1IAQA

C-h-ras p21 protein mutant with thr 35 replaced by ser (t35s) complexed with guanosine-5'-[b,g-imido] triphosphate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
149
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDSYRKQVVIDGETCLLDILDTAGQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic properties of the Ras switch I region and its importance for binding to effectors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
total genus 54
structure length 149
sequence length 166
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1iaqA00
1AQUA 2R62A 1LFDB 4GT1A 4QJ4A 1S8FA 2UZIR 1ZW6A 4FIDA 4B2IA 2BKEA 3HPRA 2EWVA 2REXB 4LV6A 2PMDA 4US0R 1Q12A 2PJRA 3WYAA 3MLEA 2BOVA 3MMPA 4HLQB 5FH9A 5BWMA 4DSOA 1R6BX 1CEEA 1OHHD 1SULA 1Z6YA 1TQ2A 2WWIA 5HE8A 3B7GA 3ZQ6A 4ACBA 4Q19A 3SJZA 1EFTA 4OQMA 2WJHA 3TW8B 4BGDA 1E3MA 4W5HA 2WKRA 3LBIA 2A5JA 4G5RA 2VP5A 4KYIB 5JCZA 2XX3A 421PA 3N2EA 3C8UA 3IILA 5FUWA 4B33A 1Z63A 2FOLA 1D5CA 3K9HA 1Z0KA 4NL4H 2FEOA 2QENA 1KAOA 3QVVA 3TE6A 3FVQA 5CM8B 1Z47A 3ZVRA 2L0XA 2NO9A 4Q1EA 5LB2A 3SOPA 4Q03A 3I61A 4HUQA 3TUIC 3RAPR 3B1YA 3MWJA 2WM9B 3CKLA 2ZRDA 2F1RA 3FTQA 3NDBB 1G5TA 3ICQB 1A2BA 4NCIA 2OO7A 3B13B 4C0BA 3GLGE 5AUQA 4TMXA 1WB9A 2ZI6A 4C7OB 2IUSA 2Q3HA 4HZUA 4Q9IA 3RS3A 2QSYA 3ASYA 2AD1A 2OE2A 2OFXA 3THYB 2RGNC 3SS8A 4CGZA 2IF0A 3MCAA 4F4CA 3GJ6A 2HUPA 3FHCB 2F6RA 3B9QA 4TLDA 1G21E 2RB4A 4RD0A 4EAQA 2HF9A 3QNUA 2P6UA 2LKDA 3W5JA 4KJZA 2D62A 1YZUA 3KFXA 4ZKEA 1RYFA 1GZSA 2YNMA 4JBYA 3WYGA 1JQLB 2J1LA 1UM8A 2Q6TA 1W4CA 4JVSB 4PSKA 1NSTA 4OBEA 3U4QA 3NBZC 3CRRA 5FBLB 1AZTA 2DBYA 1ZVQA 2X1VA 2WWHA 1HV8A 3LVQE 5FBVB 1XPRA 1XB2A 2REOA 2VA8A 1DO2A 1W0JA 2IS4A 2WICA 1E0KA 3SHFA 2REBA 3EZFA 4GNKA 2D7DA 1WXQA 1NVWQ 2J7PD 2OAP1 5TV2A 5L3QB 3TAHA 1ZU5A 3Q3JB 3M6AA 3U44A 1II8A 1GAJA 3BB1A 1G20E 1MV5A 2PEZA 3LH5A 4MRNA 3HP1A 2D06A 4URZR 4B74A 1V5WA 5JJKA 4EPTA 1TADA 4HEJA 1GKUB 2OCYC 2JASA 3QPUA 1E1QA 4LJ5A 5J4LA 2WHXA 1I4TD 1DAHA 1BYUA 1G7RA 1OLOA 1GNPA 4LDJA 5FBQB 4C2UA 1KJWA 1JR3E 1G3MA 2NGRA 4LHVA 3P20A 4PPFA 1ZCBA 2EYQA 1HURA 1G6HA 2DHRA 5D3QA 3X1XA 5FFMA 4B3XA 2P0EA 3NDPA 4G5QA 2Z6VA 2EFCB 1IN6A 3LBNA 3Q85A 5KDLA 4E5UA 3NBYC 2OCPA 3MWKA 3UIEA 4LBWA 3BFVA 2ANBA 3MUFA 2W6IA 2QSZA 2ZI3A 3RHFA 1SKYE 3EPKA 2DB3A 2VP6A 2ZE7A 2QZ4A 3I8SA 2OUKA 1XWIA 2P6NA 2J0VA 2LWIA 3CM0A 5FI0B 3F5FA 4OJQA 5CLLA 3RWMB 2FSGA 4K8OA 3KDSE 4NZYA 2J59A 1N0WA 4Q1CA 3K0FA 4MKGA 4PPQA 3QPWA 5JS8A 4CF7A 3GFPA 1TX4B 1YR7A 2ZTSA 1E2JA 4E03A 3B8HA 4CEJB 4RD1A 2C9CA 3THOA 1NJGA 2QMHA 3D8BA 1P4SA 3AVYA 2QTVB 1TUEA 3RABA 3JVVA 4FI3C 4BFZA 4CIDA 2C77A 1SVOA 3VR4A 1UKVY 4MGYR 2OV2A 4AKGA 2ONJA 3LXXA 2RAPA 4URYR 2BBSA 2DCUA 2H5EA 1N6PA 2Q21A 4BEJA 5B64A 4C0AC 4ASUA 4PHFA 4AYWA 2HLDA 3OE7A 3C41J 4JLDA 3BE4A 3A1WA 5JWHA 2O8CA 1U9IC 4EDHA 1ZUIA 1G7SA 2ZRFA 3K0AA 1PV4A 2GAAA 2RGDA 4NU0A 2Z83A 3TLXA 4DIDA 4AY2A 2ZI9A 1CS4C 1OXTA 5CDFE 5K8UA 3PENA 1ZM2A 2GVZC 4B44A 3AVWA 2IHYA 2ZJ8A 2W6JA 4JYBA 3AKCA 1XX6A 3WMEA 1P60A 3A8TA 2CL7X 2QEQA 1KI7A 1BMFD 1XJ0A 3GFOA 1QHXA 4A2QA 1W5TA 4IXMA 2ZSAA 5JECA 2C99A 2ZS9A 3AVOA 2IYXA 2OSBA 4Q9JA 1Z83A 3MG9A 4CDGA 5D3MB 3QKSB 1KZGB 4CT5A 1YVDA 2FFHA 2O52A 1OSNA 5KNCA 2FDCA 2CE7A 3OIYA 3DOFA 2IYQA 1Q44A 3GEIA 1E2EA 5FL7A 5LPNA 1ANKA 2BMEA 2J46A 1U2RA 1K6MA 3IDQA 4LHZA 3LQRA 2FU5C 4MYCA 4HSEA 5BXQC 3ZS9A 3W34A 3EZ7A 5CIWA 1DAEA 4UNRA 3ZS8A 4FMBB 5G3YA 2YYZA 2FSHA 2YZ2A 5SZJA 5JCPA 2C9OA 3H1TA 4PANA 1ZNZA 1MKYA 1T8TA 4IVRA 4Q7LA 1KHTA 3WNCA 3M4YA 1OXSC 4JIMA 4BRWA 2E9SA 4LBVA 1T91A 3HYTA 4K46A 5EXTA 1DAFA 3IQWA 1J2JA 1OFUX 1W48A 2MSEB 1QHHB 2H8KA 1XD2B 1F48A 1Z0FA 1TQ4A 2GK6A 4RD2A 4B3FX 2XJ4A 1G291 3DMDA 2JLQA 4IVPA 2ORWA 4DRZA 4XSHA 1SKQA 2PH1A 1DTSA 5FUXA 2ODEA 2AWNA 3EZ6A 1E2FA 3N2IA 4M9SA 4F92B 2BEKA 3KJHA 1AN0A 4C9BA 4MYTA 4D6PA 4AKIA 2ODWA 1FP6A 1QG4A 4G5OA 4R9UC 1FP7A 5CB6A 4LSGA 2CE2X 4IDQA 4A0RA 3CUEF 1WQ1R 3PUXA 1NVXQ 2JJ2D 621PA 3MFYA 3SJBA 4ITRC 1NVVQ 1OH5A 2R6GA 1S3GA 4QRHA 3Q72A 1JJVA 3QF7A 1KSHA 2PJZA 5GADl 2HDNB 3R9XA 1NY6A 5EJEA 1WE2A 5IK2D 2ZI7A 1KI9A 3AF2A 1AZSC 4Q01A 1W36B 1MOZA 3FGNA 2H7VA 2QM8A 2WOJA 3ZIAA 2R9VA 4PC3A 4V02A 4JKYA 4TQAA 3S1AA 1XXHE 2IXEA 4TT3A 2ERYA 1KI8A 1XJQA 1VMAA 4B6FA 4BFUA 4QHYA 4EQ6A 1GOTA 4IOJA 1E79A 1ZMXA 1D8TA 4IRUB 4BQSA 4B34A 1JXMA 4PQRA 5AR1A 5JSZA 1IOZA 1NF3A 5BQ5A 1ZNWA 2V1XA 3GLFE 2QU8A 2BJWA 3DKPA 2B6HA 4TQUS 4DZZA 2JIZA 821PA 1CIPA 2ZETA 3K9NA 4IFEA 3SZRA 4GI7A 1S3SA 2J45A 3CW2A 4BLSA 3WMGA 3GLIE 2JIZD 1G64A 4NCNA 3LV8A 1XD9A 4HZIA 2J0UB 5LD2C 1MABB 2ZAMA 3BFXA 3D3QA 4EJSB 1TTTA 5EUQB 2BHRA 4G0NA 5J47A 4KITB 4JZKA 2X8AA 1E79D 4TZ0A 1VYUA 1DEKA 1OHHA 1QF9A 5AJWA 2OESA 2FGJA 4Y0VA 2WVJA 2V4ZA 3EIHA 1SQ5A 2VL7A 3CNOA 4WXPA 4KHZA 3CF2A 3NWJA 1KMHB 3I1FA 1TQ6A 5DHFA 5SZIA 3ZD7A 1P7CA 3ZVNA 1DELA 2EU8A 2PX3A 2ZREA 5JJLA 4JT2A 1EX7A 2F3TA 4A8JA 3LVRE 2WAXA 3E2IA 4PAMA 2JLXA 2VP9A 4ZIRA 2NIPA 1BKDR 2RGBA 2ORIA 2AX4A 1GWNA 4OQNA 3BB3A 3TK1A 1L7VC 3AUXA 2OXRA 4YXWD 2IEZA 2WJIA 2EFHB 1KY2A 3D31A 2ZRPA 4LI0A 3GLGA 4I99A 4RFSA 1OW3B 4JLNA 3O8RA 4C4PA 2DR3A 1KDRA 2DFKB 2XEXA 3RANA 4M1WA 2FE4A 1P9RA 1W47A 1WMSA 5JWOA 4EPWA 3P32A 4JMPA 4D4JA 2CNWA 3MJRA 2GJAA 1VTKA 2DWPA 4TTPA 2QAGC 2NO1A 4RCZA 2IW3A 2WAYA 1LTQA 3T1OA 3RVBA 4D2IA 3KKOA 2B8TA 5K8IA 4NYIQ 3P27A 4ZPXA 2HCBA 3B60A 5AJZA 4AC9A 2NO0A 1IXSB 4HAXA 5FL3A 1OB5A 1F2UB 4D0GA 1P72A 2O8EA 2ZUBA 1LVGA 1P9NA 2SHKA 4H9GA 1PJRA 4DHEA 3SBDA 1N0UA 4FMDF 3NH9A 4CRWB 3LLMA 2PEYA 3B9PA 4DIEA 3TBKA 1QG2A 1G3RA 4XD7A 3C14C 3H4MA 5E7JA 1ZRHA 4DDTA 1NKSA 1KYIA 1SGWA 2FZLA 2QPAA 5EXPA 5ANRB 2VSXA 3RDPA 2O8DA 4BUJA 1S1MA 5BYKA 4C0JA 5EE1A 2XXAA 2BEJA 2MSCB 3WP0A 4PC7A 4M4SA 2EQBA 2ZRHA 3FYHA 2KSQA 2O8DB 1CTQA 3T1VA 4Q21A 2QBYB 2JLWA 1NLZA 2ZYTX 1G6OA 4TL8A 5CJPA 5H70A 2AN9A 1US8A 4WZ6A 2EWWA 2I1VB 1ZIPA 2VYFA 3KXKA 4NCKA 2G83A 5A4JA 1Z6XA 5K8TA 3QBTA 2ODBA 3GLHE 1PLKA 3B85A 4KU4A 1V43A 1ESMA 1W0JD 3PUVA 4D80A 1E2IA 3KTAA 5EZ5A 3U61B 3IPYA 4DT1B 3PUZA 4NPHA 5DHAA 3I5YA 3CNLA 1XXHA 4M9ZA 2FF7A 4D82A 4RD4A 1KDPA 1SKYB 1OKKD 4WZBE 1IONA 4PXAA 1E2HA 2H17A 2BBOA 1GM5A 2EFEB 3RS7A 5EUMA 3ADBA 1CR4A 3RLFA 3KUDA 3K9LA 4H1VA 1OFHA 3QSYA 4PQFA 2JJ1A 4JLPA 2KI5A 4D4MA 3KB2A 4LK2A 2QAGB 4P4UA 1OXVA 4KODA 2JGNA 5AK0A 2I3BA 1AK2A 4PPNA 4QKQA 3ASZA 2IS6A 5FPSA 2C9YA 5FOWA 1F2TB 2ZSEA 4YMSA 3NTUA 3U3KA 4CEIA 4TYPA 1JEDA 2WPDD 4M9XA 4NBSA 5EP2A 3VAAA 4QM7A 4DCUA 2H16A 1VG9B 3WBKA 5JWRA 1CR2A 1NBME 2P5SA 1OIWA 1U0HC 1UDXA 1XZQA 1MR3F 4IVQA 4UNNA 4TMZA 3FB4A 1NVUQ 3EASA 3IHLA 2GETA 1O3YA 1OFIA 3MSXA 2C96A 3BBPA 4C0HA 3T12A 4C30A 1KK2A 1TU3A 1CJTC 2YKGA 4UXHA 2XGJA 2ORVA 4QL3A 1AS3A 3L8ZA 2GCPA 3IPXA 2ZM5A 2ZJYA 4KVAA 4HB2A 4MA4A 1SVKA 2QE7D 3ZVLA 1Q20A 1W0KA 2GXSA 3HR7A 1P75A 4FMCB 3IGFA 1JPNA 3CNNA 4U7DA 1KI6B 2AK3A 5BN3A 3CH5A 4LX0A 1Z07A 4QJ3A 4C0KA 3KFVA 3GLHA 5KO2A 1KNQA 1SZPA 3TUZC 4P31A 3WRYC 3B82A 1X1RA 4JL8A 4CYMA 2Z4SA 4KSCA 3CPJB 5BN5A 3PITA 3THWA 4ZDWA 3CR7A 2N42A 4DCSA 3SFZA 1G9XA 1G4UR 1LB1B 1N6RA 4GP6A 5LDDC 4Q1DA 2XZOA 4JBWA 1SHZA 2CK3A 4X8LA 2XZLA 4PQYA 4OHZA 4KFTA 4J0QA 4DLYA 4KFUA 2R65A 1E32A 4O3MA 2BWJA 4Q9HA 3I62A 1KSGA 1I2DA 1TQDA 5B2ZA 2A78A 3LO5A 1MO3A 3X1YA 3VHLB 1MO6A 4ASUD 3RWOA 2GILA 1E9BA 4ESVA 2ZROA 1CULC 1XCMA 2VHUA 3V4RA 1RRFA 4O0MA 5F9FA 1CXZA 3PG5A 2A5DA 3DM9B 1VCMA 1TL7C 1EX6A 4O2LA 1X8LA 1DAIA 2CVFA 3UMSA 1TAGA 2NO6A 3N5CA 1W49A 2VHQA 4BFVA 1NG1A 5E3HA 2QGZA 4XH9B 1A1VA 1OPXA 4TLBA 4Q7MB 4CEHB 1Q0UA 2E1RA 6Q21A 5KNBA 2ZI5A 3UXMA 4BPBA 2YWFA 3NHBA 4GMXA 4TLEA 4JBXA 3OEED 3D7MA 4NMMA 1Q1ZA 4HLCA 1RIFA 1HY3A 4X8MA 4IJMA 4DKXA 2O8FA 4BZXA 2CCKA 3FKQA 4JLMA 3B1XA 4RFVA 1QZXA 5B30A 1GVNB 1G5PA 3OAAD 3TQFA 1SVWA 4V0ME 1NNEA 3RS0A 3B5JA 4YQFA 1XTKA 4TZ6A 1HH4A 1XRJA 5DE3A 1B23P 4OK6A 2PZFA 3QKRB 3W6OA 4V0MA 2R6FA 2HT1A 1YZKA 5H8WA 2EFDB 4DCVA 2NO7A 3IEVA 4DB4A 1SXJC 3VU9A 2CJWB 3ND8A 3QG5A 4URVR 1DBSA 2Q3FA 2ODNA 1HA3A 3GJ5A 1BO6A 3AF3A 1P2VA 4I1SA 2ZS7A 2BBWA 4KFSA 4XTRA 4LYHA 4B43A 1Z5ZA 1FX0B 3WY9A 3NHAA 4B3GA 3AVQA 3IEUA 3HWSA 1FNMA 4YMVA 1W46A 1PZNA 1IJFA 3QKTA 5JS7A 1G41A 1TPZA 5C1BA 3AP1A 3A6PC 3K0SA 3CX7A 3NBXX 5KSOA 1S9HA 4U02A 1UKYA 3ZGXA 2CHVA 1GTVA 3FMIA 4L15A 1E4YA 4BECA 1G7CA 3QEJA 2NTYC 3MD0A 1R0XA 1XCGB 1Q57A 1JNYA 2ATVA 2ZSFA 1SVLA 3K8YA 3I3SR 3CX8A 2KJQA 1W4BA 2W0MA 5CK5A 1JR3D 3TKLA 4HATA 2YC2C 5A5GA 1JB1A 3ZIAD 1P6XA 4E22A 3FE2A 4PSAA 1DVRA 4URWR 1UADA 3BB4A 2Z0MA 1P2UA 5EP3A 1FQKA 2WBLC 3ZZUA 1SXJA 3CR8A 1IXZA 4F91B 5AJXA 1YRBA 4QBFA 4KLNA 5DNYB 1KK1A 5L8VA 1PUIA 4OI4A 4IW3B 4ZO4A 5DI9A 2J9RA 1N5IA 2GZAA 4IDOA 4V0OA 3U7HB 2B7BA 4Q48A 1FMLA 3FKSA 3KJEA 1LS6A 1T3SA 1NN3A 2IX3A 1E2LA 1EFRD 2N46A 5FUVA 1DG3A 1FMJA 5CLQA 5AJVB 2CCGA 2YJTD 3BH0A 3OE7D 4II7A 3O8DA 2ZJBA 1UBEA 1JECA 1E0JA 4PO1A 1RW4A 2XSZA 4JSTA 5JEDA 3FWYA 4YDSA 2GJSA 2ZRLA 4R7ZA 2FA9A 5CK4A 1G8FA 1L4UA 2WJYA 4Q5IA 4V0NA 4XSGA 4F93B 1DE0A 2CL6X 2X2FA 1FFHA 1Z06A 5TDHA 3FPAA 1NMZA 2EW1A 2PCLA 1Z3IX 4JL6A 1J7KA 3HR8A 3BH6A 1R5NA 2EFGA 5H1YA 4DJTA 1VKJA 3GQBA 2XB4A 2CLCX 3UWOA 1YZQA 1I2MA 3QPVA 2YWHA 121PA 1UEIA 1N6KA 3QI2A 2DPXA 1OIVA 3ADKA 1NIPA 1XFAA 1W5SA 3ETLA 1XMJA 1Z8FA 3O8CA 1TF7A 3NXSA 3K1JA 3KB1A 1KTVA 4WA7A 2OLJA 4D4LA 3TSOA 5J4YA 3K70D 2PCJA 1AS2A 4BEBA 3FFBA 3TR5A 3LX8A 4B2PA 2CMKA 4OK3A 5AUPB 1ZM4A 1DAKA 1KNXA 3BXZA 2WJVA 4KYUA 3KQHA 1OH6A 2JDID 1RRCA 2GESA 1Y63A 3UATA 1G19A 2YOHA 4ARZB 5CDFA 4DCTA 3NH6A 1HYQA 2ATXA 4HB0A 3QXCA 4OKSA 3AH8A 2DWQA 2G77B 1N6OA 4FCWA 1J8YF 3ND9A 1DOAA 3SEAA 4NH0A 1U8AA 1AM4D 3W9YA 1G3QA 4MGIR 1G3UA 1D6JA 8OHMA 1R5OA 1UDWA 1E2NA 3P4XA 4UNSA 3GLIA 2F1IA 5DH9A 2F55A 3PJRA 1X3SA 4Q4AA 2RGGA 1XZPA 3GLFB 3NC1C 5JRJA 5J4KA 2XOKD 3M1IA 4NP6A 1EGAA 1YKSA 4TL9A 5HE9A 4QGGA 2QG6A 1M7HA 3EA0A 4LJAA 1CF4A 2F7SA 2IK8A 1VDZA 3KKQA 3N70A 4M1OA 2H1LA 4MKFA 1XEXB 3IIMA 1RJ9A 5KSZA 4QGAA 4TSFD 5FPKA 1ZUNB 2FEMA 2JLUA 1OE0A 2H92A 4Q00A 2AK2A 1E9SA 3KQUA 4DXAA 1FNNA 1Q1BA 2WZQA 4TL7A 2F9LA 4QHTA 3REGA 1L8QA 1CJVC 4Q1BA 3PEYA 4IFBA 1S1CA 4HB4A 2CK3D 4MYHA 1HT2E 3I4LA 4NHOA 4ABYA 2D74A 4GZLA 3GP8A 1Z6AA 2BVNA 4Q02A 2IWHA 5JJIA 1KKMA 5GJWC 1JBKA 5EP1A 2RHDA 4O25A 1R0YA 4LJ4A 1R0WA 1XJCA 3QXSA 4PZYA 2NOAA 2C95A 3VKWA 3WNDA 4B75A 4JLKA 1RC8A 3W3ZB 2ZJOA 2ZRGA 1NN1A 2ZR0A 4AKHA 4ZDJA 5E7IA 4A9AA 2QY9A 2IYSA 4JLBA 1Z29A 1VECA 3L43A 1NRJB 2F1JA 2FWRA 2WSSA 4DUGD 4HDCA 5K8LA 3PV0A 1Z0AA 4PTLA 1UFQA 3T1TA 4HAZA 4V0KA 1AA9A 1H65A 4B3BA 4KAXA 3GJ8A 4LHXA 1FZQA 4RY2A 3C4JA 2A7QA 3Q5DA 4DLTA 3U7GA 1K5DA 3T61A 3CWZA 3T34A 1CR0A 2OXCA 2W2XA 3KKNA 4QNMA 4CVNA 4LJYA 2RHMA 3AF4A 2HF8A 3OEHA 2PZEA 1GILA 4L9WA 1GKIA 3RS4A 2WKPA 2ZIAA 2ZJZA 1E98A 3E70C 3HU1A 4LV5B 5BW8A 1KDTA 4UQOA 3NIBA 1LV7A 4B6EA 4EUNA 5CB8A 1BYIA 5DI3B 1W4AA 4G01B 1F60A 2D7CA 3I32A 3W3AA 4P4SA 3T15A 5HKKA 4Y0AA 1UBFA 2GAOA 1WBDA 3GEEA 2XB2A 2VEDA 4POAA 3V00A 5DSZA 3H86A 3BERA 4PAOA 1G3IA 4HDQB 1J70A 4TLCA 4Q4JA 1C1YA 4Z8YA 4WIAA 1DARA 1KDOA 1N0VC 2XNDD 3EC1A 3V9PA 3QXJA 4Q4HB 2GVDC 5EE0A 5EP4A 2JJ1D 3O47A 2IS2A 1RZ3A 1G7TA 4Q18A 1G4AE 4G5SA 4TMWA 1IY0A 3QF4A 3EZ9A 2IT1A 1VHLA 2GCOA 4I4LA 4G3XA 3VR2A 5EXXA 3VTKA 2O0KA 4WZAE 3C7KA 3CH4B 2VHTA 1NI3A 2A9KA 5G41A 4FMCF 5JZVA 2F43A 2O8BB 1XPUA 1ZM9A 4LJ6A 1VYVA 5CYPA 1JEEA 1M74A 3L8YA 3Q7QA 2HJVA 2BV3A 3R7WB 4R2HA 1HTWA 3CX6A 1DAMA 3AGQA 3QBVA 1D2EA 3IHWA 3U60B 1EFRA 2I4IA 3TVTA 5L3SB 2AXNA 2GF0A 3AUYA 2CVHA 3QENA 3THXA 4FINA 2PT5A 3MWYW 3AF1A 2R8RA 4M1KA 1D2MA 4TMVA 4JSYA 1KI1A 4EIWA 4B3DA 1R4AA 4MQBA 5C46F 3LA6A 1OXUA 1OH8A 1XEWX 2VTKA 1P9WA 2VSOA 4LOAA 1OKKA 1ZCAA 2KE5A 1U99A 2CLDX 3NEYA 2ZPTX 4TYYA 1FW6A 5FOVA 2WMNB 2X19A 1N25A 2R6CA 4A6PA 3EARA 4OHWA 4DDVA 2DFLA 2ZJ2A 4BLQA 1H8ED 5LBIA 2OBLA 4L8GA 4RSGA 5EE3A 4Q47A 4O2RA 5CIQA 1KO1A 4AG6A 4P32A 1N6NA 2ZRAA 2PX0A 5L3RA 1S96A 2R2AA 4NE2A 4FD2A 4S35A 2AKYA 1G1MA 3UKDA 4I81A 3E1SA 3UMRA 4NKRA 1X8KA 4MKIA 4HUTA 4BWYA 1KIMA 4YC7A 1QVAA 2FFQA 3WXMA 1G8GA 5JI2E 3BJIC 3VX4A 1XTIA 3SC3A 2D3WA 2CL0X 3CONA 3AKEA 3MGCA 4PZZA 2GJ8A 2OM2A 2YHSA 5DISB 1EWQA 2QA5A 1D2NA 3AP2A 2CDNA 1AS0A 3LQQA 4OI2A 1IY2A 3SYNA 4DLZA 2BJVA 3K0EA 4HUQB 3UMFA 5GJCA 1IN5A 2OZEA 4I1OA 4LHYA 2OG2A 4YMWA 1H8HA 2WIBA 2G88A 3EIQA 3EIEA 1KKLA 4TYNA 3RC8A 1GSIA 2A3RA 2UKDA 1ZBDA 2A5FA 2GCNA 2WKQA 4C7OA 1KY3A 1R8SA 1ZP6A 1R8QA 1HE8B 1KSJA 4HZUB 5FPYA 1KGDA 2GXQA 4MYUA 2ZRJA 2FV8A 2XTMA 1PLLA 4A36A 1FOEB 3EXAA 4JLJA 4MKHA 3THYA 3A1UA 3HDTA 2MMGA 1W36C 2W2TA 4PHGA 3TIFA 3H0KA 3A58B 4KVGA 4LGMA 4IOMA 4Q7KA 2ZJ5A 2W83A 3BD9A 1KAGA 3PCRB 1MO5A 3OAAA 4PHTA 1U90A 1KJYA 2IYWA 2NZ8A 1Z0DA 3VR5A 2A5YB 1Z0IA 2IC5A 4G1UC 3U4QB 1N3BA 4B3CA 1LY1A 1OH7A 4HB3A 1E2GA 4UNQA 4B73A 3IO5A 1ZYUA 2WJJA 3RSLA 2NG1A 2VQSA 4PFSA 1WRBA 1T3HA 1TEVA 2FMXA 2JATA 5L3QA 2UZ3A 1EK0A 3LLUA 3U44B 3U3MA 1II8B 3T1QA 4PO9A 4A0FA 1WBBA 1VYTA 1LNZA 4TYQA 4LPKA 2QROA 2TMKA 4QHSA 1B0UA 1UKZA 4ON9A 1G16A 4RCYA 4EPXA 2CEAA 2P5TB 4K81B 2HYDA 3RRYA 5HCNA 1GL6A 2ZR9A 2RGAA 3BAFA 4JT4A 1NMXA 2ZRNA 4GPTA 5JHHB 5C4GB 1GG2A 5FOXA 1W2HA 3X1ZA 2J87A 1T5IA 4GL2A 1YJ5A 2GEUA 3K9GA 2N1BA 1E1RD 1ZD9A 3GJ4A 3LWNA 5EXSA 4DLXA 2IL1A 4IEIA 2PZGA 2OT3B 4P0TA 1XPOA 1XEFA 2WWGA 3TSZA 1W1WA 1DPFA 1S0UA 1OIXA 2QMEA 2J5XA 3F8TA 3T35A 1BIFA 1F6BA 4WVFA 2PMKA 1Q1EA 4JLAA 1ZNYA 3WNBA 5IT5A 1RFLA 2RH5A 3PVSA 1W7AA 4GMDA 1IN7A 4XOIA 4DCNA 4KFRA 2BC9A 2DY1A 4MH0R 2GDJA 4AG5A 3EWSA 2JJ2A 3HPQA 3CPEA 2F1HA 2V6JA 4KLZA 2ZRMA 4DLUA 1ZUHA 1AKEA 3QE0A 4MGKR 5DYGA 5GJVC 5AUNB 3Q8XB 3OFND 5AWFC 2ZYVX 3K0FB 5FUYA 1DS6A 1UJ2A 1IN8A 1CU1A 4XTCS 1E2MA 1UF9A 4CEJA 2YOGA 4C3ZA 4ESHA 1X8JA 2MSDB 4XIGS 2VF7A 3KXIA 5TXGA 2OFOA 1U9IA 3ZZTA 2GRJA 2QTFA 4ZI3A 5IRCD 1M7BA 1KK3A 3U3OA 3ZJYA 4GSYA 1BH2A 3KKPA 1ZM7A 2O8CB 1Z28A 3T06B 1ZAKA 3BOSA 3K0AB 5C2JB 5E7MA 2OEPA 2FPKA 2KB0A 4HAUA 2QI9C 1HQCA 2X2EA 1HUQA 2WPDA 3Q9LA 2GTPA 3KJIA 3SDZA 3IIJA 4TL6A 2ZE5A 2ZYWX 4ILEA 5CJ2A 4C2TA 2QTHA 4PZLA 1Q1QA 3EG5A 4TSFA 3C15C 5F9HA 1KO5A 2QQ0A 4A0GA 1OV4A 5D3MA 2ZI4A 3QKSA 3QVUA 4Q4LA 3VR3A 1Z6GA 2P65A 2GJKA 2OAQ1 2RGNA 4A0HA 2XSZD 3U2QA 4CZ2A 4F7WA 4RZ2A 3SJCA 3DVLA 1U0JA 5FOUA 1J90A 3L0IB 5JFGA 1CJKC 5EE9A 3VQTA 3K70C 4MRVA 1Z2CA 3AF0A 3PR1A 4DC9A 1COWA 2KBEA 1UAAA 2Z5FA 3LRPA 2B21A 1YR8A 4ZCIA 5KPJA 5KDOA 3W6PA 4GP7A 5KDDA 3H2YA 3W8RA 2DFNA 1U98A 4MRPA 5LD2B 1BOFA 1X86B 2PT7A 3GJ7A 3P4YA 4BFSA 2BDTA 2BMJA 2VSFA 4XWKA 3SHWA 1FQJA 1ODFA 3OZXA 4JJKA 3R8FA 4NYIR 4EFLA 1UBGA 2O5VA 1ZC3A 1JALA 3WP1B 1XTQA 4Q1AA 2ZVPX 3EX7C 1RKBA 1QHHA 1XD2A 2OCAA 4JJZA 4KSBA 4ERNA 2ZSBA 4QBGB 1TMKA 4UXJA 4X8HA 3VFDA 1CRQA 4NCHA 1P2TA 2BBTA 1DG1G 3U7EB 4M1MA 4YMTA 3R9WA 3PXGA 1KOFA 1T6NA 4XWAA 3KJGA 1UEJA 1W44A 5FTJA 2GBLA 1MH1A 3A37A 2R6AA 2C03A 4LUCA 2V54A 1Z0JA 3SE0A 2GXAA 4NTZA 1AJEA 3WHKA 1M6NA 2OILA 1E69A 5TARA 3RRMA 3SNHA 4ACAA 3GEHA 1A2KC 1W36D 2A2ZA 1N5JA 1NKTA 4HI0E 3K09A 1AGPA 4LBYA 4N0DA 4KBGA 1EESA 2W0SA 3OF5A 3ZLJA 1XF9A 1YR6A 2HV8A 3B1ZA 1OJLA 4E09A 3KKMA 2EVWX 5C18A 3X2SA 5LB4A 2HEIA 4Q1FA 1ZINA 3Q5EA 1AKYA 5FI1B 5J4VA 2QNRA 1XTSA 5FPTA 4RZXA 3IBGA 3MRSA 1GKYA 3S1AB 1MRSA 4LBZA 1VHTA 4P4TA 5SZKB 4XVRA 4KBFA 3QEOA 1M2OB 1KO8A 4EQ6B 3L0PA 1P5ZB 1YZLA 3I8XA 1RRGA 4IDHA 1E4VA 4YXWA 5JSZB 2XOKA 3FKSD 1N5LA 2YV5A 1P2SA 3DZ8A 4OQXA 3AKYA 3BGWA 4P3YA 2RMKA 3EPLA 3LD9A 4JYCA 1RPZA 1IM2A 1JPJA 2P3SA 2P67A 1XTRA 4PPGA 2VPPA 1ELOA 2J0UA 3PEVA 1VG8A 1MABA 2WOOA 3K53A 5FOSA 4S2EA 4EJSA 3U6BA 1XMVA 1JXOA 1VPLA 3BFKA 4PC2A 2NQ2C 2HXSA 5C4MA 1G8YA 2FFBA 3CF0A 3BC1A 5J5CA 5BN4A 1N5KA 2J0QA 4QBIA 1Y3AA 3GPLA 4AWXA 2XTZA 4M22A 1NJFA 2C5LA 1L4YA 4NYJR 1NMYA 3ZVMA 4KCGA 4M1YA 3IBYA 1MRNA 3AM1A 2UVQA 1KMHA 4XJXA 1WA5A 4WBSA 3KQLA 4A15A 2G1KA 4RZUA 3RC3A 4GDFA 2QL6A 3BWDD 3LAWA 1CP2A 4N0EA 5IHPA 4PC1A 2FX3A 4A8JB 3J81k 4QG7A 4QBHA 3FMPB 4OI1A 1SXJD 2ZITA 4ZIRB 1HQYE 1M7GA 2IEYA 2ZYUX 3U7FB 3QJYA 4BLTA 4L9SA 4L16A 3QKUA 4Q66C 2IYZA 3CRMA 1GNQA 2KBFA 4RD3A 4FW9A 1SVSA 4PR0A 2YC4C 1II0A 2CHQA 1OYYA 2VP2A 3OIVA 3GLGB 3A1TA 2F3RA 1VCOA 2WMOB 4RFSB 5UKDA 1G8PA 1G5RA 4BFYA 4KO8A 4ZCLA 4BFTA 2XNSA 3AP3A 3K09C 1QBKC 3BORA 5F3WB 1JQJC 4TTQA 1NN0A 4Z8XA 2C98A 1QHNA 2Q0HA 3G82C 5IF9A 1KO7A 3ICEA 1T0HB 2HCJB 5DLQC 2ZUCA 1XEWY 3SFVA 2PBRA 2DYKA 5H68A 4FCVA 4M1TA 2I1QA 4BLPA 3OIWA 1GL9B 2V7QD 1KI2A 1F2UA 3DDCA 4QFMA 2O8EB 1SVIA 3SI7A 2W6JD 3U6KA 1KZ7B 1E2DA 2ZU0C 4B48A 1AIPA 4JLVA 1E96A 3NKVA 2DWOA 2IA5A 1WP9A 4OYHA 1FTNA 1E99A 2QMUA 2J7PA 2GK7A 1AQYA 2V9PA 1W2GA 4M2LA 4LYJA 4B47A 3L82B 4R98A 3NBFA 2VO1A 3ZDQA 1GP2A 4ZKDA 2J0SA 1S9DA 2FPMA 2WSSD 3B78A 3ZYCA 2IXGA 2CHGA 2FJUA 4DUGA 3KQNA 1LF5A 1YE8A 1ZIOA 2XXAB 2AR7A 1I4LD 5F2EA 1KK0A 2EYUA 1ZU4A 4CT4B 4AIIA 4LC0A 1II9A 4OK5A 5G40A 4B71A 1E0SA 1EFUA 1MT0A 4DDUA 2RGCA 3E5HA 1E9CA 1QDEA 3MAAC 2IYYA 4LC1A 2QBYA 5F98A 1G18A 5KSPA 4F38A 4BE7B 1US8B 3M0EA 2QT0A 3CPHA 4BZPA 2BM1A 3HU2A 4NYMQ 3DM5A 4EFMA 3DPUA 5TY0A 2XITA 4PHHA 2C78A 3CBQA 4DLVA 4A8JC 1CLUA 2LCFA 3OEHD 4IOKA 4QM6A 3KTAB 3LFUA 3LDAA 3D6TB 4DT1A 1D9XA 2ZRKA 2OCBA 4LV8B 2BCGY 3SYKA 2JLRA 4A2WA 5M04A 3CB4A 1XXHB 3AV0B 3SYLA 1KO4A 3NC0C 3VNUA 1F5NA 1YRAA 4RD6A 2AHOA 1QVRA 2G0NA 2GNOA 2IYUA 2XJ9A 3JZAA 3L0OA 2H57A 4QNRA 2JLZA 3CIOA 4BASA 2D2EA 5IDVA 2QP9X 5FTNA 1HT1E 3A4LA 3T5DA 3RRZA 5JHGB 4OQFA 2IS1A 1XBTA 1K5GA 4DLWA 5DGXA 3B6EA 4LJ7A 4DVGA 2BKUA 2QAGA 3C5HA 1VCNA 5FOTA 2FH5B 4QOSA 5DO9A 4RVCA 1CRPA 2Q9BA 2BMFA 2IYVA 5HR5A 1E9DA 1F2TA 1OT3A 1IXRC 1KJZA 2V8OA 3I73A 4TQ9A 2IF2A 1TF2A 1H8HD 1P61B 4CEIB 2HT6A 3TNFA 5L3VA 3U5ZB 2H18A 3KX2A 2ZSDA 4DEXA 1E1QD 5HCIA 3PFIA 3LY5A 4US1R 4MUAA 2O0JA 1XP8A 2AFIE 3BK7A 1U8YA 3EC2A 2HLDD 3NG1A 2VP4A 4OI0A 1ZM3A 2ECKA 4NYMR 5BYJA 1YHNA 1YZTA 2IHBA 1KSFX 1YU9A 2WWFA 4HAYA 4U00A 1R7RA 2VRWA 4RKFA 3W5IA 3K0CA 1KMQA 4D0LB 2QAJA 3BS4A 3V4FA 2ZQ5A 2OFWA 1N6IA 1U0LA 4IDNA 2NPIA 2VIIA 1IAQA 1G17A 2IUTA 4XD7D 4V03A 1NSFA 1KI6A 1Z08A 4HAVA 5P21A 3Q7PA 3WMFA 3A36A 2F9MA 1H8EA 2GEDA 3GLHB 2JLYA 1ZD1A 4GOKA 2WJGA 1I4DD 4I1UA 1GRNA 1IQPA 2CBZA 2BCJQ 4YONB 3I92A 4B35A 2FGKA 3AVPA 4TT3D 3IO3A 2NMVA 1LF0A 1FL9A 2QM7A 2Z43A 3UWKA 3WBJA 4AK9A 1NBMD 2V6IA 5EZ6B 3UANA 2CCJA 4D0NA 1DO0A 3THWB 4QXAA 4IEEA 5DYIA 2JA1A 3GCGA 4FXPA 1NLFA 2X77A 3A4MA 1T4GA 3ONWA 2MMCA 4JVNA 2XNDA 2FSIA 1R10A 1JAIA 2BM0A 1LS1A 3K0CC 3MJHA 4W7SA 4A4DA 4FWTA 3LX5A 4M0LA 4M9QA 4BFXA 3ADDA 4UJ3A 2B7CA 1ESNA 1P3JA 3GD7A 4W9MC 4GZMA 3QY0A 4FN5A 4W5JA 4JVLA 1M34E 3DZDA 4HDOB 3T5GA 1NL3A 2VHJA 2WV9A 4A1FA 4DLSA 1NVVR 5AJYA 4BRUA 1NG9A 2C04A 2P2LA 1XNJA 1OYWA 3W8NA 721PA 1U94A 1E6CA 4M21A 4V0LA 4HYYA 4FWIB 1JJ7A 4PC6A 5TMPA 2QN6A 2ANCA 3LW8A 1CKEA 3F0TA 4HLUA 4MRSA 1E9EA 3QQ5A 4FCTA 4TN1A 5KTYA 2IYTA 4CEHA 4M8NE 3TAUA 4ZI2A 2GZHA 3P1JA 2WTUA 1J99A 1QHGA 2HYIC 3LBHA 1OF1A 3CZPA 3DOEA 2QE7A 1U8ZA 1ETUA 4NYJQ 1FUUA 3TH5A 5J4HA 4OQLA 3I5XA 2O8FB 3PEWA 1OFTA 4IOLA 1N2CE 2LKCA 4JL5A 1NLYA 3SR0A 1E9FA 1VG0B 1FTSA 1DADA 3JZMA 521PA 1T9HA 3U3RA 3FHOA 4YMUA 3TVDA 3EPHA 2J41A 1WDTA 1XMIA 3QKRA 1VG1A 3EA5A 3KL4A 1E94E 4B2LA 4ZDKA 2QT1A 2FNAA 3ZH9B 2QMOA 3ADCA 1NBMA 3G5UA 2V55B 1T8UA 4URUR 4TMKA 4JKIA 4AYTA 3VU9B 2CJWA 2G1JA 2Q3MA 2R6DA 1NY5A 1M1YE 1O87A 3AQ4A 3OEEA 3VNVA 3A4NA 1N6LA 5JI3E 2XTNA 4LCBA 4OJKA 2GHIA 1EG7A 1KI3A 2IYRA 1Z6TA 2CLSA 3DMNA 4UJ5A 5EE5B 5HPYB 4MITA 1A5TA 2XZPA 2ERXA 2O0HA 5KOYA 1EFHA 3DHWC 4WW0A 4EPVA 1FX0A 2ZRIA 4NDZA 1JR6A 5KHOC 5B57C 4LZZA 4AI6A 1IBRA 3TMKA 2DFTA 1A82A 1M8PA 4X8OA 3CF6R 3LW7A 2W6ID 1RRPA 4TYWA 4OHXA 2CXXA 4Q9LA 3TGPA 1A4RA 4OHYA 2ZJAA 3IIKA 3PIRA 4EKDA 2V3CC 3TQCA 1WCV1 1ZJ6A 2RKOA 3SQXA 3VHXA 1TNDA 4PO8A 4Q9KA 2W58A 1E1RA 3DO6A 3GMTA 2GWHA 3KQKA 4DWJA 3AVXA 2FFAA 2G9NA 2ZE8A 4LHWA 4GFDA 3RYTC 5JMTA 1XU4A 2BMDA 2HJGA 2V7QA 4IXNA 2ZXUA 2PLRA 1PUJA 5JBQA 2WWXA 4HAWA 2ZANA 2JAQA 1E0AA 4YLGA 1SXJB 1GNRA 2ZRCA 1C4OA 3CO5A 3VKHA 1WF3A 4EFNA 5GVRA 4B32A 2FPLA 4TWZA 1Z2AA 5B58C 4IHQA 2G3YA 1S4QA 5J40A 2AWOA 4AD8A 4QGHA 4NCJA 2G6BA 4DSNA 4JVMA 1RYHA 4HLDA 4XVQA 2ZUDA 3RNLA 1TF5A 5KYKA 1P62B 4RJLA 1FUKA 4DSUA 1NN5A 1E9AA 1Q3HA 2J7KA 2WWWA 1LW7A 4AKEA 3BIFA 3AVTA 3FFAA 3CLVA 1OXXK 3IKJA 2Y8EA 1CJUC 2GF9A 3AGPA 3DKVA 2G0TA 3R20A 2JDIA 3FDIA 4DBLC 1Q22A 4CW7A 4C0LA 2GJ9A 4L4UA 5KU1A 4DB2A 2AKAB 3SQWA 2QRZA 3SU8A 2ZRBA 4LYFA 4F4JA 2YWGA 1YZGA 3I72A 3VX3A 2OBNA 1QHIA 3BH7A 3HU3A 3U3JA 4R71A 1IN4A 2JLSA 2VH5R 1BMFA 3TR0A 2AXPA 2V1UA 2IWRA 4QC2A 2KWIA 4AURA 1VCIA 1T5LA 1IJEA 2B8WA 2QUZA 2ZU6A 4WOPA 1QHYA 4LY6A 4M53A 3EW9A 2YVUA 5SZHB 3VR1A 3QXXA 2ZE6A 2RCNA 2FG5A 3TJZA 2OBMA 1JR3A 2W00A 3HJNA 2NZJA 1YR9A 4L5BA 5HTKA 5KPDA 2WSMA 2NPFA 1U81A 1GRQA 1ZD8A 3EZ2A 1QRAA 3NEJA 4GOJA 4LPSA 4RKEA 2GA8A 1T3LA 4B76A 5DIFA 4DLRA 3A1VA 2JCSA 2IUUA 2QORA 4WXRA 1XD8A 4OHVA 5FTKA 4UKDA 5HZKA 4A82A 4AYXA 1GUAA 1GFIA 4URXR 4XVUA 2IYLD 3L2OB 3QIAA 4Z1MD 4ARZA 1BS1A 4KI0A 1VIYA 1ZNXA 3QG1A 1OB2A 3CRQA 1XDBA 4A2PA 2D2FA 4M1SA 2OHFA 1VIAA 3ZQJA 4WAUA 1E9RA 4TTRA 4BLRA 4MDFA 3L0SA 3RS5A 3B1VA 3P26A 2GXUA 4U5XA 5FR1A 2W2VA 3VMFA 1W0KD 4I1VA 5CYOA 3GLIB 2FN4A 2WIAA 1XCPA 1RVDA 2QPTA 1DAGA 2Q9CA 2Q9AA 1W4RA 4W5WA 3K70B 4Q4AB 2QGNA 3R8CA 4UNPA 5CITA 5G53C 3GLFA 3OHMA 2PL3A 4KV9A 4Z54A 1HEIA 1Q21A 2AL7A 3GJ3A 3TW4A 3X1WA 4EPYA 3FHTA 4EPRA 1UKEA 4IKEA 1TUIA 3CWQA 3LNCA 4OL0A 3A1SA 1JAHA 4H1UA 1XEXA 5FTMA 2YINC 5TB5A 3OFNA 1CBUA 1RJ9B 4RZ3A 5FBWB 4N1AA 1L2TA 2B92A 4YDHB 4LRWA 1MO4A 4LJ8A 5EQTA 2AFHE 5TVKA 4C0QC 5DN6A 1EWRA 5HKKD 3ECCA 2A30A 4A6XA 4Q7JB 5G3ZA 1E2KA 3PQCA 3TUJC 3KUCA 5E95A 5IK2A 1SVMA 4PAQA 3AVUA 3C5CA 3O8BA 4GBMA 1EXMA 4GOXA 1X6VA 4LJ9A 4NONA 1YQTA 3WRXC 1ZC4A 2IBMA 2ONKA 4EJSC 4ZV4A 2VHCA 3W90A 2XAUA 4JLOA 2GKSA 1R2QA 1T0JB 4C0SA 5AUOB 5ELXA 3C16C 3LXRA 3UG6A 1SXJE 4UXIA 1XTJA 1GL7A 5CM9C 3H84A 5HZHA 3AB3A 3HYRA 2Z4RA 1IY1A 4D81A 1R0ZA 2E87A 2YWEA 3RSOA 5JRZA 3AEZA 1UBCA 1GITA 4MGZR 3W6NA 3QXHA 1E2PA 1COWD 1S2MA 5FPHA 2ZS8A 1C9KA 2JLVA 3QOFA 221PA 3B2EA 2VP0A 4D4KA 4Z1MA 3UK6A 4DEYA 1P73A 4TLAA 1FPMA 1EFCA 1CR1A 3PUWA 5GVSA 4N3NA 3BRWD 1QHSA 3SN6A 2FZ4A 4KXFB 4MDEA 3JVUA 5FL7D 2J3EA 1Z22A 2R44A 1JI0A 1GIAA 1KI4A 2VLIA 4GRAA 1A7JA 3VR6A 1PLJA 5E4FA 5DI3A 3OIUA 2VBCA 2ZVQX 3KZ1E 2CNWD 3DEFA 3UG7A 4P4SB 3MWLA 4TMTA 1F3OA 2K5UA 1R5BA 2IXFA 2JEOA 1K8RA 1Q3TA 3EWAA 1GDDA 3IUYA 5FR2A 2D4HA 2QP4A 1PVOA 4DDWA 4Q4JB 1YZNA 1J8MF 3IQXA 4E07A 5FTLA 1XMSA 4IDPA 3ZD6A 3VKGA 3TSWA 2A5GA 2YOFA 2GBLC 5A0FA 3NVAA 4Q4HA 4XWOA 4ZDIA 2WWYA 3F3YA 3REFA 2QPOA 1ONBA 4Z51A 4PX9A 3SJAA 3PEUA 2QRNA 3QF4B 3WHLA 2FSFA 2GCOB 4BFWA 5JLJA 2P6RA 4P33A 1RE0A 1D9ZA 2HXYA 4FMDB 4D26A 4A92A 5KUTA 1TU4A 4MRRA 1SHKA 2PLFA 4F4IA 4ZCMA 4PSVA 5JEEA 1UPTA 2OLKA 2RGEA 2F43B 1G8HA 1TEXA 3WYFA 1CJMA 2C2HA 5KSYA 2O8BA 4JS0A 1N6HA 3CZQA 4LYAA 4BLOA 3G0HA 3R7WA 3GFTA 1NP6A 3CRW1 5FBRB 3FMFA 3GJXC 1HE1C 3KXLA 3QUSA 1GRRA 4G5GA 5DN6D 1IHUA 3AKDA 3RS2A 3RRNA 2QQEA 3B1WA 3UPUA 2ASEA 2AD5A 3TRFA 2GEVA 3PUYA 3FMOB 5KNDA 3CRVA 4DSTA 2GZDA 5L3SA 4LWZA 3THXB 4HLUC 2RGXA 3DL0A 3EAQA 1X1SA 4QJ5A 5GJBA 3GJ0A 2JJ8A 2ZEJA 3R9IA 3SBEA 3EPJA 3X1DA 4MUBA 3AVVA 2BIFA 1AGRA 2ZAOA 2QP3A 4D25A 1NIJA 3ZZ0A 4BZQA 4US2R 1E2QA 2ZR7A 2C8VA 2VF8A 3FOZA 4QGFA 3OESA 4R2IA
chains in the Genus database with same CATH superfamily
1AQUA 2VJMB 4QJ4A 4G0PA 1SCBA 3EY9A 1DAOA 2CWWA 3PYXA 5KVVA 3V4ZA 4NBNA 1HEYA 2B36A 3KZNA 1HDXA 1MOSA 1A04A 3VM6A 1PK7A 5K2OA 1TZJA 2EWVA 5ITVA 3O03A 3I01A 3A2LA 3AFNA 2RAFA 4US0R 5KTNA 5CHEA 4M0EA 2ONZA 3MLEA 3DOCA 5DFAA 2BOVA 1BXGA 3MMPA 3PRKE 5BWMA 4DSOA 5HTOA 1T26A 3OUZA 1OHHD 3BAZA 1N4DA 4UM9B 5TMPA 1EIWA 1SO8A 4Q19A 1EFTA 1RVV1 4WQMA 4HDKA 4BKQA 3GPDG 1G5HA 3HZRA 4W5HA 5IP5A 5AVSA 1UKBA 3Q3HA 1HM5A 16PKA 2XX3A 2ZBFA 4KH1A 4BB0A 1YTLA 1H6DA 4QLOA 6NULA 3HBAA 5B5SA 4EYKA 2HQSA 3NNDA 4Y2XA 3DWGA 2QVCA 4NL4H 4MV3A 5KHAA 2X42A 1X9HA 2H07A 3IT0A 4OMFG 3MWEB 3TE6A 4CPDA 5CM8B 1PR5A 3ZVRA 5KYYB 1NVBA 1HSZA 4PQEA 4YAOA 1NTRA 5DGHA 1NV8A 5BW6B 4HUQA 4IIBA 4ZZ3A 1YFLA 3H2SA 3GRRA 1ZIDA 2J0EA 5A62A 4BNIA 5I9MA 5TPZA 1FTGA 3K6KA 3T8YA 1FFDA 3FTQA 4DY6A 4E46A 1A2BA 5JD3A 4ALKA 5BWOA 3H0EA 5EWLA 2RKBA 3B13B 1BMDA 2NAPA 2XZDA 4L5AA 4C0BA 1DTWA 2VRBA 5HZMA 4FUTA 4GDMA 4TMXA 4G1BA 2ZI6A 1WB9A 2IUSA 5CXUA 2Q3HA 4K28A 4Q9IA 3RS3A 4DMKA 4FB5A 3E3LA 3CXUA 1R00A 1IM8A 4WOCA 4E5DA 1IC6A 4LIPD 4H59A 1SOVA 3OT1B 4B7ZA 1KPIA 1H1LA 2WM3A 3PXDA 4F4CA 4JYMA 4REMA 3MIZA 2VXCA 1GEEA 1G0OA 1DUVG 1X92A 4Z0HO 1G21E 4EAQA 2XGMA 1REQA 1W0CA 1XCLA 3QNUA 4U8HA 4CMHA 4KJZA 1J0AA 1FLNA 1YZUA 2J31A 1YIAA 3ITKA 3N53A 4ZKEA 4Z4QA 2ZWMA 3WYGA 4WESA 2PJUA 3FPCA 3ZX4A 3U4QA 3CRRA 1KH2A 2CV0A 5BSFA 2UZ0A 4PVCA 2X1VA 3F6PA 1XPRA 1HV8A 3H83A 3FNIA 5E6SA 1UPCA 3L8FA 2VA8A 3MTGA 1DO2A 2IS4A 3NGMA 4Q3OA 1OX4A 3H9QA 3MB8A 1U5AA 3MGAA 3LUBA 4HWTA 3T7DA 2XT0A 3TSCA 2REBA 3EZFA 4KO4S 5IDWA 1EJBA 1NVWQ 1SRRA 1RWQA 3A06A 4G0ZA 2HWWA 2ZUUA 5TV2A 3WLRA 2BI7A 3HN2A 3U44A 3H1BA 1CVRA 3TF5A 1JIIA 1G20E 2Z95A 5M5BA 2PEZA 3H7IA 3I2FA 3EXG2 3HP1A 4URZR 1GTRA 2WD7A 3OX2A 2I3GA 1TADA 1GKUB 3QPUA 3FOAA 4LJ5A 4J3JA 1GG9A 1WABA 4MW0A 5HOEA 1ODSA 2B0JA 2VT2A 5KTRA 5GM1A 3HB4X 1M8JA 1GNPA 5IMSA 2Y3IA 3HVKA 4LDJA 5FBQB 1P74A 3L18A 4RH1A 1UDCA 3N07A 2XUHA 4R5MA 2QXTA 3UV6A 1G3MA 2BGIA 2NGRA 2B1QA 3KPWA 4IDCA 2FQXA 4LHVA 4RTQA 1G6HA 2DHRA 2Y1DA 4LZPA 5D3QA 2AI1A 5FFMA 1JT9A 2E55A 3NDPA 1VM6A 2Z6VA 1AHPA 2Q28A 1JKJA 1T24A 2AG0A 3WDSA 1RAAA 1EQUA 1TQ8A 1MDBA 2RH4A 3EVDA 3MBOA 3NBYC 2QTCA 3EXHB 3MT7A 4RXMA 1WG8A 2AQKA 3G5AA 3MWKA 4LZNA 4RF5A 2IKSA 1AQ6A 4R7GA 2IPAB 3CVJA 3EPPA 3FUVA 2CVPA 4KPGA 4RYDA 3VVMA 3ICCA 2W6IA 2ZI3A 3UTDA 1NGSA 5DBEX 3RSZA 3D8SA 4Z2AA 1NA5A 4EGFA 1EUDB 1ATIA 2H4ZA 1V5EA 2QZ4A 3KOOA 3LP5A 2P6NA 3V1UA 2J0VA 2LWIA 5H7XA 3WGQA 3ZHXA 4ICIA 5AI8A 3TL2A 1JLHA 5C31A 3G79A 1RI4A 3CM0A 1K97A 3PXBA 4UTOA 3VOAA 1ECCA 5EN4A 4HO1X 2II6A 5JARA 1YIOA 2ZAIA 5KS2A 5K0NA 4QREA 1N0WA 3PC8A 1PWHA 4ZAWA 3W3AH 4RLHA 4ZZ0A 5F23A 2PD6A 1ZGCA 3FGZA 5BN1A 1SUWA 3GFPA 1TX4B 5A03A 1PFWA 1E2JA 1Q91A 2VDNB 2Z58A 4LKOA 4RD1A 3CNBA 3U3ZA 1NJGA 3CUKA 1SBQA 4I5IA 2QMHA 1IZ0A 4ARAA 1P4SA 3LT0A 2Q1TA 2FPWA 3L7KA 3PFBA 4G1CA 4CIDA 1SVOA 1DNPA 1O9GA 3FJYA 2VVTA 3HFJA 1A9PA 2RAPA 3DONA 4DR4B 1GZ7A 4PIVA 3PS9A 4J91A 4BEJA 4WH0A 1PG0A 4WWHA 4YRRA 3HVHA 1N2IA 3C6KA 4MB2A 3LCVB 3VHQA 3A1WA 3HGMA 4IXWA 5IAEA 4B6OA 1WSDA 3P0JA 4ZAGA 4ND8B 5K99A 1G7SA 3IR7A 4RH3A 1QO9A 1RKXA 2VH1A 3UXYA 2RGDA 4NU0A 4DIDA 1CS4C 1OXTA 4X93A 2C3OA 1XU7A 4J0FA 1CFZA 1ZGJA 1DC8A 4N3CA 4MVCA 1ZM2A 5WRFA 2GVZC 1D2CA 3W7VA 1OFGA 2J5RA 4BRSA 1DP4A 3CMCO 2IHYA 3LUHA 2W6JA 3O8QA 3P2EA 1XR3A 3AKCA 3UHOA 4GKKB 3JXEA 1XX6A 1WB4A 5F1OA 1P60A 2C4HA 5A7HA 4A2QA 2H11A 5K01A 3BQMB 4ZEOA 1W5TA 4BVKA 4BMYA 3C6MA 1P18A 4CDGA 1Q7CA 2P78A 5KYNA 3MN1A 1KJIA 3F67A 4R2KA 5DHPA 2NSYA 4TKVA 2V97A 3L8GA 4OXRA 3ZE9A 4S05A 1GPAA 1AVTA 3QV1A 4AB1A 3G89A 4B3SB 5DGIA 4P7JA 3JD0A 2OXIA 1GAXA 1JBEA 2BSAA 3UCEA 1JKFA 4N8EA 3GHYA 1JEQB 4UBOA 1FUEA 2BLNA 3IALA 3WYBA 3PHCA 1JQAA 3LQRA 2GZ3A 4S1NA 3FIJA 3W34A 1LXCA 2PS3A 2GO1A 2H54A 1KR2A 1F1BA 1RKUA 3QMWA 4ENVA 4MCJA 1ADGA 4HFRA 4LAFA 2YZ2A 5MN4A 4GR4A 3H1TA 4E5PA 3I6BA 2R47A 3DT8A 4X1YA 3TTSA 1YVEI 3NHSA 2Z09A 4NJMB 4Q7LA 1YO6A 3X44A 3SF0A 5H9WA 5JZSA 1XTTA 3P9NA 3PL1A 2WSYB 2V03A 4OHBA 4DW8A 3AETB 3KE8A 5EXTA 4X1IB 4BNTA 2CMGA 3U09A 4GGMX 1O08A 1QHHB 1XD2B 5DOZA 3GGOA 3MMZA 1TQ4A 3QEAZ 2OZKA 2XJ4A 1ULTA 2W4MA 1PZXA 2KW5A 2HU8A 3ANSA 5CVUA 3ROMA 4N65A 4G1EB 5E9WA 1L8AA 4H1TA 3OQMA 1C9NA 3SHTA 2YWDA 3EOAI 2ODEA 2A67A 1SCUA 2AWNA 3EIUA 5AOBA 3N2IA 4D96A 5JS6A 2AZMA 1BXKA 2HJRA 3DTNA 4BVLA 1H0KA 2XRZA 5ED4A 4C9BA 3JYOA 4D6PA 4IZ6A 4Q24A 1BCSB 1F2DA 1FP6A 2Z2IA 1Y4ZA 1U0GA 3FTDA 4G5OA 4R9UC 1R3UA 3DVSX 1NQOA 2QM3A 5HIJA 3VHRA 2JJ2D 1S4MA 1V5GA 2AG5A 2DU8A 4N3BA 3GFQA 5A4MS 3HYCA 1JJFA 1YE5A 3BTUA 3E9QA 1VXOA 5J58A 4B87A 3OPNA 1J9ZA 4RF3A 5DT9A 2HB6A 1U4NA 2L69A 4JOSA 3R40A 1KSHA 1TC1A 3JCZA 4GGPA 1I7PA 1OI3A 5ARDA 5IEJA 3R9XA 1TIKA 5EJEA 5K05A 5IK2D 2XB9A 3LYUA 1V3TA 1NZDA 2ZI7A 1KEZA 3DMPA 1MOZA 2B3DA 2HIMA 2OHHA 3V7UA 2H7VA 5LOVF 5ICFA 2DSNA 1CUDA 4OBWA 5E1DA 2XYHA 1PNQA 2R9VA 2OQRA 4PC3A 4JKYA 3ZIAA 2K7FA 3W5VA 4ZTZB 4DQKA 1ADYA 1CY6A 4G84A 4OOEA 4KXLA 2WNHA 4B6FA 1WZNA 3OKCA 1M2OA 3IDFA 4EQ6A 4YRBA 4AJJA 5AVTA 3K9FC 3QP9A 3UMYA 2I66A 2XYRA 3C3PA 5EZYA 3WGJA 3ZHVA 1V8OA 4MW4A 4QO7A 1JXMA 5JSZA 1UT8A 1YQWA 3OZTA 5BQ5A 4R8RA 1PD0A 4GI5A 3QVOA 3GLQA 1ZMRA 2BJWA 2QD3A 3DKPA 4BNFA 1THMA 3O4VA 4TQUS 4KDRA 1TW2A 4ZVVA 4YP5A 2GM4A 3I4FA 4G9GA 4DABA 1S3SA 2FHSA 2VNHA 3W1EA 4AN1A 4BLSA 4JY7A 1LJUA 3WMGA 4IJQA 2Z57A 1E6UA 3GLIE 4IS2A 3NCHA 4TS4A 5FEMA 5K45A 3BT7A 3TS1A 1T2UA 2J0UB 2Q1XA 1MABB 2PS1A 2AZDA 4EJSB 1O5IA 1XKXA 5L6MB 1JDTA 1TTTA 5J47A 1ORRA 3L8DA 1Z7GA 1C8LA 2BM9A 1LNSA 1V4BA 4LF9B 4TZ0A 2CC2A 5EIOA 4GX0A 1EVZA 4HPXB 4L4YA 1I5EA 3EIHA 5K8VA 3FCEA 4D3FA 2YJ3A 4FUQA 3CNOA 1L5SA 5KOIA 4KHZA 3WL4A 3GCZA 4FDAA 4PNEA 3NWJA 2Z98A 2FLVA 1TJNA 1T5SA 3I1FA 1FXSA 3R4CA 4O4JA 3ZD7A 1P7CA 1SD5A 1DELA 5FUMA 4DUZB 3EIOA 1H3NA 1MIOB 2YXLA 3F6BX 1O8CA 3D6AA 1EX7A 3QBDA 3WLQA 2F3TA 5B6JA 2G08A 2HADA 2WB4A 3UFXB 5BT8A 1WU7A 3IEPA 2DTDA 6YASA 3I9NA 1T5HX 3O74A 1BKDR 2RGBA 4E30A 3SAJA 5CFRA 2WIKA 3D59A 3BB3A 2FP3A 4Q3NA 4I1RA 2XDQA 2QHXA 3M4XA 4QDTA 2IEZA 1GA4A 2EFHB 4N9QA 1KY2A 1CUBA 2ZRPA 3PLNA 3O8RA 5JJIA 1T4CA 2ATIA 4DNFA 3PU6A 1UWKA 2DR3A 4QDKA 3NHFA 3RYFB 2IU4A 4M1WA 3WTCA 3A6FA 3DR5A 2Y27A 1W47A 3EE6A 3E9MA 2X9VA 5LQJA 3PX7A 2QNIA 2HN9A 4OQQA 4LDRA 2GJAA 5DF1A 5GP1A 2GYYA 2QAGC 2GN0A 2H31A 2NO1A 5ITZB 3GIWA 5I7VA 2IW3A 5TVGA 4ECAA 3B52X 1KJJA 4D2IA 3VSBA 4PLVA 5I9TA 4ARVA 1DQRA 2JNWA 2VS1A 3P27A 2DT5A 5FWNA 5KX5A 1XMOB 3B60A 4FIZA 3SNKA 4AC9A 1NU6A 3HXMA 1F0KA 3BIWA 4FDLA 4EITA 1OB5A 1F2UB 1P72A 1MHPA 1LVGA 2SHKA 5IN5A 1HLGA 4H9GA 1GA6A 2PUAA 2MR6A 4IJ5A 4FMDF 1VOTA 2Q6IA 4RM2A 2PEYA 3DGEC 1DT3A 1J0BA 5ALLA 2XMRA 4B2YA 4DIEA 3TBKA 3M6LA 1G3RA 1LI7A 1YI8A 1PX0A 2O9JA 1UMBA 3PWSA 4D8VA 2H1VA 3H4MA 4GR9A 5E7JA 1NKSA 3NASA 4HQ0A 5KTTA 5EXPA 3T0IA 2QRVA 2GT1A 3DAYA 3G13A 4RVDA 4IO1A 3UNXA 4BTEA 5BY2A 5KZMB 1WXXA 5KMGA 3X0DA 1JG1A 4BBAA 2NQTA 5IVIA 4TSRA 1YCGA 2O3UA 4IR7A 1K6IA 5KVAA 3WP0A 3EEFA 4PC7A 1MEEA 1O1YA 2EQBA 1Y1PA 1GAQA 1VBMA 3DFFA 3UJHA 4Q21A 4ERXA 1W85A 2ZYTX 3EVGA 3F7OA 4AXXA 4PU0A 4R1LA 5CJPA 2AN9A 4YX9A 3W8EA 3L8CA 1X1TA 4WZ6A 5A0TA 2J08A 4M86A 2VYFA 5IKMA 4CDNA 4EO7A 2G83A 1PQUA 1QH9A 3JYQA 3PE4A 4EGCB 4B8WA 3BGIA 2XIJA 3BRWA 5FBZA 4Q12A 2VJCA 3LRXA 1PLKA 2GPYA 3B85A 5JXHA 3DLHA 3U26A 2H1RA 1S7GA 5DK4A 3QPDA 1W0JD 1W87A 3LOPA 1Y9ZA 4UEQA 1WEHA 4DT1B 3PUZA 3MCTA 4RULA 2H85A 3KT3A 4LRSB 5E3JA 1ZS9A 1I51A 4D82A 3G7UA 3G0GA 4H4EA 3RT9A 2J3IA 4GE0A 1OKKD 4WZBE 2DR0A 4UU1A 1IZ7A 1N5DA 1S8AA 2H17A 3BBLA 2IY8A 3HB7A 5CH8A 1ZOSA 3ZXUB 1GM5A 2I55A 5AI9A 2PKRA 2P9CA 2V98A 1Z6PA 2C7VA 1RQLA 3HE3A 4GM1A 4W5OA 1JLSA 3L5OA 3TINA 1SXIA 3K9LA 2R6HA 1X80B 3ROEA 4PX2A 5B3LA 1QP7A 1R0SA 2RH8A 4PQFA 1DMSA 2PR2A 3PBKA 1XMXA 1P1CA 4BQFA 2HMVA 2KI5A 2G63A 2O5RA 1NJ2A 4LK2A 5EKSA 4D4MA 1T6BY 2VBFA 4KODA 3FNHA 1ODCA 3CJTA 1J8QA 1PDOA 3KOUA 4PCUA 4PPNA 4EEKA 2IS6A 1T4BA 3ELUA 1D7OA 4EX7A 1PZMA 1F2TB 1M0EA 4YMSA 4J4BA 5CVVA 3R5FA 2NNWB 2X8BA 4BMOB 5D85A 1PK9A 3COVA 4CETA 4BJ5A 1FU8A 3T3IA 3FA2A 5EP2A 3VAAA 4ZK2A 1DLJA 1VG9B 3H2KA 1CR2A 3HU5A 4OP2A 2P5SA 1OIWA 3O26A 3PA8A 4BVBA 1A9QA 4UNNA 1WKVA 3EASA 2GETA 1OFIA 1PFQA 5JYDA 3ZK7A 1RLTA 1K7CA 4DL9A 4JB2A 2H06A 1RRKA 1EI9A 2YRXA 4MMXB 4MQMA 4C30A 4C0HA 5TJ9A 4ZYWA 3WWDA 4GMGA 1GGHA 4QL3A 4TTSA 1AS3A 3KUKA 1GTJ1 1S89A 2GCPA 3IPXA 1O6FA 2BTQB 2ZJYA 4V3CA 4EI9A 3RYCB 3ZVLA 2QE7D 2OQVA 1RLIA 1X19A 1R0KA 3LT1A 2XBLA 4OFXA 3HR7A 3UUFA 1DIGA 2DUNA 5IXSA 3AI1A 2VDUE 1JPNA 4J16A 4O02B 4Z7QB 3JR3A 3P0HA 5BN3A 2JD1A 4JAVC 3GLHA 2I5PO 5KO2A 2MOKA 3UMJA 4ETWA 1RZRA 4JI7B 1VMKA 2BSQA 4R69A 3ZDFA 1EVYA 4P31A 4K9QA 1VPTA 3DHYA 3WRYC 2DBZA 1FEZA 1UC9A 1Z34A 2ST1A 1V2GA 3DV2A 5DK6A 1ZPDA 4DV1B 1OJ7A 3OBBA 3B82A 1X1RA 3QMPA 1SXPA 3MT8A 1I8TA 2Z4SA 3DZIA 4CYMA 1ICIA 3JWPA 3CPJB 3JQRA 1T6ZA 4N54A 4ZDWA 4DCSA 4ZJPA 3UHJA 3SFZA 2TS1A 4AZ0B 1O0BA 1CDDA 5K3CA 3JQFC 4Q1DA 4HDRA 2AZ4A 3UUGA 1Y1KE 2Q29A 4YAFA 4OHZA 3RR2A 5FCDA 3SXJA 2GM3A 1XWWA 2G71A 1WS6A 3HG7A 3MJVA 2FWPA 2CNOA 2JVIA 1PT9A 1FVOA 4ZJYA 3IDSA 3N7TA 1YK1A 5CB4A 1MQAA 5IF3A 4C4YA 3DOUA 2BWJA 1M0SA 3KBOA 2WYVA 5HEKA 2QAIA 3DFUA 1NW3A 2XUIA 2YQ5A 3RBAA 4Z6KA 1L5YA 1UK6A 5EIWA 1GZ4A 1MO6A 3PNOA 5BNWA 5HXAA 3PF9A 1GYRA 3KYCB 1ODJA 1Z0UA 2VHUA 1RRFA 1G63A 4IQFA 4XUCA 4RXUA 1WMDA 4GOND 5LU8A 3PG5A 1BS9A 3DM9B 2AQIA 1VCMA 4MV0A 3WMXA 3QLTA 4LF5B 1P19A 1X8LA 4RV9A 5KOYA 3GJTA 1TAGA 1TA4A 2VHQA 4S1OA 3V2HA 4IHJB 1A27A 3CW9A 4W5TA 5FLEX 4CF5A 1VFNA 1C8BA 4R3WA 2FZGA 4XIIA 4ZCQA 1JG2A 3AL3A 3X2FA 2WJ4A 2WILA 3ZWBA 3QV2A 4JJFA 6Q21A 1DEXA 3UXMA 2XRYA 5I01A 2J4FA 1JA1A 4PR3A 5KOJB 3NHBA 1E61A 3KYBA 4JBXA 1BHQ1 4LE1A 3I6MA 3NVKI 2B20A 4PIMA 2GS9A 4IV0A 4EENA 2H1OA 3A9CA 1IBSA 1ID8A 2Z04A 4X8MA 1R8JA 1QUEA 5GZ3A 3KJZA 4W6QA 1BHO1 4DJAA 4DRXA 3D1JA 4BZXA 2CCKA 3FKQA 1ZMTA 4JLMA 4LOJA 1CF9A 5B30A 2REQB 1E4EB 2JFPA 4IO0A 1V95A 1GARA 3TQFA 2XT6A 1FS5A 2V3VA 3RS0A 4FKBA 2XT9A 3WA7A 1NNEA 4H6PA 1E5LA 3P5BA 1I1HA 4QYWA 3OIFA 3M6MD 4OK6A 3W6OA 3NYWA 4BO7A 2HT1A 5LUBA 1EJ2A 5SYNA 1NI5A 2IPMA 4EVRA 2NO7A 3UEOA 3IEVA 2CJWB 1NJ6A 2BFFA 1B0AA 4BZWA 4ZCTA 3QG5A 4URVR 2IW1A 5SYAA 3F73A 2JBWA 2UU9B 4H3SA 4DIOA 1GPDG 5ESXA 1WDWB 3ORSA 3B6IA 3OU6A 1F0NA 1LRJA 1P2VA 2PYZA 3OOSA 4M9UA 4I1SA 3EGWA 3WOHA 2BBWA 1M6VB 4MICA 3ZTYA 5JANA 1QIEA 4LYHA 4B43A 1KXZA 4BQNA 2G06A 2B5VA 3LKVA 4PLGA 1FYFA 1M2FA 3NHAA 3AVQA 2FZ5A 3HWSA 1SEPA 3VDQA 5EMHA 4RA6A 1FNMA 5DNEA 4E11A 4YMVA 5TLSA 1PZNA 2B82A 1G41A 2OHJA 1YSCA 2XB6A 3BXXA 5C1BA 5BW4A 1J09A 5C1DA 5T4HA 2VTVA 1M8FA 2ZZKA 4NS4A 1L6RA 2QJRA 1B0PA 3WKCA 1UKYA 3CZ9A 2X9NA 4YT5A 2QR2A 2BFBB 2CHVA 4LGCA 2UZ1A 3HRIA 1GTVA 1T5OA 2QRLA 2BONA 1I3NA 3KNZA 1G7CA 3BK2A 4GBED 2A1TS 3DTVD 4WXEA 3TXAA 1WP4A 3ZDEA 5A04A 3BIXA 5BV1A 3AHEA 4GPEA 1R0XA 2Q9UA 3EQZA 3WWPA 1JNYA 3K8YA 2XE4A 4L8FA 1W4BA 1U7TA 1QU3A 3B20A 2G17A 4YP9A 4UVGA 2YC2C 2XQGA 2UXBB 4IGEA 4JX9A 3C5EA 4WPGA 5BPFA 1K06A 1RM3A 1CY8A 5ISMA 4FEYA 4MS3A 1ZSYA 1FQKA 3ZZUA 1L4GA 1SXJA 2DAPA 3R3WA 3J7TA 1E1DA 5AJXA 4AN4A 4YLEA 4D4GA 2PSHA 4QDXA 1FMCA 1JNXX 1EUCA 1LDNA 4LCEA 1CUYA 4J7AA 4IWNA 1J0DA 4X6YA 3TCNA 1FY2A 3EWNA 3H7AA 3PK0A 4BO4A 5L8VA 4M89A 3W7BA 3U13A 1XE3A 4YRKA 3IJEB 5LU9A 2J9RA 1Z8HA 3FKSA 2HTEA 4FYPA 3EF0A 3HCNA 1XQXA 1KH1A 3ABSB 3FVTA 1Q74A 1USKA 2FFJA 1NN3A 1ISRA 1FMJA 1VLQA 4OU4A 4AJLA 3I05A 2DPYA 3WIDA 5JALA 1JPUA 2CCGA 1M10A 3UB4A 6ABPA 3P19A 1QS0B 3NBKA 3V34A 3W2GA 5K0SA 3OE7D 1SWWA 1L4HA 1UT5A 3CKMA 3HBNA 4K6MA 4B4UA 2HIAA 3O8DA 1YS1X 2HEGA 2BI4A 3PFWO 3DTTA 1CEQA 1NNUA 1EWTA 1UBEA 3LDGA 3RW9A 5BURA 4OMCA 3L9WA 1E66A 3WIVA 2EZ9A 2VDOB 5FBHA 2ZRLA 4R7ZA 3SBOA 5CK4A 3NJ4A 1LZKA 4LG1A 1L4UA 3PD0A 4Y9DA 4NABA 4V0NA 3NHYA 2YIDA 3M6UA 1T8SA 3OCCA 3JY6A 4JFAA 4KDEA 4OXNA 2GFQA 4PM4A 5AM1A 2CL6X 2R11A 4EG7A 1W88A 4QDUA 4RF4A 2QN9A 1VKHA 3IIEA 1U2PA 4H3HB 4X6LA 4BJ6A 4DJFC 1X77A 2H3EA 3P9RA 4P5PA 4AF8A 2YYSA 2PCLA 4MQUA 3CEJA 1QB7A 1POXA 3KQMA 4RVUA 1Y5IA 1J7KA 1UXKA 5DRTA 4AKSA 5KVQA 2GNAA 5H1YA 4DJTA 3JS5A 3JU3A 4ZMBA 4IV8A 3FPLA 4EWLA 1KERA 3V42A 4DANA 2YCBA 1UEIA 2PH7A 1NQ5A 2DPXA 3TLCA 2OPHA 2PHZA 3UENA 1PQ4A 1XFAA 4FHEA 2Q1YA 4CI0B 3KCNA 2QZSA 3KLMX 1FB5A 2FZCA 3S70A 3O8CA 4FR2A 3EPRA 2DQKA 1BVUA 1WPRA 3WB2A 1DG9A 1FQOA 1RQXA 2WZCA 3KSBC 1QRSA 1A4UA 4D4LA 3FMGA 3AEUA 1NURA 3TSOA 2PCJA 2ZUVA 1I2CA 5I8ZA 1GO2A 5BUZA 3TR5A 4HKTA 4FFLA 4OK3A 1BXRB 5AUPB 2EBHX 3BXZA 3KQHA 1MGPA 2WJVA 4XM0A 1FSSA 1O9BA 1DXHA 4J90A 4X3PA 1V6SA 2OXEA 3BEDA 5CDFA 3H5RA 5DGTA 4DCTA 1R64A 3ZOKA 5IT4A 1OAKA 1KVSA 1NXVA 1N6OA 2G77B 3W77A 5C32A 4OHOA 3ZJTA 4NH0A 1DQYA 4BXOB 3D7SA 3W9YA 4MGIR 2HCRA 1CB0A 1H66A 3LC1O 2F1IA 5DH9A 1R9JA 1OWNA 4BDTA 1YMUA 4NAUA 4EUSA 4Q4AA 2AIRA 2PXXA 3R5TA 5TRTA 3SQLA 4HNTA 5KQLA 1GZ3A 4BLUA 4UBKA 3DEAA 3GLFB 3NC1C 3RT1A 5JRJA 1YRYE 2XOKD 2G36A 2O2JA 2XUQA 1W5FA 3L4SO 2R4UA 4UUPA 3ROTA 1FFWA 5BSGA 3EA0A 3WBBA 2F7SA 4RM3A 1H0HA 1NC1A 1NW7A 4Y2UA 5C3MA 4CFZA 2Q7XA 2A33A 5KSZA 2JH9A 2AOXA 4TSFD 1Z4KA 4UU0A 4MUNA 5CFMA 1E9SA 4BVFA 1C7IA 4B0OA 4DXAA 5JT1A 1FNNA 3SF8A 1Q1BA 2WZQA 4AU1A 3FIUA 4QHTA 3PEYA 2YY5A 1CJVC 2P2YA 4GLFA 4CNBA 3FPBA 4IFBA 5DIZA 5DN9A 5ICCA 2Q27A 1KARA 2P9HA 4NHOA 4MARA 2JVKA 2R60A 2BI8A 1E4OA 3GP8A 1S3FA 1LK5A 2NW6A 3EVTA 4KN8A 2JGDA 4L5YA 3IFSA 1JBKA 3K2QA 5JNRA 5EP1A 1E7MA 1ENZA 3HDVA 2X13A 4Q37A 1ZJYA 4G0QA 3RKUA 2HMAA 3GY0A 3IE0A 3E0XA 1MOPA 1AGYA 4JLKA 5JTUA 4DV6B 3W3ZB 1KZ9A 4CCWA 3HKDA 1NN1A 2ZR0A 4OLJA 1RC8A 4AKHA 3RVKA 1RQ7A 2IYSA 4JLBA 4DPLA 1VECA 2COUA 1NRJB 3T9CA 5EA2A 1D4AA 3H5AA 1JU9A 1ZA1A 4ZYZA 4HDCA 4LY9A 4D9KA 2MTBA 2W4QA 1Z0AA 3FNGA 4IKPA 1AA9A 2N3ZA 2P75A 4ZVQA 3SVLA 3UA4A 2V5VA 1CDEA 3D6NB 4N4AA 5AQEA 3RSQA 3S6JA 3V2UA 1H4TA 3T1HB 3HKCA 3OVMA 4DV5B 3U7GA 3CINA 2YZMA 3EDMA 3HMKA 4W9NC 3HKBA 4UUOA 3DH0A 4BRZA 1CR0A 2W2XA 3KKNA 5JV5A 5DASA 4CVNA 5F35A 2CXSA 2RHMA 4AW9A 5CG2A 3EGOA 1H2ZA 1TZMA 2G4VA 3OEHA 3KT8A 3L6RA 1PT8A 1GGKA 4JOQA 5ALDA 1GPNA 2RC5A 1GILA 3LC0A 3MTEA 3NFRA 1M1UA 2I8AA 2QQFA 3BMXA 4WEOA 4YVFA 5EIAA 4E32A 4BCDA 4X3CA 2UZ4A 1F4LA 4K86A 2OGSA 3UT0A 4GWKA 3AY3A 4KGXA 3HU1A 5HIMA 3L7AA 3CGWA 4MHOA 3OHPA 1LV7A 4CLOB 3TD2A 5CB8A 2ZYDA 1X9IA 3GZNB 5DWVA 4NMWA 5G0TA 4N7RA 3HNOA 3SMVA 1UMKA 1WBDA 4S1WA 2XKAA 1IUPA 4N5DA 1N2CA 4Y0AA 1BMQA 4XFJA 4QGBA 1CQIA 1U7PA 2NVUA 3UBMA 4TLLB 2EW2A 2KHZA 1JFRA 1G3IA 4HDQB 3IE1A 2VUIB 4W8HA 1OD6A 1DCKA 4F5ZA 2XAAA 1C9MA 5DKFA 4DWWA 1YS9A 4YCCA 5TPZD 3V9PA 1TGYA 1XHLA 3GPBA 4OD0A 4Q4HB 1MBZA 1XSEA 2GVDC 3DAFA 3GFGA 3GARA 1PS0A 3O47A 3Q4GA 4Q3EA 5EP4A 4E2YA 5ADHA 2IS2A 1RI1A 3IC5A 4G5SA 3Q8KA 2Y76A 3SDSA 4EKYA 1P7VA 2IT1A 3C1AA 1T0BA 3L0BA 2EIHA 3VR2A 3VTKA 3WL7A 2J33A 5B2EA 2VPTA 1OI2A 2O3RA 3P2OA 3PA6A 2C2GA 3QMVA 5JC1A 2J9FB 3ZJVA 5G41A 4MUFA 4B3IA 5JZVA 1WMBA 2RKWA 1MNQA 3E3AA 1JIQA 4V1CA 3VOBA 2GVNA 2GM5A 2A0UA 3EMKA 4AO6A 4F71A 2BV3A 2OZVA 3V8BA 1KOGA 1JEYB 4L78A 1ZN7A 4R2HA 2GEJA 1JB9A 3C7TA 2GEKA 3GVPA 5B55A 1GV1A 2FEAA 4BLWA 5K20A 2C3MA 3CX6A 3D8NA 3DBHB 4V3BA 5AOVA 3U60B 3E9NA 4R3UC 2I4IA 3LQ2A 2PO5A 2FPGB 4G56A 4C4SA 2GF0A 2TMGA 1UMDA 3D43A 2PQ0A 3QENA 4K9NA 2H4XA 3RB8A 2VJBA 1QMGA 4L4SA 5DHUA 4KKXB 2QRQA 5JCOA 3OPMA 1GADO 4D97A 1MZPA 1TKBA 1EM8A 4TMVA 1K4YA 2X0DA 5KPJA 4FHFA 3MBKA 3AHGA 2PX8A 2YIJA 1VB3A 1KYWA 4REQB 4MQBA 4BJ1A 4UOEA 1NONA 3KM0A 4WMLA 2AF4C 2HWYA 3SHVA 4N41A 3ZJ5A 5T64A 2G9QA 5FULA 1RCTE 1UOEA 1A96A 2AE1A 3GROA 3P96A 1OKKA 1S2NA 1KMIY 4WK4B 4EB3A 1IULA 3UN1A 4C03A 1U99A 2CLDX 3NV9A 5KHLB 3MQ4A 4WFJA 3NEYA 5D5HA 5KWEA 2ZPTX 3PP8A 4I46A 2SKDA 4KO2S 4WNIA 2X19A 1DRKA 4EG4A 3WLTA 3K32A 4PZPA 2D59A 4L0MA 4EYOA 3CA8A 3GMIA 3K5IA 4L8GA 4RSGA 3BHJA 5C8YA 1L7QA 1PJZA 3A3OA 5LMUB 3UHAA 1BXGB 3HL4A 4DCPA 3RUPA 3UVEA 3AEKB 4BJ3A 1L5HB 3R5HA 4AG6A 3O3OB 4UDOA 4L0QA 5J43A 1S96A 2R2AA 2PKQO 3T3PB 1ZXLA 4C22A 2UYYA 3BX1A 2V74B 2JHCA 2XF8A 3E1SA 4I81A 1ZN2A 2EL7A 4HUTA 3IVRA 4FC7A 4YC7A 5SICE 3AR8A 3WXMA 1N33B 3C3MA 1J24A 3RYIB 3VX4A 1JG6A 3E23A 1HTBA 3E84A 3Q9UA 4PZZA 2XVYA 4I8DA 2PMCA 3MGCA 1B3RA 2C7OA 1G8KA 3NANA 2QA5A 1UWCA 2JFGA 2ZJ0A 3PC6A 5KYYA 4OQYA 2I2DA 1DB3A 2WYWA 4OMDA 3B3AA 4P2BA 3SYNA 1CT9A 4WY2A 3W5CA 1P2FA 1YC5A 4LHYA 5K0ZA 1NUAA 3E2PA 3GLUA 1B7GO 3R74A 3RTEA 3UGKA 1KKLA 4TYNA 4NVRA 1DTWB 1X74A 1JDPA 1YA6A 4RORA 2HZ7A 1RXCA 4C7OA 3SQMA 5EQDA 1R8QA 2EBUA 1KMMA 4IAOA 3CQ9A 5FPYA 2GXQA 1RCFA 2DUWA 2FV8A 2XTMA 2ZRJA 5B12A 4JLJA 1SQ6A 5H4HA 1W36C 1O94C 3OT1A 2WHQA 4XGKA 4P22A 3TIFA 3AEXA 3B48A 5E9QA 1Y9JA 1CFJA 3DDHA 4ID9A 1U0BB 4YPFA 4BTVA 4IOMA 2XXBA 3B5IA 2FMFA 1FRVA 2W83A 3MLBA 1MO5A 4P3KA 3TZCA 4XQGA 1U90A 3WLKX 4WESB 3COWA 3AOEA 4DPMA 4QEDA 2A5YB 1MW9X 1XQ1A 3O75A 4XYLA 3G2KA 1UM9B 1DDOA 3Q3VA 5L95A 2J5QA 2GK4A 3HO6A 1UC4B 1LY1A 4KLCA 5E6SB 4QOIA 4UNQA 1X1DA 2D4AA 2OP1A 4AF6A 3ZKAA 5JJCA 2WJJA 3RSLA 2ZK7A 3ENVA 1WULS 1KFCB 4HP8A 1V7QA 5LL6P 4H7HA 4PFSA 1T3HA 1ONPA 2ATCA 3MBIA 4EAAA 1JH9A 3GDHA 2O06A 3LY9A 3OF3A 4EBBA 1EK0A 3LLUA 3IBFA 3U44B 3U3MA 1IHXA 4UHHA 4U2DA 2J6CA 5A1JA 1J21A 4J2OA 1OR8A 4ZK6A 2I7CA 2TMKA 4QHSA 4EI2A 2AEEA 4L02A 4RCYA 1AURA 4OFBA 4EPXA 4K81B 2WA2A 2X4DA 1TM5E 4P8RA 4YMIA 1NW9B 1V35A 4YIKA 5DW0A 3NHPA 4E5VA 1Y5NA 1GL6A 4NX2A 4KRYA 1KZ6A 3G0OA 1RZVA 3L79A 4AY6A 2FF5A 4BNGA 1SKBA 1MFPA 3W8DA 4EKEA 1NMXA 4KR6A 4GVLA 3BE8A 5JHHB 2NSDA 5CBKA 5FOXA 2DVMA 4QAJA 3PPIA 4FFVA 3USES 4ND7A 1B6TA 1E1RD 2DPHA 3LWNA 3VZBA 3BL8A 2QTLA 1AV6A 2NZXA 1DJQA 2HSJA 3MFQA 4D99A 5JD4A 3L4JA 1XPOA 1HXHA 4TVKA 1YA8A 3IMCA 1OIXA 1F0YA 3EXHA 2J5XA 3F8TA 4TX1A 1F6BA 4O4HA 1U7OA 3CX3A 4LQDA 5BV8A 2M6KA 2Q6KA 4WVFA 1ZJ4A 1K4MA 3AR3A 4JLAA 1NAHA 4NIMA 3GUHA 3PVSA 4L6CA 1CVIA 1XZJA 1UBHS 5AESA 1JMYA 1OYOA 1N5MA 4GZ3A 4HG2A 4XOIA 1EUDA 1W94A 4KFRA 2EFYA 4F21A 1Q5PA 1L4FA 2GDJA 4AG5A 1JIVA 4AECA 2JJ2A 1UBLS 1A8QA 4R8VA 1F7VA 5EUBA 5JZ9A 3S81A 4HMOA 3HB1A 1T15A 4ZVOA 2IE0A 4KLZA 3UMBA 1ZI9A 4ZAXA 1KY4A 1JE0A 3QE0A 4MGKR 1E5DA 4WTOA 4GEGA 5B2FA 4YCNA 4OKIA 3U7JA 3UKJA 1DS6A 1YMVA 2GASA 1IN8A 1QP8A 1JPVA 4J0IA