1IAQA

C-h-ras p21 protein mutant with thr 35 replaced by ser (t35s) complexed with guanosine-5'-[b,g-imido] triphosphate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
149
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDSYRKQVVIDGETCLLDILDTAGQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Dynamic properties of the Ras switch I region and its importance for binding to effectors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 149
sequence length 166
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1iaqA00
4GL2A 2FSGA 3U3MA 3O8DA 2CHVA 2WWYA 4BLQA 1DG1G 1LF5A 1ZUNB 1C9KA 2PX3A 3HU1A 1QF9A 1VHLA 4G0NA 4BECA 1JBKA 1JJ7A 4TYYA 4LJAA 3L43A 2DBYA 4GOKA 5K8IA 5KSOA 3MMPA 4A1FA 3LVRE 1FP6A 1S4QA 4YDHB 4MKFA 4BLOA 3NTUA 3T1TA 2FFAA 3DDCA 1E0SA 5G53C 4MUAA 5E7JA 2QM7A 2REBA 3E2IA 1Q0UA 1KDTA 3ZIAA 4NCKA 2XZLA 3MCAA 2IYZA 4FIDA 4JBWA 1Q1QA 5JRZA 1D8TA 3LW8A 2H1LA 5CIWA 5AJVB 2WJJA 1FQJA 2ODBA 4HAUA 2G88A 2R6GA 1RJ9B 4WZ6A 3OESA 1IXZA 1CJKC 2C96A 2CE7A 3PEYA 1NVWQ 3KUCA 4HZIA 4OK5A 4OQFA 1W47A 2KI5A 3WYAA 1I2DA 1SKQA 2AD1A 3IHWA 5JEEA 1XD2A 1E9FA 5KTYA 4NTZA 2BM1A 3LH5A 4Z1MD 4LC0A 1R5BA 4MGYR 1P6XA 3AF0A 2P5SA 3GLFE 5KO2A 3CO5A 2CEAA 4KHZA 1EK0A 5FOVA 4QBHA 2IYRA 1AZSC 3K9GA 4GMXA 3NXSA 5FPYA 5FTMA 1KHTA 2QORA 5KDDA 4TYQA 2JLSA 1T6NA 1HURA 3VR5A 2CBZA 3DMDA 1E9EA 1Z6TA 4PSVA 1NSTA 5J4HA 3T1OA 3QKUA 4PPQA 1NMXA 5FPHA 1TX4B 1GDDA 4EJSB 4P4SA 3FMOB 3BK7A 3UWKA 4XVUA 1T5LA 3SR0A 2C2HA 2WOJA 3A1VA 3SI7A 1XPRA 2VL7A 4JLPA 1U81A 1WCV1 2GK6A 2A2ZA 2HXSA 2KSQA 5IRCD 2QMOA 4UJ5A 1DBSA 1E3MA 1VG1A 3D6TB 1JEDA 3LQRA 4XWKA 3U44B 5L3VA 3AVUA 1G7SA 2XZOA 2ZVQX 4R2IA 2FDCA 2VHQA 4URVR 4LPSA 3BFVA 2PZEA 3BOSA 1ZD8A 3R7WA 2J0SA 2VTKA 3GEIA 4GPTA 2Z5FA 4N1AA 4BWYA 2NIPA 4Z8YA 4LPKA 1K8RA 2EU8A 4Z8XA 3W9YA 5BYKA 3FTQA 4MYTA 4KSBA 1G9XA 1OYWA 1GRQA 1OW3B 2B8WA 3SFVA 1YRBA 3TQCA 5IHPA 2CLSA 1PZNA 1FMLA 1T9HA 1OFHA 4CEIA 2O8FB 1QHXA 4B3CA 4L4UA 1L7VC 2F6RA 3UKDA 1W7AA 4BLTA 2D4HA 3HP1A 521PA 2Z83A 1EWRA 2O52A 1W2HA 3MWKA 1G3QA 2W6JA 1P5ZB 1RIFA 5EP4A 2ZM5A 4D4LA 3GFPA 5L3QA 3QKTA 3LAWA 1CIPA 5E3HA 4PZLA 1VG9B 1P75A 3TW4A 4NHOA 2XNDD 4BZQA 2D7DA 1AS3A 2J9RA 1KMQA 1BIFA 1UPTA 4XIGS 4Q1FA 1Q1EA 3ICEA 5FUXA 1W5SA 2RB4A 5CJ2A 1W4BA 1KK2A 4IOLA 1HA3A 3QJYA 2EYQA 5JHGB 4BEJA 2RGNC 1G5RA 4Q03A 4F4JA 1BMFD 4TWZA 1W44A 1IN4A 1P73A 2CXXA 2D74A 3VTKA 1W4CA 3CM0A 3ZD6A 2QAJA 4B3DA 2SHKA 4DT1B 1OJLA 1N0VC 4LHVA 4FCTA 5F3WB 5DI3B 2AFIE 2G77B 1A1VA 2O8EB 1FNMA 1XTQA 1II8B 3AV0B 2ZVPX 3GLFB 5JWHA 3CH4B 2P6RA 4Q4JA 2JCSA 3I3SR 4Z1MA 2QM8A 5EQTA 1ELOA 1NVXQ 1VG0B 5EXPA 2GTPA 2IXFA 5J4LA 1U0LA 1P7CA 2D62A 5TVKA 2F3RA 1KNQA 4B71A 3CIOA 2GCPA 1E1RA 3I4LA 5TARA 4DLXA 3D8BA 5GADl 4PTLA 1VTKA 2OBNA 2ZU0C 4OHZA 5KSPA 2WHXA 3FOZA 3B6EA 3AVWA 1DADA 4Z51A 4TLEA 1G5PA 5KHOC 4LBVA 3V4RA 2YV5A 3VFDA 4EQ6A 5CB6A 3AVPA 3LVQE 1OE0A 4AKGA 3KUDA 4GT1A 4Q1AA 1EXMA 4D4KA 1R0XA 2N46A 1NRJB 2GJ9A 2RH5A 4OQXA 4URYR 5AUOB 1MOZA 3JVVA 4WXRA 3CF2A 1Z06A 4JLBA 4JMPA 5B57C 1VMAA 5JWOA 5F9FA 3E1SA 1NLFA 1G6HA 1RFLA 1OFUX 2H8KA 2OZEA 3FHOA 3TAUA 3BRWD 3CNOA 3I32A 2ZI4A 4A36A 3P4YA 2ZJAA 3L8YA 1W36C 1QRAA 4PO8A 3C15C 3B9QA 3FFAA 1E2NA 3THXA 1E1QD 4M2LA 4M53A 4Q4LA 2IS4A 5CIQA 5SZKB 1KAOA 1T8UA 1OIVA 5F98A 2J41A 1ZCBA 3A36A 4XSGA 3QSYA 4KJZA 3BB4A 2NPFA 4P4TA 4ZKEA 5CITA 2JASA 3EPHA 5JJIA 1KSGA 4YC7A 1OLOA 2UKDA 5DYIA 1I4TD 1RKBA 4L9SA 3UG7A 3WBKA 3K70B 2HXYA 2E1RA 1KI1A 2FPLA 2XNDA 4PO1A 1YVDA 4PHHA 1U8YA 4DB2A 2W6ID 1GZSA 3NWJA 3SFZA 1NBMD 3Q7QA 4B3GA 3GP8A 1Q20A 4WXPA 4JVNA 3VKWA 4NYIR 1ZM2A 3QI2A 4CEJB 1Z5ZA 1VCNA 4MKIA 2QBYB 4PC1A 2AR7A 1M8PA 3WNDA 2REXB 3H4MA 1BMFA 3DKPA 4ZCLA 5G3YA 1TQ2A 2C8VA 3KJEA 4LBWA 4B34A 1A2KC 4D4MA 2EFHB 2A5GA 2ERXA 1R5OA 1M7HA 1SVWA 1WF3A 2YC2C 2RGEA 4Q7LA 2OAQ1 1RYHA 3IO3A 3ND9A 4QXAA 3GLHE 4Q48A 1YJ5A 2C98A 4JYCA 3TJZA 5DN6D 1SQ5A 5FTNA 1G3UA 2VP4A 3W90A 4DLZA 1U90A 3TUJC 1DO2A 3BS4A 2KE5A 2ZJYA 2I4IA 5G40A 5FBVB 1FP7A 1R5NA 5L3SA 1G3RA 4FWTA 4JT2A 3MLEA 4YQFA 1CEEA 1F48A 3PV0A 1HQCA 2V55B 4I1OA 2QQEA 2X19A 4MDEA 4A92A 1HUQA 1JPNA 2Z43A 1SVIA 3OAAD 4KAXA 4MGZR 2QQ0A 4N0DA 4O3MA 1QHHB 4KCGA 1Z6YA 2O5VA 5C2JB 2ZI9A 3WP1B 2Z6VA 4TQ9A 4AYWA 3RS4A 4ZIRA 2ZYVX 3LWNA 1A7JA 4LHXA 4EFNA 2WAYA 2JJ1D 2WWGA 1CJMA 2AKYA 4KVAA 2OM2A 2WWFA 1UDXA 2OE2A 3AEZA 3MJRA 3B8HA 3WRYC 2BOVA 5D3MB 1II0A 5FOUA 2NZ8A 1D5CA 1JAIA 3AH8A 4G3XA 4X8LA 4LBYA 1FPMA 2BVNA 4EPYA 2WM9B 5AUQA 4YMVA 2Q6TA 2QZ4A 3LBIA 2V3CC 3CPHA 5FH9A 2YJTD 1U9IA 3ZYCA 3EZ6A 2D7CA 3KQNA 4ZI2A 1S2MA 2VA8A 3GLIB 1OF1A 4QM7A 3HU2A 2E87A 2WKQA 1NSFA 1SXJD 1M1YE 3NBXX 1W49A 2NOAA 1YRAA 1DO0A 1E1QA 1Z22A 3GPLA 4JLAA 2DWOA 1GOTA 3LXXA 3CB4A 1FW6A 4TL7A 2EQBA 3MD0A 4TMWA 3ZGXA 2NO9A 2XB2A 1EFRD 4QGFA 621PA 1DAKA 4DIEA 3GJ7A 3G0HA 3W8RA 4LJ5A 2PZGA 3KKNA 4A9AA 4DLWA 2PLFA 2PH1A 1E2PA 1DEKA 2IYTA 1GWNA 1E0JA 1L8QA 4WVFA 2FN4A 3EIHA 1WBBA 1E79D 5GJCA 2GF0A 4DUGD 3K0FA 3SYLA 3ADDA 2FSFA 3LNCA 4EAQA 2AN9A 4S35A 4CEHA 1EFUA 2ZUCA 5FTLA 2C9YA 4D6PA 2W6IA 3TKLA 4BZXA 1FTNA 1MKYA 3ONWA 4RD6A 1NBMA 1YQTA 2JLRA 4LYJA 4LV8B 4LWZA 2ZE5A 4NYJQ 4QKQA 3WHLA 1NKSA 1GRRA 2IHBA 3RWOA 5KSZA 5CDFE 4D26A 3AVTA 1G4UR 2HUPA 2JLXA 1R4AA 3U3RA 1N6IA 4ZI3A 5K8LA 1DE0A 3KKPA 3KZ1E 4Q5IA 3PITA 4UXIA 4B47A 2A5DA 1WRBA 1B23P 2AK2A 4NZYA 3FVQA 1OIWA 2ZRNA 1Q1ZA 3KDSE 4FMDF 1E2JA 4A0HA 3JZAA 2AFHE 3X1YA 2HJVA 4LRWA 1JALA 2B21A 1BYUA 1NF3A 2F7SA 2UZ3A 1T0HB 2CLDX 2QRNA 3PUXA 5KDLA 1ZRHA 2ZRHA 3OF5A 2ANCA 1ONBA 2ZRBA 3OAAA 3KFXA 3ZQJA 5KPDA 4B44A 1G64A 1W2GA 3SQWA 1E2FA 2J7PD 3ASYA 2F3TA 4BZPA 1KO5A 4JYBA 4PPGA 2HF8A 2PL3A 2JJ1A 4KFSA 2G6BA 2ZUBA 3ASZA 3OZXA 3CWZA 1G7CA 2QMUA 3IEVA 2ODEA 2HLDD 1S1CA 4BE7B 1F2TA 1PUIA 4JVLA 3S1AA 1N25A 2PCJA 2XZPA 4HAXA 3B1VA 4WA7A 1F2UA 1KI8A 4D0LB 1NY6A 4N0EA 4PHFA 2A9KA 3Q72A 2DFNA 5HCIA 3FWYA 3DKVA 1AK2A 1XZQA 2X77A 1UKZA 2HF9A 3AKEA 4IKEA 1ZMXA 1BYIA 1E9AA 2WSMA 3QBVA 4NH0A 1TAGA 3WNCA 1S0UA 3RLFA 1RW4A 3NVAA 2AWOA 3TW8B 2JLWA 1FNNA 1SXJA 3CBQA 3IIKA 2JDIA 2QP4A 3UMRA 4B48A 4X8HA 1I2MA 3QVUA 2AKAB 3KKQA 3FPAA 2JLYA 2Q9AA 3GJ4A 3MG9A 4A6PA 4F93B 4TQAA 4JBXA 4IFEA 4LV6A 4UNNA 3K70C 2XXAA 1U99A 1ZU5A 2OEPA 3H1TA 5EXXA 2R9VA 4C7OA 4QOSA 1AIPA 1EFRA 4FINA 4AI6A 5FL3A 4WZBE 1TU4A 4LDJA 1D9ZA 3PFIA 2GRJA 2J59A 4KO8A 2WMNB 1KDRA 2QSYA 4M4SA 1JNYA 1YZUA 2PBRA 2QAGB 4EFMA 4TQUS 2B6HA 5A0FA 4H1VA 1O3YA 1TF2A 1E79A 4AG6A 4DUGA 1X86B 1G21E 2XTNA 4JT4A 1UBCA 1JAHA 4V0NA 2ATXA 3MWLA 2J7KA 3L82B 2Q3FA 1QHSA 2R62A 1TF5A 1Q57A 4TTPA 1KMHB 4I1SA 2RGNA 4Q1BA 5FTKA 2GF9A 3NH6A 4HI0E 3THYA 4PAQA 2GZDA 1DAEA 2X1VA 4RFSB 3QXHA 4DLVA 4NONA 2XTZA 2F43B 5ANRB 5L8VA 3MGCA 4TTQA 2QSZA 3DZDA 2VBCA 4ARZA 1P9RA 1XEWY 2Q3HA 3RWMB 2GXSA 2QEQA 3SNHA 5M04A 2NO7A 1GKUB 4Y0AA 2YOHA 2YWFA 3A58B 2C77A 3SZRA 3ZZUA 1E2HA 5FOTA 1WA5A 2EFDB 1GG2A 3AP2A 1NMYA 1PV4A 1Y3AA 2WJGA 1N5KA 2C78A 4PQYA 4NMMA 3QF4A 5JCPA 2HYDA 3MWYW 5E95A 3G82C 4OJQA 3W5IA 3KJHA 1JR3D 1BO6A 2ZRAA 1KK3A 2EWWA 1H8HA 5LB2A 5B2ZA 1C4OA 2ZSDA 2OILA 4UNPA 1ZBDA 3B1YA 3K8YA 2ASEA 5JBQA 3GFTA 1S1MA 4PSKA 1FL9A 3GMTA 2QPOA 4NCNA 2YZ2A 1NKTA 2LKDA 1OB2A 2J7PA 2J0UB 2OT3B 5KNCA 3X1ZA 4A2PA 1IY1A 4JVMA 1GRNA 2IS6A 1XXHB 2ZI3A 4IDOA 4GZMA 2DPXA 4BLRA 2HLDA 2BEKA 2VQSA 1Q12A 3WRXC 4XH9B 3U7HB 2HEIA 4D82A 1NL3A 3TVTA 4G5OA 3MWJA 2CCGA 1B0UA 2YOGA 2B92A 2IYVA 3EZ2A 4Q19A 4GFDA 3UMFA 5EJEA 4S2EA 2FPMA 1IQPA 1RZ3A 1G6OA 2XGJA 3VR6A 2NTYC 5FUVA 3VHLB 2W2VA 4IOKA 3VU9A 2FX3A 1KI4A 1CXZA 4B3BA 1DVRA 4F38A 4PC7A 4XWOA 3MFYA 1W4RA 3QKRB 4TMXA 3K0SA 2GDJA 3FYHA 4IDNA 3CX6A 1WE2A 4KFUA 5FTJA 3HJNA 3G5UA 2GEVA 5TXGA 2IEYA 3ZJYA 5LD2B 2RGAA 5TDHA 2W83A 1VCIA 3QPUA 5JSZB 2K5UA 3IKJA 1P61B 3DZ8A 3X1WA 1BS1A 4G5SA 4M0LA 1NN0A 2VP9A 4LJ6A 3P27A 3U2QA 2Q9BA 4E03A 4W5HA 1IN7A 4IOJA 4PPNA 3T61A 2Z4RA 3AF2A 4LHYA 1CR2A 4WZAE 5B64A 1IXSB 2CHQA 4D0GA 3GJ8A 3HWSA 4B35A 4NCHA 4C0LA 2V1UA 5H8WA 4MGIR 3VR3A 1VECA 1AGPA 1IY2A 4BFVA 5LDDC 2JIZD 1RC8A 4IXMA 2O0HA 5HPYB 2ZYUX 2ZR9A 3KKOA 1ZCAA 1KSFX 4XSHA 1UBEA 3U6KA 1FFHA 1EFCA 2FGJA 2DWPA 5BN4A 1PLKA 1NI3A 2VF8A 4A8JA 2KBFA 4P31A 5J5CA 4LK2A 1E2LA 3H0KA 4FW9A 4DC9A 5HZKA 2QP9X 1Z0JA 1TL7C 1Z2AA 2ZRLA 3IIMA 3W6OA 3CRMA 5SZIA 4EKDA 4QGGA 4RFVA 4Q9KA 2ZRJA 5FOXA 2YVUA 3KB2A 2P67A 1J99A 2G1JA 2VP2A 2ZRIA 3O47A 4LYAA 4KSCA 4O2LA 1ZU4A 1X1SA 2FZLA 3MJHA 3NHAA 1C1YA 2HT6A 4G5QA 1E1RD 1KKMA 4PZZA 5DE3A 3RS3A 2ZXUA 1U0HC 1W46A 2X2EA 3PQCA 1JR3A 3M0EA 2O8CA 3KJIA 5E7MA 2WSSD 2GJ8A 2RHMA 5KDOA 1S3SA 3B85A 4M8NE 5K8TA 2NZJA 4JIMA 4C0QC 4YMUA 1XD2B 3HPRA 4CF7A 4YONB 4LHZA 3SC3A 4I1VA 5BWMA 3SJZA 3CX7A 3B5JA 421PA 2HYIC 4Q4HA 2HDNB 3LD9A 5KNBA 3AF4A 4BFTA 3DOEA 4LZZA 4HLUC 4CGZA 4OI1A 2RGXA 4EFLA 4D4JA 4JJZA 2GVZC 4A2WA 3RANA 1CR4A 2ZI5A 4ESVA 1QVAA 4PZYA 4XJXA 3K0CC 3A4NA 4P4SB 1XTRA 3B78A 4MITA 4UXJA 1HT1E 3QEJA 2OUKA 3NC0C 4RKEA 1UEIA 2C9OA 2Q9CA 3EASA 3LRPA 1OXUA 1N5JA 3PIRA 5FOSA 2OV2A 4QJ5A 3A4LA 5GJVC 1US8A 3VNUA 3SYNA 2DHRA 4CVNA 1T5IA 2ZSEA 1TEXA 4DEXA 2FJUA 5CM8B 4A0GA 1J2JA 1KO1A 3EIEA 1DPFA 2BM0A 3CKLA 5FR1A 4G01B 2GK7A 3R7WB 1KI2A 4R71A 2LCFA 4LJYA 3DPUA 4M1MA 4WIAA 1TUEA 4XD7D 4W5JA 3LBNA 2VLIA 2HJGA 1TUIA 5DSZA 1F5NA 3DHWC 3TR5A 4Q21A 2O8BA 1DAHA 4DEYA 4F4IA 4CYMA 4DWJA 2ZS7A 4Q02A 1KO4A 1XU4A 2IT1A 1G3IA 3IHLA 1CLUA 4CEIB 3VKHA 3CUEF 3RRYA 1ZAKA 2VO1A 2XAUA 4ZO4A 1IN8A 3LLUA 1CKEA 1XBTA 3BD9A 2DYKA 2MMGA 4Q01A 1OFTA 5EP2A 3BXZA 2J5XA 3H86A 1TNDA 2XX3A 4HDCA 3THWA 1HE1C 3QY0A 5L3QB 2CL7X 1XEWX 1OKKD 1XCPA 1HT2E 1NG1A 1LVGA 1ZM4A 2FNAA 3K0AA 3KX2A 5KNDA 1OH6A 3QPVA 4RVCA 2JIZA 1IHUA 2IYXA 4DLYA 5DGXA 1GNPA 1R0ZA 2ZTSA 1TF7A 4L16A 2O0KA 2O8DA 1MH1A 2IYQA 3U4QA 3CPJB 4U00A 2QA5A 3SS8A 2YWHA 3EWAA 4M1OA 4GOJA 2IL1A 4I99A 4HAVA 4PANA 2RCNA 1EFHA 5SZJA 3A8TA 2ATVA 1FOEB 4DDUA 2ZQ5A 4TLBA 2VP6A 1NLYA 3GJ0A 1G18A 1UJ2A 2EFGA 1S9DA 2CJWA 2YKGA 4II7A 2A3RA 2MSCB 4FMBB 3T12A 4B43A 4HUQA 1CS4C 4TT3D 4KITB 2EWVA 3AVYA 3TUIC 1XD9A 4QJ4A 1LV7A 4OHYA 3TAHA 2RKOA 1XF9A 3SJBA 2WWXA 4PSAA 2QGZA 4HB3A 2WSSA 2ZAOA 2VP0A 2CDNA 2WPDD 3RYTC 3EZFA 3NH9A 1NLZA 4URXR 3ZZTA 4Q4JB 3C7KA 1EFTA 2R2AA 1VKJA 1DELA 5JEDA 1YU9A 1E9CA 1Z8FA 3UATA 2RAPA 3ADKA 1KJYA 2GBLC 4EPWA 3VX3A 5HKKA 2ZR0A 4IDHA 3EAQA 2Z4SA 3IPXA 4M9XA 2IS1A 3GLGB 1TQ6A 4NYMQ 3HU3A 1J8MF 2Q0HA 1GIAA 5GVRA 1JXMA 1R8QA 4PAOA 1DARA 1XTKA 2G3YA 3B7GA 1N0UA 1R2QA 1T8TA 1YR9A 3W3AA 4EQ6B 1GITA 3QG1A 3F0TA 3UXMA 2D06A 3CNLA 3BERA 3SBDA 3CR8A 1YE8A 3GLIE 4BFUA 5DH9A 4B75A 1UKYA 3U61B 3KTAA 1AS0A 4MKHA 3A1SA 3MRSA 2IWRA 4ACAA 4US0R 4W9MC 2OLKA 3U3OA 4NDZA 1UKEA 5LD2C 3VR2A 5HTKA 3JVUA 1E6CA 1ZD1A 2YHSA 2RMKA 4U02A 4YDSA 4IVPA 2FZ4A 4JSYA 3O8BA 2GCNA 1Q3TA 4XD7A 1RRCA 2QL6A 3THXB 3IUYA 1ZJ6A 3IPYA 4PPFA 3X1XA 4KLNA 1UAAA 3IBGA 1VIYA 1BOFA 4QHTA 1P3JA 5DI9A 3QEOA 5CB8A 5CK5A 5FFMA 3M4YA 4GI7A 2N42A 1GL7A 1Z0KA 4B3XA 1PJRA 2BC9A 1HQYE 1ZUHA 5HE8A 4DXAA 3AKCA 1RVDA 1DAFA 1N0WA 4XOIA 3OIWA 4HLCA 4Z54A 5DHAA 3KJGA 2ZJZA 1G8HA 4Q1EA 3ETLA 1ZNWA 1OKKA 3SE0A 4E5UA 1P9WA 1SHZA 4FMCF 2ZJOA 2JLQA 4YMTA 3C41J 4JLKA 4Q9JA 3CNNA 5FBLB 1COWD 3O8CA 3AP1A 4AY2A 4RD3A 2EFCB 1V5WA 3EPLA 5CJPA 1E9SA 1K6MA 2FU5C 2X2FA 1MRNA 4UNQA 4MYHA 3AVXA 4D81A 1NBME 1JPJA 3MSXA 4W5WA 4F4CA 3NDBB 3AF1A 5KUTA 2OCAA 5BXQC 2WJHA 3CRVA 4HAYA 3TSWA 3P20A 1U8ZA 2DFKB 4OKSA 1R0YA 2QT0A 3LFUA 1KJZA 2WKPA 4BFSA 3A37A 2C03A 4LHWA 1ZIPA 4O2RA 4DSNA 1H8ED 2ZS9A 3FMIA 4EJSC 2V9PA 3WYGA 2D2FA 1ZC4A 4P0TA 1J70A 1LW7A 2WTUA 4TLCA 1WMSA 2ZYWX 3OEED 4POAA 4TT3A 3PUYA 3WMEA 4BRUA 3C5HA 4L9WA 3AF3A 2VHUA 3RRNA 3FKQA 4DCTA 4KFTA 2EFEB 1SVLA 3K9LA 3Q7PA 1XD8A 2Q3MA 5FL7D 4GZLA 4QM6A 4J0QA 2GAAA 4OJKA 2WPDA 4AG5A 4FN5A 5L3SB 1E2MA 4ZCIA 1KDPA 4FCWA 3RABA 3P32A 2QPTA 1XMSA 3QKSA 3T34A 5FBWB 2JLUA 2HCJB 2VSFA 1G19A 1OPXA 3PUWA 3GLGA 1GAJA 1Z47A 2OESA 5JJLA 2ZSFA 3MAAC 4KI0A 2QU8A 4DB4A 1X8KA 2UVQA 4KU4A 2R6DA 1KI6A 4KLZA 1XEXA 4QFMA 5FPSA 1S3GA 4ZIRB 5LB4A 4JKIA 4CIDA 1KTVA 4R98A 121PA 2FGKA 3B1WA 2IK8A 5EE0A 3O8RA 4CT5A 2ZRGA 1VDZA 4ITRC 2JDID 4RCZA 1D6JA 4YLGA 4IDQA 1Z0FA 3Q85A 2W58A 1FMJA 4EPTA 3OFND 2ZSBA 4LX0A 2B7CA 1KI9A 2YINC 3N2IA 1KY2A 5DISB 5FUWA 1KI3A 4PC3A 5JLJA 1LS1A 3EC2A 1TADA 1LF0A 3RAPR 3TR0A 1YKSA 4MRPA 1EGAA 2ZJ2A 1ZNZA 3DMNA 1M6NA 3RS2A 1PLLA 4X8MA 8OHMA 4US2R 2ODWA 3BE4A 5FOWA 4A0FA 2XEXA 2YWGA 5AK0A 5ELXA 3C16C 5EP1A 3AVQA 4DHEA 3NEYA 1SXJE 2P0EA 4JL5A 3TLXA 4URZR 1OB5A 3L2OB 2BBWA 3ZVNA 2QROA 2F9LA 4P4UA 2FH5B 5AUPB 1M7BA 3NEJA 4U5XA 3I5YA 1UKVY 4UJ3A 2KB0A 1LB1B 1Z28A 4PC2A 3UK6A 3GQBA 3U3JA 3H2YA 1XRJA 4ABYA 3GLHA 1NVVQ 1T3HA 3K0FB 2JJ8A 3K09C 2F1HA 4AKEA 4CEHB 1E0KA 4QBFA 1COWA 1Z08A 5F2EA 1QBKC 2QG6A 3ADBA 3I92A 4PQRA 3U7EB 3PXGA 5EP3A 2FFBA 4EPXA 4Q9HA 4MDFA 3PENA 4JLDA 1K5GA 2OFOA 3FHCB 5EXSA 5KU1A 4E09A 3SU8A 4IDPA 1A5TA 1KO8A 1PVOA 4HAWA 2YYZA 3LXRA 4LC1A 4RZUA 1GL6A 3B13B 3TIFA 5EE9A 3PG5A 2Z0MA 2CHGA 1H8HD 5FPKA 1Z0AA 3I72A 1I4DD 1XJCA 1H8EA 5A5GA 4BFWA 1W0JA 2YWEA 1AKYA 2GKSA 3PEUA 2EYUA 3W34A 1Z2CA 1KZ7B 1CBUA 3OEEA 1XTIA 2WZQA 3JZMA 3PUVA 3WXMA 1SULA 3EA0A 4HZUA 1EESA 1UBFA 3HYRA 1EWQA 5AJWA 5FL7A 3BWDD 3NDPA 3D7MA 2KWIA 3N5CA 2IXGA 5P21A 4ERNA 4V02A 1OH8A 4DKXA 2OCPA 3W6NA 3EW9A 4Q4AA 4TN1A 2YOFA 3KXIA 5H70A 3SJAA 1HTWA 2DY1A 2ZRDA 2JLZA 4MRRA 4A82A 3RS7A 2P6UA 1XXHE 4DLUA 2VH5R 4Q9LA 2E9SA 3HR7A 4NPHA 1MR3F 3AUYA 4TMZA 1ETUA 2HT1A 2QP3A 2W2XA 3FHTA 1KY3A 3TSOA 4HLUA 4ZDIA 2ECKA 2PZFA 3IIJA 3X2SA 3ZLJA 3ICQB 4HLQB 4IXNA 4Y0VA 2G0TA 3AUXA 4DLSA 3GJ5A 1Z07A 4CZ2A 2ZE6A 2ZREA 3K0CA 3A1TA 4PAMA 5CM9C 1W36D 4DDWA 2WJYA 2XSZD 4JKYA 2NO6A 5JMTA 3A6PC 1IM2A 1F2TB 4OHXA 3S1AB 5DNYB 3RRMA 1F2UB 4UQOA 3OFNA 4UNSA 1CP2A 2BCJQ 3GJ3A 1ZM9A 1OSNA 2ZRFA 4PXAA 1MABA 2ZPTX 1NIPA 2GCOA 1YHNA 2PEYA 3QXCA 4DSUA 2QGNA 1SZPA 2XB4A 2JAQA 3NIBA 1E2QA 2A5YB 4RZ3A 1P2TA 3QIAA 2BMDA 4TL6A 3M1IA 5FR2A 1F60A 4AURA 1SXJB 5FUYA 5G41A 1UF9A 3HR8A 1E9DA 1J7KA 1Z29A 1J8YF 4QRHA 3R9XA 4I81A 1Z6AA 1W0KD 3QQ5A 3LDAA 3LV8A 3R9IA 1YR8A 2XXAB 4DCNA 2MSEB 4HDQB 4TSFD 2G83A 3ZVRA 4C7OB 2TMKA 3I8SA 5GJWC 1G16A 2ZRCA 5JI2E 4PFSA 5CDFA 3HPQA 3BB1A 4QBGB 4RY2A 4DSTA 4HLDA 2D2EA 1KSHA 4N3NA 3BH7A 2Y8EA 2A78A 1YZLA 2BJVA 3GD7A 4MRNA 2F1RA 4V0KA 4FD2A 4V0MA 4NCIA 5GJBA 2R44A 2JJ2D 2C9CA 2ZUDA 3OE7D 4I4LA 2ORVA 2MMCA 3GFOA 4MYUA 1G20E 1P2UA 4F91B 3KL4A 1KNXA 2G9NA 1RYFA 1Z83A 1E32A 1MO5A 2H92A 2BJWA 2XOKD 2B7BA 1XPOA 2JATA 2WIAA 2IC5A 4M22A 4AC9A 1GUAA 2GJAA 5E7IA 3THYB 5F9HA 3FGNA 2R6AA 3QE0A 4DBLC 4ZDJA 3RC8A 1GILA 2AHOA 2PEZA 3V00A 3CZPA 2I3BA 4A6XA 2AXPA 821PA 2H18A 2ZR7A 4ARZB 5FI1B 3UWOA 1S9HA 1FX0A 2FPKA 1UADA 1KOFA 1NN3A 4CDGA 1E98A 3AQ4A 2GJKA 2ZYTX 3Q5DA 1SVSA 3ZS8A 3L0PA 4HB2A 4ZDWA 4DSOA 1E9BA 4RZXA 3KQLA 1LS6A 4AKIA 1W5TA 2ZRPA 1VYVA 3QF4B 5B30A 3ZH9B 5C4MA 4IW3B 2CVFA 4KODA 3TH5A 5KSYA 3B60A 3DOFA 2RGGA 3BC1A 5KOYA 2CNWD 3D31A 1L2TA 4TZ0A 3WMGA 5DYGA 1JR3E 4EIWA 5KPJA 4QJ3A 3A1UA 4A2QA 2ZROA 2ZI7A 1M74A 3DL0A 3IEUA 2ZJ8A 3VQTA 1P2VA 4Q1DA 4EPRA 5CLQA 1HYQA 1TQDA 3KFVA 2ZANA 1QDEA 5LBIA 1O87A 2ZU6A 3CWQA 2I1VB 2XSZA 2QE7D 3QOFA 1CRQA 3WP0A 1OFIA 1U9IC 2OFWA 2C95A 1G4AE 3RVBA 4NU0A 3TQFA 2IW3A 2LWIA 4RD0A 1M7GA 3ZVMA 3LBHA 1CU1A 1HE8B 1ODFA 1T4GA 2V6IA 4GNKA 4UKDA 3T06B 1Z6XA 1NN5A 1KZGB 4RD1A 3BGWA 2C5LA 1QVRA 4LUCA 3RDPA 3H84A 1Y63A 4KFRA 4NYJR 4OBEA 4ZV4A 3PR1A 1WBDA 3WHKA 2W2TA 2WWIA 3GEHA 2BKEA 4LJ7A 1LNZA 3RC3A 5CK4A 3AP3A 2O0JA 5IF9A 3VU9B 1IBRA 1JQLB 2N1BA 1TTTA 2IYSA 4IEIA 1DS6A 3NHBA 2JGNA 5JS8A 3EPKA 1W0KA 2QMEA 1DTSA 1P60A 1JXOA 1XP8A 1EG7A 3T35A 2GVDC 2IEZA 1N6KA 1OXTA 3K9NA 1ZYUA 4TSFA 4GDFA 5IK2D 3CRW1 1TU3A 1N5IA 1WDTA 3THOA 4DDTA 4M9SA 4LJ8A 3UMSA 4ACBA 1XTSA 4HEJA 1GTVA 2WBLC 3CZQA 2QTFA 1RJ9A 4OQNA 3REFA 4BUJA 3KQUA 2OXRA 4IVQA 3B2EA 1HH4A 1UEJA 3KB1A 2REOA 2JJ2A 3ZVLA 3HDTA 2MSDB 721PA 5A4JA 4KBGA 1FUUA 3OE7A 3IO5A 3MUFA 2QY9A 2GXQA 3OHMA 4LBZA 1JI0A 3TBKA 5EE1A 3RS0A 4B2PA 2GJSA 4FXPA 1E2IA 2GNOA 5FPTA 4D2IA 1AZTA 2XOKA 1E2GA 2ODNA 3TUZC 5FI0B 2JLVA 1NVUQ 1GSIA 4NYIQ 1NMZA 2IHYA 3LLMA 3GEEA 4A8JB 3V4FA 4XTRA 1SHKA 1FZQA 1KK1A 3LO5A 4DZZA 4D25A 2IBMA 3W5JA 4BEBA 4EJSA 2QMHA 2NMVA 2WV9A 4R2HA 5EE3A 5JFGA 4TMKA 3VKGA 2RGDA 4F7WA 2ZJBA 3CR7A 4G5RA 2LKCA 3WY9A 3EXAA 1HY3A 1R6BX 2GWHA 2V54A 4R9UC 1TPZA 2QENA 3A4MA 4H1UA 5HKKD 1OIXA 1ZNYA 1CR1A 3U44A 1KIMA 1Z63A 3FB4A 2ERYA 1Q44A 1BH2A 3QF7A 4NCJA 4OL0A 3FKSD 4DVGA 4DLRA 1Z3IX 4MGKR 3KQHA 3RSLA 4F92B 5TY0A 2O8CB 3GLGE 1TEVA 2CNWA 2CCJA 2G1KA 2PT5A 1YR6A 2VHJA 4RCYA 5CLLA 1IJEA 4BFXA 3F5FA 1RRFA 2FFHA 3LX5A 3QG5A 3QXSA 4RZ2A 4ZDKA 3QNUA 3FDIA 1OHHD 1I4LD 4Q4HB 3OIUA 2BHRA 2O8FA 1XMIA 2AD5A 3CX8A 1E0AA 1XX6A 1ZVQA 3AM1A 4FMDB 4HATA 4B33A 4AYXA 1AJEA 2QE7A 1IAQA 4JLJA 1G5TA 2P2LA 2AWNA 1EX7A 3L0OA 1FTSA 3ND8A 4AD8A 4DDVA 4OI0A 1E99A 4XWAA 4M1WA 2VPPA 3FE2A 4MRVA 4BQSA 3K70D 5C4GB 1DG3A 3ZDQA 4LCBA 2QAGC 1SXJC 5BQ5A 5J4KA 2OLJA 2OG2A 1DOAA 1YZKA 2GEDA 2V6JA 4KYIB 4PC6A 5EUQB 2ONJA 1ZINA 1QG2A 4BGDA 4LGMA 4O0MA 1US8B 1YZNA 2QNRA 2ZE8A 1KGDA 4YMWA 5AJYA 3C14C 1MO3A 4MH0R 1AM4D 1NIJA 2W0MA 3NBFA 5EXTA 4ESHA 5D3QA 4H9GA 3R20A 1FUKA 4M9ZA 1LFDB 2QTHA 3IILA 4FCVA 5SZHB 2BEJA 3K9HA 2HCBA 4C2TA 3DM5A 1NJGA 2P65A 4PHTA 3B9PA 3R8CA 4DCSA 2NO1A 2FWRA 1VCOA 4TLAA 2FSIA 4JJKA 5GVSA 4LV5B 5DLQC 4LJ9A 2O8BB 2GA8A 3PVSA 5IK2A 4MUBA 4DT1A 3F8TA 1N6PA 4GSYA 3CPEA 2GAOA 4BLSA 1ZIOA 2KJQA 4MA4A 5DI3A 3SDZA 1CF4A 1NN1A 2G0NA 1MV5A 3BB3A 4RD4A 2O8EA 3AKDA 1V43A 3K09A 1AQYA 5B58C 1NY5A 4GP7A 3THWB 1II8A 3AGQA 1Q3HA 2IA5A 3GLFA 2F55A 5JJKA 1MO4A 1ZC3A 4M1SA 3U5ZB 2H16A 4JLVA 3K0AB 4LYFA 1ANKA 1IONA 1WQ1R 1QHNA 2XTMA 4GMDA 1IOZA 2ZETA 2IYLD 4C4PA 2P3SA 1GKYA 4LOAA 2O8DB 3U4QB 1KI7A 3LW7A 3TGPA 2PMDA 1E4VA 4PR0A 3PEWA 3L8ZA 3WBJA 2ONKA 4QNMA 3SJCA 2BCGY 2BKUA 1X8JA 3B1XA 4IRUB 4ON9A 1U94A 4QGAA 3I5XA 3WYFA 4AKHA 1T3SA 3SEAA 4TLDA 3TNFA 1N6OA 3A1WA 3KXLA 2BBSA 4GOXA 4KYUA 4M1KA 4AWXA 5C18A 1GNRA 1YZQA 1X8LA 3NBZC 3GCGA 4DRZA 3ADCA 2ZSAA 1SVKA 1YR7A 2B8TA 2OCYC 2CJWB 1QHIA 3UG6A 3VR1A 5UKDA 4B74A 3Q8XB 4HUQB 4LSGA 1OH5A 1U8AA 2J87A 3FKSA 3NKVA 3OIVA 4FWIB 1IY0A 4B6EA 1S8FA 1P72A 1E2EA 2WOOA 4OQMA 1G17A 2J0VA 4XVRA 1OV4A 5EUMA 2FFQA 1OXSC 2V7QD 1G8YA 5H1YA 4IFBA 2J3EA 2FOLA 1XCMA 1P62B 2P6NA 3U3KA 2AL7A 3IGFA 2WWHA 5CYPA 3K53A 1OHHA 3Q3JB 1YZGA 1JQJC 4Q47A 3SOPA 1LY1A 1W4AA 2WKRA 3EC1A 3PUZA 2NO0A 2OBLA 2IUUA 1XCGB 1XJQA 4ILEA 1R8SA 4LJ4A 2JEOA 4HYYA 5K8UA 2PJRA 5J4VA 3QVVA 2OHFA 4HSEA 1KK0A 1U0JA 2J1LA 5EZ6B 4AYTA 4TYWA 1R0WA 4MYCA 3EPJA 4JL6A 4JLNA 3KTAB 4DIDA 1VPLA 2ANBA 2FA9A 1II9A 2FSHA 2R6FA 2NPIA 4JS0A 2ZE7A 1PLJA 3I8XA 5C46F 2PX0A 3HYTA 4KBFA 4HUTA 4CEJA 4WAUA 3I61A 2W0SA 4MQBA 2QBYA 1CJUC 3C5CA 3PJRA 1XTJA 4DCUA 3TVDA 1VG8A 2PJZA 4AIIA 4LYHA 1GKIA 1UDWA 2X8AA 1BKDR 2VP5A 1JEEA 4B2LA 1KYIA 2IF0A 2XNSA 4KVGA 5KYKA 4D0NA 3T5DA 1JR6A 2AX4A 2WJVA 5E4FA 1QG4A 2OO7A 1ZP6A 1CR0A 3TRFA 2XJ4A 2OBMA 1ZM7A 1W48A 4NL4H 4QL3A 2CLCX 2IXEA 4G5GA 2R8RA 5FBRB 1ESMA 3CRRA 4JL8A 1KKLA 1N2CE 1S96A 3W6PA 4E07A 4A8JC 1IN6A 5C1BA 2CCKA 4NE2A 2FMXA 5BYJA 4NKRA 3ZZ0A 4RSGA 4IEEA 3AB3A 3RHFA 2H17A 1W0JD 4BASA 1D9XA 4RJLA 2BIFA 1QHHA 2OSBA 4Q7JB 3EX7C 3SBEA 3EWSA 1OXXK 4RKFA 3NC1C 2GXAA 4EPVA 3EZ9A 4OI2A 4QGHA 2ZITA 3FFBA 3VNVA 3IQWA 4LY6A 1M34E 1E94E 3QPWA 4K46A 1AGRA 1ZNXA 3VMFA 1WB9A 3NBYC 3KXKA 3N2EA 1CRPA 3CW2A 4NBSA 5D3MA 2PT7A 3OEHD 5BN5A 3QXXA 1CJVC 1N3BA 1AA9A 2VHTA 1Q21A 4YXWD 2C99A 3UPUA 3ZD7A 2DB3A 1AQUA 1DAIA 2F9MA 2QI9C 3K1JA 4TMTA 3VAAA 2C04A 2ZRMA 4PX9A 1NP6A 2AXNA 2CVHA 3QXJA 1GP2A 1X6VA 1HEIA 3LY5A 3BH0A 5AWFC 4M1TA 1NJFA 3UIEA 1WXQA 3T5GA 1MRSA 1OYYA 3D3QA 5DHFA 3GLIA 2PMKA 2Q21A 3REGA 4C9BA 221PA 2F1JA 2V7QA 3CONA 1DAGA 4BFZA 4IOMA 4XVQA 3QKSB 4EDHA 2WICA 4GBMA 3PCRB 5JWRA 4TZ6A 4CT4B 2A5JA 1L4YA 2BMEA 4C2UA 1SVOA 5FBQB 1X3SA 3TSZA 3QUSA 2H5EA 1N6NA 1KI6B 2DWQA 1XEXB 1A82A 2GZHA 4QC2A 1XPUA 3AVVA 3NG1A 1GL9B 1P2SA 1KDOA 5AJXA 5JECA 1UBGA 4WBSA 2QN6A 1W1WA 2HV8A 3B1ZA 3SN6A 2QT1A 3EARA 2D3WA 5EE5B 2R65A 4HB4A 2XITA 3EIQA 3QBTA 4GP6A 5JI3E 2YNMA 1CJTC 4A0RA 4Q66C 4YMSA 4K81B 3WNBA 4JLMA 4B6FA 2RGCA 2ZEJA 4WOPA 5EZ5A 1SKYE 1P9NA 1Q22A 2P5TB 3BH6A 3BORA 1ZUIA 1GNQA 5HR5A 1E2KA 4RD2A 1JECA 3TE6A 1N6RA 1G8GA 4L5BA 5HE9A 5TB5A 5JS7A 4U7DA 1L4UA 2EVWX 3RRZA 2XJ9A 1F6BA 1XMJA 2H57A 1LTQA 2A7QA 3F3YA 3ZS9A 2DCUA 2OFXA 5L3RA 3RS5A 4A4DA 4IVRA 2ORIA 4BPBA 4EUNA 4X8OA 4TTRA 1G41A 5HCNA 1KO7A 4OI4A 3T15A 2W00A 4BFYA 2PLRA 4Q9IA 1VCMA 3V9PA 4URWR 1RE0A 2OAP1 1E96A 3ECCA 2FF7A 4OK3A 1XWIA 4R7ZA 1Z6GA 4DLTA 2ZI6A 1MO6A 2BDTA 2FE4A 3RNLA 3B82A 4C0AC 1EX6A 3FMFA 2GEUA 3GLHB 4JBYA 2OCBA 2BMFA 2IYUA 3L0SA 3X1DA 4Q7MB 3QENA 3BFXA 4V0ME 1H65A 3CLVA 5JCZA 3C8UA 2A30A 4C0BA 2RHDA 5IT5A 2DFTA 2EW1A 3L0IB 4NYMR 5DN6A 3E5HA 3R8FA 1D2MA 4C0HA 5AR1A 2IS2A 2CK3D 2ZIAA 1M2OB 4I1UA 4XTCS 4TYNA 2ZAMA 1D2EA 3P1JA 1RRGA 4NP6A 4BLPA 5TMPA 4JLOA 4AK9A 3J81k 3CF0A 5J40A 4HAZA 3SYKA 4E22A 3U6BA 2VF7A 4DCVA 3U7GA 4Q1CA 4OK6A 3OEHA 1K5DA 4YXWA 1D2NA 3CF6R 4MRSA 3VX4A 3EA5A 2JA1A 4B2IA 1Z0IA 2VYFA 4M21A 4ASUD 2ZRKA 4HZUB 5DIFA 2FG5A 4C0KA 1UFQA 3SQXA 2IYWA 4TYPA 3CH5A 3I73A 4Q4AB 1Z0DA 4Q00A 2WJIA 2F1IA 4UXHA 4UNRA 5BN3A 1TQ4A 2GHIA 2NG1A 3EG5A 2VHCA 2WMOB 3AKYA 1G7RA 5AJZA 2J46A 3IDQA 1IXRC 3EZ7A 3W3ZB 3VHXA 4HB0A 4OHVA 2ORWA 2OXCA 4A15A 1AS2A 1SGWA 2R6CA 1GVNB 1KJWA 1PUJA 4O25A 2PCLA 4DJTA 5JRJA 4JVSB 1G291 1P4SA 1T3LA 1KAGA 5G3ZA 1G1MA 1OH7A 4B76A 3KQKA 2IUTA 3FMPB 1VIAA 2QAGA 4URUR 4C0JA 2IX3A 3T1VA 1RPZA 1HV8A 1TMKA 3WMFA 4CRWB 2J0QA 3DEFA 1GM5A 1SKYB 1E9RA 4D80A 5J4YA 3T1QA 2KBEA 4CW7A 2WWWA 2J45A 1OXVA 1N6LA 3ZQ6A 1MABB 4B3FX 2GCOB 3SHFA 1KMHA 4KXFB 3R9WA 2WAXA 4P33A 1NNEA 3N70A 3U60B 2V4ZA 4MKGA 4V03A 1ZW6A 2WVJA 5AUNB 2GESA 1A2BA 1N5LA 3LA6A 4RFSA 4B32A 1G8FA 2F43A 2H7VA 3P4XA 2BV3A 2BBTA 3U7FB 5CYOA 3VR4A 4ZPXA 2IYYA 1SVMA 3BBPA 5BW8A 1QHYA 5DO9A 2BBOA 4ZKDA 3ZIAD 4P32A 1CULC 4US1R 2BWJA 4FI3C 2BMJA 4OYHA 1XB2A 3BAFA 1G3MA 1WP9A 4JSTA 2CL6X 2GXUA 2VEDA 2NQ2C 3UANA 4PQFA 3I62A 1AKEA 3P26A 3DO6A 3C4JA 2QPAA 1XNJA 3OIYA 1OT3A 3LX8A 5JZVA 2QUZA 5H68A 4QNRA 3IBYA 4IJMA 3Q9LA 2V8OA 3M6AA 4GRAA 4OQLA 4Q7KA 1XDBA 5HZHA 4QHYA 2L0XA 1XJ0A 4P3YA 1XMVA 3TK1A 4HDOB 2NGRA 1VYTA 1QZXA 4Q18A 2CE2X 3DM9B 3LQQA 2J0UA 4IHQA 1QHGA 4PHGA 3I1FA 1IJFA 2YC4C 2CK3A 3DVLA 2A5FA 2QTVB 2UZIR 2DR3A 4WW0A 5LPNA 4LI0A 1XXHA 1XFAA 4TL8A 1E69A 1X1RA 3PEVA 4TL9A 3BFKA 4L15A 1ESNA 3IQXA 3RSOA 4BRWA 2IUSA 1JJVA 1FX0B 2GBLA 2FEMA 5JHHB 1UM8A 2GILA 4G1UC 4W7SA 1MT0A 1ZD9A 2IWHA 4M1YA 1G8PA 4ZCMA 4FMCB 2AK3A 4QBIA 2FV8A 4OHWA 4ASUA 2WIBA 4M9QA 4V0LA 1A4RA 1DAMA 3GJXC 2QRZA 3E70C 2VSXA 3BJIC 4TMVA 1G7TA 4V0OA 5J47A 1NG9A 1RRPA 2ZJ5A 1N6HA 1R10A 3Q5EA 1E4YA 1YZTA 5TV2A 4C30A 2VIIA 5IDVA 1KSJA 1XZPA 1E2DA 3QKRA 1JB1A 2DFLA 2VRWA 1VYUA 3CRQA 3GJ6A 2I1QA 4KV9A 4B73A 4QG7A 1AN0A 1GFIA 4JZKA 1Q1BA 1U2RA 3BIFA 5JSZA 1ZM3A 1IN5A 1R7RA 3AVOA 4L8GA 2VSOA 2IF2A 4K8OA 1W36B 1F3OA 1U98A 2FEOA 2V1XA 2CL0X 4PO9A 3K0EA 2RGBA 1J90A 1XEFA 2GZAA 3W8NA 4C0SA 6Q21A 4QHSA 1FQKA 3TMKA 1VHTA 3AGPA 2GETA 1NVVR 1T0JB 1T91A 2W6JD 4C3ZA 3SHWA 2CMKA 3KKMA 2ZS8A 1CTQA
chains in the Genus database with same CATH superfamily
4GXNA 5AI6A 5EMHA 2FQYA 5DNDA 3GRUA 1XZCA 3O8DA 2B2XA 2G7MC 4YAJA 1DG1G 3U3MA 3DOUA 4GECA 2NP6A 3RAFC 2BE9A 4O4HB 2F8LA 1OX5A 3HU1A 3H5OA 2AOTA 1G0OA 3A7EA 1TDJA 4H15A 2FW8A 4JI0B 1JJ7A 4LJAA 3DVAA 3L43A 2ZRQA 1Y8RA 1KZ9A 4R2KA 3LVRE 3WQQA 1FP6A 1VE5A 1L7XA 1S4QA 4YA6A 4D6XA 1N77A 3O31A 1L5LA 1LRKA 2JF0A 1HEYA 4HUJA 2FFAA 2FLVA 4H4EA 4NBTA 1Y6FA 4I9HA 1U5BA 2EAUA 5E7JA 1T3TA 4Y6LA 3ZHUA 3MGKA 3Q7EA 2QRMA 3E2IA 3JW8A 1RM0A 5GZ3A 1KDTA 2PUAA 3MCAA 1RQNA 4RL4A 5IYZB 2YHUA 1Q0HA 3CU5A 4Z0NA 1R00A 3HEBA 4GOND 1FYWA 3MMZA 4A27A 4FIDA 4JBWA 2H4WA 2EF1A 3LW8A 4MXDA 2H1LA 1MMFB 2WG0A 5CIWA 4DQDA 5AJVB 4KLCA 2ODBA 3NHZA 2WWRA 3UK0A 3VR6H 3HHEA 3QVTA 1OWPA 2EL7A 1JDNA 4L9AA 5IKPA 4WZ6A 3NHFA 3OESA 4PFKA 5A4IS 1MXHA 3MQ2A 4MNTA 3AFIA 3F3KA 5JCJD 3D6HA 2X23A 1N33B 2W6ZA 1NVWQ 3K4HA 4NF2A 3KUCA 4X9XA 4OQFA 1SBQA 1DUIA 2HZ7A 3OPMA 3WYAA 1QYWA 5CAEA 3EFHA 4K28A 5E6RB 5FXMA 4CQMA 1E9FA 4DLNA 3DD1A 5F5NA 1HDXA 4LC0A 1JBEA 4FZVA 4BNJA 3GRPA 2P5SA 3KAKA 4G9GA 1AHPA 4FW8A 4L50A 3GLFE 1EK0A 1O0BA 4EGAA 2IYRA 2CV2A 2PYDA 1J09A 1T4CA 1O96B 4LEIA 3G2OA 1DMSA 4ZOCA 2PRYA 4UHEA 4WI1A 4ZJPA 2JLSA 2PDAA 1HURA 4PSVA 4A73A 3QKUA 1TZKA 4L74A 4OXKA 5FPHA 5FPPA 4ZD6A 1GA4A 1P0IA 2UVPB 1QX4A 3PP8A 3CR3C 4MV8A 2QLBA 3UWKA 3BD7A 1QUEA 2YVLA 1NNLA 1I2BA 2C2HA 3GIWA 5TJHA 3SI7A 5ITSA 2IZOA 4ZAVA 1XPRA 3L07A 4WUVA 1FTYA 5FIUA 2AT1A 2A2ZA 1MT3A 5IRCD 1G2QA 4H6PA 4UJ5A 1JG7A 3LQRA 3U44B 3AOEA 1G7SA 1T24A 3MWGA 3NT5A 2A5LA 3E7XA 4FFPA 4AX4A 1V37A 4HNGA 5FNVB 2UV8A 2FDCA 4FR0A 2GFQA 3GG9A 3K9CA 2VHQA 4KXYA 1NZJA 4YX9A 5JFTA 1MJFA 1U6JA 4LPSA 1SQ6A 2AEFA 2PZEA 2VNAA 2VTKA 2DSTA 4PLWA 1SUEA 4N1AA 4Z8XA 2QLFA 2Y66A 2HTEA 3EH2A 4OP1A 3FGZA 5AQEA 5BYKA 3MTJA 4MS1B 1B15A 5FLYA 1SCAA 4MAAA 1J22A 3HCDA 3UJHA 1U1GA 2FN7A 1WLYA 4BLVA 4GWKA 5IHPA 5E6SA 3DLAA 1PZNA 1T9HA 3DB2A 4CEIA 2O8FB 1UT6A 3GW8A 1L7VC 3BGDA 3L01A 4MI9A 1J06A 3E5MA 5IAEA 4IQFA 3NIGB 4P81A 1SUIA 1WV1A 5CP8A 4BFCA 3ZKWA 2ZUFA 4X85A 4DG8A 2P4QA 1E6WA 4LXHA 1EWRA 1B00A 1O03A 1TIBA 3V1KA 3MWKA 4JJAA 3AEUA 1HORA 1FE8A 5ALXA 5EP4A 4WK2B 3WL3A 4D4LA 1W4ZA 2KX7A 3ZOKA 1VG9B 4NHOA 1RLUA 2Z3VA 2XNDD 3M70A 3OOJA 4L3WA 4NNPA 1AS3A 1U4SA 3EIOA 4KAJA 4L0QA 3N2YA 4V0RA 2D7DA 2HW8A 1GV1A 4XUDA 1KMQA 4LRUA 5EYPA 1BIFA 5BQXA 3L92A 4I08A 1IHXA 1Q1EA 4Q1FA 5DHRA 1MJ5A 4BV2A 3LXUX 5CJ2A 1PO7A 1W4BA 5BSMA 2PU7A 2R8BA 4NZZA 1HA3A 3ML1A 3OCXA 1PFWA 1X7DA 4K9LA 4RH3A 4CM9D 5JARA 1QC5B 1CUBA 4YRZA 2H54A 5C7OO 3CG4A 1J2TA 4F4JA 4AQYB 1W44A 3BMQA 2H63A 1C1XB 4JUDX 5A4DA 1IN4A 3Q10A 2EQ5A 3ORYA 5REQA 4C6RA 1W4CA 1VHWA 5E2AA 1O77A 4I4CA 1ZSVA 2QAJA 1FYXA 4CL2A 2HRQA 4IDEA 4D99A 3GLRA 3DUFB 1ZFNA 2LCQA 1GPNA 4LHVA 3BGIA 3GI1A 3KOWA 3MLBA 4C4ZA 4FS8A 4FEEA 5ICSA 4OQQA 3N05A 1SC4A 1JKFA 3GP5A 4OHMA 4MIEA 3IELA 5JC1A 1U2DA 1FNMA 1XTQA 5AKHA 2H1RA 3ZXSA 3OU6A 1BDMA 3ZWCA 1HT0A 2ZVPX 3F6CA 3TQOA 4O4LA 1IQ0A 3ZDFA 2P6RA 3HC7A 2ZWAA 3PFHA 3LE8A 1WWKA 2JCSA 3I3SR 4ZOLF 3CRNA 2AN4A 2QM8A 1FSPA 5HVNA 1ELOA 1A9ZA 3BKWA 1PSDA 5EXPA 4OGFA 3GAAA 2Q0XA 2HI0A 2IXFA 3E7WA 5FA5A 5KB3A 1U0LA 2D62A 5TVKA 5TGDA 4IL5A 3GLGA 5TARA 2GCPA 3DW3X 2OENG 1XOIA 3ZE0B 5F2KA 3WBBA 2ZB3A 1C3JA 2C1ZA 2OBNA 1VE9A 5KSPA 5DBFA 3LI2A 2AZ4A 4ES6A 3B6EA 1B14A 3AVWA 1DADA 2GN6A 4TLEA 3MGBA 2DM6A 5CT6A 4Z51A 4OOFA 1M0SA 1VYHA 3ES9A 2V65A 2VRNA 3GFVA 1OE0A 1EM8B 2GH1A 1EUCA 2VNKA 3DL2A 3G88A 4PLVA 1UEXC 4Q1AA 1FRQA 3TBFA 1EXMA 4D4KA 3KP1A 1SXHA 2VCHA 2GJ9A 4URYR 1UZAA 3JVVA 3LM8A 3D5QA 1JJBA 2BFMA 4LKRA 2WJ6A 3CNHA 1DQRA 3V8PA 1WUJS 4FGZA 2C59A 4JMPA 5JWOA 4MQ4A 1M5RA 4RU1A 1A8PA 1NLFA 5U4XA 3RC1A 1XYGA 4J76A 4CDMA 3RRXA 2ET6A 2PO5A 3NHYA 3TAUA 1DEXA 1LJUA 1WCIA 3SC6A 3VNBA 1JYFA 4QD3A 5L95A 5IUJC 3P4YA 1VLVA 2O2YA 2GZSA 3PNVA 5JMPA 1ZIYA 3RV4A 1N5MA 3BEOA 3DHVA 4QU8A 3RGGA 3JARB 5KWVA 4WESB 2ECFA 3C15C 3FFAA 4DMCA 4F3TA 2QD5A 2HQSA 2C42A 3ZWNA 2IS4A 3ZHVA 3KXPA 2WTBA 4GNRA 5CLHA 5KBYA 2P7HA 1KAOA 3OZTA 3TZLA 3R3SA 2B1JA 4XASA 3OPYB 2J41A 1FW8A 1XDGA 4TTVA 4A26A 1ZHFA 3A36A 4XSGA 2A8YA 3U9SA 1ZL2A 4GPAA 3DEYX 1QGUA 4TV9A 2RIRA 4UU8A 3WOVA 2G5PA 5LNK6 3MCUA 3X2FA 1LPSA 1Y5RA 5C81A 4U39A 1W0CA 1RKXA 2ZTLA 1AHNA 5TDHA 2A92A 3UG7A 3WBKA 3IP1A 1EGHA 4IH1A 4DIKA 7AT1A 4NCBA 1F9EA 4QTUB 5JJCA 1AO0A 3PRKE 4QE3A 5KVCA 1JQDA 1PG5A 3WYEA 2GNPA 2WAAA 2Q7XA 1PR6A 4XUCA 5I5EA 1RIIA 3TINA 4KC0A 2EGHA 1WOMA 4ENVA 1ORIA 3D7NA 3IQFA 2Q0QA 3Q7QA 1Z45A 5H80A 4OATA 4EHAA 1VA4A 1VLMA 2NP7A 4D46A 5I8PA 1PS8A 4ZFNA 5C7IO 3QI2A 1X9GA 2C54A 1ZH8A 2OMEA 2G09A 1VJGA 4KI7A 1OGJA 1M8PA 4MA5A 2REXB 5IFLA 3ETHA 3DKPA 1AOXA 3UJBA 2IZ0A 1E8DA 4IAOA 3E22B 2B7LA 4B34A 2PUDA 1N3IA 1VKHA 1HLFA 3CCCA 4G1CA 1PWYE 3IOMA 4XJTA 4D4MA 4FSHA 1R5OA 4YJFA 4OXIA 4J0DA 1F8GA 1J5EB 1EHYA 4IDFA 5AHOA 1H2YA 2HF7A 5B1IA 3ND9A 1M6EX 1MG0A 5BVHB 4B0OA 5F4ZA 4GX2A 3ZK9A 2C98A 5DYYA 4EM6A 5B5SA 4B4UA 1XT6A 2J0SA 1SQ5A 3OE5A 1G3UA 2O50A 2VP4A 3W90A 9ABPA 1D4FA 1DX9A 4G89A 1U90A 4PLZA 2WNHA 1EINA 1J97A 3E0QA 3BS4A 1NE2A 3ZOZA 1L3IA 1FFXB 2LUOA 4NFHA 1P45A 4UU7A 1XN4A 1JH9A 1BXZA 4G86A 2ZULA 1B6RA 5EXEA 1CEEA 2O2EA 3R7LA 3VHRA 2QQEA 3LQYA 3MQFA 4CHTA 3EIWA 2RHOA 1SVIA 3OAAD 3E5RA 3PKZA 4O3MA 5BNIA 5IWAB 2GX6A 3D2AA 5LJLA 2QZPA 1A0OA 1UBMS 2CD9A 2UYGA 2ZI9A 5FLEX 4AZWA 4BRSA 5A4MS 5KAPA 5K3SA 3WL4A 4ZIRA 4LHXA 1LDBA 1BD4A 2JJ1D 1CJMA 3OC6A 3U19A 5LMUB 3NHSA 2C3MA 3DYIA 2WD9A 3OLXA 1OJ7A 4CQLA 1A71A 1SC6A 5EHNA 5FYQA 4LZPA 2WFZA 2FDRA 3AEZA 1FBNA 3FD8A 1J00A 2ACEA 2BOVA 4ATNA 5AOCA 4HNTA 5D3MB 1Z4OA 4J1SA 3WV4A 4HL6A 3BQNB 5BN5B 2N47A 5FOUA 3FY4A 5BT8A 4MDHA 1GUBA 1RPAA 2HA2A 3HQ4O 1IB6A 1WB5A 1W87A 4OL9A 2BTEA 1CLEA 2B6NA 4G63A 5FH9A 1YDWA 3BRWA 5AW8A 3ZYCA 4LNUA 1E6MA 1T0UA 1JHOA 1GFWA 4YPVA 3L46A 4ETNA 1U65A 2SKDA 3E7DA 2QDKA 1NSFA 1KAMA 1DO0A 1MORA 2X5KO 3I9OA 4MTCA 4HBZA 1T2UA 2DWOA 4FSXA 4L6IA 5B1YA 2OUIA 5ITZA 3FUUA 1GOTA 1EEXB 1KBQA 4RGQA 5IASA 2C84A 3LXXA 3S4YA 3CB4A 1DTWB 3MD0A 3Q5GA 1KIAA 2K6GA 2H85A 4TMWA 1MO2A 4FYVA 2XB2A 3NV7A 1LU9A 2FEPA 2JGKA 2X3YA 3OIFA 4XGRA 1YIAA 3WDLA 2J9GA 2WFMA 3I6ZA 5KKAA 1QYRA 3VYTB 3OY7A 3TLBA 4DA7A 5BMVF 4DV3B 1TJ4A 2JGIA 4UBIA 4BVJA 2Z6AA 4UAUA 1ZJWA 2C2XA 3W5VA 1PZGA 4A9AA 3A9UA 4DLWA 2YICA 1E2PA 2IYTA 2C8JA 4XR4A 1WBBA 1E79D 1SC1A 3G6WA 4DUGD 2HWXA 4DM4A 2AR0A 4JGBA 2FSFA 2ZLBA 4K6MA 1UIRA 2AN9A 2YQ5A 3L8GA 1ZRSA 5FTLA 5JY6A 3TKLA 1JDZA 4BZXA 4EZBA 3ONWA 4HT3B 4QOGA 4M38A 4RD6A 5AHKA 1UWVA 3JAKB 1GAWA 1ZWLA 2VAPA 4LV8B 4LYJA 4ZOEA 5JDIC 3EMKA 1JT9A 4L4ZA 4ZGWA 1PNVA 1U1FA 2OHXA 2V97A 1TJYA 4S1NA 1NKSA 4E3WA 5E7QA 1FTGA 3GWGA 3RVSA 3STYA 2IHBA 4F9GA 2QTNA 3ZHXA 1C9YA 4ETWA 1WSBA 2HUPA 3L7OA 2WW8A 5IF3A 3ME5A 2BTQA 2BGJA 4DMKA 4ZI3A 3KZ1E 1Q50A 3ZBTA 3C3BA 4B46A 2AK2A 3E82A 1XK7A 2PGJA 4NZYA 2KHZA 4YLYA 1QYVA 2GHRA 2ZRNA 4NJEB 1YMUA 4P0QB 2E2WA 1Q1ZA 3H2SA 1GZ6A 4FMDF 1POXA 2VDWA 4TRRA 5B1SA 4UBLA 3UMJA 4MCJA 1LNQA 1OC4A 4ALNA 5JNRA 2QS9A 1E4OA 2YXBA 5EHGA 3EODA 1JALA 1D6SA 4UARA 1BYUA 1QRSA 2CLDX 1XZHA 5KDLA 1ZRHA 1USKA 2Y76A 4YUVA 1K6IA 2Z5LA 4LA4A 2YJ6A 2ANCA 4PINA 3LUDA 2GT1A 4XGKA 3ZQJA 2BF7A 4Q6WA 1IY8A 4B44A 1WAMA 2QL7A 3HCWA 2Q4TA 1G64A 1W2GA 3GK3A 3RFFA 4YUZA 4BZPA 5JAPA 3L7DA 4JYBA 1TT7A 4KN9S 2HF8A 1R12A 3IMCA 4PPGA 3ND6A 1DKUA 5JCOA 3TSCA 5KNCD 3W0LB 3F6PA 3EIFA 4UTPA 4KO1S 2XYVA 2BISA 4GR5A 3Q2IA 2NTEA 5HNKA 2ZYRA 3H7AA 3IC5A 4FDLA 3WYNA 4BQRA 4RIGA 2ODEA 4PXYA 3T7TA 1S1CA 1N92A 1Q0RA 1Q17A 3T99A 4BE7B 4XPZA 3NOQA 2WM2A 3S1AA 4P58A 5I9SA 5KKNB 4R8KA 5ALPA 2I55A 4N0EA 3HCFA 1I3MA 2WP8J 1WXGA 1Y80A 3SXJA 4LXTA 3NYIA 1R0BA 3DKVA 4QUAA 3RYHA 3ODPA 4WKPA 4MUJA 1E66A 2HF9A 4UHCA 5CH3A 3T5AA 2A0YA 1CVLA 1P77A 2EG9A 4R9NA 3TOXA 4ZI7B 1BYIA 2AEMA 3GPCA 1SCIA 2VCEA 4NH0A 3NRCA 4OM7A 1WHTB 3WNCA 5EQJB 4UM9D 3FLBA 3VR6D 1QIIA 5TPWA 2HBQA 3E9NA 3CBQA 4I46A 1CDEA 3IIKA 1Q5PA 2QP4A 3UMRA 1HG0A 5EIEA 3EUEA 1A9YA 3FPAA 2PFSA 3RFVA 1QZZA 3NB0A 5JH7F 1QKKA 3VHXB 3V4VB 3F73A 1AXRA 2C8KA 1QPZA 2XXAA 1RE1A 2P4SA 4OV6B 4RDCA 5EXXA 2C61A 4W1SA 5FL3A 4WZBE 3QEKA 1TU4A 1H2RS 1H5UA 4PBTA 1D9ZA 2GRJA 3I0NA 2J59A 4KO8A 2WMNB 1KDRA 1YFZA 2BDUA 3FOWA 2UDPA 5LYJB 5IU6A 1YZ3A 3FCEA 2B6HA 2QVBA 4ZEXA 4NY1A 4REQB 3I9LA 3OIDA 2H2DA 3BEDA 3HVIA 5HKAA 1SBZA 3D3JA 2JHFA 4V0NA 3UV7A 2CMDA 2XQFA 3A4TA 1YCHA 3MWLA 1ONNA 4G81A 5DGIA 3WTBA 4KIWA 3WZLA 1I7DA 2R97A 3Q3EA 3L82B 1U0BB 2DTXA 5TEVA 3VR3D 4TVSA 2CN1A 9LDBA 2QTBA 1Q57A 4WXMA 1KMHB 1E3JA 1X2BA 4X97A 4U7HA 1RBMA 1RYZA 1S7GA 4HI0E 1GGKA 5E8JA 3MBOA 1DAEA 1L7MA 2OWDA 4EHKA 4NONA 2XTZA 3ZTWA 5ANRB 3O4HA 4P3PA 4R2WA 3CINA 3JQAA 5A5EA 1Z88A 2PX2A 4YRQA 4ZZIA 1QZUA 4I3FA 4RYLA 3DULA 3ULKA 4D44A 2CLEB 1FVXA 2GXSA 3KR9A 4RLHA 3SNHA 1XF1A 4CLHA 5M04A 4MEAA 1ODCA 3BZUA 5LR6A 4Y0AA 1O5OA 3LCUA 5E6UB 3SZRA 4C1BA 2NU8B 4C76A 1B6TA 2SKCA 1E2HA 1WA5A 1J56A 3VSBA 1PV4A 4TUYB 4H6WA 3N3BC 2B4KA 1Y3AA 4QWWA 1VJCA 2NUBA 4NMMA 1HFEL 2PUWA 1WCWA 2RH9B 2HYDA 1MP0A 3CUVA 2J48A 3E03A 3VV2A 4KR2A 3C7TA 3N86A 4G8BA 2P79A 2YIMA 4OJQA 1N3YA 1W30A 3H9CA 3RVNA 1HK7A 3IA2A 2ZCUA 3PWSA 3QHQA 2ZRAA 3UJCA 3A3OA 1Z82A 1H8HA 2Y99A 2GHQA 1DIGA 3FYUA 1J2EA 1E6EA 2FEXA 3G59A 1GPWB 3RRFA 2BGWA 1KOGA 4F9EA 2VKTA 1A4IA 1WMDA 1QIGA 4WEQA 5AI5A 2OILA 4E11A 4E1VA 1NV9A 3B1YA 2Z3ZA 2ASEA 3K8YA 5EJ9A 1XTUA 2VSYA 4IX9A 5LZ9A 1FL9A 3GMTA 1OB2A 1S2NA 3HO1A 2YQZA 1C2TA 2J7PA 3EUAA 5GZ1A 5KNBD 1AO3A 1XA3A 5K0NA 4FB5A 1K7YA 1OU0A 3ILXA 1BQ4A 4JVMA 1IZ9A 1GRNA 1ZGGA 3G0CA 3G2NA 3ABQB 2BY4A 4M55A 3UK1A 4KK4A 5KJFA 2W4IA 4IDOA 4L57A 3RAEC 1L5YA 2H1WA 3OF3A 3VR4H 4DHWA 1NBAA 1Z8NA 4FTWA 4J91A 5IAOA 5F7ZA 3C3EA 3NTQA 3PK0A 1Q12A 4XH9B 4BGIA 3O2JA 2OMKA 4RK1A 4ER0A 5DWVA 3K8OE 4D82A 1HKUA 5JYCA 3IEMA 1QGYA 4IMJB 3OZVA 5F7XA 3ANYB 1O7JA 2W8ZA 2GA9A 1B0UA 1XTPA 1E5QA 2P2YA 4IHAA 4WY8A 1RZRA 2XBMA 2FWNA 4PS0A 3MD9A 3NOXA 3TNDA 3KWMA 4Q19A 4DXHA 5C5CA 5DHQA 4KEAA 5FUVA 4KXVA 3B5IA 3OZUA 2AN1A 3DWEX 4DV7B 1KI4A 1P1KA 2ZBUA 4WKNA 4F1KA 1DVRA 3NETA 3MFYA 1W4RA 3PC6A 4JA0A 2CNBA 1MOSA 4C5AA 2I7VA 1SFRA 4J3FA 4NZOA 4RQBA 4TVOA 5FTJA 1RXSA 2NVWA 1AC5A 2VDPB 1JGTA 2IEYA 4MOWA 1KFCB 2FZ5A 4XGQA 2OGSA 5JIBA 5KMGA 3QPUA 3EF1A 1QH1A 3NKFA 3EVZA 3ISVA 4P22A 4M0LA 1M8JA 3LOUA 4CWAA 7ABPA 2H7XA 2MINA 2W5UA 2X3UA 1B1AA 2Q9BA 4LOJA 4E03A 3FJOA 3I09A 3T3EA 1SQFA 4W5HA 3EQ7A 1KTIA 1GNSA 3SBXA 3WB9A 3T61A 2Z4RA 3EFBA 4GI3A 2RH4A 4WK0B 5ALTA 4CUZA 1QNLA 2BGNA 5IHXA 3LC0A 1OFUA 4RBNA 4D0GA 5J23A 3HXKA 5EIBC 4B35A 1QK3A 2GD6A 1HFKA 1LCIA 1UM9A 1GYQA 1KFJB 3G2PA 2HSGA 3G89A 1YSCA 3SX2A 4C0LA 5H8WA 2V1UA 4BS9A 1VECA 4DLPA 3ZWOA 3PHLA 1FJHA 2JIZD 4PIPA 1NUPA 4RGBA 1DUVG 4RQTA 5DGHA 3TS1A 4BX2A 5HPYB 1JDBB 5EMNA 4IO1A 1U9JA 2PZAA 4XSHA 3U6KA 4V38A 1X87A 1WCYA 2FGJA 8ADHA 5BN4A 2VF8A 3O1LA 4PFQA 4MRMB 1XJ5A 3AM3A 1CQJB 3OKAA 5J5CA 6ADHA 1E2LA 3WWPA 2BHSA 3H0KA 1EFVA 2DMRA 4Z2AA 3I01M 3LA8A 1LPPA 3UJ7A 4H0CA 1DJMA 3E23A 4TTJA 4ZZ0A 3KQSA 1PTKA 3I42A 3L0DA 1TM7E 3A11A 3C74A 2VUIB 3V8RA 5DPMA 3LPAA 5FOXA 5JZ9A 1J99A 5CBPA 4WN9B 3BJZA 2B3TA 2H0RA 4AMVA 1QDUA 1PL8A 4MP8A 4OX9Y 4N5IX 3DAFA 4S1TA 1ZU4A 1BH6A 1E7YA 3WQHA 2JPDA 1X1SA 3ECSA 3MUNA 4G5QA 3WIUA 1DXQA 4LXQA 2ZXUA 2QHXA 1YFJA 4XB1A 1NJ2A 4MWCA 4YRIA 1V9LA 1BAPA 4NESA 2QJOA 4PNHA 4UDOA 4BAUA 5HF5A 4NULA 4TSRA 3STWA 1M6HA 3ZK8A 1UXOA 3HDYA 1H2AS 4R1MA 4XAQA 5C3UA 4A5OA 3B85A 5MN5A 2O48X 1ISIA 2P4HX 3K3PA 2ZKIA 1XD2B 4DZRA 4TTTS 1PZFA 2ZB8A 4LHZA 4U2FA 3SC3A 4HDNB 5J43A 2C1XA 421PA 1RXVA 2HWYA 2HDNB 3LD9A 5T6BA 2B83A 2VHEA 2NO5A 5EY5B 1T43A 4HLUC 4EI8A 5EJAA 5AI9A 2PS1A 3NT2A 2RGXA 1U7XA 4EFLA 2FZEA 3WHPA 4L85A 2UYYA 4PE5B 3RANA 2ZI5A 2FXIA 2BH9A 2YV2A 4KXQA 5L3ZA 2OCIA 5IP5A 3KR1A 1ZMRA 4P4SB 1TVCA 1XTRA 3MB8A 4GOOD 1B2RA 3ICWA 4Q93A 4UXJA 1PQWA 3QEJA 4ZVOA 1Y48E 4AZTA 3NC0C 1XWFA 1UJ6A 1LBHA 5HWSA 4INZA 1Y6RA 4XFJA 3P2EA 2C3OA 1Z38A 3K2BA 3SK0A 4JR2A 1CZNA 5D1NA 3CCBA 3WSTA 4WKOA 4H31A 1I3OA 5FRDA 3SC2A 1Z6QA 3C98A 5GJVC 1U3CA 1ZJZA 4UUQA 3TM5A 3SYNA 4KXLA 3ZNNA 3IVCA 3FBGA 2ZSEA 2B5WA 3FDXA 5TIIA 1WQ3A 1NVAA 2FWAA 3H17A 3HLYA 4K26A 3VR2D 4LMAA 2VTBA 1J2JA 2OFFA 1IOLA 2RHLA 3NAZA 5FR1A 1JHPA 3MMXA 5T64A 2FKNA 1YI1A 3IURA 3UJ8A 4HWPA 4CCSA 1IZYA 1O95C 3DPUA 4P5EA 3Q87B 3LBNA 1DQZA 1YO6A 3E3NA 2ZBGA 3LPNA 3G0DA 1F5NA 4IIHA 3TR5A 4BO5A 4H3VA 2X8JA 2CYCA 4Q21A 2Z2KA 1DAHA 3CLUC 1HBJA 4QUGA 4DWJA 2O8BA 2A1UA 4HRAA 2ZS7A 4Q02A 5BSRA 1KO4A 5KX5B 1BROA 3B1KA 4DANA 3CUEF 1LK7A 2II6A 3LQFA 3RRYA 3HJCA 1IN8A 1REQB 3K5PA 4TLLB 4P86A 5DGCA 1XBTA 4RA9A 3WLFA 4P34A 2VVTA 4P35A 1X7GA 2CMGA 1C0IA 3HXOA 1OFTA 4U2BA 3IP5A 1M2HA 4JT8A 3DMTC 2R25B 3OI7A 1ONSA 3BXZA 4PLYA 4PAGA 4WCFC 1TJPB 1TNDA 1GO2A 1MENA 2UVDA 4MS4B 1HE1C 4K6GA 2WG2A 3KS9A 2CL7X 3DV0B 1OKKD 1HT2E 3GFFA 2CLLB 1LVGA 2BSQA 4L5AA 4GE0A 1IZ8A 3IVGA 3SX0A 3KX2A 1L4FA 4HDMA 3QPVA 5DGXA 1KMCA 4EQZA 2O8DA 2O0KA 1MH1A 3M8KA 3A6GA 3VUEA 2WM8A 1KC3A 2XNJA 4GVPA 1VMIA 2YWHA 3EWAA 1QUFA 3RVRA 2P62A 2PFKA 4CNBA 1KVSA 2EDAA 2RCNA 4HAVA 5BRNA 2VXOA 5IG2A 2YQ4A 3A8TA 2ATVA 1P3DA 2FXVA 1D4AA 2AMLA 2I4NA 2ZQ5A 2Z1NA 2VP6A 1YRQA 2HLHA 4QPJC 4XQCA 2QMZA 2M9MA 1OR8A 5IVIA 5IAAA 2PLAA 2EFGA 4O0LA 4GQBA 1CZOA 1RXUA 1S9DA 5CR9A 3KIPA 3L8MA 3I2KA 2DAPA 1YTUA 4GPBA 1CS4C 2QQGA 1QR6A 3AVYA 1XD9A 4FOLA 4CG3A 1LV7A 4OHYA 3C43A 1SKAA 3AFGA 3TAHA 1SPXA 4BNNA 2RKOA 5TS2A 3WO1A 4G1VA 3EVDA 2NUTA 1SZDA 3ZJ4A 4JV5B 2WSSA 5FUBA 4O4IA 1CRZA 2CDNA 2I7CA 3U7QB 4BCCA 4PG5A 5KU7A 1GV0A 4AW9A 1TVMA 4MMYB 4AP5A 4QVGA 3KVRA 1JDVA 4Q4JB 5F23A 1GZ7A 2FG6C 1EFTA 2R2AA 5GGYA 1DELA 5JEDA 5CM2Z 3SP1A 2BKAA 3CSUA 3ECAA 1MIHA 2R60A 2RAPA 3NDJA 1KJYA 5GV7A 2WHQA 4L72A 3VX3A 4EPWA 2ZR0A 5HKKA 3EAQA 2DHQA 2EFJA 5FPQA 3WGOA 5EN4A 3EDMA 3QU4A 2OK7A 1GA1A 1KAQA 1AVTA 3MJ4A 1KOLA 3CF4A 1JXMA 2IDKA 3AY6A 1DARA 1RAEA 3NUZA 3W3AA 1QIDA 2YZNA 5FTWA 3NBKA 3D8RA 3QG1A 4ZYTA 3TOZA 3GNTA 1RWOA 1FF9A 1PR9A 3IS3A 3ZJUA 1JKIA 3C1OA 3F8SA 3MIIA 1KP9A 1JHMA 4B75A 5IZ4A 2BFNA 3U61B 1PG2A 5JTTA 2YJZA 1HE2A 1HOTA 4X95A 2OD7A 1UIMA 3TD2A 3L0YA 1THZA 3IBFA 4KGXA 2WMDA 3QZUA 3JVUA 2CLKB 2YIVX 4HF7A 2YHSA 1UPBA 5HTKA 4HCJA 3C24A 3R6WA 1P5RA 1ML4A 3P9YA 2QGFA 4KWTA 4IVPA 5H9VA 4EHNA 3X1MA 3EPPA 3KSDO 3AK4A 1ECGA 3O8BA 5SY4A 1EB8A 4Q05A 4TKVA 2QL6A 3TF5A 3THXB 4J2TA 3K2IA 3IUYA 2KS6A 2UXCB 5AYVA 3G79A 3F6SA 1VIYA 4ZYLA 2O2IA 1XVIA 3PB3A 5MFPA 4QHTA 1ODIA 1RDFA 5D3ZA 1PZXA 3QEOA 1C0LA 2Q5CA 3BM5A 3FSRA 1OWOA 3H3XA 5JANA 1WJGA 4GI7A 2PQ2A 2W11A 3L84A 1GL7A 4B3XA 3T1YB 1F3LA 3GJQA 3HI6A 4G0MA 2CMHA 3GAFA 1ZUHA 5HE8A 4MR8B 1XMPA 2V4MA 4DXAA 2DEUA 1DAFA 1N0WA 3GQVA 3OIWA 4HLCA 4D9KA 3VVMA 4Z54A 5EIBD 4F4DA 5LU8A 5D01A 4NFLA 1CUDA 3SWWA 4ND8B 1CR6A 1Y3FE 2A9FA 4NS4A 4PF1A 4E5UA 1YQGA 2YFQA 1SHZA 1Y7PA 2FJPA 1IPFA 1QSGA 1LSOA 3A6EA 3B53X 4FMCF 2JLCA 2JLQA 4L6CA 3V2UA 5CDHA 5ICEA 4Q9JA 5FBLB 3DONA 3BT7A 3ELUA 4KW7A 1JKJB 3O8CA 4AY2A 4LSWA 2FK7A 3TLGA 3T4UA 3UBMA 4JP2A 3U37A 4P3XA 3AW8A 5CJPA 5U4QA 2GN2A 4D92A 1K6MA 4MJ7A 4AQDA 2DLCX 1MRNA 4MI3A 2H5IA 2I22A 4RK7A 4UNQA 5DNWA 5IKOA 5CVEA 1NBME 3GHHA 2A84A 1KE1A 5KUTA 2OCAA 4NRDA 2WJHA 4YP5A 1N2SA 5L7WA 1A2QA 1XLTA 3P20A 1DZIA 4K2HA 3FCYA 3LFUA 1HDYA 1KJZA 4F2PA 2C03A 2HA3A 2G8LA 5MF6A 3KOYA 1J20A 2X1LA 1MIOB 3N7UA 3NGLA 2BR3A 2DHEA 3NBQA 4OFZA 1JVSA 4A03A 5B12A 4PYQA 3VI4B 3NJ4A 1S2LA 1ZRMA 5DULA 3WK4A 4TLCA 3OEED 4FONA 4POAA 4TT3A 2Q5LA 4L9WA 3FVVA 2VHUA 1Y1QA 4YJ2F 4GD3Q 5GPBA 3G0HA 3K9LA 1SVLA 5K7SA 4HNAB 3HBMA 3KUXA 4GZLA 4OJYA 3IESA 5BOVA 3B6JA 4H27A 3S44A 2Y1EA 5JADA 2HDWA 3OX2A 1KDPA 4JA2A 4MW1A 5IJ9A 1W85A 4FCWA 1V16A 5KYXA 3RABA 1U0OC 4N8SA 4R0MA 3P32A 2QPTA 3W5UA 1YCGA 4COKA 1XQVA 2VSFA 1OPXA 1OX4B 3OT4A 3PUWA 4R41A 4U9HS 4OB7A 2ZSFA 3RVMA 2FPIA 1X7ZA 1RQPA 2UVQA 2YW9A 2VYQA 1JAYA 3GVXA 3MJEA 1ZK3A 1S3GA 1CD5A 2YRFA 3FTDA 4R98A 2FGKA 3AOGA 4XIIA 4NOLA 1ZGJA 2E4AA 4YRGA 1JHZA 5A9TA 4CT5A 1JSRA 4RCZA 2YWRA 3UY4A 3JAMA 3CTMA 1Z0FA 5LA6A 3KHUA 4EG0A 1MPXA 2JL1A 3PE3A 2DECA 2W58A 3JTMA 3BSFA 3BXFA 4EPTA 4YRKA 1YOVB 4LX0A 3PX2A 4CTJA 1C3OA 5DISB 1KY2A 3A6FA 1SR8A 4GXRA 4BAGA 5A5DA 5JLJA 4KQ2A 3PZRA 4N54A 1AHIA 1TADA 4MARA 2OECA 4IM7A 4Q6BA 5EUBA 2IU0A 3TR0A 3WLTA 3GY0A 4YYZA 5H83A 4UTNA 1JNXX 2ZJ2A 4S3MA 4W5TA 4M0CA 2JI7A 4HGRA 1SHUX 1M6NA 3DTVA 3RS2A 1PLLA 1GNLA 2HGSA 2WFAA 4BNFA 5F7JA 1Y3IA 1JE0A 2ODWA 4R16A 2PKYX 1I24A 4P4LA 3CLUD 2NT3A 5AK0A 1K6EA 1FNCA 4A5SA 5F2NA 2I78A 1KC1A 5EP1A 3EXEB 4UVDA 1OVGA 4N39A 1SCDA 3O94A 2RKWA 2P0EA 1TMGE 3QX9A 4U2EA 1PQ4A 3TXXA 1MUUA 3IRUA 1GGMA 3OC0A 3TLCA 1F38A 1N8TA 4IMRA 3LVFO 4B09A 2I4RA 1P0QA 1E3WB 3D4IA 3IBTA 4P4UA 2YHBA 5DBHX 2PKWA 2JFYA 4RFLA 1JN0A 4KXXA 1O9BA 3LBAA 4PC2A 3GQBA 4RIEA 4OFXA 1P5FA 3PHGA 4KMSA 2UU9B 1NVVQ 5JC8A 4ALMA 2P9QA 3K09C 5L9AA 1VL2A 5HRUA 2ENUA 2F1HA 4AKEA 4QBFA 3TGWA 1AV6A 3PUHA 2XDAA 4RHTA 4LDNA 1AQ6A 1CK4A 1M34A 2JJMA 3GRCA 2YCLA 2YFHA 4G6ZA 4ALIA 4IUYA 2WF7A 3ICVA 3MTIA 1DCFA 1USVA 1K5GA 5FA8A 2IGTA 5LUAA 1HE4A 1H2HA 5C4IA 2YYZA 4NFYA 2WC1A 2QYSA 1CWUA 2IFTA 1E6LA 2B98A 2O14A 3LT0A 3TIFA 5EE9A 1W19A 5FNZA 5H02A 4HH4A 1Q15A 2PRZA 5FPKA 4ZHQF 1Z0AA 3ELYA 5FAXA 1GL3A 3PGMA 4KMRA 3U7IA 5A5GA 3CLSD 1LI7A 3UGQA 2Q1UA 5KZMB 3ZWDA 2O1EA 3DZCA 2AZTA 1MOPA 2WZQA 3BWXA 3FRHA 3EA0A 1QANA 3JZMA 4Y6PA 2YJGA 1UMKA 5AMXA 3UZUA 1DGQA 4CMIA 2WT9A 4ITVA 5AJWA 5HW0A 3TJMA 3RG2A 4ERNA 1CDDA 1WDMA 4O08A 4DKXA 3EW9A 1W96A 1YZFA 2EX4A 1P1HA 3PS9A 1B6GA 4GGPA 5H70A 4DM3A 4CKWA 3HM9A 4A82A 2P6UA 1N8SA 4JOCA 1SXPA 3PVCA 4Q9LA 3VYVA 2VH5R 4NPHA 3AUYA 3SKVA 1L5RA 2HT1A 2W2XA 5D5PA 4EFKA 2ZBQA 3I39X 1U8FO 2ON6A 3CFYA 3ZLJA 2RC6A 3AUAA 4DADA 1ZGCA 4RTPA 4DLSA 2G0TA 1Z07A 4CZ2A 3EG9B 1SUBA 3QKIA 3K0CA 1NU6A 1D0SA 3A1TA 4PAMA 4NZMA 4F71A 2XNKA 2V0GA 4K6OA 1T26A 1KAHA 2E7ZA 1LKZA 2HU5A 2DHDA 5ETJA 3F71A 1GPH1 4MKZA 4QUIA 3S0JA 5DNYB 3RIXA 3MILA 4AJ1A 3ND7A 1F2UB 1HR0B 2UXBB 1ZEMA 2JCYA 4UNSA 1Z4QA 4LDZA 3UXEA 4DCGA 1CP2A 2D5CA 1X1AA 3PGLA 4B7AA 3GJ3A 1H6AA 3F5MA 4ZOLB 5IANA 2ZRFA 3DT8A 1FRZA 2ZPTX 3S2FA 1NIPA 1YHNA 2I2CA 4DC1A 4BUZA 2IUYA 3CE6A 4DSUA 2QGNA