3RUEA

Alternative analogs as viable substrates of udp-hexose 4-epimerases
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WbgU
publication title Alternative analogs as viable substrates of UDP-hexose 4-epimerases
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
total genus 122
structure length 336
sequence length 341
chains with identical sequence B, S, b
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rueA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3rueA02
1X7DA 2FSSA 1NQ5A 2Y99A 3FF4A 4R01A 5CPBA 1WMBA 3WGTA 3LT1A 2UDPA 4OXYA 5A9RA 4RZHA 1I3KA 4J1SA 4S1VA 4WCFB 3ZNPA 5CPFA 3DZBA 1YOVA 3RFVA 3HB5X 3D3WB 4ZQFA 3PGJA 4WK6A 3RBVA 2ZYGA 1SCUA 3EHEA 3GZNA 1KY5A 5EIOA 5G0SA 4H3VA 2EHDA 2VNSA 4EEZA 2WE7A 3AI3A 5COBA 3TZKA 3V8BA 3GNTA 5BSFA 1EMDA 2DBVO 3B20A 2O7SA 4R41A 1QMGA 2B69A 2BH9A 4IQ8A 1KVRA 3LLSA 2QRJA 4EI2A 3SLKA 4R3NA 2I5PO 2JAPA 4XQEA 2JFFA 4F46A 1UXHA 4WASA 2EGHA 1YQDA 3E03A 1LLUA 5JDIC 3I1JA 4TVBA 1I2ZA 1LRKA 4HV4A 5GY7A 1E3JA 3PDUA 3E8XA 1WWKA 2Y68A 1Y5RA 1HE2A 3FR8A 3IUPA 3WGQA 1DAPA 1E6EA 4AJKA 4W7IA 3I9JA 4CR8A 3HN2A 3P2OA 1LQTA 4DUPA 1T24A 1EUZA 3Q1LA 5F5NA 5B37A 2ZKLA 4E4YA 3KXDA 1V6AA 2Q2WA 2C59A 1WDKA 4UREA 2AQHA 1WW8A 3W4IA 2BI8A 1I10A 4YAJA 1IZ9A 1DRVA 3RROA 5AQ1A 1JVSA 4AVYA 1AE1A 4I5EA 1DIGA 2VZ0A 3D5QA 5GZ1A 4WECA 3U49A 1FF9A 4WLUA 4UVGA 2C2YA 1XIVA 5JSFA 4P4NA 3PFFA 3RC2A 4MPDA 2IXBA 2J3KA 4R68A 3VZQA 4BGVA 2EKQA 2NLOA 1GPJA 1HSOA 1JKIA 3BMQB 3T7CA 3GK3A 4GPD1 5JBIA 4FFRA 4Z0PA 4GX2A 3ZWXA 4FGSA 1D7OA 3L9WA 3M1LA 5THQA 2XPCA 1NPDA 1ZNQO 3S2IA 1UXIA 4E2ZA 3NTOA 3OIGA 2ZB8A 4UEKA 5DULA 5L7YA 4RORA 2I76A 4ITUA 1C1XB 3T7EA 5A4DA 4QUKA 3LC7O 1DLJA 3PWKA 4O63O 3UGKA 4HP8A 4GLOA 3TOZA 1UXGA 2ZYDA 2EERA 3C7DB 1ENZA 4J1QA 3Q11A 3ZCXA 4URFA 4BO2A 2YHIB 3LF2A 5A02A 2AEMA 3D3EA 1ISHA 1F8GA 3P19A 4YACA 4EW6A 4XR4A 3TL2A 1GADO 1P1RA 3C85A 4GQAA 2W8ZA 3L9XA 4H7PA 1M76A 1ZSYA 4BNKA 1H5QA 4CM3A 2R00A 1NNUA 2EIHA 1DOHA 1NVGA 5KVQA 3R0IA 5IG2A 4MKZA 5KTKA 4E5MA 1I2CA 4RL6A 1KC1A 1NR1A 4E12A 4ALIA 4D43A 1LTHR 2GN4A 4PG7A 4QTZA 4IGEA 2JJYA 2JL1A 4I9NA 4XQCA 3A9WA 1DIRA 1PQPA 3CZRA 3EDMA 1SOVA 3K8ZA 4HFRA 4O59O 4HY3A 2PGLA 1ZJYA 2RIRA 4BO8A 4E33A 2IZZA 2NQ8A 4J4HA 2OXIA 4D46A 2I67A 4Q3EA 2Y0DA 1XELA 1TVEA 2YHUA 4PLPA 1IOLA 3GDGA 3QA9A 5C7OO 1E77A 1P31A 2C07A 5CEEA 1LSSA 4NPCA 1MP0A 5A06A 1KC3A 2AQKA 4TKLA 1RKXA 3VDRA 1BW9B 1DRWA 4JXKA 4RLSA 2PGDA 4GSLA 2AA3A 4RF3A 2QZ9A 4KQWA 2NM0A 4IDGA 4OOEA 4X54A 4RPHA 5AXBA 3B1FA 4J9UE 3D64A 4KOAA 1Q2XA 3AM4A 1O6ZA 3PRJA 1YQGA 3ZNQA 3W1VA 2D3TA 4OJNA 4K6CA 4BNVA 1GUFA 1IZ0A 1U3VA 1PR9A 1Z82A 4WE3A 3HFSA 1GUYA 1KS9A 1I01A 1QP8A 3RKUA 4K28A 2BGMA 1HL3A 2X4GA 3DTYA 3PP8A 2NACA 4PVDA 1R4MB 3JQ7A 3GVCA 4CQMD 4CL8A 2ZJ0A 3PVZA 1LDYA 2NV6A 3AU9A 4YVFA 2CVOA 3ZN2A 3ZU4A 3BIOA 4AL4A 3O26A 3ITDA 4AJIA 2Q46A 1ZXBA 3X2EA 4MVJD 1YONA 4NK5A 5JAQA 1HDRA 2EJVA 2JAHA 4WCFA 2VYVA 4L76A 4I5FA 3DO5A 3E48A 1PZHA 3D3WA 3DQPA 3ASVA 5G0TA 4UVEA 3O8QA 2OHXA 3TN7A 4DIOA 1VL0A 1E6WA 3WMWA 4DPLA 1YWGO 2O3TA 4CLXA 4PCVA 3IC5A 4XD2A 2O3UA 3MJCA 3DOJA 2Y93A 3PQDA 4Z3KA 1ISIA 4OMUA 4WLNA 4FQ8A 1M2WA 4AJ2A 2O50A 4JBGA 1DSSG 4FFPA 1JKJA 3BMOB 2DBZA 4P22A 2J5QA 2ZB3A 1J4AA 1I0ZA 1Y7TA 3E82A 3GG9A 1ZIDA 1U1IA 2C7VA 5JYEA 5IDQA 1D4FA 1J49A 5I9LA 2YQ5A 1K5HA 2B4TO 4K26A 1ADGA 3DBLB 3K2EA 3GFBA 4E32A 2GYYA 2HJSA 4D3DA 5BR7A 2DPHA 1NHWA 2ZIZA 1G0NA 1HWYA 2YV2A 5EINA 2GLXA 3ONFA 1DXYA 1VL8A 3AI2A 5JMWA 4RF4A 1PZFA 3DFZA 3RJ9A 3WLEA 1RPNA 2VHZA 4J16A 1EFKA 1Z75A 4JIGA 5A9TA 4UUNA 2AW5A 2Q50A 2H63A 4YPOA 1XLTA 1XQ6A 4LRSB 4CM1A 4CQLB 4Z0TA 2VHVA 5DF1A 4INAA 3EYWA 3BMQA 4JP2A 4BNIA 3OP4A 3PIDA 3ZDFA 1VJTA 1HDGO 4W99A 5IAAA 1P3DA 2FPGA 2HLPA 1VRWA 2DQ4A 3AFMA 3HDHA 1BXKA 1UP4A 4PLWA 2ZB4A 4PG6A 4ROSA 4R69A 4WGGA 5JXWA 2AE1A 1O5IA 1C1XA 3H3FA 1N7GA 5I8ZA 1TA4A 4BV8A 1Y9EA 7MDHA 3ICPA 1K6XA 1U3WA 1SPXA 3I83A 1JTVA 2VWPA 3DHNA 4TRRA 5T8KA 4H15A 3WNVA 2RHRA 2NU9A 3G1UA 1PJ3A 4ZQEA 4ESOA 4NFSA 1V3TA 3ROQA 3LLVA 4IDDA 4XIJA 4KDEA 3WGGA 2HMSA 3RUAA 3VH3A 4J7CA 3H2ZA 1T1RA 4DBZA 3HB4X 1AUPA 3ZHBA 3GUYA 5DBIA 3WQQA 1U2GA 3I6QA 3OQ1A 4CJXA 2PZKA 1Y8RB 1SO8A 2GD1O 3CE6A 3NX4A 2HJRA 4JK3A 4AJLA 4ZRNA 4L0QA 2BMAA 4IIUA 1ORRA 4FJ0A 4D7AA 2CY0A 2FR8A 4IS2A 3WYBA 2NVUA 4ZQHA 4BNJA 4LN1A 1ENYA 2EJWA 4JCOA 5KJFA 4FPXA 1P1FA 4CM4A 3LDHA 1ONNA 3H9JA 2AG5A 4QT0A 2BFOA 3H65A 1SOWA 1HEUA 2X0IA 3FCOA 3W4JA 2DAPA 2AEJA 1E92A 4JN6B 1XG5A 1P1HA 1ADCA 5A1TA 2WYWA 1WDLA 1BVRA 4YT8A 1JDJA 4YJFA 1UXKA 3ICCA 2P9GA 3FWNA 1XHLA 2X1HA 1CQIA 1LC0A 1MA0A 4RPLA 1UZLA 4LMPA 1JU9A 3IAHA 3VDQA 1SEPA 5HTOA 3I23A 1EK6A 3DAGA 4W9NA 3HDQA 3OSUA 2QRKA 3HHPA 6ADHA 2PA3A 2BRUA 1WPQA 4BO5A 2Y1DA 3OHSX 3B6ZA 1MLDA 1G6KA 4YJGB 2B4RO 1GYQA 3GZ4A 1XWFA 5LCXA 4KUEA 3RCBA 2NU6A 3Q9UA 4XGNA 3S1LA 3ZU2A 4E31A 4PN3A 2FZWA 5JY6A 4UUPA 4OXNA 4XB2A 2XF8A 4FW8A 4BMNA 3OF2A 1NX6A 3WLFA 1N9GB 3P5SA 2P91A 3ZWAA 4NFHA 4G81A 4DIFA 4D0RA 1CRWG 1GYRA 4A10A 5I9MA 1R4MA 4I9HA 1J5PA 3D4PA 1ZK2A 2J5KA 2PR2A 3U5TA 4NIMA 4BNTA 4XRRA 1CQJA 1KVSA 3ZHZA 2RBEA 4XQ9A 1QYXA 5L95A 2CDCA 2P4QA 3H7AA 5KOIA 1W6UA 1XKQA 1E3WB 1H93A 4KQXA 3WSVA 1LSUA 1C14A 1NAIA 3L6OO 4PRLA 2RHCA 1QLHA 4NJMB 3NGXA 4U5QA 3GC6A 1B3RA 3NJ4A 3WS7A 3QHAA 4IJWA 1C0KA 4P4LA 3VH1A 3A14A 3EMKA 1XU7A 2UUOA 1KEWA 1SBYA 2X7HA 4A0SA 4GAEA 1MUUA 3NDJA 1YJQA 4PG5A 3JQAD 4NBRA 1GUZA 3M2TA 2Q3EA 3MJVA 4FJ2A 2EG9A 4YRBA 1YH3A 2FPPA 4PLGA 5CDTA 1PWXA 3PZBA 3JQFC 4N5MA 3W6UA 1E7SA 1IY8A 2A92A 3KYDB 5IF3A 3NT5A 3A4VA 2JD2A 3GNQA 4FIZA 2GN9A 3GY0A 2HRBA 4WNCA 1HDYA 3KSUA 3KYCA 2GZ2A 5J23A 4CMGA 1TXGA 5DBFA 1HDCA 2YV3A 3DBLA 4TMFA 2VUSA 3PJFA 1LEHA 2HKIA 3IS3A 3ADOA 4E2YA 2JCXA 3F6YA 5ILOA 3RAJA 1FDUA 5TS3A 4IXWA 3ZV5A 1ZFNA 2I9PA 1PJ4A 3E9NA 4BMSA 2DUUA 3BHMA 5IJZA 2YQ4A 4J43A 4OQYA 3QRWA 4IJKA 1U5CA 3V5NA 3QVTA 2A4KA 3ANMA 3LZ6A 2PKQP 4CV2A 1B3BA 3I52A 4G65A 4BO3A 2Q4BA 4B3HA 1TLTA 3GUCA 4ZICA 3DZJA 4L75A 1M66A 5EERA 3INRA 3DZIA 4J7UA 4CQLA 3I6IA 5LDHA 4TZKA 1EVYA 4TVOA 1ZW1A 4M87A 3D1LA 1YXMA 4EYEA 1ZMTA 4YTEA 5ADHA 3WNQA 1C0LA 4GMFA 4QEDA 3ABIA 3DDNA 4GWKA 4TKMA 5IXYA 3RKRA 3HE3A 1SAYA 3JD4A 4XCVA 1BWSA 4M49A 1Y81A 4U8GA 4OL9A 1QRRA 4Z6KA 3JQ8B 4YB8A 4IDBA 3EY4A 3INGA 1YS4A 1C3VA 4QO7A 3PYMA 1GFSA 2EXXA 5MGBA 3I4FA 2G1UA 1HZJA 2G5CA 4O5OA 1GV0A 4Z9XA 2PNFA 2W2LA 1MXHA 3PLNA 1K6JA 2F00A 3GRPA 5TGDA 3DBRA 1NWHA 3NJ8A 2DT5A 4LCEA 2VN8A 1R4NB 1WLYA 2J6IA 3ZWCA 3RC9A 3L6EA 3JV7A 1IPFA 1UAGA 4IM7A 3C24A 1NVMB 1U3UA 1KERA 5LDGA 3TWOA 2EGGA 2VZ8A 3PHHA 1Y8RA 4MVJF 5TQVA 1L7EA 3MJEA 2OP0A 1LDGA 2QYTA 1BMDA 1FMCA 3FBGA 4N54A 4NJOA 1MV8A 2PD3A 4FN4A 3RBZA 4DMLA 3O4RA 2QYSA 3D4OA 2YDYA 4Q3BA 3TFOA 3ZHXA 3OQ6A 4PZEA 2J3JA 3WYCA 2YUTA 4R1UA 4XA8A 3PJEA 3MEQA 2ZB7A 1QXSA 3WIEA 5T6BA 3L07A 2GCGA 5KCZA 4FS3A 2A9FA 1OOEA 2AXQA 3AY6A 4CM9D 1MC5A 3LSYA 2VCYA 1YL6A 5FFFA 4WPGA 4DYDA 2PK3A 3O38A 3H3JA 3H9GA 3Q6IA 3UOGA 2NVBA 8ADHA 3DL2A 4NR0A 3ZWMA 2E48A 2JHGA 5HWSA 2FZEA 4OYRA 1ZK1A 2O3JA 3I4CA 3RUEA 1NFRA 1LLCA 1XR3A 2O23A 1A9ZA 1ZK0A 3V2HA 2BKAA 3WICA 5BSEA 3T4XA 4RGBA 4YRAA 1IPEA 1DC5A 4MINA 4BGUA 1L1FA 1OC2A 4LRTB 1T26A 4YJGA 2PD6A 4MVJG 3U0BA 4E5YA 3C8MA 3E9MA 4OSOA 1K2WA 2GPTA 4B8ZA 1NHGA 2PZMA 1MB4A 3WTCA 2JCYA 3E5MA 4DLAA 1N2SA 3DZFA 1BXGB 2NADA 3EZLA 3ZV4A 4CLOB 2IYPA 4B7UA 3O03A 2B5WA 3PGXA 4RVGA 3JYPA 4D45A 2C0CA 3AM3A 1HLPA 2Q4EA 5AVOA 1UP7A 3ZU5A 3UF0A 4BHTA 5FEUA 3U9LA 3NRCA 5ITVA 1Z6ZA 3NDIA 5A03A 3PQEA 1AHIA 5DOZA 3I9NA 1U9JA 3N58A 4HKTA 1H6CA 5JAIA 3CXRA 4BMVA 1I36A 3W4KA 4Y67A 3TZ6A 1E3WA 3F3SA 4WLOA 5TLSA 4CQMB 3WGZA 1FDWA 1DDOA 5F3RA 4NJMA 1GTMA 3FTNA 2HMTA 3ZWNA 4B4VA 1EVZA 3RSHA 1DC4A 3VPXA 2PZJA 2WD7A 4OOFA 4R9SA 5BNFA 1NP3A 3FPCA 4M8SA 2I99A 1HE5A 2E6UX 4Z0HO 1KEVA 5FI5A 3RU9A 4BGEA 1EVIA 3WWZA 3WBBA 3QWAA 4BGIA 1ISGA 1W4ZA 3G3EA 3H2SA 4RV9A 4W7HA 3PHJA 2DBRA 5K0ZA 4JBIA 3FWZA 1ONPA 3JQDA 5BNTA 3BTOA 2GO1A 4CMIA 4MJLA 1EE2A 3JQCA 3DXFA 2G0TA 5JPIA 1YDEA 3H9UA 1RWBA 4DA9A 3WB9A 2GR9A 3HDYA 5L7WA 4LGVA 2YY7A 4BO7A 4WLFA 1U7HA 5JDCA 5IN4A 5CG2A 1CEQA 5DBGA 1B0AA 3QWBA 4YDRA 2PD4A 3VPHA 3AOGA 1GEGA 5GMOA 1ML3A 2NTNA 3H5NA 4AJ4A 4F6CA 2IZ1A 1PGQA 1WNTA 3FR7A 3W6ZA 1PJSA 1WP4A 1BTOA 5DZSA 3ENNA 5HRUA 1DHRA 3SJ7A 1LDNA 5IZCA 4GL4A 4NBVA 1T1SA 5B4TA 4AJJA 2BHLA 4RVHA 4EUHA 2PH3A 1CETA 4F6LA 4BB6A 4XYLA 1P77A 5TJ9A 1SZJG 3F9IA 4RDHA 2FSVA 4XKJA 1S6YA 1W73A 3Q2IA 4F45A 1A4UA 5F21A 3S2EA 3GGPA 1Z7BA 3GEMA 4KTTE 4NI5A 4BO4A 3RU7A 3GOHA 4RPJA 5TJHA 3EC7A 3GEGA 4II3A 1T2CA 4Y6RA 5JMPA 2D4AA 5LC1A 3B1JA 2Q2QA 2RH8A 4IQGA 3BA1A 2LDBA 3JQ8A 3IQDB 4NQZA 2O4UX 3GR6A 4D44A 1CDOA 3ST7A 2V6BA 1CERA 1KETA 4BQPA 4DIBA 2CFCA 4I5GA 1F06A 4BNZA 4D41A 1UH5A 4ALLA 3VOSA 2CUKA 2I6TA 1Q7GA 1DC3A 1ZO8A 5G4KB 1DPGA 2SCUA 3ZI0A 5JCJD 4W82A 3FNHA 3PIIA 5DDIP 2Q45A 3H4VA 4UVDA 2OBNA 1PJ2A 2PV7A 1R4NA 2OFPA 5ICSA 4IUYA 1PX0A 4UEJA 2X9NA 1DO8A 4CV0A 3TZHA 4NBWA 1ARZA 3G17A 1LLQA 1I3LA 2WEKA 4M89A 4TSKA 3QE3A 2O4CA 2X0RA 3FHLA 3BMNB 1VPDA 1HSZA 1CIVA 1U3TA 1YGYA 5DN9A 4WCDA 1CJCA 1O95A 4MP8A 4OO3A 1U4SA 2OUIA 4K6FA 2Q1SA 1N5DA 3HWRA 4ALNA 5KJCA 3ETEA 1M75A 4WLEA 3IDSA 1VSVA 2VWHA 1VE9A 2NTJA 3SVTA 4MIOA 2C29D 3GPDG 3QLJA 3WDSA 4XDYA 1ZEMA 1FDTA 4CMEC 1E3SA 2FWMX 4ZGWA 3GHHA 4I08A 3ONEA 2NU8A 4DMMA 3JQBC 4Y6PA 1P1KA 1ZCJA 4BO6A 4CMJA 3GAZA 5KIAA 1TT7A 1G1AA 3GT0A 4FOOA 3TDKA 4CMBA 3UHAA 3RUDA 3BMCB 1ZKMA 4MO2A 1WAMA 4GGOA 3UFXA 4GMGA 1PGNA 4WKGA 1BG6A 2VYND 2Y1CA 1E7YA 1MG5A 5U1PA 3ROMA 4J9VA 2NUAA 3OQBA 4PLZA 3PHLA 3PWZA 3X2FA 5AXAA 3RUHA 5CHEA 3V1TC 4Z9YA 1A7AA 2I65A 1QYVA 1MFZA 4R51A 4HXYA 1LDBA 3JQGA 1BSVA 3OA0A 1JA9A 3GAFA 4YCAA 5I7SA 4YJDA 2QG4A 2GUGA 4DQVA 3Q2KA 1BXGA 5KVCA 4DGSA 1AXEA 4CM5A 4E0BA 2W2KB 3KTDA 1EZ4A 4FBGA 3GA0A 2JCVA 3DHYA 4HUJA 5DT9A 1PZGA 4CUZA 1GEEA 4IINA 2DLDA 1AN9A 1H0KA 4B3JA 4CPDA 1BHSA 5HBRA 4RVSA 4DREA 4WJZA 1HETA 3AM5A 4XJSA 4CQMA 1ZZEA 4YYZA 1BXZA 1PR3A 3A06A 3IMFA 2G76A 3LC2O 2EP7A 3U4IA 3Q0EA 1MX3A 4EJ6A 4DC1A 1XCBA 2NTVA 2Y1OA 2P9EA 5HS6A 1JVBA 4AJEA 5JW6A 3I5MA 3DC2A 1H9BA 1NFFA 4Q3AA 4IIVA 1EBFA 4A27A 4C7KA 1LRLA 3U09A 4O1MA 3JQFA 5BT9A 2X86A 3H8VA 9LDBA 3JQAB 4YQZA 1Q7BA 2Y66A 3L4BA 4PRKA 3S55A 2P9CA 3GMDA 4RCVA 4XR9A 2O3QA 3TZCA 3FNEA 2DTXA 3H5RA 2QHXA 1AHHA 2GZ1A 4DL9A 2I3GA 1KVTA 3QY9A 5ES3A 1Y8QB 2X23A 4JJIA 4CMHA 3UUWA 2X0NA 3GF4A 4KTVE 3FTPA 1AXGA 4PZDA 3NTQA 3OJLA 1ULUA 3MJTA 3DMTA 2PTGA 4XB1A 3JQ9C 3PYLA 5ENVA 3PLRA 1IHYA 4KZPA 4P38A 4IZIA 1E3EA 4MVJM 4PLHA 1HDXA 5CEFA 1GZ3A 3C1TA 3MZ0A 1VI2A 1F12A 4PVCA 3AY3A 3WWYA 1OC4A 1A72A 2BFMA 1IL0A 4DLBA 5CDGA 2CDAA 3BHJA 4KUGA 3RVDA 2ZQZA 1HYGA 2DUWA 4KP7A 4P4GA 3GQVA 3UW3A 3VTZA 2WJPA 4B7XA 5CDYA 1KVQA 1R15A 3M2PA 1JQBA 2G17A 1WVGA 2VHXA 3ANLA 3V1YA 3PTZA 2UAGA 3SX2A 1DIHA 3WFIA 3HZZA 4U6QA 4XX0A 3RUIA 2UV8A 2DFVA 1PS9A 3DZKA 3ETGA 2QX7A 2X5KO 2Y0EA 3DMYA 3OETA 4B79A 1GCOA 4FGWA 3C1OA 2Y0CA 5I7FA 2HMVA 1KEPA 2ZTVA 2DBQA 1FDSA 4R5MA 2X5OA 1IUKA 4LK3A 4GX0A 1PJQA 1U7TA 4O0LA 8LDHA 1QYCA 2HQ1A 3D0OA 1E0DA 1W0CA 3DFUA 3QVXA 3SEFA 3WXBA 3OM9A 3VAZA 4YEDA 4J1NA 4YBZA 3OA2A 4A26A 4U6SA 3HN7A 2BI7A 2YHIA 4J6FA 2CF5A 3CPSA 4J2HA 4BNWA 3DAFA 4R9RA 1NPYA 1NFQA 1RM4A 4L9RA 3KVOA 3UCFA 3VTFA 1TEHA 1I32A 4BNGA 1SEVA 3KHUA 3KZVA 3DBHB 4XIYA 2TMGA 1A4IA 3RWBA 2O2YA 4ND2A 1BDBA 1V8BA 4NU5A 2ILTA 1KVUA 4FOSA 1X7HA 4QFDA 5I7VA 2WE8A 3G49A 3K5PA 1LSOA 4ALKA 3RFXA 2HDHA 2GF2A 3TJRA 5I8WA 3E18A 4G5HA 2V6GA 2Q99A 3NV9A 2YZ7A 3F1LA 1TB4A 1XU9A 4EUFA 2WYUA 3ZNOA 3KBOA 1K3TA 3FNFA 1I2BA 3JQ6A 3LK7A 4LCJA 3WOHA 2TMDA 1JWBB 3MTJA 4I1IA 1YBMA 1Q7CA 1EBUA 1Q0LA 4CV3A 3AJRA 2VRCA 2ZJ1A 2FR1A 3AW9A 4M1QA 4L8VA 1I33A 2VHWA 1BW9A 3SBOA 3ZW8A 5L7TA 1PJLA 4XYBA 3IJRA 5B1YA 2YFHA 4RJTA 3KYBA 1X0VA 2FN7A 1NQAO 5DOVA 3ZHYA 2QZZA 4J90A 2G82A 3FSRA 2IE0A 4R1TA 3UVEA 1DLIA 4JROA 4IZHA 5CEJA 4WOJA 4YWJA 3JYNA 3AOEC 2O3SA 3R3SA 3AWDA 3GN2A 3H5AA 4BV9A 2W2KA 1MFPA 4N5LA 1UDCA 2DU8A 3IP3A 4E5KA 3UKOA 1DAOA 5C7IO 3KEOA 1L7DA 3GVPA 2GDZA 1QR6A 1GDHA 3IJPA 4RF2A 4BKQA 4YAEA 1KYQA 3IKVA 2VZ9A 3IOYA 4YRDA 3S2FA 1VL6A 1OZAA 1YL5A 1O89A 1HT0A 4AJOA 1Z45A 2GN6A 3WQRA 1U4OA 2YDXA 1LDMA 3LT2A 3WIDA 1DIAA 4KUHA 3QP9A 4KWHA 4YT5A 1YO6A 3TQHA 3PHGA 3VVCA 1X1EA 4NH4A 3WTBA 1KY4A 1GD1O 1OI7A 1RM5A 3LT4A 1YOVB 5TNXA 2X8LA 1XSEA 3W8DA 2BGKA 3W8EA 3JQAA 3M6IA 2J8ZA 3QW2A 4TQGA 4WCFC 4CR7A 4ZU3A 5JDIA 4Q3NA 3AU8A 3BMOA 1XA0A 2BELA 5JFOA 4KMSA 3ZU3A 3FN4A 4ALMA 3G1TA 3C3XA 2I3AA 3U3XA 3GMSA 5T5QA 5JC8A 1ZK3A 1PEDA 1QORA 1T2AA 1Y8QA 5U9CA 1GZ6A 3I3OA 4J3FA 4ZA2A 1B7GO 4J91A 1VJ1A 3LU1A 4AJHA 2CNBA 2ZYAA 2J5RA 3F4BA 4YQYA 4JJGA 3RUFA 5F1KA 3RBXA 1UUFA 3FRJA 4N5NA 4EZBA 3F46A 1H94A 3F4LA 4HFNA 2EKLA 2JD1A 2E82A 3FD8A 3KO8A 2D8AA 2DFDA 1VKNA 1OMOA 1E3LA 2H9IA 1Z73A 1A9YA 1RM0A 1A71A 1H2HA 1YBVA 3OJOA 3C7AA 3N74A 5FI3A 3ZGYA 3RQSA 3GLQA 4B7CA 1SMKA 4MP6A 2EW2A 2ZK7A 1B8PA 3K96A 4DRYA 2W4QA 3JQEA 1O0SA 1LX6A 2QIOA 2VQ3A 1SB9A 5I9NA 2JHFA 1VSUA 4PLVA 2PKRA 5A05A 3ZWOA 1N1GA 2R2GA 1XDWA 3EGOA 1LQUA 2HK8A 4LVCA 4XGIA 3Q3CA 1HYEA 3OJFA 3MJ4A 3KB6A 5COAA 3QVWA 2NNLD 2EV9A 4OSPA 4BQRA 2WTBA 4D42A 5AOVA 3HNPA 2VNAA 2R6JA 5JC1A 1E1NA 4FFMA 1UZNA 4NZ9A 3JYQA 3F1KA 2HAEA 1SNYA 1JAYA 1NWCA 2PH5A 4GKVA 1GPDG 1V3VA 1F14A 2FRDA 3ZW9A 1HE3A 3HFGA 5TX7A 5FWNA 1W8DA 1QYDA 1VJ0A 2WWRA 3PXXA 3OEYA 2AQ8A 4OXKA 3GVIA 3KLMX 5L45A 2AE2A 4BNNA 4L4RA 2VWQA 1HZZA 3DZGA 2W2LD 1VKOA 1GR0A 1ZSNA 4PLTA 4AJPA 1Y5MA 4EITA 4MKXA 3KSDO 3UAGA 3HSKA 4BL5A 1E1LA 1K89A 3DB2A 2BD0A 4OM8A 4UEOA 5CP8A 3S8MA 2GERA 3GDFA 4CV1A 4R4JA 3UCXA 3OECA 2UVDA 4DTIA 4FFOA 3KV3O 3TL3A 4PLFA 1PZEA 4IPTA 4IDFA 3GVXA 2FR0A 2DTDA 1EUCA 3GRKA 3LQFA 3VHRA 1Q0QA 4WLVA 1X0XA 2OMEA 5EL0A 3CINA 4D3FA 2HU2A 1YE3A 3UN1A 5HM8A 2YV1A 4FC7A 1LNQA 2PLAA 1ZK4A 4J0FA 3I9LA 1J0XO 2J3IA 4WEQA 4CMEA 2BFAA 3QWHA 1EDZA 4C7JA 4IMRA 1D1TA 2AMFA 2BGLA 3GGOA 4GH5A 5KVVA 1ENOA 3JQBA 4XYEA 1GQQA 4MVJI 3K6JA 3M1AA 5C37A 5A04A 1E7RA 4LSMA 2O3RA 4CM9A 3ETDA 3D4NA 3QWIA 3AUSA 4BKOA 3E6AA 4JLWA 3MWEB 5JAMA 3QJ5A 3L6DA 1YRLA 2Q1WA 4NHEA 4RQTA 5ITWA 4FDAA 1YVEI 4F3YA 7ADHA 1DFHA 3DONA 3LC1O 4OAQA 1UZMA 3RFTA 1PJTA 3OJ0A 2E49A 1HKUA 3R1IA 1WDMA 3K31A 5U4QA 4XJTA 2DM6A 1BDMA 2EW8A 1EEHA 3K2BA 1GCUA 1X15A 2FP4A 4HADA 5EQDA 1H6BA 2NQTA 2X6TA 3PYXA 3WMXA 1N9GA 4D3SA 1B16A 5F5LA 4A5OA 4TRMA 5CG1A 2CSUA 3P7MA 4W9NC 5ER6A 4D0SA 5EQFA 3P2YA 4WOKA 2FHSA 5AXCA 4S3MA 2GN8A 3WQSB 2O48X 3OMLA 2ZQYA 3VKUA 3SXPA 4GGPA 4UULA 5G2OA 5T57A 4HWKA 2FMUA 3QIVA 5MDHA 1NXQA 4J7XA 1DJNA 5TT1A 4ND5A 2W98A 3CMCO 4CMKA 1QYWA 1Y9AA 3KLPX 1HDOA 3MOIA 3ZNNA 4FCCA 2B4QA 2Z1NA 2XAAA 4IQ0A 4L73A 2NWQA 4WNIA 4B3IA 5IDYA 4IGFA 3HUDA 4CM8B 3PI7A 1WXDA 5ICMA 2DKNA 2OORA 4QECA 1N7HA 1ZEJA 3QWFA 4QQRA 3IL2A 3AK4A 3BTSA 2AG8A 5ILGA 1I3MA 4W6ZA 3TRIA 1KEUA 4EJMA 1XGKA 5A3VA 3O8QB 3OH8A 2QRLA 2YW9A 1MXFA 2RAFA 3KYDA 4R1SA 1P1JA 1Y6JA 3HG7A 3RIHA 2C2XA 1LXCA 5DCYA 4O6VA 4GWGA 4XRGA 1T2EA 1YL7A 1ID1A 4GVXA 4YT4A 3UICA 2P5YA 1PGPA 2IRWA 1FDVA 3WGOA 3JQ9A 3JD3A 4UUOA 4YAGA 3VPFA 3CEAA 4JQCA 3VPGA 4HNHA 5KJ6A 5CDSA 1H9AA 1P33A 1HF3A 4FJ1A 3PZRA 5TF4A 1YKFA 3WGYA 4M86A 4GLLA 2ZATA 1E7MA 4MKRA 4DLLA 4Q9NA 4EEXA 2A35A 4RVFA 1ZXLA 3WFJA 3ZWYA 4BNYA 3AFNA 3QVSA 3K30A 3H6KA 2PGJA 4IS3A 1OAAA 4CODB 4Z3DA 5KJ1A 4IMPA 3BAZA 1R0LA 2VT2A 3GEDA 1ENPA 4LW8A 1M6HA 4Y8VA 4NK4A 1QV7A 5EJ2A 2CF6A 3LT0A 2F1KA 3GG2A 1BRMA 5KKAA 4RPKA 2YJZA 3EVTA 5L4SA 4BNMA 4J49A 3GVHA 3IIEA 3HQ4O 1MG0A 2BLLA 3T4EA 1LI4A 3GN1A 1NR7A 3L4SO 4FC6A 3ASUA 3DEYX 3K9QO 4ZN6A 2D59A 5I7EA 3WBFA 4BNHA 2QW8A 3F5SA 1H6AA 1DJQA 1P1IA 2ZCVA 1PL8A 2D2IA 3FNGA 5H82A 1B26A 4E5NA 2C5AA 4GX1A 1LSJA 3DBVO 3OBBA 3FBTA 3MTGA 4JBHA 3B70A 4B4UA 4R5HA 3DOOA 2FY8A 4IDAA 2B83A 3PWSA 1HLDA 2OZPA 3OIFA 4DYVA 1U28A 1ZMOA 3WGIA 4DQUA 3JD0A 3JYOA 3DWFA 4GX5A 4ND3A 1I30A 2VRBA 3AUUA 4IBOA 4YAIA 3STHA 1XQ1A 3LVFO 4BOYA 4DWVA 4WEOA 6LDHA 5G0UA 1EUDA 5EPOA 1EDOA 5JCJA 3DZHA 3NTRA 4YR9A 5TSDA 4BNFA 3E5RA 3BTVA 1VC2A 2VUTA 2GSDA 4L4SA 1NTOA 4OIMA 2Y67A 4HFJA 5B4VA 4RF5A 2DC1A 2JD0A 2X9GA 2Z5LA 3GNSA 2Z1MA 5ENDA 4E2WA 3H9QA 3LYLA 3DAPA 1EK5A 3MOGA 2ZTUA 4EGFA 3U62A 1NAHA 3TOXA 3VH4A 5EESA 2HMUA 4GVLA 1IULA 4CLEA 3K92A 3EW7A 3VZPA 2NVUB 1BGVA 1ISJA 1HRDA 3KRTA 5A9SB 1B15A 2IYOA 3C1AA 3G79A 4CM4B 1GV1A 4E2XA 3TZQA 2V6MA 2CVQA 2OP1A 3I9MA 4MVJE 4ILKA 1LRJA 3IP1A 1X1TA 1IE3A 5F1PA 4Q3CA 4XEHA 4ZQGA 4HBGA 4HNGA 1MC4A 4PLYA 4CM6A 1JN0A 4RPGA 1C0PA 4U7WA 1D8AA 5K6AC 4YJFB 1U5AA 5H83A 4R1NA 3OJEA 1I24A 3LF1A 1GY8A 3VPSA 3TF5A 4NFYA 1H2BA 4BB5A 3INTA 4CLHA 1I3NA 1WZEA 1HXHA 2VYNA 1F0YA 3BZUA 3AOEA 1YB1A 1H6DA 2C20A 1PJBA 2EP5A 2CVZA 4A7PA 4CLOA 3ROPA 3RASA 2VOEA 5BSGA 4ZVVA 3RUCA 4XYMA 1JLLA 1C1DB 2HMWA 2IZ0A 3JSAA 2VOJA 2JFHA 3DHEA 1HYHA 1DFIA 5TT0A 1QV6A 3VZRA 1NVTA 1N92A 3PK0A 3I9KA 3JD1A 3EVNA 3HADA 1GQ2A 1NQTA 1T4BA 3PQFA 4QXMA 2EEZA 2H1SA 4FFNA 3SLGA 2Q1TA 4XZ3A 3KUXA 3VZSA 2YYYA 1CYDA 2HUNA 2BF7A 1PU2A 4L4XA 3DR3A 1CWUA 4MVJA 4DVJA 1DRUA 2VYVD 3ONDA 1D3AA 4CM8A 1F8FA 1V0JA 4XWYA 3U4DA 3UXYA 3JD2A 3KSZO 3QV1A 1UR5A 3COSA 5L9AA 1R0KA 1DEHA 5JS6A 2IODA 5JYDA 1QSGA 5HA5A 2Y1GA 2VUUA 2Z95A 3WG9A 1UDBA 3Q9NA 4JJFA 2GZ3A 1UXJA 1LBEA 2J3HA 2B36A 3WR5A 4ALJA 3BTUA 4E21A 4N7RA 5CDUA 4UUMA 1DHTA 3KEQA 1E1KA 5H81A 1HDZA 3NUGA 2RH4A 3ULKA 3BHIA 3O9ZA 1U2DA 4QFCA 1LDEA 1YBAA 3C7CB 5JY1A 1VM6A 2WM3A 4GI2A 4NG5A 1ZUD1 4NBTA 3RC1A 2PFGA 2V7PA 2VT3A 4QX6A 3EAGA 4DC0A 1QKIA 3I9OA 4C4OA 5L40A 1P9LA 5T64A 3JTMA 4MVJH 2HCTA 3K73O 4K9DA 1T4DA 2CDBA 2VTDA 5BQFA 4IJUA 4ZD6A 1X7GA 3PJGA 3TPCA 5C5IA 3QSGA 3KYCB 2WYVA 2ZCUA 4TRJA 2FOIA 4NNJA 5GZ3A 2Y1FA 1GZ4A 1Y1PA 4JNKA 2C5EA 5JDCC 2D5CA 5KNLA 5CFZA 4DPKA 4ZJUA 4NDNE 5IXSA 3MCVA 1R37A 3SC4A 4HFMA 3WYEA 2C7GA 3JCZA 4PGFA 1A7KA 4LISA 1N1EA 1ZSVA 1PTJA 3VC7A 3CKYA 3W8FA 2AQIA 5DCWA 2B0JA 1E1MA 3AY7A 1GYPA 1P0FA 3CH6A 4R16A 4GBJA 1M6WA 4TRNA 5JO0A 3S2GA 4CLRB 1E7QA 4XQGA 3FI9A 5IZCC 3R6DA 1PIWA 5IN5A 2YFQA 2WSBA 2D1YA 2WD8A 3UH1A 1RYEA 3MJSA 1Q1NA 4E3ZA 1EE9A 4BNLA 5L3ZA 2C54A 3NGLA 1R66A 5JE8A 5HS4A 3PHIA 2EWMA 3CSDA 4NBUA 4PIVA 1SB8A 1ZJZA 2X9VA 5IZ4A 5G4KA 1OBFO 1FXSA 1QLJA 1UAYA 5C7LO 2GASA 4J4TA 2H5LA 1R0SA 2ZTMA 3WJAA 4YJHB 1TT5B 5IFLA 1PJCA 3ON5A 2POQX 3D7LA 5G4LA 3N7UA 4U0JA 4TZTA 3GHYA 1E5LA 5TRTA 4RQUA 2DVMA 3OEWA 1V3UA 2PKQO 4K1LA 4HX5A 5GZ6A 1NQOA 4RVDA 3BMNA 5KKCA 1DC6A 1IB6A 3DBRB 1O94A 5DCUA 3OIDA 2NVWA 3AI1A 3DOCA 4OHUA 1E6UA 3BXXA 5L4NA 5L51A 5B4UA 1A5ZA 1T25A 2FPIA 3CIFA 2A94A 1O9BA 4BNXA 4B4OA 3ZZNA 1O8CA 1ZVMA 2Q1UA 4WUVA 4JP3A 2R00C 4IXTA 5THKA 4G2NA 1IHXA 1CF2O 1M67A 4BVAA 1X14A 1B2LA 3U4CA 5T67A 5A9SA 4BO9A 3JYLA 3G0OA 4UVHA 2B5VA 4XYGA 5TIIA 4FR5A 4TROA 5KJEA 3ITKA 4MVJP 1EFLA 1VLLA 3ZWPA 5JAZA 2IEDA 1PS0A 2AHRA 3BMCA 4ZQBA 3UCEA 5JLAA 1B8UA 2EF1A 2XXBA 3OFSA 1BVUA 4H16A 1DBVO 2VRCD 4DPMA 5JCXA 4AJ1A 1D1SA 2RCYA 2VHYA 2ET6A 2V6FA 1E7WA 3QQPA 2VTEA 2E37A 2D5AA 5JNLA 3ORFA 4I5DA 1U8FO 3ZH2A 2HK7A 5A5FA 3ZWVA 4AJNA 1RM3A 4MIYA 5COQA 3NT4A 1B14A 4MOWA 1C1DA 1PS8A 4BKPA 1NASA 4MIEA 3RJ5A 2X22A 1UJMA 1F17A 3V2GA 4N18A 5DNAA 1B8VA 4FD3A 4BIIA 4MP3A 4MDHA 2WMDA 4Q39A 4YA6A 4ID9A 3AUTA 3EZYA 4AFNA 3CMMA 4OKNA 3GPIA 4I9UA 4BKRA 5C3MA 1LU9A 2XOXA 2P4HX 1GU7A 3A1NA 4B8WA 3TSCA 4PG4A 3NT2A 2P2SA 1V35A 1HE4A 3TFQA 1P0CA 1DB3A 1C0IA 2O2SA 3GDOA 4M54A 1GQYA 2OL4A 5CAEA 4E30A 1WMAA 1PSDA 3PDJA 4RDIA 3EK2A 1A27A 4J0EA 3ANNA 3EUWA 2CMDA 1LLDA 3WX0A 2C82A 3RD5A 1ISFA 2UUPA 3R3JA 3GFGA 4IDCA 1P74A 2HSDA 3GZNB 4J2OA 4OGWA 3V2UA 5G0WA 2WD7B 3RC7A 4CMCA 4CUKA 2I66A 3ZV3A 5A3JA 1X13A 5BSHA 3PPIA 5DP1A 1U8XX 1GL3A 4JGBA 4BO0A 1E3IA 2EKPA 3E1KA 4FFLA 4R54A 4E6PA 3MWDB 4ND1A 1EVJA 4CMIB 1OFGA 3SC6A 3E9QA 2OO5A 4E13A 3NKLA 5KVSA 3B1KA 1SC6A 3L4BC 1P44A 3ZV6A 4L74A 4ND4A 2OGUA 4ZRMA 5G0VA 3ENKA 1I8TA 1PL6A 4AICA 2V65A 2PZLA 3NYWA 2X5JO 2XXJA 1FK8A 1YB5A 2DPGA 4GKBA 3NDRA 4GSKA 4LMRA 3FPLA 2H6EA 1JWAB 1R12A 4XGKA 1EQ2A 4BS9A 3DMTC 5DP2A 3CTMA 1ZH8A 1LUAA 1Q0HA 1NBOA 2GRAA 4I8XA 4ONEA 4IY1A 1PGOA 2HO5A 4YT2A 4AG3A 1E5QA 4M55A 3L77A 2B37A 1IYZA 1YB4A 4A73A 5K9ZA 1TI7A 3WSWA 2OOSA 5TC4A 5JO9A 1UDAA 2PWZA 4CLDA 2P5UA 4NU6A 5B12A 4CLRA 1V9LA 1JKFA 3U4HA 4W4TA 1PQWA 1PQUA 3BYZA 4D79A 4B4WA 4RLHA 4E5PA 4EDFA 2CD9A 2Y05A 2W90A 2Q49A 1KOLA 2BFPA 3ZWBA 3PFWO 3V1UA 4YAKA 1JAXA 1RYDA 2VWGA 3ROKA 3VH2A 1NM5A 1K0UA 2Q2VA 3QVOA 4JX8A 2JFGA 4BKUA 4Q3DA 4BUCA 3IKTA 2JKVA 4YJHA 3WJ7A 1TT5A 4EBFA 3TNLA 4EJ0A 1DFGA 4CMAA 4FSHA 3RI3A 5L4LA 1LJ8A 4RVUA 5AXDA 1LC3A 3DBHA 1GAEO 4A03A 5T8KC 3VKVA 1RJWA 3IUSA 3CUKA 3DTTA 4A2CA 1EQUA 4PLCA 2Y1EA 1ISMA 2HK9A 3KOUA 2P68A 4Y6SA 4BO1A 1ONOA 4BNUA 1T2DA 1QG6A 1XYGA 2NU7A 3H9EO 1MGOA 1PWZA 4CL3A 1I5RA 1PGJA 2IXAA 4Z9FA 4II2A 4FB5A 3HDJA 2GNAA 4PFJA 4CM7A 1YQXA 3OICA 2E4AA 4TWRA 5IDXA 4PG8A 4U0KA 2LDXA 3PJDA 3NAQA 3GGGA 3D5TA 3KETA 3WGHA 1J6UA 4XDZA 1AGNA 4DQXA 1KBZA 1KIFA 4YXFA 1ADBA 3CZMA 2ZTLA 1N8KA 2IDZA 1R6DA 2CZCA 1LA2A 5A5EA 4Y98A 2HRZA 1JW9B 4P8RA 4EUEA 4OKIA 4NMHA 1ULSA 4QO8A 3VVBA 4R3WA 5K6AA 2D0IA 3A28A 4ZHSA 3PEFA 1NPTO 2UYYA 3L0DA 4KDFA 1UP6A 5ER9A 5FYDA 2B35A 1YDWA 3F5QA 1S7CA 2DTEA 3KM0A 3F47A 5EMHA 4PZCA 1PL7A 3HJAA 1Z7EA 3ZWWA 4QSMA 5BNIA 2WDZA 1HTBA 1ZBQA 5L53A 2IEBA 4IJVA 4J4BA 4OQZA 2NSDA 3ADPA 4J1TA 5F1OA 1NYTA 1G0OA 2X58A 3SJUA 1FJHA 2OBYA 3AUAA 4IDEA 5AYVA 1YJ8A 4CUJA 1K6IA 5IDWA 4Y9DA 3GH3A 4LSWA 5KWEA 4RZIA 9LDTA 3JQGB 1T2FA 4UAGA 2O7QA 4KWIA 4DXHA 1P45A 2X0JA 2PY6A 1WZIA 3NEPX 5EN4A 4UVIA 2GGSA 1DIBA 1Z74A 4OH1A 2AEFA 3JQ7B 4LVUA 5FF9A 1ADFA 1R16A 4RO0A 1XEAA 4CR6A 4DBVO 2QQ5A
chains in the Genus database with same CATH superfamily
2FSSA 1N6OA 2P9JA 3K0SA 2IUUA 1NVEA 2XNDA 4W5QA 3G2OA 3GGSA 1WMBA 3WGTA 4MPTA 1HI9A 2ZZNA 4B6EA 1DP4A 4EAAA 4RZHA 5D6OA 5A9RA 1I3KA 2W6ZA 2REOA 2QG9A 1M74A 3EPPA 4WCFB 4DA7A 1KMMA 5LR6A 4IHJA 4TWZA 4OX9Y 3LVRE 1YOVA 4RY0A 1K5PA 3RFVA 1PNQA 2XE8A 3Q5DA 1C4WA 2CXPA 1X70A 2XHZA 3HYRA 5E7IA 4EHLA 1KXJA 2GKSA 4JCCA 3Q8MA 2P8SA 2VZEA 3NXKA 2IBSA 1X6VA 1GO2A 2C03A 2K5UA 2WA1A 4QPNA 4X20B 1AD2A 1GM5A 4H3VA 1RI5A 4A0HA 1AMOA 2WE7A 2FZGA 3AI3A 1GNLA 3F90A 3NCTA 3P9PA 2VAVA 3HXQA 1S3IA 4RZ3A 5BSFA 2IV2X 3QXCA 3TEMA 2IYRA 1UADA 4XTRA 2Z2XA 3M89A 1XAGA 2O7SA 3VAAA 1Z22A 1AK9A 4DRZA 3LLSA 2QRJA 2CYBA 2FFRA 3SLKA 4UNNA 2JGIA 2JAPA 1X1CA 3CUTA 4NABA 1EHYA 2QEQA 4RJKA 1I4TD 2P27A 4M98A 4B83A 1I2ZA 4RBNA 3T5CA 2YYAA 1JXQA 1XTPA 3EXIA 2D0DA 4K6MA 3D81A 5LM3A 4IICA 3Q7EA 4WXYB 1Y5RA 1HE2A 1FZTA 5IDVA 3C87A 3L1JA 4CQJA 1DT3A 1DAPA 5BWOA 3L8CA 1XCPA 4MAMA 2C0PA 3DDOA 2AMJA 3DJYA 5BUZA 3Q1LA 3MK31 5F5NA 3TB4A 4YLYA 5CX1A 3KXDA 5FR2A 3PNVA 1JFSA 4UREA 1F9AA 3CA8A 2XT9A 1RAHA 3EEOA 3KK0A 2BI8A 1I10A 4YAJA 5ED4A 3OE5A 1DKOA 1JVSA 3JASB 1AE1A 4MV0A 5G1NA 1DIGA 3AEKB 1Q3KA 5E7QA 4B45A 1NUQA 1FF9A 2HEIA 3I53A 3L8ZA 4MRNA 3DBIA 4NU0A 3TQCA 2QBYA 1XIVA 1RP1A 5JSFA 3WI7A 5ALIA 2RHTA 1EM6A 2OB2A 4KWCA 3SNHA 3VZQA 5HCNA 3LPMA 3ZZTA 3WLHA 5M3BA 1RQPA 3K6SB 2B30A 5AVQA 1QTIA 1HSOA 2V6JA 2VJOA 2YXPX 4G5SA 3KQTA 3GO4A 4KXNA 3T7CA 1PSZA 2UU9B 2JH3A 4IWYA 3VV2A 1Z25A 4UE2A 1SA0B 1BGXT 5B2FA 5J63A 1FTYA 4Q7KA 1GIAA 3N3BC 1FLDA 1PZNA 2QLLA 1W1UA 1NPDA 2Q8NA 2WT4A 1JPUA 5LQCA 4Z4FA 1PJAA 1H0RA 1MNQA 3DMPA 3PL5A 4H6WA 4G26A 4BLOA 4E2ZA 4PFKA 3NTOA 3GI1A 3OLVA 4UTPA 2ZB8A 1Z34A 1UMBA 3RV4A 1E8DA 5DULA 3ZX5A 9ABPA 3W6PA 1X7XB 3P97A 3T7EA 3WFZA 1BEEA 5AKKA 1RCTE 3PWKA 4L3OA 4FDLA 4HP8A 1I5EA 3ML1A 4V02A 3UGKA 5L3SB 5FUVA 3V9AA 3KXPA 3S99A 1ENZA 2IPLA 1E2KA 2R1TB 3KXLA 3FW1A 3CRZA 3MXOA 2C61A 4URFA 4BO2A 4U9IS 2I2WA 3LF2A 1SCNE 3D3EA 2YZMA 2FRDC 5J2UA 5JSZA 1B0UA 4XR4A 3QQ5A 1RI3A 3WKDA 4C0JA 1GADO 2PHZA 1U6IA 2DWCA 4Q18A 2W8ZA 1BDHA 3OT4A 4H7PA 1RLTA 1HZZC 1DG1G 4J6EA 3ZQ6A 4DLPA 2XDWA 1PF7E 5DH9A 3QX9A 4JI6B 1FNCA 2OA0A 3RF7A 5K6RA 1L5WA 1I2CA 1N25A 2I2DA 4RL6A 1NR1A 2R84A 3EXHA 1OIWA 2PBZA 3QXSA 4ISCA 4E12A 4EUKA 2O2CA 4YECA 3HTXA 1E9EA 2GN4A 4PG7A 2BZSA 4IGEA 1JMKC 4IV0A 1F8UA 1LV8A 1TO2E 5D84A 4OO3A 1PQPA 3EDMA 4LXGA 5BOSB 2QPAA 2WNIA 3A6EA 7AT1A 7YASA 2Z6QA 3IXLA 2OILA 2R8XA 2HFKA 2NQ8A 4J4HA 4KDRA 4TMXA 1OWOA 4FINA 2A1TR 1ZGCA 1WB4A 1RRMA 5HUJA 1UZUA 2ZT6A 1R9MA 1XELA 1V7PC 4INOA 5DSTA 5IC5A 1CQIB 1G291 2V9CA 1IOLA 1SCJA 1I6WA 3PNSA 3WGJA 4CEJA 2V8BA 1JT9A 2ZT5A 3RVSA 1A5TA 1LSSA 1ZOIA 2TRSB 1KC3A 3T7TA 3B3QA 2ZJ3A 3ZZMA 4ZV4A 3PUWA 5BV0A 1DS6A 1BW9B 4GPEA 3U26A 5KYUB 3FYDA 2HFJA 3PCRB 4MMXB 3M6FA 4NV1A 4F93B 5JSHA 2PA0A 1YJ5A 2QZ9A 5K03A 4IJMA 4F1WA 2NM0A 3TTTA 3UMVA 2C2WA 4RPHA 2WG0A 4P9NA 4G1CA 4EQ6A 2VTBB 3AM4A 1Y1KE 4G4IA 1GCIA 3A4NA 2J48A 1YQGA 2BEVA 3FZYA 3E22B 4BNVA 2IYFA 1U3VA 1U0BB 4WE3A 3U2QA 4Y6QA 3V3TA 3IP9A 1R10A 4AKHA 4DR7B 3QFHA 3IP7A 4K28A 2BGMA 1W5SA 2FWAA 3DTYA 2HYDA 3AO0B 3WIBA 1AKWA 2FWJA 5TF0A 2QQ0A 1XYVA 1YKGA 4YP5A 4ZCLA 5LU8A 1C2YA 2PT7A 1DBIA 4N4AA 3SE7A 2IH5A 1YUNA 1Q14A 3M0EA 1N2CB 1KPHA 4QPDA 2WUFA 5EJAA 3SZGA 4BZWA 3BIOA 1JDSA 1R5NA 2QXUA 2XCOA 3HP7A 3O26A 5A6SB 3RYIB 4BMOB 2CL0X 3HB9A 1QB7A 4I4TF 2JAHA 1IIRA 4WCFA 2VYVA 3B3FA 3F6PA 4I5FA 1JKMA 4RUKA 1NXVA 3U17A 2D3WA 1QYRA 1H2ZA 1P62B 3TD6A 2KLBA 4UVEA 2ORIA 4YCBA 2UZ1B 1A8PA 1VL0A 4Y7DA 3EJ6A 2ZE8A 4X20A 1ZJ6A 4X8LA 5DU2A 5H3LA 3WMWA 1Y7PA 2QGFA 1OXVA 2O8EA 2IBTA 1U2PA 1XVAA 2COEA 3EIFA 3ILSA 3HR4A 4CLXA 4R71A 1BO6A 3K1AB 1DJPA 3A4MA 2GS9A 2Y93A 3DOJA 1ZRSA 4A6DA 2C42A 3ZBTA 1RQLA 4F97A 4MWDA 4OMUA 3NIDB 1A76A 2OORC 3P2KA 4FQ8A 3NGMA 1PK7A 3P2EA 5CYFA 4ZT5A 5JZOA 2ZRKA 3R9WA 1KJYA 4M8KA 2NPFA 2Z8XA 2DBZA 4FVTA 1MEEA 3T12A 1OSNA 5JYEA 2C7VA 2CL5A 3D59A 3E0QA 4FTWA 5ECYA 5EYPB 1OIXA 3BF7A 1UKCA 3DYBA 3NR2A 1PUXA 4CF6A 2YQ5A 2XVMA 5I9LA 2OD2A 3REGA 3FJOA 3AG5A 5GPBA 1VBKA 2Y3IA 1BN7A 3T7KA 1RXVA 4O2BB 3WE7A 5MF6A 3ETHA 4N49A 3HJRA 2LGJA 4DSUA 2AWNA 4HQ0A 4MEBA 3TUJC 4D3DA 2DPHA 2VK4A 5DHFA 2ZIZA 3OFJA 2HBQA 1C0EA 2CHVA 2PJZA 3T5BA 1LFDB 2QLJA 1DXYA 1TRHA 2CXSA 2GD0A 4E07A 1O0BA 2K7FA 2H1OA 2WBLC 3VSAA 1E3TA 2GXQA 2YMPA 3JASA 5AKLA 3RS7A 4C0XA 1PRYA 3AL3A 4DB2A 2XUFA 3G6KA 4FZJA 5IVPA 1RPNA 4FQ7A 3QVGA 2WU8A 2XY4A 3BX1A 4PAGA 1VMAA 4Q9LA 3W0LB 3VYSB 1ZU5A 2Q50A 3DPUA 2H63A 1B8NA 4YROA 3T41A 4AC9A 1XLTA 1XQ6A 4EHKA 2ZM5A 4Q3KA 3R7NA 4C6SA 2VHVA 2AX4A 3G68A 3KT8A 3HRHA 4GEKA 1CIJA 4OBXA 4PWYA 4REQA 5AOAA 1JQLB 3MD9A 4JP2A 4LKOA 3V46A 4BNIA 2GXSA 2R96A 3FCAA 2OD7A 3OP4A 5IAAA 4UARA 1CR1A 3OZXA 2HLPA 1SA0A 4FEEA 2EJBA 4N40A 1VRWA 2C9MA 4GXQA 1XN4A 2OZVA 2WW8A 1J8QA 2I87A 1BXKA 1RP7A 1X86B 4PLWA 5H9VA 2EFDB 4PG6A 4RZQA 4ROSA 4G0NA 3LZDA 4WGGA 1EFHA 4J76A 4EYGA 2AE1A 5A4MS 3ENWA 1Q19A 3ZCUA 5JH7B 1XT6A 4HYQA 4NMXB 4W1SA 3W7AA 2NNWB 2QNIA 5HJ7A 1A8SA 3PE3A 4KMOA 1HPLA 1RWQA 2HY7A 4LHYA 3QTBA 2WICA 3UPDA 5T8KA 1G2OA 1SPXA 1U3WA 2EP8A 2H4JA 2QROA 2CUZA 3CY6A 5L3SA 2RHRA 4GLBA 1Y7LA 2R1TA 5GQSA 5IBRA 4QM6A 3R5SA 4HB2A 4ZQEA 4BDSA 4Z51A 1HYBA 1MO3A 4KV9A 1QP4A 3UJ7A 1Y82A 4EA9A 2ZU6A 3FIJA 5I4CA 2G40A 1SY7A 2J41A 4J7CA 5EMKA 3RUAA 3KQHA 1ECFA 1U28C 1EIZA 2LIPA 2ZFUA 1AUPA 2GXUA 1J1IA 3ROEA 1W4LA 2WSMA 2R85A 5DBIA 3VSBA 1XEXA 2WHRA 4DJDC 3TSZA 2GTHA 4ZEVA 4BLRA 3MHTA 5HIIA 1SVUA 4L5AA 1J56A 4O4JA 1TJNA 1J22A 3NX4A 2GX6A 4ZCRA 2JF0A 3K1YA 3UEOA 3UQZA 4IIUA 2HNKA 2BDTA 1QQ6A 1ZVVA 5JUWA 3HCNA 2ZS7A 1YIAA 2NVUA 1PHRA 1ENYA 4JCOA 4BQQA 5KJFA 2VP5A 1P1FA 1T29A 3F78A 1S1CA 4G1BA 1ONNA 2GF9A 5DV9A 3ZJYA 1XZMA 2G8LA 4X63A 3S2SA 3TAHA 1O95C 2AG5A 2Z08A 2BE7A 1FSFA 2BFOA 2FJUA 3H65A 4DY4A 5DTIA 3QKUA 3C6YA 5DM70 2JAQA 4Q3OA 3GQBB 1S2GA 3PUIA 2PJRA 5BOSA 2DF8A 2VA9A 1N2CE 1Q0ZA 5DX8A 4PZPA 5JTTA 3AONB 3PUJA 2WYWA 1WDLA 1BVRA 3EG9A 3LFHA 3QE0A 5EP4A 4YRLA 1K0FA 1UXKA 2MT9A 1K97A 2P9GA 1TECE 1EI9A 1EX9A 1Y0BA 3CISA 3LBFA 1BE8A 2X1HA 4ZVTA 5FV4A 2PAFA 4FILA 1CQIA 3O83A 1RHQA 1P9NA 1SEPA 3GGDA 3OE1A 2JI9A 1BQEA 1XTTA 1UJBA 2CCGA 1EFPA 1VG8A 2A1UB 2R7NA 3I23A 3IVRA 3Q41A 3QELB 3S81A 3M5WA 1JAIA 3OD5A 4Z7QB 6ADHA 1Y5NA 2IOYA 5E6SB 5KYUA 4C0SA 3AX6A 3HB1A 2PPVA 2ZRHA 3B6ZA 2G5GX 4C6RA 1GRCA 1PG2A 1VECA 1GN9A 2ZUTA 2DJ5A 5KZMB 3EEBA 1Z0AA 2NU6A 4XGNA 3S1LA 3QU2A 1D9XA 4HTFB 4CEHA 2VYCA 3B6KA 1H8EA 4O25A 1XZ8A 3U81A 4E31A 2XGJA 4XCQA 3BGSA 3QX7A 1ZUNB 3O4VA 3UXMA 3E22A 2XF8A 3H42B 3JU3A 4BMNA 1KO4A 3QMWA 3QPCA 2AS0A 3LC0A 1NX6A 4FSDA 3ZWAA 3WL4A 1S96A 4DDHA 4D8YA 4HG2A 1GYRA 1QDLB 3IAUA 4NP6A 3KUCA 2VDNB 3GFTA 4I9HA 2EJTA 3D4PA 2XD9A 2PR2A 4NIMA 2RBEA 5ERYA 4JENA 5L6LB 1N2CA 3AEQA 3U4HA 1LTKA 4C4XA 2XYHA 3B3JA 2JFNA 3NC1C 4JH0A 4WBSA 4KQXA 2PO7A 1O6BA 3RYIA 5A6SA 2HV9A 2F8SA 4C2BA 1NT2A 4TYPA 3F0TA 4NJMB 4KN5A 3N9IA 3QHAA 1YS9A 2G4CA 3R3UA 5AWFC 5CB4B 2P6RA 1XEWX 2PVPA 3R74A 4TMWA 1E96A 1MUUA 4ZOLF 3NDJA 5KREA 3E70C 3SR4A 2OBMA 3ZLAA 2IEGA 1UDWA 4LJ4A 2AW3A 4I4IA 3R5HA 1WB5A 4WDQA 1IN1A 1YH3A 3BRCA 5HUQA 2BR4A 1IVYA 2WV9A 3TNJA 2J87A 2VPZA 3PZBA 3JQFC 1M0WA 5TVGA 1WSBA 1QE0A 1Z07A 3LYUA 3VKHA 1JFFB 5IBQA 4DQKA 3L8YA 1N36B 1VIVA 2JIQA 4IDHA 3R5KA 5A4JA 4RK5A 3NT5A 5A7FA 2CLDX 2W4MA 2ZIWB 3BRQA 3GNQA 4FIZA 5AW0A 4RMHA 1CQXA 4AI6A 3L1VA 3H1PA 4P34A 4KRGA 2XUIA 2ZIUB 3F3YA 4GZ5A 4CMGA 1U2DC 1HDCA 3MFYA 4QUJA 1XWIA 4O2BA 4QE3A 4TMFA 4C20A 1Z2AA 2HKIA 2NSJA 2JCXA 2QL7A 3F6YA 5FO1A 2IH4A 3EJWA 1R6UA 5HX7A 4HN4B 2I29A 4NAUA 1P17A 1Z2DA 3FOZA 1UINA 1Z6TA 4KNYA 3GLHE 3A2LA 2H48A 1Y5IA 2I9PA 4XJXA 1NI5A 3K09C 2XQJA 3LLCA 4MQBA 4Q1EA 3EGIA 5T4FA 3ZZ1A 2VQDA 2PJUA 3QRWA 1NMXA 2WKWA 4I81A 2V55B 4BLQA 4GOKA 1QFMA 3QVTA 1JJBA 3DCYA 3DDCA 3K16A 3F74A 3I52A 1X80B 2WTAA 3NNSA 1G6Q1 4PNHA 4BC0A 1DMSA 1TLTA 3GUCA 4ZICA 3CO0S 3LY8A 4CCWA 3DZIA 2R1ZA 1D6MA 3I6IA 3AXSA 4L15A 5K0EA 3BXFA 2PANA 2NSHA 5CB8A 1FNDA 3VR2A 2X4LA 4TSFA 4K9KA 1M1YB 3FTQA 4YTEA 1TKCA 1FTQA 2ZUSA 3KVYA 2C31A 2IIQA 1KMIY 2R3SA 3QUQA 3O74A 3H5TA 4M9SA 4QEDA 5DEOA 1G5QA 1L4NA 3D0QA 4TV8F 3JD4A 1BWSA 2C0QA 4M49A 1KARA 5KWSA 2M6SA 2IITA 4Z6KA 3HCRA 3WLMA 3JQ8B 4YB8A 2Q0SA 4A2WA 2HJWA 2DERA 2IS2A 4F4HA 3WIUA 3EY4A 2D1FA 2P9YA 5MGBA 3I4FA 4OTZA 2VCHA 1VG1A 4HDSB 3H19A 3QNMA 4WT7A 4YMGA 4R84A 3PLNA 1MXHA 2SCUB 3IAAA 4MWOA 4B5LA 1K6JA 2IC5A 3HBFA 4LDJA 1P72A 3TLAA 3DBRA 1Z83A 3FSGD 3PE4A 4JP8A 4GE3A 3ZCPA 2BM0A 4H7JA 2H2HA 2OBLA 5TE9A 1WSWA 3ZWCA 1E18A 2H2GA 3EHDA 2ZIAA 1L8OA 3W8RA 1WBBA 4KXMA 2YZKA 2B94A 1U7OA 1M2KA 3RWOA 2BW0A 1Z8DA 4YP0A 5LZ5A 5LDGA 4IIEA 4DDTA 4LHEA 4OCZA 5TQVA 3L7MA 2FLKA 1XTZA 1L7EA 4O33A 2JW5A 4N54A 4F4JA 3KQMA 1V7QA 1JLMA 2PD3A 4YUXA 3Q9SA 3D4OA 2YDYA 2B3TA 2Q21A 2VZLA 5AH0A 4N47A 5KHOC 3ZHXA 3OQ6A 1N9ZA 4PZEA 2YUTA 4UHKA 1W94A 4YQFA 2AG0A 5T6BA 2FE1A 1KZHA 3W79A 1NXXA 2QTRA 2V1XA 3LFTA 4BY9E 3L01A 4KAJA 4N5HX 1U0SY 1H05A 1SBNE 4M0EA 4TLLB 5LC1A 4YHHB 4K6KA 1A8QA 1ICIA 1ABEA 5FFFA 4WPGA 4ZO4A 2PK3A 3CR3C 3IHWA 5JD3A 4I8DA 2G72A 3FAZA 3Q6IA 4PNZA 3K35A 3KUDA 2VH1A 3MQ2A 4MVWA 1CS0B 4OA5A 3OC0A 1H2FA 1XZEA 4G0MA 2DKFA 1OLOA 1LLCA 3WRXC 3J7TA 3EGXB 4N5IX 3FTFA 3NMUF 4HDNB 3VKGA 1ZGAA 4I50B 4S2EA 4EFDA 4Z2AA 1W0KA 2DFPA 2JA2A 4JB2A 2A1UA 3V2HA 3T4XA 5B58C 1D5CA 4AKTA 2V6IA 2ASEA 4M8IA 1IPEA 1DC5A 2JEZA 4TT8A 5E6SA 2XTMA 4BGUA 1OC2A 5JSYA 5K8IA 3CB4A 3I2JA 1DKQA 4FKZA 3U0BA 1XNRB 4ZI5A 3JY6A 3E9MA 3B8HA 3N28A 4LJ5A 5LD2C 3TJMA 4HTFA 4J3JA 1Z2CA 3O1IC 4IIFA 1MB4A 2PRYA 3G82C 4HNQA 2JCYA 4N0QA 4NVRA 5JS8A 1A5SB 2WM2A 1ZUNA 3FCYA 1YZQA 3PC7A 4TYMA 4BN4A 1N5IA 2NADA 1UDRA 3EZLA 2G28A 4CLOB 3PDCA 1WHSB 3N6XA 4EYKA 4Y2XA 1MB2A 3L5OA 4ON9A 2WJ6A 3H1TA 2C0CA 4D45A 1UIRA 2QP4A 3GT3A 1YAHA 2CFTA 3FWPA 1FLVA 3CH4B 4O4LA 4IVPA 5AVOA 2Y1LA 2H4YA 3UF0A 3U9LA 4RL4A 2CT8A 3N2LA 3X2SA 3HJGA 5A03A 1ZGGA 3Q8LA 2DJIA 3I9NA 4QQFA 2QE7A 3DLHA 5JAIA 5C1IA 3V33A 4BMVA 5BWLA 1CULC 3Q3GE 4YC7A 5EWLA 2HB6A 4WRRA 1T9GR 2ZJ8A 4ZO8A 2A88A 1ZN9A 2AN4A 3TBHA 1WBDA 1JHUA 4NJMA 2YC2C 1UKEA 4CKCB 1EVZA 4ZHQA 1R4ZA 2GTPA 1J8YF 4CFSA 5CB4A 1W6RA 1T0IA 3M1IA 1W35A 2P77A 2IVFA 4OOFA 1ZM3A 3FMOB 4R40A 1PUJA 1QC5B 5BNFA 3CW9A 3IFSA 4Z0HO 3USES 1EVIA 3WWZA 3P9ZA 5A4FS 1GSIA 1QO0D 2DWOA 2VT7A 3DCNA 4WZBB 4Y7CA 4BGIA 3LTNC 3ECSA 2MSDB 3KX2A 4N9WA 4R8VA 3H2SA 3SF8A 1IBLB 4I6GA 1R27A 2OSBA 4N0MA 4EVQA 3MMXA 2OV3A 3O7MA 2ZIEA 3ILVA 4IIBA 4CMIA 3MJRA 1JFFA 1U8ZA 4JLOA 5ARBA 2AH5A 2KBEA 4GI1A 5IAOA 4E08A 3X1JA 2XWPA 4XVQA 5ARCA 1RWBA 1PVDA 4LOIA 3WB9A 3G0IA 2GR9A 4HGRA 3NIGB 1XRQA 1WMFA 2UYQA 3H1AA 3A7EA 4QL3A 4JBXA 4BO7A 4UDOA 1WS6A 2O7RA 5CYPA 5CG2A 1U7XA 4Y6GB 3ROXA 5J40A 4W5WA 2CNLA 1B0AA 5HEKA 3M70A 2PD4A 1GEGA 2CNDA 2QTGA 1ML3A 4P4UA 1L5HB 2WT9A 2NTNA 4RWEA 3H5NA 2P90A 3SQLA 4F6CA 4W6QA 4BU1A 1PGQA 5K4HA 4E4TA 4F4UA 3GCZA 1NW5A 3IAS6 3GLGE 1U8TA 3FR7A 4E2FA 3T5DA 1I6MA 1OXTA 3RRFA 3AKCA 1Y3CE 5EVCA 1EZ1A 5C52B 3A31A 3ENNA 4TL8A 1PFUA 4UTRA 2C1ZA 3ROTA 3QH4A 2R48A 1J0DA 1ODSA 2VSOA 4P82A 4GL4A 3FMGA 1E3DA 2PSJA 2QLBA 4JBYA 4NBVA 5B4TA 3U7EB 2GN1A 4I46A 3ONVA 1MEOA 2BHLA 3DPIA 1IQ0A 4P83A 4AJJA 5I7RA 1FFGA 1SXPA 1X80A 4HDMB 4GOMD 2DH6A 2ZXEA 3G0CA 3ZTYA 4EUHA 2X15A 1LY1A 3RGGA 5K3DA 4B3BA 5HW0A 4XYLA 1GGEA 2DQYA 4Q1FA 1QZXA 1N2OA 2FSGA 4DMGA 4B0OA 5HR5A 1WMEA 2FA9A 3Q2IA 5ADHA 5F21A 2X40A 2P9ZA 4KTTE 4RXTA 2GSWA 3SHVA 1ZCBA 3QYJA 2D4HA 4RPJA 4XM1A 1E6MA 3P0IA 2WJAA 5KQMA 4EG4A 1FFSA 8AT1A 4JQYA 1E2MA 1X42A 2WKRA 4A4DA 4PYOA 1RJDA 1K9VF 1U6KA 1ZN2A 1K7EB 5GAJA 1NZJA 3B1JA 4MV8A 1M34E 2Q2QA 2QUAA 2RH8A 3IPCA 4HN9A 4TWJA 1YFJA 3W1WA 2YHBA 3JQ8A 3IQDB 4NQZA 1I7PA 4DFDA 2QM8A 1CDOA 2CLSA 2IHZA 5IC6A 1PDWA 4DIBA 2CFCA 1F06A 1XTUA 2JJ2D 4QARA 2CUKA 2I6TA 5C53B 1ZO8A 5E8JA 2SCUA 3LNCA 3MUOA 5LP6F 2HC9A 4W82A 3W05A 3Q88A 4OBBA 2Q45A 1NE7A 5JTUA 1Z08A 1KR5A 5L3QA 2RK3A 3JATA 1K66A 2ZSFA 3E0XA 5ICSA 1ZNXA 2D6FA 1NG9A 3DXXA 4JMLA 1UJ4A 4UEJA 1GL9B 3BK1A 1ARZA 4KBYA 2VAPA 5GTDA 2X19A 3GFVA 3CYFA 4LTDA 2JIDA 3EFBA 1INLA 4Z7OB 2X0RA 3FHLA 3BMNB 3RFUA 2HN9A 1CIVA 3GA7A 3INYA 3TE7A 3WJ2A 1ULTA 4WJLA 4GP6A 2CCJA 1GPLA 4WCDA 2EZ8A 3B85A 1T6XA 4GR4A 1OBHA 2OUIA 1W0JD 4RV5A 4K6FA 4JYZA 4BV2A 3U56A 3HWRA 2O20A 4ALNA 5KJCA 3FYCA 3DZCA 4FYIA 1RKVA 4WLEA 3IDSA 3OZSA 4PR0A 1ND5A 3KJQA 4G9BA 1EXWA 1MQ8B 2NTJA 3PE6A 3M3PA 4KZKA 1U99A 2C29D 4MR9A 4UQPA 4WZAB 2ZI3A 1SN7A 2JRCA 3D6AA 1ZEMA 4TL9A 4MS4B 3DOEA 3OF3A 2G0AA 5GOZA 2ENUA 3H84A 1E3SA 2ORED 3C3EA 4L5JA 4ZGWA 3GHHA 5LXTB 4DMMA 3C45A 4ODIA 3JQBC 1CS0A 4FLMA 2HPZA 4WI1A 3FGOA 1P1KA 1ZCJA 3SMQA 1TT7A 4E03A 4NYMQ 4QZVA 3EGXA 2CXHA 2FZLA 2H1RA 5CVVA 4I50A 2DQKA 4CMBA 3UHAA 2CUTA 3HBMA 3R7AA 1I7QB 2JDID 1Z4JA 3O8DA 3TEJA 1PGNA 1XA4A 5KSPA 2X77A 2YJNA 4JC8A 3TO5A 4JUBA 2CLFB 2O6HA 1OWPA 4MCJA 1YZGA 2RGRA 3ES9A 5DKFA 4R3UC 1DG9A 2D1TA 1QR2A 4I4LA 3GJ0A 3AVVA 4JWKA 1QG4A 4K3VA 3ANTA 4R7TA 3IO5A 3RVPA 1O6CA 4HXYA 4JT8A 2IOFK 1LDBA 3JQGA 3OA0A 3K9FC 2B92A 4KSCA 3L05A 4RVNA 4H1HA 5IJ9B 2HDWA 3Q2KA 1P5RA 1WHSA 3HM2A 1MR3F 5BMVF 2H7XA 3EXG2 1Z37A 4M1SA 3AVPA 3PHCA 4WKPA 3RSSA 4K9SA 1OD6A 4EY3A 3I5YA 2INGX 3HO8A 3IQWA 5D6NA 1LK0A 1PZGA 4X44A 1GEEA 4IINA 4U7TB 4CUZA 1XCLA 5AFSA 2PUFA 1WUIS 2C4UA 3M6AA 1KKMA 2XUGA 1H0KA 2G3YA 2PN1A 5JCOC 5M04A 4PSCA 5HBRA 4WJZA 2PGIA 1EGHA 4XJSA 1DOZA 1XL1A 2AX3A 1BXZA 2OAGA 1SVIA 3CUEF 1P0MA 3L0OA 2C5HA 1B42A 3WZLA 2ZT8A 4DV5B 4YASA 4Z5XA 3MQ4A 1OAOA 4NBSA 3RO7A 4TTTS 4PX5A 5EXEA 3FRIA 4L16A 1EQAA 1ULHA 4RPIA 4B33A 4Q0MA 1QC5A 1FU8A 4RTRA 3MWYW 1JVBA 1JBEA 5U4XA 1E6KA 3NATA 4MXDA 4WZBA 4Q3AA 4GBED 1EBFA 1RQ2A 1YB7A 4MV9A 2ISQA 2X86A 3U7GA 2FMXA 2XNSA 3BK7A 4KGVA 1JEQB 2DHDA 4JJKA 4YQZA 2PQMA 4Q00A 5EE3A 1JDVA 3TK1A 3PUZA 4ZT2A 2WF5A 1YR6A 1MQAA 4DLYA 1VZ3A 3I73A 3ORQA 4WA8A 3EASA 4HSGA 3UB3A 4I3HA 1KEEB 1DWOA 1UEIA 4PSKA 1P5JA 1PT9A 3BXOA 1DXOA 4CMHA 5MN6A 2BAGA 4CKEA 5CA0F 1TTQB 3GF4A 1E64A 2HWKA 4F12A 5C5CA 3M9WA 1SCKA 5F9MA 5D7BA 1X77A 5FUBA 4KRXA 3I6ZA 4XB1A 4DUGA 2WUWE 5JBQA 4QWWA 1TDJA 1X2BA 2BEWA 3EOAI 3IILA 3PLRA 1U0GA 4KZPA 4MW4A 2Z8YA 2XITA 4CF5A 3UJCA 4P84A 5AK6A 4MVJM 3ZXYA 5CEFA 3EEFA 2XMPA 2JFQA 4JLAA 4PFSA 4X6LA 1OC4A 3WWYA 1OH7A 1UZAA 4PQYA 4C0AC 2F1RA 1EK1A 4OHVA 1HMPA 3E9CA 1DU4A 1XVUA 1Z6XA 4GVPA 3RVDA 2ZQZA 4RH3A 4KP7A 4HDMA 3U19A 2XNKA 4FR2A 4CWAA 4ENQA 5GP1A 1KVQA 1CP3A 4NZMA 4F1KA 4UQLA 2NSLA 5B1SA 2VHCA 4E5DA 3GJ8A 5EC8A 2UAGA 4D99A 1DIHA 1YBHA 1W1WA 2XWBF 3M5CA 3LXRA 3QNUA 2UV8A 5FYQA 1Z6AA 4X1IA 4P33A 3S8EA 2ANCA 3LWZA 4HNAB 2ZBFA 3ETGA 1R5JA 4CIWA 2Y0EA 3FCUB 4DV6B 3AP1A 1GUBA 2NZXA 3F3MA 1KZ1A 1OXKB 3VO1A 3R7BA 3UHJA 2Y0CA 3AEUB 4DCSA 1JNXX 1DO0A 1Z4PX 2Z2JA 4RADA 5CW1A 3I8OA 1L5OA 4R5MA 3T5TA 4ECAA 3BB4A 1MAVA 1PJQA 2LIVA 2D2VA 3LY9A 4LK3A 4QQ8A 4RA9A 5E9AA 3BGWA 3CZ4A 3U6BA 3A4TA 1YZNA 2J3EA 4NCKA 1R50A 2X7XA 3Q6NA 2OYRA 2D06A 3C5HA 4B1FA 1ETUA 1RZ3A 4DNFA 2OG1A 2Q3DA 3COVA 3OM9A 4KO2S 3URMA 4YBZA 4LZZA 5FI1B 1J1UA 2FXIA 2H31A 2EZ4A 3E84A 5AVYA 3D0KA 3P0EA 1L5QA 2ZS8A 4IUDS 2QTAA 5JWRA 2AJCA 1UF9A 1H0HA 1R8YA 2D1QA 2IGBA 4KVAA 5HIJA 2OZEA 3F2IA 2RDMA 1FRZA 3PXUA 1MA3A 2UXBB 1U0JA 1M54A 5LLDA 5DYWA 4MQ5A 2WAXA 2TMGA 1AO0A 4JI0B 1JIKA 2FB9A 2D2XA 3H75A 4QDKA 2HCFA 4F5EA 5K0FA 1R0RE 3EQ9A 1TZBA 2R8EA 1K8YB 2ILTA 1D5WA 2ZRFA 3W7VA 4QFDA 3KCQA 5I7VA 4OP3A 3G49A 3K5PA 5DSZA 3SYRA 3DO8A 3MPOA 1N33B 3KTAB 4IHJF 1M72A 2RAUA 3B82A 4MB2A 4XH9B 1IUOA 4IHAA 5TB5A 2IW1A 2V6GA 5CH5A 2ZPTX 2CXUA 2HWWA 3G6WA 1KI1A 2Q99A 4ZREA 3WP0A 2P2DA 8ATCA 3KPJA 2IYSA 3LUDA 2XGMA 1TB4A 1UM9A 1XU9A 2C1XA 2FPMA 4WZAA 1C9MA 5DHUA 2NZ2A 2V4ZA 2ZVQX 4KBFA 3F5FA 2BWJA 3GEPA 4NU8X 5CX4A 4ACAA 1C7FA 3O2QB 4E46A 5JANA 5EIXA 5JOQA 2H5JA 3AFGA 2P6NA 3TNFA 3LK7A 1CDZA 2HNBA 5LMCA 3I30X 3CLKA 3CVVA 3ANXA 2VJMB 1EBUA 3V7YA 5DN6A 1GARA 2F8LA 3UG7A 5G40A 5EZ6B 4C4TA 3AW9A 3PVCA 4WBNA 3C5VA 4Z54A 1MC8A 1I33A 2BMJA 2VHWA 1MRNA 3ZW8A 1C4XA 1PJLA 4XE5A 5B1YA 2XVZA 1F60A 4UMDA 2VUHB 2YFHA 1GN8A 4NE9A 3R76A 3BE8A 3QBDA 1VE6A 3LGAA 4MUGA 3NEJA 1XE3A 3PDIA 5KYXB 1KYIA 3EVDA 5EEGA 3B1ZA 4Q5IA 3TRDA 2ZR9A 1TUIA 4LF6B 2J9YB 2NO6A 2XNJA 3UJBA 1N7IA 3UVEA 2JS7A 3KPYA 5G1PA 2FP4B 1MORA 4JROA 4HNUA 3W9BA 4R2HA 5IJ9A 3L3BA 4EJFA 5LQKA 1V8OA 4EKEA 2FPRA 4LRXA 3MIZA 3R7WB 1UDCA 3N7AA 1ESDA 3C5WP 4ZO7A 1FTWA 3UKOA 4Z7NB 2E4VA 4JDPA 3KEOA 1IWBB 3GVPA 2GDZA 2ZRLA 2UUCB 2AOUB 1PO7A 1R0YA 2WWXA 1P2UA 2ANBA 3QMVA 2KS6A 4KVFA 3U3ZA 2GZSA 2VZ9A 2ZW9A 2A9PA 3NH9A 1TYCA 2QUBA 1YZ3A 4CIAA 3SX4A 4BVKA 3W7BA 1YL5A 4M8LA 5C8ZA 1JQ5A 2W6OA 1OBOA 1BEUB 3CF6R 3LT2A 1A97A 3B5IA 1VKJA 4EVSA 2QVLA 3ZJ5A 5IVHA 1Z7YA 1HORA 4YPFA 1T3ZA 2CVHA 1KI9A 1V2HE 4YT5A 3TQHA 3ZS9A 3ZOZA 4Y2HA 1X1EA 1JJVA 4HWOA 3TLGB 3IUQA 5E3JA 1Y42X 1T8UA 2RHLA 1KY4A 2R7MA 5ETJA 1IQPA 3UWPA 2NTYC 1SXHA 2F1JA 5AK4A 2BUCA 5ALEA 3CN7A 2OAEA 2VLBA 4M2LA 1QUFA 2X8LA 3W8DA 1JEQA 2BGKA 2QSJA 5ALRA 3QW2A 5GJWC 2N42A 3W8EA 4AO7A 3NANA 3BMOA 4G0WA 2F3RA 1G20B 1H2XA 4RTQA 2VXYA 1E6LA 5JFOA 2B8NA 3M6UA 1KAOA 3C3XA 3LX6A 2C99A 3K0HA 1KEEA 2RHDA 2YBDA 3GMSA 3OTGA 1ZK3A 1PEDA 1QORA 1T2AA 2O52A 1G63A 2W83A 1IDN1 3FPKA 4FX2A 3DKPA 3E9RA 4J3FA 5J2UF 4NCAA 4JMPA 1H3FA 4TLBA 1CUBA 3EN0A 3Q0TA 4AJHA 2VBCA 1JTFA 1NI4B 2WAMA 4XRRA 2UXCB 3L41A 4DF3A 3RS8A 3RBXA 3OX1A 1E9CA 4IEIA 4N5NA 2P69A 1XDZA 5CCXA 4IAOA 4RGVA 1QWSA 3N0XA 1L4HA 3W5BA 3KJHA 3F4LA 3KQYA 3KO8A 3C3KA 3FD8A 3OG9A 2DFDA 4JI2B 2HOQA 1HC7A 1E3LA 1Z73A 1A9YA 2Q3LA 4OHOA 4QU9A 1Q1EA 5AICA 1P91A 5F9HA 5CJJA 5AJHA 4DEYA 4B7CA 1UQRA 4MP6A 2FPWA 4MS3B 3JQEA 2UXDB 1O0SA 1RQNA 1DKRA 1LX6A 2QIOA 5DISB 3KCNA 4ICIA 4W1PA 4OBEA 1SB9A 5I9NA 3WA6A 2WFMA 1ECJA 3FDFA 1JJ7A 2B6NA 2ACKA 3O4HA 1LQUA 2HK8A 4LVCA 5EXDA 1ESNA 1ZWLA 5JASA 4ARIA 4PC7A 1HYEA 3OJFA 4G1MB 4RZ2A 2PMFA 4YMUA 2W6JA 2WZQA 2HREA 3KPVA 2X3UA 2NW6A 1UODA 2OYSA 2V1UA 4ZVKA 1M2OB 1N57A 2VNAA 1YK1A 2Q6VA 1IG3A 2QVGA 4ZMRA 2XMBA 3D6HA 4CKWB 2XV1A 2FE4A 4UQOA 4NZ9A 1SJ9A 3RYHA 4F72A 1ZH4A 3F1KA 4EO7A 3C3MA 2HAEA 4GNRA 4Q02A 3X0DA 1JAYA 1QV9A 3OQMA 1P4GA 2V3WA 3RIGA 5AW1A 1T6BY 3G2HA 1TM4E 1Q15A 1V3VA 5DTQA 4R6WA 2A5LA 4MSUA 5JEDA 2QLTA 2FRDA 1BMTA 4JUFA 1HE3A 2FHPA 3HFGA 5TX7A 5FWNA 4BRUA 4JJ6A 2XBLA 2NZVG 2VDJA 3BORA 4IFTA 3D6VA 3EQ8A 2ZYRA 2C4MA 1HZZA 2Q27A 3ABSB 1Q11A 4B2PA 3KLBA 1A3CA 2QTVB 4XIIA 1S2OA 1TKRA 1ZSNA 4X6XA 2GM4A 2ETXA 1GNQA 3KSDO 5LYYA 3FSGA 3VC2A 5THXA 2OXTA 5AVVA 2EX0A 2ZZKA 4OM8A 3H5WA 3MTIA 4UEOA 4YMSA 3S8MA 4BAGA 1KWKA 4EO9A 4UU8A 5EIBC 3I01M 1A9QA 3N07A 3S44A 3AJ9A 2MWMA 4OQXA 4RFLA 5DHAA 2UVDA 2QQ5A 3X1XA 5EIAA 1GA6A 1N5LA 3E9DA 3IUNA 5CXQA 1PZXA 2HIMA 4FT4A 1UCFA 1CUXA 2DE0X 3Q3HA 1KO1A 1GSOA 2BN4A 2FEAA 1KI6A 4AURA 1WOMA 1YE3A 4PQFA 2J0SA 1R8JA 2C2HA 1P6QA 2PS3A 2R68A 4MWZA 3HO6A 1U2GC 2WSLA 4AS1A 1LKZA 4WEQA 2J3IA 4CMEA 4RZXA 3QXGA 4IMRA 2JGDA 1C2TA 4ZXPA 1D1TA 3HBJA 2RC6A 5KVVA 3UC5A 4BE7B 3LCRA 4C5CA 2X2FA 3IE0A 4JU8A 2FWIA 3IP5A 4E1AA 4EHIA 2BDUA 2Y1KA 2F9LA 4TLAA 5F2EA 2QMYA 3ETDA 3HGQA 3QWIA 4H7FA 3VNSA 1CIPA 1H3EA 3I72A 4BKOA 1U3FA 2VJMA 1RFLA 3E6AA 1S9HA 2J33A 2KPOA 4N48A 3QJ5A 3WFIA 4F85A 3EFOB 4B48A 4MJXA 4GNKA 4MUKA 4EF5A 3A9UA 1EG7A 1R9NA 3GRAA 1I1NA 3KJFA 1P0QA 3OU2A 4OAQA 1CRPA 1KZYC 2FJ0A 2Q07A 4LFCB 3OJXA 4PYRA 3GWZA 1WDMA 2YJ6A 3I1IA 5ICFA 2VDOB 4H6VA 4L8GA 4MUHA 4KIJA 4QDXA 2EW8A 2ZI9A 5EG5A 3EIUA 5HNKA 2PMDA 2VJPA 2GRUA 1GCUA 1CUFA 3PICA 2FP4A 3CBGA 3H9CA 3CLRC 1H6BA 2GBCA 2NQTA 2X6TA 3G8YA 3PYXA 4XI9A 3SZUA 3AM1A 3I42A 1N9GA 3OFVA 3W77A 1ZW6A 5JFGA