1THTA

Structure of a myristoyl-acp-specific thioesterase from vibrio harveyi
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
302
structure length
294
Chain Sequence
QCKTIAHVLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDHFAGLAEYLSTNGFHVFRYDSLHHVEFTMTTGKNSLCTVYHWLQTKGTQNIGLIAASLSARVAYEVISDLELSFLITAVGVVNLRDTLEKALGFDYLSLPIDELPNDLDFEGHKLGSEVFVRDCFEHHWDTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRTGHCKLYSLLGSSHDLGENLVVLRNFYQSVTKAAIAMDGGSLEIDVDFIEPDFEQLTIATVNERRLKAEIENRTPEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOESTERASE
publication title Structure of a myristoyl-ACP-specific thioesterase from Vibrio harveyi.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Thioesterase
total genus 101
structure length 294
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02273 Acyl_transf_2 Acyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1thtA00
1E8DA 4H7DA 5FP0A 1CRLA 2HDWA 2VF2A 3ZWQA 2OPHA 1JFRA 1QTIA 2EDCA 1FFAA 4AB1A 1BCSA 1CQZA 3ICWA 2BJHA 5K5EA 5FRDA 3EIOA 3HXKA 3L1JA 2XMRA 1SCIA 5EHXA 3F96A 1JJBA 5BOVA 4JYMA 4EY8A 1ZGBA 2DCMA 2R11A 3D2BA 4Y2YA 4HRYA 4OUKX 4AX4A 4FWBA 1CUWA 2WIJA 4Y2SA 3R3YA 4H35A 5ALZA 3HJUA 5AOBA 3QBJA 2NW6A 3W04A 1CUUA 1MNAA 5C8XA 3U1TA 3DEAA 3V9AA 4J0GA 4UHFA 3NGMA 4L9AA 1QIJA 3AUKA 4N8SA 4QWMA 4U2FA 4WJLA 3ZLVA 2YXPX 5EI5A 3IB3A 1DWPA 4PF1A 3BJMA 3BJRA 3R40A 2Z8XA 2VTVA 4K6KA 3W9UA 1CEXA 3H19A 3W06A 2RHWA 4X3CA 2DR0A 2EDAA 4X91A 3ESDA 2WTNA 4CCYA 4N8EA 3I6MA 3WWEA 2OAEA 3F67A 5H3HA 2OQVA 4L0CA 1EH5A 3DKKA 5K3DA 2RIPA 4U2EA 1IVYA 5AK3A 1DQZA 1ZOIA 3PUHA 2OCIA 4PSUA 3D59A 2QOEA 2WFLB 4G5XA 1U2EA 3AFIA 1QIFA 4BDSA 5SYMA 5JIBA 1H22A 4AMZA 3KDAA 2PSFA 2O2IA 5C8ZA 1HLGA 4FNGA 4BVLA 5LZ7A 1VXRA 1XZAA 1UK7A 1UKBA 5T4EA 3DOHA 1JJIA 1O6FA 4OB7A 1UWCA 3JW8A 1Q83A 5ALLA 4EZIA 3Q8WA 1XQXA 2OG1A 3MUNA 1Y7HA 5K3EA 3G7NA 3GUUA 1Q84A 3G9ZA 4KRXA 2OCGA 4EHBA 3DD5A 4J0KA 3CCBA 5LZ9A 1NU6A 1CFJA 2Q0XA 4FBLA 5CT8A 5BWBA 2H7YA 5BWCA 4KR0A 4H7JA 5K3FA 3WA6A 3ZPXA 3G0GA 1SCKA 3E3AA 2HA7A 1IUNA 2G4LA 1CUYA 1QO7A 2GYUA 3C6YA 1AZWA 4YPVA 3FAKA 2G63A 2J3QA 5ALWA 4GI1A 3QMMA 2VA9A 3KSRA 1G66A 3WIBA 4WFIA 2PSEA 5AJHA 4QEKA 1P0IA 3GZJA 4DM7A 4AZ3A 1BEEA 1S8OA 3WWDA 3CCCA 5AKGA 4OU5A 4P9NA 4K2AA 4BTLA 3C6ZA 1XFDA 3IVMA 4B9EA 4E11A 4GDMA 4HXGA 5FDFA 5FPQA 3DDUA 2HRRA 3E4DA 4G9GA 3BF7A 7YASA 3DYVA 1U4NA 1I6WA 4PO3X 1WB5A 1K8QA 5CT5A 5EHZA 4A5SA 1XRNA 1GGVA 1UKCA 5LZ2A 2VAXA 1BEZA 5A7HA 3DL4A 3L1HA 1EA5A 2WHQA 5AKXA 3SWWA 1ZD4A 2LIPA 2OGZA 3O0DA 3NOXA 2O7VA 2FJ0A 3RARA 4PNZA 4EUSA 3IUQA 5IVHA 1N1MA 4IQ4A 1XLWA 4N8DA 2XUHA 4X90A 3C87A 3FBWA 4N5IX 2CZQA 3VJLA 1XQYA 5AOCA 4LYDA 2AJLI 3M81A 5AKIA 1YASA 2QXUA 3A70A 6YASA 3QPCA 2HIHA 2VT6A 3ZLUA 1QIGA 2HM7A 2C5FA 5ALSA 1ODSA 4TPKA 1K4YA 3BIXA 5CTAA 4M0EA 5D3ZA 3ZI7A 1YB7A 4BP9A 2CJPA 3AZPA 3IBTA 4BZZA 2XMZA 1F0NA 2QRUA 4W1PA 1TAHA 3F9CA 5CT6A 2J4CA 5ALXA 2VAVA 1D07A 4DTCA 5JD4A 4HZGA 1LPAB 4Q82A 5CXUA 3TJMA 1LPSA 3GROA 1C7IA 1PFQA 2WILA 3EQ9A 4UFPA 3W05A 1WOMA 4J0DA 1THTA 4J03A 4HXEB 2CKMA 1C7JA 4DMFA 5AM5A 2XE4A 4BRSA 5E4YA 1B41A 4GW3A 4X95A 2VSQA 3C70A 4TVKA 3R41A 1UOPA 5EFZA 4BE9A 3AZOA 5DYTA 3IIIA 5ALPA 1XLVA 1G42A 5ALGA 4G8CA 2B9VA 3C8DA 1R50A 2XUQA 4MQMA 3WWPA 2W6CX 1VZ2A 1KU6A 4UBKA 2H7CA 1WHSA 2ZJ7A 1QJ4A 1XZLA 2WU4A 4IH9A 1CUHA 2QR5A 1R88A 4HRXA 4H7EA 5FV4A 4PQEA 4U2DA 1VZ3A 4X71A 3ESCA 1ORVA 4B7ZA 3BXPA 2AXEA 3N2ZB 4TGLA 4V2IA 2IX9A 5AKJA 5E4TA 1MO2A 5CXXA 4Y2JA 3AINA 5FPPA 4DNQA 4X97A 2O7RA 4FLMA 1EK2A 3B12A 4CG3A 5HF6A 1BU8A 1CPYA 5E2IA 1MX1A 4Y7DA 2DFPA 2WU3A 5AI5A 3H04A 3I2JA 2ZJ6A 5AO9A 4B80A 5EHQA 3G0IA 5T4BA 4KAFA 3I2KA 4B0OA 1ZJ5A 4Y2RA 3WK7A 5CRIA 2JEYA 2JGFA 4LXIA 1HQDA 5AKKA 4UHDA 1ZIXA 4QA9A 1XRLA 1WM1A 2VT7A 1GKLA 1W76A 3HI4A 5D3KA 2JF0A 2XMDA 3ZLTA 2V9ZA 1XQWA 3I1YA 4BVKA 3WI7A 4WCVA 2BAGA 5YASA 4G1FA 1A8SA 1IUOA 5A62A 3KXPA 1XZMA 4XJVA 3IULA 3H2HA 2H1IA 4F5ZA 4FFVA 5AHXA 3DS8A 1GT6A 1GXSA 1AMNA 1JI3A 2XUJA 2XUKA 4FFWA 4I4CA 3M3DA 1ISPA 3PF8A 4C6HA 3IUMA 2H7XA 4BRZA 2ORYA 4FNMA 1ZI8A 4QLAA 2QTBA 1HBJA 4MEAA 1E8NA 1DT5A 5AM1A 2PM8A 1L7AA 4FLFA 4OB6A 4X85A 4I3FA 5KBYA 4K6HA 3Q0TA 3SX4A 2HL6A 4JYPA 1EB9A 2XMCA 2AJCA 2I78A 1FSSA 3DQZA 3CN9A 3NUZA 4Y9SA 5A7FA 2IITA 4H7FA 1HL7A 3HLKA 3G0BA 3B5EA 1QIHA 1T4MA 4ROTA 5CT4A 2OQIA 5AM4A 3AJAA 3FSGA 5EHNA 4H0CA 3E0XA 1X2EA 4WDRA 4GBGA 1UFOA 1YR2A 1XZFA 2VQ6A 1LNSA 1WB4A 1QTRA 5I8PA 5AP9A 2ROQA 2XQGA 3YASA 4G9EA 4EA6A 1DT3A 4ZI5A 3QITA 4AN1A 2DQYA 1CIJA 5CBKA 2BFNA 4X6UA 4FTWA 2WUEA 4KE8A 2ACKA 3NWOA 1XZGA 1P0PA 2ES4A 4UBLA 5A71A 4HXFB 5AH0A 4BCCA 3VDXA 2YYSA 3QMVA 2I03A 1AC5A 5EIEA 2H9YA 4Q3KA 3K2IA 4LYEA 2X76A 4OD0A 1GPLA 4J0JA 3X3HA 4OB8A 2PBLA 5JD5A 3DOIA 1LPBB 2X5XA 2XMSA 3A2NA 2JBWA 2C0QA 1B6GA 2CUTA 5CH8A 4H77A 5CW2A 1FFBA 2XUIA 2GBCA 1YAHA 2HU7A 5JZSA 3S2ZA 1W75A 5EIAA 4INZA 4BCDA 4WFKA 4X93A 3ED1A 4C88A 2PSDA 1R9NA 4B9AA 5HQ3B 3WA7A 1BROA 2XB6A 1P0QA 1SOMA 5JATA 1W1IA 1J1IA 1MX9A 2D0DA 4Y2XA 5ALDA 1YS1X 2WHRA 3C8HA 4QNNA 1XRQA 2Y1KA 4GEGA 3G9XA 4H18A 3RKSA 4G8BA 4DLNA 1ACLA 2QT9A 5ALFA 4X7BA 1TK3A 1DX6A 5LKRA 2FX5A 1XZCA 5T4HA 2OLEA 4RE6A 4CFSA 4EY5A 3PFCA 2HU8A 3H18A 4P93A 1QLWA 4OU4A 3IDAA 1IZ8A 3DL7A 4CG2A 1HPLA 3STTA 3H2JA 4O08A 4XX1A 4ARBA 1UZAA 1ODCA 5K3BA 1VE6A 5AM3A 3BDVA 3HSSA 3QYJA 5AK5A 2BGRA 4UPDA 4FBMA 2JGLA 3P2MA 3MUOA 4PV7A 5AKEA 5LZ5A 5DYYA 2JGMA 1A88A 5ALQA 4LKOA 1VA4A 1O6GA 2PKYX 1OCEA 2BGNA 1Q0ZA 4LIPD 5AKLA 5CH5A 1DQYA 2J3DA 1L7RA 4HAIA 2QJRA 2QUAA 2V98A 2RONA 4P08A 4CIBA 1UXOA 1XZBA 1MT3A 5AIAA 3TGLA 3C43A 2XQIA 2XI4A 4QE3A 3HRHA 1ZICA 3R3UA 2Y6VA 1EI9A 1H2WA 4HVTA 4YK7A 2Z3ZA 3D0KA 4BAUA 2QVBA 1CUBA 2AJBA 5DTIA 1C4XA 3TEJA 2XQFA 1BN7A 2WJ3A 1HKHA 3WYDA 1W52X 3H1AA 1E89A 2BUBA 4QDOA 3I2HA 1MX5A 3EBLA 5ALTA 4GWLA 4NMWA 1EVQA 3FLAA 2B20A 2K2QB 3O4IA 5JYCA 2HADA 4F60A 5AIBA 1TCAA 5AKZA 2QMQA 1GPNA 4CCWA 1FJ2A 2IIVA 5FKJA 4B82A 2ZSHA 5ALIA 2BCEA 1MAHA 4PW0A 4Q1VA 1CUCA 5E4JA 5IVIA 3RLIA 3D5EA 1TCBA 1X70A 1CVLA 4J7AA 3WK5A 4RPCA 1N5RA 2XLCA 3QPAA 1ZD2P 4S0XA 4FHZA 1U8EA 4H7KA 2PSJA 3G0DA 4Q3OA 2XDWA 4X94A 4Y2TA 1P0MA 3W2TA 3DLTA 4B0PA 2GZSA 1NU8A 2XUOA 1EDEA 1LLFA 4B85A 2CMFA 5DNUA 4J0HA 3OPMA 4DGQA 3CN7A 1CUDA 4NZZA 3OURA 1WPRA 4FDMA 3K9BA 3WWCA 3C6BA 2QS9A 4E46A 5DNVA 4MXDA 4UHHA 1T2NA 2I3ZA 5D7BA 4ZWNA 4QZVA 2PU7A 3R3XA 1RYYA 1A8QA 3WK8A 4KAJA 3A2LA 1KU0A 4OSEA 4QDZA 1IMJA 2BUCA 2QZPA 4AO8A 1BRTA 2XT0A 4A16A 3WWOA 3IA2A 3WL6A 4Y2PA 4MJ3A 5AK4A 4X00A 3ANTA 5FUMA 4N5HX 1JMKC 2AJ8A 3SC2A 2WFMA 4DMKA 1FFEA 4DYHA 3M82A 2XUAA 3EQ8A 1WB6A 5AI6A 4WY5A 4IO0A 2XUFA 4CCYB 5JALA 1GQSA 3VISA 3HABA 4LXGA 3FOBA 3DYIA 4QDXA 3FSGD 1LBSA 3AIKA 3OG9A 1LPOA 1XQVA 1EXWA 3KWJA 3DNMA 3V48A 4L3WA 3UUEA 5IVKA 1XRRA 1YCDA 5ALOA 1DX4A 1CQWA 1CUSA 3FNBA 1CLEA 4C87A 4G4IA 4UFNA 1XZKA 4X6XA 4H7IA 5LZ8A 2WTMA 3HACA 5JARA 1U65A 4X92A 3H17A 4EY6A 4QWWA 1DU4A 1EHYA 1TQHA 3BWXA 5DJ5A 4C4YA 3G0CA 4B83A 5HZGA 3V1KA 4C89A 2WG0A 4ZXFA 2CB9A 4C4ZA 4MYSA 3WKAA 1MTZA 2WFLA 1QZ3A 4K6GA 1Y7IA 5A2GA 1ODTC 4J0IA 3R3WA 4FKBA 1QIDA 4UBNA 5LIPA 3ICVA 3H2GA 3ILSA 2XLBA 5AK6A 4ZREA 3GBSA 5JAPA 5AKYA 3E1GA 2X8BA 4UBMA 3LS2A 2QM0A 1XZEA 1MU0A 1CUGA 3EF3A 4AN0A 4U2CA 5SYNA 2C7BA 3ZV7A 2EEPA 1ZIYA 4BCBA 4KJXA 1DINA 2ZVDA 2WIDA 2WG1A 5K3FB 2O2GA 1ZI9A 5FOQA 4WFJA 2OCKA 2GYWA 4IH4A 5ALKA 2GBIA 3WLAA 5AI9A 2WG2A 3QPDA 1AGYA 4UHBA 2HA5A 3GELA 5C8VA 2PVSA 1QIIA 1PV1A 1QOZA 1LGYA 1QFMA 2PUJA 3C5WP 3VVLA 2Z3WA 1UOOA 1PJAA 4PSDA 5AI4A 2JGIA 1LPMA 5CURA 3WZMA 4F0JA 4L72A 4GECA 1EK1A 3WJ2A 2VJCA 2HA0A 4E14A 1H2ZA 1JJFA 5HFAA 4B81A 3KOOA 2P8SA 3O4JA 5JAHA 3QVMA 4ZGBA 4FMPA 3QH4A 3H0CA 3VJMA 1Z68A 5HKBA 5HK9A 3ESAA 4M0FA 5DLPA 2GBGA 2XQJA 4BC0A 5LKAA 3HEAA 1GKKA 1THGA 2YH2A 4W63A 4J3JA 2QUBA 2VEOA 2JGEA 3UUFA 5JAOA 1R4ZA 2ZSIA 3UMJA 3WK9A 1VE7A 3I2GA 1BS9A 4Q3LA 4KE6A 3HC7A 3WL5A 3D7RA 1EB8A 5T4FA 5ALVA 1IZ7A 5A6VA 1CR6A 1N5MA 4GLBA 4BAZA 3LIIA 5EIHA 3WMRA 3JWEA 1YB6A 1JT2A 5ALUA 1H2YA 4BVJA 2WIGA 3O95A 5ALYA 4K5QA 1UK6A 3QMWA 3STYA 1UKAA 1LPPA 4EY4A 1MNQA 1ZGCA 2Y2VA 4Q05A 1E3QA 5LZ4A 4UHEA 4UUQA 4LXHA 3GFFA 4KE7A 3IUNA 3KD2A 5AM2A 1WHTA 3BL8A 3PICA 2FUKA 1EDBA 5HF8A 4MQLA 5DTJA 1YSCA 3H2KA 2C58A 2PU5A 5CH3A 1XZIA 1F0PA 1CUZA 1BN6A 3STXA 2WQZA 3T52A 1J07A 5IKXA 1AQLA 4EY7A 1X2BA 2ZYHA 1Y37A 2JGKA 4E15A 1XZJA 1ZI6A 5D6OA 4JNCA 5AI0A 1MJ5A 2Y6UA 3W9BA 1E66A 3B3QA 4B6GA 4OYLA 5AKHA 3STUA 4Y2VA 1VOTA 1YAJA 2HRQA 2QJWA 4ZRDA 1J2EA 5JASA 2CBGA 1GQRA 3IURA 2HA2A 4RNCA 5AM0A 1RP1A 2HU5A 4BP8A 2VJAA 5I7UA 2HFKA 5ALMA 3I28A 1EX9A 1MAAA 2PUHA 3C45A 3DKRA 2AJDA 2D5LA 4AO7A 4GHWA 3A6ZA 2R8BA 2RAUA 4OYYA 3O9MA 5JD6A 5LLSA 1UT6A 3HZOA 4BC1A 3PI6A 1FFCA 3WL7A 2XMQA 3F98A 3RM3A 1SFRA 5FXMA 4C01A 3TRDA 4AO6A 2ZYIA 3QM1A 5DNWA 4UHCA 5HFNA 4ARAA 1QIKA 1CUEA 2XQKA 1XZHA 4Y2QA 1QE3A 1JU3A 3H2IA 2PSHA 4UBJA 3QZUA 4KRYA 3OTQA 5LP1A 3BE8A 4MWTA 2ONCA 5LYYA 3STWA 3VKFA 2XMGA 2JEZA 1QO9A 4JUIA 2DQZA 1ZD5A 2ZYRA 3BF8A 4C4XA 4NS4A 2PL5A 2C4HA 4CI9A 2WHPA 4WY8A 1XZDA 1A8UA 3F8SA 4U2BA 4FOLA 1CUFA 3T4UA 3I1IA 1EDDA 4DNPA 1E8MA 4A23A 4BE4A 1VLQA 3R3ZA 5ALEA 2DHEA 2PPLA 1G5FA 2W22A 4MYDA 2Z5GA 4LHEA 5ALNA 3LIPA 4Q34A 2B4KA 3PF9A 2J4FA 4UBOA 4YX9A 2Z8ZA 4FLEA 3KWFA 3GA7A 4G4JA 2JIDA 1Q0RA 5C7YA 3C5VA 3EQ7A 3LLCA 4HS9A 4ZV9A 4G4GA 4OCZA 5ESRA 4BYMA 3PE6A 2RGUA 2XMBA 4XVCA 1LPNA 5K3AA 1ZJ4A 3PFBA 3L1IA 3N0TA 4XIIA 3FCYA 1WPXA 3VJKA 4UBIA 3WL8A 3PUIA 1USWA 2DHCA 1ZD3A 2WKWA 1XKTA 3D2CA 1UK8A 2HA3A 4AXBA 1G4HA 4CIAA 1NX9A 5ALHA 2XUDA 4ZV7A 3AIMA 4P92A 1VXOA 3A2MA 3OC0A 3FLEA 2PX6A 3VXKA 4Z49A 3V1LA 1ORWA 3FYUA 4RGYA 3G9TA 4DSZA 3STVA 3K6KA 2ZYSA 4QDUA 3O4GA 5I9IA 3FYTA 2WFZA 1ETHA 1DWQA 2WIKA 1CV2A 4BZWA 3WKCA 4F21A 1H23A 2WUFA 3F97A 5A7GA 5HCUA 1ACJA 2WLSA 4Y2UA 3OM8A 1R3DA 1L7QA 5AOAA 1YS2X 3VVMA 4BTVA 3RK4A 3O4HA 4QDTA 3WKDA 2QKYA 2VATA 1K5PA 5HKAA 5ALRA 4KAAA 3CXUA 4RE5A 3G8YA 1HDEA 5HK8A 4W1SA 2FJPA 1BCRA 2B61A 2BUAA 4MWSA 1XRPA 1EVEA 5ALJA 1OXMA 2CEKA 1TIBA 2OGSA 3MGAA 3M83A 1TRHA 1MN6A 4BATA 4H7HA 5K3CA 1QGED 1VJ5A 2OCLA 3AIOA 2WJ6A 2OAGA 2VJDA 1TKRA 3WIOA 1F6WA 1KEZA 3IUJA 4B84A 4GXNA 1N8SA 1QIMA 3BDIA 4KACA 2WUGA 3WKBA 1AKNA 1MPXA 5FLKA 5IVDA 4WDQA 1FFDA 5CMLA 1QFSA 4W1QA 3WK4A 1WCYA 1LBTA 4XWGA 3O9VA 1H2XA 4DNOA 1AUOA 4ETWA 3LP5A 3FWHA 2WJ4A 2RHTA 4UFOA 3SK0A 2WM2A 3I6ZA 3C6XA 4G8DA 2HFJA 2DHDA 4DMHA 1CUJA 4I19A 5KREA 5EGNA 5HQ3A 3MVEA 3WYNA 3S8YA 3DCNA 4AMYA 3PDCA 1UOQA 2GYVA 3V1NA 1J06A 4W1RA 4DMCA 2UZ0A 5C81A 1DWOA 1CUIA 1K63A 2GZRA 4CG1A 2WSLA 2YASA 2ECFA 4BBZA 2Y2UA 2ACEA 2C5GA 3BIWA 2O2HA 1XLUA 5HF5A 5J3JA 4MEBA 4NVRA 3G9UA 2V97A 3AILA 4X6YA 4DNFA 5JAUA 1CUXA 3WQHA 2WIFA 5BV7A 2QXTA 1QONA 1SC9A 5AI8A 4U2GA 5JANA 4IHAA 3D2AA 2XUGA 3ANSA 5CT9A 2ZJFA 4KE9A 4EB0A 5AICA 5JZBA 1JMYA 4JEIA 4AZ0A 1W6RA 4YASA 1UK9A 4DSAA 5F4ZA 3WZLA 3FYUC 3D4LA 4EBBA 3H1BA 2OXEA 1IUPA 3DJYA 2WHPB 5KWJA 3D3NA 1SCQA 1RWQA 1W4LA 1M33A 5JADA 3WJ1A 3U0VA 3G02A 1E5TA 3R0VA 3WKEA 1K6EA 1VA5A 3ESBA 3JYHA 5ISMA 3FCXA 1TCCA 1GPKA 3FVRA 3LCRA 4KYVA 1JKMA 1XROA 3FVTA 4JH0A 1EINA 3HYSA 1XRMA 2VJBA 1XKLA 5HF9A 4BDTA 3WK6A 4IH1A 1AX9A 1QIEA 2HHAA 2E3JA 4QLOA 2DSNA 2XUPA 5DWDA 3I2IA 5DYWA 1LZLA 3I2FA 4OPMA 5IH7A 2V96A 3V1MA 1A7UA 4BAGA 2I3DA 1VKHA 4DIUA 1CUAA 2G5TA 2HA4A 1YA8A 1JU4A 4D9JA 2BKLA 2G5PA 3FYUB 1DTEA 1F8UA 2RI6A 2OGTA 1AURA 2GBFA 1OILA 4ITVA 4KEAA 2HA6A 2JGJA 1YA4A 4HTAA 1BE0A 4AQDA 2C0PA 3I6YA 1R1DA 2WUDA 5KWIA 4J0CA 4BB0A 1LZKA 1R9MA 1GZ7A 3FLBA 3R3VA 5JZ9A 1CUVA 4PSCA 3OOSA 3AZQA 4M0MA 4W9RA
chains in the Genus database with same CATH superfamily
4H7DA 2QQ5A 1T9GS 1CRLA 1NI4B 5GZ6A 4D98A 2VF2A 3QLJA 4BO7A 5LP6A 1PZMA 9GPBA 4NICA 4LRYA 1F3LA 1TJ3A 4DEVA 3BK1A 3TLGB 1H6DA 4F2PA 1O9BA 1FFAA 1Q92A 3A9TA 4X65B 2DPXA 2P65A 4X6LA 4YP6A 5F5XA 3H75A 1WLSA 3GXBA 3EZLA 3ICWA 4UVDA 5EGSA 1LF5A 3SYRA 2B94A 2BGMA 4JYZA 3EDCA 3GZNB 5K5EA 3EIOA 1BTOA 4PLFA 1Z4OA 4KXLA 1T15A 1CSEE 3RVNA 5JAMA 4NDNE 5AXCA 2NU6A 2IW3A 4JQYA 1B6SA 1X7WA 3G2JA 1L8QA 1TAQA 3K9FC 2OHHA 1FTNA 2VYFA 5BOVA 4URXR 1YB4A 5JSZB 1QNLA 4A8JC 5HOEA 3FUUA 3H3FA 3MWGA 4EY8A 1KQFA 4AY6A 4RTSA 2PUCA 5L3SA 4E2FA 2ETXA 1H3NA 4YJFB 3S7TA 1KOJA 2IUFA 2XVYA 4Y2YA 5GONF 2CMKA 4HRYA 2BFAA 4TQUS 3ST7A 1EA7A 4ZJYA 5B3KA 5C35A 4UMVA 1KRHA 3R74A 5DGIA 3JVEA 1K1EA 2GAJA 1SXJE 1DADA 2F9MA 3H5VA 3HCNA 2CZGA 1SQSA 4JP2A 4M89A 4Y2SA 5G3YA 3HJUA 1X9IA 1T13A 5AOBA 1ULUA 3QBJA 4HQ6A 4Q12A 2NW6A 3VHXB 1RZVA 2D4HA 4TTIA 4ENPA 1US8A 4LZOA 4M8KA 4QOJA 3STHA 2Y92A 1ECLA 4EABA 2YKGA 3DC7A 1MV8A 3U1TA 2J9FA 4M36A 4NCKA 3EOZA 3V9AA 2QW0X 4WADA 4KO8A 2VZ9A 2VCYA 3WGGA 1C29B 1JG1A 3F6CA 5JFTA 4KWIA 3OD5A 1S2NA 3FMIA 4MKFA 4GI3A 2PZMA 3AUKA 4U2FA 3V7UA 2L2QA 4N9WA 4ZODA 1CQJA 1SA0B 2R79A 2YXEA 2FA9A 5LLDA 2DLNA 4HYQA 5DKFA 4KQJA 3EVTA 3TPCA 5EI5A 3ORQA 1SM4A 5FTMA 4PF1A 2GK4A 4S1WA 1R4NA 4FI3F 4IMJB 5LIRA 2XZPA 2ZJ1A 3FYHA 4W82A 1SWVA 3ZU6A 1B8PA 1E7WA 3U31A 4B8WA 1W48A 4KH1A 1Q57A 1V3QE 1WCIA 2BTQA 1UBLS 4B4KA 1LSSA 3UJNA 1CEXA 3PDJA 4P58A 1XO1A 1NVEA 4JLWA 4X3CA 5LQKA 4AQYB 2XCLA 4CR7A 3KIPA 3K9LA 2OOKA 3SBOA 2FZ5A 2O14A 2WTEA 2IDKA 3ESDA 3FDFA 1BJTA 2EJVA 1I14A 3O9ZA 5EOVA 1UDCA 2ZJAA 4NU5A 1LLCA 4ZOLA 3IMEA 3ETGA 4PSAA 1Y3FE 4CDNA 2OAEA 1RZRA 2HDHA 4Z4QA 3NKFA 4EUEA 3ZY6A 1W2WB 2IOFA 3MSCA 2IKQA 4HYTA 1PI3A 2Q8NA 4PPYA 3RYIA 2Q62A 2Z1MA 4L51A 3KLOA 4MVJF 1D2AA 2GD0A 4X1IA 2V7TA 3DDZX 3PYXA 5EQFA 1GM5A 2O50A 3EIEA 1ZOIA 4YJ2F 3ZY5A 1ZK3A 4YCDA 4W5WA 5B6PA 2FEOA 2OCIA 2J09A 5JXJA 1JQJC 4RTQA 4I4IA 1FSFA 1EX7A 3O31A 4B7UA 1PR1A 1S6YA 1NRXA 4ZEXA 1MDBA 4ZQFA 2R44A 3N2GA 3MG9A 2DFDA 3D59A 3QHQA 4WKCA 5A0FA 3CE6A 4UEJA 3FPKA 3OO1A 3ZE2B 4BDSA 3MTQA 1GG9A 4OXXA 3NRJA 1U0LA 1CBUA 3ROXA 5SYMA 3KJQA 1UJ4A 1BDIA 2HIGA 4HJXA 1NTOA 3ZDRA 5TVKA 2O2IA 5C8ZA 1LV7A 3MILA 3CRNA 1EQ2A 1YHZA 5KOJB 3VKVA 1PNOA 4QTYA 1XD2A 3VFDA 3E5RA 3BSFA 1XZAA 3FW1A 1RM4A 1UKBA 3HKBA 3PQEA 5T4EA 3A6EA 3ROGA 4B4DA 1GYRA 1ZP6A 5JJBA 3AM1A 3BE4A 4IILA 4EBFA 2IHKA 4G5RA 4RGVA 3TNYA 3UBMA 4R1PA 1H85A 4JSRA 5BSFA 1H9CA 4B40A 3PXEA 2QAGB 3QFRA 3RUIA 3VZQA 4M7WA 4AULA 1P2FA 2VVTA 1UWCA 3NLLA 1DDIA 4OB7A 5GGXA 4DJDC 5JXWA 4HDMA 4K0KB 3H05A 4EEXA 2OG1A 3KPUA 3PB3A 4LJ7A 1T9CA 3V8NA 3ILXA 5BNZA 4Q9DA 4F46A 4XVQA 4R1QA 4PAGA 3KE8A 1ZU5A 3GIDA 1MB2A 4GE3A 1KZ6A 2Y68A 3NBUA 3E2IA 3RS0A 4KRXA 5BN4B 2JHPA 2OCGA 1Y5IA 5K0SA 3V4ZA 4EHBA 3DD5A 3NAMA 4TTJA 5LB4A 3CCBA 3ZKWB 2PBFA 5HIKA 1W44A 1AY0A 5LQAA 1GNPA 1P7ZA 3JALA 3QVSA 4KQIA 2H4ZA 4BOYA 5JNTA 3EVGA 4FFLA 2ZU0C 3WGVA 2NWQA 4BLVA 1MKYA 1NQVA 3EHDA 3N74A 4B3HA 1MD9A 1YL7A 3UKDA 1U02A 2AOWA 5IN4A 2O8BA 3FR7A 5CT8A 3CZ9A 2GK6A 4MS1B 3AUSA 4H7JA 1K8RA 5K3FA 1P75A 2QVZX 3WA6A 1BMFD 3G0GA 1QPGA 3OAAA 1LNZA 3DE7X 3E3MA 3ZZ0A 3SBDA 1W2HA 2IZ1A 3E3AA 2H5LA 1XXHE 2HA7A 4ZI7F 1PWYE 1BXZA 2G4LA 2TMKA 4PXAA 1CUYA 3ZLJA 1QO7A 4GVPA 2OBLA 2J6HA 3BJEA 5FBVB 4J7CA 5LWQA 3RSZA 2P2SA 1Y8RB 3ZY2A 3OZBA 3V3TA 3EBPA 3S0JA 3SYKA 1V0JA 2O0JA 3FAKA 2G63A 4RNDB 3V8VA 2GI4A 3PS9A 5ALWA 3W6ZA 2RHRA 1M7BA 4ND5A 4DMRA 1DMRA 1ML3A 1BOFA 2OHXA 3OEHD 2ZRJA 5BT9A 1LC3A 3I62A 4G4SO 3LHKA 4UJ3A 2E5WA 4KGVA 1Y9EA 2J0VA 4XLZA 2YY7A 3F7MA 1QM5A 4WXMA 1WY7A 4Y0AA 2DBRA 2J7PA 3GAAA 1P0IA 1BVRA 2WT9A 1VFNA 2C5SA 2MDTA 3HZHA 5GONA 4CNQA 4QD3A 1OHHD 2B5VA 4I9HA 2O5EA 1S4MA 2IBMA 1XOIA 3E03A 3TW6A 1TK9A 1GGHA 4D56A 5M5BA 1PFYA 2FN7A 3G6KA 4JYBA 2ZUDA 4Q66C 2ZRHA 4ZQGA 5EMHA 4CWAA 4C6RA 2QRGA 3CCCA 4C0KA 1KFEB 2YBEA 4DN6A 3MS7A 4QBKA 3G8BA 4B3MB 5K8TA 1P1HA 4X24A 1X3SA 2D13A 1C1DA 2AI2A 1KDPA 4OU5A 4O2AB 5KNDA 1E7MA 4P9NA 5ICGA 4PSVA 1NYLA 1YFKA 1M7HA 4TRRA 5DSZA 1B1CA 3IVMA 1OJ7A 2E4ZA 1NV8A 3RPEA 2W6PA 2ZB8A 5JBIA 1NYRA 1QCCA 2V6GA 2VPQA 4KWHA 1KY5A 4O4IB 1JPUA 4OQFA 3QUBA 4DLZA 1YZLA 3W79A 5BRJA 1O87A 5FPQA 2IU6A 4JSTA 3JQBA 1LW7A 2E4XA 3O4FA 3QEMA 1A9RA 4YMVA 2Q2VA 3C3XA 4AICA 2AXPA 2HRRA 3AJ8A 3E4DA 3QQ5A 1G5RA 3ADPA 4AM8A 4ND1A 3T3PB 2YRXA 4G9GA 1NP3A 2RI1A 5CA1B 1Z75A 4MGHA 5AW2A 2AOVA 3MHTA 3BF7A 3A28A 3IVCA 4MAAA 3QXXA 3DYVA 5AJXA 4L16A 1TAUA 4Z4IA 1MC1A 2VBFA 4QXQA 2DWUA 2BGIA 3HWSA 2DBQA 4ZO9A 1UJ2A 2CXPA 4K0RA 4GM1A 2FLVA 3N59A 3PGJA 3R0QA 5CEJA 5CLJA 1M34B 2GARA 5JJLA 4M0PA 5BOSA 4JI6B 2BKXA 1G16A 1JN0A 3AW8A 3L1HA 2JPDA 3K9NA 3GLFB 1J97A 3BK2A 1LX7A 3ITDA 4PM4A 5SY4A 4V0MA 4OBWA 4B5KA 3O7WA 3U16A 1TF5A 2ID9A 3HBLA 4FHDA 2Q0QA 3MT9A 3RRNA 2Q6TA 2AN5A 1FFHA 5JS2A 1TYEB 3AG6A 4JXZA 2FJ0A 3V9PA 1W96A 2ZI5A 1IQ0A 5B1EA 4G0UA 4RZQA 3VR2A 4IQ4A 4N8DA 1E2DA 3TZQA 4ZFNA 1D3AA 1VPEA 2WJGA 1IPHA 4YJ2A 2CMHA 2X0IA 5A9TA 4Q7EA 2XYQA 1TJPB 4ID3A 4QTTB 3C74A 3SZ3A 4FUTA 2CZQA 4NG5A 5HBGA 3VJLA 2AS0A 4RTMA 1I7DA 3ERCA 4YAEA 1XQYA 1G3QA 2YHIB 3EIHA 4GYYA 4BUCA 4FFDA 1GTZA 1M3SA 2HXGA 1DARA 3LPDA 4PBRA 4IZIA 5LNK1 1WUTA 1PLKA 1Z5GA 2QLTA 3CWCA 3ED5A 4FBGA 4HDRA 1MJHA 6YASA 2EHDA 4LDNA 4M87A 4CYMA 4RQBA 1AQ6A 2OOSA 4YRKA 4JQSA 4HAUA 4EVIA 4KG7A 1C4KA 1IN6A 1E3LA 1TE2A 1KI9A 1YZGA 4N3GA 2UYHA 3ZI7A 1VCHA 3HB4X 1TO1E 4CKWB 5C1BA 1YB7A 2YFHA 2ZIGA 1LF0A 2XHEA 1OLXA 4PLZA 5I8ZA 2B2XA 1U9CA 2OBFA 3ODGA 4TX1A 3ZUPA 4B5LA 3KSBC 3IBTA 3RD5A 4GRAA 4BZZA 3LUHA 1D0IA 5LJLA 2GCIA 1DAHA 2QY9A 1R6AA 4ZQEA 2LZ0A 4MRPA 2FN8A 2FR1A 1BX3A 1MQSA 1W88A 3W6OA 5LUAA 3WMXA 3RVQA 3ZWBA 2Q2WA 3G0OA 3NTXA 3R9XB 1TAHA 2XWQA 4C0JA 3BVPA 4MWZA 4XYGA 5DX8A 2CSUA 1BJKA 2VHCA 3TQQA 2JRCA 5IJ9A 5IJWA 4W99A 1PU2A 3HYLA 2OBNA 5ALXA 2ZYUX 2DWQA 4E33A 1YDHA 2RGEA 4KVZA 1Z47A 1ZK0A 4MYHA 2IY9A 1XVUA 3TH5A 5AESA 1Z6GA 4DTCA 3AY6A 4KO2S 3GLGB 3C4JA 2XZDA 4YVFA 1JZSA 2DTDA 3BHMA 1BKYA 1V8ZA 2HREA 2K4MA 5CXUA 1IC6A 4OQYA 2MSNA 5DMXA 2J9XB 3GROA 3IUEA 4GRIA 4K6FA 4R1OA 3RTEA 1N5LA 2AN4A 2ON6A 4JUDX 3A1DA 3NM4A 4LK3A 1QKIA 4R2JA 5H9VA 3V42A 1XEWX 5EZ6B 4ZI7A 4H9GA 1NQXA 4QVKA 3LA6A 1F48A 1O03A 3SJBA 3KJNA 1HT2E 5E1MA 2QP4A 1JB1A 4U8HA 3LHIA 2QN2A 3K1JA 4JLBA 4D6YA 4YY3B 1XTVA 3BRWA 3SI7A 1MVOA 1JHQA 4MWGA 4NARA 4URWR 3UGKA 1RKBA 3O84A 4JNKA 4ZT5A 4BRSA 1SIBE 3LLMA 3ZV4A 2KHZA 3ZBTA 3ZDBA 3HZZA 3PBKA 4GW3A 4X95A 1G8HA 2VSQA 1O95C 3C70A 1PR2A 2XECA 4TVKA 4US2R 4BE9A 1KI6B 5DYTA 3FZGA 2WWYA 2A5JA 3BIOA 4OLFA 3HP7A 3GVIA 4MI1A 2NSLA 4RLHA 3I2YX 4MGKR 2IHBA 4OMFG 3VI3B 1RM0A 2RGNA 4BVAA 2AEMA 4YMGA 3KM0A 3WRYC 4E5YA 3KFLA 3PC4A 2XUQA 2VQSA 5KTYA 1XNRB 2XTMA 3LGAA 1DIOB 1GRNA 1VZ2A 1EXMA 4QC2A 3ZE6A 1LQUA 3ZXSA 4AN4A 4UBKA 5KNCA 5B5SA 1Y4ZA 3C3MA 5IH3A 4MDFA 1F1JA 2FW1A 3TCKA 2WJYA 2W7TA 3T94A 5ANRB 1M6EX 1E2GA 2J3LA 1JQAA 1WHSA 3OEYA 4FJ2A 4HN2A 4KXMA 5BNFA 1HDIA 5CHEA 3U7FB 1NW9B 4RU1A 1A5ZA 1XZLA 1YL5A 2WU4A 3FNGA 3HB0A 2WW8A 4UKDA 4AS3A 4CF5A 2UXBB 1X1BA 3LT4A 3MCVA 5J1SB 2WJVA 3T4XA 4WIAA 4WXYB 3ABQB 3E9EA 2QR5A 3EVNA 3LHSA 3CRRA 4CEJB 1VE3A 4HRXA 4H7EA 16PKA 1E7RA 2G82A 3RF7A 5FV4A 1D7AA 1VZ3A 3GEBA 1PEAA 3LGSA 1BQ4A 5E3IA 4AECA 2X6RA 2AEFA 1ORVA 4BLOA 1L7MA 2HUPA 5DM1A 3L0SA 5K4AA 4B7ZA 1M2OA 1Z82A 1ZO8A 1G38A 3NHFA 3T3HA 2B7CA 4I5EA 4TGLA 4I6GA 5JBNA 3L93A 4RHXA 4AI6A 1G17A 1B3BA 1KS2A 5K45A 3IQHX 1J5EB 3NYRA 2XIJA 2O7RA 3IEKA 4N41A 4F2GA 3KUCA 4P6VF 3F7TA 3QWFA 4CG3A 4E94A 3LSYA 3R2JA 4B3XA 1REQB 2J08A 3BD9A 3KT0A 3VPDA 2HDOA 3MXOA 5AFSA 1CPYA 3GGGA 1OV6A 4FKMA 4PLTA 2C2HA 3Q3EA 2JHAA 2RBKA 3P2JA 2MMGA 1VJ0A 4CPDA 1TLFA 3HBFA 3R9IA 2YXNA 1NDHA 3OPVA 3MINB 4DC9A 1RRMA 1H5UA 1TQ4A 2FPXA 1GU1A 3CGWA 3HU2A 2DFPA 3E82A 3PGA1 3PQCA 4YP7A 3GMDA 2E1RA 1P7PA 3UPUA 3CZ5A 3OP4A 13PKA 1KJIA 3AUYA 3K92A 2PX0A 3REGA 4B80A 4CL8A 1QRTA 1EFCA 4OYHA 3HGTA 3EF0A 3MT0A 1BS2A 2XYRA 2J9YB 4HLNA 5EXEA 3W77A 1AQNA 1CW2B 2ETVA 1YQUA 2H65A 4OI1A 2RGXA 2FB9A 3I2KA 3TKLA 1ZJ5A 4GPD1 1BH2A 1OPXA 3WIDA 3WK7A 2QAIA 4H1HA 1EXNA 4YAIA 1G3UA 1QOQB 1ZX1A 5DGXA 1FVFA 2WAMA 1U7DA 1UMDB 1L2TA 2CZCA 1CU1A 2I80A 1TM7E 3CE9A 1ECJA 4BNGA 4HRVA 2P2YA 2O0HA 1KORA 2WV7A 3GDFA 1WM1A 2E5FA 5BN5B 5C4MA 4R31A 1BIFA 3HO1A 1D0VA 2GPYA 2G83A 1EPUA 1Y4DE 2Y8EA 2O3UA 3HCAA 1XXHB 2GEVA 3LD9A 2H8KA 2V9ZA 4DABA 4EZBA 4GUDA 2AN1A 2EJUA 2J8ZA 1AUXA 4FK8A 4L15A 5FPTA 4DLLA 4ZDJA 4BV8A 2GX6A 3FG9A 4OQXA 1CY8A 1IHYA 4BNDB 3G8AA 3WI7A 1T9BA 4GVXA 3DOUA 1ODKA 2C2BA 1GU0A 2PE5A 4YIHA 4BFVA 1L8OA 1XZMA 2B21A 3OQMA 4MRMB 4KX5A 4X3OA 2HWWA 5HG0A 5IWCA 4D8WA 3WIVA 5ENVA 2PMEA 3ROFA 3IULA 4R83A 4TWIA 5JJKA 1U5AA 3IRVA 4EVRA 5KYWA 5DV9A 1LTQA 2DKFA 2Y1WA 1AMUA 1GZ3A 4EI9A 3SLGA 3VTZA 1GXSA 3CG0A 2CHUA 2OESA 3ZGZA 2P4HX 1I7PA 3WSWA 3GUHA 4A2QA 2CDAA 5TPWA 3W4IA 4LG1A 1YTUA 3QLVC 3U7QA 1AIPA 4IVNA 2F8MA 2L82A 3M3DA 2SECE 1N7JA 5JTTA 2X2OA 3O8DA 1T5DX 5GY7A 3PF8A 1FUYB 3CT4A 1B8VA 1G5TA 4Z4HA 5CDYA 4BRZA 3V4RA 1IBKB 5F7OA 4FR0A 4MYRA 2AQIA 1KMNA 1DVRA 3U44A 5G0SA 3IQWA 2ONYA 5JNSA 1KVQA 3A4TA 3BKXA 3ESRA 1EE1A 2Z08A 1HBJA 3L8ZA 2JIQA 2P35A 3K2BA 1E8NA 1C3JA 4QREA 2PKEA 3PXGA 4QECA 3LDUA 1DT5A 1JBKA 3Q7IA 2JA1A 1NNUA 5CIWA 3ITNA 5G3ZA 4FFPA 4FLFA 4YAFA 5DP1A 4DNXA 3T7EA 3VU9B 2EKPA 4LZJA 4R41A 5KBYA 2MSLA 3EVCA 1KFJB 3ACBA 1TQ8A 4O0LA 3GOHA 3RC9A 3SX4A 4A9AA 2B6HA 2XYVA 4NJEA 1KQOA 2PS9A 1E79D 2AJCA 1ZCFA 4AJOA 1U0OC 3DQZA 3LNTA 1AGPA 1K7YA 3UT0A 1AS2A 2GKOA 4Q4AA 3GA0A 4QFBA 5KCMA 3DXYA 1OXBB 4JJKA 4YDRA 4IIYA 3AR5A 4ZVOA 1J9ZA 2YV2A 3CNHA 3BJZA 1URPA 2ET6A 2IS4A 1RQPA 2WWTA 1L5HB 2D3WA 3K5IA 2R6DA 3RCBA 4L7VA 1O9GA 4E30A 1TW2A 3IOCA 3OQVA 4YACA 3SBXA 3AJAA 1EDOA 5JCJD 4FFSA 5JC1A 5IAOA 1M2WA 2R5FA 5FPKA 5JY6A 1X2EA 3WHPA 1DIAA 4WV3A 3VHRA 3K70C 1Y6GA 1YZHA 2EP7A 2UUBB 1AZSC 2VK4A 2Z5FA 1CJSA 1JPJA 4GBGA 2PUGA 3AR3A 4LZPA 3TZLA 5KQSA 1YR2A 2C20A 1IHUA 1KVRA 1E9EA 4UNRA 1LNSA 1QTRA 3HYRA 5HE8A 1QVWA 1PQUA 1YBAA 1JDUA 4JVLA 4B33A 1G18A 5BSEA 3KXLA 3DWGA 1R7RA 3UJPA 2B0CA 3VOTA 4EA6A 3PTAA 3NZEA 3ZI0A 2GYYA 3ZWPA 3ROQA 3UO8B 1PK9A 2ZQZA 4N3BA 1XWIA 4AP9A 1G63A 1JEEA 1T5TA 3PD0A 4EY3A 1SZDA 8OHMA 2I2FA 2FMHA 3W8EA 5EIFA 2XCTB 3LKBA 2GEKA 3RSGA 5CA0B 5CBKA 3ZTYA 1BXGB 3HKDB 1KYIA 5EPOA 3VH2A 1J90A 1H94A 3T5AA 4FTWA 4HQNA 4KDFA 1E4OA 1PL0A 3UJ7A 1NLUA 4HB0A 2DXIA 1WY5A 3OFJA 4RK0A 2GCNA 1W1WA 4PYOA 1FDRA 4UHJA 1ZVQA 1XZGA 1R0LA 1O94D 1HG1A 1P0PA 2GFHA 3G7SA 4RA6A 4WE3A 3L6CA 3TVTA 3TXXA 1YQGA 2Q5CA 5A71A 4GX5A 4HXFB 2P6OA 1O0BA 5HX7A 1S3GA 2FW8A 3SHFA 4S1NA 5E1DA 4UDXX 3RBVA 3EHEA 4FYJA 5EVCA 1FFSA 4M1OA 4RFSB 1UEIA 4P5DA 5EP1A 2CKDA 1SUDA 5F5LA 2FOXA 3DQQA 4NI5A 1ECCA 4DIDA 4RL6A 3FHLA 2OP0A 2FX3A 1A2QA 2H9YA 2AW3A 2E85A 3DV0A 3D6HA 3E7XA 1F8YA 3ONWA 4HGOA 3OPXA 2VAWA 4KNVA 1UAGA 1C0EA 4MB2A 3ZIUA 2X76A 4IYJA 3SS8A 2X2EA 2J4DA 3CZRA 1RAFA 3IFSA 4XYMA 3GLQA 2HD4A 4E2ZA 4I99A 2UXDB 4Z9XA 1Z4PX 4LFAB 2AE1A 2GN6A 3DOIA 2IV7A 5IK2D 1J09A 2H5IA 2X2FA 1Z28A 1A76A 2JBWA 3H5WA 4YCMA 3TUJC 1I24A 3U5TA 1ORDA 1RD4A 5CCXA 1ND5A 5M34A 3AVWA 1RHQA 3N2KA 4H77A 2JNWA 3KZKA 2C9YA 3ONEA 5CW2A 3WLKX 1A1VA 4BV9A 3ZJ5A 4LW8A 2GCOA 4LC9A 1FFBA 1M66A 1VM6A 4MCIA 3WS7A 5JZMA 4MICA 3AQIA 2J48A 1CEYA 1IXYA 5DRTA 4JBLA 2XUIA 1GAJA 2LCQA 3MZ0A 3WGZA 5K2OA 1L4YA 3H83A 1SXJA 2VT3A 1YAHA 3BE6A 4U6SA 1JEQA 2GN2A 2Y1OA 4FX2A 5EXPA 3S2ZA 2CXSA 4XYLA 5JZSA 5L9AA 2GRJA 4ZD6A 3C8UA 3I39X 1L6IA 2NN3C 3FSRA 4Q7JB 5EIAA 5BQ5A 3AQ4A 5FX2A 1RU3A 2BZ1A 3OM9A 3SOZA 2J5BA 4EF6A 2YNMA 3GPBA 3DB2A 4AVYA 2VJMA 4UEKA 3K0EA 4RVSA 2X2PA 1K88A 1UQRA 4NQZA 5KNBH 3JU3A 4C88A 1G59A 1IIBA 5LQMA 3SM3A 3T3DA 3PJEA 4DV4B 1J0DA 2PUAA 3WA7A 2IZZA 2WWHA 1NZJA 4XR4A 1C3LA 3WGUA 4EUNA 1W8DA 3HEBA 4WZBB 3RVDA 5C3MA 3PQ7A 2XB6A 4YMWA 3G23A 1LY1A 3SJUA 3HCPA 1AB5A 1V5EA 3C7TA 3ORSA 4NKRA 5JATA 2R6HA 1E92A 4C5CA 4JI8B 1RJGA 3CLSD 2P11A 2YMQA 2D1SA 5D2CA 1S2LA 5LFAA 1J1IA 1RR6A 5DN6A 4OO3A 2C1ZA 1QHHB 4E22A 1B26A 4YROA 2VSFA 2Y93A 4I8DA 5ALDA 2V45A 2WHRA 1QS0B 4QNNA 3X1DA 4GOXA 4FONA 4BQOA 2VQFB 1PV4A 4V2UA 5DBFA 3EGXA 2Y1KA 1XLTC 1H93A 2PD6A 2YW9A 4LDQA 3DWEX 4B3SB 2Q3FA 3MD0A 3D4BA 3W7AA 3R20A 1MMFB 2Q50A 3AEKA 1VL5A 1Y9DA 3I1FA 3LQFA 2IPNA 1RVV1 1LNQA 1ML4A 1XN4A 2M1ZA 1FP4B 3DUFA 3PL1A 4LV5B 3DF7A 1KOFA 3JY6A 4AKHA 1VMKA 5JVDB 3BORA 1KZ9A 1GCGA 1CJUC 4B8ZA 5F3WB 1TEVA 3AERA 5E8RA 2ZR9A 3EZ9A 2W6OA 4R98A 2HU8A 4MULA 3H18A 1OI7A 1FUEA 3SYLA 1KARA 3RJMA 4D4KA 3SKVA 5KC9A 3WQQA 2VHJA 1XFAA 1W4ZA 2I29A 4BO3A 5BVHA 2BH2A 1OREA 3CEAA 2R1UA 2OO7A 2JIOA 4MWOA 1OE0A 1TO6A 3O8QB 2WYVA 3P2EA 5KVSA 4R05A 1C9YA 1MORA 1XEFA 4O08A 2JDIA 4ARBA 1C5KA 4DJ5X 1ODCA 3TPZA 2X5NA 3OZWA 2B8TA 4AZ0B 1GL9B 1JHVA 2A88A 5AVWA 5DEOA 5FTKA 3NTOA 4EJ6A 2WWRA 4CKYA 2RJ3A 3DDOA 2XT6A 1SB8A 3ZVLA 1ZZEA 3HRIA 5HKKA 1V41E 3OFVA 1G5PA 1YS9A 4PV7A 1ENOA 5C51B 4A73A 1EFVA 1UJ5A 3LPNA 4IDFA 5DYYA 3SICE 2AYZA 1B23P 4LKOA 3UIEA 2PGDA 1YI0A 2PKYX 2EBWA 3NU1A 2SKDA 2BGNA 1MQAA 4H3SA 3MLBA 4QVGA 3E53A 2R6JA 2NLOA 2Q6KA 2VDOB 4LX8A 4MVXA 4YI5A 2IYTA 2MINB 1NBOA 2P69A 3VV3A 1DQYA 1U0JA 4BGUA 4TTSA 1L7RA 4M1SA 3SJAA 4JBHA 4H1UA 2P5UA 1N3YA 4HAIA 3PITA 1B93A 1N0HA 4TVBA 5AUQA 3GLIE 1WBBA 1XR3A 4EB6A 4JUAA 2OAQ1 3GOQA 5TQJA 1HFKA 1Z17A 3IV7A 4ZOBA 1NQWA 4XYEA 1PTJC 4C7XA 4E5SA 2VH2A 3KR9A 4G9BA 5D7NA 3R3JA 3U3ZA 4CLHA 2WDPA 2NT3A 3NQ41 4RF4A 3AXSA 3GLKA 5K1ZA 3C43A 1HNNA 2G88A 5IRCD 2XI4A 2XGMA 3HRHA 3EGCA 4FD3A 3GDOA 4RY9A 1PZEA 4WEQA 5MN5A 3S2EA 1QE0A 3MTBA 3T7TA 1AMOA 5HHTA 4KLZA 2FE4A 2A9PA 1DLJA 1NWCA 4IXTA 3FYSA 5KHOC 3QLUC 5ARCA 4C78A 5JFGA 3VSAA 3AX6A 1G8KA 1LXCA 3NBAA 4RDHA 3HHEA 4RY0A 4WLVA 1MG5A 2GLTA 2Z3ZA 1X1QA 4RWEA 4ENUA 2MJLA 2LNDA 2IP1A 3ILVA 4KN5A 4D81A 4XWWA 5JUWA 1YACA 3IQEA 5JNRA 3M5PA 5EKXA 1COWA 2QX8A 1E1RA 5DTIA 3V32A 1SQ0A 4WY2A 4X5OA 2NU9B 1JR3E 3TDMA 3BKWA 1MGPA 4A0QA 1JR6A 1HZJA 1HKHA 2HT6A 5HE9A 4OTZA 3R6DA 3QNWA 3WMFA 4KREA 2IP4A 1E96A 3AY0A 3HKEA 3LOUA 1JSZA 3HHPA 4ZCPA 4N47A 2P6RA 4Z4EA 2J5RA 5I48A 1Z0IA 2NUAA 5L40A 5ITWA 1Y7TA 2Y27A 1T6XA 1NFRA 2BUBA 3E4CA 3OY2A 3C4QA 4X62B 1I36A 4Y2GA 1TT7A 4EX7A 2FHSA 3N86A 5ALTA 3ZWYA 2JKZA 3HB5X 3TSWA 1KZ7B 2HQSA 3ZQUA 3U9TA 3GMSA 1WVGA 3OH8A 3FLAA 4HAZA 4F93B 2ENWA 2PS1A 4HEHA 2K2QB 1R8JA 4YRPA 2PYDA 5JXHA 1EQAA 5I7VA 2RMKA 1UT5A 1C7ZA 4M54A 2V7QA 1EFPB 5AIBA 5DCUA 1IVSA 3GJ5A 4B3DA 1ST3A 3OVMA 1PUXA 3CZPA 4A10A 4I1OA 3C39A 1Y9ZA 4F06A 2IIVA 5FKJA 2AYYA 2JH9A 4IIVA 3TSZA 4G2TA 4B82A 5JS1A 4C06A 3IUSA 1GDDA 4LPKA 5EJ8A 2APJA 1G0NA 3NIFB 4L0MA 4Z1MD 2PD4A 3MRTA 1RAGA 2B69A 4LOJA 1R4MB 4Q1VA 3TZKA 3VC1A 1P61B 1VMEA 2QLFA 4ND4A 3T8YA 5B4UA 2ZXUA 2I4LA 3K4QA 3UOWA 5K0CA 4EPTA 1TTHA 3PSAA 5IVIA 3D5EA 2Z4RA 3OZCA 4PONA 3JAKA 3LDFA 4KDCA 1TCBA 5H1YA 1U2PA 4YP0A 2EHJA 1CVLA 5BR8B 2QGZA 1PT9A 2CJWA 1Z7YA 1F4LA 3LDGA 4REQA 1EUDA 1N5RA 4RPCA 3WK5A 2QRPA 4F6RA 1C0LA 4OXRA 3ETDA 4MKZA 4W5QA 1JQLB 3EAFA 4S0XA 1YFJA 3GNSA 3IQDB 5B12A 2PSJA 2P4QA 4AJNA 3G0DA 3SZOA 3ANXA 3AHJA 2FMXA 3MWJA 3DLTA 4QSMA 3EW9A 2GZSA 4RMNA 3IH5A 4WERA 5G4LA 3HG7A 1PGPA 2NP7A 2WWIA 4Z3KA 5IG2A 2FMIA 3R0JA 2YUTA 4IKPA 4R8MA 3RSSA 2C3PA 4R68A 4B85A 2CMFA 4JIGA 4X84A 4CUKA 1V16B 3WO0A 2IXFA 2EFGA 5IZCA 2DP4E 2PR2A 1N5KA 1XAHA 3LUJA 3CNQS 4RZHA 3MMPA 2AOXA 1CRZA 1UINA 3AGQA 3REOA 1C0PA 4L5YA 2VDKB 3KVRA 1TU4A 1R5BA 3C15C 3OQBA 3OURA 4S2UA 4C3OB 1EUCB 3EQ2A 1WPRA 1H8HA 1R0KA 2BRUA 3HSYA 1WW8A 3FHOA 1Y1SA 2YICA 3D3JA 4FDMA 4CLRB 2EGGA 4R1SA 4XRGA 1JLSA 1SC6A 4JUFA 1MAWA 3EF1A 1Z8HA 4DLVA 1Z83A 2OHJA 2ZRLA 2PZGA 3DO5A 3G88A 2QTCA 3HP4A 1UADA 3Q5GA 3GFBA 3PEWA 3RUHA 2P67A 3DM9B 5FWDA 3BCSA 4TKMA 3LQ1A 5DNVA 2HTFA 1U2RA 1AQYA 3HBAA 4C05A 5C2JB 2R7AA 2QZ9A 1RYZA 3KUXA 4ZWNA 4R3NA 5CM2Z 3FHJA 4ARIA 2PU7A 3R3XA 1NLMA 3FTNA 4KAJA 4L0QA 4WCDA 4LY6A 3DW1X 3GLVA 1QOPB 1LQTA 1MPTA 3HXPA 2C4NA 1DAKA 2FZWA 3PPYA 4PEVA 4YP5A 1RE1A 2G1UA 1H66A 1TL7C 1C4OA 3QG5A 2BUCA 2IHTA 1R6VA 5BNWA 1JLHA 3IC5A 2R1VA 3KPVA 1Z4KA 3LC7O 1HE5A 3D6VA 4ILEA 1HX7A 2UVPB 1U0FA 3ASZA 3H9QA 2R3SA 3AKYA 3HO6A 3O8OA 2FZEA 3UPDA 3WL6A 1YA6A 2H92A 4L8WB 1XF1A 4DZZA 4IRMA 4ER0A 1T3HA 5A06A 2WK1A 4ZP1A 3OX4A 1KL7A 4OL9A 4ZVVA 1U81A 3OUTA 5FUMA 3NTLA 3SFVA 4A3SA 3FGNA 3FZYA 4QQ8A 1EBFA 1QP8A 5HM8A 2AJ8A 3O1IC 1IM8A 3IVRA 3I42A 1PJLA 2JGDA 4ER5A 2WFMA 1MABB 3H4IA 4XGIA 4MTLA 5CP8A 4OMCA 4ZC8A 3VR4H 4BN5A 4N0MA 5C7LO 2XUAA 3EQ8A 4KPFC 2CYBA 2WAOA 7ADHA 3HYCA 1XVTA 1SKAA 1G4UR 2ODQA 3QW4B 4HWPA 3ZEIA 4CCYB 3BT7A 4WLNA 3FKSA 1QH1B 1VG8A 2CL5A 2E82A 5JMWA 2G07A 3LTNC 5A0TA 1YOVA 2F64A 3DMNA 2X5JO 4WK2B 1R10A 5JH7F 4DA9A 3DYIA 3H11B 1UKEA 5ARDA 3OG9A 3JWIA 1PJTA 2P5SA 4RXMA 2OV4A 1YJQA 1G9XA 4NIMA 4BE7B 3DNMA 3TG8A 4MK4A 1XNHA 2HPZA 3KFVA 3M1AA 4Y2HA 1OLSA 1U1FA 1IOZA 2V3VA 3PRHA 4FHFA 2QRKA 1K0UA 1IWPB 2J45A 3DHEA 2WLTA 3DL0A 3UUEA 1XMPA 3CVJA 2ZIUB 1NSFA 2PO7A 2ZJOA 3QVLA 4PX3A 3FVVA 4I50F 4TQGA 3WBKA 1GG5A 1XEXA 1II8B 1U7PA 3FETA 3W3AA 5T3UA 2WVAA 4DADA 2WPDD 1R0XA 1KETA 2IKSA 5CB6A 3RB8A 3LCUA 4IQ8A 3EDYA 3VZPA 4K3UA 5AJVB 2WNHA 1V1MB 4XUDA 4Z5XA 2BEUA 1CTQA 4NNOA 4OKNA 3WGYA 3U39A 2GQ0A 1U65A 4X8MA 3SE0A 5F51A 2ZSDA 1VGRA 2YVLA 3KQVA 1G9SA 5J23A 2L69A 3HTXA 3E8MA 4U3JA 3R09A 3WOHA 1GL7A 1DU4A 2A0UA 3EA0A 3G2NA 1XDBA 3U09A 1VCNA 1KEUA 5DH9A 4C89A 2YW2A 3K8QA 3JQCA 4LJLA 2JD0A 1CVIA 1XMXA 3BAZA 4JC8A 4L5IA 4L28A 3EEBA 2C97A 4LV6A 3QU5A 4ZXFA 1KH2A 2CB9A 1EWYA 1ZCJA 1SKYB 2A4MA 3N0RA 4JHXA 3AJRA 4Y6OA 4YCNA 5E6SA 2WFLA 1QZ3A 2XYGA 4TXHA 3HUEA 3CLRC 1OY1A 5A2GA 5F2OA 1BHJA 3DXFA 3R3WA 2BI4A 2XDAA 3KO8A 4URHA 5GGYA 4YREA 2Q2OA 5ITSA 3JARB 3F6PA 4QTXA 3DD1A 4G84A 2PMFA 3VTAA 5IFKA 3K1AA 2OV2A 5LIPA 2HSGA 4MRAA 4LXXA 2QG6A 3EGDA 3MFQA 3CFYA 4J1QA 4ZREA 1QLHA 3K1ZA 4FI3C 4YAGA 1NN0A 3KQKA 4QQRA 1GKIA 1QRDA 1X77A 4NV0A 3WLHA 1NBMD 3OZUA 3ZD7A 3G2MA 2W2LD 2WVGA 5FJIA 4IKEA 1NQUA 1XTTA 3EDMA 2JH3A 1UBJS 3ZZ1A 2R47A 1EM8B 1M2FA 4J29A 4AN0A 4MWEA 1RTTA 4ZZ2A 1IN7A 5SYNA 2QI9F 5HILA 4D9MA 3S27A 4FOOA 2WYIA 4IMIB 1Y1PA 3UXYA 1DJLA 1UBTS 4JCOA 3KVNA 4C2AA 4CM8A 3PC3A 4OQDA 2ZVDA 3OFNA 1TCVA 2R6GA 2H08A 3JQEA 2NG1A 4IYRA 2OYRA 3BB3A 2GA9A 1Q1AA 3W9SA 3A1TA 1JHUA 3I9KA 2P2DA 5KYYB 3VX3A 1B0UA 5CTJA 5LXTF 5FOQA 5IABA 1O6BA 4JFAA 2IYSA 4QUIA 1XWFA 2LP4Y 1AGXA 1GPDG 4IH4A 4RSRA 4WNYA 5ALKA 5IULC 2QTTA 4YJ3B 2GBIA 2JLSA 3WLAA 5AI9A 4BMSA 2OCXA 2ZIXA 1PCXA 1ZISA 1D2RA 2A0YA 1AGYA 1OW3B 2ACWA 2BKUA 2QMUA 3AHDA 3GELA 4MLPA 4RL4A 4Y9RA 5TB5A 3U62A 5C8VA 2PD3A 3PRKE 4RJTA 1V6SA 4UM8B 3MAAC 5CW1A 4C7OA 1Y6QA 3N6RA 4FSDA 1EHCA 4PX2A 5J1TB 5L3VA 1QOZA 5KQRA 2ZUBA 2LKDA 3F46A 3C5WP 1NBIA 2Z57A 1KS9A 5INTA 1HFJA 3PQFA 3ILYA 4ESHA 1MA3A 1GOTA 2JFGA 1V7QA 2E37A 3SXUB 4AZ3B 3JQRA 4QYXA 1C30B 1LPMA 2XGGA 5CURA 5K51A 2RBGA 4X45A 5B4VA 5KOHB 1J7KA 3WZMA 5FBQB 2VPIA 4X41A 2ECQA 2L0XA 5JD6A 3QKSB 3N9IA 5CYFA 4Z8YA 5L4NA 2YFYA 2FQYA 1EE9A 5GMOA 4QEZA 2J30A 3ANNA 1Q15A 2F1RA 4JLVA 4DIMA 4ITUA 1NJ8A 2G5CA 1H2ZA 4WWHA 3MTEA 2H8GA 1FA9A 1AT1A 3N0VA 2FPKA 3QFSA 4JP3A 3MBKA 4NU0A 1Z2DA 2REXB 1FXUA 3W2EA 4RWZA 5EIWA 2JAWA 2HZBA 4X1OA 2ZRQA 3D4IA 4FMPA 5AW7A 4S04A 3H8WA 1ZSYA 4J43A 1JFTA 2J87A 1T9GR 4KQXA 2E6UX 1ZPDA 3B82A 2Y9MB 3PHCA 1KWGA 1PBTA 2GPJA 2BSQA 4JQCA 4M0FA 3TX6A 1DCMA 2QL7A 4FUQA 4DCMA 1ZUWA 5DLPA 3U7RA 3OOWA 3KBOA 1GKKA 5F1YA 3IIKA 3ZWCA 1A5TA 1RI1A 4G0XA 2QTLA 3CBQA 4HH0A 4BQIA 2ZRFA 1QHYA 4J3JA 3KV3O 2J3KA 4DWWA 4KQ2A 1GP2A 1PDWA 2C7OA 5JD5A 3B1XA 5KYGA 2V3WA 3EFBA 3ZBUA 3UUFA 5JAOA 5HSGA 4IGEA 1TAGA 4F6CA 2Z8YA 3DBVO 3UMJA 4IXMA 3T4PA 1S5PA 1ABFA 3D4OA 4LYJA 4RA9B 3TOXA 4BBPA 2D06A 3WK9A 2VPTA 5EZ5A 2HMTA 3QXHA 2OR3A 2ZULA 4YQEA 1V9CA 4V0KA 3RTAA 1JKJB 4FZ3A 3RC2A 2G0AA 2YWJA 4KE6A 3WP1B 5JH7A 2BZSA 3QE2A 5TX7A 1QRSA 3IVXA 3DXXA 4E2WA 3PFKA 4GZLA 2ODEA 5IXYA 4CR6A 5JU6A 2XXAB 1AXGA 4A1FA 1XJWA 3GJTA 4HEJA 4F1WA 4AL4A 3S2IA 5A6VA 5DE3A 1LKZA 4WGGA 3PKJA 3T1QA 4KQFA 4LOIA 1O7JA 3WXMA 5BRAA 3VNVA 4P8RA 4DA8A 5IMSA 3GEPA 4I50A 4PYNA 3UYKA 2IPXA 3WMRA 4K26A 4Q4CA 3EXFB 3KEGA 4CKEB 3THXB 1ZL0A 2V0CA 3F8TA 4P4LA 1QTQA 5CEFA 1LS1A 3PUKA 4TL8A 4ZPXA 1I6LA 5FLYA 521PA 5EIBC 3DO6A 4RPJA 2CUKA 1KDTA 4R0VA 3TEMA 4BX3A 4BVJA 2JAQA 3QX7A 4PYMA 1J2YA 4R3WA 4E4TA 1L5YA 4Q18A 2I5PO 5FR2A 1YS4A 3EG5A 4K5QA 2VBIA 1CNEA 4QBIA 1E9BA 2QTGA 2JASA 2R60A 2X0EA 4ZJPA 2BGUA 4BO5A 1LPPA 4UCWA 2VNAA 2GHRA 3K0KA 3INNA 3NKLA 5DCLA 1LEHA 3GFRA 3Q85A 1MNQA 2DWPA 1ZGCA 2CEAA 4YWJA 2JA2A 1FTSA 3LRXA 4Z8XA 2COEA 3PQ8A 5EE9A 2ZM6B 2ZE7A 1RHJA 2A7XA 1NNLA 2HJSA 4YXWD 1WP9A 2C9CA 2CXNA 1E9AA 2JJ2A 1P3JA 2EG5A 2PQ0A 2VDUE 3FTDA 1OBCA 3HVRA 1OX6A 3VUEA 3W5UA 1FUKA 2EQ5A 4XJXA 4C0WA 2OV1A 4RVCA 1WHTA 3F2VA 3A4LA 4MV3A 3E9RA 3A6KA 4DBLC 1C8KA 3RT7A 2ZROA 3AHGA 3L0BA 3BL8A 3KUUA 1TZKA 1RPAA 2FUKA 1EDBA 2I66A 3HM2A 1R66A 2I2DA 3ND7A 3PICA 4MV1A 1LSJA 3L7CA 4MQLA 2GKGA 3KEQA 3M4YA 2DAPA 5G1OA 5IYZF 1RZ3A 5TQ0B 3VU0A 1YSCA 2IUTA 2P2CA 2PT5A 3SIPA 2PU5A 1KI4A 1XZIA 3HPQA 4MS4A 4D0RA 5KDDA 3VNUA 1F0PA 4TZ6A 3PWTA 1XUOA 2XT9A 2NXEA 4UATA 3KNZA 3NIGB 3STXA 1DOZA 2GSWA 3RS8A 4DLRA 3T52A 2DY1A 4KI7A 1EFDN 3RRXA 5IJ0A 4L74A 3KP1A 2QTMA 1KI3A 5DXJA 5F3DA 3RU3A 3MWEB 1PDOA 1TZCA 2JHFA 3RTBA 1EGHA 1Y48E 3O3MB 3IVAA 4PPQA 1L0BA 3AG5A 1JNXX 1P4HA 2Q5IA 1E5QA 4EY7A 5I3ZA 2Q4EA 2XGJA 1X2BA 1TEHA 4ASUD 1PK8A 1RSZA 2C3MA 2QN8A 3DOJA 3MWDB 3QA9A 4P2GA 4V1CA 5C46F 1C8LA 3FFWA 2XAAA 5LXTA 3E9QA 2IBSA 2JGKA 2R68A 4MSUA 1JBQA 4HQOA 5FOXA 5GVSA 1XZJA 5KVCA 5JXGA 3X1JA 3GLHA 5JPCA 2P79A 5E7QA 2VHUA 1U8ZA 1DC4A 5SICE 1PDVA 2CDBA 2Y6UA 2UVDA 2EW8A 3A4VA 1NVVR 2QA5A 2GWHA 2QAGC 4Y8VA 3W9BA 1A2BA 2Z2XA 3ZX5A 4I4LA 4B6GA 3HKCA 3H5IA 1JLRA 5AKHA 1N2JA 2IYAA 2AFVA 2W6NA 3FUTA 4HDAA 1V5WA 4RXTA 2VP0A 2ORED 2VYND 3ZIAD 4LA4A 1PJBA 4DMLA 1G8AA 1YAJA 2AXNA 1AG9A 3TNLA 2ZREA 4XWOA 4B2LA 5DBGA 1UDXA 1RQ7A 2QJWA 4MROA 5FOWA 5C80A 1D7OA 1IBSA 1PT5A 2VK8A 5GOZA 5KJCA 2WMOB 1DG3A 1JQEA 1T3GA 1FDSA 3LL7A 1NW7A 5EKDA 3IDOA 4KYTA 3C24A 3DMTA 4MV6A 2YV1A 4NXNB 2X9GA 1CYDA 4BP8A 2N42A 3FTEA 3BQ9A 1GTL1 2HO4A 2I6FA 4D4LA 2HFKA 4WNAA 3I28A 2C2MA 2NXWA 4PAOA 5TQVA 1HY3A 1RNLA 3BX1A 3NT2A 1FVOA 1WXWA 4FHEA 1ISHA 3KQNA 1KI8A 1SGWA 1VIAA 2P4EA 3DKRA 3LGXA 1JSCA 5B64A 1G19A 2AJDA 2D5LA 4WRRA 4DIBA 3CVUA 3ZE1B 4GOJA 2VDMB 1HE4A 1FMTA 3R7BA 2H7VA 4UZSA 5LLSA 3HZOA 4ZO8A 4BC1A 4BEJA 3CF0A 3H6HA 4UM9B 4ZZIA 3LG2A 4KGXA 5E4FA 1OKKD 4CXMA 4G81A 1YQTA 3BCHA 1U0RA 4I0WB 4WSOA 3VZBA 3WC4A 5ITZB 2Z6QA 1M5RA 2RGBA 3U4IA 3VJRA 1YJ5A 1QGOA 4G01B 1K7EB 3WL7A 2W2MA 3X1MA 1M2EA 4CKBA 4IMPA 4F9TA 1LDEA 1IN1A 3HJAA 1E3EA 3F98A 4EA7A 3W9YA 4WBNF 4D3SA 5HZMA 3FTCA 4C01A 5CAEB 4LSMA 5A9RA 4H17A 3V6LA 1TTQB 1C7QA 4C7JA 4QHYA 3A14A 4HADA 2YFQA 2ZW9A 5JBQA 1PFWA 4DB4A 3EUAA 3I52A 5DNWA 3RC3A 1NASA 1DEOA 1RPNA 4NK4A 3HU3A 5D00A 5HMLA 4DR6B 1FMFA 1Z15A 1AVTA 3OQIB 4L8FA 1NUAA 1N3LA 1I7SB 1G8SA 4Y2QA 1JU3A 4HNUA 1QQAA 1N6OA 1OFHA 2XA1A 3I5AA 2AHRA 3M6MD 3LDHA 1WSDA 4M98A 3TZEA 2YYYA 3CUSA 2Y1XA 5JJIA 3CUEF 3KCNA 3RSLA 1QYRA 2V5UA 3OTQA 4PZCA 3GRUA 1Y8QA 3Q3JB 4YRGA 2FGKA 2XE6A 3ZJTA 3O1HB 1GILA 1M8FA 2O1WA 2GRUA 3GUCA 4YCLA 1N78A 1I4OA 3C1TA 4YUAA 1A5AB 1Y7PA 4UCQA 1JFSA 3V4OA 4LDPA 2QJTA 4NC9A 1N2CB 1K5DA 4CFZA 3OWHA 2VRBA 4Z9AA 3SN6A 2ZB3A 4KFCA 1Y3HA 3DFKA 3U3XA 2QE7A 2O2YA 4ZU1X 2VSYA 2PL5A 1RMTA 2J5XA 4WINA 3IKLA 4OF4A 3ENNA 1PEYA 2VPWA 2PMCA 3CH6A 4RGQA 3TTWA 1P5FA 3AF3A 2CCGA 3ELYA 3F8SA 2NVBA 3P0HA 2IDMA 4FOLA 1YDMA 3T4UA 4EG6A 1K08A 4I1VA 2VNKA 3GH1A 4DRXA 4DNPA 4A23A 3IT2A 3PFIA 4UMDA 1VLQA 3R3ZA 4LZLA 4QGAA 2I34A 4H0NA 5ER6A 5JRDS 1SG6A 4FGUA 2JI6A 4NBKA 2DHEA 2PPLA 5FTJA 1G5FA 5BP7A 4MYDA 2H4WA 2XW6A 3OJLA 4KR9A 1EYZA 3REQB 3WGMA 1BXKA 4AUNA 2FI1A 3HRKA 4XFJA 4XKJA 4Q34A 5C1DA 2QPLA 1LW6E 1RYEA 2VCEA 2C04A 3EWAA 4G85A 4DR4B 4QFDA 2NQ2C 3OX2A 5IJZA 1UP4A 4LXUA 2KBEA 2ZJBA 3HY6A 4S05A 1NVUQ 3TD2A 3H97A 5IYZA 3L92A 3CINA 4MJ7A 1QVAA 1E2MA 5KMGA 1JFVA 5IBQA 4LRWA 4UUNA 3N28A 4FXPA 3TR6A 5JNWA 1JPVA 5DW0A 1AO3A 4CCAA 5KYXA 2IXBA 5JSKA 1JHDA 2Q6VA 2PX5A 4HS9A 4BV2A 5ESRA 4QTZA 2ZUSA 5E6UB 3S70A 4AG3A 2Q5EA 3Q10A 1WIWA 1KC1A 2MWMA 4PYLA 1TEXA 2F1HA 4KGDA 7REQB 3KTAB 4DLSA 3ADBA 1H2RS 2WSSD 2XMBA 4XVCA 3GFSA 1ZM3A 1P60A 2RJOA 2IY7A 4XIIA 3FCYA 1WPXA 4EPRA 3A3OA 4Y1RA 1QANA 3E35A 3Q6NA 4O6VA 3T7RA 2JGRA 3P2YA 3VPAA 1TYBE 1M2VB 3RRFA 3WMGA 2J0QA 1RADA 3BYZA 1P2DA 4GI5A 1XKTA 3NPMA 4DUPA 4EDHA 1O5TA 5CFMA 1D6JA 4LF7B 1UK8A 2IIQA 5GQSA 1H65A 1WNFA 2HA3A 3E23A 4R9VA 3UYLA 2AFHE 3FDZB 5G4KB 3U4QB 1QSGA 3FZQA 3E7FA 3MJFA 3L9WA 2GPSA 4MV7A 4N7JA 2VWQA 3MMXA 5K03A 3GWZA 2XUDA 3CKMA 4JZKA 3A37A 4KLCA 1UXGA 4IZ6A 4LDZA 2V7GA 3AIMA 3L05A 4P92A 5AD1A 2JBAB 2SKEA 1WJGA 5T57A 3A2MA 4D9GA 1QC5B 4WOCA 2GJ4A 4MV8A 4ACBA 4EIWA 2HLDD 3S44A 5AVUA 3FNFA 1C2YA 4I8IA 3A4IA 3V1LA 4Z49A 1KYZA 2AZDA 1OT3A 1ORWA 3EWSA 4B6EA 3DZ8A 1IY0A 1F9AA 3FYUA 4B6OA 2CXUA 4BNMA 2MR6A 2SCUA 3C2QA 3IV9A 5K8CA 3CW8X 2O3QA 3P32A 3EXAA 4JLUA 3IAS6 3TLBA 2VHQA 4A6PA 3SVTA 1Z2PX 5EJ7A 1U7OA 2XCUA 3FIUA 2H17A 3HCFA 4UVEA 1P5RA 2D5AA 2O20A 2ZBRA 3M0EA 2IIBA 4L4XA 3VZDA 2BKAA 4UULA 5IT9A 1N0IA 2AFIA 4ZCSA 3OTHA 4WASA 1H8EA 2PY6A 4RK5A 1N8KA 1DWQA 1SHUX 4ZI2A 4FNOA 3QA3E 1U0NA 2RE8A 2HMUA 4BHTA 1EKXA 1N2EA 4OFXA 2CLLB 5CX1B 3TRFA 5H70A 1E2QA 4B3FX 4ZOCA 2YOHA 4RDXA 1FFWA 1MEEA 1PKEA 3GO4A 3I6QA 2BN4A 1I1OA 4X44A 3ZQ4A 4GZMA 1H1LB 4RLQA 1WXGA 3ROMA 4F2WA 5HCUA 3S4YA 2QYOA 3RO7A 2AZXA 2O19A 3UWKA 1LCIA 1FW8A 1ZBQA 2O2EA 5FNZA 2R8ZA 1Q7GA 1NOIA 4F3TA 3HO8A 2Q3MA 1I01A 1UXIA 3PDWA 4JAVC 3S7ZA 3ZN2A 2XNDD 4BNXA 1QTNA 1BZYA 1YDEA 1E0AA 3CR8A 3R6GA 4EARA 3DZBA 2OD9A 3VVMA 3D7KA 5KPJA 3NDIA 2VAMA 4F12A 4WBNA 3RVLA 2EGUA 1DXQA 2CMDA 2P7IA 1ZVMA 3BMOA 2VDWB 1TJNA 4QJ5A 1GTSA 3VSEA 1HDEA 5HK8A 4EA9A 1YRQA 2IEGA 2H1LA 3ONNA 5FA5A 2GCEA 1F8FA 2ODNA 1SVLA 4RMHA 1VLMA 4RZSA 5L3QB 2D6FA 2BUAA 4WAUA 5KDOA 1GGFA 1FU7A 1MA0A 1XRPA 1SC3A 3WGLA 1OXMA 3LFHA 2QSUA 4LJ9A 1KJ8A 2IT1A 1RCTE 2GZHA 2H29A 3E9DA 4L6CA 1Z3CA 2GHTA 3AHEA 4FMDB 4QXRA 1JWBB 3PRJA 4YMUA 4HPWA 2DBYA 3M83A 2GHQA 2DUMA 2C3OA 5DYGA 1MN6A 5JSZA 1JIQA 5CLQA 5DOZA 3DZGA 5CPBA 2XYPA 3GZ4A 3PCRB 4TT8A 4YJFA 2RK6A 1NRIA 1PSZA 3A1WA 3WLMA 1NMQA 1SUBA 3K8ZA 1X38A 1DQNA 1Z0ZA 2ZWMA 1VJ5A 2P6NA 3RHZA 2FW0A 4MI6A 5FEUA 2KLHA 4E2XA 2OAGA 4IPTA 4TZTA 1YMUA 2ZGVA 3GGOA 1DEXA 2AOUB 2ATEA 1XNGA 3CBGA 3O8BA 3T38A 4B84A 1QIMA 3FE2A 5FWAA 1EJBA 2AVNA 1NFFA 2O3RA 1JXMA 1MB4A 1WDMA 3KL2A 2LDBA 3P2IA 4RZXA 4XWAA 1P2VA 2BEWB 2F3QA 3IE0A 4G0PA 1V3VA 5DRYA 5K99A 1HR0B 4KACA 3H9UA 4WZAB 1JW9B 1ZINA 3AIIA 3WKBA 1XD9A 2IYPA 5FI5A 1AKNA 4AKTA 1S2DA 5D86A 5FFNA 1MPXA 1X74A 1MH1A 4JC0A 1NZDA 1R4AA 2R48A 3QK7A 4WDQA 1FPMA 5CMLA 2G7MC 3LW7A 5AHWA 2PGNA 4RD4A 3FA2A 1E58A 1SA0A 5KNBD 3ZK9A 1Z0AA 1LBTA 4G56A 4XWGA 3O9VA 3PZBA 4DNOA 1GQQA 3W5CA 2DT5A 3HL4A 1V3UA 4E70A 4GXRA 3VKUA 3VUFA 2ZCJA 2J1LA 2G5GX 2WJ4A 3GEMA 4OHMA 3AWIA 4MUGA 1O3YA 1OIVA 4WJKB 1L5WA 2W2XA 1G7SA 2FN3A 3TE6A 4N5DA 4UFOA 2VXOA 5C8YB 4D0SA 1N92A 1XKXA 4HNHA 4FGKA 1PJCA 4PICA 4B6QA 1ECPA 4RQTA 3HP1A 2HFJA 2QN1A 5AOVA 2DHDA 3SC6A 1CUJA 2FKAA 2O2JA 4I19A 5AK0A 3A7EA 4BJ5A 5C5CA 1FS5A 5K0EA 1GUBA 4OGWA 4XOIA 2W2OA 3CVWA 4F38A 3KYDA 4KKXB 3OEHA 4EUKA 1NPTO 1XJ5A 2COUA 4V0OA 3W90A 1RI2A 2W2KB 2G67A 2IEZA 2QLJA 1E1CA 4LK2A 2XJ9A 1QYXA 4F3RA 3AI1A 1OVMA 1TVKA 1VP3A 2NZXA 4OXYA 1Z6ZA 4AJIA 4CGYA 3SFZA 2F6RA 5G53C 1ZDMA 4GP9A 3LX8A 2GYVA 4RZ2A 4ENSA 1J06A 1L7OA 1OHHA 1GARA 1YZ3A 4L08A 1CNFA 1H0RA 1YU6A 1K2WA 4GYWA 4HNSA 5ICSA 5H3CA 3K2EA 3OQOA 1XPRA 3FPBA 3H7AA 1DWOA 3BCUA 3U13A 1ZUNA 4AX8A 4BWFB 1OX5A 2OBBA 2V9CA 2XVAA 1DBWA 3I9JA 3I61A 4P1ZA 5JV5A 1JEYA 3WLFA 2C5GA 4JC4A 1XA0A 1ZUHA 3IALA 3CXRA 5FLEX 3HU1A 1XLUA 2Y1GA 4OLJA 4ZAFA 4MKIA 1Q19A 3UXEA 3ZZUA 3L1VA 4BV3A 1C9JA 1T3LA 5E7MA 4EL0A 5HF5A 5J3JA 2HYDA 4ZK6A 4DDHA 4DFDA 3AILA 1DKQA 3S2YA 3VPCA 4EHKA 2CUNA 3SQNA 1P33A 4PLYA 5HIAA 8ADHA 4I6EA 3UB3A 5AJUA 1O94C 1HE1C 1NXVA 2WF7A 3QVKA 5JNVA 3BWEA 4HK4A 5BV7A 4CUJA 3NWEA 5JDIC 1QONA 4ALKA 2Y3IA 4XR9A 3THOA 1FDIA 2H07A 3IAXA 4GGOA 1PQ4A 1WSWA 3D2AA 2XUGA 3ANSA 4WVLA 2P3LA 4UNNA 3ZNQA 3CJQA 1NQTA 2BGTA 4QUEA 5FEMA 1UQUA 2YS6A 4CVNA 4ENQA 3HPRA 3MA0A 1VSQA 3TLXA 5DLQC 1P5ZB 2YOFA 5AICA 4DM4A 1P62B 1T9KA 5JZBA 1QVVA 3L40A 5LU9A 3BXOA 3OLYA 3TAHA 2X7XA 2ANBA 1RKUA 1VGVA 4RPLA 5EWLA 3KETA 4TM8A 2W6ID 2HSZA 4FT2A 4PZUA 1EG7A 4F1KA 5TMBA 3ASYA 4RZIA 4E21A 1NN1A 4WI1A 4O3FA 4BVEA 4DA7A 5K4GA 3D7NA 2WHPB 2ZRBA 3WP0A 1JECA 1QF7A 4I5GA 3C8ZA 3ZKWA 4D9FA 2CLOB 4HMOA 3IEMA 3EXEA 1HV8A 1XTRA 2QNRA 5JO9A 3TLJA 4MV9A 3FJYA 1ECBA 4ZRMA 2EFJA 3PT9A 4WA7A 1YC5A 4BJ1A 1CG6A 5EWMB 4WK6A 2CY0A 1TZMA 5TF0A 4TZ0A 1EG2A 1BC5A 1HRDA 3QVGA 4RESA 4TYYA 3ROZA 3HUDA 5A5GA 1E5TA 4OHKA 2FEMA 2JI8A 4RMGA 1GUZA 2Z04A 1SCNE 1Z06A 4G67A 5EE3A 5J5CA 1K6EA 2CBZA 3ND9A 1D4AA 4RVFA 3WKEA 1YFLA 1XIVA 3CX8A 4E5UA 1T5HX 5K6AC 2CK3D 3M6WA 4P7BA 4YB8A 2RH9B 1NXQA 3RS4A 3I58A 3BICA 5E6RA 5AW6A 1U8CB 2H11A 4E51A 3FCXA 1BKSB 2QL5A 3IR7A 4LJ5A 5EXXA 1UBKS 5IMBA 4R0MA 1ZL2A 2O1SA 1ORHA 3F2IA 3P9RA 3L0YA 2C82A 5H68A 2XADA 5H5JA 4HP8A 1P6QA 3JX9A 4CKCB 1QYVA 2NTJA 1ZQ1A 4DANA 4S1PA 3V2UA 4HAWA 3HBNA 4KYVA 4DXHA 1X7YB 1K5GA 3LNCA 1EINA 2GM9A 1XRMA 2PUBA 4IMRA 1M74A 4QARA 4RVHA 2BC9A 3DKVA 4BDTA 4FJ0A 2OZPA 3P94A 4JLKA 2IEYA 4FVTA 4KUEA 1V96A 1SD2A 5TDHA 3TCXB 4N5MA 4BLWA 1HMPA 1APBA 1PR6A 2TYSB 2QM8A 2GESA 2VCHA 3L8GA 3T06B 3TZHA 1HDZA 1C7RA 1JILA 2WDZA 4OPMA 3VR1A 3WL3A 4O2AA 4LE1A 4DJAA 3MRXA 1BAPA 2FFJA 2ZAYA 3UT6A 4RULA 2PIAA 2HZ7A 4BAGA 5KWSA 1J9GA 2Q07A 3WRWA 4W7SA 1TKBA 2IEBA 4ZYVA 3OC6A 2QX6A 2VBGA 2WHXA 4O4IA 5GJVC 5GV7A 3QEBZ 1W0JA 3AMVA 4IDQA 3K94A 5EMLA 1U9ZA 3NEYA 4IHKA 5BURA 2G5TA 4L73A 1P6UA 2ECPA 4G2NA 3JTMA 3L0PA 3F3SA 3TZBA 5C5EA 1OZHA 4DKXA 4EO9A 1EXVA 4A0FA 4HDNB 2FETA 3I73A 3L8EA 3LX6A 1OVGA 1J5PA 1A9TA 2WWFA 1JDVA 3LX5A 4N01A 4GIBA 2AIRA 1XU4A 2UAGA 1OXXK 5T64A 3SIXA 2O7NA 3QX3A 1A95A 2QMYA 2FDCA 2RI6A 3SP1A 5HZHA 5DM70 3G17A 2EERA