMEC 3PR2B 5JG7A 2FRXA 2HR1A 2ORED 1Q1QA 2QEQA 3HABA 5P8WA 3F73A 4YO7A 1JZQA 2C83A 3FZNA 3KSDO 3OM1A 4YRTA 4H7KA 2EFGA 1XXHE 2E4WA 4N01A 4EJ0A 4A26A 2IYPA 2OYRA 4E5YA 1I2DA 1Y9AA 4LBYA 1FU4A 2NZVG 1JR3A 1IWPB 5DB4A 4Q3EA 2Z5VA 3O9VA 2VRNA 3AKEA 3OHMA 2UU9B 1D5WA 1AKYA 5E6UA 5K0CA 4MIOA 2X2PA 3CKLA 3JYOA 3OMLA 1SIWA 3PGLA 3ZDAA 1GNTA 2AN5A 4EKIA 2C8KA 2UYQA 4GYKA 2A1IA 1O96B 2BFFB 4PX3A 2BFDA 2ID8A 1MRNA 1PL8A 3DEIA 1DXQA 4KPFC 1ODFA 1N3BA 1NHGA 1ULAA 5JECA 5KUTA 2Q5JA 4LMAA 2Y4OA 3F7NA 3U7QB 7MHTA 4LF7B 2C92A 2YCLA 3PP8A 5ALPA 3G79A 1P2GA 3EK2A 2AS0A 3USCS 2WUVA 4JT9A 3OCWA 1JILA 4UE2A 2IK8A 4MUJA 2SCUB 4DA8A 4O4JF 1IE3A 4QUGA 1XVLA 4Q1CA 2QAIA 2QMOA 4JT8A 1VRVA 2GK6A 4YT4A 1ZSNA 1CQIA 4B9AA 4HLNA 1YZNA 3JQ7A 3LY8A 2JFOA 3BAZA 3KPJA 5KBYA 2FK8A 3QF4A 2ZRBA 1MF7A 2PHZA 3N86A 3L8DA 1ITZA 2FN8A 4G1CA 2BUCA 1UMDA 2ZDGA 3BWYA 1DCKA 2IYVA 2Z8ZA 3WP0A 5KNCD 5M34A 1Y1SA 2KPOA 1E89A 2AG1A 2XWJI 1JG3A 4Q34A 3FVRA 3ZLUA 4UM9B 4ZQCB 2Q5CA 2XUIA 2QMUA 4G97A 2G8NA 2NTNA 3F71A 4OQDA 3R75A 4NH0A 4DA7A 3U09A 1M5RA 1U5BB 4OXKA 1O6ZA 2BJWA 2R1UA 2YZMA 3R7WA 4LYYA 1RHKA 2NAPA 2JFVA 1YR8A 3JQGA 4BV3A 4CMJA 2IT1A 1ZONA 4J2TA 4YRAA 1K5PA 2PMDA 2G83A 4ND5A 4X0EA 1L5KA 3R77A 3E3OA 1U3DA 4W7SA 1YU9A 4NI5A 1Z2CA 4FR0A 2HPAA 5J9FA 3PI7A 3TQRA 1TLLA 3BIFA 5FFNA 3VNQA 1EFVA 4BGVA 4BZWA 3AINA 3HCNA 3KV1A 3CURA 2HOQA 2A0KA 5JZMA 5LP1A 3F6RA 4XR9A 4WACA 5AUNB 1V8DA 1ST3A 4BGIA 1DGQA 1OA0A 4YJDA 1M2FA 3UB4A 1AQYA 3C7KA 3O4IA 3SJZA 3ND5A 3NTOA 4E46A 1UP7A 2ERYA 1KC1A 2VH2A 1H9BA 5DSZA 1XNRB 1QF6A 2I4MA 1CDOA 1OROA 2YR0A 1PNVA 4BNDB 4XCQA 4BDSA 2ZREA 2VFAA 2XXBA 3UIEA 1K7XB 3E8XA 4FD2A 3LOPA 3ZLJA 3V3KA 1ZM7A 2XKBA 3TQTA 4TUYA 4FJ0A 2I55A 2JGAA 3H04A 2FWPA 2MU1A 3KWLA 4PIVA 2H3EA 1U7HA 2FUKA 3FDIA 3D81A 3HNRA 4HP8A 5C1DA 2QBYB 4YCDA 4MQ6A 4TZ6A 1M8KA 4IFIA 4QTUB 5EHGA 3SQLA 3EPHA 5IJ0B 4XCXA 3DLCA 1L7EA 1NQ5A 2N1BA 3ACBA 4EI7A 3ZGXA 4WCFB 1AMOA 1U9ZA 5EIWA 3LX5A 4XE5A 3Q7EA 5CAEB 1U04A 4WNCA 4JJFA 3DPUA 4G25A 3R20A 1ZL2A 3ESCA 2YWBA 5A9SA 1I6WA 3JQQA 3NVAA 2W6IA 5JVDA 1U5AA 4K26A 2AI3A 3DYBA 3WQBA 3JRWA 1HLDA 1I6KA 4C1NA 3AG5A 5D3ZA 5HHTA 4HDQB 5LP6F 4RF2A 4BVKA 2W6CX 1W5BA 3M4YA 3ST7A 3CZ5A 1HFWA 1DX6A 1TM5E 1RYDA 2CHFA 4TRRA 3U31A 1XK6A 2EP5A 3VSAA 1G8MA 3IELA 4PYIA 1WPRA 2RHJA 4J7AA 1NXWA 1NF9A 4C21A 2HO4A 1V25A 1K92A 3K9CA 3B3GA 4UCFA 1KFKB 1XMSA 4D9HA 3OTQA 1W4CA 5HZMA 2FPRA 3WG9A 4G01B 2DUMA 3BCHA 2M6RA 4A6EA 3R44A 2CZQA 2XA2A 3LLMA 1SWVA 1ZNYA 1ISSA 2QTRA 3SXPA 1EZZA 4ZU3A 5ITZB 2X40A 4CCSA 4EY7A 1FNCA 1SKYE 2HRDA 5GOTA 3PR3A 5HWSA 1USWA 2A30A 3PVSA 2AQ8A 4OQZA 3GLTA 3QX8A 1UBMS 2ZUVA 4G26A 1XEWX 3J7TA 4G5QA 3T34A 2BI8A 3WICA 4YJGB 3WAKA 3SSMA 3V4ZA 4TRJA 3E3MA 3GJ8A 1TGYA 4MA0A 3D8HA 4FYVA 5DCLA 1G20E 1AH2A 2QTNA 2WFLA 1PLJA 4KVAA 3RRNA 4M0PA 3AEQB 1J6UA 3ZW8A 2VNKA 3ZVNA 2AMFA 3NYWA 1Z7BA 4WUTA 3WHKA 2XRZA 4YWHA 4IEFB 1K3FA 3TLAA 2FFAA 4PTYA 2BP7B 5G0VA 4EI2A 4DQUA 4H1HA 3MTGA 1EI9A 1FPQA 2QMYA 3N6VA 1NW5A 3QOWA 5JSYA 2FN7A 3AW9A 5C8XA 2VSFA 5CFZA 1P2DA 3IEPA 1CERA 2W2NA 3CMCO 2CD7A 1BDJA 2EBUA 3BK7A 2ZE8A 3GFRA 3MRSA 4WI1A 4LSWA 1F0YA 1RPJA 4ZTUB 2PH5A 4PQEA 5D86A 3SIPA 2GWHA 3BGSA 2J6BA 1SN7A 5A9TA 3T7JA 4CLHA 3EGDA 4EA9A 3MC1A 3IIJA 3ZIDA 4PYQA 2OHOA 1YQEA 4K9RA 3VU1A 3OT4A 2PNJA 3N8DA 4JSRA 4YUVA 4RX1A 5LZ8A 1UMCA 3Q15C 1PQ4A 3QU2A 4I08A 3MTJA 4CI0B 4FMBB 4FDVA 1V9CA 1WG8A 3MJVA 3E27A 2VP5A 4MMXB 2FZEA 1JSXA 1NDHA 3MYYA 4W99A 3MTBA 5HCIA 5CFNA 5M5BA 3O8QA 4V0MA 4ER7A 2X22A 1A3CA 2V9ZA 4EG0A 4HEA1 4F72A 3A4LA 2J87A 4C4OA 2JW5A 5DZSA 1IZ0A 4BNGA 4C0SA 1DEHA 3MJHA 1Y4UA 1XTZA 1DDOA 1V35A 2H9YA 4NTZA 3FLAA 1QU3A 4V0NA 1MB4A 3AEYA 4M4SA 4PSUA 5DYIA 5JANA 3CTMA 3EXG2 1Q2UA 5AK5A 3ANNA 5GTDA 5JWRA 4OIMA 2FFRA 3LQ2A 2I9KA 3HP1A 5KYTA 1UMBA 3CHYA 3EAQA 1ZH6A 5D01A 4N7BA 3KR1A 2OVBA 1AK2A 4M9ZA 5KQRA 2EJTA 2GPWA 3FZYA 2MJLA 1YNSA 2WIDA 4LE2A 2DKOA 4L22A 2D5IA 4W63A 1VJRA 3LWNA 5CD9A 2WWVD 1NUQA 4FBGA 1ZW6A 2XE7A 3FPFA 3NH6A 2VP2A 4WKPA 3EVAA 2Z2JA 5IHXA 1LLCA 3TIIA 3KHKA 1VL5A 2XMPA 4KNWA 3S2SA 4F1WA 1LTQA 2C5AA 2G80A 4B71A 4K8OA 3MM4A 2BMVA 2B5OA 4BO1A 1UOQA 2J9ZB 1GFWA 3A6JA 2QPOA 3RT9A 5D00A 2ZIAA 3ENQA 1CZUA 1MQSA 4I1PA 4KJXA 1SA0A 4RVDA 4WIAA 4RVUA 2QTLA 3AV3A 4GOKA 2C2HA 1SVNA 4GSKA 4YRFA 3TEMA 3DCYA 4MV9A 1ULSA 2HHCA 3L4BA 3AL2A 1ULHA 3CUKA 3NHUA 2D54A 3T9CA 4EY5A 3RWOA 3LPNA 2HUPA 4G07A 2W9XA 4F06A 2PJDA 4V24A 1U0NA 1I51A 2RAVA 4U5QA 2I87A 5D51S 1IEVA 5BORA 5FI5A 3AFHA 2YXBA 3RYCB 2B4KA 4UVDA 1QDUA 3TQOA 2WU0A 4RY0A 1SG9A 1BMDA 3O83A 3ZCUA 3JD2A 5FAXA 3E23A 3ZWNA 2EXXA 4HLDA 2K6GA 4NSNA 1FFWA 1LWNA 1RKXA 2I99A 4QULA 1EP9A 2NXEA 3KAPA 2PQ0A 3LOUA 2JZOA 3PEEA 3R40A 2I2WA 2Z08A 5KTSA 2UVQA 3HFJA 1FSZA 1MT3A 1LS6A 1XAJA 4BUCA 4DA6A 1BU8A 5J5AA 3EQ2A 3NOVA 4LWOA 1SK9A 4UHHA 3L7KA 3NETA 4HATA 3ZHBA 2C7GA 3M6WA 4IIFA 4JENA 4BWFB 4NEGA 3IKLA 4PYOA 2OSBA 1QG2A 1T0PA 1N2OA 1T2CA 3NHRA 4N0EA 4DXHA 3U5TA 1NBHA 5CJPA 5IAKA 2AL7A 2R96A 4WY8A 5C1PA 3RIHA 3QELA 2IKQA 4HDNA 1XE3A 5AM4A 4BQRA 1GQOA 3ETEA 4LJ9A 4AX4A 4YRLA 4XSGA 2PSHA 1N2CA 3NM4A 5EIOA 1BX3A 4WOBA 3VVBA 1LDMA 5G02A 4FKZA 1R6UA 1DKRA 1CUUA 3A9SA 2GF0A 3EVTA 4RDCA 4ZRNA 1OZGA 1OT5A 2JAXA 3C87A 2X3FA 1QG4A 3CLSC 3G13A 3MQ2A 1SZPA 1C4OA 3VHXB 3ZDDA 4PX9A 2YX1A 1O1YA 2R5WA 3Q0IA 4FFSA 4HNSA 5CH3A 3W04A 2R7NA 2YY6A 3FYUA 3QEKA 4JVNA 5BWCA 5JQGB 1IHXA 2X2OA 2C2ZA 5EEHA 1JIUA 4DV5B 5E4YA 4JBWA 3DTVA 3TAHA 1HLGA 4L0CA 3FBWA 2V7GA 4UNSA 3A9UA 2NLOA 2ZRQA 3DHEA 2F1JA 2ETVA 1I2ZA 3GU3A 2F4NA 4RF3A 3EXAA 5FUYA 2B25A 1VKOA 2GJAA 2C4MA 1N7HA 4LQLA 2IV7A 8ATCA 1BE8A 1AM4D 1UQRA 3L2OB 3HXMA 5JMTA 2LCIA 2Q9UA 4J16A 1H9CA 3CRQA 4LYEA 3CW8X 1D4AA 1L7RA 4K2HA 3RSSA 4NE7A 1JQ3A 1Y6RA 5CLLA 4D0LB 2RK3A 5K4AA 2J30A 3FMIA 3L4KA 1CE8A 3NTVA 2XWBF 4YQYA 4DJFC 2IY9A 4O29A 4EY3A 3QU5A 1WXHA 3MVEA 4BQIA 1ILEA 4JJKA 3QFSA 5CT5A 1S96A 1XRSB 1NXVA 4JODA 4O2RA 3U3MA 4I19A 3OEHD 2Q5HA 2VZ9A 5HGJA 3TB6A 5KNDA 3BE4A 1CJCA 3LDHA 3O31A 5T4EA 2A9PA 5E38A 1CEYA 4R8RA 2E5LB 4E6EA 4EELA 3F5QA 5AW2A 4DCCA 3BDIA 3K6RA 4M3NA 4NJOA 4B3SB 2O2JA 4YMHA 1IJBA 3PCXA 1W7AA 2AK3A 2CUZA 1WS6A 2MMGA 5F52A 2R5NA 1IM2A 2AB0A 2GEFA 3CJRA 3HGTA 3GDOA 3NPAA 1R6VA 5EJ6A 4CG2A 5JAQA 4GMFA 1KJZA 1QDEA 2JBHA 5K09A 1ZP6A 1YJ5A 4P0TA 2AEMA 1J1IA 3WIBA 3LQYA 2C98A 3TQCA 4GC9A 1UPCA 1JTFA 2DF8A 4NCAA 2O1XA 4W6ZA 1HH4A 1GADO 2NZYA 1N9GA 2ZUBA 1QH1A 1ML4A 1V43A 3PIRA 4TXLA 3B85A 2X4GA 4A9AA 3IMGA 3PX7A 3QA3E 1FTGA 2O59A 2JJYA 2FUEA 4RDXA 2BH9A 2PT9A 1RHQA 2W2OA 3OY2A 4RMJA 3V8NA 1Q21A 1A95A 2LUOA 4DBLE 4EAAA 3AFMA 3K92A 2GNPA 4F9TA 4G8BA 1UPXA 2PZLA 4U6NA 5BT9A 2REOA 4NARA 3VVMA 2PH7A 3FHJA 3GJ0A 4NE2A 5JASA 4U9IS 1HZJA 1GCIA 3RVQA 2VJMB 4JD5A 1ZK3A 2IOQA 2B8WA 3PHJA 4IGKA 2EL7A 2VS1A 3GYGA 1JDJA 2ADFA 4B3BA 2AMLA 4KOEC 1ZH4A 2ZRIA 3GRCA 2QTCA 3HC7A 1TYCA 3NC4A 2ZBVA 4G1EB 3W8RA 4ZREA 5B2FA 2GWRA 1NRJB 2FLWA 4G24A 1AMNA 4YLYA 4CM6A 4P92A 3P94A 3V1TC 3QE9Y 4WLUA 3LJKA 1J06A 3KEFA 4RVOA 1NT4A 4DKJA 1W6UA 1I9GA 3EA4A 4P83A 3RF6A 1V5GA 2HSGA 2QRVB 2XOXA 3B3FA 4M1MA 4EF4A 2VTBB 3AZQA 3CYFA 3EVNA 5BYBA 4BV2A 2R8XA 1OF1A 4MKIA 2I8LA 3REGA 4HX2A 1YC2A 2GZMA 2OV3A 3KL2A 3VOAA 2PIAA 4U7WA 4BRZA 3ETNA 4HZGA 5DNEA 5HILA 3THOA 1FFDA 9GPBA 1L7PA 1U0EA 3S0JA 2JAWA 2V3VA 3THXA 3F49S 4KQXA 2AF4C 4RVCA 3B70A 4HH0A 3TSCA 3T3PB 5D3QA 1KBZA 1KGSA 2BBTA 2BCEA 2NYVA 3V2HA 1KO8A 3PJRA 4UARA 4E03A 2XLCA 4DF3A 1W2GA 2FH5B 3KEQA 4J6FA 2ZWAA 3WNVA 1J25A 1R0BA 1XMVA 2FZKA 3KU1A 4GX0A 3ZI7A 3EXEA 4BWYA 1JQKA 1Q74A 4AL4A 1TB4A 4NLLA 4MUIA 4XXHA 4P7JA 5GGYA 3PI6A 5CM8B 4KNVA 2J31A 5FD8A 3V80A 4HEHA 4A0FA 1PS8A 5AOVA 4CM4B 4ZIRA 2LIPA 2P91A 3FNBA 3C24A 4KGVA 2R1VB 4JEUA 3TLGA 4YUZA 4BFWA 3FRJA 3DTTA 5JWOA 1E1QA 2YHUA 3HU1A 3L0ZA 4L27A 4QOGA 4RV9A 4QU5A 5FTJA 3S70A 4KR0A 1I13A 1PJZA 4H0CA 1JMVA 1NU6A 1YZQA 2QUJA 3SFVA 2II6A 1IG3A 1OY1A 2OHIA 3TRIA 3ZU4A 3GEMA 2GFHA 1Q1AA 3CZRA 3GR6A 3EIQA 4FEEA 4AM8A 1M2KA 2W5UA 1SEPA 4FS3A 2GEKA 1C8BA 1TF2A 2G9UA 1XD2A 2XUHA 1JKXA 2ZRFA 4OXRA 3SZLA 4OJKA 4ZI5A 5BYAA 5TF4A 4Q4HB 3UEOA 1KI8A 1RAHA 5CFPA 5ITSA 1AXEA 4BZQA 1W73A 4FYWA 4MCJA 2V4ZA 4V39A 2HQBA 2KBEA 1XXHA 4COKA 4EKNB 2QTHA 4JB8A 2HCBA 3RGWS 3C8MA 2QUBA 1D0SA 3GLVA 4KXMA 4L5JA 4BLPA 3DOHA 1G8JA 3RRJA 1NAIA 1TLFA 4ZU1X 1CEXA 4X93A 5HM6A 1Q7TA 2HK6A 4XWAA 3AUXA 4MQ4A 3T7IA 1K4KA 4UVIA 3R2JA 2R6CA 1SUPA 3JU3A 4F0JA 1T5SA 3CVUA 2JKYA 1AN0A 2V1XA 4EECA 3CSDA 2WQZA 1P73A 4FR5A 1C9JA 1H6DA 1T1IA 3CR8A 5FOVA 4C04A 1SBZA 2Q3DA 2IWRA 1U2EA 1ZD5A 4LJ7A 3T9AA 1RPNA 4QQKA 3UT6A 3T3OA 1I7DA 2JIZA 4YCAA 3U7JA 4DCTA 4G0XA 5THXA 3ROFA 1JKJA 4YRKA 4C4TA 1FMTA 1GR1A 2D74A 1MV5A 2C4VA 5DLPA 1P2TA 3OZDA 2BFWA 4YQEA 4BQPA 5LXTB 1DTSA 3DUWA 3SG0A 5A1TA 1QMPA 2FDRA 1Z06A 5HTKA 5IVKA 3B6ZA 4U2GA 5CIQA 3TZEA 2Q0XA 3F4LA 3GQBA 1AQJA 1FSSA 4I55F 5ARCA 5EIBD 5LDHA 5DVZA 2B9EA 1CUEA 1T3GA 2BHNA 2ZB4A 2GYUA 3RG2A 2VYNA 4B83A 1B6TA 1CJUC 2WJHA 3D64A 2CZGA 3Q1LA 4L4YA 3DBHB 3K8YA 5T64A 3TYXA 3NONA 4MRRA 1XMIA 3AC0A 1HLPA 2JJ1A 2O7SA 3QXHA 4GSYA 4HR7A 2Q4BA 3CNHA 4R1NA 1EWYA 5FR2A 3REFA 3A11A 3D6UA 2ZRLA 2RG7A 3Q5EA 4Q3KA 3ZE8A 4EP1A 2HTFA 2VBCA 2AF3C 5AM2A 1ADJA 3TJZA 3G9TA 3G9QA 2ZBEA 3K0HA 3LUPA 1A2OA 4YAFA 3EVFA 3PFGA 1GTL1 1XZMA 4RA9B 3RK0A 3SPXA 4WFKA 2FPSA 1Y81A 4C0WA 5AIBA 1XFDA 1W8DA 4TV8B 5CIWA 1PQPA 1E3SA 2HMVA 1JA0A 1RXUA 2LDBA 4EO7A 2YXDA 4QBKA 4CEIA 1RLTA 2R8PA 3P97A 3UATA 2FEPA 4IKPA 1NUPA 1P8JA 4GLOA 1T8UA 2X0RA 3ADOA 4HGNA 1XLVA 3PLNA 1T6YA 5FBZA 3OJ0A 4Q3DA 2WSBA 4R1QA 2IHNA 3PT9A 2G71A 1J5XA 2Z2YA 3FLBA 5I9TA 1LVHA 4B33A 1ZWLA 2ZOSA 3EARA 1E64A 4ZYXA 3QBVA 2P6NA 2XCOA 1MZPA 2JCXA 1YRLA 3K5PA 4RSHA 1ZH2A 2GA9A 4KE7A 5KOJA 4DJ5X 4LF5B 2O8EA 4QGBA 1E2LA 5FQNA 1SU8A 3KAQA 1C4KA 1NX9A 2O5VA 3T3IA 3DR3A 3COPA 3Q3IA 4ZV4A 2VEOA 1BHJA 1CNEA 2H0AA 4DV3B 3MIZA 4R8LA 2GD0A 1FU7A 3FSGD 1ODKA 3RS7A 3Q9LA 3TTYA 2YW2A 2D3TA 2QAGB 2OHHA 4YIHA 2HWUA 3QWAA 3TLZA 2Z8YM 1KZ7B 4NYJQ 1VE3A 2RC6A 3GBPA 1GT6A 2PR7A 3F47A 1UKCA 2QJTA 1CJTC 1NBAA 4UUQA 3HU2A 5DOZA 1QZUA 1R4ZA 2JA2A 3V5NA 1ZC4A 4QEZA 3D54D 4F11A 4QU9A 3WLIA 1K0FA 1U99A 4EBFA 2YJ4A 3HJTA 3OKPA 3NVMB 4IUCS 5FB3A 3ITNA 4BEVA 4D4KA 1QJCA 5EMMA 1OC2A 3VZSA 2YFQA 1E3JA 3BIOA 5C32A 4FYKA 2NPFA 1LSUA 4IQ4A 3TNFA 5A5FA 1YS9A 1P1CA 2HHAA 1P72A 4P54A 4O4HF 3NV9A 3UJPA 3SY8A 5ALHA 1JAHA 2PO5A 1Y8QB 3ILXA 5FBVB 6YASA 2FOXA 5CK5A 4EJSB 5LU9A 1W1IA 3FA2A 3R9IA 2R6JA 4IO1A 3TECE 4CMIB 1U1DA 4GM0A 2BZGA 2OO5C 2YWXA 3IT0A 3TSOA 8LDHA 5EMKA 3A9RA 3KHUA 4QPDA 4IHJB 1YJCA 3J81k 4TTJA 1MQ8B 2NVWA 3HJAA 3LXXA 3WWPA 3MMSA 4ZYVA 1EDBA 4GECA 3I2YX 4OCZA 3CLVA 3V8MA 2H00A 4ENSA 4ZEVA 3BXOA 4RQBA 4MPTA 1PWYE 13PKA 3REQA 1EXNA 4H77A 3MLBA 3ZBTA 4KX5A 4X8MA 1B76A 5A62A 5B1DA 2QSUA 4TL9A 3MBKA 5L7TA 1JDZA 3LF2A 4XARA 1ZHOA 5F12A 3I30X 1SXJB 3L4SO 3N8GA 3G8CA 4R2JA 3TO5A 3FCYA 1JHMA 1MAVA 2AZTA 2QLNA 3FPLA 1U2RA 1OLSB 2IXEA 3BE8A 3I83A 2DHCA 4N8EA 3ONDA 3VRHA 3K16A 5F7XA 1JAZA 1K8ZB 4G1VA 1G20A 1RAFA 3R9XA 5IWAB 5L4SA 1HA3A 3JALA 4CLRB 2UVPA 3U0BA 3UA4A 1W48A 2C1XA 3CISA 3WMFA 1SG6A 1L5HB 2FKNA 4Z8XA 3KE9A 1QHNA 4DIBA 3LPCA 2ZITA 1SCJA 2WM8A 1XVAA 2AZDA 1E79A 2ODQA 2CF6A 3EJ6A 1Y6FA 1UT6A 5CA0B 2WAMA 4KQMA 4D3SA 4ZI3A 4LOKA 1JMKC 3ABSB 4GMKA 3U56A 1AGRA 4GXNA 5E8RA 1W85B 1N0VC 1T8PA 4K2AA 1J20A 2XE4A 1JFLA 3R3UA 3KYDA 3W8NA 4TM8A 4UM7A 1FRVA 3IUMA 4QXAA 1RWKA 5K03A 3T06B 1NMYA 1SQGA 3FNRA 3EFOB 1O95C 3QIAA 2QI9C 5BN4A 3C3JA 2IYXA 5L6LB 1FYXA 4A2WA 4O33A 3OTWA 4P3NA 5F7OA 3TPZA 1R0ZA 5IF3A 2D6FA 1DO0A 2JK1A 5JATA 1G9TA 3VBCA 1VPDA 5E1MA 3R09A 5I7WA 3MRTA 2QQGA 1WB5A 4U7FA 4E0BA 1XJCA 4R5HA 1KYZA 1PFYA 3UTDA 1PNQA 2BSXA 2J07A 2X1HA 3G8YA 4P1ZA 2VNJA 4P80A 2FE1A 3VGPA 1I4EB 2TMGA 4UUMA 1TM2A 5L3SA 3CF2A 2Q6TA 3LBHA 1EGHA 1OI3A 3AU9A 3ZCXA 4KHZA 4DWOA 2FI1A 4F4JA 1DQZA 4S1VA 1Z25A 2OESA 4QUDA 4RJIA 4UM9D 2D1QA 4IVPA 5SZHB 5HF9A 4F97A 3WXMA 4TQAA 5BR7A 5CB4A 2I33A 3CZ4A 2A0FA 1NJSA 3C74A 3EXHC 3DP7A 3GC6A 2E4XA 2HD4A 1JDSA 3K9BA 2E89A 1Q0TA 2WKQA 1NR1A 2F1KA 1QOZA 1PTJC 3OT1A 1TJYA 2JIRA 4HDAA 1S2DA 3U6BA 4X92A 1NW9B 4TSFA 2C2XA 4EABA 3O3NB 4TL7A 4PSDA 4X24A 1NNEA 1FXSA 1CIVA 2MYUA 2PLRA 2CXQA 3JRNA 1FP7A 3LBFA 3QPUA 4X1KB 3RUEA 3WLKX 3ZHOA 5AD1A 1A04A 1YUNA 2CJXA 4DUYB 4DB2A 3PVZA 1XMXA 3BB3A 4CKBB 4BKMA 2XUJA 2E48A 4ZWNA 3T41A 4P58A 3L8GA 3ORRA 1Z73A 3GJ7A 4Z7OB 5AW5A 4HC4A 5JY6A 1QTIA 3NR2A 4QBFA 2CVOA 1JW9B 2H2IA 3LL7A 4I9FA 1RM5A 3C39A 4X44A 3LY7A 4JY7A 1XQVA 1Z16A 4BB0A 1Q77A 4I6GA 4JL8A 3UCXA 3L7NA 3ZIAD 4EGFA 4QG7A 3BX1A 3JQFC 3PL1A 3SE0A 1EX9A 1HQDA 3NT4A 4HYEA 5KSPA 3T9EA 4QOFA 1HMPA 4MUMA 4XGIA 3UYKA 5CLFA 5L45A 2DWQA 4HRVA 1J70A 1J0DA 3SLGA 3IQXA 4IJ6A 3WNQA 4Z51A 3DCNA 2VPQA 3KU4A 1PZEA 3UAOA 3QW2A 1NYQA 3BE6A 2GZAA 3EW9A 4OQPA 1NG1A 1NSFA 1X80B 5JXIA 4IM7A 3UCFA 1MMFB 2WHXA 3RC9A 3H7AA 1T9HA 4WH0A 5AW3A 5JI3E 4FYIA 2H48A 2AVDA 2OAQ1 2XDQA 3A2LA 3BM5A 3L43A 2FKAA 3ACCA 4HSGA 4PZUA 4YA6A 1X1CA 5I3CA 1OPXA 1Z28A 5C7LO 1I94B 1RWBA 4AJ2A 4UCQA 4F91B 3AK4A 4GOXA 4BKPA 5F35A 3DNFA 3CJTA 3OPXA 2JB9A 2OB1A 2WV9A 4FOOA 2V96A 1ZJYA 2C31A 3LVQE 2OCIA 4KLCA 2CLHB 2EHDA 4YDQA 5I5EA 5IT9A 1I10A 1PGPA 3AR6A 2D8AA 3SAJA 3T5DA 2VDMB 1QBGA 3FNFA 4E5NA 3ELYA 2VDWA 2VZEA 1NY6A 3RIYA 1T8RA 1G9SA 2ODNA 5EJMA 1VJ1A 2Q0SA 5E6UB 5E6SA 1M5UA 4OHPA 4C0BA 5CEJA 3ORFA 1D6JA 4PHHA 4HI0E 4QM6A 4YUXA 2VHZA 4HFJA 3VPGA 2Z83A 2BFDB 1Y7LA 4YC7A 2ORYA 3EFBA 3IS3A 5CVJA 3NOQA 2DCMA 2P2SA 2OKCA 1NKSA 4GKBA 4CKEA 2QV0A 1PUJA 1RIIA 4L85A 3WGQA 3UHOA 4R2KA 1VSTA 5HF8A 1EFHA 2H63A 3EGOA 4XJVA 3TD6A 1P1HA 1Z2OX 3FWYA 2FCAA 2PGDA 4ESVA 1ETUA 4GRDA 1XZCA 1XF1A 3UWPA 3PTZA 1GYQA 5CDSA 1Z88A 3LT2A 5FPHA 4X1YA 3G2PA 3LYAA 3R5HA 4QGFA 1CQIB 3OFNA 4BIIA 3UB3A 5KNBH 4YCNA 3K2IA 3JQ7B 3KXDA 1OB5A 3UY4A 4RENA 4CXMA 3AQIA 1BGVA 5BV2P 2CUKA 4FOSA 4U7DA 3KQHA 3INRA 1K3TA 1QRSA 2AI1A 3W2IA 1PS0A 4MKHA 1GEGA 4XM2A 4DCUA 3FVTA 1V3UA 3IR5A 4D1YA 4H4CA 2PAFA 3B52X 1VECA 5EHQA 3MJ4A 1I3LA 1G8YA 3VR3A 2R5FA 1RI1A 5CRIA 2ZUWA 2YWEA 4LXTA 2VP6A 4TM7A 4JU9A 3N2KA 5FTWA 1OXTA 4IIHA 4YCLA 3IYLW 3R7WB 5BN5A 3DYIA 3K0SA 4CPDA 3M81A 5KVSA 1Z07A 4MVCA 5AVQA 1JFRA 3OU2A 1FS6A 4KGXA 3A6ZA 1KP2A 4J0KA 4QU8A 4UBOA 3NNNA 1IQ0A 1IB0A 1P0PA 1Q11A 1QGUA 3PNMA 4MVYA 1MJNA 3KXPA 2OXIA 4RPLA 3HBMA 4RHYA 5JY1A 4FHDA 1EFVB 2BY4A 2ZWVA 3D4IA 3GDFA 1AU9A 5LYJB 3K6SA 1QIFA 4YJFA 3NLLA 1E9CA 1JLLA 3E0QA 4J91A 3HY6A 2CVQA 1OYOA 1QAQA 1MB9A 2WHRA 3M6FA 1JHAA 1PGNA 3U26A 2IPXA 4DV0B 2EQAA 4ND2A 3RRBA 5CEFA 3S3TA 2RC5A 1SUFA 3BIWA 2PNFA 1UT8A 4D26A 2E5FA 1LDGA 4J3JA 4TUYB 3TOSA 2CLFB 1E2DA 2JLCA 2QQEA 5EERA 3WQHA 1D6NA 4CM9A 5HKAA 3B8HA 1XD8A 2AJCA 2PGNA 1VCIA 4DVGA 1GVHA 3RYFA 3K05A 3SOPA 1UC8A 1NULA 1K5GA 1MIHA 2FX2A 4QGGA 4XSVA 1CQXA 3NXSA 2CUTA 3P9NA 4KFUA 5C8YA 5FV7A 3THWA 2VF4X 2HA2A 2FJ0A 2J5RA 1NVBA 1KYXA 4G4SP 5JSFA 2XLBA 4DDTA 5KYNA 1ZVVA 3F6BX 1CETA 1H8ED 2GD1O 1IN4A 3X3HA 1QQBA 4X7RA 3QKSA 1KTIA 2BMFA 4H08A 2BSQA 2H29A 2WM9B 5IBPA 1X1TA 1M5TA 3JARA 4B87A 1R6XA 1PUXA 1UBTS 3L0CA 4KSCA 5GIOE 2NV6A 4U00A 4MEAA 3EGVA 1DFIA 5LQUA 4M37A 3Q8MA 5EHNA 2A35A 3K5HA 4D9BA 3BMQA 3ZCQA 1FFBA 2Y3IA 2R25B 4BLUA 4JUFA 1WW2A 5DE3A 5HRAA 3FVQA 3EPPA 5DO9A 4E5DA 1FXWA 2HWKA 1KFEB 4JP2A 3RVOA 4DNPA 4ES6A 4MYDA 3M7IA 4QYTA 5DIZA 1AKWA 1U9YA 1H69A 1X7WA 1CLEA 3AR4A 4AJ9A 4QEDA 5AKZA 3CNEA 4F6RA 2A5DA 2XMQA 1E8DA 3ROKA 2IDZA 2WVHA 3EQ8A 4EF5A 4EDFA 1KORA 5FNVA 4CCAA 5MHTA 4W5JA 2W2LD 1G8FA 3THYB 4UDYX 3NVKI 3K73O 1EXMA 1CUZA 2X77A 4OQ4A 4Y6RA 3TJRA 4BNHA 2LV8A 2D5CA 1EFLA 1FJGB 5D84A 2QE6A 2BR3A 2OGUA 3IP1A 2WWXA 1KI7A 4LZZA 2FQXA 2XCTB 5A4AA 1JKIA 1KK1A 4PZ0A 1H4QA 3IAUA 2HV8A 2PX3A 1E94E 4TXHA 5EYPA 2Q7DA 3ZYCA 2Q5EA 3C3PA 5JE8A 2WFLB 2P77A 3HCFA 1PJ8A 1NZDA 5JRZA 4IDQA 4CU2A 1E6KA 1NUUA 4QUAA 2UUAB 1QYWA 1AQNA 4OAQA 5BNFA 5B1EA 3S81A 3GX1A 2PGAA 5CITA 3MEQA 1NI4A 2GF2A 2RHGB 1I6MA 3E61A 1KZ6A 4WGFA 3WMEA 4O0LA 4IXNA 3AR2A 1NPYA 3LCRA 3HM9A 1F8FA 3VBEA 4WECA 3ADDA 1HE2A 2P9TA 2GKOA 3P2OA 1FVFA 4UJ5A 2JLQA 1Y98A 2SBTA 4Q9NA 2FR0A 3I0NA 4WJZA 2ZJ5A 3QLUC 2FW8A 5AKIA 3ANTA 3V1YA 2CLMB 2O54A 2AUMA 3EEYA 5BWLA