1THTA

Structure of a myristoyl-acp-specific thioesterase from vibrio harveyi
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
302
structure length
294
Chain Sequence
QCKTIAHVLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDHFAGLAEYLSTNGFHVFRYDSLHHVEFTMTTGKNSLCTVYHWLQTKGTQNIGLIAASLSARVAYEVISDLELSFLITAVGVVNLRDTLEKALGFDYLSLPIDELPNDLDFEGHKLGSEVFVRDCFEHHWDTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRTGHCKLYSLLGSSHDLGENLVVLRNFYQSVTKAAIAMDGGSLEIDVDFIEPDFEQLTIATVNERRLKAEIENRTPEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a myristoyl-ACP-specific thioesterase from Vibrio harveyi.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Thioesterase
molecule keywords THIOESTERASE
total genus 101
structure length 294
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02273 Acyl_transf_2 Acyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1thtA00
2QM0A 4B6GA 5AOBA 3ICVA 1SCIA 4NS4A 5JZSA 4CCYA 5JATA 2WLSA 5ALSA 2C0QA 4LXHA 2AJBA 3IURA 3F8SA 1N5RA 3G8YA 1AKNA 3HLKA 3STXA 3HXKA 1HBJA 3QMVA 4J7AA 5EHXA 1HLGA 3M81A 3DOIA 4ZI5A 5KWIA 3STVA 3AFIA 3WLAA 2Y2UA 4AO6A 2WG0A 5A71A 3H2HA 2EDCA 3CCCA 4W1SA 4FFVA 3DCNA 2XUIA 3W06A 1WB5A 3HZOA 4UFPA 4BRSA 2QUAA 3O0DA 4Q05A 1VLQA 2OQVA 3C8HA 2WTMA 3FYUB 3F9CA 3QBJA 3F98A 1K5PA 3ED1A 2GBCA 5D3ZA 2VATA 5T4HA 4BC1A 3ICWA 4DNPA 3C45A 4UHBA 4X3CA 1MJ5A 1XZCA 2WJ6A 1TIBA 2YASA 2QR5A 4IH1A 2XUOA 2XUKA 1ORWA 1MO2A 2GYWA 4ROTA 4OSEA 1EXWA 2QJWA 1UT6A 1DQZA 3ANSA 2Y2VA 3DD5A 1C4XA 4EA6A 3AZPA 3H2IA 1WB6A 5A7GA 2FX5A 5JANA 3TGLA 5K3BA 5I7UA 4J3JA 3WJ2A 1J2EA 1G66A 5ALRA 2G5TA 3VXKA 1K8QA 4IHAA 2WHRA 2XUFA 4KE6A 3LS2A 2VT7A 1IUOA 4X90A 1UFOA 1IZ8A 1MNQA 3WQHA 2DQYA 4Y9SA 3FSGD 1BU8A 2AJDA 1HKHA 4FDMA 2I3ZA 1Q0ZA 1CUHA 1QIHA 4B84A 2R11A 2X8BA 5HF5A 3TJMA 4G9GA 4ZV7A 3DYIA 3E1GA 3FNBA 2XMRA 3FVTA 2HA2A 2WM2A 2DFPA 2ZJ7A 3D5EA 3V48A 2XQGA 4C01A 3GELA 4G8DA 3ESAA 1VE7A 1EHYA 1FFDA 1CR6A 1KU0A 1MAHA 3PF9A 2AJCA 1QFSA 3HC7A 3FOBA 4CG1A 4C87A 3SX4A 4KYVA 5ALIA 1TCCA 4C89A 5FV4A 3A2MA 1XZEA 4HZGA 2CUTA 3DS8A 3O4JA 2H9YA 5T4BA 3VVMA 1CUBA 5H3HA 5LP1A 4G4JA 1GZ7A 5FPQA 2QXUA 2WFLB 5DYTA 4U2FA 4UFOA 3A2LA 3BIXA 3STUA 1A8QA 1XRRA 4KR0A 5IVHA 4CIBA 3G9ZA 4N8DA 2ZYIA 3FYTA 3VJMA 3X3HA 4B9EA 2OXEA 4X97A 2WHPA 5LYYA 4F60A 4BTLA 2HRQA 5AKXA 4Y2QA 1XZFA 4WCVA 4FOLA 4G1FA 5HKBA 1UK9A 2OCLA 2HA4A 2OCKA 5JASA 2HADA 1ODCA 2HA7A 5JAUA 3WI7A 5K3FA 7YASA 4B81A 3D7RA 3QZUA 4AN0A 4LKOA 1FFAA 2WJ3A 4X7BA 2FUKA 3BWXA 2I03A 2XQJA 3AJAA 1G42A 1J1IA 3ESCA 2AJLI 2WUGA 1UOQA 1XZIA 2ONCA 1LPNA 3VISA 4Q3KA 1GPKA 2RIPA 4AN1A 3PUHA 1EDEA 4DMFA 2WJ4A 1AUOA 3HYSA 4BP8A 5K3FB 1LZKA 2WIDA 1W4LA 4MEBA 2QKYA 4BAGA 5JAHA 3ILSA 3VJLA 5HFNA 4DGQA 2W6CX 3M3DA 3F96A 3L1IA 2XMCA 4AO7A 2EEPA 3R3ZA 3QM1A 1CEXA 1VXRA 4NVRA 4AZ3A 3OURA 1L7AA 1CUGA 4FKBA 1UOPA 4KACA 1HQDA 2PX6A 4DIUA 2O2GA 1UKAA 1XQWA 3N0TA 5AKIA 4L0CA 1Q0RA 1THTA 2QVBA 3VKFA 4G8CA 1P0IA 4B85A 3JW8A 4Q1VA 5AM2A 5BWBA 4N5HX 5EFZA 5AKJA 3O9MA 3CN7A 5LZ7A 5AM0A 3RKSA 5AK3A 1O6FA 4U2CA 2OGSA 3V1NA 5LKAA 2PVSA 4EY6A 5ALVA 5IKXA 2PSJA 2O2IA 1LPMA 3STYA 4UBOA 3WK4A 5A62A 2XB6A 1KEZA 3I1YA 3EBLA 2QJRA 1XRLA 5ALJA 5CXUA 3JWEA 1FJ2A 2QUBA 1H2YA 3ZI7A 4U2DA 1CUZA 3K2IA 4W63A 5CXXA 5ALUA 3W2TA 2WIJA 1QO7A 4ZV9A 5C8XA 4B0PA 2Z5GA 1R9NA 5IVKA 1EDBA 5AH0A 3D2CA 4FNGA 5ALQA 3QMWA 5AJHA 5DYYA 5JZ9A 2OGTA 1EB9A 1ODSA 5I8PA 5DJ5A 1H23A 5AKGA 3RK4A 1RYYA 2EDAA 4YPVA 1YB7A 3W9BA 5AI4A 1BN7A 4LXIA 4ZREA 2QZPA 4Y2TA 5BWCA 2HA0A 5ALPA 4K5QA 5BOVA 4KRXA 2G63A 3D4LA 5C8ZA 2V96A 4W1QA 1HPLA 5J3JA 5HCUA 5JD6A 3L1HA 4OU4A 4EUSA 2WU4A 3PUIA 1QZ3A 2Z8ZA 3AINA 1BS9A 5ALKA 1WHSA 2XQIA 4AXBA 1CLEA 5ESRA 2HRRA 4FTWA 1EVEA 3IUJA 4FBLA 3AIKA 3ESDA 2X76A 2BUBA 3EIOA 1WHTA 5HF9A 4DNFA 4GHWA 1W6RA 3R3VA 3D2AA 3WWDA 2WFMA 3I2FA 3QYJA 1X70A 5AOCA 4EBBA 1QOZA 4OYLA 2XT0A 2BGRA 4I4CA 5ALGA 4Y7DA 3AIMA 5K5EA 2DHEA 2J3QA 2PUJA 5IVDA 3M82A 3WK7A 2C0PA 4KAJA 4QZVA 1BEZA 2PKYX 1ZIYA 4Y2VA 1CUDA 4P08A 4H7FA 5D6OA 2LIPA 3IB3A 4QLOA 1QTIA 4BCDA 3G02A 4X6XA 1CRLA 4JUIA 3T52A 5A6VA 4NMWA 4BCCA 3CCBA 1DWQA 4BTVA 3I2GA 4M0EA 1UK8A 1H2ZA 1MN6A 1ZIXA 4C4ZA 2UZ0A 3KXPA 4H7IA 1GXSA 5ALLA 1WPRA 4BE9A 1DT3A 2VAXA 1E3QA 4RE5A 3R40A 1ISPA 1QIFA 3ESBA 3HRHA 4UBKA 1LZLA 3PF8A 1XRPA 1J06A 4X91A 1DQYA 3R0VA 1Q83A 3FLAA 2BKLA 3A2NA 3IVMA 5ALOA 1X2BA 5HFAA 1VA5A 3KD2A 1Q84A 2ZSIA 4H35A 5C8VA 3H2KA 1ETHA 4H77A 5AK4A 4OYYA 3I6MA 1MX5A 3AUKA 4WY8A 4BZWA 4YX9A 2WFLA 4UHEA 1GT6A 4M0FA 4RE6A 5DTIA 3E0XA 2P8SA 5K3AA 1ZGBA 3FAKA 4KEAA 2RHWA 2XMBA 4BB0A 2K2QB 3SWWA 3WKBA 3BF8A 1THGA 4MYSA 3R3XA 4H7DA 3ZLUA 3PI6A 3I28A 4DM7A 3K6KA 1BCSA 5LZ5A 2VAVA 4ZXFA 4OPMA 5K3DA 3GUUA 1YASA 1C7JA 4HVTA 4DSZA 4ARBA 1LPBB 1SCQA 3FCXA 4H7HA 4J0DA 4XWGA 4Q82A 1RP1A 3AIOA 1N1MA 4AO8A 1LPPA 5LZ8A 1EK1A 1J07A 2XMZA 3IIIA 1CIJA 3BJMA 3C70A 1YS1X 3QITA 4AQDA 3V9AA 4X95A 1XROA 3FLBA 4B83A 3WA6A 3FCYA 5FKJA 4WFIA 6YASA 2DCMA 3BE8A 1WOMA 1FSSA 2B9VA 4DSAA 3B5EA 2HFKA 1R88A 5JALA 2VJCA 4G4GA 2NW6A 1CUYA 2XMGA 2Z3WA 3TEJA 3U1TA 1QIDA 3G0IA 4C4YA 2OAEA 4QDXA 3C5WP 4J0JA 1Y37A 1BE0A 3C43A 4JEIA 4ZWNA 2VF2A 4E15A 5LIPA 1E89A 2BAGA 5AKKA 5ALMA 5AK5A 5AHXA 5CURA 1ZGCA 2XQFA 3DL7A 4A5SA 3PFBA 4GBGA 5LLSA 2OCGA 5IH7A 4Y2PA 1XKTA 5JD5A 1ZD2P 1XRMA 1BN6A 5CH8A 1WCYA 3WK8A 5C7YA 3QPCA 2IITA 4I3FA 3NUZA 2HM7A 3WKCA 2VTVA 2D5LA 1XLVA 2WSLA 2GBFA 3FVRA 4K6GA 3IBTA 5ALHA 1QIGA 4NZZA 4QLAA 2B4KA 4J0HA 3A70A 3WA7A 1ZOIA 2WIKA 3H1AA 5HF8A 1LBTA 4U2BA 4BP9A 1XKLA 2GYVA 1N5MA 4MWTA 1Y7IA 2QXTA 4Y2RA 5ALWA 3WYDA 4JYMA 3I2HA 1NX9A 1CUFA 4BATA 3C6BA 4BRZA 4N5IX 2X5XA 1WB4A 2ACEA 3IULA 4S0XA 2J4CA 4H0CA 1XQXA 1M33A 4GEGA 2VJDA 2QT9A 5AKHA 4BAUA 3O9VA 2AXEA 3G0DA 4B0OA 2BFNA 1D07A 3C5VA 1TAHA 4H18A 2JEYA 1K6EA 1WPXA 1MX1A 5CW2A 2VQ6A 2Z3ZA 4KAFA 1QE3A 5AKZA 1AMNA 2QRUA 2BJHA 4Z49A 1QIMA 2ACKA 4BYMA 4JH0A 5CT5A 1DWOA 2XLBA 5CMLA 4DNQA 2IIVA 5JADA 1G5FA 4XVCA 3WIOA 4K2AA 3EQ9A 3ZWQA 2WUFA 3WL7A 4QDTA 4B80A 5AM4A 1CPYA 2W22A 3WWPA 1JU3A 4FNMA 4BC0A 4OD0A 1JMKC 3DKRA 2XQKA 2HU7A 4BVLA 2DR0A 1L7QA 2PL5A 1OCEA 4RNCA 3O95A 3IUMA 1XZAA 4H7KA 1XLUA 1C7IA 1I6WA 2ZYSA 2OG1A 4F5ZA 4PV7A 1VE6A 5DLPA 4C6HA 1L7RA 2XUAA 5DNVA 1P0QA 3RLIA 3FBWA 5ALXA 3LLCA 2DSNA 2WTNA 1U8EA 1GPLA 3WK9A 1TRHA 5E2IA 3STTA 5FRDA 5AIBA 5BV7A 4DMKA 4Y2UA 5KWJA 3OOSA 4CG3A 2DHDA 3HEAA 5ALEA 2QTBA 1P0PA 1JT2A 5HKAA 4H7JA 1BRTA 4UHHA 1QIEA 2XMSA 3P2MA 5DWDA 2QOEA 2V98A 3BJRA 3DJYA 5EGNA 5EHZA 2ZJFA 3HJUA 3KWJA 2G4LA 4MEAA 1VJ5A 1FFBA 1CUVA 4DNOA 5DNWA 1T2NA 4GW3A 3FLEA 4HRYA 2WFZA 1F0PA 4PSCA 2H7YA 1VZ3A 1MAAA 3V1MA 3WKDA 4EY8A 2B61A 4ZRDA 3H19A 1YR2A 1QIKA 4GECA 5JZBA 2ECFA 1XZMA 2RI6A 2XUJA 1MNAA 2OAGA 1IVYA 1LLFA 4K6KA 1ZI9A 2JGMA 4O08A 3OM8A 4XJVA 5F4ZA 1ACJA 3OG9A 4DMHA 1JI3A 2ZJ6A 3BDVA 4ARAA 4FHZA 2J3DA 3WJ1A 1U4NA 1VKHA 1QO9A 4MXDA 3G7NA 3H1BA 4WJLA 1GKLA 3PDCA 4BDSA 1LPSA 5E4YA 1G4HA 3AZQA 4FLMA 5FOQA 2WUDA 4KAAA 3H18A 1A88A 2C4HA 3H17A 4BDTA 2WUEA 3DNMA 2WG1A 1CFJA 4WDQA 1VA4A 4PSDA 1LBSA 3R3UA 1QTRA 4U2GA 3WWEA 1MT3A 1U2EA 3G0BA 4KE9A 3JYHA 2JBWA 2C5FA 5AI6A 4JNCA 3DOHA 5AKYA 2PUHA 5YASA 2C5GA 3KWFA 1QFMA 3PICA 2CJPA 1PFQA 2JGLA 1UKBA 2CB9A 2BGNA 2ORYA 4DMCA 5FP0A 1UKCA 4X6YA 4BBZA 3H04A 4UBLA 1A8UA 4KE7A 5JARA 3MUOA 2JGEA 3D3NA 4GDMA 4J0CA 3D0KA 5EIAA 1EK2A 3S2ZA 1K63A 1JJBA 1YAJA 1YAHA 3V1KA 4HXFB 2H7XA 3HSSA 4OB6A 3E3AA 3QPAA 4FWBA 4EY7A 1VZ2A 4EY5A 2HA5A 5LZ2A 4DTCA 4N8EA 3WL8A 1XZHA 4MQMA 1QJ4A 2O2HA 1JJFA 1GQRA 4BVJA 1DWPA 1ZD3A 3C87A 4UHFA 5JYCA 4C4XA 1K4YA 5DYWA 3D2BA 2ROQA 4B82A 3GA7A 3S8YA 1SFRA 2H7CA 1JFRA 4G9EA 3CN9A 3A6ZA 3I6ZA 1DU4A 2BCEA 4N8SA 5AM3A 2HU8A 5T4FA 1H2WA 1XZJA 5HZGA 5HK9A 1GPNA 2XUHA 3BL8A 2RONA 4QDZA 2HHAA 4WFJA 5EHNA 3N2ZB 1YS2X 1EI9A 3U0VA 1DT5A 1BCRA 3Q0TA 4X94A 4X00A 1GGVA 2PM8A 1AX9A 1CUSA 2C58A 4AB1A 1S8OA 4YASA 4PO3X 2ES4A 4JYPA 1XLWA 3ZLTA 2PU7A 4AMYA 1EA5A 1Z68A 2OQIA 3K9BA 5JAPA 1ODTC 2PSDA 2Q0XA 2O7RA 1TQHA 4IO0A 5AP9A 4BZZA 5A2GA 2OGZA 3TRDA 4V2IA 1ZICA 4MYDA 4YK7A 4J0GA 3WIBA 3NOXA 1R3DA 4CIAA 2XDWA 2XLCA 1YA4A 3HI4A 3WZMA 2BUCA 2PSHA 5HQ3A 1XZGA 4UBIA 3M83A 2HIHA 2GYUA 2GZRA 2Z8XA 4AX4A 2WIFA 2FJPA 2OLEA 1XRNA 3R3WA 4F0JA 3UMJA 1IZ7A 1SCKA 2ZSHA 4QE3A 4XIIA 1PV1A 3MUNA 2CKMA 4CCYB 2WILA 4ITVA 3IUNA 4BVKA 1QIIA 3G0CA 2XMQA 5DTJA 1R50A 1USWA 2WHQA 2I3DA 4J03A 2OPHA 3WWCA 1IUNA 1R9MA 2RGUA 3H0CA 1VXOA 4F21A 5FDFA 4Q3OA 1UK6A 2ZVDA 5CTAA 5T4EA 5EI5A 3QMMA 1ORVA 1W1IA 2JF0A 4CG2A 3G9UA 5K3EA 4OB7A 3FWHA 5K3CA 2VA9A 3R3YA 4QDUA 4DLNA 4MJ3A 2WKWA 3O4HA 4RPCA 1AQLA 3WL5A 5AICA 4WDRA 1TCAA 3GFFA 1QONA 1OILA 1E8NA 1CUUA 4MQLA 2XUPA 4WFKA 3KSRA 1A7UA 3ZLVA 2JGFA 4E11A 2VT6A 1B6GA 5AM1A 5ALZA 4QA9A 2BUAA 4A16A 4IH4A 3WWOA 1CUJA 1CUWA 1UXOA 2CBGA 2JEZA 4INZA 5JAOA 3F67A 1ZJ5A 3DKKA 4UUQA 1Y7HA 1W52X 5AM5A 5KREA 3W04A 4BE4A 2ZYRA 4QNNA 4GI1A 1R1DA 1H2XA 2RAUA 1A8SA 1XRQA 3OPMA 1QLWA 1ZJ4A 1LPAB 4X6UA 5AKLA 5IVIA 5LZ4A 3DQZA 4ZGBA 3O4GA 5AO9A 3LIPA 2B20A 3FSGA 4PQEA 3I2IA 5A7FA 5CT6A 1AC5A 1XZDA 4C88A 5AOAA 3VDXA 1YSCA 2WQZA 4HAIA 2R8BA 1EINA 4OB8A 4G4IA 3I2KA 4WY5A 4B7ZA 5JIBA 1JU4A 3WMRA 1TKRA 4OU5A 2YXPX 3YASA 3CXUA 1ZI8A 1N8SA 3MGAA 3DEAA 3IA2A 2CZQA 4FBMA 4P92A 1HDEA 2O7VA 4Y2SA 4G5XA 2ZYHA 3GZJA 1NU6A 3T4UA 4BCBA 1XZBA 3BF7A 3STWA 3B3QA 3AILA 4Y2YA 2AJ8A 1ZD5A 1F8UA 4W1RA 3UUFA 1E8MA 2J4FA 2XUGA 5ALDA 1ZD4A 1LNSA 4QDOA 3PFCA 3I6YA 3I2JA 1SOMA 4LIPD 3SK0A 3E4DA 4HS9A 5ALTA 3LCRA 1UZAA 5AKEA 4PF1A 3H2GA 3MVEA 4UHDA 3RM3A 4RGYA 2QMQA 1AZWA 3WKEA 1W76A 5AIAA 5SYNA 2GZSA 4MWSA 2VEOA 2HFJA 1EDDA 5E4TA 1U65A 5AK6A 2XUQA 1BEEA 3KOOA 4X92A 4Y2XA 4UPDA 5D7BA 1EB8A 1F6WA 4FFWA 1RWQA 5AI9A 5CRIA 5ALFA 3WYNA 3ZV7A 4KRYA 3B12A 2WIGA 5EIHA 3R41A 4ETWA 1YB6A 2CEKA 3I1IA 5FUMA 2H1IA 3KDAA 1E5TA 1QIJA 3L1JA 5CH5A 1VOTA 1IUPA 5FLKA 3V1LA 4LYEA 4L72A 4UBMA 1CV2A 1B41A 1F0NA 2QS9A 1E66A 2RHTA 4DYHA 3DL4A 1MTZA 1JKMA 3ANTA 3IDAA 4L9AA 5CT9A 3BXPA 2HU5A 1CVLA 2E3JA 5ALYA 2I78A 5FPPA 5A7HA 1XZLA 1NU8A 1WM1A 4TVKA 5SYMA 3F97A 2WG2A 3O4IA 4KJXA 1CUCA 4J0IA 3UUEA 4X93A 3VVLA 5HF6A 5DNUA 5CT4A 2WU3A 2CMFA 4P93A 1KU6A 5LKRA 3NWOA 1CUXA 2PSFA 4EY4A 3ZPXA 1UK7A 4LYDA 5HQ3B 2GBIA 4QEKA 3IUQA 4LXGA 1LGYA 2VSQA 4TPKA 3QH4A 3FYUA 2Y6UA 3G9XA 4A23A 3G9TA 4EB0A 4IH9A 1CQWA 1QGED 4CFSA 1CUAA 4HTAA 1OXMA 2DHCA 4GLBA 4E46A 2PBLA 3NGMA 4UFNA 1ACLA 4PW0A 3C6YA 5ALNA 4X71A 2VJBA 1UWCA 4FLEA 3C8DA 1GKKA 1EX9A 4AMZA 4Y2JA 2HDWA 4U2EA 3VJKA 1XQYA 1PJAA 2XMDA 1DINA 4KE8A 3G0GA 4OUKX 1DX6A 2PU5A 5LZ9A 1O6GA 2XUDA 1MX9A 3PE6A 4H7EA 1T4MA 4QWWA 4FMPA 1CQZA 4G8BA 5C81A 1TK3A 4M0MA 2Y6VA 3WK6A 5JD4A 1YA8A 2JGIA 3DYVA 2JIDA 3Q8WA 5AI8A 4OCZA 4K6HA 5EHQA 1E8DA 2PSEA 1X2EA 4I19A 4UBJA 2JGJA 4B9AA 1DX4A 5CT8A 2YYSA 1SC9A 3BDIA 3D59A 4E14A 3C6XA 4TGLA 3HACA 2HA3A 2XE4A 1IMJA 4P9NA 3QVMA 4UBNA 4L3WA 2IX9A 4PNZA 4W9RA 3WK5A 2HL6A 3GROA 4QWMA 2OCIA 5KBYA 4D9JA 2GBGA 2HA6A 4GWLA 1JMYA 1TCBA 4Q34A 5HK8A 2C7BA 4FLFA 2VJAA 2DQZA 1AURA 1GQSA 4CCWA 4W1PA 1LPOA 3LIIA 4XX1A 3LP5A 1BROA 5CBKA 2V97A 1CUIA 3DLTA 3WL6A 1FFEA 3EQ8A 4EZIA 2PPLA 5CH3A 3SC2A 1MU0A 3GBSA 1ZI6A 4J0KA 5AI0A 4UHCA 4IQ4A 2WHPB 1HL7A 1EH5A 2Y1KA 3C6ZA 2XI4A 5I9IA 1DTEA 5AI5A 5ISMA 3WZLA 1JJIA 3HABA 3OTQA 3RARA 4HXGA 4Q3LA 5EIEA 2YH2A 1EVQA 2G5PA 2D0DA 3WKAA 3W05A 1XQVA 2FJ0A 1UOOA 1H22A 3H2JA 5E4JA 3DDUA 3FYUC 1P0MA 4CI9A 3EF3A 4PSUA 4AZ0A 3AZOA 5FXMA 2JGKA 1XFDA 1R4ZA 5D3KA 3OC0A 3W9UA 3BIWA 4LHEA 4HXEB 4X85A 4BAZA 1CUEA 1AGYA 1XZKA 1FFCA 3EQ7A 2V9ZA 1MPXA 1W75A 4GXNA 4HRXA 1YCDA 4EHBA 3QPDA
chains in the Genus database with same CATH superfamily
3UJ8A 4A2CA 2W48A 4YRFA 4B6GA 1UKZA 1PN3A 2DHRA 3ICVA 4PYMA 5GINE 5C1DA 1P60A 1K3TA 2IF0A 2JD0A 3LY5A 3LDAA 3PNQA 5JZSA 5JATA 1L3IA 1ZUNB 1UODA 3MAGA 1VE9A 3OA0A 2N46A 3PIRA 3GUZA 2OFFA 3U4HA 3VYUB 2WLSA 4CQLB 4CUJA 4NATA 4H1TA 2C0QA 2V7VA 5GAJA 2A7QA 3A58B 4H1UA 1C3EA 3IURA 3MQFA 4M1EA 1WVIA 3ONNA 2VWGA 1M8JA 1ELOA 3TAHA 2XQVA 4G2NA 2UUBB 1AKNA 4QQKA 3PVZA 3CINA 3U60B 4D25A 4CCSA 2A9PA 3WYEA 4AJ1A 1DZ3A 3AW8A 4KR2A 3F1LA 1VFPA 3QMVA 1CNFA 3FVQA 4FVTA 5JPIA 3R74A 4J1QA 5BYAA 1D0VA 1HLGA 4GOXA 4RQUA 3NV9A 3RH0A 4C1BA 5KWIA 5FBRB 1Y6FA 1E9DA 1TUEA 2YY7A 1AGPA 1P4RA 1IJKA 2NXNA 2M6LA 3DKPA 2QD2A 1WVGA 3ZNQA 3UT5B 2IPMA 1FVFA 3GOQA 1JNYA 2P2SA 2NTJA 3FVVA 1RPTA 4OLHA 1R6TA 4L16A 2PRIA 3T1QA 3MQ4A 3TQHA 3DCIA 3T3HA 1ZU5A 1ZVJA 3SZOA 5CLQA 2EKLA 3E7XA 5F1PA 3ZE1B 3SXJA 2WYOA 3CR7A 3ADOA 3I61A 4PXAA 2QVLA 3LUJA 4W1SA 5I9SA 4FM9A 1QH8A 3HCOA 3N8KA 3GP8A 4PFJA 1KFJB 1WB5A 3FF1A 5B1HA 4B7CA 1FLDA 3HZOA 1WABA 3PIDA 1OU4A 1ADCA 1JSRA 4HATA 3H2SA 4LMRA 4BRSA 1Z82A 4CF6A 4OXQA 4CEHB 1DOZA 2CFIA 3O0DA 2OQVA 3EFBA 4D3FA 1QB8A 2GZMA 2VZEA 3B1KA 1N6LA 4GNRA 4UATA 3W5SA 2HF2A 3FYUB 4YYEA 1AQJA 2WLTA 3SM9A 4LE1A 1FXWF 3GGGA 5I7RA 2Z04A 2G5GX 1L4UA 3SQLA 1U63A 3CH4B 5IT4A 1V43A 2UYGA 3KUKA 3VR5A 3QIAA 2PZLA 1N33B 4WRRA 1F2TB 1BS2A 3FTEA 1HM5A 3UXEA 2AZMA 3G8DA 3ICWA 1QFZA 4CWAA 3CRQA 3GQVA 2LCIA 3OJEA 4DNPA 4G0WA 3AVOA 1E79D 1VRWA 2VSYA 3GZNA 3JD1A 1GUBA 2XT9A 3TLGB 4FJ1A 5FUVA 2WJ6A 5FL7D 1NE7A 2AWOA 1ZU4A 4IH1A 2WWGA 1NE2A 4U8HA 2NXJA 4FW9A 4Z9FA 5A1TA 2ZRJA 5HILA 1ORWA 1CF2O 1FC0A 2QAIA 5JBNA 3CGGA 2NT4A 2GYWA 2RK3A 4ROTA 4G0UA 2RAVA 4ESHA 1E1LA 1WXQA 1XMVA 1EXWA 1KAQA 4O0MA 4QYMA 7AT1A 1G6OA 1R4MA 3EPPA 2RB4A 3GXOA 4IFEA 2IWHA 3W8NA 3KQVA 1DQZA 5IKMA 5JS6A 1W35A 3V6MA 1Z0IA 3HB9A 3UT6A 3GGCA 3WL4A 4IG4A 2ANBA 2V5UA 1FMCA 4FOSA 1MB3A 1R18A 5FOXA 3VFDA 3KKEA 2GHRA 1A1VA 1J6UA 5CG1A 3UW1A 1GAQA 1PFVA 1NN3A 2PZFA 5KYKA 3AKCA 2AQ8A 4TTPA 4ASUA 3TGLA 4OX9B 1JF8A 2DLCX 5KAMA 2R5WA 1KEWA 2P9HA 5F3WB 1CT9A 4QREA 3FDJA 1J2YA 4LRTB 3JYOA 3AEXA 1MJNA 1JQDA 2J3JA 2D74A 2HLHA 2HWWA 2PMFA 2ZTUA 1J7JA 4GMGA 5M5BA 5L6MB 3GNTA 1T1JA 3NHMA 3ACBA 1UQTA 3B1FA 4Y8VA 1I0ZA 3NP9A 4DRXA 3BTUA 1G19A 3VXKA 4DDUA 2R1ZA 4IHAA 4A1OA 1E99A 3TB6A 3RVLA 2XUFA 3EOZA 2QVCA 4X1OA 3LS2A 2VT7A 4ZJUA 1RI2A 1RVDA 1MNQA 1BFUA 2YW9A 4M60A 4PPQA 4RKWA 1J49A 5DYGA 3TFQA 1GTSA 1HZJA 1UH5A 1SZDA 5DGIA 3M89A 3F6EX 4KFTA 3A04A 4AMGA 1Q7EA 2WK1A 1E0DA 2FOIA 3UO8B 2I3ZA 2XDQA 4P3XA 1GN8A 1TAQA 4TYMA 3FSRA 1MCZA 2P91A 3UENA 4FCCA 3EZFA 1CUHA 1QIHA 4A8PA 4U63A 4IZ6A 3H8VA 2Y1WA 3AUFA 1KYXA 1OBCA 2GVDC 3RTEA 1GGKA 1W2WB 2N47A 4DT1B 4EGSA 3HB1A 4FZ5A 1QWOA 1TZ2A 3OZ7A 2ZCJA 7ADHA 1YMQA 1K9SA 3NVKI 1PFKA 4Q5IA 4CTNA 1I36A 2YHIA 2G80A 3BWYA 2J3KA 2HA2A 1EVIA 1SK9A 4AULA 2WYVA 4IIGA 5IM4A 2DFPA 2B8NA 2ZJ7A 1OKKA 1L8LA 3HN7A 4N54A 3R7DA 3RVMA 2YWGA 4YCNA 3ZVRA 2I4IA 1QZXA 1WW2A 1TCUA 2VP2A 2A9FA 5H7XA 3ESQA 3K6SA 3EYWA 3IPAA 3R5XA 4U39A 2L69A 4N5MA 4L5CA 2ISQA 1HE4A 2P3QA 3RHTA 1EHYA 1M0WA 1UAGA 1Z45A 1G9TA 2B4YA 3ES9A 2FOXA 2AJCA 3MJDA 4QJ5A 4LECA 4ZOEA 1PWEA 3GUHA 2XSZA 3C3XA 4QD3A 5SY6A 3ZHQA 2GDZA 3A3KA 4BWYA 2H4ZA 1YQEA 3S5JA 4CG1A 3JQGB 1DEAA 1GGNA 4KQHA 4C89A 3CA8A 1J2TA 2JCBA 4GOMD 1LDNA 3DBRB 1RLOA 1YR7A 4YS6A 1U28A 2A0UA 4IMPA 3TSAA 1TZMA 4BO1A 3FCEA 5H5JA 1OW3B 2A1UB 3EMKA 1B43A 3IQIX 5H4HA 3DS8A 5NLLA 4DAEA 1ZGZA 4WK2B 5M3BA 1GPAA 2HLNA 2B8JA 2RKOA 4PYNA 4XUEA 3TZEA 4EHFA 3PS9A 4HZUB 5EWLA 1C4WA 3IOEA 5CXQA 2HQBA 5H3HA 2C29D 5HZGA 4R1LA 5JO0A 1DP4A 3D31A 1IBKB 1N8NA 2WJAA 1JAHA 3IGFA 4CL0A 3H0KA 2DFDA 5T6BA 5KTTA 1JZTA 3IAXA 4Z1MA 1GU7A 4EQ6B 2O8NA 4KK3A 2HIMA 4H1WA 4JIGA 4KIUA 5FPQA 4C03A 1N92A 1YK0A 3VU9A 3THXB 2R66A 5CHEA 4ETNA 1O8CA 1C9EA 1M1YB 2OK7A 2OESA 3AONB 3F6CA 3H5OA 4ND8B 4UFOA 4BWFB 1NXVA 4KQMA 4OK3A 3OZIA 2YV4A 2NZYA 3BIXA 3MMSA 2Q1YA 2EP7A 4G1EB 1EE9A 4UVDA 3STUA 1TTQB 3G68A 3NATA 1XRRA 4KR0A 2IZ5A 4E4YA 3P4XA 1U7WA 2HCRA 3GEHA 5H4GA 2H9IA 4EYSA 5IVHA 2JAWA 3VO2A 3UAGA 3EYAA 1GCIA 3FTCA 2O0LA 3EFHA 2C8KA 4ES6A 5K9ZA 4B9EA 1Z4OA 4FFSA 4ENTA 4LDNA 4II2A 4EJSB 5LYYA 2LD4A 4MPPA 4NMLA 1UBGA 2AMFA 2RGDA 3SSAA 4F60A 1IM8A 1DELA 4CLEA 4WCFB 2KB0A 3UWDA 5KYUB 4BMVA 3VKWA 4FEAA 4N7RA 2BGMA 1UMDA 3VAAA 1XZFA 4M7PA 3GMIA 1BWPA 1ZONA 1XWIA 5HKBA 1K8RA 3VJRA 3M4JA 1VL2A 1N3LA 3GLFB 1QSGA 4NDAA 2GYYA 3HZRA 3LPMA 4IV0A 1S2GA 4JBHA 2HA7A 3ACDA 2PG3A 4DCCA 7MHTA 1A04A 5K3FA 3RSGA 3K7EA 3K2QA 4LZWA 4KWTA 2GT1A 4KQIA 4XCXA 3GU3A 1OC4A 3QZUA 2D0OB 4JOCA 2A1IA 4I9FA 5D3MA 1VJGA 3I0NA 1FFAA 4LKOA 2WJ3A 3FB1A 1FTNA 3OKAA 3PEUA 2BPOA 2X6RA 4QTUB 1UXIA 2GSWA 2FUKA 5JCOC 2ZM6B 1BDHA 3BWXA 2EX4A 3MAJA 5HMMA 1JEQA 5J2UA 1DRWA 4ISCA 4OP3A 3O8QB 2X4LA 3EXHB 4UQOA 3DFKA 3QUTA 3ZWVA 3CVUA 2Q8PA 1XZIA 3E1KA 1ESZA 2ONCA 1XYVA 2X9GA 3I9JA 1A5ZA 1GNLA 1RQRA 3L1UA 4JDUA 4QRHA 5G3YA 3VDRA 4KWCA 2ZRBA 4DMFA 2ZB7A 3LX4A 5KO2A 1AUOA 4NL4H 4W7SA 1V48A 2PMCA 1H2RS 1DFIA 4MICA 5DSTA 2VNSA 5EP4A 1S2OA 1X19A 2ZE5A 1P2UA 4LHZA 3PQFA 4BP8A 1C8KA 2RGXA 3JVUA 3L7JA 1JXQA 1KBOA 1LZKA 2YHSA 1BG6A 4L5YA 1W4LA 3TW8A 3PXEA 4LGCA 3O8DA 2PXXA 1KY2A 3IAS1 1R0CA 4YMWA 3P2KA 2P0EA 5JAHA 3U4IA 3RIGA 5ADUS 2Q4BA 2VDVE 4NECA 4OQXA 4PZPA 3DMGA 2PNJA 4B73A 1YZFA 2W6CX 3ZX4A 4HDNB 1QQAA 4IIVA 4CT5A 1JWAB 4R9UC 4DMRA 3RWMB 3L1IA 4WADA 1VB5A 2EEPA 5B3AA 3QM1A 1CQJA 1O54A 1UBEA 3U2QA 1QTQA 3CONA 1VIDA 3G2OA 4TMVA 3TQCA 3VO1A 3VPHA 3AG5A 1Q50A 2GM9A 4RMNA 5BSGA 4XD7A 3DCJA 2HMUA 2IZ0A 4HLQB 2VHZA 1KL7A 2VJYA 3D8HA 4Q9DA 5B64A 1SR8A 2FVXA 1T15A 3HUUA 4XIJA 1U0TA 1FX0A 4MVYA 4CRWB 1OTHA 4BQPA 2PX6A 4JELA 4DIUA 2BR5A 2C9YA 3OZVA 1K75A 1XQWA 3T3OA 3FFTA 1F38A 4UU1A 4IUBS 1X6VA 3TM5A 3F49S 3ZCQA 1A9QA 3SQDA 3GLKA 2O7SA 2O48X 2QVBA 1U2DA 3VKFA 4EG1A 1RWMA 4L51A 5BW8A 4DJJA 1RLUA 1V8ZA 2O54A 4JB3A 5EJEA 5DLDA 3UF0A 4FGJA 4KV9A 1V5IA 2EKQA 3O9MA 4OQDA 4I4LA 4QYIB 1SUAA 2ZYTX 3M6LA 5GQSA 3L4BA 3UHJA 1OXBB 3QNMA 2DTXA 4J1SA 3HKDB 2P4QA 5JAMA 3L6BA 3UOAB 2IHJA 1SD1A 2XNHA 3IAS6 3QUSA 4OMDA 3PTLA 5CLGA 4C0KA 4EW1A 5KU1A 2UKDA 2PUGA 3RE1A 4YLEA 4YJFA 5LKAA 2OENG 3IQWA 2IU3A 2IOFK 1QCYA 2X6QA 3CBGA 4JB0A 2MCFA 2PSJA 2QPOA 3I23A 4P3YA 2V65A 1LPMA 2I2WA 3HBAA 4M8SA 3CJRA 3P9SA 3STYA 4DEXA 5L4SA 4EKNB 5BVGA 2ORIA 4BN4A 1KEZA 3THOA 4QFDA 5EZSA 3BH0A 2IYOA 4E22A 2FUG6 1AKTA 2YWRA 1YMVA 2GKSA 1VMEA 3AOEC 2R8XA 5K0FA 2V7QA 2UYHA 1JR4A 4X7MA 4REOA 1MJGA 1Z06A 3ADDA 1N1DA 5CXUA 3WIEA 3BAFA 1URPA 4RW0A 1FJ2A 1N6RA 3BWCA 3F9IA 4YV1A 2OHFA 4O5AA 2XEDA 3T3GA 3PQ8A 3PKIA 4LBWA 2ETVA 4F2HA 5HUHA 4KNVA 4UTOA 3L7AA 4AW9A 3EPLA 3CVOA 5CXXA 4COKA 1EXMA 1QP8A 3C7TA 4AKGA 2WIJA 2DGDA 2J7PD 5FCDA 3JYLA 4DLXA 4NY1A 3E3NA 4GMHA 4O4IF 2ZB8A 4MYTA 4Q4AB 2X0IA 3EEQA 2R751 1WUHS 2BI8A 4B0PA 2JATA 1IWPB 3EUEA 1RZVA 1R9NA 3V6LA 3F9RA 5KOHA 3F5FA 5H9VA 3E81A 4LI3X 4RL6A 5TX7A 4EMUA 1NHGA 2WJPA 1EDBA 3N86A 3MILA 4ZD6A 1PKXA 3E7FA 1B8VA 3HGMA 1AXEA 4FNGA 1ECGA 3CH5A 4RPIA 4TKLA 4YRTA 3ND6A 1YB1A 5AJHA 4G81A 4YUWA 2GZ2A 1EB9A 2R6GA 1UMKA 5I8PA 3RWBA 2Q3FA 3HY4A 5DJ5A 4BKMA 2OEPA 2Q4EA 1SC4A 3RK4A 4KRFA 3HWRA 3OLVA 2XA2A 1JW9B 1OFUA 2GHIA 2JAHA 1XSEA 4TS3A 4XPIA 3R6DA 1G3RA 4C7VA 2AMVA 3I4CA 4M9ZA 2Q7DA 4GDFA 2Q62A 3GEBA 2QZPA 1OUMA 2GXSA 1XTTA 2L0XA 1Q92A 4RYLA 2M32A 5BWCA 4DV3B 2WABA 4RFVA 2QUKA 2WDZA 1RMTA 2RH4A 4KRXA 4YRDA 4JJFA 2PGJA 2X0KA 3D4LA 2J46A 3REQB 5C8ZA 5KJEA 1XXHA 3KTOA 2VT2A 2OMKA 3N75A 4MS4A 4TL8A 1DXQA 5L45A 2YWCA 4WASA 4PFQA 3OQ6A 2NO0A 3CR3C 1AGNA 4TUYA 1DRVA 2R4TA 3UG7A 3PHLA 1U2GC 3K9GA 4Q01A 5C7LO 5HCUA 1ETUA 3FI9A 3SYKA 2XITA 4AUEA 2AZDA 2G67A 3FWYA 4LYHA 2XNDA 5DPMA 4BNZA 4CEIA 3UWKA 3LLVA 4PN7A 5AESA 5EESA 1VIAA 1FX1A 1GFZA 1P6QA 1Z8NA 4PCVA 5JY6A 3RFTA 5GIOE 1V4BA 4L0QA 4MITA 4D3XA 2IE0A 5ALKA 1FUUA 2D8MA 1I51A 1N2CB 4D8VA 4CIWA 1CLEA 4BX8A 2RI1A 1K2VN 1UBNA 3DZFA 2GPSA 2LCFA 3B1YA 3MD0A 3IKLA 4OOFA 3X1YA 4JUFA 3JQ9C 1INLA 1C9JA 1JNXX 3AIKA 5AVXA 2ZP1A 1V3TA 2BUBA 1F1BA 2E5FA 3EIOA 3LGSA 3OSZA 1R00A 3PKJA 4M46A 3L6UA 1WHTA 4AZSA 4UTRA 4MVJA 4OHFA 5HF9A 4BQQA 1J8DA 1UKVY 3IT1A 4GHWA 5EJ8A 4Y1RA 5HJEA 3H6HA 2WHEA 5ITSA 2RJNA 4EEKA 3S2IA 4RETA 3L8YA 2Z2XA 4HNAA 2WFMA 1ZSNA 2J5RA 2FPIB 3ETDA 1N2GA 1QAQA 3I2FA 3QYJA 4NCNA 2XNDD 3NIGB 1B2RA 1COWD 1N5JA 5AOCA 5ARBA 2B94A 1X80B 1TA9A 3O2NA 4EBBA 2BGRA 1ZLXA 4FYVA 4HLCA 1FYFA 5A0FA 2LXNA 2C4UA 1TZKA 4Q4JA 4YTEA 3TMYA 1CE8A 4DQXA 2GA8A 1E2LA 3H16A 3P2IA 3RIYA 4LRYA 4AQ7A 3HP1A 1J2UA 1PIWA 1H1LA 2C0PA 1KEKA 1P80A 4Z3KA 2QLFA 1D4ZA 4ZOAA 4L1KA 1R66A 1QCCA 1WCV1 2ICAA 2JIBA 5DHRA 3S1LA 2IELA 4IGIA 3ON5A 4TSKA 5FL7A 1SQGA 4GPZA 4YRMA 5I9LA 2Z2JA 4FT4A 1CTQA 4X20B 5KNDH 5ER9A 2LIPA 3O2QB 3WY9A 4ESEA 5B12A 3JAKA 4IKOA 1Q5PA 1EFVB 4FS3A 4MDHA 5K0BA 4BEBA 4O2LA 1TD9A 5E1BA 4X6XA 4LDRA 1ZRHA 1LK7A 2ENUA 2KBFA 3DHYA 4A91A 3QYFA 2JVJA 3WDLA 1AS0A 4M89A 1EK0A 2DLDA 2YKGA 3HO1A 1AUPA 1GZ3A 1NURA 2FDXA 3QKSB 1Z0ZA 3FTPA 3I2GA 3K9HA 1SCAA 1H2ZA 1OAKA 1BU5A 1ECPA 1SXGA 4MB2A 3ANMA 1TRKA 2YVUA 3HV0A 3BDAA 2O0HA 4A2PA 4PM4A 2E0IA 2QUZA 1Z0DA 4L8WB 5E8RA 3AEKB 4H7IA 2QQFA 1Z4IA 3I5XA 2PQ0A 4R5HA 3DEJA 3ZH9B 3OM9A 2JJ1A 1EQ2A 4F93B 5JDIA 4KLZA 3QWAA 4II7A 4ZCLA 1J39A 3HNPA 1N9GB 3K9LA 2TYSB 1V11A 3SZ3A 3IQDB 4NIMA 5JAIA 2XADA 1GPBA 1D9ZA 1STOA 2JH9A 3OCZA 4MGYR 1T43A 3JQ8B 4FR0A 4JCCA 1QIFA 3Q5DA 4MKFA 4XD2A 3PNVA 3SC4A 2C4KA 2PXHA 1QG0A 1I4TD 1T24A 1L4KA 1FP1D 1XRPA 1J06A 3FRHA 1S2MA 4G5YA 4NMHA 4NLLA 4X8HA 2NP7A 4MRNA 1ZXXA 2EX0A 4PO9A 5ALOA 4BLTA 3JQAD 3FTFA 2BFDB 3EARA 1VA5A 3KD2A 4PCUA 4Q21A 1JKJA 4R40A 1D7AA 3KO8A 4BXOA 3O47A 1V1RA 3GEPA 1LEHA 3Q3VA 4P54A 4WK0B 1QPBA 5L40A 4GICA 2C7OA 2ZAIA 2UYCA 1J56A 2QPTA 1FQOA 2XWJI 5AK4A 1ZCAA 4OYYA 3RAFC 3DVAA 3EDMA 1JR3D 1NP6A 4H4EA 1RKVA 1TVMA 3AUKA 2MSNA 1NJ8A 3TD2A 4BZWA 3D5QA 3E70C 1JHYA 1HUQA 1L7VC 3W5VA 2WFLA 3RK0A 1FUEA 2F67A 2WMDA 4GPAA 4LRSB 4UHEA 2WTAA 1MA0A 1E7WA 2M1XA 2P8SA 5KX5B 2XRMA 3NOOA 1ZGBA 1DI0A 2FPMA 4KEAA 1II8B 4YQZA 4TXJA 2NVUA 3LUAA 3HDGA 2FW6A 4J76A 3GBVA 2XKAA 4OJNA 1U8ZA 2Q3JA 2R68A 1YTUA 1ECLA 4BQNA 1LSSA 4YJ3B 2W6OA 5JVDF 2Q3EA 5A5EA 4FMCB 4BMPB 1ILWA 3N87A 4HWOA 4U6NA 3R77A 1JIVA 1K6XA 1NJ1A 2PRYA 4PBRA 4CKCB 2RGBA 1KK2A 3HJNA 2BELA 4UEOA 2OGUA 2BFFB 1ZVKA 3ZKWA 2ODTX 3I28A 4DM7A 3Q85A 1EWRA 1JX6A 1W5FA 5LYJB 4O4HA 2YYAA 1M72A 1XN4A 4FNOA 3UGJA 1O8BA 5CR9A 1JR3A 2IUEA 3DC2A 4ENQA 3IAFA 4JS0A 2GPBA 4WV3A 4JR1A 3A2KA 4B7UA 1FYWA 3NEPX 3ECSA 3IA7A 3K8YA 2ZRPA 4HVTA 3IMFA 4JLMA 4RVCA 4TM7A 5EPEA 3PLAE 3NTVA 3IUEA 4ACAA 3AH8A 3UAOA 1R37A 3EGXA 1AKUA 1U3TA 1BX3A 1P1FA 1V11B 2C61A 1QKJA 3WB1A 4AG6A 2BE9A 3OZAA 1QE5A 3TH5A 3WICA 4MDEA 1W93A 1H8EA 1XVAA 2ZS8A 2M2IA 4B2LA 3QVWA 3AIOA 3MTAA 2JHPA 5TQ0B 1ZK4A 5IDXA 1E62A 3G5LA 3WHKA 3EIWA 4EUNA 2XHZA 4P53A 3HA3A 3SR3A 5AVRA 1RAFA 3M6VA 1EWVA 2R79A 5AJXA 5AUNB 1J07A 3OF5A 1CDZA 1BGVA 2EJBA 2XMZA 3L40A 3TXAA 2NVBA 2F1OA 1BVRA 4X8MA 1OC2A 1WMBA 2FPLA 1Z5GA 3C70A 3SKVA 3AWIA 3PGJA 4LF4B 1M6VB 4KJZA 3B85A 1GAJA 2FZCA 3TXXA 4PGAA 3PQEA 4WXYB 3D3KA 4IS2A 1T0BA 3S70A 3U3ZA 4X95A 1XROA 3QLUC 4ZT5A 5IRCD 5FOVA 4ZEVA 1PTJA 1ZCFA 4CJXA 4B83A 4KXWA 1Q7BA 3EXIB 3T3PB 5L8VA 3KELA 1QLJA 2H65A 1UMCB 1PJTA 1W94A 3IV9A 3Q3GE 3KBBA 2YMMA 4NRDA 2B35A 4ZQEA 5G4KA 3T12A 4IP0A 4OLJA 3U4DA 4CGZA 3BE8A 1N7IA 4BNFA 1LVHA 4RVDA 3RHSA 1KZ7B 3O82A 4RWEA 3ZVNA 4QULA 1J24A 5BN3B 2B9VA 5K99A 5LQNA 2HFKA 3MCWA 5FOSA 5AVYA 3HUFA 2P35A 3U7RA 4B75A 4IV5A 4HS4A 1L5LA 1F14A 1I0LA 2JHFA 1XU7A 1AK9A 3FDZB 4C07A 4ZZ0A 1CCWA 1SZPA 5DH9A 4A8HA 4EJ6A 2Q07A 4JMPA 1II9A 2W43A 1GZ5A 4Y6SA 1CUYA 4IIXA 2NO1A 3AF0A 1Z5UA 1B0UA 2I9KA 1N5LA 4DZTA 1O77A 2V1XA 1UKEA 3L0OA 4WKGA 3TEJA 1WETA 1Y6QA 3SBEA 3G0IA 2J0UB 1X0XA 2PKCA 4OFZA 2CXUA 3G2LA 2PGDA 1SHKA 2KJQA 2OV2A 3OZSA 4PRZA 1KMNA 4JEIA 3OEHD 5KDDA 2R2GA 2VJMB 4EPRA 1AZSC 2VF2A 4O4HB 3NTUA 5LIPA 5EMHA 3DXXA 3IBYA 3NASA 2XGSA 3BXFA 1DJNA 1ZJYA 4WA7A 1YZVA 1JILA 4LKRA 2BAGA 2FPPA 4HNGA 4EHHA 1CJBA 2MYTA 5KNBD 2C1EA 3OLZA 3PX2A 3UV6A 5ALMA 1RAGA 1NY6A 3IAHA 3U3KA 3EDYA 3VDNB 4EHIA 3CWZA 4FC7A 4IEIA 1NPDA 4PC2A 5DM70 3Q8LA 1NW4A 2XQFA 1MT0A 1Z36A 2ET6A 2X23A 3JAWB 2JFYA 4PZDA 2ZOSA 4QUDA 5G0VA 4CL3A 3EJ6A 3R0ZA 2VYVD 3R0IA 4GAEA 1M1NB 2X40A 4Y2PA 5FULA 3KEFA 3ZY4A 3TPZA 5T8KA 4WD3A 2VWPA 1A96A 4EABA 2EZ9A 5ICEA 3JWIA 3H1PA 4R3NA 1I7QB 2IH4A 4WHMA 4K7JA 4WI1A 5DCUA 1PHRA 2NQTA 2UDPA 2VAWA 4J1TA 5IN5A 4CM8B 3NDBB 2O8FA 3SIPA 2YC2C 4I8IA 3GFSA 3NWJA 3ANXA 4CCAA 1L4MA 1NVUQ 2C3MA 2VH5R 3DULA 3HO8A 1XLVA 1GSHA 2HYDA 3G2NA 3RSQA 4NQRA 1CC1S 2Z4TA 4IDEA 3FVRA 5ALHA 1PL7A 3IBTA 3SS9X 4NZZA 3ABZA 5B1SA 1Y1QA 3OM1A 4LJYA 1PNVA 4ENUA 3LKVA 2AZ4A 3MLEA 5ARCA 3WA7A 5HF8A 3BGDA 4S1VA 3NTXA 1WUKS 1M1UA 2ORED 1KH3A 4PYQA 4O02B 3FNHA 4POAA 3WXMA 2Q27A 1S9DA 1E1MA 1TJYA 3EODA 1PR3A 3SP1A 5BMOA 1R0XA 1X7XA 2CL0X 3BCUA 1MRZA 3NUGA 1D2MA 1VKJA 2FPGB 1Q3KA 2VCEA 3LHDA 3RBZA 2PV0A 1N0HA 2Z08A 4O1HA 1X8XA 1SA0B 2FTKE 4A92A 4WQMA 2A14A 3JR7A 3TQOA 3WYDA 5E7IA 1ONSA 2R8OA 1JEAA 3K9CA 4KLRA 6NULA 2QYTA 5KOHB 2G7MC 1ONNA 3KYDA 1XD9A 4IPTA 1WB4A 4FXOA 2AE1A 5KWVA 3BJZA 1JAYA 4Q7JB 4ZEMA 2EFCB 1NVDA 3IAM6 4P86A 1MIHA 3OOHA 1NR5A 1FFSA 5EYPA 4L9RA 2CDRA 3WGGA 5KTPA 1N5IA 2LIVA 2RGAA 1ND5A 3FTQA 1KGDA 4LJKA 4F4CA 4WUTA 5IAEA 4JXKA 2ORWA 3CY6A 5F73A 4MLZA 3A26A 4IF4A 4C3VA 2TRSB 2RGEA 1GWNA 2QT9A 5F3RA 2FV8A 5MF6A 3FMFA 1ISSA 3LW7A 3GZTB 2X14A 4BAUA 5BRNA 1F8XA 4F9GA 3IR7A 4JC5A 1MB2A 3RAPR 3TRFA 2CXTA 3NPMA 4RLFA 2H31A 1ZDMA 3PD7A 4CL2A 3RYCA 4XB1A 4B0OA 4UVHA 1T8RA 3O91A 1CRQA 4KLAA 3S8MA 2WA2A 5ERGB 4KC0A 5BSFA 2CCJA 4XE5A 1UFVA 1SQ6A 1ZBDA 4KGZA 4PRKA 2I3GA 3FKQA 1K6EA 4RZ2A 1V1MB 4UUNA 1P2VA 2EZ4A 2XAAA 1DO2A 3AHGA 2OFXA 3QJ5A 1QHNA 4HI0E 4NAUA 5KKAA 4KAFA 2B0CA 2QENA 4JLUA 3VKVA 2PL9A 1V6CA 4DLPA 2B34A 4LZPA 1E2GA 5BQPA 3ZCSA 5IN4A 5ITWA 2QRUA 2VPXA 2HMVA 5BYKA 1RYDA 3Q0EA 4O2AF 1RYBA 2Y77A 5FAKA 2XB2A 3KK0A 4JH0A 5UKDA 1DWOA 5HE8A 2XLBA 2FR0A 3ZU3A 2BEUB 2R4UA 2H5EA 1I1HA 3GWGA 1Y3HA 5DCLA 2Y1DA 5E4FA 5J47A 4FI3F 3A1TA 1WXEA 2D1SA 1YVRA 4DLZA 4N40A 1W581 2HJVA 4XVCA 1E9VA 1OX5A 3G5AA 3X2EA 1RJDA 3J81A 4XYGA 1JDSA 2IVFA 1CB0A 2ZJYA 2FEXA 3AHEA 3RANA 4LYAA 4MW1A 5LD2C 1EGMB 3DA8A 3BFVA 1P5JA 3UWMA 2IZ7A 1M1XB 2XNKA 3ISTA 3WWPA 4CMGA 2JZOA 1FRFS 1U0OC 1JU3A 4FNMA 5K0CA 1BDMA 1KNXA 3TDKA 1T1IA 4KLNA 1WF3A 3ETJA 1XXLA 1P3JA 3IUPA 5IF3A 1LV8A 1GNVA 4MUXA 3RUAA 3WFZA 1IULA 4JXJA 5HKLA 2DR0A 4MB6A 3PQCA 4G0OA 2PL5A 1OCEA 1YULA 4NX2A 1QG4A 4D9NA 1HT1E 1B15A 3FETA 5DO9A 1T0JB 3MBKA 1A1SA 1ADJA 1V7PC 1VC2A 3S7TA 2EJUA 3L6CA 4RHYA 4JNKA 1RRFA 2WJGA 1Z4NA 3EMVA 4IBOA 1XLUA 3GMTA 1AKRA 4PIMA 3ZGLA 1E2JA 5F9MA 1GNPA 2ZYSA 5IK2A 4YCMA 2V4ZA 4ZU3A 3DLBA 1V3VA 3DF7A 3OF2A 3MM4A 4J1NA 1JR2A 5DLPA 3J80A 4HDKA 1Q1AA 5GZ1A 1VMKA 1XTUA 1XBTA 1M2JA 4CEJB 4X9XA 2XUAA 2IH5A 3EAGA 1OV4A 4CU5A 3COPA 3ZC3A 1DSSG 4HEHA 4HGZA 3ZIUA 2YJ4A 1NVGA 4QQ8A 3FB4A 4LWPA 5HEKA 4DEVA 1P0QA 1XPUA 1WNFA 3FBWA 1GZ6A 4R3UC 2HT6A 3GLHE 4MLDA 4TTIA 4J7CA 4JBNA 1SXIA 1RYEA 1SCJA 1YQWA 3MCVA 3IKMB 1H0SA 3MFYA 2WTNA 2X3YA 2C0CA 4ER5A 5B37A 4MULA 3HGQA 3W2EA 4CM4B 1XCJA 3MTQA 5DTMA 3NI2A 2AR9A 4LOIA 1EYZA 3RUEA 4PINA 2WD8A 1D2EA 1TEVA 3ETCA 5FRDA 2JGRA 5AIBA 5ICSA 3LUFA 1UEJA 2FPPB 5DZSA 1M2NA 2GCIA 3NHLA 4DMKA 1XAJA 2P2YA 4YB8A 3HBJA 5IDQA 3MHTA 5KWJA 4PZZA 3TR6A 4NKRA 1JIUA 3ESRA 3OOSA 1W5TA 4HKTA 2Y9MB 4UXIA 3A4MA 3TLZA 2JCYA 2A33A 3WHLA 4FS8A 2BFOA 3U3XA 1NLFA 2ZROA 1T1RA 1XDZA 2K7ZA 5CPBA 5AHWA 2BFEB 1KI3A 3DMHA 2HLDD 3N7UA 4W9NA 1Z74A 5KJFA 2N3ZA 3LT5A 1Z8HA 1YQUA 3GLTA 1K7XB 2PZAA 2QTBA 3DOFA 4BNTA 1JIJA 5A5DA 1P0PA 3L77A 4LC1A 5JROA 5TARA 5HKAA 5B3JA 4NXNB 4H7JA 1Y5RA 4DFDA 1N3IA 2P6NA 3ML1A 5BSVA 4B3RB 3EBPA 1E3DA 3P2MA 4HK4A 2QOEA 2V98A 4P7GA 3ROZA 5EGNA 4A0RA 1KQFA 2Z6AA 4HX9A 5DBEX 2ZJFA 1P74A 2VPPA 1H94A 5ECWA 5B6JA 2QTCA 3C15C 3WGLA 2FXVA 1F8GA 2O2SA 4U9IS 4Y2GA 2HWUA 3U56A 1Z0KA 6PFKA 4PTLA 5IJXA 5KYYB 3TZKA 4DSTA 3QV2A 5DNWA 1OFVA 2C5AA 2IOFA 2IYXA 1JG3A 3GOHA 4HN9A 2EZ8A 4HRYA 4KRGA 3AFOA 3BL6A 4PSCA 1F0PA 3DQQA 2C04A 2E4WA 2VF7A 3KQUA 1FUYB 4WJZA 3WKDA 1NQOA 3V8EA 1X92A 1Y9JA 3LF2A 5F9HA 3P4YA 3C4JA 4N9QA 3FSJX 2CLDX 4JU8A 2O8FB 3L4KA 2ECFA 4JQOA 1TE2A 3QOFA 3ENKA 2RI6A 3THXA 2XUJA 1COWA 5EVCA 5D1NA 4H0FA 4EQ6A 4PNPA 4LOHA 4N3BA 2DERA 1R8JA 3OTHA 4O08A 3OM8A 5BSTA 5JW6A 1M1NA 3OLWA 3LYAA 4M6WB 4O4LA 2HIGA 3BC1A 4WH0A 2GXAA 1IN4A 3E35A 3WGTA 2H1SA 3ROEA 3VZCA 1FTWA 4QM6A 3OWXA 4MWDA 4DIEA 3A1WA 4ABYA 4HUTA 2ZJ6A 2PKXA 4L28A 2B8EA 3VR3D 5A5VA 1GEGA 4YQYA 3EWIA 4BHTA 5ES4B 3TZCA 5SZIA 5EPOA 4DNXA 4FB5A 4MARA 3DBHB 1TA4A 1HE5A 5KSZA 4PX3A 1GKLA 3DGEC 4PPNA 4YA6A 3QE4A 5HIMA 4TKVA 3FROA 5E4YA 2HSEA 3S7ZA 3ZWYA 5K2OA 3B5IA 1G4HA 3FPEA 3FJOA 3LLSA 2NO5A 1VECA 4FLMA 3NLLA 2CV2A 4E5YA 4C6TB 1L5MA 1XALA 2G9VA 4JBYA 4KAAA 1W6UA 3H17A 3V8BA 4BDTA 4PRYA 2WUEA 1VGRA 1BTOA 3RFUA 2ZJ1A 5GV8A 4HNQA 3SOZA 4CF3A 2AC2A 1CFJA 4KXQA 5A4JA 8LDHA 3BT7A 4PSDA 2IHVA 2X9NA 4PS1A 5J2UF 2GN0A 3VC1A 2HK8A 3ZHUA 5BNWA 3GLIB 2IDJA 2X0DA 4WAUA 2NG1A 1TKBA 2PZJA 2IPLA 5FWDA 1L7DA 3UJBA 5ICCA 1J8MF 3IVRA 4EHAA 4YMLA 3BCRA 3A06A 4HX2A 1XE3A 1CRWG 4N18A 4W8HA 3FNFA 1DC4A 2QIPA 3CE9A 2FY8A 2FW7A 1IEXA 4Q6BA 2FP3A 2AEJA 2CNWD 2YBEA 3BXXA 1MT3A 1NKSA 3AOEA 3KJQA 1U2EA 1OLXB 3WGKA 5JOQA 1O97D 4KE9A 4R9VA 1ZBQA 1ZFNA 2OV1A 1H2HA 3KPYA 5DHUA 5AI6A 3JXEA 2BDUA 3R24A 2PMEA 2ISCA 5KX5A 1G4AE 2Q29A 4JNCA 3R9KA 1SU4A 1R6AA 5AKYA 1XELA 3H8WA 2BI7A 2NGRA 3SZLA 2PUHA 4MVJG 3QVGA 5YASA 2PUBA 4LVNA 4HQOA 2NAFA 1CY6A 3PICA 3W5JA 1Z34A 4CN9A 4N1AA 1CQIA 3DZKA 4D81A 3P9YA 4K26A 4B4VA 2ZUEA 5DNEA 3UK7A 2JGLA 1NI5A 4Z5XA 1NKTA 2JKYA 4OGKA 2EXXA 5BORA 2BGNA 2RHGB 2FLWA 1GZ4A 3W6OA 1DAEA 1KJ8A 3BSSA 5FBVB 4H1HA 3UGKA 3L02A 1SXJE 1UKCA 2BDEA 3IAUA 5EZ5A 3KSZO 3W1EA 4XJSA 3OCYA 4BBZA 5I4KA 5JZOA 2E4VA 3SFVA 1SQ5A 3U1VA 3E15A 3IP3A 3DV0A 4FJ2A 3JQ8A 1A8UA 3DHEA 1Z7WA 2FZEA 3ONWA 2IW1A 3EGXB 3OCXA 3DVRX 3BJIC 1OHHD 3GJXC 4NZMA 3FPGA 3CZ5A 3DHWC 3SLKA 5K3OA 1N9GA 4KE7A 3DV0B 4F71A 3DMPA 5JARA 2XKJE 1HLPA 4P1ZA 1R5BA 4DV0B 4J0CA 5ILQA 2QTFA 3LXRA 4AP6A 4MGKR 2YL2A 4LY6A 5HKKD 4TWIA 4LNUA 3BBPA 5FPYA 1GA6A 4JUDX 4BMSA 2H85A 3F4KA 3HLYA 5DNCA 1C1YA 3N2IA 3DEIA 1CXZA 2P2DA 2ZUTA 1YAHA 1N2ZA 4QICA 3W5DA 2XBMA 2O7QA 3KTAA 4HXFB 3G85A 2H7XA 3HSSA 4K81B 1T8WA 4OB6A 4TTQA 5EIOA 4CW7A 2B99A 5ITZB 1T5HX 5KCMA 5F78A 5KOIA 1G8GA 1NXQA 1IH8A 3AM4A 3NQ41 4EY5A 2NZVG 2GILA 4EI9A 1T0HB 1C3VA 1Y1LA 2HJSA 3GZNB 3K2EA 3RVRA 3TLGA 4AJLA 4DTCA 4ZAWA 3LVFO 4MQMA 1QJ4A 2CFRA 2O2HA 4M1TA 5AD1A 1U99A 5IHPA 1RCFA 4HWKA 5IC5A 3L07A 3OAAD 3PVCA 2A3RA 2H3HA 4BVJA 1ZD3A 2GARA 2MINA 2PX4A 4BNWA 1OWMA 3KVOA 5JNRA 3C87A 4OQEA 4IMRA 2NTNA 1YNSA 3K1YA 4BN5A 1AKQA 1YRQA 3TGPA 3W4KA 4GPEA 1C1DA 2OUKA 2ROQA 3BRCA 3BVPA 4WKNA 5IARA 1NF3A 2REOA 5C52B 2ZE7A 4EWLA 5CLFA 4NEGA 1C4KA 4E21A 1LVGA 5A4DA 1SFRA 2D62A 1UZNA 3TUIC 4G9EA 3K6RA 2Z0MA 4YI3A 1YZKA 4LHXA 3QOXA 3TW4A 3JD2A 3IDFA 4AN4A 3A6ZA 2H1CA 3LU1A 1GA4A 1R0WA 3L7BA 4BXOB 2VDKB 5IG2A 2OECA 2P2GA 4I5EA 4RFLA 4XKJA 1PT7A 1QVWA 4Z86A 3GLIA 2ZI3A 3WLMA 1HORA 4ZCRA 3HRKA 4JQCA 2XW6A 4F4UA 4ZICA 4FDLA 5T4FA 4ZT3A 5K8CA 3S2SA 2ODPA 1BHJA 4A73A 3WYFA 4LX0A 2ZCVA 3BL8A 3O3MB 4WFJA 2I87A 2VUSA 5EHNA 3QF4B 2W6ID 4IGEA 2FA9A 4NNPA 1F6DA 4ZAZA 2JRLA 1JHXA 1YS2X 5IAJA 3KTDA 2OCXA 4ZU1X 3U0VA 3WNQA 4DCUA 4OFXA 4HH0A 4GM4A 2ENWA 1JJAA 1ZA2A 2OC9A 3I9MA 5HS6A 1M2HA 5FQNA 3IUBA 1M5UA 1DFGA 1JXAA 1VKNA 3LX5A 3HDHA 2AW3A 5I7OA 3LAWA 4YASA 3W7VA 2WOOA 1Z29A 1SHJA 3P32A 3VZPA 1NIJA 2QR3A 3ETLA 1ENPA 3ZYCA 2JC3A 4YAGA 3THWB 3QI2A 4PO3X 1SBYA 3RASA 1GAWA 4OLBA 4CDNA 3P97A 1U0RA 1Z56C 5KKCA 3VUFA 4WBNA 2I4RA 2ZUVA 1GVHA 4BJHB 4I3HA 5JNWA 4OV6B 3EIQA 3N0XA 2PU7A 2ZBPA 1U3DA 4NPCA 1AD2A 1TU3A 4GF5A 1JFSA 2OQIA 1KS2A 4L4ZA 5CLLA 2JFXA 4Q18A 4C06A 4NF2A 1BXRA 3GFVA 3HCPA 5JAPA 4K40A 1ODTC 2PSDA 2CJXA 1FRNA 1IG0A 1V7CA 2EIXA 4M36A 4WOKA 1N4AA 4ZAFA 3ZUGA 5BNTA 3KKNA 4FR5A 2C7VA 2D8AA 1SVOA 4BZZA 1T0IA 1Z7BA 1JP7A 2OGZA 2QNBA 1T5IA 3FX2A 3GYBA 4DR2B 3T54A 4JLWA 3G8BA 1LC3A 3TCXB 1M7GA 1CS4C 4OHBA 4US0R 4YK7A 4RCZA 3KUCA 3E9MA 1R64A 3NOXA 3VPAA 1H3FA 2XGGA 2ZT6A 4E5DA 4NCAA 4WY2A 3BZUA 4DQ0A 4IEFB 5CDSA 2G08A 1V96A 1P7WA 2XLCA 3EIHA 3NUQA 4JLDA 1C3OA 1TTPB 1YA4A 4MVJH 2ERYA 2BUCA 4Q4DA 2Y0DA 3P45A 4YECA 4AJIA 5KYWA 3ZDXB 1UJCA 4B3GA 3AJ8A 2Q1TA 3Q7TA 1HY3A 4JDPA 4A7PA 1EPUA 1SEVA 2RHMA 4PG6A 4YLGA 2SCUB 3OX1A 4ZT2A 3DNFA 3V4FA 4EEZA 4N76A 2EC5A 1XZGA 4FBGA 3M83A 2CFSA 2F3TA 4N0QA 4XUDA 2O6HA 4Z9YA 2DWOA 2GZRA 4I9UA 4N5NA 2Q28A 3W2IA 2WIFA 2FQYA 4C1NA 2JFGA 3R7WB 3URKA 1WKBA 1AY0A 1VHDA 1TA0A 3PHGA 4JQSA 1IZZA 1JYSA 3VSEA 3WMEA 3ECCA 4E6EA 4B3DA 4JP1A 3IEIA 3V4VB 2ZSHA 3GX1A 3JWHA 4XIIA 4A26A 3MUNA 1XU4A 2NO4A 2XECA 4JB2A 3A4IA 4CCYB 5BW4A 4ITVA 2R6HA 1PQYA 3WIDA 3AVWA 4I9GA 4LOKA 1JPVA 4YI5A 2QMOA 2ZAMA 1XTKA 4Q00A 1Y89A 3K5PA 4AY5A 3K1JA 5JTTA 3GMDA 1CYEA 3KQHA 1USWA 2VNJA 2I3DA 5E7MA 1Q3TA 3ORYA 2IXEA 4I36A 2OPHA 1CNMA 3PCTA 1QP7A 3EXG1 1A4UA 3D8TA 4KWEA 4LRQA 3L43A 2WSIA 4TMKA 4J6EA 3WFJA 1VXOA 4V2UA 3M7IA 3EXFB 5D51S 2VRWA 3PR1A 5FDFA 4YT5A 1JLHA 1W1WA 1UZLA 1YE3A 3DC7A 3DLIA 3OEHA 1Y3BE 2QHXA 3LQRA 1N57A 3VTKA 2W2MA 2GN2A 4Y6QA 4BMDA 1W1IA 3AF3A 4JC8A 2QX6A 4YJFB 3E03A 4P35A 2JF0A 4Z0HO 4D0LB 4OG2A 4FR2A 1U4OA 1UPAA 3UEOA 5JUWA 4DG8A 4OB7A 1B6SA 3FWHA 3O3OB 4ITUA 2PA3A 1QFYA 1RE0A 1W73A 1D6NA 1TQDA 2Y71A 3CRMA 4QDUA 2QRGA 4I9HA 2IE8A 1XP5A 3NIWA 3SD7A 4MJ3A 2A5DA 3RU7A 2W2LA 4NENB 4X45A 4MMXB 5IJWA 3PQDA 1Z12A 2R5NA 1BQ4A 4RPCA 4X44A 4XTRA 5AICA 4YRNA 3BGIA 3GFFA 3PC8A 5K2MA 2I4LA 4PHFA 2A57A 3G2PA 1E5XA 3EIXA 1ECFA 1OAOA 3MZ0A 3PU6A 2YIDA 4HPWA 4QAJA 4BC0A 1CW2B 5G02A 4LXXA 2D0IA 1NVMB 1JMVA 1JT9A 4MQLA 4WFKA 4OSOA 1XKQA 4C04A 1FNSA 3ZLVA 2ZSJA 1VIMA 5ITVA 2N42A 1KE2A 3EWSA 5GJBA 3HBNA 4GU5A 1IFXA 2Z95A 3LYHA 2MSEB 4HNUA 5C5IA 3DAFA 2GFQA 1IBCA 3RIMA 2EAUA 2C3PA 4JJ8A 3U49A 1T9ZA 4F9EA 3WAGA 3GLGE 1YFLA 3ZDCA 3QTBA 4Q4AA 3WWOA 1CUJA 3N28A 4REQB 1VE1A 4UARA 1DJOA 4EB8A 3TD9A 4ZEOA 3HL0A 5H1YA 3IE1A 1U0BB 3OE1A 3X1WA 1EFAA 4UUQA 1C9YA 2H16A 3GPIA 1BMFA 5LBUA 4CR7A 3W3AH 3LA6A 5B6PA 4MKXA 3K8OE 1DAIA 4AJPA 3AUXA 1N4DA 1NW8A 1V5EA 2FGJA 2Y66A 3BD8A 4BLQA 2OO5C 1KHTA 4QNNA 1RLJA 3FPLA 5G41A 4BX2A 4P32A 4Z0NA 1TOAA 4K0RA 4CKEA 4RTJA 3B6MA 2FHPA 2BFEA 5JECA 1BJRE 2Y67A 3HCEA 4DA9A 1GTL1 4P5EA 3U7HB 5IMBA 2F6RA 2JCXA 1UPBA 3V80A 1F5SA 4G5GA 1LSUA 1OGJA 4IINA 3B1VA 2XIQA 3JD0A 4K1LA 1AHHA 4JJ6A 1ZJ4A 4X6UA 5IVIA 4IXNA 2KMLA 2GAFA 4CPDA 5ENZA 2WYWA 1HGXA 4JCOA 2C3YA 1YHZA 2AMJA 1JWBB 1M34A 3LIPA 3T5DA 4LJLA 3U81A 3P2OA 3HBLA 2UU9B 3FSGA 1BJTA 4HFRA 1M7BA 2AC7A 4LJ8A 1SJ9A 3IEXA 2YUTA 1G16A 1PFYA 1AC5A 2Q9AA 1A7AA 3COVA 3L2OB 1DTWB 1FLNA 3O8QA 3LKDA 4RLSA 3SHOA 2A58A 1O96A 1XZDA 1GOTA 1PS8A 2XGMA 2DBQA 4C4AA 3I1JA 3L7CA 5AOAA 3VDXA 4DE5A 3ILYA 5E6SB 1QE0A 4Z99A 4O5OA 4DXDA 4GOJA 4WSOA 3H8SA 4DQVA 3OJOA 4K46A 4B32A 1MA3A 4R68A 2IS4A 1GKUB 4ZPJA 3L9XA 2ZW9A 3RYIA 4PO8A 4XFKA 1AVTA 1IWOA 4G4IA 1RCTE 4KB5A 1PJ8A 3I2KA 5FA6A 4D5EA 1NF2A 4B7ZA 3WIVA 2G36A 2COUA 4B8YA 3RC8A 4C7XA 5KSYA 2N1BA 1JU4A 3WMRA 2HT1A 2CV0A 2BH9A 1J90A 1TKRA 2AFHE 4YMTA 1P9RA 1SMKA 2VHTA 4Q3BA 2YXPX 4IJVA 1BFDA 1UMDB 4GNKA 3SIWA 3X2SA 2F17A 3CXUA 3NHBA 4EB6A 2G06A 2FB9A 1LRJA 1TEXA 5KWSA 1R3UA 2ZREA 3BN3A 4D8TA 1CY7A 3A4VA 1QVAA 5IEJA 4GZ5A 2BZGA 5BR8B 1DKUA 3ROQA 1QH1B 4OLFA 1XCLA 5AW6A 1OT3A 1GRCA 2V7EA 2CVHA 4HAZA 3C3YA 3IL2A 5TJHA 4QX6A 2AIRA 3ZU2A 2HJWA 4AUNA 2BFMA 3BF7A 3KBOA 3LZDA 3SLGA 1L5HB 2VHWA 3KJNA 5KOJB 5KJ6A 3QOWA 4BASA 1E4VA 1T9BA 3MA0A 4EFLA 1CEEA 3RJMA 3E8SA 4EPXA 1GL7A 4B1FA 1APBA 4GYKA 2HCFA 1KQGA 3UUFA 1E8MA 2CW5A 3G79A 2J4FA 3PC8C 3ZCPA 4BP3A 4KVZA 4TZTA 3VGPA 1L5YA 5SV2A 2PQ6A 5EIBC 1R6BX 3THSA 3U4QB 5DTQA 4QDOA 3S1SA 1NN5A 3L4SO 3TX6A 3K1AB 5H59A 2BEUA 3I2JA 4UE6A 4YDHB 3W7BA 4D0GA 4JI5B 5EP3A 3PDUA 3FUUA 1J0BA 1I2BA 1OBHA 2FQWA 4S0ZA 4ND5A 3LX6A 1TVKB 2VYNA 1A9YA 1CR2A 1OYVA 3DZIA 4Z8YA 1SU7A 5CNKA 3WRXA 3I8SA 4YRPA 4XGKA 4XA8A 1Z3IX 5ANRB 4Q4LA 1UBRS 4KKVA 3KX2A 4HQRA 4UZSA 1AB5A 1Q6ZA 2OWDA 1QP4A 2YJZA 3NYRA 4GGOA 1BKYA 3RM3A 1VL0A 2Z56A 3T7EA 4A6DA 5C1BA 1T2CA 1MB4A 4QOSA 5C3UA 2X8LA 3GGJA 4TLDA 2VSFA 2A0XA 1SUDA 2PR7A 2B36A 2GZSA 4JLKA 4RS4A 1NVXQ 4MWSA 2RMKA 5SYNA 1G5IA 3OOYA 4NE9A 4DVJA 4FHDA 2WF5A 1IN7A 4ZYVA 2VSOA 2B9EA 1T9KA 1CEQA 5EZYA 5BV2P 1HFJA 4G5RA 4MIOA 5IX8A 4RDHA 4EPVA 3IO5A 4TKUB 1M0TA 3A9UA 1BEEA 4YMIA 5IJ9B 1JECA 1VYTA 2C2OA 1W85A 3KOOA 2ZBQA 4TTAA 1QV7A 4XM0A 3S27A 4GR5A 1VG0B 4RMHA 4FHCA 2AG5A 1DC6A 1SVMA 5K6AC 4WLOA 3E23A 3VHXB 2DT8A 1RBMA 3F8WA 5AQEA 4UPDA 1CY2A 3BK1A 4KI0A 2IBTA 1OE0A 1QHGA 3OFVA 3KRTA 1EB8A 1P18A 3CNNA 1NVKA 3DXZA 5KVAA 3GQBA 5CB6A 1KPIA 4JD5A 3TQSA 1NYTA 5KVVA 2K87A 3D5TA 4KITB 3WYNA 5FWYA 1GCGA 4MVJP 1VI2A 4HB4A 4OTZA 1N9ZA 2OFOA 4NFLA 4RULA 1KJWA 2WNHA 3B12A 3BCSA 5LOVB 2HOQA 2WICA 3WGYA 4AUMA 2J5KA 2K7FA 3KZCA 4L5IA 1O57A 4RANA 1Z13A 4ETWA 5EQJB 2P2NA 3I1IA 1WTAA 2D5CA 1WULS 3WADA 1Z6TA 2ZK7A 5AW4A 3S8EA 4YJ2B 4GMDA 3G17A 1U5BB 1BAPA 4MO9A 1UDAA 1S1MA 1WCIA 3PC4A 3R0XA 4DR3B 5J43A 2P6RA 1OH5A 1RHUA 5FYQA 5CCEA 2DKOA 2Q3DA 1YJQA 4PGGA 5FLKA 5ER6A 5JJ5A 1Q19A 4I1SA 3C3BA 1OFHA 3V1LA 1N2EA 3ITNA 3OKCA 1K2WA 2Y0EA 2FVYA 1B41A 4L72A 4UBMA 4R2LA 1Z38A 4ZOLF 3VO8A 5AW8A 2A4MA 2B5OA 2IEBA 2XB4A 3E5HA 5DV9A 3CLSD 1GILA 2VJQA 1II0A 4MB0A 1EGAA 1XF9A 4RC9A 4CM8A 1K6IA 2AL7A 3ANYB 3MMPA 4NJOA 3SS7X 3T1OA 1HSZA 1JKMA 1YZQA 1Y6RA 1J0XO 1C80A 2I9PA 1NDUA 2PVPA 3CZMA 3DE1X 3G6KA 3IDAA 5HIIA 2FW9A 4ZYZA 4OXNA 2ZI4A 3ZJ5A 2YIJA 3BXPA 3M5WA 4Q24A 4B6FA 1YJBA 5DHQA 5GV7A 4N3NA 2I78A 2Z2KA 3C14C 3EPRA 3K15A 4QU5A 4IJKA 5FPPA 4Z53A 3BAZA 3ZVLA 4TVKA 1A2BA 4RJJA 2FZWA 1QG6A 2G07A 1TC1A 2XV1A 1U94A 1V8PA 2I76A 3JAWA 2WG2A 4G8JA 2COKA 4TWJA 2BM9A 4DBZA 2HDOA 4UCQA 1RU3A 1RI5A 1ZIOA 4OFBA 3HXTA 1K88A 4ZCQA 4BEVA 1T0UA 4ZDJA 1I4LD 3DTNA 2NO9A 5JXJA 3K71B 1U8XX 2SKCA 1CUCA 4F11A 4QBKA 3UUEA 3BH7A 1K0FA 2V6MA 2F4NA 1H4VB 2I7VA 1EIWA 5JRZA 3H7AA 1JAIA 2BKXA 3QTTA 5CK5A 4IWYA 2PSFA 3GGDA 5CA0F 1HE3A 4ND4A 1FP4B 3ZPXA 4POOA 5BWLA 5KEIA 3ZXUB 2Q5HA 1FFGA 4DY4A 1RPZA 1UOEA 4LXYA 4QEKA 1W36D 1TMKA 4LXGA 1LGYA 5IW8A 2W2XA 2Z5LA 3PCXA 3FYUA 2GRAA 4G2TA 3JALB 3F5MA 1BS1A 5H82A 1ZD1A 2J32A 4FYWA 1E59A 1CQWA 3CLKA 1QGED 2PT6A 3QQ5A 2WT8A 2I2XB 4QT4A 1YS9A 3FZYA 1QH8B 4HTAA 4D1YA 3FH0A 1I30A 1OXMA 5L6LB 3L0BA 2Y76A 4E07A 1TEZA 2POCA 1ST3A 2OCPA 4BYGA 3D3EA 4E4RA 4WNIA 3WLIA 2RKBA 3AOGA 2XXJA 4EVIA 3RQIA 521PA 4MV9A 4AX8A 4E46A 4F8EA 5M04A 3QLJA 5E38A 2O3SA 3UT5A 5IDYA 4UFNA 2AS0A 1DDOA 4C0WA 3FW1A 1BXRB 1I80A 4J75A 4H60A 3Q2IA 1K27A 1QDLB 1T3TA 2CLCX 3C6YA 2IXTA 4P0PB 4N39A 4X71A 1UWCA 1TVEA 1SPBS 1MHPA 3GG2A 1RQ7A 3HNRA 3K05A 2CXRA 3K94A 1A97A 2BFCB 3I76A 3IDSA 4WLNA 4DCSA 2QL9A 3BG5A 4A27A 2W6QA 2NIPA 4LXTA 2FZ5A 4BGEA 3HB7A 3FMOB 1S7GA 1PR1A 4DG9A 3G2JA 3CBQA 2GXUA 1ICEA 2IY7A 4IFBA 4U2EA 1LU9A 3SYLA 2EJTA 2WWTA 2WZQA 2X5NA 2OHGA 1CYDA 4G86A 5A9SB 2XMDA 1SVIA 2CLLB 3HRIA 1BOOA 2GPNA 1O1YA 3G0GA 4OUKX 2WKRA 4LY3A 4CV3A 4RJTA 2PU5A 3P2YA 3SQMA 5LZ9A 3A9VA 5LJIA 3Q9SA 2O5EA 5A4KA 4LUCA 1UBJS 3QEMB 1ID8A 2J48A 3BIFA 3FMVA 3JQBC 3HU3A 4HFMA 4H7EA 3I6IA 3GY0A 3ONFA 3JVIA 1KBQA 4G1CA 4QWWA 2JLWA 5TXGA 3JAKB 3ZOKA 2OBNA 1NRIA 4JQYA 3A10A 1YNOA 4Q9KA 4JASB 3QPWA 1FXSA 4ZEWA 1MRSA 3I05A 1ULBA 2C1XA 4NYIR 5C81A 2IHUA 3KKZA 1G21E 3QEMA 5AXBA 4F3NA 4RA6B 5LYJA 3B2NA 4XIYA 1ORDA 3WQSB 4X7PA 5A05A 3WK6A 2QZJA 3BEDA 3LX8A 4W5HA 5FI3A 3R7FA 2NPFA 2QE7A 2IP2A 3Q8WA 2YJTD 4OCZA 5FEMA 3WL3A 3DUWA 4XWOA 2PMKA 5MN4A 2HMAA 1JKXA 2QI9C 3JATB 5GMOA 5C31A 3QK7A 1I24A 2Y0CA 5HZMA 1ZJJA 3ACCA 1TC2A 2FQ1A 2A9RA 4WKOA 1X2EA 2O3TA 4JLAA 4I19A 4MP3A 2GZDA 2BF4A 4XARA 5BMVB 3NMUF 4DHWA 3O75A 1W4CA 3HJAA 4Y0AA 5JMOA 2GCEA 4LV6A 4B9AA 1A0OA 1U2DC 1YU6A 2BFCA 4C0BA 4YLYA 5F76A 3PCRB 4KSBA 4QO8A 3HV2A 4UTXA 4EKYA 4OUDB 4BNXA 2XJ9A 3U5ZB 3OQVA 4NULA 1Z88A 4RPGA 1W88A 3BMNB 3B9RA 2NU9B 1P0FA 4XWWA 3D2LA 1LY1A 3D59A 4E0BA 1TMYA 3ZCXA 4E14A 1FVHA 5JSFA 2A9QA 2XHEA 1RAHA 1YACA 2FN3A 4N3AA 4RQTA 3FIJA 2OOSA 1M6NA 2VN8A 1HG1A 1IXSB 4XTCS 2DFNA 2QZSA 4N49A 4E88A 4EO4A 3VHLB 1MAWA 1S2LA 4E7OA 5IT5A 1WW8A 3F4BA 1QYWA 2JFNA 4IZIA 4TWZA 3WBKA 1JKJB 2YV3A 3M5CA 4NCXA 4IOJA 2BFDA 2XE4A 1VIVA 3QVMA 2ZJ8A 3IODA 1XMQB 4Q4HA 4WXMA 4CF7A 1M67A 2V5VA 3AVTA 4HFNA 3OP1A 1J7KA 4QWMA 4C7OB 1C50A 5L4NA 4J90A 2I34A 2PGOA 2R3SA 1G60A 2W5UA 2DPGA 3EB9A 4MZDA 3ZNNA 4WKCA 3RC2A 1EEXB 1XX6A 4RD3A 2V7GA 3ZY2A 1B74A 3QKWA 1Z83A 3QXJA 4IDQA 2IX3A 1JMYA 1UCFA 4Q34A 3T6KA 4GLFA 4FLFA 1MHTA 2G40A 5J1SB 5KMGA 1UIMA 1Q95A 1H1TA 3QU7A 1EUCA 3W3AD 4CCWA 4W1PA 3CWQA 4PCLA 2V6JA 4PX2A 3CW8X 3PHJA 3EUWA 1GZUA 3UTDA 1C14A 1Q44A 1Z4JA 2H9AA 3AEKA 3GT7A 2CBZA 1Y7TA 3REQA 4LC0A 1ZCBA 1TT7A 1K1EA 4R7ZA 1YDWA 2ID7A 2HJHA 4ONEA 5FBWB 4YIKA 5D5PA 2BWJA 2EW2A 4G56A 2V97A 3DPUA 4MMYB 3DLTA 2JI7A 2O3UA 3HKEA 3N7AA 4RDCA 1RXWA 4ZOLB 4ZAVA 2EW1A 1QNLA 3FZGA 4HTFB 1XCMA 4LVUA 4TRJA 2D3TA 2NPOA 2VYVA 3KQOA 5SZHB 4IXWA 4R2XA 4X24A 1NMQA 1QH9A 5FI5A 5CH3A 1PG0A 1U3UA 1Q91A 4KUEA 4DDTA 4J94A 1G5PA 3SJZA 4CIYA 3CR8A 2UV8A 2WUWE 3FCUB 2BGLA 2HHCA 5CB0A 2CXOA 5TE9A 5CDGA 1DZIA 2WHPB 2QGZA 2HK9A 3E84A 2HZ7A 2RCYA 4YRRA 2W2PA 1XJWA 2VJLA 2QTVA 2YIVX 4JA0A 2Y1KA 3ZHTA 3SS8A 3TDNA 4F4DA 2QX7A 5LXTA 2RHDA 3AVQA 4XLTA 3JQEA 4RFSA 3DW1X 4FFRA 5CVCA 3AJRA 4DPKA 1QGZA 1DTEA 4IR7A 1KMHB 2HCBA 5C8YF 5KS2A 5ISMA 4B4WA 4LF7B 3HJHA 3TKLA 3PX3A 3HABA 1E92A 4P6VF 3UMYA 4KOEC 1Z2NX 2PZKA 4RV4A 4Q1BA 3F5QA 3NXSA 4RF5A 4TN1A 4Y1GA 1ECCA 2YH2A 3G1TA 4OKSA 2C99A 5BPHA 2G5PA 1H8HA 2B8TA 1ISHA 2QAJA 2CL6X 1NNSA 2FEMA 2D0DA 3CM0A 3EUFA 4P33A 3TCKA 4D02A 2MHCA 4JLPA 4RY2A 3TFWA 1R0YA 2PPVA 3O03A 3SHWA 4AZ3B 2RHOA 1EAYA 4L4UA 3AW9A 3FYUC 4L9WA 2QD3A 3IDQA 1QV9A 3P0EA 4PSUA 3O5AA 4S05A 3BQ9A 4MQ6A 3SFTA 2RGGA 3L7NA 4JT2A