3QP9A

The structure of a c2-type ketoreductase from a modular polyketide synthase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
498
structure length
470
Chain Sequence
VQDSWRYRIDWKRLAVAGLSGRWLVVVPEDRSAEAAPVLAALSGAGADPVQLDVSPLGDRQRLAATLGEALAAAGGAVDGVLSLLAWDESAHPGHPAPFTRGTGATLTLVQALEDAGVAAPLWCVTHGAVSVGRADHVTSPAQAMVWGMGRVAALEHPERWGGLIDLPSDADRAALDRMTTVLAGGTGEDQVAVRASGLLARRLVRASLGTASPWWQADGTVLVTGAEEPAAAEAARRLARDGAGHLLLHTTPSGLAGLVAELADLGATATVVTCDLTDAEAAARLLAGVSDAHPLSAVLHLPPTVDSEPLAATDADALARVVTAKATAALHLDRLLREAARPPVLVLFSSVAAIWGGAGQGAYAAGTAFLDALAGQHRADGPTVTSVAWSPWEGSRVTEGATGERLRRLGLRPLAPATALTALDTALGHGDTAVTIADVDWSSFAPGFTTARPGTLLADLPEARRALDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type I polyketide synthase PikAII
publication title Structural and functional analysis of c2-type ketoreductases from modular polyketide synthases.
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Oxidoreductase
total genus 160
structure length 470
sequence length 498
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08659 KR KR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qp9A00
4QXMA 1K0UA 3H6KA 5EINA 1IPEA 5IN5A 4J2OA 4AJIA 4CMEA 4XRRA 2NACA 4ND5A 2FR0A 3WGOA 5CDSA 1Q1NA 3GVIA 4I5GA 4A5OA 3EHEA 1B2LA 1C0IA 3AUAA 1O5IA 4J1SA 3TZHA 5JAMA 1E7MA 5LDHA 4G5HA 4YEDA 3GN2A 3E03A 1JLLA 1DAOA 2CVOA 2VQ3A 1EDOA 3QWFA 1VKOA 1AHIA 2OBNA 1UP6A 3MTJA 4KUHA 4GGPA 5BNFA 4DL9A 3UCFA 4NJMA 1Q0QA 1T26A 2C07A 3Q6IA 3DFZA 3ZWYA 3PFFA 1LJ8A 3QSGA 4R5HA 3ZWMA 3R3SA 1BVUA 4OH1A 5ENVA 4BNMA 5IDXA 3GFGA 4EUEA 4IQ0A 2CDCA 2RH4A 5FI5A 4MP6A 3V8BA 1YONA 4NJMB 3DMTA 5G0SA 4J1NA 4R51A 3NUGA 1R6DA 4IJWA 3WR5A 1D1TA 5JW6A 2D0IA 3AUUA 3M1AA 5AVOA 4GX5A 1SB8A 3FWZA 2OXIA 1P77A 3C1TA 4Z9FA 3VZSA 1JVSA 2OP0A 1WDLA 2HMUA 4U0JA 2NU8A 5EQFA 1BRMA 3ITDA 4F3YA 5CEFA 2OO5A 3R3JA 4MVJG 5A02A 2W98A 1LDEA 4TZKA 1LBEA 1B8VA 2IDZA 1P1IA 2CNBA 3CH6A 4PG6A 1W0CA 2PFGA 2AEFA 3JQ9C 1J5PA 3ZWWA 4CQLA 3FCOA 4OXKA 3L77A 4A7PA 1GV0A 3DHYA 1ZZEA 1ORRA 1DXYA 1PJQA 1R4NA 5CEJA 3OIFA 3GGPA 1EDZA 4XYGA 4N5MA 3EZLA 4BNIA 3SJUA 3NTQA 3H5RA 4QSMA 3AI3A 2B36A 3KBOA 1MXFA 1DJNA 1HDCA 1PU2A 4CQLB 3PZRA 3PGXA 5HA5A 3D1LA 4IINA 4OQYA 1R4NB 2HMTA 4OKNA 3C3XA 2GR9A 1J4AA 1GZ6A 1HE5A 3CZMA 3QHAA 1ADCA 1KVSA 1NM5A 2HQ1A 2QW8A 1E1MA 3SEFA 4FGSA 4MVJH 3IC5A 1IPFA 4O0LA 1KIFA 3COSA 4CMGA 3VH1A 4XQGA 4CLDA 1YL5A 2FSSA 2EG9A 3BAZA 4MVJA 1E92A 3A1NA 3WTBA 1N5DA 2BD0A 4R16A 3ZU4A 5KJ6A 1UH5A 3TZKA 4QFDA 3TZQA 3EVTA 3ONEA 4IJUA 3LU1A 3TWOA 4E31A 3AM3A 2YJZA 2AQHA 2OUIA 2Y67A 3WXBA 3L4SO 2W4QA 1VRWA 1N1EA 2JFGA 2A92A 3BYZA 2GYYA 4OMUA 4LSWA 1WDMA 4W4TA 5KKCA 3C1OA 2EKQA 5F1OA 1HETA 2W2KA 3KYBA 1T2CA 5GZ6A 3L9XA 1BXZA 5C5IA 3I5MA 5H81A 4KDEA 1W8DA 5DBIA 2C20A 2P5UA 3WLFA 3RJ5A 1SZJG 3FR8A 3HB4X 1YRLA 1QKIA 4I5EA 5GZ3A 1NTOA 3FRJA 2ZB3A 1F12A 3QV1A 4HFNA 2ZCVA 3DL2A 3UH1A 2LDXA 1R0SA 2W2KB 4Z9XA 3CTMA 4JP3A 3G79A 2Q4EA 2RCYA 3L6EA 4PG7A 3VPSA 4B3JA 3GHHA 3UFXA 4O5OA 2NQTA 5DULA 2PNFA 4XB1A 3WYCA 4BNUA 1PGQA 3WICA 3I9JA 5GZ1A 3GF4A 1WZEA 4HFRA 3OFSA 4KOAA 3JD3A 3U4CA 2AG5A 1E3EA 3ST7A 3V2GA 4BMVA 5G0UA 1RKXA 3PPIA 2VYVA 4K6CA 1U8FO 4LRSB 4ZQGA 1OAAA 5EN4A 4BGEA 3AW9A 3DWFA 4CUKA 4D3FA 8LDHA 5TC4A 1HYGA 1PS9A 4RPGA 3WQSB 1P45A 5JLAA 3KRTA 3RKRA 2BLLA 4FFOA 5BNIA 2X6TA 1QRRA 3F9IA 3C85A 3OJLA 2ZATA 1VL8A 4CMAA 3BA1A 3W4JA 4QUKA 1ISMA 1PQUA 2G76A 1QORA 5HS6A 4YRAA 1E3LA 5L4LA 1EBUA 2CSUA 3WWYA 4J3FA 4Y67A 4BMSA 3D4NA 3QVOA 1SEPA 3TL2A 3GAFA 3AFNA 1HXHA 4E4YA 1OOEA 4GSLA 3VKUA 1XQ6A 4IJKA 3SX2A 4BO5A 1LQUA 3ZNPA 3V2UA 4D44A 4OOFA 5JY1A 4RQTA 1DJQA 5FWNA 3E5RA 1XG5A 2I3GA 3UGKA 5THQA 2NADA 4BNYA 3LC7O 5A5EA 4IGEA 3WBFA 3GC6A 2WE7A 3K6JA 3Q9NA 4ZJUA 3Q1LA 2I6TA 4C7KA 2WDZA 5KNLA 2C5AA 4Y6RA 1HRDA 3JD1A 4B7UA 5CG1A 4FFLA 2B5WA 4BHTA 1J49A 1HTBA 3DQPA 2EGGA 1XELA 2YQ4A 4AJHA 3IS3A 2CFCA 1R66A 1I32A 2P2SA 4L76A 3GVHA 3IAHA 4O1MA 4DYVA 2NWQA 5IN4A 3NKLA 2RHRA 4AFNA 2XF8A 3P5SA 3H8VA 5EQDA 4DA9A 3DZFA 1QR6A 5H82A 3FNGA 2X5OA 4BO9A 5IDYA 4EEXA 1H6AA 1NX6A 2B83A 2PZLA 3WDSA 1IHXA 3KSDO 4NNJA 1GUFA 5AXDA 4CLHA 3HN2A 3Q9UA 4CQMA 1ADBA 4MKRA 1LDBA 3ROQA 1IZ0A 3UOGA 1KEPA 4J1QA 5A06A 3NV9A 3DFUA 3G3EA 4ZRMA 2QIOA 3CINA 3ZNQA 3EDMA 3VH4A 2ZYAA 5DOZA 2BHLA 4CQMB 2GLXA 3DHEA 1YKFA 2CF6A 1IUKA 1XA0A 1B3BA 1ZFNA 4CMBA 2V7PA 4YQYA 2E4AA 2JHGA 5GY7A 2DTDA 2IXAA 4TRNA 1BXKA 3DC2A 1ENYA 1PGOA 4YJGA 4YT2A 3KV3O 1EUZA 3IL2A 2ZTVA 3KM0A 1ZK1A 1QV7A 1O0SA 2R00C 1LC0A 3ZWPA 1GQ2A 3EYWA 3NJ8A 2AHRA 3ENKA 1NASA 4ND4A 1HE3A 1RYDA 4YAGA 4A10A 2HAEA 1H2BA 3IP3A 1BWSA 4NBVA 1C14A 3S2EA 1HE2A 4YJGB 1C1XA 1U1IA 3G49A 2V6GA 3TRIA 3F4LA 2P91A 4E33A 7ADHA 1ZJYA 2HSDA 3JYPA 3OH8A 4Y6PA 3UXYA 4E5PA 1ISFA 4BQPA 1ENZA 2FSVA 1I10A 3LSYA 3B20A 2Y0EA 4GSKA 3GMDA 5JC1A 4WUVA 2XPCA 4R9SA 2X0RA 3LF2A 3KUXA 4J0FA 4YXFA 1HSOA 1C1XB 1LDYA 1G0OA 4XX0A 1NPYA 2XOXA 3ZCXA 3H5NA 5JO9A 2Q2WA 1ZMTA 1ZH8A 2EJWA 3IOYA 2C0CA 2VRCA 3WWZA 4EDFA 3MJCA 1XCBA 4E5NA 2ZJ1A 4H16A 3T7EA 1XU9A 5CDYA 5T67A 4FGWA 1GEEA 5TQVA 4DXHA 4YWJA 4GL4A 4QFCA 1RM0A 3GAZA 4IXWA 1I2BA 5THKA 1V3TA 4L8VA 2VHXA 3NT5A 1IY8A 1KS9A 4M89A 4BNFA 1TB4A 1JTVA 3C7AA 1UUFA 3RFTA 2EKPA 2Z1NA 3UICA 1TI7A 5K6AA 2Q1UA 1LX6A 2JD1A 1PGPA 4GMGA 4HKTA 5JMPA 3WMWA 5T5QA 3ZV3A 1I8TA 1V6AA 2OGUA 4DREA 5I7FA 4W6ZA 5U4QA 5JDCA 2HLPA 3MJ4A 4H3VA 5JYDA 5ICSA 2Y05A 4CM9A 3JSAA 1Z82A 5JO0A 3K31A 3ZV4A 4BQRA 1EUDA 2ZJ0A 2I66A 4D42A 5CAEA 4A2CA 4IDBA 3WMXA 3JQAA 1WMAA 3V1UA 1FDSA 4QO8A 4Q39A 4FC7A 1M75A 4E2YA 3VZRA 4AJPA 2IRWA 4NFHA 4JX8A 1P1KA 4BO6A 1QSGA 3L07A 5EERA 4XGKA 4TSKA 4LMRA 1OC2A 1PJ2A 4WCDA 1UZLA 4DWVA 3G17A 1YWGO 1CYDA 3QW2A 2YHUA 3HB5X 3PWSA 3QQPA 3BXXA 5TT1A 4L73A 3JQAB 4E30A 2X8LA 1Z6ZA 1LXCA 4JJIA 1MX3A 3P19A 2DM6A 3RU9A 4ALKA 4LCJA 4RZIA 3GPIA 3M6IA 4TROA 5B1YA 1ZXLA 5F21A 2OZPA 3PYXA 4WCFC 2W8ZA 1NQTA 5A9RA 1A27A 2J3IA 3PJFA 4U5QA 4D41A 4CLOA 2QHXA 2BMAA 1Y81A 1GYRA 4GAEA 5L7TA 1R37A 3GLQA 3VDRA 3GRKA 2GD1O 3WYBA 3H3JA 1Z7EA 5DBGA 1RPNA 2P68A 2C7VA 1LLUA 5B4VA 1X13A 2HRZA 3W1VA 4CV1A 3RC2A 4DC0A 5A04A 4LVUA 3RQSA 2I99A 4RGBA 2JCYA 3CIFA 3FNEA 1I5RA 3KSUA 4PCVA 3D4OA 4E12A 3FN4A 2AA3A 3MOIA 4HNHA 2QZZA 3C1AA 3OHSX 3CSDA 4J7XA 2BGLA 1ZK0A 3ABIA 3ZHBA 1NHWA 3AU8A 3Q3CA 4WOKA 5KVSA 3GVPA 2P9CA 3RVDA 1B3RA 1NWHA 5ILGA 1GR0A 5IJZA 1E1LA 2VZ8A 2VTEA 3IJRA 4CM6A 1V3UA 4MVJM 5ER6A 5A3VA 3TN7A 4DYDA 4WGGA 1ADFA 2X0NA 1IULA 3PHJA 1SOWA 3GMSA 3OM9A 4B4VA 3NDIA 3BZUA 1KC3A 1T1RA 5L9AA 5TRTA 1MG5A 4W99A 1D1SA 2TMGA 3TFQA 3W8DA 1F8GA 5KJCA 2P4QA 4FJ1A 3SBOA 4NBWA 4CUJA 5I7SA 4NDNE 5CHEA 1Z45A 4C4OA 1HZJA 4LSMA 4MO2A 2J3HA 4OQZA 4XQ9A 2DBRA 4JP2A 5TX7A 3LVFO 3ULKA 2NU6A 4JBGA 1YL7A 1EMDA 2VHYA 4RDHA 4D0SA 3JYNA 5IDQA 4EW6A 2VOJA 1FF9A 1P33A 1QLJA 2C2YA 4U0KA 4R1TA 3JQEA 4EEZA 5FFFA 1EVZA 1K3TA 3CE6A 2O3UA 2ZIZA 5IXYA 2R00A 2I76A 3FF4A 3LLSA 3WSWA 3DR3A 4Q3BA 1DLJA 4OXNA 4YAKA 2W90A 4YCAA 1E1NA 1XDWA 4N5LA 4BL5A 3O8QA 3E48A 1LLQA 2OORA 2QQ5A 4K1LA 4XCVA 3EK2A 4RQUA 5BSHA 4QX6A 3M2PA 5EMHA 3RUCA 5TT0A 1NQOA 4DPMA 3E1KA 5TNXA 3DDNA 4DUPA 5L4NA 1P0FA 4LISA 4PLGA 1N8KA 1HEUA 1P31A 4PRKA 4FFMA 1ZSYA 1EQ2A 2QX7A 1Q0HA 2NU9A 2Q99A 4TKLA 3ADOA 4AL4A 5J23A 3PXXA 3O8QB 4XA8A 5KTKA 3PHLA 2CVQA 3DEYX 2JL1A 4BNGA 4CODB 4GVXA 2AQ8A 4QECA 4Y98A 1IZ9A 4Y9DA 3O4RA 3AM4A 3B70A 2NTVA 1PJLA 4PG5A 1KVRA 2A4KA 4TVOA 4E21A 2Y66A 1E5QA 4Y8VA 1O95A 2H6EA 1D4FA 4HNGA 3VAZA 1UDCA 5JDIC 3F6YA 3QWAA 1BG6A 3AM5A 2NM0A 5F1PA 3VPFA 4B8ZA 2D1YA 1VJ0A 4BIIA 3STHA 3W6ZA 3UW3A 1ZXBA 4NU6A 1I30A 3BHMA 4WLNA 4CMIA 3C7CB 4YT4A 4IUYA 4UUOA 3ZWBA 1GAEO 3T7CA 4CM8A 3I4CA 2YZ7A 3CPSA 4J49A 4BNTA 1WXDA 1WZIA 1R0KA 1P0CA 1PL8A 4K26A 2VRBA 4D3DA 1AHHA 2ZQYA 3UUWA 3E9MA 3RC9A 4PRLA 3GRPA 1B14A 1QP8A 4B4OA 3E9NA 4CMIB 4GI2A 3X2FA 2NTNA 4RVFA 5IF3A 3WGYA 4B8WA 1CEQA 2PK3A 4CM8B 4K9DA 3SXPA 4L4SA 2VTDA 1C1DA 3WBBA 1JKFA 1XHLA 1DIAA 1JU9A 1Q7BA 3HFSA 4DVJA 4MKZA 3NRCA 1P44A 2I3AA 3NT2A 3WNVA 4R3WA 1I0ZA 4WNIA 1RWBA 2PD4A 4NK5A 3TOXA 4GH5A 3VPHA 4F45A 5KKAA 1TXGA 1H9AA 4GKVA 5HM8A 2GSDA 4WK6A 4FSHA 1C1DB 1MG0A 4A73A 3RUDA 1A71A 4RVHA 3QA9A 5JCJA 4BV8A 3LC1O 3LT0A 4WCFA 3P7MA 4IDGA 3IP1A 1Y8RB 3C24A 4WLOA 4OOEA 1T2EA 4WLEA 3U09A 4B4WA 2Q3EA 4JLWA 2GUGA 1NR1A 3GEGA 1DRVA 4LRTB 5LCXA 1B15A 5DOVA 2Z5LA 5BSGA 3VKVA 1TEHA 3I6QA 4IQ8A 2FY8A 1Y7TA 4WCFB 2I5PO 3QJ5A 3EUWA 5HTOA 4Z0TA 2HKIA 3PHGA 4YBZA 2D5CA 4GWGA 1JVBA 3FTPA 4EJ6A 2VWHA 3E5MA 3VHRA 1BDBA 1SCUA 2PD3A 4IMPA 4BS9A 3QLJA 5I8ZA 1HKUA 1MV8A 2DTEA 2DTXA 3AY7A 2G1UA 4BB5A 5MGBA 2PZKA 2B37A 4RVUA 5JXWA 4CV3A 4R5MA 3AFMA 1X1EA 3VTZA 1BDMA 4W7HA 2AE1A 1E1KA 3RCBA 1UXHA 3GVXA 1UP7A 3DBLA 3NT4A 3KTDA 3ANLA 2HMWA 3OIDA 3ZI0A 2CVZA 2UUPA 1A4UA 2ZB8A 2VCYA 2QRLA 3KB6A 3VZQA 3WGGA 4AJEA 4AG3A 3N74A 2UDPA 2TMDA 3EVNA 1GUYA 3PTZA 4WECA 2BELA 3WIDA 1YJQA 2DPHA 2Z1MA 5FI3A 4EUFA 3W8FA 2CUKA 4FS3A 4K28A 1R12A 3DBLB 3PWKA 1NR7A 4J7CA 4XB2A 5AXBA 2DUWA 5DNAA 1NPTO 5MDHA 2C59A 1HDRA 4XR9A 4J0EA 2AQKA 3ROKA 4CM3A 2PV7A 1N2SA 3K73O 2VHWA 3WIEA 2VYND 3TZ6A 4AJNA 5L4SA 4R4JA 5IZCC 1FJHA 1BTOA 5TSDA 1VLLA 1P1FA 1Y8QA 4CJXA 4E13A 2ZB7A 1M6HA 4CMHA 5EL0A 4O6VA 3PI7A 1F8FA 1T2FA 3OJEA 3ANMA 3PJGA 1QMGA 2Y1GA 4O63O 3WB9A 2BGKA 5CDTA 1FDVA 1LC3A 2EW2A 2GN9A 1GD1O 3U4DA 4EUHA 2EW8A 3NGXA 4G2NA 4LVCA 3PP8A 1HSZA 1HL3A 3K2BA 3DBVO 2X9GA 4KTTE 4PLPA 4WLVA 1G6KA 1Y8QB 3ZW8A 4XKJA 3ZWVA 1NHGA 4DBVO 2O23A 4E2WA 4B3IA 2FMUA 1MXHA 3OECA 2HCTA 3HDHA 4RVSA 3OETA 1GCUA 2BH9A 2Q2VA 3E8XA 5F3RA 5ITVA 5K0ZA 5KVCA 2Y1OA 3K2EA 5ILOA 4WKGA 5FYDA 3PQEA 1YDEA 4N7RA 1I3KA 1T1SA 5JDIA 4XRGA 5JAIA 3S2FA 3EMKA 4I5FA 3E82A 1W4ZA 1LSJA 4I5DA 4FJ0A 3BMQB 1A7AA 1DEHA 2RAFA 2DKNA 3VH3A 2EP7A 2PWZA 1Y5RA 4J7UA 3GNTA 4YDRA 4LMPA 2D3TA 4LK3A 5F1KA 3JCZA 1YQGA 1UP4A 5TGDA 3FD8A 2X23A 4FQ8A 2NNLD 2J5QA 1AXEA 2JD2A 9LDTA 2X86A 5L53A 4P38A 3TF5A 4KDFA 1EFKA 1I33A 3DAGA 4GBJA 1SEVA 3RKUA 3RUHA 2FR8A 1E6EA 3K5PA 1U8XX 1E3WA 1WW8A 1NVGA 4ZU3A 4J9UE 3VZPA 1OBFO 2WSBA 3TQHA 4CL8A 5KVQA 2JHFA 2GNAA 1SPXA 1B8PA 1UZNA 2IEDA 3LT1A 1PZHA 4DLAA 3Q2IA 1EVIA 2Y1FA 3KETA 1CRWG 3DONA 3H7AA 1U5AA 3QRWA 1E7WA 4YQZA 1V8BA 1GYPA 2HK8A 1E3WB 1W6UA 2I65A 5K6AC 2E37A 5ICMA 3I1JA 4KMSA 5HWSA 4RPKA 3HZZA 3JV7A 4R3NA 5I9MA 5I8WA 1PQWA 1YE3A 1MFPA 1WLYA 3W4KA 5JDCC 4RL6A 2I9PA 2NVWA 4AJJA 5A1TA 1JN0A 3LT4A 3S2GA 4RPLA 1PR3A 1MB4A 1ZUD1 1UXGA 4JCOA 4YJFA 3RC7A 4FC6A 2IZ0A 5L3ZA 4QO7A 4Z0PA 3KOUA 5G2OA 2A35A 4AJKA 2DC1A 4BB6A 1P74A 5JE8A 3DHNA 3GDFA 1QYWA 3I52A 1MUUA 4MIOA 1M6WA 1X0XA 2HJSA 1CDOA 3PLNA 5CP8A 5A9SA 3OQBA 3BHIA 4YJFB 4X54A 3F4BA 4INAA 3L6OO 3PRJA 4XYEA 2PKRA 3PVZA 3GN1A 5B37A 4JN6B 3QP9A 3ICPA 4E5YA 1C0PA 3F5QA 3V2HA 2DVMA 3PYLA 1F14A 4Z6KA 4IDCA 5JC8A 1BSVA 4UUNA 5JCXA 5A9SB 1R16A 3TZCA 3V5NA 4EITA 5HBRA 2HDHA 4GLOA 2I67A 4II3A 1ONOA 4JK3A 2X9NA 4RVGA 1PIWA 3QIVA 3Q0EA 3AY6A 2Q1SA 1UXJA 3DTTA 3LZ6A 4MDHA 1P1JA 1DIGA 2J3KA 4BVAA 1DBVO 3DAFA 1ONPA 2VWGA 3ROPA 2BI7A 4BNJA 4CL3A 1E7RA 1S7CA 4GX0A 3H9JA 1O6ZA 2Q2QA 2DBVO 1XKQA 3D0OA 1HDXA 1K5HA 1H93A 4MVJD 1U3VA 2FWMX 2WYUA 4BO7A 2IODA 5ER9A 3K30A 1M66A 4W9NA 2OBYA 3KYCA 4PZEA 2OL4A 4GKBA 3VH2A 4BO1A 4D79A 4EJ0A 1EE2A 4BO2A 1IYZA 1PEDA 3IUSA 1I2CA 1A9YA 3EGOA 1EE9A 5IZCA 2E82A 1A9ZA 3GVCA 2VOEA 2VNSA 4IBOA 4IQGA 5G0TA 1H0KA 2RIRA 2X9VA 4YJHA 1X7HA 1N1GA 3ZH2A 1NFQA 3GDOA 1ISJA 3KYCB 2YHIA 3MZ0A 3O38A 4L74A 2GN4A 1EK5A 2B4TO 4ZVVA 2PH3A 1NNUA 2ILTA 3GZ4A 4D43A 1JAYA 1O94A 4RORA 2UYYA 4DMMA 4J43A 4HXYA 1ZVMA 3TPCA 1F06A 1PX0A 3DZJA 2V65A 4YJHB 3WOHA 1ZK3A 3LYLA 4UULA 4L75A 1AGNA 1DIHA 1DC6A 3FR7A 2FN7A 2QZ9A 2YHIB 4BNXA 3S8MA 4PG4A 2XAAA 4KWHA 5G4KA 2YW9A 2CD9A 4FFRA 1C3VA 2CMDA 1C0LA 2DAPA 1T2AA 1QYCA 4P4GA 4XWYA 2Y99A 2O2SA 1EEHA 1FXSA 5C7LO 2HUNA 2P9EA 4UVGA 4R68A 5JAZA 5BSFA 5G4KB 4H15A 1BMDA 4TRRA 3ZU5A 4WPGA 1NAHA 3L4BC 1NP3A 1WWKA 1Q7GA 5IXSA 1QV6A 3ZNOA 4QTZA 1GL3A 3INRA 4ALLA 1DFHA 1RM5A 4J90A 1VE9A 2A9FA 4KP7A 4KZPA 3D7LA 2FPPA 2Q46A 3GNQA 1ZW1A 5COAA 1A4IA 3BIOA 4I9HA 4UVDA 4NBRA 4Q3DA 4MP3A 1YB1A 2GASA 2NVUA 3OEWA 1ENOA 3MTGA 5AQ1A 1ZKMA 5T8KA 3FPCA 3JQGA 3AY3A 3O03A 3PGJA 3T4EA 2VUTA 3W8EA 4A03A 2AEJA 1DIBA 2EV9A 3H9GA 4MPDA 4BNHA 4XJSA 1VM6A 3RD5A 4ZD6A 3RWBA 3N58A 1AUPA 1NYTA 2F1KA 4HUJA 4J4HA 5TS3A 3MWEB 3GZNA 4DIFA 5U9CA 2O2YA 4WNCA 2NVUB 2GN8A 4R1SA 1PJ4A 1LEHA 3I6IA 5BSEA 3ONDA 4BOYA 4FFNA 4RLHA 3JQGB 4E2ZA 3EY4A 3A9WA 3P2YA 4YB8A 2WM3A 3GEDA 1VPDA 3GG2A 3B6ZA 2B35A 4LN1A 4XYBA 1QYXA 1I36A 4FB5A 1H6DA 4PN3A 1A72A 3F1LA 5BT9A 3FSRA 3U3XA 2W2LD 3GZNB 5I9NA 4EI2A 1UXIA 5AXAA 1YB4A 4W82A 4XZ3A 2VUUA 3MOGA 3QVSA 3CEAA 3WFJA 2EP5A 4BO4A 3ANNA 2EF1A 4RVDA 4FOOA 3CMMA 1DLIA 2AXQA 1FK8A 1TLTA 2GF2A 1Z73A 1BXGB 1T24A 1WVGA 1U7HA 2VT2A 2WTBA 3S55A 4I8XA 3DZHA 2JAPA 3I83A 2V6BA 4II2A 3W4IA 5AYVA 1I3MA 5B12A 4DMLA 3AWDA 3JQBC 3ZWXA 3PK0A 3LC2O 2WE8A 1T4DA 3GOHA 3ZHZA 1RJWA 5KWEA 1EVYA 1P1RA 4YT5A 1YS4A 3RBZA 1LRKA 1ML3A 3HNPA 3S1LA 2YV2A 3IMFA 3LF1A 1Z7BA 3GG9A 4A0SA 4GPD1 1GTMA 1ZBQA 3D5QA 1DB3A 4WASA 1IHYA 3GNSA 3HADA 4CLRA 5IAAA 5AXCA 4UEJA 3X2EA 1YB5A 5ADHA 1BVRA 4E2XA 4JGBA 3BMCA 1K6IA 3NYWA 3QVXA 3SC4A 3WTCA 1YDWA 1S6YA 5CFZA 1RYEA 1MA0A 2BI8A 3K9QO 2YYYA 1N9GA 1LNQA 1ZEMA 2E6UX 3GEMA 3ZWCA 4CLRB 2G17A 3PIIA 2ET6A 2HK7A 1P1HA 4IZHA 4M1QA 4CMCA 3RASA 1OZAA 3BMCB 4Z3KA 2B4RO 1XWFA 5A03A 4FN4A 1JKJA 3ZU2A 5G4LA 1T25A 4DIOA 3FHLA 4BNWA 5HRUA 2UV8A 2O3JA 5DCUA 1N9GB 1GFSA 3DAPA 3HFGA 3GK3A 1XYGA 1K89A 2O7SA 5IZ4A 1H6BA 4F6CA 3I9KA 2BKAA 4TZTA 3E18A 2GPTA 5ITWA 4FDAA 4M49A 2DBZA 2EERA 3QE3A 3ZHYA 2PH5A 1NFFA 1R4MA 1BW9A 3G1UA 3OP4A 4J4TA 5FF9A 3P2OA 4ILKA 5C7OO 1L7EA 2VRCD 1SO8A 4UREA 1RM4A 3RSHA 1ZJZA 2O50A 2GZ1A 3KYDA 4M86A 4NZ9A 5DN9A 4YT8A 2POQX 1QXSA 2RH8A 4XGNA 2EGHA 4FJ2A 1VC2A 2A94A 1KOLA 1WPQA 1PGJA 3F1KA 4BGVA 2IEBA 1NVMB 5JNLA 1R4MB 1BW9B 2O3QA 4BNNA 3ETDA 1H94A 5EJ2A 1E7SA 1IB6A 1U4SA 3JD2A 4GX2A 4E32A 1YQDA 4D3SA 5KOIA 3KYDB 3MJTA 1X7GA 4NI5A 4WEOA 3ROMA 2LDBA 3L4BA 1MP0A 3ASVA 2D8AA 4PG8A 4Y6SA 4CUZA 5AOVA 4PZCA 1PL7A 3B1KA 1UAYA 3K8ZA 1XR3A 2ZK7A 4DGSA 4MVJI 3F47A 2GCGA 1LA2A 3MCVA 1U9JA 3VC7A 4IDEA 3NEPX 1GUZA 1DIRA 3ETGA 1DRWA 1B0AA 4WE3A 1I3NA 2OP1A 1X14A 2HMSA 3A06A 4ALMA 2O3SA 4PLHA 4B4UA 5C37A 2HRBA 2AW5A 2PKQO 4O59O 1K6XA 3U0BA 1TT5B 1G1AA 1DFIA 3OJFA 2ZTMA 6LDHA 2QRKA 4KWIA 1YBAA 3DO5A 3CZRA 1O9BA 4AVYA 1NQAO 1UXKA 1Z75A 4UUMA 4TRMA 4Q3EA 2GZ2A 3WQQA 1V35A 1ADGA 1GDHA 3GUCA 4PLWA 2VYNA 3TOZA 4BO8A 5T57A 4Q3AA 3HWRA 1PS8A 4I1IA 4DRYA 4P8RA 1ULSA 1MLDA 1E3SA 4ZQHA 4BGIA 4YR9A 2CDAA 3D3WB 3OMLA 4KQWA 5HS4A 3OJOA 5TLSA 1ZEJA 3OSUA 3OEYA 2HK9A 2SCUA 2PLAA 4FD3A 4YACA 5JPIA 4RPHA 4HY3A 3WGIA 1NAIA 3FBGA 3T4XA 3W6UA 1DC3A 3NTRA 4ALIA 2WYVA 2Y1CA 3RUAA 3CMCO 1U2GA 3AI1A 3TDKA 3RBVA 4HP8A 4E3ZA 4ITUA 3BMNB 5A3JA 3R0IA 1Y8RA 3F46A 4TKMA 4ZN6A 3F3SA 3FTNA 4LCEA 2EHDA 5BR7A 1UAGA 2ZTLA 5IFLA 4IGFA 4CR8A 1LDGA 3FBTA 1LRLA 3DB2A 2V6FA 4TMFA 3ZU3A 1DOHA 2UVDA 4XJTA 1HDOA 2O4CA 5A9TA 3GFBA 4OKIA 4UVHA 3H9EO 1KVUA 4IZIA 3JQBA 1Q2XA 3FWNA 2PGLA 1O89A 2JFHA 3KEQA 2V6MA 3JYLA 4IIUA 2WD7A 4JJGA 4Q3NA 2IZZA 4YJDA 4NBUA 4NMHA 4NU5A 3PDUA 3OJ0A 3M1LA 5IDWA 1GEGA 2FOIA 4PVCA 1U7TA 1MGOA 1VI2A 2B69A 2P4HX 2X0JA 3H3FA 1ZK2A 1LUAA 4AJ4A 4RF3A 1LRJA 2WD7B 2O3TA 2JJYA 1GCOA 3PWZA 4XIYA 3RIHA 1ZNQO 2X0IA 5JYEA 3U5TA 1GQQA 2WD8A 4BV9A 1XEAA 4KQXA 2GGSA 1CWUA 4S3MA 3NTOA 4OJNA 4DPLA 2E48A 4B7CA 5DP1A 4BNVA 3IJPA 4XYMA 3ON5A 2PD6A 4DLLA 2O3RA 5ENDA 2G82A 2PR2A 1N92A 3HN7A 4HX5A 3DBRA 3JQFC 3RUFA 4IJVA 1FDUA 4R69A 2JCXA 1QYDA 3AUSA 1ID1A 1KBZA 4GQAA 4NBTA 5DBFA 3WFIA 4N5NA 2Y0DA 1EK6A 4ONEA 3FI9A 3I23A 1NXQA 4GVLA 4HWKA 3BTOA 5K9ZA 3H5AA 4NQZA 4R9RA 1ISHA 3VTFA 1E6UA 2AE2A 3DBRB 4NPCA 4TQGA 5L45A 2EIHA 4M55A 1PZEA 3ONFA 4CMKA 4OIMA 1HLPA 1D8AA 3GHYA 4NR0A 4YAJA 3ZWAA 2RHCA 1WP4A 4ZRNA 2XXBA 3NDJA 3KVOA 3HSKA 3LLVA 1Q0LA 3PJDA 4W9NC 5IG2A 1HYEA 1VL0A 2O4UX 2BFPA 3IIEA 1EVJA 1L7DA 4N18A 5TJ9A 2QRJA 4B79A 1EUCA 3HDQA 3MJVA 1XQ1A 2VWQA 5A5FA 1T2DA 4UEKA 5CDUA 1VKNA 2NTJA 5LDGA 3VDQA 2G5CA 3PZBA 3E6AA 1NFRA 3DZKA 1F0YA 1YXMA 4BO0A 4E0BA 3GR6A 3I9OA 4MVJP 4IM7A 1AN9A 3LQFA 2FZWA 1W73A 1N7GA 3ZV6A 4Z9YA 3ZDFA 2NVBA 3TJRA 4XQEA 4BNZA 3WGQA 4EBFA 1PGNA 2R6JA 4FCCA 1E77A 3VOSA 1G0NA 2Y0CA 4RLSA 2D5AA 3OF2A 3TSCA 1M2WA 3AI2A 4I9UA 1U28A 3NGLA 1YJ8A 4BKRA 3BMQA 1DC5A 1IE3A 1Y9EA 1PSDA 1KYQA 4U8GA 4N54A 3WNQA 1U3WA 2GN6A 2IZ1A 3ZZNA 1B26A 2QYTA 1V3VA 3WGZA 3C8MA 2E49A 1H5QA 2ZQZA 1GU7A 1GV1A 3L9WA 1LDNA 2OHXA 4ZQEA 2JD0A 2WMDA 1IOLA 3OICA 3RAJA 4D7AA 1PS0A 4FBGA 5L7YA 1I01A 4TRJA 3D4PA 3KZVA 4MP8A 3L0DA 4HBGA 2QG4A 3C7DB 1ZIDA 4Z0HO 1LDMA 2AG8A 3DOOA 3KSZO 3WQRA 4D0RA 2Q45A 4NFYA 5T6BA 1I24A 1HWYA 3IKTA 4LGVA 2B0JA 1VJTA 1ZSNA 3MEQA 3RC1A 4NK4A 3HUDA 4C7JA 3VVCA 1A5ZA 5CG2A 4URFA 1P9LA 4U6QA 5DCYA 3UVEA 2ZYDA 4G65A 5KJFA 3BTUA 4PLFA 1PTJA 2D59A 3RU7A 2B4QA 5JCJD 1U3TA 1RM3A 2AMFA 3RUEA 4IXTA 2VZ9A 1B8UA 1H6CA 3ZGYA 1Y9AA 2GRAA 1WNTA 1E6WA 4HFMA 1PZGA 1FDTA 4XQCA 2GDZA 3H2ZA 4MINA 3WX0A 1GPDG 1H2HA 3PQDA 3ZW9A 4DLBA 4MIYA 1DHTA 3JQCA 3GUYA 3INTA 5T8KC 3KLMX 1DDOA 3D5TA 3WG9A 1J0XO 3K96A 4HFJA 1CETA 1YBVA 1B7GO 4JNKA 3F5SA 2PZMA 3ZNNA 3OA0A 2X1HA 1E3JA 4OO3A 3QVTA 4XIJA 1UR5A 4QEDA 5BNTA 2ZKLA 3DOCA 1HT0A 4RO0A 2WJPA 4P4NA 1JWAB 2BFAA 3KXDA 1LI4A 3I9MA 1I3LA 2PKQP 3INGA 1U2DA 1ONNA 4CMJA 1AE1A 3KLPX 4JQCA 4PIVA 1X1TA 1PJSA 2X7HA 3SLGA 3SVTA 1YOVA 3ORFA 4A27A 2Y1DA 2FRDA 1I2ZA 1DPGA 1DFGA 4UUPA 4RV9A 5F5LA 3WYEA 4DC1A 2IE0A 3E9QA 1IL0A 3HQ4O 4L9RA 1JKIA 1OC4A 1OI7A 4BKQA 3NDRA 4JROA 1BHSA 4OSPA 5CPBA 4U6SA 4PLZA 3RI3A 5KJEA 4NJOA 3SJ7A 2VUSA 3UN1A 4IMRA 2C2XA 2NUAA 3I9NA 3ENNA 2IYOA 3PJEA 2YQ5A 1YOVB 3WLEA 4DIBA 4PFJA 4ZHSA 1JAXA 1NQ5A 4E6PA 4PLCA 5B4UA 1LSSA 4TVBA 3IQDB 3JQFA 4JBIA 4RF4A 4CLEA 2Y93A 1LSOA 1DO8A 1V0JA 2C82A 3JQ6A 3N7UA 4JJFA 3OIGA 1GZ3A 3A14A 3HJAA 2PY6A 3JTMA 3GA0A 2O7QA 2WYWA 3ASUA 4GWKA 1EFLA 4M87A 4OM8A 4WLUA 5CPFA 3UAGA 3OA2A 5JSFA 2BGMA 4I08A 2EXXA 4KUEA 1SB9A 1OFGA 3MJEA 1XU7A 4L4XA 1UDBA 1PJBA 4CM7A 4F6LA 3WS7A 3WJAA 4CM4A 4ZICA 4R1NA 2DLDA 1VSUA 1ISIA 3CXRA 4E5KA 4BNLA 1K6JA 2OMEA 3OBBA 5JS6A 3VPGA 1ENPA 2P9GA 1A7KA 4B3HA 1E3IA 4MOWA 3DZBA 1LU9A 4XD2A 3AUTA 2W2LA 2VNAA 3QVWA 2DT5A 3AOGA 1U4OA 2RBEA 4J4BA 4NG5A 4CM4B 2BF7A 3UHAA 2CZCA 5JFOA 3JQ9A 1LLDA 4UEOA 4NIMA 3UCEA 3ZWNA 1GQYA 1OMOA 4GGOA 5LC1A 4YRBA 1PZFA 3EW7A 1KVQA 2DFVA 5L40A 3BHJA 4CM5A 1H9BA 3DOJA 4B7XA 4IDDA 2R2GA 4AJOA 3AOEC 4K6FA 4R41A 4AJ2A 3RUIA 3V1YA 4YA6A 3GH3A 4ZQFA 3JD4A 4J2HA 1CQIA 2PTGA 1ISGA 2ZYGA 5U1PA 2D4AA 3L6DA 3H4VA 1QLHA 5L7WA 1KEVA 4XR4A 2BFMA 1F17A 1ZSVA 1SBYA 1HYHA 2X58A 3GGOA 1MFZA 3O9ZA 4IY1A 3UF0A 2C29D 3LK7A 1D3AA 1PL6A 3ICCA 2FHSA 3LDHA 2WWRA 1K2WA 3TNLA 2PGDA 3IKVA 4BNKA 1HDGO 1KERA 1JDJA 1HE4A 4PLYA 4HV4A 5A4DA 1LLCA 4GX1A 4LW8A 5BQFA 4OAQA 4XEHA 3I4FA 2PZJA 4R01A 2DBQA 5I9LA 5I7EA 1GPJA 5COQA 1PR9A 3QWIA 4GLLA 4YTEA 1R0LA 1ZCJA 4OYRA 2VYVD 2PGJA 4TWRA 1E7YA 2DQ4A 4PLVA 2EJVA 4FW8A 4NFSA 2CY0A 3ITKA 3ZWOA 3O26A 3ZHXA 1NPDA 2JFFA 3AJRA 3PHHA 2J6IA 3PDJA 1HLDA 1KY5A 2VHVA 1EBFA 2EKLA 1R15A 1KEUA 1YO6A 2EEZA 3DMYA 1VL6A 4BKOA 5DF1A 1UJMA 2Z95A 4F46A 1E7QA 3NAQA 4J16A 1PWXA 2Q1WA 2Y68A 2YV3A 1MC4A 5C3MA 1HF3A 2HO5A 4FIZA 1O8CA 2YFHA 3JYQA 4JBHA 1XLTA 1XGKA 4FOSA 4IPTA 4MVJF 1JQBA 5GMOA 4R54A 1DC4A 1EZ4A 1L1FA 4RPJA 2DUUA 2HMVA 5DT9A 3ZV5A 5C7IO 4JXKA 5H83A 2AQIA 3FNFA 3HG7A 4OL9A 2FPIA 4QT0A 4ND3A 3HE3A 4OGWA 4ND1A 5G0VA 1DRUA 4FR5A 4ND2A 2YUTA 3JQDA 3WGTA 3GPDG 2C5EA 1KVTA 4ZA2A 3RROA 3U9LA 3NX4A 2UUOA 5KJ1A 2H1SA 1XSEA 2WEKA 3RJ9A 2NV6A 2Q50A 2YDYA 7MDHA 5JY6A 3R1IA 4XDZA 2X4GA 3U4HA 3BTSA 5JBIA 1BXGA 1P3DA 4RJTA 2B5VA 2GERA 4R1UA 2NU7A 1ZMOA 4EZBA 3M2TA 3VVBA 2GO1A 4ZGWA 3SC6A 1QYVA 5DZSA 4CR7A 4PZDA 3TL3A 2J5RA 3TFOA 4DTIA 3HDYA 5FEUA 2VN8A 4L0QA 5KIAA 4YPOA 1YVEI 3EC7A 4JIGA 4J9VA 5I7VA 5CDGA 1YBMA 1VSVA 1N7HA 3UCXA 2XXJA 3IUPA 3QWBA 1E0DA 4OHUA 1CERA 3B1JA 3PYMA 4L4RA 3BTVA 4Q3CA 5KVVA 4XYLA 3JQ7A 4CQMD 5JAQA 2D2IA 4ESOA 3DTYA 2NLOA 3H65A 4M54A 3RBXA 1KY4A 2FR1A 2P5YA 2IYPA 2C54A 1Y5MA 3B1FA 5T64A 1WAMA 5TIIA 3QWHA 8ADHA 1SC6A 4CMEC 1TA4A 3JQ7B 1SOVA 2YY7A 4WLFA 4CPDA 3R6DA 2BFOA 4CV2A 1XIVA 3U62A 3UKOA 4KTVE 3WJ7A 3JYOA 3PHIA 1Y6JA 5G0WA 4IS2A 1YGYA 1GZ4A 3MJSA 3DXFA 3KO8A 1JWBB 3EZYA 4J6FA 4QQRA 4RF2A 1EQUA 3U49A 1LSUA 4YYZA 3PQFA 5EIOA 3RFVA 3IDSA 3G0OA 3VPXA 4U7WA 4ALJA 4DQUA 3EAGA 4CLOB 4CR6A 1NVTA 2J8ZA 4YRDA 1U5CA 5B4TA 4CLXA 3KHUA 2ZTUA 3A4VA 1PQPA 1Z74A 3ETEA 3GY0A 3AOEA 3DMTC 1DHRA 1CQJA 4BKUA 2Q49A 1CJCA 3I9LA 1B16A 2FPGA 4P22A 4NH4A 2IXBA 4BKPA 1DAPA 1NWCA 4IIVA 5JMWA 1CF2O 6ADHA 1X0VA 1JA9A 1VJ1A 2CF5A 3CKYA 4EGFA 4ID9A 4AJLA 4CV0A 3GQVA 1T4BA 1C0KA 4OSOA 4WEQA 1UZMA 4NHEA 2YFQA 4CM1A 5CEEA 1U3UA 5COBA 4MJLA 1GADO 2JKVA 1J6UA 2QYSA 2GZ3A 3OQ6A 4I9NA 2UAGA 2X5KO 3BMOA 1WMBA 2ZCUA 3DBHA 3H9QA 2VWPA 4W7IA 1FMCA 2DPGA 2DU8A 4ROSA 1HDZA 3V1TC 3GT0A 4Q9NA 3PLRA 4M8SA 3I3OA 4UVIA 5DDIP 3D64A 3GDGA 4MVJE 3U4IA 4ALNA 2PA3A 3HDJA 4J91A 4BUCA 1GY8A 2Q1TA 3H2SA 4DQXA 4WOJA 1ULUA 4S1VA 5TJHA 1AXGA 3BMOB 4PLTA 3WGHA 4E5MA 3DBHB 4IDAA 4G81A 1D7OA 1TVEA 4RZHA 2Y1EA 3ZN2A 1ARZA 5L51A 1TT5A 2Q4BA 3DZIA 2H63A 1KETA 1MC5A 4IS3A 4IDFA 3AK4A 3S2IA 4CM9D 1Q7CA 2VHZA 3D3EA 2JAHA 2ZB4A 2X5JO 4BO3A 4OXYA 3AU9A 5L95A 4J1TA 2CDBA 4RDIA 1ZO8A 2EWMA 4AJ1A 3DZGA 2FP4A 3JQAD 3NJ4A 3RFXA 1BGVA 4MIEA 4XGIA 4DBZA 1JW9B 1NBOA 2DFDA 4AICA 4YAEA 1PJTA 2JCVA 3QY9A 2AEMA 4RF5A 3GGGA 1CIVA 2HU2A 3D3WA 4XDYA 2OOSA 4MKXA 1ZK4A 9LDBA 3LT2A 3JD0A 4GMFA 2OFPA 1YQXA 2HJRA 4Z3DA 3WSVA 4D45A 4RCVA 5A05A 4PVDA 1SNYA 2G0TA 1LTHR 1M67A 2C7GA 1DSSG 4FPXA 1HDYA 5TF4A 2O48X 4EJMA 4EYEA 3BMNA 1FDWA 2VZ0A 4PGFA 5F5NA 1Y1PA 2FZEA 3FNHA 3MWDB 4UAGA 4H7PA 5EESA 1GYQA 1WDKA 2F00A 3K92A 1YH3A 4HADA 4P4LA 1PWZA 5ES3A 1QG6A 4A26A 1SMKA 3G1TA 3PIDA 1X7DA 4DPKA 1SAYA 3Q11A 1KC1A 2YV1A 4FFPA 2X22A 4UVEA 3HHPA 3FPLA 3A28A 1HZZA 3JQ8A 3ADPA 3H9UA 3SLKA 5DP2A 4YVFA 5KCZA 4ZQBA 1PJ3A 3Q2KA 2J5KA 1TT7A 2J3JA 1UDAA 1V9LA 1PJCA 1LQTA 2NSDA 2YDXA 4WJZA 1KEWA 1X15A 4KUGA 4D46A 3PFWO 3KEOA 4BGUA 4BMNA 2BRUA 1M76A 5EPOA 4DQVA 3CUKA 1YL6A 3OQ1A 2NQ8A 1E5LA 3JQ8B 5DCWA 4YAIA 3PEFA 2VT3A 2H9IA 2H5LA
chains in the Genus database with same CATH superfamily
3C3JA 5DX0A 1I4LD 3A6LA 3FFXA 4Q4LA 3L0PA 1GAXA 5HFAA 2MOKA 2R5NA 1BU5A 2R7LA 2XDYA 4L2IB 4C0QC 721PA 3JY6A 4OXXA 2IYZA 3SMQA 1UBMS 3BQMB 5CDSA 3I01A 3GVIA 5AP9A 3ZD9A 4D74A 4I5GA 5IAOA 1I1OA 2GBIA 1IBSA 1WUJS 3Q5DA 4JJ4A 1W7AA 3I34X 5DBEX 1TU0A 3JWJA 1WW2A 4M0FA 4HATA 5FFNA 2R84A 2R6ZA 4MQMA 1YRWA 2YL2A 2IH2A 1JAZA 5INTA 2JJQA 2PLNA 3G2HA 4IRMA 2CVOA 4H3SA 4ACBA 3QWFA 3IAEA 4K8RB 3NDPA 4KQMA 1VKOA 3KX2A 5EIXA 3IX7A 4DZZA 4AI6A 2AD1A 3M5WA 3MTJA 4DL9A 3QVGA 4NJMA 3V1NA 5ESWA 3WB9A 2GWHA 3ZWYA 1LJ8A 3DFIA 3EGWA 4MJ7A 3G02A 4X41A 5AUQA 3R3SA 4BNMA 5FCDA 5IDXA 1E8MA 4FFDA 1K3UB 1ABFA 4ZALA 2EDAA 4EUEA 1I7PA 1VJ5A 1JLLB 2JLAA 2OFWA 4IQ0A 3VO9A 4B6QA 1AG9A 4LKRA 1VMEA 5TQ0B 1B1CA 3FWHA 1KY3A 3JVEA 4G0WA 1M2KA 1WXIA 3UWOA 5G0SA 9MHTA 3I39X 1F7VA 3NUGA 1R6DA 4H1WA 4CIBA 5K4HA 3M5PA 3WR5A 2MSDB 2DJ5A 2XUZA 3LWNA 5AM5A 5EHGA 2C42A 3C97A 2PEZA 5JXIA 1JMYA 2OXIA 4OX9Y 3L40A 2A4MA 1P6QA 3AUFA 3C1TA 3TE7A 2QUBA 1TZCA 1Z06A 4GKKB 1QBKC 3BFKA 3NWEA 2OP0A 2BEJA 1SCUB 2RAUA 4U0JA 1UPTA 3QE4A 5TR9A 3IT3A 4F4DA 2OO5A 1GFIA 3R3JA 5FWDA 1CZRA 1Y0BA 3VX4A 1M6VA 4DRZA 5FQOA 4JGGA 3H97A 1FTSA 2IDZA 3UK0A 1P1IA 2CNBA 5LVAA 3USES 3AJ8A 4PG6A 2CXXA 2C5SA 2C98A 3OQIA 1RWQA 4OXKA 1XMPA 2OV3A 1E94E 2FFRA 4DCSA 1IBMB 3UKJA 3DHYA 1JR6A 2JFYA 2OYSA 1OTHA 1DXYA 4Q47A 4QPCA 3OIFA 1ATZA 3GGPA 3LUGA 2J33A 3TUZC 2VDOB 4B4KA 1RQ7A 2NU8B 2D13A 4RM3A 4PC2A 3VR5H 5ABPA 1T3ZA 2RHTA 3H5RA 1CDEA 4JLBA 2QKYA 1GGFA 1MB9A 1E2JA 3VU1A 5C1PA 1FFYA 4Y9RA 2WJIA 1ODFA 4FYHA 1XB2A 2DBYA 3D1LA 3A58B 1BFUA 2GEDA 4IINA 4NOKA 4U2FA 1W8IA 5HQTA 1PG5A 1ZA2A 2QD2A 4BBPA 4G97A 4RIFA 4KRGA 4DBLE 2KM1A 3K20A 4KIFA 3HJRA 5EAIA 3E8SA 5F52A 4RKQA 3TM5A 4CT4B 1ORWA 4I8DA 1RHRA 1ADCA 1TJPB 1NM5A 1PR6A 2QW8A 3KCNA 4GXRA 1WG8A 1EFRA 1G66A 1R8SA 2EJBA 2J85A 3A10A 4G9GA 4EFLA 2HWXA 3FCSB 3AJ9A 3GP3A 3VH1A 2GEFA 1RAEA 4X90A 3ZCTA 2WUEA 3B2QA 1BDJA 4KYUA 1YL5A 4EG7A 1JLHA 4EKNB 1X8LA 2PRIA 2FSSA 4MVJA 4JH0A 4LFCB 1CUBA 2IS4A 2Q5OA 2RHWA 1TVKA 2XQVA 2WINI 2ZANA 5A3QA 1N5DA 1EZZA 3GLHE 1S1CA 3PDWA 4S0ZA 2WBLC 3AONB 3OFNA 4IIYA 4R16A 4B75A 2FW0A 3O0DA 3TZKA 4AU1A 5KJ6A 3TZQA 1HOTA 2XGGA 4RJ2A 2YJZA 1WXXA 2VDMB 4HYEA 2Y67A 4HI0E 4KR0A 1CV2A 3FFAA 3QG1A 3GLSA 1JHVA 1G8FA 3KKZA 3QLTA 4OMUA 1WUTA 1KI2A 1NKTA 2A92A 1K6MA 2VJCA 2FFHA 4DBLC 2ZRNA 1BJTA 2GAFA 3NVMB 5FTKA 4CNQA 3H5LA 2M6KA 3H9BA 1YU9A 3K32A 1ULTA 3PDHA 3PE3A 2IV2X 2NV0A 3RVBA 2CLLB 1T2CA 2WMNB 3QVUA 4B46A 1XLTC 3MLBA 5C5IA 3D6FA 4KDEA 4OI0A 4FGJA 4MZXA 1W8DA 4BZXA 4DUZB 4QZVA 4G8DA 2Y4OA 3UEOA 4ENQA 2PE5A 1VI5A 3I58A 1HY3A 3HB4X 5DHAA 4HNAB 4UMEA 1BKYA 4I5EA 1T9GS 1P4GA 2ZB3A 5FWXA 4QOHA 1H85A 5BVHA 1CY2A 2D2XA 3EVFA 3MW8A 3Q7QA 3AFGA 1G8YA 1XTQA 1R0SA 5KTNA 3U2QA 2QLJA 5BVGB 2PKYX 3HA7A 4TWBA 4JP3A 3G79A 4ZOEA 2RCYA 2YWHA 4B3JA 5BQ3A 1O6CA 5F7OA 1P18A 2PNFA 3D0RA 3EFOB 3WYCA 1E0JA 2BKEA 2NXJA 1UBHS 2OPHA 4V39A 5GZ1A 4PO9A 3EHDA 4V0SA 3MK31 4D3ZA 1JMKC 1N6KA 3GF4A 1LPBB 1R6VA 1KDTA 3WLQA 5FTWA 1GT6A 4DDVA 1TQHA 4N6NA 3CTPA 3V2GA 5CX4A 4CKBB 1CDDA 1PQYA 3ES9A 2EZ8A 4UCQA 5G0UA 2P35A 3PFIA 5TJHA 4OV6B 1OXMA 5LOVB 1I4EB 2OBBA 4YO7A 3AP1A 2C2MA 4PZ9A 5I9IA 4M37A 2VIIA 4GLFA 1FIUA 1R9GA 4I1PA 3KR2A 4DA8A 1OVMA 5EN4A 2IW1A 4RLQA 3BK1A 4JSTA 3U3JA 3VYRB 5K5EA 4LZOA 5TC4A 2PXAA 3UJ9A 1W1UA 1UDWA 4EO7A 1X1SA 3T3EA 3HO6A 4NBNA 3VV3A 3EIFA 4WZAE 4G63A 4RL4A 4RPGA 3SCZA 1DTWA 2H5IA 3UB2A 1P45A 4N7MA 4RHYA 4LFBB 1LPAB 1II8A 3KRTA 2ZS9A 2JIOA 3FZNA 3G8CA 3H86A 3HB9A 5A7HA 1K08A 3K1YA 2X6TA 2ZRDA 2IU6A 1RQNA 2Z5FA 3QELB 1OKKD 1F4VA 2ZATA 5KWJA 1VL8A 3T5AA 2KMLA 1ISMA 4B6GA 3HJUA 1JR2A 1P2VA 1ECFA 4Y67A 3D4NA 2DR3A 3EXFB 4M7WA 4FDLA 3TL2A 1K7CA 1XNGA 3GAFA 1ZITA 3ZXUB 5JPCA 2C78A 4TLDA 3V8QA 1EVLA 4C4AA 1R5NA 3VR2A 1BA2A 3VKUA 3W3ZB 5KYNA 4IJKA 3SX2A 2V7BA 1ZX1A 3E7WA 4NF2A 5SYNA 4WNAA 4AULA 1SXJC 3PNQA 2HHJA 5B58C 5JY1A 3T0IA 3BEOA 1ZUIA 3W6OA 1E2GA 4PPFA 5FWNA 2BM0A 3HGQA 4XPZA 3T3PB 3MYRA 4JP1A 4Q66C 1QQ6A 1H8HD 1T10A 2AFRA 3BK2A 3PNYA 3WBFA 3OTOB 4KLRA 3GC6A 5KNDD 3K6JA 1JHDA 3F7TA 3Q1LA 1MABB 2I6TA 4GXTA 1DZ3A 5B36A 3KVYA 1JHOA 4QA9A 1GU1A 2WDZA 1RI2A 3FYDA 1NW9B 4O1HA 4OKSA 4Y6RA 4NATA 3JD1A 4NV1A 3IH5A 1P5JA 5JXGA 4FFLA 2ZI7A 4HEHA 3UGTA 2ZIAA 3PU6A 2O1WA 3ZDAA 1V8DA 4AJHA 1X80B 2P79A 2QRQA 3DLAA 3HB0A 4WESA 1EWQA 2X9QA 1ZISA 3FCYA 1TO1E 1BHJA 3BCHA 3QMWA 4LDNA 3WL3A 4G67A 3U3KA 3KDPA 1QS0B 1E1YA 1J56A 2GN0A 1QX3A 2RHRA 4AFNA 1R88A 2VFAA 5CVDA 3W2EA 4XVUA 3P9XA 4YMHA 1V5EA 1VCIA 2YVQA 3G9UA 2IFTA 3GLRA 6ABPA 1KI6B 5HJ5A 2JVKA 3EGCA 5EIWA 3GJZA 1J8YF 1NL3A 2PZLA 1IHXA 2NVOA 1JG6A 1GUFA 1Y89A 2QLTA 5D00A 3EPHA 1NR5A 2I8AA 1M1ZA 4TMVA 1NVAA 1CS0A 3OOSA 1SKYB 3PLAE 1E9EA 3FKQA 1QRUA 1YGPA 2W0MA 3PS9A 3VOTA 1W4CA 4XSVA 4AUEA 1TMGE 2RI1A 4E5DA 2WYHA 3EDMA 2XGJA 2QEQA 4DG5A 3AR7A 3VH4A 4D9KA 2MMCA 2P3OA 2ZYAA 1W88A 5DOZA 2BHLA 4CKWB 1RWKA 1RU3A 2WIAA 4Z8YA 2GLXA 3DHEA 3H1EA 2CF6A 2HBQA 4LZJA 3UPDA 1JI0A 1XA0A 4JBNA 5CB8A 1VPVA 3IA7A 1KH1A 5F2NA 2JVJA 1SULA 5KOJA 2V7PA 3SU8A 2Z6AA 1OILA 3QXSA 4L8WB 2XCQA 4RE5A 4MYDA 4IOMA 1BXKA 4YLYA 1IXSB 3L0SA 4YJGA 5FQNA 2YHSA 1UMCA 2RK6A 5BSWA 1MOSA 4X0EA 3IAAA 4BQNA 2B1IA 5BN5A 2UU9B 5L3VA 3AVXA 3A4IA 1QV7A 5ELMA 1O0SA 2R00C 3KE8A 4I5IA 2OG1A 2I62A 3PFHA 4DQLA 5BR4A 2WM9B 3UYLA 1J2JA 5L3SB 3DDOA 1R0ZA 3ENKA 1S2OA 3A3OA 4D4HA 4DV4B 4DMUB 2I9KA 4J0HA 3IP3A 4DLZA 3TE6A 4NE9A 2JIPA 2CCKA 4WBXC 4GZ5A 1E4EB 1M0WA 5CCEA 4E33A 1KXZA 2OWEA 7ADHA 2HSDA 2OHFA 3M6MD 2XB6A 4NMWA 3QBVA 2HT6A 5D8DA 2XGMA 3B20A 5AM3A 1WB6A 1SXIA 1CFJA 2IYWA 5DI9A 2BZ1A 1OBOA 3AF3A 2AK2A 2WF9A 4H60A 4R9SA 5AI5A 4QTXA 1YR9A 3R0JA 3Q8MA 2VCHA 3EOAI 4TTSA 4YAWA 3I8OA 1C1XB 1LDYA 1G0OA 2VA8A 2EX4A 3VNSA 2XOXA 5AKGA 2HA0A 3FTEA 1FDOA 1ZH8A 3LA8A 3IOYA 4OBEA 2VRCA 3H2JA 2XITA 3T7JA 4XX1A 1T0JB 4DMHA 1BKSB 2BN4A 4EDFA 4Y2UA 2UZ4A 1II0A 4BUJA 3LOPA 5EEHA 2EBFX 3ZXXA 1A0OA 2L0XA 4CN9A 3H8JA 1GEEA 1EWYA 1YI8A 3OOJA 5GWXA 2MYPA 3MB8A 4Q02A 4BE4A 4GL4A 3N59A 1ZVJA 4C6RA 1WXQA 1RHMA 1U11A 2C99A 3GAZA 4IXWA 3RARA 4HDSB 4RTJA 1IN1A 1NLUA 4I1OA 2Y0BA 4FI3F 4GYKA 3VC2A 1PFVA 3ZCQA 1FJXA 4ERXA 1G3IA 4YJ3A 4QNRA 5CA0A 1EGAA 3PCTA 2VAVA 4D6XA 4YRJA 1TI7A 1LX6A 3GRVA 5AW0A 2JARA 1CX9B 1MEJA 4GMGA 3JAWA 5T5QA 1XZQA 3ZV3A 2AS0A 4CZ2A 5DYTA 1OWOA 4O4IB 2WWFA 1V6AA 4PPQA 4RAQA 1Z4LA 2J3EA 1SVIA 3SXJA 5C7YA 3VV2A 3LSTA 3JSAA 3WXMA 4MGIR 3RTAA 2EG5A 1TM7E 1VHLA 1YQUA 5JO0A 1MA3A 3LKZA 3ZV4A 2ZUUA 1YASA 1I7DA 1Z5OA 2H2FA 4TLLB 4RANA 4RAOA 4BVGA 1AO3A 1XEFA 3GA5A 3WMXA 3O1HB 5A6SB 1FDSA 2CUTA 4KWCA 3QNWA 4Q39A 3F96A 1M75A 1RBYA 5KVAA 2IRWA 1PDVA 4BLRA 1HRKA 1P1KA 1VFPA 3ZOZA 4UAUA 5EERA 4XGKA 4LOHA 2VDPB 1PW7A 4WCDA 1J9EA 1ZQ9A 3CRRA 2H00A 4WJLA 3N87A 5TT1A 2W8BA 1UKBA 4M8IA 4L73A 3E1GA 3RG2A 4D97A 3BKWA 4TN1A 1TNDA 1Z6ZA 3E22A 1LXCA 2N47A 2VSYA 2DM6A 4HXEB 2XSZA 5JSHA 1U0GA 2RDMA 3M6IA 4PAOA 3L43A 3T5MA 1ZXLA 3RM3A 4MX8A 3I2GA 2YJGA 4WCFC 2YNMC 2W8ZA 4QFBA 1KE2A 4DIMA 1TM5E 3QPWA 1UANA 2R4QA 5EZ5A 2GNPA 4LFAB 4U5QA 4D41A 5KBYA 1SY7A 4KSBA 1WU7A 2QHXA 3EIHA 2BMAA 1GYRA 2PZBA 1R37A 3O8BA 3Q10A 1XEWY 3VDRA 5JANA 3GRKA 2D00A 1Z6AA 2V98A 3ZUGA 3WL6A 1W4AA 1QE5A 1Z7EA 3W79A 3MVEA 5AOCA 2VF8A 2YMQA 4BE9A 3TG8A 3GPLA 1X13A 1PF7E 2D0OB 3PNOA 3W1VA 4DC0A 1K7FB 3EFHA 4O4LF 4ZZ0A 3RQSA 5LMZA 3KSBC 2IDMA 4F11A 2VUHB 4R2WA 1YDGA 3M3HA 1I5RA 3EGXA 3KSUA 3U7HB 4EMSA 3D2CA 4KQ6A 3X1YA 4B6EA 4C6TB 2OZLA 4DNFA 2BFEA 2QZZA 2IP2A 2AFHE 2WPDD 2K2WA 2QV0A 3OQHA 3Q1KA 2CFOA 1FQKA 1QH8B 1RS0A 2G4VA 2QMZA 1CB7A 4K1XA 3GYBA 2NUPA 2AYXA 3V8EA 4WOKA 5JPDA 5KVSA 3PX2A 3LCCA 4MRVA 4OMDA 3WB0A 4E51A 1EAMA 1NWHA 2WSIA 3B5IA 1M7HA 1L4BA 5CFOA 3QI7A 1QO9A 2A9VA 3CWQA 4RSMA 1L4LA 2C3PA 2VTEA 5GVSA 5ER6A 3QXCA 2PWYA 4CEHA 4KZKA 3CVXA 2BVNA 3REQA 3SM9A 1ADFA 2X0NA 1CJBA 1IULA 4JT8A 2QY9A 1INLA 5CT5A 2JW5A 1RBZA 2E5FA 3STUA 1H4VB 1M2OA 4KGXA 3IELA 3LJKA 5TRTA 5BWMA 3KZOA 1MG5A 3A3PA 3ONWA 4KI0A 3TFQA 1F8GA 4FJ1A 1K5PA 1UC5B 1E89A 1JILA 1V3QE 1N5RA 1OIXA 2P7IA 5I7SA 1IUNA 2C2HA 2NNWB 2J3HA 2NO4A 3CZCA 4XQ9A 4P80A 4UATA 2DBRA 1CEXA 3LVFO 4LI0A 2BMJA 1THTA 1JJBA 3MTEA 4WX2B 4FR0A 1NYRA 1DBIA 3AY0A 5G40A 4GI1A 5JRJA 4PR0A 3Q7TA 4D0SA 3TQIA 1B6TA 3T5CA 2FKAA 4EW6A 4MVXA 1QLJA 1ZBDA 8ATCA 1VLZA 3QJGA 4R1TA 4U0KA 3PHBE 5FFFA 5TEVA 2QM8A 3ZTTA 121PA 4IV8A 1DLJA 4QUJA 3UATA 3RSSA 2W90A 1B0ZA 3TGWA 2NU6B 4MUFA 4F2WA 4YAKA 1AV7A 3NBMA 3O8QA 4YONB 4EI7A 5KTYA 4WZBE 1HT2E 2QQ5A 4XCVA 4HCJA 2M1ZA 4ENPA 1AY0A 4RQUA 4WDRA 5AR1A 4QX6A 4AYTA 2FW7A 2XZTA 1O8BA 1QCCA 2DY0A 2FFJA 2YYAA 3GRRA 4KQHA 5EMHA 1OI3A 1YV9A 2OCBA 3RGWS 2UXCB 4DUPA 5DNYB 1D2NA 2LD4A 1HEUA 4YXWD 1ZSYA 4CIYA 1K06A 4TKLA 2EF0A 2C4WA 3LGSA 5GQSA 3AHIA 3GQBA 3RSQA 1U81A 2PGOA 5E2IA 1SXPA 3G9TA 3ZJ5A 1RPJA 1FRQA 1BDHA 3HCWA 4XA8A 4LCBA 4ISBA 1VLHA 4K03A 1XPJA 2EC5A 3OE7A 3G2NA 4HB4A 3DEYX 5F9MA 4BNGA 6NULA 2AQ8A 4O2RA 3LCUA 4QECA 2Y1KA 1AK2A 3B70A 3DEKA 4X85A 2WHYA 3NFRA 4GQIA 4JODA 2PXXA 1NXPA 3UMSA 4X8HA 1KVRA 3HP7A 4TVOA 4V1CI 3TG2A 3MLAA 13PKA 5ADVA 3PRKE 3IBGA 3VAZA 1UDCA 4M1YA 2FNAA 3O8RA 4MS1B 3RIGA 5JDIC 3DO8A 1U5BA 3W5HA 3F6YA 5ALJA 2P9YA 3QWAA 5DXJA 5KC8A 3MGCA 1EWKA 1P81A 4C7OA 5AKLA 5LXTF 1PYOA 2Z9DA 3M9XA 5AICA 5ERXA 3W9BA 1X7WB 3CUVA 2D1YA 1GRCA 1S3FA 2Z4TA 3BAFA 1ANKA 1VJ0A 1UMDB 1NDUA 3JAKA 4NCIA 1ZXBA 4WLNA 2HA2A 1HM5A 5FR1A 3WKAA 4CMIA 2VQSA 4YT4A 3FDZA 4DLNA 4FYVA 4IUYA 4JJKA 3K0AA 3MCAA 2OFOA 1N6PA 5E4FA 2OT3B 5KNBA 2YZ7A 3DW1X 4XFDA 3ETJA 2RGUA 4BNTA 1WZIA 3X1KA 1P0CA 2R65A 1T5SA 3EGIA 2VDQB 1RFGE 3M4NA 2DHQA 4IHAA 4X7RA 4YS6A 4OHYA 3IHWA 4ZAFA 2X4LA 1YA4A 3UUWA 3E9MA 1O0CA 2M6RA 5HKKA 3BGDA 2I2XB 3TTXA 3O7MA 1PEAA 4XPIA 1PV2A 5BMOA 4YQEA 3OPQA 2BKUA 1L6RA 3D7SA 4W1RA 2CNNA 3SFTA 2W2VA 2QM3A 2RHOA 2SHKA 5IF3A 3NBKA 4KFCA 3SXPA 4NMLA 3IKMB 4LYAA 2VTDA 4OSEA 4ISCA 3KELA 4UDYX 1Q7BA 4DVJA 2X8BA 4MKZA 1P44A 1DWQA 1JP7A 4DG8A 2C9OA 1RZRD 1SU8A 4DWOA 3CCFA 3NHKA 4Q37A 1RADA 1K8YB 4Z53A 2PD4A 1RQPA 5EXSA 1XJ0A 3W5IA 2H7VA 5EJGA 1YVPA 1Y8ZA 5KKAA 1QPBA 2ES4A 3L82B 3OX3A 5HM8A 2GA8A 2GSDA 2Q3HA 4MUAA 3ERCA 3NP9A 3P9QA 1U8TA 2W83A 2X3FA 3MSCA 1MG0A 3PGMA 5F3DA 4A73A 3RUDA 1N5JA 1L8LA 1UM9B 4BV8A 3ELYA 3LC1O 4GOND 4BX0A 4XFJA 2C94A 2MSKA 3SXUB 1K9VF 1N3IA 1GQFA 1V11A 1Y8RB 3DVQX 3IP1A 1BN7A 4UEQA 5EKSA 3B60A 4WLEA 3JWIA 3U09A 4EG3A 5KTTA 4X5OA 5HQJA 1ZPDA 1H2EA 3GU3A 4N9QA 2ZITA 4PC6A 2FEWB 1DRVA 3PC8A 5LCXA 1YF3A 3G7NA 2AI2A 4IUDS 1XBTA 3G23A 4HDKA 4JDUA 4OA5A 4WXEA 5EP2A 3GJQA 2AFIB 1DAGA 3I6QA 4KH0A 4BX8A 2CXRA 1Y3BE 2GK4A 4QICA 4JUFA 1A50B 2WFLA 1TFRA 1T0PA 4R40A 4YGXB 1SCJA 5A4AA 1V1MB 3C15C 2EIXA 2HKIA 3GRFA 4FZ5A 1BWQA 2YOFA 4PQGA 4Z0TA 4Z54A 4R9VA 5K20A 3FTPA 4B3CA 4DAOA 3E5MA 3VHRA 1FJ2A 1X6VA 1JEJA 2PSEA 1XL0A 3MT7A 4BS9A 1CP2A 4PXYA 2TMKA 3BBPA 1LJLA 3QLJA 3UXEA 4C30A 4S2UA 2FVXA 1K66A 2O8FB 3D7NA 4RVUA 1NN0A 5JXWA 1LWNA 2UYHA 1X1EA 4C1BA 1SD5A 3WWCA 3SEZA 4JB3A 2PV0A 2AE1A 3R5TA 1K3FA 4L4ZA 5EGNA 3RCBA 2CLSA 5IK2D 1O5TA 1UXHA 3PL1A 1ZM4A 1TIPA 1XQ9A 3RAEC 5AK6A 3RS0A 3LV8A 3ZI0A 1WV0A 2FXIA 4HT3B 2CVZA 3VZQA 1DBRA 2YMLA 2EP8A 2QRLA 3N2KA 2J30A 4AJEA 1E3MA 3GLGA 2QD4A 2EVWX 3N74A 4HB2A 3IMKA 3TOCA 1XA4A 1G98A 3EVNA 3ZJVA 3PTZA 4WADA 1JG4A 4ZTZB 1QOQB 3NP7A 2Z1MA 3QHQA 3X44A 4EG4A 4EUFA 4JY7A 4EKGA 1JR3E 3RGGA 9ATCA 2CUKA 5J2UB 4KXQA 1R12A 1XZDA 4XB2A 5ETJA 1GUDA 1RWMA 1XF1A 4BFSA 4EX7A 1KJJA 4YAOA 2YXEA 2ABWA 2PN1A 1D04A 1PD1A 5FUBA 4X1OA 2XV1A 4F5EA 3U3DA 3VJRA 4DSUA 4KMOA 2C9ZA 3A3NA 1N2SA 3OJWA 2CV0A 5F2OA 4AJNA 3R3XA 5CNIA 1B6RA 4F4CA 4R4JA 3V8VA 2UVPA 3HCOA 2P62A 4LBZA 3VR5A 2QN1A 3EXIA 5K99A 1ACLA 3B9RA 3K6KA 5EOVA 1VB5A 2VDKB 4DJDC 1VECA 2HD4A 1ZJ4A 3GCWA 3TLCA 1E66A 4KQGA 4E13A 3GJ4A 4HXGA 1YDHA 1DL5A 4O6VA 4LJYA 3Q3EA 1IAVA 3PI7A 3H42B 3ANMA 1WM1A 1COWD 4Z8XA 1O94C 3K1AA 1RW4A 2EW2A 1MB0A 2GN9A 3SSNA 2ONZA 2P77A 4QJ3A 4B43A 1BCRB 3B9QA 2VPPA 3UO8B 1AUOA 1HSZA 1UBRS 1DKRA 2B2NA 2ZE7A 3RRZA 3KB2A 3T9BA 3KJNA 1H65A 1GGNA 2X9GA 4MR9A 4KTTE 1W25A 3AHGA 1Y8QB 3JRWA 4JQYA 4MAAA 2YN4A 4XVRA 3R75A 2PS1A 1LF0A 1COZA 3LRTA 3NC0C 4E2WA 2HPVA 4NDZA 4B3IA 3PL5A 3RSZA 3E2PA 4WK4B 5E6RB 4BWGA 5H3HA 2HA5A 3H75A 3RRNA 4AN4A 2HCTA 3O3NB 4N3GA 3OETA 4REOA 3OQJA 5F3RA 5CIWA 1C3LA 3B48A 5IMBA 4AMVA 5BW8A 3K2EA 1E32A 4WKGA 1GPLA 1GSHA 3PQEA 5FYDA 1I3KA 2GPAA 2YVAA 3LIIA 3S2FA 3E82A 3KC2A 3HJFA 1W4ZA 4I5DA 3D4BA 3KTFA 1GCGA 4FJ0A 1R0BA 1TJNA 4OH7A 5M5BA 3FVVA 4ZWNA 1J8VA 1AS0A 4LDAA 3RAFC 1WVIA 3DUFB 3GNTA 5IP5A 1H8EA 1CRPA 4X7PA 2FSVC 4LMPA 1IJFA 4UAJA 5D1NA 3HBMA 3K9BA 3T7SA 4M76B 3KTOA 1W75A 1UP4A 2QLBA 3FZQA 1GLGA 1PJZA 1YRBA 3BL5A 2GH1A 4P7FA 1OYYA 1QB7A 1SRQA 1ILEA 3TSYA 1IIRA 3BIWA 3AGQA 4ZI5A 4KDFA 1Q1GA 4AC9A 4DV3B 1L5WA 3DAGA 3RUHA 2EYQA 4NABA 4WGFA 3RF7A 1LW6E 1T13A 1QQ5A 1WP9A 3DD5A 3K5PA 5E95A 3S28A 1E3WA 1NVGA 4NYIQ 3VZPA 1OBFO 3QEMB 2JHFA 1I2DA 1BEEA 2XMDA 4JUDX 1B8PA 1GA6A 3DQQA 1UZNA 3HL4A 1T91A 2FZGA 2IEDA 3LT1A 1Z5ZA 1XTPA 2JFWA 2X19A 3BC1A 4H3KB 5KHAA 1WXFA 4XDGA 1OSNA 2FI1A 3HUEA 3AKEA 3RS5A 4ZV4A 3GEIA 3KETA 1BFDA 1CRWG 5REQA 3OU2A 1E7WA 1YAHA 1V8BA 3P8ZA 4L78A 3GRUA 4CG3A 1KU0A 3I4LA 4ZDWA 3S27A 4D4MA 1RCFA 3UY4A 3WB1A 2GHQA 2YQZA 3LUAA 5FJIA 4B2PA 5BQXA 3WAGA 2WSMA 3TFWA 4R3NA 3KPYA 1A9PA 2OFFA 2NSLA 1YE3A 4M7PA 4WKOA 2GZHA 2JG3A 1CD5A 2O14A 4RL6A 2V9CA 3GW8A 1NU6A 4ZTBA 1PZXA 1TEXA 2OXTA 3LM8A 1OE0A 2VDWA 2YS6A 4RPLA 1D5CA 4ZAGA 5C18A 2BSQA 1AZSC 2IVZA 1H1LB 3I5AA 3PNPA 4IXDA 2QP3A 2DGDA 4FYKA 1ECCA 4FC6A 4B2LA 4KK4A 1ST3A 1H4QA 5L3ZA 4QO7A 4IV0A 5H70A 1GWNA 7REQB 2ZSJA 4NSNA 1SXHA 1V9CA 1TJYA 4BWYA 4N41A 1CEEA 3A11A 5ALEA 2ERYA 3EA0A 1P74A 4NV0A 3EXEB 3J80A 4C0LA 4AKEA 3V55A 2HMYB 2VXOA 1I1QB 1QYWA 1MUUA 2AZTA 3I52A 3KL4A 3OCJA 4HEA1 4MI1A 4OB8A 4FD2A 4B3FX 3EAFA 2P8SA 5AJTA 4F5WA 3OQBA 3IYLW 4YJFB 5DTEA 4X54A 4HWTA 4EBBA 1N2CE 2P9FA 4PPNA 5SZJA 4OLFA 5FLKA 3GN1A 3ROPA 1E2HA 3EAQA 2XA1A 3ICPA 3OY7A 3C87A 4JUAA 4Z86A 4ENUA 1NMXA 4OI4A 1T2VA 1F8YA 2HU7A 3MUOA 4RGYA 5JCOC 2A67A 1J33A 2GAJA 2VNIA 3GJXC 1BSVA 1F5SA 4JVMA 4UNPA 4UUNA 3EDRA 4FMDF 4UD2A 5CVCA 5HTKA 3U1TA 1BS2A 1LPOA 2E5WA 1KDOA 4BBZA 3NASA 1KFBB 3PC6A 1ONOA 1TAQA 1PIWA 1L7XA 3Q0EA 2R1TB 2Z9BA 3AY6A 3EA4A 3IVCA 2Q1SA 1UXJA 1TQ6A 3DTTA 3LZ6A 4OUDB 5HOEA 4D6YA 1CY4A 3A1WA 1VHJA 3IAM1 5E7QA 1GA4A 2MSEB 1DBVO 2V3VA 3KEFA 3T3IA 5JADA 2CJWB 2JFOA 1H3NA 1U6KA 1ZNWA 1M8FA 4CL3A 3PXDA 2CXHA 2MR5A 2E18A 4R1PA 3V97A 1FLDA 3NWJA 4ZT4A 1L1RA 2IUTA 4C4ZA 2J6HA 4KE9A 4M9RA 3EQ6A 4BO7A 1H93A 5C5DA 1U3VA 2WYUA 4IVQA 4HYQA 3PPWA 5ER9A 5I9BA 1UT6A 2WJAA 3K30A 3WO0A 5BN4A 1M33A 3HKCA 4NZNA 3DYIA 4WFIA 1EE2A 4RKRA 3O91A 3CUEF 1PEDA 1YHZA 5J2TF 1I2CA 3P9RA 5JQWA 2BP7B 3HS3A 5DHRA 3SKXA 2FJ0A 4XWGA 4AZ0B 1T9AA 3ZZ1A 5KC9A 1A9ZA 5TE9A 4L9AA 2FWNA 2VNSA 4IBOA 4RQBA 3L7IA 5ES4B 1H0KA 2RIRA 1CIJA 4NVRA 1VB3A 5KSPA 2MSCB 1ZJJA 1Q6YA 1LFDB 3ZDEA 3ZR4B 1Z26A 1ISJA 3KYCB 4QOJA 4DNXA 3I2YX 4HRVA 1FS6A 2VTVA 1RRCA 2PGIA 1NNUA 1X87A 1C30B 2G6TA 3FF1A 2H92A 1E1DA 3HJHA 3I04A 3BD7A 3IEUA 3N2NA 1K4KA 1A98A 4DMMA 4OK6A 3V7UA 3MWYW 3BQ9A 1J24A 5EJ7A 1C50A 1PX0A 4PINA 3WRYC 3DXYA 1CJUC 4IDQA 5JMOA 3LYLA 2ZUDA 4KLNA 1DIHA 2YZ2A 1A76A 5B1HA 3S7ZA 4LF7B 3ZTWA 1WEHA 3AVQA 4HVAA 1AZWA 4BNXA 1SBZA 1T15A 2QMYA 1C5KA 4PG4A 3V7WA 2CD9A 3SHTA 1Z3IX 4FFRA 1C3VA 3Q7RA 3Q3IA 4KEAA 2DAPA 1C4WA 1W0JA 4R1QA 4Q9LA 3WRXA 2IPNA 4CIWA 2R4UA 3IV9A 4P4GA 4XWYA 1QIHA 1SHJA 2D3WA 1NXXA 4U5XA 5EA2A 3AR8A 1TZMA 2V3WA 3NTVA 2VHQA 4KR3A 3GBVA 5C7LO 2VPZA 3IESA 4R68A 5F9HA 2VJMB 2JDIA 4KRYA 5CB4A 4M0EA 1KZ1A 2YFYA 1NXSA 3UA3A 1K8RA 5G4KB 4F92B 1QZZA 3OZTA 4R9UC 5EWMB 4WPGA 2QAJA 4EAQA 1RJEA 2XDAA 4I6GA 2ZI9A 4I50F 3IQWA 2WJJA 5J9FA 4EY7A 2IPXA 3R0VA 2O0MA 5DLYA 4PTLA 2UUBB 1GL3A 1OGJA 3CH5A 5J59A 3INRA 4ALLA 2GTIA 2PANA 3N8KA 3LKDA 4V24A 1ZG3A 2VPWA 1VE9A 2OXRA 2A30A 2QMQA 3HCBA 3H2GA 2IIPA 4FW9A 5ARDA 5M2QA 3D7LA 3ZHSA 2FPPA 3L3BA 4MPRA 1YDFA 1MDFA 3BDAA 5B1IA 4I9HA 3D6HA 5LXTB 2BEKA 4J8PA 3SDSA 3EPJA 4DV1B 2ECFA 1JXMA 1NRJB 5DT2A 1EFVA 3KT8A 3MWEA 4QOIA 2GPWA 2V7WA 3G2PA 4Y1RB 1XKXA 4WY5A 1JIXA 2HDOA 1NVXQ 4QBKA 5BSTA 5AQ1A 1F2UB 2PLRA 1DQNA 2FMXA 3DV0A 3AY3A 3I30X 1T1GA 3IP7A 2VUTA 3O03A 4L72A 3W8EA 1DIBA 2PL5A 4F2DA 4DM7A 1Y48E 4ZYWA 3HLKA 4XJSA 3OLQA 2WTEA 4PGGA 1VM6A 4UE2A 3RD5A 5BW4A 3GJ7A 1Z2AA 2D5LA 1YS1X 3N58A 2O1XA 4TQUS 1NYTA 5K1ZA 4HUJA 1I1HA 2W70A 3TIFA 5TS3A 4AKSA 3KV1A 4DIFA 1SBQA 3HBJA 4WT7A 5DWQA 1U0TA 2GN8A 3K9HA 2B8WA 4Y7DA 4QQNA 2BHRA 4MLDA 1FTWA 3L1KA 1JYSA 1K75A 2BGJA 4XUGB 4MKIA 4B84A 1CJTC 4RH0A 4U7GA 4CF5A 1EBBA 5JD4A 4LN1A 2F9FA 1H6DA 4OBXA 2RAPA 4TXHA 4PN3A 1A72A 5BT9A 3FSRA 3TW8A 2W2LD 3GZNB 4LHWA 5H3LA 5I9NA 2IPOA 5HGJA 2WHPB 3S6JA 1AD2A 1UKEA 4BO4A 1PEYA 3ANNA 4A2QA 2EF1A 4ZI7B 3EG9A 4FOOA 3CMMA 3EUEA 3VNQA 3IB3A 1DLIA 3EZXA 1KO8A 2YMMA 4E07A 4F2HA 5IUKC 4P08A 2BCJQ 2ZRPA 3TL6A 1U7HA 2VT2A 2SKDA 4WQMA 5H4GA 3DZHA 1JQKA 2JAPA 5DTRA 1QFJA 2FMKA 2V6BA 4MR8A 1NRIA 5ALKA 1YRHA 2UZ1B 5BURA 5JVDB 3NBUA 4II2A 5B12A 2GKGA 1N2GA 1KYVA 3PK0A 1N77A 3LC2O 5C35A 2WE8A 3IV6A 4X84A 2V3CC 4S1TA 2VF2A 3E15A 5F51A 1TDJA 1RJWA 5AKIA 1EVYA 5C2JB 1M5UA 2E4WA 1P1RA 1SUFA 2D2FA 1LRKA 1RP1A 3CVJA 3S1LA 3G8DA 3IMFA 4HO1X 1XLVA 4QYTA 3ZHOA 2VJPA 1ZJ6A 5FA5A 5C1OA 4WASA 3F6CA 3T35A 4EHDA 1QX4A 1RE1A 2W6JA 3L79A 3LP8A 3A9CA 4QXPA 4HZUA 5AXCA 1KI8A 3HVUA 3UAOA 1UPXA 3X2EA 1YB5A 4QE3A 2XMBA 1Z0AA 4GIBA 3DEFA 3K09C 1Z6PA 2QV7A 4JGBA 1Z5UA 3BMCA 3TQSA 3NYWA 4EYGA 1FSPA 1OX4B 3ELBA 3SC4A 3R3YA 2ANBA 2H31A 4AYXA 1MA0A 1KFCB 1C3XA 2YYYA 1GKIA 2OILA 4L5AA 1YRQA 1E2QA 2REQA 4MNTA 3ZWCA 4CLRB 1R50A 1PNTA 2DWPA 3L6RA 3P0EA 4LNAA 1V5IA 4M1QA 4ZCPA 2HLDA 4HL6A 1PWHA 2P2LA 2PL3A 3NHJA 5L3RA 1OZAA 4Z3KA 4ZEVA 2B4RO 5A03A 4FN4A 2Q5IA 2ZU6A 3PIRA 5G4LA 4LC9A 2EQ5A 5FUWA 2PSFA 3FHLA 4BNWA 2ZRBA 5DPMA 4S04A 2UV8A 2NSJA 5J63A 1PT5A 1GFSA 3LPMA 3DAPA 2DRIA 3HFGA 3IP8A 2ZR7A 1DT5A 1YA8A 4MWOA 3U17A 3U6BA 2ISQA 3LGAA 4FQ7A 4EYKA 1XTZA 1Y6RA 4TZTA 1LPSA 1L4NA 2IL1A 3E18A 3M8KA 3IQIX 4M49A 1JIIA 1ZS9A 2VHEA 2EERA 3AH8A 3OZEA 3QE3A 4QYIB 4J4TA 1SM4A 3EC2A 3EUFA 3OP4A 2EWVA 3P2OA 3G88A 4QGFA 1YS7A 4LXQA 3RSHA 3SNHA 3OHMA 1NVVR 5KHOC 1NUQA 3R7AA 2GZ1A 4A4DA 3E53A 4M86A 2C3YA 1X38A 2PX5A 1K6EA 2W58A 1M34E 2VF4X 3AYXB 2J07A 1PWYE 2POQX 3GH1A 1RXIA 1TF5A 2A94A 5SZIA 4K6KA 4LRYA 1VPWA 4A0RA 4DR4B 3BOSA 3QBEA 5JNLA 1RXVA 3HU2A 4KSCA 4QUHA 4BNNA 2PX6A 2XEDA 1H94A 5EJ2A 3OESA 1IB6A 3B1XA 5HM6A 3UB3A 3KR0A 3GO4A 5KOIA 2ODQA 5DTQA 1X7GA 2X0FA 3ODGA 3ROMA 3FPJA 2D8AA 1P91A 2GD0A 2ZIEA 3IKLA 1A7JA 1WCIA 1J0BA 2VQDA 3MC1A 5AOVA 3J81k 3D31A 1PL7A 3MMZA 1ND5A 1XR3A 4N40A 2ZK7A 1TM2A 3MJHA 4G0QA 4DGSA 2NT4A 1SKUA 2GCGA 2W6ZA 3F47A 3MCVA 3B82A 3G6WA 4RIGA 5CT4A 4LHXA 1W94A 3VC7A 3AFHA 1U9IA 1R4AA 3QOWA 4IJ5A 5ALSA 3NWOA 1B0AA 1A82A 4NWIA 3WGMA 2PJRA 1PLKA 4WE3A 3T3HA 4KAJA 4FMPA 3A06A 3DCYA 4PLHA 4GYWA 4RZ2A 4QUDA 4UCXA 4OI1A 4EYOA 4W9MC 2HRBA 2PKQO 3UZUA 1NN3A 1YZGA 3W3AH 2WF7A 1G1AA 1DFIA 5AW4A 3RYCA 2YJ5A 4OTZA 4KWIA 1YBAA 2ZCJA 3E3AA 2I4LA 1UXKA 3HU5A 1ADYA 1V96A 5TPWB 3RVLA 4R2IA 4FHEA 2Q7DA 3TB6A 3WQQA 3ZVNA 4N0EA 5A6VA 1Z2CA 1IQUA 2AMLA 1GDHA 3LZDA 1Q1QA 1SXJD 3EZFA 5HFJA 1L5NA 1NRWA 1WY7A 2WY2D 3MYYA 5T57A 6REQA 3HWRA 5AUPB 4I1IA 4DRYA 1R2QA 3HC7A 4L8GA 2A0FA 5B7QA 2NUBA 3LECA 3OZCA 2P75A 3OHPA 4GRIA 4BGIA 4MW0A 3SIXA 3CX6A 3MCWA 5TLSA 4C2UA 5HJEA 1ZEJA 3MS7A 3OEYA 2JLUA 2I54A 3COYA 4RSHA 5ALIA 3VC1A 3OIVA 4RK5A 2R8EA 1COWA