3RUEA

Alternative analogs as viable substrates of udp-hexose 4-epimerases
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternative analogs as viable substrates of UDP-hexose 4-epimerases
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
molecule keywords WbgU
total genus 122
structure length 336
sequence length 341
chains with identical sequence B, S, b
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rueA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3rueA02
2FSSA 4I5FA 4U0KA 5JY1A 2GN6A 2P9GA 4PG6A 4E3ZA 4J1NA 2C07A 4CM1A 3ZH2A 1KEPA 4E2YA 3ADPA 2VWGA 4QSMA 1ZXBA 1YL6A 3EVTA 4E31A 1MB4A 1K3TA 4RVHA 4OKNA 3QWIA 4LVCA 1M6HA 3UGKA 2Q1WA 5JO9A 3K6JA 3DBHA 2RBEA 4W4TA 4ZQFA 3OA2A 3FPLA 3DEYX 3O4RA 1W73A 1M2WA 4E0BA 5L7TA 2AEJA 3GNTA 4MIEA 3W6ZA 1C14A 3H3JA 4IS2A 3OM9A 1VM6A 3F4BA 2GDZA 4Z0TA 4INAA 4R9RA 1V0JA 5BNTA 3RFTA 3H5RA 2HMUA 1RM4A 2NNLD 3STHA 4IQGA 2FR0A 2J5QA 3DBRB 4N5NA 4JP2A 3H9JA 3WQRA 4EGFA 1G1AA 4TROA 3VKUA 1VL6A 5CDTA 2UYYA 5HTOA 2BF7A 1EUZA 2CNBA 3F1KA 3ENNA 1GQQA 4TRMA 4MKZA 3G0OA 4CLEA 2YY7A 1B8VA 4CQMA 3L0DA 2YDYA 1WAMA 3NTQA 1ZEMA 4OHUA 4TSKA 4NZ9A 4YT4A 1R0LA 5CDSA 3P2YA 1Z82A 4NNJA 1GCOA 3KV3O 4CV2A 3DHYA 1Q0HA 3RIHA 1TB4A 2CD9A 2EKLA 3UXYA 1KS9A 4MKRA 1V6AA 3QE3A 3NT2A 3INGA 2JD2A 1U7HA 4ID9A 3VPGA 1DIHA 1DIRA 2AQHA 4HX5A 2QHXA 1RJWA 3TFQA 5HRUA 1E7QA 1PTJA 1E3WB 1ZXLA 1ZK0A 2YQ4A 5IXYA 1C0LA 3BXXA 5CFZA 1SPXA 3DBLA 3T4EA 1MXFA 3OETA 3OICA 1X15A 3K30A 4QO8A 4TRRA 3AI1A 1SAYA 4CMIB 4R5MA 1LC0A 4OO3A 2IODA 2IYPA 2R00C 4EEZA 4FFNA 2JAHA 5B12A 1PJ2A 2WWRA 3KM0A 4YB8A 1HSZA 3G1UA 3WR5A 4NK4A 2VQ3A 4E5YA 2PZKA 5J23A 3DAGA 2D5CA 2EW2A 3MJEA 1GUFA 1YO6A 3HWRA 3WGIA 1SO8A 3UUWA 1Q7BA 4BNWA 5TF4A 3VH2A 4ZD6A 1H9AA 1R6DA 1Y8RB 3PPIA 3TN7A 4YYZA 1U4OA 4CUZA 3IC5A 4HFNA 2I6TA 3ZWCA 1QP8A 2EP7A 1DB3A 3C3XA 4B3IA 1DDOA 2WM3A 2IXAA 2JD0A 3TDKA 1ZK3A 1YDWA 2VNSA 2GGSA 4CM4A 1RYEA 1RKXA 1DIGA 3WGQA 2D3TA 4BB5A 1QV6A 2IXBA 2P9CA 3GRPA 3O8QA 5KWEA 4FJ0A 1UR5A 2NU9A 4FB5A 3OQ6A 3W6UA 5F5LA 2EKPA 2YDXA 3DFZA 2Q2WA 2W2KB 4G2NA 2WMDA 4J7XA 2BFMA 3GOHA 3PHIA 1GADO 1DHTA 1E7RA 1MGOA 2YYYA 4WEQA 4BKUA 4PRLA 5A03A 3PYMA 1IYZA 4NFSA 4R1SA 3B1KA 3RROA 2WDZA 3GVCA 3ZV4A 3NTRA 4D7AA 1LUAA 1YXMA 3TRIA 5JC1A 5JNLA 1O8CA 3C7CB 2LDXA 1QMGA 1M6WA 4W6ZA 4BNVA 2O2YA 3HFSA 4I08A 1JDJA 4LISA 3ZWBA 1NYTA 1PL7A 3WTCA 4IDFA 1B26A 1NFFA 1BMDA 1QLJA 2QRLA 3CINA 3JQ8B 2VZ9A 1HDGO 4JBIA 1I3MA 5DZSA 5JCJA 1VSUA 4IM7A 3RU9A 3WYCA 2VOEA 2Z1MA 1G6KA 4KDEA 4BNGA 3WOHA 5L7YA 3CEAA 4CLOB 1YJ8A 1SB9A 5G0VA 2Y68A 1LQUA 4R51A 1ZVMA 1E3IA 2ZB8A 5F5NA 1BW9A 3I9LA 3ZI0A 4ALJA 5C5IA 5TJ9A 1ISIA 3ONEA 4DL9A 1D8AA 1E1KA 4F46A 3HB4X 5AXDA 4CR7A 4ZQEA 3AWDA 2OGUA 1R37A 1XQ6A 3Q0EA 4O6VA 1UP4A 1P31A 3I52A 4K1LA 4JK3A 4PGFA 3MWDB 4ONEA 1NQTA 4XGIA 4RZIA 5L51A 1XELA 1HDYA 4TRJA 3RFXA 3CPSA 2VCYA 1NPTO 2OMEA 2R00A 4IQ8A 5JFOA 2PKRA 7ADHA 3DR3A 3GDOA 5DULA 2FR8A 1C1DA 4JJFA 4YAIA 1YQXA 4WOKA 2NQ8A 3WSWA 1XWFA 2V6BA 5JYEA 4EYEA 4ZJUA 5TJHA 1R4MB 2IEDA 4BKRA 4AJOA 5ENDA 1ULSA 1GTMA 3UFXA 3PVZA 3V1UA 4UVIA 1E3EA 5B4VA 2VTEA 3R3SA 2BFAA 2X1HA 3GPDG 3PLNA 1YBVA 4RPHA 3VZRA 2B5VA 5U9CA 1GUZA 2O3SA 4QEDA 4MIOA 4MKXA 3WXBA 4CUJA 1EE2A 1HYGA 1PJLA 1Q1NA 2FPIA 3P7MA 4PIVA 3UW3A 5CDGA 3VDRA 5ITWA 4LMPA 4PLFA 3SLGA 5G0UA 4RDIA 1XYGA 2GUGA 3OJ0A 1YH3A 3JYPA 3LC7O 4ALKA 3KLMX 1R0KA 4PLTA 2WD7A 1KIFA 1GY8A 2C2YA 2PGJA 4W9NA 2BELA 3H5AA 1EQUA 3N7UA 4IDDA 1I30A 1T2AA 4I9UA 4RPJA 2EXXA 4KUHA 3EUWA 3H4VA 2ZTUA 1DFHA 4E5NA 5C3MA 2J8ZA 4E6PA 3KOUA 3GVXA 4BO0A 3E5RA 4IGFA 2HAEA 4QTZA 2VWQA 1T24A 1PQPA 1KY4A 4GGPA 1CRWG 3DZJA 1S7CA 3GZNB 5BNIA 2DTEA 3I9MA 1NAIA 2JJYA 4U8GA 4AJNA 2JL1A 1H6CA 3BMOA 4M87A 4CMEC 1Z7BA 5DOZA 4FN4A 2VHYA 4MVJF 4E5KA 1G0NA 4AJLA 5IJZA 1MLDA 4XA8A 1VJ1A 3H7AA 3SBOA 3ADOA 1ZJZA 2CDCA 2O7QA 3LLVA 2CZCA 4G5HA 2X6TA 3NDIA 4KWIA 4R16A 3D5TA 3CMCO 3DBHB 1A4UA 4QT0A 4CLRA 3MEQA 4K28A 3DZIA 5KVSA 3M1LA 5EESA 3ABIA 5L3ZA 1NR1A 2EGHA 2EJWA 1OFGA 3WFJA 1JVBA 3BMCA 1OI7A 2GYYA 4UAGA 4II2A 2X9GA 3TPCA 3PDJA 3A06A 4RO0A 2B0JA 3D5QA 4FFOA 3ZNPA 1XR3A 3JSAA 2O4UX 4RJTA 2BGMA 3NUGA 4AVYA 3FWNA 2GN9A 1GQYA 4DYDA 2D59A 2PTGA 2PZLA 3AY3A 4YACA 4MVJH 3D64A 4JX8A 2J5KA 2ZB4A 2QQ5A 1E6EA 3HFGA 3JQGB 3EGOA 2EKQA 1RM3A 4YJFB 1SZJG 1ARZA 3UCEA 4CMKA 4FOSA 2QRJA 1O5IA 4IDBA 4GWKA 1R0SA 4S1VA 4D46A 4XJTA 2DBVO 5DBGA 1KEUA 2P68A 2O2SA 2O3UA 4KP7A 4CR8A 3BHMA 3AU9A 1XSEA 1P3DA 1LDMA 5L53A 3ZV5A 4IIUA 1PGNA 3JD4A 2DKNA 1ENZA 1I32A 4J0EA 1CWUA 4ALMA 5TQVA 3M2PA 4HNHA 4BL5A 1G0OA 3GMDA 4AJ1A 4R68A 4CR6A 1XA0A 1EE9A 1KEVA 3GF4A 3DONA 4RF5A 3PJGA 1SCUA 3GVIA 4H16A 1HDXA 2YV1A 3BYZA 4RZHA 5JW6A 1YOVB 3JQEA 3IQDB 4GL4A 4XR4A 2PWZA 1PR9A 1QSGA 3I9NA 4L74A 2I3AA 1KVSA 2JD1A 3P2OA 2GERA 3HDYA 1WPQA 2AQ8A 4KWHA 3JQDA 4MIYA 4WLNA 3WMWA 5JSFA 3DZKA 2RCYA 3H9UA 3H2SA 1U7TA 4NBRA 3KRTA 1XU7A 1A4IA 2YJZA 3LT2A 2I9PA 4BO2A 1C0IA 2POQX 1ADBA 1TEHA 1KEWA 2PKQO 2G1UA 4OKIA 3UHAA 1DAOA 3H9EO 4I9HA 1LSOA 2BRUA 3K73O 5TC4A 1FDTA 2OO5A 3I9JA 1Q7CA 5JAMA 4TZKA 4GPD1 2SCUA 2VHXA 1I33A 4RF4A 5I8WA 1H6AA 1I2CA 1YB5A 1YS4A 3TSCA 2IEBA 3BIOA 4B3HA 2PV7A 3GVPA 4R69A 3JQFC 3WGHA 4OQYA 4YDRA 1YONA 1EK5A 2EV9A 3S8MA 2QZ9A 1CJCA 3U4DA 2DFVA 4J3FA 4L8VA 4YJFA 4LSWA 4I1IA 4UEJA 1C0PA 5IG2A 1O95A 3E1KA 1ORRA 4Q3NA 3Q9NA 3IP1A 5B4TA 3U0BA 3K2BA 1U3TA 5L9AA 1PL8A 4RVSA 3KSZO 3KHUA 3RASA 1BGVA 1DLIA 1ISMA 1X0XA 2XAAA 1AGNA 4KUEA 3DZBA 3KYCA 1EBUA 1UDBA 2A92A 3NDJA 4B4VA 4NH4A 2X22A 1LI4A 2NM0A 1AXEA 1U3VA 4J9UE 3WQQA 2RAFA 4A03A 2XPCA 3HHPA 3FF4A 3JQ7A 3PZBA 3NGLA 3HDJA 1ZNQO 3G49A 1KVRA 2Q99A 3U4CA 1EVYA 1T2EA 5AYVA 3EY4A 4LMRA 5K6AC 2NVBA 3TJRA 2F1KA 5AXCA 4LCJA 3MZ0A 4FGSA 3QY9A 4GH5A 2FHSA 2AQIA 4Y6RA 3GNSA 1H6DA 3U4HA 5KNLA 5KJ6A 3DOCA 4KTVE 4O1MA 4RV9A 2W8ZA 3KYDA 4YJHA 3EAGA 1E3JA 3UVEA 3GN1A 2X23A 1P44A 4E2ZA 4EUFA 1GL3A 2QYTA 1RYDA 1E5QA 3INRA 2ZQYA 5BSGA 3ON5A 3WB9A 1I2BA 2J3HA 4J1SA 5JAQA 3WX0A 4PN3A 3WICA 4M49A 4TQGA 3K96A 4GX5A 1JKFA 4IXTA 3F1LA 4YAEA 3PXXA 2B69A 3UICA 8ADHA 1DRWA 3ASUA 2PD3A 3LT1A 1OC2A 4ND4A 1CEQA 2X9NA 1M75A 4R1NA 5KJFA 4QECA 1MX3A 2QYSA 5KKCA 4DWVA 4TZTA 1EDOA 1YOVA 3HQ4O 4QUKA 2AEFA 5LC1A 4J1QA 2YV3A 3B70A 2O3QA 1KVTA 2CVOA 4KZPA 4XIJA 2O48X 3FNGA 1Q0QA 4MP3A 1NQ5A 2WYWA 4M8SA 3QVSA 1L7DA 1MG0A 1HEUA 2GSDA 3BZUA 4PG7A 4PFJA 4DQXA 3QP9A 1QYCA 2DUUA 1AXGA 4E2XA 1BHSA 1E1NA 1HE5A 3E6AA 1K6XA 4BNLA 1IPFA 5DBFA 5G0TA 5H83A 3IP3A 1DJNA 5G0SA 3ROKA 3WBBA 3Q6IA 2BFOA 4UUMA 3N58A 4BO5A 1M67A 4YBZA 1A9YA 1JQBA 2C59A 2O23A 3PWZA 4G81A 5JDCA 2UUPA 3HDQA 4BNTA 1BVRA 3GRKA 4XQEA 4AJEA 3DFUA 1I5RA 1ONNA 4QXMA 5IZ4A 3ROQA 1E7YA 2ZB7A 4J90A 3COSA 4Y8VA 4OGWA 3D0OA 3I4FA 3NRCA 2GRAA 1IULA 3VH3A 5ER6A 2NSDA 4FCCA 1LRKA 2Y93A 2G82A 3E5MA 1XQ1A 2TMDA 3VVBA 1P1RA 3WMXA 2PLAA 4M1QA 1LU9A 2Q49A 3V5NA 2VYVA 2YHUA 3JD2A 4NU5A 5FI3A 3BMNA 5CDUA 5K6AA 3ZWAA 3H3FA 4CLXA 1A71A 2VNAA 5T5QA 2C7VA 3KO8A 2C29D 2VUTA 4ITUA 1ZK4A 4ZHSA 1HKUA 2O7SA 2Y1FA 4YVFA 4XEHA 4MVJD 1D3AA 2H6EA 4YT8A 1OC4A 3O9ZA 3I83A 3WYBA 4KDFA 3UF0A 3O03A 1JA9A 1ZZEA 2PGLA 2AHRA 1PS0A 4RPLA 2NACA 4NBVA 4DIBA 3B6ZA 3GUYA 1PIWA 3X2EA 1Y5RA 2BI8A 3AUUA 4XYEA 4GQAA 3L4BC 2D5AA 4LRSB 4UUOA 3U4IA 5L4LA 1Q7GA 4DA9A 4ZICA 3JYLA 5CP8A 5K0ZA 4I9NA 1R15A 4E33A 1J6UA 3AUAA 3QVOA 1N1GA 1U3WA 2NTNA 3BA1A 4N18A 1MG5A 1SOVA 2PY6A 3O26A 2Q2QA 5BSFA 3TL2A 1UDCA 5A5EA 3K2EA 4CPDA 3DMTC 1Y8RA 2NWQA 4PLHA 3CMMA 2Q46A 4YTEA 5EERA 3W1VA 5JMWA 2JHGA 1ZJYA 2ZCUA 5JXWA 5H81A 1T26A 4MVJI 1V3VA 4RVUA 3H9QA 1N1EA 1N2SA 2ILTA 2UVDA 4NIMA 4K6CA 4YAJA 4OXKA 3VOSA 1NQOA 2B35A 2HO5A 2OBYA 1P1IA 1RM5A 1GEEA 4WKGA 1R4MA 3BMOB 4OMUA 1P1JA 3TL3A 4AICA 1Y9AA 3ZCXA 2Y67A 4BHTA 3DAPA 4E30A 4J4TA 3H2ZA 5L45A 5L4SA 1H2BA 4MVJM 5KJ1A 2ZCVA 2FMUA 3A1NA 1F8FA 3JQBA 4AL4A 5HA5A 1L1FA 2RHRA 1NBOA 2H1SA 3D7LA 3SEFA 3GGPA 2AE2A 4UUNA 2Q50A 5BQFA 1E3SA 1C3VA 5COQA 3W8FA 5CEEA 3GFGA 4FQ8A 4IZHA 3WNVA 2PZJA 1RM0A 2DC1A 1OZAA 2X5KO 1UP6A 3IJRA 5DN9A 9LDTA 2GCGA 3VZSA 3VVCA 3ZWMA 1TI7A 1VJTA 5F1OA 5F1KA 5A02A 2QRKA 3TOZA 4R9SA 3JQAB 5TIIA 1N9GA 2HKIA 5HS6A 5BNFA 5IFLA 4KTTE 1NNUA 2C0CA 3NJ4A 4IXWA 5DCYA 4HP8A 1U9JA 2DVMA 4EDFA 1PQWA 3OJEA 3KXDA 2RH8A 3AM3A 3RD5A 1GFSA 2GN8A 4BNHA 4XKJA 2FP4A 3SLKA 5DT9A 3BHIA 1C1DB 4P4GA 1LX6A 3S2GA 1ADCA 1U5CA 1TXGA 4U6SA 3GVHA 1AN9A 1HDRA 1QLHA 3PTZA 1DFGA 1O89A 3LU1A 3NT5A 1A5ZA 3PWSA 2W2KA 5THQA 1X7GA 3GH3A 1HDOA 3TWOA 2XOXA 4CQLB 2JCVA 1OBFO 2ZTVA 2D8AA 3NEPX 3PFWO 4NG5A 4PLWA 3JQFA 4CMBA 4A5OA 1P0FA 4FC7A 4GLLA 3ST7A 1A7AA 1LSSA 1HZZA 2WSBA 3DTYA 3PQEA 4MVJP 1X7HA 2HJRA 2NADA 3RU7A 4ALLA 1I3KA 3IOYA 4YQZA 4Y67A 4XDYA 2EF1A 4DMMA 3VZQA 3DMTA 3DWFA 5JYDA 5A3VA 3V1TC 4YRBA 3EMKA 3QVTA 1E3LA 4DPMA 4IS3A 1VKOA 2ZTMA 4OQZA 4CMHA 4DPKA 2JKVA 2PH5A 1QYXA 1D7OA 4PLZA 4AJIA 4FSHA 4RPGA 2E48A 5IXSA 4JXKA 3QIVA 2EW8A 2Q2VA 4I8XA 2P4HX 1GZ4A 1NFRA 3E8XA 4IINA 3VPSA 1S6YA 4P4NA 1UDAA 1WDKA 1Y6JA 1YB1A 3S2IA 3OP4A 1PZHA 4RDHA 4WLVA 2DFDA 1ML3A 5TS3A 1U8FO 1UXJA 4A0SA 3LLSA 1E1LA 1N92A 4HY3A 4YAKA 3TZQA 1SB8A 4BQRA 4IQ0A 3FTNA 3JD3A 3ZWWA 1EMDA 1DJQA 2OXIA 4J16A 4NMHA 4YCAA 3FHLA 4DRYA 5JC8A 4BNZA 5C7IO 1H93A 4GSKA 1XG5A 3AUSA 5I7SA 5EL0A 4PLVA 4BNFA 3DL2A 4WCFB 4B79A 2IE0A 4ILKA 4XB2A 2RHCA 4GI2A 4PZCA 4BO4A 2C5EA 5C7OO 2X58A 3RJ9A 5F21A 3FSRA 2VYND 1LNQA 2DM6A 2ZB3A 3PDUA 4P4LA 5I9NA 4J49A 2DT5A 3IUPA 4D43A 2DU8A 1YQDA 2J3JA 4CM8A 1TVEA 3AFNA 2ZQZA 5ILOA 1NPYA 4MP8A 1GV0A 1I24A 1DO8A 2V6MA 2VHVA 2WYUA 1YJQA 1RWBA 1ISGA 3KEOA 3PLRA 3L9XA 5JAIA 3ZWXA 3JD0A 4YWJA 3GK3A 1ZK2A 2BGLA 3JQ9C 5JE8A 1GAEO 1T1SA 5BSHA 3L4BA 4JROA 1HSOA 3M2TA 5ENVA 4D0RA 1SMKA 3RVDA 3HSKA 5AOVA 4CQMD 4Z6KA 4YJDA 3RUFA 1QR6A 5JCXA 1WW8A 4BUCA 2DBZA 3DMYA 4WCFA 2FY8A 1I3NA 1QKIA 1GZ3A 3HJAA 4PVDA 5JLAA 2G5CA 4DYVA 1YKFA 5LDGA 1JN0A 1VL0A 1Y81A 1BDMA 3AY6A 4FR5A 4HWKA 1WMBA 3BTOA 4BGVA 5BSEA 5FI5A 2NV6A 3Q2KA 5AXBA 3AUTA 1B3BA 2Z95A 3PHJA 1DC5A 3TZKA 1LBEA 4HFRA 4CQMB 1F17A 3IDSA 5HS4A 4CM5A 1SC6A 3U9LA 5AXAA 4O0LA 1O9BA 1ZSVA 3W4IA 3R0IA 4GVLA 1ZEJA 4BQPA 1E6WA 3P19A 2DTDA 6ADHA 4WASA 2X7HA 1E0DA 1HZJA 3LSYA 3PIDA 5U1PA 1LLUA 3O38A 4BNKA 1N8KA 3ENKA 1PJCA 2HK8A 3LVFO 4XYBA 2I5PO 4HFJA 5BR7A 3PP8A 4L4SA 1K6JA 4N5LA 1T2DA 4RCVA 3VPXA 5EQDA 1QYVA 4CV0A 5A5FA 1EVIA 4R5HA 3ZW8A 1VRWA 4IGEA 3F5QA 4WE3A 3BAZA 2IZ0A 4S3MA 1Y7TA 3DO5A 4YA6A 4YT2A 3QRWA 4IPTA 3C8MA 2AE1A 4N5MA 3BMNB 1XEAA 5AQ1A 1B2LA 1T2FA 2JAPA 4NK5A 3GC6A 3GGGA 3K31A 4UVHA 4BVAA 4O59O 3EZLA 1B0AA 1O94A 4DC0A 3U49A 4FS3A 3U3XA 1J4AA 3FCOA 3C7DB 4JQCA 3O8QB 2GZ2A 1K2WA 1LTHR 3PJDA 4AJ2A 4BOYA 3TQHA 2F00A 5EJ2A 3IIEA 2CVQA 4I5EA 4TKLA 3A28A 5A9TA 1QG6A 1ISHA 2GF2A 3DXFA 2VWHA 3ZV6A 2WJPA 3KBOA 4FD3A 1TA4A 1YL5A 4C7JA 3JYNA 4M86A 2ZIZA 3V1YA 4E5MA 1LA2A 3QA9A 4XYLA 1ISJA 1DIAA 4MJLA 3NYWA 4CV1A 5EN4A 3JD1A 4CM6A 2GASA 5T64A 2DQ4A 1DEHA 3S2EA 5DOVA 1VLLA 3CH6A 1NQAO 3R6DA 3IKTA 2GD1O 5F3RA 4WLEA 2EP5A 3GEMA 2QX7A 3FRJA 1PGQA 3VPFA 2PNFA 4B3JA 2OOSA 4RPKA 5JY6A 3EK2A 4J7CA 3ZV3A 1HDCA 3PGXA 4Q3EA 2G0TA 3ICPA 1MFZA 4J9VA 2NU6A 4CMGA 1WZIA 4K26A 4CMIA 3B1FA 3IAHA 1E92A 4PVCA 1BXGA 5A04A 3PHHA 3CKYA 4B7UA 1D4FA 2VTDA 4U0JA 2NU7A 4L75A 1HF3A 5KTKA 4EI2A 2Y05A 4J2HA 4F6LA 2R2GA 4Z0HO 3LDHA 4BNUA 3SVTA 3D4OA 2Y1OA 4GVXA 2BGKA 1GUYA 3E48A 3GGOA 1TT7A 5DDIP 3T7CA 2E37A 5I7EA 1PWXA 1EUCA 3OFSA 3QWAA 2ZATA 4EJ0A 2PD4A 1YBAA 4L4XA 2DPHA 4TWRA 1HXHA 2OZPA 3QVXA 1X14A 3WLEA 4D45A 5IZCA 1A72A 1X13A 4TVBA 4BNMA 1VI2A 3MJCA 4Z9YA 2FPGA 3ZU4A 2I76A 1UXKA 3KVOA 3DBRA 1YDEA 3AI3A 1LQTA 3OIFA 1LJ8A 2H9IA 1WVGA 3K9QO 5C37A 3PI7A 1ONPA 2HMVA 3ROMA 3EYWA 3B1JA 1LXCA 2X8LA 4Y6SA 3AU8A 3QWBA 3ONFA 1LDBA 2YZ7A 3JQ7B 1VE9A 5IZCC 1MFPA 1SOWA 4W7IA 3VTZA 3DAFA 3HG7A 3TZ6A 4KQXA 1BG6A 3NAQA 4NBWA 4IBOA 2GO1A 3OQBA 3Q11A 4DLAA 4HV4A 1FDSA 1LEHA 2RH4A 2YHIA 4TRNA 4FBGA 2B83A 3ULKA 4O5OA 5CEJA 4A73A 2ZTLA 5KJCA 1NP3A 2CDAA 4G65A 6LDHA 3S55A 3ZHZA 4GAEA 3W8EA 2A4KA 1UH5A 2X5OA 2FN7A 3MTJA 5MDHA 1BXKA 4HBGA 1HTBA 3NKLA 2WD8A 1PS8A 2NTJA 1WP4A 3IUSA 4J6FA 3DC2A 4JNKA 4OOEA 2D4AA 3LF2A 1K89A 2Y0DA 1NHGA 1YQGA 1X7DA 4PRKA 3MOIA 3OJLA 2NVUB 3WWYA 2ZYGA 3PHGA 5I7VA 3QV1A 1HDZA 4IY1A 1C0KA 3GMSA 3JQCA 4O63O 2HK7A 3ZZNA 2VOJA 3MCVA 3GN2A 2CF5A 3KZVA 2AG8A 3DHNA 4MDHA 3WSVA 1EFLA 1OMOA 2Q1UA 4DGSA 5A05A 3RBVA 3DZHA 3OBBA 5CPBA 5IDYA 1PJ3A 4J4HA 4EEXA 1E3WA 1Z73A 3I6QA 1ADFA 2DBRA 3PYLA 3E82A 4RVDA 3G17A 4AJHA 1MC4A 1NASA 4PZEA 2X9VA 1QRRA 3GA0A 4GLOA 4JLWA 3NX4A 1C1XA 1D1TA 1EVZA 2VZ8A 3OEYA 5EMHA 1UXIA 2HK9A 1X0VA 4M54A 3RJ5A 1DC6A 3PGJA 1BVUA 1V3UA 4Y9DA 1WZEA 3SX2A 3V2GA 2C5AA 2X0RA 1HE4A 2XXBA 4NJMB 4IZIA 3NJ8A 4L73A 4R54A 1EVJA 1O0SA 3NGXA 1F06A 4L4RA 4Q3BA 4XR9A 3ETGA 5JS6A 2A94A 1GYPA 4GX1A 4RQUA 2ZK7A 1HLDA 2NTVA 3RUCA 3FNEA 4LRTB 4CODB 2W98A 3ZNNA 4A10A 2BH9A 1P77A 4W99A 4H15A 4WK6A 4MINA 3TF5A 3ZWOA 1ZUD1 1GZ6A 2VZ0A 4YPOA 3PZRA 3FBTA 3HN7A 4Q9NA 3OF2A 2PD6A 2HMTA 1DFIA 1XHLA 4W82A 2O50A 4YJHB 3RI3A 4BMVA 5A9SA 2JFGA 1LLCA 3D4NA 5A06A 2VN8A 1PJBA 3ZHYA 5ITVA 2DUWA 4GBJA 1KBZA 3AOGA 1B16A 4I5DA 3K5PA 3QW2A 1XIVA 3GY0A 4YJGB 3VPHA 4CMAA 1IZ0A 1AE1A 4JN6B 4RVGA 3GZ4A 4BO9A 4WLUA 4XQ9A 4FFPA 4CM9D 3KSUA 4A26A 2IRWA 4EW6A 3L9WA 4IIVA 5JBIA 4OM8A 3RC9A 1J5PA 1NVTA 3GG2A 5G4KB 1V9LA 3EHEA 4NBTA 3JQ6A 4PG8A 4XYMA 1ENPA 3AM4A 3N74A 4OOFA 1A9ZA 1E7WA 3ZWPA 3B20A 3UH1A 3OJFA 1VKNA 3GHHA 5CEFA 4RGBA 3WWZA 1I0ZA 3U5TA 1BSVA 3DTTA 3I9KA 1ZKMA 1GPDG 1I36A 5T6BA 3TOXA 3BTVA 3G79A 1LSUA 3V2HA 2ZYDA 2IYOA 5COBA 4XWYA 2VWPA 2AMFA 3ORFA 1GCUA 4NFHA 4DBZA 4DLLA 3KYDB 1O6ZA 1WDLA 1UZLA 4J0FA 4RLSA 1IHYA 2EWMA 2Q4EA 2ET6A 3I4CA 4H7PA 3ZDFA 2XF8A 5TX7A 4RORA 1E77A 2NLOA 3PIIA 4E13A 4FW8A 4UVEA 3HUDA 4IMRA 4XRRA 1CETA 1VL8A 3QVWA 5EQFA 1KERA 2P9EA 1DAPA 3RUHA 2HUNA 4JJIA 1ID1A 4UVDA 1ZO8A 3FTPA 1Z75A 2E82A 2BHLA 4K6FA 3JQAA 4NU6A 1WLYA 4D42A 1Y9EA 1YE3A 4W9NC 5CG2A 4L76A 1JTVA 2I99A 4WLFA 3DB2A 1SBYA 1DC4A 1B15A 1HLPA 2VRBA 3DZGA 1ONOA 1NWCA 2P5UA 3GNQA 4DIFA 3UCXA 3RC2A 3C1TA 5JMPA 4Y6PA 5DCUA 4BIIA 1PEDA 2FOIA 4ZQGA 4D3SA 1AUPA 2GNAA 5LDHA 3OJOA 1PZGA 2CVZA 3AK4A 4FJ2A 3DBVO 4BB6A 2X0NA 3D1LA 5EIOA 2C82A 4Z3KA 3GDGA 5A4DA 1UAGA 2A9FA 2X4GA 4LSMA 3IL2A 2RIRA 9LDBA 3JTMA 2O3JA 1W8DA 2FZWA 3RKUA 3DZFA 3CXRA 1PX0A 3WJAA 2HU2A 4RVFA 5JAZA 3AY7A 8LDHA 3VH1A 3H6KA 2H63A 5A9RA 1H94A 1YL7A 2PH3A 1U4SA 4I5GA 3JQBC 4OXNA 3KEQA 1V8BA 4NJOA 4D0SA 3FR8A 2W90A 3ZHXA 1DRVA 4BNYA 3WQSB 3JQAD 4B4OA 2X0JA 1PWZA 1HE3A 4DQUA 2GZ3A 4CM7A 1Y8QA 1AHIA 1T25A 1YWGO 4CLOA 2DLDA 5T57A 2YHIB 4GX2A 5ADHA 1ISFA 4JBHA 5JO0A 1KOLA 4QX6A 1HL3A 1NWHA 4CMJA 1EUDA 5ILGA 1GYRA 2VT2A 5ICMA 1CIVA 4Z9XA 3MWEB 4JIGA 2JCYA 1GU7A 3OEWA 4DBVO 2C20A 4XYGA 1IUKA 1UXHA 4Q3AA 3W8DA 2FSVA 1W4ZA 1YVEI 2DAPA 2A35A 4WNCA 3EVNA 5T67A 4Z3DA 5THKA 5U4QA 1PGPA 2G76A 4ZA2A 3R1IA 5DCWA 3LT4A 3F9IA 3GT0A 4EITA 4RF3A 3I3OA 4BNIA 1B8UA 1R12A 2GR9A 3AW9A 3I6IA 1YBMA 3OQ1A 2NVWA 4NDNE 4XGKA 2I66A 3T7EA 4BNJA 2FR1A 3JQGA 1F14A 5DNAA 1B14A 3EDMA 3VH4A 1GD1O 2PR2A 4B4UA 1IY8A 2V65A 4OIMA 5G4LA 2HDHA 3W4JA 5FEUA 1I8TA 1N7HA 2QZZA 1NVGA 4TKMA 2PGDA 1DSSG 1V35A 3G3EA 4YT5A 1BXZA 1F0YA 3L07A 3M6IA 4ALNA 3PYXA 4BO7A 2P5YA 5LCXA 1KY5A 1XLTA 1Y8QB 3MJ4A 4DXHA 3OECA 4A27A 1Z7EA 3FNHA 2FRDA 4RF2A 1PZFA 2GZ1A 5FWNA 3I1JA 3KYCB 4KQWA 4XCVA 3U62A 5HM8A 4AG3A 5B1YA 1L7EA 5GZ3A 2FZEA 3PQDA 4D41A 4CQLA 1BXGB 2P2SA 3RC7A 2HLPA 2VHWA 4AJ4A 1B3RA 2UAGA 3Q9UA 3RBXA 3Q3CA 3C1OA 5JDIA 2CSUA 3ZWYA 2Q3EA 1E1MA 4YJGA 2GLXA 3C1AA 1ZW1A 1YGYA 1LDEA 4NR0A 5C7LO 4N7RA 1ZBQA 5GMOA 1MXHA 4IUYA 1IB6A 3JV7A 4YR9A 4FFMA 5CPFA 4WPGA 1JLLA 3W4KA 1R4NB 5TSDA 2NUAA 4C4OA 1RPNA 1U28A 1HT0A 1MUUA 4DREA 2I65A 5IDXA 4BGEA 2W4QA 3BTSA 1XDWA 1T4BA 4A7PA 3DOOA 4FFRA 4GX0A 2O3RA 1E7MA 3QJ5A 4IJUA 5F1PA 1K5HA 3Q2IA 2CFCA 1NX6A 3ZN2A 2WEKA 5I9MA 4FJ1A 2YFHA 3IKVA 1DBVO 3LQFA 3BMQB 1KC1A 1HETA 3RUIA 4AFNA 4GMFA 4J7UA 4NJMA 2FPPA 1K0UA 1MP0A 3PRJA 4GKBA 3ZWNA 3L6DA 4MVJA 1ENOA 4EJ6A 3DQPA 3E9NA 1NR7A 4ZRNA 2WE7A 3KB6A 3MJTA 1C1XB 4PLGA 2AQKA 1LDYA 3CZRA 2CF6A 4PCVA 3SXPA 1UJMA 4DUPA 2ZKLA 4ZQBA 2OUIA 2UDPA 4AJKA 3PHLA 5GZ6A 1A27A 4FDAA 4C7KA 1BTOA 4B8WA 3C7AA 4BKPA 4YXFA 3RKRA 4YQYA 3FPCA 2E4AA 3A4VA 5HBRA 2AA3A 1LSJA 2HMWA 3ZU5A 1PR3A 3NDRA 4J1TA 1ZCJA 1B7GO 4U7WA 4ALIA 3H5NA 1PQUA 4XQCA 4IJWA 4N54A 4J4BA 3OA0A 3ZNQA 2OP0A 2VUSA 3FN4A 4R3NA 4DTIA 4W7HA 2Y1DA 3OIDA 4CV3A 4UEOA 3TFOA 3ICCA 1W6UA 1Q0LA 5ER9A 3UAGA 1R16A 4YEDA 4BV9A 3WJ7A 4XGNA 5K9ZA 4NI5A 3A9WA 1LRJA 4XJSA 3U09A 3ETEA 3WLFA 1Z45A 1SEPA 4LN1A 1EEHA 1P1HA 1QYWA 4TMFA 2X86A 3NTOA 4DPLA 1ZH8A 2CUKA 2EJVA 2IDZA 2Z1NA 1KVUA 3ITDA 4QFDA 5KJEA 4MVJE 3F4LA 4HUJA 1Q2XA 3KTDA 3GHYA 4IDGA 4E21A 4CJXA 1P45A 1UZNA 5G2OA 4OXYA 5G4KA 2DBQA 1P74A 4OSPA 3A14A 3WBFA 1N7GA 3GG9A 5TGDA 1CQJA 1PGJA 3L6EA 3QWFA 4DLBA 1GYQA 4JP3A 1EDZA 3ONDA 3IS3A 1PJSA 3CTMA 4ZVVA 3RQSA 5I9LA 3LC1O 3UOGA 5B4UA 3PJFA 1B8PA 1N5DA 4BKQA 3P5SA 3NV9A 1XGKA 1FDVA 4BMNA 5FFFA 1UUFA 5COAA 1IL0A 2O4CA 3F6YA 5I7FA 2D1YA 4BMSA 1ZFNA 2C2XA 3H65A 3T4XA 5TT1A 3WGGA 3RUAA 3WGTA 2OFPA 3ZGYA 4FPXA 3GZNA 2OL4A 5JDCC 2UUOA 2HRZA 2VRCD 4RQTA 4ZU3A 5AVOA 2Q45A 3AJRA 1AHHA 1DPGA 3OHSX 2ZJ1A 2HJSA 4RL6A 2TMGA 4WEOA 5A3JA 4JGBA 4NFYA 1LRLA 3DBLB 3I9OA 5FYDA 4Z9FA 3G1TA 3VAZA 2E6UX 2PK3A 4WOJA 2LDBA 2VUUA 4GWGA 4ZRMA 3DDNA 4D3DA 2YFQA 2EEZA 5IDWA 1IOLA 1TLTA 4CM4B 1HWYA 1ZSYA 5L40A 2BMAA 4L9RA 5B37A 1Y5MA 3LZ6A 1IPEA 4WGGA 4GMGA 1DLJA 4JBGA 2W2LA 2HQ1A 3BMQA 1VJ0A 4HFMA 2WE8A 4E4YA 1WMAA 2QG4A 1OOEA 1PJ4A 4XX0A 3QWHA 2AEMA 3PJEA 1JWBB 1U5AA 3ZU2A 3HE3A 4AJPA 1Z74A 1ZMTA 3S1LA 4NHEA 4XIYA 4WUVA 3GAZA 1FDUA 3PQFA 5JCJD 1T4DA 1R4NA 3QSGA 2J6IA 3MJSA 4GKVA 3DOJA 3QQPA 1KVQA 4YRDA 2JCXA 3RAJA 2BI7A 4GSLA 5H82A 5TRTA 3TZHA 2V6GA 1MA0A 1VSVA 4EJMA 1BDBA 1QV7A 3D3WA 2UV8A 3FR7A 3WIDA 4BO8A 1JAYA 1EQ2A 4CMCA 5DP1A 3RC1A 4QQRA 2OBNA 1DRUA 3TNLA 1F8GA 2EHDA 1CDOA 2J3IA 3I23A 4II3A 4XZ3A 4MO2A 2IZZA 4CM9A 4B4WA 4OJNA 3UN1A 5JPIA 1XCBA 3AOEA 3PEFA 4Q39A 3S2FA 4TVOA 2OP1A 4J91A 3OH8A 5MGBA 2EIHA 3KSDO 3K8ZA 1P1KA 4KOAA 1M66A 1NXQA 1BW9B 1HYHA 3BHJA 3SC6A 2Q1SA 3BMCB 4UULA 4QFCA 3MOGA 2OHXA 1J49A 3F3SA 2QIOA 3L77A 1T1RA 2I3GA 1U8XX 5DP2A 1GDHA 4EZBA 2I67A 3E9MA 1MC5A 2BD0A 3R3JA 3ZWVA 4BV8A 2R6JA 4D79A 2D2IA 3EW7A 3K92A 4P22A 2P91A 4LCEA 2B5WA 2C54A 2H5LA 1H6BA 1HRDA 3ANLA 3RBZA 2J3KA 3AOEC 1VPDA 5CHEA 1NAHA 1EFKA 3KLPX 3VDQA 2Q4BA 3VZPA 4A2CA 5IN4A 2Y0EA 4E5PA 5L4NA 1MV8A 3WIEA 3WYEA 5A9SB 3ZHBA 1HE2A 4DC1A 1DIBA 4IDEA 4L0QA 2YV2A 2YQ5A 1OAAA 3FD8A 5CDYA 2G17A 4FIZA 3SJUA 2ZYAA 4PLCA 1CYDA 1X1TA 4FFLA 2E49A 1EBFA 2PA3A 3GR6A 1F12A 4D3FA 4CL8A 1VC2A 4ZQHA 5GY7A 4ESOA 1P9LA 3GQVA 3E18A 1TT5A 4IDCA 3WS7A 4R1TA 5KKAA 3X2FA 4LVUA 4PLYA 4BNNA 4M55A 1KYQA 4X54A 3LT0A 3ZNOA 2AG5A 4B7XA 3ITKA 2BFPA 1UXGA 2XXJA 3GLQA 3LK7A 1W0CA 3CIFA 4M89A 4UEKA 3D3EA 4PG4A 4RLHA 3WNQA 4BO1A 1ZSNA 4HKTA 4D44A 3WTBA 4ZN6A 3KYBA 2Y99A 3ASVA 3JYOA 2YW9A 4Y98A 1P1FA 2EGGA 4Q3CA 1KC3A 5KOIA 4CL3A 5KCZA 2BLLA 2HSDA 3JQ9A 4R4JA 1WXDA 4U5QA 5L95A 1CQIA 2VHZA 3NT4A 4UREA 3FI9A 4NQZA 5T8KC 4XD2A 1UZMA 5HWSA 2YUTA 4HXYA 4ND5A 4QO7A 4YAGA 5DF1A 4CLDA 5I8ZA 4UVGA 4E32A 4JCOA 5IDQA 2B4RO 4J43A 2HRBA 3LC2O 4CM3A 4NBUA 4R3WA 2WTBA 3C85A 4CM8B 1ZK1A 1QORA 1DHRA 1NTOA 5TNXA 4F3YA 3TZCA 1Z6ZA 3BTUA 3HNPA 2VYNA 4XB1A 4URFA 4LW8A 1SNYA 4F6CA 4MOWA 4ZGWA 1ZIDA 1JWAB 1JVSA 1X1EA 3OSUA 4NPCA 1PZEA 4XDZA 5L7WA 2BKAA 1ENYA 1PGOA 3JYQA 1IZ9A 2GPTA 2JHFA 4OL9A 3WGYA 4BNXA 3RWBA 3HN2A 5A1TA 5T8KA 3WFIA 2Q1TA 2CDBA 1WNTA 1U1IA 3L4SO 3KUXA 4FC6A 4HNGA 1GV1A 4BO3A 1XKQA 1NM5A 3UCFA 1I10A 4UUPA 1IE3A 3GDFA 2Z5LA 1TT5B 3GUCA 1SEVA 3MTGA 1KETA 5KVQA 2C7GA 2DTXA 2P4QA 2OORA 3JQ8A 4XQGA 3I5MA 1GR0A 3ROPA 1BWSA 1CERA 1QXSA 2B36A 1YRLA 4MVJG 4K9DA 4BGIA 3UKOA 5GZ1A 4WECA 5EPOA 4EUEA 3FBGA 4YRAA 4MP6A 3AM5A 1U2DA 5TLSA 2V7PA 2HCTA 1GQ2A 5BT9A 4KMSA 1JAXA 4Z0PA 1ZMOA 2NQTA 3PWKA 2AXQA 4ND1A 4AJJA 2WYVA 2ZJ0A 1XU9A 1HYEA 1ADGA 5TT0A 4R41A 1LC3A 1LDGA 1EK6A 4B7CA 1WWKA 2VRCA 2VYVD 4ND2A 3WDSA 2HMSA 5KVVA 4WNIA 3HDHA 1ULUA 2VT3A 1I01A 3GEGA 3L6OO 2X0IA 1IHXA 3PK0A 4DMLA 3RUDA 3GFBA 4ROSA 1WDMA 3VC7A 1T2CA 3D4PA 2PKQP 3HB5X 4BGUA 4Q3DA 3CUKA 3VTFA 4F45A 4OH1A 1DOHA 3EZYA 1Y1PA 2GN4A 2X5JO 3OIGA 4OSOA 4OYRA 4P8RA 4PG5A 2Y66A 4P38A 4CLRB 1FDWA 3GEDA 2FWMX 1QYDA 1E6UA 1UAYA 4E2WA 3FNFA 3JCZA 1LLQA 4DIOA 3ZU3A 1FF9A 3CE6A 3ANNA 5KVCA 1U3UA 1LDNA 3V8BA 3RCBA 1H9BA 4BS9A 1GEGA 3D3WB 3GAFA 4EUHA 4R1UA 3H9GA 3EC7A 5FF9A 1EZ4A 4EBFA 3WGZA 3M1AA 4LK3A 2NU8A 4B8ZA 1FK8A 1CF2O 1FXSA 3IJPA 4E12A 4FGWA 2QW8A 1LLDA 5IAAA 1K6IA 1PJTA 2B37A 5CAEA 3FWZA 2AW5A 3IMFA 4OAQA 4PLPA 3RSHA 5ES3A 3Q1LA 3QHAA 2CY0A 4FOOA 2Y1CA 3C24A 3OMLA 4IDAA 4WCDA 5IN5A 4CUKA 4XRGA 2Y1EA 4H3VA 3HADA 3LYLA 2PZMA 2JFHA 1U2GA 2B4QA 3SC4A 3E03A 4GGOA 2D0IA 4WCFC 1H2HA 4CLHA 3SJ7A 2J5RA 4LGVA 3AFMA 2O3TA 3KETA 1N9GB 1YB4A 2B4TO 1P0CA 3INTA 1D1SA 1PS9A 4IJKA 4IMPA 1I3LA 1J0XO 5JDIC 1PL6A 5ICSA 5EINA 3RFVA 3PFFA 3ETDA 1NFQA 3H8VA 3WG9A 1UP7A 4BO6A 4R01A 1PJQA 3DHEA 2WD7B 3RUEA 2DPGA 3CSDA 4CMEA 3ZW9A 1JW9B 1FMCA 1FJHA 3VKVA 1JU9A 1H5QA 1R66A 3F46A 1I2ZA 4DVJA 1H0KA 4KUGA 1M76A 2Y0CA 3QLJA 1V3TA 4IJVA 4JJGA 1PSDA 1A7KA 1JKIA 5IF3A 5CG1A 5DBIA 1NHWA 2IZ1A 4U6QA 4WLOA 4J2OA 2JFFA 7MDHA 1DC3A 3V2UA 3WGOA 3VHRA 1GPJA 3MJVA 2Y1GA 1E5LA 3LF1A 2EERA 4HADA 5KIAA 4ND3A 1PU2A 2NVUA 3GPIA 2PFGA 2W2LD 3ANMA 4BKOA 3AI2A 1JKJA 1E7SA 1NVMB 3CZMA 3E9QA 4WJZA 4DQVA 4PZDA 3F5SA 2V6FA 5G0WA 3F47A 1DXYA 1P33A 1BRMA 3HZZA 2CMDA 2EG9A 4MPDA 1NPDA
chains in the Genus database with same CATH superfamily
1GGMA 3EXHC 4C7VA 4LBYA 4JI7B 2CLOB 2APJA 2OBFA 3MSCA 4U0KA 5KSZA 3H2YA 3QU2A 4B6RA 1P1CA 2PXCA 4MI9A 4JI3B 2Q3JA 2JGFA 2DPLA 2I8CA 3WMFA 4BQQA 2C07A 5IT0A 3FMOB 1AZLA 3RJMA 5B1DA 1ZMRA 1J25A 1GQRA 4E31A 2OLJA 5KAMA 1UT5A 4OQLA 3QWIA 1JRLA 1M6HA 4CXMA 3NHSA 1OHHD 1MR3F 3UGKA 1U0HC 3DBHA 2RBEA 1SC3A 3PQ6A 4RJIA 2MJLA 4QTTB 3WADA 4FZJA 4EMBA 3T5GA 1W73A 4J0HA 1M2WA 4Y6LA 2YFKA 121PA 1OXXK 1Z0SA 2FSVC 1HI9A 2QSZA 4ZO9A 2XNHA 3REGA 3UGTA 1H5UA 2E4XA 1GNLA 1IOWA 1G60A 1XJQA 1EP9A 3B5IA 3H3JA 3Q3HA 4OU4A 1YQWA 1JFLA 3F4BA 3JRNA 2EEPA 3OM9A 4R9RA 1Z33A 1QHSA 3SZ3A 3V33A 2HMUA 2G9RA 4IR7A 2C58A 2OXFA 2ILVA 2J1LA 4IQGA 2RFLA 4N5NA 4X8HA 4MRNA 4WL0A 4F21A 3H9JA 5BXQC 4RZQA 3DGEC 3WQRA 2Z9CA 4TROA 4EGFA 1VL6A 1LBQA 2Q6KA 2QTZA 4K9LA 4RA6A 5HTOA 1E4VA 3Q8LA 3HUUA 4BPBA 4DQDA 3AR2A 1ZVJA 4ER5A 1K68A 1DGQA 5B58T 5JWHA 4HNSA 2ORYA 2QDXA 2QVCA 2VH1A 4XSVA 4CLEA 1KTIA 1ZLXA 4EX6A 1U28C 4PNPA 2YDYA 4TSKA 1JB9A 1ZEMA 3OZ7A 1G42A 3Q85A 2I1LA 4OHUA 4DRXB 4F8JA 1R0LA 4LVNA 2V8BA 1XA4A 3P2YA 4GPZA 4XXHA 5E1DA 2HA6A 3KV3O 3B3AA 4FI3F 4HWOA 4ZI3A 1QVVA 2QT0A 4JUIA 3BSSA 2EKLA 3CRMA 4S24A 3UXYA 1KS9A 1CZLA 1X1RA 4QSHA 3M3DA 5BURA 4DA8A 3TB4A 1MDBA 5F5XA 5I45A 4RK0A 4Z3OA 4BJ5A 1CC1S 4IVQA 221PA 1LBSA 1HE1C 1RYYA 1U7HA 1MRSA 3VPGA 4DNPA 4ZGGA 1DIHA 4ZOCA 4AO8A 5ALIA 1KKUA 1RJWA 3RVOA 4ZYWA 1E7QA 1FCJA 3DLCA 4IMJB 1E3WB 5JI2E 1ZK0A 3CKMA 2NTEA 5IXYA 1C0LA 2JGMA 5JSHA 3DW1X 2P41A 1SPXA 3MWKA 1L5KA 3S81A 1MXFA 4MW0A 3OETA 1O94D 1X2BA 4PZYA 1CUVA 1H23A 1E89A 4Y3UA 4TQAA 4QO8A 4JYBA 4TRRA 5L3QB 1HLGA 3AI1A 2QE6A 1H3NA 4REQA 3OOYA 4PPFA 5LBIA 1LC0A 1WHTB 1JIJA 1JJFA 3K4PA 2ADFA 3PPWA 2F3RA 3KOXA 3ESAA 3EFOB 5BOSA 4DCVA 4K46A 1RWNA 4GI1A 5DI3B 3KM0A 1DV2A 1I14A 1PKXA 3CUSA 3G1UA 3LP5A 1MW9X 4OUDA 4YK7A 4M36A 5FOVA 2YWRA 2F1HA 4E5YA 4REOA 1P4HA 1DUIA 1WSBA 2EZTA 4MYRA 4P3KA 5LMCA 4M8KA 1T8PA 3ADKA 5B5SA 1FP2A 1GUFA 3RVLA 1IJKA 2NZVG 2CEAA 2WP0A 3LZDA 2X1MA 4F9FA 5AM2A 1SO8A 1Q7BA 2VHJA 1V95A 4W5JA 3VR3A 2G6BA 3GLKA 4DEYA 1KJYA 1ATZA 1H9AA 1Y8RB 2KLHA 3KELA 3OZDA 3TN7A 2BSQA 5BNZA 4PONA 4CUZA 5AJWA 2WU1A 4LZOA 4E5UA 1YU9A 1QP8A 3FNIA 5J4VA 2WM3A 2IXAA 4OMCA 2HMAA 3JYHA 3CZ9A 1V11A 3JRWA 3EDCA 4WY5A 5KMGA 4ZT2A 1TJ5A 5IYZB 1MB2A 2GGSA 1ML4A 4KPUB 4I1YA 1RKXA 2IPMA 2P35A 4JLPA 2D3TA 4BB5A 1S9DA 4BXOA 2IXBA 4ARIA 3U3JA 3K32A 3O8QA 5F2OA 5KWEA 4UNRA 2XVMA 3MTEA 3OQ6A 5GTDA 3SDBA 2YHBA 2X5XA 1TA0A 4B3RB 3O5AA 1L8LA 5AI5A 4QATA 2YDXA 3DFZA 3DP9A 4FHZA 2XYRA 2UVQA 1AGRA 2PO7A 1XZGA 1KRHA 4GM4A 4G2NA 4QDUA 4J7XA 5E3HA 5JPCA 3T1VA 3GOHA 1DHTA 4E14A 3O4FA 3PGKA 4WEQA 1BO6A 3CF6R 3PYMA 1P9RA 2YXLA 2AFIE 2C2HA 3CX4A 2G70A 1TUGA 2B30A 2RGXA 3FVWA 3FYDA 4QUEA 4R1SA 5EPUA 2Q3DA 3UUGA 2XH8A 4PF1A 3TRIA 1CJSA 2NZXA 1XLTC 2D7CA 3P9SA 3MNFA 2OO3A 3H05A 4TSRA 3B60A 5BQXA 2LDXA 3JWIA 1XPUA 3THOA 1M6WA 3KAJA 4JQZA 3DCIA 5JSYA 2VG8A 3FGZA 2ZRAA 3EXG2 4C4RA 2FMIA 4L8GA 3ZWBA 4I4TF 3WWDA 1HDIA 1LWNA 2GH1A 4BJ6A 1QNFA 1JEJA 3GFOA 1W49A 1NFFA 3L79A 1MO2A 3DTNA 4O02B 3MT0A 5DZSA 4JBIA 3I61A 4F91B 2WQZA 2FMHA 3R3XA 4IM7A 1X80A 5H0IA 1N6OA 2Z1MA 2IH4A 3WOHA 4CKEB 2YWXA 4X90A 2JAUA 2R8BA 3GELA 2A78A 2QTTA 1MORA 3C8HA 1E1CB 4HHEA 3HABA 4XCXA 4UU7A 5C5IA 3OQMA 1E3IA 4RHUA 1BW9A 3GJ3A 3ZI0A 1ISIA 3MYYA 3NAMA 4WFQA 4DL9A 1D8AA 4NF2A 4CR7A 4LPSA 4ZQEA 4DSUA 2WSIA 2Y4OA 3RM3A 3ZXUB 1XQ6A 3JSXA 3KZMA 4MTCA 5IAJA 2G09A 5IAOA 1UP4A 2EZ4A 3OTQA 3GLIE 1OE0A 3I52A 1WUIS 2ZPUA 1G18A 3AP3A 2PKCA 3CLVA 3TZBA 4Q7QA 3K0KA 2KJQA 2CL6X 3AX6A 4DXAA 2R8XA 4IWXA 4PQFA 3TYXA 5FI0B 3CPSA 2VCYA 3EEQA 1J7KA 2R00A 2LCQA 1QTIA 1Z2NX 2YJNA 3SYRA 3VV2A 4HAOA 3TJMA 3DZ8A 3GDOA 4DFDA 3G2PA 4PFKA 1VOTA 4WOKA 4E4TA 5K0CA 3E81A 3TLMA 1V9SA 3DE7X 1NJ2A 5JYEA 3THXB 3B51X 5TJHA 4ZCPA 3EX7C 5ENDA 3ZLUA 1ULSA 1JXAA 2BMDA 4D1YA 1J33A 1GTMA 3DHVA 2FZGA 1B41A 4AN1A 3E2MA 1CUGA 3QITA 1A9XA 4CQNA 1DG3A 4BMXA 3GPDG 3VZRA 5TQJA 5DHUA 5U9CA 2WB2A 3KJHA 1VCIA 3G0IA 1MT3A 5CT5A 4LHEA 4OXQA 4ZVNA 1Z0DA 3K0FA 3Q3VA 3RC3A 1PJLA 3SE7A 5ITWA 2UYHA 4J3JA 3SLGA 4EP1A 2W6NA 2GUGA 2J0UB 1MV5A 1TKRA 4F96A 2PGIA 3U26A 4AC9A 1JG7A 4AZ0A 4DMRA 1RCFA 1XN1A 3GOQA 2GHIA 2XOKA 4H7KA 1KIFA 2PGJA 3WXMA 4JQOA 4DUGA 4YCMA 5JEEA 5HE8A 4IDDA 1T2AA 4I9UA 4RPJA 5IVIA 3BEDA 3WK5A 3ADBA 2PEYA 4LHYA 1EDEA 4HH0A 4KPEC 4G5GA 4ZVVA 1OXTA 4QOFA 2VP6A 2YUIA 5C3MA 1GITA 3OU7A 4NEGA 2NUBA 2J8ZA 2KYRA 5CNKA 3O82A 1CIPA 3AF3A 4JT4A 5DLYA 1VDMA 3RVPA 3SS8A 3D2AA 1IIBA 2WC1A 4EFLA 3IEKA 1TU0A 4IGFA 5LZ9A 2YNMD 2ATIA 2XVXA 3K9CA 5I51A 5LP6A 2VWQA 2JANA 1KY4A 2HHLA 3NOVA 4XUDA 2XYPA 2X42A 2PCJA 5CAEB 2QZSA 3W9SA 1PR0A 4LK2A 4FM9A 4U8GA 1C29B 2NV0A 3E9EA 2JL1A 2IHTA 4CMEC 1DT5A 3SF8A 4MMZB 4F6RA 4NE2A 1FFDA 1G0NA 3TKAA 1M34E 1DKNA 4FINA 2NUPA 3K0CA 4I3HA 3ZPXA 5B7GA 4Y2UA 2IZOA 4OP1A 2ZJ5A 3JASB 2FSFA 3HA5A 1ZJZA 1OLXA 4UM7A 1AUQA 1G5QA 1NVDA 4PXYA 2X6TA 1EVEA 3T34A 2QXUA 4G1VA 1QH8A 3CMCO 4H7IA 2JLWA 4KAXA 5C53B 3E61A 4KK3A 1TADA 3AFGA 5CFLA 2W4MA 2WJ6A 3DZIA 1QCZA 4N8SA 4XSHA 1EGVB 4Y0AA 5AD1A 5M5BA 3WLRA 5HDBB 5L3ZA 2RGEA 1NJGA 1NR1A 3IAAA 3UG7A 4HNUA 1J09A 1JVBA 1OI7A 1S96A 5ED4A 5ALEA 1N57A 1L5YA 2OCKA 3EGDB 3FXAA 3RS8A 4MA5A 2QG6A 4FFOA 4RJKA 2BEVB 3I5YA 2CV0A 1M0TA 2PANA 3JSAA 4J8PA 1OBHA 3HCWA 3RFCA 3TUZC 1HQCA 4NC9A 2GHTA 4DYDA 2D59A 1ZMXA 2PTGA 3AY3A 3K9BA 3Q7IA 4EI7A 4Q6WA 1I7QB 3F90A 1A04A 5LQUA 1TUBB 1BGWA 2WLTA 5E7MA 1FMFA 4RIGA 1RI1A 3GWGA 1ULBA 2OV3A 2CCJA 2ZRFA 3IOMA 2P30A 3IOCA 4YLEA 2HUPA 4AW9A 1RM3A 4YJFB 2O8VA 3THWA 2PHZA 4JYCA 5KDDA 1ZICA 1XNGA 4CMKA 2QRJA 4PYIA 4YH1A 2TMKA 4AS3A 4GWKA 1R0SA 2PDAA 3HJBA 3OHPA 4CKYA 3NO4A 4AZVA 4D46A 4AUKA 3KT6A 2DBVO 1WKVA 2R2AA 4YS6A 5BN3B 2P68A 2O2SA 1P62B 2O3UA 4QUDA 4PXAA 4UW9A 3O4VA 2B2NA 3L18A 4FBLA 5H70A 2FPGB 5I3CA 5L53A 4EYGA 1E5TA 4AQ7A 1I32A 2CJYA 4HC4A 3UJ7A 3ZL9A 4R9NA 3WKBA 3PUZA 1PV2A 3K6SB 4ALMA 4V3CA 4DDWA 1SCKA 4HNHA 4D96A 2BOVA 1G0OA 3GMDA 1C3LA 2J08A 1YKGA 2Z4TA 4KACA 1XA0A 3HR8A 5AJHA 3GF4A 4HZUB 1DDIA 1I2AA 1SCUA 1UM9B 1L5VA 4GYWA 4AD8A 2YV1A 4LJKA 1W96A 3T95A 4DDHA 4EYOA 1STOA 3NALA 4RHCA 5FUQA 2VNKA 3A11A 2C5HA 4Q1VA 2JVIA 4L74A 1K7XB 3HDYA 1WPQA 3D8HA 4M46A 2AMVA 2IH2A 4NDAA 4MIYA 1AKYA 3VNAA 3SXUB 2J48A 3OLCX 3DZKA 3ETCA 3OT1B 2XBMA 5IT9A 1MB3A 1XU7A 1FNSA 1XXHA 3CX7A 4BDSA 3LT2A 2I9PA 5K9ZA 3IV9A 3DMDA 1IRXA 1DAOA 2Y77A 3FZNA 2R5NA 3L1IA 5HMLA 5TC4A 3ZIDA 5KJ6A 4JB3A 1V5GA 2OO5A 2PVCA 3I9JA 5FULA 4F12A 1OV6A 1WCIB 1ZRMA 4GPD1 1ZOIA 4NSNA 3P2MA 4RF4A 5CM9C 4BX3A 1R5OA 1PD1A 4GKAA 4IH4A 4YUZA 2D00A 4QM6A 1GGFA 4LYJA 5DHTA 3NYIA 3WK6A 4LWQA 3V55A 2IYEA 3OTOB 4O3MA 3WGHA 1IN8A 1R9GA 1RTKA 1EK5A 1VGQA 1W93A 1YONA 1CJCA 2EV9A 3M9LA 2H5IA 3N87A 2Z2IA 3EUAA 4LSWA 4NHOA 2B98A 3V8NA 2HNAA 1W19A 2FE1A 5AESA 3V2GA 3R5SA 3MAAC 1NVVR 1WOMA 4YWHA 4XFJA 5KYYA 4LFBB 2QLBA 1YJCA 1A8HA 5EUMA 3SDZA 3KSZO 2WRZA 5HJ2A 2QVLA 2IYUA 4XVCA 1Y9JA 1YASA 3ANTA 3TMYA 4TMZA 5IMSA 4ZZ2A 2VNHA 1OBVA 4OB8A 4GF5A 5FL7A 3FI0A 4KUEA 5B64A 3DE4X 3DZBA 5J4KA 4Q12A 5CYOA 2A92A 4DV4B 2Z2KA 3LZCA 3MMZA 1C50A 4QPDA 3GAAA 5E2IA 3G8AA 1JSCA 3HCOA 3L5KA 3UMFA 5C18A 3MLAA 4JC0A 3OEHD 4I3GA 1DQNA 2NM0A 5FJJA 3ENQA 1U3VA 5DYWA 4B3CA 2B8JA 3A0RB 3O84A 2A67A 4X00A 3PGA1 3W2FA 1GGVA 5LP6F 5CNIA 1VJGA 4A03A 3BGVA 3RTCA 3JQ7A 5IXJA 1XCOA 3AVTA 3HDJA 3Q87B 2O14A 1ZNQO 4KMOA 4DUZB 1X74A 2WAYA 1KVRA 2Q41A 1U90A 2Q99A 3L40A 4WXHA 1T2EA 3SM3A 4BUZA 4E6EA 3EY4A 5AVTA 5LUBA 2NVBA 2QPLA 1IATA 4XIGS 5FNZA 2F1KA 3DUFA 3LCRA 3MZ0A 5TB5A 3QY9A 2AQIA 1DAHA 2X3FA 3IUYA 3UHFA 3FYSA 2MSLA 3GNSA 4QFMA 4WA7A 3ZKWA 5KNLA 2HF7A 2VDWA 1OWLA 1TC2A 3DOCA 1ZC3A 2B3TA 2I78A 2P3LA 2WKQA 3KYDA 1E3JA 3UVEA 2QUIA 4AN0A 4EUFA 1U5BB 4MQFB 2A88A 3ESXA 5GINE 5C46F 5BSGA 2ZQYA 5IAKA 4JT2A 2I7TA 2V9ZA 2IW1A 2J3HA 2Y2UA 1Q74A 5KINB 1D7AA 4M49A 5EJAA 3W3AH 2WIJA 5B3KA 4HJRA 3K96A 2R62A 2PBZA 2XODA 2VHUA 4CIWA 1FRQA 1PSWA 2ZGVA 3VNBA 3F6RA 2AL7A 5AOCA 4HB2A 4LJ4A 3RAGA 3PXXA 2B69A 4AMBA 1DRWA 1U0SY 3ASUA 3BFKA 4LZAA 3FOBA 1JH9A 2YVKA 1W36C 4UHFA 1PG2A 5K8LA 2R6FA 1KR2A 4B43A 1YCDA 3KQHA 2XQVA 3G9TA 1HT2E 1BVHA 1P80A 4E1VA 3NWBA 1PAUA 1CJUC 2XVYA 4HUQA 5F98A 1B74A 4BLVA 4UNPA 4EHKA 2I7CA 3B70A 2O3QA 3PNBA 2OOKA 2CVOA 4XIJA 1Z36A 1R00A 2Q2NA 1FP6A 2GEUA 2W6ZA 3EBOA 2QYOA 4NL4H 4YJ3F 1HEUA 4PG7A 4KE7A 3MA0A 4JP5A 5JSZA 4GC5A 4G0ZA 2PWAA 2W8BA 3A9TA 5BYBA 5EAIA 2I2DA 1ORWA 2C94A 2OAEA 5DTJA 1HE5A 4LXGA 4DT1A 4O29A 1SKBA 1O95D 1XCGB 3E6AA 4PZLA 4ZVSA 3R2JA 5DBFA 5H83A 4BTVA 3E4DA 3AUJB 5G0SA 3TLYA 5C8VA 3QU9A 4Y1EA 3DDZX 2A58A 4PQEA 5ITZB 3N58A 2C9MA 5I9BA 1A9YA 1L5SA 4MW5A 1I3OA 1JQBA 2C59A 3CLUC 3S5JA 4C1BA 1UJNA 4G81A 3DYIA 4FOTA 1UDWA 2UUPA 3WKCA 3HDQA 5BSTA 4BNTA 1Z0JA 4MHTA 5HZGA 1IQ0A 3AQ4A 1THGA 1M5TA 3TCKA 2ZB7A 4J90A 4DADA 1FEZA 4Y8VA 1NXVA 4S2EA 5CXSA 4OGWA 5H4GA 1Q57A 3QLVC 3BD8A 4O2AA 1FSFA 3I42A 4JDPA 4P4SA 2C2WA 1IULA 3E3AA 4PYOA 2VQEB 1E96A 2BKUA 2LUOA 1ND6A 1VLQA 4JJ7A 2M6LA 4FCCA 2ZRHA 4H0CA 1IQUA 3ZHVA 3N2EA 3ZHCA 3E5MA 3PXBA 4LMBA 2C04A 3L6CA 3M0EA 4UE6A 2Q49A 2GA9A 3OQOA 2VYVA 2WHEA 2VA9A 1N9KA 2X8JA 5FI3A 2PKYX 2ZS8A 3BMNA 3KEMA 4X65B 2W6JD 4CE6A 3ZWAA 1NYRA 2BP7B 4CLXA 2B9VA 3M82A 5EE1A 3S2YA 1A71A 2CB9A 3DCYA 5HRCA 2LVBA 2JB9A 4PHCA 1K6MA 1J2UA 2PX5A 2R7LA 2QN3A 3KO8A 3N6VA 2JLZA 3VX3A 4ITUA 1JPNA 4XLZA 1TKCA 1YZLA 2P8SA 3E84A 3U13A 3ZQ4A 1W0JD 4RJLA 3QE4A 2P9JA 3TBHA 3WOVA 1Y48E 4MVJD 4U7GA 2I71A 3C48A 5DM0A 4N47A 1OC4A 3WYBA 4HPJB 2CLCX 3UF0A 3X1MA 2JEYA 3K0AA 3KT3A 1JA9A 2JF0A 2PGLA 1Z8NA 3ICWA 1E99A 2QT9A 2IHJA 3B9BA 2NACA 3FROA 2CL5A 2KPOA 3JARB 2WU4A 5GPBA 3TW6A 3GUYA 3PKIA 3HCRA 3MG9A 3WL8A 1YTUA 2WWTA 1W2GA 4J1TC 5HIIA 4EYQA 4G89A 2EFJA 1DG9A 4QOGA 4W5TA 3EQZA 2ZJYA 3C3EA 5KQGA 1JR3A 4X95A 3U4IA 5DJ5A 4W9MC 1M72A 3CW2A 5CP8A 5I5GA 1WW3A 2IDJA 5GJVC 4Q1CA 1ILEA 3AUAA 5DM4A 4BXOB 5T3YA 2G63A 4BE9A 1N1GA 1U3WA 4HSEA 4GWLA 4HYYA 1OGJA 2ZIGA 1JPJA 4HSGA 4MZXA 4Q18A 1QU3A 3BXHA 4C3ZA 2I1VB 1TCCA 3DMGA 2JH9A 3HB0A 4CQJA 3O26A 4FMDF 3DVAB 3NANA 4JI1B 2NPOA 4GU5A 4ZZ1A 1CZUA 5F2KA 1NOIA 2R66A 4JLBA 4BKMA 4CPDA 3M6XA 1Y8RA 4JSYA 2F62A 2Q21A 3CMMA 3BWCA 3FYTA 1U0RA 1U3DA 2M32A 2NT4A 3X0DA 4EUSA 2C98A 4FWTA 2P4UA 3QYJA 4U2KA 3JASA 3ZK8A 3ZIAD 3IJ5A 2Q8PA 4ZT4A 3H9QA 2HSZA 3WHIA 1CS0B 2WAOA 2UVDA 4NIMA 4K6CA 4DJDC 1PT8A 4OXKA 1UKCA 3VOSA 3O7MA 2GPSA 2OBYA 3NBYC 4PSCA 1DTWB 2GILA 1GEEA 5B30A 1WDTA 2WIDA 1R4MA 2W2OA 2X19A 3BMOB 1P1JA 1I5EA 4JNCA 4OMUA 5CVUA 5H5JA 4AICA 3THXA 1K86A 2G5TA 3TI7A 1Y7IA 5CIWA 1W36B 1OIXA 3MVEA 3PD7A 4JA0A 5KB3A 4J4TA 2R65A 1H2BA 2ZCVA 2CXRA 1R0ZA 2PZEA 3S27A 4AUNA 3A1NA 4JHLA 3BCHA 3ZWKA 4DBLC 3O0DA 3TH5A 1QOZA 2XRFA 5IP5A 3UY4A 1S8AA 1VIVA 3UZUA 1KZ7B 3GPCA 1NN5A 2GO7A 4UUNA 2IYXA 3U5ZB 1W5TA 1Y9DA 2W83A 4CT5A 4QUJA 5BVGA 3W8FA 5CEEA 2XJ4A 1S2OA 3IAM6 3DE2X 3QUCA 3GAMA 3GJYA 3KQYA 5A5GA 3WNVA 1PT6A 1KGSA 1NJ6A 1O0BA 1QQTA 5DRTA 1XBTA 2OR3A 5E2AA 4AIRA 2C2ZA 1IN4A 3G89A 1FSZA 3W6NA 7GPBA 1S4MA 5CTJA 9LDTA 1EP3B 3JQRA 2BVNA 3VVCA 4BWGA 3ZZ1A 2ZT6A 3WKEA 1VJTA 3TOZA 3T5TA 1KS2A 1CZOA 5TIIA 4A8JA 3R5XA 1A8UA 4ZV9A 1GUDA 2HRCA 2ORVA 3VR6H 1RVDA 3H6HA 4HF7A 4N5IX 1ZI9A 1MH9A 1NNUA 1FNNA 4GZMA 4CEHB 4FOPA 3FAKA 1I2DA 2DCUA 2HPAA 3R3VA 5FO0A 3FOAA 4M3NA 4WVLA 3UAZA 2DVMA 4C4PA 1PQWA 2NX2A 3AJEA 1KBOA 2P2CA 3I73A 5B1HA 2AG1A 1SOMA 1K8XB 4FI3C 2BGIA 3EMVA 5KWVA 1NQUA 3GIWA 1Q0ZA 2IS6A 2FW1A 4P4GA 5CK4A 4RAQA 4TL6A 4HEA1 4C29A 5FCDA 1MB0A 4U6SA 3KZXA 4M1SA 1Q77A 1AN9A 3BRCA 2AF3C 1OLSA 4BEJA 4HDOB 3PTZA 1A2QA 2JAOA 1DFGA 2QUHA 3IDAA 5EJFA 1A5ZA 1E3DA 1SHJA 1H0HA 5K2MA 3Q41A 2IP4A 2C03A 3TWOA 1L8AA 4CQLB 3LBNA 2D74A 3IIJA 4LDNA 1VHJA 4TT8A 4PSVA 4YBRA 4NG5A 1MPTA 4O08A 2WF8A 3PX7A 2JFNA 4JT9A 4A5OA 3AEYA 2VJYA 1GPMA 1F8UA 3D5EA 2P27A 3I0ZA 4HQFA 3B6JA 4NZOA 2B92A 5ALHA 1GTSA 2GBCA 3FDFA 5JHGB 4QPNA 3NAGA 1N33B 5D7NA 1BIFA 2NADA 4ZIRB 3WYAA 4FYPA 5IYZA 1WM1A 2XA9A 3IOYA 2QZJA 5ALKA 3BZWA 2PX8A 4Y67A 1V26A 2DFPA 1ZJ4A 2EF1A 4MWTA 4TMYA 4B40A 1L4FA 3BH7A 1BE8A 5EUCA 4ZCSA 4DMMA 5JRJA 3ZJVA 3MLEA 5EMKA 3M7IA 2HBQA 3DMTA 3LUCA 4G0UA 4IW3B 1P7PA 3ANSA 2JIBA 2VJMA 3ACCA 4R1MA 3QVTA 4GYKA 3T9CA 4BVKA 4DMHA 4DPMA 4KHZA 3DT9A 1VKOA 1XQYA 1FP7A 1EAMA 5EQTA 2R1UA 1CK4A 1JBQA 5K0BA 2YWBA 4P33A 3M8KA 3RWMB 2QSJA 3TZLA 4ER3A 2WTXA 4FSHA 3BG5A 1PR6A 4US1R 3H5WA 1W1UA 4RPGA 5D6OA 2VJQA 3IPYA 5D2CA 4JXKA 4AULA 2YN2A 1VL1A 2EW8A 2Q2VA 3BIJA 2P4HX 4I8XA 1Q83A 4DCCA 2ID7A 3E8XA 4IINA 1QKJA 5IRCD 1Z2CA 3E7FA 4V0LA 2Z3ZA 5FPYA 1EFPB 4QYTA 1BE0A 3OP4A 2FFAA 4WLVA 1ML3A 2AR0A 1TNDA 1EK1A 1UXJA 1XQWA 2RKOA 3M33A 5IUKC 4A0SA 4URWR 2FDCA 5KYGA 1SB8A 4I4TA 3LLCA 1QVWA 4R1LA 1R8YA 2QLLA 3FB1A 3JD3A 1OWPA 2ZJOA 1EMDA 4LXUA 1MAWA 2O1SA 3CLRD 5C32A 2A4MA 4Z4QA 3TTVA 4IGIA 2N0SA 5LZ8A 4CIAA 2FZVA 2PWYA 2P2YA 2UZ0A 4YCAA 3T0IA 4ECAA 2FPPB 3OKFA 1MGPA 1ZD2P 5JC8A 2OLKA 4MCAA 3TZEA 1M2NA 1OIVA 3LIIA 1U0FA 3V00A 1Y7PA 3DL2A 2RGDA 1D2CA 2WWIA 2IE0A 4ILKA 4WCFB 3WFZA 1S01A 2C61A 4GI2A 2YVUA 2N3ZA 4DRXA 4BO4A 3WMXA 3NI2A 4MUNA 3TLEA 4D4MA 2XLCA 3S4YA 5EMLA 1V96A 4GOXA 3FSRA 2VYND 1L4MA 1LNQA 3AMVA 3WNCA 4P4LA 2JGKA 4JX9A 4CKWA 4J49A 5I9NA 2DT5A 4KDRA 2F1RA 3DE6X 2WMOB 1SKQA 1XNRB 3FVTA 2J3JA 3ROEA 1DQZA 2ZQZA 1FNCA 1YRQA 3VBEA 3RHFA 3I2IA 2PPVA 1HG0A 2BONA 1GV0A 4PS1A 5DNVA 5FADA 1DO8A 2Q4TA 3L4JA 2V6MA 1V1MB 1YJQA 1L5MA 3KEOA 4U00A 4RU1A 4FYVA 2CLSA 1OSNA 1XRQA 2AN4A 1L4BA 5KNDA 1XNJA 2DJIA 4QBKA 5JAIA 5CITA 1ZK2A 2C2OA 3H2IA 3JQ9C 1HYBA 2GM5A 5LDDC 1JHOA 1WPGA 3SHFA 1SKYE 5ALMA 5JE8A 1FC0A 2M9MA 4UTOA 1WO8A 2W5UA 5FBRB 5BSHA 2CVPA 2QN7A 3B9PA 3L4BA 4JROA 3W2IA 1V5WA 5AUOB 3FZGA 1KFCB 1THZA 2IS4A 8ABPA 3CEPB 3NP9A 4Z6KA 1RBMA 1DADA 3T0GA 4XLLA 3A2NA 3KQWA 4ZYUA 4BQOA 1KI7A 2A1TS 2VVTA 2CLMB 1QKIA 2XE4A 1ST3A 4M83A 4PVDA 4B4KA 3ED5A 3AHEA 3L46A 2Y1XA 4RSHA 2H48A 4YREA 5U4XA 1YKFA 4P3YA 3EMBA 2RSLA 3EODA 1HLFA 4HWKA 4M37A 3AY6A 4ZEXA 5LDGA 1WMBA 3CQ9A 1IAQA 2F1IA 4R9UC 3TSCA 4DLWA 4YQFA 5BSEA 1Y6ZA 4HMOA 4Q24A 1B3BA 2P9YA 3NMUF 5HF5A 2VPWA 1SBNE 5AI6A 3TZKA 1Y6GA 2R8RA 1F17A 3RANA 3IDSA 2Z2XA 1RC8A 2Q6LA 1JYEA 1Z15A 3TNJA 5K20A 3M4JA 4BFSA 1FW6A 1J0DA 2VCHA 2Z6QA 5AXAA 3B52X 4O0LA 1Y1LA 3KCNA 3T1NA 4WJKB 2ZROA 1ZEJA 1J1IA 4UXIA 3AF6A 1E6WA 3EXEA 4TXJA 1ZJJA 1TD1A 3RVRA 5DLQC 4I2NA 3VPBA 3A05A 3EG9B 5FA6A 2QTVA 2X7HA 4DJAA 4PO9A 2ZI4A 3PC8C 5IMBA 5LA6B 3SHQA 3L3BA 4XYBA 1LF0A 1AY0A 4L8LA 4N5LA 3AYZB 3OOSA 2IV7A 4QDKA 1QYVA 2X4DA 4G56A 3T15A 2AJLI 3H2KA 2WJ4A 4XE5A 4UJ3A 4WY8A 4WE3A 3F5QA 2O07A 2HI0A 2IZ0A 3AZPA 4MI3A 1NOKA 4UM8B 4F2PA 1Y7TA 4I6EA 5HK8A 2XMZA 3TG2A 4YT2A 2FCAA 2ZUFA 3QRWA 4OTZA 4PAOA 3BMNB 4P7JA 1J5XA 3RUPA 3RRFA 4AJ9A 1LH0A 4AUMA 2JAPA 1T2FA 5F3WB 4GKKB 4EW3A 4X6UA 3K31A 4M2LA 3F97A 2VAPA 2G0NA 1BE6A 5HPYB 1RHRA 1CVIA 3AR3A 2HA2A 4BFCA 4OJMX 1J4AA 3C7DB 4NCAA 3PE6A 2GRUA 1LTHR 1V5EA 5IYZF 1F9AA 4AJ2A 1X1BA 3AL2A 4O2AB 3EVFA 4YRPA 1WV0A 1S1MA 3MMPA 1T9GR 4H0NA 4QXAA 3DKKA 5EJ2A 3BQNB 1EDBA 3MGGA 4I5EA 4DSAA 4L9AA 4KVAA 2ZSBA 1KI9A 1ISHA 3AR8A 3DXFA 2FRXA 5FBHA 4ZVKA 3T52A 1UEIA 2Q3LA 2WJPA 3EF3A 3EPPA 1OZGA 2FE4A 3KBOA 4FD3A 4OIFA 4QUBA 3SQDA 3HRHA 1WQ1R 2AWOA 3CUEF 3NRJA 1P0QA 4JB0A 2JW5A 2W2TA 4J07A 4J0GA 2QP9X 1YA4A 1JIXA 4XYLA 1QX3A 2FWIA 3QPDA 4FFDA 2AR9A 1A4RA 3NYWA 4HN9A 5KYYB 1KHTA 2VXBA 2XOKD 3O3MB 4PSDA 2YVLA 3ESYA 3DH0A 4PFSA 1HG1A 4UHJA 3SIRA 2VDNB 3R5JA 5LZ5A 1SBCA 3CH6A 5CB0A 1G20E 1T6ZA 1PI3A 1RQ2A 1VPEA 2XYGA 2BBWA 2GD1O 3IE2A 3FRJA 4FMBB 1PGQA 4MDEA 2PNFA 3TRKA 2OOSA 3TQQA 4Z51A 4RPKA 1B6RA 4EA6A 1HDCA 1OBOA 3OQIA 3PKJA 4ER6A 3V7YA 3FETA 1L7PA 1K66A 4BJ3A 2IEZA 3HU1A 3D4BA 4K26A 4UBMA 1CSEE 1HM5A 4D6XA 2OM2A 5GOZA 3B1FA 1YDMA 3PDWA 3R76A 1SCDA 4RA9A 1BXGA 5CU7A 3OZEA 1KZYC 3T99A 4MV9A 1JDBC 3CKYA 4MV4A 4B7UA 4MEJA 2OV6A 4BQNA 1P7WA 3W78A 3R6LA 1KWKA 4U0JA 3EZNA 2IUYA 3TBKA 4B8YA 5C31A 1JYSA 3OT4A 3MLBA 4JI2B 2J59A 4HYTA 1ULAA 2V9PA 4PTLA 5CLHA 5I8PA 2ZWOA 1J9EA 4RTLA 3RRMA 3HBFA 3LQKA 2Y1OA 3IBTA 3Q3GE 1CUJA 4GVXA 1X1DA 4KNVA 1TT7A 5DDIP 3EGXB 1EGQA 5GGXA 2EYUA 5I7EA 4IIJA 4Q82A 3QWAA 3WRWA 5FWXA 3GU3A 1ZA1A 4FWIB 1QGYA 1VIMA 1GZVA 2R8ZA 4AMUA 1KI6A 4HS9A 4L4XA 4P9NA 4LBWA 2NV2B 1WXXA 4Q1EA 4Z9BA 2GLUA 2H2FA 4PYJA 5ADWA 4ARBA 1QIHA 4QREA 3KWFA 1HH4A 1RYHA 4XIFA 4GI3A 3ZZ0A 4BGDA 2PKXA 1QFSA 3QI2A 1RAAA 2PU5A 5CW1A 3RHTA 1N1MA 3DBRA 3AI3A 1CKEA 3HJGA 1KMHB 2CMFA 3K0AB 3OIFA 4XM1A 3T4PA 1DX9A 2D2XA 1NXPA 2VP3A 4LI0A 2QTVB 3GMIA 3F7TA 3QEBZ 2HMVA 3KVVA 1FS6A 1J9ZA 3CBQA 3B1JA 1LXCA 4Y6SA 4H6VA 3CY6A 2JGLA 4WESB 3BRWA 1VECA 3EXIB 1UXOA 3OJXA 4AURA 1MRZA 1VE9A 5A62A 3LA8A 4A4DA 1SOWA 4NBNA 4W5NA 5C4GB 3KTAA 3OX1A 3VTZA 2DRIA 2EKDA 3I01M 1QGDA 1BG6A 1JHRA 1NLZA 3N8GA 1M74A 1RP7A 4MW6A 4NBWA 4AZSA 4N76A 1JMVA 1O94C 3GH1A 3WISA 1M2OA 4HV4A 3H16A 1D04A 2YIJA 4M1EA 5D1NA 2RH4A 1NNLA 2J9RA 5SV2A 3F5MA 3WE7A 3U3KA 5ALSA 2ZUWA 4D9CA 3ZZTA 4O5OA 4YO7A 4DXDA 2ZTLA 2QTRA 3VJRA 4KYIB 2CDAA 4G0WA 3FDIA 4ESEA 3ZHZA 5GONB 2GQ0A 4TKUA 3W8EA 2A4KA 1Z88A 1T5LA 2C1XA 2F59A 2PGXA 5KCMA 1HTBA 1T8TA 2VPPA 3LKVA 4RM3A 1R8SA 1WP4A 4QWMA 5CCXA 4OOEA 4EPTA 2NYUA 2D2EA 4UBNA 2D4AA 1AU9A 2PFSA 1GDDA 1HURA 4S1NA 5E1BA 4PO8A 1NHGA 1ECGA 2CXXA 1X7DA 3E8MA 3QMVA 4PRKA 1ORHA 2NVUB 5JH7B 1B6TA 2YVQA 3PHGA 3W1EA 4FE3A 1SFRA 3IAM1 4NAVA 2I3BA 4ZP1A 4EG4A 1VCHA 2O7RA 1Y1SA 5I7VA 2YBDA 4EEKA 1C0KA 2BTEA 2V4MA 5CLQA 3ZJUA 1O08A 3VO9A 3O8DA 5DK4A 3QUBA 2HK7A 3N07A 3ZZNA 1J2EA 3O1IC 2VOJA 4GQIA 3GN2A 1EM6A 4REQB 4S0ZA 4A9AA 2QJOA 4YRLA 1T1JA 2JBAA 4FX2A 4D6PA 1SVOA 1T3GA 3P1JA 2JCBA 1OMOA 2Q1UA 3D2BA 3EUEA 5TPZD 2XITA 3URKA 1WW2A 2C5SA 3ELWA 2QTWB 3IP6A 1OPRA 4DM4A 9ATCA 2ZJ8A 2BGWA 5EVCA 5CPBA 4BMPB 1BFUA 3RYIB 4CTMA 5HE9A 4XVRA 1QF7A 4MPPA 4ZWNA 1ADFA 2ERYA 4U5XA 2XEXA 1U11A 3D0RA 5K5EA 1U7WA 4JP8A 1NASA 1RQPA 2OZVA 2X9VA 3O2QB 3GA0A 1A50B 3GNLA 4GLOA 3K05A 4TN5A 1XTTA 1QQ6A 3DV9A 1WDWB 4GXNA 2OM6A 2H0RA 3ESQA 3GJTA 3RJ5A 3A6JA 1DC6A 1T9KA 4Y9DA 1WZEA 4IFBA 4QU5A 1XTZA 3PSHA 1JAHA 4IZIA 4QAQA 3NJ8A 3LX4A 5BW4A 1YDFA 2FI1A 4S1TA 4RSMA 4YR7A 1O0SA 1PV1A 2XKJE 3NGXA 3EDOA 3MPUA 3GEHA 4Q3BA 4RLQA 4AF7A 1IPHA 4LTMA 1YZVA 1QP4A 2A94A 3Q8XB 3R3UA 2VBCA 4JCCA 1KOGA 1EFDN 1EWRA 1BX3A 1TYBE 2ZK7A 4HAVA 4QL3A 1TCAA 3RTDA 3FNEA 4LGMA 4RLFA 2JNWA 3TO5A 4AP9A 4CODB 4A10A 2XQJA 2BH9A 4KIWA 4W99A 3Q3IA 3T35A 4GBGA 3V4ZA 4AO6A 1UK9A 3BL5A 1GZ6A 3HXQA 1M33A 4LKOA 4AYWA 3GCZA 3LO8A 4ZI2A 4ZO8A 2WD9A 4W82A 2O50A 2XECA 4CWAA 4HPWA 4C0XA 3MGAA 4BZQA 1ZNYA 4YI3A 3WHKA 8OHMA 5KI6A 3V2IA 2H2WA 4TN1A 1PJBA 2IYNA 1N8NA 3ZYZA 4ZXPA 3FFTA 1QQ5A 3KHKA 4M4SA 1KBZA 2GJAA 3AOGA 3JPYA 5D86A 2PJRA 1SRQA 1Q1GA 4MH0R 1QMPA 1XIVA 3CNOA 3RVQA 1IZ0A 3ILYA 4P5PA 3KC2A 5DIZA 4JN6B 3UJBA 2OG1A 2AC2A 1I0LA 1BEEA 4RVGA 3BWXA 4B31A 4BO9A 1ZH0A 2IDMA 2ST1A 1X7XB 3CX6A 4B2YA 4ENVA 5J2TF 1K5GA 3I8XA 3UAOA 5IKMA 5JBIA 2H1FA 5DIFA 1JU4A 4O2BF 4IYJA 1NVTA 3EHEA 1R88A 3EPHA 1MHTA 1LV8A 1YHZA 5SYNA 2P1RA 4PG8A 4XYMA 3IUMA 3L1KA 2G0AA 1L7AA 1VKNA 1N5RA 4X6XA 3IYLW 4RGBA 2YH2A 4WV3A 3I9KA 1OKKD 4RTSA 3QYAA 1I36A 1KE2A 2AOUA 4B85A 3BTVA 5K8VA 3C5WP 3T3DA 3C14C 5WRFA 3ASYA 3LKZA 2FN4A 4W5OA 4Z4FA 4C0QC 3L8DA 3I64A 4XVUA 5IM4A 3CS3A 4JFAA 2L2QA 4AK9A 4IFIA 2VDMB 1RAGA 2GJKA 1U5BA 4MQFA 4DBZA 1KOJA 4D9MA 2R8OA 1SXJA 5FHQA 2G04A 4F8EA 2GN1A 2F9FA 5GP1A 1DI0A 5EWJB 3BQ9A 1IHYA 3I4CA 5IJ0A 4H7PA 1Q2UA 2Q9CA 1UMBA 3E9RA 4S1OA 1CFZA 1R10A 4Z1OA 1NBEA 2CJFA 4BP8A 3U16A 2PMKA 4KLNA 5CGQB 3NW9A 4E13A 3FPEA 4W1PA 3IKLA 4UQO