3QP9A

The structure of a c2-type ketoreductase from a modular polyketide synthase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
498
structure length
470
Chain Sequence
VQDSWRYRIDWKRLAVAGLSGRWLVVVPEDRSAEAAPVLAALSGAGADPVQLDVSPLGDRQRLAATLGEALAAAGGAVDGVLSLLAWDESAHPGHPAPFTRGTGATLTLVQALEDAGVAAPLWCVTHGAVSVGRADHVTSPAQAMVWGMGRVAALEHPERWGGLIDLPSDADRAALDRMTTVLAGGTGEDQVAVRASGLLARRLVRASLGTASPWWQADGTVLVTGAEEPAAAEAARRLARDGAGHLLLHTTPSGLAGLVAELADLGATATVVTCDLTDAEAAARLLAGVSDAHPLSAVLHLPPTVDSEPLAATDADALARVVTAKATAALHLDRLLREAARPPVLVLFSSVAAIWGGAGQGAYAAGTAFLDALAGQHRADGPTVTSVAWSPWEGSRVTEGATGERLRRLGLRPLAPATALTALDTALGHGDTAVTIADVDWSSFAPGFTTARPGTLLADLPEARRALDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of c2-type ketoreductases from modular polyketide synthases.
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Oxidoreductase
molecule keywords Type I polyketide synthase PikAII
total genus 160
structure length 470
sequence length 498
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08659 KR KR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qp9A00
1VPDA 2BHLA 2C2YA 3JD3A 5EQFA 6ADHA 3JTMA 4U0JA 1R4MA 3T7CA 3PZBA 5GZ3A 3L4BC 2QX7A 5C37A 4ZQEA 3HQ4O 2JFFA 3PTZA 4B8WA 1M6WA 3JQBA 4GQAA 1LXCA 3C1AA 2HCTA 3DWFA 4TRMA 3UN1A 5JW6A 1LRJA 1EE2A 1PQPA 1QR6A 5G0WA 4GH5A 3GPDG 4JIGA 4OAQA 4CL8A 1ADGA 4CLHA 2D8AA 1KIFA 4EUEA 4OXNA 2V6MA 3BMCB 4QFCA 1M76A 1YJQA 3WJAA 4EDFA 4BNHA 2YJZA 2DKNA 2EHDA 2GLXA 2PD3A 4QO7A 4MIOA 4I5GA 1I30A 5ES3A 3DMTA 2VHWA 3ZU3A 2O23A 4Z9XA 3RC9A 2P91A 4UUOA 4E31A 3H2SA 1Y7TA 3OA0A 5EL0A 2Y0EA 1EVYA 1E7YA 3EY4A 3JQ7B 1JDJA 5B37A 1I24A 3H7AA 5KNLA 2P5UA 2HDHA 1NPTO 4YT8A 2GD1O 3BMOB 1U4SA 1K6JA 3SC6A 2GN6A 3GAZA 5JDCC 3DTYA 5A04A 3EK2A 2IXAA 4L9RA 2ZIZA 1PJLA 4CQMA 3ONEA 4IXWA 5EINA 3OICA 3N74A 2DM6A 1MC4A 2X22A 1VL0A 4FFLA 4ZQBA 4H3VA 3NT2A 4L76A 4CUJA 2Q49A 2BFAA 1M6HA 3C7CB 4AJ1A 2DUWA 1YS4A 3DL2A 3KV3O 4RZHA 4E5KA 4UREA 5CEFA 4R68A 2FR8A 3M1AA 3HJAA 1SOVA 2PZMA 1ZK4A 4RVHA 1DDOA 3OBBA 3PHJA 3V8BA 3DOOA 3ZDFA 1GU7A 5IN4A 3B6ZA 3K96A 4BNJA 2HSDA 5THKA 3ZHXA 4XYLA 3H9UA 2CDBA 4IMRA 1M66A 1I2BA 4BO0A 1NX6A 3VC7A 3A9WA 1Y9EA 3KZVA 5H81A 1VKNA 2PZKA 3RBZA 2E4AA 4M1QA 1X1EA 4BO9A 4LGVA 3NAQA 3DDNA 2CD9A 1A71A 1VJ0A 2GZ1A 3N7UA 4GLLA 2DPGA 5DZSA 4XDYA 1KEWA 1EFKA 2BI7A 2X6TA 4YAJA 2XXJA 3GAFA 3G0OA 2DTEA 3QVOA 3W6ZA 4F3YA 1AXGA 1DHRA 3MEQA 4O59O 3GRPA 2POQX 3AWDA 3VPGA 1NHWA 2NQTA 2W90A 4MVJE 5U1PA 5AXBA 3ULKA 4EI2A 1SOWA 3B1KA 4G65A 2J3JA 2FY8A 4P8RA 4NHEA 4BVAA 1U9JA 4R4JA 4R5HA 2B4QA 3AOEC 2Q4EA 3PPIA 3AUTA 3W8DA 4DPMA 3RUEA 4MVJA 2C29D 3UH1A 3KHUA 1OFGA 4ZRNA 2Q1WA 3ZHBA 1E3EA 3WJ7A 4CM8B 4YAKA 5IZCA 4AJ2A 5JYEA 2BGKA 2QRJA 5JAQA 3IJPA 4FFMA 4LISA 2OGUA 5G0TA 3AUAA 5JO9A 4DL9A 2OL4A 2O3SA 3UKOA 1GYPA 2Q50A 5IZ4A 3GRKA 4GWKA 5IAAA 2XPCA 4R9RA 4IM7A 4TSKA 4J6FA 2O48X 3O4RA 3E9QA 4CLOA 4NI5A 4WCFA 3ZV5A 1YOVB 1MFZA 3LC2O 3UCXA 3UOGA 3K6JA 2DBRA 1HLDA 4JJIA 4L74A 1U8XX 3PIIA 4NBWA 4I9NA 3UVEA 1XYGA 5L7YA 4H16A 1EQ2A 2YHIB 1PSDA 2C07A 4DA9A 1PJ3A 2DU8A 3W8FA 3WGOA 3ZU2A 5F1PA 1F12A 3WFJA 3BZUA 1NNUA 5HA5A 2OZPA 3E8XA 4RDIA 2O3UA 4Z9YA 4DBZA 1DC4A 4XQ9A 4EUFA 2BKAA 2P9GA 1B7GO 2H1SA 1JWBB 3L6DA 2FZWA 4E32A 2Y0CA 3RFVA 2EEZA 3B1FA 3WQSB 1HLPA 2EW8A 3KYCB 1X7HA 5FEUA 3JQ9A 1LSOA 4OJNA 3OHSX 2W2KB 3ASVA 2HKIA 1ARZA 1DB3A 2VUUA 3FCOA 4CODB 3I23A 1BW9B 4R01A 1LA2A 1ML3A 5AQ1A 1CDOA 2VYNA 2X5KO 1JA9A 1ZK1A 1Y81A 1ENOA 2VCYA 3AY3A 3C7AA 4EBFA 1KVSA 1GL3A 2V65A 2I3AA 3DZFA 1V0JA 4HFMA 4NBRA 3VPFA 2IZZA 4DPKA 5L40A 4W99A 3GEDA 3ZNNA 5L4LA 3K5PA 3DBRA 3HN2A 4MIEA 3TZ6A 5BSGA 3U62A 1GZ3A 2JFHA 2Q1TA 2VWHA 1VSVA 3Q11A 2ZB7A 1O5IA 1I3LA 1VM6A 3DEYX 4BGUA 2YQ5A 4LMPA 1YL5A 2PGJA 3EYWA 4UAGA 4TWRA 1WP4A 1AE1A 2OO5A 3ZU4A 4BO2A 1Y6JA 2DQ4A 2C20A 3KTDA 4J49A 4NPCA 1LC0A 4FJ0A 4H7PA 2VHVA 3EZLA 5A5EA 1F06A 4E5NA 4DLLA 1A4IA 1QXSA 3H3FA 1IHXA 2C0CA 5T8KC 5L95A 4BKQA 4F6LA 1NFQA 1E3SA 1D1TA 1E3WB 3GN1A 4ZU3A 1PJQA 4W6ZA 5LDGA 4RL6A 2VOJA 3QVTA 4YRBA 1EDOA 1U1IA 5FF9A 1A5ZA 6LDHA 2IEDA 3QJ5A 4RF3A 2Z1MA 1LSSA 3OQ6A 1DAPA 3JYOA 3ZZNA 4XWYA 2H6EA 4B3JA 2FOIA 1E1LA 5F1KA 2E49A 1OC4A 5JSFA 2DLDA 1PJCA 1MG5A 1GCUA 3EAGA 3IMFA 2CVQA 2VWGA 3WGGA 4J4TA 3EDMA 2OP0A 3E5RA 3KSZO 4JBHA 3NRCA 2JHFA 4Q3AA 4QXMA 4BGIA 1NHGA 4OOEA 3KEOA 1A7KA 4FW8A 1NFFA 3WQQA 4MP6A 1HZZA 3BMNB 4OKIA 1U3WA 4XIJA 1Z73A 4YJHB 3QIVA 3L07A 3TZQA 1J0XO 4YVFA 2P4QA 2FR1A 1UAYA 1ID1A 3LZ6A 4Q3DA 3OQBA 2V6FA 4YTEA 3GDOA 4KDFA 3JQGB 3QW2A 1YOVA 4YQZA 3UXYA 3WXBA 3E9MA 2CFCA 1QV6A 4BNIA 3LF1A 4DLBA 3KRTA 3UHAA 3DAPA 2XAAA 3JQAA 3RQSA 2C82A 1P44A 2NQ8A 1ISMA 4PCVA 2A92A 5EESA 1ZXLA 2DBVO 3LU1A 2VWQA 4E3ZA 5C3MA 1GYRA 3QQPA 3L4SO 3LC1O 4AVYA 2O7QA 1LSJA 2GN9A 4J9UE 4CQMB 3ANNA 2IYPA 4J2OA 3RBVA 1HYGA 5TJ9A 3L9WA 1W0CA 1ZJYA 4AJJA 4E5MA 1XELA 2H5LA 4I9UA 2B5WA 2EKLA 2X86A 2PNFA 3RD5A 3QWFA 5G0SA 4IBOA 2JD2A 1R15A 1UDCA 1N1EA 3D3WB 3PEFA 1BGVA 5DT9A 2PFGA 4NJMA 1ZMOA 3S2IA 4JNKA 4Y98A 1ENZA 2GRAA 1TT7A 1D8AA 1EUCA 1CETA 1BXGA 3G79A 1UP4A 1U28A 4QO8A 1B8PA 1HDCA 3IOYA 3ABIA 2P9CA 2G17A 2X5OA 3WYCA 5I9MA 4ZQGA 1E92A 4PG4A 4TKLA 3ROPA 4I08A 3BMQA 5DF1A 2Q45A 3BYZA 3LC7O 2AQIA 3SJ7A 3ZHYA 2NVBA 1QYCA 3GMDA 4NFSA 5CDSA 1Q7CA 3VH3A 3PXXA 1JAYA 4OM8A 4IIVA 2W98A 3RVDA 1EVZA 1ZVMA 4BB6A 4HFJA 4EYEA 3DMYA 3N58A 3LT4A 3MJEA 1HETA 3NDRA 1TXGA 3HDYA 4OOFA 4XR4A 3RASA 3CZRA 5A4DA 1C1DA 4BNLA 2EJVA 3L0DA 3KBOA 4JCOA 3ZWNA 4AJNA 3ZW9A 3WTCA 1LLUA 4B7XA 2WD7A 4C7JA 4BMVA 3DZBA 1EUDA 3RKRA 3UF0A 1OOEA 4BMNA 2O4UX 2BGLA 4RPHA 2NTVA 3G1UA 1E7MA 1YONA 5ILGA 3GNTA 2VT2A 3DZKA 1CRWG 3AY7A 1R4MB 4LN1A 4IGFA 1ZO8A 4FFRA 3ROMA 2I65A 3B1JA 4NQZA 1PL7A 4XEHA 4MJLA 5A9TA 1I10A 4MVJF 4IZIA 4HADA 5EMHA 2DBQA 4FGSA 1JKIA 3TRIA 4D43A 4DMLA 2V6GA 5EIOA 4KTVE 1X0XA 4QTZA 4Q3NA 4WUVA 1HE5A 1V9LA 3C7DB 3T4EA 4URFA 4XYGA 1JAXA 1FDUA 2I99A 4H15A 4KWIA 1ADFA 4INAA 2OBNA 4O0LA 3I52A 4WKGA 3ITDA 1R4NB 2IZ1A 4J0FA 1ZFNA 3PQDA 1EZ4A 1KVUA 1N7GA 2AMFA 5HM8A 4IDGA 3Q2IA 3BXXA 3ZV6A 4FBGA 2Y05A 3GH3A 3HSKA 2HO5A 5MDHA 4BO8A 1V8BA 2PZLA 2ZYAA 1HWYA 2VRBA 3L77A 2AA3A 2ZJ0A 4LRSB 1C0PA 1HDZA 5IXSA 4KUGA 2NLOA 1PS0A 5IF3A 4XYBA 2JL1A 4PG7A 4OIMA 4PLGA 3K30A 4KWHA 1E5QA 2HMTA 3HG7A 4MVJM 3Q9UA 4J90A 4II2A 4PIVA 1LLQA 2CF5A 2GCGA 1OMOA 2RH8A 1ISIA 3JQAB 3NGXA 4RLSA 3WG9A 5A9SA 2C5EA 1JWAB 3JQGA 2Y1EA 2VNAA 2EF1A 1AHIA 1I3MA 1TT5A 1XEAA 2CDAA 1HEUA 5JC1A 3KUXA 2O3JA 1PGJA 2DUUA 4PZEA 4J16A 5G2OA 4EUHA 1QYXA 3OETA 3R0IA 2GO1A 4CR8A 1UP6A 2X9GA 1Q7GA 3FWNA 5KJCA 2I5PO 4O6VA 5CFZA 5JAIA 1CIVA 4R3WA 4MIYA 1B15A 1GQ2A 4CMIB 3GFBA 1SZJG 1WMBA 1GEEA 1GZ6A 3E82A 3WSVA 1NR7A 1AGNA 3BHIA 4Q39A 1KETA 3HDJA 2ZTMA 3EMKA 2JJYA 5AXCA 2GUGA 3GVCA 3AOEA 3FF4A 4IJKA 3ZWAA 1VI2A 1O6ZA 4NBTA 2W2LD 1A27A 3TF5A 4N7RA 2DPHA 4CM1A 1SB8A 3CEAA 2FHSA 3PI7A 1IPEA 3GLQA 4NMHA 3JD4A 3C85A 3HDHA 3PWKA 1LDGA 2WD8A 1H6CA 4OQZA 4BO1A 5A9RA 1RM0A 3VPHA 4ALJA 4RVGA 4ZQFA 1NR1A 4GWGA 3RAJA 3ON5A 5BNIA 3ADOA 1SO8A 4GMFA 1JVBA 4BNKA 5EERA 3EUWA 5KIAA 5GZ6A 5JMWA 2O2SA 3FTPA 1Y5MA 1FK8A 1K6XA 5KJ6A 3AFMA 1R16A 3UCFA 4RF5A 4UUMA 3VH1A 1KY5A 2AG5A 2HU2A 3RC1A 3ROKA 4R1NA 3P7MA 4CR6A 3VVCA 1FJHA 1T26A 1YXMA 5CG1A 1GV1A 3OJ0A 4WPGA 1X13A 1C1XB 3ZW8A 4AJEA 5G0VA 3F5QA 3TL2A 1BXZA 2Y66A 1C1DB 4XYEA 3ZWYA 3TZKA 1LRKA 4P4NA 3OJEA 1X7GA 1DJNA 4BGVA 5K9ZA 3AU9A 3UUWA 5LC1A 2ZTLA 1XKQA 3JQ8B 4AFNA 4ND5A 3WIDA 4CMJA 3WDSA 1ZK2A 2D2IA 2PY6A 3HFGA 3MJTA 1PX0A 3PDJA 3U4IA 2GDZA 4WASA 1T1SA 3NT4A 5HS6A 3TFQA 1N2SA 1WW8A 2PTGA 1DFHA 2FPIA 1MC5A 3INGA 1RJWA 3HHPA 1ZIDA 3P5SA 2DT5A 3L9XA 5DULA 5JPIA 2WYWA 2AG8A 2ZYGA 1BVRA 3I9NA 5A1TA 5BSHA 1P45A 3FD8A 1X1TA 4Z0HO 2VTEA 3GNQA 1HYEA 4CMIA 1GEGA 4KOAA 1Q0LA 3CZMA 4M8SA 1YVEI 4R41A 1I2CA 4N18A 4MKRA 2HMSA 1R6DA 1NAHA 4RVDA 4ZN6A 4XJTA 1LNQA 4NG5A 3WLEA 3NV9A 1XSEA 2PKQO 4HFNA 1WWKA 4Z6KA 4B8ZA 1YE3A 2J3HA 3GHHA 1CF2O 2NUAA 1NAIA 4BNMA 4CM9A 1RM5A 4R69A 2PH3A 5FI5A 3DBHB 3DONA 1I5RA 1O0SA 1DPGA 2AQHA 2JD1A 4FQ8A 4GAEA 1GD1O 1TB4A 4KUHA 4K6CA 3CSDA 3U4DA 1EVJA 4PZDA 5JXWA 4J1QA 4KTTE 4DYVA 1GQYA 3RBXA 3PJDA 4B4WA 4R1SA 2VRCA 4CV1A 1H0KA 1ZNQO 1ORRA 1UZLA 4F46A 2CSUA 2DTDA 3JCZA 4Y67A 1LRLA 1TA4A 1FDVA 1E1MA 2Q1UA 4W9NC 3KLPX 2QZZA 3G1TA 2O3RA 1F0YA 1O9BA 5JMPA 1T4BA 3E9NA 4WE3A 5HRUA 3AU8A 3MOIA 4FJ1A 1VJ1A 1DJQA 2DC1A 4CMBA 3RI3A 3IL2A 1SCUA 4NFHA 2VN8A 1E7QA 4B79A 3QSGA 2I66A 3GQVA 3KO8A 3GZNA 3V1TC 4LSWA 3ASUA 4E2WA 3S8MA 4PLYA 1TLTA 2VYVD 3QRWA 4YR9A 2B0JA 4DXHA 3IAHA 4YAGA 5IG2A 2C7GA 5EN4A 1OAAA 3QHAA 4AJKA 4W4TA 4D46A 1PZEA 3B70A 5A9SB 5JCJD 2UYYA 2HUNA 2AW5A 4Z3DA 2F1KA 2I9PA 3CIFA 2B69A 1EDZA 4CM4B 4RDHA 4R1UA 4D3DA 2PV7A 1DIGA 2DFDA 3VAZA 3T4XA 4DWVA 4Y8VA 3IIEA 1UXIA 3NJ4A 4XGNA 3WNVA 1XG5A 2IXBA 3FNHA 4LW8A 3UAGA 1CJCA 3A14A 4A5OA 1H6DA 1AN9A 4NU6A 2D0IA 4CLXA 3V2HA 2C5AA 3LQFA 1RPNA 2FRDA 4AJLA 1R4NA 3L6OO 3FNFA 3FBTA 1H9AA 5TT0A 5DBIA 3PGXA 4YT4A 4WCDA 3UICA 1LBEA 1NASA 1IULA 4ITUA 2FPPA 5MGBA 3LF2A 1Y8RA 4XIYA 1M75A 1NQOA 3KM0A 3PP8A 3WYBA 5I9NA 4P22A 4GX5A 1Y5RA 4WNIA 4FC7A 4J1SA 3JD0A 4NK4A 4LRTB 4PLWA 4U8GA 4ZQHA 2QRLA 4DIFA 3JQDA 2VQ3A 4B7CA 1C0KA 1P33A 4J7UA 4HWKA 1A4UA 4YJFB 3NT5A 4GSKA 1QP8A 2WJPA 4I5FA 3SJUA 4AJHA 4I5EA 3VZPA 2EERA 3D4NA 3DOCA 3A06A 3E48A 3FSRA 3S2FA 1P0FA 2VZ0A 1I33A 1YQGA 3GVXA 2ZK7A 1ZEJA 2BH9A 3AY6A 4WJZA 3ZWWA 3MOGA 5KVSA 3JQAD 4QSMA 4NJMB 1TEHA 3G3EA 2QZ9A 1VSUA 1JLLA 4WEOA 3GVHA 4CLDA 4AJ4A 1TVEA 5COAA 1YO6A 4BNXA 3C1TA 1BXKA 3GGOA 4UULA 5TRTA 4D3FA 4A73A 1LDMA 2X9VA 1H94A 1E7RA 3AK4A 3OEYA 4FR5A 1PJSA 2ZB8A 1UXHA 1WZIA 2JD0A 3AI3A 4PRLA 4NBUA 4PG8A 1P1HA 4CV0A 1EEHA 4WLVA 3ADPA 1DBVO 4XR9A 3KLMX 5LDHA 1IYZA 1J5PA 2YV3A 4CJXA 2NNLD 3TSCA 3I9JA 9LDTA 2G1UA 1ADBA 2WSBA 4EJ6A 3GVIA 2EV9A 4AG3A 3HNPA 1ONOA 3PHGA 1XIVA 3H3JA 4CLOB 1KY4A 8LDHA 1WPQA 3GG9A 4YRAA 4OGWA 5EPOA 1K5HA 3ITKA 1EFLA 3INTA 1PTJA 3AM5A 1UP7A 1LUAA 3CPSA 3VPXA 3IJRA 4E0BA 5L53A 3UW3A 4EGFA 5JAMA 3VTFA 5THQA 4J1TA 3WFIA 4I1IA 3AOGA 8ADHA 3ETDA 4TRNA 1YWGO 3HUDA 3M6IA 3FI9A 2WMDA 5C7IO 1E3LA 1XGKA 4B4VA 1H5QA 3BTOA 4GPD1 2OXIA 1SEVA 5IXYA 1UR5A 1LX6A 2WM3A 4NZ9A 4FPXA 4P4GA 4DC1A 1IUKA 3H9GA 4ROSA 4RQTA 5CDTA 2NVUA 4LVUA 1DC5A 2J5KA 2PD6A 3SX2A 4FFOA 3H9JA 5B4UA 1P31A 1ZSVA 4WECA 3PWSA 3NTQA 2A9FA 4BNGA 4RZIA 1YB1A 1K89A 3L4BA 4CQLB 3RJ5A 2I67A 3H2ZA 2C7VA 3F5SA 2E37A 4BKPA 1T2FA 4IQGA 2P5YA 5JCJA 1WNTA 1GTMA 1IY8A 1R37A 4K26A 1P77A 4BL5A 4D79A 1E6WA 2UUPA 3K73O 4U5QA 3MJ4A 1BVUA 1FDTA 1I32A 3EC7A 1LI4A 4R3NA 4U0KA 1DC3A 3DO5A 1PU2A 2E48A 3U5TA 3JQ7A 4ND2A 1G0OA 1ISGA 1NXQA 1YRLA 1GADO 4BUCA 1I8TA 3IKTA 2AE1A 2JAHA 1B8UA 3R1IA 4JGBA 5IDQA 1JU9A 1BG6A 2YHUA 3HADA 5TC4A 3T7EA 3BTVA 4GMGA 1YH3A 3WGHA 4E2YA 3IP3A 2Q2QA 5DP2A 4Y9DA 4D0RA 1FMCA 2VT3A 3BHJA 3TJRA 1Z74A 5L7TA 3PQEA 1NVMB 4JJGA 1XA0A 3DMTC 5K0ZA 3H65A 4L0QA 1B26A 1IL0A 4KUEA 4DC0A 1NWCA 5KKAA 4Y6PA 2VRCD 3MWDB 4IDEA 2CY0A 3E1KA 1YJ8A 1BW9A 4JBIA 4J91A 4N5NA 3JQCA 2ZCVA 1F17A 5GY7A 4R9SA 1HTBA 3HB4X 4UUNA 1QLHA 2D59A 4DQUA 1FF9A 1PS9A 4IXTA 4WCFB 5KCZA 4BKRA 2QQ5A 4RVUA 3LK7A 4Y6RA 2A4KA 3RUAA 4JP3A 3HDQA 2D5CA 3NTOA 1H6BA 4EW6A 2LDBA 1OBFO 1AUPA 4C7KA 3K9QO 1ZK3A 1YBAA 4PVCA 3NYWA 1DIAA 3ROQA 3KXDA 2B4RO 3SBOA 1NTOA 5H82A 1S7CA 2YZ7A 3BMQB 1XDWA 3LYLA 2B36A 3H5AA 3KYDA 1L7EA 3UCEA 1GFSA 4IS3A 3VTZA 2EGGA 2ZJ1A 4BMSA 4IQ0A 5DP1A 2I76A 2WWRA 4CM8A 5A3JA 2OMEA 3VKUA 1QLJA 2Q2VA 5A03A 4HV4A 2JCVA 4YJDA 4ALKA 1PR3A 1U8FO 4IZHA 1NM5A 4QFDA 2HMVA 2CUKA 2YFHA 1Z7BA 1ENYA 1PGOA 1C3VA 2PGLA 3LLVA 1EMDA 2Y93A 5IFLA 2EXXA 1MGOA 1T2CA 4CV3A 4HNHA 1P74A 2OP1A 3RSHA 4YA6A 2R00A 3DB2A 3NJ8A 1K6IA 2H9IA 5IN5A 3WGZA 4A26A 4TVBA 1A9YA 3FN4A 4W7HA 5CHEA 5KVQA 2PA3A 5A02A 4EZBA 4L4RA 2XOXA 1NWHA 3JD1A 3EVNA 4B7UA 2GZ3A 2C2XA 4MVJD 3GFGA 1RYEA 3BIOA 1PL6A 5JDIA 3FNEA 1GQQA 3IP1A 1DIBA 4WCFC 1O94A 1L7DA 2NVWA 3GZNB 3BTUA 3JQFC 3LVFO 4CMEA 2BGMA 2FMUA 4E5YA 5CDGA 3KVOA 4E30A 1T2DA 1CQJA 4R54A 4BO6A 3MJSA 2Y99A 4PLPA 4ND4A 5TT1A 2X0RA 1QYDA 1GDHA 3OIGA 4BNFA 3VH4A 4WEQA 2BELA 4R1TA 3SEFA 1R0KA 4MVJG 1N9GB 5IDXA 4G81A 3I9OA 4UEKA 1NYTA 3JQBC 3DBLB 1E7SA 1PZGA 4HNGA 5JLAA 2UAGA 5LCXA 1GZ4A 4FS3A 1CERA 1NQ5A 1B14A 3PYMA 2GYYA 5G4KA 3JQ9C 2OOSA 4RO0A 3ZNPA 4EJ0A 5JY1A 1T4DA 1IB6A 1UAGA 2YY7A 4GVXA 3SC4A 1MA0A 3LT0A 3C3XA 1OZAA 4FOSA 1N7HA 1O95A 3PHIA 2SCUA 1WXDA 5T67A 4BNTA 3PJEA 4BV8A 4CUZA 3RUHA 1TT5B 3RUCA 2WD7B 2B37A 2BFPA 1YQDA 2FSVA 3AW9A 5L9AA 2H63A 1YBMA 3OEWA 1MXHA 2GERA 3CMMA 1YGYA 2A35A 3WICA 3IQDB 1DIRA 4IJUA 4UVEA 4BNZA 1PQUA 5KJEA 2BFMA 3JYQA 4WLOA 3RIHA 5EQDA 1E1NA 4RLHA 2FP4A 4CQMD 5CDUA 3WTBA 4BQPA 5KKCA 4CQLA 3JYPA 4I5DA 1C1XA 5T8KA 1RKXA 1LQUA 4RORA 5TIIA 4U6QA 1LC3A 2OFPA 1F8FA 1SPXA 3DAFA 1HSOA 3H6KA 3PYLA 4RPKA 4DGSA 4OO3A 3WSWA 1PGPA 3DAGA 3CTMA 3F1KA 4TKMA 4YAEA 1YB5A 1P1RA 5L45A 5FWNA 3I6IA 1VLLA 4DBVO 4OH1A 2OUIA 4UUPA 2EW2A 2O50A 2B4TO 2RCYA 4XD2A 1E3IA 4ILKA 3WWYA 3GK3A 3GNSA 4ZRMA 1XU7A 1HRDA 4Q3BA 1LQTA 3AM3A 2W8ZA 1ZBQA 5B4TA 2CNBA 4YDRA 1IZ0A 1H2BA 2GGSA 1JQBA 2PH5A 1C14A 4RVFA 1MB4A 4J9VA 4CV2A 5G4KB 1KOLA 3EW7A 3FHLA 4LVCA 2FSSA 1VRWA 4OKNA 1X14A 2Q2WA 2EP5A 4PLCA 2DAPA 1O8CA 1PS8A 1IHYA 2VHXA 2ILTA 4DRYA 5TJHA 5TSDA 3SLKA 4YQYA 3TPCA 5IJZA 1WZEA 5KOIA 1GV0A 4EEXA 1ADCA 2FPGA 4ND1A 4U6SA 1MFPA 2G5CA 1QG6A 5L4NA 3U09A 3X2FA 1Y8QB 4ID9A 2YV1A 1K3TA 1B3BA 2TMGA 2RAFA 4OMUA 1EVIA 1W6UA 4PFJA 1IZ9A 3M1LA 4PRKA 3EZYA 3VHRA 2Y1DA 1UZMA 1DHTA 4G2NA 2PZJA 5AXDA 3WGQA 3QVSA 3JV7A 3NDIA 5JC8A 3OIFA 3GA0A 5AOVA 4XGIA 4DUPA 3GN2A 2TMDA 1DRUA 4ZD6A 3RC7A 4K28A 4ALLA 1PIWA 1RYDA 4IMPA 3EVTA 3ZU5A 2Q3EA 5B12A 4HXYA 3QA9A 2NTNA 3A1NA 3Q6IA 3RU9A 4Q3EA 3GDGA 5TGDA 3PJGA 3SVTA 1U5AA 1DLIA 4ESOA 5JE8A 2IZ0A 1I0ZA 1Y8RB 2QG4A 4OXYA 5A05A 1J49A 1ULSA 1P0CA 5CAEA 4WLNA 1H6AA 3OH8A 1RWBA 3HWRA 4E13A 1EQUA 4FOOA 1PWZA 4J4HA 3H9QA 3I1JA 2LDXA 3MJCA 3VKVA 2J8ZA 4JBGA 4XZ3A 3ZWBA 1VL8A 2B5VA 1R0LA 1YDWA 4B3IA 1QMGA 2ZATA 2JAPA 1ONNA 4S3MA 1SMKA 3DBHA 1JKJA 4YEDA 3K92A 3MWEB 3E6AA 1MUUA 1BTOA 3ZWCA 4AL4A 1D4FA 4CLRB 4GX2A 5JO0A 1U4OA 1U7HA 3R3SA 4MINA 1U2GA 1UZNA 2GPTA 3JSAA 2NVUB 5CPFA 1R66A 5CEJA 3I9MA 2VUSA 4L4XA 1P1JA 4JQCA 1JN0A 5JY6A 2D1YA 1KVQA 3ICCA 4MPDA 3WGTA 1T25A 3WX0A 1Z45A 4HKTA 1F8GA 5ER6A 2R00C 1AHHA 1V3TA 4DQXA 5J23A 3OJFA 2AQ8A 3GUCA 4RPGA 2AEMA 4A10A 1X0VA 2HK9A 4CMGA 3H8VA 2NTJA 4IIUA 4TROA 4YJHA 1T1RA 2J5RA 4O1MA 2QW8A 5DBFA 3RJ9A 4BV9A 4FJ2A 3IDSA 1R0SA 4D45A 4WLEA 4M87A 2WYVA 4M54A 2IE0A 2WDZA 2HMUA 3GR6A 4WK6A 4Z9FA 1ZUD1 4QECA 4BO7A 3PWZA 4E33A 2G0TA 3ZWOA 2X5JO 3O38A 2NV6A 4YRDA 4BNYA 2PD4A 4N5MA 3PDUA 2X1HA 5KTKA 3FBGA 2BRUA 5IDWA 4D3SA 5C7LO 5HTOA 1A9ZA 2YUTA 4L75A 3S55A 4FN4A 4DIOA 4BOYA 1UUFA 4JXKA 3JQ6A 4HUJA 1LTHR 1QSGA 2C54A 2ZB3A 3DHYA 3DQPA 2VYND 1LDNA 1V3UA 4NFYA 4AICA 4GSLA 2D3TA 3P2YA 3S1LA 3TN7A 2FZEA 4YJGA 2HAEA 3D64A 1QRRA 1Y9AA 1J4AA 5TS3A 2EGHA 3G49A 1B2LA 1NP3A 4LSMA 3E03A 3SLGA 5ENVA 3K2EA 5GMOA 3D4OA 5HWSA 4J2HA 1ZW1A 5DN9A 3R6DA 4OHUA 4R51A 1ONPA 4MOWA 2WE7A 2AHRA 3FNGA 2QYSA 3GOHA 4FC6A 3ANMA 1OI7A 4N54A 4A0SA 4BNUA 4ND3A 4NDNE 4D42A 4XJSA 4GL4A 1HZJA 1DEHA 5JFOA 1HE2A 1NQTA 3OP4A 1I01A 3HB5X 4CLEA 2J3IA 4CMEC 3WIEA 4I9HA 1WLYA 2ZTUA 4BNNA 2GN4A 4L4SA 1MLDA 2Z1NA 1U5CA 1XHLA 2R2GA 4IDBA 3ZV4A 4PVDA 1Q0HA 4UEJA 3I9KA 4WNCA 5DOZA 5HBRA 5JDCA 3UGKA 1PZHA 1I36A 4A27A 1N9GA 4JP2A 5K6AC 3AUUA 1EK6A 2AXQA 1ZEMA 1HE3A 1BHSA 4IJWA 4J7XA 1LLDA 4IDAA 2CVZA 4FFPA 4TRRA 4DYDA 1ENPA 4NU5A 1B16A 3JQFA 4DMMA 3ENKA 4QX6A 2ZQZA 3P19A 3WB9A 3TZHA 4XCVA 3HZZA 1U3VA 4YT5A 4RF2A 3KOUA 3QWHA 2Z95A 2WE8A 4Z3KA 2PWZA 4KZPA 3GHYA 1C0LA 3ZNOA 3VZSA 4TZKA 4S1VA 5FI3A 3RROA 4N5LA 2BMAA 3MZ0A 4XRGA 3M2PA 3PHLA 1I2ZA 3RUIA 1AXEA 1DSSG 2RHRA 4CLRA 1BDMA 4ZGWA 1JVSA 5TF4A 3TZCA 4PLVA 3S2EA 4BNVA 1BSVA 4CM3A 3CXRA 5H83A 4PG5A 1UDBA 4Z0PA 4J43A 3O03A 3I4FA 4CM5A 3HFSA 4YCAA 3C1OA 3VOSA 1UJMA 2HJRA 1WDLA 2EJWA 4CUKA 3K2BA 1GR0A 4PLZA 2XXBA 3ZH2A 2G82A 5JNLA 4NH4A 4ZJUA 5L7WA 3OJOA 3V2GA 1LDBA 2IDZA 4QEDA 1B8VA 2IODA 2ZB4A 1F14A 3GEMA 3IKVA 3I6QA 1KVRA 4FSHA 4IDDA 5GZ1A 4EEZA 3BA1A 5I8WA 1NQAO 3GDFA 3D3WA 1NVGA 4W82A 2EG9A 3FWZA 4I8XA 5A06A 4HY3A 3OFSA 3PHHA 7MDHA 4EITA 2DVMA 4YBZA 4RJTA 4ALNA 1ISJA 3ST7A 3I5MA 1HDYA 1EUZA 2DTXA 4IY1A 2PK3A 2JCXA 5CP8A 1S6YA 5G0UA 3ETEA 5I7SA 2WEKA 2BF7A 4GGPA 7ADHA 3WMWA 3Q2KA 3WR5A 3O9ZA 1PQWA 3IUSA 3RUFA 5FFFA 1A7AA 3PGJA 1GAEO 1XU9A 3DHNA 2O3QA 3QLJA 1VKOA 2UVDA 4AJIA 4PLTA 4EJMA 2ZKLA 3CE6A 2J6IA 1GUZA 3TDKA 1WDKA 2P9EA 3ZN2A 2CF6A 2HRZA 4JX8A 4RVSA 3JQEA 5AVOA 4II3A 2W4QA 3GVPA 2YDXA 2WTBA 2HK7A 5TQVA 2Y1GA 4CL3A 1B0AA 4FGWA 4CM4A 4XQCA 2GF2A 3H5RA 3RWBA 4RQUA 3DR3A 4LK3A 1X15A 4PLFA 3DXFA 4RCVA 3ZHZA 4WOJA 1Q0QA 3PQFA 1ZXBA 1C0IA 3U9LA 3ZWMA 3RCBA 1DLJA 3WMXA 1SB9A 4A7PA 3D4PA 3GUYA 4HX5A 5DBGA 5ICMA 2UUOA 4J3FA 3GEGA 2EIHA 4YPOA 4XGKA 3V5NA 4GVLA 4WOKA 5EJ2A 3PYXA 4O63O 4RPLA 4YXFA 3GC6A 4WLUA 3U4CA 4PGFA 1VL6A 4DLAA 4IS2A 3VDQA 4CMCA 3F4LA 1D1SA 1YQXA 3V2UA 4TMFA 1V6AA 2X23A 4E4YA 1HDOA 1E1KA 4MVJI 3OMLA 3D1LA 1VE9A 4IQ8A 1GPJA 1HF3A 3OIDA 2X0NA 2CDCA 4GKVA 5COQA 2IEBA 3JYLA 1PR9A 3TWOA 3F6YA 2NM0A 2ZCUA 4HP8A 4YB8A 3NTRA 5ENDA 2QYTA 2UV8A 3LDHA 4XKJA 2GASA 4UVDA 1SNYA 5BNTA 2VNSA 4YYZA 5KVVA 4W9NA 4E5PA 3DZHA 2X0JA 1Y1PA 5DNAA 5BR7A 1WAMA 3CMCO 4HBGA 3DTTA 4UEOA 4ZHSA 3G17A 3QVXA 4FB5A 4J1NA 4OXKA 3UFXA 2OHXA 4OSOA 3F9IA 1XCBA 2NACA 4WGGA 1Z75A 4Z0TA 4M55A 1HL3A 2HMWA 2O2YA 3WNQA 3V1YA 1XLTA 4KQWA 4OQYA 3TOXA 4BKOA 4CMKA 3COSA 4NJOA 1IOLA 1N8KA 1PJBA 1XQ6A 1HE4A 1Q7BA 1Y8QA 3RFXA 3E18A 3HN7A 3FRJA 3QV1A 5JBIA 4UVHA 1V3VA 3DBRB 3DZIA 3NUGA 1NPYA 1FXSA 3ZWPA 3BTSA 4PZCA 3MCVA 4BNWA 4MVJH 4CM6A 3ORFA 5I7VA 4GBJA 3Q9NA 2W2LA 2NU9A 2Y0DA 2PGDA 1NVTA 2ZYDA 2YFQA 4DTIA 3HE3A 3AFNA 4IJVA 2X7HA 5I9LA 1T2EA 5C5IA 3D5TA 3RFTA 3WBBA 1ZKMA 5DOVA 3H5NA 5G4LA 4FCCA 4TRJA 3AI2A 1E7WA 4G5HA 1W4ZA 4C4OA 1LJ8A 2I6TA 1SBYA 1E3WA 5DCWA 1P9LA 3RU7A 3PK0A 1HXHA 1WVGA 3KYCA 4XDZA 3V1UA 2NSDA 2YW9A 1JW9B 1LDYA 2Y1CA 4O5OA 2I3GA 5DDIP 1YL7A 9LDBA 5JCXA 4D0SA 4OYRA 3QE3A 3IS3A 4ALMA 5KJFA 3W8EA 2VWPA 3LLSA 3X2EA 1UXKA 3SXPA 4BQRA 1JKFA 1HDGO 4GLOA 4BHTA 2D4AA 2PKQP 4MP3A 1GYQA 1LLCA 1T2AA 1XR3A 1PWXA 2GN8A 4XRRA 3W4KA 5U9CA 3ONFA 4GX0A 2IYOA 2OBYA 1HT0A 4RPJA 2D5AA 1I3NA 2BLLA 4IDFA 5DCUA 3GT0A 1G0NA 5I7EA 1N5DA 3S2GA 5T6BA 1VJTA 3F1LA 3PIDA 4Q3CA 3VH2A 3U3XA 5T64A 1B3RA 3VZRA 1GCOA 2GR9A 3LT1A 5I8ZA 1QORA 4D7AA 2FR0A 4RV9A 5FYDA 1XQ1A 3DZGA 1Z7EA 3W4IA 3JD2A 2ZTVA 2VZ9A 1UXJA 5JDIC 1P1FA 1IE3A 1T24A 2Q4BA 3STHA 2V6BA 2VUTA 4BO5A 4CM7A 4DVJA 1P1KA 1E0DA 1KC3A 4E6PA 3WLFA 1DO8A 3OF2A 2RHCA 4JN6B 4D41A 2E6UX 3H4VA 2CMDA 3IUPA 1U7TA 2QIOA 2W2KA 4R5MA 3RUDA 4KP7A 3PJFA 4MDHA 4M89A 3ZWXA 1QYVA 2RH4A 2FWMX 3FTNA 1NBOA 5ICSA 3GGPA 5IZCC 5KVCA 1KVTA 3D0OA 3AM4A 1PGNA 3FR7A 3O8QA 1YL6A 3KSUA 4DPLA 5CPBA 2BI8A 1TI7A 5BT9A 3ANLA 4ALIA 1MV8A 3FPLA 3K31A 3O26A 3I9LA 5F5NA 3E5MA 1GY8A 1DAOA 5U4QA 1YB4A 3DBLA 3I3OA 1O89A 1BMDA 2QRKA 5JYDA 1IPFA 5ER9A 4KDEA 4J7CA 4QUKA 2CVOA 4AJPA 2EP7A 4XYMA 1MX3A 3KETA 4YWJA 4KMSA 3KYBA 3NKLA 3GGGA 3OECA 1BRMA 4XQEA 2Y1FA 2V7PA 1LU9A 2R6JA 2JFGA 2CZCA 2EWMA 3CKYA 3PFFA 1NFRA 1ZJZA 2XF8A 1HYHA 4HFRA 3L6EA 1K2WA 2P2SA 3TFOA 5B1YA 3F46A 4Y6SA 4MVJP 1QV7A 1M67A 3MTJA 4J0EA 3VZQA 4F45A 1PJ2A 1EK5A 2C59A 3KSDO 3I83A 3A28A 4GKBA 1BWSA 3A4VA 4JROA 4WLFA 4B4OA 4TZTA 3U4HA 2VZ8A 3WGIA 5A5FA 3WGYA 1VC2A 5TX7A 5BSEA 3JQ8A 3RC2A 5KWEA 1ZH8A 3CH6A 1KS9A 1U3UA 5K6AA 1KEVA 3C8MA 4XB1A 2NU6A 4CPDA 3GMSA 2YQ4A 1D3AA 4UVGA 5AYVA 2NU8A 1ZMTA 4XX0A 4TQGA 5ITWA 3INRA 3ONDA 2JCYA 2HRBA 1L1FA 2OORA 3PFWO 3U49A 1RM4A 5ADHA 4QT0A 2Q46A 2EKPA 2GZ2A 2QHXA 5A3VA 1YDEA 2YHIA 3W1VA 2GNAA 1WMAA 3WQRA 5T5QA 3PLNA 3NX4A 4NR0A 3F4BA 3OJLA 3C24A 2VYVA 4BB5A 4M86A 3WS7A 4AJOA 4L73A 3QWIA 3ICPA 5L4SA 3OQ1A 3Q3CA 1SAYA 4BKUA 1ULUA 4Q9NA 1ZZEA 4DQVA 2X4GA 4BS9A 5KJ1A 3DC2A 3LT2A 2B83A 3ETGA 3D7LA 1HKUA 4GGOA 1LSUA 1FDSA 1DC6A 1R12A 4XQGA 3FR8A 5DCYA 2EKQA 2AQKA 3K8ZA 4UVIA 1ZSNA 3WBFA 5HS4A 3ZWVA 1CWUA 1KEPA 1U3TA 2BD0A 2HQ1A 4K6FA 4MO2A 3D3EA 5CEEA 1UH5A 5T57A 4W7IA 1ISFA 2VHZA 1P3DA 2J3KA 1GUFA 1YKFA 1DIHA 1LEHA 2DBZA 3DFZA 4CMAA 3VPSA 3NGLA 1DOHA 1CQIA 2G76A 1RM3A 3WOHA 2A94A 3PVZA 3D5QA 3MTGA 3LSYA 4YAIA 1Z82A 2DFVA 3OM9A 1W8DA 1E6EA 4YJFA 2VHYA 3KB6A 1Q1NA 5F5LA 5B4VA 3IC5A 4QQRA 2O7SA 2P4HX 4P38A 4RF4A 1E5LA 3EGOA 1KC1A 2HJSA 1CEQA 4P4LA 2BFOA 4CM9D 3U0BA 3TNLA 2X0IA 1M2WA 2RIRA 1SEPA 1D7OA 1DFIA 3QP9A 5CDYA 4JK3A 3AUSA 1QYWA 2Y67A 4YJGB 2E82A 5CG2A 3FPCA 3DZJA 3BAZA 1KERA 1ZCJA 1JTVA 2AE2A 1N92A 2HK8A 2VOEA 3B20A 4PN3A 3H9EO 5L51A 4DREA 1DXYA 1OC2A 1W73A 3AJRA 3WWZA 3RKUA 2YYYA 3QWAA 4IGEA 4MKZA 3WYEA 4YT2A 3DFUA 2JHGA 1H93A 3GY0A 1ZK0A 4MP8A 3PLRA 4CR7A 3DBVO 2F00A 3AI1A 4BGEA 1SC6A 3EHEA 3TQHA 5AXAA 4LCJA 1U2DA 3CINA 3GG2A 4LCEA 4ONEA 4XB2A 1PZFA 5BNFA 3TOZA 1DRVA 2Q1SA 3Q1LA 1N1GA 3JYNA 1DRWA 4YACA 2PKRA 5TLSA 4NK5A 5I7FA 4PG6A 3ZCXA 1NPDA 4GI2A 3BMNA 3BMOA 4BIIA 5BSFA 4FFNA 5COBA 4XA8A 3NDJA 2PLAA 4IUYA 4IPTA 2Y1OA 4ZVVA 4ZICA 3ZV3A 3O8QB 1J6UA 4ZA2A 1UXGA 5TNXA 4X54A 2NADA 3QVWA 4J4BA 4U7WA 5ILOA 2AEJA 2RBEA 1I3KA 2VTDA 1MXFA 1PEDA 1KEUA 1PJ4A 4JJFA 1Q2XA 2FN7A 1CYDA 3DOJA 5ITVA 4IDCA 2GSDA 2X58A 4D44A 4NIMA 4R16A 1GPDG 4FD3A 3KEQA 3P2OA 3QY9A 3VVBA 3F47A 4A2CA 2IRWA 3BHMA 4F6CA 1PGQA 4NBVA 3W6UA 4E21A 1E3JA 2ZQYA 1QKIA 4K1LA 4OL9A 3ZNQA 5C7OO 2YV2A 3F3SA 2J5QA 1KYQA 5IDYA 2AEFA 2Q99A 1G1AA 3GZ4A 1XWFA 4TVOA 1EE9A 4JLWA 1K0UA 3OA2A 1PJTA 5JS6A 3I4CA 1DFGA 4LMRA 4CMHA 5BQFA 4DIBA 2X9NA 2O3TA 1YBVA 4OSPA 3NEPX 4RGBA 1BXGB 3Q0EA 2NWQA 4KQXA 4BO4A 1WDMA 1X7DA 2Y68A 1Z6ZA 1P1IA 1ZSYA 1ISHA 2WYUA 2YDYA 3GPIA 2O4CA 5F1OA 4B3HA 1PL8A 2NU7A 5F21A 3MJVA 4NNJA 4K9DA 3QWBA 4PLHA 3ZGYA 3R3JA 1E6UA 4L8VA 3ZI0A 2ET6A 1LDEA 1HDRA 4GX1A 1HSZA 3PZRA 5F3RA 4A03A 3OSUA 4E2XA 3CUKA 1MG0A 3ENNA 1A72A 1MP0A 1V35A 3DHEA 1UDAA 1EBFA 1H9BA 2HLPA 3PRJA 4FIZA 5L3ZA 2JKVA 2Z5LA 1E77A 2B35A 1EBUA 4MKXA 4BO3A 3GF4A 1BDBA 4M49A 4FDAA 1HDXA 1GUYA 2UDPA 4E12A 1FDWA 4IINA 5JAZA 1G6KA 3W4JA 3VDRA 2X8LA 3KYDB 1KBZA 4E2ZA 2PR2A 1H2HA 3M2TA 3TL3A 3BMCA 4B4UA 2P68A
chains in the Genus database with same CATH superfamily
1VPDA 2BHLA 3A9CA 4D96A 4DJTA 1A98A 1I2AA 3GJ8A 2I3BA 3OQNA 1OU0A 1ABBA 1GKYA 4BX2A 4H4DA 1JIXA 2XCSB 2BW0A 5AKEA 5GZ3A 3L4BC 1EWRA 5EHZA 1A8HA 1M6WA 3LX6A 2GAAA 3C1AA 1YKGA 1DARA 3AR9A 1QCZA 3MB8A 4L57A 3UN1A 3C3JA 4CKEA 1JAZA 1LRJA 4E11A 4P0TA 5EZYA 4A2PA 1ZY2A 5FBWB 2BJHA 5G0WA 1Q3HA 3JAKB 2ZLBA 5IW8A 1U1GA 4JIGA 3FKSD 3OX4A 1CRZA 1BGWA 1RBMA 2B2CA 3FMVA 2E21A 3TIFA 1SCIA 2VXCA 3UM9A 1QAMA 2D8AA 1NC1A 1O7JA 3MINA 2OCYC 1XP5A 3BMCB 3TZBA 5KWVA 4ZVKA 2XADA 3VKWA 1Z15A 3O9MA 2EHDA 3E9CA 4QO7A 4EGAA 5LXTF 1A82A 3F5DA 3UMGA 5LP1A 1R64A 3DMTA 2R7LA 4JP1A 2WT4A 4G5OA 4Z9XA 4WXPA 3RC9A 1MIHA 3LA6A 1TKCA 1YRYE 3ORYA 3DEHA 1L4YA 3BJZA 5DGXA 1CLUA 1E7YA 4NYIR 1KS2A 4KW7A 1JQ3A 3O4JA 3OM8A 1JDJA 1JXQA 1Q17A 3I04A 4F3RA 1G4UR 1GIAA 1L4GA 2PKWA 3KJHA 1I24A 3H7AA 2IY7A 3OT1A 1WHTB 3NM5A 1KEKA 1QGED 4MRNA 1YZVA 4YT8A 1UWKA 1PHPA 1CUFA 4QFBA 1TFUA 1ZIOA 3ZCQA 4C7OA 2CLDX 3D2AA 3WQBA 1CTQA 1V4VA 4L9RA 2D13A 2X8JA 2ZIZA 4P7FA 3UT5B 121PA 2SKEA 4B0PA 4CQMA 1D0IA 4EHIA 2PM8A 4A5SA 2DM6A 4Z99A 4FFLA 2WHPA 1VLJA 2R97A 1KI9A 3NT2A 3PNLA 4DRZA 2Q49A 5AHWA 1BOFA 2IK8A 1KI6B 4LRWA 4ZO4A 1YS4A 4C4XA 1A9XB 4OAOA 4RZHA 2Z2IA 2PL9A 1CS4C 4KJXA 1N4AA 3RVNA 1XCMA 4IV0A 2PV0A 1WY5A 1SOVA 5FOTA 5BV1A 4ND6A 4Y0AA 2XZDA 1LV7A 3MUOA 4RVHA 3PHJA 1F2TB 4N8SA 3VR0A 3RYIA 3TRDA 4W8HA 3DOOA 3P9XA 2MSEB 1GU7A 2QRMA 1ISRA 2IPOA 1P9RA 3N6XA 3K96A 4V0OA 3ZDFA 4Q66C 2WV7A 4HX2A 3NQ41 4AI6A 2WDPA 4KVAA 5FPPA 1VKHA 1FNSA 3H9UA 2DFTA 1AHNA 4TTSA 4HQFA 4WAUA 1NVKA 5IHXA 4E22A 1M66A 5FHRA 4AULA 1JQLB 3VR3D 2WIJA 1NX6A 2VHQA 2GJSA 4Z4FA 4CN8A 4ZAWA 1Z88A 3MAGA 2C2WA 2XR1A 3KZVA 4KLRA 2ECKA 2QX9A 5H81A 4G63A 5CVVA 4DLSA 1XD2A 1JG3A 4QLBA 3WNBA 2D4HA 3EGIA 2CNWD 3HSSA 4M1QA 2PMEA 4L5CA 2Q3JA 1Y33E 3E7DA 4AZVA 5IRCD 3I62A 1A71A 2ZIXA 2GZ1A 4ZCLA 4GLLA 2OBXA 3IEUA 3OLVA 1E1RD 4IIJB 1WCIA 1NLUA 1XO1A 2BHSA 2R60A 2OZVA 2VP9A 1A5AB 1A50B 3ODGA 3GAFA 3G0OA 2IVFA 3BD9A 2Q8NA 3MEQA 4ANFA 5ES4B 3EGXB 1RLUA 3JALB 2QW0X 3AWDA 3Q7QA 5CVCA 5LQJA 4JZYA 5E6RB 5LU9A 3GLIA 2W90A 1W88B 1WP9A 3B2NA 3B1KA 3G5AA 1JEEA 4UZFA 3BL8A 2XGJA 4ND8A 4U5XA 5J1TB 2NO5A 2QJFA 4YP5A 4F56A 4TL6A 3HK2A 4R81A 3DE7X 2B4QA 3AOEC 3HEBA 4DPMA 1NRJB 3UJ8A 1QH9A 4MVJA 5L3SA 1TW2A 3O5AA 4M6WB 4Q37A 4O8ZA 3KHUA 2OQRA 1SUIA 2CEAA 1DELA 3ZHBA 3WB0A 3NHLA 3ECCA 3FSGD 3OZBA 5BRAA 5EI5A 3TJMA 2YOHA 2AXEA 4CM8B 4WUTA 4G89A 4YAKA 3U13A 5IZCA 1TYDE 1P0MA 1TQ8A 1UBJS 1XTVA 2P69A 2PZBA 2QRJA 2PNJA 4ESEA 4OD0A 3CGWA 4LISA 4ZV9A 3AUAA 5TVKA 1D07A 4EG3A 2FDXA 3OCXA 4PYOA 2DR0A 1Z62A 4UQLA 1E1CA 5IFKA 1GGJA 5BMVB 4GWKA 3OFND 4R9RA 4JBNA 2X3YA 5I8PA 1WOMA 4J6FA 2IIVA 4CLOA 3HCDA 4TXHA 1I0IA 3ZV5A 3T95A 4LGYA 5LLDA 3QGMA 4RSHA 3OCZA 2JGMA 5CM9C 3RM3A 1OE0A 1WZUA 3QMMA 4JJIA 1YKSA 1U8XX 2QRVA 1J56A 3LUFA 3PIIA 4L74A 4NBWA 3AP2A 4CVNA 1CJBA 3W04A 4TT3A 1ZICA 2AMJA 4HQ6A 3BBPA 3LUGA 3HUEA 4DA9A 1PJ3A 3FCAA 2DU8A 3ZU2A 5BWLA 1G16A 4PANA 4JKIA 2WIAA 4Q4DA 1PR0A 2UVQA 4N9WA 1IXKA 2B3TA 2CBXA 1JZSA 2OZPA 3PRYA 2EKDA 2O3UA 4Z9YA 2W0MA 1R5BA 4PGHA 4PQRA 1B7GO 2ZDHA 5C9ZA 2H1SA 1JWBB 2FZWA 1PNQA 3R4CA 3OX3A 2DFLA 1SCQA 2EEZA 3LP6A 4DR3B 1HLPA 3VPDA 3D7SA 4ENRA 3NVDA 3OCUA 3MTQA 2O2XA 4CCYA 3EOBI 2DY0A 2HKIA 1ARZA 4KVFA 1WUKS 4EF5A 4LJRA 2H1IA 3I23A 4URHA 1ML3A 4M9XA 5AQ1A 2IGTA 1Z63A 1CDEA 1LF5A 2VYNA 4HNRA 1ZK1A 1Y81A 2ZIWB 1A5TA 1V7PC 5F3WB 2WWFA 2IHZA 5JSQA 2V65A 3JARA 1X1DA 3DZFA 4FE7A 1SCKA 3CURA 2WJYA 2FE4A 3KAKA 2O5CA 5IWAB 3UWOA 4EHKA 2R1UA 3EJWA 1G8FA 4WI1A 5EZ6B 4W99A 4DPKA 4EJSC 3KZ1E 3GEDA 3IEIA 4UTPA 2OO7A 5L4LA 4M37A 4MULA 4J29A 2PSSA 4JI2B 3HN2A 4MIEA 1W44A 2GAOA 3D4BA 5I7RA 1UIMA 1CNMA 2YV5A 2KE5A 1OAOA 1MO6A 2VWHA 3AJEA 1L8QA 2IIPA 1O5IA 2JHAA 1I3LA 1VM6A 3PRKE 1JR4A 4AZ0B 2YQ5A 4QJIA 5G53C 4D9JA 1HLGA 1SOMA 2YWEA 3PR3A 1QQ6A 1USUA 2HXSA 1QIGA 5L8VA 4MW6A 1AE1A 4YRRA 3KTDA 3G0GA 1CG6A 1A4RA 1LC0A 2X5XA 4H1WA 4OHZA 1GSOA 4H7PA 3KBBA 2GPNA 5BNFA 2VHVA 1I5OA 2Q0SA 1N2CE 3EZLA 1GARA 3CG4A 3GGSA 1F06A 3PG5A 4P3PA 1A4IA 1GGFA 4TT3D 1CBUA 2WVAA 2B9EA 2XKAA 5DZSA 3Q6NA 1VDZA 1UBFA 2B1JA 3FFAA 3TQFA 4BKQA 1AQNA 2LCQA 3RS3A 1GQOA 3NETA 1E3WB 3QBDA 1Y9ZA 1PJQA 4W6ZA 3N2IA 1KI1A 1JDUA 4D82A 4X44A 1L5VA 2HSJA 4TX1A 2I7XA 1KDOA 1DOZA 2QT9A 3E3OA 4LVNA 1EUCB 2W83A 3WGUA 4XWYA 2FOIA 1P2TA 3HACA 2Z6VA 4GMXA 2VH5R 4OLFA 1E1LA 4V39A 2A5YB 4UCFA 1C5KA 2DLDA 5C3UA 5JSFA 1MG5A 1GCUA 3EAGA 2PT5A 3L3BA 3MMXA 2YC2C 1ZNYA 3TOSA 1KEEA 1GHTA 4IX9A 4DV2B 3EDMA 3KSZO 4JBHA 2Q2OA 4Y1GA 3BDVA 3IVGA 3QXJA 4Y1RA 1M0SA 1G59A 4LHYA 3T3DA 2CVHA 1NFFA 4PC3A 3JRNA 3TRJA 2MYUA 4RM3A 1ETHA 4JIMA 1Z73A 4KPGA 1U5BB 3G6KA 4P4SA 3QIVA 1GZHB 3KTFA 3L07A 3PUWA 1PK7A 2ATCA 3QLVA 4M8IA 4K0KB 2XZTA 1E2UA 1J0XO 3MBKA 4YVFA 4QU0A 1IIBA 1KZ1A 1UMCA 1P4GA 2V45A 1BHJA 1UAYA 4MQ6A 2M6LA 4F5ZA 3LZ6A 3OQBA 3IODA 4YTEA 4M0EA 3HMQA 3V6MA 1YS9A 4MW2A 4KDFA 2PZFA 3B5EA 2FR8C 1FS6A 1T5BA 3KB8A 3JRXA 2I8CA 2ZXUA 4QYXA 4RBNA 2H4YA 3U4QB 3U2QA 1IXSB 3QW2A 2EHJA 1YOVA 4YQZA 4GMHA 4EHNA 2F7SA 2BBWA 3WXBA 2Y6VA 2CFCA 1NLMA 2JK1A 1M1YE 1NBMA 1B6GA 1C1YA 3LF1A 4HF7A 2G8NA 4LUCA 4Y18A 5ERXA 4B48A 2X8WA 2HU8A 3DAPA 3IUNA 1AQJA 2C82A 5CB0A 2IV2X 2FN3A 1G2PA 2NQ8A 2C97A 2A92A 2GK3A 3LU1A 2X0FA 2EG5A 3VR4A 3KEGA 3ZK7A 5BVGA 4QVKA 5C3MA 1FZQA 1GYRA 4RQBA 1XAGA 3T3IA 3CUWA 4Q1EA 2O7QA 2KS6A 5FLYA 2J9GA 4J2OA 1IJFA 2XQKA 5TJ9A 1ZI8A 4YUVA 4E5MA 1ZJYA 4AJJA 1XELA 3MW8A 3OC0A 4DGQA 2PNFA 4X3PA 3QLUC 1W5BA 3QYAA 2JD2A 4F7WA 3DFFA 3UNXA 1H2ZA 1TIKA 3ND7A 2CUTA 1OPXA 3N8KA 4Q7LA 4ZMRA 1E3DA 2Z2JA 2BFDA 3RTGA 3CX8A 4LOJA 2GEBA 4EJSA 4F84A 3SE7A 2X9LA 4Y98A 3H1AA 3AJ9A 4URVR 1WE2A 4J0HA 1D8AA 1L5GB 3UAZA 2PS1A 1WJGA 2C8KA 1UP4A 3L7AA 5IVKA 2Z5FA 1BFDA 1DPFA 1HDCA 2BGTA 3PICA 1Z17A 4ZQIA 2P9CA 1Z36A 2GM4A 1QM5A 5ITZB 1XXHE 3RSQA 3USZA 4CFSA 1U2SA 3DQZA 1RRGA 3R6WA 1AGYA 3R75A 5DF1A 2Q45A 3W2HA 2XUGA 4KFRA 3HRIA 1VE3A 2BM8A 4YUWA 3ZHYA 3MPUA 2FE1A 3L7DA 3FW1A 5H3HA 1Q7CA 3GLFA 2NYAA 1JAYA 2WMOB 5CD9A 3B48A 3T5DA 2F9FA 4Y6QA 4LQCA 1FYVA 4BYMA 3DL7A 3RVDA 3SGLA 1FL9A 1A3CA 4BB6A 3QBJA 2DHQA 4EYEA 4FIDA 2IWHA 4LVOA 4I4LA 4TV8B 4DABA 4AY2A 2X4DA 3DM5A 3RASA 3ZY3A 2QW1A 3LIPA 4BFCA 2PHZA 3D6TB 4MS1A 4RY0A 4QXPA 2ZBVA 1KPGA 2EJVA 5SY9A 1RI3A 3L0DA 4JCOA 5ICFA 5DK6A 4AJNA 3U26A 1DQPA 4B7XA 4BZXA 3BICA 1AMNA 1EUDA 3RKRA 3VOAA 2NVOA 3RS2A 4BMNA 1GSIA 4HATA 1FU4A 1W52X 2AH5A 3AEQB 1Y5LA 3B1YA 3G1UA 2V7QD 4FMDB 5AI0A 1U2TA 5ALKA 5T7BA 2I33A 1TTTA 2P1ZA 3ETNA 4ZT3A 2VT2A 3DZKA 4FYMA 1YZ3A 4OGKA 4DR5B 1Z28A 3E7XA 3O8DA 1XMJA 4ZQCB 3HZHA 1Y8CA 5JSKA 1INLA 3ROMA 1PZXA 4HWGA 2I65A 4XW2A 2PLNA 4NQZA 3S1AA 5HIJA 4MJLA 5A9TA 4IIXA 3CQ9A 5F51A 2JFQA 3LDFA 5A3SA 3A11A 3DPIA 3N8DA 1NN3A 3LUKA 3TRIA 1P0QA 4DMLA 1FUEA 3Q7IA 1P91A 1X0XA 3LTNC 2JLUA 4C1BA 2WWWA 4F6RB 3OU2A 3G13A 5DT2A 1QHNA 4XYGA 1VPLA 3AIKA 4KWIA 3DNPA 4KFCA 1JDZA 1MOPA 2OBNA 1BXRB 2G1JA 2Y1KA 2ZR8A 3E9EA 3FPAA 4FT4A 4KYVA 5E2AA 3W5CA 4W5WA 1R4NB 1ZFNA 4C0KA 2REQB 2EW1A 4CI9A 1KVUA 1N7GA 3ZVNA 4ER0A 3RADC 3Q2IA 4C03A 2C3PA 3BXXA 5BN3B 1LK7A 1B76A 2Y05A 3VNAA 1MOSA 5D5PA 4Z4EA 3AVWA 1BE0A 2BEVA 2HO5A 3HSKA 3VTKA 4BO8A 1V8BA 2V3VA 4L8FA 1UXOA 2OE2A 4Y2YA 3OBIA 1A8UA 4E5DA 2C3UA 1HDZA 4JVMA 4D25A 2NLOA 1D2AA 1GNPA 3OZRA 3RREA 3QTTA 1QOPB 2WAMA 3KYJB 5H3LA 2HMTA 1GUDA 4I2NA 1E64A 3AESA 4MVJM 1NONA 3Q9UA 2A1TR 3NHMA 3OLYA 1ECCA 1LLFA 4XPIA 3QU7A 4BWVA 4W5TA 2BGRA 1LH0A 1NQUA 1TECE 1OMOA 1ISIA 3VTAA 3WLQA 2V7VA 4WOBA 1BQEA 3IP6A 1RXUA 2X42A 4ITRC 4KLNA 4ZRDA 5B3JA 3WG9A 5A9SA 4PXSA 5AR1A 1QWSA 1JZQA 1E2LA 4RMGA 5KOYA 2A5DA 3GCXA 1LFAA 2HIGA 1PR2A 1ND6A 1M1UA 1PGJA 2DUUA 2O3JA 3AP3A 3OOWA 4PZEA 2C84A 3A1VA 4DSAA 2WWTA 1WW2A 4U8HA 5AVJA 1KYIA 1Q0UA 1KDRA 5I9IA 1PT7A 1GGHA 3U9SA 4BMOB 2I3DA 1YVPA 4D97A 1FUIA 1Q7GA 3FWNA 4QXOA 4D8YA 4D9MA 1Z13A 1CIVA 2AYZA 2EDAA 3KVRA 3EFEA 4FWIB 1UBSB 3REGA 1SZJG 1WMBA 3I1FA 3KSRA 4W1RA 3UWKA 1X74A 2BGJA 4MDYA 1GZ6A 2RGNA 1NR7A 4UU8A 2WLSA 2PZ8A 5KDLA 4BQEA 4NYMQ 5JU6A 4UNNA 2V97A 4EG0A 3ZD6A 1MVOA 4RKFA 5BR1A 3JVIA 2X6RA 4JVOA 3EMKA 5DMHA 3PNQA 2WJZB 2IDKA 4D6XA 1RWMA 2W00A 2HM7A 3RVBA 4NBTA 4H27A 1BA3A 3TI7A 1AY0A 2I1WA 1SB8A 1ZYUA 2FHSA 3BB4A 4W6QA 2ZZMA 3AVXA 3WAKA 1IPEA 2P8JA 5GONB 3FTDA 2CHUA 1IN8A 3C85A 4L8LA 5FPHA 5I4CA 1XQVA 4RHYA 4LZWA 2G77B 4UHHA 4L4YA 3TIGA 3TMAA 1W9MA 2PUJA 5B7GA 5JANA 3VPHA 1NR1A 2CZQA 1UBGA 1ZOPA 4W8OA 3MAAC 4XB6B 4MS3B 4B6SA 2IQIA 5BNIA 2PA0A 1AF7A 4L85A 1SH7A 4LRXA 1FVOA 3EVAA 5JIBA 4PO8A 4J0JA 1TYZA 1N2OA 1W96A 2A9JA 3N6RA 3TQRA 3ZI4A 4C7BA 4QREA 2O2SA 3V32A 2ABWA 2BZ0A 1M0WA 2FSHA 3OE7D 1QKJA 5EIEA 3AFMA 1R16A 3UCFA 4JU8A 4CEHA 4RF5A 3K1JA 3WRYA 4Q0MA 1MRSA 1CE8A 1FP1D 1TEVA 2VTVA 2WTAA 1NATA 3PUVA 3UJCA 1XRNA 2Q3FA 2ZBPA 4CR6A 3S2ZA 4R1NA 3P7MA 1NYQA 4KE8A 1T26A 5SY4A 4DMFA 1P7YA 1YXMA 5CG1A 4D9GA 4F2DA 1UWVA 3CZAA 4FYYA 4DS3A 1N2JA 1M2KA 1X13A 2P1RA 3A6HA 4BFXA 1JH8A 1X6VA 1YZQA 3ROEA 1SBCA 5CJPA 2WRZA 4QJ4A 3FDZB 4JLUA 1KAMA 1YRWA 1TQHA 1R0CA 2VP2A 3IQHX 1G4AE 4A23A 3C6ZA 1NF3A 1O6CA 4QG7A 3W34A 3ICVA 2NT3A 3PC8C 1OGYA 4LZZA 1L1QA 4I1RA 3O84A 4EMUA 4JLJA 5LC1A 3SKVA 2R8PA 2EEPA 1Z12A 1XMOB 1O54A 2ZBUA 3A1UA 3QY0A 4GI3A 2D2IA 3MJTA 1U81A 2GDZA 1XCLA 4F6RA 1N2SA 1BN7A 1OLUB 1XZIA 2ZVDA 1WW8A 1SZCA 3W3ZB 4KU4A 1VECA 4EK9A 5C81A 2OCXA 5C53B 4IOMA 3M3HA 2ZT6A 2C5GA 3N2YA 1RJWA 3HHPA 1ZIDA 1EVKA 3P5SA 1MJNA 3L9XA 3TSZA 5JMTA 4PX3A 2AG8A 2MCFA 3VRHA 1DMSA 1Z07A 4C5AA 5I4IA 4QVIA 1GA4A 3BXFA 4P33A 1NNSA 2A9RA 2WPDD 3PHCA 1WBJB 2XD9A 1YVEI 2CHVA 2QGZA 2RGEA 3CS3A 3Q41A 1RAGA 4N18A 3UTDA 1GZDA 4D26A 1Z4JA 4PXYA 2FJPA 4QHTA 2F55A 4US0R 3EDOA 2DWCA 4XJTA 3QYPA 2JJ8A 1LNQA 5LFAA 4NG5A 1FRQA 5BQ5A 4IGKA 4QAQA 3WSTA 3DMHA 2UZ1B 3FYSA 3M6VA 4M1EA 4NZYA 1VJRA 4F1KA 4UNRA 2BC9A 1NW5A 1OHHA 4MS1B 2HA5A 3T9CA 4N40A 4OYLA 1W30A 3GIDA 4UMFA 5AESA 3GHHA 4GIBA 4BN5A 1NAIA 4D98A 3FUXA 5AM4A 3H2JA 3EXG2 4RJJA 1HUQA 1E2MA 3RKSA 4BNMA 5FI5A 2DPLA 4B82A 1O0SA 4MI9A 2PUFA 1AM4D 3DE1X 2JD1A 3FCCA 4GAEA 1EPUA 1GD1O 1TB4A 2L17A 4G9GA 1C8VB 1BCRB 4K6CA 2J3LA 3W7AA 3SSAA 3T9FA 4BTLA 5HQ3A 3PQ7A 5LQAA 1XTSA 5JARA 1PG5A 5FBLB 1JR6A 3OX1A 5A0VA 1KJIA 5CIQA 4DYVA 3DXXA 1WV1A 4EY3A 4X62B 2HJVA 2QLFA 2VXYA 3KZNA 1T3LA 3AI7A 4PGAA 4R1SA 2H59A 2OVBA 1ECBA 5FAKA 2E1RA 1ORRA 4F46A 5A7HA 1YZYA 4Y67A 5LZ9A 1Z2DA 1C3OA 1M7HA 2JKYA 1TA4A 4FHCA 4JI8B 4JXZA 1KOFA 1FDVA 3DFMA 1CDZA 1K7FB 2P3QA 2H4ZA 5B6PA 1J8FA 4MW4A 3VYWA 2Q1UA 4DDMA 4IIDA 4W9NC 3UPDA 4Q48A 4CNQA 3IB6A 2ZJOA 3G1TA 3JWHA 1TZ2A 1Y98A 3EZ7A 4YUXA 4GT1A 1T4BA 3T5MA 1K08A 1ZA1A 4RHTA 1SVMA 4TL9A 1WB5A 3KJXA 3ZKAA 1M3SA 3AU8A 1G21A 2BDUA 1RE0A 2DC1A 1DJQA 3H6GA 3KVYA 3VR2D 4RIHA 3RI3A 5JYBA 5LYJB 4OI4A 3DTVA 3IL2A 2VN8A 2R5FA 4NCJA 3HO8A 1G1MA 2PUBA 5EKXA 2QV0A 4OJQA 4WACA 5AW5A 3KO8A 1JV2B 1Q1AA 2OPBA 2P0EA 4XM0A 5IJXA 3V1TC 4B35A 1FFGA 2A0WA 1TLTA 1V41E 4G67A 3QRWA 5CX4A 5GVSA 5K5EA 1JEQA 1U0SY 3IAHA 2H08A 2JFWA 5ALJA 2VT7A 3LOUA 1HFWA 2OA0A 1US8B 3HEAA 4JP8A 4JXJA 5ALXA 1V16A 1GGMA 1OAAA 1RXIA 4RYDA 5JJ5A 5K0FA 2GNOA 4UATA 3H4MA 4CKCA 3B70A 5A4JA 4KVZA 4C1NA 1SG9A 5JCJD 4GDFA 1BN6A 2HUNA 2W2VA 4Z3DA 1BD4A 3MRXA 3W05A 1THMA 2B69A 4CM4B 1K1EA 1OWNA 4NAUA 4R1UA 2PV7A 5EMJA 3VAZA 1QZUA 3C5EA 3FMIA 3AERB 4ZYLA 3IIEA 5JALA 4PC7A 3NJ4A 2IXBA 3UAGA 4U2DA 5JG7A 3A14A 3ZXIA 4ARBA 2FLVA 4RSRA 4UD6A 5FADA 3UFBA 4NU6A 4UTNA 1C9EA 2YJ3A 1J2EA 3PNPA 3LPCA 4INOA 5D3KA 4AJLA 3HPRA 4ZOBA 3ZQUA 3FNFA 4H0CA 2B3DA 2ZI9A 3ET4A 1M7BA 1NM5C 5TT0A 2LKDA 2ACKA 2DWQA 4FKZA 1U2DC 3X1JA 1J33A 2P9JA 3W5DA 4CG0A 5ALGA 4A1OA 1IULA 4O4LF 1N6RA 1ECPA 2P2LA 2XLBA 4AZTA 4B47A 4FZ5A 1KKLA 1NQOA 3PDWA 4YK7A 3V34A 3WYBA 4ZYYA 2KHZA 2XE8A 2RGYA 3OOSA 1WUJS 3F6BX 1Y89A 2N1MA 4QEKA 1RMTA 3QVLA 2IYAA 1GCGA 2QAGB 2XCQA 3G9XA 2C5SA 3M5CA 4LRTB 4PLWA 3TKLA 3GZJA 1OLUA 1RSZA 4N5IX 2ZUEA 4J7UA 1R0WA 4JT8A 5HIMA 1K68A 1YE5A 4P7JA 4DRXA 4GSKA 4GEKA 4I5FA 2I6FA 3NR2A 4I5EA 3VZPA 4EF4A 1TCCA 2EERA 4BFVA 2FQ1A 2PWAA 2ZANA 3A06A 1XZFA 4ED9A 1P0FA 3MJHA 3UV3A 1XXLA 1REQA 1V8OA 1IATA 1LNZA 3FOAA 3HU3A 4L7VA 5DB4A 3UJNA 2D0DA 1XF1A 1YJBA 2WAOA 3GI1A 3SIPA 1Q21A 4GP9A 5KVSA 3QYJA 3JQAD 3OLXA 3NWBA 3VR1A 4ISBA 4DLXA 4WEOA 2F1RA 2V5UA 3H8JA 1TVEA 4YQFA 1C4OA 3NYIA 2WPDA 3AF6A 1IY0A 4IXMA 4CF3A 1MQ8B 3HC7A 4BNXA 3B5IA 3GGOA 5TRTA 4C0WA 3ZXYA 4QE3A 4HT3B 4A73A 5LXTA 1D1QA 3UMJA 2XNDA 1H94A 3R7LA 1RQ7A 3ROXA 4WY5A 4JLAA 1E7RA 3AK4A 2GOYA 3CNEA 3FYDA 4Q12A 2JD0A 1UPCA 2QI9C 3DT9A 3PSHA 1WIWA 3U60B 1E6MA 2XCLA 3K9CA 3LZDA 3V7NA 4EB8A 4WLVA 2I6GA 2WF8A 2BEWA 4KVGA 3KLMX 4XR9A 3EOZA 4GNRA 3DLHA 3TUIC 4K2HA 3ZYZA 3Q3JB 3TSCA 4CJXA 2AJCA 1S1MA 1N2GA 1S3GA 1JI3A 1YHYA 3IQXA 5K6TA 1RRFA 2EV9A 2Y77A 2AR0A 2DHCA 3OTHA 4AG3A 3HU5A 1YQEA 2CXSA 4NSNA 1LV8A 1SC3A 3H3JA 3R74A 2D00A 1JNYA 3F6SA 4CLOB 5BN3A 3ND5A 4YRAA 3GG9A 4FZRA 3ELDA 5FNVA 1K3FA 1AZSC 2O1SA 3OUTA 2GN1A 2VP4A 4MLDA 2WT8A 3AM5A 2XX3A 4EUNA 4IOKA 3D0RA 1WF6A 4R1OA 1JE0A 3LWDA 3CPSA 1EP3B 1U3FA 3LWBA 2P35A 3UW3A 3EVGA 1E89A 3VTFA 1CZUA 1OXMA 5EVJA 4ZDKA 1Q1ZA 1NBWB 1SXHA 4BECA 2HUPA 5CLFA 1YWGO 5IC5A 4U3JB 2W5UA 3DE5X 2JBWA 1J06A 2WMDA 3FI9A 5C7IO 2AX3A 1E3LA 4QHYA 4B4VA 3GCZA 1E5DA 1PJZA 3SE0A 4MPJA 1FMTA 4JB3A 4KQMA 3O2NA 3O6VA 1LWOA 4TXMA 2C83A 4MR9A 1V1RA 2VQFB 5I5GA 1SEVA 4O4IA 3K1AB 1LS1A 1LX6A 2WM3A 3MQ4A 4MAFA 4MRAA 1HOXA 2IXDA 4B80A 5K8CA 3OTOB 1ZCFA 4MHOA 4LJ5A 2CMFA 4P4GA 2YWDA 3VKHA 1LK0A 4DC1A 1ZX1A 4YRSA 4RQTA 5CDTA 2AOTB 1BE1A 4UJ5A 3RSZA 3VAYA 3X1MA 2XAUA 4YJ3B 2ZBQA 1SVLA 3SD7A 1UC5B 4FFOA 3H9JA 1J0EA 2XBUA 2AVNA 1P31A 3EZ9A 1V8DA 4TV9A 4K9QA 2IEGA 1X2EA 4RZIA 2TMKA 5F12A 1K89A 1E9AA 2INGX 4B6QA 4DJJA 2I67A 1MO3A 2Q0XA 4JKYA 1Z5WA 5LZ2A 2LNDA 2P2DA 2ZI5A 3F5SA 3HEMA 3ZI7A 3ZW7A 3ELWA 5GOTA 2OKGA 221PA 1Z5NA 3HYLA 2QTHA 4Y2VA 1VLZA 4N8EA 4D3XA 3CVWA 3IEMA 4ASUD 1E6WA 2UUPA 4Y0NA 1FP7A 2AX4A 4LXQA 3STYA 3IHLA 2V7QA 5E6UB 3TVDA 1Q1GA 1X7ZB 3GT7A 1NUAA 2E48A 4MUNA 2BGUA 3VSBA 3UHOA 4DCPA 4RTJA 3RLIA 4BUCA 1I8TA 4MR8B 3IKTA 1KARA 1NKSA 1B8UA 1TZBA 2IW3A 3N2LA 3HI4A 3URMA 5TC4A 1BG6A 4MYDA 3K71B 3S2UA 3T7EA 2Z2KA 4PAQA 3IELA 1DZ3A 3IA2A 4KKXB 1BVHA 4D6PA 1IWOA 2G9UA 2VEDA 2G1PA 3K1YA 5DP2A 1OXUA 5MHTA 1FNBA 2ODBA 4HK4A 2QEQA 3NM4A 4RH0A 3CN7A 4ZKEA 1SG6A 5L7TA 4TPKA 4C43A 4G5QA 5DGHA 3T35A 4NX2A 1PN3A 4KUEA 1XTUA 2BCGY 1C9DB 3WK5A 4C0LA 4C3ZA 3DOUA 1T4GA 5E4FA 5GM2A 4OU5A 1M1YB 4TKVB 3DMFA 1SXJA 2VRCD 4Y6PA 3EDYA 3H2HA 2CY0A 1R8YA 1YJ8A 2FG6C 2H1LA 3E1KA 4K87A 4LBWA 4J91A 5K3OA 2QM7A 1ZZGA 3QVGA 3IOEA 3JQCA 2BR3A 2X15A 2BL4A 1YQWA 4R8MA 2GWHA 1L5MA 4Q05A 3FMOB 1RFGE 4Y2XA 2O0MA 3HB4X 4R9SA 3P97A 3OZXA 5FLEX 1FCJA 1QYIA 2DLNA 4E51A 3BH7A 3ZE7A 2O0LA 4W5OA 1M34E 2W6ID 4IXTA 2H4HA 4R0VA 4DG8A 4HDSB 5KYXB 2R8RA 3C43A 1GPWB 1C9YA 1MAUA 4YECA 1QF6A 2H54A 4YUAA 2FUG6 2Z98A 2NYVA 3LCMA 3A1DA 2ZRHA 2AI3A 1YFKA 2F3QA 4LSZA 4DR2B 3FWYA 2XKKA 4QYIA 2NZXA 5EYPB 1T8YA 3C14C 1DIAA 2DP4E 5REQB 4IGAA 4DLKA 2PAAA 1QIHA 3KXDA 4MW1A 1Z0ZA 3UK7A 1GO2A 1WPGA 1BKSB 2C8LA 2OHHA 4AK9A 4B2LA 2YZ7A 3BMQB 1XDWA 1ZUIA 4DM7A 1OWLA 3E9YA 1Y1KE 3BILA 5FRDA 3KQYA 2IOQA 1IBSA 2H31A 3NH6A 4IS3A 3EVEA 1CJSA 2VI5A 3LQ1A 4YJ3F 3LSTA 4IHQA 3LLUA 2F3TA 4BVLA 1AKEA 5FR1A 1XFAA 4DNOA 4Q18A 1ONSA 1SQGA 4JX9A 1QLJA 4KITB 2FN4A 1G3IA 4CCWA 4ALKA 4IZHA 1DL5A 4M0LA 2CZGA 3DO6A 2EF0A 3LV8A 1ENYA 1PGOA 1C3VA 3LLVA 4ZYWA 2OHIA 2JJ2A 5IFLA 2FX5A 1EXNA 3EXHC 3VX4A 3WGMA 4YPVA 2FWRA 1J24A 1W19A 1DJPA 4GXNA 3UJPA 3B36A 5I9TA 2Q27A 5HTKA 1P74A 2FUNB 3H5TA 3HYNA 3LPDA 1EX7A 2Q21A 3V33A 3NJ8A 4G5GA 4C14A 5BOSB 1F1BA 2P2ZA 3GJ4A 5TE9A 4EVQA 4TWIA 4Z8XA 4G24A 4U2EA 5CHEA 5AXCA 1T3HA 4K6HA 1SKMA 1CD5A 5K0BA 2PA3A 4NHOA 1MDFA 4L4RA 5A02A 4YCMA 1U2PA 4B3DA 5G1NA 1D9XA 2K7FA 2QVYX 1RKBA 3KELA 4YP9A 1OPRA 2QK4A 3FNEA 3HUTA 1MZPA 2QMUA 1CCWA 3GZNB 1YZTA 1M2VB 3PIRA 2JLQA 1EFVA 4CMEA 1Y4UA 4EKGA 1PK9A 5EOVA 1CQJA 1HL7A 4CZ2A 3JAWB 1KP3A 2Y99A 2YHSA 4N6OA 1XAJA 4PLPA 2X0RA 1MX5A 1QYDA 2CFIA 5TMEA 5TT1A 4KXYA 3V8MA 2BELA 2G83A 2QNRA 3ROTA 1N9GB 5IDXA 4EX7A 4M0DA 4ENWA 3I9OA 2PRYA 3LL4A 1XYYA 4QPNA 2B5OA 3Q8XB 2B9VA 2YYAA 4B44A 3W6OA 3GV0A 2P9YA 1M72A 5LCXA 4ZHQA 1GZ4A 1ACJA 1OTXA 2CLOB 4KAAA 4OLHA 2J59A 4RWEA 4UU1A 4CEIA 3AZPA 2XUAA 4EJ0A 3VNVA 3H1FA 2FSPA 8ATCA 2CWWA 1OLXA 2QRGA 2YY7A 5ESDA 5LLTA 3GX1A 3SXJA 4IG4A 3PHIA 2CWDA 5EUMA 3N2GB 5EUCA 3RUHA 4MWDA 1IM5A 1RACA 4W7SA 2AT1A 2B37A 2WD7B 4RFVA 4NBKA 4YRJA 3TPZA 1T9CA 3AW9A 3DKIA 1LZKA 3HXKA 3P2EA 3RYTC 5BUQA 4IEEA 5LMNB 3DYIA 1SJ9A 2ID7A 1CJKC 3AW8A 2N42A 4UVEA 5AKKA 2YZKA 1XLWA 3R7FA 4PZYA 2PQMA 5KJEA 2RGRA 4ESHA 1PKXA 1HFEL 1N2CB 2F90A 4WLOA 2RG1A 3K9BA 1E1NA 1RWVA 2ZIEA 4R7TA 4XJVA 1Y4ZA 3HN6A 1DEAA 4HDSA 1N8TA 1YIAA 2B98A 2ZETA 3KUDA 3JYPA 4PQFA 4X1IA 3QYFA 5K1ZA 1O95D 2XJ4A 1LQUA 4JLNA 4U6QA 3FVRA 3BWXA 5EJMA 1NMEA 1NKVA 2CLKB 2QA5A 3H1TA 1FYWA 4RPKA 5CFOA 3TSWA 3PX7A 3L43A 4KL8S 2CV2A 3DAGA 4KSYA 4YAEA 2GILA 1WULS 2Y8EA 3G2HA 5KNDH 3A6PC 1W47A 2Q5LA 3I6IA 1MW9X 1VLLA 1DG3A 4OH1A 1L5QA 1N2CA 3LYUA 4M99A 1UBMS 2PUHA 3DDUA 4OHWA 4ZVQA 3RAGA 1RPZA 3RQIA 4ECAA 2GPJA 4IYJA 3A7DA 3REQA 2DWUA 4BWFB 3WWYA 4P5EA 5JNSA 1KPIA 2FPIB 1KIMA 3GK3A 1RHMA 2KJQA 3LXRA 1ZM4A 1EVEA 2PKYX 4Q3BA 4V0LA 1MDBA 1ST3A 3AM3A 5EHXA 2BDTA 3OE7A 2UU9B 4CCAA 4UMVA 3D1JA 5B4TA 4IF6A 5B30A 2DHEA 1IZ0A 1J97A 3P9IA 3CF6R 1H2BA 3GCWA 2PH5A 4RCZA 3ZZMA 1MB4A 2ZRFA 4E1AA 3G7NA 2UKDA 4Q4CA 3SM9A 4CV2A 1QLWA 2PBRA 1P9OA 2P6OA 1J39A 1PFWA 5A2GA 1CUCA 1IB0A 1LFDB 3EW7A 1WA5A 1E4YA 2XNSA 1VRWA 4A2QA 4V1CA 3LP8A 4JJ6A 4OKNA 4DR7B 1JU4A 5JSHA 4TTPA 3ZZUA 1O8CA 2Y0PA 4MRRA 4DWWA 4DRYA 1XJWA 3K16A 1O97C 3OCCA 5TSDA 3C74A 3EH2A 4GF5A 1GPMA 1X7WA 1Y1QA 4IJ5A 3TPCA 3M7IA 4EJ2A 3HXTA 1WZEA 3T3EA 1QPZA 4M0PA 2APJA 1S2NA 1T6YA 1MIOB 3PC7A 4IRMA 3EULA 3PNKA 1M74A 1U6JA 3T15A 1A7JA 1S7GA 2P6MA 3B3GA 3L8EA 3L7CA 1B3BA 2AZTA 3V3TA 1GTSA 3UH0A 4BMDA 1C9JA 3DD5A 2IELA 2RGXA 1NG9A 1KMIY 4KDRA 3SWWA 1F2UB 3PL5A 3WGQA 4FGKA 4XVCA 4NULA 5EXDA 4PZ0A 1AHPA 2HDOA 3SC2B 3BE6A 1WX1A 3T12A 1FUKA 3D3JA 5HRCA 3ZCPA 1ZH6A 4FSXA 2XYRA 1A8IA 1ZCBA 1RRMA 3HL0A 1XQYA 3P32A 2WQZA 3CJRA 3GN2A 3K1AA 1V9SA 2YY6A 1ORHA 4QUJA 3RC7A 4OB6A 5JAHA 2CBGA 3EZGA 3LOPA 3EPHA 3CJTA 4PZ9A 5DXAA 3BXOA 1PIWA 2FWAA 4OL0A 3DKVA 3V8NA 3STWA 1F0KA 2ONJA 2W0SA 4DMUB 4KRYA 4PYKA 5B12A 4HXYA 1O0BA 4F4JA 1XTKA 4WN9A 3ED1A 3FLBA 2PAFA 2F8LA 1KZ6A 5EXSA 5TGDA 1UBOS 1L6IA 2XWBF 3CVOA 3OJWA 3PJGA 4MK4A 1Q14A 1U5AA 4WKCA 5EJ4A 4ZREA 4R05A 1CUEA 1Y8RB 1W4BA 2QG4A 1QC5A 2ZYTX 5CAEA 1S89A 4MA0A 1JG6A 3KE9A 3O8OA 4WLNA 3EEQA 5C34B 3V2IA 5JS7A 2QN1A 1EK0A 2C4VA 1RWBA 3PDIA 1XDUA 3CNHA 3D9QX 1RKVA 3JZFA 4J3JA 3DYVA 4D9HA 3AKZA 2YHBA 5BN5B 5A5GA 3E5HA 4I5IA 3PEUA 5MN5A 3TXXA 1SIBE 2QUAA 2ZM6B 4QXRA 1BCSA 4B3XA 1W94A 1KDVA 2GLUA 2GPWA 4NEQA 5EVCA 5JD6A 3GLIE 4X1IB 1P7VA 4S0XA 4LJ8A 1AQ6A 1F9EA 2G72A 2QG6A 3CX4A 2XCOA 4YEDA 4AMGA 4UDXX 1ZR2A 4AL4A 4FCTA 1BTOA 4FXPA 3Q7TA 1KE1A 4C05A 2RMKA 3DVRX 4RETA 2GD2A 5IJAA 3KKEA 5EY5B 3X1XA 2QLNA 4F7DA 2IPMA 3QELB 5F2NA 3G8YA 1UDXA 1DMRA 3F97A 1P1JA 4JQCA 4TGLA 1RQPA 4IHJA 4MUIA 1WCYA 3HKBA 5IAJA 1N0WA 3WGTA 1T25A 2YY5A 1QKKA 1Z45A 4A8JA 4BMCA 3QPUA 3SMVA 2EARA 3U7RA 5I9NA 1GAWA 3EJ6A 9ABPA 4RX1A 2XCUA 4DQXA 5FBVB 1D8TA 1VBNA 1MN6A 4KQ2A 1YTUA 2CYCA 2AQ8A 4RPGA 2H3EA 3UK1A 3E4DA 4X1KB 3LXUX 2FZKA 3R20A 1GRNA 1N3BA 2NTJA 4AW9A 2XMZA 4YDQA 4CIDA 3MWLA 1XXHB 4YJHA 3UANA 4XTCS 3WL3A 4E1BA 4KQEA 2LRHA 2DECA 1XDSA 4M98A 3RJ9A