1THTA

Structure of a myristoyl-acp-specific thioesterase from vibrio harveyi
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
302
structure length
294
Chain Sequence
QCKTIAHVLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDHFAGLAEYLSTNGFHVFRYDSLHHVEFTMTTGKNSLCTVYHWLQTKGTQNIGLIAASLSARVAYEVISDLELSFLITAVGVVNLRDTLEKALGFDYLSLPIDELPNDLDFEGHKLGSEVFVRDCFEHHWDTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRTGHCKLYSLLGSSHDLGENLVVLRNFYQSVTKAAIAMDGGSLEIDVDFIEPDFEQLTIATVNERRLKAEIENRTPEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a myristoyl-ACP-specific thioesterase from Vibrio harveyi.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Thioesterase
molecule keywords THIOESTERASE
total genus 101
structure length 294
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02273 Acyl_transf_2 Acyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1thtA00
1E66A 4Q05A 2HU5A 2XUQA 5K3FB 2XUPA 4QWWA 3ESCA 2X5XA 5A71A 4I4CA 4U2FA 1CUHA 4TGLA 1EVEA 4WY8A 3PICA 1UOQA 4QDUA 3BXPA 5AJHA 2UZ0A 3HRHA 1JFRA 2VATA 5ALKA 4HXFB 2GBFA 2QMQA 3A2MA 3D59A 3I6MA 5AM1A 2XUHA 3MVEA 4UFOA 4EZIA 4HXGA 4QWMA 4E14A 1EDEA 1YSCA 4F60A 1QIDA 1LPOA 4MEAA 2HA7A 4QDTA 2D0DA 5ALHA 3AUKA 5KWJA 4BZZA 2G4LA 1UZAA 4AXBA 2XUFA 5JZSA 2QUAA 4Y2RA 3W2TA 3WK6A 3GBSA 3AIKA 4ARBA 3G0CA 1C7IA 1VZ2A 2HL6A 4HTAA 1GT6A 2YYSA 3B3QA 2RAUA 3G8YA 4EY6A 4UBLA 1KU0A 3D7RA 5AI9A 2WIKA 2I3ZA 3BJRA 1CPYA 2AJLI 3WWOA 1XKLA 1YB7A 2DHDA 5D3KA 3OOSA 3ZPXA 5AOBA 3R0VA 4GXNA 1SC9A 3ED1A 4X91A 2C5FA 1SCIA 1UK6A 2XUDA 4RPCA 4PSUA 2R8BA 2HA4A 4YK7A 5ALDA 3FVRA 2Y1KA 5FXMA 4BZWA 4TVKA 4BP8A 2D5LA 2QS9A 5AI6A 4S0XA 5ESRA 5HF5A 1CFJA 5BWBA 1MN6A 4HVTA 5AIBA 2XQJA 4WCVA 4X94A 1FSSA 2HA0A 2C4HA 3PE6A 4IQ4A 1RYYA 5CTAA 3WMRA 2DQZA 2PKYX 3KDAA 1VXRA 4NZZA 4ROTA 1XZMA 4H7JA 1T2NA 4I19A 1CQZA 5JIBA 2PU5A 2OGTA 4UBNA 1VA5A 1JU4A 4DTCA 1QTRA 5AM0A 5AI4A 4YASA 4UHDA 4D9JA 3WIOA 2AJBA 4H77A 3IA2A 1XZLA 3PI6A 5AK3A 4B0OA 2WLSA 5AKGA 1I6WA 3DEAA 2QTBA 2VJCA 2OXEA 5HF9A 1EB9A 4UHEA 1MX9A 4B83A 5ALNA 2OQIA 4CI9A 2V96A 3OG9A 4OUKX 4C89A 2HA3A 5LZ7A 2WTNA 4WDQA 4EY7A 5AM2A 1UOPA 4XIIA 3STTA 4FBLA 5FDFA 1J2EA 2WIGA 1UFOA 1HDEA 5AH0A 5DNUA 2VT7A 2QT9A 1AURA 3WZLA 2OPHA 4MQMA 4B9AA 1OCEA 3O4JA 1AX9A 1LNSA 1WHTA 2Y2VA 4OU4A 1XLUA 3T52A 4OYLA 5CT5A 1X2EA 5IVHA 2XMCA 2OCIA 5FP0A 2QJRA 1FJ2A 4N8SA 5I9IA 5CURA 3U0VA 1XZGA 3Q0TA 1A8QA 4GW3A 4CCYA 5EFZA 3TGLA 4DNFA 1NU8A 5JAUA 4K6KA 2ZYIA 1E3QA 4V2IA 4UBIA 2CJPA 3SX4A 1L7RA 3F8SA 3M81A 5AKIA 5HCUA 5YASA 1ACLA 1QFSA 3VVLA 1XZDA 2HA6A 3L1IA 4FTWA 4Q34A 4ZWNA 1THTA 3UUFA 3CN7A 5A7HA 5CT6A 4FLMA 1MTZA 5AKEA 4WJLA 2AJDA 5ALPA 1KU6A 5IVIA 1Z68A 4X3CA 2C58A 1C7JA 3C6ZA 5BWCA 4G4JA 2ZSHA 4FLFA 4Q3LA 1RWQA 2PSDA 2QJWA 5ALMA 4HS9A 1W76A 5EHXA 3BWXA 1BROA 5ALTA 3ANTA 5DNVA 2J4CA 2OLEA 1W75A 1YCDA 4KE8A 4Y2SA 5ALZA 3BIWA 4JYMA 2WG1A 2DSNA 4FBMA 2XMQA 5FUMA 3STUA 1CUEA 3EQ7A 4DM7A 3F98A 3NGMA 4C4ZA 1N8SA 4GHWA 1H22A 1XZCA 2HFKA 5A62A 2DHCA 2XUJA 2XMGA 1FFBA 2WQZA 1XZJA 1QIJA 1GXSA 3G9ZA 1XZAA 3C6YA 4UBJA 5FRDA 3IURA 2OG1A 4X71A 4TPKA 3B12A 4OB8A 1FFEA 3R41A 5ALGA 5HKAA 1X70A 2CZQA 2FX5A 1IUOA 1HBJA 2WJ6A 4CG3A 2WILA 3C8DA 1JMYA 4PF1A 1CUYA 3EQ9A 5A6VA 1XRNA 1J06A 3WL5A 4EB0A 4ZGBA 2XT0A 5HQ3B 3D5EA 1P0IA 5ALVA 4C4XA 4U2BA 4X90A 2BUBA 1EI9A 1CV2A 1ACJA 1BS9A 4BAUA 4QNNA 2WHQA 1ZD2P 3EBLA 4QDOA 4LIPD 4DSZA 1UK7A 4K5QA 1H2YA 3I2GA 5T4FA 1EK1A 5T4EA 1ODSA 3HJUA 3S2ZA 5A7GA 4F0JA 2DQYA 3WL6A 3H19A 2XB6A 3IIIA 5LIPA 4L3WA 2PPLA 3V1LA 5LP1A 2NW6A 3H2KA 2OGSA 3V9AA 3MGAA 3KOOA 1EVQA 3L1JA 1H2WA 4CIAA 5LZ8A 4C6HA 1W6RA 1CUJA 1UK8A 4ZREA 1PFQA 4X93A 2EDAA 1ORVA 5AM3A 1UWCA 4ZV9A 2J4FA 4DIUA 2WJ4A 3NUZA 2VA9A 2WG2A 3BF8A 3BF7A 4BBZA 4FNMA 1CUIA 1UK9A 3K9BA 1KEZA 1E8MA 2XUKA 4IHAA 3C5WP 4AQDA 4B85A 4G1FA 4OB7A 2VEOA 4ZV7A 1F0NA 5HFNA 1E89A 4EY4A 5AK5A 4GI1A 5AP9A 5I7UA 3LIIA 2VSQA 2QR5A 2WFLB 5CXXA 1FFDA 3GUUA 4UHFA 1A8UA 3QMMA 1J07A 2WUFA 4KRXA 4QDXA 1MO2A 1TIBA 3IUMA 2WFMA 2HHAA 1AKNA 3S8YA 1YA8A 2XUIA 2OCKA 5DJ5A 1CEXA 4GDMA 4BB0A 1LPSA 1UOOA 2B61A 2JGEA 6YASA 3W9UA 3YASA 4WFJA 4OSEA 3HC7A 3WYDA 3JW8A 3WKAA 2DHEA 1XFDA 2XQGA 3G0BA 3P2MA 3ESBA 3O9VA 3HYSA 4U2CA 3A2LA 4FFVA 3CCCA 4QLOA 1MX1A 2XUAA 4DGQA 5AIAA 4LYEA 5EHQA 5LLSA 1ZJ5A 2ES4A 3FNBA 2QRUA 2BKLA 4EY8A 3OM8A 4H18A 3I2IA 4LXGA 1R3DA 2G63A 4WDRA 5FLKA 3L1HA 1CUXA 2XMRA 1G66A 5JADA 4UHHA 3BDVA 4DMKA 4JNCA 4F21A 5IVDA 4JEIA 4O08A 5IH7A 5T4BA 3PUIA 4C4YA 4KE7A 3G0IA 1BU8A 1VE6A 3FSGD 1HKHA 1LZLA 1THGA 3CCBA 4INZA 1ZICA 4J0IA 3QYJA 4Q82A 2YXPX 4LHEA 2HIHA 2ZJ7A 1DX6A 4AB1A 4DYHA 5DWDA 4G8CA 4RE5A 3WQHA 4HRXA 3KWFA 1WOMA 3IUQA 3DL7A 4OYYA 4W1QA 2G5TA 2RGUA 3M82A 1CLEA 2CUTA 1VOTA 4BC0A 1CUDA 5KWIA 1VE7A 1U2EA 5ALIA 2XMBA 2YH2A 2GYUA 3ESDA 4CG1A 1XQYA 4G4IA 1C4XA 1H2XA 2ZYHA 3LP5A 4GEGA 3FOBA 3SK0A 1GQSA 4HAIA 3V1NA 1YS1X 1VLQA 3R3UA 4N8EA 4Z49A 1A88A 1AMNA 2WU4A 3AJAA 4MWSA 1EX9A 3C8HA 3A2NA 1XKTA 3I2HA 5AOCA 1R1DA 4LXIA 2FJ0A 4KRYA 1ETHA 4YPVA 2OAGA 2WHPB 4UHBA 4P92A 4FLEA 3G0DA 1BCRA 2EEPA 3FWHA 2ACKA 1MNAA 4IH9A 1EDBA 1ZIXA 4DNPA 3ZLUA 2QUBA 5AKKA 3D4LA 5C81A 2ONCA 1GPLA 2PVSA 1Y7IA 3I6YA 3G9XA 2ZJFA 2W22A 4H7KA 2B4KA 3WKBA 4QLAA 2QZPA 4MWTA 3SC2A 1XZIA 3AIOA 1VA4A 1VXOA 2PBLA 2WU3A 3E3AA 4A23A 1XRMA 2HA5A 5LKAA 5CT8A 5ALFA 3WL7A 3ZLTA 3IDAA 1EINA 5LZ4A 3UUEA 1YB6A 3H04A 2O2HA 2X8BA 2GBIA 3D2AA 1MT3A 2WSLA 3H2JA 3V1KA 4H7EA 3WWDA 4AMYA 4W1PA 4Q3OA 4W63A 4X97A 2JGLA 3RK4A 1QIKA 3D0KA 4A16A 2HADA 3QM1A 3DYIA 1CUWA 2Z8XA 1DQYA 2ZVDA 3W04A 5T4HA 3EQ8A 2ZJ6A 2ECFA 1ZD3A 2WTMA 3K6KA 4GBGA 2HU8A 4WY5A 4XX1A 3WK7A 1YAJA 5AM4A 2IX9A 2WM2A 4DNOA 2J3DA 3FLEA 1IUNA 1DX4A 3EIOA 5CH5A 2WIDA 4W1RA 1TCAA 5IVKA 3WJ1A 4I3FA 4JYPA 3KWJA 3IB3A 5DYTA 1DT3A 3R3ZA 4G5XA 5AKJA 2RI6A 2H1IA 4KACA 3HXKA 1W1IA 2ROQA 1YA4A 4PW0A 4FWBA 1AUOA 4GWLA 4PSDA 1HLGA 4BVJA 3M83A 1IMJA 1QOZA 1R9NA 2CKMA 4BYMA 1WB4A 3MUNA 2PSFA 3KSRA 5C8XA 1XROA 1ODTC 3O9MA 4FMPA 1GKKA 4MQLA 1AGYA 1A7UA 2WHRA 1EXWA 5CXUA 1QO9A 3VISA 1QO7A 2B9VA 4FFWA 3DLTA 3F96A 5H3HA 1QZ3A 5FKJA 1FFAA 1CR6A 4H7IA 4X6XA 3TRDA 1QJ4A 4BRSA 1MAAA 4B80A 1Q83A 2CBGA 5EIAA 1CUGA 2PU7A 5AK6A 3H2HA 1CUVA 5JD6A 1R50A 2Z8ZA 1A8SA 5AKXA 4HZGA 4LXHA 3F67A 2CMFA 5JD5A 1UT6A 3WA6A 4UPDA 2BAGA 3KD2A 4P9NA 5ALRA 4KJXA 4H0CA 3G9UA 1BEEA 3DJYA 4DMFA 1EDDA 3E4DA 3JYHA 2DCMA 3N2ZB 5AK4A 2PSEA 4MYSA 4G4GA 2HM7A 5HK9A 3FBWA 4XVCA 4PNZA 3STYA 5AI5A 1WM1A 1QTIA 5HZGA 4G9GA 3Q8WA 2VAVA 3GELA 1JMKC 2WUDA 4Y2UA 1ORWA 1MNQA 2Z5GA 4E11A 4EHBA 1LZKA 5AKLA 1TQHA 3MUOA 4PQEA 1R88A 3WKCA 3WL8A 2IITA 3QZUA 4BP9A 2JGJA 1ZGBA 4EBBA 5K3AA 2GYWA 3DD5A 1SCKA 5D7BA 2WUEA 5E2IA 3HZOA 5JZ9A 3T4UA 1XZFA 2LIPA 4BCBA 1VKHA 2VJDA 5JD4A 1E5TA 1BRTA 4FHZA 4ETWA 3H2GA 2VT6A 3OC0A 5A7FA 4L0CA 3WI7A 4N5IX 1QIEA 2FJPA 4PV7A 1VZ3A 1QIHA 5ALLA 5E4JA 4OD0A 4B81A 4B9EA 1YR2A 3H1BA 4KAFA 3H2IA 3ESAA 1F8UA 4C87A 4KAAA 3STXA 1R4ZA 1DINA 1XRLA 2XQIA 1L7AA 3WWPA 4FDMA 1QGED 1WCYA 2H7YA 1B41A 1CQWA 1ZJ4A 4HXEB 3AIMA 2QKYA 3ANSA 3C45A 1N1MA 3R3XA 4U2GA 4K6GA 5ALQA 4BRZA 2PUJA 3IUNA 5JAPA 3WWCA 5ALSA 4AN1A 1O6FA 3PUHA 4E46A 5LYYA 2QOEA 2RONA 3D2BA 7YASA 1IUPA 2E3JA 2RHWA 3BDIA 1Q0RA 1VJ5A 1SCQA 1XRPA 2BUCA 4UHCA 3DDUA 3C6XA 1IVYA 3WKEA 3WIBA 1M33A 2HA2A 3WKDA 2W6CX 3ICWA 2VF2A 2JGMA 2HFJA 5SYMA 2QXTA 4FOLA 4BVLA 4BC1A 4ITVA 5IKXA 4Y9SA 4EA6A 4OU5A 2VJAA 5A2GA 4Y2VA 4X7BA 3QITA 5K5EA 1B6GA 1BE0A 1MPXA 4DNQA 1T4MA 4WFIA 2XE4A 1TK3A 3G02A 1GQRA 3FCXA 2JGFA 5JARA 4CCYB 1QONA 4W9RA 1ZOIA 2XLCA 4GECA 2GBCA 2BUAA 1IZ7A 3OURA 2H7CA 2OAEA 4DLNA 5K3DA 4AMZA 4J3JA 3NWOA 4FNGA 2ZYRA 2R11A 2JGIA 2BJHA 2QM0A 4DMCA 3NOXA 1U4NA 3VJMA 2WIJA 4P93A 4Y2XA 3AILA 2ZSIA 1L7QA 5AKZA 1DQZA 4QEKA 4Q1VA 3EF3A 4UUQA 1MAHA 3IUJA 1UKCA 3O4HA 1JJIA 5C8ZA 1XLWA 4X85A 3FVTA 4MJ3A 4KAJA 3B5EA 3DYVA 1ZIYA 3D3NA 2VTVA 1ZI8A 3DKRA 1RP1A 3QPCA 4G8DA 3FAKA 3W06A 3STWA 3WK5A 1XZHA 3RLIA 1GPKA 2XMSA 1JI3A 3R3VA 1DT5A 2P8SA 1JJBA 3JWEA 5AM5A 3FYTA 1XQWA 5CH8A 1LPAB 2ORYA 1AC5A 5HK8A 4U2DA 3PF8A 2AXEA 5AHXA 2CB9A 1GPNA 4BAZA 3LLCA 4UBKA 4Y2YA 2XLBA 3C70A 2HU7A 5JAHA 3UMJA 2Y6UA 5FOQA 1DWOA 1QIFA 1CUSA 3STVA 4RNCA 5BV7A 4QE3A 1U8EA 4OCZA 1D07A 1QIIA 3ICVA 5EHZA 2I3DA 4KEAA 3HSSA 1MJ5A 3LS2A 1JKMA 3VJLA 2XMDA 3FYUA 3HACA 2V97A 4AN0A 1ZI6A 5E4YA 1CIJA 3BIXA 3IBTA 2WKWA 4J0CA 2HDWA 3IULA 1P0QA 4IH4A 3A70A 4C01A 3TJMA 3WLAA 4BCDA 4ZI5A 2I78A 5JANA 2Z3WA 3HI4A 1XLVA 4AX4A 5CRIA 1SFRA 5HQ3A 1LPBB 4W1SA 3DCNA 1P0MA 4QZVA 4BTVA 1LPMA 1N5RA 4BTLA 3WK4A 3O95A 2HRRA 1XQXA 1EK2A 4QDZA 1F6WA 5SYNA 3F97A 1DTEA 1TCBA 5BOVA 3G0GA 3QMWA 1JU3A 4J0HA 1GKLA 4P08A 3PF9A 1CRLA 4BVKA 4BAGA 1Y37A 2O2GA 1MU0A 2WFZA 2Y2UA 1CVLA 3FLAA 3H0CA 3GFFA 1ISPA 1GZ7A 1XZBA 3OPMA 5DYYA 5AKHA 4K6HA 3R3WA 3VDXA 1XQVA 4K2AA 1CUUA 4A5SA 4E15A 2DFPA 4NMWA 1TAHA 1W52X 3H18A 2V9ZA 2XUGA 2PSJA 2XQKA 4HRYA 2AJCA 4ZRDA 2C7BA 3VJKA 1PV1A 2BCEA 2RIPA 3AZQA 5JAOA 4PSCA 3N0TA 3DKKA 5ALWA 4H35A 5CBKA 4X6YA 1HQDA 1DWQA 2B20A 1N5MA 4KYVA 3C43A 1UKAA 4U2EA 4OB6A 1BEZA 2HRQA 3K2IA 2Q0XA 4H7FA 4NS4A 4BCCA 3HABA 4J7AA 5AO9A 1W4LA 4NVRA 5JYCA 2RHTA 2JF0A 2XQFA 2JEYA 3DS8A 1CUBA 1TCCA 1LBTA 5ALYA 1UXOA 1HL7A 1Q0ZA 5CH3A 2C5GA 4UFPA 3AINA 5DLPA 1NX9A 3KXPA 3SWWA 3FLBA 4Y2TA 2C0PA 1BN7A 3HEAA 4UFNA 1WPXA 1ZD5A 3LCRA 4N5HX 4RGYA 2AJ8A 1E8NA 1AZWA 4DSAA 3FSGA 3PFBA 4XJVA 3OTQA 5KBYA 3LIPA 5ALXA 2DR0A 4H7HA 1LPPA 3O0DA 3R40A 4B0PA 4AO8A 4G9EA 1H2ZA 5JZBA 1ZGCA 1CUAA 5EHNA 5CW2A 2WFLA 2OQVA 1LGYA 4OPMA 3PDCA 1FFCA 4C88A 3I2JA 5DYWA 3ZLVA 4XWGA 4BE9A 5K3BA 3D2CA 2WIFA 3IVMA 5LZ2A 3E1GA 2OGZA 2EDCA 4RE6A 2GZRA 1K8QA 1OXMA 4CIBA 2YASA 3ZWQA 4PO3X 4X95A 2WUGA 5FPQA 5DNWA 4BATA 3X3HA 1K4YA 1DU4A 5F4ZA 4X6UA 2H7XA 5CMLA 5EIHA 3WZMA 4AO6A 2Y6VA 3I6ZA 5EI5A 3E0XA 2QXUA 4X00A 2X76A 1ZI9A 3W9BA 4J03A 4MXDA 3AZOA 4B84A 2K2QB 3VVMA 3BJMA 4LKOA 3CN9A 5K3FA 2WJ3A 4AZ3A 1HPLA 4CCWA 2ACEA 2GBGA 3WK8A 3A6ZA 2PM8A 5HF6A 3FCYA 4MYDA 2JIDA 4MEBA 1QE3A 1JT2A 4Y2QA 1Y7HA 4DMHA 2WG0A 2O2IA 5D3ZA 1YS2X 2PX6A 3DOIA 4IO0A 1WHSA 4L9AA 4Y2PA 3QVMA 1BCSA 1LPNA 2IIVA 4CG2A 2OCGA 1CUCA 3C87A 3ZI7A 1QIMA 2CEKA 1R9MA 5E4TA 5D6OA 5LKRA 3WK9A 1U65A 1YASA 1CUZA 2VAXA 3RM3A 4Y7DA 2OCLA 1E8DA 1K6EA 5JASA 5C7YA 5AOAA 4M0EA 1S8OA 1WB6A 3RARA 3DQZA 5AICA 2XUOA 3AZPA 3GROA 5K3CA 1H23A 2BGNA 3VXKA 1AQLA 2BGRA 3I1YA 1MX5A 1TKRA 4JH0A 4B6GA 3I28A 1K63A 5FPPA 3DOHA 4N8DA 5FV4A 5AKYA 4J0GA 4YX9A 1XZEA 1X2BA 2O7RA 3I2FA 1GGVA 1J1IA 4M0FA 5ALUA 1NU6A 4KE9A 1ODCA 3V48A 2Z3ZA 3FYUC 1LBSA 2PUHA 1G42A 4B7ZA 1Q84A 3G9TA 3M3DA 3H1AA 1TRHA 4G8BA 4B82A 3I2KA 3I1IA 1IZ8A 5ALOA 1WB5A 2C0QA 3O4IA 4KR0A 5DTJA 3O4GA 2PSHA 4BDTA 4QA9A 3QMVA 5J3JA 3GA7A 1G4HA 3DNMA 2VJBA 3BE8A 4F5ZA 3WWEA 3WA7A 4X92A 1P0PA 3QPAA 4UBMA 3TEJA 3C5VA 4BDSA 4FKBA 1PJAA 5AI0A 5CT9A 5CT4A 1DWPA 4J0JA 4ZXFA 1UKBA 4JUIA 1JJFA 4CFSA 4Q3KA 2JGKA 2G5PA 4AZ0A 4M0MA 1QLWA 2JBWA 3QPDA 4EUSA 4IH1A 3AFIA 2J3QA 2BFNA 2VQ6A 1XRQA 2FUKA 2H9YA 5KREA 4EY5A 5K3EA 5JATA 1USWA 3ILSA 1YAHA 3HLKA 1O6GA 1WPRA 5HKBA 1XRRA 2GYVA 2O7VA 2XI4A 1LLFA 1K5PA 5C8VA 3W05A 4GLBA 3R3YA 3FYUB 1QFMA 3F9CA 4J0KA 5I8PA 1EB8A 1EHYA 1ZD4A 2XMZA 3GZJA 4H7DA 2WHPA 5LZ5A 3DL4A 5HF8A 1OILA 4L72A 5EGNA 2GZSA 5DTIA 1XZKA 5ALEA 3U1TA 3RKSA 5HFAA 1F0PA 2V98A 1EH5A 2ZYSA 3QH4A 4KE6A 1CUFA 1G5FA 3QBJA 3PFCA 3V1MA 1QIGA 3CXUA 5ISMA 4UBOA 5JALA 2QVBA 2PL5A 3WYNA 4Y2JA 5AI8A 4BE4A 5LZ9A 3C6BA 3WJ2A 5EIEA 4J0DA 2XDWA 3BL8A 3H17A 4WFKA 2I03A 4AO7A 1SOMA 2JEZA 4LYDA 3G7NA 4ARAA 1BN6A 5ALJA 3VKFA 3ZV7A 1EA5A
chains in the Genus database with same CATH superfamily
3OU6A 1Q1NA 1E66A 2HXGA 4BO9A 5GIOE 2B4RO 1FRNA 1U3GA 2I4LA 4KJZA 2XUQA 5JJ5A 1DJQA 2NU6B 2Y0CA 4X5OA 2DSTA 3KYCB 3E3NA 4QWWA 1WTAA 1ZQ1A 4HDKB 1PSZA 2HNBA 2BFEB 4I4CA 4GYJA 1L6IA 3I3SR 1UMDB 4KLZA 5F2NA 2CHGA 3E9NA 4PM4A 1NNUA 4BGDA 2ZRKA 5DHAA 2EKQA 1EVEA 3RHFA 1UJ6A 2FWJA 3FGNA 4M99A 5AJHA 4RTRA 4GYWA 5B6IA 1EFVA 1N3IA 2HCRA 3DC2A 3DSRA 1H42A 3OQPA 3PE3A 2JL1A 2XQVA 2X0RA 5FFFA 1BHQ1 1JFRA 1OWPA 1SHTX 4LJ7A 2I4OA 2YY7A 5ALKA 1X19A 1P1HA 4RGVA 4YMGA 1E99A 2DKFA 2YICA 4WINA 4R7TA 5KWSA 1ZK4A 1QYIA 1TTHA 3MAAC 4QDKA 2G6BA 3KEGA 2ARKA 4ZDWA 3MVEA 4RTKA 2IKQA 5ESWA 1KI4A 2IY8A 1Q22A 1G55A 1O7JA 1O94A 1YSCA 2G80A 4TV9F 2WVJA 2IGTA 4CQMA 4F60A 5JUWA 1U0SY 2WU1A 4XM0A 1QIDA 4M1MA 3X1JA 5E0OA 2A9OA 4NBUA 1E79A 1LTQA 2YIMA 3CF4A 3BMNB 3LX8A 5L7YA 3SG0A 1VLLA 2FEKA 4QDTA 3HCBA 1HDZA 2ZRDA 1P80A 3WBFA 3CVYA 4NEQA 3T6KA 4BL5A 5K45A 4BXOB 3GFPA 4WLOA 5SZJA 5CVTA 2IV2X 2Q3JA 5T8KC 2BIFA 2G4LA 1OLXB 3L40A 2O8BA 2XUFA 3A4IA 1EUCA 4LYYA 5JZSA 1PHPA 3V2UA 3SOPA 2VOEA 3TLBA 1F20A 3VQTA 2ZE7A 3RR2A 3W2TA 5H3CA 5KQGA 1WCIB 3HUEA 2JCSA 2R6ZA 3WK6A 4JB2A 1AKVA 3QUAA 2B1RA 1TJNA 2DF8A 3CV3A 3KRTA 4XYEA 1FW6A 1J8VA 4YRQA 4G86A 1VRCA 3G0CA 5DN9A 2ZVQX 5J1TB 1RRMA 3KQLA 4NZPA 1RVDA 4QTTB 4ZCLA 4XIFA 4F04A 3I73A 4PC7A 4MKGA 1PR3A 1R6XA 2YYSA 5GINE 2HQBA 3KFLA 4RESA 2QTGA 2YQ5A 4MI1A 5DI3A 2RAUA 4YDRA 1KU0A 1IBKB 2XHEA 1CPYA 4PAGA 1G98A 4R1UA 1Q95A 5EJFA 4IGKA 3WWOA 5A02A 5JVDF 3SNHA 2HK6A 5COBA 2ORWA 3SI7A 5D3KA 2BVNA 4LBYA 5EY5B 3ZDCA 1VSBA 1Z4JA 4XE5A 4FFSA 1B3RA 4HNAA 3TUIC 2E4ZA 3ED1A 5C1PA 4KXQA 1MEJA 1TJ5A 4I9FA 2WJPA 2OBNA 4ZOLA 1SCIA 1TM3E 3ZDZB 4UJ5A 1ZJJA 4GOXA 5IBCA 1Y1RA 1YO6A 3A6EA 1ZH6A 1ZMTA 3UJ7A 2PCJA 1QWSA 2QUIA 4YK7A 4R05A 4ZVTA 2PO5A 3FVRA 3DZFA 3K1TA 5LXTF 3UC5A 5GZ3A 3MFYA 4NZ9A 1SBTA 4I8DA 4RV9A 1T6BY 2J7PD 1C4KA 4MKRA 5E6UB 2XKKA 1KY4A 3NOQA 4J6EA 2D5LA 4DARA 4E2ZA 3IL2A 2QS9A 1RQXA 3MIIA 5AI6A 1ADJA 4RDXA 5ESRA 5TPWB 1EYZA 4YP1A 5FBZA 4UXJA 4B3IA 1K86A 1U2TA 3DDWA 4TYPA 5BWBA 1NUTA 1TYEB 2JCBA 5C3MA 3DEYX 2A5FA 1M2GA 4HVTA 3ZYZA 2MMCA 3M3PA 4RSGA 3A1NA 4WCVA 4X94A 4V02A 2IPNA 4GEKA 1QFXA 1N8KA 1AY0A 1FSSA 4TKVB 4ZQBA 5HDBB 4EMUA 1OI3A 4HNSA 3RFVA 3HO1A 1AHPA 2ZUBA 3FKSA 1NUAA 4IQ4A 3MTEA 1O0CA 1I7PA 2POCA 4UVIA 3WMRA 2DQZA 2NZJA 4KCGA 1U04A 3SXUB 4IOMA 1TDJA 5BRJA 2FWPA 5CM9C 3EGXA 3KYJB 5JWHA 3MQ2A 1O3YA 4I19A 2DQ4A 4JLJA 1QS0A 2PU5A 1YMVA 5E9QA 4D57A 4TT8A 2V7QD 1I10A 1P91A 1S2OA 3JRXA 4F8YA 4JMPA 2V7PA 2ZWMA 5KTPA 2Q3CA 2ZI5A 3GLGA 5I45A 2ZT7A 1XXHE 2GJAA 4G1CA 1WDMA 3VDQA 4II3A 1JU4A 4LRTB 4DPKA 2HBYA 3BC1A 4E4YA 2QI9C 5IYZA 1M1UA 4D41A 1I7DA 3H5WA 5K51A 5AI4A 4L78A 1NQXA 4X8MA 5FJIA 4JJZA 3EPRA 4UHDA 2O05A 4NFSA 4LOIA 3QG5A 3ICPA 3B9RA 4JVOA 4C4TA 2GD0A 1CJVC 1DOAA 2VKQA 1QG6A 1T5BA 2XNSA 3IA2A 3LK6A 4KLNA 4L22A 5K8VA 3ZV5A 1JHAA 4G84A 1Y9EA 1H1TA 2HMWA 4YTEA 4X6LA 4QQFA 3VR1A 4AJ4A 4B0OA 4DHEA 1XNQB 2I6FA 4LQDA 4PYJA 2HW8A 4G5FA 4H3VA 3VR5A 1QAQA 1CT9A 3DUWA 4HVLA 2XB9A 1I6WA 5AKGA 3U4AA 2QG4A 1WZEA 1JZTA 2XZDA 1T15A 3OWHA 4OHFA 2EVWX 4M6WA 3PNPA 5JSKA 3ZX4A 4I5FA 2F8SA 3TLEA 3V7NA 2QMZA 2QPAA 1IY8A 3VTFA 2QVYX 1KSFX 4PSVA 5BW6B 3L93A 2PKQO 1J8MF 1PJSA 1U3VA 4HDOB 4R0NA 4I4TF 4JU8A 4AS3A 3P2YA 4EYEA 2OORC 5ALNA 5FQNA 2E4AA 2VNJA 3GRAA 4DRXB 4UTRA 4GZLA 1G38A 2OQIA 3GEEA 3SQDA 1EM6A 3K9GA 2Q6OA 1PO7A 5KVQA 4C89A 2I8AA 4PIPA 3O3CA 4L8WB 3IELA 5FLEX 3V8RA 4BNJA 1ICEA 3THXB 2BI7A 1D1QA 1NJ6A 2CW5A 3ILVA 4FW8A 4LE0A 4WDQA 3R1IA 3QUCA 1PWHA 4UE2A 3STTA 4FBLA 1QV7A 2QZJA 2F62A 2XWSA 1N4DA 2HMVA 2QN3A 2FFHA 1J2EA 1OU0A 2NAPA 4MCJA 4QD3A 1PZGA 3CO5A 3KKPA 4OHXA 4PRZA 1HDEA 3PFWO 3PSAA 2OZLA 3CE9A 1DNPA 3QU4A 5AH0A 5DNUA 5GTDA 5LDDC 2QT9A 1AURA 2PQ6A 3REGA 3WZLA 2HMUA 2MYTA 4KVAA 2OPHA 1XA3A 4JLVA 4BO6A 4MQMA 3FRHA 3BMXA 2PGAA 1YE3A 4IOJA 1SQFA 4Q21A 1JAHA 2Q29A 4EQ6B 1IZ9A 4ESVA 2WP0A 1VHLA 1AUQA 1AX9A 1AQYA 2L18A 1LNSA 2OKGA 4IS3A 4GKKB 1X7GA 3KYBA 2HMTA 4EYSA 4ZCIA 3ADDA 3M6LA 3OY7A 4O1MA 4WKBA 3VPAA 1XLUA 2AC2A 4I7EA 1ZMRA 3O4VA 3Q72A 3TTVA 3FPJA 3Q6MA 2AG8A 1IVNA 2B99A 2O3RA 3L1UA 1TUEA 3NRJA 4CMKA 1CE8B 1TF2A 5FWYA 3TZLA 1TIPA 3FB4A 4MKHA 3Q9LA 4E07A 2BCGY 2WUVA 2HBRA 5FTNA 4CTMA 1GG2A 1Z13A 4MGEA 1G8AA 4BWVA 4H2DA 1GTVA 4GSYA 3FFAA 3FNIA 2HXYA 2C20A 2EKBA 2OCIA 2ZETA 3GH3A 2WA2A 3N3BC 1NBEA 4ZICA 1D2AA 2HIMA 5I9IA 1DKLA 4YO8A 4A0SA 1XZGA 3OFND 5I6DA 3Q0TA 2BGMA 5KNDA 3KE8A 1PQ4A 4ALKA 3D6NB 1J2YA 5DSXA 1H0HA 1PSDA 1KERA 1NU8A 3C3PA 2DGDA 3HP4A 4K6KA 5JAUA 1PJ4A 2PYDA 3ACBA 6LDHA 2ZP1A 1B8NA 2CY0A 1K27A 4MVJM 4QYMA 1ZRMA 4AQYB 3CRW1 2HJGA 1L7RA 2JVJA 3OF2A 4FFBB 2WP8J 3SX4A 621PA 1PLJA 3S2YA 1JP7A 3RVPA 3N74A 3JVDA 4RJIA 5JS8A 2E87A 4HWTA 1ACLA 1M76A 4HEJA 4N3CA 4JBXA 4OBBA 3TBHA 5T3UA 1L5NA 4BMSA 2JKYA 1PNRA 3HVKA 1KDRA 1U31A 3IHTA 1C3JA 1XU4A 3QQPA 3DE4X 4JFAA 1PJQA 5DHTA 2ZATA 1S7GA 2G82A 2WC1A 1T0UA 2AG1A 1J49A 1T3ZA 5FORA 4EG5A 1NV8A 2ZCUA 5CT6A 3MC1A 4ISCA 3O73A 3X1YA 1X39A 1L8OA 1K3TA 1T5DX 1V5FA 4DILA 2JIMA 1H2RS 4WJLA 2H4FA 3H5IA 5IVIA 1QRDA 3ABRB 2B3DA 3UGTA 3IP3A 4QYXA 2V9PA 3VVCA 3P9RA 3ISTA 3G3EA 4GS5A 1ZIPA 3VR0A 1ZM7A 3AP1A 4OGLA 3URKA 3DFUA 3L0DA 1C7JA 2LW7A 1AUXA 4RENA 4IDEA 4X1KB 1AOXA 3NH9A 3QLVA 1ZP6A 3T9EA 1ULUA 1HWYA 2HPAA 4ZCSA 2X77A 2PSDA 4GKBA 3RI3A 2QR2A 2CDCA 1QU2A 3JV7A 1WXXA 4I1SA 1C29B 1TOAA 2FFBA 1OVGA 1P61B 2I3AA 2Z2XA 2EU8A 3MFQA 1RHJA 3L5KA 4HS9A 3VDNB 4QOJA 3BMQA 3QELA 4ONEA 5EHXA 3KEQA 3PXDA 2XVXA 2QTVB 3ISJA 4M8NE 1G3RA 2G72A 1JYFA 2GK3A 2Q6TA 4XI9A 2HNAA 5LIRA 4EB3A 5KTRA 1DQSA 3IAFA 5D84A 2OLEA 2J32A 3PHBE 5HTOA 2ZT6A 5TQ2A 4GI5A 3GWZA 4MS1A 1ML4A 1K8RA 3HCFA 1V9CA 2VQ3A 3IESA 3PV0A 1GUFA 2J9YB 2NO1A 1AK9A 4IICA 3J7AC 4LVOA 4TYMA 3GI1A 1QANA 1T0BA 3L6EA 4TUYA 5ALZA 2DP4E 1IY1A 2R2GA 1IJBA 2FSFA 2VP0A 4KQ1A 3BIWA 3IPYA 1XTIA 3P9SA 5EWLA 4JYMA 1W0KD 3F3KA 4RIEA 3D1JA 1RAAA 2DSNA 2NZWA 2ZJZA 2BN4A 3H4MA 4ZCMA 4ZT4A 1E7WA 2ONZA 2XMQA 3LK7A 3STUA 3H2YA 1DZIA 1KKLA 2WJGA 3MRXA 5B58T 3VAYA 1G6HA 2OBLA 3SJCA 3U9LA 2IHUA 2CXQA 2QG9A 1WLYA 5KTYA 4BFSA 3EG9B 1UBLS 1Y1SA 2I65A 2REQB 2W8BB 3F98A 4D4MA 3NGMA 1IN5A 2IYAA 3GD5A 4MV1A 4QFDA 5F73A 1WRBA 1V35A 5A62A 4DNXA 4X66B 2XMGA 3IEUA 3T3GA 5J58A 2YVUA 4UZFA 2AI3A 5KWEA 1XZJA 1KEVA 3OF3A 1QIJA 5SY9A 4PG8A 3UPUA 3ETHA 2FPPB 4UBJA 2WE7A 2ZROA 1HLFA 3P0EA 3U60B 1Z2OX 5BT8A 1R10A 1V96A 2MTBA 3H5VA 3OQBA 5FRDA 2P9TA 1BW9A 1KO5A 2WSMA 4ZFNA 1ITZA 3K9NA 2VR1A 3UVEA 2R44A 3CSDA 4OB8A 4HFJA 4ZANA 1E60A 3NS7A 1Y63A 2KWIA 3F7OA 1QUEA 2CZQA 2XNKA 3DV0A 4FJ0A 2G1AA 3MT9A 4UAUA 4YMIA 4JI1B 3ZQKA 2F3TA 4NCAA 2OSBA 4P3OA 1S7CA 4K9QA 3AL3A 5FI5A 3C3CA 4P54A 2KE5A 2FPXA 1BCRB 4PF1A 4PX9A 4QVKA 1DE0A 2WJIA 1U0LA 2NQ8A 2VT3A 3Q0IA 4LDPA 1V1JA 3BUSA 3WC4A 4CHGA 4YHHB 4TL8A 2Q5QA 3MTQA 3R23A 5DBIA 1J06A 4EB0A 4EUHA 3FHCB 3G2MA 1O6CA 1AS0A 2X9LA 5HKLA 3FNHA 3E2PA 4P36A 4AT1A 3UXEA 2A33A 4X45A 2AXNA 1WXDA 2X8LA 4LJAA 5LUBA 3OPXA 5TRTA 1N3BA 5CA1B 3URMA 2J09A 4Q18A 3U1BA 4D9MA 2IOQA 5K0TA 1NOIA 3MBOA 1OFGA 1P17A 3FTQA 4H08A 4YJ2B 2ZJOA 4H27A 4CW7A 3MG9A 3FNGA 4MTLA 5FWXB 3L4SO 4K0RA 3LPLA 4FS3A 3PYMA 4MVJP 3O2JA 4QDOA 1LQ2A 2CVOA 3M4NA 5HE9A 1T5IA 3P2IA 3OEWA 4DSZA 4GRAA 1FJXA 2K7ZA 4P34A 3SFTA 2O2SA 3I2GA 4RK0A 2KX7A 2H5JA 1H1LB 2I4TA 4LNUB 4YJFB 5T4EA 3VDRA 3PX7A 4ERNA 5ITWA 3S2ZA 2M32A 3IP8A 1RBMA 2DQYA 3A31A 5DXJA 2EFCB 2WR8A 4F0JA 2O0MA 2EQ5A 1T2CA 3ENNA 3OOEA 4G0ZA 5A04A 2XB6A 3OT1B 2ZRGA 1PT9A 5KQLA 4L3WA 3NDRA 3F73A 5LP1A 1J0DA 1VHDA 2YHAA 1P1IA 3BGVA 3MWJA 3ZCPA 2EW1A 1Z4QA 3FHJA 5DCYA 4DM4A 1Z35A 2FH5B 4RUKA 5LCXA 3UH1A 1YZGA 2PANA 3RYHA 4YUYA 1QH8A 1B8VA 3LLUA 3MGAA 1DEAA 4Z3DA 2AQHA 2BLNA 2BF4A 4HLUA 1JXOA 4LPKA 1WZNA 1B00A 2E4YA 2PRJA 3GLFA 4D99A 1I3CA 1MFZA 1XKQA 3U2QA 1NAIA 3KOUA 2IY7A 4JP8A 2BTQB 4LZNA 4YRDA 3OCCA 5LZ8A 4D3DA 3R76A 3GRYA 2G5GX 1CUJA 5DN6D 3L79A 4ED9A 1YZFA 2EWWA 1EIWA 2X0IA 3PEEA 1WMEA 1A98A 1V6SA 1Z0AA 2DQKA 3P0HA 3QY9A 4IV8A 4X93A 3DLCA 2FFQA 1K88A 1KO7A 1R0SA 2PWAA 4ZA2A 1POWA 3ZI0A 5BV0A 4BBAA 1P2TA 3BJEA 1KZYC 1KZ1A 3GRPA 4GZ5A 4KIJA 5AJYA 4CDMA 3Q2OA 2JLUA 3TPZA 3BYZA 4F4JA 3BF7A 4N0EA 4RZXA 4RULA 1PU2A 3V8NA 1EUQA 1QGOA 2OXRA 2BEUA 4LCJA 1U7ZA 4MUEA 1O9HA 2VH5R 1KEZA 2J85A 1YUMA 3ZXSA 5KU7A 2A57A 1IK4A 1YGPA 2H1FA 3C5WP 4HFMA 4LRUA 4NJEA 1UBOS 4B85A 5EAIA 3O26A 3I64A 3GEBA 1KY5A 2Y92A 3IRVA 1F0NA 4ZV7A 2RJOA 3P26A 1QO0D 3WGHA 1NF9A 5BVHA 4M53A 3NBAA 1XNJA 3GGGA 2E89A 5AP9A 3KZNA 4HEA6 5K8IA 2VSQA 1HG1A 2QR5A 3OBIA 4TS4A 5CXXA 4G0WA 5AVVA 2XITA 1P18A 1TYAE 3PRYA 4C2UA 5LSAA 2Z56A 2NSJA 4RU1A 2FI1A 1A8UA 3QMMA 2Z2ZA 2AOUA 1NJFA 3K4PA 1TF5A 4QDXA 1YDFA 3EOBI 4JQOA 3NBZC 3BD8A 3OE4A 2O2EA 2GVNA 1KK3A 2A1TS 2VUHB 4UM7A 4KO4S 5FADA 1GZ3A 1CJUC 1INLA 2B7CA 4HRVA 4RPGA 3IUMA 5JAQA 5JR3A 1Z22A 5C2JB 2G1PA 3S70A 4UREA 3TG8A 5JIBA 3LYAA 4G8JA 3ZIAD 2C2OA 1CY7A 3EDCA 3T7JA 2IU4A 4D8WA 1QP8A 3UTDA 1XXHB 2A14A 3P0JA 1I9CA 1JR3A 1M1NB 2GTPA 2R7AA 4XR4A 4EJMA 1MIOA 2ZG6A 4F91B 2QBYA 4B6SA 3QGMA 2II6A 3GGPA 2I54A 3COWA 5DM0A 4B40A 4JC5A 1X7WB 4ASUA 3TIFA 1LPSA 5KQSA 4WXMA 4EJ2A 3LKBA 2QRVB 4Z53A 4WFJA 1N5IA 3O8OA 2GD6A 2A9FA 4OSEA 3LDUA 2CLOB 3MCZA 3VMMA 3HC7A 3V80A 3ZVNA 3JW8A 5H70A 3WKAA 3DWIA 1EEXB 3W3AA 1XFDA 2WU8A 3JR7A 4MQ6A 4CYMA 4IJMA 1MA0A 3JQFC 3ZHXA 2XQGA 3G0BA 5KTNA 2VA8A 3LUJA 4RZHA 1LF5A 2DY1A 3AETA 3P2MA 4PG4A 3P9KA 3O9VA 1E63A 3HYSA 3ZDQA 1K6IA 1U4SA 1ECGA 4N5LA 5LOVB 2C7PA 3QUQA 5IYZF 1DZ3A 5EEGA 3Q7PA 3EDQA 1I3OA 4PXAA 1UUFA 4JBWA 5B4UA 5GGYA 3I62A 1E9FA 1T1SA 2C82A 4KPUA 3HKBA 2Y1XA 2YS7A 4EMBA 2XXBA 3UF0A 1UF9A 1YOVB 2I8LA 1ZJ5A 2PUVA 4AZSA 3K9QO 1URPA 2QW8A 1PL6A 2J5XA 4AECA 5JI3E 4F3CA 4I2VA 4PFJA 2X4DA 1RACA 3WJ7A 3LXMA 2ZW9A 4Z1MA 3C2QA 5EZQA 5IDQA 3SHOA 1QSGA 3U4QB 1NUPA 4BFUA 3QHPA 3KFXA 4E30A 4TXMA 1TQ2A 2IQ5A 1V26A 1JB9A 2DR3A 2RKOA 3GV0A 3TTUA 5IM5A 4ZIRA 3LCVB 2YWDA 2HQOA 1PLLA 5CX1A 2C2MA 4AS2A 1JR4A 1YVPA 5JADA 3KLPX 4NH0A 2UUPA 1E1RA 1IH8A 1UJBA 4GDFA 1UZMA 1PFVA 3L05A 3TFQA 4MW9A 4OIFA 1AIPA 1MENA 1VE3A 1DBRA 1NFQA 1BQ3A 2BMVA 3KR9A 4O08A 4PLCA 4RZIA 4DA7A 5A4DA 5JXHA 2IS6A 3E9RA 1T26A 1J2UA 3OZUA 4KE7A 2AUMA 5IDXA 1Y0BA 3TD2A 3SR3A 1OPRA 9LDBA 1ZM9A 2CFOA 4N39A 5TPWA 1HDRA 5AXBA 3FSGD 5JDIA 2BWJA 1B6RA 5JECA 1T0HB 4DWOA 4CKYA 1ZK0A 1IIBA 2FZVA 3FMGA 5IC4A 4A15A 4O2RA 1XB2A 5IZCC 3LI2A 3MUEA 4QUKA 1DEXA 2Y3IA 2Y76A 1EJBA 2YXPX 3KQWA 1AKMA 2R6DA 1DTSA 4EVRA 4AWXA 5E9WA 4RPLA 3EPKA 1RJ9A 3N6RA 1DX6A 1LK5A 5BVGB 2F64A 3QVWA 2JDIA 3FMOB 4DYHA 3OIDA 4G8CA 4RE5A 1YJXA 4TLMB 4LDZA 3ZCSA 1LA2A 4LGVA 4KWEA 3UWOA 4LJKA 2CHFA 3GVHA 3C74A 1OT3A 1FW8A 5DM2A 1FTNA 4D74A 1E61A 4IRUB 1ZLXA 2WF6A 1PN3A 1GAJA 4FE7A 4W8GA 5G1PA 5EMNA 3DL7A 3EEQA 4D79A 1HYHA 1M34E 2ATXA 2YJ3A 3HLYA 4RZUA 1M5RA 1BC5A 4FGSA 3BTVA 1ZU5A 5IJZA 2IZZA 1Z5GA 1RHMA 2HOQA 3S81A 4QXRA 5B37A 1MC4A 2FZLA 2BHTA 1HT3A 1MX3A 1RLOA 2J9GA 3NBFA 3TLYA 5EMJA 4US2R 1DBSA 1L5HB 1DC5A 2B2CA 1ILEA 1CUDA 1HG0A 4DLWA 5IJ9B 1T9DA 1G0OA 1ZU4A 3ZZ0A 4FFNA 1RJFA 3VRHA 3USES 1FBTA 5IBPA 5ALIA 4K87A 1PJZA 5CHYA 5CVCA 3W3AD 2YX1A 1UXGA 1MOZA 3CSUA 5E4FA 4CV3A 4C20A 1BCSB 1DKOA 3NHUA 1HDIA 1P1KA 1XQYA 1JFFA 2NV6A 4G4IA 4EA7A 4MKIA 3LP5A 4GEGA 3PXBA 1H65A 3RU7A 4AJIA 3W8NA 2CSXA 1OXUA 4PICA 4S2UA 2GD1O 3SK0A 4A0HA 2PLFA 5J4VA 3V1NA 4TLLB 5AVXA 2XGJA 4L4YA 2I7VA 3R3UA 4Q37A 2H00A 3N2NA 4BVEA 2CNOA 1HE1C 2YV2A 1H8HA 1IATA 1OKKA 3DBLA 4JEUA 5TT1A 2AN4A 2GN8A 3KQPA 4OXRA 1YRHA 2NT4A 1M8GA 4PPYA 4RIHA 1Z7GA 2YWXA 5BQOA 2IH4A 3L8ZA 2B8NA 3QXJA 4YJ3F 3AJAA 3PWTA 4ZYXA 4KQIA 3JAMA 1KOGA 4GLJA 2B98A 4RYLA 3UMYA 2OGUA 3C0KA 4DRYA 1QV9A 1JAIA 3A2NA 3BA6A 4O2AA 2AVNA 1A9PA 4Z49A 2C8LA 2CNLA 4KDCA 3HXOA 1IBLB 2R2AA 1BMFD 4C04A 2JKZA 5TEVA 3KZ1E 2GZ2A 1LRLA 1NN1A 2FJ0A 2YXEA 3B2EA 3OX4A 1MC8A 2OO3A 2OFOA 4P35A 2A9RA 4NPAA 1Q1QA 4PANA 5H9WA 4GLOA 4Q1DA 4DV2B 1V1RB 1D04A 3OTIA 1ISSA 1X7HA 3AEXA 3ANYB 2YJTD 1EFPB 3DH0A 3PC7A 1T13A 1DBIA 1IQRA 2ZOSA 1GPYA 2EEPA 2QVCA 1P62B 1RKXA 3FUUA 5H80A 3R7LA 4ZEWA 4M0LA 3VR3A 4EKIA 5KMGA 4FD3A 1L5ZA 1ORDA 4WXHA 1TVCA 3TQRA 5JJCA 4HT3B 1HX7A 2WJWA 3IUBA 3RREA 3SHWA 3ZHYA 5BNTA 3RE1A 3RS9A 3M34A 4U0JA 3S1AB 2XMPA 1QH1A 5FLXA 1S1MA 4JUDX 2NQTA 4HH0A 3EEIA 3PNOA 3IB6A 1NP3A 3BSSA 4HB2A 5HMLA 3R7NA 1KO8A 5JMOA 3KZVA 2ONCA 2GAJA 1IN6A 5C5EA 4Z9FA 3N70A 3MN1A 3TI9A 1QH0A 5NULA 5JC8A 5LQJA 3U19A 1CQIA 3AJRA 1YKFA 1KMHB 1QF9A 1V6CA 2M9MA 3G9XA 4H7KA 4R01A 3UCFA 3WZ2A 2P40A 2VWPA 2GWRA 2MDTA 1M5UA 1KETA 1PRYA 1P4GA 2ODWA 2OD9A 3LUBA 4HYYA 2B4KA 4CF4A 4F5YA 3MWFA 1NJ1A 3AUFA 5ES4B 1XQ1A 1P45A 1JA0A 2CN1A 1QAMA 4RY9A 3Q6NA 3T7KA 4DZZA 2ENWA 3DM9B 3I3OA 3E5HA 5HCIA 3PC6A 4V0MA 3THYB 1ZH0A 2PBLA 3FCAA 5E7QA 1YBVA 4PFQA 1WUHS 4O59O 4A23A 4HDSB 1JPNA 4KO2S 3AVUA 2O06A 5LKAA 2VUUA 5CT8A 3DDOA 3WL7A 3SFVA 2FA9A 3L82B 1H8EA 3HVIA 4JL8A 5LN1A 3FHTA 2HEIA 4NCXA 4BNGA 2AG5A 3P96A 3DWEX 3IDAA 4R2JA 1EINA 2IPLA 4OHPA 1LTHR 4TX1A 4Z9YA 5B2FA 1YB6A 2BFBB 4QLBA 3QG1A 2GSWA 1E6LA 3IIKA 1TJ4A 3C16C 2O2HA 1NXTA 2A35A 5HQTA 2GAAA 2C2ZA 3DGFC 3D2AA 1PNOA 2YHUA 1WJGA 1G7CA 2XIJA 4IIYA 1O5OA 3M6IA 4BNDB 4BTEA 4WNAB 4K81B 4K05A 3HUFA 4MV9A 1AN9A 4QECA 1A69A 4P3YA 3RC3A 3UMRA 2JI6A 3DTVD 1QNFA 1S3SA 3FA2A 4H1TA 1BXRB 1LS1A 3LFHA 1XHLA 1E5XA 4CM7A 3GLHB 5F23A 3CRMA 3FZGA 1ZW1A 4F4CA 1P2GA 4W63A 3ZU3A 3IDSA 4BKRA 4QOGA 3Q3IA 4CLDA 4EKYA 1JIUA 3AUTA 3D0KA 5C5IA 4QBGB 5HNKA 4X1KA 3KPYA 3T94A 1OY1A 3I5YA 3S29A 3QLUA 4OHZA 3TSCA 2OK8A 1P3Y1 3D4IA 4IDBA 2H92A 4Q19A 4IIJF 3SBXA 4YCMA 1CUWA 2AB0A 4TKUB 3UICA 3MWDB 1DQYA 4BO2A 1OBFO 4IWXA 2ZVDA 4NMXB 1GCOA 1II8B 1N0IA 1JGTA 2F2TA 2ZJ6A 2ECFA 1Q57A 1ZD3A 2VPWA 2X2EA 5JT1A 3IOYA 4HYTA 2QY6A 3ELYA 1J23A 1EGQA 1Y80A 2IX9A 3ROMA 2JFPA 3ZJVA 1RTTA 2A58A 2DLNA 3CTMA 3LWBA 4PPNA 3KSZO 5JCOC 1F4PA 3A9VA 4MJXA 5F2KA 1M34B 3FLEA 3NFRA 3HFRA 1DX4A 4WD3A 4B44A 1UM9A 2C29D 4UCWA 3T1NA 3P0RA 4MDYA 4EJ0A 3PD0A 5CH5A 2BW0A 3I9LA 1JYSA 1LDGA 2ZAGA 4PR0A 5LFAA 3L9XA 3C97A 4W1RA 5BMVB 1CERA 3DBVO 3WOHA 3EUAA 3T9FA 1G19A 2P11A 3HR4A 3S44A 4M9QA 4E5SA 3WJ1A 5JNVA 5AVKA 3V7UA 1JIQA 4A82A 5BXQC 3E48A 4BKQA 4Y9UA 3W6OA 5BUQA 2ABWA 3R3ZA 4G5XA 3QJYA 4W82A 2H1IA 2ZSEA 2GHIA 1JHDA 2JFHA 3TD9A 4ZT2A 1W1IA 4I8XA 1HNZB 3RVOA 2DY0A 3RVQA 1QHIA 4JEHA 3E18A 4TMKA 4YAKA 3THRA 2QRVA 4M46A 2VL7A 3O8OB 4DYDA 5KNCH 4LFAB 1SBQA 3OC6A 2ZJ1A 3GDHA 3KPJA 2V7BA 4MS3A 5EP3A 3RK0A 1U5BB 4RJJA 1SMKA 2AKYA 4NBSA 2YVAA 1JIXA 2DERA 1RYFA 2R68A 5DSZA 5LBIA 3T34A 5C8DA 1HLGA 1NR7A 4ZQEA 4YDSA 2B1QA 2ORIA 4DZRA 1IMJA 1Q3TA 1T35A 4ZOLB 3U3JA 3UJCA 2QXYA 3UAZA 3HGMA 1IDOA 3MUNA 3KSRA 4DQDA 2AW5A 5L95A 4FFRA 1XROA 3HKEB 3BRSA 4O4HA 3MMNA 4LA4A 2D13A 1F38A 1E0KA 5JJKA 1ODTC 1JSRA 1AKEA 4YYZA 1QFJA 4UASA 3AI1A 1CEQA 4KPUB 1Z45A 3VX4A 3DV2A 3ZDEA 4EUNA 1EXWA 5JFOA 3BQNB 2O3UA 1N2HA 1U02A 2WWFA 4FCVA 3RTBA 1Q0TA 3D8HA 1A4UA 4IY1A 2X4LA 1THZA 1DAGA 1QO9A 1CQPA 4HB4A 4TSRA 4TSFA 3AEUA 5EXEA 5GJVC 4DFDA 3IDQA 3AK4A 5HOQA 3VJRA 4LMPA 1C0KA 4E2YA 3UJAA 3KUKA 4OBWA 4KO3S 5IT0A 4EGCB 2B9VA 3W2GA 3KAPA 4PBRA 3DLTA 3MM4A 1B26A 2GZAA 3FPAA 5BMOA 5FWXA 4DLKA 5FKJA 1CR6A 3EZ7A 1A2KC 1JPUA 3NJ4A 1PCXA 5A9TA 2I62A 3I5UA 1CUGA 1VIAA 4QBTA 3F6EX 5AVZA 1L3BA 2B1GA 4XAQA 1OGJA 3INYA 4EF6A 7ABPA 1W87A 3H11A 1GTZA 2C5AA 2Z8ZA 3DTVB 1MG0A 4MRMA 2XF8A 4ND3A 2BMDA 5TQJA 4BYGA 4DJ5X 1UBGA 4CPDA 1NZJA 1V37A 2O50A 2X2PA 3SEAA 1JALA 1FU8A 2WWHA 2P79A 2CMFA 3IKLA 2G28A 4GSKA 2FR1A 4XEHA 5DASA 4CLXA 3FOEC 5JWOA 4JI8B 1BFKA 1A8IA 2BAGA 2IWRA 1Z38A 3PHJA 2QMEA 1RQPA 4W7SA 3LL7A 1W0JD 1HQCA 5EPOA 1G59A 2BH9A 5ERXA 1VG0B 3A36A 4QAQA 1U1DA 3DJYA 3S2EA 2ZBGA 2OCDA 3LF2A 4DMFA 1JEEA 2FW6A 3E4DA 3KB6A 3PQ7A 3R7WB 4HJXA 1P7YA 1NP6A 2DCMA 4LSGA 1E5LA 4RTLA 1KAMA 4LYHA 2OOKA 1BNCA 2HM7A 3DFMA 4F38A 1GLGA 3FBWA 4FK8A 4R83A 4UTZA 3JRWA 3L7MA 4EZBA 3JU3A 3CUKA 1OXXK 2IPMA 4IJKA 4O4IF 4OO3A 3R6DA 1M2HA 4OQLA 3E5RA 3Q98A 1QTIA 5HZGA 4PFKA 4XLTA 4ZTUB 4UPEA 1TQ6A 3JASA 1U2GA 4LHXA 3BTUA 1R0BA 1LLQA 2W8ZA 3DBHA 3GJ3A 1BA2A 1CJCA 3F8TA 1ZUWA 4Y2UA 2OHVA 1PK7A 4MB0A 3FH0A 3DE3X 4EPYA 5B1YA 2FSUA 3QLJA 1W4CA 2ZYUX 3IUYA 3O6VA 4EHBA 1NLFA 4HAYA 1SXJE 2ZRQA 2EWMA 3EH1A 4X1YB 5E6SA 5JMTA 1DHRA 3AERA 1Q7EA 2CWDA 2PKXA 3RSZA 2P9YA 3QZUA 1TPYA 4MQBA 5KCMA 3MWEB 3I8XA 2BT4A 1U9IA 5JRJA 3FBGA 1IMOA 4ZYLA 2I4MA 4DBLC 3WV4A 3T7SA 2R0QC 4EBBA 1QC5A 3MJSA 3DD5A 2FKAA 2P2LA 4MW1A 4RD3A 5D7BA 2H85A 3JD3A 5E2IA 4PHTA 4Y30A 4MI9A 4IYJA 3BA1A 5I9BA 4I8IA 1CBUA 4P7GA 5ITVA 1Q92A 4CV0A 4JHLA 2MCFA 1QBGA 3CWQA 4UOQA 2QQEA 2GRUA 3LY9A 1CZLA 2R6R1 2YDXA 4RJKA 3S7TA 1NRIA 2BBOA 1IXSB 2HF8A 5JSZA 2FSPA 2AD5A 2VRCA 3HBMA 5BOSB 2C3PA 3HDVA 4FHZA 4DBZA 1NIPA 2C9ZA 1PT5A 4O2AB 3GDFA 1Y3AA 3PC4A 2WVGA 3PENA 3GFOA 4BFXA 1WMFA 1A9YA 4NHOA 4QTUB 3IYLW 2I7DA 2FPWA 3O94A 4KBFA 2XNJA 5JNUA 3C7KA 4K40A 1E3EA 1G8HA 3CE6A 3QJGA 3SXUA 2FJPA 4JAVC 3KE9A 4K9RA 3WAKA 1OC2A 7GPBA 4B2YA 5ICCA 1L4GA 4PN3A 4OF4A 3N2YA 1GDHA 1L4NA 1WVIA 4LS3A 2ZYDA 5EVCA 2R1TB 5HDQA 5LMZA 4YS6A 3HXQA 3VPGA 5ALLA 4Q6BA 5ARDA 4GVPA 3X1DA 4HQKA 4OD0A 3DZGA 5TEWA 3K3PA 2HR1A 3AL0C 2ZUFA 1XGKA 5BSGA 2B36A 2WMDA 1YR2A 2QDKA 3R4VA 4LGYA 3D6VA 5EP2A 1AZTA 3G6WA 1WUKS 3H0EA 5I9NA 2M2IA 3H1BA 1DCFA 1W5AA 2XHZA 1A5AB 4ZJZA 2DPHA 4JV5B 4YRJA 2QD4A 2XYGA 3BB3A 1SOAA 3WX0A 5AK0A 5KTOA 4TMXA 2ZDQA 2DFLA 3G2OA 3LWDA 1Y4UA 3AFNA 2YC2C 3F4LA 2ACWA 1O1YA 2H52A 3OA0A 4J1TC 5BYJA 4IIGA 3STXA 3ZZ1A 3FPFA 4W4TA 3RYIB 4OREX 3IBGA 2OHFA 1DINA 2P8JA 3C6QA 3CR3C 3LT2A 4DM3A 4F72A 2N3ZA 1R9JA 1GGFA 4GGMX 4I55A 5HIKA 1LI4A 4CLEA 1BMTA 1WCYA 3AR6A 4IGFA 1E6EA 4JUCA 3TJZA 3QEJA 3QPBA 3SOZA 3HXTA 2ZRBA 3FFBA 4HNGA 1W7AA 3C3BA 4D02A 2ZIXA 1IJKA 5JH7F 5CVJA 3TOVA 3BVPA 5IVPA 1VB3A 2IXAA 2R5WA 3MPOA 3GYGA 4HQ0A 1NBMD 4MCIA 4MMXB 1PW7A 4HXEB 1AGXA 2FWBA 3BZWA 5F7ZA 4JLDA 3PXGA 1NBWB 3AIMA 1ML3A 4DL9A 1NQTA 4IX9A 3IUPA 3SIXA 4BASA 4LHVA 2LPMA 5D51S 4WQMA 5ALQA 3IUNA 4MR8B 1EFDN 3HHPA 1S2LA 1MG5A 2B4QA 5ALSA 3GLIB 3SYLA 2QX8A 1VGQA 2G04A 3KOWA 4QUHA 1NW3A 3ZXUB 4E46A 3D2BA 3G5AA 2MR6A 2E3JA 4E09A 2BGUA 5H4GA 3LY5A 2VS1A 3HCPA 4AJ2A 5A3RA 4PQRA 1VJ5A 4IVRA 4RCYA 1N77A 5IDWA 2QP9X 5DK6A 2P2GA 1R12A 3CKMA 4ASUD 1DQNA 2EF0A 5ELXA 3MYRA 2BUCA 4QOFA 3SYRA 5ADHA 2GUWA 2REBA 4BQNA 1UMBB 1PFWA 1WZ2A 2HU2A 3ICEA 1U3UA 3BMQB 3OX1A 3QELB 3DP9A 2G17A 5B1SA 1U0BB 2Q2OA 2PLNA 2XWPA 1AA6A 1KPHA 1M33A 2HA2A 3L0OA 3UEOA 2WT8A 5IULC 2H1HA 1XAJA 5JOQA 2G4VA 2WEKA 2D4HA 3ICWA 5F3DA 2NO9A 2VF2A 3TL6A 1JJAA 2JGMA 2VDOB 5AUNB 2HFJA 4FOLA 3KP1A 1RPAA 4XGIA 3KL4A 5IZCA 2BP7A 5JYBA 4EQ6A 1L8XA 1R0ZA 2EJVA 4GVXA 4OU5A 2VJAA 5TPZA 2OB2A 4OXNA 1UXKA 3ZK9A 3MGBA 1QYWA 3L7BA 3C5HA 4J8PA 1ZN9A 3JWJA 1ONOA 2JHAA 2JFNA 2LXNA 2QLTA 4ENQA 2JA2A 5DLYA 4PTYA 1Y42X 3FCOA 1QK4A 2HBZA 2LKCA 2N42A 3ESQA 1I2BA 1U0NA 3G2HA 3MJFA 3PNSA 5FL7A 3VZQA 1ENYA 4QBKA 3WQSB 5JNTA 1QKJA 3VHXB 1JG6A 4D43A 1ZESA 1YDEA 5EUBA 4BEVA 3TOSA 3Q9SA 2ZUWA 1QYVA 4MUMA 3MWDA 4YLYA 5HG0A 2JH9A 2YHIB 1WEHA 1H94A 3Q0EA 4RF5A 2UYYA 3ROKA 5ICFA 5AJZA 1VPWA 4K6CA 2NXCA 1ULBA 1U0RA 4LNUA 3L01A 4TQUS 3E82A 3L6OO 1QONA 5JARA 1O0SA 4W9RA 1SCUB 3GJYA 4C2BA 5DVZA 1ZOIA 4MK4A 3IJPA 2XLCA 2BM8A 4GECA 1EWQA 1OB5A 1IZ7A 1UKEA 1Q1EA 1YOBA 2VNKA 3COPA 3MEQA 3OURA 1P74A 5J63A 4A26A 1FA9A 4BPRA 5AW2A 2AF3C 3K53A 3CRVA 1OBOA 3HV0A 1KEKA 2F8TA 3BHNA 3ZUPA 1V45E 2Z8YM 3G1WA 3WAGA 1NI4B 1QGYA 4EAQA 3FAZA 5CPBA 3V3TA 1PG2A 4KLRA 2ZYRA 4IILA 3GRKA 5BMVA 4OXXA 4P4SB 2BJHA 2QM0A 4KWHA 4NCBA 3OIUA 5E6UA 2G77B 3ABZA 2OXTA 2B94A 5HRUA 3UKOA 2QW0X 3FHLA 4QYTA 4ZVRA 4M87A 3TQSA 1JE1A 2WIJA 3VJMA 4XWKA 4P93A 2ZSAA 5LQKA 2AOTB 3FUTA 3PPIA 2XCSB 4RWZA 3TOCA 1GADO 3AILA 5K0SA 5KPJA 1I8TA 3RAGA 2R7NA 4IG4A 5DWVA 2VAPA 1DQZA 2C1XA 2HLNA 1R4NB 2RMKA 4Q1VA 4XFJA 2NU9B 1VSQA 3RJZA 2HUNA 3H8SA 1MAHA 1U1FA 1NPDA 1K0UA 5FHRA 1A9OA 4I9UA 2TYSB 3O4HA 4TKVA 5CCBA 4XJSA 2CXXA 5ES3A 1ETUA 4P33A 1J0AA 1H9CA 1XLWA 3OESA 1Y3FE 1MTOA 4ZQFA 4IJWA 2ZTHA 1PR6A 4MJ3A 5TX7A 3KKQA 1QYDA 3B5EA 2W7TA 2WF7A 3DYVA 3D8UA 4M8LA 1YQQA 4EEKA 1D1SA 1FFGA 2Q6KA 2AEFA 2JHPA 2UZ1B 4TS9A 3TQCA 5LNK1 2VTBB 3DD1A 4R9SA 2VTVA 4FOTA 3NNSA 5DT2A 1KJ9A 4I1OA 4Q0MA 3GG2A 5HGJA 3IT3A 4P86A 2GX6A 1F5SA 2IYNA 3E5MA 4G8DA 5AR1A 3SBDA 1P3JA 2PZ8A 3TDKA 5J43A 1DKRA 2CXTA 1ADBA 2C4UA 1MVOA 2OV3A 2G08A 3AG6A 1Y33E 4QL3A 2QM7A 5GM1A 1XZHA 2YXLA 4W99A 5B3JA 1RRPA 2CJFA 2ZS7A 3BPSA 4HX9A 4AKGA 3AVWA 3KR0A 3AY0A 2P8SA 2R4UA 5DIFA 4ZOEA 3M6XA 3UK1A 4YUZA 1QG0A 1A96A 1N7GA 1YH3A 2DBQA 3U61B 2C83A 4PZAA 1GITA 5AM5A 3V2IA 3GEPA 3HKDA 4MMZB 5B2EA 1LPAB 3IPXA 1NMZA 1NP7A 2VQEB 4U2DA 3ZZMA 1C1DB 4F06A 2XCLA 3L6DA 1H5QA 4HLCA 3W5AA 3PF8A 1E5DA 1S01A 2HZBA 2PA3A 3NBYC 4TMFA 1RPZA 1V7QA 5AHXA 1NV9A 4GF5A 1EVJA 1Z75A 3GB9A 4KMOA 3JQPA 1RYEA 4E5PA 1I6MA 3ZHOA 5K0CA 1LLUA 4R2KA 4RLFA 2Q3LA 2IUUA 1IK6A 3FPLA 1TA4A 3CBQA 3EASA 5K2MA 1O54A 5FOQA 3CYFA 2ZUSA 3D9QX 2A67A 4PZPA 1TEVA 3EVZA 3ZLJA 5AOVA 4DOMA 3D43A 4LAFA 2EJCA 1U8EA 2HWYA 3KYDB 1YL5A 2C31A 1JQEA 4KIFA 3VU0A 3LG2A 4OCZA 5AVJA 3QFSA 3TRKA 4RH1A 4YT8A 4KFCA 3GJ8A 1JLLB 4NXMB 3ZCXA 5EWJB 3T7TA 3ICVA 4IUBS 4OKIA 4R1TA 1N5LA 2GB4A 3CISA 5CFMA 1O8BA 5EIBC 4P4UA 3VJLA 2BMFA 4CV2A 3CZ9A 3FYUA 4G1BA 4L15A 1EFTA 3B1KA 3THXA 4ZARA 4AN0A 1Y5NA 4FI3F 3RHSA 3DAPA 5E4YA 1LDYA 1CIJA 3UAWA 1E1LA 3FX2A 1P1RA 3DF7A 4CMAA 2OP1A 1Y8QB 5TB5A 3ZWWA 1DHTA 3A6LA 1QYRA 1AD2A 3R9XB 1P0QA 1ZC4A 4EQZA 4C01A 1NUSA 1B93A 1P5ZB 4IDNA 5DRYA 1X8XA 1XYYA 4RD2A 1JKXA 2D62A 3HB4X 3WLAA 3FOZA 4JROA 4DA6A 4FYVA 5T67A 4DCGA 4ZI5A 1KTIA 3TZCA 1B8OA 1T1IA 2V59A 3HI4A 2JCGA 2OQRA 1T5HX 3A6HA 5TNXA 1R0RE 2IXBA 3EISA 5CRIA 2I22A 1M2JA 2V5AA 3C4QA 5A5FA 3N75A 1CY4A 3LQ1A 4BTVA 1Y1QA 1HMYA 1N5RA 5HCNA 4BTLA 1Q0LA 2W6ID 5U1PA 3WK4A 1MEOA 1O08A 2C3OA 4CLRA 1VMDA 3F5MA 3L7CA 1RWBA 3SXJA 5BR1A 2C98A 2QAGA 1I3KA 3GRCA 3H87A 5F3RA 1A77A 1SCAA 5TV2A 1XYVA 4C7BA 3HWWA 2L17A 1DI0A 3LHDA 4MV3A 3BWYA 3RYTC 1F6WA 5H5JA 2WZDA 1TA0A 2AS0A 2O1WA 2P2CA 2VSXA 2GNPA 4HQOA 4M1QA 5SYNA 3TW8A 1OFIA 1S2DA 1NPTO 4LISA 3VO9A 1ZRHA 4D45A 1ZXBA 3C3MA 6PFKA 2ZTLA 3HBJA 1GKLA 3FCEA 3OCZA 4J0HA 4P08A 3T41A 1E1QA 2PJZA 3HYRA 2BCJQ 3ZDRA 5M04A 3HJTA 3LYLA 3IAEA 3GX1A 3LW8A 1ECCA 1Y37A 4XX0B 4BNXA 4D6XA 3PXEA 1W2GA 5EXDA 2FZGA 4XGNA 2HLDA 1FQWA 3OH8A 3NEPX 4PVCA 1WPQA 4Q12A 1TW2A 3CVXA 3FVQA 3NKLA 4MVJH 2HT6A 3M2TA 2EYUA 1DC6A 1TU4A 1SEPA 2PH7A 2H18A 2JD1A 3JYOA 4O4JF 5HZKA 3VDXA 1JSXA 3UB3A 1PJ3A 3GGCA 3R7SA 4CIVA 3PLRA 3H5RA 4D9BA 3MGGA 3PDWA 4A5SA 2IV3A 3N05A 1I1QB 4B3DA 3GMDA 1OX5A 1TMGE 2BFWA 3H1GA 1ZH2A 2BGGA 4IFTA 5H16A 4BNUA 4MH0R 4MQFA 1Z6XA 3H18A 4QRIA 4EI8A 3TF5A 4HDKA 5TF0A 3PBKA 2V9ZA 4AJPA 3VSAA 2QLNA 5EXTA 5MN6A 3ZOZA 2QK4A 3KJGA 5KAMA 3DOOA 3DZHA 3W8FA 2PSJA 4EG1A 1LQUA 2P4QA 2VPTA 3UW3A 4UXIA 4R54A 1XFAA 2YKGA 2ZZMA 1YR1A 2R3SA 1TMKA 2L82A 1PL7A 3OQ1A 8OHMA 4IX1A 5B12A 4HMOA 2C7BA 4MA4A 3O8CA 2DH6A 4CKWB 1NVXQ 3UFXA 1FYFA 4HNQA 3QA3E 1YIOA 2O19A 3FUVA 3G85A 3M4YA 4NCJA 3T9AA 3AZQA 3FR7A 2M1ZA 1OR8A 2GO1A 2BEWB 3F6BX 1ZA1A 1PZXA 3O8QA 1GGKA 1NXSA 1GG9A 3DM5A 3HA3A 3ZJ5A 4A2WA 4AUEA 1HNNA 4NAHA 3MELA 1TK9A 1FCJA 3BIFA 4EWLA 1WXIA 2QM8A 1PG0A 2R62A 3OCVA 3JWPA 3RLFA 2FUCA 4RAOA 1RKBA 4NG5A 4KGDA 2D5BA 3OU7A 2Q0XA 2D2EA 2X1VA 3G1UA 3A9SA 5EVJA 5FBHA 3RS7A 5TMPA 3AJ9A 3IDOA 4BFTA 2CFIA 1W93A 2EZUA 4CKEB 1DTWB 1YQUA 1YS6A 4KIUA 5HKOA 4L9RA 2W4QA 2ZJ8A 5AO9A 1K0FA 1IPFA 4NVRA 4H6WA 5DK4A 5TMDA 1SR8A 4HXYA 4W6ZA 5DTRA 2XAUA 3BWEA 3T5DA 4GKJB 1PUJA 3ZIDA 4DSOA 2O5CA 4KITB 1H2BA 3FHOA 1H1DA 2XYQA 3GD7A 3GH1A 3MXOA 5G0TA 5JDCC 4A2PA 4AX8A 5JYDA 3LWZA 1D3AA 4CUKA 1NSYA 5ALYA 2OO5A 4NULA 1Z6ZA 4A36A 2C57A 1QZTA 3ILXA 3CX7A 1NXVA 4V1CA 1F2UB 4JGGA 3R7FA 3CVWA 4B5LA 3CIFA 1Q0ZA 2CLFB 3EZGA 3R75A 2YZMA 1SUSA 1W29A 3AINA 4EJSC 4AUNA 3FNQA 1AH2A 4V3CA 3WQBA 4PXYA 2BE7A 3N8KA 3LUCA 4HUQB 4Y2TA 3HMQA 2X7JA 2C0PA 5J9FA 3RIHA 3C8ZA 2QRKA 3MWLA 3TM4A 1RQNA 3EXEA 1GXSB 3AEQA 3JQDA 1SGWA 3AVQA 3UJ9A 1WPXA 1OASA 3LCRA 1OHHA 2FSSA 3F7MA 3IS3A 3LUPA 3BFPA 3H99A 2CL6X 2AJ8A 1ZCBA 2G36A 2QPTA 4RGYA 1AZWA 3FN4A 5EJ9A 2C4MA 1F7UA 1JS1X 3ZE2B 4KR3A 2P77A 1P4JA 3GC6A 3NM6B 4Q7QA 4ND8B 3A3OA 4DWVA 3IXQA 4NFLA 4HWKA 4ETIA 4O63O 4YCCA 3CT6A 1LPPA 4TQ9A 3SIPA 4B0PA 2KYRA 1OV6A 4Q1FA 3NETA 3HBAA 2F9FA 1QX4A 1CUAA 3PT9A 1KDZA 1I24A 3VKGA 3GLVA 1JW9B 5FEUA 2NUBA 1RM3A 2RC5A 4TSFD 5CW2A 4W9NC 2WFLA 3H9UA 3WYCA 1LGYA 1U2GC 3G13A 1K75A 2V6MA 3GYBA 4GPBA 4F8JA 5BSTA 3WO1A 5GZ1A 5DGDA 3IA7A 3GQBB 1MFPA 2V74B 2AHRA 5CVUA 5JY1A 1U8UA 4U3JB 1UDBA 4WHMA 2O6HA 4R8RA 2ZRCA 5K8UA 1AKQA 1D0VA 5JXJA 2Z9DA 1HDYA 1Y34E 3EVTA 5DBHX 2ID8A 1TMYA 2BFCB 2YXBA 3GGDA 1OPXA 3IVMA 2QQFA 5B36A 1TTPB 3L4JA 1T9HA 4AMBA 1W6UA 4RE6A 2OGZA 2VBCA 4TLDA 2GZRA 1JDPA 1R0CA 1PS0A 3U7JA 1QQ6A 2VP6A 2ZJ0A 3AUAA 4DREA 3WWYA 2ISCA 3ETEA 4CIBA 3ZWQA 2W70A 3K1AA 1JEQB 1QVRA 4FFDA 2PD6A 2BZGA 3BX1A 2WUGA 1EWVA 4NZOA 3W7AA 4BATA 2QW1A 2OFWA 2XYPA 4DA9A 4Z5XA 1CCWA 4BO8A 1AXGA 3KU4A 1V11A 2HTEA 3GRVA 1EHIA 2OC4A 3IMKA 5CR9A 4YREA 3U7QA 1TC1A 5HW0A 1J00A 1GZHB 4LOHA 1PVVA 5CYFA 2Q45A 3BWDD 5JCOA 4X6UA 1T0PA 4IYRA 3WZMA 4KN9S 3MS4A 4OX9B 3U49A 2OM2A 4B8YA 3E0XA 4L28A 7AT1A 2O0LA 4CN8A 2A7XA 2V7WA 4F97A 2WJAA 5CB4B 3ZXYA 1PT7A 2JJ2D 2C8VA 3EWSA 3W9BA 3GHHA 3LOUA 1XDBA 1S6YA 4GMKA 4EG4A 1R5OA 3AZOA 4AC9A 3RUCA 1W8IA 5CDFE 4A27A 2BHLA 3OAAD 4J7CA 1NKTA 5BR8B 2HRBA 2BGLA 3PK0A 3S7ZA 2WSSD 3W5SA 1IXZA 2WAMA 2JGAA 2PX4A 1E1KA 3ZBTA 1U90A 5K3FA 2B82A 5JS6A 3TWOA 3L6CA 1M6VA 1KTVA 3AONB 2J3KA 1FPQA 1PR2A 4NMLA 2GF9A 4QJ4A 3LECA 2VNAA 3NWJA 4YA6A 3OT5A 4NESA 3DOCA 3T3IA 1Q77A 1MB9A 3I8OA 4WZ6A 1KK0A 1TUGA 2CUNA 2FAXA 2GBGA 3LCUA 3MJCA 5E2BA 5LP6C 3WK8A 4ARUA 5E0KB 2VXBA 2OXIA 5J5AA 2AOWA 2P9GA 2IDKA 4QU9A 2G9QA 1RAGA 2H6EA 4MYDA 1E3TA 2IYXA 1XX6A 1NMYA 2PGJA 1JT2A 4NYIR 1DC7A 4ZYVA 2Y9PB 1B6TA 2ZR9A 4RZQA 3L6UA 1X92A 3JARA 3CSSA 1C5KA 2FOIA 3A58B 1LXCA 2JFVA 2NO0A 2Q07A 2WWIA 3Q8XB 1WCWA 1YS2X 3QW2A 4H16A 4HATA 4ZJPA 2AX3A 1W44A 3RYIA 2ANBA 4KV9A 1OX6A 1TM2A 4JXXA 1RBQA 4QNRA 1RI3A 3GLFE 2IIVA 2YVKA 1R8JA 2VP4A 4CG2A 1CUCA 1YJBA 1BO6A 5HRAA 5JAZA 3JYLA 1YFKA 2IZ6A 4REMA 4KSYA 4D9NA 3THWA 4RDCA 2X42A 1YZKA 4HWSA 2HQSA 3I0MA 5IAGA 5JPCA 1XI2A 1L4FA 3OJ0A 3G8DA 3G6KA 4AKHA 1CUZA 2CLCX 2RK6A 2R6GA 2JCXA 4G1UC 1GRCA 4ZGGA 1CFZA 5GVSA 2FFAA 3RM3A 4ODIA 2B8WA 2CVHA 2A1IA 1ZG3A 1E9EA 5JASA 3TIIA 3VZBA 5C7YA 3CGWA 2NN3C 4FI3C 1THMA 4FNOA 2EIXA 4M0EA 1AQUA 4WBSA 5KIAA 1DPGA 1S8OA 1YRYE 5CNMA 2XGOA 1WD7A 5EJ5A 4KVFA 2ONJA 4QRDA 3IR5A 1WNTA 2P7IA 3W90A 4MUKA 3KTDA 1MW9X 3KOZA 1MMFB 2ACVA 1C1XB 1MW8X 1KYTA 1PKXA 5LXTB 4RCZA 5AXAA 3V00A 1EZ1A 2UU9B 4H9GA 5AICA 4J9VA 3TPCA 2IF0A 2WLTA 1W59A 1X0VA 2WNIA 3AZPA 3EEFA 4QQ8A 3A3KA 1GZSA 4FYJA 4B7CA 1Y8QA 1DADA 4B47A 3K1YA 1VLJA 1DAPA 2B92A 2C5HA 5LLDA 1RQ2A 3WB9A 1WZUA 1UPCA 3D0OA 3CLUC 3KOMA 4IQFA 5DOZA 1V3QE 1TKRA 4JH0A 2IW1A 2J3IA 2Q5HA 1I2DA 3ANMA 4AYTA 3B20A 4IR7A 3OM9A 1K63A 2DVMA 5FPPA 5I7VA 1SXPA 2FPUA 1G0NA 4ZAGA 4JI3B 3V7YA 5ABPA 2J45A 1M34A 2ZJ2A 3Q11A 4RHXA 3NTUA 4TTQA 3IPAA 1WVGA 1L6RA 2HQRA 4H1UA 4M83A 4E88A 5FV4A 1FP4A 5F64A 3LFTA 4J0GA 1P5JA 4YX9A 3ZJUA 1XZEA 1G64A 2R86A 4GOLD 3FF1A 4KX3A 4Q3KA 4NEGA 5EHIA 2O1EA 2WAAA 3R7DA 4RIIA 1L7XA 1WBJB 4GUDA 2O7RA 3U31A 3H13A 3KV1A 4B33A 3DE0X 3MIZA 1FQOA 4NXNB 1WDTA 2AOXA 4CFZA 1NU6A 4PTZA 2CMDA 3WGLA 4JGIA 2ZI4A 1QK3A 4AG6A 3Q8MA 2J5KA 4LVUA 1ODCA 1Z4KA 4F1JA 1YK0A 1EE2A 3IQXA 4KOAA 4BJHB 2PRIA 4P5DA 5ITZA 3QF7A 5ESDA 4E1AA 1DSSG 3FG9A 1Z4PX 3RUAA 2DFDA 2I7XA 4K6MA 4LRXA 5KKNB 5JNSA 2H51A 4UQOA 5JH7A 4INPA 1TQ8A 4AY4A 2JFXA 1CF2O 2AEMA 4Q24A 3AT1A 4DIUA 5H7XA 4NJMA 5DI9A 1VG9B 3TQIA 3R3JA 1N6RA 3T54A 3H1AA 2ZIFA 4U5QA 1N36B 2PH5A 3DZBA 5DSTA 2J7PA 4Z4HA 3I2KA 4NCKA 1GDTA 3TEFA 1RCUA 4KSCA 3LC7O 2C0QA 2ZVPX 1Z8FA 3H1PA 3HUUA 3O4IA 4KR0A 3O4GA 5DTJA 4FMDB 2PSHA 4CQLA 1KAOA 2P4SA 2X40A 1KQPA 3KOXA 1M6EX 4B32A 4BQFA 4QA9A 2PKRA 4PPFA 2V8OA 5HJ2A 1JHXA 4DJJA 3LY8A 3MAJA 4ZC1A 5J3JA 4Z6KA 1DFGA 4JVMA 1RLJA 4HFNA 4BMOB 1QCCA 3RSGA 2JLXA 4JXJA 5A0VA 2E18A 2GKOA 3BE8A 4F5ZA 1X38A 3CURA 3WWEA 1JQDA 3I04A 4TWAA 3AEUB 3UUGA 1SD5A 3VFDA 1CB7A 3ZE8A 4WACA 2YFKA 2YJGA 3OZXA 3K1ZA 4Q7KA 1G3IA 1E1YA 1WCV1 2ODEA 2QUHA 3CB2A 1KYZA 5FI3A 4MVYA 4NR0A 4I5DA 3C15C 2UZ1A 5CT9A 2VTBA 5IMBA 5CT4A 3E8SA 2OV6A 1EWTA 4P2BA 3HYNA 4YRRA 3V4VB 2IYYA 4J0JA 4UZSA 4JUIA 4Y6SA 1JFSA 5DYGA 2ODBA 1F8YA 4OFZA 1BGVA 3UWMA 2ECKA 2G5PA 2GF0A 3ECSA 4HYQA 1GILA 4ISBA 1W35A 4M1SA 1D0SA 1XTVA 4DQVA 1QLWA 2HCFA 2MWMA 2VJMB 3QNMA 2JBWA 5COAA 1SC3A 4WSOA 4MB2A 4R68A 1PWZA 2DTXA 4FQ7A 5BSVA 3QPDA 3THYA 2XOXA 3WYAA 5SZKB 4RHFA 3RFXA 3FI0A 4OG2A 2QVLA 3TD6A 3SN6A 1P7CA 3ZNPA 4ATNA 3IVGA 5JCJA 2IFTA 3MPUA 2O59A 2J3HA 2HKIA 1HEUA 2HF2A 3KT3A 1Z2AA 1NKSA 4QKQA 2J3QA 2J4DA 5D5HA 2J46A 4UVDA 1BVUA 3SC3A 5J4KA 2BM1A 5DGIA 1X15A 3DQPA 1U4OA 2AMLA 2BFNA 3UJBA 2ZYTX 1L5YA 4FC6A 1OIWA 3KTAB 3LJKA 4EY5A 3D8NA 4FX2A 3F9RA 4YCJA 2VDPB 1EM8B 1E3IA 1T9AA 1U6KA 2OYSA 3EZ9A 3R5HA 4ZALA 1YAHA 4EA9A 4YRBA 1SUIA 1UWLA 2IBMA 2OV1A 3A4NA 2BISA 1WPRA 4Q03A 1U8AA 3PUZA 4UTVA 2Q9UA 4RVCA 1XRRA 1Y7LA 1YRBA 2LTAA 4TN1A 3DE2X 3TTYA 2DR2A 1IWPB 2P2YA 5A3VA 5PGMA 4X44A 5KHAA 1ILWA 4TQGA 1K7FB 1JJ7A 2XI4A 5J5VA 3W4IA 3JX9A 1EK6A 3H1TA 1K5PA 2IZOA 4EJFA 3ZS8A 2Q1TA 4H0FA 1C4OA 2G9VA 4MKFA 4R9RA 2REOA 4C0WA 3U7HB 2H4YA 5JROA 3F9CA 1MXHA 4QT0A 5B1IA 2C5BA 2E55A 5I8PA 3N1UA 1EHYA 1CE8A 3GEMA 1XEXA 3UMFA 3EWNA 2X4IA 3GZJA 4H7DA 1CK4A 1FDIA 2GUGA 3R9XA 3VR3D 5B5SA 5HF8A 4ZJUA 5DLEA 3WGMA 3NHBA 2IU0A 2PZAA 2PBZA 3BRCA 4CM4B 5KMGB 3GAFA 2GZSA 8MHTA 1CZUA 1G1AA 4JLAA 3NKVA 1XD2B 2WPDA 1XU9A 4LXYA 1X1RA 3KTFA 1HRKA 4IGEA 4DWJA 5H8WA 1FDVA 1G7TA 5GIPE 1AA9A 4G5QA 4ESOA 4UDYX 3PL5A 3ICOA 1OLUB 5B7PA 3QNWA 3MW8A 4JSYA 4L4XA 1C7ZA 4J75A 4S1PA 3CNHA 4XPZA 5HFAA 3ZNOA 3BM5A 2EX1A 1YQGA 2PD3A 3KJXA 2V98A 3KUXA 4GXQA 4Q9LA 4WVLA 5EJEA 3QH4A 4DUGD 4F9GA 3A28A 5M7EA 2VFAA