3W9YA

Crystal structure of the human dlg1 guanylate kinase domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
175
Chain Sequence
NYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords Disks large homolog 1
publication title Crystal structure of the guanylate kinase domain from discs large homolog 1 (DLG1/SAP97)
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 175
sequence length 193
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3w9yA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w9yA01
4ASUA 2RGEA 4E5UA 4WXPA 1KOFA 1U94A 1G3MA 1RRFA 4A0GA 1E79A 3BB3A 1DO0A 4BZXA 4M1SA 5DLQC 4DZZA 1KDPA 3KB2A 3UMRA 3AF0A 2C96A 2ZRLA 5TV2A 1JXOA 2IWHA 1PVOA 1LF5A 4NCJA 3PXGA 4NH0A 5E3HA 2VSXA 3RSLA 521PA 3TNFA 4ESVA 2ZRKA 5BQ5A 3B5JA 4Z1MA 3SU8A 4IW3B 4EPTA 1G5PA 2H57A 1W7AA 2VYFA 2JGNA 2I3BA 2QL6A 4G1UC 4KSBA 4RD3A 1T91A 3HR8A 4GOXA 4M2LA 3QKRB 2H92A 3BOSA 3MJRA 3I8SA 2FZ4A 1N6PA 3AKYA 2IXGA 2OO7A 1AS2A 1JR3A 3AVXA 3R8CA 1GDDA 1IHUA 4I1VA 4HLDA 3T06B 2HLDA 4RY2A 2P5SA 4QOSA 3TQFA 1EWQA 2V4ZA 2HXYA 1R5NA 4ILEA 3B60A 3W6OA 5B30A 1N6RA 1NI3A 4MRVA 2N46A 2ZJBA 8OHMA 4QGHA 1KI3A 1VCNA 4CIDA 2ZJZA 1IN6A 2JJ1D 2MSEB 3BRWD 3CR8A 4M1OA 5DISB 3VMFA 3ZIAA 3RS3A 2PCLA 2QA5A 1SXJC 3LX5A 5JEEA 1R0ZA 4B74A 3CB4A 5CB6A 1CRPA 1DG3A 2GETA 3K09A 4EFLA 3MRSA 2RGNC 3GJ7A 3BD9A 2ZAMA 1MO3A 4LPKA 1R0XA 2J0VA 1YZUA 2W6ID 3GPLA 3EXAA 3AKEA 4HLCA 4LCBA 1TQ2A 4L16A 4Q47A 4AKHA 4XVRA 1TAGA 1TNDA 2WKRA 1NN1A 4QHTA 2FEMA 4OQLA 1BH2A 4F93B 2J3EA 1ZNZA 5AUQA 4IVQA 2IS6A 5DYIA 5FUWA 1EK0A 1RYHA 5BYJA 1T3SA 3VAAA 3NBXX 3ETLA 4CVNA 4A2QA 4XSHA 3QPWA 4Q02A 4WOPA 3OEED 2GAOA 1CTQA 4LUCA 2GRJA 2BBTA 3SS8A 1JAHA 2ZI3A 2LKDA 4OI2A 3LNCA 1VCMA 4BFZA 4QJ4A 1W47A 5CM8B 1Z0JA 1UM8A 2J0UA 2Q3FA 1UKEA 4A1FA 1XBTA 2EFEB 2QU8A 1L7VC 4Q1BA 4HLUA 3GFOA 1XTJA 1UBFA 4X8MA 1OPXA 2ZE5A 3THWB 2VRWA 4V0KA 3L2OB 3IGFA 1YZLA 1D2EA 3K9NA 3WRYC 2ZR9A 1X8LA 1FPMA 4LHWA 4PO1A 4H1UA 5L8VA 4Q7JB 1U0LA 1VIYA 2QRNA 4HEJA 4AYXA 4EPRA 1FMJA 4C0AC 1KMHA 2J0UB 1NLZA 4L15A 3BK7A 3I5XA 1MRNA 3RNLA 3WXMA 3EZ9A 4PXAA 2WAXA 1XCPA 1NVWQ 3I1FA 4KCGA 1IXRC 5KNBA 3KQNA 1GRQA 2GKSA 2R44A 5CJ2A 3RS2A 3N5CA 1W0KD 4TL7A 1E9SA 3ZZUA 1AIPA 4C9BA 2Z43A 4MGYR 4QRHA 2W6JD 1V5WA 4ZDWA 3W3ZB 1YKSA 3T5DA 4B35A 3Q9LA 2JLVA 3FKSD 2ZQ5A 2V6JA 1KMHB 5F3WB 3V4RA 1SVMA 2OCBA 1KJWA 3DPUA 3KXIA 4XTCS 3SQWA 2VL7A 4Y0VA 4ZCIA 2UKDA 2CHGA 4MKGA 4HYYA 2CL6X 5JCPA 2J5XA 3ADDA 1NG1A 3NHBA 2C9CA 3E1SA 4UNRA 1CULC 5FOVA 2IYZA 2WV9A 4RCZA 3VHLB 3I92A 4W5JA 4EQ6B 2MMCA 4R9UC 1CR1A 3FMFA 2F6RA 2ZSEA 3TAHA 2BMFA 2GHIA 1G1MA 1OFUX 3CF0A 5H68A 4A8JC 2Z0MA 3U7FB 3AKDA 3M6AA 4PC6A 4RJLA 2OXCA 1GVNB 5IK2D 4Q7LA 4HUTA 3KB1A 3WNCA 1NVUQ 3LFUA 5TY0A 4A2WA 1ZNYA 4YDHB 4B47A 3Q3JB 4B6FA 4IEEA 2WSSD 2JLYA 1II9A 2B8WA 3HU3A 3P4YA 3ONWA 1Z5ZA 1DARA 2QORA 2IA5A 2QM8A 4Q9KA 1XMJA 1JECA 2WPDD 1MO5A 3RLFA 4C0HA 3R20A 2DFLA 1E9BA 1E2HA 2QG6A 2RGNA 1RVDA 2IT1A 2REXB 1FW6A 2NO7A 2GAAA 3ZQJA 3CNLA 2C95A 3EPKA 2WKPA 3I73A 3JZAA 2CCKA 2ZANA 3MWLA 4JLDA 1KJZA 2NPFA 2BHRA 2D3WA 5EE3A 4KSCA 4PHHA 5CDFA 2FNAA 4CZ2A 2FPMA 1MKYA 1AS3A 3I72A 4FWTA 3G0HA 3P26A 2P2LA 1L8QA 3L0IB 2LWIA 2IUSA 1FZQA 5CITA 1XXHA 1IQPA 2ZVQX 2EU8A 1RYFA 5B64A 3JVUA 5KNDA 2XZOA 2F1RA 2QAGC 4F38A 4LJYA 1NN0A 4CT5A 3AUXA 2AD1A 1W2GA 5F9HA 2IYYA 1N3BA 2QP9X 3IILA 5FTNA 1X3SA 2V8OA 1UAAA 2HT1A 4D4KA 1HT2E 2O8CA 1W0KA 1G4UR 4M1TA 1WF3A 2FU5C 3EASA 2W6JA 1TQDA 3IEVA 1XXHB 4JBYA 4JL5A 3FKSA 2JATA 4Q1CA 2ZIAA 3PEVA 4JBXA 3KKNA 1CP2A 1LW7A 2A78A 3ND9A 4JSYA 4QGGA 3T1TA 2A3RA 2FWRA 4YONB 4C2TA 3GEHA 821PA 2O8CB 1Z0DA 3RS5A 2IEZA 2GEVA 2KBEA 1DAIA 1SULA 2OEPA 4MYUA 1K5GA 2ONJA 4DLZA 1ESMA 1W4BA 5FBLB 5C4GB 2WAYA 4DCNA 5D3QA 3ICQB 5KPDA 2R8RA 4LC0A 5FR2A 4J0QA 2NPIA 3SNHA 2GK6A 5IK2A 4NBSA 5E4FA 3QKSB 4F4IA 3LRPA 4PHTA 2H5EA 2X2EA 5KHOC 1MO6A 2HF8A 3TAUA 2KB0A 2L0XA 2WSSA 4MUAA 5EJEA 1P2SA 1P72A 1ZMXA 1R5OA 4TLCA 1GSIA 1DBSA 2WPDA 4K46A 1P75A 2E1RA 3LD9A 2RHMA 4C0SA 4Q4JB 5JSZA 1P62B 4JYCA 1DTSA 1YZTA 3LBIA 3P27A 4FWIB 4TMWA 1E99A 3NDBB 1KMQA 4JLOA 4O2LA 4Z51A 3PEYA 4E07A 4XWOA 4HAVA 1KI4A 3EWSA 4HSEA 2WJJA 2N42A 4MRPA 3VR3A 3VKGA 3AB3A 4KVGA 1DAHA 4G5QA 1RRGA 1US8A 3EIEA 4LYJA 4JSTA 1ZCBA 4RZUA 2V55B 1QVAA 1S8FA 3B6EA 4PC2A 4TTPA 3IEUA 3ZD7A 4RZ3A 1PLLA 2IWRA 2G77B 5JSZB 4Q1DA 4PSAA 1ZM2A 1P73A 4RFSA 2FEOA 1DAGA 3DVLA 3TJZA 1G291 2P6NA 4LV5B 5J40A 1R0WA 3QKTA 1ZD1A 2RGAA 4D81A 1KHTA 2PZFA 3BC1A 4OL0A 2D06A 2JLSA 1OSNA 2WWYA 2GJAA 1WMSA 2GILA 3MSXA 3TUJC 2F7SA 1KK1A 4PZYA 1JR3E 4X8LA 4RFSB 3SR0A 4V0MA 2WWHA 4RD0A 4GL2A 2X8AA 3X1YA 1NBME 1ZM4A 3EA5A 3GP8A 1DADA 1T5IA 3AH8A 5EE5B 1FX0B 2ODWA 3C5HA 4W5HA 5K8LA 1BMFA 5AJWA 2PT7A 1O87A 1VMAA 3CWZA 4UNQA 1D2MA 3FE2A 2X77A 3RABA 3C14C 3BB1A 421PA 3RC3A 4TYPA 3OIUA 3FHOA 4NHOA 2JA1A 3EW9A 1YQTA 1UADA 5CIQA 5LD2B 721PA 4C2UA 1HE1C 4DVGA 3AVTA 2WHXA 3MG9A 4AYWA 1NN3A 5SZHB 4IDNA 2F43A 1NJGA 1PV4A 4M1YA 2CHVA 2OHFA 3C8UA 4GPTA 1TMKA 5HCNA 5FUXA 2ZSAA 1RJ9B 2DWOA 5JI3E 5G53C 3THYB 4Q5IA 1M8PA 2XJ4A 5FPYA 3W6NA 3R8FA 1Z47A 5CK4A 1OE0A 2B21A 2QSYA 3UWKA 2VIIA 5EP2A 3IO3A 2VP5A 5KPJA 3A4MA 4DRZA 2YZ2A 4DT1A 4A0FA 3NIBA 2F43B 1GRNA 4QJ5A 4Q4AA 4BFVA 4D2IA 2PH1A 1XF9A 1EFHA 3HPQA 3Q72A 3MGCA 4P4SA 1E2NA 1T6NA 2LCFA 1NLFA 4GRAA 1W36C 1Q12A 2B8TA 1SHKA 2GZDA 3TBKA 3T34A 4R2IA 4D0GA 2C78A 1UFQA 1DPFA 1M6NA 1XD9A 4NE2A 1KDTA 1VIAA 4RD1A 4H1VA 4CYMA 1H65A 1GP2A 4DT1B 1N6OA 1RIFA 1KDRA 1T3LA 2QTVB 4LBVA 4Q4AB 621PA 4TLAA 3WHLA 2BOVA 2ZRBA 2QM7A 2AKAB 4M1WA 3W6PA 3MUFA 2W83A 1XTKA 2BBOA 2VPPA 1AGRA 1MABB 2BCJQ 3PR1A 1QHYA 4XTRA 2EFDB 2ONKA 2YWHA 3AP1A 4BLTA 2G9NA 1YR7A 1P5ZB 2PEYA 4PQFA 4DLYA 2JDID 3M1IA 1CJTC 3ZVNA 1CF4A 2QQ0A 4II7A 4LJ6A 1TX4B 4FN5A 3WP0A 5AUOB 2CVHA 1NL3A 3NDPA 2Q3MA 4TMXA 4AC9A 1ZJ6A 3N2EA 3VR5A 3GEIA 3PUVA 2SHKA 4IVRA 3EPJA 3EARA 1J8MF 2ZS9A 1JR6A 4QNRA 4OHWA 2CDNA 4LSGA 2XTZA 4NYJQ 1G4AE 4B3CA 1XDBA 2NZ8A 5AJYA 1GG2A 1E2IA 1J2JA 1WP9A 3BE4A 1XEWX 3AP3A 2FGJA 1CU1A 2ZRPA 2BJWA 3D8BA 4DWJA 3AVUA 4GMXA 5L3RA 2YWEA 3VX4A 3SBDA 1JEDA 2C77A 4LJ8A 1YR8A 4Q7MB 3U44B 1E0AA 2O8DA 5SZIA 4QFMA 1Q3HA 1SXJE 1II8A 3NBZC 2FSFA 3U3RA 4B75A 2D2FA 2N1BA 4N0EA 2OCYC 1K6MA 2DHRA 3NH6A 2VH5R 1E3MA 4NMMA 1OH7A 2HYDA 2Q9AA 2IL1A 4DLWA 2JJ2D 3NEJA 4HUQA 4OK6A 5LBIA 1IONA 3MWYW 5G3ZA 2ZS7A 1G17A 2TMKA 3EZFA 4UNPA 1ODFA 3P32A 1E2GA 2ZRCA 3A4NA 1XPRA 3KUCA 4FCVA 1SHZA 1II8B 4B2IA 1GITA 3U5ZB 3P4XA 5CDFE 1QDEA 2FN4A 2CE2X 1DAKA 5P21A 1AZTA 2GCNA 3A1TA 2XJ9A 4HUQB 4B33A 1F5NA 4DDUA 1AS0A 4KXFB 1F60A 2WIBA 4JT4A 4PFSA 1KGDA 3CX6A 4NL4H 1TEVA 4OQXA 5A5GA 4CF7A 3KQLA 1A1VA 1CJUC 2XNSA 1EG7A 2CNWD 2ZS8A 3P1JA 3SYLA 3K9GA 2XB4A 3BWDD 4EPYA 1KSHA 3ZYCA 1BKDR 2ORVA 1F2TB 3UMSA 3GLIA 5SZJA 4DUGD 2JIZD 4IOKA 2FE4A 1Z08A 2CLSA 4LRWA 1CBUA 3QOFA 2WZQA 1E0KA 3O8DA 1Q22A 1QG2A 1ZNWA 3HYRA 3T35A 1HA3A 1ZIPA 1N6NA 4URXR 3IBYA 2JDIA 4HB3A 2RH5A 3PENA 4BZPA 4PAOA 3T5GA 3U7GA 4ZDIA 3GLHA 3SJCA 3C15C 2VP2A 4ZPXA 4LHXA 3QNUA 3IPYA 1JJ7A 3D6TB 5IRCD 4BE7B 1E96A 1YRBA 2PLFA 2WJIA 3ZVRA 2Z6VA 2HJGA 2RGXA 5FUYA 1C9KA 4CT4B 2KE5A 1KZGB 3HU2A 3LLMA 3KJIA 1QHGA 3A8TA 1YZNA 1P9WA 4GBMA 4Q9LA 3GLHB 2Q0HA 1Q21A 1G8YA 4CGZA 3RC8A 4DLVA 4IFEA 1G20E 4TQAA 5HR5A 3FFBA 4MKIA 4V0NA 2C03A 4LC1A 3DOEA 4XJXA 4NP6A 3VNUA 3LLUA 1XD2B 2IYSA 1U98A 4Q18A 1KI6A 1JI0A 2V1UA 4P31A 3B9QA 5BN5A 2AWOA 3W90A 1Z6TA 2QSZA 3K09C 1G3QA 2Q9BA 1N5IA 3K0FB 4JLMA 2J0QA 4MKFA 4WA7A 2J7PD 3OAAD 4B48A 1GL9B 1Z3IX 2GF9A 2E87A 3MWKA 3EIQA 1MRSA 1OXXK 1PUIA 4C30A 3S1AA 4QM7A 5AJXA 5EP3A 2F1JA 3B78A 1QBKC 2CK3D 4IVPA 3LDAA 1FMLA 5EE0A 3D3QA 3KXLA 2QENA 3BB4A 3ZZTA 3EZ2A 3NBFA 1JPNA 4TQ9A 4I4LA 2PZGA 4HATA 1CR0A 2ZSDA 2HXSA 2VP4A 4L8GA 4O25A 1ZYUA 3ZDQA 1E94E 1E1RD 1TU4A 1B23P 3E5HA 1E2FA 3U4QB 2X19A 1IN4A 1GL7A 2H8KA 4MRRA 1NY6A 4NCKA 1XNJA 3S1AB 1NMZA 2VHCA 4EPVA 3A37A 2CL0X 2CNWA 1R4AA 1LTQA 2PZEA 6Q21A 1W44A 4NYJR 4MRSA 4HLUC 3G5UA 4AY2A 4KVAA 1I4TD 1L4UA 2AHOA 5DGXA 1F6BA 1SZPA 2BJVA 2JIZA 4DUGA 1XTIA 1GZSA 4V0ME 2G6BA 2OT3B 2YINC 2ZAOA 2O0KA 1IY2A 1KAOA 2ZRNA 3SN6A 1YR6A 1XCGB 2RGDA 1Z0FA 2WVJA 4A0RA 1VCOA 3KKOA 2GVDC 4KLZA 5B57C 3SYNA 4O2RA 2DBYA 1XPUA 3SEAA 1UKYA 5DN6D 4MYTA 2AKYA 2WOOA 4WW0A 3QKRA 5HCIA 2G0TA 4FMBB 2VP0A 3F0TA 2ANCA 3W3AA 4TMTA 3QPVA 3U3OA 5GJVC 5IHPA 1KI1A 2AX4A 2VHQA 4EUNA 1I2DA 3U3MA 3EIHA 2NQ2C 2AWNA 1FQKA 3FMIA 5KUTA 3QXSA 2ZJAA 1Z2CA 2ZRIA 1H8HA 4LGMA 2QRZA 4Y0AA 5EE1A 4A82A 3ASZA 3ZJYA 2YC2C 4WBSA 4G5SA 3ICEA 1P3JA 4GP7A 1U2RA 1E2DA 1E4VA 1IN8A 1E2PA 1ZINA 3QG5A 5KSPA 1OXSC 2YC4C 2GXSA 2B7BA 2YJTD 4YMUA 2VEDA 4URVR 1OT3A 2FX3A 2JCSA 1VPLA 4R2HA 4TYQA 4HB2A 1Z28A 3DM5A 4PANA 3QIAA 2BV3A 1UJ2A 2CXXA 3DKVA 2J7PA 3OAAA 4RZ2A 4Q01A 3SC3A 4XSGA 5CIWA 4Q19A 5JWOA 3F3YA 3RRZA 4PQYA 4UXHA 3VU9B 3A1SA 1U0HC 1BYIA 2CK3A 1VKJA 2ZJ5A 1K5DA 1Z0KA 2AK2A 4A15A 3NKVA 4GFDA 5GJCA 3GJ5A 1EFTA 4KI0A 4OQFA 2BMDA 3GLFE 1E1RA 3Q7PA 2PBRA 1WBDA 4IXMA 1W2HA 2V1XA 1YHNA 4R98A 2ANBA 4F91B 1Q57A 3LQQA 3REGA 5K8IA 1OHHD 5BXQC 1EFRD 2NO9A 3CM0A 2FPKA 2R6GA 3TH5A 2YOGA 2D74A 3A4LA 3CNNA 4AYTA 5EUQB 1W48A 1VG0B 5G41A 4LYFA 3DHWC 4GOJA 4XIGS 1UBGA 2PL3A 1KY2A 3NC1C 3K70B 3TLXA 3THWA 4A9AA 1XTSA 4TWZA 3IPXA 2GXAA 2ZTSA 2FMXA 3PV0A 4DCTA 1M2OB 3L0PA 2RGBA 3BGWA 3NEYA 1S96A 3DO6A 3P20A 4WVFA 1XD8A 4B3BA 4D4MA 3PUXA 3V4FA 3M4YA 2BM0A 2F9LA 2ZSBA 5DN6A 4M1MA 3T1VA 1KAGA 1UDXA 3DEFA 4ZI3A 1PZNA 3AF2A 2NO6A 4M4SA 5HTKA 3R7WB 4PO9A 2ZI7A 1SKYE 4XD7D 1EX7A 2W2VA 3THXA 1Z07A 4OQNA 4OK3A 5FTLA 2DY1A 3DM9B 4KBFA 1N5KA 4GSYA 5GVRA 2GCPA 1KI2A 1R7RA 1W5TA 2BEJA 2QEQA 1CXZA 2G0NA 3HU1A 3T15A 4S35A 2QROA 4KLNA 1JAIA 5FBWB 2ZJOA 5JMTA 1RFLA 2CMKA 4Q48A 5BWMA 4EQ6A 3THXB 2WMOB 3K0CA 4CDGA 3M0EA 3BBPA 1BYUA 1BOFA 2IYRA 3CLVA 2YHSA 3TUIC 5AWFC 1KSFX 2FH5B 4TMVA 1SVLA 2VLIA 4LV8B 3QKUA 1DVRA 1GIAA 1NP6A 5FUVA 4ARZB 2G1JA 3MCAA 3PVSA 2XXAB 2VP9A 2D62A 2AL7A 2JJ1A 4B3GA 1ZCAA 2DPXA 4Q4LA 2IYXA 4W5WA 2E9SA 4BFWA 2Q6TA 3KQKA 4US2R 1VG8A 2EQBA 2YV5A 3EPHA 4OI1A 1OXVA 4R7ZA 5G3YA 4AIIA 1BIFA 1KO7A 4HLQB 2QNRA 1IY1A 2OM2A 2W6IA 4Q66C 2WSMA 1OHHA 4HZUA 1EFRA 4P4UA 1OYWA 4ZIRA 1ESNA 1NIJA 2F3TA 2ZEJA 3FHCB 3OESA 5E7IA 2J1LA 1T3HA 4LK2A 1OIVA 3GLIE 1U9IA 2HV8A 1U8ZA 1UBEA 4F4JA 4B2PA 3AEZA 4DIEA 3IHLA 1GUAA 2BKUA 4QHYA 2UZ3A 4JJZA 1A2KC 1LNZA 3Q7QA 3OEEA 2O5VA 1Z29A 1E98A 3QUSA 2EVWX 1XP8A 4HZUB 1WB9A 1YZGA 1C4OA 4ZIRB 1E2QA 2OFOA 3RDPA 3HYTA 4TZ6A 1I4DD 1G7RA 2PT5A 2WKQA 4GDFA 3U2QA 1RW4A 2JLZA 1XB2A 2WWWA 1ZNXA 5LD2C 3WNDA 1JB1A 1R6BX 4TLDA 3SHWA 4XD7A 1XTRA 1K8RA 2K5UA 1G21E 2QBYB 4MRNA 1G7CA 1N0UA 4TL8A 1QVRA 1E69A 1OB5A 3REFA 2QAJA 4B34A 4HI0E 4KITB 1G9XA 2A5GA 2J45A 3AGQA 2CL7X 3CPEA 3K9LA 1E2JA 3ZVMA 1FP7A 1A2BA 1I2MA 2XITA 2FFHA 2IF2A 4B3XA 1F48A 2A5YB 3L0SA 5FTJA 1RPZA 5F9FA 4IOLA 2A5FA 1B0UA 1L2TA 2PEZA 2QY9A 4DLRA 4CEJA 2DFKB 2ERYA 5UKDA 3WYFA 5KSZA 1Q20A 3U3KA 3QKSA 1FUUA 1NKTA 1Z0IA 2W00A 4JKIA 1TTTA 2Q21A 1AJEA 3K8YA 3K0AB 1FTSA 3BJIC 3LW7A 2FJUA 4JLJA 1Z8FA 1OLOA 2QGZA 2QZ4A 1U8YA 3AM1A 2A9KA 3BXZA 4B44A 3GCGA 4C4PA 4IFBA 1VHLA 4Q4JA 4D4LA 3QBTA 4MGIR 1LV7A 4CEJB 4TMZA 2IYQA 3BERA 2OILA 2W0SA 2W0MA 1KNXA 1RZ3A 2ERXA 4LWZA 2YNMA 1UKZA 4A36A 5DI3A 3RYTC 4EIWA 1XX6A 5EQTA 1ZW6A 3FKQA 2HF9A 4MUBA 2OAP1 3I5YA 1PLJA 2CLCX 2OFWA 1MH1A 1RE0A 3BH7A 4JLAA 5DI9A 4TYNA 1LFDB 3FTQA 2ZRFA 2BCGY 3CUEF 5E7JA 1YU9A 1FTNA 3TIFA 2D7CA 2FV8A 3CZQA 3ZS9A 3AQ4A 5KYKA 3OEHD 2C9OA 4AG6A 4DIDA 4ZI2A 3K0SA 1HH4A 1E4YA 5H1YA 2IYWA 4URYR 1P9NA 1DEKA 3A1VA 3GJ4A 2QT1A 1D8TA 4GOKA 4Q03A 1KYIA 4HB0A 5DI3B 1FFHA 4C7OA 5E7MA 1NIPA 1IOZA 3I62A 3K9HA 4I1OA 2ODBA 3DL0A 3GFTA 1Y3AA 4UKDA 2FDCA 2ZUCA 4JLBA 5AJVB 3PEWA 1J90A 3E2IA 2ZJ2A 2OESA 3DZDA 2QPAA 3W34A 1N2CE 2KSQA 1JBKA 1HUQA 4B6EA 2FGKA 4LJAA 3VR4A 3UXMA 4DDVA 2FSIA 3Q85A 1ZUIA 5G40A 1FX0A 4DLUA 3WMEA 1SVOA 2Z5FA 1JQLB 2DFTA 3BFVA 1CRQA 3FMPB 4C7OB 1QF9A 4U5XA 2OXRA 4BECA 5JEDA 2GXQA 4IEIA 2ZUDA 1R0YA 3EAQA 2QE7D 4QHSA 5GJWC 4XWKA 4DSOA 4BQSA 2OCPA 1DS6A 3LVRE 4KJZA 4UJ5A 5HPYB 3QY0A 1TPZA 2O8BA 2O0JA 1KTVA 5FTKA 4IKEA 1NF3A 1JXMA 3TVTA 2R6FA 2FFBA 2QMEA 3DMNA 3L82B 4LHVA 1U90A 1M7GA 1Q1ZA 4FINA 4BRUA 2GVZC 3WNBA 1R10A 3X2SA 1UPTA 4WXRA 4TYWA 1P2TA 4JLPA 2H18A 3OIWA 5DO9A 1WE2A 1JQJC 4KYUA 3N2IA 3B1ZA 2O8EA 1HURA 1S0UA 3AVPA 1NN5A 3F5FA 2O8BB 3A1WA 5TARA 3CX7A 3VR1A 1RJ9A 4URZR 4PPGA 1SVKA 1TU3A 3FVQA 3QPUA 4L9SA 1E0SA 1G8GA 2HJVA 5CJPA 3C7KA 3THYA 3I32A 4BFYA 4YDSA 4EFMA 1FOEB 2EYQA 1FNMA 3HPRA 3QF4B 4MGKR 4TYYA 4PPFA 1DAMA 5L3SA 2D7DA 1G41A 2DFNA 2FFAA 5EUMA 4X8OA 3ADBA 5EXXA 3IIJA 3ZGXA 4PX9A 3OE7D 1E9RA 3H0KA 4LPSA 4A4DA 2O8EB 2C99A 4JJKA 2VSOA 3UK6A 2CBZA 5FOUA 3AVVA 4PPNA 4DHEA 3FYHA 2VP6A 2BWJA 2XTMA 5B2ZA 2GJSA 5F2EA 1ZM3A 2B6HA 3EPLA 4EKDA 1SQ5A 3KFXA 3ADCA 5JJIA 3OEHA 4YC7A 3SFZA 3WYAA 5L3SB 1H8ED 1WRBA 3DKPA 2WIAA 3LV8A 4LYAA 3TUZC 1XEXA 4ABYA 2XNDD 4YXWD 4RFVA 4FIDA 4ON9A 4JL8A 1Z22A 2LKCA 5IF9A 3OZXA 4PQRA 3HR7A 1AKEA 1ZRHA 4O3MA 1MABA 2D4HA 4N0DA 5TVKA 1VYUA 2ZR0A 4LBYA 2I4IA 3R9IA 1OXTA 4GMDA 3BH6A 2C98A 4BFUA 1LS1A 4DKXA 5JHHB 2RMKA 3CO5A 4C3ZA 3O8RA 4EJSA 2QUZA 2JEOA 1AZSC 4R71A 5H70A 4AD8A 1DAEA 1NJFA 4BUJA 1KI7A 1XEXB 2ZJYA 5GADl 1GAJA 2ZITA 1XMVA 4L9WA 2ORWA 1ZM9A 2F1HA 2OG2A 3B13B 4ZDJA 4DCSA 4Q00A 4BLPA 1XZPA 1CIPA 4XH9B 4BFXA 2P0EA 3L0OA 1E2KA 3VNVA 3CPHA 4B71A 1DO2A 4TLEA 1TF7A 4DBLC 4EJSB 2OBNA 2MSCB 4M9SA 4M0LA 4PZZA 5FOSA 1COWD 1U0JA 5KSYA 1D2NA 3W9YA 1R2QA 1T8TA 4H9GA 5AUNB 4A2PA 3B1WA 3A36A 5AR1A 4DSUA 3ZVLA 3FOZA 4QJ3A 2HCBA 3QF7A 3EX7C 3U44A 4KAXA 2YVUA 4M53A 3NWJA 1L4YA 4URWR 1XRJA 3MLEA 1Q44A 3UG7A 3EC2A 2JLRA 4C0JA 2X1VA 3KKQA 2QP3A 2IK8A 4FCTA 1QZXA 1AA9A 2GNOA 2ZR7A 4OI4A 2HDNB 1MV5A 2GEUA 3OE7A 2AN9A 1MOZA 4PHFA 5FI0B 5FPSA 1E32A 2GDJA 1U8AA 3EG5A 3KZ1E 1ZD9A 4E22A 1GKUB 3X1DA 4I1UA 2WTUA 4OJQA 2ZETA 3ND8A 2OBLA 4Q4HA 2WWXA 4LI0A 4M21A 4YQFA 5BYKA 5DE3A 4AKIA 1FQJA 3BFXA 2F3RA 3N70A 1N6LA 1II0A 2IYVA 2H7VA 1KO4A 2IS1A 2XNDA 4YXWA 2FSGA 3V9PA 2DR3A 4NCNA 3EC1A 221PA 3DDCA 1F2TA 3KJGA 4DEXA 1G3IA 2GBLC 1EX6A 5CLQA 1G64A 1MO4A 2XEXA 3FB4A 3OFND 4JMPA 1Z6GA 1Z83A 4LJ7A 4Q4HB 3B1YA 5FH9A 1M34E 3QEJA 3LVQE 2CE7A 3DMDA 2OV2A 1TUIA 1Z6AA 4JIMA 4BFTA 1XXHE 1UKVY 1OIXA 3B8HA 4MYCA 3TSOA 1YR9A 2XGJA 4Z8YA 5LDDC 3A6PC 4RD2A 3FDIA 4LJ9A 1OFTA 4IRUB 3WP1B 2ZM5A 1G8HA 4L4UA 1WBBA 3AF3A 3LY5A 5FI1B 4JL6A 4QG7A 2J41A 4V0LA 4FW9A 1NSTA 4HAYA 5FPKA 1T0JB 5CYOA 2JAQA 4LBWA 3TE6A 2BIFA 4O0MA 3MAAC 4HDQB 1S2MA 4EDHA 1XU4A 4S2EA 5L3QA 3RS4A 4BFSA 5EP1A 4WZAE 1COWA 3IO5A 2IHBA 5TDHA 4TTRA 1SVSA 2OBMA 4LDJA 2JLUA 2ZRAA 4MQBA 3EZ7A 2CCJA 2WBLC 2DWQA 3SQXA 3GEEA 1XD2A 5K8TA 3DOFA 3U60B 3AF4A 1IJFA 4DLXA 3GJ0A 5JFGA 1P60A 3PQCA 1CKEA 3QE0A 3H84A 4ASUD 1S3GA 3ZQ6A 2R6DA 3K0FA 4JVLA 5L3QB 1SKQA 1E79D 2J7KA 2MMGA 3SZRA 1YVDA 1QHIA 5D3MA 2XSZD 2GCOB 2ZRJA 4V02A 2UVQA 4DEYA 1TF2A 3PCRB 2ZE6A 2RCNA 5GJBA 4GP6A 1G18A 1OV4A 1OW3B 3RRMA 4ERNA 4JLKA 3GLGA 4CEIB 1N0VC 5A0FA 4BLSA 3WRXC 1JPJA 1ZM7A 2XX3A 2IBMA 3QJYA 2WJVA 4IDPA 1EXMA 5J4VA 2RHDA 4IOMA 1N5LA 3K70C 1V43A 3JZMA 2ZPTX 4UNSA 1E9CA 2JJ2A 4US1R 5D3MB 5LPNA 1G16A 1CJMA 1HY3A 3U4QA 3L8ZA 4UNNA 3LQRA 4KFUA 4FMDB 1OFHA 3LX8A 4GZLA 3GLGB 2KI5A 1RRPA 4LJ4A 5A4JA 4QC2A 1G6OA 1FL9A 5KTYA 1P7CA 1N0WA 3QVUA 4MA4A 1F3OA 1OB2A 3OFNA 3L8YA 3CH4B 3K70D 2V3CC 4LBZA 3R9XA 1NBMD 2O8FA 3UWOA 1CR2A 3QQ5A 2CCGA 3BH0A 1OYYA 3QVVA 4RCYA 3T12A 3TR5A 4US0R 2AXPA 2PCJA 1GKIA 1VDZA 2BM1A 2CHQA 2Z4RA 2QN6A 3K53A 4LJ5A 4OKSA 2XZPA 5JI2E 1XJ0A 1GM5A 3C4JA 2FA9A 4Q21A 2BBWA 3FHTA 1T5LA 4DCVA 3AKCA 2GZHA 1P61B 3CRRA 3T1QA 1ONBA 4RVCA 3B7GA 2GBLA 1J99A 4RKEA 4IHQA 4ZCMA 3Q5EA 2O8FB 1XJCA 4HDCA 3IUYA 5EE9A 2Q3HA 1T8UA 1QG4A 2PX3A 3UKDA 1NRJB 3CF2A 3B1XA 5J4HA 4KHZA 2G88A 3EZ6A 2O52A 3FPAA 4UXJA 4D82A 2ODEA 4QBHA 5EZ5A 1ZU4A 1PUJA 1X1RA 1T9HA 3MWJA 5JCZA 4Q1EA 3PFIA 4MH0R 5CM9C 4Q1AA 1WXQA 4ZO4A 2RGCA 5ANRB 4PAMA 3RAPR 3H86A 1VG9B 3C16C 3H2YA 3K0CC 3IBGA 4NZYA 4PHGA 4P32A 4AURA 3TVDA 4K8OA 4CEHB 4TL9A 4Z54A 2ZYVX 3E70C 3TW4A 2XSZA 3UPUA 3PUYA 3UIEA 1GKYA 2H1LA 4RKFA 2WJYA 3TKLA 3VU9A 2P67A 3IDQA 1LB1B 3MD0A 1XEFA 1WA5A 2QMUA 4PSKA 2REBA 4YMVA 4P4TA 1LY1A 4PZLA 4TTQA 1VG1A 3WMGA 4B3FX 1ETUA 1Y63A 2IX3A 2JLXA 2O0HA 1S1CA 1XTQA 2OLKA 3D31A 3Q5DA 4PO8A 2A30A 4KYIB 4C0KA 3VFDA 5HZHA 2ZREA 4F4CA 2FFQA 3K1JA 4QKQA 2A5JA 1S9DA 4TN1A 5KOYA 5JBQA 1ZC4A 2ZRGA 4G3XA 4Q1FA 1U9IC 3KKMA 4E03A 2AFHE 4GNKA 1OJLA 4IJMA 2A7QA 1I4LD 4UXIA 2F55A 2GJKA 3C41J 4M8NE 2V7QD 4RSGA 2P65A 1NBMA 1P2UA 2QP4A 4LX0A 3NH9A 4TMKA 5FBQB 1SVIA 1JNYA 2WJHA 4MYHA 3NC0C 5BN4A 2HT6A 2FZLA 1MR3F 1E9EA 4PPQA 4IDHA 4JVSB 3PUZA 4ZCLA 1N6KA 1YZQA 2IF0A 2DB3A 2NO0A 3QXJA 4QM6A 3SI7A 3LAWA 4CW7A 4PC1A 4MGZR 5C1BA 4WAUA 4DB2A 3KDSE 4KFSA 1BO6A 1Q1QA 1NLYA 2GA8A 1Z63A 2EFCB 2WWFA 3AF1A 3VR2A 3R7WA 1UEIA 2J87A 2GF0A 2HCJB 1E9AA 1TF5A 1W4CA 4B76A 3PEUA 4DJTA 2IYLD 2AXNA 1UF9A 5DYGA 2NOAA 2ZRMA 4DC9A 2ZRHA 1KJYA 1T4GA 2QT0A 1ZP6A 2XOKD 4XWAA 1AQYA 4PAQA 4M1KA 4XVQA 1SXJD 1GL6A 2P6UA 3AGPA 1C1YA 2AK3A 3CPJB 1HEIA 2KWIA 3QXCA 2C2HA 5DHAA 3R9WA 1ZBDA 1S4QA 1X86B 5HKKD 1FP6A 1KNQA 4QGFA 5H8WA 3CONA 4EAQA 1QHSA 3TK1A 3UATA 2KJQA 4BASA 4NDZA 3ECCA 4TLBA 5TB5A 4ARZA 4F92B 2XXAA 4RD4A 2CJWA 4P3YA 1A5TA 5JS8A 4QBGB 4DDWA 5JS7A 1WDTA 2YOHA 3UG6A 2CVFA 2WM9B 3LWNA 1KK2A 2Z83A 4NCHA 3RWOA 3K0EA 4JVMA 2IXEA 1XMIA 2IC5A 4KV9A 4EFNA 1QRAA 3AVWA 2CEAA 2IUUA 2ASEA 3ZZ0A 5KO2A 3B82A 2QMOA 2JLWA 1TUEA 2GXUA 1X6VA 4DSTA 1Q1BA 4IOJA 4IDQA 4LOAA 5FOWA 2ZXUA 5KDOA 2GJ8A 2CJWB 1AQUA 2IS4A 3I8XA 2PJRA 4HZIA 1TEXA 3AVOA 4ACAA 1T0HB 2ZUBA 1ZD8A 1P4SA 4YMWA 2V7QA 3D7MA 2W2XA 4OHXA 4PR0A 1S3SA 5DH9A 3TSZA 3TGPA 2UZIR 1RC8A 1UEJA 3CZPA 3JVVA 4JS0A 1QHNA 1VTKA 4QXAA 3SDZA 3SJAA 4YLGA 2FPLA 2VO1A 4F7WA 3O8CA 3HDTA 2EW1A 4YMSA 3J81k 1KI9A 2YYZA 3U7HB 2QTHA 1NKSA 2BBSA 4XVUA 3F8TA 4A92A 1S1MA 4FMCB 1ELOA 2IW3A 1LF0A 2X2FA 1KO1A 4D0NA 1CLUA 3HWSA 2A2ZA 4M9XA 4DDTA 3QG1A 4QL3A 2PMDA 5HZKA 1CR4A 1U81A 1VYVA 4D80A 1XJQA 2QBYA 2BMJA 2XB2A 3U7EB 2BC9A 2GWHA 3AV0B 1OH6A 5BW8A 3U61B 3GLHE 3WMFA 5L3VA 2AFIE 1ZAKA 5JHGB 1NSFA 1KO5A 1XZQA 2QI9C 4BPBA 4G5GA 2R65A 1G6HA 2XOKA 3LXRA 4BLRA 2WOJA 2XAUA 1SXJA 1GTVA 2EWWA 3CH5A 5EZ6B 3RHFA 5F98A 5LB4A 5ELXA 1E9DA 3CX8A 4DB4A 2J59A 4U02A 4NTZA 2ZVPX 1J7KA 1G3UA 1CEEA 3LH5A 1KSGA 3FWYA 4OJKA 5HKKA 4LV6A 1IN7A 1W46A 1ZUNB 3WHKA 2IS2A 3LXXA 3AVYA 1G8FA 3GLGE 1IXZA 1UDWA 4I99A 2ZE7A 1RRCA 1SXJB 2NO1A 3O47A 3VKWA 2HYIC 3THOA 1LVGA 2VTKA 3W5IA 3K0AA 1TL7C 3QXXA 1CJVC 3H4MA 3SJBA 3W8RA 3SBEA 5C18A 2J46A 3BIFA 4OYHA 3IQWA 3VR6A 2VHUA 3NVAA 3T1OA 5JWHA 1E9FA 3CRVA 2VHTA 5FR1A 4AG5A 2OSBA 1WCV1 1SVWA 4FCWA 4OHVA 3T61A 2R6AA 1Q0UA 4GI7A 3X1WA 1G5TA 2ZRDA 4HAZA 1YE8A 3LBNA 3IKJA 2QPOA 1IJEA 3KJEA 1CS4C 4EPXA 4TSFD 2NG1A 3NXSA 2I1VB 4A0HA 3RVBA 3VX3A 1BMFD 3QI2A 3SJZA 4KBGA 3V00A 1Z2AA 1XWIA 1GNPA 1E6CA 2JASA 1KKMA 3QEOA 2IXFA 1OH5A 1HQYE 2J9RA 3BFKA 3KFVA 4PC7A 2B7CA 4KU4A 3Q8XB 3AP2A 2OCAA 3MMPA 1NMYA 2D2EA 4B32A 4DLSA 4G01B 1FNNA 1Z6XA 3G82C 4NYMQ 2EWVA 4EJSC 4TZ0A 1D6JA 3QBVA 2ORIA 3VKHA 5JWRA 1GOTA 2IYUA 2NZJA 1E0JA 3GJ3A 1YRAA 1W4AA 2F1IA 5FPTA 1W49A 1U99A 1WQ1R 1VYTA 2R9VA 4BEBA 1IM2A 5KDLA 4MDFA 3KX2A 3PJRA 1IAQA 2R62A 4D6PA 1QHHA 4Q9JA 4JLNA 2VHJA 1JEEA 3QENA 3GJXC 1HV8A 2ZSFA 1Z6YA 5FL7D 2OUKA 4BLQA 2NMVA 1YZKA 4A8JA 1PJRA 4Z8XA 2YKGA 3PUWA 4NONA 4AK9A 4HAUA 3SYKA 5IT5A 2YWFA 2ZI6A 1O3YA 1DELA 4XOIA 5K8UA 1W5SA 3CIOA 4W9MC 3CRW1 1R8SA 2DYKA 2W2TA 4B2LA 1SGWA 5FTMA 1QHHB 2WJGA 4AKGA 5JJLA 1D9XA 2ECKA 2ZYUX 3AVQA 1EESA 3BS4A 4HAWA 1KZ7B 4N1AA 4A8JB 4MITA 5DSZA 4BRWA 2NGRA 3TQCA 4KO8A 4IDOA 3RRYA 1VHTA 3QF4A 3KUDA 3TMKA 1GNQA 1OKKD 4FI3C 5C2JB 3W8NA 5JECA 3IHWA 3GJ8A 1IBRA 1US8B 4NYIQ 1OXUA 1A4RA 5C4MA 1A7JA 4ZKDA 1DG1G 1P2VA 3ASYA 3NHAA 1TADA 2OAQ1 2ODNA 5JRZA 5JLJA 1FUKA 4TSFA 1M1YE 1GWNA 5DNYB 2BEKA 4POAA 5B58C 1W0JD 5CK5A 1NMXA 1D5CA 1IXSB 4C0BA 2GZAA 2PMKA 1HYQA 2WICA 4C0LA 1W1WA 1XMSA 3UMFA 1X1SA 4LHYA 2QAGA 2ZE8A 4P33A 5LB2A 1X8KA 3I61A 3ADKA 1N6HA 2WWGA 1KK0A 2OE2A 1LS6A 3QXHA 4RD6A 3WBKA 2ATVA 4N3NA 3GD7A 3RWMB 2BDTA 4DSNA 4JVNA 1EWRA 4G5OA 4D25A 3RSOA 3CRQA 1Q3TA 2QMHA 1AKYA 1XPOA 3KTAA 1AGPA 4QGAA 2QAGB 4LZZA 3CR7A 1IY0A 2ZU0C 3CF6R 1R5BA 4QNMA 5FBRB 2OFXA 4ESHA 121PA 3NBYC 4G5RA 1KI8A 5JRJA 4FMDF 3TW8B 3MJHA 3SE0A 4CRWB 3CKLA 2VBCA 3A1UA 3IIKA 1E1QD 1KIMA 2B92A 1EFUA 5FL7A 5FL3A 4B3DA 4EPWA 4HB4A 1HT1E 2IUTA 1NVVQ 4LY6A 2BVNA 1G19A 1KKLA 4BZQA 3KTAB 1KK3A 2G83A 2I1QA 4QBFA 5TXGA 3OHMA 4OQMA 4MDEA 4WZBE 4E09A 3AUYA 2P6RA 4MKHA 5DIFA 4U7DA 3CBQA 3OIYA 5C46F 4KODA 2AR7A 2QE7A 4WZ6A 4OHYA 4BWYA 2QPTA 2FOLA 3GLFA 3KQUA 4HAXA 2VQSA 1J8YF 2Y8EA 4WIAA 4M22A 5FBVB 3GMTA 2ZU6A 4TL6A 2F9MA 4V03A 3VQTA 4AKEA 2R6CA 5J47A 5FFMA 3KL4A 1GILA 3UANA 1OFIA 5TMPA 4D26A 4NU0A 1G7TA 1NG9A 2GEDA 3A58B 2ZYTX 3C5CA 3FGNA 1HQCA 4AWXA 4DXAA 1OKKA 2FSHA 4LYHA 1OH8A 2IHYA 5EXSA 4P4SB 5BN3A 4OK5A 3WYGA 4NYMR 2VSFA 1XEWY 4URUR 1PLKA 3GLFB 1G8PA 1W36D 5CB8A 1JALA 3GFPA 4TT3D 3PITA 3MFYA 1JJVA 3TSWA 1R8QA 1NNEA 1MT0A 1W0JA 3WY9A 4B73A 5J4KA 1CJKC 2GESA 4IXNA 1IN5A 2PX0A 2QQEA 4K81B 5HE9A 5JJKA 2DWPA 4YMTA 4FD2A 2REOA 2BKEA 3ZS8A 4KFTA 1E2MA 2ATXA 2NIPA 3CW2A 2BMEA 3H1TA 3L43A 1N5JA 1UBCA 4JKYA 2JJ8A 3B9PA 1OIWA 1HE8B 4OI0A 4BEJA 1KSJA 2H17A 2FG5A 1H8EA 4G0NA 1AN0A 5FPHA 4ZV4A 2W58A 1E2LA 1M7HA 2H16A 4JT2A 2QTFA 3GJ6A 3KQHA 1N6IA 1YJ5A 4JZKA 2ZJ8A 2ZYWX 3VTKA 4FXPA 3FMOB 2P5TB 1AK2A 3B85A 1SKYB 1Z0AA 2V6IA 5FOXA 1E1QA 2ZI9A 2KBFA 5SZKB 4DLTA 2IEYA 2V9PA 4NYIR 4NKRA 3B1VA 3EA0A 4PC3A 1ZUHA 3CWQA 2G3YA 4LHZA 4Q9IA 3VHXA 2O8DB 1NY5A 5J4LA 4A6PA 1ZC3A 1XFAA 2VA8A 2G1KA 2IYTA 1Q1EA 3ZLJA 2PLRA 3RS0A 3LW8A 2C04A 3U3JA 5EP4A 1HTWA 1TQ6A 4QBIA 1TQ4A 3PIRA 3OIVA 4TQUS 2HUPA 4JBWA 2EYUA 4JLVA 4RZXA 2RAPA 3HP1A 5J4YA 4W7SA 1F2UA 2GCOA 4PTLA 1GRRA 2OLJA 4X8HA 2RKOA 5KSOA 4C0QC 1GFIA 1OF1A 2XZLA 2GTPA 5AJZA 4A6XA 3I4LA 4BLOA 5M04A 3I3SR 4CEIA 2V54A 1VCIA 1DAFA 1M74A 3CNOA 3KJHA 2MSDB 3ZH9B 4NCIA 1GNRA 4TT3A 3W5JA 2Z4SA 1KDOA 4L5BA 2WWIA 1NVXQ 2EFGA 1N25A 2YWGA 4BGDA 2Q9CA 5IDVA 1F2UB 3B2EA 2HEIA 5GVSA 4V0OA 1G7SA 5J5CA 1ANKA 1QHXA 2VF8A 2ZROA 3GLIB 3U6KA 3ZD6A 2GK7A 1G5RA 1AM4D 3EWAA 1DOAA 1W36B 5DHFA 1X8JA 1A82A 2ZI5A 5KDDA 1NVVR 1W4RA 1ZIOA 4ACBA 3SFVA 3NTUA 4AI6A 3QSYA 3RS7A 3SHFA 1VECA 3IIMA 1EFCA 4I81A 4GT1A 4D4JA 4Z1MD 5EXTA 1KO8A 4M9ZA 1D9ZA 3RRNA 1ZU5A 5HE8A 4OHZA 5CYPA 2VF7A 1H8HD 3O8BA 2R2AA 1EGAA 4Q9HA 4D0LB 1P6XA 3RANA 1M7BA 4M9QA 2XTNA 4OBEA 4Q7KA 2YOFA 3HJNA 4U00A 2EFHB 1RKBA 3GQBA 2C9YA 2ZI4A 3NG1A 4UJ3A 2PJZA 4GZMA 3BAFA 3X1XA 3TRFA 4B43A 1JR3D 5FOTA 2J0SA 5EXPA 3CRMA 2HLDD 1KY3A 3BORA 3LBHA 2FF7A 2RGGA 5JZVA 5AUPB 2RB4A 2WMNB 1ZVQA 2QGNA 3U6BA 4KFRA 3KKPA 2DCUA 3KXKA 2JLQA 3WBJA 1BS1A 1P9RA 3X1ZA 1E2EA 1KI6B 2C8VA 2CLDX 3DZ8A 5E95A 3ZIAD 3LA6A 3TR0A 2OZEA 2AD5A 5KU1A 2C5LA 4NPHA 1G3RA 2A5DA 5CLLA 4JYBA 2NTYC 2P3SA 1S9HA 1Z06A 1J70A 4ZDKA 2GJ9A 3FFAA 4FMCF 3IQXA 4CEHA 5AK0A 3SOPA 4ITRC 4PSVA 1DE0A 1XCMA 3PG5A 4ZKEA 4DCUA 3OF5A 4UQOA 5KNCA 4I1SA 4HDOB 4P0TA 3LO5A
chains in the Genus database with same CATH superfamily
1B76A 3BE5A 4P7FA 2JB9A 2H1OA 1C29B 1O97C 4AN1A 5AK3A 4E5UA 2QTGA 4G0PA 4HVCA 1RRFA 4O08A 4A0GA 1E79A 1WB4A 4ZP1A 2OHHA 4M1SA 1VM6A 1MW9X 1PL6A 1PS0A 1QH8A 2BF7A 2GPYA 4OMFG 4CMJA 1USVA 3K1AB 3USZA 1LJUA 3EY4A 3KB2A 5B12A 5C8XA 2H9IA 4H3SA 4CLOB 2C96A 4GGPA 5I6DA 4QZVA 2ZRLA 4ZK2A 4PGHA 1JXOA 1ZN9A 1DX4A 1PVOA 4ZEXA 1UWLA 3E5NA 4R6XA 4F9GA 3JR3A 4WY8A 1A98A 1CZNA 1T26A 3G0BA 1Z26A 3PXGA 2RSLA 2Q0QA 4WESB 4BCDA 3I45A 5E3HA 1RMYA 2B7LA 1KMMA 4ESVA 3E7DA 3FPKA 4B3IA 4MW9A 2ZZMA 3SU8A 3LGXA 1QH8B 1G5PA 1K98A 2H57A 4YAJA 3NNDA 2QRPA 2I3BA 3FSEA 2C5SA 3GK3A 2QL6A 2X15A 5GZ1A 4HQOA 4KSBA 1NM5C 3BOSA 3UT5A 2FZ4A 3BXEA 3VZDA 1HDCA 2GO1A 2QTNA 3NDIA 2WB2A 1ZRMA 3N2YA 1JR3A 3JQPA 2JFWA 4OQEA 1D4FA 4DNFA 3MXOA 1T10A 1UK6A 2HLDA 3DVAA 1THTA 3NBAA 4FNGA 2IH2A 1CUJA 2V4ZA 4YROA 3X43A 5B30A 4MW7A 4ILEA 3B60A 4IIGA 2V59A 1N6RA 1NI3A 1WZNA 3BRCA 4FLMA 2BKXA 3LT5A 2ZJBA 1V4VA 2P5YA 3OPYI 3PZRA 4KR2A 1GAQA 2YHBA 1VCNA 1IU9A 4AZVA 1DFIA 1MV8A 2JAWA 2MSEB 2B69A 3E4DA 1VB5A 1J09A 4RMNA 2C97A 5C3UA 2SICE 2R7MA 4KNWA 4R40A 3G49A 3MMNA 4IRXA 3F74A 4BWFB 5LWHA 1DG3A 2Q1UA 2E2WA 2HQSA 1H2RS 4H3KB 3WK4A 2HC9A 1YRLA 4HWTA 4F3TA 1T5SA 3NIFB 3GPLA 2ZYGA 3EXAA 1TQ2A 2C42A 5JZSA 1SMKA 3T6KA 4NSNA 1ATIA 3O3NB 1T13A 1TAGA 2WE7A 1MAUA 1XVIA 1NMEA 4WNAB 2NN3C 2QG9A 3HDJA 1ULBA 2J3EA 3MWEB 1FXWF 1C4KA 4IVQA 5DYIA 5BYJA 1EK0A 2ZBRA 3LA8A 1BVYF 3JW8A 3C6KA 3TXYA 5J63A 4ZV9A 4DNPA 2PQMA 5IDQA 1JVNA 4P4NA 2VXOA 1Q15A 8ABPA 1OZGA 2GAOA 1G0NA 3B7PA 4M8SA 2NZXA 3R3XA 3W1WA 3W5UA 1S02A 1T2DA 2DQ4A 2LKDA 1VCMA 2RIRA 3PD7A 3PFGA 2C0PA 2OP0A 4TWJA 3AEKB 1KHHA 3E5MA 4QNNA 1W47A 1M1ZA 1EVYA 5CM8B 5DYTA 4EFDA 1XNRB 2XR1A 4S24A 4WN9B 4X94A 2QKYA 3CJRA 4HLUA 1ZR2A 1A5SB 3AUFA 3P0FA 1PV2A 4PNPA 1EAMA 1P8JA 2CLIB 3JQ9A 2FEWB 2C2OA 4LXTA 1X3LA 4P7BA 1XMPA 1DUIA 2BM9A 4V0KA 1LX7A 5TVGA 5JXHA 3L2OB 1ACJA 3IESA 3A6DA 2XUGA 1W1UA 3KO8A 4L6AA 4PO1A 5I7WA 3DE0X 4AYXA 4EPRA 2PPLA 1L4BA 5F5LA 5C8DA 1FMJA 4LCEA 3FMVA 4MVJA 3IPRA 3W6UA 3STHA 3SYTA 1NLZA 1CVLA 1S2GA 3AR5A 3RNLA 2YL2A 3OP1A 2H3EA 5LZ7A 3WXMA 1FTQA 3V6MA 1B16A 5AVVA 3P96A 1Y3DE 2J3MA 2UYHA 2FZ5A 1GGFA 3G8BA 1X9GA 3I1FA 5GY7A 3X2EA 4GP9A 3L0ZA 5K0EA 1QFJA 3G13A 1W0KD 4NICA 3SSMA 3ZZUA 3RSCA 1B26A 3G2PA 2BY4A 3PFHA 4ZDWA 1HF3A 1NVGA 4JB8A 5LZ5A 2JLVA 5CCXA 4EGJA 2ZQ5A 4X65B 4O29A 4KLAA 1SVMA 2BH9A 1KJWA 2PUGA 3JSXA 1W581 1Y98A 2REQA 2CHGA 3HUEA 4G0YA 2L69A 2VJCA 4KUEA 4X1OA 3BRWA 3K5HA 3NHBA 1XA0A 3ANNA 1CULC 1DIRA 1LPPA 3A1DA 3R6WA 4M86A 5IARA 2WV9A 2EZ4A 4QGSA 2E4VA 4X91A 5AKJA 2O3RA 1L4FA 3P5BA 4BNWA 5IT0A 1K97A 4MRAA 2X14A 2BMFA 4UBJA 3TAHA 1WHTB 3HXMA 3ACDA 4JAVC 5H68A 1DKPA 2JFBA 4ZO9A 2Z0MA 3KLBA 3CMMA 5ETJA 4E14A 4RJLA 3FMGA 2XNKA 4YP9A 2I7DA 5HZMA 3IXLA 1S5PA 4Q7LA 1BFDA 2I4NA 2R66A 2HOQA 1ZUNA 4JLSA 1USWA 2PANA 1UMDB 3K4QA 3D4OA 4B47A 4DQ0A 5J5VA 3VJMA 1BFUA 2X4GA 2WSSD 4IEEA 2B8WA 3LC7O 5FWDA 3ONWA 2IA5A 2QM8A 3EBLA 3COZA 4MW2A 2WTMA 5G4KB 1Z9BA 3GUCA 3RLFA 3JQ8A 4C0HA 1I3OA 3TFWA 1T4DA 1A3CA 4D98A 3UWDA 1CUDA 1KBZA 3NIWA 3QUTA 4OA8A 5EHGA 3S8MA 1Q74A 4Y7DA 1RVDA 1U4SA 2VNJA 2DXIA 4G4SO 2A9VA 3G0IA 3KOWA 4YRQA 4F6LA 4OFZA 4WY5A 3H9BA 1Q17A 4UHKA 5K7SA 1NONA 3I73A 3JZAA 3MPUA 4NULA 5GIOE 5C5IA 2CCKA 3K6KA 1DRJA 3G6WA 1T3GA 3ZQUA 1KJZA 3KYIB 3C5VA 6NULA 5HRAA 3IIIA 3UB3A 2FPMA 1MKYA 1QK5A 4CZ2A 3DDWA 3IXQA 1WBJB 2H5LA 2OVBA 2RHLA 3A3PA 3QOXA 3KT0A 1GR1A 6YASA 1XRLA 1L8QA 1MX3A 1VLMA 2JFNA 2MWMA 3E22B 3ZHYA 1PJ4A 3QM1A 2FN9A 2Q46A 2HMAA 2I62A 2VF5X 3OT5A 2H6EA 2W8BA 1LKZA 5EEHA 1XXHA 3T38A 2P2DA 3F49S 1EZ1A 2HIMA 3JVUA 3MS4A 3OOSA 1U0OC 2L18A 5FNVF 3D7LA 1UBHS 4C1BA 4EY4A 5AKLA 1BHO1 3TZEA 2Z95A 2A86A 2X0NA 3BSSA 3OX4A 3KAPA 2CGEA 2Q4OA 3QQPA 1K4KA 2AD1A 4FFSA 4HMPA 3ETJA 2C4KA 2QZJA 4MGEA 4YT8A 1Z15A 4TLLB 5BWLA 1N3BA 3FAKA 3EUWA 1B2LA 4MWOA 5FTNA 1BCSA 1X3SA 3LT0A 4H27A 4JWKA 3GPIA 4MKZA 4Y9RA 5FUBA 1A2OA 1SCAA 1PYOA 1G4UR 4M1TA 4N8DA 5IAJA 3SY8A 2FU5C 1XELA 2W8BB 2W6JA 3WRYA 2A92A 1C0LA 2Q62A 3IEVA 5CRIA 1XXHB 4JBYA 4XFKA 5ALSA 4J3FA 5G1OA 2B36A 1WS6A 1HZZC 2ZIAA 1RRKA 4JBXA 1O9BA 1MUUA 1QTRA 4IV5A 1I1QB 1LW7A 1Y1LA 3ND9A 5A7HA 1UJCA 3RGWS 4UFPA 1A9TA 4JSYA 4QGGA 3H2JA 4CDRA 2LPMA 2Z1MA 5JS6A 1ZI8A 4YONB 3T7AA 2CDCA 3FCYA 4FDUA 1BCSB 2VJYA 3K8ZA 2GPWA 4GQBA 2NU8B 4EO9A 821PA 2IEZA 2KBEA 3CZRA 1DAIA 1SULA 2WSBA 3BREA 1RAGA 4MYUA 1PT8A 5K0LA 5BMOA 1W4BA 4X1IA 5FBLB 1J07A 5DASA 2CXOA 4F12A 3L92A 5D3QA 3H6KA 4YRFA 3GRRA 5KPDA 3FFWA 4AY6A 4DADA 5FR2A 2SKCA 4Q15A 5IK2A 4B3TB 4UFOA 4NBSA 5E4FA 3FRIA 3QKSB 1G20A 4F4IA 3LRPA 4PHTA 3RLIA 3RPEA 3EBOA 2ZZNA 2G7ZA 1EH5A 2GX6A 3Q12A 2HI0A 2EOAA 2WD7A 1X42A 5EJEA 4MUAA 4B45A 1P72A 1F4LA 1V2GA 1MNAA 4EG1A 2JVIA 1JFSA 1SC3A 1GSIA 2WPDA 1T2VA 1MDFA 2RHMA 3FA2A 4ND7A 4EW6A 4P82A 1P62B 3ICPA 4OYLA 3LBIA 5BSEA 3E9QA 5KNLA 4R2XA 3WAKA 1DZ3A 2ZUEA 5LVAA 4JP3A 5WRFA 2XVAA 3K4PA 1YCGA 3PFFA 4Z51A 1CDEA 4HAVA 3EWSA 2WJJA 4KK4A 1AV6A 1TJ3A 4R9NA 2BSAA 5ECWA 3NI2A 5AHOA 4F85A 4RQTA 4JI8B 1DAHA 3V8RA 1ZCBA 4RZUA 2XB9A 1QVAA 3LX6A 4PC2A 3ESCA 1AKRA 4TTPA 4WERA 1L4HA 5KOJB 3ZD7A 1MBZA 2DTEA 2IWRA 2V6BA 2VQ3A 2G77B 2JA2A 4OP2A 4NBWA 1SZCA 4X3OA 5MHTA 4ZV7A 2IHJA 1ZM2A 1X77A 2FQXA 3AY0A 5IUNC 2XQGA 1DDOA 3OE1A 5IBCA 2G9UA 1R0SA 3DVLA 3TJZA 5EHQA 4ZZ1A 5LQRA 1YK1A 4P0QB 1A9ZA 3UGKA 3KEGA 3H17A 1EWKA 5J40A 5DIZA 1ZD1A 3DO5A 3I39X 2RGAA 4FEGA 1CW2B 2X58A 3RVOA 3WC4A 4BNXA 1FU4A 1AUXA 1W6RA 2XMDA 3HFRA 3AHIA 4ZU1X 3UV7A 2R8YA 2JLSA 1RWQA 2NPOA 1RMQA 4E4YA 1FFDA 2BZSA 3K2EA 4L02A 2LCQA 1NATA 3NAZA 5LN1A 5HJ5A 1ENYA 1JG2A 3NGMA 3JQBC 3FZQA 1QGDA 1T34A 1YZVA 2WWHA 4RD0A 4V0MA 3X1YA 4TVSA 3A9UA 4KMOA 16PKA 4HQRA 1XAJA 3AT1A 4CETA 3K92A 3HI6A 4NR0A 4KAJA 5EE5B 3C5HA 2F00A 4BV8A 1O87A 5E2BA 4UNQA 5IZCA 3PNMA 4XZ3A 2X77A 1NYQA 4LVNA 2B5WA 4CFYA 4NESA 3H9CA 4X6YA 421PA 1RWOA 1U2EA 1JKJA 4NS4A 1FUIA 3ORSA 5AI9A 1U2DC 1GLVA 3ESRA 4C1NA 2O2CA 1CUSA 4K9KA 4W5QA 2JFZA 3RUIA 2AN4A 4UU8A 3PGJA 4JBGA 4Y2XA 3JAMA 2BMVA 1QYCA 2VJMA 2FWMX 3ZX4A 5TGTA 2EP5A 3A25A 2WU4A 2ZW9A 3HA3A 4KMRA 1PR9A 2JKYA 5A9SA 4IDNA 1VPWA 1V4NA 4FFLA 2Y76A 4DA6A 4L9RA 2HK6A 4DSZA 1PV4A 1Z25A 2CHVA 4OB6A 3WWPA 4NCBA 5KTMA 4AQ7A 2I78A 3C85A 4UHBA 2ZSAA 4OL9A 4AJIA 2PTGA 4BZZA 1VLHA 4ZYVA 3VPSA 4GMGA 3V8QA 3THYB 2XJ4A 3IAS1 1O6BA 2XOXA 3N7AA 5LP6B 1ZWLA 4RHCA 2VZLA 2VJMB 3MZ0A 2R751 5DXFA 4DM7A 1OJ7A 3BUSA 2B21A 1C14A 4MTCA 2VIIA 5EP2A 4BO1A 2ZBQA 2I9PA 4E21A 3VVCA 2CJXA 4A27A 5T57A 2C3PA 4A0FA 4YT4A 5IKPA 4BFVA 2PX8A 4RIFA 3PHBE 5LR6A 4QEZA 3E8MA 5KAPA 2GM9A 2VT6A 3C7CB 3Q72A 4BJ3A 1FYEA 1Z35A 4C2AA 3ETNA 4PIPA 5HUHA 4GRAA 4CN8A 5EMJA 1W36C 2B8TA 4RNCA 5IYZF 1NQOA 2IU0A 3ZW8A 2GZDA 2ZBGA 3KQWA 4HQLA 3TBKA 3V8BA 5FP0A 1DC6A 1XD9A 1Z17A 2B3DA 3X2FA 2PKEA 1QCZA 2N9UA 4CYMA 5JJCA 4I8XA 4HXFB 1Q5PA 5F77A 1RIFA 3M2TA 1JT2A 3HKDA 3FGOA 4K9RA 3TXAA 3V7FA 2P3QA 2BOVA 3KIPA 4NG4A 4KREA 2AKAB 2ZBEA 2VOEA 4LKOA 1K9SA 4G84A 4EBBA 4CL8A 3W4KA 4WLOA 3T4UA 1E66A 1SBCA 2W83A 1XTKA 4PLVA 4DLPA 1AGRA 1GVHA 1MABB 1PT5A 2KQUA 1UXHA 2WF8A 4WZZA 3C4VA 5K20A 1LWNA 2IYOA 1B0AA 4KAFA 3HN2A 2EJCA 2ONKA 2JCVA 3HVKA 1I0IA 4DJEC 3VSCA 3AP1A 1SHTX 2G9NA 4BLTA 1AO0A 2R84A 3FW1A 3OZUA 1P5ZB 4DLYA 2JDID 4G24A 1ZGHA 2GEFA 3P9CA 5LMCA 2CL5A 3Q10A 1KYQA 1NXWA 2IEIA 3BN3A 4L4SA 3NDPA 3O4VA 4EZIA 5BR1A 4V3CA 2D2IA 4RH0A 5T3UA 3VC1A 1MJGA 5HQ3B 3HNPA 1K2VN 3KFLA 3L6DA 1AZLA 1TCCA 2FMFA 1H85A 4I36A 4IJVA 4IVRA 1J8MF 4L5YA 4JP2A 4LA4A 1MORA 4MEBA 4RH1A 4KPFC 2P0YA 4PYJA 4ZWNA 3OPYA 1JR6A 2ODAA 2XTZA 1XHFA 4WCFA 4FONA 4B3CA 3FIUA 2EKLA 3BFJA 3DB2A 3JATA 5AJYA 1WCIA 3N5KA 5CEFA 1ZMRA 3BE4A 4JQYA 2FGJA 4B85A 4LDRA 4DC0A 4MTLA 1TYEB 3D8BA 3D4LA 1JDZA 2YWEA 2IIPA 5L3RA 1L1FA 3ZNPA 4B4UA 3ZG6A 3WLLA 1NE7A 3CRZA 4Q7MB 2PBLA 4HRAA 4DLAA 4Z6KA 1D1TA 2XZTA 1Z7WA 5SZIA 2O8DA 4UQLA 3W04A 5KKNB 4P9NA 2IP2A 3OZBA 1SXJE 1RTTA 3OPYB 2N1BA 3L49A 4WCFB 1OZHA 3UAYA 4CR6A 13PKA 1K6MA 1N3LA 4MI9A 1V11B 1UBTS 1JHQA 2VH5R 3OFJA 1CY4A 4LXXA 1T1SA 2YQZA 2GD1O 2BMWA 2Q9AA 2IEGA 3PGKA 1ESDA 2Q2OA 4NMMA 4W1RA 4BMXA 3N39C 5LBIA 4NAVA 3VTZA 1IONA 3BRSA 5JUWA 3MJFA 3JD1A 1JGTA 3QK7A 5ALKA 3OJEA 4UBLA 2ZRCA 3H8SA 4JXJA 3EPKA 1XPRA 2GA9A 3KUCA 1GITA 1FFAA 4I55F 5HMLA 4LZNA 3KUKA 4RFLA 4MUJA 4EF4A 1GA4A 1WHSB 5CA0A 3GOQA 2YHUA 4RLSA 3A1TA 3JQRA 3A4VA 3PXUA 5JNTA 1Z2OX 3O4RA 4ZQFA 1F60A 4JT4A 1ID1A 2H2GA 4CCYA 5CFMA 4OX9Y 1SU8A 1DJQA 2I22A 3OY2A 5KYGA 2VJQA 3T9DA 2XNSA 1EG7A 1DKRA 2CNWD 4FSDA 1KMCA 3SEZA 4RQBA 1I94B 1QM5A 2XB4A 3F97A 4YRAA 3P8ZA 1TZMA 3DFZA 4IL5A 1L7QA 1F2TB 3A10A 3QMMA 4HH1A 2ZPAA 4PYIA 1QRRA 2NZYA 3N2KA 4LGCA 1EJBA 4RIGA 2ZWPA 3F7NA 5CA0B 2JZOA 4BB9A 3A3OA 3OY7A 1CBUA 1VLQA 2WZQA 3H3FA 2XTAA 3NVDA 4CG2A 1Q22A 1XHLA 3OLVA 1ZNWA 2C5BA 4FZVA 2HZ7A 4CCYB 5JNRA 2VPYA 1O94D 5BUSA 1N6NA 4EGQA 2R97A 3ROXA 1PKXA 2FE1A 3ZGYA 1T9AA 3WLPA 2O6LA 5CH8A 4HB3A 3VNBA 3PENA 1Y1QA 1IUKA 1N2IA 4CLHA 4DSAA 3MB5A 1SRQA 2IUYA 5FULA 1OILA 1W94A 3INTA 1J23A 2IYPA 4LHXA 4M1EA 4NBKA 1JJ7A 4BE7B 1NI4A 2P27A 2TRSB 3LI2A 2PLFA 4K6GA 4MVJM 5L7WA 4JXZA 4Y6OA 2BM8A 3DZJA 5F2OA 2QY6A 3CZ9A 4K6OA 3KSBC 2PL1A 3N07A 3PNLA 2F1KA 3IMEA 2B99A 1DTWA 1KZGB 3DDNA 3LLMA 4R84A 1PR2A 2XV1A 2Y68A 1IHXA 1MX5A 3F9RA 1Q0TA 2P7IA 3FPHA 4GZ3A 3MOGA 1J0CA 1C1XA 1QX4A 2IZ1A 2R7LA 2VSQA 3L0YA 5HS4A 4J1SA 1DUVG 2G09A 1PS8A 1NI4B 2D0PB 4GG1A 4LC1A 3VNUA 2I67A 4ZI7A 3V8MA 1XD2B 3G85A 3UUWA 4U1RA 1YR1A 4KDFA 4PW0A 2AWOA 4REQA 2FRXA 1ODSA 2RARA 1KFBB 5TR9A 1GTL1 1USUA 2JI7A 4KLRA 4UCXA 4XIFA 2QSZA 1KOGA 1G3QA 2HO4A 3QFHA 4J7UA 4BO7A 5ILOA 1SCDA 2AQHA 2ZDGA 1C1XB 2B82A 3OAAD 4ZZ2A 4F5ZA 3EDQA 2R8PA 3C48A 3DMHA 2IHNA 1Z3IX 4FZRA 4X64B 3KETA 1XR3A 1SIWA 2XUAA 3S1AA 3Q9NA 5CT6A 3ZWBA 5IDXA 1U04A 2F1JA 3DW1X 4ZI7B 1QBKC 1T1RA 2ZIWB 1K7EB 1MIOA 3ZZTA 4REQB 4DCGA 3ZXSA 1JPNA 2E5FA 3DE5X 5KZMB 4I4LA 2PZ8A 2P5UA 2PZGA 3L0DA 1HDEA 4Q82A 2HXSA 2XVMA 2AGVA 4L8GA 4LHSA 4UHJA 1TU4A 1E1RD 1YB5A 3DAOA 4JK3A 1JKFA 3AMVA 5CH5A 3F90A 3H4IA 3CT4A 1WVIA 5HHTA 2H8KA 3QVGA 1I13A 4ZVVA 5KVAA 4FDTA 1VL0A 1TD1A 5DYYA 1R6VA 1U7XA 3S1AB 1DRKA 2AV6A 2F64A 3A37A 3UPDA 4DSTA 5JVDF 3EPJA 4NATA 3OU7A 1X0VA 4WK0B 4HLUC 1SB9A 5AOAA 1CUFA 5LP1A 4AY2A 5DGXA 2AHOA 1F6BA 1AMNA 4DUGA 2JIZA 4GSLA 4HH4A 1SVNA 3BCRA 1TD9A 1UDRA 1XCJA 2YINC 3I64A 1JG7A 3EWIA 2O0KA 1TA4A 1IZ0A 3QVGB 4WNYA 2B94A 3SN6A 1YR6A 1G5QA 2RGDA 4B0PA 5KHLB 1VCOA 3IEPA 2FPRA 4M37A 2I91A 2VPIA 4UFNA 1EUCA 3AZPA 4K6MA 4O2RA 3NXKA 5FI5A 4AB1A 2FRVA 5J2TA 4ALNA 1UKYA 2PIAA 1DRWA 1T2FA 2AKYA 2WOOA 1ZDMA 3ELWA 4XGRA 2PKRA 5G0SA 2ANCA 3NONA 4R69A 3QPVA 4UAGA 3HTXA 4G9BA 2FMIA 4CMBA 1KI1A 5IN5A 4H08A 1N2CA 4WACA 4B4VA 3NHPA 4EUNA 1I2DA 4Z2AA 4BC1A 3EIHA 1V45E 3HLKA 3N3AC 4E3ZA 1EUCB 2HQRA 1ML3A 1P0MA 2TECE 1H8HA 4Y0AA 3SX0A 4JBNA 1YKGA 1CZUA 3BMNB 3JQEA 2YC2C 5J2TB 3ORFA 1EB8A 4H77A 4KDCA 4GP7A 1U2RA 2UDPA 4CT0A 3ZI4A 3BMOA 3LQKA 2OD2A 3OE4A 4WLFA 4MP8A 4HL6A 2EFYA 2YC4C 2GXSA 2YJTD 4YMUA 3R7BA 2ARKA 4DDKA 1LUAA 4PYNA 1Y6JA 5DGTA 4E6EA 4R2HA 3F7MA 5F7OA 5JD5A 1LPAB 1QP7A 3MK31 3QIAA 1DXYA 1UJ2A 3C97A 3DKVA 2J7PA 2HA4A 3P9YA 5C7YA 3L8CA 5F1KA 1GNVA 2JG3A 1ZGCA 1JRLA 3F6YA 3WYCA 3VU9B 2CXSA 3S4YA 2VNIA 2KX7A 3SC6A 3ETCA 2FEXA 1BYIA 1Q83A 1IY9A 3BMOB 1FLDA 2UUPA 2QM0A 3OURA 3L4SO 5EIOA 3VM6A 4CL0A 1CNEA 2HSZA 3NKVA 1TVEA 4BPRA 3PXAA 3JARB 3GJ5A 1BDMA 4MPDA 4HS9A 5HWSA 3WIUA 3B2NA 4IXMA 1KDVA 2V1XA 4A2CA 4ZGBA 1FYDA 1YHNA 3BL6A 3LQ2A 4HQNA 1P4RA 4N8SA 3A1NA 2I54A 3O4FA 1WMEA 1TYAE 3IUEA 1SY7A 1P1HA 5TQVA 5A0TA 1L3CA 1EFRD 1BMTA 1H2WA 5DLYA 3DLAA 3WIEA 3NJ8A 4A8TA 3CLUC 4PN7A 4J75A 5FADA 4ESEA 2CFIA 4QUAA 3CZMA 2GAFA 1CUWA 2D74A 3AFMA 3O93A 4JDPA 5IUKC 5CDUA 3DV0A 1C1HA 2IDJA 3IP6A 1W48A 3K5IA 4ID3A 4UMVA 4XPIB 1KORA 4L27A 5CT9A 5BSWA 1SCBA 3R3ZA 2D0DA 5J5AA 5JMPA 5I4IA 1KMNA 1X1QA 2V65A 2VJDA 3K70B 2FEPA 2AVDA 3F6EX 3RKSA 2FW1A 1JF8A 2DETA 4C7XA 3TDNA 1RZRA 2J8ZA 3IPXA 3UOGA 4B6RA 2Q3EA 2GXAA 2CLMB 3U3ZA 3QFCA 5AI0A 5FV4A 5K0GA 3NT5A 4LFAB 4OGWA 4XOUA 3NEYA 3BL5A 4V0RA 4DMKA 5HKOA 4X24A 1AF4A 2RCYA 2X13A 3DV0B 5HA5A 5D1NA 5FB3A 5BW6B 2F9LA 4U9IS 2QMQA 3KELA 4M1MA 5DN6A 1AU9A 3T1VA 3WV5A 3P2EA 3EA4A 3AF2A 4M4SA 5HTKA 4AF6A 3R7WB 3U3XA 4PO9A 2X42A 3AI1A 3B52X 3JU3A 1EX7A 4XD7D 3K9FC 2W2VA 3FTCA 5JPCA 4R1QA 4OK3A 3HVRA 4E5KA 2QNBA 1DQNA 5I9MA 4BQRA 2ENUA 5I47A 1QB8A 4RKWA 4MMXB 1KP2A 1N8SA 1N5KA 4FW8A 3FLEA 1S2IA 2Q6OA 1LNQA 1YJ8A 2BL4A 3AI2A 5GVRA 1AKMA 4D3DA 2ZJ6A 4PSUA 1A5AB 1KI2A 2Q3DA 3D4IA 1A5ZA 1BWQA 2JBAA 3GLVA 4P34A 1UFKA 4W7HA 4CM9A 4LF7B 2XHEA 3QWBA 3HU1A 1M6YA 4S35A 1WSAA 5FBWB 2RI6A 4HOYA 1RFLA 5LOVA 2DKFA 4A16A 3QVXA 1POXA 4RX1A 4DJ5X 2WMOB 1ZVVA 1SC9A 3QGMA 5BSTA 3WGVA 1NGSA 2HA2A 4E70A 3LUCA 3QFSA 1BYUA 1BOFA 2FLWA 2WHPB 3CLVA 3MFQA 4QBKA 4QX6A 5ALDA 2FH5B 5FWAA 3TQRA 4R41A 5E0OA 3SK0A 4LV8B 3VH2A 1Z7YA 3NHKA 3QKUA 1QH1A 2BELA 3OUTA 2OCIA 2R5WA 3A05A 4ARZB 2G1JA 3MCAA 2UXDB 2A94A 4JYMA 2D62A 1YS1X 1KYVA 4OGGA 3A4IA 4B3GA 1V0JA 4XYEA 1DFHA 2IYXA 5E0KB 1V71A 1X1BA 2JFQA 4EOGA 4ZAWA 3KQKA 1BG6A 3A6JA 3KJFA 4US2R 3R3YA 3PR2B 5G3YA 4Q37A 2G72A 1RS0A 2VDOB 4ZOBA 4H16A 4KUHA 4MUKA 5LQSA 3TOVA 5CB4A 1YHZA 1H6CA 1QH1B 4Q66C 2WSMA 3FRHA 2DC1A 1RAAA 4HFMA 5T64A 4ZIRA 1JPUA 1C7QA 5IJAA 2YNMD 2F3TA 3BKWA 4P53A 4L5AA 4LK2A 3ZU3A 2EERA 2P11A 5JTUA 5L53A 5DX8A 1C8LA 2QQFA 3K2QA 1UBEA 4F4JA 2HSEA 5K0NA 1K7YA 5T6MA 2FZCA 2RHRA 5IJ9A 3VTAA 1LNZA 1YIOA 1ZLXA 4FBGA 7REQB 2O5VA 1E98A 1JAXA 2I99A 3ANMA 4G81A 4HBZA 2X9GA 3DVRX 1GHTA 1Y9AA 2M1ZA 1YZGA 3W0LB 4DJTA 4ZIRB 4R1LA 4AM8A 1IN1A 4TZ6A 2W98A 4WGFA 4KPYA 2W4QA 5I4KA 5BY2A 2WKQA 2C31A 1RQXA 1BZYA 3NKLA 5AVJA 2P2CA 5LU9A 1XB2A 4NMXB 3I5MA 1GCOA 4GGOA 4FOLA 1DLIA 2IXBA 3BEDA 1P2BA 4GYKA 1SXIA 3ZW9A 2ZPUA 4AZ3A 3CKKA 2XYHA 1K8RA 4PLZA 2K5UA 5TPWB 1V39A 1G21E 4LY9A 1JEJA 5EIBC 3W8EA 1NA5A 1BVHA 2G5GX 5K0BA 3PF8A 1GL3A 4AN4A 2QDKA 4KITB 5IZCC 2C7BA 4H1WA 4UOEA 1DNPA 3K7EA 2YS6A 2ECFA 3NGXA 1QTNA 2VQ6A 3OQPA 3KT6A 4S1NA 2YFQA 1K68A 1XCOA 4FGSA 4D57A 3FR7A 4KQ2A 3KD2A 1TYDE 1JFFA 2X0JA 3PF9A 1SG6A 1FX1A 5KJ1A 2B8NA 4AZ3B 2H51A 3GAFA 1RXEA 4B3XA 4C7VA 1RWKA 1MJGM 3DT9A 3UOWA 2NM0A 2JLBA 4TS1A 3U4GA 4BNYA 4X6XA 2QYTA 3FBTA 5LP6C 3EGEA 4EG5A 1ZZEA 5EIBD 1B0UA 1LPMA 1R4NA 1HTTA 1X15A 2PEZA 3AF6A 2GJ4A 4ZQGA 1EVIA 1RMTA 4YDQA 2VHEA 5DDIP 2P2YA 3QVWA 1Z0IA 4JKIA 4L08A 4O2AA 5CU7A 4JLWA 2P4UA 1AJEA 2HHCA 2Q21A 3Q3CA 2MINA 4L5JA 5A4AA 1ZA2A 3C70A 4JLJA 2FJUA 2P6MA 1RBMA 1Z8FA 2QGZA 3TLGA 3VBEA 3AM1A 2A9KA 3KM0A 3BXZA 2XF2A 1CHNA 2WFLA 4IFBA 4D4LA 1R4NB 5HIJA 1LDGA 3QBTA 3T5BA 5JY6A 1HX7A 1PKEA 4I50B 2IVFA 2V74B 3QYPA 1KYYA 4R0VA 1JU4A 4ZVUA 1DQRA 2W0SA 2W0MA 2OV6A 5DOZA 2ERXA 1VGVA 2OA0A 1NMQA 3SQLA 3T94A 2I55A 1UKZA 2RHHA 4MVJP 4OQPA 2MINB 3RJ9A 4A36A 3QE2A 5BURA 5EQTA 3D1JA 3TLGB 1W29A 2E48A 4Z4HA 2OAP1 2VHWA 1U0BB 2IH5A 1RE0A 1VI2A 2OL4A 3UFBA 3U16A 4TYNA 2WFLB 4TKVB 5GGYA 2EX0A 3GDFA 5KQPA 1E1NA 2QRUA 1YU9A 3M2PA 4IIJA 1MPXA 2D7CA 3R4VA 3GUHA 5K6AA 3AQ4A 4LZJA 2GWRA 5KYKA 3DP9A 1JFRA 4AG6A 2YMPA 4ZI2A 3FLAA 1DUSA 1HH4A 3IT1A 1E4YA 3RNOA 5KINB 4KKXB 1PW5A 2QT1A 1D8TA 4HB0A 2P3OA 3TL2A 3VJRA 2HMUA 5CX4A 5JH7A 3C1AA 2IV7A 2ODBA 3GFTA 3OPVA 1U3CA 3RSSA 3OU6A 4UKDA 1W9HA 1I1OA 1Y6RA 1MJNA 3H83A 1OAOC 3EVEA 1VPDA 2JIDA 4JLBA 3N28A 3LPCA 1OX5A 2QPAA 4IIJB 2PPVA 4PU0A 1ULUA 1H94A 1KVRA 3C8DA 4FNAA 4URFA 3G2KA 3K6SA 1Y5IA 3VR4A 3G2JA 1O95D 3UXMA 2GAJA 2R8XA 3HCFA 4UZFA 1AMUA 1RYYA 1Y3CE 1ZUIA 2D54A 4LG1A 3KOMA 3V32A 1HT0A 2IITA 2FWNA 2Z5FA 2DFTA 3F78A 2XBLA 5JH7B 1CZOA 1I7LA 3WLKX 3FDXA 1YACA 1K3TA 2NXNA 2ZUDA 2OB1A 4I9HA 3EAQA 3ESQA 4WCFC 1KXZA 4BTEA 1C0PA 2JCXA 3LVRE 4UJ5A 5KJFA 5HPYB 1R3UA 2FSPA 1NF3A 3TVTA 2AA3A 3DMNA 1GQQA 5HJ7A 2UUBB 4FSHA 4LHVA 1GFSA 1PRYA 3I83A 1W5AA 3WI7A 4RXTA 2FOIA 1CNFA 3Q0EA 2QLLA 3H7IA 3L18A 1QR6A 4UU0A 3SKVA 2V6FA 5BYBA 3R5TA 4J16A 5T4HA 3A3KA 2H18A 3IQZA 3PPWA 5EKSA 3RJTA 1WE2A 4HO1X 3UBTA 4EMSA 3VYTB 3URMA 2CFSA 1GQRA 2XRYA 3N2IA 1TQ8A 2NU8A 4DQXA 4ENQA 2E55A 1NU8A 1NN5A 3D8SA 3F5FA 1TTPB 3A1WA 3TQOA 3VR1A 1RJ9A 3OUUA 1V41E 1QGYA 1KZ6A 3W2IA 1OA0A 3FVQA 4R1OA 4RPGA 1BE1A 4WFQA 3GRCA 4YDSA 1FOEB 3RTEA 3OJCA 1BDHA 1FNMA 1V1RB 1RJDA 3BQ9A 4LCJA 5ILQA 4TYYA 2C54A 5L3SA 2D7DA 1L8LA 2E21A 3P52A 2Q6IA 1ZI9A 5EUMA 4BQEA 3ADBA 2FUEA 5EXXA 4ZYTA 3IIJA 3QMPA 3H0KA 5DGCA 2C99A 1SQFA 3UK6A 3ZOKA 3OI7A 3AVVA 4DHEA 3VHQA 1WKBA 2VP6A 2GB4A 3OTIA 4D92A 2D5BA 5EJ7A 5B2ZA 5KVSA 3V1LA 5F2EA 4L7QA 1Z56C 3EPLA 3KFXA 1EHYA 1RC0A 4MLZA 2E4ZA 1QGOA 1WXHA 4EVSA 5L3SB 1YQDA 3LBFA 2P9HA 4NOMA 1WUTA 3LV8A 3RYCA 4AG3A 1EDOA 1XEXA 2XNDD 3I9FA 1HFWA 2AQIA 1YRYE 4TZTA 4ON9A 1EGVB 4EHJA 1IMJA 3LZCA 4D3FA 4E13A 3UKJA 5H16A 4O3MA 2LIPA 2DPYA 2D4HA 2DH5A 2PQ2A 5EXDA 3RM3A 4LRSB 1FRFS 1KQFA 3OCXA 5CXSA 2I4IA 3R9IA 1E60A 3TDMA 4HYEA 4QUKA 2IHVA 2X1LA 3BH6A 1X13A 3OZIA 4GC5A 1JS1X 2L42A 2RMKA 1GTJ1 1IATA 1RD4A 4PG7A 4UVHA 4C06A 4EJSA 2BGGA 4R71A 1AZSC 1E59A 4AD8A 3OQ6A 4GAEA 3KQYA 2HY7A 3RYCB 1RRVA 1KI7A 1XEXB 5CH3A 4ZJUA 1JSLA 1VBNA 3G1WA 1IE3A 1K6EA 4ZYZA 2OG2A 4GI5A 5BQOA 3LC2O 4I8IA 4QSHA 4DCSA 1H2XA 3WGJA 4ZDJA 1P1CA 3Q9UA 1O6FA 1JMYA 3EVGA 1XZPA 3S6JA 4EATA 1RZUA 4BFXA 1K08A 4CQNA 3KB8A 3QLUA 2ZRQA 4X66B 4TLEA 1TF7A 3UWSA 4BRZA 4PLYA 4EJSB 5B7QA 4TKMA 3QEMB 4ROSA 2G63A 4M0LA 1EB9A 3RROA 4CMIB 2VQFB 1UJ5A 1Z2DA 1MQ8B 3KSZO 1SPXA 1YQWA 3W9YA 1D2NA 1T8TA 2DFVA 2FTKE 2YTZA 3NLLA 4H9GA 2GGSA 1QORA 3WWYA 4DSUA 4GEKA 3PDCA 2C8KA 1E7QA 2HCBA 4Y2GA 4CLEA 3UMJA 3U44A 1L7NA 1EDBA 1RXSA 3KQTA 5FKJA 1X2BA 5GOTA 3UF0A 3QHPA 2ECOA 3L6OO 3O84A 1L4YA 2POCA 1CC1S 1X7XA 2W8ZA 4URWR 2RKWA 1YHYA 1OR8A 3MLEA 5L45A 5GMOA 2FN7A 2BGMA 3EC2A 1ISGA 3O3MB 3UG7A 3AHEA 3JXEA 4AJLA 4D9BA 3KKQA 3E1KA 2QP3A 3F46A 3H1AA 2C57A 1RPJA 3SGLA 4FCTA 1YVEI 1RNLA 4D5GA 3ISJA 1AA9A 3LQ4A 3SX4A 1T6ZA 3JQCA 4Z4FA 2ZR7A 2EKDA 4K05A 1U9ZA 2B30A 1QOQB 4WT7A 3OE7A 3ZUGA 4TKLA 1R5JA 2E0IA 4HDAA 5FPSA 4YYZA 2GDJA 1VMEA 5BOSA 5HW0A 1U8AA 3EG5A 3KZ1E 4E22A 4EG0A 2PUAA 1GKUB 3X1DA 2IH4A 2PIDA 2OGTA 1U3TA 3EXHA 2CD9A 2NZUG 1HI9A 3HZZA 3ND8A 4KXNA