3ESZA

K2ak3a flavodoxin from anabaena
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
169
Chain Sequence
SAAIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Flavodoxin: A compromise between efficiency and versatility in the electron transfer from Photosystem I to Ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Electron transport
total genus 60
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3eszA00
3F6SA 2Z9BA 4N82A 1CZLA 1WSWA 4ESEA 3ES9A 1NNI1 2R97A 1SG0A 5ULLA 4D02A 2D5IA 1FLDA 5LVAA 1KBQA 3NHJA 3OX3A 5TGZA 4J8PA 1FLVA 1VMEA 3GFRA 1YDGA 3NHUA 3G5MA 3N3AC 1AKVA 2MTBA 3W77A 1AKWA 1YOBA 2A5LA 2X2PA 2BMVA 1XI2A 3B6MA 1AKTA 4PU0A 4YAUA 2KLBA 1E5DA 2QMZA 1X77A 5LJIA 4GR9A 2BF4A 3K20A 1B1CA 5LBTA 1FLNA 4Y9RA 4LA4A 1V4BA 4YALA 1JA1A 4R81A 2KQUA 1XYVA 3OX2A 4LTNA 3W7AA 5EAIA 3W78A 3LT5A 3NHFA 3FJOA 1WSBA 1DXQA 3OX1A 1FVXA 1BU5A 3K1YA 4F8YA 2FAXA 4C0WA 3GFQA 4FX2A 2FOXA 1TLLA 2QMYA 2XODA 2OYSA 4N9QA 3NHPA 3RPEA 4NLLA 5LLDA 5BUCA 5NLLA 2FCRA 3NFRA 3F90A 2HNAA 3NHKA 1RCFA 1XYYA 3SVLA 2MT9A 3EDOA 3KAQA 3L9XA 3NHLA 3N3BC 2B3DA 6NULA 2N1MA 3KLBA 2Q9UA 1XT6A 3U7IA 3U7RA 1F4PA 2MWMA 2HNBA 3GAMA 2HPVA 3OVMA 3EYWA 1CZRA 5NULA 4N65A 5JROA 2GSWA 5FA6A 1AKUA 1OBVA 4PTYA 1CZOA 4ZVLA 2FZ5A 3OWXA 1KBOA 3B6JA 4H6PA 1GG5A 4DY4A 3OJWA 4FGLA 3L9WA 2AMJA 1FTGA 2Q62A 1QR2A 5EA2A 4CETA 1AHNA 4FGJA 1CZHA 4NULA 2FLVA 2M6RA 3ESXA 4C14A 3F2VA 1J9GA 3F6RA 1SQSA 5A4KA 2QX8A 5B3LA 1H66A 4ZVNA 3HA2A 2R96A 1AKQA 1ZX1A 1T5BA 1D04A 3N39C 4C76A 1FUEA 1J9EA 4LTMA 3P0RA 3ESYA 3KAPA 2ARKA 4ZVMA 2BN4A 1BVYF 1FLAA 3FNIA 5F51A 2BZSA 3UXEA 1C7EA 4M0CA 3OWHA 4BMPB 2V5VA 3LCMA 1DX9A 4HS4A 2RG1A 1YCGA 4QODA 4H2DA 3QFRA 1FX1A 4LAFA 4BMOB 1C7FA 4YAFA 3TE7A 2BPOA 2QR2A 2QX9A 5EMNA 4GQIA 1YCFA 3B6KA 3HLYA 1OFVA 4Y9UA 3ZHOA 4YAWA 2OHHA 4U7HA 3NHWA 4CF6A 1J8QA 5LMCA 1RLIA 5F4BA 4DILA 4QOHA 1JA0A 5FX2A 2FZVA 1YCHA 5FUQA 3NLLA 2ZKIA 1I1OA 1RTTA 1AG9A 2XOEA 4QOIA 1D4AA 2V9CA 4YQEA 4U7FA 3FVWA 2OHIA 4XDHA 2OHJA 1TIKA 2MOKA 3QE2A 1QBGA 2FVXA 1ZWLA 5B3KA 3S2YA 1DXOA 4S24A 4HEQA 5LBUA 4FGKA 2WC1A 4QOGA 1H69A 3TZBA 3KEGA 4QOJA 2V5UA 3NHYA 2QX4A 5LJLA 1YRHA 1AMOA 3O2NA 1CZKA 1J9ZA 1YKGA 3UXHA 4ICIA 3NHRA 4Y7CA 3OJXA 2FDXA 4DIKA 1CZUA 3R6WA 3O73A 1AKRA 1QRDA 1RLJA 3ESZA 2QWXA 4LTDA 3FX2A 3D7NA 3HR4A 3NHSA 4GI5A 2Z98A 1ZWKA 5F12A 3FW1A 2FX2A 3TEMA 4YAOA 4C0XA 3W79A 1OBOA 4XDGA 4QOEA 2Z9DA 4OXXA 2QX6A 2W5UA 4QOFA 1CZNA 2X2OA 3JSXA 3QFCA 1AZLA 3GFSA 2F1OA 3B6IA 2M6SA 4U7GA 2Z9CA 1QHEA 1D03A 1T0IA 4ZVKA 4PTZA
chains in the Genus database with same CATH superfamily
1MDBA 3QVVA 1AUQA 3K0EA 3ZNOA 5E3HA 3NEYA 1EM8A 3ROQA 5LWQA 4UJ5A 3QBJA 2C4VA 3QOYA 4KQCA 5EZ5A 3WIDA 4NZYA 3RFTA 1YGYA 4U7DA 2W2XA 1D2HA 3B12A 3S8YA 1W36B 5EMMA 1QCZA 4FDAA 4MLZA 4MWDA 3FLBA 1Q1AA 1YS1X 1E7RA 5ILOA 1GQFA 1SVOA 2JHPA 4DYHA 5EJAA 1C4WA 4QVKA 3CQ9A 2SICE 4DG5A 1E2HA 3GZJA 5I9IA 5AKZA 4UU8A 2P1RA 4LI0A 2NV6A 4R3UC 3HYNA 2EBWA 4JJ6A 3QVUA 4Y7DA 5HOQA 1M54A 1SKUA 5L6MB 3IAHA 1VMEA 3B6ZA 2QW8A 4U00A 5DNAA 4CNQA 1W9MA 2IYUA 4WCDA 2IRWA 2A1IA 1MJFA 5L3QA 1MIHA 1LDNA 4C4RA 1AE1A 1I1NA 2JAWA 2WSMA 1DIOB 2BMAA 1NNSA 3H18A 3W77A 3C48A 4YRFA 5DZSA 4H9GA 4BFCA 5FHQA 5A3VA 1QGYA 3FFWA 1HDCA 5J1SB 1F2UA 1RZVA 1ZN9A 2C3UA 1J5PA 1MIOB 2AI3A 1OJLA 2HRRA 1TW2A 1OLXA 3ZE8A 1Z26A 1H2WA 4LWPA 5KCMA 2VNIA 5JC8A 1TNDA 4MAMA 2GJAA 2FSVC 3X0DA 3CX8A 4M7PA 1V11A 5AVYA 5F2KA 3AFGA 2GERA 4R3NA 2OE2A 1YR3A 3L7LA 4YONB 1SXGA 1Y63A 3WNDA 3A3NA 4KB5A 3DUWA 2FPOA 2Z5VA 3HFGA 3WLMA 5DT2A 4ZJPA 1E1QD 4RLFA 4PR0A 3ANNA 3WQQA 1A71A 1Z5OA 2CMFA 2AUNA 4GR9A 5L9AA 5CAEB 5AOVA 1UADA 3O4JA 4PSVA 5DBFA 3W5HA 1GRQA 1A9YA 4GRAA 2J31A 1YBVA 1VGQA 1MMFB 3TLGB 3W2HA 3WVNA 3DL0A 1VL8A 3ZK9A 4TRMA 5HGJA 1QVVA 2JZNA 1NSYA 3G0GA 2QVCA 4IVNA 3RADC 2BTEA 2QVGA 121PA 1BYIA 4QQRA 1FYXA 1U0FA 2XE6A 2HWKA 3C6KA 3OT4A 2ZI3A 1WHTB 3AJ9A 4HK4A 1L7MA 1PF7E 3W78A 3S1SA 3CZAA 4J76A 4F9EA 1DIRA 4BE7B 4E2ZA 2QAGA 1JLLB 1YBAA 4NENB 1HGXA 4EGFA 4PF1A 1DXQA 3O8NA 4PZ9A 4Q3EA 4HDSA 2AXEA 1Z37A 1BGVA 4WA8A 5GP1A 2RI0A 2DOKA 2Z1NA 3AR3A 2D5BA 3KE9A 3MAGA 4TLDA 1HYHA 5TQ2A 5K0NA 3ZBUA 2VTBA 3IALA 4OHMA 3V8BA 1GPKA 1MW9X 1Z36A 1BH6A 5DV9A 4JC8A 4TX1A 3V4SA 4WI1A 3C5CA 1ISPA 3GJRA 3HUEA 3KS9A 3V4LA 3O26A 5HK9A 2DBQA 1JG3A 1NOKA 2GLXA 2PMBA 2WTUA 1NLZA 3EDQA 3RQIA 3IMCA 3R77A 4J16C 2PKRA 3CNBA 2G09A 2ZU6A 1Q0UA 4FC7A 5EUQB 2NO6A 4P80A 1LS1A 5T41A 4GOMD 4F91B 3MEQA 2MYTA 1XQ1A 1J00A 1UK9A 2QTFA 1CCWA 3LHIA 3R44A 1YR1A 4PG7A 4TL8A 5K0CA 1S8NA 4BXOA 4Q1CA 4BDTA 4MW5A 2BFEB 2FEOA 4HJXA 3R7AA 3SX0A 3CW8X 2GBGA 4N5NA 2PQ6A 1O6ZA 1C7QA 1AMNA 1AHIA 2QHXA 2O06A 1YZHA 4KOEC 3EUEA 1GLNA 1FRNA 3BGVA 2GYUA 3AZOA 3N9IA 3ZDEA 5B1YA 4RTSA 2Q4TA 3M81A 3HBAA 5JWOA 1H4SA 1QYCA 3M49A 1HNNA 2GLTA 4FBLA 3AHEA 1XXHB 4JU8A 2YOFA 1K6EA 4HUTA 3R3VA 1JE0A 3EDOA 1RYHA 3BFKA 3PUZA 5C1OA 3V7NA 3S55A 2ZWOA 4LYDA 5K0GA 5TR9A 4WKOA 1GD1O 1PJBA 4K6OA 1EUZA 1JHPA 2B21A 3LUCA 5IAAA 3BFVA 3FVQA 1Z4PX 2RGUA 4Q3DA 2W37A 4IJWA 1N3LA 4D41A 4N03A 1CUAA 1DBQA 2VXBA 3R2JA 4GOLD 4LZWA 4J1TA 3FZYA 1RI1A 3STTA 1YVEI 2ERXA 1XCBA 3A1DA 3BK2A 4IGFA 4OUDB 3HJCA 5D01A 1N7GA 3B1YA 4Z51A 3L46A 4GT1A 1EUCB 5B6PA 1E7YA 4L6CA 1MQ9A 3KVVA 1P3JA 4S0ZA 4FFLA 2IE0A 2MWMA 4HGQA 3QUCA 2AYZA 2CLEB 1OAOC 2WNSA 3Q7RA 2LIPA 2W48A 3ZXXA 3DVRX 4BP9A 4X41A 4OJTA 4BCCA 3S2ZA 3IQWA 3D3NA 2PO5A 1LBTA 2PPLA 3RJ9A 5FOSA 3R6GA 2H7VA 1P7ZA 1XTKA 3I6ZA 1U8FO 5EWJB 1YE8A 4OM7A 1QYRA 3L7AA 3H87A 2DFLA 1N2BA 3FUUA 2GPNA 3HR8A 4D26A 1BCRA 1GGHA 4FZRA 3G2LA 4TKUB 1ZJ6A 3VAAA 1T35A 4AAYA 3KOYA 2IUFA 4X5OA 1I3MA 3ICPA 4O08A 2VQ3A 1YGPA 4QUDA 1U7ZA 5M34A 3WL5A 1RM3A 3LDAA 3BERA 5HFJA 4O8CA 3WJ2A 3KB2A 4C5BA 4GSLA 3MBIA 4QPCA 3CBGA 1TUIA 4TTIA 4E2FA 5JXIA 1HTBA 2FPPB 3NO4A 2Z2ZA 1U0OC 1U9ZA 1YR9A 4QQFA 4IXMA 4WE3A 3UJPA 4YCBA 3ROTA 3LUAA 1I5OA 3L0IB 2BH2A 5K03A 2MYNA 1JHRA 3IBGA 3ZG6A 1Z4KA 4A8TA 2QN8A 1RC8A 1Q83A 1L3BA 3R0VA 1JYFA 4H17A 4RK0A 5BNZA 5B3JC 4YMUA 1SVNA 5K8LA 3LX8A 4R2IA 4UEOA 3U1VA 4LCEA 2ZUCA 3V42A 3PJRA 2Z04A 1YS6A 4WDRA 3HXMA 4MULA 4X91A 1ZYUA 4BX9A 4UARA 2OGUA 1FFCA 3AM4A 4OXRA 3UW3A 5B7PA 2WJPA 3D81A 2XHEA 3GOHA 1I4OA 2PX3A 3L0BA 2NUAA 4ITRC 4LOKA 4JY7A 1J0EA 1CRLA 3L7YA 4MQEB 4CKWA 3L4BA 5HJ5A 1C30A 2G25A 2YH2A 4QM6A 4RPHA 3KJIA 2DFTA 4PFKA 1Z12A 3LLVA 1CLEA 4IHJB 4K9LA 4PCUA 1RAHA 3C45A 2WE7A 2CVPA 2IGBA 1P80A 1LQ2A 3LQFA 4ROSA 2PZJA 3VNAA 2JFHA 1JILA 3HO8A 3CZ5A 1VFNA 2QZ4A 2EJTA 3GNSA 2MMGA 2I66A 2X4LA 2XF8A 1BYUA 2HLPA 5GONB 1RS0A 1DL5A 2V7PA 2ZJ7A 3N39C 4X20B 1QPZA 4UNPA 4WOBA 3RG2A 3I12A 4EW3A 1FUUA 4FDUA 2SBTA 3GH1A 4JODA 1JEYA 2QLMA 1C3LA 3R5XA 1BQ3A 4M87A 4DQKA 4LNUA 2B99A 5I6DA 2F90A 2VNJA 3NT5A 1KWGA 3VBEA 2CJWB 3VC7A 5KSWB 1S3FA 5U1PA 1TAGA 4GR4A 4E22A 2GFQA 3JQ8A 4Z5XA 5ES4B 2QZZA 2VK2A 1Z15A 3TECE 1BCSB 2EJBA 1BWRA 3L6EA 4HNGA 4C2UA 3FPKA 1DX9A 2GEJA 1GUZA 5LIRA 1AKNA 1E9VA 2HJVA 4HAYA 2PGLA 3DNPA 4DAOA 5DB4A 3E0XA 1KMMA 1VPEA 3QFRA 5DLYA 4DDVA 2EKDA 3GQBB 3MTGA 2W2OA 1G1MA 1ZM7A 1M10A 2BR3A 3DE6X 5FI0B 5DWVA 5LZ8A 3VSBA 5HNKA 3VSEA 2BBWA 3QX8A 5B3AA 2Y4NA 3HCCA 2XY4A 3CTMA 3PT9A 3A0UA 4IIFA 3WYCA 1MUUA 4UBKA 5M2QA 1WA5A 4BS9A 1V5WA 2WZDA 3GFOA 1JJAA 1KOFA 3TVTA 2Q8NA 1DC5A 3FUWA 5KO2A 1WV0A 1XPRA 2HQBA 4LJ6A 1HLPA 3UTDA 3F97A 2EYUA 2V9PA 1X1QA 3QWFA 4N7RA 5AW4A 1BE6A 4BNDA 4X71A 3OLWA 5DMHA 4L9WA 2MCFA 1B73A 5DTRA 1E3LA 1OFVA 2XUIA 4CTNA 2XYQA 2ROQA 3IVAA 3ZQJA 2HDHA 3KQPA 4DWOA 3NGLA 1E1YA 3DFMA 5JZ9A 3SPXA 1LPNA 2O0HA 4Z8XA 2IV3A 5EJ7A 1U3TA 1Y4AE 4A2QA 3W5CA 5ADWA 2WPDA 1OAKA 4L6AA 2HU7A 2JA2A 4D25A 3QBVA 1FFAA 2X5KO 2ZK7A 1ESZA 3HFJA 2DHQA 1K68A 3CF6R 3HJGA 4GE0A 5G1NA 1HT3A 2J33A 4ERNA 2FUG1 5LXTB 4CQLA 4DILA 4GQAA 3ABOB 1YA8A 5I9TA 1T91A 3RUAA 1DKRA 5IP5A 4JB8A 3T5BA 5BYKA 4EYGA 4L5AA 2OAQ1 4O0MA 3KL4A 1QH8A 4KDRA 2JG3A 2VWGA 3D5TA 2VXYA 4I4IA 3RS3A 2FPUA 1VMKA 4JBIA 3K6SB 2MU1A 1HT2E 3QVWA 2V9CA 3LK7A 4PW0A 4DV5B 1RQLA 4HXYA 5EYPB 1U90A 1OIWA 3L01A 2P0EA 3DT6A 3OC0A 3K5HA 4JH0A 5AKJA 3VZQA 4JAVC 4IOKA 4WESB 3VR1A 1O8CA 1KEEB 4EFMA 3GJ3A 2RGDA 1LV7A 4GM1A 1K3TA 2C59A 4G26A 4PSAA 4AURA 1L7BA 4M49A 2B1RA 5K0SA 1H5QA 2ZS9A 4L5IA 2VPXA 4NMHA 4CEHB 4MUYA 1MZVA 1IHXA 1SMKA 1J2EA 3UAOA 2YRXA 2ZJYA 4G4JA 2MSKA 3R7WA 2WJYA 4PGHA 2HQSA 1Z33A 2YHSA 1DUIA 4NJEB 4PPQA 3S2YA 3N0RA 3TW6A 2AEFA 1G9XA 1X14A 2F6RA 2J45A 3MNFA 1HL3A 2ZW9A 4IGEA 5JAQA 3OFKA 5MDHA 3BSYA 1S3GA 1K8RA 2RHLA 3BIFA 1MXFA 4YC7A 4B3DA 3H2IA 4ZAYA 3UK7A 1MNAA 2BI7A 2HA7A 2ZSDA 4E7OA 1EX1A 1Q1NA 1XTUA 1OFGA 3C3KA 6ABPA 1Y8RA 1O58A 1DMSA 2JJMA 5C0OE 2B61A 2CMDA 3RYFA 4G01B 4MICA 3DVSX 4TV9B 3SYNA 1QORA 3H5TA 4C88A 1P9OA 4QAJA 2VYVD 3GA5A 4TXLA 2XE4A 3KE8A 1FVOA 1ORDA 3FGPA 1XZLA 4S35A 4KQIA 3DMTA 3OTWA 1KYVA 3KZOA 2XW6A 3INYA 2CBXA 4I66A 1GZ6A 3I3SR 4L4YA 3UJBA 4OJQA 2GO1A 1R0SA 4GI2A 3NBKA 2VUUA 3PXXA 1UODA 4R1QA 4GM0A 3U0VA 2V1XA 3VHXB 2HIAA 2IV7A 5D1NA 3OJXA 4K2HA 5LB2A 1KO7A 3UG7A 3WLRA 5BT8A 3OG9A 5HWSA 3LM8A 4MW9A 3GFVA 5T6MA 4GPD1 5KNLA 1MRNA 3IELA 3EZ2A 2BBTA 4O2AB 3UQZA 1YFJA 2C3MA 3ESZA 3R40A 3C3DA 4H6VA 2V98A 3U19A 1UBHS 3U61B 3UGTA 3FTFA 4ALJA 1QB8A 1NY6A 2PKQP 1UFOA 4G0XA 2X0RA 3CXRA 1V0JA 3CKLA 3DZIA 3H1FA 1Y4UA 2Z98A 1D1PA 3LOPA 4BUZA 1AGXA 2FDRA 1HUQA 3FSEA 1VKOA 2P0AA 3E27A 3MTBA 1ZGGA 4Q21A 3JD2A 1PKEA 2FK7A 1JF8A 2HIGA 2HSEA 1EP1B 3KTFA 4B73A 1HE3A 1WETA 1DAIA 3L3BA 1A3CA 1J22A 1K6MA 1X1RA 2WM9B 3DLCA 5CXXA 1QHHA 4FB5A 4HH4A 3EZYA 2XVYA 2ZJ1A 3ZD7A 3SDSA 1XKQA 2GJKA 5CGQB 3K70B 4UVHA 2GXQA 3T15A 4BAUA 3EDRA 1Q0TA 2P91A 4Z4FA 1W2HA 1Y8QA 2FN9A 3RLIA 1CY2A 3EF3A 3TCKA 4EMSA 4OX9B 1CY0A 1XOIA 3FAKA 3IQXA 5C81A 3B53X 3DEHA 2I2WA 1T2FA 3A1EA 3ETLA 3MRXA 4PN3A 1GQ2A 1K6XA 1XCJA 2HRBA 1UXHA 5B55A 3LSYA 1NI4A 4Z4QA 2YVQA 3D0QA 4JBNA 5KYYA 3CIOA 4RKYA 4BLPA 3AMVA 4ZGBA 1CJTC 1RWWA 1KMIY 4HPWA 4IVQA 1SH7A 4XWWA 2OV4A 3BAZA 4BRWA 1RI4A 4Z0TA 4IKOA 4D56A 2UVPB 2CLSA 2IXAA 3AWDA 1Q11A 4N82A 3K1AA 3WAJA 1DFHA 3C3BA 1F0PA 1O94C 3SG0A 5IWCA 4AKSA 3WFJA 4HPXB 1M2VA 2QMHA 2A0WA 3FYUC 1SRRA 2C2MA 3SSAA 3RTGA 2Z83A 1WU7A 3IAFA 3M4NA 4XEHA 3QLVC 1CEXA 2CF5A 5U4XA 3ZWQA 4AJKA 4FYPA 2GEVA 1G3QA 4HEA1 3E8MA 3QVOA 5ALNA 2HXSA 3TCXB 2QJTA 4B6OA 2I87A 3SIWA 5K8CA 4KC0A 3U0BA 5I3CA 4GHWA 4KXWA 4NV3A 4J0CA 3VDRA 1YDGA 1UIMA 3N87A 3O8DA 4OO3A 1BRTA 3L0SA 3NHUA 3L7JA 3OIYA 5AJZA 4AP9A 4RPLA 1AKVA 1TKRA 1O95D 2RHJA 5D6NA 3GA7A 3VOBA 4YXWD 3L6UA 1HZZC 4P3KA 3K2QA 3MWDB 1OX5A 4ZGWA 1A9OA 1EQUA 3J7AC 2HLHA 4ZPXA 1OILA 2YBDA 3IIMA 3EF1A 4HMPA 4P54A 1YOBA 2KHZA 3F6EX 4DIMA 2ZTLA 2Y9PB 4R3WA 5A5FA 2BMDA 4PR3A 1ZH0A 1M8JA 1NLMA 1J5EB 3BDAA 5I8ZA 5ISMA 1MQAA 1T6YA 3GEBA 2JI8A 5CU7A 3FBGA 2HA6A 4ZC8A 3L0YA 4Q93A 3QENA 1ODJA 3JWPA 1E1KA 3OU7A 3NYRA 3MFQA 3E1KA 2VPQA 3KKPA 1R10A 2H18A 4JOSA 5FF9A 1FYFA 3V4RA 1YZYA 4DIBA 4NRDA 3CPHA 4JI7B 3DPIA 1Y3IA 2AFVA 3LUJA 5HBRA 4DMGA 1G1AA 1RHUA 2E0IA 2HFKA 1E5DA 4KUEA 3UBMA 2AFIE 4D4GA 1JE1A 3SNHA 5LSAA 4MKHA 2V7WA 1DO2A 4Y2XA 1WP9A 3FFXA 5EIFA 2H1OA 1JR3E 1GVNB 2VHVA 3EIWA 1B1CA 3C7CB 4PYIA 1FLNA 5LLSA 3ZGZA 5HVNA 1ZNZA 2ZTVA 3AY3A 5MHTA 3SJ7A 2E4WA 4KYUA 4V0SA 1R4MB 5BN3B 4XCXA 2ZR8A 3JZDA 2Q4RA 1XNHA 1PRYA 1UT6A 3T7TA 1FSPA 1K1EA 4U63A 4ABYA 4ASUA 3HM2A 2VNKA 2ZUSA 3RU9A 2FPLA 2XGGA 3MAAC 1MV8A 3IR5A 4D4HA 4YO7A 2VI5A 3DXYA 3IOBA 1Y3DE 4Y6RA 2V0NA 3EW9A 2ECQA 1VKZA 2ZPAA 1IWOA 2AOTA 1Z88A 3O38A 4OQQA 3SJUA 2O52A 5F1PA 1IQRA 4E31A 5CBPB 1MQSA 4WK0B 3RYTC 3TLKA 1Q3HA 2AFIA 3O9VA 1DBIA 3DGEC 3A7DA 5K5EA 1TGVA 3O31A 1T8SA 1V48A 3LOUA 3Q11A 1JR3A 3D5EA 2DECA 3ETDA 3R3XA 3LUGA 3I9FA 4BBJA 2GRUA 1E5XA 5EESA 4C6RA 1EXMA 1M33A 1XD9A 3SYTA 3MT7A 2IYXA 5KX5B 3COYA 4Y8VA 5REQB 1B8VA 2J9FB 4G89A 4ENTA 1M7BA 1A9PA 1U3CA 1FXUA 1G41A 2EFJA 2RIPA 5F21A 1U8XX 5EHZA 1ZSNA 3MXOA 2W58A 3BM5A 3EHEA 1ECCA 4U7TB 1KF0A 3C8DA 4GOKA 2OYSA 2VSNA 1I24A 4XPIA 1EXVA 2G63A 3CX6A 4MZDA 4RF5A 4I1UA 4RMIA 2P5TB 2D1QA 4R8KA 3SYRA 3PVCA 4FNOA 4NYIQ 2BGGA 1TM3E 2R85A 1IBKB 3C1UA 4YAKA 2I55A 3ZE1B 5LLDA 4GYKA 3SP1A 3RTDA 3IMFA 5NLLA 4Q4DA 3L8ZA 3ZXUB 3I1YA 1U5CA 3NFRA 4K6KA 4PHFA 5FNVB 5GIOE 4HFMA 3FWPA 3IV7A 4KE8A 4EMBA 2FPWA 4B45A 3NHKA 4RH1A 4DRZA 3FD8A 5LOVB 3F5SA 4IXTA 2H4FA 5JJCA 4M1SA 1K7FB 1T3TA 2HNKA 5IDQA 4INZA 1KI9A 1BO6A 3FPBA 3E35A 3TLCA 3UOWA 3G8YA 1H8HD 4AKHA 2Y1WA 3KUDA 5L3RA 4EF6A 3ZV6A 5DWDA 3BEOA 2ZE7A 4H1UA 1E58A 1V8PA 4HWKA 2CLHB 2WVAA 4TVKA 2GAOA 4ARAA 3H8SA 4JNCA 4ZICA 3KVOA 3C4QA 4XYBA 4JYPA 1KAGA 2GJ4A 3HBFA 4MPRA 1EKXA 3U62A 3K0HA 4JLBA 2WIAA 5C4MA 4HDKB 3AESA 3A2NA 3SLGA 1YZVA 3GGPA 1USIA 4LRWA 4WTOA 3SZMA 4HDOB 2DX7A 4B9AA 4HNUA 3CURA 3FGNA 3PGLA 1AK9A 4IUCS 4RZUA 3JYQA 4QEKA 2VSQA 2UYYA 1Q0SA 1KQ3A 5IHPA 1AN0A 1HETA 2W2KB 3NI2A 3ZXSA 2PL9A 1RKBA 3LVFO 1TTQB 1XQWA 1Y80A 4L08A 4PAMA 2QRVB 3W2IA 4DNQA 2P9CA 2AWOA 3V8RA 2HPVA 3WX0A 5GMOA 4MQ6A 3BMOA 2ONYA 2TS1A 3VXKA 3G89A 3JTEA 4F7WA 5CK4A 1WTCA 3SQXA 2V7EA 3W9YA 2XAAA 3DYBA 3Q3IA 1MX5A 4JVMA 5L7YA 1PTJA 2DCUA 3G2PA 3KWMA 4OXIA 4LFCB 2FRXA 2CMHA 3UAWA 2AOWA 2XNSA 2I1VB 2QP3A 3T6KA 3NOQA 4KGXA 4PQFA 4ZVVA 3AI1A 3NBFA 5DM4A 5FULA 3VM6A 2W8BA 4B82A 2Y9MB 4DIOA 2GHQA 4Z2YA 1E0KA 2XQVA 1YB1A 3NU1A 1B3RA 2ZDQA 1II8A 2IPXA 1P1CA 2J3DA 4TKZA 1YRYE 3TPZA 1NUPA 1T9BA 4MA5A 5K3OA 5E8RA 1KWKA 2R8ZA 4XR9A 3PK0A 3BULA 3HLKA 5CNMA 5CT6A 3UHOA 3V55A 2ZIXB 3IDAA 4M9XA 4MI6A 2P27A 4LJ7A 4HH1A 1OFHA 1QIHA 2GZ3A 1X7GA 1NTRA 1SOMA 1T8YA 1XZFA 2VJYA 3D4NA 4MO2A 4PHGA 2P9QA 1WXXA 3ASVA 1RCTE 2HAEA 5FORA 2Q5HA 1FTGA 3HP4A 4CN9A 4EPTA 5CFNA 1CRZA 5LD2C 4BGUA 4HH3C 4MMYB 4QDXA 2G4LA 2EERA 4GR5A 2RKWA 3PD1A 4O4JF 5EA2A 5KQMA 1E2GA 3UQYS 1QTNA 3ZWDA 2BKEA 1E98A 2WOOA 3ESBA 1G4HA 4HWPA 4D4LA 3FYUB 1U2DA 4PV7A 3CRNA 4EB8A 1IU9A 3SJZA 4EB6B 3TSYA 2OWDA 1GNPA 3LUBA 4OFXA 3UICA 5BW8A 1Q0PA 1E7QA 4C29A 1EVZA 3T34A 2B1QA 2H5EA 5E9JA 1KP2A 4HN9A 4MS1A 2P2ZA 3LUHA 4JLSA 1VXOA 4D9CA 1TT7A 4B76A 3G49A 1QV6A 1X92A 1NF3A 3MHPA 5KNCD 4N0MA 3EXIB 4WW0A 4DJTA 5JYBA 2FSGA 3RHZA 4MR9B 2I2XB 2XRYA 5EI5A 1R8SA 2GCOA 5FA5A 4RY2A 4BWFB 4U6QA 3WA6A 3DZCA 2ZSAA 3L8MA 3V8MA 1HM5A 2G4CA 2FYTA 3KYJB 3ORYA 4G0QA 2FHPA 1X6VA 2D7CA 4QYXA 1NQVA 3JQBC 3MMPA 2I0FA 1ZX1A 3QWAA 4Q9KA 5CT8A 2N9UA 1SD1A 1RXSA 4YT4A 3MOSA 2XUDA 4O2BA 2BFBB 1RKXA 2ORWA 7AT1A 5KWEA 1IN6A 2J5BA 3DFZA 4Q15A 4I5GA 5AKYA 3KAPA 3EOZA 2ZIEA 4G07A 4YDHB 4FYXA 1AS2A 4NYIR 2PVPA 1G5FA 3UMVA 2BEUB 3FNIA 1A72A 5EMHA 2ODPA 2IPMA 5F51A 2JLWA 5HK8A 3ZWCA 4I1PA 3PUXA 1A2OA 2XDYA 2G67A 1D6MA 1JFLA 4AD8A 2Q0HA 4X6LA 4AKEA 5BN4A 1HF3A 1OLUB 4LFAB 4WOJA 2CWDA 3CS3A 5IN5A 3ROXA 3U6KA 1E9RA 1DOZA 3K9QO 4I4TF 2Q1UA 3LTNC 2OK8A 3HDJA 3GRKA 1DAEA 4DJDC 3HKEA 2ODAA 4NESA 4O4JA 4OM8A 1QFYA 3PHJA 3WXMA 4G5SA 4FINA 3CISA 4CUZA 2DTXA 4WSOA 4A6PA 5DSZA 4QC2A 3OH8A 4HCJA 4HWSA 1XTRA 5KTTA 3LQ2A 3VTZA 1U3GA 2IHBA 3OX4A 3T06B 5LFAA 1X7HA 1A98A 3BICA 4MGKR 4MLPA 3BF7A 4B09A 1SHLA 1DKPA 1S2GA 3FTQA 4NZMA 3V1TC 4ALNA 2O3RA 3UKDA 2FPIA 2H7XA 3PFWO 3DR3A 1UANA 3FCYA 2Z6VA 1IZYA 4X90A 4AUEA 4AXXA 1A82A 1RM5A 4F3NA 1B0ZA 1II9A 4E94A 1TD9A 2BEWA 1QP8A 3C97A 3HLYA 2FE4A 2G3YA 4OBXA 4LVNA 2C5LA 3TQTA 1DU4A 1DBWA 3PKJA 1Q7GA 1I3KA 2PMWB 3E22B 4C2BA 2R4UA 1SOUA 4ZAGA 2DUNA 5GJVC 2ZRBA 4WH0A 3UF0A 2LIVA 3PYMA 4P1ZA 3TOSA 3W3AH 3IRVA 1OI2A 4UVEA 3TL2A 1ODCA 1P1IA 2OZLA 3LYLA 3N74A 5CA0A 1HLDA 3VV3A 5AW1A 3LA8A 5L3ZA 2DB3A 7ABPA 1BVRA 2GPTA 3IAM1 3K8OE 4OSEA 5EN4A 1DG1G 1YI1A 3PPWA 5HF8A 2P30A 2G9QA 4UOZA 1VGRA 5DI3A 1YR7A 5CH5A 3UV7A 5CLLA 2WOJA 2NU8B 3HNRA 4EGAA 5AO9A 1X8KA 1ZUWA 1YE5A 4HQOA 2I7VA 2V7GA 3JASA 4IFTA 2EKBA 3BUSA 1ITZA 2FQWA 2NU9A 5BQ5A 3DLPX 2ZVDA 3X1YA 3F46A 2JH3A 5A2QA 4FWTA 2FG6C 1U2ZA 5HIKA 2O2EA 4I4TA 4ZI2A 3T1NA 3NMUF 3F3YA 1I7PA 5FUVA 2BMWA 1OTYA 1CC1S 3AHGA 3PX2A 1F51E 4XRRA 1F6WA 2NTJA 4V39A 2Q1WA 4DTIA 1OFIA 4GIBA 2H4XA 1GZHB 3PC7A 3V7FA 1G3MA 2PUFA 3ZZNA 4ZQFA 2EBHX 4B84A 3EPJA 1NBME 2FVXA 3LBAA 4G5FA 1ZWLA 1ZIPA 3VZDA 1EGHA 4QOGA 4GZLA 2HLDD 1G20B 3ONVA 5B3KA 3H4IA 3KZNA 3C6BA 4JWKA 4ZV4A 2ABWA 2G1UA 2DBRA 1JAXA 1F3LA 1UJ4A 3B85A 4FMDF 5G3YA 1NBIA 4BNHA 4YMGA 4NEGA 5CIWA 2GM9A 3K0FB 4KMOA 3JARA 1ISHA 3QX3A 5IJAA 3A4MA 2P2DA 1HXHA 2VHYA 3T3DA 3LZDA 5AHRA 1H69A 4XGIA 3E9MA 3IDFA 1N2HA 3TSCA 3H9BA 2WYOA 3C16C 3DOEA 5M3BA 4B40A 1P6XA 1TI7A 2XQKA 1XVAA 2QBYA 3FNRA 4IZHA 3GY0A 2VZ0A 3AETB 4O59O 1OI3A 1F60A 3H83A 3NNDA 3P8ZA 4BGDA 3M2PA 4V0LA 3R6DA 3CNNA 4CN8A 1NBMA 2IZ0A 1B74A 3JWGA 5BSFA 4DG9A 1J06A 2R11A 2P9HA 3ICEA 3H86A 2EZ4A 6Q21A 1H4QA 1E3QA 4KVFA 4GYJA 4S05A 2CHGA 4G5QA 2O2SA 3TFQA 1IXSB 5HKLA 1EJ2A 1NDHA 1N8TA 2R7MA 1M2GA 2XRMA 3OTHA 4M36A 1IXYA 1IQ0A 2DUJA 1PJRA 4A8JA 1O8BA 3RTAA 3ZDAA 1O03A 1QGOA 1ZN2A 3OF5A 4L85A 4IJUA 4WFJA 3ZCSA 5SYMA 5AESA 1MA0A 2GTHA 2HK9A 4LZAA 4P34A 4HVCA 1T8UA 1I5RA 2PDAA 4BVAA 4TKLA 1QHXA 4ZODA 3W6ZA 1UKAA 4YAJA 3IIKA 2GAFA 1SCUA 4YJFA 2ATEA 2HLNA 4QTUB 4EATA 4IR7A 1MJGM 2V7VA 4MCAA 1ILEA 5KEIA 3VPDA 1DKUA 4YQYA 3ICOA 4WGGA 3TTSA 4G5OA 4FS8A 1K4KA 3QV2A 2R5NA 1C3VA 2VH1A 1ZWKA 1Z25A 1EIZA 4Y2YA 4YXFA 4UHCA 5TMBA 2FSSA 2GMWA 1EWKA 3FWZA 4B6FA 5FDFA 4ZANA 1TF7A 3WLAA 4CR8A 1IEQA 2IS2A 4Q12A 1VI6A 4EVRA 2QN3A 5ITZA 2NV2B 2XTMA 1FF9A 1TPZA 3MMXA 2GX6A 3REOA 3BJZA 2OBMA 1YA4A 2OZKA 5AW7A 4FCWA 3PC2A 3Q5EA 3JQDA 4ES6A 5A4JA 3RV4A 3H9GA 3D3KA 4QGBA 3RODA 2YCLA 3H1BA 4IV8A 1IG3A 1IN7A 1TCUA 2Z4RA 2O0KA 3UCEA 2PX6A 4DLNA 4UHHA 3VUFA 4HX9A 1A2QA 1ZL0A 3I9LA 4QPDA 5IUKC 3HKCA 3LCCA 3KXPA 5EP1A 1IJEA 4C7KA 1SIWA 5DSTA 6YASA 2Q1TA 2IEIA 4NPAA 4W1SA 4DR4B 3OO1A 3GW8A 2GH1A 2JJYA 4YJKA 4HP8A 4NU6A 2QL6A 5KSZA 1G63A 1EWVA 1FFDA 2AD1A 2PMDA 1DBRA 4FZ3A 4ZMSA 2X22A 4XI9A 3UA4A 2VT2A 3JW8A 3O8LA 1GHTA 4I2VA 1MV5A 1FJHA 3KAJA 1Y5RA 3OM1A 2FX3A 4BQNA 3L0PA 2XWQA 5ULLA 3S2IA 1Q2XA 3A4IA 2JNWA 1Y81A 3TQCA 4TYYA 5HX7A 5DX0A 3OQVA 4JNKA 3UNXA 1H2YA 3IC5A 3EIUA 3CH5A 4CQMA 1NMSA 1TYZA 3ASZA 3IP8A 4R1SA 7MDHA 4Q16A 4WADA 1A9XA 2UYGA 1XL1A 2XQGA 3FKJA 1GA4A 2IY9A 3L8DA 2Y76A 4OV6B 1UMBB 1Z6QA 4UEJA 5DXAA 5T8KC 2WUGA 1XKTA 1SXHA 1VJGA 3GDHA 2DRIA 2E37A 1ESCA 2ZKLA 5DX1A 1BG6A 4KV7A 4R2HA 2D54A 4FOPA 5IAKA 2RK6A 1SQ6A 4GDFA 3ETJA 3LFUA 4AUMA 1XVUA 2HOQA 1V4NA 3CRVA 1N5DA 3TRDA 1E1NA 3PD7A 4ZAZA 1SZPA 3IEPA 2BHSA 1W4CA 4BEVA 1ZW6A 3K1ZA 4QTTB 2G82A 4ENRA 1FMLA 4ID3A 1ISGA 3KPYA 2ZZKA 4HUQB 2YWJA 2XCUA 2UZ4A 4BATA 2PUBA 4KQMA 1RT9A 3KHTA 1YJ8A 2A6PA 1A96A 2PUHA 1XTVA 5A05A 5CXUA 1E20A 1KK0A 1OUMA 1PLLA 3P97A 4Q9JA 4OVKA 4EI9A 4YPOA 2VPWA 5EVJA 3RRMA 4Z99A 1ZCBA 5AM1A 2I22A 4JN6B 2NUTB 3KOZA 2W8ZA 2XAUA 3EISA 3LQ1A 2I4TA 3IE2A 3N0WA 4G63A 4MTLA 4CTMA 1SWVA 4URYR 3OY7A 3TVDA 1SBZA 3EEIA 4KFRA 1U1IA 1LQUA 2HDOA 3DO8A 2Y99A 1U1GA 3LXRA 3IEVA 4RA6B 2JCVA 2P78A 5GJCA 1I0IA 4M9UA 4YCMA 1V8OA 1OGYA 1F8GA 1MOZA 3N1UA 1D8TA 1A50B 2R8YA 1A9RA 2C77A 4X1IB 3EFEA 4FB4A 3IIEA 4YRRA 5EZQA 1LEHA 3OCYA 4UUNA 1IUOA 5BMVF 2CVOA 1X0XA 5AW8A 3CRRA 2ODBA 2P77A 4ZU3A 1JIXA 2LZ0A 5ENVA 2VH2A 4UBJA 4RVGA 4ZTBA 2Q3FA 2QLNA 3PHLA 1C1XA 4E5DA 1Q77A 3ORSA 3CT6A 1T6BY 4XVHA 1BDJA 2PX2A 3AL2A 5L4NA 2O5EA 1ZNWA 4FPXA 3ZDFA 1HEIA 5DBEX 3KOWA 2F3SA 2JFVA 5DM2A 3ZWNA 4TWJA 4WNCA 4YT8A 3DOUA 3DZHA 3GDOA 3GROA 1RQ2A 2CJXA 4MV1A 2G7MC 2A0FA 2JASA 2FOIA 2YJGA 2X23A 3BMNB 3WNZA 1RLOA 1Z82A 3UPDA 3ZD8A 1TUBA 2PGIA 3HADA 4AJNA 1T1JA 1I8TA 3P4YA 1BD3A 4BEJA 1KVUA 4Y6GB 3MN1A 2OPHA 2VZ9A 1X1TA 2NU6A 2EYQA 4N9QA 1HDOA 3ZE7A 3N7TA 2ILVA 3NVAA 2YS6A 1UK8A 1YS4A 1HE8B 2IUTA 2P9GA 5DW3A 5BUCA 1RDFA 4MLDA 1OWPA 2GAAA 3JRXA 4IFBA 1ZESA 2WWHA 3L02A 1UFRA 1KGSA 2VJMA 3QPDA 3A4YA 1WEKA 3GJ0A 5D1HA 1UWKA 2R8RA 1T5HX 2R79A 5G1PA 4DLBA 2PV7A 4DLRA 3WKEA 4ARCA 1AZTA 1FP1D 1L5YA 4UUPA 1J0DA 2WIBA 1MF7A 3RSHA 1P5HA 2QLJA 4GI1A 2QVXX 4PX2A 4RHUA 4CCWA 1X74A 4JP3A 1QFJA 1YFKA 2WMOB 3IJRA 5EKTA 3AL3A 3LW8A 4DRXB 4U2BA 2CN1A 2KM1A 4WKBA 3PDIA 3OLYA 1KGDA 2SCUB 3F49S 4KO3S 4DBZA 3CPEA 3L7KA 2Q5CA 3NBQA 1WX1A 4P93A 3VOTA 5BMVA 3TGPA 1XVVA 2R0QC 2QORA 1L5GB 5LUAA 1XCLA 3JAWB 4Q1FA 1U63A 2GEUA 1E69A 1YVRA 5COAA 4ZO6A 4PC2A 3SXJA 4AY6A 4JKYA 1FXWF 2XXBA 3DAFA 1XK7A 4J91A 3WFZA 1VECA 5EIBD 3WRYA 4YMLA 3L1VA 1R0XA 5TGDA 4WLOA 3G2IA 5BRAA 5BVHA 1P2UA 3QOFA 5FTJA 5LYYA 4MKGA 3BFXA 4NBTA 3W1VA 5JBNA 1TIBA 4HHEA 1MAWA 1N0VC 1HEUA 3OIGA 3D4BA 1LK5A 4JBXA 3CX3A 4DLKA 1OXMA 4HX5A 3WMXA 3OQJA 3T99A 1L3IA 5ARDA 3DEZA 3A05A 1P2SA 1XLUA 3F5FA 4B5KA 1JS1X 1N7JA 3C3EA 4YPFA 4KLRA 2IWRA 3DNMA 4CI9A 1T24A 4YRNA 5IUNC 4KIUA 3ER6A 5BVGB 3CR7A 2XMGA 3KT3A 5CJJA 1EGQA 1VPTA 4HZIA 5J2TB 3AKYA 1M9NA 3IP5A 4JV5B 1IEXA 3ND9A 4LGMA 1CB0A 3KELA 4P33A 2D8AA 2Z6QA 1ESDA 5TS2A 4EGSA 3THWA 3OWXA 5FOUA 4TSRA 3FMGA 2L69A 4RLHA 2NO9A 3ENKA 4QXMA 5JXWA 3BMQA 3DE7X 2AW5A 1OIXA 3GGGA 3LLSA 2ZIAA 4Q34A 5FYQA 4CL3A 4X8OA 2BFNA 4EOGA 4HDRA 2YMPA 4DUPA 4BO1A 3USZA 4BEWA 2DBVO 3QFSA 5LDGA 3WRXC 3L9WA 3PXCX 4HVLA 2D2VA 2G40A 3CW2A 1G17A 1ORHA 4JP8A 3TW0A 2DR2A 1TAHA 1X7YB 2X4DA 3SVZA 4ZVQA 4H7DA 5EJ5A 1E2FA 1Q91A 2V6BA 4MKXA 3VDMA 3DDUA 1PJ4A 1MCZA 3RT1A 1E59A 2REOA 3PV0A 1AHNA 3U9TA 4I55F 2XDQB 5BN5B 3RC8A 4E14A 1ORTA 1FXWA 1T34A 2JGRA 2ZPTX 3RUDA 2PUDA 2B4RO 2CT8A 3ESRA 1EK0A 4L78A 3KU1A 3NWPA 3ZOKA 3UPTA 3PICA 2CFTA 1YB4A 2HMSA 2QTLA 1QH1A 3EVEA 3KPJA 3PVSA 4P98A 4QT0A 3ZX5A 3HYRA 2RH5A 1UBCA 3EF0A 2YWEA 5FYDA 3MZ0A 1GILA 1KQGA 3H2JA 2O2YA 2GLUA 4BRSA 4EL0A 3AVOA 3HYTA 3NM4A 4NS4A 3G7SA 4RX1A 5GGYA 2VZ8A 4NCXA 3ZLBA 4UEQA 3FYHA 3OIDA 4B83A 3ASYA 3GUCA 4L8LA 1NN3A 4DMFA 3EPRA 4P7JA 1J9GA 1UMDA 4QULA 1YQUA 4HSEA 1GPNA 2FUNB 1NUQA 1ABFA 4Y2JA 1EE9A 1LJ8A 4R5MA 5LZ2A 1JAYA 2R7NA 2XMBA 3N2GA 2PZEA 3DOFA 3P5SA 1TYBE 4WX2B 3H7IA 4RKFA 3KCQA 3DLBA 1KOGA 2TMDA 5DM70 4R71A 3IL2A 1D04A 1NVMB 2AJLI 2PZFA 3VH2A 5CP8A 1DX6A 2O3TA 2HBQA 2I3AA 1X9HA 3F67A 3V8EA 2QGZA 3RB8A 2IQIA 3THYA 1NR1A 4ZQCB 3O0DA 2OZVA 1NX9A 3S68A 5JAOA 2BHLA 5EEGA 3NC4A 1KE2A 3G02A 5T5QA 5BSUA 2W00A 5AJXA 4WNAB 2NZWA 3K9WA 3LXUX 4QDUA 3ZE0B 4WUVA 4XCQA 2AJ8A 5HQ3B 4C05A 4OYRA 5B36A 4RDIA 2RG1A 2VYCA 1G98A 3KOXA 4JT9A 4KN5A 1VE5A 1B3BA 2PS1A 3KTAB 3MINA 4FW8A 1SBIA 1FIUA 4J75A 3TSZA 3MF4A 4KQWA 3FDZB 1MABB 5JATA 2YDYA 3F5DA 4I55A 5HA5A 1OB2A 2ZSIA 1HFEL 3QG1A 3N70A 2G5GX 4MPJA 5H3CA 4QYSA 2IYEA 2QRQA 3BDIA 1FMCA 2ZJOA 1QIJA 4HOYA 2NX2A 3R3ZA 2R66A 3B3FA 2CLLB 2XCLA 4GSKA 4L15A 5DRYA 1N6PA 5CM8B 1LV8A 4QJIA 3HGMA 2OO3A 1QXSA 3C5VA 5JSKA 2ETXA 3W9BA 4Z49A 1Y42X 1GU0A 2BCGY 4WK6A 4R51A 1G7SA 1OI4A 2Z2IA 3EGXB 3G2HA 3ITNA 2WMYA 4C7OA 3QU9A 3E5HA 2R7KA 4AY4A 4E5NA 1GA6A 1ZJ5A 1J49A 2YV1A 2EBFX 2F62A 4HTFB 4PRYA 4YYZA 2VBCA 3BBLA 1FDSA 1YB7A 3WO0A 1LI4A 3P9QA 4L75A 4Y0AA 4PYJA 3ROEA 1VL2A 2RB4A 2ZJBA 3A10A 4DDKA 4EX7A 5IBCA 3MJVA 1OH8A 3SICE 4TTPA 1D6NA 3DXFA 1RPTA 4HD8A 4UFNA 3LYHA 4PZAA 1B76A 3KD2A 1S2IA 3RIYA 3MWGA 2LXNA 4O3FA 1P60A 5F4BA 3LOQA 3R5FA 2Q27A 1KIAA 1H8EA 2XD4A 4OREX 4LMAA 1VPDA 1KJZA 1TVMA 3ECAA 1JDPA 3WYAA 4C0JA 1IH8A 3K8QA 2WICA 2D2IA 1I01A 1XYGA 2FJUA 3NT2A 3VVLA 3UT5B 4YUXA 4BB0A 4W63A 1X9IA 4QYIA 2C4TA 2MR6A 4GC9A 2HMWA 3VR4H 2JS7A 3M6VA 3FZQA 5EP4A 1XP8A 1K9VF 3NWEA 1Z5NA 1ZNXA 2XRFA 4U2EA 3ZPXA 1UBLS 4B7AA 5D85A 4ENPA 3LS2A 2GD1O 1DC7A 1KVSA 2QUAA 1TEVA 3A9UA 1TMGE 1BFKA 1UQTA 3C6MA 1R0LA 3GEIA 2RJ3A 4EY5A 1LTQA 2J9GA 2QMOA 3MOGA 4JXJA 3TGWA 2PUEA 1H9AA 3SEZA 2W2VA 4JJ4A 3ML1A 2G88A 2O8FB 3IT1A 4DOMA 5FWXB 4KXMA 3I5YA 2XNJA 1XVIA 3ND6A 3TX2A 3ULKA 2UYHA 1L5VA 3KSZO 5JU6A 4P38A 3RFVA 3PYLA 3W9UA 3BJRA 1YB2A 2VKQA 3KDSE 4B71A 1XFDA 5BV8A 2HCRA 3ZXYA 3NPMA 6LDHA 1VIVA 5IDVA 4ID9A 1JR4A 1PFUA 2V7BA 1E2LA 5DTEA 3T1QA 3V1LA 2V8OA 3CJQA 3L49A 1PUXA 2ZCUA 3QMVA 3EFBA 1HT0A 1ECPA 3COSA 1AF4A 4J9VA 3TZBA 3EAQA 2XA1A 4JJ8A 4AX4A 2CW5A 3CVVA 1JHXA 2DY0A 1T0PA 2PUCA 2V5UA 1CS0B 5BP7A 4DMKA 1Z0AA 1MIOA 1NBOA 3KHKA 3NR2A 5GM2A 3RC3A 2JK1A 2NN3C 2WWFA 5DWQA 5I9MA 3ZY3A 1QB7A 3ORHA 4GD3Q 1NR7A 4FD3A 3OQ6A 1TK3A 3K5PA 3QYAA 2VS1A 4PXYA 4Y98A 1R50A 2AFRA 4KSBA 3L1KA 4PWZA 5T4HA 3KG2A 3W05A 4DNXA 4IH9A 1V3QE 3KVYA 1N7HA 4EYKA 2AYYA 4GUDA 2ZVQX 4MDYA 4E33A 4KQXA 1ZJJA 1NMQA 1DV2A 3SQDA 3A1TA 3RGGA 1XAHA 4MUNA 2OQIA 8LDHA 1Q1ZA 4WLEA 4S1WA 1T3LA 4Z7QB 3RVRA 4LHZA 1OXXK 3IDQA 4FDTA 4FFBB 4Y2TA 2D8MA 2EDAA 3H5WA 5C4GB 4ECAA 5CAEA 2BMEA 2B92A 3E05A 1M8FA 1UQRA 1M72A 2G28A 4PFJA 2WWRA 3D7NA 3TLGA 5IT9A 1JVNA 2OSBA 2CHFA 1YULA 4F3CA 2J3MA 3MHTA 1GCUA 2X42A 2HXGA 1J99A 3R3WA 3ROZA 2GYYA 1EFHA 2I54A 4OI4A 3SEAA 2WP8J 1WHTA 2XH8A 4DFDA 5DYYA 3D6JA 1S2DA 4IRUB 5BXYA 1P9LA 3TEMA 3UFBA 4KQ6A 2PH3A 1RVV1 1JLLA 1PNOA 3N7AA 1SHUX 2YQ5A 4NENA 3LY8A 3G2MA 2VRCA 3MRTA 3RTCA 3SJCA 1UBMS 4CU2A 1Q84A 3W5VA 2HREA 2W83A 1ZVVA 2IYAA 4MGHA 1PK7A 4IY1A 4U9IS 4AICA 1E61A 3AOEC 2WFMA 1XCPA 4POAA 3LHDA 4AM8A 5CFRA 1E0DA 3FPAA 3G0HA 1PU2A 3NJ8A 2HCJB 3GFSA 3FVRA 1Z5VA 4I4CA 1KQNA 5A9TA 1O1YA 3BREA 1I1QB 3MCWA 1L5WA 3MCUA 3K0SA 4OGLA 1G55A 2O7RA 4N40A 4X6UA 3WNCA 2WYIA 1N2CB 4K1LA 1C3EA 3IUNA 5E95A 4BASA 1U0BB 1HQDA 1V5EA 2Z9CA 3RAPR 1G6HA 2FWNA 3CVYA 2ECPA 4O3MA 1WE2A 1FS5A 1LBHA 5G53C 4GC5A 1IMJA 3MERA 1V3TA 3K0KA 1ZIXA 2BFEA 2I76A 1CPYA 3D8BA 4R54A 4ZVSA 2GFHA 4B4DA 4CQJA 5A5VA 4JELA 4BQSA 4DMMA 3COZA 3GJ8A 5EUCA 4YRJA 4LSGA 5B1IA 4EITA 4ZV7A 2XKBA 3BTSA 4F71A 3DE3X 4MQ4A 2IEGA 2RC6A 1RQPA 3OFSA 2DM6A 4OQPA 2HDWA 2R00C 1RRVA 4BP8A 3NHBA 5LVAA 2HF8A 4UUBA 4DLTA 4DZZA 4K6HA 5KI6A 1GYRA 2R60A 3O8RA 1FQJA 5HM8A 4TLCA 2RAUA 2Y66A 3E9CA 3N28A 4IICA 1FNCA 1RYMA 2HSZA 3EYAA 1ZOSA 4OY3A 5TGZA 3RYHB 5B4UA 1KI3A 2PQ0A 3LC7O 2QLLA 3BQMB 3QU5A 4R2JA 4JI8B 2NAPA 3LT4A 2RBKA 2DSNA 3ZOZA 2OO5A 4DMCA 4IIYA 1UBKS 3N3AC 4EW6A 1WPXA 1WR8A 3EC2A 4Z9AA 5TT1A 4BYGA 3UKOA 3CF4A 3JQAB 5AWFC 1GEEA 4OUDA 2TRSB 1IDN1 2H2FA 5BNFA 4WOCA 4PPGA 2OD9A 1EUCA 1OE0A 2IIVA 3VKGA 4TS1A 1ZCFA 2Q4EA 5CJ2A 4J49A 3D2LA 3BEDA 4Z6KA 2H29A 2UYOA 2VHXA 3EUFA 4K1XA 4BAGA 2QQGA 5GGXA 1YUBA 5CEJA 4YBRA 5K4AA 3VR3A 2XF2A 1KNQA 1I4LD 4XW2A 4FUQA 4UM7A 3A1WA 4EAAA 3O4FA 2XDWA 3DTYA 2NUBA 1HDZA 1RBYA 4IHJF 2IZ6A 4LF8B 5C9ZA 2IYQA 2EFCB 2QK4A 2QSJA 3IT3A 3CVOA 4PSKA 1GTL1 3CNEA 3FUCA 3L7BA 1XTIA 4KXNA 4IRMA 4MQ5A 4PZUA 3HN2A 5EPEA 4F5EA 1NVEA 2WM2A 5DNCA 4ZOEA 4QPNA 3TD6A 1O9GA 3JD0A 3MIIA 1GTSA 2D6FA 2P6RA 5GONF 1QZTA 1CNMA 1E9CA 1KK2A 4OXQA 4TKUA 4W8HA 2IT1A 2Q7XA 5CHYA 5CJPA 5LZ5A 1FCJA 3AV3A 2ZYAA 3SN6A 3D2BA 2AKEA 4LBVA 3DZBA 2KQUA 5BSWA 3HVRA 1XMIA 5GJWC 5K3CA 1ONBA 2JIBA 4K3VA 4KNWA 1KO1A 4H0NA 2PCLA 2VK4A 4I99A 5D5QA 4KOAA 1T5SA 4F9FA 4UNRA 3NONA 3EVGA 1ZOIA 2FPPA 1G66A 3TDKA 1UEIA 2ZT5A 4MR8B 4PZZA 2QKYA 1NFQA 1BTOA 4P0TA 4E5YA 3KYCB 3M0EA 3QNUA 1OH5A 1V8DA 3DULA 5HXAA 4JUFA 2J3IA 4E12A 2ZIGA 1T3GA 3GN1A 3P9NA 4ZOBA 1PBNA 3HRIA 3NTXA 1USVA 3R7BA 4YYEA 5F98A 1WKBA 2IITA 4W99A 3PWSA 4Z2AA 1FDVA 2Q2VA 4C22A 1D8AA 2OQVA 2NGRA 5ALUA 3EWSA 3GFPA 3UXMA 3HO1A 2FZ4A 4XGRA 2QE7D 4ND1A 1FYDA 4YACA 2FB9A 1Y1PA 5EQDA 4NVRA 4F3YA 4CIWA 4DY6A 1WUTA 2WAXA 1H1DA 4JBYA 5H0IA 4AF8A 4DV6B 1KYXA 4EUEA 1YJ5A 1NW8A 3E70C 4WXPA 2CUZA 2YZNA 5F2OA 2XUKA 4AZVA 1CDOA 4OFBA 3F96A 1IRXA 1KI2A 2IYWA 1ST3A 3HGTA 3HVJA 1YDFA 4CLDA 4MQEA 1PWXA 1P7PA 2D5LA 5JAMA 1FJ2A 3L8YA 4D9IA 2FPXA 4OQXA 3P94A 5DOVA 3T3HA 1GQSA 3VTFA 1QP7A 1NUTA 1POWA 3K9BA 2Q2WA 4IHJA 3ILVA 4RJLA 4AW9A 4DCNA 1AKEA 1W1IA 4U8GA 4G9GA 2YWDA 4M3NA 4X7PA 4AUKA 2Q9BA 2ID7A 4HATA 3MYRA 4LE2A 2P3SA 5F7ZA 1NXPA 4P82A 5FTKA 5GONA 2I5PO 1PFVA 2UXBB 2X76A 3FI0A 1U4OA 4O02B 4PTLA 4TT3A 4UMDA 3IHTA 2P9JA 4AJIA 5BRJA 3G88A 2GWRA 2O05A 4X20A 3UMRA 1M7GA 3MTQA 1Y7HA 4HYYA 1WULS 2I62A 4MP8A 1FSFA 1XN4A 4R1LA 5E0KB 2FFAA 1DKOA 4M54A 3D7RA 2GVDC 2AOUA 2HZ7A 4LY3A 3EGEA 3I1FA 4GMDA 4K03A 5LXTF 3URKA 4KRFA 2AJCA 1N6HA 3AI3A 2HJGA 1UJNA 3N86A 3BGIA 2B37A 3OLXA 1CD5A 3IVRA 1BOOA 2A88A 3VQTA 4DQUA 4XJTA 1U9YA 2CJWA 4M0PA 2A9KA 3ZWBA 4G1MB 4KDEA 1T6ZA 2PJUA 2QN9A 5DH9A 4JI6B 5JXHA 4CMEC 1G7CA 1Z6PA 2ES4A 4PIVA 1DRUA 2EZUA 4DF3A 1R3UA 2B1GA 5L45A 1BCSA 4MUGA 2I78A 3M2TA 4KHPB 2Q45A 3ET4A 4OMCA 4NBSA 2Q3CA 4DRYA 1BA2A 5KUTA 2P1ZA 5J40A 3GGCA 2DTDA 4M1WA 4R1NA 2PG3A 3X2FA 3HY3A 3PNQA 4Z0PA 5FBWB 4TTAA 3OVMA 5BSVA 3SR4A 3DXZA 2VP2A 1QO7A 1NJFA 1S89A 4D0LB 4F5ZA 4CCSA 4B85A 1NOIA 4XGQA 5KU1A 3ND8A 4ME6A 4BYMA 2WFZA 3A4LA 3N05A 2MINB 4KTTE 1EQAA 4LC0A 8ATCA 5FCDA 1ULHA 4KWTA 3OCCA 1JB9A 5ABPA 4RDCA 3C87A 1X1EA 4UE2A 3TTYA 1V6SA 3DLAA 3ISJA 3K94A 2WRZA 4MO9A 3Q2OA 4OUKX 3TZCA 3VR0A 1TMOA 3PYXA 1RQ7A 2C0QA 4DCSA 3BMCB 3BX1A 4G0VA 1OBVA 4JUIA 2IGTA 3U4IA 1OKKA 1D2CA 2Q0XA 3WZMA 1X8LA 4UQLA 3IXLA 3H84A 1WDLA 4HRAA 4J16A 2FZ5A 1L5NA 3TAUA 4BTEA 1LTHR 3A9RA 2EQ5A 4GYYA 5DPMA 3PA8A 4IS2A 2ADMA 3UYKA 3KXKA 4OP3A 4BNLA 1CE8B 3G9TA 4TV9F 2A14A 2P6MA 3W9SA 2AQKA 2CUKA 1LTKA 1NAIA 1YL7A 4AZSA 4UZSA 4DY4A 1YJXA 2E49A 4L95C 3K9NA 1SKBA 1H23A 2GZSA 5T4EA 3KZMA 2CXOA 4IQ0A 5LXTA 3FPEA 3ZW7A 3KKZA 2GJ8A 1JIUA 2X0KA 4U2GA 3VUEA 2Q62A 1MP0A 3FCEA 5KDLA 2H57A 3RS4A 4EBBA 2IX9A 2E48A 2JJ8A 3CEAA 1HZJA 1GZ4A 4NBLA 1GSHA 1HX7A 3OPXA 1RZRD 3EC1A 4QRHA 4WKCA 2GF0A 5BSTA 3CR8A 1YAHA 1ZMXA 1FUYB 2FUG6 4O2AF 4XWKA 3H2KA 4H77A 2JPDA 5CYGA 3K6SA 1NC3A 2CDAA 4DDWA 1P45A 3RJZA 3E1GA 4MI1A 5EYPA 3AEKB 3VR5D 2A3NA 3RH0A 3AG6A 1H5NA 4NHEA 1DC8A 4WESA 5HZHA 4ZQGA 1KEEA 2ZIUB 3RF6A 3K71B 3PDUA 3KX2A 4YP7A 4DBLC 2C92A 3CY6A 4IO0A 4ONEA 4XDZA 2ECOA 5CTJA 3HGQA 4CEHA 4TT8A 3VA7A 3TWOA 2JIQA 1JVBA 4BNZA 1VRCA 3SOZA 3OTOB 4RE5A 1KYTA 4NJEA 3CNHA 1RWNA 3D59A 4LZOA 4JYZA 2FSPA 4RZ2A 1JTFA 1JQDA 2C97A 5BMOA 5GZ3A 5DIZA 3C6QA 4EF4A 4ZTZB 3T5GA 4WY2A 1OAOA 3QMMA 5FV7A 4D0RA 3AF2A 3WB2A 4ALIA 1T9AA 3JVDA 4YCAA 4OQMA 4NMMA 3TIGA 4MJLA 3TG2A 3STHA 3HHPA 3QPUA 4GXRA 1CVRA 4D9JA 1F2DA 4TV9A 3LFTA 1JXOA 4NE7A 4OKSA 5AI6A 1FLAA 3OZRA 1XKLA 4UUAA 2IYRA 2A9QA 2I8LA 5K0TA 3WBKA 1MTOA 4MHOA 5IU6A 3QNWA 5L51A 1DFIA 3IP7A 3VYSB 1AHPA 3U4CA 3QUAA 1P4HA 4JT4A 2PGXA 1Q5PA 4RS3A 3OIWA 4NJMB 3ZE6A 3ZZTA 1UBFA 1RWKA 2WU4A 4MVJI 3D5QA 3VU3A 1FZQA 3G3EA 2BKXA 2A2ZA 3RIMA 4BO6A 4L4UA 4CCYB 3VHXA 4P3OA 4KE6A 1EAYA 1RWBA 1W96A 4NYMQ 2AW3A 2WIKA 2R6ZA 3GMIA 1CY7A 5EE5B 4ZEXA 3V1KA 3ZHZA 1EFAA 5MFZA 4O2AA 4D9MA 1C7FA 3GLIB 1N1EA 1VDMA 4OJMX 1RAEA 1ZK3A 5JS6A 1F7UA 1RRKA 2I3BA 3ISTA 5KU7A 4RDHA 4QU9A 3GG9A 2PSSA 2DFPA 3VPXA 1DPGA 3VAYA 1MLDA 3MLAA 3NW9A 3WGKA 3DKKA 4BFXA 4X65B 4GL2A 4WJKB 1RQGA 3EVNA 3KT6A 4UUMA 1Z8DA 3JYNA 1NE2A 1STOA 5EHGA 1OBCA 5EXXA 4BLRA 4PC3A 5B3JA 2R6R1 2PT9A 2XB9A 4JB3A 4PRZA 4PZPA 2CXXA 5ALEA 4R2WA 5K0FA 2FR0A 1OHHA 1YBFA 4JHXA 2P2GA 1XZIA 5IFLA 3GRUA 4M1ZA 1B00A 1Q6YA 3CPSA 3V33A 4BJ1A 5JD5A 3W6NA 2OBFA 3P4UA 2HFJA 5EJ4A 3KOUA 3X44A 2A8YA 4GDMA 3VNRA 1Z8HA 4JB2A 5A7FA 5CIYA 1CR0A 3MQFA 2ET6A 3KZXA 4QFDA 3RABA 1G18A 3H6KA 3VVCA 1Y6FA 4IJQA 5ARBA 2F00A 2UVQA 2ODNA 4ENVA 3UPUA 4WCFC 1R4ZA 3NAZA 1SWWA 2BFOA 3A04A 3SXPA 2J08A 4OQDA 3VVMA 2FQ1A 4QTXA 1GLGA 1BRMA 2I2BA 1OU4A 4R0NA 2YHUA 2BI4A 2I9KA 2YXBA 1KE1A 2GZAA 3SHVA 2OBNA 2WA2A 3HCFA 2QJWA 4LVUA 3NYIA 2R8XA 5J2UB 3STUA 3VPFA 4IOJA 1TTHA 4XLTA 3G68A 2FTKE 4PIMA 4PO1A 1ZC3A 2W6ZA 6REQB 1UJ5A 1G38A 1QO9A 2V97A 3IFSA 5HRCA 3WMGA 2OCYC 2QG4A 3A11A 3EODA 3GUZA 4AJPA 1TT5A 1PL8A 3NIFB 2Q41A 5FBZA 2UVPA 3WYGA 3G2QA 1TAQA 3BXFA 4MS4B 5GPBA 3B20A 1BVUA 2C98A 5DYIA 3ON5A 3Q8XB 2HSGA 4B8YA 4EJSB 4TN1A 4UDNA 2DCMA 3NGMA 4JUDX 1OZFA 5ALFA 4DDUA 1NRIA 3TZEA 1EP3B 4JBLA 2WB2A 1UC9A 1KP3A 3EZXA 3IEXA 3O90A 5DM60 2P1DA 1P2BA 2ZRAA 4OHFA 4GGMX 2PA3A 5KNBA 2JIDA 3WGIA 1HDRA 1IUPA 2AX4A 4IDCA 2XQFA 4GMHA 3LQKA 3MPUA 5SZKB 1ZOPA 4F3RA 8GPBA 2A5FA 1Z3CA 2RH4A 1ID1A 4MW0A 1RBZA 2H2GA 3WV5A 4DCPA 3LI2A 5KX5F 5DNVA 1JPNA 1U8TA 1YRBA 3P0FA 3MWDA 1CB7A 1N6LA 4CUKA 4ZQEA 3OQMA 3CXUA 2FMFA 3OM8A 4ZOLB 5AVTA 2FEMA 2DHCA 4KE9A 1Y1KE 2PEYA 3SKVA 5CD9A 1ST2A 1UZMA 3DMDA 3VZBA 4JFRA 3T5AA 5KTSA 5JSZB 3TLXA 2C7PA 4OLAA 1OVGA 1IIRA 2IEBA 2H4ZA 1R88A 3CWZA 1ADJA 4UC0A 4RM2A 2C9DA 1ZL2A 2X6TA 2O1EA 5FI3A 4AT1A 5BR8B 4Q39A 5CNJA 1AT1A 3SE0A 4DIUA 1A9QA 2P4QA 2QUHA 4EFLA 1XZPA 3FOWA 4RHTA 2JLZA 4LBZA 3LTEA 4RZXA 1U4NA 4KLCA 5FNVF 2H52A 2CLMB 4UOQA 1MEOA 1M5TA 2FDXA 2I1WA 2Q5OA 3FIUA 4KP7A 5BN1A 5I9LA 2ODWA 3O73A 4QUKA 4C4TA 4XYLA 1VKRA 5LOVF 1WUIS 4KQGA 5I4IA 3OZCA 1LC3A 4MUFA 4QVGA 2HJHA 2IZ1A 4QG7A 5AKEA 4QU5A 2BTOA 1EM6A 4RY9A 1R4MA 2BE7A 5BN3A 1GKIA 3V2UA 2HADA 3C3MA 3JSAA 3KQKA 2AG0A 3MWLA 5CDUA 5CFQA 5CDGA 3NHSA 1IL0A 2VJLA 3D3WB 5M29A 4XX1A 4HB0A 3KZ1E 4JJGA 5IANA 3SBXA 3RS5A 1YH3A 3WOVA 5CEFA 4W5QA 5AJVB 3GRRA 1WW8A 3H9CA 3NBAA 2QAJA 1RPNA 4QHYA 2QTVB 1G7RA 5FT9A 1RADA 2YVLA 1RFLA 1C9MA 2LE0A 5EERA 5GY7A 1R16A 2H1VA 1OBOA 1P9NA 1KHTA 2QYTA 3IERA 5IF3A 4TTTS 1C4KA 2J3KA 1SOAA 1C8VB 3D4LA 3LKVA 4WECA 5TSDA 3KP1A 4BWVA 4LOAA 3TZ6A 2W5UA 2O2JA 1X7DA 2O2IA 1AGNA 1XLVA 3D2CA 4LZLA 4WXRA 3CG4A 1IWBB 4MS3B 1E79A 5KX5A 2XUQA 2XCOA 5REQA 2C8JA 1DKMA 2J9FA 3FSRA 4MGYR 4L7QA 4E5VA 1FDUA 1V7PC 4UVIA 1MKYA 3PS9A 3KKNA 4RD3A 5C7YA 1D2EA 1X3SA 1FMFA 1TF5A 1Z5PA 2OMKA 4TQ9A 3ZDZB 3NZEA 1YQTA 2O2HA 3G6KA 2GO7A 2HZBA 2G1JA 3A14A 3CEJA 2OZPA 2COUA 2J8ZA 2P6OA 3TQHA 3AW8A 4REMA 4UZEA 1JUDA 4ODIA 2C2XA 3RBXA 4I1IA 4JK3A 3UW1A 3FCSB 2J46A 1KSJA 2C82A 3GMDA 2XVMA 3OCWA 1QFXA 3NXKA 1B6GA 1BEUB 2BOVA 4OAPA 3RVBA 1N5JA 5CVTA 5BO5A 5FNVA 1YRAA 2CJYA 3ZR4B 3ES9A 2VUHB 3GVIA 4RHFA 2HUPA 3B70A 5CNKA 3QVSA 5LOVA 2J30A 1AS0A 4PC6A 4C2AA 5EWLB 3LW7A 2IH2A 2FFHA 2X15A 3A6PC 1CY4A 2YZMA 3ADPA 3MD9A 3MTDA 3JPWA 4AJHA 1DS6A 2GKSA 5KNDA 4UJ3A 1K63A 2E4VA 2H4HA 1G7TA 3OX3A 3A1SA 2JEOA 2C42A 2X3YA 1GFWA 4COKA 3PX7A 2WJZB 1ZGAA 3EAFA 1ADFA 1WOYA 4IM7A 3LVRE 3MWKA 4V0KA 4YP6A 3GFRA 2YHIB 3ZWXA 1UEXC 4G0OA 1PT5A 4PQGA 3H6HA 1U5AA 2QYOA 4HDKA 4D96A 5K8JB 2WW8A 2F2TA 1EK6A 2XD9A 3SEFA 1HBJA 3BBPA 1THZA 4ZYYA 4ROTA 2OFOA 2ZBQA 3HCDA 4J3JA 1N3YA 5J4VA 4B3RB 3GJZA 3RS8A 2PO7A 4LOLA 5H9VA 1NM5A 2HWUA 2W2KA 3KR9A 4BRZA 1AH2A 3OOSA 4FNAA 3O74A 4POOA 4YY3B 2AR7A 2ZR9A 3I28A 1J0BA 1EPUA 3FHJA 3OI7A 4I9GA 3BTOA 4NE2A 2QRVA 4O2RA 1OFTA 1UPXA 2AMVA 1PJQA 2C5FA 4OA8A 4X63A 3WMEA 4F4UA 1SXQA 3N58A 2BM9A 1LK7A 1KMQA 3H05A 2AZTA 2Z58A 4P53A 4YAUA 2ZYTX 3L1UA 2WQZA 3WK4A 1NWCA 1KTIA 5LMNB 1DI0A 5IH3A 4CMAA 4M60A 2Y93A 3KB6A 4KAAA 3LPMA 4AP5A 4HQFA 5IASA 2DKFA 3TDMA 4URVR 3B7GA 2Z56A 3IPLA 1F4VA 4Y9RA 5A4FS 3UCFA 4WCFB 13PKA 1BN7A 2W4IA 1FS6A 5UKDA 3QG5A 4LXQA 5LCXA 4EVSA 1IHDA 2CLCX 5AW3A 3P1JA 4TL9A 2B69A 3EA0A 3HZHA 3G59A 4F12A 3QY0A 3QWBA 3AR8A 4KXUA 3UEOA 1A76A 4J0GA 3UAGA 1BWPA 2WSSA 4CG2A 4YX9A 3LWBA 1JYEA 2Y92A 4CMIB 1M0SA 3M6AA 3AKZA 3CBQA 3D8SA 4FOTA 5GQSA 3REFA 2Y6UA 2W6IA 4BQFA 4NZPA 4RVOA 4BUJA 4UHKA 4Z4HA 1XQ6A 2WTXA 2A5DA 3BWEA 3SD7A 5CT9A 5BSEA 3V8VA 2NSDA 2O0MA 2F1JA 2ZIXA 1ZKMA 3HPRA 3M8KA 5DISB 5TS3A 3CVUA 1K3FA 2FR1A 2VK1A 3L4SO 3QPVA 1A04A 3VV2A 1PZNA 3SKYA 3AJDA 3BRSA 1CIJA 2WDPA 3PVZA 1BU5A 5E4TA 4HGPA 4HWTA 3RROA 5KTYA 2HRZA 4P4LA 1E5TA 4HNQA 2FAXA 3E9YA 4PSDA 1L1QA 3P52A 5JI3E 2GEFA 2B4YA 2OV6A 4G41A 4ARSA 3F6BX 4LXIA 3AUFA 4M7OA 2XECA 2IUYA 3FYUA 3HXQA 2QMYA 5IKOA 3RSZA 4EPXA 1PCXA 1GTMA 3BQ9A 1ZUHA 4EB6A 4H7FA 4NTZA 1Y82A 3IT2A 2EL7A 3RTBA 3QLVA 3AY0A 3F1KA 3OIFA 4P81A 1ZMBA 5GM1A 2IX3A 4P0PB 3AR9A 2JAHA 2HMTA 2XQJA 2Z43A 2G7ZA 4RW0A 3NHPA 2DH6A 3QRWA 1CUUA 2VUIB 1SBCA 3HYSA 5FLXA 1SU7A 2OBXA 4W8GA 4E4RA 3LIPA 5JSFA 4AWXA 3HK2A 3SHOA 5EP3A 2VYFA 3KB1A 1HZZA 3EXIA 5H70A 4QPPA 4B2YA 2PR2A 5JNUA 3HN7A 1S3SA 4WZZA 3GLSA 4MR9A 5TIIA 4YASA 3R3SA 4JFAA 3P9YA 4L8WB 3N6XA 3RF7A 4F3KA 2EF0A 4YWJA 2JDID 1SVIA 4UXJA 2SNIE 2YYSA 1F9EA 4ZAFA 4B4UA 1G3RA 4F2PA 1ZMRA 1QE5A 2BFBA 3JYOA 5FR1A 1E1MA 2OILA 1N8KA 4BQQA 3RS9A 1GL7A 5IBPA 1BXKA 3R5JA 1E1DA 3E9QA 1HG1A 2QRLA 1OT5A 4HX2A 3OURA 4O25A 3ZCUA 4EJFA 2YWRA 2BEUA 1XEWX 2X0DA 3KLBA 1D0SA 2Q9UA 2BJHA 1MO4A 2E3JA 4D82A 2CHUA 1OLUA 2XUJA 1H4TA 2RG7A 3BE6A 3DBLB 4DC0A 4IIGA 4BUCA 2BH9A 4ZEWA 4KPUB 4MINA 2B2CA 4D9FA 1F4PA 1RYDA 1E2PA 4KR7A 3EZGA 4EARA 4F4HA 4C30A 4ARIA 1MNQA 1MVNA 2X9GA 1D0VA 3PCTA 2DHEA 3BS4A 5K3SA 1ZAYA 4AZWA 4HAOA 1DQPA 4NBKA 1V25A 2YDXA 1QGUB 2O48X 1GYPA 1W49A 5E4FA 4L74A 1DHTA 5KMGB 4JXZA 2BGNA 3ELYA 2IY7A 3Q7QA 4H7PA 4PRLA 5FUBA 3CU5A 4EL5A 4ZT2A 2XUHA 3AINA 4I1OA 1J1IA 1R7RA 4XIGS 4XJXA 1XUOA 2PRJA 3EXAA 1P1KA 4UDOA 4BCDA 4D0SA 4DLPA 2QJRA 2P6UA 3W8FA 5IRCD 1XEAA 5FPYA 3VJLA 3DV0A 4DJEC 1YRLA 2XZTA 1MJ5A 1BMDA 1OTHA 1GXSB 5AXDA 3AHHA 3E48A 4EPVA 3K32A 4G23A 1PZFA 4BVFA 3IEUA 3CUTA 5AI5A 2VP9A 2YN0A 4LHSA 4QWMA 1QK4A 3EVDA 4OMDA 4M83A 2VP3A 1JQ3A 3GGDA 4G5GA 4J1QA 4A0QA 2W22A 1S4QA 4B6PA 4BVJA 3TGLA 2CV1A 4IINA 1ML3A 4IZIA 4KIWA 2GXSA 1YVUA 2IZ5A 2G08A 3E22A 1GITA 4KNVA 2H65A 5TY0A 2V59A 2OXIA 4YV1A 4JSRA 4B5LA 3N0XA 3WWYA 4QXQA 2C2WA 4L51A 1GEGA 1FSGA 5JJBA 5JADA 5DHUA 1CYEA 1YHNA 4EB3A 2LP4Y 3ZW8A 5AOCA 4PLVA 4CT0A 4RCVA 4PM4A 5ER9A 1YASA 2JFWA 1M1UA 4DUZB 1RAAA 1G20E 3IDZA 1TLFA 3KEQA 4LY6A 1EFVB 1CUJA 4GW3A 5F7JA 2NU8A 5JD6A 2DEUA 1AXEA 4EKYA 1QVRA 3N2KB 3C5EA 2QJFA 2VJPA 2QYSA 3GJSA 3ITDA 4OIFA 1SVLA 3DZGA 4YR7A 1RRGA 2RBEA 1JW9B 4NZ9A 1I3LA 3IAM6 3AEYA 3G2OA 2FLVA 4Y6PA 4XUEA 3T54A 1RFGE 1F38A 2LCIA 3FCXA 3OHMA 3VSCA 3BXHA 1FJGB 3KZVA 2WWWA 2PZKA 1LUAA 3TOZA 1NU6A 3FR8A 2I3GA 3Q0EA 4IO1A 5A5GA 1FBTA 1TK9A 1VP3A 1KDVA 3IJEB 4BFLA 1OH6A 5I7FA 2P9YA 1SU6A 1AQYA 2CLFB 5AI0A 3I3OA 1LI7A 1SD2A 3PZRA 1PDVA 1SK9A 2A57A 3G13A 3E9NA 4IDBA 1WVIA 4RH3A 4UD2A 3KETA 4QRDA 4DR5B 5DGIA 2O2GA 1G20A 1BKDR 4KWIA 5BYAA 5AVWA 1A9TA 1A8HA 2J3EA 1RYNA 1ZQ9A 1U94A 4WL0A 3SR0A 3WAGA 1J2JA 3K0FA 2EX1A 5DNUA 1B0PA 3PC8A 3ROFA 2IPNA 1WDWB 2R96A 4EHFA 2QM8A 3HZRA 1SC1A 1T5BA 3SWWA 1G8PA 2CXRA 1Y4SA 1KDTA 3IVMA 4D74A 3GNQA 3EBLA 2HRQA 2ACEA 3I72A 3P2KA 4PEVA 4CQNA 1H8ED 1E7WA 1FRQA 5EQTA 4FXOA 4PXSA 4D4MA 4EPRA 3AVPA 5L7WA 5L8VA 5A6SB 3AETA 3FPGA 3OKAA 5DNDA 4F2GA 2ZDHA 3FB4A 4RENA 4DXDA 3RU3A 2BSXA 1GRCA 1JDNA 1NJ6A 1THGA 1V3VA 4CV2A 1EFDN 1GL3A 1M2KA 1O97D 3H1PA 4NG5A 4C4AA 4BPBA 3NC1C 2X58A 1EDEA 1PNQA 2QXTA 2EJWA 3P9CA 4OHZA 3UXEA 3KEMA 4UM5A 4BMPB 1M5UA 3O8OB 2GXAA 4QXAA 4R40A 5CDFE 2E5LB 1PYDA 4H35A 2ORVA 4OHUA 3FB1A 4TXHA 2V5AA 3AC0A 1DZIA 3FMIA 2CV0A 1CULC 1NSTA 3H4VA 3UMJA 2GRJA 4KVAA 4H2DA 4FJ1A 3I2YX 4BMYA 4CKEB 1PHRA 1G8AA 2E4YA 1EFCA 4EO9A 1PNTA 4XJVA 2B8JA 1QG0A 3RS2A 1D2RA 1GRRA 2QN1A 3K0CC 2C4NA 3MS4A 4BB6A 1Z16A 1VG1A 4AL4A 3COPA 3EIOA 1U02A 2WZQA 4DBVO 1T5OA 4OAOA 4DQXA 3L7CA 2ODQA 1NP6A 1KS2A 1G21E 2G9VA 1V96A 3I8OA 2P41A 5ESRA 4FE7A 1EVLA 4CM7A 2KBFA 3HRKA 1DJPA 4JT2A 4DLSA 2WDZA 4DSOA 4NL4H 4GQIA 5FI1B 1I14A 2B34A 3A8TA 3O2SB 5CDFA 2P79A 5ALJA 5B64A 1J24A 4H0FA 721PA 3H1TA 3EZ9A 4HWOA 1EYZA 4DCTA 2RMKA 5HZMA 2B36A 1EHIA 1K7SN 1YI0A 2OHHA 3NBYC 4PYLA 4F5WA 3S0JA 4ZVRA 1NVGA 1XWWA 4C3OB 5B30A 2GOYA 4KJZA 4PZDA 4LZJA 4BN5A 1E2JA 3F7OA 3EY4A 2QY6A 3A2LA 4QG3A 2QTNA 4W6QA 2X14A 1QU2A 3IAS1 2D06A 2E7ZA 2YL2A 5BW5A 4JLPA 1D07A 5I7OA 2FMHA 1PQYA 3WYBA 3BSFA 4DHEA 3ZBQA 3UFXB 4DDMA 2FP4B 2TECE 3GD7A 3AW9A 2ZIFA 4D9EA 2CD9A 5JSYA 2ASEA 4BP1A 2CXHA 2JGIA 1XQVA 1GU7A 3G8BA 3WV4A 2XOEA 2HSWA 3P20A 5TXGA 1KEZA 5CW2A 4F46A 4D8UA 2ALJA 4M6WB 4MQUA 2YBEA 3ED5A 2QT0A 4G2TA 3JQBA 3FVTA 1EJ0A 5AI8A 5AJWA 4DNPA 4YS6A 3FLMA 4Q3CA 5KJEA 1P4AA 2PX0A 1T5IA 3UHAA 2C2KA 3QEMB 4GKBA 3RBZA 3WLNA 2JI6A 3CZMA 1Z07A 1Z7YA 5I9BA 5AUNB 2MOKA 1H6BA 3V7UA 4D0GA 1SJ9A 2IA5A 2YOHA 4RM3A 3QSGA 4J6FA 2P65A 1ZVQA 4GKJB 1MB0A 1NLYA 1NJSA 1UJMA 2O3QA 3BGDA 1J7JA 1TC1A 2C54A 4JYCA 2G1KA 4RLSA 5J4KA 3T9EA 3COWA 1IPHA 1Z34A 2H85A 3L18A 4IOLA 4N0DA 3WGHA 4C2TA 2QJOA 1QDUA 2CK3A 4H4DA 1QCDA 2IHJA 4ZJZA 4YMWA 1KS9A 2VHTA 2WHYA 3HUDA 5EHQA 4RTNA 1TEZA 2AMFA 3NATA 1OH7A 4XLLA 4I6GA 4E2WA 4P8RA 3ONFA 1M2HA 2EJVA 1FRZA 1OWOA 5E6SA 1JIIA 3Q8LA 1W1WA 3OKFA 2JRCA 1W1UA 3DO5A 3FCOA 2XUOA 1G5HA 3RUEA 3DBHB 1LDBA 3UC9A 3ZUGA 2WKPA 3HSKA 1RYBA 3EEOA 3EPLA 2OKCA 1Z17A 1XNRB 4K05A 4YJ2B 1J23A 3G0IA 2A5JA 5LA6A 1L7PA 3RBAA 5JAPA 4HUQA 3RBVA 3A3OA 1IATA 4Y1EA 2JFPA 1I6MA 5EXTA 1UEJA 4R8RA 2A78A 2C9YA 3CN7A 1TZKA 2VJAA 3AV0B 3KJNA 3VGPA 2JB9A 4BQEA 1SBYA 3PGA1 2DFVA 3O2NA 4Y9DA 1QO0D 1QJCA 2OXEA 3OMWA 1I0ZA 1VPVA 2A1TS 2OAP1 4RGVA 3VX3A 1L7AA 5PGMA 3HVHA 1U0HC 3DBRB 2I7DA 4LNHA 3NVMB 2NUTA 4CLHA 1KI8A 5ICSA 2FDCA 1N5KA 2PJRA 2OVBA 4PLPA 1P74A 2IHUA 4QUJA 1AKRA 1E0JA 4OLJA 4HYQA 5DCLA 3MMSA 2EWMA 5JZVA 1QUEA 4WXMA 1GUAA 3VC3A 2I2CA 4PO9A 2Y8EA 1M76A 1ULAA 4QGHA 4KR3A 2PZ8A 1SQGA 3ZGOA 4YRZA 4LDRA 2IEAA 2EZ8A 4GI5A 4X1IA 3K4PA 5E7MA 4ZMBA 1UK7A 1UPFA 4L73A 3TMAA 4JLWA 2XMSA 3R5SA 3U4HA 3ZLTA 2K7FA 2ZM5A 4M88A 1MHTA 4E13A 1TPYA 1C7ZA 1Z6TA 4Q1AA 3DHEA 2C29D 3GFGA 3HA5A 2GSDA 2Q5LA 2M1XA 4NJOA 5D8DA 3WL3A 1SQ0A 3TM4A 1WJGA 2H59A 2A0YA 3NHZA 2J6IA 3L0OA 3LF2A 1C9JA 1S8OA 3BG5A 1K0FA 4M22A 2ZRCA 3K30A 1DJQA 1N1MA 1CZNA 5G0SA 3F6YA 3NV9A 2JF0A 5EY5B 5B6JA 4ZRMA 5I7RA 1HURA 2AUTA 2YJNA 4TL7A 2ONKA 4JP5A 1ZH4A 3BMNA 4NG4A 3JZFA 1AUPA 1PFYA 1VDZA 2ZSHA 4DTCA 1IQPA 2AHRA 4Q03A 1YUMA 1TCVA 4LY9A 1GAXA 4V02A 4ZCIA 3IAUA 4J43A 3TAXA 5JQGB 4XOUA 4WFKA 5KAMA 5YASA 2ASVA 5FKJA 4EUFA 4CEIB 3DHWC 3R5KA 3F6SA 3T3PB 2ACWA 3LUDA 3D6VA 2H8GA 2OCIA 2ZLBA 3CLKA 3H2ZA 1IBRA 2HA5A 1L8OA 4QUAA 3W34A 4MGEA 3R9WA 4MOWA 2QGFA 4UXIA 1CZLA 1WSWA 1PGOA 1F1JA 2NZ2A 2WUFA 3LYUA 5J2TF 1AQIA 3PQCA 4DXA