1IAQA

C-h-ras p21 protein mutant with thr 35 replaced by ser (t35s) complexed with guanosine-5'-[b,g-imido] triphosphate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
149
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDSYRKQVVIDGETCLLDILDTAGQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic properties of the Ras switch I region and its importance for binding to effectors.
pubmed doi rcsb
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 149
sequence length 166
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1iaqA00
4YC7A 3ZDQA 1KK3A 2RGNA 3WY9A 4MYUA 1COWD 3NXSA 3Q3JB 1VCMA 3EC1A 5L3SB 1UKVY 1X8JA 3EPKA 4JL8A 3GJXC 1YZQA 4PC6A 2Q9BA 5H1YA 4XSGA 1NP6A 1P9RA 4HAXA 4O25A 1Z08A 4B6FA 3O8RA 1E79A 1H8EA 2CL0X 1P2VA 4RY2A 2BV3A 1I4LD 5K8UA 2N42A 1W0KA 4DCVA 3F8TA 5DHFA 3VHLB 1LF5A 3NBZC 1SKYB 4IW3B 5CK5A 2D06A 2JJ2A 3SJAA 3TRFA 4B75A 1LNZA 4DUGA 1NSTA 3WNCA 2NPFA 2JLSA 1MH1A 3NC1C 2CMKA 4K8OA 5E7JA 3L0SA 2VIIA 4C0BA 3LAWA 3FMOB 2B6HA 1AZSC 2ZJOA 2F9MA 1QHNA 2XTNA 1IN5A 1Z8FA 2BDTA 2REXB 5B2ZA 4BLSA 3RC3A 4KLZA 1R0ZA 4HI0E 2QA5A 2GTPA 4UQOA 3RS5A 1UEIA 2WSSA 3PITA 1Z0JA 1VG1A 2VP2A 1Z0KA 4N1AA 3RRYA 2HYIC 4Y0AA 3H84A 3Q9LA 3RANA 5LD2B 1YE8A 4R71A 1N6LA 2GNOA 1TQDA 2IS4A 1R2QA 5LDDC 2IUTA 3ND9A 2BMJA 3RS2A 4JLKA 3GLGB 2ODBA 1YZUA 1WF3A 2TMKA 1E1RA 4QGFA 2G0NA 1H8ED 1N0WA 2A5GA 4DRZA 2V3CC 1BO6A 3V4RA 5FR2A 1AS0A 3UWOA 5KPJA 5BYJA 2VA8A 3AGQA 1EFTA 3AVQA 2VSXA 3IPYA 2ZRHA 3JZAA 3UIEA 5JZVA 4TMZA 3CONA 1JALA 1BS1A 4HLUA 3Q7QA 4Q1DA 4NH0A 4DHEA 4XTRA 1XTRA 1CRPA 3HU2A 1SVLA 2CLSA 4LYAA 1W5SA 1T91A 4PHGA 4M9ZA 3ZS8A 4TMKA 2ZS8A 4D0GA 4LHWA 1HYQA 4JLNA 3CRQA 3DOEA 4KCGA 1HURA 5EP2A 3QI2A 2MSCB 4LJ7A 3THOA 3T12A 4HUQA 2IYTA 4LJ4A 1ZM2A 4B6EA 1TMKA 2ZRCA 3KQUA 1SXJC 4KBGA 2I3BA 2XOKD 4AURA 3B5JA 3ZIAD 3KQLA 4R2HA 2ZI9A 1YU9A 2VP6A 4DEYA 1DAFA 2EWWA 5GJCA 3EZ2A 3N5CA 221PA 3QSYA 4TYYA 2QT0A 4GPTA 4D4MA 2ZJ8A 3ZGXA 4MKFA 4LYJA 2NZJA 1AS3A 4JLVA 4Q1FA 3NH9A 2ZTSA 1EK0A 4DC9A 2Q9CA 3SQWA 3D6TB 1XD9A 2B8TA 1CJTC 5TB5A 4LBVA 5KNCA 1AGPA 1ZCBA 4DLYA 1RE0A 3PV0A 3OEHA 4PC3A 4ON9A 1U8AA 3A4MA 4HUQB 4NYIR 4F38A 2ZRPA 1E1QD 2QENA 2B21A 3CPHA 3KXKA 5FTLA 1F2TA 3GLFB 1KI1A 1GILA 1OLOA 3A1WA 1E2GA 3B78A 4DIEA 3KTAB 4GSYA 5TXGA 1XD2A 2ZE5A 5JWRA 2ZUCA 2ZEJA 3C5HA 2NPIA 4N3NA 2JDIA 4LCBA 3MWJA 2P6UA 4C30A 4LC1A 3CR7A 1T3SA 2QT1A 5IDVA 2ZJAA 3H0KA 3EASA 3Q72A 3FGNA 3BIFA 4TLEA 5FOVA 2MMCA 1VCNA 2ZSBA 4Z54A 2CHVA 1TUEA 1U99A 5EXTA 4QC2A 4BASA 2BM1A 1VYUA 1DAIA 1ZMXA 3DZDA 4ZDWA 1D6JA 1XF9A 1UKZA 3RRMA 3MUFA 1AKYA 1U9IC 3V4FA 3C5CA 3I8XA 1ZU4A 4AWXA 2XGJA 3L82B 1KI6A 3TW4A 3ZVLA 4AC9A 2D2FA 2NIPA 4S2EA 4TWZA 3TH5A 1EGAA 4DLSA 3AVXA 1F2TB 2WVJA 1DE0A 2YOGA 3UXMA 2QMUA 5CIWA 2LWIA 2X2EA 1XD2B 4KAXA 1CJMA 2XJ4A 4F92B 4LPSA 4FMCF 1MO3A 5AR1A 1LVGA 5SZHB 3KKQA 5B30A 3A4NA 5EE9A 3H2YA 1LS1A 3TSZA 1OH5A 4LZZA 4MH0R 2GETA 2W58A 5L3RA 3SI7A 4UNSA 4PHTA 1YR8A 3S1AA 3THWB 3K0CA 4JVLA 2W6JA 2ANBA 4LHZA 5DLQC 4ARZA 2IEZA 3VKHA 5FUXA 3TGPA 5DGXA 3R9IA 4M1WA 1NVXQ 2JDID 1KI6B 2PLFA 2ZUDA 2OFXA 5DYIA 4YONB 2A7QA 2D2EA 1HTWA 1SVIA 1E96A 1G5TA 3UMSA 1AS2A 4QG7A 5FBQB 2D7CA 3W6NA 4CT4B 1E9DA 1G7RA 4BECA 3FB4A 3AGPA 5JS8A 3B85A 5EXSA 3AUYA 2AR7A 2ZR7A 3OIUA 3QEOA 4QGHA 1XZQA 3CB4A 2J87A 2OAP1 1UBFA 4YXWA 2CCKA 2BBWA 4AKEA 1OH8A 3PEYA 1DOAA 2PCLA 1OV4A 2VQSA 5C18A 3K70D 3GJ5A 1G7CA 2ZAOA 1TU3A 4BEBA 2HT1A 5DI3B 4LDJA 4TL7A 1G5RA 1XJ0A 4PO1A 3O47A 4XD7D 1X3SA 5DE3A 3F0TA 3BE4A 3S1AB 4ARZB 1DBSA 5TV2A 3R7WA 4OHWA 1UAAA 1X86B 4URWR 2O0HA 2GZAA 2YYZA 1FTNA 1I4DD 3DM9B 3CLVA 2WOOA 3LX8A 1KJZA 3GEIA 3VNUA 3IILA 1RZ3A 3C15C 2J7KA 4URVR 2ATXA 2JIZD 1P73A 4OK6A 2FOLA 4GMXA 4JT4A 1OXUA 4OYHA 3EX7C 1JNYA 2QP4A 3D3QA 4OJKA 1M6NA 2AXPA 3NBFA 2QE7D 2RGAA 2D62A 2ZJYA 2LCFA 2AL7A 3E70C 4CF7A 5FOUA 2VP5A 1M8PA 5J47A 1CU1A 2GJSA 1Z07A 4DLUA 1D9XA 1KIMA 1NI3A 2ZE8A 1QZXA 4MGIR 4I1SA 1BYIA 2VP9A 3AF1A 5EP1A 1VG8A 4D0NA 3WNBA 4BE7B 1PUJA 1XZPA 2RMKA 2XX3A 3X1YA 4TTQA 1SHZA 2IF2A 5DHAA 3ZS9A 1KO8A 2G1JA 3OE7A 2R6FA 4GMDA 4GT1A 1OFIA 5EXXA 5EZ5A 1VYVA 4GDFA 4PAMA 2ZREA 2GVZC 4MRSA 4MDFA 3O8BA 4AG6A 5JHGB 1M1YE 1GFIA 2BEJA 3NG1A 1Z6AA 2ORWA 3ZJYA 3U7FB 2YKGA 3CZPA 3WBKA 4BLPA 3MWKA 1AIPA 1QG4A 4M8NE 3KQNA 1KAGA 1P61B 4M2LA 1A2BA 1KDRA 5FR1A 2HEIA 1Z0DA 4QHYA 4G0NA 4QXAA 4OHYA 1YKSA 1S8FA 1EFHA 3UMFA 2IXEA 4F4JA 2FZ4A 5LD2C 2QRZA 2OBLA 2O8CB 1RIFA 2Y8EA 3EARA 1XTIA 1KJYA 2C77A 2FNAA 1N0VC 1P4SA 1JJ7A 3CZQA 4JSYA 3EZFA 2XZOA 2WJVA 4A36A 1ZD8A 2AKYA 2IYWA 1TU4A 1VG9B 4YMVA 4Q03A 1TEVA 1GAJA 1KSJA 3EZ6A 3LDAA 3CO5A 1AN0A 3RS0A 5DIFA 2WWYA 1CR4A 2WPDD 5JJKA 1FX0A 2V6JA 3I4LA 3K9LA 3PUXA 3N2IA 1Z47A 4DDTA 1KZ7B 1LW7A 2GAOA 5AUQA 2FH5B 4OQLA 3KJEA 1IONA 4IRUB 4IVRA 2J7PD 3K09A 4HB4A 2QAGC 2V8OA 2IYVA 4EJSB 2BC9A 5KDDA 1OYYA 1GG2A 1KO7A 3CRRA 1VTKA 2QMHA 2VPPA 3K9GA 2OO7A 3KDSE 4LJ6A 3QF4B 5L3QA 4QM6A 4WXRA 4LWZA 3GEHA 1GKYA 1WBDA 4FW9A 3EZ7A 2GEUA 3DO6A 4C2TA 4NYMR 3NBXX 2GJ9A 3V00A 4FCWA 4OI4A 3X1ZA 4IVPA 2EU8A 4TLAA 1E2HA 5KSZA 1IN4A 3H1TA 4AY2A 1E2KA 4RSGA 1JR3D 2ZJZA 2QPOA 2HF9A 1XJQA 4M4SA 4PXAA 4W5JA 4WAUA 4HLUC 5FUYA 3QXJA 3SC3A 1GL7A 3T06B 3T5DA 2GK7A 1W36D 3QG5A 2NO1A 1ZYUA 2EWVA 1EESA 2C78A 2ERXA 4UXHA 1O87A 5FUVA 1QG2A 1OXXK 3B8HA 1MKYA 3LW8A 4DLXA 5L3QB 3T15A 3LVQE 3TQCA 2FPMA 4GZLA 5FOTA 1R8SA 1P7CA 4IFBA 1W2HA 2IXFA 3TKLA 1Q1ZA 1P6XA 4AYTA 3L8YA 4CVNA 4Q18A 4Q5IA 4FCVA 2HUPA 4OQMA 3AVOA 4KSBA 5CM8B 2R44A 3LBNA 4M1KA 4Q7MB 1BH2A 3GQBA 3W3ZB 5IRCD 3C4JA 3W3AA 2Q3FA 1IY1A 3X1WA 4KLNA 4TQAA 3R8CA 4CT5A 2QI9C 4E07A 1VIAA 3LBHA 2W0SA 2MMGA 3B1VA 2O0JA 4JLAA 2G83A 3AVVA 1OE0A 2C98A 4TMVA 2IUSA 4I1UA 1XEWY 1Q57A 2GRJA 1R5NA 2R6AA 4TSFD 2AK3A 3LLMA 1G8GA 2WWWA 2O8EA 2FFHA 2BBTA 3IEUA 2GKSA 4TMWA 3NDPA 5EE0A 2W6IA 3X2SA 4C2UA 3WHLA 4U5XA 4CEIA 3OAAA 1HV8A 4DDUA 1W4CA 4PPQA 5ANRB 2VH5R 4LGMA 4QHTA 3CRMA 3M6AA 3MG9A 4DXAA 3CPEA 1GRRA 3W6PA 4B76A 1US8A 1KI9A 2ZRBA 3PEVA 4NCJA 3JVUA 4M0LA 3CX8A 1GVNB 4US2R 2EFCB 1OHHA 4OJQA 3VU9A 2WZQA 1E2EA 2V1XA 3KZ1E 3B7GA 4OQNA 4JS0A 1XB2A 2QTFA 1W49A 4WBSA 2DBYA 3NEYA 4MITA 4QKQA 1Q21A 3CF2A 2WWIA 4Q1CA 4Q1EA 2O8EB 3GJ6A 2K5UA 4TT3A 1G3IA 4B73A 1U0HC 4IDNA 1U98A 1DVRA 5EJEA 2B7CA 1XCMA 3BORA 3WBJA 4JYBA 3R9WA 1PJRA 2QP3A 2DWPA 1KHTA 5C4GB 4A0RA 1V5WA 4AYXA 1E9CA 4NHOA 4NE2A 4XSHA 2EYUA 4FD2A 3RDPA 2QM8A 5F9HA 3WHKA 1US8B 2QUZA 5DN6D 5LPNA 2VEDA 2BWJA 2CVFA 5J4HA 1FNMA 1M7HA 4D4KA 5KSYA 2H18A 3L0PA 3LV8A 3U5ZB 3FKSD 3U7GA 2HXSA 1QVRA 1YRBA 2JLWA 5AJXA 5DYGA 1EFCA 2Z43A 3Q5DA 1WP9A 3CR8A 4TTPA 3KX2A 1NMZA 4UXIA 3VR3A 1SZPA 4ESVA 4L15A 2ERYA 2SHKA 1NN0A 1QDEA 2PJZA 4HATA 1NVVQ 2BMFA 1NVWQ 1NF3A 1NLZA 3B1XA 1VIYA 4LHXA 4A9AA 2YV5A 2XAUA 4Q02A 3OIYA 2RGXA 4QNMA 4UJ5A 3RVBA 1CJVC 2OESA 2Z6VA 3TR0A 4C9BA 1NKTA 3HJNA 5DO9A 4FMDB 4DIDA 2QN6A 8OHMA 3GLHA 3FMIA 4NTZA 3RSOA 2REBA 3VX3A 5TDHA 2P5SA 2WSMA 2OBNA 4RZ2A 2GXUA 4HYYA 3QXSA 3TUIC 5FTKA 1RVDA 3A1VA 4ZIRA 1IY0A 1UDXA 3LRPA 2KSQA 5HCNA 3VTKA 4LJ9A 4HUTA 721PA 3ASYA 3IDQA 4G01B 1G4UR 3TW8B 3SZRA 1SXJD 2QPTA 1WMSA 1R0WA 3FTQA 4JL6A 3TAUA 4IXNA 2IHYA 5FTMA 4OI2A 2HCBA 3U6KA 2ZRKA 3C7KA 2OLKA 2RH5A 4ZV4A 3SR0A 2YWFA 2Z0MA 5DISB 1AK2A 3Q5EA 5CB8A 2FG5A 4V0LA 4LX0A 2R8RA 3AM1A 3EPHA 1E0KA 4GFDA 1NJFA 1GKUB 2RHMA 2F43A 3CKLA 4MYHA 5JFGA 2JATA 4M1OA 3GLIA 3BXZA 4LBZA 4LHYA 1RJ9A 4M9QA 5FOSA 2HYDA 3VR5A 2KJQA 3RC8A 1BYUA 1GNPA 3EW9A 4YDSA 4A82A 3SS8A 1NBMD 1DG3A 2YNMA 3MMPA 4NBSA 2XNSA 4M9XA 4QFMA 4QRHA 1XMIA 4A0FA 1YR6A 1KKLA 5FBLB 4PQFA 3A1TA 5FL7A 5KUTA 4JLMA 1NBME 1S1MA 3GLHE 3PUWA 4XH9B 3OEEA 4X8HA 1IN8A 2VHQA 1N6NA 2WBLC 1CR0A 1COWA 2ZRLA 1KI3A 4M22A 1XTQA 4MRRA 2OXCA 4A8JA 3GLIB 2ZSDA 4CEHA 2GAAA 3K53A 2F3RA 4EJSC 4G5GA 2IWRA 5LB2A 4TQUS 4PHHA 1WDTA 2N46A 3MLEA 2G9NA 1GOTA 1NN3A 1W0JD 2KI5A 2OCAA 1U8YA 1FW6A 2OAQ1 3ZH9B 1W4RA 2ASEA 2BMEA 4BFUA 1S1CA 2H7VA 2A5DA 1VYTA 4JYCA 3PVSA 2ZR9A 1I4TD 4BRWA 1UBGA 1KDOA 2JLVA 4Z8XA 3RLFA 4A1FA 2Q9AA 2O8DA 1IJFA 1F6BA 1H65A 3LBIA 2IYQA 2JLUA 2CJWA 3VKGA 3NC0C 3MAAC 4A8JB 2CHQA 1K8RA 1G8PA 2A2ZA 3Q8XB 4CEHB 2EFGA 1G41A 1OFUX 4MRPA 2WOJA 2ZJBA 4L9WA 4HB3A 4I1VA 1Y63A 4I1OA 1FP7A 2QQ0A 3PFIA 4QL3A 4UNQA 4RCYA 4S35A 4EUNA 4DSNA 4TYNA 521PA 3GFTA 1TL7C 1EFUA 2P3SA 3EA0A 2CCGA 3OEED 5SZKB 1MRNA 2V54A 5A5GA 3THXB 2PEZA 2WICA 3A1UA 4K81B 1YVDA 2NGRA 4DLRA 3KKNA 3F3YA 2JGNA 5B57C 5G40A 3X1XA 2R65A 1DS6A 4M1TA 3KKPA 2GEDA 4ZPXA 2D7DA 4NCIA 1IOZA 1JECA 4RD0A 4DDWA 4IHQA 2F55A 4YQFA 4NZYA 2J45A 3QKSA 3IIJA 2FSIA 5D3MA 2DCUA 2GF9A 2QP9X 3AF2A 1JQLB 5M04A 1EFRA 2IS6A 1M2OB 2QORA 5BWMA 1S96A 2VLIA 5GADl 4P4TA 2Q0HA 2H1LA 2YINC 3B60A 1XWIA 2GK6A 2YZ2A 1KK0A 1PUIA 2JASA 2PH1A 1NJGA 1AQYA 3KFXA 3DM5A 3HPQA 5E7MA 3E5HA 4QM7A 1G20E 1R10A 4GOJA 1G8FA 5FOXA 2H8KA 3JZMA 1N3BA 3PEUA 4JVSB 2ZRNA 3ZZUA 1U90A 2XEXA 5FUWA 2RB4A 1M34E 1JEEA 2VHUA 2XOKA 3ZIAA 3NKVA 3MSXA 3QKSB 1WXQA 4RCZA 1DARA 1TF2A 4AYWA 5K8TA 2GILA 5D3MB 5G41A 3PR1A 1II9A 1GNRA 2NO9A 1KNXA 3IKJA 3HU1A 2RGCA 4HLQB 3RS3A 1MO4A 3EXAA 2E9SA 4QJ4A 5HE8A 1G5PA 3TR5A 4GBMA 1Z29A 2ZM5A 4TL8A 4ZDKA 4DCSA 1PZNA 1UDWA 3SBDA 1NLFA 4MUAA 1EFRD 1OH6A 2QY9A 1E1QA 2VF7A 2QNRA 2I4IA 4Q4LA 1YRAA 4HLCA 4GOXA 4LC0A 1Q12A 2G3YA 4A2PA 3DOFA 3QXCA 1BKDR 4LRWA 1CP2A 4Q9LA 4Z1MA 2WMOB 1I2MA 1NKSA 3GPLA 3G82C 1YZTA 1NNEA 1AJEA 1G7SA 5KTYA 1E98A 2OXRA 3IO5A 1G8HA 4HAUA 2D3WA 2IC5A 5CJ2A 2MSDB 3AH8A 2ZANA 2WWXA 4EIWA 2QBYA 2GESA 3FVQA 5BW8A 4AKIA 4YLGA 1KK2A 2VSFA 2BEKA 5AJZA 1CIPA 4E22A 1YR9A 2QRNA 3RS4A 2EW1A 4BFXA 1ZW6A 1U8ZA 1G64A 1HT1E 1OIXA 2C9CA 3GLGE 1ESNA 1UPTA 2ZRMA 3FDIA 3HPRA 3DMDA 5AK0A 5H70A 4DSUA 3TUZC 1O3YA 1ZUNB 1JAHA 2IYYA 4WZAE 2G77B 3EIEA 3GJ4A 1XPRA 4ZI3A 1S3GA 5AUOB 1RRCA 4BPBA 3ZQ6A 4C0LA 1OT3A 1LV7A 2GHIA 3DKVA 4KYIB 4XOIA 5KOYA 3IHLA 1NG1A 2FF7A 4EAQA 2MSEB 3K1JA 2R9VA 4G5QA 1QHHA 4I99A 3U3RA 4UKDA 4Z1MD 1VECA 1GSIA 3QF7A 2AD1A 4Y0VA 4X8OA 4CRWB 3KJHA 1AZTA 3E2IA 1KZGB 4L8GA 4B48A 1JXOA 4URXR 4GP7A 1FUKA 3IPXA 1GIAA 1OFHA 3F5FA 2I1VB 2QTHA 1J8YF 1ZM3A 4PPFA 2J5XA 3SU8A 4LY6A 4PAQA 4R98A 2IHBA 3NH6A 3ADDA 1KMHA 4XD7A 3BC1A 3PG5A 4EDHA 1HEIA 4DEXA 4CEJA 1ONBA 4LV6A 4UNPA 3QKUA 3GJ7A 5HKKD 4RZ3A 2IF0A 4JT2A 4F4IA 1IQPA 1FNNA 1MRSA 1QHHB 3T61A 4RKEA 5CYOA 4P4SA 5CLQA 1QHGA 4TN1A 3CM0A 4LOAA 1GTVA 3HDTA 1UEJA 2QZ4A 2JIZA 4AIIA 4ASUD 4DLZA 2A3RA 1M7BA 5EUQB 4E5UA 1NMXA 3ZYCA 1JR6A 3GP8A 3U3MA 2FWRA 2QE7A 3K70B 2WKRA 1UKYA 4HB0A 3ONWA 1KMHB 1ZNWA 2DR3A 4MGZR 3BGWA 1P2TA 2CCJA 2X8AA 1P3JA 2XB4A 3ETLA 3BS4A 1RW4A 3BFVA 5JJIA 5FFMA 5CK4A 5E4FA 1IXRC 2V1UA 3KQKA 4JLJA 1II8A 2ZRAA 4H1VA 1KOFA 1Q44A 1XP8A 2PZFA 2ZE7A 3VR4A 1X1SA 2IS1A 3HYRA 1SULA 3BFKA 3LQRA 4P4SB 4HAZA 2ZR0A 4HB2A 5P21A 4B44A 3NHBA 4KFTA 3L8ZA 1XPUA 4L4UA 3KB2A 3IIMA 4WZBE 3DHWC 4XTCS 1A5TA 1EWQA 1YR7A 3WMFA 3IGFA 3QPWA 1ZRHA 2AN9A 1GL6A 2ZS9A 3C16C 2ZYUX 1FL9A 3W6OA 4R2IA 4WIAA 4A8JC 3BOSA 4JJKA 2P0EA 3SJCA 2GBLC 4M53A 4O0MA 2O8BA 2C99A 3K8YA 3L0IB 4FMCB 5J5CA 1T5IA 2AHOA 1IN7A 1W48A 2WKPA 1DAGA 1L4YA 4D81A 4DT1A 1ANKA 2WJIA 2NQ2C 2ZU0C 4Q4AA 1EX6A 3PXGA 1FPMA 2V4ZA 3CNLA 4LBYA 3GJ0A 4MDEA 1CRQA 1KDPA 1A4RA 4LK2A 3R7WB 1N0UA 5EUMA 4MYCA 4D26A 3B2EA 1SKQA 3W8RA 2IX3A 1OXSC 3AVPA 2GWHA 1TUIA 2ZVPX 3B1WA 3C8UA 4D6PA 1E0AA 1N25A 2C2HA 1Z0IA 3P4YA 1DAHA 2WPDA 1ZU5A 2LKCA 3RABA 2VSOA 2DY1A 3I32A 2O8BB 2HLDD 2KBFA 1C4OA 2RGDA 5DH9A 1NMYA 1X1RA 1TTTA 3OIWA 3CF6R 2H5EA 2J7PA 2NTYC 1G8YA 1DO2A 4DKXA 1W5TA 4KVAA 1ZVQA 4PAOA 2JCSA 2Z4SA 1B23P 2RGNC 1G9XA 3I5XA 2A78A 2J0UA 4NYIQ 4II7A 2H16A 5JECA 4HAVA 4EPYA 1RYFA 1N6OA 1G3MA 4HZIA 5HR5A 2WWHA 3AVYA 1ZC3A 3EWAA 1T6NA 2CK3D 2JLQA 1W7AA 2IYZA 2ZRGA 5FBWB 3RRZA 3VQTA 4EPXA 1YZGA 3QPVA 3QPUA 3RSLA 3A1SA 3RNLA 1JR3A 4ERNA 1LF0A 5K8IA 2L0XA 1D2NA 1XDBA 4U00A 2CBZA 4TYPA 4XVRA 4IFEA 4YDHB 2ODNA 4URUR 2YWHA 4DLVA 2VTKA 2HCJB 2FDCA 4FMBB 4DCTA 2AK2A 4HLDA 4P33A 4XVUA 1FMJA 4JL5A 3OFND 3CIOA 4TMXA 1FZQA 3DEFA 1G16A 3LXXA 4QJ5A 3MD0A 4L16A 1HE1C 2FSHA 4LPKA 2UKDA 4G5RA 4OHVA 4OL0A 2V6IA 5HZHA 3NDBB 2IXGA 5HZKA 1KI4A 3HP1A 4F93B 1GRQA 4RD2A 5CDFE 3AB3A 4A6XA 5JMTA 4JSTA 4R7ZA 4BZXA 4ZCMA 4OQFA 1CULC 1DAKA 2IL1A 3I92A 4W5HA 5JLJA 4WVFA 1G18A 1QHYA 3DMNA 2WWFA 1HQYE 3UK6A 1D8TA 4PPGA 1A82A 2QMOA 1W36B 2ZSAA 3UWKA 1FOEB 2GXSA 1VKJA 1XXHE 2EFEB 1U2RA 4UNNA 3FKQA 3FMPB 4BWYA 3ADCA 2QMEA 3REFA 1FX0B 1OIVA 4NKRA 2FSGA 1TAGA 3CNNA 4B47A 4TSFA 2A30A 1T3HA 2OBMA 3QQ5A 5CJPA 1Z6XA 3I61A 1XBTA 3HR8A 1R0YA 4RKFA 1JR3E 1W4AA 3CW2A 4GNKA 4KJZA 1KTVA 2WM9B 2ATVA 5CB6A 2GXQA 2VHCA 4W5WA 1GL9B 1MV5A 3OESA 2QROA 4HZUA 1YZKA 1MO6A 1BMFD 2ZSEA 1QHSA 3P20A 4Q4JA 4AKGA 1FUUA 2VRWA 3FFAA 4Z51A 1ZM4A 1HA3A 4NU0A 4F7WA 3H4MA 1Z63A 3ICQB 3FHTA 1CKEA 2YC2C 1IBRA 2ZJ2A 1OW3B 2F3TA 2OM2A 4LBWA 2GEVA 3I1FA 4BGDA 5GVRA 1M7GA 2REOA 3LD9A 1RKBA 1A7JA 4Q9KA 2O8FA 3A36A 1L4UA 1DADA 1F5NA 4P32A 3WP1B 3DDCA 3AKDA 3KXLA 1R6BX 5GJWC 1E9EA 4B71A 1NY5A 5J4KA 2OFWA 2F1JA 3BBPA 5FH9A 4I4LA 3O8CA 2J3EA 4D25A 1Z6GA 1U0JA 4D82A 2FJUA 3PIRA 1S9HA 2XNDD 2FN4A 1ZD9A 1J8MF 3T1OA 3EA5A 3ICEA 4HZUB 1A2KC 1HUQA 2YJTD 3JVVA 5DN6A 1G19A 3BH0A 3D8BA 3NBYC 3K0FA 3SEAA 1Z0FA 1J2JA 3FKSA 1BOFA 2FFAA 4JLOA 5A0FA 5J40A 1G4AE 3KB1A 2J46A 5JJLA 2P6NA 3I72A 3RRNA 5IHPA 3QKTA 4XWOA 3WYGA 2D74A 1NY6A 1L7VC 1K5GA 3MJHA 2GJKA 4B3XA 2PT5A 4KFUA 4WW0A 3FMFA 3LVRE 1W46A 4EFNA 4V0ME 1P60A 2OT3B 2DWOA 3K70C 3T1VA 2GXAA 3SDZA 4YMWA 4OK5A 3WMGA 5KPDA 2OE2A 2YOFA 5SZJA 4NMMA 1D2MA 3K0FB 2XSZA 1PV4A 2KWIA 4OQXA 1KI8A 4D4LA 2ZITA 4AD8A 3MRSA 1LS6A 2YHSA 1T0JB 4LUCA 2GCOA 5IK2D 2YWEA 1XRJA 1XD8A 1VHLA 2GZDA 5TVKA 1YZNA 3SFVA 4E03A 4CEIB 1JQJC 2UVQA 4DJTA 4EFLA 6Q21A 3AF3A 2IT1A 3SQXA 3CBQA 2GA8A 2NO6A 4ABYA 4Q1BA 4R9UC 3AKCA 3RWOA 5KSOA 4DVGA 4A2QA 1E2PA 1SXJA 3Q7PA 5AJWA 1DAMA 3K0CC 3VU9B 821PA 4Q01A 4HAYA 1NIJA 2X19A 3BJIC 4NYJR 4B74A 4RZXA 1NSFA 4IOJA 1S9DA 4IEIA 3K0EA 4NDZA 5F3WB 1KSHA 3REGA 1X8LA 1ETUA 2Q3HA 4DB4A 1GZSA 3GJ3A 4X8LA 1QF9A 4B2LA 2O52A 2ZRJA 2GCOB 4B43A 3QENA 2EVWX 4B2IA 2ZPTX 2ANCA 4OK3A 2CNWD 3OF5A 2C9YA 4QOSA 4C0QC 5GVSA 2FEOA 5G3YA 1G6OA 4OI0A 3AP3A 4BZPA 1L2TA 1SQ5A 2Z5FA 3GEEA 2DYKA 2XSZD 5FL3A 2P2LA 2ZI7A 2FZLA 1N5IA 2CHGA 1NBMA 4NYMQ 1QBKC 1E9FA 5AWFC 4NL4H 2OUKA 1XTJA 1KSFX 1R7RA 5JCPA 2UZ3A 2ZI5A 3SYNA 2XXAA 3LFUA 3ECCA 1S3SA 1A1VA 4JKYA 1CTQA 4HDOB 2C96A 2J9RA 4QBFA 3K0SA 1TPZA 1E6CA 4PZLA 5J4YA 1YQTA 3IIKA 5FPHA 1U9IA 2BVNA 4EPWA 4PFSA 3LLUA 3IUYA 4POAA 2QSZA 4KVGA 3UANA 2JAQA 2EFHB 2X77A 5FPYA 1SXJE 2B8WA 2HF8A 1W0JA 3IEVA 2PL3A 2PZGA 1TF5A 3GLHB 3U4QA 2C9OA 2RAPA 3V9PA 1Q1QA 3J81k 2J1LA 1SGWA 4O2LA 3ADBA 3AF4A 3QVUA 4ILEA 4KBFA 2QTVB 4UJ3A 2DPXA 2VO1A 4JLBA 4QHSA 3HR7A 2VF8A 4A2WA 1EX7A 4ZIRB 5AUNB 2J0QA 1OIWA 3OIVA 3AV0B 5KNDA 2HT6A 1TQ2A 3GJ8A 2WIBA 4BLTA 2HXYA 3U7HB 4DB2A 3A4LA 4PO8A 2NMVA 1ZCAA 3L0OA 3QOFA 1KAOA 2C5LA 1T0HB 2PJRA 1GDDA 4IOMA 3VNVA 4XIGS 1UBCA 3W8NA 3BB3A 3U4QB 3DVLA 1ESMA 1HT2E 1KDTA 2RKOA 3G5UA 5FTNA 1Y3AA 1AQUA 2W83A 1OF1A 1LTQA 1TEXA 2Z4RA 5CM9C 2F43B 4Q1AA 5JEEA 1ZC4A 3O8DA 3QJYA 1RJ9B 1G1MA 1UF9A 2VP0A 4M1YA 3H86A 4B35A 4IDOA 1E4VA 3W34A 2OV2A 3WMEA 4OHXA 5JSZA 3P32A 2O0KA 5DNYB 1W36C 2P65A 2BMDA 3EAQA 1NRJB 4LV5B 1Z83A 2W0MA 1QRAA 3BH7A 3T1TA 5DI9A 4RD6A 3KQHA 2PBRA 4JVMA 3FWYA 5H8WA 3T35A 3QKRA 3UPUA 1ZUHA 3E1SA 4ZCLA 3L43A 421PA 4BFYA 1K5DA 5C46F 3ADKA 5TARA 3K09C 3AUXA 1E2IA 1S4QA 3R8FA 3CH4B 2P67A 3LQQA 5L8VA 2CE2X 2QGNA 4EFMA 2GZHA 3B1YA 2N1BA 4YMTA 2CDNA 5JSZB 1E99A 2DFLA 2B7BA 1NLYA 1XJCA 3U61B 4DBLC 1H8HD 3WYFA 2O8DB 1OYWA 4RD4A 2AKAB 3TIFA 2RGGA 1KK1A 2J0SA 1JJVA 2EFDB 2QPAA 3QKRB 5E7IA 3KL4A 4NP6A 3BB1A 4LSGA 2CJWB 3VX4A 1G21E 3PUZA 4PZZA 1E0SA 5KNBA 3ZD7A 3BERA 4NCHA 4PANA 1E9BA 5C1BA 5FTJA 4NCNA 3W5IA 4D0LB 1OFTA 5EQTA 2ZYVX 2BKEA 4G5OA 1KI2A 2IUUA 3PQCA 1E94E 1VMAA 1SHKA 3TMKA 3U60B 2A5JA 3BAFA 3CRW1 3ZD6A 3MFYA 4BLOA 4TLCA 4KFSA 1R5BA 2EQBA 1UKEA 1FTSA 5BYKA 2V7QD 1T8TA 3CNOA 4B3GA 1KNQA 2QEQA 2C03A 2VBCA 3T5GA 5BN5A 2R62A 2G88A 2B92A 1P5ZB 1Q1BA 4D4JA 4WXPA 1E32A 1KI7A 1T3LA 2JJ1D 3KFVA 2ZETA 3GLGA 3SOPA 1JEDA 4BQSA 1S2MA 2BKUA 3PCRB 4PQYA 3SN6A 4IJMA 2BM0A 3UKDA 2GCNA 4V0KA 4MGYR 3AKYA 5E3HA 4ZKDA 2AWNA 5IF9A 1IHUA 2FPLA 1GWNA 3M0EA 1TF7A 3NWJA 4P31A 4FI3C 4RFSA 4KU4A 1P9WA 2QAGA 1AKEA 3A8TA 3SHWA 2X1VA 4BFZA 1SKYE 2X2FA 5FPSA 3EZ9A 1RFLA 4BLRA 2QG6A 2R6GA 1Z2CA 1RRFA 3K9NA 3EWSA 4QGGA 3LO5A 4Z8YA 3LWNA 2PEYA 3IHWA 1GUAA 1S0UA 2QAJA 5JI2E 5KU1A 1RRPA 3CH5A 3TSOA 1E2DA 1B0UA 2KBEA 4CDGA 1E79D 3WYAA 4PO9A 5AJVB 1Q3HA 1IM2A 1CS4C 4JZKA 1J70A 1W0KD 2GDJA 1OB2A 2C8VA 1XNJA 4NPHA 2W2XA 2ZAMA 2UZIR 4RFSB 2JJ2D 3DZ8A 4DUGD 2QAGB 1KSGA 2F9LA 3U3KA 4EPTA 4Q47A 4LJAA 2QSYA 2ZJ5A 2OZEA 2W2VA 5HKKA 1ODFA 1RRGA 1TX4B 5F2EA 5GJVC 4Q4HA 4YMUA 4AG5A 3VFDA 2PZEA 3QY0A 4BFTA 3GLFA 4DLWA 2BCJQ 4G5SA 4KI0A 4BZQA 4PC2A 2C04A 2WSSD 2ZUBA 3KTAA 2HDNB 5EP4A 5H68A 2AD5A 1MOZA 4N0DA 1GNQA 1G291 4Q21A 2AWOA 5CIQA 4M1SA 4ASUA 2JLRA 3TNFA 2IEYA 4ACAA 2W2TA 2XTMA 2R2AA 4KXFB 4ZDIA 2ODWA 1U0LA 2QBYB 1SVSA 1AGRA 3PJRA 1DAEA 1ZBDA 1Q22A 1E1RD 1G3UA 4MKIA 1T5LA 2ZVQX 3TQFA 1UFQA 5JI3E 1N6RA 2ZYWX 4IOLA 3TAHA 2I1QA 3K9HA 4C0KA 4WZ6A 1PLLA 4Q4HB 2QU8A 2ORVA 2WJYA 1FMLA 2OCYC 1NL3A 1IAQA 1I2DA 4RD3A 4B32A 2IYSA 2QQEA 3B9PA 3GMTA 4TQ9A 3WXMA 2IK8A 1ZM9A 2GJ8A 1IXSB 2PMKA 3GFPA 2VP4A 4W7SA 4KITB 1W44A 4Q9JA 3WRXC 1QHIA 2BJWA 3WP0A 3QIAA 1G7TA 4TTRA 4CZ2A 1E2NA 2BIFA 2OEPA 4QNRA 5JBQA 5JRZA 4YMSA 2OLJA 5FPKA 1T4GA 2WTUA 1Q1EA 1G3RA 5KO2A 1KGDA 3THWA 3LA6A 3TBKA 3A6PC 4P4UA 1AA9A 2OCBA 2A5YB 4P0TA 4UXJA 4MYTA 2R6CA 4G1UC 1T9HA 2DWQA 3GLFE 1E3MA 3U6BA 5C4MA 2OILA 4JJZA 4MRNA 3RWMB 4DDVA 1JPNA 4EQ6A 5KHOC 2ZI4A 2KB0A 1G6HA 4JBXA 2WIAA 4BLQA 4HSEA 2CVHA 4J0QA 4BUJA 1OXTA 1X8KA 2DFNA 1ZJ6A 4B34A 4RFVA 5FBRB 4PR0A 1WE2A 1XMJA 1DELA 4PSVA 1E2QA 4DCUA 2JLZA 4CEJB 2VYFA 1XCGB 1Z6YA 4HEJA 4M1MA 4Q9HA 3FHCB 3OEHD 1SVOA 5DI3A 4ZKEA 5KDLA 3SJBA 4A6PA 4RZUA 1W47A 3RS7A 2J0VA 4V02A 3UATA 2QM7A 4FWIB 3I8SA 3ZZTA 1GM5A 4BFVA 4QBHA 2BBOA 3QG1A 3BK7A 4LV8B 4TLDA 3ZVRA 4C0HA 2HLDA 2PX3A 4PX9A 1NN5A 1LY1A 3THYA 3CX6A 1N5LA 4U02A 2BOVA 4EQ6B 2Q3MA 1E69A 4LHVA 2CL6X 1VCOA 1IJEA 2W00A 621PA 3ZQJA 3QE0A 5EP3A 1R8QA 2WHXA 3BH6A 3TVDA 2OSBA 4LJ5A 2E1RA 3G0HA 4P3YA 1Q0UA 4LJ8A 5TY0A 2YWGA 4GL2A 121PA 4PHFA 4PQRA 3AVTA 3QEJA 1E2LA 1II8B 3FYHA 1DG1G 2CK3A 3EC2A 1JAIA 4TL9A 1P2UA 1KO4A 4FN5A 4XWAA 4B3BA 4U7DA 3FFBA 4Q00A 3LW7A 4JBYA 1E4YA 4BFSA 1WRBA 3THYB 1C9KA 1N5JA 3U3OA 2PCJA 2RHDA 1XMSA 3FPAA 3R20A 4NCKA 4DSTA 5EE3A 3LXRA 4ESHA 1R5OA 1JXMA 4MUBA 3OHMA 3PEWA 1XFAA 1YJ5A 3B1ZA 4W9MC 1AM4D 3N70A 2HV8A 1ZINA 1JB1A 3SFZA 4A15A 2W6JD 3OFNA 4PSKA 3N2EA 2NOAA 1XX6A 5CDFA 1CF4A 3VR6A 4KYUA 1VG0B 1SVMA 3EPJA 1N6HA 5HTKA 3ND8A 1MABA 3ZZ0A 1YZLA 4Q7JB 5KSPA 4DT1B 3SJZA 5D3QA 4MA4A 1HQCA 1SVWA 1ZAKA 3KJIA 4Q4AB 4PTLA 4N0EA 4EPVA 2YVUA 2NG1A 1TQ4A 4YXWD 1XXHA 3HWSA 2OHFA 2C95A 2NO7A 4HDQB 5LBIA 3UG6A 2JLYA 3TVTA 3I73A 4IOKA 2LKDA 4Q66C 1CR1A 2O8CA 4MGKR 3CX7A 2EYQA 2FMXA 3NIBA 3K0AA 4IXMA 2JJ8A 1E2MA 2ZU6A 4B3FX 5FBVB 5AJYA 3ASZA 1IY2A 3BWDD 2WKQA 4GZMA 2BBSA 3IO3A 5L3VA 2A5FA 2KE5A 4FIDA 3GFOA 2WMNB 3AP2A 3KJGA 3EIHA 3M1IA 3EPLA 1HY3A 4IDQA 4OKSA 1MABB 4EKDA 2CE7A 5GJBA 1WBBA 3VKWA 4MRVA 1RPZA 2GJAA 2WV9A 2ONJA 2J0UB 4CIDA 1XXHB 3UG7A 4US1R 4KHZA 3ZVNA 5J4LA 3PUYA 1LFDB 5HE9A 1BMFA 1RYHA 3TE6A 4EJSA 3BRWD 1ZIPA 1OPXA 1QVAA 2PMDA 3QF4A 2GCPA 1JI0A 5BQ5A 3BD9A 3MJRA 2HJGA 3K0AB 4MQBA 1XU4A 2PT7A 3IBYA 1XEWX 2QGZA 1XTSA 3NEJA 1ZM7A 2VHTA 3KKMA 2O5VA 4IEEA 4JVNA 3SHFA 1CEEA 2ODEA 1EWRA 2WAYA 3KUCA 4HDCA 4WOPA 2ZROA 3QVVA 4QBGB 4M9SA 1NIPA 1GP2A 5SZIA 2XZLA 4TYWA 2J41A 3QBTA 5FPTA 3OE7D 1FFHA 2XNDA 4ZCIA 4JMPA 2IYUA 4QGAA 1XPOA 3AF0A 1NVVR 2ZRIA 3OZXA 2CL7X 2FPKA 3LX5A 1BIFA 1P75A 1OXVA 3MWLA 1NG9A 3WNDA 1DEKA 4KSCA 2DB3A 3I5YA 1M74A 1ZIOA 5JS7A 4BRUA 3U7EB 1OH7A 3AQ4A 1FQKA 3AKEA 5BN4A 2AFIE 2P6RA 4V0MA 1Q20A 3P4XA 3DPUA 4CYMA 1WB9A 3PENA 4TLBA 3A58B 3DL0A 3Q85A 5JWHA 5FI0B 3D7MA 3DKPA 1XMVA 2HJVA 3D31A 1W4BA 4WA7A 3RAPR 5BN3A 5HPYB 5ELXA 4AKHA 2CXXA 3W5JA 3VAAA 2ZSFA 5A4JA 3CUEF 5EE1A 2F1RA 5B58C 2ZXUA 2YC4C 4EPRA 4AI6A 2RGBA 4FCTA 4IDHA 3X1DA 1UBEA 1OKKA 4UNRA 5IK2A 4G3XA 2CLDX 3W90A 3CWQA 4K46A 2ZRFA 3U2QA 2PLRA 4DWJA 1QHXA 4OHZA 1KO1A 5B64A 2WJJA 4X8MA 5C2JB 3R9XA 1P2SA 2ZYTX 4Q4JB 1N6KA 2WAXA 3L2OB 2AFHE 4B2PA 2G6BA 2VHJA 2H17A 4KODA 4O2RA 5CYPA 4CW7A 2XJ9A 3IBGA 3P27A 5G53C 1Q3TA 2J59A 1LB1B 2FU5C 3QNUA 3SYLA 1Z5ZA 3SYKA 2XZPA 1CJUC 2O8FB 5F9FA 2CEAA 4L9SA 2GF0A 1G17A 5EXPA 2CNWA 3I3SR 3LH5A 2G0TA 1U81A 2G1KA 2WJHA 2AX4A 1W1WA 3C41J 1DPFA 3GD7A 3FHOA 3KXIA 1F2UA 4DSOA 2FEMA 3A37A 4Q48A 3TLXA 1ZNYA 3BFXA 1MR3F 1OB5A 1Z28A 4C0AC 1OKKD 4C7OA 3SBEA 3SE0A 2IS2A 3LY5A 2IW3A 3P26A 4JKIA 1R4AA 4Q19A 1KY2A 4LYHA 4V03A 4PC1A 3VR1A 4FMDF 1II0A 2DFTA 4FXPA 4C0SA 2FGKA 2VL7A 4IVQA 4OBEA 4GP6A 4JIMA 4B3CA 2PX0A 4RJLA 4O3MA 1UADA 3B6EA 3FE2A 3CF0A 1CXZA 4LYFA 3QXHA 1PVOA 4XJXA 2H57A 4JBWA 4TL6A 1J7KA 2ZI6A 2V9PA 3AVUA 5DSZA 1UJ2A 1F2UB 1L8QA 1CBUA 1OJLA 1KJWA 4GI7A 4C4PA 5BXQC 2IYLD 4C7OB 5JHHB 5J4VA 4AK9A 4ACBA 1WA5A 1ZUIA 1ZNXA 2GVDC 1E9RA 4QBIA 2XB2A 2BHRA 3HYTA 3IQXA 2JLXA 2YOHA 1P62B 3CRVA 5TMPA 3B82A 4OI1A 1KO5A 1ZNZA 3TK1A 1N5KA 2ORIA 2W6ID 1WQ1R 4MKGA 4DZZA 3OAAD 4HAWA 2FGJA 4PC7A 1SXJB 3EG5A 3EIQA 2IWHA 4JLDA 3FOZA 4ZI2A 5FI1B 1J90A 1Z6TA 4M21A 1V43A 3AVWA 1E2JA 1D5CA 1NN1A 2OCPA 2ZIAA 3QXXA 3B9QA 3AP1A 4KFRA 4KV9A 1KY3A 1P72A 4CGZA 1XEFA 2F6RA 2IYRA 2WWGA 5JRJA 4TZ6A 1OHHD 2A9KA 3KUDA 2F1HA 1NVUQ 1CR2A 4LJYA 4GOKA 3MGCA 2OG2A 2FE4A 4V0NA 1E9SA 4RD1A 5JWOA 1N6IA 4A92A 1X6VA 3P1JA 3T1QA 2XITA 1GITA 2FA9A 3C14C 2NO0A 3CWZA 3AEZA 5AUPB 4ITRC 4IKEA 4TT3D 5G3ZA 3ZVMA 1G3QA 1Z22A 2BCGY 2OFOA 3RHFA 4B3DA 1TQ6A 5F98A 2V55B 3TSWA 1DTSA 2RGEA 4B33A 4GRAA 2ZS7A 4E09A 1XTKA 2ZRDA 1MO5A 4TYQA 3UMRA 1UM8A 3SNHA 4D80A 1PLKA 5KDOA 2F1IA 1F60A 2XXAB 2BJVA 2Q21A 4URYR 1W2GA 5JCZA 1XEXA 4XVQA 5KYKA 2IBMA 2JEOA 1R0XA 4PPNA 1N2CE 3QBVA 4BEJA 3CPJB 3VHXA 2QL6A 2CLCX 1E2FA 1VPLA 1E9AA 4C0JA 1VDZA 1Z3IX 2FSFA 1D2EA 1P9NA 4LI0A 1TNDA 4ZDJA 3M4YA 4H1UA 4FINA 4KO8A 1F48A 5E95A 2XTZA 1JBKA 1PLJA 3I62A 1GKIA 4A0HA 1E0JA 1WCV1 4FWTA 1HH4A 2ECKA 3NHAA 1F3OA 2E87A 3GCGA 3HU3A 4PSAA 3WRYC 5CLLA 1EG7A 1FP6A 2FFBA 1ZP6A 2R6DA 1TADA 1H8HA 2ZQ5A 5CITA 4Q7LA 5JEDA 4URZR 4PZYA 1SVKA 4XWKA 1XEXB 4A4DA 1FQJA 3NVAA 1IXZA 4IDPA 4F91B 3KKOA 1J99A 2DHRA 1VCIA 4C3ZA 2RCNA 2D4HA 1GRNA 5EE5B 2F7SA 3NTUA 2Z83A 4DCNA 2H92A 1CJKC 1ELOA 2IYXA 4H9GA 3QUSA 1Z06A 3LNCA 2GBLA 1YHNA 4TMTA 2FFQA 2ZI3A 4F4CA 4TZ0A 3U44A 1CLUA 2NZ8A 4ZO4A 2V7QA 3IQWA 5UKDA 3VR2A 4Q9IA 1KKMA 2Q6TA 3TJZA 1ZD1A 2DFKB 3T34A 2IA5A 3THXA 5LB4A 4QJ3A 3B13B 5IT5A 2FV8A 3BB4A 5L3SA 2JA1A 2FX3A 1HE8B 1JPJA 4US0R 1XCPA 2JJ1A 1D9ZA 4Q7KA 1MT0A 3RYTC 1DO0A 4NYJQ 4V0OA 5HCIA 1Z0AA 3GLIE 4I81A 1Z2AA 1VHTA 5EZ6B 5FOWA 3U3JA 1RC8A 1OSNA 3VMFA 3ZLJA 1IN6A 2ONKA 4MKHA 4RVCA 4D2IA 1N6PA 1T8UA 2AXNA 3MCAA 5FL7D 3PUVA 1U94A 4A0GA 3U44B 3TUJC 1KMQA 1KYIA 4JLPA 4L5BA 4BFWA 3W9YA 5K8LA 2P5TB 4NONA 4DLTA 1EXMA 3MWYW 2ZE6A 2WJGA 1K6MA 1C1YA
chains in the Genus database with same CATH superfamily
2ZJFA 1FFWA 3HY3A 1KIAA 1PSZA 4BIMA 5DP1A 3Q3JB 3NXSA 5ALIA 5LU8A 1QFJA 3SMVA 3ZI4A 2H3EA 4JCOA 3EPKA 5TEVA 2P75A 2JHFA 4XGKA 1D6SA 2Q9BA 5H1YA 2JFHA 2ZYAA 3QPAA 2YJNA 5FEMA 4Q16A 2PO5A 3VNAA 3C97A 1E79A 3MTQA 2CL0X 4UVEA 1P2VA 3BGDA 3HI6A 1GKLA 2B4YA 1ORDA 1I4LD 4EBBA 5EKTA 1QCZA 3I37X 5T4BA 5DHFA 4BO0A 3VHLB 1NVDA 3NBZC 3VPBA 3WSTA 2XQFA 2EFYA 3FA2A 3VUFA 1DC8A 1EFLA 4D3YA 2AN1A 1LNZA 1VJ1A 5ALYA 2PSFA 5FRDA 4C4AA 2WF9A 3L6DA 5KNDH 1TUBB 2FWNA 4J49A 1UBSB 3HDJA 5LU9A 2DEUA 2CMKA 1L5NA 2VPIA 3HBMA 2C4HA 3LAWA 2IHJA 3NPAA 2B6HA 2FLKA 2WYIA 1AZSC 5D85A 2R8OA 3IBCA 1A9ZA 1OX6A 2XTNA 4BLSA 2J3DA 4R2MA 4XX0B 5SY4A 4KLZA 2GH1A 2QA5A 2O5CA 3K5WA 3VDQA 2NUPB 2WSSA 2MYNA 3PITA 3KEQA 2VP2A 1KAHA 4N1AA 3K9CA 2QRLA 5T64A 4X7BA 3TG8A 3Q9LA 5LD2B 1JHAA 4OO3A 1SD2A 1XDSA 2GEFA 1ECJA 2PZ8A 2WY2D 3ZX5A 2GNOA 3KQSA 1DEAA 3BJRA 3BMCB 1SIOA 1TQDA 2HK6A 3FNGA 5AYVA 2IS4A 1KH2A 1R2QA 4K3VA 3AFHA 4IGFA 4JLKA 5K3CA 1OVGA 3HEAA 4DA7A 1WF3A 2NUBA 1THZA 2FCRA 3JYLA 1U2DA 2IEIA 1EXNA 1OYVA 3FCCA 4DRZA 5DYNA 5T3UA 2V3CC 1IVYA 3V4RA 2WP8J 3LOQA 5FR2A 3UWOA 2C2ZA 4ZCTA 5IC4A 4ARCA 3AGQA 1JEQA 1EFTA 3UW1A 2ID8A 1C9YA 3GVHA 2UZAA 1FIUA 4KGZA 3VYRB 1O58A 4BP9A 1Y34E 5KAMA 4Q1DA 4NH0A 4DHEA 4XTRA 5ALPA 1CRPA 1CV2A 2CL5A 2CLSA 2NSDA 4EVQA 1T91A 2RK3A 2X5OA 4M9ZA 4TMKA 5IFKA 4D0GA 1HOXA 4NSNA 1W88A 2JIMA 1U0FA 2QN2A 2X22A 3CRQA 4YR7A 4G4GA 4BXOA 3DOEA 4HWSA 3OQBA 1SQ0A 3L8DA 1HURA 2XKKA 4WKBA 2MSCB 3THOA 4RL4A 3PSAA 1C4XA 2EEZA 1ZM2A 3AESA 1DTWB 3DYIA 1SHTX 3ZLVA 1YQGA 3RRBA 4BDSA 4L6CA 4CE6A 3EEQA 3U49A 4UTVA 4BNJA 1GVHA 1VIDA 3EXFA 4AURA 1EFPB 2V98A 3KQLA 4DV2B 4DEYA 3JW8A 1KVUA 2TYSB 3H9UA 3RIMA 2X4DA 5JH7B 1BDHA 5GJCA 1SCUA 3EZ2A 1CQIB 4FFVA 2V5UA 1COZA 2MIIA 2QT0A 3H9BA 2HJWA 1O96A 2MDTA 4QX6A 4ZAZA 4LYJA 4D4MA 2NZJA 4YCNA 1A72A 2Z2KA 3R5FA 5ALEA 4LISA 2FJ0A 2ZTSA 5HF9A 2NU8A 3E9DA 4DC9A 1KEEA 2AEJA 1R18A 1L7RA 4R2XA 3UB2A 3R6WA 5TMBA 3ZW9A 1FU8A 2HREA 2PBFA 2ZJ0A 1JXAA 4LBVA 4X24A 1RAGA 3WLSA 4A0SA 2QB5A 1AGPA 1L7DA 4BQPA 3PV0A 4LTDA 4PC3A 1MT3A 1U8AA 1BD4A 3L05A 4ON9A 2FK7A 2GUGA 4NYIR 4TUYB 2QENA 3CPHA 4Y6OA 4EJMA 3DB2A 3GLRA 2IIQA 4PLFA 4L57A 2D2IA 3B78A 4DIEA 1LA2A 4GSYA 4RHEA 2W71A 4BNDB 1JWBB 1CUIA 1JPUA 3OCWA 2ZUCA 2ZEJA 1O77A 4OJYA 4UUNA 5HNKA 3IELA 4LCBA 1GN9A 2P6UA 4MA0A 2G70A 1SBNE 4LTNA 4UZSA 3TS1A 1UOEA 3ELYA 1T3SA 2QT1A 4F71A 2ZJAA 1AK1A 5CNJA 3T7DA 3M70A 2WW8A 3WGGA 3ZQUA 4OOFA 5LZ7A 2ZSBA 4MMXB 4Z54A 3U3OA 3ZWVA 1P31A 5JE8A 3JWEA 4JH0A 2BM1A 4KRGA 2C5BA 1DAIA 2J9XB 3GFSA 4WI1A 4ZDWA 3VC2A 1PJSA 5EZYB 2WJZB 1I3CA 2OGUA 2I8LA 1XQYA 4RU1A 3WLAA 3ZWXA 2G9VA 1ZGBA 2DZDA 2BISA 3HJUA 4JJIA 3RRMA 1AKYA 3V4FA 2JJQA 4GEKA 4RJ2A 1ZU4A 5DBFA 3LT2A 2JJMA 1J25A 1ZD2P 3PXXA 3ZVLA 4KNYA 5LLTA 2OHGA 4C0WA 5DTQA 1EGAA 5AOCA 3AVXA 2AQ8A 4AJNA 2WVJA 2WKSA 4P5EA 1B76A 1QK3A 1M1NB 3OURA 3RG8A 5CIWA 4P34A 4A1OA 5A6VA 5KYUB 5A9TA 5CBPB 1CJMA 2XJ4A 1P1FA 2XGOA 3Q12A 1UC5B 2WT8A 1HG0A 2HRBA 3HFRA 1IEQA 2CXQA 4LKRA 4IKPA 5SZHB 4BX3A 1ZAYA 3P0FA 2RH8A 4J4HA 4UBJA 1LS1A 2E5WA 1ZZEA 2O54A 2O23A 2PZMA 2W58A 2X9VA 3KAPA 4MH0R 4JDUA 2RGWA 1U3UA 3SI7A 5EJ6A 1P3DA 1IWBB 1SPXA 1VSUA 2H31A 2F8TA 4RNDB 1SQGA 3THWB 3K0CA 2H6EA 2W6JA 2ANBA 3U5TA 2IEZA 1ONSA 5AKKA 4GICA 5DGXA 1H9CA 2IY7A 5DDIP 1NVXQ 3R7AA 1KI6B 2ENUA 1GPJA 2PLFA 2F48A 2X5JO 3G9XA 5DYIA 2G72A 3QNWA 5AMXA 2UUBB 1Z4NA 1FPQA 3ET4A 1NQAO 1HTWA 3JD3A 5F73A 5FO1A 1G5TA 3L8GA 5LMCA 2O0MA 3W6NA 4CT4B 1E9DA 4CM4B 5DOVA 2SKEA 3OF2A 1RPTA 3U4GA 2G4VA 2A1IA 3EXIB 1H93A 4IIJB 3AUYA 2AR7A 2OHOA 2PVCA 3LY9A 2FY8A 3QEOA 1RC1A 4P7KA 5HIIA 1XZQA 4B3IA 4E30A 4GR9A 2OAP1 5ALLA 5IUKC 1TCVA 2UYYA 2ZBDA 2PCLA 2VQSA 4GRIA 1C9JA 2VXBA 3QZUA 3ITKA 1TU3A 2HT1A 3R5SA 3TL3A 4MUGA 2VYQA 1Y9JA 1G5RA 4U7HA 3ENNA 3K6SA 4CTKA 3A4IA 3GFGA 4BMCA 1X3SA 5AXBA 5L7YA 3VYVA 3INTA 1O95A 4I2NA 5ESWA 1IHPA 2EG5A 3BMQA 1W85B 2CKDA 3IUJA 1WTCA 3MMSA 3K2IA 4GOOD 3WGQA 4ARZB 4F86A 3W77A 2B4KA 2ESRA 2O0HA 2GZAA 1TVMA 2UZ0A 1MBZA 2H4JA 3I0MA 1GQQA 2YYZA 4HC4A 4I6JA 2ZM6B 2R79A 3EGCA 4GMKA 4BRZA 1Y6FA 2XGSA 3LX8A 4E33A 5JXGA 3C3DA 4MW2A 2I4RA 4IHJB 1MJ5A 4LXGA 3OHSX 1L5LA 3TPCA 2IXDA 2IHVA 4QTYA 4MVXA 4S04A 1H66A 1KBOA 1QUEA 2C4NA 2J7KA 2ATXA 2G9QA 4URVR 1P7YA 5IFLA 2FOLA 3KQVA 3W2FA 1OXUA 2IPXA 4OYHA 2VT2A 5DYWA 1B1CA 2QP4A 1XR3A 1DUVG 2BY4A 1C8KA 3NBFA 3DL7A 4MK4A 4OJKA 5K1ZA 3SBOA 4JFRA 1VHJA 3PD1A 4IPTA 3ND5A 2ZJYA 4MQFA 2QRHA 3JALB 2DUNA 4UUAA 4WCFB 4O2BA 2AJTA 5F52A 1Q1NA 3HB7A 1YR2A 3VHQA 4JJ8A 3ZKWA 2VH2A 3KQOA 1EU1A 2VDPB 5I7AA 1TT5A 4C3OB 1CP3A 1JLLB 4FLFA 1N3LA 4RSMA 1JDBB 1M6VA 4MGIR 3VRHA 5CFNA 4I1SA 1BYIA 2VP9A 2B4QA 2V97A 4DMHA 4MMZB 2NUTB 1NURA 1CZRA 3VR4D 1PWHA 2NX2A 2OQVA 5IJ9B 1FSPA 4RHXA 1WIWA 2XX3A 3GFQA 1J5PA 3X1YA 1DO8A 2QZSA 1ZWLA 3KR2A 3ZS9A 3OI7A 4LY3A 5IDYA 2QX6A 1C3XA 1ADGA 1I9GA 3DMFA 3H0EA 4QPJC 4RPHA 1VYVA 3L46A 3R5HA 2IU4A 2JGMA 5ALDA 1N4AA 1QV9A 4QGSA 1VIMA 3GYBA 3QYFA 3TOCA 3NG1A 1DRJA 2CDAA 4Z7OB 1IY8A 1B16A 5HQTA 5FULA 5MHTA 2QZJA 4QUGA 2YKGA 4IQ0A 1L5VA 3B6KA 3ZDYB 4E3ZA 5JYCA 3MMXA 4XUEA 3CUWA 1DSSG 1P61B 3E48A 1YBFA 1KDRA 1M75A 2HEIA 3PP8A 4ZOLF 5EKUA 3W9SA 5EYPA 4ZXFA 4GPEA 2J33A 2JIRA 5H4GA 1S8FA 4R31A 5SY6A 3LGAA 4DR7B 1EJ0A 3DMTC 3HJAA 3IXLA 2IXEA 4M87A 4OXIA 4X54A 2CV2A 3V7NA 2FWIA 2C2WA 2AOTA 2OYSA 1YS7A 4F4JA 1Y1SA 2FZ4A 5LD2C 4UU7A 2QRZA 2O8CB 4TM7A 2XYPA 1KJYA 4R54A 1K9VF 3UTDA 1JJ7A 4WOCA 3HNOA 1LXCA 3W6ZA 1ZN7A 4BVJA 1CT9A 1RXSA 2FUNB 2NTEA 3INRA 2FQ1A 2QTCA 2WJVA 3EZFA 2FZKA 4IBOA 1ZD8A 2AKYA 4JSYA 1AO0A 2IYWA 5KKCA 4X1IB 4P0QB 1DKOA 1WLSA 1TEVA 2A9PA 4QDTA 4XLLA 5DCWA 3VBEA 5DIFA 2AFIB 1J0CA 4OMFG 1R4NB 2XNCA 2Z5LA 2HFJA 4NMHA 4BUZA 4G0WA 1OFGA 3AYZB 1LW7A 1N57A 1VOTA 2GAOA 2ZR8A 4NI5A 4OQLA 3L7LA 2CXPA 1NUHA 3IA7A 3KJEA 4IVRA 5JZSA 3T3NA 3K09A 2QAGC 2IOFA 2DM6A 2ZSKA 3FHJA 3HYCA 3S0JA 1W6RA 2BC9A 3DGEC 4MR9B 2OECA 2B5VA 4P81A 4P3XA 2BF4A 4HDAA 1O7JA 1H0KA 4ZOEA 1TYBE 4MUJA 1N3IA 3TFWA 4QM6A 5TJ9A 5JROA 3GEHA 3S70A 4BP1A 1T13A 2G5GX 2RJNA 1SC3A 4YMIA 4FW9A 1Z74A 3DO6A 4C2TA 1ORIA 3FY4A 3C85A 1I14A 4CV1A 3H5RA 4ARUA 4PXYA 2Q7OE 5TIIA 1SBHA 4HDMB 3PEWA 4XYEA 4EY7A 4ER3A 5KSZA 1IN4A 2DJIA 4G0UA 2LZ0A 1E2KA 4MJ3A 3F4KA 5AK4A 5YASA 5TR9A 2PUWA 4YP7A 2PMFA 2QTTA 2QPOA 1JFVA 2LP4Y 4M4SA 1GHTA 4PXAA 4WAUA 4EJ6A 4DMRA 4CCYB 1E8DA 1TFUA 2QJOA 3AEXA 4TKUA 5FUYA 4UQLA 4FZVA 1YA4A 3SC3A 1QZ3A 1W36D 2FR0A 3QG5A 5HRUA 4MV7A 1FK8A 2VXOA 4UXHA 2ERXA 1T24A 2R1ZA 2WYWA 4NLLA 2JGLA 1OXXK 3B8HA 1Z5NA 4TKMA 5JG7A 5L3QB 4DLXA 3T15A 3TQCA 4IHKA 5JNUA 3OZCA 4JP5A 4N7MA 3TDMA 3MJFA 3W4IA 3OM0A 3R7LA 3TKLA 1DBQA 1USVA 1Q1ZA 2RH4A 4EJ2A 4JBHA 2C9MA 2C5FA 3GVXA 3NQ41 1NDHA 1EUDB 4E7PA 4MWGA 1DQNA 4Q7MB 3BL6A 1BH2A 3GQBA 5IVPA 1CPYA 2BM8A 3MJVA 4MZXA 2Q07A 3PDUA 2BI7A 3O91A 1UM9A 1I3LA 4GUDA 3WWEA 4G9EA 2Y1OA 2IEGA 3PK0A 4CT5A 5A3JA 5JUWA 1M2WA 2WQ7A 4IJWA 2ZT6A 2RHRA 3DXZA 4L5JA 2E82A 1J97A 2O0JA 2YHIA 3LCUA 1J0DA 4NCAA 2G83A 3KPWA 2PN1A 3EW7A 4YJ2B 2PXAA 2YS6A 3EYAA 4LMBA 3TZEA 4IIFA 2UXDB 4MKZA 4TMVA 2IUSA 2WVGA 3AF6A 4DR5B 1Q57A 1DKNA 3H5IA 3MIZA 3SX0A 1JSXA 1YAHA 2O2CA 1HLDA 3KAJA 3LQKA 2ZIZA 2VNHA 3HCPA 3Q8KA 2FFHA 3C5EA 4CN8A 2W4QA 4TMWA 5EE0A 3OIFA 3P4UA 1L5HA 3RFFA 3CS3A 3QYJA 3OAAA 3HJFA 3RSQA 4J3NA 5BRNA 1GPMA 2NV6A 4MW7A 4M7OA 2VAXA 1ZQ9A 2EW8A 3RTEA 3ZEIA 3DEZA 3PTZA 4E6PA 1UWLA 2FKNA 4B76A 1RZRD 1SJ9A 2CHEA 2BDUA 3JVUA 4KN8A 1WKBA 5IANA 1OU4A 3IQIX 1OHHA 2YV3A 3GT0A 3NB0A 3VU9A 1E2EA 1W6UA 2C8JA 1PE0A 3KZ1E 3RG2A 3B7GA 2XUOA 3CRZA 4QLOA 4QXOA 3S5UA 4WBSA 3NI2A 4DS3A 3OZGA 3UHAA 4PY2A 4MITA 1Q21A 3R09A 2OQIA 2NVUA 3GJ6A 4MOWA 4EHFA 2VQFB 1U0HC 4IDNA 5CA1F 1DVRA 5EJEA 4JYBA 2QTLA 4LK3A 4V0SA 4GXTA 1GSHA 2DWPA 1KHTA 2M1ZA 3BQMB 3R5XA 4EYEA 4U9UA 4ZGWA 2DTEA 2FW0A 2AZ4A 5B1DA 3S2SA 3NKFA 4NHOA 4O8ZA 5F76A 2RD2A 4JX9A 3Q3EA 1DWOA 5BSTA 1I10A 3HE3A 4BWVA 1X7YB 1C3VA 2A6PA 2VEDA 2BWJA 3VUEA 2CVFA 2XCIA 3VOSA 2DU8A 1M7HA 3X1JA 2VPYA 5KSYA 4K9LA 1W19A 2K87A 3LV8A 2DBVO 3U9SA 4D4IA 1IRIA 3FKSD 5JW6A 3U7GA 1R4MA 1KEKA 5JAZA 1TYDE 2JFOA 2CJXA 4OD0A 2DFPA 2WIKA 5A3QA 4GHWA 4D8VA 1EFCA 2Z43A 3B53X 3CMCO 3Q1LA 4P5PA 5JLAA 3CR8A 1JE1A 5FJIA 3X43A 1KAMA 5LYJA 1RYZA 5H7XA 2ERYA 3RUIA 2IFTA 1QDEA 3IUBA 1L5WA 1OZGA 3DYVA 3JQ9C 1NVWQ 1NF3A 3F6SA 1NLZA 3PDIB 1ACLA 1VIYA 2Y4NA 2YV5A 1I3MA 3E9QA 2XAUA 3UJDA 4A9AA 2RGXA 5B3AA 2PL5A 4WCFC 4QGBA 3QUTA 2NZVG 4TMFA 4O4IA 4YCAA 1VP3A 3RROA 4AJLA 2FMUA 1DOZA 3HJNA 4FMDB 4G36A 2XBLA 1N2CB 3FMIA 1T4CA 1UMKA 4NTZA 3RSOA 1V96A 1JDBC 2P5SA 3GCDA 4LXXA 1WG8A 2FRDC 2ZUWA 4PG4A 1ML4A 3UWDA 1BS9A 2GXUA 3PT5A 1L4KA 3QBDA 4G0OA 4HYYA 5FTKA 2V3WA 1RVDA 2BF7A 3EXG2 2WJAA 5FFFA 2JAUA 2B35A 3FCXA 5EG5A 4ZIRA 2X3UA 1IY0A 2WR8A 4PYMA 4BNZA 4C21A 2WTMA 3HH8A 2I4MA 4OHFA 1IB6A 1FDSA 2ASVA 3ASYA 3IDQA 4G01B 3R6GA 721PA 5L7WA 1E7WA 5LIRA 4NBLA 3T3PB 3SSMA 4BMOB 4QBTA 4WDQA 1ULSA 1GGKA 5K0NA 2OB1A 3W3AH 1WXFA 5BV8A 5LJIA 1XVTA 4IXNA 2JC3A 2R1TA 4Q9AA 2HGSA 2HCBA 3IUPA 5FTMA 1JQAA 4AMVA 1X14A 2XT6A 4W9NC 3LSYA 1HG1A 2Q4OA 1FDRA 2B36A 3M4JA 2ADFA 4C4OA 3N3AC 1TZKA 5K2MA 4Z6KA 1JSRA 5AKZA 1GKUB 2RHMA 2F43A 3L7CA 4MVJF 4MYHA 4I9UA 2FPGA 2JATA 3S2IA 2JGAA 2R4TA 3OQHA 4UDXX 3GLIA 4FR0A 3IPLA 4LHYA 1UJ5A 1PT7A 3GVPA 5M5BA 1PEKE 1V7ZA 1XRRA 2IIVA 2KJQA 1FYEA 3VR5A 1TD1A 2GFHA 1BYUA 2AMYA 2CNOA 3NFRA 2AF3C 4R05A 1CQWA 2NV0A 3ENZA 5DX0A 3ROPA 3W06A 2OPBA 4O4LA 1TJ3A 4NBSA 3COYA 3B1JA 1D2RA 3WGMA 4QFMA 4BMSA 1MCZA 1XMIA 1YR6A 1XQXA 3BQ9A 4JITA 1E6UA 3OQMA 1C1XA 1EBBA 1LRLA 3OBIA 1R0SA 3FLAA 1FTWA 1S1MA 3PUWA 4FGLA 1Y7LA 3PKJA 3TIXB 4II2A 1BMQA 4LMRA 3PDJA 4LE2A 3OEEA 2ETXA 2BFWA 2WBLC 1GFSA 1R66A 2B61A 2JH9A 2WU0A 2XADA 2EERA 2QVZX 1XTQA 4MRRA 4ND2A 3P0RA 1WXDA 5AKLA 2B1GA 3D6FA 2DXIA 2F3RA 5JZ9A 1ENYA 1ZLXA 2I7TA 3OM8A 5LC1A 5F2NA 3NGLA 2N46A 1GOTA 1VGRA 2KI5A 3H3JA 3MM4A 1KRWA 2Q9UA 3BE8A 2G4CA 5K09A 4UVGA 1YUMA 3CCCA 3NUQA 3MZ0A 3T52A 2BMEA 4DV5B 1SD5A 1JQDA 1U28A 1S1CA 2PV0A 3FGZA 4HQLA 4CWAA 4DXDA 4JYCA 4U63A 2DLCX 4BRWA 2W4MA 1UBGA 1H05A 1N1MA 2E6KA 4QPNA 3TIVA 2Q6KA 1YL5A 5DX1A 4A1FA 1U3CA 5HIAA 2I0FA 4HNRA 5DW3A 1F6BA 3O94A 1F14A 2JLUA 2XDYA 2Q2VA 2BI8A 3QKWA 3NC0C 3SG0A 3GZNA 4QU9A 5HBGA 1PFYA 1G41A 3E6AA 4MRPA 5IZCC 4L9WA 3LJKA 1Y7HA 2MSKA 4HB3A 5LA6B 2A57A 2Q2QA 1A8SA 4QXQA 2GO1A 5D5QA 1DIGA 4RCYA 3G0IA 4ZT2A 4EUNA 4PZ9A 4I50B 1M8KA 1AXEA 1PBNA 2CCGA 3OEED 3JAKB 4Y2UA 3UF0A 2CDBA 2V54A 4PG5A 3GQVA 5JQGB 1AZLA 1EVJA 5ITZA 4K81B 3PU6A 4JSRA 4OJTA 3KKNA 3F3YA 3RVQA 4Q15A 2OAEA 3STWA 1JYFA 2R65A 3KVYA 1A9QA 4EY8A 3KKPA 3SKVA 2C7OA 1PN3A 4ZPXA 3VVMA 2D7DA 4AQDA 4IXDA 5EERA 1RI2A 3IAEA 1G8SA 4MUMA 2JK1A 2YRWA 2FLWA 4NZYA 4CT0A 1SOWA 2FPOA 5D3MA 2DCUA 2DTDA 5IYZB 4DCPA 4YQYA 1EFRA 4OHBA 1I2BA 3MOIA 3EXHA 3PF9A 4Q37A 1P7ZA 2IS6A 3KSBC 3WXBA 3HABA 4TV9F 4ZFNA 1S96A 5GADl 1PL7A 2H1LA 2ET6A 2YINC 2YQ5A 3H1AA 3B60A 4UEOA 1XWIA 4EY6A 1KK0A 1PYOA 1PUIA 1RWWA 2PH1A 1NJGA 4YP6A 3KFXA 4QM7A 3HPQA 4DVJA 1KEZA 1GSAA 1R10A 1SU8A 1HRKA 2QTZA 3L1HA 4YWJA 4EY4A 3JZMA 4JVSB 5ALZA 1O1YA 3ICWA 2DUWA 2XEXA 5KREA 2XF2A 3RPEA 3AEQB 1JQEA 2VHUA 1E60A 3UYKA 4YWHA 3QKSB 3WIUA 4RCZA 4PLGA 5K8TA 5KQGA 1LPMA 4RBNA 1PG5A 2CZQA 2XE7A 2ZWMA 3FNBA 5I7OA 1SY7A 1ZR4A 4TKVA 4NOLA 2DF8A 4HLQB 1ZONA 3RS3A 4AS3A 1VLQA 5WRFA 1BE6A 3V1UA 4BO2A 2HMAA 4BX0A 1NQWA 5TQ2B 4QJ4A 3UB3A 2XUDA 3DTVD 3C4QA 1G5PA 1YNOA 1HYBA 1HTTA 1KEUA 2OCKA 1A2OA 2EEPA 2PYIA 3IKTA 5KYNA 4J3FA 3NHYA 1KJJA 3MWDA 3KU4A 4IGAA 5HQ3A 4N03A 4WVLA 5U4XA 2VR1A 4KWCA 4HJXA 1NLFA 3FDFA 3SBDA 3V5NA 4CN9A 2G4LA 1QIMA 4N8SA 1EFRD 2IOQA 4CFZA 1JI3A 2XUFA 3TLGA 4DR3B 4N54A 2QY9A 3R41A 3UB4A 2WTXA 3WJ2A 3FPGA 5F7JA 3PLRA 2FN3A 3BGIA 2P2SA 3O82A 4JEUA 4D42A 1GQYA 5DM4A 4A2PA 2R5FA 4GG1A 1PSWA 1P44A 3A9VA 1YGYA 1QIDA 1R6VA 3D0KA 3LK6A 3IR6A 4FX2A 4L8VA 3KC2A 5KWJA 3JD4A 1OOEA 4WKNA 5EQFA 4Z1MA 1J2RA 1Q2UA 2GHQA 2WMOB 3SF8A 2J9GA 1PT9A 2UXBB 4JP3A 3FRIA 1NUUA 5M7EA 3K2BA 1RBZA 1YT5A 2JGFA 1CRLA 2Q5JA 2Y68A 1G60A 2YCLA 4EHAA 3IO5A 3DMRA 4NG5A 3I4CA 5CFLA 3HLKA 3BGSA 3PL1A 2PRZA 2IC5A 3UICA 4QEZA 3AH8A 2VSNA 2ZANA 5EN4A 4UPVA 2WWXA 4E5YA 1NW8A 3A1CA 3GL9A 5BW8A 3G2MA 1JFFA 3PQEA 4YLGA 1KK2A 2VSFA 3HL4A 3RW9A 5AJZA 5KZMB 4H2DA 2AZMA 2NWQA 3A9RA 3CSUA 1FVHA 4BKUA 1R8YA 4DIKA 3SEFA 3RS4A 4WNAB 3CN9A 1YRHA 1HT1E 1VC2A 4KGXA 3TVYA 5EI5A 1ESNA 3KJXA 1MV8A 2YZGA 3LUDA 3L79A 2LE0A 2PY6A 2XBUA 4G0ZA 4DLNA 4ZVRA 2ID7A 4IS2A 1Y42X 5C80A 1ZUNB 1JAHA 4XWTA 4GLBA 3GU3A 2G77B 3GJ4A 4KIGA 4DEVA 1RXVA 5TPWB 5ALMA 5KTNA 1XPRA 4RF5A 1KPGA 3MELA 5AUOB 4X6YA 3GOHA 2PFGA 2IX9A 4C0LA 4OIMA 1AQJA 4CNQA 2C61A 3CMMA 1LV7A 1SG6A 2GHIA 3LI2A 3DUWA 2HX1A 4H15A 4WESA 3WAJA 5JIBA 1EQ2A 1YC5A 3S55A 4Z7QB 4NXMB 4WOBA 5EEHA 1C30A 3D6NB 4EAQA 2XCQA 3K1JA 4PBTA 4DJDC 4Z1MD 2P9EA 2B20A 1GSIA 3H5OA 1PJ8A 3ZTWA 1F9AA 3VDNB 4Y0VA 5KS2A 1DRKA 1YA6A 1HO3A 2CLEB 1AZTA 2FSPA 3KJHA 1CRWG 5T6BA 3E2IA 1KZGB 3GGJA 2Z2ZA 4NPCA 4L8GA 4KE9A 1Q0PA 4QQKA 3TSCA 2VJLA 1QWSA 2PWZA 4FQ5A 4RVUA 1YDMA 1GIAA 3OWHA 1HPLA 1J8YF 1NKVA 2CYAA 3L7JA 4LY6A 2H1OA 3M81A 3NNNA 3E05A 3NH6A 5EJMA 3DLBA 3AEUA 3WIDA 5FPQA 1U8TA 1W73A 4EDHA 2IHZA 1J2TA 4N82A 4OM7A 4S1VA 3O93A 4RGBA 3H4VA 3QKUA 1Z8DA 4HPWA 4C2BA 2R66A 1IQPA 3CN7A 1FNNA 4OV6B 4AMYA 4F4IA 3NBMA 2JRCA 2V7VA 2IQIA 2QD1A 1O5TA 1ZK2A 3CM0A 3FOBA 2QUKA 4EUSA 4D9BA 3RRXA 2HZ7A 4BNDA 3HDTA 1QH0A 3W7VA 3QWBA 1EZ1A 5E6RA 4AIIA 3ORYA 1H2XA 3YASA 3HJHA 2C83A 1M7BA 4GPIB 4DLZA 2YHAA 3VZQA 4TXMA 1URPA 4EQZA 3MPUA 4KC0A 4KR3A 8ABPA 5BQPA 4RORA 4UFNA 1RT9A 4E5SA 2W37A 4N65A 2PKRA 5IEBA 1C8VB 1CUEA 1B8VA 1Z2NX 1ZNWA 1XOIA 3GARA 3RUPA 4B3JA 5FPKA 5KJ6A 1V3TA 1Z7YA 1P2TA 3OMWA 2CCJA 1P3JA 2XB4A 4M9CA 4NESA 3PWTA 2OZLA 5JTTA 2CDRA 4Y6QA 3I58A 5E4FA 1IXRC 1WBJB 2P1ZA 4CCWA 1AQLA 2FPIB 2R8YA 4JLJA 1JVSA 4UTPA 3T5MA 1N8KA 3PT9A 1KOFA 3EBOA 1UPXA 2ZE7A 1AUPA 1IJKA 1AKUA 4ETWA 1WW3A 1IXKA 4Q7QA 1SD1A 4RACA 3RIXA 3QEBZ 3ZDZB 1ISMA 4HB2A 3NHBA 2QG9A 2ZTLA 1M2VA 4UUQA 4YI5A 4L4UA 1UR5A 5E2AA 3QVWA 4KO1S 3A0UA 1Z8NA 3BPSA 1R5JA 1ORHA 4UD6A 2VDWA 5NLLA 2WUEA 3DHWC 3UW3A 3AZPA 5IJ0B 2EC5A 2O50A 1V1RA 1QGYA 4B17A 4OFBA 3WMFA 1AKTA 2AN9A 1JJBA 1GL6A 3GN1A 3O83A 5G4KA 3ZU2A 1CVLA 5I45A 3HVHA 3TRHA 4BLWA 1FL9A 4EITA 4ZHQF 3VZRA 2HO4A 4WIAA 2I2BA 4CODB 2RIPA 4MR7A 4JJKA 4OXNA 2QZPA 4ECAA 1QOPB 3LYLA 4M53A 5LBTA 5C8DA 2O8BA 1FZTA 1DBVO 4NENA 4J0JA 3EPRA 1F8GA 2LUOA 5LKRA 5J5CA 4MVJI 1VPWA 3I8OA 4EG3A 3HWRA 1W48A 1UJ4A 3BAZA 4G63A 1WHTA 1SBZA 3I12A 4LDPA 1ANKA 4ZARA 1AXGA 1DWQA 4Q4AA 1E1MA 4WLFA 3WL4A 1FPMA 2V4ZA 3HV2A 3PD7A 4GVPA 1KC1A 1ORVA 3LT5A 4D9KA 2J4FA 1KDPA 3UJ3X 4WN3A 3IVGA 3OOJA 2FPXA 3EIFA 3X2EA 1LD3A 2AYYA 3H7IA 1TUIA 1OX4A 3C8UA 3LWBA 3BVPA 4WCDA 3FSJX 1EJ6A 4AZ0A 3P4YA 3TLCA 3E22B 3LPLA 2VAPA 1P80A 2WM8A 4KXXA 3ZV7A 1UWCA 5BWCA 1C4OA 2C82A 2SECE 1FEZA 1X1RA 1HQDA 3ZV3A 3OIWA 3ZCSA 2KS6A 2BTEA 3OKCA 3ZCVA 4PVDA 1ZIDA 1AQIA 1ZVQA 3AL2A 2XKAA 3UH1A 4EELA 1QMGA 3QOYA 5KVVA 1B23P 1HYHA 2VH1A 1UAGA 1G9XA 3EVEA 3QVKA 5ADHA 1K7XB 3N2YA 3CEHA 4JI4B 1FTQA 2I2DA 3QV2A 1LBIA 4RA9A 4WFKA 4HZIA 5J2UB 3RHZA 3ZDCA 1ECLA 1OU0A 4LFAB 1GTSA 3AVYA 3BIOA 3PNPA 3Q2KA 1O6CA 2A0UA 1JJAA 5JMPA 1ZC3A 2QL7A 1VJTA 1VKNA 1PJTA 1YK0A 2JBAA 2I4TA 2IYZA 3I6IA 2BMWA 3GFRA 3SXUB 3RRZA 1PEYA 1M8GA 1ZBQA 1YZGA 3QPCA 1YACA 1NV9A 1LDNA 4HNSA 4Y9SA 3RNLA 4AF8A 2G63A 1LLDA 2QJWA 4PAWA 1PNRA 4XVRA 5BPHA 2VPTA 1DV1A 2XT9A 2C7RA 3O21A 4G4SP 4UBKA 2HMWA 3P97A 3EHDA 4EABA 3WBBA 4HAOA 3LT4A 3AJ8A 5IBCA 1U0GA 3QQPA 2RHGB 3L92A 4UBIA 2B37A 2R1VB 1RXWA 5IEJA 2FUKA 4NBWA 3RVPA 4BO1A 4JL5A 4EF5A 2CN1A 3LXXA 1NYQA 3DS8A 4L4XA 3MD0A 2FSHA 5IM5A 4G5RA 2LNDA 1A7KA 1KC3A 3VR6D 2IXGA 1GV1A 2JGKA 1V48A 4XEHA 4E32A 3GFFA 1A9PA 1JKFA 3NC4A 4NU8X 3WISA 4LZJA 1NXTA 4DKJA 2NU6B 4HNGA 3AB3A 3CLUC 4Q12A 5JMTA 1FXUA 4REQB 3R6TA 4BQQA 3QFCA 3MGGA 1GFZA 1DAKA 1ZVKA 4GPZA 3UWSA 3ZD8A 4AFNA 3OLCX 4ZCMA 2ETVA 2CXTA 2DAPA 1IHOA 3M4NA 1MC5A 3DMNA 3L1IA 3NCTA 3H11B 5L3ZA 5FP0A 3UK6A 1DJMA 1D8TA 4G9GA 2FPUA 4HH4A 2LTAA 5EHZA 3JPYA 1VKJA 3ZNNA 1N0HA 4BNLA 4BWYA 4W1RA 1ISSA 2J0EA 3R0VA 3REFA 5GV7A 2FR1A 2CMFA 1TAGA 4ZOLB 3NHWA 4YV1A 1PS0A 2ONYA 4FONA 4TSFA 4FFOA 2AFHB 3L4KA 2A30A 1C5KA 2OBMA 5U4QA 1RHUA 5BOVA 1BKYA 1XBTA 2ZTMA 3N6VA 4XVHA 1WUYA 3GNSA 3CRNA 2HAEA 4RKFA 4FNAA 5CD1A 1FMCA 3COPA 4M86A 5H5JA 5HCUA 3ZYZA 2WM9B 5GP1A 1H1TA 2ZXEA 5CB6A 3VAZA 4AWBA 2VHCA 3DFFA 3HBAA 1K92A 5GONA 3I9JA 2Z6QA 1VB5A 3GUCA 3U81A 1AO3A 4RAOA 4TWRA 2FSVC 3MWEB 2YV4A 4RVOA 4B6GA 4GKJB 1MO6A 2ZSEA 5BSEA 2J3LA 2Z6UA 1D3AA 4QPDA 1FUUA 2JI9A 2VRWA 4Z51A 4PCVA 1ZM4A 4F7WA 4NU0A 1Z63A 5FBZA 4Q6BA 1QNFA 1NRXA 2RC5A 4BVFA 1CKEA 4KQKA 3JATB 3KHSA 4DR6B 4BGDA 3EVNA 5GVRA 1VJ0A 2I5PO 4Q9KA 4RF4A 1BU5A 1BCRB 3A36A 4WY8A 4GR4A 4P32A 1K4YA 1B7GO 4DY4A 2QIOA 2B5OA 2H9YA 5GJWC 4BJ6A 5J4KA 3V3KA 3O8CA 1ILWA 3KYIB 3T1NA 2C7VA 4AJ1A 3TMAA 3LCMA 4I19A 1WZ2A 4D25A 2FJUA 8MHTA 2Q41A 2HWYA 3PIRA 1RLOA 3PIIA 1RKUA 4BX2A 3ICEA 2WTEA 3B20A 3MMNA 3EOAI 4LY0A 1G19A 2YICA 3GIDA 3H1GA 3BQNB 3NBYC 5THKA 3GAMA 1D0SA 3IAHA 4H60A 4ETMA 1UMBA 3SEAA 1Z0FA 1JHOA 4YA6A 1ISIA 1NA5A 1J2JA 5SY9A 1RWVA 3RQSA 1BOFA 2X7XA 1XMOB 4OQDA 5J40A 1Y4AE 4JBLA 3HCBA 5ICEA 1ZH8A 4J7CA 4R5MA 2YYSA 2P6NA 3LHIA 3V1LA 5JTUA 1CE8B 3IMFA 4L0DA 5CEEA 1F1BA 5IHPA 4UOQA 2C3OA 4DABA 1JG7A 1H6DA 1W9HA 4K6MA 3MJHA 1WXGA 4QOJA 1F0NA 4MHTA 1V1MA 1M1XB 3WSWA 3PRJA 3UC5A 2ZOSA 3PEFA 3UJNA 1W46A 3FFTA 4NV1A 1P60A 2OT3B 1MNAA 4RPIA 3HQ4O 3Q40A 1Z5VA 4Y2TA 3GAFA 4F06A 1G8KA 2QVXX 3U09A 3OQOA 3OWXA 3VPSA 3OEWA 1ENZA 3EQ2A 2HADA 3K0HA 3L41A 3MYRA 5CDTA 2Q1XA 3E2PA 5SZJA 3WLNA 3NRJA 4BY9E 2AEEA 3MCTA 1NONA 1Z6ZA 3MBKA 2ZITA 3H17A 4AD8A 3MRSA 4J16A 4GM1A 3CT4A 4AQ7A 4HOYA 3SFVA 1RM5A 1IHDA 2UVQA 3AY3A 4NK4A 1SUWA 4ZQIA 1E9VA 4QQNA 4LZOA 1PHRA 1O2DA 3ND6A 3T94A 4CL0A 1RADA 1N7JA 1XZFA 5JR3A 2B69A 1J7JA 3AKCA 3G1UA 5KSOA 3AOEA 4A2QA 5BYAA 3HSSA 1YZ3A 3NHPA 4LDZA 1SXJA 5AM5A 4ZOQI 4DV3B 1N36B 3Q7PA 4H0FA 1SHUX 1IQ0A