5TIIA

Comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
251
structure length
241
Chain Sequence
ELELGLRGKKALVTGGSRGVGRGVVLALARAGVDVFTCYREESDASASLARELKQLGGDHHALRADLADPKQIAELFQEVGRRFGTLDVVVNNAGVISHVPYAELPVAEWQRIVDVNLTGAHLVIQHAIPLLGDKGSVISIGSKSSEVGIPLRAHYTATKHALRGLTRSLAKEYGRSGLRFNVLALGVVETEAEMTKFYSTKTALGRLGTPDEVAGAVAWLASDLSRYVTGATIHVDGGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-ACP reductase
publication title Comprehensive Analysis of a Novel Ketoreductase for Pentangular Polyphenol Biosynthesis.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 89
structure length 241
sequence length 251
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tiiA00
3OJ0A 1YQDA 3VVBA 4U0JA 2YV1A 2XXBA 3L6EA 4EYEA 3LC2O 4FN4A 5CDGA 4FR5A 4FC6A 2DKNA 2UUOA 1Q7CA 4D3FA 4GX5A 3ZZNA 5AXBA 5KOIA 4IDEA 2D5AA 3KYDA 1H94A 2AXQA 2C0CA 2GERA 1T24A 3JQ7B 1VE9A 3ZWOA 4XQGA 7MDHA 4IJVA 1HDGO 3SX2A 5F5LA 3X2FA 3GEGA 2NU9A 2DTXA 4CM4A 1JQBA 1ISGA 3WSWA 2OHXA 2H63A 4N5MA 3WFIA 5JAZA 2XAAA 4RCVA 1ADGA 3MJ4A 4IINA 1LSOA 2W8ZA 3OJOA 3PQFA 4PVCA 4AJ1A 3W4KA 3PJDA 5JFOA 4RVSA 3ZHYA 4FIZA 5IF3A 1ZCJA 1M76A 4H3VA 3NRCA 2PKQO 4M89A 3TOZA 5KTKA 3BYZA 4OXNA 4M1QA 1C14A 2AQ8A 3M6IA 3JQCA 1GUYA 4CQMA 3GAFA 1NQAO 4YT5A 4CQLB 4E4YA 1EFLA 5CDUA 1ZJZA 1Y8QB 4D0RA 4F6LA 5EJ2A 1PZFA 4A27A 3IL2A 1TXGA 1RYDA 5IFLA 2Q99A 3WG9A 3ZV5A 3VZRA 3LDHA 1E7SA 2O4CA 5I9MA 4ZQHA 3PLNA 2CF6A 4H7PA 1WVGA 3FNFA 2VYVD 2WSBA 1GR0A 3EYWA 3KRTA 2XF8A 5TLSA 4J91A 4TROA 2DFVA 5AOVA 1QYXA 2DTEA 2ZTLA 5T8KC 2C7VA 3W8DA 4B4UA 4DXHA 4PLCA 3CIFA 5B4TA 4J16A 1GQYA 3JQBC 4FDAA 4HY3A 5JAIA 2GZ2A 2ZCUA 2GGSA 2HCTA 5TGDA 3AOEC 1DC6A 5F1OA 1E6UA 1EFKA 1JKJA 2FZWA 2DPHA 2HLPA 1EE9A 3PWZA 2FY8A 4BHTA 3INTA 2V6GA 1ZK4A 3GPDG 4ONEA 3FTNA 4J4HA 4R1NA 1UXKA 2CMDA 3U4CA 3QV1A 1NQTA 5FI5A 2JCXA 2PZMA 3OICA 3ZHXA 3I5MA 1ZEMA 4R1SA 5DCWA 1V6AA 5JLAA 2BGMA 3ROPA 2CSUA 2VNSA 1ZNQO 4GBJA 4XQ9A 3UF0A 4DLLA 4JGBA 1O89A 4F45A 5TIIA 2J3JA 3BMCB 4ZN6A 3PHLA 2PFGA 4XD2A 3C8MA 4RZHA 5A02A 1YL5A 4BVAA 4YXFA 1LSJA 4PZDA 1KVSA 1DO8A 4RF5A 2VNAA 4IMRA 4NNJA 4UULA 3WSVA 3P2YA 3JQFA 1Y8RA 2UVDA 3F5SA 4RQUA 2X5JO 4F6CA 1PL6A 4LVUA 4FFMA 3L6OO 3LZ6A 3RIHA 1GZ4A 3WBFA 4ESOA 2B69A 1K3TA 1NPTO 3KYCA 2DBZA 3AUAA 1I32A 3SC6A 5L4LA 3WIDA 2HK7A 1CIVA 4D3DA 4GQAA 2HK8A 2VN8A 1OC2A 5A3JA 4I5EA 5BT9A 5JAMA 5B4VA 4BNGA 5ER9A 1WAMA 1MFZA 3AI2A 5JMPA 1KEUA 1WZEA 2IYPA 2VWQA 3BMOA 4JIGA 1KVUA 4MVJH 1NX6A 1UAGA 1KIFA 4ZRMA 5LCXA 4J3FA 4BGIA 4ZICA 3IOYA 4HV4A 1IPFA 1TA4A 4JBHA 4Z3KA 3NT2A 3PEFA 2Y66A 4ALNA 3GMDA 2Y67A 1Y1PA 3I83A 2NU8A 5K6AA 3RU9A 2OGUA 2Y99A 3ANLA 3IUSA 5IJZA 4J7XA 4CLOB 3RUIA 1BRMA 1UXGA 2VHXA 3AI3A 4R1TA 3GG2A 4JNKA 3V2GA 1ZW1A 3ADOA 4QFDA 2NADA 4TVBA 5TF4A 3RBVA 3Q11A 1E1LA 3NGLA 1F17A 2HO5A 1RPNA 3HB4X 4WLEA 1PQUA 2AW5A 4RJTA 1A7KA 5COAA 4HNHA 4M49A 4NK4A 4XDYA 5HWSA 5T5QA 4EW6A 1B26A 2P91A 2ZYGA 4PLZA 4LK3A 1NBOA 1CEQA 3ASUA 1UXIA 5K0ZA 3G1UA 3BMNB 3WMWA 4NHEA 3DMYA 3NYWA 1HE5A 3HDYA 4RPHA 2HU2A 4BNXA 2AEMA 3C7AA 3LT4A 3V1TC 1I8TA 4EZBA 1ZEJA 2GF2A 1HTBA 3OA2A 5ES3A 2IXAA 2FOIA 3AFMA 4RVHA 3W8EA 1NFFA 4IQGA 3KBOA 1UXJA 5JDIA 3AI1A 1DPGA 4HADA 2X0RA 1Z45A 4RV9A 2X4GA 4UVDA 4KWIA 5JCJA 3TOXA 1B3BA 4BNVA 3H3JA 1NTOA 3RC7A 3IUPA 1Y81A 2QZ9A 1EUCA 1VI2A 1N2SA 5FFFA 3E82A 3OHSX 4PFJA 1DFGA 4K26A 4IZHA 4IDAA 1E7YA 4YJGA 3Q2IA 3L4BA 4JN6B 1UP4A 2QW8A 1SOVA 4CLRB 4E31A 1Z75A 2I9PA 3OQ6A 3AFNA 4PVDA 1ZK2A 4XWYA 1CETA 3RQSA 4EGFA 3H9QA 5B1YA 1PQWA 4MVJP 3A14A 1A4IA 2CF5A 5I7EA 4BMSA 4MDHA 4WECA 3FPCA 4AL4A 5JCXA 3M2TA 1IHYA 3GHYA 3UICA 2BGLA 4E3ZA 2W2LA 1GEGA 3HZZA 1SB8A 3DR3A 2WTBA 3DZHA 4R54A 1UZLA 2NSDA 3FBTA 1GCUA 2AQKA 3BMQB 4F3YA 2QYSA 5L51A 1NP3A 4JJFA 3NV9A 2Y1CA 3VKVA 2FR8A 3S2FA 4FJ1A 4KOAA 3JQAD 2DUUA 2HKIA 4Q39A 1JWBB 5CDTA 2CDCA 1YGYA 1YRLA 3DHNA 3O9ZA 1R15A 5EESA 1KC1A 1IOLA 4YRDA 1G1AA 4CLXA 5IXSA 1PL8A 2JKVA 1QRRA 3WGQA 3IDSA 4RVDA 1FDVA 3GDGA 4PGFA 2B4RO 2VRBA 2CUKA 4R69A 4BNUA 4FJ0A 3FCOA 3OETA 1KVRA 3L9XA 1VSUA 3LVFO 5JSFA 1X7GA 3DBLA 1PR3A 4NFSA 1JVBA 3BAZA 2NTNA 3WGIA 1M2WA 3V1YA 1ZSNA 4OXKA 2Q2VA 3ZGYA 3PWSA 2H6EA 3TJRA 4U0KA 3ROQA 1C0PA 3E5MA 2JJYA 1A72A 1AHHA 4Z9YA 3IKVA 3U0BA 1KY5A 4AJJA 5T67A 5MDHA 4EUHA 3NJ8A 4IJKA 2X58A 5GZ3A 1MUUA 2B4TO 4MVJE 5JW6A 5JY1A 3GDOA 3JQ6A 1CJCA 1FK8A 1E7WA 4JCOA 3VZSA 2EXXA 4BNFA 3RJ5A 2CY0A 4AJPA 2CVOA 4DQVA 1BW9B 4ALJA 2O3SA 4B4OA 4ITUA 1P1JA 3OECA 8ADHA 4PZCA 4D45A 3E5RA 1B2LA 1HL3A 3KUXA 3EGOA 4GSLA 4B3JA 4TZKA 2EJVA 4GI2A 3JYOA 3DONA 1E3SA 5EIOA 2IZZA 1T4BA 4YAIA 3C85A 3GZNA 4J0EA 5CG2A 3KB6A 1ADCA 1L7EA 1BXKA 1W6UA 2DT5A 2OXIA 4CMIB 1Q2XA 2PGLA 2VYND 4YAJA 3QA9A 4HFMA 4IY1A 1PJCA 4CM6A 1P9LA 3IP3A 5ICMA 3VPSA 3GGOA 3RASA 1PZGA 1ZFNA 4U7WA 1HDXA 3NEPX 1WW8A 1UH5A 1I2ZA 4E0BA 4E30A 5KVQA 3KXDA 3QWIA 3BTUA 1SB9A 4W9NA 4WEOA 1SZJG 3TN7A 1T25A 3FNEA 3TZHA 1M6HA 3PP8A 5TC4A 4ZA2A 1BDBA 2BI8A 1B7GO 1P0CA 4DTIA 4XQCA 4EJMA 2EWMA 3CEAA 1QG6A 3MJTA 3KM0A 4KUGA 2LDXA 1PQPA 5FF9A 1GEEA 3KZVA 1DBVO 3CKYA 1A9YA 5HM8A 5IDWA 1PU2A 4FB5A 3H6KA 3S2EA 3VAZA 1X0VA 4CM4B 3OP4A 1U5AA 2P4QA 2VTEA 4PG8A 2O3TA 2UAGA 3NDIA 1J5PA 3PFWO 1CQIA 4OKIA 3RSHA 3JYLA 2O23A 4KMSA 1VL8A 4LCEA 4LGVA 1J6UA 1HKUA 2J3HA 3H8VA 3OF2A 5L3ZA 2JAPA 5CAEA 1ZXLA 2DU8A 4XZ3A 2FPIA 1HWYA 1O94A 3VTZA 3BXXA 5I9NA 4MKXA 3WGHA 2IYOA 4E21A 1TT7A 1UUFA 2P5YA 3GVCA 2HRZA 2X0IA 2VZ8A 4CQMB 4BNJA 5IZ4A 2X9NA 4NI5A 3F46A 1DXYA 3DAPA 5C7IO 3D3WA 4OIMA 3NTQA 2AEJA 3D5QA 1GU7A 3VZQA 2P5UA 3W4JA 1SEPA 1X15A 2IZ0A 3IMFA 5DZSA 3VKUA 3DZKA 3GVHA 2EGHA 4IIVA 2HMUA 4ZD6A 5J23A 2Q1WA 2JAHA 3DBRA 1WLYA 4R9RA 5JBIA 4MP8A 1N1EA 5I7FA 5EPOA 2Q3EA 1IY8A 3IJRA 3DZBA 2A35A 4CMHA 3WX0A 3H5NA 1ENPA 4D3SA 2D3TA 1PJ2A 1YOVB 1FDUA 1FDSA 3QWFA 3K30A 4Z6KA 1YWGO 1Y9EA 2HJSA 4IJUA 4XRGA 1PJLA 3GFGA 4FGSA 4EEXA 3C7CB 5TSDA 2HMTA 2ZYDA 2E6UX 3PPIA 3PQEA 1JAYA 3GVIA 4CM8B 3QLJA 4RPGA 2HSDA 4QSMA 3WQQA 1YJ8A 3VH2A 1WDLA 3OBBA 3WB9A 1P31A 1Q0QA 1VSVA 3GNQA 1ZK1A 4I5DA 4YTEA 4ZJUA 2AG5A 2X1HA 3C1AA 3NTOA 4DYVA 1NWHA 2VHWA 1SC6A 4UUMA 2VOEA 1ZSVA 1ARZA 1NPYA 3GRKA 4DLAA 4YJHA 2IZ1A 1GV1A 4N5LA 3W6ZA 3CMCO 1LUAA 4DLBA 2QQ5A 3ULKA 1HETA 1R4MA 3KEQA 1LLDA 1OMOA 2EERA 5EN4A 3RUEA 3PQDA 4IDFA 3ZN2A 3Q9NA 4GVLA 1VJTA 1Y8RB 2YUTA 3B20A 3F3SA 3PGJA 5CP8A 1MGOA 1A9ZA 9LDBA 1T26A 4OAQA 1H93A 4RF3A 3TSCA 3V1UA 1EVYA 1OOEA 5G4KB 4J1QA 4NG5A 4WGGA 3H2ZA 2QIOA 3TFQA 4D43A 1HDCA 1K2WA 5BNIA 1T2DA 4BQRA 4NH4A 4KUHA 4A10A 1U8XX 4R41A 2V65A 3RROA 3TF5A 3FRJA 4CV1A 2UDPA 4MIOA 3BMOB 2X5KO 4I08A 5LDGA 4BO4A 4WCFA 1UZNA 1PS0A 2QYTA 4P38A 4B79A 5L40A 3D4OA 3T4EA 2WJPA 5A04A 1K89A 1ULSA 3F4LA 4IGEA 5DDIP 4J2OA 1PWXA 1QYDA 4YJFA 1QYVA 2NV6A 4NJMB 3FHLA 5EQDA 3A1NA 4OYRA 5BSFA 1HZZA 3ZHBA 1GL3A 2RAFA 3LT2A 3OQBA 5KJEA 5IN4A 2PTGA 2GN8A 1R0SA 4YT8A 3VPXA 4UVHA 5IZCA 4D42A 2C59A 2DFDA 3DHYA 4DQXA 4RO0A 4MO2A 3WLEA 3E8XA 1EE2A 3UHAA 4BO0A 2NVUA 2H9IA 3O8QA 1YONA 1RYEA 3BZUA 3GUCA 2Q4BA 4II3A 4BKRA 3QVTA 3HG7A 2ZTMA 3L07A 4NQZA 4O63O 4KWHA 4TZTA 5ITWA 2PWZA 4IM7A 4W7IA 5F21A 4J9UE 3F4BA 4CM9D 3GZ4A 5KVSA 1YKFA 4IDGA 1C0LA 3V2UA 4A5OA 4CJXA 2VHZA 4BV8A 4DYDA 4E6PA 1C0IA 1LLUA 4AJHA 2BFAA 4Y6PA 4YCAA 1ZJYA 3MJEA 2G76A 2RIRA 3WJAA 5A4DA 4PZEA 2D4AA 4CMCA 2QRLA 3R6DA 5HS4A 2O50A 4BNNA 3P7MA 4J49A 3WNQA 5ITVA 5AVOA 3GPIA 3ZH2A 3RUDA 3E03A 3MCVA 5CEFA 3PIIA 4LCJA 1HZJA 4RPJA 1LC3A 4PLHA 1WXDA 7ADHA 4PLFA 4KUEA 4KQWA 3GY0A 4BB6A 4Z9XA 3DEYX 2CNBA 1PJ4A 2YQ4A 3DDNA 4AJEA 1GQQA 2Y0DA 5FI3A 3RVDA 2NVBA 6LDHA 3AUUA 4WK6A 1N1GA 3HDHA 3IJPA 2J8ZA 4GL4A 3CH6A 4R01A 1TB4A 2CD9A 2EW2A 3H4VA 3I9NA 3QQPA 3RUAA 4IJWA 2A9FA 4CV3A 2PGDA 1EUZA 4QXMA 3PLRA 2UYYA 4HBGA 2WYUA 3EVNA 1KEWA 3BHMA 2J5QA 4IDDA 2ZJ1A 3UW3A 2R00A 4O1MA 1C1DA 3LT0A 2HMWA 4NJOA 3U09A 4WEQA 3VPHA 1XLTA 4FQ8A 3DBLB 5CG1A 3PZBA 4E2YA 2QHXA 3JQ8B 1MA0A 3K2BA 3JQFC 1C1XB 1MLDA 1VL0A 2DUWA 1V3UA 2PY6A 2CDAA 2Z1MA 4XGNA 4Y6SA 1IPEA 4IBOA 3NT4A 3O4RA 2JFHA 3EZLA 3C24A 3BIOA 3WBBA 4E33A 1O6ZA 3ITKA 4FD3A 3ICCA 4TRRA 5HS6A 4BMVA 3U5TA 1R0KA 3ZNQA 2X22A 4TVOA 3ENNA 1ISFA 4L75A 3WYEA 3FD8A 1CYDA 3DZIA 1RKXA 5IDXA 3KTDA 4OSOA 4YRBA 2PA3A 4GX1A 5KJ1A 5K6AC 5ICSA 3DTYA 5COBA 2O3JA 1F06A 3ABIA 1NYTA 2X0NA 1PX0A 4NR0A 2YYYA 4R5HA 3TRIA 2EG9A 1Z82A 5JMWA 1YB4A 3AUTA 4XA8A 3C1OA 2HK9A 3QWAA 5JC8A 1PJSA 3DBHA 3NX4A 4OOFA 1U4SA 3R1IA 5I8ZA 4DRYA 1M75A 3C1TA 3GZNB 1PL7A 1QP8A 2X7HA 3P19A 4B7CA 4K6FA 2CVQA 3TDKA 4CLDA 4TKMA 1QLJA 3MWEB 3WGTA 1I2CA 4BB5A 4XYEA 2Q49A 1LBEA 4BUCA 1KEVA 2QX7A 1EVIA 3BHIA 1AHIA 1P45A 2W2KA 3W6UA 2VHYA 1WWKA 1Z7BA 5F3RA 3PGXA 4J7UA 1NHGA 4I1IA 4OXYA 3MJCA 3F47A 3PYMA 4YQYA 5TX7A 1FMCA 3E9NA 4OMUA 4E2WA 5JO9A 5JDIC 1NNUA 3FR8A 2VT2A 1NWCA 1PGOA 3FNHA 3RI3A 2BLLA 3SLGA 3C3XA 4XR4A 3U49A 3B1FA 4YT2A 1YB5A 2O3QA 3ZW8A 4R4JA 4TKLA 1ISMA 1ZH8A 3ZU2A 3CXRA 1JTVA 4FGWA 1U5CA 1N7GA 1N5DA 1ML3A 1SNYA 3L4BC 4TMFA 4GKVA 3QWBA 3PTZA 4D41A 4ZHSA 5CDYA 4EDFA 3BTOA 2A4KA 1KC3A 1HF3A 2EKQA 1OZAA 3FI9A 2P68A 1PJTA 1E7MA 4N18A 2IODA 3PWKA 1Q0LA 5T6BA 2PV7A 3IAHA 4MVJD 1PJBA 5G0SA 3RFXA 4L8VA 3PHGA 4R51A 2G17A 1Q0HA 2EP5A 2BHLA 3G3EA 1KVQA 1V8BA 1Z7EA 4XB1A 4IS2A 3EY4A 4WLVA 1BWSA 3AY3A 3D3WB 3OJEA 2NLOA 4K6CA 4Y98A 1KERA 3D1LA 5BSEA 5KVVA 4CQMD 2EGGA 4FBGA 1PGPA 1TT5B 4YAGA 3ENKA 1F8FA 4GGOA 3A4VA 3DOJA 3UN1A 1Q7BA 1TVEA 5DOZA 3U4IA 4R5MA 5DBIA 1I3LA 4NBTA 1QKIA 2XPCA 1CQJA 4CLEA 3O26A 1A4UA 5KKAA 3DBRB 5JDCA 4ROSA 4NPCA 2EV9A 4YJDA 4OSPA 4PCVA 3P5SA 2RHCA 4RF4A 5B4UA 4D0SA 2A94A 3LK7A 4QTZA 3ZHZA 3S2IA 1WPQA 3ZWYA 2X9VA 4B4WA 2AA3A 4BO8A 5A06A 3I4FA 4R3NA 1PZEA 2NQ8A 4XYGA 1GYRA 4IUYA 2HDHA 4XIJA 1NVGA 4OQZA 1S7CA 2I99A 5JE8A 3MWDB 4XGKA 5A5EA 2IEBA 1P1FA 4IGFA 4FFPA 1X14A 4K1LA 4TWRA 1H6BA 3KLPX 1XQ1A 1GV0A 1XGKA 1XYGA 4XX0A 4J9VA 3LLSA 4BKUA 1ORRA 5THKA 4IDCA 4FOOA 2ZKLA 1A7AA 3DL2A 4DMLA 4YWJA 3AY7A 4OGWA 3ANMA 1GUFA 3GEDA 4XRRA 3G17A 1LRKA 4UUPA 4FFLA 2V7PA 1IHXA 4YJHB 5G2OA 3ROMA 4W7HA 1X1TA 1HE3A 3CE6A 5FYDA 4G2NA 4A0SA 5TT1A 5HA5A 3L77A 4J4BA 1E1MA 3O03A 5BSHA 3IKTA 3WFJA 2RH8A 4GMGA 4AJLA 1WDMA 4FCCA 4LRSB 1L1FA 1CWUA 1M6WA 1GQ2A 3JQGA 2V6BA 4GKBA 4GPD1 4HWKA 5JC1A 1KOLA 3SEFA 3LQFA 1QV7A 2DPGA 4DC0A 3DOOA 1PWZA 3AW9A 4PLPA 4GVXA 4JQCA 4QEDA 2PZJA 3ITDA 4DREA 2EEZA 2R6JA 1YBVA 1KS9A 3W1VA 2C82A 3RFVA 1E92A 2PH3A 1DAOA 2E48A 3CZRA 1RJWA 2JL1A 1XR3A 1U7HA 2BF7A 4DPKA 3JQ9A 1EMDA 3D4PA 5C37A 3LU1A 4DWVA 1IUKA 4WCFB 4FJ2A 4I9UA 3KYBA 4E5NA 1OBFO 1AXGA 1IL0A 3VH4A 1EQUA 4ND3A 1JLLA 4Z3DA 3L9WA 1E5LA 2WYWA 1HXHA 4W9NC 4CL8A 3G79A 3PHJA 3I52A 4XR9A 1ZKMA 4YJFB 4ALLA 5A9SA 4J6FA 4RVFA 3TNLA 4AFNA 3U4HA 4BNIA 1HE2A 1D8AA 1P33A 3GNTA 4HKTA 1N92A 1AN9A 4BGUA 5KVCA 2VYNA 3DHEA 1Z73A 1E3IA 3EK2A 3OIGA 5HBRA 4IMPA 1DIBA 1NAHA 1WMBA 4AJKA 2VTDA 1V35A 3B6ZA 2BFOA 4YT4A 3ZNPA 3H9JA 3ICPA 2YV3A 4A2CA 4BNLA 2NVUB 2D8AA 2H5LA 3VDRA 3JQ8A 1ENYA 4LW8A 3WR5A 5I7SA 4L4XA 5IG2A 3JD2A 5I9LA 1P44A 4ND5A 1ULUA 1SPXA 2C7GA 1U2DA 2AEFA 1CRWG 3JQ7A 3KVOA 3OMLA 4IIUA 4XGIA 5ILGA 2JD1A 3UGKA 4UAGA 2FSSA 3JD0A 5COQA 5JCJD 5CHEA 2VRCA 1NR7A 1R37A 2BMAA 2HAEA 2Y1FA 4N7RA 2YFHA 5IAAA 2P9GA 3A9WA 3HB5X 3I9LA 4I9HA 4Q3DA 5TS3A 3QSGA 4QX6A 1TEHA 4H15A 4ZGWA 3SJ7A 4NIMA 1V9LA 5A05A 3EDMA 3WLFA 2EKLA 4R9SA 3ZWXA 3VDQA 1JN0A 1XEAA 3WICA 5A1TA 4EUEA 3HDQA 3FBGA 3JQEA 2E37A 2FR0A 3WYCA 3K92A 1E3EA 2O4UX 3X2EA 1P74A 4IQ8A 3ZWVA 3CSDA 4XEHA 2F00A 4CQLA 4ND1A 4WOKA 4MVJF 3PZRA 1Y8QA 3DZJA 4DIOA 4KTVE 3TFOA 1NPDA 1PSDA 4BNKA 4ZQGA 4ALIA 4FOSA 1QYCA 4EJ0A 2PLAA 2W2LD 2ZJ0A 1HDYA 1VM6A 4UVEA 1Q1NA 2YY7A 2O48X 2W98A 1I3MA 3RC9A 2V6FA 3TZKA 1G6KA 3F9IA 3PFFA 3QP9A 4A7PA 4II2A 3DAFA 3PHIA 4JXKA 4P4LA 1U9JA 3KYDB 4MKRA 5DN9A 4UVGA 4YACA 1C1DB 2VZ9A 5BQFA 4JBIA 1LI4A 4L0QA 3L4SO 1ID1A 1K0UA 2PZKA 4DVJA 3AM4A 3QVXA 1RM5A 3K2EA 1CF2O 1DIAA 1T2CA 3MJVA 4NBUA 1E0DA 3EZYA 3WGOA 4DQUA 1ZBQA 1ZO8A 1O5IA 2JFFA 4G65A 4W4TA 1R0LA 4EEZA 2GN4A 4PLGA 1H2HA 2PK3A 3GR6A 5A5FA 4YB8A 1E6WA 1V3TA 1H2BA 3RUHA 1ADBA 1ONNA 4ALKA 2PGJA 3QVSA 3WWYA 3DQPA 3OEYA 2DAPA 5EINA 1IZ9A 2GO1A 3I9MA 1LDMA 1X7HA 3FSRA 3N7UA 4WCFC 5JY6A 1BXZA 2ZQYA 3H9GA 4G5HA 4KTTE 3GUYA 3VHRA 4E5MA 5L4NA 1V3VA 2IE0A 4ND2A 1Y9AA 4OKNA 5C3MA 1XIVA 3HWRA 4IDBA 5L7YA 5JXWA 1Z6ZA 3GC6A 3OM9A 3SJUA 1JKFA 3A28A 1G0OA 2C2YA 2CFCA 3F1KA 3ONFA 4B8ZA 1YXMA 1YL7A 4NMHA 2PNFA 3PJEA 4L9RA 4EJ6A 1D3AA 2OORA 2X5OA 1DLIA 1VPDA 2SCUA 3FF4A 3Q0EA 3LT1A 3QWHA 5IDQA 1NFQA 4BGVA 3GAZA 2ZTVA 3RKUA 1XA0A 5IZCC 1I24A 2ZATA 4N54A 5CPBA 1PJ3A 4RDHA 2WYVA 2RHRA 3JTMA 3GEMA 4QO7A 2VUTA 4RF2A 4D46A 2PD4A 4HFNA 2I65A 1VC2A 1DHRA 1FJHA 1U2GA 2G82A 1Y5RA 2O3UA 5AYVA 1HEUA 3GVPA 1U1IA 1JKIA 1GZ6A 1OAAA 2NTJA 4BIIA 1MV8A 1OFGA 3GF4A 3OA0A 4BNWA 5A3VA 2AE2A 4CLOA 5L4SA 3PJFA 4BO1A 3OIFA 5FWNA 1DJQA 2Y1EA 4GH5A 1DIHA 1JU9A 2NVWA 2TMDA 3FWZA 5DBGA 4YQZA 1HLDA 1I30A 3P2OA 1SBYA 2C54A 3HN7A 4XB2A 3ZWAA 1I33A 4DPMA 1HSOA 4NK5A 3GFBA 5G0TA 2WE8A 4J1TA 4WLFA 4P22A 4Q9NA 3WDSA 4D79A 1WP4A 4I9NA 3FN4A 4E32A 4MVJI 2IRWA 2JHGA 1EDOA 2ZK7A 2DTDA 4L4RA 4WPGA 3CZMA 2J3IA 2YQ5A 3HE3A 1P1RA 2OL4A 2GRAA 1EUDA 3SVTA 2CDBA 3U4DA 3WGZA 1LSSA 2BELA 4CM9A 4NFYA 3EC7A 2EHDA 1UDAA 3KYCB 3DFZA 1GTMA 3K96A 4N5NA 1B14A 1PZHA 2O2SA 4WUVA 2WDZA 3A06A 1WDKA 2ZB7A 3QRWA 3QVOA 3NJ4A 3ZU4A 1XDWA 4BO2A 3F5QA 4JK3A 4NBVA 4R16A 4XQEA 1VL6A 3DFUA 5GZ1A 5JO0A 2GCGA 2GASA 1AE1A 4CM7A 4PLTA 4ZQBA 4P4NA 4GAEA 4I5GA 4CLRA 1U3VA 3HHPA 4NDNE 3GNSA 2X8LA 1XKQA 4FSHA 4NZ9A 5JPIA 5TRTA 3ZNNA 4ZVVA 1N9GA 1HYEA 2P2SA 1T4DA 1YQXA 5L45A 3F6YA 3ANNA 2OBYA 2DBRA 3ZWCA 5BSGA 1GD1O 1B8VA 4BS9A 2Y0EA 1NHWA 2O7QA 4L76A 2FP4A 4XJTA 1DRUA 1LRJA 2GPTA 2R00C 5HRUA 1H9AA 1LLCA 3UVEA 3GOHA 3WIEA 2W90A 4FC7A 4GGPA 3UCFA 1MC5A 4GLOA 3U62A 4BNTA 2NACA 4AG3A 4C4OA 1H5QA 2X0JA 4JX8A 1B3RA 4QQRA 5I8WA 5DCYA 1KVTA 1BDMA 3ZWMA 1MX3A 3K5PA 3QY9A 1YB1A 4EUFA 1I36A 1BHSA 1JA9A 2HRBA 5G0VA 5H81A 1DFIA 2ZIZA 1BXGA 4EI2A 4TRMA 3AOGA 1E7QA 5CDSA 2GLXA 1JAXA 4BV9A 4JJIA 2CVZA 5KJCA 1F0YA 5TT0A 4BO5A 1RM4A 2Y1GA 2Z5LA 5ENVA 3JQGB 4UEJA 3Q9UA 1MP0A 3DAGA 4CODB 4OOEA 4A26A 5GZ6A 1DLJA 4YJGB 3UFXA 4RGBA 3ZWBA 4XCVA 1GYPA 1MXHA 5DCUA 5ILOA 1W73A 4CUKA 3VPGA 4QO8A 4B7XA 3MEQA 4DBVO 3ZW9A 1KY4A 4BOYA 1H0KA 3ON5A 4BKQA 4RVGA 4L74A 1LQUA 1WNTA 1CERA 3DBVO 1O95A 1QYWA 4URFA 5LDHA 1P1KA 3RBXA 3S2GA 3WJ7A 2X23A 3RD5A 3KEOA 4PRKA 1KEPA 1XSEA 1W8DA 4HFRA 3ZNOA 4CMKA 4CUZA 4DC1A 3H3FA 5AQ1A 2I3GA 3H7AA 1BW9A 5B37A 4J1SA 2Q1UA 2PKQP 1LEHA 4TRNA 2OO5A 2DBQA 2RH4A 2FWMX 4WLOA 5EERA 2VYVA 4DL9A 3QHAA 1I01A 3FNGA 3EVTA 3NGXA 2NTVA 5BNTA 5A9SB 1PGQA 1PGJA 3W4IA 3RC1A 4PLWA 1E1KA 4X54A 1FDTA 5DOVA 4AVYA 4BNMA 4AJOA 5T64A 3ZU3A 5A9TA 3VZPA 4YAKA 1LQTA 5CFZA 3AY6A 1LRLA 3D64A 1I3KA 4U6QA 4RZIA 1PEDA 4PG7A 4EITA 3GGPA 4S3MA 1ZVMA 3D5TA 3I1JA 4R3WA 3KSUA 3L6DA 3DZFA 3N74A 3R3SA 2E82A 1K6XA 4GLLA 2V6MA 1FDWA 1C3VA 2IEDA 4RPLA 5IDYA 4HUJA 3UAGA 2P9EA 1J49A 1QLHA 3WNVA 1DFHA 1GYQA 2B0JA 3WOHA 3I9KA 4PRLA 4CR7A 2GSDA 1DIRA 1QORA 3OJFA 1D4FA 1U28A 4K9DA 3NAQA 3VC7A 2O3RA 3ETEA 3IP1A 2OOSA 1DIGA 1DHTA 4JP3A 4RORA 1VKNA 4BO3A 4D7AA 4Y6RA 1YDWA 3PK0A 1NR1A 4XJSA 4BMNA 3TZ6A 3MOIA 3VVCA 5KWEA 2JHFA 3LC1O 3NDRA 4MIEA 4KDFA 4JP2A 1YH3A 4QECA 2O2YA 3JYPA 4MVJA 1B8PA 4BNZA 2F1KA 5L95A 5JDCC 2YDXA 1HDOA 1TI7A 3TPCA 3I3OA 4XYBA 4C7JA 4ILKA 1MG0A 4OM8A 1PIWA 8LDHA 1F8GA 1ZMOA 2E49A 1YE3A 1PJQA 1NQOA 3DMTC 3ZV6A 1HLPA 4UREA 1SMKA 4IXWA 1XU9A 1SCUA 1HE4A 1RWBA 2GNAA 1LDBA 2I6TA 1I2BA 3GN1A 3UCEA 5KIAA 3INGA 1NVTA 5DBFA 1NFRA 2I5PO 2WD7A 1GFSA 4BKOA 3R3JA 4EBFA 3H5AA 3HUDA 4WJZA 1RM0A 4Q3AA 3TL2A 3ORFA 1NVMB 2XOXA 1Y6JA 4NBRA 3KETA 5DNAA 2B5WA 3H5RA 3OEWA 5JYDA 2PD6A 3QE3A 4E2ZA 1H9BA 3H65A 4YRAA 2BKAA 4WKGA 4U5QA 2IDZA 2OP0A 4FFRA 4CMEA 1YOVA 4CR6A 3DTTA 4PIVA 1KETA 1HDRA 1EDZA 3E1KA 3OFSA 2GZ1A 3GQVA 1E3WA 2FR1A 2ZB8A 1Z74A 2O7SA 4C7KA 4LISA 4WOJA 2AQIA 4MIYA 4NU5A 4ID9A 1UXHA 3ZV4A 3GMSA 1G0NA 4CM8A 4B3IA 4Z0HO 5DULA 4D44A 3EUWA 2UV8A 1DB3A 1ZSYA 4PG6A 4YYZA 4CV2A 1HSZA 4NFHA 3K73O 3PDJA 4GWGA 1XQ6A 2YHIA 3Q1LA 2PZLA 4AICA 1W4ZA 4J90A 5F1PA 1C0KA 2CZCA 1YJQA 3WMXA 1GCOA 3JD1A 3V8BA 3QW2A 2VCYA 1IULA 4JLWA 1MXFA 1NAIA 2EIHA 2JD2A 3JQ9C 1P3DA 2FZEA 1PS9A 5F1KA 1UAYA 2D1YA 3T7EA 4DUPA 3ZWWA 3HFSA 2VUSA 3B70A 4HP8A 4MVJM 4A73A 5BNFA 2WD8A 3S1LA 2ZB3A 1YQGA 4Z9FA 2GYYA 1L7DA 3MTGA 3NUGA 1EQ2A 3WXBA 2B36A 1E1NA 3FR7A 1P1HA 3I9JA 5T57A 4IZIA 1D1TA 3B1JA 3RU7A 4BO7A 5G4KA 1U3WA 3EAGA 4M87A 2ILTA 4HNGA 1ZK0A 3ONDA 4ND4A 2X86A 3NT5A 3KV3O 2YFQA 4LSWA 5AXDA 1R4NA 2B37A 4PLVA 3CINA 1PR9A 3ROKA 3ZI0A 3WWZA 1YDEA 3DMTA 2J5RA 2TMGA 4AJIA 1YL6A 2C07A 3RFTA 3SLKA 4OO3A 1ZK3A 2AHRA 2NUAA 4PG4A 5DT9A 4FW8A 3LYLA 1DEHA 3N58A 4M54A 3VTFA 1LNQA 3KOUA 1QMGA 1H6CA 2WMDA 3JQAA 4IS3A 4P4GA 4PG5A 1H6AA 1OI7A 3PXXA 4Q3NA 4XDZA 5HTOA 2JFGA 5C7LO 4M55A 2UUPA 1A27A 1IZ0A 1UP7A 6ADHA 4NJMA 2FSVA 1CDOA 5T8KA 1FXSA 5U1PA 4BNYA 5KJFA 4DBZA 1ZXBA 2NM0A 4W6ZA 4J7CA 5JYEA 5B12A 2YW9A 1T2FA 3JQBA 2AG8A 1LDEA 1ZMTA 3BHJA 1XU7A 1XCBA 3D7LA 2H1SA 2RCYA 1NXQA 1VKOA 2OP1A 2Q1TA 3PVZA 1R4MB 4HX5A 5ENDA 3AOEA 4WNCA 3M1AA 4WLNA 1BG6A 1U3TA 3PYXA 2X9GA 4U8GA 4UEKA 1YVEI 2Q4EA 1B8UA 4RVUA 1GUZA 3HFGA 3GLQA 1R12A 3E9QA 4GWKA 1LA2A 2BGKA 2ZYAA 4Y67A 1I3NA 1QR6A 3Q3CA 5THQA 4M8SA 2NNLD 1XELA 2VWHA 1LDYA 4WLUA 4CL3A 4Q3CA 3MJSA 1NASA 2J5KA 3EMKA 4HFJA 4Z0TA 3B1KA 1EK5A 2VUUA 4QUKA 3KLMX 3IIEA 5IN5A 4TRJA 1VRWA 4OH1A 1KBZA 1ONOA 5H82A 2HJRA 5L53A 1AUPA 3V5NA 3KO8A 1GPDG 1HYGA 4Y8VA 2D2IA 2EP7A 5K9ZA 1DOHA 1LDNA 4MVJG 1AXEA 1LDGA 1N9GB 3UOGA 2EF1A 2HMSA 2QZZA 4M86A 3WGGA 5KCZA 5MGBA 1A71A 3E48A 2EJWA 3NKLA 3AM3A 2W4QA 5L9AA 1T1SA 1VLLA 1ADFA 2C2XA 2QRJA 5TNXA 1Y7TA 4KZPA 2E4AA 4S1VA 4J4TA 2PKRA 1EK6A 3IQDB 4RQTA 2VT3A 3E6AA 3G1TA 4KP7A 3OSUA 5G0UA 1X0XA 1EVZA 3PI7A 3R0IA 4RDIA 3C7DB 4YPOA 5JS6A 1MB4A 4UUNA 4CMGA 3DZGA 3U3XA 1YBAA 3I9OA 4MP6A 4FPXA 2IXBA 4JROA 3CTMA 1EBFA 1KYQA 4RL6A 4E5PA 1D1SA 3JV7A 2D5CA 3RUCA 1ZUD1 3ST7A 2GN6A 3O8QB 2Q2QA 1B15A 2Y05A 4GMFA 3G0OA 4OHUA 4R68A 2QG4A 3SXPA 3UUWA 1BXGB 3I6QA 5F5NA 2YDYA 4L73A 2A92A 4ALMA 2PH5A 3M2PA 1LC0A 1QV6A 5ADHA 1P1IA 1GPJA 2ZTUA 3Q6IA 2FPPA 4FS3A 3CMMA 2GUGA 2ZB4A 5FEUA 3WS7A 4CMAA 2G1UA 1JWAB 4DPLA 1E77A 3I6IA 3AK4A 2I3AA 5DF1A 5TJHA 1LTHR 1C1XA 5JAQA 3ONEA 4OQYA 4P8RA 1XG5A 2WM3A 2NQTA 2VOJA 1M67A 1JVSA 2HQ1A 2I76A 1E5QA 3D3EA 3GDFA 3DB2A 2VQ3A 1N8KA 2AMFA 1OC4A 4GSKA 4JJGA 4RPKA 1P77A 1LJ8A 1W0CA 4Q3BA 3CPSA 2YJZA 1U3UA 2OZPA 1DDOA 2G5CA 2X6TA 5U9CA 2WE7A 1J4AA 3DC2A 3IS3A 2FHSA 1A5ZA 3RKRA 1ZZEA 4GX0A 2VHVA 5AXAA 2Z95A 4LMRA 1PTJA 2DBVO 1WMAA 1IE3A 4XYMA 4A03A 2P9CA 4R1UA 3PJGA 1IB6A 1J0XO 1MC4A 1UDBA 4L4SA 1B16A 3H9EO 2C5AA 3GN2A 3TQHA 2B4QA 2JD0A 1WZIA 5EMHA 2D59A 3E18A 3ZV3A 3QJ5A 3VPFA 3PHHA 1NQ5A 4J1NA 3JQDA 4MJLA 5CPFA 3ZWNA 1UZMA 4OL9A 5IXYA 1DRVA 5JNLA 5G0WA 3ASVA 3PIDA 3UCXA 3M1LA 3GGGA 5EQFA 3I23A 1YO6A 1O8CA 1E7RA 1O0SA 1UR5A 4O59O 4YVFA 4QFCA 2POQX 1EVJA 3RJ9A 3VOSA 1QXSA 4CV0A 2J3KA 2XXJA 2GN9A 1EZ4A 4LN1A 3QIVA 4LRTB 4CM1A 5BR7A 2BFMA 4FFOA 1I5RA 4J43A 3ETGA 4B3HA 3BMCA 4W82A 4YBZA 3HNPA 1F12A 1ZIDA 2GDZA 1K6JA 1HRDA 3RAJA 3T7CA 2OBNA 2WWRA 3WTCA 5C5IA 3LSYA 2VRCD 2VWPA 1BTOA 1JW9B 2B83A 3T4XA 3UKOA 3WGYA 4XKJA 4CMJA 1DC3A 4O0LA 1SAYA 4AJ2A 5GMOA 4U6SA 1D7OA 1LX6A 1BGVA 3RUFA 4CPDA 2Y93A 3AWDA 3EHEA 4TSKA 1XWFA 1HDZA 1VJ0A 4BGEA 3STHA 3SBOA 1JDJA 1Q7GA 9LDTA 3DBHB 4AJNA 4RLSA 1BMDA 3LLVA 2ET6A 3JSAA 4BKPA 4QT0A 3AM5A 1PS8A 1P0FA 2I67A 4WE3A 3QVWA 4G81A 4NBWA 1E3LA 3BTVA 3H2SA 4MPDA 1TT5A 3GH3A 3O38A 2YZ7A 2FMUA 2Y1OA 3F1LA 2BD0A 1TLTA 2GZ3A 2DC1A 2D0IA 3DO5A 1T2EA 5KJ6A 2G0TA 3AJRA 1BSVA 1K5HA 2W2KB 3JYQA 3ZCXA 2WD7B 3CUKA 4F46A 3KSDO 2FPGA 1XHLA 3L0DA 4B8WA 3NTRA 2Q2WA 2Q46A 1R16A 1ENOA 3ADPA 3K9QO 1X1EA 1U8FO 3JD3A 4NU6A 1U4OA 3TWOA 4E2XA 2BH9A 4AJ4A 1U7TA 4DA9A 5EL0A 5L7WA 1ENZA 2P4HX 3AU8A 3HJAA 2LDBA 1H6DA 3I4CA 1E3WB 2I66A 5DP2A 1E6EA 2Y0CA 1R66A 3RC2A 3RCBA 3FTPA 3D0OA 3D4NA 3BMNA 2PD3A 3GHHA 3GT0A 2GD1O 4DIFA 3SC4A 3WQRA 2QRKA 2Q50A 4MKZA 3GA0A 1RM3A 4HXYA 4UEOA 4CMBA 1X7DA 2Q45A 3FWNA 4H16A 3ZU5A 5CEEA 2OFPA 4BNHA 1I0ZA 2C29D 1X13A 2YHIB 1B0AA 4IPTA 4YA6A 2Z1NA 4WNIA 5L7TA 4WASA 1SOWA 1DAPA 3RWBA 2DLDA 1K6IA 1DC5A 4DMMA 4W99A 3ETDA 3MTJA 1Y5MA 2J6IA 5H83A 2AE1A 3G49A 5U4QA 5A03A 1UP6A 3TZQA 3MZ0A 1LXCA 2R2GA 3NDJA 3K31A 4E5YA 3PYLA 3OIDA 4DIBA 1NM5A 2JCVA 3PDUA 4IXTA 4YEDA 4I8XA 4O6VA 4INAA 5DP1A 2VZ0A 1DRWA 1HYHA 4LSMA 4ZU3A 2Q1SA 4BL5A 3JD4A 1T1RA 3JCZA 1LU9A 2GR9A 4DGSA 1M66A 3HN2A 3S55A 3WYBA 1BVUA 4IQ0A 2AQHA 2HMVA 1S6YA 1R4NB 3VH1A 3AUSA 3JYNA 4J0FA 2C20A 3TZCA 3TL3A 3K8ZA 4XIYA 3WQSB 1YBMA 4O5OA 4ZRNA 1UJMA 4KQXA 4ZQEA 4BQPA 3U9LA 1QSGA 1V0JA 2RBEA 4ZQFA 1ONPA 1HT0A 5GY7A 4E5KA 3BMQA 4TQGA 3BTSA 3GG9A 1PGNA 3OH8A 3JQAB 1ISIA 5KNLA 4E13A 4K28A 3PRJA 1GDHA 2WEKA 3ZDFA 1R6DA 3S8MA 1ISJA 1DJNA 3OQ1A 4YR9A 4UVIA 3H9UA 4Q3EA 2DQ4A 4MP3A 1ISHA 1GAEO 4FFNA 4PLYA 1DC4A 4CLHA 3ZWPA 1T2AA 1LLQA 2Y1DA 4CUJA 3DXFA 4CM3A 2DVMA 2OUIA 4OJNA 3HADA 2OMEA 1UDCA 4Z0PA 4CM5A 1F14A 2EW8A 4MINA 1VJ1A 3E9MA 4I5FA 2C5EA 4CR8A 1SEVA 3EW7A 1EBUA 3K6JA 5A9RA 2FRDA 3MOGA 1DSSG 3COSA 3KHUA 2DM6A 3IC5A 5AXCA 2YHUA 2BI7A 1I10A 2JCYA 5LC1A 4GX2A 3RBZA 3LF2A 1MG5A 4Y9DA 1SO8A 2EKPA 4BO6A 4YDRA 5CEJA 3INRA 1MFPA 2NU6A 5TJ9A 3LC7O 2HUNA 3HSKA 4YAEA 4B4VA 1GZ3A 2ZCVA 3AU9A 3DWFA 3KSZO 3GVXA 4RLHA 1N7HA 5KKCA 1IYZA 4JBGA 4LVCA 3Q2KA 4E12A 1YS4A 2PR2A 1LSUA 3VH3A 3WTBA 3DOCA 4UUOA 2B5VA 5I7VA 4KDEA 2BRUA 2ZQZA 5C7OO 5ER6A 1GY8A 3UXYA 1E3JA 2NU7A 4XYLA 5G4LA 1AGNA 1EEHA 4J2HA 4WCDA 1O9BA 2BFPA 3LF1A 3V2HA 4CMEC 4B7UA 2B35A 2NWQA 3W8FA 4MOWA 3HDJA 3UH1A 1FF9A 3OJLA 2Y68A 4BO9A 4CMIA 4LMPA 5TQVA 3FPLA 4PN3A 2YV2A 3GRPA 1GADO 3BA1A 2VWGA 3GK3A 1BVRA 2FN7A 3HQ4O
chains in the Genus database with same CATH superfamily
1RAFA 4GUDA 2YV1A 3SQXA 3QHQA 2JRCA 2AH5A 3BXHA 1CXZA 3HJGA 2DKNA 4FC6A 4D3FA 3KT6A 2J7KA 1BIFA 1POWA 1VPEA 2D2VA 3GFTA 4GX5A 2I4OA 1G5PA 2D5AA 1AH2A 3AUKA 3PC8C 3I2FA 5D5HA 5CX1B 3JQ7B 3V4FA 4AN4A 1VE9A 4M4SA 4DR1B 1XCMA 4XQGA 7MHTA 2N42A 2CEKA 3R0JA 4S1PA 4ZI3A 5FA8A 5EJIA 2AX3A 2EFDB 1E0KA 4MRPA 4KPUB 3SOPA 3TTYA 3I2YX 4MPRA 1YZQA 4NOLA 2FZVA 2HLHA 2NU9A 3BN3A 4MV0A 2DTXA 3HB1A 3PR1A 4Q1EA 5CURA 3TQCA 4N5MA 3VR6D 3WFIA 1AKTA 1T4CA 2G70A 2OPHA 4UM9B 5I51A 5LQCA 4NXNB 3G5AA 3EIWA 4OH7A 1O6GA 3MLEA 3LTEA 3IP5A 2XTNA 1P8JA 2W8ZA 4B46A 3BUSA 4I81A 2ABWA 3TRJA 3AEKB 2JB9A 3EARA 4PVCA 4TXHA 4AJ1A 1OXUA 1Y63A 3OUTA 3W4KA 5JFOA 1D0SA 3L79A 1THTA 4QAQA 4QBKA 4M89A 2PKQO 2F9MA 1O5TA 1FS4A 2YVUA 3OPXA 3RV3A 3K9NA 4M1QA 2AQ8A 3HCRA 4DR7B 2GDJA 2O8DA 1C8VB 4HAUA 4CQLB 4J76A 4XFDA 4WDRA 4DMUB 3SMVA 4FSXA 1O95D 1Y6FA 4A8JC 3CVWA 4N0DA 3B2NA 4IEFB 5EJ2A 5TPZD 2B8TA 3LDHA 3KDSE 1T5IA 3K0KA 3NOXA 5ALYA 4U1RA 2G80A 1E2MA 3D6HA 1FB5A 4E70A 3O84A 1J21A 2QV7A 3D3QA 5T4BA 4Z4EA 3ZCUA 4YI5A 3FNFA 2WSBA 4A36A 3N8IA 3WJ2A 2PQ6A 2WF7A 1KMIY 1GPLA 4KNYA 2GEUA 3TI7A 2VP9A 4TROA 4O4IB 3VR2A 5AOVA 3FHOA 5EKXA 2PNJA 4DXHA 1WZCA 2C7VA 4JT9A 4UDYX 5FI1B 1FUIA 3HBJA 1QH8A 1A76A 1B93A 4B4UA 1VXRA 3QXSA 2AJDA 5B4TA 2LIPA 3RYHB 3JQBC 2JFQA 4RQAA 1E9RA 3A4IA 3C41J 4JI5B 3P2EA 4XJVA 3I5AA 1G7TA 1TRKA 4QDXA 3AOEC 3STYA 3V34A 5F1OA 1E6UA 2R68A 2FETA 4PYQA 5CT6A 1EE9A 1GZUA 2EX1A 2FY8A 1QHEA 2FPLA 3INTA 1ZP6A 5TB5A 1KMNA 4QRHA 2ZRCA 1S4MA 2FSFA 4F4UA 1GKIA 1NF9A 2CMDA 3AUJB 1XCPA 1PFWA 3U4CA 2G0AA 1NQTA 1FTQA 1N7IA 3QX9A 5FI5A 2CZQA 3UJDA 1RHJA 4LDPA 1MDFA 1V45E 4Q48A 1ZRHA 3AX6A 4DLNA 3I5MA 4NZYA 4R1SA 3BKWA 3ROPA 2VL7A 3OZFA 3L7JA 2R3SA 4QJIA 5BRJA 5IRCD 1G7CA 1RC1A 4O2AB 4KIJA 3LK6A 4TVKA 3T1QA 3TUJC 1AZSC 5LL6P 1EUQA 1T2VA 1VB3A 3NUQA 3BMCB 2QXTA 4RHFA 5TIIA 1TD9A 3G89A 1XXHA 1VLHA 3PHLA 1JG2A 2PFGA 3IERA 5F9MA 2QN7A 2VSOA 3K1JA 5A02A 4BVAA 4PNHA 5I01A 3NHZA 3HWWA 4LNAA 5KHLB 1Y48E 1PKXA 4UULA 3LQKA 3MJDA 2XZDA 1U9CA 1ULHA 1PZXA 3JQFA 4PC3A 5G3YA 2C5HA 3F5SA 4RQUA 3DEFA 2X5JO 4A4DA 4F6CA 2V5UA 1XZNA 1KDRA 1J33A 1GZ4A 3ND9A 3RIHA 5IJWA 5KO2A 4YRCA 3EOAI 1C3LA 3NH9A 2I29A 5HFNA 1K3TA 1NPTO 3KYCA 1VHJA 4FKMA 1RRKA 3PFCA 5ULLA 1T6BY 4GZ6A 5DSZA 4C7BA 1F1JA 4C0QC 1NYQA 1OWPA 4O2BB 4NCBA 4MNTA 1OC2A 2BUCA 3IILA 5B4VA 2XECA 1WAMA 4IHKA 1QFYA 2EL7A 3QG1A 1KEUA 3KEFA 1WZEA 5FOXA 3S2YA 4MVJH 2WSYB 2ZJ7A 3E9RA 4R40A 2A5LA 3F5DA 5LCXA 4BGIA 2OZLB 2Q3DA 3KKLA 1IPFA 4U3JA 4JBHA 4HV4A 4GL2A 3NT2A 2Y66A 4AQDA 3VC1A 4EHBA 4KWCA 1ZUWA 4HQ6A 5A0FA 3RRZA 4FNGA 3WRVA 1FYFA 3I83A 5K6AA 2NU8A 1GNSA 4PZZA 2XQGA 2IXFA 3ZW7A 2F6RA 1E98A 4HR7A 3H2BA 4G5QA 4R7TA 4ROTA 1HQCA 3IRVA 3ANLA 3IUSA 5IJZA 4DUZB 2XVXA 1PVDA 1ADYA 2OKCA 3H1GA 4AMVA 2QTVB 4ZI5A 2VKTA 1UXGA 3RUIA 2VHXA 1J06A 3Q5EA 4R1TA 4A0RA 2WJ6A 2QU7A 2NZYA 4TVBA 3DE2X 5TF4A 3RBVA 1C9NA 1U7DA 2RHBA 3TM5A 4OHFA 5CYOA 3ENVA 3HB4X 3P9QA 4H08A 5GWXA 5JD4A 1PQUA 1V5GA 2AW5A 4OXXA 4RJTA 1U0BB 4XDYA 4OQLA 5F3DA 5HWSA 1BDIA 4EW6A 2ZYGA 1Q50A 5IS2A 4LK3A 4YC7A 1CEQA 1UXIA 2RAUA 3WMWA 3CKMA 3FYTA 1OXSC 3BMXA 4NHEA 4QULA 3OLQA 5FWXA 3HDYA 3NAGA 5D2CA 4NCAA 3I2KA 2YHBA 2OMKA 3HC7A 4EZBA 3HSYA 4FK8A 2IV3A 3CBQA 1D2CA 4OUDB 1WV1A 1V1MB 3DLAA 2AD5A 3EGDA 3Q98A 3W8EA 2XGGA 1KBQA 2A5YB 1UXJA 2FPRA 2FSPA 1DPGA 3AI1A 4KXWA 4P3KA 2Y71A 4UVDA 2H1FA 1PFUA 5JCJA 1WSDA 1MHTA 3H3JA 1NTOA 1JQDA 1K9SA 2ZSIA 3ND7A 3UZUA 8AT1A 2QZ9A 1IXYA 5BQPA 1VI2A 5FFFA 2RK3A 3GIDA 2VZLA 1C3JA 3EIUA 2E85A 4BVHA 1Z5WA 3TZLA 4BVKA 4WRRA 1KDTA 4YONB 2O2XA 3EDQA 3KL2A 4IDAA 4K9OA 1DRJA 1B1CA 6AT1A 5EQJB 2K5UA 5JNVA 1EFAA 1PD0A 3JZMA 4UMVA 2ATVA 2IY9A 2QW8A 3A7DA 1ZGHA 2XCLA 4GGMX 1SIUA 1WDTA 3FNIA 4M1SA 4ZVLA 2I9PA 4AYWA 4ZZ2A 1M6VB 1XTRA 3MUFA 3OQ6A 4ZANA 1ZK2A 4J75A 3N70A 2XMPA 1M54A 1UMDA 1PQWA 2IUFA 5KBYA 1NVWQ 3RODA 3T7KA 3DYVA 3IB6A 2CLKB 2XYPA 3ZZMA 3KFXA 1MVNA 1S1CA 1HNZB 2BEWB 2VAVA 4MDHA 4WECA 4L3WA 1I4LD 1MX5A 5C9ZA 1DG1G 4DA4A 2IGBA 3IX7A 1WF3A 5AM5A 3V8QA 2POCA 1IHYA 3B53X 2I1QA 1W4AA 4E3ZA 4Z51A 2IDKA 4U7PB 3HZZA 5L3SA 4FYKA 4XVQA 4CXMA 3DM9B 3DZHA 1UZLA 2WJVA 3FBTA 2DGDA 1UJ6A 3BMQB 2JGRA 3L46A 1N0IA 3D7NA 5E0KB 4ZAGA 1Z12A 4F3YA 1UBUS 4JJFA 4D6XA 2BY4A 1CJUC 2Y1CA 3C3EA 3W06A 3VKVA 2FR8A 2E4WA 2PMWB 1D2NA 4JMPA 3WLMA 3W5JA 1KEEB 2HKIA 2W6IA 2BGWA 2CDCA 2XAUA 5FBHA 4KGDA 2CVPA 5NULA 1ZDMA 4P5EA 1NSTA 4ODIA 2ZUWA 4TZ6A 1A4XA 1AMUA 5IXSA 2FK8A 4X6XA 4XSHA 4BBJA 1H3NA 1QRRA 2IF0A 1KI3A 1ZM4A 1AQNA 3HKBB 2J3EA 3I04M 4K0RA 1FX1A 1W25A 2B4RO 1RKQA 2CDRA 5DNDA 3KQHA 1CNEA 2HCRA 2OILA 4TWJA 5LNK6 4W5WA 5JSFA 1RP7A 4OK3A 3WWEA 4QXAA 2EZ9A 3EWIA 1F7VA 2ZI4A 1J9ZA 1UBSB 1AKEA 4N8DA 4Y2TA 4HDNA 2Q4TA 4DM4A 1M2WA 2C95A 4YJKA 3BL8A 2ZT8A 1C7JA 3FCYA 5CXQA 1XZLA 3UFXB 3UWMA 3ROQA 3MUNA 4QEKA 2YRFA 2R65A 4NP6A 4OJTA 3U3JA 3UTCA 4ZMSA 1KY5A 4Q4AA 5T67A 3VYWA 4AJJA 2P27A 5EZYF 4OG2A 5AVUA 5AKXA 1R7RA 5MDHA 1TVKB 1WPXA 3GD5A 3UPUA 5EZ6B 1JR4A 4FNMA 3LYHA 3A1VA 2F1IA 3AR4A 2QY9A 4I6EA 3Q85A 2H2AA 4IIGA 2EGUA 4M8IA 1XQXA 3MWYW 4NNOA 1K68A 4MVJE 1S8OA 3TTVA 2EBFX 1XMOB 4GNKA 4JJEA 3ZY3A 4GE0A 1CJCA 1FK8A 2XCQA 3CCCA 4RZXA 1NVUQ 2P7IA 3GJ7A 3LX4A 4JCOA 4BBAA 3V3TA 1QFZA 1DKRA 5AMXA 4D3ZA 2R5NA 4EHFA 1MW8X 3IMEA 4AJPA 4IG9A 3V3KA 1VHTA 2QR5A 4AY2A 3PPVA 2X1VA 2O3SA 5LYYA 4B4OA 3LWDA 1YU6A 1T1JA 1JLSA 1CE8A 1Z08A 3AEZA 2QPOA 1QH1B 1AZTA 3VTAA 2PVPA 1B2LA 4J0KA 3KUXA 3EGOA 4GSLA 1CIJA 3AILA 4TMYA 4B3JA 3HB7A 4TZKA 2FMHA 2MSEB 1I94B 3SBDA 2WP8J 2WHXA 1E64A 1L7RA 1T4BA 3SNHA 3V8NA 5HXAA 1VQ1A 1KKMA 2PGXA 3TRKA 4JLSA 4XTRA 4PYJA 1NW8A 1Z13A 3IAEA 4CNQA 2QL9A 4N0EA 1SCKA 1ADCA 4M0KA 1JR3E 4UXHA 3IUQA 2OXIA 3ZGVA 1Q2XA 2LV8A 2VYND 2ZVJA 3G8BA 2OAEA 3R5KA 5LYJA 1P9LA 3KJQA 2H2FA 1II8A 4HNAA 2G0NA 1NQWA 4Z5XA 2AC2A 3GGOA 4UD6A 2YN0A 1IY9A 2GXUA 1P2VA 1ZFNA 4MS4A 4U7WA 3AVQA 4F3KA 2ST1A 1PLLA 2VUHB 4UDNA 1UH5A 5JZSA 5IM5A 4E30A 5KVQA 3KXDA 2P62A 4QC2A 1HMYA 2R8OA 2DPYA 2VKQA 4MR9A 4JODA 4WEOA 1Q16A 5A3SA 1JA1A 2FUG1 2A0YA 3FNEA 3IP9A 3CRNA 4O4LF 3PQ7A 4P3YA 1FRFS 4HTFB 1SA0B 2CNNA 2GCIA 2WB4A 3F3KA 3GJZA 2A84A 4HZUB 4TLDA 1WB4A 4P4SA 2C8KA 4IZOA 3ZQJA 4DTIA 2GUWA 1FSFA 5JVDF 2EWMA 4Q37A 1QG6A 5G02A 4LV6A 4QOSA 2AWOA 4H0FA 4KUGA 4I2NA 1PQPA 1JFSA 3ZV7A 4P5PA 1FZTA 1DBVO 3B38A 4AIIA 1R74A 1PU2A 3H6KA 3VAZA 4AO6A 4F4IA 3ZS9A 2PS0A 4CT4B 1FY2A 4MGIR 3BDIA 4FMDF 4AZ3B 4K9NA 3OP4A 1QM5A 1U5AA 3PWTA 4PG8A 5IAEA 3NDIA 3N07A 4JC5A 2ADOA 3A04A 1TCAA 2V96A 2WM8A 4OKIA 4QKQA 3Q8WA 2QRGA 2F64A 1JPNA 4KMSA 2HK6A 5I5EA 5CJPA 1PR6A 1J6UA 5L3ZA 1I1HA 1CY8A 1E9DA 2JHCA 3H5LA 2JAPA 2G9NA 1G42A 2DU8A 2NP7A 4BLVA 4LTMA 1DBPA 1O94A 2PLNA 4WBNA 4MKXA 2CXNA 2IYOA 1UPAA 3UB2A 4E21A 4R9NA 3Q7TA 4HRVA 2X0IA 3ZIAD 4KXXA 4CQMB 1CY6A 4BNJA 4F9TA 1KI7A 4N48A 1YA6A 4NI5A 3F46A 1JJ7A 3CA8A 1NLMA 2MYPA 1OE0A 1OBOA 4G0XA 3NTQA 2J0UB 1LFAA 4JLAA 5IEBA 3D5QA 3CM0A 4JHLA 5LQRA 1UK8A 2DKOA 4WN9A 3RREA 3F78A 2TMKA 3HO8A 5AK4A 3OCZA 4UHJA 1W1IA 3RPEA 1JEJA 5FPQA 1DXOA 3IMFA 4B6RA 2YIDA 2G40A 3IEXA 4IIVA 1CR1A 3UAOA 4DY6A 5E2IA 5LDDC 5J59A 1CUUA 1NXSA 3IQGX 5K8LA 2BN4A 1WCIB 1V4NA 4TVSA 5I7FA 1ESCA 2AXEA 4UNIA 3IJRA 5CIQA 6ABPA 4O02B 3GLHA 4L8LA 4P7KA 4RD4A 1IIRA 2CFRA 4CPDA 3KKOA 4B3DA 4DSZA 3LFTA 2QZSA 1FU4A 1YWGO 3CLSD 3N0WA 2HJSA 4RJJA 2YNMD 2DUMA 3AVWA 3GFGA 1YIDA 4D4HA 1JKJB 1NOIA 3RAPR 2DETA 1XZEA 1X3LA 3BCSA 4JC0A 4YRLA 4B9EA 1JAYA 3E7FA 4CM8B 3QLJA 1KU0A 2ZS9A 5C5CA 2PLWA 3WQQA 3PFGA 3X1YA 5F12A 1Y0BA 3VH2A 4C08A 4XVUA 4E5SA 2FW6A 3FJ1A 5DM1A 1ZK1A 2FPMA 2AG5A 2X1HA 3IXQA 4N3AA 3PXGA 4DYVA 1D2EA 4WL0A 2J87A 3AB8A 3QLTA 1SC6A 3O9MA 2I03A 1IDN1 4INJA 4X6LA 4RD1A 1NPYA 1XA3A 3GRKA 2XJ4A 4QASA 4A8PA 1U90A 1IZ8A 3MT0A 4ZDWA 2MCFA 1I13A 1CDZA 1M7BA 1Z0ZA 2ZVDA 3PUKA 4TMXA 4ZJPA 4H60A 3CMCO 3E9DA 2OENG 1WPGA 3ULKA 1RI3A 3IULA 1LLDA 3AYXB 2WQ7A 1E5DA 3FTCA 5DW0A 3AR7A 1TIKA 1RU3A 1XALA 5ECYA 3R5FA 5HIJA 5DM70 1VJTA 1CUCA 4HQRA 3HCWA 2R25B 2P1DA 1QZ3A 2QBYB 1WUHS 3ANSA 4JOCA 3HWSA 2H06A 4EKDA 3SN6A 2G83A 1C1YA 3E9ZA 4G23A 1PFVA 1PWHA 1J1IA 1T26A 3L40A 2XYVA 2G4VA 1AU9A 2NO5A 4IHJB 4PNPA 4RF3A 1L5HA 3TNFA 2X5XA 5G4KB 4NG5A 3V1UA 1TJ4A 1VKHA 3PGLA 4N9QA 5BNIA 4BMOB 3V9AA 4KQMA 4NH4A 4CCYB 2IS4A 4KUHA 4ZALA 3P20A 3BT7A 3FRJA 4GBGA 1HURA 3KV1A 2UDPA 3G2JA 2LE0A 1SCAA 3BMOB 4UCQA 1Z17A 4A8JB 5I6DA 3TMYA 2IHKA 3X44A 2OQ2A 5I9TA 3JR3A 1JHXA 4US0R 4YRMA 4KLRA 5CA0A 1OT5A 2ZJYA 3R7LA 3I62A 5TPWB 1BH6A 1NULA 4R0NA 3HCDA 2WG1A 3BGVA 3FTFA 1PWXA 2QNIA 4HB4A 5AD1A 1OTXA 1NNSA 2FSHA 3G2KA 2CGEA 1M83A 1UADA 4MPPA 3FHLA 5DNEA 2QWXA 1RXCA 1YHZA 5E95A 1KXJA 5JNRA 1HZZA 1TM7E 2JIOA 2Z0MA 4JVLA 2HD4A 2RAFA 4X94A 5SYMA 3ZHBA 3BQMB 3DEKA 1R0SA 1N6IA 1TZBA 1SXJA 4GRDA 4UVHA 5B2EA 6REQB 5H0IA 2WHYA 2HJ9A 3THXA 5HIMA 2ZJ4A 5JJLA 3LXRA 4WK4B 3S28A 3BIWA 4RO0A 5JI3E 1CZUA 3RWOA 1NF8A 3WHIA 3E8XA 2I55A 3UHAA 4NCKA 1J2UA 3MOSA 2YIJA 3O8QA 1ICEA 3G6WA 1MABA 2UZ1B 3BZUA 3P5BA 2Q4BA 4BKRA 1WXXA 3HG7A 3OZAA 4N5DA 4NQZA 3RBAA 3DXYA 3DJYA 5ITWA 3MRSA 1C9DB 4LV5B 4RVNA 5BV8A 1IBRA 4Q03A 4RKEA 4CM9D 2EATA 1UFQA 2FUKA 5KVSA 1EUCB 2ETVA 3L8MA 3DE4X 3DQQA 4IDGA 4PICA 1RWVA 3ICVA 4TUYA 2VHZA 3ZHUA 4BV8A 4HQ0A 4E6PA 1QU3A 1LLUA 3Q3GE 4IQ4A 4MWCA 2UZ4A 1UMCA 2V5VA 5JIBA 4QU0A 5A4DA 3WJAA 4PZEA 2O0MA 1F7UA 1M0WA 2WUFA 4CMCA 4DCMA 2JAXA 2AXPA 1KEKA 4DDVA 3EFHA 3T1VA 1KS2A 3GPIA 2ON6A 3ZH2A 2Y0PA 3E03A 3DWIA 5T6MA 2PGIA 5IJXA 4KNWA 2WKRA 3CZ5A 1T3HA 5K6RA 1QQBA 2HRQA 3PIIA 1EXNA 5TS2A 2ZXEA 1F2UB 2RB5A 2ZG6A 1EK1A 4LVOA 2GM5A 2VHCA 2AOWA 3B3JA 2FN4A 3EQ2A 4RY0A 5JFGA 1WXDA 5JFTA 2P78A 1JIKA 3UMFA 4U4AA 5CBPB 2BGUA 5ALWA 2B0CA 3D0QA 2R8ZA 3KS9A 4B80A 4KQWA 5IVKA 2FLVA 4Z9XA 4MW6A 4BB6A 3TOVA 5LP6F 3SSNA 5ADUS 4D9JA 3DEYX 2YQ4A 3D4IA 3QKRA 2Y0DA 5FI3A 3DWGA 3RVDA 4CIWA 3GRRA 1ZJ5A 2CMFA 4R7ZA 5ITZA 4WK6A 4K81B 4O1HA 3M4XA 2I7TA 4IOJA 1OYYA 1K3UB 2WHEA 2P9TA 3HJTA 3VFDA 5C8YF 1NJFA 2C31A 2B98A 2R8EA 3CH6A 5BN1A 2CD9A 4KXUA 3ZR4B 3I9NA 1MF7A 2HOQA 2A9FA 1GCGA 2I2CA 1HPLA 1ATIA 2XRYA 4G0PA 4M1ZA 5ALHA 2IEZA 2JIZA 2UZ0A 2UYYA 2RK6A 4C0SA 3U6KA 1Z33A 5IXJA 1KTIA 1KEWA 2JGKA 1C9MA 4MEAA 4X63A 3FAZA 5KOJA 4EY8A 1DL5A 2F43A 1D4OA 3C6QA 2ZIVB 3BFPA 3KAQA 4FYVA 4LPSA 5AUQA 3UW3A 4KITB 2HDWA 3I6BA 1HY3A 1U9YA 4JT8A 3LT0A 4TXLA 4NYMR 3LIIA 5FP0A 4UTRA 2O2IA 3FB1A 4WEQA 3U09A 5BPFA 1UKZA 4ZZ3A 3C48A 2G6BA 2L82A 5JWRA 4QFMA 2YZGA 3RRYA 4E2YA 3O8LA 2QHXA 2WLSA 1WLSA 4IV8A 4JFRA 4QA9A 1TTTA 1MLDA 1Q74A 4LWQA 4MW9A 3DEIA 4XGNA 4NG4A 4L2IA 4H1HA 4JL6A 1EWVA 2I4NA 3LHIA 3WAGA 4Z4IA 3T3MB 2IIPA 5D7BA 3VO2A 4E2FA 3O83A 3UH0A 2GNOA 1JALA 3BIOA 3H2HA 3ORQA 3R2JA 3RR2A 2PL3A 4EGQA 1CX9B 4G0MA 3MYYA 3P0RA 4G8DA 5AI9A 2FFRA 4HSEA 1R5JA 1GQSA 2PUJA 4LEIA 5H9WA 5K3OA 3NIFB 2EYUA 1AURA 3QKUA 4Q6WA 5T3YA 1MPTA 4KYVA 1SC9A 5ENZA 5LFAA 4YXWD 3U5TA 5HKKD 3C3MA 4Z4GA 1ZA2A 3HN6A 1JH9A 2QTWB 5CJ2A 3HGMA 1CYDA 3K05A 1COWD 1J8FA 3EEQA 1E60A 4LX8A 3SBEA 5IDXA 2XWQA 1PT8A 1R9NA 1TFUA 4GOMD 3FPKA 3O4JA 4GX1A 2DFPA 4HD8A 5ALUA 1MC1A 2LTAA 1IJEA 2VBCA 2X0DA 4C0XA 3K6KA 1BHQ1 4AMYA 2HH9A 5TVKA 2EG9A 5BMVF 1SXPA 2IPLA 4MV4A 1Q1QA 1DV2A 2X6RA 2G4CA 1V7CA 3AUTA 4QGFA 3EDYA 5CFRA 5JS1A 3MTIA 1M8PA 4GRIA 2W4MA 2FH5B 5I8ZA 4HUQA 4WY5A 1PL7A 4JFAA 2JA1A 5KU7A 3BE4A 3N0RA 2EJUA 1O9GA 3GMTA 4Q4HB 4B7CA 1X6VA 3TDKA 3P0EA 2WTXA 4MAAA 5EGSA 4TKMA 4ZOLF 4KAAA 1H3EA 1AV6A 3WGTA 1QRSA 1I2CA 1R0RE 3MILA 1IG3A 4G0OA 1DCKA 1XCLA 3C3JA 4XLZA 1AQJA 1V6CA 5A0TA 8ATCA 1AHIA 1YS7A 1TLFA 2C4TA 2IS2A 2ZRNA 1ZM2A 4NTZA 2VHYA 1WWKA 2PWBA 1QVAA 2ORED 4YUVA 3EPJA 5DGTA 3FTDA 2XSZA 5GJBA 5H8WA 2P9YA 1J1UA 4KCGA 3LCMA 2V45A 2GVDC 3ICWA 2FU5C 1L6RA 4YQYA 3TIGA 4YV2A 4JB8A 1ZISA 3TZEA 4K87A 1L5KA 4OMUA 3RK1A 1L1EA 4JGGA 3RT7A 2QLJA 4LGCA 4TWIA 4TV8F 3WLLA 4RHTA 4GFDA 1VPWA 2V8BA 3W6NA 1T5LA 1J1ZA 3RI3A 3ZE0B 4DGQA 3CE9A 4G9BA 2ZYRA 3EIOA 3MK31 5IT5A 1V8PA 2EQBA 2CJWA 2NSJA 3B1FA 1TGVA 3U49A 1C9EA 2ZR0A 1NT2A 3P4XA 4HSGA 3LNTA 4P92A 4R8VA 2KBEA 3ZW8A 3D8RA 1F4VA 5KOHA 3EVZA 1YCDA 2CEAA 5CA1A 1JTVA 4FGWA 4W8HA 3W6OA 3NONA 1M0EA 2X14A 1N7GA 5LOVF 1ML3A 4TMFA 3QWBA 3OQPA 2PL1A 3VKFA 4CZ2A 5LVAA 5CDYA 4BVLA 1KC3A 3UB4A 4L7QA 2P68A 2BSQA 3CRMA 4M0DA 2OCGA 1OKKA 4RTOA 4PAMA 2IOQA 5EZ5A 5BN4B 4Z7OB 4R71A 4MV9A 1VECA 1M73E 5T6BA 1IDOA 5EPUA 1FLVA 5FHRA 1MQAA 1Z2OX 4LC1A 4KSBA 1F2TA 1O6CA 1V5WA 3I6ZA 4L8VA 5THXA 4R51A 5NLLA 4RK6A 1G64A 2EP5A 2F4NA 2BHLA 4EUSA 3WHPA 1Z7EA 3HH8A 1W94A 2H2HA 1BWSA 3D3WB 3BULA 3Q7IA 1E3TA 5BSEA 1KERA 3KZXA 3LNCA 3CNBA 4ITVA 1H05A 4OD0A 5AM2A 3DOJA 5FTJA 4B09A 3BE8A 1TVEA 5IAKA 2HU5A 4R5MA 5DBIA 2O8FB 4LHWA 1U1FA 1WHSB 3MNFA 4NBTA 4F8EA 5A62A 4EECA 1QKIA 2XUDA 2AFHE 3T9CA 3QVLA 4KGZA 4JLBA 1T5HX 2D2FA 1JBEA 1E2DA 4HJRA 3CW8X 1C29B 4NPCA 3F8SA 1TU3A 4FFDA 3R3ZA 5TARA 2A9KA 2EV9A 3EG9B 2H17A 4PCVA 3Q1KA 1DJMA 4KPYA 5B4UA 4H17A 3SXJA 3LK7A 4QTZA 5EIBC 1L7NA 3ZHZA 2OSBA 1ONBA 1U6KA 2PAAA 4B4WA 1G8KA 5G40A 3WIUA 3QZUA 4HNVA 4P0TA 1Q7EA 4KR9A 5A06A 2BL4A 1V16A 4R3NA 1RFLA 1Z0FA 4LF8B 1HT1E 1YI1A 2BR3A 4XIJA 4OQZA 4PQGA 3SYRA 2NAPA 3DDWA 2DERA 3UYKA 5E3IA 1NJ5A 2GZDA 3O82A 5CXUA 5KTTA 3OE5A 4IGFA 2VNKA 3WGJA 1H6BA 1SVUA 1GV0A 4MI6A 4BX8A 1WKVA 1XYGA 3D3JA 1NQUA 2TECE 4LNHA 4REQA 3AH8A 3TL6A 5THKA 4PW0A 1Z0UA 1AS0A 1A7AA 2Z2XA 5FBRB 1G5IA 1OIXA 4JC4A 4A2QA 3MS4A 1GUFA 3E70C 4XRRA 1LRKA 1SG9A 2V7PA 3DFIA 1I7LA 1T2NA 1VBMA 3N2IA 4JYCA 4W7HA 3N7AA 2WTNA 1DDGA 1X1TA 3TOSA 5B3JC 4QVIA 3RIYA 3AG6A 3AR3A 3JATB 4J4BA 1RHQA 3VV2A 4UEWA 4MJXA 4EBBA 2FEKA 3WFJA 5K45A 2RH8A 4WY2A 5K8VA 3IKTA 1BKSB 5K09A 1QV9A 1EZZA 4M1KA 1IC6A 2BFBB 5JPCA 4CIBA 2FRVA 3JQGA 1ACMA 1G2IA 4IWXA 2JG3A 3LQFA 1PR0A 4YLGA 2H31A 2C9CA 2JKYA 3GQBB 4XJXA 5FBQB 4GVXA 1BGXT 5CLLA 2FCRA 1QGOA 5SZHB 2PZJA 4FI3C 3I0MA 1NMZA 2EEZA 3RC3A 2GOYA 4JLVA 3W1VA 3IR5A 3A1EA 5E7MA 5I9BA 1KI6B 2XUHA 3G0BA 3C3AA 1M7HA 2B3DA 2PH3A 3IBTA 3MVEA 1XZMA 4MTLA 4OHKA 1GIAA 1E1DA 3KKZA 5J5VA 3SHTA 1EVQA 1U7HA 2BF7A 5ELMA 1UKCA 4A6PA 4A0HA 4JSYA 1CUXA 1V48A 4KQ2A 5SYAA 2HA3A 2L17A 1P9NA 3W0LB 2PIDA 3C5EA 4WCFB 5ALGA 1F6BA 2XE7A 2AFHB 3KYBA 3L18A 4CI0B 3K70C 2ZIEA 4ZEOA 2PJRA 1FYDA 1TM3E 1IL0A 1IONA 1SHZA 4IUCS 1ND5A 4UFNA 4O3FA 5DCLA 2QN6A 1W48A 3UIEA 2WW8A 3GJ0A 2JAQA 2R62A 4W9NC 2PXAA 3PHJA 4Z7JA 3I52A 2NYUA 4XR9A 4U7DA 2ZI5A 4ALLA 3CLTC 1IXKA 4JJKA 4E4TA 5I7WA 2NYRA 3ZE2B 4N01A 2KM1A 4J6FA 4HB0A 5FI0B 1UDRA 5A3RA 3IAM6 1RWQA 4NAHA 4OP3A 2HPZA 2DSTA 1TUIA 3QEJA 4XI9A 1NP6A 2IU6A 2HSGA 4INPA 4XB6B 3SJBA 1W36D 1XVVA 2CNDA 3C3WA 5JCZA 3EK2A 5JD6A 4MGHA 3AJEA 3V42A 1YZTA 4KQ9A 1DIBA 1UJNA 2HLDA 4GI5A 1WMBA 1IXRC 2NO9A 3OQIA 2G88A 2BGRA 3QG5A 4X71A 1XTPA 4JI8B 4BV2A 1WNFA 5GOTA 2P3QA 4ACAA 4EA8A 3ITEA 2BFOA 4EHNA 2BMVA 3ZNPA 5IJ9B 1Z2CA 4TTTS 2QP9X 3CEJA 3QKIA 3KUDA 1DWUA 4BNLA 3PICA 2D8AA 3DO8A 3LDGA 1T34A 3C4JA 4G1EB 2XQFA 4LW8A 4WKCA 2P6OA 3FB4A 2D0OB 3H1AA 3DKPA 5GONA 2Z2KA 2MR5A 3HVKA 4JB3A 3SFZA 1NXWA 3KYIB 1QQTA 1Y80A 3AYZB 4UU0A 1ULUA 1L5OA 4LC9A 3FFAA 3R7NA 2AEFA 2FPKA 3OUUA 5ILGA 1EJ6A 4ZYWA 4ZZ0A 3FPHA 2VA8A 1X2BA 4EA9A 2WIKA 2WQZA 2LVBA 2YCLA 2ZZMA 2VRCA 1LPAB 2W6JA 1YZVA 2WIBA 4RCYA 4UBNA 1OI2A 1CP3A 4RC9A 1PJAA 3OUZA 2BMAA 2VP5A 2FPWA 3N2KA 3PUHA 4NCIA 1NVKA 1ZJJA 2GYUA 1N5IA 2P9GA 2XTJA 3A9WA 5DE3A 5IAAA 5E7QA 1F0PA 1KK1A 4FEEA 2NZ2A 3WNZA 4BVEA 3WE7A 3DOHA 1P5JA 2VK1A 3WLFA 3ZWXA 4U39A 3VHXB 3W2HA 1JN0A 1QX3A 2Z4TA 3UYLA 4GM4A 2GHRA 3HDQA 4KN6A 3FBGA 2P9FA 1T9DA 2AZDA 2CXRA 2C9MA 3Q10A 4HDRA 1NN3A 1CUEA 2WG0A 3N6VA 5IUJC 4OLBA 4GR4A 4TKVB 3WYCA 2ZITA 4RIEA 1E3EA 3X2EA 4D56A 4X7RA 4UBJA 5A7HA 1P74A 1AK2A 4IQ8A 3ZWVA 4IMIB 4QU8A 4XEHA 2F00A 5BSKA 1KZ7B 3GNLA 3GPBA 4U2KA 4WOKA 3DE1X 4P32A 4DTCA 2O8EA 3W5AA 2H1WA 2ZIXB 2GBPA 3FLBA 3QE2A 3UUGA 4DIOA 1REQB 4OHBA 4K7JA 4BNKA 5L6LB 1CNFA 4FOSA 4ZCLA 1EZ1A 4LA4A 4B2YA 1B00A 3KIPA 1HG1A 3UENA 3DFFA 1Y4AE 1YZNA 2M98A 4FLMA 5DMHA 3T12A 2P9BA 5LU8A 2UYOA 2O48X 2YICA 1RAEA 2VDRB 1ESNA 2CFTA 3F9IA 2XNHA 4Q12A 3TKYA 5KC8A 5EOVA 1E2QA 2L42A 3BJIC 4UU1A 1Z5PA 3EQ8A 1R5NA 2Q3BA 4P4LA 1LPPA 4MKRA 2VEDA 5HOQA 5FOVA 4DMFA 3DZ8A 1POXA 4DIUA 1G1MA 5KQSA 1ZIYA 4D0GA 3AUFA 1LI4A 3CT4A 3KDPA 1L5RA 3GEHA 4MI1A 5HJ2A 1FVXA 4L0QA 3L4SO 4ENRA 1ID1A 5DASA 1U9IA 4QUGA 1XMXA 4FGKA 4LDAA 4W5JA 1ZITA 4DT1A 2VXOA 4MV6A 3WKBA 1BAPA 3M89A 5CVDA 4YP9A 5K3FB 2Q0XA 2JFUA 1CF2O 1W47A 1ZGZA 2HBYA 1DIAA 3C3KA 3I6YA 3IQEA 3JPYA 4FLFA 2FUNB 4LJYA 5EIFA 1ZO8A 1IZYA 4G24A 1NBME 2R1TB 4FMBB 2Z56A 1JI3A 2O0LA 1UBRS 1XCJA 2AJTA 2JFFA 4G0NA 1J8VA 3ZDCA 4ZVSA 4WUTA 3E5HA 1G3QA 3GR6A 5A5FA 5EJ4A 2Q07A 5AVXA 4IIJB 1E63A 4YB8A 2C2ZA 2QRHA 3G2HA 3MB8A 3SK0A 4BCCA 1SVWA 3OC6A 3WGKA 4ALKA 1FX0A 4KXFB 2EFEB 3T41A 3H18A 2ZRPA 3NRBA 1IZ9A 1RACA 1LDMA 2QKYA 4QE3A 3EGXA 3FSRA 1AGXA 1ZMXA 3SFVA 1YASA 2YWFA 3DPIA 3BJEA 3EBOA 3F5MA 3AL2A 2ZRKA 4UNSA 1KFEB 1P9WA 3CV3A 3VHRA 5JQGA 1CLUA 4ZOQI 1L7OA 5JHHB 1Y9AA 4OKNA 4PHTA 3RRNA 1SFRA 2V7UA 5CB8A 1XIVA 2RFLA 3Q4GA 3KQVA 3V48A 4AO8A 5JXWA 2Q3JA 2IZ5A 2LCIA 1RXSA 2C61A 2ZYWX 3SJUA 3QKSA 3A28A 4LJKA 5TMDA 3ERCA 1JDNA 1YXMA 2J48A 2PNFA 3HYTA 6PFKA 4IHQA 4L9RA 3KKEA 4M88A 3SEQA 2OORA 1SKQA 3OT4A 5KYVA 4UUBA 1DLIA 4ENPA 4MVYA 1BVHA 1ZJ4A 3G82C 1BYUA 2PH1A 3GAZA 2ZTVA 4HTAA 2AOXA 3F73A 2WWIA 4AZWA 1B0ZA 2ZYUX 5LPNA 2IPXA 1K8RA 5BWBA 3DD1A 4UHHA 1L4YA 2W6QA 1KK3A 2IHZA 3AEQB 3UMJA 3JTMA 3D54D 1TVMA 2VSXA 4FT4A 4HFNA 2H3HA 2JNWA 1VC2A 1DHRA 3GYBA 1Z2DA 3QENA 2OKGA 3E05A 1KARA 4EENA 1MV8A 4EF5A 4LXXA 1OFGA 2DT8A 4B7ZA 2OFWA 4BASA 1RS0A 2AE2A 1Q83A 2BFDB 3PJFA 2VBFA 2VPWA 2XNDD 2XGSA 4MH0R 2Y1EA 2OR3A 1L7BA 1U2RA 2QNBA 3CG0A 3H7IA 4B0PA 2NVWA 2TMDA 3FWZA 4UCWA 3MJHA 4CGYA 4YQZA 3EWNA 3OE7A 1Q5PA 3LA8A 4IDHA 1QOZA 3FUTA 4ENUA 1AO3A 1BQ3A 1NW5A 3HN7A 4XB2A 5IPFA 4BDTA 5KMGA 2DZDA 4IXDA 1LBHA 5LZ2A 5K0TA 3THYB 3CEHA 3HY3A 4KDRA 5ED4A 1R3DA 2Z6AA 2D1RA 1QRAA 2RI1A 1AD2A 3FUVA 4P22A 1U81A 4Q9NA 5CNMA 3STWA 5IKOA 2ERXA 3G8CA 4D79A 4DC9A 1X94A 2IHTA 2CB0A 4E32A 1WZNA 4JS0A 4G9EA 4MVJI 2ZM6B 1G7RA 5CGQB 1VGRA 2ZRBA 1YQWA 3CLRC 4I3GA 4EL0A 1G8GA 2OGZA 2RHTA 1M1YA 3IAXA 2GTIA 2CDBA 4RA6B 4U2CA 3QFFA 1LSSA 4NFYA 1F0NA 4CG1A 1UDAA 1GTMA 2Q29A 3NBFA 1PZHA 3MTAA 4QGAA 3A06A 1W75A 1SVIA 1Y9JA 2JATA 1YQQA 1ZH6A 2YOHA 4NOMA 3GLGA 2AV6A 2O7RA 1G8JA 2JFXA 3AGPA 3QVOA 4K9RA 3ZCQA 2ZEJA 1XDWA 2C97A 2PUTA 2XDQB 3OLXA 2RKBA 1RBZA 1LW6E 4JK3A 5CXSA 3TDMA 4BO2A 3Q8MA 4LAFA 1VL6A 4JLDA 1J2TA 1X42A 1FNDA 1NX9A 1BH2A 1ULZA 4QJ5A 1B74A 5AIAA 5GPBA 1V8OA 5IC4A 1RLIA 2Z2ZA 1M6YA 3VGPA 4CLRA 4G63A 3SF8B 1CK4A 1NA5A 4KVFA 4NZ9A 2O05A 3FYUC 5JPIA 4CTJA 5TRTA 1UIMA 1YMVA 3HCPA 4ZVVA 2P2SA 1KY2A 3ZNNA 1VKRA 3OT1B 2XQJA 3F6YA 2PMEA 3SS8A 4XE5A 4OGKA 5KQRA 4ZTBA 5DX1A 4ZKDA 4Y9RA 1K86A 1GD1O 1B8VA 2ATXA 1TJ3A 2FQXA 4G25A 3ZU6A 3LGSA 3RABA 4BS9A 4UNNA 2FP4A 2WT4A 1F9AA 1P5RA 2NPOA 3HP7A 3LY7A 4UU7A 2KHZA 4XJTA 5H02A 2ZUFA 2FHPA 5H3HA 4TYWA 1LLCA 3HXKA 3MGGA 2SKCA 3GOHA 3UVEA 4FC7A 3NHUA 4INOA 1MC5A 1UK9A 3UJCA 3ADKA 1XRRA 2WTMA 3ZK8A 1O96B 3N8NA 4C0JA 1H5QA 2X0JA 1UFKA 3AFOA 3QTLA 5I8WA 1GWNA 1KVTA 4XX0B 5GIOE 4LS3A 2BFFA 3K5PA 4KXNA 3P26A 3EW9A 2QEQA 1I36A 3IOEA 4C0AC 1BHSA 2F7SA 1W76A 2HRBA 2PX2A 1Z68A 3E4CA 3PPWA 4KQ6A 4ZYTA 1W59A 3KJIA 2OXRA 1BXGA 4F3TA 5DN6D 4EI2A 3KT0A 1V5FA 3MBIA 2VYFA 3DKKA 4N3NA 3ROGA 2HUPA 3IKMB 3PA6A 3U4AA 4LBYA 3L7LA 1HRKA 2CDNA 2V7XA 2FXIA 3AJDA 5E7JA 2ONYA 1PYGA 1EGVB 2XKKA 5DHAA 4EPRA 1CS4C 1QTIA 3UG7A 2OGTA 1SBCA 1XMSA 2VAXA 3BB4A 2G06A 2FZ4A