3RUEA

Alternative analogs as viable substrates of udp-hexose 4-epimerases
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WbgU
publication title Alternative analogs as viable substrates of UDP-hexose 4-epimerases
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
total genus 122
structure length 336
sequence length 341
chains with identical sequence B, S, b
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rueA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3rueA02
3PQDA 1ARZA 2HJSA 4D3DA 4OM8A 3EAGA 3AUSA 4W4TA 2Y1FA 2VT3A 2CF5A 3DTTA 3WLFA 2X4GA 2PZKA 5KVSA 1M76A 3GUCA 3UN1A 2AQHA 3NTOA 2DM6A 2V7PA 1DOHA 4ZVVA 4I5DA 3ZV5A 2EKPA 3OJFA 5I7VA 3DBLB 3GPIA 3LT4A 4PG8A 3IIEA 4YJHA 3KEQA 3ABIA 5TQVA 4IQ0A 3OFSA 4WJZA 3HQ4O 1M6HA 1PGPA 3VH1A 3ZV3A 3K5PA 4E5YA 1KEUA 5A3VA 3ZWNA 4AJHA 2B5WA 3MJSA 3RROA 4HWKA 4BO6A 4UVGA 1HE4A 4W99A 1HE2A 5LC1A 1ZK0A 4PRKA 2VYVA 3GGOA 1U28A 2D5CA 3MJCA 3R0IA 4DQUA 5KJ6A 1G0OA 4YRBA 4GI2A 1PL6A 5DULA 4R3NA 1PTJA 4CLDA 1ZMOA 1TXGA 2P9EA 5F21A 3W8DA 2VOJA 4OOFA 5MDHA 3B1KA 3GEDA 3EZLA 4GSKA 4DMLA 1GQ2A 1NFRA 1XEAA 4GWKA 2AQ8A 1MLDA 4P22A 4YJHB 4N5MA 3RWBA 1FDUA 1E3JA 1NQ5A 1CDOA 3PJGA 3W8FA 1YBVA 2H63A 2O7SA 4PVCA 4XDZA 3ORFA 4AFNA 1WZEA 2GZ1A 1CWUA 4IPTA 4PLCA 3VC7A 3HDYA 3C24A 4J9UE 1X1EA 2UUOA 1DIAA 4GKVA 4B4VA 3G0OA 4GX5A 4E2XA 3VOSA 1K0UA 1MC4A 4NFSA 1L1FA 2GZ3A 2FR8A 2QQ5A 1J49A 1IB6A 1P1IA 2P91A 4OYRA 1SC6A 3UCFA 3PHIA 4FFNA 3B1JA 3TDKA 5F5LA 2C2YA 3E9QA 1I3KA 1HDXA 3PDUA 4IIVA 5JAIA 3F1LA 1H2BA 2IODA 4CJXA 4HKTA 1I33A 2P9CA 1QYDA 1DXYA 2NVWA 1XCBA 1T2FA 3GA0A 2E4AA 2HMWA 3DZBA 3JQFA 2JJYA 5EPOA 4Z9YA 4BL5A 3H4VA 2G17A 4FD3A 4NPCA 2PA3A 3GNSA 1DSSG 1H9AA 3AFMA 1FDSA 2PLAA 4XB2A 5KVQA 1UXGA 1UZNA 2PGJA 3ANNA 3AOEA 3FD8A 4QXMA 5DZSA 2HRBA 1YJ8A 2C7GA 4B7UA 2AA3A 5THQA 4YBZA 1LRKA 3W4JA 1RWBA 4RF4A 4PZDA 4BNTA 4MVJG 3I9KA 1YXMA 4GLLA 4NMHA 4K9DA 5BT9A 3V1YA 3D5TA 4EUEA 3EY4A 1K3TA 1YL7A 5TX7A 1P45A 4WEQA 2I99A 1E6EA 1YOVA 1KETA 4QECA 2VHVA 3GAZA 4GQAA 3P7MA 2EGGA 4IIUA 1PJCA 5KKAA 3U4CA 3UW3A 1VL0A 4FFRA 1XR3A 1UR5A 2VNSA 2GN4A 3JV7A 4BGEA 4YAIA 4F46A 4UULA 4WK6A 1MA0A 2JD0A 2HK8A 4RVDA 4XJSA 1KEWA 1X15A 3GAFA 3O8QB 4W6ZA 5HS4A 3DZFA 2HU2A 3UHAA 4R41A 3RU9A 4DPMA 4BNWA 3M2TA 3ZV6A 5IZCC 3IP3A 3JQ9C 1DO8A 3BAZA 1PS0A 2NV6A 3OP4A 2QZZA 3RUFA 3WSVA 3GGPA 1ZIDA 1LDMA 2O2SA 4PLHA 2P9GA 4JNKA 5DP1A 4DC0A 3KRTA 4DIBA 2HRZA 3DBVO 1HE5A 3R1IA 1GR0A 3RVDA 2AE1A 4B4UA 3ITDA 3H8VA 1MB4A 1C1DA 2EP7A 4LCJA 2EERA 2EG9A 3AI3A 3VKVA 3DHEA 1P33A 2FN7A 3DB2A 3UVEA 3VH2A 4TKLA 1JN0A 2X1HA 1G0NA 1SBYA 1R4MA 1O94A 2BFAA 1W6UA 4NFYA 2A35A 2HK7A 2VZ8A 3RUHA 4B4WA 4YT8A 5JXWA 1UAYA 1PIWA 1UXKA 3AY6A 2OORA 3C1AA 2I67A 3B20A 2NNLD 2O2YA 1Y5RA 4PN3A 2Y66A 2CDCA 4FFLA 4MVJP 4RPLA 3LT2A 4KTTE 4BMSA 4GMGA 3MCVA 1DJQA 2VN8A 1DDOA 4BNJA 4P4GA 4AJ4A 4CM4B 1PR3A 4L8VA 2YYYA 3FN4A 3GEMA 1K6XA 4LN1A 1DC6A 4CM8A 4M49A 3F47A 3KYCA 5LDHA 3GZ4A 2UDPA 3HSKA 2W8ZA 5H82A 3TFQA 1JU9A 5IXYA 3EUWA 4ROSA 4CLRA 4YQZA 1CQJA 2YQ4A 1F17A 3GC6A 3JD1A 2QX7A 3C7DB 3WGTA 1R4MB 4IGEA 1R12A 4R1NA 3DL2A 3RKRA 3WYBA 3SX2A 1LDYA 3RQSA 1X13A 3QQPA 1Z73A 3ROPA 2OP0A 2BI7A 2BMAA 3ENKA 3H5RA 3PGJA 2JFGA 3QWBA 5HA5A 1VRWA 3BHJA 1M6WA 4XYLA 4J90A 2ZB7A 2ZATA 5L4LA 3AUUA 3GVIA 1XWFA 1QRRA 4RVGA 5KJCA 4R1UA 1OC2A 3DO5A 2GUGA 2I66A 1BDBA 4WLFA 2O3UA 1IPEA 2D2IA 4PLPA 4PLGA 1PJ2A 1Y9AA 1CJCA 5ENDA 5GZ6A 2WMDA 1BGVA 2NU6A 3SEFA 3K2BA 3GRPA 3BTOA 3ON5A 5G0UA 4W9NC 1WDKA 1AUPA 4OKIA 4ZN6A 3WGYA 1SNYA 4H3VA 3WFJA 4C7JA 4YTEA 4Z0HO 1HDGO 1QLHA 1Z45A 4PLTA 4WLNA 3DAPA 4Q3BA 4ZHSA 2DBQA 3GUYA 1FK8A 1I30A 4GVLA 4WPGA 1KBZA 3Q11A 4J1NA 4WE3A 3HJAA 2GD1O 2I3AA 2FWMX 2VYND 2YFHA 3PFFA 5ITWA 5JC1A 5TT1A 4JIGA 3AM3A 5G0TA 4NI5A 3CTMA 3GVXA 5HRUA 4B3JA 2C20A 3KHUA 3WBBA 3IC5A 3WNQA 4HP8A 4I9HA 4JBIA 4EITA 5A9SA 3W1VA 4NU5A 3WDSA 1T1SA 1LSUA 4I5GA 1BTOA 2Q2WA 2B4RO 1UP6A 1A4IA 1WMBA 5G4KA 1E3LA 2VRCA 1ZKMA 3PJDA 3ROKA 2PH3A 2I9PA 1Y8RB 4H15A 4N5NA 4GH5A 3WYEA 2JCYA 2HMUA 5DBGA 2QRLA 5A5EA 3BMOA 5DOZA 2YV3A 1ML3A 1O5IA 1QORA 2HDHA 2OOSA 5T6BA 1JVSA 3P5SA 4ND2A 3JQ7A 3LT0A 4RO0A 1HXHA 4CV1A 4EGFA 1X7HA 1DIRA 3K2EA 4FJ2A 3AU9A 4BKQA 3EYWA 4OIMA 4OSPA 4BNLA 1P0FA 1NQTA 1HF3A 5IZCA 1YBMA 3JQ9A 5G4KB 1OC4A 4FBGA 5JDCC 1IPFA 1ZXLA 1IUKA 3PHJA 2X7HA 1LSSA 3C85A 3HN7A 3NT4A 3VKUA 1T2AA 5K6AC 1Z82A 3QVOA 5HS6A 1WDMA 4S3MA 1E7YA 2Q2VA 3GN1A 2WYVA 2ZYGA 5JPIA 5TIIA 2V6GA 1Q0HA 3E03A 4CM6A 1Y8QA 1YO6A 4XWYA 1MG5A 2HKIA 4WLEA 1SCUA 1UUFA 2YY7A 1E1MA 3ONEA 2C2XA 2Q2QA 1HWYA 1IHYA 1U9JA 5U1PA 2W98A 4FPXA 3MZ0A 1VLLA 3I3OA 2WYWA 4XGKA 3PYLA 4DIFA 1NWCA 1AXEA 4L4RA 2E37A 4J43A 2CD9A 4L74A 4OJNA 1LEHA 2J5RA 1ISGA 1EQUA 1XU9A 3GVHA 2Q1TA 3D4NA 4MVJD 4AJNA 4OO3A 3HN2A 4CV0A 1KEVA 4ALIA 1BG6A 5JBIA 1HDRA 2GERA 3BMQA 3H5AA 4N5LA 4PLZA 2UAGA 3U4DA 5KVCA 5KVVA 3OJ0A 4K28A 4P4NA 2Y0EA 4YT5A 3DAFA 3DEYX 4PZEA 2D59A 1HE3A 1TT5A 3KLMX 1I0ZA 2FZEA 4L76A 1HDYA 5ER6A 4HV4A 3T7CA 4RCVA 2VWHA 4XB1A 3CE6A 2YFQA 1LSJA 1EBFA 4UVDA 1AHHA 1W4ZA 3IKVA 3RFTA 2BH9A 3TZQA 3VPFA 2H5LA 4XQEA 5B4VA 1GY8A 3PI7A 3EHEA 5A1TA 1NVTA 1KC3A 4J7UA 1HZJA 3A06A 3WTCA 4IQ8A 3E18A 2GN9A 3IQDB 4NZ9A 4TRMA 2G5CA 3L6DA 5AXDA 1WLYA 1IZ9A 2BRUA 1ZBQA 5JAMA 4L9RA 1U1IA 1U5AA 4NR0A 3C1TA 4W9NA 4BS9A 2AHRA 1DC5A 1PU2A 3ZHYA 1LDGA 1A7AA 1O9BA 5ILOA 1V0JA 3KV3O 2OBYA 3PZRA 3QHAA 4GX1A 1U5CA 1LLQA 3ZWAA 1EK6A 3PIIA 5CP8A 1MX3A 2E82A 1XELA 2CY0A 4U0JA 3CSDA 3PPIA 1Q0QA 3V2UA 3GK3A 3ICCA 4CMCA 2DPGA 3KTDA 1N8KA 3B1FA 5CEJA 3BXXA 1RM0A 2ZIZA 3F1KA 3PFWO 1B15A 3FF4A 3OJLA 3DBRB 3LLVA 3GY0A 4BO8A 4E32A 1HSOA 1QKIA 4PVDA 2OO5A 4LW8A 5HWSA 3TZ6A 4WECA 2D4AA 1FXSA 4ZRMA 1WW8A 3R3JA 1GUFA 3I4CA 1DEHA 4XYMA 4MKZA 1H6CA 5JLAA 2EJWA 4K6CA 2QHXA 1K6JA 5B12A 3NTQA 2ZK7A 3FNGA 5TC4A 1H6AA 3P19A 1AXGA 3BTUA 4KUHA 1YE3A 3ETGA 4BV9A 2IDZA 4EZBA 3RC1A 3WIDA 4F6LA 4HBGA 4BKOA 5K0ZA 4J4TA 1N9GB 1Z75A 1LLCA 1O89A 1YDEA 2Y1DA 1K2WA 3ASUA 5BSEA 3CINA 3NRCA 4P8RA 4CV3A 4GL4A 1LNQA 2AMFA 2R00C 2G82A 3LSYA 3DONA 2Z5LA 1VKNA 3MJ4A 2FR1A 3DMTC 3DOJA 4YT2A 3A14A 5GZ3A 2GSDA 4F6CA 2J5QA 3NGLA 4J0EA 3JQCA 1P3DA 1T25A 2UV8A 3FNHA 1LDBA 4QEDA 4WEOA 2ZB8A 2ZTUA 3JYOA 4RDHA 5JDCA 4UVHA 1E7QA 3VH3A 1AN9A 1YJQA 2DKNA 4JGBA 3KB6A 3O26A 4ILKA 4YJFA 5K6AA 4CMEC 2YQ5A 2UYYA 4FOSA 5HM8A 5JY1A 3UFXA 1F14A 1L7EA 2Q4EA 3JTMA 4NJMA 5CEEA 2P5YA 2AG5A 1EZ4A 1D4FA 4Q3DA 1Z6ZA 3R3SA 4OL9A 4RDIA 4YAJA 3D3EA 1EQ2A 2D1YA 1XIVA 1N5DA 1RYEA 4GBJA 4L4SA 4XYGA 2NUAA 1F8GA 4DYVA 4FC7A 1ID1A 4IJVA 1NNUA 1S7CA 2BFOA 4IJKA 3DFZA 1A9ZA 3HZZA 4H7PA 3A9WA 2JFHA 4Y98A 1JAXA 4M86A 5TLSA 3H3JA 4IS3A 3H65A 4WCFC 4XD2A 1B0AA 2C54A 2VYVD 1D1SA 4WUVA 4E3ZA 4CQMB 4RVSA 3V8BA 5CEFA 1Y6JA 3DQPA 4AG3A 2VUTA 4TKMA 1NR7A 3OM9A 5G4LA 4BKUA 5DBIA 5F5NA 3K73O 4EUFA 1I8TA 4J1QA 1P31A 1DAOA 3DOOA 2ZKLA 4NHEA 3SLGA 3VTFA 5L53A 3L9WA 1WMAA 3ZNQA 5DF1A 5EN4A 3U9LA 1ONOA 3D4OA 4RVUA 4DRYA 3RI3A 5AVOA 3TRIA 4PLVA 5A5FA 5AQ1A 3GG9A 5LDGA 9LDTA 1T4DA 5IN5A 1IOLA 4E5KA 4B7CA 1QYCA 4DIOA 5I9LA 4CODB 4L0QA 2Y67A 2Q46A 4YJGA 5JY6A 2B5VA 2P5UA 3H2SA 1W73A 1WNTA 3HDQA 3KSDO 3INTA 1LQTA 1EUCA 4LRSB 1LA2A 4YDRA 4KMSA 1YB4A 1AHIA 1K6IA 3PXXA 4BOYA 1NHGA 3LF2A 1JAYA 1U2DA 3PIDA 2YDXA 4DA9A 5IDQA 2I76A 3M6IA 3D4PA 4B3HA 2X0JA 5L7TA 2Q50A 4HY3A 2NU7A 2NACA 2LDBA 2FPIA 2EXXA 3TZCA 3ETDA 3VPGA 1NX6A 1PX0A 1HYGA 2VQ3A 2ZTLA 3SJUA 5L7YA 3UF0A 4XR9A 3OIFA 3RUCA 4JQCA 1LSOA 4IDAA 1GAEO 3DZKA 4G81A 4BNFA 3CXRA 3ZNPA 4TMFA 4I08A 3F46A 2VHYA 1PS8A 1T1RA 4E5PA 1MV8A 3KETA 4CL3A 4AVYA 5F1KA 5CDGA 2X9NA 2OBNA 4J1SA 5TJ9A 1WVGA 3FTPA 1E6UA 2RH4A 3TFOA 1UP7A 3RC2A 1RJWA 1UDCA 1Z74A 1HDZA 4OAQA 3U49A 1P1KA 3KO8A 3ZWWA 4R5MA 4FJ1A 5TF4A 2WE7A 1F0YA 4OXYA 4E0BA 2HMTA 1MP0A 3DZIA 3DFUA 3WGGA 4CMAA 5KJ1A 4U7WA 1N7HA 4YVFA 2CF6A 3UGKA 4A2CA 4NBVA 2G76A 3ZWMA 3MEQA 2PFGA 3GN2A 2RIRA 4LCEA 1ISHA 1NAIA 4J4BA 1BW9B 2J8ZA 4JP3A 5DBFA 1HRDA 4D43A 2NVUB 2HCTA 4ZRNA 2R00A 1PGQA 3F5QA 3DMTA 4F45A 1CYDA 1WZIA 4YCAA 3AFNA 3WFIA 1ENPA 1PWXA 3FNEA 3RC9A 1PSDA 2AEFA 1DJNA 3ULKA 3U09A 4WLUA 1IE3A 3ITKA 4MINA 1EMDA 1VJ0A 4W82A 2B0JA 4AL4A 5FEUA 3ZGYA 3I9LA 4LMRA 1A72A 5EQDA 3HDHA 4CMEA 2BGMA 3ZV4A 3TJRA 2HLPA 1GD1O 1LQUA 4JJIA 1U4OA 4LK3A 3WGZA 4YACA 2O7QA 5CDSA 4YT4A 3CEAA 3QWFA 4X54A 2YZ7A 1HKUA 4YRAA 3WGQA 4TVOA 4RF5A 4WASA 4E31A 3AM5A 4OSOA 1LC3A 4Q3AA 1KEPA 3WJAA 4D3FA 4CUJA 1NPDA 2FMUA 1VSUA 4CLHA 3K96A 3L4BC 1ZK2A 2Q4BA 2X5KO 1QXSA 1VKOA 4FQ8A 4KDFA 4QSMA 2EKQA 4WCFA 3UXYA 5JAZA 3IJRA 2OGUA 1QMGA 2CVQA 2PKQP 1U8XX 1CEQA 4ZJUA 1YWGO 1XHLA 1ZK1A 1O8CA 3MWDB 3WTBA 3O8QA 1X1TA 2Y93A 1SEVA 3ZHXA 1DIHA 1LJ8A 3ZWBA 3DC2A 2W4QA 4Q39A 5C7OO 5DT9A 5AYVA 1YS4A 2BFMA 3I23A 4BO0A 3QY9A 1RKXA 2PD4A 5FF9A 1JWBB 4EJMA 2WD7A 3EZYA 2D8AA 3GFGA 5ER9A 1LI4A 2BELA 2DBRA 5FI3A 4Z0TA 4BNXA 3FCOA 3GDFA 4WCFB 2D0IA 2ZJ1A 2Q99A 4OGWA 1NVMB 1H2HA 2O3RA 3FI9A 1EVZA 2A94A 4CL8A 4IDDA 4HADA 1EEHA 1BXZA 1Q7GA 1XU7A 3C7CB 4EJ6A 2ZJ0A 1KERA 3I6QA 1U3VA 2BGKA 4UVEA 4RPJA 3PTZA 1WDLA 3ETEA 4N54A 4FC6A 2Q1UA 2H6EA 3PWSA 4I1IA 1GUYA 1UDAA 2WD7B 1IULA 4TWRA 2BGLA 3HUDA 2GDZA 3BMCB 3RJ5A 1KVTA 1E3SA 2Y1EA 3DMYA 4CM4A 3JYQA 1NAHA 3ZH2A 1NPTO 3IUPA 5JCJD 1OMOA 5U4QA 4EW6A 2XOXA 3AI1A 1R15A 3CZMA 4B3IA 3AK4A 1QP8A 4Z3KA 4CQLA 1E0DA 2JKVA 4FFOA 3TSCA 4R69A 3WX0A 2QYTA 4FJ0A 4BO7A 1NHWA 1QR6A 4C4OA 3ZI0A 3AM4A 3ONDA 3M2PA 1B8PA 4TVBA 3MJEA 2VRCD 3MOGA 3QW2A 2H1SA 3NX4A 3LQFA 3O03A 1KVQA 1I3LA 4IY1A 2YDYA 1W8DA 4UEKA 1A71A 4E33A 1B8VA 2OL4A 3L4SO 3F4BA 4K6FA 5CFZA 2AEJA 1V35A 3KUXA 1DLIA 1LBEA 4EEXA 4UEJA 4EYEA 4CQLB 5G0VA 4Z3DA 2OXIA 4RGBA 4JBGA 4BB6A 4EBFA 4IJWA 4P38A 1JKJA 2NSDA 3K8ZA 1QLJA 3Q1LA 5F1OA 3GMDA 3FPLA 5GY7A 4NG5A 5EMHA 2WDZA 1VL6A 2EW8A 4O1MA 2FOIA 2Y0CA 5C7IO 3FRJA 1B14A 1P74A 1G6KA 4OOEA 2X22A 4J91A 4BNHA 2RHCA 5KKCA 1KVUA 1ONPA 4Q3NA 4CM5A 1ZCJA 5EQFA 1CF2O 1V9LA 4MKXA 3IAHA 4CLOB 2X23A 2I5PO 3OIDA 4D45A 5JO0A 4D0RA 1VJTA 3VPXA 3JSAA 1PJLA 4MIEA 5J23A 4NH4A 3WWZA 3AU8A 4BNNA 1FDVA 3AI2A 4NIMA 4B8ZA 5L51A 2CVZA 4CR7A 5FWNA 1O0SA 3LYLA 3UUWA 4MVJE 4KWHA 3I9NA 2PGLA 5DNAA 3ZCXA 3ZWCA 1V6AA 1DRWA 4ZQGA 4I5EA 4KWIA 1YRLA 4ND4A 5TGDA 3H9EO 1KOLA 1E3IA 4J1TA 4LMPA 1QYWA 3QP9A 3W6ZA 1OBFO 1TI7A 2FSVA 1Q2XA 3O4RA 1K5HA 4Y67A 3GFBA 2B4TO 4BKPA 3D1LA 1P0CA 1GADO 1Y8RA 1M67A 2PNFA 3L4BA 4FFMA 4NBUA 5JCJA 3ZWPA 2GCGA 4AICA 2I3GA 3L9XA 2XXBA 2C07A 1U8FO 2Z1MA 1NTOA 3WBFA 1PZFA 4RVFA 3WICA 1ULSA 2DUWA 4JP2A 2JAPA 5I7SA 2O4CA 1YB5A 1ISJA 4KTVE 3S2FA 1H6DA 3GGGA 4R54A 3SLKA 1E5LA 1LRLA 1Y9EA 1BXGB 4HUJA 1ZMTA 1ADCA 4FSHA 3DWFA 2FP4A 4MIYA 2PZLA 3DXFA 4FN4A 2O23A 1MXHA 4UVIA 3LC2O 3E9MA 1HTBA 4GVXA 3A28A 5AOVA 3TL3A 2H9IA 4PIVA 5JNLA 3AY3A 3FPCA 5KOIA 4DPKA 4ZQHA 4RORA 1BRMA 1PGNA 3AW9A 3RKUA 4E5MA 4J3FA 5CPBA 1OAAA 1U7HA 3ST7A 2PKRA 3JQ6A 3CUKA 1T2DA 5CPFA 4XYBA 4TZTA 6ADHA 3EC7A 5JW6A 1YGYA 3Q9UA 1ZJYA 3G3EA 1GL3A 1ZNQO 2FHSA 2TMGA 2VTEA 3MTJA 5G2OA 2Q45A 1P1FA 1SMKA 1GFSA 2GR9A 2ZTVA 3INRA 3ROMA 2JL1A 4ALLA 1ZJZA 3LZ6A 5DCWA 4WOKA 4BNVA 1DRVA 1NQAO 3AWDA 4ID9A 1I5RA 3ZNOA 4CM9A 4CR6A 4I9NA 1N1GA 4R68A 4O0LA 3DBHA 1VC2A 3H2ZA 4QQRA 2GN8A 1LUAA 3I52A 3NEPX 4ALNA 4ND3A 2X8LA 3PHGA 4QFDA 2WWRA 1XA0A 3D3WB 1E7RA 1QV7A 4H16A 3ZDFA 3FHLA 1ZXBA 1I2ZA 4J6FA 3VZSA 4CMBA 3E1KA 2FZWA 1Y5MA 4JX8A 5A03A 4XJTA 1I32A 2J6IA 2PD3A 4OXKA 5C3MA 3OQBA 2WEKA 3S2GA 2YV1A 4BIIA 1T26A 1LTHR 4RQTA 5IDWA 2QYSA 3D0OA 1K89A 3RASA 1XSEA 4RLSA 5JDIC 2ZQZA 4PRLA 3WGIA 1EDOA 4UAGA 3QE3A 3DBHB 3N7UA 3WGHA 2XF8A 1JDJA 1E6WA 1ZSYA 3IJPA 4TRJA 3I5MA 1VL8A 3TOZA 4BMVA 3BTVA 3VPSA 1MUUA 4HX5A 4J2HA 3GH3A 2QRJA 5TRTA 1J6UA 1E7SA 3HE3A 3O9ZA 3HNPA 4XRGA 3UICA 4PG5A 3V2HA 3NKLA 3OQ6A 5BNFA 2HUNA 2PWZA 1C0PA 3ZHZA 1BWSA 1JLLA 1PR9A 1P1HA 1BVUA 5TS3A 2OUIA 4Q3EA 3K9QO 1DBVO 3RD5A 3GZNB 4G2NA 3DBRA 5L95A 2DFVA 4DXHA 1DAPA 2C0CA 4A73A 4S1VA 1LU9A 4W7HA 3ZWXA 1FJHA 1HEUA 1E3WB 3BTSA 5HTOA 2X0NA 1EE2A 2PH5A 4QTZA 2NM0A 3C8MA 4CMIB 2J3KA 3S1LA 3KXDA 4JCOA 4B79A 4PLYA 1VPDA 1I24A 1D8AA 4DLAA 4Y6PA 1B26A 3TOXA 4LGVA 4JBHA 2C29D 4EI2A 4ZGWA 3O38A 1EK5A 2VHZA 5I7EA 1B8UA 3JYPA 4TROA 4ESOA 4R51A 2VRBA 1JKIA 1N9GA 1SB9A 1J0XO 3BMNA 1WPQA 1QYXA 3DAGA 3NGXA 4XDYA 5KTKA 1RPNA 3IDSA 5DDIP 1C3VA 2F00A 5LCXA 4JLWA 2GO1A 1ENOA 1ZK4A 4A5OA 1E1NA 1XKQA 2YV2A 1HLPA 1PZHA 1PZEA 3IUSA 4YR9A 4RQUA 3PQFA 2DU8A 4TSKA 3COSA 1U7TA 1I36A 1GV1A 3D5QA 3ROQA 1ENYA 4AJJA 5EL0A 5BNIA 2OFPA 3F4LA 3OSUA 3L6OO 3F6YA 1CIVA 1ENZA 2BLLA 3T4EA 3SJ7A 4IDBA 1HDCA 3E5RA 3BMNB 3PLRA 1R66A 2PV7A 3I6IA 1IYZA 1VE9A 2B83A 5T64A 1KIFA 2CZCA 5T67A 4NFHA 9LDBA 1XQ1A 3S2IA 1MFPA 4BV8A 1XG5A 1I2CA 2F1KA 3HB5X 4PLFA 3LLSA 4XEHA 5I9MA 1P9LA 3GF4A 3IOYA 1PGOA 2YHIB 2RAFA 3FBTA 4G65A 1X0VA 2AEMA 2DQ4A 3WQQA 4D41A 4BQRA 2NTNA 2BD0A 4CPDA 5TT0A 2V6MA 4XCVA 2X58A 4O59O 4WOJA 5AXCA 1N92A 2IE0A 4F3YA 4BB5A 4E13A 3E82A 2P4QA 7MDHA 2IYPA 4CUZA 1MXFA 5DCUA 2IZ0A 1EVIA 4DUPA 2JFFA 4CQMA 3L6EA 4YJDA 1F8FA 4URFA 4R5HA 3T4XA 3OF2A 4NBTA 4RZHA 4GMFA 2I65A 2PZJA 2DVMA 3UOGA 3VH4A 3TZHA 2ZYDA 2PZMA 4PCVA 3SVTA 3KYBA 1I01A 4XIYA 4AJPA 1FF9A 2R6JA 5JCXA 3KYDB 4OMUA 4YWJA 1O95A 3BHIA 5IFLA 1LXCA 3CPSA 4XKJA 4PGFA 2P4HX 3B6ZA 4MDHA 1GUZA 1Y81A 5IN4A 4PZCA 4JN6B 3OJOA 4Y8VA 3KM0A 2POQX 3JQ8B 5JC8A 3WWYA 4M8SA 2RH8A 1U3TA 1ZW1A 1RYDA 2X86A 4YRDA 4BMNA 5A04A 2ZYAA 1L7DA 2NLOA 5BQFA 4IZIA 1IY8A 4N7RA 1DB3A 5C37A 5JSFA 1YBAA 4TQGA 2X9GA 4CUKA 2Q3EA 1PJQA 1YB1A 3CMCO 4LSMA 1E1KA 2PGDA 3WXBA 3CIFA 4CR8A 1C14A 5JDIA 2ZQYA 3TPCA 1I3MA 1ADGA 1ZEJA 3Q9NA 2X9VA 3ZU4A 1UH5A 1R0LA 2WM3A 2UUPA 4QT0A 3H5NA 1SOWA 1UXHA 2P68A 2Q49A 3K30A 3PDJA 3PHLA 3FTNA 4KOAA 4P4LA 1GU7A 4XGNA 5A05A 3TZKA 1XGKA 1B2LA 2O3TA 1PL7A 5CHEA 1JVBA 1Z7BA 3H9JA 1UZMA 4NK5A 3X2FA 2ZB4A 3OMLA 1UZLA 3QIVA 4KZPA 1ULUA 4DREA 3UH1A 2CFCA 1UAGA 5ITVA 2PKQO 4DPLA 3A1NA 4EEZA 2X0IA 4OQYA 1GQQA 4MJLA 3LVFO 3RFXA 2IRWA 2AQIA 3VZPA 3AOGA 3S55A 5A06A 3ZW9A 3RIHA 3SC6A 3PYMA 2VZ0A 1M2WA 4WKGA 2OHXA 4QFCA 3RFVA 1VJ1A 2VHWA 2Y1GA 4GGOA 3DZHA 2W90A 4XZ3A 5I8WA 3HFGA 3GLQA 3P2OA 5A4DA 4DMMA 3ZU3A 3H6KA 3KEOA 5JMWA 2O3QA 1YH3A 2A4KA 2CNBA 3VDQA 1TVEA 3U0BA 2W2KB 2AQKA 1LLUA 4MVJF 4BVAA 5CDYA 2CMDA 2IXAA 2J3HA 3JCZA 5JS6A 6LDHA 4XGIA 4PFJA 3PGXA 2GLXA 3I9OA 5L7WA 1NBOA 3Q2KA 4AJEA 3ANLA 4D42A 2DPHA 3D7LA 5ICSA 4M1QA 5H81A 4MKRA 3GOHA 4CMKA 8ADHA 1MG0A 1U4SA 2VWGA 4GPD1 4J4HA 5CG2A 1TEHA 1BW9A 1NM5A 4WGGA 1XYGA 2NVUA 2E48A 5T8KC 3W4KA 4J7CA 1GTMA 1JQBA 1P44A 1ONNA 3NT5A 1ISMA 2B4QA 3JQAB 3QVXA 4KP7A 4B4OA 4DBZA 1BXKA 5COQA 1R6DA 4PG4A 5JO9A 1PJTA 4CMHA 1DIBA 2V6BA 2EWMA 3EGOA 5DP2A 3EDMA 2WE8A 4MOWA 3ZN2A 3OEYA 1EBUA 1NVGA 3EMKA 2AG8A 1KVRA 4K26A 3N74A 1PGJA 1ZSVA 4Y9DA 3LC7O 1C0LA 1VI2A 2CUKA 3MJTA 4Y6SA 1ZH8A 2Z1NA 4DVJA 2PK3A 3C7AA 3DZJA 4DYDA 2BKAA 3FWNA 2CDBA 2V6FA 1UP4A 1E3EA 5KIAA 4BNGA 1GEGA 3M1LA 1RM4A 2GPTA 1E92A 1E5QA 4UUOA 4W7IA 1O6ZA 4BQPA 1PEDA 1B7GO 1SB8A 1V3UA 2DTDA 3JQEA 4RV9A 4CLXA 1DPGA 5U9CA 1ZEMA 1ZFNA 4IJUA 4IDGA 2G1UA 3PJFA 4IXWA 4A26A 3K92A 4JXKA 4YAGA 3STHA 2C82A 3OH8A 3TNLA 4Z6KA 1U3WA 1Y1PA 3L0DA 4JROA 1QSGA 3FNFA 4IBOA 2FSSA 3GVPA 3GG2A 2HK9A 4R01A 4AJ1A 4GX0A 3WR5A 4IDEA 1PJ3A 5EESA 3VDRA 2FR0A 1HZZA 2Y68A 3PQEA 1PJSA 5B37A 1H9BA 4J0FA 4BHTA 4TRRA 3OA0A 4XQGA 3QA9A 3JQGA 3DDNA 3WG9A 3IKTA 4Q9NA 3RUDA 3RC7A 1FDTA 1I3NA 3TL2A 3HDJA 1P77A 5JYDA 1NASA 3CH6A 4ITUA 2JD2A 3BZUA 4RPGA 2EHDA 1LX6A 2ET6A 3GT0A 1AGNA 4HNGA 4PG7A 1BVRA 1B3BA 4UUNA 4QO7A 5DCYA 2J3JA 2YUTA 4I8XA 5H83A 4MVJM 5I8ZA 3V1UA 4R4JA 2EJVA 4JJFA 1EVYA 3ADOA 4OH1A 5EJ2A 2G0TA 5EERA 3ZWVA 5L40A 2NU8A 3RUEA 4XYEA 2C5AA 4LISA 5EINA 2CSUA 3WGOA 3U4IA 3PEFA 2GN6A 4U6QA 3BMCA 5B1YA 2PTGA 3JQGB 4CM7A 1GYPA 4MVJI 3VZRA 3EW7A 3PWZA 1ADBA 3I4FA 2Q1SA 1GPDG 3OHSX 4Z0PA 4BNZA 1WAMA 3F3SA 3KVOA 4HFRA 3QWHA 1BSVA 4YQYA 4E5NA 3CKYA 3LT1A 3QJ5A 1A7KA 3IL2A 5JFOA 2GRAA 4MVJH 2NTVA 4BO1A 2AW5A 3ZW8A 4WNIA 1ISFA 1EVJA 1GZ6A 4HFJA 3U5TA 3K31A 1TB4A 2J3IA 4R1TA 3BA1A 2BFPA 3LDHA 2HAEA 1N7GA 4YEDA 4NK4A 3JD2A 1TLTA 4DTIA 3ZZNA 4NDNE 1KC1A 4IUYA 2XXJA 1H5QA 2CDAA 5KJEA 1ZVMA 4HFNA 3I9MA 4QX6A 1DHRA 5CDTA 2JD1A 2V65A 1YOVB 5COAA 3PRJA 1SZJG 3VTZA 1J5PA 3W6UA 4J7XA 4DQVA 2O3SA 2X5JO 3JD0A 4CV2A 1IZ0A 4FS3A 5AXBA 1Q1NA 2P2SA 3WJ7A 1EDZA 4KQXA 4XX0A 4DLBA 3NJ8A 1YQDA 5T8KA 1F06A 1HSZA 4AJOA 1PJ4A 4D44A 3P2YA 1H6BA 4IS2A 1GYRA 3QLJA 4ND1A 4E2ZA 2XPCA 1NYTA 1EUZA 4UUPA 3QVWA 1NQOA 1B16A 4WLOA 4D46A 3RUIA 4M54A 1MC5A 3HWRA 4CLOA 3CMMA 2VWQA 1ORRA 1WP4A 3DR3A 4INAA 1ZZEA 2OP1A 1IL0A 1GEEA 1I2BA 3UKOA 5JYEA 4D3SA 1TT7A 2DBVO 1HYEA 1WWKA 3ONFA 3UCEA 4DBVO 2E49A 3V1TC 4IDFA 4XA8A 4YB8A 2RCYA 4AJLA 3LK7A 4FGWA 2BF7A 3Q2IA 1C1DB 3GNTA 4TRNA 1U2GA 4YA6A 3G17A 4TZKA 5TJHA 1VSVA 3NUGA 3RJ9A 3ZU5A 4ZICA 2Y99A 5IG2A 1E77A 1LRJA 1R16A 4A7PA 4R16A 1RM3A 5AXAA 1RM5A 3WMXA 1HT0A 1T2EA 3U4HA 4FB5A 2BI8A 3E8XA 1J4AA 4XIJA 2DUUA 3U62A 3W4IA 1BHSA 2D3TA 4D7AA 3OECA 5MGBA 4CM9D 4Z9FA 3GDGA 1AE1A 3RU7A 3TQHA 3VVCA 4C7KA 4CM3A 3JD3A 1M75A 3HB4X 5KCZA 1MGOA 2NU9A 4MP8A 4ALJA 2ZCUA 4CM8B 4PLWA 3E48A 4NBWA 5FFFA 3KYCB 1C1XA 3T7EA 3U3XA 2AXQA 2GZ2A 3WNVA 5ENVA 1ZUD1 1YVEI 1C0IA 2O48X 4E2YA 4WLVA 2ZTMA 2Y05A 4R9SA 3DTYA 4LRTB 1R0KA 3JYNA 4CLRB 1EFKA 1E1LA 4L4XA 4RZIA 4EJ0A 2JHFA 4IZHA 1BXGA 4U0KA 3V5NA 3HFSA 5CG1A 4ALKA 2X6TA 4UUMA 3B70A 1SPXA 2B69A 5G0SA 5C5IA 2RBEA 1QYVA 3PHHA 2WSBA 5A9TA 4CMJA 5IJZA 4Y6RA 3OETA 2OZPA 4R3WA 3CZRA 3ZWOA 5L9AA 3ENNA 3RBZA 2NQ8A 2Q1WA 4R9RA 3BIOA 4EDFA 4U5QA 1XQ6A 1C1XB 4O6VA 2GGSA 1EE9A 4KDEA 4XRRA 4LSWA 1D1TA 1X14A 1PL8A 1OZAA 5GZ1A 2JCVA 3I1JA 1Z7EA 3H9UA 1YONA 4L73A 1TA4A 4NBRA 2IYOA 1CERA 4J9VA 1A4UA 4FW8A 4MO2A 3OIGA 1U3UA 2J5KA 3S2EA 5HBRA 4YAEA 5IDYA 1GYQA 2O50A 4DLLA 2C5EA 3ZU2A 2DC1A 2WYUA 3PJEA 1VM6A 1BMDA 3DZGA 5TSDA 1HL3A 1Y7TA 4XR4A 1KVSA 3NAQA 3GNQA 2JAHA 5JMPA 4HXYA 1KY5A 1OI7A 1SEPA 5GMOA 5COBA 3ICPA 2I6TA 1H93A 4JK3A 3W8EA 1H94A 3QVTA 2DTEA 4RJTA 5BSFA 1NR1A 2EF1A 5IZ4A 1F12A 4N18A 3QV1A 3ZNNA 3D3WA 2HJRA 1LDEA 2EKLA 2YHUA 3KBOA 4E21A 3UCXA 4JJGA 5BSHA 5A9SB 1ZSNA 1EUDA 1JA9A 5BNTA 2HMSA 1CRWG 1H0KA 4ND5A 4A10A 4HNHA 4BO2A 3EK2A 2RHRA 2QG4A 4XQCA 4OHUA 4CMGA 1Q7CA 1R37A 4MPDA 5ES3A 2VCYA 1GZ4A 3OBBA 3IS3A 5BSGA 2FRDA 2VT2A 3FR8A 3IP1A 5KNLA 1KY4A 3WYCA 1A27A 3SXPA 4ZQEA 3L77A 2EV9A 3BMOB 4YYZA 1E7MA 2QIOA 2PD6A 4BUCA 2GNAA 2IZ1A 3X2EA 3JQ7B 4QUKA 5A3JA 1DC3A 4G5HA 2EW2A 3AJRA 4ZD6A 4ONEA 5ILGA 3WQSB 2IEDA 1NFFA 4IMRA 4AJKA 4YPOA 2A9FA 1B3RA 3KSZO 1SAYA 1Q0LA 3VPHA 2ZCVA 3GZNA 4RPKA 2ZB3A 4NQZA 1LLDA 1S6YA 1ZO8A 3Q6IA 3NYWA 1X7DA 2HQ1A 4I5FA 3ZWYA 4IMPA 1E3WA 2R2GA 4GX2A 3VHRA 3MJVA 4CLEA 3TF5A 2DBZA 3ANMA 1N2SA 4PG6A 4CMIA 4U6SA 3V2GA 2VYNA 4HFMA 4GSLA 2FY8A 4ZQFA 3LF1A 1HYHA 4IXTA 2WJPA 1Y8QB 4M87A 3RCBA 4BGUA 3WIEA 4BO9A 4CQMD 3M1AA 1GDHA 3NT2A 1YQGA 4BO3A 1DHTA 1UXIA 2AE2A 2IZZA 3N58A 3PLNA 4IM7A 3DHNA 1FMCA 1YDWA 5JAQA 4U8GA 3AY7A 3MTGA 5IXSA 3L07A 4QO8A 1ISIA 1YL6A 2PR2A 2YJZA 4DGSA 1V3VA 2EGHA 2QRKA 2TMDA 3MOIA 3JD4A 4RF3A 2X0RA 4B7XA 2VWPA 1GQYA 1EFLA 5JE8A 3JQBC 4RVHA 3OEWA 4FOOA 3FWZA 4LVCA 5B4UA 1I10A 4IQGA 1P1RA 4GAEA 3FBGA 3WOHA 5I9NA 3VZQA 3BMQB 2QW8A 5F1PA 3OA2A 5I7FA 4AJ2A 4AJIA 1DFHA 4KUGA 4KQWA 4L75A 4NU6A 3WS7A 4GLOA 4ZQBA 1JWAB 2DFDA 1KS9A 2UVDA 1TT5B 4A27A 1X0XA 2EIHA 2WD8A 3G49A 2VTDA 4M89A 5T57A 4A0SA 1LC0A 3GHYA 4MP3A 5FI5A 3JYLA 2A92A 1W0CA 3NV9A 1UXJA 3WB9A 3KSUA 4E4YA 3E9NA 4YAKA 2B35A 2YHIA 3HHPA 2YW9A 1YQXA 2VNAA 2DLDA 4GKBA 4II2A 4O5OA 4B8WA 3GQVA 4BO4A 4YXFA 5IF3A 1GZ3A 3F9IA 4FFPA 1HLDA 3OQ1A 2Y1OA 5L45A 3G1UA 1MFZA 7ADHA 3DOCA 4XQ9A 1T2CA 3BHMA 4ALMA 3RSHA 1NFQA 4J16A 3AUAA 2NTJA 4D0SA 3G1TA 3BYZA 1CQIA 1DFIA 4WNCA 3RUAA 3GRKA 3Q3CA 3KZVA 3SC4A 5ICMA 1M66A 1JKFA 3H9GA 3RBXA 2NVBA 1PS9A 3QWAA 2VUUA 1QV6A 3LC1O 4E30A 4FR5A 4J49A 3E5MA 2JHGA 4FIZA 4II3A 4ZU3A 4EUHA 2QZ9A 4NJOA 1GPJA 5A9RA 2E6UX 2PY6A 4RF2A 1SO8A 4WCDA 3MWEB 3ZHBA 3KYDA 3PZBA 5CAEA 2GASA 1R0SA 3D64A 4BNMA 4K1LA 3JQAD 1A9YA 1JW9B 5G0WA 1PZGA 3VVBA 3OICA 5ADHA 3SBOA 2W2LD 3NDIA 4MVJA 5DN9A 3PVZA 3R6DA 3A4VA 2EEZA 3JQ8A 1NWHA 1FDWA 2BHLA 4MP6A 5KJFA 3WQRA 5CDUA 3GMSA 1UDBA 5K9ZA 1LDNA 3WSWA 1DRUA 3KOUA 3WLEA 4BNKA 4E12A 1BDMA 5DOVA 3FSRA 2DTXA 4LVUA 4CM1A 2C59A 3H9QA 4R1SA 1DLJA 4IGFA 3Q0EA 5KWEA 3PK0A 3DHYA 1PWZA 4FCCA 3NDRA 1Q7BA 3NJ4A 1PQWA 3EVTA 3WMWA 2NWQA 4GWGA 3S8MA 3GR6A 3QVSA 2VZ9A 4GGPA 3C1OA 2GYYA 5IDXA 1D3AA 4RLHA 2NQTA 2DAPA 4RPHA 4DC1A 2NADA 3PP8A 1HDOA 2ILTA 4DL9A 4I9UA 2JCXA 4BNYA 5L3ZA 1KYQA 2O3JA 2OMEA 4BKRA 4OQZA 5T5QA 3NTRA 3HADA 3I83A 1XLTA 8LDHA 2EP5A 1DIGA 2HO5A 2GF2A 2LDXA 1QG6A 3NDJA 1CETA 1DC4A 1IHXA 2B37A 3JQFC 4NNJA 1XDWA 4ZA2A 4UEOA 4BGIA 1V3TA 3PWKA 4MIOA 3HG7A 3AOEC 4IDCA 2VUSA 4E6PA 1YL5A 4YJFB 1N1EA 4O63O 3K6JA 4Q3CA 2VOEA 1PQPA 2DT5A 4DQXA 2Z95A 2B36A 2HSDA 3IMFA 5IAAA 3VAZA 1NP3A 3JQDA 2X5OA 4Z9XA 1UJMA 3GVCA 4NJMB 1T24A 2C7VA 2W2KA 3F5SA 5EIOA 4FDAA 2D5AA 3RAJA 1D7OA 3FR7A 4BGVA 1E7WA 5F3RA 4D79A 3GPDG 1V8BA 1X7GA 1C0KA 4FGSA 5A02A 3TWOA 1GCOA 1NXQA 2Y0DA 3OJEA 5TNXA 1DFGA 3ADPA 4BO5A 1R4NA 3AUTA 5C7LO 1YKFA 4M55A 3GDOA 3TN7A 2IEBA 3INGA 3I9JA 4BNIA 3ASVA 2WTBA 1A5ZA 3C3XA 5L4SA 3EVNA 2CVOA 3GEGA 1JTVA 3QRWA 4UREA 2IXBA 4RL6A 3G79A 3LU1A 1WXDA 3JQAA 3JQBA 3QSGA 4E2WA 2SCUA 1ZK3A 2W2LA 2HMVA 2XAAA 1GCUA 3QWIA 1PJBA 4OXNA 5L4NA 3H3FA 2FPGA 2FPPA 4BNUA 1GV0A 1P1JA 3KLPX 5FYDA 1R4NB 4J2OA 3RBVA 2VHXA 2Y1CA 3PYXA 1NPYA 5B4TA 3DBLA 2O4UX 1G1AA 4IINA 1OFGA 1T4BA 3UAGA 5THKA 1OOEA 1PQUA 5BR7A 4KUEA 4OKNA 1ADFA 4YJGB 4A03A 4DWVA 3GHHA 1SOVA 3E6AA 1HETA 3H7AA
chains in the Genus database with same CATH superfamily
2HJSA 3U16A 1CEYA 1MA3A 4WA8A 5FTJA 1UBRS 4G9BA 1NW9B 3CEPB 4OYHA 4JA0A 5E6RA 2VT3A 2CF5A 2YOHA 1M2NA 2B4YA 1RABA 2A5FA 4LY6A 3WLFA 4BBAA 2X4GA 2FJUA 2PZKA 5ALEA 4DQLA 3L8EA 1M2EA 1DE0A 1WO8A 1B4DA 2DM6A 3RRNA 2XE7A 1JR3A 1GXSB 3OMWA 5E6UB 2NU7B 3R3VA 4QXQA 5I7VA 3VO2A 5IEJA 3CH5A 4F93B 5FOTA 5CFQA 5ICEA 1FFYA 1E1QA 3KEQA 4G1EB 1V6SA 3PX2A 1EHCA 1TVKB 1ZESA 3P2JA 1PGPA 1EG2A 4YRKA 5JEEA 3ZV3A 4JELA 2R1ZA 1AM4D 3IELA 4ABTA 4AJHA 2B5WA 1MV5A 3FTCA 5C18A 4MW2A 1KS2A 1Y6GA 4C07A 2WIGA 5I5EA 4G5RA 3T6KA 2QNBA 3QBEA 2DULA 4HNQA 3USCS 4YX9A 3MJCA 3FPAA 2WSSA 8ABPA 2IH5A 1PL6A 1B6GA 3NHUA 3P9QA 2VHUA 4GQIA 5DULA 4YV2A 2NUBA 2FK7A 2GAFA 2ZRJA 3E81A 3AF6A 2WILA 1U02A 3TTWA 1CJBA 3WP0A 1QQ7A 3PRKE 1A5TA 2QTBA 3TIGA 5C8YF 5F9HA 2WF8A 1GRVA 1NFRA 2BFBB 3AKYA 4WXMA 3FMIA 4P22A 2P3QA 4Y2VA 3DF9A 4Q4JA 3SFTA 4BECA 5K8JB 4EKYA 4TKZA 3HBAA 1E3JA 1NQ5A 1WEHA 3PJGA 5JZ9A 1D0VA 3WHLA 4OQDA 1W36D 1QHGA 3HCWA 4XDZA 1WZEA 3VU9A 1NX9A 3EA0A 3LPMA 4D6YA 1XBTA 4IPTA 5EZQA 3BH6A 3HDYA 2QDXA 3KQOA 4JIMA 4OJYA 4YFYA 1IZZA 3ET4A 1L5MA 4J9UE 4IGAA 3RS7A 3FGOA 3IP7A 4DZZA 1DIAA 1EXMA 4E07A 3V4PB 4CTMA 1TF5A 2ZE6A 3G0BA 1K0UA 3NXSA 1UPUA 3CUTA 3ZYCA 4E2XA 4NARA 2QQ5A 2FR8A 5AJTA 1MPXA 3SWWA 1H2FA 1NMXA 4ENRA 5CB4A 5K20A 1KAEA 1W34A 3PHIA 1QGDA 1H2ZA 2WZQA 3B1JA 1E2MA 5EMJA 1I3KA 4LK2A 2P3LA 1HDXA 5CT6A 2XCUA 5LZ7A 5JAIA 1L5FA 5D1NA 3F1LA 1H2BA 2IODA 5TQ0B 1FFSA 1W96A 1I33A 2Z3ZA 4DNFA 1Z2AA 2CZGA 2NVWA 2JAQA 3HP1A 4KLCA 1F9EA 4L8LA 4M60A 4QVGA 2V7WA 5FRDA 3L8FA 1HNZB 3JQFA 2QR5A 2E7ZA 4DCTA 2JJYA 4POOA 2WWWA 2QN3A 4Z9YA 5YASA 3SEAA 2W71A 4BL5A 5CX1B 2R86A 3FHTA 2MSEB 3NNNA 4JU8A 4XB2A 4FILA 1FDSA 2PLAA 5KVQA 1UXGA 4BEBA 4XJXA 4QXMA 5LWQA 5AUNB 2CW5A 3GJ7A 2J4CA 5THQA 3R75A 1Y6RA 4M76B 4YBZA 3VO1A 1LRKA 2CL7X 4BTVA 4UTVA 4J3JA 4V0SA 4E1AA 1LPMA 1CLEA 2VCEA 2YYZA 2ZR7A 3OE7A 1K8ZB 1OAKA 3Q85A 4QPZA 1G60A 1JHRA 5ALNA 3UMFA 4MVJG 4BNTA 3CUWA 2ACWA 2NGRA 4ACAA 3EBPA 4GLLA 2QJFA 4QQNA 4G9GA 2A9PA 3S8EA 5BSVA 3PPXA 2YY5A 1TADA 3SDSA 3HZRA 3HA7A 5L6LB 1NRWA 3D4BA 5AKEA 3EMDA 1P45A 1ZLXA 3UWSA 1QTNA 5CBPB 1I0IA 5J1SB 4AY6A 1KETA 2YXNA 4QECA 2CN1A 3FYUC 4AMYA 2GB4A 1RCTE 2R68A 3EVEA 3P7MA 1M34B 4GQAA 3NIWA 3W2FA 3CX3A 3WIOA 1PJCA 1T6BY 4OBWA 1TGVA 3U4CA 4UBIA 3NBKA 1VL0A 2VRNA 2NPFA 3LQ1A 2D1RA 1YA6A 2VP5A 1OH5A 1J23A 2I62A 2VBGA 3BFXA 4BWYA 4GWLA 1X15A 3GAFA 2LUOA 1NXPA 2FZVA 2JGLA 5B1IA 1VCMA 4R41A 3RU9A 4IUCS 4L4ZA 1E3TA 4TXMA 2VPPA 4UDNA 4BNWA 3EPJA 1B6SA 3W7BA 3M2TA 4GYWA 1TW3A 1QAQA 1ZYUA 2DKFA 3JQ9C 4IJQA 1XZKA 3BAZA 5IZCC 2O2IA 3X1MA 3L7KA 1YC2A 3HU1A 2NV6A 3WLIA 3IOBA 1F4PA 3BQMB 3IAFA 3RUFA 3WSVA 2IHJA 4ARCA 5BUSA 2CMFA 2DOKA 4FT2A 4JXJA 4ESVA 3KQKA 5J58A 2P9GA 2IFTA 5DP1A 1KFBB 2J5XA 3KV1A 3LVQE 4DC0A 3QVVA 3R41A 3VC3A 2JLUA 3KRTA 4EFDA 3DBVO 4MLPA 4MV7A 4L3WA 2X2EA 5LIPA 4UMDA 4B4UA 4CKBB 3Q7SA 2C0QA 1TNDA 1MB4A 1C1DA 2BFDB 2HDWA 3B51X 2EG9A 4TTIA 3RVNA 4K6HA 3FJ1A 3IBTA 3VKVA 1P33A 1JYFA 2W8BA 1XTRA 1P29A 3WA6A 2O2CA 5E2AA 1JN0A 2OV4A 3UT5B 4JEIA 5TIIA 1V6CA 4JD5A 2BFAA 2NYVA 4NFYA 3C4JA 2A35A 2HK7A 2AYZA 2XYVA 2H1CA 4RGQA 2HLDA 5DMHA 5ETJA 1UAYA 1PIWA 5EZYB 4ZYLA 2RAVA 5K3DA 2I67A 1DQZA 1AGRA 3GUHA 4DJDC 1KZYC 1N6NA 4DCUA 4MB6A 1SHLA 2JCSA 1V1RB 4I1VA 2CDCA 4EYQA 1BCSB 3MT8A 2BZ0A 3UB2A 4OD0A 4DAEA 3BG5A 3G0CA 4P4GA 4ZPJA 4BO3A 1UCFA 1QH1A 2EFGA 1DKNA 2GLTA 4L8VA 4QUBA 5TRTA 4A8JC 1N34B 1DC6A 2CEKA 4A16A 4QLOA 4BTLA 2A1TR 3KYCA 2ZJ6A 3GZ4A 2EOAA 2REXB 3NAZA 2G67A 2ZRCA 2AT1A 4X95A 5H82A 1JU9A 4RZ2A 3DDHA 2RGWA 2RHTA 3MMXA 4C7VA 2YQ4A 4YXWA 1X1BA 2EZ4A 3PUVA 1F2DA 4IGEA 3WGTA 4H6XA 4RZ3A 2G5GX 1W94A 3WYBA 5IBCA 3JR3A 4XUCA 5FNZA 4YR7A 5ALTA 1PSZA 3PGJA 3MPUA 2FFBA 5KTNA 2JFGA 3NWBA 3QWBA 4R3UC 4E3WA 1VRWA 3BERA 3PCTA 1U3DA 3DC7A 2ZB7A 1EFPA 2J41A 4KXMA 4UPDA 4ZAZA 3UANA 3RADC 1ZR4A 2YYSA 5EY5B 2QRMA 2DERA 5CVDA 1PZXA 1QRRA 2XR1A 3IPAA 4K9RA 3GYBA 2HEGA 3L05A 1E4VA 4MWEA 5LQKA 1RACA 2GK4A 2QRVA 3DUFA 1SBZA 1E2PA 4NCHA 1AS2A 3PI6A 2KYRA 4DNOA 4Q1BA 1DADA 1RZ3A 1KTVA 2D2IA 3I3SR 2FOLA 4PLGA 1PJ2A 3EZGA 1PFQA 3P0IA 4QDJA 5M29A 2B1GA 5DI3A 4IRMA 3SEFA 3WLRA 3K2BA 3VNUA 3BTOA 2BKVA 3QHPA 2AX3A 1P73A 4UHDA 4OKIA 4UW9A 4UZEA 2CUTA 5FBZA 4Q1EA 5IBQA 1JT2A 4D9FA 3PD0A 4ZOLA 4ZN6A 3I5YA 4GUAA 2OQ2A 3WFJA 4TS4A 4YTEA 4ZYYA 3DDCA 2IZ6A 1Y5IA 4Z0HO 1YTUA 4JFRA 1HM5A 1KZ7B 1QLHA 3HKCA 2YWHA 1IATA 3OO0A 4IKOA 5CVVA 1W9MA 3T35A 4YASA 3PB3A 3KQTA 1ZL0A 4G24A 1SA0A 2DBQA 2QWXA 1QOPB 3P2KA 4GZ3A 4WPGA 5IULC 5H0IA 5C51B 3A9CA 2VXCA 2BEWA 4J1NA 3WHPA 5CFNA 5JSHA 1NY6A 1WUYA 2GD1O 5MFZA 4BVHA 5BOSB 1CY8A 2FWMX 3ZLTA 2YFHA 1FFWA 2JH8A 4MV8A 1ZJ6A 2OO5C 3ECSA 4IH4A 2ERCA 4NI5A 2XTMA 3HYNA 3PFKA 5H3HA 3MMZA 4C01A 3GRUA 3TW4A 1NI5A 2PMCA 3TGWA 1ZCFA 4I9HA 2Z5FA 1N3LA 5BMVB 2JJ1A 2RGRA 1WABA 4H60A 3ZBUA 3OC6A 4I19A 3W1VA 1QH9A 2TECE 3E8MA 4DG9A 1T1SA 4I5GA 2PT6A 3HJTA 4N39A 4A8HA 2Q2WA 4IJSA 2W58A 4V3BA 3CR7A 1A4IA 3PGKA 5LU8A 1GSIA 2Q0XA 4HDCA 3ZE8A 1YASA 4Z2YA 1QO7A 2X0DA 4F96A 5K8VA 1ZKMA 5J2UF 2IIVA 3PJDA 1YHNA 3R7FA 3ROKA 3PBKA 2QZ4A 5T4FA 2GCPA 3EQ9A 1T91A 2QW1A 3S99A 4YWHA 1DQNA 4I1UA 1RJGA 1WMDA 2VDQB 1MN6A 1NRJB 1P39A 4GH5A 4ER5A 4ETIA 2JCYA 1SG9A 2ZVJA 2C5BA 3AIMA 2CVPA 3CURA 1DU4A 1CR2A 2JHCA 2VJPA 3BMOA 5A3RA 1NUPA 1YS2X 3EGEA 3HEMA 2Q7XA 4NMLA 2OOSA 4O4IF 2PCJA 1J8QA 1JVSA 3D3JA 3JQ7A 1ISSA 3IQHX 2FMHA 3BD9A 3I6ZA 1HXHA 4FMPA 2PX2A 4AK9A 4EGFA 1DIRA 1XTJA 4FJ2A 2PZFA 1JBQA 4BKQA 4UCWA 3DDWA 3BWDD 1H5UA 4OIMA 2MSWA 4LXGA 5I7UA 5KNCH 1ESZA 4X20A 1E32A 1YBMA 5G4KB 2I6QA 4W5WA 3VAYA 2JJQA 3WRYC 4FBGA 4PAOA 4R9VA 3PJRA 4XLLA 5G41A 4B33A 1LSSA 2IGBA 4P3KA 4M0LA 4N0PA 3HN7A 1J1UA 4AUKA 2FP4B 4H77A 1I6MA 4KVZA 3ZWVA 3S1AB 3AB7A 2UZ4A 1WDMA 1NC3A 1UWVA 3M6MD 5K3OA 1MJHA 4LTMA 3GN1A 2E9SA 1C3OB 2WYVA 3C98A 5JPIA 3F97A 2V6GA 3VUEA 2QZJA 5BN4A 4L72A 1JG1A 5KCMA 1WVIA 3EXEA 1KIAA 1KZ6A 3KXPA 1YO6A 5A4MS 1PG0A 2G1KA 3T1VA 3TSOA 1SXJB 2HKIA 2B98A 4ZODA 4FGJA 1SCUA 1GR1A 1Y82A 1EGMB 3AG6A 3O8DA 4JQYA 4RA9A 1I7SB 2BFEB 1HWYA 1IHYA 4R8RA 2PEZA 2D06A 2GTIA 4YRMA 1U9JA 2HV9A 1A76A 3AMVA 2WIAA 3MZ0A 4PQRA 2COKA 3VAAA 4DSOA 3TRKA 1NE7A 3ILHA 3PYLA 3QA3E 4QQKA 1X1SA 2WZBA 4J43A 5REQB 3ZZTA 1D4OA 2CD9A 4OJNA 3GX1A 4Y2GA 2QM8A 4C29A 3AC0A 4NBKA 4XVQA 2UVPB 1Q3HA 4MVJD 3O8NA 2H1RA 1ZRHA 2ZRAA 4I50F 1SC4A 1U5BA 3HN2A 1V39A 4CV0A 1BG6A 1Q50A 4HDAA 4WNAA 2BWJA 4BAZA 4Z4IA 3WV4A 2GERA 3EXHC 2UAGA 3EEFA 5KDLA 1KPHA 3U4DA 3IA7A 3OJ0A 5KVCA 5KYYB 2XB2A 1LZLA 4P4NA 4YT5A 4BUZA 3JAKB 3DEYX 1FNNA 2B7BA 2H1HA 2J3QA 2D59A 3HXKA 1W87A 2PN1A 3MGAA 4XX1A 1I0ZA 1N6OA 2CMHA 2PL5A 1RZVA 2Z09A 3B6EA 1HDYA 3E7FA 2C4MA 3T7CA 5HE8A 3CE6A 2YFQA 3TTTA 1EBFA 1RLUA 5DLQC 3IKVA 3VOAA 2BBWA 1T8UA 3EVCA 3RFTA 2BH9A 1QAOA 5KYUA 1GL6A 1W0KA 3VI4B 4GOKA 1OIVA 3M5CA 3IT3A 4JUFA 4O2AA 1NV8A 1R5JA 1WR8A 1GY8A 1QZUA 2OGWA 1KP3A 3I9V6 2K7FA 4GKKB 4CDNA 3DLHA 1NVTA 3A4MA 5DK4A 1HZJA 1QRTA 3PTLA 4IQ8A 1O6GA 5AK0A 1UFOA 3T7RA 1KSGA 4HDNA 3AF1A 1ULAA 2BRUA 5EKTA 2IU6A 4L9RA 5JAMA 1U5AA 5LD2B 3C1TA 3HVIA 4F7DA 3LYHA 4BS9A 3BWCA 2AHRA 3LV8A 4E14A 3OF3A 1O9BA 5IVDA 4DWJA 1RLOA 4MI9A 4ZCPA 2W4IA 3O0TA 3B9RA 2HJWA 3KV3O 2OBYA 4PNEA 2YXDA 1IY1A 2G4CA 4MS1B 5DM2A 3ZCPA 1JBKA 3U3JA 3CLSC 2ZI4A 4PZUA 5EXSA 2UYHA 2B34A 3PIIA 2Q1YA 2O9JA 1Q83A 5CP8A 3M4YA 3GUZA 1PRYA 1P19A 1QGOA 3LCVB 2CXXA 1PLJA 3JWPA 5JFTA 3DMPA 4JBLA 3GLHB 3S7ZA 4CCYB 4ZMRA 4ZZIA 3IAAA 3ICCA 3KTDA 1YJBA 3UQZA 5CEJA 3BXXA 3NDPA 4XVRA 1LTQA 3COPA 4L5CA 3TNDA 1B15A 4HGZA 4E32A 3DBRB 1NURA 3LLVA 4BO8A 4DMKA 1OZ0A 3T3NA 1IXRC 1G7RA 1N1MA 2NO6A 1H66A 2DHQA 4I1OA 4JP8A 2IYUA 3BCRA 4IICA 4YREA 3UYLA 4MQEA 5KWSA 2D4AA 1FXSA 4EH1A 5J5VA 3ZBTA 1GTJ1 3R3JA 3I4CA 4YH1A 1ZP6A 5DTRA 4FQ5A 2EFYA 1H6CA 1QVWA 5CH8A 4AECA 3Q3JB 1GPKA 2VPYA 2EJWA 4K6CA 4ASUA 4DLPA 3OQMA 2QHXA 2ZIEA 3O2JA 1EWQA 3NTQA 3AFIA 2L69A 2PIDA 1HT2E 4KI0A 1ZD9A 1H6AA 4PO8A 5F77A 3P19A 1T3SA 2R65A 3BTUA 4IYRA 3ETGA 1C7FA 1J8VA 2ACEA 2FW6A 1HKHA 3KFVA 3UKJA 3QLVA 3U9SA 4JVMA 1A9PA 4LDZA 5K0ZA 3HLKA 3MYRA 1B23P 2GLUA 3T0FA 2ZUTA 1P3JA 3I34X 1Y3DE 3L7AA 1L3IA 1CEXA 3NIGB 3CE9A 1KNQA 1OIWA 3O8RA 2FAXA 1BJTA 5JSKA 3IPRA 2CV1A 5B55A 2F8MA 3NRCA 4CV3A 3ROFA 4NAVA 1BHQ1 3VTKA 2P2NA 3MWFA 4KXNA 2UZAA 2R00C 2G82A 4L07A 2HZ7A 5LMNB 1VKNA 2BI4A 1VBFA 1IU9A 2EZ8A 2GNOA 2ZZKA 1KDRA 3CX6A 3DMTC 2ZUSA 5GZ3A 2GSDA 2UUAB 2J5QA 4JLVA 1WKVA 4JL8A 1PJRA 3TNJA 3DDUA 1GT91 3CLSD 3D5EA 3Q7PA 4M98A 1DO0A 3BJMA 1CD5A 4QEDA 2NSHA 2ZTUA 4X61A 4G5QA 4RDHA 5AW1A 3SZ3A 3O73A 1KQ3A 4JGBA 2A78A 4G5XA 4JHXA 2WUFA 5THXA 3W05A 2XBMA 3MCZA 3T4UA 2XUZA 4YJFA 1PBNA 2ONZA 5K6AA 4AKHA 2YQ5A 5AOCA 4DG5A 4TKVA 3LPLA 4NYMR 3A6PC 5JY1A 4O02B 1V7CA 4KJXA 4YRLA 2PAFA 1OREA 4GXTA 2LZ0A 2GK7A 5CEEA 2YZGA 2NZVG 1NW8A 1ZY2A 3G1WA 2ETXA 2D3WA 3PQ2A 2WJGA 2NX2A 3HA2A 4Z1MA 2IWHA 2XDAA 4YAJA 5DIFA 5K3EA 2F8LA 3D3EA 1EQ2A 1VE5A 2EFCB 2UYCA 2G4VA 1S5PA 4XYGA 4KCGA 2AOTB 4RLQA 3M89A 2NUAA 1BE8A 3DNFA 4KGDA 3AIIA 4NABA 4U7TB 2Y1KA 5GOTA 2GEKA 4D4JA 4QDKA 2Q27A 3G7SA 1XZCA 4DXDA 2XTNA 4B48A 4JJ6A 3PFCA 2HQBA 2IEYA 3A9WA 1JAXA 3FZNA 4EKNB 3FFWA 2EVWX 4WCFC 4F9EA 1B0AA 2OFOA 2VYVD 1D1SA 5A2QA 3USES 5FAKA 5JPDA 1EFCA 4RVSA 2O8FA 4MQLA 3MRXA 3DQPA 1QHHB 5JLJA 2LWIA 4D9EA 1VL1A 2Q6LA 2ATEA 3DE2X 3HBFA 3R2JA 4BKUA 3EC2A 5DBIA 4AI6A 2WF7A 1RQRA 1ECBA 4E7OA 5F5NA 4MS3A 4P9NA 4LBYA 2WY2D 1UPBA 3RK4A 4D82A 1QU2A 2C2OA 1XZLA 1X7XA 3ZNQA 2M6SA 2QAGB 3C8UA 1CZUA 4DRYA 2OCYC 3UTCA 1R8XA 3SR0A 5A5FA 4HQKA 3JU3A 5LYJF 3GG9A 4TQ9A 5E0KB 1T4DA 3N8IA 9LDTA 4W5HA 1FU4A 2JDIA 1BXRA 2MSNA 4GMXA 1NU8A 2QVYX 2X2PA 4DIOA 5D6OA 5I9LA 4DEVA 1Q0ZA 3L41A 5C35A 5FJJA 1YZ3A 2Q28A 2P5UA 5BN1A 3H2SA 2OCXA 2BFCB 1W73A 1GPNA 4IZ6A 4WQMA 1ZA2A 3RK0A 3KHTA 3QLUA 1RMQA 3M6FA 4LRSB 2ZE5A 1EP3B 2Y92A 5GM1A 3WRWA 4KMSA 1YUMA 1T35A 5BN5B 4G56A 3VC1A 2JLBA 5C5CA 5C8YB 1GAQA 3V7UA 1U2DA 3DBOB 2I8CA 1R0BA 3GCXA 5L7TA 3M6IA 4TWZA 4YQFA 2X0JA 1W75A 1PE0A 3V4VB 1EFRA 1V95A 1XKLA 3SYMA 1G8KA 2LDBA 3FBWA 3T3OA 3B2EA 3L8CA 1JFRA 1SOAA 1PX0A 1DG1G 1Q91A 2F1IA 4XD7D 3RIEA 1GTRA 1SK8A 1C80A 4NYMQ 3G8AA 3MIZA 3VFDA 3AVTA 4K87A 1JIIA 2KQUA 4CEIB 1D6NA 1R9MA 3G2OA 4HDRA 3V1KA 3OIFA 1KEZA 2P40A 3EQ2A 4G81A 3CXRA 4ID3A 1DC7A 3F46A 3ND7A 2FMIA 2QNRA 1N8TA 4E46A 2VHYA 3L2OB 3BCUA 1BX3A 1L4MA 2RK4A 2QD4A 2PUFA 2ZI9A 3PQ6A 3QQ5A 4QUEA 1UDRA 4AF6A 1POWA 4CL3A 3IHWA 4GNKA 2V9PA 4DJEC 1PP4A 3QUBA 1FRVA 1OIXA 1HTWA 1NJ6A 1QM5A 1M6YA 1U2ZA 1WVGA 1ZCBA 3BQNB 3FIJA 1E6UA 4FHCA 4AICA 3TFOA 2A9KA 1CZHA 1ZRMA 2A1IA 2JANA 2OK8A 5LR6A 3DYBA 5F7ZA 2XZPA 2WF6A 4ERNA 3ORYA 1P1KA 3ZWWA 1NU6A 4JBXA 4FJ1A 3TRFA 3IAS1 1IBCA 2PX0A 5GVSA 4G1CA 1VI6A 4RS3A 2HMTA 2AFHA 3U37A 1J7JA 3DZIA 4CMAA 1D1PA 1C9MA 1VB3A 1D4ZA 3PC6A 4U7WA 5LN1A 1E59A 1XE3A 1LWOA 1KO1A 2GXQA 2CF6A 2JVKA 4C4TA 4QVIA 1MQAA 1G17A 1JQEA 1L6IA 4LHSA 4UHEA 1W0JD 1JVNA 1EH5A 1WB5A 3MEQA 4JODA 2WZCA 2PFGA 3VJMA 1Q11A 1S9HA 5ULLA 1TD9A 2YIVX 3AP3A 3RSZA 3PXCX 4I4TA 3OOSA 4JP3A 5BW6B 3OFNA 2Z6AA 1WEKA 2H54A 1C7QA 2FPKA 4I66A 2ARKA 4ZRNA 2NVUB 4BC1A 5AK5A 3RR2A 4ER0A 4ZGBA 1NUSA 1BKSB 2OG2A 1QCZA 5AVXA 1PGQA 4RCYA 1GU0A 2H3HA 1Z4NA 4KR0A 1CYDA 2CLCX 1WZIA 1VYUA 4DCOA 2OESA 4Q4CA 1W76A 4YCAA 4RSHA 3WFIA 1Z28A 3FXAA 3ELUA 3QE4A 4KPGA 3RC9A 3ZDEA 1AZTA 2YQZA 4KQ6A 1MEJA 2WFLA 3VMMA 4UARA 1M0EA 4WLUA 2AN9A 3IEXA 3QUSA 1UJBA 1VJ0A 4G5YA 4W82A 2ISSD 4D4KA 1H42A 3PFGA 1S8FA 3U44B 3H4MA 4LMRA 3KUCA 5EWJA 5K51A 3HDHA 1XDSA 3X1WA 5LUAA 2VTBB 2HLPA 1HQYE 4QFMA 3GZTB 1GD1O 4ML3A 1L8AA 1RZRD 1JFSA 1N0UA 3MCWA 3CEAA 4X54A 1G21A 2YZ7A 1ZJ5A 2REQA 3JATB 3CLTC 3AEYA 1HGXA 4MH0R 3HCAA 4RF5A 5CM9C 1G18A 5DLPA 5JWOA 2QS9A 3AM5A 2AOWA 4Q3AA 1RHMA 1OKKA 1TJ5A 2DMRA 4IGIA 4OHOA 2JFZA 1AZWA 3A32A 1NPDA 1JFVA 3MIIA 3R6WA 5JAOA 4HQLA 3HZHA 1DTWB 3K96A 4WN9A 5FWAA 3UJ8A 4FQ8A 4KDFA 4GYKA 5JAZA 5LB2A 3IJRA 1WVMA 1X7YA 2OGUA 5KDOA 1D6SA 1QMGA 4B2LA 4A1FA 5L3QB 1FYEA 1U8XX 5I7HA 4F9TA 1JS1X 1NYQA 3QELB 1V16B 4J3NA 2O19A 4AY3A 1O0CA 1RI4A 1G8SA 2W42A 2OB2A 3QX7A 1TU4A 5G3ZA 4AUNA 1ADYA 1SEVA 4J29A 3KQQA 5AICA 1YVPA 4LZJA 2HSWA 3ORRA 5C7OO 4YONB 5ALDA 2BJWA 1YS4A 2R44A 1CJUC 3CQ9A 3FDIA 1WUHS 3I23A 4IP0A 1WCIB 3QY9A 4X1YB 3U17A 3EVAA 1P7PA 3I5AA 3HJUA 3PVSA 1K98A 1RFGE 4KRXA 4EJMA 1RPZA 2FK8A 3E7WA 3J7TA 5IKMA 1B0PA 3SJBA 3VZBA 2RI1A 1T0JB 3PU6A 1ES9A 3GDFA 3CWCA 4Q9JA 1SM4A 2D0IA 1XNGA 1YZNA 2Q5JA 1DJPA 4MV6A 5DH9A 4Z54A 2Q99A 4OGWA 1NVMB 3BFKA 1U6IA 2IUYA 1TUGA 1EVZA 2A94A 3RVLA 1SWWA 5F9FA 3TDMA 1NBEA 2HF9A 4E09A 1OROA 3TW8B 1XD8A 3QTTA 3ZZ1A 1R6BX 2XA9A 4B34A 1MPTA 1T0IA 3KU4A 1SIBE 1SXJC 4BASA 4EJ6A 5GJCA 3I6QA 2VAVA 4ZVTA 2AZXA 1U3VA 2PT7A 2BGKA 4RC9A 4RPJA 1H85A 4JB2A 2PMWB 1M1YB 2GN2A 1F2TA 4B73A 1ZGGA 5ALZA 4DR1B 3CLTD 2DB3A 1K06A 2V4UA 4TGLA 1AA6A 4H7IA 3VXKA 1IULA 4LXTA 1YDGA 1IAQA 4TWRA 5KTTA 4AUMA 2VF4X 2BGLA 3CPJB 3A6DA 1UKAA 3AO0B 2XH8A 3BMCB 5EWMB 1CJSA 1KVTA 3GROA 4YN3A 4BU0A 3GUVA 3WIUA 3FPJA 2V74B 1NPTO 3VQTA 4OLBA 5BUQA 1YS7A 2GEVA 4AROA 2QTNA 2XHEA 2YXPX 1QCYA 3GQBB 4HVTA 4KR2A 2J85A 4YPFA 3IVXA 1P2VA 3CZMA 3HCFA 1RC0A 1YZTA 4QBFA 1QP8A 5I9IA 1ZUWA 2XE8A 4CQLA 2C7RA 2JLYA 1IEWA 5B3JA 4ZANA 1JG7A 4RVCA 5H8WA 3R9XA 5I9TA 1Y1SA 3JAWA 2EGUA 2QYTA 3QKSB 3N8NA 5LLDA 2BFNA 3H8JA 3AM4A 2FKNA 5KYTA 5LJLA 3MAJA 3DEAA 3WDMA 2CNWA 5IC6A 3MOGA 3WDKA 2B1JA 2H1SA 3NX4A 5I7WA 1U31A 4JQZA 5BRNA 2JFWA 4CF3A 5EXXA 2NUTA 5JD5A 4YRJA 1SD1A 5IWCA 3D8NA 4J7AA 1KMQA 4IDXA 1Z18A 1W8DA 2WJWA 3FUXA 2CNNA 5AM4A 3F7MA 3LPAA 1FDOA 1B8VA 2VRWA 3ED5A 5KHOC 1OB5A 3F4BA 3PL1A 3L1JA 1LBEA 3QBJA 2YN2A 4URHA 3MJFA 4EYEA 4JUCA 2WNHA 4AY5A 3KWFA 1TAUA 3K35A 3ZQUA 1J09A 4PSDA 3JARA 3CU5A 4JB3A 2FNAA 2OXIA 4P2GA 4RGBA 5HE9A 4UQLA 5LD2C 1QRDA 3IXQA 4EBFA 2IS6A 3D0KA 4BIMA 2DHDA 3P20A 1K8RA 1CQXA 3JSXA 3WJ1A 1P2UA 3TSYA 2O52A 2P5TB 2OCDA 2WSYB 4FDLA 4OGLA 5FLEX 2ZWPA 5AKIA 1GQSA 1YGPA 3ACCA 4O1MA 5GV7A 2M32A 4RSRA 4RK0A 2N47A 5J2UB 1B14A 3U4GA 5EHZA 4RKFA 1CF4A 2LVBA 2X22A 3NLLA 1Z5OA 4J91A 2XYGA 4L4YA 5JTTA 1DRJA 1AURA 1ONPA 4Q3NA 4CM5A 3C3EA 1JEQB 5ECDA 4L8GA 1ZCJA 5B6JA 3EXG2 1BNCA 3KKMA 2PXHA 3H97A 2C9BA 4LRYA 2Z83A 4CLOB 3FZGA 4QNMA 3V1NA 5FXMA 4G23A 4D45A 5FA6A 5KOHA 2HD4A 1PJLA 5I4BA 1NTRA 1V7QA 4O4IB 4NH4A 4RSMA 1EVKA 2FN4A 3O92A 3R7WB 3VPAA 2H31A 4JLJA 2O07A 3ZY3A 2P9FA 4NIMA 4RE5A 2FJ0A 4A91A 4B8ZA 1O0SA 2MJLA 3FYHA 3L0CA 3L7OA 4C08A 2E0IA 3GEPA 5DNAA 3QI2A 1HORA 3ZWCA 1V6AA 3O82A 1VG0B 1DWPA 4IEIA 1E3QA 1TMKA 2HCRA 4JLUA 4ND4A 4RKYA 3RIGA 4DSNA 1AGXA 4U4AA 4EMSA 1QYWA 2N1BA 1DBQA 5H70A 1XRSB 4IQFA 1UMCB 3I45A 3QJGA 4K9QA 2NV0A 1N4DA 4KITB 1UDXA 2GPJA 1OBFO 3R3YA 3U3DA 5AUQA 1K5HA 4Y67A 5D00A 1A9XB 2H7VA 3I2JA 5EG5A 1RKVA 4Y2YA 2BE7A 4YPVA 3SOPA 3QX8A 4QPCA 3L4BA 2ODQA 2PNFA 3RNOA 3S2YA 3AJ8A 2M6KA 2I3GA 3GU3A 4C5AA 2C07A 4URXR 4L57A 2BSAA 1PWEA 2VHCA 3KYJB 1T29A 4XWTA 2DUWA 3M70A 2IDJA 2O20A 4KAAA 5C7YA 1XZBA 4PSUA 3ETJA 3SIXA 1QOZA 2NU9B 4DCMA 2XE6A 1DKUA 3A2NA 3NFRA 1OWOA 2C7PA 5BNWA 2BMWA 2C88A 2VP0A 3ZLAA 4DV7B 3BIFA 3OLWA 5BWLA 4KTVE 2QPAA 3E9DA 5B57C 3DKIA 4UE6A 2X4DA 3FTEA 5DIZA 3SLKA 3ZQKA 5F2EA 1NJGA 5BRJA 2BGUA 3G6KA 1BXGB 5EIAA 4O4HF 3I01A 2P4UA 4FSHA 1ADCA 3DFMA 3E22B 3H11A 1E60A 2ADFA 3OT1A 4MIYA 1QRUA 2Z9BA 1NLZA 4FN4A 4UVIA 4ZQCB 1SG6A 1F2UA 1H4VB 3E7PA 1VKZA 4XIGS 5FTNA 4GEKA 5DYTA 4EHFA 1ZGCA 1IPHA 2H9IA 2BKUA 4HZUB 3SZGA 3ZLVA 3AY3A 2AZDA 1W4RA 1Z4JA 4DPKA 1MAUA 2D00A 5FL7A 4WCVA 3BCHA 1QK3A 4GP6A 1BRMA 1PGNA 4I6JA 4N1AA 4GNRA 4E5MA 3DMDA 3ZJ5A 2CK3D 4F3NA 1E1YA 4KXVA 4EFMA 1E1DA 3UXHA 3Q7EA 1EWKA 2PKRA 3GJSA 3HB9A 1D2GA 4JI3B 4G0MA 4Q34A 4R84A 5FOSA 3AUKA 2FETA 6ADHA 1Q7TA 2DETA 1DI0A 4YBRA 1VP9A 1H8HD 3A6FA 4PYNA 2HFJA 2I2AA 5K0FA 4WUTA 2FSHA 4JP5A 2ZS9A 4JLNA 2VTEA 3AVQA 5AKKA 3PRYA 3WE7A 1V5IA 1BVYF 3MTJA 3ZXUB 4LSGA 1KRXA 5LOVB 1GFSA 1J8FA 4N3BA 1BZYA 4RULA 1YR6A 1MO3A 3IBSA 1ZRNA 3A04A 5TS2A 5DI9A 2EP8A 1F1BA 5F3WB 3G9XA 2V3VA 3FNBA 4Q00A 4CIYA 1V25A 3GP5A 1YMQA 2OZLA 2VBIA 4EARA 3AWDA 1S8OA 1YJCA 2QAGC 3VKGA 1LI7A 3RS0A 4CM9A 5BXYA 4ZI5A 4RTKA 1Z7YA 3LSTA 2DQZA 2L17A 4R68A 1JNYA 4F86A 2XMZA 3NGMA 1U7UA 3U7QB 2GZHA 1E5DA 1VC2A 4KXXA 3B3AA 3B2QA 3C14C 1FP4A 3PHGA 1JU4A 3M6LA 4YMLA 3CLKA 2II6A 2WAYA 4LZOA 1W36B 2P7IA 1LV7A 1GGNA 2B9EA 2BISA 1M5RA 1QV7A 4WZBA 3FHLA 5KC8A 1ZXBA 1F51E 4YUWA 4QXAA 3LKBA 1L7AA 3E1KA 3H3XA 4GKJB 1Y5MA 3RYIA 2J0EA 2D7JA 1WF6A 4KQMA 1OLOA 1S4MA 2GYWA 1XEXA 3DBIA 3OQBA 5AOBA 3OIUA 2WEKA 5IM4A 2GBLC 4EG7A 1T26A 1F0KA 1LTHR 5I51A 3OAAA 3VR2A 1XSEA 2J6BA 3K2QA 3KOOA 3CYFA 3M4ZA 5F2NA 5JDIC 3EIFA 3L0ZA 3O2NA 3KZOA 2EARA 1N6PA 4QKQA 2DBYA 1EDOA 4PHFA 3QE3A 4QOHA 3HKBA 4GZLA 3H7IA 4LC0A 1JDJA 3GDHA 4FKMA 4TRJA 3CRMA 3NBZC 5E8RA 4BMVA 3BTVA 3VPSA 4J2HA 4QGAA 1SQSA 2QRJA 1N2BA 2QRUA 2ZT7A 2ZSFA 1MORA 1D2RA 1T10A 1FVOA 2P3SA 2PGXA 3C3BA 1JR3E 3HE3A 3HNPA 3O9ZA 2FHPA 2H85A 4MUGA 2WUWE 4BQEA 1NXWA 5HRAA 2YJ4A 5IYZB 1ZH6A 2HXYA 3K15A 1BWSA 4N47A 3ZXYA 1FFAA 2I8AA 5TPWB 3K9QO 3F0TA 4CKEA 4G2NA 3LRXA 4I5IA 4DCVA 2C0CA 1LU9A 1MAWA 1DT5A 1FJHA 1HEUA 1GILA 4IOLA 5CCEA 2CLFB 1EBBA 3KOZA 2ALJA 1Z4MA 4NZPA 2XRZA 3G13A 5DX0A 5JNWA 2GCOB 5JZBA 1VPDA 1D8AA 1I24A 3BXZA 2ZPAA 4ZXFA 2Y27A 3AEQA 3OJWA 4JT9A 4D02A 1IQRA 3DTVA 3KKEA 5DK6A 5IANA 4ZGWA 5C4IA 1MW8X 1KOGA 2ZRHA 2X4IA 2OKCA 3JYPA 4H4CA 4TROA 4R51A 4ESOA 2ZYIA 1PUXA 2XMDA 2JJ2D 1N3YA 2FH5B 3BMNA 3N70A 4XDYA 5KTKA 5LNK1 3HGMA 3AJAA 5UKDA 5HHTA 4DB2A 4RIEA 3QMWA 4TTTS 5LCXA 5KAPA 1O0BA 3NUZA 2VK8A 3PKZA 4X1KB 1DJLA 2CCGA 1NM5C 5HDBB 5IF9A 4PC3A 4DUZB 4B75A 5DB4A 1ENOA 5IBRA 4ZRDA 3R23A 1HLPA 2W2VA 2C1ZA 4M1TA 3CJQA 1Z22A 4AZ3A 4XTRA 4PBSA 2OSVA 3VA7A 1NNEA 1HQCA 1PVVA 2Q4TA 4DXAA 3AY0A 3FVVA 1E64A 3QU5A 1FUYB 3DXZA 3UMYA 5DGDA 3WI7A 4Q93A 3SS9X 3WL7A 3WLSA 3CV3A 3E9YA 4NNOA 4YCJA 4PRZA 1CZNA 1HDCA 3LCCA 5MN4A 2W2NA 1HNNA 5D87A 5ALUA 4OU5A 3ZCVA 3PLRA 3H6GA 4IQ4A 3IKMB 2PV7A 3LQ4A 1OX4B 1IYZA 1GA1A 1VE9A 2B83A 2J3MA 3ECAA 3EWAA 3K16A 4RQAA 5T64A 4A0QA 1Z25A 2UZ0A 3HA3A 4AZWA 9LDBA 3OQIA 3N2NA 4OA5A 2AN3A 1BN7A 3ELYA 1NW5A 1TAQA 4QOSA 2IDMA 3R5JA 3GF4A 2DECA 1PGOA 1MJGM 2PZGA 2YHIB 4KXWA 4C14A 2R85A 1IBLB 4G65A 1X0VA 4FDVA 5FO1A 3WQQA 5LYJB 4D41A 2W0MA 2NTNA 4M1OA 4CPDA 4CETA 2F59A 2EX0A 5GOZA 1I6LA 2HLNA 3N8KA 4EKDA 4LJKA 5ECWA 4JSRA 2X58A 1ZL2A 3BPSA 2AYYA 3B3JA 5F7XA 1YFLA 1VE3A 4E13A 2QD5A 2C00A 1CU1A 3DMRA 2HNBA 5H68A 1ONSA 1G59A 2OQIA 2LP4Y 4NICA 4XUEA 2ZSIA 1MXFA 2FZ5A 3WZLA 3D8SA 4BLWA 2BHSA 1O5TA 2FG7C 5CTJA 3WK4A 3NYRA 2JFFA 1M33A 3I72A 3MHTA 3OZXA 4R5HA 1U7OA 1Q1EA 1F4VA 3T4XA 4JDUA 4RZHA 2PZJA 5J3JA 2DVMA 1GCIA 3K9GA 3UOGA 4B1FA 2R6GA 3LH5A 4HTFA 3AEZA 4Q1AA 2FG5A 2ZYDA 2PZMA 2IOYA 3NS7A 3W77A 1ONBA 3CHYA 1ABEA 1I01A 5JCXA 4R8LA 1JL3A 3KYDB 3O4VA 1O95A 3BHIA 1GTZA 2JLQA 1LXCA 3GGCA 3K1JA 4WZAA 1E98A 5CH3A 4UTOA 4PGFA 4ENSA 1YI1A 3B6ZA 4MDHA 1GUZA 4S1TA 5IN4A 4G85A 4TS1A 4CDGA 1NVDA 4NE2A 3LE8A 4NV1A 1QHIA 1MAAA 3OJOA 4PZCA 5I5GA 4ZZ3A 3F7TA 1HZZC 1N9KA 2POQX 3ETCA 3IE0A 2HHCA 2ZUVA 2OGZA 1F48A 1U3TA 3PA6A 1A7UA 5A04A 3FY4A 5EE9A 3GFTA 2C2BA 2C4NA 1E1CA 5H7XA 3ZK8A 4EMUA 4IZIA 1P60A 4MGKR 3C15C 4N7RA 2Y1WA 3SNHA 5C37A 4ZT4A 2X9GA 4MUKA 3PFNA 3QYPA 2YUIA 3U7FB 5K5EA 4LSMA 2JLZA 2PTHA 4YMSA 2PGDA 2IS1A 2QD1A 2QE7D 3IODA 3DZDA 3V6MA 2P9TA 1K4KA 2ZQYA 4CR8A 1O77A 5HWSA 1ZEJA 2O8EB 1GNRA 1OV6A 4H3SA 3AJDA 1G8GA 2WM3A 2HSGA 3D2CA 3LOQA 4R8MA 4G86A 2ZR9A 5BVGB 3K32A 1AJEA 1SOWA 5D3KA 1S8NA 1UXHA 4U7HA 2PWYA