1IAQA

C-h-ras p21 protein mutant with thr 35 replaced by ser (t35s) complexed with guanosine-5'-[b,g-imido] triphosphate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
149
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDSYRKQVVIDGETCLLDILDTAGQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Dynamic properties of the Ras switch I region and its importance for binding to effectors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 149
sequence length 166
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1iaqA00
1OXXK 2YKGA 1CTQA 3CNNA 4HAWA 3OE7A 5C46F 3WNDA 1M6NA 1Q0UA 4DZZA 3FMOB 2Z4RA 2EFEB 4Q4LA 1E2LA 2GAAA 4B44A 2X1VA 4B47A 4DIEA 1IN7A 1ZCBA 1SKYB 2DPXA 2HEIA 2I3BA 3VX3A 4LC0A 4BFUA 1KMQA 1RKBA 4TQUS 4PPQA 4HLUC 2G88A 3RS5A 5DHFA 4UXHA 1NRJB 1NBMD 5A4JA 3G0HA 2BMDA 1GKYA 1JR3A 4PC6A 1UPTA 1S9DA 2NG1A 1FFHA 3VKWA 4TMXA 3C14C 1OKKA 4LUCA 3SOPA 4WXPA 2ONJA 4A1FA 4MRPA 4HUTA 1DAFA 4KFUA 4KLNA 4NCJA 3EZ2A 4QBIA 2W6JD 3QXXA 4B34A 4AY2A 1Z28A 2FGKA 3NHAA 4M1WA 3AVWA 4DLVA 5AJZA 2K5UA 3WBJA 2XZOA 2IXGA 3HR8A 2L0XA 2ZI6A 1G3MA 5FTLA 3GLHB 1M1YE 3B5JA 4JYBA 2IBMA 2JDID 5GADl 3AVVA 1Z0AA 3RRMA 4KVGA 1H8HA 4PTLA 4A2PA 2ZM5A 3OIWA 1JR6A 2PZFA 1UBFA 3NC1C 1W4AA 1L7VC 3Q5DA 5GVSA 4RZXA 4CVNA 5FOTA 2QAGC 3WMGA 5EJEA 4EFLA 4OJKA 3QVUA 3M6AA 2DFTA 3R7WB 3RSOA 1W4CA 2WWHA 3AKDA 2IT1A 1KI2A 2GJSA 4V0ME 2QAJA 3T5DA 3V9PA 1NL3A 3BGWA 4MITA 2ZRMA 2G9NA 3QXJA 5C4GB 1IJFA 1NVWQ 2AWOA 4A36A 2YWEA 2FSGA 3QPUA 4M8NE 1X8KA 2J9RA 1AKEA 1ZAKA 3BIFA 4YMWA 1DAEA 4HAZA 1IHUA 2JLWA 3KX2A 1SKYE 2RGAA 2RGXA 4J0QA 2GESA 4PO8A 3LAWA 5G3ZA 5LD2B 3ZLJA 4M0LA 3D7MA 2VHQA 1EFCA 3PR1A 4IJMA 4PQFA 1IN4A 3B1WA 4RCYA 1XTSA 4NYMQ 3K70B 2DFNA 2GVZC 4D4LA 1RYHA 3OIVA 4RFSB 5L3RA 1PJRA 3EA5A 3X1ZA 3UG7A 5C4MA 3PFIA 1X1RA 3PXGA 1ZU4A 3TMKA 1Q1QA 3BBPA 2CXXA 1U8ZA 4HB2A 1Z6TA 3NDBB 3HPRA 1R6BX 3VU9A 2VIIA 4L8GA 4NCIA 2RGGA 4DSTA 5FUVA 5FH9A 4Q9KA 1KAOA 3JVUA 2NO9A 3SFVA 2ZR9A 1JXOA 1M34E 4ARZB 3U6BA 1EFRA 1WBBA 5AUQA 5LBIA 1Q21A 1Q1BA 4TT3D 4TTPA 3C5CA 1E9AA 1SXJD 4JIMA 5SZKB 1QHSA 3ADDA 2R2AA 2IHYA 2VHTA 2WV9A 3NH9A 2GRJA 1JPJA 3HU1A 1G20E 5H1YA 3T1VA 2FPLA 2FFQA 2R62A 3NVAA 1XXHB 2BEKA 4Q1AA 5EE5B 2HV8A 1TPZA 4XOIA 2B8WA 1XTRA 4AYTA 3ZVLA 5H8WA 4LHXA 1P7CA 2BOVA 2V54A 1P6XA 5JZVA 1OHHD 5B58C 4C9BA 1I4TD 5FTNA 1W4RA 4OBEA 2OZEA 2O8BB 4PZLA 1ZP6A 3RC8A 5AK0A 1ZCAA 1E4YA 2LKDA 2CNWA 2OO7A 3TK1A 1R0XA 3B9PA 3ZD7A 4PAQA 2BMFA 1OB5A 1J90A 1Z29A 3ASYA 3IHWA 4WXRA 4QJ3A 1NN1A 1R4AA 3SHFA 3EZ7A 3O8BA 2CK3D 2RH5A 3EASA 3UKDA 4LJ6A 3PITA 2QP4A 2GNOA 4EFMA 3AP2A 1ZM7A 2F3RA 3K9NA 4GNKA 3TKLA 4TQ9A 2P6NA 2E87A 1A82A 1PZNA 4JBWA 1DVRA 2IA5A 3NDPA 4JLNA 4KJZA 2WSSA 4GT1A 4D80A 4Q4JA 1D9ZA 4FD2A 4HYYA 1JXMA 2OBMA 1G291 3DVLA 2C04A 1ZD1A 3TR5A 1MRNA 5ANRB 3HR7A 3GLFE 1GRNA 3BFVA 3W6NA 4BZXA 1UDWA 4ZIRA 1FP7A 1CJUC 1T9HA 5DI3A 2HCBA 2VH5R 1P9WA 4W7SA 2PX0A 2DWPA 4M9ZA 3B78A 1CEEA 3F0TA 5KSYA 4YXWA 2N1BA 3W6PA 4PO9A 3EPLA 4OKSA 4XD7A 4B71A 1MABA 3KB2A 2NO1A 4KYUA 4NDZA 1XXHE 3C16C 5D3MB 3THXA 1XMJA 1WP9A 3QKRB 3KQLA 1RRPA 1H8ED 4N3NA 3LBHA 2JIZD 1YVDA 2NO0A 4IOLA 4AKIA 5K8UA 4TZ6A 2IWHA 3IQXA 4D0GA 1Z63A 2AKYA 2B8TA 1NBMA 4D0NA 1S2MA 1NMYA 2I1QA 1GKIA 2GEDA 3EZFA 4BPBA 4D6PA 2ORVA 3RAPR 3LLUA 1NP6A 2FMXA 2W6JA 4AI6A 2EYQA 2OCAA 2BVNA 5HZKA 5CLQA 4DLWA 1KI4A 5G41A 1DO0A 2A2ZA 4B32A 3FOZA 4A0GA 2WZQA 1CXZA 2CVHA 2XJ4A 5DO9A 5FPHA 3IILA 4DUGD 4IXMA 4IOJA 4MQBA 3CW2A 1U0JA 4FN5A 1U2RA 1HEIA 2WWIA 2I4IA 2ATVA 4TL6A 2XTZA 4B2PA 3AVPA 1IY1A 4EPXA 5KYKA 1RW4A 1KI7A 2J3EA 1W48A 5DIFA 1G41A 4WZBE 3RWMB 3ZIAA 4KCGA 3B9QA 4YC7A 5JEDA 4OHVA 3U6KA 4LJ8A 1W2HA 5DI3B 3CPHA 1N5IA 3JZAA 3AEZA 1VMAA 5FOXA 2KBFA 3LQRA 2GZDA 3LV8A 3QJYA 4JVMA 5DHAA 5E7JA 4A8JA 2JLUA 2PL3A 4QKQA 4Q4HB 1MR3F 2QZ4A 3KFVA 2QT1A 3F5FA 1KYIA 2VL7A 1MABB 4LCBA 1AZTA 2FGJA 4UNNA 3TJZA 2D62A 2W6ID 2B7BA 4A0RA 1KO4A 1G7SA 1O3YA 3LX5A 3I1FA 5IF9A 1EFHA 3MJRA 3TUIC 4Q7KA 1MKYA 1G6HA 3BWDD 1PV4A 2AXNA 4BASA 2OUKA 1Q3TA 1O87A 3HJNA 3L82B 5L3QB 3CPEA 2FFHA 2W0SA 5LB2A 1ONBA 1N6NA 1ZM2A 1N2CE 2X2EA 3LXRA 4U5XA 3T1TA 2ZE8A 3QNUA 3NBFA 1YR6A 3FPAA 4P4SA 3QKSA 4XJXA 3TSZA 1RZ3A 2XZPA 1FMJA 1RJ9B 2QE7D 4FMDB 5LD2C 2NO6A 2C9YA 3DOFA 4GOKA 2WKQA 1OIWA 1DG3A 2AX4A 3OF5A 1S4QA 4DCSA 3AVXA 2VHCA 1IOZA 4A15A 4AG5A 3C41J 1QG4A 3UATA 1U99A 3MJHA 2JJ2D 4KSCA 1BYIA 4KSBA 3X1XA 3CRRA 3DKVA 2ZI4A 3TLXA 1M8PA 3UMFA 4TZ0A 2ZUCA 5J4HA 3AF3A 1E9FA 3RANA 4TT3A 3ZVNA 3A6PC 1T4GA 5AUPB 3R8CA 1E9RA 2BBSA 2BIFA 5D3QA 2O8EB 2E9SA 2YYZA 4JS0A 6Q21A 2WWWA 2AFIE 2IYLD 3MMPA 4B3GA 5FOWA 2Y8EA 2ZRIA 4HLCA 1CR1A 3HYTA 2J0SA 3AKCA 3SDZA 4CYMA 1CULC 5K8IA 2R6GA 3C8UA 3RYTC 4BFZA 3SYNA 4A82A 2R6FA 4PFSA 4W5WA 1G21E 521PA 1OHHA 1II8A 3M0EA 3TSWA 4DHEA 5TY0A 1RRCA 1YHNA 1BMFA 1N5LA 3MSXA 2FU5C 4RVCA 3R9WA 4BFXA 1A1VA 4GMXA 4AKGA 1EX6A 5GJVC 2GCPA 4OK3A 4IDNA 1KK2A 2EQBA 1OIVA 1TQ2A 4PC1A 3THOA 3X2SA 1TAGA 1G8YA 2VP6A 3GLGB 1OFHA 1QVAA 1RRFA 2KWIA 3H0KA 1Z83A 2HT6A 4LBZA 4Q9JA 5EP3A 4PPFA 5FL7A 2DBYA 2CK3A 2XXAA 3WY9A 2TMKA 2FX3A 3SBEA 5HZHA 4G3XA 3NBZC 5EZ6B 3T35A 2GBLA 2J0UB 4XTCS 3A1WA 4HEJA 1P4SA 2BMJA 4LBYA 1COWD 4E09A 4C30A 2R8RA 3Q7QA 4OHXA 1SGWA 3KUCA 1LTQA 1HTWA 2IL1A 5HCIA 2Q3HA 3KKOA 3WNCA 3A37A 3PEYA 1NI3A 3GFOA 1U8YA 5G40A 5C1BA 5KPDA 2QMHA 5IK2A 4MKGA 1U8AA 3BFKA 3LLMA 1TEVA 3T06B 5KDOA 1SXJB 4N1AA 4Z1MA 1Z5ZA 4EKDA 1W5SA 1Z08A 5EE3A 4GMDA 2G6BA 1JALA 2RGDA 5KSOA 1JQLB 4ZPXA 2GDJA 4NYMR 2CMKA 1BIFA 2X2FA 1E1RD 1TMKA 1NKTA 5EP4A 1AJEA 1XNJA 2HF9A 3Q85A 2FA9A 2PMKA 2YNMA 5AJYA 4ZCMA 4TLDA 3ZZTA 2V6IA 2F55A 2AR7A 1AA9A 1A4RA 1OFIA 1UM8A 3BXZA 5JI2E 5F2EA 1NN0A 2NQ2C 3AVTA 3SC3A 2WJGA 2W00A 1Z22A 2YOFA 2W83A 4LJ4A 1P9NA 1N6KA 2ORWA 1Z0FA 3P20A 4C0QC 3FHCB 3P4XA 1E0AA 4ZKEA 5JS7A 2BMEA 3A4NA 3DOEA 3PCRB 1G3IA 5IHPA 4M4SA 3THWA 2IYUA 2F43B 2JASA 2HDNB 1ZNXA 4LI0A 3S1AA 2OILA 1HQYE 1MT0A 4TL9A 3EW9A 2GZHA 3L2OB 4GZLA 2FPMA 3M1IA 4OK6A 1GITA 4I81A 2Z83A 4LJ5A 1KO1A 1WDTA 3H4MA 2ZSDA 2WWFA 4DUGA 4KO8A 2W2VA 4Q1DA 4RKFA 4BLTA 3I61A 2YC2C 1QDEA 3H1TA 4X8LA 2DWOA 3KJGA 2VP0A 2YV5A 3VQTA 1M7BA 4P3YA 4PHGA 4XIGS 3WYGA 4ZI3A 3GJ6A 4DT1B 5FBWB 1KY3A 1XCPA 4DRZA 1H8HD 1W44A 4BFTA 4DLYA 2CBZA 4MDEA 2GCOA 1OYYA 1SXJE 3KL4A 1G3RA 4C4PA 2OG2A 1BS1A 3B1YA 1EX7A 1DAGA 5AUNB 3GPLA 2ZRLA 1WCV1 5B2ZA 5BN5A 2O8DA 5DYIA 1E99A 5CB6A 3MGCA 2F1JA 2W6IA 1FNMA 1FZQA 3O47A 2QTVB 2XB2A 1FTNA 2VP5A 3JZMA 1M74A 4OQLA 4Q7MB 4ILEA 3GJ0A 3TW4A 5L3SA 5BN4A 3WHKA 1Z47A 1K5DA 2CJWB 4DC9A 3EARA 4JVNA 3LWNA 3QPWA 1YR8A 1AS2A 2WSMA 2ZSAA 3CF6R 4LYFA 2A7QA 4QGFA 3VR4A 4EDHA 1KK1A 3THWB 2ZXUA 2JATA 5FPSA 1N6HA 1GNQA 2J7PD 3K0FB 3S1AB 3ZH9B 4XWKA 3QXHA 4A6XA 3T15A 1XWIA 1AIPA 3QUSA 2ZREA 3AF1A 1KAGA 5JWHA 2FH5B 4C0JA 2WOJA 4GL2A 8OHMA 3QQ5A 1VIYA 2NO7A 1OXVA 1E2MA 1R8QA 3D3QA 3U7EB 1NMXA 4TMZA 5FOUA 4ITRC 3A36A 3X1DA 4M1MA 1M2OB 4FCWA 1Q22A 1EFRD 4M1SA 2EFDB 1E69A 821PA 5K8LA 1ZUNB 1E9EA 1II0A 2WBLC 2BCJQ 3DMNA 2YWFA 2FSFA 1DS6A 4BZQA 4JL6A 3F3YA 3B13B 4IVQA 1ZM3A 1KDOA 4MGKR 3TE6A 1WBDA 2PZGA 3TQFA 4A8JC 3NG1A 2OEPA 4ON9A 3TBKA 3EZ9A 1OT3A 1DAMA 1JB1A 1OXSC 4IDQA 2C2HA 4EFNA 1G7TA 2F1HA 1FQKA 5FBQB 1OXTA 2GILA 4IVRA 2G1KA 4EPYA 1KY2A 4PAMA 1BOFA 3IPYA 4FMBB 1EWQA 2R6CA 4C0HA 3C5HA 1WXQA 3T5GA 4PC7A 3LRPA 1XEXA 3PUZA 4GP6A 1ELOA 1YZGA 2JGNA 2N42A 3W6OA 1G3QA 4NONA 1E0KA 1CJKC 5HE8A 2BJVA 4JL5A 4B3BA 1N6LA 4BFWA 2P0EA 2CNWD 2GK7A 5BQ5A 5KNCA 3W90A 4JLMA 4JLBA 2A5YB 2IX3A 1ZUIA 1XD2A 2NTYC 1IM2A 1G4UR 3CNOA 5KDLA 3SHWA 1P5ZB 4B3XA 3GD7A 2ZRBA 1Q57A 2VO1A 3GJ4A 3UWOA 4TYNA 4Q4AB 4LX0A 3W5IA 3O8RA 4OQFA 2ZI3A 1FL9A 1W49A 2AN9A 2FOLA 2W58A 4OL0A 3BH6A 4JSYA 2C98A 4WOPA 3TSOA 4TWZA 3K8YA 1KI6A 2ZJ5A 4GDFA 3L0PA 4Q00A 3H2YA 5FI1B 4ACBA 4M1OA 2FF7A 1IJEA 3CO5A 2WSSD 2PZEA 3U3OA 3QIAA 1JQJC 3KXKA 3U44B 4LHWA 1E9DA 2ZU6A 4FMDF 4G1UC 2QNRA 2OCBA 3FDIA 4NYIQ 4HLQB 1NY5A 2XNDD 1N6OA 3FHTA 2VPPA 3MUFA 5DLQC 1E1RA 1U9IC 2A78A 3SS8A 1T8TA 4UJ3A 1SHZA 1YZUA 2CCJA 1E96A 2F1IA 1AS0A 3MWKA 3RC3A 4YXWD 1JBKA 4XD7D 2LKCA 1QF9A 4ZDIA 3WP0A 1T3SA 2O8CA 2QY9A 2WJJA 4Q1FA 4BQSA 4KYIB 1T91A 5E3HA 1RVDA 2RGCA 4WBSA 3WHLA 4TLEA 2ORIA 3B8HA 1D6JA 2I1VB 4A0FA 3RABA 5J4YA 1E94E 1KI8A 2IW3A 5KPJA 4CDGA 1XEFA 2J0VA 2ZAMA 1CF4A 5SZHB 2ZI9A 2HJVA 2HXYA 1T0HB 3THYA 3GLIB 2UZIR 4JT2A 4G5GA 2GK6A 4POAA 3CPJB 4D26A 1N0UA 3QY0A 4EQ6B 2ZYVX 4D4JA 1U94A 3BB4A 3F8TA 2P67A 3W5JA 4D2IA 1OSNA 1W4BA 1MO6A 5GJWC 2J1LA 5BXQC 4YLGA 2PLRA 2WKPA 4MGZR 1N5JA 1ZIOA 4TL7A 5JLJA 2GBLC 4RY2A 2O5VA 4NU0A 4Q01A 4CEHB 2YZ2A 2FDCA 3AV0B 5FR1A 2KJQA 2VLIA 5KOYA 3TNFA 4Q1EA 3FMFA 1Q44A 2IYYA 5FPYA 2XZLA 3SQXA 1E2DA 1FUUA 5EQTA 2A5GA 2WPDA 4IRUB 2WAXA 4ZCIA 4TMTA 1HA3A 2IYVA 3U4QB 4TTRA 2XJ9A 3CBQA 4IDOA 2OBNA 4TSFD 2IYWA 3KKQA 5TB5A 3ZIAD 2A30A 2GJ8A 1LY1A 4Q48A 4M9SA 2QGNA 2CE2X 4Q1BA 4LGMA 3T34A 3AQ4A 2ZITA 3NHBA 3QG1A 3NKVA 2REBA 4MH0R 1AS3A 1NN5A 1ETUA 4LWZA 2CLSA 721PA 1XRJA 1GTVA 1NLZA 4MYHA 3REGA 3HWSA 4FINA 3D31A 3GLFA 4QM6A 4IW3B 3NXSA 4MGIR 4L5BA 1F3OA 4TMVA 5FBRB 1KK3A 1JJVA 4EPVA 1FUKA 2PMDA 2CL0X 1AM4D 3CRVA 1DPFA 1N6RA 4W5JA 2WKRA 3EIHA 1V5WA 1Y3AA 2JLSA 2J7PA 4HAXA 4XH9B 1XTIA 4M22A 4Q02A 4PX9A 2BKEA 1IAQA 3LH5A 1G4AE 1UDXA 4F4CA 1E2QA 4AIIA 2HT1A 1IY0A 1N0WA 1ZM9A 1NLFA 3ASZA 4EJSA 1XJCA 4UNPA 1AKYA 3P4YA 4LJYA 2XEXA 4WAUA 4AYXA 3AP1A 4G5RA 1OF1A 1PUJA 3LO5A 4CEIA 1XCMA 2BBWA 3PUVA 3CWZA 1B0UA 4DLUA 4F38A 1D2EA 4TLBA 3VFDA 1HT2E 2QMUA 4LV5B 4MRNA 5M04A 1KTVA 3GLHE 1DBSA 3ZYCA 2J0QA 2OM2A 1P73A 2ZVPX 3ZQJA 1TF5A 1WQ1R 1MO5A 2D7CA 4D4KA 2EFHB 4URUR 3A4LA 5TXGA 3FWYA 2BV3A 3OHMA 2PJRA 2WMNB 1G8GA 4WIAA 4B2IA 4QBHA 1KI1A 1LS6A 3AB3A 4IOMA 5E4FA 3L0SA 4DCNA 2GJ9A 2EFGA 3WYAA 2D3WA 4V02A 5FR2A 4TN1A 2GJKA 2VHUA 3H86A 4MRVA 2XOKA 2G3YA 2ECKA 2R6AA 2CL6X 2A5DA 4RCZA 1GUAA 1PLLA 5GJCA 2IF2A 3VR2A 1R0YA 2QP9X 3FFAA 2QPTA 2Q9CA 4KV9A 4QC2A 621PA 2CHQA 1EESA 1BMFD 2IUSA 2XX3A 1EFUA 4Q7JB 4DDTA 5JWRA 1SVIA 5CLLA 2PT7A 2PCLA 4M21A 3ZS9A 4BFYA 5E95A 1II9A 5FL7D 4URVR 1CKEA 3DM9B 4LBVA 1JR3E 3VR6A 4FCVA 3IEUA 5BYKA 2CDNA 3TR0A 1OH6A 3K53A 1VG1A 3DMDA 2D4HA 5IDVA 3VU9B 2DB3A 4IDHA 4Q19A 2O8FA 2MSCB 3QF4A 4PPGA 5J4KA 1EK0A 2ERXA 2C03A 5CITA 2Q0HA 4DDUA 1BYUA 4KU4A 4JLVA 3ZDQA 4HAYA 5JFGA 2WWGA 1SQ5A 1E9CA 4N0DA 2XNDA 4QXAA 1OV4A 3PUWA 4HZUA 3ICQB 4IKEA 2NPFA 5IK2D 3ADKA 2BWJA 2VSFA 3EAQA 4ESHA 1AQYA 2BBOA 1FQJA 1W1WA 1CLUA 4I1SA 4Z1MD 5DGXA 2DFLA 2RCNA 4M53A 2J87A 3A1UA 4ZDWA 2ZJZA 5JHGB 1TTTA 1Z06A 1QHHA 4LY6A 2PJZA 1KSHA 4A2WA 1WE2A 1CS4C 2H5EA 1GP2A 3I5YA 1VYUA 3LNCA 4H9GA 3AKEA 5HE9A 3U2QA 5JHHB 2E1RA 4FW9A 4NCHA 2W2XA 1T3HA 3B7GA 4DEYA 3ICEA 3OEED 3IUYA 1J2JA 5FPTA 2ZRAA 1M7HA 2IYTA 2ODWA 3AF4A 4LV6A 4FMCB 2C96A 2J45A 3N70A 4O2RA 4GPTA 1IN6A 2V55B 3QVVA 2QRZA 2AD5A 4NKRA 2XSZA 1SULA 1E2PA 2IF0A 3VHXA 3A8TA 4P4TA 5AUOB 1XTJA 2W2TA 4JSTA 1M7GA 3K1JA 2VF8A 2IUTA 2GF0A 2CCKA 3OZXA 3TRFA 2JLYA 4QM7A 1P2VA 3QBTA 2P5TB 2B21A 3DDCA 4BEJA 2ZSFA 4JLKA 1TF7A 5TDHA 3EC1A 3UXMA 2DR3A 1ESMA 3KJIA 1ZUHA 1Q3HA 5AR1A 2QI9C 5IRCD 2XB4A 4ZI2A 5K8TA 3VR3A 4TYWA 4Q4JB 1S1CA 4JLOA 4LOAA 4NL4H 3FE2A 3T61A 1GL7A 4BGDA 3V4RA 1GZSA 1UBCA 5EXSA 4TSFA 1G8PA 1E98A 1GKUB 1F5NA 1NKSA 2BEJA 4ZIRB 5FBVB 5CK4A 1XMIA 3RS0A 4PR0A 2WHXA 4CEJA 4R98A 2QORA 4AKEA 1KNQA 2FFAA 1XMVA 5KDDA 2ZIAA 4B3DA 1X6VA 1VPLA 4GP7A 4A92A 1KO5A 3BD9A 1Z2AA 3THXB 3D8BA 4I1UA 1XD9A 2P65A 3AVQA 3QF7A 1D2NA 1BKDR 2AKAB 2FWRA 1S1MA 3AF0A 3U3RA 1KDRA 5UKDA 1W0JA 5CIWA 4PXAA 1FTSA 2V8OA 1YE8A 3EZ6A 2WVJA 3NEJA 3AVOA 2XAUA 4S35A 4B3CA 3U7FB 1XCGB 1QG2A 1G17A 3CKLA 2OT3B 2OXCA 4IOKA 3PIRA 5DISB 1OE0A 4NYIR 3EX7C 4QG7A 2IXEA 3CB4A 4Y0VA 1RRGA 4C0SA 3WXMA 2ZU0C 3UWKA 3TH5A 2ZJOA 4Z51A 1J8MF 1DOAA 4Q1CA 3GCGA 1AGRA 3AF2A 2ONKA 1SVOA 5HTKA 1IXRC 5JS8A 3IEVA 1G64A 1HT1E 3E70C 1IQPA 2F7SA 4BLSA 2WJHA 5DYGA 3ADCA 1F2TA 3TGPA 1GM5A 1ZC3A 1ZMXA 4D4MA 2HYDA 2NZ8A 4R71A 2QBYA 1N5KA 1UEJA 4PC3A 4NTZA 2FE4A 4D81A 2PCJA 3SYLA 4YMSA 1AQUA 4FIDA 3OEHD 4A8JB 2LWIA 4LSGA 1FP6A 4EPTA 3K09A 3EPHA 4K81B 1F2UA 1YKSA 3SJCA 2UZ3A 1WRBA 5TVKA 5CYPA 3NBYC 3PEUA 1DG1G 2QRNA 3SNHA 5F9HA 1G9XA 1TQDA 4I4LA 1G5RA 2H92A 4LJ7A 5KO2A 2QM8A 4LPKA 421PA 1TEXA 3KB1A 1E2IA 4JJKA 4RD3A 1I4LD 4P33A 4RD4A 4UNSA 4UNRA 4OI0A 1NG1A 1D9XA 3QBVA 4JLDA 3QEOA 3TVTA 3LA6A 4Q9HA 2FSHA 1SHKA 1ZD9A 2A9KA 4LDJA 4B73A 1NBME 1R5NA 2REXB 4KODA 3VX4A 4P4SB 3QKSB 3L8ZA 1E1QA 2YINC 4RD2A 4BFVA 3ZZ0A 2ZSBA 5A0FA 4NBSA 1YJ5A 3W8NA 1A7JA 1P2UA 2WWXA 3BJIC 3NBXX 1CR4A 1GVNB 4EJSC 3KJHA 2VHJA 1Z0KA 2C8VA 4BRUA 4KHZA 1KKMA 2VTKA 2YC4C 4FWIB 2ZTSA 3L8YA 2Q21A 4YMUA 1EFTA 1K8RA 3Q3JB 3LFUA 2F1RA 4NMMA 4PSAA 5DH9A 3SE0A 4CRWB 1UEIA 2PX3A 2IEZA 3MG9A 5L3VA 1FMLA 5B57C 4N0EA 4UXJA 1S8FA 1DAKA 3CONA 1CRPA 2FSIA 2ZI5A 2QG6A 3GEEA 3KKNA 2IUUA 4JZKA 4PHFA 2A3RA 4URWR 2IHBA 1WMSA 1G5TA 1TQ6A 3BB3A 1FX0A 1P60A 2UKDA 1YRBA 3HDTA 2H1LA 1GL6A 1U81A 4TYPA 1QBKC 5CK5A 1US8A 4S2EA 4F4JA 1P9RA 1ZD8A 3AGPA 1II8B 4YONB 4WVFA 3OFND 1HE1C 2C9OA 3OEEA 4O2LA 3KUDA 2OXRA 5EE1A 5H68A 2GTPA 3BRWD 4OJQA 3BB1A 4IDPA 1DTSA 4DIDA 1KJYA 2EWVA 4M1KA 1J7KA 2J5XA 1E3MA 1IONA 4LBWA 2WIBA 4HB3A 3ZS8A 3B1VA 5J47A 2AFHE 2DYKA 2ZSEA 4P0TA 4F7WA 3GLGE 3FVQA 3KZ1E 5JJKA 1VHLA 3FYHA 1W0KA 1MO3A 2B6HA 2XXAB 2GA8A 4AWXA 3Q8XB 5CDFA 2WWYA 2BBTA 1Q1EA 5BWMA 2FN4A 1G3UA 2IC5A 4QNRA 3BERA 3JVVA 4W5HA 1XEWY 4KBGA 4V0LA 2CLDX 1ZYUA 2ZRHA 1EG7A 5CM8B 4HZIA 3ADBA 2ZRGA 2AK2A 3MD0A 5JCPA 1CP2A 1E79A 2JJ1A 5EUQB 4DJTA 2CVFA 3EIQA 2C5LA 2DCUA 4ESVA 2GF9A 2ZAOA 1VECA 2QL6A 3QI2A 2WPDD 3ONWA 4PC2A 5AJXA 3QKUA 4OHZA 4TL8A 4FCTA 3V4FA 2ZS7A 2QT0A 1IN8A 1CJMA 3PV0A 3CR8A 4IFEA 4DVGA 1FX0B 2VSXA 4RZ2A 1XF9A 4B74A 1US8B 3EWAA 3HYRA 3WP1B 2RKOA 2JJ8A 1VG9B 4FI3C 5J5CA 3A58B 5AWFC 4RSGA 1MV5A 1Z6XA 4LRWA 3SI7A 4V03A 5EE0A 5EXTA 3ZVMA 3C4JA 1S3SA 3KTAA 3SBDA 2FJUA 4US0R 3U3JA 1KNXA 1OFTA 2KSQA 2HF8A 3K0AA 4AC9A 3E5HA 4GI7A 2OCPA 3CNLA 5FI0B 3U7HB 4B33A 5C2JB 1R5OA 2OHFA 2XITA 5G53C 2CHGA 1DE0A 2F6RA 3BAFA 2REOA 1DAIA 2CEAA 4DCVA 1L4UA 3OIUA 5JJIA 1TNDA 3UIEA 1JAHA 4D82A 4ZO4A 4MKIA 4AYWA 4QHYA 3RLFA 4A0HA 3IBGA 2DY1A 1R2QA 1YZNA 5JSZA 2EU8A 2ZYUX 5KSPA 3LX8A 4FMCF 3K9LA 4P31A 3QG5A 3I72A 1R8SA 4M9XA 1KK0A 4ACAA 1P72A 1W5TA 2FEOA 3WRXC 4PSVA 4C2UA 2JLZA 4A2QA 2VP9A 4PPNA 2GCOB 1IXSB 3OEHA 3FHOA 3QXSA 1G7RA 4FXPA 4G5OA 1C1YA 4LHYA 3DHWC 3LXXA 3GMTA 1RE0A 2ANBA 2ZRDA 2O8DB 1Z0IA 4IEIA 4AURA 4BECA 2VSOA 5FTMA 1CR0A 1RC8A 1HE8B 2VF7A 1NIPA 1XPUA 3VMFA 4QNMA 3NIBA 2C78A 4KXFB 2XOKD 3VTKA 3VNVA 5FBLB 4DEXA 3SU8A 3TIFA 1GRQA 1Z6GA 4HATA 2QP3A 3PQCA 5L3SB 3I4LA 4RJLA 1SVSA 1ODFA 2J7KA 4V0MA 5HKKA 3AVUA 3VHLB 4DLRA 3P1JA 3A1SA 4XSGA 3SYKA 1W36C 4XVRA 1TUEA 5B30A 3EWSA 3W9YA 2CLCX 1JPNA 5JMTA 2P6UA 4PZYA 2GEUA 4IEEA 3A1VA 1KI9A 4YDSA 3Q9LA 2NPIA 2ZE5A 5A5GA 3J81k 4NE2A 1L4YA 1AK2A 3NWJA 1DARA 4DDWA 1ANKA 2IS1A 1L2TA 2Z43A 1LF0A 2NZJA 2AK3A 4ERNA 1E2NA 1C4OA 3ZGXA 2QENA 5HPYB 4PAOA 4DBLC 1VCIA 3CX7A 2ZANA 4URYR 4C3ZA 2HLDD 4LV8B 4O3MA 2R65A 3QOFA 1XP8A 1R0ZA 4H1VA 2ZS9A 1T0JB 1J99A 2GWHA 4DCUA 4ABYA 1GL9B 4QBFA 5FL3A 1XMSA 1JEEA 1J8YF 1GRRA 4LJAA 3KQHA 2X8AA 1NNEA 3NH6A 4DLXA 4YQFA 2HXSA 2OCYC 1UKZA 4M1TA 2EVWX 5P21A 4CZ2A 1Z8FA 4BUJA 1KIMA 3OFNA 3RS2A 1UKEA 1PLJA 3BC1A 1I4DD 4GFDA 1AN0A 2OFXA 2XGJA 5FUWA 2BKUA 3PENA 3U5ZB 2B7CA 4IXNA 1XEXB 4PHHA 4RZUA 2GXAA 3R7WA 2FPKA 2VRWA 3ECCA 2QSYA 1T3LA 3CZPA 5KHOC 3U60B 1OH7A 2PEZA 4V0OA 3CR7A 3PJRA 2QUZA 2XSZD 3R8FA 2QQ0A 3VKHA 2Z6VA 5DNYB 3LDAA 1XD2B 2H17A 3KKPA 1UBGA 4KBFA 1IBRA 4R9UC 2WJYA 5EUMA 2OESA 1ZIPA 2XTNA 3TW8B 3MWJA 4Q47A 1NLYA 1UKVY 2C99A 4G5SA 1KSFX 1KI6B 2WTUA 4UNQA 4MYTA 2FEMA 1YR7A 2YWHA 1TL7C 4II7A 1E2FA 3WMEA 1NIJA 1KMHA 4R2IA 2YJTD 3Q7PA 3DO6A 2G77B 4M1YA 3RRYA 1E9SA 2G0NA 4RFSA 3TVDA 2OLKA 4HUQA 5KSZA 2RGNA 4HDOB 5BN3A 2CHVA 2OV2A 3RVBA 5E7MA 2RHMA 2ZR0A 4WZ6A 1VG8A 2ZETA 2WJIA 4URZR 1XBTA 2CE7A 2J41A 3IIKA 2IYZA 3AH8A 3FTQA 5FUXA 3CUEF 3GJ8A 1IY2A 1OB2A 1JAIA 1G19A 2BJWA 1DADA 3FMIA 3O8CA 4ARZA 4TTQA 1LV7A 3LBNA 2PT5A 3C15C 1VG0B 3A4MA 2O0KA 1X8JA 2ZE7A 5JBQA 2O8CB 1NVVQ 2QA5A 5C18A 4OQXA 2QN6A 1W0JD 2QPAA 4KITB 4JBYA 4LYHA 2C9CA 1RFLA 1W36D 1CR2A 1XTQA 1KKLA 2F9MA 3R9XA 4K8OA 1YZQA 2Q3FA 3VAAA 3THYB 4HAUA 3K0CA 3CIOA 1UKYA 1XXHA 4IHQA 4A6PA 3TUZC 2ZRKA 2JEOA 3GLIE 1PVOA 1EGAA 1XJQA 2AXPA 3ETLA 2OLJA 2JLXA 3EIEA 1GWNA 1T5LA 3W3AA 4QHSA 3D6TB 4L16A 1KGDA 3IO5A 1OXUA 1VCNA 4JJZA 2PBRA 3QXCA 1MH1A 4OQNA 5EXPA 4MYCA 1LS1A 1C9KA 2V4ZA 4JL8A 4DKXA 3CRQA 2O8BA 5CB8A 2Q9BA 2HUPA 1YQTA 2AD1A 3CZQA 4RKEA 1TQ4A 2EWWA 3VR1A 3N2IA 2EYUA 5DE3A 4QFMA 1XX6A 1KMHB 1NSTA 4LZZA 3K0EA 3UMSA 4OHYA 1P75A 2R44A 1TF2A 4WW0A 5JRZA 5HR5A 1GDDA 4HUQB 1HQCA 1XD8A 3CX6A 4DB2A 3KKMA 5KTYA 2ZE6A 1A5TA 1UFQA 3AKYA 5DSZA 3QEJA 1G5PA 5E7IA 1SVLA 1G16A 5FTJA 4JLPA 1G8HA 4GZMA 1DEKA 1KO8A 1IN5A 2EFCB 4F4IA 3EC2A 4PO1A 4KFTA 4NHOA 4NPHA 1GSIA 4U7DA 3G82C 3AUXA 3GLFB 3N2EA 1MRSA 1QRAA 1OYWA 2P3SA 1ZNWA 2ZYTX 4TMKA 3SEAA 1T8UA 4UJ5A 4X8MA 4BZPA 2IS2A 1V43A 4BLRA 3K0SA 1XZPA 4DDVA 4YMVA 3QSYA 4NH0A 2V3CC 3VNUA 4TYYA 3KXIA 4XWAA 1Z0DA 1E2JA 2GJAA 4JMPA 2KI5A 3A1TA 5CJPA 1UF9A 2ZJBA 2RGEA 2MMCA 4EJSB 2FG5A 4DB4A 5D3MA 1E1QD 2QTHA 2JLVA 2YOHA 3QKRA 2W0MA 1W7AA 1KSGA 1ZINA 3UK6A 1ESNA 4CEIB 1KO7A 3N5CA 3CLVA 2OBLA 4MUBA 2D7DA 1SVWA 2ZRJA 4ASUD 1DELA 5JWOA 1KDTA 4NCKA 4XVUA 1N6PA 2HLDA 4D25A 1XPOA 2ERYA 4TYQA 4H1UA 3VKGA 2G83A 2A5FA 2AHOA 1OPXA 2ZJAA 3MLEA 2KE5A 4B35A 3RWOA 3W8RA 1U90A 1TX4B 3HU2A 1CU1A 2G0TA 1HURA 3B1ZA 3X1YA 2BCGY 4HDQB 4BWYA 3BS4A 1LVGA 3WRYC 4TLAA 4LJ9A 3PEWA 2GAOA 2KBEA 1N25A 3CH5A 4WZAE 4L4UA 5FUYA 1JNYA 4B3FX 3GFTA 2AWNA 4X8OA 1BO6A 4Q03A 4OK5A 5H70A 4M9QA 2GHIA 2X77A 4DLSA 3U7GA 2DFKB 3C7KA 4G5QA 3B1XA 4GRAA 1T5IA 1NN3A 3G5UA 2RB4A 1D5CA 2MSDB 2V7QA 2QTFA 4EIWA 5TMPA 3TUJC 2P6RA 1CBUA 2C77A 1Z2CA 4Q9LA 3E2IA 2IWRA 1S96A 2OFOA 4UXIA 3LD9A 2A5JA 4UKDA 1XFAA 3SFZA 2H57A 3E1SA 2B92A 4OQMA 4Q4HA 5G3YA 5FTKA 3SJZA 4OI2A 1ZJ6A 2XTMA 1SVMA 4PHTA 4Q66C 1XB2A 4MUAA 5F3WB 3ZD6A 4CIDA 4URXR 4MA4A 1VCOA 1G18A 2WIAA 2ZRCA 1W0KD 1YZKA 2AL7A 2GEVA 1OW3B 1I2DA 3HPQA 1R10A 2ODNA 4MGYR 4NP6A 4G01B 3ZQ6A 1U0HC 1PUIA 2WM9B 2KB0A 1W46A 2Z0MA 1R7RA 4HI0E 4LHZA 2O8FB 3MWLA 1G1MA 1U0LA 4QGAA 3FKSD 5L3QA 3QF4B 5F98A 1ZC4A 1MO4A 4XTRA 5DI9A 5B64A 4E22A 3SN6A 3DKPA 4L9WA 4NZYA 3UANA 2VP2A 4EPRA 3PG5A 4C0LA 3OAAD 2Z5FA 4D0LB 1RJ9A 4ZDJA 2ZRFA 3I3SR 1E79D 1HUQA 1Q20A 2JJ1D 2QM7A 3MWYW 4OHWA 4HZUB 4P32A 3RRZA 4IFBA 4U02A 5KU1A 1KSJA 2GCNA 2PLFA 1F48A 3GEIA 3WNBA 2JCSA 5LPNA 4BE7B 1LB1B 1X86B 4QGHA 1S3GA 3PUYA 3W34A 2NOAA 4GSYA 3IIMA 4KFSA 1NVUQ 1UBEA 2JDIA 1NJFA 4B76A 4JLAA 3UG6A 1LNZA 1QHHB 2BM1A 4EAQA 2QSZA 4TLCA 1QHNA 4TQAA 4B6EA 3BORA 221PA 2J46A 5GJBA 1Q1ZA 2BDTA 3SQWA 1JEDA 1VIAA 3DZDA 5KNDA 4K46A 1F60A 1UADA 2O8EA 2GVDC 3LW7A 5ELXA 2V1XA 1E9BA 1IXZA 5EP2A 4AK9A 4AD8A 1QHIA 4XWOA 2QPOA 3CM0A 2IYXA 2RAPA 3MRSA 4NYJQ 5TV2A 3ZVRA 2XNSA 4QGGA 5JI3E 1ZNZA 2WJVA 2ZRNA 2ODBA 3LVRE 121PA 2GXSA 2D2EA 2IYRA 4MRRA 1GILA 4B48A 2IXFA 3FFBA 1ZRHA 3GJXC 5JEEA 4BLOA 2ATXA 4C2TA 4GOJA 2OAQ1 1W2GA 1N6IA 1TADA 4BRWA 4ZKDA 2MMGA 3AUYA 4BLQA 3QPVA 2OE2A 3DL0A 3GJ3A 3RNLA 4JKYA 4W9MC 2ZJYA 4NCNA 1OJLA 5FOVA 1CJVC 2Q3MA 1VYTA 2F3TA 5FOSA 1KI3A 2BHRA 3FKQA 3GLGA 1LFDB 2ZJ2A 3I8SA 1ZNYA 3K9GA 4F93B 5AJVB 3U3MA 5EXXA 2IK8A 3PVSA 4LYJA 4US1R 4R2HA 3K9HA 4MRSA 3UMRA 3IHLA 2H7VA 3LW8A 5CYOA 1TUIA 4Z8YA 4KFRA 3MCAA 3K70C 2D2FA 2J0UA 4KVAA 2WICA 3BK7A 3Q5EA 3SZRA 2PEYA 3EPJA 4CEJB 2RGNC 4LYAA 5DN6D 5FPKA 2GXUA 4C0BA 4E03A 2ZJ8A 4OI4A 3VR5A 2DHRA 1XU4A 1CIPA 3TAUA 4V0NA 1ZM4A 4FWTA 2CCGA 1KOFA 1KDPA 2GXQA 4CT4B 3R20A 1SXJA 4I1VA 3GEHA 2LCFA 4RZ3A 2ZEJA 4B75A 1EXMA 1U9IA 2JLRA 2QU8A 4Q18A 1W36B 1S0UA 1TU3A 3IBYA 1E2EA 4DSOA 3KQNA 2D74A 1QHXA 3GJ5A 1VHTA 4A9AA 1H65A 3NTUA 4QOSA 2N46A 4JLJA 3WYFA 5HKKD 2ZVQX 3CH4B 4R7ZA 5HCNA 1NY6A 2O52A 1VKJA 1HYQA 4Z54A 2RHDA 2FFBA 3LQQA 1JJ7A 1X3SA 2C95A 2WOOA 2YVUA 3K0CC 4KI0A 5LDDC 1GFIA 2P2LA 3WMFA 1FOEB 3LVQE 3SJBA 5FFMA 1Q12A 1DAHA 4AG6A 2UVQA 4ASUA 1OIXA 4HLUA 4DLZA 4JT4A 4QJ4A 4QRHA 3P32A 5LB4A 4RD0A 2NMVA 1Y63A 3B60A 2Z4SA 1XZQA 1F2TB 2R9VA 1NVVR 1KZ7B 3I62A 1KJWA 1F6BA 1XEWX 2BM0A 2F43A 1AZSC 2ANCA 2IYQA 2X19A 3RS3A 3IQWA 3RSLA 2QBYB 3H84A 3W3ZB 1KHTA 3ZJYA 1XTKA 4IVPA 4M2LA 1YR9A 1E2HA 1P62B 4AKHA 1MOZA 1D8TA 2QMEA 1SVKA 4Q21A 1OH5A 1F2UB 3O8DA 3T12A 4B6FA 4Z8XA 2QAGA 2V1UA 4B2LA 4DT1A 2ZRPA 3UPUA 2QGZA 3OESA 2OSBA 4JYCA 2FZ4A 3I8XA 1RPZA 2VQSA 4DLTA 5BYJA 1OH8A 5F9FA 1GNRA 2DWQA 1HH4A 4QHTA 5EE9A 3OIYA 2GETA 2NIPA 5CJ2A 1QHYA 1QZXA 4DCTA 1NVXQ 4I99A 4QL3A 2Q9AA 2QMOA 4ZV4A 4LC1A 1YZLA 3LBIA 4UQOA 1A2BA 1E32A 2VA8A 3TQCA 5L8VA 1J70A 3FMPB 1H8EA 5JCZA 2VBCA 2JIZA 3OE7D 1Z0JA 4Y0AA 3ND8A 1E6CA 3FKSA 2FNAA 2IS6A 1BH2A 3AP3A 3Q72A 5KUTA 1RYFA 3BH7A 3CRMA 4YDHB 1YU9A 4RD6A 2CJWA 1GIAA 2RMKA 3PUXA 3I5XA 3OAAA 1E0SA 3DEFA 1U98A 1AGPA 1WA5A 3L0IB 3NEYA 4PANA 5KNBA 1JECA 3R9IA 3K0FA 5JJLA 3I32A 2WMOB 3SJAA 1JR3D 3GJ7A 3K70D 2VP4A 3CF2A 4JVSB 1E2KA 2F9LA 4C7OA 3X1WA 1FW6A 1L8QA 1XJ0A 4XSHA 1OKKD 1CRQA 2SHKA 3FB4A 2JA1A 3RS7A 1Z6YA 4CW7A 3P26A 4KAXA 1Z6AA 3IKJA 4O25A 4PQYA 1VTKA 2O0JA 3KQKA 4DXAA 2FZLA 3IO3A 1DO2A 3AVYA 4MKFA 3B6EA 2QAGB 1X1SA 3MFYA 3I92A 4GBMA 1VCMA 3CX8A 4HSEA 2GKSA 1B23P 4QBGB 4JKIA 1X8LA 3GQBA 1LF5A 4PZZA 1NF3A 4CF7A 2P5SA 4Q7LA 3RHFA 2ZPTX 3QKTA 2EW1A 1NJGA 5SZJA 1HV8A 3V00A 2HYIC 1CJTC 3I73A 4OYHA 1KZGB 5CM9C 1K6MA 2YHSA 1WB9A 5EP1A 4ZDKA 4L9SA 2V9PA 1N3BA 3AGQA 3CRW1 1Z07A 3BOSA 1ZW6A 4MYUA 1P2TA 3P27A 2NGRA 1R0WA 3DZ8A 4BEBA 1Z3IX 4BLPA 1RIFA 2JAQA 2V6JA 4HAVA 4YMTA 3CWQA 3BH0A 1LW7A 1K5GA 1S9HA 1T6NA 3IDQA 3PEVA 4O0MA 4RD1A 4KLZA 4EPWA 2QE7A 1HY3A 1KJZA 1QHGA 1G8FA 1XDBA 1TU4A 4DWJA 2JLQA 3BFXA 2ZROA 3ND9A 2ODEA 1OLOA 2RGBA 4JVLA 1P3JA 4PQRA 4DSNA 4G0NA 4C7OB 1NMZA 4HB4A 1FNNA 2WAYA 2JJ2A 4TMWA 5DN6A 4LPSA 2YWGA 3MAAC 1ZVQA 4Q4AA 3FGNA 2H16A 1GOTA 5CIQA 2VYFA 3ZZUA 4CGZA 3IGFA 3M4YA 3DM5A 3EA0A 1UAAA 3CF0A 4WA7A 1GG2A 2D06A 4A4DA 2Q6TA 2G1JA 3L0OA 1SKQA 2QQEA 1E2GA 4B43A 1XPRA 2J59A 1W47A 2GZAA 2VEDA 3QENA 3U44A 4JBXA 2IS4A 5SZIA 3SR0A 5AJWA 3GFPA 1P2SA 2ASEA 3HP1A 4ZCLA 1OFUX 3IPXA 3KTAB 5GVRA 3REFA 3B82A 2HCJB 2ZR7A 3U61B 4DSUA 2BC9A 3K0AB 2H18A 1N0VC 3TAHA 1PLKA 2ZS8A 2O0HA 2QROA 1A2KC 4L15A 2PH1A 5J40A 4X8HA 1SZPA 4HDCA 4P4UA 4OI1A 3LY5A 2ZQ5A 1FPMA 4RFVA 5CDFE 4C0AC 3B85A 2OAP1 4E5UA 2ZUBA 4QJ5A 3BE4A 2HJGA 5JSZB 3AM1A 4CT5A 1G6OA 1ZU5A 1E0JA 1I2MA 4HB0A 2IYSA 4MKHA 4U00A 4PSKA 3EXAA 1R5BA 4I1OA 4Q9IA 1VYVA 3DPUA 2QEQA 3GLIA 3T1OA 3B2EA 1E4VA 5TARA 4XVQA 3L43A 3KXLA 4Q5IA 2R6DA 4EQ6A 1JI0A 4F92B 2YOGA 4NYJR 4LHVA 1WF3A 1COWA 4F91B 5J4VA 4EUNA 3EPKA 4C0KA 3KDSE 5BW8A 4HLDA 2H8KA 3KJEA 2FV8A 3GLHA 1QVRA 3GP8A 4CEHA 3EG5A 5IT5A 4E07A 1YZTA 2ZI7A 3RS4A 1G7CA 3T1QA 1D2MA 3K09C 2ZYWX 3NC0C 4BFSA 4MDFA 4V0KA 1EWRA 2ZUDA 2IEYA 2OFWA 5JRJA 3KFXA 1NSFA 3HU3A 3U4QA 3RDPA 3WBKA 1P61B 3QE0A 1VDZA 1GAJA 2MSEB 1UJ2A 5J4LA 3IIJA 4GOXA 1SXJC 3RRNA 4US2R 5EZ5A 3U3KA 2V7QD 3KQUA 4LK2A 1ZBDA 2CL7X 5JECA 1GNPA 1NG9A 1YRAA
chains in the Genus database with same CATH superfamily
1OXXK 9GPBA 5HJEA 4Z7JA 2C9ZA 2I1LA 2MCFA 3O5AA 5IHXA 3WNDA 4K9LA 4DZZA 3H2HA 5LZ5A 5EFZA 2Z4RA 4JZYA 1JHPA 2FPSA 5DULA 4RL6A 2F90A 4Q4LA 4AZVA 2WYHA 4C14A 5JMWA 1MXFA 1P5FA 2XGGA 4LOHA 5KKNB 4L27A 4DIEA 5JS2A 3PLRA 4JJ7A 1UCFA 1R0CA 1SKYB 1GV1A 1SEPA 1IOWA 1WUYA 2HEIA 4M1QA 4YCJA 4I4TF 5AW2A 1YI8A 4XASA 4OLHA 3DAYA 3ESCA 4DA4A 1RKBA 4JI8B 4PPQA 1YBAA 4X1KB 4HLUC 5COBA 3ZW8A 4F60A 5DHFA 2Q2QA 1RMTA 1U2GA 4C03A 1L7PA 2D13A 1NBMD 3UB4A 2PAFA 3DEAA 2E4VA 3FPEA 1B0PA 3TQSA 4KRFA 3SZ3A 4MRAA 3C14C 3N2GA 4MW4A 4LUCA 4REOA 5JY6A 3WGYA 3P9NA 3M49A 3NASA 3P5BA 2Z6AA 4KFUA 4AY2A 1NU6A 4NCJA 3H8WA 4B34A 5CBPB 3NHAA 4FUQA 5AJZA 2XZOA 3EHDA 4I2VA 5LOVA 2L0XA 2ZI6A 3KOYA 1K6XA 1R3DA 4PN7A 5FTLA 1M1YE 5GADl 2JDID 4XM0A 1G0OA 3RVJA 5AW4A 2VJAA 2R7MA 4NQZA 4UUAA 3IOMA 5L40A 3IS3A 4C06A 3T3MB 2E7ZA 4IZ6A 5AW8A 2AKEA 4CVNA 3N2LA 1UOQA 4HKTA 2QAGC 3F1LA 1LSUA 1XDGA 4WJZA 3FFWA 3WMGA 3VOSA 4YV2A 3W79A 4FDUA 5BR7A 3B5IA 2Z09A 5A0VA 4OJKA 3INYA 4S1PA 2PYDA 4JBGA 3IVRA 2G8LA 1CQZA 4JI0B 1KE1A 2WQZA 3N2KB 9ATCA 1Q7CA 2VG8A 3VR5H 1AZLA 4Q12A 2QAJA 3UXEA 2LIVA 4XYMA 2BUCA 2FQXA 3DTYA 1NL3A 2V4UA 3JVIA 4GLFA 3GNSA 2ZRMA 2PT9A 3S29A 3UPTA 2X5XA 3MGGA 4M88A 3HFRA 3QXJA 1IJFA 3FPKA 2FSGA 3QPUA 4M8NE 5EWLA 2J9RA 3LL7A 4KIFA 4HCJA 4QEDA 3V8RA 4YMWA 1N7HA 2X22A 5IC6A 1EFAA 2C4UA 3EF0A 3KETA 3VJRA 5JYBA 2JLWA 4BDTA 1RXVA 4AI6A 2H3EA 2RGAA 2RGXA 2CXOA 1R8YA 2XA1A 1E1MA 1ZWLA 4ZRDA 4PO8A 1MQAA 4PYKA 5ENVA 5G3ZA 3H7IA 4V3BA 3TCKA 2VHQA 1EFCA 1I3MA 3GGOA 4PQFA 4EUFA 4RTMA 4NYMQ 4XDGA 3K70B 1U0BB 1RYHA 1E1DA 3UJAA 1X92A 5KVSA 3HTXA 1MPXA 5AHRA 2BLNA 3DT9A 4L5IA 2C3YA 4XDZA 4Z4EA 1ZVMA 2GB4A 3L0CA 5C4MA 1YB2A 1PUXA 3AZOA 1QVZA 3C7DB 3JYLA 4K03A 1T2NA 1A04A 3TMKA 4EOGA 3WLPA 4PCLA 4CT0A 3OQOA 3NDBB 1PL0A 1R6BX 3EDCA 3M82A 4JH0A 3VU9A 2RGGA 5LQNA 3VYUB 1LLDA 2JD0A 1WVIA 1FVOA 2OSVA 1LI7A 1T36A 4CLDA 3F3MA 3JVUA 5ITZA 2PS3A 2ZR9A 2VTVA 3IDZA 4ARZB 4CQMA 2H11A 2YZGA 4GKAA 2P0AA 1Z4PX 5IT4A 5AUQA 1Z5WA 4KPFC 1VRWA 3U7IA 3H1GA 1I7LA 4F2PA 3HVHA 4RETA 3ZGYA 4OUDB 1IQUA 2ZSHA 3WL5A 4U2BA 3AI7A 2PL1A 3QLVA 4RVDA 5BVGA 1Y0BA 2RC6A 5DF1A 1T35A 1MC1A 1RLIA 4FMPA 2IHYA 2SKCA 2WV9A 4OHPA 4H4EA 1KMIY 4IUDS 3M6IA 2BPOA 4LDRA 3K32A 1WF6A 3HU1A 3LCCA 4MARA 3AC0A 5I8PA 3R3HA 3T1VA 2IZZA 3HDQA 2FFQA 1WMBA 5EE5B 2YCLA 4Q1AA 5JSKA 3ETHA 1JMKC 4F4UA 1RI4A 2ZW9A 4MUFA 2IYOA 5ALLA 1XTRA 1S3IA 1WLYA 3ZVLA 2H08A 4AX8A 3ZBPA 3HEAA 2V54A 4PQGA 5B58C 3PWSA 1I4TD 5LLTA 3C43A 4GHWA 1QLJA 2GZRA 3RUHA 4YFVA 2O8BB 4PZLA 1XMPA 1ZP6A 1KYZA 1PDVA 3RC8A 2JFHA 1M66A 3HB0A 2LKDA 2OO7A 3OJCA 3TK1A 5IM4A 3H97A 2JAOA 4PAQA 3NPMA 4UUMA 3EH2A 4EELA 1Z29A 2I7DA 3ANYB 3C1AA 4B4KA 2VPYA 1SKAA 1A1SA 5ICSA 5KX5B 1X7GA 2GO1A 1WXIA 4FC7A 2IHJA 2RH5A 1Y33E 3E0QA 3EXG2 3HS3A 3RBAA 4PZPA 3NCHA 5DBHX 4YHHB 2GNOA 3LKBA 1FS4A 2AJLI 3DYBA 1ZM7A 3G8BA 4GNKA 2I4NA 4RK7A 5CU7A 4BKMA 1NQXA 3KNZA 4TQ9A 3BWXA 3UH0A 3VTAA 3ZY3A 5LYJB 1XZEA 1EE9A 4HR7A 4DILA 2HIHA 2WE7A 3BULA 4I50B 2AG1A 2IA5A 1T36B 2SCUB 4GOND 1ILEA 4Q4JA 3ZYZA 1NXQA 4FD2A 2VUTA 5BRAA 3WLKX 4NXNB 5BT8A 2OLEA 2OBMA 5ICFA 2C04A 1NMSA 5F78A 4FNAA 4DNOA 6CHYA 1MRNA 5AVUA 3HR7A 9ABPA 4LWQA 3GLFE 2PVSA 1UDWA 3UWMA 1SD2A 1FP7A 2GPSA 1T9HA 3IJPA 2VH5R 4LNUA 4W7SA 5DP1A 3PGA1 4DJFC 3FYUC 1JA0A 2DWPA 3B78A 1SUWA 4GR5A 2IPAB 3ON5A 5A6VA 4YXWA 3SK0A 4PO9A 3RFFA 4L8LA 4P4LA 4XD7A 3EPLA 1JQEA 2WWVD 2AVNA 3ABZA 1YAHA 3M4XA 1MHPA 4KYUA 4PSDA 4JQZA 2F1OA 3W9UA 3THXA 4MYRA 1IBLB 4KL8S 4B87A 3LBFA 4QU5A 1Z36A 5C53B 2XLBA 1SKMA 2LV8A 4OEHA 5K8UA 2IWHA 3IQXA 2AKYA 3QX8A 2AUMA 3RVMA 5A2GA 1NGSA 1Q16A 4BNTA 1C4KA 2VC2B 3NHSA 2GEDA 4LXTA 3KT8A 4ZVSA 5EGNA 4ZYTA 4EO9A 3CURA 4D1YA 4BPBA 4D6PA 1RHRA 1OLUA 3CQ9A 1NP6A 3WK4A 1IWPB 4ND1A 2EYQA 4IZOA 4V38A 4PGGA 1FYVA 2PTHA 3A7EA 4RHEA 3OQ6A 4CTMA 5FDFA 4EJMA 3JQBA 3FOZA 3FNRA 4UOEA 2XJ4A 5DO9A 4L2IA 3I5MA 4YWHA 1Q83A 2Y76A 3RS8A 4BE9A 3IXLA 3GIDA 4HN9A 4YUWA 1N2SA 1QP7A 2Q41A 4BB6A 2PL9A 1QH9A 1L4HA 3BWCA 1C8BA 3CW8X 2UV8A 3TZHA 1ZHFA 2XT9A 2ATVA 3CSUA 1EIZA 4TL6A 4HK4A 2YQ4A 3HUTA 4CV1A 2O8NA 4RC9A 5KYKA 3HKDA 2XBLA 3BDVA 3I1IA 4ANFA 1SQ0A 4V1CI 4CLXA 5DIFA 3AY7A 1G41A 3GAMA 4WZBE 3RWMB 3ZIAA 4YC7A 2D0PB 2GKGA 4EMSA 3U4MA 1QVWA 1R6AA 2WJ6A 4OHVA 5T64A 4XRGA 3U6KA 4CLEA 4LNUB 3TD6A 5JPDA 5FOXA 5FUBA 3AJDA 1I13A 3KZMA 3QJYA 3RT9A 2JLUA 2RHBA 1A5ZA 4U6QA 2PANA 4XAQA 3UV7A 1KYIA 1XTTA 5IYZF 2AG5A 4L0QA 2VL7A 1QU2A 4MMXB 5GZ3A 5JS1A 1U6KA 5FD8A 2RGYA 3QU9A 5IAEA 3EVZA 2JB9A 5LNK6 1RZRD 3IAS1 3NP9A 1O97C 3O4IA 3MRXA 1L6IA 2D62A 1U0NA 2AI1A 2A6PA 4FOOA 4L5JA 1Z33A 4E30A 1G7SA 2NVOA 1WZUA 2WYVA 3ONVA 1IHXA 1EFHA 3MJRA 1G6HA 1GQFA 1I1NA 3CMMA 1YGYA 3HJNA 1O87A 2X4IA 3L82B 1Y9EA 4O4JB 5AIAA 5I45A 4JXXA 1NMEA 3OKCA 1NBAA 2WYIA 5BMVA 1N6NA 3LXRA 5KMGA 4Y2PA 2I6SA 4E31A 1L3BA 3T1TA 3NBFA 3PSAA 2DLCX 4XJXA 3UF0A 4HNHA 4HYTA 1FMJA 4KR7A 3JXEA 1XLVA 2X9LA 2C29D 2O7QA 4FMDB 3JCZA 4E2YA 2NO6A 3DVAA 4HPWA 1DG3A 2GRUA 4R2JA 2Q1WA 2VHCA 2HRBA 3QWHA 3WOVA 5JNWA 3V8MA 5ALUA 2A9OA 3UATA 3OLVA 4YP9A 1T2AA 5FB3A 4OFBA 4AQYB 3EFBA 3DMTC 3OZCA 4PXSA 3JWGA 1D4AA 3P9YA 4ZRNA 3TLXA 2G08A 3E6AA 2ZUCA 3VO2A 4KPEC 2FWBA 4IF4A 1VJ1A 5T8KC 1P17A 3DXZA 1QFXA 1Z73A 2GNAA 2XKJE 3LZDA 3JQEA 1GTSA 2C5AA 3MT8A 5CEJA 1ZOPA 4EA7A 2QW1A 3T3NA 1QP4A 4WXEA 2BIFA 6Q21A 2JCXA 4JI1B 4LRYA 1I3KA 4TS9A 4FHGA 4NJOA 3SOZA 2ZM6B 1E5LA 1RAGA 1TCCA 3FWZA 1CR1A 1JQ3A 1NPYA 2E6KA 1L7AA 3PDCA 5G4KB 4IIJF 3I1YA 1YRYE 3T9AA 4AJ2A 1M76A 4NOKA 4EF6A 5A4IS 1U3DA 2HCTA 4WOKA 3SG0A 3NWPA 3C8UA 3D0QA 3AZQA 1YQXA 4BFZA 3OT1A 4A82A 3LPNA 4W5WA 5ALPA 5EXEA 1II8A 3O6VA 5DJ5A 2YIJA 4DHEA 4P81A 1LJLA 1BMFA 1QLWA 3EMVA 4RVCA 3UENA 3DLCA 3GUCA 3H3XA 3GJQA 4ILKA 1KAQA 4XLTA 2XHEA 4FOPA 1L4GA 4GMXA 5DGHA 3V3TA 4EHBA 5GJVC 2GCPA 3VTFA 4OK3A 1MJGA 1K4KA 1KK2A 1HWYA 4IDNA 1XZBA 2FYTA 2FWMX 3IAS6 1I0IA 2WY2D 2Y0EA 3MPUA 1RRFA 2D5AA 2KWIA 2HT6A 3DBIA 2B0CA 5EP3A 5AT1A 5AYVA 5AVXA 3PYLA 1Z4QA 3F3KA 3ABRB 2CK3A 5AKZA 2XXAA 2ZIZA 3O8NA 2TMKA 1JI3A 2MYPA 5DK6A 3SBEA 3EVCA 3E5NA 4G3XA 4LDAA 3RU2A 2GPJA 3L6CA 2J4CA 4I5DA 4AJ9A 3DHNA 5EWMB 4XTCS 1KS2A 1RXYA 1YULA 3C1OA 4HEJA 4YCAA 3TOSA 3WE7A 1NM5C 2BMJA 3VOAA 1E5VA 4RBNA 4OHXA 3UWSA 4D8UA 3KUCA 1HTWA 5I7OA 1T15A 4QDOA 4GKJB 3A37A 1Q6ZA 1NI3A 2BEUA 4G8BA 1UBSB 2EDCA 4HDNA 5KPDA 4RLHA 2P35A 5IK2A 4YJHA 4D9KA 3CKMA 5AMXA 5HM8A 1ENOA 1JIJA 4UAUA 5LMCA 1TEVA 5KDOA 4EYQA 4FXOA 4KFCA 5ALIA 2WTAA 4EKDA 4ZJYA 4GQAA 4EB0A 1EQUA 4UPDA 1JHUA 1JALA 1VRCA 3F1KA 4L3VA 4QTXA 2A9JA 3H9UA 3NGXA 4Y9TA 5E6SB 1MCZA 1VHJA 4CKCB 1VL5A 4EZBA 4DV1B 3JARA 1JQLB 2QVZX 3TB4A 3T9BA 3CTMA 4KIGA 3PSHA 5ES3A 2IDMA 3UAWA 1BIFA 1YA4A 4B6EA 2ZP1A 1G8KA 5AP9A 1VC2A 4OGWA 4YPOA 4W5OA 4UTRA 3AG6A 1AJEA 2HF9A 3Q85A 4GMKA 4HDRB 4NZMA 3ZEAA 4ZCMA 1A50B 4R5HA 4TLDA 5K6AC 1CRLA 2CY0A 3G88A 4OHCA 2V6IA 4O63O 2ODAA 4KKVA 5HK9A 4UBLA 1AA9A 2R7AA 4GW3A 4LYGA 3ZNPA 4DGQA 2B2CA 3LKZA 5JI2E 3UAZA 3KV3O 4GX0A 1QAQA 2YOFA 3UWDA 3FGPA 1Y5LA 1IUPA 3AEUA 4GKBA 4JENA 3ZCPA 2GYYA 2B5OA 2ORWA 1N6KA 3NHJA 1O4VA 2WTMA 3P20A 3R41A 4G85A 3JS5A 3P4XA 3EGVA 4TRRA 4J0EA 1E0AA 4DBLE 1E4EB 1JAYA 3EGDB 4UREA 2HJSA 2HA3A 3PQ3A 2LCQA 1QOZA 1XHFA 1YFZA 1QGAA 4EI8A 3HK2A 1F12A 1IBSA 2IYUA 2F43B 1GCAA 3BMOB 3MLAA 4L5YA 1DUSA 3SYRA 3TQRA 1SY7A 5ALJA 4FGSA 5FT9A 1XGKA 4TL9A 3DV0A 1KBOA 3GA7A 4DMKA 1GITA 2Z83A 1H9CA 2J3IA 1ZN7A 1TLTA 4Q3KA 1KO1A 5IX8A 4K6CA 4KO8A 4XXHA 3P9IA 1R6XA 2QIOA 2YXPX 3WHPA 4RKFA 5I9NA 5K20A 3FZGA 4IV0A 4Y67A 3RGWS 1QDEA 3ZBTA 4EUHA 2XYRA 4JP2A 3A26A 1QO0A 5JVDA 3OY2A 4ZI3A 2AOUA 3N1UA 4E2ZA 4WASA 3VC3A 1KY3A 2QRMA 3N8DA 3P97A 4DNFA 3FOEC 4O5OA 3D8NA 4IGAA 3FMGA 3TW0A 1EK2A 4BFTA 4AJPA 2W11A 3C6MA 1L9XA 2X9GA 4DLLA 1OYYA 1F4PA 4RIEA 1SXJE 3P94A 2PMBA 3IQHX 4C5AA 1WS6A 3DZFA 4WCFA 4C4PA 1FTGA 1G3RA 1SPXA 2ECPA 2XWSA 4JKOA 3WKAA 3FTEA 1EX7A 4E6PA 3HL4A 3PX7A 1KRXA 2ZRLA 5B2ZA 5BN5A 1T9CA 5CB6A 5A3QA 1A9RA 4JA0A 4YAGA 2W6IA 1FNMA 1GUZA 2Q5IA 1ZCZA 2HSEA 1FZQA 3O47A 2JEYA 2Z3ZA 5FA5A 5JU6A 3N0VA 5K2MA 3KR0A 2XB2A 1T5TA 1KFEB 2VP5A 1UZNA 4RMNA 1SJ9A 3K5IA 3R09A 2VJMA 4TV8A 4WKPA 2C94A 5FHRA 4CG0A 2VAPA 4E2WA 2XHZA 4ILEA 3AEUB 4JI7B 5AKYA 2CJWB 1NJ8A 2BSQA 3UH1A 2A1UB 3QPWA 2RHWA 1TUBA 4PR3A 4FEYA 4LOJA 4D02A 4DNPA 4ZICA 1EIWA 1TU0A 4AO7A 4F8JA 4EDHA 3IV9A 3U3DA 2JATA 3EEYA 4QYSA 2FSVC 5FPSA 2J7PD 1GNQA 1ZSYA 3KU4A 1UOPA 4Y6OA 4DIUA 5CFMA 2C07A 1OR8A 3QXHA 4XWKA 5JR3A 3R23A 1W4LA 2VK8A 4Y3UA 4PG8A 1KWGA 1DLIA 2BGKA 3GROA 2ZJ6A 1Z7BA 4WFJA 3E7FA 4U7WA 3L5OA 2FH5B 2ZPUA 1NW9B 2AEMA 2WOJA 1C0PA 5IH7A 1EAMA 1PG5A 3CCBA 1OLSA 3PX2A 3QQ5A 2A58A 4G2TA 3E2PA 4AULA 4DIOA 1KZ6A 4XYLA 3IB6A 1R8QA 5JVDB 5KCZA 4CKWA 2HF2A 3I3OA 4IMRA 4B82A 4RH1A 4KO1S 4O59O 1PCXA 3ROZA 3RUDA 1N8SA 2PGOA 3I30X 3OBIA 3V7UA 4CQMD 1NXSA 4CTJA 4WBNF 3IUJA 3C5EA 2QN1A 3GYGA 5K8LA 4ADSG 3QVGA 3SC2A 1E9EA 2WBLC 1ICEA 1JA9A 4R6XA 5FHQA 4HNGA 3DMNA 1H5UA 2OV8A 2APJA 3FPGA 2FSFA 3K1YA 4BZQA 1J33A 1I7NA 2NNLD 2FCRA 3NFYA 4PAGA 1ISGA 1CD5A 3OX4A 4KPGA 4M0KA 5JC8A 2C7RA 3J7TA 3RE1A 4ON9A 1QSGA 4QTYA 3AIIA 3H5IA 3HLTA 5BQ3A 2Q3LA 4EX7A 4YRJA 1DBWA 2OXFA 3GP5A 1EFVA 3I6QA 3WLSA 4EFNA 4P0PB 4JB2A 5LQSA 1NW6A 4YUAA 3OM8A 1RAHA 3UTDA 4EPYA 1AKMA 2AI2A 2RBEA 2VJMB 3IPYA 1YDMA 2C5FA 2X6TA 4FMBB 4B84A 1NASA 5JXJA 2HFKA 4BHTA 2O0LA 3T5GA 4C6RA 4Z3DA 1DX6A 1MIHA 3JQQA 3S7ZA 1YCFA 4QBTA 1FYWA 4HNAB 3ZGLA 2WU4A 2JFWA 4MUEA 1G3QA 3NEAA 4R84A 4JL5A 4NULA 2COUA 4BFWA 5LXTF 2P0EA 1K7CA 4HRAA 2NSYA 1ORHA 2IGBA 2ZIFA 5KNCA 4MWTA 3DL7A 2D1QA 5EJFA 5EUCA 4JLMA 5DSTA 1KC1A 2YIDA 4B3XA 2NTYC 5J1TB 5KDLA 3SJ7A 1TM3E 1QCYA 1XMXA 1A8UA 3GD7A 2ZRBA 3RK1A 3GJ4A 1I8TA 2ZBFA 2QNBA 4LX0A 5AW1A 2JGKA 2QMZA 1MAVA 1HFWA 3MWEA 3D59A 1VMKA 2FOLA 4YP1A 1UBNA 4CNBA 3BH6A 3W5VA 1KBZA 3H2BA 3NHPA 4C0WA 3L0BA 4CFSA 3N0RA 4CGYA 3HDHA 4C4XA 5E6RA 4CKWB 2Q0QA 4URHA 4NFHA 5FI1B 3RBXA 3OTWA 2FF7A 3ESYA 3CO5A 3LJKA 1EE2A 1XTZA 4AZ0B 2D4AA 5LQJA 1E9DA 2ZU6A 2WQ7A 4G1UC 4NYIQ 2IIVA 2DHQA 2HL6A 2XNDD 1W581 3ZK9A 1X19A 2QWXA 2Y77A 3QVGB 2OHJA 2VPPA 3ABIA 1E1RA 3I0NA 4BCDA 1U9IC 2OVBA 3F3SA 4DV0B 2BGGA 2AUTA 3OOSA 2VDNB 4HXYA 4MK4A 2Z6QA 3TXAA 1GUYA 2WSIA 1YL6A 4M38A 4GOLD 4J6EA 1V1MB 1YTLA 2X4DA 3PIIA 4Y2YA 2BR4A 3G8YA 3NT2A 4YXWD 2HSWA 3GT4A 1TCUA 3JD1A 4KAJA 4XD7D 3BMQA 5KTKA 1QF9A 4B85A 1T26A 1T3SA 2XMZA 1DRUA 3QFRA 4OBXA 3TLEA 4C7MA 2O8CA 1LPBB 3M3HA 1Z68A 4QQFA 5E3HA 2RGCA 3UJ7A 1Z2OX 1ORVA 4TMYA 3SQMA 2JFXA 5F73A 4E6EA 1BW9A 1V1RB 4MQEB 5IBRA 4OLFA 1X8XA 1E94E 3VPAA 2IW3A 3RT7A 2M1ZA 2YN2A 1FJHA 1YZ3A 3VU1A 4BRSA 5KOHB 1AQNA 4N82A 2BF4A 5DTIA 5K0FA 4D56A 2UZIR 2QMYA 3MMZA 4EG0A 5JAPA 2ZYDA 3CPJB 4D26A 2Q5FA 1KR5A 2C7BA 1RWQA 4HL6A 4MQ5A 2JGRA 4WFQA 1U94A 3BB4A 2JAHA 4EQ6B 3K8QA 2P67A 5TMBA 3W5JA 3COWA 3AM4A 4DCJA 1AK1A 1TDJA 5CFQA 1MO6A 3BQMB 2GBIA 2J1LA 4DAOA 4YLGA 5K51A 1N5JA 1WPGA 1YV9A 2JD1A 1BMTA 1ULSA 3IEPA 3U13A 4ETWA 2PUCA 4CV2A 2MTBA 2YZ2A 5DOZA 2HMAA 4DWVA 2VJOA 5A9SB 1MJHA 5IVDA 2DGDA 3TNFA 3KBOA 1T1GA 3BKWA 3OZWA 1M2NA 2IYYA 3RC7A 4BWVA 4MCIA 1ECGA 3L1JA 2A5GA 4LDZA 5CX1A 5EQTA 5ARCA 4ZCIA 1TYCA 4PX3A 1HA3A 4TMTA 5F1PA 2XJ9A 1GLVA 1C0IA 3CBQA 2B3DA 3ANTA 3PE6A 5K0LA 2XKBA 4TSFD 2X40A 2IYWA 4GMHA 1PWYE 3ZIAD 3ORQA 1JDVA 3C3KA 3VOTA 1LY1A 2G9UA 2WK1A 1B93A 3NHBA 1E3DA 1UFOA 2QTRA 3QG1A 4DKJA 3S8YA 1AS3A 1NN5A 4QD3A 1Z8DA 3L6BA 4LWZA 4YS6A 5I9BA 4HVTA 5JNRA 3GPDG 3MS2A 2AC4A 2MJLA 2ORED 1JHXA 4L6IA 4EARA 3M34A 4KQIA 3REGA 3HWSA 3MTEA 4E4YA 1H0RA 2OCKA 3PX3A 4BNLA 5IH3A 2GR9A 2NQ8A 3D31A 2YNMC 3NR2A 4MDHA 3NXSA 4RWZA 4J3NA 2G9RA 3GLFA 5KAPA 5I9IA 2I03A 3ITEA 1RACA 3O21A 4TMVA 4OVKA 2A86A 1PJCA 2Y2UA 1JJVA 3FIJA 1BW9B 3G68A 5EIBD 4EPVA 1FUKA 2PMDA 3Q0IA 1SA0A 3WB9A 3BIWA 1DPFA 4IIGA 4R16A 4W5JA 3EIHA 3L7DA 1Y3AA 2R1UA 4MOWA 1XTIA 4TUYB 4RPHA 1WSAA 3FNHA 3HL0A 4KGXA 4PX9A 2GHRA 1XZGA 3I64A 4WLVA 4BJ3A 4ZHSA 2QZZA 4UM5A 1ZX1A 4U7HA 4A7PA 1XJCA 1YACA 2ZB4A 4LJYA 3TKAA 4WAUA 3PBKA 1W5AA 4LIPD 5FLKA 3AP1A 4AYXA 4G5RA 2W4IA 1PUJA 4QVGA 1HOTA 2BBWA 2PRJA 3PUVA 1OU0A 4DLUA 3GRVA 2A4MA 1F38A 2ZTHA 3BXHA 4AIRA 5FF9A 4WN9A 4RULA 4FGWA 2QMUA 2XVYA 4WESB 5F52A 1RAAA 2GERA 2YICA 3KYIB 4LV5B 4M99A 4UU7A 3IAFA 3FD8A 4XSVA 5FO0A 4E12A 5J2UF 1P73A 3ZQJA 4WQMA 1MO5A 2D7CA 3QWFA 4D4KA 5IXSA 1MVLA 3RCBA 2RIPA 5CX1B 3DTNA 1WZCA 3COJA 1OTHA 3A4LA 3F6RA 3ZZNA 1LI4A 5TMEA 1XU9A 3MQFA 4FFRA 1KOLA 2E2WA 2IEIA 4XGKA 2WIFA 4ZYUA 1V26A 1V1JA 4IOMA 2RD2A 3ZWPA 1UQRA 4F46A 4YRAA 3HGTA 4HNRA 2CXSA 1SBHA 2OG1A 3PFHA 4J1QA 2C3OA 4Z86A 3WYAA 1EWTA 2Q7XA 3RSGA 1SC1A 1JT2A 3BXPA 4P7FA 1E92A 2NU7A 1F06A 2C2GA 3H86A 3RYIB 3L6RA 1HQDA 4RV9A 2CL6X 1QFZA 1PQYA 4BE4A 4BEWA 4DSAA 2A5DA 3HB5X 3JVEA 1PLLA 4G5FA 3VR2A 2IF2A 1R0YA 3IIEA 1UJ5A 3H11B 4QC2A 4KK3A 621PA 2R8OA 4NMLA 1BMFD 2WAOA 3NRBA 3K96A 1UM9B 2GI4A 3SY8A 3QJ5A 5K0NA 1U7DA 4PPYA 5FLEX 1RCUA 2L82A 4BVAA 2PT7A 4ZFNA 1VLZA 4XPIB 1A97A 5D2CA 1IY8A 2IP1A 4R9RA 4FFDA 4WKOA 3RIHA 3KYDA 3L7KA 1FSGA 1II9A 2HJ9A 5E95A 1CKEA 3DM9B 2F48A 3GOQA 4X1YB 3X1MA 4RTOA 2CLEB 4FCVA 3FTCA 2I2BA 4NRDA 5HIJA 2DFPA 5YASA 4BNDA 1EWYA 4CL0A 3QMWA 1OOEA 2GTIA 3H9CA 4FHEA 4CCYA 2ACKA 2FW9A 3MVEA 4CBVA 4IDHA 1H3FA 2O8FA 3QX3A 5J4KA 1HDRA 3OQIA 4W1QA 3AY3A 3OM0A 2J4DA 4NNPA 4W9NC 2NUAA 2WFZA 4RY9A 5TVGA 2EP7A 4HAYA 4KH1A 5DCUA 2B5VA 3SX0A 1OYVA 1BTOA 1R15A 1ZH2A 1SQ5A 2G8NA 1RQ2A 1E9CA 4N0DA 3Q0TA 4WY2A 4XM2A 1CB7A 1OV4A 4HZUA 1IVSA 1ONNA 3T5PA 5IK2D 2P7HA 1NVBA 1Z2PX 2BWJA 4Q15A 5PGMA 2A8YA 2BBOA 2WV7A 4XYBA 4AMZA 1FQJA 1W1WA 2PX6A 3ND5A 4M46A 1THZA 2FUG6 3P2EA 5KAMA 4M53A 2J87A 2ZJZA 1NUSA 2I62A 4TKUA 5JHGB 4L78A 4GBED 4IMIB 5FAKA 4LY6A 5HP4A 1KSHA 3PWTA 3T1HB 1CS4C 2CXPA 1YCDA 2JCBA 2WFMA 3F6PA 4P80A 3W9SA 2B4AA 5LP6B 4AM8A 3ICPA 1NJ5A 4CMGA 1VPWA 2ID7A 1OWOA 3Q3GE 2CLLB 3UA4A 1NFRA 1ML4A 2E1RA 3DKKA 1Y4DE 2JLBA 4FW9A 3GCDA 4JSRA 4NCHA 1XYVA 5FRDA 4BP3A 4DDKA 4E21A 1L4MA 2VK1A 2WC1A 3HXQA 4F6LA 3D0RA 3IUYA 2XTJA 2BGTA 1T4BA 1M7HA 2ZRAA 3AF4A 2JI9A 4FMCB 3GCXA 2K2QB 2OCLA 5EPEA 4O2RA 3MUEA 4D9EA 1IN6A 1T9GR 2FPPB 1Y6RA 2O4UX 2XSZA 2YHIA 5G4LA 2QXYA 4C4SA 3QH4A 3ZPXA 5HQTA 2Z2ZA 2TECE 2V7PA 4YAOA 2E18A 3TW8B 1RXIA 1XTJA 1FLAA 1P1CA 4EEXA 4PCVA 4YO8A 2GF0A 1JRLA 2IOFA 3GCWA 1LSOA 2P9JA 3MEQA 1P2VA 4Y2JA 3DTVB 2P5TB 2B21A 3EOBI 3EVAA 1TZMA 3KJNA 4P8RA 1SK8A 3QKIA 4RHUA 3INNA 4ZO6A 5JDCC 4JLKA 3JWEA 3EC1A 1FW8A 4ZVMA 3KJIA 3VPCA 2G67A 2GPAA 2XB4A 1E6MA 1O77A 2LVBA 3QEMA 4JITA 4X3CA 2QLLA 3T38A 4Q3LA 1UC8A 2HDOA 4KVFA 1XZCA 3QLEA 4JC5A 3T61A 1GL7A 3CUYA 4PS0A 3W6ZA 4J0FA 1VI6A 4TYMA 1LJUA 4C29A 1NKSA 4OJNA 2XCRB 1VL8A 4NMXB 5E8RA 1LSSA 5KHAA 5CK4A 3RS0A 2BYTA 2WHXA 2BZSA 2EL7A 2WZCA 2O2SA 4IJVA 4LN1A 4ME6A 3BIJA 2XD9A 2FFAA 2VWPA 4ER6A 2YMMA 2AH5A 2V9CA 4MCAA 4A92A 4KN9S 1Z5OA 3BD9A 3BXXA 5FXMA 2R25B 3IQFA 2AZTA 2C3PA 3T52A 3ZDRA 4GZ3A 5H5JA 4EG8A 3N8IA 2P8SA 5TMDA 3BCRA 3VZSA 3PD1A 2BRUC 1JFFB 3NEJA 2XAUA 4S35A 2BHTA 1HT0A 4PLFA 1EXDA 3HI4A 5DM2A 4LSZA 1TZ2A 2H31A 1IEVA 1Y4UA 3CKLA 2OT3B 5JZBA 2OC9A 3ORHA 2O2ZA 3C85A 1M73E 2H4YA 4GUAA 3L6UA 4DPMA 1EVKA 1GJRA 1GUBA 1TJYA 2F1KA 3G0IA 4IO0A 3EX7C 1XU7A 3OQBA 2IXEA 3I9FA 5M2QA 1UFRA 3TH5A 1A72A 3JALB 4CM8A 2O3RA 1Q1GA 4JCCA 1C8KA 4I3GA 3O8OA 5AJTA 4Q1CA 2H2GA 3GCGA 13PKA 1G55A 2C2ZA 2ZBUA 3CEPB 3M89A 4PX2A 3IEVA 4G41A 3HUEA 3ER6A 2C4HA 3RIYA 5FWXB 3A4YA 1GPBA 4L7VA 3EC7A 4FC6A 2R6HA 5ALGA 3IDSA 3UYLA 1F2TA 5G1PA 3TGPA 1GM5A 4RK6A 4OMUA 1R9JA 2YWJA 2NZ8A 2IVZA 3LM8A 4BNFA 4LE2A 1P2GA 3KALA 2PFGA 2HNKA 3WA7A 1N5KA 1UEJA 2V7BA 5HF5A 3JATB 1XTPA 4NTZA 2O05A 2YZNA 3OLZA 1X1BA 4DNXA 4L8VA 4B6RA 1AQUA 2W5UA 3AUUA 3PC8C 4PLGA 2OYCA 3OEHD 4A8JB 1TMGE 4ZYYA 4NXMB 4Z9XA 2VBIA 1K7EB 1YJQA 1YKSA 3OH8A 2UZ3A 4BVEA 1TRKA 3GBSA 5CYPA 2QRNA 1OTYA 3O2JA 4HH4A 4JUDX 4MUXA 2IW1A 4I4LA 5HF9A 1U65A 2JIQA 4PICA 3UZUA 1G5RA 4BVHA 4DRYA 1T0BA 2NUTA 3N75A 4M0EA 421PA 1FXUA 3KB1A 3PGJA 4GMGA 2IXTA 4LZWA 1I4LD 3GWZA 4P33A 4RD4A 4AUMA 4LYYA 2VI5A 4NFYA 1NG1A 3PE3A 4J0HA 1XLTC 1D9XA 3QBVA 4JLDA 4FFPA 3KYCA 2AFHB 2IZ7A 4PCAA 1SHKA 3ECSA 4B73A 4IIYA 3CSSA 4TTAA 3VI4B 4MQFB 1E1QA 4RD2A 4ZVTA 3PU6A 3IUBA 2B34A 5KNDH 3CNHA 3EF3A 3AEQB 1UMCB 1Y4SA 1NYTA 4E88A 5HDQA 2I76A 3ZZ0A 1KIFA 2H5IA 4G0MA 4ZQHA 1UAGA 4R1LA 2IY9A 4PBSA 3IT3A 5A0FA 3W8NA 2WWXA 5HKAA 2FK7A 4CM8B 2HHHB 4M89A 2HA2A 4KO4S 4OATA 4BRUA 5DLYA 3UXHA 2VTKA 3D4NA 4F71A 3F98A 3UFXA 1PN3A 4IG4A 4G2NA 4XJVA 3VH3A 5BMOA 3ZU2A 3UJBA 1GTL1 1QWSA 2AGVA 2Q21A 1MJNA 2YV3A 4NEGA 3HCPA 3WLHA 2HCFA 3LFUA 2F1RA 2VNIA 4PSAA 5DH9A 2QX9A 3HY4A 4ER3A 1SVNA 4L8YA 4HH1A 4CRWB 2PX3A 3M1YA 2O54A 3A31A 1G4HA 3L9XA 4P54A 1IBMB 1N8TA 2RI6A 1U7UA 1DAKA 4O2AA 1FYDA 5B4VA 3ZVKA 4NU5A 1ADGA 3HKBB 1XWFA 3DD1A 3O84A 4JZKA 3OQ1A 4O4LB 4URWR 3FPJA 4NVRA 2V0NA 2ZG6A 1M54A 2UKDA 5LOVF 4MROA 3HDTA 2A5LA 2II6A 3M8KA 1E3WB 4WY5A 2H1LA 1GL6A 1U81A 2F00A 1QBKC 1Y9ZA 1P1KA 3H2IA 3Q88A 3UUWA 1JIKA 3DYVA 2PH5A 1GL3A 2CBXA 2PX8A 3NHFA 5AM1A 2CXNA 4WVFA 3GHHA 3OEEA 1M2HA 4X60A 2OXRA 4OL9A 1G8SA 1JHAA 1X87A 2GTPA 2Q1SA 3BB1A 1X7YA 2QRVA 1DTSA 3KV1A 4IDPA 4OYYA 1KJYA 3PA6A 4TVOA 3QUAA 3P8ZA 4M1KA 4N7RA 3G5MA 4EYOA 3GZNA 5KSWB 2FWIA 1JYSA 1NYQA 2V03A 3B12A 5AXBA 3IJEB 4GUDA 3WK8A 5IU6A 1VDMA 3B1VA 3NORA 3MJTA 4MLZA 5A5VA 2BF7A 4NJEA 2OO3A 2ZSEA 3UOGA 3RAGA 5EJ4A 1D09A 3RKRA 1VHLA 2PSJA 2VAVA 1JEYA 3FYHA 4Y8VA 4YIHA 1UZMA 1T8YA 2GA8A 4UAGA 5JJBA 3G9TA 3JYOA 2IE8A 3DDSA 3F9CA 4LNHA 4AB1A 2Z1MA 3VDNB 2BBTA 3WLIA 2YTZA 1NSYA 2FN4A 1JKXA 1FSSA 2JKZA 2Y1WA 4GC9A 4QNRA 1V47A 3DLHA 2PFKA 5HRCA 1GTMA 1XEWY 2P4QA 3UFXB 1QDLB 4KBGA 3ZJTA 1PR4A 3PYXA 1ZYUA 4BO3A 3BHMA 3MN1A 1N1DA 4M0DA 5JFTA 1K0FA 2ZRGA 2AK2A 2D1YA 3FOFC 1E20A 4FFSA 1O5OA 4DARA 3MMNA 5BNWA 1BWSA 3FROA 4N7BA 5K09A 4Q3CA 1FPQA 3EIQA 3ETGA 2C5LA 3IMFA 3NUQA 4G1BA 4MQ4A 2QL6A 3OY7A 5AJXA 3IP5A 2J85A 3VSDA 5KJFA 1J4AA 4NICA 4PIPA 2ZS7A 2Q8PA 4DNQA 4OU5A 3M6UA 1HKHA 2AT1A 2PPLA 2AZMA 3AI2A 3CR8A 4IFEA 1QYWA 3WNZA 1NYLA 4RDCA 1M33A 1ECPA 4DA6A 4E3ZA