1IAQA

C-h-ras p21 protein mutant with thr 35 replaced by ser (t35s) complexed with guanosine-5'-[b,g-imido] triphosphate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
149
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDSYRKQVVIDGETCLLDILDTAGQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Dynamic properties of the Ras switch I region and its importance for binding to effectors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 149
sequence length 166
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1iaqA00
5CJPA 5KDLA 1D6JA 1L7VC 3WMEA 4DLXA 1FW6A 2GK6A 1XNJA 1HY3A 2WIBA 2PL3A 621PA 5L3QB 3ZIAD 2IYQA 4LY6A 1QVRA 1E98A 4E07A 4KITB 2JGNA 1AIPA 3UWKA 2Z5FA 1OW3B 1EFRA 3K1JA 3QF4B 4PC3A 1Z8FA 5D3MA 1W46A 4QM6A 3AGPA 2KE5A 1UKZA 2WJVA 3AEZA 3DZDA 2LCFA 3L0IB 5AJWA 3OE7A 1XD8A 2ZUBA 3DOFA 2YINC 4O2RA 4C30A 3A4LA 3M6AA 4RCZA 2A9KA 4NPHA 5J40A 3U4QB 3ZLJA 2RGGA 1RJ9B 3K53A 5CYOA 5EJEA 1FTSA 4CDGA 2ZE6A 4Z8XA 3HU3A 3N70A 4LI0A 1S2MA 3KXLA 2GXAA 1TQ2A 4QL3A 3S1AA 4JLKA 2KJQA 4NCNA 4OHXA 1IN4A 1S9HA 2OEPA 4CEJB 3Q5DA 2Q9BA 4HAYA 5FTMA 4QG7A 1CR2A 3BORA 3R8CA 3ZD6A 3QQ5A 4HAZA 1X3SA 2BOVA 4EPRA 1LB1B 3U3OA 1CRQA 5CK4A 1CEEA 1H8HD 3W3ZB 1M7GA 3NEYA 1WCV1 1Z6TA 1CF4A 3U61B 2O52A 3E70C 2OAP1 5EXPA 4ZKDA 3I4LA 2XTMA 2C04A 4OJKA 5EE1A 3L0SA 1T8UA 1U98A 1X1SA 1D9XA 1QHHA 3BXZA 3GJ5A 4OQMA 4AYWA 4YC7A 2V3CC 2VP9A 4NCJA 3U6KA 2YKGA 3QBVA 3UG7A 2R6FA 1X8JA 5FL7A 2ZEJA 2R6DA 2W6IA 1R0ZA 4W7SA 3WRXC 2ODWA 2A5JA 1E4VA 1GITA 1XMIA 4TL8A 3TSOA 4QNMA 4JKYA 2W0MA 1HH4A 5DIFA 1J70A 2RGNA 3IO5A 2ZRCA 4FIDA 3ZVRA 1E0SA 3QY0A 1KI6A 3BJIC 3IDQA 4Q1EA 2IEYA 2IEZA 3KB1A 1E0AA 2G88A 4F4CA 4EPXA 1ZIPA 4LHWA 5TARA 3SEAA 4HZUB 3ZGXA 1JR3A 1KSJA 2IWHA 3U3JA 3UATA 1G19A 1E2LA 3NBYC 2QPOA 2BCGY 3LXRA 4JBYA 5AR1A 4PPNA 4ZPXA 2X77A 2HXSA 4IDQA 3KQNA 3E2IA 2VF8A 3LBIA 1YKSA 2C77A 5B57C 4B33A 4JIMA 2NMVA 4AKIA 2ZJBA 4P3YA 1LNZA 4GT1A 2YOHA 2GZHA 1KSGA 5JI2E 4CEHA 5FOWA 4IDHA 2QORA 1KIMA 1XX6A 2ZETA 4WXRA 2N46A 2A2ZA 2Q3FA 1YR6A 1FUUA 3LV8A 1DO0A 4JKIA 3ICEA 4EPWA 1W5SA 5BYJA 4V03A 4QGHA 3AUYA 1KI4A 5TB5A 5HKKD 1R6BX 2V4ZA 4FW9A 2F1IA 4DCVA 4NU0A 4HAUA 4AWXA 1ZJ6A 1Z3IX 3A1UA 1ZM9A 3BRWD 2RGEA 4DT1A 1A82A 5AK0A 1KY2A 1RRPA 4PSVA 4GZMA 2CCGA 3K09A 1U8AA 3I5XA 4JLVA 1FQJA 3TMKA 3CH4B 2OAQ1 4G5RA 2WJHA 5HR5A 1J7KA 2EVWX 3T15A 4E5UA 4B47A 4AKGA 3SHWA 3DL0A 2Q21A 4W9MC 4RCYA 3CPEA 5KYKA 1FOEB 3LNCA 4AURA 4XJXA 5DHFA 2W6ID 2DB3A 4Q4LA 3QIAA 2FSFA 2IYUA 4GRAA 2TMKA 1XPUA 2J1LA 1QF9A 5BW8A 2QSZA 4QBHA 2AN9A 4ARZA 4XIGS 4BFTA 5EP2A 5CB8A 1DVRA 2ZYUX 2OZEA 5J4LA 2AD1A 1E0JA 3H84A 4I1OA 1TNDA 2ZPTX 2IUUA 1GNRA 1T0HB 1XB2A 3H1TA 4HUQA 2PMKA 4JL5A 4A82A 4GOJA 2EFCB 2ZRJA 1CR1A 2P67A 4FN5A 3GLFB 1ZM3A 1JR3D 2IYRA 1NBMD 1G7CA 3CRW1 2R6CA 5H70A 4IHQA 2V6JA 4BFVA 4MITA 3GLIB 4C3ZA 2AK2A 2GEVA 4I4LA 5EUMA 1GRNA 1SVWA 4CT5A 1HQCA 2OCAA 4URVR 1T3HA 1Q0UA 2G1KA 1UAAA 2IS4A 1X8KA 1HEIA 4RJLA 3QXHA 1IN6A 4PQYA 1C1YA 5FOTA 2PMDA 2DFNA 4OYHA 4U7DA 3UANA 4BGDA 5LDDC 2O8FA 5JHGB 2AFIE 2WSSA 4JBXA 5FPHA 2F55A 1XMSA 3BC1A 2XSZD 1VMAA 3NG1A 4M1MA 4LYFA 3KQUA 1UDXA 2XNSA 4A0HA 1V43A 4WAUA 2QM8A 3WYFA 1JAHA 1OB2A 1G41A 2PCLA 4B75A 2R6GA 2J7KA 4URZR 5FTJA 3KUDA 5JRJA 3SYNA 1OFUX 1XCGB 1TF7A 1YZLA 2J46A 3EARA 4CRWB 1FTNA 2BM0A 1PUJA 4OQFA 1UM8A 1QVAA 2IL1A 1G16A 2NO1A 2BMEA 4Q9LA 5G41A 2AR7A 2IYZA 4DB4A 4B73A 4JLBA 2DPXA 5FBWB 1G17A 1MRSA 3W3AA 1JQLB 3ZZ0A 4BFWA 3I3SR 4FCVA 2IXFA 4RZXA 4WZ6A 1MO4A 5CM9C 1NKSA 2H18A 4FCWA 2BHRA 3LW8A 5BQ5A 4QBIA 1IJFA 2ZJAA 2AHOA 4MKIA 4P0TA 4QRHA 1QHYA 5HCIA 1Z28A 3WBJA 3CH5A 5BWMA 3VHXA 3MCAA 1VYVA 4LYAA 4B3XA 1G5RA 2EQBA 2CL0X 5FI1B 4TYNA 2ZI6A 1NIPA 5DI3A 4QHSA 1IQPA 4V0KA 4BLTA 2KWIA 4C0BA 3ZS9A 1PUIA 3NC0C 4I1SA 2CXXA 4D81A 1SXJB 2Z6VA 1NL3A 4TYQA 2IW3A 3MFYA 2O8DB 1OHHA 3IHWA 3TLXA 4G01B 2ZI7A 4DLVA 3ND9A 2I1QA 4LHZA 4B74A 1E0KA 3SFZA 3CNOA 3H0KA 2J59A 4BZXA 3U44B 5CDFE 4ZDJA 2IF0A 3KUCA 1B23P 2O8EB 3SQXA 4WW0A 4PO9A 3OFND 5K8IA 2NOAA 2PZGA 5CIQA 4PR0A 4NMMA 4KLNA 4TMXA 4R71A 4XOIA 2G1JA 4RD0A 1US8B 2BM1A 1E2HA 5CLQA 3CONA 3VTKA 1Q21A 4B35A 4EIWA 2WSSD 1P2TA 4PTLA 1IXRC 2R6AA 2VBCA 3PUXA 3O8BA 2XB4A 2JLUA 4OL0A 4Q5IA 1G7RA 1NSFA 2FSIA 1NSTA 2IYTA 4ON9A 4AKHA 4BE7B 2WKQA 2XZPA 3K0FB 4S2EA 5EQTA 3DKPA 1NN3A 2ATVA 4AG5A 2BBOA 3L82B 2P2LA 4L15A 4LK2A 3BH0A 2CJWA 5DO9A 1NI3A 4Q7KA 2VF7A 4F4IA 3PEUA 5GJVC 4GL2A 2XJ4A 1DBSA 2KBEA 4WA7A 4C2TA 2QSYA 3EZFA 3AKEA 4IJMA 2ZROA 3LQRA 4CZ2A 5JBQA 3GFTA 1KO5A 4YLGA 1E9SA 2FE4A 3AVUA 3SE0A 1DPFA 1Q3HA 5KSOA 4HI0E 3AUXA 2CDNA 5SZIA 4PO1A 1W0KD 3Q7QA 4L9SA 4YXWA 2D7DA 2F7SA 2WOOA 2XB2A 1KSHA 2WJJA 4IXMA 5EXTA 4Q1FA 4Q4HB 1FZQA 2QAJA 1GNPA 1EESA 2ODBA 4WZBE 4HLDA 4ILEA 2CNWD 1F2UB 3I5YA 1N6LA 3K70D 1FP7A 2JDID 3KXIA 2XEXA 4WBSA 4M1OA 2JJ1A 3N2IA 2Z83A 4LCBA 1OHHD 4Q4JA 2VHTA 1ZU5A 5B58C 4L16A 4KSBA 3X2SA 2ZRBA 3VQTA 1LVGA 1I2DA 3C5CA 1DAGA 4ZI2A 2ZRIA 1K5DA 4K81B 1OH8A 2MMCA 4QJ4A 2HV8A 5KSYA 2FEMA 2I3BA 4BRUA 2B8TA 5H8WA 5JLJA 2GEDA 1R0WA 1HURA 1GDDA 2OE2A 1EFUA 2QAGA 4LX0A 4UNPA 3VX4A 1P2UA 2A5YB 4ZV4A 4HB0A 4LSGA 4Q19A 1SULA 4JLJA 1NIJA 4B34A 4EPVA 1WBBA 2ZANA 1BYIA 4A0FA 4Q9IA 2FN4A 1E2KA 1XJQA 2D7CA 1JXMA 3ASYA 5JHHB 2OBNA 3T5DA 2YJTD 1DO2A 1JAIA 1UEIA 4E03A 5AUOB 1Q12A 3ZZTA 3MRSA 5KPJA 1W36C 4FMDB 1E4YA 3GEIA 3HR7A 5GJWC 1N25A 2WOJA 1Z6YA 3Q3JB 1U0HC 2UZIR 2RCNA 2XGJA 2IHYA 1OPXA 3GJ6A 3I32A 1DAMA 1GILA 4Q9JA 5DISB 1KMQA 3AVOA 3PFIA 5HE8A 2FPLA 5IT5A 2WJIA 4JSTA 3W8RA 5LD2C 4JS0A 2X2EA 3RLFA 3TQCA 2GKSA 4XVQA 3LWNA 2HXYA 1UBGA 2ORVA 2WWFA 4IRUB 1A4RA 3OF5A 4FMCF 4G3XA 3QKSA 2NIPA 1GUAA 1N5KA 2CVHA 4OQXA 1RW4A 1RRFA 1U9IA 3WNBA 3RYTC 4BRWA 2PCJA 1K8RA 1KDRA 3PUVA 1E94E 4OI0A 4F7WA 3QXCA 1AZTA 1G3IA 1QZXA 4TLCA 4OJQA 1SKYB 1XMVA 2GCPA 1IBRA 1T4GA 1Q1QA 1X8LA 4L5BA 4TMKA 2XOKA 4V0OA 4V0MA 4JYCA 4WXPA 1CU1A 3MWYW 1Z08A 2CJWB 4LJAA 1X86B 4O3MA 2W00A 3B13B 4IVQA 3ZS8A 3O8RA 2OM2A 2F43A 2EYQA 3ZVMA 2VHUA 1ESMA 1CJKC 1CR0A 3VR6A 5TMPA 4MRPA 2J41A 2JLQA 4QGAA 4TZ6A 1NMXA 3X1ZA 4TQUS 4MKGA 1GVNB 2FG5A 1AN0A 4IDOA 1AS3A 2NO6A 1UDWA 2GVZC 2VSXA 1N5JA 3A4MA 3BS4A 4ESHA 2ZSFA 3X1WA 4KFSA 4BUJA 3TUJC 4B3CA 3R7WA 4GFDA 2F6RA 1SHKA 4L8GA 3OIVA 2CE7A 2IK8A 3K9GA 4NP6A 3SJAA 3ECCA 1Q3TA 1KZ7B 3OIWA 4DSTA 1Z0JA 4D4KA 2ZM5A 2QU8A 5E7IA 3RS2A 2VSFA 4QM7A 1VYUA 3G5UA 4PAOA 2XZOA 4M1TA 4MRRA 2FF7A 4CW7A 3VNUA 3B1WA 4H1UA 1A5TA 1XDBA 4DWJA 2J0UA 4YQFA 4GP7A 2EU8A 4DVGA 1FFHA 4AYXA 4RD1A 2RHDA 3X1XA 3B60A 2GZDA 4KFUA 2VA8A 4TLEA 4Q4JB 5FOXA 4PXAA 3LDAA 3THXB 1UPTA 1NBME 4LV6A 4HLUC 2OFXA 3CR8A 1KDPA 1YZKA 3ZZUA 5DH9A 3EZ9A 1G5TA 1CP2A 2RHMA 1WDTA 4GPTA 3UMSA 2G6BA 5P21A 5EE5B 5J4HA 5FBLB 5HE9A 3H86A 3R8FA 3MMPA 4Q4AA 1II9A 3KXKA 1WMSA 2IA5A 3QKTA 1NRJB 3T35A 3TH5A 4AIIA 3D3QA 3B1VA 3P4XA 1ZIOA 2GDJA 3T06B 4C0LA 2CMKA 1NLFA 2QAGB 4C0AC 2YOGA 1OE0A 2NPIA 4OHZA 3RS5A 1WXQA 3QVUA 3NC1C 2CCJA 3B1YA 4P4SA 4Q01A 3L8YA 4IOMA 3GJ0A 3CF2A 2VHJA 1PZNA 4QGGA 3THYA 5EE3A 2RMKA 3GJ3A 1EFTA 3ZIAA 5DE3A 1KNXA 1MH1A 4NE2A 1YZGA 1KDTA 3B1ZA 1L4UA 4M1WA 2G9NA 5BXQC 2G83A 1OYWA 2GVDC 2XOKD 3LLUA 1CRPA 1E2QA 3I92A 1DADA 1OH7A 2IWRA 1XMJA 3L43A 3MGCA 4OI2A 4KV9A 4B71A 3DO6A 4HLQB 1C9KA 4PPFA 4A2QA 1QHSA 2ZYWX 2B7CA 1YRBA 2EW1A 3KKOA 2A3RA 2FV8A 1O3YA 4P4TA 4KBGA 2DWOA 2EYUA 4RKEA 1WB9A 2GNOA 3AM1A 1T5LA 4BFXA 1E9DA 1QBKC 2O0HA 2OXCA 3UMRA 3ADCA 2ZRNA 2VP4A 1TTTA 1SQ5A 3B8HA 4PSKA 2UZ3A 3V00A 1TF5A 1S0UA 5A4JA 5A5GA 5IRCD 5HCNA 4PANA 5FTNA 3RS4A 4XWKA 1JEEA 3K0AA 3EZ7A 5C4GB 4Q1CA 2NGRA 3SYLA 3MWKA 4DLZA 2GJAA 4JLNA 2ZS9A 3BIFA 1Z07A 2VHQA 4US1R 4NCHA 1DS6A 4U02A 3LQQA 1P2SA 3DMNA 2XTZA 5B2ZA 5L3VA 1P6XA 1WRBA 3OEHA 5JECA 2O8CB 3MLEA 4C2UA 2IYVA 3T12A 2DFLA 2H57A 1NY5A 3TUIC 3C16C 4GOKA 3CRRA 4DDWA 3DVLA 4G5QA 3FFBA 1OXTA 521PA 5KPDA 2DCUA 2CVFA 2JLSA 4TTQA 1T9HA 3PIRA 3GP8A 1F60A 2YWGA 1N6RA 2J0VA 3NBZC 3B78A 3EPLA 4IOLA 1VTKA 2BC9A 3ZVLA 4YMSA 2HDNB 3D7MA 1COWD 1GL9B 2I1VB 2W2XA 3GMTA 4AG6A 3G0HA 2ZSAA 3R7WB 1ZNXA 2H16A 1KY3A 1VPLA 4MH0R 4OQNA 2QMHA 3PITA 4R2HA 4EQ6A 1IXZA 3TW4A 3C7KA 1R0YA 1TU4A 1YR8A 2BVNA 2PLRA 3MWJA 4QGFA 4Q9HA 5FUWA 4F92B 1BS1A 3AP2A 4PZYA 1JALA 3LD9A 4Q18A 4R7ZA 5IHPA 4W5HA 4ESVA 4B43A 4LWZA 3E1SA 4AI6A 3UKDA 2J0SA 3LO5A 2RGBA 1KOFA 1KMHA 1AJEA 4IKEA 2ZSDA 3EPJA 2ZR9A 1ZUNB 4TL7A 2BV3A 1VHTA 4LJ8A 1CTQA 3HP1A 4B3BA 2WBLC 3KKPA 3UMFA 2CLCX 1OH6A 4D25A 2EFEB 3DM9B 1HUQA 2MSEB 1IONA 3B7GA 3BGWA 1O87A 1XU4A 1GG2A 2I4IA 4C9BA 2YNMA 4ZIRA 2QA5A 2JAQA 4HZIA 3TBKA 4PFSA 4XH9B 2P65A 1J8YF 1X6VA 1TQDA 2VQSA 4MYHA 1XEWX 4GBMA 1FNNA 2ZTSA 3ZDQA 1XJCA 5HKKA 4EDHA 4QXAA 3TNFA 2NZ8A 1EG7A 1OF1A 5DI9A 1G3QA 3TK1A 4A15A 2Y8EA 3AQ4A 4B3FX 1KZGB 1VHLA 1EGAA 2VP2A 4DLYA 4PHFA 1AQYA 2QNRA 3CBQA 3P26A 1SVOA 3A1VA 4PZLA 1IY0A 4IDPA 121PA 2REXB 3OEHD 5EP1A 4KJZA 3QE0A 4Q1BA 3THWB 1M6NA 2GWHA 1E79A 1NVVR 4OKSA 4F91B 1H8ED 1KO4A 3W6PA 1LFDB 4DCTA 2IXEA 3W6OA 1FX0A 3W9YA 4JBWA 4J0QA 4DSNA 4PHTA 3GLGB 4RFSA 4PC1A 1E9BA 2R9VA 3M1IA 3KQHA 2VEDA 1WF3A 1SZPA 3Q85A 4KCGA 4C0SA 3OZXA 3EWSA 4TMZA 5AJXA 1XTIA 1VECA 4BFSA 4C0HA 4M9XA 4BEJA 3FB4A 2RB4A 1D2MA 3B1XA 1E32A 3CRVA 4QBFA 5KNCA 4P33A 4AD8A 5JS7A 2V54A 4ERNA 1NBMA 2ZU0C 3CW2A 3IGFA 2ODEA 2YWHA 4AC9A 1NVUQ 1OKKA 2OCBA 2V7QA 4Q21A 1RRCA 2J9RA 2BBWA 1CR4A 4KAXA 2GILA 1MRNA 1OFIA 1VCOA 3U60B 1G3MA 2QP3A 3VR3A 2ZJYA 3U2QA 2QI9C 3LVRE 5CITA 3T34A 5KU1A 3VKHA 3DMDA 3FDIA 3VR5A 8OHMA 1ZC3A 4MUBA 2GJKA 4I1UA 4BLRA 2X8AA 4CGZA 5F9HA 3TJZA 1QHIA 2V8OA 4M0LA 1A2KC 4D6PA 4D4JA 1N6PA 2J87A 2GRJA 5BN5A 2PZFA 1XEXA 2CEAA 3QKRA 4NONA 2P6NA 2C9YA 2XSZA 1HQYE 2XX3A 2BMDA 3MSXA 1XXHB 1DARA 1MABB 3GJ4A 1ZMXA 4KYUA 2IHBA 1TX4B 2CHGA 3BE4A 3DEFA 3FTQA 4K46A 4M1SA 3REFA 5B64A 2ZRMA 2L0XA 1II8A 3DDCA 3B9PA 4JYBA 1KAGA 2RH5A 1HT1E 3GEHA 1VIYA 1G3UA 1XTKA 2VLIA 4EQ6B 5JCZA 2NZJA 1OV4A 1Z6AA 2WKPA 3A1TA 2RGAA 4CT4B 2A5FA 2AK3A 4B76A 2NPFA 1P60A 5H68A 3X1YA 5D3MB 1E2JA 2JASA 3IQXA 1FP6A 2F3RA 3ZD7A 1KMHB 1E79D 4Y0VA 2IXGA 5ANRB 2VL7A 5JJLA 5GVSA 1JPJA 1GFIA 1W47A 4TLBA 3TVTA 2JLVA 2JLRA 3TSZA 2HYIC 1OFTA 3VR2A 3NVAA 3RWOA 4DKXA 2WMNB 5KO2A 4MGZR 1W4AA 4KODA 4DCUA 1Q1EA 3S1AB 4UNSA 1U8YA 4TL9A 3VMFA 4DHEA 4D26A 5GJBA 2FJUA 3NXSA 1KK0A 2C98A 1SGWA 4FINA 4QJ5A 2ORIA 2WWYA 1ZM2A 2BKUA 3HPQA 5AUQA 2OXRA 2R2AA 2EFGA 3TR0A 3I8XA 3TIFA 2VHCA 4S35A 1OKKD 4TQ9A 1IN7A 2V7QD 2VP5A 1P2VA 5C46F 3GCGA 5F3WB 3KDSE 1LS6A 4EFNA 1DG1G 5KNDA 1E2EA 3OFNA 2BJVA 4B2LA 2WV9A 1KI9A 4KXFB 1WBDA 3AVXA 1QHHB 4YMVA 3AVYA 3HPRA 4EJSA 4ZCMA 3JZMA 4X8OA 3P32A 1Z0IA 1HA3A 4H1VA 1B0UA 2CE2X 4TZ0A 3V4FA 3RS7A 3CRQA 1ZM4A 2W0SA 3M4YA 4RFVA 1CIPA 2XJ9A 3KTAA 1GRQA 4F38A 4R2IA 1E6CA 3CM0A 3P27A 1UKVY 4RZ3A 1Y63A 3SC3A 3VNVA 1W49A 2C99A 3AH8A 2YYZA 2FPKA 4GP6A 3D8BA 5E7MA 1OXUA 2RGNC 3IEVA 4IOKA 1KI2A 4GZLA 3LBHA 1RC8A 1KI6B 2A7QA 3KKNA 3EPHA 1J2JA 1OFHA 2HLDA 3RC8A 4NHOA 1NJGA 2DR3A 1EXMA 2D62A 2FPMA 2CL6X 3ZQJA 1U94A 4R98A 5L3SA 1NVVQ 1S96A 1UBCA 5EZ6B 3KJEA 4YONB 2WAYA 1ELOA 1RYFA 1CULC 4XVRA 1NG1A 4TLDA 2AL7A 4EFLA 1XCPA 1SVSA 1W0KA 2G77B 3TRFA 2OUKA 2R44A 4GSYA 3U7FB 4CEHB 1KNQA 2W83A 1GSIA 4NYMR 1ZP6A 3K9NA 3WMFA 3G82C 2VSOA 3PUZA 2FSGA 2FEOA 2CNWA 1YZTA 1OXXK 2CK3D 3BFVA 3BH7A 5AWFC 2XXAA 2ZYVX 3CO5A 1SXJC 4LPSA 3LX8A 2ATXA 2JDIA 3LA6A 1G21E 4BPBA 4U00A 4ZCIA 1ZYUA 1OB5A 1LV7A 3ZH9B 3RRMA 2DY1A 2H8KA 1EX7A 3V4RA 5DN6D 2ZUDA 4PPGA 2QBYA 4BFZA 1CJUC 3GLHE 1GZSA 2V9PA 3VKWA 2GBLC 3D6TB 1QDEA 1KAOA 4DT1B 3K9HA 4M9ZA 2F9LA 3NIBA 1XD9A 1XFAA 3L0PA 3CLVA 1HE8B 4OHWA 5EXSA 5FR2A 1F3OA 1X1RA 3CWQA 5EZ5A 1VG8A 3WY9A 4DBLC 4DSOA 5J4VA 3U5ZB 1AM4D 4LV5B 4NCKA 4PC2A 1QG2A 1SHZA 1LF5A 4A2WA 3R20A 821PA 4E22A 4PQFA 2FZLA 5IDVA 1W1WA 2GXQA 1PLJA 1RIFA 1E1QD 1S4QA 2REBA 4ABYA 1ZAKA 2WIAA 2PZEA 2ZRPA 4HB2A 1ONBA 4DEXA 4ARZB 4DXAA 3U7EB 1DELA 2ZR0A 2Q3HA 3KKMA 1NNEA 1XD2A 3R9IA 4LJYA 2B8WA 5D3QA 2CLSA 1XTSA 1UEJA 2ZJ8A 2QE7A 4HUQB 3PEWA 2O8BA 3U3KA 1J8MF 1G7SA 2HLDD 3CPJB 1XEFA 4EUNA 2P6UA 4V02A 4JLMA 4HDOB 3SHFA 4A8JA 2WJYA 5CB6A 5J4KA 3NHBA 3F5FA 2ONJA 2ZR7A 2RGCA 3NDPA 1FMLA 1NP6A 3C15C 1JNYA 4DDTA 3IILA 2QT0A 1AQUA 2BIFA 1E69A 2B21A 1CS4C 3EG5A 3N2EA 4LJ5A 4DZZA 4F93B 4KHZA 4MYTA 4OHVA 4ZKEA 1D9ZA 1R0XA 4B32A 3LH5A 3CX8A 4HEJA 3ND8A 4NYJR 2X2FA 1P62B 2QMUA 5AUPB 4ZDWA 3U6BA 2O8FB 3ADDA 1WE2A 5H1YA 2LWIA 5JMTA 3VU9A 2HCJB 3QENA 2BEKA 2G0TA 3MD0A 1GL7A 4A92A 3LW7A 3CX6A 2GCNA 2GJ9A 3CIOA 2P5SA 1RKBA 2YWFA 1KYIA 2VPPA 3L0OA 5JSZA 2JCSA 5KUTA 3T1QA 1TMKA 3DPUA 4Z51A 2AXNA 2CLDX 1J90A 4Q1DA 3VR4A 2DBYA 2DFTA 2YC2C 4FWTA 2IS6A 1U8ZA 6Q21A 3T61A 1SVIA 1CXZA 4JVMA 4ZCLA 2FU5C 4G1UC 5JFGA 2ZRDA 4MDFA 5L3SB 1AKYA 4HSEA 3BB4A 4A9AA 4OBEA 2W2VA 2QP9X 4LYJA 1W36D 1OIWA 2WZQA 1M8PA 2AKAB 3CUEF 5K8UA 1OLOA 3TR5A 4A0GA 3AB3A 1KKMA 2ZSBA 3QEJA 4XTCS 4PPQA 3ZYCA 4C7OA 2PX3A 4FWIB 2QP4A 5FH9A 2XNDD 2CL7X 4MRNA 3T5GA 3WRYC 5J47A 1TQ4A 3HYTA 1W4CA 1ZC4A 4TT3D 2ODNA 3TUZC 3DKVA 4JL8A 3B5JA 5DI3B 1NVWQ 1RZ3A 4A36A 3SJBA 5JEEA 1MOZA 2GCOA 5JCPA 1Q57A 2QE7D 5CM8B 3K70C 3K70B 1DE0A 4QOSA 2VP0A 1AGRA 3PVSA 1ZD8A 2QBYB 1TF2A 2R65A 3EPKA 3MJRA 3GQBA 5LB2A 4IVRA 2CCKA 1E9RA 1VCIA 5K8LA 1KO7A 4TTRA 1G20E 2J45A 3ZVNA 1JJVA 2ZS8A 4IXNA 5FOUA 3PXGA 5AUNB 4K8OA 2J5XA 2JATA 2YWEA 3QXJA 1G1MA 1I2MA 1N6NA 2E9SA 3BH6A 1TPZA 2Z4SA 5CK5A 1V5WA 2QGNA 2VP6A 5DNYB 4HAWA 1Z83A 5JRZA 1KHTA 4Y0AA 1GOTA 4NYMQ 1ZNZA 2GXSA 1Q44A 4M8NE 1I4DD 2JLWA 2JIZA 4Z1MD 2G0NA 3FYHA 1EFCA 4DLRA 4GMDA 1G4UR 2C9OA 1ESNA 3RRZA 4DCNA 4TL6A 3PUYA 2WPDD 4UJ5A 2WSMA 3WMGA 1DAIA 2IYLD 2H1LA 4O25A 4Q47A 1LY1A 1M7BA 1OJLA 4RD2A 1KI7A 2P3SA 1IN8A 1W4RA 2V6IA 2WTUA 4EKDA 1KK2A 5DLQC 5JS8A 3KKQA 3R9WA 1GAJA 2PX0A 2IYWA 2KB0A 1JJ7A 4WVFA 1HT2E 3RRNA 3RS0A 4BEBA 4TWZA 5JZVA 4QJ3A 3IBYA 2MMGA 1G291 3EIHA 1XTRA 3PCRB 3LVQE 2EWWA 1MR3F 2IYXA 3AP3A 3I72A 4NZYA 4URWR 4XVUA 5F2EA 4XSHA 3OESA 3GD7A 2BMFA 3QJYA 4IEEA 4PQRA 5HTKA 3GLFE 3SU8A 2ZUCA 1HTWA 3FE2A 2OSBA 2NO7A 4UJ3A 3VU9B 4BZPA 1I4LD 4EAQA 3GLHA 4NBSA 4Q7JB 4DRZA 1YE8A 3GLIE 5CDFA 3WHLA 2QRNA 3B9QA 4TMWA 2C78A 4LJ7A 1NLYA 1U81A 2FX3A 1C4OA 1BMFA 1DOAA 5FFMA 3HU1A 1W4BA 3AF1A 4PAQA 4A6PA 2QT1A 1JQJC 3KQKA 1KDOA 2REOA 4LC1A 3W6NA 4C0KA 3VKGA 1TEVA 1Z63A 4Q9KA 2ERYA 4HATA 2JJ8A 2GJSA 4HAXA 2GJ8A 3QPVA 5L3QA 3WNCA 5G53C 1ZD1A 3RS3A 3MWLA 3FWYA 1XBTA 4NYJQ 2H7VA 4BWYA 4DJTA 3U3MA 4ZDIA 2FFBA 2RAPA 3QF4A 4A6XA 1MV5A 1DAFA 3AP1A 2Z43A 3BWDD 1GKIA 3QG1A 2QAGC 1G8HA 2A30A 5AJYA 2ZI5A 4BLSA 3PJRA 5CLLA 1P9RA 2GHIA 5TDHA 1COWA 2JIZD 3IKJA 4JVNA 4TN1A 2OCPA 4HDQB 2DWPA 3RANA 3U4QA 5E4FA 1YJ5A 3TKLA 3Q72A 3BOSA 3IO3A 3W34A 1G5PA 3B2EA 3AF0A 4A4DA 4W5WA 4OHYA 2GCOB 2ZJ5A 2Q9AA 4D4MA 1GM5A 4PC7A 4CEJA 3K0CC 3TE6A 1GKUB 2D2EA 5KSZA 4HUTA 4TYPA 1JEDA 1HE1C 4ITRC 3A37A 4ZI3A 1NY6A 1T8TA 4PHHA 2WWXA 2Q6TA 5KDOA 3GJ7A 1OT3A 2FA9A 3WNDA 4FCTA 3T1OA 1G18A 2F3TA 2JJ2D 1UBEA 2QPTA 3QKSB 1XPRA 2PLFA 4MYCA 1SXJE 2IUTA 1JECA 1W44A 2BJWA 1U9IC 1UADA 2IYSA 4NCIA 3A58B 4IDNA 3TW8B 2Z0MA 2LKCA 3NEJA 2ZJZA 4TYYA 3AKYA 3QEOA 2JEOA 1P4SA 4B6EA 4AKEA 5G3ZA 1DAHA 3SZRA 1UKEA 2QMEA 4OK6A 3CRMA 3CF0A 5JJKA 1BMFD 2FFAA 1NN5A 2PT5A 1P9WA 5C18A 1T0JB 3AKDA 4IW3B 4MKFA 4KVAA 3SFVA 2ZVQX 2DFKB 1QHXA 4O0MA 2WWWA 5FTKA 1TADA 2UVQA 4OI1A 1DAEA 4UXJA 1KKLA 3AVPA 2GZAA 1E2PA 4UNQA 4X8HA 3QPWA 1WP9A 2F43B 1H8EA 4XD7A 4JLOA 1S3GA 4HZUA 1G6HA 4URUR 2NO0A 5F98A 4DDVA 4DLUA 2D3WA 4MGKR 1Z2CA 5FPKA 1RVDA 2ZI4A 2EFDB 2HUPA 3KJGA 5JWOA 1PJRA 3FVQA 3L2OB 5HZKA 1Z0DA 3HYRA 1VYTA 1M74A 1F6BA 5M04A 2AKYA 3IQWA 1L2TA 4LGMA 4F4JA 1ZNWA 3FKQA 2P0EA 3PUWA 4EPTA 3CPHA 2AXPA 3BB3A 1G9XA 2PJRA 1JBKA 3KJIA 3BFXA 5KDDA 4Z8YA 1E1RA 2IS1A 3CZQA 4BLOA 1MKYA 1WQ1R 1Z06A 3PQCA 4IEIA 2BCJQ 4KVGA 3FHCB 2J0UB 2WWGA 3OAAD 4B3DA 2OBLA 1MO3A 3AVQA 2PEYA 4NH0A 5E3HA 3EC1A 3HU2A 5FOVA 2OBMA 4I99A 2VH5R 3BERA 2BWJA 5L3RA 1XRJA 2ORWA 3EAQA 3RC3A 2QTFA 1ZBDA 3L8ZA 3PR1A 5LBIA 2FGJA 3WYGA 1QG4A 3BB1A 3KQLA 4TLAA 4AK9A 1CLUA 1UBFA 4E09A 4UKDA 5L8VA 2H17A 4RSGA 1EK0A 5E95A 4D80A 2QRZA 4Q4AB 1AGPA 1QRAA 1TAGA 2OFWA 4LC0A 5FI0B 4D0NA 1MT0A 1SVLA 2MSCB 2OT3B 3GPLA 2ZXUA 2YVUA 1S3SA 4P4SB 1R5OA 2DWQA 4FMCB 2XTNA 4X8LA 1M7HA 3QNUA 3THYB 5FR1A 2PT7A 4DIDA 1QHGA 2ZRFA 4MKHA 4BASA 1NVXQ 1GP2A 3MAAC 4N0EA 3Q8XB 1AS0A 4NTZA 3I61A 1DTSA 4Q7MB 2ZRGA 4C0QC 4BFYA 2H92A 2ANBA 1UJ2A 2VTKA 3AGQA 4CVNA 2ZE7A 1W7AA 3IBGA 2J3EA 3GJ8A 2ZITA 4XD7D 4QHTA 2VO1A 4LJ6A 4QFMA 3GLFA 4NKRA 4DB2A 1YZNA 4IFEA 5IK2A 4QHYA 2QG6A 1SKQA 2H5EA 2XITA 2N1BA 2C5LA 3BAFA 3GLIA 2GTPA 3CB4A 4D0GA 3AVVA 3QG5A 2ZRHA 3SN6A 4NYIR 3QF7A 2GEUA 1SVKA 3FMOB 4MA4A 3WP1B 2OCYC 5FPSA 1S8FA 3C14C 1AK2A 3W8NA 1FQKA 2WHXA 3QVVA 3FPAA 1A7JA 3B6EA 1ZVQA 3A6PC 2FOLA 5BN4A 3K0AB 4G5GA 2HJVA 5TY0A 1E1RD 2QTHA 4URXR 1GTVA 1PVOA 3M0EA 3CNLA 3WP0A 3W90A 1Z0KA 2FSHA 4V0LA 3WXMA 1MO6A 1YZUA 1XZQA 1S1MA 4CEIA 5B30A 2J7PA 2CHQA 2HCBA 1YVDA 5AJZA 5C4MA 2ZSEA 1EWQA 1D2EA 1K6MA 1ODFA 4LOAA 1T3SA 4A2PA 1E2IA 3SJZA 2HEIA 3WHKA 1KO8A 4Q1AA 3SR0A 1SKYE 1LTQA 2GESA 3KL4A 3DM5A 2C9CA 3I8SA 5JWHA 1EFRD 1F2TA 4JJZA 1ZUIA 1ETUA 2QGZA 3GFPA 1YZQA 2ASEA 4URYR 5CYPA 5KOYA 2HF9A 3HJNA 3OE7D 4PX9A 1QHNA 5FPYA 2QENA 2WJGA 1IAQA 2ZRKA 5CJ2A 2KI5A 5EE9A 4GMXA 4TQAA 5EP4A 1VKJA 2QQ0A 1HYQA 3EIQA 3JVVA 4JT4A 5BN3A 4KBFA 221PA 5E7JA 2ZAMA 2ZJ2A 1ZNYA 1ZW6A 3DZ8A 1YHNA 1G8GA 3FGNA 5C2JB 3NTUA 2YC4C 2OHFA 3OIUA 3NHAA 2W6JA 3O47A 3LFUA 2Q0HA 4JVSB 4PC6A 3A1WA 3W5IA 1SXJA 1VCMA 4R9UC 2PH1A 3NH9A 3OIYA 2FFQA 5EE0A 2JA1A 4B44A 2O8DA 1M1YE 5IK2D 2IS2A 3ZJYA 3NDBB 3TAHA 1JXOA 2FGKA 1CJVC 3SNHA 2AFHE 3QUSA 1XP8A 3X1DA 4ASUA 1G3RA 3FHOA 3U44A 1P73A 2GBLA 4UXIA 3I1FA 4Q03A 1OIXA 2O8EA 1S9DA 3FFAA 3TSWA 1T6NA 3NBFA 4ZIRB 2OO7A 1KGDA 1T91A 1TU3A 4HB3A 2F1RA 4Q66C 4P31A 4LZZA 1YR9A 2ZAOA 1Z2AA 2CK3A 3LRPA 5JEDA 2WAXA 4AY2A 2BKEA 5UKDA 2V1UA 1US8A 4HB4A 4JVLA 4JZKA 5FL7D 5AJVB 4GI7A 4LV8B 5DN6A 3AVWA 2HT6A 3RSOA 4FMDF 3KZ1E 4LUCA 2FFHA 1RE0A 1W48A 2QROA 4FXPA 2ZI9A 3K0FA 1GIAA 2NQ2C 3EIEA 1GL6A 4H9GA 3RRYA 1P3JA 2J7PD 4GOXA 1TQ6A 4RD6A 3ICQB 1KK3A 4EFMA 1XTJA 3RDPA 1IY2A 1A2BA 4Q00A 3RAPR 4JLAA 1KI1A 3B82A 3CF6R 2R8RA 1FX0B 1CJTC 3EW9A 2V1XA 1ZINA 1XCMA 3Q7PA 2A5DA 4RFSB 2N42A 3FKSA 3IIMA 3P4YA 5FL3A 4KFRA 1R8SA 3IIKA 1E1QA 4BLPA 3PEYA 1E3MA 3F0TA 4O2LA 3Q5EA 1FPMA 4CIDA 3IHLA 4ZDKA 3F3YA 1DG3A 1R7RA 4KI0A 5LPNA 3QKUA 1E99A 2FZ4A 1FNMA 2R62A 4M4SA 5IF9A 4XSGA 1Z6GA 1P9NA 2DYKA 3C5HA 4JMPA 5G40A 4HAVA 4EPYA 4FMBB 1PLKA 3AF3A 3OHMA 1R2QA 3ASZA 2GAAA 2Q9CA 4V0NA 4CYMA 4Q4HA 1P61B 4WIAA 1TUIA 2W6JD 3EXAA 4TSFA 3K0SA 1FL9A 1VG1A 1F2UA 4DUGA 2PJZA 1ZU4A 2D74A 3HDTA 4CEIB 1II0A 1SXJD 3C4JA 1NN0A 1ZRHA 3GFOA 4P4UA 1E9EA 4MQBA 4FI3C 4JT2A 4B6FA 2NO9A 1Z47A 4ASUD 1AKEA 3CWZA 4NYIQ 1Z5ZA 1LW7A 1N6KA 1IN5A 3EA5A 4RVCA 5LB4A 3A1SA 1D5CA 1XEXB 3HWSA 3QKRB 3SYKA 4YMWA 1F2TB 4JLDA 5KSPA 2K5UA 4N1AA 3I62A 2QQEA 5CIWA 1GWNA 4N3NA 4V0ME 4XWAA 3ZQ6A 4I1VA 2C03A 4UXHA 4C4PA 4M53A 4OI4A 1UF9A 3V9PA 3E5HA 4DC9A 1II8B 2ZVPX 1L4YA 2ECKA 2V55B 3TVDA 1P75A 4FD2A 4BZQA 3KX2A 5DYGA 1IJEA 1U99A 1G8FA 1TEXA 4NDZA 1XWIA 2BDTA 1IM2A 2RGXA 4LDJA 1OH5A 3CX7A 2W58A 1D8TA 2G3YA 3K09C 4TTPA 5JWRA 3MJHA 5GJCA 1Y3AA 1IOZA 3JZAA 2A78A 4KSCA 4TYWA 4M22A 3SI7A 5KTYA 1AA9A 5KNBA 3LX5A 4OK5A 1Q1ZA 1XTQA 5FBRB 4G0NA 4RZUA 1E2FA 1R5BA 4M2LA 4DEYA 2GAOA 3FKSD 3QOFA 2Q3MA 4G5SA 5FTLA 2XNDA 4A1FA 1OXVA 2VYFA 3HR8A 3RVBA 1N3BA 1BO6A 1P72A 1R5NA 2QZ4A 1T3LA 5A0FA 5C1BA 4DLSA 1E2MA 4TT3A 1GRRA 1NG9A 4PHGA 3CR7A 2B7BA 3A36A 3EA0A 1N5IA 3U3RA 3AF4A 3IPYA 4TMVA 3NKVA 4Q7LA 1G8YA 2NTYC 1NN1A 3T1VA 3SJCA 2JLXA 1XJ0A 1AS2A 2AX4A 3JVUA 5TVKA 1XPOA 2KBFA 4RD3A 4TSFD 3SS8A 3BD9A 2IUSA 4JSYA 4DUGD 1KJZA 3O8DA 3FHTA 2HF8A 2A5GA 4ACBA 4D4LA 3CKLA 4EJSC 4EJSB 3LY5A 4D82A 2PEZA 3FMPB 4MRSA 4QKQA 1NJFA 2YOFA 2IC5A 3VHLB 5FPTA 5K8TA 2W2TA 3MUFA 3EZ2A 1W0JA 2OILA 3KTAB 2Z4RA 3NBXX 4Z1MA 1VG0B 3LLMA 3SOPA 1GKYA 2C96A 1BYUA 3RABA 4L9WA 2WPDA 3CNNA 2OLKA 4W5JA 1NF3A 2ZRLA 4IOJA 1YU9A 3EX7C 1N5LA 3NWJA 4PZZA 4MDEA 1NMYA 5ELXA 3VX3A 2WKRA 5DSZA 4US0R 4WOPA 5TV2A 1NLZA 5BYKA 3OEEA 5HZHA 3BFKA 4Q48A 4LBYA 1Q1BA 2ZYTX 3BBPA 4QC2A 2BMJA 2FNAA 3IUYA 3EASA 3GLGE 4PO8A 1XZPA 3RSLA 2BBTA 1XF9A 2HJGA 4BQSA 4RD4A 1BKDR 1E2GA 2XZLA 3AF2A 1EFHA 2ZI3A 4C0JA 3KFXA 3EWAA 2ZJOA 3ADKA 1OIVA 3KB2A 3UG6A 3VFDA 1F5NA 1G4AE 2C95A 2KSQA 4G5OA 4M9QA 4LHXA 4DCSA 2ZS7A 5JJIA 1RPZA 2BBSA 3THXA 1KI8A 3KJHA 4KYIB 5EXXA 2QMOA 4OQLA 4HLUA 2GF9A 1TL7C 3EC2A 4M1YA 3SBDA 2CHVA 3KFVA 3K9LA 1ANKA 1Q22A 1KI3A 2XAUA 4M9SA 421PA 1PLLA 3B85A 3PG5A 2JLYA 3CZPA 4DLWA 3MG9A 2XXAB 2RGDA 1E9FA 1JPNA 4KU4A 4RKFA 3PEVA 1Z29A 5SZHB 3LAWA 4B3GA 1N6IA 2GXUA 3H4MA 3QXXA 1E2DA 3A4NA 1N2CE 2D4HA 4GNKA 3PENA 1E2NA 2E87A 4JJKA 1LS1A 4LHYA 4LPKA 2OV2A 1UFQA 3A8TA 4UNNA 2DHRA 4WZAE 1XXHE 3C41J 3UPUA 4XWOA 1W36B 2OESA 3O8CA 3FOZA 1P5ZB 1VG9B 2QY9A 1U90A 2F1JA 2QUZA 2ZE5A 4BECA 1U0JA 3K0CA 1OYYA 2F9MA 3D31A 4XTRA 4JLPA 3SBEA 5GADl 1I4TD 2P5TB 1G7TA 1M34E 1VIAA 1W0JD 2IX3A 3TGPA 1N0VC 1H65A 5HPYB 1IY1A 1IHUA 4A0RA 1OXSC 4HDCA 1JI0A 5LD2B 4POAA 4Q02A 1W2HA 4D0LB 2O0KA 2QPAA 2BEJA 2WM9B 1KSFX 4NL4H 4KO8A 1UKYA 1XD2B 5EUQB 1G64A 3OEED 4LJ4A 1L8QA 3W5JA 4I81A 5SZKB 2O8BB 4YXWD 3H2YA 3RNLA 1BOFA 1JB1A 2SHKA 1E9CA 3RWMB 1P7CA 3IPXA 1CJMA 1TUEA 2ZREA 1Z22A 4BFUA 3J81k 4A8JC 1F48A 4M21A 4A8JB 1RYHA 3SQWA 3GEEA 5F9FA 2OG2A 1VCNA 3K0EA 1ZCAA 4HLCA 2ZIAA 2JJ2A 4Z54A 1KJYA 1R8QA 2NG1A 4DDUA 3T1TA 2JJ1D 5DHAA 4ZO4A 4DIEA 2AD5A 4LBZA 4OK3A 1S1CA 3U7GA 2X1VA 2O8CA 5TXGA 4LBVA 1EWRA 3GJXC 4B2IA 1CKEA 1YRAA 3SDZA 2X19A 1N6HA 4MYUA 3U7HB 2QN6A 3QSYA 5J4YA 2YV5A 1RRGA 5KHOC 2B6HA 2CBZA 3AVTA 3IIJA 4LJ9A 2WWHA 1ZUHA 1AZSC 2VRWA 4PAMA 2VIIA 1XEWY 4UQOA 5JSZB 2JLZA 1CBUA 2RKOA 1KJWA 4IFBA 4US2R 1R10A 3WBKA 2F1HA 3UIEA 1E9AA 3Q9LA 3REGA 1IXSB 4AYTA 5DYIA 2FDCA 1Z0FA 1FMJA 3FMFA 3QXSA 1ZM7A 2YZ2A 1DEKA 1NKTA 3UK6A 1KK1A 2LKDA 1J99A 1E96A 1DAKA 4C7OB 2OLJA 2AWOA 2FWRA 3ONWA 3ADBA 4B48A 1RJ9A 1JR3E 1LF0A 3R9XA 3LBNA 1BIFA 1NMZA 3LXXA 5FOSA 2QM7A 4YMUA 3WYAA 3VR1A 2WICA 2QL6A 3DOEA 4MGYR 5DGXA 2IYYA 3I73A 3QPUA 1G6OA 1OSNA 2B92A 3TAUA 3OAAA 3AV0B 4MRVA 1JR6A 2IT1A 3NH6A 3RHFA 4YDHB 5SZJA 1WA5A 3PV0A 2HT1A 1ZD9A 4UNRA 5FBQB 2WVJA 4X8MA 2EWVA 2ZE8A 1W2GA 5GVRA 2D2FA 4IVPA 2ONKA 2PBRA 5FUVA 5FUYA 1U0LA 4U5XA 3IEUA 2IBMA 1D2NA 1T5IA 2O5VA 4PSAA 4QBGB 2WWIA 4RZ2A 1N0WA 2AWNA 3THWA 2ZRAA 4YDSA 4TMTA 4KFTA 2HYDA 1RFLA 4CF7A 4LRWA 2D06A 2GK7A 2E1RA 1YQTA 2FH5B 3ETLA 4DSUA 4KLZA 5FUXA 3GLGA 1HV8A 1U2RA 1FUKA 3P1JA 2O0JA 1GNQA 3EZ6A 3VAAA 4JL6A 2QEQA 3K8YA 1K5GA 1N0UA 3F8TA 4MGIR 3FMIA 5G3YA 1YR7A 2FMXA 4YMTA 2UKDA 4BLQA 3AKCA 4II7A 2EFHB 4HYYA 1A1VA 3C8UA 2MSDB 5FBVB 4P32A 3TQFA 2GETA 2C8VA 5EP3A 1R4AA 5JI3E 1H8HA 1BH2A 1W5TA 3UWOA 4LHVA 4B2PA 1G8PA 4GDFA 4L4UA 5J5CA 2QTVB 2GF0A 1KTVA 721PA 4MUAA 2C2HA 1SVMA 2IF2A 1EX6A 4D2IA 2GA8A 1MO5A 1KO1A 1Q20A 3P20A 2WMOB 2ERXA 3UXMA 4RY2A 1ZCBA 2YHSA 3THOA 1Z0AA 4DLTA 4M1KA 3GLHB 1M2OB 2ANCA 3QBTA 2OFOA 1PV4A 1VDZA 3QI2A 2ZU6A 3BK7A 4LYHA 1N6OA 2P6RA 2ZQ5A 4LBWA 1Z6XA 4N0DA 1XXHA 3N5CA 4QNRA 3DHWC 4ACAA 1MABA 2J0QA
chains in the Genus database with same CATH superfamily
4X65B 2QVGA 4X71A 1D6JA 4NAVA 5HEKA 3P0IA 2H8GA 5FA8A 3TX2A 3DFKA 4U2KA 1FW6A 3QNWA 3USCS 3M4XA 1SG6A 5CG2A 1XQ1A 5ESWA 2IYQA 3I9KA 2AJLI 3UWMA 1EJBA 4IICA 3ZC3A 1PRYA 1R4NA 4GGMX 2M2IA 4HDNA 4IDCA 2JGNA 3R3UA 2CLLB 2BFOA 3DYIA 1Z8FA 2AJBA 1W46A 4ND8B 5D3MA 4AZ0B 4QM6A 2WFMA 3KM0A 4FN4A 4F1JA 3P97A 2LCFA 5ALIA 3T4UA 1AY0A 5C0OE 4E70A 3OJOA 2JCVA 2P9HA 3JARA 4RVUA 4U2CA 2BZ1A 4RGBA 4DABA 2GBIA 4NPHA 4P5DA 5FHQA 5J40A 2RGGA 3U4QB 1NE2A 1RJ9B 3KXDA 3QVSA 4MR7B 5TPWA 2NO5A 1D03A 3ZDEA 4ZAYA 2ZE6A 4Z8XA 3HU3A 3N70A 5E2AA 1SBYA 1W76A 2FEWB 3R3YA 4AF7A 2ORYA 4L8LA 5FIUA 5BPFA 2GXAA 3CCCA 4LFBB 1JLMA 1KJQA 2OD2A 4NCNA 2JCXA 3Q6IA 3D2LA 4OHXA 4DIBA 1IN4A 1S9HA 3G2NA 4P3NA 4YV7A 2SECE 1PT9A 1BEUB 1J5PA 2L17A 5FTMA 4N82A 3O8OB 3PJFA 1CR2A 3BORA 4RIGA 4HDKA 4UUNA 3DKIA 4BC1A 2JKYA 2X4IA 2B8EA 1SB9A 3N2LA 1LB1B 2D1TA 1CRQA 3G2HA 2CYAA 1H8HD 3DVSX 3W3ZB 3NEYA 3SR4A 1WCV1 3T8YA 4DMHA 2XB6A 2G40A 4ZVOA 1ZH6A 3ZXYA 4QUKA 1NDUA 3TLKA 3HBLA 1Y9JA 2HQRA 5EXPA 4D6YA 2HW8A 3AZQA 3BRWA 5IEJA 3JRNA 4FGKA 2CLOB 2W8BB 5EHXA 1CY0A 3L0SA 3JSAA 1T8UA 1X1SA 4HMPA 4YUXA 4W5OA 1D9XA 3GJ5A 3PQ3A 2XMQA 1FRNA 1OAOC 3DNFA 1TM7E 4GDMA 1NT2A 4YC7A 2WUEA 3LM8A 3K16A 3W04A 5A4JA 4U6SA 3SX2A 1R9GA 2XTJA 2Z8ZA 4MS4B 1K86A 4R2XA 1E4EB 2CXSA 3S7ZA 1WMAA 3QBVA 5K0NA 1CZHA 2JCGA 1YCDA 3AY7A 4MJ7A 3NHPA 1X8JA 4QU0A 5C32A 3ZW9A 3F7MA 5EWLB 1LXCA 4W7SA 2W6IA 1EZ1A 4B82A 5HIAA 3RBAA 4PYQA 1CHNA 1CUDA 1Q77A 2I71A 2XT0A 1LI4A 2XB9A 4N9QA 3PA8A 4JKYA 3TSOA 1ZVVA 5LOVA 3T3OA 2VSQA 2H59A 2XUPA 4K9LA 1VBMA 3BMQA 4UVDA 3ZGYA 3Q15C 4FQ5A 1CDOA 1NJ1A 3IO5A 4OOEA 3CYFA 5DASA 3QY0A 4Q1EA 4ARVA 1OPRA 4GSKA 1O6CA 2C2BA 3H8SA 3KPWA 2HHAA 4F4CA 4M83A 4HRXA 4KXUA 4KPUB 2X1LA 1PD1A 1MTOA 3ZGXA 3BJZA 1TEHA 5H0IA 1GR0A 3U3JA 3OCWA 1PJSA 1R0BA 1Y5NA 4R8RA 4FBGA 3R5JA 1Y5LA 2Q46A 3SX0A 1UT8A 2Q0SA 3P0RA 4R3WA 3VPFA 4JBYA 2ZUSA 4MS1B 4CKEA 1FYFA 3WIDA 4IDQA 2JI9A 5ELMA 1WPQA 5A4KA 3AI2A 1J9EA 2NP6A 1P39A 4LNUB 3G8CA 4RO0A 3PCXA 1ORIA 4MA0A 3ENNA 5AK5A 2X9GA 1J5XA 1NP7A 4JIMA 4D9EA 3K2IA 3KWMA 3T3PB 4V1CA 3U39A 4UREA 3WWZA 3KTFA 4CM4A 1C7JA 3H1AA 2R5WA 4CWAA 5CA0F 3HHEA 2BGRA 4W9NC 1MBZA 2BLLA 3BRCA 4GQIA 3E0XA 3GCZA 5A5VA 1XX6A 4QPDA 3BSSA 4WXRA 2GK3A 1C5KA 2Y1FA 1SXHA 1V7CA 4Y0NA 1FUUA 3KEQA 3K3PA 1DO0A 4LWOA 5ECWA 3PDIA 5LBUA 3U40A 2F8MA 3EJWA 5E4YA 2P77A 5BYJA 1DQSA 3IYLW 5IAAA 5J2UF 1R6BX 1UWCA 5A3QA 3LPMA 4FW9A 1XQWA 3T7EA 3PNSA 3LYAA 5K0CA 4BN5A 1Z3IX 2Q2WA 3MTBA 4PCLA 4M8LA 4ZOCA 3A1UA 1JBQA 5KMGB 2ZIVB 3EEFA 4JA0A 3FLEA 3IAHA 2R8ZA 1A82A 3GD5A 3OTQA 4PSVA 5HM8A 3K09A 2A88A 3ACCA 1U8AA 4KR0A 3ABOB 1SU8A 2AEFA 3DBLB 1QO0A 4E13A 1B26A 3CH4B 1KEZA 1CQPA 1OFGA 1XRSB 5H7XA 1IHOA 1DZIA 5C8YF 3SEFA 3RJ5A 3K4HA 4IF6A 4B47A 4AKGA 2PH7A 1T6ZA 1SOAA 4FW8A 4L07A 1RI4A 2GPNA 2NZVG 3IVAA 4D74A 4UTVA 2F90A 4K0KB 2HRRA 3KTOA 3NTVA 2YICA 1Y89A 3TNJA 4ZQEA 3AR3A 1G38A 6YASA 4X6XA 3JTEA 2EL7A 4U9IS 2TMKA 2B9VA 4J3NA 4CLOB 2D2VA 5BW8A 4QBHA 4BFTA 2AN9A 2BF4A 3CEPB 4J3JA 4FHGA 4FYVA 4UUMA 2V5UA 4ARZA 1DVRA 1XAJA 2P2DA 2OZEA 2TSYB 1OZFA 3F2VA 2RJNA 4P6VF 5J4LA 5LKAA 1YB2A 4D57A 1TNDA 1TVKB 1U2GA 1T0HB 1UP4A 2E4WA 1V8ZA 2EFCB 2ZRJA 2W48A 3LQYA 4E33A 1ZM3A 1JR3D 2IYRA 3BL8A 2WPNA 1EK6A 1H05A 4GM4A 1WBJB 1EE9A 2HA7A 2R6CA 2I87A 2V6JA 4F5EA 1J06A 2AK2A 3AHFA 4HF7A 1TW3A 3OFVA 4I4LA 4LJSA 4WECA 5CT5A 1C7QA 4QPPA 5D1NA 4CT5A 2GN6A 3W5AA 1E8MA 1L5VA 3TLGA 1XLVA 4EB0A 1PZMA 2C0CA 2JRLA 1X1AA 1GXSA 2G1KA 5KQGA 2J6BA 2CXPA 4MWZA 4RJLA 4E21A 1T4CB 1R0LA 3GIDA 3QXHA 4GKAA 4XXHA 1IMOA 3NV9A 1Z88A 1ZKDA 2ZFUA 3PKIA 4L4SA 2DFNA 1MPXA 3PNBA 4QVKA 5FOTA 4AIRA 4U7DA 5LDDC 4MQEA 4MPJA 4AN0A 1FFGA 3OT4A 4PGMA 2B1RA 1KMIY 4I6JA 5EQFA 3ZHOA 1ADCA 5K3AA 3VH4A 2XSZD 1VMAA 2O7NA 5CAEA 2BFBB 4MUFA 4YI3A 3JQ8B 3GIWA 3OZDA 1U02A 2AJTA 1W19A 3EVCA 1HTTA 3D8HA 4JCCA 3OF2A 5LDHA 4A0HA 4WAUA 4E5DA 2D6FA 3L41A 4RV4A 3RVMA 1ETHA 1G41A 2QTNA 1HDZA 1JDTA 2CGEA 2UYCA 4GZ6A 3R7FA 2R6GA 3FB1A 3HDVA 5BNFA 3KUDA 5JRJA 4GKJB 3WLKX 4J4BA 4F71A 1B8VA 4IRXA 3SYNA 5D87A 4KI7A 4F97A 3LQ4A 4QATA 5EWJA 5BT8A 4OQFA 2PYDA 1UM8A 2F8TA 2XUIA 3O3OB 2K4MA 2C61A 4KE9A 4RM2A 1V26A 1N2OA 1M54A 2IYZA 5AJHA 3DEHA 3QV1A 5JLAA 2XKJE 4JLBA 2CT8A 2QNBA 1G17A 4BNVA 2WRZA 3ELWA 2IXFA 1XU7A 4JOQA 3SM9A 2AH5A 2WIKA 2H18A 3DO5A 3IAUA 1WSBA 3L0ZA 3QTLA 4FCWA 4Y7DA 3WDMA 4IZOA 4C5CA 2BHRA 4YJFB 4FS3A 3RSSA 3DQPA 3BMOA 3RVJA 1IJFA 3WFZA 3T7TA 2GYWA 5CFQA 4WJLA 2AHOA 5C81A 5LMCA 2Y3IA 1ZEMA 2H65A 5ITVA 4UQPA 2YHAA 3OJFA 4KXYA 3GAZA 3TI7A 5DYTA 3CH5A 5JSFA 2FETA 3VHXA 4Z7OB 1CUUA 3MCAA 5A5EA 2WHQA 2YN0A 2REQA 3GA5A 4LS3A 1NIPA 5IAOA 4V0KA 1YC5A 4C0BA 1NRXA 4KQGA 1JHXA 3ABQB 1GLVA 2Z6VA 1RAFA 4Q24A 2ADFA 4TYQA 1U9CA 3RYIB 3A1FA 4MCIA 4NH4A 1ZSYA 2IW3A 3N2YA 1IWBB 1NM5A 5BUZA 5K0TA 4K6HA 4H6WA 1S2IA 3L1JA 1OHHA 4L76A 2A4KA 3P0EA 4G01B 3ND9A 2I1QA 4NFHA 4E08A 4N40A 3SFZA 1H2WA 2P9QA 1NJ2A 3AIKA 1ZA1A 2JIOA 3MT0A 4IWNA 4UD6A 4BEVA 5CDFE 2O8EB 3GX1A 4I08A 3EVTA 3HCDA 1XJWA 3OFND 4RSRA 5EHQA 4OHFA 1VRWA 4DV4B 1QWSA 3B3QA 3BJMA 1FDOA 2EATA 2BFAA 2PZGA 4HWRA 3PNYA 4Q6BA 4NMMA 4B3RB 4JBLA 1DEAA 2AOWA 2OVFA 3ADOA 3ESYA 3OD1A 2I76A 2RK3A 4J6EA 3AHEA 4UDXX 1DV1A 2FPWA 3N3BC 4LTDA 4YP9A 2NU8B 3VTKA 1GADO 4B35A 4WESA 4EIWA 2C8JA 1I9GA 1P2TA 4F72A 2VBCA 3GAMA 2JLUA 3CO0S 1E61A 2XQJA 4HH1A 1E63A 3I12A 5JDIC 4J2OA 2I6UA 4GNRA 1MAUA 4KWTA 2WZBA 3RK1A 2XVZA 5EQTA 3S5JA 1KJ8A 4CMIB 3K96A 3DKPA 1FP2A 5IF3A 3I4CA 2ATVA 1TTPB 4AY6A 1Y5MA 4LK2A 4YYEA 4M49A 5JQGF 5I7HA 1JDNA 3GFSA 1V5FA 4HNTA 2ZM6B 1FQWA 4HQ0A 4L8YA 2VF7A 1NBIA 4A7PA 5JC1A 4X9XA 4F4IA 4GL2A 1T9CA 2C58A 3K30A 2XJ4A 1DBSA 1C3EA 4WA7A 4KDCA 1Y9ZA 2GRAA 2H1HA 3O90A 2YQ4A 5D86A 3AHJA 5KREA 3IVGA 1FSSA 1MOPA 4CZ2A 5C5IA 3GFTA 1PFKA 1RSZA 5C4IA 1VL5A 1CLEA 2G9VA 3IHTA 1DJMA 3IEXA 3AVUA 2IOHA 1Q3HA 2VJNA 4IAOA 4HI0E 4EB6A 2QX6A 1H6CA 4D0SA 4YXWA 4IIJA 5E6SA 5IKEA 1PVDA 2D7DA 2F7SA 1N4DA 3UJPA 1KSHA 4UHJA 4LE0A 4Q1FA 5ARBA 1G98A 2OZLB 5F1OA 3DAPA 1FZQA 4HHEA 4L27A 3NWEA 4MSUA 4YPOA 5GZ6A 2J9GA 1YRQA 1FXWA 2CNWD 2OY0A 3I5YA 1N6LA 2J3HA 5A4MS 1FTWA 1TZMA 2D1YA 4QECA 4O3FA 1FJHA 2OG1A 1YBVA 2RHGB 1KOLA 4FNMA 3U7QB 1EFDN 1N7JA 5DV9A 3CHYA 5TF4A 3VR0A 1PZGA 3UTDA 1UBTS 5JMWA 3IKTA 2PUDA 4MVCA 3EE6A 5AVJA 3E9YA 1ISFA 3IFSA 3HKDA 1NP3A 4CLHA 1D0IA 4C7MA 1I2DA 3GJRA 3N5KA 1BHJA 4M6WA 3B38A 4K0RA 3U49A 3FI0A 3MGAA 3N8DA 5IDQA 3UJ8A 3LUFA 1GPBA 1NUAA 1KL7A 1N2GA 2HV8A 2I67A 3JQBA 3WR5A 5B3JC 5KSYA 2B8TA 2OV8A 5JLJA 2GEDA 1I1OA 1RI5A 1XTTA 2PRZA 2Z3WA 4A8HA 2A5LA 4O5OA 3T3HA 4CIWA 2YJ4A 4R81A 4LX0A 5JMPA 3G88A 3MK31 3IV7A 3RW9A 5IMSA 4EI2A 3X43A 4ZV4A 1RADA 1SA0A 1SULA 1NFFA 3FYSA 4JB2A 5LLSA 1BYIA 1SC9A 3SYRA 1T15A 2FN4A 4L08A 2OECA 1YA4A 1XJQA 1MB9A 1CC1S 1SKAA 1ULZA 1XELA 2D7CA 1PK9A 4I3FA 4NFYA 5SY9A 3P96A 5JHHB 2ZZNA 3PX2A 1P9LA 2YJTD 1JAIA 5H3CA 3T5DA 3AHDA 4OHCA 2O2CA 3KT6A 5AUOB 5FQNA 1GGHA 3ZZTA 1RBZA 3HS3A 2DC1A 3MRSA 5AW4A 5KPJA 2BH9A 4DMKA 1PZEA 1EUCA 1RD4A 3HR7A 5D1HA 1DUIA 4I36A 4NFLA 4OXRA 2NSYA 1Z33A 4Q12A 1LWNA 2A9JA 1JFRA 4FNGA 4I55B 4Q3DA 5EHNA 1DAMA 1GILA 3STVA 4YT5A 1GGEA 1IUPA 3N6XA 1P4GA 4MW4A 2A1UA 2HDWA 1ZMOA 3AVOA 3PFIA 3QU4A 4NE9A 2GARA 4PGGA 4RY9A 4IO1A 4B7XA 4BZZA 5IT5A 2WJIA 1K6XA 1YASA 2AI1A 5M7EA 4XVQA 2XZDA 5L4LA 2PVCA 1ZVMA 1UBGA 2HXYA 2ORVA 3FUWA 3NORA 3OZIA 4NMXB 4FM9A 2RGRA 1Q16A 2C00A 2EBFX 2PSDA 3QYJA 1EFVA 4GWKA 5K05A 1AHHA 5CP8A 4O4HA 5JY1A 1V7QA 3WFJA 1O0SA 3OTOB 4HH4A 1WPGA 2J08A 3URKA 2MSKA 3VSAA 5GONA 1RAGA 3WNBA 4UE2A 2VH2A 5I01A 1K8RA 1KDRA 2GSDA 2RI0A 1E94E 1QQ7A 4MVJA 1ZAYA 3GDFA 4D9NA 4N01A 1G3IA 1DQZA 4OJQA 3WIOA 3VA7A 3T5BA 2GCPA 2B2NA 4MP3A 1QS0B 5K2MA 1EDZA 2XNKA 1QU3A 1X8LA 3FDXA 1FTQA 2KLBA 4TMKA 5DNUA 4JYCA 4WXPA 1MX1A 3RODA 2CJWB 1UODA 5CD9A 4XYLA 4RH3A 3JYHA 2GLUA 3ROMA 1U6IA 4EH1A 1M3SA 7ADHA 3F67A 5B3KA 4UFOA 2OM2A 2X0FA 2YWJA 2F43A 1SC4A 1JFVA 3AONB 2EYQA 3D7RA 4YLEA 3ZVMA 5HILA 2C7RA 1ESMA 1JG4A 4DUYB 5CA1A 4AZTA 4BVAA 4QGAA 4F4FA 4TZ6A 1QYVA 2BEWA 3P9RA 3X1ZA 4TQUS 2C2OA 4GGOA 5J2TA 1NTRA 2ZRQA 4QQKA 3KOOA 5AKIA 4MUMA 3ZXIA 2VSXA 1T2EA 3A4MA 2VXYA 2ZSJA 3BS4A 3HKEB 3OSUA 1Z5UA 4ESHA 2FMTA 3A25A 1EDDA 4TVBA 3H5WA 1Q14A 3TIIA 4ZP1A 1T2DA 2H06A 4Q37A 2F6RA 3L0YA 4J75A 3R7WA 1IBKB 4PS1A 1YT5A 2JCBA 2AG8A 3K9GA 3ECCA 3OIWA 1KZ7B 2APJA 2B37A 4NP6A 1EZZA 1M1YB 2E5LB 4P0QB 2PUWA 2J9FA 4C21A 4FFWA 1DFGA 2WAAA 2Y77A 3W3AH 5DTIA 3F7OA 4BQRA 2IXTA 2PGNA 2R6R1 3TJMA 3IQEA 5ENZA 2FF7A 3H6HA 5K3CA 1NPTO 3VNUA 2GCEA 2YZ7A 1TZ2A 5L40A 4DWJA 1E5DA 1TCBA 4BNDA 3F90A 4YQFA 3COWA 4RA9B 5ADUS 3PC2A 2EU8A 4DVGA 4AYXA 3ZV6A 5C5CA 2RHDA 5I7UA 4J1QA 1IPHA 2PGAA 3B60A 2DPYA 2CYBA 4KFUA 4HNUA 1YQ9A 4LAFA 3A4YA 4ALKA 1BHO1 1DMRA 1BVYF 4KMSA 1JGTA 3SHOA 4P35A 1DMSA 1LTHR 2OFXA 3WJ1A 5AHOA 1MEEA 1CP2A 1RKVA 2RHMA 2V6BA 2O7QA 4GPTA 2CHUA 4I2NA 4LY3A 5P21A 5EE5B 4DDMA 1SRQA 1O4VA 3D8SA 3CZ4A 5FBLB 3H86A 1Z35A 3WBBA 4Q4AA 1YDFA 5DNWA 4M55A 3NLLA 1M10A 3PF9A 2IA5A 3Q6MA 3QKTA 4IH9A 4AIIA 1H2RS 1ECFA 3B1VA 5CG1A 1C7RA 1O8CA 2CMKA 1U8UA 5LXTB 2YOGA 1OE0A 1WXQA 3QVUA 4N3CA 3NC1C 3PGKA 4Y6SA 2O0LA 4Q01A 3HBJA 3OZVA 4G0MA 2BFWA 3W4KA 5MFPA 4LCEA 2A9VA 1EFTA 3MAJA 1KNXA 2PJUA 2XGMA 1PTJA 4B6JA 2JC3A 2UUPA 4R69A 2G9NA 3K05A 3L46A 2VJBA 3RTDA 1KR5A 2R751 1RPTA 2GD1O 3I92A 3KBOA 3OPYA 4I46A 3AK4A 5IH3A 5IBRA 2IWRA 3RPEA 2PV7A 4OI2A 1BGWA 4B71A 4YJDA 1A2QA 4GYKA 1SBQA 2PZKA 4P4NA 4O6VA 1L5WA 4HLNA 4DLKA 2V3CC 4A2QA 1YAJA 2EW1A 4RMNA 4ZOLA 1O3YA 2NUPB 4I1YA 1LTKA 1NNUA 2QG9A 1WB9A 5E0KB 1XK6A 2XYGA 2WABA 2Q4DA 3CU5A 4KO2S 4MZDA 3HXOA 2PRIA 3A27A 2HDHA 2JZNA 2YVLA 2A6PA 3HCOA 1QBKC 3OZRA 4WKCA 3FBTA 4EW6A 4C1BA 1XEAA 2VP4A 3QWHA 5JROA 3ZDFA 1RRMA 2C2WA 1TTTA 4N49A 2JI4A 3DQZA 4QD3A 2GN0A 1SIWA 2ZKLA 1PQUA 3G9XA 1TF5A 3KJQA 2P9ZA 1RYZA 1SG9A 2YR0A 3N7AA 3OU7A 4PANA 5FTNA 3K0AA 1R74A 4G8JA 4LRUA 1I5OA 2VQDA 2WFLA 3AR2A 3BULA 4IX9A 1MQ9A 1O1YA 1RC1A 2OGWA 3IODA 3K1ZA 4JLNA 4R5MA 3GNSA 3ESXA 2ZZMA 4N8DA 1YR3A 4RK0A 2VHQA 3C24A 4TMYA 2WI8A 4US1R 3ENKA 1EH5A 3ZZMA 4XASA 2JD2A 2V97A 3SXUB 3VU1A 4RK7A 4GMKA 1EWVA 2YMLA 4M7RA 4V0SA 2FUKA 5E9WA 2NU6B 3L05A 3DKKA 4ZCSA 5IVIA 4UFPA 5BSVA 3W6UA 3EXFA 4X1OA 2P9FA 3ND7A 1BU8A 1DIHA 5F2NA 2O8CB 3MLEA 3S8EA 4C2UA 2IYVA 4GMFA 2VTVA 5LQUA 3HG7A 4HYQA 2HPZA 4M99A 2D1RA 3GLQA 3TUIC 5HRUA 1PCXA 2VPYA 4DDWA 3FFBA 3CJQA 1VHDA 1OXTA 3T41A 4E51A 5KPDA 2CVFA 1YQUA 3K6RA 4TVSA 5AXBA 3GZJA 1KH3A 4EMTA 1W88A 2HR1A 4MQFA 1K8QA 1EGMB 1QC5A 1T9HA 1U0OC 3F6YA 5EJAA 2YWGA 1N6RA 3A11A 3KYBA 3B78A 3IDOA 4YJ3B 4IOLA 4DRYA 1IQUA 1W5BA 2BC9A 3RRXA 4DA0A 4R68A 1COWD 3GFBA 4ZARA 4EARA 3CUTA 1EFKA 2ZSAA 1ZNXA 2IJGX 1K7EB 1KY3A 1VPLA 2YIJA 4F1KA 2YJNA 3VTAA 1FS6A 1LSUA 2AMLA 1OWNA 2V74B 4Q3OA 3O9VA 3U4AA 5DF1A 5T7BA 3LOUA 2VK8A 3M9WA 1X92A 3JZIA 3TW4A 1TU4A 2BVNA 2XVYA 5FUWA 1Q0ZA 2G71A 4WOJA 1BS1A 3AP2A 1PW7A 1V45E 5FUBA 2O48X 4Q18A 4R7ZA 5ICEA 5EIWA 3H6GA 4YMGA 3E1SA 3LCVB 4G1CA 2MSNA 4RGYA 3G1TA 1XPJA 2UVPA 3LO5A 2PZMA 2RI1A 4BO1A 4YRNA 1G0NA 1AJEA 3K1TA 1BNCA 1T1EA 1JJIA 3KT0A 3QMWA 4UAJA 1KMCA 2PZ8A 4TL7A 4D9KA 5TEVA 3KQSA 1OLUA 1CTQA 1PFQA 4LJ8A 2WBLC 4BP1A 4EUSA 1RZRD 3COJA 1BA2A 5IZCC 3PHHA 4D25A 1WTAA 2EFEB 4PRZA 2OXIA 1ST3A 2MSEB 4Z0PA 2NX2A 2Q1XA 3K5HA 4E4YA 3HZZA 4XA8A 4A16A 2ACVA 2WFZA 1ODJA 1OGYA 2YNMA 1K4KA 4R05A 4QO7A 3B6KA 3C3CA 3LWBA 4PLPA 5CYFA 1OX5A 3VDXA 5C8ZA 1X6VA 3CEAA 3CSUA 3VSCA 4BV8A 4AY3A 2ZTSA 3ZDQA 2JGLA 1V71A 1XJCA 4EDHA 4HT3B 5K0SA 1EG7A 1OF1A 3TK1A 4E2YA 1DBQA 2I34A 2YV2A 4QICA 4MLCA 1KZGB 3ZDCA 1EGAA 1XRLA 1QONA 4PHFA 4DLYA 5CNKA 5M34A 2PM8A 3P26A 3A3NA 5H02A 3A1VA 3TQTA 3SSNA 2WM2A 1IY0A 2O8VA 1TA9A 3JS5A 3OEHD 1KGSA 1OWLA 2F8SA 3QE0A 5ERGB 3WLLA 1HF3A 3SC2B 3O75A 3DDNA 3HCPA 4JAVC 1XHEA 4HVLA 2WYOA 4UTRA 1NVVR 3WI7A 4H59A 1KO4A 3W6PA 3M4NA 1P18A 5CXQA 4GC9A 1FX0A 4EYQA 3PS9A 1Z18A 4JBWA 3F3KA 3UWPA 3X2FA 4BMVA 5JDCA 5MGNA 3UYLA 3WGYA 2R5FA 3I34X 5K45A 4JI7B 1O6FA 2H2IA 2QRVA 2FP4B 1Z62A 2YYYA 3UMVA 3E15A 1DXHA 5I9BA 3A28A 1SHTX 3ZY5A 4OAPA 4RY0A 3D2BA 3E35A 4M36A 4R8SA 1XTIA 2B7LA 1RWMA 5LP1A 4DNOA 4ZJPA 4RPLA 1S2NA 3QVMA 4NCXA 3WWCA 4M9XA 1CYDA 4B8ZA 3KKKA 1BWQA 1QKIA 1RAEA 2H54A 3ZIUA 4PICA 1E32A 3MILA 5KNCA 3E4CA 3AOGA 1P3DA 3DCJA 2A84A 2V54A 1GLNA 1RXYA 5EMNA 5LDGA 3IGFA 3UCFA 5JS7A 4YCAA 2E5WA 4Q21A 2OCBA 2V7QA 4FYKA 2PUEA 4KAXA 2UZ0A 2WM3A 2VAWA 4TWRA 5EMLA 1G3MA 3HJCA 3VR3A 1LK7A 5CITA 4JENA 4KPEC 3TLJA 2AB0A 3WNQA 2MCFA 1XCBA 3R7AA 4RPGA 3HR4A 5AI4A 1DKNA 1E18A 1A5BB 2YFYA 3PHLA 2GJKA 3LQ1A 3Q9SA 5JZBA 4HVCA 1QHIA 3F5QA 2QN7A 5FWYA 1N2CB 2EIXA 2J0EA 4P3KA 1DOHA 2QSJA 4EMBA 4CM8B 2IPAB 3JQAA 4NONA 2ZTLA 3WLQA 1OX4A 2AQIA 2P6NA 5DU2A 2C9YA 1S2OA 1HQYE 1ZK3A 2DPLA 4M89A 1P1KA 1FFEA 1XXHB 1N5DA 1XHLA 2Q5LA 3DEZA 1ZMXA 3E48A 1LA2A 1VPVA 4M1SA 3ED1A 3EY9A 3JALA 3N2KA 5DBHX 1AQLA 4JYBA 4LVUA 3WBFA 2A1TS 2WINI 4PZCA 3TAXA 1RQGA 1V0JA 1VIYA 2VLIA 4ZVSA 4EQ6B 1R6AA 1F17A 3LPAA 4ZD6A 4BX2A 4HDNB 3UH0A 3KDAA 3N05A 2Z30A 4CT4B 1ZHHA 2A5FA 2AK3A 3O92A 2G9QA 4YAJA 5GOTA 3MMNA 4MR9A 5H68A 3X1YA 5D3MB 1CHDA 4NOLA 2GPAA 1V39A 1NJ8A 3AUJB 1V4BA 3S4YA 3ZD7A 3P9QA 1VHQA 3QK7A 3R7NA 1D4FA 1ODCA 1XSEA 2IXGA 3ZXSA 4DJ5X 1JPJA 1L5FA 1RBQA 1RFGE 3F4KA 5C9ZA 2Z6UA 2WY2D 2HK9A 1F7VA 1DQPA 2WJAA 3H18A 3L9XA 5TPWB 3HVUA 2PVPA 2PPVA 2WMNB 4H1TA 5KO2A 1USGA 2ZBFA 3WDLA 1KFEB 4HY3A 1BEZA 2J6HA 2XNCA 1G2QA 3EMDA 4X8OA 3DBRB 5DGCA 3OPVA 3VSBA 1YBFA 2PBLA 4UNSA 2WU0A 1BZYA 3UPTA 4ES6A 5REQA 1BKSB 5ALDA 2FJUA 1NBHA 2QB5A 1RBYA 1KDZA 1KK0A 1NZDA 4BS9A 1DRUA 5ER6A 3JATA 1S8OA 1GNVA 1T36B 1Y3FE 4HDKB 4C6RA 5JUWA 5JFTA 1QX3A 5HVNA 2Z3VA 3TRDA 1MNAA 3UK0A 5CLJA 1XYVA 2P2GA 5IH7A 5E3IA 1P5HA 1VJ5A 5DCYA 3AM4A 4CQMD 2FUCA 4ZT4A 1LI5A 1JWLA 4HGRA 1IN7A 3IKVA 4V0RA 2C5FA 5C46F 1LLQA 3AOEA 4RACA 1KAMA 4ISCA 4UE6A 4PNEA 1UKCA 4IKOA 1WDKA 2B4KA 2PX5A 3BXFA 3VC3A 4II2A 4QFCA 2B30A 3KSRA 2BJVA 3IQIX 3R77A 4KN6A 3DFZA 1KQFA 4R2MA 2AOTA 3LPLA 4YMVA 3HPRA 1MU0A 3PNPA 3VR5D 1Z0ZA 1DP4A 1JI3A 2FHPA 1HA3A 3EGXA 1RABA 2D2XA 5FNVF 2VUUA 1TB4A 1XVVA 2IUFA 5KVQA 4DIMA 3DD5A 3IQFA 3V4FA 1EKXA 2W0SA 3CRQA 1ADJA 4TS4A 4IJ6A 4RFVA 1ATIA 5EIAA 2XJ9A 2NXWA 5K6AA 3NM4A 3RE1A 4IIVA 3CM0A 4ITVA 3RGWS 1C4KA 4RZ3A 3A2LA 3AXSA 5CXXA 5LOVB 5IVPA 1W87A 3H5IA 2ZQZA 2JFHA 3WGOA 2YYZA 4GP6A 3BMQB 3D8BA 4IO0A 5GPBA 1BDBA 2RGNC 3IH5A 1XRMA 4U0JA 4UARA 1QMPA 3RG8A 8ATCA 5LQJA 5KQPA 1RC8A 1G8SA 2V7BA 4RV5A 2G06A 3KKNA 4HN4B 4Q15A 1O0CA 3EPHA 5IUNC 1P1JA 2JHGA 2A9QA 2WG0A 3HFJA 1OFHA 2RHOA 4Y18A 3V7FA 3WB1A 5ALTA 4LRYA 1NJGA 1ZX1A 3RVPA 3IPAA 2DR3A 1A4XA 4OLFA 1EXMA 1WNFA 2FPMA 2VXBA 4G4IA 4QIHA 4RAOA 2OZKA 5A3VA 1U94A 3R24A 4PGFA 2XTAA 2OA0A 4MKZA 2Z6AA 2C2MA 2IELA 3ANTA 2VDKB 3HTXA 5KU7A 1ECLA 2QW8A 3FVVA 1YJAA 4KO3S 4LZNA 1ELOA 3UFBA 1PEKE 3IMGA 2HBRA 2JGEA 2PU7A 5HF9A 5JZMA 4V1CB 3WGMA 1Y3BE 4CM4B 1W0KA 3QLVA 3B48A 3F49S 3VR2D 5JXJA 2EQ5A 3CTPA 2G77B 3MWFA 4FGLA 2KS6A 3ZWKA 1KDVA 1SXQA 3WAGA 3BM5A 4NYMR 4NF2A 3UT6A 4L73A 3K9NA 4H16A 1BWSA 5LNK1 1L3CA 1N2ZA 3BMNA 3BCRA 3G82C 3DFFA 3ZTYA 1XDGA 4D3YA 3PUZA 5BNZA 1GT6A 4WGFA 5EPUA 3PDIB 1YZTA 2K6GA 4O2AA 3T3MB 1J42A 1USUA 1NQ5A 2YXPX 2IEAA 2GHTA 1T1GA 2ATXA 4ZAVA 4AT1A 4ZCIA 1EWKA 3A3KA 4DBZA 4KVFA 3V8EA 3V4RA 1V37A 4J7CA 3II6X 3CNBA 4IIDA 5T8KC 1CT9A 3H3FA 3LP8A 4ZRNA 4BQFA 1NRWA 3PE3A 2GBLC 1SD5A 2Y0CA 1RCTE 3D6TB 3TINA 4BP8A 5JRDS 4MYDA 3K9HA 4LQLA 5KNDD 1Z4MA 3NIBA 3ZJUA 3L8EA 4N5HX 4GX1A 1YIAA 1J2TA 1SCIA 3JV7A 1HE8B 2PKRA 2B1GA 2Q41A 3NBAA 2OZPA 3MRVA 5EXSA 1I51A 1MC5A 2O1SA 2OCKA 2VEOA 3C45A 5FR2A 3CWQA 4M9CA 5EZ5A 3U56A 3I52A 4KIWA 3B5IA 1AMOA 3U3DA 1QG2A 1VMKA 1LF5A 3LK6A 3JQ9C 1SQ0A 1N9ZA 1OC2A 3U4MA 3ETDA 3DPSA 4EY7A 2GPTA 4ZRDA 1PLJA 2CVZA 2ORED 3AFGA 3DDUA 2P0AA 3KELA 1NURA 3LRXA 4NV3A 2A14A 4O29A 4R1MA 4B3JA 3ZDDA 4IBOA 4XR9A 1ONPA 2PZEA 2ZRPA 3I6ZA 4YP1A 1NI4A 2E89A 4ZYYA 4ARZB 4O4IF 1QRSA 1GYRA 2XA2A 5C7IO 4PZEA 5HOQA 1ODSA 1Y1RA 4NBNA 2IYNA 3NHJA 4BNZA 1F8FA 3R9IA 3WHPA 4KAJA 4MLDA 4LJYA 1DDIA 2WD9A 4LZLA 5D3QA 5JYCA 3QWAA 1BQ4A 1UEJA 6AT1A 3U3KA 1E3JA 2HLDD 4WRRA 4YP0A 1LDNA 4KK4A 3GY0A 4C14A 2P6UA 4LVNA 4RVFA 4MB6A 4EW3A 4HDOB 4A8JA 1AQNA 3FNHA 1EK2A 4N5LA 3PRYA 1NHGA 2FR1A 2V9ZA 3NVKI 2F3PA 1D5WA 1JNYA 3HEMA 2E21A 2CLHB 1AQUA 2VYNA 3EG5A 3TLGB 5K7SA 3SP1A 1BDIA 4OHVA 4ZKEA 2G6TA 2CF6A 3DUFA 1D9ZA 3G0DA 4E12A 1V8PA 1UZUA 4QWMA 2FQQA 1N0HA 1NOKA 2BGNA 4LYDA 2AQKA 4RTMA 5AJUA 1P62B 2LVBA 4XB6B 4ZMBA 1DEHA 5K6TA 5J1SB 4MQEB 2ALJA 2CMDA 3VU9A 2HCJB 1UMCA 4JJ8A 1NQXA 3MD0A 1X70A 1Q84A 4A92A 3LW7A 1A9PA 3CX6A 4F4DA 2DG2A 1ZZEA 2JZCA 3PDCA 4IHJA 1JDPA 5DGDA 5KTNA 4EL5A 1RHJA 4UEWA 3Q88A 5BWOA 4BXOA 1M6YA 5AKEA 5D01A 5HYVA 2AZMA 4ED9A 2ZW9A 4RM3A 4Z51A 2FPRA 4Z53A 1J7JA 1Y7IA 4PY2A 4TV8F 4MICA 1MB0A 2DFTA 2IODA 4M0MA 2J3JA 2A4MA 1CNEA 2P2ZA 5EWJB 2OYRA 2GF2A 2QTZA 4ROSA 5CM2Z 5CT4A 4ZCLA 5JFGA 3DXFA 4YXFA 4G67A 4YIHA 2ZRDA 4GR5A 5BQXA 1TT5B 1QZ3A 2BMWA 3UB2A 4UDOA 1KYXA 2OK8A 3BB4A 4OBEA 4A9AA 1PO7A 2W2VA 3AUTA 3GDOA 4HH0A 1AUQA 3STTA 1I6WA 3CUEF 1WM1A 3HRKA 5DLEA 5T6MA 1TKRA 4UCWA 2JFOA 3Q41A 5K8UA 4DR4B 4KMOA 3AB3A 2ZSBA 5FF9A 1ENYA 3PQEA 4GOMD 5BT9A 2CNDA 3M6MD 3TLCA 3ZHXA 3NU1A 3E7WA 1JLHA 4G9GA 4GBGA 4P53A 3T5GA 1QR6A 3AILA 3OJWA 4CM3A 2PH5A 2XDQB 1PFYA 1UINA 4IMJB 4PQEA 3VHXB 4CTJA 3UAOA 1Y0BA 4TT3D 1XTZA 4M7OA 3GFGA 4RIFA 4O4JA 3DKVA 3TUZC 4JL8A 2REQB 5F5XA 4N8SA 1M6HA 2WYWA 1J22A 3M1AA 2WLTA 1TVEA 1MOZA 4HRYA 3K70C 4RADA 4MQLA 3ANLA 3E03A 1IUKA 1AO3A 4R9VA 3WLFA 1QANA 3P9IA 3R5FA 3R75A 5IT9A 1FRFS 3P9PA 1IQ0A 3C7AA 5E8JA 1ZD8A 3TOVA 1EXWA 3CW9A 5FJJA 2DHQA 1T0PA 1TF2A 4X41A 1FUEA 4BGUA 3FGZA 4IVRA 1VCIA 1KO7A 3FPEA 4OVKA 1DX4A 3BCHA 2XUQA 2ZS8A 3IEKA 3PXGA 1H0KA 1U9ZA 2AMYA 1J97A 2XPCA 1NW7A 2YWEA 1EXVA 4FDAA 4X64B 1N6NA 2HRQA 3NWPA 5ER9A 3LKVA 2JVKA 3MWGA 3BTVA 1P4AA 2F3QA 4Y0AA 3OQIA 1ZNZA 3H9BA 1RQNA 1Q83A 2X22A 4BX0A 5HJEA 1J1UA 4WESB 2AE1A 2JLWA 5KWJA 2DETA 4RW0A 2FRXA 5DXFA 4DLRA 5A3RA 1D2AA