3MAGA

Vaccinia methyltransferase vp39 complexed with m3ade and s-adenosylhomocysteine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Mrna processing
molecule keywords VP39
publication title mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains.
pubmed doi rcsb
source organism Vaccinia virus
total genus 98
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1998-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3magA00
3FUUA 2PX5A 4X61A 4C06A 2VDWA 2VZ9A 5DSXA 3R0QA 3CJTA 3PVCA 4RTPA 3OCJA 2IFTA 4O29A 2JG3A 3R6TA 2ZSUA 4M38A 5E1BA 1SUSA 1M0EA 5LQUA 3HA3A 3GIWA 4X1OA 4G56A 5EEHA 5E9WA 2PXXA 1BKYA 5U4XA 3AXSA 3DXYA 3KPWA 4OA8A 4R8SA 3QOXA 3BT7A 5K01A 1R8YA 4B17A 2FYTA 1T43A 3EPPA 3GJYA 3R24A 5KYGA 1D2CA 1BC5A 5LQKA 2OXTA 2P7HA 5DX8A 2HTEA 4ER0A 2ONYA 4RTRA 4OQDA 1NBHA 1Q0SA 5EOVA 3UZUA 1KYZA 2IIPA 4QVKA 2ZBRA 3AJDA 4E33A 2UYOA 1VL5A 1RJDA 3EVBA 3RIEA 3ELWA 3G8AA 2PJDA 5FTWA 5DRTA 5DXJA 4FT2A 3LHDA 3K6RA 3P71T 1WZNA 3M70A 4PWYA 5EEGA 5DWQA 1NW5A 3IYLW 1AQJA 5LQAA 5FA5A 5IH3A 2PGXA 3RW9A 4F86A 4RVHA 2NYUA 2YUIA 5GP1A 5JUWA 1I1NA 3FPJA 5HOQA 5K0FA 3Q87B 4AX8A 1NW8A 5HIMA 2JJQA 1N2XA 2XVAA 2ZTHA 3GO4A 4FP9A 4GF5A 4IWNA 4WVLA 3ME5A 1RI2A 5E9JA 3SVZA 3TKYA 1EJ0A 1VQ1A 5CD1A 2IBSA 4HTFB 2PWYA 5FCDA 1JG2A 4E70A 1N7JA 3ORHA 3UJCA 1JQDA 3GWZA 2B25A 3FPEA 4EQZA 3BWYA 4MQ4A 5B1SA 2Z6UA 5FWAA 4QTUB 3BKXA 4PGGA 3SSMA 2NXNA 5DM2A 4OX9Y 5CVJA 3LKDA 1UWVA 2P40A 5KQSA 3KPYA 2AN3A 3HCCA 4M7RA 2O57A 1XCJA 2P3LA 3EEOA 3EGIA 3IHTA 3VYWA 3BWMA 4GUAA 3DMHA 3O4FA 5K09A 5F2KA 2EX4A 4U7PB 5DM4A 3UFBA 2OYRA 1ZHFA 3MERA 2R6ZA 5DTRA 3OZTA 4V0RA 4DKJA 4E30A 1NW6A 4P7GA 4HC4A 3A25A 3KQMA 3PLAE 4PIPA 3DMGA 3CCFA 2AN5A 4ZTBA 5MHTA 2QRVA 3TLJA 1NT2A 3FTDA 4RYLA 3UJ6A 3ER9A 2OB1A 4P7FA 3HVIA 3LCCA 3CJRA 5EKUA 4PYJA 2AVNA 5JR3A 3AY0A 4ATNA 1NV8A 1O9HA 5T67A 2I6GA 1UFKA 3DR5A 4PYQA 5EKXA 1P91A 3HTXA 5FHRA 5HILA 2UYCA 3KQWA 2ZWVA 1YZHA 1INLA 2YQZA 3FUVA 2AOTB 3G89A 4RWZA 2UYHA 2K4MA 2C7OA 5ICCA 5HIIA 1ZGJA 1ZKDA 3DLCA 4EK9A 1EIZA 1F3LA 2G8NA 4PYNA 1X1DA 3Q7EA 4LG1A 1KPIA 1JG3A 2IP2A 3CKKA 3DOUA 3P8ZA 4L7VA 4X60A 1B42A 5T6BA 4UOEA 2AOUA 2JH8A 5GWXA 3SR4A 4C03A 2PXAA 3FUXA 3B3GA 5CVVA 2G1PA 2IH5A 2ZULA 1P39A 4GC9A 4R8RA 3AXTA 4YV1A 5LR6A 2P1DA 3MHTA 3G5TA 1FBNA 1G60A 3TKAA 3PX2A 4R6WA 2AOXA 3MQ2A 1PJZA 4DCGA 4AZTA 4C4AA 2V74B 3P2EA 5E1DA 5EMKA 5D1NA 1MHTA 2BR4A 2V7EA 2KW5A 4E2ZA 1P1CA 2A14A 5HZMA 4RTSA 2ZCJA 3EGEA 4AZSA 4EKIA 3LCUA 1V39A 2ZZKA 3KR9A 3UJ9A 3M4XA 2ZW9A 2BR3A 1SQGA 3FTCA 1JG4A 2PXCA 4QDKA 1QAMA 3GRYA 3M6WA 5BP7A 5DPMA 4PIMA 5H02A 3O7WA 4KIFA 4FR0A 2YTZA 2ORED 2PX8A 3QOWA 2FK7A 5E1MA 2AVDA 2G72A 1L3CA 1WG8A 2G71A 4FS8A 3P2IA 1FJXA 3BZBA 1EJ6A 5CIYA 3G2MA 4OQEA 3OZSA 4E2XA 4RX1A 3G5LA 1YFJA 3EMBA 2PVCA 1G8AA 3OE5A 3ELDA 4KDRA 2FCAA 4RV9A 4E2YA 1JTEA 4GOLD 5LQCA 3BUSA 2BM8A 3PX3A 1KIAA 1KXZA 3I58A 3HCFA 5D1HA 4OBXA 5ERGB 1R00A 3HCEA 2PV0A 1NKVA 1TPYA 3EVZA 3TFWA 3LSTA 4OA5A 3U81A 3UJAA 2P3QA 3EVCA 2ESRA 3DP7A 5E2AA 2GS9A 5HFJA 5DM1A 4IKPA 2YVLA 2PX2A 2Z6AA 2WK1A 3FTEA 3LBFA 1ORIA 3FPHA 3FPGA 3B3FA 1TW2A 3HM2A 2ZWAA 2JHAA 4FGZA 4RSRA 3P9NA 3TM5A 5GM2A 4ISCA 2XVMA 3DMFA 1JQ3A 3KQQA 4M36A 5BW4A 3KPUA 1L9KA 2HWKA 2XBMA 1EQAA 1KYWA 2GAFA 3OFJA 1ZGAA 3LDUA 2XYVA 5G02A 2ZZNA 3LX6A 4QPPA 1G38A 5HIJA 1KPGA 4PYIA 3SSNA 5M5BA 2CMHA 4RTLA 5EG5A 1IXKA 1KHHA 1O54A 4MTLA 2IDKA 5CCXA 3PB3A 4KRGA 1EAMA 3C3PA 2PWPA 4PGHA 4DM3A 1L1EA 3OZRA 5K8VA 3BGDA 3T0IA 7MHTA 3V97A 3KQYA 1M6EX 3OPNA 3M6VA 4BLWA 2QM3A 4RTMA 1SKMA 2JH9A 3DXXA 3MCZA 2IDJA 5KS2A 2AOWA 4DA4A 1YB2A 3LGAA 2I7CA 4QQKA 3LPMA 3TPZA 1O9GA 4YUZA 1Y8CA 1JG1A 3BWBA 2HMYB 4PCLA 3FPFA 1I9GA 3TR6A 1JSXA 10MHA 5EHGA 1D2HA 4LWPA 3H2BA 3BWCA 1AF7A 4JXJA 2ZVJA 4QTTB 5CM2Z 3KR0A 3HCAA 4LECA 4GEKA 3FTFA 5DM0A 5KVAA 8MHTA 2Q41A 2AOVA 1R18A 4RVFA 4PNEA 2ZFUA 3CVOA 5LQRA 3TMAA 1U2ZA 3UA4A 3O31A 1UIRA 1XJ5A 4DMGA 1QANA 2ZBQA 5HIKA 3C6MA 2O07A 1R6AA 3CBGA 4KWCA 5EIFA 2GLUA 5ICEA 4YMHA 4EMSA 1NBIA 3SM3A 5E2BA 3E7PA 3HP7A 1XVAA 5BXYA 3M6XA 3GCZA 3GXOA 4PCAA 3CGGA 1RJGA 3NTVA 3I5UA 1VE3A 3EVGA 2IBTA 1G8SA 3M33A 2PLWA 2Y1WA 1FPQA 1X1BA 1XDZA 3FRHA 3B89A 3REOA 1RI5A 5E9QA 3VC2A 1VP3A 2ZIEA 2ZIGA 2VDVE 1WY7A 3I53A 2ZBPA 4LWOA 3A7DA 3HA5A 3S68A 2UZ4A 4U7TB 1WS6A 2LD4A 3A26A 3E05A 4GOMD 4X63A 3C3YA 1XTPA 3KHKA 2EJTA 3G88A 3MB5A 4PYKA 1RI3A 2AOTA 4GQBA 4XUCA 5ICFA 3R9XB 3T7SA 2NXJA 2H00A 3LDGA 5C0OE 2B78A 2EJUA 3MTIA 3M6UA 4P7JA 2OO3A 2WA1A 3LCVB 3NDJA 1DCTA 3ERCA 5CVDA 5EMLA 3ELUA 3P9KA 4HH4A 3A4TA 4XUEA 4P7KA 3DH0A 4V0QA 2YXEA 3UA3A 5E1OA 4K6MA 3EVDA 5ICGA 5K05A 4PONA 1G55A 2HR1A 1HMYA 1EG2A 3A27A 1SQFA 1F38A 2GH1A 2P35A 3ANXA 5FADA 4YUXA 1H1DA 3NMUF 5DTMA 3T7TA 2QE6A 1BHJA 3A7EA 4R6XA 4GC5A 5LSAA 3L8DA 4BLVA 4C05A 2ONZA 2PKWA 5LQNA 1BOOA 1ORHA 3KQTA 1VPTA 3KQVA 5EVJA 5FWDA 5C9ZA 1YF3A 3NVMB 1X1CA 1TW3A 2C7RA 3TM4A 1HNNA 1VBFA 2Y1XA 2IGTA 2P8JA 3GRUA 3KPVA 3EVFA 4RTNA 2WA2A 3LL7A 3JWGA 1X19A 4HRAA 3OU6A 5E8RA 5C1IA 2BR5A 3PS9A 1D2GA 4X41A 4A6EA 2PSSA 2F8LA 2CKDA 1JSZA 2QYOA 3K0BA 3IEIA 4HSGA 2I62A 3OU2A 3P9CA 5EPEA 1RI1A 3LDFA 4F84A 2EG5A 3MCTA 3RODA 3HCDA 2PT6A 1RJFA 3GRZA 4AZWA 3TOSA 2OBFA 1L3BA 2NP6A 5EC8A 1OR8A 3UJBA 5EQJB 2YXLA 2ADMA 4ER3A 4E2WA 5EGSA 3DULA 4XCXA 3I9FA 5K0BA 4POOA 1FP2A 3MGGA 5P8WA 4CKBA 1VIDA 4RTOA 4E32A 2PX4A 3B5IA 1XDSA 1QAOA 3SGLA 4ER6A 2QY6A 4IV0A 3ID6C 4QQNA 4EVIA 4RTKA 4WXHA 1L3IA 3E23A 3VSEA 4DF3A 2C7QA 1PRYA 4FSDA 3PTAA 3C6KA 5FUBA 3LECA 2NXEA 2B3TA 3OFKA 3EGVA 5EZQA 3THSA 3UWPA 2BH2A 9MHTA 1ZQ9A 3KR1A 2CWWA 2O05A 2NXCA 3FUTA 2JHCA 4GOOD 2PY6A 4KW7A 4DQ0A 1WXXA 5CCBA 2Z6QA 2G70A 2XYQA 4YV0A 4FSXA 1NV9A 4CWAA 4EKGA 4PYOA 5FQOA 1G6Q1 5IKMA 4YUWA 5GIOE 1KPHA 1YZ3A 3DXZA 3IV6A 4QVGA 3V8VA 3FZGA 3HCBA 1QAQA 3P2KA 1R74A 1SVUA 3KQOA 3QV2A 2VP3A 4Z2YA 2P41A 4PYMA 1XCLA 2O0LA 5CUQA 2EFJA 1KP9A 2BZGA 3E8SA 4RVGA 5EIWA 4MWZA 1YFLA 1AQIA 1ZG3A 3FYDA 1XDUA 2AS0A 2DULA 1NE2A 2GB4A 5DT2A 5K0JA 5CVEA 3FUWA 2N47A 1SUIA 3HA7A 3OU7A 4E31A 5LQJA 4HTFA 1Z3CA 4YUYA 2OB2A 5F2NA 1YUBA 4CXMA 3TRKA 4GBED 4RTQA 2UYQA 3R3HA 3GDHA 3G7UA 4CTKA 4RVDA 4OBWA 2IH2A 3TQSA 3SXJA 3KU1A 5K0GA 4P58A 3GNLA 3PT9A 5K0EA 3CC8A 1MJFA 4A6DA 1NW3A 2OZVA 1QZZA 4QDJA 3D2LA 2IH4A 3KPJA 4XUDA 5FHQA 3UBTA 3KR2A 4Y30A 1XXLA 4M37A 4FT4A 4PINA 3G2OA 4KDCA 3NVKI 4AUKA 3SMQA 1JR4A 2FRXA 4KIGA 3THRA 2ZZMA 2FHPA 1JQEA 4C04A 2QRVB 3FYCA 2HNKA 1SG9A 3EEYA 4BLUA 4NECA 2VS1A 1AV6A 4MHTA 3BXOA 3G2PA 4DCMA 4FZVA 2BM9A 3I64A 3EVEA 5FULA 4CKEA 3ELYA 2XYRA 3MAGA 3F4KA 5E8JA 4GOND 1QYRA 3GRVA 3UJDA 5FQNA 3CJQA 1I4WA 3GRRA 4IV8A 4AZVA 4DZRA 5GM1A 5DTQA 5GINE 3LBYA 3NWBA 3HVHA 5BW5A 5F2OA 3JWHA 5DX1A 3PFHA 4YV2A 2YX1A 2H1RA 3MTEA 4PYLA 3EMDA 4C08A 5HEKA 2JHPA 2ZLBA 2YR0A 3KQSA 4HGZA 2NP7A 4HG2A 1M6YA 1FP1D 1RJEA 4HGYA 5EZSA 2OPBA 1NW7A 5FA8A 3X0DA 4BY9E 3HNRA 3BGVA 2B9EA 2C7PA 2AN4A 1IY9A 2IPXA 2O06A 3NJRA 3NWEA 1X1AA 2AOUB 3LKZA 3KKZA 3EVAA 5K0LA 2GA9A 3BKWA 2AZTA 3GU3A 2FPOA 3UJ8A 1Q0TA 5DLYA 3NW9A 5K0NA 1P1BA 3C0KA 3P97A 3HEMA 4R05A 3DLIA 2OKCA 3T7RA 3JWJA 3HVJA 3VC1A 3SSOA 4ER7A 1DL5A 2ZIFA 2ERCA 2NNWB 2YXDA 1IM8A 2B2CA 2CL5A 3P9IA 4CKCA 5K03A 2E5WA 2P7IA 2H11A 2HV9A 4F85A 3PFGA 1JTFA 2R3SA 3G2QA 3ER8A 3DTNA 4KVZA 5K0CA 3WSTA 5KQRA 2PBFA 5DSTA 4YUVA 4C07A 4Y2HA 2P3OA 5DX0A 4H0NA 3FRIA 4CTJA 3G8BA 3SX0A 3HVKA 1RI4A 3DUWA 2GPYA 3NDIA 1VP9A 2AR0A 2PT9A 5EHIA 2OY0A 3B3JA 3OE4A 4MIKA 5T64A 1DUSA 1VLMA 4BP1A 3AWIA 3B7PA 5CVUA 2VDUE 2FK8A 5DXAA 1N7IA 1R8XA 1KR5A 3JWIA 5GIPE 3KQPA 5DRYA 2I9KA 5GOZA 4BP3A 2CMGA 4QPNA 5EMJA 5EMMA 4ER5A 3GGDA 3UJ7A 3BGIA 4RTJA 2DPMA 1WXWA 4YMGA
chains in the Genus database with same CATH superfamily
1STOA 4H15A 4R1QA 4ZXPA 3NWOA 4M6WA 1NQVA 4DTCA 3IVRA 2VZ9A 5IDWA 1RDFA 3R0QA 4WOPA 5JHGB 4RTPA 3H18A 4D4KA 5D85A 2UZAA 2ZSIA 3D0QA 2C5AA 1CQXA 1NI3A 4NSNA 4Q9DA 3T9FA 4JKIA 4OFZA 1P3JA 4EPWA 5JQGA 2YICA 1H2ZA 3Q3EA 2VA8A 5DNCA 5A04A 2CJWB 3VBEA 4ZZ1A 1NMXA 3VXKA 3HVUA 1IMJA 2C9ZA 3WYEA 1TKBA 3DNMA 1G20E 5AXCA 5KYGA 1G2PA 4Y7DA 3UXHA 2G9UA 5EJEA 3BGWA 1SOWA 3IUNA 4D96A 1OBHA 1K6JA 1ZOPA 5LYYA 2YKGA 1Z0UA 2IPMA 1QIHA 4RGQA 3JVDA 5HQ3B 4DMUB 2IIPA 5BMVA 2ZBRA 1YVPA 1M2EA 1MAWA 4OATA 4RMNA 1T8WA 4IILA 4DREA 2ZRCA 3WRVA 5A3SA 4IX1A 5A3VA 2GILA 2W6CX 3DNPA 2NUTA 4OL9A 2LXNA 5AJUA 1S1CA 4WN3A 4GO1A 3T3DA 2OFPA 2XUDA 2QZJA 2WZDA 2GUWA 3Q7PA 4HVCA 5A6VA 5H3CA 2YRWA 1FBTA 4UUBA 3O91A 4CM4B 3O8DA 3QU2A 3DZIA 4FP9A 1N2XA 4CQLA 2PO5A 4YJHB 1RQGA 1F0NA 4BFTA 5FT9A 5C8ZA 2E4VA 3E2IA 3JYPA 1J09A 1DRUA 4LYEA 4KX3A 1QC5A 4Y9UA 3SYMA 2AF4C 3DOFA 4H7EA 1KO4A 1U9ZA 3CLTC 5FO0A 5H83A 3WMEA 1KBZA 3ZGVA 4B6EA 2VQEB 3JR7A 2DFDA 5KI6A 4O4LA 4ACAA 1M76A 3NGXA 1NBAA 4EI8A 3PNQA 3C45A 1DOZA 4UHKA 5CVJA 5KQSA 2AUNA 4DGSA 3NBMA 2QF7A 3EGIA 2JJ1A 1I8TA 2Z2YA 4DRXB 4JB0A 3DKRA 4BRWA 3CSSA 2HDOA 4BVJA 4ROSA 3ZXSA 1ESDA 2IPLA 2VF2A 3V9PA 3HLTA 1T1SA 2R60A 5IJAA 3BE8A 4PZZA 1H4QA 3NG1A 2ZUDA 2X5KO 2BHLA 1GU0A 2GCGA 1JVBA 3STYA 1QFMA 1AG9A 1QP7A 1MGOA 2ID9A 4ZOLA 1J0XO 4ND3A 2G9ZA 4TYWA 2I87A 1ZJYA 4FFWA 1SCNE 2BOVA 2D1QA 2FWMX 1I6KA 5IN4A 2YY7A 2GM4A 4EFKA 3F5QA 3ZS8A 3CUSA 1YONA 3NAMA 5BSKA 1OTXA 4IJUA 4DXDA 3WGIA 1Q7TA 2O8DB 4FKZA 1IPEA 4FHDA 4DMKA 2ZWVA 2PN1A 1YZHA 2HYDA 1RZRA 2A57A 4IS3A 2K4MA 3ANMA 1IPFA 1EQ2A 2RH5A 2F3PA 4GH5A 3S8YA 3F6RA 1TQ6A 2CDRA 2ZUSA 2GD0A 1TK9A 5FLXA 4K6HA 2COEA 4DR2B 4CCYA 5ELLA 2YJ4A 1G2IA 1MRNA 5CD9A 2NU8A 4B75A 2CNDA 2OT3B 2B69A 1WULS 1YDFA 3AF4A 5JH7A 4RLSA 3LV8A 3KHSA 3GT7A 2R1UA 4EJ0A 2WM9B 3W6UA 3BH7A 3U0BA 4X71A 4H6PA 4QX6A 5EZYB 5JDIC 1QIJA 5THKA 4K40A 2JLUA 3L49A 4YDHB 4D43A 2CFSA 2ZSKA 3UK1A 4C4SA 1T8RA 4CDRA 3GLHA 1Q7GA 2ZB2A 2IYSA 3TRJA 1QGYA 1PVOA 4LXTA 1U0OC 2MMGA 5KPJA 1R64A 3PYXA 5AKXA 1UJMA 1P1CA 4BIIA 4WXEA 3TRIA 1O8BA 2VATA 3CZ4A 3KYCB 4YCMA 3NBYC 2Q45A 2BE9A 3OCVA 3T3NA 1M2OB 1U0TA 1WAMA 2WP0A 4KX5A 2G09A 4AN4A 3I61A 2VF8A 2GPBA 2YVQA 5JCOA 3DB2A 2ORED 3Q3HA 4TTTS 3M82A 1TOAA 2VJOA 2WZCA 4G01B 1OCEA 4D2IA 1OLOA 5F1OA 4RQTA 5BQPA 2JF0A 4OQEA 3ZHCA 4AF6A 4AF8A 4BX8A 2R8OA 2PQ6A 3ZZUA 3ELDA 4IHJA 4I5FA 1WNTA 2SKDA 1CUAA 1WDLA 1J9EA 3I1IA 3OZGA 3V7YA 2BGKA 3CLRC 1VMDA 4GOLD 4DA6A 5TRTA 2WSBA 2DLCX 5B3KA 5D1HA 2RGEA 2CCKA 1R00A 2VDWB 3LCRA 4JLAA 5C7IO 3TFWA 3BF7A 3EXFA 4OK3A 2ZS8A 4KQWA 2BAGA 1DJOA 4B3XA 1T3HA 2C7VA 4IEIA 4L5BA 4C1NA 2CDAA 2E5LB 4N5DA 3ZD6A 4UXJA 4MQFA 4DMLA 5CH5A 5BW6B 4EHKA 4HAXA 2QN7A 2ZI6A 2LCFA 2QLMA 3UNXA 2W6ZA 4W8GA 3DMFA 1E0SA 3EWNA 2BSQA 2O8CA 3ZBTA 4P4UA 4LRTB 4NZNA 1EEHA 2OQIA 3H7AA 1RU3A 3CF2A 3IPXA 3LX6A 4QPPA 3VZCA 2C5GA 1GNQA 2D7JA 1AUXA 3K0AB 1AQ6A 5F77A 3I5MA 1WUHS 1W9HA 3NEYA 2Z56A 1XQWA 3C3PA 5TVGA 4WERA 1Y34E 3SK0A 5K8VA 3OZRA 4LQCA 2FWPA 3LWBA 5G41A 2LV8A 2EGUA 1XZHA 1JQJC 1KZGB 3D6HA 5KNBD 1UBFA 2CE7A 2QM3A 2VYFA 1KETA 1TCCA 4DL9A 3GLFA 1YJ8A 1NASA 2PWBA 3MOIA 4DA4A 2Z8YM 1VJ0A 1DIOB 3Q1KA 3T3EA 4NMXB 1Y8CA 1F8XA 3GVPA 1X1SA 1C3OA 4L72A 2WQ6A 1R8SA 1TDJA 3JRWA 2I4MA 3PJRA 1MV5A 2V1XA 1V7CA 5KU1A 2X9NA 5K20A 1NVVQ 2P9TA 1Y5NA 3AR9A 4PX3A 2Y1DA 3NWPA 1QRUA 3HCAA 3JVEA 4EPRA 3GV0A 2F1KA 2BI7A 1I32A 3KKQA 2ZB3A 2Z98A 3L1HA 3MGBA 1SC6A 5C8YA 1VBKA 4JJ8A 1T10A 1SBIA 3O31A 5JWOA 2G5GX 1QANA 4ZCRA 1XMQB 3ZH9B 1M72A 2GLXA 1QTRA 3U39A 4X64B 4E14A 2JGEA 3F9CA 1R12A 4B9EA 3FF4A 4EYSA 5I4IA 1N8SA 1PFUA 2ZTVA 2ATEA 2O2JA 3QEMA 1NX9A 3IP5A 2VAPA 3KJIA 2R6CA 3WGOA 3IR5A 1W44A 3KJXA 4EJSA 3ZCXA 1Z5UA 3QX8A 1VHDA 4RZQA 5HCNA 5TQ2A 2Y67A 2QLBA 1QH1B 3D4LA 1K8RA 5E9QA 3I0MA 4I46A 4B73A 1WY7A 4AJ9A 2NU6B 1RCUA 1K8YB 1XUOA 5AI4A 1ILEA 3LJKA 2I6QA 3C5EA 3ZCVA 1RLJA 2E89A 421PA 2A3NA 4EO9A 3ZVMA 1UADA 1W85A 3QUSA 4YLEA 4D02A 1WBDA 4ZCQA 4BKMA 4ZYZA 1GKUB 2YZKA 3R6GA 1KQNA 2RJOA 3EIEA 1QP0A 1T8YA 2RGBA 1AGYA 2XZDA 3MTIA 4MYDA 4NI5A 4XYEA 5FBKA 5HDQA 3S99A 1KRWA 1AS0A 3VTZA 1NF2A 1N2EA 4JJFA 3N07A 2PFKA 2EZTA 3EZYA 2EVWX 3OZWA 3A4TA 1ZCZA 3UICA 5A7GA 4TM7A 4MDYA 3CH5A 4N3GA 4J0DA 4H1TA 4ZYUA 4ZAZA 4JXXA 3ZE8A 4Y2JA 2GM3A 2H51A 2XGOA 2ZQZA 4DBLC 1NBMD 3HXKA 2P9BA 2HQSA 3TOXA 5JNWA 4B1FA 2G4VA 1IL0A 1G7SA 1SKAA 1VB5A 3UTDA 2PKWA 2ZJOA 4L08A 2D54A 2KBFA 2ZDQA 3BB4A 1VJGA 4CIXA 5J1TB 4DM4A 1QDUA 1VSTA 3DEJA 5BNWA 1YF3A 4AFNA 4JQYA 3Q5DA 4AO6A 3ZIDA 3PX7A 1P18A 2GASA 1T9DA 2Y8EA 1M5RA 2RAUA 1U4NA 2ZKLA 3VNRA 2Y6VA 3AHCA 1Q21A 5E3HA 4I1PA 3H4MA 2YZNA 3WGHA 5BOSB 3K0HA 3TZEA 3GEPA 4PTZA 1JSZA 3HY3A 1IN8A 1XVVA 4NHEA 1X7ZB 2CNWA 1H0KA 2MINB 3RLIA 1JKXA 4DRYA 3VNUA 4HAUA 3M4ZA 3PUKA 1EX1A 2PANA 1XZGA 1PF7E 2OWDA 3EFHA 3EFOA 3PC3A 4NR0A 4UTPA 1Q20A 4F93B 5EC8A 1UK9A 4L5CA 3ROFA 1LRLA 5AI0A 4NK4A 4DHEA 4J1SA 3FFXA 1YBFA 4BRZA 4Z3DA 4GLJA 3LT0A 3HJHA 4POOA 4CKBA 4RHYA 3QOYA 4WKOA 5AKEA 2PX4A 4F3KA 3MUNA 3RASA 4U6QA 1H2YA 3AOEA 1HE8B 4TYQA 1L1QA 3BBLA 3W6PA 1PE0A 4MO9A 3AF3A 1OLSA 1NMYA 3A9RA 3QKRB 4YAJA 5BN4A 1YTLA 2I7DA 3AFOA 4F8JA 3I2JA 5LUBA 3COWA 1C4WA 2BMJA 1E3SA 3NBUA 3T7EA 1G8GA 3EIUA 3PL1A 1CHNA 4DANA 1IEXA 3UAGA 1RJ9A 2EL7A 1JDZA 2Z95A 4JI1B 3W2EA 4ZMSA 4NNPA 1PYDA 1KPHA 2N1MA 3NHJA 2YHAA 5IXJA 4P9NA 1XNGA 3HCBA 1Z7BA 2O5RA 1Z73A 1GU1A 2W2VA 3FKSA 1FYEA 2VP3A 3AY3A 4BC1A 2F3QA 4E3ZA 5H59A 1XA3A 4BO6A 1XCLA 1I94B 1BSVA 5CUQA 5EJ8A 4EABA 3IKMB 1O58A 1II8B 1MFPA 1E61A 2NNLD 2ZBFA 2I6TA 3FYDA 4I50B 5BOVA 1N6HA 1QX4A 2JCGA 4B6JA 4NOMA 3FFAA 4TKVB 5CT4A 2XX3A 4JBGA 3SZRA 5L3QB 2EV9A 2X8BA 2BMAA 4DLNA 4RVNA 3SQXA 3DE7X 2QU8A 3UYKA 4YUYA 3ONFA 1HNZB 1BA3A 4QIHA 3NBZC 2JIRA 3ET5A 2VFAA 4ODIA 3VDNB 3OF2A 3RHZA 1NVFA 4JMLA 1VHTA 2TMGA 1ZL0A 4GLLA 5JMWA 3EJWA 3QXHA 4X62B 3DKPA 1I13A 2J9GA 4OV6B 2ODWA 2OZVA 1B3RA 3TB6A 1NDHA 3KFVA 2FW0A 3HGQA 1TTPB 4EEKA 5AKZA 4NYJR 1Q7EA 2Y4NA 4XGKA 2IH4A 4OKNA 2I4RA 2JVKA 4HDMA 1HDIA 3KR2A 3IMGA 3UBMA 2GK6A 1WBJB 2X14A 3KOUA 1PK9A 3EPRA 4FOPA 4M37A 4MPRA 2BFCB 5ALIA 3VNQA 1V5WA 3JQBA 3CCCA 1RCTE 3M2TA 2QUHA 4KBFA 3ABZA 1JQEA 1JE0A 1MG5A 2BFOA 2IU6A 4J1QA 3WIEA 2XD4A 1SG9A 4B6SA 4BWVA 4F1WA 4BLUA 1TTHA 1WCIB 2XDYA 3GLHE 1R0KA 4ZOQI 3QX3A 3E9MA 2G80A 1B0PA 3QPBA 4GPBA 4ZHSA 2VO1A 2YDYA 3QYAA 4A8HA 4HDRA 2FE1A 3W4JA 5E8JA 2R5NA 3URMA 5BV7A 1IBCA 4B0PA 3K1AB 3U7GA 4MKGA 5HRAA 1E7SA 2JAPA 1LV7A 2XD9A 5T5QA 1QHYA 2DUUA 1HV8A 2QTWB 1IZ7A 1A7KA 3LBYA 3LD9A 4ZU6X 4B3JA 1JHXA 5DX1A 4YHBA 3D2AA 1A5BB 3F6EX 4A82A 2P77A 3RT1A 1MT0A 2Q6TA 3KBBA 4LZPA 1T4CB 4Q4JB 1V8BA 1A5SB 1C1DB 2YR0A 2BMVA 4K26A 2FPLA 2FR8A 3K8YA 2JGDA 3AP2A 4KQ2A 4ZT5A 4LA4A 4FFBB 4GZ6A 2BHTA 1R66A 4X6XA 2DRIA 1PT7A 4C5AA 2NV2B 2X6RA 3QY9A 4R81A 3WL4A 2OESA 2VDRB 4UPEA 2Q8QA 4O8CA 3AUTA 1IVSA 3A3OA 2D5BA 4D80A 1IRXA 4RPCA 2WSSA 3R9WA 1TL7C 4X65B 3P97A 1NVAA 3HEMA 1DQPA 1IBLB 2XDQA 3GB9A 3VC1A 1GPAA 3L6UA 3FNIA 1QKKA 3JYQA 2ERCA 1K9VF 3V8NA 4BVFA 1WV0A 3HSKA 3IQHX 4L16A 4B82A 4DJJA 2PDAA 1N3IA 1AKUA 2HLDD 3M5WA 4TQGA 4G0VA 3OLCX 4S1NA 2GPWA 3BRCA 3RRBA 3RC7A 3WGZA 5EHXA 2AXEA 3JQRA 3K4QA 2PMDA 4DUZB 2R7MA 3WSTA 4PSVA 3A6EA 1U0GA 4U7DA 1NQAO 1QCCA 4BQEA 4HYEA 4NENB 5TX7A 5F51A 2IYEA 3D8HA 1J24A 3B1VA 3THYA 3U49A 3PITA 4CQMD 4FFNA 5JSYA 1Y3AA 2ZR7A 1VI6A 4R8LA 2OGTA 1EFHA 2GZ1A 1WQ1R 5T8KC 1LI5A 1RW4A 1DDIA 2B36A 2Q4DA 3TTYA 3VO8A 3QE9Y 1S4MA 4NESA 3BCRA 3G23A 3ZK7A 1NVTA 3MTQA 3TECE 4AKGA 2OFWA 2ZAOA 4EX7A 3MJSA 1U1CA 1KR2A 2PX0A 2QMUA 5F7ZA 5DCLA 1OIWA 1ETHA 3FUUA 4IJQA 1GPLA 4NARA 6PFKA 1S01A 5BN3B 3CW9A 2H1LA 1T6BY 4KV9A 2F8TA 3NS7A 4O29A 2V45A 3TL6A 3DFFA 3PNSA 1U9YA 1BWPA 3GLFE 5E6RA 1Z4OA 1GZUA 3RARA 1QGED 3LA6A 4WI1A 5ELXA 2RBEA 1MKYA 4F4DA 1XMXA 2NQTA 3WLNA 3LMKA 1ZD9A 5TQ0A 2MDTA 4OB6A 4AJHA 2PMKA 2VNAA 3GUUA 5G0UA 3AUFA 4WBNA 3HKEA 1VM6A 2QLJA 2WNSA 4NU5A 2W6QA 3CFYA 2HPAA 3C1TA 5E7MA 3GN1A 4OREX 1MB3A 4JYMA 2HRCA 3IEVA 3OFSA 4HNGA 3NRBA 4FDLA 4R16A 5MGNA 2NZJA 3GPDG 2JATA 2H5IA 3CPHA 3RIEA 3PCTA 4QWWA 1TA9A 5EJIA 3LY5A 5FPHA 4EENA 2PK3A 2X0NA 4AJKA 4NL4H 4JELA 4URWR 5A2GA 1KZ6A 3MNFA 4PWYA 1WHSB 3CQ9A 4ZT4A 4DYHA 1NXOA 1XI2A 3PD1A 4JSRA 4FMPA 3QXGA 3PQ7A 4YAFA 4ZAXA 1YK0A 3VZPA 4D74A 9ABPA 3WAJA 2XXJA 4GIBA 4RVOA 2HMSA 2ETXA 2QLNA 4RELA 4D82A 4QEDA 3U3MA 2VP6A 3NXKA 4NH0A 4IWNA 4G8JA 5CK5A 2XNCA 3CUWA 2HXGA 1IOLA 3LX5A 5AR1A 1U31A 5I3CA 1T0PA 4AKHA 3F96A 2ONCA 3LQYA 1RHUA 3FSGD 1LA2A 1S96A 3HFGA 1TQ4A 5B1SA 2B99A 3KE8A 5FWAA 1NSTA 4IMRA 4OX9Y 2WP8J 5DM2A 3S28A 4V0SA 2QD2A 3LKDA 3UHPA 3RE1A 1KK2A 3PUXA 4M7RA 3L0DA 4YDRA 2O20A 1BJKA 3BWMA 3O92A 4ALNA 5K09A 5F2KA 2QR2A 1KQ3A 4NNOA 2X1VA 3IEPA 4QGBA 4RKFA 3ZGNA 1Z3IX 5ITVA 4O3MA 4GMKA 1I1QB 4F3RA 5C35A 5K8IA 3BM5A 1E18A 4DCCA 1YVEI 5BV0A 1ZPDA 4RPLA 2JFGA 1X3SA 2LDXA 3FGPA 4ZTBA 5B53A 3UVEA 5ULLA 2YNMC 2OB1A 5C31A 1VC2A 2HPVA 3E2PA 1CV2A 1TF2A 4NLLA 1FDRA 4C4OA 3AY0A 3N76A 1XL1A 4X7PA 1HPLA 3S2FA 1RE1A 1PGNA 5DHFA 3KB8A 3DVQX 1R16A 4A92A 2WYIA 3HSSA 4A0GA 4KMRA 4QJ3A 1O5TA 3NIBA 4MS1B 3R9XA 1XRLA 2CYBA 3IUSA 3CF6R 1K5HA 2FVYA 3B9BA 3HSYA 3Q7EA 4HVLA 7MDHA 5CFMA 1IVNA 3IDOA 4F97A 3R6DA 2VBCA 2YS7A 4PQGA 4UQOA 2GJ8A 2V4UA 5YASA 2ORIA 2CCJA 5IAGA 1ISJA 4X8HA 3DAHA 1JYSA 1CTQA 1R0BA 2PEZA 2VQSA 4YRKA 3D0RA 3GAMA 3CLSD 3W78A 3Q3GE 4CMIA 4K87A 3RVNA 3OF5A 3TD6A 3ZWQA 4AZTA 2IU4A 2H2AA 3P2EA 4YO8A 2M6KA 4O63O 4RK6A 5CMLA 3L4SO 3UW3A 4ARVA 3EAFA 2C9BA 4RMJA 4HDKB 1KQPA 2Z43A 1X7HA 1X9HA 4KEAA 2XUPA 5ALRA 3HZRA 4WLOA 5JZVA 3KR9A 4Z8XA 1VG1A 2ZW9A 2QX9A 2Q4RA 2I6XA 2ZK7A 3ZWYA 1RZRD 3T5TA 4KIFA 5LYJF 2HRQA 1TVKA 2FWIA 5D01A 5E1MA 3IPAA 4PM4A 3A4YA 4KYVA 4WXMA 2GZRA 1XFDA 1KEWA 1VPLA 2PD3A 2GBIA 4ND7A 4B3GA 1C7JA 1CQZA 2QJFA 3GNQA 1TCAA 3EZGA 3G5LA 3IAUA 4HUJA 1GDDA 3B82A 1XKLA 4MYRA 4X85A 1GGVA 1MHPA 5IYZB 1DKQA 4MQEA 4NVRA 4Q3AA 5TJ9A 3V2HA 5LZ2A 1DARA 2GBLC 3I9LA 1W8IA 4KP7A 5I9MA 2XVXA 4F5WA 2UV8A 4X20A 1VG9B 1BCRA 3O1LA 3QK7A 5KQPA 4Y2QA 5FBHA 3VR6H 2GEJA 3EVZA 3MB8A 1WUIS 3LX4A 3WQRA 1CDOA 1S0UA 4C22A 1Y5RA 2XJ4A 1BOFA 4CF4A 3MS2A 3BVPA 3TSAA 5IJ9B 3IELA 3ZXUB 3O82A 3G9XA 4MOWA 4NKRA 2GXQA 2Z6AA 4EG3A 5HQJA 1RRMA 3MD9A 1KMQA 1ZMBA 2G76A 2V0CA 5EL0A 3WWDA 4CG0A 5JQGF 1YHYA 1ZH2A 5ECGC 1XPOA 1I3KA 4RHFA 1DI0A 3CRW1 3L8YA 1P7PA 4F3YA 2C94A 1GWNA 3EIHA 2C5FA 1CF4A 3V8EA 4AYWA 1HMPA 3CX6A 2NLOA 3F5MA 4PRYA 4U3JA 1H9BA 1NONA 1U2DC 3G9QA 1KMHA 2ODPA 4N5NA 4XFKA 5TPWA 3OJXA 4MUFA 2VUSA 2QENA 3AM4A 5HIJA 1NMQA 4F5ZA 3H65A 5J4VA 1RYEA 4JK3A 3VKHA 2BFNA 1T9CA 1JX6A 3PB3A 1HDZA 4GMDA 1T6NA 3H5IA 4PZLA 1IHYA 5HPYB 4JR0A 3HXPA 4L3VA 4E94A 1YNOA 1IHDA 1HA3A 4WFKA 4MW1A 4K9RA 4H1WA 1LVGA 4AI6A 1RC1A 4MKRA 1IZ8A 1TMOA 1K08A 3AFIA 1VECA 4HB2A 4QUAA 2HK7A 3A4MA 2OVFA 3FPBA 4MP8A 2IEBA 3H9GA 4XLTA 4MV6A 5EHNA 1O9GA 1Q0HA 2Q5JA 4PV7A 4L9WA 2FA9A 4MEBA 2HMYB 2R7NA 1GZ6A 1UWKA 1VKRA 1EUDB 2GFQA 1ENZA 3R20A 4OHPA 2NVUB 4BWYA 3VC3A 3P1JA 2BJWA 4W6ZA 4IXDA 4TYMA 1SUPA 4G1MB 4JXJA 4WESB 5HILA 4ASUD 4R2JA 3MWEA 3SYLA 5J43A 4WX2B 1GZ3A 5CCDA 3KAPA 3L7LA 4P36A 4PQYA 2KM1A 4GEGA 2PG3A 1PG0A 3IH5A 4J3JA 3H0CA 5E0OA 2ZBQA 3GFVA 2H0AA 4DIFA 1ZMXA 2C00A 2W2LD 1R6AA 4JLUA 4IOKA 5CA0F 2WTUA 1B0UA 2J9FB 2WYWA 4PEVA 5ICEA 1FLNA 4ZAVA 3OOHA 2IOHA 1YRAA 1IUNA 2V97A 3ZEIA 1MENA 2Q28A 5BSGA 4U9UA 2UUAB 5FOTA 4RM2A 1PTJC 1H65A 4EUEA 1O3YA 1BXZA 4GP7A 1PLKA 1R27A 5MN6A 3LUGA 4P4TA 4I8DA 3E70C 4R7TA 4O4JB 1T36B 3MTDA 1I1HA 2EU8A 2VPIA 4LWOA 1T8PA 2QAJA 3A7DA 1T2DA 3PNVA 4FSHA 4KPGA 1KAOA 3IBYA 5B7PA 1MPXA 1OTYA 2YXNA 1JW9B 4BX2A 1BCSA 3UHOA 3S0JA 1K7XB 4FS3A 1PS0A 4JEMA 1K8XB 5KTPA 1NUUA 5PGMA 2C1XA 5C0OE 3QTLA 4JUDX 4LF9B 4DJAA 4TYYA 2WPNA 3N2KA 2EQ5A 2NUAA 3N6RA 5JLJA 4IIFA 2PUEA 4DV3B 1GILA 1RWPA 3A2KA 1QK3A 2VWPA 2HIGA 3GA5A 2H4JA 2OC4A 2CNOA 2DKOA 2D5LA 4TL6A 1ENYA 1ZOSA 2YVKA 1DNPA 1W1WA 1ORVA 1Z5NA 3EVDA 3SLGA 1IM5A 1C9DB 1U3GA 2PKQP 3HFSA 3JCZA 1TAQA 2YZMA 4Y1GA 4ZXFA 1MUUA 4L15A 2V96A 2G3YA 2GAIA 3IX7A 4I4IA 2A0KA 5BSTA 2Y68A 5CX1B 2HEIA 3FR8A 4GC5A 2W58A 1W1UA 2WLTA 4KXNA 1QE5A 2ONZA 2VP0A 3KQTA 4L6AA 4LE2A 4U2CA 1G1MA 5CM9C 1JBQA 2W2XA 3COPA 3P9YA 3GG9A 3U37A 4PVCA 1HNNA 4BQPA 3MJHA 3QLVC 4CDGA 1U0LA 3PWKA 3QVSA 5J23A 3O8RA 3W8EA 3NFYA 4ZAWA 3LL7A 1DBIA 3IP9A 5JSQA 5B2ZA 1KTVA 3PS9A 3R09A 3O8QB 5EXXA 4GX0A 4C1BA 1WW8A 2Y9MB 1V8ZA 3B9QA 1BE1A 2XEXA 4JUCA 3PV0A 3ANLA 1X7XB 3HCDA 5K5EA 4B3TB 2Z8XA 5C7OO 2IKQA 2VG8A 1J4AA 1T24A 1NYQA 4V38A 2WHRA 4DSAA 1D07A 1U0JA 4LOAA 4NZMA 2DKNA 2ANCA 1G5FA 1D8TA 1XOIA 4AJIA 1RTTA 3VPHA 4FFDA 4D4MA 1GGFA 1R4NA 5K7SA 2HX1A 2GLTA 2VSOA 2C61A 4O3FA 1UMKA 4NNJA 4Q1BA 4UKDA 5FLYA 3OLVA 3U44B 1UMCA 1NI4B 5AFSA 2GVDC 3F3KA 4M1WA 4P53A 4EY8A 2JFHA 2JD0A 4HZUA 2CBXA 3PGJA 4OXNA 5FUBA 1F6WA 1YVUA 2ZB8A 5B2FA 2A0XA 2AHOA 3VYSB 2GSDA 1OA1A 2YINC 2A5FA 4HH3C 3TDKA 2JK1A 5CCEA 4FHFA 3K9BA 5AO9A 1A1VA 1CJMA 1XTRA 3IKJA 5AVQA 2A86A 4L4RA 4MRMB 2C4HA 4D97A 5IKMA 2WBLC 4IOMA 3KCQA 2ILVA 2AV6A 5DW0A 1W93A 3QVVA 2MCFA 3A28A 4OIMA 3UW1A 4Z7JA 4H7HA 3SZ3A 2IYQA 2QTRA 4PFQA 5DDIP 4LC9A 4CGZA 3JZMA 3D3NA 1II9A 2VJYA 1PDWA 4P4LA 3AYZB 4Z5XA 3DONA 1GKLA 1GZSA 1F4VA 3OCWA 2R6AA 2YFHA 3AI2A 4Q24A 1SUIA 3L7DA 1A4XA 4MKIA 3W8RA 3WKDA 3L7MA 2XPCA 5F5XA 5LQSA 4AZ3A 1CETA 3Q2OA 1U2EA 1NUSA 2NU7A 2W6PA 5CX4A 4LJKA 2RH8A 1Y7HA 2FW7A 3AK4A 3IBFA 1TIKA 4Y0AA 3WIVA 4E15A 1O57A 2WRZA 4HNAA 3HUEA 1D5CA 1W19A 2PH3A 3HADA 4MNTA 3FDIA 4BVBA 2DAPA 3KOWA 3ABRB 3JQ9C 3H2KA 4GQIA 5EMHA 1P2VA 2HDHA 4ARBA 5LWQA 4QJ4A 2V0GA 3SF8B 3A6JA 1LKZA 1RQNA 4KDCA 4HEA6 4LI3X 5IULC 3BOSA 3H1FA 1WL8A 2ZUUA 1XEAA 3ETCA 4FCWA 4ZD6A 1QH0A 2C7GA 2XNJA 4V1CB 3O3CA 1B6SA 3PI7A 3LPDA 2FSPA 4EF6A 1MX1A 5G2OA 3WNVA 1DKRA 1GO2A 4P92A 3DOCA 3BJIC 3QVLA 1N5LA 3JS5A 4FE3A 4NECA 4NP6A 5JECA 4TM8A 4Y6LA 3UN1A 3DHVA 2BFWA 3Q0EA 5JDCA 3IDAA 5C32A 4EMUA 4CNBA 2DEUA 4LQ4A 1YTUA 1EZ1A 5E95A 2VJAA 1SN7A 2YFQA 4Y9RA 3I28A 4RW0A 3C7CB 5BO5A 4C6TB 5HKAA 4UEOA 3USES 2GTHA 4YO7A 1IB0A 2JHPA 3E7XA 4HGZA 4X90A 4G4SO 5CTAA 3TQTA 4QXMA 1P7ZA 4Y1EA 1K89A 1KOJA 3HNRA 3IUMA 4GZLA 2UYYA 2D3WA 5EQFA 4AQDA 1EBUA 2IPXA 4YWJA 3QNWA 3U80A 1XZ8A 1YJQA 2NUPA 1K4YA 1ZWKA 2WIDA 4Q7KA 3GJQA 3ZBQA 4AWXA 2AUTA 1H2XA 1OSNA 2AEJA 1VCMA 2MJLA 1N2IA 2PJZA 2GTIA 1IZZA 1XJCA 1P0QA 3L1IA 1JSLA 1RM3A 4R05A 3O03A 3VAYA 5IX8A 1GG2A 2ZUCA 3X44A 1PNOA 3P9IA 4TV8B 4BO0A 1D2EA 1U02A 3N0WA 2P7IA 4C7BA 3AU8A 1P2UA 1X13A 3U3KA 2PL5A 1ACJA 2X1HA 3R5KA 2OG1A 5AK4A 1JFTA 5UKDA 1PZEA 4GZMA 2HLPA 1W7AA 3HKCB 1AS3A 2J7KA 4MVJF 2PZKA 3MINB 2W42A 4G0ZA 1FVFA 1P0CA 3QF4A 4G1EB 2CL0X 2WAXA 1YB7A 2PJUA 3DCYA 1DQZA 4LW8A 1RC0A 4TKZA 4J2OA 1G6HA 1JU4A 3GARA 3HCNA 1VOTA 3RKRA 2EWWA 4WOCA 1NJ1A 2JRLA 5D2CA 3FPLA 2PS0A 4ROTA 1G9TA 5DRYA 3HRIA 1F1BA 1QIGA 2I9KA 1AT1A 1YBAA 1IHXA 1U8TA 4PVDA 2W0MA 5LBIA 4Y3UA 2EP5A 1VHLA 4UHBA 4TVSA 3QUCA 4DNFA 4NCAA 4NJMB 1XTVA 2MU1A 4YMGA 3VJLA 3E22B 1A5ZA 3E6AA 3A1EA 3AO0B 5DN6A 4HDSB 4UXHA 3CG0A 5KHLB 1YOBA 1E2GA 4EHNA 2DBQA 4RJ2A 5EJAA 3OWXA 4I7EA 5GQSA 1ECPA 5CXXA 1BQEA 4BNTA 3DXYA 4NU6A 2ZUTA 5I7EA 5F3DA 2BFDB 1EFUA 3E4DA 1C1YA 1RRCA 2V4MA 5AYVA 2ECQA 3EPPA 4BLOA 1WOMA 1JI0A 1I2MA 4HPWA 5C8VA 2J0QA 2F90A 5GMOA 1TO2E 3UUWA 5DLPA 1POXA 3U6KA 4HRYA 3AY7A 1Y9JA 2NX2A 2ONYA 3RUHA 4GI7A 1DXYA 1Q0SA 3ZCTA 2IXDA 1GA6A 3NC0C 3QBJA 2KJQA 4ESOA 4CI9A 2ZYDA 1RJDA 2AFIA 3DP9A 3EVBA 1HTBA 3IBTA 1OAOC 2PJDA 4HN9A 3AEUA 5AXAA 4XM0A 4ANFA 4CCAA 1QR2A 3M70A 4EWLA 1MVNA 2ZRKA 4UCFA 4I1RA 2IYFA 3AV3A 5JUWA 1P0MA 2B1JA 1BX0A 2NM0A 2XWPA 1CB7A 3E9RA 3LX8A 5EP2A 1OGJA 1YI1A 3RSOA 2G40A 3JPWA 5C1OA 1IY8A 4OQXA 3IXMA 5CD1A 4EVSA 4ZCTA 1FFSA 3NP9A 1ADYA 4RMHA 4Q4HA 1VE9A 2CNNA 3BDIA 4R9SA 5IWAB 3HO6A 3AJ9A 3P0FA 4KRXA 1NBEA 1CY6A 4RADA 1DXHA 1ZRHA 4EG6A 1GNRA 2ZSFA 4D9IA 1JU3A 3H0EA 3O74A 3A32A 3COVA 3VAAA 1T3LA 1ZCJA 4KOEC 1ZD4A 1RMYA 1Y5LA 1M8PA 2DJIA 5BPFA 1YE5A 3EEOA 1DLIA 1IDOA 3AF0A 2WT8A 1SCQA 3K6KA 3QTBA 3LYHA 1IUKA 4IRXA 3UFXA 2XYHA 2HMTA 5G0VA 3ZLJA 1ISGA 3IUYA 3O9VA 1P2DA 2ZBUA 3K09A 3FNEA 4NV0A 4K5QA 2AK3A 3T0GA 1SCKA 3NHZA 4MB2A 5EJ4A 3LVRE 4YT5A 5DCWA 3GDGA 4EZBA 4QXQA 4ND4A 4CODB 3V1MA 5LOVF 4RYDA 2AMLA 4Q7JB 4YAWA 3C41J 3TN7A 3KLBA 3BULA 4QE3A 4RYLA 3ZNQA 2YWCA 4DLVA 5HUHA 3HGMA 1OGYA 3ZCUA 4TRMA 3HVIA 5GZ3A 3DT9A 5EIHA 3WLMA 3OHPA 4ALKA 2QHXA 1ZMOA 3UJPA 1TNDA 4G8CA 4UTOA 4ZYLA 4KXVA 5BSVA 3HTXA 3PK0A 1P91A 5KMGB 3WLRA 1FP4B 2BUBA 1DMRA 3HU2A 3RS3A 3LVQE 4GX1A 4QBKA 4R2IA 2UYHA 1JHDA 9LDTA 4PPGA 3WR5A 1Y4AE 4ZI3A 2NYVA 3NAZA 1CU1A 4LZJA 2FEXA 3HXMA 3EOZA 1FB5A 2XSZA 3IXLA 4UM8B 5DHRA 5G40A 2YOFA 1O94C 1U2QA 1UPXA 2ATXA 2IZ1A 4G0PA 2YYAA 4HGRA 1AHHA 2FEPA 4K6FA 2O3TA 2JGAA 1IZ9A 3CN9A 4L7VA 5CHYA 4YH1A 4F3TA 1HFKA 5L7WA 5HZHA 2PXAA 2QJOA 4RIFA 4MW2A 4WEOA 1OX4B 1M67A 2JKVA 2YRFA 3WL3A 4R8RA 5KC9A 4CLOA 1QRDA 5GV8A 3BF8A 3GJ3A 1HTTA 1T9BA 5DHQA 2DLNA 3BXHA 2YJGA 5I7WA 1XMOB 4ENQA 3ISJA 3JARA 4C6SA 3CNQS 3L07A 2V74B 4D6XA 5EMKA 2FEMA 2O8BA 4MB0A 1E1LA 1US8A 4FHGA 4JVMA 3MPUA 1DPGA 1IXSB 1G7CA 2WNHA 2WU4A 1X2BA 2EDAA 3AR4A 3KJZA 3OEEA 2GA8A 4MX8A 5WRFA 4E6PA 2UVQA 4MUYA 3K70D 1JAZA 1OAKA 1RYFA 1UC4B 2QT0A 3H5WA 3D3WA 3LSYA 1AUVA 2E4ZA 5DLEA 4U7JA 3CUYA 3VR5D 3PGKA 4MUEA 1UH5A 2EJWA 4E0BA 2NACA 4DLRA 1GZ4A 4PNHA 4TMKA 4YASA 1EXWA 1N2OA 3URKA 4D8VA 4F04A 4URXR 2E7ZA 1N9ZA 3NYWA 2WF5A 1SXGA 3E9EA 4UE3S 1IIRA 5C46F 4IXWA 3P2IA 4XIIA 5EJ9A 1NLUA 5AT1A 5LZ9A 1RWWA 5KHAA 4ADSG 4A0SA 4KXYA 4ZYTA 3RB8A 1YFJA 3JD1A 2WIFA 1T9ZA 2JZCA 4AK9A 1YS2X 2FU5C 2FCAA 1F2VA 3SEFA 3VUFA 2Z57A 4ZHQB 1E6LA 2A0FA 3ZKAA 5BVGB 3ZZTA 4CTNA 3NVAA 3P9PA 4Q9LA 4YCJA 2RK6A 1DX6A 1T2CA 2N46A 5FWXA 5KDLA 3U4GA 4Z1OA 4OHOA 1KIAA 1E69A 4DWJA 2HJSA 2Z2ZA 5IC5A 3JX9A 4W6QA 1EU1A 2XOEA 3HCEA 3QVJA 5T4EA 4DILA 1O4WA 4B5KA 2JLZA 1CUYA 3X43A 1OXSC 3K73O 2UZ0A 4UE6A 3WLQA 3IJ5A 1M74A 1E79A 1NVEA 1JILA 2WK1A 3PRYA 4NPHA 3OT4A 1TVMA 4G63A 5DP1A 3WFZA 1Z17A 3G79A 2FP4B 1N36B 4MDEA 5BSMA 4PWZA 4CGYA 4IVPA 4Q02A 4EI7A 1JQ3A 2IZ7A 2ZI7A 5I45A 5K3EA 3MHPA 1TM1E 4WWHA 4AZ0B 1L9KA 2QGNA 2WSYB 2HWKA 2XUAA 4I2VA 1M7BA 2L17A 1EQAA 4PS0A 5KYUA 3TLZA 4KK4A 1V35A 4FFVA 1QBKC 1B8VA 3TR5A 3ED1A 4JN6B 3C3KA 1MC5A 4MH0R 4D3XA 2Y1KA 3IUQA 2F3TA 4JP1A 3WDMA 2AQKA 1O54A 4MW6A 5B58T 3S7ZA 4CF5A 2X41A 1IBMB 3T1OA 4JX8A 4PGHA 1JEJA 4EHHA 5ESRA 3RSSA 3Q9NA 3WGQA 3KYJB 2PZLA 3TSYA 2I0FA 2HGZA 2IHYA 1YS1X 4XKJA 3DF9A 3H99A 1ZSNA 4MYUA 3Q72A 3TBFA 1WMFA 2O3JA 2VF4X 3HUFA 3M6VA 2GNAA 1ZIOA 2PRZA 1PN3A 2IDJA 5A2QA 2M6RA 4F3NA 1DC8A 4O4IB 1WXQA 5ALGA 4OHYA 1Q0ZA 1U8UA 1WVGA 2QTLA 2ZS9A 5EY5B 1XZBA 1D6MA 1G8JA 3K5IA 5AD1A 3FPCA 1UAGA 4C4YA 5IM4A 5B12A 1FTYA 5D00A 1N3LA 4HKTA 2BLNA 4JEHA 3BWCA 8ABPA 2GX6A 2Z3VA 2OBXA 4JI5B 1I4DD 4GVLA 1NNEA 1DAOA 2IZ0A 2YWJA 4WLNA 2JJ2A 2B6HA 5IKOA 1R18A 1U8XX 4RVFA 2BMWA 4C6RA 2WD7A 1KI2A 1L5LA 1AB5A 4G09A 1USIA 1SOUA 2VKTA 3DFZA 3NR2A 4KN5A 5D3ZA 4MRVA 3KCNA 4TTQA 4NJEA 2ZRAA 1FW8A 1JHZA 4F12A 4NONA 1B0ZA 1EFVB 2NU9A 3X3HA 3ICWA 1WD5A 1RJGA 1LW6E 5C7LO 3U31A 5JI3E 1YUMA 4HCJA 2H5LA 1KZ4A 2H0QA 2H6EA 2HCRA 4RANA 5BT9A 2D13A 1O9BA 2AR9A 3N3BC 3B89A 5E38A 1P1KA 1RKBA 2WI8A 3EARA 3VC2A 2X13A 3A36A 3R23A 4A1OA 1ML4A 4BV2A 2ERYA 4OB7A 3JQDA 3MT8A 2OD9A 1DRKA 2FMUA 3A26A 3P9QA 1WPXA 4RABA 5AK3A 3H8WA 1HNWB 4K7JA 1YRHA 3BQ9A 4DSZA 3S2IA 4R8MA 4KACA 1Y37A 3ZK9A 1Z34A 2JLBA 3FSRA 3RSCA 3ZWAA 1A9XB 1H85A 5KOHB 3DE6X 2ZAMA 1R6UA 2W71A 4P7JA 1M9NA 4BBJA 5BNFA 3KSMA 4AYXA 2EP8A 3D3EA 3JALA 4TT3A 1CNFA 1XAIA 1W1IA 1D9XA 2F67A 4CEIA 4JBWA 4BV3A 4MW5A 1D3AA 2PTGA 1HMYA 4KIWA 3UCEA 3PHIA 3AQIA 2X4DA 4J0IA 4D0GA 4QFDA 1JIVA 4K03A 2MWMA 4HAIA 1LBSA 5HIAA 1DJMA 4F5DA 2ZUBA 2EYQA 5D3MA 3WLHA 4C05A 1DTWA 4WZ6A 2AI2A 5DNWA 2QX8A 3O4RA 2ES4A 2P4EA 3HY4A 1ULHA 2HIHA 1CR0A 5HE8A 4O4HF 4IYJA 3R4CA 2B5WA 1FRZA 1UBUS 2P65A 1OI2A 5EGNA 2XA2A 2I33A 4KIUA 3WNCA 4AO8A 5K8UA 3AL3A 4ZU1X 5AW3A 2AFIE 5FBRB 3OU6A 2BZ0A 2DKFA 1N8KA 2R65A 4Y2UA 1B41A 4FGLA 1EJ2A 1N3YA 3BE5A 3COYA 4PNZA 4RPHA 1UXOA 2QRGA 5LB2A 2WWVD 3Q7TA 3IB6A 3MCTA 3EISA 4V02A 2WDPA 3EIQA 5BR1A 1BQ4A 2GEKA 1MQ8B 1DFIA 1CUWA 4EELA 4HUTA 3KUDA 1WLSA 1K7FB 1ONBA 2CHVA 3C74A 1SUEA 2Q5LA 4MCHA 4MV1A 2ADMA 3WKEA 4LF8B 4K1LA 4KXXA 5K0BA 4ENSA 3QU4A 4W5RA 1JEQB 3DKIA 3DE2X 3B5IA 2HMWA 1HZJA 3T4PA 2J4CA 1EFAA 2WWGA 4RDHA 5KC8A 1F9AA 1L8LA 4HDNB 3VZDA 4BNNA 2DSTA 3H2HA 4Z9XA 3HPRA 1CEEA 5EUCA 2XWSA 2OOKA 1JT2A 1VGVA 2G63A 3NO4A 3E48A 2J5BA 3EZLA 3A6LA 3KYBA 5LD2C 5K3FB 2A67A 1XX6A 1CUGA 1KI9A 3I2GA 4L3WA 4GOOD 1RP1A 3ADOA 5HUQA 4W1SA 4CWAA 4PHTA 1EXMA 1G6Q1 1LFAA 2B7CA 1EK6A 4NYIQ 5TVKA 4C7KA 3AEXA 4W5OA 4RF3A 1WD7A 1UBKS 1F48A 3VSCA 4ALJA 5AHOA 2FSUA 4BLRA 3FOWA 4QEKA 2ICAA 3HJGA 3FWHA 2FG7C 4RSMA 5EIWA 4ND5A 1ZUNA 4YRDA 4YAUA 1YFLA 2GM5A 2YHSA 3UC9A 1ZINA 2VJMB 3M3HA 4J07A 1NE2A 4M7WA 4QDTA 4HAOA 3UATA 4RKQA 4M21A 4NQZA 2ZP1A 3QJYA 2FUCA 1LB1B 1SBCA 2DFLA 2RGNA 2FW8A 5F2NA 4ARCA 3TRKA 1IG3A 2P90A 3NAQA 4ZARA 3WK8A 3GDHA 3ZCSA 2PXHA 1X9IA 3CZCA 4EI9A 2H92A 2VHEA 4IF6A 2VHWA 3C4JA 4LXIA 2CLLB 5FLEX 2X2PA 1CUBA 1ZJJA 4X1YB 4DLBA 5C51B 4RD3A 3JVUA 4ZU3A 1G20B 3PFIA 4Y9SA 1Q1QA 4BVKA 2UZ1A 4JJEA 1BG6A 1XPJA 4G26A 1F14A 1YZKA 1M7HA 4J0JA 4LGMA 3U3OA 1AE1A 1UDAA 2FX5A 1MX5A 1TYBE 2Q21A 2WU0A 1Q17A 1JLKA 4QGAA 1J0EA 3H6KA 4MWOA 5ALFA 1V0JA 3HNPA 3TTUA 1W36D 1NAIA 3SEQA 4EDFA 1SCJA 3CISA 3GG2A 3B3QA 4RPJA 3S6JA 3VPSA 3BXOA 4DCMA 5DBGA 1KSHA 1TUGA 3N39C 4LPKA 4RAOA 3ZJ4A 3CH7A 1DU4A 1P5JA 3CRVA 4C88A 5BNZA 1KL7A 3OIFA 3GRRA 3GZNB 1E2NA 3DBHB 3I9NA 4DZRA 1YOVB 4Z4CA 4LE0A 3A58B 4P3YA 1JN0A 4XTCS 2JL1A 3OIWA 5E0KB 5IBPA 5I8ZA 3IAHA 2YX1A 1Y3HA 1UJ4A 2PH5A 4Q4AA 3LQQA 4QULA 4WH0A 4DLXA 5FR2A 5HEKA 3SZGA 4E4RA 2ZLBA 3KXKA 1O8CA 4D0SA 3WRYA 1NW7A 1H05A 1IB6A 1RD4A 4BMVA 4C7VA 4JBLA 3VO9A 1C5KA 3PUIA 4NH4A 1OYWA 1VJTA 4ZKEA 4I1SA 1BZYA 4OQLA 3UGJA 2GD6A 3TH5A 5HJ2A 1WP9A 1Q1AA 2GK4A 2GKSA 2J4DA 3BKWA 1VXOA 4B6RA 3AC0A 2XUHA 2HW8A 2RFLA 4DOMA 5D5QA 1Z5OA 2KYRA 5F4BA 4GYJA 1U11A 1JH8A 2B2CA 2FPIB 2X7JA 1YAHA 4F92B 1U2GC 4EHJA 4L6IA 3P94A 1Z15A 2Y27A 1T13A 1YZQA 3K1ZA 2OFOA 4Y67A 3EUWA 3BMOB 3TINA 2JLRA 3UT0A 3UOWA 5LD2B 3KWFA 4P35A 1C3EA 4YFVA 2GVNA 5KQRA 5GJBA 2HSJA 4TTSA 4H0NA 3FY4A 3QWFA 3ZPXA 4OFXA 4PZUA 5L51A 1ZSVA 2EGHA 4ITUA 4NZZA 4AY6A 3C97A 4KQKA 2FUNB 1SVKA 2BYTA 2FUG1 3HU5A 2Q07A 2P4SA 4TUYF 1O7JA 5KNDD 1HSOA 2ZBDA 2ZYRA 4BP1A 2VDUE 4QYIB 4R40A 3WIUA 4MTCA 3BMQB 2JDID 1A71A 3DF7A 1UC5B 4OQQA 2OV3A 1HYBA 1T1EA 5EMJA 1JU9A 1LSUA 1HEIA 1SCDA 1SQ5A 4GLFA 2RARA 4HGOA 4HH4A 5L3VA 4NCNA 3T1TA 2WTAA 2H3HA 4Z99A 1ZJ6A 4BUCA 1FMLA 1PJ4A 3LIPA 4F6RB 4MUHA 1U1GA 3VYVA 1SHTX 1KJWA 5JASA 1KVUA 4S0XA 1H0RA 2V6IA 3K0FB 1SKUA 1QOPB 2EQAA 4DDWA 5JZ9A 4M89A 2EW2A 1Z22A 5HX7A 3HL4A 2OLJA 4D6PA 2BT4A 7AT1A 2QK4A 2V6GA 4CM9A 3KPWA 4R8SA 2O19A 5JV5A 2JCXA 2ATIA 3CLHA 5GGYA 5LKRA 3H1BA 2EAUA 3WMGA 3I12A 4IMIB 1E8MA 2PCJA 5LQKA 1F0YA 1J2JA 1N4DA 2VJKA 3DTTA 1BKSB 3CLUD 2P62A 3E8MA 3T95A 2VK1A 1T5OA 2IOFK 1SU6A 4AS3A 1KI7A 1ZN2A 5ILOA 1W30A 1CRWG 2ORYA 1SBHA 1AV7A 2ZSJA 3JQEA 4FYJA 4KQ6A 5J9FA 2ZE6A 5ADVA 1ZC4A 1OWPA 3IT0A 5GZ6A 3AT1A 3G59A 2B98A 1ZLYA 3TE6A 4QDXA 3V6LA 3WK7A 4KPEC 3K6RA 3RYIA 5BR8B 4CEJA 1UP4A 5DASA 2NTYC 1NXVA 5FPTA 2GEFA 3GP5A 4D1YA 3K0CC 3OOSA 5REQA 4CLXA 3OAAA 1YR6A 2J9YB 3FMOB 5CDSA 4IIJA 3LBNA 3IIJA 4J3FA 1Y3DE 1ZD3A 3AZQA 3BGOS 3II6X 4NTZA 4AX8A 4OMDA 1JRLA 2FZ4A 1P6XA 3FCSB 4MDHA 3SVZA 2VYND 1QFZA 1GZ5A 4E5DA 2X3YA 3AW9A 1FP7A 1NSYA 3ONVA 3TLBA 5HGXA 3B20A 3UH1A 1XN1A 2C3UA 1OT5A 3FFWA 4K88A 4O33A 5FNZA 3GFOA 1XKTA 3TFOA 1HY3A 2OAEA 2YIJA 3CRZA 1Y8QB 3ACCA 4HSEA 1RXIA 1Z2CA 1LNZA 2QVXX 3BMCA 3JSAA 2QQ5A 4UVGA 2VAXA 1F8GA 4IJ5A 4CL3A 1XCJA 1ODIA 1OC4A 4R2WA 4R68A 1RPJA 1HG1A 4OUKX 4QGHA 1FS6A 2OK8A 4G37A 2C31A 3D64A 1W2GA 2H1IA 3RRFA 3SOZA 1ZIYA 4UPDA 5DYTA 3TG8A 3SNKA 2OM6A 3P0HA 1WCWA 4A26A 3LZCA 3AKYA 3UWOA 1E20A 3FJ1A 2ZPAA 4MW7A 5BN1A 4QDOA 4WZAB 2Q6KA 1PUIA 2QVZX 1L7EA 3QHQA 4I2NA 2JGIA 4GG1A 4IBOA 4GOJA 4ZEMA 1UOEA 3NOVA 2GF9A 2VSXA 4HMOA 1T2AA 1ZXBA 3I5YA 2O59A 1BVHA 1Z07A 4D8XA 1JFFA 2W48A 3U4MA 4ATNA 2QP9X 3FDXA 4YUAA 4ZCPA 2B4YA 1G66A 1LK0A 4LC1A 4BKPA 1GNPA 1YVDA 3DFUA 3ZZ1A 1MC4A 4BO3A 3AV0B 5BNIA 3E3OA 3NH6A 4FGKA 2W6JD 2FQWA 2VDNB 4O5OA 3WIOA 2HLHA 2UDPA 3G0IA 1XAHA 3W9UA 3E53A 3CF4A 2A9RA 3TZLA 4DQXA 4P3PA 2OBNA 3VHLB 1W0CA 2BFFB 1KPIA 4RK1A 2LUOA 3L41A 1AY0A 4XI9A 3MMXA 5TMPA 1E5QA 1JGTA 3FTQA 2AOUA 2QY9A 2WF9A 3JATA 1H2BA 1A3CA 2QDXA 4L8WB 1W8DA 4BFXA 3C1AA 2HU8A 3B3GA 3CLKA 3G13A 1NKTA 3GNSA 3RIXA 2B8TA 2FRVA 4A5OA 4BP9A 3FJYA 2A7XA 3UK0A 5M2QA 1Z6ZA 5LIRA 4LHVA 4OOEA 1K5GA 2AFVA 4C4AA 3JAWB 3RYFA 2YFYA 3V7WA 4AYTA 1DINA 5JADA 1TJNA 4I55F 5LMUB 4NG4A 4E7OA 1MC8A 1P1IA 1SULA 3EG9A 2PKEA 3ODGA 3WGGA 1L4BA 3VJMA 3ZZMA 1FFYA 1Q3KA 3DVRX 2L69A 2PVPA 3E81A 4YRMA 2H16A 2FDCA 3G5MA 1Z25A 2J0UB 3B2EA 4ZQGA 4JEIA 2X9VA 1EINA 3B3AA 4LNAA 3L2OB 1U7OA 5COAA 4LOHA 5U1PA 4Y1FA 1W73A 1SD2A 4OHFA 2VHVA 4B3BA 1QVZA 2HA4A 3F6BX 4ZAGA 3BZBA 1FJXA 5JNUA 1Z8FA 2GBGA 2JD1A 1OZGA 3VHXB 1C1XB 1H1TA 1O89A 1OU4A 1RACA 1G8AA 2IHTA 3CINA 1H2AS 2OHOA 2JK0A 5LDHA 2HCBA 5CU7A 2FY8A 3K9WA 1QORA 4JYBA 4R01A 2QDKA 1MD9A 3FKQA 1T1IA 4INAA 1RXYA 2F8SA 1OH7A 2PV0A 4BQSA 1PNTA 1GSIA 5AHRA 2IF0A 4C4TA 4K9NA 3U81A 3UMBA 3U7FB 2O2XA 1NG9A 2R1ZA 3RYTC 4OJYA 2GCIA 1ZD2P 2Z08A 3TOVA 2YVLA 3PFWO 2GETA 2OSVA 1Z33A 2ORWA 1EK1A 3F98A 7YASA 3FCEA 3EEBA 1VDZA 2JVJA 3FCOA 2XVMA 3I5AA 4ISCA 4OJKA 2V5UA 4FMCB 4NBVA 4FR5A 4QRIA 4EBBA 2EGGA 1QPBA 1QVRA 4LS3A 3KSRA 2CVQA 1F6DA 1NQWA 5BMVB 3EJ6A 3H5OA 5AKIA 5HQ3A 2Z04A 1N57A 1P6QA 4ACBA 2R96A 4P34A 1KHHA 4B6OA 5JCOC 1DDGA 1H2FA 1I01A 4JENA 2QL9A 2QRQA 4L8FA 2NUTB 1VSVA 4IXNA 4DM3A 2Q2VA 4EM6A 4RY8A 3AG6A 3G0OA 1QB7A 3T0IA 2AMJA 3DLTA 4FCTA 2BFBB 1Y8RA 2NO7A 2B34A 4JJ7A 5CLQA 5HF5A 3OWHA 2CKMA 2ZIZA 3AEKA 3F7TA 3R3YA 2ZJ8A 4FIZA 3RVOA 5FPKA 5KS2A 1TAUA 2PKRA 4YUZA 2ZIAA 1FK8A 1W5FA 1MTOA 3W1WA 1Y7LA 1RRPA 2PWAA 4YJHA 3U17A 4OH7A 4GRDA 3ZUPA 4QT0A 5EERA 1QC5B 3OJLA 5GJVC 4NHOA 4XQEA 1JSXA 1PWZA 4M8LA 3GZJA 5TQJA 2GBPA 1NW4A 4OYYA 4AL4A 4UARA 5H81A 1LWOA 1AF7A 1DFHA 2F3UA 2ZI3A 3VSBA 4FGUA 3LY7A 2R751 3KYIB 1P45A 1UXHA 3C6ZA 1T2FA 1S8NA 3KR0A 4IF4A 4M53A 1VMKA 1M6VA 3SDSA 4EZEA 5FTLA 3N05A 2VAMA 2WD8A 4PICA 1GPUA 4IKEA 3JPYA 4HB3A 1UM9A 1VYTA 1CY8A 4E12A 3QE4A 4YMTA 5AICA 1RFLA 3BL8A 4JFRA 5EXPA 1AMNA 3H1TA 4Q00A 4YP6A 3S2SA 1ODKA 4D9MA 3DR3A 1VZ2A 2QN1A 2QBYB 2Q0HA 3IP8A 1FQKA 3LQ1A 3TIFA 1O5OA 1Z47A 4MLCA 2H2DA 1FP6A 1EWKA 2D06A 4ZOLB 3VDXA 2CB0A 3FRHA 1JPVA 4K05A 4O2RA 2A9QA 2QOEA 1S6YA 2YQ4A 4M8NE 3TEJA 1OIXA 4MULA 2MR5A 4YONB 3W3ZB 3D3JA 4FC7A 1N77A 1G0NA 1ORRA 3P2JA 3ZN2A 4X3OA 2AHRA 2AMYA 3M2PA 1OB2A 4RD2A 3KK0A 4RFSB 3TAXA 5KSOA 3FVVA 2VNSA 1SBNE 2QTHA 1THMA 2Q5EA 3HO8A 1QQTA 4UEKA 4CCYB 4IJKA 3WHPA 5TSDA 2NU8B 5I48A 1ATIA 2O8NA 4X91A 5DTIA 3ZTYA 4D3FA 5C18A 3VO1A 1RKQA 2QA5A 4G4JA 3UV6A 5I9LA 4XUEA 2R44A 3EOAI 1NN3A 5I4KA 5IASA 2CV0A 2OZKA 1PSZA 5HZGA 4HAWA 5JIBA 2WUWE 3VR0A 4DPMA 1HURA 2QZSA 1K1EA 1LLUA 4K3UA 5EZYA 4JI6B 2IZ6A 4DNPA 2BGMA 2XUQA 3AJ8A 4RQBA 2PA3A 5B6JA 1DXQA 1ZKMA 1S7GA 1V5GA 2QROA 2QN9A 3MWGA 3TQQA 4DV5B 3C3EA 2AXQA 1AURA 2XBLA 3RFCA 3ZW7A 3PHBE 1R4ZA 4F45A 3G2JA 2ZJAA 3P0EA 1LCIA 4H6VA 2SHKA 3DMDA 1E77A 2GD1O 4WEQA 4HQRA 1NY6A 5F2EA 3OVMA 1M8JA 4J0FA 4N8DA 1TW3A 4UEJA 5K3AA 4KSCA 3WA6A 4BC0A 3WHKA 3EXIA 5DVZA 1T0IA 4MRRA 4PC7A 2ECFA 4A8PA 4EJSC 3WNDA 2GHTA 4CFYA 1KS9A 2PMCA 4HRAA 2EIXA 5BWMA 2H7YA 1N5OX 1Q7BA 1KK0A 1ZU4A 3IILA 3U7HB 2QR5A 1P5FA 3VR6A 3BWVA 3AUJB 4P3XA 4EY4A 1H8HD 3QJGA 3QZUA 2KWIA 2WHXA 1BXRB 4YHHB 2Y1EA 3JVIA 4AZWA 4IHJB 4L50A 5FWYA 1EUZA 2ZWOA 1I51A 2N9UA 4D9JA 2CN1A 2R11A 4RMIA 1T5DX 1ZRMA 2Z9CA 3QSGA 4P98A 3N2NA 3SJUA 5AHXA 4AWAA 1XEFA 1EHIA 3B1KA 2F62A 1C14A 2WT9A 3HB7A 4Y9TA 1IHUA 1T25A 2ZJ2A 3WV5A 1V5IA 3EEQA 3FHJA 4AUMA 1SR8A 1TD9A 1YJBA 1YV9A 1BWRA 3ZZ0A 1AU9A 2C7QA 1YR3A 4MQFB 4DF3A 2RI6A 2PMFA 1EA5A 2PZFA 2Q1WA 1G8FA 2WWIA 3ESCA 3JV7A 1QHNA 1Q19A 1WKCA 2FN3A 4D9CA 1GPJA 1WQ3A 4R83A 4ETIA 1Z37A 3UCFA 1ODCA 4XWTA 2WJGA 2ZJ3A 3FAKA 1R6DA 3O2NA 2G70A 3VDMA 1BKDR 1PJ2A 3H16A 4BIMA 4P22A 3R1IA 5ADWA 4I4CA 5EINA 4YUWA 2B4QA 3C8UA 1ZGBA 2BEKA 3DXZA 3S2UA 4B3HA 3Q2IA 3IB3A 2OQVA 1SPXA 1ORWA 3AKEA 2JAHA 1ULBA 3QM1A 1AUOA 1R74A 1SVUA 2VIIA 1QU3A 3WBBA 3K0AA 2E55A 3QIVA 5CB8A 2CMDA 2ATCA 2EFJA 2VZ0A 3E8SA 3PNLA 4RVGA 4TL9A 1BGXT 4ZVSA 3GA7A 4XIGS 1IYZA 2HSDA 4JEUA 4QNMA 4AECA 2A0WA 13PKA 3OH8A 1EVZA 4EY7A 5DT2A 3TQRA 4O59O 3LQFA 4F0JA 5H9WA 4AS1A 1CY7A 1VXRA 1YC5A 3DE1X 3W6OA 5JTTA 1PR9A 1M1YB 4GBED 4QM7A 3ZKWA 3EQ9A 3G7UA 2CXHA 1XZQA 1ZD8A 4BZPA 5FL7A 4GPZA 4DR5B 4JLDA 2BEUB 1U7TA 4RACA 2CJYA 5AP9A 5EE3A 3LI2A 1YJ5A 3TBHA 4Q12A 4NXMB 1LFDB 1M1XB 4LFBB 2ZYVX 4YMSA 3TJMA 3AOEC 3O5AA 1T8TA 2OBLA 5FHQA 1ES9A 2VRNA 1Q6YA 1VL6A 4D4IA 2EKDA 4U9IS 4PINA 3EPJA 1NURA 3X1MA 4WCDA 4DFDA 1Z68A 3PPVA 4HFRA 4KIGA 4OAOA 5C8YB 2ZZMA 4OGFA 2YS6A 4QECA 2R7AA 3P2OA 3ZHYA 3B6MA 2ZEJA 2QRVB 3KTAA 4URUR 2QVGA 3IUBA 2VDQB 4LRQA 2CL7X 1R5OA 3VH3A 4BPBA 2HRBA 2ODTX 4KBGA 5DNDA 3RUPA 1N2HA 3QPWA 3VKGA 1R4MA 3HI4A 3VGPA 1Q84A 4OJQA 5FULA 3FCCA 3FDZA 3QEMB 4YTEA 3SKYA 4HQNA 3V4SA 4PPQA 1E4VA 5FQNA 4LYFA 3K20A 4DBZA 1I4WA 3KXLA 1ODLA 1V9CA 3BK1A 3RBAA 4EJSB 1V4BA 2GEBA 1X15A 5DI9A 5TQ2B 3TNFA 5KJCA 5L95A 1ECFA 1LBQA 1L7BA 3DNFA 3ORSA 3PFHA 2Y4OA 4Q1VA 2H1RA 3B6JA 3SBXA 4DV7B 2NU6A 3EQ6A 1QFJA 3SM9A 1QZUA 5H7XA 1W85B 1MFZA 2OFXA 1L1FA 2RE8A 4MMZB 1XTSA 1NOJA 1WXEA 1J90A 3LC2O 6Q21A 4BBAA 4BX0A 5AIAA 1AGNA 2PUDA 1MW8X 3LKZA 1AKEA 4LY0A 4MS3A 8LDHA 1RVV1 4OFBA 1CZUA 2UVPB 4GSLA 1XYYA 3A4VA 4HGQA 5E4YA 5A7FA 4B3RB 5DLYA 2G82A 3DLIA 3EUEA 3T5GA 3GQVA 1ZMRA 4V0LA 2D2XA 4Q15A 5TEWA 2Q5OA 4JC4A 4HYYA 2GPTA 2VLIA 3DVAA 4ENVA 1SD5A 1ATZA 4NV3A 3M89A 1R6XA 3PR1A 2DHQA 2XIJA 1GQQA 3BIWA 4EO4A 2DYKA 3W8FA 4DLLA 5FUYA 4YUVA 3D7LA 3MG9A 1W29A 1BMFA 5BV8A 5SZJA 3N75A 4U4AA 3ZXYA 4DJFC 1GT91 4ZZ0A 1YRYE 2GPYA 4MIEA 4N0DA 5LZ5A 3L0CA 1MRSA 1EHCA 3DBLB 1BVRA 2V9PA 3ZOZA 4YRNA 4AIIA 2R8BA 1N25A 2PBRA 4MEAA 3GEBA 3K8ZA 4FZ3A 1NJ6A 3C5CA 4PS1A 3C5HA 1YSCA 4F2DA 4OP2A 3H3JA 1EFCA 5EMMA 2HH9A 4I4TB 1U2TA 1CRZA 5TT1A 1DOHA 2F64A 2DPMA 3OQ6A 2FR8C 3NVDA 3FG9A 5IS2A 4FYHA 2MINA 2C9OA 3VPBA 1SFRA 3QPVA 3E35A 2OXIA 5CNMA 3DZJA 3EFOB 1IOVA 3GJ0A 4LXHA 2JFXA 3CJTA 3GVCA 2H2GA 1EDZA 3EF0A 3JD3A 3PNOA 1YD7A 3WISA 1J5EB 5E1BA 2JG3A 2FWAA 4Q39A 2FW9A 4D26A 1B73A 2HO4A 2Q29A 5EEHA 4CKBB 5BURA 3WKCA 5E9AA 3C8DA 1D03A 1MIOA 4LKOA 1N34B 4V1CI 1XT6A 3RRYA 1X86B 4Q1FA 1ULSA 4KAJA 2X23A 2QVYX 5AI8A 4HNQA 1OLSB 4WTOA 3ZNOA 1D2RA 4J8PA 3ZD7A 1FXUA 1VFNA 4WW0A 1PFKA 1OI4A 1PNQA 2BI8A 1DWUA 3M6FA 3KD3A 1M7GA 3QKRA 4OQDA 1XELA 4RZUA 4C0BA 2ZJ4A 5B7NA 5AW5A 4AWBA 3NBFA 1XC7A 4O5AA 4ETNA 2CLIB 2BEVA 4R4JA 1RJ9B 2ZWIA 2ZB4A 2X9QA 3GL9A 5EP1A 3ZY6A 3TNLA 4OU5A 2FV8A 5KJ6A 4BNMA 1OTHA 2WHYA 3PDIA 3PDUA 3D8RA 4GR4A 4JVSB 4TXNA 3COSA 5G4KA 2NYUA 4H31A 4HT3B 3OZVA 3HMKA 1V7QA 3PXXA 1J7KA 2QRLA 2ZTHA 2F55A 3I6BA 1DJNA 2NZ8A 1II8A 3ENKA 4I50A 1EDOA 3TZHA 2QZ9A 3DEFA 1XU9A 2GM9A 1XEWX 1BXGA 1E2MA 4JJ6A 1UKZA 1QCYA 3KG2A 3ZLVA 1QCDA 1YR1A 3RM3A 1Y4DE 1QHIA 1QWSA 4MROA 4LJSA 4ALIA 1TPZA 4ENPA 4GOXA 5F21A 1RS0A 1Z4QA 3X1DA 5I9IA 1USUA 4YROA 3T6KA 3LHIA 2Y0EA 1IN1A 4I9FA 2O7QA 3TGWA 2ACEA 2EX4A 2OKGA 2RKOA 2XE7A 4HDMB 1DXOA 4JC0A 2OYRA 1ZHFA 3NH9A 1DC6A 2WV7A 2JGLA 9GPBA 1BFUA 4ZJYA 4JI8B 1Z88A 5CURA 2Q5QA 1FDVA 2X5JO 2Y2UA 3CCFA 2RHLA 4X8MA 2I8CA 1U0NA 1BRMA 1MW9X 2CVHA 4FOTA 4DUGA 1BHQ1 3L93A 3OAAD 2QAIA 4M60A 1ISPA 1WCIA 3KL4A 5AWFC 2OBYA 3CJRA 4MEJA 1XG5A 3D4IA 4O2AB 4CI0B 4RF2A 3NBKA 4Q6BA 2FPPA 3CVWA 5B3AA 4IRUB 1SCIA 5JBQA 5K8CA 3IQIX 5FJIA 5CEJA 1Y9AA 2YRXA 4ZGBA 3GT3A 2DBVO 1W4ZA 1Z6YA 2I4TA 3A9CA 1K75A 1T6ZA 4NBKA 2A33A 2R2AA 3QWAA 4PSAA 2X40A 4QG7A 4UUAA 2CVFA 1ZH8A 2WABA 5I6DA 1MQSA 4NC9A 3RADC 1T4CA 4PC3A 1C1DA 1LZLA 1YBMA 1N8NA 4HWSA 3U3JA 2VWQA 2VCYA 3GT4A 4B7AA 1W4CA 2PKXA 4PLHA 1M83A 5IKXA 1WMBA 4INPA 5DH9A 4OQZA 1F51E 4N0MA 4NMWA 5GWXA 4C03A 1RPAA 5KTKA 3FGOA 2WTBA 3NV9A 4J6EA 4D56A 1AH2A 3JQFC 3AXTA 1OA0A 5DWDA 1YCHA 3IVMA 5SZKB 2QUBA 1BVYF 4H1HA 4YV1A 5JSZB 2XDQB 1ZUIA 1UC9A 4KODA 5AKGA 3TLGB 4N41A 1BH6A 3CSDA 1E3TA 4FW8A 4G3XA 1JE1A 3NTXA 4EH1A 4QXRA 3EBPA 5JXJA 1KHTA 5D1NA 2PQ0A 2A1UA 1E9EA 4UU1A 3PJDA 1AS2A 2Y71A 3UKDA 4A3SA 5JQWA 2WTNA 1G1AA 3LCUA 3BFKA 5DNYB 4JHLA 4P2BA 1GNSA 1Q83A 3QLTA 2H18A 4IFTA 5TGDA 1TECE 5MFPA 3MUOA 3PIRA 2NV6A 1KJ9A 3PRKE 5EWJA 3EMVA 5HKKA 2Q5CA 1SWWA 4BDTA 3K70C 3ICCA 4TMWA 1IN6A 4TTIA 1EJ6A 3G2MA 1GRRA 2CJPA 4Z7NB 5C34B 3O8LA 1W59A 1HETA 2MYNA 4JX9A 3Q4GA 4MVJD 5EUMA 1KQGA 2H52A 3OE5A 1RADA 2IEYA 3NV7A 5EQTA 2WZBA 2IYLD 1DBWA 3N8DA 3OSUA 1L9XA 2DFVA 4KO4S 3ROEA 3G68A 3ITEA 1UL1X 2QX4A 1TKRA 1IZYA 3WK6A 1QVAA 2G36A 3ZYZA 5KKCA 5ERGB 4DLSA 3D2BA 5BYBA 5BN3A 1DC5A 3GRCA 2YZGA 4L8LA 5THXA 4RDIA 5E6RB 2YJ3A 3ITDA 2FE4A 5BPHA 5JXHA 5EP4A 5LIPA 2GS9A 1ULTA 1SK9A 5TQ0B 1TJ5A 4EHIA 1SHLA 5C8DA 1TU4A 2QNBA 3ASYA 5IBQA 2QTMA 3VDRA 4NRDA 4Q7MB 5F5LA 1DQNA 4Q18A 4S24A 4RIEA 4WN9A 4BBZA 5IXYA 1DUIA 1P4HA 1QTNA 5B57C 4DB2A 2CXSA 2VXBA 1D2AA 4HLCA 5TE9A 2REQA 5FYQA 2J0VA 3VDQA 3ZG6A 3I4FA 1X7GA 2P1ZA 1TK2A 3F6SA 3JASA 4R8KA 1WXFA 3ENVA 3K32A 4XYBA 3RGGA 2J7PD 1NJFA 4ZT2A 1UAYA 1Z2AA 4QOEA 4B7UA 4Z54A