1IAQA

C-h-ras p21 protein mutant with thr 35 replaced by ser (t35s) complexed with guanosine-5'-[b,g-imido] triphosphate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
149
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDSYRKQVVIDGETCLLDILDTAGQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Dynamic properties of the Ras switch I region and its importance for binding to effectors.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 149
sequence length 166
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1iaqA00
2P5TB 2Q9CA 5KSYA 3EPKA 2OAP1 2IYXA 4G01B 2QGZA 3E1SA 2YHSA 1N6PA 3PJRA 4PPQA 4ACBA 1UF9A 2VP5A 5HE8A 3VR2A 4GL2A 1WE2A 4OI0A 2MSEB 1CJKC 3PENA 2QMHA 1MABA 3DZ8A 2REBA 2CCGA 1E3MA 5C46F 2IUUA 1OH6A 5JSZB 1VTKA 2BM0A 4ZCMA 4ZDWA 1XCPA 2KBFA 5HCNA 2KJQA 4IVPA 2GJKA 4UXHA 2D62A 4B47A 4YQFA 4HEJA 4Q4JB 3RRYA 1HA3A 1N6KA 2QSZA 3EX7C 1G1MA 4YMSA 5B64A 5BWMA 1T0JB 1RRCA 3FHCB 2Z43A 2IX3A 4CEHB 1RYFA 1FQKA 1TPZA 2ODWA 3CX8A 3BOSA 4IXNA 5DYGA 1KO1A 2RGGA 2QT0A 2VL7A 3GLFA 4HLDA 1SVSA 2J0UA 2ZR7A 2BBOA 4I1VA 3PUXA 3VNUA 2YWFA 4FI3C 1UEJA 1XTJA 2RGNC 4B34A 2IYUA 1Q1ZA 1IN4A 4BFSA 1AS0A 2YNMA 1Z07A 1TMKA 1OXVA 4RD1A 1T3SA 4YDSA 3SYLA 3WNDA 1H8HA 1ELOA 1G3UA 1W0JD 1YZUA 4QBFA 1MO3A 1I4DD 2GCOB 3C7KA 4AK9A 2J5XA 1NNEA 2AD5A 1E0SA 2CL6X 2ZRDA 3JVUA 1XD2A 2PEZA 2ASEA 1P61B 1EG7A 1JQLB 1SVOA 2NO7A 3BFKA 4U00A 1KDTA 3DZDA 1CXZA 1D2NA 4AKHA 1KSHA 3W5JA 3ASZA 3LA6A 4D0NA 2GZDA 3EZ7A 3IHLA 1AIPA 1G16A 1QG2A 4CYMA 1S4QA 3IO3A 4QNRA 1FX0A 3VKGA 3WRXC 2A2ZA 2YWHA 2ZSDA 3KL4A 1FPMA 2VF7A 3ZQJA 2D2EA 3EA5A 4CIDA 4JT2A 1BOFA 1NKSA 2IL1A 5EXPA 4CDGA 4DSNA 4TLDA 3VNVA 2IA5A 3K0FA 2LWIA 1LY1A 5DO9A 3RVBA 2OCAA 2PMDA 4QC2A 3SHFA 5IF9A 4K46A 4NYIR 3E5HA 4V0MA 2XXAB 5CYPA 5HKKD 3FVQA 2GXUA 2RKOA 3CH4B 2HJVA 2FFBA 2FH5B 1MO5A 2UZ3A 1W36C 1E2GA 1TAGA 3RDPA 4F4IA 1U98A 3HWSA 4IDNA 4POAA 4DLUA 3BC1A 5E7MA 1Q3HA 4B73A 3GJ8A 4RFSA 4D6PA 2WMNB 1FUUA 4TT3D 3IQXA 1QHHA 4II7A 2GJSA 1D5CA 1O87A 1ZUNB 2RGXA 3FMFA 4BQSA 3R20A 5FTNA 4LHWA 3JZMA 1NJFA 1IJFA 3G5UA 2GILA 1G64A 3P4XA 4XTCS 2YWEA 4ZDJA 3OEHA 3RSOA 3SFZA 5E7IA 2ZRLA 1MABB 2W2VA 3QE0A 4KLNA 3AUXA 4DWJA 4PHTA 1TQ2A 1HEIA 4LBVA 2WM9B 1N25A 4PX9A 3CWZA 2PT5A 2IYSA 5LPNA 1GITA 1HY3A 1BYIA 4EJSA 5M04A 3KFVA 4OJQA 3QNUA 4BLRA 4QHTA 2WWIA 2VTKA 4JLPA 4D4MA 1JR3E 2NIPA 4PHFA 3FFAA 2QGNA 4EFNA 3TRFA 2ZRNA 1OHHD 3AV0B 1UEIA 1W49A 4WZBE 3TVTA 1Q57A 2OFWA 3GD7A 721PA 2CK3D 2IYZA 3QI2A 1E4YA 1XPOA 5J4YA 3PUZA 2ZPTX 2IW3A 1U90A 3CB4A 3EIEA 1U8YA 3B82A 1G41A 4B48A 1N6HA 5FR2A 2V9PA 1PJRA 4JLAA 2GNOA 3LO5A 1N6IA 1GL7A 4F7WA 1Z08A 3E70C 1E9SA 1E9RA 3T1QA 1SHKA 3EWAA 4A9AA 3T1VA 2BIFA 3KQNA 1TTTA 1VMAA 2ZI3A 3WMFA 4LJ7A 1RC8A 2J3EA 2A7QA 1XD2B 4DB2A 2PL3A 2RGNA 2ZUDA 2DHRA 2ZUCA 4M53A 4IVQA 1XTQA 3LAWA 5FL3A 4MRPA 5L3QA 3ZVLA 2P65A 2JLWA 4OI4A 1R7RA 1OH5A 4IKEA 2R62A 3IQWA 4ILEA 4JLJA 3TE6A 3WMEA 1KO4A 3ZVNA 2A9KA 3BAFA 4KU4A 4QFMA 5FBWB 4LUCA 1TEVA 4BEBA 3RWOA 3QY0A 5DI9A 4MDEA 5H68A 2CVFA 2DR3A 2P6NA 3L8ZA 4Q18A 3C8UA 3P27A 1M7GA 1Z3IX 4OBEA 5DHAA 3TK1A 2JLZA 2A5GA 1NVUQ 4JT4A 1R2QA 4X8LA 5KPDA 2VSFA 2FJUA 3RS3A 2JJ1D 1SVWA 3NBXX 4DC9A 3THYA 3FB4A 3FE2A 1GP2A 3K0FB 4RD2A 4DLTA 1AK2A 1G3RA 2GKSA 1R5OA 1FNNA 4NPHA 1ZUHA 3TNFA 5FPHA 4TN1A 4URUR 1GTVA 3RS0A 1VPLA 2PX3A 4LHZA 1LV7A 2GZAA 5JJIA 2HV8A 2AN9A 2QAGB 1KAOA 4L16A 4XSHA 4EFLA 1W2GA 4RFSB 1ZU4A 4Q7LA 2OAQ1 2XSZA 4P32A 1UFQA 4Y0AA 3TQFA 2JLXA 4D25A 3K1JA 4JLDA 3R9XA 4Q03A 4QJ3A 4BFVA 5AWFC 4PO9A 5CYOA 2FSFA 3LFUA 2BKEA 3CNOA 1SHZA 3LLUA 1X1SA 2YINC 2MSDB 2XZPA 2JJ2A 5B30A 4US2R 4OHWA 1CF4A 3LVQE 3GEEA 1GIAA 3BK7A 4JLNA 4P4SB 1WA5A 4TL9A 1RRGA 4DVGA 2UKDA 2B8WA 1JBKA 2OILA 3K0AA 3MWLA 2HXSA 3VR3A 4EJSB 2O8DB 1ESNA 3AF0A 1S1MA 1T9HA 4M1MA 1FFHA 5SZJA 4F38A 3Q7PA 3HU1A 2YYZA 3NVAA 5KU1A 3KKNA 3MCAA 3QF7A 3LXRA 1W48A 4Q9IA 2R6CA 2OSBA 1E9BA 2WWFA 3AVXA 2GXAA 3VR4A 1G8YA 3CIOA 2YC4C 4UXIA 1P62B 3CF2A 4LJAA 3DHWC 1FZQA 3LV8A 1HT1E 2ZSBA 2QBYA 4IFBA 1CRQA 1TUIA 4ARZB 1YHNA 2ZE7A 3KZ1E 1G3IA 3T34A 2QM7A 3EPJA 2X77A 1ZCBA 3BFXA 3F8TA 3THWA 3KTAB 3P32A 5KSZA 1G4AE 4P0TA 3U3OA 4OQFA 1EXMA 3KDSE 2ORIA 2Z5FA 1UM8A 1GRRA 5DN6D 3R9WA 2ZRAA 4B44A 4Q66C 2QTFA 4KO8A 4GZLA 3EC1A 2IK8A 4MYCA 2DCUA 5DYIA 2ZE6A 4D26A 2IYWA 2IXEA 5L3QB 1IXRC 4HB0A 4V03A 5HTKA 3GLGB 2BKUA 2V1UA 5HPYB 3S1AA 2XOKA 2FDCA 2DWOA 4I99A 4DSOA 4Q1FA 4OK6A 1KI2A 2GXQA 1U0HC 4B6FA 3SQXA 3HPQA 2FPMA 1E0KA 1HE8B 4JLOA 4TMTA 3ZGXA 1COWA 1N0UA 1XTSA 4QJ5A 1V5WA 2WJJA 5IK2A 2Q6TA 2RAPA 3FHOA 4IDOA 3TVDA 1KDOA 3B78A 3VTKA 1VG8A 2X1VA 4CW7A 4LRWA 3KQHA 3M1IA 1BIFA 2B7BA 2JA1A 5TMPA 1J90A 5KDOA 1E94E 3EZFA 3U7HB 3K9NA 2FPKA 2HYDA 2ZS9A 3O47A 5FTJA 4Z8XA 1E2IA 4EPWA 1BYUA 3LD9A 4ZKDA 1J8MF 1UBEA 4XWKA 4QM7A 3HPRA 1KSGA 4US0R 1LF0A 1CRPA 4URYR 5AUQA 1CU1A 4MH0R 2A78A 1MO4A 3D7MA 5HZKA 1KNXA 1G7RA 3DMNA 3AVWA 4KVGA 4YONB 3K9HA 2H8KA 2CNWD 3THXB 1VHLA 4MRRA 2C04A 2ZJBA 3NBFA 2X2EA 3TLXA 5K8IA 4A8JB 3L8YA 1E1QD 2ZSFA 3VU9B 1Q20A 4XH9B 1AZSC 1EWQA 4Q01A 1F2UB 2B92A 4L8GA 2Q9AA 3CX7A 3K0AB 3UWKA 1UJ2A 5JS8A 3ZLJA 2WWXA 2B8TA 3EIHA 4TL8A 5FI0B 1YR9A 1WXQA 2VP4A 4BFZA 3TUIC 1XEXB 2QPAA 1N5JA 2Z83A 2CE2X 4M1OA 5DHFA 2P6RA 1QVAA 2EFGA 4D0GA 2PCJA 2ZI9A 5BYJA 3ZS9A 1BMFD 1M7HA 1E98A 2Y8EA 3RLFA 2H5EA 4TQUS 3ND9A 3B1XA 2WSSA 3MWKA 5FFMA 3Q3JB 4KYUA 3P4YA 3C41J 3IEVA 3KJHA 1IBRA 3WXMA 4PSKA 1RJ9A 4GFDA 4MRNA 1VG0B 5DSZA 3DKVA 1VIYA 3THWB 1S9HA 1KY3A 4UNSA 4JBYA 3BORA 1GKUB 4A6PA 5J4HA 4D2IA 2NPFA 3K09C 3M4YA 4ZKEA 4H1UA 1U0LA 3T5GA 1GUAA 1E2FA 1C9KA 1JR3A 3Q85A 4DLYA 2IEYA 3THOA 3ZVMA 1SVLA 1CJTC 3GFTA 3AVQA 3I72A 4R2HA 4WBSA 4LBZA 4C0HA 1DOAA 3SU8A 1P2SA 4Q9JA 1O3YA 3KJIA 2Q3HA 3F0TA 2WMOB 4NU0A 5EE3A 4DCSA 1VCIA 1YRAA 5AJZA 5LBIA 2RHMA 2OFXA 3ADDA 4PQFA 3MFYA 4O25A 2WTUA 5EQTA 4BLSA 1YR7A 3B13B 2BHRA 3MSXA 5KDLA 1SXJD 3GPLA 1KJYA 3H2YA 1SKQA 2VHJA 2ZSAA 1G17A 3L43A 3CPJB 3TAUA 1G8HA 1T8TA 4IOLA 2DPXA 1ZJ6A 3B9PA 3CBQA 3DM5A 2ANCA 4JYBA 4LY6A 4Q1EA 1NSFA 3KUDA 4I1UA 2R6GA 2GJ8A 2Q3MA 5EXSA 3B7GA 2E87A 2C5LA 1QBKC 4C30A 2DYKA 1Z6GA 2OUKA 1R0ZA 1TL7C 3NBYC 2IEZA 3FKSA 5CIWA 3FPAA 5J5CA 4C2UA 2OO7A 2JLRA 3SJBA 1XMSA 3W6NA 2W00A 4JIMA 3UIEA 2L0XA 3LVRE 3GCGA 2ERXA 4N3NA 4AG6A 2FX3A 4A0HA 2VA8A 2J1LA 4ERNA 5JBQA 4WZ6A 2QORA 3O8RA 2H18A 3DOEA 4LV5B 5H1YA 1YZQA 5CK4A 5CK5A 2KI5A 3GJ0A 4FCTA 1KGDA 2HCBA 2Z6VA 1R0YA 3ZYCA 3FKQA 1NMXA 1ZNXA 2GCNA 4LC0A 1XTRA 1ZW6A 5FBRB 2VSOA 5EE9A 1T0HB 3OIVA 3QEJA 2PLRA 2FFAA 3UATA 1IN6A 3K9GA 3OFNA 1QVRA 4XD7D 2GETA 5FUVA 2V54A 4NYJQ 3TAHA 1G8PA 1T6NA 2ZRPA 1W4RA 3QKSA 3F5FA 5SZKB 4LHXA 1U81A 3DKPA 4D4KA 4PTLA 1SVIA 2D2FA 2F3RA 3DO6A 4LBWA 5JI2E 2XTMA 3QXJA 1N0VC 4ESVA 5TDHA 1EK0A 2VF8A 3ONWA 1R4AA 4M1YA 4G1UC 3WNCA 3K70D 3K0CC 2VP9A 3VR6A 1DAGA 5KO2A 2NO9A 2H7VA 2PJZA 5GJBA 1KO8A 4UKDA 3SE0A 3TSWA 1UKZA 2QT1A 2EFCB 4B35A 3KQKA 4ZI2A 1EFRD 4V0NA 1VIAA 3VQTA 4FN5A 1W44A 1X6VA 3TBKA 1RJ9B 1W0KA 2J7PD 3T5DA 4RCYA 1YRBA 1VYTA 2CMKA 4Q7MB 4ASUD 1CR1A 2VO1A 2W6JD 2F6RA 4PPNA 1LVGA 4PAQA 4DRZA 2VYFA 1LFDB 4IRUB 4NYIQ 5P21A 3T1TA 3FFBA 3SJCA 2Q0HA 3WHKA 3U4QB 1RPZA 2C9OA 4LSGA 1F5NA 4ZCLA 1IM2A 2QQ0A 3VAAA 2WWWA 1QHGA 2XEXA 3U6KA 3SOPA 2W2TA 1G4UR 4TSFA 1DAEA 4MRVA 5IHPA 1ZM7A 2C03A 1G8FA 1XJQA 5CIQA 5DISB 1HV8A 1E1RA 4Q9LA 3GLHB 3KKOA 3MGCA 1RIFA 2J45A 2FSGA 2VP2A 3OIYA 3SEAA 4DT1A 1XPUA 1S9DA 1ZC4A 1DG1G 3PV0A 2IS4A 2XNDD 4IXMA 1E2NA 4JS0A 3LW7A 4TL6A 3WYFA 3RC8A 1L8QA 1KJZA 4H1VA 4AYWA 2J87A 2WAYA 3KQLA 1E9EA 1E99A 2IHYA 3AF1A 3ICQB 2GEUA 4DLXA 3ETLA 4WW0A 2Z0MA 5AUPB 1Q21A 3IEUA 2NG1A 4JLBA 2OCYC 2WVJA 3Q5DA 2IS2A 3LQQA 4HAUA 1YZKA 4GOKA 4GP7A 4Q48A 2QMUA 3TIFA 2R8RA 2V7QD 3OZXA 2J0VA 1T91A 4DEXA 2J41A 5E7JA 3OAAD 4D4LA 1V43A 2FOLA 3M6AA 3TW4A 2ZJ5A 4QRHA 2QP4A 3WBKA 4PSVA 3TH5A 1S8FA 1N5LA 2UVQA 4TMKA 2WJIA 2GZHA 4Q1CA 1GAJA 2ZJOA 2AFIE 2ZJYA 1E4VA 2KWIA 4FCVA 4Q02A 1W5SA 3PITA 4A2QA 5BQ5A 4Z1MD 1YQTA 1XEWY 2RGDA 2HF9A 1WDTA 3BBPA 4XIGS 1AGPA 5G3ZA 3FWYA 2C96A 4U7DA 1E9FA 4IOMA 3T1OA 4TQ9A 4A0GA 4A15A 3I8XA 2DWPA 3RS4A 3QPVA 3A1WA 3A4LA 4Q1BA 3QKSB 4ON9A 1HQYE 1YU9A 3AP3A 2F43A 2HLDD 4Q9HA 1U8AA 2GWHA 3KUCA 4V0OA 2NPIA 1W4BA 3WRYC 2VPPA 3I62A 2GAAA 2NO1A 2D7CA 1XD8A 4O2LA 3GP8A 1IN5A 3D8BA 1R0XA 1NVWQ 2YKGA 4BASA 1CJVC 2O8BB 3LXXA 4Q5IA 2RH5A 2ANBA 4RD6A 5CITA 2VIIA 1GNPA 1DBSA 1GG2A 3A6PC 1KNQA 4FD2A 2NZJA 2D74A 2G1KA 1AJEA 1Z22A 5A4JA 1NG1A 4OHXA 1Z8FA 1XMVA 1NF3A 2JDID 1TEXA 2P6UA 3MUFA 2AD1A 4GRAA 5TB5A 4R71A 5JEDA 3ZD6A 4LGMA 1E6CA 3A1TA 4Q4LA 4DDVA 3NH9A 1D9ZA 1TX4B 3B85A 3K0CA 2XTNA 1CR2A 4GSYA 1KY2A 1R5NA 2C98A 2XITA 5KNBA 4Q21A 1Y63A 2V4ZA 3AH8A 5ANRB 1OFTA 5F9FA 2QZ4A 1UAAA 1W0JA 2ZI5A 4KAXA 2D3WA 5FTLA 2Z4RA 3TUJC 1FL9A 1VECA 2E1RA 4PZLA 3ZD7A 3R7WB 1KI1A 4JMPA 3NTUA 1FQJA 2XZLA 1ZNWA 1BH2A 1KZGB 1LTQA 2JASA 2YZ2A 4JL5A 3LQRA 1KI4A 4WOPA 5AUNB 4ZIRA 1N6LA 1F48A 2EFDB 2OXCA 4TYQA 5K8TA 5FOWA 1XEFA 2QTVB 2B21A 3EARA 4JBWA 1D8TA 4JZKA 4UNRA 5LD2B 1WBBA 1K8RA 4NP6A 1D6JA 2QMOA 5FOXA 2GK6A 4DCTA 2HYIC 1N3BA 4X8MA 4RZ3A 2R2AA 1WF3A 3AVTA 1NKTA 1OXTA 1XJCA 1ZNZA 4HSEA 2LKDA 3N70A 5JZVA 2WICA 3QEOA 1JR6A 1KMHB 5FOUA 2F1IA 2C99A 1XX6A 3TMKA 1JEDA 2OLJA 4PHHA 2KSQA 4UJ5A 3U2QA 2DB3A 1Q1EA 2WPDD 2VHCA 4BEJA 2BMEA 1OB2A 4PANA 3A8TA 4DLVA 1IHUA 5G41A 1XWIA 4NL4H 5GADl 1KDRA 1XXHE 3IDQA 4I1OA 1HH4A 2CLSA 4TLBA 2F9MA 4KFTA 1EX6A 1I2MA 1UBGA 3B9QA 3DDCA 1Z6TA 3PEUA 4TT3A 2V3CC 3D31A 3FHTA 1S3GA 2FEMA 2GBLC 4QBIA 3R9IA 1D2EA 4JSTA 4DLZA 1QZXA 2JLQA 2ZYTX 3BH6A 5C2JB 2NGRA 4RD4A 5E3HA 3NG1A 2V55B 3SN6A 4JLVA 4CEJA 1CR0A 4AC9A 2ZR0A 2QE7D 5FR1A 1F60A 1KI6A 3MRSA 3VFDA 3LW8A 4AKIA 3AQ4A 4PQYA 3O8CA 1MKYA 3EASA 5UKDA 3QF4A 5BXQC 1TU4A 3H86A 4BFTA 1KO5A 2GEDA 3GLIE 1HT2E 2GAOA 4XTRA 4OI2A 3UKDA 3V9PA 2QI9C 3U7GA 1OKKD 3GQBA 3R8FA 2GJ9A 1ONBA 2WIAA 4FINA 1AA9A 3CR7A 3SHWA 2RGCA 3O8DA 3Q5EA 3I61A 4GI7A 1BS1A 4HB2A 2IWRA 3SFVA 1OHHA 3QBTA 3UMSA 4C7OA 4GMXA 4OHVA 4KSBA 2WWYA 4JVSB 4PZZA 4C0BA 2CK3A 4LI0A 3L0PA 2ORWA 2ZS8A 4V0LA 3LBHA 3GLFB 2J0UB 2ZE8A 4YLGA 4M8NE 1RE0A 4DDTA 4BZPA 2OBMA 3IKJA 4BECA 3MMPA 1G20E 1SXJE 1G19A 3VHLB 4EFMA 5KYKA 2G6BA 4O2RA 2ZVPX 5D3QA 1HYQA 4B6EA 3PUWA 2QENA 4NH0A 5L8VA 1NBMD 4B3FX 2W0MA 1KAGA 3T06B 1CP2A 1E96A 5B57C 4JLMA 1Z63A 2IS1A 4L4UA 4U5XA 2W6ID 3TR5A 2GRJA 1OV4A 4PZYA 5JFGA 2F7SA 2F1JA 3MWJA 1A82A 1ZM4A 2HUPA 1ZINA 1QG4A 4RD3A 2JIZD 3QXCA 4R2IA 1LS6A 3ZIAA 4G0NA 4KFRA 2BVNA 2AK3A 2ZJ8A 4ZIRB 4EPXA 2IF2A 1W4AA 3VHXA 2NOAA 2QPOA 3EWSA 1FW6A 1RW4A 2JJ8A 3U7FB 1D9XA 4NDZA 1CLUA 2A30A 2ZRJA 5L3VA 1FX0B 4GOJA 1Z2AA 2BBWA 2ZETA 3OE7D 3W6PA 3A1UA 4YMTA 3WHLA 5JJKA 2PX0A 2JJ1A 1WQ1R 2XB2A 4PC1A 4AKGA 4Q7JB 4A1FA 2FF7A 1YVDA 4NBSA 4UNQA 2ZAOA 4B76A 1OLOA 1Z6XA 1Z83A 2ZAMA 3CNNA 3QKRA 1OIXA 4HB3A 1KDPA 3JVVA 1W4CA 1P6XA 1UBCA 3HYTA 4LV6A 5AJVB 3IILA 2ZSEA 1PLKA 3AF3A 4IOJA 1NVXQ 2GVZC 2ZRFA 2IHBA 4MKFA 4Q4HA 3VR5A 4C9BA 4AY2A 4DEYA 2DFNA 1IN8A 1MV5A 2AWOA 5AUOB 3ICEA 2VP6A 2ZU0C 2F3TA 1Z5ZA 3VKWA 2W2XA 3PXGA 4DCVA 1G5TA 1QHHB 1G6HA 5CJ2A 5F3WB 1NI3A 4PC6A 2HDNB 2CEAA 1QHYA 1NN1A 4WAUA 4TYNA 4MUAA 4S2EA 4CRWB 3TSOA 2PH1A 4CEIA 2MSCB 2QP3A 2NMVA 1EWRA 3G82C 4R9UC 4CEJB 3TSZA 4BFWA 2IS6A 1Z0JA 2REXB 1QHIA 1NP6A 2VEDA 4L15A 4XVUA 5G3YA 1KK1A 2XB4A 4C0KA 3U3RA 1Z2CA 2GBLA 4MKGA 8OHMA 3GJXC 2G0TA 1AS2A 4XJXA 1P75A 3K53A 1DEKA 1HE1C 4K81B 1MR3F 1OSNA 3QBVA 4NCJA 4EQ6A 5TVKA 5F9HA 3B1WA 3GMTA 2JLVA 2TMKA 2WIBA 3CZQA 3F3YA 4LPSA 3U60B 1AS3A 1FOEB 2B6HA 2QPTA 3CF0A 3BH7A 1OIWA 4KITB 3Q8XB 1GKIA 1DADA 3NBZC 2WKPA 2FZLA 3RS2A 1FP7A 2CL7X 4MQBA 1KK2A 4DLSA 4MDFA 4MGIR 2BV3A 2CCJA 1R5BA 4HAVA 3SQWA 1Z06A 3W6OA 3AP1A 3OESA 1GRNA 1E2HA 3PG5A 3SBDA 3VKHA 3LX5A 4DB4A 4HZUA 4O0MA 2QTHA 5DE3A 1UKEA 2REOA 4KCGA 3ECCA 4OYHA 1ZD8A 3QG1A 2IUSA 3H0KA 4YDHB 2IBMA 5DN6A 1DO0A 4UQOA 3FTQA 4HLQB 4G5RA 1EX7A 3RHFA 3LY5A 4RD0A 2X8AA 5EXXA 2ZQ5A 1SXJC 3K9LA 3GFPA 4URXR 1NN3A 3GEIA 2BJWA 4IEEA 1IXSB 4PAMA 1IJEA 4QBHA 2D7DA 3UG6A 1ZM2A 1KI7A 4LHVA 2BBTA 3P20A 1CTQA 3N2EA 1NRJB 1XF9A 4JYCA 2X19A 2J0SA 4L5BA 3AVYA 2CHQA 5BW8A 4WVFA 1NIPA 4JLKA 3BIFA 4EKDA 4E5UA 2FFQA 5FL7D 2BMDA 5DLQC 1ESMA 1VCOA 3CKLA 1CEEA 3THYB 4QGAA 2A3RA 3I4LA 4HLCA 4NONA 3OIUA 4TWZA 1GFIA 1R8SA 2Q21A 5BN3A 1YZTA 3QKRB 3AKYA 2IXGA 1Q44A 3QXXA 4RFVA 3B5JA 4M9ZA 3EXAA 5HR5A 1WMSA 2YOFA 3UWOA 3HYRA 4FW9A 3E2IA 4LC1A 3VX4A 3KB1A 3OHMA 5TXGA 1TF2A 3RS5A 3NWJA 3X1XA 4WA7A 3CLVA 5FOTA 3WP0A 4D81A 5HE9A 1AKYA 4NYMR 2ZREA 1LNZA 2YVUA 4FWTA 3NC1C 2JLYA 3OEEA 1ZAKA 1Z29A 2RGEA 1X86B 5CDFE 5IK2D 4IDPA 2C8VA 2JGNA 5CLLA 2NO0A 2GDJA 3GEHA 3TJZA 3X1DA 4F93B 3AKCA 2BDTA 3SI7A 2WWHA 2G1JA 2ZI6A 2F9LA 1M34E 2ZYWX 4CEIB 1W36B 1VYVA 3B1VA 1PLJA 1UKYA 4XVQA 3T35A 2F1HA 4AYXA 1E1QA 1G3MA 4JBXA 4LBYA 5D3MA 1ZIPA 4E03A 3D3QA 4U02A 4HATA 1ZC3A 3K70C 2NZ8A 2FEOA 4M1KA 4KV9A 2IYLD 4KODA 5CB6A 1E0AA 1KI3A 4EQ6B 1VCNA 1XXHA 5FTKA 2O8CA 3DPUA 4TZ6A 1DAFA 4HZIA 2O8FA 2VSXA 2ODNA 4PXAA 2J9RA 4BFXA 3A1SA 2DWQA 2XJ4A 3JZAA 1BMFA 3W3ZB 1OH8A 2YV5A 2PBRA 1SKYE 1JB1A 4LYJA 1AGRA 4DIDA 1ZM9A 2R44A 1G9XA 1A1VA 1U99A 4KJZA 3CRMA 3A58B 2F55A 2QBYB 1E79D 4HAXA 2JEOA 1US8A 4C2TA 5L3RA 4RKFA 2ERYA 4AI6A 4B3GA 4TMXA 4HZUB 1M6NA 3V00A 4W5HA 2CHGA 2O0JA 1J2JA 2P67A 3QUSA 4PAOA 2ZRKA 3P1JA 3T15A 3KFXA 4KVAA 3GLIA 3O8BA 4F4CA 1HQCA 3AF2A 3L0SA 3W8NA 1Z0IA 1FNMA 4QKQA 3PUYA 1AN0A 4HAZA 4R98A 5JS7A 4QHYA 4OI1A 2OCBA 3KX2A 1RZ3A 4URWR 4YMUA 1X3SA 2RMKA 3CF6R 3S1AB 5EZ5A 4BLTA 3PUVA 4W5WA 4K8OA 4TYPA 4EPTA 1R6BX 1XCMA 4B74A 4B3DA 1OJLA 3ZVRA 1SXJA 1X8JA 1N5KA 5EP3A 5JRZA 4OQLA 4YXWD 3CM0A 1VDZA 4HAWA 5JLJA 3W3AA 4LWZA 4TMVA 3BFVA 2ZJ2A 4BUJA 4CVNA 2P2LA 4GPTA 1JXOA 2WJVA 3KKMA 2I1QA 1G6OA 3Q7QA 3SYKA 3HJNA 5HZHA 1Z6AA 1OFIA 4AURA 1XZQA 4A0RA 3EPLA 1E9CA 2WJHA 2OE2A 1XU4A 4OL0A 1JNYA 1NY6A 1DG3A 4N1AA 121PA 3MLEA 2RGAA 3AB3A 2ZITA 5FPTA 1OXUA 5KDDA 2WKRA 5TV2A 3N2IA 3TKLA 3PEYA 2QAJA 5FI1B 3RNLA 1L4YA 4PHGA 2OEPA 4EIWA 3CH5A 1PUJA 4HB4A 2BWJA 3UMRA 1X1RA 5FPYA 1EFTA 4M4SA 5EUMA 1E2EA 1GILA 1Q1QA 1WBDA 3AVUA 4NCIA 3HP1A 4JL6A 2QROA 1RKBA 3CPEA 3FKSD 2O0HA 3REGA 2HXYA 1XTIA 3KKQA 4XD7A 2ONJA 4GP6A 2BMFA 1G21E 3QSYA 1U0JA 2O8CB 3BRWD 1W47A 4FMBB 1E32A 1EGAA 2O8FB 4UNNA 1NBME 2ZI7A 4JKYA 2BEKA 3KKPA 5CM9C 1GZSA 1KKLA 1P2TA 5KTYA 2O8EA 5H8WA 1KTVA 5KUTA 2ZJZA 1J70A 2OESA 1FP6A 4IJMA 5FBQB 5JWOA 1DELA 1Q1BA 2XTZA 3CR8A 3PFIA 4ZDIA 2O52A 3B6EA 1NY5A 3MJRA 4ACAA 1EFRA 2AXPA 2BMJA 4L9WA 1P73A 2E9SA 3I5XA 2J7PA 1TF7A 3OFND 1XPRA 5L3SA 1XBTA 2WJYA 3H84A 1QHXA 4ASUA 3PVSA 2W6JA 2ZM5A 2CL0X 2FA9A 3SDZA 1ZIOA 1A7JA 2BM1A 2PMKA 5JSZA 4XSGA 2EWWA 2HT1A 5EUQB 3LWNA 2J7KA 4IFEA 1OXXK 3GLIB 4NCKA 4FIDA 1ETUA 2BCGY 2Q3FA 4P33A 5SZIA 4BFYA 4DSTA 4Q47A 4Q4JA 3EC2A 2YOHA 5B2ZA 1MO6A 2GTPA 2PT7A 5JWRA 3HDTA 2AKYA 2QA5A 1UPTA 4G5GA 2OBNA 4HUQA 4EAQA 3NKVA 5GVRA 4CEHA 4G3XA 1CS4C 1YKSA 2WHXA 4DLRA 1TQ4A 1W0KD 3I32A 3NHAA 2JATA 2ZROA 3K09A 2XNDA 2ZS7A 2W0SA 5FPSA 2VHTA 4RJLA 3LBIA 4GBMA 1G5RA 3CZPA 1JECA 3KJEA 3IIMA 3V4FA 1T3LA 2BJVA 3RRNA 4B75A 1VHTA 4M21A 3K0EA 4TSFD 1HURA 3QG5A 4PC3A 4EDHA 1H8ED 3LNCA 3X1ZA 2QUZA 2YC2C 4EUNA 4TYWA 4BRUA 1N0WA 2V7QA 2R9VA 3CRRA 4UXJA 4TLAA 4CF7A 2DY1A 5SZHB 2DBYA 5C18A 2RHDA 3M0EA 4N0DA 4B33A 4PPFA 3W90A 1Y3AA 3LX8A 4PQRA 4URZR 4Q9KA 4NTZA 4DUGD 1JPJA 4HDCA 2A5DA 1U2RA 4QGGA 1VG1A 2IYVA 4QG7A 3DVLA 3W9YA 3BXZA 4MYUA 1W1WA 2ZJAA 2QMEA 5LB2A 4IOKA 4M9SA 4Z1MA 4C0SA 1YZGA 1OE0A 2QAGC 3NEJA 3QXHA 5FBLB 5DI3A 3CONA 1EFHA 4TTRA 4ZO4A 1X8LA 1JI0A 2ZTSA 1ZRHA 1VG9B 2H1LA 3CW2A 4BPBA 2OM2A 1TU3A 4NKRA 1CIPA 1G8GA 3TUZC 2XXAA 1NJGA 4HYYA 2HLDA 4M0LA 4B43A 4YMVA 1NG9A 5J4VA 1ZD9A 4BRWA 3EZ2A 4BLPA 2OV2A 5CJPA 4D0LB 1FMJA 3QVVA 1OPXA 3K70B 2O8EB 1YR8A 4F4JA 5CDFA 4A92A 3J81k 3L82B 2VP0A 3L2OB 2NO6A 1G7CA 4EJSC 4GZMA 3IUYA 2ZE5A 2W58A 4AYTA 5F98A 5EZ6B 3SBEA 1SQ5A 5CLQA 4RZUA 2JDIA 1S2MA 3UMFA 2XAUA 5L3SB 3PQCA 2CBZA 4DDWA 3K0SA 4UNPA 3WYGA 4X8HA 3C5HA 3I73A 5JWHA 4KXFB 2A5FA 2I4IA 4JVMA 1I2DA 5IT5A 3SYNA 1EFCA 1GL6A 1LF5A 1NN0A 4C0AC 3ADBA 4KBFA 2V6JA 1FMLA 5C1BA 2A5JA 1AQYA 4F91B 4V0KA 1MRSA 4M9XA 2H57A 4LDJA 4FMCF 3SZRA 3UXMA 3WP1B 3AUYA 1M74A 3QXSA 2P3SA 4HUQB 2PLFA 4DXAA 1T3HA 2QY9A 4TL7A 3RS7A 2CDNA 4AG5A 3QKTA 4IHQA 4JL8A 4NCNA 3RABA 4A2WA 2ZRIA 4DT1B 4KYIB 4BGDA 5J47A 1OF1A 2ATXA 1WP9A 1EFUA 5AJXA 5FUYA 4D80A 2V6IA 1YZLA 4MA4A 4HDOB 1VKJA 2EYUA 3FMOB 3IPXA 2C77A 3VMFA 1XB2A 3EIQA 2R65A 3EZ9A 1MRNA 2ATVA 1L4UA 5B58C 1A2BA 3TW8B 1E2DA 1NLZA 3T61A 4M9QA 4BLQA 1B0UA 3CRW1 4WZAE 1H8HD 2ZRHA 1UBFA 4ABYA 4LJ9A 1DTSA 4QHSA 2OBLA 4NYJR 4OJKA 5CM8B 4DHEA 3LLMA 1XZPA 4MITA 2C78A 2GCPA 2IT1A 2WPDA 2GESA 5A0FA 1OH7A 4CGZA 2J0QA 4OQXA 2ECKA 2V8OA 4KSCA 4WXPA 5HKKA 1P60A 4M1SA 3W5IA 4NHOA 1K5DA 5E95A 1TQ6A 1U8ZA 1ZD1A 5BYKA 3GJ7A 4ZPXA 2VLIA 4D82A 5JRJA 2QSYA 4G5QA 1KI8A 4QBGB 3DL0A 4AD8A 1CBUA 1XRJA 1P3JA 4PSAA 1W7AA 3B8HA 2HJGA 3ZZ0A 3BE4A 3BERA 2G9NA 2BBSA 2OFOA 1Q0UA 2PZEA 3DMDA 5DI3B 3NH6A 5EP2A 4ESHA 5JI3E 1WCV1 2G3YA 4Q4AA 1E2KA 2HT6A 3BS4A 4YC7A 2QE7A 5JCZA 1F3OA 1II0A 3KB2A 3PIRA 2ZRBA 3VR1A 2A5YB 2FWRA 421PA 1PLLA 2F43B 3GJ6A 3LBNA 5J4LA 4QM6A 1XP8A 2QAGA 4XWOA 3VX3A 2OXRA 1JAHA 1Z47A 4RVCA 4A8JC 2FGJA 2IYTA 1XMIA 4LPKA 1JEEA 1OKKA 2C9CA 3SNHA 1CR4A 1M2OB 1P5ZB 3P26A 5LB4A 3KQUA 1RRPA 4AKEA 2ZU6A 2WJGA 2PCLA 1QRAA 4NZYA 2PJRA 1DAIA 3FOZA 1FUKA 1ZU5A 4ITRC 3OEHD 3ASYA 1M7BA 3EA0A 1XD9A 2BC9A 3C4JA 2D06A 4IDQA 1WRBA 2XNSA 5C4GB 4P4SA 2Z4SA 1R8QA 2I3BA 3Q9LA 1OYYA 2DFKB 4BLOA 1E2QA 3B1YA 4DZZA 2O8DA 3B1ZA 4BZXA 1N6RA 2G88A 1QHNA 1T8UA 2BOVA 4G5OA 2JCSA 3TR0A 1W2HA 1ODFA 1NBMA 3X1WA 4BZQA 1YJ5A 3I3SR 5DGXA 1S1CA 1UDWA 1K6MA 4NYMQ 5BN5A 1QF9A 3ZH9B 3IIJA 1CJMA 2W6IA 3A4NA 4OQNA 1SKYB 2AR7A 4MRSA 4V02A 3GLHE 4GT1A 1OB5A 4TLCA 5EJEA 2NQ2C 5EE5B 2VH5R 1DAHA 4EPVA 1A5TA 1XEWX 4Y0VA 2JIZA 4C0LA 3MG9A 1RRFA 3U3KA 2WZQA 4PC7A 1KK3A 2PZFA 4ARZA 2J59A 5G40A 1NVVR 1KIMA 1ANKA 2QL6A 5KOYA 5JJLA 1WB9A 3BH0A 1E2PA 2XGJA 3KTAA 5BN4A 1GSIA 4PO1A 3R8CA 3G0HA 1OT3A 1AM4D 1XNJA 3OE7A 4XWAA 4OHZA 2ZANA 1AKEA 4F92B 3QPWA 2FSHA 3ADCA 3CRVA 5FUWA 5GVSA 2PZGA 4PR0A 3U44A 3GFOA 3IBYA 1KSFX 2ZVQX 3ZS8A 1II8A 1GL9B 4LK2A 1N6OA 5KHOC 221PA 3GLGA 2OHFA 2P5SA 1IQPA 4IEIA 1TADA 3ZIAD 2H16A 2R6FA 4LYHA 4D4JA 3V4RA 3PEWA 4DCUA 2R6DA 5FOVA 3NXSA 1DO2A 1XFAA 1RFLA 1XTKA 3Q72A 1XJ0A 3IO5A 1XMJA 4PFSA 3L0OA 1C4OA 2FG5A 1MT0A 1N6NA 1DARA 1KZ7B 2WKQA 2WAXA 4BE7B 5DNYB 3KXLA 1R10A 4ZV4A 1EESA 3NDPA 2B7CA 5EE1A 4MYTA 2IXFA 4DIEA 1ZMXA 2Q9BA 2GF9A 1M1YE 1VCMA 2KB0A 1UDXA 3AVOA 1P4SA 4Q4AB 2CVHA 4GDFA 2CCKA 2GF0A 2FE4A 2ZXUA 1HUQA 1OYWA 3GJ5A 2XZOA 4LV8B 1E69A 4B32A 1KI6B 1E2LA 3QENA 3RRZA 4LJ4A 1GWNA 4Q19A 3BGWA 3DOFA 4C0JA 2ODBA 3QF4B 5ELXA 3DEFA 3I8SA 2BCJQ 1N2CE 2IYQA 4XOIA 1GNQA 4MKHA 1R0WA 4B3CA 4TYYA 3U3MA 2XSZD 3W8RA 2ZYVX 4FCWA 1G291 4LHYA 5EP1A 5FH9A 5E4FA 2I1VB 2WWGA 4ZI3A 3UK6A 3THXA 1ZBDA 2GA8A 4MGZR 3BJIC 4MUBA 4C7OB 4AIIA 1W36D 1J8YF 1NIJA 4A8JA 3VU9A 4PO8A 4HAYA 2JJ2D 1JPNA 1DPFA 1UADA 2OZEA 1TQDA 2JAQA 1F2UA 1ZVQA 1SVKA 3IBGA 1KO7A 1LW7A 3K8YA 2AWNA 4J0QA 3IPYA 2ZRCA 3U3JA 2EFEB 2QNRA 5KSOA 4JVNA 5FUXA 3AKEA 2H17A 2X2FA 1MOZA 1XEXA 2FFHA 2CLCX 1SZPA 3BB3A 3KXIA 2ZIAA 5IDVA 2ZEJA 4RZ2A 2HCJB 4B2IA 1G7SA 1CULC 2GEVA 3AGPA 4I4LA 4TMWA 4E09A 3AVVA 3ND8A 5CB8A 2G0NA 3LRPA 1RYHA 5AR1A 3UPUA 1KJWA 3IIKA 4HLUC 2AHOA 3DM9B 4KBGA 5J4KA 2G83A 1NMZA 2R6AA 1NSTA 4A6XA 1IY2A 4DLWA 4TTPA 2CJWA 2ONKA 4US1R 3CUEF 5TY0A 4JSYA 1ZYUA 2FMXA 4A82A 3NC0C 2RCNA 2F1RA 4DKXA 5FL7A 3FYHA 3ZDQA 3GJ3A 1PV4A 1S0UA 4X8OA 3U44B 2N46A 2IC5A 3PR1A 1Z0AA 4HI0E 3EAQA 3SJAA 4LOAA 4FMDB 5KPJA 3AP2A 1II8B 2EWVA 4Q1AA 2CHVA 1E2JA 2QN6A 2K5UA 2VRWA 2JLUA 1T5LA 5IRCD 1J99A 1P9WA 3NHBA 1PVOA 3MJHA 1A4RA 1CKEA 4ZCIA 2XOKD 6Q21A 2AKAB 2ZR9A 1GM5A 1OFHA 2BEJA 1C1YA 1P9RA 2WBLC 4JJZA 2ZYUX 3EZ6A 2CE7A 4P4TA 4Q4HB 4YMWA 3EPHA 4LYAA 1A2KC 5EE0A 3A37A 1COWD 2QG6A 1GOTA 3QJYA 821PA 5H70A 1Z28A 2ZUBA 2AXNA 1ZM3A 2EVWX 3A1VA 4RY2A 2CNWA 4A2PA 1P2UA 2N1BA 1W46A 5FOSA 4B2LA 3BWDD 1OW3B 2HEIA 4ZDKA 2GJAA 1Q3TA 5A5GA 2EU8A 4LJ5A 4DBLC 5AJYA 2IF0A 1UKVY 1IONA 2FN4A 3ZQ6A 1KYIA 3AKDA 2CLDX 2AFHE 4EPYA 2EFHB 3IHWA 1K5GA 2AK2A 4B2PA 1ZUIA 2YWGA 3N5CA 2EYQA 3CNLA 3OEED 4JJKA 4Q00A 4DJTA 2XX3A 5F2EA 4LCBA 4B3XA 2SHKA 521PA 1Q12A 2QRNA 2FPLA 4QGHA 3RRMA 4DCNA 3U61B 1XCGB 4KHZA 1I4TD 1NN5A 1TNDA 1G18A 3ZJYA 1S96A 5AJWA 1U9IC 2WSMA 3D6TB 5KNCA 3GLFE 1SVMA 1E79A 2JLSA 4QJ4A 1S3SA 2FZ4A 4LJ8A 4MKIA 1H65A 3AM1A 4M2LA 2N42A 4QL3A 2IUTA 2FU5C 4GMDA 4OKSA 1TF5A 3TGPA 3A4MA 3SJZA 4Z51A 2ODEA 3A36A 1B23P 1GRQA 1JALA 1F2TA 5FTMA 4O3MA 3WBJA 3OF5A 4CT4B 3UANA 1DAMA 1IOZA 1DS6A 3HU3A 1TUEA 5G53C 4A4DA 2WV9A 3H4MA 3ZZUA 4KI0A 5JHGB 4M1WA 1JJVA 4W9MC 3WY9A 4OK3A 1F6BA 2WSSD 5FPKA 1AZTA 3HR8A 1KKMA 4WIAA 4C4PA 1JXMA 4P31A 2C2HA 2CJWB 4Z8YA 3MAAC 1JJ7A 4LJYA 1BKDR 1P2VA 4DDUA 3X2SA 4LZZA 5JHHB 1FTSA 4YXWA 4B3BA 4FXPA 3U4QA 1YE8A 1OFUX 2KBEA 3LDAA 2QP9X 4HLUA 2GXSA 5GJCA 3RC3A 1SULA 2UZIR 2YJTD 4R7ZA 1KI9A 2IWHA 4I81A 3FMPB 4MGKR 1J7KA 4FMCB 1JR3D 4TTQA 1FTNA 1KHTA 1AQUA 3AEZA 1NLYA 2XJ9A 5LD2C 1BO6A 3QIAA 3GLHA 4OQMA 4C3ZA 4V0ME 2ZI4A 4IVRA 4S35A 2PEYA 2RGBA 4IDHA 1ZCAA 2LKCA 4G5SA 5HCIA 5JECA 3B60A 4TQAA 4NMMA 5GJVC 3MD0A 4PC2A 3KJGA 4P4UA 4A0FA 1IAQA 4E22A 1L2TA 1P72A 2EW1A 3FDIA 2QU8A 3C5CA 4UJ3A 2GVDC 4IW3B 2CXXA 4JKIA 3U7EB 1GDDA 2O0KA 1NMYA 2YOGA 1HTWA 1KSJA 4QGFA 3SS8A 3NDBB 3PEVA 5AK0A 1Z0KA 2NTYC 5KNDA 3RWMB 4P3YA 4N0EA 4H9GA 1N5IA 1PZNA 4DSUA 4CT5A 1LS1A 1ZNYA 2WOJA 3NIBA 3ZZTA 5D3MB 3RYTC 3T12A 4L9SA 4B71A 1DE0A 4RSGA 5EP4A 4E07A 5K8LA 1M8PA 1X8KA 3AF4A 3CWQA 1XDBA 3IGFA 1JAIA 4QNMA 3C15C 1NLFA 2W83A 4RKEA 4Q7KA 1XXHB 2HF8A 3HR7A 3FMIA 4GNKA 3I5YA 2QEQA 1NL3A 1L7VC 2LCFA 1OXSC 2ZRGA 2FV8A 3SR0A 5C4MA 2OLKA 4W7SA 3MWYW 4FWIB 1Z6YA 1IY1A 1Z0FA 2ZRMA 2AL7A 2QRZA 3I1FA 1VYUA 4AWXA 3B2EA 2GHIA 5JMTA 3GJ4A 2KE5A 4JVLA 1T4GA 1JQJC 2V1XA 2EQBA 4TMZA 4MGYR 1US8B 2VHUA 3PCRB 3QKUA 621PA 3CRQA 4W5JA 4Q1DA 4CZ2A 2DFLA 1CJUC 2QQEA 2AX4A 1GKYA 2VQSA 1F2TB 4A36A 1U9IA 5GJWC 3U6BA 1GVNB 2QM8A 1G3QA 3CO5A 4MYHA 2O5VA 1D2MA 1W5TA 2O8BA 4WXRA 1ZP6A 1DAKA 3WNBA 4FMDF 1LB1B 4QXAA 2MMCA 3I92A 3GLGE 1Q22A 1P7CA 1KMQA 2IYYA 3X1YA 3QVUA 3U5ZB 4HDQB 3NEYA 4GOXA 3REFA 4URVR 3KXKA 3EW9A 3UG7A 4NE2A 1SXJB 2OCPA 4RCZA 3OIWA 4PPGA 3LH5A 2GK7A 1MH1A 3W34A 2VBCA 1IY0A 3EG5A 3C16C 2FSIA 1IXZA 4KLZA 4RZXA 3AGQA 2P0EA 4BWYA 1H8EA 3WMGA 2MMGA 2GCOA 1QDEA 2G77B 5DH9A 3R7WA 1E1RD 2WOOA 1E9AA 1II9A 4XVRA 2ORVA 5J40A 1G5PA 1PUIA 2FGKA 3L0IB 3OAAA 5DIFA 3CX6A 5KSPA 2VHQA 1OIVA 3AVPA 3QOFA 1G7TA 4DUGA 1KOFA 2D4HA 4Z54A 4OHYA 5TARA 2C95A 4BFUA 5EXTA 1SGWA 1U94A 2C9YA 2FNAA 3QPUA 4I1SA 4NCHA 3FGNA 1YZNA 1P9NA 4QOSA 4TLEA 5JCPA 4LJ6A 1T5IA 3QQ5A 1RVDA 3BB4A 4M1TA 2H92A 5FBVB 1QHSA 1E9DA 4LYFA 5LDDC 1IN7A 4EPRA 1KMHA 3CPHA 4TZ0A 1DVRA 5JEEA 3C14C 1E0JA 3BB1A 1YR6A 3H1TA 3TQCA 3RAPR 3RSLA 4HUTA 3SC3A 1KK0A 2OG2A 4KFUA 3RANA 4KFSA 3HU2A 1E2MA 3ADKA 3BD9A 2DFTA 4OK5A 4C0QC 1I4LD 5K8UA 1GNRA 2OT3B 1Z0DA 2J46A 4LX0A 2RB4A 3WYAA 4M22A 1NVVQ 2IYRA
chains in the Genus database with same CATH superfamily
5I7RA 4WY2A 3EPKA 4HTFB 2E85A 1VL6A 2UUAB 2ASVA 2PL5A 5DHSA 5H3LA 2JFXA 4JBIA 4PPQA 3PC2A 4EY5A 1XA0A 2NXEA 1TC2A 4ME6A 4E6EA 2JFYA 1WE2A 1CT9A 1DX6A 1THTA 5LQNA 2PS0A 3AZPA 4UAVA 1MABA 1ESZA 3R75A 3I2HA 4EWLA 3DZ8A 5CFZA 3G2OA 4X20A 4L07A 1AQJA 1E3MA 2ZRQA 1Y34E 3L4SO 4BS9A 4UOEA 3VZQA 5I7SA 1VTKA 1AHNA 3T0FA 2BM0A 2DUWA 5TQ2B 4ZDWA 1N2GA 4XARA 2XT9A 1CQXA 2KJQA 2P68A 4IVPA 4TXHA 2XT0A 3OY7A 4JCOA 2GYVA 2GJKA 3B7PA 2B8NA 3A6EA 2D62A 4DY4A 2BL4A 4YQFA 2VQDA 4KBYA 3RRYA 3NM4A 5JALA 1G1MA 4M0PA 4YMSA 5BWMA 3M81A 4MR7B 3U56A 1RRCA 1OT5A 2VAWA 4RA6B 1BVHA 1ZGZA 4HDMA 3FIJA 4CEHB 1S2DA 2VHZA 1YUMA 4RSMA 2CC2A 5IXYA 1KO1A 2YRWA 2QT0A 4TRRA 4NULA 5H16A 1SVSA 3ELWA 3A3PA 3D8HA 1Z37A 3GA5A 2ZR7A 2AOVA 3QU2A 3FI9A 2BBOA 1GQYA 1IZ9A 4P80A 1L5WA 1EHCA 1JKIA 1QFSA 1XZBA 5K6AC 3PUXA 3ZCTA 1XDZA 1FXUA 1RKUA 2BTEA 1Q1ZA 1UZAA 2CUNA 3CCCA 1P18A 1AS0A 2EFJA 1FLAA 2HN9A 4BFSA 4ALJA 1U1FA 1TMKA 4RD1A 4LJSA 4EG8A 4DR7B 1GFWA 5TRTA 1ELOA 4BQQA 1VL2A 1W0JD 1REQA 1NTOA 3TPCA 3ZY4A 1W8DA 1I4DD 4NFLA 4AK9A 2D8MA 2J5XA 1WSDA 2J5QA 3DXFA 2AD5A 3MUOA 2WF8A 3MS2A 3ULKA 5TNXA 1U2EA 1UQRA 1Y82A 1XD2A 3IP3A 2OQVA 4QGBA 4RGYA 4HZGA 1L5MA 3O4RA 5K3BA 2LIPA 2P35A 4PLHA 1KJQA 1SEPA 1JQLB 4ZQCB 1SVOA 5EPOA 3TQHA 4MYRA 4HWTA 5TF4A 4L0QA 3JQ9C 1ADBA 1E8DA 5G2OA 3SR3A 1L4FA 3CVJA 3Q0IA 3W5JA 3LA6A 3R9KA 4UUNA 2A0XA 4GO1A 3QVJA 4KMRA 3JQBC 2ZM6B 1KBQA 1SWWA 1X1DA 2CNDA 1S4QA 1DUIA 1EEXB 2I62A 4BP3A 5HJ5A 1FX0A 3HEMA 2A2ZA 4Y1RA 1FPMA 3FXAA 3U6KA 4JT2A 4RX1A 2W70A 1WCIA 2IL1A 5EXPA 1TMYA 3RVRA 4BP9A 3SK0A 2WJPA 2PGDA 3IP9A 3SYTA 3W4JA 3VNVA 1DIRA 2IA5A 3N39C 3PSHA 4L0DA 2HSJA 4B5LA 1HE5A 1DSSG 4ZYXA 3HFGA 3ILVA 3ZWMA 2NT4A 2PMDA 2VKQA 3EQ8A 1RLIA 3JAMA 2AJDA 1AKMA 4B4KA 4BGVA 4K46A 3IVRA 1NXTA 4WVLA 2BZSA 4LF9B 1E1KA 4H17A 1IBKB 3MMSA 2FH5B 2VAMA 3NBAA 3NOVA 1C0KA 1E2GA 1W36C 2XAAA 3RDPA 3QBJA 4OVKA 4DG8A 3I9JA 2Q6KA 4CKYA 5DLPA 3IPCA 1U98A 4R9VA 5JY1A 5E7MA 3C8DA 1Q3HA 2FG7C 4B73A 2CFCA 1XHFA 2A58A 2JGMA 4GE0A 4QO8A 3WIDA 1SZCA 2IDKA 3IQXA 1K8XB 2XRZA 1SG6A 1EU1A 4EY7A 3L4EA 3UAZA 4F45A 5KS2A 1M83A 3LCMA 1P80A 1XDGA 3INTA 5C31A 4ECEA 5FTNA 2UXCB 2WFZA 3P4XA 2YWEA 3EVZA 1FTQA 3NP9A 4XB2A 1CY4A 2AYYA 5E7IA 2ZIXA 3ZKWB 1MABB 2YJGA 2XCQA 3L7IA 3AUXA 2VZLA 2GHRA 3PTLA 4PHTA 4RGQA 5K4AA 2X5XA 4FT4A 1VE6A 3QE9Y 4MICA 3GPIA 1L7RA 3OWHA 3QWAA 2VHWA 4U2GA 3VGJA 1AOXA 5E2BA 5JCOC 2NYVA 2IYSA 2WQZA 2Q7XA 3OA2A 4ICIA 1IDOA 2CXRA 2CN1A 4EJSA 5M04A 5AKEA 1RLTA 3QNUA 1YK0A 2Q2QA 4JLPA 2O3SA 2QTCA 2D1SA 1LLFA 4QHTA 1JR3E 1ZOPA 4JYMA 4JI3B 4GGOA 1V1RB 4D4MA 4PHFA 1LW6E 4D8UA 1PFKA 3H7IA 4HDMB 2ADFA 2NV6A 4Z53A 3AMVA 3X2EA 3SGLA 3GYGA 5F2NA 1OFVA 1UEIA 3P9ZA 1ZPDA 3QLUA 1SOVA 2OFWA 5EQDA 3GD7A 3MOSA 4HD8A 4QDUA 5E9AA 5L40A 1YFKA 3WQBA 4D1YA 3MXTA 3N0XA 2WF5A 3IERA 4E2FA 3SYMA 4BMCA 4B48A 3HQ4O 1N6HA 2Z3VA 3GO4A 4O1IA 1RZRA 2OZLA 2X1HA 2P77A 2ADMA 3KUUA 1UWCA 5CPFA 1DOZA 1ZLXA 2P27A 3RIEA 3HS3A 1GPKA 1Q5PA 1SHKA 3A6LA 1UPXA 3T1VA 3ESYA 4P1ZA 3FYSA 2WUDA 3KR9A 4BVKA 2ZI3A 3WMFA 4PICA 1PL0A 1XD2B 3LDUA 2EHDA 2ZUDA 1EFVB 4XSVA 1XCLA 2ZUCA 2NYUA 3FA2A 4EARA 1M6YA 4MRPA 3GRAA 3ZVLA 2JLWA 2PUJA 4ARAA 1IQ0A 3UUGA 3ZVNA 1TMGE 4TRMA 1E62A 3TE6A 1KO4A 4XPIB 1WOYA 5FBWB 2WU0A 2XGGA 3RWOA 5ABPA 5LMUB 3QY0A 1EK2A 5DI9A 4MDEA 2P6NA 2R8PA 3O03A 4YHHB 1ESDA 1NAIA 2FR1A 3K16A 1JLKA 4Y1RB 5DHAA 1Z3IX 1Z6QA 3GUYA 3RLIA 1KEVA 2PFGA 2AEFA 5G4KA 3FTEA 2A5GA 4IZIA 3S8YA 3TKAA 1ZH2A 2FJUA 2JJ1D 2K7ZA 1AQLA 1GP2A 3GH3A 2AMLA 3ORRA 5F7XA 2BE7A 5KJCA 5CFQA 1SC9A 1ZUHA 5JCJD 5IAGA 3EVDA 3EF1A 4TN1A 1WTAA 4URUR 4AY4A 5BOSA 1LWOA 3G49A 3RS0A 4J2OA 1ZZGA 3DDZX 3WRXA 3NT4A 4LHZA 1VFNA 5CEEA 3EJWA 4AAYA 1ECPA 1MX5A 2WFAA 1GQQA 1YCFA 4RK5A 2AN9A 2QAGB 2Y4NA 1IXKA 4L16A 4KIWA 2FN7A 3AI7A 3HN6A 4RM2A 3QVXA 1DKRA 4F12A 5ADWA 2L19A 3AIIA 5CT8A 3F71A 3S27A 2Z2JA 4P32A 1KIAA 1E7QA 3M6VA 5DM1A 3R9XA 4Q03A 5THQA 3QOXA 3VYTB 4BFVA 4D98A 3EVNA 4O8ZA 5CYOA 4CFYA 1LQUA 4JLWA 3WHPA 2PGJA 3CNOA 3M5DA 4JI1B 1SHZA 3LLUA 3PFGA 2MSDB 2XZPA 2JJ2A 5B30A 3FROA 2FUG6 3R1IA 2R7NA 4IDGA 4JB2A 3OU6A 1Y8AA 4PGFA 4E5SA 5EZQA 2QTWB 3BK7A 4P4SB 2ZJ3A 3ND5A 5EYPB 3PX7A 3C3JA 5EKTA 4CM3A 3MJVA 4I55A 4W63A 3TINA 3VR3A 4EJSB 2A1UA 1JYSA 1ESNA 4B7XA 4E30A 1S1MA 1WX1A 4RH3A 1FFHA 1U3CA 3KAQA 4FLFA 2V0CA 4RETA 2YYZA 3T9EA 2H4HA 3KKNA 3MCAA 4R1PA 4YP0A 5ALTA 3ZNNA 4HFMA 5BR4A 5HS4A 4GYJA 2XKJE 1VRVA 1EZ4A 5DW0A 3GDHA 4N0PA 2I03A 2GT1A 2QZ9A 3CZ4A 2KM1A 3MTDA 1R6UA 3U81A 4X1YB 4I50F 1RJWA 3RYFB 4L8YA 2A1IA 4TKZA 5T8KA 1JEYB 2Q5OA 1QJCA 3VC2A 4Y2SA 2QLBA 3KBBA 3DHWC 4WEOA 3ZHYA 1HT1E 4I46A 1CRQA 5EGSA 4ARZB 1YHNA 2ZE7A 3KZ1E 4J0HA 3T34A 2X0EA 1N0HA 2ID9A 4GG1A 2OZLB 1IN1A 3THWA 1ORWA 3IUEA 2DJIA 2SCUB 5CX1A 1J07A 3RVJA 4IFIA 3WK5A 3AI3A 2ZUVA 3O3OB 4TWAA 4EW1A 3EFEA 4JEHA 4QARA 4EKGA 4WLVA 2ZRAA 3TZHA 1I4EB 1V26A 4KO8A 1ISSA 3EAFA 2NUBA 4Q66C 3TRHA 4GZLA 2A9OA 1C3JA 1FDOA 1U9JA 3EC1A 3PC7A 3BE6A 4MYCA 3U40A 2E1PA 1NUSA 2BLLA 4HB0A 3PF8A 3OEWA 5CB0A 1I80A 2KX7A 3DJFA 4I5IA 4N18A 3IHTA 2BKUA 2V1UA 3EEOA 1NULA 1P4HA 2P8JA 5DNCA 4C4RA 3QQPA 3O73A 4I99A 4J8PA 5I9MA 3TZEA 4RLQA 1K2VN 2PZJA 4FGKA 4TQGA 1KI2A 1CUAA 2GXQA 4LJLA 4L5JA 5GONB 4PZEA 3ZDFA 3SQXA 5JSYA 4CFZA 4NAHA 3JQAA 4JLOA 4OUDA 1C41A 1YJQA 5G4KB 3AHFA 3DWIA 1UZLA 1HMPA 3OPYA 3VTKA 1VG8A 4UVDA 1KQNA 3KQHA 1BIFA 2B7BA 2JA1A 4ND2A 2C7RA 1YTLA 3ZU5A 1O94A 1VRWA 1Z4OA 1EA5A 2FPKA 2HYDA 4IIUA 5BOSB 3O47A 2WAOA 2HV9A 5CHYA 1Q7TA 3HE3A 1V5EA 3DZCA 3MQ2A 4M0CA 2WC1A 4ZKDA 3I05A 2B1GA 5E2IA 2HLHA 3OHSX 1QNLA 3CCFA 1NA5A 3HPRA 1YFJA 4XGIA 1WHTA 5AUQA 4C5BA 4FFLA 1BVRA 2VCHA 1CU1A 1J56A 2JAOA 1J23A 1C7FA 1JXAA 2LUOA 4BVFA 3U4CA 4B7AA 2A78A 3UYKA 3VYUB 1GU1A 2X40A 3OT4A 4V2IA 4BQEA 4NFYA 3ILSA 4KVGA 4MPJA 1O6ZA 2WSLA 3BL5A 4D79A 2H8KA 5IBQA 1ESEA 2CNWD 4RANA 1PT8A 4F2HA 1HORA 2C04A 1ATZA 3EDRA 2GI4A 1UWLA 1X7WA 2NTVA 3SIWA 4FONA 3G2PA 5K45A 3TLXA 3RU2A 2JLBA 3K71B 3HACA 1E1QD 2ZSFA 1NE2A 1Q20A 3FB1A 2XD4A 1KIFA 1AZSC 1XI2A 3KJQA 3PC8C 4JUFA 4AJ2A 4UDNA 5THXA 5FUMA 4P3NA 2RE8A 1F2UB 4FC6A 1PIWA 1QYRA 2IVFA 4HN4B 3K5PA 3AHHA 3KYJB 4MCHA 1UJ2A 2A1UB 4J3FA 4AN4A 4NBLA 1NX6A 1SCKA 2OHGA 3WNVA 3FVWA 3HDYA 3P9NA 5FI0B 5HNKA 1YR9A 3OEYA 1GUDA 1WXQA 2FUCA 3NIWA 4BFZA 5ALWA 1MX3A 1Z0UA 3VI4B 2QPAA 3HZOA 4KMOA 4ZVNA 2J6BA 2VDMB 1C3LA 1N5JA 1VI2A 1W19A 1MNQA 3LECA 1YHZA 4DM3A 1KVUA 3I09A 1DGQA 1HDRA 4LZNA 5BYJA 1KJIA 4E15A 5FI5A 3WVNA 4K6FA 1RLJA 1ML3A 1P4AA 3DMPA 3RLFA 5JZOA 2AX3A 2IODA 2WSSA 3B1XA 4HL6A 4ZAXA 4KYUA 3M9WA 2NP7A 4HVCA 1MJGA 2PG3A 3KJHA 1JEQA 1IBRA 3NHYA 5JSKA 4KV7A 1YFLA 3WBFA 4GFDA 3A3YA 2O1EA 3DKVA 1VIYA 3ZOKA 4AICA 1FDRA 2C0PA 3THWB 3D02A 3W7VA 1CUGA 1KY3A 1WUIS 2BEUA 3CN9A 4UNSA 1ZJJA 4TUYB 3TSCA 4A6PA 3DEHA 4D2IA 5TPZD 4I36A 2NPFA 5ADUS 2GWRA 3M4YA 1DB3A 3E18A 1GGEA 2UYYA 4FYXA 1M1UA 1KVTA 1FDUA 1DTWA 1PWEA 3JQQA 4NBRA 2MCFA 1JR3A 2WNSA 4IVNA 4TLMB 3TTYA 3PL5A 4DLYA 4FQ7A 4UBKA 1SVLA 1YXMA 2GD1O 1W2WB 3AVQA 5B36A 3P0FA 1ZXBA 4C0HA 1DOAA 3SU8A 1NW5A 4KI7A 4CMAA 2PT6A 2G0AA 1EG2A 1JIXA 1O3YA 4X62B 3BXGA 1AB5A 5GZ3A 1XIVA 3NALA 5HUJA 1N33B 4DCSA 1VCIA 1ISGA 1XTZA 1YRAA 2VJCA 5AJZA 5MF6A 2IUEA 5LSAA 3MFYA 3BE8A 5ALVA 1OBCA 2Q9UA 2ZYIA 1KU6A 1X19A 3DBRB 3EVAA 3HA3A 4BLSA 1HMYA 4OUDB 4N9WA 1ZI6A 5DWQA 5EMMA 2HADA 5DNEA 2SICE 2VHJA 4UBJA 3OPYB 1ZDMA 2PWZA 3UM9A 1LQTA 2QRUA 2JH9A 2C7OA 2YYYA 1EDZA 1PN3A 2RCYA 3DM5A 3EQ9A 3WTBA 1OZAA 1GEGA 3H5RA 4HQKA 2WUEA 4I1UA 2WHYA 1K6IA 2E87A 2C5LA 5EJ7A 2G40A 2OUKA 1R0ZA 1HNWB 2IEZA 3FKSA 3VO8A 1T2NA 2OO7A 1Z3CA 1WPGA 2P2SA 3DMYA 3MJSA 3I61A 1UJMA 3G89A 4RK4A 1DJOA 3SJBA 2Z6UA 2XOXA 2WI8A 1RJDA 2V6MA 1G5HA 1WHTB 4TGLA 3AEQA 4ZYVA 4FDAA 4AG6A 4B31A 1NJ2A 2J1LA 5JBQA 5ITSA 2IEIA 1OUMA 3EY9A 3O8RA 2Q2NA 3DOEA 3IAEA 1F7UA 3OOJA 3GN2A 4LV5B 3A06A 4OHUA 5HS6A 2WILA 4LOIA 5CK5A 2JF0A 5DCLA 2KI5A 2PUWA 3ITKA 3KOYA 1KGDA 3H9UA 5ALRA 3WV4A 2GAFA 2OK8A 4BGUA 4X65B 1XDWA 2I4RA 4DMRA 1ZNXA 1Z74A 1V39A 2ZZKA 4E11A 1NR1A 3RYCA 5EE9A 1B15A 4QPCA 5AHKA 1TVMA 4O33A 1IN6A 3K6RA 3OFNA 3LYAA 3UATA 4B17A 4EG0A 4XD7D 2FMHA 1AKQA 5DYYA 5FUVA 2OSVA 4G65A 3GFRA 5SZKB 1RTKA 4BO7A 1U81A 4CR7A 5K0FA 3IRVA 3DKPA 5LL6P 1TCUA 1Z5GA 2D2FA 2LCIA 1ODLA 3KDPA 4J2HA 4P98A 5IKPA 1TYAE 2M98A 1N0VC 5TDHA 3G8BA 2B0JA 3ONWA 1R4AA 2AYZA 5ED4A 4RVDA 5F3RA 4HPXB 3Q15C 3NVMB 3P9QA 4GPD1 1OPRA 1KY5A 3KZNA 2UZ1B 2NO9A 2CUKA 4M88A 4TTJA 2MR5A 5GY7A 3T5MA 3HXTA 5GJBA 4GRDA 1KO8A 1COZA 3KQKA 1UKZA 2QT1A 3IR5A 3H4VA 1ZL2A 4EG1A 2AFRA 1RSZA 4FN5A 5JFOA 1X6VA 4G0MA 1GU7A 3TBKA 1F2VA 1W0KA 1Y6JA 4ZT3A 2YWCA 3BIOA 4RUKA 1F51E 2WD8A 1YRBA 1VYTA 3HDVA 2VUTA 5FOQA 2VO1A 2W90A 3FLMA 2W6JD 4N65A 4EJ2A 2G8NA 2QTZA 4PAQA 3K6SA 1GA4A 1A9TA 1U65A 4EM6A 3J81A 3FFBA 3SJCA 4PX5A 3WHKA 5LDHA 1A8SA 1RPZA 3U4MA 1GL3A 4D3XA 1LLQA 1M6EX 1RD4A 1X7GA 2QQ0A 3WB1A 3ZI7A 1KTIA 2EBUA 2PNJA 3CB2A 2OV6A 1WWKA 4OA5A 2GTIA 2QL9A 2AG6A 2W2TA 3GGPA 4LRUA 3PNKA 5ALIA 4CLOB 4YCNA 2PBFA 2W2OA 5A9TA 1XJQA 1LJ8A 5DISB 1E1RA 4PCLA 2PMCA 3GLHB 3MFQA 1NXQA 1LDMA 2KLHA 1WXEA 3CSUA 3HRIA 3OIYA 3OJWA 3RK1A 1EE1A 3ZWAA 1XPUA 4JD5A 2WTMA 4ND6A 4Z4CA 2IS4A 4X84A 4AMUA 4DA8A 4W8HA 4TL6A 4ITUA 1O6GA 4U1RA 3B3QA 3WLKX 4K1XA 4DEVA 3FPSA 4C43A 5K8CA 1VSVA 4F3TA 1KJZA 3L05A 5EQFA 5EJ2A 5EHNA 4OQPA 2J87A 3DDSA 2C7GA 3MCVA 4KLCA 4NU6A 3CFYA 3WMXA 3F4KA 4XLLA 3SLRA 5DNVA 2IHYA 1V4BA 2PTGA 4EHDA 3H9EO 2E21A 3IVAA 2K7FA 2WD7A 3BHNA 3ETLA 2RGUA 4WW0A 2I2FA 4DLXA 2XCRB 1Q21A 3MGAA 2B98A 3Q5DA 2QPLA 4CL2A 3BE5A 3L0DA 5EJ9A 2ZP1A 4Q48A 1ORDA 4WGGA 3TIFA 4RQAA 3ZV6A 3OZXA 3FSEA 2DKNA 3STYA 3UK0A 4L0CA 5E7JA 2QRPA 1TZBA 3ZWKA 4G0YA 4I9UA 4D4LA 2FOLA 2GKOA 2P9HA 1IYZA 2XNHA 3LLVA 3OWOA 3AEQB 3PVCA 1YNOA 2WINI 4ROSA 4I55F 5AI9A 4NLLA 1ZJ5A 1IMJA 4DAOA 3O0TA 2JD1A 2ZYHA 1S8FA 1N5LA 4GD3Q 4J1QA 3OUTA 3PXXA 4P4LA 4Q1CA 5IMSA 1R16A 1GAJA 5LMNB 1F5SA 2YRXA 3ZWVA 3PX2A 3PITA 5BQ5A 5I4IA 3X1MA 1TVCA 3ETHA 4MI6A 5LIRA 1VLJA 1E3EA 4MINA 2UDPA 3N74A 4IJQA 1QNFA 5ERXA 2C96A 2PL1A 4LZJA 3HSYA 4W4TA 3QLTA 4WCFB 3H2GA 1U28C 1UBMS 5B3LA 2W6NA 2YYSA 4Y18A 5FFFA 1FYWA 1WABA 3RS4A 2WF9A 3A1WA 3A4LA 4OMUA 4Q1BA 4AQYB 2Z95A 2F43A 2NU9A 3DVAA 4Q9HA 5IDQA 1XZGA 2FWBA 2VPPA 4K86A 1USIA 3D1VA 3W2EA 3ZI4A 3GROA 2XWSA 4PTYA 2D7CA 1XD8A 1PL6A 1SIBE 3BWYA 3D8BA 2OD9A 4PR3A 3R5SA 5CT4A 3HCCA 2P9CA 1B2LA 3G5TA 3GUHA 3NTVA 4G1MB 4KLAA 4TKUA 1CJVC 1Z4NA 1LEHA 3L6UA 3LXXA 4Q5IA 2ANBA 3U9TA 5CITA 4LY9A 2W8BB 1GG2A 3A6PC 5BN1A 4QUBA 2E4ZA 2QJFA 1R1DA 3UA4A 1GGMA 4GMFA 2D74A 2E6KA 1ONPA 2HIGA 2WUFA 3L8CA 5TF0A 3BSSA 1D2AA 4EK9A 4GRAA 4OYYA 2BGTA 2XMGA 1AKNA 2B35A 1J8VA 3AFMA 5JEDA 3TLBA 3ZD6A 1T9GR 4OX9Y 3EGCA 5FPQA 4HNSA 1DC3A 1R9NA 2XTNA 1CR2A 3K6SB 3TB4A 1R5NA 2C98A 4BAZA 4LCEA 4IHJF 4PVCA 2M1XA 2I66A 4Q21A 4B9EA 2DHEA 5F9FA 1OFTA 4CQLA 1A5SB 1VPDA 1P9OA 3TRDA 3KE9A 3CMCO 4BATA 4C4SA 4DMUB 1W0JA 3W78A 5BOVA 4J0KA 3TUJC 1VECA 2EIHA 2QYOA 2IZOA 3HL4A 1NFQA 5L51A 3V1LA 4PZLA 1UOOA 2PH5A 2WSBA 2TRSB 4J4HA 2QMYA 4JMPA 2RIRA 3BMCA 4C5CA 1XELA 1BH2A 1EFPB 1LTQA 3N87A 3RK0A 2AG1A 3V34A 1M1XB 2IBSA 2WP0A 2A33A 1X9GA 1ECFA 2X23A 2V74B 1TRHA 4IUYA 1PW7A 3D59A 1N2EA 2VAXA 2C2ZA 2JAWA 4IO1A 4BQPA 5K8TA 2DQKA 3ANMA 1XEFA 4KUHA 5LD2B 1T9BA 5KVAA 4JZKA 2Q2WA 3EDOA 3CZAA 4RZ3A 4U7WA 3RF6A 6PFKA 3W5CA 1MCZA 1EAYA 1NURA 4G81A 3RVLA 1OXTA 3ZDYB 4HCJA 4P4NA 2LKDA 2I6SA 2XPCA 1U3DA 3NU1A 1RQXA 2FW1A 3L93A 4FOOA 4UEWA 4AP5A 1KMHB 3AUSA 4ZDIA 1T2UA 3S99A 4UJ5A 2QRGA 5AW2A 1Y1QA 3DVSX 2PR7A 2X41A 3F67A 5KIAA 1Q1EA 2WPDD 3IE2A 4PLYA 4YJ2A 2OV3A 3WDSA 4MUXA 2BMEA 1QV7A 3DUWA 3SJ7A 2FRXA 3A3NA 1EGMB 1QYDA 5LYJA 4M0EA 4P5DA 5GADl 2ONYA 3T3OA 2E7ZA 1XXHE 3I9OA 1HH4A 2XWQA 5ESXA 4Y6OA 2XW6A 2X22A 2OBXA 4KFTA 2Y6UA 3T5BA 4DIFA 4CIYA 3JD3A 2ZWMA 3KQMA 3LFHA 4FLEA 2OG1A 3TBFA 4AX4A 2FEMA 3VXKA 4FS8A 1KQGA 5BNFA 3NBUA 1D2EA 3RYHB 4JSTA 1ZH4A 3DBLB 4DLZA 2YFKA 4U7JA 3RROA 3O4JA 5C2JB 2NGRA 4RD4A 2ZULA 3HVHA 3NG1A 2V55B 1IWOA 3M6LA 4N03A 1NXXA 7REQA 3G7UA 3WLOA 2H3HA 1VJTA 4YJHB 3JQ6A 2MDTA 2QE7D 2COUA 2IXDA 4MLZA 1YB6A 2NU9B 1YE3A 3AQ4A 2AFHB 3U31A 1AURA 2QRJA 2X4IA 3EIUA 1K6JA 4I8DA 3E9YA 3QF4A 4R2MA 4A5OA 1TU4A 2BHLA 4ZVLA 1YD7A 2GEDA 3JATA 3B20A 1Y4DE 2WB2A 3HDHA 3UKDA 2RHHA 3A28A 3G2MA 3MWFA 3U7GA 3U7QB 2FW7A 2F3PA 5AXCA 1PBTA 4FWBA 3WK9A 2VG8A 5I4KA 4Z49A 1AHIA 1ZHOA 3BREA 3IX7A 3QEMA 3BX1A 3E3LA 1NQ5A 3D8SA 4PO3X 3G2QA 4R68A 2C1ZA 2WWYA 1KZ4A 3SSMA 1PJCA 1F8YA 4JVSB 4PZZA 3CVYA 3VPFA 3L0PA 2QUBA 4N8SA 3GLFB 3I39X 2J0UB 3FAZA 4FHZA 3W6UA 4G9EA 4QTTB 1JIUA 2GN8A 3HNRA 1RE0A 4M8NE 3EIFA 3WB0A 1WXFA 5LMCA 4HX5A 4FD3A 3MMPA 1YB5A 5KYKA 1CY0A 2V7BA 4GPAA 2FPIA 2XVAA 4HWPA 4YCDA 1JILA 3B8EA 3FGPA 4CQLB 2RI1A 4CKEA 1IVSA 4QGSA 1U2GC 4OB7A 3OZCA 4GXRA 3KPJA 4EI8A 1HR0B 3FRJA 1NBMD 2WG0A 4JOCA 1N1DA 3H5VA 9LDTA 3RKRA 2OV8A 2PIDA 3SDBA 3FCOA 3NTLA 4JLMA 3ANYB 5B57C 1BOOA 4L4UA 5I4BA 1Z63A 2IS1A 4U5XA 3W9BA 1WVMA 2GRJA 4XR4A 4ARUA 3WO0A 3BMCB 2PRZA 2BTOA 4WCDA 4O4HF 5JFGA 1SCAA 1ZM4A 4ZD6A 1YT5A 5M34A 1KC3A 2JIZD 2AI3A 1NQVA 4IV5A 3LP8A 2C9MA 3GVXA 5F52A 2DLNA 1P2BA 2XGSA 3ZIAA 4E7OA 2IF2A 1W4AA 5AHWA 4BP1A 5JNTA 2RONA 1HL7A 2HU5A 2QPOA 1EM8A 1WIWA 4RK6A 5CTAA 4RKYA 5DN9A 2ZSKA 4UOQA 3E9DA 2VBGA 2VQEB 4HEA1 4QYIB 1CLUA 2A30A 2ZRJA 4QNNA 5HW0A 1DDIA 4CMBA 3CVVA 4IV0A 2Y99A 3ETCA 3PQFA 5TGTA 4EJFA 2ZETA 4O2AA 2D5BA 5IABA 3ZWXA 1U2PA 2B78A 3WMRA 4CMHA 3NP7A 2PX0A 2JJ1A 1WQ1R 2B30A 2EKBA 2Q5HA 3LQ4A 3QIVA 5CT6A 5CXSA 5F12A 4A1FA 4Q6WA 4UVGA 4OP1A 2HU2A 3OLVA 2W8ZA 4NBSA 5JCJA 3VYSB 5BQPA 1FYDA 2B0CA 4UHJA 1DJLA 1PYOA 3EYAA 1OIXA 3L7OA 4X66B 3V8NA 2QGFA 2Q99A 4NZZA 1P6XA 3ZWBA 1R18A 1CWUA 1UBCA 3HYTA 3WYBA 4BB0A 3FZGA 1Q1GA 1L7AA 2A0YA 2YHAA 2BFFA 1Y3FE 5AXAA 1NVXQ 2GVZC 4Q4HA 1U8TA 2IHBA 4AY2A 1E4EA 1Q7CA 4DEYA 1EUYA 1FU8A 2DFNA 1IN8A 2ACEA 1DEXA 2AWOA 4G5YA 5GWXA 3ICEA 2ZU0C 1SK8A 2ZXFA 5DGIA 1X7YA 3DEZA 1QG6A 3E9MA 4FT2A 1NYRA 4MP3A 3OZEA 1G6HA 2OTCA 1UL1X 2AI1A 2Y1CA 3HCOA 1NI3A 2K87A 2RHGB 1XK6A 3D4PA 4WAUA 2WA2A 4QU5A 4S2EA 5CVVA 2PH1A 2BY4A 1J97A 4R9UC 4FP9A 3Q1LA 4BFWA 3WADA 1L3CA 4H2DA 1R8XA 4B6QA 1NVBA 3E7FA 4XGKA 4WA8A 1IH8A 2VJOA 2R1VB 4IIJA 4ZTBA 3RFUA 1SHLA 4Y7CA 3SC2A 3TJRA 4UFPA 2W9XA 3AY7A 2CGEA 2XMSA 3I42A 4B83A 4TXMA 3JATB 2P6PA 4LECA 1ZG3A 3F8WA 1DEKA 1XWWA 2R86A 4K81B 2YJ4A 4NCJA 1JHVA 5TVKA 1GZHB 1DBIA 1V3UA 3ESRA 3F3YA 4H08A 4JYPA 1AS3A 2QPTA 2Q46A 1YHYA 4LKOA 2ROQA 1IC6A 4E5KA 1LPBB 1M0SA 4HPJB 4BO2A 1J09A 1OIWA 2JIOA 2UYOA 1SB8A 4QT0A 3OPXA 3E27A 3WNZA 3OU2A 4S0XA 2PE5A 2WKPA 1KJNA 1U1CA 2X42A 1YFZA 2BFEB 1GKKA 3NBQA 2LCQA 2G7ZA 5K8VA 1Z5PA 4RKRA 4KTVE 4J90A 5K01A 1R74A 4KDCA 1ZGAA 1WZEA 2CCJA 5EKDA 2OY0A 3NS7A 4EB6B 1Z06A 3OCXA 1E2HA 1GRNA 4F9GA 3VKHA 2GFIA 3BG5A 4DB4A 3FZYA 4NK5A 4QUAA 3ZWNA 3ZXYA 4TTVA 2QN3A 1UKEA 3WRVA 3R9XB 3AFOA 3HFSA 3PPXA 1NHWA 3O1HB 4D42A 1RYYA 1HRKA 5IJ0A 1EVZA 3FTQA 5F5LA 1A2OA 1F0NA 3MTBA 2AOUA 4RD0A 2X8AA 4CBVA 5H82A 5D5QA 4Q3EA 3ZW7A 2ZAGA 1P1RA 1G38A 1NN3A 4NK4A 2BJWA 2L18A 4UUOA 1S02A 1IJEA 2D7DA 4IIEA 4P5EA 2XNJA 4LHVA 3D6FA 3ZX5A 4OA8A 2H1HA 3N8KA 2D1TA 2CMDA 1X7XB 4DLKA 3BKXA 2FPGA 3L9WA 4WBNA 5ETJA 1Y1RA 3AETA 1Y9DA 2I8AA 2FMIA 4I9GA 1LI4A 2CW5A 2CHQA 3FPHA 3K6JA 2OXEA 3ZW9A 4WVFA 4ID9A 4NATA 5KVVA 3K0BA 1L8AA 4EKDA 3HHEA 4R05A 2QQFA 1USGA 1VPVA 3VVMA 4JBNA 5KJ6A 2BMDA 3DE4X 2QUIA 2CBGA 4PYRA 5DLQC 3HJTA 4ZO7A 3THYB 2J9ZB 2QN7A 2RGRA 4NONA 2Y05A 1E8MA 4CI0B 1X1CA 3GGDA 4J07A 5HQTA 1Z2OX 2OKGA 1DXYA 3EOZA 2GD0A 1PT9A 3QU5A 4F2PA 2G72A 2XBLA 3UWOA 4FW9A 3VX4A 3ENVA 3H11A 3HCEA 2R87A 5ECYA 3NWJA 1NWHA 1U0FA 2O2JA 3WLSA 4GQBA 3CLVA 4WA7A 3R6GA 1WHSB 4AULA 5AVVA 1E4EB 4QSMA 5JMWA 2FPPA 4PV7A 1NYLA 1RJGA 4YR7A 4NYMR 1N2IA 2ZREA 1LNZA 4FB4A 1D07A 5AI8A 1Z4KA 1ZAKA 2KPOA 1X7YB 3OEEA 3ADPA 1ZD2P 2RGEA 3ENZA 4U7HA 5CLLA 2H1WA 3I2JA 3Q5GA 4OO3A 1WDWB 4Q1VA 3MWEA 2QY6A 2X5NA 4RW0A 4F93B 2JFHA 2CHEA 2BDTA 2NUAA 5C81A 5J59A 1ZK2A 2G1JA 2XVZA 1MEEA 2JZOA 1NOJA 2ZI6A 3BDVA 3GLSA 1VYVA 3Q3EA 1W36B 1ZAYA 2RHBA 4ZODA 1E1QA 1G3MA 1PS8A 1XKTA 3Q7EA 3WO1A 5D3MA 1EH5A 4DYDA 4EHHA 1JYFA 4E03A 3D3QA 4HATA 4IHAA 4N76A 4ND3A 2EJVA 1I51A 1YIOA 2QIPA 3OM1A 3IR6A 4ZREA 4I2VA 3SC2B 3ZU3A 4F6CA 5A5FA 4KODA 2WK1A 3Q2IA 4G8BA 4OXRA 3R7DA 3U4HA 1FYEA 4Z4QA 5BSKA 1XAJA 1MP0A 4MWDA 1RWBA 2GB4A 1Q7GA 1G55A 1ZW1A 4HQRA 3RVOA 3MGGA 1XXHA 2O8CA 5FBZA 3KIPA 1DAFA 4HZIA 4FFMA 6NULA 3NWEA 3GIWA 4PXAA 1C7EA 4L7VA 4EFKA 3N8NA 3W06A 2PZKA 2O50A 2WF6A 4PYNA 1P74A 3AT1A 3JZAA 4M37A 3KSDO 1CUJA 3R5JA 4LGVA 4PRLA 1ZSNA 1OH8A 4K9NA 4JKOA 2ZUEA 1N4AA 4MO2A 4MARA 4AO6A 2Z08A 4DIDA 1D2HA 1ZM9A 1BJTA 1IMOA 2R44A 4M8KA 3BVPA 1PR9A 2HWYA 1BE8A 1JNXX 2P2NA 1HZZA 2QBYB 1TMOA 4K0KB 3RKSA 2J3HA 4ER3A 4HGZA 2JG3A 5AKJA 4TMXA 4IUCS 2D5AA 4A5SA 4MJ7A 3M8KA 3ID6C 5LA6A 3UKOA 4NV3A 2G5TA 4W5HA 3TRIA 4YUWA 3GJYA 5LQRA 4OXIA 2P67A 5TPZA 3QUSA 5IJ0B 3T15A 3KFXA 5CA0B 4PIPA 2C5HA 4Q3NA 3TNDA 2Y1OA 5DT2A 3VNRA 3L0SA 4AFNA 3UV6A 3KQTA 3QRWA 1I0LA 1X70A 5E38A 4F84A 1M8GA 1V8FA 3QTTA 2RHRA 3CLSD 4HAZA 3W1EA 1OXKB 2XMCA 3CEHA 2OCBA 3L9XA 4RHUA 4YJ2F 2NVUA 2A14A 3ENWA 2HMVA 1W9MA 3VBCA 1KMIY 2AZXA 1YA8A 4GVLA 4DRXA 5LYJF 2C4WA 3AUTA 4BLTA 3PUVA 3CUSA 4UU7A 2Z8YA 5JAMA 4GKJB 3QVKA 4JOSA 5AJTA 1PT5A 2ZXEA 4ZQGA 4B74A 5ITVA 2OMEA 4UCWA 3K8OE 2ZATA 1CIVA 3H5WA 3H5NA 3IFSA 1MQAA 1N5KA 5I45A 3NCTA 3IELA 4WK6A 4KE8A 5JATA 1CZUA 5JRZA 3UAXA 1SHTX 5JNUA 4H7KA 3BFVA 4GC9A 4KOAA 3T95A 4YMGA 4CVNA 3GEBA 4P34A 2PKYX 4GPTA 3K4HA 3GEGA 3PD0A 3B1JA 5AKGA 3Q7QA 3ENKA 4F96A 1RI3A 1Z6AA 2O1WA 2Q3CA 5BVHA 3H4TA 2C88A 4AURA 3DYBA 4DM7A 4P54A 1Z75A 2OPHA 3RCBA 4DQDA 1NUPA 1JNYA 4O1HA 3VVBA 1M8KA 5LUBA 4ETWA 2QX7A 2ORED 3BXOA 2X6TA 2RGAA 4IINA 5IMBA 3AB3A 2ILTA 5FPTA 1OXUA 5DV9A 5TV2A 3N2IA 1J8QA 3ZY3A 3Q40A 3L6BA 4LHEA 2R96A 3BWCA 4TXLA 4WUTA 5ISMA 1J20A 2WR8A 4II3A 4GEKA 4NBKA 3RNLA 3AR6A 4MEJA 2NUAB 3WGKA 2GPYA 2LGJA 4E5MA 1RCUA 3BWXA 3RR2A 5DGHA 3W4IA 1AQ6A 3NFRA 3ITEA 1EPUA 3DR3A 4HB4A 2BWJA