5TIIA

Comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
251
structure length
241
Chain Sequence
ELELGLRGKKALVTGGSRGVGRGVVLALARAGVDVFTCYREESDASASLARELKQLGGDHHALRADLADPKQIAELFQEVGRRFGTLDVVVNNAGVISHVPYAELPVAEWQRIVDVNLTGAHLVIQHAIPLLGDKGSVISIGSKSSEVGIPLRAHYTATKHALRGLTRSLAKEYGRSGLRFNVLALGVVETEAEMTKFYSTKTALGRLGTPDEVAGAVAWLASDLSRYVTGATIHVDGGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-ACP reductase
publication title Comprehensive Analysis of a Novel Ketoreductase for Pentangular Polyphenol Biosynthesis.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Oxidoreductase
total genus 89
structure length 241
sequence length 251
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tiiA00
4I5FA 1DAOA 1P1HA 5TRTA 4J2OA 5FF9A 4E5KA 1X15A 4RVDA 4U0KA 3DO5A 4FFRA 4Q3BA 4ZA2A 1AXEA 4DPKA 1X7GA 4HX5A 4E2XA 4MIEA 3ENNA 2SCUA 3PYLA 2EP5A 1XQ1A 5JAIA 1ML3A 4CM4B 1BVRA 3P2OA 3DMTA 1PJQA 2BI8A 3GEGA 1MG0A 1ZSNA 1FXSA 2WM3A 9LDBA 5LDGA 3S1LA 3R3JA 4Z3KA 1K0UA 4ND3A 2B83A 3GQVA 1YB5A 5ITVA 1KC3A 4GMFA 1U2DA 3RU7A 4ALIA 4CLDA 3ANLA 4PRKA 1WDKA 3G3EA 4IBOA 4Y8VA 3SC4A 5BSFA 2C7VA 2RH8A 1K6IA 2A92A 3BMNB 3QSGA 5CPFA 2B69A 3PHIA 3PHLA 4AJ4A 1I3MA 3FD8A 1C1XB 1TI7A 3FN4A 2D5CA 4DMLA 1KS9A 1AN9A 4AJHA 2YUTA 4YAEA 5T5QA 3QA9A 2BFMA 4M1QA 3PDUA 1EVYA 2E82A 1ZK3A 2J8ZA 1DRUA 4NBUA 3I1JA 5KJCA 2OOSA 4WECA 5JCJD 4ALKA 1L7EA 4PG8A 5CG1A 3BIOA 2NSDA 2OORA 1CEQA 4EW6A 1WNTA 4ZN6A 3OIGA 2AQ8A 2Q1TA 3TWOA 4YR9A 1BXGB 3LT1A 3PJDA 4JCOA 4CQMB 4E5NA 1IPFA 3NJ8A 2QYTA 3OP4A 1RYEA 2NACA 2RBEA 3G79A 1BGVA 4PVDA 5T8KC 4BO8A 2X9GA 3HHPA 4CM1A 3NYWA 3SX2A 1KIFA 4BO3A 1C1DB 5DOZA 1PGJA 1A9ZA 4EI2A 1JA9A 1P0FA 4CM9D 3TZCA 4XDZA 1WLYA 1DDOA 1K2WA 5BR7A 1GQ2A 1I5RA 2WDZA 1MFPA 4NMHA 3VTZA 4RLSA 1LSUA 3LC1O 1PIWA 1UP6A 3UAGA 4BO0A 2PR2A 3ROMA 4BO7A 3B1JA 2BH9A 5TT0A 1WMAA 2DTDA 4IQGA 1OI7A 2AQKA 4J7XA 1HDYA 5DN9A 4YT4A 1XWFA 1FDVA 1DIBA 1DIAA 2BMAA 2R00C 3ZV4A 3W1VA 4WE3A 5JFOA 3NT2A 4Q3EA 3K6JA 5K6AC 1GZ4A 4IJWA 3JD2A 1D7OA 1B14A 4IDCA 2WYWA 2PD4A 7MDHA 3PEFA 2JAPA 1I2CA 4OXYA 3H3FA 3JTMA 3FNHA 3RI3A 2P68A 3FR8A 4IDGA 1KVRA 1ZXLA 1SCUA 4GI2A 3OF2A 4IMRA 4B79A 5JAQA 2ZKLA 3VPSA 4WEQA 1E5LA 4UUOA 1LTHR 4R69A 2D8AA 1A4IA 2JCXA 2WYVA 2O4CA 4DBVO 2HK7A 2QG4A 4XQCA 5JCJA 3QP9A 2JAHA 1E1LA 3RUEA 3I9OA 4E31A 2R2GA 3TF5A 3CINA 1GDHA 2EHDA 2V6FA 3C3XA 3FF4A 1E92A 2ZIZA 2GGSA 3QW2A 3H9JA 1GYPA 4JK3A 1NP3A 2HAEA 4Q3CA 2PLAA 5COBA 3S2IA 2HQ1A 1M66A 1PJLA 3MWDB 1G1AA 4W9NA 1KVQA 1PJCA 3C85A 3ETGA 5T67A 1C3VA 1GUFA 3DXFA 4R5HA 5EIOA 3WMXA 2PD6A 3EZYA 4MVJI 2BRUA 4R1TA 3UKOA 3B1FA 4HFRA 4AFNA 3JYQA 1R66A 1IOLA 1XSEA 3PWSA 1RM0A 4Z9XA 4D3SA 2UV8A 3Q2IA 4BNGA 3PPIA 3TZHA 1E7YA 1O6ZA 5G4LA 3PGXA 1DRWA 3DHEA 4KQWA 3CH6A 4Y98A 1QYCA 2FR0A 3H2ZA 4GLOA 2WMDA 1HE4A 2FOIA 5ENVA 3D3WA 3GNSA 1A7KA 3I6IA 3QRWA 1LU9A 2VNAA 2EJWA 4H15A 2O7QA 1ID1A 1ZK0A 2PV7A 1V9LA 3HG7A 1NHWA 3FWZA 3KYBA 4UULA 2I67A 3WGZA 2VZ9A 1GUYA 5JMWA 2H9IA 3KV3O 3DZKA 4YRAA 5HS6A 3PJGA 4OH1A 4UEJA 1P1KA 2E4AA 2VT3A 4WLNA 4PRLA 2NQTA 2R6JA 4IDAA 4DVJA 1M6WA 4AJKA 3DBVO 5IDXA 4QUKA 2B4RO 2XXJA 4RDIA 1W8DA 4EUEA 4XYMA 5A4DA 1LRKA 5AQ1A 3VH4A 1B2LA 1GTMA 5EPOA 4H3VA 2CF5A 5JW6A 2IEDA 2ZK7A 2X5KO 4PG6A 4UEKA 5TF4A 1FDUA 1KEWA 4DPLA 1B8VA 4B8WA 4ALJA 1V6AA 1XG5A 2DQ4A 3KVOA 3B70A 4CV2A 1QV6A 1LDGA 1R4MA 3PJEA 4DIOA 3GZNA 5FWNA 1DFGA 1XU9A 3JQ9A 5B4VA 4GX5A 2FPPA 3I52A 3LVFO 1ZIDA 4Y9DA 1PS9A 4O63O 2HMVA 3VPFA 5MDHA 2ZYGA 4FOOA 1EK5A 1XA0A 3E48A 5A9SA 4P22A 3H2SA 3GDGA 3UN1A 1ZCJA 3NTOA 5ENDA 3TFQA 3IJRA 5I7SA 3FNGA 3R0IA 5B4UA 2ZTMA 3KUXA 4NJMA 3U09A 3GR6A 1SOWA 4PLWA 5A04A 2GUGA 4PN3A 2AE2A 1DOHA 2RAFA 3E5RA 5TX7A 3DMYA 4WK6A 3NDIA 3F4BA 5B37A 3VAZA 4TSKA 1CIVA 4ZVVA 2VWQA 3SEFA 1F8FA 3GZ4A 3MOGA 1FMCA 1W4ZA 4KP7A 1E1NA 2XXBA 1O95A 2VZ0A 3VH3A 4JXKA 2P4HX 3BHIA 2VCYA 3JQDA 4W4TA 1HZJA 4XB2A 3GUYA 1X0VA 3GGOA 4Z0HO 4R4JA 1E3JA 3FNFA 4BHTA 2AW5A 1FK8A 1QLJA 2P4QA 2WD7A 3O26A 4FW8A 3OQ1A 3ONFA 3UXYA 4XJTA 3ULKA 3HN7A 2POQX 3PYXA 1DB3A 1PWXA 1Z6ZA 3FPCA 1Q7GA 1VC2A 1DC5A 2D4AA 4YQZA 3KBOA 3LSYA 1UZNA 4FFNA 4IINA 5LCXA 1I3KA 1UP4A 5IZCC 5A5FA 2OBYA 1WW8A 4QTZA 1N7GA 1NWCA 8LDHA 1ONOA 1ZJYA 2P2SA 3WQSB 3ZI0A 1ZJZA 5IAAA 5JDIA 3KOUA 1E7RA 1QYDA 2W90A 5FI3A 3WGGA 3T4EA 4TKLA 3NEPX 3OQBA 4YWJA 2YDXA 4ZQFA 4YQYA 4BOYA 4O0LA 4K26A 5IJZA 4D7AA 4JBGA 4YTEA 2FN7A 3FSRA 2BFAA 2AEJA 4OL9A 3QWBA 3JYNA 4O59O 1M6HA 1SO8A 2Y66A 2HRBA 2NTVA 3IC5A 5AXBA 4BKQA 4WEOA 5FEUA 1P31A 2VWPA 4OIMA 4RVHA 2Z5LA 3TSCA 2UYYA 4J3FA 2P5UA 3LC7O 5AYVA 4B4VA 2PZJA 5EESA 3R3SA 3E5MA 3EVNA 3VTFA 2GN4A 3OJEA 2GN9A 1VL8A 1NQ5A 4GX0A 3BHJA 1GEEA 2FY8A 2AEFA 3E82A 4GGPA 1DXYA 2C5EA 3G1TA 3GEDA 5CP8A 4B7CA 1PJ4A 5HWSA 3HDQA 5EN4A 1DPGA 2VT2A 1LDMA 5HM8A 5MGBA 4UVDA 4YACA 3E9NA 1CDOA 1GZ6A 3HB5X 3DDNA 1MUUA 4BNJA 4D79A 5BSGA 4IDDA 1EUCA 1MXFA 2D0IA 4PLGA 3U3XA 1ADCA 1AGNA 3MTGA 5IN4A 1X7DA 4DLBA 1UAYA 1XYGA 3K30A 4ZRMA 3AFNA 2WTBA 2IZZA 3DAGA 4IUYA 5U4QA 4NNJA 3R1IA 4MKXA 1R6DA 3ZWBA 1U3UA 2CVOA 3JQBC 2I3AA 4J4BA 4OSPA 1YVEI 1KVUA 4CMBA 3SXPA 4CQLA 3C1OA 5U9CA 3WTBA 2J5QA 2HO5A 1UJMA 3DWFA 3AM3A 4U5QA 1VE9A 2HKIA 3NRCA 4KWIA 1Y5RA 2PFGA 4WLFA 4TVOA 3DHYA 1Q0QA 1YL5A 5JCXA 4MVJE 5KVSA 4YRBA 3HB4X 4IJKA 4AJLA 2C2XA 3F6YA 1E3IA 1EVJA 1MFZA 5ER6A 1CRWG 3CXRA 3FNEA 4I08A 3KRTA 4IIUA 1NASA 4KUEA 2ET6A 1EZ4A 4QEDA 3RC1A 1EQ2A 3QVTA 1U4SA 4OMUA 1AUPA 3T4XA 4AL4A 1HKUA 1UXGA 3EMKA 4JROA 1PTJA 4R16A 1M2WA 2CY0A 4NIMA 3ZDFA 2WSBA 3HUDA 3OETA 3PQFA 1JWBB 1YS4A 2NU6A 3IDSA 4E2YA 4L4RA 2YFHA 2ZB8A 4PLTA 3DBLA 5L45A 1TVEA 2Z1MA 4Q3DA 3NAQA 5KJFA 4FC6A 3BTSA 3KYCA 1DC6A 4XEHA 2C59A 3GNTA 1YDEA 2YYYA 3WS7A 2D5AA 3ZNPA 2EG9A 4OAQA 1C0KA 3RUFA 4S1VA 4CMJA 2CZCA 1PJTA 1ZVMA 3RBZA 4CMEC 4MKZA 5I9NA 3TPCA 3W8FA 5DF1A 4D41A 3BAZA 4LGVA 1R15A 4J4TA 2H63A 1ENYA 1WDLA 4GLLA 1Y9EA 2QZ9A 3BZUA 3WJ7A 4D3DA 3IQDB 1I2BA 4J1TA 2V6MA 2DBQA 3MOIA 5JSFA 3UF0A 3FBGA 5I9LA 2AE1A 3QVOA 2LDBA 3GY0A 4EDFA 5I7VA 1ZNQO 4I5EA 4IDBA 2VHVA 4M89A 1XELA 3L0DA 4CLOA 4UREA 4A7PA 4RVUA 5FFFA 5DBFA 2X0JA 6LDHA 1ENOA 4JX8A 3GDOA 4ZRNA 4B3JA 4NU5A 3MJCA 4J91A 1XGKA 2J3JA 5IG2A 1X13A 3GMSA 3JQ7B 4NZ9A 2C5AA 2PK3A 2X1HA 1EBUA 4WCFB 3AUSA 3UCFA 1T1SA 2E48A 4P8RA 1HE3A 1GPJA 5B12A 2AQIA 4TRMA 1P0CA 3WNVA 3V2UA 3UCXA 2Q2WA 4YJGA 1R4MB 2CF6A 5A9TA 1IHXA 2UVDA 3G49A 5C5IA 4GKVA 1ZZEA 2OL4A 3DBHA 3IIEA 3TZ6A 1RM5A 3RC9A 3W4KA 1I33A 2DFDA 4CR8A 5L40A 1JKJA 1K89A 2I65A 4CMCA 3OFSA 1UDAA 2ILTA 1GY8A 3D4OA 2PNFA 3IKVA 1W0CA 3QE3A 3QLJA 3TL3A 1ZK1A 1OC2A 2VOJA 1Q2XA 3ZW8A 4GH5A 5G0WA 1PL6A 2PKRA 4K6FA 4XYLA 1KEUA 3F5QA 3GRPA 4KDEA 4ND2A 4YBZA 5A06A 5TJHA 1ZSVA 1O8CA 2RCYA 1T24A 1GQYA 1B15A 2GSDA 2W98A 3PHJA 3WBBA 3WLEA 4NI5A 2BF7A 4RVSA 4CMGA 3EAGA 1OBFO 4AICA 4E2WA 2B37A 1ZFNA 3JQFA 4ONEA 3SLGA 1ZUD1 2I99A 1JQBA 1HXHA 1UUFA 4IZIA 1E1KA 1ADBA 4BO1A 5KTKA 1HSZA 4BMNA 1T2CA 2HMSA 3WJAA 3KLMX 4IZHA 4BQPA 2ZTUA 2HMUA 4BIIA 3AOGA 3A14A 8ADHA 3VVCA 3GRKA 1YB1A 6ADHA 1U3TA 3CKYA 4XRRA 4RGBA 4WCDA 4J7UA 3IMFA 5GY7A 1SAYA 1QORA 3WDSA 3GPDG 4I9NA 4Q9NA 1PU2A 4RO0A 4QFCA 1E7WA 3F9IA 1IYZA 3U62A 5GMOA 1U8XX 1YJ8A 4CM5A 2V6BA 1NWHA 2X9NA 1GR0A 5JPIA 2PKQP 3LK7A 1B8UA 2HMWA 4GBJA 4MVJP 4QO8A 5DZSA 3AM5A 1Z82A 1DIGA 1IE3A 2O3UA 5L7WA 5IZ4A 4JBIA 5CG2A 2B0JA 3ITKA 4ID9A 4P4GA 4XQGA 4RV9A 4J43A 4K1LA 3VPHA 4WUVA 4R5MA 5L3ZA 3WGIA 2QW8A 5IN5A 3TZQA 5AOVA 3RU9A 1LDYA 2ZB4A 4YT8A 5L4LA 1H2BA 2EGGA 3F3SA 5ES3A 2NU8A 3E6AA 2DKNA 4EITA 2NM0A 1P1JA 2JD0A 2V65A 3NT5A 1GU7A 3GAZA 3U0BA 3RC7A 4DC0A 3S8MA 3WGOA 4B4UA 3AU9A 3KYDA 3QJ5A 2Y0DA 4WLUA 2FZWA 1BW9A 5ICMA 1HLDA 2H5LA 4J1NA 3DR3A 1H6CA 4FFLA 4N54A 2GF2A 2W8ZA 2PH3A 3U9LA 4OXNA 1DJQA 3RFVA 3G0OA 1ISFA 5KJEA 3UGKA 4QT0A 5EMHA 1I0ZA 4U7WA 3ASVA 4DUPA 4ILKA 2DC1A 3M2TA 1RKXA 3PTZA 2HCTA 5TNXA 3DOOA 3RFTA 1YXMA 1KETA 4L75A 3D4NA 3TOXA 3X2EA 3K5PA 1FDTA 1VL0A 1A27A 3ENKA 5JC8A 4OXKA 1LI4A 3DHNA 3DL2A 4HFMA 2EEZA 2VZ8A 4M86A 4PLFA 4R51A 3L6DA 5ILGA 3FI9A 4BKPA 2Q49A 3QWAA 4L8VA 4OYRA 4CUZA 3RCBA 3P5SA 3PI7A 4A26A 2NVUA 3W6UA 2DBZA 4HFNA 2Y1DA 2TMGA 1S7CA 4RQUA 3HZZA 1TT5B 1YONA 2I3GA 4WCFC 4CLEA 1GV0A 3AOEC 3K8ZA 1U9JA 1BSVA 3L4BC 2VYNA 2YQ4A 3TOZA 2EGHA 3WSVA 4I8XA 3CMCO 3JD4A 3A1NA 2PTGA 2PZKA 4KWHA 4E5MA 4MVJM 2PZMA 3ETEA 3HFGA 1KEPA 2XPCA 2IXBA 4XWYA 3DBLB 4HWKA 2LDXA 1YL6A 1KERA 3MJEA 1O94A 1Y8RB 4BKOA 3KYCB 3QWFA 1KC1A 4D3FA 1D1TA 3IP3A 3OM9A 1KBZA 1Z7BA 4GX1A 2YV1A 4Z0TA 3ZCXA 2DUUA 4GSLA 4FBGA 3UUWA 2Y0CA 3F1KA 4PZEA 3QVSA 2GCGA 2RHCA 3S55A 4ITUA 3NT4A 1UXHA 4IPTA 5TJ9A 3O03A 4ZGWA 1E3WA 3H4VA 1P1RA 3H9EO 3BHMA 1YDWA 3OJOA 1XHLA 3GEMA 3H65A 1ISIA 2QZZA 3EW7A 3TN7A 2O7SA 1D4FA 2JCVA 4M54A 4CLOB 4CLRA 1QYVA 4J6FA 4NHEA 2YZ7A 2X7HA 1F14A 5DBGA 1X14A 1YGYA 3RUDA 2FPGA 4EJ0A 1LDEA 5T57A 1EE2A 3EUWA 4U6QA 4DLLA 4P4NA 4AJJA 5CFZA 5HTOA 1K6JA 3H5NA 3JQGA 1UXIA 4I1IA 4PZCA 2ZYDA 4PLZA 2JCYA 5TQVA 5A9RA 1E77A 2UUOA 3WQRA 1N7HA 3PP8A 4EUFA 1NPYA 1MLDA 1QG6A 3VZPA 3KSUA 2VUTA 4LISA 4LMPA 3WIEA 3JCZA 4FIZA 3GLQA 2X0RA 3BMQB 4HFJA 1Q7CA 4BNTA 1PJBA 1RWBA 3CUKA 2W2KB 1U2GA 4NBTA 5T64A 4PCVA 1Y8QA 4IQ0A 2NU7A 3KSZO 4PVCA 1R16A 3D1LA 3DBHB 5COAA 5KVQA 3D3EA 2WEKA 1JKIA 1J49A 1Z7EA 1WVGA 4ZQEA 3SBOA 2Y1CA 1ZO8A 3Q9UA 1IHYA 3O8QB 4AJNA 3UH1A 3PWKA 2AG8A 2W2LD 3AUTA 3KSDO 5TIIA 1C0PA 4NU6A 1ENPA 5L4NA 4Z3DA 3NDJA 2HMTA 1B26A 2FMUA 3FTPA 2GDZA 1PZHA 4D42A 3H5AA 1VSUA 2EW2A 4JBHA 1YBMA 5DCUA 2VN8A 5DNAA 1EFLA 3CSDA 3U4DA 4KMSA 1T2DA 3ADOA 7ADHA 2CFCA 3JQCA 4J0FA 5JS6A 4BQRA 4C4OA 2BFPA 2Q99A 4PLPA 2NU9A 1Y7TA 4BNFA 3RJ5A 2YHIA 5I7EA 5JAZA 1GEGA 3ZWMA 1CERA 5F1KA 2TMDA 3BMOA 4PFJA 4G5HA 1F8GA 3DFUA 3VKUA 4JP3A 2B4QA 3QQPA 2J3KA 1W73A 1NFQA 3F47A 4URFA 3WFIA 1HTBA 3LQFA 1P33A 2Q1SA 1A9YA 5JDCC 1U4OA 1AE1A 4XQEA 4RPHA 1ZEMA 1BG6A 3MJTA 4A0SA 1LEHA 4B3IA 1LQTA 2VTEA 3K31A 2O2SA 4FD3A 4ZD6A 1XKQA 1SBYA 1HDXA 4F6CA 3KTDA 3PFWO 1SEVA 3OA2A 3OA0A 1SOVA 3GN2A 4GVLA 5KWEA 4BB5A 1U7HA 4YYZA 1K3TA 1YL7A 5L95A 2PGLA 2DBRA 1VKOA 5L9AA 1YQXA 1WZEA 3E9MA 4ZQHA 4RDHA 2G1UA 2JD1A 2YFQA 3PHHA 3RUCA 4JJGA 2A94A 4OSOA 4MKRA 5ADHA 1T4BA 1NX6A 3OJLA 3CPSA 4AJIA 4CPDA 1F06A 4RF4A 3FWNA 1KY5A 2XF8A 2EIHA 4TQGA 4GKBA 3GGGA 1JVSA 4Z9YA 3U4CA 3JYLA 3WR5A 1OFGA 1G6KA 4BNWA 4CMIA 3V2GA 3L4SO 4DIBA 4NDNE 5FYDA 3RD5A 3WB9A 4BNIA 4BO2A 2W2LA 3H9GA 4IGFA 3WMWA 3OMLA 2O3JA 3KB6A 1YOVA 1Z45A 4LRSB 1VRWA 3A28A 3KYDB 1AHIA 1T25A 2XAAA 4FN4A 4J2HA 3M1LA 3VZSA 2X5JO 3KEOA 3L07A 4RZIA 4XB1A 1ZK4A 3LT0A 1P74A 4N5MA 5T6BA 5K9ZA 3ZWCA 2CNBA 1J4AA 1I36A 3QWIA 2PGDA 4YT2A 3A06A 1NQTA 1ZXBA 1MA0A 4E5PA 1DEHA 3LDHA 3W4JA 1ULUA 3RUAA 5CDSA 2P9EA 4XGNA 3MZ0A 4WGGA 2VHZA 3HFSA 4QO7A 1HYEA 4OO3A 1HE2A 2GN8A 3LF1A 4XIYA 4YJHA 3QIVA 3FTNA 3U4HA 4J49A 3JSAA 5JO0A 1H9AA 3HNPA 5T8KA 3I9JA 2BGMA 1WPQA 4JQCA 1ENZA 4FJ2A 3ZV3A 2D59A 2ZCUA 3E03A 1YE3A 3C24A 3ZNQA 3IP1A 2QIOA 1NHGA 2YHUA 2Q46A 2XOXA 4JGBA 1EFKA 3B1KA 3W4IA 1C14A 1R0KA 3DAPA 3VKVA 4DWVA 3EK2A 5KVVA 3H3JA 5I9MA 1LUAA 2IZ0A 4FFPA 4WNIA 2ZTVA 4NJOA 3K2EA 2J6IA 3WGQA 1GD1O 2DPGA 4AJ1A 4A10A 4S3MA 1NBOA 4XX0A 2NNLD 3P7MA 1J5PA 1IY8A 1SEPA 4D44A 5EERA 1RM4A 2VWHA 2D2IA 2R00A 2WYUA 2FR8A 4O6VA 1YBVA 3JQ8A 2V6GA 5K6AA 4I5DA 3I3OA 1XU7A 3VDRA 4FOSA 4CL8A 1MG5A 3DC2A 1PR3A 4IXWA 1MGOA 4Q3NA 4F3YA 3KETA 2PD3A 5BSHA 4CODB 1Y81A 4EUHA 4ZQGA 1HDCA 1M75A 1PGNA 3M1AA 4YXFA 4QQRA 2PZLA 3PQDA 3LT4A 1A4UA 1IUKA 3M2PA 1ISMA 3T7CA 1E3WB 3GA0A 1OAAA 4YB8A 4FFOA 2C82A 1I8TA 1WDMA 4ALMA 3K73O 3BYZA 3LLSA 2BHLA 1CETA 1XQ6A 2A4KA 2GRAA 4EEZA 1B3BA 1NNUA 4JP2A 4BL5A 4IJUA 4MP3A 1IZ9A 4XD2A 5G4KA 5BQFA 3E9QA 1BXZA 5DT9A 1YRLA 4NFHA 4BB6A 3C8MA 4L4SA 1JW9B 4CLRB 2VOEA 3NJ4A 5TSDA 4BGUA 1B0AA 4AG3A 4DYDA 1WWKA 2ZATA 3B20A 4BNYA 4C7JA 4MVJG 2Q2QA 3Q1LA 1SC6A 1PGOA 4CQMD 2X0NA 5IF3A 2GR9A 2IYPA 5G0UA 3H5RA 2BGKA 3RFXA 1I3NA 3D64A 3IUPA 1FJHA 3JQGB 1DBVO 4KQXA 1DHTA 3I9KA 2DPHA 5JYEA 1ONNA 4MP8A 4KOAA 4ESOA 2NWQA 2QYSA 5DP2A 5HS4A 3GK3A 2CVQA 1E7QA 3DONA 3NGLA 3MTJA 4IM7A 3GNQA 4II3A 1UDCA 1LLUA 4TMFA 2NVBA 3ROKA 4CLHA 1X1TA 1KYQA 2G0TA 2GYYA 3KEQA 4BNNA 5G0SA 3WNQA 1O0SA 2O2YA 3RBVA 1PJSA 2Y93A 3ZH2A 2X22A 2PWZA 4WASA 3PIIA 4OOFA 4XKJA 1GZ3A 1VL6A 1V3UA 1E7SA 1A5ZA 3RASA 1JKFA 2Q3EA 3JV7A 5F3RA 4WOKA 3DZFA 3H9UA 3AUUA 4WKGA 5A5EA 3HDYA 1PQUA 1C0LA 3ZU2A 4DYVA 3IOYA 5A3JA 5L7TA 3N7UA 1UXKA 1M76A 2AA3A 2Q50A 4IY1A 4CM4A 4QSMA 2JD2A 5A3VA 1I24A 3AY6A 4MP6A 4FC7A 4II2A 1MC5A 4CV0A 3EZLA 2JKVA 4YVFA 1NQAO 3PHGA 3WYCA 2VNSA 5G0VA 3EYWA 3UHAA 1BDBA 2VTDA 4CV1A 5IXYA 4KDFA 1K5HA 5H81A 3DOJA 5BT9A 3TZKA 1DIRA 3MWEB 1DO8A 2C2YA 3G1UA 3MCVA 3V1TC 3U49A 4PIVA 1LXCA 5C7IO 3PRJA 2Y1GA 2HUNA 4L9RA 1P44A 4FS3A 4XGKA 3BMOB 5I8ZA 5JBIA 1NVMB 3GFBA 4B7XA 4UAGA 2DM6A 3PGJA 5DDIP 2NADA 5JO9A 3AUAA 4JJIA 2Q4BA 1N1EA 3V1UA 1GADO 3D3WB 2J5KA 1NPTO 3BA1A 4OQZA 4AJEA 1EE9A 4OQYA 4L74A 4R9SA 2FSSA 1H0KA 4XCVA 3LLVA 4MIOA 3ZU4A 3UICA 2HJRA 4NFSA 2C54A 3VDQA 3X2FA 2UUPA 4CQMA 5TC4A 1DFHA 3WWYA 3DMTC 4NH4A 4L76A 1HDRA 3VVBA 1XDWA 5AVOA 3ORFA 1J6UA 1QMGA 2EKPA 1H5QA 4O5OA 3PLRA 5C7OO 3SJUA 1T1RA 1U3VA 4OHUA 3U4IA 2C29D 4ZJUA 3DOCA 2CDCA 1LX6A 1PJ2A 4CUKA 1JWAB 3IJPA 3RAJA 3Q2KA 1PZEA 5F5NA 4J7CA 4CJXA 5L4SA 3WSWA 4QFDA 5A1TA 5BNIA 1UR5A 3H7AA 1HDGO 4FGSA 4PG4A 4C7KA 3LZ6A 1N92A 3CZMA 4K9DA 3GZNB 1XEAA 4CMIB 2GN6A 1UZMA 3ZN2A 3I9NA 1P3DA 4YCAA 5CDGA 5H82A 4GWGA 3D5QA 1YOVB 3CTMA 2X6TA 1KEVA 2C7GA 5EL0A 5A9SB 2HLPA 3I83A 2FR1A 2GD1O 2DVMA 4HKTA 1B16A 5IZCA 3RUIA 1BHSA 3A9WA 4DL9A 4ZHSA 3JQEA 4IIVA 4W6ZA 5AXCA 3WX0A 4ZICA 3L77A 4NJMB 5L51A 3TRIA 5KNLA 3ZNOA 1E5QA 1PQWA 2ZTLA 4J90A 4R54A 3GT0A 3DEYX 2EERA 1LLDA 4OKIA 4PLCA 1DC3A 5KVCA 1LSOA 4WNCA 2X8LA 2OGUA 4Y67A 3OECA 4X54A 1DJNA 1Y1PA 1EUDA 2DAPA 1GCUA 2AG5A 3R6DA 5KJ1A 2PA3A 3OEYA 1X1EA 5F21A 3TL2A 4GVXA 4JIGA 4MINA 4OOEA 3AWDA 4DXHA 1V3TA 5L53A 3ZGYA 1YQGA 1HSOA 1P77A 2G17A 1QKIA 1WMBA 2WD7B 1E7MA 1YJQA 3CEAA 3GH3A 2QRLA 3IAHA 2WE7A 5JE8A 4HBGA 2D3TA 3GVPA 1CQJA 3S2FA 2VQ3A 4HP8A 2Q2VA 1W6UA 5DP1A 1DLJA 4NK4A 1CWUA 1V35A 3EY4A 1HL3A 4F6LA 2Y1EA 5K0ZA 1Z75A 1ISHA 2HDHA 1U5AA 3INGA 2DT5A 4E13A 4ZU3A 3G17A 3HQ4O 2RHRA 4XGIA 4AVYA 1Y5MA 3L6EA 4GGOA 4DMMA 4JN6B 5I8WA 3ANMA 4FJ0A 2X86A 2VYND 4XIJA 1VSVA 3JQ8B 1E3SA 1MC4A 3VZQA 4TZKA 4R68A 3JQBA 4LSWA 1QRRA 3AY3A 4IS2A 4RLHA 4TZTA 4BGEA 1F12A 3WGYA 4D45A 1NAIA 4XR4A 1TT7A 2J5RA 3F4LA 1GV1A 4E33A 1ONPA 2NLOA 1H9BA 3PYMA 1RYDA 4E4YA 4R1UA 2EV9A 1XCBA 1F17A 3ZWWA 2VRBA 4YRDA 3ON5A 4P38A 1Y6JA 1XIVA 3RSHA 5JXWA 3QHAA 4RVFA 3WG9A 3HN2A 4N5LA 2JJYA 3CMMA 3EGOA 5C37A 1XR3A 2E37A 4W9NC 2PH5A 4IDEA 4WLVA 4PLYA 1LA2A 3JQAD 1NYTA 2EJVA 1DC4A 4YJFA 3C7DB 4UVHA 1S6YA 3Q9NA 4Y6RA 2I6TA 1A72A 1LDNA 2Q1UA 1QR6A 3PLNA 2FSVA 5CPBA 2HRZA 2BD0A 1PGPA 2BFOA 2DLDA 3S2EA 1JVBA 2P9CA 5COQA 4G65A 3STHA 1N1GA 3M6IA 4LRTB 4FR5A 3ZNNA 1E1MA 2QRKA 1TEHA 1D8AA 3JYPA 3ZHZA 4YAKA 1LRJA 2P91A 3AW9A 2O23A 2O3SA 3DZBA 3WBFA 1QXSA 4O1MA 5F1OA 2A35A 5HA5A 4QECA 4CQLB 1NVTA 3DAFA 4NG5A 3WTCA 4EEXA 5ITWA 3K9QO 2C0CA 3OSUA 2VUSA 4CM8A 2IE0A 1HRDA 2Y0EA 4J1QA 4BUCA 2AXQA 3QY9A 3KLPX 4EGFA 2DTXA 4CMEA 3HWRA 1QP8A 3DZHA 4MOWA 1TA4A 2DUWA 2NQ8A 3OQ6A 4JJFA 3P19A 4GL4A 2OZPA 5EQFA 3TQHA 1GYQA 4TVBA 4E21A 4B8ZA 3GC6A 3JD0A 4BVAA 1UAGA 3ETDA 4WLOA 1HT0A 4K28A 4CM3A 1BMDA 1P9LA 3AI3A 1HYGA 1CQIA 2VHXA 4EZBA 3L9XA 1VLLA 3N74A 2YV2A 3GUCA 4DIFA 2O48X 1Q0LA 2CVZA 3IL2A 2O3TA 4LN1A 3H6KA 1YWGO 4A73A 2BGLA 2GLXA 3AY7A 3JQ9C 2B5VA 1X7HA 4R9RA 4RPJA 4E30A 1EVZA 4G81A 4LW8A 2JFFA 3ZU5A 5TGDA 2B35A 4UVGA 4JNKA 4MJLA 4OKNA 2OHXA 3HDHA 1GCOA 2I5PO 4RPGA 4CV3A 2IRWA 2X5OA 2NTNA 1LC3A 1UZLA 1LDBA 4NBVA 3Q3CA 3AI2A 1T4DA 2CD9A 2VRCD 3RVDA 1EUZA 1R0SA 2QQ5A 3DTYA 1JDJA 4CL3A 1WXDA 1YKFA 2ZQYA 3WLFA 3ZW9A 3Q6IA 4DBZA 1IB6A 2IXAA 4E2ZA 1Q7BA 4RPKA 2DBVO 2ZB7A 4IJVA 2CUKA 3JQAA 4CUJA 5AXAA 2Z95A 1L7DA 2F00A 3PFFA 4IMPA 4BNXA 1HLPA 2G82A 1KY4A 3BXXA 3UOGA 4E32A 4YT5A 1ZMOA 3B6ZA 1R0LA 1E0DA 4W99A 4ALLA 4BNMA 1EVIA 2HK8A 3JQ6A 4W82A 4FSHA 1AXGA 4BO9A 2OFPA 3O38A 1K6XA 3BTUA 4DRYA 3HSKA 4D43A 4Y6PA 2ZYAA 1EK6A 4E5YA 3GG9A 2FWMX 4GMGA 4MVJH 4BKUA 1CF2O 1BWSA 3F1LA 5GZ3A 2NV6A 1HWYA 2AQHA 1NQOA 3C7AA 3S2GA 1PSDA 3DBRA 1JTVA 3GMDA 4EJ6A 1E6EA 3BMCA 1FDSA 1WZIA 4CMHA 1I30A 3IKTA 5TS3A 4BKRA 5G0TA 2DU8A 1BXKA 1V0JA 3FHLA 1ZSYA 3LF2A 4YJGB 5JDIC 1C0IA 5L7YA 4DTIA 2J3HA 4BV8A 4ND4A 5I7FA 2Y67A 5CDYA 3GDFA 5IXSA 4RF2A 1ISJA 4PG5A 4TKMA 1EDZA 3GHYA 3WIDA 1SMKA 2OBNA 4B7UA 3NDRA 4DQXA 5IDYA 1SPXA 4CM6A 1HF3A 3SLKA 5CDTA 4I5GA 1T26A 4PZDA 4YEDA 1I01A 3N58A 1Z73A 2CDBA 2WE8A 3GVXA 2ZCVA 1DIHA 4YPOA 2PY6A 3JYOA 3PIDA 2VRCA 4W7IA 4A03A 5JAMA 1PL8A 1ZK2A 4IDFA 1KVTA 1LLQA 4CR6A 4R1SA 2OXIA 1G0OA 1UDBA 3LC2O 2QX7A 2GZ3A 3QVXA 4NFYA 2CDAA 3QVWA 3TDKA 4U0JA 1E6WA 5DOVA 4GSKA 2AEMA 1HYHA 1TB4A 2W4QA 4L0QA 3GVCA 4Z9FA 1V3VA 3HJAA 2VHWA 1D1SA 3DTTA 4KZPA 3ZU3A 2C20A 1P1FA 2FZEA 2FRDA 2IDZA 1NAHA 1O89A 3K92A 3DZIA 3GVHA 2IYOA 3D0OA 1A7AA 1H6BA 2GERA 1JAYA 2E6UX 3DFZA 1ADFA 2X58A 3EVTA 4CM9A 1LSJA 4CR7A 1YB4A 5A02A 2BLLA 2HSDA 3NKLA 4UUPA 3AJRA 3DZJA 2DFVA 3H9QA 4YDRA 2JHFA 5EQDA 2B36A 2P5YA 3K96A 3WGHA 4NK5A 3JD3A 3O4RA 1QSGA 4ND5A 1ULSA 4KTTE 3C7CB 4LSMA 2GASA 1DHRA 2AMFA 3AM4A 1ORRA 4HADA 1U7TA 4TROA 1CJCA 5KIAA 1PZFA 4B4OA 1WAMA 4MDHA 3I6QA 2I66A 4RZHA 1L1FA 4RQTA 2YW9A 3ZWXA 5IDQA 1VJ1A 1IL0A 3GPIA 1H6AA 1ZEJA 1OC4A 3BTOA 3UCEA 4DPMA 4FDAA 1NFFA 3IS3A 4YJFB 4QXMA 3VPGA 4UUMA 3RUHA 1U28A 4FCCA 3JQ7A 4R3WA 3WYEA 1HETA 2GZ1A 2I9PA 3JD1A 4NPCA 4WCFA 1BW9B 1LC0A 3AOEA 3GAFA 3L4BA 3VZRA 4A2CA 3RKRA 4IS3A 4J16A 2X4GA 5CEEA 1YQDA 4N5NA 2JL1A 2O3RA 3ONDA 4HNHA 3OJ0A 1DFIA 2VUUA 5EJ2A 1PZGA 3WGTA 4XRGA 1U8FO 1EQUA 1AHHA 4H16A 4KUHA 4IGEA 1QYXA 3L6OO 3PQEA 3O9ZA 1DSSG 5KJ6A 4HUJA 5U1PA 4CM8B 1I3LA 1T2FA 3LT2A 4D0SA 3EC7A 3L9WA 3WICA 5B4TA 2WJPA 1NFRA 1U5CA 1YBAA 2V7PA 1IZ0A 1GUZA 1N9GA 2BELA 4R41A 4TRNA 4XYGA 5JMPA 4E6PA 5KCZA 3RROA 3P2YA 3KXDA 1PS8A 4DLAA 2HU2A 2Q45A 3W8DA 2NVUB 3INTA 3OEWA 5ICSA 3PZBA 4J9VA 3NTQA 5HBRA 1X0XA 2X23A 3MJ4A 1SB8A 2EW8A 1VPDA 3IUSA 3A4VA 4XYEA 4L73A 3V1YA 3ZZNA 4XJSA 3GHHA 3D4PA 3GVIA 1HDOA 1OZAA 4CM7A 2QHXA 4R3NA 1VI2A 1NXQA 4RF3A 2FHSA 3D7LA 4BO5A 4RJTA 4AJPA 1VM6A 3HADA 2VHYA 3ADPA 1JLLA 2JFGA 4NBWA 5EINA 3WXBA 3VH1A 3COSA 2IEBA 5JNLA 2Y05A 4HV4A 2CMDA 4WJZA 1R4NA 1YO6A 3PDJA 4J1SA 1JAXA 1IPEA 2Y1FA 3W8EA 4GAEA 5KOIA 2AHRA 4MVJF 3OHSX 4OJNA 3TJRA 1BTOA 5JY6A 5CEFA 1GQQA 1GL3A 5DULA 3ZHYA 5GZ1A 4PG7A 3WOHA 3SJ7A 1EBFA 3ZWNA 1PQPA 4I9HA 9LDTA 3JQAB 4BV9A 1ADGA 2FPIA 4HY3A 5F1PA 2BKAA 3UW3A 1EMDA 2OMEA 3EDMA 5GZ6A 3BTVA 4L4XA 1XLTA 4EYEA 1GPDG 1UXJA 5LC1A 1CYDA 4U8GA 5H83A 3OH8A 4BNVA 2JFHA 3JQFC 3QWHA 3RBXA 4BNKA 3UFXA 3WQQA 1MB4A 3MJVA 1PX0A 5DBIA 4UEOA 3MEQA 2YDYA 1G0NA 3GN1A 4B3HA 2YY7A 3HDJA 4WPGA 4RF5A 1Q1NA 2YV3A 2H6EA 2G76A 3I4FA 4XA8A 3GF4A 5BSEA 5THQA 1P45A 2FP4A 3DBRB 2Z1NA 3ZV6A 4LCJA 3BMCB 4R1NA 4BGIA 1LQUA 3MJSA 4E3ZA 1MV8A 3EHEA 1JU9A 3CE6A 4FQ8A 1Y8QB 4NBRA 1LJ8A 2H1SA 2Q1WA 3UVEA 5IDWA 3Q11A 3RKUA 3ZWAA 1RJWA 2EWMA 2NUAA 1R37A 1ZKMA 3CIFA 1NPDA 2PGJA 4BNLA 3CZRA 3NV9A 4CMKA 1ARZA 4P4LA 4CLXA 3VOSA 2OP0A 4LCEA 1DAPA 3I4CA 5JDCA 3WWZA 1V8BA 4A5OA 5THKA 5ILOA 1I10A 4DQVA 3NX4A 3PXXA 3V5NA 5TT1A 1IULA 3GG2A 1PWZA 4XQ9A 5IFLA 2GO1A 3ST7A 5B1YA 3TNLA 4XDYA 1ZH8A 4B4WA 4XZ3A 5JY1A 4UVIA 2OP1A 1VJTA 1P1IA 4BNUA 1BVUA 4IQ8A 1PGQA 3PZRA 1KOLA 3DQPA 4NR0A 1JN0A 4D0RA 1LLCA 4CMAA 5BNTA 1ZBQA 4GQAA 4EJMA 1PS0A 2B5WA 2ZJ1A 2RIRA 3ASUA 1GFSA 1PEDA 1TLTA 4BGVA 4M8SA 4BMSA 2X9VA 2YHIB 4F46A 1O5IA 1TT5A 3BMNA 4RCVA 4JLWA 1Y9AA 2O4UX 2Q4EA 4NQZA 1C1XA 3SVTA 2WWRA 4MO2A 2EF1A 3ZWVA 2CSUA 4KTVE 4PLVA 3E1KA 1MXHA 3NGXA 1EEHA 1YH3A 3KHUA 5JLAA 1M67A 5TLSA 1T2AA 1HDZA 4N7RA 4ND1A 3OIDA 3RC2A 4D46A 3OJFA 4LVCA 4MIYA 3FPLA 1HZZA 4ROSA 4DA9A 5KKCA 4TWRA 1BXGA 1Y8RA 3ZWYA 4GX2A 3VPXA 1I2ZA 3PK0A 3H8VA 3ROPA 4R01A 4YA6A 1HE5A 1PJ3A 4XR9A 1UP7A 3V8BA 3E18A 2A9FA 4KUGA 3INRA 3QV1A 1C1DA 5HRUA 1QLHA 1A71A 2EKQA 2NVWA 3AFMA 2RH4A 2G5CA 3LYLA 2O50A 3KZVA 3ZHXA 3W6ZA 4Q39A 4Y6SA 2F1KA 3TFOA 4FJ1A 2YJZA 3F5SA 2PKQO 1ZW1A 1VKNA 2VWGA 3NUGA 4M87A 4FB5A 3FRJA 1H93A 4MVJD 3WYBA 4EBFA 3ABIA 4WOJA 4YJDA 3VHRA 5CEJA 3SC6A 5A05A 1NTOA 4PLHA 3WFJA 3I23A 2GPTA 3GOHA 4DGSA 4OM8A 3ANNA 1N5DA 3DZGA 3I9MA 4GWKA 5ER9A 1NM5A 1GAEO 4FGWA 1D3AA 4J9UE 3ROQA 1Z74A 2VYVD 3DB2A 3FCOA 3KO8A 1Q0HA 4XYBA 2GNAA 1FDWA 1H94A 2ZJ0A 4M55A 1BDMA 3BMQA 1N2SA 5DCYA 1MX3A 2W2KA 2GZ2A 1U3WA 4A27A 1SZJG 1E3EA 3RIHA 1HEUA 4BNZA 3PJFA 2BI7A 2Y68A 4QX6A 4Z0PA 4FPXA 3FR7A 4YJHB 4MPDA 1KVSA 2ZB3A 2DTEA 1SNYA 3GGPA 1MP0A 2EKLA 1N9GB 4W7HA 3O8QA 3RQSA 4E12A 1ZMTA 1RPNA 1T2EA 2J3IA 4UVEA 5DCWA 4AJOA 1PL7A 3PVZA 4K6CA 1J0XO 4Q3AA 1B3RA 2EXXA 5BNFA 2IODA 1GYRA 4RVGA 3ONEA 2YQ5A 3LU1A 5JYDA 5AXDA 5J23A 1H2HA 1H6DA 3OBBA 5A03A 4LVUA 4HNGA 5CAEA 3GFGA 1N8KA 2Y99A 3FBTA 5G2OA 2I76A 1QV7A 2B4TO 4Z6KA 1VJ0A 1UH5A 4OGWA 4I9UA 4TRJA 1NR7A 1LBEA 3ICCA 4BO4A 4ZQBA 5KKAA 1SB9A 4F45A 3T7EA 3VH2A 2QRJA 3E8XA 4DQUA 3OICA 2ZQZA 4H7PA 3ZHBA 4RORA 1QYWA 1R4NB 1B8PA 1RM3A 2P9GA 2OUIA 1B7GO 2EP7A 1EDOA 3NTRA 3D5TA 2OO5A 4RL6A 4YAJA 3VC7A 4J0EA 3ZWPA 1R12A 3I9LA 4LK3A 3AK4A 3KM0A 4WLEA 3ZV5A 4DC1A 3ICPA 4UUNA 4MVJA 4YAIA 2JHGA 1LSSA 1U1IA 1NR1A 5C3MA 1BRMA 1E6UA 4BMVA 4AJ2A 3AU8A 2E49A 5F5LA 2NTJA 3OIFA 5CDUA 1TXGA 3U5TA 4LMRA 4BO6A 1DRVA 1PR9A 4YAGA 5G4KB 4N18A 3I5MA 3C1TA 4BNHA 1F0YA 1LNQA 3HE3A 2VYVA 5CHEA 5FI5A 1I32A 1DLIA 1LRLA 1OMOA 3RJ9A 4BS9A 1O9BA 4G2NA 4J4HA 4M49A 2X0IA 3K2BA 2HK9A 4GPD1 4E0BA 4INAA 1FF9A 3PWZA 5LDHA 5JC1A 4U6SA 2D1YA 2UDPA 2Y1OA 3F46A 5C7LO 4ALNA 4RPLA 1OOEA 2UAGA 2O3QA 1WP4A 3C1AA 4TRRA 3RWBA 3AI1A 3Q0EA 1ISGA 2IZ1A 3V2HA 1NVGA 4HXYA 3ZWOA 2WD8A 4DREA 1E3LA 4PGFA 4FFMA 3ITDA 4IXTA 2HJSA 2C07A
chains in the Genus database with same CATH superfamily
1SQFA 2KYRA 3ZY6A 1M2EA 5TRTA 1QPBA 4J2OA 2IP2A 3K70D 1GPWB 2O8CB 4E5KA 3CF6R 1WHTB 3CHYA 2FPWA 2Z2KA 2MCFA 1YVDA 4U0KA 2YUIA 3FUVA 3P1JA 4FFRA 4LDRA 1LCIA 4L27A 1ZGHA 5T4EA 4HX5A 3RO7A 2R751 2QRPA 3GQBB 4US0R 3I5UA 5FOQA 4HAVA 3BM5A 4L95C 3PYLA 2EP5A 4JC0A 1XQ1A 3PE3A 2E6KA 5TDHA 3I1IA 4DM3A 2CBZA 5BURA 1DPFA 3R20A 4CM4B 1FVFA 3P2OA 3DMTA 1KAOA 1PJQA 2OLKA 3WZMA 1MG0A 2BTQB 4C1NA 4MUNA 1PFVA 2AX3A 2GAIA 4ARBA 2HF7A 3ENZA 3PG5A 5TQ2A 1U0GA 1EI9A 2PKXA 3BQMB 3GQVA 2FN3A 1J06A 3WDLA 2AC7A 3WGKA 2JLRA 3GCZA 3OSZA 3ZLVA 4ID3A 2QTLA 4ZQCB 1RDFA 2ZBGA 3RVOA 3QFSA 2A9RA 3FDZB 5JOQA 3ANLA 1H2ZA 2Z2ZA 1KZHA 3NLLA 3I2FA 2EGUA 1XJ5A 2NT4A 1TMKA 3A6KA 4HYTA 5IC4A 1TKAA 1ATIA 2BZ0A 4MKHA 1ZY2A 3T99A 1ESNA 3GA5A 4N3BA 3H83A 3DBIA 5FI1B 4D8YA 3QSGA 2B69A 3PHIA 5EKXA 2DKFA 4RH0A 4G01B 1MTOA 4RJ2A 3FN4A 1SC4A 1FQJA 3DTVD 3IMCA 3M7IA 5HG0A 3RV3A 4DR2B 3CQ9A 4M1QA 4F84A 1ZVVA 5CUQA 5AOCA 5F51A 2J8ZA 4DBLC 3I1JA 4K87A 3UAZA 4AWXA 4ZVNA 2P40A 5JCJD 2YX1A 2ZTSA 5IKEA 3H7IA 5CA0A 2Z8YM 2NSDA 3BIOA 2VF5X 3NYIA 2IOFA 4UM5A 3TWOA 3D8UA 2R44A 5SY4A 3MXOA 1G18A 1XMIA 3FGNA 4PWYA 4DA8A 4F97A 4E5NA 1CF4A 3A11A 4JI4B 5J4YA 2QYTA 4LPSA 2ATIA 5K8JB 1Y0BA 3G79A 1O95C 2NTEA 8AT1A 4G2TA 2JHCA 3TQIA 4C7VA 3OTQA 1BFKA 1KAGA 2ZULA 4MYUA 4IQ4A 4ZDJA 1UBJS 3N2GB 5ALZA 3FOEC 1NBMA 1H1DA 4XJXA 1C1DB 1CUEA 4BO3A 1MZPA 1PGJA 3BE5A 5D6OA 2BM9A 4LMBA 1A9ZA 1BVYF 1Y3DE 2P8SA 2XYRA 3FDJA 5KQSA 3VVLA 3CPEA 1BQEA 4XDZA 1KQFA 5IH3A 3HS3A 3G59A 1GQ2A 3QMMA 4HRAA 1KMQA 5AH0A 2WDZA 3TNFA 1K97A 3BGOS 4M4SA 1G2QA 3PNPA 4WFQA 5DGHA 2PKWA 4KR0A 3VOAA 5D8DA 1S9DA 3VZBA 2JGJA 4PSAA 2XKKA 2O0MA 3BGIA 1FFWA 2ZSHA 3B1JA 2HHJA 2WG2A 1XEXA 3IMEA 5TT0A 4J7XA 2LCQA 3R5XA 3H5IA 3IA7A 4Q01A 4OLHA 2R00C 3T3GA 4KOEC 2FR8C 1QPGA 1M2VA 4W1SA 2EVWX 2WU8A 3D0QA 2IOYA 4Q3EA 3K6JA 2AN1A 4GOKA 4XD7D 2R5WA 5B6JA 3G02A 2W93A 3T0FA 2IU6A 3JD2A 3NC1C 1Y42X 1TQ8A 2IYTA 4BFTA 4IO1A 5EUMA 1Z4QA 2PD4A 2G6TA 4B09A 5HIAA 3KD2A 3ONWA 4B34A 3AEQB 3EAFA 3W8RA 1FS5A 3LO8A 1FQWA 2DZDA 1VL2A 2JAPA 3BRSA 1EFPB 3RG2A 3CVOA 2WILA 1XQVA 5LSAA 2YJ6A 3H11A 2QGNA 3LBAA 4MV3A 4E22A 4LJ8A 1XCGB 3RIGA 2YH2A 2AS0A 2BOVA 1AKVA 2R4TA 3WMEA 2UUCB 2O2JA 4PTLA 3FHTA 5L3SB 1U1EA 4GI2A 1NVDA 4IMRA 3VSCA 5AT1A 2ZSIA 3VPSA 1IMOA 3NIDB 3AP1A 1DC8A 2C04A 3PHCA 4WH0A 5JZBA 3IULA 5CW2A 2DH5A 2O59A 1A4IA 3JALB 4DEYA 4DCCA 2O4CA 2Q28A 2RC5A 1UBUS 3OZWA 5CT8A 1H4TA 4DBVO 5KMGB 5I51A 2ZUSA 3QP9A 3TF5A 5DT2A 1XBTA 4IW3B 1O08A 1E8MA 3FF4A 3K6RA 4UHKA 1E92A 2Q3BA 5LWQA 3KUCA 1SC9A 5BQXA 4NBLA 1M34E 3G8DA 4I6EA 5IHPA 2HAEA 4Q3CA 2PLAA 1KI9A 1PJLA 1G20B 1CHDA 1PJCA 1TZCA 1KOJA 3DXFA 1Y80A 2YWEA 4MVJI 4AFNA 3B1FA 2RSLA 3CBGA 3DLPX 4HFRA 4I6GA 5AK0A 1QHYA 1XF1A 4M0CA 2XUOA 3IVMA 4EW2A 3OX3A 4AF7A 1LTKA 1FW8A 5T4BA 4BNGA 1Z0ZA 3COWA 1E7YA 1VZ3A 3OWOA 4URHA 3WZLA 4TWZA 2VDWB 3KFVA 5FTNA 1O95D 3MB5A 1PYOA 3KP1A 5FUXA 3EEIA 2PUGA 2XNDA 2OGTA 1Z2CA 2VDNB 3C74A 1A7KA 3A1CA 1JLKA 2VNAA 4DMHA 5JBQA 5GADl 1ID1A 4W1RA 1K5PA 1OT5A 5BN3A 1DCFA 2GLTA 4P7JA 3PF9A 1Z4NA 1IOWA 3KYBA 2NZXA 3LYAA 4KN5A 1WETA 2GXAA 1GUYA 3RVNA 4YUXA 1IY0A 3T9CA 4IUDS 1NJ1A 3DZKA 4D9MA 1UOQA 1RQGA 3PJGA 1Z2EA 5DLYA 3WJ1A 1RI4A 3LQ4A 4RE6A 3CISA 4WLNA 4IDAA 1QQAA 3GJ6A 2EJCA 3FPFA 1N57A 4AJKA 2O1EA 4DV6B 5IDXA 2Q41A 4IX9A 1IJBA 3ODGA 4MLPA 4QUKA 2SICE 3Q98A 3UBMA 3WK5A 1SXHA 2WUVA 2XXJA 3IR5A 4RDIA 3MD0A 3EFHA 1UKCA 3KQOA 4J29A 2IF2A 3DL4A 5IJ9B 5EPOA 3PV0A 4H3VA 5JW6A 2ONYA 3PT5A 2ONJA 4PG6A 3OJXA 1RXVA 2ZT6A 3FETA 3KEMA 3T61A 5FBHA 1QUFA 1E9DA 3WHIA 1QE5A 1FDUA 1W8IA 1UJ4A 4DPLA 2Q8PA 4HRYA 4FYVA 4RGYA 5TVKA 1JHOA 3SHWA 1U81A 1UT6A 1K63A 3N2IA 4RAQA 4ALJA 2DQ4A 5B7GA 4CV2A 4L08A 4RK0A 4TYNA 4PPNA 1YB2A 3EQ6A 3GZNA 3KWLA 2R3SA 2GYWA 4YONB 1DFGA 1XU9A 3E4CA 3L4EA 2CLHB 1NDHA 3DP9A 4JL5A 3SIPA 2JFYA 3NDPA 1GKIA 2FPPA 1EJ6A 3DYVA 3K05A 1W4AA 3VPFA 1T36A 1G66A 4MI9A 4OFBA 3HKBA 3VVMA 5BNZA 3F6EX 4FOOA 1XA0A 3CRVA 5DNCA 3LUBA 1ZYUA 2PM8A 4R7ZA 2ZBVA 1Q74A 4AY4A 5A9SA 3GDGA 4RE5A 4I36A 4YMHA 2WM9B 4TLEA 2J08A 1GSOA 3UN1A 4A2WA 1X70A 1GPNA 1ZISA 3ZKAA 1N5KA 1EWTA 2J3MA 2P0AA 4FZJA 4IHKA 4OHFA 4XI9A 5L3RA 5IT4A 3G8BA 5JAHA 1THTA 3SYLA 4TL7A 1OFVA 1B0UA 1A8SA 3B51X 3JPWA 1S96A 2N75A 4K3UA 4PLWA 4BRWA 3HVHA 1CJKC 2BEWA 3BJRA 4H31A 3PI6A 1U1CA 2J9RA 3RT7A 1N9ZA 3DEHA 3F4BA 4Q3LA 2JLVA 1EK1A 1Z3CA 4TSKA 2LKCA 2VWQA 3SEFA 1Q83A 4E3WA 2F3RA 1WLSA 2FE4A 2H3HA 2Q1XA 5JVDB 5KCMA 1FQOA 2HDOA 4KP7A 5LBIA 1E1NA 2VSYA 2C61A 3F3YA 3SP1A 4B35A 3BIJA 3LQKA 4JXKA 1JEJA 2X8JA 5TQ2B 3BHIA 2GZSA 5JPCA 3KHKA 4KMOA 2BISA 4M22A 4BJ1A 5ALEA 1XZIA 2P5TB 1X0VA 3FNFA 1C8VB 4BHTA 5MHTA 1V48A 2YL2A 3O26A 1JX6A 3A4YA 3D4IA 2OGSA 3OQ1A 3UXYA 2IHTA 1HT1E 3ULKA 2JK0A 4BPBA 4PHFA 5I7RA 2POQX 3BQNB 1FP6A 3CW2A 2NUBA 5LD2C 1Z6ZA 3FPCA 1VC2A 2EP8A 2MINB 2XB9A 4MNTA 2OHGA 3LSYA 4MQ4A 3W78A 3TEMA 1I3KA 2CC2A 2IYNA 1YDHA 4GYJA 4FONA 4L9AA 4QU5A 2CJXA 2XAUA 3VNBA 3QPVA 2YHSA 1N7GA 1TU4A 2IHZA 3WYNA 2P2SA 3FI0A 3H1GA 1GOTA 1DO2A 1USKA 1ZJZA 1CUHA 3KOUA 3Q7RA 4DTCA 5JDIA 2BYTA 1NYLA 4C0LA 4E70A 3FKSD 1N0VC 4ZQFA 3RPEA 3F8TA 1EGAA 3KQSA 4PFSA 1QBKC 3DKKA 4FK8A 2XVYA 4QYSA 3SZ3A 1QMPA 5KC9A 5H4HA 1TZ2A 4K9OA 1J8YF 2Z9BA 4K81B 3U7HB 3EG9B 3PVCA 2I78A 4UZFA 1M6HA 3IC5A 2WSYB 4Y1GA 1R8JA 2PSFA 1M2GA 1SIWA 1YR2A 3IB3A 3L0CA 4MRAA 3G8CA 4PCAA 3TR5A 4RVHA 1FYWA 5DN6A 1OAKA 3GJQA 3LC7O 2OMKA 3FH0A 1RMQA 4GNRA 5AYVA 3SVZA 2BM0A 3D6AA 421PA 2PZJA 4Q6WA 4UD2A 1N6NA 3E5MA 4EG1A 2B6NA 2MT9A 3VV3A 1ZJJA 2I2WA 1XB2A 5FQNA 2EX4A 2GN4A 4P7FA 1KE2A 2C96A 3TRJA 2TECE 3E8MA 3EVGA 5EHGA 1CUXA 1GEEA 3L6CA 4J0QA 2MR6A 2FY8A 2CK3D 2W8BA 2QLBA 5CP8A 3BRQA 5BT8A 1NLFA 3G8AA 1L8OA 1RRMA 4O3MA 1JQLB 1U2ZA 1LDMA 1YFZA 1JALA 4HLUA 4G63A 4CHTA 4UM9B 1ACMA 1C2YA 2NZWA 2K6GA 3IMKA 3KS9A 2OGWA 4YACA 1GG5A 2GHIA 3IQWA 1SXIA 1BQ4A 4FMBB 3UAYA 1XEXB 4OUDA 3HK2A 1EUCA 4KGXA 3T3PB 1XDUA 5IN4A 4G9GA 4MWDA 1X7DA 1O6BA 5DM2A 3K30A 4UNSA 4EJSC 1K4KA 2GCEA 5SY6A 4DUGA 2JIPA 5JS1A 3IBCA 1E9SA 5U4QA 1BDJA 2E4XA 4OH7A 1GTRA 3DKVA 2D13A 4H7HA 1JFRA 4LBYA 3HB7A 2CVOA 2I3AA 2VYQA 2O5VA 2BH2A 2YIVX 4MGYR 1YVEI 1KVUA 2C5GA 4IZOA 3SXPA 4CMBA 1KL7A 1RYBA 1ZESA 5JXJA 4BKMA 2P6NA 4F2HA 4PO1A 3WTBA 2J5QA 1XCOA 4LFCB 2ZYWX 1Z9BA 2YNMD 3MRTA 5DLDA 2DE0X 4UTPA 3G89A 1MH1A 1V4NA 3EISA 1VLJA 3BGWA 3L0YA 2ZS9A 4WVLA 2FUG6 2ZJ8A 3E3AA 4WA8A 3TVYA 4WLFA 5DM60 2CHEA 5LQMA 1Q0QA 2PV0A 2OCKA 3IUNA 2M1ZA 5JCXA 4ZO8A 1FJ2A 4YRBA 3HB4X 4IJKA 1FL9A 2PAFA 1E3IA 1EVJA 5ER6A 4MB6A 3W5UA 1T1EA 3AH8A 3ESCA 3KWFA 3ZLTA 2CCGA 3VU0A 4I08A 1D07A 1FP1D 3VKFA 2VP6A 4CFYA 2ET6A 2GRUA 2GKGA 3HJHA 4QEDA 3K0CA 4KW7A 3SYTA 5A5VA 3JAMA 2FSVC 2QD3A 4OMUA 2LP4Y 3H6GA 4BVLA 3T4XA 4Y2XA 4ZHQF 2ADOA 1HKUA 2ZUEA 2O8BA 2J6HA 3CR3C 2EDAA 3QQ5A 2IA5A 1PTJA 2HX1A 4BX0A 1GRVA 1XMOB 1VPEA 1OU0A 1XVTA 3HP4A 4TV9B 5CRIA 3UK1A 4BMDA 3AVTA 4TKZA 1W35A 1PDOA 3LW7A 1XTBA 1YS4A 4XCXA 4Y2PA 1Z12A 1BGXT 2YFHA 1G19A 3OZIA 1M0EA 1ORHA 4KSBA 2MYUA 3DBLA 5AOAA 1GXSB 2JLQA 1TVEA 1NXSA 2BEUB 3N2EA 1IN7A 3KPJA 4YI5A 4R2LA 4H1UA 1CR4A 4YJ3F 1D5CA 3JVIA 4DY4A 5KJFA 2EZUA 4G0NA 5TQ0B 5K8TA 3QFRA 2JIQA 3NEYA 4RIFA 1XN4A 4Z86A 5KU1A 4ZMBA 1ECCA 2HWYA 2YYYA 4PYMA 5CCXA 1O4WA 4S1VA 3GLGB 1PJTA 1OI3A 1SKYE 2UVPA 5J5VA 1MJGM 3RG8A 3W8FA 3NPMA 1AUXA 5EWJA 2IHYA 2WZDA 4J4TA 4OB7A 2H63A 4B3BA 2I8CA 1S4MA 4WK2B 4D3DA 5BN3B 1KMIY 2P77A 3IQDB 1I2BA 2V6MA 4R98A 2DBQA 1KK3A 3EF1A 3NYQA 4N12A 3UF0A 3QFFA 1FVOA 2OD2A 4NNOA 5JSFA 1EGHA 2CLDX 3GY0A 3OIVA 3QVOA 1E3TA 4EDFA 2WT4A 4N48A 1DQSA 1YCHA 1ZNQO 3JXEA 5EIFA 3EGXB 3L0DA 4CLOA 1VCIA 4M37A 1PUXA 1L7RA 1G7TA 4X1OA 4I4CA 3OKPA 2X0JA 1F2DA 1RHUA 2HM7A 1PLJA 2YASA 4KE6A 3RR2A 5JD6A 1SQGA 1L3BA 4A1OA 4E14A 3GDOA 3BXFA 3DV9A 3PA6A 3QKUA 4NU5A 1KQ3A 5LMUB 1L7PA 3E9RA 4Y0VA 3Q3EA 3JQ7B 2QMOA 4RMJA 3BZBA 1P6XA 1VHTA 1M1ZA 2X1HA 3H0KA 3L8EA 2KJQA 3R77A 2E48A 1SU7A 1XZ8A 2FSGA 3TQTA 2X3UA 3NONA 1HE3A 3U9TA 4DV0B 4G5RA 2RI1A 3V7UA 2HQBA 5B12A 2B8JA 2AQIA 3B3JA 1E59A 4TRMA 2LZ0A 2P65A 5LQJA 4X3OA 4YJGA 1DTEA 1QP4A 2GB4A 4Q9IA 2HA6A 1ZKDA 3QEJA 1WZ2A 3CRNA 1M2HA 3V4ZA 3FGPA 1E2FA 3RNOA 3VYUB 3KXPA 4GKVA 1ZZEA 1SUFA 2FPPB 4BVJA 2OL4A 4DLKA 1T36B 4CCSA 4FINA 1VG8A 2W71A 2I2AA 1ZGZA 3C5WP 5CIWA 3RC9A 2YZNA 4LSGA 3W4KA 1ND6A 1WBJB 1W2GA 2P3QA 4R8LA 3U7FB 3OFSA 4QXRA 1UDAA 2CKMA 2ILTA 2DWPA 2V6IA 1R9NA 2V9ZA 3QLVC 3D4OA 4YMUA 1WQ1R 3IKVA 2V54A 2HRDA 2R11A 3QE3A 4JGIA 3TL3A 1EA7A 4TWBA 3FPAA 3CX8A 3KJZA 3T3NA 3DE5X 1SU4A 3W9YA 1WXXA 5AK6A 3ZI7A 2H4ZA 1W30A 4DWOA 1VHWA 1X6VA 2PKRA 1JQDA 3B53X 4IXNA 4XVHA 1KEUA 3LHKA 4BEWA 4KDEA 4ZK2A 4M7RA 2Z09A 4ND2A 4JKIA 4D9CA 1GAQA 2AG0A 2I4TA 3BWCA 1YFJA 1VJRA 3R3WA 1E96A 2A67A 4QGHA 1P4AA 3A9VA 1Z4OA 2PH1A 5C7YA 5M3BA 3IV9A 4ZAFA 2W98A 3WLEA 1W6RA 2BF7A 3CBQA 3I01A 4RVSA 4PAWA 3CO0S 4X44A 4CMGA 1QH8B 4NDAA 3ZLUA 2D1QA 4E2WA 2X8JB 5DASA 4EPVA 3RK0A 3R6TA 1ZUD1 4J1NA 2R4UA 2GD6A 3B2QA 3OF3A 2C8VA 1UUFA 3B13B 3K8QA 4KL8S 5B3KA 1EFTA 2QRVA 1CEXA 5D86A 5KTKA 1JLLB 2X2FA 3HR7A 1NP6A 3QE9Y 1T2CA 2HMSA 2ZB2A 1MVNA 3KLMX 1ZN8A 3WQBA 3HKEB 2FQYA 1XVAA 3Q5GA 3DGEC 4D26A 3HEMA 3OUTA 1FSPA 5HIIA 4DMFA 3M6XA 4D0GA 2QLJA 1YB1A 1Z0JA 1YIOA 1U3TA 3GRKA 1L3CA 3JQRA 4OJYA 4XRRA 3TL6A 5LVAA 4KBFA 1SAYA 2FKAA 4ZVLA 4C9BA 1QZUA 4J07A 1I9GA 2IHUA 3DDCA 3N8GA 1K1EA 2CL0X 3IRUA 1P1CA 4Z49A 1MAVA 3O8CA 2P69A 3MGAA 1YHYA 1P2GA 2GPSA 5CIQA 4CM5A 3LJKA 5FOSA 2Q3HA 3QX3A 3CF2A 2Y77A 2V6BA 3UA4A 1NWHA 2WTXA 3BFVA 3LX5A 1OH6A 1SCKA 3N0TA 5JPIA 4A8JB 5DZSA 4GBJA 4EVQA 4F3CA 2MIIA 3B6MA 1W76A 4I1RA 3AM5A 1SURA 2DBYA 3E7PA 4YJ2F 5JRJA 3ZDXB 5IZ4A 4DXDA 4D96A 5CG2A 3VSAA 1L4YA 1Y3HA 2B0JA 5D3MA 5CITA 1AKMA 1YQTA 3FLEA 4S2UA 4YIKA 5E1DA 4DIEA 3VPHA 1RW4A 2PZFA 2C58A 4V02A 1SCQA 5IN5A 1HNWB 4BB9A 3RU9A 2PANA 1LDYA 3QYJA 2ZP1A 1COWD 3B9QA 4C7BA 1H2BA 1MOPA 4YT8A 3IAAA 3IV7A 3C3BA 4CUZA 5I7UA 4ZOLB 2QS9A 3AX6A 3OJWA 2NU8A 1UFKA 3E6AA 1KDZA 4DGSA 4EITA 2Z8XA 1ZD3A 1Z5UA 3H1PA 3M89A 4IJQA 1HMYA 3CPJB 2CJWA 2JD0A 3A9UA 5GGXA 3SY8A 4F2DA 4ZFNA 2OKGA 1WMEA 3GAZA 2H29A 2CHUA 2IBTA 3CNBA 2IPLA 2QB5A 5ECYA 1R5JA 2Q6LA 3BXGA 3PPYA 1T8WA 3KYDA 3UGJA 4R1MA 4XLTA 1XZPA 4OUDB 3QLTA 4WLUA 1EUCB 1TGYA 2MSCB 1UJCA 2QN8A 3J7TA 2JCSA 2V7GA 1KZ1A 2W22A 3DR3A 3LK6A 2BW0A 4GVPA 1H6CA 3LX6A 2OCPA 3P0EA 2JZCA 2IHJA 3KAQA 4P5DA 1F51E 3IE1A 4V0LA 4OXNA 2H16A 4BTLA 4BQFA 1DJQA 3RFVA 1ISFA 1I0ZA 1SUEA 4DUPA 3WNZA 4F04A 1IEVA 1PV4A 3M2TA 3M6FA 4EUNA 1RKXA 2E3JA 2EX0A 1DEOA 2B3TA 1X38A 2HCTA 1UJ6A 4ME6A 4RA6A 2NSJA 4QYIA 1OGIA 2BHSA 1UBGA 2ZU6A 1UK9A 3RT9A 1UWKA 1L4HA 1JA0A 1QC5A 1T5DX 3DW1X 2CYBA 5IHXA 1CR2A 4U7HA 2ZWOA 3DL2A 1OTHA 2Q4RA 4WY8A 3L6DA 3M4NA 3COJA 3ZIUA 3I12A 3O91A 3X2SA 2H4FA 2ORWA 2R4QA 3DB1A 3K0HA 4IXMA 2Q49A 4W8OA 1P81A 3O93A 2C1EA 4L1KA 2YFYA 4WFJA 4RXTA 4JC5A 4Y2QA 3E0QA 1ZRMA 3PIRA 1WTAA 3RCBA 3UQYS 2RAVA 3I2KA 4NPAA 2NVUA 1P4JA 1C3EA 4NE2A 4PGGA 5CFOA 2DBZA 3R3YA 1FNNA 2XE4A 1QG4A 2P6UA 4RQUA 3IHWA 3DKRA 3HZZA 4EA6A 2I3GA 3KYIB 2XMRA 4MUKA 1GV0A 4CLEA 2HMYB 3AF3A 1BSVA 1CUAA 2WFLA 3BN3A 4IEFB 2P9TA 3BA6A 4I8XA 5J59A 2PTGA 1C7IA 3AEUB 3T9FA 2K4MA 4ZHQA 4MVJM 3G0BA 4BU1A 2PZMA 3PR1A 1GU1A 1KNXA 3EIHA 4P4SB 4Q93A 3RYFA 5FXMA 1U8EA 2C5HA 3IQIX 1W0KD 1MCZA 4HD8A 2K7ZA 3PXCX 3T3DA 5TY0A 2E87A 1Z3IX 3DBLB 3SJZA 2GFIA 4KIJA 1KHTA 1Q95A 1YL6A 3IOCA 1KERA 2BTOA 3MJEA 4MW7A 1HFJA 5DTJA 4AKSA 3QWFA 5EHQA 4FQ7A 721PA 3L8FA 2HWWA 4H6PA 3WSTA 3IP3A 3ED5A 3OM9A 1OZGA 2R7LA 4YN3A 1T43A 1Z7BA 2G0NA 4GX1A 4JUAA 4YJ3A 3ZCXA 3ZBQA 4CTNA 2OCYC 4FBGA 2XMGA 2PS0A 2FJ0A 2UVPB 4ARCA 3F1KA 1W44A 1XTTA 4MWGA 3SPXA 3DT8A 2XQKA 2LUOA 1M6VA 1H23A 3FCYA 3NT4A 1BMFD 4FFBB 3VR6D 3U7RA 4YMGA 3Q5DA 1E3WA 1PLLA 3H9EO 2OBLA 1YDWA 4J8PA 4QA9A 4C7XA 5HVNA 3ANSA 1FIUA 3H65A 3FRHA 3E9EA 2OSVA 3NC0C 1E79D 1R6AA 5HDQA 1KPIA 1TTQB 2QZZA 3CZ4A 1LGYA 4EY7A 4QVGA 2DCMA 2WAOA 2RH9B 3O8NA 3G8YA 4MITA 1X1AA 3EZNA 4JB0A 1VA5A 4M54A 4CLOB 3HCAA 4YMVA 1F3LA 1IVNA 2Q62A 2ATEA 2X7HA 3HLKA 3TEJA 4UQLA 1YGYA 3RUDA 2FPGA 4NQRA 3UWPA 3LVQE 3WGLA 4QYMA 5J3JA 3EUWA 3O6VA 4U6QA 4KMRA 3SFTA 4DLLA 4DLWA 4WKPA 4F3KA 3GLIB 1QP0A 4FCVA 5DISB 3H5NA 2WPDD 3JQGA 1NGSA 1UXIA 4UTVA 1W0JA 3V7FA 2FW7A 2WJZB 2QU8A 2X41A 3FYDA 1TPYA 3NQ41 5DBEX 3ZHQA 1Y9DA 2PQ0A 3QEAZ 2H5EA 1QG6A 3CEMA 3VZPA 2BM1A 3SDZA 4TTAA 4MV1A 2PSEA 3JCZA 1IQPA 3I30X 3GZTB 5A5GA 2X0RA 2Z3WA 3EGEA 5E2AA 3U37A 3P9CA 5ICGA 1RWBA 4I1UA 5EIBD 1U1FA 4UUQA 5A3QA 2I55A 2PWBA 2OK8A 1PWHA 1NC3A 2I03A 2NU7A 2YMLA 1KWKA 4NU0A 2VJMA 4PVCA 2I80A 3H9CA 5KX5F 5COAA 3NV7A 4GBGA 3OLVA 4I2VA 2OFFA 2AF3C 2WEKA 3WRYA 4B4DA 1Z2DA 3L5KA 3MUNA 1DCKA 5BV0A 1JE0A 3AONB 4MMXB 2AFRA 1OA1A 3WP1B 2C57A 1WVGA 3T7IA 1USUA 1J99A 1GG2A 1ZO8A 2FGJA 5BQPA 3O8QB 4EKYA 1DOZA 1XAHA 2EHJA 2WYHA 4BMYA 5KYKA 5FP0A 2JB9A 2FPMA 2W2LD 3KSDO 2O2EA 1C0PA 4M0EA 4O2LA 4NU6A 2OCDA 1RKVA 2XB8A 2HRQA 3N70A 2ZVJA 4MWCA 3AKEA 4PC7A 4COOA 2HMTA 5H59A 2GDZA 1T3SA 3D7RA 1PZHA 2IWHA 1YVPA 1TZMA 2C84A 2IYUA 3IAXA 3H5AA 4KJXA 5CNIA 2NZUG 1U2SA 3KB2A 4FGZA 4BDTA 1APBA 1Y3IA 5DCUA 1EP1B 2VN8A 5DGXA 5DNAA 3FBWA 5K3BA 3U4DA 4KMSA 4IKPA 2CFCA 2XBLA 3C4QA 5C1BA 2D8MA 4QDXA 2O14A 4LJ5A 3R7NA 2BFPA 4HUTA 3OY7A 3S29A 2FF5A 2Q99A 2V8OA 4CFZA 5AM4A 5AVZA 1EFRA 4JLAA 2NU9A 1Y7TA 2V96A 3P9PA 4BNFA 1RXSA 4EB0A 4FM9A 3LFTA 3EEQA 3F78A 1CUZA 3K1JA 3UB2A 4QBFA 5JAZA 4FBLA 1GEGA 3O2JA 4MAMA 3CWZA 4I3GA 2VPQA 1CERA 5F1KA 3WLTA 3CX4A 3SKXA 3BMOA 1UEIA 4G5HA 2BM8A 3VKUA 2P2CA 2O0LA 4PGMA 3QQPA 1OR8A 4B6OA 2I1VB 4RTKA 1H22A 3HJTA 1SCAA 1TCUA 3F49S 3KAPA 1WUYA 4MRRA 2Z4SA 4URFA 3GBVA 1VIYA 5DI3A 1ZM2A 3Q1KA 2HNKA 3L5OA 1CUWA 5J5CA 5H5JA 1A9YA 1XMSA 3LCCA 5JDCC 5JSKA 1UEJA 4RPHA 3AFHA 4AAYA 1ZEMA 1JQAA 3KZOA 4MW2A 2QN2A 3MBOA 3U7QB 2JS7A 4DZZA 5ADVA 2EFDB 1MBZA 1SVSA 1X7XB 2EW1A 2VTEA 3K31A 4ZD6A 1C3XA 1UBKS 2PX8A 1WXIA 2QQ0A 3NH6A 4OEHA 2DGDA 3KTDA 1Q12A 4Z4IA 5ILQA 3OA0A 1U6KA 4GLJA 3OIYA 4B9AA 1U7HA 2UVQA 4QBGB 1IB0A 5HJ2A 2WWXA 2VRNA 3E05A 4YRCA 4IGAA 4M1KA 5L9AA 5HM6A 3GLIA 3UHOA 1FYDA 1FJXA 4V0NA 1EWKA 3ENVA 3PHHA 2ZWPA 3LOUA 1QM5A 4UMDA 2AW3A 3GWZA 2G1AA 4RJKA 5LZ7A 4HPWA 2WWFA 1AB6A 2VO1A 2L17A 5EJIA 1FPMA 621PA 3CPSA 2DYKA 3PUHA 2IFTA 2R2AA 3C3KA 4ER0A 4YJ2A 1KY5A 4ENTA 4TQGA 3IP6A 4IIDA 1JWLA 4BX9A 4FYKA 5BVGA 4J0HA 1JVSA 1OROA 1YCGA 3PDHA 4Z9YA 1EQAA 2JC3A 4HH4A 3U4CA 4DR4B 2DWUA 2F2TA 3HB1A 1G6KA 3I6YA 3JYLA 3WR5A 3V2GA 1F0KA 1R0YA 4IDPA 2VK4A 4DIBA 1PUJA 1DBIA 3MINB 3HZOA 1CJTC 3W6NA 2X8BA 4U02A 1HZZC 3CA8A 1KI6A 4G1FA 3OVMA 4IGFA 4UHDA 2O3JA 4XIGS 3ZHOA 5AVWA 1S1MA 1VRWA 1Z2AA 3KYDB 4FN4A 1T25A 4J2HA 2AEEA 1TIBA 4OATA 2X5JO 1S2GA 3K0AA 2YZKA 4RZIA 3W8NA 3GL9A 1T8PA 2F62A 4BXOA 2WF6A 5HF8A 1Y6QA 5KTOA 3GA7A 1GA1A 4X1KA 3T3MB 2O8VA 1HY3A 1W4CA 4DSZA 1VP9A 5CMLA 2XEXA 3FKQA 3OCCA 4YGYA 2AG1A 1CC1S 5LMCA 5HX7A 1MA0A 4ZI7B 5KHLB 2X8AA 5IK2A 1R8QA 2GRJA 3LDHA 4LZNA 3W4JA 1EYZA 1ULUA 4MQLA 5I9IA 3ZGZA 2P9EA 4L5AA 1CRPA 4RA6B 2H1RA 3CV3A 4QYIB 1XMQB 1FDOA 1TGVA 3LF1A 1J8VA 2ACKA 2YRWA 3U4HA 3LAWA 2X4DA 3CRMA 5JO0A 2ARKA 3UHFA 5T8KA 4A82A 3LHSA 2COUA 3AXSA 4L4UA 4YASA 1HTTA 3BS4A 3O8BA 4JA0A 3LA8A 3C8HA 3HWX1 3F8WA 5FTKA 5K3CA 3AGPA 5FUMA 2D59A 2ZCUA 1KS2A 2RB5A 4KVAA 2E4VA 5HFJA 3ZNQA 4ZYVA 3VYRB 3MTDA 2CBXA 1ORDA 2VT6A 1OFTA 2CNKA 4NOJA 3NATA 4B87A 3B1KA 3SM9A 1C14A 1R0KA 1YC2A 3DAPA 4NE7A 4CDRA 1N36B 4DDVA 5ISMA 1G8KA 1H3NA 1R50A 3B7PA 1NM5C 2QTGA 5I9MA 1NE2A 1NOIA 3QK7A 3SQNA 4DDWA 2OEPA 4ZCTA 4NJOA 1IBRA 2FRXA 3QY0A 4IMJB 3K2EA 4MQFA 1OXXK 2J6IA 2XJ4A 3CH7A 4ZHQB 5M5BA 4AJ1A 1JHQA 5ALIA 4XX0A 3RYFB 1K27A 5JS2A 4LQCA 4MMZB 1SEPA 3B6KA 4KIGA 4LK2A 3L7KA 3K0EA 4HDCA 3VR5H 5IWAB 1RM4A 2BJWA 2X19A 2VWHA 1BCSB 2X15A 4LJYA 4C20A 4N03A 3NHZA 2MHCA 4Q1AA 1FRQA 4CIXA 2E55A 1ZC3A 2MDTA 4LXHA 1YBVA 3JQ8A 2WMYA 3V2IA 3ZPXA 3RSGA 1RWQA 1T5IA 3I3OA 4I5DA 1TYDE 1KU6A 1UC5B 4QM7A 4MVCA 1MG5A 2W42A 1E0JA 2B8EA 3RV4A 3TVTA 4IXWA 1MGOA 3EIQA 4Q3NA 5EFZA 5JALA 3KETA 3ZDBA 1X8XA 1EK2A 1MD9A 5J58A 3W34A 2C31A 2J32A 1PGNA 3Q3GE 3EGWA 2PE5A 4QQRA 3CVYA 1SHJA 3JZFA 1M6VB 1UKAA 4U1RA 5BWLA 1A4UA 4Y2RA 1E3WB 3IELA 4N0QA 4MRVA 4FFOA 4YB8A 3GEIA 3U7EB 3G2QA 3K73O 3QXJA 1DKMA 1OLUA 1CETA 1DP4A 1RYMA 2JGFA 4KWCA 1I1QB 1QTIA 3CNEA 1M2OA 1Z18A 3LUJA 1TM5E 2IW3A 4IJUA 1EWVA 4JP2A 5DPMA 3E9QA 1DEAA 2ECPA 1BXZA 2X4IA 2XUGA 3A1SA 5DT9A 1Y4AE 1DMSA 4QWWA 2R85A 2QLMA 5FI0B 1I9CA 3ELDA 3C8MA 3OLYA 1XT6A 4L4SA 5IRCD 5BW8A 1JEQA 1OYYA 4M0KA 2W83A 5FUWA 4QOIA 3PKZA 4TL9A 4W9MC 1XXHA 1NBHA 2FPGB 5JJBA 2FI1A 1YFKA 1PGOA 2ZJ3A 2OAGA 2X0NA 3QFTA 5KC8A 4PX9A 3OJCA 5G0UA 3H5RA 4OU5A 4M8LA 5ALGA 5AICA 1ZIYA 3IUPA 4HWRA 4RKFA 2RG7A 2AZDA 3JQGB 3HGQA 1DBVO 4JKYA 1CW2B 5JSYA 3V4LA 3WYDA 5FUQA 2DPHA 3L4KA 1YZLA 2WF5A 1NC1A 3ND9A 2AR0A 5JQGF 2NWQA 2QMYA 5DP2A 4EYSA 1VI5A 4S1TA 3DPSA 4OJMX 2Y1WA 2RHJA 2AZXA 3OE1A 2VYCA 3NGLA 4IM7A 3GNQA 1GFZA 4XUDA 1LLUA 1ZS9A 1NUTA 4GPBA 1Y48E 2NVBA 4H0NA 5IBQA 4BZXA 1HYBA 3BGVA 3TLZA 1KYQA 2GYYA 2OHFA 3HKCA 1O97C 2NU7B 3R0JA 2ZVPX 1TZKA 1MN6A 4BNNA 2AFIA 5K01A 1O0SA 1PF7E 4AZ3B 4ECEA 4C0AC 2NQ2C 4XB6B 5BOVA 1NSFA 2FZLA 4IQFA 4JI7B 1WF3A 1GSHA 3TIFA 4TLLB 3TB4A 2A1TR 4DLXA 5JXIA 3E22B 2CT8A 1SCUB 5DYWA 2M6KA 4QJBA 4ZEXA 4H7IA 4MB0A 3HBJA 1M73E 4XKJA 1K75A 5D5QA 2IY9A 3W5AA 1E7SA 1A5ZA 2ISCA 4RKWA 3D1VA 3R6WA 3DZFA 3DE3X 1S7GA 4MCAA 1SHZA 3AUUA 1N8TA 3NHJA 4KQHA 3F98A 4PAOA 5A3JA 2BFFA 5H9WA 2IHNA 5JD4A 2Q50A 1EAYA 4BBAA 3FLMA 4QSMA 5BWOA 3WI7A 5A3VA 3AY6A 2ST1A 4KFSA 4LXIA 2QE7A 1N2XA 2P6OA 2VQFB 1BN7A 5KAPA 4CV0A 1OAOA 2R25B 3EZLA 4YVFA 1V37A 3PHGA 2VQSA 2PT9A 1N2HA 3LXMA 3KE9A 1WXWA 4ZKDA 2JLWA 4J75A 4CI0B 3L0PA 1BDBA 1E63A 2XCUA 2BUAA 3EDOA 3RYIA 2HV9A 3KKEA 3DOJA 4LYFA 5C8XA 4QBIA 1X80A 2NU9B 4BWGA 2NVOA 1WULS 2C2YA 4HYQA 3RHZA 4ED9A 5IM5A 4NABA 2WT8A 3V1TC 1UKZA 5C7IO 5KSZA 1WMFA 1WXQA 2HUNA 2IJGX 1P44A 5I4BA 3BMOB 4GXQA 1M1UA 4V38A 5I8ZA 1WSBA 4AS3A 1NVMB 1PT7A 5FPSA 5JBIA 3GJRA 2NUPA 4JZKA 2XA9A 3DJYA 3L0BA 4JSRA 4MYSA 2XMCA 5DDIP 3TRHA 3ZY3A 4HAOA 1DZIA 1XXLA 2REQA 1OPXA 1N1EA 5DI3B 5F4ZA 3D3WB 1U02A 1FLDA 4ETIA 4L5JA 1QZTA 1YAJA 2J5KA 2JGAA 2YWBA 3NWBA 5FYQA 1DAKA 4AJEA 4MAFA 1VRVA 1VMEA 2XVZA 4R9SA 4DKXA 2Y27A 3BUSA 2GM9A 2YMQA 3UICA 5F98A 2P5SA 3AM1A 3DEZA 1GUDA 4Q4AA 3SI7A 2MSWA 3VDQA 2PUBA 3AF5A 1N6LA 1L5SA 4M2LA 5CVCA 5GV8A 3TOVA 4RIGA 3DMTC 3IPXA 2CD7A 4AUEA 4R8VA 4FP9A 3A2MA 1XDWA 2F8LA 5C18A 2ODBA 1A69A 3QTBA 4HQFA 4JU9A 5KYXA 1QMGA 5IUKC 4P31A 4LF5B 3SJUA 5A62A 3C6MA 2ZCJA 1T1RA 2D62A 1BA2A 5CFQA 5BSWA 3DOCA 3WMGA 1KJNA 4RHXA 3FFXA 1LX6A 5FWYB 4G3XA 3SF8B 1PJ2A 2P2NA 4LYYA 2ZSBA 1R9GA 4JLDA 3Q2KA 2ZR9A 1JEDA 4QTTB 1FNMA 4KXVA 3QV2A 3KR0A 3BH6A 4UBKA 5KINB 4FTWA 1G5TA 4K88A 1ORVA 4YJ2B 4CJXA 5L4SA 3AW8A 2EKZA 3X1MA 5I3ZA 4LJKA 1J8MF 1IG0A 1QTNA 3TPFA 5BNIA 3QTTA 5CM2Z 4NDZA 1CV2A 3HSYA 4BZZA 2WLSA 1CSEE 4OXRA 3TTVA 1P8AA 1FE8A 1XZHA 1P3Y1 4MI6A 5E1BA 4OHZA 4GYWA 3E9ZA 4HTAA 3WGMA 4L8YA 4AN0A 4ZI2A 3RIMA 3I32A 2ACVA 2X1LA 5E9JA 3UMVA 5CDGA 1O97D 1QIFA 4F86A 2HA4A 1EKXA 1DKPA 2X6TA 1P6QA 2C95A 1M72A 3KALA 4MEBA 3I83A 4MJ7A 5EL0A 4C7OA 3AF2A 4L4YA 2AK2A 1ZI6A 2IYXA 2XGOA 1W1IA 5EMLA 2OFXA 5I5GA 4BXOB 2PO5A 4X1KB 3R7FA 5IZCA 2C4HA 4IIBA 3ADCA 3A9WA 3PNBA 3JQEA 4W6ZA 2W4MA 3ICWA 4YMTA 1R3UA 3MK31 1IJKA 2XY4A 5SZIA 3ZX4A 5L51A 3JASB 3ZGOA 2QPLA 4B81A 5KTSA 1VXRA 4J90A 4R54A 3SZUA 3GT0A 3A4TA 3SX4A 3AQIA 2FUEA 3I76A 2ZIXA 4OKIA 5DWVA 4O29A 4PLCA 3UB4A 3DOIA 5KVCA 2IEIA 2OGUA 4Y67A 2QTCA 4B17A 1S2M