5TIIA

Comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
251
structure length
241
Chain Sequence
ELELGLRGKKALVTGGSRGVGRGVVLALARAGVDVFTCYREESDASASLARELKQLGGDHHALRADLADPKQIAELFQEVGRRFGTLDVVVNNAGVISHVPYAELPVAEWQRIVDVNLTGAHLVIQHAIPLLGDKGSVISIGSKSSEVGIPLRAHYTATKHALRGLTRSLAKEYGRSGLRFNVLALGVVETEAEMTKFYSTKTALGRLGTPDEVAGAVAWLASDLSRYVTGATIHVDGGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Analysis of a Novel Ketoreductase for Pentangular Polyphenol Biosynthesis.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-ACP reductase
total genus 89
structure length 241
sequence length 251
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tiiA00
5JYDA 3DHEA 3ZNPA 4BNNA 2YV3A 5IZ4A 1WWKA 4GSLA 2BD0A 3L07A 5CAEA 1WZIA 4MVJI 9LDTA 4CM4B 3JYQA 2IXAA 4Z0TA 2GDZA 3CZMA 1ISJA 3M1LA 2IODA 2OFPA 1C0KA 4ND2A 1WMAA 4PZEA 3EMKA 1ZUD1 4EITA 2QZ9A 4YJHA 2HMSA 3PK0A 4ROSA 1W73A 4LCEA 2VZ8A 4YT4A 4JNKA 3TZ6A 2H5LA 3C7CB 1H2HA 5A5FA 1E7MA 2X4GA 4IXWA 4XEHA 1GEGA 4WLFA 1LX6A 4KDFA 3BYZA 2HLPA 5I9LA 2NU6A 3DO5A 3H6KA 2ZTLA 4Q3EA 4JP2A 1PEDA 4UEKA 3B1FA 3TOXA 3GHYA 2D1YA 2X0IA 4IBOA 4CM5A 3DZJA 3HN2A 4D7AA 4RF2A 4R5MA 3CXRA 1PGOA 1X0VA 1TEHA 3GNQA 4CPDA 2Y1OA 3GN2A 5A05A 4CLDA 1JVSA 1KOLA 5CG2A 1XU7A 1MC4A 1Q7GA 3NDJA 1HF3A 1LC0A 3DC2A 3OIFA 4HKTA 4MO2A 4R41A 1TT7A 5CDYA 2OZPA 3RC9A 1PL7A 1JKFA 3BXXA 4L4SA 2G82A 2E48A 1JLLA 3JTMA 4KWIA 2OL4A 2G0TA 3BMOA 1GQYA 2HUNA 3OBBA 4AVYA 3I83A 2A92A 4WKGA 4R1NA 5GZ3A 1YL5A 1P0CA 4AJIA 1KVSA 3BHMA 1A4IA 1JWAB 3ETDA 5JDCA 3VC7A 1EDZA 4ZJUA 5HTOA 3KEQA 1N7GA 1R15A 1YQXA 3H3FA 4CQMD 5L3ZA 3DAFA 1HSOA 4YJDA 2VWPA 4K6FA 4MPDA 2RHCA 1G6KA 5DZSA 5L51A 2ZTVA 3H8VA 4D43A 1I24A 1HT0A 4IJVA 3M1AA 4ALKA 4O0LA 1QR6A 5DBGA 1LLUA 4Y6RA 5EJ2A 1VSVA 2JD2A 3E9NA 1VLLA 2TMGA 3GC6A 1UP7A 3GAZA 4NPCA 3NT2A 2JFHA 1Y81A 3NRCA 5I7SA 3RC2A 3NTOA 1EVIA 1SB9A 2PKRA 2H6EA 2NWQA 1RJWA 3BMCA 3GRKA 3KYCB 1EVJA 2Y0DA 1QORA 1UXIA 2O7SA 1GYQA 3D3EA 4FOSA 3MOIA 2FY8A 1QXSA 4J6FA 3VPSA 4CLRA 1PJQA 4XR9A 3BIOA 4PN3A 5JDCC 5KOIA 2B35A 1ZCJA 1V3TA 1QV6A 3LC1O 3OEYA 2FP4A 3HJAA 4BNGA 3DOCA 3JD4A 3CPSA 3PGXA 5DP1A 5TJHA 2C2YA 1UZMA 2VTEA 3H2ZA 4QECA 4R3WA 3FNHA 4I5FA 4XYGA 3NDRA 2W2KB 3MWEB 5TNXA 2BGMA 3EVNA 3PZBA 1TA4A 3TDKA 4OM8A 3ZU4A 3T7EA 3IL2A 3DB2A 2XXJA 1LU9A 4GX5A 4HV4A 1PGNA 4S3MA 5IDYA 3SC6A 3B70A 3QW2A 4CV1A 1TT5A 4WEOA 4RV9A 4LVUA 1U3WA 3GAFA 3O8QA 1BG6A 4YYZA 4QFDA 5G2OA 5BNTA 2I76A 1GYPA 3S1LA 3AFNA 3OFSA 5EQFA 1BXGB 1CJCA 4HFJA 2X7HA 4J4TA 4WCFB 3ZI0A 3LVFO 3IDSA 1H93A 5KJ6A 1UXKA 3EC7A 1VPDA 1GCUA 3OH8A 4BB6A 3P19A 4E21A 1B8UA 2JKVA 4NBTA 2O50A 1U5CA 4JK3A 1PS9A 4Y98A 4DL9A 2J5KA 2J3JA 2FPIA 1I30A 2DBZA 1RYDA 4J4BA 3N74A 4MVJF 4CMIB 1E1MA 4CV2A 4YAEA 4JBGA 3KXDA 5DDIP 1F8FA 3ZW9A 2W90A 3FTNA 5DN9A 2HO5A 2IDZA 1YL7A 3AUUA 1LA2A 3AI3A 3JQGB 3LF2A 3W8DA 3WBFA 5IDXA 5HRUA 4IQ0A 4CUJA 5ICMA 3MEQA 1HDRA 4G5HA 5CDTA 2WD8A 2BGLA 4Y67A 2NTJA 5JDIA 1F14A 2VHYA 2P9EA 2J8ZA 4M87A 3I9OA 4YJHB 3TWOA 1GY8A 3NJ4A 4MJLA 1LQTA 3ZV4A 1PQPA 4OH1A 3ASUA 1PL6A 2J5QA 1YQDA 4RORA 2FR0A 5FI3A 4BOYA 2DBQA 1U8XX 5K9ZA 1BDMA 2FMUA 2R2GA 1DC5A 1YB5A 4Q3AA 2HK7A 4BGEA 2G17A 2AMFA 5T57A 3AWDA 4IDGA 2HDHA 4NJMB 5KTKA 4OXKA 1V0JA 3F5QA 2AQIA 4OIMA 1M75A 3JQ8B 4B3IA 2EP7A 1TLTA 2JHFA 3A4VA 5THKA 4FBGA 4IQ8A 2VUUA 5L45A 1BVUA 2AEMA 2LDBA 3LC2O 4YACA 4GVXA 2X0JA 4BB5A 1A4UA 2VYND 1YOVA 3PHJA 2PWZA 4NBVA 4PLVA 2IYPA 1C1DA 2PKQP 3WSWA 4DIOA 4J1QA 1CQIA 2Q2QA 1XYGA 2CF5A 1CERA 3K9QO 3LT2A 3DZFA 1HZJA 3FBTA 3PYLA 4YXFA 1ULUA 1E6EA 2IZ0A 2WJPA 5EMHA 2IZ1A 3DAGA 1KEWA 3LDHA 4AJ1A 1PWXA 1NVTA 4KUHA 1ADCA 1XG5A 1OFGA 4HY3A 4GI2A 2X86A 4DC1A 4RVSA 3RASA 2NTVA 3NUGA 1F06A 4R54A 2O3QA 4CV0A 3EY4A 1CYDA 3PYXA 3AU8A 1I8TA 3LT1A 3ZHZA 2HMTA 5THQA 3PFWO 3WLFA 1QLHA 3ZWNA 4YTEA 2VCYA 4IJUA 1GZ3A 1X0XA 4KP7A 2W2LA 2RAFA 3MCVA 2VHZA 4J3FA 1HE3A 3BTSA 4YQZA 4AL4A 1XEAA 3IAHA 2PD6A 1I0ZA 2DC1A 1OC2A 2DT5A 2GASA 3JD3A 2C5AA 2J5RA 1ONNA 3HE3A 1E7YA 1HDXA 5L4LA 4LGVA 1NR7A 3E6AA 4FGSA 4JX8A 5ITWA 3M6IA 1IHXA 4IPTA 3ROQA 3FN4A 3O9ZA 1AUPA 1R0SA 1IE3A 4JROA 1T2EA 4R01A 4W6ZA 4B4OA 2OORA 3GVCA 1DPGA 2EJWA 3GF4A 5JDIC 2PD3A 3BMOB 1KETA 2GRAA 1AN9A 2VWQA 1WDLA 3HB5X 2W4QA 3TZQA 2POQX 5JCJA 1ZIDA 4KQXA 3QWBA 3WGIA 5C7OO 2D4AA 4NZ9A 2CDCA 4K9DA 4WPGA 1KVQA 5JFOA 1TI7A 3SC4A 3Q3CA 4NMHA 4EEZA 4RVHA 5I8WA 1Z74A 4RQUA 4ZN6A 4KUEA 3QSGA 4XX0A 2ZATA 2W2KA 2PH3A 3EVTA 2YQ4A 2ZIZA 3JQDA 4UVEA 1GDHA 4EJ0A 3JQ7A 3S55A 3N7UA 2OGUA 5I9MA 3FWNA 5JY1A 1IOLA 2I3AA 2OP1A 5CHEA 4RJTA 2AE1A 1ZMOA 2OOSA 3NAQA 2Y1DA 4FC7A 5AOVA 2VRCD 3MJVA 4LK3A 5AXAA 1D3AA 3G17A 3BMNA 1Y5RA 5B4TA 3OJEA 5T5QA 3ASVA 2ZB4A 4WLVA 3E9MA 1ZK1A 4CM9D 4L0QA 2OXIA 4ZQGA 1QSGA 1S7CA 2O4CA 3LZ6A 4RGBA 3VH1A 1DJQA 1LDNA 1HDYA 2D8AA 3D5TA 3ONEA 2VWGA 4WGGA 4PLFA 4CM3A 4I5DA 2OP0A 1EBFA 1IUKA 2EHDA 4TRNA 5CPBA 3D0OA 3K92A 1R37A 4QQRA 5GZ1A 4FFRA 4IDDA 3VPFA 3GH3A 4LRTB 3S2FA 3TNLA 3UKOA 2P2SA 4E3ZA 1YL6A 3I5MA 1HKUA 4EBFA 2HRZA 3RD5A 3W6UA 1ADBA 5CEFA 4A0SA 1YB4A 3DZBA 4OMUA 2WDZA 1BW9B 1QYDA 2C7VA 5G4KB 2QQ5A 4B8WA 3UCXA 1UDBA 3LK7A 4CM8A 4R4JA 4OKIA 4E0BA 4LISA 1VSUA 1D7OA 4TZKA 4Z9FA 1AXGA 4BO0A 1HXHA 3DZHA 3BZUA 4JBHA 1C14A 3AK4A 3HFGA 4IDCA 5FI5A 1E7WA 1V6AA 4NK4A 4C4OA 2PGJA 3GPDG 5TS3A 4YPOA 3ICPA 1HE4A 4I5GA 6ADHA 3B1KA 2FSSA 4IMRA 2RBEA 4DA9A 1XLTA 4QXMA 1NNUA 4R69A 1QLJA 4EUFA 4RQTA 4BNMA 3OQ6A 3ADOA 3L0DA 1E1LA 4KQWA 2CDAA 3D3WA 3KLPX 1EUDA 1Q1NA 3R0IA 3KB6A 3WICA 1LI4A 4QO8A 5IN5A 1PJBA 2NU8A 1N9GA 4L74A 1R4NB 3OM9A 3ROKA 3ZWVA 4J7XA 1K3TA 3FTPA 3KETA 2O3RA 3P5SA 1MG0A 3QVSA 5GMOA 2ZCUA 3GZNB 1BGVA 4RVUA 4JQCA 1X7HA 2YJZA 4TRJA 3COSA 1SC6A 3C7AA 4CV3A 3C1AA 3F6YA 5GY7A 1HRDA 2DPHA 2ZJ0A 3R3JA 4NH4A 4WCFA 1FF9A 1ZKMA 2BFOA 4I9HA 5KKAA 3GNSA 1T26A 1QKIA 2WYWA 4OQZA 4BNUA 1DSSG 4W4TA 1GV1A 4BO7A 4UREA 1I3LA 5JMPA 5DCYA 1ZEMA 3H7AA 2O3JA 4HFMA 5I7EA 1ZW1A 3K8ZA 3VZSA 2D5CA 3F3SA 4BO5A 1U4SA 2PNFA 1LDBA 3KSZO 5FF9A 4R5HA 1T2CA 1KEUA 3H5RA 4HNHA 1Y8RA 1T2FA 3E8XA 5A5EA 1SCUA 4ZVVA 1U7HA 2BHLA 1K0UA 7ADHA 3VAZA 3ZNNA 3AUTA 5ER6A 3WJ7A 4LRSB 1Q7CA 4IJKA 3PXXA 1P45A 4YAKA 1GPJA 4RZIA 4Z0PA 3JQAB 5TIIA 1GQ2A 5IFLA 3JQ9A 2EWMA 3C1OA 3GR6A 1NFFA 3WGOA 3DBVO 1XELA 4BMVA 3D64A 2A94A 4E5NA 4Z6KA 5I7VA 2NM0A 3L4BC 3MTGA 1VRWA 4RL6A 2PZJA 3DMTC 2VTDA 1BMDA 4FW8A 3RFXA 3RUCA 4B3JA 4O59O 4KOAA 3L77A 2NV6A 2HQ1A 3P2OA 3PP8A 1BTOA 2EW8A 3Q2KA 4B79A 4DBVO 5BQFA 4GGOA 4XCVA 3F9IA 5TGDA 3GVPA 1NHWA 4FS3A 2DM6A 1O95A 4A2CA 1WLYA 3WXBA 1PZEA 3HHPA 1H94A 3LSYA 3LLSA 4PLZA 1ENZA 1X15A 3FPLA 4FFOA 4O63O 5B4VA 4DTIA 2CDBA 3IMFA 4O5OA 2E4AA 5JCJD 3WLEA 4JJFA 4Q3CA 2Z1NA 4MVJG 4BGIA 1EFLA 5BNIA 5JAIA 2ZB7A 2P5UA 2Y1EA 3PQEA 5CPFA 3GDFA 2X0RA 1UP4A 1YGYA 3NEPX 3ON5A 3PPIA 4GLOA 5A04A 2X58A 2PY6A 3GNTA 1CETA 4XYLA 4DPMA 1BDBA 2J3IA 4BNFA 1PJ4A 5TRTA 3VTFA 2BRUA 4J7UA 1SB8A 3ZGYA 3HFSA 4ZRNA 3GUYA 3KVOA 1PSDA 4TSKA 3V1UA 4AJ4A 4II3A 1E3JA 4ONEA 2Y1FA 3VKUA 4DIFA 4DQXA 4XZ3A 3A1NA 3MJCA 1BSVA 3RUDA 3O03A 1PQWA 2GNAA 5DULA 1LRLA 3INGA 4QO7A 3W6ZA 3DOJA 4Y6PA 1P1JA 1EK6A 2H63A 4TRRA 4W99A 4AJPA 2YZ7A 4YRDA 4NFSA 4NFYA 3ANNA 2VYNA 4RZHA 2HJRA 4GX2A 3QWFA 2IXBA 4R3NA 1IL0A 3W1VA 4B8ZA 3FRJA 3I4FA 3DHYA 3PWSA 1E6WA 4F6CA 2ZQYA 3LC7O 2DPGA 3F46A 3G1TA 4IY1A 4NQZA 1ZVMA 2PR2A 5KVQA 4HX5A 4WE3A 4KZPA 3X2EA 3K73O 4BNJA 1PJLA 2C54A 1NWHA 3L9XA 3TF5A 2GCGA 3CMMA 4H15A 4CM8B 4GMFA 4RF3A 3K96A 4MIYA 1LEHA 5KVCA 1DRWA 1NR1A 4OAQA 4CM9A 3Q1LA 3DMYA 4J43A 4E13A 2EV9A 3TL2A 2XXBA 1E3WA 1ONPA 4IXTA 1XQ6A 4BQPA 4PG5A 2EGGA 3ABIA 3V5NA 3WQQA 2B36A 1R4NA 1ISFA 1GUFA 2VRCA 3OMLA 3UW3A 5IZCC 1I2ZA 5TF4A 3G49A 4J7CA 5K6AC 1WW8A 3H2SA 1NBOA 4DPLA 1MV8A 5IN4A 1DHRA 2V6BA 2QIOA 3RU9A 2Z95A 3U09A 1RM5A 3RC1A 1O94A 1GYRA 1ZFNA 4U7WA 2E6UX 4ZQHA 5B4UA 3WMWA 1B7GO 4GKVA 3WGHA 5DBIA 4DVJA 4C7KA 1I3KA 3GMSA 3CIFA 3NGXA 4D0RA 2FOIA 1T25A 1A9YA 4OO3A 3WWZA 3D5QA 4HP8A 4U6SA 7MDHA 3JSAA 1T2DA 4ZQBA 3WYBA 4IS2A 2PK3A 4KTVE 1JVBA 2GD1O 5C7LO 4HWKA 1EQ2A 4YAJA 3DR3A 1DC4A 4PLPA 1I3NA 4NU6A 2AXQA 3JV7A 1PIWA 3AM3A 4WOJA 4W9NA 1W6UA 3DTTA 1ZEJA 2PFGA 5EIOA 1FK8A 1I33A 1RKXA 1E3LA 3K6JA 3MJSA 4DQVA 1DRUA 3WMXA 4CMCA 1C0IA 4FFPA 1Q0HA 5TQVA 4YT8A 3PFFA 3QV1A 4NI5A 1D4FA 4IZIA 5L40A 2LDXA 3K30A 2AA3A 3HSKA 2B4TO 1N1EA 4XGIA 4ZA2A 3IJPA 5JNLA 3FI9A 2CD9A 1MP0A 3MTJA 4I8XA 2V65A 3CTMA 1OBFO 4PZCA 1V9LA 3S2IA 2C2XA 5A3JA 2WWRA 3KV3O 4XQGA 1JKJA 3KTDA 1ZK3A 4L73A 1SOWA 5K6AA 4XJSA 3C1TA 4S1VA 1GAEO 3TZHA 3WWYA 2ZTMA 1N2SA 4FN4A 4HFRA 4QUKA 1KEVA 1LJ8A 4R51A 1PGJA 2O3UA 4WCDA 3RFVA 3VPXA 1ISIA 4TKMA 4J9VA 2Y66A 4GL4A 5L4NA 3N58A 3U4DA 4BKQA 3WQRA 1Y9AA 1Q0LA 2G76A 3H4VA 3A06A 1NPDA 3AUSA 3EUWA 3ZCXA 3AY7A 4DIBA 2P4HX 4D45A 1YE3A 4OHUA 4LN1A 1FXSA 2QRJA 4AFNA 3BMCB 3I9JA 4FSHA 3S2GA 1GUZA 1H9AA 4YAIA 1DFHA 3RFTA 4CQMA 2I3GA 2CUKA 4ZQEA 4HADA 3ROMA 3KHUA 5L4SA 1NP3A 1KS9A 4A03A 4ND3A 3LT0A 3UAGA 2X6TA 2WE7A 2YDXA 3GZNA 4I5EA 5TX7A 5IDQA 4J1NA 5F5NA 1YVEI 2JJYA 1DIGA 3QVWA 3ZWYA 1NWCA 3ZW8A 2DFDA 2EIHA 3JQ6A 3KBOA 3UFXA 3TFOA 1U2DA 4FIZA 1XWFA 5A9TA 2H1SA 3BMQB 2QYSA 3AW9A 5ADHA 2VN8A 1JAXA 1Y6JA 1B3BA 4HBGA 4OKNA 5EESA 4EYEA 1SMKA 2I9PA 2BI7A 3DBLB 3OICA 4E2ZA 1RM4A 3HN7A 1DB3A 4TVBA 5HM8A 2NQ8A 3BMNB 4ND5A 2DFVA 1E1KA 1E3WB 1E3IA 3RI3A 5G0VA 4WLUA 3UUWA 5KIAA 5JC1A 2FN7A 1GV0A 5HWSA 2WD7B 4JBIA 4ZD6A 1X14A 4L76A 5AXCA 2NADA 1YXMA 3C85A 3Q11A 3PTZA 4R9SA 3ZWCA 2ZK7A 4FFMA 1UP6A 1M6WA 3HZZA 1ZXBA 3IKVA 3DOOA 4P8RA 5HBRA 1Q0QA 5ENDA 3BTOA 5A06A 4NJOA 4F3YA 3PIIA 4D41A 3H9EO 2EEZA 4XA8A 5F21A 3UHAA 5K0ZA 1K6JA 4KDEA 4M8SA 5DCWA 1HTBA 2J3KA 4AJLA 1BRMA 5KJCA 3JQEA 1KY4A 2JAPA 3W8FA 5IG2A 4OJNA 3W4KA 4F6LA 1FMCA 2P9CA 3AI1A 4AJEA 1NHGA 1U5AA 2O23A 4FJ1A 3QY9A 1Y8QB 1B14A 4IIVA 1HLPA 3BHJA 3CZRA 1C1XB 4U8GA 3HDQA 2G5CA 1QYCA 3PJFA 2AHRA 4JIGA 4B4VA 1YOVB 2PZKA 4KUGA 2FPGA 1LC3A 5L9AA 3PJGA 2WE8A 3SEFA 1QYWA 3K31A 3OIGA 4E6PA 5A03A 2P68A 2VRBA 3JYPA 4K26A 4CMJA 3M2TA 2FRDA 4BHTA 4PFJA 4D46A 4K28A 4B7XA 5IAAA 4D42A 1LDYA 5CDSA 2VT2A 3F5SA 4E2WA 3HG7A 4J4HA 4UEJA 1UAYA 3JD2A 4UVIA 4E4YA 2RH8A 4D0SA 1YBVA 1MG5A 3E48A 1T2AA 1K6XA 3NJ8A 3E82A 3I4CA 5A9RA 3L6EA 1YWGO 4CUKA 3TFQA 1IPEA 1CEQA 2PZLA 2YDYA 3NV9A 3WX0A 5ILOA 1KERA 4N5MA 4GWKA 1LSUA 4LW8A 1Z75A 2NU9A 3ZN2A 1ENOA 4EEXA 1YJQA 2VOJA 5JC8A 4NBRA 1E92A 4WASA 3JQBC 2YV1A 3JQ8A 3GZ4A 3VZRA 5JCXA 5KVSA 3ANMA 2UDPA 4B4WA 4FPXA 3UICA 2YQ5A 3HWRA 3ZU5A 1ENPA 5DCUA 4FJ2A 3A9WA 4OSPA 3B20A 4INAA 3L6DA 3TPCA 2WEKA 4UUMA 3Q9UA 2Z1MA 2NU7A 1C1DB 3U0BA 4B3HA 4TMFA 1C0LA 1ORRA 4XD2A 3Q0EA 1NQ5A 2VUTA 1PR9A 4WNIA 1ISMA 4TVOA 3KZVA 4WK6A 2YY7A 1F0YA 1I2CA 4GQAA 4NNJA 3I3OA 5IF3A 2I6TA 3S2EA 1NAHA 1PJCA 3UN1A 2OO5A 3OECA 3DZIA 1AXEA 3Q2IA 4HUJA 2EJVA 1V3VA 2HRBA 1E3SA 4UUOA 2GPTA 1XIVA 1MGOA 2VYVA 2RCYA 3D4OA 5IXYA 5T64A 4X54A 4MINA 2X5JO 4FR5A 2QX7A 3U3XA 1ISGA 4XJTA 1NPTO 2EKPA 1Q7BA 4WUVA 1L7DA 1LLDA 4N18A 4AICA 4CMAA 3DEYX 2X9NA 2BF7A 5KKCA 2FR8A 8LDHA 1WXDA 4BNYA 4GH5A 5JO9A 3WQSB 5HA5A 1BXZA 2Y1CA 3AOEA 3T7CA 4U6QA 3F4LA 1O0SA 2Q99A 2AW5A 1B8VA 5AXBA 1D1SA 4PG6A 1YKFA 4GVLA 4G65A 4N54A 1WP4A 4YBZA 4DGSA 4IINA 1CQJA 2UV8A 4RO0A 4YEDA 1ONOA 1PZFA 4YR9A 1DLIA 2O48X 3F47A 3GHHA 3QIVA 2EKLA 1BW9A 5BSHA 3HQ4O 4DMLA 5G4KA 1DAPA 1IB6A 2E37A 3OJOA 4R1SA 1MX3A 1HDZA 2OBNA 5L7WA 1HL3A 1A9ZA 2V6FA 1VM6A 3JYLA 5COBA 1E7QA 5H82A 1EE2A 2IRWA 3KYCA 4BKPA 3FR8A 2Q50A 4XYMA 4ZQFA 3C8MA 3JQ7B 1OAAA 4CLHA 3GK3A 3OHSX 5MGBA 1T4BA 4Z3KA 4CLRB 1D1TA 4Y6SA 5F1OA 1SBYA 3NX4A 4UVHA 3DBLA 3JQFC 2P9GA 4CR7A 4FDAA 1WDMA 3HNPA 1E1NA 3DFZA 1R4MB 1E5QA 1BWSA 3U4IA 2BGKA 2CSUA 3DMTA 4LSWA 1TXGA 1B15A 1E3EA 1SZJG 1VI2A 2HU2A 1YONA 2JAHA 4P4LA 2EKQA 5ER9A 4XDZA 3VVBA 4YA6A 1U9JA 1U3UA 3IS3A 3VHRA 2X9VA 2Q4BA 4BNZA 4ALMA 2B0JA 2BKAA 1IULA 1RYEA 3LLVA 2GN8A 1GUYA 3U49A 2X9GA 3GRPA 5L7YA 2I66A 1Y8QA 4IS3A 2PH5A 3ZU2A 1FDUA 3E5RA 4LSMA 4BO3A 1VJ1A 4IGEA 1UJMA 2D0IA 3TOZA 3ZWAA 5KJEA 1RM3A 1KYQA 1UDAA 3MZ0A 4BL5A 2GLXA 1FDVA 2EP5A 4IQGA 3RC7A 4TRMA 4A5OA 3E18A 1Y5MA 4WECA 4CUZA 4EJ6A 3KLMX 2O7QA 3O38A 1A7KA 4R1UA 1P44A 2V6MA 3MJ4A 4BGVA 1HEUA 1B26A 5C7IO 3C3XA 1UZNA 2G1UA 5AXDA 3D1LA 3GVIA 2VHVA 2P91A 1I32A 4Q3NA 3WFJA 3RAJA 3ZDFA 4JGBA 2HMVA 2Q1UA 2HSDA 4M86A 3GOHA 1P74A 4JN6B 5CG1A 4L9RA 5BSGA 3I9LA 3GPIA 1Y7TA 1AGNA 4MDHA 1DFGA 5DP2A 3IUSA 1J49A 4BO6A 5LDGA 2TMDA 3TSCA 1M76A 3L4BA 1M66A 1H0KA 1VL0A 3H9QA 4AJKA 3QE3A 3D4NA 3ROPA 1LLCA 4A73A 2EG9A 2Q2WA 1O5IA 4ND4A 4K1LA 4BIIA 1E6UA 4LMPA 3DFUA 1N9GB 1NAIA 4L4RA 3UGKA 3MJTA 3ZV3A 1DXYA 1TB4A 3UF0A 4Q3BA 4TZTA 4U0KA 4EGFA 3HB4X 1DC6A 3WGZA 1WPQA 3E1KA 4I9UA 4R68A 1EUZA 1Y9EA 5F5LA 4RF4A 4DC0A 1ML3A 1K5HA 1PJSA 1X7DA 1YS4A 3RQSA 1LNQA 3TZCA 3TL3A 4CM7A 4FGWA 5KJFA 2NVUA 4IDEA 4W82A 2X22A 3QJ5A 5AQ1A 5JAMA 2JCYA 2EERA 3K2BA 3NT5A 5B37A 1PX0A 4OQYA 4IIUA 2CZCA 3ICCA 3DBHA 2D3TA 2BELA 1XHLA 1H9BA 2HCTA 3U4CA 3QQPA 1NASA 5B1YA 3BTUA 3WGYA 3R3SA 4B4UA 1I10A 4KWHA 3H9UA 4AJ2A 1S6YA 3KEOA 3PRJA 5C3MA 4RVFA 1ZJYA 3VH3A 2C5EA 1C0PA 1V8BA 2GZ3A 4P4GA 1BHSA 4MVJD 3ZV6A 3AFMA 3IOYA 1DFIA 4BNHA 3GGGA 1ZZEA 3KUXA 2ZKLA 4NG5A 1HYEA 5TSDA 5CEEA 3RROA 3CE6A 4RVGA 3KOUA 4IDAA 5ENVA 1VC2A 1PS8A 3HADA 3QLJA 2AG5A 4J9UE 3RUFA 1XA0A 1WVGA 2WSBA 3W8EA 4BO4A 4YDRA 4LMRA 3SBOA 3RU7A 4H7PA 1CIVA 3JQBA 4RDIA 5AYVA 1PQUA 4MVJP 1MLDA 3X2FA 1P77A 5FEUA 8ADHA 1OC4A 2C59A 3Q6IA 1MC5A 1V35A 3PHHA 3VPHA 3A28A 4D3FA 1GD1O 1IHYA 2VQ3A 3FD8A 4D79A 1B8PA 4Z9XA 2D5AA 5U1PA 2VOEA 1B2LA 5T67A 2O2YA 1GCOA 4PLWA 3VOSA 3JQAA 3DZKA 4L8VA 1A5ZA 2J6IA 5A9SB 2ZQZA 1HYHA 1DIBA 5JBIA 4MVJA 1G0OA 3RBVA 3C24A 4BVAA 1JAYA 5C37A 2Y99A 4PZDA 4YWJA 4CQLB 4M89A 2B5VA 2GERA 4ALNA 4IJWA 3FWZA 3ZWOA 3LYLA 1N92A 1B0AA 9LDBA 2C07A 3H9JA 3DZGA 4PLCA 4GAEA 4G2NA 1MXFA 2UUOA 3AU9A 5IDWA 3K5PA 2JL1A 5G0UA 2VHWA 3A14A 1DHTA 3BAZA 4EW6A 5JS6A 3DBRB 2B83A 5TJ9A 4J2OA 3OETA 3ZHYA 3VH2A 1VJTA 2GN9A 4FFLA 1ZSNA 2Q1TA 3ETGA 2NNLD 4I08A 1R12A 3GVHA 3G79A 3D4PA 3H9GA 1SOVA 4YRAA 1NVMB 1PJ3A 2FR1A 3V8BA 4FFNA 5J23A 1VJ0A 3P7MA 1ZBQA 3JCZA 1F8GA 3JQCA 4KTTE 1H2BA 3FR7A 1HDOA 1T1SA 1CRWG 1UZLA 1JA9A 1GQQA 1I5RA 1LSSA 3I23A 4OXYA 1Z7EA 3DQPA 4EDFA 3GGOA 2B5WA 1ZO8A 1BXKA 5F1PA 1FJHA 2DU8A 4QSMA 4MVJM 3G0OA 3VH4A 1R0LA 2Q45A 5L95A 3SJ7A 2X1HA 2AQHA 1JTVA 2FZWA 1CWUA 4PRLA 2RHRA 2R00C 2VUSA 3L9WA 3GFBA 4D44A 4ZU3A 2VHXA 4D3SA 1UUFA 2XOXA 1NFRA 2UAGA 2A35A 1NPYA 3C7DB 1EVYA 4WEQA 2J3HA 4WJZA 3V2GA 4JJGA 1YRLA 3PWZA 2HJSA 4DWVA 1PGPA 1DC3A 2DAPA 1Z82A 1E5LA 4CLEA 1SAYA 3L6OO 3R1IA 3KSUA 1O9BA 3B1JA 1RM0A 5JYEA 3AM5A 3F1KA 3GY0A 5DOVA 1XU9A 4GWGA 3RUHA 4NU5A 2ZYDA 2DLDA 1VKOA 1EDOA 3NDIA 5A02A 2B4RO 1LDGA 1I36A 1PS0A 3FNFA 3L4SO 3TN7A 1R0KA 1P33A 1O6ZA 4Z0HO 3ZHBA 1U7TA 3ZHXA 2IYOA 4ZHSA 1WMBA 4U0JA 1GEEA 3I1JA 1P3DA 2GYYA 4J0FA 1PWZA 5ILGA 3RWBA 3OJFA 4BNIA 3RUIA 4PLTA 2ZYGA 1YBAA 4YCAA 1Z45A 4UVDA 2QHXA 3QVOA 4BGUA 1H6CA 4RPLA 4RPKA 1YDEA 2DTDA 2GN4A 1PJTA 2WTBA 3AI2A 4XQCA 4YJGB 1GPDG 1YH3A 2P5YA 4RLHA 2X5KO 4ZRMA 3K2EA 3I9NA 5EN4A 4WLNA 2UUPA 4BO2A 4YQYA 4CR8A 3GUCA 3OEWA 5H83A 1JN0A 1M67A 1FDSA 3PHIA 1AE1A 3GG9A 4CLOA 3GLQA 4QT0A 3ULKA 3WS7A 3QRWA 1HETA 5B12A 4BNVA 1MFZA 4DBZA 1YBMA 1HSZA 3ITKA 4IUYA 3LU1A 3ONFA 4PG8A 2GUGA 3W4JA 4MVJH 3V1YA 2V7PA 4CM4A 4J16A 2JCXA 1F12A 2ZB3A 3GGPA 4Q3DA 4XQEA 5KCZA 1DJNA 1Z6ZA 1XDWA 4XGNA 1ZSYA 4OYRA 4FD3A 1MUUA 5JAZA 2I67A 1ZSVA 4CMEC 2A4KA 3PI7A 2RH4A 4NK5A 1JW9B 4B7CA 2NVUB 2AEJA 3V2HA 3BMQA 5G0TA 4CR6A 5MDHA 1NXQA 3AUAA 3WBBA 5DF1A 4K6CA 3FNEA 4CMKA 5I9NA 4RF5A 4E33A 3TRIA 3QWIA 2GR9A 4MP8A 2QW8A 2DBRA 3ZWXA 3ZNOA 4PG7A 1P0FA 1P31A 3D3WB 5CEJA 4M49A 4J49A 4NHEA 2NACA 4PLHA 4LCJA 1Y1PA 4DREA 1YB1A 1LLQA 2WD7A 1MA0A 5KNLA 3WGGA 3OJ0A 2VYVD 3WB9A 2B4QA 4XKJA 2Z5LA 1GFSA 3WNQA 1P9LA 1U8FO 2EXXA 2GSDA 5JAQA 5T6BA 2NTNA 4PCVA 2Q46A 2JFFA 3CMCO 2ZB8A 3WOHA 5L53A 3G1UA 1ARZA 1Z7BA 1H6DA 3VVCA 1LDEA 3W4IA 5DT9A 4PLYA 4DRYA 2ILTA 2WYVA 1ISHA 5DBFA 3PDUA 1N7HA 5EL0A 5ICSA 3GA0A 4OOFA 1TT5B 3U9LA 4BO1A 1R66A 1B3RA 1DOHA 3VZQA 5I8ZA 4GGPA 1FDTA 3ANLA 4NFHA 3H3JA 3VPGA 1QMGA 1HZZA 4UULA 1OMOA 5TC4A 4IGFA 4E5PA 1MB4A 2CVQA 2IE0A 1PZHA 2NQTA 3DL2A 3PIDA 4W9NC 3ZWPA 5BSFA 3WYEA 3IIEA 3OJLA 3DONA 4YAGA 3GQVA 5JY6A 4YT2A 2UVDA 1ZXLA 2ZYAA 4L75A 4OSOA 4EJMA 3H5AA 3RBZA 2JHGA 1E77A 1UAGA 3JQGA 2D59A 4OGWA 4PG4A 2ZJ1A 3JYOA 5CP8A 4LVCA 1IZ0A 3RSHA 2PGDA 3MWDB 4A26A 4XWYA 3VZPA 4AJHA 3HUDA 3ENNA 4URFA 5IXSA 4Q39A 2YHUA 1YDWA 2HKIA 3IJRA 3I6QA 4E2XA 5U4QA 1OZAA 3HDJA 5DNAA 4EUHA 5G0SA 1DAOA 1U28A 1KVTA 4YVFA 4G81A 2D2IA 2QRLA 2HMUA 5A1TA 1SNYA 5EERA 5JO0A 3E5MA 3VTZA 3IC5A 4FCCA 3RJ5A 4MP3A 3BA1A 4R9RA 4CMHA 1UXHA 4WLEA 1KC1A 4DXHA 1B16A 4R1TA 2V6GA 2ZCVA 3AOGA 3HDHA 2UYYA 3LF1A 4NJMA 4Z3DA 1GTMA 3I6IA 3U4HA 2B37A 4MKRA 4YT5A 3UH1A 2YV2A 3F1LA 1EK5A 4Y9DA 3MOGA 3RUAA 2O4UX 3ZWBA 2Q1WA 3WFIA 4E32A 2DTEA 2Q49A 2GGSA 1PZGA 3MJEA 3WJAA 1PL8A 4BKRA 3SVTA 3WIDA 1O8CA 3OP4A 3DDNA 3VDRA 3PZRA 2NVWA 4CM1A 1C1XA 4CM6A 3BHIA 4NIMA 1Y8RB 3UOGA 1SEPA 3VDQA 4ALIA 2ZTUA 2OUIA 4ALJA 3F4BA 2NVBA 1IZ9A 1VE9A 3TZKA 2Y1GA 1PGQA 2GF2A 4NBUA 2BFAA 1LUAA 1EFKA 3V2UA 1KY5A 1PR3A 1GR0A 1UDCA 1G1AA 1LRJA 2O3SA 2W2LD 1WDKA 5FFFA 2H9IA 1X13A 2PV7A 1KVRA 1ZMTA 5KJ1A 3QWAA 3GDGA 3RIHA 4XIYA 5CDUA 3NT4A 1EBUA 1DIAA 4YJFA 4OXNA 4DLBA 1XGKA 2W8ZA 4BS9A 3RKRA 1DEHA 2NSDA 4AJJA 4ALLA 1XCBA 1ZJZA 2VWHA 1K2WA 1QYXA 2C82A 1LSOA 2E82A 1LBEA 2CMDA 3RBXA 4E5YA 2Y67A 1MXHA 1A7AA 4XRGA 4WCFC 2CFCA 4FQ8A 4IMPA 4YJGA 2W98A 2HK9A 1ADGA 3JQFA 4XYEA 2O3TA 4HNGA 1DDOA 1A27A 2Q4EA 2OHXA 4CMGA 4YB8A 3WYCA 2YHIB 1ULSA 4PVDA 3ZU3A 4CL3A 2FSVA 2FPPA 3AY3A 5JW6A 4P22A 1K6IA 3I52A 4RCVA 1JWBB 1KIFA 1NX6A 3P2YA 1P1FA 1LDMA 4MIOA 4RDHA 2DUWA 4QTZA 4E31A 2FHSA 3KO8A 1NM5A 2I5PO 1DLJA 3ORFA 3PJDA 3STHA 2WMDA 1EQUA 5I7FA 4UUPA 1X7GA 1XKQA 3ITDA 1DIHA 3ONDA 4N5NA 4UEOA 3CINA 6LDHA 3PEFA 1ZH8A 4HFNA 1MFPA 3QWHA 2BH9A 3H65A 2OBYA 2AQKA 3GN1A 4BKUA 5CDGA 3JQAD 2VZ0A 4BO8A 3JD0A 4ID9A 4E12A 2C0CA 1ID1A 2HAEA 3FCOA 4WNCA 5A3VA 1Z73A 4RLSA 4Q9NA 5G4LA 5JLAA 3ZV5A 4M55A 4CMEA 4CMBA 3EK2A 2F00A 2YFQA 1PU2A 4Y8VA 1J4AA 3UCEA 1KBZA 2Q2VA 3ADPA 4F45A 3EZLA 5FWNA 3IP3A 3D7LA 3SXPA 1VKNA 4R16A 2PKQO 5KWEA 1NQOA 5JPIA 5C5IA 3PLRA 4E2YA 2XF8A 4XGKA 3SJUA 1U1IA 1QG6A 3OSUA 3RUEA 3UCFA 1GZ6A 4PRKA 3H5NA 4C7JA 3INTA 4JJIA 1F17A 1WNTA 2GO1A 1U4OA 5A9SA 4EUEA 3AOEC 1AHIA 1XSEA 3NTQA 4CJXA 3QVTA 1U3VA 3EYWA 3INRA 2C20A 4HXYA 4UVGA 1R16A 3ZWMA 3VKVA 5ITVA 3RCBA 1P1KA 2Y93A 4M54A 2EGHA 1UXJA 5TT0A 3GG2A 5EPOA 2WYUA 5L7TA 2F1KA 3GMDA 4RPJA 3ETEA 4BQRA 4P38A 4RVDA 1NQTA 1OI7A 2IEBA 1RPNA 1W4ZA 3AY6A 3NGLA 4BNWA 1ENYA 1BVRA 4XQ9A 4GX0A 3DAPA 2BFMA 2VT3A 4L4XA 2CVZA 4J1SA 4IDBA 4ZGWA 3IP1A 4QFCA 4N7RA 1W0CA 3ZH2A 5U9CA 5BT9A 3OIDA 3HDYA 4QEDA 3PHGA 1IYZA 3JD1A 4PVCA 4AJNA 4DYDA 2DKNA 2GN6A 1P1HA 1RWBA 4WLOA 3EGOA 3KSDO 1X1EA 4PIVA 3PGJA 4JP3A 2OMEA 3KYDB 4GMGA 4BNTA 3B6ZA 3GFGA 4CQMB 5JE8A 3LQFA 4I1IA 3ZWWA 5IJZA 1ZK2A 4BNLA 3T4XA 1HYGA 1R6DA 2R00A 1XR3A 4H16A 3OQBA 1WZEA 5LCXA 1EUCA 3E9QA 4NBWA 1JKIA 2BFPA 3CUKA 4E5MA 4TQGA 3E03A 4Z9YA 4ITUA 4FJ0A 3WG9A 3NYWA 4BMSA 1EZ4A 5F1KA 5EINA 1JU9A 2QYTA 4XB2A 2AQ8A 5T8KA 4DYVA 5H81A 1GADO 2PA3A 4EI2A 4XRRA 5T8KC 3SX2A 4A10A 2C7GA 3IUPA 2QG4A 4FB5A 4J0EA 3M2PA 4BV8A 1J5PA 3PQDA 3OQ1A 2DUUA 3AJRA 4BV9A 3GEMA 3R6DA 4DLLA 1GZ4A 4MP6A 1DBVO 4GX1A 1JQBA 2YFHA 3TQHA 2XPCA 2I99A 4BMNA 1QV7A 3CH6A 1HDGO 5FYDA 1NTOA 4DPKA 5JSFA 1YQGA 3EAGA 3AM4A 1IY8A 1EVZA 1IPFA 1X1TA 1J0XO 2DVMA 2IZZA 2NUAA 2HK8A 3PLNA 2X8LA 4AG3A 3I9KA 3OF2A 2YUTA 1HE5A 1UR5A 3QVXA 4GLLA 3RJ9A 3SLKA 3ZZNA 4BNXA 2YYYA 1YO6A 4KMSA 2JD1A 4I9NA 3CEAA 1KVUA 3ST7A 4DUPA 3U62A 1EMDA 4MKXA 1H6AA 1PJ2A 2PTGA 3OA2A 1LSJA 2XAAA 1N1GA 4YJFB 4MOWA 5TT1A 4WOKA 3PHLA 5BNFA 3GT0A 3PYMA 3KM0A 2QRKA 2YHIA 3FPCA 1I2BA 1I01A 5HS4A 3QHAA 1GL3A 3NTRA 1T4DA 2B69A 4NR0A 1HE2A 2PD4A 4ND1A 4F46A 4J91A 5GZ6A 3WTBA 1HLDA 4XYBA 4CL8A 5KVVA 1ZK0A 3EW7A 4IM7A 1Q2XA 2CF6A 3SLGA 4DQUA 1N5DA 1TVEA 2VZ9A 2AG8A 1QYVA 2CVOA 3UXYA 5JXWA 2Y68A 4TROA 1H6BA 2AEFA 3PQFA 1DRVA 1SPXA 4MVJE 4GKBA 3CKYA 1JDJA 1NYTA 4NDNE 1I3MA 1E0DA 3GDOA 4BO9A 5COAA 3UVEA 1L7EA 4TWRA 1WAMA 1UH5A 4E30A 1A72A 1P1IA 5LDHA 4GSKA 1M6HA 4GBJA 2DTXA 1A71A 1O89A 4A27A 5G0WA 1U3TA 3CSDA 3KRTA 4U5QA 1M2WA 2CNBA 3DXFA 3GEGA 3IQDB 4XIJA 1LRKA 1EE9A 1HWYA 3ZNQA 1R4MA 5A4DA 3FF4A 3FSRA 4TKLA 3PVZA 4IZHA 4XB1A 1E7RA 3TJRA 4JXKA 1D8AA 4D3DA 4AJOA 3DTYA 4PGFA 4IDFA 4N5LA 1DIRA 3V1TC 4DMMA 3LT4A 1NFQA 4YRBA 2DBVO 2Y05A 2YW9A 3FNGA 4BUCA 1UXGA 2GZ1A 1CDOA 3WSVA 4CQLA 3WIEA 1NVGA 4O1MA 2HMWA 1U2GA 2P4QA 4EZBA 4O6VA 4DLAA 2JCVA 1ADFA 2Y0CA 4B7UA 3QA9A 4H3VA 4ZICA 4A7PA 2ET6A 5EQDA 1VL8A 1VL6A 4JCOA 1QRRA 2Y0EA 3QP9A 3O8QB 4J1TA 3EZYA 2IEDA 2EW2A 3KYDA 2PGLA 3WDSA 4FC6A 2AE2A 2DQ4A 1PTJA 3O4RA 3WGTA 1H5QA 2SCUA 4CLXA 1SEVA 2JFGA 3OA0A 2I65A 3RKUA 1J6UA 1L1FA 1LTHR 2NLOA 3PJEA 3S8MA 2PZMA 2QZZA 3DWFA 3PWKA 1P1RA 1OOEA 4W7IA 4BNKA 4GPD1 3GVXA 1GU7A 5F3RA 4FOOA 1AHHA 1HDCA 1T24A 3T4EA 4M1QA 3NKLA 2EF1A 1KC3A 3KYBA 5LC1A 3WR5A 2BMAA 2RIRA 3FHLA 3O26A 3U5TA 1KEPA 2C29D 4E5KA 4II2A 1T1RA 5AVOA 3G3EA 4ESOA 4OL9A 1K89A 4QX6A 4CLOB 1XQ1A 3PDJA 4UAGA 3EHEA 5BSEA 3EDMA 1YJ8A 2Q1SA 3DBRA 1V3UA 1LQUA 4XR4A 3IKTA 1BXGA 3FBGA 4JLWA 4XDYA 2FWMX 1LXCA 5COQA 3WTCA 1E7SA 4J2HA 2PLAA 5BR7A 5JMWA 1DO8A 4BKOA 1N8KA 2X0NA 3DHNA 2O2SA 2E49A 3JQ9C 5IZCA 2VNSA 1QP8A 5ES3A 2R6JA 5CFZA 2X5OA 5DOZA 4MKZA 2CY0A 3RVDA 2JD0A 1W8DA 4RPGA 1ZNQO 3WGQA 1CF2O 1C3VA 3BTVA 3I9MA 4PLGA 4MIEA 2FZEA 1EEHA 2X23A 1SO8A 3JYNA 2WM3A 4P4NA 2A9FA 4W7HA 3WNVA 4RPHA 5TLSA 5HS6A 4CMIA 4OOEA 1G0NA 4CODB 3DBHB 3Q9NA 4J90A 1FDWA 1ZK4A 2Q3EA 3ENKA 2VNAA 3GEDA 4ILKA 2BI8A 2GZ2A 2BLLA 1NQAO 4UUNA
chains in the Genus database with same CATH superfamily
5A4FS 5HR5A 3DHEA 5JYDA 2VQDA 1MAUA 2Y3IA 2YV3A 1JGTA 2YWGA 4KVGA 4OV6B 4PTZA 1Z5ZA 5BN5A 2Z2KA 3CG4A 3Q8XB 3TW0A 3JYQA 1DG1G 3COYA 4B82A 3UPUA 4Z0TA 1CRLA 2DE0X 4MKHA 1E4OA 3IBGA 3OEHA 3N6RA 2GDZA 3PV0A 1GN9A 1ISJA 3M1LA 4KU4A 4RFVA 3H2GA 3LDUA 1NVDA 1C0KA 3KVNA 3F8WA 1F0KA 2JBAB 2Q5JA 4IJQA 4PZEA 4RJ2A 5CA0A 4EL5A 4JNKA 1X77A 1LK7A 5HCIA 1BJRE 2C5BA 2Y77A 1I6MA 1H2HA 1OWPA 3AF3A 2COEA 4IIHA 5DBOA 3RRBA 3WZMA 4Y2RA 6REQB 3B3FA 2Q4RA 1M33A 1CD5A 2HLPA 5DHAA 3H6KA 1EJBA 4JUIA 3HRKA 3ENVA 3TOXA 5LOVF 3FDZB 2HW8A 2DCMA 3ZZUA 1NVEA 4I1VA 1JZTA 4QLAA 2D1YA 1M2KA 3TVDA 4NICA 4CM5A 5AM4A 4C21A 2Q1XA 3IR6A 4YCLA 5AVJA 4BDTA 2ATIA 4MV4A 3QKRB 3DKKA 3GNQA 1V8ZA 4M7RA 1PRYA 3DYBA 5FNZA 4KH1A 5DKFA 5FYQA 5A05A 3NHMA 4CLDA 5CG2A 3QFSA 2PFKA 4HEQA 3NDJA 1Q7GA 4MR8A 4KITB 2A1IA 4HKTA 2BHRA 1KDOA 4L6AA 5CDYA 4AECA 2ZZMA 3Q5EA 3U1BA 5K3CA 2GXQA 4TWJA 2PZBA 1J0BA 4N3BA 2BBWA 3FRIA 3KTFA 5FEMA 3KJGA 1HNXB 2OL4A 2AX3A 2HUNA 3PXBA 4WKGA 4Y6QA 3KJFA 4R1NA 1PEYA 4RIGA 4AJIA 3HPQA 1SD1A 2AJ8A 1UZAA 3OY7A 3ETDA 5AKEA 4M0UA 3B7WA 5JDCA 5DEIA 2NYRA 1ZJJA 1R0ZA 3RDPA 2AD1A 2V7QD 3VC7A 4HAVA 3UJ6A 4BMZA 4M1OA 4CQMD 3L8CA 4EBBA 1SUCA 4X91A 3VOBA 7REQA 2UXCB 2GJKA 2VWPA 4AWBA 3AKDA 3R0VA 2Q8QA 2RHCA 4M1EA 1G6KA 3FFXA 1XTSA 2ZTVA 3H8VA 2P67A 3EBOA 4C6HA 4IJVA 2YCBA 3ZWQA 3IUEA 3BHNA 3C14C 3UPDA 1IQUA 2G71A 4O0LA 5DBGA 3K9CA 1TQHA 3U4QA 1DKMA 1VSVA 3OFKA 1P0QA 4IHKA 5KYWA 4O29A 2PRYA 521PA 4TMVA 1HC7A 4NPCA 3WNBA 1MQ8B 2JFHA 3VR4H 2AMYA 3NTOA 4JLKA 1NDHA 1MPXA 4NNPA 1EX7A 3KTOA 3LBFA 3DUFB 1SHKA 3R4CA 4I0WB 3LA8A 3B9RA 1MQAA 4INOA 3MTQA 4HHEA 1SXJD 3E9ZA 4JY7A 2Z2YA 3I9FA 2FY8A 3ZOZA 4J6FA 1UK8A 1CG6A 1VXOA 1XMPA 3FUTA 4WFIA 3ZZMA 1Y8CA 1S3IA 2B35A 4MWTA 3VNBA 4KX3A 4N48A 1VI6A 4O8CA 2H4ZA 4MR9A 3GLTA 2W2NA 3T1OA 2FTKE 2C4UA 4BJ3A 2O54A 3HJAA 4RJKA 3JD4A 4S24A 5BYAA 2FPUA 3L49A 3PGXA 3PVCA 5DP1A 4L8LA 1LX7A 1UM8A 4LY6A 1UZMA 2OQIA 3O90A 1E99A 1X3LA 2J41A 4H3KB 1U3FA 4JC8A 1CT9A 4OQXA 1XT6A 1IWBB 1MTZA 1JHAA 2BGMA 4F4UA 4B3DA 5JSZB 1TA4A 2RK6A 2V0NA 2X8BA 4ZGBA 5CM8B 3DB2A 3IL2A 1XO1A 2XXJA 1IOVA 4QVKA 4KPYA 4UM8B 1R0CA 2IP2A 3HLKA 3NUZA 4XLZA 5EMMA 5IDYA 4ZOBA 3SC6A 3QW2A 4CV1A 1UIRA 4H1HA 4WEOA 4KNYA 3AQ4A 1T9KA 3MT7A 3GAFA 1Q5PA 4X66B 4PGAA 1M8GA 3HNRA 1HH4A 3HI6A 1GSAA 4M0EA 3QEMB 5BNTA 3LCUA 3HJTA 3OFSA 2O1SA 2R96A 5EQFA 1KDVA 2GD0A 3RADC 1UJ5A 1W44A 3DTVD 3HJRA 4D0GA 2JPDA 4L5AA 4PBTA 4BTVA 2H92A 4F97A 1MU0A 4WCFB 3ZI0A 3A6DA 3KR1A 4F86A 5ES4B 1H93A 4KFTA 4DHWA 1VPDA 2B30A 4KQJA 4NBTA 2ZSUA 2O50A 5J2TA 2H4FA 1YR6A 4DL9A 2FSVC 2WC1A 1P60A 4G0VA 1XMXA 2CUZA 2DBZA 3LE8A 1BEEA 3RS5A 5H59A 3N74A 2XOKA 1D2GA 3F90A 4GE0A 4CMIB 2UYQA 4KIWA 2R7LA 4CV2A 1NUSA 4B3RB 1YTLA 1CY1A 1USVA 4MRAA 4B4DA 5T3YA 3I6BA 3CX7A 2W90A 3IDFA 2WAAA 4E5SA 1RDFA 5U4XA 2MSLA 1LA2A 3AUUA 3PGMA 3SKVA 3QY0A 3NDPA 4I1YA 3ZY6A 5IDXA 4CUJA 3BEDA 3IRVA 4UTXA 3HO8A 4TWBA 3UJBA 4Y0VA 3MEQA 5FTMA 1EIZA 1HDRA 4X8MA 2C4HA 4QUJA 2PHZA 2CFRA 4MHOA 5HJ7A 1JHUA 3VPBA 2X5XA 3V7FA 3C5VA 5AR1A 4NP6A 2BEKA 2J8ZA 1C3XA 3QKIA 4M87A 3ICEA 1L5HB 1NBAA 3FMIA 1FS6A 2VP9A 1Y7LA 1F8YA 1PL6A 2XVZA 5E9AA 2FWJA 2IXTA 3R3VA 4M8IA 4YMUA 5JH7B 5ISMA 1U0LA 3ERCA 2FR0A 1QAMA 2J08A 2ZPAA 4A8PA 2GSWA 5FI3A 1IBLB 4BOYA 2GZHA 2WPDA 5K9ZA 1BDMA 2IDKA 1JIQA 4Q3AA 2HK7A 4BGEA 2H0RA 3HB0A 4NZMA 4RABA 1OZGA 1G5RA 4QICA 3MYYA 4H31A 5AHKA 2VJNA 4RA6A 1A88A 4UM9B 3F5QA 1OFUA 3JQ8B 4B3IA 1TLTA 1ZR2A 3M4XA 2P77A 2ONKA 3CWQA 5THKA 4QTXA 4FBGA 2VUUA 4XM2A 2E4XA 1T1JA 3U3RA 1BVUA 1X7WB 2LDBA 3LC2O 4LZPA 4GVXA 3DBOB 5L45A 1ZBDA 2ZB2A 4HZGA 4FR2A 4KJZA 5F4ZA 3A11A 2PYIA 5C8ZA 4N0QA 1EDEA 2IYPA 5GWXA 3FJOA 1RWMA 4G01B 2N1MA 5JSQA 3FNQA 1CQIA 3IAFA 1G8KA 3ECAA 5GJWC 3OZDA 1ANKA 3NXKA 5KNCH 3KQQA 3IBTA 4OHBA 1MB2A 4ZAVA 5HOQA 2CNWA 3BDAA 3PYLA 1YDFA 2GM5A 3AF1A 5IBQA 5K0GA 4YXFA 1X42A 1E6EA 1YAHA 2FZ4A 1BHQ1 2IZ0A 2WJPA 3QU5A 4JUCA 5I9BA 2VAPA 1QHHA 3SOPA 3GD5A 3D1VA 3TD9A 1NVTA 4KUHA 4UW9A 2ZUVA 4DIDA 1GVHA 3ANXA 1GTRA 1OLOA 4P92A 2R6R1 4GXQA 1JR2A 4RVSA 2AYYA 2NTVA 5CJPA 3FTFA 4R54A 1P3Y1 3IJ5A 4TYYA 4LV5B 2O3QA 5BNZA 4BLSA 4V2IA 3J80A 3PYXA 2OHGA 4B81A 3M5PA 5IJAA 2NW6A 4I3FA 3OCXA 2D13A 3G8CA 3PFWO 3WLFA 1PKXA 3BT7A 1QLHA 3EQ8A 3K8OE 3RTGA 4J03A 4BMDA 2VCYA 4IJUA 1X0XA 3LQ4A 4B31A 1JSRA 4N7BA 4PC1A 3TRKA 3M4ZA 4BFZA 2OO7A 5KEIA 3QYFA 3HXTA 1Z5OA 5KHOC 1ICIA 3IMCA 2YASA 3MTAA 2JIZD 1OC2A 4EW3A 2GASA 4ZI7B 5AUPB 4ZHQF 2XUQA 3HE3A 5HRCA 5EE0A 4AZTA 4FU0A 2XCLA 4LGVA 3B60A 1P17A 2GS9A 4FGSA 5DTJA 5EJ7A 2IF0A 5KTYA 2FWNA 2RB5A 1BWPA 3CNHA 2VHCA 4CU2A 3U44B 3RHSA 1AUPA 4KX5A 4KKXB 3TW4A 4I81A 1SQGA 3L3BA 3WIVA 1JPUA 1SVMA 3VPAA 2D1TA 1UC5B 1XPRA 2OORA 5HSGA 2PD3A 3H0EA 1LKZA 3CX8A 4P32A 5LIPA 1AN9A 2GHTA 5J2TF 3T8YA 2VWQA 1EIWA 4HAWA 2FK8A 3TZQA 3KXKA 1Y5LA 5K7SA 3PJRA 1L5QA 2I6FA 3QWBA 1GPUA 4G5RA 5C7OO 2VDOB 4NZ9A 4EB3A 1E2HA 4Q4CA 2ODWA 3U7FB 1RPTA 1JT2A 1PWEA 1YRAA 3MRVA 1Z74A 121PA 2H0QA 1UK6A 3GUHA 4JUDX 3ZI7A 3IAEA 4ZT6A 1GTL1 1O95D 2I62A 4KUEA 4ZVQA 1OVMA 1DKRA 4UE2A 2Z9DA 2GWRA 3EVTA 1ZD8A 3OCYA 5E1MA 3DM9B 2ZIZA 4OK3A 2XDWA 1EYZA 3PHCA 3SIXA 1GDHA 5C5DA 3JQ7A 3N7UA 1Z88A 4MKGA 1MH1A 3K0BA 5KU7A 2OP1A 2VPYA 5FUYA 2FG7C 3SSMA 2QUAA 2JJ1A 5HKKD 1HX7A 2H2IA 3G0GA 1M9NA 2QI9C 2ZLBA 4WL0A 1ZUNA 2C2GA 2FEOA 2Y92A 3DQZA 3MJVA 4H17A 5AXAA 4COKA 5B7GA 4ARSA 1D3AA 3G17A 4YP7A 3R9IA 1NVVR 2J0UA 1BA3A 3TXYA 3U39A 1CQPA 5B4TA 2HNBA 1QJCA 3ASVA 2DXIA 4J0HA 2ZB4A 5AJXA 1EESA 5G53C 4WLVA 2Q7OE 2XF2A 1EFAA 1CUJA 4RKWA 1H5NA 2JIOA 3WRXC 1U3CA 4CM9D 2ONCA 2XMBA 1G2IA 1QSGA 2FX3A 2O4CA 2PUHA 1JLLB 3H83A 3LZ6A 3VH1A 2EVWX 1SOAA 4M9CA 4RHXA 1DBRA 1HDYA 2BKUA 2QV7A 2X3YA 3L0BA 5EEHA 5GV7A 4EKIA 5M29A 3QYPA 3MAAC 4MVWA 1EAMA 5B1EA 5A5GA 2YINC 1TD9A 2W48A 3E61A 3PKIA 4XWKA 1GR1A 2OP0A 2XZOA 2ZIFA 3FB1A 1ZX1A 4TRNA 5IM4A 3OLQA 5CPBA 3IEUA 2GK3A 3K92A 1TUGA 4FFRA 5KTRA 4IDDA 1T8TA 3VPFA 4EUSA 1R4AA 2QORA 3FHJA 1QVAA 2ISSD 3OD1A 1VRCA 2XB4A 1BGXT 3IP8A 1KARA 1KO8A 2A58A 1M2JA 2O2DA 3C8HA 3LCMA 3RD5A 2PX6A 1OFTA 2ZR8A 3G8BA 4HMOA 4FOTA 4XGRA 1E3QA 2WMNB 3BK7A 3C41J 3QPUA 2QUKA 5FHQA 4DLRA 1ODJA 3VSDA 3QBVA 2BGGA 3HP4A 4E09A 1M5RA 3D1JA 1BW9B 5CD9A 1QVRA 2QQ5A 1N1MA 5C34B 3UCXA 4B8WA 3ZDBA 4C2AA 3HUEA 1OROA 2C8LA 2IUSA 3N2IA 1VPTA 2EFDB 1VSUA 3E35A 5I7HA 3VKWA 5CLJA 2F9FA 1GLGA 2ZJFA 2OBFA 4Z9FA 3IB3A 3HY4A 3ZVMA 1C14A 3K4HA 1NG1A 3N6VA 3PUZA 3UB2A 4C4OA 4N7MA 1DQSA 3ICPA 4LV6A 1PDWA 3LTNC 4PPNA 1QOPB 2RBEA 3OOJA 3BE8A 1Y6QA 1HBJA 2CLSA 1Z2CA 3TTWA 3UWOA 1XLVA 1NNUA 3A4NA 4AMGA 2PS0A 5GTDA 3N0TA 4RPIA 4RQTA 1OJ7A 3A6GA 2H0AA 4ZJZA 3PXEA 5DM60 4GM1A 1EXDA 2CFOA 4PCAA 4UPEA 5J58A 3KLPX 1EUDA 1Q1NA 3R0IA 4B3TB 1OIXA 1YQWA 4P31A 1JU4A 4QO8A 2QAGC 2NU8A 1N9GA 2A2ZA 3O2JA 4L74A 2NMVA 2CB9A 1U9CA 3OM9A 5AVQA 3FTPA 3KETA 3BH6A 3P5SA 1MG0A 1MRSA 2FA9A 4Y1GA 1L5FA 2PPVA 3ZDRA 1BGVA 4JQCA 4HH3C 1KFCB 2C2KA 1KR5A 2A5GA 2YJZA 1AA6A 1L4GA 3E4CA 3C7AA 4CV3A 3EFOB 2XR1A 4J76A 2C9OA 4MI6A 4EKEA 1E2NA 5GY7A 1UDRA 3AF2A 5JVDA 3EUFA 2IH2A 5M3BA 5J5AA 4IIJA 4DLYA 4FYPA 4JENA 3UAZA 2LCQA 3LKVA 4AN0A 4DJAA 4OQZA 3FCSB 4R9UC 1ZRSA 3SKYA 1IXSB 4ACBA 5K0EA 3K6SB 4YJ3F 5JMPA 4D4HA 1CUXA 5G3YA 3UH0A 1JJVA 3D6JA 1YR2A 2OHIA 3GLKA 4BQSA 4M7PA 3WZ2A 3O83A 3Q0TA 2OZKA 1C9KA 3ZU6A 2ENUA 1W96A 3F3SA 3M6WA 1RRGA 3N0RA 3RRJA 1GSIA 4JDUA 2QM8A 4BO5A 1WSWA 3PUYA 4JJAA 4KACA 4U4AA 3JRXA 3RF7A 1RPZA 3FWPA 4MDEA 5F77A 4RHCA 1U28C 3H5RA 4HNHA 1GILA 3KTAB 1TTPB 2ZXFA 3TKYA 4IUBS 4ZVVA 2P69A 1X7ZB 3GZJA 1F2TB 1Z6GA 4P4SB 5LQUA 4I1UA 4TM7A 3S81A 5ER6A 3WJ7A 3GT3A 3UMVA 3Q7SA 5G02A 3VZDA 4YAKA 1UKEA 1QNFA 1PWYE 4IOLA 4Z0PA 2JHCA 2PZ8A 3A31A 4C0JA 1M1NB 5IFLA 4ITVA 5IEJA 2DR0A 3C1OA 3LFUA 4WBXC 1NFFA 4RACA 1FUUA 1JR3E 4LY3A 1KDYA 4BMVA 3ZVNA 3D64A 1KI6A 1XEFA 2B1QA 3ENQA 2I34A 3NAGA 1Q6YA 4YRPA 2IA5A 2QGZA 4E5NA 4EQ6B 5ADVA 3HB1A 2B8TA 4UJ3A 1O94D 1SVUA 1Y63A 1VOTA 1BMDA 2JJ8A 3S28A 1DX4A 1JG2A 2LW7A 1JE1A 1HE1C 4K9NA 5PGMA 3B2NA 3L77A 1NQWA 4ACAA 4WN9A 5A2GA 2XB9A 2HQ1A 3P2OA 3Q2KA 4F4HA 2C4WA 4B79A 3TBKA 3EISA 4G2TA 2ZRFA 4LWQA 1NHWA 1W2GA 2DM6A 5F4BA 3SQMA 5JXIA 1FFDA 1MDFA 3KT0A 3HP1A 1PQ4A 4A2CA 4HGRA 1E1DA 1NVUQ 1VMIA 1DARA 3P9SA 1PZEA 4LDNA 4Y0NA 1V7QA 3TIXB 3WXBA 5FOQA 3O8NA 5EMKA 3E9RA 2DETA 4TS9A 2MYUA 1KFJB 3IR5A 4GEGA 1IFXA 3RG8A 4BVKA 2DQYA 4EZEA 1VPWA 2YXNA 1O9GA 2E4AA 2HOQA 3ZGVA 3RK1A 3F7TA 1P9NA 3HCDA 4QU8A 4BE4A 1QCCA 4IJMA 4A2WA 2PZAA 3IUJA 1VGVA 3RSZA 3C6QA 1CQIB 2OPHA 1JKXA 5FI1B 1NBIA 2Y1XA 5CPFA 3SYTA 3UAWA 1SCQA 1M72A 3WOVA 2X0RA 2CT8A 1ES9A 4R6WA 4YGXB 3PPIA 5A04A 2V03A 2X58A 4HX2A 3DXXA 1I2AA 3F7NA 3OJCA 4MRPA 2I80A 1IHPA 4BNFA 2CNDA 3PNBA 1GAQA 4CIBA 2IH5A 4BX2A 2J7PA 3FVQA 1I6LA 4ZRNA 3DVQX 3F97A 5FOSA 4TSKA 4TV9A 4QPZA 3D3JA 4Y2PA 3LY8A 2SKEA 1E3JA 4ONEA 3SR3A 3VKUA 3W9YA 3MYRA 2ZR7A 2FLVA 2TRSB 4BVJA 1SJ9A 1VMDA 5DULA 3INGA 2BPOA 2P41A 2B4YA 3CLSC 4BN0A 1P4HA 2BMEA 3HA3A 3DOJA 1BX1A 3JQPA 2AZTA 1EK6A 2GN1A 3PGLA 3IAM1 4V3CA 4YRDA 1KQ3A 1LPNA 1R8JA 4B48A 1L7NA 1EFHA 4RZHA 3RW9A 3MWGA 1WHTA 2AFIE 1JG1A 2OT3B 2HJRA 5C1IA 3UHFA 6NULA 2GM3A 2HR1A 5F9MA 1NIJA 4UTPA 1A8IA 4FZ3A 1VSTA 2WTNA 3S2YA 4B5KA 3SY8A 3PKZA 4RH1A 1GA1A 4NQZA 1SZPA 3AXSA 1ZVMA 4ZAXA 3A7EA 1QG2A 3EF3A 2BFFB 4UCQA 3HVRA 2QLBA 1OXBB 1DMSA 2AZMA 4DR7B 4N0EA 4IVRA 2XYQA 1VBNA 4RJJA 4KYVA 5ECDA 1U0FA 1QDUA 3GLHE 4NPHA 2GCGA 2GZMA 1NU6A 1V8OA 3CMMA 1Z5WA 3EXG1 4GMFA 4QGFA 3A37A 3L2OB 1BCSA 2PVCA 4R1QA 5DLDA 5KSZA 4KFUA 4DRZA 3UMSA 4YP5A 5KVCA 4W1SA 1R6VA 4BZWA 4EYKA 3CH5A 5AHXA 1M73E 4QOEA 1DRWA 3L7BA 1CU1A 3EPRA 4UFNA 2X0DA 4JLSA 1OU4A 4WDRA 4X1OA 4LNUB 3LJKA 3U3ZA 1TUIA 3FGNA 4KFRA 1XQ6A 3QOXA 1JP7A 1M1YB 2YWRA 4PG5A 2Q9BA 5AFSA 2VRCA 3C6XA 5IZCC 1SD5A 3EX7C 3B1ZA 3E3OA 5FKJA 3P26A 5SZKB 4XD7D 4MGHA 4HBZA 5EXSA 3RARA 1YCFA 3S6JA 4L95C 2ASEA 1WW8A 3H2SA 1NN1A 1NBOA 5DRTA 4DPLA 4EQ6A 1V8PA 3FTDA 4F9GA 3E15A 3RU9A 3UHJA 3CWZA 3N8GA 1K86A 2QRZA 2I8LA 2WJZB 3TUJC 1QWOA 4DM7A 2W71A 3D8BA 1B7GO 3FAZA 1JSLA 2FPGB 2QTBA 5LBTA 4GKVA 3WGHA 4LZNA 1CJSA 1W1UA 3GGCA 3JVIA 4IFTA 4JJ4A 3UIEA 4XI9A 1A95A 2WA2A 5T6MA 2PX3A 2IW3A 2EDAA 3LQRA 4K8OA 1AM4D 5FR2A 3HTXA 3D5QA 1L5MA 4HP8A 2YVAA 1E4VA 4A8JC 3S8YA 1XQVA 1XTUA 1FBTA 1T2DA 1V41E 3GU3A 5TF0A 2J9FA 1IONA 1W0KA 2GD1O 4HWKA 3UYKA 5EJIA 2IYNA 1RLTA 3DFIA 1DC4A 4FQ7A 4NU6A 5CH5A 3JV7A 3ZXXA 2OCXA 4QARA 4QOGA 2VTVA 1F8UA 2YR0A 3DTTA 4H7DA 2PFGA 3SXUB 4JBNA 3UC9A 1SQ0A 3LLCA 5EIOA 1N4DA 2RJNA 3K6JA 4DC9A 4DG8A 2AN9A 1EM8A 2ID8A 3LX6A 3M70A 3ZE0B 3WGUA 4JOCA 1JHMA 3K35A 3OE7D 1C3LA 2WHXA 2HRCA 1M5UA 2QQ0A 3R9WA 4NE2A 4RAQA 5J40A 3WWOA 1J07A 4GRAA 1KJ9A 1N1EA 1Z07A 2QNRA 1PFYA 4H9GA 4EWLA 2OBXA 3EQ9A 1QQ6A 1SIWA 4JQOA 2V65A 3II6X 1OBFO 4P4SA 5H80A 2Q27A 3QU4A 1V9LA 5K2MA 3U7GA 2C2ZA 3UT5A 4DLKA 1VYHA 4Y6LA 3BBLA 3G89A 2KWIA 5EWJB 5IWAB 3NV7A 4HVCA 3LO8A 1ZJ4A 4KMOA 4LC9A 3KSBC 5A4IS 1JSXA 4L73A 1SA0A 4QGAA 1C30B 2F9MA 3PD0A 3C1TA 4S1VA 4XJSA 3TR0A 3WL5A 3WWYA 5K6AA 2UUAB 3IAM6 2NQ2C 3FTEA 4B2LA 4EJSB 2XVAA 3G85A 3N75A 4R40A 4QUKA 3EBPA 1KEVA 3VPXA 1GPNA 4CTOA 3PICA 1T4CA 1X2BA 1RBMA 3PQ8A 4N3AA 4HEHA 3U4DA 3Q8MA 5J9FA 3LOQA 4U3JA 4B32A 3M3PA 1W34A 2P35A 3H4VA 1XWIA 1OT3A 2Q62A 1LF5A 3FUXA 1MHPA 1N8NA 2P4HX 4TSRA 5GONF 4D45A 1DBWA 4F85A 5KYWB 3K70B 1SCAA 1UEIA 1Y37A 3HHEA 4EG8A 3OMXA 1Z2PX 1UBLS 3EUEA 2PKCA 2V5UA 4FYKA 1FXSA 3ICVA 2PSJA 3DUFA 4QU5A 4JC5A 4YAIA 1GUZA 4LHVA 2D2VA 3EW9A 6GPBA 2I71A 3QQ5A 2ZJBA 2IIVA 3SYLA 3OQJA 4EX7A 4LQLA 4NZOA 2PL9A 1HNNA 1TJYA 3C3BA 3FMFA 1C7RA 4FGKA 4HADA 3CNNA 5ICFA 2XNHA 2BLNA 4PV7A 1M54A 2KI5A 2XVMA 3T7TA 1TAQA 1YZUA 1EWTA 3LT0A 1YI0A 4IH1A 1ZD2P 1KXZA 3IDZA 3NBUA 4EP1A 5IDQA 1Z62A 4PWYA 4G4SP 3O0TA 2M6RA 3IOCA 1BEZA 4IL5A 4ZAGA 2H1IA 3L7LA 2ZUTA 2AN5A 2ZDGA 3WL8A 1NWCA 4UZEA 3ZW8A 2H7YA 2PVSA 4XCQA 4CKBA 2H4XA 1XWFA 5BVHA 2ZEJA 4UBNA 1LI5A 3UMFA 2IX9A 3RHFA 1L7AA 2Q9AA 3AY0A 1AGXA 2JGRA 2LIPA 2GD2A 3MS7A 3WRVA 3ZH9B 4L5JA 1JG4A 3HJFA 1P2VA 4W6QA 3RPEA 4MUGA 4C14A 4I7EA 3B8HA 2I9PA 4BLUA 3N2NA 3HS3A 4I2NA 4KRXA 3LZDA 2XLCA 3OICA 4QAQA 5AUOB 3LC0A 1F2VA 2JI4A 2XGGA 3UV6A 4CT5A 4E2ZA 1H3FA 2IBTA 2ZYTX 5AW4A 2QT0A 2V7GA 1DB3A 1CFJA 1E1YA 1K4KA 2Z04A 3VSAA 5JEDA 3TG8A 3NU1A 4FNGA 3T99A 4HQNA 2DFVA 2R48A 4A1OA 1E3WB 2DSTA 3RI3A 5G0VA 4WLUA 2W6PA 3OUZA 1IY0A 1PYDA 5DLYA 1GV0A 1WVIA 3V00A 4JBIA 4ZD6A 1X14A 3EWSA 4DMMA 1B73A 1BXRB 5AKZA 1XQXA 4H7EA 4RIEA 3V2IA 1AA9A 3SMVA 3QLEA 4FFMA 4IILA 4Z54A 1O03A 3HL0A 3MCAA 1IN5A 1BKDR 1MT0A 5K8VA 1N8TA 1XCJA 5HBRA 3K70D 3TPFA 1R3DA 1GKKA 5ENDA 4DRXB 4JXJA 2VK2A 1Z4QA 2TMKA 3DOIA 2XEDA 2ALJA 2FJPA 3ELBA 1QONA 4YP9A 2FB9A 4MB2A 4TM8A 1FCJA 1QK4A 3SDSA 4PX3A 1WJGA 1K6JA 4A92A 4YBRA 4KDEA 3C3MA 1AKWA 1HTBA 1TYCA 3HGTA 4PTYA 1I3OA 1O96A 3JSXA 3OOEA 5CNJA 3T5GA 1OXUA 2OCLA 3I62A 1OFIA 5KJCA 1CHNA 2JAPA 1YRQA 5AVRA 4TQUS 5IG2A 3W4KA 4M53A 2OB1A 2G1JA 4CNQA 1VKZA 1FMCA 4PAMA 4UHEA 3AI1A 3PX7A 3EB9A 1NHGA 2B1GA 3LPAA 4JJKA 3H1FA 3HEAA 4FJ1A 3LOPA 2YICA 5CIYA 1Z7YA 4M38A 4TYQA 4M6WB 2PWBA 3LZCA 4U8GA 4H4DA 1QYCA 3GA7A 1T5TA 4NYMQ 3EH1A 3O3MB 2W6JA 4Z2AA 3OIVA 1GAJA 1UPFA 2FPGA 3T7JA 5CCEA 4W5OA 2IFTA 3TUIC 1LC3A 4M7OA 1GN8A 5CBPB 5AJTA 3OZEA 2KS6A 3CZ9A 3SEFA 4TVSA 5B7NA 4K46A 5AI4A 3GLFE 1UQRA 2P68A 1TNDA 2VRBA 3JWGA 2G72A 2FRDA 3M2TA 3NHAA 3U1TA 1RBYA 4BHTA 1UQUA 3CLUC 1MO2A 1RMTA 5CYGA 1WB9A 4JLUA 1LDYA 3GBVA 1QH9A 4H60A 3F5SA 5IVPA 3AUJB 3DPSA 4A8JB 4E4YA 3DSRA 1OIWA 5C80A 1K66A 1XD8A 1SC9A 4IYJA 2AD5A 1YBVA 1JAHA 3B3JA 1MG5A 3S4YA 1TU4A 1T2AA 2J45A 2P7IA 2VNIA 3DDZX 1RIFA 3E48A 3NJ8A 5E0OA 1EJ2A 2J3LA 4Q4AB 4OG2A 4YLEA 3B2EA 4L15A 1HTTA 3ZX5A 3CW2A 3Q6NA 5FOVA 4C22A 1D4AA 4WQMA 5J3JA 2VI5A 3WX0A 4ZC1A 2PA0A 1KERA 1OKKA 4B3SB 1LSUA 1SKAA 2EIXA 2IOYA 1DKNA 4O4HA 4Q7JB 3PDHA 3WLNA 3L02A 5ARCA 4QASA 3W3AA 2VOJA 2QR2A 1QRAA 5FQNA 2QN2A 1E92A 3QI2A 5DGTA 4RSMA 2A5YB 3JQBC 3QVGB 2BP7A 5T41A 4CTJA 1KMQA 3WHIA 3ANMA 1UBNA 3TQQA 1N5IA 3K4PA 5L6LB 3ZZ0A 5CVTA 3ZBUA 1WB4A 4OSPA 3B20A 3A6JA 2WEKA 4U3JB 3Q3JB 4HF7A 1WUIS 3ACCA 3KUDA 3FZYA 1C1DB 4B3HA 4DYHA 1A69A 4FI3C 4OHOA 4GXRA 3FNIA 4YC7A 2XBUA 2P9JA 4HJXA 4P7BA 4BJ1A 1VMAA 3UA4A 1PR9A 1XFAA 2JZCA 3M4JA 1Q50A 4DG9A 1Q3HA 2FGKA 2HEGA 4JELA 1F0YA 4NBKA 1WSBA 3IT3A 4GQAA 2L18A 1XX6A 3L0PA 2I6TA 2WNIA 3S2EA 1PJCA 2D1FA 3U3MA 3Q2IA 4HUJA 2FMFA 2HRBA 1E3SA 3ZE7A 2HHCA 3T1TA 1QHGA 2FLKA 5HKAA 4X54A 4BRSA 5EEGA 2I7DA 2JJ2D 5KYYA 2QX7A 1PNOA 5K0FA 4MNTA 5FA5A 2YMLA 1Q7BA 1V2GA 4K0RA 1XYYA 4MA0A 1W47A 4D96A 3IP7A 1WXDA 3IEXA 4GH5A 4Q9DA 3WQSB 3ZKWA 5E6UA 2Q0XA 4XOIA 4BNYA 2VHUA 3LI2A 2OAP1 4ZPXA 2O0LA 3AOEA 1AZWA 4U6QA 2Q99A 2XTZA 1PFQA 2CKDA 3H42B 4IUCS 1P4SA 1I4OA 2MINB 5HKOA 3CEHA 4UCFA 5AXBA 1GSOA 3W9SA 2R8XA 1XWWA 2X19A 2IWHA 1CTQA 2AN1A 4M9XA 1YI1A 4F2HA 2O48X 1FDRA 3F47A 1OBHA 3GHHA 2IEAA 3ZGNA 5BSHA 2ORYA 3HQ4O 1SU6A 1IB6A 3HSSA 4KL8S 4QDOA 5IYZF 1Y4SA 4DMLA 4F8JA 4R1SA 4WBNF 1TK9A 3AR5A 5I7OA 1GO2A 1RLMA 2O9JA 2VXOA 4Z1MA 1OX6A 3PXCX 2ZAGA 5COBA 1YQEA 1E7QA 1QIKA 2IRWA 1HV8A 4BKPA 1EHYA 3S1SA 2FSUA 3JQ7B 1SK9A 3AVTA 4R8MA 2GAIA 1CUWA 1ESCA 2PSFA 4RANA 1MEOA 1SXHA 2X41A 4R31A 4ROTA 4WXMA 5EIAA 1LJLA 4YJ3B 4Y6SA 3K53A 1SBYA 3NX4A 5F1OA 5FB3A 4ZVSA 4D9BA 3SFTA 5I4CA 2P9GA 4CR7A 1MO3A 3IYLW 1NC1A 3CLRD 3BEOA 3F3YA 4U7PB 4RTPA 3SIWA 4H1TA 1E2PA 4LSWA 2J33A 5DLQC 4UHKA 2HPZA 3CFYA 2HU2A 3PE3A 1VDMA 4AXBA 1LBIA 3CUYA 3HEMA 1AU9A 1XNHA 3OOHA 4RD6A 4YA6A 4CIYA 3IS3A 3VHRA 2CD7A 1WD5A 2GX6A 2QN8A 3I6ZA 4BNZA 4WW0A 5GVSA 3AEXA 3AR2A 1GTSA 1N2BA 3LGSA 2B0JA 1IULA 1RYEA 3BA6A 3SI7A 1GUYA 5MN5A 2Z56A 3I42A 3NJRA 3E5NA 3E8SA 1ODLA 3STVA 2I66A 1Y8QA 3VR6D 1QHFA 2ZUWA 3GJZA 4Q9HA 2DQSA 3E5RA 4OHXA 3FUWA 2J31A 4QOJA 1K8XB 4LSMA 3TOVA 4DARA 2D62A 3KQKA 1T3SA 4JB0A 2CNLA 5E6SB 2ZRCA 1XTBA 1E2UA 1UJMA 1IBKB 3G7UA 1DPFA 5T3UA 3DOHA 1TM1E 1RM3A 3OESA 1KYQA 3W9UA 3WK5A 4BL5A 3H19A 3MZ0A 5DYGA 4IVPA 4K88A 3RVMA 1T5SA 3RC7A 1DAFA 4DF3A 3GLIE 4RLFA 3FWYA 3E18A 1NRIA 4J0GA 2MSEB 1Y5MA 4K5QA 4M1WA 5IXJA 1FMTA 1S2MA 2DFTA 3G02A 4JB3A 4FINA 1NQUA 1QCYA 2O7QA 2PGIA 3MXOA 4MR9B 4NY1A 2JAUA 3TCXB 4K9SA 2V6MA 1DMRA 3MJ4A 1HEUA 2YJTD 1UZNA 3NCTA 1IAVA 4F6RA 2XD4A 3WIOA 1M2FA 2W37A 3DXZA 3TMKA 4I55F 1Q91A 1G9TA 3E0XA 1KYIA 1JR3A 2JVIA 2R8BA 2NTEA 3MRXA 3WFJA 3KALA 4D9MA 2QMYA 2FOLA 3RAJA 1W7AA 9MHTA 4JGBA 3EMBA 2MR5A 4NE9A 1JQAA 4DGQA 2B61A 4CI9A 3NEAA 5CYPA 4JASB 4JLOA 4YPVA 1TJNA 1P74A 4JN6B 4CQJA 5YASA 3WGNA 3WLTA 5BSGA 3PG5A 3TJMA 2A9RA 4FT4A 4NYJR 1IM5A 1AGNA 5K3OA 2JASA 2P90A 2W2QA 3VRHA 1CS0A 5DP2A 3IUSA 2P9QA 3WQHA 5MN6A 4XOUA 1E18A 1ZCAA 2HM7A 3O8LA 5JOQA 4AYWA 2TMDA 2FCAA 1C0EA 1L9XA 3EXEA 4KR6A 1AS0A 2YBEA 1RRVA 3V4ZA 1VL0A 3H9QA 3EJWA 5F7OA 2RE8A 1NXTA 4Z53A 4FLFA 5K0JA 1J2UA 3FGOA 5CB0A 4GI3A 4C88A 2Q2WA 3HACA 4OYYA 4BXOB 3C6YA 3OAAA 3ABSB 3A0UA 1BFKA 1KI3A 4LMPA 3DFUA 3OWHA 2HSEA 3UV7A 2PZEA 3MJTA 1DXYA 5D85A 4BYGA 4YREA 3R5KA 4MWSA 2GCPA 4U0KA 4HSGA 4EGFA 4AUNA 5BYJA 2QMUA 1OI4A 1ZKDA 3E1KA 1PYGA 4I9UA 5GGXA 1Y9EA 3CGWA 2OBLA 5F5LA 1R5NA 1EGMB 4I3GA 2PUVA 4D5EA 4M1ZA 2DHCA 1PJ8A 3SIRA 3W9BA 1PK9A 4Q4JB 2PT7A 3R5SA 5I8PA 1YS4A 1QIGA 2HCJB 4AKIA 3K9HA 4RENA 1C9DB 2JGJA 3TZCA 5JAHA 3RYCB 2A59A 1L4UA 2CXQA 5KJFA 3N2EA 3QJ5A 2PUTA 5AQ1A 2F62A 5JAMA 2A9JA 3GJYA 5AHWA 3EJ6A 4BLTA 2F90A 2XKAA 2IPXA 4O2LA 5B37A 2AJLI 1PX0A 4OQYA 2CZCA 2QD2A 5BW4A 3ICCA 4HNAA 2D3TA 3U4CA 1E66A 1YRWA 1NASA 3M3DA 4R2XA 4QU9A 2QM0A 1G4HA 1ML4A 3R3SA 3N7TA 2XRMA 3OSZA 3G5LA 4GYJA 5CK5A 3H9UA 2WRZA 3D9QX 4A6PA 1QIIA 3ZQJA 2F3RA 2JARA 3F6BX 3PRJA 3K5IA 4RVFA 2AFHE 3PR2B 1JEYA 5A3QA 1A0OA 4X63A 3AFMA 3IOYA 5CA1A 2W6QA 2XWJI 4DKXA 4C03A 1JMKC 2XWBF 3FLBA 2OXCA 4ENQA 4MS4A 5ALOA 1IB0A 3W5VA 1HYEA 1KBQA 3RROA 3BJMA 3KOUA 5AO9A 2P2YA 2R66A 3RUFA 5IX8A 2WSBA 3RSQA 4YDRA 4PAWA 1BGWA 5K8CA 3PPXA 5AYVA 2DFLA 1PQUA 2CLDX 1GNRA 4Y9UA 5K99A 1P77A 1TUBA 4FYHA 5CGZA 1MAHA 1XZJA 2PXHA 3IILA 3HVHA 3R6GA 2ZBDA 3H6GA 4P3PA 4WRRA 2OHHA 4XPIA 3VPHA 4HLUC 5M04A 3ZCSA 2MINA 1P7ZA 4BN4A 1GD1O 1IHYA 4D79A 4Z9XA 4TLAA 3NTXA 1FW6A 2OFOA 1N3BA 4P81A 1YB7A 3U17A 2GEVA 3QF7A 4QBKA 4PLWA 4PFSA 1XJ0A 3JQAA 3VOSA 1AURA 4C0XA 3C6MA 3OJWA 1J0AA 1XQ9A 2BJHA 3FGPA 3WGVA 3OBIA 2WWTA 2HJHA 4MVJA 1G0OA 3E1GA 4M8NE 4PAQA 2YIVX 5E8JA 1E9FA 1LFDB 3C24A 2YZNA 1JAYA 3RBVA 4BV2A 4BVAA 3NEYA 1U4NA 1NJGA 3EVGA 2B5VA 3DE7X 1A96A 4IJWA 4O4IF 4Y18A 5J4YA 1D5CA 9LDBA 1XP5A 4PIPA 4PHTA 3H9JA 2TECE 3AWIA 4B83A 1MXFA 3VR2D 1WCWA 2V55B 5IDWA 4OP2A 3K5PA 2FPKA 2JL1A 5G0UA 2ORIA 4D57A 2OCPA 3PDIA 4JIMA 1JT9A 4O4LB 5HCNA 1PL0A 5ALWA 2EFCB 2WFLB 3TLBA 2PH7A 1Z4IA 3AEKB 3R20A 3ZHYA 1FZTA 1DO2A 3DKPA 1RAEA 3C3WA 3UOAB 4DLZA 4FFLA 3OFND 2BGIA 4H1VA 3WYGA 2RMKA 1ZGGA 2AOUA 3K1AA 1LNSA 1FLNA 4HPJB 2GKOA 4G0ZA 3RTAA 3E05A 1DV2A 1HKHA 3DPIA 3H9GA 1RXWA 3B13B 4YRAA 2J30A 2NSLA 3V8BA 4FFNA 4M36A 1J9GA 4I9FA 1ESMA 1P4AA 2F9LA 3JQCA 2PL3A 1H2BA 2H57A 4KTTE 5SV2A 3ZYCA 4RA9A 4MVXA 4HS4A 3OMWA 1J0EA 1F6DA 4KQFA 3RSFA 1CRWG 1K88A 3BULA 2DECA 2VT6A 3KL2A 5LN1A 3TNYA 4MS3B 1Z6XA 1PLLA 2E5FA 3EGCA 2XNKA 3QBDA 4PYOA 1PVOA 4EDFA 2O8DA 4IYRA 5C8YA 1ZO8A 2VAMA 3OZ7A 2J9YB 3PC7A 5EWLA 3TGLA 3TTSA 3CVUA 1BXKA 5F1PA 3SZ3A 3IR7A 1USIA 4D9EA 4QSMA 4MVJM 2W8BA 1AZSC 3G0OA 1JKMA 4WCVA 3VH4A 4HDAA 3ZE8A 5J43A 2AMLA 1RNLA 1USWA 1XZEA 3R09A 2F4VB 5TMPA 4BBJA 1YGPA 2AQHA 2G07A 1LVGA 2QRPA 2RBKA 3O3NB 1CWUA 3UM9A 3NHFA 4HQFA 1FFEA 3CLSD 5A3RA 3U6BA 1OY1A 1ECLA 1Z7GA 3GFBA 3LW7A 4LCBA 4O2BF 1ZI8A