4BTVA

Structure of phaz7 phb depolymerase in complex with 3hb trimer
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
344
structure length
330
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHAMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNAAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAYNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
total genus 125
structure length 330
sequence length 344
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4btvA00
2WU4A 4PV7A 4DSZA 4U2BA 4U2CA 2GBFA 3H2GA 4HXEB 2DR0A 1GQRA 3FYUB 4H7JA 1YSCA 3STTA 5K3EA 5HFNA 1EH5A 5JD4A 2WIGA 1THGA 2RIPA 1GPKA 5FOQA 4X85A 2C4HA 3HI4A 1UKBA 1YA8A 1VOTA 4OB6A 1MAAA 3AILA 5HKBA 3BJMA 2B4KA 1ORWA 2XUAA 4WY5A 4K6HA 2XMRA 4KAFA 4IH1A 1ACLA 5EI5A 1K4YA 2HHAA 2WTMA 3D7RA 2WUGA 2DQZA 4X3CA 5H3HA 4GW3A 3UUFA 1UK9A 2JBWA 2Z3WA 5CT4A 1W4LA 3E0XA 4WFKA 1AQLA 2D5LA 3UUEA 1ZGCA 4DIUA 1DWPA 3M83A 2OGSA 2XQKA 4D9JA 4UFPA 1BN6A 3T52A 3I1IA 3I6MA 2PPLA 4Y9SA 4ITVA 4ZRDA 2O7VA 3A2MA 5K3BA 2VJAA 2C5FA 5ALJA 4G9EA 5DNVA 2XUGA 1P0IA 3PF8A 2J3QA 4FFWA 5AKHA 6YASA 3WL7A 3WIBA 1YASA 1W1IA 1CQWA 3BJRA 2R8BA 4FOLA 5CXUA 5JZ9A 4U2GA 4FLFA 2Z3ZA 2OG1A 1R9MA 5CMLA 5IH7A 1XROA 4BCDA 3R3WA 2WJ3A 4H7IA 5ALOA 3AFIA 1QFSA 2RAUA 4BVLA 3EQ7A 5DNWA 5BWCA 5FDFA 2WG0A 2WHQA 3BIWA 4W9RA 3M82A 4EB0A 2JGMA 1MTZA 4X6UA 3WKCA 1ISPA 3HXKA 3HC7A 3NOXA 5DJ5A 5AM2A 1PV1A 1L7AA 1A8SA 1IZ8A 2HFJA 3F9CA 1G66A 4RNCA 1GKLA 1E66A 3LIIA 3WYDA 1TQHA 5AJHA 1ZD3A 4GLBA 2XUKA 3NWOA 1P0PA 1XRRA 4EHBA 2HU5A 4X90A 2CMFA 5EIEA 3NUZA 5AI4A 2PUHA 3DKRA 2I3DA 4JUIA 4DMFA 4F60A 2QMQA 4AQDA 3GROA 4A5SA 1LPSA 3RK4A 1ZOIA 2YASA 3ANSA 2QXTA 5A7HA 3R3UA 5A6VA 3FCXA 5I7UA 1BU8A 2I78A 4HXGA 5EFZA 5AIAA 5AOBA 2LIPA 1YCDA 3V1KA 5DWDA 2XUOA 3WMRA 1AMNA 3WJ1A 5AK5A 5AI9A 5ALGA 5DNUA 1XRPA 5HZGA 2ZYHA 5K3CA 1A7UA 4A23A 4J0CA 4KE9A 1XZEA 2PSDA 3FOBA 2QT9A 1EXWA 2QRUA 3YASA 4W63A 5LKAA 2X8BA 4PSCA 4C4YA 1C4XA 4DLNA 1XZAA 4K2AA 1X2EA 3WZMA 4DM7A 1W75A 1ZGBA 4J0KA 2HU8A 4E11A 4JH0A 2GZRA 1R50A 5IVHA 1UFOA 1THTA 4YK7A 4AO7A 1G4HA 3IUNA 1JJIA 4C88A 5AM1A 3P2MA 2H7YA 2WIJA 3HEAA 4C89A 3QPAA 3MGAA 4B0PA 3DQZA 2WQZA 4AX4A 4B9EA 1A8QA 4IH4A 5T4HA 3H2IA 5CBKA 3G9XA 4QDTA 2JGJA 3FSGD 2OQIA 4ZV9A 1JI3A 1CV2A 4QDZA 3G7NA 2DQYA 2XUHA 1AX9A 4OU5A 1BEZA 1KU6A 2DFPA 4J0IA 4CI9A 1XRQA 4OB8A 3G0GA 3LIPA 3WL5A 1AZWA 4FFVA 5AK4A 1DX4A 1YS2X 3OG9A 2RHWA 1FFCA 5A7FA 3HLKA 4WDRA 1LPMA 4CG1A 1CUJA 2OGTA 1ZIXA 3M81A 4GDMA 1QIJA 3G0DA 3KWFA 4O08A 4UBMA 4G5XA 4PSUA 1HLGA 2GBGA 1EDBA 3G8YA 1IZ7A 4L3WA 2BUAA 5FPQA 5A2GA 2HA6A 4I19A 2WU3A 3L1IA 4CFSA 4B80A 5AKYA 4BCBA 4H77A 1R4ZA 5E4YA 2HL6A 2PM8A 3CCBA 3AIKA 3HACA 3FAKA 3DL4A 3K9BA 4H0CA 2UZ0A 2WFMA 4HRYA 4JEIA 1QZ3A 4UBJA 1ZD2P 2VSQA 4K6KA 4RE6A 5AKLA 4J3JA 3DOIA 1UK6A 5CW2A 2XLCA 4FMPA 2ROQA 5CTAA 2WFZA 4DTCA 4HXFB 2CB9A 4BP8A 4Q3KA 1XRMA 1L7RA 2XDWA 4FWBA 3FLEA 2IITA 4Q1VA 1PJAA 2C7BA 2YH2A 4N8DA 4AO6A 4IO0A 4IQ4A 4FTWA 3C43A 5KREA 4UUQA 2G4LA 5FV4A 2CKMA 1A88A 4QA9A 3ZV7A 2XUJA 5AHXA 1B6GA 1B41A 2QJRA 3IIIA 3R3YA 4KRXA 4UHCA 1CUCA 5JAPA 3QPDA 5JADA 5IVIA 4EBBA 4NVRA 4QZVA 1QIGA 1TCBA 2K2QB 2WUEA 2FJ0A 3FLAA 4C4ZA 1FFBA 2XI4A 2HA3A 3C45A 2WJ6A 1ZI6A 4G8BA 5ALUA 1CUWA 1HQDA 1MX5A 4U2EA 3G0CA 2XQIA 1MU0A 5ALLA 3M3DA 1XQYA 1FFEA 4ZXFA 4LXHA 1J1IA 3DDUA 2WUDA 1GZ7A 2HA2A 1JFRA 1ZIYA 4S0XA 4X92A 4BRZA 4UHDA 5E4TA 5JATA 2HRQA 2QTBA 1DTEA 3D4LA 4CIBA 1LNSA 2XUIA 1WCYA 2H7CA 4OSEA 1J2EA 3FLBA 2VEOA 4GHWA 3FVRA 3LS2A 2OXEA 3FBWA 4N5IX 2QM0A 5LZ4A 5AIBA 1VJ5A 1NU6A 5BOVA 5AKZA 5DYTA 3C5WP 2VT7A 1CQZA 2BGNA 4X71A 5ALQA 1Y37A 4H7FA 2BKLA 4X94A 4CG2A 2WM2A 1CUFA 4UHBA 5AM3A 4MXDA 3WKEA 4BP9A 4EY8A 5ALFA 2W6CX 1GKKA 3WA7A 2VJDA 5JZBA 3F8SA 3W9BA 5LZ9A 2BFNA 3U1TA 2WIDA 1TIBA 3DD5A 4X91A 2OAGA 1C7IA 1NX9A 3ED1A 2Z8ZA 4AXBA 3STYA 2BUCA 3B5EA 5HF6A 5JARA 2AJBA 4J03A 2NW6A 3N0TA 2H9YA 3G9TA 4X93A 1W6RA 1SC9A 3V9AA 1CUAA 1FFAA 1UOPA 4OYYA 1ZI8A 3H2KA 1VA4A 3FWHA 4UBNA 3WK5A 4DNFA 4XIIA 5JASA 4FLMA 4XWGA 4BC0A 4HTAA 4P93A 1TK3A 4Q82A 4XVCA 2ZSIA 5JAHA 5HF8A 1UKAA 4P9NA 1XZJA 4MYDA 2BGRA 3WK8A 3I2HA 4EY7A 1UWCA 2OCKA 2ONCA 5JAOA 1XZLA 4WFJA 4HVTA 2J4FA 4UHHA 5AM0A 3IURA 2QKYA 2PSHA 3K6KA 4B83A 3A6ZA 4HS9A 3IBTA 4G4IA 5KWJA 1CPYA 5K3DA 3IUJA 1Y7IA 4OU4A 4YPVA 1AKNA 4K6GA 3ESDA 2HRRA 3C5VA 5F4ZA 1EDEA 3BF7A 4TPKA 2EEPA 4H35A 4OB7A 4U2FA 4G9GA 4UBIA 3FYUA 1DWOA 3HZOA 3IB3A 3GUUA 1R88A 5JD6A 1QO7A 1VXRA 1ODCA 3DEAA 1JJFA 1LPAB 4A16A 1CLEA 5AI0A 4X6XA 4CCYB 5EHNA 1LPBB 1QJ4A 4X95A 4EUSA 3PI6A 1CUVA 2HA7A 3GFFA 1OCEA 1XZFA 4BVKA 3S2ZA 4JYPA 4KAJA 1XKLA 2O2HA 3F98A 4U2DA 5IVKA 2BCEA 3VDXA 1CEXA 4GECA 2XUQA 3V1MA 1GGVA 5T4BA 3O95A 3OC0A 4ROTA 1BROA 5K3AA 4KE6A 4UFOA 2X5XA 3WYNA 1G5FA 2HA4A 3IA2A 1LPOA 1JU3A 5ALVA 3GELA 4P08A 1F6WA 5AK6A 1SCIA 2P8SA 1CFJA 5D3ZA 4W1SA 1CUIA 1LZLA 4BATA 5HK8A 1TCCA 4Y2UA 5JANA 1QO9A 3BDVA 4QNNA 3ICWA 3R3ZA 3MUOA 1W76A 2ZVDA 1RWQA 4AMYA 4E15A 5A71A 3G02A 1WPXA 1Q84A 2GYWA 5AOAA 3HJUA 2VQ6A 1QONA 2V98A 1WHSA 3IDAA 1XZIA 4G4JA 3RARA 4LYDA 1SCQA 4LXIA 5CH8A 3I2FA 5ALKA 4PNZA 2WTNA 1CUXA 4WFIA 4IH9A 3F97A 1K63A 4QDXA 2J3DA 4QE3A 1HBJA 5FLKA 1WB5A 3QMWA 1XQWA 1QLWA 1JT2A 3STWA 2QZPA 2XB6A 1CUHA 2CUTA 4Q05A 4B82A 3ESCA 2OCLA 4KE8A 5HQ3B 1EVEA 2X76A 1E89A 1F8UA 4GEGA 4Y2YA 5JZSA 4KR0A 5CXXA 3I28A 2AJCA 4PSDA 1S8OA 3D2BA 2ZJ6A 1DT3A 3EBLA 4ZV7A 1CVLA 1MN6A 3V48A 3MVEA 5D3KA 2ZJ7A 1XZDA 3DYIA 4Y2SA 3TEJA 1JMKC 4JYMA 2EDCA 3G9ZA 4FBMA 3WQHA 4B9AA 2WUFA 1JKMA 4Y2QA 4Y2VA 3SWWA 1LLFA 5CH5A 3JWEA 5AKJA 1CUSA 2QUAA 1MPXA 2H1IA 4KEAA 4J0JA 1H2YA 3TGLA 1DINA 4RGYA 4Y2PA 5LZ8A 4DYHA 3F96A 4BZZA 1AUOA 1P0MA 2BJHA 4FBLA 5EGNA 1K5PA 5C81A 3ILSA 4ARBA 1E8DA 4AMZA 2WILA 1N1MA 4ZWNA 5JD5A 5LKRA 2D0DA 4J0GA 4W1RA 4IHAA 4B84A 3PUHA 2QUBA 4MWTA 3HSSA 3VXKA 4KACA 2YYSA 2I3ZA 5LZ7A 5HK9A 3D59A 1CUDA 4N8EA 3AIOA 2XMGA 4FLEA 4LXGA 4BAGA 3DL7A 1P0QA 3DNMA 3O4GA 4CIAA 5C7YA 4GXNA 3SC2A 3AIMA 3PICA 2AJLI 4LIPD 3WKDA 3MUNA 4EY6A 1DU4A 3DS8A 3ZLTA 1EK2A 3A70A 5AKGA 1C7JA 1EI9A 5BV7A 2XMDA 4BTLA 1ZJ5A 2O2IA 3H0CA 5DTIA 5FXMA 2PSEA 3QYJA 2AJ8A 2O2GA 3L1HA 1HKHA 2JGLA 1QIDA 3KXPA 3QITA 1VZ2A 3O4IA 4UBKA 2JEZA 3HYSA 1XZHA 3FSGA 3FYTA 2JGIA 1GPLA 3G0BA 4KJXA 2WHPB 5EHQA 4QEKA 1G42A 3VJMA 1XLWA 1EVQA 1BCSA 2C0QA 3KSRA 5K5EA 2GZSA 1MX1A 3FCYA 1ZICA 4X6YA 2XMBA 2BAGA 5ALHA 1VE6A 1USWA 5SYNA 1CUBA 3ZLVA 4OYLA 2HIHA 3KD2A 2XMZA 4GI1A 1XZGA 1FSSA 3DJYA 2WHPA 2FX5A 4DGQA 4P92A 5HCUA 1QIIA 5AO9A 3W9UA 2E3JA 3WL6A 2HADA 3L1JA 2JGFA 4BDTA 1VE7A 1QTRA 5DTJA 5BWBA 3TRDA 4G8CA 1U4NA 1CUGA 2DHEA 2RI6A 1IUNA 4WDQA 3D0KA 4N5HX 1IVYA 1ZJ4A 2PSJA 2XQFA 2C0PA 3C70A 1QIHA 1SCKA 3W04A 5ESRA 5AKIA 3ZPXA 4HAIA 4ARAA 4BTVA 3PFCA 2G63A 2VTVA 3E4DA 2WLSA 2HM7A 5KWIA 5ALYA 3ANTA 1LZKA 1TKRA 2AXEA 2OCIA 3AZQA 3O4JA 5YASA 1SFRA 1WHTA 4BBZA 1XFDA 5LZ2A 1LBSA 3E1GA 3Q8WA 2Y6VA 1WB4A 5ALSA 2QJWA 4I3FA 3OM8A 5AP9A 1XQXA 2ACEA 2XLBA 5IKXA 3R3XA 4NS4A 3O4HA 1MX9A 3G0IA 2PU5A 4Q34A 3I6ZA 3C6YA 3IULA 4Y2TA 3AJAA 2XQJA 3D2CA 5CT9A 1XRLA 5AOCA 1AURA 4BVJA 1MO2A 3D3NA 4DNQA 1A8UA 3CCCA 1I6WA 2XQGA 4H7DA 1H22A 1MAHA 3R41A 4FKBA 3VJLA 1N5RA 3H19A 3GZJA 4K5QA 3GBSA 1LBTA 3ESBA 2RGUA 1SOMA 3BWXA 3ZI7A 1R9NA 4DMHA 3WJ2A 4Y2RA 2GYUA 4XJVA 3JYHA 2DHDA 2QOEA 1ACJA 2WFLB 1IUOA 2GBIA 1M33A 3EIOA 4EA6A 3STXA 1QOZA 4H7HA 3IUQA 1R3DA 1WB6A 2PVSA 4YX9A 3PDCA 2WIFA 1CUYA 3BE8A 1YAJA 5FPPA 2CEKA 3OPMA 2XMSA 3E3AA 1VA5A 4J7AA 5HFAA 1VXOA 3QM1A 2OAEA 3TJMA 1O6GA 1Y7HA 3IVMA 3OURA 5T4EA 4CG3A 4UBOA 3WI7A 1XLUA 2YXPX 1QGED 5E4JA 4FHZA 4BC1A 3I2GA 3SX4A 5AICA 4UHEA 4C01A 1QFMA 5I9IA 2FJPA 2H7XA 2FUKA 3D5EA 1Q83A 2AJDA 3IUMA 1BCRA 2JF0A 5ALXA 4Y7DA 4X97A 3C6ZA 3B3QA 4BYMA 1QIFA 3WKAA 3H04A 3KWJA 4AN0A 2V96A 1UZAA 4Y2XA 3CXUA 2XMCA 2XUFA 3C8DA 3I2IA 1E8NA 4QWWA 2VAXA 4UFNA 4Y2JA 1QE3A 5D7BA 3R3VA 1MT3A 1YA4A 1CUUA 1OILA 4B81A 5C8VA 1RP1A 4MJ3A 4NMWA 5EIHA 1L7QA 4BDSA 1R1DA 2WIKA 5A7GA 2ZYIA 5JIBA 2V9ZA 3V1LA 2OLEA 5AI8A 2WKWA 4BE4A 4F21A 5AKXA 3BXPA 1GXSA 5ALNA 2I03A 5JALA 2QVBA 3V1NA 4E46A 3FVTA 4C87A 3WWPA 1MJ5A 3ZLUA 2IX9A 4OPMA 4HZGA 5AH0A 4F5ZA 1N5MA 3AZOA 1E8MA 4YASA 4KYVA 1VLQA 3B12A 5CT5A 4CCYA 3BF8A 5HF5A 5ALWA 2JGEA 3C8HA 4KAAA 5J3JA 3DYVA 1T2NA 1XQVA 2QS9A 5HF9A 3QVMA 1JJBA 2HFKA 4KE7A 2JIDA 3CN7A 4M0FA 3QMMA 3D2AA 1O6FA 4B6GA 1F0PA 3STVA 1X70A 1FJ2A 3VVMA 4AN1A 1ETHA 4WCVA 1QTIA 1MNAA 3EQ8A 2C58A 3R40A 4TVKA 1EINA 1OXMA 5C8ZA 1H2XA 3VISA 4DMCA 3H1AA 1ZI9A 2EDAA 4ZI5A 2Z8XA 5LYYA 4EY5A 4AO8A 2RHTA 3WLAA 1GQSA 4DNPA 1IMJA 4MYSA 2C5GA 3O9VA 2J4CA 3WWEA 5CT8A 2ORYA 1W52X 2VA9A 5AK3A 3R0VA 1MNQA 5HKAA 4F0JA 1YR2A 2B9VA 3WK6A 1DQZA 3WWOA 3WKBA 4FDMA 4DMKA 3WK7A 4BB0A 3S8YA 4I4CA 2B20A 1N8SA 2WSLA 2XUPA 4Z49A 3C87A 4QWMA 3STUA 4HRXA 4X00A 3FYUC 1E3QA 1XZMA 3G9UA 5ALIA 3WIOA 3KDAA 1YB7A 4G1FA 1CUZA 1GPNA 1XZCA 2RONA 2QR5A 1J06A 1YAHA 5AI6A 1TCAA 3C6BA 3T4UA 3QPCA 2CJPA 4ETWA 1CRLA 5HQ3A 3A2NA 3QZUA 3BL8A 3RLIA 3CN9A 2PBLA 5ALDA 3WK9A 4BAUA 3PFBA 1VKHA 3JW8A 3RM3A 4KRYA 5DLPA 1H2ZA 1XZKA 3AZPA 4H7KA 5ALTA 5D6OA 3F67A 3DOHA 5LZ5A 2VATA 1DQYA 4W1QA 1TRHA 2OGZA 4GBGA 5ALZA 5FKJA 1ORVA 4TGLA 1QIKA 3HABA 4UBLA 3OOSA 2VJCA 5AI5A 2XE4A 5CH3A 3W2TA 4L72A 4OCZA 1WPRA 5CURA 2B61A 2WG2A 1ZD4A 1DWQA 1ODTC 3LP5A 2O7RA 5E2IA 4QLOA 4BCCA 1TAHA 5CRIA 2PSFA 5FP0A 3WA6A 3QBJA 4QDOA 2VAVA 1JU4A 3C6XA 5EHXA 1LGYA 4Q3OA 5DYYA 1UK7A 1KEZA 2G5PA 1T4MA 1BS9A 4DNOA 5EHZA 4G4GA 2BUBA 3DLTA 3H2HA 2CBGA 4PF1A 5IVDA 2GYVA 4MEBA 2Z5GA 2PX6A 2OPHA 3DCNA 2XT0A 4L0CA 5JAUA 4AZ3A 5A62A 2VT6A 3ESAA 2ZYRA 3W06A 4BE9A 2JEYA 1XZBA 2WJ4A 4LYEA 1EA5A 3QMVA 2V97A 3Q0TA 4RE5A 4WJLA 4EY4A 3A2LA 4H18A 1H23A 1X2BA 1UK8A 4PO3X 2DCMA 1RYYA 2QXUA 4C4XA 4CCWA 5K3FB 2DSNA 2Q0XA 2ZJFA 4INZA 5JYCA 4LKOA 3X3HA 3EQ9A 1KU0A 2PKYX 4JNCA 5DYWA 1EX9A 1XRNA 1UOOA 4G8DA 2VF2A 1H2WA 2WG1A 3ICVA 1LPPA 1PFQA 3H17A 4B7ZA 2IIVA 4M0MA 4X7BA 4BAZA 4N8SA 3EF3A 4XX1A 5AM5A 1EK1A 4MEAA 5K3FA 4UPDA 3I2KA 1U2EA 1BEEA 2Y6UA 4UHFA 1EB8A 3U0VA 1UOQA 4J0DA 1GT6A 5ALPA 1DT5A 1BRTA 2PL5A 3K2IA 4V2IA 3H1BA 5EIAA 4Q3LA 1UKCA 1BE0A 2ZSHA 1UT6A 2VJBA 4PQEA 1XLVA 4MQLA 3AUKA 3BDIA 4MQMA 2CZQA 1WM1A 3LLCA 5FRDA 1WOMA 1U65A 3N2ZB 2HU7A 2PUJA 3WWCA 3VKFA 3SK0A 4OUKX 3O0DA 3NGMA 3DKKA 1EDDA 5LIPA 1YB6A 1JMYA 4M0EA 3WWDA 2HA5A 4FNGA 3LCRA 1QIMA 3UMJA 1Q0ZA 1J07A 4BZWA 4MWSA 3H18A 2OQVA 4ZGBA 1AGYA 2HA0A 4LHEA 2ES4A 4C6HA 2HDWA 2ZYSA 3WL8A 4AZ0A 1HDEA 1Q0RA 2XMQA 5ISMA 4B0OA 4AB1A 5C8XA 2XUDA 5SYMA 3I6YA 4J0HA 1F0NA 3RKSA 1ZD5A 3PE6A 5T4FA 2W22A 3FNBA 4GWLA 1EB9A 1K8QA 1YS1X 3PUIA 1U8EA 5FUMA 5KBYA 2OCGA 5CT6A 4QDUA 1HL7A 1QIEA 3I2JA 5AKKA 2GBCA 3VVLA 5AKEA 1VZ3A 1UXOA 1E5TA 5ALMA 2G5TA 4H7EA 1CIJA 3GA7A 4QLAA 3HRHA 2DHCA 4ZREA 1D07A 1HPLA 3VJKA 1FFDA 3AINA 4BRSA 4W1PA 2R11A 3O9MA 4RPCA 1AC5A 1K6EA 1LPNA 3WZLA 3PF9A 1Z68A 3I1YA 1XKTA 1CR6A 2JGKA 5ALRA 4DSAA 1DX6A 2Y2UA 4B85A 5AM4A 1CUEA 7YASA 1EHYA 2ACKA 4OD0A 2PU7A 3QH4A 4FNMA 1IUPA 2ECFA 3WK4A 4EZIA 4L9AA 5LLSA 2Y1KA 5LP1A 3W05A 3BIXA 1BN7A 4NZZA 4PW0A 2WFLA 2WHRA 1ODSA 3OTQA 4E14A 3KOOA 4WY8A 1NU8A 5ALEA 2Y2VA 3ZWQA 3H2JA 5I8PA
chains in the Genus database with same CATH superfamily
3WXMA 5ERGB 4ROSA 2AI1A 1NQTA 3BD9A 2IEBA 3V8RA 5JNVA 3LTNC 3ROZA 1DAHA 1KAHA 4PV7A 3FCAA 2CCKA 4DCTA 3P9PA 5E3HA 1SHLA 2I9KA 4B3IA 2ZAOA 4XCQA 4Q66C 4EWLA 1E1QD 1VYUA 1TQ2A 2PLNA 1Z75A 3FYUB 1OXVA 2CJXA 3U0BA 4C4SA 2H4YA 4BY9E 4MO9A 3A1FA 3BMNB 4CT5A 1Y5IA 2CVZA 2HO4A 1ZC4A 2FN4A 2Q1TA 2YIJA 1JAIA 2AEJA 1WY7A 4JBXA 5K3EA 2QV7A 1ZJWA 4NAUA 4REQB 4AJIA 1GSHA 4M7WA 5FYQA 1EH5A 4ZYTA 5JD4A 1Q1EA 5IX8A 1C8VB 1FU8A 1YRLA 2YJ5A 5FI3A 4C76A 3WL4A 1EP3B 2HHJA 3E9YA 3TO5A 4LF5B 5DBOA 4ZAFA 1O97C 2PLWA 2WJWA 2WAMA 2X8LA 2EJBA 1GPKA 1XXHE 4IXTA 3BWYA 1Y9ZA 4W7SA 4OKNA 4R1OA 3NOQA 1IN7A 1MIOB 2C9OA 4OB6A 5IMSA 4R7TA 1NW8A 2H1FA 4O6VA 1TEZA 1TO6A 2B4KA 3GJ5A 2WNIA 3OEHD 4FW9A 1V8DA 2XUAA 1E5DA 2NU8B 4WY5A 3S8EA 1EX7A 3ZY5A 4W5NA 5EE1A 1T35A 2XMRA 5FORA 2IYYA 3TNJA 1DCTA 4QQNA 4FPXA 4MPTA 5H5JA 2HHAA 2CLKB 1OFHA 4IF4A 3SEZA 3RLFA 4RF4A 2QMOA 4AI6A 5H3HA 2X0RA 3UUFA 1UK9A 2VOEA 1COWD 4TUYA 2QROA 5EIFA 3NHJA 2JBWA 3RYFA 2E6UX 1JQDA 3ZCTA 3CRRA 4MV1A 1XTKA 4W8HA 2CUKA 4I36A 3E0XA 2HPZA 4NBVA 3UAGA 1V25A 4CLHA 3R0QA 1RRMA 1E1RD 1BXGA 4G84A 3UUEA 3T9AA 1G0OA 2XTNA 5HKKD 1YE3A 3BJIC 5KDLA 4AF7A 5ITWA 2JFUA 1C0LA 2XQKA 3NH9A 3QVXA 1FBTA 5I9SA 1ULHA 4PS1A 2J4DA 1SQGA 3K9LA 4GKBA 1VPTA 3UPUA 5T3YA 1I51A 3I1IA 3FUVA 1E7SA 1W93A 4MK4A 2C5BA 5EQDA 4Y9SA 4AS1A 1MAWA 5CBPA 4KL8S 2WWYA 4CIVA 1ODJA 4ZRDA 1IY8A 1H6AA 1LC0A 3QIVA 5K3BA 1OV4A 3HVHA 1QGAA 4KU4A 4QODA 1TRKA 3GNTA 1XO1A 1SUIA 4IOLA 1DQPA 2P9HA 3IFSA 2HNBA 1QNFA 3LK7A 4AG6A 5DNVA 2BI7A 3F5QA 3F90A 3D7NA 1JG6A 1MC1A 4PCUA 4DMLA 3EG9B 2OFWA 1DQNA 1IEVA 1T5OA 4OHUA 1U6JA 2JAQA 4FFWA 3VOSA 4DJJA 1Z8FA 1DAOA 3MRTA 1QB8A 6YASA 4JLMA 1L9XA 3QKRA 5GY7A 3WL7A 3WIBA 2IH5A 1M1YB 1YASA 3S27A 3C7TA 1NRJB 1U7TA 3MB5A 2V6GA 2C5EA 3TM5A 5COBA 3L05A 3RSSA 4GC5A 1Z8NA 5IP5A 3MAGA 1VL1A 3NX4A 2YHBA 3UNXA 4GOND 2FEMA 1PL0A 4GM4A 4HVAA 3UJ8A 3M1LA 1QVVA 2R8BA 3VC2A 5FH9A 1WHSB 3C85A 2Q2OA 5CVJA 3MOGA 4BU0A 1PGNA 2PL3A 2E9SA 1U0HC 2YUTA 3NXKA 3TKLA 5BURA 5CXUA 2YC4C 2PUWA 1KVRA 2H07A 2ZRMA 4PPQA 5AOVA 1R16A 4MRVA 1NUUA 3QUAA 3RVBA 3UGQA 2IUSA 2FMKA 1DAIA 1Y8RB 2WOOA 1O3YA 3FDZA 4FGWA 1EFUA 1PX2A 3VV2A 4HGYA 4PXYA 2VJOA 3WBKA 4BCDA 1CHNA 3E18A 5A0TA 3TL2A 1PVDA 1B3RA 2RAUA 2Z43A 4BVLA 1JYEA 3V4FA 1EFRD 3DBRB 1S4MA 4KZPA 5DNWA 2AN1A 4B3MB 3ISVA 5E6SA 5FDFA 1X1RA 1AF7A 3BIWA 2COUA 2SCUA 2IP1A 3M82A 3MCTA 4I81A 2JGMA 4KO3S 4MWCA 2DKFA 4EB0A 4S24A 3I73A 1G4AE 3C39A 3WKCA 1KSHA 3FMOB 3QLEA 1ISPA 1GCAA 1HDIA 3D7SA 3WX0A 2P9EA 1YR3A 2FR8A 1EUDA 3EC7A 4Q4JB 4P0TA 4DQDA 4BGDA 3HXKA 2P27A 5DJ5A 3CZPA 3NOVA 1L7AA 4QJIA 4TYQA 5FWYB 1IZ8A 4C4OA 3F9CA 4AX8A 5DPMA 3VR2A 5CD9A 1G66A 3FNGA 1L3CA 1H1DA 2X2PA 4DANA 3I3SR 1NW9B 5CA0B 4O4IA 4PFQA 2GR9A 2FMIA 1ITZA 2E87A 3A27A 2Q4RA 1RI2A 3VR6H 3WYDA 1JZQA 2BFFA 3A25A 1Z4NA 2W6MA 4J1QA 4CN8A 5TVKA 3GAFA 3Q3JB 1UBEA 5EZYF 4EHBA 1NN1A 3F7NA 4X90A 4RH3A 2FG7C 1S2LA 2BRUA 3QEJA 5K4HA 1S8NA 3P2IA 2N46A 3W5IA 1FMLA 2J3MA 1P91A 4EKNB 5IZCA 2XH8A 4GXRA 5A4DA 4KVGA 2E55A 3BKWA 4OMFG 3UENA 3KQOA 1ZINA 4OAPA 5K6RA 1EQUA 1ZOIA 2GAAA 1TW2A 4RL6A 4UEQA 5E6RA 4BO4A 4GOMD 1KFCB 4RD3A 4BUCA 3V9PA 3ANSA 2QXTA 3MMSA 2YFHA 3RT9A 1NNI1 4BUJA 1JB9A 3R3UA 2B5OA 1A9ZA 3FCXA 3T4PA 3TTSA 5K6TA 3OTWA 3VAAA 4O2AB 1VG9B 5I01A 1PV2A 4TTVA 2NLOA 1W9HA 3IE2A 1UDXA 4J4HA 3EFOB 4JQCA 5FUWA 1X9GA 1C0KA 2BM8A 3RC3A 1MRNA 2O8EA 2FK8A 4PRYA 1R66A 1RWNA 2AC7A 3GRCA 3UMVA 2Z9CA 4PO8A 4YP5A 9MHTA 2C9CA 2I3BA 2YV4A 3OFVA 1BU5A 4FGLA 2A1TR 1FJHA 1WLSA 4IS2A 1VRCA 2E4XA 5J23A 2XUOA 3RRYA 4O4JF 3N8NA 4EMTA 3O26A 3WJ1A 3WLEA 3U3KA 1ML3A 3RHZA 4PN3A 4Z4CA 3A05A 2W2XA 3HRIA 4RM3A 1NHWA 1WXWA 3TAHA 5CFMA 1WABA 1CY0A 3NHFA 5IAKA 1RT9A 4L5YA 3WDKA 5BVHA 1OI4A 3NIWA 1JSXA 3K35A 5DLDA 2AE2A 4YV0A 3EXIB 3LY8A 5G02A 4YREA 4A23A 1J9ZA 1P77A 1T24A 5EOVA 4BNWA 1PV4A 2XR1A 2VQSA 3QYAA 2NGRA 1M83A 3G3EA 4CNBA 4KE9A 1UPUA 4MIEA 4LX8A 2PXXA 3R77A 1G6KA 1SK8A 1I4OA 2QT9A 3G2PA 1G8HA 1PJSA 4US2R 1JX6A 3YASA 4MS4A 4M1MA 1BE1A 4W63A 3PZRA 5D87A 3AP1A 4HDKB 2OXIA 3KVRA 4PSCA 3B2EA 4C4YA 1XZAA 5HM8A 3A9TA 1YO6A 1P75A 3IA7A 3K09A 1FZQA 1RKUA 1SN7A 5F3RA 1F60A 1E3MA 3V34A 3B6JA 3T06B 1YCFA 1OVMA 1ZGBA 4NL4H 4J0KA 1J4AA 3LVRE 4B3HA 3E2MA 5AXDA 3PL5A 4YRCA 4D8VA 5LYJB 2P68A 1TFRA 3T61A 1SC6A 2FEWB 3IJEB 1S89A 4DLKA 3IIJA 3KAPA 4JFAA 4LV6A 4C7BA 3DNPA 1CQIB 2XVMA 4GSLA 3WGQA 5HQTA 1CDZA 3BX1A 1DRUA 1H0HA 1W44A 1P18A 1G4HA 1ZH4A 2NO4A 2O2DA 1WULS 4YUVA 4JJGA 1PFVA 4AWAA 4PQRA 2RH8A 4EB8A 4C88A 2ZYTX 4FT2A 5AM1A 4F6LA 3CRNA 4PN7A 4E0BA 3JQ7B 3BM5A 2P6NA 3EYAA 2H7YA 4OHZA 1UBGA 4JBNA 2ZIWB 1M9NA 5JDIC 3HEAA 3ICPA 3LLSA 3GD5A 4PFKA 2GN1A 1H9AA 4KQ6A 5AT1A 3GRUA 4XQEA 4B0PA 2OCPA 4D3FA 4LN1A 3FCOA 1XDDA 2ZJ3A 2QDKA 1KJ8A 1V8ZA 1U9CA 3M4NA 2UZ1A 3RVQA 5HIKA 1TL7C 2CLEB 1E69A 4B9EA 4YV7A 2ZANA 4HDRA 4L0QA 1US8B 2G88A 3GXOA 1ZK4A 5B7NA 1CSEE 2IW1A 3Q3CA 2F1OA 3EVCA 3PTLA 3R6LA 3AERA 4LZAA 5C4MA 1X7DA 4QBKA 1B8OA 1I4EB 1VBNA 1I4LD 4NJOA 3AEYA 4ZJYA 4EA7A 3F0TA 3C1TA 3O8DA 1LF0A 1E3WA 4RK1A 1Q3HA 1G5QA 1LI7A 1O57A 5KPDA 1Q2XA 3QV2A 5BXYA 4ZA2A 2E82A 3BFJA 3IT1A 3OZGA 3SKXA 4YDHB 4ZCLA 5TY0A 4BRWA 1R6TA 2VHCA 1BKSB 2PBRA 2G25A 2PZJA 1E3SA 1LEHA 5T8KC 4EO4A 3S1AB 2JFOA 3DNFA 1YZGA 3CX4A 5F35A 4OU5A 3EY4A 3QA9A 4JYBA 4KMRA 4HX2A 1KDVA 2DFPA 4KHPB 3HVJA 4IFIA 1XRQA 3W3AD 4Z8XA 1Y82A 3LIPA 4BNDB 3GRKA 3WL5A 1W36D 3AR6A 3GEIA 3MGCA 3KV1A 5A5VA 2GA9A 2QMUA 3IYLW 3QJGA 4IBOA 4RYDA 3ZW8A 4KXWA 2QYSA 1RHQA 2G3YA 1BQ3A 3OOYA 1RU3A 3SG0A 2QEQA 2RHWA 1FFCA 1WSAA 3KR1A 3S55A 2G40A 3DO8A 3K9HA 1KYVA 3D8RA 4MWBA 3VR4A 4YT4A 5HXAA 1IL0A 4NOKA 2QHXA 4FD3A 1SXHA 4OLHA 2ZVJA 5CB4F 3ORQA 1AA9A 5FTJA 3RC7A 2KSQA 3D0OA 3G82C 4DPMA 3VNVA 3KL4A 3FPJA 4H15A 4I6GA 5EYPA 4KLNA 4EYGA 4LF8B 3CWCA 4WD3A 3THRA 1P9RA 3OOHA 4PU0A 2W6JD 3CNEA 3KPYA 4MYRA 1QIJA 5GM2A 1DKQA 3G0DA 4ACAA 5I51A 4F4DA 4XARA 3KWFA 1GQ2A 1V16B 3L0PA 4HAVA 3WSTA 4NZPA 3TDKA 2OHIA 2QSZA 2CL7X 5BSKA 1INLA 1UFRA 4RD0A 1IZ7A 3PGJA 1QDLB 3AHJA 4XZ3A 5FPQA 5T3UA 1RWOA 1YS7A 4I19A 2AKEA 1QGDA 1C30B 1UP6A 1ZEJA 2CNWA 4ISCA 1E4EB 1U02A 5JJLA 2DFLA 5JY1A 3IHWA 5AKYA 3OJ0A 1A50B 2X4IA 3A14A 4WXEA 5JHGB 5L3QB 2ZT6A 1P6UA 3IOEA 5ELXA 3OQHA 5E4YA 1ZITA 3TRFA 4AZVA 3D4OA 1HZJA 4LY3A 3AB3A 3ZLBA 1OH8A 2AZXA 3T3NA 5CB6A 2PM8A 1LSJA 2WVHA 3KLMX 4K6MA 4DIOA 4NCJA 5A4AA 3RRXA 3SE0A 4NRDA 1SXQA 3H1PA 4HRAA 5H4HA 2JBAA 4HRYA 1XCLA 1IY9A 3BMQA 1QZ3A 4BEBA 5EE3A 2PANA 4NXNB 4R1UA 2VHWA 4D3XA 4UBJA 1L2TA 1BMQA 4PC2A 1AQYA 1E2BA 1AUPA 1ZESA 3WGUA 5JOQA 2J0QA 4RO0A 2IY8A 2A0UA 3LHFA 1I7SB 2Z6AA 2J7PD 3AY7A 4A1OA 2XLCA 1X92A 1L7OA 1LNZA 2J0UA 4I66A 5KOJB 3PC3A 4CQMA 4WIAA 4J7XA 1HZZA 2WFZA 2VPWA 2IXFA 5LUBA 1EM8A 3ZQ4A 1YQTA 5FUBA 3RCBA 3NMUF 5DLEA 1XRMA 2K4MA 4IDHA 1WBDA 1JE1A 4KQWA 3U5TA 4IIJA 5DTEA 3HO1A 4F97A 2XX3A 5HYVA 3N86A 2V4ZA 2GBLA 3FDFA 3C7DB 2YH2A 5I7RA 4AO6A 1U5BA 4PPFA 4FTWA 1FP4A 2I54A 4KOEC 5LP6A 2J5XA 7REQA 4G0WA 1O7JA 1KE2A 1KDTA 5ICMA 4I99A 3WRVA 4E5MA 1E9SA 3W9SA 2X1MA 3FETA 4V39A 1KNQA 1MG0A 2FW8A 2R85A 2G4LA 1M8GA 5FV4A 1LTHR 2O1SA 5KTSA 3QKUA 3P1JA 4DREA 1DAEA 5AHXA 1KSGA 4PYLA 3TE7A 4G37A 2ZUFA 2MSCB 4L15A 5CLIA 1O95A 3BK2A 3Q5GA 2E48A 3N0WA 1X8KA 3E82A 4HGZA 1LTQA 1ECJA 4KRXA 2YXLA 1ECPA 1MB3A 3BHMA 1RLIA 3JAKA 4WSOA 3EUFA 5FLEX 2I1VB 1E7YA 2ONZA 3E5HA 3ZCRA 4J0EA 1KQ3A 3U7RA 4BJ3A 1DELA 2BFOA 5JADA 1Y3BE 2VF7A 1ZNXA 3H1EA 2EYQA 3FOAA 1ESEA 3DZ8A 2FX3A 2P90A 3BRWA 1TCBA 5BY2A 4AJOA 2B0CA 4Q6BA 1KAGA 1QOPB 2W6OA 3CV3A 2PA3A 4JVMA 4AJ1A 1YHYA 3R23A 3RJ5A 1BTOA 4JZYA 3C14C 1Z74A 2X58A 5IJAA 4TMXA 5EKXA 3OFKA 3W7BA 3SZLA 3PHIA 3QA3E 1MPTA 2B4TO 3KCNA 5KJCA 2HA3A 5SZKB 3ZD8A 4DY4A 5CAEA 5TQJA 1F51E 1QOQB 1BKYA 1RKQA 3C45A 2IU4A 4PPYA 4XPZA 3UN1A 5KTMA 4XUCA 2WJ6A 4G8BA 3KZXA 2QN9A 2BT4A 4DCPA 1F2VA 1J8MF 3II6X 4R1LA 4M9XA 3RYHB 1E2UA 1HQDA 1HG1A 4YMWA 4CTNA 4J07A 4F5DA 4IGKA 1QQAA 2IPAB 4DYDA 2WU0A 1EM6A 4D80A 4NV1A 4GP9A 3UMCA 2GZDA 3LQ1A 4OQFA 5A9RA 4V1CI 4JR1A 4BV8A 5HZKA 3GPLA 1TU0A 1WE2A 1FFEA 2O2ZA 5KYNA 4LXHA 1T15A 3L5KA 3DDUA 3IP7A 4JR0A 3Q7EA 3S6JA 4NCXA 1ONOA 3P0HA 4DQUA 3O75A 5EINA 2A9QA 2D1YA 1HA3A 4ZO4A 4AY4A 1JFRA 4ZPXA 1M34A 4RSGA 1OJLA 3OU2A 1Q1BA 1YACA 1SVMA 2IW3A 2VQ3A 8ATCA 2QAGA 2FZVA 5E4TA 5KHAA 1NPTO 5FEUA 3G23A 1DTEA 3UAYA 1ZH6A 3K32A 1ILWA 1Z9BA 2XNSA 3CSUA 4CIBA 1LQ2A 3PG5A 3GJ3A 3KSUA 2XDQA 3WMXA 3A06A 1U4SA 2ZUVA 2UZ3A 1J9EA 2KMLA 5K6AA 1J2EA 1FNDA 3CEMA 4GHWA 4EW6A 1QHYA 2OXEA 3BXFA 3FBWA 3ZJVA 5LB2A 1K6IA 4FN4A 4GOXA 2QMYA 3QKSA 4CEHA 3L8FA 3R5TA 4PCAA 2QTNA 1QR6A 4OQPA 3ZKAA 4MS3B 1RLTA 2J9FA 5LDDC 2RGCA 1GTL1 2FP3A 2YV5A 3OM9A 4EPXA 3EPRA 1Y63A 3IOCA 2VT7A 4ALJA 5DYGA 3UYLA 4LQDA 3W5VA 1LNQA 3GLUA 2BGNA 3ZWWA 1D4ZA 5LA6F 3RASA 4ZRMA 3EQZA 3K70D 4A6PA 1ZBQA 4EM6A 1Y37A 3CF4A 4CG2A 4MGZR 1KMIY 1Z33A 1XPOA 4GSKA 3T9CA 4KR7A 2RHJA 5J5CA 4MXDA 5KJFA 2ZAYA 2Y1GA 4OQEA 5TV2A 3C97A 3O4VA 3GA5A 4B7XA 3EW9A 3PCTA 4GZMA 4BMXA 4JL6A 2GEBA 3KSDO 3ZIDA 4BP9A 1HE2A 4G3XA 4Q3DA 5ALFA 4LTMA 3MQFA 4YCDA 1SQ6A 3LHIA 3P2YA 3Q9LA 1WV1A 3CKYA 5DE3A 4JIGA 4B75A 5AW8A 1M74A 1XTPA 4MV3A 4C21A 3EIEA 2WYIA 1QTNA 1T0JB 9ATCA 4QXAA 3W9BA 1SBCA 5LZ9A 2PZGA 1JU9A 2RGEA 1QGUA 3P9RA 4E5PA 4NU6A 2FRDC 1Y7TA 3DD5A 1JSRA 4MUEA 1ZH2A 3KZVA 4HX5A 1Z2PX 1A76A 3GMDA 1VQ1A 4GMKA 4MKFA 3V1YA 4OQMA 2HLHA 3H5IA 2GPSA 4CM8B 4FYYA 3B9QA 5C8DA 5AW3A 4Y2HA 1O8CA 3ETLA 1UJNA 2Q3MA 3T5DA 2W98A 3PK0A 3Q8XB 1KO5A 1XE3A 1I5OA 3RTGA 4FZVA 2Z8ZA 2X6QA 1MW9X 3PE4A 2F9FA 3KQSA 2JI6A 3MGGA 3R7LA 3UJPA 3EY9A 3B5EA 4WE3A 1N8TA 4Y0NA 3SM9A 2IYPA 2AJBA 2VIIA 3E8XA 3N5CA 5FBWB 2PNJA 3OE7A 4K40A 4KR6A 4X93A 3PUKA 2C2GA 1M1XB 1L5OA 2HK8A 5D51S 1HNXB 1GNPA 1TI7A 1E58A 4EELA 4G67A 4HMQA 1JDVA 4HGRA 1EFDN 3DP7A 1CUAA 3DMYA 1TXGA 4ERXA 4OYYA 2D4AA 3KUUA 4KOAA 4Q3NA 4MYCA 6CHYA 4M6WB 1XCOA 5K1ZA 3G17A 1D4OA 2FN9A 1DIBA 3JVDA 4LSWA 3AH8A 3VHXA 3SZMA 4UBNA 4JV5B 4XIIA 4ZXPA 2NXNA 2FG5A 2Q5EA 4K9KA 4PLVA 4HTAA 2OV8A 3EMDA 4EL0A 1P8JA 1T2UA 3MJCA 2IOQA 3NEYA 4P93A 1TK3A 2QSJA 3UTDA 5JNTA 5JH7B 4KH1A 1TK2A 4WUTA 1EQ2A 2CXPA 4JC4A 3W6UA 3WLRA 4P22A 5JAHA 3B5IA 4C3OB 4IOMA 1TQ4A 5HF8A 1DBWA 2CFRA 1OLSA 4KZKA 1XZJA 3MOSA 1ZUIA 3BGVA 3MELA 4XWAA 2PBZA 4KXVA 3TQHA 3CNQS 2WAXA 3FOEC 4RAQA 3KCQA 2P3LA 4D7AA 1RHJA 3AVVA 1IZYA 1XC7A 1MT0A 4IUCS 4PCLA 4PS0A 5FTMA 3USES 1UWCA 4EUKA 1WQ1R 3PEYA 2FPIB 5JAOA 1T2CA 4OHXA 4NG5A 3LWDA 3H4VA 2PLRA 1KZYC 2MWMA 3LC7O 3NAZA 4J8PA 4CIYA 4Q5IA 4DQ0A 3GZNA 2Q0SA 3FMIA 1CE8A 1N1EA 1YULA 2C83A 2ENWA 4ZTUB 3ILXA 5DK4A 1V5IA 1QAMA 1C4KA 1Z6ZA 1XVVA 3V6MA 2AWNA 1L1QA 1QVWA 1Y7IA 4IWYA 3ZD7A 4B73A 4ENWA 2B8TA 3D3EA 4HFJA 1FYEA 3G2KA 3K6RA 2FU5C 4YJ2F 4I1IA 4UMEA 3UVEA 4CF6A 5TQ0B 1PUJA 5F4ZA 5FBVB 5LXTB 4BQPA 5E7JA 1JHQA 4G6ZA 2RE8A 1P7PA 3OY7A 4H3HB 2QLLA 3L0ZA 1O0SA 4YQYA 5FUVA 4RH1A 4H35A 4B79A 1NAIA 5KU7A 2XA1A 4OB7A 3UT6A 1CJBA 1GZHB 3A4IA 4LECA 1Y1LA 4Q03A 4MUJA 4U2FA 4AIIA 1DWOA 3R5JA 3DPIA 2CUNA 2Y1FA 2WVJA 3HUFA 3I3OA 4ASUD 1Z36A 1K1EA 2BCGY 2Z04A 3M1AA 3BE5A 4KXFB 2F00A 3BXGA 1R88A 4NBUA 2JD2A 4QOJA 5JD6A 1QO7A 4LJ6A 3GFGA 3UA3A 2VTEA 2ZZKA 3TF5A 4DNXA 5TNXA 3OLYA 4AT1A 4CDRA 3OO1A 1Y4SA 3DEAA 3NOOA 5JDCC 2JLVA 1I0ZA 1SA0B 1QNLA 2LKDA 3ELWA 1S5PA 4A27A 4A16A 1T2VA 2MYUA 3KZOA 3FRIA 2R87A 2RBKA 5B1HA 2BEJA 3CRMA 1YONA 3EZ9A 2ZUTA 4X95A 2F48A 2WT9A 4OV6B 5ILGA 2QAJA 1XQ1A 1BYUA 1SMKA 2DVMA 3I42A 1K0FA 1QG4A 3I04A 4GGMX 1JLRA 2P7HA 1ZWKA 4CMHA 3W9YA 1QH1A 3GFFA 1I2DA 1WP9A 2WKQA 3EZ2A 3TW4A 1MO5A 1DJMA 1WR8A 2ZBQA 2G17A 3CT6A 3G2IA 1I4DD 2O2HA 2X5KO 3F98A 2H4JA 3CEHA 2J08A 4J76A 2E7ZA 1J42A 4I8IA 4W8GA 3VU9A 3I05A 1XA3A 4M2LA 4RY9A 2BCEA 3TTTA 3QUTA 4QUAA 4D9FA 3U44B 2RH9B 1WW3A 2UAGA 2MIIA 3PFWO 2JFPA 4AP6A 3DDWA 2W2LD 5KNBH 3DTNA 4QELA 2JGDB 1C7QA 5T4BA 1M34E 4R8LA 1SB9A 2PZLA 3A6FA 4MW5A 4D3DA 3OC0A 3A6LA 3RAGA 1IEQA 1L5WA 2B69A 3ND5A 2W9XA 1G64A 2ID9A 4DUGD 3DQQA 1BROA 3DE7X 4H3KB 2HCTA 2ZRQA 3GVCA 3OLVA 3UKJA 5HWSA 1I3CA 4RD4A 2X5XA 2I80A 4JLPA 4MNTA 1YKSA 3DFUA 3ZWNA 1JDUA 3QP9A 3ZGVA 4Q93A 4JROA 3ZW7A 1V5FA 1IRXA 3ONNA 1MJGA 4MKZA 4NABA 3IA2A 2HC9A 3SQLA 4RTJA 2P0AA 4NU5A 1JU3A 2IZ5A 2R9VA 1B0AA 5ALVA 1PQ4A 1YCHA 1CK4A 1P2BA 3QQPA 5MFPA 1F6WA 3NDPA 4ZPJA 1R0XA 3FX2A 4KVAA 2R1TB 5LOVF 5BT8A 4AD8A 2W71A 4GR4A 5BV1A 2ZIAA 4FMDF 2DTXA 1LF5A 4X1YA 1GTVA 2MSLA 4BATA 3SBXA 5CIQA 2V0CA 1G6OA 1TCCA 2ATIA 4Y2UA 5FQOA 1QO9A 1QRAA 4BB5A 4U39A 2VUTA 5EXPA 3H9JA 3DMPA 4B32A 2PHZA 5BQ3A 3NDRA 2RAPA 3KZKA 3MTAA 4XGKA 5HR5A 1KYIA 3DDZX 2FA9A 4TRMA 4NKRA 4D1YA 4E15A 1QRDA 1XN1A 5FAXA 5A71A 5HE8A 1E9AA 3N0VA 3E53A 3T99A 3O38A 3X1XA 1AKRA 3JTEA 4YMGA 4K1LA 4EYSA 2PVCA 2BI8A 3HJUA 4PZUA 4GBMA 4M9SA 1W1UA 3I9MA 3BQ9A 3A0UA 4EECA 4DCVA 5TRTA 3RS3A 5TGTA 5HMLA 4ZCQA 2Z08A 1NI4A 1PZGA 3GUCA 1NJ5A 1Q74A 2QQFA 2XNKA 3EPPA 1UT8A 1SCQA 3A3KA 2Q0HA 1JQ5A 5DIZA 4EEZA 1JFSA 3TEFA 2J0SA 1GG2A 2W4IA 3CR8A 5F7OA 5J4YA 5U1PA 2HZ7A 2WLTA 3ZHXA 5JSQA 3TG2A 3IDZA 1TUEA 1N9GB 4NNOA 3U7QA 3U9LA 5BPFA 3V2HA 3WZ2A 2CT8A 2BZ1A 3TQQA 2ZUEA 2WA2A 1XU9A 1JG3A 1V3QE 3BXHA 1FW8A 3IBSA 3JV7A 4B6SA 4PNZA 2IH4A 3IQWA 5CCBA 2O0MA 4AURA 2LTAA 5JISA 3PTAA 3NTOA 1RJEA 3NB0A 2ZI6A 2I6GA 1R4AA 1K63A 2N1BA 4RKFA 1HBJA 3B3GA 4CIDA 3AOEA 1GUYA 2CE7A 1HFEL 1BFDA 2X23A 2X0DA 2PR7A 2Z1DA 3I23A 3SR0A 4FWTA 3NDBB 4YRBA 3OQPA 1IHYA 4Q4AB 3ENQA 2R8PA 1CUHA 1FMJA 4Q05A 1Z3IX 2BKVA 2H0RA 1JA0A 3ESCA 4B82A 1DO8A 5ADHA 1FK8A 5AJVB 1WPQA 4LZNA 4UASA 1QV9A 5HTKA 1DC5A 2ZUUA 2DWPA 3K0FA 1GAXA 2X76A 2EATA 1E89A 4XD2A 4DE5A 1AKTA 1F8UA 3AK4A 4MV0A 3LQKA 1VLLA 3K1JA 1QVZA 2J46A 1HT1E 2W2KA 4TUYF 5JZSA 3JYLA 3RBZA 1CJMA 4QYXA 3SYRA 1ZGGA 4Z53A 2GAJA 2AJCA 2MCFA 1NULA 3D2BA 2HSGA 1Z8DA 3Q1LA 1GKIA 1H85A 2P0YA 2G80A 3GQBB 3MERA 4IY1A 2HKIA 4LVOA 3GEBA 3PYMA 2ZJ6A 5J4LA 1GDTA 3EZXA 2XA2A 4KPEC 2JJQA 3EBLA 3FRJA 5IUNC 3LP6A 1CVLA 2ZRPA 3P9XA 4DIEA 3IMGA 2QTAA 5IK2A 3P45A 3V48A 1U8ZA 3M7IA 3ETDA 3OKFA 4R3NA 4CJXA 5K0TA 2AUNA 3CLKA 4FW8A 3IMEA 3CF0A 2NYAA 2ZJ7A 1L4FA 4BMCA 2H7VA 1HG0A 2J3HA 3L01A 1XZDA 4TRNA 1EDZA 1Z7GA 1AIPA 3CWZA 2G1JA 3K1YA 2WMNB 2BZ0A 3O82A 4S35A 4Y1RA 5T6BA 4DZZA 4EFDA 1MJFA 1VGVA 5IFKA 1JLKA 3AI1A 5ICGA 1NGSA 1KKLA 3HB1A 3UWSA 2WUFA 3LXRA 2VHYA 2GHIA 4UM9B 1OFTA 4D8UA 4N7BA 3SOZA 5A04A 3GRFA 1JKMA 2IHKA 3O92A 3L8MA 2KS6A 1E20A 1YQGA 3H6GA 4LGMA 3SR3A 2P62A 4HWGA 1RE0A 1MHTA 1A97A 1XVLA 1FUEA 2GI4A 1DDOA 1E63A 4IIGA 1I2BA 4NECA 3DCJA 1GT91 3GCXA 5MFZA 2O2YA 1FMTA 1DINA 4JL5A 4EHAA 3K70B 2DUJA 3CF6R 3QUQA 4PHHA 5CX1A 4IMRA 5KJ1A 2BFCB 1R4NB 4IVNA 2CNBA 1RM5A 1IPFA 1ZXLA 4YT5A 1P5RA 5DTRA 4XYEA 1WMBA 1O08A 3F96A 2DQ4A 3TNFA 4CF7A 4OYRA 1W94A 4UXHA 2LDBA 1RBYA 3Q7QA 1AUOA 2YRXA 1GPAA 3SF0A 4EF4A 1F06A 4TVOA 3ZGLA 2DB3A 1MFPA 1CDOA 2MYPA 2FF7A 2W2OA 1V26A 1Q16A 2IXBA 4JP1A 1O77A 1M0EA 2QLMA 5E0KB 3OIFA 4TSRA 4GQAA 5M29A 2MR6A 4FBLA 1ECFA 1HOXA 2ABWA 2E4UA 1K5PA 2HMYB 3HDHA 3KBBA 2CLHB 3ISJA 1Z37A 4RGBA 5H02A 3S5UA 3PHGA 5H1YA 4KFCA 1FJXA 3OUTA 2AZDA 2O1XA 1FYVA 1E8DA 2PRYA 4Q3EA 3KR0A 2HJSA 5HUJA 3GLFB 5CEJA 1N1MA 4ZWNA 8ABPA 5JD5A 2VPIA 1I4TD 5DBGA 2OV1A 5JRDS 4NOLA 1E9RA 1KI3A 2B3TA 5M7EA 2J9GA 4B84A 3LBIA 3LC2O 3Q6NA 4B3JA 2AJTA 2QUBA 3OPNA 1N3BA 3PQFA 5K0ZA 1PRYA 3I6IA 1PP4A 2Y66A 3K0AA 3QVOA 2B34A 2ORED 2PWAA 3QI2A 4KACA 4LJ9A 3N7UA 3SS7X 5KYUA 5CR9A 3ZNQA 4TVBA 1Q22A 2V7WA 2OCBA 1HEIA 3LX8A 1YB4A 3PJEA 2F3RA 1C1XB 4GQIA 4WNAB 3AIOA 2E49A 1XEWY 1T3HA 4HFNA 4O4IF 4II3A 1I30A 3OY2A 3QXGA 3ZKWB 2O3QA 3DL7A 1P0QA 2ZRFA 3AF4A 4QECA 1YZNA 1U0GA 4CMIA 4OK5A 2B5WA 1M7HA 3O6VA 3GN1A 1SUBA 1ZR4A 3FZEA 2FWIA 1ODLA 2FPRA 3KOWA 5FEMA 1SGWA 4LOKA 3ROPA 1H2BA 2J3EA 2NSDA 2XMPA 3D4IA 3IQFA 3U4GA 3WKDA 1OAOA 3OT4A 3ZDCA 3QX9A 1KVSA 2OHJA 2X4DA 3N2NA 1DBRA 3RFVA 2VZLA 4N3NA 4DUYB 2AS0A 3A36A 2P5TB 4DBLE 3DS8A 3LOPA 5T6MA 5LM3A 3GLIA 3SDZA 2BGWA 1AZSC 3LCCA 1XD2B 1EI9A 3HZHA 3KUKA 3ZDDA 3IQHX 4NATA 3TQOA 4CLEA 1O94D 5JNWA 4YDSA 3QTTA 5KVCA 2IUEA 5E0OA 1KI6B 5I7EA 3AETB 3KFLA 5FXMA 2V7TA 1TNDA 4EI2A 5A9SA 5LUAA 2NP7A 1C14A 2JCVA 2WSIA 3VR6A 4YCCA 2OXFA 3QYJA 4NZYA 2AJ8A 2O2GA 1U0JA 5H59A 3STTA 1KPIA 3IXLA 1UIRA 3R1IA 3ZU6A 1DBVO 3KXPA 3QITA 1H8ED 4HNVA 1OV6A 1X42A 3OPQA 3NATA 3ZEAA 2DWUA 2EG9A 5LQDA 5DM1A 4R68A 2YJ4A 4UBKA 1OA0A 1P4SA 2OUKA 3K3PA 3T3PB 1UM8A 2ZRJA 3PXBA 3FSGA 4WZZA 1R6VA 4F5YA 2O8NA 3N8IA 3BH6A 2B8JA 4KUGA 1AE1A 1GPLA 2C8VA 4US0R 2HXSA 4KJXA 3DUFB 2QVLA 4D0NA 5EHQA 2HYIC 1KRWA 4NCNA 4N76A 1SCNE 3LVFO 4XQGA 3X1MA 3CX8A 4RY8A 1JIKA 1JILA 5AW7A 2HSJA 1N7IA 3HKCB 1BCSA 3NHYA 3DG9A 3FPKA 5K5EA 3I5MA 4OJTA 4OVKA 2FVYA 4MW7A 4JFRA 1NYRA 4A0FA 2CD9A 3FSRA 2IYUA 1FL9A 3DLHA 1ZHHA 2XRMA 4X6YA 4HN4B 4EGQA 2ZJ8A 5TPZA 3AR5A 2VN8A 4EW3A 1ZIPA 3UJ6A 4ND8B 1VE6A 1L4EA 1USWA 3BTUA 2H2FA 3OT1B 3MS7A 4IJ6A 4B6JA 2WEKA 1RRKA 1KP2A 1OT5A 4OYLA 3HZZA 4P3XA 2D4HA 3MYYA 3SXJA 3ZLVA 2VP3A 3P0IA 1QRRA 1UBLS 2OCDA 2VDKB 3P5BA 3AHDA 4GLLA 4IYJA 4BEWA 2ZSJA 3F6PA 2JPDA 3GCWA 3NG1A 1MP0A 4GI1A 4OSOA 5CVDA 5F51A 1SXJA 3DDNA 5JWRA 5JY6A 1U5CA 2HHCA 1VRWA 1Z5NA 2X40A 4G25A 1RYBA 1S3IA 3WSVA 4YRSA 3T5AA 1FSSA 4ZFNA 5EPEA 4PHGA 3UJBA 3RVKA 4C0XA 1PSZA 2ZAIA 1R10A 1M2FA 3OU7A 1J24A 3LA6A 4XSHA 1OLXB 3JQ6A 3EA0A 1E1CA 1R0KA 5AO9A 1XVAA 4XQ9A 3R7SA 1JFVA 3EC2A 3GBVA 1NMEA 2GXAA 1Z13A 1DDGA 4HHEA 4BMNA 4HXYA 2BZGA 1JKIA 4WXYB 4U3JA 3KT8A 4MTCA 2GESA 4P7BA 4N6GA 4PVDA 5DW0A 1S96A 5GM1A 3JARA 2O2CA 4JI4B 5DMHA 2VRWA 5DTJA 5FIUA 3VYTB 5BWBA 3EBOA 3H5NA 4DZRA 2P41A 5TF4A 3KJEA 3KJHA 2C61A 1PZMA 4J16C 1GGJA 4NE2A 2UUOA 1U4NA 3OICA 3TZEA 1Y3CE 2DRIA 4X7PA 1U90A 2QTCA 1OAAA 2IYVA 4GI7A 1QQ5A 3KTAB 4L74A 1V9SA 3C24A 3MJFA 2HTFA 1TGVA 2D13A 3IAAA 2OE2A 3D0KA 2BM0A 3MC1A 4WDQA 4CLRA 1CRQA 3C8UA 1Y6GA 4G97A 3NALA 4C43A 2JNWA 3WLLA 3ASVA 3KDSE 3PT5A 3ZTWA 4R2WA 5EUCA 4U0KA 1SCKA 1Y1KE 4C2BA 1VSBA 2BIFA 1HDYA 3A37A 3CVWA 1EFPB 1QQTA 5AKIA 4CF4A 1RXUA 1XFAA 2JFFA 3FSEA 4HWSA 2QAIA 3OJLA 3OIDA 3NANA 4X44A 2VC2B 1ZVQA 1V35A 3PFCA 4A9AA 1FRZA 4HDNA 1CD5A 3GFOA 1JALA 2ZAMA 4MUMA 4OHOA 4KX3A 5DT9A 3VAYA 3UANA 2DT8A 1X0XA 1TJ4A 5HUQA 1SVUA 4Y0AA 2J32A 3UHFA 4DMGA 5B1IA 3D6VA 3ANTA 1W5AA 4YJ2B 1TKRA 3AZQA 1TT5A 1SFRA 1WHTA 1FX0A 3ONVA 4YRGA 3MD0A 1AV6A 4E3WA 3BRCA 3HP7A 1BXRA 3VPHA 4X8OA 5LZ2A 1LBSA 3EQ6A 4XFDA 1FMCA 1W4RA 1TTHA 4YRFA 3WBBA 3Q8WA 1OI7A 1IM2A 3GGDA 2GYYA 1J5PA 1ZQ9A 4N4AA 3E03A 3NBYC 4TT3D 4KHZA 4WOBA 1I5RA 2C03A 1B43A 2XTAA 3HEBA 2B8EA 3P52A 4MMXB 1GGMA 3WGYA 2VSNA 3X0DA 1FBNA 4RV9A 2VYVD 1GPJA 5ECGC 2XWBF 4NS4A 4UATA 3AV3A 3K9FC 3ZVNA 1YV9A 4ZOAA 3ZDQA 1UJCA 2UYOA 2XGOA 2C77A 2ZI7A 3KR2A 1KI8A 1YZTA 4PZ9A 1ZOOA 1OSNA 2BMWA 2AT1A 5I4BA 4EG3A 2CSXA 1RAGA 1WXFA 2PU5A 2A92A 1ECLA 3R4CA 1DX9A 4EVQA 2XNJA 1Q15A 4L16A 2NOAA 4LZJA 1DXOA 1FFGA 1RBMA 2Q6IA 3I6ZA 3KYDA 3U19A 3GFVA 3LCVB 2GNOA 3C6YA 5DI3A 1P45A 6REQB 3F8WA 2D3WA 4IMJB 5ESWA 1KVTA 4OREX 3QFFA 2IXAA 5IHPA 3L06A 3EEQA 1BD4A 2Y67A 1I13A 1MIHA 4JGGA 2WWGA 3DFZA 1N0VC 2XQJA 5AR1A 4F7WA 3MBIA 3OEED 4E3ZA 1TVMA 2FWRA 3KXIA 2JRLA 2B9EA 3EZ6A 2OK7A 1WUIS 4I1YA 1GN8A 2KHZA 4Q0MA 5F77A 5I4IA 1WCV1 4PTZA 3N87A 5JJCA 4BVJA 2WMDA 3PBKA 4QU0A 3TPCA 4KITB 5C4GB 1N6KA 3D3NA 4TYNA 3M89A 2OZVA 1VE5A 4NAVA 3FYHA 4YFVA 3CNOA 4V3CA 2EP8A 2ZCVA 3PQ5A 3ZWMA 1J8VA 1NXWA 1RWBA 1XQ6A 4DW8A 3U81A 1TW3A 1FPQA 5DF1A 4E5NA 3CY6A 4H7DA 3CLTD 1H1LB 2UVQA 1MAHA 2XD4A 3GLTA 2RHMA 1N5RA 1SWVA 2IYFA 1S8FA 3H19A 4FR0A 4RPLA 3GZJA 4REMA 4MQFA 4ZU1X 2OO5C 4K5QA 3GLIE 3B1XA 3LI2A 2YW9A 3OIYA 1SU4A 4ICIA 1LXCA 4W8OA 3RSGA 1WA5A 3ESBA 3IUBA 3ZE9A 2OD7A 1E96A 3BFVA 3BWXA 2G72A 2H2AA 1R9NA 4IVPA 3SF8B 4BP3A 3RC8A 4OYHA 5KNCD 2GYUA 2PA0A 4AKTA 4D6PA 4IIJF 1PJRA 4I8XA 1O0CA 5LQAA 1ACJA 2CLSA 1UR5A 5ARCA 1IUOA 1FQOA 2FR1A 1MAUA 4Z2YA 4E31A 2NX2A 3HNPA 5H81A 3E84A 1ANKA 1M33A 2FEPA 3HTXA 3H0EA 1BQEA 4DMRA 3C3XA 3G85A 2O8DB 3NHLA 1CIVA 5AVYA 4S2EA 5BYJA 3ZX4A 4AG3A 1PNVA 3IUQA 3T0IA 5IASA 4BNGA 1L6RA 3CXRA 3OEEA 5DTQA 4XD7A 1PS9A 1R3DA 3GIWA 1VLZA 2JJ2D 4YQZA 3NV7A 3C4QA 1RRPA 1X39A 5IXSA 1QK5A 2YQ4A 2QYOA 4OQLA 4F2HA 1G8MA 3OWXA 4GF5A 3QJYA 3UICA 2FAXA 2WTUA 4GMDA 3BE8A 2JVJA 1K4MA 4FGZA 3BC1A 1B6SA 2CEKA 5FPPA 4FHDA 2WYOA 2QP9X 2NO1A 4L5BA 1VA5A 2VQFB 5HFAA 2ZIZA 4MVXA 1BDHA 1GUAA 1JI0A 2WJHA 1NVBA 3GFBA 5E1DA 1T1GA 4YO8A 4CKYA 1BSVA 3PQ8A 5TQVA 4ETIA 4HDMA 3ADDA 3QLVA 1S0UA 4UAJA 5EJ4A 2IS1A 4ZODA 1YDEA 1U8CB 2IYXA 4COKA 1JHRA 4B3XA 2LVBA 3ZWAA 4CT0A 1W73A 1E6KA 1WV0A 4B2YA 1T9AA 2WWHA 3HKDA 1QGED 1RS0A 1P1FA 4MVCA 2B4AA 1GWNA 1E2PA 1SXJE 2AV6A 1F3LA 2NUAA 2VPYA 5KB3A 5AICA 1M5TA 2OO7A 4L27A 3TB6A 2PUAA 1XF9A 4E2ZA 3BB4A 2AFHA 3DVAA 1QFMA 1T8SA 3AF0A 3PPXA 3AM5A 4UC0A 1C5KA 5KYVA 2ZIXA 5E3JA 3OUZA 3IVXA 2H06A 1W8IA 1EGHA 1L7PA 1M1UA 2OD9A 3R5HA 4URHA 4I1RA 4YJHA 5F76A 1SQSA 1BCRA 3A1TA 4HQ6A 3IE1A 3EPJA 5I6DA 1CF2O 2JJMA 3TLBA 3L04A 5AW4A 4GOJA 1M72A 4RTQA 3FFTA 3WRXC 4DLUA 3MRSA 3QXXA 4B2PA 2ZR0A 4BV9A 1T4DA 3M2TA 3C6ZA 2Y1WA 3B3QA 4G0NA 2JJ2A 4YRMA 4WCDA 5E9QA 2VSYA 4AXXA 1JQ3A 1WL8A 1J20A 1WKBA 4BYMA 4F8EA 3WKAA 3RYFB 1BS1A 3KWJA 4OMDA 1GD1O 4G5HA 1JKJA 3DDSA 4R8VA 4V0QA 4XVQA 6ABPA 4QO7A 4Y6RA 4EHNA 4ABYA 2W4MA 1GXSB 2BR5A 3AJ8A 3D81A 4LG1A 1FDWA 2JHCA 5K4AA 5TT1A 3T7TA 1QS0A 3CXUA 1BNCA 2JH8A 3LT4A 3T9FA 4I9HA 4BNFA 1REQB 2XMCA 2XUFA 1QQBA 3L77A 4LDAA 5F7XA 3CTPA 3G49A 3RF7A 1NNSA 5SY6A 3ZWOA 2AMJA 3ZHTA 4DJEC 2EFEB 4IDNA 4BWFB 1H2HA 4U7HA 1VLMA 4K9SA 1IQ0A 1U3UA 1G2IA 2IZ6A 1LI4A 2C5LA 3R3VA 2WPDA 4MDHA 2ZJAA 1EJ2A 2PRIA 1VSUA 2JLQA 3CLUD 3DB1A 3GR6A 4ZCIA 1LY1A 3HDGA 1OILA 3GDWA 1NHGA 4OJNA 2HBZA 5EIHA 4LXTA 4BNNA 3ZCVA 3FFWA 4B45A 1R1DA 4UDYX 4BLRA 1K7XB 2C3YA 2B1RA 2WIKA 4JP2A 5JHHB 1AUQA 1SVIA 3AESA 1XXLA 3AM4A 5AXBA 2V9ZA 3S29A 4AMGA 1QU3A 2OLEA 3VNUA 1QH8A 2JIZD 4QOEA 1IHDA 5A1JA 3AR3A 3QKRB 4MJXA 1NXQA 2WKWA 4B8WA 2MMGA 5BN4B 4BE4A 3BH7A 1UEJA 4GLOA 1EFLA 1LQUA 5HVNA 5ALNA 5BN3A 4N6OA 1B42A 3Q7RA 3THYA 4HYTA 3IAXA 3FVTA 3IT2A 3WWPA 4U00A 3ZLUA 1NE2A 4EGSA 4N03A 2O54A 3I61A 4BNZA 4QXQA 2PGXA 5B2FA 2Z5FA 5AH0A 4ER5A 4YUAA 5HUHA 4Q12A 1RXCA 2EFHB 4B4DA 1X86B 1AKQA 1KH2A 4F5ZA 4I5FA 4LC1A 4WBNB 1N5MA 2ZUSA 4IKOA 5F2OA 3QELB 3B1VA 2YHAA 1E8MA 2R6R1 3H86A 3LECA 2P1RA 3G2QA 3JAWA 4PZLA 4YASA 1T2FA 1H6DA 3DE3X 3E1SA 3QF4A 1EVIA 2QRNA 5GQSA 3SKVA 3S68A 4MJLA 3AMVA 2IZ0A 2A7XA 4Y6SA 5IJ9B 3NBFA 3B12A 3H3FA 1FXSA 4ENPA 3QE4A 1T25A 1VC2A 2NWQA 3C8HA 1KJNA 2K7ZA 5FNVA 3K9WA 3BICA 3ZCSA 1YQUA 4XFJA 5J3JA 5HF9A 3FGNA 4D5EA 4N65A 3SEAA 2SCUB 3C5HA 4DG8A 1ZP6A 1YIDA 4LRUA 3EEOA 3HWWA 3ND9A 3O74A 2FK7A 2HFKA 2C3PA 2ZRIA 3H65A 1EWQA 2M1ZA 4KE7A 3DT9A 1PU2A 1Z18A 3JZFA 1EUDB 3AGQA 3GAMA 3GWZA 4LVUA 4UUMA 4UVHA 5AVWA 1DPFA 4M0FA 3RKRA 3LYHA 2EC5A 4RDIA 3EJ6A 4FYJA 2ZXFA 1L7NA 9ABPA 2QUJA 4EIWA 5JCZA 5JWOA 3ICEA 4W99A 1G55A 3HCDA 3ZD9A 1HQCA 3DO5A 2FPOA 2O7QA 1UDRA 3FTCA 1ETHA 1QTIA 2VZ9A 4DWOA 4BGIA 3TFOA 4MV4A 1HX7A 3HE3A 5FBZA 3R40A 4TVKA 3UH1A 4YMLA 1PR9A 2IHJA 2YVKA 4QU8A 3P2OA 4AUEA 3FI0A 4WAUA 4UMDA 3SN6A 3ZWCA 4GMXA 1H2XA 7AT1A 4NZMA 1Z2DA 3MPOA 3RG2A 4GT1A 1D1TA 2ZETA 3HPQA 2CDCA 1R8QA 2FXIA 4EMUA 1NVGA 1ZEMA 2GRAA 4C0JA 4O33A 4BOYA 1QG0A 4JC8A 5K8CA 4M7RA 5LYYA 3WGIA 2SNIE 3DDOA 3F7TA 5LPNA 4GH5A 4WN9A 3H13A 2Q6VA 1R0WA 3DMGA 1V5WA 1KS9A 2YXNA 3D54D 3P9KA 5G1NA 5E6RB 4FQ8A 4UEJA 1TKAA 3ZIAD 5BNTA 2IU0A 2J4CA 2I33A 2L17A 3IOBA 1SHKA 2FR0A 5ETJA 1RACA 4I5DA 4UEWA 1KBOA 4QVIA 1GRQA 2VA9A 5AUNB 1F7VA 1XAGA 3LCMA 4V0KA 3RVOA 4N49A 4Q48A 1BMFD 4C0KA 3A1NA 3PFKA 4XSVA 3LBAA 1M2HA 2Z6VA 1AK1A 1U6IA 2ZROA 4Z9AA 4CLDA 4KFSA 4YCAA 3HBMA 3WBJA 4FDMA 4YRIA 3M6LA 1KI1A 1SXIA 2QM7A 4TWBA 2VJMA 4DMKA 4ZV4A 5C52B 2O8EB 3LV8A 5ED4A 3EIQA 4QUIA 3TCKA 1GP2A 1ZSNA 3R5KA 3DE4X 2B20A 3COJA 1RYDA 1PK8A 2H11A 3AX6A 4S1PA 2QLJA 1SZCA 5GMOA 3MA0A 3NHMA 2UXBB 1E18A 1MJNA 1WCIB 4FYMA 4Z49A 1DJPA 2H1SA 5CFNA 3IO3A 3PHBE 2A5JA 2BDTA 4Q7LA 1O4WA 2QU7A 5HPYB 2ZYGA 1N2GA 2R97A 3SZGA 5CUQA 3ZV4A 5I5EA 3WLIA 2RMKA 2XKAA 4KCGA 4PBRA 5GIPE 4RENA 1E3QA 4A73A 3OI7A 4ETNA 5BVHB 1VIDA 4XPIB 1DXHA 3WIUA 2NU9A 3KVNA 4P81A 1TM1E 3PX3A 5ALIA 1A95A 4M9UA 5IM5A 1PKEA 3KDAA 1X80A 5KNBD 1GAQA 2E4YA 2PT9A 3O7WA 2PKEA 4WNIA 5CLFA 4PLHA 1Z28A 3AF2A 2YTZA 3IIKA 1XZCA 2GH1A 4I2NA 4M37A 5FWAA 1FY2A 4ZVSA 5IABA 2XGJA 4IHQA 4KWTA 1NA5A 1NQXA 3LY5A 3QW4B 1XTBA 4FIZA 4HBGA 3V33A 2NVUA 3BVPA 3SHQA 1NQ5A 3P71T 3QU9A 1JHXA 3NC1C 1BVRA 3QGMA 1PQUA 2AFHE 4F2GA 5AW0A 1RMTA 1AQIA 1RI5A 2VRCD 1FTNA 1Q2UA 4E2FA 4PSAA 2C59A 4ZHQA 3EDRA 1RFGE 5HQ3A 4B4VA 1K5GA 2YRWA 2HWWA 3HSKA 1CFZA 1H05A 3JQCA 4ZCSA 1ZVVA 2PZKA 4S04A 3BL8A 5H16A 3UK6A 1SU6A 4JELA 1KMMA 1B73A 1NQOA 3UWMA 1JAXA 4JLSA 4UHJA 1C2YA 4BMPB 2FMFA 3JW8A 4NF2A 3RM3A 3UMMA 3ZHQA 5KKNB 3M4XA 3EE6A 4R51A 4MGKR 5DLPA 2C95A 3VSEA 3KQLA 1Z2EA 1R5NA 1XZKA 4FXPA 1KAEA 4H7KA 4BS9A 1UZUA 3ZY3A 1NNLA 4Q47A 5JTTA 3KZCA 3EVNA 3UUGA 3AO0B 3NRCA 5GV8A 2VATA 4K6CA 3B9RA 1DQYA 1V41E 4W1QA 1I8TA 5KPJA 1J8DA 1G3IA 4LCEA 2WOJA 3TXAA 4FSHA 5AVUA 2ORVA 3PUJA 4DAEA 3TZBA 2HJ9A 2RHOA 4HAXA 3G13A 5KTNA 1U0OC 1VB3A 2UZ1B 4ZGWA 1TO2E 1VFNA 5ALZA 5FKJA 4HDRB 4TGLA 3U3OA 4AF6A 3HABA 3ZU4A 1PN3A 1I14A 3WRYC 1ZISA 3FPBA 5FBRB 3AERB 4ETMA 4IHJB 2XE4A 3KB8A 2XZOA 4OCZA 5K05A 2EWVA 5E1MA 1UMKA 1JHOA 1E3WB 2P4UA 3ZY2A 4G1EB 1AH2A 2WDPA 4DSOA 2CC2A 2HWXA 2ZYUX 1DWQA 1RKBA 1IJKA 2OV2A 3P9SA 4TXNA 3ER9A 2GKGA 2FPLA 2QRLA 5DRTA 1CLUA 1S9HA 1NVAA 2YZKA 3I01M 3MN1A 4EH1A 4QLOA 2R751 1C8KA 4GYJA 5BRNA 2CLDX 2BGLA 4W7HA 3BGWA 4WLVA 5L4SA 4MUYA 4WKNA 4F46A 1NN5A 2NYRA 4BO3A 3SM3A 2FR8C 3B3JA 2C4TA 1MVOA 1OVGA 1SULA 2VAVA 4JEUA 4MKHA 4MUGA 5G3YA 3S7TA 3WLTA 1P1JA 2X41A 2A5FA 1YU9A 2OB1A 1LGYA 2VO1A 2XCOA 3QLUA 4LRYA 2QZZA 3HQ4O 4MA4A 1CY1A 4Q3OA 4R1NA 3TNLA 5ABPA 2WSSA 4IMPA 4L22A 4RULA 1UMDA 1Y34E 1ZL0A 1TJYA 2A3RA 3K9QO 1UK7A 2RKBA 1YFKA 2ZIEA 4U5XA 5FBKA 2AKYA 3PPYA 4COOA 1WIWA 3CINA 3SPXA 2QMEA 1QPBA 1JR3D 1K4KA 1YZLA 1B1AA 3PX2A 4TTTS 5JS6A 3VHQA 4DLVA 2C9MA 5JECA 2WTXA 1D3AA 5CDHA 4NK4A 4DNOA 2ASVA 2I8AA 4IX1A 2JLAA 3K15A 4G4GA 4WXMA 5EP1A 4ZI2A 1U94A 5K03A 1XTTA 3H2HA 2CBGA 4KYTA 3A8TA 5EYPB 4RD2A 2JAXA 4UZEA 2BRUC 3GVPA 1ZLYA 3ESRA 5DX0A 2OPHA 3I8XA 2GQ0A 2R7LA 1MZVA 3BGDA 4CIWA 3R9IA 2BBWA 1UJ4A 3OE1A 3CVYA 4KI7A 4JHLA 4AZ3A 1XV5A 1RLUA 3O1LA 3FGOA 5IZCC 1KK3A 2VT6A 1NXPA 4BE9A 1EWYA 4E6PA 1KI2A 1JVNA 5KYXA 5BPHA 4JDPA 1M2KA 2FSGA 5DM0A 4D0GA 3ZJTA 1A9XA 1E4YA 4LYEA 3MTDA 1CDDA 1G41A 1S9DA 1L5ZA 5CYFA 1X1TA 2ZYAA 1Y8ZA 1TUIA 1DTWA 1CJSA 2ZB7A 3QMVA 3GJTA 2Y1CA 4JT2A 2JFNA 3E7WA 3LUJA 4KMMA 5JWHA 1PS0A 4IL5A 2ILVA 3A2LA 2NUTA 3O8NA 1SEPA 4TQ9A 3HJTA 1EE1A 4O4HF 2QXUA 2EW2A 5DI9A 1II8B 3DLPX 1W4AA 4L9SA 3X1KA 2XTMA 2IGTA 3GPBA 3K1AA 3P96A 2IPOA 1BE8A 1WSWA 2QG4A 2AXQA 3OCCA 2C3UA 1T9HA 2H3EA 3UMBA 3A1VA 1XTUA 2GASA 5IW8A 4EUFA 3PEVA 1L5VA 4PYIA 2H31A 3V46A 2WJYA 3NDIA 4U7JA 2J0UB 2J3IA 1XMPA 1LW7A 3TL6A 4BX8A 5B58T 1GGEA 4QFDA 5FPYA 4CQMB 4JYAB 3TZ6A 3EQ9A 4EP1A 1ODFA 2B83A 2EQAA 3FIUA 3DFKA 1JIVA 1EM8B 1YVDA 2NQ8A 2VSOA 4J7CA 4PLYA 5CA1A 5JYEA 1BJTA 3U6BA 8ADHA 4CKBB 3GDHA 3FGPA 3K16A 4JNCA 1VYTA 2I7VA 1YRAA 4LWOA 4FGSA 1PKXA 5D3MB 4GPTA 4D99A 4HLDA 5EPUA 1UOOA 5CVEA 4NBNA 2GWRA 4R54A 5DHFA 2F3TA 3IQDB 4YJGA 2N47A 5BSMA 1LWOA 1SWWA 1E62A 1Z6GA 1U5BB 4KQ2A 4RW0A 3SZRA 7REQB 5LP6B 1H94A 4XM1A 1GGNA 3HP1A 3TQIA 4F04A 4B3BA 2QGFA 1Z7WA 4OXXA 3HKBA 5M04A 1DFHA 3EF3A 4UU7A 4XX1A 2FQYA 4PZPA 3CGGA 4ZZ2A 1T0IA 1A72A 2TECE 9LDTA 1IM8A 3I2KA 4AZWA 1U2EA 2ZDGA 2P3QA 2JC3A 2Y6UA 3K09C 2JH3A 1EB8A 2X2EA 2JIMA 3GEGA 2GRJA 1ZRMA 2YOGA 3F5MA 1QP7A 2NO7A 1PNOA 1SOUA 4LY9A 1G7CA 2GARA 4V3BA 4D25A 2IQ5A 1G1AA 1M3SA 2CJFA 2OUIA 2OBBA 1QO0A 1ZY2A 3D5TA 3WADA 1ZGZA 4JXKA 2C07A 1Z88A 3B1WA 3JAKB 1S4QA 4UNQA 3RABA 3K5IA 3FF1A 1GT6A 3PQ4A 4LYJA 4RQUA 5ALPA 5DCWA 2BFDA 1DT5A 3W5SA 5B4TA 2PL5A 2R00A 2DECA 1HYEA 4KC0A 3KIPA 3T7CA 1GRNA 4V2IA 3L7NA 5EIAA 1XZNA 3PPWA 2ZSBA 4Q3LA 3DWEX 4AW9A 1WNTA 2MYTA 2VJBA 1Z26A 3B20A 3T7JA 2HMWA 4PQEA 3VOTA 3TBHA 1DC6A 1RWXA 1SQ0A 1TAQA 2ZG6A 3L6UA 1LVGA 4TTPA 4X8MA 3LWZA 5CAEB 3AUKA 3BDIA 1FFHA 4OBXA 3T35A 3WB9A 3KOMA 3U13A 4DCSA 1GCUA 3AF1A 4GZ3A 4F6RA 2CZQA 2HIAA 1GUFA 2ONKA 2QW0X 1FTYA 1KO1A 3WY9A 5C3MA 4QICA 2VAPA 3UHJA 1G9SA 2OHXA 3HDTA 3O94A 4R31A 4RIGA 1YR7A 3C98A 3M1IA 1HLPA 2AVNA 4Y6QA 1KE1A 4HO1X 5IBRA 5FBQB 3UMRA 5HZMA 1U65A 2C92A 2OC4A 1T5IA 1XDBA 2Q6LA 3CLRD 2A5GA 3N2ZB 3R7BA 4D42A 4DV3B 1H42A 3E7PA 1C81A 3FKQA 4XQ0A 2IQIA 3RYIA 3ROMA 2C8JA 2ODWA 2X6TA 3T1YB 5L3VA 1AQJA 1IUKA 4GPEA 4OUKX 1E2KA 3O0DA 2G07A 3NGMA 1GPBA 4BMDA 1ABEA 2W48A 1JLLA 2O8BB 2R4UA 4MW9A 1YB6A 2B35A 4UTVA 4MJ7A 1ZHOA 1YJ5A 3B2NA 5MDHA 2HA5A 1EBUA 4ZT7A 2QAGB 3A6DA 4KIWA 3UT0A 1RXIA 3GEEA 3A4TA 3M6UA 5EMNA 2AZTA 5H80A 1Z08A 2QRGA 4ODIA 1J07A 1XG5A 3RJZA 1T6XA 2WTAA 2PEYA 4LJYA 3Q72A 4Z86A 1O6CA 3MOIA 4HFRA 2WHYA 5E7QA 2GPNA 1IU9A 4R16A 4YXWD 4DCJA 1I1QB 1AK9A 3PNSA 4ZGBA 1JAYA 3DTVB 3VNAA 5L3SB 3MILA 3Q9SA 3R8CA 3PNVA 121PA 4LHEA 4WZAA 1ZYUA 3QNUA 1F2DA 3QKSB 4BO1A 1MG5A 2J3JA 1E2FA 2HDWA 1G19A 2Q6KA 2RHLA 2XY4A 2ZYSA 2AF4C 3ECAA 3IP5A 3X2FA 2Q41A 3GARA 4O2BF 4AZ0A 4D79A 3RBVA 1FNNA 3Q10A 5DZSA 3WHPA 2C2BA 1AXEA 4RTNA 1DJQA 2H92A 3OMWA 3PDUA 3QVLA 4LMAA 2IOFK 5EIOA 4DDUA 5C8XA 1W4CA 3ZGZA 1RMYA 3C0KA 4UULA 3I09A 4XB1A 3K05A 5FL7D 4MLCA 1S7CA 1KDOA 4NJEB 1BWPA 4J0HA 4IIDA 3RKSA 2PGLA 5DISB 1M5RA 1UADA 4ND1A 4UAUA 1W7AA 2R8ZA 1ZD5A 1JEEA 4PBSA 1SRQA 1CEQA 2OGUA 2Z83A 3FB1A 2W22A 3EK2A 4GWLA 1U7UA 1ULSA 3WYFA 2FYTA 2D3TA 4ESHA 1K8QA 2CV0A 4BZQA 4YAEA 5LLTA 2XCQA 1R0ZA 1XJWA 1B16A 2CBZA 2RKWA 2X3FA 3KB1A 2XUZA 1U8EA 3LFUA 3PUIA 4ZQGA 3O8CA 3L02A 1W1WA 1V47A 5A4JA 3OJOA 3ZYCA 3A32A 3G1UA 4FE7A 5A1TA 4W9MC 2QV0A 3EZ7A 3EFEA 1KYYA 3G0OA 3RYCA 4RMJA 4E4YA 5K0BA 1ID1A 5H3CA 1NY5A 2XKBA 1NI3A 5AKEA 3VVLA 5LQJA 1P2TA 5GWXA 3AY6A 1RHMA 2JK1A 3Q2IA 3BE4A 3WNZA 3S40A 2JASA 2GK4A 4V0RA 1E5TA 4YXWA 4TT8A 5ITSA 2IS4A