3W9YA

Crystal structure of the human dlg1 guanylate kinase domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
175
Chain Sequence
NYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
publication title Crystal structure of the guanylate kinase domain from discs large homolog 1 (DLG1/SAP97)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 52
structure length 175
sequence length 193
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3w9yA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w9yA01
4M1WA 1ANKA 1T6NA 3HU1A 1KKLA 2LKDA 1KK1A 3LQQA 1KJZA 2GVZC 4M21A 2REXB 2WZQA 3WNDA 2HLDD 4GBMA 3E1SA 4B74A 1CJVC 1TF2A 4CW7A 3GLFB 5AUOB 2XB2A 1N6LA 1S9DA 2W00A 4XD7A 4M22A 3CIOA 1X8KA 2ZE7A 1T91A 2GCOB 1EWQA 2OZEA 3CNNA 4GDFA 4MYHA 2DFTA 3NXSA 3KKOA 2CL0X 4OQXA 4MKHA 2ZJOA 4L15A 3RS7A 1AGPA 5TV2A 2QMUA 4MGYR 3AM1A 1NBMA 2BC9A 2OT3B 3QXHA 4O0MA 2JJ1D 5H70A 4B47A 3SNHA 1Z6YA 3IPXA 1HE1C 4UNQA 2WAXA 3BGWA 2GDJA 1A82A 3W9YA 5BW8A 1JALA 2NO6A 2J0UA 3EIQA 3ZH9B 5JS7A 3C15C 4KITB 1U2RA 5KDLA 2H16A 2RB4A 1OT3A 5EZ5A 4MRSA 2IS1A 3BB1A 2IUTA 4IEIA 4OHXA 2QBYA 2J0QA 1TUEA 1C1YA 1UFQA 3TSZA 5EE9A 2C98A 2JJ2D 4LJ7A 5FL7A 4O3MA 2HUPA 2QG6A 3QKSB 3QPWA 2NO1A 1DG1G 5KPDA 4DCVA 3T35A 4ZV4A 2BIFA 3GLGE 3I92A 5KTYA 1G7CA 1IN8A 4IRUB 4D25A 2L0XA 3AVWA 2VTKA 4LBWA 3ICEA 3PR1A 2B92A 1XD9A 4DXAA 3PENA 3VR4A 5B57C 2GBLC 3KB2A 2VPPA 4FI3C 4LYAA 1EK0A 5B2ZA 2AWOA 3I61A 3DVLA 1HV8A 4WZAE 1E2MA 2AK3A 1UJ2A 4XH9B 1OFHA 2YC4C 3GFPA 4M9XA 2JLSA 1S3GA 1G8HA 1HT2E 3CRW1 4H1UA 3ONWA 3I5XA 3FGNA 4KAXA 3AVYA 2ZSDA 3GD7A 3Q85A 3IEVA 1Z22A 1ZMXA 2QUZA 2WSSA 2ZANA 4PO1A 3SJAA 3TR0A 1DG3A 2IWRA 3K8YA 3T15A 4NBSA 4ACAA 2G3YA 2V1UA 1G3QA 2XSZA 4RVCA 1NY5A 2XITA 3CONA 1ONBA 3DMNA 4RFVA 1JJVA 5HCNA 4ZIRB 3VAAA 2Q9BA 2F3TA 1SXJE 3PVSA 1AKEA 4NYMQ 3NIBA 3TRFA 2FFQA 2GEUA 1UKZA 2BKUA 2YHSA 5L3QA 1XXHE 3GJ0A 1U99A 3DM9B 4GOJA 4V0LA 2YV5A 3K0AA 3TVDA 2Q21A 4N3NA 1AZSC 4Q7JB 4ESVA 2GVDC 1I2MA 3DZ8A 1RRPA 1SKQA 2FE4A 4MUBA 3ZVMA 4P4SA 4MGKR 3RC3A 1OH7A 1BIFA 4M9ZA 2I4IA 2VLIA 4F4CA 1G7RA 4DEYA 4C0JA 2P6RA 4NCIA 1N6KA 2F43A 4FCVA 3DOEA 3WYAA 1P5ZB 3N2IA 1SKYE 3EWAA 1YE8A 4OYHA 1J2JA 4TL7A 1HYQA 3SJCA 5JMTA 1ZNWA 2BCJQ 2J59A 3GEHA 2QA5A 4GRAA 4AY2A 5FOWA 5J4KA 4M1YA 4EIWA 4XVUA 2O8CA 5FOXA 4R71A 2R6CA 1COWA 4ESHA 2DWOA 4FWTA 3N2EA 2JASA 4HAUA 3U44B 3LWNA 2HF8A 1UKYA 1E2IA 4MKIA 5KSZA 3MJHA 5L3VA 2GILA 3SYNA 4I4LA 2NZ8A 3BH7A 1XJQA 4G5RA 2XXAA 4IJMA 3TSWA 1IY2A 3RABA 3VNVA 4Q4AA 4FCTA 4WZ6A 2QN6A 5DN6A 4WXRA 1P2VA 1YQTA 4DT1B 1G3RA 2OEPA 2RGEA 3DDCA 2BM0A 2ZRJA 4LZZA 4AYXA 4GL2A 3QG1A 3U7HB 2REBA 3VR1A 3QF4A 2J0VA 1S8FA 5A5GA 1R10A 5BN3A 1G3MA 4K81B 4Q1FA 2B6HA 3PUZA 3KKNA 1E0KA 3F3YA 2Z0MA 2EFCB 1P3JA 3U3MA 5BWMA 1LVGA 1M74A 5F9FA 3EW9A 4OI4A 2MMCA 1CKEA 4HAZA 2H57A 3SS8A 1G21E 1QHYA 4A15A 1ZCBA 1RJ9B 4EPXA 3G82C 1E1QD 3CPHA 3AVPA 1NMYA 1OFIA 3DKPA 2GEDA 1Z8FA 2GHIA 1OXVA 2QTFA 1VIAA 5E95A 4Q1DA 3UPUA 4LSGA 3M1IA 3THYB 1OH5A 4TYYA 2CLCX 2ZRHA 5JHHB 1N5IA 5HKKA 3QOFA 1G1MA 1S2MA 2YKGA 1XPOA 2JIZD 4PC1A 3BXZA 2FOLA 4V02A 3L0IB 1XJCA 2CE2X 1M8PA 5A4JA 2RMKA 2V8OA 4PAQA 2EU8A 1GG2A 4Q01A 2OLJA 3NDBB 2X19A 4V0KA 8OHMA 3KQLA 4W7SA 2JLXA 2YC2C 621PA 4IDHA 3O8DA 3M6AA 4H9GA 4DZZA 1R0XA 1ESMA 3AGQA 3BBPA 5JWHA 1JPNA 3QKSA 5EXPA 2GAOA 3PV0A 3BH0A 4TLDA 2CLSA 2XZOA 3QG5A 1EFCA 5CDFE 4LJYA 3C4JA 2H92A 1W4AA 1AS3A 1IN4A 4QHYA 4AWXA 3A6PC 2QMOA 2VHJA 4TQ9A 4NZYA 2PZEA 1XF9A 2RGNA 3HYTA 2QENA 4US0R 4TMZA 4JT2A 2DCUA 4TYQA 5FH9A 2JCSA 2IC5A 5G41A 1JNYA 1QHIA 2RGBA 3NH6A 4J0QA 4C0SA 2WAYA 2WBLC 2ATVA 2VP6A 4DLZA 3U61B 3TR5A 2J7PA 2XZLA 2XNDA 1NNEA 3NBFA 5AUQA 1KO5A 1J8YF 4KV9A 3CB4A 1N6RA 4OK6A 2PLRA 2CL7X 2OV2A 3NHAA 1KY2A 3TQCA 1KK3A 3IBYA 3PIRA 4C4PA 5FBRB 3ZIAA 1DAGA 1S96A 1QVRA 2H5EA 1AN0A 421PA 4NHOA 2ZAOA 4BFVA 1W36D 1L7VC 3K0FA 1SVOA 4NTZA 2QQEA 3RS4A 4G0NA 1OYYA 2QNRA 2WICA 2HV8A 5HKKD 4PSVA 4Q48A 4CF7A 2GRJA 4I1VA 3BS4A 3FWYA 1M7BA 1M34E 2CK3D 2R9VA 4EDHA 3HYRA 3X1DA 1RE0A 1CR1A 4B3BA 1WCV1 1XPUA 4JLBA 2WWHA 3L43A 2FGKA 2XJ9A 4WXPA 4JYBA 2ZEJA 1WMSA 4JLNA 3U7EB 2IF2A 4DCUA 1GAJA 121PA 5EXSA 4O2RA 2ZJZA 1KK2A 1XJ0A 1YU9A 1KMQA 2YWEA 4JVSB 2EFHB 1PLKA 1EESA 1O87A 1OLOA 3E2IA 3C7KA 5G40A 1CBUA 2IEYA 1H65A 4I1UA 1XEWX 3SZRA 4QJ3A 3NBXX 2A5FA 2IYLD 2ZE5A 3EPHA 2BM1A 3LO5A 3B1VA 5HZHA 1OE0A 4AYTA 3CF0A 4A8JA 4D4MA 4S35A 3TGPA 3WP0A 4Q9JA 3KFXA 1K5GA 1OHHA 4YDSA 4HATA 3U44A 4AKIA 1G17A 2FJUA 2Q3HA 2IK8A 5CYPA 1A2BA 1BS1A 3IIKA 4ZO4A 3U5ZB 2FEMA 1F60A 3WYGA 4W5JA 1OIWA 4LJ8A 2FU5C 4JVNA 2WV9A 1UDWA 5CYOA 1SGWA 3PITA 4EJSC 3GFTA 1EX7A 3LW7A 4I1OA 4B3GA 1W44A 1XDBA 2ORIA 3M4YA 1VCOA 2YWGA 3B8HA 2BBOA 4MDFA 4WZBE 2CCGA 1W46A 4M9QA 1Z0JA 4DSTA 2O0KA 2Q9CA 4ON9A 2WWYA 1UEIA 1G64A 5GJWC 1P62B 1Z08A 1DELA 4TZ6A 1ZW6A 2EQBA 2NPIA 2Q0HA 4KBGA 3RHFA 3IIJA 2WPDA 1GTVA 2QL6A 5DI9A 1TUIA 2G88A 4QFMA 5L3RA 2ZM5A 4R2IA 1BYUA 4CEIA 3L0SA 1KO1A 4KXFB 3GJ8A 1UF9A 3OEED 1RJ9A 2FGJA 2WOJA 4JYCA 2WJHA 2C9CA 1W2HA 1VYTA 5ANRB 2DR3A 2OUKA 3AUXA 3Q9LA 4NYIR 2NGRA 3Q7PA 2J9RA 3AEZA 2O5VA 2RGGA 2ZI9A 4LHXA 4RD6A 5H68A 4Z51A 2C96A 3THYA 4C0BA 2DYKA 5CJ2A 5DHFA 1HA3A 4IEEA 4LJ5A 5EUQB 4JBYA 3MSXA 3W6PA 4BZPA 4LYHA 3ZD7A 1MO3A 5DISB 3F5FA 4JLJA 2IHYA 1W5TA 1FPMA 4P32A 3R8FA 3LV8A 3W5IA 2V9PA 5BYJA 1LV7A 1P9WA 5LB4A 4TZ0A 2ORWA 5GVSA 1H8HA 3PEVA 4R7ZA 1E2DA 1I4DD 3OIYA 3HR8A 2G0TA 4QOSA 1P2TA 1DAKA 3IHLA 4TN1A 4TSFA 4BUJA 1GRRA 3IBGA 1MABB 4BRUA 3NG1A 3VTKA 3KFVA 1Z0AA 2XTZA 4JIMA 4BFTA 1G3IA 5DHAA 2F1JA 3UWOA 1PUIA 1H8EA 5L8VA 2J5XA 3KTAA 3VX3A 1E2FA 3S1AB 1U0LA 1UEJA 4PQYA 1CJKC 4RD3A 5EUMA 4WVFA 3PEWA 2KJQA 2OFXA 4XVQA 3TJZA 4B2PA 2OLKA 4HUQB 1KJWA 1Z5ZA 1T3LA 4M1MA 5F2EA 1CRQA 5FOVA 3B9QA 1CXZA 2A7QA 1T9HA 2GXQA 4JBWA 4YMUA 4NP6A 2FDCA 3NWJA 4OQLA 1N5JA 3HR7A 5M04A 1WF3A 4MH0R 4PHTA 2WPDD 4FMDF 1VMAA 1XPRA 2AXPA 4URVR 1W5SA 2A5DA 3GLHA 2ECKA 2FMXA 3HPQA 1DE0A 4W5WA 4XWAA 3RSOA 2VF8A 2ZI3A 4POAA 3B1YA 4DDUA 1G19A 4G5OA 4JJZA 2N1BA 2ZUDA 4A6XA 1KGDA 4TYNA 1D5CA 3K0CC 4Q1EA 1MO6A 1KDPA 2OSBA 3HPRA 3EX7C 4DLRA 2WOOA 1XBTA 3UKDA 4JL5A 3B1ZA 3JZAA 2OXCA 3CRVA 1XP8A 1YVDA 3THWB 1JJ7A 1CJMA 3Q5EA 2QTHA 1NN5A 4X8MA 1GKYA 2YYZA 4L4UA 1Z06A 4DLWA 4Q4JB 1U81A 1YZGA 1Z6XA 4PR0A 2XEXA 1JI0A 5JRZA 2CBZA 2ZVPX 4AC9A 2W2XA 2XAUA 5FFMA 2AKYA 2LCFA 1LB1B 2ZU6A 1Y63A 2ZS7A 3H4MA 4LJ4A 3RWMB 3RRNA 4LBVA 3KDSE 4NCHA 2CLDX 2PL3A 2VP2A 4LV6A 2Z43A 3WMGA 1TQ2A 1KI4A 1YZNA 3RSLA 1S4QA 3O47A 1Z6AA 3B5JA 4QJ4A 1XXHB 2CL6X 3IEUA 5AUNB 2XOKA 1UBGA 4KHZA 3B2EA 4FWIB 1R5BA 3O8CA 3SYLA 4I99A 5BYKA 4PC2A 1OB5A 4DDTA 4Z8XA 4NE2A 2IUUA 4Q02A 4U00A 1GNQA 2V7QD 3QNUA 2GJ8A 3G5UA 4P3YA 2N42A 4PC3A 4NCJA 1ZBDA 1ZM3A 4WAUA 2ZYVX 3A1WA 4OK3A 1KMHB 4LHVA 3KKMA 4MYUA 2LWIA 3IGFA 1MT0A 4PQFA 1NVVR 1GNPA 2RHDA 2PT7A 4OHZA 3OESA 4LCBA 4AD8A 1X6VA 1E9AA 3PCRB 5FPHA 5EJEA 1V43A 2G0NA 4Q9LA 3SJZA 3ZS8A 4ASUD 5EQTA 1J8MF 2EWWA 2HLDA 3K0AB 5F98A 2AWNA 4ZCLA 1ZM2A 4MRNA 4C2TA 2H18A 1AM4D 3CPJB 4TMWA 3WMEA 1IJFA 4NMMA 2V55B 2CHGA 1E2GA 3ZD6A 3AKCA 4LGMA 1E2NA 1U98A 4KLNA 3B9PA 3LLUA 4Y0AA 3SJBA 1FFHA 4B44A 3SQWA 2BBWA 5KYKA 1NP6A 4HDCA 3RS2A 4Q5IA 1XWIA 1KSFX 1ETUA 4FD2A 5KNCA 2OO7A 4N1AA 3ZJYA 2JGNA 3FYHA 2NQ2C 4HLDA 1ESNA 1KK0A 3CW2A 4IVRA 4JMPA 2JJ1A 5EZ6B 3MCAA 4BWYA 3QKRA 1XZQA 3I8XA 1GILA 4EAQA 4DCNA 2QQ0A 1VECA 3T1OA 1MRSA 1EG7A 1KIMA 4B34A 4U5XA 3NVAA 2GJKA 4Z1MD 1XCMA 4EFNA 1ZAKA 2QY9A 4A0FA 1NKTA 2QSYA 2JJ2A 4II7A 2JLZA 2ERXA 3K70C 3CWQA 3CX8A 1HURA 4PHFA 1Q0UA 3BRWD 3KB1A 3FTQA 2GCPA 3ZZ0A 2H7VA 5DI3B 4R98A 1Z63A 1R4AA 4OK5A 4C0QC 3BC1A 4F4IA 4YMVA 2BEKA 4MGIR 2YWFA 4URYR 1IN6A 5UKDA 5KSYA 4Q4AB 3WXMA 3OZXA 4GMDA 2QORA 4QGAA 2P3SA 3MUFA 4ZDIA 1CEEA 3SBEA 3L0OA 3T5GA 1P75A 2F1HA 4L9SA 5FBVB 1RPZA 3SEAA 1KZGB 1NY6A 1Q3HA 1F2UA 1HT1E 4IDQA 2QPTA 1W4CA 2ZS8A 4MKFA 5J4YA 3FKSD 4Q1AA 1OXSC 1DEKA 4NDZA 2RGXA 4HUQA 4DSOA 1X1RA 5JFGA 2R65A 1RRCA 2GF9A 5EXXA 1YR8A 1FOEB 4NH0A 4A92A 3MMPA 4HDOB 3VR2A 1SVLA 4C0KA 4QHSA 4QKQA 1W36B 2DB3A 1J90A 2ZRDA 2OBNA 1HUQA 1T8UA 1ZNZA 3BFXA 3L0PA 5CK5A 1Z28A 4IDPA 3GLGA 3IDQA 4QGFA 2ODBA 3A1SA 3VMFA 5C18A 1QHHB 3BAFA 1YKSA 1E2HA 2Z6VA 5KPJA 1NN3A 5E7JA 1ZU4A 3DHWC 4Q9IA 4B3XA 2ZJAA 2VHCA 2C9OA 2QSZA 1FTNA 4FIDA 1GUAA 1SVWA 5J4LA 3GJ3A 2IYZA 5GJVC 3THWA 5D3MB 1GM5A 1KDOA 3OEHD 5DIFA 3AVTA 5C4MA 4G01B 1GOTA 1SVIA 3B60A 2OE2A 2ZE6A 3CNLA 2ZE8A 1U9IA 4Q4JA 1CJUC 1OF1A 1CR4A 3C41J 3G0HA 4BLQA 3DOFA 3HWSA 5CB8A 1SULA 2WJVA 2DPXA 3DM5A 5TDHA 4Q47A 2QPAA 4HEJA 1YRAA 2HXYA 4PQRA 2CE7A 4CZ2A 3UMFA 1N0WA 1GNRA 2VIIA 2LKCA 1E9EA 1SXJA 1G41A 1G4AE 1N0UA 3SFZA 5B64A 1IXZA 1DO2A 1XXHA 5K8TA 2HYIC 2NZJA 2CNWD 3VKHA 2V1XA 4LHYA 3U3KA 5DO9A 1RFLA 3T1QA 3R9XA 4UQOA 2NTYC 4Q66C 4C0LA 4MRPA 2B8WA 1R0WA 2ONKA 3TUZC 3UXMA 1K8RA 1NBME 2ZAMA 1KNXA 3KJHA 4YQFA 1FP7A 2FPMA 1UADA 2D2EA 2ZJ8A 1KMHA 3W3AA 4TLEA 2CCJA 3R7WB 3AKYA 4BFYA 4V0NA 4X8LA 1FW6A 1YZLA 3CWZA 3QPVA 1XU4A 1A5TA 3AUYA 3A4NA 4TLBA 1GRNA 4MUAA 3LD9A 4DB4A 3K0FB 5IDVA 2V54A 3F8TA 4LJ9A 2QAGA 3PEYA 3W8RA 2R6GA 3EPLA 3P20A 4Q18A 3I4LA 3GJ4A 1Q22A 3JVVA 4IHQA 4PFSA 3SU8A 2J0SA 1G18A 3NC0C 2OILA 1Z3IX 1E1QA 1E2JA 1P6XA 2VH5R 3GMTA 4US1R 5KOYA 2XB4A 1G8GA 2VP0A 3VFDA 4B3DA 4HAYA 1JB1A 2BKEA 4OBEA 3Q72A 4JSTA 3FVQA 3P27A 3SOPA 1E69A 1XTSA 1P60A 1KI6B 4MYCA 2SHKA 4N0DA 2G1KA 1NG1A 2JIZA 3B1XA 2G83A 2ZR9A 3CPEA 3SDZA 2JJ8A 3SC3A 2WKQA 3TMKA 1IY1A 5BQ5A 2W58A 3OE7A 2FFAA 2ODNA 4XIGS 4LHWA 4DVGA 5JI3E 4MITA 1YZUA 3IILA 2O0HA 1NLZA 2GBLA 4RSGA 4A8JB 3QIAA 5KDOA 3QF7A 5E4FA 3AVQA 2B21A 4FMBB 4Q7LA 1CLUA 4EFLA 1SXJD 2VP5A 2UZ3A 4B76A 3PEUA 2GJSA 2GK7A 2OG2A 2ZROA 3IO3A 4NL4H 3R9IA 3ZVNA 5DI3A 1EGAA 1FTSA 4LYJA 4D4KA 3V4RA 5IK2D 1XB2A 1CTQA 1TTTA 3T1TA 4PX9A 5LD2B 1A1VA 4TMKA 1ZCAA 2A78A 3ZDQA 4BLRA 2BBTA 1QRAA 1E2LA 1LTQA 2CHQA 1Z29A 2IHBA 5JRJA 4PTLA 1E9SA 1GKIA 1NL3A 4G1UC 5AJXA 1JQJC 3PUYA 2R44A 3FOZA 3BORA 2R6DA 4TQUS 5AK0A 4TMXA 3AP3A 4QC2A 2A5YB 4TLCA 1IJEA 4JLVA 5JBQA 1E0JA 3ZZTA 4LBYA 2EVWX 1P7CA 3ADKA 1AJEA 4JLPA 5FOTA 1U0JA 3QE0A 4QNRA 2KBFA 1LS6A 1RRFA 1IN5A 1TMKA 3PUXA 1KSGA 2IYQA 4CEIB 2OXRA 1P9RA 1TQDA 3I73A 4JKIA 3WBKA 4BFSA 4MRVA 3GJ7A 1XEWY 5HCIA 2RGNC 4M1TA 4D80A 2FA9A 4V0OA 3P4XA 1AKYA 1XCGB 4P0TA 1N6IA 1XFAA 4HAVA 3U7FB 4AURA 2XTNA 2W6JD 3A1TA 1QHHA 4ZI3A 2CK3A 4IW3B 3I62A 3ND9A 1TF7A 3CRRA 1F48A 3ZS9A 1WB9A 5F3WB 2IYSA 3AV0B 1NKSA 4QXAA 4E03A 5JWRA 3A1UA 3W8NA 2OESA 2ZI5A 5CM9C 4PPNA 5BN5A 3U6KA 721PA 5FBWB 5F9HA 3RVBA 2GXAA 3QUSA 1T3SA 2D06A 3OE7D 1W7AA 5TY0A 4U7DA 1EFUA 3D8BA 4OL0A 5D3MA 4QNMA 3DO6A 4GP7A 1U90A 5L3SA 5IT5A 4NYIQ 2QEQA 1W0JD 4XJXA 3B85A 1S1CA 3LNCA 1JEEA 5FTKA 2MSEB 1VTKA 1K5DA 2V6JA 3ZVRA 4D4JA 3ICQB 1WBDA 1P72A 3GLIE 1Q20A 2ZRBA 3KTAB 2BMJA 2IYYA 1VKJA 3RS3A 2ZSEA 4OQNA 2PJZA 2WWIA 1AA9A 1RYHA 3NBYC 2VP9A 2Y8EA 4D81A 2QMEA 3AF0A 1AZTA 3GLFE 4KFRA 1OPXA 1ZM7A 3T34A 3TK1A 1NJGA 1T4GA 5LBIA 3AP1A 4TL9A 2W2TA 3LRPA 1R2QA 2JLQA 4QG7A 4UJ5A 4CDGA 1QDEA 5K8LA 4YC7A 3J81k 1IBRA 1LF0A 3CZQA 5JZVA 2JLUA 1RYFA 5E7IA 2C95A 4UNPA 3RDPA 2NIPA 2Z4RA 1WP9A 2QAJA 4KVAA 2FSHA 2IYTA 1VHLA 3VR5A 3C5CA 4B75A 3GLHB 1R6BX 3GP8A 3U3OA 3MGCA 2A3RA 2JEOA 1ZUIA 1XD2A 4DCSA 1XCPA 4A8JC 4P33A 5KNDA 4KFSA 3U6BA 3R7WA 1XMJA 2HT6A 1HY3A 2ZRAA 2PBRA 1E9CA 3NKVA 4ZDJA 4V0MA 4M1SA 4Q9HA 5EE3A 5JLJA 1OB2A 3L8ZA 2AFHE 3QSYA 2ZR7A 1KJYA 3A1VA 1PV4A 3M0EA 2FH5B 4DDVA 2H8KA 1SQ5A 4XSGA 2FZ4A 3ZGXA 4RY2A 1GFIA 4OI0A 4NPHA 1UAAA 3OEEA 5C1BA 1JBKA 2VL7A 3GEIA 4XWOA 3KQUA 1JR3E 5EE0A 2ZYTX 4YMSA 4KODA 3LW8A 2BJWA 3AVOA 4C30A 1DARA 2DFKB 2W0MA 4A0HA 2FSIA 3QEJA 1VG0B 1YR9A 1ZM4A 2WWXA 3TUJC 1E94E 1VG9B 1ZUNB 1GITA 2GK6A 1KI6A 3D7MA 4NONA 3JZMA 2PCLA 4NYJR 5FPKA 3HDTA 4PO8A 3ADBA 1PZNA 1J70A 1OXXK 4DUGD 1ZD9A 4W9MC 2VP4A 1N6HA 3C8UA 4KJZA 4CRWB 2REOA 1DTSA 1ZP6A 5LDDC 5DNYB 1OW3B 1KDTA 2GXUA 2FNAA 2VSXA 2AD1A 2HCJB 1FZQA 2IYWA 2ZITA 3EA0A 5KNBA 1N6OA 1CS4C 2J87A 3VHLB 5FUYA 3MWLA 1D9XA 1YR6A 3BWDD 3LX8A 2ANBA 4U02A 4FMDB 1KI7A 1WRBA 2P6UA 4YONB 1ZJ6A 1Q3TA 2AK2A 4LV5B 1VCMA 2GETA 2IS2A 3KQKA 1LS1A 2BDTA 2ZRIA 4JJKA 1XZPA 3V9PA 5FI1B 4EPRA 4EFMA 3RS5A 3B82A 3L2OB 2PH1A 4HLUC 1JR3D 4YXWA 2BVNA 4LPKA 5TMPA 2JAQA 1IONA 1HQCA 1S0UA 1X8JA 3QVUA 3U4QA 2C03A 2VQSA 1VCNA 4HB2A 3A8TA 4A6PA 2H1LA 1VCIA 1E6CA 2WKRA 4PZLA 3REGA 4BPBA 1NIJA 1J99A 4YLGA 4WA7A 3BB3A 1Q1BA 4UNNA 4BLTA 1D2NA 4CT4B 4EPVA 4CYMA 2ZJ5A 3EC1A 1NVVQ 3DMDA 2PX0A 5FOUA 2HF9A 1F2TB 5FBQB 1M1YE 1PVOA 2J7KA 3FFAA 3PXGA 4L16A 1ODFA 4Q7KA 1S1MA 5DYGA 1L4YA 2HDNB 3CF2A 1LFDB 4FCWA 3QKRB 4RZUA 3UWKA 5ELXA 1EFRD 5KSPA 2BMEA 5D3QA 2CHVA 4JS0A 4DLTA 2ZSFA 2OFWA 2OCBA 3EA5A 2ODWA 3WRXC 2FV8A 2NO9A 3MG9A 4KO8A 1U8YA 2ODEA 4FN5A 2PLFA 3CLVA 3FHCB 4UKDA 5SZKB 1YRBA 4DSNA 4AI6A 5JWOA 3DPUA 3EZFA 4LJAA 4B43A 2J1LA 1KHTA 4OJQA 2ONJA 1ZINA 4Z8YA 5CJPA 4Q19A 1GL6A 2QTVB 5HPYB 4D82A 2ZI6A 5FUVA 4TYPA 2D4HA 4L5BA 2BMFA 5JS8A 2GZAA 5CM8B 5AJVB 4IDNA 3QENA 1ZM9A 4HUTA 5JI2E 3O8RA 1Y3AA 1QG4A 4ZPXA 2NO0A 4UNSA 4K8OA 5JECA 3EZ9A 2CVHA 2XX3A 1WBBA 3EPKA 1XD8A 2ERYA 1DAIA 1F2UB 4CIDA 4G5GA 4E07A 4YXWD 3ND8A 3LQRA 4UNRA 1TX4B 2V7QA 1P2UA 1G9XA 2VSOA 3C16C 3T61A 2D74A 2J3EA 3KQNA 4PSAA 1FNNA 4LV8B 5EXTA 5KHOC 1RIFA 4MKGA 5C46F 3QJYA 4TT3D 3RRMA 2GXSA 3I8SA 3IKJA 4TMVA 3U2QA 4QBGB 5HZKA 1FL9A 3ASYA 3NC1C 2WWFA 3LAWA 3LA6A 3BD9A 1F5NA 4K46A 3TW8B 1NSTA 4DEXA 3KJEA 1J7KA 3LBIA 3LVQE 4LUCA 4NCKA 1D2EA 1W48A 3GLGB 1CP2A 4TLAA 1RC8A 4OQFA 4ASUA 2VHUA 2YNMA 4E09A 2WVJA 1DAEA 4L8GA 4BLPA 3X1ZA 3HU3A 2GTPA 1KO8A 1G5RA 2IUSA 5P21A 4Q7MB 3LBNA 4A0RA 1T8TA 4EQ6B 1JAHA 4KLZA 3KKQA 1ZIPA 3A58B 3NTUA 2QZ4A 3X2SA 1N25A 3AF1A 3W6NA 1OV4A 4KYIB 3CRMA 2IXGA 3I32A 3LDAA 1G3UA 3X1XA 2QGNA 4BQSA 1N6PA 1G6HA 1M7GA 3X1WA 4M1KA 5B30A 1DAHA 4NCNA 2IF0A 3VR3A 3DL0A 2ZJYA 1D9ZA 3RWOA 1KI2A 3GJ6A 4F38A 4FINA 1WDTA 1KI1A 3RLFA 2Z5FA 4UXHA 2EFEB 3KZ1E 3EG5A 3K09A 1EWRA 2K5UA 4M53A 2C9YA 2ZI7A 2QI9C 1OFTA 2IBMA 2PZGA 2UVQA 4Z1MA 5B58C 5KU1A 4GFDA 4C7OB 1BMFD 2OAQ1 1R8QA 1ZIOA 1SXJB 2ZREA 3T12A 3LXXA 1U0HC 1N5KA 3EZ7A 1NN0A 1IXRC 2GKSA 2P6NA 4RFSB 2BBSA 1UDXA 2QP9X 5FTLA 3EAQA 5EP4A 5JCZA 5LB2A 2H17A 1OKKD 1AIPA 1ZC3A 2GAAA 4NU0A 3EASA 3PJRA 5IRCD 3ADDA 1TU3A 4BE7B 2ORVA 2P65A 4HSEA 2A30A 3QKUA 3W5JA 2YINC 3FKSA 3GCGA 3IQXA 1SKYB 4JL8A 2QAGB 2WIAA 4GOXA 3UIEA 3TVTA 1C4OA 4CVNA 2QE7D 1FX0B 2RCNA 1P2SA 1RRGA 1XEFA 3CX6A 4HB0A 4B33A 4JBXA 2MSDB 2PMKA 3AQ4A 1Z2AA 3OAAD 2CMKA 1KAOA 2QT1A 1WE2A 2O52A 1SHZA 1II0A 1ZNXA 3H0KA 4FXPA 4JLDA 3CNOA 1II9A 2N46A 2DWPA 4AKGA 3EC2A 1AQYA 3LBHA 3KL4A 3HU2A 1Q12A 2GWHA 4UJ3A 4B32A 1F2TA 4IVQA 4C9BA 2XZPA 3V4FA 5FUWA 4QHTA 3TSOA 3K9LA 2IX3A 1G6OA 2ZRGA 4GMXA 4D6PA 1BH2A 3CRQA 4B73A 4PZYA 4URZR 4PPGA 1R7RA 4ZKEA 2RGAA 1V5WA 3E70C 4D0LB 2X1VA 2C77A 4DDWA 1HEIA 4URXR 1E0AA 3K53A 3OEHA 3P32A 4JLOA 2VBCA 2QP4A 1GKUB 5LPNA 5GADl 2D7DA 2VHTA 3CO5A 2IW3A 4A36A 3W6OA 2Q3MA 821PA 1DPFA 1NVWQ 3LH5A 3W34A 3E5HA 4TL6A 4EPWA 3VKGA 4HDQB 2W0SA 3DEFA 5FTNA 4LC0A 1E99A 4DHEA 3WHKA 2HJGA 3X1YA 4AYWA 3KKPA 4KBFA 2R2AA 3F0TA 4Q4LA 4RZXA 2YZ2A 1UKVY 1OSNA 2CJWA 2DBYA 4YMTA 3SN6A 1UBEA 3SYKA 2RHMA 3TNFA 3WYFA 1MR3F 4EPYA 1G8FA 1W0KA 3RRYA 1IOZA 4OHWA 1NI3A 1X8LA 2XTMA 3OHMA 4MDEA 4PO9A 2I1VB 4Q00A 2CNWA 5FL3A 2AD5A 3T1VA 1XNJA 1XTQA 3MWJA 5FR1A 4CEJB 4F4JA 1U9IC 4RD2A 2XNSA 1Z47A 2O0JA 3SFVA 1E79D 2A5JA 3GFOA 2CCKA 2WM9B 4LWZA 1KKMA 2D62A 2D2FA 1G7TA 1EXMA 2FX3A 4OJKA 4RJLA 3U3JA 3O8BA 1DVRA 3EWSA 1Z0IA 3LY5A 4D26A 1CR0A 2QT0A 1DAMA 3FE2A 5KUTA 5DYIA 3RNLA 2NOAA 3AGPA 2IS6A 1EFTA 4OI1A 3K9NA 1KO4A 3OFNA 3RANA 2IWHA 1N2CE 3FPAA 1E32A 4ACBA 3RYTC 2B7BA 1PLLA 4FMCF 2ZXUA 3GLIB 5C4GB 4RZ2A 3V00A 4DB2A 3EZ6A 2FWRA 4JSYA 2QROA 1A7JA 1KOFA 1GIAA 3BIFA 4JVMA 4HB3A 1YHNA 1ZC4A 4HZIA 4BGDA 4AG5A 4EQ6A 2EYQA 2OM2A 5HTKA 4MRRA 2IXEA 4BEBA 3AVVA 4ERNA 2ASEA 3SR0A 4BFUA 2X2EA 1NSFA 1B23P 4IOKA 2R8RA 2JLVA 1ZNYA 2QU8A 3K0EA 5L3SB 1QHSA 1I2DA 4Q9KA 4KFTA 1CULC 5C2JB 4IVPA 3AF4A 1ZUHA 3SE0A 2QAGC 4LY6A 4QM6A 3ETLA 3ZZUA 2OHFA 2YWHA 5JHGB 2ZPTX 1K6MA 3TW4A 2KI5A 1CIPA 2UKDA 3IPYA 5GVRA 3GQBA 4P4TA 3QXSA 5DSZA 1D2MA 4PANA 2UZIR 3AVXA 4C7OA 4DLXA 1W0KD 2JATA 1KI8A 4DRZA 4D0GA 3OIWA 2DWQA 3MWKA 3QXXA 1JR6A 2Q9AA 5J40A 2PMDA 1T5LA 2W6ID 3A36A 1BKDR 2PX3A 5IK2A 2WWGA 2FG5A 1OFUX 4B6FA 3C14C 4QL3A 3ECCA 2AKAB 3IHWA 4LJ6A 4RFSA 1R0YA 3EIEA 4WW0A 3OIUA 1E1RD 3C5HA 5FBLB 4EKDA 1E98A 3FMIA 5SZIA 3UK6A 4JT4A 2BJVA 1E2KA 1XD2B 2DY1A 4D2IA 1CRPA 4G5QA 3VU9A 1VDZA 4C0HA 1D6JA 3R8CA 1TEXA 1XEXB 3TAHA 2B8TA 4PZZA 3OFND 1RZ3A 1XTJA 1P9NA 2IYXA 3B1WA 3BERA 5CLLA 3EZ2A 2WMNB 4B3CA 5JEEA 2IL1A 2IT1A 2KWIA 2XGJA 5FPSA 1IXSB 1FX0A 2X2FA 1OYWA 2ZYWX 3KUDA 1EFHA 2WJJA 1G5TA 3WNCA 3MFYA 1AK2A 5FI0B 4DC9A 2QM7A 4OQMA 4M9SA 3AH8A 5FPTA 3FB4A 1YR7A 4V03A 5HE9A 5K8UA 4XSHA 1FMJA 2R6AA 5DLQC 5BXQC 4XD7D 1UM8A 3MWYW 1G4UR 1FP6A 4XWKA 2W6JA 2WJGA 2HYDA 4RKEA 2NPFA 4A9AA 1NVXQ 1SVMA 2I1QA 3KX2A 3K70D 1IM2A 3CH4B 2J41A 4GZLA 1DADA 3ZQ6A 2C5LA 3NEJA 2D7CA 2O8BB 1WQ1R 5H1YA 1M7HA 1KNQA 2F9MA 1NBMD 1TQ6A 1UPTA 1JXMA 1KI9A 3LVRE 4B48A 1GVNB 4A82A 4M0LA 3THOA 4WOPA 3AKDA 4CT5A 1KI3A 4BFXA 1YZQA 4QJ5A 1XTKA 4DSUA 4UXIA 1IQPA 3VR6A 1QVAA 2WJYA 5BN4A 1W36C 2JLWA 1W0JA 2BOVA 2GF0A 3SQXA 1OIVA 1TADA 2YJTD 4L9WA 4XTCS 2NMVA 1XMIA 5FL7D 4NYJQ 2GZHA 2ZSBA 4O25A 2V4ZA 3BFVA 1TEVA 1E2EA 1LNZA 1TL7C 3IUYA 3QQ5A 3R20A 5J4VA 2ZTSA 1QF9A 4AIIA 1N5LA 2WIBA 1YZKA 5G53C 4JLKA 4BASA 3U4QB 4G3XA 1FNMA 1G8PA 3SHWA 3WBJA 2A5GA 4CEJA 1PJRA 3ZYCA 2R62A 2V3CC 1GRQA 1TQ4A 2C99A 5FOSA 4TTQA 2QRZA 1VYVA 1W2GA 2ZUCA 2NO7A 2O8EB 1YZTA 4LK2A 3TQFA 2JA1A 1NF3A 3OIVA 1E9RA 2FFBA 4HAWA 2JLYA 1NG9A 1U94A 5IHPA 1G16A 2EYUA 2WSSD 3U3RA 4PPQA 2VEDA 2WKPA 3REFA 4JVLA 1RKBA 1KDRA 3THXA 2VO1A 2XSZD 2BCGY 3LXRA 5JCPA 4FW9A 4F92B 3U60B 3GLIA 5H8WA 5CDFA 4AKHA 4DBLC 1R5OA 2QGZA 3AB3A 4KFUA 3P1JA 4B2LA 1ZD1A 4JL6A 4PHHA 4C0AC 1EX6A 3Q3JB 3GLFA 4ZDWA 1IN7A 2RH5A 2QPOA 4F7WA 4B3FX 4D4LA 2FZLA 2CXXA 4F91B 4QBIA 4S2EA 4HZUB 2FN4A 1R5NA 2GCOA 3D6TB 4LC1A 1N0VC 2AX4A 5KSOA 1GSIA 1R0ZA 4IOMA 1JECA 2RGDA 3SBDA 4B6EA 4DUGA 1G7SA 5FR2A 1W49A 1TNDA 2VYFA 4YMWA 4LDJA 4X8HA 2BEJA 4CGZA 1M2OB 3K9HA 4RCYA 1NLFA 4AKEA 2P5SA 5GJCA 1Z83A 4ILEA 4G5SA 4EJSB 3DZDA 1DBSA 1US8B 3H86A 3EPJA 4Q1BA 3BFKA 4Q1CA 1MV5A 3U7GA 4H1VA 3UG7A 2C2HA 3KXKA 3L8YA 1NVUQ 3VNUA 2AXNA 4PXAA 4DWJA 2PEYA 4IKEA 4BLOA 1OXUA 1COWD 1BO6A 3CF6R 4WIAA 1VIYA 5G3ZA 2B7CA 3KQHA 3KUCA 1VG1A 1JR3A 1Q44A 3FMPB 4C2UA 2XJ4A 3VKWA 4TL8A 1KAGA 4RKFA 1P61B 2YVUA 5CIWA 3VQTA 2MSCB 1OH6A 3UATA 1MOZA 2F1RA 4IOLA 1X86B 2F9LA 2ZRPA 3PQCA 5DN6D 4AK9A 1KY3A 3QVVA 1GL9B 4LHZA 4DLUA 2EFGA 2MMGA 2QP3A 3QPUA 2P2LA 4LYFA 4NYMR 4PC6A 1JXOA 1XEXA 4KYUA 3B78A 1NLYA 4NKRA 3ADCA 2X8AA 1ZYUA 5DH9A 1VPLA 1NJFA 2TMKA 1Z6GA 4KSBA 2YOHA 3B13B 5LD2C 1FUUA 1KYIA 4PC7A 5FPYA 5TB5A 3BE4A 3VX4A 2V6IA 4I1SA 2ZS9A 3R9WA 1GP2A 2ZR0A 2ANCA 1EFRA 3TUIC 4ZIRA 2OAP1 5CK4A 3MD0A 4IXNA 2FSFA 1E9FA 4LOAA 1BOFA 1QHGA 3FDIA 4TWZA 1ZRHA 2O8DB 2QMHA 3BOSA 1UBCA 1ZVQA 2IYRA 4KU4A 3CR8A 2HEIA 4PSKA 3W3ZB 4OHYA 1E3MA 1QHNA 2O8BA 4UXJA 1O3YA 4Z54A 4ZCIA 3HP1A 4GZMA 2HCBA 2ZRFA 1TU4A 2VA8A 1I4LD 3QI2A 3EARA 1JPJA 2VF7A 1IY0A 1VG8A 2YOFA 4KSCA 5EP1A 3ZVLA 5KDDA 2Q3FA 2F6RA 1CF4A 3I5YA 1DOAA 3CR7A 3N70A 4GNKA 4DLSA 1NN1A 5FUXA 2IS4A 1L8QA 4URUR 1GWNA 2W2VA 4URWR 221PA 4C3ZA 2IXFA 4BFWA 4B71A 1P73A 5A0FA 4DCTA 1TPZA 2OFOA 2WMOB 1S3SA 1Z0KA 2PJRA 4V0ME 4HAXA 4DIEA 3TAUA 2O8FB 2ZU0C 5KO2A 1CR2A 3H2YA 3FFBA 1AS0A 3A4LA 5CLQA 3NEYA 3CZPA 1KTVA 2OCAA 2OCYC 1Q57A 3CKLA 5FTMA 4QGHA 2QM8A 1MKYA 1T5IA 1TF5A 4QGGA 4US2R 1XMSA 2A9KA 2I3BA 1F6BA 3B6EA 4TT3A 4ZDKA 3WY9A 1OH8A 1E9BA 2A2ZA 1HTWA 4M1OA 2AFIE 1KZ7B 4DLYA 3HJNA 6Q21A 4TTRA 3OF5A 2O8EA 5FTJA 5JSZB 4XOIA 4R9UC 2J7PD 2XNDD 2JDIA 3PUWA 4X8OA 3NBZC 1WXQA 3H1TA 5J5CA 5SZJA 2Z4SA 2IYUA 3I1FA 4W5HA 1TAGA 3MJRA 4DT1A 4P4UA 2ZRCA 4A1FA 4ZKDA 1GZSA 2YOGA 3ZIAD 5GJBA 1FUKA 3GEEA 5AJZA 1CU1A 5HE8A 4QRHA 1X3SA 1SVSA 1XMVA 2IYVA 1CJTC 1QHXA 2FEOA 3AKEA 2IA5A 2E1RA 2VRWA 2R6FA 3UG6A 2E9SA 1D8TA 1PLJA 1B0UA 1C9KA 1JQLB 1X1SA 2EFDB 2PZFA 5JJKA 1IAQA 1SHKA 2HJVA 3IQWA 1OJLA 1E2QA 3L82B 2P5TB 4N0EA 5AUPB 4ITRC 2J45A 4TTPA 4IXMA 3T5DA 4CEHB 4XVRA 3IO5A 4PPFA 2HXSA 2AR7A 3PUVA 1GL7A 4BZXA 4HZUA 4DJTA 1GDDA 4BZQA 1WA5A 1G5PA 2GJ9A 3D31A 1MO5A 3BH6A 4JLMA 2CJWB 3W90A 1XRJA 5HR5A 1BMFA 3MLEA 2AHOA 4BFZA 1Q1EA 4BECA 4LPSA 2GESA 1A4RA 2ZSAA 5IF9A 5JJIA 3TLXA 1LY1A 2P0EA 1Q1ZA 3P26A 3LX5A 4TQAA 4HLUA 1IHUA 4E22A 4EJSA 2PT5A 3EIHA 4HYYA 3N5CA 1US8A 4Q4HB 3TKLA 4RD4A 1II8B 1OIXA 4MYTA 1XTRA 3QBTA 4Q21A 2F1IA 3PFIA 1W4RA 2C8VA 2GJAA 1G8YA 1PUJA 3AVUA 4ARZB 2GNOA 4D0NA 1OHHD 4O2LA 4A0GA 3K09C 1OKKA 3WMFA 5AJYA 3B7GA 5TARA 2EW1A 4KI0A 4MGZR 1XTIA 4TYWA 2ZJ2A 4PHGA 4GI7A 4MA4A 1FQJA 4A4DA 1KSHA 5J4HA 2WWWA 3BJIC 3KJGA 1Z0DA 2GZDA 2RKOA 3RAPR 2FSGA 2G77B 3FKQA 5EE1A 2JDID 2HT1A 4BRWA 4GT1A 4TMTA 2QE7A 5EP3A 3WNBA 3IIMA 3KXLA 1FMLA 2BWJA 3K0SA 3SHFA 2F55A 3AP2A 2OBLA 3OAAA 1F3OA 2WTUA 2F3RA 3KXIA 4DKXA 1P4SA 2BMDA 4BEJA 1UKEA 1E4YA 3TH5A 2AN9A 3I3SR 4RD1A 1E2PA 1Q21A 3Q8XB 4B35A 4DLVA 1G20E 2G6BA 3FHOA 4A2QA 3K70B 2ATXA 2GA8A 1DS6A 2Z83A 4A2PA 2CDNA 4LX0A 1RVDA 1L2TA 4F93B 3UMRA 3NDPA 5K8IA 3EXAA 5AJWA 2BV3A 4QBHA 1ZD8A 1NRJB 2FPKA 2J0UB 1FQKA 4LI0A 4M4SA 2G1JA 4E5UA 2O8DA 2W83A 3I72A 2DHRA 2QBYB 4KVGA 1T0HB 1AS2A 1QG2A 1ZU5A 3RRZA 1BYIA 1QZXA 1L4UA 4ABYA 4R2HA 3GLHE 3UANA 3FHTA 5EP2A 4I81A 1HH4A 3KJIA 4RCZA 1H8HD 1AQUA 3UMSA 3CH5A 4HI0E 2FFHA 1NMXA 4TSFD 4JZKA 3D3QA 4QM7A 3CBQA 2FPLA 2PEZA 3CX7A 4FMCB 2ZYUX 2E87A 2GEVA 3NHBA 2ZRLA 4LRWA 3K1JA 1E96A 2RGCA 2ZUBA 4DIDA 2O8FA 2P67A 3ASZA 3H84A 3VU9B 1YJ5A 2QRNA 4Q03A 4PAOA 1H8ED 4GP6A 521PA 2VSFA 5DE3A 4RD0A 1E79A 3T06B 2ZRMA 4M8NE 2ZRKA 4IFEA 3TE6A 2VHQA 4OI2A 2ZRNA 2EWVA 2OCPA 4HLCA 2ZI4A 1JEDA 1T3HA 3CM0A 4ZI2A 3LFUA 5DGXA 1Q1QA 2ZVQX 4LBZA 4HB4A 2GCNA 2X77A 5JEDA 3K0CA 3QXJA 2KBEA 1N6NA 1RW4A 1VHTA 3NH9A 1VYUA 3WHLA 3QY0A 3P4YA 1QBKC 3AF3A 3VHXA 5AR1A 5AWFC 4OKSA 3GPLA 1KO7A 2J46A 1SVKA 2ZIAA 4IDOA 3JVUA 1LF5A 1U8ZA 4A2WA 3QKTA 2KSQA 5JSZA 3DKVA 4AG6A 2NG1A 2WSMA 2CVFA 2F7SA 4ZCMA 2C04A 4IOJA 3Q7QA 1UBFA 5L3QB 3QXCA 4EUNA 3GJ5A 2CEAA 3A4MA 2BHRA 4QBFA 1M6NA 2ZETA 4BLSA 1AGRA 1A2KC 1E9DA 1W47A 5E3HA 1NIPA 1ELOA 3ZLJA 3TIFA 1E4VA 1JAIA 3K9GA 1MH1A 4B2IA 3SI7A 3LLMA 4P4SB 5JJLA 2JLRA 3WP1B 5CITA 4MQBA 4XTRA 2G9NA 3Q5DA 4JLAA 4CEHA 3FMFA 4PAMA 1XX6A 5EE5B 1KSJA 1W1WA 1S9HA 2F43B 2DFLA 1U8AA 3BB4A 3A37A 1SZPA 4EPTA 1T0JB 4GOKA 4M2LA 4WBSA 3QBVA 3RC8A 2ZJBA 1G291 1N3BA 2C78A 5TXGA 3AF2A 2RAPA 4RZ3A 2O8CB 1HE8B 5CIQA 2D3WA 1Z6TA 4GSYA 1LW7A 5G3YA 1Z0FA 3ZQJA 4JKYA 2W6IA 1DAFA 5TVKA 1MRNA 2DFNA 3PG5A 2IEZA 4Q4HA 2XOKD 5SZHB 2KE5A 1II8A 1W4BA 2ZQ5A 2Q6TA 1Z2CA 1E0SA 1E1RA 3BK7A 3FMOB 1OXTA 1R8SA 3RS0A 2AL7A 5E7MA 4ARZA 2XXAB 1NMZA 4P31A 1MABA 4KCGA 5CB6A 4HLQB 1HQYE 2FF7A 1Z07A 3GJXC 4IFBA 1DO0A 4GPTA 4Y0VA 1SXJC 2KB0A 4OHVA 1MO4A 3TBKA 2WJIA 3THXB 3S1AA 3QF4B 2PCJA 3QEOA 2WHXA 5J47A 2OBMA 1I4TD 3MAAC 3CUEF 3MRSA 3WRYC 4YDHB
chains in the Genus database with same CATH superfamily
5G2OA 1ANKA 1T6NA 4GRDA 4HQ0A 1NW6A 1J5PA 1KJZA 4R0NA 2GVZC 2ERCA 1KC1A 4B74A 2HLDD 3GLFB 3T7EA 2FLVA 3REOA 3M4NA 2BSQA 2Z6QA 2FR1A 3V4LA 4JUIA 3RUEA 3OFJA 4YCAA 4E3WA 1L4EA 1S9DA 2QLLA 3B3GA 5JNWA 1T91A 2DTXA 1DBPA 3ICCA 4NY1A 3RUIA 2CEKA 2GCOB 4FHGA 4UTOA 1XNRB 3TEMA 2GKGA 4O4LF 1UBTS 4LMBA 4B31A 2JK0A 1ZN9A 4CM8A 3F4LA 1YRHA 3OZRA 2NUTA 2YY7A 3AM1A 2QMUA 4MGYR 1NBMA 4O0MA 5CVTA 1T34A 3PQFA 1KYWA 3SNHA 3TZLA 3IE1A 4P54A 2JGJA 4P81A 4Y1FA 1UZLA 3EFOB 4ZOAA 1JALA 2NO6A 5H3HA 4L08A 5DK4A 5JS7A 1FFCA 3BHIA 4G86A 2VAVA 1PKEA 2F64A 4WCVA 2RB4A 4BMZA 1OT3A 1U8FO 4BLWA 1TUEA 3W8EA 1C1YA 1ZCFA 3FFWA 5DNEA 3JD3A 3RVOA 2QTWB 5FRDA 4LJ7A 2JHAA 3ZEAA 5FL7A 4ZYYA 3MHTA 1HFWA 1JJIA 3ZU4A 3K20A 3O4IA 3QPWA 2NO1A 2JAXA 4TKLA 3MQ4A 2JFXA 2FKAA 4NV0A 3WG9A 3NUQA 3E3NA 4XX1A 3O8LA 3I92A 5B53A 4G67A 4AZ0A 1E1YA 2ECPA 2O3UA 3GEBA 3HB7A 2XAAA 1N9GA 2A6PA 3N07A 4JLUA 4RIGA 2Y93A 4YX9A 3AVWA 1LLCA 4QWMA 1E3QA 2GAJA 1KH3A 2HBQA 5E8JA 1XD9A 2PTHA 1WEKA 2IE0A 4DXAA 3NTQA 2B3TA 1T8RA 2GBLC 2I33A 2VPPA 3PYLA 5CVVA 5F76A 5HGXA 3AESB 4DMMA 3KWJA 2IPNA 4ZQFA 1TT5A 4EGCB 1GZ5A 1EK0A 1ZN2A 2FUG6 4GWGA 4I3HA 4LE0A 5DWVA 4TROA 3RNOA 1HV8A 3STYA 4B6OA 3ZC3A 1T2UA 5AT1A 1W88A 2NXNA 1E2MA 1UJ2A 1OFHA 5JS6A 3FSGD 3U5TA 4B3MB 3SXJA 1MF7A 2JLSA 3QJGA 1DRWA 1KZHA 1G8HA 4H1UA 3I5XA 3GFVA 3I34X 3UNXA 3FGNA 2HNBA 2I8AA 3R0QA 4KAXA 4WOJA 5DTQA 3JPWA 3HVRA 4PLHA 1MB0A 1C3JA 1ZMXA 2KQUA 4G56A 4PO1A 4ZT4A 2DU8A 4BAGA 2ZJ0A 2WW8A 3SJAA 1M1NA 1QFZA 3QPBA 5BP7A 2UVPA 2QRQA 4M9RA 3KDAA 5EOVA 4KWHA 3P0IA 2R4TA 5CFLA 4ACAA 1PQUA 1ULHA 2G1UA 2R5WA 2XSZA 4FE3A 3VR2D 5HW0A 1S6YA 3T3OA 3DLBA 1M1ZA 4JJIA 2Q9BA 5IABA 1PFWA 4NYMQ 4XJSA 5DMXA 4HT3B 1JDNA 4JCOA 1UKZA 1CUEA 2V03A 3KELA 1XXHE 4LZWA 3IAUA 1EFDN 1L3CA 1VE1A 3K2IA 4PV7A 1EWYA 1P1BA 2YV5A 3WL5A 4BCBA 1GAQA 2Q21A 4G1EB 2HNKA 1JFFA 4Y0NA 4ZOQI 5K0FA 1CERA 4DA8A 4ESVA 1J1UA 2GVDC 4U7JA 3ESQA 3K15A 1I2MA 1MB3A 3HCEA 1SKQA 5DNAA 4UTNA 4GPAA 2XMPA 2POCA 3VZDA 1NC3A 4MUBA 1Z62A 4MGKR 1U3UA 4OIFA 3EZLA 4EGQA 1KL7A 2VZLA 4PIVA 1BIFA 5D6OA 3UAOA 2AFIB 4HH4A 1H2WA 3OX2A 5EJ6A 2I2BA 1PZEA 2H1SA 1CY0A 2BGTA 3O31A 1JAZA 1C1XA 2G9ZA 1J56A 2R79A 4YJGB 3WHPA 4EB8A 4R1QA 2B99A 1SZCA 1KMMA 3FSJX 2C5SA 3FDFA 3MW8A 2F43A 4FCVA 1KU0A 1R18A 1Z75A 3DOEA 3E81A 3JW8A 3SF8B 3WYAA 1M2EA 4MS1A 1DJLA 1G0OA 4AZSA 5K2OA 1YE8A 4TL7A 1HYQA 1P0PA 4E6PA 5CG1A 3RODA 3K2EA 2C9BA 4AY2A 2QA5A 1KU6A 2G6TA 4Y7DA 5AJHA 2B98A 4WASA 3VI4B 5J4KA 1G2PA 2XYPA 1G59A 4ZZ1A 4EIWA 2DR0A 4TKZA 4INAA 3M83A 4PGAA 7AT1A 3EHDA 3LCUA 3P19A 3MGAA 2IU0A 4FWTA 3GLRA 4UFPA 2C5FA 2OR3A 4HH0A 4ZZ0A 3U44B 1X77A 5IN5A 5M3BA 1C7QA 1VXOA 2MSKA 4YDRA 5BNTA 1E2IA 4NIMA 2TS1A 1QYCA 2JBWA 5KSZA 3MJHA 3AW9A 3OH8A 2XCSB 1V1RB 3SYNA 2MR6A 1YB5A 2IOYA 4I4LA 5ALOA 3QLVA 3Q6IA 2NSDA 3HA5A 3MMZA 2P0AA 4HCJA 1WEHA 5E4YA 1IY2A 4WJLA 1Q74A 2FSPA 1TCBA 3VR4H 1DKNA 3VNVA 1XAGA 1JA1A 4M9CA 4D02A 2VJMA 3EK2A 5DN6A 2ZYAA 2L82A 4DT1B 5LP6B 4ZVRA 3DJFA 4EHAA 3SVLA 4GL2A 1A5AB 4FFLA 4UEJA 1EFPB 4OLJA 1S8FA 3RSCA 2ZUVA 2ZP1A 5A5GA 2BL4A 4OKIA 5A2GA 3EOBI 2Y0BA 3KAQA 2B6HA 1KRXA 3KB8A 3OO1A 1E0KA 4QNNA 2H2GA 4X95A 3RTEA 3UHJA 2YXBA 3TXAA 3DD5A 5D1NA 4HNRA 1ZOPA 2WILA 3DFFA 2Q46A 3EW9A 4D1YA 2MMCA 3LE8A 2JKYA 4HAZA 4C7MA 2XYGA 1QHYA 5JTTA 1RJ9B 1L4LA 1CDEA 1YO6A 3HXPA 3ZU5A 1I1OA 3O74A 2ST1A 1NMYA 3BXHA 2ZWMA 2GHIA 1OXVA 4QU8A 4TTAA 2OC4A 2IDMA 5IPFA 4MVJP 4LSGA 1CUDA 1Z4OA 4LOIA 3THYB 1O6FA 4KZPA 2GD1O 2VK1A 4TYYA 2O59A 1B73A 5HKKA 4YJ3B 1XP5A 4B6PA 5LJLA 5L6LB 1QIEA 2YKGA 3KLBA 4HNHA 4CCSA 4R51A 3FMGA 1JDJA 4R5MA 2YWRA 4R0VA 4XFKA 1WUJS 5BUQA 2JIZD 4PC1A 3UJ7A 2LE0A 2WJ3A 2ZJFA 3C3KA 3HC7A 4FBGA 1PQPA 4IGIA 2H11A 4X6LA 1Y7IA 1ZEMA 3VH4A 4H6PA 1TMYA 1QQBA 3N87A 3I39X 2F4VB 1XCBA 4MEAA 1OWNA 2A67A 4N18A 5JU6A 3QVJA 5A4AA 1VMDA 4RVFA 5K3CA 2PGIA 3W5DA 2Y0EA 5I9SA 4X6YA 1ESMA 2Q50A 4MJ3A 3AGQA 1LPOA 4GPBA 4U2FA 3T7AA 5JBIA 4JYPA 3QKSA 4GMKA 4LX8A 3UB4A 5F35A 2PKCA 3DDSA 3U49A 1NTRA 1SU4A 3DOHA 3KLMX 2CLSA 4PBTA 4RXUA 3B8EA 1T26A 2MU1A 3E53A 5CH3A 3VNQA 3R5SA 4XYGA 3RYFA 3IKMB 3JALB 5JMPA 1KIFA 5T4FA 4ND2A 1EJ6A 5JD5A 4HV4A 3QITA 2FEKA 4E4TA 3AWDA 4NZYA 4OHUA 2RGNA 2J9FA 4HEA1 3LP5A 5A7HA 4CT0A 1UBLS 1KEEB 2JGKA 2P2YA 1BW9B 5CT8A 3KVRA 4TYQA 3VJKA 1JNYA 1UPAA 3EDCA 2RGBA 4TWAA 1JMKC 1WW2A 3NH6A 4J0QA 4C0SA 3OCZA 4DLZA 3TR5A 5BR1A 2J7PA 4KB5A 1Q2UA 2XNDA 3NBFA 4LS3A 3EVTA 2PR7A 3JR7A 1FRFS 1E5XA 3CB4A 4KV9A 2PLRA 3AETB 4NESA 4OK6A 4DIFA 3TYXA 9LDTA 3NKFA 1P4RA 2FSVC 1KK3A 3PIRA 4FK8A 1NHWA 1TM5E 4RHXA 3RKSA 5FBRB 4C4PA 1BDBA 5HF8A 1AHIA 3RAFC 4L3VA 5JROA 3MS7A 2H5EA 4WKOA 3C4QA 4Q1VA 1Q7BA 1V5GA 5FAXA 2AMYA 2ZT6A 3Q15C 1A4IA 1R4MA 4NJMB 2VDJA 4BFVA 2EGGA 3ESYA 4NTZA 4IGEA 3F7MA 1OYYA 4MAAA 2HQ1A 4RV9A 2WICA 1KWKA 2XTAA 3MBIA 2HO4A 1SK8A 3OJEA 3KVVA 4GYWA 4Q48A 1DJPA 2Z1MA 2ZQYA 5EVCA 2VDLB 5KSOA 3BS4A 3BWXA 3D4IA 1NP3A 3FWYA 3NIFB 4M76B 4EDHA 3AR2A 1BU8A 3NHPA 4N9WA 1R1DA 3P2MA 3HSYA 4N9QA 1TLLA 4DBLE 4IHJA 4BO7A 1E5QA 4JLBA 4E32A 1PFKA 3W8DA 3WYCA 1LZLA 3L43A 5EINA 1C4XA 1ABEA 3AYXB 1E3SA 4JYBA 1MB9A 3HS3A 3AG6A 1J8QA 4QUJA 3GF4A 1HX7A 1P0QA 1GPUA 5EXSA 4O2RA 2H9YA 1KK2A 1SFRA 1YU9A 1KMQA 1G60A 2YWEA 3N2NA 4KX3A 3DMRA 4BTVA 4ZK2A 1BA3A 2HD4A 2VXOA 1F20A 2H2AA 1EUCB 1XIVA 3IUPA 1AQJA 1FFXA 1NJ6A 4OB7A 3WNQA 4WNCA 4S1NA 1RAAA 1YJBA 3CHYA 4K26A 2IEYA 2ZQZA 1V3QE 4QTTB 1H65A 2NZVG 1QZ3A 3QE2A 2Q1TA 1XEWX 4B7AA 4DCOA 3Q7IA 3MFQA 3ZLTA 1Z4QA 3AY7A 2IYLD 3DE7X 2RJNA 3M6LA 3NGXA 2BDEA 4QDJA 3LO5A 3B1VA 1K3TA 2WFAA 1FDUA 5TS2A 4AYTA 5IAAA 3DLAA 2A9QA 3TOXA 4D4MA 4UFOA 4EEKA 3D7NA 1K5GA 1OHHA 2C2OA 3VH3A 3C3EA 4I4TB 1T9GS 4XJVA 4FMPA 3K4QA 3LPAA 4QJIA 4X6XA 5IC4A 3DBHB 4DY6A 1A2BA 5IAGA 3S8MA 1BS1A 3L7KA 4YUZA 3RCBA 3U5ZB 4HDAA 3IVMA 4W5JA 1DFGA 1JYEA 1B8VA 2IHVA 2FU5C 1NBEA 3VSDA 3FA2A 4JVNA 4WH0A 1RQNA 1JU9A 3VYTB 2E6UX 5AVRA 3LW7A 1EX7A 3JR3A 3PE4A 3TZQA 5KYXB 1XDBA 2EZ4A 3OCXA 4MUNA 5D3ZA 4PRKA 4MDFA 4WZBE 3IXLA 4EK9A 3CB2A 1W46A 5A02A 5EIXA 1QLJA 1Z0JA 5E9WA 4DSTA 3KSDO 4KI7A 4ON9A 4KE8A 2PMEA 1NTOA 2O2CA 1G64A 1UWCA 4ZT6A 1P62B 3SHQA 2R6JA 3O9MA 3FPBA 4Q3KA 3RUHA 1Z5UA 3S2IA 2Q0HA 3VH1A 1J0BA 4KQEA 4KBGA 1FYFA 5HZMA 2WPDA 3G7NA 1U1IA 2QL6A 4QFMA 5L3RA 1Q7CA 4Y1RB 2IXTA 3C74A 3QRWA 4NSNA 3CY6A 1BYUA 3H8JA 4CEIA 3L0SA 4KXFB 2NU9B 4DQVA 4TZKA 3OEED 4HDSA 3IOYA 2OYSA 4QASA 1INLA 1W2HA 4A1OA 2BJHA 2IIBA 3D0OA 2DR3A 1EZ4A 1OBCA 1SIUA 4QICA 2C4UA 4PX3A 5H0IA 3Q7PA 2DHQA 4Q16A 2ZI9A 4LHXA 4RD6A 2C7GA 3OF2A 4UHEA 4HXYA 5P8WA 1JI3A 4KV7A 1GLNA 3B3QA 2QRJA 1X87A 5IVKA 3KC2A 1JU3A 4Z86A 4MO9A 3SYTA 2Q2NA 4EHIA 4F1JA 4K1LA 3X1JA 1PI3A 2PMCA 1K0UA 3E7DA 3JRWA 3PPXA 3Q0IA 4LGVA 3AUTA 4OSOA 3SR4A 1ISIA 2IHYA 4JLJA 1PDVA 3ABZA 4P32A 2GBGA 2OLEA 2X4LA 2RG7A 5EJFA 1U2DC 2QNIA 4I8DA 5LQSA 5I9TA 5JO0A 3W5IA 2V9PA 2W2KB 3IAXA 2VPYA 5KNBD 2ORWA 4R7ZA 4FR2A 1I4DD 1OX4B 1CYEA 4TSFA 2VTDA 2PYIA 4TN1A 3JQRA 2BFCA 4CG3A 4UQPA 3HO1A 1MABB 3DE0X 3M33A 4ZAGA 5JDCC 3S27A 3V5NA 3WZLA 5IASA 2XTZA 3ABOB 3FI0A 2PLAA 1WWKA 1MC4A 3D5EA 1CZOA 4QFCA 4WKCA 2F1JA 1U3VA 2Z56A 4LMRA 2WEKA 3V2GA 1PP4A 2XBMA 3NTVA 5L8VA 2ON6A 3W5UA 5EEHA 2O2EA 3KTAA 5A4IS 4DCJA 4EO4A 3ZUGA 1QGZA 3F6EX 5DSXA 3HCNA 5ALZA 4LDPA 1Q15A 3JQBA 4WVFA 1H2XA 2FI1A 1DGQA 5AVTA 1MBZA 2OFXA 3BGOS 4YRTA 1VHJA 1A5ZA 4KAJA 2FG6C 4XDHA 2CXNA 1UQUA 3TZCA 1T3LA 2J30A 4BBPA 1CRQA 1CXZA 1U6KA 3DTVD 2A7QA 4I5EA 2DJ5A 4ARIA 2XE6A 4JIGA 4NP6A 5TT0A 4PG8A 4OQLA 1ZKDA 3JAKB 3D3NA 1JU4A 1N5JA 4O8CA 3WRXA 4CI0B 2JGIA 1SKUA 2XKAA 1RYNA 2IUFA 4FMDF 1XPRA 3AEKB 1DMSA 2V58A 1J2TA 3GLHA 5FULA 4JXXA 2H8GA 2WNSA 2AR9A 4TWJA 3RSOA 3MT8A 2W4QA 1G19A 2HQBA 1JPVA 4AULA 4BQOA 4GI3A 1JSRA 2N1BA 4Z1OA 3T9DA 5IJ9B 1GY8A 2BGGA 4DC1A 1XNHA 1YAHA 3QEBZ 1H2FA 4H6XA 2AN3A 1QTRA 4PONA 1D5CA 1HGXA 4Q1EA 2NXCA 1MO6A 1RPTA 2OSBA 1DTWB 1BMDA 4MWOA 4DMKA 2JI8A 4GEGA 3EX7C 1NI4B 2WOOA 2QD1A 3JZAA 1E89A 4W6ZA 2AB0A 1XP8A 4PWYA 4CLXA 4L78A 3ESCA 3PQ7A 1CJMA 3M4XA 4M0MA 4Y2JA 5IDYA 2K6GA 3FWKA 1PWZA 3H5LA 4RA9A 4WCFA 4DLWA 2JCXA 1U81A 1YZGA 4O0LA 4AWBA 4KN5A 4B45A 2WWVD 1XYVA 3DFMA 4RM2A 4U2EA 4F4UA 4B4VA 4COOA 1NVDA 1C3LA 1S3IA 1DKMA 4Y2UA 1U3DA 5ESWA 1H69A 2JEZA 1U0GA 1ZH4A 1ZQ9A 4R9NA 4EATA 1HFKA 1TA0A 2V3VA 4Z2YA 4LBVA 1DU4A 3DFZA 1PNRA 2PL3A 3B1KA 4KAFA 5TQ0A 4IIUA 1IZZA 1VZ3A 3JQ8A 4L0DA 5ED4A 3HKCB 1EAMA 1T5BA 3KALA 1S4QA 3RSLA 1Z6AA 2A4KA 1GNLA 5AUNB 5EJ9A 1GR0A 1UBGA 3X3HA 2RI6A 4C5BA 4FWIB 4KGVA 1GA4A 1I3NA 3OQIA 4I99A 5BYKA 2JK1A 5ALJA 3TAXA 1CUZA 4NE2A 5EWLA 2IUUA 4WUVA 5EJ5A 5TRTA 2V7QD 2R1VA 1TVCA 4G4SO 2JLBA 3G5UA 4P3YA 2OWDA 1GGFA 4LXGA 4O4LB 4XZ3A 2PTGA 3RF7A 3V8MA 5T5QA 5IULC 3EGWA 1K88A 1KMHB 2E4WA 3FCOA 2AIRA 4LHVA 1RVV1 3DR3A 4F45A 2QDKA 3IBTA 5GV7A 3WO1A 5J9FA 1EIZA 1NVVR 1XZEA 2FK7A 4DB2A 4J03A 4OHZA 1U0OC 3OESA 4KP7A 4AD8A 4NMWA 4J2HA 1N0IA 1D2CA 1FA9A 2OP1A 4KTVE 3GEGA 3P96A 3EJWA 3I9NA 5EJEA 2G0NA 1U3GA 1GT6A 2ODPA 1G1AA 1JIIA 4MWGA 4Q9LA 4YBZA 5EIWA 3PNBA 1DBIA 4YWHA 3SJZA 5IKEA 4W1SA 1A9RA 4S0XA 2FP3A 2JBAA 3C2QA 5EGNA 4ZCLA 1WSDA 4N48A 1K92A 1NDHA 1IJFA 4KZKA 2V55B 2FPUA 4NMMA 5A3SA 4E7PA 1E2GA 5U9CA 4LGMA 1UXHA 1JN0A 3AJ8A 3B9PA 3UJNA 1Y1PA 4KMRA 5D84A 1IUPA 1FFHA 4YFVA 5FXMA 2LR0A 5KYKA 2DETA 4C4RA 4W5RA 1VSBA 1QV7A 1UZNA 3R3YA 4CKZA 1TKCA 3RVJA 5EWMB 1PT9A 4FD2A 2X0FA 5KNCA 5JANA 5I8WA 4JMPA 2GWRA 4BMOB 3VR3D 2M6KA 3Q7EA 4C4AA 5JY1A 4IGFA 4RKRA 5A0TA 4IJQA 4KGZA 4EAQA 4C4OA 2ZIWB 4ALIA 2QQ0A 3T1OA 4A6EA 5LIPA 1MRSA 3TFQA 3SC4A 1EZZA 2XZTA 4ZZ3A 4ZOCA 4CU2A 2KYRA 3BICA 3CNBA 3PNKA 2EARA 2QSYA 3QE9Y 2OCKA 2D5CA 2ETXA 3K05A 4OP3A 2GX6A 3CX8A 4NR0A 2CKDA 3BRWD 1L3IA 3DFIA 2DQZA 1X7WB 3JQQA 3ZGLA 3MHPA 2WAAA 2BEUA 2TRSB 1R4AA 4JB3A 3AV3A 4LDNA 1BS9A 3ZOKA 3BC1A 3M8KA 1G42A 3KIPA 1SB8A 4RJLA 3B1JA 3SIRA 4V2UA 5BSKA 1Y1RA 5UKDA 3WXMA 3OZXA 4GMDA 2CJYA 2CNOA 4UU1A 4C22A 4F3RA 4LVNA 2O8NA 3OTGA 3UH1A 3ZDXB 2Z5GA 3DQZA 1RPNA 1TD1A 1O08A 4YXFA 3T5GA 3EZGA 1P75A 2F1HA 3UB2A 1RPZA 5ALIA 3SEAA 1V9LA 3EEIA 4IV0A 5F9MA 3D8TA 1F2UA 2P9FA 4B9EA 5FWNA 3G7UA 1PHRA 3WSTA 1IWPB 3T5AA 3FKSD 1OXSC 2KHZA 5AVZA 2RGXA 4MLCA 3WLSA 3QLEA 4HUQA 4ZI7A 2XNHA 2VFAA 3L84A 3EQ6A 1BHO1 5KYTA 4QU5A 4M8IA 5DEOA 5LP1A 1T36B 1YR8A 3NP7A 1H2ZA 1SU6A 3ICWA 2RHWA 2JFBA 2Q4DA 3L7YA 3ED1A 2VCYA 2KX7A 4ZRNA 4EFDA 5CA1F 3R6GA 3TQSA 1G5QA 4L8VA 3MMPA 4TS3A 4QEKA 2H07A 3PEEA 1T2VA 2H85A 1O5TA 3INYA 4FFNA 1LVUA 4PNZA 1TW2A 2EL7A 5C3UA 1W36B 4O3FA 4CV1A 3BFXA 3L0PA 5CK5A 1Z28A 3WB1A 1GPAA 5CCDA 5FOQA 4B09A 2HSGA 2DT5A 3VMFA 1E4EA 4G0VA 4YP6A 1J21A 3UJCA 1KJQA 1UPUA 4MPTA 2Z6VA 3LT0A 4AO7A 5KPJA 5DTEA 3UJ9A 2VDKB 2Y6UA 2Z9CA 2X76A 5DW0A 3DHWC 3NHKA 1LX7A 1M76A 2C9OA 3O38A 3RIYA 5BN5B 1XPJA 3ZK7A 2IYZA 3EGOA 5GJVC 3CV3A 1JSLA 2QX4A 4FLFA 4G4SP 3KKZA 3PJFA 3D2BA 5TJ9A 5I8PA 2EBWA 4G01B 2C5BA 1GOTA 2IRWA 1E62A 5CVCA 2P91A 5HIMA 2OE2A 2ZE6A 3URKA 1Y8CA 2DT8A 4J3JA 1ZAYA 1U7ZA 4PGMA 4H1HA 3KZKA 3AHDA 3VUEA 4CKBA 3EEOA 1XZCA 1ENPA 2FUCA 2W5UA 3GD5A 2C7VA 4E0BA 3FR8A 3DOFA 2GTHA 3WWEA 5H59A 5CB8A 2M98A 1XRLA 5ITWA 3KSRA 2QPAA 3QOXA 2HXYA 2CE7A 2VRBA 2FX2A 1N0WA 3IQFA 2I3DA 1PJAA 5IT0A 1X7XA 1EBBA 4NZMA 5JDIA 1SXJA 3OLZA 2ID7A 1RYMA 1YDHA 1G41A 3RYIA 4QPNA 4FB5A 3RUFA 5B64A 2AC7A 4H4EA 1DO2A 2FXVA 2HYIC 3M7IA 5HILA 1ZN8A 4EF6A 3OP4A 1K6XA 4LHYA 1PHPA 3U3KA 1T2AA 1MJFA 1REQB 2NPOA 4GG1A 3T1QA 2BFDB 3R9XA 5F1PA 4UQOA 2NTYC 4B46A 1I1NA 4C0LA 3DHYA 4QU9A 1U7HA 4CNBA 3UCXA 1L5MA 5HMLA 3V33A 1K8RA 4KAAA 1AMOA 3G68A 4FNGA 4F21A 1QGUA 3DF7A 2ZB8A 4L57A 5LUBA 2FPMA 1VHQA 5EG5A 5KYVA 5AVVA 3B70A 3K0KA 4M0DA 5LMZA 3E7XA 3DL7A 3LHIA 2XB9A 4BFYA 1X9HA 3BX1A 2AFVA 2YRWA 5T4BA 2X5JO 4AL4A 1R37A 4KOAA 1FX1A 4JEMA 4R8LA 3ESBA 1CY8A 5GM1A 3F6RA 2JKZA 3LUAA 5IDVA 4LYGA 3U7IA 1K08A 4H2DA 4J1TA 3ND6A 5KI6A 2FJ0A 4Q18A 4N8DA 4LW8A 1Q22A 5BWNA 3JVVA 4ETWA 3MRXA 4PFSA 4OQPA 3NC0C 4J0HA 1NNSA 2VUTA 1E2JA 2BE9A 2R48A 4HYQA 2XB4A 5CFZA 1RQ2A 4MJLA 1T2DA 2QSJA 1HE4A 3JAWB 3IHTA 4ID9A 4ALKA 4B82A 4N76A 3KUUA 3TGWA 4MHTA 2IUYA 1UQRA 3AQIA 3OKAA 2OO5C 1XTSA 2OZPA 1EZ1A 1QDLB 1RI1A 1KI6B 1ETHA 1X80A 3SKVA 4RWZA 3CPEA 2ZR9A 1NOKA 4QUDA 1UM9A 1ZD3A 5KC9A 4C21A 3LUGA 2NO4A 4ETNA 3FLEA 2O2IA 4FC6A 2J6CA 1TXGA 2IEAA 5JT1A 3DOJA 1FSPA 1FFAA 1T8PA 1L5HB 2CYAA 2FFAA 5IFLA 3FDXA 1L7QA 4MITA 1ZESA 3IILA 4ER7A 2VAWA 3LUPA 4L2IB 4H16A 2B21A 2I7XA 4ILKA 3ZUPA 1X92A 1CLUA 3HBJA 1W8DA 3W5CA 2X6TA 3ANMA 3F6BX 3H83A 5DHUA 1RJWA 3ZDYB 4MSUA 2ZROA 3ZVNA 4BL5A 3BCRA 4PG4A 5DI3A 1FTSA 1JWAB 4S1WA 4DC0A 5DNCA 5IK2D 2K4MA 3AEUA 1XB2A 3O3NB 3RYCB 1JAYA 3DKIA 1KHHA 1ZK2A 4PYNA 2F17A 3L40A 3AZPA 5H81A 3T1TA 5IN4A 1UZUA 4IHKA 1ZCAA 2A78A 2CLHB 3BRQA 3E23A 3KPWA 4TMKA 1XZLA 4EGFA 1GPDG 2J5QA 4GYYA 1QRAA 1GYPA 1Z29A 5JRJA 4CLEA 3RTGA 1F8GA 2FWBA 3JQFC 3M1AA 4OIMA 4RHUA 4G1UC 5FBZA 5AJXA 4LA4A 4ZQCB 2HU5A 2OZLA 2IHZA 1QAMA 2PD3A 3INTA 3NQ41 4ISCA 2ZUTA 3VSAA 4ENQA 4Z4QA 3KS9A 1PSZA 5HFAA 1FSZA 3AP3A 4X20A 3DYVA 3IUNA 3F7NA 4K6OA 4TLCA 4M0CA 1O96A 4U7FA 3F8SA 4EHBA 1E0JA 4L5AA 4E2ZA 3B48A 4AJ9A 2NP7A 4HJRA 1KBZA 2WFLB 1DXOA 2GPAA 2C2ZA 1V1MB 3Q41A 3HLKA 3OOHA 2J5RA 3TSCA 3ACBA 5KB3A 4NMLA 1LS6A 3PUXA 1KSGA 1RRKA 4DPKA 1NAHA 1P4HA 1P9RA 3LWDA 4KPFC 4JKIA 4BP9A 3V1LA 2WVGA 2QUKA 3G0BA 1PWXA 4M1TA 4D80A 2YDXA 3KWFA 1L4HA 4EO7A 1XFAA 3QOWA 4DR4B 3U7FB 2Q7OE 3PC8A 4LNAA 2W6JD 2XDYA 1FJGB 3SCZA 4JDPA 4RF2A 2CK3A 5HBGA 3ZNNA 3I62A 3ND9A 1TVMA 3MOGA 1WB9A 1P0CA 4Q3OA 2IYSA 1FUIA 1NKSA 1QVVA 3Q6NA 1O95A 1PSWA 3G79A 3A1UA 5CYFA 4ZT2A 4K2AA 3W8NA 2ZI5A 5CM9C 5H4GA 3CCBA 1U0TA 1A71A 2B30A 2BDUA 3M3DA 3ZCRA 5F9HA 2GXAA 3BQMB 4QOEA 1T3SA 3E5RA 4OUDB 5ERYA 5IEJA 5TY0A 1EFUA 2BI4A 1RCUA 1KAQA 4OQ4A 1Z2DA 3FNQA 3MT0A 1G5HA 1PUXA 3FNRA 5L3SA 1G38A 4NYIQ 1XE3A 3R7SA 4F3NA 4XJXA 5AJTA 4OU5A 4U6NA 2DHDA 1Z2OX 2R97A 1B41A 3PSAA 3LF1A 1X7YB 5FTKA 2QK4A 3I64A 1YVPA 4BNUA 4JOSA 3F97A 1WMAA 3OJFA 1LJUA 1H3FA 3WISA 3KQYA 4GOOD 1U28C 3L8MA 3H1GA 1KZYC 4LK3A 4UBOA 3UT0A 1PN3A 3RS3A 2IYYA 2B78A 1SA0A 4MW0A 1U0NA 1AA9A 1WSWA 1SBTA 3HKEB 1H23A 3DMPA 3QVGB 3VR6H 2P2NA 4N49A 1J0AA 1PG5A 4FDUA 1ACJA 2QTNA 2UYYA 4JBNA 4PY2A 1LSSA 5A03A 4S04A 1R12A 1R2QA 4UJ5A 1UBOS 2HV9A 1J22A 3ZV4A 4CDGA 3DTYA 2H4ZA 1M34A 3KEQA 5FNVF 1RWXA 4FFPA 2XUOA 3MTAA 3CZQA 4LFAB 1E6WA 3L1VA 2JLUA 1RYFA 3ABRB 2GSDA 2NIPA 3SS7X 5EHXA 2FSHA 3VR5A 3C5CA 1BDJA 4CG0A 3VPBA 4QJBA 4ZEVA 5JUWA 2QVXX 2A3RA 2JEOA 2EFJA 2JIRA 4BBZA 5BRAA 2WG1A 5C1OA 2QTRA 3IHKA 3R7WA 1IBLB 1HY3A 1YQEA 5B2FA 1O03A 5ARDA 5A7GA 2AOUA 1E1CA 2D3TA 3LQFA 4L8WB 3P2KA 2WLSA 5JLJA 1BH6A 2WHEA 2F59A 4L5IA 1TM2A 2FN9A 1PV4A 1H4VB 2FW1A 2QR5A 1JWLA 3OJCA 2H8KA 2R7KA 3O94A 4LNUA 5JZBA 5KJCA 5A3JA 2CKMA 1CY7A 1UK9A 3A9TA 1TCVA 2A0FA 2ZBRA 1NUQA 1NZDA 1PWEA 2ZYTX 1LPNA 4YMSA 5LXTF 2C4NA 3QYPA 2W71A 3FGZA 3S81A 1AMNA 1J8DA 1WF6A 2FRXA 3FETA 1MXFA 3QYJA 4HRXA 4PLZA 4A0HA 3PRJA 2BEWB 2X23A 1YR9A 3TUJC 1N32B 1VG9B 2PV0A 4JJ8A 1GITA 5EJ7A 2WJ6A 4L0QA 5LQRA 1RJEA 3PXEA 2UZ1B 1ZY2A 5DP1A 4NONA 3JZMA 5TEVA 3SGLA 2JPDA 1PZNA 1J70A 1BXRB 1R6AA 2FWNA 1GGEA 2H00A 4XGNA 4TVSA 4RLSA 1G98A 2OZVA 3WSWA 1BVRA 5DGIA 3C8UA 1W4ZA 3N2KA 1WUKS 3O7WA 4G0QA 3CU5A 4KJZA 5BNFA 5JD6A 1HQDA 1OW3B 1C41A 2GXUA 3I1JA 5D2CA 4BDSA 1BX3A 1NVAA 4XYLA 5KVAA 3MMNA 2IYWA 4DA7A 1VKNA 2FN8A 2ZATA 4C06A 1N6OA 1IFXA 2YH2A 2YZNA 4YRMA 1HDEA 1QOZA 2RH8A 3ESAA 3MWLA 1P2DA 6NULA 5E3IA 3TIGA 2UYHA 1QRUA 3GJSA 2OGWA 2PBFA 1ODIA 4U02A 3JS5A 4MV7A 1YDEA 4FMDB 9GPBA 1I5OA 3GUHA 3H7IA 2P6UA 5JCOA 3KOOA 4ZJPA 1ZJ6A 4F46A 4ZVUA 2GETA 4YROA 3DV0B 4J7UA 1UBUS 2XUPA 2ZRIA 3NJ8A 3V1TC 4D8WA 2JB9A 4HSGA 4P38A 1G8AA 3ZJ4A 1SK9A 2BF7A 4KQIA 1UPFA 3L2OB 1SKAA 3RS5A 3UMJA 4HLUC 3D6FA 3MOIA 4L0MA 2HWKA 5TMPA 2JAQA 3KZOA 3RFUA 1IONA 3T9AA 2EW8A 2FE1A 1QGYA 3PFHA 4TXLA 3QVUA 5CLGA 4HFJA 4EZBA 3LSYA 1ZR4A 1RLTA 2VQSA 4ETIA 1FF9A 4B79A 3P97A 3GN1A 4S12A 1EG2A 4R1OA 4ENPA 3QLUA 3WO0A 1F2DA 3TZHA 4BO0A 4CHTA 1ZH8A 3G0DA 4WA7A 4TV8B 1X94A 1IRIA 2JIBA 1ZW1A 5AM4A 5F64A 1IK6A 3UUFA 3LIPA 4CYMA 5B6PA 3TPFA 2BEVA 4UW9A 2UUOA 1JQDA 5JQGF 1PVOA 1F2TB 1M1YE 3OP1A 2J7KA 3PXGA 2COUA 3IODA 1ODFA 4L16A 2WZDA 3CSSA 3RHTA 3CF2A 1WTCA 1RWMA 1P3DA 3CXRA 4RZUA 2V65A 1EFRD 5KSPA 3PPWA 3V42A 1Z2NX 4CI9A 2XD4A 1I33A 2QD4A 2BHTA 4E46A 4FD3A 4NZNA 2CUTA 2GVNA 2PWAA 4OHKA 4BQEA 4JS0A 1EEXB 1WPRA 5H80A 3HB5X 3DPSA 4QVKA 2OCBA 4DA9A 4EX6A 1H4SA 1V37A 1NXSA 4KO8A 1X7DA 2W2QA 2WHPA 3PQ3A 4TT8A 3RR2A 1RACA 2SKDA 2DERA 3I5MA 4FN5A 4RC9A 3L0ZA 4UASA 4OX9Y 2FG7C 4B3SB 3WGVA 1I6WA 4B43A 4E11A 4G25A 4RPCA 1FTWA 3KYIB 3E3LA 2VF2A 2ONJA 3SLGA 5CJPA 4DR1B 4IP0A 4TUYA 3H5WA 5FWDA 5EJ4A 1HDXA 5HPYB 3PXDA 4IMPA 4LXYA 4LRXA 4QXQA 5CPFA 1EVQA 5LBTA 4AJ1A 4L5BA 4XA8A 4OH1A 3G13A 4ZAFA 1ZM9A 5JI2E 1Y3AA 4RY8A 1JTEA 3FB1A 1A9XA 1QO0A 4UNSA 4K8OA 4LTMA 2PJRA 5KNBH 2CVHA 2UXDB 5DLDA 5ESDA 1ATIA 4E07A 1WMDA 3R3XA 3ND8A 1PR9A 4XEUA 2VSOA 3C16C 4R2WA 2D74A 1SCJA 5BNWA 1Z25A 2HJ9A 4NU6A 2R5FA 4LV8B 1CZKA 1GAEO 3VO9A 4D3DA 1RIFA 1XQWA 3NT4A 5C46F 2XNJA 1P17A 1Z34A 3I8SA 4G41A 4D3SA 2C5AA 3VPCA 2XVZA 1F7UA 1NASA 1EK1A 1ZOIA 5DM60 1ZK3A 2O57A 1FL9A 4KDFA 3ASYA 3NFRA 3ZI0A 4B6GA 1USUA 3RD5A 3VXKA 4K46A 1F5NA 1NSTA 1V2HE 3EIFA 2JLAA 1XMPA 1SUCA 2G8NA 3BJMA 1ZONA 3LBIA 3LVQE 1U1DA 4IG9A 4IPTA 4NCKA 4QAQA 2ID8A 1U5CA 3S2YA 4BZZA 4DSZA 4ASUA 4J4HA 4X85A 4HYTA 2WVJA 2JFZA 1DAEA 1T13A 3X1ZA 5IJ0A 3EIXA 1KO8A 3BQ9A 3O1LA 1HKHA 3RT9A 1G5RA 2IUSA 5P21A 4Q7MB 4RBNA 4IF6A 1L4NA 1T8TA 1ECFA 4B17A 1N5RA 1JHRA 1CY6A 1UZAA 4B5LA 4LDAA 4Q3LA 4YACA 5ALGA 5IXJA 3X2SA 1PDWA 6CHYA 1BVHA 4KYIB 1P81A 4KIUA 3JQGB 4DWOA 3X1XA 3TL3A 5ES3A 5COBA 1RBZA 2YJGA 3PA6A 4GBED 1G6HA 3A1DA 4HLNA 1MEOA 2C92A 3CGWA 4OM7A 1OI2A 4NCAA 3Q1LA 1NBOA 1GCGA 4XPIB 5DHSA 2X5XA 1YQXA 2BRUA 1KI2A 4RH1A 1SKBA 4FINA 1V4NA 3U62A 3ORFA 3R74A 2CXTA 2Q3JA 1N77A 3W8FA 2H2IA 2Z5FA 2ZW9A 5HF9A 2PZLA 1IVNA 4OAQA 3AJDA 4AJLA 2O0MA 4AZVA 3R0ZA 1UMCA 1KF0A 4M53A 4FM9A 3ZQ4A 1K6JA 1OFTA 5KU1A 2BLNA 1XDDA 1MFPA 3KOUA 4ZU6X 1R8QA 4TTTS 3VVCA 4YRDA 1ZIOA 2X1MA 1KVQA 3W1WA 2QRKA 3NO4A 3GWZA