1THTA

Structure of a myristoyl-acp-specific thioesterase from vibrio harveyi
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
302
structure length
294
Chain Sequence
b'QCKTIAHVLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDHFAGLAEYLSTNGFHVFRYDSLHHVEFTMTTGKNSLCTVYHWLQTKGTQNIGLIAASLSARVAYEVISDLELSFLITAVGVVNLRDTLEKALGFDYLSLPIDELPNDLDFEGHKLGSEVFVRDCFEHHWDTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRTGHCKLYSLLGSSHDLGENLVVLRNFYQSVTKAAIAMDGGSLEIDVDFIEPDFEQLTIATVNERRLKAEIENRTPEMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOESTERASE
publication title Structure of a myristoyl-ACP-specific thioesterase from Vibrio harveyi.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Thioesterase
total genus 101
structure length 294
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02273 Acyl_transf_2 Acyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1thtA00
2BFNA 4J0JA 3AZOA 1C7IA 2AJ8A 1YR2A 1H2XA 5AI4A 4UHEA 4BCCA 1FFEA 1ODSA 2HADA 4B6GA 3O9MA 4KE7A 1O6GA 5J3JA 4BYMA 1EINA 5EIEA 3ANSA 3VKFA 2XMBA 2PU5A 1LPBB 1ORWA 5BV7A 5JYCA 1CUWA 4J3JA 4I3FA 4DIUA 2VJBA 3WKBA 3CN7A 1QIIA 1TK3A 4FWBA 4H18A 4KJXA 5AIAA 4UFNA 5LLSA 1C7JA 4YASA 4FNMA 5AI8A 1MX5A 4X3CA 3VVMA 4ZREA 3M83A 4KAAA 4QNNA 1XQXA 1BE0A 3R40A 2XUQA 5DYWA 4D9JA 2HHAA 4C88A 3O0DA 1DT5A 4HS9A 1LPPA 5CH5A 1E8DA 1RYYA 2PSHA 2WQZA 4CG3A 1XLUA 4K2AA 1HPLA 2W6CX 5CT5A 4WDRA 4CIAA 3G0GA 2H9YA 4MQLA 3WK7A 1WOMA 2XUKA 4XWGA 3ZV7A 2R8BA 2OAEA 5AP9A 5FOQA 2B20A 4B9AA 1JJFA 1WHSA 2WHRA 1JU4A 2HA2A 1FFAA 1LBTA 2QM0A 5DJ5A 5AKZA 4JYPA 2WUEA 3WWDA 2OXEA 4DLNA 3IUQA 4Y2QA 1FFCA 5BOVA 1ORVA 4AXBA 1DWQA 1DQZA 1ZOIA 2QTBA 3FLBA 4J7AA 1GPKA 2HRQA 1MT3A 2XUGA 1H2YA 1DWOA 1UK8A 4QLOA 4J0IA 5ALDA 3O4GA 5EHZA 1DX4A 4H0CA 4UBJA 1ZJ4A 3ZWQA 1TKRA 1JMKC 4HXGA 3BXPA 3OG9A 1L7RA 1ZI8A 4C4ZA 4X91A 3GA7A 2RHTA 2XUAA 4JH0A 4F60A 2B61A 2YH2A 2ZJ6A 4UHFA 2HU8A 4J0DA 1RWQA 3C8HA 3DLTA 4RE5A 5CW2A 3HC7A 4J0CA 3C43A 3ICWA 3N2ZB 3BJMA 2GZSA 1ZJ5A 2PM8A 5AKLA 5FP0A 1MNAA 2GBIA 4NZZA 2EDAA 1CR6A 4X85A 3V1NA 2JIDA 1ZIXA 3DOHA 4UFPA 2HFKA 4H35A 3D3NA 4P93A 4WFKA 3CCBA 5A2GA 4XIIA 1R1DA 2XMCA 2WIFA 4ZWNA 1Q83A 4OB7A 3ESCA 5K5EA 1SCIA 5I7UA 2QXUA 4BDTA 1QO7A 3STTA 5ALWA 2ZYSA 1W76A 4AN1A 2C4HA 3G0CA 2WJ3A 1LPAB 4OYLA 4FOLA 1XZCA 1ZD4A 1XQYA 3PUIA 4GXNA 5EHNA 1PJAA 3PFBA 2O2HA 3AFIA 5H3HA 4LHEA 2HU7A 3HI4A 2Y2VA 2Z3ZA 4OPMA 3KSRA 4BTVA 1ZI9A 2QVBA 5C81A 4UBLA 4BRSA 1UKAA 5ALFA 2V9ZA 5JZBA 4IQ4A 3ESBA 1WPRA 4DSZA 1VKHA 5AI9A 2ZSIA 1EDDA 3E3AA 1RP1A 4E46A 3AILA 3HJUA 3PUHA 3I2JA 5ALKA 1XZFA 4G4JA 4B83A 1XZGA 4F5ZA 4E14A 3IURA 3WMRA 4UHBA 4F21A 4ETWA 4KE9A 3FLAA 1LPSA 3B12A 2QRUA 5K3EA 1EVEA 1E3QA 3L1IA 5AK6A 5DTJA 1K4YA 1UKCA 1UK7A 3HRHA 4BAZA 3YASA 2JF0A 2HRRA 5JD4A 5C8XA 4RNCA 1WCYA 2RHWA 1WB5A 1XKLA 5CT6A 4BC0A 4KAJA 1P0MA 4G4GA 2IIVA 3TRDA 4EY4A 3L1HA 3R3UA 3HXKA 1R4ZA 3WWCA 2WIDA 4DYHA 3ESDA 4EUSA 4EY5A 4LKOA 3WKDA 3QH4A 3TJMA 3KXPA 4LYEA 1X2BA 4FKBA 1CUUA 3NWOA 4Q3LA 2DQYA 4M0EA 3O4JA 3BIXA 4UBIA 3KWFA 3H04A 1PV1A 3DD5A 2V96A 4QDUA 2BUAA 1USWA 2QKYA 2CMFA 1K8QA 4CIBA 1MTZA 4CCWA 4AO6A 3LP5A 5CXUA 1GXSA 4WY5A 3MUNA 1U2EA 5DLPA 1ACJA 1LLFA 1EB8A 4Y2RA 3QITA 2JBWA 3WWPA 2WM2A 1N8SA 4H77A 5CT9A 3H19A 5FV4A 3W06A 4BAGA 2I3ZA 5LZ7A 1T2NA 3IBTA 3UMJA 3A2LA 1QTRA 3H1BA 1ODTC 1ZI6A 2WILA 2WJ4A 4WFJA 5CBKA 3PDCA 4JEIA 1VZ2A 1ISPA 2R11A 5KWIA 3I2KA 3STVA 4GWLA 4AZ0A 2GBCA 1EHYA 3F97A 3I2HA 2V97A 3FSGD 3OTQA 4WCVA 5BWBA 2JGEA 2XUPA 3G8YA 4UUQA 1LZKA 1ETHA 2PVSA 1E66A 2O2GA 3HABA 3WK8A 2RIPA 4DMKA 1QOZA 2G4LA 4H7FA 5JAHA 4BC1A 3MVEA 4PO3X 1WHTA 2WUFA 5JARA 4C87A 3WYDA 1TCBA 4X00A 3IULA 1XZLA 4EHBA 2AJLI 1CUEA 3H18A 2C5FA 4HRXA 4HRYA 4PSDA 1JU3A 4KACA 3STXA 1MAHA 5HK9A 3N0TA 4G5XA 4LXHA 1XRLA 4OU4A 3G0BA 3AINA 2J3QA 1XRPA 1BU8A 4UBKA 3LIIA 1CUIA 3BF8A 1IVYA 1D07A 1UOPA 2XMGA 4OB6A 1H2WA 5LIPA 3F9CA 5ALJA 2J4CA 1BN7A 4ZV7A 3SC2A 3WWOA 3V48A 4BTLA 2DHCA 2D0DA 5E4YA 5AKEA 2OG1A 1NU6A 3G0DA 1YB6A 2OCIA 3DYVA 4ARBA 1CUXA 2XQGA 3T52A 1N5MA 3QMMA 1GQSA 1XRNA 5LKRA 1MX1A 4QDXA 2J3DA 3TEJA 4KE8A 5EGNA 1VA5A 3B5EA 3KD2A 2G63A 5CRIA 1TIBA 4ROTA 1FSSA 1XZHA 2Z8XA 1GT6A 1IUPA 2VJCA 1W1IA 1DT3A 1Q0RA 1OILA 5ALXA 5T4HA 4BZZA 3QM1A 1DX6A 1K63A 2OCLA 2XMSA 5ALTA 3PI6A 1W75A 4M0MA 5ALUA 1GPNA 3LLCA 1CUYA 3M3DA 4FFWA 1TCAA 5EIAA 2ZYHA 4DMFA 4KYVA 2PL5A 5EIHA 2VF2A 4G8CA 1MO2A 4FTWA 4KR0A 4U2DA 3M81A 4MEBA 1ODCA 3DNMA 2VT7A 5D7BA 3A2NA 3W05A 3FWHA 3RLIA 5AKJA 3NGMA 1F0PA 4RE6A 4GBGA 2HA3A 2HL6A 3H2HA 2G5PA 4AMYA 1Y37A 2WJ6A 2QUBA 4MJ3A 3KWJA 4TGLA 3GROA 2DCMA 1B6GA 3H2GA 5AKYA 3Q0TA 4KE6A 4QWMA 3EBLA 3V1MA 5ESRA 3VVLA 3IB3A 4FLMA 3V1LA 1L7QA 1CV2A 2D5LA 3DL4A 1JT2A 2VQ6A 2XI4A 1QIFA 5AKKA 1EDBA 1XFDA 1K5PA 4EA6A 2OAGA 2Q0XA 5CXXA 5EHXA 5DYTA 4J0GA 3WK9A 1VXRA 1YSCA 4KRXA 1IUNA 3MUOA 4PF1A 2PSDA 3LIPA 1ZGBA 1NX9A 2IX9A 2WG0A 4QDOA 5AOCA 1EVQA 4UBMA 2GBFA 2XUHA 3AUKA 4AB1A 4ARAA 1R50A 1AZWA 3JWEA 4HZGA 2C58A 4LYDA 1GGVA 3FLEA 4GHWA 1QFMA 4V2IA 4X7BA 3D2CA 5LZ4A 4JYMA 3LCRA 1XZBA 1E8NA 3AJAA 2BAGA 2C0QA 2QMQA 2XT0A 5ALPA 2WTMA 1C4XA 4FFVA 1ZD3A 5ISMA 2XLCA 1AURA 4LXIA 3S8YA 4XX1A 2B4KA 5SYMA 4PW0A 4UHCA 1SCKA 4FMPA 5ALZA 1A8UA 2VATA 3WWEA 5JATA 1Q0ZA 4DNFA 2YASA 2WKWA 5AK3A 4KEAA 1QLWA 4H7HA 1AQLA 1IZ8A 3ED1A 3DKRA 4QDTA 4Q82A 2PBLA 3S2ZA 4Y2VA 1THTA 3A70A 4C6HA 5JD5A 1MJ5A 4BB0A 5ALLA 3CCCA 1H22A 1JFRA 3WKCA 1HL7A 3E1GA 4U2BA 3R3WA 4G8BA 1YASA 4L72A 1PFQA 4Y2YA 2JGKA 4PSCA 1BS9A 5IVHA 4ZXFA 4C4YA 1BROA 5E4TA 5AM1A 2AXEA 4X92A 2XUIA 5FPQA 3H2JA 5HCUA 5AO9A 5AIBA 5AM2A 3HYSA 5ALOA 4DMHA 3DEAA 5LZ9A 3K2IA 3PICA 3FYUB 3ILSA 1CFJA 1H23A 5ALNA 3L1JA 1LGYA 4INZA 1X70A 1AUOA 2QR5A 3O9VA 1IZ7A 2WHPB 3FVTA 3ZI7A 1ZGCA 2ZVDA 4MQMA 1ZIYA 4H7EA 4P92A 3WA6A 3K9BA 5I9IA 1GKLA 3CN9A 4Q05A 4U2CA 2WTNA 1AMNA 3KOOA 4FBLA 2JGLA 5ALYA 3FYUA 2HU5A 2HFJA 3QYJA 1EA5A 1DQYA 1BCSA 2XUFA 3WJ1A 3QBJA 1MPXA 3GELA 1QIHA 2XE4A 5ALSA 1CUVA 1CLEA 1LBSA 2WHPA 3AIOA 1L7AA 5HFAA 2Y6VA 3IUNA 1CIJA 1QE3A 4FLFA 1MU0A 5A71A 4FNGA 1UWCA 3PF9A 5AK4A 3WZMA 3PFCA 1CUAA 4X90A 1X2EA 4B84A 4I4CA 2RAUA 4QE3A 2Y1KA 2CB9A 1QGED 3F98A 1UOQA 2VAVA 1YA8A 1WB4A 2JGJA 5LP1A 4N8EA 5K3DA 2LIPA 3DS8A 5IH7A 4OCZA 1EX9A 1A7UA 2EEPA 2ROQA 1R3DA 1G5FA 3BF7A 4OU5A 1QZ3A 1CUBA 2XLBA 3QPCA 1CQWA 4JNCA 5JAUA 3OM8A 4M0FA 2OGTA 1U65A 4UBNA 2C5GA 1MX9A 1THGA 5HF5A 3C6BA 2O7RA 4A16A 5A7GA 1CUSA 1UOOA 3PE6A 5JALA 3STUA 1YCDA 1CUDA 2OGZA 4AX4A 3C45A 1UFOA 4AMZA 3I2GA 4RPCA 4EY6A 1BEEA 5ALHA 4QA9A 5HK8A 3I6MA 3WL7A 3FCYA 1DWPA 2FUKA 1R88A 1H2ZA 4UBOA 2GBGA 2WIGA 3FNBA 2H1IA 3DQZA 4QDZA 1F8UA 4Y2TA 5AJHA 2Z3WA 5AHXA 3STWA 3D0KA 3W04A 2CBGA 1JJBA 2W22A 5DWDA 4UFOA 5K3AA 3H1AA 4Q3OA 3EIOA 4IH4A 1FFDA 1QO9A 4YX9A 5DTIA 3WIBA 3IUMA 1MNQA 4NS4A 4B81A 1OXMA 1XQWA 5ALEA 4HVTA 2Y6UA 4I19A 2FJPA 1QTIA 3IUJA 3F67A 4OYYA 4PSUA 3SWWA 3G9XA 1QIJA 3WIOA 3WZLA 1BN6A 3C87A 5CMLA 1CEXA 5KREA 4W1SA 3T4UA 2BCEA 4AO8A 5AK5A 2ZYRA 2GYWA 4J0HA 3A2MA 5ALIA 2I3DA 4LIPD 2B9VA 5HZGA 2WIKA 2IITA 3WK4A 2VA9A 1N5RA 5DNWA 4ZGBA 2AJCA 4HXEB 1NU8A 2I78A 3ZPXA 5DNUA 1CVLA 5AM0A 1F6WA 2CEKA 1M33A 3G0IA 4OSEA 5JAPA 3H2IA 2CJPA 5LZ8A 2VSQA 3I6YA 5HF8A 2WUGA 3R3VA 1IMJA 4DMCA 4G1FA 2QOEA 5AKXA 4BCBA 4QLAA 5A7HA 3D59A 4TVKA 1JMYA 3FAKA 2WG1A 3V9AA 1FJ2A 2YXPX 2JGIA 3EQ7A 3SX4A 5HFNA 5JD6A 2VAXA 5IVKA 4WFIA 4U2FA 3E4DA 3RM3A 3ZLVA 1Q84A 5A6VA 3ANTA 4H7DA 3NOXA 4UPDA 5C7YA 3R3ZA 5ALMA 1CPYA 5CH8A 2HA5A 2XUDA 7YASA 2O2IA 2E3JA 1LZLA 2PSEA 1DINA 5ALRA 4CG2A 2ACEA 1BCRA 4OD0A 3QPDA 5FLKA 4B0OA 1UXOA 2I03A 2RONA 4S0XA 1I6WA 4C4XA 1W6RA 1Y7HA 1U4NA 2DSNA 4GECA 1GKKA 1VE6A 1QIGA 1VOTA 5FDFA 3RKSA 1VE7A 2XMDA 1P0QA 3O4HA 3A6ZA 3K6KA 3X3HA 2XQIA 3G7NA 4EBBA 1HQDA 1A8SA 2BKLA 4BCDA 4L0CA 1DU4A 4B80A 1J07A 3B3QA 2JGFA 3FVRA 3O4IA 4PV7A 4X93A 3RK4A 3AZQA 3WL6A 3MGAA 5HKAA 4YK7A 4KAFA 3VXKA 1R9NA 3WJ2A 4DNPA 2RI6A 3W9BA 2JEZA 3IA2A 2XQJA 4MWTA 3DOIA 3R3XA 2RGUA 2Z8ZA 1CRLA 1GZ7A 5JZSA 4G4IA 2OCKA 2XMQA 5CT4A 1FFBA 1UK6A 2DHDA 4BP9A 3W2TA 1YB7A 1ZICA 1VXOA 3I1YA 4W63A 3IVMA 3WKAA 5HQ3B 1ZD2P 2JGMA 2ONCA 3DCNA 4FHZA 3DDUA 2C7BA 4OUKX 2BUBA 1EK2A 2GZRA 4OB8A 4NMWA 3WYNA 2OGSA 5CTAA 4BE4A 3QMWA 3BE8A 1W4LA 1S8OA 4BBZA 2ECFA 3EQ8A 5LZ2A 5EHQA 5JANA 4AO7A 3DJYA 4L3WA 4Y2XA 1CUHA 3AIMA 5HQ3A 4Y2SA 3IIIA 2DFPA 5E2IA 2HM7A 4Q34A 3C5VA 3OOSA 4HTAA 4N5HX 4EB0A 3I1IA 2XMRA 2HA6A 5I8PA 3CXUA 3I28A 5C8VA 2WUDA 1CUZA 4ITVA 3STYA 2WU3A 4W9RA 3H0CA 3C6YA 3ZLTA 4AZ3A 5K3FB 2FJ0A 5K3CA 1E5TA 1UKBA 2YYSA 5EFZA 2O7VA 1SC9A 5DYYA 4E11A 2QXTA 5LKAA 3EQ9A 5AI0A 3VDXA 5IKXA 2G5TA 2XQKA 3GZJA 4GDMA 4CI9A 1BEZA 2WHQA 4ZV9A 5K3FA 2WG2A 6YASA 1XZIA 3M82A 1GPLA 1VZ3A 1VLQA 5AOAA 4H7KA 5EI5A 3C6ZA 2WFMA 5D3KA 5FRDA 2OPHA 4BVKA 4BVLA 3FYUC 4WY8A 3R41A 4GEGA 3ZLUA 3R0VA 4BVJA 4DSAA 1UT6A 1P0PA 3I6ZA 5AKGA 2PPLA 3IDAA 4U2EA 4P08A 4X6UA 4FLEA 4NVRA 4WJLA 3BIWA 4YPVA 1P0IA 4DNQA 2X5XA 5AH0A 4TPKA 4B7ZA 1QIMA 1G66A 2ORYA 4N8DA 5IVIA 3WK5A 1QFSA 3C5WP 4G8DA 2VJAA 3D2AA 5AKIA 1K6EA 1Z68A 2X76A 4Q3KA 4J0KA 1DTEA 4KRYA 4BRZA 5JASA 4FBMA 2PSFA 3WL5A 3FOBA 1SFRA 5LYYA 4UHDA 5FKJA 5AM5A 4QWWA 4IO0A 5LZ5A 1XLWA 2XQFA 4Q1VA 2BUCA 3H2KA 1CUJA 3BJRA 4ZRDA 5IVDA 1T4MA 1KEZA 4Y2PA 4QEKA 1XQVA 4HXFB 2V98A 2XUOA 5HF6A 2AJBA 2CUTA 2XB6A 2VEOA 4JUIA 1WB6A 4J03A 4MWSA 5HKBA 2OLEA 5FPPA 5ALVA 1WM1A 3UUEA 1CUCA 4MXDA 3DYIA 1AC5A 2VJDA 5F4ZA 2H7YA 4Y7DA 3QMVA 5E4JA 4BDSA 4K6GA 1QONA 4H7IA 3C8DA 1Y7IA 3WI7A 1EK1A 4IH9A 2K2QB 3BL8A 2HDWA 2PSJA 1EDEA 2ES4A 3P2MA 1XKTA 2Z5GA 2QT9A 3HEAA 2QS9A 3UUFA 4ZI5A 3D7RA 3C70A 3FSGA 4K6HA 2HIHA 3U0VA 3Q8WA 1LNSA 3E0XA 1KU6A 3C6XA 5SYNA 4BAUA 3QVMA 3W9UA 4LXGA 3G02A 2QJWA 5JAOA 2ZSHA 4BP8A 4XVCA 3TGLA 2FX5A 1J06A 1YS1X 3AZPA 2Y2UA 4MEAA 4W1RA 1TAHA 1XZDA 3I2IA 3H17A 1QIDA 1SOMA 1G4HA 4Z49A 2QJRA 4W1PA 1QJ4A 1EI9A 5DNVA 4BE9A 5ALGA 5AKHA 1N1MA 4GW3A 2HA4A 5D6OA 2PUJA 2H7XA 2CZQA 1E89A 2BGRA 4FDMA 2QUAA 4Y9SA 1TCCA 3WL8A 2DHEA 4K5QA 5T4EA 1LPOA 1MN6A 3GUUA 2QZPA 1XZJA 4G9GA 3DL7A 3RARA 1JKMA 4DNOA 3VJMA 4AQDA 4E15A 1CUFA 3AIKA 3F8SA 4EY7A 4L9AA 3LS2A 3VJKA 3D2BA 5A7FA 1XRRA 4CCYB 3WA7A 2WIJA 4DGQA 1XROA 3OPMA 1YA4A 3WLAA 3D4LA 5K3BA 1QIEA 3GBSA 1UK9A 4X97A 1VA4A 3QZUA 5C8ZA 4U2GA 2DQZA 3JYHA 3HSSA 3BDIA 3VJLA 1U8EA 2OQIA 1LPNA 4PNZA 5KWJA 2WU4A 1TRHA 1A8QA 1TQHA 1HKHA 1XRQA 3HACA 4CCYA 1HBJA 2HA0A 1YAHA 1W52X 3D5EA 2VT6A 3JW8A 4RGYA 1XZEA 3SK0A 4C89A 1B41A 2NW6A 3BDVA 3NUZA 3FBWA 4MYSA 4N5IX 2PUHA 4Y2UA 4CG1A 1XZAA 4K6KA 1XZKA 5AI5A 4W1QA 4UHHA 4B82A 5CURA 2X8BA 4G9EA 3U1TA 2BJHA 4IHAA 4BATA 5A62A 1J1IA 1XLVA 3I2FA 5JZ9A 4A23A 2C0PA 1JJIA 3ICVA 3F96A 5ALQA 4DTCA 2OCGA 2DR0A 3G9ZA 1YS2X 3HLKA 5AM4A 3FCXA 1IUOA 5JADA 5CT8A 1E8MA 5FXMA 3FYTA 4XJVA 1ZD5A 3V1KA 4PQEA 4GI1A 2PU7A 1A88A 1J2EA 4QZVA 1QIKA 1HLGA 1GQRA 2WFZA 1AX9A 2VTVA 1UZAA 3HZOA 3BWXA 4F0JA 4CFSA 5T4FA 3R3YA 2XDWA 1BRTA 4X6XA 2GYVA 2WFLB 3EF3A 4X6YA 5CH3A 4AN0A 3O95A 2ZJFA 3WQHA 1R9MA 1CUGA 5HF9A 2OQVA 4Y2JA 1O6FA 3KDAA 4BZWA 4EZIA 2J4FA 1HDEA 3QPAA 4EY8A 3GFFA 5YASA 4X71A 1EB9A 2ZJ7A 2XMZA 2H7CA 1XZMA 1KU0A 2WFLA 2UZ0A 5D3ZA 1SCQA 2WSLA 3G9TA 1VJ5A 3WKEA 3WK6A 4DM7A 2HA7A 4IH1A 1JI3A 1AKNA 2BGNA 3OURA 3DKKA 4H7JA 5KBYA 1AGYA 2JEYA 4X95A 1WPXA 5BWCA 5FUMA 3VISA 4HAIA 2XUJA 1ACLA 5AICA 5AOBA 4C01A 1OCEA 2ACKA 4X94A 2EDCA 1EXWA 1MAAA 4B0PA 2PKYX 2WLSA 4B9EA 5AM3A 1G42A 4N8SA 3G9UA 1CQZA 1LPMA 5JIBA 4O08A 4WDQA 1F0NA 3OC0A 2CKMA 4MYDA 4B85A 5T4BA 2ZYIA 1XRMA 1EH5A 2GYUA 2AJDA 4P9NA 3PF8A 2P8SA 4GLBA 2PX6A 3ESAA 1YAJA 4A5SA 5AI6A
chains in the Genus database with same CATH superfamily
1RQ7A 2AC7A 1JHXA 2JVIA 1PGOA 3A1DA 3AY6A 1W581 3E82A 3G2KA 4DBLE 1U0JA 3K70C 5EVCA 3EVBA 2AJ8A 4KG7A 1YR2A 3FXAA 3WTBA 1L8LA 1ID8A 2A7QA 4OK6A 5AI4A 4OKNA 3SMVA 4B3DA 1EYZA 1ODSA 3QKRB 4B6GA 4FFMA 2QX7A 1E0JA 3EN0A 2Q4EA 3MXOA 3RANA 4CMAA 2JK0A 2OBXA 1R0CA 1O6GA 1NKVA 1P6XA 3O1LA 3Q3VA 4RMNA 3OJXA 4BYMA 1BDHA 1EINA 5CA0B 2AR0A 1E0DA 3VSDA 4MLCA 4C78A 3O4VA 4JIMA 1BJKA 5EIEA 2MJLA 1WBDA 3VKFA 2AFIB 2DPLA 1XF1A 2OAQ1 2QMEA 3HY4A 2KLHA 1LPBB 4J16A 3EFOA 2QN2A 1WEKA 2G04A 5L7TA 2ZBQA 5C4GB 2VJBA 3QV1A 4RZIA 3WKBA 2ENWA 3TLCA 2Z6QA 4FYIA 3SLRA 2UUAB 3IAUA 4CYMA 2B99A 3IIMA 4KJXA 3T15A 1ZBDA 4UAJA 1WQ4A 1HT1E 4UFNA 4L6CA 2XNJA 3LHFA 2A1UA 4KZKA 3GRRA 3MNFA 1KSJA 2Y9PB 5LQAA 1O9BA 2EBHX 3REFA 4BB6A 3PKIA 3QFTA 1RAHA 5KU7A 4Z6KA 4P35A 3E5MA 3TK1A 1WZUA 1C7JA 4YASA 4D9GA 3ZU2A 2PYIA 1XCJA 4FNMA 2C8KA 3WRWA 1MX5A 1VLJA 1MC5A 4MIKA 2FLWA 2XXAB 4QNNA 3EXEA 3O93A 2IYWA 4H3SA 4JY7A 4MVJE 4UNIA 1XQXA 4Y3UA 3VYSB 2AYYA 2Y1GA 3VDNB 3WLTA 2C3PA 1HRKA 3R40A 4C7VA 4CF5A 4D9JA 2HHAA 2OV2A 4RHEA 3DV9A 3KR1A 1XNQB 2QNRA 4MYUA 4L8VA 1VLHA 3IBFA 4IGKA 1DT5A 5EYPA 3T35A 3WNZA 4JI0B 4NE9A 4QYWA 2OZPA 5CH5A 1XMXA 2K5UA 2WWXA 3T7DA 2DYKA 4DEXA 2ISSD 2N75A 5JY6A 1RYYA 4E22A 2Y1FA 5IKOA 2PZMA 4D4KA 4QU0A 2BOVA 3THRA 1JZQA 5IABA 3T1HB 3O8QA 1X87A 3SHTA 1UMCB 3KR9A 2VOEA 3ZHQA 4R2XA 2V74B 5BW6B 5EIFA 2UV8A 4LSGA 2YKGA 1TJPB 1I0IA 2GLTA 2C7GA 1RFGE 5EE1A 4ZU6X 4RO0A 5FWYA 1SUPA 1UBSB 2X19A 5KDDA 2H9YA 3S2EA 2HHHB 3PBKA 4M0PA 3NHSA 4MQLA 5SZKB 2G08A 1VI2A 4TM8A 2GZ1A 3EUEA 5SY4A 3ZV7A 2ZB2A 1YC2A 2B20A 1BZYA 1QK3A 2OY0A 4ZO4A 1WX1A 3EEFA 3FPEA 1SBYA 3LM8A 4J49A 1XCOA 2O2JA 2EJCA 1L7BA 2WNSA 3NM4A 5ADVA 3FKSD 4L4SA 1C80A 2AX3A 2BV3A 3CG0A 3HO1A 1NR7A 3EIXA 1PU2A 1M2OB 3PHGA 3N2YA 2WKQA 3KEQA 1TMGE 3KFLA 2BHLA 2EKQA 3OZCA 1LX6A 3MWYW 4H1UA 3FUXA 5DN9A 3IEPA 5FYDA 5JRDS 4FIZA 2WUEA 3TLAA 3W5JA 1TEZA 4QFMA 1ZL0A 2H9AA 1VPTA 4CN9A 2YHSA 3VVBA 3FSJX 4HUQA 1BD3A 4HOYA 2F43A 3V42A 3B20A 3QY0A 1XGKA 2CLCX 1NJSA 2D4AA 4AXBA 1QHHB 4F8EA 5DM60 4MI9A 2G80A 5EFOA 2ZB7A 1DQZA 3GYGA 4EENA 1JA1A 1EQUA 1NV8A 5MFPA 4JQSA 3OLVA 1S3IA 3Q12A 5A1JA 1MT3A 3G2HA 3L6EA 2XUGA 4Y6QA 2HSZA 1ICIA 1QAMA 4ANFA 4O1MA 1OX4B 2JIRA 1P3JA 4BVAA 2XWPA 4RGQA 3DVSX 5KO2A 1HLPA 2Y0PA 2VH1A 3PKZA 4LSMA 5EXXA 3DTVD 1RBYA 4EHNA 1QU3A 1VHTA 1DPFA 2GEFA 2XHEA 3EFHA 2V45A 4J0IA 3U7EB 4ZAGA 1SOUA 4KNYA 1DMRA 1OA0A 1ZK0A 3RS4A 4DEYA 4MR9A 3LK7A 1GYPA 2I80A 4NENB 3UHOA 4AZVA 2W6ID 3C3PA 3L3BA 2BE7A 3ZY6A 2QZ4A 3EFEA 3KBOA 3LVRE 1STOA 1T8YA 4GICA 1J9EA 3BMQB 1A9OA 3PE3A 3AXSA 4EG5A 3DAFA 1QX4A 4JODA 2J9GA 2G4CA 1K5HA 4PBSA 4UBJA 2ZI4A 4DWVA 3ZWQA 3E9RA 1N2CB 4IJKA 5DIZA 1XKXA 4MV8A 1TK9A 1CP2A 1RQXA 1U2DC 3OQ6A 4HN2A 4S12A 1TKRA 1U81A 3DFMA 4GX5A 4BBJA 4CMIB 1YFLA 1ZY2A 4HXGA 1RXYA 2R4TA 3UUWA 3UT5B 4P38A 4WKOA 3Q0EA 3RTEA 3KSDO 2G67A 3NTQA 4X91A 1PL0A 2RHTA 1L5OA 4Z1MA 4E6EA 1BSVA 3NNNA 2L42A 4JH0A 5KVVA 3GN1A 1KWGA 5EQTA 2VP2A 1JSCA 2B61A 3FG9A 5AJXA 1CE8B 1W5BA 2AUMA 2ZJ6A 4DY4A 2JAUA 2H2FA 4OKSA 5EMHA 4J0DA 1RWQA 3C8HA 5D3MA 1TK2A 2ZBUA 3LWNA 5CW2A 4EO9A 2ZBRA 4UE3S 2QE6A 1S4MA 3HC7A 3O47A 4J0CA 3VAZA 4TQAA 3OEWA 3ICWA 1AQ6A 2Y92A 1RMTA 1X1DA 2JGRA 3K7EA 1YJ5A 2GZSA 4XM0A 3ROPA 2GASA 5TXGA 1EVYA 2PKEA 2W5UA 3KXLA 1M1YE 3UAGA 5JVDA 2PK3A 2Q50A 3OX4A 3W1EA 3NOOA 5K51A 1PFUA 4X1IB 1VB5A 1KSFX 3LCUA 5EMKA 2I4OA 1FFXB 1FRVA 2EBUA 2PY6A 4PBRA 2JIDA 3E3LA 2HMAA 4FYKA 4I81A 1MP0A 2HGZA 3BCRA 3BWEA 1KEPA 3CISA 3CG4A 3P2YA 4XR4A 2MSLA 1P73A 4FXPA 1BS1A 1YT5A 1NMEA 3LP8A 2HFKA 1HTBA 1O94D 3RUAA 4F3YA 1TJNA 4H35A 3D3NA 1G9TA 4XIJA 4YMWA 4AD8A 5JHHB 2H1WA 1F60A 1QF6A 2WC1A 2FRDC 2P7HA 3AQIA 5KSPA 3I3OA 4WFKA 2PT5A 3C85A 2BR4A 2Z43A 3K4PA 2OO7A 4HWPA 8ABPA 1RMQA 3IV6A 2WIFA 3QJGA 2QQEA 3SFVA 3SCZA 4ITUA 5C1BA 2VRBA 3PEEA 4MYRA 5DMXA 4EF5A 1SKBA 5DNEA 3NT2A 1DQRA 4MJXA 1LRKA 2A57A 3ESCA 5K5EA 3BQMB 1PNVA 4M55A 2OB1A 1Z17A 2YS6A 4URUR 3RFUA 3VAAA 2D0PB 1Y8RA 4KC0A 5K4AA 2QYOA 4CM7A 2V3VA 1QO7A 1CB0A 2YN2A 3TUZC 4TUYB 4X8HA 3PP8A 2MDTA 4AJ4A 4L3VA 2ZG6A 1B1CA 1FDIA 4FDUA 5BSWA 2NVUA 4P54A 4BQFA 1E4OA 1DLIA 1W76A 1OKKD 2ZYSA 3L8GA 4DCTA 5I3ZA 1HF3A 3EVEA 1WPQA 4JDPA 5F12A 4BRWA 4JP5A 1MV8A 1U4SA 5E1BA 2QL7A 3RYFB 4QXAA 2PH1A 2MSEB 3IP5A 4N41A 2G4VA 4V1CA 2FPWA 3K6JA 5P8WA 1GTL1 3ZDYB 2EHDA 4L5CA 1U2DA 4B7XA 4NS1A 3IHTA 4WKCA 4LMPA 1VMEA 1VKOA 4OYLA 4DANA 1W19A 4FWIB 4FOLA 4KAXA 5IMSA 1Z2DA 2FP3A 1ZD4A 4PYOA 3IQXA 3IVGA 1T24A 2B98A 4K8RB 4RS4A 1H2AS 3PUIA 2H4XA 1SKYE 2P78A 3IRVA 4R7ZA 3ZCQA 4HWGA 4FFOA 2PCJA 1JL3A 2X9NA 3BSYA 3BXFA 2LDXA 4J1SA 4RKWA 2XIQA 4HH1A 3VTZA 3DDCA 4OL0A 4Z7OB 3HI4A 1J1UA 3TLKA 2X9LA 1SBHA 2QJFA 2Z3ZA 3BWDD 3JPYA 3JVIA 1MXFA 1RLUA 4J1TC 4PVDA 3T5DA 1F8YA 1E2FA 2HXSA 4XYMA 1XF9A 4CM6A 5F2NA 1AGXA 2LGJA 4DW8A 3K8ZA 2MINB 4X8OA 5CHEA 2V9PA 3MWLA 5FTWA 4BTVA 4TL7A 1G2QA 3LPNA 4PAGA 2J41A 3G8CA 4YMLA 5IC5A 4RTKA 4FZVA 3LT4A 1AHHA 1DJPA 1PEAA 3RUPA 4KDEA 5C81A 3FFAA 3ENNA 1IOLA 3GCGA 1N1EA 3BTUA 2C94A 3GLVA 4KUHA 5ALFA 2C8LA 3PXEA 1NMQA 4A0SA 1PT5A 3DD1A 5JZBA 5J1SB 4OQ4A 1OGIA 3FUUA 3LWZA 4MMYB 4RK4A 2H52A 5AYVA 4EL0A 2CL7X 1O6CA 3A1WA 3CS3A 1CTQA 4MS1B 3CB4A 3HCCA 2I99A 3MGCA 3NYQA 3MPOA 4O2BB 3NB0A 4O2LA 1QMGA 5I4BA 1HE5A 4D81A 4QM7A 1VSUA 1AIPA 2R6FA 1H0KA 2AFVA 2PIAA 2FRXA 3AEUB 3D9QX 3NTLA 4JJ7A 2D8AA 3AU8A 3HJUA 4C1NA 1ZKDA 2BTQA 1U0HC 3KLBA 4OJKA 1CZRA 3PUHA 4DEVA 1ZHOA 4J75A 1OLUA 3LL7A 4JL5A 3V3KA 4BNNA 4V0NA 5REQA 2X8AA 1TLLA 5K3OA 2NP7A 2Q29A 1G4AE 5C3UA 4HZUA 2R00A 3L41A 4BQNA 2IEZA 1F12A 4J6FA 3GO4A 4B83A 1QOPB 2ZT5A 2D2EA 2O5EA 2EXXA 2FMHA 4C21A 5ABPA 1ZPDA 4E14A 1FUIA 5CX1A 5J5CA 4R2HA 2O6HA 2R8RA 4QT0A 3VVCA 3R6TA 4QM6A 2NM0A 3TR6A 5SY9A 4KE9A 3KPVA 5K3SA 2W90A 3B1VA 2X9GA 3QEMB 3B12A 4RD0A 4E30A 5KJFA 2XCTB 3I0ZA 2PMWB 4CETA 2J45A 1P9RA 3ROFA 1T6XA 2G28A 1I80A 4LXYA 4ZA2A 4QG3A 5K3EA 1KRHA 2O8DB 4B43A 3KQMA 4XCQA 2OHFA 1PNQA 4YRJA 2QMYA 2GD0A 2YHIA 3QVWA 3AT1A 4EPYA 4JC0A 1K4YA 1KFKB 2AFRA 4X3OA 3A6EA 5KDLA 3U4MA 3FCEA 2C1XA 3HRHA 3EGVA 1G7CA 2WAYA 3YASA 1EUCA 2HRRA 4BQOA 8OHMA 3N86A 2ZB8A 4NCBA 3V97A 2O5CA 1ID1A 3PD0A 4DZZA 2IY9A 2JGNA 3FZNA 1GNRA 1MZVA 1XKLA 4YJFB 4D4JA 1SURA 4YB8A 1EBBA 3DMNA 4D4MA 1HL3A 5COAA 4BC0A 4A3SA 1URPA 2DLCX 3DOCA 3HKBA 4B2LA 1V5IA 2RH9B 4J1TA 1YBFA 1PGQA 1RLMA 2PNJA 5AW0A 1BKDR 1QVWA 1PE0A 3L1HA 1T2EA 1BQ4A 5DDIP 2J5BA 4RENA 1KHTA 1RQGA 4YRLA 1E63A 3OQMA 1FLVA 1N77A 2DG2A 2W2XA 3OTIA 4YPFA 2JJ1D 3A7EA 2Q4OA 1YA6A 3HKDB 1G1AA 3EC1A 4IIVA 1G8GA 3AV3A 3OZVA 4W9NA 5ANRB 2QTVA 5HTKA 4X1KB 1VSBA 2H1CA 2PMDA 3R6GA 3ND9A 3ETEA 4RUKA 2WFAA 5ENVA 1G3IA 4B48A 1IN6A 1Z0AA 3QH4A 3OP4A 4X66B 3BZUA 2A33A 4WZBA 2QVLA 1X6VA 2C7VA 3K1AA 3OUUA 2ZZNA 3PE4A 4IQ8A 2EGHA 5AW1A 1AKRA 4QJ5A 4FCVA 2X4LA 4JBIA 1QGDA 4FJ2A 4JWKA 2QK4A 4F6RA 3LTEA 4M0EA 3DAYA 1JWBB 2EX0A 2HIGA 3PENA 1AUXA 3TBHA 3ZOKA 3CJTA 1NIJA 4PSVA 4YXWA 1RIIA 1G8HA 1CC1S 1G7TA 4UBIA 3TKLA 1KAMA 3U40A 4WXYB 5JNSA 4XM1A 2XDQA 1PV1A 1HETA 5LP6B 3DBOB 3K9CA 3GLIA 4Q3DA 3MQ4A 3GFPA 1EESA 3ADPA 4IIXA 4QDUA 4A1OA 1M1YB 2WZCA 3AJ9A 3AWDA 1Q0LA 4G85A 4PPFA 4YP9A 5H9VA 1E3IA 2ZGVA 4C43A 4OXKA 1JEQB 4LHVA 4YPOA 4MUXA 2DECA 4NMLA 2E4AA 2VJYA 4B5KA 2FVXA 3ENZA 3S6JA 4YC7A 4RVUA 1P18A 1Y7PA 3QWFA 5EQJB 5JCJD 3LP5A 3T7TA 3OM0A 1F3LA 1QK4A 2R6CA 1WAMA 1GXSA 4HX5A 3MS2A 5I9BA 1QFXA 4UM9D 3CMCO 4FMBB 1U2EA 2PLWA 4YT4A 1EB8A 2OEPA 3A1FA 4N9WA 4Y2RA 4LYHA 3UKOA 3AEKB 1GEEA 1QCYA 3T3OA 2A92A 1L8XA 2JBWA 4O3FA 1UPXA 1N8SA 2AR9A 5JG7A 2ET6A 3DBIA 3D31A 5GADl 1GM5A 4IKOA 3H19A 4V24A 5FV4A 3L6DA 2P4QA 3ND6A 3TLYA 2D3WA 4HNQA 4MITA 2I66A 2XH8A 4ZK6A 2MSWA 2VAWA 3FNFA 1XP5A 1T8TA 3WLQA 1EXMA 1PS8A 1QE0A 2UVPA 2ZRPA 3A2LA 4S1NA 3H1BA 1ZI6A 2NVBA 4YUVA 1OC2A 4EVRA 1F2UA 3UXYA 3HGQA 3MLAA 3HCPA 4BU0A 5CBKA 5HTOA 1JVBA 1QHGA 5JXIA 3MGGA 1PN3A 5G0UA 5B2EA 3CUUA 1J2UA 1JQEA 2FZKA 2JLAA 4TX1A 3TD9A 3OZUA 3GA5A 4DJAA 1ECGA 4JKOA 3GGSA 3F8TA 1ZD1A 2PQ6A 3PTZA 3STVA 3CSUA 1WHTB 4AZ0A 1YR7A 3TTTA 5JAIA 2JH3A 1VHDA 3ZGYA 1HLFA 5GPBA 1H85A 3ICOA 3WSWA 1OH6A 1LX7A 1GNVA 4L57A 2V97A 1PWEA 3OTQA 4DARA 5BWBA 3PVZA 1RJ9B 1G5IA 3M0EA 3Q3IA 1GAEO 2BEWA 1MW8X 1D1QA 1PV2A 3T38A 2UZ1B 1CP3A 1YE8A 1YUNA 5CFPA 1QGUB 2PVSA 1IHPA 4KO4S 2O2EA 5TR9A 3UM9A 4OXXA 1SKYB 5TSDA 2JARA 2MMGA 2OWEA 3A6LA 3GCDA 3RU9A 4R05A 4E1AA 1V26A 2R62A 2UUCB 3PLAE 5LNK6 4JITA 2AE2A 2RIPA 1KGSA 3ZCSA 3FCOA 3PEVA 4CEIB 1QOZA 2J7PD 2WSSD 4H7FA 4WK4B 3TW6A 4LFBB 4G37A 2GCPA 1K92A 3ENKA 5JNRA 1GTZA 5KSWB 5KZMB 4PO3X 5KOYA 3ZBUA 2WUFA 4INOA 5DLEA 2B8NA 3R3JA 1GIAA 4BNMA 4RPGA 1TCBA 3F1KA 4X00A 3F3SA 4RD6A 3SF8A 1XZLA 1Y3IA 4YGYA 3HR7A 3CQ9A 4EHBA 5KNBA 3H18A 1V8BA 1OFHA 2C57A 2C5FA 4C2UA 1C3OA 2ODBA 1KO4A 3OOEA 4HRYA 4JVLA 3LQ2A 5GM2A 1JU3A 2YMPA 4KACA 3RAPR 2ALJA 4II3A 4NAUA 3ABZA 1IBMB 2H1VA 4LCEA 5L45A 2NT4A 4E5SA 4EELA 221PA 2BC9A 2EW2A 4HEA6 4UU0A 3DFUA 4G5XA 3T3NA 3CVOA 2CZGA 1NQTA 4Q1FA 1W8DA 1L5LA 3ZTYA 2ZJ5A 5IJ0A 2QENA 2BJVA 4UVHA 4CLHA 1QYXA 4Z0TA 5C34B 5CVEA 4PLCA 1XRLA 4QG7A 2Z30A 4DLYA 3N6XA 1UPTA 1NVXQ 2YVLA 2AG1A 3HU1A 4FFBB 5KWVA 4DCPA 1DCTA 4UBKA 1SOVA 3LIIA 1NWHA 3DMYA 3BF8A 3FBGA 3LWDA 1IY8A 1WDLA 1V35A 3OFNA 1M0TA 1G64A 4HFRA 3IDZA 1RLOA 3DHYA 5L53A 5CIYA 3PDIA 1PR6A 3HHPA 4IQGA 4KCGA 4OMCA 4QTZA 5CYPA 1RCFA 5K1ZA 1ONSA 4GKVA 1GUYA 3F9CA 2FEKA 3VR5H 4JI4B 1VJRA 1RT9A 2FP4A 4K46A 3P9XA 3QWIA 4ZV7A 1GR0A 2BM9A 1ZH0A 4N3BA 2GF0A 4ZANA 4ARZA 2O59A 1UBJS 2QP9X 3HLYA 1S2LA 4GRAA 1U5BB 3WWOA 4DCOA 1GZ6A 1GQ2A 1FQOA 2J5KA 3MCVA 2J07A 2L19A 3OETA 2GEKA 4MV4A 2SKEA 3H8VA 2TMKA 3KQUA 2C7RA 2VDQB 4NK4A 2L18A 2D7DA 1RWWA 1O6ZA 2QLMA 3GVIA 4TV9B 4WW0A 5BQXA 1XK7A 2XGOA 1NU6A 5B6PA 3LT1A 5KNDH 1YB6A 3GDOA 4N12A 3H9JA 2NNLD 1S6YA 3GGDA 5IARA 1E7QA 1VIYA 3EXFA 4ARBA 5I9MA 1CUXA 4K9NA 3HJBA 1XJCA 1TQ6A 3T52A 3W9SA 3OCVA 2Y1CA 3HUTA 3S3TA 2RARA 5L3SA 2NQ8A 4GI5A 4W7SA 3U9SA 1VFPA 5JNWA 2UKDA 4KFUA 2RCNA 3TEJA 4MAFA 3V80A 1VA5A 3PLRA 1R10A 3MF4A 5ARCA 2ZSBA 2LR0A 1D4ZA 1JUDA 3B5EA 1YZGA 1XD9A 3AUAA 3PQ3A 2VBGA 4X20B 5EJ8A 1RZRA 4CEHB 3N0WA 3SBDA 4AIRA 3DXYA 4FBGA 3G2PA 3K20A 4KO2S 5CRIA 5AVTA 1NI4B 3PLNA 4ROTA 3PWZA 3CH4B 4FSHA 3ME5A 1I10A 3CLKA 3NH9A 2B4TO 2REQB 2ZPAA 3ZDQA 3LPAA 2I8AA 1NPTO 2R44A 5ALXA 4DBZA 3VPFA 1X1RA 3UJHA 1UAGA 4WKGA 4JI3B 1C9JA 2XB2A 5JVDF 1E3MA 1C30A 3KKNA 5F5NA 4TXNA 1FS5A 5P21A 5JJCA 3PI6A 1ND5A 2QSZA 3OA0A 1QQ5A 3QFRA 1HTWA 1ORHA 4HGPA 4P4NA 5G53C 4JFAA 4NJEA 4M0MA 4J4BA 5SZIA 5J63A 2O19A 5ALUA 1YCGA 1TYZA 2FUG6 1GPNA 1NVKA 1RWVA 3WS7A 1CUYA 3PCRB 4A6EA 3QGMA 1J6UA 1HDGO 1NHWA 3T94A 4A36A 4NG5A 3HJCA 4BFVA 4J2TA 4OHRA 4E5NA 2W00A 3RUHA 1U1FA 2A58A 4FYMA 4UCQA 4W5NA 2HLDD 3EMDA 2C31A 4MEBA 2WVAA 4FCCA 3W1VA 5FPTA 1PNOA 1CF9A 2QQ0A 2RG1A 3EZYA 4ZVTA 4MA0A 1OH5A 4RW0A 5FOTA 4ZU3A 1KI7A 3VKVA 3LFTA 1XCMA 2PGIA 2ZIVB 4YYEA 1NLMA 1P80A 3NGMA 4RE6A 2OZEA 3G9QA 3MMZA 1L5GB 2DP4E 3MIZA 4Q47A 3KV1A 2FRVA 2H5LA 3AUYA 3WJAA 4ZJPA 5CIWA 1PLKA 5CK5A 3NVDA 2J3JA 2VAPA 3BE5A 1Y37A 1S2NA 4KLCA 2JH8A 3J81A 5JSUA 3B9RA 2WJ6A 3QU2A 4MJ3A 1Z5WA 1V71A 1Z28A 2EU8A 3KHSA 1QP0A 1K3TA 3LUKA 2WOJA 5EPOA 5FORA 3VR4D 5ICGA 4Z9FA 4BX0A 2ZAOA 3C3KA 3INTA 5AHWA 5ESRA 2FSPA 3VVLA 2WVGA 4D45A 3F73A 1TAUA 3IAFA 4RFVA 2O9JA 5IKMA 2EFYA 4QJ4A 1CV2A 1JS1X 3ZGLA 1XU4A 1C3EA 1JR4A 2ZSKA 1J0BA 2VQ6A 4J94A 3TNYA 3ESRA 1BE6A 3HA2A 2B3TA 3CUSA 2XTZA 5BR7A 1USKA 1CQIB 1J0XO 1I7PA 1QIFA 2QLFA 3AB7A 3FDZA 3LUGA 3N1UA 4EB6A 3CW2A 4F04A 5IDQA 1Z6XA 4BFLA 4F9FA 4MUIA 1ZUWA 1TDJA 3GF4A 4FT2A 1K5PA 3AKDA 4DRXB 1IYZA 2B1QA 1SCJA 3EA4A 4Z7NB 3SKVA 2M32A 3IMCA 2W2LA 3IUBA 2Q0XA 2J0UA 2WF6A 1EP3B 1N6NA 1T43A 3WK9A 2XT6A 2BFBA 4J0GA 4MTLA 3BRQA 1GKUB 2ZOSA 3OZXA 3Q3EA 4PGFA 3ZKAA 1NONA 1YSCA 4JYAB 2OE2A 2R1TB 1P0FA 3KQWA 1Q14A 1IUNA 1E6KA 3FYDA 4FT4A 4MVJH 4X1YB 5FL7D 2Q7DA 2NSJA 4HDMA 2P27A 4A4DA 1Q1NA 1PJSA 2W2OA 5HP4A 4PR0A 3KPJA 3QEOA 2JRLA 4OBWA 4BHTA 4X8LA 3RSQA 1YRYE 1EVQA 1L1EA 2GK6A 5L95A 4J43A 3VPHA 2E82A 1D4OA 2IX3A 3NEYA 3NASA 4HFMA 3RIGA 3NTUA 3UWKA 1RLIA 4HZGA 3FDIA 2BI8A 1CJKC 3DM5A 4LBWA 2PZAA 3CZ4A 5I7HA 1ZMTA 2O20A 5E4FA 2VK4A 2G8NA 3PT5A 5A5EA 3PGA1 5EJAA 3R5XA 3II6X 3FRHA 3NONA 3LQFA 4X7BA 3D2CA 1JJ7A 1U3GA 4ZCQA 1LTQA 2FKNA 2P7IA 3DFIA 4RA9A 2QTHA 1QBGA 2F3PA 1II0A 1GG9A 1AG9A 2IKSA 1AM4D 2ZE5A 1C7EA 3AJAA 3W1WA 1PO7A 4B47A 2QMQA 1FVHA 3FFWA 5IPFA 5IFLA 2J67A 1ENZA 3ETGA 3PGXA 3KAQA 3FJOA 5I7SA 4UEQA 4TTIA 5A9SA 2PUGA 4Q9KA 4QTUB 1WMSA 2WDPA 3HB1A 2C84A 2GXSA 2XLCA 4FP9A 3OQNA 5DNDA 2OZLA 4HN9A 4LXIA 1K08A 1XTKA 1YR1A 2H00A 1NP7A 1NLZA 2GKOA 2QD3A 1WNFA 3AOEA 4UQPA 3SZLA 4FVTA 1SCKA 3TQQA 4YP1A 5LFAA 2C5BA 4XSHA 2WQ6A 2EZ8A 2MSKA 4D8UA 2E5LB 4B3MB 3A4YA 4OFWA 3UWMA 1TVCA 2PZJA 2Z4RA 2HIMA 4H9GA 7AT1A 3R9XB 1GU0A 2Y1WA 3RS8A 3AU9A 2M2IA 3QSGA 3IDQA 5HE9A 4FS8A 3WWEA 2HW8A 3QLUA 1UMKA 5JATA 2PYZA 1FDRA 3VSCA 4W5TA 1C5KA 1ZYUA 2ID7A 2YASA 1NVUQ 2YX1A 3LUJA 3QVKA 4MQ5A 1V96A 2XCUA 3RFTA 4ND5A 2ZM5A 5J40A 2PXHA 3ZHVA 3WIVA 2DFLA 2XZTA 4TRNA 4DAEA 1K6XA 2ZWOA 2P2YA 4JUFA 4M8IA 3M2PA 5AW9A 5K05A 1MHPA 1WXQA 4L0MA 3MA0A 3Q5EA 2C2XA 3DUFB 3TIXB 3MELA 1NDUA 3SQWA 2WD7B 4A15A 5GIOE 4M38A 3KT0A 4FC7A 4OOFA 5ES3A 3RYTC 1XXLA 4S0ZA 3ZBQA 2JLYA 3M5CA 3RRFA 4GDFA 4MYCA 2E89A 4FCWA 5CBPB 4MWCA 3NUGA 4OY3A 1XZNA 1SBTA 4RLHA 4Z99A 4BB5A 3E9ZA 4NU8X 4ID3A 3CZAA 4KJZA 1N3IA 4DCUA 5JCZA 5JS8A 1I4LD 2BZ1A 2GESA 2J8ZA 3GJRA 1CQPA 4WECA 3MCTA 3FI0A 1ISJA 2F8MA 1Z07A 5I9TA 1DHTA 5GTDA 1NVFA 4EGJA 2O3QA 3FR8A 4KQ2A 1QP7A 3CCCA 3JQCA 3V2HA 1SKQA 1G8KA 4V0LA 1H22A 4FFDA 3WKCA 2PT6A 3M6LA 2ZIXA 4GYJA 3MILA 4TVSA 3HYNA 3MD0A 1SWWA 1YO6A 4D9MA 5DHPA 5BWMA 3ACDA 1NMSA 1NW6A 4RV9A 3UENA 3K92A 2HGSA 1YASA 2OBYA 3V4LA 4KVGA 4MRNA 3IIKA 4JJIA 2CXHA 3MT7A 1U98A 2VVTA 4OJTA 4WK6A 3TUIC 3WHKA 4EJSC 4UPEA 1YQDA 2JGKA 4B3JA 3G49A 4ZCSA 2QRQA 4PSCA 1VG8A 4OQPA 4HGYA 3CSSA 3NHMA 1L7DA 1O58A 4ZXFA 1JZTA 4L9SA 4MGIR 3JASA 1O08A 4WCFC 3NTVA 3JSAA 4O0LA 2P9BA 1QDUA 1DV2A 1OAOA 1SXJC 4X92A 4ZHQB 2D5BA 1XHEA 3OIUA 3PTAA 2XUIA 4MINA 5FPQA 5IANA 3RU3A 3IT3A 3R1IA 3H2JA 4ILEA 5ARBA 5MHTA 3IDSA 4PC6A 4UUMA 6REQB 5L4SA 1R5JA 5AO9A 3GFTA 5AIBA 2B34A 1M6HA 1Z88A 3QFHA 2HF7A 3T4EA 3A6FA 2FPOA 2O0JA 4S1OA 5D01A 1P2DA 4MYHA 3S1SA 3VZSA 5ALOA 2VP6A 2XCQA 4DMHA 2G1UA 4MKRA 5H82A 3HYLA 3VAYA 2XAAA 4QOHA 2PGJA 4K26A 3ZGVA 3THYA 5F7ZA 4J1QA 4MMXB 4JASB 3RSFA 4DHEA 1EIWA 4K0RA 3JYLA 4ZJZA 3ILSA 1LSJA 2PUTA 1H23A 5ALNA 5EUBA 5CFZA 1PQWA 4HPJB 1F14A 2G9NA 4PO9A 121PA 2O8VA 2QR5A 1Y9ZA 2PS1A 1LW7A 1W9MA 3K71B 5F73A 3SQMA 4A03A 4J76A 1PYGA 5JPDA 1MUUA 3AVUA 4WZAE 4NXNB 3GFVA 2VLBA 3FVTA 4K87A 3USZA 2GM4A 2FZ5A 1XPUA 3IUYA 2ZVDA 2WEKA 2WIAA 4MQMA 1Y3BE 1U8ZA 1YJCA 2RI1A 1L8OA 3MT9A 2NX2A 4GXRA 3K9BA 2X8JA 3KOXA 1K8YB 1V3UA 1P1JA 5JS1A 3CN9A 3GRKA 1UJNA 4Q05A 4U2CA 3RVNA 2Z5FA 1T2UA 5ERYA 1R6DA 4TTAA 2JHGA 3ZK7A 3Q9UA 1EA5A 4OQQA 3BWYA 3TRFA 2VSYA 3PNVA 1BKYA 1Q1QA 5DF1A 3WJ1A 3WDLA 2AQ8A 4FZJA 2C29D 3PQ7A 3QXXA 4KHPB 2JVKA 2YINC 1P5HA 2J46A 2VPTA 1V1MA 3DLAA 3GELA 4RJKA 2XE4A 3EVDA 4TTJA 2AYXA 3UO8B 4MUKA 1DQNA 1LBSA 3BXEA 3L7YA 5BRNA 3QLJA 2FGKA 5HFAA 2VZEA 1J1ZA 2VQSA 4L75A 1F8XA 1T2DA 3HGTA 1K89A 3WP1B 4AKSA 4BVFA 3OCYA 4P81A 1T4CA 5JZVA 4LHSA 4R71A 1WZEA 1DOAA 4HPWA 2REBA 1SU8A 3ND5A 2HWWA 3NVMB 3ORHA 1MB0A 3PFKA 1A5TA 2JA2A 1X9IA 3RJZA 1T8RA 4GMGA 1KO5A 5DHFA 1UP4A 5B37A 1C0LA 3TMKA 4XGKA 2FW0A 2R8OA 3T1QA 4GL4A 4LF7B 1Z4LA 1HSZA 4WCFA 4B84A 4HJRA 3OLQA 2HTFA 2IDJA 1QHXA 2FPPA 5HMLA 3I73A 1S3SA 1GV1A 2AI3A 3K2QA 3IEUA 2I6QA 3DB2A 1UOQA 1Y1KE 4X64B 1M6VA 3AKEA 1C8LA 5HGXA 1LLUA 1GT91 4FHFA 2Z83A 1BNCA 3V34A 1WB4A 5HCNA 5I5GA 1L5WA 2JFVA 3RG2A 3NETA 2RC6A 4Y0NA 4H60A 3UTCA 5K3DA 3ZDCA 1CS0B 3IQEA 4XWAA 4PICA 4Z1MD 5BMVA 1CT9A 1YKGA 4IFTA 5DSTA 2ZREA 2ATXA 2EBWA 1DJOA 1E94E 3TFWA 2EKLA 5TEWA 4QT4A 3ZW8A 1WF6A 3LCCA 3C8ZA 4FONA 3CX7A 2ZVPX 1AO3A 1R16A 5JAUA 1FLDA 3CH5A 3O26A 1JFVA 4ZI2A 1FSGA 4O4HF 2EJWA 1U65A 1QS0B 3DHNA 1D9ZA 1G291 4H4CA 4A0RA 2ZFUA 1KNXA 2JFWA 2O52A 3OAAA 2W83A 4Y2GA 3TEMA 3U4QA 3V2IA 3KELA 4ZYXA 1Z36A 2O2DA 1KQFA 4M9ZA 3C7DB 4DA4A 1B76A 2CLDX 5EZQA 1U1EA 1XVAA 3QLTA 1KMIY 1CJSA 2Q7XA 4NPCA 3NIGB 4CLEA 3GJXC 3STUA 1SUEA 1D1TA 4I1IA 4KRGA 2ZI6A 4HAUA 1QDLB 2X0KA 3K96A 1VECA 1JG4A 3PDHA 3RAGA 4A2CA 1CUDA 1UAAA 2OGZA 2UZ3A 3EZNA 1B7GO 2A5GA 2ZK7A 3K05A 4G09A 4TQ9A 3T6KA 1UFOA 4AMZA 3I2GA 2VTBB 3W3AH 4MGHA 5DI9A 1T8SA 5C8YA 3AF6A 4CPDA 1Q6YA 1U2GC 3WNDA 4EFNA 4RPCA 4MULA 1KF0A 4B46A 3CX3A 4EY6A 1BEEA 3C3YA 1IWBB 2AN9A 4LKRA 2PDAA 4C0QC 1NT2A 3DE4X 2OCPA 1QCDA 2RHGB 5EKUA 2EKZA 1VGVA 3FCYA 1DWPA 3MTGA 4Z5XA 2GEDA 2XTJA 2IJGX 3DOOA 3EGCA 1NBMA 3BK2A 1UCFA 1JNXX 3QRWA 1YB4A 2R65A 1XB2A 3B38A 2VNHA 1WMDA 3IAM6 5FI0B 1XA3A 1B0UA 4Y1FA 3HG7A 2QLTA 4WWHA 1R12A 2EQAA 1ORDA 2PH7A 1F8UA 4QDZA 4YV1A 1EPUA 3QA3E 5AJHA 4CWAA 1IHOA 2C7OA 4EMTA 5LQUA 1HMPA 3URMA 4FD3A 3KOZA 3OJCA 2X1LA 3D0KA 3U60B 3HA7A 1JJBA 3KTOA 1E3EA 1XJQA 3RB8A 3FUWA 4H4DA 5K3AA 1U2ZA 4Q3OA 1LK7A 4IH4A 2WT4A 1QQBA 1MJGA 4ZEWA 2J0QA 1QO9A 4F4HA 4PYLA 4YX9A 4MX8A 5IM4A 5LMUB 2ZJZA 3HM2A 1MG5A 3E3NA 3AVOA 4NS4A 5K8IA 4HLUA 4RLQA 4DT1B 2VA8A 2ZRLA 3QWAA 1XQWA 1VKJA 3BILA 5C31A 3UOWA 2XVZA 1H0SA 3GCXA 4Y98A 1RM0A 2IY7A 3ITNA 3UT0A 3AHDA 2CFTA 3IAS6 2PKWA 2FJPA 1YS9A 1KK2A 3S29A 2R2AA 1JB1A 4BS9A 1QTIA 2C4UA 1W85A 5EE9A 3WISA 3NAQA 4KWIA 4PQYA 3NLLA 4N49A 2Q2OA 2XBUA 4P7FA 4F6CA 4D3FA 2E4XA 1DKLA 2IS1A 2YJ5A 3F9IA 2A4MA 1XTZA 3GZNA 1YZKA 2XTAA 5GINE 1I13A 4L5AA 1E1LA 4DDKA 2G1AA 5K6TA 2I1LA 1CEXA 1VIMA 1YZYA 2IYOA 5KREA 1C81A 1R9GA 3AF1A 4DXHA 4ND6A 4RAOA 3RNOA 5AQ1A 5KB3A 3ZVNA 2BHNA 3CNNA 2RHOA 2X4IA 4DOMA 3BB4A 1XR3A 1Z7WA 2BCEA 4RHCA 1Z5PA 4XUGB 3ZNPA 4NXMB 1RC1A 3A06A 4JJ6A 1E6EA 3F5MA 4OXQA 4TXLA 4A91A 2C96A 5EXPA 2XJ9A 4OX9Y 4GOJA 1O57A 2FETA 2AUNA 4PTYA 4JX8A 4WXPA 3PC8A 4HHEA 1T4DA 4KPUB 4LYJA 2KM1A 2OO5A 3GFQA 5AK0A 1RD4A 3I0MA 1GGEA 3TDKA 2R1ZA 1FDWA 4RGBA 4YHHB 2CVHA 3UK0A 1OFUA 3EYAA 2C9MA 4LIPD 4C30A 4CQNA 3WGZA 5HZGA 1BA2A 1C4KA 2HWXA 3NTOA 1P4HA 3P4XA 4D8XA 2GERA 2W71A 2AN5A 5KSYA 4DUZB 5CLIA 4F91B 2Z5VA 3HCAA 1V0JA 1R0WA 2H1HA 5BURA 5CA0F 2VA9A 2AWOA 4WZAB 4ZGBA 4O3MA 1NVTA 2ZBPA 4GP9A 1OYYA 3K8OE 4RNDB 2QD5A 3HV0A 2ZCUA 3AM5A 1T0HB 2QPOA 4RY8A 1Y3HA 3QQPA 9LDTA 1ML4A 2JCVA 4AZSA 2VG8A 1AS3A 4KQKA 3R8CA 4R69A 5THKA 4A8JA 3H87A 2B8EA 4YJDA 2C59A 1MO6A 1PG5A 3H9BA 1Y3DE 4TV8A 3DDSA 3JCZA 4IUCS 3DHEA 4P32A 5DPMA 4D9FA 3L6UA 3LY5A 2H1LA 2XYQA 1U6IA 5JY1A 1IM5A 2JFUA 3B1JA 3VC3A 1E5LA 2ZAGA 3F9RA 2F1JA 5AXCA 1W48A 3B1YA 1L4EA 1U28C 1E9BA 1KVRA 1OYOA 1EFHA 3FPSA 2VSQA 1Q0TA 2ODWA 1N2EA 1JQBA 2IGTA 2VRNA 5HF8A 5IMBA 2WDZA 3W3ZB 2CCKA 2NXWA 2WUGA 4F12A 4IDPA 1K0UA 1LBIA 1EX7A 5ITSA 2LTAA 1Y7LA 4G6ZA 4NECA 4RX1A 5EXTA 4BZXA 2IW3A 3OE5A 4PXAA 3RHFA 1W47A 1A69A 3BXOA 3UJDA 4XWKA 2ZEJA 1SXGA 3PPWA 4JLJA 5HKOA 5DSZA 4H1WA 1M7BA 2ON6A 3D59A 4TVKA 5DT2A 4BFUA 1ND6A 1JMYA 1TI7A 5LDHA 1I2ZA 1IIRA 1A8PA 4NOKA 2QRHA 3HFGA 1UEJA 2LWIA 2WG1A 5FLEX 3WLJA 1HG0A 4PPQA 5DBIA 3ANLA 3V9AA 3TM4A 3GPIA 3IQZA 1XYVA 4HGQA 4NG4A 3F7NA 4D8VA 1MOZA 5BN3A 4PM4A 3GCZA 4E5PA 3UJ7A 3OM1A 1YMUA 3QYAA 4Q7EA 1P60A 1BFUA 3HO8A 2Q41A 2WHYA 2OWDA 4KFCA 4YRFA 1Q2UA 2FEXA 4CNBA 1KXJA 4CF7A 2VYVA 5B6IA 4RMIA 3SE0A 5LOVB 5BWOA 1OB2A 3OZWA 2ONZA 4BO9A 3COWA 2VDKB 3CPJB 2VAXA 2UYHA 4X84A 2QIPA 1XEWX 5TPZA 1HYGA 2PZLA 2R68A 1FP4A 2R1UA 2P65A 4MKGA 3CJRA 2NMVA 1RRFA 1Q84A 4DXDA 3HZRA 3VO1A 1BMFA 3GLFE 4H7DA 4CKBA 3NOXA 4UPDA 4G0WA 1Q22A 4UREA 2YCLA 2LRHA 5C32A 4BLOA 3HN2A 1A04A 4YXWD 3DBVO 1X3SA 2EYUA 1VGQA 2WBLC 2XUDA 4PZZA 4UM5A 2E3JA 1LZLA 2FQ1A 1SIOA 1TD9A 3H1GA 1Z08A 4BFCA 4EVIA 1ZZEA 4NMMA 3AHJA 1FSFA 4CG2A 2Q5QA 3HBAA 1JFFB 2CLOB 3HXTA 2F3RA 4KXYA 5THXA 3OSZA 5H3CA 2IU0A 1KI6B 4L15A 2IBSA 4OD0A 5AVZA 8AT1A 1OXVA 1PEDA 2BCGY 3QPDA 3O75A 4QBTA 4HNVA 7GPBA 1SHLA 5KCZA 3ZJUA 3VHRA 2B30A 1FK8A 4HNAB 4UAGA 3F0TA 1ZNWA 2HB6A 1SQ0A 4QO7A 2MSCB 1X7YA 4S1PA 1KFEB 5K6AC 4KQ9A 3RK0A 4BEJA 1UXOA 3K8QA 4S0XA 1M1NB 2P62A 4YLGA 4IOJA 4PNEA 3L6OO 4F9TA 3E61A 4E4TA 3PL5A 4R1PA 1I6WA 5CLGA 1JG2A 3HP7A 4O29A 3QVOA 1W5SA 5EEHA 4RWEA 1UMBA 1U4NA 4CLRA 3DT6A 1LVUA 3DE3X 3VYVA 1PVVA 2ZXFA 3T9AA 1ZM9A 3H9EO 3JQ7B 4ODIA 4JI6B 3V8QA 3NPAA 3E58A 4ENTA 1W94A 4KPFC 3E9CA 3IKVA 5TT0A 4YCNA 3ICEA 1U90A 3HSYA 3AETA 1O95C 1KMHB 2O8EB 4QNRA 2VUTA 1G20A 1QV9A 4CKCB 3K6KA 5EIWA 1JIKA 3REOA 3SI7A 3M4NA 4BGVA 4BQEA 5HKLA 1KTVA 5IN4A 3BGVA 3RABA 5IH3A 5LPNA 4GGMX 3D8UA 4TYQA 4ETIA 1ZUNB 1DC8A 4HQ6A 4EJFA 4L0CA 4RSRA 4B7AA 1DBQA 4B80A 2E4YA 2JGFA 3FVRA 3O4IA 4ZP1A 3KJZA 3IVRA 5L7YA 2PX4A 5GWXA 4ZAZA 3TSWA 1IEWA 3CF4A 3FNGA 1WVMA 2R6AA 1TLFA 3AZQA 3MAJA 3B2NA 4MR7B 2V65A 1EGQA 2W2TA 3HB7A 1DSSG 2X5NA 4MLZA 3ELYA 5F35A 3RIHA 3GEMA 4ZTZB 5DWQA 5HKAA 1E9FA 1XJ0A 2FMFA 4YK7A 3IOBA 1TJ4A 4DF3A 3IB6A 1D6JA 3AEXA 4KAFA 4UUPA 3ZOZA 1JDBB 1R9NA 2XWSA 3P9ZA 5B3KA 2ENUA 4H6WA 1LVGA 1YULA 2V1XA 3GLUA 5CCEA 1T6NA 3DDOA 4R2JA 4L78A 4MWTA 2NSDA 3K0CC 1N2GA 2GM3A 4MUNA 1SZCA 3C2QA 1N32B 2F62A 3PFNA 4IJ6A 3RSLA 1RHJA 1SWVA 2DFNA 2IUTA 2M9MA 1BMQA 1YI0A 2REXB 2Z8ZA 1CRLA 5BYKA 3PK0A 2M98A 1TT5B 4PX9A 4G4IA 5EZ6B 5JWRA 4XEUA 2VUIB 1FXWF 3QTBA 5KNBD 2XNDA 4I1UA 5D84A 5FWAA 5G4KA 1CR1A 4BUZA 4W5HA 2LE0A 2VPYA 2XMQA 3GG9A 3FPAA 3E8MA 1FFBA 1ISMA 4CTMA 1NFRA 5AJVB 4URZR 2RGWA 3ELWA 3LF2A 1MD9A 2C5SA 1U7PA 5KYUB 3I1YA 3G5TA 3PR1A 2AQIA 2QX9A 9GPBA 4QOGA 3IVMA 4PONA 5B2ZA 3TW8A 2I2WA 5IJAA 2JNWA 1RQPA 2XGGA 3FE2A 4ND7A 3WHIA 3WKAA 4YUWA 1RCTE 3P9NA 3HWX1 1JKIA 3LXMA 1P1RA 5HQ3B 1E6CA 3FLMA 2JGMA 3DCNA 4E88A 4OP2A 3N2KA 1NSYA 3BD9A 3DDUA 2DQKA 1II9A 4QAQA 3ZWNA 3OFND 3MW8A 4XB6B 1TKBA 4TMKA 3MYRA 4D79A 2H11A 3CT4A 2GZRA 4OB8A 1S1MA 4RMHA 3TLBA 3WYNA 4AZTA 4B76A 2FPIA 5CCXA 2OGSA 3QTTA 2EG5A 2NAFA 3QMWA 5F3DA 4BZZA 1DARA 1Z6TA 1W4LA 2QU8A 3ICQB 3K0HA 1K2WA 3DXFA 1UXIA 1VL2A 2ECFA 3IT0A 2FSFA 4IIEA 4ENRA 1HDOA 2GZHA 4I9HA 4MS3B 4AO7A 1QRUA 4XE5A 3M3PA 1UANA 3C41J 3GP5A 4Q3NA 4MVWA 6Q21A 1FC0A 1TQDA 4QICA 1I3MA 2ODNA 4Y2SA 3OCZA 2DFPA 2XD9A 1FLNA 4YV7A 1TU3A 4V1CI 1EFTA 4JKYA 4HTAA 1NSTA 1Z5ZA 4JEUA 5ECDA 2CNKA 2WT9A 3TI9A 1BFDA 3O2QB 5DW3A 3I1IA 4IYRA 1LUAA 3LHIA 4YMIA 1I3KA 3HY6A 4XWWA 2D1SA 5I8PA 1SXIA 2PD4A 3GFGA 2PANA 3G1WA 4NCJA 4PAWA 3BERA 3SYTA 3C24A 1TW2A 3JZMA 3TCNA 5K8VA 5FOUA 4D44A 4OHZA 1ZX1A 1OTHA 4ITVA 4UMFA 3HXMA 2HXYA 3K0CA 4R1UA 5BMVF 4R8MA 2W4IA 4OFBA 4OHMA 3IJ5A 4LEIA 4XD7A 4N48A 4UHJA 1FNMA 3H0CA 1RZRD 4BVHA 5IG2A 3SHVA 2XEDA 1Z0JA 3QF7A 1C1XB 1A2BA 2NU9B 2CHFA 2C3UA 3FYCA 3PX2A 1NNUA 3IIEA 4LZLA 4B17A 5JCPA 2F8TA 4O2BF 4PSKA 3F2IA 3M49A 3OZDA 1R6XA 3S44A 2YYSA 2WWHA 3QUBA 3R0QA 1V8OA 4Z8XA 4IAOA 2IF0A 4CDGA 2D54A 1YS6A 2B82A 2R7MA 4MA4A 1IVSA 2HMYB 5E3HA 1ZHHA 5AUNB 3AFMA 3EQ9A 5AI0A 1A5BB 3ETLA 3VDXA 4FMCB 1F6BA 5IKXA 2XQKA 3L06A 3THWB 2PWAA 1D4AA 1P7WA 3MJTA 4GLLA 4K8OA 4Y1RB 4ARIA 4EGAA 1L9XA 3N87A 4ZVRA 5EXDA 3LT2A 4RACA 3GLFB 1AXEA 4TWBA 3ZDEA 2AOTB 2WHQA 1SVIA 5B7QA 5L40A 4QRIA 2VPZA 4GFDA 3RRBA 1LQUA 3LBHA 4O2AA 1KOLA 4JV5B 1FJXA 1G41A 1GPLA 2DQ4A 1E5XA 3KV3O 4MKXA 5KYXA 2V0NA 2H16A 4CLOA 4CMCA 4AN4A 1JPUA 2IUFA 4YI5A 3ZWPA 1LDBA 1T6YA 3SR0A 1NDHA 3K3PA 3NBXX 1CY0A 4M1TA 5GGXA 3PTLA 3CR7A 1ZAYA 3LDAA 1YZFA 1IL0A 5LB2A 3LY7A 1C0EA 1XPJA 4WN3A 1TA9A 3TD6A 4ON9A 2ZSJA 4BVLA 4CG0A 4CMHA 3FYUC 2Q5LA 1Y9DA 2XA1A 3NJ4A 1M8KA 1Q0HA 1UBKS 3RKRA 1AF7A 1MIHA 5KYKA 1O9HA 2XUZA 1R8SA 2C2YA 3LQ4A 4FXOA 1RPNA 1F51E 3CH6A 4KV9A 4LK2A 5JZMA 1FRZA 3D0OA 5U4QA 5B1SA 2X77A 1ZEJA 1N6IA 2IYXA 4KZPA 1P0PA 1Y63A 2C8VA 5AVQA 3N9IA 2BFCA 1MOPA 4NYJQ 5J2UB 3NR2A 3U9LA 1D3AA 2R86A 4AJ9A 4BX2A 4EW1A 1W36B 3UXHA 4X6UA 4BQRA 4FLEA 1SXPA 1YBAA 4WJLA 3T99A 4BO6A 4REQB 1JDZA 4RHYA 4DNQA 3CF6R 2GN1A 4R4JA 5HOEA 2X2OA 4YMTA 2YQZA 2DH5A 2ORYA 4QOEA 5IVIA 3E8XA 3KBBA 3LKDA 2FLKA 4IHJF 3E05A 1WMFA 4FHCA 2CHQA 4PLYA 5AKIA 4OJMX 2BGTA 5IDVA 1MEOA 3A3NA 3KOUA 4JJKA 4D80A 3U4GA 3FB1A 4QKQA 1Z68A 4Q3KA 2Q1SA 4QGGA 2ODEA 2WV7A 4TKVA 4QFBA 1R8JA 1WQ1R 4GPZA 3LLSA 1DIAA 4TS9A 3MFYA 4MA5A 3KZOA 2YWJA 3EGWA 2EWMA 1ECCA 3RJ5A 3WL5A 2P0AA 1FTSA 3FF1A 2W2LD 3ITDA 5FKJA 3S68A 4B4VA 3IL2A 4L51A 5AM5A 4ZU1X 3OU7A 4IO0A 4NBTA 1U0FA 2FG5A 3BMXA 3OZAA 1T5SA 4TQGA 3WYEA 4DIFA 2XA2A 3T9CA 3HJNA 1DC7A 3IDOA 2NU8B 5LNK1 1EK0A 3LMKA 3M9XA 3EMVA 3RRYA 4UDOA 4DZRA 4NCKA 4XUDA 2OK7A 4UOEA 2QVCA 4Y6LA 5A5FA 2BUCA 4CEJA 1J0CA 1BFKA 2QN6A 1CK4A 4M37A 1T4MA 1FVFA 1Y8CA 2OZVA 2VSOA 3AVPA 3LBYA 1DXOA 3FMGA 4RVDA 1J70A 1CQXA 2RHRA 4YJ3A 5FNVB 1LDEA 3OQ1A 3M9WA 4IOKA 3RHZA 4PLTA 4Y2PA 1G5QA 2HRBA 3T5MA 4LDRA 4AIIA 2INGX 1EP1B 2KBFA 3H9CA 3K0FA 1PYOA 2JI9A 3CRNA 2G17A 3LXUX 1Z4NA 1X92A 3IBSA 3V2UA 2H4FA 4HEA1 4EAQA 4EKGA 1W5TA 2DULA 3FPFA 3KOMA 3OIDA 3QA9A 4MQEA 4TWJA 4EI9A 1DAFA 1DEOA 4TYPA 5E3IA 4BFXA 5FPPA 4BX8A 5EUQB 4XVRA 4MQ6A 1NTRA 2N0SA 1WM1A 3FGNA 4MXDA 4EKEA 1XLTA 1JX6A 1W2GA 1ZLXA 2VWGA 3EK2A 2A3NA 1PR1A 3WWYA 5A04A 1AOXA 5F4ZA 3NHRA 4Y7DA 1V3QE 2NUPA 3ZUGA 4RK5A 4RK0A 4TV8F 1UBMS 1Z4OA 3IALA 2Y1LA 4MWOA 3RO7A 2PUVA 5IUKC 3WX0A 4UHKA 5EQDA 2AXQA 3L7KA 1PJBA 3V4RA 2V7WA 3HZZA 1EK1A 4IH9A 1P4JA 1TCVA 2ZUSA 4KQ1A 4YP7A 3E03A 1VJTA 2K2QB 2OD9A 2ZUTA 4NK5A 3ASYA 1WXFA 3F7OA 4II7A 3GLKA 5B4UA 2V4UA 3QU5A 3GLHE 2ES4A 3F47A 4H17A 5KOJA 1O77A 1XKTA 1JXAA 1E62A 3LD9A 4OP1A 1A71A 1JZSA 3E4CA 4YHBA 4EGQA 1AT1A 4EGSA 3HEAA 4CR7A 3UUFA 3I9JA 3VZRA 1SO8A 4D4IA 4FFSA 4JLMA 2A1TR 4IMJB 4XSGA 3TSCA 1TB4A 2I87A 3FSGA 1J33A 1ESCA 2JCGA 2Y3IA 3M6UA 2HIHA 3NHKA 3ON5A 1YD7A 3Q8WA 5TB5A 3MJEA 1PLJA 1GL6A 1XRJA 2WD9A 1KU6A 3C6XA 2CVPA 4Z4GA 3FWKA 1JPNA 4IVPA 3B1XA 5KVQA 4YEDA 3W9UA 5FULA 2QJWA 3KTAB 1DNPA 2PGAA 2QTFA 4TYMA 4WN9A 2ZSHA 3AUTA 4HDKB 5KSOA 3KR0A 1P7ZA 2XE7A 3L0YA 2PXCA 3DPUA 4P82A 2EVWX 2J9FA 2MHCA 3OT5A 3UFXA 4YUXA 4EO7A 2ADFA 2PYDA 3DMHA 1REQB 1TVKB 4NHOA 5IDWA 1YS1X 1RRGA 3USES 1TAHA 3JYQA 1P45A 3P0RA 4DA7A 4RZ2A 3BIFA 1A50B 1YB2A 3U4AA 2DR2A 1DUSA 4OIMA 2D2VA 3ZDXB 4LJ7A 2IH4A 1QJ4A 3TQHA 3MERA 4DDHA 4BE9A 2BFDA 1T9AA 2GBLC 2IZ1A 1OLXB 2ZIFA 3N2EA 4CKZA 1ODFA 5ALGA 4DQKA 3ROMA 3VA7A 5IWAB 4Q4CA 2HA4A 1FQKA 3IP3A 2R7AA 5D6OA 1QFYA 2F2TA 4C08A 3FMPB 4K6OA 3A6HA 4EPTA 4JB8A 4DVGA 2GTHA 5DYIA 1O97C 3D7MA 1YZHA 2QUZA 5I6DA 3WL8A 3MCUA 3ECCA 1VLVA 3DB1A 4FJ1A 4Y1EA 3KWLA 2FF7A 1JH9A 5C46F 4E2YA 3O8CA 2B8WA 3WQSB 4XQ9A 3ZXYA 5I7OA 3GUUA 4GLFA 2OB2A 2QZPA 1RQRA 3I23A 5IKPA 3IBCA 1KAHA 2X6QA 3AB3A 1FVOA 2FUG1 1YR6A 5GONA 1CU1A 3K35A 4U7TB 4DNOA 4OFXA 2M6KA 4FX2A 3SEAA 1CUFA 2J7KA 3JWGA 3UATA 2AOUB 1YR8A 4UNSA 4OG2A 3VDQA 3VTFA 1GPBA 2BFPA 1AKTA 1G8MA 4L9AA 2PA0A 1M7GA 4EHDA 2NXJA 6LDHA 1NRJB 2ZRIA 4DPMA 4HDOB 2I2AA 2QMHA 1L5KA 4YMGA 1Z0SA 2W48A 2JLQA 4WXRA 1OW3B 3QU9A 1OA1A 1CY7A 1E60A 1YA4A 4ZVVA 2QT1A 3K5IA 4BN4A 4LF9B 1CR2A 1PFKA 4I55F 1XE3A 2PSSA 3CNOA 1UJ5A 4G1MB 4X54A 1QYWA 4DB4A 3GBSA 3U9TA 2XCOA 2VC2B 1DOHA 1UPFA 3EFBA 4TV9F 1SN7A 4FYXA 4AF7A 2WTBA 3KYJB 4OLFA 4U2GA 4XM2A 4DMRA 5C8ZA 1U7TA 4ZYUA 5L7WA 1GCUA 1XCGB 1E1DA 2A67A 2AV6A 2GSWA 4BMZA 3SN6A 3TQTA 3ZWOA 5EP4A 4LZNA 1LPNA 4UDXX 2RH4A 1JN0A 2XV1A 3G17A 5DGXA 1VG1A 3N0RA 3X2SA 4CCSA 1JQ5A 2OBLA 2FSUA 1A8QA 1JJAA 1XRQA 2FFHA 5FF9A 1HG1A 5ICFA 3UK2A 4Q7MB 2JATA 3FNRA 3FUCA 1AY0A 2NPFA 4AP5A 1ETUA 4Q7LA 3OZSA 2KLBA 2DQSA 3D5EA 4US1R 4CLDA 3EASA 3PU6A 3ICPA 3LW7A 3PXCX 5E0KB 5ELMA 3H2SA 4GI3A 3A10A 2VZ8A 3SK0A 3R8FA 3H6KA 1B41A 2AHOA 4LDJA 3QXHA 1HFEL 2NW6A 2C4KA 3N7AA 1O03A 2CLHB 3NUZA 4FYPA 4Z9AA 1YVDA 2PLRA 2E2WA 3WDKA 1SUDA 3IYLW 4HDNA 4MYSA 4KREA 5HUQA 4IIHA 3DYBA 4Y2UA 5I9SA 4PPGA 4K6KA 4HVCA 2EFHB 5JYDA 4KQFA 1T0JB 1XCBA 3T5PA 1EKXA 5ED4A 4ZK2A 3MSCA 4MQ4A 1A72A 5BYBA 5FAXA 4JJZA 1IOVA 4M54A 5BSEA 4OGKA 2YOHA 2VQDA 3W78A 2ASEA 3UMBA 4B6QA 2W6PA 4LMRA 2FWMX 1BGXT 1UBLS 2UAGA 1U0TA 3Q7PA 4IHAA 2IVFA 1HH4A 4H15A 4NJMB 3R5TA 2X6TA 3FGZA 3W0LB 2GZMA 3GUZA 1J1IA 3JVDA 1XLVA 3RSCA 3ZBPA 2CSXA 5BV2P 4WASA 2C4VA 1JJIA 5DTMA 2IYLD 5ALQA 3THXB 5H9WA 1QH1B 3QXJA 3QVXA 4DTCA 5IZCC 2MSNA 2IHTA 3EVCA 1OXUA 4LYFA 1Z7EA 3TI7A 1QTQA 4AUNA 2ZANA 3ETNA 1HYEA 4R51A 3H3JA 1IUOA 1UBRS 4MROA 4AUEA 3A32A 1QU2A 3MJFA 2V4ZA 3I34X 1ZZGA 2NVOA 1U3VA 1YJBA 3FYTA 3MMPA 5DYGA 5D85A 4QLBA 3V1KA 2AW5A 4UUOA 5DI3B 3MJHA 3M1AA 3O7WA 5BN4B 3T9EA 2KS6A 4G26A 2AN4A 3AV0B 5BYAA 1CEYA 4QZVA 1M1UA 4DLAA 3OT4A 3RFCA 1QIKA 5HOQA 4HMOA 4HAVA 2I29A 2YIDA 3IXQA 4IGAA 2NZVG 4W8OA 3CLUD 1AVTA 1J0DA 3WMXA 2IYFA 4OHYA 2HV9A 4O63O 1W0KA 1PFYA 1HOXA 3WRYC 3D43A 3CKMA 1QVVA 3CIFA 3N53A 4R8LA 1OX5A 4G36A 4XUCA 3IDFA 3MUEA 4YJGA 4LISA 1XHLA 2VTVA 3ZGNA 1Y6JA 2GK3A 4P3XA 5DIFA 3OQJA 1RP7A 5DTEA 2H48A 2YVAA 3RIXA 3SYKA 1XC7A 3DEYX 4V0MA 3WJ7A 5JMOA 1O4WA 2OILA 1YS4A 1KDZA 3U81A 2RGRA 1RAFA 1Z6QA 2LVBA 2PTGA 4CFSA 1XTBA 2AKAB 2DY1A 3MINB 4OL9A 4PGGA 5A4FS 2GHTA 3IQWA 8ADHA 4H3KB 1PJLA 3OY2A 3AERB 1FJGB 3PFFA 2VHCA 4ASUA 1UOEA 3OAAD 3O95A 4R5MA 2CV0A 3EDOA 3QHPA 1EBUA 3GLHB 4TN1A 1XDBA 2LD4A 1R9MA 1YHZA 4P7JA 1CUGA 1JBQA 1RBZA 2GVDC 2OC4A 1QCZA 2P6UA 5ERXA 5JBNA 1E1CA 2XDYA 1EUDB 3GBVA 4WOBA 4A6XA 7ADHA 3W8RA 1VE1A 2DCUA 4CQMB 2Y71A 1ESZA 3RFVA 4IX1A 4BZWA 2XBMA 3CJQA 2J4FA 2WJJA 1HDEA 3QPAA 1B16A 2FHPA 5YASA 1N8TA 4YQZA 3A6GA 2EJBA 2NUAB 2PVCA 2IZ6A 5EQFA 4RF4A 3LC1O 5BNFA 4CKWB 5LJIA 1N6OA 2VDNB 3KO8A 2OM6A 3IR7A 2PE5A 4L07A 2H7CA 2EQBA 1OUMA 2DM6A 1XZMA 3EARA 3R5FA 4OHUA 4TVBA 3ZWCA 1QDEA 4B4OA 2A94A 2WFLA 1BW9B 1SJ9A 4Q4AA 4ZC1A 5L3VA 4KIFA 3VX4A 4QASA 1O1YA 2I6GA 1UL1X 3AWIA 3G9TA 4I46A 4LRTB 4I4TB 1VJ5A 4LXTA 5I7RA 2GVNA 2HA7A 4JIGA 2Z1MA 5CD9A 5T67A 5GZ1A 4WNYA 4BKRA 1XOIA 2HEIA 4MUEA 1NBMD 4CLXA 3BH0A 1EGAA 1EDZA 2B25A 3E3MA 5A4AA 4E1VA 1RRPA 4KU4A 4H3HB 4AMBA 2HX1A 1VMIA 2HF9A 1GDDA 4ENWA 4QXQA 1A0OA 5FOWA 2DJ5A 5FUMA 2Z57A 4EEZA 2D62A 3KJNA 3QTLA 2WI8A 1Y5LA 1CD5A 2JIZA 1E20A 2ACKA 3R2JA 4EG7A 4O2AF 4BNFA 4D4GA 1CHNA 1EXWA 1MAAA 4P7GA 5EZYA 4Q4DA 4RPJA 2VDWA