3W9YA

Crystal structure of the human dlg1 guanylate kinase domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
175
Chain Sequence
NYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the guanylate kinase domain from discs large homolog 1 (DLG1/SAP97)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Disks large homolog 1
total genus 52
structure length 175
sequence length 193
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3w9yA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w9yA01
4EFNA 1YRAA 3TQFA 2R62A 2JLQA 1PV4A 3KKMA 3KTAB 2JLVA 3FFAA 1GKYA 3U7GA 1Z0IA 3LX5A 4URVR 5JJIA 4NPHA 4H9GA 4BFUA 1XRJA 4EKDA 3GJ6A 4Q19A 3PFIA 4TL8A 4BFSA 1C9KA 3A4MA 5KSYA 3ZQJA 1ZD8A 2D06A 3UPUA 4Q1EA 2VTKA 3OIWA 2C77A 2J0VA 2QZ4A 1WXQA 3FB4A 1BMFD 3RVBA 3SJZA 2DB3A 4TYPA 2ZETA 5DLQC 5H70A 1VHTA 2PT7A 4Q47A 5GJVC 3VKGA 5F3WB 5JWRA 2IXGA 1CJVC 3AF3A 4BECA 4F91B 3BFKA 1HY3A 2ZS9A 1GKIA 3KXIA 4IJMA 2QSYA 2CVHA 3QKUA 1VIYA 3GPLA 1IN7A 1NKTA 2CMKA 1CU1A 2VHCA 4E09A 4QJ5A 3AP3A 5EXTA 3EPKA 2BEJA 4URZR 2D3WA 1VDZA 3AF1A 1KO5A 1XD9A 5AK0A 3F3YA 4HAYA 5TY0A 2IF2A 3UK6A 4IEIA 5IRCD 1XTKA 2PJRA 3ZD6A 2YNMA 4IXMA 4O3MA 4FMCF 4BZXA 5E95A 3SYNA 3RS7A 5JRJA 1ZP6A 4HLDA 1CKEA 2FH5B 1E9DA 4A2QA 1RRFA 3FKSD 4RKEA 1V5WA 1UKVY 5JBQA 1S9DA 3AP2A 3U5ZB 3KFXA 1Q1EA 4NYMQ 3K0SA 2OFOA 1OHHD 1IBRA 3D7MA 3FKSA 5FTJA 1OH5A 5UKDA 2B7BA 3PQCA 3RLFA 2WWFA 3LD9A 3A36A 4G0NA 4RCYA 4V0OA 3WNBA 1AQYA 2HEIA 3BGWA 4P0TA 5GVSA 3BJIC 2DYKA 3B82A 3K70B 2FA9A 1E99A 1PUIA 3AGPA 4NCKA 4QL3A 1GDDA 2GJ9A 2O0JA 3B6EA 3PUZA 4KITB 2ZRHA 3QBVA 3QY0A 5EZ6B 2AD5A 1J90A 3CF2A 1HA3A 1VTKA 1G19A 2F1HA 3THWA 3B9PA 2WKQA 1L7VC 3UWOA 5G3YA 4LWZA 5AUOB 1OFUX 4ZIRB 1UPTA 3IKJA 3TMKA 2R65A 1IQPA 2VF8A 3NC1C 2RGEA 1HEIA 3BH7A 4F92B 1XEFA 3B1YA 1DPFA 1UBEA 1UM8A 2QM7A 4HB0A 4AKEA 3SDZA 2J7KA 3O8DA 5GJWC 2HLDD 4GL2A 3NKVA 2C03A 3FE2A 3AGQA 2QN6A 5JI2E 1ONBA 1P3JA 3BBPA 5BYJA 3TE6A 4FWTA 3B5JA 4GPTA 5B57C 2ZSDA 3TRFA 3AVTA 4WOPA 3SJBA 4RZ3A 3TKLA 3BE4A 1VCMA 2ZR0A 3FMFA 3LXXA 3QOFA 3I72A 4ZKEA 4R2IA 3VR3A 1NN3A 4AKIA 2JJ1D 5CLQA 3K0FB 2BV3A 2FFHA 1Q20A 4X8LA 1R0YA 1E2LA 1M8PA 1T9HA 2YINC 3A1UA 2PMDA 3GJ8A 4Q9IA 1OH6A 2R2AA 3U3KA 2QMEA 2F1IA 2ORWA 3E70C 1XMJA 1KOFA 5FTKA 3CNOA 3NIBA 5C46F 4HDOB 1Y3AA 3PXGA 4DLRA 5J40A 3GMTA 1OB5A 3BD9A 4LHYA 2REOA 3D8BA 1KZGB 2ZJAA 3ZS8A 1SKYB 2JLRA 1G21E 1LW7A 1P2UA 2IL1A 3PUWA 2WKPA 1OF1A 1T0JB 4CEIA 2AX4A 5JEEA 1II0A 3GJ5A 4JJKA 5IT5A 2ZTSA 4OHVA 3CPEA 4B43A 5CK4A 5D3QA 5CDFA 1CR0A 1L2TA 2VSOA 1ZM2A 1KK0A 4DC9A 1DO0A 2BM0A 1VMAA 4P31A 4I1SA 5JCPA 1SZPA 1OFHA 4PHGA 2CNWA 3B78A 4BQSA 1MKYA 3AB3A 2VBCA 4M9SA 1I4LD 1J2JA 3AF4A 4B6EA 5L3SB 3KQUA 1G6OA 4ARZB 2ZREA 5JMTA 2PX3A 1D9ZA 2CNWD 1II9A 3PEVA 3WXMA 4ACAA 5FUXA 1W36B 4CF7A 1MOZA 3MFYA 1GM5A 4ASUD 4GDFA 4QNMA 4B35A 4B32A 4HUTA 1SVKA 4OHZA 1NIJA 3A1TA 3LV8A 4GI7A 1SXJD 3FTQA 1QVAA 2RHDA 1Q12A 3JVVA 1EFHA 1TMKA 3FVQA 2JLYA 1S3GA 4Q9JA 1J70A 4PZZA 4CT4B 3V00A 4DT1B 2X19A 2XB2A 1FP7A 2IYTA 2J0UB 1E1RA 4HUQB 5AJWA 1ZD1A 1S9HA 2QPOA 2VP2A 1DAKA 3C41J 5HPYB 3MCAA 5EUQB 4JIMA 3W34A 1OXSC 3K53A 3KKQA 1VCNA 4HAZA 3THXB 2ZIAA 4HLUC 3REFA 4DDUA 1Z0JA 1CXZA 2N1BA 1ELOA 3HU1A 2ZVPX 5CIQA 3TVTA 5FTMA 1KO7A 1Q22A 2FPLA 2ZQ5A 5EUMA 2YOFA 5K8TA 3P4YA 4K81B 3OZXA 2V55B 4AWXA 2ZI3A 2Q9CA 1MO3A 2GETA 4DHEA 2XZPA 3K0EA 4IKEA 3CWZA 3LXRA 3V4FA 3OIVA 4UQOA 4UNPA 4HI0E 3MUFA 3T35A 4YQFA 2GBLC 2J0UA 4Y0VA 3AF2A 2X1VA 4EDHA 2FSHA 2AN9A 1XMVA 2EFHB 3QI2A 3I8SA 4MKGA 4TT3D 3KKOA 5EXSA 4CIDA 4HB3A 2RGDA 1YE8A 4AYXA 1VIAA 4NYJR 1QF9A 4DEYA 2B8WA 1P6XA 4LJ9A 3SBEA 1EX6A 2RGAA 1EFTA 2JA1A 5L3QB 5BWMA 1FTNA 4LBYA 4Z51A 1YZUA 1IOZA 1TUEA 3AUYA 3P4XA 3PR1A 1E9BA 2E9SA 3X1XA 4B75A 2DFLA 3KX2A 4RJLA 2GJKA 2GXSA 4Q21A 2JIZD 2A5FA 2W6JD 4RVCA 4BEBA 2PCJA 4W5WA 2IYZA 1TQDA 1OYYA 3LW7A 4V0MA 4XVQA 3ADBA 4BWYA 5IDVA 3UMRA 5SZKB 3RWOA 3K70C 1E6CA 3QF7A 2YWEA 2JIZA 3LW8A 3I92A 2ZI7A 3MGCA 2OSBA 4RZ2A 3VU9A 4EJSA 3M1IA 5KUTA 4M0LA 1CEEA 4EQ6B 1J8MF 2YYZA 3L0OA 2ZJBA 4HZUA 1QZXA 1PLLA 2CXXA 5FL3A 5B30A 3QKRB 3T06B 3VQTA 3QJYA 2Q9BA 3D6TB 1M7HA 1FMJA 1T3HA 3OE7A 2BMDA 3NWJA 3AVWA 2EFGA 2IXEA 1ZAKA 4DSUA 2OFXA 4BE7B 4LRWA 5BN3A 3R8FA 2O8DA 4B74A 1DO2A 4TMTA 5SZJA 2BOVA 2GESA 4LI0A 2D2FA 2C9YA 3VTKA 1XXHA 1XPOA 2J9RA 4M21A 3SHWA 4IHQA 4M1KA 3LNCA 5EP2A 1ZU5A 2C8VA 5BYKA 1GAJA 3EZ7A 2ASEA 1E96A 3ECCA 4P4TA 1N6KA 4JVMA 3ZZ0A 2AXPA 1JNYA 1E98A 1LNZA 2CK3D 4OQNA 2QROA 4DRZA 4K46A 2F9LA 1NLYA 3TSWA 3B1XA 3GLFE 1DVRA 1CR4A 1JPNA 4LPSA 3SE0A 2EQBA 3LAWA 3S1AB 1XTSA 2ZE7A 2IUTA 5KO2A 1XDBA 4Q7KA 2IYXA 1A1VA 3T5DA 3W6NA 1LV7A 1ZIPA 4A9AA 1YR9A 3N5CA 5J5CA 2DWQA 1GZSA 2RGBA 4YMVA 5FOVA 3KKNA 4US1R 4MRPA 4IRUB 1EFCA 1ZINA 3L0IB 4FMBB 5EE3A 1HTWA 3IDQA 4U02A 4D81A 3KJGA 1UEIA 5HKKD 2PZEA 1E2DA 4G5RA 4RCZA 3PITA 4I99A 4BZPA 4DUGA 1OSNA 2YVUA 4BLTA 4E03A 2XAUA 4PC7A 2VEDA 2AR7A 3DZ8A 1UBFA 4RZUA 1T5LA 3GJ0A 2BVNA 4IVQA 3WP1B 4ZDWA 3K70D 4QBFA 4UXJA 1NMYA 3CR8A 4ESHA 3QKTA 1DAFA 2ZRGA 1MV5A 3PG5A 3Q7PA 4G01B 4JT4A 2X2EA 4XWOA 4TMZA 3GFTA 3H2YA 4C0KA 2RGXA 3PVSA 4XTRA 4DLUA 2CHGA 3QXXA 4GP7A 4LYJA 4JL6A 4KCGA 4Q4AA 2WJJA 1HQCA 1IHUA 1UADA 3GD7A 4BFZA 1IAQA 2VPPA 2DWPA 1A7JA 3QUSA 2XITA 3QKSB 3UKDA 2VQSA 4DLXA 1E0SA 3GFPA 1XEWX 2JAQA 3WNDA 4Q1CA 1U90A 4EPYA 1CIPA 4WZAE 1NKSA 2VP4A 2ZVQX 3K9GA 3W8NA 3NG1A 3X1WA 4HEJA 4MGKR 4URWR 3H86A 1H65A 4TL9A 1A82A 1N6HA 5ELXA 2OG2A 2PMKA 1VKJA 3TGPA 1R0XA 2WIBA 1JB1A 2FU5C 2JLSA 4LCBA 1U8ZA 1Z2CA 4TL6A 4C0JA 1LB1B 3AVUA 4DCTA 1BMFA 1TF2A 2IHYA 1Z28A 1TQ2A 3K0FA 5BW8A 2DFNA 1RW4A 3PV0A 3AKCA 1EFRD 1KMQA 4QJ3A 5C2JB 1JEDA 2A78A 2ZEJA 2NTYC 2C04A 1KI2A 4KV9A 2KSQA 1QHYA 2OO7A 3CPJB 3I8XA 1BYIA 1PUJA 4Q1DA 4B48A 1KK3A 1Z06A 4IEEA 2H1LA 2OBLA 1M74A 1JXMA 4URXR 5DGXA 4EIWA 2JLZA 4Q02A 3KXKA 4L16A 1N25A 2C99A 3LDAA 3QPUA 3VMFA 3LRPA 5DI9A 4TLEA 4US0R 4Q1BA 1R5BA 1NP6A 1YZGA 2IF0A 1E2MA 3TIFA 4PQFA 4M9QA 4UXHA 2EWVA 2Q21A 421PA 3SBDA 2BBWA 2IS2A 2WJHA 2CCJA 1S0UA 2GVZC 2WWWA 4FMDF 3LVRE 1P9RA 3LO5A 4DCUA 5HKKA 1Z8FA 3OAAD 3QG5A 2HT6A 3CW2A 4DUGD 4MRNA 2VP9A 1FX0A 3I5XA 4ZV4A 5CIWA 1XZPA 5TB5A 4RFSA 3X1DA 1N3BA 2GRJA 3M6AA 1EX7A 2AXNA 5FUWA 3TSOA 4DLZA 4CRWB 3I5YA 5IK2A 1LS6A 3KL4A 3AKEA 5JSZA 3BORA 3LY5A 2F43A 2WICA 3KUCA 4BLSA 5FUVA 2IUSA 5DE3A 4HZIA 4B47A 2J46A 4TYYA 2R8RA 2BMEA 4NP6A 4DB4A 1MABB 4DSOA 4TSFD 1GL9B 5ANRB 4E07A 3CH4B 4LYHA 3AQ4A 4BRUA 3G5UA 3NBFA 2VYFA 1AKEA 4V0LA 4PHFA 4XD7D 1W4CA 4E22A 1F60A 3FHTA 3KZ1E 2RCNA 4TTQA 2ZSAA 2NO9A 1OKKA 3TNFA 3TUZC 1ZUNB 2AKAB 3L8ZA 1SVMA 4LJ5A 4HDCA 4DIDA 2F9MA 3GQBA 1I2DA 2PX0A 2ZRIA 4URUR 3EC1A 4XD7A 2AK2A 3CBQA 2XB4A 1TNDA 3NH6A 3JZMA 5C4GB 2AWNA 4V0NA 2QPTA 4FCVA 5G40A 4PQYA 2CLCX 2LKCA 4OBEA 1KNQA 3RNLA 5LD2C 4AKGA 3RS3A 1KKMA 1F5NA 2IYYA 1FMLA 2B92A 2QMOA 4G5QA 3KB2A 5HZHA 2WSSA 3TVDA 2ZU6A 3EASA 4OJKA 1R7RA 3DOEA 5EXPA 1YVDA 1AM4D 1IJFA 4HSEA 2IBMA 3CX7A 1IM2A 1RRGA 1E2QA 3RRNA 2QE7A 2XTZA 3DMDA 1G8PA 4DJTA 1G16A 1Z6XA 3SJAA 3BH6A 3LLMA 4LHWA 1GRNA 1BH2A 3NBYC 1FQKA 1NY6A 4KODA 3NVAA 1XNJA 2CHVA 2ZROA 1ZM7A 2QE7D 1VPLA 4OK5A 4Q4AB 3EIQA 3TK1A 3K1JA 4DLYA 2JGNA 3EA5A 1R8SA 3AVYA 2GA8A 4ZI2A 4HAWA 1N0WA 1JJVA 5BXQC 1MH1A 1OHHA 2W0SA 3KTAA 3FYHA 3HYTA 4YDSA 3IBYA 1S3SA 2XZLA 5JJKA 3L2OB 1SGWA 4HAUA 1A2KC 2P3SA 4MKIA 4QKQA 2GEVA 1P4SA 3P20A 2WAYA 1BO6A 1F2TB 4CEIB 1JI0A 5EE5B 2Q3FA 4I4LA 1IN6A 4C0HA 3NXSA 5EJEA 2Z4RA 5CB8A 3CRQA 2KB0A 1Q1ZA 2XOKD 2QENA 3MMPA 4LBWA 2QTFA 2V6JA 3W6OA 1US8B 3EIEA 4US2R 5JHGB 1KO8A 4MH0R 2A5YB 1KMHB 3LH5A 4PC3A 1D2NA 4G1UC 2HLDA 2QEQA 4LOAA 3VHLB 4EPRA 3AKDA 1F2TA 4L8GA 1FQJA 1QHNA 1U0JA 1YZTA 1E2IA 3VNUA 5E7IA 5JECA 5BQ5A 1UAAA 1ESNA 2VO1A 2WMOB 2XNDD 3LBIA 4JBYA 3ZQ6A 1G5PA 1Z22A 2FGKA 3X1ZA 2BCJQ 1KDPA 1VG1A 5E3HA 5FH9A 1G20E 4XSGA 3EZ6A 5TMPA 1ZM4A 1Z47A 1QBKC 2P2LA 2QA5A 2PCLA 1HE1C 4P4UA 1YU9A 5K8LA 5HR5A 1KKLA 2VIIA 4Q4JB 4CEJB 4JVSB 2C9OA 2G6BA 4OHWA 3WNCA 1RJ9B 2VHUA 2GZHA 2GHIA 3C14C 1QHXA 3WMFA 2ODEA 2JEOA 1KI9A 2WHXA 2C98A 2DBYA 3DL0A 4LY6A 3RRYA 2EU8A 3V9PA 5E7JA 4M1OA 3JZAA 4XWKA 2QL6A 5GJCA 1W48A 2OM2A 1DBSA 2DR3A 4A36A 4KBGA 1X86B 2O52A 1NF3A 2IK8A 3QIAA 5B58C 4GFDA 4ZIRA 4A2PA 4JL5A 3R9IA 3DDCA 3ND9A 3R20A 3CRW1 4JYBA 5AUNB 2WWIA 5TXGA 4QHSA 3TUIC 5DYGA 4BLRA 3UATA 1SXJC 3U3MA 2O8EB 2IYUA 2W6JA 3HPQA 1KI4A 4RD0A 3QENA 1W36C 4F93B 1OLOA 1TF5A 3C15C 1E79A 2OCPA 3I4LA 1KSFX 2V6IA 1VHLA 2G3YA 4IFEA 5FL7A 4AC9A 4GNKA 1U2RA 4EPVA 5FTLA 1WDTA 1TEXA 2C78A 2ODWA 3QVUA 4MGIR 3GP8A 5KDOA 3M4YA 2WKRA 2XJ4A 2GAAA 5LPNA 5AJYA 2ZYWX 1G8FA 1T8TA 3GFOA 4IOJA 1XJCA 2XZOA 4Z54A 3HU2A 5J4VA 1G7RA 2ZI5A 1G41A 2GF0A 1GL7A 2O8BA 4KFSA 2VHJA 1JPJA 2F1JA 4Q7LA 4E5UA 3GLGA 1DAGA 3Q85A 3GJ4A 2I4IA 1BIFA 3QF4B 1H8HD 4JBWA 1II8B 1KSJA 5JS8A 4UJ3A 4DWJA 3WYAA 1E9RA 2MSEB 3ONWA 2OEPA 3JVUA 3WMGA 1QVRA 3H4MA 2ZJ2A 4D0LB 4DCNA 2P6RA 2A3RA 3FMOB 1SKYE 1D6JA 2XJ9A 2CLSA 2L0XA 1M6NA 4ZCLA 4NKRA 1G7CA 1ETUA 2NGRA 4OYHA 4V03A 5C1BA 4MDFA 1N5LA 2CL7X 3C16C 4MRRA 5FBWB 2NZJA 1W0KA 4QC2A 1OJLA 4A8JC 2BDTA 3KQNA 4DBLC 3VX3A 1A5TA 3H84A 4EJSC 5FR1A 4ZKDA 2BBSA 1CTQA 1P62B 1KSGA 2F55A 3UANA 4Q00A 2GK7A 4AK9A 2WWGA 1XBTA 3KQKA 1RRCA 1E2PA 3IUYA 4B33A 4DT1A 2DHRA 4A2WA 1CF4A 4DDVA 5L3QA 1R0ZA 2KI5A 3OIUA 1LF5A 1XB2A 2J5XA 3QE0A 2NQ2C 2KWIA 3U2QA 5AUQA 2NO1A 3EAQA 1YZLA 1J99A 2UZ3A 4QHTA 3ADCA 4M1TA 4MYHA 4OQLA 4RD1A 4FIDA 4D2IA 4MA4A 2V1XA 5CK5A 5SZIA 2RGNA 3ZS9A 4NCIA 1HYQA 4UXIA 3AEZA 1WBBA 1GSIA 2ODNA 3HPRA 3VFDA 1E32A 1W2GA 4RD3A 3DM9B 4KFTA 3TAHA 2FZ4A 2OBNA 2YWHA 1AK2A 3A4NA 4LSGA 4CGZA 2FSIA 4HZUB 3IILA 2PZGA 1ZC4A 2BMFA 1VYVA 2G0TA 2VP6A 3NHAA 2ZRDA 3B60A 1UF9A 1XEXA 3AM1A 3NBZC 1JEEA 2CLDX 5AJVB 2PLRA 2R44A 4B3CA 3HYRA 3F0TA 1FOEB 1N0UA 2Q3MA 2J1LA 1TQ6A 1Z6AA 2VSXA 1OIXA 3K0AB 4CEHB 2DY1A 1XJ0A 2W6ID 2XX3A 2YV5A 4FCWA 5KDLA 2CL6X 4F4CA 4PPNA 3P27A 4HYYA 5CDFE 1W4AA 2YOGA 5KNBA 2H16A 2W6IA 3QF4A 2GCOB 4LBVA 2ZU0C 2D2EA 1ZU4A 4JVLA 4MUBA 1IN5A 4JLOA 2R9VA 4YONB 3SQXA 3WYFA 2I1QA 4Q5IA 2ZI9A 4AKHA 4OK3A 1JECA 2MMCA 2TMKA 4TN1A 1Z0FA 5LB4A 1E9CA 1K6MA 2Z5FA 4CW7A 4PX9A 3QXCA 1N6OA 2GJAA 1UBGA 1Z0KA 4II7A 5CYPA 3TW4A 4B2IA 4MDEA 5CLLA 3UWKA 1TX4B 3HJNA 1TPZA 1E2HA 2JATA 4LX0A 2Z6VA 2GCOA 4A6PA 1EFRA 4BFXA 621PA 5KPJA 2ZM5A 1G291 1GILA 4QGGA 1E2FA 1L4YA 2QAGA 1SXJE 3RABA 1KJWA 4LV8B 2F43B 3UXMA 1CJMA 3D3QA 3K8YA 1GKUB 5L8VA 5H68A 5JSZB 3W9YA 3QKRA 3WMEA 4EPXA 3CR7A 3REGA 2QAGC 4NBSA 4HLQB 1WBDA 3K9LA 2A5JA 4GMXA 2BMJA 1IONA 4TWZA 4MRVA 4L15A 2DWOA 4ACBA 2CEAA 1GL6A 2CL0X 1SVSA 3IHWA 3N2EA 2B7CA 3CZPA 1KYIA 4C0SA 2GVDC 5P21A 1G17A 2D62A 3IPXA 4A8JB 1NL3A 1P72A 2Y8EA 3VX4A 1LTQA 4C0LA 2BJVA 4EUNA 1OW3B 1TU4A 2I3BA 4UKDA 2REXB 1L4UA 3FMIA 1UFQA 1U98A 2W2TA 1ANKA 4WZBE 1KGDA 2Z43A 2OAQ1 4Q9HA 3U4QB 4B44A 4IOLA 2C95A 3O47A 5L3RA 3RS2A 1S1MA 1YRBA 2HJVA 3W5JA 4AYWA 3R8CA 4TMVA 1RYHA 5K8UA 4TSFA 2FPKA 3CNNA 2XGJA 1GP2A 4OQXA 4C30A 5KYKA 1W49A 3E2IA 4BPBA 1OKKD 4W5JA 5DYIA 1NVWQ 4P3YA 4PO9A 1G3UA 1P60A 2R6FA 1ZIOA 3B1ZA 4POAA 1HUQA 3NHBA 2QBYB 2F1RA 2H18A 4XH9B 5DH9A 2CE7A 1E4VA 2PH1A 4KSCA 4M22A 2KBFA 5SZHB 3V4RA 3IEVA 4PR0A 4A0FA 1DEKA 3NH9A 3GLGB 4TLAA 3PUXA 4DLSA 3IQWA 3AVPA 1ZYUA 5B2ZA 1NJGA 3RRZA 3MLEA 4EFMA 4P33A 4RY2A 6Q21A 1KAGA 2ZUDA 2YOHA 1M2OB 2ONJA 1ZCAA 1G7SA 4IDOA 4TYQA 2A5GA 2ERXA 3CO5A 3A8TA 4FMCB 2ZJ8A 5EZ5A 2B6HA 4IDPA 4MGYR 2UZIR 3PCRB 4H1UA 4PC2A 1ZJ6A 3RYTC 5J4LA 1XWIA 5L3VA 1E0AA 2AKYA 3A58B 5J4HA 2WMNB 4D4KA 5JFGA 3U44B 2V8OA 5EP1A 3SC3A 4A8JA 4PFSA 4KO8A 3IIKA 1Q3HA 3QNUA 3TSZA 4ILEA 4XIGS 2PJZA 5A0FA 1TTTA 4R7ZA 4MYCA 1WP9A 4F4JA 1E2EA 1KI1A 4NHOA 3WBJA 4W5HA 3EPHA 5BN5A 2IYVA 4RFSB 2ZJ5A 1P2TA 1JAIA 1SULA 4C9BA 4JSTA 4QBGB 2I1VB 3EW9A 1RFLA 1X8JA 1PLJA 4EQ6A 1KZ7B 2FWRA 1K8RA 4PTLA 1G5RA 1W0JA 2YJTD 4M2LA 2NMVA 1G64A 3BIFA 2V9PA 4TMKA 1SXJB 5CM8B 1FFHA 3KJIA 1E94E 1ZMXA 1VG0B 1U8AA 4OQFA 2YWFA 4PZYA 3LX8A 3U4QA 4XVUA 1VCOA 3IQXA 4PAOA 4ZCIA 1FL9A 1KK2A 2QAGB 3SN6A 1G4UR 3DKVA 3GLHE 4UNSA 4D82A 4TZ6A 1V43A 4DB2A 4TLBA 4GT1A 4C0QC 1RC8A 1YZNA 4ESVA 1W47A 2ZE6A 1RIFA 4V02A 1AJEA 4H1VA 1E0JA 1AIPA 2NO0A 3EWSA 2FE4A 2OUKA 4JJZA 2R6CA 2EVWX 2VHQA 2CBZA 3B7GA 4L5BA 5FPTA 2X2FA 3WY9A 2IS6A 3K0CA 2AHOA 1EK0A 2IYRA 2ZRPA 2Z0MA 3Q3JB 3CF0A 1N6RA 4WBSA 2JLUA 4LJ4A 1Z5ZA 2IC5A 4PSKA 3OEHD 3ZD7A 1D9XA 1T5IA 4YLGA 3EIHA 1W4BA 4OKSA 1ZUHA 2P6UA 3BB3A 2GAOA 1AGPA 4Z1MA 2ZYVX 3EPLA 1E1QD 3IBGA 221PA 1U9IA 3CKLA 1NSFA 1RRPA 4RKFA 2EYUA 1NBME 3VNVA 4LK2A 3LA6A 4GOKA 4KU4A 4MKFA 5CM9C 4JLPA 3B8HA 2QQEA 2NO6A 3VKHA 4BFYA 1ZNWA 4FW9A 4QM6A 4N1AA 2QGZA 2MSCB 4YMUA 3FWYA 1II8A 3BH0A 3CONA 4NYIQ 2QSZA 4WZ6A 4Q18A 1H8EA 2WOOA 1PJRA 2BKUA 1DOAA 1KDOA 1BYUA 1P5ZB 1QRAA 1X8LA 2GZDA 4YDHB 1OH7A 2WWHA 3A1VA 5TVKA 3BXZA 2JCSA 1Q0UA 4GRAA 1X3SA 1N6PA 2ZXUA 2Z4SA 3F8TA 2WPDA 2D7DA 5JZVA 4N0DA 3U7EB 1JJ7A 2RGGA 3SEAA 1W2HA 5C18A 1AS0A 1R10A 3W6PA 1N5JA 1IXRC 1WRBA 2FDCA 2GCPA 3QPWA 3K09C 2ZS8A 5GADl 1KTVA 1MRSA 3ICEA 1LF0A 1FNNA 2RHMA 3ADKA 4LHZA 4LPKA 5FPKA 3SR0A 1G9XA 2ZR9A 4P4SB 5FPHA 5H8WA 1T4GA 3IGFA 1T6NA 4KSBA 3GEHA 2ORVA 2NOAA 4LJYA 3SS8A 2F7SA 2ZR7A 1NG9A 4JLAA 2E1RA 3ZVRA 4FD2A 3T12A 2WV9A 4EAQA 2O8EA 3FFBA 2QPAA 1AZSC 3PEUA 2NPIA 1NVXQ 2Q6TA 1OT3A 4M8NE 4CYMA 1OE0A 2CJWA 1SVLA 5E4FA 2PEZA 1P75A 1YJ5A 3DOFA 2XSZD 3EC2A 1E1RD 4DIEA 2O8CA 3QVVA 2UKDA 2GJSA 1WF3A 4V0KA 2FG5A 5KPDA 3BB4A 3C8UA 4HDQB 3PUVA 4OI4A 4TMXA 2GXUA 4Z8XA 5FOUA 5AUPB 3U6KA 1IN4A 2ZAMA 4P4SA 4TLDA 3VR2A 1W46A 2QRZA 4TQ9A 2GWHA 4B3FX 1OIWA 1GOTA 1GRRA 2ZRFA 2FF7A 5KDDA 3CZQA 2J0SA 1W0KD 1WCV1 1U0LA 1GWNA 4IDHA 1IY1A 4TYNA 1B23P 5K8IA 3E5HA 5A4JA 1WMSA 2QM8A 4Z1MD 3KQLA 2FSFA 2PLFA 1E1QA 5LB2A 4HAVA 1P9WA 2F6RA 2ZE5A 2V4ZA 4DLTA 4BGDA 4QFMA 1T8UA 1KO1A 1JQJC 2G88A 2VSFA 5TV2A 1GG2A 2BEKA 4WW0A 3CM0A 5H1YA 1XPRA 3AVXA 3BWDD 3HP1A 3EG5A 5JI3E 4WXRA 1S8FA 2BBOA 2PBRA 5E7MA 4YXWD 4XSHA 3MD0A 3O8RA 1YKSA 3C5HA 4NONA 1CJKC 1IY2A 2GKSA 1JXOA 4ZDIA 4LBZA 1NMZA 1N5IA 1CS4C 3A1WA 4NDZA 1XTIA 521PA 2WPDD 4QGFA 3TJZA 1RYFA 5IHPA 2OESA 1SVIA 4PXAA 2ZS7A 2YWGA 2GK6A 2QG6A 2ZITA 4TL7A 1D2MA 4IVPA 3KJEA 2OILA 2OAP1 3CX8A 4B34A 1G3QA 2ZSBA 4GZLA 2ZI6A 1KO4A 3DKPA 4BFTA 2C2HA 2HUPA 4O2LA 2QNRA 1Z29A 1MR3F 3IIMA 3AKYA 4KAXA 3MAAC 2HYDA 5KTYA 4Q9LA 3DHWC 3OHMA 4A4DA 5JLJA 2JLWA 1ZM9A 4XTCS 1VG8A 2ZSFA 3DZDA 2OE2A 2R6AA 2QUZA 2GJ8A 2ZI4A 1KMHA 1TF7A 3THWB 2QAJA 2J7PD 2PZFA 1JQLB 4ON9A 4OHYA 5AWFC 4JL8A 4B3BA 1Z0DA 2WJGA 3TR5A 2FGJA 4C2TA 4Z8YA 2FFAA 4Q4LA 5G3ZA 3BRWD 2XXAB 1CR2A 3SHFA 1BS1A 4P32A 3RAPR 3L8YA 1AZTA 1J7KA 1N6IA 1R0WA 4YMWA 2ECKA 1W7AA 3HDTA 5CB6A 5KHOC 4BASA 4M9XA 3BC1A 5JHHB 3RRMA 4X8MA 1RE0A 1R5OA 2NG1A 3ZGXA 5J4YA 1M7BA 1S4QA 4QNRA 4M1WA 4A0HA 1DTSA 3K0CC 2J0QA 1NI3A 2QMHA 4GMDA 1AS3A 5DHAA 4PSAA 3MWLA 1ZNZA 2XTMA 4KVGA 4XOIA 4GOXA 1EWRA 2O0KA 3DO6A 4AURA 4IOKA 4RD2A 1TEVA 4IDNA 1T3SA 2JASA 3W3ZB 3LBHA 3T15A 2DFKB 3T1QA 2GEUA 1XF9A 4LZZA 4WAUA 2WZQA 5A5GA 1A4RA 4DXAA 4OK6A 3ZH9B 2OCBA 1KY2A 1OB2A 4PHTA 3NTUA 1KNXA 2ZJZA 4BFVA 2RKOA 3ZZUA 2DFTA 5HE8A 3B13B 3VR1A 2ZUCA 4F7WA 3NDPA 2W2XA 4DCVA 1G3RA 5DHFA 3CNLA 4S35A 2AD1A 3TBKA 5JS7A 3LBNA 1Z3IX 4MGZR 4A15A 1TL7C 4F4IA 5JWOA 3THYA 3UMSA 4JLJA 1N2CE 2ZE8A 1Z6GA 2O8FB 3AVQA 1KJZA 2QP3A 2HJGA 2FOLA 1OXVA 2CVFA 4D26A 3TR0A 2ZRCA 4QG7A 4ZDKA 3BOSA 1IN8A 3OE7D 4YMTA 4DLVA 1T3LA 1E2JA 1GFIA 3NC0C 4TYWA 1A2BA 2ANCA 1Z0AA 2O8BB 4XWAA 2LKDA 5M04A 3OEED 3T1VA 1G3MA 2BJWA 2HCBA 3SJCA 2VP5A 1KI8A 2VL7A 1HH4A 1CJUC 4O2RA 4TMWA 4AYTA 4D80A 3OEEA 2LWIA 4DKXA 3M0EA 1SHKA 1Z07A 1OXXK 1Z08A 1W36D 1ESMA 1J8YF 2EW1A 2PL3A 3ZJYA 3DEFA 2FJUA 1OFIA 4D4LA 4PQRA 4R71A 4GOJA 1COWD 3R9XA 2PT5A 2ORIA 3B1WA 2B8TA 4GBMA 2RMKA 1ZNXA 4N0EA 3PIRA 3QQ5A 3KKPA 1D8TA 3TW8B 1XPUA 4JKYA 1SQ5A 1XCPA 3SU8A 1G4AE 3S1AA 3VR4A 5JEDA 3I1FA 4EJSB 3U61B 1FX0B 4CZ2A 5EE1A 2YZ2A 1QHSA 3SYLA 1DADA 1MO6A 1XEWY 3SNHA 4GSYA 1XD2B 3MRSA 1JR3D 2NZ8A 1JAHA 2HYIC 2A7QA 2PEYA 5CJ2A 1GIAA 3UMFA 2EYQA 1I2MA 4L4UA 1G18A 3VKWA 1KDRA 2IW3A 2RGNC 1UJ2A 2ODBA 4B76A 2QI9C 3FHCB 1DG1G 2D7CA 5LBIA 1GTVA 3U44A 1X1SA 2K5UA 3CF6R 4JLNA 4OHXA 1FW6A 1IJEA 5IK2D 3ETLA 4TLCA 3IO3A 5G53C 4DLWA 1MT0A 4PHHA 2R6GA 2YHSA 5FOXA 3GLHB 2WM9B 3MJRA 2HT1A 1R4AA 2IT1A 4QM7A 1EXMA 3CH5A 4CDGA 4D0NA 1U81A 2ZRLA 2E87A 3KB1A 4NE2A 4R98A 3FPAA 2XEXA 3U6BA 4PSVA 2N46A 4I1VA 3B1VA 2O8CB 3ZYCA 3A6PC 3RC8A 2QTVB 4A92A 5HE9A 2IWRA 3X1YA 5AJXA 4QGAA 2J87A 821PA 1W4RA 1X6VA 721PA 2ZRBA 5FOTA 3W8RA 1OXTA 3DMNA 2OLKA 4FXPA 4W9MC 1KY3A 2VHTA 1JBKA 2HDNB 2FN4A 2H17A 3AVOA 4ABYA 4LGMA 4AG6A 2B21A 4LC0A 2FX3A 1Q44A 2EFCB 1CULC 1CRPA 5F9HA 2AL7A 1RJ9A 2BKEA 3WRXC 3WRYC 4X8HA 2IS4A 2HF9A 1X8KA 1ZBDA 2UVQA 5KSZA 2EFEB 3OFND 1NNEA 1N5KA 2J59A 3KDSE 1JALA 1C1YA 1Q1QA 3MJHA 4KXFB 4EFLA 5C4MA 4F38A 5KU1A 4BRWA 1U0HC 3LWNA 1CJTC 3T1TA 1C4OA 4JT2A 2EFDB 2OV2A 3EARA 4YMSA 2YKGA 2IYQA 1PVOA 4WA7A 1KI7A 1X1RA 4C2UA 4JYCA 1UKEA 4BEJA 4KYUA 1F6BA 2FV8A 3K0AA 4CEHA 1XD2A 5FBVB 3AH8A 2O5VA 3C7KA 1Z63A 2OZEA 1ZM3A 1NIPA 2GZAA 2JJ8A 1E2GA 1E9EA 4D6PA 3CRRA 4LHVA 4MRSA 3GLFB 4C0AC 2WAXA 3CWQA 4B3GA 2C9CA 4B3XA 1E9FA 4ERNA 3KQHA 4N3NA 1BKDR 2HCJB 4QHYA 1CBUA 2ATXA 5GJBA 1XMIA 4MYUA 4HLCA 2FSGA 3QSYA 1KHTA 4RZXA 4FI3C 1P2SA 1YQTA 1G1MA 1XXHB 4WIAA 4LJ6A 4KFUA 4A1FA 4C7OA 2WBLC 1P2VA 2FMXA 1QG4A 1UBCA 4M1SA 1TAGA 5FBLB 1YR8A 5FPSA 1W5SA 1GVNB 4R9UC 4JS0A 3NEJA 4V0ME 1O87A 2OCYC 2HF8A 2H92A 3EZFA 2VLIA 3Q7QA 1ZNYA 2FPMA 2OLJA 1NN1A 4Y0AA 2GEDA 1S1CA 4LYFA 4ZI3A 2G1KA 4ZDJA 2A30A 2QBYA 4JKIA 2IYLD 3AVVA 1TQ4A 2JJ1A 1KIMA 1N6NA 3ZVNA 3OEHA 3GJ3A 3VU9B 3CIOA 4HB4A 1OPXA 2QP4A 1ZW6A 3LLUA 2G9NA 1F48A 3VAAA 1E4YA 2QT0A 1E9SA 2CDNA 3NEYA 3W90A 3GJXC 2RAPA 4RSGA 4MKHA 4BLPA 4B2PA 3SZRA 1WE2A 2CCGA 4M4SA 1LVGA 4LC1A 2CE2X 1IY0A 4B73A 4BLOA 1VCIA 2OXCA 4Q4HA 4NZYA 5KNCA 3MG9A 3ND8A 2VH5R 2VA8A 4BUJA 4NL4H 1O3YA 3SFVA 3MSXA 4CEJA 4DDWA 1G8YA 1XTJA 3H0KA 4BFWA 3EWAA 3U3RA 3VHXA 4DSTA 1NLZA 1H8ED 1XXHE 3ADDA 1YR7A 2RB4A 1E79D 4I1UA 4MITA 4AG5A 4IW3B 4NMMA 4NCHA 3QXSA 3TQCA 2V1UA 2NO7A 1Z83A 3QPVA 3G0HA 1D5CA 3F5FA 1AQUA 1G7TA 2Z83A 4O25A 3U3OA 5DIFA 2XOKA 2G77B 4NH0A 2FEOA 2Q3HA 2ZPTX 3D31A 1ZVQA 3QBTA 2V7QD 1OIVA 4LJAA 4IXNA 2GDJA 3K9NA 3W3AA 4ASUA 3P1JA 3EX7C 3OIYA 4KFRA 1NVVQ 5JWHA 1SXJA 2ZAOA 1UKZA 2MSDB 3EA0A 2A5DA 5BN4A 2J41A 2FFBA 3A1SA 1EG7A 1ZC3A 1TUIA 4L9WA 4CVNA 5EQTA 1E69A 2JJ2D 3QG1A 2FNAA 4JLBA 5J4KA 4G5GA 1LY1A 2RH5A 4LDJA 3THXA 1W5TA 3L43A 3UIEA 1F2UA 4LUCA 3SOPA 4FMDB 2HXYA 1MO4A 1XTQA 3I61A 2QRNA 1WA5A 2XSZA 4PPFA 4C7OB 2G1JA 2ZRMA 3EZ9A 3RDPA 1W44A 2ZYTX 2AK3A 1NN0A 1R5NA 1MABA 5KOYA 3L0SA 1CP2A 3MWKA 4HATA 1ZUIA 1T91A 1EWQA 2WVJA 3QEOA 1QHIA 2WOJA 3K09A 4KHZA 4M1YA 2D74A 4BLQA 1DS6A 2BC9A 1BOFA 5TDHA 1DELA 1XCGB 2QU8A 4G3XA 5FOWA 2X77A 3ASZA 4IVRA 1IXZA 4MQBA 1B0UA 1NJFA 2IEYA 4J0QA 2CJWB 1S96A 3FGNA 2OFWA 1AGRA 2C96A 3DPUA 3FHOA 4Q4HB 2F3RA 3GLGE 2V3CC 1XP8A 3IEUA 4NCNA 4B6FA 1R2QA 1EGAA 1I4DD 1RZ3A 3UG6A 3ASYA 3SI7A 2BM1A 3N70A 4NYIR 1U99A 2FEMA 4KLNA 2H57A 4XVRA 3ZZTA 3ZVMA 3LVQE 1HT1E 1FUKA 1ODFA 1RVDA 1E2NA 1KDTA 3BFVA 1UDXA 1DAIA 3SQWA 2WJVA 4Q01A 2ZRNA 2IS1A 4DZZA 2QGNA 1PLKA 3T1OA 2IYWA 1VECA 3BERA 4QJ4A 4KJZA 4ITRC 3TH5A 5FI1B 3HU3A 3RWMB 4GP6A 3H1TA 2NIPA 5JJLA 4PC6A 1U9IC 2G83A 1G8HA 3RSLA 2REBA 3C4JA 5DO9A 4D25A 3HR7A 2XTNA 1YZKA 2OXRA 1NBMD 1KI3A 5GVRA 2FZLA 3TLXA 4G5SA 3EXAA 1UEJA 1ZRHA 5F9FA 3I73A 1K5GA 3I32A 1TADA 4IOMA 2V7QA 1JR3E 4OJQA 5CYOA 2O8DB 1QHHB 4RD6A 1YZQA 5HCNA 1CRQA 1XZQA 3N2IA 4IFBA 1EESA 3IIJA 4NCJA 5F2EA 4JSYA 5DI3A 4A82A 3RHFA 2QP9X 3AV0B 1NRJB 1HURA 1XFAA 2Q0HA 4AY2A 2W58A 3IO5A 4O0MA 2JJ2A 2GILA 5AR1A 3RANA 1AA9A 3L82B 4LV5B 4A0RA 1E9AA 5FTNA 3RC3A 3GLFA 3BB1A 5FBRB 1E2KA 4ZO4A 3FDIA 3WHKA 1AKYA 2XNDA 4TTPA 1XCMA 4AIIA 2IXFA 3U7FB 1SKQA 3Q8XB 3QKSA 2WWXA 4OI2A 4KI0A 1TU3A 3SFZA 2J7PA 3WYGA 3T5GA 3GJ7A 4HUQA 4FN5A 4B2LA 3I3SR 2BBTA 1DG3A 5EP3A 1I4TD 2D4HA 3NDBB 1HV8A 1Q21A 3R9WA 4Q9KA 4TT3A 2G0NA 3HWSA 1LFDB 3THOA 2GCNA 1OV4A 1OH8A 4YC7A 4TTRA 4TZ0A 1ZD9A 4C4PA 4OI0A 1VYUA 5F98A 2NPFA 1MRNA 1SVOA 5J47A 3W5IA 4HB2A 3B85A 3AUXA 4ARZA 3DM5A 1JR3A 4M9ZA 2GF9A 2ZSEA 2AFHE 4YXWA 4FINA 5EE9A 3CX6A 2J45A 4M1MA 4GZMA 5FOSA 3WP0A 1NN5A 3CUEF 5EP4A 1SHZA 4JLMA 2QT1A 5B64A 1P73A 3TAUA 1VYTA 2XXAA 2A2ZA 2SHKA 4PANA 4DVGA 2JLXA 3X2SA 1F2UB 2BWJA 4UNQA 1M1YE 3O8BA 1DE0A 5AJZA 4B71A 3GLIB 5FL7D 1GRQA 3THYB 1K5DA 3MWYW 3G82C 3RS5A 2P0EA 4RFVA 1HT2E 1R8QA 1XD8A 1NBMA 2YC4C 1QDEA 1E0KA 3AP1A 3CLVA 2H8KA 5EXXA 3RS0A 3U3JA 4U00A 2FFQA 3O8CA 2GXAA 5DSZA 3VR6A 1FUUA 4I81A 3LQRA 2P5SA 1CLUA 4JMPA 4PO1A 2ANBA 4D4MA 4DDTA 4QRHA 2P5TB 3SYKA 4D0GA 1XX6A 2GNOA 2JDID 2P6NA 3GLIA 1QHHA 4PPQA 2QORA 3QEJA 121PA 1FZQA 1XU4A 5HZKA 3PEWA 1NMXA 4MYTA 1GNQA 1H8HA 3PUYA 5DISB 4C0BA 2ZJYA 3ZLJA 3EZ2A 4OL0A 2W2VA 2OBMA 1G3IA 3DVLA 4IDQA 1QHGA 4D4JA 4Q4JA 1AN0A 4PAQA 1NLFA 5L3SA 4EPTA 4MUAA 3BAFA 2WJYA 4M53A 4AD8A 3Q5EA 4S2EA 1G8GA 4DSNA 4JLDA 1Q1BA 3C5CA 3FKQA 3OESA 2X8AA 4JLKA 4QBIA 4KYIB 3I62A 5HCIA 3OFNA 3RS4A 1WB9A 3J81k 2IWHA 1RKBA 2VP0A 2ZJOA 2KJQA 5LDDC 2CK3A 2EWWA 5LD2B 3IPYA 5FPYA 3AF0A 3Q5DA 5G41A 1COWA 1US8A 4L9SA 1S2MA 1W1WA 3UG7A 4LJ7A 4NTZA 3ZDQA 3RSOA 3A37A 2OT3B 4OQMA 2BHRA 2CHQA 1XEXB 2ZANA 1Z6TA 4DEXA 5DNYB 3EPJA 1Z2AA 1AS2A 3GLIE 5FR2A 2N42A 4U5XA 4A0GA 4URYR 2V54A 4Q1FA 5D3MB 1U8YA 5KNDA 2R6DA 1KSHA 3FMPB 3T61A 4KVAA 1GITA 2QTHA 1CR1A 3TUJC 3PJRA 3VR5A 4UNRA 3LFUA 3ICQB 1NSTA 2XNSA 4KBFA 4ZPXA 1E3MA 1L8QA 1N0VC 1FNMA 1Q57A 2HXSA 3HR8A 2ONKA 3MWJA 5DN6A 1GNPA 1OYWA 2GTPA 4FCTA 4X8OA 3E1SA 1FPMA 1N6LA 2QQ0A 3P26A 1KI6A 2CCKA 3ZIAA 1U94A 4Q66C 1YR6A 1KK1A 3BFXA 4Q1AA 4QOSA 2W83A 5FFMA 4B3DA 5DN6D 3KXLA 3QXHA 1DARA 1UDWA 4DCSA 3GCGA 3PEYA 2YC2C 3ZIAD 2GBLA 3A4LA 3P32A 1HQYE 3CRVA 3PENA 4Q7JB 1P61B 2KBEA 4Q03A 1IXSB 3GEEA 1DAEA 4QGHA 1KJYA 4QBHA 5IF9A 2IA5A 1GNRA 1NG1A 1RPZA 2W0MA 3CPHA 3CRMA 2AWOA 2JDIA 4Q7MB 5JCZA 2IX3A 2O0HA 1F3OA 4KLZA 4JZKA 1M34E 5KSPA 4UJ5A 4AI6A 4PZLA 3Q72A 4R2HA 5KSOA 2ZUBA 4K8OA 1UKYA 3WHLA 4FWIB 4ZCMA 4HLUA 2IYSA 1P9NA 4LYAA 2J3EA 3KJHA 1R6BX 3LQQA 4NYMR 1KAOA 3K9HA 2QY9A 4NYJQ 3R7WB 1XMSA 2H7VA 2WSSD 4RD4A 1Y63A 3GLHA 3FOZA 1EFUA 1P7CA 5FI0B 1DAHA 5DI3B 2WJIA 4UNNA 4XJXA 4QXAA 4LV6A 2OHFA 4LJ8A 1PZNA 4PPGA 2MMGA 2WIAA 1D2EA 4W7SA 2ERYA 3ZVLA 2DCUA 3L0PA 4C3ZA 4A6XA 2ATVA 1SVWA 3B9QA 2LCFA 5FUYA 1QG2A 4I1OA 1OFTA 5FBQB 4BZQA 1M7GA 4Q48A 1G6HA 3U7HB 1MO5A 4OI1A 1NVUQ 5CJPA 4NU0A 1YHNA 3BS4A 3Q9LA 4PO8A 3U60B 5D3MA 4JLVA 1Z6YA 3OAAA 3R7WA 4PAMA 5HTKA 1JR6A 1NVVR 1LS1A 2O8FA 2IHBA 1G5TA 5CITA 4WXPA 1W0JD 2P67A 2A9KA 2C5LA 2P65A 2RGCA 8OHMA 1WQ1R 3IHLA 1XJQA 3KFVA 3T34A 1Q3TA 2IUUA 1NY5A 2VRWA 2H5EA 1DAMA 3GEIA 4TQUS 2Q9AA 2DPXA 3WBKA 1VG9B 3NBXX 2WSMA 3QXJA 2BIFA 3BK7A 1OXUA 4HAXA 2ZRAA 2QMUA 2ZRKA 4TQAA 4JVNA 2OCAA 2HV8A 3OF5A 4CT5A 3KUDA 2F3TA 2WWYA 2ZYUX 1KI6B 2IEZA 2KE5A 4WVFA 4EPWA 4PC1A 5TARA 3B2EA 2W00A 4LHXA 3CB4A 4G5OA 2VF7A 4U7DA 5EE0A 1T0HB 4JBXA 5JRZA 2BCGY 1HE8B 2AFIE 1XTRA 2ZRJA 1FTSA 1FP6A 1ZCBA 1GUAA 2WTUA 2GXQA
chains in the Genus database with same CATH superfamily
3BGOS 3VDRA 3H2KA 1H1TA 1PV4A 2B20A 2Q46A 1AGXA 4ZVPA 3KTAB 1JUDA 1RLIA 5KI6A 3PHLA 4YT2A 2YXPX 5JJIA 4URVR 4JI8B 1Z4OA 3MJDA 5FD8A 3C97A 3I6IA 4S2UA 4U7HA 3PFIA 2RHHA 3EE6A 3JQ6A 1SRQA 1YDHA 1ZD8A 2D06A 2XIJA 3PI7A 4JROA 5ALVA 5J59A 3D64A 3GCWA 5IAKA 2QZ4A 2NZYA 3RVBA 4H77A 2WVGA 4HBZA 2PMCA 1NURA 3A6EA 2DB3A 4GX5A 3RK0A 4U0JA 2FZGA 2G9QA 2PSSA 3C1AA 4YQEA 1HNWB 5JWRA 3A26A 1YVRA 1J2UA 1EJ2A 3FGPA 4RAQA 4XLZA 4YUWA 4NJOA 4M86A 5KC8A 1GKIA 2HHLA 2JLAA 4O4JA 2QSYA 1DRUA 3TRIA 4OMUA 5IYZF 4MKRA 2CMKA 2NV0A 1WS6A 4KGDA 5FJJA 1ISSA 2EP8A 2BSXA 4OJYA 2W48A 1BJKA 3AP3A 4IMIB 1QKIA 5EXTA 1NYLA 1ZPDA 1MD9A 3ETJA 3QNWA 1WSDA 4URZR 1TKRA 3AF1A 1KO5A 1XD9A 3EHEA 3UT5A 5AK0A 2BF4A 2PH7A 1UXKA 2PRSA 4KSYA 1V7QA 1RI4A 2XVAA 5TJ9A 3FI9A 5CURA 1R8XA 4O3MA 4FMCF 4P7KA 2FPIA 1DC8A 1OVGA 2N3ZA 3CISA 4QQ8A 1CKEA 3PPWA 2PX4A 1Q7TA 2BCEA 2E0IA 2WTAA 3PNOA 4QYWA 1TK3A 2JI9A 4INPA 1XF1A 3JD3A 1AGNA 3KFXA 4FSHA 4QYMA 1YDWA 1L4EA 1T9ZA 2GSDA 4IGAA 1RKUA 3WYCA 1BRMA 1P4AA 1OHHD 2IOYA 3WXBA 5SY4A 5E0OA 1IBRA 3DXYA 3FKSA 1BDHA 3V1MA 1OH5A 1CLEA 5JCJD 1U28C 2B7BA 4EJMA 2FPPB 4E08A 4R54A 3A36A 3BWYA 4Z7OB 2HEIA 3BGWA 3D7NA 5GVSA 3F7NA 2DYKA 2XY4A 3EEFA 3QYPA 3R3YA 3GGDA 3KT0A 4NCKA 4BNWA 3L46A 1I2BA 2GJ9A 5CA0F 4KITB 1YS4A 3F74A 3TNDA 3ADPA 3QBVA 1X7XA 1R9JA 1XC7A 3A1FA 3X1MA 5ALZA 1J90A 3CF2A 5LC1A 4HQRA 2UZ4A 1G19A 1Z35A 2F1HA 1P77A 3GEDA 2I7VA 5EJ2A 3GT4A 3SDSA 2AS0A 5E1DA 1L7VC 1UT5A 5DM60 5G3YA 4KXQA 1OFUX 1L1RA 2WFMA 3TMKA 1IQPA 2TECE 3NC1C 4PTYA 1JYSA 1XEFA 1NATA 2GR9A 5AKHA 1UBEA 2A9FA 2M1XA 4Y2VA 2JJMA 3NHPA 5IUKC 3F6CA 3K2QA 5F4ZA 3NKVA 1U1EA 2VK8A 2Y4NA 3AGQA 1M2NA 4NRDA 2QN6A 4EG8A 1OJ7A 3BBPA 4FWTA 4UMFA 4KNYA 3VPDA 4G37A 3EXG1 2IZ0A 1RMTA 1NJ8A 1H2EA 2EERA 3NHKA 4WOPA 5JO9A 3TKLA 2B1IA 5BWCA 2JANA 3FMFA 3N1UA 3U81A 1AQJA 2X42A 4AJPA 4R2IA 3VC1A 1LTHR 4CMKA 3GUUA 1HMYA 2P8JA 3G2PA 2BGNA 5KVCA 4JZYA 1CQJA 4L08A 5FCDA 3VOSA 2NO5A 5LMNB 1T9HA 1M8PA 2I2XB 4FX5A 4UBJA 3IAEA 1OH6A 1JB9A 1W76A 3MILA 4RPCA 3ZX5A 1E7YA 1PGQA 3E70C 3OUTA 3VMMA 4WCFC 4OM7A 3CNOA 5DGTA 4HDOB 3PF8A 3O94A 3PDIA 4G25A 1PX2A 3WISA 3CV3A 3ZDFA 4DLRA 5HX7A 5J40A 1HRDA 1JJIA 2ROQA 2QK4A 3UFXB 5A9SA 4Z0TA 4ZO6A 1RPTA 1W581 4CETA 5TF0A 2PS1A 2E89A 2REOA 2E5FA 2G28A 3ZS8A 1LGYA 2JLRA 2YN4A 3FOWA 1G21E 3C1OA 3KWLA 4QWMA 4YP0A 3RUHA 3HI6A 1PYDA 2IL1A 4E13A 1RYDA 2WKPA 1XN1A 4E5PA 2OZLB 5IXJA 4CEIA 4K6OA 1XRMA 2AX4A 3P2OA 1WNTA 4UHJA 2OL4A 1B0PA 2ZTSA 1KEPA 3CPEA 5IMBA 4EJFA 3TG2A 5CK4A 4ITUA 1CR0A 2VSOA 3GR6A 3NAMA 2IE8A 4YFYA 5H16A 3UJ9A 1SURA 3ANYB 1WO8A 2BM0A 3PZBA 4P31A 5ITSA 5JCPA 3LL4A 1ZESA 1VE7A 4PHGA 4P36A 3IP9A 1FMTA 4C21A 1USKA 3GO4A 3ZU4A 1I4LD 4QOHA 3X3HA 1J2JA 1RWWA 5L3SB 4B6EA 4NOLA 3ZY4A 2R6JA 3KQUA 2XB8A 3LXMA 4X93A 1II9A 2C8JA 2FQQA 1EZZA 3GFBA 3VYTB 4ARBA 3HXLA 1N57A 3C0KA 3BUSA 5FUXA 4BN4A 4CCYB 5CVVA 1RCTE 1W36B 1YMQA 1WZNA 4YRNA 3GAZA 4MI1A 4S1NA 4ARVA 1ULBA 3LCRA 2DUNA 1ZEJA 2FW1A 2L42A 1SXJD 4DR6B 4P2BA 5FO1A 2RHDA 5M7EA 1ADBA 2V7BA 3ICWA 3AI2A 3IXMA 1BKYA 3FVQA 4WGFA 4DR7B 4JVOA 1T35A 2EJUA 4FTWA 3V00A 1TFUA 2PFKA 4CR6A 4GP9A 4JQOA 3UF0A 2IYTA 4CHGA 4HUQB 3WG9A 1IZZA 3HC7A 4O4LB 4GS5A 4DY6A 2YTZA 3NGLA 5IWCA 1DAKA 1B0ZA 4DQVA 5HPYB 3MQFA 3MCAA 5MN4A 3OZTA 4JIMA 4ENQA 1Y6FA 1FYEA 2ODTX 4H16A 1TM2A 3SR3A 3BSSA 3FZGA 2ZIAA 4HLUC 3UCEA 3FLEA 4RGBA 5J23A 2WG1A 4JIGA 4RS3A 1Z0JA 1CXZA 4UHFA 1JG6A 4P0QB 3NNSA 5EUMA 2VUHB 2ZQ5A 1KDVA 2YOFA 5K8TA 3P4YA 5L95A 2GPWA 4E1AA 2O2YA 3BCSA 3GUHA 2J9ZB 1OYVA 3JW8A 3F90A 5KIAA 1W85B 3N6VA 1HFJA 3K0EA 4QPCA 3A6LA 3I6QA 1QYCA 2RI6A 2WU3A 3OIVA 3Q7IA 3QI7A 4HWSA 2VCEA 4BMDA 1DQZA 4CLXA 4ER0A 4I36A 3X2EA 4YQFA 2GBLC 2VQ6A 3QOWA 1O6ZA 4E5KA 5U9CA 2H08A 3WYBA 3HUDA 2X1VA 4TX1A 1XDWA 1Z16A 2ZIXB 3MT9A 3ZZ1A 2XMZA 2XQJA 4BEWA 4XOUA 4EA7A 2PJDA 3I01M 3F3SA 1ULUA 4PNPA 1DIGA 1QF9A 1X0VA 4HKTA 5IKOA 1EX6A 5F12A 1Y89A 2RGAA 3DT8A 3KYJB 4X20B 4C7VA 3GOHA 4LBYA 4Z51A 1F2VA 5FXMA 3ESZA 3O4VA 1CSEE 3AUYA 3NPAA 1Z4NA 3P4XA 4IJUA 3L4JA 4YAIA 3KX2A 2GJKA 5AK4A 3A7EA 1UXOA 3ZIUA 4RVCA 5JARA 4ETMA 2IYZA 3GG9A 1Y81A 2X6TA 5IUNC 3WKEA 1AE1A 2JFFA 3UMRA 1YJAA 3D7LA 1LRLA 4HVAA 1Z13A 2JIZA 1I0IA 3I92A 4LOHA 1N32B 1NT4A 3NYIA 4ZVKA 1RLMA 1EHCA 3CH6A 3FW1A 3IP7A 5KUTA 2VDMB 3K72B 2PUVA 3Q4GA 4TS1A 4EQ6B 2P2SA 1QQAA 2O2ZA 1D6MA 4X1KB 5FL3A 5B30A 2O14A 1VL6A 3HDHA 4IJ6A 4L3VA 4QFDA 3WLLA 3AVUA 1LV8A 1DL5A 1FMJA 5TQJA 1T3HA 1Q5PA 3HLKA 3ZWOA 4TGLA 4LYYA 3RASA 1NF8A 5A4FS 3CE6A 4Q9NA 4GKVA 3SX0A 1DUIA 3NTRA 2VF5X 4LWQA 3BFPA 3CXUA 1DO2A 4B74A 4TMTA 2QN8A 4KDFA 5JTUA 2EWMA 3U3XA 2YFHA 4MP6A 2BGLA 3M6LA 1QH9A 4L0MA 5EHXA 2XT6A 1T3GA 3CLTC 4LZJA 3LYLA 1NE2A 4NX2A 3UJCA 2P91A 4B9EA 4N65A 1NUUA 3TTTA 1XPOA 3SHWA 4FCCA 1SK8A 3OM9A 4WKCA 3TI9A 2RAFA 1JL3A 1RBQA 3Q9NA 1Y82A 2IU0A 2C8VA 2P4UA 5KPDA 1TEZA 3RYFA 1K8XB 2DJ5A 4BV3A 1WWKA 4FYHA 5HJ7A 2IBTA 2YRFA 4P4TA 3OCVA 4UM9D 4CV1A 2Q5JA 1G2QA 2GBCA 3F49S 4JVMA 1PWYE 2E5WA 3Q9UA 3ZZ0A 2O8VA 2Y1DA 4OQNA 1XZ8A 2F9LA 4YCBA 3B1XA 2QHXA 1QH8A 3GLFE 1T9AA 1VSBA 1JPNA 3I0MA 2ZYRA 1XTSA 1VIMA 3WLPA 5ICMA 1UBHS 1Y9DA 3NGMA 1Y3HA 2QG9A 3VVBA 1LPBB 1XDBA 2F3UA 3L01A 2ADOA 5AVKA 4RAOA 4C87A 1PT5A 4D4IA 1A1VA 3ZWNA 2OD2A 1ZIPA 2RKWA 1OXBB 5J5CA 5K0LA 3SQNA 3TBHA 1GZSA 2RGBA 5LYJA 8GPBA 4HSGA 1EK1A 4US1R 2AEMA 1EFCA 4IRUB 4C5AA 2RHWA 3DJYA 1KQFA 2C2OA 2I2WA 4HNGA 1GUBA 4J1TA 4Q39A 4BU1A 5HKKD 1RHRA 2B8JA 1E2DA 1D4OA 2JFHA 2PZEA 2ZB8A 4G5RA 4F9GA 4F6RB 2CFSA 4F5WA 4GVXA 2HK6A 2MU1A 2XYQA 4I4TA 3T9CA 4G6ZA 3GN1A 4E03A 3TZHA 1YUNA 3OFVA 1U1IA 1UBFA 4MDFA 1V96A 4JC0A 3GJ0A 4RZUA 3S2GA 3V8EA 2BVNA 2WUEA 2C20A 3PLAE 1UM9A 3E05A 2H29A 4L8WB 5EKUA 4NFYA 3M6MD 4ESHA 2B1RA 3PG5A 4MS1A 4PGMA 1OLUB 1LK7A 1QK3A 3UJBA 2WWRA 4LZWA 2IYOA 4FILA 3WNVA 4TMZA 3GFTA 4PFJA 5JSYA 2FVXA 3A4YA 4C0KA 4DM7A 1YR3A 2B1GA 1DTWA 2FK7A 3Q3IA 4HXFB 4BBAA 3A4IA 4Q4AA 3RV4A 3MN1A 4XRRA 4ZREA 1G8AA 1OLXB 5KYVA 5FAXA 3R5TA 1GCOA 5B7QA 5EJGA 4BFZA 3UUWA 2DGDA 2X41A 3LPMA 4JJIA 5A4MS 1QZ3A 5KYYB 1XA3A 5H7XA 3UKDA 2HWYA 2XITA 3QUSA 4REMA 3VZRA 5IAAA 1J5EB 1XZAA 2YY6A 3PFCA 3GFPA 5K20A 1LQTA 3FYCA 2F8TA 1SZCA 1O54A 3KAPA 4Q1CA 2H0QA 3VH4A 1CIPA 4WZAE 3HJFA 2VPXA 3K9GA 3NWEA 4URHA 1JLRA 1H65A 2R96A 2EOAA 2EP5A 5ELXA 1GTRA 3O5AA 3HGTA 3HJGA 5JQGA 5KREA 1IEWA 4EB3A 1V5IA 1FFWA 5LL6P 3TGPA 3KOUA 1THZA 4FR2A 4TL6A 2YY7A 4I9GA 1BMFA 4MEJA 3ZKWB 3LOUA 1TQ2A 2X3YA 5BRNA 3A2KA 1I80A 3KL2A 3HB1A 3W78A 2SECE 2R8BA 4RV4A 5BW8A 3N8HA 4L75A 2CYCA 2FP4A 1EFRD 3UEOA 2JZOA 2QW8A 4L72A 3WB0A 3DF9A 4QJ3A 4ZGWA 4LC9A 2IOFK 1T9CA 1QG6A 1VPVA 3RKUA 3VH2A 4Z7NB 2ZEJA 5KYWB 1RMQA 3L92A 5K8VA 1L8XA 1WCIB 2KSQA 1QHYA 4Q1DA 1NGSA 3I8XA 2Y9PB 1PUJA 4B48A 4Y2QA 1KK3A 1KU6A 2H1LA 3IJPA 4URXR 3IB3A 4TVOA 2HZBA 5FQOA 1L5NA 1WB6A 4EO4A 2QYTA 2FEXA 3VMFA 2ZBQA 1KZYC 4L4YA 5TT0A 4BMSA 2PR7A 1LBTA 3N7UA 1VLZA 1ZKDA 1K75A 1U6KA 2IP2A 1ISIA 2EWVA 1H23A 2VYVA 1NNSA 2X76A 3BF8A 4UXHA 2Z5LA 1BX1A 2CCJA 3AHDA 2E21A 2QTNA 3BSWA 4UDXX 4DCUA 2C00A 3OQBA 5JSHA 3DT9A 3QG5A 1RQRA 2HT6A 4DUGD 7MDHA 2O2GA 1Q95A 4MVWA 5CGZA 2MOKA 1ZA1A 5FUQA 2HMAA 1VRVA 3I5XA 2GPAA 3Q8KA 4WZAB 1SOMA 1W5EA 5TB5A 3TVYA 4B3TB 2VAXA 5IVIA 5JANA 4RDCA 4EG4A 2W2NA 1UC4B 4GEKA 2I67A 4DLZA 4CRWB 2OG1A 3A3PA 2INGX 2X0RA 3X44A 3I5YA 1PDVA 3I39X 2DUWA 3AKEA 1DIAA 1MJGM 1I1NA 1ZRSA 3BORA 1O2DA 4RY0A 4MUGA 2DUMA 1J5PA 3LY5A 3O3OB 2WICA 3LPAA 1JG3A 4EGCB 5I48A 1U0FA 4PXYA 1FTQA 1BW9A 2R8RA 3KHTA 4NP6A 3ZWAA 1RABA 4ID3A 5F4BA 4DSOA 4DB4A 2PUFA 3H8SA 3VU3A 3V7UA 3NHUA 2VYFA 4ZEVA 2WQ7A 1AKEA 1EFLA 4GOLD 4V0LA 1SOUA 2FN3A 1F0PA 4WZBA 4JJ8A 4J43A 1Q7BA 4GR5A 2NO9A 4TTQA 4LJ5A 3L8ZA 4LZLA 2A0FA 3DOHA 4K9RA 2QX7A 3IMEA 1A7AA 4BATA 4ENSA 1ABBA 2CBXA 2E2WA 4TYMA 4ZWNA 1P39A 1QIJA 2I65A 2ZRIA 4URUR 4XD7A 4C1NA 3CUTA 2FEPA 3STHA 3N2KA 4P92A 3JZMA 2OV3A 2XRMA 5LQRA 1DX6A 1O0CA 4V0NA 2AN3A 4OIFA 3KAJA 1GGEA 1KNQA 3RNLA 5LD2C 2C2KA 3RS3A 5IN5A 4PAGA 1SPBS 3BQNB 4Y7CA 1F5NA 4UUQA 2B92A 3N28A 5CAEB 3TVDA 1T9KA 1ZDMA 2K2WA 4EGFA 5AW3A 1P0PA 3RH0A 4LDZA 5L6MB 3CEJA 4R1LA 2IBMA 3CX7A 4JK3A 1RRGA 3WQRA 1LK0A 5A6SB 1K5PA 3RRNA 3UK1A 4CF6A 4F8YA 2HMWA 1Z6XA 3SQDA 4IGEA 4ZQEA 1HDXA 1ILWA 1H6DA 1GRNA 1BH2A 2FKNA 3JASB 1QYRA 4KODA 1ZISA 3RREA 3VSDA 4CGYA 3KAQA 5U1PA 2A14A 1XNJA 3KB6A 2ZROA 1ZM7A 1N77A 2P1DA 4G0UA 2Q4TA 4QTUB 3GL9A 2IIBA 4IIBA 3ZI4A 3EIQA 1KJ8A 4RZSA 4DLYA 2KS6A 5CG1A 2I80A 3AG5A 3DZJA 2Q0XA 3EA5A 1R8SA 3MCVA 4W9RA 1JEQA 1HEYA 2AH5A 5EHGA 1ZJ4A 4YUYA 1NC1A 2JAWA 1XMXA 2HCRA 4D5EA 2DWUA 3OF2A 1MH1A 1OHHA 3QUQA 4IKPA 3UXYA 1EFPB 4OGLA 1E3WA 4FHEA 4F8EA 2R84A 5JCJA 4JASB 5JBNA 1S3SA 1P1BA 1KEWA 2DR2A 2XZLA 5JJKA 3O7MA 4HOYA 4MIOA 3P0RA 3H9QA 3QBJA 3PPXA 2QTZA 4IP0A 3TL2A 4DIUA 1O08A 2WJ4A 4RFLA 4L5IA 5JJBA 1BCRA 1MENA 3FAKA 4QKQA 5AFSA 2I6TA 1IZ0A 4PX5A 1J8FA 1BO6A 2IHJA 2VH1A 4O4JB 1OAKA 2I6QA 1JI0A 2JH9A 2NPOA 2Q3FA 1IN6A 1KVQA 4I4LA 5EE5B 3KSBC 1J4AA 5EJEA 3SFTA 5CB8A 2EHDA 4HMOA 3CSSA 4X61A 3R3VA 3MMPA 3ZLVA 2I6GA 4XB1A 3KDAA 4WOJA 5H5JA 1UBJS 3UK0A 5I9IA 3W6OA 1WABA 1US8B 2VCYA 1SJ9A 2R7KA 4WL0A 4YJ3B 5JHGB 4LF5B 3A6HA 3JQ8B 2XYVA 4I50A 2A5YB 4MW5A 3W5HA 4BUCA 1AQNA 1UBOS 3M81A 3S2YA 4O2AA 1C30A 2ZQZA 4U2GA 5IAGA 1MJFA 2PL1A 3VHLB 5FX2A 4OTZA 3AKDA 1L4FA 2PL9A 4L8GA 1BMQA 1QHNA 3VO2A 1I7LA 4UATA 2KHZA 5AKZA 1RWXA 5JVDB 3HDQA 2OQIA 2XIQA 3LBIA 2JPDA 4AP5A 1ZGGA 2HSDA 1Z22A 3X1ZA 4FQ5A 4ZVNA 1CUDA 1KDPA 1VG1A 3E5MA 3KZVA 4FFOA 3TMYA 3WHPA 5E3HA 1VKZA 2XRYA 1H2YA 3EZ6A 3GP5A 1EFVB 3V2UA 4U9UA 2P0YA 5TMPA 2VN8A 2QZZA 5EESA 2PCLA 1V8DA 5I7VA 4DEVA 1TLLA 4YRJA 4P4UA 3HNOA 3UFBA 1A27A 1DBRA 1KKLA 2VIIA 3DUFB 4FC6A 4JXJA 3WNZA 5C9ZA 2QTAA 2C9OA 1CZHA 3AR2A 3OQJA 3UHFA 2VHUA 2GZHA 2GHIA 4KDCA 3TNJA 4INOA 3ZWPA 1QHXA 3ZHQA 4BVJA 1L8AA 3WMFA 4KQHA 4YAKA 1Q17A 3V7NA 3EVBA 3I30X 1Q91A 1ZK1A 1LZKA 4LY6A 1FUIA 3VVCA 2HK7A 3AHGA 3V9PA 5E7JA 4MHTA 4I1RA 4LSMA 5BMVA 1NPTO 5JNUA 4BXOB 4J8PA 5GJCA 2OM2A 1R0KA 1KZ6A 3WX0A 4Q3KA 5GGYA 2FQXA 3QIAA 2R60A 4JGBA 2PH3A 5A4IS 3U13A 2FUCA 4MPDA 3GLIA 4E32A 2O9JA 4J1TC 2MT9A 4PLVA 1HO3A 1IM8A 2JEYA 1XCJA 3DDCA 3EF1A 3LK6A 2AIRA 4IY1A 3A0RB 3F8WA 4JYBA 2FUEA 5B1SA 3WKDA 4CUJA 4DVJA 3TUIC 6GPBA 3UATA 3PGKA 4GOND 3TNYA 2W6JA 3HPQA 1KI4A 3JRWA 3QENA 3G5AA 4RD0A 5IULC 4X3CA 3UQZA 2ZIVB 2WW8A 3NV9A 1JPVA 2VNSA 1VHLA 2B8EA 2IGBA 4IFEA 4FT4A 4GKKB 1VIVA 4TV8A 5CFOA 3GBPA 2N9UA 3OTGA 2BP7A 2G80A 2EX4A 3EGIA 3F3KA 3OLZA 1DWPA 2R7MA 3LCMA 4MR9B 4Q1VA 2QMZA 1K8ZB 4E51A 5ADWA 3K32A 1DKOA 3ELYA 2WKRA 1V1JA 4LRYA 3TPFA 4OFBA 5LPNA 1T2CA 2RAUA 2YJ6A 5AJYA 4IOJA 4FFSA 2AC4A 5JZMA 1FYVA 1M1UA 3MWDB 1QAMA 4GKJB 5F52A 2XZOA 3HU2A 1C7FA 3B1FA 3LY8A 5J4VA 2ZI5A 3CUKA 1PFUA 3V97A 4YY3B 3HCNA 5KX5B 1XL0A 4KFSA 3ZU3A 2HZ7A 1JPJA 1Y7HA 4FNOA 1V3VA 1OZFA 4E5UA 2PG3A 2C4WA 1DAGA 2X5XA 2DR0A 4ND8B 4PIPA 1K2WA 4RK0A 5FB3A 2I4IA 5FUBA 3GJQA 3V2HA 1A5AB 2BEUA 4ATNA 4FB5A 2FLVA 3QFHA 4OP2A 2NUTA 1DFHA 4U2DA 3PYLA 3TNLA 3S6JA 1CNFA 3I5AA 1LBQA 1SIBE 3HA7A 1H42A 4N18A 1T0UA 4UJ3A 5JS8A 2AEFA 3WWYA 5F3DA 4GIBA 4JBLA 2EJCA 3B52X 1CF9A 4EARA 2FP3A 2V4MA 3CEAA 1H0SA 3C3MA 5TLSA 2A3RA 1Z37A 4RVDA 5BNFA 1Q0ZA 1SKYE 2XJ9A 1K1EA 4Y6LA 2X58A 3C3EA 1ID1A 4DSAA 3Q8MA 3ENWA 1DIBA 1I5EA 4V03A 2PMWB 1T36B 3HL0A 3W1VA 5FBWB 2I91A 1P91A 2BDTA 3K92A 2ID4A 3VZQA 1ECLA 3OY2A 5FR1A 3UCFA 4GX0A 1TJ3A 4LGYA 3WLFA 2VQEB 4CKEA 1YIOA 1XVLA 4DA6A 2PSFA 1A9PA 2WWGA 1XBTA 5L45A 3KQKA 4RA9B 3CLRC 1X19A 3L93A 3LT2A 3FYTA 4BRZA 1CF4A 1RXVA 2YRXA 3KZMA 5HRUA 1B74A 1LF5A 1ECPA 2BLNA 1Q3KA 1LSOA 2AMLA 2KWIA 3PGLA 3U2QA 3HE3A 4ZI7B 2NO1A 3EAQA 3IDOA 3ADCA 2B5VA 4UARA 4OQLA 4FIDA 4MA4A 3NIDB 3ISJA 1PJLA 1A4IA 4ML3A 4B3IA 4KHPB 1XKLA 2RGNA 4P80A 4XFJA 1LC3A 2EZ4A 2L69A 3L7DA 5JJ5A 4W63A 1QQTA 3HPRA 1Y4SA 4K7JA 2A67A 4R9NA 5CBPB 3RAGA 1WU7A 2DTDA 1RYMA 1ODJA 4XYBA 2OBNA 5BSHA 1NUQA 3A4NA 2NSLA 1PEYA 3HYNA 4R8RA 2ZTUA 4ES6A 1KH3A 1CDDA 2A1TS 4HH0A 4HZUB 4NU6A 4C43A 4GSKA 1YSCA 1PS0A 2G0TA 2AC7A 3I52A 3L7YA 3OH8A 1UF9A 1XEXA 2UYQA 2Y77A 3NBZC 5IUJC 2P78A 2J32A 2PPVA 2PLRA 2R44A 2X3FA 2FXVA 3ENNA 4B3CA 1FOEB 1JEJA 1N0UA 3BGSA 2J1LA 2VNIA 3WLRA 1OPRA 1Z6AA 2VSXA 1U2ZA 2FX5A 1OIXA 2ZBFA 1CQXA 3IOCA 2W6ID 2XX3A 2YV5A 3K0AB 1I30A 2QR2A 3ET4A 4JBHA 4DCTA 4F4CA 3V48A 2OLEA 3EGOA 3ILVA 1YCGA 1QS0B 4C14A 1GAQA 3R5KA 1ACJA 3I76A 5FQNA 4A6EA 4MV3A 3C8ZA 4FJ2A 5IAJA 1XQVA 4C4YA 1E64A 4LBVA 2O48X 2C2WA 4AJLA 3G7UA 3D4BA 4YAOA 1ZU4A 3GRYA 1O95A 3DAPA 1PL7A 1P2BA 1K8YB 4X92A 5J2TA 3FOFC 1X0XA 4WNCA 2OAEA 2WJPA 2A8YA 3BMNA 2D5LA 5FA8A 4KMMA 4OK3A 4GQAA 5MFPA 1GPAA 1ECJA 2Y6UA 2IP1A 1E1DA 2TMKA 4FDVA 4ZRDA 1Y4AE 3FLMA 1T6XA 1G42A 3P96A 5T8KA 3GH1A 1N6OA 2GJAA 4B2IA 3F1LA 1NJ6A 3UWKA 5ILOA 5AW5A 2GPBA 4YNBA 1TPZA 3LX6A 3DPIA 3TYXA 1E2HA 1WIWA 4LX0A 4MCJA 2V6BA 2GCOA 4KKVA 1NUTA 1YI1A 3PRHA 1EFRA 1CNMA 1E3EA 1DJNA 3OZCA 4NMHA 3RKSA 1REQA 4BVAA 621PA 2ZM5A 5FFFA 1VL5A 1L4YA 3N07A 1FDVA 1QE5A 4DXDA 4NBUA 2XUHA 5LZ8A 4AMUA 2XMRA 3O8OA 3D3QA 3C7CB 5IJXA 1RAGA 3UN1A 1ILEA 2YN0A 1OWPA 3DLCA 3V5NA 1S01A 3O1HB 4G8BA 1DZIA 1MB3A 1CEXA 1CNEA 2X8JB 1AQ6A 1RAEA 2JFXA 3K8OE 4ABTA 4GMXA 3KYDB 3WDKA 1XJ5A 2AJTA 2ZWIA 4I9HA 2DWOA 2UZ1B 3O8NA 3JPYA 4DMRA 5B7PA 3S8YA 4I8IA 3ESXA 2CL0X 1SVSA 4REQA 2B7CA 2SCUA 4TV8F 3H42B 4X95A 4YT5A 4C0SA 1GV0A 3SPXA 3IQDB 5F1OA 1G17A 3IPXA 4A8JB 4YPOA 1NL3A 5DWQA 5B53A 1IPHA 1UDBA 1A76A 2ETVA 3DMGA 4LOIA 3LTNC 2O5EA 3A6JA 1EP3B 1USGA 2OMKA 5DTMA 4KN5A 2RG1A 3ANXA 2I3BA 2REXB 4NNOA 2XMDA 2W2TA 1YDGA 3G49A 2EBFX 2EGHA 4HS9A 1U11A 2CDAA 3JVDA 3EXEA 2F62A 1F14A 1EE1A 4OQDA 5DNWA 1X7ZB 3UM9A 1I1QB 4D3XA 4ZZ1A 4P6VF 1NBAA 4IOLA 4MV9A 1T6ZA 3KOXA 4W1QA 1S1MA 5DHPA 1SQ0A 3W5JA 4F86A 3DHYA 2D1SA 2W7TA 2NUPB 3KQQA 4TMVA 1Q0PA 3AY7A 1LPPA 5K8UA 3AUSA 4HCJA 4M1ZA 5NLLA 4WEQA 1X74A 4H4CA 4E94A 1EBUA 4TSFA 4DQLA 5JH7B 1C7ZA 1J56A 2XGJA 1DRWA 1OI4A 3CZAA 4RHXA 1WVIA 1BDMA 3N2GB 4X1KA 2WJZB 1ZOSA 1W49A 4X6LA 5LDHA 5GONB 3KKKA 4BPBA 2ZUVA 1ABEA 4XM0A 3ZN2A 3S1SA 1NVWQ 1PG5A 1GY8A 1G3UA 5DCUA 1C0LA 3J7TA 5F2OA 4R1PA 2Z6UA 1O95D 3VM6A 3ILYA 4A03A 2HHHB 3UUFA 4DARA 2F1RA 1UQTA 2AVDA 3GHYA 3NHRA 4QLAA 1DX9A 4XH9B 1E8NA 4FZJA 5DH9A 1E7QA 2UUOA 1AUQA 2F9FA 4M22A 3KQWA 2VT7A 4FP9A 4WTOA 3DAOA 1T5SA 4GPZA 2OA0A 3RIEA 1NJGA 1ZBQA 1MGOA 3DL2A 4P33A 2MTBA 1W73A 5IS2A 1KAGA 3R8XA 1DTWB 3T3GA 2PIAA 2IPOA 4FE7A 5CBPA 3FXAA 2HHJA 1G7SA 4IDOA 1CETA 2OCKA 2VDWA 4UUMA 1T24A 4EH1A 3O92A 2JGEA 1E7MA 1PL8A 4NZOA 1M5RA 4FBLA 3P0IA 4OI0A 3DYBA 5AKYA 2FSUA 1VKRA 1QGYA 2B6HA 2C9BA 4BO3A 2UZIR 4YCNA 3PCRB 4H1UA 4R3WA 3RYTC 5J4LA 2I29A 1EG2A 5CXUA 1A9TA 3KSZO 3TRHA 1E0AA 1SG0A 3IVXA 3O1LA 2GTIA 5LUBA 3RRJA 1K06A 4X0EA 1JS1X 2ISQA 2BRUA 4IH9A 2VTEA 1E3TA 2BEVB 3IIKA 4H0FA 4CM1A 5BVHA 1QF7A 2I4TA 4EEZA 1N4DA 2JIPA 3OZAA 1YQDA 1ZH0A 2X6RA 3RADC 3BIWA 4C22A 3SZMA 5TGTA 4BNDA 2B4QA 3QVSA 4YRMA 2O06A 4JDUA 5FIUA 5DMHA 1RFLA 1X8JA 3M6UA 2X86A 1JDSA 1PLJA 1Q6YA 1VBKA 4EYSA 3OD1A 3OTQA 3IAUA 1KZ7B 3NOVA 4PZEA 3ZY2A 4CWAA 2FWRA 1XI2A 2QSJA 5F1YA 1K8RA 3I64A 4PTLA 3RIGA 4FGKA 2VRCD 1GZ4A 4W9NC 1BROA 1DQYA 2PBFA 3ZV7A 3CKMA 4EF6A 4NFSA 3FYSA 1HDCA 3EBOA 5AD1A 2V9PA 3EDQA 4TMKA 4DGQA 2PYZA 5E8JA 1EM8B 3R76A 1IRXA 2HSWA 1E94E 4K5QA 1HM5A 1VG0B 2FMKA 2Y1KA 3LQKA 4GYYA 1WXGA 4L8LA 4OQFA 1QO7A 1MJNA 2HMSA 3LX8A 1JEYA 1VCOA 4PAOA 3FCEA 3R9XB 3PGVA 2WR8A 2QAGB 1QC5A 2XUAA 1G4UR 3EGDB 4CLDA 4WJLA 1J0BA 1WTCA 4UNSA 3UTCA 4CQMD 2JGMA 4TZ6A 5CLHA 1D1QA 3L8GA 4A7PA 1W87A 1G0NA 1QFSA 1GPKA 4F4FA 1LSJA 1RC1A 5ALNA 5J63A 3AZPA 4NPAA 4V02A 3ID6C 4RGVA 2CLOB 4AP6A 3MTAA 4H1VA 1AIPA 1UUFA 2SKEA 3VH1A 1QQ6A 2OUKA 4XW2A 2LR0A 3RTAA 2HC9A 4HQ6A 4XIJA 4AJ9A 3DNPA 5FNVF 2WUVA 4CM4A 3B7GA 4L5BA 4WK6A 4ER7A 1JNXX 5FBHA 3RBXA 2IS6A 2PSJA 2C0CA 2IYRA 3AHHA 4IMRA 4QODA 2ENWA 3SSNA 4H6PA 3TD2A 1OA0A 9ABPA 2AZTA 1N6RA 2D5AA 5A3JA 1T3TA 4OM8A 5CT6A 2JLUA 3R7LA 2IC5A 4CM8B 5JOQA 1RQGA 1K9SA 1VPEA 3KKEA 4YJHA 3FLBA 3HBNA 3QU4A 3TAXA 1TZMA 3GPCA 2P6UA 2AG0A 3BB3A 4Y2RA 3USES 2VHWA 1XYGA 2FETA 3BWEA 5IABA 3D3WA 3IBGA 5EZYA 221PA 1U9IA 3OE1A 1W75A 3DP7A 4NZPA 1RRPA 4BKOA 1I33A 5M3BA 4X66B 5KTMA 2GK3A 4AMZA 4LK2A 3LA6A 4BPRA 4FSDA 4KU4A 3PC3A 1U9CA 2QGFA 3LHIA 3P9PA 2QQEA 3ZOZA 2NM0A 4HH4A 1Y8RA 4FW9A 4QM6A 2QGZA 1ISJA 4YMUA 2NUPA 3GLIE 3FWYA 3DKKA 3BGVA 2HQSA 3BH0A 1E6KA 2QSZA 1IPEA 3TFOA 2P9JA 4KNVA 2WOOA 3EYWA 2DF8A 1I4WA 4M9CA 2BKUA 1OH7A 2B37A 2I6FA 3MFQA 4Z99A 2WWHA 3COZA 4HTFB 3BXZA 4BO2A 2BFEA 2VR1A 1F7VA 4JJ4A 5AO9A 5L3ZA 2Y92A 3ITDA 1QVWA 1CUHA 4RY9A 3HVRA 2ZXUA 2Z4SA 2SNIE 3L41A 1MBZA 5IW8A 3OECA 3CJQA 4JB2A 3ZE6A 5PNTA 2CKMA 2RGGA 1ZQ1A 3KE8A 3ZLUA 5C18A 3W6PA 2Z08A 5D7BA 5E8RA 3E9NA 4J75A 4P3PA 1ODKA 3C39A 1RBYA 3ICEA 5LMZA 4LHZA 1F6DA 2SCUB 4UEWA 1M1NB 3GD5A 4CM5A 5A7FA 3DDUA 4MKZA 1G9XA 5FPHA 4J0CA 5HILA 5AVUA 1T4GA 2XMQA 1T6NA 2UZ1A 4KSBA 5LMUB 3CS3A 3GEHA 1JMVA 2YUTA 3AOGA 5HRCA 5B58T 2NV2B 3T12A 1DKNA 4KPYA 1NKVA 2J08A 3PIDA 2N75A 4TMFA 2OPHA 4BVFA 3FNGA 4GPD1 3PEUA 4R2LA 3L8CA 1NVXQ 3PFNA 3RVOA 3S5JA 2Q6TA 2C4TA 5KVAA 4GOOD 1UKCA 1SVLA 3IALA 2PEZA 1KR2A 1YJ5A 4XDGA 2HREA 1I3KA 2R3SA 3IPAA 3ND6A 3QVVA 2A9JA 2UKDA 4QDJA 5JZVA 3RSSA 2PXCA 5B4VA 2AX3A 4DLNA 1XSEA 1Y0BA 3BB4A 3CW8X 1L5WA 2VI5A 4TMXA 2D1YA 4RIEA 1ZG3A 2P9QA 4BNTA 5CA0B 3VDQA 5ENDA 1SBTA 5AUPB 5CFQA 2HMYB 3U6KA 1L7AA 3W7BA 2CNBA 2PLWA 5HUJA 4R7TA 1GOTA 2VUUA 1U65A 3AUTA 3A2MA 1QK5A 1E5XA 3CGGA 1M33A 1ZWKA 5K3AA 5A71A 4LF7B 4CMEA 2J0SA 4FYVA 2EJVA 2QRHA 1WCV1 1GWNA 5AXBA 2VKQA 4ALIA 1DU4A 4IDHA 3ON5A 4IINA 3V4VB 2X8LA 3ACBA 5C4IA 3DQPA 3EEQA 4R40A 2F59A 2MSWA 4Z1MD 5H9WA 1A9XA 5BQFA 2WAOA 1WPQA 2WIDA 3B3JA 3DKRA 3H17A 4HAVA 5LB2A 5A02A 3LQ1A 4JKOA 5EIEA 5JU6A 4TS9A 1QORA 1S5PA 1QO0A 1W94A 5TV2A 5CLJA 4WW0A 2J31A 4RPGA 3BWDD 3VR6H 1EUYA 4FGZA 3K1YA 1W1IA 4WXRA 1V47A 2WM2A 1C30B 2PBRA 3R5JA 3UMBA 4DAOA 3JASA 4P08A 3HMQA 4XSHA 3MD0A 3PGJA 5C37A 3O8RA 1PN3A 1YUBA 1M2VB 1CJKC 2GKSA 2YVQA 1PV2A 3TTXA 4H0NA 4B85A 1YRHA 4NBRA 3Q3HA 4WX2B 1NMZA 2OV6A 4L28A 4TTTS 3V1NA 5MN5A 1U0RA 2Y2UA 1ZD3A 3A2LA 5ALSA