3QP9A

The structure of a c2-type ketoreductase from a modular polyketide synthase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
498
structure length
470
Chain Sequence
VQDSWRYRIDWKRLAVAGLSGRWLVVVPEDRSAEAAPVLAALSGAGADPVQLDVSPLGDRQRLAATLGEALAAAGGAVDGVLSLLAWDESAHPGHPAPFTRGTGATLTLVQALEDAGVAAPLWCVTHGAVSVGRADHVTSPAQAMVWGMGRVAALEHPERWGGLIDLPSDADRAALDRMTTVLAGGTGEDQVAVRASGLLARRLVRASLGTASPWWQADGTVLVTGAEEPAAAEAARRLARDGAGHLLLHTTPSGLAGLVAELADLGATATVVTCDLTDAEAAARLLAGVSDAHPLSAVLHLPPTVDSEPLAATDADALARVVTAKATAALHLDRLLREAARPPVLVLFSSVAAIWGGAGQGAYAAGTAFLDALAGQHRADGPTVTSVAWSPWEGSRVTEGATGERLRRLGLRPLAPATALTALDTALGHGDTAVTIADVDWSSFAPGFTTARPGTLLADLPEARRALDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of c2-type ketoreductases from modular polyketide synthases.
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Oxidoreductase
molecule keywords Type I polyketide synthase PikAII
total genus 160
structure length 470
sequence length 498
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08659 KR KR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qp9A00
2OMEA 2FSVA 3TF5A 3RSHA 4OXNA 3KTDA 2EP5A 2EKQA 4XR9A 4RF3A 1MP0A 1MC5A 4K9DA 2PR2A 4W7HA 2BGLA 3ON5A 1KY4A 4XCVA 5AQ1A 2FR1A 5C5IA 3OQ1A 2IZ1A 3PXXA 3W1VA 1VL8A 4NBWA 3FBTA 1D1TA 2DQ4A 5IXYA 3E18A 4J0FA 1VC2A 3DZKA 4J4TA 4OOFA 1HSOA 2VHXA 5EESA 1O6ZA 2CNBA 2UUPA 1YS4A 2NU9A 3DZJA 4RVSA 4FGSA 1DXYA 3TJRA 2YJZA 1T1RA 2Y1GA 4OQYA 4BO5A 6LDHA 1T2EA 3ZU2A 4IDAA 1C0IA 1ISGA 2D8AA 1S6YA 1YBAA 2OZPA 2X1HA 3HN7A 3KYCA 4FD3A 5IN5A 5IZ4A 2X5OA 3I4FA 3KXDA 3OIDA 3QLJA 3ZCXA 4DBZA 3ROPA 2GSDA 1DIGA 2I3GA 4R68A 2VHWA 2UDPA 3ZU4A 5F5NA 4DYDA 3JYNA 1W8DA 2QG4A 2FPPA 2QRLA 1U8XX 2VOJA 2YZ7A 3K96A 2W4QA 4UULA 4ZRMA 4RPKA 1H9BA 1V35A 4KTVE 1OFGA 4BO4A 2ZTMA 2HO5A 1NNUA 3ZHXA 1SMKA 2VUUA 5KNLA 2P4QA 3KYBA 4FFNA 1DBVO 3NDIA 3HWRA 2BFPA 2XXBA 1O89A 5T6BA 4RPJA 1Q7BA 5I7EA 4K1LA 5FFFA 1LSJA 2I6TA 4IDDA 3RUFA 1EUDA 1L7EA 4Z0TA 4HP8A 2ZQZA 4BO1A 8LDHA 1TT5B 5A02A 1PS9A 3RUHA 3WX0A 4BO7A 2FPGA 5G0VA 3SX2A 2EW2A 2X8LA 3WYBA 5JAIA 1IY8A 5DBGA 1U3UA 5ER6A 4ALIA 4O59O 4DQUA 1UZNA 3KV3O 3JQAD 1IZ9A 4H16A 2PH3A 4XYBA 1U4OA 4LCJA 3RROA 1XQ1A 1KERA 2Q4EA 4G2NA 3ZN2A 1HKUA 3EK2A 3PYLA 4BNLA 2W90A 3I4CA 3LLSA 1GQYA 3WGHA 3OIGA 2PKQP 3VVCA 3QWFA 3WTBA 3C85A 3O4RA 4PZDA 2C29D 3E5RA 1LRJA 4BMSA 2ZCVA 2OL4A 3AOEC 2R2GA 2UAGA 3F1KA 3G1TA 2YV2A 3GDFA 3L9WA 3U4DA 2HU2A 1PWXA 1U2DA 5L7TA 1TT5A 3DOJA 4JX8A 4W82A 4WOJA 1CQJA 1HLDA 2EV9A 1F17A 4N5NA 4QX6A 1A71A 3VPSA 3PPIA 3W8DA 1KC3A 3EAGA 1NQOA 2O3SA 3RCBA 3QA9A 4HKTA 2NU6A 1EE2A 3ZHBA 4N5LA 2Z5LA 4FFLA 1TLTA 1RM4A 4ZQFA 4I5DA 4F45A 3ZW8A 1GCUA 1GAEO 1GU7A 1LSOA 3JQGA 4GX2A 3R1IA 1PJBA 3PWSA 4GVLA 4J7UA 5JO9A 1GR0A 1PJ4A 2WYUA 5JAMA 1JWAB 1NVGA 1ZUD1 4TZTA 4A5OA 3ULKA 2VZ0A 3KVOA 4GAEA 3QVWA 3T7CA 1HRDA 2Y0EA 1YJ8A 3E6AA 3QP9A 4D45A 3LYLA 1VE9A 1M76A 1DIAA 3W4JA 3HSKA 3ENKA 4XX0A 3ANMA 4ZA2A 5JDCC 1PZFA 1H5QA 2CY0A 4M1QA 4DVJA 1YBVA 3KUXA 3WMWA 1E5LA 4RGBA 4WECA 1U1IA 4EUHA 3SLKA 4R69A 5JPIA 1N8KA 3GRKA 2JJYA 3JYLA 4XRRA 5COBA 4J1SA 5A3JA 4NJOA 3S2FA 1WPQA 4GX0A 3AWDA 4BB6A 3GPIA 3PHGA 2WTBA 1YQXA 2D5CA 2UUOA 4WGGA 5TSDA 1UXKA 3UCFA 1TA4A 3L4BA 4J7CA 1FJHA 5KVCA 5TT0A 1U7TA 4ALKA 1E7WA 1CEQA 3L4SO 4GL4A 1RM3A 1LDEA 4Z6KA 2VNSA 5L7YA 3E9QA 1E3SA 1YOVA 1WVGA 3TZHA 1ID1A 3ONEA 1PTJA 4DLAA 3D64A 4Q3DA 4NBTA 4E21A 1KEWA 1VJ0A 3ZZNA 2VRCA 3JSAA 2BD0A 4HV4A 2DKNA 1AE1A 3DO5A 3WIEA 3D4NA 1X0VA 4OL9A 4RPGA 3ZV4A 2OORA 2O2SA 3DOCA 3B6ZA 1Y81A 4M87A 2EG9A 5DNAA 1UP6A 3R6DA 1BWSA 3GHHA 4F6LA 2C07A 1E1NA 3H9EO 4PG8A 4CMBA 1X7GA 2AXQA 1I36A 3DBHA 2PZMA 1EE9A 3QV1A 4PZCA 4BMNA 3FWNA 1ULUA 1ZCJA 3BMCA 2I5PO 3DMTA 3UHAA 4QO8A 4DPLA 3FI9A 1NHWA 2VQ3A 4RO0A 5JLAA 1P44A 1ISHA 3MTJA 1QYDA 2Q46A 3OEWA 2VZ8A 1X7DA 3S2IA 3EC7A 5A03A 3ABIA 1Z45A 4RLHA 5JO0A 3GUCA 3ZH2A 1JKFA 3RFVA 1LC0A 1LQTA 4A7PA 5BNTA 4LCEA 1B2LA 5TLSA 3N58A 2R00C 1DC4A 1T2DA 4XQEA 2GN9A 4B7XA 1TVEA 5B1YA 1TEHA 1R4NA 1BTOA 4IBOA 2BFMA 2E4AA 4R5MA 1LRLA 3SJUA 4IMPA 1CF2O 2ZIZA 5T57A 5JS6A 3IQDB 3KEOA 4WPGA 1TB4A 4MINA 2ZJ1A 4IY1A 3EY4A 1ULSA 1VRWA 1E7SA 1K6JA 3QVTA 1WLYA 5JDCA 3GQVA 2CVZA 1G1AA 3EZYA 1OI7A 1MG0A 3JQFC 1LDMA 4R1SA 1ADFA 1YE3A 3NGLA 4UREA 1SB8A 3F46A 3IP3A 4NBUA 1C1XB 2DTEA 1WDMA 4NMHA 1NAIA 2HMVA 4WE3A 4M8SA 3PZRA 4BQPA 4XJTA 2E49A 4NFYA 3UFXA 3DZHA 1I3LA 4BO3A 5L53A 4Z3DA 1PJSA 3JTMA 4G5HA 3B1KA 2C0CA 3RC7A 4W6ZA 2Y1EA 3RKRA 5BT9A 4L75A 4E32A 3VVBA 3WSVA 3LK7A 4CM4B 4GX1A 2ZYAA 4CMHA 1SB9A 3ZWVA 1EVZA 1YVEI 4Z9XA 1C0KA 5BQFA 3FNHA 4NI5A 4EBFA 4JP2A 4TWRA 1E6WA 3F5SA 1U3TA 1XKQA 1HZZA 4CLDA 2GCGA 3U62A 3I1JA 4TZKA 4D0RA 3C7AA 4RZHA 2YV3A 1NPDA 4N5MA 1DIBA 1P1JA 4IDFA 2JL1A 1YDWA 1DRVA 1YB4A 3EVNA 1YXMA 1P1HA 3GVPA 2JKVA 4BO2A 1WDLA 4HFRA 1D4FA 4YJHA 3L6DA 4B3JA 3VZPA 3SEFA 2NV6A 1B14A 3WNQA 3WWYA 5G0TA 2EGHA 4PVDA 4A26A 1SO8A 1PS8A 4GGOA 4CMCA 4URFA 2AW5A 4HFJA 4DREA 5A06A 4YXFA 2UYYA 3ZWYA 4CQMB 1ENYA 4CMEA 3ZDFA 1UP4A 3UICA 3GDGA 5BSFA 1GDHA 1AN9A 3ROMA 4PVCA 4JCOA 1BGVA 2H63A 4FFMA 2NTNA 4BS9A 3VH1A 1UR5A 3IMFA 4K6CA 3S8MA 4CLOA 4JGBA 2V65A 3NJ4A 2IYPA 1HEUA 3KYDA 5I9NA 2EKLA 1JAXA 3L4BC 4DIFA 5L4LA 3JQ8A 4KOAA 4XEHA 1OAAA 3GN1A 4GBJA 1WXDA 3JQ9C 3JD1A 3H9UA 4EUEA 5A9RA 1NXQA 2YW9A 4NFHA 4DGSA 3ORFA 4KUHA 2NQ8A 2NSDA 2DVMA 1W6UA 3HHPA 3PQEA 5GMOA 3TZ6A 3BMNA 1LDGA 2FWMX 2TMGA 4BKOA 3BMOB 2JAPA 5KTKA 2J5KA 3GT0A 5HBRA 2VTEA 5IN4A 2PWZA 1YL6A 4DTIA 5AXDA 1K5HA 1N7GA 3DTYA 3P5SA 3TRIA 2VT2A 3N7UA 4UUMA 3PDUA 4IDGA 4EJ6A 1T4BA 1K2WA 3S1LA 3JQ7B 4MO2A 1V8BA 3Q1LA 5JC1A 4JBIA 3NX4A 4IMRA 5EL0A 4O5OA 3U4HA 1JTVA 3DMTC 4R4JA 4YRDA 3AY6A 4D3FA 1E3WB 2PD3A 1NFRA 2OGUA 2DU8A 1SZJG 3A1NA 5THQA 1JQBA 1IPFA 1T2CA 2IEDA 2O48X 3F9IA 3LDHA 2WEKA 4BNZA 2W2KA 1DIHA 1QLHA 2Q45A 3EZLA 3PTZA 2FOIA 3B70A 4LGVA 5C7IO 1V3TA 4F3YA 4P4NA 4BNWA 2CUKA 5DULA 1Z7BA 3NJ8A 5CPFA 3A28A 4CM7A 4ZJUA 4CQMA 3QWIA 2D5AA 3H4VA 5HTOA 1IB6A 1UDAA 4EW6A 1OBFO 3NV9A 4Y98A 2NUAA 3WLEA 4DC0A 1GFSA 2B5WA 3PHHA 1YB1A 3PFFA 4GQAA 4NK5A 4FC6A 4DLLA 2GNAA 3I6IA 3V8BA 1HT0A 4UVDA 4R1NA 2HLPA 2PZJA 1UZMA 1HZJA 1DEHA 2G0TA 3LC1O 4UEOA 2A4KA 2Y1CA 1C0PA 1UXJA 4DIBA 3A14A 3H2SA 5TX7A 2J3IA 5CDSA 4YCAA 3SJ7A 2FZEA 2DPGA 3GRPA 4INAA 2X9GA 3TNLA 5B12A 3K2EA 5C37A 2WD8A 3EDMA 5THKA 1JAYA 2Q2VA 4E2XA 4RVFA 1EMDA 4XQGA 1I3NA 3JD4A 1B3BA 4PN3A 4BO0A 4ZVVA 3NKLA 5CDTA 2ZKLA 5EPOA 2IXAA 2QX7A 1XWFA 3FTNA 4RQUA 3GNSA 4KP7A 1R0KA 1VI2A 2WMDA 3B20A 4Q9NA 3UCXA 4W9NC 1QP8A 1SOWA 2DBRA 5T64A 3ZW9A 3V1UA 3PJEA 3BYZA 1Y6JA 2FR0A 4L0QA 1PGJA 3PK0A 1QXSA 2Y1FA 2H6EA 1DC5A 1PSDA 1U2GA 2X0IA 1DB3A 1O0SA 4K26A 1BDMA 3K9QO 3OBBA 4ZGWA 4J49A 3HDQA 3H8VA 3ZWCA 3GEGA 3NDRA 4WOKA 3SLGA 1E7YA 3LT2A 4RL6A 3VDRA 4PIVA 4MVJD 2NNLD 5A9TA 4NU6A 1FK8A 5K6AC 4NK4A 2WE7A 3D3WB 2BI8A 1RYEA 2VUSA 1PL6A 3DDNA 4E5KA 1IE3A 4RJTA 2VNAA 3OICA 4PG5A 1A4UA 4QTZA 2HMUA 3TSCA 3QIVA 3UKOA 3ZNOA 4MOWA 3ZU5A 3HDJA 2JD0A 2LDBA 4XDYA 1DRWA 3EMKA 3OEYA 2AA3A 2I76A 1VL0A 4BUCA 2EF1A 1WWKA 1N2SA 2CVOA 3INGA 4ND4A 1HYEA 1E3LA 4RVUA 1QV6A 1JKIA 2E6UX 2CDCA 4GSLA 4I9NA 1XYGA 2GPTA 4TKMA 4TRJA 3RUIA 3ZV6A 3CUKA 3PYXA 2EWMA 4JQCA 4YR9A 4AICA 1CYDA 3RUCA 3VPHA 2Q99A 4PG6A 5DBFA 4DQVA 4DXHA 3AUSA 3CKYA 2HDHA 2AG5A 1N9GB 3INTA 4E30A 1UXIA 3BA1A 1QYXA 4WK6A 5GZ1A 2H1SA 1UAYA 2B35A 3HB5X 2J5RA 2A92A 2X22A 1KBZA 5EQDA 1HDOA 2DPHA 3CSDA 5TT1A 2GN6A 2HRBA 4FSHA 1FMCA 4BQRA 4DYVA 1KIFA 1H93A 3ZHZA 4UVGA 3Q2KA 1EBUA 3AFNA 3MEQA 4AJJA 1YQGA 3IOYA 3WOHA 1MFZA 3GNQA 3GR6A 4R51A 2HKIA 3IC5A 1RYDA 1I2CA 2RHRA 1E77A 4QUKA 1K6IA 1WMBA 3U4CA 3JQEA 4FOSA 4R41A 2I3AA 4HXYA 4TVBA 4EITA 4GPD1 3VPFA 3DAPA 4ZQBA 3VZRA 1YQDA 2YV1A 4L8VA 4PLVA 4FFOA 3FSRA 1IPEA 4HUJA 2B0JA 1YOVB 5JDIA 4J1TA 3QSGA 5LCXA 3RI3A 1X13A 4FOOA 3JQDA 5TRTA 2AMFA 4I9HA 4YT4A 2GN4A 2HK7A 4XIJA 4E31A 3GA0A 1H94A 3FNFA 1LEHA 3HZZA 1U9JA 4Q3EA 1I2BA 2QYSA 1M66A 3IIEA 1NQTA 4P22A 3D1LA 1ZZEA 5I9MA 1M2WA 1GZ6A 1KY5A 3WGZA 1RM0A 2W8ZA 3PHJA 4TRMA 1J4AA 3TPCA 4D7AA 1UDBA 2OBNA 4M89A 1Y7TA 1B0AA 1WAMA 3OJOA 4PLTA 4O1MA 1VM6A 1CRWG 2R00A 3E8XA 3MJEA 5KIAA 1OOEA 4L9RA 3C7CB 3WS7A 2W98A 4UUNA 2PGDA 3WMXA 4YQZA 3L77A 3K2BA 1C1DA 2YFHA 2IDZA 4FFPA 4E2WA 1BVUA 4WASA 4G81A 2VOEA 1T26A 4M49A 3I9NA 3VH4A 4OJNA 4BGIA 3NTOA 3OECA 5BNIA 3NT2A 4CLXA 1E3JA 5CG1A 1E3IA 4NU5A 4GGPA 1YONA 2Y66A 2GD1O 3K31A 3UF0A 3LT4A 5B37A 5A4DA 2HMTA 3LF2A 1NWCA 1I0ZA 2X5KO 4R54A 4XYMA 4JBGA 3ZWOA 1AHIA 3BHJA 3DBLA 3ETEA 2V6FA 5TNXA 4JBHA 1FDTA 3DBHB 4IQ8A 3PGXA 3TZKA 4W9NA 4BV9A 1ZSYA 2F1KA 4UUPA 2PZKA 3KLMX 1Y9EA 1YH3A 3D5QA 4B8ZA 2QZZA 4IJVA 3U49A 2Y67A 3DBVO 3IJPA 4A27A 3HG7A 3RBVA 3F3SA 2I9PA 2NTJA 3GZNB 4B4OA 1UXHA 3WSWA 5CAEA 3VH3A 2GERA 1E3EA 4A03A 3K30A 1R12A 1XGKA 1P45A 4CMAA 4HADA 4Y6RA 1NPYA 2O2YA 2PTGA 4I1IA 3HFGA 5I7SA 2X0JA 1EVJA 1I10A 4H15A 1E1MA 4TVOA 3L6OO 4FPXA 1Q7CA 2B5VA 3WIDA 1ZSVA 3KO8A 4ND2A 4NJMA 3PP8A 4E5MA 1ZK0A 3WBFA 5EINA 3JV7A 3VHRA 3K5PA 2DAPA 1HXHA 3L9XA 1NQ5A 4CV0A 3OJ0A 3F47A 2CFCA 1NAHA 1E7QA 1PJ3A 2HK8A 4DLBA 4JK3A 1KVTA 4WLVA 3ADPA 5G0SA 1ZSNA 3PQFA 1PEDA 2YQ4A 3BXXA 1R4NB 3P2YA 3X2FA 3M2PA 5G4LA 1PR3A 3JQ6A 4M86A 3C7DB 3IP1A 2PY6A 3GVIA 3SC4A 1SAYA 4CR8A 2O23A 3A9WA 5F1PA 4ALJA 1MB4A 3EYWA 3WGTA 4N18A 4ZHSA 3KSUA 1NR1A 1LDYA 1KS9A 3I9JA 4UEKA 2F00A 1DLIA 4IJUA 4EEXA 3JYOA 4J4BA 1DC6A 2XXJA 3AM5A 4PFJA 1CJCA 1LUAA 2QIOA 3D3EA 5FYDA 1B15A 5G4KB 1D3AA 3KRTA 2FSSA 2P5UA 4BL5A 4YT5A 1NHGA 2VCYA 1HL3A 4MP6A 2O50A 5HM8A 1J49A 2BGMA 1GZ4A 4R16A 4R9RA 1GV0A 1C0LA 3BMCB 3ZWNA 2YYYA 5CDGA 5TJHA 5JBIA 4GWKA 3WFJA 5IDYA 5IDWA 5JNLA 1P31A 4MDHA 4GLOA 1X15A 4CMIA 1GL3A 3TL3A 3DZFA 1P0CA 2EP7A 2VTDA 2VYVA 5B4UA 2C2YA 1EEHA 3H2ZA 1N1EA 3WJ7A 5I8ZA 3VH2A 2AQIA 1M67A 2C7GA 5JAQA 3V2UA 4FIZA 2UV8A 5ILGA 3ZNQA 1MFPA 4D41A 4MP8A 2DC1A 3U3XA 1A4IA 2X6TA 3RU9A 4MKZA 4AJPA 1DJQA 2GYYA 2HUNA 4ZQEA 3UGKA 4K6FA 4P4GA 5HWSA 4CM5A 1ZO8A 5HA5A 5T5QA 3QVSA 2XAAA 1E6UA 2QQ5A 2WJPA 1AXEA 3PHIA 4AJ1A 1Y5MA 4FC7A 4IXWA 5ITVA 4RF2A 4LSWA 1BXZA 4BNKA 4OQZA 4XKJA 4YDRA 1GUFA 4BKRA 2GF2A 3UOGA 4BNJA 4E2YA 4EGFA 3I83A 4B7CA 2EGGA 1ZK4A 2GLXA 1FDUA 1KC1A 3HJAA 1DDOA 3GVXA 3K73O 3LF1A 3I23A 5F1KA 5JAZA 2QHXA 3R0IA 2JAHA 1A27A 5ENDA 1BW9A 4CV3A 5IJZA 3WR5A 4A2CA 2PGLA 5JDIC 2ZB4A 4TRNA 3GPDG 2I66A 1DPGA 2B4RO 4KMSA 4N7RA 2O3QA 2YHUA 1LA2A 3FD8A 5G2OA 3E82A 4J4HA 4GLLA 3I9LA 4JN6B 1ZIDA 3G17A 4MVJG 3MZ0A 5JCJD 1ONOA 4YAEA 1S7CA 1F14A 1WZEA 3KSDO 3NGXA 1PZGA 3JD3A 4QXMA 2OUIA 5KJCA 4CLRA 3STHA 2O3JA 1GCOA 1F12A 2OFPA 4B3IA 3AK4A 3JQBC 5T67A 1YGYA 1QV7A 1PGPA 3T7EA 6ADHA 1EUCA 2ZCUA 2GN8A 4BHTA 2CF6A 3H65A 5J23A 3RFXA 5K0ZA 4PZEA 4NFSA 1Q0LA 1C14A 1NWHA 5K6AA 4XR4A 1LI4A 4QECA 3PJDA 1GQQA 3G49A 4ZU3A 3UH1A 3VZSA 4B3HA 1M6WA 1E7MA 2AQHA 5JE8A 4ESOA 5COAA 2B69A 1HDCA 4CQMD 2G5CA 1ZK2A 4YQYA 4NHEA 3TFQA 5GZ3A 1N7HA 2FRDA 1HDZA 3ETGA 4KWHA 4JP3A 3FCOA 2V6GA 4OXYA 4ITUA 3BTUA 4ONEA 4PGFA 3WQSB 1UP7A 2EERA 1KVQA 4RORA 4BNUA 4J1NA 3SBOA 3W8EA 2LDXA 3JQFA 5LDHA 4RPLA 3PJGA 5GZ6A 1HE2A 3B1JA 1YWGO 1O8CA 1AHHA 2BI7A 1MG5A 2Y99A 4BNGA 1JA9A 2CDBA 4QO7A 3PRJA 5BR7A 4LVUA 4XIYA 1Q0QA 2X23A 5JC8A 1Q7GA 3GOHA 1IHYA 2RHCA 1D8AA 3AOGA 2D4AA 1AXGA 1BG6A 3OP4A 1ZBQA 3PLRA 1JLLA 1ML3A 1ADCA 2C5EA 4X54A 4ZN6A 4DMLA 5CDUA 1JW9B 3FNEA 3WNVA 5H81A 1Z75A 4GH5A 1NTOA 1PU2A 3GC6A 4E5YA 2PKRA 2YY7A 2QZ9A 1SBYA 1HYGA 3V1TC 3Q2IA 4FB5A 3DZBA 1SOVA 5AXAA 1NX6A 4BNTA 1QR6A 3GMSA 3M1LA 3MJCA 3AU9A 5BSEA 2PV7A 3OM9A 5IZCA 1P3DA 3HQ4O 4GX5A 4IIVA 4DC1A 5KVSA 4CLHA 4J0EA 2P2SA 2FZWA 2J5QA 5CEJA 1PGQA 1P33A 4EI2A 3GMDA 1KEUA 2PD6A 1NR7A 4ZD6A 4R1UA 5DCYA 2WD7B 3NDJA 2GO1A 3I3OA 3I52A 3WQQA 1DLJA 3AW9A 3ZI0A 2D1YA 4FCCA 1P0FA 5ICSA 3GEMA 4YBZA 1B8VA 5HS4A 3Q0EA 1B3RA 4LSMA 3INRA 3OSUA 4TRRA 1I32A 1NVTA 5AVOA 1T2FA 5CDYA 2HCTA 1ZEMA 4R9SA 2BMAA 4EYEA 1NP3A 1TT7A 3C1OA 4IZIA 1BDBA 1BSVA 1VPDA 1L1FA 3H9JA 1I01A 5B4VA 2IZZA 3H7AA 3L07A 2J3KA 1VKNA 4TROA 3FRJA 3IUPA 3PDJA 4CM3A 3NRCA 5L9AA 2NU7A 4UVHA 3WG9A 3AI1A 4R3NA 3V1YA 3OFSA 4R5HA 2Z1NA 3UXYA 2VYND 3KYCB 5T8KA 4CV2A 2NQTA 4KZPA 1QYCA 4YRBA 3FBGA 1DFGA 1X14A 3PEFA 2EJVA 2X86A 3T4EA 1GPDG 1ONPA 2DM6A 4UVIA 3FHLA 4Y67A 4K28A 3IL2A 3CMMA 3HDHA 3GK3A 2BELA 3OA0A 3WGQA 1XA0A 2G76A 3ENNA 3CZMA 3W6UA 1T4DA 2WD7A 2BFOA 3LQFA 4U0KA 5EMHA 5A5FA 1LTHR 2WYVA 4BO8A 2DUUA 2Q1WA 1J0XO 1CIVA 3NAQA 2XOXA 3GGGA 2BKAA 3DMYA 5L4NA 1ENPA 2FN7A 3DC2A 1ZW1A 4IDCA 4U6QA 4J1QA 4KTTE 1KYQA 1ZXBA 5I9LA 5A3VA 5L45A 1QORA 1IZ0A 3QVXA 1I8TA 1WNTA 4F46A 4CMGA 3ROQA 1I3KA 1NASA 2X5JO 4LVCA 1A72A 3S2EA 2PGJA 4NNJA 3Q9NA 2JFHA 4NJMB 5L4SA 3W6ZA 1NPTO 1PIWA 4WLNA 3RQSA 4I5FA 3KLPX 3PVZA 4B7UA 2EHDA 4GI2A 1LDBA 4Z0PA 3D3WA 3JD2A 2NVBA 1F8FA 4LMPA 2HK9A 3RFTA 1H6BA 3GZNA 4CV1A 3G79A 4GVXA 2CZCA 4WCFA 4UAGA 4YJDA 3TQHA 5JCJA 2WDZA 1XHLA 1YRLA 3A4VA 5JY6A 1E6EA 1P74A 2P5YA 3DR3A 4E2ZA 1ZK3A 1PL7A 3DHEA 1LLUA 5ENVA 1NFFA 4OH1A 1MX3A 3KOUA 4PCVA 5EQFA 1HTBA 5CFZA 4J90A 3JQGB 4AJLA 1LX6A 4ALLA 3WBBA 4FW8A 2P9CA 4JIGA 2X58A 3HDYA 2Y05A 1BHSA 3KSZO 4XGNA 3DWFA 3PWKA 4RDIA 2X7HA 2O3RA 1ZK1A 3AI2A 2GZ2A 4NH4A 1PS0A 1W4ZA 1A5ZA 3PFWO 1KOLA 4S3MA 5KVVA 4CM9D 1U8FO 1QYVA 5AXBA 5KJEA 1J5PA 4Y6SA 4XB2A 2VRBA 5FF9A 1T24A 7MDHA 3M1AA 5BSHA 4QFDA 4XJSA 4E33A 3QWHA 3L6EA 2CVQA 4WCFB 1RM5A 1U5AA 4YYZA 4MIYA 1R0LA 1Y9AA 4XQ9A 1PQWA 3RIHA 5FEUA 1ZNQO 2D59A 1R4MA 5CHEA 3HN2A 3JD0A 3ZNPA 1O5IA 2AE2A 2H5LA 4BNNA 1WDKA 3LT1A 1N1GA 4MVJI 4N54A 2OP0A 4IZHA 2DT5A 3VZQA 4OIMA 1A9ZA 1LXCA 2O7QA 4MJLA 1ONNA 2A35A 3O8QA 3ZHYA 2RCYA 2C59A 1VJ1A 4JJGA 3QVOA 3VOSA 4B79A 2VHVA 3RUAA 2YUTA 4J7XA 4S1VA 5KJ1A 3KB6A 1WP4A 3HB4X 1I33A 1PR9A 1LSSA 3FR7A 4O6VA 2CSUA 3MTGA 4WCDA 2HSDA 1ZVMA 1HDXA 4Y9DA 2C5AA 3T4XA 1I3MA 4D43A 4EJ0A 1DIRA 2H9IA 3PLNA 4J43A 5JYEA 3DAFA 4FFRA 4IDBA 4CQLB 3H9QA 4P4LA 5IAAA 1TXGA 2YDYA 3GF4A 3V2GA 3H5AA 1EUZA 1EFLA 3KHUA 2Y0DA 3R3JA 4QFCA 3GN2A 3SVTA 4XYGA 3DONA 4YA6A 5T8KC 1ISJA 3GDOA 3EW7A 3I9OA 4JLWA 4II3A 3V2HA 3UW3A 1U5CA 5TQVA 5JFOA 1H9AA 1ADBA 1Q1NA 2WYWA 3ANNA 1B8PA 2PD4A 2ZB3A 4OYRA 4RVDA 3AI3A 4IGEA 3DTTA 2V6BA 1NFQA 3CEAA 3F5QA 2AEMA 2D3TA 4IS3A 4MKRA 4OMUA 1MA0A 4BVAA 2OXIA 4AJIA 3LVFO 1UZLA 2J6IA 2GZ3A 2GUGA 2JHFA 5JW6A 3FWZA 4C7JA 3EHEA 1BRMA 5ER9A 1R4MB 1IL0A 2RBEA 4PLCA 2QRKA 2VWPA 3DZIA 1N9GA 2VYNA 4QQRA 5G4KA 4A10A 1LSUA 1HF3A 4XB1A 2O4UX 4MIOA 3MJSA 1DFIA 3OIFA 4CUZA 2Z1MA 4IPTA 4ZQHA 5KOIA 1IYZA 1GYQA 4RCVA 3NT4A 5F1OA 1UUFA 2OBYA 3TWOA 4GMGA 3ASVA 5JYDA 4EUFA 3W4KA 4M54A 1UAGA 1M6HA 2ZYDA 4ZQGA 1PJQA 4E5PA 4E0BA 4RF4A 3PGJA 1B7GO 1V3VA 4C7KA 1PZEA 3D4PA 2ZTVA 1Z6ZA 2DBQA 3RASA 1CWUA 2DUWA 1OC2A 4JJIA 5C7LO 5DP2A 3WWZA 1LRKA 3KETA 3H5RA 8ADHA 3FN4A 3O9ZA 3BMOA 3RJ5A 4CM6A 3BIOA 1K3TA 5LDGA 4YRAA 1Q2XA 3QRWA 1VLLA 7ADHA 5HRUA 3ST7A 4CM1A 1DHRA 1DHTA 5I7FA 3AU8A 3DZGA 4RDHA 5C7OO 3QWAA 2VZ9A 4D44A 4WLUA 3GNTA 2AQ8A 2ZK7A 4Q3NA 4D79A 1ZH8A 3DB2A 2AHRA 2C54A 1EQ2A 5KVQA 2W2LD 4RF5A 3SXPA 4A73A 3WGIA 4W7IA 4DMMA 4PG4A 3BMQA 3TN7A 4LRSB 1GADO 1SPXA 3H6KA 5HS6A 3F6YA 3NTQA 3OETA 4OHUA 5A9SA 5L51A 4PRKA 4XA8A 1XEAA 4BNYA 1P1IA 4BO9A 3JQ9A 3K8ZA 2NWQA 4H3VA 3RC2A 1YL5A 4U5QA 4PLZA 1H6CA 2B83A 2JCYA 2P91A 3OQBA 4GMFA 4DBVO 5COQA 4D0SA 1D7OA 5DN9A 3LT0A 2AG8A 5TGDA 3PIDA 4HWKA 5AYVA 3RJ9A 4I08A 2RIRA 2CD9A 2X9NA 2VHZA 3WB9A 4YT2A 3QJ5A 3QE3A 2PNFA 1FF9A 4E13A 4KWIA 1NYTA 1GQ2A 1AUPA 2ZATA 3FTPA 3RC9A 1VKOA 2Q3EA 4CUJA 1U3WA 3C1TA 3M6IA 3DFZA 1I24A 1ZXLA 2Q1SA 4E6PA 1KEPA 2VRCD 2PA3A 2AE1A 4J6FA 4YAKA 1H6DA 1TI7A 3WXBA 3FNGA 2VWGA 3LU1A 1HYHA 2DFVA 4L4XA 4DQXA 5B4TA 1BMDA 2I99A 1JKJA 4AVYA 4HY3A 3MCVA 1Z82A 4J91A 1NVMB 1SEVA 3JQBA 1EVIA 3RUEA 4WKGA 3RBXA 4O63O 4E3ZA 4YAIA 5JMWA 5H83A 5MDHA 2PKQO 3QW2A 4HFNA 5F5LA 2P9EA 2B4QA 4BMVA 3MOGA 2XPCA 1DFHA 1W0CA 2NACA 1HETA 1HLPA 1QYWA 3COSA 3PWZA 2D0IA 4RLSA 4B8WA 4CL3A 3Q9UA 4KUGA 4NBVA 2RH4A 1Y1PA 2W2KB 5IDQA 4C4OA 4KDEA 4D3DA 4NIMA 4BB5A 2BF7A 4PLFA 5A04A 3ITDA 3C24A 4OKIA 4AJ2A 4KQXA 1DAOA 4XGKA 1XLTA 5CG2A 3GVCA 4NG5A 3SC6A 3TL2A 2IYOA 3VKVA 4DL9A 1PJTA 4OM8A 3AUAA 4AJ4A 5KCZA 4Z0HO 1XELA 3AM3A 2ZB7A 1GTMA 3PQDA 3VAZA 1Y8QB 1RPNA 2C2XA 2JFFA 2NU8A 3ZWPA 1MXHA 3GEDA 5AOVA 1PQUA 3E9NA 1SCUA 1JN0A 4CQLA 1F06A 2FMUA 3BMNB 3QY9A 1W73A 4NQZA 2VT3A 1KVRA 4WEOA 1HDRA 2ZTLA 3G1UA 4IXTA 1P1FA 1A9YA 1YO6A 1C1XA 4IJWA 2NLOA 3C8MA 4JJFA 4YACA 5IDXA 2FR8A 3DBRB 3BTOA 5DP1A 3WYCA 1OZAA 1Z7EA 4FJ2A 4WJZA 3U4IA 3H9GA 2Y93A 3ETDA 2C7VA 1LLQA 4BGVA 2WWRA 3AY7A 1Z73A 3ZNNA 1E7RA 5KWEA 4AJEA 4YPOA 3TDKA 2RH8A 4ZICA 4Q3CA 4U6SA 2DBVO 2W2LA 2DLDA 3K92A 3CZRA 4B4VA 1IOLA 1Q0HA 4AJNA 5DT9A 4B4WA 4CMKA 4ROSA 4ND1A 1T2AA 3ANLA 1LNQA 1ARZA 4KQWA 4RQTA 1JVBA 3OHSX 4DIOA 1H6AA 4FGWA 4GKVA 4OO3A 4PLWA 4ILKA 1YL7A 2BGKA 1YB5A 3MJTA 2IZ0A 1X1EA 2P68A 4KUEA 2D2IA 3DBLB 4E12A 5A05A 3E5MA 4BNVA 1DAPA 1KETA 3GAZA 3X2EA 2B4TO 5CEFA 1DO8A 2A9FA 3RUDA 4UVEA 3D0OA 1ENZA 3TOZA 3O26A 3D5TA 4CM4A 2PK3A 3LSYA 1O9BA 4MP3A 5I8WA 1ISMA 3W8FA 4AFNA 2X9VA 4BO6A 3MWEB 4ID9A 3CH6A 4II2A 4CLRB 2DTXA 4Z3KA 1GZ3A 3TOXA 3BTVA 5EJ2A 1XU9A 4HX5A 5G0WA 4QEDA 2P9GA 5ITWA 4MVJP 2AEJA 5KJ6A 5L95A 3O03A 3DHNA 3L0DA 4DUPA 3OA2A 4R01A 3ADOA 2XF8A 4CMEC 4D3SA 3G0OA 4YT8A 2JD1A 2PH5A 2HJRA 2BLLA 2YFQA 3JYQA 4OOEA 1JDJA 5L3ZA 4Q3AA 3N74A 4J2HA 4DPKA 4BNMA 1YBMA 1NBOA 3I5MA 4EJMA 4LRTB 3TZQA 3AFMA 1G0OA 4Y8VA 3RKUA 2Q49A 2POQX 4CUKA 3FF4A 3D4OA 2CF5A 3RD5A 4RPHA 3DBRA 4EDFA 5KKAA 1PGOA 4O0LA 3IDSA 4WEQA 3FPCA 2FP4A 4CLEA 2JCXA 4LW8A 2GZ1A 5DCUA 1GYPA 3GZ4A 3HUDA 4RVGA 4WLFA 5JCXA 1ZJZA 2IE0A 5G0UA 3JQCA 1QRRA 1RKXA 2GDZA 2AEFA 3ZWWA 2EJWA 3BHMA 3MWDB 3B1FA 1T1SA 1B8UA 2B36A 4IGFA 1LJ8A 1HE5A 3GGOA 1R37A 3GUYA 1E5QA 5DDIP 2O3TA 1PJLA 3GAFA 3BTSA 1XCBA 3E1KA 3CE6A 3F4BA 1KVUA 3GFBA 1BW9B 3WQRA 3JQAA 4XYEA 3WGYA 4CR7A 3DFUA 1KEVA 1C1DB 1XR3A 5A9SB 1XDWA 1O94A 1X7HA 4Z9FA 9LDTA 4PRLA 3AUTA 1FDVA 1T25A 3JQ7A 5ES3A 4OAQA 3EGOA 4FR5A 1MGOA 1IULA 2IODA 3Q11A 4R3WA 4L4RA 4RV9A 3WJAA 2VWHA 2NVUB 4J16A 1IHXA 4CPDA 1ZMOA 5TJ9A 1CQIA 2FY8A 4BNFA 3WGOA 1Y8QA 2C20A 4TQGA 2V6MA 4YJGB 4TSKA 4FBGA 4HNHA 2JFGA 3I6QA 4E5NA 1DRUA 1EK5A 3DL2A 4FDAA 3PJFA 5TC4A 1V3UA 1WZIA 1DSSG 2Q1TA 5KKCA 2OOSA 3ZWXA 4OSOA 2DFDA 2QRJA 5CEEA 4Y6PA 4ALNA 3ICPA 2I67A 2AQKA 5DBIA 4E4YA 4WNCA 3IKTA 3CTMA 5L40A 1XG5A 3IJRA 1M75A 3GFGA 3VPXA 2ZTUA 4A0SA 5BNFA 1QKIA 1X0XA 1LBEA 2NVUA 3AJRA 3PYMA 4MPDA 5F21A 3W4IA 4BNXA 4IJKA 2R6JA 5ILOA 2Q2WA 4XGIA 4IM7A 3DXFA 1OC4A 4LISA 2FPIA 2BHLA 2HQ1A 2ZQYA 5LC1A 3AY3A 1LDNA 2WSBA 4UUOA 1U7HA 2YQ5A 3WFIA 3ZV3A 1BVRA 2JCVA 4BV8A 2J8ZA 3ZGYA 4YAGA 2NVWA 3ROKA 3K6JA 3CPSA 1UH5A 1YJQA 5IFLA 2J3JA 2G17A 4CMJA 1JU9A 1U28A 3DAGA 3VKUA 1PX0A 2BH9A 2CDAA 4KDFA 3AUUA 3QWBA 2OP1A 1MUUA 1U4SA 1P1RA 1SNYA 4WLOA 1ZKMA 1VJTA 1R16A 1FXSA 1Y8RB 3JYPA 4IS2A 3E48A 4OKNA 3ZWBA 5K9ZA 3LC7O 4NR0A 1E0DA 5A1TA 1H2HA 2HAEA 2VUTA 1L7DA 4L74A 4PLGA 2FHSA 4CJXA 3KEQA 5A5EA 3OJLA 4NPCA 4QT0A 5I7VA 3WYEA 5F3RA 4B4UA 2OHXA 2VN8A 5TS3A 3AM4A 4U7WA 5IXSA 3HFSA 2ILTA 4LN1A 1SEPA 1JWBB 2WM3A 4CMIB 3ONDA 3GHYA 1EFKA 3JCZA 3S55A 1LLCA 4ZRNA 3UAGA 1N5DA 3LZ6A 5DZSA 2G82A 5JY1A 4AJOA 4BKQA 2Y0CA 4J9UE 2G1UA 3BHIA 4JNKA 2IXBA 3RVDA 4EEZA 5BSGA 3IAHA 1BXKA 5ICMA 3OF2A 4UEJA 4YB8A 2Y68A 3RC1A 4LMRA 1WMAA 4P8RA 1FDSA 5CP8A 1GV1A 2PLAA 3IUSA 4BIIA 2E37A 4DWVA 2YDXA 4IQ0A 2X0NA 3U0BA 1DC3A 4FJ1A 4AL4A 1E1LA 1LQUA 4M55A 3GH3A 2JD2A 3Q6IA 3QQPA 1GUYA 3FR8A 4XQCA 1Y8RA 1GY8A 2C82A 1UXGA 2YHIA 1P1KA 4OXKA 4R1TA 1CERA 5U9CA 1V9LA 3IS3A 4BGEA 3H3FA 3GVHA 3MJVA 1QSGA 1LLDA 4W4TA 3A06A 1MLDA 4W99A 4XYLA 1FDWA 3OQ6A 4OGWA 1UJMA 4MVJA 5L7WA 4YJFB 3BMQB 2PZLA 5DCWA 1J6UA 2JHGA 1XQ6A 1EDZA 4EZBA 4AJKA 3MOIA 3P7MA 2V7PA 3CXRA 3EUWA 1PQPA 4G65A 3HADA 4I5GA 3WDSA 5IZCC 4IIUA 1NM5A 4FJ0A 4OSPA 4MVJH 4NDNE 3WICA 1OMOA 4BNHA 1HE4A 2VYVD 1YKFA 1N92A 2VWQA 3D7LA 1I2ZA 3KM0A 1E92A 3ZWMA 3ONFA 1E3WA 3NYWA 5FI5A 4XRGA 5JXWA 2CMDA 1K89A 2HRZA 3OJEA 3BAZA 4HNGA 1NQAO 4L76A 3UVEA 4WCFC 5H82A 1DJNA 3Q3CA 3PI7A 1ENOA 1P9LA 4I9UA 2GRAA 1I5RA 4XDZA 1F8GA 1ADGA 3O8QB 3LC2O 1PGNA 2X4GA 3OMLA 3VDQA 5IF3A 5IG2A 2NADA 1IUKA 2O4CA 4GWGA 4WNIA 5FWNA 3GGPA 2BRUA 5ADHA 2UVDA 5TF4A 2Q50A 5C3MA 2EXXA 4ALMA 3I9MA 3CMCO 1B26A 4BNIA 2Y1OA 1HSZA 3JQ8B 3PZBA 4DPMA 4J9VA 4AJHA 1PWZA 5U4QA 4BKUA 4CM9A 4J2OA 1SC6A 5DF1A 4XD2A 1B16A 2GGSA 4HBGA 2B37A 1KVSA 2SCUA 2IEBA 4Z9YA 4BKPA 4CL8A 3O38A 1GEGA 3ICCA 4TKLA 1E1KA 1LU9A 1GUZA 1XIVA 2HMWA 3NTRA 4YTEA 1ORRA 3ZU3A 1C3VA 2YHIB 1PJCA 4PG7A 5KJFA 2GASA 4BOYA 4YJFA 1MXFA 1EQUA 2EW8A 5FI3A 3QHAA 9LDBA 4IQGA 1Y5RA 1RJWA 1K6XA 1R6DA 4F6CA 4XZ3A 3CINA 5DOZA 1R0SA 5U1PA 5DOVA 1GD1O 5CPBA 4YJHB 4I8XA 5GY7A 1ZEJA 2PFGA 4H7PA 1HDGO 1VSUA 3OH8A 3WTCA 1QLJA 1UDCA 3HE3A 5JMPA 2IRWA 3KYDB 2OO5A 1O95A 3EVTA 4FS3A 5JSFA 1R15A 3U9LA 1YDEA 2DTDA 4CODB 1WW8A 2Q1UA 2Q4BA 4FQ8A 5MGBA 4DA9A 2O7SA 4RZIA 1Z74A 4LK3A 4MIEA 1EVYA 1BXGB 3VTFA 3VTZA 2ET6A 1H2BA 4PLPA 3H3JA 3U5TA 3KBOA 4CM8B 3H5NA 2NM0A 4MVJF 2GR9A 3E9MA 3V5NA 4BGUA 5TIIA 1EDOA 3C3XA 3KZVA 4J3FA 2I65A 3TZCA 3IKVA 3GG2A 3RU7A 2EEZA 3RBZA 3ZWAA 3UN1A 3PIIA 1QG6A 1DOHA 1HWYA 4Q39A 4YVFA 3WGGA 2E48A 2TMDA 2VHYA 3VPGA 2A94A 5EIOA 1X1TA 3JQAB 1A7AA 5EN4A 1MV8A 2QW8A 3DEYX 3NT5A 1H0KA 4ND3A 4Q3BA 4MVJE 3DQPA 4I5EA 4TMFA 2E82A 2RAFA 2NTVA 3NUGA 3MJ4A 3GG9A 2DBZA 4MVJM 1VL6A 4IDEA 4PLHA 1ZFNA 4GKBA 1U3VA 4RVHA 1JVSA 1PL8A 1LC3A 1GEEA 3DOOA 3P2OA 4CR6A 3U09A 3F4LA 1XSEA 3WLFA 1I30A 4DRYA 3P19A 1PJ2A 4NZ9A 1QMGA 3OJFA 2X0RA 3F1LA 1G6KA 4CLOB 1ZJYA 4NBRA 1A7KA 1VSVA 2HJSA 4WUVA 4D46A 1CETA 1D1SA 1V0JA 2Z95A 1AGNA 1BXGA 3R3SA 3CIFA 4YEDA 3UCEA 3GLQA 1ISFA 3AOEA 1HE3A 1ISIA 2P4HX 1GPJA 4U0JA 3G3EA 2J3HA 1EBFA 2BFAA 2QYTA 3UUWA 1GYRA 3NEPX 1HDYA 3RWBA 1PZHA 3C1AA 4YWJA 2ZB8A 4HFMA 2ZYGA 3GY0A 1R66A 4GSKA 2EIHA 1CDOA 4ND5A 3HNPA 1V6AA 1EK6A 4IUYA 2Q2QA 4P38A 3S2GA 1K0UA 1XU7A 3BZUA 1MC4A 3ITKA 3VC7A 4JROA 4YJGA 1ZMTA 4PLYA 3RAJA 4IINA 1P77A 3M2TA 3DHYA 3ASUA 2WE8A 4YAJA 5EERA 4L4SA 4JXKA 4AG3A 1G0NA 3LLVA 4U8GA 1RWBA 3TFOA 2HMSA 3E03A 2O3UA 3PHLA 4D42A 4FN4A 2ZJ0A 3I9KA 4MKXA 1EZ4A 2EKPA 2Y1DA 5AXCA 4CM8A 4L73A 1F0YA 4WLEA 4XWYA 4QSMA 3ZV5A 3FPLA
chains in the Genus database with same CATH superfamily
2FSVA 4XDGA 1Z17A 3EGXB 5TE9A 3KTDA 2EP5A 3NGMA 2Q4TA 1EK1A 1LVHA 3MELA 3RTAA 4B85A 1U9CA 3DDOA 3HA5A 2H1LA 4W7HA 1Z8HA 4NP6A 4O2BB 4ZEOA 4DADA 1BS9A 1B42A 3ON5A 1DCKA 1KY4A 2ISSD 2IYQA 1AXRA 3CNQS 3EHDA 2HRQA 3OESA 1XAJA 4NENB 3RHSA 4D8TA 4BLPA 5C5IA 3W1VA 5LQRA 4ZCIA 1OI3A 2DQ4A 4PAMA 1Q16A 5IXYA 4YI3A 4J0FA 6REQB 4Q4JB 1VC2A 1V43A 5J4KA 3HFRA 2VHXA 5ETJA 3GV0A 5K8LA 4JUBA 4PHHA 1Z0DA 1VMEA 3WWPA 1X1SA 4EY8A 2XSZD 1ZZGA 4YRIA 3BWMA 1IK6A 3M6VA 4OLJA 4BO5A 2X3YA 5JXIA 3LBAA 3FVWA 1RWNA 1TZKA 1X3LA 3M82A 1UBRS 2AFRA 2D8AA 2HIAA 2OZPA 3O1HB 1U1GA 2BHSA 2KPOA 4FD3A 4GOND 3HDGA 4NWIA 3V4FA 5JCZA 5K8JB 4S04A 3BWYA 3KXDA 2E4YA 4K46A 1FXWA 1C8BA 2FQWA 4MV9A 4N47A 3ZCXA 1NYLA 2DCUA 4HDNA 2P3QA 3DMRA 1Y1RA 3TH5A 3PGMA 3UGQA 3VX3A 1W8DA 1XKXA 1W5BA 2W2XA 3UWDA 3VDXA 3I01A 3G2HA 1JF8A 2FPPA 2WJ6A 4R31A 2H08A 1U8XX 3HR8A 1LW7A 4LOLA 4MLCA 5AIAA 3Q72A 4N0PA 4BGDA 1CY0A 2C7QA 2D7DA 5KNCH 3N3BC 1W8IA 1KHTA 1MAWA 1T9AA 2N1BA 4Y2TA 4R2IA 4B45A 3HI4A 3A1CA 4N0MA 4RPKA 2J0SA 1H9BA 2P9BA 1ZICA 4JBXA 2QRVA 5CM8B 3KOYA 1H69A 4JASB 2GTHA 3OE1A 3ZHXA 5K0TA 1CR2A 3PEVA 3QPVA 1Y48E 1AZSC 5ICMA 4FFNA 4EY3A 3D6HA 4Q0MA 1NDHA 3KQMA 4TYQA 5FA5A 3S0JA 3WLIA 1CUWA 1R50A 4UKDA 4NESA 2FG7C 4RWZA 2P65A 4F3CA 1ZRNA 2CXHA 4BX9A 5I7EA 3KWLA 1IWPB 2O05A 5FFFA 1LSJA 1ZI6A 4RK5A 2FH5B 2REQA 3OX3A 2WP0A 4HWTA 3W5HA 4CIYA 1DL5A 1V47A 1WQ1R 1FS5A 3ACDA 3EXFA 4PZAA 1RW4A 2GUWA 4Z0TA 5TV2A 4W5QA 3CCFA 5IAGA 4EG4A 3MHTA 4WBNA 3E1GA 1WSDA 4FNOA 4HP8A 1V9CA 4BO1A 8LDHA 1TT5B 3H0KA 4BEBA 4R6WA 2A1UB 4L15A 3DLCA 1ORVA 1ZJ6A 1CZNA 2G1KA 3NI2A 5IAEA 1LI7A 1DOAA 2XUGA 3IBTA 4OPMA 1RQPA 4HZGA 1QK4A 2XUJA 4BO7A 2EW2A 2X8LA 3MUFA 5DBGA 4ALIA 1OLXA 3DQZA 3O2NA 4O59O 3BFKA 3GLHB 1T6NA 1UZNA 1KJ9A 1GAQA 3V4VB 2X0FA 4JSRA 4PO9A 3L1JA 3OOWA 2XBLA 3HBJA 4MV4A 1U4OA 4ZOLF 4LCJA 3AERB 1KERA 4DLZA 1E20A 3LBFA 2BW0A 4G5YA 1Y89A 3E2MA 3IR7A 5CIWA 1W9MA 4LRYA 4I4CA 3WTBA 2WWGA 4D4JA 1LRJA 4I1PA 4J0HA 3W90A 4LDPA 2UAGA 1KMNA 1JFFA 2DHQA 3U4DA 2YV2A 1W85A 3M83A 3Q7PA 4LYFA 5LQAA 3FCSB 4RESA 4EZIA 1JI3A 2HA4A 5ALNA 1RI1A 4WOJA 3GRFA 3U1VA 4PTZA 4F60A 1UJBA 4NDZA 5FYQA 5SZJA 3M81A 3VKFA 4L3WA 4XLTA 3EAGA 2J31A 4IW3B 3RCBA 3QA9A 2GJKA 2GFQA 4HKTA 1GG5A 2F1IA 4DUGA 4DV2B 1T5TA 1I1QB 3QPDA 2I8LA 5CW2A 1TLTA 3G8YA 1Y8ZA 1H8ED 1PQYA 2O2EA 3OCYA 4UBIA 4ZYUA 2F48A 3AW8A 1UBKS 3KPVA 5AW4A 5KU7A 3UEOA 4F45A 4YDSA 1LSOA 4ZJZA 1Q1BA 4P7FA 3OHMA 3TECE 1PV4A 5JO9A 1SCQA 1PJ4A 3PEEA 4TXJA 1B8NA 1V4NA 1E94E 1WO8A 1VPEA 4Q7KA 2P75A 2VZ0A 4IFBA 1YK0A 2PCLA 2AZ4A 2CMHA 3TMAA 2H1OA 2IV3A 4EJSC 1RAAA 3SKVA 3KQLA 3E4DA 2GCEA 3GJ3A 3IUEA 1GPKA 1P3JA 1VRVA 2J0UB 3LYLA 4UQLA 3FOEC 1DIAA 1L5HB 1E96A 5G1OA 1VCOA 3W4JA 3HSKA 1PT5A 1WOMA 1S7GA 3U26A 3VYVA 4N7JA 3WKAA 5JDCC 4W5RA 1PZFA 1E1QD 2HADA 3GWGA 4WK0B 3O7MA 4DVJA 2E89A 3UATA 1YBVA 3PDWA 1LPMA 3WMWA 1FIUA 3ICEA 2GTPA 3OZDA 4RGBA 4WECA 3NHUA 1CE8B 2YXEA 2CCKA 3LS2A 2CKMA 4HX9A 1N8KA 2C4HA 4GOKA 4KJZA 2FCRA 2JJYA 4R69A 4MYUA 4XRRA 1N6NA 3HACA 3KHTA 4J6EA 4J1SA 5EIFA 4MYRA 2O8BB 4IDOA 4BLWA 4ARSA 1N75A 2X6RA 2Z8XA 4MTCA 4PGMA 2FWRA 3DE3X 3ZQKA 5KYNA 1WUIS 3PHGA 4KFCA 1CSEE 4V38A 5TSDA 1UXKA 3FMVA 4UE3S 2R60A 4EI8A 1A98A 1TA4A 3L4BA 4KDRA 1SKMA 2FPLA 2C8KA 4FNGA 4RLQA 5EUMA 4YP9A 2GHRA 1U81A 2RDMA 3W2TA 1E7WA 1CEQA 2EZTA 1R8XA 1X80A 3L4SO 4RA6A 3T3DA 1O03A 1RM3A 1C3EA 2P1ZA 1AUOA 2FRVA 2M6RA 2XTAA 3DS8A 5A7GA 2XYRA 3OM8A 3L1HA 5K0BA 2V58A 2QAIA 1JMVA 2YIVX 5D1NA 5BSTA 3LA8A 1Y8CA 4YAUA 1I1OA 2QQEA 3ONEA 4Q6WA 5CT6A 4P9NA 5IHPA 1E0AA 3D64A 4Q3DA 1AKMA 2QMUA 1ONSA 3A0UA 3KNZA 4NBTA 3ZWQA 1J7JA 3ZZNA 3JSAA 1XPRA 4HV4A 2DKNA 4JMLA 3BK1A 1KDPA 4L28A 4ZEWA 2YNMD 1LNZA 5I7HA 3ZV4A 1UKAA 2OORA 3DOCA 5LA6A 2VTVA 1Y81A 2Q5CA 1UP6A 5D87A 4A0HA 3ZUPA 4B80A 3UJDA 1N3YA 1ORDA 1PTKA 3WLLA 4CMBA 1L8LA 2OD9A 2C61A 3G68A 2OGWA 5SYAA 2RGXA 2WV9A 2Q9UA 1WZ2A 2CZQA 3CHYA 3AILA 3ZHUA 3BMCA 3DMTA 4KL8S 2CD7A 4L0MA 4FBLA 4OLHA 3G1WA 2EBHX 1QNLA 3IODA 3R7DA 4EI9A 1QYDA 2PT5A 2Q46A 1J0EA 1C9JA 2JA2A 3S2IA 3EC7A 5A03A 3H1AA 4H7IA 1E32A 4RLHA 4KI0A 5JO0A 5LP1A 1KAMA 1O9GA 1NOKA 4FE7A 2B4KA 1JYSA 2C2WA 5AOAA 5FLXA 1AGXA 1TU4A 2A58A 1B2LA 4EATA 3FGOA 4ZVNA 9ATCA 2HIMA 2WABA 1T2DA 3NBQA 4CQJA 2GN9A 3KZXA 4BN0A 1FB5A 3I01M 3BGSA 3WK5A 2EX1A 5HP4A 1TVEA 1EM8B 5EJ5A 1NW4A 1CUBA 4US1R 1ACLA 2RAUA 4IBOA 3LCVB 3KUCA 3IEMA 1BC5A 5CHYA 4R5MA 1VG8A 1LRLA 2VK1A 1HR0B 4JGGA 1MJGA 3IDFA 5LOVA 1D8TA 1W30A 1E9FA 1VJGA 2GVNA 3ONNA 4QPNA 2ZIZA 5T57A 1W36B 2YZGA 4DA4A 2AF3C 3IQDB 4QNNA 4AMVA 2AVNA 1W5SA 1T9HA 3RW9A 1NUTA 3T7DA 4C29A 1G63A 3HTXA 1YSCA 3F78A 1CDZA 1NQVA 4YH1A 4O4HB 2W11A 1W96A 3E4CA 1L5LA 1MZPA 1ZP6A 1LQ2A 1RMTA 3P97A 2JZOA 1OX4B 1E6MA 1E7SA 1RRCA 2QLMA 1XVAA 3UY4A 3TXXA 2WQZA 1RLOA 2CVZA 2JJ8A 3JQFC 1MG0A 1REQB 4EO9A 1MIOA 3ZOKA 2WM8A 3HXOA 1Q6YA 4AWBA 4U9HS 2P0EA 4Y18A 3NIDB 3F46A 3C5CA 3IP3A 3W2FA 1E9DA 1WDMA 2OB1A 4WN3A 2V5VA 1GHTA 1JIXA 1RKVA 4R1QA 1QTIA 4BTVA 2F90A 2FFQA 3N2ZB 4FYVA 1Y1TA 4M8SA 2P6OA 3M8KA 3ILXA 5DBHX 3UFXA 4Z3DA 3P32A 2FMIA 2RHHA 1G5PA 1XTBA 2PMBA 2VF5X 3B1KA 4B76A 2QSJA 5IC5A 4HTAA 2Y1EA 3RKRA 1XZQA 2I2WA 1DNPA 2XVYA 5F3DA 5BT9A 4YRZA 1TYAE 1ZNYA 1AQ6A 3WYAA 3ZXSA 4CM4B 4PS0A 2F67A 1OI4A 3CRNA 4GX1A 3TVDA 4CMHA 4CWAA 1MW8X 3SHVA 3G0DA 3SZMA 3GO4A 1Z0AA 1EDEA 4M36A 3S2YA 4D0LB 5K3EA 2AKAB 4JP2A 4TWRA 4IOKA 1NVBA 2XTMA 5JRJA 2CBXA 1RXSA 2I2AA 2Q62A 5EKUA 5HCNA 5T4HA 2FEMA 2JFNA 3MWKA 4CLDA 4EM6A 4UPEA 3C7AA 9MHTA 2R87A 1NPDA 3ANTA 2G6BA 1DIBA 1P1JA 1M7HA 3EVNA 3DP7A 4KXVA 1YOBA 4XOUA 1ZLXA 1K7YA 1OCEA 3GRRA 3UJ8A 4BO2A 4DLRA 4AI6A 2XB2A 1D4FA 3L6DA 4EGSA 1SUAA 3CX6A 2X42A 3GJ4A 4EGJA 3L40A 1JHMA 4PVDA 4UCXA 3H1EA 1SO8A 4D82A 5BWCA 1RLTA 4ZXPA 2AYZA 4W6QA 2UYYA 2Y3IA 2FETA 1ENYA 4FZRA 3NHPA 3T3OA 4MITA 2KQUA 3NWOA 3OU2A 2YY5A 1F5SA 4RSHA 3TCKA 5DI3B 4KRFA 3GFQA 3LW8A 4QVKA 1T5BA 2GWRA 4FMDF 4JCOA 4KXYA 1II0A 3ZY6A 2QP4A 5DM2A 1I13A 1UR5A 5IM5A 4YREA 2MIIA 1OBHA 2AFIB 2V8BA 2YWHA 1GGNA 1E5TA 4TXLA 1P2SA 1ZS9A 1HEUA 2OG2A 4MPJA 3DOEA 4Q1EA 2WNSA 1G8GA 2P0AA 4KAJA 2EKBA 2HH9A 2AC4A 1YMVA 2A9KA 4KPUA 4G5XA 2XQFA 4FD2A 4G6ZA 4ZOLA 4JZKA 1VIAA 5EXEA 1E9AA 2V9ZA 5A9RA 2P40A 4ZVKA 5JSKA 3OIVA 3RVKA 4MRMB 2ZSDA 3PC8A 3OFVA 1NXQA 2YW9A 3LOQA 3VI3B 3HCNA 5ANRB 3ORFA 2GI4A 4NFLA 2XXAA 1W6UA 3PQEA 1UPXA 1XD9A 4RENA 2EF0A 5IJ0A 2FWMX 5LJIA 3BMOB 2JAPA 2HU8A 2ZWOA 2VTEA 2R4TA 1IJEA 2PWZA 3TCXB 4TZ0A 4ZYXA 2FK8A 4DTIA 2B99A 5F73A 4JT4A 5LMCA 1VA4A 2UZAA 1XZ8A 2G4LA 3LBNA 2QUBA 1CY7A 3DTYA 3CNNA 2ZR0A 3IB3A 3P5SA 4S1NA 4B3MB 3E3MA 2WFLB 1KF0A 4BPBA 1NZDA 2R4UA 1X38A 4EB0A 3S1AB 1TZJA 4G2TA 1K4KA 3GROA 3PDUA 1T4BA 2JJ1A 3A8TA 2QMOA 3KR0A 4IDGA 1FS4A 2D2FA 3S1SA 4JAVC 4MO2A 1V8BA 3JAMA 1V26A 1K5PA 2YNMC 3OLCX 4HMQA 4M1OA 3SF8A 4MV0A 5FA6A 3WK8A 4MHOA 4BNDB 4JITA 1EX9A 3NX4A 4IMRA 4JEIA 2AV6A 2NO7A 3C8HA 5E9QA 5EL0A 4DGQA 5GGYA 5AVTA 3W9SA 4IDQA 2VT6A 4G86A 1FYWA 4HGZA 5SY9A 2IDMA 1U2TA 5C52B 3A1NA 2DU8A 1MTZA 4TS3A 1P81A 3NAMA 2BY4A 1X6VA 3FVVA 2O48X 4C6SA 2JLSA 2IYNA 2HTEA 3LDHA 2BF4A 1E2UA 1EP2B 2DUMA 2IVZA 3ZE2B 2Q45A 3D1VA 2QTCA 3B3AA 4C2AA 5KX5A 2YS6A 2EZUA 1Z7BA 1JFLA 2RAPA 2CLHB 5AJZA 4CGZA 4JY7A 1ZD4A 2MSLA 4QJBA 1A76A 1OLUA 2EYQA 1G9SA 3BOSA 2VXBA 5IYZF 2IWRA 4NCAA 1T8WA 2D2VA 2I1WA 1FNSA 1GVNB 3ZXUB 2G3YA 3NYIA 4ZCQA 3WLEA 2B5WA 2DULA 3PHHA 4NKRA 2ON6A 4GQAA 4FC6A 4MGKR 2OR3A 1NM5C 2IYFA 4ZALA 3T41A 2XMRA 4KH1A 4UNSA 2P9QA 1HT0A 3RK1A 2HHAA 2PZJA 1YQQA 4W5TA 3AEUB 2QENA 2ZPTX 2ZBUA 4C7MA 2I71A 5HKAA 4XIFA 2IW1A 5KNBD 1RABA 1UXJA 2KW5A 3I28A 2PLNA 3EMBA 4TTPA 3R5SA 4G07A 5CDSA 3QE9Y 1J9ZA 3RUPA 3TFWA 2C83A 3ND5A 4UPVA 4G5GA 4LSZA 4GPIB 4KQ2A 3GRPA 1DKOA 3OFND 4RHEA 2X9GA 3BE8A 5BYJA 3TNLA 3AM1A 4Q82A 4MV5A 3ASZA 4MS3B 4ARAA 2AWOA 1VHDA 2YHBA 1UBJS 2WHEA 1EMDA 4JP8A 1YVPA 2VF4X 1UM8A 5E0OA 1KJJA 3IHWA 3NM6B 4BO0A 2ERYA 2HX1A 4L16A 4JQOA 2PU5A 3KSRA 4P93A 4ID3A 4YJ2B 5EPOA 3A25A 2XYHA 1P8JA 2PBZA 4RQUA 3SFVA 1N36B 2XTZA 3GNSA 3A6JA 1R0KA 1VI2A 5K99A 4W9NC 3C8DA 5A0VA 3V1UA 2OBMA 3EVZA 4L0QA 1TJYA 1Q91A 1PGJA 3LHDA 4HDKA 3T7IA 3HZOA 2BR3A 3HL4A 3G02A 1U2GA 2Q0HA 3T15A 1PDOA 2X0IA 1DB3A 3D1JA 2G9UA 4PBTA 3V46A 3K9QO 3OBBA 4W5WA 1QHHA 3H1BA 4ZJPA 4S2UA 2PXCA 4XM1A 3R0JA 2BFCB 1K27A 1VSBA 2GAOA 3F3KA 1ETHA 1D9XA 3OPYB 4IZOA 3SLGA 2FEXA 3SHWA 2B3TA 3TAHA 4XVCA 5ESRA 1XD2B 4F5WA 4NU6A 5K6AC 2WE7A 3IE2A 1V8OA 1ZRHA 4LZJA 1QC5A 4P2BA 5K3SA 2BI8A 3ZYZA 1W4LA 2DPLA 1FQWA 1PL6A 4M1YA 4M6WB 4UBNA 4AECA 5E6SA 3C16C 3QI7A 1IE3A 1WQ3A 4KI7A 1QYIA 2VNAA 4RDXA 1RZRD 1CQPA 1Q50A 1L8QA 3CWZA 3ANSA 1ZUIA 3C45A 4WZBE 3TSCA 1A5SB 3MOSA 3HMQA 2FFHA 2JD0A 4XDYA 2DWQA 3DT9A 4CEIA 1N2EA 1T36B 1VKJA 2AA3A 2I76A 2ODPA 2VZLA 4YMWA 3STUA 3T9DA 4CTNA 5BSEA 3B7PA 1TEZA 5EXSA 1WWKA 2LUOA 4HXEB 4Y7CA 4ND4A 3H17A 3ZH9B 2ZYUX 2NZXA 1C30A 1TVCA 4M9UA 3G9QA 1E3LA 1JTEA 1IMJA 2ZPUA 4O4JA 1JKIA 3DWEX 4I9NA 4RW0A 3A7EA 4HXGA 1T4CA 3LO5A 2IGTA 4NV1A 4XCQA 1MQ9A 4LVNA 3T06B 2JAQA 3QNMA 4EW3A 1UC4B 4YR9A 1A9XA 1E5DA 2LV8A 2AX3A 3SMQA 4ZMSA 1E8MA 2Q99A 2FJUA 1P4SA 3ZHTA 4DXHA 3ESZA 4AD8A 5JMTA 2AG5A 3INTA 2RARA 5E6RA 5BUSA 1RLMA 3C14C 4WK6A 1UAYA 3EZNA 3NATA 3RSQA 1C1HA 3RRNA 3T3HA 1SRRA 2QZ4A 2PZFA 4AZ0B 4EL0A 5ADUS 2VDWB 2CNWD 1FFWA 2YIJA 1AN0A 4LXGA 1D9ZA 2IIPA 2W2NA 4U00A 3DHWC 3PSAA 1D1QA 5CLIA 4GZMA 3FYHA 4AJJA 1J0AA 1L1RA 3P9RA 3WYNA 4C0XA 2BTEA 4HUQA 2O0HA 4BTEA 4ZCLA 2I6QA 3GFSA 3MIZA 4MZXA 5FWXB 3LQ1A 4Q4AA 1I2CA 2RHRA 2VDRB 1JR4A 1K6IA 1WMBA 2ADMA 3KXKA 4BVKA 4DSTA 3JQEA 1UFRA 1R9JA 1XO1A 4FOSA 2ZI4A 4HXYA 4TLEA 4FW9A 2HLDA 4C08A 1ECGA 3VQTA 4EG6A 1NUQA 4MI9A 3VPFA 3FUVA 3GFFA 4ZQBA 3R5TA 2AR9A 4L8VA 4PLVA 3ZHOA 4HUJA 4RM2A 1YOVB 4OMDA 1IY0A 3QSGA 4R2HA 4ZDWA 4QG3A 1SUFA 5HHTA 4FOOA 4L57A 4YT4A 2MT9A 2IZ7A 4MUHA 1SC3A 4ZOEA 2GN4A 2JGLA 4POOA 3D2BA 1HT2E 1H94A 3MLAA 2N47A 2QUHA 2IF0A 1JLHA 2NP7A 2W83A 1M66A 4WY5A 5AKLA 2Q5HA 3KD2A 1X3SA 1NQTA 1JDBB 5JS2A 2ZS7A 3D1LA 3WL8A 2JIDA 4XUDA 2WAYA 3BZWA 3UA4A 3WGZA 4ND8B 2NGRA 3PHJA 4K1XA 2WF5A 5AHKA 3QH4A 3QM1A 1PWHA 1B0AA 1WAMA 4PLTA 3ETCA 4O1MA 1R18A 1WUJS 4PHCA 4BX0A 1OXMA 4YFYA 1XN1A 1M74A 1KPIA 4MW1A 2JLVA 5KIAA 1YGPA 3RYFA 2H2DA 4L9RA 2SICE 1DQNA 3WS7A 2W98A 1BIFA 1GNQA 1VECA 2ZVPX 3ED5A 2PUTA 2Z4SA 5B53A 2GVZC 3V3TA 2L42A 1BHQ1 2HYDA 5HKKD 1BNCA 3O9MA 1MORA 1VE6A 2C8VA 3PD0A 2NT4A 2SCUB 4WASA 3BL6A 4IO1A 3VV2A 4I5IA 2IQ5A 1SQ5A 1GRQA 1OW3B 3I9NA 4Y2PA 2OQRA 4OJNA 3KP1A 3OECA 4BASA 4BVEA 5JEDA 5AJYA 4PX9A 3AF3A 1LY1A 1KZ6A 4MUJA 1W34A 1WULS 1XPJA 5EMLA 4KVGA 4DCMA 4GGPA 4BMPB 1G4UR 3EIWA 2GD1O 1PD1A 1YIDA 5DGIA 3VNQA 5FTJA 5E6RB 4PC6A 1NWCA 1ISSA 3WI7A 2BGTA 1B8OA 4UPDA 5KMGA 1C9YA 3IPLA 3T38A 4QXRA 2V6FA 4LWPA 3ZBPA 1KJWA 4IQ8A 3LL7A 3QELB 4L5IA 3PGXA 3RS5A 1ZSYA 3WBJA 1RFLA 2GXQA 4L5CA 5L3QA 4B31A 5DE3A 1C7FA 1SIBE 3U49A 2H2WA 3EPPA 4MA5A 4X92A 4BMOB 3HG7A 4PX5A 1GNTA 4ZJUA 3D7KA 1K0FA 3GZNB 4ILEA 3KU1A 3UJ6A 3VR4H 3A7DA 1O1YA 2ZRDA 4B4OA 4CN8A 3EAFA 3IPAA 4YMGA 5LMZA 3T3NA 1GVHA 3K30A 3OIUA 2CLFB 1R12A 3TZLA 2D4HA 3PHCA 1P45A 4HADA 1U1FA 1MEEA 3FCXA 2YVKA 1NPYA 2FEPA 2Q7OE 2QTVA 2PRJA 1TNDA 2UZ0A 3PVCA 1YCGA 1SBZA 3L6OO 1Q7CA 1T0IA 1SU8A 2P78A 2QDKA 5BUQA 4ND2A 2WWTA 3KPJA 4E5MA 3MFYA 3QLVC 3UENA 4BVGA 5IKXA 1KYIA 1U80A 3SYRA 1RWXA 2V4UA 4WADA 4B3FX 1NDQA 1N5JA 1A5BB 1J33A 2YCBA 4G4GA 3WXMA 2GEVA 4NBLA 1P62B 3ZKWB 5CVDA 5BN4A 3F47A 4IQ4A 5EIWA 5DBOA 1VLVA 5FXMA 4PX3A 4F5ZA 2VS1A 2V0CA 2PS9A 4DLBA 4RKQA 1XJWA 4WV3A 5CH8A 2JJQA 4ENQA 3RAPR 1PEDA 2QAGC 2YQ4A 3WGMA 3KB8A 4O4LF 1PR3A 1C7JA 3JQ6A 3OLVA 5G4LA 5JVDA 3CVXA 2CNDA 1I6MA 4HLUC 3M33A 4IDNA 4OIFA 5AOBA 5HRCA 3JZFA 2VP9A 2MDTA 3A9WA 5F1PA 1CX9B 1MB4A 4ALJA 4ZO4A 1B43A 1XYYA 1K4MA 4N18A 1L5MA 4Y2UA 2PL9A 1LDYA 1KS9A 3V55A 2O1EA 3HLTA 1JJIA 5EJ4A 4EEXA 3A1TA 3D02A 4F9GA 3AM5A 4PFJA 1QF9A 4IJMA 4LZWA 5LD2B 3QEAZ 4NCIA 2XT0A 2QIOA 1Y6GA 5FYDA 4GPZA 4NH0A 2NOAA 3UWKA 2JVKA 2D2XA 4ZT4A 5CDFE 1B15A 5G4KB 3UWMA 2HPZA 3FCYA 4BL5A 4CT5A 2VQ6A 4K5QA 2HHCA 5JT1A 1Q21A 1PF7E 2XUHA 2ZE5A 4CKEB 5F2EA 1YQTA 1HFWA 3S2UA 1USVA 1KE2A 4LBVA 4MQUA 5D3MB 3H3XA 4BJ1A 5CDGA 1WCV1 1UZUA 3ORSA 4YALA 2RHJA 1GKIA 3LBIA 1KYVA 1F48A 2W0MA 2JIZD 3AMVA 4TV9A 1QDEA 1XMSA 5I6DA 4JYZA 1NY6A 2EBWA 1J42A 2WUDA 4HLNA 4MDHA 5IDWA 2NO4A 4GLOA 3PCTA 1KFEB 1OXKB 1X15A 1QFXA 3QFRA 2V54A 4KMMA 4RE5A 3TL3A 3HGTA 2VF7A 3ROXA 4DLNA 3WZLA 2EP7A 2NYUA 4RTJA 4AZWA 1H1DA 3TGWA 4N1AA 5JYBA 3WKCA 1KZYC 4ER0A 3KXLA 1EEHA 2WUWE 3QXSA 4PONA 3K0SA 3RG2A 1ZQ1A 3FPKA 2HF7A 3JAWB 5I8ZA 4AF7A 4I8IA 2R7NA 4TTAA 4WBNF 2HWKA 3ZNQA 3SC2B 4RABA 3R75A 2NO6A 5IWAB 3DVAB 5KQMA 4CG1A 4MKZA 4QLAA 3QX9A 4AJPA 3PE3A 3WE7A 1DJQA 1XZBA 2E6KA 2GYYA 2HUNA 2VR1A 3KWMA 1O87A 1WKBA 1ZO8A 3KC2A 5HA5A 1UIRA 1QHXA 1TZCA 2QQ5A 2WJPA 4LNAA 4RPIA 2IP2A 3CRQA 2BMWA 2LP4Y 1HPLA 2WHQA 3DJYA 1RMYA 1DQZA 3IP9A 4FHCA 1KWKA 1NURA 4C2TA 3FOWA 2UZ3A 1UPBA 1IJKA 4RSGA 3WADA 6CHYA 1MB0A 2EQBA 2ES4A 3HXLA 4LYYA 5ITVA 1JFTA 1BXZA 3HU5A 3LYUA 4X91A 2ZRBA 4YDRA 4YONB 3GRYA 4R9VA 2XVXA 3EOAI 4EGFA 1RD4A 2HLNA 4LZZA 3B48A 4PBSA 2I29A 1AKWA 2Y2UA 4JD5A 3ZDCA 3HJAA 1Y3HA 2QXTA 3U3JA 2XMSA 4RADA 5DPMA 3WC4A 2C1EA 2NZ8A 4L3VA 1KEEB 2KE5A 5JAZA 1R88A 3UIEA 1K7XB 1X7WA 1A27A 1JEDA 3TTXA 3ZUGA 4E88A 1DINA 1CRZA 5IJZA 2W6MA 4A2CA 2H1FA 4RD3A 3CU5A 5HFJA 2E9SA 2ECKA 2HCJB 5CX1B 1JQJC 3LDAA 3NASA 3FPGA 3GLIE 4OI0A 5MN6A 2OQ2A 4KMSA 5JJ5A 3OUUA 1EKXA 3FD8A 3E82A 3LWBA 2RJNA 3L8CA 4D81A 1U2ZA 4F84A 4X6XA 4N01A 3GJ6A 4BFYA 3H0EA 5F1YA 4E1BA 2QL7A 3OE7A 4YAEA 2R1TA 1WCYA 4PNHA 4WFJA 1WZEA 5AKXA 3NGXA 3Q2OA 4HD8A 2WWXA 3PKIA 1E2JA 5CTAA 5D3MA 3STHA 5B7PA 5EJMA 2G67A 2OD7A 4CLRA 4JJEA 2ZZMA 2H2HA 3CN7A 3AK4A 4M9ZA 5T67A 1XLUA 2IYVA 4CFZA 3V7FA 1ZRSA 3AGQA 4OA5A 1PGPA 5FWYB 3T7EA 1EUCA 2ZCUA 3RADC 4DA0A 4B71A 1QQ6A 3AGPA 3MSCA 2M98A 3H65A 2P11A 2ZUWA 3TLXA 3QK7A 3A2LA 5K6AA 1ECCA 3BUSA 1LI4A 1Z6GA 4NHOA 4CHGA 5KHLB 1GQQA 3EF1A 4KQ6A 1YDFA 1EXDA 4JI4B 3G2JA 4M21A 5DB4A 4EY4A 1XRQA 2C5HA 5H5JA 3HBMA 1HG1A 2B69A 3S70A 3E3AA 3ELDA 2V0GA 4JYAB 4F5EA 3GEPA 1E8NA 1CT9A 1Z5ZA 4MWDA 4BBJA 1N2HA 5GJVC 1N7HA 1WY5A 2F1OA 4OM7A 5KC8A 3RYTC 1D0SA 2O8VA 4JP3A 3IR5A 4GPBA 2DLNA 3FCOA 1W19A 2JFVA 2VJLA 3P0EA 2CWDA 4TXMA 1FTYA 4PGFA 2NZWA 3SR4A 1UP7A 2EERA 1GR1A 1E5VA 5KYYA 4ZO9A 1HA3A 1OB5A 1N6PA 2VH5R 5B7GA 2HYIC 2C7PA 3R9WA 4J1NA 2R6HA 5IC4A 3TNJA 5JR3A 3F3MA 1ZR2A 1YR1A 3IDQA 3UMGA 3LPAA 4BUJA 3DFIA 1IXRC 3B1JA 1DX6A 4AKGA 1Y7PA 1IEVA 2VC2B 3GFOA 2OBLA 3THOA 4YDQA 2CDBA 2Q5FA 3VSCA 1JFFB 4R8MA 1VHWA 5KTRA 3F6SA 4LVUA 4IIDA 4OP3A 3F6BX 5JC8A 4DR2B 1ZH0A 4AQ7A 2RHCA 3EY9A 2Y0BA 1CEEA 1QAQA 1UODA 3AOGA 1NXSA 3RVJA 4IUBS 4XSVA 3PLRA 3FYUA 2C5EA 4X54A 5D86A 1QAOA 2Z30A 4NZZA 4G8CA 1J5EB 4RD0A 5FA8A 4IJ6A 1CHDA 5FBKA 1S2NA 3WNVA 2XVMA 4ZPJA 5EQJB 3AR5A 2HJVA 1PU2A 2QTRA 4HSGA 5T41A 4CL0A 2NZUG 3O82A 3QTBA 4UQOA 4D4MA 2SNIE 2Z8ZA 5DHFA 3RODA 1BEZA 1MGPA 3AFIA 3DZBA 3VR2D 1SOVA 1SXQA 1OXTA 1QR6A 3K3PA 3M1LA 3MJCA 3D43A 4NE9A 2UYHA 3K70B 4F12A 2SKDA 2PV7A 3CLRC 3FNRA 4RFSB 5G41A 4QREA 3X1YA 3I6YA 5HILA 5GOTA 3W77A 4DC1A 4F8JA 3VHLB 5DHQA 3VO1A 4Q37A 1DQRA 1QH8B 4MUNA 2H3EA 2PD6A 1Q11A 3G9UA 4C1BA 2PMFA 3H4IA 4YQEA 3SGLA 2VH2A 2A7XA 3NCHA 4IG9A 5FHRA 3I3OA 3SR0A 4EF5A 3ZC3A 3WQQA 2X40A 3CVUA 1U0BB 4HCJA 4Y6LA 4POAA 2X0EA 3UPTA 4LI0A 1CDEA 3EG9A 2BEJA 1N25A 1U0FA 4YP7A 2W9XA 4MVCA 1L7RA 3Q0EA 5LQMA 3IJ5A 1I32A 3UJCA 4ETNA 2HCTA 2PVPA 5ALJA 4RH0A 4EYEA 5HIIA 3D5EA 1IRIA 4HDNB 3W7VA 2PWPA 1SQFA 3DBOB 3C1OA 3N2EA 1BSVA 2OHVA 4RY8A 1L1FA 4FOTA 1RJ9B 5FOXA 2G88A 3FY4A 3G23A 3H7AA 4TROA 1WE2A 1MHTA 1GA4A 3IUPA 3OPVA 2VLIA 2C4WA 1M6VB 2X6QA 3NRCA 1LV7A 4YGXB 1UMBB 3P94A 2EC5A 1ZAKA 3PA8A 4EGAA 1EXVA 1U7UA 1ECLA 5ALQA 3AETA 3G59A 3V1YA 1E0KA 4KGVA 2ZRQA 4ARVA 2WAXA 1YU9A 4CV2A 2Z1NA 3AC0A 3NC0C 1DKRA 4KZPA 2H16A 3OOSA 4GZ5A 1SHLA 2QTWB 1IY1A 1X14A 3BS4A 5EJ6A 2X86A 1TRKA 1XEFA 3QF4A 3T4EA 3CVWA 5GJBA 2A33A 4BJ5A 4UVIA 4M46A 4QTTB 3SR3A 5JZBA 2I7TA 5KNBH 1Y82A 2YWGA 3D8TA 3IL2A 3GK3A 4Q4HB 1GTG1 1H23A 3WGQA 3ZGLA 3REGA 4BVJA 3MAAC 1XT6A 3W6UA 1T4DA 2W6CX 1IMOA 3A4LA 4LYDA 2PKEA 2EEPA 2VQSA 4LYEA 3S1AA 4U0KA 4D97A 3SE7A 2G04A 4LZLA 5A5FA 1LTHR 1I80A 2C2OA 2P69A 2ZBVA 3EZ6A 4M9CA 1J0XO 1CIVA 4UFOA 1YMUA 2VSYA 2XOXA 1JSCA 4V0KA 3U7IA 4HUQB 3CLUC 4NMXB 2JIBA 3DC2A 1ZW1A 4RELA 3DLHA 2P90A 3M89A 1G20A 3ITEA 1RQRA 3GA5A 2AUNA 4G56A 3AX6A 1ECJA 5I9LA 1QORA 3P71T 1VLQA 4WZZA 3TTUA 5ALIA 1WNTA 3SEZA 4EY5A 4F46A 3X43A 1EB8A 2BM8A 1U2GC 5GIOE 4P81A 4Q15A 4XPIB 2FU5C 4INZA 3LKDA 4H6WA 3K4QA 1NV9A 2JC3A 4PGGA 5AVKA 2PQ2A 3DMFA 1WY7A 4G1MB 3T35A 2A14A 1L3IA 4K6OA 3RQSA 3ZDEA 3PVZA 4B3SB 1SUEA 5F98A 4FR0A 1F38A 3QE4A 4GI2A 5I51A 4K7JA 5AK3A 1SA0A 4RANA 1IQ0A 3B5IA 2QX8A 4QASA 4YAWA 1F8FA 3IIJA 5REQB 1IXYA 3D4BA 3K72B 2B6HA 4V2IA 5EUQB 4KLAA 1NKSA 2Q3MA 2AXPA 5DI3A 4UAGA 3UMJA 3GRVA 5EHXA 2E87A 1D07A 4IEFB 1YRLA 2MYNA 2GYVA 1K8ZB 1KHHA 4OU5A 1II8A 2E7ZA 2PGNA 3FBWA 1E6EA 1IDN1 5EXDA 3V8PA 2ENUA 1H66A 4HDMB 3DVSX 4WHMA 5HTKA 1DG9A 4E2ZA 1EFTA 1GFZA 2H31A 3ETHA 2AOVA 1W5AA 2VPYA 3NUZA 1JGTA 1M7GA 4XGRA 1JYFA 1MX3A 3MPOA 2RGNC 4MYDA 3KWFA 1HTBA 3VSAA 2GD0A 1BJRE 3L8GA 1UBFA 3C6XA 1MEJA 4ZOBA 3WAJA 5AM5A 3QKSA 3LDGA 4JUAA 1IY2A 3E27A 3WBBA 5LYJF 1U9IC 5I4KA 3N76A 2GLUA 2ZUFA 1Q92A 1O58A 4QDKA 4RE6A 4NABA 5EP1A 3HXQA 3TUZC 3CVJA 5LP6A 4XGNA 2ZDQA 4WAUA 2O3RA 1VYVA 3AI2A 1OXVA 4L4ZA 4TTJA 4I1YA 5CLHA 4Y6QA 1W4ZA 5JWRA 4WK4B 1P5FA 3LQQA 2ONJA 2RKWA 1NQXA 3PUYA 1J1UA 3B6KA 2H4FA 3FFBA 3U9TA 1D2NA 5TARA 3V7UA 4YRNA 1J5PA 4HDKB 4DV0B 4XB2A 3CUUA 3EYAA 1VG0B 4E33A 3B89A 3QWHA 4L3OA 5EKSA 2Z2IA 1LNSA 4WGFA 3G8CA 3CLVA 4L4YA 1XXLA 1IJFA 1WIWA 4WCFB 2QJOA 2LIPA 3ZHCA 1U5AA 4G0VA 5D3QA 4YYZA 3AF5A 1Y9AA 4E4RA 3KZOA 1PQWA 3Q5GA 4FE4A 4QOIA 1TC2A 1ZNQO 4QU9A 4TWIA 1R4MA 2BBWA 1VMKA 1H8HD 5K1ZA 1XYVA 3ZNPA 1O5IA 2FN8A 2JZCA 4W8OA 4RTMA 4ZAVA 3BIFA 3HEBA 3R0VA 4BFUA 4FWBA 4MKIA 4C07A 2GBCA 3PFKA 4YRLA 1A9ZA 3RFCA 2YC2C 1XTUA 4XSHA 5FI0B 4B74A 1ONNA 1YCFA 3IT1A 3O8LA 3ZHYA 1GT91 1WCIB 5CFQA 2DMRA 1DCFA 2C59A 2VI5A 4JJGA 4QT4A 2BSXA 3QVOA 1IC6A 4EHFA 2P9TA 4LKOA 4F06A 3L3BA 1B6SA 4OHFA 3N2KA 2XWJI 2C84A 3RUAA 3JZAA 2YUTA 4CGYA 1KR5A 4RTKA 5KJ1A 3JR7A 2JGRA 3PC8C 1BCSA 4F3KA 2CB9A 3HB4X 5C34B 3I1IA 1I33A 4PEVA 3FR7A 3VHQA 4WZBB 2CSUA 4DMGA 4G0WA 4GRAA 2W2QA 1D03A 2EFEB 3G0BA 3KQTA 2Q2NA 1ZVMA 2CSXA 1VBFA 1HDXA 1Q5PA 2PT9A 2C5AA 2UKDA 1XJ0A 3GBPA 3T4XA 4IR7A 4EJ0A 1DIRA 1XJQA 3FUCA 4OATA 3I61A 3PLNA 4TYNA 3ZJVA 1N3LA 4NU0A 1PJ8A 4IIFA 4P4LA 2WC1A 3GF4A 3V2GA 4RMJA 1TJ5A 1QZXA 3DFFA 1II8B 2ARKA 5BSMA 2WSYB 1AMUA 2XKKA 2HLDD 2OZVA 3H5AA 4WNYA 2J7PA 3GAAA 1Y7HA 3N5KA 2C9ZA 1AHNA 4YA6A 2UZIR 1JBQA 2JI4A 2W2OA 2FW0A 2OCBA 3O4GA 3GDOA 3TQIA 4ACAA 4A15A 2WVGA 3DW3X 1UJNA 4ZANA 4ZHQF 3OQPA 1QBGA 1NV8A 2BTQA 3E23A 4HB2A 3MWLA 4Q02A 3CLTD 3K9BA 4LYAA 1ADBA 4G0PA 1Z2PX 3UHFA 1X70A 4AZ3A 3EVGA 2I4MA 4RVDA 3EPJA 1CVLA 1MRNA 4F93B 4GI3A 1DAFA 5CDHA 5HK8A 3JQQA 1USWA 1F8YA 1ZM3A 1CUHA 2CB0A 2Q8QA 3BORA 4FZVA 4MKRA 4S0ZA 5H3CA 3RG8A 2H2AA 3RRMA 2AN9A 4ZVOA 5CH5A 5K2MA 1UC9A 2Y1KA 3BXEA 5H70A 3ADKA 1UZLA 2CNKA 2J6IA 1IHUA 1IVYA 4RCZA 1YJAA 2ZBQA 5JW6A 5KC9A 1N1DA 4C7JA 3RTDA 2ZJ3A 3JRXA 4MPRA 4JLPA 1V5IA 1R4MB 2UVQA 3Q7RA 1NSYA 5C37A 2QRKA 5JBQA 3H8WA 3U3ZA 2X2OA 2B3DA 5LIPA 4QBFA 2GZDA 4QQRA 3UHJA 1ACJA 4LWOA 4G5OA 5ENZA 1LSUA 2J59A 4DLXA 4CL2A 1XZNA 4P83A 3OKCA 1J7KA