3L8FA

Crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli complexed with magnesium and phosphate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
183
Chain Sequence
SVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
publication title Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 53
structure length 183
sequence length 183
ec nomenclature ec 3.1.3.82: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l8fA00
2PKEA 3GYGA 4HGRA 5ALZA 2Q4TA 4BEWA 5AW4A 1RDFA 4QJBA 1LTQA 1RRCA 4G9BA 3NIWA 2HDOA 2W4MA 4OHFA 1RKQA 3E8MA 1Y8AA 3UMCA 4CE6A 4UW9A 3WKCA 4YCNA 3K1ZA 3WKAA 1WVIA 1LVHA 3N8GA 3OCXA 5AI4A 5ALKA 3B9BA 4UASA 4I9FA 3W5DA 2B8EA 5AM3A 5AW5A 2WHEA 4YIHA 4HGNA 3WGVA 5AKZA 3SD7A 3ZWKA 2EAUA 3WKDA 5ALRA 2YJ4A 2BDUA 2VKQA 3WK9A 5AW0A 4HGQA 1T5TA 3B9RA 2ZXEA 1TE2A 1L7MA 1RLTA 2OM6A 4GIBA 2OBBA 3FGOA 3UMGA 4C4TA 3QU5A 3MMZA 3WK4A 2WFAA 1QYIA 3U26A 1L6RA 3B8EA 2MSNA 5AVRA 1NNLA 3ET5A 3A3YA 5AM2A 2IYEA 3QX7A 3UM9A 3AR8A 5IS2A 5IT4A 1O08A 2YJ5A 4BEVA 2HHLA 1RLOA 4XE5A 3KD3A 3A1CA 2GHTA 5AKKA 2RAVA 2AGVA 5E0OA 5AKIA 2CN1A 3E84A 5AK5A 1QQ6A 3MC1A 3ZW7A 2O9JA 2B82A 3NAMA 1ZD2P 1RKUA 2QLTA 3NRJA 4UMEA 1K1EA 5AM1A 3I28A 1T9ZA 3CZ4A 3N1UA 3R9KA 1S8OA 4XQ0A 5ALDA 3SKYA 2RB5A 3RF6A 1RKVA 3CNHA 3OCYA 2ZBEA 4BX2A 4EX6A 2P69A 1EK2A 2WF6A 5FP0A 2FPSA 3ZU6A 1L8LA 1Z4JA 2G08A 3KZXA 4OFZA 4UATA 4Y2SA 1TA0A 3QYPA 2EARA 2ZOSA 4Y2XA 4E88A 5ALPA 4JB3A 1U2SA 2FPUA 1YV9A 3M1YA 3QUQA 3SHQA 3FM9A 2JGAA 2YBDA 1J8DA 4CNQA 5AM5A 3WK8A 2FI1A 1L7OA 3WGUA 2YMLA 5ALVA 1Z88A 3KC2A 3DNPA 3DV9A 4MUMA 5AI6A 1XVIA 4CF3A 2C8KA 3QXGA 5A3QA 1L7PA 3BWVA 4EX7A 2ZBDA 3ZX4A 2G80A 2C8LA 3DDHA 3PDWA 5ALOA 2OYCA 2R8EA 2R8YA 1VJ5A 3ZTYA 5JJBA 3IJ5A 2CFTA 3F9RA 2JAOA 3AR6A 4KNWA 1T5SA 4Y2RA 2R8ZA 1PW5A 3PCTA 2YMMA 4UMDA 5ALYA 4Y2UA 2B1RA 3QUTA 4KN8A 4PNHA 1YMQA 5AKGA 3U7HB 5T41A 2HX1A 2QYHA 4UU1A 1U7OA 3EWIA 5AVZA 3QLEA 2HEGA 5ALGA 3ZUPA 1U02A 4H1WA 5AM4A 4BX3A 2G1AA 4EEKA 1ZS9A 1SWVA 2HOQA 2JAWA 1NF2A 2BY4A 5ALWA 5AI9A 2JARA 1KYTA 3S6JA 5AW8A 4UAVA 4XOUA 5ALSA 4NWIA 3A1DA 4ZEWA 4Y2QA 2FUCA 2ZBGA 3L8HA 3J7TA 3KOOA 4BKMA 5AKLA 3AR5A 3ET4A 4DFDA 1ZD4A 3OCWA 2ZBFA 5AKXA 3OCZA 3R4CA 3AR3A 3QUBA 4F72A 3A1EA 5ALLA 2YN4A 4KX3A 3SF0A 5AESA 3ZVNA 4YIKA 3DAOA 3KBBA 2I33A 4UM5A 1ZJJA 3QU4A 1TJ5A 3QU7A 1FEZA 3WK6A 2YMQA 2C9MA 2HF2A 1ZRNA 4XPZA 4Y2PA 4NABA 3KDPA 1U7PA 1VFPA 2G0AA 5AVYA 3AR2A 1RPZA 2HF7A 1YJ5A 3SMVA 4MWOA 4BBJA 2Q4RA 3NASA 5AKJA 3TLMA 3WK7A 3QNMA 3BA6A 3FVVA 4O8CA 3PGLA 1RLMA 3U7EB 2CFRA 2ZG6A 4Y2JA 2W11A 1S2OA 2NO5A 5AI0A 4QQFA 3ZX5A 3U19A 3L8FA 3L0BA 1ZD5A 4B6JA 1WPGA 2HO4A 2O2XA 4HGOA 2NO4A 1J97A 1N8NA 1SWWA 2R8XA 3AR4A 3L8EA 4G63A 2I55A 2W43A 2Q5EA 2YJ3A 1NRWA 5ALFA 2GFHA 4BNDB 5AI5A 4FYPA 4ZEVA 2C88A 5AVTA 3W5AA 1QQ5A 5AM0A 2AUTA 3AR7A 2P9JA 3EF0A 4JDPA 5AW7A 3R09A 5AK6A 4EELA 3VAYA 4BNDA 3ZVLA 3OTQA 2HSZA 4EZEA 3N07A 5AHXA 4ZEXA 3MN1A 1CR6A 3OCUA 5AW3A 1Z4MA 2DQSA 3PGVA 3E81A 4YGYA 4HGPA 3W5BA 2B0CA 2P27A 1TJ3A 5A3SA 2PQ0A 4AS2A 2WF9A 5AVQA 3OPXA 3L0CA 1RQNA 4L6AA 5AKYA 3L5KA 2WF8A 4CF5A 2IOFK 5AVVA 2HI0A 3L1VA 5ALMA 1SU4A 3EF1A 3SLRA 5AVUA 3HLTA 5A3RA 3I1YA 1YNSA 2CFSA 2AH5A 1QH9A 2NYVA 1RMTA 2FUEA 1N9KA 3RFUA 2I34A 4UMVA 2YFYA 3ESRA 1MH9A 4NFLA 3QU9A 2P11A 3AR9A 2B1QA 4YCLA 3ED5A 1RC8A 4EENA 2RBKA 2YJ6A 1XP5A 5AK4A 1U2TA 3ZTWA 3I6BA 4F71A 2OA0A 4AP9A 4IG4A 1L8OA 5ALUA 3U7FB 1Z4KA 4UARA 4HYTA 4C4SA 3NUQA 2FPWA 1RQLA 4Y2TA 2FDRA 1Z4IA 3L7YA 2C4NA 3ZWDA 5ALXA 1YS9A 3N5KA 3UMBA 5AW2A 2JAUA 3E58A 1YDFA 4KNVA 4IFTA 4Y2YA 3FPBA 4NAVA 3ESQA 1AQ6A 4L57A 4RETA 1Z4NA 1WZCA 2B30A 3QUCA 5AKEA 3L0YA 4HAIA 2YMPA 4FE3A 1Q92A 1Q91A 5ALTA 4UM7A 1WR8A 4Y2VA 4KX5A 2IOHA 4J03A 3QU2A 2WF7A 4FFDA 5AIAA 1ZRMA 3NALA 2IOFA 3P96A 5AK3A 1VJRA 3W5CA 1ZD3A 2AMYA 2BDEA 1F5SA 1ZOLA 4CF4A 3SKXA 2GHQA 4YCMA 4OD0A 5AVXA 3EPRA 3NANA 5AICA 3L8GA 4BX0A 5IT0A 1Z5GA 5AKHA 1Z4PX 2G06A 5AIBA 3U13A 4DW8A 5AW9A 4AS3A 2HCFA 3U7GA 2WM8A 1Z4OA 1XPJA 5ALQA 3D6JA 3L1UA 1Z5UA 4I9GA 5AI8A 5AVSA 2B8JA 2IA5A 4GXTA 4UAUA 2I6XA 2G09A 2PR7A 4L6CA 3HYCA 5AW6A 3MPOA 3WKBA 2I7DA 1TJ4A 4OCZA 3I76A 4BYGA 1RMQA 2EATA 2ODAA 2GMWA 5ALIA 3ZVMA 2D2VA 2FPXA 3WK5A 3ZI4A 1O03A 2MU1A 5AW1A 4YH1A 1Z4QA 2GO7A 3WKEA 5AVWA 3M9LA 4RESA 3OCVA 4UU0A 3FZQA 3QGMA 2WF5A 1RMYA 5ALJA 5ALEA 4J2TA 5ALHA 5ALNA 4Y3UA 4NV0A 1EK1A 1JUDA 2FPRA 2I54A 4DWOA 1CQZA 1Z4LA 4C4RA 2YY6A 4DCCA 2G07A 1X42A 3FPSA 4UMFA 1L7NA 3ONNA 1IWOA 2X4DA 1QQ7A 2FEAA 3IB6A 2RARA 4KYTA 3N28A 3IRUA
chains in the Genus database with same CATH superfamily
1C3LA 1JR3E 1DCKA 1KBOA 1P1HA 3UG7A 1P4RA 5E95A 1Z5OA 3CZMA 2XIJA 1JPJA 3GT7A 2WP8J 3V4LA 2VXBA 4NICA 1THTA 3ESXA 3QPUA 4GL4A 1OAOC 4YAEA 2ZPTX 2O2DA 4DS3A 4XQGA 1X77A 1P6UA 1NQAO 3WLKX 5DP1A 4Z7JA 2UU9B 2AN4A 2VRNA 2PFSA 2BHNA 3G2LA 1B8UA 1N8SA 1GSAA 2BE9A 3C1UA 4KZPA 3FJ1A 3W04A 5GJBA 1EGHA 1NQUA 2ZTVA 3R6WA 4HB3A 4CF6A 1ONSA 4DR7B 1CYDA 1E8MA 3W9UA 4CF7A 5IC6A 3STXA 2YC2C 2VDLB 1O58A 2C58A 2REXB 2QM0A 4RSRA 5LDGA 4Q00A 4FFPA 4UASA 2WIBA 1F1JA 1Y81A 3DXFA 4BGDA 1N6IA 2HCTA 3QF4A 2P5YA 1U5BA 1I3OA 1LLFA 2K5UA 4MP6A 4ZVQA 1WSDA 2AOXA 1PVDA 2HJGA 1ZC3A 2SHKA 3QLTA 5AKZA 1TDJA 4P53A 1KOLA 2PVCA 3EPLA 3OC0A 2QLFA 2X14A 1ND5A 1RZVA 3LBIA 4LJKA 4RENA 1EB8A 1G64A 4M46A 3CX8A 1DKUA 4D6PA 4AO8A 2BDUA 3LOPA 1HNWB 5IDVA 3VZPA 1LC0A 3V9AA 4E5KA 1Z5WA 5AW0A 4LYAA 1B0UA 2H2WA 5AYVA 5C31A 2QU8A 2ZXEA 1KVUA 2D62A 2WG0A 3RC2A 1TE2A 5CA0A 1W52X 4L15A 3EOAI 2Q9CA 2H1RA 1RLTA 4Y9TA 3VVCA 4OQXA 4EW3A 2PCLA 4TYMA 1DRWA 2EFEB 2NLOA 1RQRA 4Y1RB 4YGXB 4EGJA 3M1IA 5DNVA 1H22A 4X20B 3O8RA 4I1VA 4EGCB 2PMDA 4BUCA 1IVYA 3W6NA 4MKZA 3R75A 1KY4A 2V8BA 2VUUA 4NPHA 2YV2A 4B8WA 4KP7A 4F91B 5IT4A 4DADA 1O08A 1NU8A 2C3UA 5KI6A 5BT8A 2D7DA 3SXUB 2CDRA 2ONYA 1T9AA 4NMWA 4C0JA 3K20A 2P6PA 1VMKA 1M8FA 3BSYA 2W71A 3NBYC 1RACA 3L7MA 2OV4A 5A2GA 3QWHA 4P31A 1KO4A 3P45A 3OFKA 3PFWO 1FOEB 1QPGA 2EG9A 2WOOA 3VRHA 3VVLA 3H05A 2VTKA 5F51A 2BTEA 2X0EA 2I67A 2WUDA 2VIIA 4KWIA 5ADUS 5AKIA 5KYWB 2WMNB 3KQOA 1USWA 3TE6A 1LJ8A 4DG5A 4DPKA 5TY0A 3W2EA 2RGWA 4EPYA 3OTOB 1EU1A 2VS1A 4DSNA 1PW7A 1DJOA 5IM4F 2XMPA 3PDJA 3ZZTA 1CUYA 2A92A 4I66A 1MP0A 3S7TA 1U7WA 3AP3A 4B85A 1X39A 1Q14A 4LHSA 4WT7A 4M9QA 3I28A 1T9ZA 1QHSA 3HFGA 3LF2A 3D6NB 2R6JA 2OMKA 3NS7A 4B46A 1I1HA 2VSQA 1O96A 2XDQB 1W94A 1MABA 2AC2A 2WD9A 4Y6LA 1BJTA 5EKUA 2DY0A 1CR4A 1ZCAA 4N9QA 4IXMA 3A58B 1EG2A 3LYAA 4LNUA 5FP0A 4CQJA 3I4FA 4TXMA 4V24A 5I3ZA 1EUDA 1L8LA 4O4HA 2VEDA 4D0RA 2NQ2C 2CLCX 4Y2SA 1HDIA 3T7SA 3SK0A 3CE6A 3D6MA 4C3UA 1XRJA 4BKRA 4D2IA 3C5CA 1CF4A 2ZK7A 4LZWA 4YMUA 2V6BA 1AHNA 1WUHS 1ZINA 2W2MA 4RZUA 4JGGA 4PPYA 3RVBA 4HFRA 1VP3A 5JY1A 1J25A 4BL5A 5A4IS 3A1NA 2XKAA 3EXFB 3NOXA 1DEOA 3SHTA 3Q8WA 1R6XA 5AJTA 3DSRA 5JCJD 6REQA 4A0RA 4XR9A 1XTTA 3CN7A 1NVTA 2JJYA 1OW3B 4X90A 1VI2A 2O1SA 4K9KA 2YZKA 5I9NA 1USUA 4TZTA 4X6UA 1IU9A 2IHUA 3AL0C 1UZNA 4U7GA 3ZW9A 3LHDA 5LZ7A 5LP6F 2H4WA 3DMFA 1P6XA 1ECGA 1UEIA 2Y1DA 4FXOA 1Z68A 4LISA 4ZCQA 1C9KA 1YQXA 4UD2A 1Z12A 5DM2A 5P8WA 4S0XA 5C3UA 3NVKI 4HADA 2H1LA 3V7NA 1M2VA 3IULA 1SUSA 5T64A 5DHSA 2G80A 2QRLA 2G3YA 2J3EA 2PMKA 1QHIA 3KFXA 1SPBS 2RJ3A 1BXRB 3PPVA 3PR1A 4FGWA 3UIEA 3K0CC 1GL7A 3A1TA 4EO9A 1VJ5A 1WSBA 3ZU5A 1IBSA 1WMBA 1QM5A 3NVMB 1E63A 3ORFA 1H0HA 1DKQA 1OX4B 3OOJA 4TLMB 3K09A 1A2OA 4QUHA 2VDKB 1VI5A 4BVJA 5BV7A 5ER9A 4IHJB 3GEGA 1GPJA 1Z39A 2JIDA 3ASVA 3OOWA 4ZQBA 4DLVA 5ARBA 5HZGA 4GDMA 2JDIA 3LQ2A 4GMHA 4DBLC 2QRHA 1QYRA 1U2QA 4AWBA 2W58A 3FRJA 3QPVA 1W4RA 3BIJA 2WC1A 3HWSA 1LK0A 2ZWMA 3IVAA 3OT4A 4OHBA 3T9CA 2JAHA 6ADHA 3UHOA 4GRDA 3DFIA 5DDIP 1CR2A 4FHFA 2EF0A 4GXNA 4HX2A 1AKTA 3EMKA 4EA7A 1WETA 5ES3A 1G55A 3HM2A 1Y3BE 3NV9A 4U3JA 4EPTA 3A6LA 3KP1A 3LVFO 5TEWA 1BE6A 1M6NA 3IAS1 3ZEAA 3HJTA 2A9VA 3EXAA 3FNFA 3WMFA 2XGOA 2ECPA 2WZDA 2FSGA 1D1TA 2IP2A 4F4DA 1JSZA 1OH6A 2I7CA 2AFIA 3KAPA 2Y67A 2XRYA 4JB0A 4CU2A 5JZSA 2C94A 3PQ3A 1EWRA 4DLAA 1AC5A 3KTDA 3K9GA 1UC4B 3OPMA 1JIKA 1XZJA 4B3BA 1HOXA 3Q6IA 3I9FA 2MOKA 4N6OA 2EW2A 1NJ1A 2WJ4A 4BCBA 1XA4A 4IEIA 4C76A 5K6AA 2RJOA 1RD4A 4G65A 4P33A 2PLWA 4S2UA 1ODJA 1M6YA 3DVRX 2JRCA 5IVIA 4D9KA 3FUWA 1OE0A 4ZA2A 5TQ2B 4RCYA 2OD9A 5LP1A 5CD1A 5ALLA 2XUJA 4EP1A 3RJTA 4GOLD 3QOYA 4QO8A 1WMAA 1HG0A 3C98A 4DDKA 4UCFA 2NZYA 2WWYA 2IXFA 1TK9A 3EZXA 3K8QA 3OCJA 4Z2YA 2Z3WA 2JKVA 1ZJJA 2K7ZA 1U0JA 3CGWA 1KGDA 5EXDA 1ZAKA 2GCOB 2XCIA 3DOHA 3EVCA 4LXUA 2Z83A 4TYQA 1QX3A 3TGLA 2VDJA 4QOHA 1CERA 2C9MA 2GDJA 4P7KA 3OTGA 4K9RA 1C3OB 1OF1A 1EI9A 2OPBA 1FRNA 3L79A 5HGJA 1E79D 2WU4A 3DUWA 4YP9A 2Q2VA 4EF5A 5LQNA 4R98A 1XA3A 4IMPA 4WN9B 3HHPA 1R9MA 1SD2A 1RC0A 2A9JA 4NFYA 5DJ5A 5EAIA 3UVEA 2ZUDA 4AWAA 1RW4A 1UPCA 3FNIA 1GZ5A 1PCXA 5KQPA 5LNK6 4D9HA 5FNVB 3T3MB 3NTLA 4I55B 3TX2A 4KQ1A 3I2YX 4K2AA 5HCIA 4DILA 5HNKA 4KI7A 1CZOA 3KXPA 2D8MA 4MAMA 3MWDB 2AK2A 4WIAA 3DM5A 2UDPA 3D4IA 3AF5A 1RM3A 4TUYF 1G8KA 1JPVA 2PQMA 4O1HA 4P6VF 1WD7A 3EDCA 1FSSA 4HQRA 2PYDA 3AESB 1T9GS 4OMCA 4WNAA 1XL1A 3MLBA 2QUIA 3ENKA 2ZIGA 1PT5A 2GRUA 3PHCA 4G63A 2PJRA 2W6ID 3V2IA 4CN9A 1MHPA 3RAEC 5I8PA 2O8EA 3MQFA 3RBVA 5CFPA 3BWEA 1E3EA 1RHRA 2YVKA 2BR4A 5CDUA 5LZ8A 3PJRA 1PT7A 1PFQA 3MWGA 1N75A 3RS9A 3SQLA 3HJNA 1N92A 1PQPA 1NOJA 3QXCA 3GLIE 1IWPB 3VDQA 3PNMA 4PYKA 1W1IA 2QUJA 2WILA 4MAFA 3IBYA 3D3WA 3RS3A 2NU8B 2W8ZA 1I0IA 5T3UA 2QQ0A 4RYDA 2PGNA 3IVGA 3CZ9A 3QMWA 1YHZA 2ERCA 4KXFB 5EJ2A 1IHDA 4MVJM 5FBWB 1XCPA 4YDSA 3SGLA 1X19A 5FUVA 1O89A 4UDOA 4G0OA 3NP7A 1QV6A 3X1ZA 4E08A 2P27A 4FVTA 4RDXA 4HTFA 4YXFA 3M5PA 1SIUA 2HNBA 4ZOBA 5E2BA 2FEWB 3HXTA 4RY8A 4AJ4A 1N2BA 1PWXA 1TD1A 3NM6B 1QP4A 1FDUA 1LW7A 1QUEA 1T3TA 2CB9A 1BGXT 5D87A 4DDMA 4ZFNA 3EQ2A 3TNYA 3OLYA 1K5HA 1LJUA 1VE5A 3AWDA 5JNSA 1NUUA 1I13A 4X8HA 2QVLA 3PUHA 3NWOA 2BGIA 4XUDA 5A4FS 2B69A 2QN2A 1N25A 1QCCA 2YHIB 2TRSB 3Q9SA 1DX4A 2O5VA 3ZCXA 4D4GA 5IDXA 4TTRA 4E4RA 1NBEA 5C1BA 1QRUA 1V5WA 3W0LB 4OA5A 4LIPD 4FIDA 4ZGGA 1NDHA 3V1LA 1KSJA 4B81A 4DNXA 5CNMA 5TS3A 3FCAA 3NT5A 4YCDA 1NM5C 1EFDN 3DZJA 3PPXA 1EFAA 2J3LA 1EFUA 4X65B 2IH5A 2YDYA 1K3TA 1DJMA 2IELA 3TRJA 1HMPA 5IKMA 3EDOA 3FTNA 1QCDA 3FCOA 3LYLA 1TKBA 3AM5A 4R1OA 4IUYA 2AXEA 3PYXA 5AK4A 3CW2A 5C8VA 4RORA 3I6BA 2G82A 4CN8A 3HDHA 3O92A 5HBRA 1SCUA 3FUTA 4QBKA 5KQLA 1MJHA 1AY0A 2AVDA 4OKNA 2AE1A 4PC6A 5ALUA 4EGSA 2ZU0C 3QBTA 5J4KA 2OAQ1 1WDWB 1ZK2A 1NSYA 2FPLA 4PLFA 5E4YA 2Z2ZA 3JQQA 1JWBB 1WX1A 2QSZA 4HDNA 5DTJA 4BFCA 1IBRA 1EXMA 1ZNQO 4HH4A 3NC0C 2PNFA 4BMDA 4GT1A 4D74A 2PMFA 3WJ1A 3F6SA 3LECA 4RS3A 3GLUA 4XVRA 2JLXA 3QY9A 3T3IA 2ZUVA 3UT5A 3KEQA 2Z1MA 4RKYA 3QKTA 1YUNA 2QP4A 3OAAA 1B0AA 2ZYHA 1CJSA 3Q7EA 4AMGA 2XUAA 3L7DA 3DL2A 3OI7A 1S89A 4YJ2B 1A98A 5KDDA 4DJJA 1TYDE 4U2CA 2AX3A 1G4AE 1KYYA 2PWPA 2CDBA 1FS5A 2JH9A 2XZTA 1YWGO 2J08A 1IUPA 2FWRA 2RHWA 5F21A 2PQ6A 3ACDA 1TIBA 1OPRA 4N6GA 3KDSE 2O7NA 3RHTA 2X6QA 2CB0A 1M5TA 2P3SA 2O4CA 2X0DA 3UKOA 3AGQA 2V7BA 3AV0B 3CEHA 3UWSA 3Q8KA 1ZGZA 5DB4A 1Z45A 2EDAA 2VPYA 3H3FA 4P1ZA 4Z0PA 4A5OA 1EYZA 2JLSA 3EMDA 2ENWA 3E5MA 1Z73A 2WZBA 3JVDA 3P0JA 4URUR 5AOVA 5SY4A 2I87A 3HVIA 4V2UA 1GN8A 3FDZA 3P96A 3VGJA 5IHPA 4H18A 1PJ8A 3CNBA 5E4JA 1UOQA 3MBKA 2AN9A 4GPAA 2O52A 5GZ1A 4E1VA 3ZDXB 3VJMA 5A9SA 1QPZA 4GKJB 4RV5A 3B89A 2WJYA 3VKHA 1UBUS 2CMDA 2RC6A 4CQMB 1CIPA 1TCBA 4BNYA 3UYKA 2FX5A 3AW8A 2EBFX 3DVAB 3FIJA 3IOEA 1NUQA 5CH5A 3NFYA 3H17A 2P9YA 1WDKA 2IYOA 4IH1A 4NOKA 5D2CA 3U4HA 4F6RA 7ADHA 4M6WB 1MGPA 2R65A 5JWOA 2VYND 2ZIAA 2B99A 1PUXA 1RP7A 2BEVA 3AF4A 3IAEA 3LRPA 5ANRB 4E21A 3OG9A 2FZGA 2FMIA 3P9KA 4A2PA 4UCQA 2QJRA 1Z8FA 4OLFA 1TCVA 1GNQA 3QV2A 4P2GA 1T2DA 3CEAA 4PIMA 5HF5A 1CUJA 1ULZA 3OE4A 4I9GA 4H7KA 1KI6B 5DK4A 1TU0A 4ZPJA 4ZTBA 3VYVA 1FMFA 3NM4A 4M38A 2PBRA 1NE7A 3N53A 5FYDA 3OVMA 5LCXA 5BYAA 5BOSA 3BGVA 1K97A 2ORWA 2DHDA 2SKDA 4ILKA 1BNCA 3HPQA 3L77A 5HR5A 3T95A 4BE7B 1RHKA 4PLYA 1Q1AA 3REGA 4N3GA 2YYYA 3ZIAA 4NCKA 2JFXA 4WK4B 1P9RA 4UXIA 1BWQA 1H2YA 1VCIA 3OY7A 1G98A 4KLRA 2GMWA 3EUWA 4LA4A 3Q85A 3U3XA 1KERA 1WCV1 3AHDA 2B6HA 2MU1A 3NKVA 1G9TA 4QXRA 5BYBA 3TXYA 4OUKX 1P17A 1TEVA 2FG6C 2H4ZA 2V6MA 1CRWG 1J23A 3SEQA 1T0PA 2BFDB 1TVEA 2OCYC 2Y9PB 4PXYA 1P7VA 1O4VA 5EP2A 4AXXA 1Q22A 1CIVA 4TYPA 1C8VB 1O3YA 1M6WA 1RYBA 1WPQA 3BCHA 3GBVA 3G0BA 4J0KA 4KSBA 4R01A 3RAGA 1X6VA 2V45A 1Y3HA 3IJEB 2GEUA 4AYTA 4IDPA 1FFDA 2H85A 4RKEA 3W79A 1OZHA 3JAMA 4B17A 2O8CB 2VQ6A 1EPUA 3PLRA 4XM2A 1K7SN 2CCGA 5DWDA 1NVXQ 3R3XA 1L7NA 4HVCA 1EE1A 3JQFA 4LGCA 4XASA 2I2DA 3F2VA 1KP9A 8ADHA 3I2FA 4L1KA 3AUSA 4C2AA 1L1RA 2H7YA 1F06A 1KI9A 1QHHB 2XYPA 3EEIA 2GD6A 3KOYA 5EJMA 3VR6H 3CNQS 3WOVA 4C14A 5JZOA 1AQNA 3FYTA 4Z3OA 1RXIA 3ASYA 5MN6A 3U3RA 1KAHA 3T9BA 3ZE8A 4NOLA 1GAXA 5IJ9A 3JZDA 5F9HA 2AG0A 3O83A 3PD7A 5BO5A 4BY9E 2Q45A 2ZSHA 1ZJWA 1MN6A 4ABYA 4PN7A 721PA 4DQVA 5E4TA 3N0VA 3S2YA 4C2BA 1SHKA 1LI4A 2FSSA 3GBSA 4TV9B 3GYBA 2CV2A 1CPYA 5FKJA 2IOQA 1TFRA 1LS1A 2H2HA 2YIMA 4UUAA 3K6SB 1T29A 2NTVA 1S3IA 2IBMA 3FGNA 3HU2A 4Z1MD 1D0IA 3A2NA 3VA7A 2R6HA 2I7XA 5AJZA 2QY9A 2GM4A 2ODEA 2F6RA 4BJ3A 1QH8A 2FOXA 2EV9A 5LMNB 3HQ4O 1HT2E 3UMJA 1PFWA 4X3PA 3M5WA 4XWAA 1Y9DA 2BD0A 1BU8A 4BWFB 4M1ZA 4B7UA 3MSCA 4LV8B 1M9NA 2VDPB 4GR9A 2CLDX 2HSGA 2UVPA 2EWMA 2E4ZA 4QQNA 1Q19A 3S1AA 3C3PA 4FGJA 4R2JA 1E3WB 1L7MA 3TEMA 1K89A 1Y8RA 1LH0A 1JLSA 4AO6A 3UK6A 1UEXC 2ARKA 3MMZA 4L3VA 3VZBA 3JQGB 2Q4BA 3ETDA 1TM3E 4KQ6A 3FWYA 5IJXA 5TR9A 1KH1A 1J56A 1VHWA 2QW8A 1H69A 3AUXA 4NKRA 4TKVA 1KJ9A 1OFHA 3RVOA 1E2LA 1E60A 2AYXA 1UFOA 3N2ZB 1QE3A 3QX7A 1R4ZA 3V1MA 5H80A 3GBPA 1NX6A 3V7YA 3RRJA 2YJ5A 4YCCA 3H11B 3T1HB 1UZLA 1FNNA 4LXGA 1HTTA 4RA9B 5JMWA 5KCZA 4DB4A 3LOQA 4BMCA 2H4FA 2GHTA 1X1BA 1PSZA 2V6GA 4GVXA 5E0OA 2BFCB 1YQQA 4WNIA 5FPPA 3W6OA 4F56A 1FIUA 2IE0A 2CMFA 3OT1B 4QPCA 2RKOA 2WSSD 4NY1A 3S4YA 5AXCA 1R6BX 3PI7A 3WDLA 1VRCA 4PG7A 5KNDA 2B8NA 3O8QA 5JS6A 4K86A 1AN9A 2CVFA 2VL7A 3NRJA 4H6WA 1HRDA 4QUEA 1TT7A 2O7QA 2DBVO 2OESA 1AT1A 3GFBA 1TZJA 1XKTA 2P2GA 4KBFA 1SEPA 4PLWA 4AROA 1S8OA 1F51E 4M2LA 3L0ZA 3NGLA 2OWDA 4JYPA 1NBME 2PE5A 4MUYA 5K99A 4B7ZA 2CNNA 4J0IA 2FLWA 3A0RB 2O2SA 5FOSA 4DM3A 5MF6A 2RHGB 3FNRA 1QO0D 1ZUNA 1E2UA 1U98A 5HF9A 1UODA 1GNTA 4DSAA 2ZIXA 1YC5A 1UC5B 4BJHB 1XE3A 4P3OA 4HDSB 4X3OA 2V9CA 5CB4B 2HLPA 2RSLA 4F3TA 1J8QA 3LVQE 6YASA 1H1TA 7MHTA 5ALPA 1M67A 1WY7A 2IU4A 1X1CA 2RK3A 4LVOA 3PEEA 3P9QA 3A37A 3T7AA 4OIMA 4AX4A 3H2ZA 4DXDA 3QUQA 1JBQA 1DV1A 3I5XA 1A27A 3MS2A 3QE9Y 2OOSA 3DE0X 1MO4A 3H5LA 4M1YA 1KHTA 1RAEA 2BFBA 2C03A 3D64A 1MD9A 3HV0A 4RGYA 4ZICA 3LUPA 3KC2A 4Q93A 2WHPA 4X8OA 4UTRA 2FJUA 3N2NA 2JGRA 1QS0A 4FDUA 2OFPA 1BCRB 2BF7A 3OWXA 4J8PA 3F5SA 2E87A 2A9PA 5TGZA 3WXMA 1XJCA 5BQFA 3LHIA 5KSOA 1R27A 4QECA 3UQZA 3JTMA 4BLQA 2FOLA 5BSVA 2OFOA 1BXZA 1JILA 4J7CA 4LJYA 4BO6A 1W7AA 1I7DA 1NHWA 1W5SA 2OQVA 3ZX4A 1DJNA 2I3GA 2JCGA 4LVCA 3VKFA 2R8EA 4MW2A 4QU0A 2QTCA 4ZCIA 5AT1A 1R6UA 1GUAA 2CC2A 1SVOA 3WNDA 2O2HA 1ZKMA 4EGQA 2YS6A 1JDPA 1QFZA 4G67A 1N5DA 4XDZA 4U9UA 3A14A 5JRDS 3GJZA 1LX6A 1T5SA 5TQ0B 4ZJUA 3RVMA 4DLLA 3FBGA 3H97A 3OJFA 3T4UA 2H4XA 1HQCA 1Q1EA 3RHZA 4M1TA 2YOFA 5K3CA 5DGTA 3IUYA 1XA0A 3D1LA 3EULA 1DZIA 2E4XA 1VPLA 2AW5A 2QRVA 4EDHA 4Y9UA 1I4DD 1NVEA 1UH5A 4Z4HA 2ONKA 5CD9A 3GP5A 4DA7A 5CEFA 1VHDA 1J1IA 3GB9A 4EUSA 2PQ2A 3TD6A 3B85A 4IDDA 3U37A 5BWOA 1IIRA 1LZKA 3PK0A 3JSXA 3D8SA 5HIJA 4KTTE 3T7IA 2PSSA 3FYCA 3TGPA 4K05A 4OVKA 4ZAYA 1TT5A 4CI9A 1XPRA 2WWXA 2GZ3A 3NYIA 2PO5A 4L3WA 1PHRA 2JAWA 2P62A 1W2HA 1SG9A 2BY4A 4FZ5A 5JBIA 1PK8A 3FYSA 3I2GA 5B3JA 4G4SP 3H7IA 2HF8A 2XB8A 4B4OA 1H2AS 2QZ4A 4EYQA 3G8DA 2P9EA 5IPFA 1Q57A 2CUTA 2ZBRA 3BGWA 3LPCA 4FXPA 4O2LA 5FFMA 3UGJA 5EHQA 5EMHA 1L5RA 2NNLD 2UKDA 3DULA 3EWNA 1P2FA 2NVBA 3HNOA 4RMGA 1GOTA 3FWNA 3H2SA 1US8A 3TNFA 2JAQA 2XWBF 3QFCA 1I6WA 2Q8PA 3RSZA 2BH2A 5TV2A 4H6XA 1K5PA 3GGOA 1OASA 1NSFA 3OESA 2WIFA 2E7ZA 3R4CA 3BZUA 1EJBA 3HZOA 1EFLA 1Q12A 4WBSA 1AO0A 3FOFC 2Z58A 4B3RB 4IIGA 5BN3A 2HQRA 3D8NA 4QYIB 1P1RA 1KZ1A 4C03A 3PTZA 1GCOA 2FXIA 2VYQA 1DFGA 4LI3X 5DWVA 3GPLA 1TX4B 3S8EA 3F78A 1GG2A 4RE6A 1R0XA 1G3MA 3AGPA 5BR7A 1XZKA 2JASA 1AUQA 2OEPA 2FQQA 4XD7D 1DAHA 2L69A 5U4QA 1I7PA 2P3OA 3RSSA 3NAZA 5LU8A 3B1KA 3VHXA 5EWJB 5FV4A 4A9AA 1D6NA 3GJSA 3BTSA 4JMLA 5ERGB 4QSHA 2PAFA 1SK9A 5LUBA 5IJ0A 1KJ8A 2GM9A 1HT0A 1JQLB 4CL2A 4OAQA 3RVPA 1QIFA 1MJGA 2L19A 4XR4A 1XB2A 2JKZA 4TQGA 3ZGYA 3P9ZA 4ALIA 4D43A 3L43A 4RWEA 3UHPA 1SIOA 1IDN1 1JT2A 4TS4A 2E21A 3AT1A 3BYZA 2LV8A 1GJRA 3AJDA 4JP1A 4LE2A 5DYIA 2XE8A 3PJDA 1ADGA 1JDZA 2W2LA 1Q0RA 3WGQA 4R54A 2JLRA 1YVRA 4Z3KA 3KUUA 3A2KA 1ZGAA 1BEEA 5IEJA 3CX7A 4ZVSA 4AX8A 2C5AA 2JD1A 2YFQA 3R77A 2V03A 2W11A 3FXAA 5D3MB 7ABPA 4M53A 4JGIA 4LRTB 4R81A 3LSYA 2G1PA 3DTVD 3AL2A 2QMEA 3BXFA 3IVMA 3IO3A 3V48A 1JTVA 1B4DA 1T6NA 4KQGA 1Z0SA 3KBOA 3IQHX 1G4HA 5EOVA 1SCNE 1O9BA 1ZWKA 2R8XA 3HVUA 2JPDA 2CXNA 4KRFA 1UJ5A 3KYDB 2UYOA 4W8OA 4QWWA 1RS0A 1FSPA 4QIHA 1RXYA 1XLTC 2H51A 5K45A 3M6MD 4YRKA 2CWWA 4ZVOA 2WMOB 1YQUA 5IYZB 5IBRA 1QFMA 2DUNA 5EERA 3DMTA 3PHLA 4QU5A 5AJUA 1DJQA 1CETA 3QFSA 2YKGA 1O6CA 4LX8A 1H65A 5A0TA 2ZI3A 3DPSA 3FZYA 4F93B 3ETGA 1LPPA 5CDTA 2V7XA 3UMSA 3R09A 5I5EA 4WJZA 1FUEA 1Z6YA 2NXWA 3KUXA 4KO2S 4HQKA 1T8UA 3RODA 5CCEA 3VBCA 5K3DA 3DGEC 1RIIA 1U90A 4L73A 4BO1A 4DJ5X 1JSLA 1UBTS 2AWNA 4FLMA 2DQSA 3PFGA 2A86A 4X1YB 3ZCQA 4DMGA 3ICEA 5CTAA 1R8YA 1ZI6A 4Z4GA 4GLJA 1KQ3A 4EIWA 1Y80A 4DRZA 1O8CA 4Q24A 1A72A 1L7RA 4KOEC 3R5XA 1TW2A 4EO4A 3EPHA 3MGKA 2GH1A 2BHRA 3MJ4A 4J6EA 4DVJA 4HUQA 1VQ1A 2XA2A 1D9XA 4J29A 4ETIA 3M1AA 5TJHA 5LWHA 1F1BA 3NC1C 2GLXA 3EVNA 1U99A 1QGZA 2OB2A 3QQ5A 4UM8B 2X40A 3WDKA 2F43B 4ZI2A 2OG2A 3PXBA 3BIFA 4KWCA 4EL0A 2UZAA 3ERCA 3K0AB 4ND8B 2IYPA 1X87A 2BPOA 1DWQA 4PXAA 5B7GA 1X94A 3JW8A 4K81B 2KJQA 1ISFA 4FYWA 3BMOA 1YR1A 1YR7A 3DBRA 3R0JA 3ESBA 3K9FC 3I9JA 4GHWA 2IP4A 3KNZA 1BTOA 2BEUB 1L5GB 1YNSA 2NTJA 1QH9A 2G40A 3FHJA 1YQGA 4HQ6A 3H2JA 4M9CA 4D42A 2P6MA 3CY6A 1E6LA 4JGBA 1ZAYA 1EWVA 1VSUA 4FYIA 4OXIA 5DN6A 4WXHA 1QH1A 4JJKA 5DGXA 3LX8A 4RPIA 2W0SA 1W76A 5DCWA 1ST2A 5LXTA 5HIMA 3BWDD 3R7WA 4EAAA 1Z28A 3EGDB 4RHEA 4X63A 4EG6A 1A9PA 1X1AA 3H9JA 4Z0NA 5CFLA 1FLDA 3GWGA 1LU9A 1XRPA 4IG4A 2A1IA 2YVQA 4IHJF 4PS0A 1OT3A 1JEEA 4HAXA 4PQEA 5TRTA 3AEKA 5I7EA 4NCJA 2IZZA 4HYTA 2HQBA 4L95C 3MWLA 1MKYA 3AJ9A 3I32A 4A8JA 1OWPA 1QHFA 1QE5A 3PNPA 3IDFA 1GUZA 3EXEA 3I37X 2MSEB 2YL2A 4MV9A 2Q8NA 3F8SA 3NUGA 5AJXA 3WRYA 1JNYA 2CUZA 2I78A 1SBZA 5AW2A 2E4YA 4DV7B 1YRQA 3KQVA 2CFOA 5A5EA 3CEMA 3SHFA 4CJXA 5LPNA 4YHBA 4BP1A 1V45E 2F7SA 3TLCA 3INNA 5EYPB 4TLDA 1Z6ZA 2IF2A 2V6JA 3F3SA 2PCJA 3WNBA 2WM2A 1OFVA 1TIPA 2R7LA 4G0QA 1SUWA 4V02A 1E3MA 1WVGA 2O0MA 3A10A 3KSMA 2X2OA 1UJBA 5B64A 4G4JA 3HBAA 2VTBB 4WZ6A 2IBSA 2OZVA 1O97C 2XZOA 1OHHA 1WBJB 1GAJA 4J7AA 1DXQA 4MVJG 1NKSA 1YACA 2NZXA 4QRDA 1NZJA 1GGKA 3GEDA 4GFDA 1Z07A 1G3RA 5JZVA 1KE1A 2OHHA 1EXVA 3ABOB 2I4MA 2D4AA 3AEUB 3HXPA 3OE1A 5BN1A 2P7IA 1UAAA 2WINI 3PP8A 3VMMA 4RVCA 1B16A 3HCOA 1Q7TA 5ENVA 3VO1A 4PZLA 2R7NA 4I6GA 2XUFA 2QZ9A 2NAPA 2WW8A 5FJIA 1KVRA 1JTFA 1GQ2A 3W2TA 1Z0AA 2P9HA 2R7MA 2H2GA 3L8GA 4YAKA 2J0QA 4ZAXA 4TZKA 1DQRA 3ESZA 2PL5A 2HMTA 2JJ2D 2PEZA 1JG6A 1RFLA 2HJHA 2Q49A 3FKSD 3HWX1 3K05A 2LGJA 4EQ6A 5DNUA 3KWJA 4R5HA 1TLFA 4XPIB 6Q21A 1V16B 1WAMA 2HSEA 3EVDA 3FFAA 1X14A 4HDRB 4I1OA 5A71A 1A1VA 2WWFA 1W0JD 4PX2A 3MTJA 3OZSA 2J9GA 4P32A 4FHGA 2HCFA 2RHOA 1S2LA 3IHKA 2WM8A 3ICPA 2NU9B 4PRKA 4NX2A 3WMGA 5LQMA 3IJRA 1SHTX 2R85A 5FNVF 4Z0TA 4I55F 4YV2A 1DKPA 3ZD6A 3UCFA 3WYCA 3NEAA 5BVHB 5G40A 1ULBA 4NZZA 1FXSA 1H93A 1NQXA 3H1GA 4LTNA 5EJ8A 4CEIA 2DR2A 1G16A 1AXGA 1JQAA 3R5FA 4U7TB 3D2BA 4JP2A 1YONA 3FG9A 2XQKA 4G01B 5A9RA 2O2IA 3JZMA 5IF3A 3KKEA 2F1JA 3GVPA 3VX4A 2O3JA 4OL9A 4MV6A 2V4UA 3ZNOA 5F3DA 3A32A 4XVUA 1DC3A 4G37A 4FW8A 4C08A 4ZV7A 1JJ7A 1IUNA 2DTEA 4Q16A 3CRVA 3SIWA 2IZOA 3SE0A 1E7QA 4JLVA 3S27A 2Z8YM 4G0NA 4PQRA 3EIQA 1RMYA 4MX8A 1V11A 1X9IA 1EK5A 1P2UA 3A9UA 3BE6A 3NXSA 1X1SA 1U1DA 4BBPA 4C0LA 1PP4A 4M86A 2FWIA 4GG1A 1HGXA 3NEYA 3MINB 4BJ6A 2PUAA 3KE8A 1K63A 2IWRA 4UTPA 1OIWA 4KSCA 4HLUA 4S1OA 3I3SR 3DKKA 3PX3A 5JSZA 4YDQA 3P2MA 4EB6A 3KKKA 3SBXA 2CT8A 1H4SA 1YR8A 1E5TA 2GBLC 4CL3A 3E70C 4RBNA 2XCQA 2YH2A 5HF6A 3KPVA 1KVTA 5CUQA 1XR3A 4D4IA 2OQIA 2C31A 1BQEA 2XCRB 4CCSA 1H1LB 4H15A 5KAMA 2HDOA 2NM0A 2W4MA 3ZBUA 3K9HA 3UXYA 2XKKA 3CF2A 3I1IA 1QLWA 1NV9A 2EIXA 3QLUC 1Y8AA 2HDHA 5EJ6A 3FI9A 4GW3A 3P0HA 1BFKA 1MQAA 1Z7GA 3UMRA 3LBFA 2VZ0A 5C1PA 4UW9A 4UDYX 1C7FA 3GROA 2GCNA 4I1IA 5ENZA 1DUIA 4GVLA 4AN1A 3GRRA 1P33A 2ETVA 3LUBA 1GDTA 1GNVA 1YAJA 4P86A 2Q9AA 1BD4A 1Q17A 2OR3A 4MR9A 1MENA 1E1CA 3PZRA 3TZEA 1T10A 4MNTA 5TDHA 4IMIB 3QFFA 4FKMA 1MO5A 1KYVA 1UP7A 3I72A 1WZEA 1T6ZA 4N3AA 1W88A 2PIAA 5KSPA 1ISPA 3WV5A 3ZWKA 4CM1A 5FNZA 3QIVA 1GTVA 4ME6A 4Q34A 2ETXA 4BXOB 1KR5A 2CXXA 1SXPA 2G8LA 5BMOA 4YJFA 4C4AA 4H3HB 1JA9A 2CYBA 3CM0A 4RS4A 4DCVA 3G13A 3WRWA 1YZYA 3KR1A 1TUBA 1YDEA 2P1DA 1J0CA 5IN4A 1SA0B 2P0AA 2HFKA 1NMZA 5E2IA 3WL5A 4FFVA 1U9YA 2VDMB 2C7OA 4QSMA 4FUQA 4I8DA 5FI0B 4C4TA 3N0RA 1UKEA 3JQCA 3K1AA 3O47A 1GG9A 5D8DA 3TOVA 5EZQA 3CR8A 3W1WA 4DIEA 2LBPA 1H4VB 3IPYA 4I14A 1GGJA 1XMQB 4MV5A 1RZUA 4KK4A 3V8BA 4ZQHA 3W8FA 4F2WA 3GFFA 1PX0A 4U6SA 4C2UA 2M2IA 5TMBA 4C0QC 2IHNA 3ZGZA 1G1MA 3RTCA 4NDAA 2XF8A 3CKYA 5FBQB 5FTNA 5IKOA 4LZNA 4IL5A 5EP4A 1M1NB 3TSAA 4DKXA 4MQMA 2RGEA 3SZGA 1WY5A 2O2JA 5TXGA 3TKYA 4YJ2F 5UKDA 3DZHA 1CUAA 2YWXA 2PWZA 1IB6A 4A27A 1QQ6A 3MC1A 5C81A 4A5SA 1G5IA 4J90A 3EUAA 3D8HA 3PQ2A 3X2FA 2AEFA 4WLUA 5K01A 5FADA 5I7HA 4OI2A 4UCXA 1YC2A 2OECA 5FHQA 1K1EA 1ZLYA 2Q2OA 4E2ZA 1QRAA 2DGDA 1OXSC 4OQPA 1CUSA 3WICA 1CXZA 3K0FA 3N1UA 1OJ7A 5GJWC 5CYGA 3CH7A 1V3UA 2EFHB 1CHNA 4MHTA 2W6MA 4JZYA 4CQNA 2OBMA 4ZGWA 4JKIA 1NI3A 4P3YA 1Z08A 3F5MA 4GWLA 4QGBA 3HEBA 4P4GA 3AHHA 3JAWB 3EMVA 1ECPA 2BFFA 2GZ2A 4K88A 4M7WA 3T1NA 2TECE 1GNSA 1CK4A 3TIFA 2H11A 2OCDA 2DPYA 3E2MA 3JAKA 5I4BA 3L04A 2XD4A 4NBRA 2MTBA 3U44A 4ZMBA 2IYZA 3U4IA 4EG3A 1XPOA 1N6RA 4Y2XA 1WG8A 2XMDA 3E05A 5JC8A 1UM9B 3AUAA 1PGNA 4KMRA 4EYGA 1D1SA 3LQKA 4GM1A 3SHQA 3ZGVA 3OJLA 3Q1KA 3JYHA 4DANA 3I9V1 2YBDA 3EGVA 3H0CA 1Y1LA 4OPMA 4RE5A 5JRJA 1YKSA 2O8DB 2G6TA 3PHJA 1R7RA 1KJNA 4U00A 3WGUA 2QYTA 5CVJA 1NRXA 3MOSA 3OHSX 1SUIA 1KGSA 2C2YA 3HKBA 2CXPA 1WMSA 4MUMA 2OK8A 5AI6A 1K86A 2AXNA 2QTHA 3D81A 1QVWA 2XNSA 3ITKA 4CM8A 2ZVPX 1CUEA 2F1IA 3QA9A 3JVEA 4LBYA 2OTCA 1XTUA 3BWVA 3VZSA 3JR3A 3VR6A 5FPKA 4CT0A 3F7TA 2FW9A 3ANNA 2BE7A 3DDHA 1Y4DE 4UHDA 2Q1TA 5KS2A 4LQ4A 4P58A 2CEKA 3WGHA 1FTQA 4HOYA 2GEJA 3NZEA 2FPKA 2WJ6A 3BF8A 3EB9A 4TLAA 3GUHA 2R8ZA 2J4DA 1ATZA 2WUVA 1RKXA 5K0TA 4IFIA 1EAMA 1HE1C 3UTDA 1J9ZA 1NNSA 2B4RO 2WVAA 3TNDA 5BPHA 1QIKA 5EZYB 1K8QA 1RJEA 1GPUA 2GAOA 4QARA 5DSXA 3URKA 2JVJA 1UFVA 1WU7A 3IUJA 5LKRA 3H1AA 3L4SO 5DLDA 5T41A 3BMXA 3ZWOA 1QONA 2ZIEA 4AKGA 1WHTA 4AYWA 4GGMX 3A6FA 1ONNA 1W49A 5HF8A 2P8SA 3K0SA 1GN9A 2B78A 3IFSA 1XZHA 4X24A 2GNAA 2J1LA 2VZLA 5CDFA 3IEIA 1E61A 3TH5A 3V33A 2BRUC 2GPSA 3W06A 1NRIA 5DIFA 2VBIA 3AILA 3THYB 2GGSA 1M75A 4R2MA 4YDHB 1AZTA 4U7FA 4KNYA 1W44A 1FTWA 4H1HA 3ZD8A 3GPIA 4DOMA 4FTWA 3KLMX 4GP7A 4CFSA 3EPJA 4XAQA 2JARA 1ABBA 4IMJB 5M3BA 1G2IA 1FU8A 2WPNA 5FOVA 1Q20A 2I8LA 1CY2A 4L51A 5HUHA 1ZN7A 4DR4B 4E22A 1UDWA 3CLRC 2IP1A 2XHZA 1FDOA 1R12A 4KE8A 2I0FA 4M1SA 4RCVA 1T1SA 2XVAA 5DHFA 2O23A 3OLQA 4C29A 4CM3A 1FFSA 1K3FA 1RI5A 1DBPA 1FFXB 1CDZA 2X8JA 2H00A 2V4ZA 2YVAA 3PE4A 3ZZ1A 4B3CA 4DFDA 4I1RA 3T7RA 3FYUA 1JB1A 3EDMA 3H16A 3OCZA 1MIOA 1U31A 2JDID 3RSHA 3WTCA 1YZGA 3ZVNA 1YA6A 1HK7A 4TV9F 1XWIA 2Q28A 5JNLA 4MVJF 2DLCX 4DLZA 1TZ2A 2AQKA 5C53B 3HJFA 3EFBA 2JFNA 4Y98A 2G5PA 1G7TA 1XZLA 1JKIA 3ND5A 2PO7A 4H7FA 4A4DA 2Q5FA 2CL7X 3L4BA 3F8TA 3D43A 1QRSA 2AOUB 7GPBA 1NW6A 1ZRNA 2QVZX 3E0XA 2HN9A 3OZIA 1JEDA 3QVMA 3IODA 4YWHA 5A6SB 5ICGA 1BJKA 1GYPA 1JALA 3AKZA 2QMUA 1GQFA 1QG2A 4LZOA 4M8NE 2ZP1A 3C3BA 3AR2A 3NGMA 3TKLA 5T4FA 1DQYA 1Q0ZA 1T2NA 2PGJA 4XWTA 5IDYA 4GP9A 3ESAA 4BNKA 2HMVA 1K6MA 4ATNA 1S5PA 2ZRHA 1BSVA 1GP2A 2HK9A 3VZQA 1QYXA 1VBFA 1XDUA 5HTOA 3VNVA 3QP9A 4EG5A 3DD5A 3L06A 1JFRA 5EIAA 4EMBA 5DT2A 1U8CB 3W2FA 5AI0A 4QQFA 4CTMA 2P78A 2Y9MB 1F14A 4YRFA 5HCUA 4MCJA 1SCDA 3ODPA 4R6XA 3SFVA 3KEFA 4HAYA 5E7MA 1SGWA 5CXQA 1POWA 3RYIA 2F62A 3BAZA 5DRTA 1S2IA 1SM4A 4IS2A 4OL0A 3NTOA 4MMXB 4FN4A 3MG9A 1YK1A 1Z5NA 1DKLA 2I55A 1JEQB 2NPIA 2RONA 4MRMB 2YJ3A 4QYTA 3RU7A 3VU1A 1H6BA 1P4GA 1ZXLA 5I48A 3LT2A 2OWEA 1GQQA 1UINA 1LDEA 4ZVUA 5THKA 2R4UA 2VAWA 3PHIA 5CX4A 1AKNA 3VYTB 4DMCA 1NPYA 2ERXA 1Z74A 4TT8A 4ZYTA 4FDAA 2KPOA 2QLNA 2J31A 1U04A 3QWAA 4RIHA 3VOSA 4EPRA 2HREA 1PR9A 1TUGA 4Z9BA 3ZWYA 1OI4A 2VLBA 3SHVA 2FWJA 1H2BA 2VHEA 4AKSA 1CR0A 3GRYA 3WADA 3BWBA 3O84A 2IHJA 1EE9A 4PC7A 1UMCB 2EZ9A 2SECE 3JASB 2FDCA 2DE0X 2NV6A 3WIBA 4AWXA 1V7ZA 3HPRA 1ENZA 2HEIA 5JS8A 2HIGA 4EUNA 4BX9A 4CUKA 2G9VA 4RH0A 1K98A 2B0CA 2J3JA 3BG5A 1NI4B 4HNAB 4JJEA 2IH2A 4YC7A 1HSOA 5EGNA 4BVBA 4WY5A 4CHGA 1HDYA 1D6SA 2WF9A 4CG0A 4ZK2A 5CB4F 4PV7A 2JS7A 2X0IA 1WB4A 2YWEA 5AVQA 4H08A 2QBYB 5EIEA 2GCPA 4CCWA 1JJFA 1XNRB 3WIEA 3ENQA 3PWKA 4FNAA 2CLSA 1SQFA 4HNHA 3DHYA 3EIUA 4XDYA 1EFHA 5J2UB 1KYQA 4QJ5A 2JGFA 1NR1A 2M9MA 4KB5A 4ED9A 5JJIA 5CCDA 3AP1A 1OB5A 3DDSA 5GINE 3IHTA 1GUFA 3WQSB 4L4ZA 2SNIE 4YMSA 1VECA 4PBRA 3BJRA 4B45A 5C7IO 1XK6A 1ZJ4A 2ZQZA 2RG7A 1KEUA 3BJIC 1IRXA 1UC9A 3CRRA 4CM4A 5FOQA 3D7NA 3ZKAA 1R4MA 1Z34A 3FWPA 4FDLA 3LXXA 2Q5QA 3OTIA 4P98A 4OUDA 4M60A 4NESA 2AI1A 3T61A 4R1QA 3SVZA 1LQTA 3F0TA 1GSOA 2E1PA 4KE9A 2SKEA 4Y6PA 5BYKA 5JAPA 1PJSA 5EE5B 3WAJA 2XWJI 1YB1A 3PTLA 3TW8B 2XGMA 3EQZA 4K9NA 4HTAA 3IJPA 4ZCLA 3FAZA 4V0KA 4TVKA 1SG6A 2DQZA 1G18A 1LPSA 2WG2A 2XGGA 1FPMA 3NUQA 4JLBA 1E5LA 2MCFA 2F3PA 4B9AA 4CRWB 1M2KA 2Z2KA 4I1PA 4GI2A 2ZI7A 3B8HA 4X7MA 1T6YA 1L4NA 1KRXA 3NHBA 1SR8A 5F3RA 2P2SA 3BF7A 5FTLA 1FNMA 1K68A 2AKYA 1YD7A 2HXYA 4RA6B 3ZHUA 1YIOA 2VRCA 4JJAA 2ZE5A 1DAKA 4LY0A 1OBCA 3RUHA 3RH0A 4ALMA 3UATA 4J76A 4GDFA 3DMDA 4BFLA 1LRLA 4G97A 4B3JA 1QYVA 4N0QA 1N34B 3N2LA 1HR0B 3TSCA 1O6GA 3HXMA 4KLCA 1PV4A 4HAVA 5FQOA 4W8HA 4MW7A 3I9NA 4UOQA 3GA0A 3PXDA 1C8LA 2O3UA 3D1VA 5KJEA 2HT1A 2FP4A 1Z5ZA 5I7SA 2B0JA 5JAUA 3ZC3A 1C7RA 4Z49A 1PZNA 5K8IA 4Y2VA 4R83A 1E6KA 4QBHA 1DMRA 1NHGA 3QKSB 3HVKA 3QW4B 1E9BA 1NXQA 3QI2A 4A6PA 2HRDA 3W3AA 4M1OA 4P82A 3M82A 3G2MA 1ZRMA 3P0RA 3AC0A 1NVFA 4JJ7A 1XMVA 3LJKA 3V42A 4RLFA 2D3WA 3PGA1 1SHJA 2GN0A 4X95A 4R7TA 5IM4A 2PSEA 3BXEA 5BNTA 4TL6A 5C8YB 4U5QA 2OY0A 4Z4EA 2YHBA 4WOCA 1E3LA 1IATA 2XXJA 3EPRA 4QFMA 2P4HX 2D5BA 2X9GA 4XIFA 2WWGA 4L5CA 3T0FA 3OZTA 2A2ZA 2JHGA 2P67A 4OHVA 2JH8A 1GCGA 3T5GA 4H0FA 3OAAD 1NRJB 1Z3IX 1JPNA 1Q7EA 1ZCFA 1FZTA 5FBRB 5BSUA 5HRUA 1PWYE 3SJBA 2P40A 3UA3A 1FYDA 1FYFA 2RI1A 1X80A 2WHQA 2GK3A 2X8BA 4GRAA 1YZNA 1DAEA 1PFKA 1TUEA 2F17A 2BFEA 3LU1A 2VPWA 3BQ9A 4ND5A 2J5RA 5A06A 4DEXA 4KN9S 1D0VA 2ZSJA 4CEJA 5HS6A 5LIPA 4HN4B 3COSA 2IGBA 1R64A 1X7WB 1YZHA 2X4LA 3E8XA 3E53A 3TVTA 3W4KA 5JH7F 3EE6A 1EP1B 1Z5UA 3LP5A 1JBKA 2CNWA 3KKZA 3VXKA 4DL9A 5C8XA 4K6FA 3LA8A 1PNOA 1RJDA 4WOJA 4NDZA 4IVNA 1PWHA 4MR7A 2QRNA 1LFDB 3AEYA 4A03A 1RBMA 2GTHA 3CB2A 2JA1A 2NPFA 2IH4A 3UMFA 3MUFA 4OMUA 3TE7A 3HMQA 3OFNA 2IS2A 2HB6A 3GEHA 3GL9A 2QAGC 3H2KA 3IBFA 4FMCB 4M21A 4OV6B 4TQ9A 4JC5A 1FF9A 1ORHA 4Q6WA 2OXIA 4DQLA 4YPVA 4RLSA 1NKVA 2A0UA 3CPSA 1G38A 2PD6A 3VSDA 3VPXA 2ZB7A 3NBXX 2CE2X 3BZWA 2JHFA 2ZVDA 1O03A 3INRA 3UF0A 1V39A 5G0VA 5DNCA 3M5DA 1MORA 4RXMA 2G1KA 2BHSA 1GZ6A 1ND6A 1NNUA 3WKEA 5AVWA 4B31A 1X70A 3MB5A 2PBFA 3OJOA 3NO4A 3O9VA 4UXHA 2GN9A 1K88A 3LRXA 3OQMA 1XQ9A 3SZ3A 5AQEA 1UT6A 4FFNA 2XOKA 1CZRA 4QFBA 1DKMA 1AIPA 3FNGA 4YAWA 4E1AA 1QWOA 5KSWB 1M0SA 3RTAA 1DBSA 1Z4LA 2EKBA 3VOTA 3W9BA 1PV2A 4G0ZA 4P7FA 3EVBA 3PXXA 2GB4A 4WXMA 5HE9A 2O3QA 3UXHA 1XQWA 2LKCA 4RTNA 5D6NA 4RHXA 3DL0A 3DE4X 3ZJ5A 3KLOA 4N0DA 4D81A 2GA9A 2PV0A 1FP1D 4JQCA 1RWKA 3EBPA 1XT6A 4HZUA 3BA1A 3O75A 3ZIAD 2VA9A 1ZNXA 4FCWA 1ANKA 1LPNA 3RBXA 4D26A 4LF5B 1F8UA 3BHJA 4B7CA 1Y7TA 1T3HA 2BGUA 1RWPA 5C5DA 4I99A 3R7AA 1BE8A 4MEAA 4L2IB 1B8OA 1M1YA 2EERA 5B53A 3TLGB 2OBFA 1YA8A 5FBVB 5AXDA 4JXXA 2WWWA 3WNQA 4QREA 3CWZA 1PVOA 4S04A 5EGSA 3BC1A 3GLHA 1VTKA 5AQ1A 4CZ2A 2IXGA 1FFHA 3VKUA 2YTZA 2XTMA 3WSTA 3A2MA 2Y1FA 5IBQA 1CJBA 1FFWA 1U2EA 3DAGA 1UMDB 3B5IA 3VPGA 4D0NA 3LK7A 3JARB 1YZVA 3W5DA 1JFVA 4BMNA 5IK2A 2ZR7A 1EJ0A 3BTVA 1QZZA 3ZHTA 4MXDA 2Y0DA 3EVAA 4YWJA 5H16A 9ABPA 1XRQA 5KTTA 2B4TO 3ZDAA 2QD2A 2CJFA 2FY8A 4BQPA 4N0EA 5I7AA 1L3IA 2R25B 3WQBA 4NZ9A 3MWKA 3TEJA 2GYUA 3D6TB 4PRLA 3DBVO 3QBJA 2IYRA 3BVPA 4JC8A 5BXQC 1JHMA 1HQKA 2FSIA 2P9GA 4OI4A 1G1AA 1CCWA 5JEDA 5IAAA 3L7KA 5BOVA 4I9UA 5EQJB 4BFZA 4HNUA 3PTAA 2CWDA 3LP6A 3ROFA 3H9UA 5KNCH 3CHYA 1XNJA 1S96A 5GQSA 1G5TA 3AK4A 1JIQA 3DMNA 4LC0A 2Q2QA 2R1TA 3BKWA 3T9EA 2CVZA 2IY7A 4MCHA 1C9JA 5CT9A 5CVVA 4PFQA 1P2BA 3UMMA 2CXSA 1VHJA 2VZEA 1CY8A 1GAQA 3LX4A 4NU5A 3MTIA 3UEOA 3EHEA 3KEMA 2A4MA 1G41A 1XU9A 4I46A 5AJYA 1Z7YA 3EEBA 5IS2A 2Z0MA 1QQBA 3HE3A 2WZQA 3OZFA 4RZ3A 1KI4A 1Y7PA 1N5OX 1PNQA 2V58A 1TM4E 4IZOA 4DMUB 3W7AA 1A4IA 1C7EA 2XTAA 1YFJA 2IYTA 3CLUD 5K8TA 2C20A 3TLYA 4TUYA 2ZU6A 2CN1A 3E84A 2YIJA 3OQJA 4IEEA 1U2DA 3GZ4A 4URVR 1Y5NA 2GYVA 4B1FA 1D2AA 4G0YA 5FPHA 1E5DA 2EFCB 4U6QA 4DVGA 2XCOA 3T8YA 2DPHA 2Z3ZA 1ZD2P 3JPYA 1EEXB 1TK2A 1ICEA 2RAUA 3DMYA 5FWAA 1L5LA 3W6ZA 2AJBA 4M98A 3B51X 1KEEA 5KOJB 5LQCA 2CLIB 3L1HA 2BBTA 5L7WA 4URWR 3OQOA 1L4BA 4Q47A 3DZCA 5JDIA 5B6JA 2ZUFA 1JH9A 3COYA 3QTBA 3QWBA 1O77A 4TSRA 1YS4A 2WF6A 3MYYA 3OA0A 3WWDA 1X7XB 1DAOA 2Q8QA 4H2DA 1SC9A 2FPSA 2EU8A 4J07A 1D07A 2JIBA 4YJ3B 1L5QA 3F98A 1EGMB 4RIGA 5DNYB 4JIGA 4UHBA 4WLFA 4IUCS 1EUQA 2OV1A 2ORVA 1P1IA 3H6KA 2V6FA 3VYUB 3CE9A 4WVFA 2GM3A 3Q7QA 4RL6A 4ZREA 3KZOA 5FPSA 4JB3A 3TOXA 4FD3A 5AP9A 5AJHA 4I4TA 1ECFA 3DFZA 4M7PA 3ADBA 4G5RA 4JH0A 3WIUA 2H59A 2FSVA 2JGAA 1B26A 2SKCA 3EVEA 5KYTA 5MFPA 2IDJA 3BGSA 1NR5A 2P2ZA 3DEZA 3W6UA 2C4UA 4FGUA 5J4VA 2E82A 3GZNA 5B2FA 2Q9UA 3TG8A 1L7OA 3WLFA 1HMYA 1D1PA 1L6IA 1VJCA 1Z88A 3QWIA 2H0AA 2UYGA 3GUUA 5KNDD 4R2KA 4D44A 2FEKA 4ISCA 2CEAA 2QGFA 4DLPA 5H9WA 3Q3VA 4LX0A 4R9NA 1MB0A 4CF3A 1C1XA 2PIDA 1CJUC 4GMKA 1WUTA 2LPMA 4V1CA 4PONA 2J45A 1M74A 1KMNA 1V25A 2IZ0A 3IMCA 2VH2A 4MVJI 4BIIA 3O74A 1EUCA 1GRNA 1NW5A 3GDWA 2ZUTA 3OPQA 4KYIB 2X2EA 3KVNA 2JIQA 2P5SA 3SSMA 5JJBA 4JU8A 5B57C 1RTTA 2ZTSA 4EI2A 5LC1A 5SYAA 1PLLA 1M8JA 3VR5H 3T41A 4Y8VA 4E1BA 1Y8ZA 2R79A 1CJMA 5JHGB 1I8TA 1TVKB 1X0XA 4L5IA 3OPVA 4AK9A 2NU6A 2V9ZA 2WQ6A 4OYRA 2QTVB 1EA7A 3D7RA 3OQIB 3TR0A 4RHYA 5DBFA 4AUEA 3VSCA 4MS4A 3KYBA 4FHEA 2PH1A 4PAQA 4B4VA 1XP8A 1ZOIA 3B20A 4DARA 3FPHA 4DMKA 9LDBA 2WWRA 4N8EA 1M5UA 1PR6A 3KSZO 2HQ1A 5TE9A 3REOA 1S9DA 1ZVKA 1ZS9A 4M54A 4OGKA 1TTPB 2QEQA 4M4SA 2OO5A 1ZVVA 1NF2A 2RGNC 1KYTA 2OUIA 1NT4A 5AW8A 5F98A 2J9XB 1R9GA 3FLBA 3NEJA 1MXFA 3KVVA 5GM1A 2I4TA 4ZEWA 2OBLA 1AM4D 3EA4A 4IICA 4AF6A 1L5HB 3L8HA 4GM0A 4QDJA 2H92A 1J0EA 1IY2A 3E9NA 5KU1A 1NVGA 3RWBA 5F23A 1WTCA 2OGUA 4IJ6A 3T0GA 2HJRA 3I4CA 3DR5A 3LCRA 4EPWA 1T4DA 3OHMA 2P9ZA 3EXIA 2AXQA 1U3DA 4F04A 1SKAA 2XQJA 4FDTA 2O2GA 1A3CA 5F2OA 2CVOA 5M5BA 2JLWA 3O21A 3P9YA 1T0BA 4P9NA 4BIMA 1MB9A 2JLQA 4QTXA 4JFRA 1CU1A 4INJA 4R1UA 3GA5A 1NNEA 1T2AA 2QAGB 5ERYA 3K5WA 3D0KA 4H3KB 4Q0MA 3CR3C 5BR4A 3ZXSA 1FDSA 2CJYA 1MX3A 1X8XA 5PNTA 1WMDA 2O0LA 3IUBA 5EVCA 1NU6A 3D3KA 3GD7A 3P26A 3IT2A 5T8KC 2OZLA 4CLRB 1E1RA 1VG1A 3KSRA 3ONDA 3SXPA 1C1DA 5FA5A 5FPQA 2X0FA 5LUAA 3V3KA 3ZS8A 5GP1A 1SCJA 5LU9A 3AW9A 4JJIA 3PIIA 6LDHA 2HF7A 1UBHS 4PZEA 1I14A 3ICVA 3KOMA 4LYEA 4KO4S 3TLMA 5BUSA 2ZBPA 3R3VA 4CXMA 3CO5A 1CQIB 3K70D 3DLCA 5K4AA 3ZK7A 1TQDA 2D5IA 2IPMA 2QP9X 3QEKA 4R69A 1E2HA 4B09A 4ARUA 4NZYA 1PR3A 2PUJA 4KVFA 2V98A 4UBIA 821PA 3SC3A 4RANA 4IR7A 2NV0A 3KK0A 1VKNA 4JS0A 3D4LA 2ZJ0A 2AQIA 2VRBA 1GLNA 5DGIA 5I8ZA 5PGMA 1E0AA 2QD3A 3IOCA 3SNKA 4B6JA 2BM1A 2Q3JA 5M04A 4YRQA 5LQKA 1A4RA 2JBAB 4KGDA 1H2FA 2B5OA 2YRXA 3STHA 2ZXUA 4AQYB 5JCOC 1Y9AA 2H1IA 1ZK1A 5LQSA 2IXEA 3L8EA 3M2TA 2YY5A 3ORSA 3RUCA 4EVSA 4YAUA 1KC1A 1P8JA 2WYHA 4E14A 3QFRA 3R8CA 5FAXA 2WI8A 4QNMA 4BNDB 4R8VA 2IUUA 5J5AA 2I3AA 3GP8A 1UWKA 4ZIRA 3I5MA 2QQEA 3ONFA 1EBBA 1EXWA 1T36A 4CLOB 1IQ0A 3MXTA 4CMBA 3AJAA 5A02A 2FFRA 3C5VA 2DLDA 5B1HA 3VJKA 1WU8A 2HMWA 4LOIA 4NU6A 4ZO4A 2J6HA 5CA1B 4OSOA 1L5WA 1FFEA 4DNPA 4B4UA 3OTQA 2W2LD 4MUBA 4N7MA 3UFXA 4ZI7B 1U63A 1A9OA 1HYHA 1N3YA 3KELA 2FHPA 1A2QA 1W35A 3I62A 1H4TA 4J0DA 4WGGA 1Q11A 3D6FA 5E6SA 1FB5A 3N2EA 3O3CA 3HSYA 5AVJA 1PX2A 1LDNA 4IY1A 4KLAA 3L0DA 4YGYA 2CFIA 3DZKA 2P3QA 1RQGA 1HL3A 2BGLA 1JEYA 4JROA 2WFMA 2WUFA 1NDUA 3AHCA 4PCAA 1CJCA 4D82A 1N57A 3S2IA 3HB5X 2DAPA 3NVDA 2IDZA 3GELA 4OU4A 2QN6A 4LDQA 3OPXA 1QVZA 3K15A 3I8XA 5THXA 1NW4A 5AKYA 3AQIA 3FFWA 1V9CA 3T38A 4E3ZA 4NU8X 3RS7A 4FFWA 1T43A 1SOVA 1Y0BA 3I61A 4DUZB 2AC7A 1RLJA 2IOFK 5A3VA 3PJGA 3TXXA 5LBTA 5KBYA 3LLCA 5DTIA 5BUCA 3U6KA 5L51A 2MYTA 3CLKA 3RSQA 1NVKA 4OI1A 4R1TA 3MPUA 4H6PA 4WY2A 4A10A 3TRDA 4MEJA 3B13B 3BJEA 1PZMA 2PFGA 2J5KA 4OHCA 4OHWA 2WJZB 4X1OA 2W2QA 3B38A 1QHEA 2FUEA 3CSSA 2KI5A 4JBNA 3NW9A 4PG4A 4JI1B 3SC2B 2PJUA 4F11A 4EJSA 2JI7A 3IIIA 4IGIA 3MM4A 2EEPA 2NADA 4EY4A 4V38A 4YFYA 4ZT2A 3THXA 1DUVG 3FHTA 4W82A 2W7TA 4YCLA 2WU1A 2QI9C 3D8BA 3N0XA 1MEOA 4U0JA 4FR2A 2JAXA 1V5IA 4N8DA 5DHUA 1IN5A 4C7JA 3CGGA 3RI3A 2IJGX 1DIRA 1I5OA 3RC7A 1JIUA 5B4UA 1V6CA 3TTVA 1AA9A 3TRIA 3ABZA 3ELDA 4YUZA 5FWYB 1WBBA 3DWGA 4UARA 5EZYF 2YIDA 3BMNB 3F2IA 4EM6A 1ZHFA 2WSBA 3IL2A 4KR6A 1TW3A 4IJWA 3I1JA 4AP5A 1JNXX 1P61B 1G17A 1UBNA 4ARZA 4G4IA 2JHPA 2ALJA 2ODQA 5KTMA 1VFNA 4BVAA 2FGKA 3NJRA 1DDIA 3K32A 1RQ2A 3MELA 3HEMA 4NENB 5EMLA 3UMBA 4COOA 5K09A 1VL0A 1IEQA 1LX7A 1OLSA 2PTGA 2QX4A 3CNEA 4X41A 3V2GA 4Y1GA 4NRDA 1WNFA 1TKCA 5CDSA 1NUSA 4BO5A 1AQ6A 2HJ9A 1CSEE 5AVKA 1I24A 5DN6D 2I1QA 2Q6VA 4YDRA 1KAQA 2QVGA 4KPUA 4NK4A 4ZN6A 5JAMA 4IDEA 3QM1A 5IDQA 3RBAA 3AVXA 2QRJA 4EL5A 2QLBA 4LZAA 2AD5A 4MVJH 5CBPB 1UK9A 2QUKA 1KQPA 2HAEA 5CM9C 4UM7A 1N2CA 4Y0NA 2VHJA 3RRXA 3GHYA 4WNCA 4E5UA 1Z9BA 5ER6A 2GAAA 4JP5A 2I4IA 3BL6A 3SY8A 1Z2CA 5D3KA 2WF7A 5CHEA 5CLLA 2XAAA 4IIBA 1E3IA 5ED4A 3L6CA 2V0NA 4BFTA 1VC2A 3VR4H 4ZYVA 1D1QA 3C4JA 5AJVB 4IVPA 4KDFA 4O4IF 4RZ2A 3STYA 4UEJA 2C2WA 2EHJA 2GEFA 2O6HA 3WLJA 2H9YA 1K2VN 1VPDA 4GX1A 4YO7A 2PGXA 1W2WB 1QKKA 4C88A 2F9LA 1A9RA 4U7PB 3FFBA 1UFRA 1N4DA 4L3OA 4OFXA 2JI8A 1PJZA 1EWKA 4XCVA 2K2QB 4XB6B 1J20A 5COAA 4YP7A 1L4UA 5GVRA 4RDIA 2BBWA 4UULA 1Z4PX 4HLCA 4URYR 2BMFA 5DBEX 3BMCA 4F6LA 3KKOA 3MFQA 2WOJA 1PFUA 1O6BA 5AW9A 4BU1A 3G8CA 3PWSA 4UFNA 1KYXA 3ON5A 3CZPA 3P20A 4DGQA 3TAUA 1NN1A 3AIOA 4OLAA 1P29A 3KSDO 4DCUA 1IK4A 2E2WA 1OHHD 2P4UA 3CCCA 5C32A 3EIOA 1UPUA 3K9QO 4BQSA 5BP7A 4O4JA 4RIFA 4CUJA 1FJXA 2IA5A 2PU5A 3DOOA 1QZUA 3RJMA 1X7YA 5HCNA 2QXTA 2PR7A 3LBYA 1O5OA 3B6EA 1BGWA 4QGFA 3TAHA 1N8KA 4PIVA 3H1TA 4WW0A 5T57A 1GGEA 1RYDA 3H6HA 2XE7A 1GZHB 4ZVVA 1OPXA 4CLHA 2FPXA 1E18A 1YR9A 3ZZNA 1UAYA 1MH1A 5CVDA 1KYZA 1PRYA 2FF7A 2CD9A 2KE5A 1VJ0A 2R00A 3KAQA 4M22A 5L53A 1ISMA 2R47A 1R5OA 4OYLA 1F9AA 1DAGA 1RM0A 1Y1RA 1N5KA 1JLHA 2NP7A 2X5KO 1EUYA 4KQXA 3GFGA 3UT0A 3HJGA 1PGJA 4CIAA 4Z8YA 4ABTA 2FW7A 2PKQP 4U2FA 3BS4A 2XUDA 2PX6A 1EK1A 3LZCA 1BDJA 4WGFA 5EWMB 1PE0A 3WL3A 2B20A 2QYOA 4DCNA 5L45A 4E2WA 4GMXA 3ZN2A 2F3TA 4LYDA 1TZCA 3TOZA 2F9FA 2W00A 3EGIA 1OYOA 3I52A 4KHZA 1MV8A 1NF3A 1U8UA 1OXMA 1E8DA 3EVTA 3RKUA 2Q21A 4HGRA 4B7XA 4LAFA 1ZXBA 3PHGA 2Z2YA 2XMCA 4ANFA 2J41A 5K0SA 4JBHA 4ZOLB 1QQAA 3I2HA 3EN0A 1Q0SA 2NTYC 3OZVA 4D9IA 4DTCA 1WCXA 1UKVY 3JQ7B 2VWQA 3UJDA 5JVDF 1U6IA 4NH4A 1WTAA 1R4NB 3EA5A 2HV8A 3MGGA 1J0DA 5B55A 3ZWMA 4CE6A 2X7XA 4TSKA 1OROA 1NI5A 1T5IA 3OM0A 4O0MA 1X1EA 5J2UF 2VSYA 1YB5A 3SXJA 4C3OB 4I9HA 4YR7A 1LA2A 1CY0A 1Q7CA 3PQEA 5K7SA 1Q0TA 3CBQA 1S8NA 4U9HS 1KEPA 2Y4NA 2OD2A 3T7DA 3GCWA 4DEVA 1FP7A 4G3XA 4I9FA 1RVDA 3ZNPA 2V4MA 3WMEA 2XT0A 4C5CA 3AY0A 4RWZA 5JH7B 5JCPA 4BO2A 4PLVA 3Q72A 2CYCA 3IMEA 1ZHHA 1NW8A 5D01A 1GZ7A 3CEPB 4TZ0A 3SD7A 2UZ4A 3NDBB 2R1ZA 1E0KA 4ND7A 3LH5A 2GEBA 5G1OA 3UAOA 1OZ0A 5L40A 3UA4A 3DLPX 3EWAA 1DJLA 4D9CA 3LPNA 1VJ1A 1QG0A 3PUVA 4ZRMA 2A3NA 1DIHA 4XX1A 1P1JA 3V80A 2VJQA 2HZBA 3MQ4A 2E4VA 4ZARA 4JVLA 2ST1A 1GRVA 3HWRA 1ODSA 1SCBA 3D2LA 1E96A 1OLXA 2G9RA 4CIBA 3KPWA 3I05A 3D1JA 2BM9A 5B3AA 1G4UR 1P2TA 1R88A 4PC3A 1SN7A 3PKZA 4ZT6A 4UTOA 4CIDA 1VE9A 2JJ8A 3GVIA 2D0IA 2CVPA 4IDFA 3TUJC 1XTKA 5IVKA 3LX5A 3PFNA 4PBTA 4L4SA 1T1JA 3ECCA 3T9FA 1PSDA 3SJ7A 5MDHA 4Y1RA 1FX1A 3PQCA 4ZZ3A 5BSWA 3CURA 5JMTA 3HADA 4X20A 2C5HA 1M73E 4OYYA 4D45A 3O9MA 5LLTA 1WKCA 5AKKA 3QTTA 1UBFA 4LJ7A 1Z16A 3ZWWA 4ZAVA 3K0HA 2P79A 4FOTA 2MHCA 3CVWA 3SXUA 1XGKA 3EW9A 3Q8XB 5KDLA 1MFZA 1C0LA 3GOHA 3NAMA 5H3LA 2QLTA 1N7IA 1N6OA 4F4UA 4E7OA 5EUMA 3ZGXA 1NZFA 4ZHSA 4R40A 2XB9A 2QY6A 1ENYA 3AOEC 3AY6A 4P4SB 2ZUUA 2PXCA 4MGKR 2RK6A 5KVAA 4JZKA 3A27A 3RU9A 2JK1A 5FBLB 3V8VA 1SVLA 3I2JA 2BVNA 4YECA 1Z6TA 4Z9AA 5BVGB 1VRWA 4JYMA 1IY0A 4Q3NA 4EF4A 1I94B 2J3QA 3BULA 2QZZA 2A5GA 4HRAA 3ZU6A 1ITZA 4E12A 3JQBC 4LNHA 3W8NA 5FJJA 1XNQB 3PVCA 5JYDA 4HG2A 2OAP1 1TA0A 4IINA 4ML3A 5SY9A 8LDHA 1E6EA 2AR0A 1Y1QA 2DUWA 2ZWIA 2XDQA 2QV0A 1H85A 3CH5A 1WCWA 1ZI9A 3QIAA 2QN3A 2Z6VA 4QDZA 3EIHA 2VK8A 1J90A 1NVVR 1W48A 2PZGA 3OZGA 3TL2A 2J7PA 2FLVA 2BJVA 1JAHA 4WKGA 4Z9FA 5JD6A 1IG3A 2DMRA 3GN1A 3NCHA 2E5LB 4LI0A 1EBFA 2GF0A 3JWEA 5DMHA 2WFLB 3TSZA 3R2JA 1ARZA 1LV8A 1RQ7A 3MTAA 1MC8A 2DH5A 2VNKA 4O1IA 3TTXA 3V32A 5CH8A 1HX7A 2FN8A 4JFAA 4PWZA 1GVNB 5B3LA 3M7IA 2FW1A 3OA2A 3HXLA 4RJIA 1E59A 3UJ8A 3MMXA 4IOLA 4HGYA 1UWCA 2VP9A 1B74A 1JP7A 4QPZA 3GX1A 2NYAA 3T7KA 4Q9NA 5JROA 3A6KA 3QA3E 3WP0A 1RXSA 2GA8A 2F67A 2I2CA 3D0QA 4FMCF 1FDIA 1M2HA 4MZXA 2O3TA 2YV3A 2R8YA 3E7PA 3LX6A 4GOJA 4WZAB 3RDPA 4XDGA 4LK3A 2QAJA 1J7JA 4WSOA 1BE0A 2HKIA 4C1NA 5BW4A 1DX6A 2XUPA 3HU1A 3LDHA 1E9VA 4G9GA 3FCEA 1JE1A 4UNSA 5BUQA 5ITWA 3PCTA 4B7AA 3JWHA 2IX9A 1VHQA 3W1EA 2M6KA 2JGIA 3TPZA 2UV8A 2NV2B 4BU0A 1BXRA 3CF4G 1NUTA 5AKGA 5G0WA 1YZQA 4FYVA 6PFKA 3WLPA 4EFMA 3LA6A 3U7QB 4C6SA 1RYHA 1OX4A 2PR2A 5TPWB 1IHUA 1ULUA 4PICA 3LE8A 4BQOA 5CFOA 3QLEA 1SUBA 4IHJA 4WLOA 1M34B 4LUCA 2PX5A 4TTAA 4BX3A 4KU4A 4XX0B 3QXHA 3U3ZA 4CMIA 4I4LA 1SQ0A 2N9UA 2FV8A 2PWYA 3O93A 4YACA 2E48A 4C21A 1KDRA 2GBIA 4KLNA 1BHJA 2Y1XA 3NDIA 4LWPA 4IS3A 1JE0A 1FFBA 5A3JA 3C3DA 2DCMA 2HMUA 2OYRA 3VR6D 3MAGA 4HQOA 1H8EA 1J1UA 3WO1A 5ALSA 4DCJA 5JYBA 2V3WA 3BAFA 4A6XA 1VRVA 3KWFA 4IWXA 3WIVA 3EH2A 4RY2A 5HDQA 4ACAA 1E7YA 1Y4ZA 4Q9HA 4ACBA 2FDXA 1Z6PA 2R2AA 3D2AA 4AKHA 4I3HA 1FTYA 1AB6A 3PNSA 4YREA 1UQUA 1JKJB 3T06B 4Q7EA 5BRAA 1UDBA 3CNOA 3QKRB 5KC8A 3AB8A 2WLSA 2WV9A 3A1EA 3D7SA 2GAFA 4KIUA 5G4KB 2VJYA 3U7JA 4AUNA 4KX3A 1ORVA 4ER3A 3KKLA 1MPXA 2BSXA 2IEBA 3D8UA 3QRWA 2BEKA 4TWIA 4F4IA 1U3TA 2IHBA 1WF3A 4WKCA 4A1FA 4MWGA 2F1OA 2HU2A 1KARA 2XJ4A 4PYRA 4M7OA 3OPYB 4XYLA 5HIKA 3WTBA 1O9GA 3HM9A 5K0FA 1AOXA 1U0OC 3I30X 1FEZA 4G0MA 3O1HB 4OQZA 2PUCA 1QWSA 2DR0A 4XGKA 4RD6A 4MWZA 1CUXA 1KAGA 4C0SA 2DF8A 1A77A 4F84A 3N87A 4KBYA 4PQFA 4XRRA 4XWYA 5CYOA 4C01A 4CMAA 1N1MA 1GQOA 1EHYA 1U7PA 1VFPA 3LBAA 3ZV5A 4BNVA 4TWJA 2G88A 3ZBTA 4BBJA 5KNLA 2GBFA 2O7RA 4FJ2A 1WUYA 2HZ7A 2IYNA 2QE6A 1P74A 4N49A 4RY9A 1U7HA 4JUAA 4TMYA 1Y5IA 1TMOA 3K30A 1MAUA 1C3OA 3MJTA 5BN4B 1XOIA 2WUGA 3E4CA 3I04M 3U6BA 3DFUA 4R2HA 3U7EB 3LBNA 5FL3A 1AS3A 3QLVC 4WN9A 2G04A 4PGHA 2JFGA 4HB2A 1II9A 5L7YA 5DCLA 4GC5A 1A8PA 5JALA 4HSGA 1ZD5A 3R3ZA 4N12A 2DPGA 1BW9B 1RC1A 1DO2A 4QZVA 1CQJB 2ZI6A 4G8JA 3NNSA 2XY4A 3DEFA 5JAOA 1E2KA 1QTQA 2NUAA 3P2EA 4ARSA 3GWZA 4B6SA 4E2XA 1XN1A 4G6ZA 4UPEA 1RAGA 1ZUHA 1L4LA 1JXOA 1SK8A 5ICCA 2INGX 3B1VA 3GLGB 3C3XA 3NIGB 4AW9A 5BYJA 4F3YA 1KTVA 1ORDA 3LMKA 3C85A 4ESVA 2ENUA 1W36D 1A9QA 1J5XA 2R5NA 1B8VA 1PDVA 3EAGA 3FNBA 4O2BB 4BLUA 3TM4A 3PDHA 3IEVA 3B36A 1IXYA 4JDPA 1JU9A 3W6PA 1OAOA 3ICOA 3A6JA 4Q4JB 2I29A 1V3TA 2Q46A 4ONEA 4PO8A 4O3MA 1JGTA 4ZHQF 3N07A 4B5KA 4FGSA 1OTHA 1OWOA 4MGHA 3GJTA 1JIIA 3LQ4A 1AZLA 1J8YF 4YJ3F 1Q6ZA 3RAPR 3KPJA 3VR5A 3MCUA 1C7ZA 3UCEA 3ZTTA 1MVLA 2NU8A 1SU7A 4OH7A 2BFAA 4OXYA 1F8XA 2EFJA 3MJSA 1I2DA 2OUKA 2HRRA 3Q6MA 5JQGB 4C0WA 1QP7A 4EB3A 4JJZA 2B92A 1Z75A 3O94A 5TB5A 4QUIA 3L0OA 4A7PA 1GXSB 2SCUB 4QASA 3TTTA 2X3FA 2HHHB 1ECBA 2ZATA 1M0EA 1C2YA 3L1VA 4I6EA 3T52A 2WT4A 5EEGA 4AJOA 4IW3B 4D3FA 5BW5A 1M72A 2JCVA 3OZAA 3A31A 4ZZ2A 5A3RA 2VDWB 1L4HA 3ZK8A 3EG9B 3VYRB 3DOCA 1BYIA 4LTMA 3K2IA 4ND4A 1KKLA 2IY8A 1RMTA 3MRVA 3ZE7A 3IKTA 1Z6GA 2UYCA 3JWJA 1W19A 2HGZA 2M1ZA 4Q4AB 1EM8B 4AMZA 3PNQA 3RVSA 4UJ5A 1YZKA 1TCAA 4NMMA 3GCZA 4RF4A 4MA4A 1M6VB 1E62A 1GQRA 1XKQA 3L8DA 1RYZA 1V7CA 5IX8A 3DTVB 2VQEB 4AP9A 2ZE8A 3I9KA 2WYUA 1FNSA 3LLSA 4JCOA 4RCZA 4W4TA 5ELXA 1W87A 1SKBA 1T5LA 4C4SA 1L5MA 1WOYA 3LO8A 2FPWA 3HNRA 4ZI5A 1PKXA 1CEXA 1EQAA 5J3JA 2H31A 4HDQB 3WWPA 4DSTA 2FDRA 4QYWA 3L46A 2RGRA 4L27A 3SOPA 4C6RA 1DCFA 5LWQA 2I1LA 2Z2XA 3BE5A 5BW6B 4OOEA 3NG1A 4D8YA 4O08A 2A8YA 1BIFA 1YJ8A 3FSGA 2WYWA