3RUEA

Alternative analogs as viable substrates of udp-hexose 4-epimerases
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords WbgU
publication title Alternative analogs as viable substrates of UDP-hexose 4-epimerases
rcsb
source organism Plesiomonas shigelloides
total genus 122
structure length 336
sequence length 341
chains with identical sequence B, S, b
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rueA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3rueA02
3R6DA 3PFFA 4LMPA 3TOZA 4AVYA 2X0IA 3QW2A 2JD2A 5IFLA 1HYEA 3AM3A 5THQA 1BTOA 2X6TA 3DXFA 5CDSA 3ZHYA 3G0OA 2PFGA 5A3JA 3C1TA 3ASVA 2Y99A 1AHIA 2HDHA 1EE9A 3ZWPA 1E7SA 4YAJA 2VRCD 1XSEA 2OBNA 1HZJA 4R3WA 2NVUA 4FOSA 3ZWOA 4ZICA 3H5AA 1WNTA 2VQ3A 2VRCA 1GZ4A 1ID1A 2FSSA 2BGLA 2O4UX 3V2GA 5JY1A 4ZQGA 1U8XX 2Q2VA 2FR1A 3PQDA 1DC3A 1KIFA 4GLLA 3ZW9A 1O9BA 2VZ8A 3PIIA 1UZNA 5T5QA 3ZV6A 4MO2A 1QV7A 3JQ6A 1DHTA 4II2A 1UH5A 3NEPX 4WECA 1HDRA 4CL8A 1MX3A 4AG3A 1NPTO 1CYDA 2Q3EA 3JQAB 1LNQA 4JK3A 3AI3A 1HT0A 3OP4A 4NI5A 2VYND 2IXBA 4KZPA 1DO8A 3GR6A 4P22A 2ZTVA 4UAGA 2X9VA 3E18A 3FHLA 4MVJG 4HADA 3ZWCA 5ICMA 2VYNA 4D45A 3I9KA 5H83A 2IZZA 4BGEA 2O3RA 1Q7GA 4QQRA 4E5YA 3LLSA 1ORRA 4UUPA 1MXFA 1BHSA 2UVDA 3CH6A 2QRJA 4WJZA 1DJNA 1E1KA 2O7SA 4OXKA 4Q3EA 4OAQA 3GHYA 1XLTA 2D5AA 5LDHA 2HRBA 3I52A 2DPHA 4IZIA 1U2DA 3T4XA 1PU2A 1ULSA 3STHA 2Q2QA 1ISMA 1DFIA 2B5VA 2XAAA 1KC1A 4WKGA 1E6WA 3MWEB 2R6JA 4KUEA 5GZ3A 1DRWA 4Q3DA 3SLGA 1U3WA 3WSWA 5IF3A 3C7AA 4ESOA 3DONA 1Z7BA 2C29D 1ZK3A 1HEUA 1R4NA 3HFSA 3ZZNA 3UUWA 5I7VA 1KY4A 1R37A 4QSMA 5L40A 2CFCA 4DQVA 2Y1OA 5JC8A 3WLEA 4IQGA 4ALKA 5DZSA 1U3UA 1B0AA 4XX0A 1I24A 1NYTA 2PY6A 3LC7O 2JAPA 3B1KA 1S6YA 1I0ZA 1V35A 1NFRA 3VKUA 3AK4A 3Q1LA 2G1UA 1WMAA 4CQMA 1Y8RB 1N9GB 1ONOA 3PZBA 3TZKA 3WWZA 1KBZA 3UCFA 3I4CA 4PRKA 1OC2A 4YJGA 2HLPA 3GVHA 1B3RA 1MG0A 2Q1SA 5L53A 4TWRA 3SJ7A 4AJKA 1GYRA 1M75A 1DIRA 2NV6A 4NU5A 4U8GA 2EP5A 4E30A 4YT2A 1X14A 1KOLA 4RORA 4CLHA 4DYDA 1OFGA 4J49A 3RUEA 5I9NA 1I36A 1G0OA 1B8UA 3O9ZA 3AM4A 2X5JO 1PS9A 4CMGA 1WDMA 3E82A 4PG5A 1Z73A 5CEEA 3U5TA 2FPIA 3KRTA 2BGMA 5JO9A 3GNSA 4B3HA 4IDFA 4BNMA 1DRVA 2Z5LA 5I7EA 4KWIA 2P5YA 4C7JA 5EESA 1QYWA 1KVTA 4M55A 4MP6A 5A9TA 1C14A 1P0CA 3ZDFA 3NTRA 4O6VA 3V2HA 1EBUA 1K6JA 2FZEA 4DPLA 1C0IA 5L51A 3E9MA 2NTNA 2X7HA 1U7HA 1YJQA 1I30A 3AU9A 1ZBQA 2Y1EA 1GTMA 3VVBA 3DAFA 4TQGA 4MKRA 4E31A 2PKQP 4WCFB 1E3SA 4L75A 2AQIA 4JJGA 1DDOA 5BNFA 3OJLA 3PP8A 3HDHA 3GPIA 4CL3A 4BKOA 1Z45A 4D3FA 1OZAA 3LC1O 3ZWMA 1AGNA 5JYDA 4R9SA 2P5UA 3ENNA 2JAHA 3PHHA 1EDZA 1E6UA 3EYWA 1EEHA 1YQDA 4RF4A 3I4FA 4ND5A 3SX2A 3A9WA 4DIBA 3RC9A 5ER9A 3PJEA 1N92A 5T8KA 3DHEA 1IPFA 5DBFA 2P68A 1HYHA 3JQDA 3UH1A 1V8BA 1GZ3A 1AUPA 4PLYA 5LC1A 3ONEA 1ZCJA 4BIIA 4ZD6A 4YAIA 5FI3A 1IHYA 3B1JA 3OEWA 4XYLA 3NJ8A 1ZEMA 4CM9D 5COAA 5CFZA 3GUYA 3ZH2A 5CG2A 3FNEA 3U62A 1E3JA 1H0KA 4PLCA 3M1AA 2Y67A 5TF4A 2Q50A 4WCFC 1DIBA 4E0BA 3NT5A 2WD8A 2Y0DA 3ABIA 4D41A 3UVEA 4ND2A 4RQTA 3WB9A 2NTVA 1E5QA 4D79A 3RUCA 1E3LA 1GQYA 1BVUA 2PZKA 2OP1A 4CMJA 5FF9A 1PGQA 3DBRB 3DZHA 4N18A 1C1XB 3TL2A 3I9NA 1EUDA 4IDCA 2PLAA 1N1GA 3BAZA 1AE1A 3PYLA 5A9SA 5ILOA 1H6DA 1NR1A 1YJ8A 2C5AA 3WR5A 5C7IO 3N58A 3D7LA 3U4CA 3GLQA 4RVFA 4J91A 2VHZA 4O59O 3RWBA 3WQSB 4DBZA 3JQFA 3DAGA 4PG8A 3KUXA 2VTDA 4MJLA 1ZEJA 2QZZA 1B7GO 2FP4A 5EL0A 1MGOA 5IXYA 3DBHA 2I9PA 1KY5A 3UAGA 4BMVA 4NBWA 2D8AA 4ROSA 3IIEA 3VZQA 4ZQBA 2RH8A 4BB6A 5FFFA 3JQ8A 4FPXA 1JDJA 1JTVA 3WX0A 1PZEA 7MDHA 4J1TA 2ZB8A 1CERA 4R69A 4GWGA 3ENKA 1Z82A 3QVTA 3PVZA 4CMEA 4XB1A 4UUOA 4A5OA 3GVCA 3LU1A 2DFVA 4CMIB 4IM7A 4IBOA 3LQFA 5GZ1A 3LZ6A 4Y6RA 4J4TA 4O63O 4C7KA 4GWKA 3F4BA 3OIDA 4KWHA 4CM8A 4M54A 3FNHA 3P2OA 3ZW8A 3UN1A 5EPOA 3ZHBA 1IZ0A 4PN3A 3OJ0A 2R00C 5JY6A 4YRAA 3I9JA 3WGOA 4ZJUA 3JQ7A 2RH4A 4BNKA 1EBFA 4MINA 1WAMA 3EZLA 3WTBA 3Q3CA 5JE8A 1P77A 1NASA 2A92A 4OM8A 4ZN6A 3JD0A 5B1YA 3PJDA 3E48A 3S55A 1VL0A 4HX5A 4B7CA 4BNTA 4XEHA 2FR8A 2ZTMA 2EEZA 2IEBA 3DTTA 3O8QA 3HNPA 1YB5A 3FI9A 3ZV3A 2V6BA 1ZIDA 4S3MA 2JHGA 5L7WA 4XWYA 2X5OA 5F3RA 3ZNNA 2ZYGA 5TRTA 1Y5RA 4HFRA 4R5MA 1HDYA 4QEDA 3UKOA 3TF5A 1WPQA 2O3QA 4AJHA 4W7HA 4XJSA 3C85A 1X1EA 2V6MA 3I5MA 3K73O 2GRAA 4LRSB 1VKOA 1LC0A 4E21A 4RJTA 4BQRA 3IP1A 4IS3A 3VPFA 4J2OA 3BHMA 2C82A 3RUAA 3K31A 2PD4A 3MTGA 2DVMA 2WSBA 3V1UA 4IMPA 1ISFA 3GPDG 4JIGA 1ADCA 1WDLA 1R0LA 3WXBA 3RCBA 3OIGA 4XGKA 3RI3A 1ZMTA 4MVJF 5ER6A 4BOYA 4DXHA 3ANMA 4I9NA 5AOVA 3RD5A 4EDFA 2TMGA 3PDJA 2YJZA 3PQFA 2UUOA 4Z3DA 4OJNA 5L9AA 3L4BA 1XELA 3U49A 3GGGA 2NU9A 3B1FA 4WLVA 1FXSA 3JYPA 1NQ5A 2FSVA 3H2SA 4GGOA 5J23A 4AJLA 5CEJA 1LSSA 1HWYA 2HMWA 1E3WA 1S7CA 4RO0A 3GN2A 3RASA 4ALIA 2EKQA 4UVIA 2Y1DA 4FR5A 4EZBA 1U9JA 3DMTC 4NPCA 3LC2O 1DC4A 3FRJA 1IULA 5I8ZA 2WD7A 2YV2A 2EXXA 4Z9YA 2CSUA 1ONPA 4ND4A 5ITVA 2WYVA 1HKUA 3TZHA 3BTSA 2OXIA 1GADO 1O89A 5HS6A 1TVEA 4U5QA 1B8PA 1SCUA 4R54A 2JCVA 4JBIA 2HCTA 1Y9EA 5ENVA 4E5MA 1CRWG 1GV0A 4DLBA 2VHYA 4WCDA 2G17A 3LLVA 5DDIP 3I23A 4E2YA 5L3ZA 5TJHA 3C7DB 4OYRA 4J3FA 1D8AA 2HQ1A 5DP2A 1XHLA 2Y66A 5K0ZA 4RVGA 4UULA 1YXMA 2Y68A 1QLJA 4IZHA 4P8RA 5U4QA 5KOIA 1C1DB 1V9LA 2BFMA 2X9NA 1KETA 2O3UA 3CINA 4KUGA 5G0UA 5MDHA 2BD0A 5KIAA 4CQLA 3WIDA 4R1UA 2Z95A 4I08A 1PWXA 4YYZA 1NXQA 3WWYA 4Q3CA 1LBEA 4XYGA 2POQX 4B7UA 1A4IA 4IIUA 5AVOA 3IKTA 3N74A 1RWBA 3CSDA 4ONEA 3BMNB 3RC2A 3D0OA 5A02A 2H5LA 3FN4A 1BXGA 3OETA 5IDWA 2Q45A 2AQKA 3M6IA 2EW8A 4YAGA 3ZNQA 3E8XA 1K5HA 1FK8A 1WLYA 3FNFA 4GAEA 2UYYA 3ADPA 3CMMA 4OSOA 2ZTLA 3I1JA 4CLEA 1HDCA 4AL4A 1D4FA 2B4RO 5H81A 1PJBA 3ZU4A 5FWNA 1YVEI 4XKJA 3HZZA 5AYVA 4BNUA 5ITWA 1VL6A 3P7MA 1MG5A 3D5QA 3LDHA 2VHVA 2YQ5A 4R5HA 2Q4EA 3DMYA 3OSUA 4J7UA 2FN7A 3DWFA 2J6IA 3IJRA 3RROA 1QMGA 1AXEA 1E7RA 1CJCA 3JSAA 2VUTA 5H82A 3RUDA 2GDZA 3G17A 4CV3A 1NQAO 1DFHA 3P5SA 4WNCA 4BNVA 1NBOA 2YUTA 4W6ZA 1ZO8A 4PLFA 1DAPA 1RYEA 1CEQA 1BXZA 1Z74A 4MP8A 3V5NA 3PYXA 1TT7A 1VLLA 1QYXA 4IJWA 3CKYA 4EYEA 3F46A 3GNQA 3GZ4A 2Y93A 2CZCA 5G4KA 3L77A 4GSLA 4Q3BA 1UXGA 4EI2A 4TKMA 3BTVA 2VZ0A 2YHIA 5KKAA 2GGSA 4CMHA 3AY3A 4J2HA 2IEDA 1LTHR 1KVUA 3AUTA 4YJFB 2O4CA 1X0XA 4E32A 4D0SA 5CP8A 2E48A 3K92A 1U3VA 4OQZA 1PJQA 1NX6A 4FC7A 1OMOA 3VPGA 3G79A 3F5QA 3ZGYA 5BNTA 2G0TA 3PJGA 4PG6A 4RDIA 5CHEA 4U7WA 3AJRA 1EVYA 3FTPA 3PHGA 4BO8A 1SO8A 2ZYAA 1K89A 4YACA 5FYDA 4RZIA 5FEUA 2AQHA 1IZ9A 3WGYA 1VPDA 1UR5A 1NNUA 2B5WA 1OAAA 1PJ4A 2J5QA 1WZEA 3CZMA 3S2GA 2AEMA 5ADHA 4IMRA 3ZWBA 1O0SA 1NHWA 1H6AA 4Z0TA 3ONDA 2JD0A 3VAZA 4YJHB 4B79A 3AY6A 1VM6A 5TT0A 2OORA 5CDYA 1D7OA 3JQAA 4W4TA 3V1TC 4FJ2A 1E3IA 1E1MA 1KEWA 5T6BA 2ZK7A 1K2WA 4BB5A 4LCEA 2X86A 4YRDA 1X15A 1W0CA 1PIWA 2UV8A 1ZK1A 3FPCA 5IDQA 4IUYA 1FDUA 4JBHA 5A5EA 5IJZA 1IHXA 2YFHA 1JQBA 3CUKA 4DPMA 1BDMA 1HE3A 3OJFA 5G2OA 2W4QA 3ANLA 2RCYA 4CMKA 1YO6A 3F1KA 3KM0A 3NRCA 3EUWA 5T64A 1AHHA 1PJTA 1JU9A 1YKFA 2DQ4A 3PRJA 4B4OA 1Z6ZA 4BNNA 2V6GA 1WWKA 3H9QA 1EVZA 3WNQA 7ADHA 4EJ0A 2E6UX 5JDCC 3QVSA 1BDBA 5EIOA 4ID9A 1WVGA 4YDRA 3JQBC 3LT0A 4CUZA 2EW2A 4LVUA 4B8WA 5IZCC 3ULKA 4JCOA 1QLHA 4ILKA 5JMPA 2BRUA 3RUFA 2DC1A 2YV3A 4KTVE 4DC1A 3GF4A 2PD6A 3EHEA 2YYYA 1I32A 1LDBA 5K9ZA 1SZJG 4PLWA 4E33A 1B14A 1K3TA 1MC4A 2O3SA 5L45A 5I8WA 4QTZA 4RVSA 1K6IA 2V65A 4IQ8A 3M1LA 1KEUA 1TA4A 3ZWAA 1O5IA 3MJVA 4Q3NA 4CV2A 1J49A 3WOHA 2ZKLA 1J6UA 4D43A 5KJCA 4PLHA 2FMUA 1R66A 4I5DA 4OXYA 4UVDA 3GVPA 2HK9A 1H2BA 5ENDA 5JS6A 1I8TA 5GMOA 4PVDA 4IJKA 4LMRA 2HK8A 4GLOA 2QRKA 4Q9NA 2EGHA 2CF5A 1VKNA 1B3BA 4K6FA 1GFSA 1NWCA 4J16A 4J1QA 3AI2A 3UHAA 1B2LA 4ZQHA 2GD1O 1A5ZA 1PJLA 1DC5A 1SMKA 1VRWA 3GA0A 4R1SA 3MEQA 2I5PO 3ROPA 4UUNA 3WSVA 1Y8QB 3DHNA 4CLRA 2B83A 2W90A 2NM0A 5AXCA 3DFZA 1YBAA 1J0XO 1GYPA 3C1AA 3JCZA 3ETGA 1JVSA 1ENPA 4Y6SA 4BMNA 1A27A 1BXKA 3UCXA 4ALLA 3TZQA 1PQPA 5F1KA 1F06A 5DF1A 1O94A 4FN4A 4W9NA 2J3JA 3ICCA 2X0NA 4G5HA 4K1LA 3GG2A 3KHUA 5G0SA 3RFVA 4TVOA 4YR9A 4MIEA 4FDAA 1Q2XA 1PS0A 3Q0EA 3RKUA 1HE2A 1DHRA 4RPJA 4AJJA 3D4NA 3MCVA 4FOOA 4TZKA 4WCFA 1DB3A 2AEJA 3PZRA 3MJTA 3TPCA 4RQUA 4BNZA 4CV1A 1ZJZA 2H1SA 3EK2A 3K30A 5I9MA 3GOHA 2DKNA 4RL6A 3GHHA 2J3KA 2DT5A 3UICA 4Y67A 3EVTA 3KEQA 2QQ5A 4NBTA 2QRLA 4FC6A 3NDIA 1BVRA 4JX8A 3RJ5A 1PGOA 4BGIA 2ZCUA 5IXSA 4MVJD 2NTJA 3F3SA 2CDAA 2GR9A 4BMSA 2CVOA 1HLPA 1NP3A 3BMOB 1FJHA 4NIMA 3ETDA 4J0FA 1LXCA 5IAAA 3K96A 4P4LA 1LQTA 1DEHA 3JTMA 2VUSA 3I9LA 5IG2A 2GN6A 2F00A 1HDOA 4CR7A 4YXFA 2ZJ0A 3PGJA 5CAEA 1PEDA 4FCCA 2X9GA 3TDKA 4I9HA 2UUPA 1E77A 2V6FA 2DM6A 3E6AA 4NJMB 3R3JA 1A4UA 2B36A 2WM3A 5CG1A 1PR3A 4WNIA 1Y9AA 3PI7A 2Q4BA 3R1IA 2EV9A 3E1KA 4DWVA 4EGFA 2W2LD 3GGPA 1P0FA 2FHSA 3ZU2A 5DN9A 3DBRA 4P38A 4W7IA 2VYVD 3WGZA 4YQYA 3FWNA 2W2LA 4ALNA 3MJEA 3BMQB 1C1XA 1O6ZA 1I3KA 5JXWA 4BNGA 5K6AC 2E37A 1SAYA 4PGFA 4BNIA 2D1YA 2VNSA 3KLMX 1YE3A 4LSWA 1H94A 1X13A 1XGKA 4N5MA 4TSKA 5TX7A 3JV7A 2ZYDA 1EMDA 1PX0A 1CDOA 2NACA 3F6YA 4EUHA 2WJPA 2NVBA 4GL4A 3S2FA 4CPDA 3JQGB 4DLLA 5G0VA 4DL9A 2R00A 1DJQA 1FMCA 1X1TA 1ML3A 3F47A 4CM4B 5C5IA 1LDEA 1NQOA 4WOJA 3R3SA 2EKLA 2X8LA 3ADOA 2NSDA 1L7DA 3INGA 2R2GA 3CPSA 2XOXA 2Y0CA 3O4RA 3WNVA 1LLQA 3UXYA 3TL3A 4F3YA 5KKCA 2EJVA 1JA9A 1E7MA 4ZRNA 4H7PA 4PZEA 2GYYA 2WE7A 2Q1TA 1SOWA 1LSJA 2O50A 3AY7A 4BNJA 2D4AA 1DSSG 4J9VA 3KV3O 4CMIA 1VJ0A 2DTEA 4OH1A 3ONFA 5EMHA 3ZWVA 5EERA 1YL5A 2O7QA 4XZ3A 4M89A 3LT2A 4BGVA 3KO8A 2B37A 2HJRA 4RPLA 1W4ZA 2Z1MA 3HN2A 3WDSA 3AU8A 1QP8A 2NUAA 4IDGA 4YEDA 3TOXA 1MA0A 2X5KO 1UZMA 4DMMA 4G81A 4FS3A 2FPPA 3IAHA 4I5GA 2ILTA 2B4QA 3DFUA 2DTDA 2AG5A 4YVFA 1N8KA 1NPDA 1HDZA 4YJDA 4E2WA 4K6CA 5L95A 1LRLA 2H9IA 1PGJA 1GUYA 3QLJA 1UXJA 4PVCA 1DIAA 1LI4A 2O23A 2ZIZA 3KSUA 4FD3A 2EKPA 2GO1A 4HBGA 5IDYA 3WGHA 1NVTA 1IPEA 3X2EA 3B70A 3QWFA 3U9LA 1GEGA 3GRKA 2LDBA 2CNBA 3RBXA 1ISIA 1ULUA 3SC4A 3VPSA 1FDTA 2DUWA 3Q9UA 1T4BA 4LK3A 4W9NC 3DMTA 4XGIA 4AJ4A 4OMUA 3BYZA 3MWDB 1P74A 5COBA 1ZW1A 4L74A 1LRKA 3DBLB 1E7WA 4N5NA 3LT4A 3UGKA 2CDCA 4CM9A 2HAEA 1ZMOA 3PTZA 3AM5A 4XDZA 3SXPA 4XQEA 3AFMA 3TWOA 4IY1A 1GV1A 2BH9A 2Q99A 4HNHA 3EAGA 4TZTA 1A7KA 3QSGA 4Z6KA 3KYBA 1YQGA 1J4AA 3U3XA 5IN5A 2VHWA 1VI2A 2RHCA 1ISGA 5DCUA 2XPCA 1GZ6A 2J5KA 5B4UA 3OMLA 4ZGWA 3Q2KA 4TKLA 1XG5A 1UZLA 5B12A 2EJWA 3OJOA 3JQCA 2CVQA 1CQIA 1F0YA 2PV7A 4K28A 3TQHA 3OFSA 4N7RA 3EGOA 4QFCA 3W4KA 4DLAA 1R4MB 2C20A 1I2BA 4HP8A 1EQ2A 4NBRA 1DPGA 5DBGA 4D42A 5B4VA 4PG7A 2CF6A 1HDXA 3I6QA 1HRDA 3DZBA 1ZK4A 1M2WA 3DZGA 4R4JA 4ZQEA 3E9NA 3LF2A 5EJ2A 2D0IA 2ZJ1A 8ADHA 3I9OA 3RQSA 2OBYA 1BRMA 1SB8A 2CD9A 1OI7A 1VSVA 4UEJA 3VTZA 3NV9A 3T4EA 4CQMB 3BTOA 2PH3A 4OXNA 2PWZA 4WLNA 1XWFA 4BQPA 3PLRA 1P1IA 1LC3A 3S2EA 4UVGA 5ES3A 4BO3A 1MLDA 2RBEA 3OA0A 1J5PA 3IOYA 4UEKA 3GRPA 2BFAA 5A04A 3W8DA 1X7DA 3FTNA 2Q1UA 2CMDA 2F1KA 4AJEA 3VC7A 4YTEA 2O2YA 1K6XA 1NM5A 2AHRA 5TT1A 4IDAA 5TGDA 1GCOA 4EJ6A 1LLCA 1HYGA 3ZWNA 1HL3A 2WYWA 3BMCA 3DZKA 5AXAA 2D5CA 4JNKA 1LDYA 3E5MA 3EC7A 3F4LA 1LSUA 3NX4A 4FFOA 3KSDO 1GEEA 2TMDA 3LYLA 2NU8A 4BL5A 5I7SA 3BMNA 4OGWA 3VVCA 3ZWXA 3OQ1A 5MGBA 1R12A 2OUIA 4EW6A 5JFOA 4XGNA 4IJVA 4RCVA 4FFMA 1LDMA 3OHSX 4MPDA 1X0VA 4J4BA 4F6LA 2JFHA 1OBFO 4GVXA 1RJWA 3WG9A 2BHLA 3QE3A 3UFXA 3WYCA 4E13A 1F12A 4UUMA 3INTA 3RU7A 1C3VA 4HUJA 4OOFA 2WYUA 3L6EA 1E0DA 3RBZA 1BMDA 2JD1A 4LSMA 3LK7A 4A0SA 4E2XA 3GFGA 4XCVA 1KVRA 2YZ7A 3QIVA 4IGEA 3V8BA 3H5RA 4H3VA 2OO5A 5G0WA 3K2EA 3VH1A 4YT5A 2VWQA 2O3TA 1H2HA 1Q0HA 2P9EA 3TNLA 3FCOA 3L0DA 1YBVA 5I9LA 4NH4A 2I76A 4FFNA 4N54A 3AUSA 2J8ZA 4DIOA 2PZMA 1M67A 1YRLA 3PQEA 4M87A 1HSZA 1ADFA 5COQA 2EF1A 1TB4A 4A03A 5KTKA 3LF1A 3QVXA 2QIOA 3R0IA 3KB6A 1Q0QA 3A06A 1A9YA 2Q1WA 3P2YA 3S1LA 5JAMA 2BLLA 4B7XA 4HFMA 2DTXA 2DPGA 4Z0HO 2VT2A 2Y1FA 4CLOB 5DP1A 4GPD1 1M6HA 3NYWA 1XQ1A 2FY8A 5LDGA 4XJTA 3G49A 2NLOA 1U5CA 2WMDA 1NWHA 1PQWA 3W6UA 1U3TA 3WQQA 3DR3A 2YDYA 3A4VA 3EY4A 4KDEA 2OL4A 4F6CA 1I10A 2E4AA 4E5KA 3FPLA 3KSZO 1QKIA 5CPFA 3WJAA 4OSPA 5JAIA 4KDFA 4QUKA 4WEQA 2A94A 4RVHA 5JDCA 4R1TA 9LDBA 1R15A 2IODA 3D64A 4X54A 3GMDA 1E7QA 2J5RA 2PD3A 2IDZA 3HFGA 3JQBA 1Q7CA 3INRA 2WDZA 5B37A 1T26A 2AE2A 1VE9A 5IZCA 5DCWA 1KVQA 4IINA 1N5DA 2JJYA 1DXYA 4NDNE 4DQUA 1LA2A 2JCYA 5CDUA 5C3MA 3QV1A 1PL7A 3AUUA 1BWSA 1ZFNA 5U9CA 4YJHA 3F5SA 2H6EA 5L4NA 3N7UA 4M49A 3H4VA 1GUZA 2G76A 1UXKA 4CMBA 5F5NA 3CE6A 3EZYA 5L7TA 1WMBA 1BGVA 4MVJM 4XR4A 3PHJA 4WLUA 4MIYA 1U4OA 4XRRA 1GL3A 4JXKA 1FDWA 4HV4A 5HBRA 3MJ4A 1ZSNA 3OEYA 2EWMA 1T4DA 1SEPA 3KZVA 3PK0A 3L6DA 4UVHA 5T57A 4R9RA 4RPHA 2OGUA 1IE3A 3PDUA 5A06A 3NAQA 3NDRA 4PLZA 6ADHA 4MVJE 1ZKMA 4LRTB 2P9CA 5JBIA 4UEOA 3T7CA 2VWGA 4U0KA 1PZHA 4LW8A 4RPGA 1HETA 5F21A 2WTBA 2GZ2A 3PWZA 1NVGA 1GCUA 2NWQA 4A2CA 2IYOA 4NK4A 1YDEA 4CMCA 3IL2A 5EQFA 1H9BA 3NKLA 1XR3A 4ZA2A 3WS7A 3FD8A 5BQFA 5JDIC 4QO7A 4A10A 2C2XA 3WQRA 1T24A 2HKIA 3LT1A 1UP4A 4WK6A 4CUJA 5BSEA 4DUPA 1B8VA 3E03A 1PQUA 4MP3A 1B26A 3KYDB 3WYEA 3I6IA 4XQCA 3L4SO 4PFJA 1PJ3A 1VC2A 4TRRA 1E6EA 4IDBA 3W1VA 3LSYA 3WMXA 4AJ2A 4BO1A 5JC1A 1QV6A 1PS8A 4E5NA 1ISHA 5IZ4A 1ZUD1 3HDQA 3ITDA 1V3TA 1MFPA 1UAGA 2QW8A 1QRRA 1TXGA 1HZZA 5A4DA 2B35A 2ET6A 4FJ0A 2GN4A 4OKNA 1Y8QA 3IS3A 1VSUA 1LUAA 3A1NA 1EE2A 1XQ6A 1KC3A 4CM3A 3D3WB 4DTIA 1XU7A 3VH2A 3DC2A 1LU9A 3HN7A 2OP0A 3RJ9A 1YOVB 2HO5A 4XYMA 1QORA 3QJ5A 1KERA 1W73A 1F14A 1P1RA 1N7HA 5G0TA 1T2EA 3KTDA 1TLTA 2I66A 1EVJA 2JKVA 5BT9A 4BVAA 1YB4A 2AMFA 1GPJA 1XCBA 4M86A 5THKA 5CDTA 1ENOA 3NTQA 4I9UA 1I33A 1ZK2A 4AJPA 3ANNA 4HFNA 5HWSA 2IYPA 1NAIA 2EGGA 3GDFA 4EITA 2G82A 4XIYA 3EDMA 4FIZA 3TZ6A 4NBUA 4GMFA 4M1QA 5TJ9A 1U1IA 3K6JA 3K8ZA 5G4LA 3DTYA 1QXSA 3JYQA 3VDQA 4H15A 4XD2A 4EUFA 1Y1PA 1M6WA 5KJ1A 2LDXA 4O5OA 1GPDG 3JYLA 4L76A 3OQBA 4WLFA 3D5TA 5K6AA 1XU9A 3BMOA 3F9IA 3S2IA 1T1RA 2PNFA 3FBTA 3BIOA 3DOOA 4D0RA 3NTOA 1PZFA 1PL6A 4BO6A 3ETEA 4MIOA 1GYQA 1WDKA 1UP7A 1P44A 3FF4A 4EEZA 4DBVO 4ND1A 2GSDA 4ZRMA 4BNLA 3L07A 3DL2A 3QWBA 2I99A 3UW3A 4CV0A 2I3AA 4NQZA 4JP3A 2JHFA 3DZJA 1WP4A 1A9ZA 2XF8A 4NJMA 2V7PA 4CUKA 1YB1A 3GAFA 1RM0A 1EUCA 1U28A 4G65A 4II3A 4OO3A 5A3VA 1JKJA 3RUHA 4CLDA 1MUUA 1DIHA 4J0EA 4YQZA 3C7CB 4QT0A 5TIIA 3RC7A 3ZCXA 4J4HA 1SOVA 4DPKA 4CM6A 5A03A 4BNWA 1V3VA 3C8MA 3TFQA 2AE1A 3HDYA 4WOKA 1KEPA 1GQ2A 2QYSA 3BMQA 4MVJP 3GDOA 1I5RA 1HSOA 1XIVA 1ZSVA 4YA6A 3O03A 4WLEA 1ZVMA 1JLLA 2SCUA 5DT9A 4Q39A 4BV9A 4LN1A 1Y8RA 1LX6A 1N9GA 1O8CA 1PWZA 3WJ7A 4AJ1A 3O26A 4TRMA 3AW9A 3IP3A 2I65A 1D3AA 1YS4A 3U4HA 1G0NA 1JVBA 3JQGA 1U8FO 1YWGO 1LDGA 1H93A 2PTGA 4OL9A 3P19A 5TLSA 4P4GA 2GERA 5CEFA 4DRYA 2W2KB 2YHUA 1AXGA 3HWRA 3JQ9C 4ALJA 1JW9B 3FBGA 3GZNB 2HMSA 4H16A 5U1PA 1UXHA 4HWKA 3WGQA 3TJRA 1B15A 4U0JA 3KYCB 1ADBA 2HK7A 3BTUA 3GH3A 4EEXA 2DLDA 4YB8A 4S1VA 3WFIA 1DIGA 3O38A 1H5QA 2J3HA 3VHRA 1YBMA 4Z9XA 1OOEA 1PL8A 2PR2A 3B20A 1MC5A 2P4HX 4CODB 4HFJA 3Q6IA 3G1TA 4DREA 3KLPX 1W6UA 4R51A 4GQAA 2EG9A 4UVEA 1KS9A 2FPGA 2EERA 3QRWA 4BO0A 4LVCA 5T67A 1IB6A 4E12A 2GZ3A 3MJCA 3GNTA 2I6TA 4CJXA 4GKBA 4ZQFA 3TN7A 1I2CA 3DB2A 1TI7A 1ARZA 4XA8A 3U4DA 3UOGA 2BMAA 1NAHA 4CLXA 1CIVA 3HJAA 1PGPA 4W82A 4NHEA 4WEOA 2C5EA 1T1SA 5AQ1A 3KETA 2BF7A 1RPNA 3OA2A 5A05A 2VTEA 3RUIA 2BKAA 2O2SA 4J6FA 2ZQYA 4O0LA 4PCVA 2VWHA 4BKUA 5C37A 2PK3A 2QYTA 2W98A 4TROA 1TEHA 4E2ZA 2Q49A 2BFPA 3H9GA 3WGTA 3D3EA 4GMGA 4MVJA 3SEFA 3ZU3A 1H6CA 5IN4A 4XR9A 4DC0A 1JAYA 3H65A 1RYDA 1PGNA 4CR8A 1T2DA 3DBLA 3AUAA 3UF0A 2HMTA 4Y8VA 1KVSA 1JWBB 3DO5A 4J9UE 4XRGA 2I3GA 4J1SA 3QY9A 4INAA 1HE5A 5DCYA 1CQJA 2D2IA 3GY0A 5AXBA 4ALMA 4FBGA 1Y5MA 4RGBA 5A1TA 4RLSA 3W4IA 3K2BA 2GPTA 3NDJA 5C7OO 2UDPA 2XXJA 3MTJA 1P1JA 3MOGA 3QWAA 5CDGA 2DFDA 3GQVA 2CY0A 4D3DA 1DAOA 1ZK0A 5TC4A 1KEVA 2HRZA 4R41A 4E3ZA 4FFLA 3GEGA 4BO4A 3BHJA 3AOEA 1DC6A 2WEKA 1UUFA 2GCGA 2VYVA 4J90A 4A27A 1QYCA 3H6KA 3HADA 5L4LA 3DBVO 3RC1A 3RKRA 1WZIA 4IS2A 1R4MA 2HUNA 1E3EA 4K26A 4YWJA 4IDDA 2ZB4A 4MOWA 3DAPA 1O95A 3CMCO 3NT4A 2C7GA 2JCXA 3GK3A 4A26A 1YL7A 3ZWYA 5JSFA 5JW6A 3DZFA 5F1OA 1SEVA 5GZ6A 4R1NA 5JPIA 4CQMD 2BFOA 2H63A 3TFOA 1EK5A 2FRDA 1L7EA 1NFFA 4DQXA 2VN8A 8LDHA 3G3EA 3VZRA 2Z1NA 5JAZA 2RAFA 3FWZA 4FJ1A 4E5PA 4FSHA 1YONA 3RU9A 3NGXA 3PHIA 3PPIA 2D3TA 4DGSA 3SBOA 3SJUA 4YBZA 1BW9B 2C54A 1LDNA 4NK5A 1TT5B 2Y05A 4YPOA 5BSGA 2W8ZA 4CLRB 3ROQA 5BSHA 4B3JA 4DMLA 4WLOA 2GN8A 3DOCA 4FFRA 1ZJYA 2NADA 1OC4A 3MOIA 2ZTUA 4L0QA 1F8GA 3B6ZA 3S8MA 4KMSA 4Y98A 1Q7BA 5B4TA 4RF3A 1QYDA 1FF9A 4R3NA 3IUPA 1PJCA 3C24A 4BS9A 2NVUB 1RM4A 2EHDA 2CDBA 4J1NA 2OHXA 4IDEA 1FDSA 3U0BA 1EK6A 2GF2A 4KTTE 1U5AA 2PH5A 3U4IA 5JYEA 1P3DA 1Y81A 4Y9DA 6LDHA 1EUZA 1HXHA 4FGWA 3I83A 2VRBA 3H7AA 4OHUA 4PLGA 1VL8A 3OECA 1HE4A 2I67A 3WGGA 1I3NA 1A7AA 3PGXA 4U6QA 3HB5X 4M8SA 1LJ8A 2JL1A 3H2ZA 5TNXA 3QVOA 3H9UA 1BG6A 4BO5A 4J7XA 4XIJA 2FOIA 4C4OA 1P33A 1D1SA 3TRIA 3GVIA 3PXXA 1SC6A 5JAQA 2GZ1A 3JYNA 1N1EA 4J7CA 4B3IA 2VUUA 1RM3A 1H9AA 3HQ4O 2PKQO 5A5FA 2PGLA 2HMUA 1M66A 2B0JA 3NGLA 5EINA 4CMAA 3EVNA 4LCJA 5F1PA 3WLFA 1P9LA 4NJOA 1NPYA 3CZRA 4LGVA 3ZN2A 4XYBA 3CEAA 4CLOA 2DU8A 2Y1CA 4BHTA 3QWIA 3C3XA 1E7YA 4BKRA 1XEAA 3GC6A 1ZNQO 3LVFO 3M2TA 3CTMA 4JQCA 4MVJH 2HSDA 5HTOA 1R4NB 5KCZA 2IRWA 1CWUA 4NR0A 3PEFA 4R16A 1X7GA 2A35A 2PGDA 4KUHA 4JGBA 4MKXA 2PA3A 5TQVA 4L73A 2VOEA 1HDGO 4NFSA 2PGJA 4URFA 1PTJA 4MDHA 3ON5A 3BXXA 4GVLA 2HJSA 2P91A 2ZATA 3DQPA 4DVJA 1GY8A 1EFLA 5FI5A 3H3JA 2X4GA 1C0KA 4YAEA 4K9DA 3ITKA 4DYVA 4PLPA 3JD3A 1QYVA 3SLKA 1T2CA 4YJGB 4BNXA 3V2UA 2GNAA 4GI2A 2Y1GA 5LCXA 3ZI0A 1QSGA 2C2YA 1PR9A 1UAYA 5AXDA 4I5FA 4B8ZA 1DOHA 1YQXA 4ZHSA 1C1DA 1UJMA 3GEMA 4WPGA 3AOEC 3W8EA 4BNYA 3VH4A 2B69A 1B16A 3WMWA 1ISJA 1Q0LA 3ROKA 3VKVA 3AWDA 5JDIA 4ITUA 5KJEA 2P9GA 3D4PA 3GDGA 4RZHA 3BZUA 1RM5A 4EUEA 2DUUA 3HE3A 3NUGA 4KQWA 1E5LA 4TMFA 1MP0A 3VZPA 3G1UA 3SVTA 1JWAB 2DBRA 2OMEA 1UDBA 2O3JA 1VJ1A 4FW8A 3ST7A 2NQ8A 2XXBA 3I3OA 4L8VA 1IL0A 2VZ9A 2BGKA 3RSHA 2Q46A 2J3IA 4RVDA 4B4VA 3WBFA 4BKQA 3OH8A 4F45A 3KOUA 1I3LA 3WBBA 4RVUA 3OJEA 5JNLA 4DIFA 1XKQA 1Y6JA 5C7LO 1NHGA 5JO0A 1P45A 3JD4A 2YDXA 2VNAA 4PIVA 1ZH8A 4CM7A 3VH3A 2ZCVA 4P4NA 3TSCA 4NMHA 2QX7A 2X22A 1UXIA 1AN9A 3BA1A 3QWHA 2NU6A 3GFBA 3A14A 3Q11A 2JFGA 2NQTA 5ILGA 1XYGA 2QHXA 3GAZA 1R0SA 1ZZEA 3KYDA 4W99A 5KVCA 3K5PA 4GX0A 1IYZA 2IE0A 1GDHA 5TSDA 2DBQA 4R68A 3H8VA 5KWEA 3BHIA 3W6ZA 2E82A 3AOGA 4A7PA 1JKFA 3H9JA 2ZQZA 4E4YA 1GR0A 5KVVA 4HXYA 2C07A 1T2AA 3I9MA 1C0PA 3FR7A 1U7TA 2P4QA 4GGPA 2AEFA 4JJIA 3COSA 4I1IA 2Y0EA 3IDSA 4U6SA 4RLHA 4OIMA 1IOLA 4NZ9A 2C7VA 3PLNA 4RDHA 3ZV4A 3VTFA 3AFNA 4NBVA 4YJFA 3D3WA 1T2FA 3QA9A 4AICA 4DA9A 3IC5A 5L4SA 3JD1A 2VCYA 1E92A 3HSKA 3OBBA 4Z0PA 1YOVA 2AQ8A 4XDYA 5T8KC 4D44A 2E49A 1GUFA 4AJNA 5A9SB 1N7GA 1Z75A 1X7HA 3ZU5A 1ADGA 5JCXA 4O1MA 5EQDA 5IDXA 3PHLA 2QZ9A 5KNLA 1EZ4A 1XDWA 3OICA 3JD2A 3HG7A 2PZLA 4GX5A 2ZB7A 4J43A 4EJMA 5HS4A 5JCJD 4GKVA 3RFTA 2D59A 3NJ4A 3IJPA 3DZIA 3L6OO 3PJFA 5BR7A 5JCJA 4R01A 3DBHB 2DBVO 1NFQA 4MVJI 2YW9A 3ZWWA 3V1YA 1P31A 1PZGA 3IMFA 3VPXA 1A71A 3H3FA 3QVWA 1HF3A 4E6PA 4FB5A 3OIFA 1UDCA 2P2SA 5KVSA 3H9EO 4YCAA 3JQ8B 1N2SA 3GEDA 2DBZA 2AW5A 4MKZA 4BKPA 2OOSA 4HY3A 3ROMA 1JKIA 3U09A 1P1KA 2PKRA 3E9QA 1T25A 1MV8A 2GLXA 3IQDB 5F5LA 4ZVVA 3VDRA 4BO7A 4JBGA 2B4TO 4ND3A 3WFJA 4QECA 1DLIA 3ICPA 5I7FA 2GUGA 3PWSA 4TVBA 4WGGA 2FZWA 1MB4A 2C0CA 4Z3KA 3H5NA 1C0LA 1K0UA 2OFPA 4UREA 4AFNA 4CM8B 3X2FA 1YH3A 4XQGA 1LRJA 3JQFC 3BMCB 3K9QO 3JQ9A 1GAEO 3Q2IA 1QG6A 4I8XA 4QX6A 2X23A 4QO8A 4TRNA 2CUKA 2NVWA 3CIFA 4JJFA 1G6KA 3DOJA 3JQ7B 5BNIA 2Q2WA 4BNHA 2FWMX 5A9RA 1MFZA 1NTOA 1YDWA 3ZNPA 3WICA 1R0KA 5BSFA 2FR0A 3TZCA 3L9WA 1QR6A 4AJOA 4IXWA 3FNGA 1DLJA 3RBVA 1Y7TA 3O8QB 2CVZA 1GD1O 3QQPA 5DOVA 2WE8A 1NR7A 3QP9A 1W8DA 4OKIA 4AJIA 3AI1A 2YY7A 4Q3AA 3C1OA 4CMEC 3KVOA 4D3SA 4GH5A 5ICSA 4BO9A 2VOJA 2X0RA 1PJSA 4IJUA 1DRUA 1HLDA 2AG8A 4NFYA 4HKTA 4LISA 5DOZA 1HTBA 5KVQA 3A28A 1KYQA 4NU6A 3GUCA 2BI8A 2W2KA 1WXDA 1ZXBA 2WWRA 4G2NA 3OM9A 2GN9A 4JROA 3GZNA 2A4KA 4RV9A 2IXAA 3KBOA 4NNJA 2AXQA 5GY7A 3HDJA 3KYCA 4N5LA 3T7EA 1LEHA 3ZV5A 2QG4A 3HHPA 3GGOA 4Y6PA 5HA5A 3VZSA 4YRBA 2IZ1A 2OZPA 1I3MA 1LLDA 4YT8A 3EMKA 3GG9A 3VOSA 2PZJA 3PYMA 3GVXA 2HMVA 5DULA 5HM8A 4JLWA 4B4UA 1SB9A 2VWPA 3MZ0A 4BNFA 3CXRA 1YL6A 1LLUA 1CETA 3D1LA 3ZHZA 4GX1A 1ZXLA 4GBJA 1E3WB 1P1FA 3W8FA 3HB4X 4PLVA 3ZHXA 4CR6A 3DHYA 4XQ9A 3KEOA 2WD7B 1FDVA 4IGFA 3F1LA 2IZ0A 3RFXA 3DDNA 4YT4A 3PFWO 2NU7A 5KJ6A 1A72A 3FSRA 5L7YA 1DFGA 1BSVA 4WUVA 4KOAA 5TS3A 3VPHA 3DEYX 5CPBA 1XA0A 4B4WA 3SC6A 1JN0A 4F46A 5JMWA 4QXMA 2YV1A 3EW7A 3WGIA 1GU7A 3WIEA 2X1HA 1H6BA 4L4SA 4D46A 4WE3A 3JQAD 1ZSYA 4FFPA 4L9RA 1MXHA 1LQUA 4GSKA 3L4BC 4IIVA 4PZCA 4CM1A 1V3UA 4BGUA 3GMSA 2C59A 4PRLA 4D7AA 2DAPA 3D4OA 1D1TA 4GX2A 1ENYA 2A9FA 3WTCA 4EBFA 1EFKA 4JP2A 4CQLB 2GASA 1LSOA 1WW8A 1U2GA 4I5EA 3UCEA 1UP6A 1NQTA 1PJ2A 1Q1NA 3IUSA 1JAXA 4RF2A 4RPKA 5DNAA 2YFQA 4L4XA 4NG5A 2AA3A 4IQ0A 4OOEA 4Z9FA 2BELA 2UAGA 4WASA 3RVDA 4YAKA 3M2PA 2RIRA 2VHXA 1U4SA 2JFFA 3ASUA 4FQ8A 4KP7A 3FR8A 1E1NA 1SNYA 1SBYA 1R16A 1PSDA 1Z7EA 3E5RA 5EN4A 1BXGB 3HUDA 3JQEA 3ZNOA 5KJFA 1G1AA 2EIHA 2O48X 4L4RA 2EP7A 3GT0A 5DBIA 3GN1A 1YGYA 3PIDA 3RAJA 1IUKA 4PLTA 2NNLD 2YQ4A 1ENZA 3PWKA 1E1LA 4FGSA 9LDTA 1EVIA 1P1HA 1I01A 3ORFA 4PZDA 1VJTA 4XYEA 1CF2O 2X0JA 3NT2A 1UDAA 2G5CA 3IKVA 2HU2A 2ZB3A 3Q9NA 4NFHA 1M76A 3W4JA 4IPTA 1R6DA 3WYBA 4CM5A 3JYOA 1L1FA 1ONNA 3OQ6A 4JN6B 4CM4A 1F17A 3KXDA 1V0JA 4ZU3A 3RIHA 4BO2A 4XB2A 1EQUA 4RF5A 1EDOA 1SPXA 1IY8A 2RHRA 1DBVO 4BV8A 4PG4A 4KQXA 1RKXA 3QHAA 5HRUA 3MJSA 1I2ZA 4QFDA 1V6AA 1GQQA 5G4KB 1BW9A 2X58A 4A73A 1F8FA 2BI7A 4BUCA 4HNGA 2VT3A 3L9XA 4OQYA 1TT5A 3OF2A 4IXTA 4TRJA 2YHIB 5JLAA 1NVMB
chains in the Genus database with same CATH superfamily
2QL9A 3PC7A 2VKTA 3AUYA 5HKKA 4FMPA 3QW4B 4RFSB 4L8YA 3ZY6A 5K8CA 3M34A 4QICA 3V8RA 1C3OB 4F21A 4TTSA 1M1YB 3ZHYA 2C3OA 2R68A 1QP7A 2PFGA 4ZYXA 2F1RA 2WJYA 1AHIA 1QYIA 2CNWD 3TEFA 3CJRA 1E7SA 1RRCA 3VR3D 2RAUA 3MERA 1D6JA 1YBHA 3L6CA 4X6YA 1Q50A 2OB2A 3H4TA 3VR5D 4F6LA 3ELWA 2QNIA 3CLUC 1FUKA 3HKEB 4K03A 3ICEA 3DVRX 1Z4JA 1WNTA 2VQ3A 2P1DA 4NU8X 3HCPA 1H66A 1DUVG 5JY1A 3M5PA 2YOHA 1O0CA 3LPDA 5E2AA 5JZBA 3PQDA 2VNHA 4TSFA 4TYYA 1H23A 1O9BA 1IRIA 2OD9A 3CNLA 2QOEA 4PGGA 4QA9A 5T5QA 1KJ9A 4HYQA 2V1UA 3JQ6A 4FGUA 5HF6A 4RADA 4TV8B 3LX5A 1ECLA 2HEIA 1KI4A 4KV7A 4BRZA 1AMOA 4UOZA 2V7UA 1YR2A 1LTKA 4AQDA 4TYQA 1VRCA 3JQAB 4RA6B 5LOVA 3FY4A 4NI5A 5GONF 4DMHA 3KB8A 1XNHA 1BQ3A 2C4VA 2CUNA 2IXBA 4HXGA 2ZTVA 4DNOA 5BMVB 3OOEA 1YCDA 3E18A 1JR2A 2CB9A 2HHHB 3ZWCA 1LK5A 2YBDA 4OJKA 3L4JA 3DKVA 3SXUB 3IHWA 1DVRA 1Q7GA 4ZHQB 2I33A 3N8GA 1SR8A 5CW2A 1XRSB 2QVCA 1N3LA 1N6LA 4EJSA 2IHZA 4IG4A 1YDGA 3EXHB 1DJNA 2JGNA 2CGEA 4QAJA 4F04A 6GPBA 5IU6A 2WUDA 1RQPA 3GHYA 3ZCTA 2AOUB 4IZIA 3I52A 3T4XA 1J2RA 1U2DA 1OROA 1X86B 1ULSA 3ZE1B 3OOYA 1ISMA 1DFIA 2B5VA 2Y71A 3V97A 3R6WA 4Q1AA 1E79D 1GSOA 4M1OA 1S2MA 4IOKA 1B6SA 2YXDA 4F06A 4AY5A 3VV3A 3OX1A 3C7AA 2GCIA 2ZJYA 4G01B 4OVKA 3DKIA 3H6HA 2WU1A 1I5OA 3U5ZB 3UUWA 1C5KA 1YC5A 5L40A 2CFCA 4KL8S 4MWSA 1WHTB 4TM7A 2Y1OA 5JC8A 4CU2A 5JVDA 5AW9A 5DZSA 2OGSA 2JGKA 10MHA 4QTUB 1S01A 2CL5A 1T2NA 2PY6A 3H2KA 5K4AA 1QTIA 1I1NA 1CIJA 4D0LB 2JAPA 3MUNA 4L78A 1M2GA 1S6YA 2GBIA 3DE0X 1C7EA 1FBTA 1FE8A 1V35A 2QXUA 1L5SA 3T1VA 1QK3A 1EFVA 2G1UA 1FQJA 1THZA 1WMAA 2FUEA 3ANYB 3I01M 2DWCA 1Y8RB 1XXLA 3TZKA 1KBZA 3UCFA 1KPGA 1OC2A 5FADA 5FQOA 1WUYA 2HLPA 3GVHA 4RTSA 1MG0A 3T9FA 3EXHC 4I6EA 2PO5A 1ETHA 8ABPA 2OZKA 4MA4A 4NU5A 4QRDA 1RIFA 1X14A 1KOLA 4RORA 3USZA 5CFRA 5BW6B 5IVDA 4DYDA 4B31A 3IPAA 1I36A 2GVZC 3PG5A 3O9ZA 1Q0UA 5B1EA 2E4YA 1BZYA 4DR2B 1Z6YA 3AM4A 2X5JO 4ENWA 2GARA 4CMGA 4HAIA 3UMGA 4JGGA 5CB4A 3L1VA 3B78A 4PG5A 1OA0A 3KEGA 4CN8A 3TTSA 4UTNA 3PEVA 3NBYC 4O4JA 3AF6A 5EKDA 3GNSA 4FDTA 4IDFA 4L95C 2ZRLA 4O4IA 4Z5XA 5LQDA 3OQMA 1C4WA 1TUEA 5EESA 1QYWA 1NVEA 5HGXA 2GKOA 2OLKA 2OGWA 4MLCA 3BL6A 4MP6A 4LC1A 1G17A 5LMUB 3ZDFA 4MV8A 1NRWA 3LPMA 3TAUA 4OSEA 1YK0A 1YDMA 3UEOA 5L51A 3O8RA 3RJZA 1DG3A 1II8A 1SELA 2BJVA 4Y2VA 2FLWA 3ESDA 4UFPA 2G8NA 4PAWA 2C4MA 1GTMA 2GI4A 5CX4A 5KI6A 3IV6A 3KVYA 4QGHA 3OESA 4AKIA 2PKQP 1E3SA 4L75A 1KOFA 2H1WA 4TMVA 3OJLA 3PP8A 1IXYA 1SZPA 3CIOA 1H2EA 1AGNA 3OX3A 4L4ZA 4KBFA 1E9SA 5J40A 1EEHA 1Z08A 4RF4A 3SX2A 2WNHA 4ND5A 1VZ3A 3RADC 1G5TA 1OU4A 4JKOA 4X8MA 4F4IA 3DHEA 1O9HA 3IBYA 1JH9A 2BGNA 2X8WA 3O75A 4RD3A 3ONEA 3C7TA 1UQTA 3PFKA 3EMBA 4ZU1X 3VNBA 4MWCA 5B3LA 1EX7A 1ZD9A 1QIEA 3PKZA 4PXSA 2FFHA 4JI3B 4YAIA 1XMSA 1MPTA 2G8LA 5M7EA 1QFSA 1ZEMA 2A0XA 4X1OA 2H5JA 2VJOA 4R0MA 1JVNA 2FSUA 3GUYA 1AQYA 2AEEA 1KQPA 2KWIA 1OBHA 5K09A 1OWOA 3K71B 4C04A 5JAZA 1UBKS 2XW6A 2G1KA 4PLCA 4TL7A 5C8YF 1FFCA 2CYBA 3JAKB 1G55A 1R0RE 1A9XB 2Y67A 3LUGA 2OR3A 5TF4A 1U6KA 1UJ6A 4LHEA 4RSGA 2Z43A 1DIBA 3T3MB 5CFQA 2R8YA 3NT5A 1XRNA 4I0WB 5IAKA 5KOYA 1CQJB 2W6QA 3FDZA 3R3UA 4P93A 4D41A 4D97A 3TLGB 1M3SA 3UVEA 3PQ4A 4EW1A 1Z7YA 4ND2A 2DHEA 4G0XA 5CA0B 5JLJA 3DVQX 2XVMA 4MQBA 3V9AA 1E5QA 1T43A 1PT6A 4D79A 1E3LA 1GQYA 1RWMA 3OOSA 4FUTA 2BMEA 2OP1A 2I6FA 4QGFA 4B34A 4RY9A 5CNMA 1OLUA 1XYVA 2YINC 4HNSA 2DSNA 5H68A 4OLBA 2RGGA 2C5AA 2QRMA 3WR5A 1M7GA 3N58A 1VOTA 2OMKA 1BJKA 2A3NA 2H08A 3B3QA 4BUZA 2YXEA 1Y8AA 5DNDA 2OB1A 2YX1A 4JI5B 2VHZA 1RI2A 2JLCA 4IIGA 4O59O 3DAGA 1VIAA 4A2WA 3CHYA 1BWPA 3DWGA 2FA9A 2FVXA 5EL0A 3RYHA 9ABPA 5KNBH 2VTKA 2FFAA 5IXYA 3DTNA 5EKTA 1Z6XA 2RB5A 5E9WA 4E11A 4K5QA 5ALNA 3DL7A 3VNVA 4U5XA 4G5GA 2GEDA 3V48A 3SPXA 2QY6A 3NRBA 1C4XA 2W11A 3SBXA 1QZTA 2JEOA 1JDJA 2X9LA 2ZGVA 4RGQA 3EVFA 1YQUA 2IYAA 1WY5A 1PZEA 1UBUS 1CERA 1LFDB 3H7IA 3PFGA 4O8ZA 2ZCJA 2IF2A 3LRTA 4N1AA 2M1XA 4QLAA 1Z82A 3HP7A 3D2CA 3A2LA 3KPJA 3PVZA 4UCFA 5AW7A 1FSFA 4MLPA 3ED1A 3GVCA 1BH6A 1QS0B 3LU1A 4MYRA 5J43A 3NTUA 3FSGD 4IBOA 1GQRA 3LQFA 5GZ1A 4Y6RA 4O63O 5IX8A 4HPJB 5ILQA 1UEXC 1JQJC 1Z07A 2DPYA 4FLFA 4KWHA 1NZFA 4M54A 5CIQA 3C14C 3QYJA 4XFKA 2XGMA 1T91A 5AUQA 3JWPA 3T3IA 1RZ3A 3UN1A 3ZW8A 2I4RA 1USVA 2V59A 2X6RA 4GPEA 4EHDA 3I6MA 2CXRA 1Z0UA 3A7EA 2DFNA 2M2IA 2HHAA 2P3QA 1SVIA 1XVTA 3OJ0A 3I9JA 1L5YA 1XN4A 2Q6OA 3WGOA 3HGQA 2RH4A 3HU3A 2NZ2A 1JQLB 1KKMA 2YICA 3FGOA 4G1FA 2C8JA 3PC4A 1Y0BA 4P54A 1KJWA 3EZLA 4L08A 4CDNA 3SC2B 3ELBA 1SC4A 1VTKA 1DTSA 1EK1A 5FOUA 4OM8A 5T4HA 3VYTB 3W05A 2QPTA 1AV6A 3AETB 1LS1A 3VI4B 3TSAA 5B1YA 1AZLA 1KJQA 3PLAE 3UAYA 1YCGA 3U3JA 1PYOA 4B7CA 3PTAA 3L93A 3KXIA 5IC4A 4Q4AB 2EEZA 3O2NA 6Q21A 3UJHA 4LJ9A 2QX9A 2R8XA 3HNPA 2HA4A 5BWCA 1IVYA 3FI9A 2V6BA 3C16C 5L7WA 4ZXPA 2QQ0A 1U8CB 3IHLA 3KAPA 2IXTA 2X5OA 3ETLA 1T3TA 3UT6A 2H31A 3FNBA 5TRTA 1Y5RA 3LFUA 2ZR8A 1UMKA 3QJGA 4HFRA 4R5MA 1QF6A 2HPVA 3C6KA 1GDDA 1KMNA 1WPQA 2C1ZA 3W5SA 4W7HA 5JH7B 5FA6A 2ZIXB 1I7NA 2V6MA 3NHYA 2GRAA 3BMXA 3I9V1 4DOMA 4GL2A 1GGKA 4EO9A 3QEMB 5AD1A 4J2OA 4MWZA 4X24A 3EDOA 4L4UA 3EJ6A 3GAMA 4A1FA 4BQSA 1OFUA 1SKBA 4PPNA 4BXOB 4LJ4A 3F7OA 2PD4A 4YBRA 3E4CA 2WSBA 3V34A 3W9SA 4B46A 3T15A 4DMGA 3PJRA 1ADCA 1WDLA 1MF7A 3CN7A 1R0LA 2PRIA 3RCBA 1Y4AE 1VI5A 3RI3A 3VKHA 5ER6A 3A05A 3ANMA 4I9NA 4EECA 1XF1A 4UTOA 1RTTA 3PC3A 1T2UA 4ZZIA 1E8DA 4BVHA 3T1HB 1B1AA 2AIRA 1QYRA 2GBFA 1LX7A 3LQ1A 3PGVA 4IEEA 3LKDA 4XX1A 2ETVA 4PSVA 4QNMA 3U49A 3F6EX 2RBKA 1WEHA 3GGGA 4ZOLB 3B1FA 4XOUA 2YL2A 3ER8A 4UMFA 4QOGA 4ZDWA 3GP3A 3AR7A 1RVDA 1ODIA 3H2SA 1QGOA 3EIUA 1DKMA 1LSSA 2XF2A 3FPKA 3PQ8A 1WM1A 5EPEA 5T3UA 1E3WA 1S7CA 2ZRMA 4RO0A 4WAUA 3GN2A 2NT3A 3HCOA 2C84A 2EKQA 1YKSA 2VO1A 1B0PA 1CSEE 4EZBA 5I8ZA 2XNKA 3G23A 1DC4A 2C97A 6REQA 1BN6A 1GPYA 2H2AA 4DQKA 4YHHB 4KVGA 3ZHRA 3I01A 4QT4A 3IMEA 1WVIA 4WK4B 2HHLA 1W35A 2IT1A 1HKUA 2P11A 1PV1A 2X8JB 5LYYA 1VDMA 4F6RB 5GPBA 3F8TA 1WIWA 3L7IA 5MGNA 3OLXA 4R54A 2OCAA 4J0KA 2YJGA 4PC2A 2YRFA 3DAOA 4NNPA 1Y9EA 2YMLA 3ZY4A 1CRWG 2Q3FA 2G9ZA 1GV0A 2LVBA 4DLBA 5KPDA 2G17A 1SUBA 3TTYA 2QUAA 1XF9A 3MM4A 1N2HA 3OFND 3C7DB 2GJKA 2IHYA 2RIPA 2HQ1A 1T5SA 3B9RA 2JGLA 3UQZA 3H8JA 1UPAA 4Q1VA 4UTPA 1K8QA 5K0ZA 2G5TA 5FFNA 3FTFA 1TCAA 1QVVA 1AHNA 1M8GA 1N75A 4UOQA 1AKNA 2FE4A 4P8RA 4TTIA 5U4QA 3ROFA 3GFOA 2FSHA 1PBNA 2IA5A 2X9NA 1VHQA 5BV1A 2XUJA 2G09A 4KUGA 3WZMA 5EA2A 1F0NA 2ESRA 1MHPA 4B6QA 3AR4A 3P4UA 3KQMA 4R1UA 2HXGA 1NXQA 3VYWA 3WWYA 3DULA 3QNWA 5KYYA 1DQNA 3CX8A 3GXBA 1BWRA 4AUKA 1RXCA 1G8YA 2F1JA 1P60A 5JS2A 3ZS8A 3IKTA 3N74A 1S3FA 1N2BA 1RWBA 2J09A 4PFQA 3OG9A 3IP5A 3CSDA 4HZUA 2P6NA 3QMWA 4ONEA 1EFPB 1ORWA 4C0JA 1QRTA 2OWDA 3OZ7A 3PE6A 3FN4A 4ZPXA 5A02A 5IKXA 4NOJA 1NXXA 2AQKA 2VSXA 3W3AA 3L79A 4J7AA 4ZREA 1T8UA 1JG3A 4ES6A 2NSJA 4XARA 2QRVB 3UFXB 2FW8A 3PR3A 3FDFA 1FK8A 2HREA 5IAJA 3D1JA 1J8VA 2IX3A 1J2TA 1KE1A 2G1JA 2XUQA 3ADPA 3CW2A 3KWLA 3BILA 3Q3GE 1V25A 4CLEA 1MAWA 1HDCA 1Y1KE 3KZOA 1I3OA 1T0BA 2B4RO 3ZU4A 3KDSE 4XKJA 4BFUA 1SUCA 2G67A 4CIXA 4YAUA 4YV2A 5KB3A 1YJAA 2BZGA 2FJPA 1Z4PX 2QTWB 1SIWA 2YQ5A 1Y6FA 2RGCA 2Q4EA 2P4SA 4AN4A 2WAAA 4NC9A 2FN7A 1ZESA 4H77A 2NNWB 3IJRA 4TLEA 4TKVA 2WWFA 4E03A 3LOPA 4BRSA 5SYNA 5BYKA 5H82A 1OZFA 1R74A 2JI4A 3QX9A 4MR9B 4Q01A 4G25A 3G17A 1Z5OA 4MCAA 4QNNA 3KJFA 4DUGA 3P5SA 2TYSB 4WNCA 5FNVB 2JJQA 3V7WA 3TOVA 4B3TB 3B9QA 1BCSA 2QI9C 3HXPA 1Z74A 3K5HA 5LYJB 1TT7A 4WOPA 1QYXA 3CM0A 3CT6A 2Q1YA 3LBYA 4UMDA 2AD1A 4O3MA 1RAAA 3BVPA 1NP7A 3E15A 5FPTA 4Q3BA 3QUAA 2OXTA 4HLUC 2XZDA 4EI2A 4AZWA 2J9FA 1PN3A 2YHIA 2QLLA 4YUWA 4K6KA 5C5DA 4P0QB 3S68A 1AUQA 4J2HA 4E6EA 2AXNA 5KQGA 3S5JA 4HDSA 2IEAA 4IF4A 3D02A 3ECSA 2H1OA 4YJFB 2BEUB 2O4CA 3STXA 2R751 2REOA 3D6FA 1NX6A 2BKUA 3U39A 1VKJA 1J97A 3PJGA 2O8BB 3K8OE 3ND8A 2OO5C 2ZR0A 4HDCA 1J00A 3FTPA 1MO5A 3QOWA 2IYRA 3PHGA 4INOA 1BXRA 4QRHA 4UZSA 1GUBA 3DCNA 5HKAA 1SO8A 2ZYAA 3WI7A 2GM3A 1L1QA 3GGJA 4D3YA 4EPRA 3AILA 3LKBA 1IZ9A 2XMPA 1DKRA 3ZE2B 1UR5A 2B5WA 4JKIA 3T7IA 1ZMRA 3H0EA 3LOUA 1TU0A 4EKGA 4PCLA 3LXUX 2AEMA 3A6PC 3B1XA 3LY7A 4IMRA 2PIAA 3ZWBA 3MOSA 4FFVA 4LYAA 1H6AA 2C9DA 2IHJA 3W5HA 1GAXA 3K6KA 4E7OA 4XJVA 4JI7B 3VAZA 1XFDA 4E5UA 3MWFA 2ZE8A 3W2GA 1X9GA 3E8MA 5TT0A 1JQKA 2WWXA 5BR1A 3ICQB 1JIIA 3T6KA 4LDQA 4FYHA 2ZUUA 4FJ2A 2O8FB 4M98A 1WSBA 1E1MA 1KEWA 2ID9A 1K2WA 4A3SA 3HB1A 3HCFA 2WT4A 3HPRA 4LCEA 3R7WB 1EFRD 4Z4FA 2I7DA 2UV8A 1KI2A 4EL0A 4LDZA 3W06A 2JW5A 4JBHA 3W9UA 3ZDEA 2UKDA 4JODA 5KQMA 1HT2E 2V0NA 1U9CA 4IDPA 3VR6H 1JI0A 2C5GA 1HE3A 2ATXA 5G2OA 4KFCA 4CMKA 1USIA 2I4LA 3KM0A 5AKJA 6ABPA 1RMQA 6CHYA 1YKFA 3PRJA 1J33A 1R8JA 2DQ4A 2GM5A 1J09A 1J56A 2REBA 2ZSFA 1CQXA 3MMXA 1WWKA 3PDHA 4MWTA 4N3CA 2PLWA 1YQQA 5HE8A 3GFTA 3S3TA 1TDJA 3WNQA 4EJ0A 3MK31 4EO7A 5JDCC 1O4WA 2OFFA 3LFHA 5EIOA 2P30A 1YC2A 4Q0MA 2IYFA 4ID9A 3JU3A 5FTNA 2AMLA 1OH8A 1NMEA 1JHDA 3JQBC 1GLNA 3FOWA 4UUBA 1ZU4A 2EFHB 1V39A 1XDDA 4CUZA 2N0SA 4CQJA 4E4RA 4LF9B 3B85A 5IZCC 4O2BA 3KJHA 4JCOA 4JBXA 4U1RA 1Y3AA 2GPAA 1WF6A 2VLIA 3JRNA 1FTWA 4GZMA 3OC0A 4LXXA 3LHKA 1QQTA 4W5WA 1G8KA 3T34A 2CDRA 3AUXA 5BQOA 2R84A 3WHLA 1U6IA 4P7GA 2XB9A 2XKAA 3EHEA 3UJ3X 3ZY3A 3FGNA 3B6MA 2EHJA 2ZE7A 3VU9A 4E33A 1DELA 3OURA 4QTZA 3GRRA 2CL6X 3ZCSA 4IIEA 5GQSA 1U2RA 1RZRD 4F86A 4N03A 1O5IA 4JVLA 4EF5A 3IAM1 3UTDA 1DWOA 3N2IA 4NAVA 4UQOA 4W9MC 4M6WA 4TVKA 1KU6A 1Q1AA 1E3MA 1UK8A 2OQ2A 2Q3LA 2AUNA 3CWZA 2FMUA 4I5DA 4K7JA 5BYAA 1J39A 1F7UA 2YXPX 2HIAA 5ENDA 1ONBA 4ABTA 4OA8A 2W4MA 3T3HA 4Q12A 5JS6A 3U9SA 4AX8A 1PP4A 4ERXA 1E2MA 3PC2A 4BYMA 3IJ5A 5KWVA 2CF5A 2OKCA 1BKDR 4M9QA 1B3BA 1JHXA 2HXSA 1NWCA 2Z0MA 4J16A 4K6FA 5EY5B 4BZZA 5LLDA 5LP6F 1NOIA 2ID8A 1HQCA 1E9VA 5G41A 1A5ZA 2GD1O 2ZIVB 1VRWA 1LV8A 4R1SA 1K9VF 2YHSA 4C4YA 3WSVA 3MRVA 2CNLA 3E4DA 2HU5A 3BZBA 2W90A 3ENWA 4WACA 4D6PA 5JJIA 2WIJA 4J76A 1ZGCA 2YWDA 2A33A 3CCBA 4K40A 1ZYUA 1TTTA 3ELUA 3JCZA 2EARA 4FLEA 1M83A 4NMWA 1JVSA 3REQB 4D3ZA 5HUHA 3D54D 2JKYA 3ZLTA 4AO7A 3TINA 2DH6A 2YNMA 5EJEA 1A27A 7ABPA 1O2DA 5E6SB 3P97A 5JTUA 3I04M 5FEMA 1ODCA 4Q37A 2BMJA 2G0AA 1CDDA 4JLMA 4DA4A 5F5XA 3ICCA 4ENPA 2X0NA 4K1LA 2OHHA 3GG2A 1GOTA 3SVLA 3N8NA 2KLBA 5CBPB 3GFQA 4TVOA 3VR3A 4M9SA 4YR9A 4DNXA 3VR5A 3EQ7A 4AAYA 3Q0EA 4YI5A 5ADWA 1TIBA 3D4LA 3RSZA 4YFVA 3X1JA 4TZKA 1GZDA 1DB3A 1MT3A 2GPYA 5AI4A 3G5LA 4DG5A 5I4BA 1L8XA 1RCTE 3GEPA 3HWWA 1SKMA 3BE6A 1JMYA 1VB3A 3EGDB 3K30A 5I9MA 2FRVA 1SUWA 5FWDA 4RMGA 2DT5A 1HZZC 3TLZA 3UICA 5J2TB 2AN5A 3UXMA 5A71A 2KM1A 1PI3A 3H86A 2EKBA 2J0UB 4IRUB 4NBTA 4NENA 1KNQA 2QRLA 4FC6A 3W79A 2B6HA 4JX8A 3ZE8A 1TOAA 3GARA 3Q40A 5CH5A 4IP0A 2II6A 5TMDA 1V95A 2CVOA 2F67A 5JS1A 1T6XA 5M5BA 4YAOA 1NN0A 3DP7A 5DYNA 2XWSA 2Z2KA 2C3UA 2VUSA 3DMRA 2NOAA 1YI1A 4JEMA 1ODLA 2Q07A 1N2CA 4DCUA 5IG2A 2GN6A 2PKCA 2PUAA 3EEFA 1N2OA 5T41A 1IJFA 1KRXA 3BQNB 3ZHVA 4TKUB 5CAEA 3A9TA 5C51B 5AR1A 2X9GA 4HSGA 2E89A 2A1IA 4LY0A 1C7FA 4I9HA 1WVMA 2UUPA 3ABSB 1E77A 3OQPA 4H6WA 4OXXA 3R75A 3QLUC 5J4YA 3E6AA 4NJMB 1Z36A 2QN1A 3R3JA 1GGFA 3THXA 1F9EA 2B36A 3E05A 4IEFB 4D9EA 2JLXA 1E79A 5CG1A 4XFDA 5FR2A 3AF4A 4PHGA 4WNIA 1PJRA 1ZJ4A 3H8WA 3R1IA 4MIKA 2EV9A 1GGMA 2CBGA 2ZI4A 1Z9BA 2ZWAA 2W2LD 1CVIA 1GZHB 2GBLA 1Z8HA 1NLYA 3GGPA 3I64A 4L57A 2FHSA 4ENTA 5JIBA 1IWOA 3OQIA 5E9JA 2G7ZA 3ZK9A 2CV0A 3DBRA 1NBMD 4W7IA 2VYVD 5TPWA 4YQYA 2XUZA 3WGZA 1PEAA 2DSTA 2WZQA 3SXJA 4DSAA 4GZ3A 1I7LA 1PR4A 1ULZA 2QT0A 1PNQA 1T0JB 2SECE 1H22A 3F90A 1FRFS 3D6HA 1FTGA 4PGFA 5IC6A 4G0WA 2VNSA 2VK1A 3DT8A 4LSWA 5FBZA 2FQ1A 1X13A 4N5MA 4CZ2A 1HY3A 2ZYDA 3MGKA 3MPUA 1O95D 5E1DA 5FCDA 4EUHA 2NACA 1ESZA 3SY8A 3OLCX 4I46A 5AK3A 1UT8A 3IBCA 4DLLA 2IP4A 1IG0A 5GAJA 1PZMA 2R00A 4IIXA 1CRQA 1DJQA 1FMCA 2B1GA 4TN1A 3U44A 4HI0E 1SCKA 4JMPA 5CX1B 3ZOZA 3FOZA 1J1UA 2D62A 1IEXA 5C5IA 4F5DA 2VZLA 2QAGB 4ZALA 3LBIA 5ADVA 4WOJA 5C0OE 1U28C 4IIDA 5FWYA 2X8LA 2HSWA 1L7DA 5B6PA 4LIPD 4AKGA 5J2UA 1XPUA 4RKEA 4CI0B 1GITA 1TM7E 3BD8A 4LEIA 5ES4B 5GTDA 2EJVA 1CR1A 1JA9A 4XWWA 4PZEA 1KZ4A 3UOWA 1ECCA 3G13A 1VHTA 3IQXA 5AHXA 3UK1A 2IZ5A 4L2IA 4E07A 3NU1A 1N33B 3NETA 1E9RA 1RHMA 4I6GA 1BWQA 2LTAA 4H2DA 1YRQA 4OK6A 2FG6C 2H3HA 2F8SA 2CKMA 4OQPA 1MT0A 2JIBA 3SSOA 1HNXB 5JG7A 4Q4HB 4NKRA 4GLBA 3UENA 3GUZA 3S99A 4R2LA 3WRWA 3C97A 4WXEA 3ZWVA 1T9DA 3DEAA 3LT2A 1Z22A 1YVUA 3VO9A 2FX5A 1WCV1 3A6LA 3MAJA 4PR0A 1OX6A 1V1JA 2ZT8A 2RJNA 3GD5A 3HN2A 4RPLA 3O2QB 1QP8A 2NUAA 2HSJA 2PGIA 3OEED 2WFAA 1OUMA 3P2KA 3HEAA 3PD7A 4ASUA 4DMMA 4G81A 3ZDCA 4JJ7A 2FPPA 4QBHA 1XA3A 3DFUA 3H42B 2DTDA 2RKBA 4LV5B 1OF1A 5BN5A 2KW5A 2IOYA 1NPDA 4HJRA 2F1IA 2OCYC 3R7DA 2J1LA 3RRJA 1OGYA 1T1JA 3ZJTA 3PQ7A 1BDJA 3QI7A 2NXEA 3FLMA 4K6CA 3TZLA 4E2WA 5AIAA 5L95A 2WWIA 2EJTA 2QAGC 4L5BA 5JALA 2CLSA 2O23A 4A8TA 3AEUA 1K06A 1G9TA 3QLEA 1GNTA 5EJ7A 3CZQA 4NAHA 3SGLA 5KPJA 2VP4A 5HYVA 1NJFA 4RK4A 3O94A 3ZHOA 3VFDA 4W7SA 2R47A 3A4MA 3LXRA 5D00A 1P2DA 5DHTA 1C3EA 5DN6D 3X2EA 1U6JA 3MGCA 2R4UA 3CISA 3HA2A 2C5SA 2EZ9A 4Q34A 2ETXA 2C5LA 4G0PA 1JFLA 5MN6A 4NX2A 4A6XA 3DPSA 5LDDC 1X80A 2C04A 2GAAA 2IGTA 1WCIB 2XQJA 3H2BA 3KQSA 1ISIA 1FDTA 2DUWA 4LK3A 4XGIA 1CVLA 1EIWA 4AJ4A 4M22A 3DW1X 2H00A 1CG6A 2Z83A 3WMRA 3ZXUB 3MWDB 1P74A 1QB7A 1ZW1A 4I55A 4R8LA 3WNZA 1F2UA 2HLHA 2X0DA 2HAEA 2X3YA 2HRQA 1S8AA 2JASA 2YN2A 4MYTA 3AM5A 4XDZA 3SXPA 1EM8A 1TTPB 2C31A 3SYMA 4UHHA 1BOOA 2ODTX 3AFMA 4QYTA 1GV1A 4R2XA 5TQ0A 1FUEA 3G2PA 5K2OA 1Q11A 3I5XA 3PNQA 2G36A 1FVXA 3C48A 1S2IA 1UKEA 4OXQA 4RMIA 4R7TA 1TCCA 3W5VA 5F1YA 1HOTA 3SEAA 3UAWA 4G0VA 4IJ5A 2LIVA 4F1WA 4RSHA 2FCRA 1XTVA 5CITA 1HE1C 2J5KA 2P41A 3OMLA 2O8FA 4MS4B 4Q9KA 5BQ5A 5BN4A 1EWVA 2HA6A 2C0QA 5AW8A 1QGYA 1UPXA 2HA5A 3N2EA 2B2XA 4FNOA 3RM3A 4NYMQ 5B12A 3JQCA 1G291 2EC5A 4HCJA 4O4HA 1EJ0A 4K28A 3BWBA 3WXMA 2XNCA 2MU1A 5JZMA 2IVFA 1HBJA 2QJOA 2GPSA 3HXTA 1EX1A 4P34A 3CUEF 1I2BA 2OV6A 1NY6A 1GXSB 2AOXA 2YV4A 4ZCLA 4BVFA 4HGQA 5TVGA 2R4TA 5B4VA 2XIQA 5D6OA 5JVDB 5I4KA 4EMUA 3DZBA 2WTMA 3NNDA 1U9IC 1ZK4A 1M2WA 3DZGA 3IQIX 2IOHA 5CVJA 3MW8A 4UU0A 5A4MS 1CJSA 1W30A 4OP2A 4ZQEA 1YOBA 3E9NA 4O25A 3J81A 2HOQA 3LF2A 2ZJ1A 3QEKA 4O5AA 5DHPA 5EJ2A 5GVRA 2OBBA 3SIRA 4EYSA 4WBNA 5CFNA 1VSVA 1L7BA 4NZNA 1EFVB 2IS6A 2HXYA 1NU8A 5FPPA 1XJCA 3IUMA 4GVPA 3AI7A 4I7EA 4MUGA 1H05A 4OXNA 2PWZA 1ZW6A 4HDQB 4WLNA 3PLRA 4F2DA 5CCBA 1VCMA 4NXNB 1MW8X 4N6GA 3M6WA 4OBEA 3S2EA 4M1SA 1I1HA 3OA0A 1C7QA 1G8JA 1SKUA 2QTBA 4KH1A 4QDOA 3WIOA 4TQUS 2R6DA 5A04A 1XKXA 4XLTA 1X7DA 1F5SA 2QRGA 3DMDA 3FTNA 2CMDA 1ZZGA 2NO7A 3G8DA 2O2YA 4WKBA 1GT6A 2BTQB 3KS9A 3OQVA 3L6RA 4JITA 1FZTA 5LL6P 5J4LA 4X00A 4EJ6A 1CF9A 4G1EB 2ON6A 3RT9A 4C29A 4NQRA 3B82A 3FSGA 4N0DA 3ZWNA 4DM4A 3M5DA 4CNQA 5EHGA 4BLPA 4PAGA 4QUJA 2PL9A 1N6OA 4UZFA 3LXXA 2AFHB 3NX4A 4PYNA 2KMLA 2PMDA 4H7KA 5HP4A 1PWYE 5CYGA 1AX9A 3HGMA 2QN7A 1FUUA 2TMDA 2HLDD 1KSJA 5I7SA 4GWLA 1BD3A 1K5DA 3ZWXA 1E59A 1GRNA 2MSCB 3AERB 1MQAA 1R12A 3HKCB 5MGBA 2R6CA 3RRXA 5JFOA 4IJVA 4RCVA 1NUQA 4H08A 4RM2A 5KTOA 2JG3A 3FMOB 3X1KA 1R6AA 8GPBA 4GPZA 1IJEA 1WD7A 3WG9A 5CFZA 5IDWA 2BHLA 4C08A 2GHQA 3S5UA 4UU1A 3CRVA 3FYUC 2H9YA 3QXJA 2E4VA 2G4LA 3V8MA 5I47A 4GLJA 4KQGA 1BJTA 3BM5A 2JZNA 5T4BA 1G7TA 2OECA 3N3AC 4OOFA 1L9XA 4BE9A 2FGJA 4RK7A 5IM4A 3GD7A 1RYHA 1P4RA 4A0SA 1GPAA 1SRQA 4MVCA 1KVRA 4XCVA 3UC9A 3A1EA 2WKSA 2YZ7A 3P2JA 4M0CA 5DLPA 3V8BA 1GPKA 4YROA 1CRPA 2VAMA 1T3ZA 2XCOA 3Q15C 4Z1MD 3VH1A 4H7IA 2VWQA 3NKFA 3GEEA 4KQIA 1N4AA 3LYUA 4BN0A 1U0EA 2XKKA 2NO4A 2P9EA 2R11A 3TNLA 3M4JA 5KHLB 1O96B 3FCOA 4DXDA 1O3YA 1HQKA 1YBVA 1I2MA 2CMHA 3EEYA 2AL7A 3AUSA 4FFNA 4N82A 4N54A 4NCIA 4ZO4A 5HILA 1Q7EA 3CNQS 4GQIA 1YRLA 2QL7A 3L0SA 1QE3A 4M87A 3VSCA 1W36B 3IDFA 3QNUA 4JC5A 2FSFA 3ZDZB 3QUCA 3SHFA 1LI7A 2EQBA 3ZKWB 4FX2A 3LF1A 4HATA 3LQQA 4ZV4A 4NMLA 1NL3A 4MLDA 1BYIA 1GRCA 3AZQA 1L8QA 3LQ4A 2PH7A 4YDHB 4Z4CA 1QIFA 1E2PA 1ZGHA 3X43A 5LQRA 5JS8A 3QBEA 4I5IA 5EWMA 2Y1FA 5JU6A 5BPFA 3C5VA 1AKQA 4YP9A 4A4DA 4M60A 5EG5A 2C1XA 3FKJA 2ZAIA 3ILHA 3TRJA 1NATA 2ISQA 1RBZA 3G49A 4YV0A 5E9QA 2GFIA 3S29A 2KB0A 1ATIA 2OBXA 4DV7B 3FNRA 2V97A 2OL4A 2YVKA 1KY2A 2E4ZA 4Z4GA 2E4AA 4UXHA 5C1DA 4OG2A 2VHQA 2Z2IA 2ZAOA 3FPLA 3GJ0A 3KD2A 3KSZO 1NMQA 1QKIA 1E99A 2Q1XA 2XWBF 1JHMA 3R5FA 1PW5A 1W4CA 3HCDA 5GONA 1C9YA 4PCAA 3V4RA 5IT9A 3AIMA 1Z5PA 4WA7A 4X62B 2F9LA 3IRVA 4WXHA 4EMBA 2RGAA 2CD7A 2PBRA 4X54A 1NF3A 1E7QA 2J5RA 1W36C 4HAZA 1OFVA 4L5CA 4ZVKA 5C4IA 4QWWA 1YZFA 1EWYA 2F9FA 4HWGA 4DIUA 2Z2XA 5AKLA 1KS2A 4FGZA 2R79A 4QUBA 1ZJJA 1XNGA 1KVQA 4IINA 1CJMA 4P3PA 1Q0RA 4DQUA 1XMVA 5C3MA 3QV1A 3AUUA 1Q1ZA 3OFNA 4KVFA 1ZFNA 2GD6A 5U9CA 4MV5A 1DNPA 2VPYA 2G76A 3RVRA 2CDNA 4UXIA 4V38A 4G0UA 1K6MA 3PR2B 5F5NA 4A2QA 5EXEA 1EFDN 2POCA 1NRXA 1OW3B 5B64A 5L7TA 4KE8A 4RWZA 2QLJA 4FHFA 2W8BA 4QGBA 4XR4A 2D2XA 4R6XA 1PG0A 2QD3A 4XRRA 3K0FB 3N59A 4MR8B 2PCJA 3R3YA 4HV4A 1M10A 4ETIA 3MJ4A 1WG8A 4H27A 1ZSNA 3IYLW 1E5DA 1ZX1A 2I7CA 1X7YB 2HFKA 3B51X 1Q21A 4PSCA 4AS1A 2AFIE 2PV0A 2ZM6B 1U0TA 3LGSA 1T36A 3JWHA 5KREA 1YACA 1QGUB 3L6DA 4XASA 2RI6A 3LK6A 1PTJC 5T57A 3ZHQA 2B5OA 4FFDA 2NO1A 5TQ2A 4FOLA 2DMRA 1IE3A 4LV8B 3R76A 3I61A 1EAMA 4J0GA 1ZICA 4YCJA 2QVXX 4PLZA 4B6OA 1AB5A 2QTRA 2R0QC 5FT9A 4WTOA 3A27A 2QTGA 2YZ2A 5ESXA 1WUJS 2HU7A 5PNTA 2V7BA 3AXSA 1JJFA 1E63A 1M2OA 1PZHA 2I2BA 2ZRNA 3KYIB 4RTQA 4HN4B 3SVTA 1AKTA 3D31A 1GCUA 1KOJA 2RB4A 4A2CA 4UJ5A 4KQFA 3PVSA 4BX8A 2O5CA 3VYVA 4CTOA 2CN1A 5EQFA 1RPZA 1H9BA 2VS1A 3HHEA 4AUEA 1LPNA 1WMFA 3Q5EA 4E70A 1VPWA 3GWGA 3EG9A 2Q0SA 2AKAB 3DZ8A 3I09A 2C2XA 5JARA 2D2VA 4QXPA 1T24A 3DV0A 5JAOA 3LT1A 1ORHA 1W44A 1G6HA 1RJ9A 2M98A 1G42A 3EA5A 4JZYA 5EUQB 4MP3A 5K0CA 3E27A 3UG7A 3NBAA 3M82A 5LBUA 1MV5A 1NQXA 2FVYA 2JC3A 1XZGA 3N9IA 4XQCA 3DLBA 1ILWA 1E2FA 4RAOA 4MRPA 4TRRA 2BE7A 4RH0A 3SZRA 3LSYA 1I1QB 1T6ZA 2INGX 4BO1A 5JC1A 1LVHA 1F2TB 1HURA 2PKYX 4FCVA 3TLEA 3QKIA 4ZQIA 1F8UA 2GO7A 3C3DA 3WBKA 5IZ4A 1ZUD1 2OAP1 2CXQA 3U7IA 2JFUA 1V3TA 4EKNB 1WMDA 4V0QA 4LGYA 2QW8A 1RSZA 1FU7A 1V71A 5KNCA 4TYPA 4OKNA 3HACA 1T8YA 2O8DA 1L4YA 3ZE6A 3OQNA 5DHQA 1PL0A 1SRRA 2W00A 5FQNA 1JEQA 1RT9A 2QK4A 2QWXA 3D3WB 3L8EA 4RSRA 3DGEC 3U2QA 4DTIA 1XU7A 4Z7NB 4K9PA 4ZJYA 1VMIA 1LU9A 2EW1A 1D1QA 3VX3A 1KU0A 1U02A 3TNJA 3RJ9A 3MC1A 4BLTA 2BFNA 3BRSA 5TY0A 5CT9A 1ADYA 4LYYA 2QRZA 3IDQA 3NBZC 4JUDX 4ND6A 2MCFA 3V9PA 1N7HA 4FS8A 1CEYA 3RLIA 1D5WA 2O7VA 1U9ZA 4UMVA 1BDIA 4URWR 2I6GA 1YB4A 1RKUA 3B1VA 4IOLA 1WDTA 3C8ZA 4M86A 4QPCA 3WNBA 3AIKA 3ZXSA 1VHLA 2I8AA 4AY4A 1VPVA 3IBSA 2FK7A 1QQ7A 3AEYA 1AG9A 4KDCA 5I4IA 3OIVA 4D4HA 1YKGA 2G82A 2JI6A 3CBGA 3CX4A 3EVAA 3LRXA 4NBUA 4JUBA 5BOSA 3CV3A 1QVWA 3DD5A 1P19A 1AY0A 1EZZA 4KE9A 2C7QA 4URZR 1RBQA 2R4QA 4BU1A 4ZMSA 3A1UA 4G9BA 1IATA 2VK4A 4NY1A 1N78A 3I5UA 4LDNA 5K3FA 1RVV1 3ZVMA 1FQWA 2JKZA 4K3VA 3JWIA 5DK6A 2BSAA 4L76A 3HO8A 3JYLA 4M8KA 3OQBA 3UUFA 3SR4A 3R5HA 1EH5A 4WLFA 2ISSD 1JHPA 1YS9A 2E7ZA 2JGJA 3BMOA 3DOEA 4OQMA 1NSYA 3I12A 1CE8A 4YMUA 1EFRA 2BGIA 1M34A 3T12A 3ETEA 4MIOA 3AZPA 1DXHA 3RJTA 1P44A 5FPKA 1KYYA 1LPPA 2W6ID 3BGWA 2ZIWB 1ESDA 1GQOA 2PFSA 5DCLA 3VJMA 2GSDA 4JXXA 2W2XA 4ZRMA 1GSAA 1MIOB 5HF5A 3DL2A 2O0KA 2I99A 2P67A 3RVOA 3ZE7A 1UC9A 3LBAA 3W6NA 3F67A 2D7CA 4WY5A 5D7BA 4BECA 3WLRA 2NO0A 1SQFA 3GLHE 3DAHA 4G9EA 5EXDA 3GAFA 3U26A 1EUCA 4II3A 5A3VA 1IM5A 4PE5B 1JKJA 3SK0A 1VE3A 2Q0XA 4AF6A 5KKNB 2JH8A 1QCDA 2I55A 3U7FB 1DIHA 1TU4A 3GYBA 1JLHA 4RDCA 4YQZA 4UM9B 1T34A 3W6PA 5TIIA 2W6ZA 2H4ZA 3U4GA 1SOVA 2L2QA 4DPKA 3C8MA