3ESZA

K2ak3a flavodoxin from anabaena
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
169
Chain Sequence
b'SAAIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Flavodoxin: A compromise between efficiency and versatility in the electron transfer from Photosystem I to Ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Electron transport
total genus 60
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3eszA00
2MT9A 3UXEA 2B3DA 4LTMA 4Y9UA 3D7NA 2V5VA 4D02A 5JROA 3KEGA 4N82A 3GFSA 5FUQA 1ZX1A 3ESYA 2HPVA 1YCFA 2M6SA 2OYSA 1BU5A 3OWHA 4NULA 4U7GA 1H66A 2Z9BA 2N1MA 3NHYA 5TGZA 1T0IA 2RG1A 1J9EA 1YOBA 3L9WA 3NHFA 3NHWA 4J8PA 1AKRA 3NHLA 3OX1A 4LTNA 4YAFA 4PTYA 1AZLA 5LLDA 4U7HA 4CF6A 1KBOA 4C0WA 5LJLA 3W77A 1V4BA 2FDXA 1QBGA 1AMOA 2KLBA 1YCHA 1WSWA 2ZKIA 1XI2A 1H69A 2XOEA 3SVLA 5BUCA 2QMYA 4FX2A 4N65A 1FTGA 1CZHA 5ULLA 1D03A 4LTDA 2M6RA 1AKUA 2X2PA 4C14A 3KAPA 2KQUA 3EYWA 3OVMA 2QX4A 2V5UA 1BVYF 2BN4A 1FLVA 3NHSA 2WC1A 2QX9A 2GSWA 3GFQA 2XODA 4YALA 1OBVA 3LT5A 1FUEA 1GG5A 3ES9A 3NHRA 1J8QA 3N3AC 2Q9UA 5F12A 1XT6A 3K20A 5EMNA 1B1CA 1TLLA 4QOJA 2OHJA 3R6WA 5A4KA 1XYVA 3FVWA 2FVXA 3TE7A 2W5UA 4F8YA 1QRDA 2HNAA 2D5IA 2MTBA 1RTTA 1I1OA 1RCFA 1AHNA 2MOKA 1DXQA 4OXXA 4DILA 1YCGA 1FLDA 1CZLA 3S2YA 1FLNA 1NNI1 4HEQA 4ZVLA 2A5LA 4ZVNA 4HS4A 3FX2A 1VMEA 3OJWA 3NFRA 1XYYA 1ZWLA 1T5BA 3QFRA 4LA4A 4R81A 2QR2A 1OFVA 2OHHA 3B6MA 4DIKA 3OX2A 4YAUA 4QOGA 1D04A 4H6PA 4QOHA 4BMPB 5FA6A 4GI5A 3OWXA 1JA1A 3TZBA 3U7RA 2QWXA 3ZHOA 5B3KA 4QODA 1YDGA 5NULA 3FW1A 1WSBA 3N3BC 4ZVKA 1DXOA 1C7EA 2OHIA 2X2OA 4N9QA 1JA0A 3W79A 1CZNA 2FOXA 2Z9CA 4DY4A 5EAIA 4H2DA 3TEMA 3F6SA 5F51A 5LMCA 4NLLA 3HLYA 3NHJA 3G5MA 4QOFA 2ARKA 2Q62A 3F90A 3EDOA 3GFRA 3O73A 1SQSA 4PTZA 1FLAA 4U7FA 6NULA 2FAXA 3QE2A 4ESEA 1J9GA 4BMOB 3RPEA 2BPOA 3OX3A 3KAQA 5EA2A 1CZKA 4FGLA 1FX1A 3NHPA 5LBUA 3NHUA 1DX9A 4XDGA 2FZVA 2Z9DA 2BMVA 2QMZA 5FX2A 1C7FA 1YRHA 3JSXA 1AKVA 2FX2A 1QR2A 3ESZA 1KBQA 2FZ5A 3GAMA 4ZVMA 3K1YA 2FCRA 1OBOA 2R97A 2V9CA 3NHKA 1FVXA 3LCMA 4PU0A 3W78A 3B6IA 1RLIA 3W7AA 1F4PA 1AKWA 1RLJA 4S24A 1AKTA 2Z98A 3U7IA 3P0RA 3L9XA 1AKQA 3ESXA 1SG0A 1CZOA 3B6JA 1ZWKA 4Y7CA 1J9ZA 4Y9RA 1X77A 4YAOA 3HR4A 4M0CA 2BZSA 1YKGA 3OJXA 4YQEA 4QOIA 5NLLA 4YAWA 3QFCA 4C0XA 4CETA 2MWMA 3KLBA 3F2VA 1E5DA 3N39C 4ICIA 3UXHA 4XDHA 1AG9A 3HA2A 2QX6A 3F6RA 2BF4A 2FLVA 2F1OA 3FNIA 2HNBA 4QOEA 3FJOA 5F4BA 5LBTA 1CZRA 4C76A 5LVAA 4LAFA 4FGKA 1D4AA 4FGJA 2AMJA 5LJIA 2QX8A 4GR9A 2R96A 1TIKA 5B3LA 3O2NA 1CZUA 4GQIA 1QHEA 3B6KA 3NLLA
chains in the Genus database with same CATH superfamily
3L1HA 4IOMA 3LWZA 4J2OA 2FKAA 2NVBA 2XXJA 4HYTA 2G1UA 1YDHA 2NZXA 2A0UA 1P2SA 2WJWA 4LQLA 4KMSA 3EPRA 4PQGA 2JIQA 1CYDA 1CJTC 1M1NA 2AVNA 3K4HA 2FRXA 4OUKX 4UMVA 4V0OA 4ZT2A 3UUEA 3ZV3A 3PP8A 3VQTA 1OB5A 2ON6A 4IMPA 3RASA 3PUHA 3CB2A 1DBRA 1FFSA 3IVGA 1VIAA 2HMUA 3GJYA 3E9DA 3H19A 3KCNA 4QBHA 3QM1A 3WJ2A 2Q07A 4B7UA 4BLVA 2DFPA 4BO2A 4CM8B 3GOHA 4K9OA 4DQ0A 3F6CA 3S6JA 4L57A 2ATIA 3Q0TA 3FNEA 1DVRA 5K8VA 2GHIA 5ED4A 1X14A 2X0NA 4FGZA 4HSGA 4IZ6A 4NBUA 4OYLA 6PFKA 4TL9A 2X8WA 5D86A 4BKMA 3DMDA 3HYSA 4EYQA 4NULA 4K40A 5KYXA 4WCDA 5BMVB 2OP1A 3OJFA 2HTEA 3MQ2A 2IHJA 4QLBA 3L7MA 3IBSA 4BFSA 2N1MA 4N5NA 3WYEA 3C43A 3RUPA 3FIJA 5TGDA 5IZCA 2QD3A 5ISMA 4ESVA 2PU5A 4JKYA 1UAAA 2Z5FA 3JYPA 2FMFA 1E1YA 3ZHSA 2CW5A 1II0A 3OBIA 1OILA 1T9AA 5HEKA 4PY2A 3T7IA 5B1EA 3PEYA 1L9KA 2RHDA 4DAEA 3CONA 4XWOA 1QYRA 1ZINA 1A1VA 3CLVA 4MB2A 4LJ5A 1X8KA 3DLHA 2OBBA 2XTAA 1X1BA 3B8HA 4N3BA 1Y3IA 1LNSA 2X8JB 3ZUGA 1Z25A 3J80A 1T0UA 1UKVY 4QYIB 3ZGXA 5FLKA 3OJCA 2VXYA 5A5VA 3S99A 4PN7A 2OM2A 4S0XA 1NOJA 3JQCA 1NKTA 3PIIA 4U2CA 3TWOA 4Y30A 1U8XX 2Z5GA 4XCXA 2L82A 1A69A 1J97A 1ZL2A 1MW9X 4I5DA 4OXRA 2HQRA 4KQHA 3KJGA 5HM8A 5GONA 3RKRA 5HXAA 3PITA 2FEXA 5DCLA 4MS4A 5LP6C 2HBRA 5IVIA 4EYEA 2C1ZA 4I5GA 2UVPA 4KWEA 3MSXA 4BP3A 1DUSA 2D74A 2F8TA 1YZTA 4DC1A 1CC1S 1NUTA 2QW1A 2ZKIA 1E1LA 3RHSA 3UMCA 5EJ6A 3WAKA 5KOHB 2NACA 4FX2A 1IY9A 2EL7A 5JRDS 1T5SA 1UWVA 4E7OA 4CM7A 1GRNA 2DY0A 3M83A 1I2BA 1AQJA 2P5SA 3IUYA 3LDUA 1VE1A 4A4DA 3F71A 5K0CA 3D4BA 1RI4A 1U3DA 2QUHA 2WJPA 1OZFA 3H42B 1GRQA 4JD5A 4G5RA 1ZJ6A 2NZVG 3VV3A 1MORA 5ECWA 1OXVA 5C5CA 1SZCA 3PZRA 1RKBA 4GT1A 4LZOA 2VDOB 2P77A 3T3OA 1Z4QA 2H0QA 3SE7A 4A0RA 1MEEA 4CKCB 3A1NA 3NTOA 1W0JA 3WADA 4TLEA 1SBHA 3M1YA 1C80A 4QEZA 1FMJA 3W8FA 2YVKA 1KK0A 1WW8A 4RBNA 4KHPB 4DCUA 5HOEA 2ZATA 3VHLB 2FUNB 4E51A 5I7RA 3H0CA 1H5NA 2DPYA 4M1SA 3M3DA 1Z88A 2HMAA 2WUGA 1NVUQ 1Z83A 4DLXA 4E2XA 3BWMA 1W35A 2K7ZA 5JY1A 3N8HA 5T4EA 3C7DB 1O96A 3ZTWA 2CSXA 1Z37A 2CJYA 5ALRA 1Z4IA 1BXZA 4TKZA 4BV8A 1BGVA 2GTHA 2XMRA 3DE0X 5JNUA 3AVTA 3KQWA 3WQBA 3DBVO 3BF7A 1NX6A 1Z38A 1GSHA 2B35A 1HTTA 3VPDA 4B0PA 4ZIRA 1TKCA 1C5KA 3F74A 3NEPX 1S6YA 3V7NA 3U0VA 4A16A 2CVQA 3EF0A 5E8RA 4QUJA 3UK1A 1APBA 3KLOA 3GW8A 4HNQA 2DY1A 3ZK9A 1QDUA 4I4TB 3D2BA 1CY6A 1VDZA 5BSTA 3VC7A 4D6PA 1XPRA 1RWWA 2EAUA 5AKEA 2IYWA 3U1VA 4RZIA 1OXTA 3PR1A 2A9VA 2EG5A 1YZHA 1SAYA 2NNLD 4DCTA 1B1CA 5JAMA 1K9VF 2QVYX 4NYMR 4Q5IA 3HXPA 4QOJA 4ZOCA 2GRAA 1F0YA 3Q8XB 4GPBA 3GJTA 1RW4A 3RT9A 1T8SA 1XZIA 1T2EA 4MA4A 1Y1QA 4DQLA 5HFJA 4ZK6A 1SQGA 3VC2A 3QOXA 1PL8A 4MPJA 221PA 4EUNA 1E59A 4J0EA 3FZQA 5IDXA 2WQZA 4TTVA 1FYWA 4EQ6B 4G1MB 5BW8A 3HB0A 3O1HB 4AIIA 1BMDA 1E6KA 4OIFA 1QV7A 3B9BA 1UBEA 3N0TA 3NQ41 4WEOA 5C7YA 1SKUA 4U8GA 4DBLE 1DSSG 2WHPB 4CM9D 2GUGA 2AN3A 3PL5A 4KKVA 1DO2A 2AOXA 2C2XA 2IWHA 4U2EA 3LRPA 1MVOA 4JL5A 4RENA 1JU3A 2A5LA 4ZVNA 2FPGB 1GA4A 3P26A 4FPXA 1PZNA 2ZREA 3DD5A 4OKIA 3EOAI 4D3XA 1I3KA 1OXKB 2FFRA 3T1NA 2PMDA 1YMUA 4DLZA 2OSVA 4U02A 2NU8A 1BMFA 2YC4C 2ET6A 4UU7A 5I5GA 4I9GA 4O4HF 3RJTA 2V7QA 3DE7X 1QYDA 5AUQA 3TQCA 5D5QA 5DGHA 3L41A 2HRBA 5AI9A 4EDFA 1LSJA 3FR7A 3V7UA 1P7PA 1QPBA 3FCOA 1CR0A 2VJPA 1E6MA 3ICOA 2VDRB 2IU0A 3HUUA 2PX8A 3DT9A 2Q6KA 1YRLA 2H1LA 3D0RA 3BIXA 3KJIA 1JR3A 1N3YA 1GLVA 3AYXB 2AZXA 1XDBA 3AUUA 2EW2A 4S1TA 4AAYA 1Y1RA 4CUKA 3U4IA 1P0FA 4PYIA 4EBBA 4BAZA 2QRHA 1T9GS 3ILYA 3CWCA 1SXIA 2WDPA 4LX0A 3KKZA 3KUCA 3K9LA 3C7AA 2A3NA 4DTIA 2VQEB 2BSQA 1JDBB 2Z58A 4QQFA 1D09A 5A3JA 1Q1ZA 1ULTA 4PSDA 2QROA 3TD9A 1FP4A 2IF0A 1X9IA 3C3PA 4DZTA 4GI3A 1AXEA 5CDGA 1SOUA 2PSEA 2ZUUA 3CUTA 3AU8A 3RH0A 1UPTA 3ZHOA 4PTLA 2XA9A 1NVGA 3SQLA 1UDCA 3H8JA 1A9QA 3KB8A 3KPUA 3EAQA 4Q7JB 4RKFA 1SCJA 2OC9A 2GEBA 3AL2A 2VK2A 1EA7A 1FYFA 4RMNA 2GEKA 1WSBA 3ENKA 2ENWA 4JKIA 5E1OA 4QM6A 3SI7A 1J1IA 1I9GA 1ZGBA 3GLGA 1DRUA 3GZ4A 4RORA 4Y7DA 2YMLA 1OVMA 4DRYA 1VECA 2BLLA 2NV6A 1KJJA 1RHUA 5JXWA 4DBVO 5JCOC 2IH4A 1QH0A 2ZJYA 2YYYA 4N9QA 3T3IA 4WBNA 3MPUA 3S4YA 4DCSA 1TCBA 2X6QA 5BXQC 5DGDA 4ETMA 2VQFB 4MYUA 2YWXA 2H8KA 4PZ9A 3NTXA 2W8BA 4QYXA 2WU4A 3SHTA 1B74A 1R9JA 3P9PA 4KXQA 1MZVA 5AKHA 3WLKX 5F52A 2OC4A 2BHRA 4M38A 2BISA 3HRIA 1CS0B 3MGAA 4H6VA 4I1RA 4S0ZA 2W48A 4W6QA 4F21A 3U19A 1MB0A 4XJTA 3JZDA 2REXB 3HWRA 2JGJA 2O52A 1ZBDA 4WJKB 2JFUA 3SJ7A 2OT3B 5KSPA 3WJAA 3Q2OA 3G6KA 2H0RA 4EMTA 3MRXA 2HWXA 3GJ5A 2X7HA 2Q62A 4DSAA 4KKXB 1IN1A 1HGXA 4MRMA 4TQ9A 4UATA 2IXGA 3TXXA 1JFSA 2ZR9A 5KPDA 1GILA 1UJ2A 4PTZA 4HVLA 4RPLA 1GTRA 4DR2B 4I1PA 1C1YA 2NTVA 1JKJB 3NBFA 4MZXA 3ZDYB 5I7SA 1Y6FA 2XYVA 3HHEA 4J7UA 4ZZIA 3CJTA 2OG1A 1PWHA 1EM8B 2IOFK 2OECA 3GL9A 4FEYA 5CVCA 3BTVA 4EHAA 5CDYA 4CQMB 4PCUA 4B87A 3OCVA 3MLBA 2ZRCA 1QTRA 2QTHA 3FDFA 4ENQA 3BSFA 5JYBA 3MINA 4OLFA 5E8JA 2HQ1A 1B4DA 3DEKA 1C3VA 2WQ6A 3CLUD 1U2PA 3TZ6A 3PUJA 4NEGA 3GGGA 2HEGA 2C2WA 3WBBA 2MMCA 1JLRA 1YQEA 4HH1A 4JGIA 2NYVA 4JR0A 5LQUA 2BR3A 5KU7A 1SBIA 3H1GA 4DUPA 2Q7DA 1W85A 2PH1A 1WD7A 4WZAA 4EEXA 5T5QA 2XX3A 3P9RA 4MUGA 2JAQA 4WZ6A 2FJUA 4ZO8A 3V9PA 2CBZA 4KI0A 1B8OA 3BCSA 4LYAA 3FPLA 3O4HA 1AURA 1X7XB 2VSQA 4KYIB 2HSJA 4LXIA 1G8PA 1WMEA 1BCSB 2GPAA 3IOBA 3O8QB 2DBYA 5CFNA 2I2AA 4KPFC 1GPJA 3RRXA 2PZEA 3ILSA 1PT6A 3QHAA 1TW2A 1O3YA 1LDYA 1EK1A 4MI9A 1SZJG 3V48A 4C89A 1VOTA 2PGJA 5L40A 1QR2A 2XPCA 2VZEA 1ZXBA 1Q0SA 3ESZA 3PJDA 4KQWA 1SQFA 4TWIA 1OH7A 2ONCA 4PSUA 3UBMA 4OMDA 4B5KA 5JARA 3USES 2B82A 2Q5FA 4ZHSA 1P0IA 1Y8QA 1VMAA 2IEYA 3HEAA 3WLQA 1WAMA 4CEIA 3E58A 4JEIA 1SEPA 5FOXA 1USIA 5AXAA 4I50B 1SD5A 4RMIA 2C42A 5EN4A 1U9IA 3GVHA 1WRBA 3WB9A 5KX5A 1XU9A 1E6WA 4NZOA 1JXQA 4KTTE 3CF0A 3IT3A 2PRJA 1F5NA 2AKYA 4A9AA 2HW8A 5F9MA 2O5EA 3ABSB 3DZCA 1Z0UA 4ND8A 1MIOA 2VPXA 3IV9A 4C5CA 1RYHA 2QU7A 4O5AA 1GQSA 1E3TA 1N0IA 2BGNA 2IYQA 3ULKA 1N8TA 1RYEA 1GN8A 5LYYA 5HZMA 1RXEA 1E62A 3A4NA 4MR8A 4XGNA 3SKXA 4BECA 4OMUA 3MT9A 4IDGA 3CT6A 4KQ9A 3IAXA 5DNVA 4K05A 4G6ZA 4F9TA 4XGQA 4Z4FA 5KI6A 2QQEA 5A5GA 2ZR7A 1ISFA 3E8MA 1Q84A 1RLJA 4F2DA 1CQZA 2ZSIA 3OOHA 1JH8A 1CR2A 3NPMA 2E1RA 3RS8A 1RPTA 4CG0A 4WOCA 5CM8B 4E5NA 1RAFA 1XRRA 3AKDA 4PQRA 1G38A 1Y3DE 1XTBA 2DLNA 2G9ZA 5IAOA 3HKEA 2DOKA 4JU8A 5AXCA 5CG2A 2IBMA 1R37A 5HF8A 2V59A 4TS1A 3BMQB 3G8DA 3QVOA 4IX9A 3GJZA 3WOVA 4WTOA 3WLMA 4P92A 4OLBA 3EVCA 2AR9A 1J9ZA 4EYKA 1JLKA 1E98A 4GVLA 2ZSBA 2ZROA 1F7VA 2JH8A 1U3UA 1EP9A 2ZB8A 4WVFA 3WGVA 3G1TA 2RJ3A 5F7ZA 3JAWA 1D4ZA 5EJ8A 5EXDA 5HKBA 5CT8A 1H2RS 4RK0A 3UAOA 3QLTA 4MVJE 1FL9A 2PH5A 2DT5A 4IDCA 3JSAA 4GOJA 2E85A 2WAXA 3O38A 2IXDA 1ZJ5A 5NLLA 4MW7A 1NUUA 2IPLA 1NU8A 3UB2A 3K9GA 2EJTA 4FW9A 1ISGA 1WHTB 2GK3A 3KLBA 1RYDA 2G3YA 3DFFA 1ST3A 2O07A 3LYAA 4M6WA 4P5PA 4PZAA 4I6GA 4UUMA 1E5DA 3H5VA 4WK6A 4DWJA 1EP1B 1A9SA 4RYDA 2GBLC 2QRGA 4L2IB 2HU5A 4OM7A 3QVUA 4ZDJA 3TZHA 2VDNB 3C3YA 4KVGA 3U0BA 2P41A 2WFMA 1E5TA 1Z75A 2DR0A 1KXZA 1VIYA 2KBEA 1RWPA 3NX4A 3PC3A 3ZNQA 4TWJA 5L6LB 1UWLA 2HIGA 1E0KA 1QG6A 3B3GA 3L40A 5BVHA 1MT3A 4TS4A 2WHEA 5CBPA 3FNIA 4KX5A 1RLMA 1MX9A 1HEUA 3M9XA 5JY6A 1KNXA 1JAYA 2ECPA 3RIMA 1WMAA 2YIVX 2ZVPX 1R16A 3DO5A 4KRXA 1FU8A 3MYYA 1BJTA 1R9NA 1L5VA 1ODIA 1G291 1CUSA 2ZRQA 1IXRC 1U6KA 1UF9A 4ZVVA 4LVOA 1XZCA 1AF4A 4JYPA 1RBMA 3HBJA 4FGKA 5EXPA 1G3UA 2EWMA 3O94A 4UD6A 4LX8A 1IQ0A 4L8WB 1S7CA 4ISCA 3H4TA 4I4CA 5KNCA 4B4KA 4GKBA 1WV0A 4RD3A 1G41A 3NOVA 3RHTA 3CPSA 1J70A 4MDYA 1AKEA 3OJEA 5AKXA 2EFDB 2ZYSA 4BRSA 1NLMA 2KE5A 4HB2A 1ZW1A 3QE9Y 3CF2A 4ZYWA 4CM5A 1JSRA 3RVBA 1OH8A 5IAJA 4H3HB 4RJTA 1L7XA 1VLHA 4DLUA 2XUFA 1H5QA 4GHWA 3TS1A 4HV4A 5ECDA 1ORVA 3ZHBA 4R2IA 1ZGAA 4KQFA 1NBME 4NZYA 5B3JA 2BOVA 2CUTA 3VR6D 3DMPA 1UKYA 1V8ZA 5HNKA 2CJWB 3L1KA 3EQZA 2VSOA 1TT5A 4X60A 3EN0A 4NU8X 2PGLA 2HK9A 1X1TA 3AXSA 2VTKA 3QW2A 4NCIA 4TWRA 3ZI4A 4TS3A 4X8MA 1L3IA 4ZZ2A 1EFPB 4K6KA 3D8BA 3DOHA 3VO1A 1IN4A 2FP4A 1CV2A 5IMBA 4D9BA 4D5GA 2F3SA 4A0FA 5KDDA 2ZJ1A 2GTIA 2ZR0A 1WXGA 1EP2B 3UF0A 4GECA 5FI1B 4A36A 3ZGNA 5FULA 4CI0B 1WF3A 1BXKA 3ESYA 5JT1A 4KFTA 2V74B 2EGHA 2M6SA 3ETEA 3JU3A 4WLOA 5DOZA 5G0SA 3T4PA 1W7AA 5B1YA 5JQWA 1DQPA 1UM8A 3T7AA 4EY5A 2C97A 2HFJA 1KOLA 5EE5B 2Z9BA 2CBXA 2Q4EA 5KNDD 1UFOA 3ZXIA 4KIJA 2FWNA 1ZR2A 2O8FA 1LLDA 1BJRE 3NHYA 5GADl 4XJVA 3KHUA 2QPLA 1A7KA 5IJWA 1ZM7A 1IONA 2F3TA 3AVOA 4FHEA 4Q6BA 5EMMA 2PO5A 3QIVA 4DUGD 1KK2A 1O6ZA 1RWBA 1SVMA 1X2EA 2HZ7A 3FNGA 2HKIA 4FXPA 4WAUA 1G3MA 4M46A 3K5HA 3I6QA 4X97A 3ST7A 1QOZA 1C3XA 1TD1A 4AJIA 3NNSA 2K4MA 2NZUG 3ASVA 3T5GA 1JHDA 1SCUA 4Z1MD 4IL5A 4HAZA 3LLSA 1SZPA 5ELXA 3NOXA 3K1AA 3E8XA 5KAPA 4XYBA 4TMFA 1FFXB 3FJ1A 1YB4A 3BF8A 1H2BA 5A5DA 3HFSA 3JZAA 5IC6A 1W0KD 1YQWA 1LV7A 1OREA 1KBOA 1OY1A 1P5JA 1EDBA 4QPPA 4CF6A 4DMGA 4CCWA 1N9KA 1R3UA 1XK6A 2ZE5A 3Q3JB 3GP3A 4P36A 2R2GA 4BNTA 1MU0A 2UYQA 3H5NA 1R3DA 2C5LA 4M1QA 4C0WA 5K8IA 3O8RA 1DQYA 1A9TA 3TVDA 4DMCA 1KEEA 3N2LA 4ZU6X 1QJ4A 3L7BA 1UOQA 5JJIA 3TZCA 5DVZA 3AERB 2P4EA 2QN6A 1SR8A 1W6UA 3NV7A 1FTQA 1U7OA 2OV6A 3BORA 3EY4A 4NSNA 3C8MA 4FP9A 2HU8A 4BX8A 4UBMA 3ZOKA 2CLDX 1EUCA 2FNAA 3X1JA 4LNUA 4I8DA 2C2HA 3HCPA 4RPIA 4Q4CA 3DO8A 3L8YA 3TI7A 1JDVA 1LNQA 3G2OA 4NWIA 3BCRA 4PSVA 2O3SA 1LC0A 4LOJA 1OGYA 5ERGB 3SVLA 1X1RA 3OPYA 1OZ0A 2NVUA 3BMCB 1KI8A 2G36A 4YP1A 4P31A 1C50A 3MS2A 4MIKA 1L4MA 2AB0A 3D4PA 3NC4A 1Q57A 3GA7A 3DZIA 4IIGA 2OSBA 4DRXA 3D8RA 1T5IA 5CFRA 4P7KA 4NV0A 2B4KA 3UWDA 2XBLA 1U9JA 3B1WA 3IJ5A 4QBGB 4OJQA 4EKDA 2PSJA 5IDYA 3W5DA 3KTDA 1SUAA 3C0KA 3S2EA 1YT5A 4JUCA 4LHSA 4NAVA 4EK9A 2BBSA 3EYWA 1WXQA 2NTEA 5J2TF 1ZUWA 3A3YA 3EIEA 3I3SR 4RHUA 5JMWA 1JR3E 1GSAA 1LJ8A 1PT9A 2FWRA 3H2GA 3U3MA 1H8HD 4JENA 1JFFB 1DC8A 1C0LA 3ZI7A 3EXG1 1GZ5A 4RZ2A 4FJ0A 4HVTA 4KB5A 4KGXA 3AFHA 5H3CA 3THXA 2PT6A 1VZ2A 2WTBA 3J81A 3F73A 3NM6B 3SC3A 3TZQA 2HO4A 3C5HA 4BNXA 3AL3A 3UJ3X 4UPVA 1ID1A 4O3FA 4QECA 2QKYA 3UHJA 4A73A 3FUWA 4RVNA 4GBJA 5ITWA 2ANCA 3ES9A 3ZWAA 2VRNA 4AP9A 4WOKA 1L4NA 1CUIA 2P67A 1LH0A 1P74A 1SH7A 3WV4A 5LOVA 1LB1B 4KR3A 1LW6E 1V8PA 3ZXSA 2A30A 4JHLA 3PJEA 3K0CC 2VTVA 3K20A 3TM4A 5CT9A 5TMPA 4L8VA 4HK4A 3ROZA 1POXA 4BYMA 2XSZA 2B0CA 3E2IA 2FWMX 1L5FA 3NEJA 3AG6A 4FCVA 2XVYA 4LFBB 3BG5A 4FOTA 4QEDA 5AM5A 1Q19A 4NYJQ 2J07A 4RVDA 1H2EA 4LRTB 1W4ZA 4US1R 1UJCA 2V98A 1TVMA 2R1ZA 1IEVA 4OX9Y 1TFUA 1B6GA 1N1MA 2MOKA 4HPJB 3X1YA 4OXXA 2JI4A 4LCJA 2BEJA 4FZVA 5FOQA 1UQTA 1PTJA 2J46A 4IKOA 1FFAA 3ROEA 3L04A 1SKMA 1FMFA 1P1CA 5G4KB 3FSRA 1V11B 1BDBA 3DOCA 3SR4A 2N46A 3WLJA 3TZLA 5U4QA 2Q4DA 5LP6A 1I14A 1IUPA 4CMKA 1Q0UA 1YR6A 1DXYA 1GARA 2B37A 2CXSA 2EKPA 1XLUA 2TYSB 3DVSX 3EIXA 1IPEA 3F78A 1FVHA 1CUZA 3OTGA 4FLMA 4KTVE 2IEDA 5K0SA 2Z3WA 2R7LA 3A1DA 1COWA 3NCHA 3C45A 2VXBA 1NXPA 3K1TA 1HQCA 4P4TA 2FQYA 3GRKA 2JH9A 1FSFA 2D5LA 1TQ4A 4IRMA 3EA5A 2QDXA 2WIDA 3MGBA 2GHRA 1RE0A 1VB5A 2GYVA 3JQQA 3PYMA 5CFMA 3FYUC 2GXQA 3WL6A 2AMYA 2YJ3A 2P2NA 4ARUA 5IUKC 2XWPA 5LU8A 3OCYA 5D87A 3M82A 1TM1E 4G0WA 2ZZNA 4KQ6A 2CUZA 3WGUA 4C4OA 4KACA 5AUOB 4E30A 2A1TS 1WQ3A 3WXBA 1DT3A 1UJNA 3R5SA 4KUEA 5HKLA 5A05A 5AVYA 2VF4X 3GEGA 2WQ7A 4LOAA 1R6UA 3CWZA 1THTA 1U81A 1U9ZA 3DT6A 4L4UA 2GPTA 4P86A 5BOSA 4BZXA 1G8SA 3IPLA 1VBFA 2GPSA 3KKKA 4WKOA 4MV5A 1GNSA 3MRVA 4L27A 5FA6A 2MYNA 4FDVA 2QTTA 3RWOA 4WZAE 4RPKA 4ACAA 4YFVA 1NBOA 1YQ9A 1J8MF 3K5WA 3W05A 5IX8A 1E0AA 1TZJA 3WWZA 4DPMA 2CEKA 2PVCA 5JPIA 5JIBA 2HMTA 4X6XA 3G23A 1XTUA 3OFVA 2WUDA 4CIWA 3CEMA 3HY6A 1RAHA 3OICA 3O8NA 3TZBA 4MJLA 5EE9A 1XP8A 5IPFA 1M2NA 2HK6A 3QUSA 1QPZA 2EZ9A 1JEAA 4FFSA 4QICA 5TQVA 4UNRA 4ZN6A 2I91A 3FLAA 1G20A 4QPJC 3ILXA 4NYIR 4GL4A 4MR7A 3ER8A 4DJFC 1L4EA 5CJPA 4IUCS 1OCEA 1SEVA 4R83A 3PLRA 4D9MA 4D0LB 4MRVA 2JD1A 2KMLA 1IIBA 3C4JA 2UYCA 3E61A 3AL0C 5H4GA 1JSLA 2OFXA 4UHDA 4FSDA 2F3PA 2MYUA 5I3CA 4GM0A 1NI3A 2X2OA 1GCAA 3CMCO 4Y0VA 2PAAA 3QPCA 3G9XA 3KB6A 5D3KA 4E5DA 3CCFA 3PPVA 2KI5A 2PDAA 5DH9A 4EI8A 4EGAA 3VA7A 4Y1EA 3M6FA 1DG3A 3P2EA 5JSZA 4UTXA 3TQIA 4XB6B 2PA3A 3KSAC 4WK2B 5IUNC 4K28A 4G5OA 5C5DA 3AI2A 4HDSB 1EDDA 3EULA 4Y6PA 2WM9B 2VUIB 1HYGA 2IA5A 3OPQA 3W6ZA 3QHQA 5IKXA 3CRMA 2F3UA 1Y6RA 3K09A 1I5RA 1WXXA 5ALMA 4BLUA 3IV7A 1A9OA 4IVPA 4JGGA 4LE1A 5BV1A 1TQDA 2B7LA 3ZTTA 3G5AA 5KOHA 2C7GA 3ICPA 3R41A 1T1EA 2XLBA 3PA8A 1K8YB 1DIAA 1MGOA 2R60A 4PBSA 1HRKA 1H2ZA 2I66A 3TB6A 3QWFA 3ZR4B 5FLYA 2G1JA 1WZCA 2Q7OE 1NURA 2W93A 3V2UA 3EGDB 4QU5A 2Q1YA 2IP2A 1JQ5A 1L5HA 4ZZ3A 3HCFA 2FAXA 2ZIXB 2IOHA 4G5SA 5MFPA 4BNLA 3FA2A 1M1UA 1V4VA 4OGWA 5T4HA 5C8ZA 5D5HA 4A3SA 3DCIA 2Q41A 2ZBPA 4LXHA 4CKCA 5FNVA 3ZN2A 1QS0B 1WW3A 2GK7A 4CR7A 4EPVA 3P1JA 5CB4A 3EOBI 2DBRA 4K6HA 2VLBA 1D1QA 2HDNB 2YFHA 4HGOA 1FSGA 3UHFA 4D8VA 2X9VA 1RAIA 4N01A 4BOYA 4EB6A 1B6RA 2Q49A 3DJFA 2NO4A 4KWIA 4MKGA 3WIOA 4ZGGA 2HSGA 3HABA 3LU1A 4NOKA 1KZHA 2C2OA 3WYGA 1K89A 2G72A 2UV8A 1PK7A 5CXSA 3OMLA 1L7NA 3GYGA 3N0VA 1GSIA 4FGLA 4II2A 1VCHA 4HDCA 3CM0A 4HQKA 2YY7A 1N1GA 3BPSA 5AT1A 4JAVC 5FYDA 3LW7A 4XWYA 1O0BA 4EGJA 2B3TA 3PJGA 3OZUA 1GA1A 5E2BA 5K9ZA 3INNA 3H8WA 5AW3A 1VPLA 3SC6A 1JSCA 3QIAA 2VYCA 2B2CA 2J30A 1GPH1 1OJ7A 2A67A 1ZMTA 2XY4A 1RHKA 3NU1A 4XLTA 1KEVA 5CG1A 1XRMA 3TLJA 3OZDA 3JSXA 2DRIA 1NVVR 2QM7A 2ZRLA 1KC1A 1JYEA 4M1MA 1GD1O 4K1LA 4I4TA 2VPZA 2YUTA 4IZOA 3L8ZA 4N0DA 3HBNA 3ZJTA 5AJHA 1Q22A 1JV2B 1LPAB 3AZPA 4DR6B 1A8PA 1KDTA 2VDPB 4OV6B 5IAKA 4E03A 4EBFA 4YACA 3IO5A 1TK3A 3CRNA 1CQJB 3QYJA 4KO4S 4EZIA 5DK6A 4EKGA 1QYIA 1W48A 1SXPA 3WHIA 3RRFA 1D2RA 2GEUA 1P75A 3NIFB 1KPHA 2RHBA 2ZJ4A 5KJ1A 3S70A 2FCRA 2W4MA 1W96A 4BEVA 1HT2E 4K03A 5ITZB 1VI2A 2G6BA 1WCIB 4FI3F 4F38A 4X63A 1P9RA 1IH8A 1P5HA 2PM8A 2R97A 3C7KA 3P45A 3SDZA 4BX9A 4EQ6A 2E4YA 1WB4A 3A14A 1D1PA 1FVXA 2B36A 1DIGA 1K8ZB 2WHPA 1TYBE 2Q5HA 4DV1B 3KR2A 1J8YF 1MO3A 4D74A 4TWAA 1OBCA 1R64A 1JU9A 3KKNA 1H0SA 2Q21A 4GZ6A 3DAYA 4AN4A 4BDTA 1P44A 3FH0A 4H7IA 4IIBA 4LZLA 2FWAA 3VPBA 2FPGA 1KYQA 1E0SA 5BSGA 1BXGB 1QORA 1MQ9A 3OE4A 5BMOA 4PYJA 5C1OA 5JZMA 5U9CA 1XDDA 3ZH9B 4JJIA 3WNCA 3A6HA 4WK4B 4FSXA 2A35A 4ITVA 5B4UA 4RGQA 2GM3A 5DSZA 2B4TO 1YS9A 3FTQA 4UE2A 1ADYA 2IZ6A 3I9LA 4ZVRA 4DMLA 2LZ0A 2WHYA 4AWXA 4LWPA 3R2JA 4L8YA 3K0HA 2OXCA 4NU5A 1ZD2P 3TTWA 4D99A 1E18A 2IHKA 4Y1RB 3FBTA 4EKEA 4E5VA 4JCOA 4RDHA 1W1WA 5KTOA 3PIDA 2NZYA 2QDKA 3VSAA 3AY7A 1QIGA 4AY5A 3FPFA 2CFSA 4RCZA 3CW2A 1ADCA 5K0GA 1FUIA 1YZGA 3WVNA 1N3IA 4JYAB 1R6AA 4MHTA 1HKHA 2JIDA 1H0KA 1NN1A 3M4XA 3NOQA 1JB1A 5EKDA 5IN5A 4X1IB 1QBKC 5MN6A 5AQ1A 3DTVB 3CNQS 2HX1A 4RA9B 1N32B 2AOUA 2N75A 4OYHA 3OEWA 2YMMA 6LDHA 4ZOBA 1M54A 2CHGA 1SBTA 5DSXA 2ZWMA 3DMFA 3GBSA 1U0TA 4N6OA 1QHIA 3S1LA 2P3SA 4MEAA 1VCMA 4RDIA 4JY7A 1V35A 2ZB3A 1YA8A 1OUMA 2YV2A 1U4NA 4OHWA 4Z9AA 5C8DA 5C18A 5A9SB 3K2BA 3W3ZB 1UBMS 5JWRA 3ZD7A 2CJFA 2WD7A 5T41A 2C2BA 3VOSA 3WAGA 3FPHA 2F1OA 1ZONA 1Y7TA 3DLTA 3LYHA 4MMYB 4BLSA 4HWKA 3LIPA 1BX3A 1BO6A 4H31A 4G0YA 2AQIA 4KGZA 4FKMA 5F4BA 1PNRA 1V7PC 2QGFA 3FSJX 4L1KA 4OD0A 1JEJA 1SC3A 2XE6A 4OI4A 2CJXA 1ZVMA 2XGOA 2Q3FA 2FEOA 3JWPA 4DCGA 4BGDA 4BO6A 3JALB 3R3ZA 1Z4KA 1M3SA 4HSEA 4HWRA 1T29A 1PBNA 5H3LA 5FWAA 1E1CB 1WPGA 1JJ7A 4BNWA 5KDOA 4X66B 4I55A 1OZGA 1QFMA 2NWQA 3GLIB 1RRPA 3OM9A 4DLPA 4LZPA 3GFBA 3CMMA 1ZD1A 1BRTA 2SKDA 4LOHA 4QRIA 1RXSA 3SYTA 2W98A 2GVDC 3IP8A 3Q3CA 4FGSA 3PTLA 1Y5LA 4PAWA 1FPQA 3UTCA 5E7IA 1SPXA 2VPTA 1S8OA 2AN4A 3HMQA 3IAHA 4L3WA 1NVKA 3LUHA 5FI3A 1DBVO 3U7QB 2B20A 1J2YA 5CJJA 2H00A 1BFUA 2I78A 2VDQB 3T99A 1P4GA 4AO7A 1DKMA 1VJRA 1EFAA 1K0UA 2H4JA 3VI3B 2VZ9A 1MQSA 3BN3A 5CD9A 1J1ZA 4DSNA 3NJ8A 2B3DA 4QWMA 2I33A 3LUFA 2C61A 2HMSA 1Z8FA 4HAWA 3AV3A 5LKRA 3WFZA 3FUUA 4BNUA 3PWZA 4MVYA 1N0VC 1G5TA 1PR2A 1S3FA 2C96A 3NEAA 4OFZA 1PJSA 2MDTA 4HZUB 3DE3X 4W5TA 2GCNA 3KSDO 3IP1A 4UREA 2PUGA 3DM9B 3FMOB 1R0ZA 2YYAA 1KZ7B 3G7SA 4MDFA 3GT3A 2GZ1A 3NH9A 4XEHA 4EO7A 4HDRA 4BVEA 3G7UA 4G89A 4GLFA 5EZYB 5LYJF 3LQRA 4U7GA 5BR4A 2EBHX 3KQHA 5IYZF 4AN0A 1E6LA 3E5NA 2LPMA 2WYWA 4AJLA 2CV1A 1BD3A 2JK1A 3BB3A 4QELA 1YRQA 3QU4A 2EX4A 2XQIA 3JQ7B 4O2RA 3UW3A 2BHTA 2C59A 2AN1A 2YJGA 3DS8A 3HB5X 3E6AA 2VAXA 4IMRA 5GJVC 1I5EA 3FPGA 5AVRA 2D06A 3P9SA 2BFOA 1Z6TA 1BWQA 3VX4A 2CFTA 3PFHA 2WSIA 3S2SA 3HC7A 2ZUSA 1F2VA 1HUQA 1TA4A 5B1SA 1U1FA 1EEXB 1Z35A 3OG9A 4B80A 1JG2A 4ZQEA 4Q05A 4C7BA 4PZLA 4AMZA 4B3IA 1PR1A 3WLPA 2WMYA 4D8UA 5FWXB 3R9KA 1ATIA 1YSCA 4MOWA 4YONB 1YTLA 1IBSA 1VRWA 2XD4A 2GPBA 1IQPA 4YYEA 4M99A 5FUMA 4J4BA 5LLDA 1E5LA 1MBZA 1S96A 3BCUA 1JH9A 2BKLA 2GBLA 2HM7A 3EXEA 4Q3CA 2Q3HA 2ZTUA 3PS9A 1HL7A 2WTXA 2X58A 4HNUA 1RXIA 2P35A 4CLEA 5BNWA 4I1SA 2XVMA 1YGPA 3JZFA 1H8ED 3UK6A 2HJ9A 1JPVA 4Z53A 4EFNA 4PPQA 4B6GA 4J43A 3O3OB 4KI7A 4RGVA 1NF9A 2NSHA 4LQCA 2C5FA 4OQQA 3COZA 5IC5A 1KE2A 3Q6NA 2I65A 2XMZA 3VXKA 2AF4C 3FRHA 1FX0A 3L77A 2B9VA 1AMOA 2ATXA 4JT4A 2W0SA 5EHNA 4NEQA 4FYPA 1N75A 1NBIA 4BPBA 7REQB 1QNFA 1FSSA 1RS0A 1PFQA 4ZMSA 1G55A 4IRUB 1E0JA 1VE6A 5JALA 4CL8A 4EJ0A 4H7KA 1C4OA 1QHGA 3M3PA 5TQ2B 3ZD9A 2V3WA 1ZJWA 2NMVA 1YTUA 4C6HA 3DWGA 1H6CA 3R4VA 2QP4A 5J5VA 3ZBQA 2HDHA 3LKZA 3GMSA 1R6DA 5LXTB 5JYCA 1I0LA 1J2TA 1RC8A 1GKUB 3UJ8A 2I4TA 2XXBA 2WE7A 2H3HA 3K6JA 5C1BA 2APJA 1V5IA 2WVJA 2WPDA 2DFLA 1HYEA 1OAAA 2QE7D 4PF1A 3RTBA 2F8SA 1G63A 2YS6A 3KXKA 4E46A 4KWTA 2E87A 2PRIA 5L51A 1ZGGA 3OQ6A 5MGNA 1PG2A 4QTTB 3A7EA 5JSYA 4GC5A 3QMWA 5DM2A 4QUEA 3WLOA 2PY6A 2C5GA 1CLUA 2BHLA 5EPOA 1ZKDA 1ZQ1A 2A0YA 2R6DA 5ALZA 3G9UA 1KDZA 3JWIA 4JBYA 1DMSA 3ZU6A 1M5UA 2ZAOA 3RYCB 1SB8A 1M5TA 1F8GA 1GXSA 1NASA 1K2WA 1JVNA 3T52A 3FKSD 3VR3D 1YKSA 3WNZA 3S28A 1H2AS 4N47A 3DNMA 4P2GA 3RROA 3SICE 4B2LA 5JAUA 2ZAGA 3AESB 2IPMA 4QYMA 1H1TA 4LSZA 2VT6A 2JHPA 5U1PA 5CFZA 4Z1OA 3WWOA 3ANYB 4DMFA 2R3SA 2AKEA 2ZW9A 1K8QA 2GFIA 4RPGA 2FPPB 4KH0A 1G20E 2XITA 1TTTA 2G06A 2BDUA 3IQHX 4CR6A 2G4VA 4EVIA 1GQQA 2JJMA 3C6QA 2VQ3A 3ABRB 1E3LA 3H6GA 3MQFA 3BOSA 1XYVA 4O2BB 4J0QA 2ZI5A 3W6OA 1E3WB 3FZEA 3KIPA 1EBFA 3WE7A 3SQNA 1GL7A 5AUPB 1L5GB 1W2HA 1XVAA 4NU6A 4TWZA 5IHXA 5G41A 1FRFS 2ZSKA 2CNDA 5JD4A 2P0YA 3TRFA 2DYKA 3AUAA 4FFLA 4IAOA 5MGBA 2OFOA 1E9CA 3ND7A 4IKPA 1Q1BA 2H4ZA 2GN6A 1C7IA 1H9CA 4JXJA 3UC5A 3RADC 5J43A 1CZLA 3IE1A 4R2XA 2C99A 1CB0A 4UM5A 2HN9A 4RANA 2X23A 1ODTC 3BJIC 1Z7BA 4FN4A 3PGMA 1BQ4A 2AX4A 2QJRA 4MRRA 4XQ0A 4UU0A 1HRDA 1E63A 4OFXA 4ZXPA 1E6EA 5LQCA 3O95A 2G8NA 2RMKA 2IC5A 5DYWA 2J3KA 4YX9A 1XDGA 2E89A 3L49A 3CH4B 3ZJYA 4BFYA 1MHTA 3OCXA 3FVTA 1NV8A 1PR6A 3T1HB 4WOPA 3RVPA 3CWQA 1OAOC 2M98A 4MV3A 1GOTA 1CJVC 1HZZC 1XYYA 2C4WA 4NHEA 1KSFX 5FUWA 1NI5A 1AE1A 2C95A 3EH1A 2CXOA 2HLDA 3CISA 3LCUA 4IGKA 4KG7A 4S35A 2W6MA 3IEVA 5EZQA 3TB4A 3B3AA 3LY9A 1X9HA 4CLRA 4COKA 2VYVA 1EFUA 1ZK4A 4DPKA 3G79A 2F9FA 1IBCA 2FN7A 1E1RD 4GXRA 1VSUA 3OFJA 3ZE7A 4EY4A 1XVVA 3HYLA 4FX5A 4B33A 3IBGA 4CLOB 4WECA 4DLYA 2Q3CA 3U1TA 1D04A 3QPVA 2P2ZA 4TVBA 1VMIA 3DKKA 4JMPA 5D1NA 3NI2A 4H6PA 1JG6A 1ZXXA 2JIOA 3LX6A 1D2MA 3KP1A 2DZDA 4PBTA 5A0FA 2FJ0A 2P2LA 1QTIA 4M22A 3WO0A 2N9UA 2YDYA 3GOQA 4R31A 2R7MA 5FUXA 2Y1KA 3R44A 1JEYB 4JQCA 2GAJA 2ZUCA 4RK6A 2C9BA 1KI9A 1PR4A 1ZEMA 4PPNA 3W7VA 4EG0A 1Y3FE 1E92A 1M1YA 3O31A 3S2ZA 3IXLA 2A9QA 1IHDA 1PJBA 3I5UA 4YN3A 2GHTA 2IL1A 2I1LA 3CFYA 4EHIA 1IN5A 2DXIA 2I3AA 4I9NA 1T4CB 1BFKA 4EB8A 3QUAA 1VHDA 2G4CA 1DDIA 3MJHA 4WKGA 2QIPA 1PUJA 1VXRA 4DT1B 2OHXA 4XE5A 1REQA 1BKSB 1RWNA 1YDGA 3ID6C 3TIGA 1IG3A 1T6ZA 4TUYA 3V33A 3UJAA 1H3FA 1WUKS 4F12A 5A0VA 2EZ8A 1PWYE 3UJ6A 1X7WB 3S2UA 3WRYC 1E2PA 2PCLA 3CLKA 3FW1A 4ZZ1A 2H1OA 1RMTA 3NGLA 4R51A 2IHUA 2YKGA 2I4LA 3EWSA 4QDKA 5ITSA 1XEXB 1D5WA 1V5GA 3IAS1 3JTMA 4LKRA 5AJYA 3TQQA 3ADPA 4IIJB 1L5NA 2F6RA 3EB9A 3REQB 2W71A 5EWJA 5ICMA 1ENZA 1S01A 3JATA 3L8FA 3K9HA 3M6VA 1GL9B 1JFRA 1QH1A 2QJTA 4L7QA 5AOCA 4JJ6A 3AVXA 1G1AA 4KYTA 1EUDB 1UODA 1UBUS 3CBQA 2BFPA 3PVSA 4GX1A 2IOQA 3HCOA 1HOXA 2DULA 2Z9CA 1KS2A 1C2TA 4DSTA 1V37A 4F2WA 4KMRA 1KRXA 3JQAD 4HWOA 2NTJA 2OGSA 4NLLA 1KVRA 1KARA 4OMFG 5A4AA 3CKMA 3G0HA 5ITZA 4Q3OA 1JHPA 1M67A 1E4YA 1ZLXA 3AVPA 4V39A 1YMQA 1ZOSA 3RVOA 4C6TA 4PRZA 1SK9A 5GJCA 2EW1A 2ZWOA 2CVZA 3KWFA 3M49A 1VI5A 1VLJA 4FMPA 5DXJA 3MTAA 1AQNA 2Q3BA 5BYJA 3CTMA 4TL7A 2X0JA 2ANBA 2HHAA 3R77A 3VZBA 2QVBA 5HKKA 5IXSA 2R44A 1P7VA 1DAHA 1YC5A 1NDUA 2FZCA 2V0NA 4PLFA 4URHA 4ZEOA 4FM9A 3TTXA 4MKXA 3ICVA 1CY1A 3AEKA 3IUEA 2EQAA 2GETA 2JS7A 1W36B 1P73A 4DIFA 3KJZA 3ETDA 4UC0A 2OCLA 4ZV7A 3EXFA 5JI3E 3FHCB 5ARCA 3ESAA 3MS7A 1F8FA 2A7XA 2ACVA 3PRHA 1Q1QA 2P7IA 3IEPA 4GX0A 4YI3A 3ZZUA 1B7GO 3FYUA 4ZANA 3H8VA 4IXDA 3TD2A 5AI4A 3OU6A 5EWMB 1M10A 3MMXA 1AJEA 4H1HA 2WHRA 4Q4DA 3T4XA 2J3LA 3AIOA 3N9IA 4EPXA 4M53A 4K9KA 4PG7A 5CLIA 2ZSEA 3LNTA 1TDJA 2LRHA 3NHPA 1VM6A 2C9DA 2EGUA 3MB8A 4LJAA 1DEXA 4JXXA 1LK5A 1NPTO 3TPZA 3C3KA 3OZFA 4FHGA 2GN1A 2Y0BA 3GEBA 4ECAA 1TW3A 1BOOA 4R1SA 4TQGA 1NRWA 1P1RA 1FSZA 2ETXA 4L9RA 4DV4B 3VSBA 4O2AB 1N6LA 3HM2A 1L7RA 2YVUA 1AZSC 3L5OA 1LPOA 2YHBA 2QG4A 5FHQA 2NUTA 1KZ6A 4FLFA 2K5UA 3BEDA 3VU8A 5AQEA 5TIIA 2YNMD 1Y3AA 2QN8A 3RUIA 4L5JA 5KSZA 5GJWC 5GONF 4FONA 4P4UA 1GAXA 4JLBA 2WILA 3D5EA 5AM3A 1TA0A 4DNFA 4KXNA 3HGTA 4L08A 2FPIA 4RJJA 4Q9IA 4YWHA 5HRUA 4DV5B 2FUEA 3AR8A 4TTQA 1ZMBA 2HF2A 2X4GA 1KJNA 2AG5A 1TL7C 3IERA 3TSZA 5F3WB 4EFMA 3VNRA 4F06A 1MTOA 4UVIA 3ZNPA 1G2PA 1NZFA 1BCRB 1Z5OA 3AF2A 4RJIA 4Y6OA 5HG0A 5AVOA 4RA6B 2BFBA 5FFFA 3KALA 3V1UA 1T5TA 2WUWE 3BMOA 1PV2A 2VJNA 2OHFA 4FCWA 3OLXA 2WZCA 3GN1A 2JI7A 4LJ7A 1QFSA 4UBJA 2CHUA 5EJMA 5FQOA 5BY2A 5CEFA 1XHLA 4BVFA 1WLYA 4D3FA 1RXCA 3T12A 2XTMA 3E9ZA 1AQIA 2WF6A 3ABQB 1J0EA 3D9QX 3R40A 2DHRA 2JLAA 4MHOA 3PNLA 4UVEA 2JIRA 3NFYA 3RFUA 4B75A 3DE6X 3B1VA 2VR1A 3R7BA 5EUCA 3HV0A 2IITA 3BKXA 5T6BA 1RLUA 3AR9A 1P45A 4NU0A 1FRQA 5JZVA 2WSBA 2O2DA 3QNUA 4KPEC 1PZHA 1GZ3A 4FDTA 4RZSA 2GK6A 4YBZA 5DBFA 2P9HA 1FXWA 3UY4A 1MB9A 3ZDQA 1J33A 3GLRA 1SKBA 2ZAMA 2I0FA 5KWIA 2YJTD 4JJGA 3OKFA 3RFFA 2ZYHA 2JFFA 3DL0A 1NMSA 3IEKA 2D5CA 2P68A 3URKA 4X5OA 1SUPA 5L8VA 3A25A 2RBGA 3GCWA 3SS7X 2ASEA 2D0IA 3VO8A 2Q46A 1ODKA 4IV0A 4PO8A 1AGXA 3GROA 4Q4HA 2AQHA 4JEMA 5FBWB 1TU3A 4EA8A 3I05A 3PT9A 4UTNA 1TF5A 3WX0A 1JLMA 3I01A 3T3NA 2P78A 4A2QA 1PYGA 4O4IB 1Q95A 4CKBB 3EDCA 4UPDA 4WEQA 4F85A 1N8SA 1THMA 1ZCFA 3IILA 3KEFA 3OZRA 3CVVA 3D1LA 5AFSA 2QSZA 5CLJA 3GUYA 5JE8A 3O74A 4BMZA 5KINB 3TIVA 1STOA 2FFHA 3ESBA 3PB3A 4OJMX 2PUVA 4YMUA 2G0NA 1EWTA 3F2VA 5I9NA 3N39C 4NI5A 3IDAA 3V8RA 3WL7A 5DNUA 4PSAA 1V1MA 3OLVA 1L7PA 1H4VB 1HFJA 2CHFA 3IXQA 4WLNA 2XE4A 1XLWA 3VAAA 1A8QA 1R5BA 3U4CA 3GUCA 2JIBA 2GKOA 2GBFA 1Z26A 1MAHA 1QIFA 2R8ZA 2YX1A 3HU3A 4L4ZA 4BNDA 4C7JA 1UIRA 3A6LA 3CUEF 2NLOA 3JYLA 1ITZA 3VHXA 3FG9A 5E6UB 5FL7A 3SNKA 5E7MA 4YT8A 4ZCRA 4AZWA 5B6IA 3UBTA 2EJCA 2FQXA 4RLSA 3V6LA 1BYUA 1COZA 3KT3A 4XRGA 5C8YB 4V2UA 1N2IA 2P9BA 3IOMA 3HO6A 5F78A 5KKNB 1ECCA 5LVAA 4KWHA 4OUDB 4CL2A 3ZU5A 4L9AA 3WS7A 1V7CA 4JQYA 3O5AA 3A9SA 2CWWA 4RGBA 5BN1A 2DKFA 2DWUA 2WJJA 5H83A 4CIAA 1UZNA 2CEAA 4NCXA 3FYCA 3KQSA 4PZDA 4GO1A 4OMCA 3VDXA 1ZA1A 1OI4A 1Q14A 2YRWA 2X9QA 2C82A 3TN7A 2IYNA 4P58A 5A2QA 1M2KA 3KTAA 2BM8A 4PGGA 4F86A 2JGIA 4KWCA 1SD2A 1AUPA 2P9TA 5ENDA 1ZGHA 1UKCA 2O8DA 4JKOA 5JJLA 2CL6X 2EJUA 3T9AA 4CIBA 1LPMA 4OQXA 2YFYA 4G0XA 4HDSA 1KQ3A 3P32A 3WRXC 2DFVA 3ITDA 3RSCA 5BV2P 4PS1A 3BE6A 2ILVA 2ACWA 4UHBA 2GS9A 5DTIA 1JIVA 2I7DA 5K2MA 5BT9A 5IJZA 3EGOA 5KNDA 1WP4A 1YQUA 2IUYA 2X0FA 2NXNA 5AVTA 3I42A 4H16A 3ANLA 3AONB 4FE4A 1FK8A 4MGKR 4DUGA 4X90A 3RYFA 4MICA 4CKXA 3AF3A 3COSA 4G5HA 2C83A 1N2EA 1YBFA 2V03A 4L22A 4IJ5A 5AVZA 3VR6H 3OLYA 4KXFB 3V1YA 3R7WB 2R8PA 5C7LO 5LNK6 1MPXA 2VP6A 3NDJA 5FV7A 3T5PA 4B8WA 3WK9A 2V6FA 4LSWA 4RHXA 2WRZA 2E5FA 1MABB 2W6QA 3HDJA 3CUYA 5FA8A 4JODA 4IWXA 3AFNA 4MYDA 4S1PA 4BQRA 3TNYA 5G53C 2WJ3A 4IQGA 5A2GA 4FR2A 1NFFA 3GB9A 2P2CA 3JY6A 1DELA 5IDVA 1EM6A 3FE2A 4N18A 3UMSA 1Y8AA 1DC4A 1SELA 1Y6JA 4X7MA 4TYWA 1M6WA 2Z2YA 1U28C 2YWFA 1ZD8A 4NMMA 5LQMA 2GGSA 5KNDH 1YOVB 1Z74A 3JRNA 4HH0A 3IHTA 4EAQA 4QAQA 3ZQKA 3RFTA 2PL3A 4D8XA 1CUXA 1F38A 2FUKA 3V1TC 2NXWA 4ZEMA 3G1UA 1IVSA 1O9GA 4WZBA 1LSUA 5H02A 3OUUA 2BFDB 3USCS 4WBNF 2GPJA 3IIJA 1I13A 2AXEA 3KZCA 1OHHA 2ZJ8A 3BZUA 2ISSD 4G5XA 4RCVA 1F14A 3RU7A 3THWA 1LS6A 3E3OA 1M2VB 2C5BA 1V41E 3ASYA 4JJAA 2QB5A 1K86A 4XIJA 4YMWA 3FMFA 4TV9B 3ZDXB 1JFTA 2QXUA 1NWHA 1FRZA 3RWMB 4LF8B 3TKAA 1JNXX 4NTZA 1DEHA 2QL9A 3Q40A 3IX7A 4IGEA 2A1UA 5CJ2A 3FLBA 1PCXA 1OASA 2GYWA 1E9FA 3ONDA 1ODJA 1L8LA 1DBIA 1UBFA 3W8EA 3DOOA 5FWYB 2JVJA 3GUUA 4DR1B 2Q3DA 3DQQA 1WU7A 2EARA 3H6HA 5JMOA 2I1VB 4AJEA 2BGGA 3MJ4A 1USWA 1VFNA 3N2GA 1JJIA 2PZAA 3N74A 2IIVA 4MYHA 4ZC8A 4R1QA 2XJ9A 4PNEA 1UXJA 1ZLYA 5DWDA 1RQLA 1T8RA 3ZUPA 2FW0A 5AM4A 3UKOA 3R5XA 3ZHYA 1HLGA 4Y9SA 5AKKA 4QLOA 2ZQYA 4C14A 2P5UA 2ODAA 1C30B 1Q1NA 4EMBA 1EDEA 1UP6A 2JD0A 3B7PA 4IV8A 4P08A 1KBZA 1SBYA 4NBNA 3KWLA 1Z45A 1ZI6A 3OVMA 3MMNA 3PQ7A 3H9JA 4G9EA 4ABTA 1UH5A 3DLPX 1BVYF 3UW1A 2BN4A 2NUPA 3DXZA 3DMRA 4BB6A 2RH5A 3WGZA 2YW9A 3ZJ5A 4D9IA 2JAOA 1T0JB 3GVXA 4A7PA 1IHPA 4YDQA 5DI3B 3IKLA 2LCQA 4ASUA 2ZU0C 2YHAA 2AQ8A 1TI7A 1JDPA 4LSGA 4CF4A 3ZIUA 1PJZA 1W76A 1B93A 5EEGA 2J5BA 3DFIA 3HJUA 3IT2A 2LBPA 4HL6A 1QVWA 5AD1A 1Z2EA 1M1YE 4REOA 4QA9A 3PF8A 3A1CA 4RSRA 3DL2A 3RHFA 2J8ZA 4MKZA 1R0RE 1ZW6A 5BSWA 5KDLA 3V00A 4IINA 3MWEB 1D07A 1C29B 3P9YA 1FU4A 3LUCA 5EUBA 1ECJA 1MG0A 1UMDA 1WD5A 1JU4A 1XXHA 3K8OE 4GVPA 5T4BA 4QO8A 5ESXA 3WFIA 3OE1A 4RD1A 2P5TB 3Q3VA 1X2BA 4JUFA 4BZPA 3GR6A 3LP8A 4U9UA 5KX5F 1TXGA 5F1OA 2HBQA 2ZP1A 3R6WA 5KYYB 4IKEA 3HFRA 2OGWA 3KUDA 4HGYA 2WAAA 5B58C 4BAGA 2DJIA 2NZWA 4LV5B 1AKMA 2O0LA 4YCDA 3W9UA 3QXSA 3UV6A 2ZYDA 3TR6A 5A4MS 5BWNA 4XUEA 1CFJA 5ADVA 1TEHA 2BRUC 1N7HA 3PEVA 4M60A 4RFLA 1Y81A 4CU2A 1GGHA 1ZICA 1ZKMA 2EF1A 2C0PA 2F8LA 2FR0A 4ISBA 1LRLA 5KPJA 1M74A 2RGGA 5AJVB 1AHNA 1RBQA 2YIDA 3LCVB 4ZOLB 4DADA 2O8CB 2WP0A 1AQUA 1VE5A 1NATA 1CBUA 2PX2A 2EXXA 2UZ3A 2ZIVB 4MB0A 1X7DA 4LS3A 3ZE1B 4U7TB 2F2TA 3M1LA 1FLNA 2LD4A 1G3QA 4OAPA 3U44B 4HDKA 3S44A 4B6EA 5F7XA 2AJTA 1PKXA 4UZFA 5LUAA 1OLXA 3TQOA 1IJFA 1PGPA 2FZLA 1DTWB 4K81B 3NAGA 3GLIA 1Y89A 2OY0A 1NUAA 3KZOA 3KOWA 1H6AA 4MV1A 3KV3O 1MA0A 5KTPA 1IL0A 2WVAA 4IQ8A 4X20B 4AJ2A 3LUJA 4UTZA 5DPMA 1DGQA 3MD0A 4C3UA 4KZPA 3DUFB 4ND6A 3F9CA 1LPSA 4Q15A 4BEJA 2JGDB 3PFBA 2XW6A 3OD1A 4P54A 1L5WA 1U2GC 1VB3A 3SYLA 4GH5A 3GP8A 1TF7A 5CIYA 1GNVA 2IY9A 4B6QA 2VRCA 2WKSA 3NHMA 3LCJA 3KZKA 1K7EB 1XG5A 2YNMC 5FPKA 3PRJA 1G8YA 1QKJA 4B1FA 4EGQA 1QP4A 1GKLA 4I0WB 4CEJB 1LBIA 1U7WA 3DQPA 2RHTA 1IZZA 2PS9A 4OOFA 1QC5B 3KFXA 2EHJA 3PXEA 3PXDA 1RWQA 1CY4A 2JK0A 3NKVA 3DDOA 5E4TA 3W5IA 2HA0A 4EPYA 3U4AA 1XSEA 2VF2A 3UA4A 2HRQA 3AF4A 2LE0A 1QXSA 4KPUA 3PD1A 4QZVA 2OLJA 1GL6A 4AKSA 5I4KA 3AFMA 4K7JA 3F4BA 4ANFA 2VBGA 3M8KA 3RSOA 4F6CA 3L7AA 4PRYA 2D7DA 2GXSA 1NT2A 3SJCA 4HQFA 2AOVA 2DPHA 2J9XB 1HXHA 3QVMA 3LLUA 2DVMA 4PYNA 1QHFA 1MVLA 1RZ3A 3U7RA 2PEYA 4IDEA 3BIWA 5FADA 4D3DA 5DTQA 3T7CA 3VMFA 3ZK7A 1AQ6A 4B6OA 3ZZ0A 3PDCA 3V8MA 2GHQA 3QOYA 3LA8A 4LVUA 2VPYA 4Z5XA 3L43A 5NULA 1Z3CA 1KH3A 4YCNA 2J4CA 2A8YA 4H3KB 3R5HA 4X3OA 2C3YA 3S1AB 1RHQA 1OF1A 4IICA 2B8EA 3DFMA 3O8BA 5TE9A 3SY8A 3N3BC 4ZVKA 3H05A 3ZQUA 2IXFA 2ZRKA 3LCRA 4P4SB 2Z04A 1IUKA 3UWPA 1KI1A 3T7RA 5B7GA 2QTZA 4M8NE 5CT6A 3W2GA 1QYCA 4OHXA 1AA9A 2RGUA 4YJ2A 1H42A 1K7FB 3PJRA 3CHYA 4JN6B 3ND9A 3MIZA 2JGKA 4R3UC 4A1FA 4EB6B 3CNEA 3P0IA 3AM5A 1MX3A 2YJ4A 3CTPA 1J5XA 2Q45A 2O50A 1TIPA 4MVJM 1C1HA 3JVVA 1BC5A 5EAIA 1WMDA 3BE5A 2AOTB 2QUIA 3FZYA 1Y48E 2Z2JA 1GEEA 1MAUA 4GDMA 5DBIA 1RYZA 3QPUA 1TCVA 2I6TA 4CF7A 5L6MB 4HX2A 2ASVA 5D00A 1MC4A 4IR7A 3NHJA 3ZU3A 1GFZA 3DG9A 3NM4A 2QNIA 5I8PA 4W9RA 1YGYA 1FB5A 4BE4A 2BFEB 1EJ2A 5T4FA 3RE1A 1N5DA 2H4YA 3SC2B 4EFLA 3DAGA 3PK0A 4QGBA 1ZU5A 4PAGA 3DOFA 3KR0A 3OOSA 2O2JA 5HVNA 3STTA 2PAFA 1BN7A 1U1DA 1GQRA 2WSYB 3JARB 4JLKA 2WA2A 4LMBA 3GRFA 3GEIA 2QSUA 2R8BA 2BGWA 1NUPA 4ZOEA 3EQ6A 7ABPA 4Y6SA 5HIJA 3Q1LA 3R20A 1U8YA 1V3VA 3NRCA 3HLKA 4ZU1X 5K3BA 5IAEA 5CBKA 3DCJA 3DZFA 5CCDA 4YEDA 1NVEA 4BE7B 1PSZA 1HZZA 3C87A 3GN2A 2WJZB 1PQ4A 3DE1X 5C8XA 5IJ0B 1O94D 1X94A 2BPOA 2VNJA 4PPFA 1PFVA 3KQNA 4C01A 2WYVA 4CG3A 2ZRDA 3SHQA 1ZC4A 4DNPA 3NJ4A 4OB8A 4ID9A 1S8AA 5DYYA 3HSYA 3RNLA 2C7PA 2XNDA 1ZIPA 1K5HA 3GGOA 3OFNA 1E2DA 3VBEA 2IV2X 2AFVA 3QVLA 2OBFA 5JYDA 2IS6A 3BVPA 3HPQA 2KBFA 4FBMA 5PGMA 1DCMA 2E3JA 1GO2A 4UM8B 1CB7A 1HDZA 2ZE8A 4C07A 5CDFA 1R74A 1E77A 4G0NA 1SB9A 1SQ0A 3GFOA 3RO7A 1Q92A 3W3AD 2NVWA 4GG1A 1FDTA 1MX1A 1P9NA 2EQBA 2Z9DA 5DHTA 2AYYA 1OE0A 1TVKA 5A3SA 4DRZA 5FX2A 4NNPA 4OHBA 3WQHA 1C7FA 3RSFA 4YPOA 3LTEA 1A2BA 4MW4A 5GOZA 4DMKA 2H2WA 3RS5A 1JG3A 5EJ5A 1L4HA 1VL5A 3C7TA 1XZKA 2OG2A 2SKEA 4Z9XA 1P17A 1WZNA 2Y92A 4J2TA 4KDFA 4ZTBA 3G68A 3GCDA 3ET5A 1AUVA 4AYTA 2FPPA 4JC0A 2WIFA 3X1MA 4OK3A 2QK4A 3AY3A 3EEQA 4C0BA 3A6JA 3HO1A 1P9LA 5AW1A 5LSAA 1WW2A 4I2NA 4UXHA 2GPNA 4A2CA 1UDBA 2VP0A 2Q1UA 4ZEXA 4DC0A 3G2NA 3T06B 5K3FA 1UDXA 5KU1A 3VOAA 2XGMA 2RHGB 3IDFA 1JTFA 3ENVA 2CLCX 1T3TA 4WV3A 2BMAA 4AKIA 5ARDA 2EFJA 3VR4D 2Z0MA 1GZUA 3ER9A 1UIMA 1K4YA 1LI7A 5BNZA 5EGNA 4DY6A 1FDWA 2QLMA 1W94A 1PLJA 3DAHA 4G4SP 3UFXB 2W6CX 3A70A 1EXVA 4R8SA 1UCFA 3EPLA 2JBHA 3E22A 3N07A 3IH5A 3VNUA 2VNAA 3T38A 1WBDA 3T4EA 1FXUA 5JXJA 4D9HA 3KKOA 4MJ3A 5DTJA 2ZVJA 4PXYA 1E9RA 2OVBA 5B1IA 3UGJA 1U7HA 5IVKA 4AG3A 1DL5A 1TRHA 2X6TA 4M0FA 1RDFA 1LNZA 3UJPA 4EG3A 5C7IO 3OIVA 1R2QA 2YCLA 2P2YA 1AGPA 3PQ6A 4CM4B 4NV3A 1HFEL 5DYNA 5KVQA 3U7IA 1DS6A 3ESXA 1XHFA 3ZIAD 3SIRA 4D0RA 3INGA 3ZHVA 4R1OA 2H2FA 2A78A 3UAZA 5JFTA 1ZUHA 1OV4A 1B8VA 3MCZA 1RRKA 5K05A 1U5BB 1OU0A 3CZMA 4EG7A 3K0AB 1KDVA 2ZCUA 3ITNA 4EELA 3Q2KA 1MPTA 1P1BA 1G1MA 2YZMA 5TY0A 4D9GA 2D62A 4V0QA 3ROXA 5ICGA 2P65A 2YY5A 4MQUA 4RY8A 2WWRA 2QT0A 3DAPA 1AUXA 3HKDB 1DV1A 3KYBA 3OJXA 3PENA 2A2ZA 1I3NA 2XNSA 4IVNA 4YRNA 4L0CA 4AXXA 3GARA 4FUTA 4U2KA 3GXBA 3R7AA 5LOVF 2JLVA 1V0JA 5LIRA 5J1TB 4BQSA 4CETA 4LYFA 1N7JA 5BYBA 3U7HB 1AVTA 2D5BA 3BGDA 4G2NA 5AR1A 3N6VA 1G9XA 2R1TA 1QFXA 3VDMA 3VKGA 1BN6A 5AI8A 4GOKA 3STVA 3AVUA 4B2IA 4Q1BA 3UXHA 4YPVA 3U56A 4LDJA 1FFDA 3JQGB 3NWPA 1RCUA 2A9RA 1MHPA 1BE6A 1TPZA 2ZPTX 1CDZA 1T9DA 1E8MA 2XUZA 2AW5A 2I3DA 3IQXA 3UQZA 4AY6A 3LT1A 2PL1A 2DH5A 2OB2A 2QX6A 3RHZA 3FCAA 4YJFB 4DR5B 2LDBA 5I01A 1ZK3A 1ZVJA 2Y6UA 2NVOA 3PFCA 3H0KA 3BRSA 3KJXA 4RQTA 3WRVA 4DT1A 4JASB 4ENRA 1NP3A 1TT7A 1TYAE 3NVAA 4BX3A 1B00A 1UPUA 4UUOA 2C0QA 4PYKA 1TF2A 3DZJA 2A5DA 2V8OA 4V3CA 4BCBA 5HR5A 3R0JA 4H27A 3CBGA 2OOSA 5DHRA 5LP6F 2CNBA 2WF8A 3SOPA 2NG1A 4G0OA 3EGXA 3M6IA 5EC8A 1AA6A 2J3EA 1OKKD 4GR9A 4BMVA 4FKZA 1GGKA 1OROA 3M3HA 4L07A 1SWVA 1Z82A 3KS9A 5FYQA 5SZIA 3S55A 4CCAA 4YV2A 2V0GA 3LBFA 3MJDA 2HJSA 4BCCA 4CQJA 4HUQA 4EJSC 4A8JC 3GLHB 4LDRA 2OQRA 3IPRA 1YRWA 1C7JA 1P5ZB 3ND8A 3OEED 4LJ6A 4HEHA 3GH3A 5E7QA 2B1QA 2HQSA 4X41A 3WLFA 3ZYCA 3BTSA 1H2WA 4BNMA 5IARA 5EQFA 5TPWA 4O1IA 5KREA 4N1AA 4XB2A 1VP9A 1RJWA 1BQ3A 3HKBA 1RC0A 2NT4A 1XQ6A 3PRKE 2J6HA 4FB4A 2YH2A 4JOCA 4V24A 5DNAA 4EARA 1RXYA 3AIMA 5F9HA 5LA6B 3FMIA 1NU6A 2CLMB 3OC0A 1C8BA 1V8FA 3CT4A 4O1HA 4AI6A 2SECE 1A5AB 3KEGA 3VR5A 2GSDA 5REQB 2O3UA 1WS6A 3E1SA 2EG9A 1HNNA 4V1CI 2ADMA 2WTEA 2DAPA 2WWGA 5TPZD 3ZWWA 4ZV4A 5IMSA 2H7YA 3JWEA 4Z8YA 1PJAA 1T8WA 3IGFA 1I9CA 1EXMA 4J03A 4OXNA 3U26A 3NDIA 4TYNA 2ZBEA 3GCZA 1XAIA 4X1YA 4IIDA 4K46A 1C0IA 1UBHS 2Q0HA 4QHYA 2KB0A 3H83A 4P83A 2I2XB 4IFIA 1GKYA 2Q2WA 3IKVA 2J5RA 1Z8DA 2ZYVX 1QHYA 1KAQA 4OSEA 1TPYA 5A04A 1SCNE 4OI0A 3VBCA 3EGWA 1V71A 1T6XA 1G7CA 4WKBA 4W7IA 1F20A 4XIGS 2DR2A 5AO9A 3AEQB 2EC5A 1SVSA 1R0BA 1G4HA 2G5CA 2OWDA 2VZ0A 3C48A 4G0QA 4B09A 1XXHE 1NMZA 3SSOA 2VDLB 4BNFA 4OHRA 1V2HE 2PV0A 2ZYUX 2O4UX 5HWSA 3L4BC 1T3HA 1MH1A 3WKEA 3EPJA 2IOYA 1EFLA 3UT5A 1R4MB 3BGVA 3N28A 1VLVA 1JGTA 1EXDA 2P4HX 1K6EA 3VR5H 2H17A 2DM6A 3EIFA 2J9FB 3P0JA 3V3KA 3NWEA 4C0SA 5IDQA 3LQKA 3M6UA 4WJLA 1SUBA 4BP9A 2NV0A 1BX0A 1C81A 2H1VA 1T1GA 4XGIA 5J40A 3CB4A 3W5HA 1L5ZA 3DSRA 3V80A 3PU6A 1H3EA 1X1DA 1JNYA 3ZKWA 1U90A 1G16A 2PXXA 3E7FA 3C98A 1A7UA 2LVBA 1GGNA 3IAUA 1JEDA 5K4AA 4MCAA 2GPWA 4BFLA 4DLKA 4P3XA 2B30A 1I4EB 2WWFA 1G3IA 4BO3A 2BJHA 4M8SA 3WMXA 4M83A 1GN9A 3UB4A 1X87A 3DPSA 1HOTA 2VFAA 1J07A 2EOAA 4JLJA 4M0KA 1PNVA 2FPWA 3O75A 5HP4A 3B70A 3TNFA 2J0VA 2XGJA 4B3HA 5DBOA 1PF7E 1HWYA 1D2HA 3ASZA 5CIWA 4D9FA 5ULLA 5LKAA 1J2JA 3WGJA 4RK5A 2WBLC 5FNVF 1BH6A 4U39A 5KTYA 5CB4F 2FR1A 1U04A 1XQXA 5ALTA 1A96A 4TRMA 3TRHA 1Z73A 4R0VA 3WRXA 2AYXA 1P1HA 1MLDA 4R9RA 4OXIA 5F33A 2Q0SA 4MV0A 2V4MA 4C7VA 1I0ZA 2P75A 4IH1A 4M9XA 1XZLA 1XAJA 3WMEA 5CT5A 1FE8A 2OAGA 1NAHA 4QDOA 5JO9A 5M29A 4FYYA 1QCDA 2CL5A 4ZRDA 1GUDA 1NW9B 1QVVA 2EBWA 2FRDC 3OZAA 4FFWA 2XVXA 2AG1A 3AH8A 3B3JA 3KXIA 2CXRA 3LO5A 1LQ2A 1MAAA 2PKEA 4D9CA 5DBGA 5EJ9A 3FGZA 5J23A 4JP1A 2WT8A 4TROA 4TV8B 2Y68A 4ENTA 1XRJA 2Q5OA 3KJHA 3LT0A 4HZIA 4F93B 3WJ7A 1CDDA 1KRWA 2ZYAA 2YV4A 1Q3HA 2QTRA 3L2OB 2WMDA 2B6NA 3PHHA 4M1YA 2PS0A 4R41A 3TLYA 3PDIA 2VDUE 2WU3A 2RB4A 3H16A 5KVSA 1YVUA 2WPNA 5JRZA 4LXXA 2H4XA 3R75A 4BO8A 1V45E 3TPCA 1YFLA 3GX1A 3HGMA 1EVQA 2O1XA 3G89A 4LGCA 4RFVA 4RMGA 2OXRA 3LDFA 3TLGB 5JQGF 1TLLA 4MLPA 1EFVB 2J9GA 2X4LA 4F5DA 1O6BA 5FEUA 2R6AA 2EFYA 3MAAC 3K70D 3OECA 4INAA 1U28A 2CCJA 3I1JA 3C5EA 2IYAA 2M6LA 2BI8A 4K6MA 3TLZA 3ZNNA 4DARA 5CCBA 1IZ0A 2X5KO 2Y0CA 2A33A 3BL6A 1WCWA 2IIPA 5CMLA 4QGGA 3V8EA 4LF4B 2NU9A 4WKPA 3V1NA 5KYWB 3N2KB 821PA 4R9UC 2GCOB 2MTBA 5E6UA 3KV1A 3IDQA 2Q8NA 4PLCA 3M4JA 1Q21A 2VA8A 1BXRB 3IEXA 2OGTA 3MFQA 4JT8A 1IOZA 1C41A 1I01A 1XL0A 5DHPA 1O94C 4F97A 3N8DA 3O8CA 1IHOA 1Z4NA 3AXTA 1LDNA 1R5OA 2QUZA 3K2EA 3QEOA 4NENB 2C7QA 3GGDA 2WD8A 1LGYA 1ONOA 2VK4A 2I6FA 1R6BX 2VPIA 3PJFA 4IH4A 4BJ6A 2Z3ZA 4DXAA 4F3KA 1OBHA 2JGLA 1X74A 1UBJS 3HCEA 4HG2A 4QVKA 2IEZA 5HX7A 4EW3A 4UQLA 1AK1A 3KLNA 3K9QO 4NJMB 3PNOA 4DREA 3TGLA 1CUCA 1JVSA 4HWSA 2J7PA 5I9IA 3F6PA 1O95A 3RVDA 4PX9A 4QVGA 3EPHA 1SU6A 3VH1A 1QVRA 4BKPA 2WKPA 3N6XA 3QNMA 1IRIA 2EFGA 4PC3A 5E6SA 2Z8YA 2BP7B 2XTJA 2X3UA 3R4CA 2UDPA 2V4UA 4ZT4A 1KR2A 1V96A 3Q3GE 3TECE 4PG6A 4PZEA 1E2QA 5BN5B 1WA5A 4TVOA 3ZX4A 3KVNA 3OPMA 4I9FA 3RIGA 3ZZMA 7GPBA 2B21A 2UZ1B 1KP3A 4P4GA 4B79A 4EP1A 2NP6A 5FIUA 5CVEA 1CP3A 1SXJA 4UDXX 2O8BA 2Y3IA 4RPCA 5L4LA 2A58A 1Y0BA 1R4NB 5DULA 3U40A 1IZ7A 3IELA 3BZBA 3IVXA 3KQYA 5BUZA 4Q9NA 1Q0RA 1VG9B 1OJLA 2A7QA 2UVDA 3B78A 3G8YA 4J3JA 4E3ZA 1TQHA 5BN4A 1RRVA 2IYLD 4RHYA 1K92A 5CFPA 2XB6A 4WY2A 2Z4RA 3PEWA 4WACA 1QB8A 2WI8A 5E6RB 3MTJA 4AJJA 4BO7A 4OHUA 4BMSA 1WM1A 1OX5A 1EAYA 2C1XA 1AB6A 2BAGA 2R5NA 2ZT8A 5CDFE 2VHWA 4BRZA 1FCJA 1JFVA 1X86B 2JAHA 1WZIA 2M6KA 3IMGA 1E5VA 3ICWA 1S1MA 5DT2A 1UXGA 3U60B 1VKOA 2XQKA 1NXXA 1PBTA 2JRCA 3H17A 4M0LA 4N7JA 4OAQA 4NCHA 4MS3A 2EYUA 3REGA 1DG9A 3MWYW 1WY5A 4OHYA 1YVDA 3U4DA 3OA0A 4BBAA 3GRYA 2O8EB 3ZCTA 1ZHFA 1YOVA 1KDPA 2PX0A 4CMIB 1FY2A 1HQYE 2RKOA 1Y42X 3I8SA 4IJWA 1AO3A 2HCTA 4TKLA 3BGIA 4EJFA 3FOWA 4I55F 3ED1A 4YASA 1C7EA 1NMQA 2HUPA 4HXYA 1TIBA 3C3CA 2FHSA 2GFHA 4GMXA 3ZVLA 3VGJA 3M4YA 1YFZA 2VIIA 1JA0A 3PUXA 1XBTA 4N0PA 3GBVA 2FV8A 4DLVA 5TF0A 3U3DA 1K9SA 3T7JA 4G85A 4YMTA 4BWYA 5L3ZA 5A7HA 2BRUA 4DY4A 4QG3A 3JAMA 1J0AA 2V7BA 1XHEA 3CKKA 3WNVA 2PMKA 4BNGA 2N42A 4GMHA 4F5YA 2EJVA 1DJPA 2K2WA 2JEOA 3GCXA 2HMWA 3V2IA 3EDOA 1QU2A 2PS1A 4RM3A 3VYUB 2O2YA 2EX0A 1YIDA 3I62A 3MWLA 4ARAA 1T2AA 3L0OA 1QGOA 1HMPA 4PSCA 5TGTA 1QCZA 4N6GA 4H08A 1JHRA 3K0EA 2I34A 3P20A 3V9AA 5AVSA 4JP2A 1OXMA 4HLNA 1PEDA 3LBYA 4FDLA 4V3BA 2Z6AA 4B9EA 1Z4OA 3UKJA 2DKOA 3QEMB 2NUAB 3I30X 4TT3D 1GITA 4L85A 4HVCA 1IC6A 2ZTVA 3ZJ4A 2HF9A 3IJPA 4GD3Q 4GMFA 3TGWA 1Z7YA 3VPSA 1LSSA 1U7DA 5AXBA 3IL2A 2TMKA 1NVFA 4Q3LA 3CPJB 1OPXA 4YDSA 3AMVA 1RM0A 3KU1A 3KOZA 2PD4A 3Q15C 4D8TA 4WXMA 4MWEA 1K63A 1C3LA 1FYEA 1YI1A 2P79A 4NOJA 3SLGA 3W5UA 4PWZA 3ZG6A 1TQ6A 3NG1A 1GQFA 3B2EA 1D5CA 2WT4A 3RVJA 1QHSA 5LZ7A 4B9AA 4GMKA 2G9NA 4V0MA 2Q99A 4Q3BA 3EW7A 1I36A 4RLHA 1UP7A 2X8BA 1J20A 3LZDA 4RY2A 5L3VA 3GUVA 1NSTA 2P27A 4DSOA 4D3SA 2VHQA 2PGXA 4UXJA 1MXFA 4D4JA 2I62A 5JD3A 3K0FA 1DNPA 1GZHB 3BMXA 4IG9A 3UCEA 3ZVKA 4P22A 3G2LA 3H4IA 5ALLA 1OLSB 2WWYA 1ZQ9A 1YCDA 3A6ZA 4H0FA 3FDZB 3BB4A 3JQFC 3QKRA 1XF9A 1M2JA 2XF2A 1CIPA 2R8YA 5A9TA 4M76B 3GJ6A 2VTBA 3MK31 4J7CA 3TD6A 1HEIA 2PUAA 4GX5A 1ZA2A 2Y1LA 4XOIA 3K1YA 4ZJUA 3S29A 1HDCA 2E4VA 4LJKA 1NR7A 3C3BA 3DR5A 4GM4A 1KFBB 5LZ9A 1YBVA 4JJFA 4W7SA 1FU7A 2R5FA 5CA0A 2H11A 2I67A 3G13A 2JARA 3VNQA 3ESDA 3JR7A 1AS0A 5G3ZA 4J7AA 4FOPA 4BJ1A 3U4MA 5BV0A 2ZJOA 1PO7A 3BWVA 3H65A 4TRNA 4TXJA 2Z2XA 3PE6A 5FI5A 5KOYA 1JHMA 4AYWA 1JAXA 3TQTA 4ZVSA 1C4KA 4LI0A 2AFHA 4RL4A 3B36A 1RLIA 4DLSA 1F4PA 3G6WA 2FSGA 4G1EB 5BNIA 5J4KA 2IKQA 5DDIP 1PG0A 2PGNA 5KQLA 4CFSA 1YE8A 5BT8A 3ZWYA 5FV4A 4P4LA 4I4LA 5HUHA 1QKIA 4B6JA 1PVVA 3I4LA 3K6KA 2WM3A 3R5JA 1XKQA 4W9NC 2OFPA 4FDUA 4HN2A 3TSYA 3U3KA 3P9QA 4OHCA 2NAFA 1FXSA 3FI9A 2OILA 1DQZA 1G2QA 3N87A 4MZDA 4POAA 4FYHA 4TLLB 4BB5A 9GPBA 1A4IA 3U4HA 4JYZA 2NADA 1JQBA 3FPEA 1SURA 1XZ8A 3KYDB 3SEQA 2BTOA 4PNHA 5H1YA 5IRCD 3D7SA 1QG2A 2GCGA 5MF6A 3ZGOA 1IG0A 3IAM6 3KHSA 4M0CA 4JDUA 5DLPA 1I4TD 4E09A 1GTVA 2X8LA 3N05A 2GNOA 3A31A 4AJNA 3R9WA 1J2UA 2DUMA 3KR1A 3QU2A 3Q2IA 4G4IA 3TK1A 3UAGA 4YAWA 2HSEA 4V0NA 4JB3A 2CXXA 2RI1A 1HE2A 4YP7A 1XCBA 3LO8A 3Q3EA 1PQPA 5CEEA 1VPEA 1PAUA 4NFHA 3NXKA 3FKQA 3ZLBA 3DZDA 1US8B 3OQIA 1WX1A 2O06A 2Y1WA 4ZO6A 2XZLA 1XGKA 2HPAA 1PV1A 1CJCA 2H1RA 4DCJA 4YH1A 5CFLA 3HXOA 1N5MA 3I0NA 3H97A 1EX7A 1VGQA 1RWOA 2AC7A 3CO5A 3CF4A 1ZUIA 3AETB 3UJHA 3F6RA 1Z2DA 1UBOS 4P8RA 1WUYA 5I7UA 3N2ZB 2D4HA 4BV9A 2HWYA 3G0IA 4TOIA 3VZCA 1ZBQA 4JT2A 2LNDA 4Z9BA 2DUJA 2Y27A 1AZWA 2FZGA 3CCBA 2BEUB 3EXHC 4UOZA 3FB4A 3N0WA 3CVOA 1DO8A 2ZKLA 4NBVA 4PG8A 3NT4A 1JLSA 1NN5A 3IEMA 5K0BA 2FFBA 3FAKA 4OXQA 2HIAA 3L4SO 3W34A 2CK3A 1E5QA 1XUOA 2ZXFA 1CQIB 1XNHA 4AY4A 3I32A 4QDTA 3U4QA 1J1UA 1D4AA 4FFBA 4RO0A 4B81A 5EZ6B 3TCXB 1YJ8A 1W0JD 2FW7A 4DNXA 4P0TA 1CQXA 4D7AA 3IVAA 1Z68A 4OA5A 4CM6A 2A5YB 2HA2A 4P84A 2ZCVA 1CZUA 2ZWIA 5AESA 4RKYA 2XMSA 4PX5A 2JATA 2VT7A 1KHTA 3I2KA 2AOTA 1GKKA 3BB1A 3L18A 3WGQA 2PZJA 3NCTA 5P8WA 3ZBUA 4JROA 1JTVA 4L74A 1HY3A 3KQUA 2LIVA 3A4IA 5E9JA 4UEOA 5AVKA 3VPHA 4WLVA 3ZW8A 1JQ3A 3ZHTA 4ODIA 2GA9A 3C39A 5JDIA 3FTNA 5IKOA 4EECA 1K06A 1JI3A 1TZBA 4BFXA 1E8DA 4RKQA 2POCA 5FTJA 4IFEA 2QL6A 1PJCA 4LTMA 4BLPA 2OGZA 3E3MA 4IDPA 4PC2A 3K31A 4Z6KA 4NR0A 2NX2A 2IX9A 1PQYA 1Z4LA 5T6MA 3HY4A 2ZETA 2GA8A 3EGEA 4TTIA 2PMEA 4DSUA 5GM1A 5HUQA 2AMVA 4KFUA 2QNBA 2E37A 3QTLA 4NXMB 5FUQA 4RTSA 3MMZA 1FTNA 3SC4A 2AG8A 2WJHA