1THTA

Structure of a myristoyl-acp-specific thioesterase from vibrio harveyi
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
302
structure length
294
Chain Sequence
QCKTIAHVLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDHFAGLAEYLSTNGFHVFRYDSLHHVEFTMTTGKNSLCTVYHWLQTKGTQNIGLIAASLSARVAYEVISDLELSFLITAVGVVNLRDTLEKALGFDYLSLPIDELPNDLDFEGHKLGSEVFVRDCFEHHWDTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRTGHCKLYSLLGSSHDLGENLVVLRNFYQSVTKAAIAMDGGSLEIDVDFIEPDFEQLTIATVNERRLKAEIENRTPEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOESTERASE
publication title Structure of a myristoyl-ACP-specific thioesterase from Vibrio harveyi.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Thioesterase
total genus 101
structure length 294
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02273 Acyl_transf_2 Acyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1thtA00
3V9AA 5FPQA 5AI0A 3DD5A 1DWOA 4AZ3A 2W22A 3ESDA 4KE7A 1B6GA 3OM8A 2XMCA 4B82A 4UHDA 5AI6A 1YB7A 1HLGA 3HSSA 4H0CA 5IVHA 1BS9A 2CB9A 3WKCA 4IHAA 3FAKA 4H7IA 3C45A 3VKFA 3WK4A 4U2DA 2B61A 4X91A 1JI3A 3WA7A 4HXEB 3H2HA 2BJHA 2YXPX 4BP9A 3OURA 3PDCA 3PUIA 2XE4A 2Z3WA 2PM8A 1GXSA 3HI4A 1DTEA 2ACKA 4K2AA 4LXGA 1ZD4A 3EQ8A 3E1GA 3N0TA 3BIXA 4YASA 1VZ3A 2QJRA 5BOVA 3H17A 1J2EA 1MX1A 2XT0A 4H7JA 4B6GA 3KSRA 2WG2A 5AKJA 2JGKA 3F98A 4C01A 3AIKA 3H2GA 1CQZA 4CIAA 2Z5GA 1JKMA 1FFEA 2BCEA 1XLUA 4PSUA 3RKSA 5T4BA 5AM3A 3I6MA 2FJPA 3B5EA 5JAPA 3EQ7A 4J0JA 1BN7A 3A2LA 2DHDA 5LP1A 5K3AA 3G0IA 3WA6A 1QIDA 2ECFA 4QDOA 2J4CA 5HQ3A 5AIBA 3IB3A 4CI9A 3RARA 3H0CA 3GA7A 4QDUA 7YASA 3TJMA 4N5HX 3STYA 5AKKA 1E8MA 3AFIA 1R4ZA 5BV7A 3CN7A 3BIWA 1CUZA 4UHFA 2X76A 4TVKA 1MAHA 1AMNA 4KRXA 1CUCA 4ZXFA 3FLBA 2JIDA 3ZPXA 2IITA 3BJRA 4IH1A 5DTIA 4N8SA 1R3DA 3VVMA 3E4DA 2PKYX 1UOPA 4H7FA 1CR6A 3FVTA 3R3UA 2GZRA 1Q83A 2FJ0A 4OD0A 4FDMA 3WKAA 2OCGA 3H18A 3FCXA 1IUOA 1Y7HA 4BRZA 2Z8ZA 5DWDA 3QYJA 4QE3A 3RLIA 1KU0A 1VXRA 1DX4A 1UK7A 4PF1A 1BEEA 1FSSA 3EIOA 3H2KA 4Y2SA 3H1BA 3WQHA 2GBIA 4KEAA 5AK4A 3ESCA 3V1NA 1XKTA 4QWWA 4Q82A 3JYHA 5ALVA 2WUEA 1K4YA 2I03A 3IBTA 3DS8A 5D6OA 4Y2VA 5ALOA 4F5ZA 3MUNA 1IZ7A 4E11A 4BCBA 1WB5A 2H9YA 4DNOA 5AOBA 2ZYRA 2CJPA 5EFZA 4BDTA 2CKMA 3S2ZA 1YCDA 2I78A 5D7BA 2NW6A 2O2HA 1EVQA 3I2HA 1J07A 3IUQA 5AOCA 1MJ5A 3DCNA 3D59A 1EK1A 1H2XA 4EA6A 4F21A 2PSHA 1R1DA 3G9TA 3BE8A 5ALMA 4K6HA 1LPSA 3W2TA 3M3DA 2OQIA 3IUMA 2DFPA 3DOHA 1JU3A 5CW2A 4BBZA 4QZVA 4DNPA 4UFPA 1J1IA 2WHPA 4PW0A 4U2CA 2RHTA 3QITA 1CIJA 3WK7A 3A2NA 1CPYA 4K6KA 5HFAA 3D5EA 2PPLA 4DSZA 4PSDA 2RAUA 4EB0A 2JGJA 5CH3A 5IKXA 5C8VA 2YASA 3I2GA 1G42A 2H1IA 3IULA 1W75A 1GPNA 1CFJA 5JADA 3D7RA 2X5XA 1O6FA 1CV2A 5KWJA 5EIAA 4FTWA 4QA9A 2XMDA 3I28A 4K5QA 5AM0A 1UK9A 4BE4A 3ICVA 4U2FA 3A6ZA 4B81A 2JGFA 2DQYA 1WPRA 1QJ4A 5AKEA 4ZV7A 2DHEA 3D2CA 4DSAA 5CTAA 1LZLA 2VT6A 2BGNA 3GFFA 3KWFA 4N8EA 1UOOA 4AO6A 3LCRA 4MWTA 4DIUA 1ZI8A 2J4FA 5T4FA 5HKBA 4Q1VA 3AZQA 3D0KA 4X6UA 1P0PA 1Q84A 4BB0A 1ZOIA 1IUPA 1PJAA 5AI9A 3BXPA 3L1IA 4IH9A 1H22A 3WK5A 1AKNA 1EDBA 5YASA 4B85A 4XWGA 5ALGA 1QIMA 1XZDA 4DNFA 4MQMA 1CUXA 2QS9A 5AKIA 5ALLA 2WU4A 5CXXA 5A62A 3STXA 3V1MA 1AGYA 4X71A 1ODSA 3O0DA 2XMQA 1DWQA 5DLPA 5ALKA 1IVYA 2XQFA 5HK9A 1VOTA 3TRDA 2XQIA 4DMCA 1UOQA 4BCCA 2HM7A 3MGAA 5LYYA 5LZ7A 2GYVA 4J0IA 5LLSA 2RGUA 1I6WA 1U8EA 5EI5A 1P0QA 3DL4A 4CG2A 3DNMA 3LIIA 1UXOA 2C58A 4BZZA 3STUA 5AKLA 1ACLA 4KAFA 1WB6A 1VE6A 2VQ6A 3PFBA 3QPDA 2QKYA 4JYMA 2ZJ7A 3R3WA 4FBMA 1WCYA 2XUQA 2H7YA 2PSEA 1ORWA 2ZYSA 4G1FA 3PF9A 3QBJA 1A8QA 4FLEA 4C6HA 3HZOA 2BUAA 5AKGA 1N1MA 3G0DA 3ZLUA 2HHAA 5ALJA 1YA8A 4Q05A 1QIEA 1RP1A 4ZGBA 3DEAA 3W04A 3STTA 4GXNA 1SCKA 3C87A 4FFWA 5AM1A 1YAJA 1X2EA 1MPXA 1LGYA 3Q0TA 2ONCA 3WKBA 5LKRA 3WI7A 4X92A 4H7KA 3PI6A 3FLAA 3C6ZA 4LKOA 2HRRA 1XRNA 4UPDA 5ALFA 3RK4A 4B83A 5JASA 1F6WA 1PFQA 2PSDA 5CXUA 4PSCA 4HRXA 1DINA 2VJAA 2WG1A 1BRTA 2JGLA 3I6ZA 3CXUA 3WYDA 5CBKA 1VXOA 2ZSHA 4X7BA 1CRLA 3C5VA 2HA3A 3G9ZA 3IUJA 2VSQA 5JYCA 3O4GA 5ALZA 3FWHA 1YA4A 4MXDA 1K5PA 4C88A 2ZJ6A 2WUDA 3C8DA 1JJIA 2OAGA 3VXKA 1F0PA 1XLVA 3K6KA 2XUFA 5EHQA 2XUKA 2CZQA 3BDIA 1BE0A 1CUDA 3AILA 5ALXA 3ESBA 3WIOA 1H2ZA 5DYWA 3FNBA 5H3HA 2QXTA 4MEBA 3WKEA 1H2WA 4H7DA 2WLSA 2JEYA 3K2IA 1MTZA 1A8SA 2PUHA 1LZKA 2WFLA 4S0XA 4DNQA 1XRLA 4CCYB 3SWWA 1BEZA 1F0NA 1FJ2A 4ZWNA 2GZSA 1Z68A 1XZGA 1DT3A 2XMRA 3WK6A 1SCQA 2OG1A 3F8SA 5HF5A 1K6EA 1ZD3A 4LIPD 4WFJA 2XUHA 4X6YA 1CUGA 2WG0A 3FSGA 3WZMA 2ZYHA 3FVRA 4Y2JA 4DMHA 5JIBA 2G63A 1VZ2A 1GKLA 2HA5A 5CMLA 2HIHA 5CT9A 1Y37A 1QIFA 3VJLA 1CLEA 4OU5A 3ANSA 4LYDA 1VJ5A 4BTVA 4F0JA 1CUJA 3G0GA 4XVCA 5AM2A 5AH0A 2ZYIA 4X95A 3U0VA 1JT2A 2XMZA 3ICWA 5AKZA 5EIEA 3O4JA 2RIPA 5ESRA 4TPKA 3WL8A 2WU3A 3OC0A 2VJBA 3B3QA 3R0VA 3WJ2A 4E46A 1MO2A 4ARAA 4CCWA 4ZI5A 3KOOA 1FFBA 4LXHA 2BAGA 5AICA 5EHZA 3AIOA 3DOIA 3BL8A 3I2IA 4HXGA 3KXPA 1LPAB 4W9RA 1DU4A 5FXMA 2JGEA 3DDUA 2Q0XA 1ZIXA 3VJKA 1XZKA 5C8XA 1NU6A 4Y7DA 3T52A 4B80A 1LPMA 4OYLA 3GELA 5FPPA 1TAHA 1TCBA 4P08A 4UHBA 4BVLA 4B0PA 1GQSA 1Y7IA 1J06A 2JGIA 1T4MA 1E89A 1TQHA 3R3ZA 5A7FA 5DYYA 4PV7A 4FNMA 2QOEA 4BRSA 1TIBA 2O2IA 5IVKA 1MAAA 2ES4A 1T2NA 4QLAA 5ALNA 2D0DA 2OXEA 3LS2A 4DM7A 1UWCA 5FV4A 3F96A 4QNNA 1R9NA 3PE6A 5E4YA 4OB7A 3I1IA 3RM3A 2EDAA 1EB9A 4GW3A 2PX6A 1MN6A 1UZAA 3L1JA 3KDAA 1GPKA 1A7UA 2WFMA 5AK6A 3L1HA 3R3VA 4MWSA 3PF8A 4J0HA 1QTIA 4RE6A 4X3CA 4NVRA 1Q0RA 4LYEA 5KBYA 3WL5A 1GGVA 2PSFA 1DT5A 3W05A 4UFOA 2BKLA 5CT6A 5C8ZA 1DWPA 3C43A 2XUAA 2B20A 1WHTA 2DCMA 5ALSA 3BJMA 3CN9A 1AZWA 1LPOA 1BCSA 5AO9A 3VJMA 4Y2RA 3DYIA 2VJDA 3JW8A 4UHCA 5FKJA 4ZV9A 1CQWA 3HABA 4KJXA 1XZMA 2EDCA 2HFJA 2WIJA 4OSEA 4CIBA 3O9VA 4BAUA 2XQGA 1OCEA 1P0MA 3MVEA 2QRUA 2R8BA 1RWQA 2G5PA 2DR0A 2IX9A 1VE7A 3V48A 3D2BA 2Y6UA 4G4JA 3LP5A 2ORYA 2PSJA 2XUPA 4HZGA 4J0GA 1AQLA 3NUZA 2P8SA 1EI9A 3X3HA 5AK5A 2FUKA 4W1SA 2OAEA 1ORVA 4G8BA 1XLWA 4OB6A 5D3ZA 3I2JA 3O95A 3C5WP 1W4LA 4HS9A 4YPVA 5A7GA 1GZ7A 1CUYA 4Z49A 4XJVA 4BE9A 5T4HA 4C89A 5DNWA 1WHSA 4ZRDA 3ED1A 3QPCA 4QDTA 3ILSA 2B4KA 3EF3A 3H2JA 2VAVA 2IIVA 1U4NA 5HZGA 3ESAA 2UZ0A 1QLWA 1CUSA 5AP9A 4WFIA 4M0FA 1JFRA 3DYVA 4BDSA 5AI8A 4FOLA 2XUGA 4M0EA 1XZAA 3O4HA 2VJCA 4BATA 1YS1X 1NU8A 2Y1KA 2PBLA 5FDFA 4AZ0A 3HYSA 3HEAA 1AC5A 4NMWA 4B84A 4B9AA 2V9ZA 5ALWA 3HC7A 4BC1A 2CEKA 3R41A 3FOBA 1XRMA 4BAGA 2C0QA 2XB6A 2XUJA 5C81A 2QXUA 1QIGA 2Y2UA 3H2IA 5FRDA 4PNZA 1AUOA 4KAJA 3I2KA 3FYUB 4CG1A 3IUNA 1YASA 2HL6A 5EHXA 3QPAA 2JGMA 4Q3KA 3QMMA 3NWOA 3O4IA 1R50A 4HAIA 4YK7A 2QVBA 3FCYA 2J3QA 5E2IA 2QM0A 5JAUA 2C5FA 4AQDA 3LLCA 5AM5A 4U2GA 4N5IX 4KE6A 1XZIA 4X90A 3PUHA 1MU0A 3UMJA 4BTLA 2CMFA 5HFNA 1XZLA 1CUWA 4GI1A 1ACJA 2QR5A 1Q0ZA 2OGTA 3ZLTA 4I3FA 4LXIA 3UUFA 2WJ3A 2JBWA 4WDQA 1WOMA 5ALEA 2VT7A 3CCBA 1L7QA 4CG3A 1AX9A 1IZ8A 2HA0A 1HBJA 4EY4A 2YH2A 5ALTA 4ZREA 2I3ZA 4Y2XA 5DNVA 4BYMA 5ALDA 4CCYA 1EA5A 1XKLA 4X93A 3JWEA 4BAZA 4ETWA 1G5FA 1YR2A 1EINA 2CBGA 3U1TA 3I2FA 4G4GA 5EGNA 3F67A 5K3BA 3HRHA 4FWBA 4Y2UA 3WMRA 4C87A 1QIJA 5AOAA 4EHBA 1CUVA 4BC0A 4KE8A 1EVEA 4DMFA 4L9AA 5C7YA 2WIFA 4J0KA 4GLBA 1C7JA 3DKKA 4Y9SA 2Y6VA 4G9GA 1SC9A 4RPCA 4DYHA 3OTQA 4NZZA 1W1IA 1BCRA 1BN6A 1KU6A 5IH7A 1U65A 1UFOA 1CEXA 4WFKA 3D4LA 1E66A 3C6XA 3AUKA 4MYSA 1XZCA 3MUOA 4U2EA 4G4IA 2WFZA 4FFVA 3WWCA 3C6BA 3R3YA 3FYTA 1E3QA 3IA2A 2VATA 3R3XA 3STWA 3IIIA 2C4HA 4I4CA 1NX9A 2EEPA 4E15A 2QZPA 5LZ2A 3AZPA 4B9EA 4QDXA 4ITVA 2C7BA 4H35A 4QEKA 4G8DA 2BGRA 5T4EA 1ZI6A 2HA7A 3HXKA 4B0OA 3WLAA 4BVKA 2AJCA 4FKBA 5KREA 1SCIA 4JYPA 1ISPA 1A88A 3KWJA 5ALIA 3EQ9A 4HRYA 1JMKC 2OLEA 3BDVA 4Q34A 5AK3A 3OG9A 2GBGA 3V1KA 2ROQA 4HVTA 1K8QA 4PQEA 5IVDA 3SX4A 3TGLA 5JZSA 5HF6A 3FYUC 4RNCA 1MX9A 2QT9A 1QIHA 1YB6A 5IVIA 4ARBA 1YAHA 2O7RA 2XUDA 3WYNA 4UBLA 1MT3A 1UK6A 5AJHA 1X70A 1P0IA 3GROA 3V1LA 5A7HA 1L7RA 3EBLA 3G02A 1X2BA 3I6YA 3STVA 4X6XA 3G0BA 1QFSA 4QWMA 3AIMA 5JD5A 5CH8A 1UKBA 1CUHA 4UFNA 4CFSA 4INZA 4OUKX 2D5LA 4GWLA 2VF2A 4UBMA 5ALQA 2GBFA 2GBCA 3WWEA 2RI6A 2G5TA 2CUTA 3WK8A 2OCKA 5HKAA 4G8CA 2E3JA 3W9BA 1UK8A 1KEZA 1ZGBA 4WCVA 3QVMA 1GQRA 1U2EA 1CUEA 1R88A 2ZJFA 5CT5A 4KAAA 4B7ZA 4G5XA 3P2MA 4G9EA 1H2YA 4JUIA 2PVSA 3OOSA 2WIDA 2ZVDA 2WIGA 5LZ9A 4JH0A 2VEOA 1LPPA 2HU7A 5LIPA 3VVLA 5FLKA 5EIHA 5AHXA 2AJLI 5JD4A 5DTJA 4KYVA 4W1PA 4LHEA 4JEIA 4P93A 4H18A 1XFDA 2J3DA 4WY8A 4BCDA 5BWCA 1R9MA 3CCCA 4UBOA 3BF7A 1ODCA 3E3AA 3O9MA 4L72A 2XLCA 3G0CA 1K63A 3FLEA 2VTVA 2XMSA 5JD6A 3HLKA 3R40A 1HDEA 3H04A 5AKXA 6YASA 3WL7A 4Y2YA 4KE9A 2HADA 1SOMA 2FX5A 1XZEA 4X85A 2BFNA 2O7VA 1N5MA 3G9XA 5SYMA 1ZIYA 2JEZA 1QIKA 4AB1A 4IQ4A 1UKAA 5AI4A 5A71A 3BF8A 3W06A 2C5GA 4W1RA 4A16A 4UHEA 3C6YA 5ALHA 1FFAA 1ZGCA 3SC2A 2O2GA 3FSGD 4GECA 2XI4A 5CRIA 1O6GA 3FYUA 5HCUA 2W6CX 5HF9A 5FP0A 1RYYA 4OB8A 1FFCA 2HU5A 1M33A 2OCIA 3DL7A 3VISA 5EHNA 1LPNA 3QMWA 1QO9A 5JARA 3E0XA 1HQDA 1XRPA 5K3FB 3VDXA 1GT6A 3QH4A 2WJ6A 1L7AA 1XRQA 1VA5A 2HDWA 3UUEA 3NOXA 1ETHA 1QFMA 5JALA 1QIIA 1TCAA 5I7UA 1CUIA 1DQZA 2WFLB 1GPLA 4AXBA 2QTBA 2XQKA 1LBTA 4C4YA 1TCCA 5ALUA 4WJLA 4UHHA 2RONA 2Z3ZA 2K2QB 4DGQA 2V98A 4FNGA 3ZLVA 3DKRA 1QTRA 1THGA 2GYWA 1ZJ4A 4U2BA 4EBBA 2WM2A 4EZIA 2XUIA 4AMYA 1GKKA 2XQJA 3K9BA 4EY5A 3YASA 1TKRA 5FOQA 3M83A 1G66A 1CVLA 3WWDA 2VA9A 1XROA 1HL7A 4V2IA 3W9UA 5DYTA 3WWOA 2XMBA 4FHZA 4XIIA 4C4XA 1XZBA 4J03A 2BUCA 3WIBA 2OGSA 5ALRA 1QO7A 3WK9A 1CUUA 2AJDA 3GZJA 4J0CA 5LZ8A 3QM1A 3S8YA 2G4LA 4UBNA 2HA2A 3LIPA 4M0MA 4O08A 4BZWA 1XQXA 2PU5A 1UT6A 1QZ3A 4X94A 1USWA 2VAXA 1N5RA 2GYUA 4JNCA 2Y2VA 2X8BA 1MNQA 4KACA 4GBGA 4HXFB 4IH4A 3IVMA 3T4UA 4OYYA 2YYSA 5K3CA 4MQLA 2BUBA 1DQYA 3FBWA 1XRRA 5K3DA 2HA6A 2WQZA 3A70A 1C4XA 5J3JA 4TGLA 5FUMA 4NS4A 5JANA 1EH5A 3GUUA 1EDEA 1XQWA 2OCLA 3N2ZB 5LZ4A 3PICA 2AJ8A 3G8YA 2WHRA 3C70A 4BVJA 5ISMA 2PUJA 4DLNA 5HQ3B 2PL5A 2XMGA 4FBLA 3QZUA 2V97A 2WJ4A 1S8OA 2LIPA 2QMQA 4EY7A 1ZI9A 2WSLA 4DMKA 3WZLA 1EDDA 2ACEA 1OXMA 3WL6A 4K6GA 3HJUA 4Q3OA 2H7XA 4GDMA 1QONA 5AIAA 3TEJA 1EK2A 4J0DA 3AINA 4EY8A 1N8SA 4PO3X 1FFDA 5SYNA 4OPMA 3Q8WA 2WIKA 4GHWA 4OCZA 2WUFA 1JJFA 4X97A 1WB4A 1MX5A 4UBJA 2AJBA 5JAHA 5JZ9A 2WILA 2HRQA 3H19A 1VLQA 5JATA 1UKCA 4A5SA 1JMYA 3G9UA 3ZI7A 2WKWA 4QLOA 1G4HA 1E8NA 2OQVA 1BROA 1LNSA 3C8HA 3DQZA 4H77A 3I1YA 1EX9A 4WDRA 2B9VA 5AM4A 3DJYA 5I9IA 2JF0A 3AJAA 1XZHA 5E4JA 1B41A 4EUSA 1EXWA 2RHWA 2AXEA 1ZD2P 3B12A 4Y2QA 5K3EA 5LZ5A 4IO0A 4FMPA 1XZFA 4A23A 1E5TA 3WWPA 4AN0A 1QOZA 1CUFA 5JAOA 1BU8A 2V96A 3F97A 1VA4A 1YS2X 1JJBA 2XLBA 5E4TA 3H1AA 5LKAA 5D3KA 1F8UA 4ROTA 5DNUA 1H23A 4N8DA 1JU4A 5JZBA 4C4ZA 1TK3A 1THTA 5CT4A 1LBSA 1D07A 5CURA 3ANTA 2R11A 1C7IA 1SFRA 4OU4A 3G7NA 5K5EA 3D2AA 4QDZA 5F4ZA 1AURA 4X00A 4L0CA 3OPMA 1LLFA 5BWBA 2WHPB 5HK8A 1EB8A 5DJ5A 4Q3LA 2H7CA 3PFCA 4RGYA 4UUQA 2DQZA 1HPLA 1DX6A 2QUBA 1OILA 4J7AA 4GEGA 4W63A 4AMZA 5AKHA 2DHCA 1EHYA 4AO8A 1IUNA 3BWXA 1XZJA 3ZV7A 4FLFA 3M81A 1ZICA 2ZSIA 4DTCA 1IMJA 2WTNA 1XQVA 5KWIA 4MJ3A 5CT8A 4Y2TA 5AI5A 4D9JA 4WY5A 3AZOA 2I3DA 3HACA 4FLMA 5A2GA 4XX1A 4MEAA 4AX4A 1XQYA 4P9NA 5ALYA 2WHQA 1HKHA 1W52X 4Y2PA 3IDAA 4KR0A 4EY6A 3WKDA 4P92A 3A2MA 3ZWQA 5CH5A 5A6VA 1QGED 2DSNA 3WJ1A 1CUBA 1ODTC 1W6RA 4L3WA 4H7HA 2HU8A 4UBKA 2XDWA 1TRHA 3NGMA 4BP8A 2PU7A 1YSCA 1W76A 4AO7A 1PV1A 2HA4A 3GBSA 1A8UA 1LPBB 4YX9A 1VKHA 5AKYA 3M82A 4UBIA 3KD2A 2WUGA 2OPHA 3SK0A 1ZJ5A 4MYDA 1ZD5A 4H7EA 2QUAA 2QJWA 5K3FA 3DLTA 3D3NA 3QMVA 4W1QA 1QE3A 1CUAA 2Z8XA 4AN1A 5HF8A 2HFKA 5ALPA 4KRYA 4F60A 4HTAA 1MNAA 1WPXA 2XUOA 2WTMA 4J3JA 1WM1A 3IURA 1E8DA 4I19A 3F9CA 5I8PA 2OGZA 4E14A 2C0PA 4RE5A
chains in the Genus database with same CATH superfamily
4C43A 3V7WA 3ZWXA 2RAFA 2Z2YA 5CW1A 3A6LA 1G2OA 3B3AA 1V26A 3WDMA 4ER6A 4OHPA 4J7XA 4U3JA 2HXYA 5HKOA 2W22A 3R76A 3H3JA 3LC1O 4ZO9A 4G0MA 3KLBA 1QV6A 3OLQA 3DONA 2GH1A 1B6GA 4CF6A 4DXHA 2XMCA 1PGQA 1QFZA 2NLOA 4IQGA 1XB2A 5DMHA 2ZP1A 2AHRA 4B82A 5JVDA 2AS0A 2O1XA 4EZBA 5CVEA 4LYGA 4MDEA 2ALJA 1Z6YA 4G0VA 2I1QA 5IVHA 5DOVA 2HMUA 3GPIA 2Q0HA 3ZS8A 2DKNA 1W0JA 5KPDA 4MVJF 4URYR 3F3MA 3D6MA 2RCYA 3F3KA 4I4IA 4IHAA 4J7UA 3J81k 2BEKA 3B6EA 2B61A 1YJ5A 1BXGB 4U2DA 1S96A 4OXRA 4MIYA 1JI3A 4DM4A 1MENA 2DPXA 2F3UA 5K8IA 1PVOA 4RF5A 2BJHA 4HF7A 3DDSA 2Q4TA 4BGEA 3LUBA 2D59A 3D8BA 4MHOA 4DQUA 1OQAA 2PHZA 4K81B 3AUUA 3AF6A 3HI6A 1DPFA 1DBQA 4M8KA 4C7BA 1K6XA 2CLCX 3RFFA 4F06A 1AMOA 4FQ5A 5EVJA 3MRXA 4ZP1A 1F3LA 4K2AA 4ZMRA 4OBBA 4MGYR 7MDHA 1PR4A 3N2EA 3V8MA 1TMGE 3D8UA 1ZJJA 3SYRA 1Z0IA 3WBKA 4RTQA 4DIDA 3QFSA 4I3HA 4P38A 4YAGA 2R751 2CT8A 2QJRA 1E1CA 3T9AA 3D2LA 4RULA 4P3OA 1WAMA 5BOVA 2EKPA 2XT0A 2ZBDA 5FQOA 2LCQA 4B6GA 4DLRA 5TMPA 3ANLA 4PO9A 4P34A 3KSRA 2V45A 2CLDX 2ZWMA 4PZCA 2ZBPA 4ZVTA 3KR2A 3H2GA 1CQZA 1JHQA 4J76A 3N9IA 1BO6A 2YTZA 1ISGA 2GXUA 3AOGA 1JG3A 1XDDA 3IQGX 3RASA 1E9FA 3CT6A 5A9RA 2AE1A 2XHEA 2ZWAA 2PXHA 2G67A 3RJMA 4RZUA 1Y8ZA 4AN4A 2BCEA 2G83A 4GXQA 1NDHA 1PUIA 1T9GR 5EMKA 3MWKA 3Q1KA 3SQMA 3UG7A 1N8TA 4LSGA 3PDHA 4KKVA 3NMUF 3O3NB 2F90A 2YV1A 3C7KA 3DKIA 5BO5A 1OX5A 3I6MA 4P4SA 2FJPA 3OEEA 4S2EA 5AM3A 3THSA 4BX0A 3I62A 2VI5A 4FX5A 3NIGB 3KTOA 5J23A 5KCZA 2HWYA 3JD4A 2QN6A 4IHKA 5C4MA 2Z8YA 2R8OA 4HUJA 5I7OA 2DHDA 4Q4AA 2HMYB 3WOHA 4CT5A 3NU1A 2E0IA 3V4VB 2PX0A 1YACA 3G0IA 4DQ0A 1QIDA 1G9SA 1RI1A 2UZ4A 2OQRA 3BFJA 1XSEA 3CURA 2A6PA 2J4CA 1CB7A 2O2ZA 2ZB8A 4ZCMA 5KNCA 3UGTA 1DCMA 1ZKMA 3ACDA 2ZSJA 1M2OB 4RK5A 4BIIA 5IDXA 4OGLA 1FJGB 1T2UA 2CXRA 3EQ6A 5FL3A 4WCFA 2ETVA 3BXOA 1SCAA 4RXUA 4V1CB 5IANA 4BNUA 1KDOA 4TWJA 2I6GA 4YAEA 1RAEA 4XD2A 5AWFC 4CLRB 4G0QA 2FK8A 3G3EA 3GA7A 4MA0A 1YJAA 4QDUA 5BMVA 5BV1A 3BCHA 1YOVB 1KMHB 4RYDA 4ETNA 5EJ8A 3VKGA 4N5HX 1PFKA 3GX1A 3U7GA 2AV6A 3AR2A 1RC1A 2FDRA 4BHTA 5BV7A 1QOQB 5A02A 4GOND 1BGXT 3K0FB 5JJCA 4DBZA 3LQRA 4UHFA 5AHOA 1AA6A 1KYQA 1RLIA 1M5RA 1NVKA 5HKKA 3PQDA 1MXHA 2HMSA 2QTTA 2CXSA 2GPJA 1FX1A 1QFYA 2X76A 2OC9A 2V3VA 4JXJA 4CXMA 2QUIA 4LJRA 1F5NA 3EXFB 3K8YA 3R44A 2BEUB 1MAHA 3K2QA 5A9SB 1Q1EA 2Q5EA 4D3XA 4RS3A 3BRQA 3DDWA 1UT8A 3IS3A 3KYIB 4KRXA 3FLBA 1NW3A 3EDCA 4FCTA 1OT3A 3I04M 3I6IA 4UM8B 1SBTA 1SQ0A 2CBXA 1KH2A 2YJ4A 4CDMA 4MW7A 4CI0B 5K01A 1OVMA 4R98A 3MQ2A 1OXUA 1TOAA 2ZU6A 2JLAA 1MVOA 2IYLD 3AI2A 1SC3A 4M36A 4NJOA 3SCZA 3TQQA 3W3AH 1JL3A 3GLQA 1LC0A 3PG5A 5H16A 3ZVLA 3WNZA 3LUPA 2FWBA 2FH5B 3TI7A 2BGLA 4I4TB 5F1YA 4AYTA 5C51B 1QGUA 5AUOB 1GHTA 2VBCA 4JQCA 2XB2A 1MRNA 4XVUA 1PL6A 1EWKA 3WKAA 1JKXA 1NVEA 3LPDA 4FZRA 2IGBA 4L8VA 4OLJA 3WISA 3GK3A 2XA2A 3WP1B 5I47A 1UAAA 4CQMA 4MDHA 1Y7HA 2DQKA 1XK7A 2DPGA 3JQFC 5DWDA 4BRZA 5IF9A 3QYJA 2ZFUA 1M0EA 4RK7A 2CF6A 4BP1A 4QFMA 1QP8A 5C3UA 1YVPA 5FCDA 4KPFC 1P5ZB 3EPRA 3H8JA 1V9LA 1DX4A 5D5PA 4ZEXA 2VWPA 2I62A 1Z4JA 3H5AA 3OO0A 4BFTA 4BU1A 5IYZA 5EC8A 3SEQA 3FPFA 2FXVA 4Y2SA 2ZUTA 3NVDA 1W6UA 3QKWA 5LMNB 2VUIB 5ILGA 2J6HA 5EP4A 1ZH0A 4M9SA 2I2BA 4KMRA 4O4JA 1O6ZA 1G5PA 3JYHA 4O2LA 2Z2IA 3HKDA 1FFYA 1PT8A 1YZQA 4LBVA 3IBTA 2DWUA 1ZLXA 4FC6A 2JHGA 4E5UA 4F5ZA 1B6TA 3E9RA 4E1VA 5KVVA 1DCFA 4DV7B 4IVPA 1NBMD 1REQA 4IZHA 2H9YA 2YXEA 3GV0A 1FMLA 4I6GA 5C7OO 3HVRA 4K8RB 1OKKA 2P0YA 1S9HA 1DC4A 5GJWC 2CJPA 3WDLA 1OROA 4L8GA 5H9WA 4BDTA 5HPYB 3R1IA 1JFSA 4EG0A 2CKMA 3S2ZA 4V3CA 3K53A 2I78A 5D7BA 1XRJA 4Q1DA 3VVCA 5CB0A 1JW9B 2OO5C 2JI9A 1ILEA 1NJ5A 1X1EA 2YMMA 2ANCA 1BKYA 1V8FA 2GXSA 3UYKA 1MJ5A 4QBHA 3TKAA 1JHXA 3QU4A 3WAKA 1KAGA 2HRZA 1JEAA 3EHEA 4U7FA 5F9MA 4QYSA 2JIQA 1D7OA 3KQSA 4WN3A 4YPFA 2GEKA 2PSHA 1FSFA 2WMYA 3BE8A 3TD9A 1MEOA 2NVUB 3L92A 5JCXA 2P9EA 2FSSA 3D31A 3ZHZA 3M3DA 2P75A 3A32A 3B6ZA 4I14A 2OQIA 3OQNA 3KFVA 5KYKA 4A8JB 3SHQA 1V9SA 1ECBA 1VL8A 1WOYA 2VEDA 4K6FA 2VF8A 4N7RA 4I50F 2W83A 1JF8A 4KREA 2IYFA 3BTSA 4IY1A 4PW0A 1QFJA 2YBEA 1SVOA 4ALLA 2CW5A 2HQBA 1YS7A 3IAFA 3QITA 4KBGA 5EJ7A 4N48A 3QLEA 4C0JA 4RIEA 2W43A 3HN7A 1PJSA 1CIJA 1W96A 3EN0A 3I92A 3G5UA 3OCYA 4LQCA 3WNDA 3A2NA 3OFND 4RK0A 4TN1A 3HJGA 4BMPB 1OAOC 1TYDE 2XWSA 4YLYA 5ICGA 1UMDB 3IMGA 5TF4A 4DSZA 1XNQB 4PSDA 2PH1A 3K1AA 3C1OA 4EWLA 3LYAA 1C4KA 4DMLA 1Z2OX 1RBZA 1PAUA 1UMCA 4ARVA 2WE7A 4PLTA 4WNCA 4LMPA 4E2ZA 4OJTA 1QAMA 3MCTA 2JGJA 4C05A 4CWAA 1QQBA 5CH3A 2Z6AA 4JUCA 4Z3DA 3I32A 3LNCA 2EOAA 1L4LA 2NOAA 2YASA 3CE9A 3R5XA 2F4VB 1G42A 1TFRA 2CLKB 3ENQA 3T9FA 5IHXA 5AVUA 1QZZA 3IIKA 4ZCQA 2IIPA 2A9OA 3IULA 4LXTA 2ASEA 4HNQA 3HKCB 2HZ7A 4FYYA 4O1MA 4DV3B 1QPZA 1GPNA 1FMCA 4XYMA 3G2HA 1KC1A 3M6VA 2BVNA 1M6VB 2ID8A 1O6FA 1OY1A 1JPVA 1N0IA 5HILA 5A1TA 3JQAD 1L7OA 3E03A 3CX7A 4MWGA 3PK0A 4WSOA 5BYBA 1JWLA 3H4MA 2VK2A 3N70A 4DQLA 4MQEB 4R8RA 5BV2P 2HF2A 3HWSA 2FY8A 2EW1A 3I28A 4M1QA 3Q8MA 1AQUA 1CJTC 1I3OA 3H13A 4PLGA 3V9PA 1M2EA 4E0BA 3I12A 2V4MA 5AJYA 3G6WA 3A6ZA 1MEEA 2JGFA 2K6GA 1TJ5A 3HADA 4IIGA 4EMUA 3R5SA 5I48A 1HFWA 1Z5GA 2ISSD 3NGLA 1ZMTA 4KKXB 2Y76A 4H4EA 3LL7A 4N7JA 4OOFA 1V9CA 4L3VA 5CTAA 1L5HA 4A2QA 1LZLA 3IOYA 4EHKA 4ZO7A 2BGNA 2J9YB 1GWNA 3ECCA 1D9ZA 2OWEA 4IIYA 4V0LA 1K4KA 2IODA 3V6LA 1ZK2A 3IPXA 3TSAA 1XNRB 3VHXB 1AV6A 4XFKA 1DV1A 1K3UB 2PZMA 1QCZA 2R1VB 3FB4A 4G1CA 4TRRA 1K2VN 4QVGA 2CNOA 1IOWA 5I3CA 1ZI8A 4BQFA 4F6RA 4IW3B 4M7PA 5JD3A 1TEVA 5GONA 3T7IA 3ML1A 3A3NA 3ZWDA 4FYMA 2JHCA 3NDRA 5F73A 4OYHA 2NZ2A 4GZMA 5BPHA 4HWOA 3UGJA 1P0PA 2R8XA 3KL4A 1N2OA 1HDCA 1Q84A 4XB1A 4BB0A 1V25A 4F1KA 3M6FA 1IUPA 3TUJC 5KSWB 2I1VB 3H8WA 1L8QA 3DTTA 4EK9A 1R6VA 1N0HA 2H2WA 2OLJA 3ITKA 1Z9BA 2QXYA 3EWNA 3FMVA 3JAMA 5D3MA 3S40A 5EXSA 1TVEA 2P6PA 1H22A 4IH9A 2D1YA 3JQBC 4RK6A 4D3DA 5JISA 1EDBA 3SQLA 2G1UA 1YC5A 5DBOA 1XTQA 3DOOA 1KY4A 3SHFA 3UHAA 4B85A 3PFNA 1FTSA 1PWEA 3VOBA 5JLAA 1U9ZA 4S1PA 1GADO 1W9MA 1Z3CA 4V02A 1H2RS 4DNFA 4MQMA 4A4DA 5K0EA 1JBEA 2QS9A 4K05A 4CUKA 3PD7A 1DTSA 3T95A 3C8UA 5ALLA 5CXXA 2CLOB 3CPEA 1KI4A 4TQGA 2J9ZB 2W42A 4DLSA 4X71A 3MFYA 5U4QA 2OHGA 3LOPA 5G4KA 3O0DA 4HGRA 1WZIA 3S2YA 3T7JA 3JQFA 1YVEI 4KX5A 4DWOA 5I9NA 1IVYA 3EXG1 5IJXA 1I0LA 4G89A 4GD3Q 2H5EA 3PTZA 1B2LA 2F1IA 3NTQA 3WG9A 3RS2A 4CEJB 5FOTA 3B36A 4G81A 3LBYA 4LYHA 3GVPA 3F8TA 4E2FA 5B6JA 5LZ7A 1GGEA 5F23A 3BSYA 2O8VA 4IYRA 4J0IA 4XH9B 4GRIA 4Q7EA 5JY1A 2R4UA 3ADBA 3REQB 2RGUA 4JUBA 4MS4A 4BMYA 1JR4A 1Z62A 1OXXK 1LX7A 3GDFA 1QCYA 2CGEA 1WU7A 4RKFA 1T9ZA 1H4TA 4LDJA 1WEHA 3Q8LA 1KEEA 1HRDA 3ETCA 4XVRA 3BKXA 1BMTA 3DULA 4CG2A 1V5GA 3V3KA 2RD2A 2FW8A 3FW1A 5DASA 3HMKA 3TQSA 1FYWA 4NH4A 4HQKA 1UXOA 1ADFA 3STUA 3ZWMA 5LNK1 4I50B 3S8MA 2A9KA 3G6KA 3UQZA 3GJ8A 3HXLA 5LDDC 3B8EA 1Q74A 2I2CA 2ONZA 4FGKA 3K96A 4WL0A 5LBIA 5C34B 1RRMA 1OZAA 4OHFA 10MHA 3DEYX 2OO5A 3BT7A 1DAEA 1GUZA 3NT5A 4FBMA 1W0KA 2PZLA 2IPXA 3FCUB 3JPWA 3QTBA 3ZDFA 2ZYSA 4G1FA 4HD8A 3PF9A 2BZ1A 1AO0A 1WHSB 3QBJA 1F2UA 1F1JA 3OPVA 1TU3A 4FLEA 2QSJA 4GOMD 4OEHA 5M5BA 1EVJA 4N3GA 1YS4A 1PF7E 3N28A 2C4NA 5JS7A 1JX6A 3QFHA 2OKGA 5DRTA 3HJTA 2L82A 2BSQA 1BXGA 2JZOA 1N1MA 4LCBA 1QYWA 2AQKA 3KOZA 1C8BA 2E4ZA 2B98A 2HNBA 4KQKA 1MJHA 1VMDA 1B3RA 3TBFA 3F5MA 1QIEA 3JZFA 3FA2A 1T1SA 4MSUA 1ZOPA 4JENA 1TM5E 2OM2A 2PYZA 3GP3A 3KHTA 3WL4A 3LDUA 4ZGBA 4OP2A 3GEMA 1R37A 2HQ1A 1DOAA 5IBQA 4GT1A 3KEMA 3GRKA 5LIRA 1W5TA 3KUUA 3X1WA 3GOQA 1NKVA 3P0IA 2FPPB 4TXLA 2VR1A 1B42A 3REGA 1QH0A 1JIVA 4FGZA 4IWXA 4F2DA 4HT3B 1OAOA 1X2EA 2HJHA 1HGXA 1PYDA 3E5RA 3NYQA 3PEFA 3Q0TA 1EVKA 4E5KA 4AZ0B 3N8NA 4OQFA 2JAHA 2QSYA 4NOKA 4P8RA 1V7QA 5LKRA 1H2HA 4X92A 1CS0B 2F48A 3RRFA 1HYEA 3QSGA 3TPZA 3E9QA 4ZVOA 4CM7A 2P78A 3EPLA 1IHOA 1PUJA 4LJYA 3ZZTA 4BGUA 4QSMA 1XVLA 4X1KB 4CUZA 1EX6A 4R1SA 3SXJA 4E2WA 1ZM4A 1RWNA 2DPLA 1A5SB 1XRNA 3AH8A 2Y1WA 3ZE7A 4Q4JB 4OHZA 4EB8A 2BHNA 3MMSA 4N3NA 4LY9A 5ALFA 4GX0A 3VU0A 2H1SA 3OPXA 4XVHA 3IT1A 4XFDA 5JPIA 4MKIA 3A2KA 1IJKA 2O52A 1PFQA 2PSDA 3ZGXA 1OASA 2ZANA 4OQQA 1ZK3A 3X1YA 4PC1A 2XCSB 2Y1EA 2IHVA 1V5WA 5KWVA 2VJAA 4W5QA 1QKKA 5B30A 1ZGGA 1ODLA 2Q5QA 2O2DA 5CBKA 1VXOA 4RXTA 4W99A 3QVTA 1VGRA 1CS4C 1Q6ZA 2PDAA 1CRLA 2ILTA 1BYUA 1RYHA 3C5VA 3RJ5A 4A1OA 3DR3A 1EUQA 4L6IA 3G9ZA 3IUJA 1UXIA 2A7QA 4KGDA 4XASA 1FDTA 2PJRA 5I7HA 2VSQA 2I65A 1Y4DE 3QOYA 5BYKA 5JYCA 1TM7E 1DDOA 4J29A 4CCAA 2JG3A 3V4ZA 1NF9A 5FBWB 1U2DC 3FWHA 4TLDA 4GVLA 3M5CA 1J8DA 2WDPA 4JBIA 3GYGA 1OU4A 2V6FA 3KWMA 4MXDA 3V2UA 4TWZA 3DM9B 4JUAA 4ZPXA 5B5SA 5DX1A 4RPLA 2IHKA 2JIMA 2PX8A 2H17A 2JA1A 3W5VA 4C88A 3ER9A 1OLUB 1ZK4A 4LRSB 4V0NA 4I8DA 4EX7A 5L8VA 2ZJ6A 2YMQA 3IESA 2OGWA 1LS6A 1M2OA 3AUJB 1YIAA 3GEPA 3MBOA 3SFZA 3VR4A 2NXEA 3K9LA 2LWIA 4U7HA 5AVYA 1DQPA 1JJIA 2VBIA 4CUJA 1A4XA 1FTGA 3I05A 4D8TA 4M6WB 4V1CA 1MABB 2IPNA 3NHLA 2CHEA 4CLRA 4BMCA 3K6KA 2EW8A 3EEBA 3NNSA 1G291 3D8TA 4L85A 2CZQA 3CCFA 1FDUA 3L0OA 2PL3A 3L0PA 1NAHA 1YOVA 1KMHA 2CHGA 2FSPA 3B3FA 1NL3A 3DMRA 3FKSA 1OXVA 3IPYA 1W25A 3WFZA 2OMEA 3VX4A 5DYWA 3G0HA 4DEVA 3P2JA 5HJEA 2YINC 1MV8A 2PPVA 2QZSA 3KZCA 1Z7EA 2QXTA 1OI3A 4MV9A 4X60A 1RW4A 3CSDA 3URKA 1NW5A 5B7GA 1IIBA 1R0YA 2WLSA 4ZT7A 1RNLA 2HF7A 2CYCA 4XB6B 3JQBA 4LX0A 3R7LA 2B3DA 1BVRA 2WYIA 1OXBB 2HRDA 1ZO8A 1W2HA 2PUHA 3EXFA 2NU9B 2E5WA 4NBUA 2K7ZA 2ZTUA 4TS9A 1XPUA 1P18A 1OYOA 1WCWA 2YRXA 2VNAA 1IPEA 2WFLA 1L3IA 4I1YA 2EZ4A 4LPKA 1YZNA 4M86A 2FGKA 4QPNA 3DTYA 3KPUA 4UCWA 4EF6A 2V9PA 4EO9A 4QDKA 3F71A 3C4QA 4KBYA 4MTCA 3NALA 4X3OA 1NQXA 1Z4PX 1CHDA 3EGDB 1I24A 1P2TA 3N39C 5C0OE 3W1VA 1RXEA 4MMZB 1D2AA 4OTZA 1R0RE 1NDQA 1C0KA 2P40A 1I1QB 4DSUA 4DUGA 4HLCA 1H0RA 1Z68A 2NO0A 4YB8A 4DQVA 3RIYA 4BVAA 1DT3A 1UJBA 3L6BA 2VPPA 3CPJB 3F7NA 3FYCA 3H97A 3MTJA 3QIAA 5BW5A 4TZ6A 3QX8A 1QK4A 3AFHA 5E1BA 3CBGA 1RQ2A 4MWOA 2HHJA 1W4BA 3OLZA 5HF5A 9ATCA 4JI2B 4QYWA 1NX6A 4IEEA 4WIAA 5JROA 4KTTE 2PCLA 4X6YA 3MHTA 2XNDD 3U7EB 4MVJA 4ZAYA 4GPBA 3GVIA 3BJZA 3WZMA 2VTEA 1T6BY 2PY6A 4HKTA 1Q50A 1RLUA 1P4GA 4PHTA 3GJTA 1Z6AA 4G5QA 4RWEA 3E2IA 1X39A 1DHRA 1AKEA 1VI2A 2NXJA 1CRQA 4HFNA 2R5FA 3U7JA 3IAXA 1SCBA 1DDIA 1Z0DA 1FF9A 1YDMA 2ZDQA 3CLRD 3TOVA 5CFRA 1PVDA 3SF0A 2WTUA 4XYGA 3LYHA 2QRHA 3T38A 1X7ZB 3WB1A 1ZOSA 3C3JA 2QX7A 4C0XA 1HI9A 2IT1A 2ODWA 3R0QA 1YB4A 1HH4A 2Q4OA 4ASUD 4GOJA 1Q0TA 4HGQA 3EGEA 5BSWA 2G71A 2Q5JA 2E1PA 5ITWA 4YAKA 1YQTA 4BTVA 2QTFA 2XXJA 1PFUA 4L0QA 3ZX5A 4F0JA 3U5ZB 3W7VA 3F46A 3G0GA 4XVCA 2H07A 5AM2A 5HZKA 5DIZA 4X64B 2ZYIA 3NWJA 4X95A 1T6ZA 3RTBA 1U7ZA 3CEAA 3H9QA 4V0KA 1UBGA 2XMZA 2XTAA 3L8GA 4NABA 4YRFA 4Z9YA 5FWAA 3WGTA 2PMEA 5AKZA 3RIEA 4GSKA 3RJTA 3PUXA 5A4AA 4FK8A 1EDZA 3HPQA 3OCXA 4TXHA 3OC0A 4RMHA 4BN4A 5L4LA 2VJBA 2GAJA 2FQYA 1K1EA 3TN7A 5CK4A 3ZEIA 4DUYB 4Y9RA 3WJ2A 3RVRA 3V4SA 5BUSA 2BR5A 4WCDA 3NYWA 1FYDA 2BFAA 1PQUA 4D4MA 3FF4A 4EUFA 5MN5A 2NQ8A 5LB2A 2VCYA 2A5JA 2JI6A 2YYAA 3KQYA 1K6IA 2CWDA 1A4RA 2Q3BA 1INLA 2WV7A 3L7OA 3LDGA 4AW9A 2FZCA 3BHIA 4BE7B 4WGFA 2BKVA 3OQOA 3BL8A 3K1JA 2J7PA 1LPAB 2B2NA 3BTUA 3KQMA 5FXMA 4LC9A 1NG1A 3HBAA 3I83A 1SD2A 5AW4A 3W5AA 4NXMB 3VJKA 3AB8A 2DWCA 1YDWA 2C2KA 1EP3B 1VCOA 1NU6A 1RXUA 1TZBA 3E27A 3EWIA 4F6CA 1PJTA 4Y7DA 1WKBA 2XF2A 5CLLA 3THWB 3QY0A 5FR2A 3ZU4A 1BJTA 1NLUA 4X20B 4A0FA 2GN6A 2K5UA 4OYLA 1O0CA 3FRIA 3GELA 4IFEA 3DC2A 1G8JA 1O58A 4PCLA 4AWAA 4S04A 1X7XB 1ST2A 2XD4A 4UHBA 3ZHBA 3GNTA 1UBCA 4LZJA 4YAWA 1BJKA 1M1NB 5EVCA 1J06A 1F2TB 1PJZA 3W6ZA 1E89A 1TQHA 5K9ZA 5CFNA 2MSEB 4PBRA 3UKDA 2H7VA 3PNLA 4DRYA 1AZSC 3HYLA 1KE1A 4MQUA 4FNMA 1L1EA 2FEXA 3HKCA 4D4JA 4QOGA 1K8YB 1L7EA 3MB5A 1GCUA 4Y9DA 1CZLA 1B26A 3OCJA 4BRSA 1MMFB 1KNXA 1S01A 5MN4A 1DQSA 2E49A 3WTBA 4QM6A 4DCTA 4A26A 3SZGA 4MIEA 5GM1A 1MAAA 3ZVKA 1JFVA 5IT0A 4R2MA 4NE7A 3B1VA 1JFTA 2HGSA 4QLAA 3N76A 4JLAA 4KXFB 1U2DA 2D0DA 2QDKA 1QHSA 1J5XA 2V58A 4JB2A 4MQEA 2FEAA 2FXIA 3EIUA 4FNAA 4QU0A 3LS2A 4YDQA 1LLQA 1T5DX 1IQUA 1WF3A 2EU8A 4OHMA 4FHCA 4IJMA 4XR4A 1HOTA 3AKZA 2BGJA 2YWGA 4KOAA 3W8DA 3LGSA 1C9EA 3PE6A 3T3HA 1SKBA 4RH0A 1JA0A 4QRDA 4GW3A 4P84A 1GN8A 2JPDA 3ZZUA 4F3NA 2IZZA 4XQGA 3RH0A 2ODEA 1Y5MA 5DI3B 5H68A 3J81A 4KPYA 3KDAA 1EWTA 1NQUA 1J09A 1R5NA 2AMYA 4TRMA 4DDMA 1GL7A 3IP9A 4PO8A 1N33B 1UP6A 1P1IA 3VHXA 1JN0A 3VJRA 1PI3A 2R1VA 4J0HA 2H2AA 1R6BX 3UT5B 4RE6A 3K35A 3RU7A 3HWWA 2R5NA 3WGVA 2AE2A 4PX5A 2WUVA 4NVRA 1E2BA 1MAWA 4EUNA 1P75A 1GGVA 1NQOA 1TC2A 2PSFA 4M9ZA 4UM9D 5A4DA 3IXQA 2FX3A 2BKLA 1D1SA 3HFJA 3PWTA 5HM6A 2VJPA 1DWPA 4X84A 1OFGA 3UOWA 3A36A 3IX7A 3NHUA 3IRUA 4ZHSA 1FS5A 2R44A 1UJ4A 5T3UA 1Z7GA 4OP1A 2Q49A 1ECFA 1E99A 2DCMA 4LV8B 2EYQA 2DR3A 4YGYA 4R2KA 1BKSB 2NUPB 4HL6A 3R6GA 4IJKA 1Y9EA 1LPOA 5AO9A 3JQ6A 3A9CA 2OEPA 2VJDA 3B38A 3DYIA 4Y2RA 3NFRA 3L4KA 2B1IA 1LQUA 3OOHA 4JI7B 1WZUA 1Y6QA 2XBUA 2YNMD 1Z35A 3JW8A 4AK9A 5CDGA 4UHCA 1B43A 3LHIA 4FXPA 2JLRA 5HP4A 3O9ZA 2CSUA 6ABPA 1V3VA 4ND4A 2VDWB 2ZRCA 4KJXA 2WSSD 1JQDA 1T4BA 1ULBA 2PUFA 1XZMA 4JYAB 5J4KA 3F0TA 3LW7A 4JLDA 3BERA 1LRKA 1ES9A 2WIJA 4EHHA 1KK1A 2R7LA 4QGHA 4H08A 3U39A 3DZIA 3P0FA 3O9VA 4JROA 1JJVA 1JQLB 1RAGA 3O31A 1VBNA 2O8BB 4D9KA 3MVEA 3LO5A 3SEFA 1BE6A 3R7BA 1UC4B 1NJ6A 2O2XA 2CVPA 4FGWA 1L6RA 1KJNA 2G5PA 3WMFA 3NTLA 2IX9A 4GBJA 2AG5A 1RZ3A 3H2YA 3LX6A 4D6XA 2G76A 1H4SA 3I8XA 3LE8A 3D2BA 1TMKA 3UJDA 3ZDCA 4CEJA 5AJVB 2X7HA 1MTOA 1XPRA 1TT5B 2XMPA 1PGNA 1M2NA 2HJVA 4ZTZB 3BPSA 3JQCA 1PG2A 4RD0A 5B3AA 1XWWA 2XOXA 1KJWA 5CB8A 3REQA 4HZUB 3PHCA 2PSJA 2ZWVA 2QN3A 5DDIP 2HV8A 1ZSYA 2Y3IA 2ZR0A 2G6TA 2HQSA 5CVCA 3RYHB 5JS1A 3RVNA 1N4AA 3N6VA 2P8SA 4NR0A 2C97A 2FUKA 2OZKA 3UK1A 4ER5A 3DWIA 2FVXA 4K87A 3T0IA 3V8EA 5SZKB 3QE9Y 4G8BA 1IXRC 2C54A 3C4JA 4I50A 1KFCB 3VHRA 4OB6A 1PP4A 1XEXB 2IP1A 2R8RA 4P4GA 1KP2A 2II6A 3MJTA 1J9ZA 5I5EA 1ZMOA 5JCOC 4ON9A 4I4LA 3CH6A 4TVBA 3ROPA 3RRYA 2NU7B 1GTSA 3GUVA 4JLNA 1Q3HA 2VBFA 1NJ8A 2GFIA 4B87A 4REOA 4XR9A 3KTFA 5FYDA 4W8GA 2XTZA 4QUHA 4PLZA 4J49A 1K7XB 3LHDA 2C2OA 4JT4A 4XIYA 5ITZB 2JL1A 2XNCA 5TRTA 1LVHA 4BE9A 2GCIA 2IHTA 4C89A 4DGSA 4ECAA 1OWLA 1X7HA 1ARZA 3WLLA 1WHSA 3M4JA 1CRWG 2Z5VA 1NG9A 2ZJ3A 4AZTA 5K20A 3AK4A 4R2LA 1G0NA 2MYUA 5K2OA 3RSHA 3EF1A 3QPCA 3ILSA 2FWJA 1SUAA 2B4KA 3DAPA 1PEYA 2X86A 3EF3A 4TKVB 4LHSA 5GIOE 1G8FA 2JAXA 2Q1YA 1NBME 3IDOA 5DNDA 3ICQB 3ZWBA 1U4NA 1JLMA 5HZGA 3ESAA 2QE6A 1RVDA 3W5IA 4MLCA 3PVSA 5SZHB 5KNDD 3A9UA 4GR5A 5AP9A 1E9RA 2YJZA 3SZMA 2JAUA 1NVFA 3TFOA 1IJBA 1HK7A 1K2WA 4LMRA 4N1AA 3T7KA 2PNJA 5FL7A 1JFRA 3DYVA 3FX2A 4BDSA 4E4TA 3HM9A 5AI8A 1ZRHA 1U0LA 2EIXA 4XYEA 1ZGAA 2FPPA 1XAHA 3KLPX 4ND6A 2OBLA 2ZG6A 3DFFA 1X3LA 1Y3BE 3P9CA 1SBHA 4Q21A 3WP0A 2LXNA 5FDFA 4AZ0A 3HEAA 3U6BA 1XTIA 4HNRA 5KCMA 1CS0A 3HKBA 2PUGA 3AI3A 3KOUA 2AOWA 1KVSA 2YHAA 2ZW9A 1V8DA 4X1KA 2PS9A 1JQ3A 2J3MA 4OGFA 1SHLA 5ARBA 3ZX4A 2AX4A 1J22A 2V8BA 2C0QA 2JCSA 4Q4JA 2IS2A 3ZHXA 1NJ2A 3D0RA 3VBEA 5AVJA 2QXUA 4IDBA 4FYHA 1ENYA 3PJDA 1OGJA 4M83A 1D5WA 4BNZA 3CF2A 5BNWA 3TLCA 3H11B 3CEHA 2UUBB 1O57A 2F3TA 2ZRHA 2PG3A 1BMQA 4YI5A 4TT3A 2MMCA 3UAYA 4WK6A 1GPJA 1GR1A 1T5TA 1N9ZA 2Q21A 3ZWVA 3ZHSA 2BW0A 4KAJA 3QMPA 3NBMA 1QHGA 3DOJA 5J5AA 1M3SA 2L0XA 2WF8A 1Z8NA 1XU9A 4WERA 2PE5A 2QVZX 4JVOA 4HS4A 4J16C 3OIUA 2Q7XA 1DC5A 2PKCA 4MS1B 4OP3A 3ZJUA 3LA8A 5JXHA 2ECQA 2GK6A 1QC5B 2G04A 4K3VA 4LOJA 3GIWA 4PG7A 3USES 2PT9A 4DLPA 1T24A 5EHXA 4Q3KA 2SHKA 1M6HA 1T36B 2G06A 3EH2A 3Q7EA 4MUYA 4F3YA 1U4OA 3GDGA 1JNYA 1DC3A 2EP8A 3FGOA 4HQNA 4LGVA 4S0ZA 3NWOA 5FQNA 1FMTA 3ZOKA 2RGNA 4JWTA 4KRGA 4C4SA 4DG8A 4JP5A 1Z47A 2XB9A 4HAIA 5BSHA 5T6MA 2QVBA 4URUR 2PD6A 1ADYA 3N5KA 2J3QA 2G4CA 2VWGA 3L43A 1PGPA 2VBGA 4AQDA 2I7VA 5DO9A 3LLCA 1OPRA 2X2FA 3O83A 5E3IA 3S1AB 4CMCA 1ISFA 4ZVLA 2QVLA 2YV3A 2QORA 1BWPA 1L5RA 2W8BA 2XY4A 4X90A 2XCTB 4FOPA 1TMYA 5CX1B 4W8OA 3OE7D 2J6BA 4BTLA 5J5CA 5HFNA 1XZLA 1MABA 1SEVA 2X3UA 1U0TA 2ISQA 1WA5A 1CUWA 2IZOA 3EZFA 1LUAA 3FFXA 1T8PA 2HK6A 2B4RO 3LNTA 3MSCA 4GI1A 1IZZA 4FMCB 3UPDA 2JAQA 1NC1A 1GUDA 4UOZA 4K0KB 1P33A 2Q9BA 4K9DA 4CHTA 5K8LA 4YYZA 5DTQA 2FFRA 1M72A 3ENZA 2W0MA 2Z2XA 5BR7A 1FUKA 2WJ3A 2AEJA 2ZJOA 1ZHFA 2BP7A 2V7PA 3QUSA 2O6LA 4QC2A 1WOMA 3JQAB 3EG9A 1I6MA 3E9EA 2HK8A 3QKIA 2NU9A 4JMLA 3OLWA 1TC1A 3UOGA 3PGVA 2COEA 2PMDA 4O63O 1CF2O 1L4HA 2CLEB 1GTRA 3VR6H 4ZREA 3AHFA 3AEKB 1N6KA 3PQ8A 3E2MA 2EWWA 3UAGA 3TKLA 4GYJA 2QU8A 3QX9A 2GHIA 5DNVA 3SI7A 1T10A 2D4HA 1CZNA 4GSLA 5ALDA 1NA5A 1EA5A 4BUZA 1B73A 1J56A 4NYIQ 2DFNA 1YT5A 2XVXA 3ETNA 4P83A 3EGDA 1V3QE 2J9GA 1E9CA 4PCAA 2NZ8A 3LYLA 4BV3A 4DMMA 4WE3A 4P3YA 3I72A 5I7FA 1G6HA 2R85A 4Q4HB 3U1TA 5LFAA 2J9FB 4FGSA 4U39A 1KRHA 3ELDA 4OMFG 2P5SA 4HX2A 2HPVA 1S1MA 4OBEA 3H9BA 2IV2X 3UJBA 3HRHA 1IBMB 1ISSA 4YWHA 4TRJA 1KZ7B 2WWIA 2H5LA 3FH0A 1A1SA 4FWBA 4Y2UA 4YRZA 5CVJA 1P7WA 1QQ5A 1E32A 1Z33A 1CERA 2JIRA 4XQEA 3RJ9A 4PC2A 4KR9A 2H8GA 2H1VA 3L8EA 4AUMA 1RI2A 4KE8A 2FJUA 5H02A 3HP7A 1GZVA 3VR0A 3TVYA 2O54A 2E2WA 1N6OA 1K7CA 4MQFB 3NETA 2BHTA 2W2OA 3SQXA 5FTJA 1T1GA 2AVDA 4RK1A 5CLGA 1QDUA 2YRWA 4QPCA 3ZNOA 3K70D 4PYQA 1RIFA 3HG7A 4GI3A 1Z7WA 5L6MB 1MZPA 2F1OA 2D1SA 4J1TC 2AIRA 3RLFA 5KMGB 2JD0A 1Y1PA 5EAIA 1WKVA 1X7ZA 4KWHA 5AQEA 5JCOA 3QX7A 5UKDA 1RYZA 1UZUA 4G9GA 5B1SA 3W8RA 4PG8A 5C1DA 3VPGA 4XCQA 2FLWA 3DFMA 4R9UC 4Z2YA 3TVTA 3ETGA 4NZZA 1QP7A 1GCIA 4EAAA 4TN5A 4KQFA 2QL6A 2ORED 3UH0A 1PBTA 3UB3A 3PBKA 3RC1A 1KP3A 3ET4A 3NHWA 4GBED 3VYRB 5CITA 1VL0A 1KQPA 3DE7X 1G63A 4JT2A 1CEXA 4ZT6A 2JNWA 2PJDA 4JB8A 3CVWA 1BEUB 2WYOA 4RDIA 3UO8B 1E66A 3I04A 2G8NA 3N8KA 3ZGYA 5EJ4A 4B6PA 3WAGA 4PFSA 1EU1A 3C6XA 3AUKA 2GMWA 2IKSA 4M7OA 2B7LA 3MAJA 4Y0NA 3GEBA 1P9RA 3U3RA 3AWIA 2X6QA 3FHCB 4IGKA 3R7NA 2I3BA 5JMOA 3IVCA 3P9RA 3FN4A 3WLKX 2I6QA 4MVYA 3TW4A 4OQEA 4FFVA 5KQRA 1YB1A 5KNCH 4G37A 3C6BA 2ATVA 3AB3A 2ZBGA 3FYTA 2C1XA 1E0DA 2CHQA 3K9WA 1PWXA 3P20A 3O94A 4TMZA 5E9QA 3STWA 1H4QA 1C7ZA 2VH1A 1YCFA 3JVEA 1O3YA 1NX9A 5FBRB 4BNHA 2UV8A 2Q5CA 3BGIA 3DO5A 2OZPA 3U16A 4R8LA 5FJIA 5B6IA 4PYNA 1GG9A 4EOGA 1ABBA 4ND7A 1HE5A 1NYRA 3AZPA 2B0JA 3PXEA 1UJNA 4QOHA 4B9EA 2ZUBA 4H3HB 1O03A 2FEKA 2C2WA 4ITVA 2DEUA 2C7BA 1R15A 4M54A 3G8DA 4P98A 4QEKA 3RWMB 1MC4A 3P94A 1ZK1A 1EGVB 4U63A 2VPYA 2NO1A 3F6RA 3GOHA 3INNA 5M7EA 1G38A 1ZI6A 3CLVA 2GHRA 4TYQA 1Q3KA 2JIZA 2ZBFA 3THWA 2NUTB 1FSGA 1IHUA 1N0VC 2EZ9A 1DHTA 2J5QA 3HXKA 4TTRA 4B0OA 4BVKA 4N76A 3WLQA 1MUUA 4X20A 2XRFA 1OIXA 3EXHB 4Q1FA 1J39A 4JI8B 2FEPA 5KREA 4EYQA 2PX3A 1X7XA 1JLLA 5TE9A 1X8KA 5KYNA 1G8YA 1M1NA 4ZRMA 1F2TA 2YHUA 2YJ6A 3Q5GA 4DJFC 1CEQA 1D0IA 1H0KA 1RKVA 3TR0A 2QD2A 4XSHA 5BYJA 1Y6GA 5HHTA 1QGOA 1HORA 1EFLA 1FTWA 2JK1A 5FFNA 1L5OA 1W5SA 1NIJA 2H08A 3JU3A 3KRTA 3QFFA 1OF1A 2QYOA 4HH3C 3PLRA 3RVOA 1VECA 2GBGA 5AW7A 3UWOA 2E87A 2IBMA 5DX0A 2BSAA 2PFGA 4J16A 1ZFNA 4JX9A 2RH9B 4XLLA 5HUJA 2ZZMA 1N32B 1KSHA 1XJWA 2JIPA 2BDUA 2F1HA 3CTMA 4K9MA 1Y7TA 3SX4A 2B25A 3QGMA 1P8JA 2F3QA 1COWD 5HF6A 5LQAA 3CNNA 4DV5B 3NBAA 2POCA 1FYVA 4MVWA 1L4UA 2D2VA 2I3AA 4NHEA 4DHEA 2X1VA 1PW5A 5MGNA 4WK2B 2AVNA 4CMEC 2ZUWA 1GG5A 3KJHA 3ECSA 2QT9A 3BRWD 1QIHA 4GOOD 1AE1A 3FTCA 1R4NB 4PAWA 2NO9A 3IIEA 4ARBA 1I7QB 3WRVA 2V6MA 3R6LA 2ESRA 3WGGA 4N3CA 2ZT5A 3ZCSA 1RKQA 5EE1A 4UXIA 1KHTA 2X2OA 5H1YA 5U4XA 2GFQA 1MT3A 3BM5A 4Y2HA 1UF9A 2PLNA 3SGLA 3C98A 3W3ZB 3WIVA 1P4RA 4RL4A 4LRWA 2Q3CA 1KIAA 2OCAA 4S3MA 4XWTA 5JS6A 2VHZA 3V1LA 4KNVA 3VDRA 2GA9A 3L93A 5JNSA 1YGYA 3B6KA 3NXKA 4JFRA 4QGBA 1L1FA 3UT5A 1FW6A 5INTA 3P2EA 1VC2A 3A9VA 1E6UA 1MKYA 2QTVB 4FHFA 1DLIA 1X2BA 2G1AA 3WO1A 5JZMA 1IPFA 1M2VB 2CCKA 5EZ6B 1OXTA 1RYMA 1TW2A 3OC6A 4CM9D 2A92A 3KBBA 4QFCA 3GLTA 1UPUA 3ICCA 3ITDA 4LI0A 1Z37A 2JIOA 2IYTA 4TQAA 2OPBA 4RHXA 5H4HA 2JFVA 3TLEA 1J97A 3VH2A 2KJQA 3GHYA 5D1NA 1L4NA 3UNXA 5ERXA 1G8HA 1QFSA 3N0XA 4OLFA 2IOFK 2F1KA 3FVVA 5CD9A 1J99A 3BB1A 1KI3A 5C31A 3WGYA 2VTBB 1DKNA 1SU6A 2X5NA 3LQFA 4FUQA 4RVGA 1ITZA 1S7CA 2VJLA 4PIVA 3DMNA 4ESEA 4CFSA 2C3UA 1ZAYA 4EIWA 1OI2A 5E7JA 4MRMA 2GEFA 5JZVA 3ETJA 4NMXB 2PMBA 1WXQA 4N9WA 1NWHA 2P2NA 2VF2A 2IEZA 1YL7A 2PQ0A 2VDWA 1QK5A 5ALQA 4JI6B 4W5TA 1SBYA 3PRHA 4RZHA 3MTIA 4R8VA 2WZDA 3DP7A 4YI3A 3GYBA 5JW6A 1BA3A 1VHTA 2ZBUA 3L7BA 5IC6A 1UP4A 3LH5A 3ZI4A 1E6WA 3PHBE 4Y6LA 2WF6A 2D1FA 1G8MA 2BMVA 4A0RA 2C77A 4HWTA 1TPYA 3OLVA 1C41A 1LA2A 1VG8A 2P4UA 4BB5A 4PLYA 1GYRA 1Y8CA 4I5FA 3MXOA 1CRZA 1ZSNA 4M89A 1FU7A 1G7TA 1X9GA 2FRXA 1R0ZA 4KXYA 4AUNA 4FJ1A 3DE4X 3T3NA 2WF7A 1DUIA 3GAZA 4O4IF 2W6ZA 5ESDA 1Y48E 4BNFA 1UK8A 3WWZA 4WLOA 1CDDA 3K8OE 4QHSA 4P3PA 1OX4B 5FWXB 1M1XB 4QEDA 3HUTA 2QGFA 1VRCA 2Z56A 2ZB7A 4HZUA 4WCVA 5FNVF 3LUKA 4E5PA 1IHDA 1QYVA 4G1UC 4WNYA 4ZQBA 4RQTA 1CUEA 1R88A 3JVUA 2WSMA 5EKSA 1RWKA 2I0FA 3DM5A 1FFXA 2V5UA 1ULZA 1DIOB 2CFRA 4FFBB 4HQ6A 4HN9A 2P41A 4N18A 4NZPA 1BOFA 1Q0SA 2AOVA 1CJSA 1PQYA 3T9CA 5JSHA 4G9EA 3UK0A 3EARA 2B69A 4B4DA 1H0SA 5GY7A 3A4NA 3DXZA 1NJ1A 4YDHB 3NIFB 1QHHB 1E5DA 3OOSA 3TCNA 4YMLA 5JH7F 4LOAA 1EG7A 1XEXA 4ZQHA 3ZTYA 4G84A 2OQ2A 2PS1A 5GOTA 3VKUA 2RC6A 1NUPA 3EZ7A 4WXMA 4B74A 4MYCA 2NU7A 3I53A 2ENUA 4YRIA 1CP3A 5HDQA 3LDAA 1UQRA 3BILA 3FR7A 3LTEA 3NDJA 3PUZA 5JCJD 1N5IA 1YBAA 4JUDX 1LDMA 3IA7A 2XT9A 2C4TA 2JHPA 3LW8A 1VPWA 1LDGA 5ITZA 1QNFA 3ESRA 1I36A 5AHXA 1D2NA 1KYVA 2A1UB 4GP7A 4LNUB 4KSCA 5ESXA 1DBPA 4IDGA 2IYRA 1A4IA 2MIIA 4CETA 1EPUA 4QREA 5A05A 4TXMA 3ETHA 2HSZA 4KYVA 4W1PA 4WLEA 1EWYA 3PXUA 3W2FA 5EZQA 3W78A 2PO7A 1FA9A 2Z0MA 4JXXA 1GL6A 4TKVA 1P8AA 1BRMA 2UVPB 2YY5A 1B7GO 2W2VA 2ZE8A 4P93A 3EZLA 1JHYA 2PGXA 3V80A 3TTUA 1XFDA 4ZYLA 5IDWA 3OA2A 3HRKA 3GFPA 5B57C 1O6BA 2O06A 4AKTA 4M0PA 3L3BA 2BFCA 1YHNA 3ZZ0A 2PXAA 1R9MA 1MQAA 1VKJA 4KLNA 1JFFA 1K8RA 1ST3A 3E3AA 3KAKA 4IV5A 4DDTA 2COUA 3O9MA 3QG1A 4IIHA 3RS3A 3K9QO 1FDVA 1KK3A 4OIMA 3HXPA 2BI7A 5A2QA 2FQXA 2XMSA 5JD6A 4MQBA 1Z4QA 3T1VA 3AHHA 1Y9DA 1KXZA 3HGMA 3D64A 4PGGA 4URWR 5H81A 4IMRA 1J00A 3UT6A 2E89A 1AB6A 4Y2YA 4YR9A 1U1FA 1NBMA 2Q0QA 4QXMA 3GZTB 2G9NA 4AJJA 3V2HA 1WBBA 4KE9A 2HADA 2FX5A 4CKCB 2X42A 3PI7A 2LTAA 1WUJS 2C9CA 2YN4A 2Z95A 1XZEA 1VIAA 4L9RA 3LTNC 2BFNA 4I66A 1Y82A 1N5MA 4G5HA 5JQWA 5F3RA 1VKRA 3G9XA 5ER9A 3EXHC 1ZCAA 1T9HA 2C9YA 1QIKA 1RI5A 2R68A 1HNWB 1Z16A 1SNYA 1WSBA 3FNGA 3HU1A 3OECA 4RIFA 2QTAA 3LCJA 1QU3A 2YIVX 3DCYA 3GPDG 3H11A 5A71A 3W06A 3STHA 3TZKA 4R41A 2OD2A 1XN1A 2C2XA 5ALHA 3HUDA 4D5GA 1SHJA 3ZIDA 4QOSA 5EIOA 2O2SA 3WXBA 1A9XB 1TEHA 4GX2A 5IX8A 3ESQA 1I33A 4M2LA 3W1EA 2O5EA 3N53A 1FLDA 4O2RA 4UUBA 1XCGB 4CMEA 4MS1A 3JALB 1YJCA 1KI2A 2I6TA 3OQHA 3O26A 4GWGA 2INGX 3IBFA 4R6XA 1A77A 4MDFA 3I9MA 1NHWA 4RLSA 1NUUA 2XIQA 3PHHA 4O2BF 5FP0A 5TR9A 2VIIA 4TX1A 1A2KC 1CYDA 1M76A 2HU5A 2E4YA 3BBPA 3O5AA 1PJQA 2VP4A 5FOSA 3WE7A 4BQEA 1NLFA 5B1EA 1VE5A 4IUYA 4AS2A 3QNUA 3URMA 3KQUA 5EHNA 1FZTA 3UV3A 1KXJA 1LPNA 2V8OA 4C0SA 3RUAA 2HYDA 4F96A 1MB4A 2QIPA 2VH5R 1U0BB 4EW3A 3PGXA 1RHMA 2RHMA 3K8QA 3QHQA 4AKSA 3F5DA 4DLUA 2FPGB 1V16B 2YV2A 1U90A 2ZJ2A 3G1UA 1AQIA 2WJ6A 1DP4A 3L1KA 3M6LA 3OMWA 2VJOA 4KOEC 3GH1A 1ESZA 2HDWA 4PY2A 4X3PA 4BIMA 3AY0A 3CINA 4LX8A 3UUEA 1RXWA 2NO6A 1Q20A 1RPNA 4NYMR 4MI3A 1NUHA 2PAFA 1S89A 2WJGA 1TCAA 1LLCA 3IV7A 2R6HA 5DHUA 1M5UA 2N75A 4M8IA 5TMEA 4G24A 1F8FA 1UBHS 1F51E 3AETB 4RDHA 3L6CA 5DP1A 1E0KA 2DUNA 1JR6A 3KIPA 4FGJA 5IBCA 1OB2A 2XQKA 3MMPA 3OZSA 1TKAA 4P31A 5THXA 5JHGB 3ONFA 4O4IB 2ZSEA 1T4CB 3T3DA 2GETA 2FDCA 1F1BA 4YJHB 5CVTA 2A4KA 4YCAA 1ZD8A 3IVAA 3T5PA 3JQAA 4R0VA 2HT1A 2P62A 4TMFA 2P69A 3ROQA 1NNUA 2Z4RA 3GD5A 1E2IA 5T64A 2XODA 3OZAA 5FNVB 4ZJPA 2H4JA 3TQRA 2QT0A 2VPWA 1WABA 2R60A 4KX3A 3ZLVA 3QENA 2WEKA 3AI7A 1DQNA 2Q2NA 4B4VA 5F3WB 4DR7B 1GG2A 4OOEA 1M7HA 3AEKA 1KDRA 4EB6B 3DKRA 3P4UA 1RHUA 2VSYA 4QO8A 4EKYA 4CKZA 4LF4B 3ME5A 4EBBA 4OFBA 2PRZA 1VLZA 1MB0A 2B2XA 4ZQCB 2AZTA 2N42A 3DHNA 3WO0A 2JBAB 1GKKA 2XAUA 2XQJA 3K9BA 2KM1A 3YASA 5FOQA 2VPTA 3M83A 3OTWA 3PYMA 4R83A 2DBQA 1AHNA 4GP9A 4NENB 4AWXA 2O8EB 4M0KA 3WWDA 4QT4A 3IOBA 1T8RA 5FO0A 1GCGA 2J32A 4Q4HA 4S35A 2P4SA 4H6XA 1XROA 4QL3A 3FPHA 4MUHA 3TO5A 1M6NA 3EJ6A 3VR1A 3CF4A 3H8VA 4TM8A 3JRXA 3PNOA 2UDPA 4Q37A 2J30A 1LTQA 3PWKA 1YR6A 3DW1X 3OM1A 3WWOA 4J4BA 2W6PA 4GAEA 1KYIA 4Y9TA 4UM9B 1PWZA 2Z4SA 1I32A 4L4YA 4DLTA 3GB9A 2BBOA 5BORA 1NVVR 2UZAA 2B8WA 3PQ2A 3PKIA 2QTWB 5CDFE 3AUSA 4E07A 2MSWA 4E31A 3FOWA 3BB4A 4KQGA 2PMWB 3ADOA 3GZJA 1E2KA 1L5MA 1TO6A 2I87A 3PWSA 4BMZA 5M2QA 1Z15A 4WINA 2VJYA 4NULA 4HQOA 4OUDB 4Z6KA 3P96A 5KMGA 1FL9A 2ZRMA 1C1HA 1YVDA 2I29A 1KAHA 3WLOA 4R31A 1A9ZA 3VHQA 3B3JA 2G4LA 2N9UA 3MRVA 1EVYA 2WIBA 3TG2A 1X8LA 4B3HA 2E48A 4MVJP 3OFJA 2QG6A 1DIRA 4DAOA 5BW8A 3A0UA 2GOYA 3NDIA 4W5RA 1USWA 2VAXA 3AF1A 1Y6RA 5HOEA 4KO4S 2GYUA 3UWPA 4E22A 1ZU5A 3VSDA 2PXCA 2AWOA 5D01A 1KDPA 1MO6A 4ZPJA 3N2KA 4CF7A 3PX2A 3Q7QA 1HC7A 3AHJA 4IH4A 4YRKA 1WG8A 2V0GA 1USKA 5T41A 4LV6A 3PX3A 3C24A 1DO8A 3DGFC 3LUFA 1G7CA 3IV9A 4GI5A 4HUQB 4J2HA 1P29A 4EI9A 4P0PB 2WNHA 4BNMA 2BUBA 5C3MA 3FBWA 4E2XA 1SU7A 1NONA 1GEEA 1Z0SA 2G09A 3VAZA 3LY7A 5GVRA 4MITA 5D51S 1YFJA 4TGLA 1TIKA 1J8VA 1Y5LA 4QBGB 4NS4A 4TTPA 3VR4H 3GUUA 1GYPA 3P0JA 1W36D 1Y3DE 3JXEA 3D4PA 3NHYA 4CEHB 4FJ2A 1CY0A 3AIIA 1MT0A 3BS4A 1DFIA 2WHRA 4FDTA 4UU0A 3J7TA 3K0SA 4FW9A 5HMLA 5BRJA 4BVJA 2DH5A 1GNSA 2GVZC 4MPPA 2DBRA 4GX5A 4BWVA 1N5JA 3AR9A 3AR6A 5G0VA 2HREA 1EQUA 1J5EB 4BLTA 4D9FA 1PL8A 2ZIUB 1ONOA 3GUCA 5KHAA 2O8DB 4OA5A 2ZIVB 4ZI7F 4UXHA 2CXOA 2NUTA 1UBKS 5HQ3B 4PX2A 4F1WA 1YZHA 3SN6A 4Q7MB 1T25A 3NVAA 2PL5A 2XNSA 5H82A 2A0XA 4GL4A 2DUJA 3EXHA 3PPXA 1YQ9A 4YUVA 4I1SA 3I0MA 3LZDA 2ZCVA 4JVNA 1N5OX 3K09C 1P7YA 3GW8A 3H5NA 1HA3A 3PUWA 4LHVA 2CV0A 2V3CC 2LIPA 4EY7A 4RKEA 4DCMA 4DV6B 1HQYE 4XM2A 2IGTA 3CUVA 1A9TA 3GGPA 3KPVA 3ZTTA 4ZZIA 1OB5A 4UCQA 1GPUA 2VHUA 4F5EA 2PTGA 3MYRA 2GYYA 4WZ6A 2DT5A 3PENA 3TLAA 4A73A 2BFDB 1NGSA 2G6BA 4KQEA 1U8TA 2FOXA 2BKAA 1ZR2A 1HOXA 1OXMA 1WULS 2BGKA 1BHO1 3GN1A 1E96A 1U3UA 3ZWKA 3HCBA 3L82B 1A8HA 4CIYA 4K6GA 1SXGA 3HWRA 4IIEA 1Q0UA 2B8NA 1IYZA 3A6JA 4XPZA 4B7UA 1TO1E 3IAM6 3RFTA 1QAQA 2JFBA 3F9RA 1UXHA 2ZRBA 3MA0A 1JEJA 4DN6A 4RMIA 3IBSA 4AP9A 1IQPA 2IS1A 3PU6A 5K4HA 2V7VA 1B6SA 1U0OC 4I9HA 1E6CA 4EY8A 3ER6A 2WA1A 4X61A 5ADWA 3O93A 3SKYA 5PNTA 3H4TA 1IBRA 1RU3A 2O3UA 2QQGA 5SYNA 3PITA 3AVQA 4CFYA 4OPMA 2C59A 3NP7A 2VYNA 4MVJH 1JA9A 5GJVC 5BN3A 2RGWA 2WWWA 3NHSA 4TLLB 3SSMA 3E4CA 2A0YA 3IPLA 1KDVA 4O4LF 1Y7LA 2ZPTX 5B55A 4CQNA 2ZYWX 4R16A 2PZ8A 2RBKA 5JZ9A 4GKJB 1SVIA 3UWMA 5CLFA 1U94A 2HRQA 3H19A 5J5VA 4ETIA 4DDUA 4ZIRB 3MF4A 1TA9A 1JMYA 4BWYA 4P32A 3HCOA 4N3BA 4QLOA 2NQTA 4BKUA 2D2XA 5AHKA 5ANRB 2CNBA 4KP7A 2NYAA 1U0EA 2M6SA 2QTVA 1KF0A 1II8A 2R4QA 1YNOA 3BD8A 1C9NA 3L5OA 1BROA 1LNSA 1RFGE 1M2VA 1HFJA 3C8HA 3IH5A 3LLUA 1SK9A 3ORYA 1UFQA 4NCIA 3ANXA 4H77A 4GZ5A 4S2UA 1Z5OA 1GSOA 1U8XX 3K5HA 4DUPA 2FUG6 4IQFA 2B9VA 1P6UA 1ZUNB 3CW2A 4GICA 5E3JA 1GSIA 5KQGA 4EI7A 2NP6A 4RMGA 4RLHA 1DAHA 3QVVA 3JQ9C 3UTDA 2DQSA 2HJ9A 3PC7A 4YFYA 3AJAA 3DE0X 3LVRE 1KAQA 4C0WA 1NR1A 4NBTA 3BXGA 2VTBA 1T9CA 3CG0A 3C5HA 4JOBA 1SU8A 1Y63A 2RHWA 3QLTA 1ZD2P 4CDGA 2AT1A 4D45A 3DHEA 3WHLA 4Y2QA 1BW9B 4NY1A 1PG0A 1XU7A 4ZXPA 4PGHA 5JXWA 2HQRA 2H4WA 3KKOA 4LCEA 3ZJ5A 4F7DA 1PHRA 3OQ6A 4DJ5X 1AKMA 1E5TA 3D0QA 3NHKA 4Q9IA 4AKIA 2NO4A 2QI9F 2YIJA 5EZ5A 1UBSB 1PSDA 3L07A 3OTIA 1WLSA 2AFHE 2ODAA 1CJVC 1N7HA 1XMVA 5KNBA 2FAXA 2PSSA 3T3OA 5I9LA 3VPFA 3IBCA 3WBFA 2J6CA 2V4ZA 3Q9LA 1JJBA 2XLBA 5DXAA 4E3ZA 2EG5A 1YRWA 2A9FA 2GKSA 2I9PA 1Q0QA 1F8UA 1RAAA 4DCPA 3QVSA 2QZ4A 1XRSB 3LPMA 4KQ2A 4GXRA 4OJQA 2OV8A 2EFCB 1J49A 1H2AS 1H23A 2EXXA 1EFUA 3O7WA 3TB6A 1JSCA 2ECOA 4G65A 4MKRA 4BZQA 1P2BA 3FHJA 1RYFA 3G85A 3BZUA 3LMKA 4ZCPA 1B8PA 3QEKA 4UREA 2CL7X 1RJWA 1TK3A 1ZJYA 3ZWPA 1H94A 1OX4A 3C1AA 5FWXA 4B8YA 1PT5A 3W7AA 3ZE8A 1ZZGA 1LBSA 2AFHB 2HY7A 3K05A 4W9MC 2NP7A 4F72A 3HDVA 2IHNA 3L8HA 4PRZA 4HVCA 1GVHA 2FPXA 4KQIA 2I34A 1M67A 4OU4A 4EW6A 1V6SA 3A3OA 3D2AA 4FFBA 3K16A 3SKXA 2GHTA 3OUTA 4ZOCA 4QDZA 4WKGA 4CEIA 5F4ZA 5DIFA 4NZOA 5LXTF 4PC3A 3N0WA 1O77A 4NQZA 4HX5A 3NBZC 3FCEA 1Y33E 1QU2A 5EHIA 2YNMC 3UB4A 4OX9Y 3R0XA 1QHHA 4Q3LA 4DW8A 4DLLA 3OEHA 1NI3A 1XEWX 4ZEMA 2Z4TA 4ROSA 1D4ZA 1XYYA 2IUSA 2A3NA 4X8HA 4ABYA 4R9NA 3NV9A 1Q2XA 1YR8A 3E2PA 2HN9A 4IV8A 3NYRA 1EJBA 3ZY4A 1I4LD 5DNEA 4ZI7B 1CK4A 2DQZA 3HFSA 1SBNE 5DT9A 4AJIA 5M04A 1U0JA 1GLVA 3DBIA 1GGJA 1P7PA 1XA3A 4LNUA 4P5DA 3KUKA 4RHEA 2H6EA 4JBLA 4J7AA 3U13A 2VAWA 2X7XA 1CY6A 2YJNA 1T29A 4H3KB 3MMXA 4W63A 5CIQA 4NFYA 3M1IA 1KQ3A 4NICA 4UTXA 3ZIAD 4AO8A 1TTPB 1OLSA 3F5SA 2NZYA 4ZQGA 5B2ZA 1QYCA 4UEOA 1BSVA 4LRYA 5KUTA 4RF4A 4AULA 3AC0A 2UVPA 5EP1A 5EQDA 3LX4A 2OV2A 1YTUA 1Z4KA 2GSDA 2ET6A 3BTVA 3LT2A 4KYTA 3WGLA 2ZRJA 3ZV7A 3KPYA 2EBHX 4HLDA 4FLFA 2A14A 2A88A 3M81A 1C2YA 4H3VA 3K70B 2D0PB 4KVGA 2PV0A 5BSEA 4D0RA 5AXDA 1X1CA 1KZ6A 4AX8A 1KH1A 4Q03A 3WJ7A 1GGFA 5EFOA 3ELWA 1LEHA 3WLPA 2CDNA 1QH8B 4YAOA 3MJEA 4FD3A 3PA8A 3IAS1 3QFTA 5JDIC 2HXGA 3VV2A 2R6CA 4ICIA 4KXWA 4X7MA 3B48A 4RUKA 1YJQA 4A92A 3P2KA 2V7UA 1MB9A 4AJPA 1KERA 1XYVA 3ES9A 5TPWB 1TVCA 3A1NA 1GKIA 2ZXEA 1OAAA 1UZMA 1XBTA 3HEBA 4OAOA 2BISA 4OQDA 5BW6B 3T5CA 3TVDA 3ZGNA 1J0AA 1L8LA 5A2GA 1BYIA 1FVXA 1ORTA 3E3OA 1U02A 1W30A 2VF5X 3K09A 4MUJA 4Z9BA 2OV4A 4DLVA 1KWKA 1KEKA 4GRDA 5LWQA 4WK0B 4O2AB 3AF4A 1FNSA 1XQYA 4O4LB 1MOSA 2C3PA 2PMFA 4MX8A 3UJAA 3HRIA 4ZVNA 4KO8A 1U7UA 1D6JA 3JX9A 4LWZA 1QTNA 1W52X 1YJ8A 2F3SA 3P71T 3Q6NA 4N65A 3DE1X 4KR0A 1HDRA 4FR2A 1JHUA 1V8PA 3RU2A 1SIBE 1D09A 4IIVA 4TKMA 3K32A 1DAIA 1NRWA 3UJ7A 4RYLA 2VYVD 4HPWA 4P92A 5A6VA 2QNBA 2QHXA 4WZZA 2QTGA 1THZA 3A9TA 1V41E 3DAHA 2GF0A 2FF7A 7ABPA 4GP6A 3IEKA 4JI1B 1BJRE 1Y7PA 3ZD8A 1SVWA 3U61B 2J3LA 1A9XA 2D54A 1RPAA 1D5CA 3I01M 2YJGA 1E7QA 3G2MA 4H7HA 3WNBA 3Q1LA 4TVOA 4X7RA 3WQBA 4K9SA 3JALA 2W2NA 3B7PA 1LS1A 2GTIA 3NGMA 5DHPA 1FP7A 1QMPA 1Y81A 1GRVA 2PU7A 4BO9A 4BP8A 3RAEC 1JWAB 2CL6X 2REOA 4CLXA 1AN9A 2PGDA 4B09A 2QRJA 3TTXA 3KK0A 3RIMA 2CMKA 1VKHA 3N2LA 3BFKA 1TTTA 1U8YA 3D1JA 4DNXA 2YW9A 3G2LA