4BTVA

Structure of phaz7 phb depolymerase in complex with 3hb trimer
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
344
structure length
330
Chain Sequence
b'LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHAMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNAAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAYNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHB DEPOLYMERASE PHAZ7
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
total genus 125
structure length 330
sequence length 344
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4btvA00
2BFNA 2BUBA 4NS4A 3FYTA 3WK8A 4CCWA 3CXUA 4Y2VA 2HA2A 5ALKA 2BKLA 3GUUA 1UOQA 4LIPD 5JASA 1E8DA 1YS1X 5HK8A 2XLBA 2C0QA 2WTNA 5DYTA 4BE9A 3H2HA 1H2YA 1VZ3A 2QVBA 5AM0A 4XX1A 3WWPA 5A62A 2FUKA 2ORYA 3I2FA 1J06A 3GFFA 5JATA 1FSSA 1UK7A 4BAGA 5SYMA 4OB6A 4EHBA 3NUZA 4WJLA 5KREA 3WL5A 4W1SA 1A88A 4AQDA 3D2AA 4UHCA 4W9RA 4BTLA 1XZAA 3DYIA 4LKOA 2RHTA 4J0JA 3H18A 3R0VA 3TRDA 3G0IA 1VXOA 3GROA 4C6HA 1U2EA 2XUKA 1VKHA 3HRHA 5ALEA 5ALLA 2QS9A 4UBIA 3QPCA 3PFCA 4AXBA 4FTWA 1R1DA 2BCEA 1W6RA 5KWJA 1U4NA 2PSDA 2Z8ZA 1YS2X 1DINA 5A71A 1CQWA 2VAVA 1JFRA 1UOOA 5C8ZA 2OG1A 2GYWA 4Q3KA 3H04A 2WFZA 1AX9A 3WL6A 3QITA 2GZSA 4JEIA 1UZAA 1WCYA 3L1JA 4N5HX 3BDVA 2PSHA 1ISPA 1WPRA 3FSGD 4TVKA 1R4ZA 4FLFA 4XVCA 4H7IA 1G4HA 1BCRA 4W1PA 2XMGA 3OM8A 2QTBA 2HA4A 3D2CA 1GXSA 4M0FA 4QA9A 4QDTA 1GPKA 2G5PA 5JD5A 4CFSA 5DYWA 4GWLA 3FNBA 3IA2A 5ALFA 1QLWA 3K9BA 4EY5A 4DTCA 1BS9A 4OB7A 5T4BA 4MWTA 2D0DA 3W05A 1LNSA 3KXPA 1KU0A 1BCSA 4JUIA 4AN0A 2H1IA 4LYEA 1CVLA 4L0CA 1IZ7A 3AINA 4S0XA 5LKRA 3STVA 5KBYA 3E0XA 3LCRA 1AC5A 3GELA 3BF8A 3SK0A 4ZV7A 4MXDA 3AFIA 3A2NA 2WIGA 2HRQA 4BP9A 1WPXA 2VJBA 3I1IA 1GQRA 4KE8A 2HA3A 3G0BA 4Y9SA 4F0JA 2E3JA 1DQZA 5CH5A 4DMCA 3V9AA 4QE3A 5JZSA 1QTRA 3F8SA 3C43A 1E66A 1J07A 4GDMA 1QIGA 3OOSA 4P08A 2CMFA 4ZREA 2Y2UA 4O08A 2VA9A 4JYPA 2WUDA 5EHZA 2J3QA 2RI6A 5D6OA 4EY6A 4HRYA 3AIOA 2ACKA 1AZWA 2JF0A 2VT7A 5AK6A 2QJWA 2V96A 5HKAA 1PJAA 1H22A 2HIHA 1VJ5A 1FFBA 3H17A 4G4GA 3G0GA 3HI4A 1RWQA 4MWSA 2YH2A 4BATA 4EY4A 4GBGA 4E15A 1GGVA 2B4KA 3WZLA 5BV7A 1C4XA 1XRNA 3JW8A 3VISA 4DNFA 4B81A 3CN7A 3IIIA 4F60A 3C5VA 1TK3A 4BC1A 2JGFA 5JYCA 1LGYA 5JALA 2DHEA 2FJ0A 3I2IA 4C4ZA 2J3DA 1MX1A 1XRQA 2EDCA 4BVJA 1XROA 2Z3WA 4J0GA 2X8BA 5HQ3B 5AK4A 3W9UA 5HF9A 1VXRA 2OCGA 1QOZA 4FNGA 1ZD2P 4QLAA 1CFJA 2K2QB 5A6VA 3DD5A 2DR0A 1R88A 2PBLA 4B0OA 2WIJA 1CUDA 5BWCA 2ZYRA 1N5RA 5YASA 1UKCA 2WU3A 5EGNA 2BJHA 2AXEA 2J4CA 4I4CA 4GI1A 4QEKA 4PSDA 3FAKA 5AI8A 5JADA 1XLUA 3EQ8A 3O4GA 1OCEA 5HQ3A 4L3WA 4Q34A 1QIJA 2VTVA 5C8XA 3V1NA 1G5FA 4N8DA 4B7ZA 4C89A 1SCQA 2PM8A 3STXA 2WUFA 4BVLA 2HL6A 3U1TA 7YASA 1BRTA 3T52A 2XQKA 2V97A 1EA5A 2RHWA 4GXNA 5ALUA 1H23A 4C4YA 3I1YA 5CMLA 3IBTA 4QDUA 4BAUA 3WKCA 4A5SA 1JT2A 1W4LA 5K3CA 3N0TA 4B9EA 4G4IA 1Q83A 2C4HA 2QUAA 1R9MA 2BGNA 3WIBA 2V98A 4MEBA 3G9UA 2ZJFA 4KRXA 3KDAA 2H7XA 4DYHA 1XZIA 1YA8A 1E5TA 4L72A 1ORVA 2VEOA 2W6CX 1EVQA 3V48A 1QO7A 3I2HA 5EFZA 4J0HA 3KOOA 3BE8A 1QJ4A 2VQ6A 1YB7A 2XMSA 4YPVA 3WK6A 3WKEA 1FFCA 4OD0A 2HU5A 1THGA 4OU5A 5FOQA 3QM1A 3IUMA 3W2TA 5AM5A 2CUTA 3E3AA 4Y2QA 4G5XA 4N8EA 5EHXA 2VF2A 1HBJA 5AKZA 1A8QA 1W52X 4UBJA 4BRZA 5AKXA 1ZJ5A 2PVSA 2JGJA 3HABA 4GW3A 3WA6A 4H7HA 1M33A 1N5MA 5JIBA 3FYUB 3G0CA 4UFOA 2QZPA 3DCNA 1QFMA 3QPAA 4DGQA 3TGLA 4U2DA 4IH1A 1E8MA 3F98A 3STYA 2Q0XA 1MTZA 3IB3A 1MNAA 2WHPB 1TKRA 1Q84A 4JNCA 5JD4A 2VT6A 3TEJA 1KEZA 3ED1A 3WQHA 3FYUA 3ZI7A 4CCYA 3STWA 2XB6A 3V1KA 2G5TA 3BIWA 4HVTA 1F8UA 4B84A 4F5ZA 3HACA 1DU4A 3WK9A 5AH0A 4WFJA 4QDXA 1XZDA 5LZ2A 5ALWA 2ZJ7A 1EXWA 1LPSA 1ZI9A 4PSCA 1K63A 2QXTA 2PKYX 2WHPA 5HFAA 2QOEA 4GHWA 1UKBA 4QLOA 1XQYA 4J0IA 5ALJA 3O4JA 3C6ZA 1ZOIA 3Q0TA 1XRMA 4OSEA 4M0MA 5I8PA 2ECFA 2OCLA 1QIHA 2XQGA 5CT5A 3CN9A 1ZD3A 3G02A 1O6FA 3QMWA 2JIDA 2GYUA 1XZLA 4FBMA 2JBWA 5AP9A 2QMQA 3JYHA 5K3FB 5ALSA 2BUCA 5FUMA 2HFKA 5EIEA 5IVHA 1Y7IA 1SFRA 4X91A 2AJLI 5EI5A 4ETWA 5F4ZA 1HDEA 2Y1KA 2RONA 3F96A 5FXMA 1NU8A 1E8NA 4UHFA 1XKTA 3WZMA 4MYDA 1CUXA 1R50A 2BAGA 1MPXA 2GBGA 2OQVA 2OXEA 4H7EA 2YYSA 2GYVA 5K3FA 3WKDA 4UHDA 3D59A 5ESRA 1QIIA 1VA4A 2WG1A 3SC2A 3GA7A 5BWBA 1A7UA 2OLEA 5ALZA 2H7CA 5DNWA 4U2CA 5ALGA 1F0NA 4A23A 4IH4A 1QTIA 3CCCA 3M82A 1X2BA 3AIKA 2HA5A 2WIFA 4J0KA 4XWGA 1P0QA 1ZI8A 3KD2A 5LZ4A 3DKKA 4U2BA 3G9ZA 1CUEA 1IUPA 4DMHA 5JAOA 1EK2A 2RIPA 3ZWQA 5AM3A 3HYSA 3IURA 1XZMA 1DTEA 5AKHA 4QWMA 4PQEA 5C7YA 5DNUA 2O2HA 3EIOA 1WHSA 2PX6A 2PSJA 3VXKA 2PSFA 3PDCA 1K6EA 1I6WA 1EDDA 5CBKA 2XDWA 2PL5A 4AZ3A 1CUSA 1J2EA 1ZIXA 3DJYA 4KRYA 1H2XA 5DTJA 3O9MA 1CUJA 4FLEA 3SX4A 1CUUA 1FFEA 4KAAA 2HA7A 3FVRA 5C81A 3BXPA 2D5LA 5HKBA 2OGTA 2NW6A 4AB1A 1SCKA 4B82A 1EB9A 1UOPA 1VE7A 2OPHA 4CG2A 3A70A 1AKNA 1YB6A 2FX5A 2HFJA 2VJCA 1HKHA 3C45A 1XRRA 5T4EA 3NGMA 3OPMA 2QRUA 3H1BA 5AKIA 5HFNA 3AZQA 2BGRA 4NMWA 1HLGA 2Z8XA 4XJVA 1XQXA 4DMKA 4HRXA 2RGUA 4UFPA 4BVKA 1ZD5A 1QIMA 1LPPA 1N8SA 4KAFA 1TIBA 3I2KA 5ISMA 3F9CA 5LLSA 2DHCA 3ZLTA 5I7UA 5LZ5A 2OGZA 3EF3A 4Q05A 5ALMA 3FWHA 3Q8WA 5K3BA 1T4MA 1K8QA 1XRPA 3D0KA 3TJMA 3EBLA 3FCXA 5AKKA 1XZJA 3WIOA 2JEZA 3OURA 4X3CA 1TCAA 3WA7A 1DQYA 2DSNA 4PF1A 4X6YA 1TRHA 3C87A 4J03A 4Q82A 3I2JA 1XZBA 2IX9A 5FV4A 5ALQA 1J1IA 5AI9A 5AI4A 3QVMA 2ZJ6A 3RK4A 1PFQA 5LZ9A 1SCIA 3U0VA 4AMZA 4BBZA 4KE9A 2OCKA 1DWQA 3D4LA 3WWOA 2AJDA 2IIVA 4EA6A 3M3DA 4Q1VA 3PE6A 1GQSA 3ESAA 1YR2A 3IUQA 1JMKC 1UK8A 3B3QA 1THTA 1VZ2A 4X85A 4IH9A 4UHBA 1XRLA 5ALVA 4AMYA 1E3QA 3L1IA 4FFWA 5ALPA 1ODSA 5AJHA 2VJDA 2JGMA 2XQIA 3IUNA 4BCDA 4K2AA 1IMJA 1JI3A 4DNPA 1DX4A 1DT3A 3K6KA 3VJLA 3WI7A 1CUZA 2Y6VA 2XLCA 2LIPA 2G63A 1XKLA 2XUDA 4Y2RA 4PV7A 2WQZA 1DWOA 3AZPA 2AJCA 1ZI6A 1LBTA 1XZFA 1WHTA 1QONA 3WLAA 2HA6A 5CH8A 2XUPA 3E4DA 4E11A 4G1FA 2V9ZA 2JGEA 2EDAA 2R8BA 2H9YA 2VAXA 4LXHA 4X94A 1R3DA 6YASA 4UFNA 4B83A 2DCMA 1W75A 3X3HA 5AM1A 2XQFA 4FOLA 1ZJ4A 2AJBA 1FFDA 5IKXA 5ALRA 3DYVA 3PUIA 1EI9A 4GLBA 3WWEA 4FBLA 1TQHA 4AX4A 5AIBA 3ESDA 3LIPA 5CT4A 3FSGA 3WYDA 3ANSA 2XT0A 1W1IA 3O4HA 3VDXA 4N5IX 4DSAA 2PUJA 5JANA 1VA5A 5LP1A 1JKMA 3G0DA 4B6GA 5CT9A 3IULA 4HAIA 1MX5A 5AO9A 1MNQA 3LLCA 4IQ4A 3GZJA 3R3ZA 3G9XA 4G9EA 2HA0A 2HM7A 2O2IA 5ALXA 1CV2A 1JU4A 2HRRA 5DYYA 1YASA 2XUIA 4JYMA 1CUCA 1YCDA 3LP5A 3L1HA 2DQZA 4B9AA 4G4JA 4YK7A 1XFDA 3RARA 4MEAA 3M81A 3MGAA 2XUAA 2ZVDA 3C5WP 3OC0A 3LIIA 3ICVA 3DL4A 3ZPXA 2Y6UA 1WB4A 2ZYIA 1A8SA 4OU4A 3D2BA 5DLPA 4HXEB 4LHEA 4KYVA 2PUHA 5AK3A 3YASA 3R40A 4DNOA 4OUKX 5ALOA 4EZIA 1HQDA 1XZCA 4ZWNA 5FPPA 4FDMA 3I6ZA 4H35A 1ETHA 1BEEA 3H1AA 1C7JA 3WKAA 1LPOA 4W1QA 1HL7A 3T4UA 1JU3A 2XUHA 2PSEA 5A7GA 1BEZA 3QBJA 3C6BA 1FFAA 3PF9A 4Y2JA 4LXGA 1BE0A 3O9VA 1CRLA 2VATA 2CB9A 2I03A 4CCYB 2XUQA 5CRIA 2QM0A 3FCYA 3W04A 2J4FA 3R3YA 5CTAA 4UHEA 1CUHA 4J7AA 5ALYA 5T4HA 4CG3A 3DS8A 4BAZA 4BRSA 4AZ0A 3BJMA 2WJ4A 1AUOA 4XIIA 2JGKA 1UKAA 3C6XA 1WOMA 2VSQA 3O4IA 1XZGA 5AOAA 1FJ2A 1QZ3A 3DQZA 4Y2PA 1VOTA 1CR6A 2QUBA 2IITA 2CKMA 5CW2A 4D9JA 1BN7A 3A2LA 2XI4A 4P93A 4RE6A 5FKJA 1AQLA 3S8YA 1VLQA 2B20A 5AK5A 1IUNA 4RGYA 1BROA 5HF8A 3WJ1A 3AILA 1P0MA 1G66A 4ROTA 3WK4A 1L7AA 3IDAA 3EQ7A 2XMZA 4W63A 1JJIA 3WK5A 2X76A 1L7QA 1NU6A 3QYJA 5AI5A 5AKJA 3B12A 1W76A 2OCIA 3AUKA 4QNNA 1E89A 2QXUA 3FLBA 3OG9A 1OXMA 2JGLA 1LPAB 5AIAA 1MAAA 4G8CA 4ZV9A 1ODTC 5E4YA 2WLSA 2WILA 1B41A 5JARA 3BJRA 3FOBA 4BE4A 3GBSA 4Y7DA 2WU4A 4BTVA 5D3KA 2AJ8A 2I78A 5HZGA 1H2ZA 3WMRA 1QFSA 3C70A 4Q3LA 4ZGBA 1QE3A 4EBBA 1R9NA 1LPNA 4LXIA 2WM2A 3G8YA 1ZD4A 2HDWA 1U65A 3PICA 3VKFA 5CT8A 4KE7A 3H2KA 2PU7A 3PUHA 3DLTA 3FYUC 4QDOA 1QIFA 3SWWA 3V1MA 3R3VA 2ES4A 3H2GA 5T4FA 1QIKA 3R41A 3AIMA 5ALHA 3BDIA 3EQ9A 5AM4A 4H0CA 5FLKA 2WJ6A 1TCBA 3ICWA 3KWJA 5CT6A 3HLKA 4CIAA 1RP1A 3HZOA 3UMJA 1XZKA 5EHNA 5HF6A 4B85A 2WFLB 3MVEA 3BL8A 1LLFA 3H2JA 3O0DA 4QZVA 5AI0A 4H7DA 1JJBA 4Z49A 1ZICA 2I3ZA 2O2GA 3KSRA 4Y2YA 5FDFA 3S2ZA 3FLAA 1CUVA 4BB0A 3D3NA 4PSUA 5D7BA 4H18A 3QPDA 4P92A 4WY5A 4Y2TA 1F0PA 4U2EA 5DTIA 5E4JA 2X5XA 3WWCA 3WWDA 4M0EA 1X70A 2W22A 4X6XA 4Y2XA 1CQZA 3IUJA 1TAHA 2C0PA 1BN6A 2C5GA 1MN6A 2WFLA 4FFVA 1ACLA 2HADA 3NOXA 4X71A 4AO8A 1EDEA 4HS9A 5AOBA 5CXUA 3I6YA 2XMCA 3DNMA 4INZA 5LIPA 4BYMA 4Y2SA 1XZHA 1Y7HA 1K5PA 5JAHA 2JEYA 5EHQA 2QR5A 3VJMA 1AURA 4AO7A 3C8HA 4FMPA 1GPLA 4MQMA 5K3DA 3HXKA 3UUFA 3STUA 4U2FA 5JAPA 1G42A 2EEPA 2XMBA 4JH0A 2QKYA 2B9VA 1ZIYA 2Z5GA 4Q3OA 1UT6A 4DMFA 2HHAA 2ACEA 2HU8A 3M83A 3NWOA 3WJ2A 4FWBA 1XLWA 3R3XA 2C58A 3WK7A 5HK9A 4EB0A 2C7BA 3WYNA 3B5EA 4IHAA 4BDTA 3MUOA 5K5EA 1QIDA 1EHYA 4J0DA 4AO6A 4X90A 5HCUA 1MO2A 1ACJA 4X7BA 1LZLA 3PI6A 4ZXFA 3D7RA 3V1LA 4KE6A 1ORWA 2BUAA 2XMDA 4BCBA 2UZ0A 1PV1A 2WKWA 4G8DA 3BIXA 4F21A 5J3JA 4DIUA 4X92A 2ZYHA 4K5QA 3C6YA 4QDZA 1F6WA 3ANTA 5A2GA 5E2IA 2I3DA 1S8OA 4H7KA 5JD6A 5LYYA 3WL8A 1O6GA 5EIHA 4G8BA 4DNQA 4L9AA 4UBMA 3VVLA 1CUAA 1ZGBA 4X95A 5JZ9A 4MYSA 1Z68A 2WG2A 3ILSA 1CUWA 2XUOA 3WL7A 4FNMA 4AN1A 2OAGA 1X2EA 1DT5A 2WHQA 1OILA 2CBGA 2GBIA 1CEXA 1P0IA 1QGED 4KR0A 3RM3A 5IVKA 1P0PA 5LKAA 2XE4A 1JMYA 3DDUA 1MT3A 1MU0A 4HXGA 1IUOA 3DOHA 1BU8A 2R11A 5JZBA 1CLEA 2WFMA 4K6GA 1MJ5A 3LS2A 3WKBA 2WSLA 3R3WA 5DNVA 4ZRDA 4B0PA 2O7VA 5CH3A 1WM1A 4K6KA 4X93A 4C4XA 1N1MA 1K4YA 2C5FA 4GECA 3A2MA 1YA4A 3PF8A 4PO3X 1CUYA 3O95A 1A8UA 2P8SA 4B80A 3F97A 3DL7A 4V2IA 2OQIA 2XUJA 4PW0A 1GKLA 4MQLA 5FRDA 2PU5A 2WHRA 1MAHA 4OPMA 1GKKA 3CCBA 4DM7A 4W1RA 5AKYA 5AHXA 5BOVA 1RYYA 5FP0A 3HJUA 4IO0A 1UXOA 1UFOA 4OCZA 5IVIA 2FJPA 4Y2UA 1XQVA 5IH7A 5I9IA 4ARBA 5AKLA 3ESBA 3AZOA 4P9NA 1AGYA 4YASA 2OGSA 5EIAA 4I3FA 1EH5A 4FKBA 2WTMA 5AI6A 1QO9A 1XZEA 2XUGA 2DFPA 1L7RA 1QIEA 4BZWA 5C8VA 4UHHA 3G7NA 5A7HA 1EDBA 2XUFA 1YAJA 2QT9A 3PFBA 4U2GA 5AKEA 5CURA 2XMRA 2XMQA 3H0CA 2WIDA 4BP8A 3QH4A 4OYLA 3N2ZB 5ALTA 4CI9A 4BCCA 3FVTA 3FLEA 4UBNA 1IZ8A 2HU7A 2ROQA 4C87A 3VJKA 3UUEA 3ESCA 2WG0A 1SC9A 4G9GA 4CG1A 5K3AA 1T2NA 2WIKA 1KU6A 1HPLA 1VE6A 1CPYA 4KJXA 4BDSA 2RAUA 1UK6A 4TPKA 4N8SA 3DEAA 3F67A 4H7FA 3A6ZA 1XLVA 5A7FA 1AMNA 1ZGCA 4ARAA 4ZI5A 2B61A 4FLMA 2CEKA 3G9TA 2CJPA 4UBOA 1EX9A 1EVEA 4WFIA 4DSZA 3ZV7A 3HEAA 4X6UA 1DWPA 1UWCA 2Z3ZA 4DLNA 5ALNA 2GBCA 4HZGA 1H2WA 3R3UA 3I6MA 5ALDA 2GBFA 4EY7A 2WUEA 1CUFA 4J0CA 4WDRA 4X00A 2WUGA 2ZSHA 1Q0RA 4WFKA 3E1GA 5AICA 2DHDA 2ZSIA 1B6GA 3OTQA 2O7RA 2H7YA 1Y37A 4KACA 3W06A 3DKRA 3K2IA 5AM2A 3RKSA 1MX9A 3QMVA 1IVYA 3QZUA 5H3HA 3VVMA 4YX9A 2G4LA 4X97A 4UPDA 3ZLUA 2OAEA 4WY8A 3HSSA 3DOIA 2CZQA 2PPLA 3BF7A 4LYDA 1C7IA 1Q0ZA 3H19A 1D07A 3D5EA 3HC7A 1GZ7A 1GPNA 5LZ7A 1CIJA 2YASA 3P2MA 1WB5A 4WCVA 4HTAA 4UBKA 4QWWA 1LPBB 1CUGA 1EK1A 4WDQA 1JJFA 2XQJA 5AOCA 4TGLA 5CXXA 5HF5A 5K3EA 5ALIA 1GT6A 5JAUA 1U8EA 5KWIA 1EB8A 4EY8A 1LZKA 5DJ5A 4BZZA 4K6HA 4UUQA 1CUBA 3MUNA 3W9BA 4A16A 1NX9A 3I28A 5FPQA 4RNCA 4OYYA 4C01A 3JWEA 2QJRA 4KAJA 4OB8A 5D3ZA 1TCCA 5IVDA 1YAHA 3C8DA 3H2IA 4I19A 2VJAA 1LPMA 1EINA 1USWA 2DQYA 2GZRA 3FBWA 3BWXA 4NZZA 2Y2VA 2YXPX 4HXFB 3STTA 1SOMA 3QMMA 4EUSA 1UK9A 4H77A 1WB6A 4GEGA 5AKGA 4E14A 4CIBA 1LBSA 4FHZA 3AJAA 3RLIA 4RE5A 1DX6A 5SYNA 2ZYSA 3I2GA 1YSCA 3KWFA 5DWDA 2JGIA 4E46A 1XQWA 4RPCA 4C88A 3ZLVA 2WJ3A 4J3JA 4PNZA 5E4TA 5LZ8A 4BC0A 3IVMA 4NVRA 4H7JA 4MJ3A 4KEAA 1CUIA 4ITVA 4UBLA 1ODCA 2ONCA
chains in the Genus database with same CATH superfamily
4MRVA 5FNVA 3V3TA 4Q24A 1E3WB 1VPLA 4BMVA 2IS6A 5A6SB 3FYTA 1XVAA 3T7DA 5G3ZA 1W7AA 1NIJA 3K1AB 3PXUA 2R65A 1TFRA 3CXUA 1W5BA 4Y2VA 3N58A 2HA2A 1ZG3A 4MQFA 2BKLA 3GUUA 4JVMA 3ETJA 4HYTA 1LSJA 1UM8A 2NUPB 3CA8A 3LVRE 4M1WA 1ZPDA 4XPIA 4YH1A 1LEHA 3KU1A 4IPTA 1PGOA 4IQ8A 1E8DA 2Y76A 3P97A 1KZGB 4KN8A 5JASA 1LFDB 3U48A 3JQDA 2IYRA 4MQ5A 4Z1OA 3CU5A 4US0R 1YDWA 3VUEA 2DKFA 2VAMA 2WTNA 3F0TA 1M8GA 1A71A 2M9MA 4Y2GA 2FPWA 4TMXA 5AM0A 3EZFA 2I6XA 2VJNA 4XX1A 2FUKA 2ORYA 1YVDA 5ECGC 2CVFA 3WWPA 3G0HA 1J06A 3AHGA 3LK7A 3OT5A 4ENTA 3VV2A 4QTYA 4EABA 1BMFD 4EO7A 4ZIRB 1UK7A 4E5MA 5GINE 4BAGA 1DO8A 1NF2A 2FRVA 4RZIA 5JI3E 1NUHA 4DUGD 2H0QA 4RH3A 3OECA 1Z7EA 5GV7A 2IEDA 4KFUA 1I36A 4RZ2A 2WSYB 3WL5A 2Y9MB 1MV8A 4W1SA 4DKXA 1HDCA 5KX5B 3H2YA 3IJEB 4GVLA 421PA 1Q0QA 3W3AH 2B21A 3H6GA 5CDFA 3VRHA 4X6LA 1A5TA 1HG1A 5DNDA 2AZMA 3RH0A 4NAUA 1FRQA 1IH8A 4W9RA 1ZHFA 4R3WA 4C7VA 1XZAA 1GLGA 2VNJA 3DYIA 2ZRAA 4RDXA 3S44A 5FTJA 3RTGA 4I9HA 4RK7A 4QJ5A 2EYUA 4NEGA 5DBOA 2Z83A 1JF8A 1Z12A 2FSUA 4MQEB 1KYVA 3N75A 3JWGA 2R5NA 4JZKA 1KSHA 2O5EA 4AG6A 5I6DA 5BW8A 1VXOA 5D6NA 1N4DA 2JCSA 1R66A 2WYVA 1DJPA 4GYJA 2NYAA 5CFPA 3HRHA 1CC1S 1RKVA 3TW8B 2BFMA 1RKUA 1WV1A 2H2HA 4L0QA 5ALLA 3N0VA 3PHJA 4NZNA 5JZOA 1GPBA 1CJUC 821PA 3VZDA 1U3GA 2ENUA 3CNEA 3TD6A 4DB2A 2P2ZA 2RKBA 1M7GA 4K9DA 4RKRA 1X3LA 2BTEA 4OY3A 1W6RA 3HUDA 1GV0A 1QHXA 5KWJA 3KQSA 2OP1A 2UDPA 4L5BA 2WMYA 4RSGA 3ZE1B 4D4IA 4ZTZB 1XYYA 5FWYA 1I2AA 1RI5A 4NIMA 4PCUA 1P31A 5JJLA 1YHZA 1DINA 1R8YA 5I7OA 1II8B 3TG2A 4C29A 3GGGA 2CSXA 3KVOA 1SBCA 1Z28A 2BYTA 1EHCA 2CXHA 3MFYA 1KYXA 1JFRA 1UOOA 4JK3A 4MP6A 2XUZA 2GYWA 3ZYCA 1A5ZA 1FRFS 3S1LA 1D03A 3FRIA 3GLHA 3H04A 3K0BA 3PP8A 4LTDA 3RAEC 4IZHA 4DCPA 3TX2A 1IEXA 2IC5A 4B44A 3T7TA 1ZZEA 2W8ZA 3WLHA 3NRCA 4CUZA 4GRAA 1WCIB 5A03A 4S2EA 1UZAA 2FDCA 3BCHA 1QANA 5C0OE 3GEBA 4FOTA 3L1JA 4N5HX 4UCWA 2XSZD 1W36C 4E4RA 3U4QA 1MB0A 2N1MA 3BDVA 4JAVC 1FPQA 3WGIA 5KYKA 2Q3LA 3O1IC 1ISPA 1J2JA 3K5IA 2ASVA 2UZ1B 2YVQA 3JRNA 2QI9F 3A6GA 4ARIA 2XX3A 4W1PA 2C07A 2J9ZB 3B38A 3F7MA 4N3AA 4A8TA 4CLHA 4KQWA 4F04A 5JCOA 2B34A 2ATXA 4NLLA 7AT1A 2HA4A 1ZVJA 3JWIA 3GMIA 1AGRA 4NF2A 1G64A 1PQUA 4M0FA 4FZRA 5DLEA 1GPKA 5ICCA 4CFSA 1Q44A 4C3ZA 3IELA 4HVAA 4MR9A 1L5GB 4NU8X 1EFRA 1WPGA 4YCCA 1QLWA 4C0WA 1BS9A 1M6NA 2OO5C 3TIXB 3QPVA 2KLBA 3T61A 3Q7TA 1N2SA 3GNLA 2Q4DA 4E6EA 4LHZA 4KK4A 4RK1A 3SFTA 4HQOA 3UGQA 2MSCB 1DI0A 4D9GA 3BH0A 4S05A 2V3CC 3LC0A 1S2NA 4F45A 3RU3A 2G1UA 1DOHA 1BCSA 1VDZA 1VJRA 3UM9A 2H1IA 3LA6A 5TS2A 1R0CA 1XQ1A 4MI3A 1W49A 1CVLA 3GLSA 3GRAA 4L0CA 2B4AA 1GUFA 1V3TA 3EXEA 4LNAA 3DE2X 4OK5A 3IDSA 3E22B 3WBKA 4E1VA 5KTTA 3TOZA 3H2ZA 3PPXA 5F98A 3ES9A 3ZVNA 1D4AA 3B3AA 3FGOA 4JC5A 3PIRA 2Q50A 3E0XA 1L7MA 1VBNA 3K53A 3LCRA 5D84A 4O02B 2G9QA 3RTAA 3AFMA 1HO3A 2KBFA 3TTTA 5B58C 5KTSA 2Q5LA 2YJ5A 3H84A 4NYMR 3SP1A 1W2HA 3EY9A 3FNIA 1Y9JA 3QUQA 4MXDA 1BQ4A 2WJIA 3SZMA 3ZGOA 4BKOA 1N92A 1IBLB 1DRUA 3A2NA 2BIFA 3LO5A 2XOXA 5THXA 2WIGA 3PC2A 4ID3A 5KTPA 1WPXA 5IJ0A 2BGKA 3K9WA 3AT1A 3U4DA 1PZXA 1JIKA 3G13A 3TYXA 3ZS8A 4DRXA 1NBWB 5D00A 3W5BA 1K08A 5TGZA 2PX0A 2Q3CA 4MYRA 2BFCA 3G0BA 5AJWA 3T35A 4F0JA 1I1QB 3F6PA 3HVIA 2WK1A 2VUIB 1F5SA 1JDBB 4WLOA 3TDNA 4AJLA 2XTNA 3AERA 1QAMA 2HK6A 3IP3A 4IINA 4OBXA 5DN9A 5IAEA 5A9SB 5MN4A 3V9AA 5LN1A 2ZETA 2MSEB 5EE1A 3U3DA 1MLDA 1V9LA 3ZIAA 1XAIA 1QTRA 4J6FA 3BGOS 4EGQA 3C43A 3NIBA 4BE7B 3WAGA 1JAYA 3QK7A 2P30A 4N3GA 1T5BA 3TIGA 1M5UA 3T38A 2NZ2A 2WB2A 4CLRA 3ZWDA 4CU2A 1YUBA 1DCFA 2OXRA 4ZREA 4PQGA 1W25A 2QIOA 2Z5FA 3OZAA 4N6GA 2VA9A 3WK5A 5AUQA 4YDRA 2P4QA 5EHZA 2H16A 5A4IS 2AQKA 4LBZA 5DT2A 6ADHA 4JFAA 1MC4A 2NO4A 3IC5A 4KWCA 2G83A 2ZDGA 1OLXA 4G5RA 3TB6A 5F35A 1Z0ZA 4O3MA 5E0OA 1AZWA 3LBHA 4R68A 1SXIA 2VT7A 5DXAA 2QJWA 1N5OX 3GV0A 4RKQA 1RADA 1DRKA 5I5GA 4AJ2A 1PJAA 2X3YA 2W2TA 1H22A 2HIHA 1R0YA 3TTSA 3OI7A 5DE3A 1FFBA 4G4GA 3DL0A 2AEJA 4ZI3A 3FFTA 1EXVA 2IPOA 4EJ6A 4YRSA 4RVDA 3F7NA 2IU0A 1NV9A 2X0EA 4EY4A 3OIFA 3E3MA 3ZBTA 1KAEA 1A98A 2I2DA 4X61A 4O0MA 5H02A 4XYMA 2C4TA 4NZMA 5K0GA 3R7DA 4TV9F 4XARA 1WLYA 4J0EA 2QBYB 1C4XA 1OZGA 2PAAA 1QGUB 3BJIC 3F8WA 3W7BA 4CKEB 4YRZA 3VISA 2OGWA 1C1HA 3MTJA 4CT5A 3KYCA 3CRNA 1IQ0A 3CN7A 1Q15A 2PWPA 1GQOA 3P0FA 3MD9A 4KXXA 1HL3A 3C5EA 5T8KA 4BNTA 1JPUA 4BMDA 4AULA 1QU3A 3N05A 2C9MA 2X0DA 3DUFA 3IP1A 4PTZA 1WV0A 3MCWA 2QM7A 4BC1A 3RRYA 3IYLW 5CLIA 4KITB 1RU3A 1DAEA 1PWXA 2JGFA 3CE6A 4MJXA 2KMLA 4ZANA 4R69A 2XDQB 4DE5A 1Z5NA 1QYWA 2WUVA 5BN4B 4II7A 4C4ZA 1TUEA 3WGGA 1Q3HA 5CAEB 4KPGA 3QKRA 1PJ4A 3L46A 3RK0A 1YB5A 2J3DA 3P5BA 1XRQA 4TYQA 4UCFA 4UDXX 1VIAA 4NZ9A 4UAGA 3KTDA 2FUG6 4IYRA 2Z3WA 2VZ0A 4J0GA 4N65A 4RHXA 3ESRA 3GIDA 1CJCA 1IQUA 2BISA 2Z58A 4HI0E 4OLHA 5GWXA 4BKRA 2PK3A 5JPDA 1RYZA 2PX2A 3COVA 1BKYA 3D3WB 2HJWA 3L1VA 4QVGA 1KI1A 1ZD2P 2P90A 3L40A 4GEKA 4QLAA 1CFJA 1UQRA 2IYAA 5DHPA 1U7WA 3W6ZA 4CQMA 4TZ6A 2C8VA 2FQQA 2DR0A 2WDZA 1UPXA 3KVVA 3NFYA 1R88A 4B0OA 1EFCA 1FNDA 4CN9A 4EKEA 5ITSA 1MPTA 4MRNA 4GOND 5LL6P 4DA8A 4ALNA 4B6RA 3JVEA 1QK5A 1R10A 5DTMA 2EC5A 2W2OA 2W11A 4KO1S 4GI1A 1PZEA 1BFUA 3KQVA 3EVCA 3GLIA 4PHGA 1FSFA 3DH0A 1ENOA 1P91A 4UEQA 3SXJA 1VG1A 1T2FA 1ZHOA 2QENA 4C2TA 1H2FA 1ZNWA 1FCJA 3JQRA 4H08A 3L8EA 3UW1A 3W5CA 1ZOOA 2BONA 3A4MA 2GD2A 5IC6A 3HYCA 1WDTA 4IMPA 4OSOA 4MQUA 1YR1A 2OYCA 1UM9B 3WGNA 5E1MA 2V9PA 1O6BA 3EN0A 4HQRA 4Q34A 1JR3D 1WUIS 2C2OA 5H16A 4FFBA 4DR6B 3M9WA 5G53C 4N8DA 3ZU3A 5C52B 4CM3A 1IHYA 3T5DA 1GAWA 2WUFA 4V24A 3JQGB 1P0FA 3EW7A 4BVLA 4RK0A 2IT1A 1NHGA 4E70A 1Z4MA 4G1EB 3UTCA 3HN2A 4I4TB 4GYYA 5DNYB 1TYZA 3PFWO 4ESHA 2P9HA 1BX3A 1LF0A 3CJTA 3C8ZA 2Z9CA 5E1OA 1DMRA 7YASA 1BRTA 1Q14A 3FGPA 2GJKA 4JQCA 4OM7A 4UQOA 1C1XB 2F3SA 3ISJA 2O2SA 3R75A 3DC7A 1EA5A 5ALUA 6NULA 2GTIA 1XWIA 3EGOA 4C4YA 1SC3A 5DN6D 4CM9A 4QATA 4GP9A 1JLLB 2P3SA 2ZKLA 4G0NA 1SOUA 1OA1A 3O1LA 4A5SA 4YRMA 3MTEA 2QD4A 3CF4G 3FXAA 5BURA 3N0TA 4BQOA 5IP5A 5K1ZA 1DS6A 2Q8PA 2PXAA 3GA0A 3R7SA 1UH5A 2J48A 4P34A 4BX8A 1JDVA 3NJRA 2XNDD 3UHJA 3VVBA 4RLQA 4BZPA 4HDAA 3R44A 2OYRA 1B0PA 1OF1A 4FWTA 4KRXA 3IJ5A 5I4IA 4CM1A 3JQFC 1AKQA 2YFHA 3T9AA 3KDAA 3LU1A 5KB3A 3V4SA 3CBQA 4DYHA 2CLHB 1ADFA 3D6HA 4H31A 2QIPA 4LDNA 5J23A 2AA3A 4FDTA 3S2UA 2WVGA 3A11A 5H83A 3FFXA 2VEOA 2W6CX 4H16A 4KGXA 2W6ID 3B52X 4YLEA 2Q99A 4HDNA 5IBQA 1RCFA 4IS2A 1UT5A 1QWOA 1R12A 2OEPA 4FE4A 4K3UA 5JLJA 5F2KA 2DT5A 3M33A 2H92A 1LDYA 1P19A 3HGMA 2OVFA 4J0HA 4MUXA 3V2HA 3KOOA 1CTQA 2WV7A 4RETA 3JYQA 3CO5A 2G0TA 1GEGA 4HEQA 1YB7A 1G0NA 3KEOA 4YPVA 2PJDA 3PLNA 3DR3A 4Q1FA 2ZWIA 3QU2A 4MRRA 1W4RA 1COWA 5FYQA 2IV3A 4DJAA 3UGJA 1Z2OX 4KKVA 2VG8A 3KEQA 1THGA 1AUXA 2O14A 3I8OA 1D4OA 4OU5A 5B1SA 4B8ZA 1INLA 1X42A 5JSZA 3H8JA 1KAGA 2VT3A 4O59O 1Q1AA 2XYHA 3AXTA 2YZ2A 3QNWA 3OQIA 1NW7A 4Y2QA 4M1SA 5FL7D 3HFGA 3GMDA 3VU9A 1T0JB 3L4EA 2BFOA 4OUDA 3NXKA 3U4GA 3ONDA 2YNMD 3T5MA 4CIVA 2DBVO 3II6X 1KWKA 3ZIUA 2J45A 5EHXA 1P81A 3QLUA 3CX6A 5AKZA 1A8QA 4KKXB 1MB2A 3C15C 1AXGA 1N77A 1PGPA 3PQ5A 5J63A 4UBJA 4AZSA 4XD2A 1M2EA 4PM4A 4CR8A 1E18A 4P0PB 2DM6A 4BRZA 4YUYA 1U98A 1V5GA 2PKWA 1RYDA 3GDGA 2H3EA 3DP7A 3HA2A 2IY8A 4U3JB 5AKXA 5FNZA 3FHTA 1Z4JA 3WA6A 1I6MA 4RTQA 3A31A 1FQWA 1SBHA 3SLRA 2BL4A 2A88A 2PUWA 3P9KA 2N1BA 4BLPA 5AW7A 1GPUA 2HPHA 3FYUB 3NC4A 2DPYA 2OT3B 2HT1A 3EXG1 2FWNA 3FDXA 3GWZA 1WMSA 3FNEA 4MKIA 2OQRA 4RLSA 4BWGA 3IQEA 3ICEA 4KLZA 4XDZA 1L2TA 4KXNA 4O6VA 2HK7A 2CLOB 3C1UA 5IT5A 2BDEA 4TYNA 2GZ3A 5GZ6A 3TGLA 2CWWA 4IH1A 2I6SA 3CEHA 3DHWC 5TC4A 4LJYA 3QE4A 3DV2A 4IVRA 2K87A 3CNQS 5JTTA 1Y33E 4FCWA 4DF3A 3GDHA 2F1HA 3SJAA 4A0FA 2P5TB 3HVKA 2GXQA 2HUNA 2O8VA 2HWXA 1B3BA 3W9YA 1YIOA 4D56A 1N5LA 5I7RA 2EZ8A 1MZVA 3RD5A 4ONEA 4PNEA 2Q0XA 3IB3A 1WMFA 1VCNA 3NBFA 2E5LB 1EWQA 5JMPA 3K71B 4HNRA 4JY7A 4QUDA 1TKRA 2AG0A 2G1AA 1E1MA 4JP8A 3OT1B 2WWXA 4IFTA 2VL7A 4PZUA 3TEJA 1ZM9A 3ABRB 3HS3A 4FEEA 1W96A 4OJNA 4WEQA 2F8TA 4YECA 3NONA 5E95A 1KKLA 3HB0A 3SR3A 1ICEA 4M1OA 3QFSA 2EGHA 5IJZA 4R0MA 4LISA 4PHCA 4CRWB 4R2JA 4E7OA 4CCYA 1JQJC 1E92A 2QRHA 2AN1A 4PPGA 4XB6B 4Y1FA 3UK0A 5ES4B 2Y1LA 5A9TA 3U9LA 4MKFA 5C32A 2IHYA 3EIXA 3OX3A 5H8WA 4X9XA 5FTMA 4MS1B 5BORA 3FBTA 1GO2A 2PD6A 4F5ZA 3GWGA 2WSSD 3USCS 3L41A 1ECGA 3LUJA 2FPLA 4Y1EA 1XZDA 2BI4A 2I2XB 3JU3A 1CJMA 3NEPX 4NH4A 5HWSA 4RTMA 4C2UA 3A6HA 3Q5GA 2RB4A 4Z1MA 3UK6A 5KNBD 2AR0A 2VBCA 2BEUB 4ZRNA 2CD7A 1ISRA 1LPSA 2HSWA 3WB1A 4JR0A 1KSJA 1YHNA 1K63A 5FCDA 2PKYX 2WHPA 4X8MA 4YR9A 4W9NA 1E2UA 2E49A 2P3LA 3FR7A 3AHIA 2XGOA 1QFZA 2ODNA 1HE1C 4FGZA 1VL5A 1L5SA 1B2LA 3RW9A 1B76A 3DM5A 3G2NA 2BOVA 1D09A 3EHEA 3UMGA 7REQB 3X1ZA 5F78A 1UKBA 2FSSA 4TMWA 4QLOA 1IG0A 1SZPA 4J0IA 1YL5A 5ALJA 1NJ5A 2BGJA 1A9XB 4PG5A 3C6ZA 3VR5A 2ANBA 5D8DA 1DKOA 1SC1A 3SU8A 2FQXA 4FW9A 1MXHA 4I5DA 4GSLA 2BMAA 3B53X 2GOYA 1KY3A 3PQCA 5JDIC 1YKFA 4XD7A 2LVBA 3CW8X 1WQ1R 2J33A 2XQGA 3F47A 2GEFA 4KR7A 2X9VA 1S2LA 1Y5NA 1WSAA 1NM5C 1QAQA 1QFJA 1K7CA 3H5NA 2VDJA 4DVJA 2R62A 2JCVA 5BVHB 3G02A 1O6FA 4JC4A 2QL6A 1E7YA 5A3QA 2JIDA 2WTEA 3LCCA 2BCJQ 3V8QA 1MRNA 2GYUA 4Q66C 3ZWBA 4PPNA 1I14A 4C14A 3S40A 4EGFA 3C7CB 4A73A 5L53A 2F8SA 3JYHA 4G5FA 1YJQA 5K3FB 4B40A 3IVAA 4I3HA 1ECCA 4G1UC 4YJHB 1ZH2A 4M60A 2BUCA 1E4EB 4LS3A 4NCBA 2HFKA 4GZ3A 5EIEA 3RUPA 1IC6A 1LK7A 2AMLA 2F48A 2OFWA 3OPYI 2NU8B 4EHFA 1TVKB 1Y7IA 4NBKA 2EIXA 1TM7E 3L8ZA 1G21B 2HD4A 3E5NA 5BOSA 3X44A 2FVYA 1UR5A 4KO2S 1CLUA 1SB8A 2PFSA 2DU8A 2RHMA 4KQFA 2V8OA 1I2ZA 4QXMA 5JPCA 2Y1KA 3QE0A 1M9NA 3L92A 2RONA 3R4CA 1Z74A 3GRVA 1NP3A 3L01A 3U09A 3OQMA 3F96A 4LDPA 1R0KA 4S1PA 2GNOA 4CCAA 4QPPA 1NU8A 2CKDA 1UPBA 2BFBA 3I12A 3LYUA 1NI4A 2J3IA 1UBGA 3OZRA 1OBCA 3LLVA 4RD0A 5KPDA 2IHNA 1L1RA 1C0EA 2R6CA 3MRTA 5L3RA 4S0ZA 4JLNA 1RFLA 3D7LA 4AYWA 3PKZA 2YV2A 4QYXA 3FIUA 4NY1A 4UHFA 5FFMA 1XKTA 3EOAI 5FUYA 4MMYB 3H3FA 3NG1A 5EIXA 2J67A 2G80A 2O8BB 1CRWG 1PUXA 3TLZA 4ENSA 1CUXA 1EFKA 2A1TR 2QP3A 4TYPA 4AJIA 5LWHA 1Q3KA 2Y4NA 1YJAA 3JRWA 3TBHA 1PJQA 3L49A 4H7EA 4P4NA 4BNUA 4CCSA 4GBJA 1DRWA 2HSZA 2F1RA 2A58A 1HA3A 2ZWOA 2YYSA 2GYVA 5ITZB 1JR2A 2NLOA 2I6QA 2VAPA 3KB6A 4UHDA 1CT9A 3KUXA 4CIDA 2O19A 1GL3A 2FX3A 2P67A 2QRVB 4CMEC 1A9ZA 3ACDA 5G40A 1V1JA 3AI1A 3P2OA 5BWBA 4QRDA 3WDMA 1A7UA 5A06A 5JCJD 4BB9A 4KV9A 4UQLA 1MO5A 4WLNA 4QAJA 2PT6A 3BZBA 5G4KB 5LBUA 3Q3JB 1O87A 2XTMA 2ZT6A 2CF6A 1HNZB 4GX5A 5IXYA 1US8B 2OHFA 1RAIA 1K5GA 3N5CA 3GPLA 3RNLA 1XUOA 1LU9A 3WOHA 3OZTA 4KSCA 4RA9A 5HIIA 3TZLA 1OKKA 4YV2A 1U2SA 4HUTA 1QTIA 3CCCA 4AZWA 1SXJA 1XJQA 2ZB8A 3MWDA 4XRGA 2O59A 1T2AA 3M82A 3AIKA 2LR0A 3G2QA 4HN9A 2P8JA 4JS0A 4MP3A 1RMQA 2IGBA 4PNPA 4YRAA 1DKLA 3QX3A 1IULA 3H4MA 3EWAA 2Q41A 3UYKA 1ZM7A 3GN1A 2C8KA 2O3UA 3KD2A 3RVDA 5LZ4A 4JL5A 3EQZA 4M1YA 1QG4A 1CY1A 1KVSA 4S1NA 3NT2A 5BUQA 4GL2A 4DCVA 2ISSD 2Q6KA 3G9ZA 3L6BA 1BC5A 3PV0A 3PFKA 4FHDA 5A0TA 4ON9A 1BS2A 3HP1A 2WDPA 1KRXA 3DCJA 1UWVA 3PXXA 4L4RA 4MS3A 5B36A 4Q18A 3ZWQA 5JNUA 1GTSA 1ZOSA 1M2VA 4GPAA 4K6FA 2QRNA 4FK8A 1KFBB 2CDBA 3B20A 1IZ0A 5I9NA 5LVAA 1ZJJA 4UHKA 1DTEA 2VQSA 2X2FA 1EFVA 1U0HC 1EUCB 5DNUA 4Q4JA 3RJ9A 3EIOA 2J07A 2K7ZA 3QTLA 3TPZA 1NQ5A 4I1OA 3UOAB 5GONA 3PQEA 1NVGA 3VZSA 1FFXA 2OHIA 2A7XA 4NYJQ 1YRHA 2XA1A 3KELA 4JLPA 2XF8A 5CXSA 2DR3A 3WBJA 2UYCA 1TT5A 2XDWA 3ZWVA 1JBEA 1JZTA 4LQLA 4AZ3A 2FCRA 3A0UA 2GR9A 2DWUA 2A9JA 2R7MA 5H82A 5L95A 1N5KA 3DBHA 1KXJA 1L8LA 1QZXA 5DTJA 3O9MA 3WYBA 4KQ1A 2QLTA 4BMNA 2WTXA 3RSHA 1J23A 3MGGA 1FNMA 4LOLA 3F6BX 2IDKA 4KAAA 2HA7A 5C81A 4YUXA 1NONA 4QXPA 4B71A 3Q41A 2HRZA 3UB4A 2J3HA 2K5UA 1YR8A 3ZY6A 2I4MA 3W0LB 1N3YA 1KRHA 3B9PA 1E4VA 4XLZA 3QXSA 2FB9A 4H6VA 1P6UA 1PX0A 1Y5MA 1UOPA 2GO7A 2O8NA 3R5HA 4EELA 1F7UA 3UKDA 4RJLA 1P61B 3IV9A 3PC4A 1SA0B 5DP2A 3TEMA 4AK9A 2NT3A 2OPHA 1X7XB 2G9RA 4UM9B 1RRFA 1TEXA 3WGMA 4E2YA 1AKNA 1T4BA 1Z7YA 2HHLA 2WYUA 4Q7LA 3TUZC 3TNFA 2FX5A 2HFJA 1W4AA 3ZE0B 2YWJA 1X8XA 4GI7A 1NOJA 4UM5A 3V8VA 5INTA 3DOJA 1PQ4A 3G85A 2FSVA 2C2MA 1PGQA 2X8JA 1YNSA 4PQRA 1MV5A 2OB2A 3DMTA 1QB7A 3DONA 4ZAXA 4IWYA 3LKBA 4LXTA 4MJ7A 3TOSA 8OHMA 4RMHA 4KR3A 4II2A 1M0EA 1AS3A 2EKPA 4LZZA 4ZDIA 2E48A 5MHTA 3GBVA 4M1KA 3IO3A 3DAFA 2Z8XA 3UATA 3VUFA 1XI2A 6PFKA 1GG2A 4BKPA 5C51B 2Q1SA 3IVGA 1U94A 1AKWA 4JYAB 4S1TA 5FL3A 3UVEA 3LYAA 1R5BA 4TMZA 4UFPA 3RWOA 2GAFA 4H0FA 1G60A 2IZ1A 4R9NA 1ZD5A 5BR1A 2PRZA 3K1TA 3T5AA 1RXVA 2RGRA 1X77A 3JVDA 3BL6A 5IDYA 1E9CA 1HDIA 1L3IA 1GRVA 4LJ7A 1JS1X 1TIBA 3RODA 4ZCTA 4YHBA 3LPNA 1PYGA 4NBVA 5C37A 5LLSA 2HREA 4JNKA 2NM0A 1T0IA 4ZQCB 1CD5A 1N2OA 1QX4A 1C7ZA 1Z6ZA 3IQIX 2QRKA 1GPH1 4BGVA 2WT4A 4UVDA 2X9NA 1ICIA 3DZBA 5ALMA 4HDRB 5AHRA 5GJCA 3UA3A 1YU9A 2J6CA 4D9FA 1IFXA 5E8RA 1NXTA 3BXZA 2W2MA 5JS2A 1O95A 4G6ZA 1KFJB 1TUBB 4WOKA 4A6EA 5DM4A 1T4MA 2I7CA 4NAHA 2A30A 4O2BB 3MBOA 3RI3A 1SC6A 3O8QA 2OK8A 4KWIA 1NMYA 3I2YX 1KYYA 2FFRA 2ZE5A 3FCXA 3DGEC 5AKKA 3WIOA 1QV7A 2XA2A 3OTWA 2JEZA 3GG2A 3E53A 3WLTA 4A6XA 5H9WA 1IXKA 5EHIA 2OESA 3A7DA 4UUBA 5BSTA 1ZC3A 1XRSB 4BJ1A 2CD9A 1UPFA 3F3YA 4MROA 2H1LA 2Q9AA 1MQ9A 3CF2A 1NQVA 2DSNA 1RE1A 1B3RA 2AHOA 2WZCA 4DY6A 1O94D 1QP0A 4EHDA 3A6FA 1NUAA 1OMOA 2FE4A 3I2JA 2JFZA 3WHIA 1M74A 1IY2A 1G59A 2K6GA 4YC7A 2PX3A 4R8RA 1AUVA 1BHSA 2E4VA 4AJ9A 2PMDA 1XZBA 3THWA 3DF9A 1IM5A 1ZEMA 4RKEA 1E7SA 4Y9DA 1PE0A 4AJPA 4G0UA 1HNWB 1Z2PX 2Q2NA 1LBIA 5ALQA 3DMHA 2XYRA 3PUWA 4RHYA 5AI9A 2H5IA 2A4MA 2RHJA 2ZJ6A 5GM1A 3HCPA 2YV4A 2FFQA 1H2EA 3L4BA 4HN4B 4O63O 1LJUA 4IILA 3U19A 4ARVA 4MINA 4I5GA 1NRXA 1E1RA 3RSZA 3GLGB 4PYMA 1DCTA 3U0VA 5CB4A 9ATCA 2VXCA 3C3DA 1ZFNA 3EDMA 2ZREA 1WMEA 2SKDA 4MGHA 2B3TA 1QQBA 3T41A 1IM8A 1E32A 2H51A 1L4KA 2D0OB 4AF7A 2C78A 4RFSB 5TF4A 3TQRA 4QECA 1VBFA 1W0JD 3SQDA 3M3HA 4WKNA 1IY9A 3KHSA 5ED0A 3ABQB 1SG0A 4KO4S 4Q15A 3RVPA 1UK8A 1E2FA 2VHVA 2WU0A 4MUGA 4A27A 1C0LA 1VKNA 2GEUA 3LQ1A 1VQ1A 4G07A 5EEGA 3PTZA 3U31A 1JDUA 3BBLA 2EKQA 3M89A 2ZCUA 4QYWA 4GWKA 2CNWA 3VR1A 5HTOA 2PHZA 3T3HA 2NTJA 4D0SA 1SD5A 5C18A 4TV8A 4IUYA 1OJLA 4FFWA 5ALPA 1TLTA 4HUQA 4ZK2A 1SU4A 3I5XA 1ISSA 1JLSA 4I81A 5AJHA 2VJDA 4KG7A 2ZLBA 1G8SA 2XQIA 5IC5A 5G41A 3O2QB 3ICPA 4RXUA 1XEAA 2VXOA 1WW8A 5F2OA 3NH9A 3AF6A 2W2LA 4BCDA 3Q85A 1ABEA 1M34A 1FL9A 1TI7A 4P5PA 4DS3A 1IPEA 1QHGA 3LQYA 5A9RA 3L8CA 3OZVA 2C61A 1Y8RB 1HURA 3VC7A 5T64A 1DT3A 4FMDB 5K3SA 3IILA 3WI7A 4QUEA 2J3JA 3JPYA 1IN1A 1E1LA 4D8YA 2QN6A 3R3SA 5BQFA 3G59A 2XR1A 2GPTA 1KY5A 3OLXA 3N2LA 4JT4A 4Z0HO 1EM8B 1PJ2A 4Y1GA 2HV9A 4L5IA 3JY6A 4NOKA 1HMPA 5CFRA 1R5JA 1AUPA 4FQ7A 1DLIA 4Y2RA 3P9YA 4UTRA 5CEEA 1O6ZA 3T5PA 3HLYA 2HAEA 3ELYA 4IFEA 1AJEA 4UDNA 2AJCA 4BIIA 1RYMA 3TXAA 2QTFA 1A5AB 5ECYA 2O5CA 3FB1A 1SZJG 1WHTA 2AOUA 2PFKA 3WLAA 1X8KA 2ZR7A 3KXIA 4WZAA 5LLTA 1UZMA 3UXHA 3WBFA 2WINI 5T3UA 2Q46A 2XUPA 3HJHA 1ZITA 1WQ3A 3CG4A 3E4DA 3L0IB 4TMVA 3ZE8A 3B51X 2FPPA 4AC9A 10MHA 4U7HA 3I8XA 4KO8A 2IEAA 5F2NA 1UPUA 2JI9A 1M6VA 5JH7F 1XLTC 1BHJA 3EX7C 2RHGB 1FXWA 3ORYA 1V45E 1P62B 5HIJA 5I7AA 4DT1A 4GNKA 4JR2A 3WYAA 3L7OA 1I1OA 1R3UA 2HY7A 2GCIA 2W6OA 1MC5A 3FKQA 3IRUA 1DPFA 3NW9A 4HYYA 4QUIA 1FDTA 2PS1A 2QT1A 1FNSA 4DWJA 2NADA 3SZOA 2I1VB 4EKYA 1R3DA 1YZGA 5EZ5A 1X19A 3H4VA 2FSIA 3R9IA 4RORA 4B3SB 5JH7A 1E3LA 1C0PA 1KZ9A 2AUNA 3LLMA 1PSWA 4BLVA 4F92B 4LWZA 3EVNA 4TSFA 2X8WA 1VBMA 4DTIA 1D2NA 1KNQA 3RQIA 1Z2DA 3I9FA 4QU8A 1RLMA 1A4XA 1SOAA 1VSQA 1FFDA 2QTNA 2UAGA 1YRLA 3BHJA 1ZYUA 3KUDA 4Q7JB 2WWTA 1G7TA 1O8BA 3VU3A 2VPZA 2P65A 3M0EA 1TW2A 4GLJA 4PX3A 4H1TA 2HCTA 3DYVA 2GXSA 3LBYA 2E5WA 3BSFA 1WP4A 2FDRA 2A9OA 2JGRA 2ZFUA 4YCJA 1J7JA 2JIPA 3G0OA 2C99A 1NI3A 4XB1A 3SHTA 1CEEA 2GHIA 4AX4A 4CMJA 3E9ZA 2QRMA 1ZWLA 5CT4A 1DP4A 4Q12A 3ETGA 2Q3DA 1F20A 1X1RA 3B6ZA 4IVPA 3WLOA 5LQNA 5CEFA 3ANSA 1F1JA 2XT0A 3ANNA 4NU5A 1W1IA 3ECCA 4TLLB 3O4HA 3VDXA 2XCSB 4K28A 4J2TA 3ETHA 4IDNA 1FU8A 4HLUA 1YJ8A 1JKMA 1NG1A 4Y8VA 5F5XA 2XTZA 5CT9A 1N32B 2Z6UA 2W8BB 2HPVA 2P6PA 4KXYA 3GZJA 1FSZA 2ASEA 3NATA 1BGVA 2AT1A 1GNVA 4ZOEA 3DBVO 3EK2A 3R3ZA 4IJKA 4NYJR 3G9XA 4TKLA 4WECA 5KI6A 3TUIC 2KQUA 4JUAA 2HA0A 4YRFA 2O2IA 5ALXA 1BE1A 4L02A 4D0LB 1YZYA 3DWIA 1AKUA 2HRRA 3UGTA 3AR9A 2PV7A 1T9DA 2C2GA 2HMWA 3DVRX 1CHDA 3JX9A 3OFKA 3QVGA 1JG6A 1YE5A 4YR7A 3ZCTA 5FPHA 1YCDA 4J90A 3H3XA 4RJJA 3EC2A 4R1UA 3LF2A 4UNSA 2O52A 4YCLA 3U26A 3HJFA 1E0AA 3U5ZB 2DQZA 1ZNZA 4BP3A 3HCOA 3C4JA 3OU7A 1MIOA 4G4JA 3V4LA 4G5QA 3O91A 3OOYA 3N86A 3R5TA 1W9HA 1YCGA 2H1FA 4J76A 4NFLA 4JJ8A 3M6XA 4MEAA 3M81A 3T7AA 3CZCA 5IBRA 4UAJA 3L5OA 2IZ0A 2BGLA 3M4ZA 3LIIA 4K1XA 4BJ5A 3Q3VA 4MDFA 3EC7A 5KVVA 3SQXA 4Q4AB 1YZNA 5DU2A 3PVZA 5THQA 3DW3X 1IN5A 3KT8A 3R7BA 3BQMB 3CKKA 3WISA 4GVXA 5CCEA 5FOTA 4EMSA 1PK8A 3DAPA 2E6UX 2PUHA 3EJWA 3LWNA 4KYVA 1ULAA 2NUTA 4BLQA 3QFRA 1BE8A 3NBQA 3AU8A 1BA3A 4QOIA 1W2WB 5AVTA 5I9TA 1JQAA 3LCVB 4S1OA 2OBBA 6REQA 3RAGA 1HQDA 1SQ0A 2X0JA 3O94A 2AMVA 3RC9A 3ILYA 4BQIA 1ZK0A 1AS0A 3OPXA 1WULS 3FETA 4R5MA 4R9RA 3UH0A 4LFAB 4YQZA 2BBSA 1QU2A 1PS0A 4NNOA 4OJKA 3TOXA 2X6TA 1KTIA 1POXA 1ZO8A 3CLSD 3ZZUA 1C7JA 1JA1A 3W7AA 4W1QA 4FYWA 1HL7A 2O4UX 4ZAZA 2PZLA 4GR5A 5KOHB 4JX8A 2EKBA 4ZMBA 2O8CB 1XK7A 1V25A 3IMEA 4NAVA 2VYVD 1BEZA 5TIIA 1NVTA 3C6BA 2K7FA 3PF9A 4Y2JA 1V11A 4NFHA 1H5NA 5D85A 4O4JA 2P62A 1NVUQ 2FG6C 5AR1A 2G1KA 1T9GS 4Q93A 1BE0A 3O9VA 4R2LA 4HPWA 1O1YA 3DUWA 5BYJA 2I3AA 5LA6B 5IYZA 3IAM6 3RC1A 1K92A 2OAQ1 1IBSA 4UVHA 5IANA 1KF0A 1SVLA 4NR0A 3HDYA 2G28A 2Y9PB 3LBIA 4RZ3A 3GW8A 3EXFB 2GEKA 3ZE6A 4RTKA 2XYGA 1MO3A 4PZPA 3H9GA 5CRIA 5D51S 1NVAA 2FRDC 5C1IA 3WP0A 3P9IA 3LPLA 3QE9Y 2QYTA 2OLJA 1UBFA 4G63A 2V03A 3FCYA 2UUCB 4GBED 1O96B 1ZX1A 2P75A 3I76A 3OEED 3R3YA 2EARA 2VSNA 4U9IS 1RJDA 4M6WA 5FQNA 4M9UA 4OLBA 2RBKA 4TTQA 2C03A 1CHNA 3EG9A 4CKWB 1SY7A 2GZ2A 5CU7A 4BBJA 2OO7A 3F4KA 1DB3A 1UEXC 4HEA1 5AWFC 4TT3D 4QQNA 1V5FA 3IT0A 1QOQB 1YZTA 3W6PA 2ZJOA 3DS8A 4KFRA 5EPOA 3N8NA 5F33A 4M21A 4KMSA 4PFJA 2WOJA 4QPJC 5JG7A 3A3PA 1RACA 2VH2A 4B3XA 2WQ6A 1HX7A 1VMIA 5AJVB 3D6MA 3HBLA 4XIIA 5DM0A 4A4DA 5AVYA 3O3MB 3OKAA 2B9EA 5L3SA 2ZYDA 3ZWCA 1DQSA 1WOMA 2ACVA 4HL6A 4P7BA 2JKVA 4IF4A 3M6FA 1XZGA 3EE6A 3I3SR 1U2TA 3K6JA 4BO1A 1IMOA 4ER6A 4ES6A 5KSZA 3UYLA 4DG5A 3FBGA 3AY0A 3DQZA 1Q77A 2X4IA 2XA9A 3MOGA 5DB4A 1VOTA 3OZUA 1OAOA 4JQZA 4KX3A 4BTEA 1TUGA 2V6FA 1DDGA 5PGMA 5A3VA 4G5HA 3QEJA 4QNRA 1W1WA 1AA6A 4FJ1A 4D9JA 2D1SA 1YI8A 1ZIOA 4RE6A 5EKXA 1SK8A 3LCUA 3GO4A 3ON5A 3VR2A 3K9CA 4NYIQ 3V1UA 3PITA 4RDCA 5AK5A 1BROA 5B37A 2QMZA 3AILA 2ZBFA 1PJLA 1ZUIA 3S5JA 3H7IA 3L7BA 4IDOA 3HA7A 2HSGA 4OKSA 3JALB 1L7BA 1E9BA 1Q57A 2JH9A 2Q3FA 1SHUX 2JD0A 1YL6A 1ZAYA 3C39A 1RRCA 4L4SA 1KE1A 3ER9A 2AG6A 4B79A 2A0YA 4N6NA 4B17A 3IDAA 1ISIA 4FSDA 1RBMA 3AETB 3G2PA 3MEQA 5DGTA 2ZBRA 4BV8A 1WZ2A 1I3NA 5I01A 1T8YA 3GCGA 2ZRLA 4N48A 2JZCA 1WR8A 2H52A 3MD0A 4LNUA 5B7PA 2J0QA 5LOVA 1C5KA 2ECQA 3IEUA 1JQEA 2IP1A 5F73A 1ABBA 1A9RA 2PUEA 4F4FA 3RVJA 4WFQA 1E5QA 2GHRA 1Q95A 2HK9A 2OCIA 3Q87B 4HWRA 2X9GA 4PZ0A 2IS1A 4QNNA 1E89A 2QXUA 3I30X 3NBMA 4RMGA 3TTYA 2A0KA 1XT6A 3RBAA 4WXYB 3FLBA 1U0OC 3GAMA 3V8EA 4GVPA 4QFDA 1FFGA 4ZV9A 2H08A 5TQ0B 1ODTC 5TLSA 4G5GA 5HXAA 1HSOA 2O20A 2Z4SA 3NMUF 3L8GA 3CLTD 4YMVA 1B41A 3DWGA 3IBSA 4BQSA 3U7GA 3BJRA 2FETA 3PX3A 3GBSA 3QLTA 1P5ZB 4QVKA 4Y7DA 4Q02A 5DGXA 5T3YA 4DZRA 2DE0X 5EJ4A 1T1SA 1YK1A 2IPXA 4E5PA 3U4MA 3NALA 3RYHA 1EGQA 1IOVA 4BTVA 3E05A 2JDIA 4O2BF 3DZKA 4PLGA 3O8OA 2O0HA 2UXCB 1JLMA 3WX0A 4DEVA 1SHKA 4CXMA 2FZWA 1IWPB 2E55A 4IDEA 3SXUB 5EC8A 2CXXA 3AF0A 2ID7A 1KPGA 1QFSA 4TVSA 4KHPB 2D06A 1RJ9A 2GMWA 2UUOA 3EGVA 3FWYA 3QV2A 4EKDA 4DIKA 1NUQA 1MVOA 4D9HA 3GZNB 4PZAA 4E2XA 3I5UA 4EBBA 4CWAA 5BNTA 2DQKA 1NN0A 1MEJA 3U9SA 1QO0A 5I9SA 5BT9A 2C3MA 2CMKA 1JHYA 4IDGA 2GBPA 1F1BA 1YQUA 1YULA 2GN6A 5I4BA 5AW1A 4TS1A 1NBAA 1K9VF 3FI0A 2MTBA 5K0NA 4F8EA 1N0WA 5A1JA 4RIFA 4NICA 1T4DA 3GPBA 2AWOA 1NUPA 1IBRA 2Y1DA 3IBYA 4Y3UA 1D8TA 3FNGA 3D0OA 3E5HA 1E1QA 1H3FA 3SWWA 2WLTA 4JQSA 4PINA 1UMBA 5AXCA 5FIUA 4NG5A 2AQIA 3WRXC 5MFZA 3WTCA 1F2TB 3GEMA 4C0HA 1O9HA 1XHLA 3H2GA 3HCBA 1ZISA 4FD2A 3MWLA 4C3VA 3ADPA 3LUCA 4PHHA 3FUWA 3NAMA 2AYZA 3KYJB 2VQFB 1VSTA 1WMDA 2JANA 3IGFA 4XFJA 2O23A 2H06A 2ONKA 4X7RA 5FBKA 3L7LA 3CEJA 2I7VA 2DP4E 1WU7A 2TMKA 1JMVA 2HOQA 1UPCA 3Q98A 2AQ8A 3ENWA 4E5SA 3PGA1 3UPTA 2HDHA 2Q7XA 3IEXA 5K20A 1JEYA 4X1KA 3CTMA 4A0QA 3QG5A 3D4IA 4H0CA 4PU0A 2QW0X 2GCOB 3OJWA 3F4LA 5FLKA 3ANLA 2WJ6A 5CT6A 2MWMA 3ICWA 4V0ME 3QYFA 3INTA 1FE8A 4AICA 4AS2A 1RP1A 2WIAA 1MJFA 2QSUA 3HB5X 3CC8A 1TAGA 2QN8A 3UMJA 1KYTA 4PAMA 5DM60 4F11A 5HF6A 3WXMA 1J42A 1ZM2A 4B85A 2GESA 2GFQA 4O4IF 1Z0DA 1BH6A 2R1TB 3O0DA 4OOEA 4WINA 4ESEA 3L9XA 4FYMA 5LB4A 4D57A 4QZVA 3R5SA 3KHKA 4B7AA 5KSPA 1NULA 2IHTA 3AONB 1H0SA 4Z49A 2XOKD 4PFSA 2I3ZA 3IPXA 2WM9B 3BHNA 3KSRA 2BEWB 4LDZA 4NJOA 4LFCB 2FTKE 3PFHA 4HDKA 4WHMA 3P9PA 4FMDF 4GLOA 1T2EA 1XZQA 5K09A 1H1DA 1AHIA 3D3NA 3QLEA 2PSSA 2RKOA 4CUKA 1J1UA 1EVJA 4L8WB 3QPDA 3TAXA 1QH1A 5KU1A 5DX1A 2CLFB 2O2DA 5CFLA 4DUZB 2X0IA 3JAMA 3ZDRA 2UXBB 2JJ8A 3KTFA 1F0PA 1CX9B 1JLHA 3LH5A 3FG9A 3QXHA 1TT7A 4AJJA 4A92A 2X5XA 3P9SA 3G68A 3IPCA 3QKTA 3PIIA 4M0EA 1CS0A 1TZCA 5B2EA 3I0NA 1VMKA 1ND6A 4A15A 2J87A 2NZYA 5AXAA 1CQZA 2BEVA 1JRLA 2FWJA 2H2IA 2XGGA 3VR4A 3SSMA 2J08A 1OY1A 4HADA 1X1QA 3GLRA 2AXPA 4E22A 4LCJA 4CDGA 3PGKA 2C0PA 2NPOA 4WK0B 3UJ3X 4KQ9A 4NV0A 3GCZA 4Y9TA 5EWLA 4GMKA 5T6BA 2WFLA 4BIMA 1DKNA 3ASZA 1ACLA 2HADA 3BGIA 4HGOA 4XGNA 4BNVA 2GJ9A 2QX4A 4PZYA 4X20A 4CV2A 4WRRA 4CMIA 5BMVB 1G2IA 3TM5A 2IE8A 4PLCA 2DH5A 3JQEA 4I1SA 5AOBA 5I48A 3AKZA 1V35A 1FQJA 1M1ZA 1G1AA 2BKEA 5EVCA 1UAAA 1N8NA 1WAMA 3TPCA 3FNFA 2XMCA 4R40A 3GP5A 3VO9A 1JIXA 4BZXA 2QG6A 1N6HA 4BYMA 2AOVA 4ZVPA 2FPIB 1OUMA 1XZHA 2I87A 4D9BA 4O4LF 1K5PA 4RK5A 1K75A 4N9QA 1V7PC 2NU6B 3UMRA 4C08A 4IXTA 1B1AA 3IKJA 3AG6A 3AF2A 3AB8A 4P3KA 4K0KB 2A9VA 5EYPB 1RWXA 1LW6E 1NA5A 4RABA 5IJWA 3A4VA 2REXB 4ZKDA 4Y1RA 1YIDA 2AX3A 5SYAA 3TCXB 4B48A 2IKQA 1FP1D 3DA8A 2H59A 1TEVA 1WJGA 1UJMA 2B9VA 2IW3A 4XQ0A 4QARA 1ZIYA 4Q3OA 4INAA 3JQ8A 3IE1A 1ADJA 2YXBA 3LSTA 3F5DA 3K1ZA 2BZ0A 4WV3A 3U7FB 2ACEA 1NP6A 1AUQA 1G21E 2QE6A 3IR7A 4LSMA 1J25A 2ZTMA 4WUTA 4BQQA 1VP3A 1TM3E 5DLQC 3DZJA 4LZOA 2H1OA 2Z30A 5EWJB 2I34A 1KO8A 1V5WA 1NKSA 1U8XX 2C58A 2NVUA 3BX1A 4AIRA 3EASA 1H3EA 4JT8A 1D6JA 2O2EA 4RPJA 4C2AA 3ILXA 3RVBA 5HK9A 3QEBZ 4FDUA 2E7ZA 1EFAA 2ZP1A 2BMDA 3HZZA 3QVVA 1ESCA 1PSDA 1U7DA 2V4MA 2ZSDA 5GQSA 4ZZ2A 4PHFA 4HNQA 2J5RA 4WQMA 4QXRA 1XDDA 3MUOA 3AI7A 4M0DA 5K5EA 3PG5A 1QC5A 3O83A 1GY8A 1EHYA 1LRKA 3AJDA 2AE2A 4J0DA 3LW8A 3P32A 2C5HA 1KR2A 4X90A 4R8MA 5H5JA 4NE2A 2VTKA 1HTTA 1G20E 3Q9UA 3NWJA 4P4LA 1MO2A 1ISMA 1FTYA 5KOJA 1ACJA 3NX4A 3CZ5A 1N0HA 3E4CA 4V0KA 2CHGA 4ZXFA 3BBPA 2CDAA 2XCUA 4J91A 1X92A 4Q7EA 1JDSA 1U8FO 3RROA 3MBKA 4AMVA 2PT5A 3PC3A 2EQBA 3I73A 4LRQA 4A26A 4DLTA 1LKZA 4XFDA 5CFQA 5CLHA 4NBSA 5HGXA 1E9DA 1ZMBA 2AKYA 4U7JA 3EZ9A 4ZHQF 1ZEJA 1YD7A 2UZ0A 1PV1A 5G0UA 2GZ1A 2I22A 3BIXA 4YRDA 1DHRA 3T1HB 3CNNA 5J3JA 4DIUA 2Z57A 2NUBA 4LVNA 2H85A 5EFOA 3FOFC 1U7XA 3DV0B 3T8YA 2YINC 3IPRA 5AUPB 2VZ9A 4XPZA 8AT1A 4MLDA 1CQIA 1II9A 1T43A 5L6LB 4NYIR 2D3TA 2HI0A 1QRAA 2WPDA 4G1VA 4H7KA 2BM0A 4HZUA 2OZKA 1H9CA 2CGEA 1DC8A 3ZH2A 2Y0DA 3N5KA 4NJEB 3KYDB 3U3KA 1S1MA 1GITA 4L9AA 3HDTA 5JAMA 3RTDA 3HB4X 2O2ZA 4ZKEA 1CUAA 2V7EA 2Z9DA 4P86A 3BMCA 2XBMA 5BN3B 4QFBA 5J4KA 2FW9A 4MYSA 1EWTA 2J6IA 4TS4A 2Q4TA 3DEKA 3GP3A 4WLUA 3F7TA 4NBWA 1GL9B 2DAPA 3KHUA 5LP6B 1N2ZA 1M83A 3EMKA 4B45A 2WWIA 3ILSA 1CUWA 1RYFA 2Y71A 2PRYA 2XUOA 3CRRA 4GP6A 2FHPA 1E6LA 1NBMA 3BXEA 4L6IA 4TN1A 3N2EA 1L4MA 1X2EA 3WJ7A 3U16A 4N03A 2ZI3A 4JLKA 1MJGA 1OILA 2GBIA 1FDIA 3GFPA 1WABA 3KE9A 3KOYA 4O4HA 1QTNA 2VP2A 3MIIA 4LSWA 4MRAA 3RM3A 4YUWA 4CHTA 3FDIA 3AESA 1G4AE 3MCAA 4OHRA 1ZQ9A 5K8JB 3VNAA 4BMXA 1TKAA 3QVSA 2D2VA 2Y1OA 1U9JA 1QHHB 5DHAA 5IX8A 1T36A 2DC1A 4PGFA 4LBWA 4D81A 3W3AA 1XRJA 1IUOA 1IZZA 2GLXA 2Q6LA 3F1KA 4HXGA 1V16B 3U4AA 3KZKA 3WNZA 1N33B 1GSAA 2IYOA 1NUTA 2IHJA 1MABA 1H8HA 1CLEA 4GXQA 5GY7A 5I7VA 3THYB 2XXAA 1B00A 2QDKA 4NSNA 1R2QA 4V0RA 3J7AC 4HX9A 4R9UC 1N8KA 1C50A 2Q2OA 1T6YA 3E2IA 1BOOA 2XXJA 4MARA 4O2AB 1PR3A 5CH3A 3A1UA 3TSYA 4S24A 1C1DB 1ZKDA 3HCRA 1DIGA 1WM1A 2PLRA 5CCXA 3RT1A 1GPJA 1GQ2A 1PZFA 1UL1X 4K8RB 4I46A 4E51A 2H0RA 2NN3C 3HBJA 4HLCA 1M1NA 1R4MB 4TZ0A 2DXIA 2C9BA 3DCYA 1C29B 1TEHA 2C5FA 3AEUB 3OPYB 4K9SA 2QNBA 4G26A 2ZAOA 4DR1B 3GXOA 3VDMA 1KJJA 1XCGB 3N2GA 1Y63A 2VRNA 4FQ5A 4MGIR 4XYGA 3ZW7A 4OF4A 4B80A 2D62A 5M29A 4LRTB 3SYMA 4OLFA 3BXHA 1H93A 3CX3A 5TV2A 1G7SA 5L9AA 3NHMA 2R00C 4QM6A 3MXTA 2XECA 5B3JA 1WQ4A 3NC0C 4L51A 3ZW9A 1WUHS 5LYJB 4HAOA 4CKZA 3QI2A 4Z0TA 1S4MA 2P0AA 1Y3BE 3L8MA 5ILOA 4LFBB 1ZJZA 1JSXA 2JHCA 1XCJA 3Q1KA 1RQNA 4K40A 4MQLA 4EQ6A 1BMDA 5HTKA 1X13A 1U9IA 1Y3CE 2EZUA 2WHRA 3ELWA 1P7CA 3OH8A 3UB2A 1DJMA 1N5IA 3LPAA 4OXNA 2WZDA 1T6XA 4YAIA 2B94A 4BN4A 4KR6A 4AUKA 4G01B 3B1KA 4PONA 4A1FA 5KQSA 4KNYA 3EH1A 1J24A 3GEGA 3R09A 3DBRA 1OYWA 3BD9A 3FSRA 2VHYA 3G8BA 4P80A 1DEHA 4J0QA 3CCBA 1CY6A 4LA4A 3K70D 2DULA 1CR2A 3ZCPA 3TMKA 4ILKA 5ICSA 1H8EA 5BOVA 3RRFA 2OFXA 2PUFA 1KARA 3AJ8A 5FP0A 1IAQA 1C41A 3U7HB 1O08A 4HNSA 1VLLA 1XD9A 1E2KA 1F8GA 1UXOA 3DCIA 2CVPA 1QZTA 2KI5A 2QMUA 4OCZA 1RAGA 2GAJA 2C4VA 3E35A 1SCUA 4JJIA 4Y2UA 1BW9A 4MB0A 1L6RA 3AKYA 3A32A 1CZRA 3VZCA 1E9RA 5AKLA 4ARBA 5BNZA 3ESBA 3UAOA 2QRJA 2R4TA 3AZOA 3ZDAA 3VR3A 2P4HX 4FXPA 3O74A 4DBVO 4PFQA 2VPYA 1T0PA 2AUTA 3LRXA 2B1JA 1TO1E 1DIBA 2GASA 1GZVA 1W1UA 4H3KB 4OVKA 1IDOA 1IDN1 2QRZA 4M88A 4P3OA 4V02A 4W8OA 4F5YA 2B2XA 1GNSA 4CTKA 5JNVA 2YRFA 4FXOA 1SKAA 5AI6A 4YAJA 2AG8A 1QO9A 3AR4A 5JMWA 2P3QA 2FMFA 4A6PA 1PL7A 4XDYA 1N2BA 3BWDD 4H60A 4UHHA 1REQA 1I7LA 1G5IA 4N47A 4P7GA 2R85A 5TMEA 3DFUA 4GZMA 2BGMA 2WIBA 3HY4A 1RLIA 1Y6RA 3PFBA 4MP8A 5AKEA 3EEFA 5CJ2A 4WAUA 1L8OA 2CXUA 4FYYA 1Q50A 1XOIA 1JDTA 4UXJA 5CURA 3MNFA 3KDSE 4JKYA 3ZHXA 4YMGA 5KPJA 4GQAA 3PQ8A 4HNVA 2WIDA 4QELA 1K2WA 3QX9A 4FYVA 4KNVA 3A6EA 1GVHA 2C92A 1WDLA 2ZK7A 4FQ8A 4IDBA 4IS3A 4DZTA 3S8EA 3UA4A 1I24A 1AMOA 1ZVKA 5ALTA 2X1VA 3VKUA 4CTMA 1CYEA 2H00A 3PD7A 1KZ1A 4CI9A 5HCIA 4BCCA 2F43B 2P5SA 3NYWA 5KSYA 5KTYA 5CYGA 1IB6A 2P2DA 2WJWA 5AJZA 4BUZA 3ZHQA 2DQ4A 1GAQA 1E9EA 2HU7A 4MVJF 3S28A 1ZCFA 4B32A 1KOGA 1QFYA 3GJ4A 3UUEA 4IIJF 1CY0A 3ESCA 1VG0B 4QULA 5J2TA 1SC9A 1T4GA 5K3AA 1KPIA 2A3NA 2G4VA 2EYQA 2WIKA 3GC6A 4L0MA 5G4LA 1EX1A 4B3BA 3NT4A 2ZYAA 4EYSA 3ZHZA 3UFBA 4D4JA 2NXWA 1BG6A 5CJJA 3HG7A 1H6DA 3E3LA 4HHEA 4YBRA 1CPYA 3X1XA 1GUBA 5MN6A 3GN2A 2XKAA 3R0IA 1OB5A 1PV4A 2CCKA 4QEZA 3Q9SA 3A27A 1KOLA 4IOLA 3MQ2A 4OI2A 1OXKB 1VSVA 1P4HA 3CUSA 3VPXA 4BFTA 1L5OA 3HV0A 3PRJA 3ERCA 3LI2A 2OHVA 1RAAA 3TW0A 5IBPA 4R2WA 3QU4A 4DL9A 4F2PA 5HJ5A 1PFWA 3ANYB 3FDFA 4OBWA 4UD2A 1SRQA 1JT9A 1XLVA 3OP4A 3TKLA 2WD7B 5A7FA 1OBVA 1XMIA 2PD3A 4AG3A 3QVTA 4EHHA 5EUBA 3SLKA 5CK4A 4BKQA 2VJQA 5FYDA 4A5OA 5LQAA 2BKAA 1U28C 2IIQA 4FLMA 4LHWA 3RSFA 1GADO 2CJPA 4EYGA 1E4OA 3HKBA 3VZPA 2GKOA 4K9RA 5HR5A 5CVEA 5LDDC 4LF5B 3ORSA 2Y27A 4LC1A 4DSZA 3USZA 3ZV7A 3CKMA 3SF8A 3X1JA 4U8HA 5KTKA 2VC2B 3WBBA 1ORTA 4E5VA 1YS9A 1UWCA 1TU3A 4R8VA 4JGIA 4O1IA 1NSFA 2FPUA 2Z3ZA 1ZKMA 5JRDS 3UB3A 3MB8A 4L4UA 4ZVRA 1CYDA 4EI8A 3H5TA 3A26A 3CWCA 4XWAA 5TVKA 1CRPA 1FX1A 1THZA 4BO0A 1LV7A 2VZ8A 3CUWA 4CTOA 2GBFA 4EY7A 3DPIA 5EQJB 3QLJA 3RWBA 3A28A 3WAJA 2GTHA 3LOQA 1NNUA 3NVMB 1CUFA 1EIWA 3VNQA 3ISTA 1F06A 1PEKE 3TX6A 5A3JA 4Q16A 4G5OA 4A3SA 3OTIA 1USKA 3RIGA 1O03A 3AP3A 2R8RA 3DOCA 4OGWA 1DXQA 4WFKA 3CF6R 4RW0A 3E1GA 2FE1A 4B87A 2QJFA 3EF1A 1M2OA 2DHDA 2ZSIA 4F06A 1B6GA 4FMBB 3BE4A 2WICA 1M2GA 5ARDA 2O7RA 2HZ7A 2M98A 2H48A 4CM4B 5ADVA 1X7WB 1Y37A 4ZAWA 1W5TA 1T8WA 4E03A 4YJ3B 3PC7A 2AL7A 4OGKA 1NR5A 5DI9A 3RKSA 5E0KB 2QMYA 1MQSA 2VXBA 3DVQX 3AEYA 3QMVA 4L5AA 4P36A 1Z08A 2QMHA 3E61A 3QZUA 4YX9A 1KFEB 1G8FA 3CVOA 3K09C 3VPBA 3E9MA 3OT4A 2ZRIA 3KJFA 1SVUA 2OAEA 4RV9A 1YZLA 1DAHA 2FPRA 2XYQA 3MTQA 4XR4A 4Y7CA 1P9NA 3X1YA 1XTKA 1C2TA 3I5MA 4GT1A 5BMVF 4NDZA 4B7UA 2EAUA 4EMBA 2QB5A 2C7OA 4U5QA 1VHQA 5CHYA 4DYVA 2ADMA 2GDJA 3G1TA 4CI0B 3QUTA 1E3IA 1NFFA 1TJPB 3DOIA 4XI9A 3UG6A 1TECE 1P72A 1UXJA 3GD7A 1C7IA 1WD7A 2JFQA 3L0SA 3H19A 4JVSB 2C9DA 4DA0A 5HIAA 4AURA 3UC5A 5KYGA 1ST3A 1Z5WA 2ODPA 1BAPA 1DL5A 3MILA 4TRMA 2R8EA 1CY4A 4L2IA 4R98A 4TSRA 2VK2A 5D2CA 4YMHA 2A59A 2VSFA 3OKPA 2DECA 3P2MA 2G88A 4C7XA 1EE9A 3BRWA 3RSOA 1EXNA 1P80A 4RAQA 1C9DB 4IQ0A 1CQJB 3HGQA 4IJMA 4QWWA 1JHQA 1QK4A 2NU9B 5JJIA 2V65A 1UZNA 2ZTHA 3CKYA 1JJFA 1PN3A 5CNMA 4ENPA 1AN9A 5IT9A 4JELA 2XQJA 1D1TA 2DPLA 1AOXA 4R84A 1A2BA 5FFNA 3PQ6A 3SHVA 4HT3B 5CXXA 1U9YA 5JS1A 2PMBA 1QRUA 1Z7GA 5ALIA 3NM5A 2I4TA 3I32A 1GT6A 1L5MA 3VO2A 1JVNA 3QA3E 3EEYA 1MW8X 4MDHA 3SHQA 3MJDA 1KJIA 1IBMB 1K7EB 1G4UR 1J7KA 3SQWA 5IZCA 2CMHA 3B5JA 3V6LA 5JC8A 1LZKA 1IPFA 4ND8B 4MAFA 2MIIA 3OFNA 3LC7O 3TLBA 1ZOPA 4K6HA 2JLYA 4C76A 1LY1A 4A16A 1W0KA 3IALA 2IDZA 3LWBA 1NX9A 4Y0AA 5BRJA 1G16A 2YHBA 3KKQA 4LYFA 4MZDA 2BVNA 1OX6A 4U7WA 2FPMA 3REQA 1HE5A 4IJQA 5FPQA 4DXAA 1N3IA 3WV4A 5IT0A 3QEMA 1Z88A 2HHHB 3AKEA 1Q0SA 2D1TA 1Z9BA 3V42A 3AL3A 1T1RA 3OY2A 2A5YB 4KGZA 2FG5A 5GJBA 2ZUDA 4Q47A 2OKGA 1FOEB 5ENDA 4TXMA 1XB2A 2DFTA 2XBLA 1KKMA 3VDRA 1EINA 1USWA 2VZEA 3FBWA 3CPHA 1JTFA 2P1DA 3W4IA 3M2TA 2CVHA 3I92A 1G9SA 2AFIA 4N54A 3OU6A 1ULUA 4IDAA 1FUIA 2Q6TA 3QJYA 1AQUA 3WHPA 1YOVB 2O8DA 1FUUA 3WGZA 3ZKWB 4DDMA 4RMJA 2JKYA 3DWFA 4P3PA 4EUSA 1V7ZA 1UK9A 3MG9A 5KNBH 2I91A 3DVAA 3H75A 4WZZA 4MPTA 2FYTA 4Z1MD 2P7HA 3SBEA 5JS8A 2ALJA 1LDEA 1SIBE 4NNJA 2ZXUA 1ZXXA 2DFDA 3GFSA 3W8EA 2PTGA 3AF1A 3HR4A 1OGIA 3OA2A 1LS6A 2IUEA 2QSZA 3ESQA 1JHPA 4CM8B 2BPOA 1O6CA 3AM5A 3LT1A 5LMNB 3EVDA 3T1YB 4QX6A 1UXGA 3MS4A 4P0QB 3SQLA 1W29A 2OC4A 2EERA 2WP0A 1Z62A 1OB2A 4BZQA 1J00A 2IIPA 1XELA 2R1VB 3D0RA 1YVRA 5D87A 3JYPA 5BV2P 4NQZA 1ZSYA 2GS9A 2HO4A 3HWWA 4AMBA 2H5LA 3E5MA 5KKAA 1JG4A 1AXRA 1X1BA