5TIIA

Comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
251
structure length
241
Chain Sequence
ELELGLRGKKALVTGGSRGVGRGVVLALARAGVDVFTCYREESDASASLARELKQLGGDHHALRADLADPKQIAELFQEVGRRFGTLDVVVNNAGVISHVPYAELPVAEWQRIVDVNLTGAHLVIQHAIPLLGDKGSVISIGSKSSEVGIPLRAHYTATKHALRGLTRSLAKEYGRSGLRFNVLALGVVETEAEMTKFYSTKTALGRLGTPDEVAGAVAWLASDLSRYVTGATIHVDGGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-ACP reductase
publication title Comprehensive Analysis of a Novel Ketoreductase for Pentangular Polyphenol Biosynthesis.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Oxidoreductase
total genus 89
structure length 241
sequence length 251
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tiiA00
3F4LA 3FRJA 3H9QA 4TVOA 4BNZA 2EEZA 5JYEA 1H6BA 3TSCA 1EZ4A 3LLVA 4KWIA 5CPBA 3JQ7A 5CPFA 2DM6A 2DAPA 3AK4A 3S2GA 4W6ZA 1WPQA 1ID1A 3K96A 3RUCA 3R6DA 4UUOA 2NNLD 4PG8A 4D3FA 1JTVA 1B8PA 2HMUA 4MKZA 1SBYA 1KY5A 1U2GA 1PSDA 2J5KA 1HZJA 3RUDA 3A28A 4CMIA 3MEQA 4GKBA 1P45A 1WDLA 3L9XA 2VCYA 1A71A 1JA9A 2A92A 4JP3A 2CF6A 4E21A 2CDBA 5L51A 1LSSA 1EFLA 1GPJA 2B35A 1HLPA 2X7HA 2O7QA 5G4KB 2NVUA 1PTJA 4LGVA 1EUDA 5JXWA 1U5CA 1NM5A 5F1OA 3D3WA 1GYPA 4YAJA 4MIEA 3V2UA 4MVJF 4BNIA 1EVIA 2AQKA 3PHHA 2Y0CA 2ZJ1A 4CV2A 4B3JA 4MP8A 1X1EA 3IJRA 4QEDA 5JMWA 1ZEJA 3GK3A 2AXQA 1P74A 4O6VA 5A5FA 3C1AA 4PLZA 2R00C 4TZTA 2UV8A 4E12A 3RC7A 3BXXA 2ZATA 4Q3CA 4BO4A 4KUHA 3WG9A 1P1IA 1DIAA 4OXNA 5HS4A 4RQUA 4RPKA 1GADO 2FZWA 1E7WA 3DFUA 2VZ9A 3FR8A 5IXSA 2BRUA 4D3SA 1YJQA 3RBZA 4XR9A 3RFVA 3OETA 3PRJA 3WFIA 3WYBA 1H94A 4A10A 1QYXA 4CUKA 5L3ZA 2JD1A 3B1JA 3GR6A 2I67A 1J0XO 1QYWA 1M2WA 1BMDA 4O1MA 4WASA 1QRRA 2OXIA 1V35A 2VT2A 4YB8A 3WMXA 2WYWA 3BTUA 3JQ9C 3DXFA 2Y66A 2ZCUA 5ICSA 3E6AA 4P4LA 1EE9A 3GPDG 1MXFA 4DWVA 2IYPA 1UDAA 4K28A 5L7YA 5GZ3A 3HN7A 4FFNA 3JQ9A 1ORRA 2Q49A 4G81A 3DQPA 1LQTA 4TMFA 1B3RA 4EYEA 2IZ0A 1KVSA 2VWQA 4HP8A 4KDFA 1R0LA 1UZNA 3BHIA 1N2SA 1NVTA 3R3SA 5JDCA 1LDEA 2PGDA 4Z9FA 1B2LA 1DOHA 2Y0DA 3WIDA 2VYNA 3DMYA 3ROQA 4MJLA 2I99A 1ZEMA 3BTOA 3PYLA 4YRDA 1ONPA 1PZGA 2NU6A 3HJAA 3PK0A 1XELA 4WCFC 3QV1A 1K3TA 1EDZA 3P19A 5ES3A 1DSSG 3H6KA 4YJGB 4IPTA 3LF2A 2OBYA 3AM4A 3VOSA 5AOVA 1E7SA 3I9JA 5IDWA 3V8BA 3GNTA 2RH4A 3JQFA 1ZXLA 1UXIA 3T4EA 1B8VA 3ETDA 1MB4A 1T26A 5AXBA 1S7CA 4J1SA 1E3WA 3KB6A 1BXGA 4KDEA 3DBLB 4H15A 4LRSB 1ULUA 3TFOA 2CVZA 3CZMA 3E03A 1E1MA 2X22A 4CQMD 4TRJA 4FN4A 2C07A 4ILKA 1WAMA 4J49A 2J3HA 2Q46A 1VSVA 4PIVA 1X7DA 4M1QA 4CUZA 4JXKA 1LX6A 1NQAO 1ADFA 2BFMA 3DZJA 3AOEA 1DC5A 3PYXA 3C7CB 4YT5A 4I5DA 4OKIA 2J5RA 3QVTA 2EKPA 3Q1LA 2GN9A 4R41A 3ANLA 1PJBA 1XU9A 3DOJA 1U5AA 3L77A 3QRWA 4RORA 5ITVA 2B37A 1KVUA 3VAZA 2RCYA 3M1AA 1PQPA 4M86A 1XSEA 4FBGA 4JN6B 2LDXA 4ZQGA 4D79A 2IZ1A 3K5PA 3JTMA 4ALKA 1K89A 1LUAA 3U4CA 1P31A 5HM8A 2VQ3A 3DC2A 4BNKA 2X1HA 4ZQEA 2EIHA 2GSDA 1BTOA 1UH5A 2BHLA 4R68A 4WLVA 2IODA 1HDZA 1L7DA 3M2TA 3SXPA 4K6FA 1GY8A 1PJLA 4PLWA 4GQAA 2SCUA 2X23A 5EN4A 4IIUA 4OMUA 4UEOA 1Q0HA 2PY6A 4DGSA 3H9JA 4U5QA 4DPLA 3EZYA 3FD8A 3VDRA 2D3TA 4ZQHA 1Y8RA 5I7EA 1PZHA 5B1YA 3ICCA 3CZRA 4IXTA 3L6DA 3TZ6A 5AQ1A 1Z45A 2YQ4A 5IDQA 4IJUA 4RPGA 3FCOA 4UUNA 2W2KA 3JCZA 4KQXA 2QRKA 3C85A 3UF0A 1HLDA 1G0NA 2IDZA 3D4PA 4BNNA 4MVJE 4NFHA 4R1UA 2GDZA 4NI5A 4XYBA 1Y9AA 3O38A 2Q2WA 1AXGA 1PQUA 4O59O 1N1EA 3JQ6A 4LVCA 1DBVO 3GUYA 3N58A 4GLLA 2BGMA 4BV9A 1Z75A 3FSRA 3E9NA 3WBBA 3ZWNA 3KTDA 1SB9A 3DOCA 2NQ8A 3HFGA 1QLJA 5CEEA 3GG9A 1NXQA 3UCFA 4W99A 4RCVA 4DTIA 4P22A 3ZI0A 1Z82A 5U9CA 4C7JA 4G5HA 3B1FA 3GNQA 4C7KA 1R4MB 4RPHA 3OJOA 1UXKA 3WQQA 5CDGA 3OH8A 1U4SA 1GD1O 3CTMA 1LC3A 3KYCB 4DQXA 4RV9A 3H65A 3V1YA 1I2CA 4HBGA 1PZEA 2PKRA 3KEOA 2NACA 2VN8A 2VRCA 5CFZA 1QYDA 2AQHA 3WOHA 4MKXA 3TWOA 4LVUA 2DFDA 2GNAA 1NTOA 3ZWYA 2GN4A 1E3JA 1E7QA 1JQBA 4EUEA 3M6IA 1KEVA 1QV7A 1U3VA 5EPOA 2QYSA 5FF9A 1M76A 2PLAA 5DP2A 4CM9D 1NAHA 3VVCA 4EITA 1Z7BA 3MWEB 1T2AA 5IFLA 1NNUA 4YPOA 5JDIA 2Y1OA 1W8DA 3QQPA 4XGNA 1OI7A 1LC0A 1VKNA 1CERA 4XD2A 4MIOA 3KSZO 1F8FA 3KLPX 4WNCA 1H5QA 4R3WA 2J8ZA 3LQFA 2FY8A 1A9YA 2GZ1A 4TZKA 3ZW9A 3SLGA 3IAHA 4B8ZA 4NBUA 1GPDG 2CF5A 3ENNA 5TSDA 4J16A 2JFHA 4D3DA 4F46A 1QORA 3I52A 1LU9A 1BDBA 4BNMA 2X8LA 2Y1EA 1NQTA 1YVEI 1WP4A 1VPDA 3A1NA 2E82A 1O6ZA 1DB3A 1ZSNA 4BO7A 3WLFA 1ZXBA 1V9LA 3WGQA 4EJMA 3AW9A 3I4CA 4PGFA 2OFPA 4ND3A 1Y8QB 4DMMA 2X4GA 4QO8A 2V6GA 3KRTA 2VYVA 4HUJA 3TZHA 5K9ZA 5ENDA 3NX4A 4NK4A 4FB5A 5IG2A 2AG5A 2EKLA 1KEPA 1PL6A 1T24A 2C7GA 3D5TA 1HL3A 3GZ4A 4NG5A 3GVPA 3LSYA 4XIYA 4FSHA 3HDHA 1O89A 3PQFA 4IDCA 3WFJA 3GHHA 4UAGA 1UP6A 1ADCA 4OKNA 1V6AA 2YFHA 3LZ6A 3GMSA 4KQWA 1KS9A 4W9NC 4WLNA 3FN4A 3GN2A 2C2YA 3KSDO 3OIFA 4R4JA 3U4HA 2D8AA 5B4VA 3O9ZA 1JAXA 4CM4A 3KETA 2EXXA 4CL8A 3WYEA 3RWBA 1ENZA 1JKJA 1ONNA 4RVHA 3DZFA 1PL7A 3PHIA 1ZMTA 2DT5A 2UYYA 2VYND 3KYDB 4W9NA 4BNYA 4BQRA 4Z3KA 5I9LA 3GZNA 4HFMA 1P0CA 3T7CA 2DU8A 1UDBA 4B4VA 4DPMA 2C54A 4PG5A 3JQAB 2CY0A 4CMKA 1YO6A 1DXYA 4AJ4A 5CEJA 3SJUA 5JDIC 1EE2A 1UXJA 2PNFA 4CR7A 1C3VA 4E32A 4TVBA 1YL6A 1YL5A 3MJTA 3KHUA 4J4BA 3DBLA 3EDMA 1YBAA 5H81A 5T57A 2H63A 3HG7A 2JJYA 3ORFA 3WJ7A 3WGYA 3NTQA 3TDKA 3VZPA 4BQPA 1P1HA 1U9JA 3AI1A 4YXFA 5I8WA 4ZA2A 2WJPA 5IXYA 2BI8A 3BIOA 4TRNA 1KC1A 2PGLA 1WZEA 2BGKA 1E6UA 1C14A 1PJ3A 2E6UX 1YRLA 4ALLA 1DIBA 3CMCO 4YACA 5TRTA 2VWPA 4EJ6A 4GPD1 1G0OA 2I5PO 4FIZA 2VZ8A 5IDYA 1VSUA 2AEMA 3ONFA 2JFGA 4J2HA 2BFPA 1HE2A 3RJ9A 4BIIA 4CLEA 1F0YA 3QVOA 2I3GA 3HZZA 4LW8A 4R01A 4Y98A 4HX5A 3RU9A 1PIWA 2B36A 2EW2A 4WKGA 3PZRA 4CMAA 3A14A 2Q3EA 5A3JA 1LRJA 3RAJA 3OIGA 1JKIA 2YQ5A 5TJ9A 1R66A 3EVTA 4D43A 5L7WA 1ENYA 5A05A 2VHZA 1A9ZA 4KOAA 3P7MA 3JQCA 2HU2A 3AUUA 4FFMA 3DMTA 1I2ZA 2FPIA 1DFGA 4L0QA 5L45A 4B7XA 4AJKA 5I7VA 4LMPA 1IOLA 3GT0A 4RLSA 2Q50A 4RZIA 5IN5A 2B4RO 4QXMA 5F5LA 4A03A 2P9EA 1PZFA 1I8TA 5GMOA 2UVDA 2PZLA 4GMFA 4D7AA 5KJFA 1QR6A 1IPEA 1V3VA 2HUNA 2ZB8A 4J9UE 2DBQA 5H82A 3RBVA 3M1LA 4PLHA 3F6YA 3PWKA 5HRUA 2HKIA 2Z1MA 5THKA 1H6CA 3ZHZA 2H9IA 3JQ8B 1ARZA 3VH2A 5CDYA 2G17A 4ZRMA 4GSLA 2O3TA 3ZV4A 3UW3A 1NQ5A 4OQZA 5EQFA 1GUZA 3K31A 3HB4X 1X0VA 3NV9A 4QTZA 5T67A 4XIJA 4EEZA 1I33A 3I9OA 4OYRA 1IZ9A 1C1DB 1O5IA 2AQ8A 4IDGA 1EFKA 5JC8A 2O4CA 4RF2A 4AJ2A 2QYTA 3PI7A 3WWZA 1P1KA 5KTKA 3WS7A 1HETA 1H0KA 4MVJH 3WYCA 1MUUA 4R69A 2QW8A 1GCUA 1HXHA 4FJ0A 3WIEA 4FGSA 2IYOA 4XEHA 1PU2A 3I4FA 3IS3A 3GGOA 3MZ0A 4CLRB 3RC2A 4XDYA 4EGFA 4FGWA 1R16A 4E13A 1CIVA 3RU7A 1AUPA 4IBOA 3OQ6A 1IUKA 2VRCD 1GUYA 4I08A 3A9WA 2FWMX 2FR8A 4ITUA 2NTNA 5F3RA 4NR0A 3UHAA 1W73A 4I1IA 5IZCA 4YYZA 2GZ2A 4WCFB 1C1XB 4N5LA 4J90A 4PLCA 1NP3A 3OM9A 3ZU4A 4CMEA 4ZRNA 4HXYA 3VDQA 3UUWA 5MDHA 3ZWWA 3UOGA 1PGPA 1SEPA 1J5PA 4HFJA 2P4HX 1HYEA 2QX7A 2W90A 2IXBA 3AWDA 5G0UA 2GR9A 4KWHA 1YGYA 4XGKA 2JCYA 4PRKA 1GQ2A 3R0IA 4TKLA 4II3A 4DYVA 3OICA 3QVXA 3EY4A 4E5PA 1X13A 4QSMA 3NEPX 4S3MA 4JLWA 4RDIA 5DCYA 5BSFA 3I3OA 4DREA 1UXGA 2O3SA 3AM5A 4FD3A 1YOVB 1LRKA 1UDCA 4GX5A 1LSUA 1KVRA 3CUKA 5DDIP 1Q0QA 1DJNA 3JYNA 3S2IA 2PKQP 4BKQA 1Y8QA 3C3XA 4B4OA 2A4KA 1JW9B 5JBIA 3H9EO 2EKQA 5L4NA 1ZO8A 3AI3A 3N74A 3JD0A 4OL9A 4ND5A 4IZHA 3PWZA 5BNTA 4MPDA 5B37A 1QYCA 4BO6A 4NU6A 5EL0A 4YJHB 3GFBA 1HZZA 4GL4A 2FOIA 4AICA 2O3JA 4FOSA 3ZNQA 1NFRA 2EF1A 3KLMX 3ADOA 3AFNA 4CV1A 4YJFB 4YT2A 4CMJA 2X5KO 4NK5A 5JO0A 5T8KC 2EGGA 4AG3A 3C8MA 1XYGA 3FNGA 5JMPA 3BMQB 1UAYA 4RJTA 1ZCJA 5AXDA 3ZWXA 3ZWBA 4XCVA 3EYWA 1D7OA 2X5JO 3IDSA 3KYDA 3ZWAA 4IGEA 4DC0A 2EWMA 4Y6RA 3STHA 3B20A 3UH1A 3WQSB 4CM6A 4M49A 4JX8A 5T8KA 3JQAA 3EK2A 2WYVA 2ZIZA 3NT2A 3Q6IA 3RUEA 4CLOB 1LI4A 1JLLA 3OQBA 1BW9A 1HYGA 1SCUA 3DWFA 1E77A 3HE3A 2ZKLA 4KMSA 4PZEA 4WGGA 3D0OA 5FWNA 3IKTA 4R51A 2NU9A 4PLVA 2AW5A 1UAGA 4WJZA 1DFIA 2V65A 1LLCA 5DP1A 4ALNA 3CH6A 4YBZA 2FN7A 3TOXA 3BMOB 2ZYAA 2VHXA 3IIEA 3JQGA 2DBVO 1N8KA 3PFFA 3UICA 3ANNA 4N18A 5A9SB 3JQDA 5JW6A 3ZHXA 1X1TA 3OJFA 3D3EA 3U0BA 4LSWA 1Y9EA 1KERA 1P0FA 2UAGA 1KEUA 1YE3A 2VTDA 2WD7B 3KSUA 4M8SA 1QXSA 2OHXA 2A94A 1PEDA 3IP1A 3FPCA 4K26A 3LLSA 4JROA 4OAQA 4GWGA 1E1LA 4CM9A 4OSPA 3IMFA 1O8CA 2VNSA 5C3MA 1XIVA 4Q9NA 2JAHA 3PLRA 1WZIA 4HNHA 5C37A 2W2LA 2Y1GA 3AY3A 4L76A 4CMGA 4M87A 3P5SA 5JO9A 3NTRA 3GDFA 1NPYA 2FHSA 3NT4A 4FOOA 1YL7A 4GVXA 1UP7A 3GVHA 3HNPA 3V1UA 1YDEA 4AL4A 2HMVA 4IMPA 4IDFA 5IZ4A 4WLUA 2P5UA 2C5EA 3JD4A 4N5MA 2P91A 1ZW1A 5JY6A 3ANMA 1C0KA 3K9QO 1XA0A 3K8ZA 2ZJ0A 3V1TC 5A5EA 5L9AA 5JFOA 4EI2A 1C0LA 1FF9A 3QP9A 1CDOA 2R00A 2Y68A 3SC6A 5L4LA 3H9GA 4ALIA 4FJ2A 4NH4A 5A4DA 2V6MA 4CM8B 2NU7A 2C7VA 1RPNA 2ZYGA 3E1KA 1L1FA 7ADHA 2AG8A 1M75A 4XRGA 3DOOA 3P2OA 4TRRA 4WEQA 3SLKA 5K0ZA 2VNAA 1K6IA 2VHVA 2ZYDA 4NBTA 3WQRA 5CDTA 1XDWA 2P5YA 1YONA 4AJEA 3GC6A 5JYDA 4TWRA 4NDNE 3H5AA 2VUSA 3GDGA 4BGVA 5F21A 3LT0A 4DXHA 1P44A 4FDAA 1I30A 1P9LA 1DLJA 3DBRA 4XQEA 3OMLA 1MFPA 1C1DA 4QUKA 2FR0A 4GGOA 4R1TA 1B14A 3MCVA 1PGJA 1WMBA 2EJVA 3OEWA 3JD1A 2DPGA 3MJVA 1MG5A 5A9RA 1TI7A 1Q7GA 3UFXA 4XWYA 4J91A 3AM3A 3I1JA 5EESA 5BSGA 4NFYA 3BAZA 9LDTA 4D45A 4CLRA 4L75A 3ZWMA 5CHEA 3E8XA 5IF3A 1GYQA 1O0SA 2Z1NA 4KUGA 1E7MA 1EBUA 5DNAA 4E6PA 2X6TA 1K0UA 4CM1A 1IZ0A 1V0JA 2DUUA 4UVEA 2O3RA 3F4BA 1SPXA 4O0LA 4NZ9A 2PR2A 3H2ZA 4WCFA 5CP8A 4XYLA 9LDBA 1CQJA 2RAFA 2HQ1A 4OQYA 5KJEA 1P1JA 5JSFA 3PPIA 3EZLA 5I9MA 3L4BC 2Y1FA 3RCBA 4LCJA 3MJ4A 4BMNA 4BNWA 1GEGA 3CXRA 1F17A 4B7CA 3E9QA 4JBHA 4NBWA 3EUWA 1ZKMA 4ZD6A 4EW6A 1FJHA 1GQQA 4BNVA 4FW8A 3FR7A 3HQ4O 3ZHBA 2IRWA 5CEFA 1NAIA 2HO5A 2Y67A 1N9GB 4ZQBA 2DTXA 1WW8A 1RWBA 3TQHA 2Q4BA 1PJSA 4BB6A 2X5OA 4NNJA 1VJ0A 3PWSA 4TKMA 2XXBA 3A06A 1ADGA 5BNIA 2R6JA 3INTA 4ND4A 3MJCA 2DQ4A 3GAZA 4NFSA 3B70A 2EJWA 3D4OA 2PV7A 4BUCA 1PX0A 5DOZA 1DRUA 2X0RA 2FPGA 4NJMA 2BMAA 3CPSA 5B12A 2H1SA 4BO9A 4MP3A 4E30A 3BZUA 1AE1A 5LC1A 1TT5B 4BNUA 1Q1NA 4YJHA 4YAIA 2OGUA 2J5QA 3K73O 1LNQA 4PRLA 1PWXA 2C5AA 5TGDA 4PG4A 5C5IA 3QW2A 1XQ1A 3K2EA 3JD3A 2GLXA 4CQLA 1E7YA 2YHIA 1OC4A 2DPHA 4YJFA 3UGKA 1NWCA 2VOJA 4IM7A 4PLYA 3VC7A 4L4SA 4IJKA 3PXXA 3F1KA 1YBVA 4D46A 5ICMA 1XQ6A 1ISJA 2JAPA 3U49A 1CJCA 5TLSA 4B4WA 5FYDA 3LF1A 5G2OA 4CV3A 4XR4A 3WR5A 1PWZA 2QG4A 5I8ZA 1YXMA 3W4KA 3FF4A 3KUXA 2WDZA 4DMLA 3D5QA 1SOVA 3JQAD 5DCWA 3VZSA 2WD8A 5F5NA 4Q3EA 3F5SA 4BGIA 3DZKA 1PJ2A 1NQOA 3V5NA 2B5WA 3H3FA 4QFDA 2Y99A 3PDUA 3C1OA 4E2WA 1B3BA 4R54A 2FRDA 4MIYA 2TMGA 3JYLA 4D42A 4EUHA 1P77A 1E6WA 4XYMA 2F1KA 2H5LA 5ILOA 4NJOA 4XB1A 4B3IA 3O4RA 4Y8VA 4BNXA 1PGOA 2AQIA 2IZZA 1SB8A 4WECA 2JHFA 5JLAA 4IXWA 4M54A 3O03A 4BS9A 4MVJM 1Y6JA 1BWSA 3I9KA 4YT4A 2PH3A 1I36A 2CMDA 5A9SA 3BHJA 4INAA 5G0TA 4YQYA 3BTSA 4C4OA 3CINA 4OSOA 2J3IA 3R1IA 3CSDA 4RVFA 3EC7A 3QVSA 2UUPA 1K6JA 2WD7A 2YV2A 4GI2A 1Z7EA 5G4KA 1ZVMA 4ZU3A 3P2YA 1LDGA 1T2CA 4RPLA 1U8XX 2NU8A 3ZV5A 4IINA 2H6EA 4GWKA 4WOKA 3OJLA 3RUIA 4E5KA 1OBFO 1D1SA 2YY7A 1DC3A 1GZ4A 1FK8A 2R2GA 3GRPA 2VWHA 2I9PA 4IQGA 3LK7A 3WNVA 2AA3A 3FNEA 1JVBA 1D8AA 1F8GA 2E4AA 2W2LD 1AXEA 3GGPA 3FHLA 1OAAA 3K92A 3IUSA 3WGHA 1JKFA 3OA2A 3ZV6A 1ISMA 1H9AA 3RIHA 2X0NA 2Q1TA 1U28A 1CRWG 4XQ9A 1E3EA 1HDXA 1K6XA 4J4HA 1YH3A 4YT8A 3L07A 2FSSA 2W8ZA 2D5AA 3KVOA 3E5RA 1KIFA 2BKAA 3GF4A 2AEJA 4CQMB 1Q2XA 2C59A 2D59A 4OXKA 2NSDA 5JAZA 3N7UA 4RVDA 1MA0A 1VL6A 2YUTA 3PGJA 3NGLA 2EP7A 4F45A 4WPGA 3WXBA 4O5OA 1PR3A 3PEFA 4PVCA 4LN1A 2O4UX 5G4LA 1QP8A 3SC4A 5TT1A 5ADHA 2BELA 2P9GA 2PKQO 4OOEA 4U7WA 3D1LA 4AJIA 2RIRA 1H2HA 1NPTO 2I65A 1DIRA 2CFCA 3Q9UA 2D4AA 4EBFA 4DLAA 2V7PA 1H93A 4DA9A 3NDIA 2DBRA 3PVZA 5HA5A 1DPGA 2AE2A 3GEMA 1BVUA 4ZVVA 2HCTA 3K30A 2GPTA 3UCEA 1E5LA 1I0ZA 4RVSA 3C24A 4YWJA 1LLQA 2BH9A 2BFAA 2FMUA 3GOHA 2ZK7A 4BGUA 3KEQA 3JD2A 3QVWA 1FXSA 4W7HA 1ZZEA 4X54A 5TNXA 3TRIA 2G1UA 3NRCA 4ZQFA 2DTDA 1U1IA 1M6HA 4ALJA 4CLXA 3FNFA 5TX7A 4UVGA 1GFSA 1FDWA 2X9NA 1MFZA 4LRTB 3HSKA 4FFPA 2HAEA 4YJGA 3NGXA 3DL2A 1NASA 3IOYA 1U3WA 4U0KA 3TL3A 1P3DA 1A5ZA 4OO3A 5K6AA 1L7EA 2LDBA 2XOXA 3OEYA 4HFRA 1PS9A 2JFFA 3VPXA 3ON5A 1ZK0A 2NADA 4JJFA 3WMWA 4GX1A 5CDSA 2RHRA 4K6CA 1GL3A 1RKXA 3C7AA 3JQEA 4NBRA 4UVHA 5U4QA 1HE3A 2HLPA 3H8VA 3KV3O 4UREA 5G0VA 4IGFA 4E31A 4YRAA 5I7SA 5U1PA 3KOUA 4MINA 4WE3A 2G5CA 4XYEA 5JAMA 1TA4A 3ITDA 2YHUA 2IE0A 4BGEA 4HWKA 3VKVA 1FDSA 4DBZA 3GPIA 4P8RA 1SNYA 2YJZA 4I5FA 1HTBA 1XKQA 3LC1O 3GDOA 2Y1DA 2OZPA 2CZCA 3OQ1A 3ST7A 4K9DA 2CDCA 4FPXA 3HUDA 3JQ7B 1N5DA 1PGNA 2V6FA 3G49A 3PTZA 1Y5MA 1JDJA 1YDWA 4RPJA 2XXJA 4IMRA 4Z6KA 4XDZA 3ZHYA 5KVSA 2BF7A 4GBJA 3PFWO 3H5NA 1LDNA 5AXAA 2VUUA 2O50A 3QLJA 4A5OA 4CMIB 4R9RA 1YB5A 3L6OO 4QFCA 3DR3A 5KKCA 3BMCB 1JN0A 1U4OA 1ZH8A 3HHPA 3OFSA 4II2A 3E48A 1YB1A 1ZSVA 4IDBA 2WM3A 2ZTVA 3BMNB 3DHYA 2BD0A 3GMDA 3MJEA 2NVUB 3ZWPA 2PK3A 3I23A 1E3LA 1DRWA 2FZEA 1JU9A 8ADHA 1AGNA 1T2FA 2HK9A 3HDJA 2Q4EA 2Z5LA 3ZNOA 4BKOA 1CYDA 1V8BA 1ZK1A 3H7AA 4GAEA 3KYBA 4CM5A 1R37A 3ZNNA 4F3YA 2AE1A 5LCXA 1F12A 1LSJA 3ICPA 3WGGA 1SC6A 3LT4A 2OP0A 1XWFA 2HK8A 3KXDA 4BL5A 1EQ2A 3VTZA 4WEOA 4I5GA 2OORA 4PZDA 4E2XA 4Z3DA 4CLOA 1YJ8A 4QT0A 3E18A 2FP4A 1TXGA 2Y93A 2P9CA 5FFFA 1E3SA 1EK5A 1I3LA 2D2IA 3V2GA 4A0SA 4URFA 4GX0A 1C0PA 5MGBA 5ENVA 1EEHA 4GMGA 1I32A 2HMWA 2POQX 1BGVA 2WMDA 1R4MA 2ET6A 1LXCA 1VM6A 3ASUA 4UVDA 2NV6A 5BNFA 3W8DA 3ZGYA 2PA3A 1SOWA 5HBRA 4DIBA 5EIOA 4ZGWA 2DUWA 1KY4A 1OOEA 3KYCA 3O8QB 4P38A 5F1KA 1DIGA 4HFNA 2EP5A 3PHGA 2XAAA 1ZBQA 4E5MA 4KTVE 3K6JA 3H3JA 2I76A 1WMAA 4EZBA 3PJFA 3EMKA 1M6WA 2QZ9A 4DLLA 4QX6A 4JQCA 3RASA 2ZCVA 1LDBA 1VLLA 3NYWA 2YDXA 5KIAA 4J7CA 2OO5A 1CF2O 4F6CA 4FJ1A 4BO0A 1E7RA 3JQBC 4AJ1A 5G0SA 4BNGA 3LC2O 1DEHA 1XU7A 4XRRA 2HK7A 5I7FA 1E92A 4MVJG 3DEYX 2P68A 4R16A 4ONEA 1RYEA 1QV6A 4PFJA 4WK6A 4RL6A 2BI7A 4JNKA 4YVFA 4G65A 1GZ3A 3Q2KA 2HJSA 1E6EA 3NT5A 4CMHA 3DO5A 5IJZA 2CDAA 1V3UA 3ROKA 2YYYA 3QWIA 1I3KA 1ZK3A 3INGA 3OF2A 3E82A 1CQIA 1ULSA 5L7TA 1VC2A 2ZB7A 1PS8A 4BKRA 1A4IA 3D4NA 2V6BA 3QJ5A 4EDFA 4RDHA 3DHNA 5CDUA 3GNSA 1E3WB 1BXGB 1PJQA 1NHWA 4KTTE 5THQA 3ZU3A 4EUFA 4JK3A 1B16A 3CMMA 4AVYA 4RO0A 1D1TA 1J49A 1P33A 3DB2A 3LYLA 1GUFA 3IKVA 4BB5A 3OJ0A 3VZQA 4Z0TA 3ONEA 2XF8A 5T6BA 2NVWA 4RZHA 3ULKA 3HFSA 4E33A 4NMHA 2O23A 2AMFA 2Y0EA 2I66A 3WB9A 5L53A 3Q3CA 4CL3A 4J1QA 3DTYA 1HF3A 1NR7A 2D5CA 1XR3A 3TZCA 4BKUA 4AJPA 3AI2A 4R1NA 4XYGA 5ER6A 2GERA 4WCDA 1X14A 3RQSA 5TT0A 2CVQA 1WVGA 2O3UA 3X2EA 4XKJA 4QQRA 2OP1A 2I6TA 4YTEA 5T5QA 1PJCA 1B8UA 1UJMA 3Q11A 4OH1A 4E2ZA 2ZQYA 3GVIA 3FBGA 1HDCA 3TN7A 1HT0A 3FPLA 4PG7A 3ABIA 5A02A 5DBIA 2YDYA 3RSHA 3VPGA 1UXHA 3IJPA 3PHJA 4AJLA 1DIHA 3DAGA 4Q39A 1LLDA 3GH3A 4DC1A 3AUAA 1MX3A 1NPDA 1LEHA 1HYHA 1HE4A 1OMOA 4GSKA 5AYVA 4AJOA 2Y05A 3PQDA 2VOEA 4R9SA 1W4ZA 4YEDA 1N1GA 5LDGA 1W6UA 1B15A 3H2SA 1HWYA 2X86A 1HDOA 4RF3A 3QA9A 3PYMA 4U8GA 1GCOA 4J4TA 1W0CA 4TROA 4BO2A 3OBBA 5KVCA 3F5QA 3HN2A 3GN1A 2P2SA 4TRMA 2NLOA 2G76A 1QLHA 4Y6PA 5ER9A 1ENPA 4UEJA 5F1PA 4G2NA 4WLOA 1NR1A 5BSEA 4YCAA 1E5QA 1TT7A 4IDAA 4L73A 1DJQA 1NBOA 1EVZA 4DPKA 2A35A 2WTBA 3QY9A 3WGZA 2J3JA 5G0WA 1OZAA 1XCBA 4OJNA 4OXYA 5C7LO 4LSMA 3AUTA 1IPFA 1I10A 1JWAB 5KKAA 3TJRA 4DQUA 3MTJA 1PL8A 4UUMA 2IEDA 4J2OA 3S2EA 4CODB 2JCXA 4RVUA 1Z74A 1O94A 1GV0A 3IC5A 1NVGA 1PS0A 3PP8A 5B4UA 4FQ8A 2NTJA 1RM3A 5KWEA 1OC2A 2A9FA 4IS3A 4Z0HO 1ZJYA 2EGHA 3BMCA 1MC4A 2O3QA 2HMTA 3GVCA 3KZVA 2NVBA 3U5TA 1QSGA 2OOSA 3EVNA 4YAEA 5I9NA 3QSGA 3BMNA 3PHLA 3VHRA 3DZHA 3G1UA 1FMCA 5JS6A 1T1RA 1KETA 1SMKA 2QQ5A 4HADA 1LQUA 3R3JA 4GH5A 3F1LA 3ZWVA 5DN9A 5EQDA 1OFGA 2ILTA 4J1TA 2I3AA 1ZUD1 4IS2A 3KO8A 3Q9NA 2GN6A 3GGGA 5BQFA 1F14A 4AJHA 3SBOA 4LK3A 3OSUA 4IZIA 2FSVA 2UDPA 4JBGA 4MVJA 2X58A 3S2FA 3GVXA 3WNQA 4B3HA 4NPCA 3CEAA 5TC4A 3DONA 2WSBA 3PJDA 4A2CA 1IHYA 2HRBA 3TFQA 5DCUA 5HS6A 2PD6A 3G1TA 4YQZA 2W98A 5FEUA 4IQ0A 3JQ8A 4BO8A 4J0EA 4J7XA 1BXKA 5DBFA 4FR5A 4YRBA 4B4UA 3WGTA 3WTBA 2JL1A 3EW7A 4B8WA 2Z95A 4YAGA 4LISA 5BR7A 3KM0A 4E3ZA 1T4BA 2X0IA 3FTNA 2GO1A 1A27A 2GN8A 3Q0EA 1DHTA 1RM0A 5TQVA 5C7IO 3OHSX 2GRAA 1NFQA 1R0SA 4ND2A 1GQYA 1IY8A 1U8FO 3LC7O 1ISFA 3O8QA 3ETGA 3GEDA 1MGOA 2OL4A 2QHXA 3JYOA 1H6DA 3FWNA 1I01A 4XJTA 3H4VA 1Q7CA 1YQDA 5JDCC 3S55A 5HWSA 4I9HA 3F47A 1ZNQO 3I9MA 1F06A 3VKUA 2IEBA 5TJHA 3C7DB 3AJRA 2BGLA 1KC3A 3L0DA 3GHYA 3GQVA 1VKOA 1BVRA 5HTOA 3W4JA 4CM4B 4NU5A 3DFZA 1C1XA 4D41A 1PR9A 2PWZA 3QIVA 1DAOA 3MTGA 5CAEA 3QWBA 5EINA 2DBZA 2OUIA 4W7IA 3VTFA 4N7RA 3JQFC 3BTVA 3GZNB 3L4SO 1U2DA 4Y9DA 1Y5RA 1NFFA 1E0DA 1WWKA 1P1RA 4A26A 1O95A 3RVDA 4CMBA 1AHIA 3ENKA 1UZLA 4GVLA 3ZV3A 4YA6A 1CEQA 1ENOA 2C82A 1G1AA 4E0BA 1RM5A 2AEFA 3A4VA 3ETEA 3UXYA 4CPDA 4WNIA 1X7GA 2WEKA 2G0TA 3RFTA 3L4BA 1UR5A 5GY7A 4E4YA 1B0AA 3G0OA 5JAIA 3NDJA 1IULA 3AOEC 1H9BA 3GA0A 4FFLA 3GUCA 1I3NA 5GZ1A 4ESOA 3I5MA 3CIFA 5COQA 4RQTA 3V2HA 1YOVA 1GYRA 3VVBA 3BA1A 2YW9A 1DC4A 3NJ8A 3S1LA 3W1VA 1B7GO 1QYVA 1IB6A 2O48X 1BRMA 4HV4A 3DZIA 2GUGA 3KBOA 3ITKA 4CR8A 3PLNA 2O2SA 3RC1A 4BHTA 5JCXA 5IDXA 1BXZA 1U3UA 1BSVA 2JD0A 1TVEA 2VZ0A 4H3VA 1ADBA 1HDRA 2QIOA 3ASVA 5AXCA 3CKYA 5TF4A 3WBFA 5JCJA 5COAA 4MOWA 4R3NA 1B26A 3TL2A 5KJ6A 1JAYA 3AOGA 3GY0A 1VL0A 4ALMA 4PLFA 2O7SA 3G17A 3GG2A 3BMQA 3PDJA 3DAPA 3OECA 4UVIA 2P4QA 3LU1A 3SEFA 4D0RA 4B7UA 5TIIA 1UZMA 3IUPA 4RLHA 1LTHR 3NJ4A 1G6KA 3RC9A 3W6ZA 1HDGO 4PZCA 3TOZA 2C0CA 4JP2A 3AFMA 3HWRA 4FC7A 4DQVA 2CUKA 4EJ0A 1AHHA 2QZZA 3W8FA 2D0IA 3U9LA 1WNTA 2B4QA 1VL8A 2NTVA 4GX2A 4IJVA 4MVJP 4PLPA 4BO3A 1SEVA 2GZ3A 5JC1A 4ZICA 3JYQA 5JY1A 1LDYA 2AHRA 3NAQA 1TB4A 8LDHA 1YBMA 1NYTA 2B4TO 3JSAA 3BHMA 3DAFA 4XZ3A 3BMOA 1C0IA 2HDHA 3PJEA 4L8VA 4PG6A 3DBHB 2JKVA 1HKUA 1JWBB 4JBIA 3IQDB 4TSKA 2J6IA 2ZB3A 4U6SA 4PN3A 4ZJUA 5KOIA 3ROMA 2PD3A 2QRJA 4XA8A 2E37A 1JVSA 4JJGA 1WDKA 3ZU2A 4DBVO 4MO2A 4MKRA 4BNTA 1D4FA 4XX0A 1E1NA 2DC1A 1YS4A 2Q1UA 1T2DA 3IP3A 3MJSA 3RD5A 4B79A 1WDMA 1IL0A 1Q7BA 3AY7A 4MP6A 3ZNPA 5IAAA 4Q3DA 2WE7A 1A7KA 2VT3A 3CE6A 1EBFA 2C20A 4Z0PA 1MXHA 3C1TA 1XEAA 4NHEA 3RI3A 4BMSA 1FDUA 3ZU5A 4OIMA 5DT9A 3WDSA 4I5EA 1T25A 3RUAA 4OM8A 2VWGA 1ZMOA 3EHEA 4NBVA 4CLHA 1VJ1A 2GYYA 3HDQA 3X2FA 4J1NA 3ZCXA 3WTCA 1ONOA 3H5RA 4CUJA 4A27A 1SO8A 3BYZA 4M89A 4J7UA 2TMDA 4JGBA 5TS3A 4AFNA 4ZHSA 4FFOA 1KVTA 1Y1PA 1K5HA 2X9VA 4KUEA 5EMHA 3UVEA 4P4NA 1T2EA 3PZBA 1NHGA 3RROA 3ZWOA 2VTEA 5KVQA 3WLEA 1DC6A 2ZB4A 4EEXA 1RJWA 5LDHA 3G79A 3FI9A 4WLEA 1GEEA 1LLUA 2EERA 1ZSYA 3TNLA 3TZKA 6LDHA 1ZK4A 3GFGA 4CM8A 1GU7A 1DAPA 3ONDA 4MVJD 5COBA 1E1KA 3HADA 1BHSA 1MG0A 4IUYA 4DVJA 4XGIA 4ZN6A 1LSOA 3NTOA 3OIDA 4IJWA 3S8MA 2WWRA 3LVFO 4BOYA 2YV1A 3E5MA 3RKRA 3VH4A 1DDOA 3UCXA 2FPPA 2PFGA 2NUAA 3AUSA 1XHLA 1R4NB 3T4XA 4QECA 4IDDA 4DIFA 3MOGA 3RBXA 2ZTLA 4U0JA 5FI5A 2W4QA 3NKLA 3PGXA 5A06A 4CJXA 2CVOA 2JHGA 2RBEA 1CWUA 3I9NA 2WE8A 1EUCA 2EG9A 1X0XA 1YKFA 4Q3NA 3EAGA 4IDEA 5J23A 3JYPA 3ZZNA 4BNFA 2OMEA 5JE8A 4IQ8A 4Z9XA 5K6AC 1P1FA 1R12A 3AY6A 1VI2A 3TF5A 3QE3A 4BNHA 2EW8A 1PGQA 4GKVA 5L4SA 1E3IA 1RYDA 2PZMA 4DRYA 4DIOA 3U4DA 3WICA 3ZN2A 1QMGA 4BMVA 1GZ6A 3D7LA 3NUGA 4BO5A 2HMSA 4H16A 4OHUA 2B0JA 1U7TA 1HE5A 2HRZA 2Y1CA 5L40A 3PIIA 5KCZA 2YV3A 5DBGA 3DDNA 4J6FA 2VUTA 4D44A 4XQCA 2EHDA 1T1SA 1LDMA 4YJDA 4RVGA 4JJIA 1LBEA 3DTTA 4CM7A 3LT2A 5B4TA 1Y81A 3LT1A 4FC6A 2GF2A 2CSUA 1BW9B 3LDHA 2UUOA 1TEHA 3F46A 3SX2A 1LA2A 1N92A 1V3TA 4YAKA 3O26A 3PQEA 5H83A 1N9GA 1HRDA 3OP4A 3WSVA 4R5HA 4NQZA 3VH3A 1XG5A 3G3EA 1YQXA 1J6UA 2D1YA 2NM0A 4E5YA 2JD2A 1EDOA 2CNBA 4XJSA 3JQGB 3GEGA 3FTPA 5DZSA 3UAGA 5A1TA 5A03A 1DHRA 2E48A 4J43A 4XQGA 3SJ7A 3HB5X 1M66A 2GASA 4O63O 4J3FA 3QWFA 1UUFA 1O9BA 4BKPA 2YZ7A 3W6UA 3DHEA 1Q0LA 1TT5A 1EVJA 3F3SA 4JIGA 2F00A 4PLTA 1KEWA 5EERA 3WGIA 2HJRA 2B5VA 3ZDFA 1ML3A 6ADHA 3D3WB 1S6YA 5JCJD 4R5MA 3PJGA 5KNLA 2B69A 1VRWA 5AVOA 4BO1A 2BLLA 2C29D 4N54A 3L9WA 2PH5A 2BFOA 3D64A 2DFVA 3B1KA 3QWAA 1X7HA 3DMTC 2FR1A 4UULA 3EGOA 1N7HA 1H2BA 2OBNA 4J0FA 1GAEO 4A73A 1WLYA 3DBVO 2YFQA 1BDMA 4FS3A 2ZQZA 1HEUA 4WOJA 5A9TA 4RGBA 2RH8A 4BNLA 1LRLA 4BNJA 1U3TA 3WWYA 4OGWA 3F9IA 2DTEA 5JNLA 1YWGO 2PTGA 4YDRA 4BV8A 5KVVA 4H7PA 5DULA 1IYZA 1ISIA 1XGKA 3RUFA 4K1LA 4AJJA 3VZRA 3IL2A 3PIDA 5JAQA 5CG2A 3COSA 2DLDA 4F6LA 2DVMA 5KJCA 4J9VA 5EJ2A 5ILGA 4N5NA 4YR9A 1EUZA 2XPCA 4AJNA 4QO7A 1Y7TA 4DUPA 4Y67A 1GV1A 1BG6A 3WSWA 3DBHA 4W82A 2JCVA 4PLGA 3B6ZA 4DYDA 1NWHA 3M2PA 1ZFNA 4IY1A 3VPSA 3AU9A 1WXDA 1K2WA 3RJ5A 4TQGA 5FI3A 2QRLA 4I9UA 1I24A 3ZW8A 3DBRB 1GR0A 2X9GA 1H6AA 3QWHA 2DKNA 3ZWCA 4LCEA 4S1VA 4KP7A 1EMDA 1EVYA 1KBZA 5GZ6A 5IN4A 4UEKA 4WUVA 1GTMA 1Z73A 1Z6ZA 3ADPA 3W4IA 2HSDA 1YQGA 1KOLA 4FFRA 1KYQA 3DZGA 3RFXA 1NVMB 2C2XA 3I6QA 2G82A 4FCCA 3JQBA 1PJ4A 3FWZA 5IZCC 2PGJA 1ZIDA 4M55A 1RM4A 3E9MA 4Q3BA 4ND1A 1R0KA 2Q45A 3WX0A 5T64A 3TZQA 2ZTMA 4CMEC 2Q2VA 2O2YA 1UP4A 1PJTA 4CM3A 1DO8A 1DFHA 1N7GA 3UKOA 2PZJA 3ZH2A 2NQTA 4BVAA 4HKTA 2CD9A 2VHWA 3FNHA 4UUPA 4CMCA 4W4TA 1QG6A 5JPIA 4MVJI 5A04A 1IE3A 4CQMA 5C7OO 2Q1WA 3MOIA 4HY3A 4LMRA 3WGOA 7MDHA 1SAYA 4R1SA 1PQWA 4HNGA 1AN9A 3INRA 3U3XA 3Q2IA 5DF1A 4PCVA 1D3AA 1VJTA 3T7EA 1FDTA 3NDRA 4WLFA 3FBTA 4L4RA 1HSOA 1ZK2A 3WJAA 4D0SA 3JV7A 5CG1A 5BSHA 3ROPA 4OOFA 3OA0A 3SVTA 4CV0A 1A4UA 1YB4A 2EV9A 4MDHA 2Q99A 1M67A 3K2BA 2Q1SA 3GRKA 4DLBA 1R4NA 4ID9A 4DL9A 1I5RA 2E49A 3I6IA 4Z9YA 1R15A 2GGSA 4L9RA 4Y6SA 2WYUA 1X15A 1CETA 4Q3AA 4I8XA 3GAFA 5A3VA 3I83A 4L4XA 2IXAA 3GLQA 4GLOA 4JCOA 1DRVA 4NJMB 3RUHA 3QHAA 4GGPA 1A72A 2VYVD 4PVDA 3U62A 3OJEA 1T4DA 1SZJG 1IHXA 1Y8RB 3UN1A 4IIVA 2PZKA 1MV8A 3L6EA 3W8EA 3RKUA 1MP0A 4L74A 5BT9A 1FDVA 4NIMA 4P4GA 1NX6A 2VHYA 2W2KB 4ROSA 4U6QA 3AU8A 4RF4A 4E5NA 2GD1O 1LJ8A 1XLTA 5L95A 2GCGA 1I2BA 3U4IA 4I9NA 2YHIB 4CQLB 2ZTUA 4E2YA 1J4AA 1EQUA 3HDYA 5ITWA 1ISHA 1U7HA 2NWQA 1HDYA 1R6DA 3TPCA 2VRBA 4CR6A 1KVQA 3VPFA 5KJ1A 1GDHA 2J3KA 4RF5A 1I3MA 5DOVA 1ISGA 1EK6A 1TLTA 3VPHA 4KZPA 2PD4A 3H9UA 1DLIA 1MC5A 3I9LA 4XB2A 4CLDA 1A7AA 4A7PA 2RHCA 3DZBA 2B83A 2X0JA 1HSZA 1QKIA 3U09A 3VH1A 1VE9A 3MWDB 1ZJZA 2Q2QA 1MLDA
chains in the Genus database with same CATH superfamily
3Q1KA 1XFDA 5LQNA 4BLVA 1UT8A 2EZ9A 3C87A 3H9QA 4M1SA 1MQSA 4BNZA 3DGEC 4EPYA 5JYEA 3UJ7A 4XXHA 2XA9A 2QUIA 1M1NB 2IL1A 1EZ4A 4KWIA 3IA2A 2VSXA 1EDEA 3IESA 5TVKA 2ZXFA 3CH5A 4HDNA 3Q15C 2BEVA 2OBXA 2NNLD 4OIFA 4PG8A 4PAMA 3TNFA 2HMUA 5DHTA 4ZDWA 2YJNA 1SBYA 1UFRA 4LK2A 5FBQB 3RU2A 1BAPA 3O0TA 1OUMA 1PTJC 3RUDA 3BRWD 3A28A 2UYCA 2QD2A 4CMIA 2HA3A 3WGNA 5JEDA 3KTAB 5AIBA 2ZEJA 3G0BA 2H18A 2BL4A 2E87A 3AEXA 1T4CB 1EDBA 4JP3A 5TPZA 2CDBA 1C9NA 1LSSA 1WS6A 2ZE8A 3FJOA 3I30X 1JSXA 2G71A 3PE3A 2XNJA 3J7TA 1KJ9A 1JRLA 2CLEB 2O7QA 3N2ZB 3O2NA 5G4KB 2JH3A 2JVIA 2NVUA 1N2IA 1JEOA 2NU8B 1XD2B 1EUDA 3WYDA 2BSQA 2OA0A 1U5CA 1NM5A 5F1OA 3D3WA 3OQPA 4JY7A 3RYFA 4XB6B 4YAJA 2QTRA 3KLBA 1FVHA 4OJTA 1J99A 1KI6B 4CV2A 2VEOA 2W6JA 2QL6A 2ZJ1A 2HLNA 5I7RA 4MP8A 1Y6FA 4QEDA 2RHHA 1ZEJA 2AXQA 1DEXA 3D6UA 4YRCA 5A5FA 5KWIA 2FPWA 2O7RA 3DT9A 3H8JA 3EZXA 1T4MA 4ZCQA 1NR5A 3RC7A 2J08A 1SRQA 4QUGA 2YZGA 1P1IA 3IR6A 1T3SA 3RTBA 4R9UC 4PBRA 4WRRA 3BK7A 4C3VA 2WQ6A 3NFYA 2UXBB 4RQUA 4JMLA 4RPKA 2FDCA 3T3EA 2Z43A 2AG6A 5DWDA 2N9UA 1RFLA 3I12A 5EPEA 3A1EA 3PNVA 1YJQA 3W8NA 1R6TA 3HBLA 1E32A 1FXWA 1M33A 1JQKA 2QRGA 4XD7A 3LW8A 5FLEX 2I2FA 4JI6B 4HEHA 4IHQA 4JBYA 1AOXA 1NBWB 3RFVA 4HNTA 5EY5B 1QYXA 5L3ZA 1JMKC 3A6KA 2HDNB 3I09A 3PFHA 3B1JA 2AZ4A 4LY9A 4Q6BA 1WULS 2PU5A 3GH1A 5EMMA 5IKPA 4ZTUB 1BMDA 3PXUA 1Z36A 2D00A 1QRRA 1OREA 3MWJA 2WPDD 4O1MA 2AOUB 2DJ5A 4WASA 3ZBUA 3IULA 5SZHB 2PS9A 3R7NA 5AW2A 4LFCB 3WMXA 2WYWA 1SVSA 2FPOA 2OZLA 2XW6A 3QG5A 4UBMA 3RYTC 4BECA 2JFVA 2Y66A 1WUIS 1JNXX 1YB6A 3A9TA 3KTFA 1RLUA 4FEYA 4QJBA 5ICSA 1W5FA 1TQ4A 2AI1A 1JHYA 3OKAA 3UBTA 1TAGA 3R5TA 3EIFA 1GRCA 5REQB 3GPDG 1M0WA 1MXFA 1CUCA 1UDAA 2UZ0A 2ERXA 4K9PA 3ONWA 2LZ0A 1P5HA 4FFNA 5KVAA 1ORRA 2HWYA 4TMFA 1LQTA 3GFRA 4WADA 5JBQA 4QEKA 1VG1A 1Q6YA 1H5UA 3R6GA 3OOJA 1GZHB 1R0LA 4FOPA 4JDUA 4AN0A 2PGDA 2WIKA 3ZY4A 1R4AA 2A58A 1YU9A 4IXDA 4TSRA 2QVYX 2MJLA 2HC9A 1Z5VA 3V4RA 3BSWA 2PX0A 2FVXA 2EFJA 2Y0PA 4DUGD 3BTOA 1ZEMA 2B20A 2YNMC 3WLOA 2ZRFA 3PK0A 3QVVA 3PVCA 1UANA 1K3TA 3K5HA 5HK9A 4P0PB 2XWSA 3KJNA 3P19A 4JKOA 1WXEA 4YJGB 1EWVA 3GWGA 3JARA 4I4NA 4KL8S 4CIAA 1SA0B 2PLNA 3KFXA 3DMPA 1ZXLA 1NX9A 2IE8A 1B8VA 2OCXA 3T52A 1K6EA 2M6RA 3U80A 4YRZA 4OBWA 5F7JA 3A4IA 1E3WA 2Q3HA 1BXGA 4Q7LA 3ORSA 1XTIA 4H15A 4LRSB 2C4HA 4JBNA 4NCBA 5BOSB 3ABRB 1SU8A 4FYKA 3E03A 4UTXA 4C7OB 2J6HA 2X22A 4RV4A 4TRJA 2BGJA 2JAUA 2C07A 2IUUA 1T5OA 1WAMA 3PNPA 4LPKA 1EINA 4LF8B 2X6QA 1AB6A 4JXKA 2WNIA 4LTDA 5KMGA 4KC0A 2AR0A 3CZAA 3OU6A 4YQZA 1NQAO 1K97A 4KR2A 1DC5A 4ILEA 1KPIA 3PYXA 2YCLA 4DMHA 2ZIAA 3C7CB 3A2KA 5DHFA 1YRBA 3OM0A 1VMKA 4OKIA 3FTDA 2EKPA 3Q1LA 3S3TA 4DIEA 2O0LA 5GPBA 4ZU6X 1I51A 4RKQA 1PJBA 2I22A 3DOJA 1M9NA 1KYYA 4UNPA 4MA0A 5ITVA 1CRQA 1Q3KA 2B37A 4NDAA 1A95A 3DEHA 5CK4A 1U2RA 2RCYA 1XSEA 2LDXA 1UEJA 3K0HA 3JTMA 1JBKA 1J0EA 1LUAA 4MMZB 5BV2P 5HM8A 3OCJA 1U0LA 3ZYZA 4Z7QB 1XVIA 5GP1A 4AZ3A 3OLVA 2Z3VA 1NW5A 4WIAA 3W5CA 1GY8A 4H3KB 3OJWA 2X23A 5EN4A 1BOOA 3T7JA 5JJLA 1OXTA 4P5PA 4MW2A 3O21A 3VSCA 4TZ6A 4JYAB 2PY6A 3GJ3A 2ZSJA 2A33A 1AT1A 1RDFA 2CJPA 2QZ4A 3EZYA 2D3TA 3VDRA 5C32A 1COZA 4R6XA 1Y8RA 1QTIA 5I7EA 5B1YA 3ICCA 1Z4PX 2CGEA 2PCJA 3I58A 4YAOA 2JI9A 5HCNA 5BN3B 1Z45A 2BFEA 3RG2A 4YIHA 3SPXA 4ZOBA 4N7BA 3L7AA 3EDRA 4UUNA 3FCOA 2W2KA 3SNHA 4KQXA 4WBNA 2QRKA 4LJ9A 3PC6A 3D4PA 2IDZA 5EWLA 2HCFA 2NUPB 3BWVA 1Z0SA 3EUEA 3P2EA 4EX7A 1XNJA 1DAKA 4NFHA 4RIHA 3AIKA 3WKBA 2GDZA 3FNIA 3L0CA 4X1YA 5J3JA 1W36C 1EUQA 2CXRA 3MT9A 4XYBA 4AY2A 4B32A 1BRTA 1E59A 1PQUA 3COPA 3JQ6A 1V1RA 4LVCA 4TZ0A 3GUYA 5FQOA 1AKEA 2H52A 1SWVA 1Z75A 4DRZA 3KTDA 1G3IA 4TSFA 1TDJA 2PBRA 5HIJA 4H1HA 4F21A 4Y18A 1KP3A 2LE0A 3VHLB 4CTOA 2ID9A 5ICFA 1NXQA 2YQZA 3E35A 4KQGA 3AJEA 4KFRA 2OESA 4V0KA 3V8VA 2AL7A 5IYZB 5U9CA 3IVCA 3P4UA 1NJFA 5EUBA 3OFJA 3SZLA 2FCAA 3B1FA 4UPDA 1HQCA 2HJ9A 3FOFC 3BGDA 3WQQA 1RXEA 3OX1A 4DRXA 1UM9B 3NBUA 5CVCA 3OH8A 2VYFA 5B57C 5LKRA 4NYMQ 4Z54A 1DQNA 2I8AA 3FPEA 1J8FA 4ZI7B 3CTMA 3A4NA 2HWWA 2QTZA 4NJEB 4DQXA 5BVGA 4BFWA 2B92A 4RV9A 3SVZA 3T94A 4CEJB 1SVLA 4HBGA 1OJLA 5C9ZA 3FZQA 2RK6A 3PWTA 4OY3A 3IQHX 2O07A 2HSJA 1S9DA 3EIHA 8GPBA 3CPHA 1XALA 4IVRA 1QYDA 4K88A 4X3OA 3I61A 3UT6A 4N6NA 4Y1EA 2YYAA 1BHQ1 3OU7A 1CVLA 3IVRA 2DFDA 1A9PA 1NTOA 1OWLA 3DV2A 4NS4A 5SZJA 2AOXA 1XRPA 2I71A 5AI0A 1XK6A 5EPOA 1QHXA 4F84A 3HI4A 4TT3A 4BJ6A 2PUTA 4F72A 2PUAA 3DWGA 2PLAA 1JR2A 2WHRA 2IT1A 4BBZA 1PEAA 4CM9D 3ZVKA 5TB5A 1U28C 1SBTA 1L4MA 1T2AA 3P45A 2GS9A 4UAUA 1Z07A 4BTEA 4EYOA 3G5TA 1O6GA 3RJTA 2Q4RA 1W8DA 3M4JA 3CO5A 3AHIA 1LC0A 1VKNA 3N6RA 5BO5A 1KJ8A 4INZA 4JOCA 1F8FA 2YZ2A 2PTHA 2QY9A 1BXRB 4R3WA 4F12A 2J8ZA 1CUFA 1F38A 2MMCA 2R8EA 5CX1A 4EG1A 2GZ1A 3M0EA 4C4YA 4HZUA 4I50A 1U3DA 2XB9A 2FP3A 3NB0A 4NBUA 1GPDG 1ZH4A 5AO9A 2J32A 1SVMA 3L0OA 3RFFA 2R62A 1DXHA 4MYCA 1BDBA 2JGJA 1S3FA 3K0AA 4YMLA 2Y1EA 2AD5A 3BXZA 2HLDA 3WBKA 5CCBA 2JLXA 1NQTA 2H17A 2QA5A 4MQEA 3V8QA 4AU1A 1YVEI 2EFDB 4GLJA 1JJFA 1JV2B 4B71A 3IXLA 4NZPA 5EIAA 1G17A 3HCFA 3M3DA 3WLFA 1LWOA 4RMIA 2B1GA 2ZYUX 3ZE0B 4O4HF 4UATA 4ND3A 5JNUA 3QE9Y 4QO8A 4HUJA 2WTAA 2VYVA 1MAVA 4I46A 1T3HA 1UCFA 3ZPXA 4D4JA 5K9ZA 3NX4A 4BFCA 3QPCA 4QOIA 2EKLA 3OZRA 1PL6A 2AZMA 3G0DA 1ZD2P 1E2BA 3T5GA 1YCGA 1HL3A 2GCIA 3D5TA 3ESQA 4XIYA 4YRPA 4OATA 3ADCA 4H7FA 3JWIA 1YE8A 1XL0A 4UAGA 2YMQA 4WY5A 1E5XA 1GA1A 3EASA 1ADCA 3NHYA 4M7WA 4TWIA 4EARA 2DWCA 1V6AA 4JJEA 1AG9A 3HCPA 3CRRA 3FN4A 3KSDO 1FU4A 3OIFA 4R4JA 2R2AA 2VF2A 4HSGA 1AXRA 4JSYA 3SSAA 2QTBA 4DLVA 4I1OA 3A6DA 2PIAA 4NV1A 4WDRA 2OCKA 1JAXA 1KK3A 2RGGA 2JJQA 1V41E 2C9YA 2ZRAA 3PX2A 5EIBD 3KETA 4GMDA 2B61A 3GCXA 1CP2A 4YPFA 4BJ3A 3MCUA 3DZFA 5K6AC 4DDKA 1HTWA 2X4LA 4CI9A 3L1JA 4FEGA 2DU8A 4LBWA 4QVGA 4TTRA 4DPMA 2C54A 3A7EA 4CMKA 2CY0A 1UC9A 2XNSA 4B6FA 4Y3UA 3RK0A 1ZCFA 3IOBA 4O4JB 1UJNA 3CX6A 1DXYA 1JLLB 1ZI6A 3KOYA 3VYTB 1GRQA 5IKMA 1SCUB 1O96A 1OGYA 4ROTA 1XRRA 3UM9A 2PNFA 2REOA 1C3VA 2QTAA 4E32A 5AKIA 3M9WA 3ILSA 3MJTA 4ER0A 1M6YA 3F4KA 1LKZA 2L18A 2ODNA 3EDMA 4M6WB 3OEHA 4O4IB 2IDKA 4MI9A 3W5AA 3HG7A 3IELA 3WFZA 5TVGA 4BLTA 3SQWA 2EX0A 2Z2JA 1R5JA 3OO0A 2ZYWX 5KDLA 1RWPA 1PVDA 1UBCA 3C5HA 5NULA 4BQPA 2DETA 4I8IA 1TYDE 2WJPA 3BIOA 4RKWA 4B6QA 4D98A 1A77A 4C1BA 5ED0A 1GL6A 1YSCA 2I62A 5JZVA 2HIMA 1T3GA 2Z3ZA 1FOEB 3BERA 1BDHA 1PJ3A 2E6UX 1KI2A 1L8QA 1YRLA 2NYVA 3K9CA 4E5VA 1UDXA 3CMCO 3OPYI 2YKGA 4QOFA 2OV3A 4WGFA 3ZUGA 2VWPA 2VQFB 3LX5A 3TL6A 4FIZA 3TBKA 2P0EA 4D5EA 2WV9A 3QLVC 4FTWA 4JJ6A 5IDYA 2AEMA 4I1SA 1VLZA 2E55A 1IAVA 3C41J 1SCJA 2BFPA 1HE2A 3V97A 4BIIA 4QPPA 1HKHA 1E2NA 1DZ3A 2GHTA 1F0YA 3I39X 3M6VA 3QVOA 4WW0A 1QU3A 3HZZA 1AO3A 4R01A 5AVZA 1NRJB 2YL2A 4PZZA 1PIWA 3O9VA 1QQBA 3V46A 1EM8B 1MZVA 2KI5A 2VKQA 3L7YA 3A14A 3CUYA 4DHEA 3FWYA 4E3WA 2K7FA 1NG9A 3DL4A 4KREA 1FU8A 3DD1A 4Y2PA 1JKIA 4GRAA 2UKDA 1XDBA 4I14A 1L4UA 1WTAA 1DX4A 3IMCA 1Y98A 5A05A 2Q3BA 2Q9AA 3JQCA 2HU2A 1ZESA 2X3YA 4L08A 2C2MA 3DMTA 4HQNA 1IEQA 3D4IA 2BFNA 1CE8A 1P3JA 1W87A 2FX2A 4ZPXA 4XARA 5FAKA 1KDPA 2WJZB 2J0UA 4HDKB 1PFKA 2EFYA 1ZAYA 3GT0A 4RLSA 1NXOA 4A03A 2OXEA 4QXMA 5FUBA 2FMTA 1ZVQA 4P83A 5IJ0A 4PX5A 4IFIA 4B0OA 2EP8A 5GMOA 4L9AA 1WU8A 1AQIA 2NU7B 2UVDA 3H5VA 4GMFA 4OH7A 1ZVVA 4RPCA 2HW8A 1JZSA 1I80A 1A9SA 3HGQA 1DZIA 2O5VA 2VDRB 1QO0A 3FDJA 3I6BA 3IMKA 4FW9A 2WTMA 3M1LA 3N87A 4PLHA 5H82A 4Q9LA 3PC7A 1MC1A 1Y37A 2HKIA 2QG6A 2BFCB 1XC7A 2R7LA 1JEQB 1W2WB 2H9IA 6NULA 1ARZA 1KJWA 2IOFK 4N1AA 3WO0A 2P8SA 3WMGA 1ISRA 2N75A 2VHQA 2A5FA 3MAJA 2Z2KA 1I4DD 1BS9A 1P0PA 3F5FA 3RJZA 4Q3LA 5A5VA 4GFDA 5DLQC 3HB9A 5EQFA 1XTTA 3CHYA 1TTPB 2EL7A 3HB4X 3NV9A 3QUAA 4OLFA 3HK2A 4XIJA 2ODBA 1JBQA 1I33A 1P4AA 2VSFA 1O5IA 3PGMA 1RVDA 4IDGA 4Z1MA 2QV0A 2WNHA 3TTWA 2JCGA 3L4JA 3FDIA 3ICQB 2V7WA 4AJ2A 2VTKA 3PI7A 5DBOA 1P1KA 5KTKA 3ETJA 1H0KA 4MVJH 5KO2A 3GLVA 1J1UA 2ZJ7A 2YIDA 1JHAA 1KAMA 1PD1A 3DP7A 1HXHA 3VVMA 4ZWNA 2FXVA 4DNQA 5IJ9B 5KOYA 1KJNA 3ESAA 1PU2A 3KT3A 3HRIA 3SFTA 4DAEA 4AF6A 3FJ1A 4F2GA 2B9EA 4MUNA 4NOMA 3ZTYA 3AIMA 1OVMA 1OZ0A 4XDYA 4RAOA 4EGFA 1R16A 4F4UA 4F7DA 1TE2A 2A4MA 2C5FA 3LQ2A 3OLQA 1G2IA 3PNKA 4PIMA 2P2GA 2A3RA 2VTBB 4PX9A 3G5UA 1T34A 4I08A 2EQBA 4G9EA 4ITUA 3X1DA 2NTNA 4NR0A 3RT9A 3PEEA 4LQ4A 4RZSA 5C53B 1E63A 1F8UA 1FTWA 4B43A 1G8FA 3QPVA 5CVJA 4V0ME 4O0MA 3U7JA 5E6SA 1W85A 2ZSEA 2HA4A 3HVUA 4IZOA 2O8BA 3MWEA 3BREA 3P9ZA 1A2OA 2C5HA 5K5EA 4B2YA 4IMIB 1QE0A 3AL0C 2GBCA 2EDCA 1OTYA 3ENZA 5MDHA 3QBJA 4KDCA 2IYQA 1KEEB 3G1WA 3TVYA 1N2JA 3N59A 4F2DA 5IFKA 4U7TB 1YDFA 4HFJA 2C2HA 1GPNA 1B1AA 1XCPA 1YQ9A 2P4HX 3IAEA 4KAJA 2FETA 2NP7A 2IXBA 3ABSB 3G2IA 1FUKA 1RAEA 3D8SA 3OKFA 5FB3A 2D2VA 2R1TA 3OFVA 4PZPA 3SP1A 1SCQA 4KWHA 2W11A 3CONA 2JCYA 4ZPJA 2B78A 2XMDA 1N5KA 3R0IA 4TYQA 4WXPA 3GYGA 3IEKA 4DCMA 4DYVA 3OICA 3QVXA 3COJA 5D5QA 1S2IA 3IIKA 1L8XA 4KO1S 4S3MA 5JARA 4HQRA 4WY2A 4M9UA 4TMXA 4DREA 1UXGA 2O3SA 1T5SA 3AM5A 1CHNA 1P8AA 1VHTA 3A6FA 2JLRA 1Q7TA 1LSUA 1MEJA 3I72A 1MJGM 2QP3A 1DJNA 1SUIA 3RG8A 3IPRA 3TM4A 3JYNA 4JXXA 1XEFA 4ZAYA 1FRNA 5DNYB 1D2AA 4JLSA 1JW9B 1ABFA 1PCXA 2EKQA 1ZO8A 1ESDA 4EX6A 5LQCA 4REOA 3R3WA 1NVVQ 4ND5A 4IEFB 1EGAA 3ROEA 3PWZA 2PPLA 4BO6A 2ZRPA 5EL0A 1KZ7B 4YJHB 2Z5GA 5TMEA 3GFBA 5A3QA 2H48A 5FBHA 1PG5A 4OGKA 3AESA 3ZNQA 3AETB 2VAMA 1XUOA 2X0DA 3SGLA 3FE2A 2YYZA 1THMA 2OGTA 1Y4SA 1XVTA 1L5WA 3AFNA 2QQFA 3D0RA 2H7XA 2QM0A 3OF3A 1BCRB 3DULA 3P9PA 3TI7A 4CMJA 4LHZA 3RTCA 4QLAA 3PKZA 2EGGA 1G9SA 4K9RA 3SVLA 1YR1A 2Z2ZA 4GXNA 4FVTA 1UAYA 2FZVA 2VJAA 4RJTA 5KOJB 5AXDA 4XCVA 4X92A 3IR5A 2XQJA 2P9BA 3CLTD 2XYGA 2ZSAA 3FLMA 1C7RA 2O05A 3KYDA 4DUZB 3KFLA 2R84A 1FC0A 3PNYA 4JUAA 3LRXA 5JXGA 4TLDA 2GXAA 5JROA 1JIQA 4G0ZA 3STHA 3G2OA 1Y9DA 1WZCA 4DV7B 3M89A 5T8KA 4IV5A 2XRYA 1RBYA 3EK2A 1F51E 2ZIZA 3NT2A 2BISA 3EG9B 4ZCPA 5LP6B 2H2IA 4ML3A 3C3BA 5CBPB 3DLCA 1A82A 2V55B 1S2LA 3DWFA 4CU2A 1RQGA 2PKCA 1E77A 2ZKLA 4PZEA 3IKTA 3D0OA 1MABB 2Z2YA 4R51A 5LLDA 2JW5A 3GLKA 2R4UA 3HA2A 1OPXA 1JR3A 2AJTA 1YULA 1LLCA 1ZD3A 4QUIA 1XCGB 5JRDS 3T7KA 1NRIA 4LBVA 2E5WA 3KX2A 1NF8A 2R6AA 4JUIA 4RHXA 3L6RA 4U2KA 2D1QA 3AXSA 2VHXA 1KXJA 2B34A 2Y9PB 3ANNA 3JQDA 5JW6A 3ZHXA 3DGFC 4INPA 4F5EA 2F59A 4E31A 2WJGA 1NBEA 3FUXA 2HU8A 3PJRA 3WKEA 5HQ3B 4QOEA 1EB8A 3FVQA 1N6LA 4P3PA 4Y2VA 3U4QB 2XYHA 4OMFG 2ONJA 5FJJA 1IATA 3QE4A 4WH0A 5FEMA 4Q03A 2AN1A 1DNPA 1QXSA 3EPLA 4Y30A 2A9PA 4DDUA 1PTKA 3IB3A 3EARA 3GLHA 4DLYA 4YI5A 3RTAA 4CM9A 5HRAA 4OSPA 4B3DA 3A6LA 3EUFA 2JZCA 2HZBA 2Q5CA 4DLPA 5FBRB 2ZBGA 4URZR 1XWIA 2JAHA 3UQYS 1NIJA 2IHKA 2C00A 3PLRA 2W6QA 1H8HA 2AEEA 2W2LA 4HR7A 2ZWIA 3IEPA 4FHEA 2GKSA 4OHCA 2I6QA 2KW5A 4W6QA 3WIUA 1SBQA 3L79A 5JO9A 5B2EA 3L02A 2XMPA 4PF1A 3W3ZB 3MTIA 2A57A 4NP6A 1UJBA 3NT4A 1YL7A 5GV7A 1F5NA 1J22A 2XNDD 3AL2A 1YDEA 3HNPA 4M46A 2PKYX 4IMPA 4IDFA 4YR7A 2W93A 3MM4A 2P5UA 3N53A 4MW1A 2C5EA 3QEJA 4N5MA 2V45A 4L57A 5JY6A 4RA9B 5AW6A 1N2XA 2A1TR 2V5AA 3KFVA 1W59A 4UUAA 3K9QO 3WKAA 4A8TA 4ZCSA 2ZJ0A 3IBFA 3M70A 3V1TC 5L9AA 5JFOA 3RRZA 1FF9A 4ZO4A 2FW6A 5GV8A 2Y68A 5BUQA 5L4LA 4IDHA 1JDNA 4F8YA 1VA5A 2HF8A 5J2TF 2WHPA 2PZFA 3Q3VA 1KHHA 3U7QB 2ZSKA 3LI2A 4Z4QA 4C7MA 2KB0A 1JPVA 4B74A 4MKHA 4PHTA 3LCJA 3ADDA 3ZIDA 1HNZB 1UPFA 3KCQA 4ZAZA 3DOOA 4TRRA 4IO0A 4DADA 1QE5A 1O2DA 1K6IA 3TW8B 1BFUA 4NBTA 2ACVA 5JVDF 1O97D 4KX3A 2P5YA 4GM4A 4EHIA 4YMUA 4TWRA 2E7ZA 2VUSA 3IAAA 5F2EA 2PZ8A 3HYTA 3CEPB 1P44A 2QRPA 1RJFA 2EFGA 4YC7A 1JHQA 2I4OA 4OB6A 2AFHB 1G8YA 2EG5A 3A3OA 3O4VA 3OFKA 4O2BA 2DHCA 4FONA 4WZAE 5D51S 4C4XA 3PFKA 1FEZA 2RGNC 1PGJA 5LBTA 1RADA 3GGDA 3AF4A 4DR3B 4LJ8A 1W34A 1RW4A 3SHTA 3K0CC 4LOIA 1Z5WA 2Q28A 1UJ6A 1XHFA 1KFEB 4DMUB 3EQ8A 4HUQA 4J91A 3ZHVA 4DLUA 4H7KA 5BSGA 2NXWA 2Q6LA 2AJCA 5AWFC 3CVVA 4HH1A 4D8WA 1CKEA 5JS8A 2GCNA 1F4PA 2X8AA 3R9KA 3W6NA 4C07A 5E4TA 3LSTA 4TTTS 4E5DA 5F3WB 1SWWA 2NO5A 4U2CA 2Z1NA 4L8FA 1UDRA 1MB2A 1HQDA 3I9V6 3M6WA 3PDHA 2UVPB 1D2GA 1WMFA 2X6TA 3K0FA 1J2YA 3CRMA 1VSQA 2DUUA 1Z83A 4N82A 4UVEA 2CKMA 3TB6A 3CO0S 1U2DC 5D6OA 1DX6A 3SHFA 2B5OA 3OBIA 2PS1A 3IBTA 4EF4A 4JJ8A 2AI2A 4LGYA 2YNMA 4BZQA 5DNDA 5KBYA 5LQUA 5DEIA 1K8RA 1AUQA 4QC2A 3SFZA 1OLXB 1DC7A 1GTL1 3NH9A 1NVUQ 3KT0A 1WQ3A 4Q1DA 5ILQA 5KJEA 4TTVA 1XXHB 2WOJA 3PPIA 5H9VA 1Q20A 3TQRA 5ENZA 4Q9JA 1HNNA 4MS3A 4F93B 3S29A 2Y1FA 1BE0A 5DFAA 4BXOB 4LCJA 1ETUA 3MJ4A 3CXRA 1REQB 4GBED 1F17A 4X8MA 3N39C 1KNXA 1YS6A 4JBHA 1LPPA 2Q9UA 1GQQA 4BTLA 1L4GA 2JIDA 1RSZA 3IP8A 4B2PA 1K5GA 2BEUA 3LTEA 1UFQA 2L82A 5L3SB 3A1SA 3HQ4O 3V4OA 1NAIA 3VOAA 1QGAA 5EHZA 1NQWA 4HNAB 4GOLD 4F56A 1IXYA 3FTFA 4BB6A 1AUXA 2WQ7A 1D4OA 2FSIA 4QYTA 4N76A 1OPRA 5B1IA 4HTFB 3NWEA 5K7SA 3EVAA 4NYIR 5BNIA 2R6JA 3INTA 1RCUA 2PRZA 3GAZA 3LHKA 3RIYA 1PEKE 1LW6E 3TVTA 1PZMA 4LOKA 4TMWA 1G5PA 3V4VB 4F86A 1J0CA 2WAYA 1NXPA 4G01B 2X0RA 2IHZA 4NJMA 2DKOA 5B12A 2QPLA 3IE2A 1TJ4A 1QIFA 1QJCA 3U3MA 1AE1A 2AGVA 2YWJA 5LC1A 1TT5B 4BNUA 1Q0RA 1Q1NA 1NATA 2YWDA 4Y9UA 5AJHA 4A8JC 3K73O 3DOFA 3GP8A 2IGTA 2XWQA 4PRLA 4P98A 2D62A 3HBJA 2P1RA 4MX8A 1A76A 1YQEA 4IWNA 4MLZA 2FN8A 4CETA 1E7YA 1I2MA 2YHIA 1W88B 3QK7A 4KO4S 2DUNA 4KN8A 3S1SA 1SC1A 1NWCA 2VOJA 3CBGA 3CM0A 2WICA 3GAMA 5AK3A 1ICEA 2AX3A 2ERYA 3ET5A 4X63A 4EZEA 3PXXA 1N6RA 1D1QA 3F1KA 3FAKA 4HEA6 4GKAA 1RZRA 2D5IA 1TZJA 3BXGA 4NRDA 4JC8A 4RXTA 1N6HA 3F71A 5HGJA 1KQNA 3WR5A 4BATA 4EVQA 3OY2A 1FPQA 3HKEA 3IQWA 1CX9B 2BHNA 3MTDA 3CA8A 2NPFA 3FF4A 3KUXA 3LX8A 1USKA 3MWDA 1XTPA 1BZYA 5CMLA 4MRMA 4YJKA 4DMLA 4I1RA 3QE0A 2VZLA 1OGJA 1OLUB 2YV4A 1GPLA 4P34A 3C6KA 5DCWA 3VZSA 4ZDIA 3DZKA 1N6NA 4TX1A 4BFSA 2OFWA 3RS7A 1CB0A 4R2LA 1FMTA 4HGOA 3JYLA 3U3KA 4Q4JB 3USCS 4XYMA 1E6WA 2OKCA 4D42A 1R9MA 2QE7A 1AQLA 1R6VA 3O4RA 4Y8VA 1ZI9A 1J9EA 1Q84A 1Y1KE 2Q0SA 3EQ6A 3WAJA 2OK8A 1U5BB 4UU8A 1S9HA 1JT2A 3VSAA 2D1TA 2ENWA 1UJ4A 2JLQA 4FMBB 4BS9A 1C4KA 4C2UA 4RX1A 3LY7A 2XCIA 4GBMA 4MA5A 5BYKA 5KOHB 2UU9B 1X1RA 1HY3A 3L6CA 2GK4A 3FFTA 2G6BA 3QXGA 2WWTA 2D74A 1Y6RA 4C4ZA 4INAA 1FYXA 1XZBA 5K8LA 4MDFA 3EXG2 3FOEC 4KR9A 2JIBA 2B3TA 2L17A 4P4UA 1DADA 1V7ZA 4RVFA 2UUPA 4L16A 1K6JA 1UOPA 1NT4A 1JDBB 4D9IA 2GH1A 3AR7A 1DI0A 4NU8X 3RFCA 3PD0A 4KPEC 4AMVA 3ZQ6A 3Q8LA 3ZV5A 2HN9A 1TK9A 5BN1A 3WLSA 3S1AA 1OBFO 2O2DA 1D1SA 1XJWA 2YTZA 2YY7A 3FVVA 4RH3A 2XUKA 2Q7XA 3V7WA 2R2GA 3SK0A 2JFPA 3WNVA 4QGSA 4NBKA 4O02B 3REGA 2WG0A 3F6EX 4E51A 1PV2A 2O6LA 2O7NA 4B46A 4R2WA 3C5CA 3ESCA 3R4VA 5BSRA 1F8GA 2CLLB 1AXEA 1WCIB 3BGIA 2K87A 4WERA 5ALTA 3CVUA 2HQSA 1WBJB 1VGVA 4YDHB 2Q5QA 2COEA 1ACJA 3NS7A 4Z7JA 1JKFA 3OA2A 6REQA 1S5PA 3ZZ0A 4DM7A 1KE2A 1J07A 1U28A 1KZ9A 1HDXA 1TO2E 1MPTA 2J3EA 4C29A 3GZJA 1C50A 1SIUA 2XQGA 3K6SB 2WJYA 4QYMA 4DJJA 2W8ZA 1KO5A 2D5AA 2RONA 1E9RA 1RHQA 2L2QA 4QUDA 2XUPA 2EL9A 5CVUA 5C4IA 4PC7A 4TVKA 1WCYA 1P2BA 1W4AA 2NSDA 3EGDA 3RVSA 3N7UA 4RVDA 1QGDA 2Q0QA 2PV0A 1UBOS 4XFKA 3DV0B 4M60A 3IT2A 1OFHA 2UZ1B 4O5OA 3FLBA 4PVCA 3WXBA 3CR7A 1FTNA 2O4UX 4QBKA 1WTCA 4FIDA 1QP8A 2FWBA 2XDQA 3SC4A 5ADHA 1GLVA 2JI8A 5EPUA 5PNTA 2GKGA 3D1LA 4KIGA 2GARA 4IYRA 1M1YB 2TSYB 3DHWC 3KJGA 2I65A 4YUYA 2IY7A 3RR2A 4NXNB 3JRWA 2V7PA 1E1RA 1H93A 4N0MA 3UAOA 2C4UA 2I78A 2C3MA 4P9NA 1DPGA 3PDCA 4P0TA 3URMA 1QK4A 2JK1A 3IDOA 4TN1A 2P1DA 4DXAA 5BSKA 4ZVVA 2HCTA 2WFLA 3ELBA 3K30A 4N8DA 3A1FA 1OBCA 1I0ZA 1XN1A 1UOQA 5EP4A 2BH9A 2BFAA 1G3UA 2M9MA 1A5TA 3A04A 2REQB 3M4ZA 4C2TA 4JL8A 1IUOA 1L9XA 2FZCA 3VR5H 3MJFA 1AD2A 2H59A 3D6HA 4D0NA 4B3SB 2X14A 2XB6A 4FEAA 1ZZEA 1RBZA 5TNXA 3ZHRA 1R8JA 3NRCA 3UIEA 3G0HA 2DTDA 1JPJA 2X7XA 5FHQA 3HWX1 2OLKA 3AP2A 3DWEX 5TX7A 5FWYA 4DBLE 4BPBA 2ZSIA 1ND5A 1GFSA 3M3HA 1FDWA 3DVAA 4U2EA 4OLBA 2ECOA 3HR7A 3VYRB 1RRKA 1ZD8A 3H2KA 4FFPA 2NXJA 2HAEA 4O4LF 5LMZA 1V8ZA 4KGDA 3R8XA 5IDVA 2R25B 3DL2A 1GSAA 4WTOA 3UENA 4UQOA 2A5LA 4U0KA 3TL3A 1P3DA 1PR6A 2RMKA 2ZJFA 1A5ZA 3DNFA 3EC2A 4OXXA 4QU8A 5K0LA 3PB3A 5K6AA 4CQNA 1JYEA 2X40A 2XOXA 4N7MA 3LUDA 1E6MA 1USWA 2ZPUA 5FOWA 3ZY5A 4EG4A 3O94A 4QTYA 3ON5A 3JVDA 5E95A 2C31A 2JFYA 3NFRA 4GX1A 4Q3KA 2RHRA 2A7XA 1GL3A 1TAQA 3MLEA 5TDHA 1BA3A 2XWBF 5EQTA 3SBDA 2HX1A 1H1LB 3JQEA 1IOWA 4R8MA 2FZLA 3FSJX 2A0WA 2FMXA 4FT2A 1HE3A 1VBMA 3PC8C 4UREA 1YR6A 1QE3A 2WWFA 3D31A 2GN2A 4MAMA 4Y2RA 2FFQA 1K2VN 1V1MB 4WE3A 4XYEA 2NAPA 5MGNA 1FSPA 1TIBA 2JFQA 1TA4A 3ITDA 2YHUA 2Q3MA 5FULA 1J97A 1SNYA 1T6ZA 4NENB 4R1OA 3UV7A 3ZUPA 4JA0A 4B76A 4ZFNA 2W7TA 1AKWA 2OZPA 1EFUA 4K9DA 2CE7A 4FB4A 4NBSA 4XOIA 3MF4A 4E70A 2BV3A 1PYDA 2VAXA 1PGNA 1WHTA 1ZHFA 4XGRA 1VYHA 5IARA 2G7ZA 3TCNA 5KSPA 3DPUA 1KRWA 4ZI3A 1EX6A 1XD8A 3BQ9A 3NNSA 4AUKA 1E2LA 4B2LA 4BVBA 5JFGA 2JFOA 2VP9A 4PYOA 3ZHYA 1E1CB 1YBFA 3CEMA 4WXRA 3TEJA 4ACAA 4GBJA 5IWAB 1D1PA 1LDNA 1U0TA 4A6EA 3U9SA 4CMIB 4R9RA 1IWPB 1SC3A 3DR3A 2R1VA 1Z0AA 3EMVA 2XMGA 3QLVA 3WRWA 1JN0A 3ERCA 3ZGOA 1H1TA 3KDSE 3OFSA 1OQAA 3OT1B 1YACA 3OTQA 4II2A 3T54A 1ZSVA 4IDBA 3HY4A 2OB1A 2BD0A 3NOVA 1BJKA 3MRVA 2NVUB 1KFBB 1X80A 2PK3A 3I8XA 1T6YA 2CB0A 1EUDB 3HL0A 2WKWA 4ZXFA 4DTCA 1RRCA 3RYFB 1T9DA 2V6IA 2W4IA 1C9EA 3EN0A 4NSNA 3UTCA 1QANA 1QNLA 5HKBA 3MIIA 4KMMA 3GGSA 5L6MB 2H65A 1W30A 1CYDA 2V7GA 5FP0A 5KDDA 2P9HA 1V8BA 1WKVA 3EPKA 4ZVKA 4KAFA 3TMYA 2XDWA 4GAEA 1CJSA 1LQ2A 2F17A 3WGGA 3GFVA 1KZHA 3FMGA 3T7IA 2DQZA 4G5YA 1XWFA 4L02A 4BL5A 1XNHA 1EQ2A 3QLTA 3IUMA 4KQEA 4I5GA 3VYSB 1Q21A 3HRHA 4L0MA 1JFSA 4PYJA 2H00A 3RYHA 1PQYA 1W1WA 2A9RA 3E18A 2Y93A 2IYXA 3P96A 2D2FA 3FKSA 1E3SA 1I3LA 4YP9A 3ZWKA 3FGZA 5CGQB 4A0SA 1S8NA 2WC1A 1JFLA 2KYRA 2OY0A 2ZAMA 5MGBA 5ENVA 1EEHA 2JIZA 2PO5A 3CF0A 4GUAA 2LCQA 1W47A 2VDJA 4OQ4A 3HO8A 1TFRA 2BE7A 1O3YA 1SXJD 4XSGA 3ASUA 2NV6A 3QE2A 3DZ8A 2PA3A 2EHJA 4DIBA 2QRMA 1OOEA 4GXRA 1KZGB 3O8QB 4P38A 1DIGA 3GPLA 1Q44A 3PHGA 4BMZA 1ZBQA 5GJVC 4KH0A 5BV7A 2EZ8A 4A3SA 5KNDA 2DWPA 1CRZA 3H84A 1P7VA 3H3JA 3KZMA 4Q9KA 3W5JA 4EZBA 1QF9A 2CHQA 2OD9A 5C8ZA 2ZJZA 1MW8X 4IUCS 3EMKA 1M6WA 2R66A 2MINB 2Y1XA 1UFVA 3NYWA 5KIAA 2MWMA 5DYWA 1CF2O 2ECPA 3MBKA 2BGTA 4HAVA 4OL0A 1RCFA 3WQBA 1Q1QA 5GM2A 1PK9A 3LC2O 3MT8A 1XU7A 2LPMA 3CURA 4G8DA 4XRRA 2IX3A 3U39A 3L1VA 2BUCA 3S40A 2YASA 5B6PA 4I5IA 2P68A 3DVLA 4M0EA 4R16A 1X8KA 2PFKA 1QZ3A 4H59A 4PM4A 4XM0A 3VSDA 5CAEB 2IS1A 4RL6A 2BI7A 3H86A 5IJWA 1NNLA 1Y82A 2ZIVB 3Q2KA 4MR8A 1WF3A 4CIWA 3ZWDA 2JF0A 4CMHA 4EF6A 3A31A 3DO5A 2Y3IA 2CDAA 3NV7A 1XQWA 3RVOA 2Q3LA 4JLMA 3QWIA 1I3KA 1UC8A 1OASA 1I0LA 1LI7A 3INGA 3Q5DA 2QB5A 2G4CA 3LDAA 1QGZA 4IEEA 1NNI1 2ZB7A 1PS8A 3JARB 4PICA 5L7TA 1NW9B 2WILA 3I42A 3UJAA 3LOPA 3BJZA 3T9EA 4RSMA 4BMXA 3QJ5A 2BTEA 4LNAA 3DHNA 4YROA 4OA8A 1DCKA 1E3WB 1N8NA 1BXGB 4KTTE 3ETHA 1FS5A 3WLTA 1IY0A 1V5FA 1RU3A 2DR0A 2EBWA 1OLSA 4U2GA 3CMMA 3GZTB 4E15A 2BDUA 1FQWA 3G2PA 4RO0A 1D1TA 1J49A 3DB2A 1PNRA 3LYLA 4NMMA 5EOVA 2RCNA 1EFPB 1D4AA 2J5XA 3VGJA 4IH1A 3MBOA 1LH0A 1NF2A 3X43A 4E33A 4LUCA 4M1ZA 4Q9AA 4Q9DA 5H1YA 4C0XA 3NEAA 1PK7A 4JQYA 2Y0EA 2BJWA 2W2TA 3F5MA 2VTVA 5L53A 3Q3CA 3K16A 1U7OA 4DQLA 4ZCIA 5HCUA 1HF3A 1YQWA 4ZK2A 2D5CA 3SM3A 1VIVA 4N41A 1XR3A 2AKAB 1RRGA 2R6FA 3SKVA 2EEPA 3R8CA 4OHVA 3Q6MA 4BMPB 4WCDA 5TT0A 2CVQA 3EGWA 3DYIA 4QOJA 5DXAA 2YW2A 1BJTA 2BKEA 5HPYB 2JHCA 2AVNA 4G24A 4AZ3B 1QHFA 4RHCA 1PJCA 2MSKA 2QLLA 5FPQA 5T4FA 4U63A 3W7VA 4W9RA 4W7SA 5HCIA 2GEDA 4E2ZA 5AOBA 4NQRA 4CKWA 4RHYA 4C0BA 2QSYA 1M8GA 1HDCA 4EKNB 2RG1A 3H97A 3UT5A 3KQLA 3FPLA 4PG7A 4NL4H 4NATA 2GBLC 4JYMA 4NH0A 5K8IA 5A0VA 5DBIA 4BKMA 1GNVA 3DEZA 3NHUA 3QXCA 3PHJA 2QWXA 1KMHB 4DDTA 2XCSB 5JASA 1T1JA 2FLKA 4LDJA 2QVXX 5K45A 4MUE