5TIIA

Comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
251
structure length
241
Chain Sequence
b'ELELGLRGKKALVTGGSRGVGRGVVLALARAGVDVFTCYREESDASASLARELKQLGGDHHALRADLADPKQIAELFQEVGRRFGTLDVVVNNAGVISHVPYAELPVAEWQRIVDVNLTGAHLVIQHAIPLLGDKGSVISIGSKSSEVGIPLRAHYTATKHALRGLTRSLAKEYGRSGLRFNVLALGVVETEAEMTKFYSTKTALGRLGTPDEVAGAVAWLASDLSRYVTGATIHVDGGIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-ACP reductase
publication title Comprehensive Analysis of a Novel Ketoreductase for Pentangular Polyphenol Biosynthesis.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Oxidoreductase
total genus 89
structure length 241
sequence length 251
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tiiA00
1Q1NA 1P1HA 3GVHA 1ZEMA 1NQOA 3PWZA 4Q3NA 4BV8A 3AW9A 3U5TA 3PQFA 4BKRA 3UH1A 1WPQA 3H5RA 4UEJA 4Y8VA 5IDWA 5CEFA 1EDOA 5C5IA 4DREA 1PWZA 2QX7A 1GDHA 3OQ1A 1E3SA 1QRRA 3JQ7B 3U4HA 4EEXA 2QW8A 4OIMA 4CUZA 2EXXA 4D3FA 4MVJI 3L6OO 1E5LA 4EJ6A 1DLIA 1U3UA 1C0KA 5HWSA 4RLHA 2PNFA 1E77A 3ONDA 2JAPA 1CDOA 1W4ZA 3CMCO 1CWUA 5T5QA 3ZHZA 3R3SA 3VZQA 3C1OA 1JAYA 4IDCA 2X0NA 4HP8A 3ZZNA 8ADHA 1MV8A 2DVMA 2CVZA 3QVTA 3RD5A 4GX2A 1R0KA 2DTEA 5H82A 3W6UA 1E1KA 2TMGA 5JLAA 4TZKA 3HE3A 5COQA 3PGJA 4F45A 2A94A 1SAYA 3EVNA 4J43A 5L3ZA 1E92A 3ZV5A 3PHIA 1U28A 1ADCA 4ZRMA 5HS4A 5I7EA 1IZ0A 3H2SA 1KC3A 3R1IA 4BO5A 4MKRA 3JQDA 4FC6A 4Y67A 3M1LA 3UGKA 1VLLA 1A9ZA 2E48A 1VRWA 3GRKA 5IF3A 1K3TA 2O3QA 3DBLB 5KVCA 3DBRB 4JLWA 1LNQA 2HAEA 4FOSA 1HLDA 3TN7A 2I67A 4CUKA 4CMBA 2PGLA 4FJ2A 1V3VA 3W4IA 1V0JA 4MKZA 1IE3A 1DO8A 4TRRA 2Y68A 3WB9A 2YDYA 3QVWA 1K5HA 4AJOA 4GAEA 2W2LA 3IP1A 1JTVA 4BGEA 5JBIA 2O48X 3I6IA 2OO5A 1ENZA 1NASA 4CMEC 1FJHA 1DRWA 1X7HA 2PZLA 1C3VA 3A28A 2YFQA 4YBZA 1I2ZA 1YE3A 4CPDA 3O03A 3ONEA 4KMSA 5EN4A 1XQ1A 2V6BA 3MEQA 3KRTA 5L4SA 4FQ8A 4BO4A 4DMMA 3ETGA 3VH4A 3H3JA 3AY3A 4GSKA 4KOAA 4XYEA 2NVBA 3IAHA 4NFHA 3HB5X 3U9LA 1CIVA 5GMOA 1M2WA 1EQUA 2C82A 2PTGA 2ZJ0A 3A06A 2HMUA 3BMOB 5I8ZA 5GZ3A 1BG6A 3A9WA 4L76A 2Q4EA 3ULKA 3H5NA 3RC7A 3UFXA 4XD2A 1PL6A 2FR8A 3GGPA 3W8FA 5A04A 4E5PA 3FR8A 5A05A 4NJMA 3H9UA 3RUAA 5EPOA 3PLNA 4IJUA 2VT2A 2D1YA 3IJRA 2Y1EA 4RF5A 1ULUA 3FF4A 4J6FA 2GZ2A 2UV8A 1T2DA 4YYZA 4DPKA 3WXBA 1OBFO 1VL0A 5TJHA 5JO0A 1F06A 2FSSA 2O50A 1E5QA 4FW8A 4UVEA 3IMFA 5DDIP 3VH2A 4J3FA 4J4TA 1JVBA 1QKIA 3RASA 3JQGA 2R00C 3V2GA 5TRTA 4ZJUA 1PQUA 4DYVA 3DOJA 1MXFA 5KVVA 3QWAA 1F8FA 1XG5A 4W9NC 3WOHA 4BB6A 4J2HA 3WMXA 5A5FA 1B15A 3IJPA 5JY1A 1ONPA 4E5NA 1N1GA 1WLYA 2C29D 1E7MA 1DAPA 1QXSA 3PVZA 3H3FA 3CEAA 1FDVA 2ZCUA 4YCAA 4IXTA 3V1YA 2J3HA 3INRA 3BMCB 3UVEA 4R16A 4I5EA 4L4SA 4M8SA 2Y1DA 1PU2A 1O94A 3JYPA 5EQDA 3WYEA 4MIEA 4PLYA 2NQ8A 2NU6A 1BDMA 5HBRA 4ND4A 1U4SA 1ID1A 4TRMA 3HN2A 3WIDA 2SCUA 3LDHA 3KBOA 1YOVB 4PLVA 3WMWA 3WGOA 4Q3BA 1S6YA 2NTNA 4Y6RA 6ADHA 2HSDA 1UAGA 1QP8A 5F1PA 5JAMA 5KKCA 2D5AA 1ISMA 5H83A 4XQEA 1N5DA 3LLSA 2GASA 2J8ZA 3ZWMA 4HNGA 5L7TA 4R4JA 3CE6A 1NTOA 1PEDA 4WCFA 4DQVA 3WSVA 4E5KA 1LTHR 3R6DA 4YJGB 1KVRA 1R12A 2F1KA 3H5AA 4MVJE 1A72A 1P1KA 4TKMA 1WAMA 1P9LA 3U4IA 1NQ5A 5CPBA 1ZBQA 4G65A 3LC1O 2VWQA 4KP7A 1DFHA 2C5EA 1NAHA 4YT8A 1QYCA 5EJ2A 2D8AA 2H63A 5JYDA 2DC1A 5MDHA 5FI5A 3ADPA 5HA5A 4WLEA 1V8BA 5KTKA 4E2WA 4E4YA 3KSZO 1P3DA 4BNKA 4Y6SA 3G17A 4IMRA 3HZZA 3NAQA 2P9GA 1NAIA 1P45A 2IEBA 3GVXA 3MOIA 3PGXA 1LLQA 1EFLA 1JVSA 3BMQA 1U9JA 3SJUA 3W4JA 1GAEO 1T26A 3I9MA 2EIHA 3IDSA 2PKQP 4B3JA 3GGOA 5G0VA 3C7DB 2W2KA 3EW7A 2Y0DA 4NFYA 5JXWA 1GFSA 4L8VA 4NDNE 3U49A 4M54A 4IUYA 4FCCA 4UUMA 2O3SA 3FR7A 4P4LA 2WD7A 4BO0A 4Z9YA 3EUWA 2QG4A 1B14A 4FFLA 2JHGA 3LLVA 3JQAA 3WICA 4YAJA 3G1TA 2CDAA 2BF7A 3AFMA 1YXMA 5TJ9A 2X4GA 1JWAB 2V6FA 1WP4A 2EGHA 1GCUA 5DZSA 1IZ9A 3PYLA 4GVXA 4IINA 1KIFA 3ZW8A 3I9KA 4R5MA 2PD3A 3TNLA 2PY6A 1Q0LA 4MVJD 1YJQA 4YPOA 2VZ0A 2PWZA 5BSFA 1JA9A 3GEDA 2EF1A 3FHLA 4LVCA 4ZRNA 4MDHA 4OHUA 3UCEA 5DCUA 4YJHA 2C7GA 4OYRA 3V8BA 2I3GA 3HDHA 2GF2A 3LVFO 1PZHA 4YXFA 3KYBA 4ND2A 4II2A 1NM5A 3ANLA 2VWGA 5A9SA 1WVGA 3SC6A 3U4CA 1A4IA 3RFTA 1F0YA 3K8ZA 5IAAA 2JAHA 2X23A 4OO3A 5DN9A 4YRAA 1H6AA 3HDJA 4E33A 1QSGA 7ADHA 4RPHA 3DHNA 4GLOA 5CHEA 2EKQA 4IS2A 5JMPA 3VH1A 4JJIA 4DUPA 4HX5A 1YL5A 1I2BA 1LQUA 4CMKA 4RVSA 2FPIA 4MIOA 1LX6A 3GY0A 2X0JA 3MWEB 1LRKA 2OOSA 2D5CA 1I3LA 4CM8A 1EK6A 4TMFA 4LN1A 3GG2A 1KOLA 1LDNA 3WTBA 2AQ8A 3LU1A 4J4HA 1CF2O 3TZHA 2J3KA 5DBGA 4I9UA 3NT4A 3SJ7A 1UUFA 4NJMB 1VKNA 2NLOA 3QVXA 1F17A 1B16A 4FGSA 1ISFA 2RH8A 2NSDA 1MA0A 1N8KA 1T2FA 2X86A 1MGOA 1QR6A 3C7CB 3GDGA 4IQ8A 4YEDA 3PJFA 4CLRA 1GEEA 3GVCA 3MWDB 1NWHA 2D0IA 3GA0A 2PD4A 1YB5A 3HB4X 5LDGA 3BIOA 3JQGB 4XGNA 1R66A 1O9BA 1PR9A 3HHPA 2Y99A 4BHTA 3OQBA 3JYOA 2EW2A 4QXMA 1SB8A 1Y7TA 4R5HA 4AJ1A 1P1FA 2BFMA 1DIBA 3C1TA 4JNKA 2OZPA 3RC2A 2DPHA 2ZB4A 3DAFA 3PQEA 5ER9A 5TX7A 2NU7A 3ZNOA 1ZSYA 4PG6A 4E21A 4YT4A 5A06A 2Y0CA 4LCJA 4Q3AA 3I83A 4GKBA 2VHXA 1YB1A 4OMUA 3QLJA 4FS3A 1HT0A 1DJNA 3R0IA 4PG7A 5EERA 3PHGA 4DQUA 3VVCA 3EK2A 4YDRA 5JAQA 2WYVA 3W1VA 1EE2A 3KB6A 4RVGA 4XR4A 1KETA 5IFLA 3FSRA 1C14A 2J5RA 4BO8A 4RDHA 3ZU2A 1XQ6A 3UXYA 2QYSA 2Y1FA 3ADOA 3P5SA 4JQCA 1P1IA 1ZJZA 5ITWA 4CLXA 1GADO 2ZIZA 2NU9A 4BUCA 1MUUA 2VWHA 3SBOA 4ALJA 3BTVA 3HG7A 4QEDA 3OIDA 3VTFA 3VPSA 3RKUA 3PTZA 2UVDA 5BNIA 4S1VA 8LDHA 1PJ3A 1TXGA 3ETDA 1H2BA 2YV1A 1NHWA 2WM3A 3Q11A 2CMDA 1N9GA 3M6IA 3GAFA 4HKTA 2C59A 3K9QO 4WCFB 3GMSA 3NDRA 2Q4BA 3GVPA 1PJCA 3MOGA 4NK5A 4OL9A 4YQZA 5BSEA 3E82A 4YVFA 3PJGA 3VPXA 3ROMA 5KJ1A 1ZSNA 3W4KA 3S2GA 2OFPA 1LA2A 4QT0A 2GN6A 1J0XO 1BXKA 3QE3A 2Z95A 1R0LA 2FZWA 3DZFA 2HCTA 4W7IA 2Y1GA 1NP3A 1B0AA 1HSZA 4Z6KA 4D43A 4GVLA 1BGVA 1B8VA 3GZ4A 3BMQB 3DAPA 2AA3A 2JD1A 4K26A 4P8RA 1HE4A 3WQRA 1PGPA 5JSFA 4OOEA 1YDWA 1B2LA 1E3WB 1DB3A 3MZ0A 2GN4A 4EJ0A 2W2KB 4IIVA 1LRLA 5U4QA 1EMDA 3DOCA 3ZCXA 1I3NA 1SEPA 4WK6A 5T57A 3WJAA 1GZ6A 4TSKA 4OSOA 1D7OA 3JCZA 5JAZA 1GUFA 2EW8A 4BNJA 1H94A 1GL3A 2WD7B 3VVBA 3IL2A 3M2PA 5KVSA 4DA9A 2WE8A 1DHTA 5T8KA 4UUPA 2P5UA 5IJZA 3ASVA 4XGIA 4B7XA 3D1LA 4CMGA 5ILOA 3I9JA 3JQAB 4J7XA 2PFGA 3WGZA 3GPDG 4DTIA 3DWFA 1ZKMA 1UP6A 1RKXA 2Y66A 5KKAA 4R3WA 1LC3A 1DSSG 4IJKA 4OKNA 5KJFA 2CVQA 4MO2A 4EJMA 3WWYA 3HSKA 3C7AA 3E9QA 4Q3EA 2ZTUA 2AEFA 2C07A 3GNTA 4GWKA 3Q9NA 2OHXA 1O0SA 4HADA 2EEZA 4J0EA 4J91A 4L9RA 1Y9AA 3CUKA 4N5NA 5F3RA 4XYLA 9LDTA 2VRBA 5L53A 4O59O 1SEVA 1GYQA 2C5AA 3QWIA 1T25A 5JW6A 3DBVO 3RKRA 4MP8A 2Q45A 2B5WA 1PGQA 3HN7A 2WYUA 1DPGA 5IXYA 2HRBA 4TRJA 3VAZA 1P44A 2CDBA 4IDAA 1BXZA 4JP3A 5H81A 5A9SB 1WZEA 3WNVA 1IUKA 1MXHA 1K6JA 2FSVA 3RUHA 4UVIA 1U5AA 2IZ1A 2AEMA 2YQ4A 4ZGWA 1GYPA 1U3WA 2PLAA 2ZQYA 1Q7CA 3QIVA 3QWFA 2NVWA 2I76A 3FNEA 1H5QA 3JD0A 4RF2A 2J5KA 2OP0A 3ROQA 4C7KA 3QY9A 1LEHA 4CMIA 4G2NA 4CM8B 1DLJA 3H8VA 3PDUA 3ZNQA 5DBFA 2DBQA 4J9UE 4YACA 3DZJA 5KJEA 1JU9A 3JYLA 3I52A 3RUFA 1XA0A 4NIMA 4CMHA 3WQSB 2C2XA 3E5MA 2GPTA 1ADGA 1KEUA 1V35A 4J7CA 3S8MA 5AXAA 4EITA 1NVTA 1T2EA 5TIIA 1ISGA 4HFMA 2EHDA 1LQTA 4BB5A 2JL1A 1B3BA 1IY8A 4IIUA 4WE3A 4IDGA 3RUEA 1KVTA 3DMTC 3NEPX 4ID9A 3AOEA 3ASUA 4R3NA 4B7CA 4CLRB 4QTZA 1HEUA 3LC7O 1X14A 2AEJA 4B4OA 1LLDA 3W8EA 4R9RA 1TLTA 1D8AA 1HL3A 1VM6A 2V6MA 3SC4A 5F5LA 3CPSA 1IL0A 1XEAA 3D3WA 4RO0A 1UDAA 3IC5A 2X0IA 3F46A 4W6ZA 3BMNB 2YYYA 3ZWOA 5AQ1A 4LVUA 3CSDA 3P19A 4PLFA 5TF4A 1VL8A 4IJWA 4J16A 3TF5A 1ZCJA 4WLNA 1QORA 4IJVA 5KJ6A 4ZA2A 3ZWCA 3OH8A 4EZBA 4G81A 2O23A 4WCDA 3ZNNA 1R6DA 4FFNA 1GZ3A 1DC3A 3DBHA 1TVEA 3G3EA 5A3VA 2NM0A 4DIBA 2HQ1A 4W82A 4PVDA 2Q2VA 2BFPA 3L9XA 3EY4A 1I24A 3HADA 1H6BA 4YAIA 4R41A 2DLDA 2WE7A 3ITDA 4CLOA 1GD1O 1D3AA 2IZ0A 2WWRA 1LLUA 1MC5A 4YJGA 3NGXA 3JQ9A 1QLHA 3P7MA 4NBTA 4AG3A 4MVJA 3PJEA 5JNLA 3WYBA 1U7HA 5C3MA 2X58A 1LI4A 1N9GB 4YJFA 1T2CA 2ZTMA 2GLXA 4LRTB 2HUNA 1VSUA 1Y81A 2I3AA 4I08A 1P0CA 3BAZA 3FNHA 3GGGA 2Q1UA 2YZ7A 3DAGA 3ZU4A 3WWZA 4CM4A 2VT3A 1HDGO 3I6QA 3L6DA 3ANMA 4RPJA 3WFJA 1CRWG 1I01A 2NNLD 2OXIA 3H65A 1JKIA 3U4DA 3NV9A 4J1QA 1LDBA 4TVOA 4JBGA 4YT5A 5B1YA 4MVJP 2B83A 3WGIA 1TI7A 4UEKA 2ET6A 4ND1A 5BSHA 1O5IA 3O26A 5L51A 1HDZA 1CERA 1H6DA 3HFGA 4IY1A 3UKOA 3QSGA 3ICCA 3OFSA 4H3VA 5U9CA 3D4PA 1BDBA 3V1UA 5C37A 3AU8A 2ZTLA 1B3RA 3QA9A 4KDFA 3WSWA 3EGOA 4D7AA 1EDZA 2BH9A 1K6XA 1HYHA 4UREA 2HJSA 3QHAA 2G82A 4R1TA 2XXBA 3BTSA 2NV6A 3WQQA 4BKQA 3AUTA 4BGIA 3EDMA 4HXYA 3K96A 4P22A 1NYTA 1PR3A 4WCFC 3UOGA 3VDQA 5T67A 1YL7A 1KEWA 2GUGA 4FD3A 5B4TA 4HUJA 3GNSA 2OP1A 1EVIA 2QQ5A 2Y67A 1GYRA 2QRLA 3QQPA 4DIFA 3NT2A 2H1SA 4OJNA 1X7GA 5TS3A 1PS9A 4FGWA 1XKQA 1PIWA 4CODB 4URFA 4YWJA 5K6AC 4TQGA 2NTJA 4E13A 1XIVA 2CY0A 1MFZA 2D3TA 5JYEA 4RPLA 4INAA 5CDYA 1OOEA 4L0QA 4Q3DA 2C20A 3KSUA 4H7PA 4RVFA 3AI1A 1QLJA 4TRNA 5IDXA 3RROA 2CUKA 3RC9A 4EYEA 1KYQA 2A92A 2Y1CA 2D4AA 1F8GA 4MVJF 2YW9A 1Y8QA 3TL3A 2GR9A 1ZO8A 3I9OA 3JYNA 1OI7A 1AHIA 3RIHA 2G1UA 2O7SA 4A2CA 5BR7A 3ENNA 4O5OA 1E6EA 3L4BA 4N18A 1VE9A 1Z73A 3HNPA 3WGGA 1QYXA 4ROSA 3WFIA 2DAPA 4U7WA 1O8CA 3ZWWA 1ZSVA 3VH3A 3PWSA 3QV1A 3ZWAA 4AVYA 3B1FA 4CL8A 2VN8A 5B37A 4E12A 1A5ZA 1HKUA 4CMIB 4FFRA 3ZWNA 1U4OA 3KSDO 4ZVVA 4YB8A 3VZPA 3CKYA 4IDEA 2NUAA 4YRBA 3FNGA 4LGVA 3WGHA 1KS9A 2IXBA 1Q0QA 1U3TA 4ALMA 2WSBA 5GZ1A 4B8ZA 1AE1A 1EQ2A 3GEMA 1OC2A 1XSEA 1U5CA 3DONA 4MP3A 2DT5A 1ARZA 2PZMA 3NTQA 2VHZA 3U0BA 2GDZA 4CV0A 4IGFA 1JKFA 2R6JA 1NVGA 3GR6A 4M87A 2Z1MA 5AXDA 4JN6B 5COBA 4BNVA 3OJEA 4Z9FA 4I8XA 1GQ2A 4JCOA 4K28A 4RCVA 4NMHA 4WOKA 1WXDA 1YH3A 2VOJA 3D3WB 2NTVA 1AHHA 4DVJA 3GPIA 3K6JA 1YBVA 4PCVA 3ZU5A 1IYZA 3IKTA 5I8WA 1M75A 2NU8A 9LDBA 3I3OA 3VZSA 4J9VA 3BHMA 3A1NA 1U2DA 1F12A 4M89A 1YBMA 2FPPA 1MLDA 4RVHA 4LW8A 2ZYGA 4QFDA 2O3UA 3K5PA 2Y0EA 3DBHB 5COAA 1T2AA 3ZWYA 1PS8A 1BW9A 4JROA 1DIAA 4DWVA 1JN0A 1G6KA 1WWKA 1UDCA 2G17A 4J1NA 4NBRA 1K89A 2UAGA 4B4UA 4BNUA 1HXHA 1V9LA 2X6TA 2ZB8A 3HDYA 3JD4A 5ER6A 5I9NA 5JDIA 2YQ5A 3GRPA 4GX5A 2FY8A 3ROKA 3WBBA 3E8XA 4CLOB 5BT9A 1NHGA 1O89A 3NYWA 5HM8A 1P1JA 3H4VA 2Y93A 4D44A 4RJTA 1WMBA 3PWKA 1E3IA 4RLSA 1ZMTA 4NR0A 4R68A 3TOXA 3W6ZA 1E6WA 4AJPA 1VI2A 4RZIA 1QV6A 2E6UX 3MTGA 3OETA 3PRJA 4YJFB 5C7LO 4LISA 4NQZA 3ZWVA 4Y6PA 1E7QA 5L4LA 3SVTA 1QYDA 4CM4B 1YQXA 1EUZA 4C7JA 3TZ6A 1N1EA 3LQFA 4B7UA 2ZTVA 2QRJA 4IBOA 4CUJA 2GN8A 3V5NA 1Z82A 3WIEA 3KTDA 1RYDA 4WNIA 3TFOA 1EZ4A 3H9QA 2FOIA 1X0VA 1E3WA 4FIZA 3MJEA 4TROA 4DIOA 2AHRA 1QV7A 2OL4A 2OBYA 4BGVA 3I9LA 3VZRA 4C4OA 1ZK1A 2C7VA 3VKUA 1EVYA 5L45A 1ENOA 2P4HX 3WLFA 3IIEA 3RJ5A 1DRVA 4TZTA 3TRIA 1ADFA 1D4FA 1ENPA 3F4LA 1EEHA 4I5DA 4WNCA 5L95A 1W8DA 4XEHA 3T4XA 3DFZA 1E1LA 3RUDA 1FDUA 5L7YA 4LMRA 5IDYA 2YHUA 1UXJA 5LCXA 2WDZA 4JX8A 5DULA 1LDYA 3WLEA 1EBUA 3UUWA 3H2ZA 1OFGA 4MVJH 5CG1A 4ALIA 2AE1A 2B5VA 1UH5A 4XQGA 2E82A 4KUGA 3L0DA 5JY6A 2W90A 1Y6JA 4IS3A 1ENYA 2FP4A 3BTUA 1ULSA 1A7AA 5A9RA 5HS6A 2IXAA 1JAXA 1Y9EA 2NWQA 1Y8RA 2BD0A 3KLMX 3ABIA 1YDEA 3PK0A 4M1QA 2Q99A 3G0OA 3WGTA 4CMCA 1AUPA 4UVHA 3DZBA 3NX4A 4JJFA 4N7RA 4BVAA 3AM3A 3O9ZA 4BNWA 4WLUA 4XIJA 2R00A 2CDCA 2PH5A 1G1AA 1MX3A 1GU7A 1RWBA 2P5YA 3ZW9A 4BNTA 4DLAA 5A03A 1KERA 4GMGA 4QO8A 4R1NA 3ZWBA 5G0SA 3S2EA 4CLDA 1FDWA 1ZXBA 2WTBA 2GRAA 3JD1A 4D41A 4XGKA 4FDAA 1C1XA 2H6EA 2XXJA 2DFDA 1A27A 1TT7A 3T4EA 3SEFA 1Y8QB 4AL4A 3I5MA 5FYDA 4CMJA 4F46A 1X7DA 4Q39A 2GCGA 4BNHA 1J6UA 4PFJA 4YRDA 1VC2A 2EERA 4JK3A 4YJDA 1ZK3A 3STHA 4MIYA 1BTOA 2PV7A 4J4BA 2JFFA 4MINA 3KZVA 2AQIA 1GTMA 2HDHA 4GWGA 3NDJA 4IPTA 2PZKA 4FSHA 4XDYA 1A7KA 1O95A 2W98A 4AFNA 3VPHA 4IMPA 2EJWA 4B3IA 4NBUA 4QFCA 3L77A 4MVJG 4NHEA 1X13A 1LU9A 2HU2A 4YAGA 1ZUD1 3PIDA 3V1TC 3OBBA 1E7WA 3DTTA 3GF4A 2DBZA 3DHEA 3WG9A 3VC7A 1VJTA 1VKOA 4Z3KA 3JQBC 4LSWA 4DGSA 4D3DA 3EVTA 2AG8A 3K73O 3BMNA 2BGKA 3LC2O 1UZLA 2FWMX 2WEKA 1H2HA 2HMVA 1EK5A 1PZFA 1SOWA 3PQDA 1H9BA 2CF6A 7MDHA 1RM5A 3LYLA 3MTJA 1U2GA 2HK7A 3MJCA 4FFOA 3WBFA 4AJ2A 5DF1A 1XU9A 1B8UA 2JCYA 1LLCA 3O38A 5A5EA 1KC1A 5FEUA 1MFPA 3PFWO 1Q2XA 5CPFA 1R16A 2XPCA 3OM9A 1F14A 5FI3A 3TQHA 2NVUA 1W0CA 3E48A 5EMHA 5IN4A 3PDJA 4ZQFA 2NADA 3HDQA 3ST7A 5BSGA 1I33A 4PG8A 3U3XA 3OJLA 1MB4A 2BHLA 3TDKA 1GZ4A 5KJCA 2RHCA 4DLLA 2PGJA 4NG5A 4R1UA 3QVOA 4TWRA 3INTA 3AUAA 1R0SA 1LDMA 3CXRA 1XHLA 4MP6A 5IZCA 4BNMA 5I7SA 3BZUA 1ISIA 3Q2IA 4XQCA 5A1TA 1BW9B 2W8ZA 4RF3A 3ZNPA 4HV4A 3RAJA 1XLTA 3EC7A 3F4BA 4I9HA 4S3MA 3CH6A 5ICSA 4Y98A 3TFQA 4BMNA 2BLLA 3AOEC 1YBAA 2ZQZA 3NUGA 3RC1A 4JGBA 1GCOA 1HDRA 4B4VA 4N54A 3L07A 4PLZA 4YTEA 4XB2A 1XELA 1GV0A 3QP9A 4GLLA 4MPDA 2IEDA 1MG0A 3JQEA 2DM6A 2PA3A 3B1JA 3GAZA 3R3JA 4L73A 2O4CA 1HDYA 5F5NA 1PX0A 4BNXA 2Q46A 5TLSA 2GZ3A 4Z0TA 6LDHA 2Q1SA 2AQHA 5U1PA 2GZ1A 4H16A 1NNUA 2HMWA 3E03A 1Z45A 1B7GO 2X5OA 2VZ9A 4GL4A 1I0ZA 1Q7BA 3PZBA 2J3IA 1E1NA 1WZIA 4KQWA 2A35A 3UCXA 3UAGA 5FF9A 5TNXA 1E7SA 1KY5A 3DOOA 4CM5A 1E3EA 4XWYA 3SXPA 1NX6A 2UYYA 3OEYA 2FPGA 1Y5MA 2XF8A 4XZ3A 2P91A 4OSPA 4R01A 2B69A 5HTOA 2VYVD 1GUYA 3KEQA 4FJ1A 4GQAA 3TWOA 1RM0A 1UZNA 4CM6A 4CM9D 1Y5RA 2QZ9A 5AOVA 2BFAA 4OKIA 4E3ZA 4KQXA 2O3JA 4IM7A 3M1AA 3GLQA 3EZLA 3JQ9C 1ONNA 4P4NA 1E3JA 2O3TA 4IQGA 2GN9A 1I3MA 3P2OA 5CEEA 3IUPA 1DEHA 2W4QA 1ZFNA 2B0JA 1J4AA 4AJIA 2BELA 2VHVA 1NQAO 2PGDA 2YJZA 4XA8A 3D4OA 4WKGA 3LK7A 1JWBB 2RH4A 2DBVO 4CQMD 4MVJM 1WDLA 3LF1A 4TKLA 1A9YA 1Q7GA 1YL6A 1TT5A 2I66A 3KO8A 4PZEA 1I32A 3GN2A 3BHIA 4M49A 4WLOA 4RVUA 4Z0HO 3ZV3A 1SCUA 1I3KA 5L9AA 3JQFA 4DPLA 5DBIA 4HFJA 1NQTA 2Z5LA 5I7VA 2Q1WA 1WDKA 4Q9NA 5JDCA 2OMEA 5B4VA 2P68A 2QYTA 2VHWA 3PPIA 1SBYA 4GGPA 4NNJA 4QX6A 5DT9A 1X15A 1Y8RB 3L4SO 3OJFA 1LUAA 4HFNA 4RQTA 1JDJA 3RFXA 1DFIA 3GDFA 5CDGA 4UUNA 2ZK7A 4GBJA 4BQRA 4LMPA 4NU6A 4CM7A 1R4NA 4XCVA 4RPKA 3L9WA 5ILGA 1XGKA 2VQ3A 3GVIA 5JCXA 3K30A 1L1FA 4PGFA 5HRUA 2VZ8A 3DHYA 3RBXA 1C1XB 1V6AA 2Q2WA 3W8DA 3UN1A 4O63O 4FN4A 3RBVA 4XYBA 1T1RA 4XRGA 3KV3O 1CETA 5IDQA 1N92A 1GQQA 2VRCD 1XU7A 2CZCA 3D5QA 4W7HA 3CZRA 5JMWA 4XB1A 4E31A 4UULA 4O6VA 4BMSA 4EEZA 4W4TA 4IGEA 2E49A 3JQ8A 4FPXA 4WEOA 1J49A 3KYCB 2O3RA 5KOIA 5IXSA 4BQPA 2FN7A 5KWEA 3LZ6A 3UICA 4GI2A 2QRKA 3MCVA 3COSA 4XKJA 4BNNA 4DLBA 4FR5A 4MOWA 4WOJA 2FRDA 2H5LA 4CM1A 1RJWA 4WPGA 3IUSA 2VCYA 2ZYAA 3DEYX 3QWBA 5CP8A 4IZHA 5G2OA 1PJ2A 5C7IO 4CQLA 1C1DA 2JCVA 4NBWA 4PLHA 4RQUA 1B8PA 3B20A 3V2HA 4OQZA 3M2TA 1ZJYA 3WTCA 2LDBA 3AOGA 3A4VA 3L4BC 4E32A 2RIRA 4XQ9A 2JFGA 4BOYA 1ZXLA 3NKLA 1T4DA 2O4UX 2V6GA 1ZVMA 4DL9A 2I99A 2NVUB 4N5MA 2VWPA 1E1MA 1KVUA 1QG6A 1WNTA 2C2YA 4JJGA 1GEGA 4D46A 4QQRA 2ILTA 3LT1A 4DQXA 3DZHA 1HZJA 2D59A 2HK8A 4MKXA 2GSDA 1T1SA 5A3JA 1E6UA 4P4GA 2QIOA 2E4AA 3DR3A 4D0SA 1NVMB 4GGOA 1I5RA 4HY3A 2PD6A 4ITUA 1IB6A 3TZCA 4L4XA 2BGLA 2XOXA 2Q3EA 1PZEA 1EUDA 1ZH8A 1VJ0A 3OJOA 4KTVE 5AVOA 4AJJA 2J6IA 3QWHA 3U09A 1VL6A 5EINA 3F5QA 3N74A 4JXKA 4WECA 3DMYA 4KWIA 3HQ4O 1V3TA 4WLVA 2X7HA 2YHIA 1DBVO 3FBTA 4Z9XA 1U8XX 4PRLA 5KIAA 1ISHA 1X1TA 4U0JA 4E2YA 4RV9A 1IPEA 1AGNA 1HE5A 1R4MA 4R54A 4EGFA 3OICA 2JHFA 1PL7A 1C0PA 4BL5A 1AXEA 3ZH2A 4UVDA 3RFVA 4XDZA 4PLWA 3AUSA 4HNHA 2GERA 5EIOA 3KETA 4ILKA 5C7OO 1NBOA 1U3VA 2GD1O 4A03A 5ENVA 2CD9A 5AXCA 4CV2A 4ALNA 1M66A 3WNQA 3OQ6A 5MGBA 2X8LA 1SZJG 3FBGA 4CMAA 2OGUA 5JAIA 3A14A 1U1IA 1GQYA 4NK4A 4BO1A 1WW8A 3ZI0A 2BGMA 1ZNQO 3DXFA 4PG5A 1WMAA 4PN3A 1PGJA 3ITKA 2CVOA 3LT4A 3Q1LA 1LRJA 3GFBA 5JDIC 1ZW1A 2V7PA 1RYEA 2JD2A 4J49A 4CR7A 3LF2A 1FDSA 4K6CA 1ZK2A 3DFUA 4DYDA 1PJQA 2DUWA 5EQFA 2FZEA 3KXDA 3ON5A 3NJ4A 4DBZA 1SB9A 4CLHA 5GZ6A 3EHEA 3PZRA 1KEVA 1PGNA 2VYND 1XR3A 4CR8A 4E0BA 5CDUA 3RUIA 1G0OA 4BO7A 4ZQHA 1MG5A 5A9TA 3AFNA 4E30A 4CJXA 2IZZA 3DL2A 3KYDA 3KLPX 4NBVA 4GX1A 3OHSX 4WUVA 2WJPA 4F3YA 2XAAA 3D0OA 3CIFA 2GNAA 3NT5A 4R9SA 3PEFA 1JKJA 2P9CA 1P0FA 1TT5B 5G0TA 4GX0A 3OECA 1A71A 5B12A 5IG2A 3IQDB 2WYWA 1UR5A 1YVEI 2RCYA 2IE0A 3OA2A 4GSLA 3TSCA 2GGSA 3F6YA 2YFHA 1TB4A 4CL3A 3DMTA 3VOSA 4PLCA 4OXYA 1MP0A 3BXXA 4AJEA 3KEOA 4CV1A 3WR5A 1DAOA 1R4NB 2RBEA 4EUHA 5TT0A 3OSUA 1G0NA 3FRJA 1BRMA 3ZHXA 2Y05A 1ZMOA 4AJKA 1BWSA 1Y1PA 4MJLA 4UAGA 3ORFA 3FWNA 3G79A 1UXIA 5F1OA 4R69A 4AJHA 5LDHA 4BKOA 4ZHSA 3AM5A 1VPDA 1W6UA 5FWNA 2P2SA 1T4BA 1HF3A 2CNBA 1K6IA 1L7EA 1XWFA 2ZKLA 3UCFA 1OZAA 1BVRA 2ZB3A 2VUSA 3LSYA 1GR0A 3T7EA 4R51A 2DFVA 2HK9A 5DNAA 3GMDA 4DPMA 3JQ8B 3K2BA 1SMKA 1DXYA 3FN4A 1EE9A 2VTEA 1ONOA 1EBFA 1GPJA 5F1KA 4YT2A 3D64A 3PIIA 4HWKA 4BO6A 1C0LA 1BXGA 2QHXA 3RSHA 3IP3A 3TZKA 4P38A 5JPIA 1QMGA 3HFSA 4Y9DA 5T6BA 2HKIA 2YY7A 2FHSA 5JC1A 5J23A 4DBVO 4PLPA 1NPDA 3GH3A 4CQLB 1C1DB 3FTNA 3S2IA 4AJNA 2VTDA 4NU5A 1FF9A 1XCBA 4UVGA 3ZV6A 5K9ZA 3X2FA 3N58A 3WS7A 1NXQA 3B6ZA 4E6PA 4IQ0A 2VYVA 3H9JA 3AK4A 4A10A 1LJ8A 4CM9A 1BMDA 4LCEA 4OQYA 3S2FA 2ZJ1A 4OXNA 2PZJA 1U7TA 4ZD6A 3ZV4A 5A4DA 4XYMA 4RPGA 4U5QA 4WJZA 4BO2A 1NR1A 3NTOA 5G0WA 2GYYA 4ALKA 2FR1A 3NDIA 4ZICA 5CEJA 1UP7A 2E37A 1IULA 1DC6A 4O0LA 1GUZA 3DB2A 1Z6ZA 4BKPA 4PLGA 1HLPA 1IPFA 2B36A 2UUOA 3GN1A 4XX0A 4XJTA 5AYVA 3L6EA 5CDSA 3AY6A 4BNIA 3SX2A 1RPNA 2VUTA 2O7QA 3GEGA 3GQVA 1YONA 3FD8A 3FNFA 4CQMA 3LT0A 4IZIA 4Z0PA 3AUUA 1ZK4A 3D3EA 1QYVA 3HJAA 1DC5A 2A9FA 4NH4A 3DZIA 3MJ4A 3MJTA 1RM3A 1YGYA 3AJRA 1E0DA 1EFKA 1AXGA 3I23A 1PL8A 3KHUA 3OJ0A 3Q6IA 2HLPA 4B79A 3RUCA 4ESOA 1BSVA 4F6CA 3K31A 2C0CA 2DBRA 4A7PA 2AW5A 4ZU3A 4JBHA 4U8GA 1HWYA 4EUEA 1DHRA 1UAYA 3NTRA 2DTXA 2YHIB 4NPCA 3RI3A 5G0UA 3DDNA 1LC0A 3GHYA 4B8WA 4BV9A 1I2CA 4OM8A 4RGBA 2B4TO 3VPGA 1R4MB 3G49A 2BI8A 4RZHA 3WGQA 4FFPA 4AICA 4A73A 1LSUA 5G4KA 3WDSA 4H15A 3RU9A 3EYWA 4FJ0A 1DC4A 1HTBA 2BMAA 2AMFA 5K6AA 5JE8A 2Q50A 3GZNA 1HYGA 1EVJA 1PJTA 2D2IA 3DO5A 5KVQA 5IZCC 1V3UA 5DCWA 3ZWPA 1ORRA 4CMEA 4TVBA 5ADHA 1PQWA 5ICMA 1KBZA 4IDDA 4BO3A 1E7RA 2EWMA 3C24A 4PVCA 4YQYA 2C54A 2VRCA 2BKAA 1HRDA 5BNTA 4HBGA 2X0RA 1KVSA 4GPD1 1SNYA 3FI9A 4EW6A 3ZU3A 3DQPA 3CZMA 3D5TA 5TT1A 1UDBA 2PK3A 3OEWA 5BNFA 3MJSA 2EGGA 3NRCA 1CQIA 5BQFA 1PWXA 1DIHA 1DJQA 2I9PA 3PXXA 4BNLA 4L4RA 1YWGO 3GUYA 2HMSA 4LK3A 5A02A 4M55A 4BO9A 4L74A 4J90A 1L7DA 3ONFA 1HZZA 3H9EO 3KVOA 5CDTA 3EZYA 3KYDB 2ZB7A 1PGOA 1YO6A 2BI7A 1N7HA 3N7UA 3JQ6A 4XR9A 3WJ7A 5CG2A 2P9EA 1IHXA 5CFZA 1C0IA 3GUCA 4B4WA 3O8QA 2OBNA 2ZYDA 1CQJA 4PG4A 3VPFA 1X1EA 3EAGA 4YAEA 4NFSA 4J0FA 1O6ZA 4ZQBA 1UXGA 3JYQA 1EVZA 1LDGA 1HETA 4I9NA 1EUCA 4K6FA 4NZ9A 1H0KA 3HWRA 1HDCA 1SOVA 4PLTA 3F1KA 2POQX 4W9NA 5EESA 1AN9A 4D3SA 2VOEA 3E18A 2X1HA 1JW9B 3E9NA 1XYGA 4ND5A 5ITVA 4D42A 2B4RO 5DP2A 5F21A 3PYMA 5FFFA 2DQ4A 3PYXA 1YRLA 3UHAA 1B26A 4PZDA 1Z7BA 2PKRA 5T8KC 1TA4A 1ZK0A 5T64A 4M86A 4EDFA 2Y1OA 1P31A 5THQA 1M6HA 1YQGA 5JS6A 3D7LA 3DTYA 2V65A 3OIGA 3VTZA 3OP4A 4D79A 3AI2A 1DRUA 3KYCA 5KNLA 4ZN6A 4PZCA 1ADBA 4OH1A 1YKFA 3S1LA 4PRKA 2CF5A 3I4FA 3RBZA 2IODA 3DZGA 3VDRA 4QSMA 1GV1A 3UF0A 2Z1NA 4J1SA 5JCJA 2AG5A 3NGLA 4ZQGA 3K92A 1UZMA 1HDXA 2HRZA 3KOUA 1N2SA 4DC0A 1I36A 3BHJA 3JQFC 4FOOA 2BFOA 4EUFA 5I9LA 4FFMA 4OXKA 4YA6A 1PZGA 5JDCC 3X2EA 4OAQA 1BHSA 3LT2A 4UEOA 1LDEA 2JD0A 4DC1A 1YB4A 3O4RA 5L4NA 1K2WA 4OGWA 1BXGB 4FC7A 1UP4A 3PI7A 4KUHA 3H9GA 4R1SA 3T7CA 3Q2KA 4DXHA 1LXCA 3PLRA 2UUPA 4CV3A 3DZKA 4RL6A 3H7AA 1J5PA 1DIRA 5IN5A 3IS3A 3JV7A 4WLFA 1LSSA 2HJRA 3F5SA 2W2LD 4A5OA 4N5LA 2EV9A 5LC1A 2EJVA 4II3A 2DTDA 1UJMA 4JIGA 2I6TA 4UUOA 3Q0EA 2BRUA 2UDPA 3C3XA 3AU9A 5EL0A 4KTTE 1PSDA 4ND3A 4A27A 1PS0A 4U6QA 3ZWXA 4CR6A 3INGA 5L7WA 1H93A 4F6LA 2ZCVA 1LSOA 2VYNA 3ICPA 1PJ4A 4ONEA 3QRWA 4FB5A 4G5HA 3IOYA 2GO1A 1U8FO 2HO5A 4U0KA 4NJOA 5JFOA 4B3HA 1RM4A 3Q9UA 2EKLA 3WYCA 3UW3A 4KUEA 3RQSA 3CMMA 5ES3A 1LBEA 3I1JA 3VKVA 2X9VA 1Z74A 3RVDA 3TJRA 4HFRA 1E3LA 2VNAA 1HE2A 4J2OA 4CQMB 1D1SA 4BNGA 2G5CA 2PH3A 3F9IA 4I1IA 4O1MA 5G4LA 1GPDG 3ZDFA 3EMKA 3TL2A 3AI3A 3E5RA 2VUUA 4BMVA 1KEPA 1UXKA 2RHRA 2O2YA 4I5FA 2PKQO 3QJ5A 4A0SA 5IZ4A 2J3JA 2EKPA 3TZQA 1R37A 3S55A 2B4QA 3NJ8A 1YS4A 3C85A 3JD3A 2WMDA 3B1KA 1P77A 1NPTO 2DU8A 3JQ7A 4EBFA 3H6KA 4RORA 5ENDA 3SLKA 4DRYA 4YAKA 1SPXA 5TSDA 4I5GA 3GDOA 2I65A 3GG9A 1CJCA 5G4KB 4JP2A 1I30A 4KZPA 4XIYA 4QO7A 3GZNB 3MJVA 3I9NA 1CEQA 1M76A 2YV2A 3FTPA 1PJSA 4RVDA 2X22A 2EP5A 3AY7A 2IRWA 2J5QA 4Q3CA 1DIGA 2X9NA 4D45A 1SO8A 3P2YA 3K2EA 2AXQA 4GMFA 3G1UA 2O2SA 1NR7A 1T24A 1KY4A 1WDMA 1NPYA 1YJ8A 3WGYA 4LSMA 1DOHA 1SC6A 4BS9A 4X54A 4QECA 3FPLA 3PHHA 1OMOA 3ZN2A 1OC4A 1Q0HA 2IYPA 2H9IA 2FMUA 4IDFA 3E6AA 4IDBA 4WEQA 4LRSB 3TOZA 4YR9A 2Q1TA 3DBLA 3GC6A 2OUIA 4KWHA 3DBRA 4BNFA 3GT0A 1PQPA 4L75A 3BYZA 4E2ZA 3VHRA 3ETEA 4PIVA 2JJYA 4EI2A 5I7FA 2OORA 1IHYA 1LSJA 4FBGA 4GH5A 4IXWA 1Z7EA 1ZIDA 1IOLA 4K9DA 3O8QB 1W73A 5AXBA 3V2UA 2VHYA 1JLLA 2AQKA 2QZZA 3OF2A 2LDXA 5KCZA 5DOVA 1HSOA 3I4CA 3JQBA 5K0ZA 3RWBA 3ANNA 4YJHB 4BGUA 5THKA 2CFCA 3QW2A 4KDEA 2FR0A 1MC4A 1P74A 2YUTA 3KM0A 2ZATA 1P33A 5TQVA 3BMOA 1VSVA 3BTOA 4Z3DA 4BNYA 2JCXA 3GOHA 4CM3A 2X5KO 2Q49A 3FPCA 2NACA 3OIFA 3HUDA 3CINA 4WGGA 4XYGA 2B35A 2RAFA 4U6SA 3JD2A 2DKNA 1ZEJA 1NFQA 4AJ4A 4BKUA 1TEHA 2IYOA 3OMLA 4BNZA 1ML3A 4AJLA 2TMDA 1CYDA 5JO9A 2WD8A 1FK8A 3C8MA 2DUUA 5DP1A 3PFFA 1H6CA 1NFRA 1QYWA 2G0TA 1XDWA 3JQAD 4NI5A 1H9AA 2JFHA 2IDZA 1E7YA 3C1AA 3RCBA 3AWDA 3WX0A 4RDIA 1X0XA 4GKVA 4J7UA 2NQTA 3PHLA 1N7GA 2X9GA 3GK3A 4XJSA 3GNQA 3ENKA 1PJBA 1DDOA 4DMLA 4XRRA 3FWZA 2DPGA 3JQCA 5GY7A 3D4NA 2JKVA 1M6WA 1DFGA 1PJLA 1HE3A 2VNSA 3GHHA 3JTMA 3AM4A 4E5YA 2YV3A 3ZHYA 3Q3CA 2G76A 4E2XA 1I10A 2X5JO 3F47A 1K0UA 3PP8A 2CSUA 3QVSA 4W99A 1KVQA 3JSAA 3U62A 1ISJA 1A4UA 2F00A 3PHJA 3ROPA 1FXSA 3BMCA 1VJ1A 3ZGYA 3SLGA 3DC2A 4J1TA 1BVUA 1GY8A 2AE2A 3GFGA 3ZHBA 3KUXA 5DOZA 1HYEA 1R15A 2R2GA 4A26A 5TGDA 1FDTA 1ZZEA 4ZQEA 2B37A 1OAAA 5B4UA 5JC8A 1JQBA 3RU7A 2PR2A 1YOVA 4QUKA 3E1KA 4WASA 3FCOA 3B70A 3TPCA 1NFFA 3F1LA 3OA0A 3CTMA 2P4QA 1S7CA 3IKVA 1P1RA 3RJ9A 1D1TA 1HDOA 1I8TA 1Z75A 3BA1A 4BIIA 5L40A 5TC4A 2HMTA 1UXHA 4RF4A 2YDXA 4K1LA 4OOFA 1M67A 3F3SA 5DCYA 2A4KA 3PJDA 4ALLA 2I5PO 5JCJD 1FMCA 1PTJA 2EG9A 2Q2QA 4JBIA 4E5MA 5I9MA 5CAEA 1NWCA 4CLEA 2EP7A 1YQDA 3E9MA 4D0RA
chains in the Genus database with same CATH superfamily
3PE3A 3TSYA 1P1HA 5TMPA 2ETXA 1RQGA 4FGZA 1SOMA 4NYJR 4Z0NA 4AECA 1OCEA 2GZMA 1M33A 4RPCA 3ZHVA 4BMOB 3PQFA 3AT1A 1SUCA 2O1XA 5IJ9A 3OJWA 3RM3A 4ZVOA 3WLKX 3U3KA 2OLJA 5MFPA 1BEZA 5AW9A 5IDWA 1RW4A 3W2IA 1JQDA 1NVAA 1UPXA 2AXPA 1ZD3A 2H2IA 4HDRA 4NARA 5C5IA 3JASB 4FB4A 1PWZA 5BMOA 1GLGA 3KE8A 4ZEVA 5EIEA 3JQ7B 2QW8A 3PC3A 4CUZA 4D3FA 3O3CA 4MVJI 5C31A 4EJ6A 4ZVRA 5HWSA 4DV0B 3AJ8A 2PNFA 1DTSA 1S2GA 2CBXA 2J45A 2VBGA 3N8DA 4C76A 1N4AA 2G72A 2H4ZA 4IILA 1NL3A 2WRZA 4R0MA 1T6NA 3HL0A 4MAAA 3CMCO 4PSDA 1CWUA 5T5QA 3ZHZA 3SY8A 1MJ5A 3ZBPA 5I4CA 3VZQA 2JRCA 3N2LA 5ADUS 2X9QA 1HY3A 3IAS6 4B3DA 4GOLD 3TZEA 4PR3A 4BP3A 1JIQA 4OHKA 3QNMA 1MV8A 1ZH6A 2DVMA 1KAHA 3C6QA 4I6GA 1VJ5A 5E9AA 2EZ9A 4GMDA 4HOYA 3RD5A 3RK4A 3IAS1 4NRDA 4ND8B 4MQFB 4MEAA 1FDIA 2R1ZA 1DBQA 4WBSA 1TO1E 5FLYA 5ELXA 3AQIA 3T7KA 3U61B 3C4QA 3HBLA 5F5XA 1W4RA 3WOVA 5SYMA 1QP0A 1EWYA 3EVNA 5FD8A 3S68A 4UTPA 2BKLA 3JQPA 3O91A 3PHIA 3W0LB 4AMBA 1DX6A 1A4XA 3K7EA 3RHFA 2HCRA 4BWVA 4P0PB 4GBGA 1RI1A 3ZW7A 3I2FA 4R84A 1KC3A 2JI9A 1V2HE 1G55A 1K97A 2R68A 3D6MA 3E4CA 3SKXA 4BO5A 1MH1A 4RMJA 1OILA 2RB4A 3RSLA 1A9ZA 4BP8A 5ECDA 5DTMA 1JFFA 4AWXA 4R2MA 1FNSA 3KT3A 5L6MB 4D4IA 3B53X 4ZAVA 1KDYA 2O3QA 1Q6ZA 3DBRB 2ENWA 3I6ZA 2HAEA 2RC5A 4P4SA 1FX0A 2C3YA 5K0EA 1T3TA 3ZY3A 2EEPA 3OPVA 3DB1A 2KYRA 3QTTA 1IE3A 3CISA 1AB5A 2X13A 4TTJA 2WUGA 3OUTA 5JT1A 2QBYB 4YGXB 2YDYA 3B7GA 3G82C 4EMBA 2W2LA 2OGSA 3IP1A 4RTJA 4N7JA 4NONA 2H2FA 2QSUA 2H2WA 4OK3A 3I6IA 2OO5A 1DRWA 1O1YA 2FGJA 3UJAA 3WKDA 3OC6A 4ODIA 2R2AA 1N6PA 3H9BA 4HGQA 2V6BA 3TKYA 1P0MA 3MEQA 3Q6MA 2IHTA 4W8OA 1RLMA 1EESA 1G7RA 3HB5X 3LRPA 4UEWA 3B3FA 3HSSA 2C78A 2F3RA 2VLBA 3FAZA 5GJVC 5GMOA 5KHAA 4YRCA 1TPYA 5HE8A 3ENVA 3L7CA 1EQUA 1YTUA 2ZJ0A 3FROA 2VL7A 4NAUA 3OCUA 3AHCA 2ZSUA 2F9MA 4L02A 3NTXA 2F55A 3ZE0B 4ENWA 3EXHB 3RC7A 4XD2A 4HGPA 4EPVA 3EYAA 3MMNA 5E6RA 5A04A 3IA2A 2NZVG 4JNCA 1W4LA 4DHEA 1G7SA 4ZHSA 4IHQA 6GPBA 1EX1A 3HDVA 3KJZA 2VT2A 2A9OA 4TSFA 1DG9A 1ULUA 3FF4A 3ANSA 1EP3B 4PWYA 5HF6A 3ZCVA 5FBWB 4YYZA 4ZJPA 4ETNA 3BGDA 5KQGA 1P4RA 2XYQA 4DPKA 2LE0A 1GDTA 2NN3C 1OBFO 1VL0A 1E2DA 1ZD2P 4YCNA 1JSLA 5JO0A 1YVUA 1F06A 3FNRA 3MWDA 4OJTA 5EIWA 5DDIP 4OY3A 4J4TA 1JVBA 1QKIA 3RASA 4NKRA 1SPBS 4IV0A 4EHLA 2UXCB 2R00C 2EFGA 1AKQA 3QEKA 3V2GA 1CY1A 4QUGA 5EHIA 5JROA 4C6SA 1XZLA 3H2YA 4KR0A 3V33A 3RWOA 3C3DA 1ESCA 1SC9A 2JAOA 3QYAA 5F2NA 3U60B 1G66A 2Z57A 3RWMB 4W9NC 1P18A 1BXRB 3SS8A 5JY1A 3IJPA 1TLFA 4U02A 4CTKA 3EPPA 4GU5A 3ZQJA 2SKCA 3CEHA 2O8EA 2JPDA 4HAYA 5KNDH 3RV3A 1E7MA 1U7UA 2R96A 2B7LA 3ISJA 2V7XA 4LRYA 4BATA 1L1EA 3H3FA 5DI3A 4XD7D 1ZDMA 3CEAA 3FETA 3SF8B 4F4IA 1I9GA 3S4YA 1KQOA 3MVEA 2Y6VA 2P8JA 4R16A 1K3FA 4I81A 1L4BA 4WSOA 3BN3A 3ODPA 2WG0A 5E6SB 4LHSA 3AUJB 3SYKA 2FWIA 3MTIA 4OJQA 4HI0E 4D4HA 2Q6LA 5EXSA 5K0SA 1ZUHA 1Y1RA 3WWPA 4G6ZA 1Z56C 1CQWA 1J2RA 3C6MA 3MHPA 2F4NA 3HN2A 4IDPA 4TRMA 3WIDA 4K8RB 2KW5A 2VKTA 4LCBA 2V7UA 3KR9A 1QQBA 2PT6A 4OHPA 2OUKA 3BOSA 3JWHA 4LI0A 4ZQCB 2OZKA 3WMWA 1GPWB 1E6CA 2OFXA 4DLXA 3QU7A 6ADHA 2Q5IA 4WFKA 2ZPAA 3ZCQA 1QK4A 4LOAA 2RDMA 4P83A 1T1IA 4WK4B 4ML3A 5FWYA 4OL0A 4QOEA 5HF8A 2IGBA 3EQ6A 3IILA 4EY3A 4V0QA 1F3LA 2IS1A 4GFDA 4MITA 3STWA 2OCYC 3EXIA 5CM2Z 1LQ2A 4DQVA 4E1BA 3K0CA 1J5XA 3SIWA 3HM9A 2K87A 3OPNA 1LTHR 2QTLA 2HHAA 3SLRA 4B81A 3BFKA 1R12A 1CPYA 2F1KA 4NBLA 4MVJE 4N65A 1EFAA 4M1TA 4ZAFA 3REFA 4QVGA 3GLHB 4N5IX 5EE9A 1Y3AA 2B8TA 4OBEA 2V0GA 1PL0A 4UTOA 1NAHA 3JAKA 1PZXA 5AVVA 2BTQB 2NSLA 1J25A 5K3CA 3OCWA 4X44A 2QJTA 5EJ2A 1KJZA 5JEEA 1GILA 5JJ5A 2CDNA 2ABWA 1N78A 3ADPA 1E2PA 1XRLA 1GGVA 1V8BA 3HDGA 4WLEA 5KTKA 1X2EA 4V0NA 2AFRA 2CHEA 1UDWA 3NAQA 5FPQA 1JHOA 1T3HA 3GEBA 3JRXA 1NAIA 2HXSA 4LF7B 2XXAA 5AK4A 2FWBA 5AKEA 1Y3FE 3ZGNA 1EFLA 1Z17A 1MAVA 2PWYA 4KQ9A 4R2IA 1IMOA 2X0DA 1GAEO 3QY0A 3S3TA 4F1JA 1MABB 1U7OA 2EIHA 4I4TA 5ES4B 1EGQA 2P0EA 2C00A 4YR7A 1E32A 2QN9A 4HDMA 5IYZB 2GCEA 3ZDAA 3MPOA 3PC4A 1N0HA 4FYXA 2ODTX 2G5TA 1KAEA 4D8XA 5JXWA 2HPVA 4L8VA 4RK5A 3JVEA 5EP2A 4IUYA 3ORYA 121PA 4NCXA 1OYOA 1FLVA 4Y2GA 4D4LA 1SULA 2CXNA 1ZICA 2JBWA 1HI9A 1RXUA 5CJJA 5IK2A 2MU1A 4O4IF 2IX3A 4R2XA 4PQFA 4FFLA 1FTNA 4AT1A 3W2GA 2X3FA 4BLUA 2A0UA 2V1XA 2HSJA 4CU5A 4YAJA 4BTVA 2BF7A 1LBHA 2ZTHA 1YR6A 4AIIA 2QG9A 2XCIA 3DMHA 5AKLA 1YXMA 2HR1A 2C57A 1G64A 1W4AA 1JWAB 3H1PA 4I8DA 4TLEA 2EGHA 5DZSA 2HA0A 1QH1A 2ZR7A 1IWOA 1KMHB 2HJWA 2HZBA 4HYEA 4K46A 4JR1A 5CHYA 2GCNA 3BCHA 3AFHA 3TNLA 5LD2C 2HC9A 2V3WA 3R7SA 5CITA 2VZ0A 1JA9A 4L3WA 1KSHA 2EF1A 2FU5C 4LVCA 3THXA 4ZRNA 4DSZA 3CKMA 4UD2A 4IQFA 5DCUA 4H27A 2XGGA 1RZRA 3EPHA 2ZVDA 4MLZA 5JSYA 2F48A 4YUVA 3K05A 2I3GA 2R8ZA 3FUCA 2GF2A 3QPAA 5FKJA 3RVLA 4QRIA 2OWDA 2D1RA 1WXFA 3VTKA 1UBJS 2OXTA 1GGEA 2MINA 3JR7A 2QUBA 1AQLA 2J6HA 3FBWA 3KZ1E 3LFUA 4OB7A 3R75A 1NF8A 1DJPA 2N42A 3FDZB 3SZGA 3RFTA 1SZCA 1X7ZB 1Q1GA 5C9ZA 2JC3A 2PX0A 2QJRA 1GGJA 3ASYA 4JA2A 1PNQA 1ZG3A 3I76A 4TL6A 2FWAA 2FW6A 4BCDA 4B3RB 3CX3A 1L4KA 2IE8A 4LYHA 4C4PA 1FYXA 1H6AA 4E33A 3N0XA 1QSGA 4Z5XA 2QGNA 4GLOA 2W0MA 2Q4DA 2YJGA 2BIFA 3CT6A 4WH0A 1YL5A 4LRUA 1VLQA 3O1HB 4AN4A 1XZCA 2QLLA 3DOHA 4Q1CA 4RVSA 4MIOA 2CNOA 3SR0A 4MDYA 5DLQC 2P40A 3V48A 5IBCA 3LPMA 1D0SA 4UHKA 4W5HA 4KMOA 1VJRA 3MWEB 3TG8A 3AYXB 2BGRA 1D7AA 1EK6A 1OLUB 1Q1EA 1L7PA 3B1WA 3QPUA 1TQ8A 3N1UA 2IYUA 3KX2A 4LN1A 4UCXA 1YZGA 3RVMA 1IY0A 1Z0UA 3MIIA 3NP9A 3TPZA 4QZVA 5JWOA 1GZ5A 4YLYA 2ZIWB 4J4HA 4M6WA 2WTEA 2ZANA 2JI6A 2ZYIA 4NJMB 3N2IA 4B8YA 3FTDA 5G3YA 1A8PA 2EL7A 1Y37A 3EIQA 1BD3A 1K7SN 3QG5A 5KX5B 5IM4F 1ISFA 2RKWA 3BB1A 1JYSA 1JH8A 1M0WA 2D1QA 2UYHA 3AHIA 1HPLA 1MENA 2GYVA 4Z8XA 3K9HA 2JKZA 3QEMB 4GXNA 1IHDA 4G4IA 4EAQA 4NZNA 3C7CB 1YS7A 4IQ8A 3CPHA 2PGOA 4YEDA 3REQA 1RYNA 1TF7A 1IZ7A 1NWHA 3GEIA 1YB5A 2FPKA 3EMDA 3N8KA 5F23A 4B46A 4ZAWA 4OAOA 4XPIA 1R50A 3G8YA 1R66A 5IVKA 3Q8KA 3HHPA 4BHTA 1KBQA 4JUIA 2TSYB 2OD7A 1QWOA 2IPNA 3DAYA 1MRZA 2A1UB 4QXMA 1MZVA 3WGMA 1KZ4A 4RD0A 3OZWA 5E4FA 1DIBA 5MFZA 1NLFA 2JGKA 2OZPA 3P94A 1JLHA 1K9VF 4HK4A 4TLAA 2ODQA 2BGUA 1QANA 1P0IA 2XWPA 3EFOA 1ZSYA 3QH4A 1ESDA 2Y0CA 4LCJA 4YJ2F 4Z7QB 2GBCA 1QCDA 3HABA 3C0KA 5ARCA 1YB1A 2W0SA 4OMUA 3VPDA 1MOQA 2WSMA 2Q07A 3AUYA 3F78A 3MD9A 1FUEA 4NATA 4CIXA 2Z8YM 4JI0B 4DQUA 1UBMS 2AI3A 2ZIFA 1EE2A 1EWVA 1GZDA 1KMIY 1KETA 1Z39A 1Y48E 1IZZA 5E7QA 4EKYA 5IFLA 1XZ8A 3TTSA 2HH9A 2Q9UA 4Q9KA 1JEAA 3ZU2A 2NU6B 3HYNA 4V1CA 3BGVA 3WBJA 1UDRA 4GDFA 1UT5A 2QYSA 5J9FA 2SCUB 1BKYA 3P5SA 5KZMB 5KNBA 1ZJZA 2QX8A 5AR1A 1V4VA 2GKGA 1II8A 1DEKA 5D8DA 4CI9A 3V7WA 1BDIA 2VWHA 3SBOA 4JT4A 2FN3A 3GCWA 3HR7A 2BJWA 3OIDA 5H1YA 3MINA 2ZRNA 3TB6A 4DLTA 4C9BA 3ZYCA 1QB7A 4HH1A 4S1VA 3ZLTA 8LDHA 1G38A 4FTWA 3EGEA 5BUSA 1L4HA 2WM3A 3IO3A 5CVUA 1N9GA 2VPWA 5JH7A 1LBQA 2H9AA 4B5KA 1T3SA 5EWMA 4X8OA 3AV0B 3H1BA 4BDSA 2Q4BA 2QTCA 1UMDB 3UKDA 3GVPA 1OH5A 3MOGA 4YQZA 4MAFA 1VMIA 3RIGA 2VNIA 4YV1A 3CF4A 1IQPA 3SEQA 2DETA 5LBIA 3NP7A 1KEEB 2PQ0A 5BWNA 1RQRA 2HCBA 3TQSA 3KQUA 1XJCA 1ZW6A 3H8WA 3PJRA 1MVNA 1WKCA 3ESCA 4UATA 3I39X 1ZGZA 3TCKA 5AUOB 3E2IA 3GDHA 4F85A 2H59A 1OY1A 2TS1A 1R0LA 1LS1A 1RRGA 2FZWA 3HRKA 2HJVA 3CWZA 3ITNA 4UTRA 2HCTA 2QLMA 4W7IA 4DRZA 3DZDA 2VHTA 4WIAA 1JIKA 4B09A 3EJ6A 5FL7D 2QE7A 3SHWA 2G1KA 2D62A 3L7NA 4DG8A 3OMXA 2ZUSA 5ALOA 2AN4A 2A5LA 2CHQA 2YWBA 2FTKE 2DJ5A 3BMQB 3ISVA 2XGJA 4P8RA 1HE4A 4GG1A 3ADCA 2HJHA 1O94D 5D85A 1E1CB 2ZJ2A 2FK7A 2C5GA 1KQFA 3IQZA 3ZR4B 2FF7A 3BKWA 5U4QA 1Z29A 4YRRA 1LK7A 3DOCA 3BWMA 2WIJA 3GB9A 1SEPA 2KMLA 3EAFA 3WJAA 1AJEA 3E35A 1AQNA 4TSKA 1HLGA 4DHWA 3T7RA 1D7OA 3K09C 5TQ2A 5JAZA 1BWQA 1GUFA 2B8JA 2VIIA 1H94A 2WD7B 1EGMB 4S05A 3M2PA 4MJXA 3WNZA 3ZDZB 2WE8A 3DE3X 3TIIA 2XJ4A 3DL0A 3OKFA 4U2CA 1TJNA 5IJZA 3EEIA 3JQAB 2OBXA 2VT6A 4HRVA 4LVOA 1QIEA 2ZR9A 4RKWA 1EP2B 3GPDG 4N03A 5IFKA 3FAKA 4MVXA 5HJ5A 5E9QA 2Y66A 3UW1A 2JAUA 2D2EA 1DSSG 1L4LA 1GPH1 4IJKA 4KU4A 5DBEX 2ZIAA 5HNKA 1CJUC 3HXMA 1DTWA 3ILVA 5FWXA 3BB3A 3HSKA 5B3JA 5DI9A 3WWYA 3T1YB 1VPWA 2DFPA 3WL8A 2ZTUA 1ZHHA 2XGOA 4GWKA 2VQFB 2W4IA 3MLAA 1QO0D 1R8QA 1ZNZA 4XYLA 1Z68A 3BL5A 3VKFA 2QTAA 9LDTA 2OZLB 5L53A 3LKDA 1SEVA 4O59O 5C8YB 2E3JA 3KU1A 1FS6A 1YU9A 2FSIA 1L8AA 4MP8A 2Q45A 3HXOA 4CIDA 2K5UA 2B6HA 3DP9A 3U3DA 4QYSA 4DIEA 2WYUA 2I1QA 4E09A 4YP9A 2HRBA 4TRJA 1E4OA 3WGNA 4EVRA 2MJLA 1P44A 2CDBA 2VKQA 1BXZA 4H08A 1F2TA 3M5WA 5H81A 3PC7A 3AVVA 3K72B 1MXHA 3HU5A 5DTEA 3RDPA 3RUHA 1QKJA 2FWNA 3VNQA 1R9MA 1WBDA 1E9DA 4ARIA 2BM8A 4B6GA 2IZ1A 3EXHA 3FOAA 4YAWA 1GZVA 3TGLA 1A7JA 1NBHA 1L5YA 4NXMB 2ONKA 2QTMA 3CRNA 2ONZA 4PN7A 2I76A 2ARKA 2GUWA 2JH9A 4X7RA 3ENQA 1H5QA 5D5HA 4LOJA 2I29A 4RF2A 2ZAOA 3D31A 4RXUA 5AJXA 2OP0A 3A9SA 2FPIB 5EFOA 3H5VA 1KYVA 2I8AA 5LYYA 3EPLA 2PKEA 3T54A 3AETA 5IC5A 3H8VA 2C03A 2J7PD 4JT2A 2ODAA 3U9SA 5SZKB 4MR7A 5AOAA 1E2JA 3C48A 3RFFA 3H2BA 3TRHA 4EG3A 4GE0A 3VPBA 4CMHA 1S8NA 1LFDB 3QMVA 3S70A 5I45A 2ORED 1XTSA 4BRUA 4J94A 4E4RA 1KEUA 4J7CA 1NVVQ 2ZXFA 3OZFA 3S8MA 1DQRA 1NVTA 1T0PA 1T2EA 3KC2A 4ARBA 2PGXA 4RVNA 3QE0A 4NVRA 3NWJA 2ZJ5A 1SVKA 5A2GA 1B3BA 2PKCA 4WE3A 4F9TA 5GINE 2IHNA 1IZYA 4F12A 1PK8A 1Y1SA 1SVNA 1AHNA 2ERXA 3DMTC 5ERXA 3VJRA 4AN0A 3IP6A 1KARA 4RDCA 4CLRB 1N32B 3FMGA 3P0RA 4DDVA 4RD1A 3A4LA 3LZCA 1XI2A 1QRUA 3VRHA 3W8EA 3ZZUA 4CWAA 4B31A 3OZCA 4J7AA 1HL3A 1VM6A 1R5BA 2HT1A 3SC4A 5F5LA 1E4EB 1IL0A 3D3WA 4RO0A 5KINB 1UDAA 2PS9A 5GOTA 5KWSA 1Z16A 2FPXA 3I1YA 3VHXB 4YRIA 4W6ZA 1E58A 2DH6A 4C89A 3ZWOA 2CFRA 3TAUA 5E6SA 2JANA 3EEFA 5G1PA 3OEHD 1G21B 5GGYA 3SC2B 3L1UA 2EFCB 1VL8A 1U0NA 3OQVA 3PEVA 2X8WA 4H3KB 4E03A 1I80A 1HR0B 3T7AA 1E66A 1GZUA 1N2ZA 2O0JA 1D0VA 1EQAA 2VZEA 3SVZA 2Z2IA 4BFTA 3QJGA 4FYMA 4G81A 2IOQA 1F4PA 3P9NA 4WCDA 5BR8B 4GMHA 4W1PA 2ECPA 3ICEA 3EG9B 3U7QA 2JJ2A 3IQIX 3DBHA 4BJHB 1G9TA 4OX9B 4B3CA 2JFBA 3FH0A 1OA0A 3KKOA 2AD1A 5A6VA 3GJRA 5HIAA 2HQ1A 4W82A 3P2IA 2H5IA 2YOGA 4DCJA 5JI3E 4ZT3A 5IHXA 2PLNA 5A7FA 2PL1A 3PTAA 4AURA 2JIOA 1GD1O 1WJGA 3N5CA 1D3AA 1QJCA 1PD1A 2IZ0A 3A6FA 4HDNA 4JCCA 1LLUA 2OCGA 1EAMA 4QPNA 4BFSA 3DQQA 5C51B 4OMCA 2PUGA 3OFVA 1M5RA 1CZKA 2E4VA 4QOHA 3VDMA 4AW9A 4DSUA 5FT9A 5I7UA 3G89A 1GSAA 1U7HA 1ZIPA 5HIIA 1T8SA 4YJFA 1T2CA 5E4TA 4O25A 5DGHA 2HX1A 1D2CA 1VSUA 5LZ5A 3UQYS 4DYHA 2HA6A 2I3AA 3R4VA 1P0CA 4I08A 4PX5A 1UFOA 2Q1UA 2YZ7A 4M3NA 5BSTA 3UMVA 3WRXC 2NSJA 4CM4A 3I6QA 4HEHA 4J3JA 1XVUA 3USZA 4A0RA 1WUTA 5IMSA 3CUEF 4J1QA 1LDBA 4KHZA 2O2JA 2F59A 3HGMA 4ZRDA 3A31A 4RZQA 4ER7A 4B2IA 2AN5A 3RJZA 2VJOA 4GBED 2XQFA 4JHXA 4DNPA 3D3NA 4MLCA 3ND5A 3RYFA 5L51A 3T5MA 4XGRA 2EWWA 2GFQA 4DIKA 4IEFB 4K9MA 1XLVA 3ICCA 2VSOA 1CEEA 4Z4HA 3COWA 3TX6A 1U0RA 2CBGA 4M8IA 3QA9A 5DEOA 3N53A 4QHTA 1SKMA 4F3KA 2P9ZA 3IBYA 1EB9A 4EHKA 7MHTA 1Z0JA 2HJSA 2WYIA 3LIPA 2G82A 1GFIA 5D2CA 1LB1B 3QHQA 4WZ6A 5ALDA 1X19A 2XXBA 2FRVA 1LY1A 2NV6A 3DP7A 5CT8A 4AO6A 1A82A 1BQ4A 1J0AA 4BGIA 2NV0A 3ROGA 2CJPA 2J1LA 2W71A 4M1EA 4MRSA 1GPNA 3Q3JB 3TZLA 5K5EA 2E5LB 2C3MA 2XEXA 3AW8A 5D6OA 4BWFB 1DV2A 1VI6A 2DPXA 1MR3F 2B2XA 2QN6A 2RJOA 4J07A 1KEWA 2WTUA 5KSOA 3ZQUA 3GNSA 4CI0B 4IV8A 1NRWA 5GVSA 4P7GA 2LIPA 3QIAA 4DIFA 1EDBA 3NT2A 3OTIA 3L8MA 2MTBA 2JW5A 3WDLA 2V54A 1EFVA 2UVPB 4PQYA 4RTPA 1PS9A 4FGWA 4G9BA 1YJXA 4RENA 2AVDA 2JG3A 1EM8B 4B85A 5DE3A 2JDID 3T9DA 4BMXA 2UYQA 3K5HA 3GPLA 4E13A 4M9ZA 2FW1A 3FLMA 2WJ4A 5ALPA 2AXEA 3RVPA 2D3TA 3B9BA 1XMSA 1O77A 4Y6GB 4E5VA 4UNRA 1GPMA 1P81A 4RMIA 1ZMXA 1MN6A 1K8QA 4L0QA 4QWMA 2F4VB 1QLJA 1RRCA 3PC8C 3JW8A 3ZIDA 3RC9A 5IKMA 3KJXA 4EYEA 1QZXA 1AKTA 5HFNA 3CLKA 2XVZA 4L5AA 5CTJA 2IOFK 5CYFA 3TL3A 5DMXA 1EP9A 1ZH4A 3I9OA 3GRRA 3RIHA 1N6KA 2O7SA 1TYDE 4PS0A 4YRKA 1VP3A 1SG0A 4YN3A 3WFIA 2R8PA 2Z9DA 4E5UA 1DRKA 1O8CA 1ZSVA 3VR1A 4A8PA 4HZUA 5TQJA 5FYQA 1P5RA 2BP7B 2KBEA 2DHDA 3T94A 3EVCA 5FPHA 1BH6A 1A5ZA 1HKUA 1GA6A 3IXQA 3T7SA 4E12A 3K71B 4FFRA 4GEGA 4DR5B 2LZ0A 4PY2A 2HRRA 3KSDO 2PIDA 4I50F 2F9LA 5IARA 3EG5A 1QE5A 4OK6A 3JWIA 3WGHA 5KYWB 1KS9A 2I3DA 2QTGA 2WSBA 4B8ZA 1NN1A 4BRSA 4RTOA 3T5CA 4Z7NB 3GEMA 5FWAA 2UKDA 5CH8A 2V59A 3SJBA 1RCUA 1U5CA 4ARZA 2C9MA 5F98A 2DT5A 2IDMA 2N1BA 1II0A 1EEXB 1ZI9A 2PZMA 3NTQA 1QS0A 3ME5A 4Q1EA 4A91A 4ZEWA 2R86A 3R4CA 1QZZA 4IGFA 5C1BA 1Q7TA 2R6JA 1W4BA 3BA6A 3GR6A 1DBWA 3I9FA 2Z1MA 2QQEA 3L2OB 4QE3A 4G26A 2ZI4A 4QOGA 4BNVA 4Z9FA 4I8XA 3I04M 1SKAA 3VR2A 4F0JA 2IBTA 1UKVY 1OLXA 4PC7A 4PZ9A 1NW5A 4FX5A 4LDAA 4NMHA 1WXDA 2OFWA 4QD3A 1YH3A 4XLTA 1EG2A 1UBFA 2VOJA 3LCCA 5CNJA 4EKIA 2PAAA 2ZSIA 4DVJA 4OVKA 4RKQA 1FJXA 1YBVA 4I99A 3MCZA 2CEAA 4PCVA 4UARA 4ZXFA 1I5OA 1JHUA 3N8HA 4J03A 3ZU5A 1XT6A 3OM8A 1U8ZA 2XJ9A 1M75A 3DOEA 1UBLS 4MR9A 2G6TA 3I3OA 4F71A 5I8WA 1Z0DA 1XRSB 2O8BB 3N75A 4EJSA 4MQEB 3A1NA 2I6SA 5TY0A 2CBZA 2OHIA 4Q4JA 1RCTE 1TECE 1GSIA 1ZWKA 4GLBA 1NW4A 2QSZA 3SE0A 2PS3A 1RYFA 3T7IA 1A96A 2F3UA 3I32A 4KQ2A 1DP4A 1K8ZB 2JK1A 5JAOA 4QFDA 5AH0A 1KSGA 2CFTA 2O3UA 3GFFA 3OCVA 3V9PA 1SELA 3M6WA 3M6FA 4WXHA 5DT2A 1XKXA 2PHZA 1G8PA 5ANRB 2ZAYA 3FG9A 3V4OA 4PXSA 3SX0A 4ZV4A 4JROA 1DIAA 1VHQA 4IWYA 4MR8A 1WWKA 5LA6B 3TXAA 4A6PA 2P2YA 3PE4A 2JHPA 3C43A 3DO6A 3Q8WA 2G17A 5TMBA 1KEZA 1UFVA 1E94E 1DJMA 4LOKA 2ZB8A 2PCLA 1VYVA 4RBNA 1ZUNA 1Y1KE 2Z9BA 1MW9X 3CUUA 4GX5A 2H2AA 3FGPA 2FY8A 3ROKA 3W04A 4KITB 1TVMA 1IQUA 1EGHA 3OURA 2Q4OA 4MRPA 4CF6A 1P1JA 1S2OA 3I5UA 4KEAA 3OLYA 2XWQA 1WMBA 3FIJA 1NI3A 3WL3A 3FTQA 1C9EA 4RLSA 1KEEA 3ZLVA 1ZMTA 3ZCSA 1OAKA 4HXGA 1OFVA 1VL5A 2A57A 1NU8A 2CJFA 2HHCA 2N3ZA 3GEHA 2D1SA 3K1TA 3O74A 4OQDA 4QGGA 4RZIA 2QD4A 4TMWA 4U39A 4RMNA 3WO1A 4TYNA 1JIUA 2ACWA 3R0QA 4IXNA 5FO1A 5C7LO 4HLQB 1EXNA 5DLYA 5ARDA 3ZWVA 2A88A 3ROXA 2V96A 4K7JA 3TRKA 2NZXA 4BYGA 1NN0A 4C2BA 3LQFA 4CEHA 1E5XA 3R5TA 4R83A 4OP3A 3E58A 2GLUA 2Q2OA 3PGKA 3RFUA 1P1BA 2AN1A 3VOBA 4CUJA 1SGWA 2BHTA 2HD4A 3KTDA 3VC2A 3TFOA 2WAYA 4RD3A 3SJZA 5BVGB 1KYTA 3H9QA 3DAOA 5CBKA 3CH5A 2DWOA 4X20B 2YWDA 3CHYA 2GN1A 2AV6A 1RJDA 4DIOA 4EYQA 2AOUA 4RJIA 5ESXA 3T8YA 521PA 1L8OA 4CT0A 2I2AA 2OG2A 1COWD 3N0TA 3O4VA 1XB2A 1YR7A 1CNFA 4QDOA 1LK5A 4BY9E 3I9LA 4GXRA 1XDDA 2A4MA 3VZRA 2AK2A 1QO7A 1ZK1A 4YK7A 4UOZA 1W36D 5IM5A 3THRA 5D1HA 1K88A 2Q6KA 2EFHB 4UPDA 3TRIA 3HV0A 2A0KA 1ADFA 2N9UA 2ZBEA 3F4LA 1F20A 1FP1D 1NA5A 1TCCA 3KJHA 4I5DA 1G16A 2ZRFA 1KWKA 3L7LA 1GAJA 3OT5A 4ZCSA 3BE5A 2CT8A 3BSFA 5IKPA 2YUIA 3RUDA 2FPUA 3HRHA 5IDYA 1JNYA 4KXYA 1UXJA 1U04A 3BRQA 2XZTA 3ESBA 3U19A 1YHYA 3WLEA 4OLBA 1VFNA 3E9CA 3H2ZA 5AKIA 1O0CA 1LI7A 1XZKA 3HXPA 4NNOA 3EQ7A 4ALIA 3EUEA 3PVSA 4QC2A 4TYQA 2OZLA 3H2GA 4PWZA 3L0DA 3S1AA 4MZXA 1LZKA 3LFHA 5CFLA 2AZDA 2YS6A 3IMEA 4ER0A 2ZUDA 3TOSA 3BTUA 1BKDR 2C42A 4QYMA 2D1FA 2I2FA 1RYYA 4ACAA 4MHSA 4H0FA 1AQYA 1KMNA 3PC6A 4ZIRB 2NWQA 1XNJA 3PNVA 3A9VA 3K2IA 1V16B 2BD0A 2VJKA 3KLMX 3MQFA 3ABIA 3QVVA 4RNCA 4YXWA 1RCFA 4L85A 4FMDF 3WGTA 5K8IA 4UVHA 3DZBA 3NX4A 4N7RA 6Q21A 3AEKB 3AM3A 3LLMA 1RQXA 2AMJA 2NYAA 2OESA 4WLUA 2CDCA 3V55A 1FX1A 4B6RA 1QU2A 1CR0A 1I2MA 3B3AA 1P3Y1 2GJAA 4BZPA 5IVDA 3U1VA 3ESDA 1IBLB 1GAWA 2AZ4A 4RJ2A 3ZWBA 1OAOA 3ORHA 1CUUA 4C08A 4D41A 3AL0C 3DFIA 1C1XA 2XXJA 2FZLA 2JZOA 3DH0A 1IZ8A 1YJCA 4XQ0A 2NV2B 2QY6A 3EVFA 1PJZA 4N47A 5KYGA 2W22A 4ETMA 1PHRA 3PFIA 1E1DA 1Y7LA 4OHWA 5F7JA 5JNSA 2EERA 3EFEA 3PGVA 5DM1A 3CW9A 3EIEA 3BCRA 2QTVA 1BTOA 4MVWA 2K2WA 5EQJB 4JSTA 3RK0A 3L40A 4MINA 2D0PB 3RVBA 3QU5A 4OGLA 1O58A 1H5NA 2HDHA 2H2DA 4GWGA 1A7KA 1O95A 8ABPA 4FFBB 1FL9A 2EJWA 2YVKA 1T0UA 3AX6A 4TXNA 2ZZNA 4M53A 1LF5A 2ZVPX 5HK9A 3DCYA 4OCZA 2C1ZA 3PFCA 3VR0A 4DJJA 4B3SB 1MAHA 2XWJI 2WNIA 3GF4A 1JR2A 3BH7A 3L0BA 4RY9A 3DHEA 3WG9A 1Z18A 2FPOA 3ORSA 3VC7A 3ZDRA 4HQ0A 3SP1A 5B58T 3R8CA 4QPPA 5ERGB 1ZOIA 1L8LA 5DO9A 4J0KA 3EVTA 3M1IA 2QPAA 2AG8A 4C5AA 3T3OA 3ND8A 5TR9A 4DOMA 2VRNA 4L57A 4MAMA 3LC2O 1KO4A 1Y6QA 5GJCA 5KYTA 1XEFA 1XPJA 3EVZA 1YASA 2JZCA 4BMDA 2HMVA 2G5PA 2DQSA 1OWOA 3L7OA 4LNAA 5IJAA 3K70B 3PQDA 2CB9A 1H9BA 3E22A 4G5XA 5JJCA 2RBKA 1RM5A 4D96A 5JBNA 2GEJA 1NW3A 2DQZA 2FSVC 3NS7A 4FFOA 3WBFA 2WSIA 4QICA 1MIOA 3KQYA 4QPZA 1D6SA 3NU1A 1BE1A 2BGIA 5DF1A 4EI7A 2O8CB 2OKCA 2JCYA 3O38A 3BEDA 3OKAA 1WCIA 4NYJQ 4XOUA 3EG9A 1KC1A 1OFHA 2X3YA 3GUVA 4PYQA 4TT3A 1U8EA 2DB3A 4ZJYA 2FW0A 4QBHA 2IUUA 2DMRA 5IVIA 5FI3A 5A3SA 4AS3A 1TCUA 1W0CA 3E48A 4NDAA 3OZRA 3L8HA 3PDJA 3IBFA 4KIWA 3SZ3A 1ZRNA 1S9DA 3VBEA 2Q4TA 3GFTA 1ODCA 2GBPA 3OESA 2VPYA 2NADA 1VMDA 3HDQA 1Z0ZA 3ZQKA 4R9UC 4YY3B 4E3WA 3AKYA 2FPPB 4YS6A 1L7QA 2FOXA 3OJLA 1GTJ1 2KI5A 2O2CA 3KEFA 3UAWA 2RHCA 1ZNXA 2N47A 3AL2A 4MYCA 5KJCA 3QVOA 3D1JA 3OSZA 1AMUA 3AFGA 5EXXA 1A5BB 4BXOB 3L8CA 2QAIA 3R6TA 3BZUA 4GQBA 3N2YA 1IOVA 4EHNA 2G1PA 4XQCA 5A1TA 3HJFA 4P1ZA 4RF3A 4RGVA 4N0PA 3BL6A 4UE2A 3PCRB 5GGXA 3N2GA 2PKYX 1XLTA 3SSNA 3CH6A 1CIJA 2PWBA 4Y98A 3TFQA 2QN3A 1OWLA 4DBLC 4FNGA 3AOEC 4DMHA 2VSYA 3IQFA 5G40A 1DT3A 3DDOA 1HDRA 1JS1X 3C3PA 3FMPB 4OHCA 4BBZA 2ZI5A 1T34A 1BHO1 1UZAA 2A59A 3GRFA 4BVLA 1RLOA 1JU3A 2ACKA 3ZU4A 4R8SA 1GAXA 2PA3A 3D43A 5JSZB 3R3JA 5I4KA 1K7EB 2SICE 1RQNA 2WT9A 1TIBA 1EYZA 2AI1A 2OCBA 5ETJA 2BFCB 1GP2A 3AR2A 1PX0A 4WA8A 1ZD1A 5F5NA 2ZZMA 1FS5A 6LDHA 4PZLA 2GZ1A 4H16A 3V8EA 1CJTC 3RW9A 5FJJA 2XBLA 1Z45A 1FQOA 4PAQA 3DE1X 3FPEA 2DRIA 3ZQ4A 4UXJA 2VTVA 4KYIB 4TKVB 3AR6A 1P19A 5KTYA 4KQWA 3UCXA 3UAGA 3Q10A 4BLTA 1T9KA 1S02A 1E7SA 1IHUA 4K81B 4QIHA 3DOOA 4W5JA 2VA9A 4M9XA 2X2PA 1FTSA 4XWYA 4MQ5A 2NG1A 4EY8A 1LPNA 1HYQA 2FX3A 1H0RA 3KFXA 3P0EA 4KN6A 1Y5MA 4N0EA 4L78A 721PA 2XF8A 1Y3IA 4OSPA 2B69A 4GQAA 1FFHA 1RM0A 1UOOA 5DTJA 5EMNA 3SKVA 4CQJA 2FDCA 2QZ9A 4KR2A 1YKGA 5AOVA 2JLAA 2WM9B 4LG1A 4E3ZA 4C6RA 1QH8A 1PLLA 3H0EA 2O3JA 3TBKA 5MN4A 1UBGA 1ONNA 2PBLA 2QWXA 4P4NA 2WWVD 1II9A 2H48A 1JEYB 1JB9A 4DAOA 1OPRA 2I0FA 1P2UA 5CM9C 4JI6B 1PJ8A 4KYUA 3TLBA 1L5NA 2VSXA 3MWGA 2W4QA 5LP6F 1ZFNA 5EP4A 2IHKA 1ST3A 4NENA 2M32A 3DVSX 5CNMA 2GD2A 4EHDA 3THYA 2RGDA 1TU0A 4G5QA 1NQAO 3IE2A 2YJZA 4PYIA 5BSMA 4TTIA 1I5EA 4NOLA 5TVKA 4G89A 4L07A 4ZCIA 3LK7A 5D3QA 1SVWA 4HVLA 2RH4A 2D3WA 1N6OA 4CQMD 2QVZX 4MVJM 3IPXA 1V26A 1UJ5A 3LK6A 3RRNA 3LX8A 4KQGA 4UMVA 1HM5A 1A9YA 3RSOA 4EPXA 3KO8A 4QJ3A 1I32A 1QYIA 2D74A 3GN2A 3N6XA 4BP1A 1WPGA 2V6JA 4RVUA 2JZNA 1NIJA 2VJPA 3SYLA 1J1UA 3F73A 1NONA 2XSZA 5L9AA 3VTAA 2FP4B 2Q4RA 3MNFA 1R8XA 4W63A 3IUQA 2MWMA 1NQTA 2P6MA 2X6QA 2ZJ8A 1K08A 1Y3DE 1WDKA 2MHCA 1FMTA 2WWHA 3IIMA 1ZNWA 3OZXA 4KG7A 5FXMA 2QYTA 2VHWA 3V6MA 1SBYA 3VOTA 2VQ6A 2GHTA 3WAJA 2CK3A 1M2NA 3L4SO 3OJFA 3G2MA 3WLAA 3AEQB 4HFNA 4DLSA 4OJMX 4WHMA 4HQKA 5FNVA 1Y8CA 2WSYB 3HFJA 4M9RA 2W43A 4NU6A 4CM7A 1E0SA 2V9CA 1FXUA 4DDMA 2DUJA 5ILGA 1XGKA 2R84A 4KVGA 4UHHA 2DQYA 2VQ3A 3G5MA 2NXJA 3GVIA 3IP5A 4KMRA 4N82A 1YCDA 2BP7A 2O2XA 4I4CA 1QP7A 4YUZA 2AZXA 5AM1A 2AG6A 3VUFA 1M10A 3T5PA 2ZIUB 1GZ7A 3GWGA 1QB8A 2YJ5A 2CSXA 3W8DA 3O8NA 4IDOA 4LYFA 4A3SA 2YZMA 3B9PA 3I53A 4R40A 4XYBA 5LOVB 2ST1A 3FPJA 4TYYA 2RD2A 4RETA 1H69A 1ZINA 1JHAA 2FFRA 2V55B 1VB3A 3MMSA 1R8YA 2P4UA 4XB1A 4BAUA 5JAHA 4UULA 4I3HA 1R8SA 1KIAA 3WDMA 4KLCA 1Z35A 1BVYF 5IT9A 3HDTA 1ABBA 2E49A 5CA0B 1TD9A 1ID8A 1J9ZA 4WEOA 3UC9A 1IFXA 2GJ4A 2PUWA 4IMJB 1NSTA 1BCSA 2WHRA 4L5JA 5HJ7A 2V7GA 3ABOB 3FNIA 5FBRB 1EINA 1JXOA 3COSA 4Z4IA 3U0VA 1MO6A 4ZI3A 4MOWA 4MRVA 4BV2A 1QHIA 3GRAA 3HU3A 4X60A 3SDZA 1NURA 5CVEA 4MSUA 4CM1A 1U94A 4RHYA 4MKHA 2C2HA 4A4DA 2XNKA 2Q6OA 2VAPA 4MGIR 5G2OA 1M54A 3BS4A 4DQLA 2V45A 4KPFC 5CXSA 5C7IO 1NMXA 3I1IA 3EBLA 1N25A 2OCDA 3QLVC 4J0JA 4D2IA 1YMVA 4HNUA 5JU6A 2JA1A 3CCCA 4OQZA 5ALKA 5H7XA 5EJIA 1QGDA </