4BTVA

Structure of phaz7 phb depolymerase in complex with 3hb trimer
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
344
structure length
330
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHAMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNAAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAYNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
total genus 125
structure length 330
sequence length 344
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4btvA00
4MQMA 4X85A 4GECA 2CBGA 2YYSA 3FBWA 3FYUC 1GQSA 5ALFA 2IIVA 4Y2UA 4EB0A 4MYDA 3H1BA 4BCCA 1XZHA 1CVLA 5AICA 1EDEA 4MYSA 5FPPA 3PF8A 4DSAA 4J0JA 1LPMA 3QPDA 5HF8A 1Q84A 1EH5A 1CUFA 1CPYA 3QITA 1G4HA 3WL7A 4Q3OA 4OB7A 4UBLA 2WG2A 3VXKA 5CT5A 4KE9A 3AIOA 1FFDA 1XLWA 4X91A 1XQVA 3ESDA 1QIKA 1J06A 5HK9A 4RE6A 3LCRA 4PSDA 3KWJA 4EUSA 4FFWA 3C87A 4GI1A 3FYUB 3JYHA 5ALKA 5ALQA 5C8VA 2XQKA 1TKRA 2EEPA 4CG3A 1QZ3A 1KEZA 2QJWA 3I1IA 4WFJA 2XMZA 4H7DA 1E3QA 1C7IA 4V2IA 3WLAA 2DFPA 2PUJA 2HA3A 3HLKA 5AOBA 2XUOA 1E8NA 2PSDA 4LXGA 3KXPA 1DWQA 5DTJA 4YX9A 1U4NA 4BYMA 4N8SA 5ALRA 2ONCA 3M82A 3FLBA 4AN0A 4BVJA 1L7QA 4WFKA 3UUFA 4QDZA 2AXEA 3ZI7A 2PL5A 1JU4A 3ANTA 4B9EA 2PPLA 1ORVA 2J3DA 3H19A 3VDXA 4UBIA 4K6KA 3WK8A 4Y2TA 1C4XA 3CN9A 3V1KA 4PV7A 4LKOA 1LPAB 2VEOA 5K3BA 4OUKX 2DR0A 5DNWA 4W9RA 3BDVA 5AOAA 4B85A 3N0TA 3UUEA 4EY4A 5JALA 2QRUA 4KYVA 5ALXA 1QO7A 3PFBA 1CIJA 2VAVA 1HKHA 3W9BA 2JGLA 4H7IA 1ZIXA 3SWWA 5AM4A 3K2IA 5ALLA 1ODTC 2JEZA 5BWBA 4OYYA 4RPCA 3WL8A 2OQIA 1QFSA 3D2AA 5AI0A 5ISMA 5BWCA 1JJIA 1EINA 3O4GA 5CT6A 2WHRA 3WWEA 1ZGCA 3RARA 2BJHA 1MN6A 2RONA 2RI6A 4GBGA 4NVRA 3GA7A 2XUPA 2Z5GA 3R0VA 1UXOA 3DL7A 5D3ZA 1IVYA 4C6HA 5HKBA 1USWA 3V48A 1X2BA 5DYYA 2WTMA 3WK5A 1UFOA 4A16A 5C81A 1W75A 3CCCA 4HRYA 3D0KA 1ZD4A 2VJAA 3WA6A 1MO2A 2OPHA 3I6MA 3WWDA 4HVTA 1YAJA 1BRTA 4F0JA 4GHWA 2ZJ6A 5E4TA 4Z49A 3V1NA 5YASA 1THTA 1C7JA 1U65A 3IVMA 4B81A 2QM0A 3STUA 2E3JA 4U2CA 2PSHA 1CUJA 3C45A 3QMMA 1E8MA 1OCEA 4MXDA 1WHSA 3PDCA 5FOQA 4OYLA 1R50A 2QS9A 1OILA 2QXTA 1T2NA 3FCYA 5LLSA 6YASA 4J0KA 3MUOA 1LBSA 4Y2VA 4DMHA 4QLOA 5LKRA 3VKFA 2VSQA 3FNBA 1N1MA 1UK6A 2BGNA 2ZYIA 3H0CA 3CN7A 4CG2A 1XRNA 2JIDA 4BTLA 3I2JA 1W1IA 3DS8A 2O7VA 2WLSA 5JANA 2WIJA 4F5ZA 1XLVA 1WPRA 2HA6A 4PQEA 3AIKA 2WUEA 3SC2A 3RK4A 2G63A 3WKCA 4G4JA 5JD5A 1WB5A 1THGA 5AK5A 4QA9A 1JMYA 2Y6VA 1A88A 3PE6A 2YXPX 3O4HA 1P0MA 3ICVA 3MGAA 3KDAA 2XE4A 2PU5A 5JZBA 4KRXA 3M83A 4AO6A 1TCCA 4U2DA 1L7RA 1MPXA 4BBZA 1FSSA 4LYEA 4PW0A 1AGYA 2H7YA 2ZYSA 1CUIA 3SK0A 5I9IA 1Y37A 5K3DA 1R4ZA 1MX1A 3R3ZA 3R3YA 2GBCA 4X97A 3E4DA 3HJUA 3HABA 3M3DA 1CUUA 1QFMA 5CRIA 3Q8WA 1CUGA 2GBFA 4ARBA 2YH2A 3C6ZA 2XUQA 4TVKA 3EBLA 1XROA 1CQWA 1CUDA 1JJFA 4Y2QA 5HFNA 4BAZA 2PU7A 5A7FA 1XRMA 4BP8A 4FHZA 4GDMA 4UPDA 1QONA 1X70A 1F0PA 2D5LA 2QT9A 5AM5A 3WJ2A 1SCQA 5ALGA 1Y7IA 1BN6A 5HQ3B 1TRHA 4IH1A 1XQYA 2VATA 3AILA 2BGRA 3O9VA 2WFLB 3H18A 5LZ7A 1CUZA 4CIAA 1KU6A 1ZOIA 5AKZA 1A8QA 1ZJ5A 1CUEA 4ZV9A 5AI5A 3D4LA 4UBKA 2VA9A 3WK6A 1EDDA 3GBSA 4Y2SA 1DTEA 2JGKA 4E11A 3IURA 4CG1A 1JMKC 3YASA 3PFCA 2J4CA 1MNAA 3WK9A 2Y2VA 2DQZA 5CXUA 3AZOA 4N8DA 5A2GA 4B83A 3W04A 4WDQA 4MJ3A 1LBTA 1SC9A 5T4HA 4UBOA 3BIWA 4H35A 2P8SA 2ZJFA 4B0OA 3WA7A 5DYWA 4IO0A 3HEAA 2CB9A 1AC5A 1YSCA 4H77A 3G0BA 3ICWA 1EXWA 1HQDA 3OOSA 2LIPA 2GYWA 1T4MA 5JD4A 2WSLA 5AKIA 2XMQA 1XZMA 2I78A 3QBJA 4EHBA 1TAHA 2FUKA 4B80A 1CUCA 3STVA 3R3XA 4OSEA 1CEXA 5AK6A 3HZOA 1ZJ4A 3C5WP 1A8SA 2HU5A 4CFSA 4Y2YA 3DEAA 4W1RA 1I6WA 2QVBA 3LP5A 4HAIA 1QO9A 3I6ZA 2RHTA 4AO7A 3STXA 2PSEA 1BEZA 3VJMA 2XQJA 1GXSA 4LHEA 1FFAA 2XLBA 4BDSA 5ALTA 1MAHA 5FV4A 1JI3A 4Q3LA 2AJCA 4W1QA 4ZREA 4JH0A 3RLIA 1LZLA 1M33A 1XZJA 1WHTA 2XUAA 1CLEA 3BDIA 4X92A 1YASA 2QUAA 2PSFA 5ALNA 2ZSIA 1ZI8A 2JEYA 4ITVA 3V9AA 4ETWA 3HRHA 1DQZA 3E0XA 3W2TA 2B4KA 2HA0A 4FTWA 1DINA 4IHAA 1QIIA 1QIGA 4J0HA 1K8QA 1NU8A 1BS9A 4FFVA 3H2GA 1NX9A 2EDCA 2C0PA 1PFQA 1AX9A 1DWOA 3NUZA 4OB6A 5AKGA 3T4UA 2IITA 3G7NA 5ALWA 2Y1KA 2QXUA 4WY5A 1BU8A 3FSGA 1XZFA 5E2IA 5CMLA 1SOMA 3ESBA 4FNGA 4Y2XA 5JIBA 1FFBA 2BUCA 1K6EA 2QTBA 5BV7A 1GKKA 3V1MA 1PJAA 2ECFA 2VQ6A 3BE8A 4X6UA 1TIBA 3MUNA 2XI4A 4RNCA 1AMNA 2HU8A 5EFZA 2JGEA 1P0IA 1W4LA 3KSRA 5AO9A 1GGVA 4EBBA 2PVSA 3D5EA 1XRQA 4ROTA 3C6XA 5A71A 3HACA 4Y2RA 5JASA 3AZQA 1QGED 3DKKA 5DNVA 4EY6A 3IUQA 2VJCA 4AX4A 1H2YA 5JADA 1YR2A 1AKNA 4UHDA 2CUTA 2XLCA 2OAGA 4BRSA 2WU4A 5EHXA 3STWA 1N8SA 2AJDA 2AJLI 4A23A 1BCSA 3ESCA 5DTIA 1UOPA 2XUKA 2BCEA 4ZWNA 4UHBA 1JJBA 5JAPA 4NS4A 1XKTA 4Q3KA 4C4YA 4YASA 3F98A 4GLBA 4H0CA 4BVLA 3L1HA 2BAGA 4NZZA 4M0MA 3WI7A 5ALSA 5JYCA 2J4FA 1YB6A 3ZPXA 4Q82A 4G8BA 2OGZA 4W63A 3B5EA 2WIKA 4AMYA 1YS2X 1AQLA 1N5RA 2BKLA 2RHWA 5KBYA 1YA8A 3LIIA 3DL4A 2WUDA 2WHQA 1DT3A 5AKYA 2H7CA 4DNQA 3DJYA 1HDEA 5AK4A 3QYJA 4G4GA 1HLGA 2QR5A 3LLCA 4DIUA 4XWGA 1XZAA 4J0DA 2GYUA 1CRLA 4KE6A 4CCWA 4F60A 3STTA 2OCGA 1VE6A 2XUDA 1A7UA 4BZWA 4UHEA 2UZ0A 5T4FA 2B61A 2V98A 4BE9A 3WK4A 2WU3A 2HADA 4FNMA 3WZLA 1EVEA 1UK8A 4FBLA 1QTRA 4K2AA 4N8EA 1ACLA 1AURA 5ALIA 5C7YA 4GW3A 4RGYA 1CUXA 4HS9A 2PKYX 4X95A 3STYA 3VISA 3HSSA 4AZ3A 1MT3A 4WY8A 5AI4A 3SX4A 1H23A 3TJMA 2OQVA 3KWFA 1VJ5A 3IUMA 4I3FA 4UFNA 2CEKA 4CIBA 4Y2PA 2XQIA 5BOVA 2GZSA 1U2EA 4G9EA 5T4BA 1XZIA 2XMDA 3GFFA 5KWJA 2VT7A 4OU4A 4J03A 3QH4A 5K3FA 5ESRA 1BN7A 2XUJA 5EI5A 2WHPA 4L9AA 4KAJA 5DWDA 3DLTA 1NU6A 1TCAA 5CT4A 2JGIA 5FUMA 1QIMA 2O2IA 2CMFA 2V9ZA 3QPAA 2HA2A 2WJ6A 3ZLUA 1DU4A 3FVRA 3C8DA 1GKLA 4DTCA 5AJHA 2ZYHA 3QMWA 1DX4A 5AKXA 3L1JA 5AK3A 4ZV7A 3IBTA 3WWPA 5HF5A 2WG1A 2PSJA 1DX6A 2I3DA 2WFMA 2FJ0A 5AI8A 5CH3A 3F8SA 5I8PA 3B3QA 5ALJA 3R3VA 3T52A 5HF6A 3VVMA 5JAUA 1AZWA 3U0VA 5F4ZA 3BJMA 1JFRA 1UKCA 1CUAA 2WFZA 4J7AA 2RAUA 4YPVA 4UHFA 4UBNA 2DHEA 3IIIA 4F21A 4MQLA 1P0PA 2XQGA 2OCIA 3C6YA 4B84A 1LLFA 5K3FB 1ZGBA 2XMRA 3D59A 1QIEA 3GROA 4KE8A 5C8ZA 3JWEA 2QUBA 3H04A 2J3QA 3WKEA 2HHAA 2VTVA 3A70A 4MWTA 5CW2A 3R41A 5AIBA 1CUWA 5DJ5A 4X6YA 2C4HA 2C7BA 4I19A 2WIGA 5ALVA 4H7KA 1ISPA 2I03A 3WWCA 5ALOA 2XQFA 2ZVDA 1AUOA 3EIOA 2C5FA 4DMCA 4FWBA 1XRPA 5E4JA 3BWXA 2PX6A 3S8YA 5AKKA 3IULA 1CQZA 3G02A 3I6YA 2ACKA 2HIHA 3H2KA 1H2ZA 1XZDA 4DSZA 1QTIA 2WHPB 2XUGA 5LZ4A 5AM3A 4CI9A 3VJKA 1ORWA 1SFRA 2ACEA 1G42A 5LZ9A 1U8EA 1B6GA 1XFDA 3WKAA 4ZGBA 3FLAA 2AJ8A 4CCYB 4UFPA 5DNUA 3M81A 2VT6A 3BF7A 1L7AA 4FOLA 2O2HA 2ZSHA 2JGMA 4DM7A 2PM8A 4HTAA 5LZ2A 5ALMA 2B9VA 2QOEA 4MEAA 4B7ZA 7YASA 2R8BA 1XZCA 3DNMA 3G0IA 2HRRA 2CJPA 4OU5A 2WTNA 1EX9A 3W9UA 5K5EA 4E15A 1IUNA 4OPMA 2Z8XA 5J3JA 5FP0A 5A7HA 1J2EA 5E4YA 1ZI9A 3A2LA 2HU7A 1XKLA 4Y9SA 5ALUA 3E3AA 3ZLTA 4N5IX 1OXMA 3DOIA 2V96A 3C8HA 1EK2A 4BTVA 2O2GA 1QIJA 5AM1A 4UBJA 3FVTA 2QZPA 3QVMA 5ALHA 4ZI5A 3FYUA 1XQXA 3WL5A 4B6GA 1EDBA 4Y7DA 5DYTA 3DKRA 3KD2A 1QIDA 4WCVA 3WQHA 2BFNA 3BIXA 1YB7A 3K6KA 4K6HA 2XB6A 1YAHA 3G9UA 5IH7A 1F0NA 4QDOA 1H22A 1HBJA 1ODSA 5C8XA 3AUKA 5H3HA 3O9MA 3L1IA 4INZA 1E8DA 4IH9A 5A62A 1EB9A 1WB6A 2WG0A 3TRDA 5SYMA 3PF9A 2JGFA 1CR6A 3JW8A 5JD6A 5AHXA 3AJAA 5FRDA 3C43A 4M0FA 5EIAA 2XUIA 1IZ8A 4C88A 3OM8A 1UOOA 2Z3ZA 4HRXA 5KWIA 4AQDA 4BAGA 1UT6A 3O4JA 4QDTA 4BATA 4BAUA 5D7BA 5AKHA 3E1GA 1WOMA 4W1SA 5FLKA 3R3UA 4TGLA 3H2IA 1LZKA 1DT5A 3WK7A 3P2MA 4JUIA 3I2GA 3IA2A 4LIPD 4BC0A 2HA5A 1LPBB 1WCYA 4KEAA 4P9NA 2V97A 4LXHA 4DYHA 4ARAA 3DYVA 3BF8A 4QDXA 2H7XA 3D3NA 2X76A 3WYDA 3KOOA 3FYTA 4J0IA 1BEEA 3DQZA 4EZIA 1YS1X 4JYPA 4KRYA 2X5XA 4FKBA 3QZUA 4MEBA 1R88A 4X3CA 4BCBA 3R3WA 1G66A 3HXKA 4FLMA 4PNZA 4UHHA 1J07A 1RP1A 5IVKA 1EHYA 4G8DA 2WUGA 2WIDA 3ZWQA 3BL8A 4G9GA 4QNNA 5IVDA 5EHNA 3W06A 2B20A 5LZ8A 4FLEA 1TK3A 1UOQA 3IUNA 5FPQA 2XMGA 4H7EA 5EIEA 4M0EA 4D9JA 1R3DA 5JAOA 2RIPA 5AKJA 3NOXA 5CURA 5JZ9A 1QIHA 3A2NA 5EHQA 3I28A 2HRQA 1UK9A 1CV2A 1UWCA 4LYDA 2WUFA 4H7JA 4X7BA 4PSCA 1QIFA 5IVHA 1DQYA 4E14A 1SCIA 3DOHA 1VXOA 3DCNA 5ALYA 3OG9A 3OC0A 5A6VA 3EQ9A 4HXGA 1VZ2A 1LPPA 1XRLA 4XX1A 2DHDA 5HF9A 3AZPA 5CBKA 1QOZA 3I1YA 1GPKA 1SCKA 4NMWA 3U1TA 3ANSA 2CKMA 4BB0A 1VE7A 1VKHA 2G4LA 4KJXA 2ZYRA 4X90A 3N2ZB 2Z3WA 2OAEA 4K5QA 3QPCA 4QWMA 1RWQA 1EK1A 2OGSA 4XJVA 5FDFA 1MX9A 3NWOA 3FCXA 2PUHA 3GUUA 2K2QB 3O95A 2HA7A 3PUHA 1BE0A 5JZSA 3EQ7A 2OGTA 4ZXFA 2HDWA 4L72A 5HKAA 3GZJA 2HM7A 3F9CA 5LKAA 1W6RA 4DNOA 1MJ5A 1FFCA 1IZ7A 2EDAA 5AKEA 2Y2UA 1XZEA 3K9BA 1BROA 3C70A 2BUBA 5CT8A 3X3HA 1LPNA 4AZ0A 4J3JA 3LS2A 3OURA 4QZVA 4QDUA 1ZD5A 1F8UA 4DNPA 2WJ4A 3G0CA 3UMJA 4KAAA 2XMBA 3WKDA 1MNQA 2XUHA 4UUQA 1CUVA 4CCYA 2IX9A 2JGJA 3FAKA 3IB3A 4WDRA 1LPSA 1XQWA 4O08A 2XMCA 5DLPA 2ES4A 3AIMA 3D7RA 3VJLA 3RM3A 3EQ8A 5AI9A 5K3EA 1MU0A 4HXFB 2Y6UA 1XZLA 2JBWA 5EGNA 1XRRA 4EA6A 1XLUA 3OTQA 2PBLA 2W22A 2WM2A 4OCZA 2G5TA 2HL6A 4DGQA 2OCLA 1VXRA 1XZKA 4X6XA 3DDUA 5I7UA 4C4ZA 3H2JA 4C87A 2QJRA 2W6CX 3O4IA 4I4CA 1ZICA 3WKBA 3VVLA 4HXEB 5LIPA 1ZI6A 1GPNA 4J0CA 1JT2A 2R11A 4G8CA 1LNSA 2Q0XA 4E46A 1GPLA 4OD0A 4MWSA 5HFAA 3PI6A 2NW6A 1ZIYA 2H1IA 1K63A 1R9NA 1CUBA 2VJBA 2C5GA 2VJDA 4QEKA 1E5TA 3HC7A 1JU3A 4BRZA 3WWOA 3MVEA 1YCDA 4KAFA 3PICA 4JYMA 1UKAA 3QMVA 4B9AA 2QKYA 5HQ3A 3WIOA 3I2KA 4OB8A 2OLEA 4UBMA 2HFKA 1VA5A 3FSGD 4AMZA 4DMKA 3O0DA 4BP9A 3S2ZA 4AXBA 4RE5A 5ALDA 2QMQA 5D6OA 5JARA 4FDMA 1EVQA 2X8BA 3FOBA 1N5MA 2WIFA 2WFLA 5AM0A 4W1PA 4HZGA 5ALPA 3B12A 3W05A 4X93A 3BJRA 1WPXA 4N5HX 3RKSA 5ALEA 4LXIA 2XDWA 4WFIA 5JATA 4GXNA 4QWWA 3CXUA 1EA5A 1VZ3A 3TEJA 5D3KA 2AJBA 1WM1A 5T4EA 2XUFA 3G8YA 3IDAA 1UKBA 4FBMA 1RYYA 4PSUA 1O6FA 4Q34A 3HYSA 4G4IA 4Q05A 4J0GA 4Y2JA 1E89A 4UFOA 2JF0A 3FLEA 3H2HA 2WKWA 2HFJA 1CUYA 2BUAA 4DMFA 1TQHA 1W76A 3EF3A 1R9MA 5AI6A 2C58A 3D2BA 5FKJA 3WL6A 1Y7HA 2H9YA 4FLFA 1G5FA 2DQYA 1J1IA 4AN1A 2DSNA 3R40A 3NGMA 3WZMA 2ZJ7A 1TCBA 4C89A 1GZ7A 3ZLVA 1VOTA 3ED1A 1PV1A 1X2EA 3QM1A 2CZQA 5HZGA 5ALZA 1W52X 5K3AA 3DD5A 3G9XA 4C01A 1Z68A 2DHCA 4IH4A 1EB8A 4BC1A 3ESAA 3FWHA 1MAAA 1XZBA 4U2EA 5HCUA 5K3CA 3G0DA 4B0PA 1QLWA 2YASA 4QE3A 2GZRA 4PO3X 2FJPA 1QE3A 1Q83A 3H1AA 3AFIA 4U2FA 2ORYA 4H18A 1VLQA 1ODCA 2C0QA 3GELA 1E66A 3F96A 1CFJA 5SYNA 3WMRA 1IMJA 1HL7A 4AB1A 3LIPA 1IUPA 2XT0A 1R1DA 4IQ4A 4YK7A 4JEIA 5FXMA 3A6ZA 3I2HA 1ETHA 3G0GA 4P08A 1LGYA 5HK8A 1DWPA 1ZD3A 4WJLA 4C4XA 1F6WA 3DYIA 3I2IA 4X71A 4XVCA 4JNCA 4XIIA 4KACA 5CH8A 4X00A 1LPOA 1ACJA 3HI4A 2WQZA 2VAXA 2RGUA 4TPKA 1GT6A 4QLAA 1MTZA 1KU0A 3D2CA 4L3WA 3WJ1A 4FMPA 4GWLA 5JAHA 1A8UA 1B41A 4KR0A 1IUOA 4P93A 2G5PA 1JKMA 1H2WA 1D07A 3G9TA 4G5XA 1FJ2A 4EY8A 4DLNA 3F67A 1WB4A 4BCDA 5LP1A 5AM2A 1XZGA 2Z8ZA 1MX5A 1CUHA 5EHZA 5CXXA 4BVKA 1GQRA 3Q0TA 1YA4A 3A2MA 3C6BA 1S8OA 4EY5A 4GEGA 5EIHA 2WJ3A 4G1FA 5AIAA 1Q0RA 1CUSA 1Q0ZA 1VA4A 5CTAA 5CH5A 1P0QA 3AINA 2XMSA 3G9ZA 2D0DA 5IKXA 1H2XA 3WYNA 2OG1A 1K4YA 3ZV7A 1FFEA 5CT9A 4B82A 5AH0A 1BCRA 2GBGA 3I2FA 5AOCA 4KE7A 4DNFA 5LYYA 1UK7A 1ZD2P 2GYVA 5A7GA 2GBIA 5LZ5A 3ILSA 3TGLA 2HA4A 3PUIA 1EI9A 3C5VA 1HPLA 4U2BA 4EY7A 2VF2A 4P92A 4Q1VA 4X94A 3WIBA 4H7FA 1UZAA 4H7HA 5AKLA 4A5SA 3BXPA 4L0CA 4BE4A 3H17A 4S0XA 2ROQA 2WILA 2OCKA 3OPMA 4BDTA 4BZZA 3F97A 4PF1A 3CCBA 3V1LA 4K6GA 1O6GA 4ZRDA 2FX5A 4U2GA 3IUJA 4UHCA 5AP9A 2OXEA 2I3ZA 5IVIA 1K5PA 5KREA 4AO8A 2DCMA 2O7RA 1QJ4A
chains in the Genus database with same CATH superfamily
4N49A 4UJ3A 2PMEA 3EW7A 2OUKA 1TW3A 2WAXA 3HR7A 4MQMA 1UZUA 1JR3A 1YVUA 3CRQA 1EPUA 3FTDA 3GI1A 3NIFB 2CBGA 2YYSA 4FR2A 4GEKA 1BA3A 1OZ0A 2EFGA 2ID4A 3KR1A 2VF4X 2H92A 3QXCA 2BTOA 3EOAI 5D87A 1QAQA 3H4IA 4ZCIA 4TMVA 1B3RA 3PZBA 2H1CA 1KFEB 2J7KA 4TT3D 3CEAA 4UXHA 5ALFA 4HJRA 1GUFA 4UKDA 2PFKA 1B0PA 1KI9A 1BXRA 1KMQA 4P7JA 5HDBB 2JNWA 1F8XA 1R8YA 4A92A 4YY3B 5CLFA 2PJRA 5F9HA 2YJ6A 3OFND 1KYTA 1EDEA 5HS4A 3LOPA 2A5LA 2UUOA 3CJRA 2A92A 3CKLA 4IXMA 3IKTA 1HA3A 1EU1A 2EKBA 1OBCA 3UAXA 4J0JA 2QAGC 1K86A 3H6HA 1WMEA 1GL6A 1K7SN 1O9BA 1EH5A 2I8AA 3IOYA 4HGRA 1Q0QA 2ZAOA 1Y8RB 1CUFA 4F06A 5C0OE 2QW1A 8ATCA 1C9JA 1D1QA 4Y6QA 5B3JA 3PZRA 6ABPA 4GKJB 3OD5A 3A11A 3GVIA 3SAJA 3TLEA 4GXQA 4YJGA 1UOEA 2RGRA 3LGSA 1D2RA 1G4HA 5DULA 2OG2A 2BEVA 4ZQBA 3VNAA 1E5DA 1X80A 5G40A 3TLKA 1LTQA 1QZZA 2P4SA 1V1MB 1TKBA 4WACA 3SJBA 3O93A 3TJZA 1NMXA 1XEAA 1TM2A 2N75A 1OLSB 2JC3A 5EZYA 4EHNA 2H6EA 3WOHA 2PZ8A 3QE4A 3FNIA 2M6KA 4INPA 1FFDA 3J81A 1XLWA 1EFRA 1JL3A 4X91A 5F64A 5HW0A 2X9LA 3CE6A 3O2JA 2Z30A 1KO8A 1TQ8A 5KSWB 3B1FA 2AFVA 3DF9A 4I6EA 2IF2A 5HK9A 4LV5B 4NX2A 1TZJA 2QN3A 4RXUA 5IASA 1CULC 4RE6A 1H8ED 2HT6A 2NOAA 3BN3A 3LCRA 4O2AA 1U9IC 2VDMB 3UT0A 4JASB 1Z83A 4CMHA 4FFWA 3T5MA 1E2KA 2LDXA 5GZ3A 3JYHA 2ECOA 2A5GA 3KXIA 1T4BA 1RDFA 4YCDA 5ALQA 1ZUD1 5KNCA 2QN8A 2QUIA 1P91A 2XQKA 2Z9DA 3FPSA 4ZVKA 4RENA 3OX2A 2O8FA 2BKUA 1Z7BA 2W2LA 1VDZA 3IUPA 1GYPA 4YJDA 5AJUA 4ZD6A 4TV8B 4FOTA 5ARDA 2HJHA 4WFJA 4TKUA 3UWKA 3COWA 2XMZA 3FE2A 5KNDD 3L82B 3WLAA 1SCDA 1V4VA 3MAJA 2JFYA 1MRNA 3QK7A 1EFTA 2H08A 1FPMA 5IC4A 3TFOA 4EL5A 5DBEX 3RF6A 4WPGA 1UMDB 4PM4A 4A6DA 2ANBA 3C7TA 5AOBA 3SBXA 1Q21A 2C9DA 3SOPA 1ZLYA 4OXRA 4D8UA 3KXPA 3O8BA 4KFCA 5BN3A 4GMKA 3C1UA 3IMGA 4MW4A 3PCRB 4V0LA 3X1ZA 1US8B 3G23A 5HYVA 1Y8QA 1YTUA 3EPRA 3VFDA 3LLSA 4R7ZA 3W6OA 1V8OA 3AY7A 3SKVA 1H0SA 1NT2A 3TCXB 1DOAA 4N76A 2H57A 3E9YA 5ALRA 5KAPA 4C7OA 3M2TA 2JHFA 2VG8A 3PPYA 2YMLA 3DD1A 1A98A 3F5MA 3FLBA 3D5TA 1K8XB 2ZSAA 4R3WA 5KTRA 4L5IA 5KIAA 1AUQA 4LZNA 3LNCA 4OATA 2V7GA 4BVJA 2HXYA 2IYWA 2X42A 4I8IA 4K3VA 1YQ9A 4RPIA 3W8FA 3DZDA 3UUFA 1K3FA 2ZP1A 3ZI7A 1QZUA 1Z16A 2XOXA 1EWQA 3WDSA 3CGWA 1E9RA 2PL5A 2Y4NA 1JU4A 4L85A 4RZQA 4MO9A 4JGIA 1IY9A 5J2UB 3T35A 1ORVA 3U9LA 2BFMA 3H19A 2TRSB 1HI9A 2H4JA 3BHNA 2ZW9A 1HFEL 3KJGA 3LZ6A 4HWRA 4RJ2A 2XV1A 4D9EA 3L0PA 1XOIA 1E96A 4MRMA 5KQPA 1C4XA 3QMPA 1J5EB 1CHNA 1SUCA 3I42A 4WKCA 4FCTA 5D2CA 5GY7A 5BQPA 1WV1A 4IWNA 5CDTA 1FMFA 3TE6A 2H17A 1RFGE 3WC4A 4YHHB 2R62A 3FI9A 3HPRA 4R4JA 1F7VA 3GCWA 1SG6A 2HSDA 4YROA 3V00A 1FZTA 1MHTA 3N0TA 2PLAA 4KXMA 1NNI1 4ZHQF 3M6AA 1NVTA 2JJYA 2VAVA 4N3BA 3VZQA 3D8HA 3NJ8A 3R5SA 5C1IA 3B1JA 1ZIXA 3ZDEA 3WLFA 2Z1MA 5JCOC 4OGWA 4JNKA 1VB5A 4AG3A 4HJXA 2A0XA 5ALLA 1X74A 3AONB 3DDHA 1ODTC 2QZJA 3R44A 1PS8A 5EPUA 4FZ5A 3TTVA 3LC1O 1OI2A 4PXYA 1KMHB 4YRNA 1GZ5A 4ZDWA 5BWBA 3WIDA 1T29A 4MIEA 4JYBA 1FXUA 4GMDA 2GJKA 2R7LA 3WGNA 5JLAA 3WL8A 2EKDA 4QPNA 3EASA 2OQIA 2UKDA 4MQEB 5LUBA 4MRAA 1TU4A 3J80A 2NN3C 2B0CA 4N4AA 5EC8A 4A6EA 1EIWA 3NB0A 5C7IO 1DDIA 3QLEA 5CGQB 3CVYA 2IP2A 1EINA 4LF4B 1EGAA 1S01A 3NVAA 2H29A 1ISSA 3O4GA 5CT6A 3WWEA 4EW6A 1XCOA 3A3OA 4PSKA 1NQTA 2GS9A 2RMKA 3DXXA 2ZREA 1JEQA 1QUFA 2YXBA 3QKSB 2R6AA 5IFLA 2ADOA 2RONA 2ZRDA 3ANMA 3LQKA 2Q6LA 3QLUA 4MUAA 5E2AA 1RJ9B 5LL6P 4P1ZA 3HHPA 3AXTA 4N3NA 2J30A 3GA7A 3HCOA 1UM8A 2Z2YA 4HBZA 3JAKA 4FYKA 3UJ6A 4YO8A 2NU6A 4Q6WA 4RZ2A 4DJEC 4F97A 3EF0A 2Z5GA 1VIAA 2OD9A 3I4CA 4EA8A 1CKEA 4WK2B 1UKEA 3DZFA 2C4WA 4DQVA 5JH7F 2KHZA 5THXA 3N1UA 2E49A 1TQ4A 4YRQA 4ES6A 2AOWA 3BCHA 1USWA 2DLNA 4XSGA 2PMWB 2ZIFA 5DYYA 3V48A 2Z4RA 2XOKA 1GZ6A 3R7DA 4YAFA 4AROA 2WJPA 4GPD1 5I7OA 3SZMA 2W6ID 2HF2A 3LX8A 3N5CA 1WXGA 2TECE 3WGQA 3C4VA 1KEWA 1P1KA 3D0KA 1Y7LA 3LDGA 4UTOA 1CDDA 2P2ZA 3BAFA 3N8GA 4NI5A 1ZD4A 3OD1A 1MO2A 4P3KA 4YCLA 1USKA 4LSGA 5D00A 2IHVA 1GNLA 5JJCA 3NRCA 1OJ7A 2II6A 2Y93A 3I39X 1DV1A 4ZO4A 3HJTA 3WWDA 5DSXA 2JJ1D 4C0AC 4GHWA 2FKAA 1UBSB 2XZTA 1F8YA 3DLHA 3ZZNA 1PLKA 2HJGA 1QVVA 2ZJ6A 1IBSA 3EVFA 2RCNA 4A91A 3RF7A 1BXKA 4FGLA 2C7GA 2QRVB 3TTSA 5KNBD 3QSYA 1XMOB 2EZUA 3C6KA 1XD8A 3PD7A 3IVMA 1WBDA 3PYLA 1HEIA 1CY7A 5AVSA 2HJRA 2N1BA 5DMHA 3ZJ4A 1B6SA 4QRDA 2QUZA 1F2UB 5CB8A 3HADA 4A2PA 3IE0A 3HYTA 3QMMA 1ZR4A 3RSLA 5IJAA 1L7MA 1OCEA 3URKA 1WY7A 3LPNA 5ICSA 4IZHA 4QNMA 4Y6PA 1W1UA 3QFSA 3DMFA 4G5OA 3VUEA 1C1YA 1E0JA 2J5QA 2DRIA 2R1UA 4MVJE 3PHIA 3NUGA 1ELOA 2CN1A 2W9XA 4AT1A 3U4QB 5FIUA 1FVHA 2QXTA 2AMLA 1T2NA 1BWQA 1GIAA 2IXEA 3KQWA 4GL2A 2F1JA 4FFPA 2OD7A 2FW7A 1JJ7A 1Z62A 2VPWA 3QUBA 1E5XA 1RLMA 3PXDA 5JS2A 4XWWA 2CLKB 4FFDA 2PKQO 2R6DA 1LW6E 4BMOB 1S2DA 4IYRA 1E79D 3IP9A 3MPUA 4J0KA 4GXRA 1PWHA 3IILA 4KO2S 3ZXSA 5MGNA 1AM4D 4J6FA 4XR4A 1D04A 2BFFB 4DMHA 3SQWA 4C2UA 5AWFC 4U9HS 5LOVB 1E58A 2AXNA 3CR3C 5KOJA 1UK6A 1TZ2A 2ZYIA 1YJ5A 3SR0A 4J0FA 2LWIA 2XNKA 1OLXA 2IZ5A 2HLDD 4BNTA 1XMPA 5IDQA 3NDJA 4CLXA 2JIDA 1GQOA 3I2JA 2H1VA 4F8YA 4BP3A 4HH1A 3COZA 3FPAA 1H4TA 4Q18A 1LNZA 2HHJA 2QLTA 4R8KA 2QD2A 1JQDA 4E1VA 2UYYA 1ZPDA 3CTPA 5DM4A 1BA2A 3RSHA 2AS0A 1GN9A 3CLTC 2CLIB 4QDKA 4F5ZA 2HA6A 3DO6A 3LUHA 3LWBA 3TLZA 1MV8A 4AF7A 1UR5A 1QRSA 1NVVQ 3BH0A 3IMFA 5KB3A 3W79A 1E32A 1BVYF 2IZOA 4CTJA 3BM5A 4BLSA 1WEKA 1CK4A 1T15A 1T9KA 2G08A 2QQ0A 3K9GA 2HHHB 4ZPJA 1TUBA 3LQFA 4QU5A 3E61A 4JUAA 2PAFA 1LJ8A 3WKCA 3MB5A 3KV3O 4U2KA 2EQAA 1N5KA 2X0RA 3WE7A 5HZHA 5JW6A 1GU7A 1WDMA 2I1WA 4IXTA 4MUXA 2XKBA 3RTCA 4BQSA 3VA7A 5DVZA 3DVQX 1KI3A 2PEYA 4CM1A 5K6AC 3P2OA 4F85A 5K0EA 2I6XA 1PJ2A 1HOTA 4PC3A 4MRPA 2XTJA 2VHVA 2WF6A 1JMYA 1JZTA 2D0OB 2Y6VA 3EZ2A 5KCMA 3MT8A 4QJIA 3PE6A 2C7OA 1VE5A 1M5UA 4L0DA 4U02A 3WO0A 1HLDA 1S2NA 1CP3A 3EEBA 3H5WA 4G4SP 4NOJA 4DA7A 3ICVA 2BGUA 2MINB 3UKOA 1G3RA 3Q5EA 1W6UA 3TXYA 2CD7A 3PFWO 2DBVO 1PL8A 4WCFB 2X8JB 3M83A 2UUAB 4LI0A 4DCPA 4GVLA 1TCCA 2EQBA 5EXSA 1Z2AA 3UEOA 3CNNA 5C5DA 3KJNA 1FSSA 1QVWA 5C3UA 3E3OA 3W5UA 2HMAA 2ZRFA 4M49A 1PG0A 2H1LA 4ID9A 3A3PA 4F1KA 2FN8A 2P9EA 1UWKA 1FVOA 2F43B 2AMJA 3BQ9A 2BEUB 2F9FA 3X1JA 3ZBQA 4B4UA 3KL4A 3KIPA 2WHXA 3L8GA 4F5DA 1L4MA 3TPZA 1A9ZA 2DUMA 2PS9A 4B3XA 1XNGA 1JHZA 1LKZA 3H8JA 1ZWLA 1TM5E 2VJMA 2ZSFA 3R3ZA 4FHCA 3DVAA 2YJ4A 2VDPB 4X97A 3SIXA 3S5UA 2CXPA 2AT1A 2DETA 1R12A 5EKXA 1PK9A 1R64A 2IDKA 3ZBPA 4EX7A 2CDBA 5TDHA 5BPHA 1GM5A 5FA8A 2NACA 3HYLA 2R47A 4I1UA 1XVUA 4KGZA 1LSSA 4RIIA 4ND8B 5DTQA 2GBFA 3PFNA 3VU9B 4AP6A 4BLOA 2X3FA 2XAUA 4NYMR 5KNCD 1RLTA 4P0PB 1P4GA 2JH3A 3C6ZA 4DLUA 4B4VA 2H2HA 4HL6A 4ISCA 3UQZA 4ED9A 3KLMX 5A5FA 2EWWA 1RI1A 4ZVOA 1OWMA 3LKDA 3ONVA 2C31A 1YBVA 4ZEXA 1SZJG 1CNMA 3HB7A 1KTIA 2AN4A 3D2LA 5G0WA 5A9TA 3U48A 1V3QE 2P3SA 2XA2A 2PU7A 1XXHE 4F6RA 5KNDH 3T7SA 3AEKB 4FINA 4NCHA 2Q46A 2QTMA 2A1TR 3AB7A 4A6PA 4DSOA 3C1OA 3SZUA 4FHZA 3NBFA 1JTVA 3OT1A 4GDMA 3U3ZA 1NBHA 4A3SA 1XTSA 1A5AB 2X2OA 2R4QA 4PLFA 3RSQA 1XLTA 1QONA 4P4NA 4H0NA 1YMUA 1AZLA 3TG8A 1MW8X 2O4UX 4UOQA 4AZWA 1KJYA 3PL1A 1VBMA 1E3IA 2GBPA 1PTKA 5A03A 2PGIA 2KB0A 3SF8B 2W6MA 3EVZA 1XWWA 4IH1A 1C3LA 1XN1A 3ZC3A 2NO5A 1N1EA 2VATA 1P60A 3S1SA 2P2LA 1GCUA 2WFLB 4FEEA 4RA6B 4CPDA 3L6DA 2YV3A 4Q02A 2X4LA 4ZT6A 3K5WA 3Q2IA 2XE8A 1JRLA 3TDMA 3PSAA 4RV9A 1ZGZA 1ST3A 2BFCA 4NJEA 1XEXA 2JJ2D 4Y9UA 5EZSA 4CV0A 1GKIA 4JCCA 4Q7QA 1XEFA 1Y1QA 1Z4QA 2ASEA 2JFGA 1RACA 2BFBB 1E6CA 1A8QA 1ZJ5A 4FYXA 5AKZA 5BN4B 4DBLE 5AI5A 4PX3A 2AZ4A 3HFJA 1YD7A 1ZLXA 1P29A 3RVPA 1BD3A 1LY1A 1W5TA 3BGDA 3GD7A 3AF5A 3KUUA 2EERA 2ODTX 4UBKA 1NHGA 3OT4A 4G26A 3QVJA 4QREA 4RMNA 1N7GA 1YDWA 5FWAA 3JZIA 3SMVA 2CL5A 4NCIA 3FBTA 2BJVA 3MNFA 1UJ2A 3DMHA 2IU6A 3JQGA 3EXAA 5H1YA 1JEJA 1W4CA 3K8ZA 1JMKC 2QQ5A 1JG1A 3P9SA 4JT2A 3YASA 3IAEA 4E7PA 4EF5A 1AHPA 3K73O 1V2HE 4HAYA 4PAOA 1MNAA 3BJEA 4NPAA 4JIGA 1W96A 3KZCA 4LRXA 1P7PA 1U2QA 2BFWA 4QXOA 5A9SA 1J9GA 1IJFA 2IUYA 2A86A 3N7TA 4EUNA 2A8YA 2WZDA 3GJ6A 5CXUA 1GQFA 1NBIA 2X1HA 1C0IA 4XDYA 3VNVA 4ZAWA 4X7PA 1ADBA 1D4OA 3L7DA 5FF9A 3SM9A 3V55A 1QRDA 3NBUA 1RAIA 3A6FA 3PNOA 2O6LA 3RO7A 3ZUGA 5GIOE 1E99A 4AJHA 4WDQA 1OH8A 4DDKA 4DFDA 4YRGA 3MHTA 3ED5A 5GV8A 4CM9D 2R2AA 1CF9A 4DANA 2GF2A 4KYTA 1QYXA 3V32A 1X7GA 1BS2A 4WZAB 1K6XA 3T06B 2HF9A 4B0OA 3WA7A 3O4RA 4LVUA 4MUEA 3RSSA 2VLBA 3QWFA 1PR2A 4G3XA 5M2QA 4B47A 5DCYA 4IHKA 3E7WA 2E4WA 3KR0A 1G5RA 1J6UA 2YXEA 3B2NA 3M4JA 3PIIA 4IDEA 3I30X 4GPBA 2X0FA 4YRIA 5CLLA 5G3YA 3G0BA 3D8TA 3B6MA 3ICWA 4U7JA 3TQHA 1X3LA 2Y1WA 3PIDA 1HQDA 1QS0B 2I2XB 4LVCA 5E8RA 1YJQA 5EQDA 4EJ2A 3R7LA 5CLJA 2VWQA 4YS6A 5C4MA 2R1VB 1JIXA 3CPSA 3BZWA 1RE0A 3DFKA 2IT1A 2X9NA 3NHFA 1WKBA 2WSLA 4LYJA 4CMKA 3QYPA 5JD4A 4MRSA 4Z1MD 2VBCA 2ZR8A 1OFUA 3AR3A 4FILA 3QBJA 1IAVA 4EHBA 5D85A 1VGQA 1GPUA 1HK7A 3EXG2 4OAQA 4NDNE 5TS3A 3RBAA 1PZFA 4HQKA 2JLAA 5IYZA 5DKFA 5LMZA 4XDZA 1CIPA 1RXEA 1LQ2A 2FPPB 3QVLA 1W0KD 3KVYA 2CSUA 3F7MA 1WXIA 5HA5A 3EZ7A 1CEXA 1F5SA 1JQ3A 1Y3IA 3T34A 1ZMBA 1IATA 1O54A 1L7XA 4R2WA 2WKRA 3T4XA 3S55A 4BECA 1GNSA 1ZWKA 4MUFA 1A8SA 4ND8A 2GPSA 3TFQA 1KYXA 4Y2YA 3CINA 5FAKA 2NYVA 2OHIA 2R8XA 4BKPA 1BOFA 1IEVA 1QGUA 2PG3A 1GPAA 2Z0MA 5EIBC 3TSWA 3TI7A 3VDQA 3ZZTA 1M0TA 1QH0A 1GAQA 1RPNA 2GZ1A 2I6TA 4FSHA 3RVLA 4AO7A 3STXA 3DTYA 1ZK0A 3KQPA 3NU1A 5GM1A 2BLNA 4ETNA 4F72A 2EFYA 2PRKA 5KDOA 1LX7A 4QFDA 3QW4B 2ZFUA 1FFAA 2CLMB 4YRJA 4M1WA 2Q45A 2O8EB 3B78A 1NL3A 2JI9A 5KTYA 1BFDA 2FR1A 4P7BA 4TT3A 2I7CA 1WXFA 4B3MB 2JD2A 2WDPA 4JH0A 4A4DA 3UFBA 5MDHA 2O7SA 2A9RA 2R8EA 3KQLA 3LT1A 1CCWA 3GRPA 4WZAE 1NP6A 2RHBA 3MHPA 2FPWA 1I13A 1EVZA 2BFDA 4TV8F 1L7DA 2OCDA 1KE2A 5CD9A 1BCSB 5E9QA 4FEYA 2XUAA 5IX8A 3NNDA 4MHOA 3MTQA 4PHFA 1L3BA 2MYUA 2QUAA 3P9PA 3FKQA 3RREA 3ZG6A 4AY2A 3OT5A 3LGXA 1SVNA 1CY0A 2WWRA 2YV4A 4YP0A 4MGZR 4PG4A 5FO0A 3KAKA 1ECBA 2GD6A 4NNJA 4TRJA 3M3PA 2J07A 3KEQA 3O3MB 4QOEA 3NBQA 4BMZA 1U80A 1WZNA 2YY5A 3AVVA 4ETWA 1T4CA 3JYOA 1M0WA 4DIMA 1VPWA 2X1VA 1XVTA 1RD4A 1OTHA 1SR8A 1JA0A 3FTQA 5FULA 1CS0B 1Y63A 4IF6A 4YRDA 4CDGA 3AI2A 3W2TA 3HCWA 3GP8A 3V4ZA 2ACWA 3OJEA 4R8VA 4CT5A 3FI0A 1KMNA 1V35A 3E3MA 2NUTA 1QIIA 2WINI 1WPGA 3IVRA 4IUBS 2G28A 1CRZA 4J0HA 3EPJA 4K9OA 1BS9A 2K7ZA 4B6FA 3QRWA 1QK5A 2Y1CA 3WL4A 4BS9A 3QY0A 1RABA 1X14A 3EXIB 2BC9A 4OL9A 1DWOA 1PJSA 3H9CA 1H2AS 4A0HA 2B1QA 3L1KA 4OB6A 2DSTA 4QULA 3T4UA 4OHVA 2AK2A 2V54A 1PQPA 4GBED 4O0LA 2C4NA 3G7NA 4HWKA 4ZI7B 3PUWA 1C1XB 4NOMA 3NS7A 2HSZA 3A6GA 2Y1KA 5CFOA 2GXUA 5AVOA 1E7YA 2PKEA 1Z38A 3F46A 2Q29A 2GVZC 3RG2A 3ZWOA 4OHFA 3LUDA 5E2IA 2BRUA 2WQ6A 5SYAA 4H6PA 2E5FA 3IEKA 4OAOA 1Q1QA 1UMCB 1CP2A 2A59A 3JQ9A 1KA9H 3PQEA 3QXHA 3VC2A 2Y8EA 2I2WA 4HV4A 5JFOA 4DJFC 5JIBA 1JEYB 1E0DA 5AMXA 1J0EA 2C3MA 5FQNA 3RHZA 1KYWA 2RK6A 1Q1NA 3IYLW 1L5OA 2V6JA 3KTAA 4D3YA 4EBFA 2GLUA 1OXKB 4LVNA 4DXHA 1K6EA 2QTBA 3D6JA 1LQUA 2XW6A 2GAJA 1KRHA 4FDVA 4NC9A 4JFRA 1ND6A 2PR7A 4I8XA 1PJAA 3H5RA 1XMIA 4V2UA 1V47A 3SQLA 3KPVA 2KWIA 2IZ1A 2VQ6A 3NTLA 3BE8A 1GGMA 3PC8A 2IYRA 2RBEA 5JCOA 2R48A 4JJGA 2Z3VA 2ZUUA 3IAS1 5JDCA 2OZKA 4HN9A 4PO9A 3TBHA 3TI9A 4ZTBA 2G9UA 5IARA 4H9GA 1E6WA 3HUUA 4P36A 3Q5GA 3AR5A 5BYJA 3ZGNA 2XQVA 3HWWA 3G6WA 2CLFB 2JZCA 4EA7A 4ENUA 3HCFA 2GN2A 2XIJA 1P0IA 2HZBA 4GPEA 1CETA 1JVBA 2H63A 5AO9A 4CU2A 2PVSA 4P22A 4R8SA 3PA8A 1G8YA 4ZO6A 2NZVG 4MW1A 2IH5A 3AF1A 1ZVMA 2QV0A 1TYEB 1ULZA 2MMGA 1SN7A 2OB1A 4ZCRA 3UB3A 4L27A 1ZITA 5TVKA 2IY8A 2O9JA 1L4LA 2CMGA 2HLDA 3U4IA 2CCKA 3R6LA 1YOVB 3UHOA 1LK0A 1DV2A 4X1KA 2DP4E 4CL8A 3OKPA 5DNDA 1D2HA 2JCXA 3IUQA 5DXAA 3HVRA 3PQFA 2ZT8A 2P2DA 5H81A 4S1PA 1YV9A 1CD5A 2EL9A 1U2TA 1O2DA 3M5DA 3H3XA 1KP9A 4G1BA 4YMTA 1A7KA 2CUTA 1E79A 4BRSA 4ERNA 2H59A 3NT5A 3JS5A 4BMYA 1JPUA 5AJYA 3LF2A 4Q7JB 3H9GA 1WR8A 4WZAA 4DOMA 3AG5A 4M0KA 3OE1A 3ADKA 4EJ6A 4ZT4A 2OBFA 3R8XA 2DHQA 1TEHA 4LXTA 3HKCB 4EHAA 1ZH4A 2Q99A 1FZQA 4MR9A 3JASA 1L5RA 1TF2A 2VZ0A 1A82A 4DLWA 1IWPB 1YCGA 3DC2A 4PYLA 3AESA 4NCJA 1Z3IX 5MN6A 2XF8A 1KO7A 3UV6A 4Z8YA 2BCEA 4QJBA 4UHBA 4DDTA 5JAPA 1U4OA 1FU7A 2JD0A 3T9BA 1T6XA 1M1YE 3TMYA 1XKTA 4EKIA 2GCOB 2A9VA 2PKCA 3ZHOA 3CVVA 3D4PA 1CQXA 1CZKA 3UMRA 1AXEA 4RTJA 2AFHA 3KM0A 1YACA 1DCTA 2YIMA 2OSVA 3ZXYA 3MMPA 3WGOA 1R66A 1XPJA 4RSRA 3O8CA 4DCOA 4NZZA 2RGYA 4E2YA 3N0VA 1B1CA 4WJKB 5ALSA 1JALA 2VPPA 3L0ZA 3T6KA 4L75A 4RJJA 1QJCA 2JEOA 2YRWA 3C0KA 3RSGA 5CCEA 5D5PA 4E21A 3RE1A 2O1SA 1EQ2A 2YZ2A 3B5EA 4S1OA 3ROEA 4AMYA 4F38A 1YS2X 3GRCA 1RHMA 4YMHA 2Y99A 4K7JA 4YRFA 4NAHA 3OMXA 1KOFA 1IPHA 1V43A 2IYEA 2Z57A 3GRZA 1AQLA 3LPCA 3IQGX 4F4DA 3ML1A 5SZIA 3L8YA 3EFOB 4M1QA 1NW8A 3NXSA 3A10A 4I8DA 3JALB 3SC2B 5HJ5A 3DL4A 2WUDA 1OHHD 1KY5A 2N0SA 2XRYA 2DFKB 4HN2A 5BT8A 3UGJA 3T8YA 3ZQJA 3Q8KA 4RD3A 5M5BA 3IFSA 3QEAZ 2V4UA 3R0ZA 4EITA 4W7HA 3I9LA 3ZHBA 1IEQA 1T3SA 1W5AA 2C4VA 1GL7A 2GKOA 5HG0A 1P0FA 1O87A 3DJYA 4LQCA 5P8WA 3QYJA 3DHYA 4G4GA 1E2UA 1USGA 1U2SA 2R6FA 5DI3B 2DFDA 3K0FB 2OAP1 1SCJA 3LLCA 4LSMA 4XWGA 2JI4A 4BMVA 1U0EA 1X1BA 1KVRA 1RYZA 2XVMA 1CRLA 3NKLA 4OBXA 2HOQA 2C2WA 4MHSA 4PG5A 2BGTA 3OPXA 5J5AA 1Z2CA 4KUEA 3LTEA 3HO8A 4A8HA 1K92A 4JCOA 3N2NA 2RHMA 3NDRA 1VE6A 3F9RA 4WW0A 3T5GA 3UG7A 1Y6GA 3B89A 1QV7A 4AY3A 3WMXA 1AXGA 1EWTA 2B61A 2HRZA 2CXQA 3C3MA 1LTKA 4BE9A 3PQ8A 1L4KA 1U6KA 1X1AA 3RVMA 4RMJA 3JV7A 5CA1B 2PSSA 1KC3A 5J5VA 1R4MB 1YR8A 4LOAA 5F5XA 1HT3A 3MWDA 2WJJA 1UBEA 5IUJC 1Z4JA 1YZNA 3CUSA 5KHLB 1M2JA 3C3JA 1ACLA 3HEBA 4PINA 4W9MC 4N5LA 4JBYA 1I7DA 4AW9A 4GW3A 1GTL1 5C7YA 4RGYA 3U5TA 4JP5A 5D01A 3PUXA 2ILVA 5K8TA 2Z5FA 2WHYA 1K7XB 3WLKX 4DV5B 3IB6A 3ABSB 5KI6A 4DHEA 4U9IS 3ERCA 2H0QA 3JQ9C 3QE3A 3HSSA 3NHZA 2ZIEA 3SX4A 5FL7A 3VKVA 4WGFA 1GSOA 1RXIA 3NFYA 1E92A 3IUMA 1XMQB 3TOZA 3H6KA 1NQAO 3STHA 4JJFA 2CEKA 4DF3A 1W34A 4F5YA 4L9RA 1P8JA 4EX6A 3GGGA 1YI1A 1ZJYA 3QSGA 4JS0A 4BE7B 2ANCA 5GP1A 1NVGA 2Z04A 1MVOA 2IXTA 1U2EA 1W94A 1L5FA 4G9EA 4KXNA 4L8GA 1LJUA 1OA1A 1W88B 3DV0B 3F90A 2ZG6A 4P3YA 5KWEA 2VT7A 3L0IB 5B64A 2OBBA 1M8PA 1N8TA 2C97A 3EZ6A 1XGKA 2H7VA 2J59A 1VPDA 3D3WA 5MFPA 4RANA 4K8OA 2VK2A 4F2DA 1NTOA 1THMA 3DVSX 5G1NA 2HRDA 3KFVA 3M6IA 2ZRCA 3WADA 1OX6A 3WSVA 1C9NA 3QU7A 2Z98A 4JBGA 1TFUA 1XDBA 2IQ5A 1YOVA 1Z6XA 2GBLA 4XR9A 5CT4A 4DJJA 5FUMA 2GA8A 1VBKA 3HJNA 2E9SA 1DFIA 3GEBA 3H7IA 5JBNA 2V9ZA 1JKXA 3QPAA 3ZWCA 2JVIA 3U5ZB 1VGVA 5FJIA 4HEJA 4LF7B 1KI2A 2ODEA 3TAXA 2DUWA 1GKLA 2YZ7A 5AJHA 4QJ4A 2Q9UA 3KP1A 1OUMA 2BM0A 3QMWA 1DX4A 1RYEA 2DPMA 3GV0A 4UASA 1F8FA 1BD4A 5K8LA 1E3JA 3TF5A 1R0LA 2I3GA 1SM4A 3BXHA 3OCYA 2FLWA 1RNLA 4UEOA 4URWR 4JI3B 1VSVA 1A8PA 4O4IB 2WG1A 4FDUA 4L4XA 3IEPA 1I1OA 4I2VA 3LXUX 4M7WA 4EYEA 2JCBA 1K2WA 2PSJA 1DX6A 1NBAA 2I3DA 2UDPA 2YHUA 4HGNA 4ZZ1A 1J56A 3AGQA 1RI4A 2FJ0A 1RQ7A 4G1VA 1AUPA 4O4HB 1FXWA 1G8AA 2IEAA 2QJFA 4JT9A 2W83A 5ALJA 1SUSA 3MD9A 4XB2A 2IUUA 5A5VA 1U04A 2F1OA 3D6MA 1U0JA 5HF6A 3T52A 1S3IA 4B44A 1T5SA 1ADJA 1AZWA 3U0VA 4WNAB 2X5OA 2XYPA 1LVGA 4NMLA 3NRBA 1T1EA 1GY8A 4J7AA 1O94C 2E4XA 3EOZA 2QL9A 4M8NE 4UHFA 3UENA 1U3GA 4UBNA 4Z5XA 4LJ9A 1L5YA 3AP1A 4K40A 1ZEJA 5TE9A 4P4UA 5TY0A 1PFWA 4X64B 2NPOA 1ZVQA 1YGYA 2WWIA 4G07A 4MQLA 4PR0A 5L8VA 1VECA 2XQGA 4GM1A 1PI3A 2RD2A 5F4BA 1K88A 2A0UA 4E5UA 1JKFA 4B84A 3ZD8A 1JAZA 1LLFA 1U8XX 5K3FB 1ZUIA 5AHWA 1C1HA 2H0RA 3SJCA 1XCJA 4BFXA 5A5EA 3LC2O 1FXWF 5FPSA 2W2LD 4Z2AA 4KR2A 3BXZA 3QTLA 5EVCA 2DERA 3KU4A 1GGFA 1UPCA 1QLHA 1QIEA 4FOOA 1BJTA 4R31A 5CP8A 3S2SA 4KE8A 5E3IA 4G0ZA 2ORVA 3UOWA 1JJAA 3LT0A 1MFZA 3BTOA 5I01A 1HNWB 1AK2A 3QV1A 4MARA 4MW5A 1X7XA 2C5LA 1MJFA 3EZXA 4D46A 1G3QA 2Q62A 3PVSA 3FOWA 1G7RA 1KS2A 2YOFA 3CVXA 4L8VA 4CCAA 3G2NA 3R23A 3NHLA 5CA0F 5LU9A 3M33A 4QUDA 1ZJZA 1FNDA 2VTVA 4MWTA 4N12A 2G04A 3KOYA 4I1OA 5A5DA 3I23A 4IUDS 1I2CA 4B8ZA 1DO8A 5AXDA 4B73A 5LOVA 1V9LA 1XA4A 5CW2A 3IOEA 3PCTA 1LX6A 4P6VF 3RAJA 5AIBA 1N8KA 1Y3HA 3LAWA 3QFRA 5DJ5A 3WLTA 3SQXA 1GRRA 1QC5B 4XFKA 3GJYA 3PHHA 4RM3A 4LX0A 2O2EA 1LA2A 1CB0A 4JD5A 1KYYA 3R7WA 5L4NA 1KI7A 1EWKA 2WIGA 5ALVA 3GGOA 2AI1A 2WD9A 1P2BA 4PPNA 3MJSA 2JIMA 1SVSA 4ZOBA 3HM9A 3HWSA 3GUHA 1JHQA 2BGJA 1CHDA 1X7DA 4RPKA 2XR1A 4RKFA 4LBVA 1G59A 2Q21A 1L4NA 2NO0A 1HC7A 4DMCA 3ER8A 1XRPA 4M1TA 3JD2A 1U0HC 4EPXA 4HZIA 2QG4A 2WJYA 3SR4A 5AKKA 2XWJI 4HSEA 1P39A 3L6BA 2HEGA 4O1IA 4L07A 2ET6A 3G02A 3I6YA 4BQEA 4RF5A 4EP1A 3V2GA 5A06A 5F73A 1KXZA 1NLFA 3N39C 1H2ZA 4MZDA 3IJEB 5A02A 3W5DA 4DR2B 4XE5A 3EA4A 3LDHA 4TSKA 2W2KA 4BIMA 4L9SA 4RDXA 4BTEA 3Q88A 2HGSA 3CWCA 2PUTA 3FDXA 3SC6A 4CI9A 5AM3A 3FCAA 4Q4JB 1ZU4A 4QYSA 1MC8A 1OV6A 3VJKA 4U6QA 4B09A 4E3WA 3O1IC 1DQSA 4TL9A 3AY3A 3CW2A 4J75A 3O7WA 1XFDA 3WKAA 3NT2A 1K75A 3HHEA 4I5EA 3WBJA 3RJ5A 2Q4RA 2G09A 4HTFB 1G8MA 3CSUA 1O95C 3G79A 3VDRA 3MWFA 4KJZA 2XADA 1O95A 1WHTB 1ZD1A 1ONSA 4I36A 5T64A 4BB9A 1LLCA 3CJQA 1AV7A 1E1CA 1MXFA 1X1CA 1Z5UA 3M81A 1YC2A 4RXTA 5EE0A 3REOA 1MAWA 4U4AA 3OZRA 4AUKA 4JBHA 3WHLA 4IGFA 4JI7B 4I6JA 5B7QA 2O8DB 4ZOLF 2EQ5A 4YV0A 2NUAA 2XCLA 4RMHA 5JXGA 2FWIA 3ETLA 4HTAA 1Z33A 4BJ6A 2VYVA 1B43A 1KMHA 3B2EA 4XLTA 3UJNA 1J25A 4RVFA 4WEQA 3UZUA 2R8BA 3A58B 4CQNA 1M3SA 3OLYA 3WGIA 1TA4A 1H3FA 1HETA 1UDWA 2CJPA 2IXBA 3DHVA 1X1RA 2WTNA 3EA5A 3R0IA 4LHYA 1EX9A 4MVJA 2WY2D 3UWDA 3VZCA 1P62B 4DC0A 4HB4A 1FSFA 4E15A 1EP1B 2BIFA 4Y2HA 1HZZC 2O8CA 4JT8A 3ELBA 3I1FA 2P9ZA 3N5KA 4OPMA 3RB8A 1YI8A 2V8BA 1EP3B 3OZTA 4N82A 5E4YA 4IY1A 4XSVA 2A2ZA 2DEUA 2KYRA 1VM6A 1ONNA 1Z4NA 2B8WA 2OP0A 2EL7A 3BHMA 2C3UA 2G7ZA 2ZYGA 5KTNA 1KKUA 3T5BA 2MSWA 1RPZA 4TKZA 3QKSA 5EHIA 2I4RA 1VJDA 2P6UA 2QPLA 3E22B 1NN0A 2ATXA 2V6FA 2XEDA 3DOIA 2APJA 3QVXA 1OTXA 4H27A 4G0NA 4IDFA 4XB6B 4E1BA 4IEIA 1U28A 1E7WA 3E15A 2YVLA 3IESA 3EIHA 2JLVA 2V3CC 3QU2A 2XT9A 1QIJA 4FT4A 4BFVA 2FA9A 2UUPA 2WF7A 1EG7A 1GTG1 4JR1A 4Z1MA 4XAQA 3NANA 1W85B 3CNOA 4IEEA 1SVMA 4A0QA 3LQRA 1TVKA 4TMKA 3VU0A 3FYUA 3L6RA 2D1QA 4WRRA 1HFJA 1OBOA 1PWEA 2JI7A 2P6MA 1BEUB 1IB6A 3B3FA 3ABIA 1P5ZB 4URZR 4YDRA 4D8YA 4C20A 3LCCA 1MQAA 3TOCA 2Y68A 4Y7DA 5DYTA 5C51B 1ISIA 3A6PC 3S2IA 4O2BF 2IIPA 1JDNA 2L42A 3D6FA 2ZR9A 3V34A 1R0CA 2O23A 4Z9BA 3SSNA 1A9QA 4MRVA 1A3CA 4M36A 4EJSA 3Q6IA 4C3ZA 3OX3A 3ILVA 4N01A 1H6CA 4HADA 4RUKA 4ESEA 3QWBA 3FWKA 3ZJUA 4EPYA 1RBZA 5IH7A 2G17A 3NZEA 1Z0KA 2ZAGA 3EMVA 2V7PA 3AOEC 2NADA 3QFHA 3I12A 4LXYA 5TF0A 4BASA 5ECYA 1FS4A 4HWTA 3QYFA 2HIGA 4TQGA 4ZVNA 5TARA 3JZDA 3NDIA 2YX1A 3QPWA 4QJ3A 1B8NA 4YAJA 2QE7D 3FFWA 4B1FA 3L1IA 3COYA 1LF5A 3IP1A 1Q0UA 4INZA 5ELXA 3CUEF 2ZJ2A 1SBQA 1L7EA 1REQB 4JJKA 1XTRA 3WLIA 5JS8A 4G0WA 2YW2A 2AXPA 1JS1X 3R5HA 2YXLA 3R7FA 2NV0A 3H5TA 4IDPA 4KRGA 4QYIB 1BXGA 1GUAA 2H5IA 3AF6A 1XDGA 4NV0A 1WB6A 4FYIA 3TRDA 4MV8A 4IS2A 2JGFA 3JW8A 2Q2QA 3OCVA 3KQMA 4EI9A 1P19A 1QBGA 3DEYX 4X44A 4EVQA 1K06A 5FRDA 4AJ4A 9ATCA 1PJZA 1Y8AA 4R41A 3NP7A 3RVBA 3N2EA 1RXCA 1P1HA 3KV1A 2C83A 5SY9A 9LDBA 3ZQ4A 3VAYA 1KEPA 5DM60 2Q5FA 3H13A 2MMCA 1PO7A 1YMVA 4GP6A 3R7NA 3T3GA 3WLHA 2XUIA 1IZ8A 3RJTA 3INTA 4PLWA 3AUTA 3ONFA 4JOSA 1MA3A 2BEWB 3EVCA 4IZ6A 4NDAA 1NV8A 2ID8A 2Z3ZA 3AO0B 3Q7QA 5KWIA 2Y76A 2FEWB 3CZ4A 1Q91A 1K0UA 2RHJA 4QUKA 5EWJA 3GAAA 1C9EA 3ZGVA 3WX0A 5JTUA 3LUPA 1K3UB 1VHWA 3R24A 4Q6BA 2PMBA 5J43A 3QJGA 3MCUA 1CQJA 1T6NA 3H1FA 5AKHA 3VU8A 1SHKA 4W8OA 2FSUA 1O0BA 4RFLA 5FADA 4DA8A 2BGLA 2P6RA 1RCUA 1D2GA 1O3YA 1P2UA 3H2IA 1LZKA 3PR2B 3P0RA 4INAA 5C4IA 2AD5A 3EXEA 4JUIA 4GP7A 3I2GA 3IIKA 3K1AA 1S7CA 4CMIA 1ZH2A 4CTOA 1RPTA 2V0NA 1Z18A 4R2KA 4BC0A 2FFAA 1M34B 3VO9A 1WCYA 5DN6A 2FZEA 3ET4A 4EF6A 2JGNA 2WV7A 2V97A 3AVQA 2C9YA 1RI2A 4LQ4A 4V38A 3A1TA 1JIJA 1ULHA 5JMWA 4FGUA 4TS4A 5LC1A 4DYHA 1UWVA 2F3RA 3BILA 5KYGA 3E9CA 4GOOD 2FCRA 1Y81A 1JGTA 1ZK4A 3DYVA 1PEDA 2JZNA 2VYVD 5EWLB 1GFZA 1VFPA 1LC3A 1ZN8A 2A1TS 2ZRBA 5EXPA 2W0SA 4X1IA 5DN9A 3KOOA 4I08A 2HBRA 3DV9A 4WZBB 1CRPA 1BX3A 1M8FA 4J0IA 1C30A 3LM8A 4BMNA 1KRXA 2HNAA 2VAWA 1YS1X 5EKDA 3C7KA 2GJAA 1UEJA 1YRAA 2QJTA 3HJAA 3KU1A 2G9VA 1XU4A 2QX8A 3N2YA 1V25A 4Q4AA 5KDLA 3F5SA 1YONA 3FHJA 3QZUA 5FOVA 1TA9A 4G5YA 3VZSA 4BCBA 3R3WA 1C7QA 1OXXK 4G6ZA 3DOUA 4FGWA 4FLMA 4KGDA 3TW6A 3FX2A 4UHHA 1L7BA 2XE6A 3JYLA 3LT5A 4I1VA 4LTNA 1G21B 4RVGA 5DGXA 2OL4A 2Q4DA 3CPEA 1V7ZA 1NX6A 2XD4A 1PR1A 2R3SA 1EHYA 3CU5A 4CMAA 4FS3A 2CMDA 2AMVA 2FMXA 5E8JA 2D7DA 1DLIA 5CG2A 4KLAA 1KP3A 3ZWQA 3QBTA 3BL8A 4QLBA 4G9GA 2FN9A 4JXZA 3AW9A 2BP7A 1SEVA 2VZLA 4Z99A 1MVNA 4JVLA 4YR7A 2JCVA 3ICPA 4FHEA 5EHNA 2PN1A 2CUNA 2VBGA 1EX6A 4HHEA 3KPYA 2CL6X 2XVYA 2QRZA 4OFZA 4HRVA 2ZUDA 4FR5A 1IBRA 1VKZA 2ZIWB 3CYFA 2XY4A 3P71T 3K1YA 3PV0A 5LDGA 5BR8B 2YOHA 3HUDA 3RRZA 2OHVA 2C2XA 4D9JA 3OCXA 1XI2A 3HI6A 3ASVA 4QICA 5JAOA 1W46A 2ZSBA 4CF5A 5AKJA 1YZVA 2V0GA 1JB9A 1XMVA 4CKCA 3JYPA 3KKZA 3L07A 2JRLA 1IWOA 3EODA 4WK0B 5B1EA 1K98A 1TQDA 3CZCA 3BWVA 3IQHX 4BIIA 3AFGA 3VI3B 1JPJA 1RKVA 1W44A 2J9FB 2PCLA 3PJFA 1R27A 4N48A 4KVGA 3R4CA 4H60A 4G01B 5G2OA 1V41E 4YCBA 3TQCA 3V4VB 4EG8A 3ID6C 4Q3CA 4JEMA 4LDJA 2QRQA 3W3AA 4QQ8A 3JATB 3QVKA 5AHRA 2VBFA 4JQSA 2VNJA 4CV2A 2WA2A 1FJHA 4X7BA 3I9JA 1PK7A 4G1UC 4PSCA 2QN6A 1SQ6A 5H02A 521PA 4ZYTA 2RHDA 1ETUA 3DHEA 4JR0A 4ZJUA 2Y9PB 2H2FA 4E5SA 1BMDA 5CBPA 1PE0A 3V2UA 1AKTA 4FE3A 1S1MA 1QF7A 2EBWA 2IBMA 1PS9A 2AMFA 4QHTA 5A9SB 1XDWA 5TEVA 3Q3IA 3RYHB 4NYIR 4PPGA 1KQNA 1E69A 3GVXA 2P6PA 1VJ0A 4B3JA 1IHXA 5ALYA 1P4RA 1OFVA 2JGDA 1PQWA 3DZ8A 5A6VA 1KYZA 3EQ9A 4MV7A 3MW8A 2PTGA 4MQ5A 3ZVNA 1LPPA 1TF7A 3CRVA 1PX2A 1RZRD 4KNVA 4IEFB 3K3PA 2GPBA 2O2SA 2XRMA 4KO8A 5HCNA 3ROZA 3SZOA 2PLFA 3E5NA 1VYTA 2Q2OA 4QYIA 4W5QA 4IIYA 1SCKA 1BFUA 5AW8A 2Q9CA 4NMWA 3HZHA 2GN6A 3ENNA 4GI5A 3NGXA 1XTBA 2XZDA 1QHGA 2NX2A 3ZBUA 3ZLJA 4BVAA 2G1AA 4PFKA 1MQSA 3WDKA 1CC1S 4C4SA 5AUNB 1DXHA 4WASA 5F77A 4L15A 4HQNA 1AZSC 2R8ZA 1H9AA 3X2FA 5CA1A 2HWXA 3GH1A 3S27A 1A8IA 4Y1RB 3SICE 1C8VB 4PWZA 5IC5A 3BMXA 5K8JB 2Z2ZA 2OAEA 5DLYA 2HYIC 1F06A 1JIKA 4K5QA 4C43A 1W5BA 1APBA 3KZNA 1OYYA 5EFOA 4B71A 1RWQA 4FFSA 4QWMA 2BZ1A 2NSDA 3BCSA 2GETA 4NV3A 1MX9A 3M1YA 3NWOA 1IC6A 3B85A 3FCXA 4FIDA 5FA6A 1E0AA 1I0ZA 2K2QB 3GJSA 4F71A 1Q6YA 1Z26A 2ZCVA 3FKJA 3O95A 3G2MA 4QTZA 3GLVA 5JSZA 2IA5A 3L9WA 4MB0A 1EFPB 1UPUA 1GGEA 3BG5A 2OXTA 2R1VA 4MROA 3HXOA 1U94A 4EHDA 4DV4B 1YDHA 3OIDA 3VC1A 3C3PA 2HDWA 5GOZA 1O5OA 4L72A 3OUZA 3A27A 1SD1A 2Q5HA 3GZJA 3IAS6 3F9CA 3C15C 3ORQA 4I4LA 4TZTA 5F2OA 1PS0A 1O94A 1WX1A 4BZPA 3PWSA 4YRMA 5TLSA 3G2OA 3KSAC 5HP4A 1KDTA 2IELA 2DY1A 3R6TA 3NTVA 1OH6A 3THWA 1QB8A 4MUYA 2V74B 1SOAA 2F1IA 2EJWA 1S2IA 2EDAA 2LCQA 4D0GA 3FPGA 4LGVA 1YDGA 2LVBA 1O58A 1YS7A 2Y2UA 1XZEA 3CXRA 4P8RA 4CMJA 1H42A 2RGDA 3B52X 1ISFA 1ARZA 2FH5B 4YMSA 4C7VA 4FM9A 2YBDA 2LGJA 2XVXA 1P7YA 1MX3A 3U3RA 4IDAA 4F4UA 5LMNB 1PSWA 4Z4QA 1YBMA 5AW5A 1S8NA 1VG0B 3GBPA 4OLHA 1WUYA 1X7ZB 2VL7A 1LD3A 3LS2A 3OURA 5TEWA 3ENZA 3MGKA 3GLIB 1HOXA 3MCAA 3QWIA 2Q49A 1NVMB 4DNPA 1F1BA 3AM4A 3VJRA 1MVLA 2MWMA 4RKRA 3G0CA 4O33A 1FUEA 3EAFA 4AG5A 1GGKA 2FYTA 2HLPA 2E4AA 5JCJA 1BC5A 4YT4A 3M89A 4QOFA 4O5AA 4X65B 3MBKA 2RHHA 4EENA 2ISSD 3LW7A 1QXSA 3VKHA 4ZYXA 3OIWA 4PGHA 1F2DA 1LI5A 1RWKA 5CIQA 1KNQA 1YR6A 2EX0A 1RT9A 4CCYA 2DU8A 2IX9A 2R8PA 4OG2A 1W5SA 1U0GA 4IGKA 3BERA 4EKDA 2DE0X 4NMHA 4WJZA 1GG5A 1LPSA 1XQWA 4FYJA 1QANA 4GBMA 2XMCA 1J7JA 1T5OA 3ACBA 4L4UA 5DLPA 3S5JA 1LC0A 5CK4A 1SU8A 4Q24A 4RD0A 3CZ9A 2P79A 4ZN6A 1YZKA 2V3WA 2LW7A 2VK1A 3BD8A 5G02A 2IWRA 3VJLA 1XQ9A 4ME6A 4TZ0A 3EQ8A 4MYCA 4LNHA 5C5IA 3UMCA 1D9XA 1NFQA 3PXUA 2GFIA 1NWHA 3BD7A 4HXFB 4RVOA 4KXQA 1ML4A 2ZDHA 1N2XA 4X20A 1ML3A 2ZBGA 2P69A 1G0NA 3TQFA 4Z3OA 2AFHB 1YIAA 2W6NA 4RQBA 1OVMA 1M9NA 3A6JA 1NDUA 4YFYA 1NY5A 3FZGA 1XLUA 2XZLA 5I7HA 4BPBA 1FRNA 3VO1A 2PBLA 5IW8A 2QG6A 4WN3A 1O94D 2VRBA 2ZYUX 3O1HB 3ZKWB 2RKOA 2Y77A 1XTKA 2WM2A 5CM9C 3W9SA 5CEJA 3ZDYB 3E7XA 1CSEE 4IICA 2ZVJA 1LFDB 1LDNA 1JDJA 5DBGA 1PYGA 1R74A 2FHSA 2AVNA 3CLUC 3MQFA 4DVJA 1J99A 3NC4A 2D54A 4IIGA 3B6KA 4CL3A 4HNVA 1VYHA 3GHHA 2RI0A 1JE0A 4WCFA 3AHIA 1USVA 2O8VA 3SIRA 2EBUA 4UU0A 1AGNA 4CLOB 1XZKA 1XJCA 5GOTA 1LB1B 1DAOA 1W30A 2HCTA 2VKQA 2DTDA 1RHQA 4C06A 5AQEA 2J0SA 2V7BA 2QJRA 3FNHA 3GUYA 1KR2A 2GCNA 3UTCA 4AJJA 3RROA 4YAUA 1IH8A 1L1EA 5HMMA 1ES9A 1U90A 1QH1A 1XCPA 3A7EA 1JSRA 3QKIA 3HVIA 4YQFA 1Q92A 5BUCA 5LIPA 1N78A 3K8QA 5JWRA 5BQOA 5CB6A 2IOFK 4WLUA 1RPJA 5U1PA 1WXWA 3DL2A 3HXMA 1KAHA 1O8CA 2GUWA 2ZE8A 3EQ6A 4TKVA 4CKCB 1NAIA 2UZ1A 1WL8A 2DKNA 2JFBA 1JHUA 3KZ1E 1SBCA 1NOJA 3JYNA 4LGMA 2BELA 1KXJA 2WPDD 1PL7A 3G82C 3MERA 1G9XA 3F8TA 1EK5A 3BXOA 5BO5A 3E03A 4S2EA 3DLBA 1UZNA 4MV9A 5JAIA 4JP1A 3F6EX 3JATA 2VDVE 3H9QA 2YZMA 1QHSA 4JODA 2NW6A 2HK8A 4NEQA 3H5LA 4NMXB 3ZZUA 1C2TA 4CLDA 1KH1A 1K63A 2AG6A 2V6IA 2X7HA 5JCPA 3OKCA 2BISA 4IKEA 4PZPA 4DLAA 2CFCA 3BX1A 1IDOA 2GB4A 1Y9AA 3AR2A 2W2TA 4YUZA 1DJMA 3AV0B 2NZXA 4LRUA 4QEKA 3QI7A 2AH5A 1SWVA 2HRBA 1B26A 1SXGA 3GP3A 4QAQA 2OE2A 5EP1A 4YREA 5IFKA 5DIFA 3PTZA 3SYRA 2EFDB 1E1NA 2IYOA 3OECA 3IT1A 1EHCA 1MDBA 4OBWA 3DTVB 4HNUA 2VVTA 3W3AD 2ARKA 3MVEA 4W6QA 3K6SA 4LZZA 2Y1GA 4OTZA 4B87A 5L40A 2I8CA 1JDVA 2M6SA 3CB2A 4GNKA 1JLSA 4PCLA 1FYXA 4FYWA 2QTCA 4P7KA 1KEEA 5JSHA 1MEEA 2FZ5A 2QAIA 3I4LA 2QKYA 2QTVB 4NYJQ 5FR2A 3SXPA 3EGDA 3WIOA 3JD1A 2PVCA 4OB8A 4FNAA 4UBMA 1XHEA 1Z7EA 2NQ8A 2WAMA 3V8BA 4ENWA 1VA5A 1IBMB 1NG9A 2BEWA 4PQYA 1VCIA 4YUWA 1MEOA 3CEHA 2PUEA 1KIAA 2PGXA 4PAMA 3EUFA 4MX8A 4BO4A 4KMSA 1JR2A 2WJGA 1Q3HA 3DTTA 4OHMA 3RUCA 2I0FA 2QMQA 4AYTA 3H2SA 3GYGA 4GC9A 4N39A 1UXGA 2GEDA 1ZEMA 1EVQA 3CW9A 4BJ1A 2N42A 4K86A 3L0YA 1KJQA 3FOBA 1RJEA 1ZONA 4US1R 4Q1EA 3O8OB 3JQQA 4NBTA 2P5YA 2P2NA 4YRRA 3QFFA 5AM0A 4TSFD 2BEVB 1T9GR 5SZJA 5LP6F 3NTRA 5SV2A 5B1SA 1PKXA 4BGDA 3EJ6A 5E6UB 4ESVA 3IDFA 5GONB 3ZXXA 3KKOA 2IHZA 4X93A 3BJRA 3LPMA 16PKA 3Q8XB 1C0KA 4HGPA 5I9TA 3O94A 2H1HA 1BH2A 2GR9A 3QFTA 3C1TA 1DOHA 3N2GA 1M6YA 4O63O 2PUBA 3MIZA 1RQRA 4WFIA 3WLMA 4HGZA 3ZYCA 3DR5A 2XODA 3RYFA 3WIUA 3V8PA 4F2HA 2C42A 2A78A 4O2AB 3EB9A 4RLSA 4U7HA 1DIAA 2IPNA 5FTLA 5DLEA 1RAFA 4NU6A 1DX9A 1VSQA 3R20A 4NNPA 1A1VA 2B92A 4WLNA 3ZW9A 3HXTA 5KYNA 1NQWA 1QZTA 3GNSA 1QB7A 4KWHA 5C8DA 5KQSA 3U6KA 1PAUA 4MAMA 1O0SA 1N7HA 2XUFA 2IZ6A 1WD7A 3DYBA 4FBMA 1RYYA 2Q2VA 3QUAA 2EX4A 5FPHA 3HR4A 3TW8B 1R8XA 1M7BA 4IIDA 4KW7A 3UT5A 3L6OO 5HIKA 3QE9Y 1FDSA 3B8HA 1DRJA 2O19A 5AVVA 1ZN9A 4JI6B 3QEJA 1RADA 2V3VA 3EMBA 3GJZA 1J24A 3P27A 1N8NA 3TM5A 5K9ZA 2B5VA 3L2OB 4R0NA 2IL1A 3NX4A 4KVZA 3WVNA 2FX2A 3EUWA 3U26A 2Y67A 3RC7A 1F8GA 4GT1A 5AFSA 1W1WA 1JA1A 5KYUA 4UFOA 3TR6A 1OGJA 1NXPA 1KETA 3LK7A 1LLQA 4WKBA 2WYWA 3NBMA 1GGHA 1XLTC 4JAVC 2DXIA 1KARA 3ONDA 4GM4A 2VUSA 2XNHA 1V3VA 1LV8A 1VG9B 3WYBA 2YN2A 4EO4A 2CGEA 2V45A 3FRIA 5MN5A 2V03A 1CVIA 2JCGA 2WZCA 3UV3A 3Q2OA 1RZRA 4LE1A 3W2GA 4B3DA 3ORRA 3FMVA 1NUQA 3TD6A 5JNVA 1T9HA 4BMXA 1R9MA 1WMFA 2OBNA 2YMMA 5AI6A 3NIDB 3T1QA 1ZC4A 4WA7A 2PD3A 3VYSB 5BURA 4C04A 3FHOA 2CF5A 4M54A 1R5BA 2H9YA 4YXWA 3VR6H 1G5FA 4B7AA 2IIBA 3K0EA 3A36A 3LBIA 4PLHA 1ODLA 2Q50A 1LJLA 4DAOA 2DSNA 3FGOA 1NMSA 4MKIA 1V5GA 2DWCA 1Z17A 1NQUA 3ZKWA 4FQ7A 1ZKMA 1VIMA 1VOTA 3M5PA 1A4XA 1B00A 4HN4B 3THXA 1PV1A 4MRMB 3MS4A 2B82A 5M3BA 1U5BA 5HZGA 1PR3A 3LKVA 3PC2A 4A10A 1WMAA 3C5HA 1SOUA 1G3MA 3DBIA 2EFHB 3L6UA 4S2UA 4AC9A 1W52X 3NPMA 1ZBDA 2JIBA 4JV5B 4OVKA 4UVHA 3T7KA 5FB3A 5THKA 4C01A 5E9AA 5HUJA 6ADHA 1G64A 1Z68A 2C2OA 2ZI9A 3L7NA 3E8XA 2DHCA 3GO4A 3QKUA 4XJTA 4M22A 2EJCA 2C29D 3TLGB 4JXXA 3GB9A 3ZCRA 5I9SA 5FTWA 2GM9A 3ROGA 1DOZA 1J8FA 5IM4A 5HCUA 4O29A 4N7MA 4MIOA 4XLLA 3K0CC 2GA9A 1YWGO 5JE8A 3UUGA 1LI7A 3GHYA 4WL0A 4B0PA 1XA3A 4YLYA 4E5YA 2NSJA 3PTLA 4QE3A 4CODB 2X77A 4B3SB 4O4JA 4JLBA 3LP6A 4J4TA 2RHLA 3RUHA 3UO8B 5ILGA 4MGEA 1X19A 3EZLA 4BMSA 2RE8A 1IEXA 1M2WA 2EGUA 1Y5MA 4UD2A 2J46A 1KOGA 5TXGA 3REFA 2IYSA 1OX4A 2WEKA 3FROA 4L4RA 3ROMA 2GCGA 2ORYA 2W8ZA 3KKEA 1JAXA 4H18A 3OA0A 4M76B 4AS1A 3F8WA 5K6AA 1JIVA 2BEJA 3GLRA 3GELA 3V3KA 2Z6QA 2AZTA 3OOHA 1KEVA 2JA1A 1S96A 2AYXA 2XX3A 1SVUA 4P33A 4AJPA 4PPQA 3VR3D 2IPAB 4J07A 2B0JA 1J23A 1IUPA 4TMWA 4BO8A 4OUDA 4H1WA 1IMOA 3KKLA 3A6DA 3JX9A 1Q1AA 2P2YA 2IXDA 1FIUA 1JV2B 3JD4A 1D2AA 4Q3AA 1W5EA 3RC1A 2CVQA 4J29A 3MFQA 4PZAA 3U4DA 5FXMA 5TGDA 2OCPA 1SG9A 2PD4A 3D1JA 1P5HA 5AJZA 5EY5B 3P4UA 2IPLA 2GJ8A 1CQIB 2CVOA 4P08A 1MC5A 5IZCC 5EE1A 2FMTA 1YBFA 5DK4A 1E2LA 3GCXA 5JSQA 1DNPA 1ORRA 3EVNA 5HK8A 1DWPA 1QGYA 3ZE9A 2IEDA 3DKIA 1F6WA 5C1BA 4YJ3A 2GSDA 2OM6A 3IQFA 4XVCA 1R0YA 3NHYA 5T3UA 5E6SA 2ZSJA 3BMCA 2D74A 3PPVA 4JOBA 5CH8A 4YFVA 4X00A 4B46A 5DN6D 4Z4IA 5A0VA 5HR5A 3BSFA 3ZHUA 4Z4CA 1GFWA 1WZIA 2VAXA 2NT4A 2RGUA 4TPKA 2AX3A 1U0TA 4WY2A 3RABA 5A6SA 1J8MF 5JV5A 2XCOA 1RTTA 2P8JA 3HCPA 1GNVA 5C2JB 2WYOA 5FBLB 2X41A 2BGMA 3WJ1A 3WQRA 4G0VA 1C2YA 3QELA 3UAWA 4Z4FA 5H83A 4JR2A 5J9FA 2O52A 4OP2A 1YQXA 2Y27A 3PG5A 1OI7A 3NYWA 1P4AA 4KR0A 3OZEA 4P93A 4LJ5A 2FFRA 3MXOA 1VLZA 5B4UA 1QM5A 1YULA 2XAAA 4OHOA 2ZM5A 2GEUA 3DA8A 4RGQA 3HCNA 1P74A 3KVNA 1BU5A 1FJ2A 1X9HA 2ZWAA 4DV0B 3HJRA 2IZZA 3F67A 4A6XA 2XRZA 1MAVA 1VL5A 1DKUA 2YHAA 3IXLA 1JIQA 2B94A 4M6WB 3EUEA 4BVEA 5CYGA 4H08A 4IZIA 3S29A 1N6KA 4R9UC 3TWOA 5GINE 1X7WB 4YP7A 1R6VA 3G3EA 2YWEA 1N0UA 3BPSA 4X0EA 5K45A 1MW9X 2Z8ZA 4BWGA 1O96A 3ZWKA 2KLHA 3E3LA 4PE5B 5EJMA 2ZB2A 3VRHA 1ENOA 4F9FA 5F3WB 4IG4A 1Y48E 3O74A 1GQRA 1YKGA 2I1QA 1HEUA 2IHJA 4LXQA 4LXXA 5EYPA 2XXBA 3HDQA 3U7FB 4BUZA 5C37A 4HLDA 4R40A 3BTSA 1P3JA 2NVUA 2X0DA 3ELYA 4K87A 5FNVB 1IBCA 1T24A 2JAQA 5K8CA 1L4EA 3OT1B 2P0EA 4UUNA 4M21A 3GPDG 2QVCA 3PVCA 4YWHA 2QA5A 3M8KA 4TVBA 1P0QA 4I5DA 5CH5A 2WKSA 5CTAA 4ASUD 3C85A 5REQA 1G20A 3FWNA 2XMSA 3D0QA 3HDYA 3PDWA 3ZVLA 1UH5A 2BONA 4DSNA 3BMCB 3OM9A 1ORDA 1PFYA 2D0DA 3IX7A 4WXHA 2GPWA 5IKXA 1QRUA 4A36A 2YQ4A 3FVVA 1N9GB 3SS9X 3PU6A 8MHTA 3EX7C 4YDQA 4R2XA 1UADA 2J85A 4RDCA 1PFVA 4XQGA 1RIIA 2XGOA 4Q7MB 5T3YA 2JVJA 3BXEA 1CYDA 5IC6A 4YCSA 5BW4A 1V5EA 2ZUBA 1C7ZA 3I2FA 3B1YA 2R8RA 2F17A 4WXEA 1AH2A 4CLOA 1ZRNA 4P2BA 3T5PA 1ORIA 1W36C 3I5XA 4ZCMA 4LOIA 1UMBB 3TGPA 4A8PA 4F3TA 1CZHA 4P81A 2ABWA 3AFMA 3F1KA 1KGSA 3DBOB