3W9YA

Crystal structure of the human dlg1 guanylate kinase domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
175
Chain Sequence
NYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
publication title Crystal structure of the guanylate kinase domain from discs large homolog 1 (DLG1/SAP97)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 52
structure length 175
sequence length 193
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3w9yA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w9yA01
4DDTA 1NKTA 3DDCA 4TMVA 1IXZA 4UNSA 2NZ8A 1FL9A 3W90A 2FMXA 2ZRKA 3I1FA 1AZSC 1PZNA 421PA 5EE3A 2IEYA 3DMDA 5HZHA 4XOIA 4HUTA 2ANBA 4LC0A 3THWA 1XTJA 4FMBB 3PUYA 2WIAA 3QKRA 5E95A 1R5NA 3LX5A 3TH5A 2PJRA 2B6HA 4M8NE 5DN6D 1OH8A 3U3RA 1XEXA 3GLGB 5TXGA 1QBKC 3MAAC 3OEED 4XWOA 3I72A 1ZC3A 1AGPA 2QI9C 4TZ6A 4IVRA 5GJWC 5JBQA 2YWEA 4DBLC 1WDTA 4LC1A 1UBFA 2BEKA 3CF2A 5FL7A 1G3UA 2GVZC 1XF9A 2GAOA 1KDRA 3B85A 1P5ZB 3UKDA 2JJ2D 2W2VA 2ZR9A 1WE2A 3IIJA 1MO5A 3BORA 5J40A 4C0AC 4GL2A 3JVUA 1XTRA 3WYFA 1SVMA 4UKDA 3E2IA 1X1SA 2GCOB 4EUNA 5SZJA 1RRCA 1NN0A 2GKSA 1R8QA 4NCJA 4NL4H 2NO6A 1DAFA 1KI4A 4IJMA 1SVLA 2WKRA 2GJ9A 3K9NA 4TWZA 4CT5A 1KO8A 4OQFA 1VHLA 4FI3C 2IT1A 3BERA 2OAQ1 4A6PA 4ESVA 2CCGA 2FSGA 1VMAA 3NVAA 1KSJA 1KO7A 3U3OA 1G8GA 1FZQA 1G8HA 2ZREA 5DI3A 3X1DA 3NG1A 3I8XA 1MV5A 3IIKA 3FTQA 3H1TA 4AKIA 3ZZUA 3Q5DA 4AI6A 2OLKA 3KXIA 1G1MA 3QPUA 4LBYA 5FOWA 3UANA 2IW3A 2Q3MA 1KOFA 3AKCA 5FI0B 1Z83A 1GAJA 1T3LA 3DZ8A 3DZDA 1ZU5A 4ARZA 3AVPA 4EPWA 5FR1A 2OXRA 2H17A 5DYGA 1MRNA 5FR2A 3TKLA 1RW4A 4QOSA 4RZUA 5L3QA 3LA6A 1Z47A 3QOFA 1NSTA 1M8PA 2A78A 5BQ5A 1U8YA 3X1ZA 3FHTA 3N2IA 4M21A 3CLVA 3BIFA 3QF7A 4PANA 4JLDA 2ZRFA 5FTLA 3U7GA 1WXQA 1YRBA 2J0SA 2J7KA 4TL6A 1GVNB 4GMXA 3GLHA 1KI7A 3K1JA 3OF5A 1QHIA 4Q00A 4RD0A 3TJZA 3VR3A 3T5DA 2XXAB 5GJCA 1G3RA 1CF4A 5GJBA 1S3GA 2PBRA 3B2EA 3QXXA 4YMWA 1G3MA 4JLNA 3AVOA 1GNQA 1ZIOA 3UWOA 2VL7A 5F9FA 1RRPA 3MWJA 4WIAA 4HB3A 1YR6A 4FIDA 2VBCA 1OH6A 4CEIA 3X1WA 4UJ3A 3KXKA 2BBTA 4NMMA 4HB0A 4LY6A 2QT0A 4MGZR 5D3MA 2CL7X 4F93B 3DM9B 3AKDA 4ZDIA 3OIUA 4YMUA 1ELOA 2DWPA 3B1ZA 3SJBA 1LFDB 2CXXA 4PSVA 5GVSA 4PHGA 4ACBA 2FEOA 2W6JD 4H9GA 4LRWA 1XCPA 5G3ZA 4YDHB 4C0KA 2O8DA 4MUAA 3CKLA 1L4UA 3CB4A 4PX9A 1DG3A 3RS0A 2AKYA 3TAUA 3B1VA 1GRNA 3WP1B 5BN5A 3UMFA 3KUCA 4MYCA 5JJIA 2X8AA 1CJTC 4N0DA 4QNRA 4URWR 3K70B 1UKEA 1G18A 1E2HA 4GZMA 3R8CA 2G0NA 1JB1A 1JR3A 3P20A 3KTAA 4F92B 4GOXA 2GCPA 2FSIA 1YQTA 2D2FA 1HEIA 3RS2A 1N5KA 3Q72A 4EPVA 4GP6A 1UKZA 2ODNA 2F43A 4X8OA 4HAXA 1DARA 1TL7C 4QKQA 5IRCD 4BWYA 3ADCA 2ZRMA 3WMEA 4JLAA 5DYIA 1TADA 4MRNA 4NKRA 1H8HD 1I4LD 3KKNA 3THYB 3IEVA 4LPSA 4DCVA 3BC1A 4WZBE 4KBFA 2CBZA 3PR1A 4TLDA 2CNWA 5E3HA 2FGKA 3GJ5A 3AB3A 3B8HA 5J4LA 3ZVNA 5DISB 1G9XA 4IOJA 1VYUA 5EUMA 3NHBA 2VHQA 1KK0A 1N0UA 3N5CA 2IYVA 3NDPA 2QN6A 3ADKA 3L0OA 3BFVA 1W49A 2ZXUA 2PH1A 4K46A 3EA0A 4QBHA 1CLUA 4US2R 2ORIA 1AA9A 2IHBA 5ANRB 2XZLA 2EFGA 4Q4JB 1XPRA 1HV8A 1U8AA 1O87A 2FFQA 1XBTA 3IO5A 4IHQA 2VP2A 4FXPA 1US8B 1YKSA 2J7PA 4F91B 4BFTA 1S9DA 4NYJQ 5LB4A 4IKEA 4KFUA 1TX4B 1RYHA 3IDQA 1SXJD 3ADDA 2XB2A 1ZUHA 3I3SR 1CR0A 4JT2A 3P26A 5JLJA 4A1FA 4N3NA 4US0R 1SVSA 3EPJA 1G3QA 2RKOA 4YLGA 4LYJA 4FW9A 1F2TB 3TW4A 3LXRA 2MSCB 4GNKA 1BO6A 2RAPA 5TB5A 3C5HA 4JKYA 2XNDA 4PO1A 2F55A 2R65A 3EZ9A 1NVVR 1OIXA 4QM7A 4OHYA 3W3AA 1VCMA 3HU1A 4L15A 2CJWB 2OM2A 2ODBA 2QGNA 1RKBA 3SJCA 1GKYA 2N1BA 5FPHA 2GETA 3EZFA 4B6FA 1E2JA 1YVDA 1N6LA 4EDHA 5KPDA 3NH6A 3GLIA 3SS8A 4MA4A 3WNBA 5J4YA 3LVQE 4JL8A 4RFSA 2ZRLA 4DIDA 1RRGA 4W5JA 3TQFA 4DLUA 4AG6A 3W6PA 4HB4A 3LBIA 2ZUBA 1U90A 1ZUNB 1ZNYA 4OBEA 2QPTA 2ZI5A 2J41A 8OHMA 4KAXA 2NO1A 1S2MA 5FOXA 2GJKA 1CP2A 1U0LA 4C7OA 1E94E 2O0JA 4URVR 4PPGA 3PG5A 4DKXA 3VTKA 4M0LA 3AP2A 4NYJR 2BC9A 3H2YA 4PC7A 1Z5ZA 2IHYA 4TN1A 4WVFA 1HQYE 2KBEA 2R62A 3DOEA 1ZD8A 2XX3A 3K09C 2TMKA 1N2CE 4TT3A 5FOVA 4ZCMA 1DOAA 2HLDA 2OFOA 4AD8A 1VPLA 2C9YA 2IC5A 1KY3A 2QORA 1ZW6A 4JYCA 1TF5A 2ZITA 4RZ3A 1CBUA 2EU8A 4JSTA 3TUIC 3W8RA 2WV9A 4G01B 4JLBA 4ACAA 3BB3A 2WWXA 1JPJA 4I4LA 2FV8A 3QKUA 2E1RA 1R6BX 4GRAA 1ZCBA 4RZXA 1SKYE 4F7WA 5EP1A 1LB1B 5BYJA 1SXJE 4Q4AA 1W44A 4AYXA 1DS6A 1II0A 2WZQA 4R2HA 1D8TA 4LHYA 2ZU0C 3AUXA 3SFVA 2ZI6A 3UMRA 2D7CA 1BIFA 1XJCA 4JBYA 2I3BA 4M9QA 4Z1MA 3AH8A 4DUGA 4B2LA 2WJYA 1J99A 2GXQA 3RS4A 2F1HA 2RGAA 4NONA 3H4MA 2PEYA 1OXVA 1FNNA 4R9UC 4Q7LA 2O0KA 1OXUA 4QXAA 3FKSA 2OBLA 4Q66C 3TSWA 3AM1A 4RVCA 1AS2A 3A1SA 1N6KA 4C2TA 1R8SA 5EP2A 5FPYA 2OFWA 1Z22A 3QXCA 1T9HA 3AF1A 4B75A 4WBSA 1CTQA 1R0WA 2VP0A 2J5XA 2QMHA 3BH0A 2RB4A 1F2UB 2OCAA 1E32A 2NGRA 2QP4A 2C9CA 1EFTA 2AHOA 3EPKA 5LD2B 3L82B 2D3WA 4JVNA 1DVRA 3A36A 3AF3A 2OLJA 4IEIA 3PUVA 5FUVA 1ESNA 3U44A 3ZGXA 3WRXC 2NIPA 3NBFA 1N6NA 2JGNA 3NXSA 2UZIR 2WOJA 1JXMA 1M7BA 3ICEA 1PLJA 4DSTA 1IY1A 5UKDA 4M1WA 2ZSAA 2IEZA 3QEJA 4DSNA 4HUQA 3PEWA 1XFAA 1AN0A 1J7KA 3TAHA 2CLSA 5B58C 1IXSB 4XWKA 4QBGB 3RRNA 2FGJA 1I4DD 2JASA 2JJ1D 3BK7A 5SZIA 1VECA 4JJKA 4I1VA 3ADBA 1E1QD 4KFRA 5FTJA 2WVJA 2ZRJA 2VYFA 4DT1B 5JHGB 3ZJYA 1FP7A 4K81B 4GOKA 5JSZA 1HTWA 1COWA 1VIYA 1ZYUA 4Q9HA 1KDOA 2C98A 4TMTA 2Z43A 3QY0A 3K9LA 2AD1A 2IYXA 2RGDA 1AM4D 3QVVA 2HYIC 4MKIA 3CRVA 1G3IA 2ZRCA 4B35A 1E3MA 1UJ2A 2HF9A 1QHNA 1KI9A 1OFHA 1KZ7B 1YZQA 4LYFA 4A0RA 2IS4A 3OIYA 4MKFA 4I1SA 2PX0A 4DLWA 4MRRA 1P9RA 1G4AE 1FOEB 4XIGS 4FWIB 1F48A 2AR7A 1HUQA 2AL7A 2FJUA 3K09A 1XX6A 3VR2A 2D62A 3TE6A 2W6IA 1KDTA 3OESA 1G20E 2P6NA 3TR5A 3TVTA 3TBKA 1RRFA 1OFIA 3PQCA 1Z0DA 4JL5A 2BJVA 1HURA 3I92A 3GLGA 4IDQA 3JVVA 4RD6A 3CZQA 3WNCA 3QXJA 2MSEB 4M1OA 3WY9A 5L3SB 2KWIA 1TAGA 1OLOA 1GRQA 3RVBA 1JXOA 1E6CA 1OJLA 4G5OA 2PT5A 4OKSA 5A4JA 2ZRGA 3GD7A 3GJ6A 3W5IA 2OXCA 2OBMA 1Z6YA 2O8EA 3QG1A 1XZQA 2A7QA 4LYHA 3FPAA 2RGGA 2AFHE 1Z6XA 4UNRA 3TMKA 4DIEA 4PAQA 4YMSA 3RSLA 3VR5A 2QRNA 2V6JA 3U6BA 2RH5A 2ZIAA 4HZUB 4ZDJA 3FYHA 3A37A 4Q9LA 1UPTA 2OEPA 4AY2A 2R6CA 1OV4A 1MKYA 2Z4SA 2ZAMA 4B3DA 3QKSA 4DLXA 1XTQA 1KMHB 4CRWB 4F4IA 4US1R 4A2PA 4BLPA 3UMSA 1LF0A 2IXGA 4MGIR 3BXZA 4JLPA 2R44A 4GP7A 5FL3A 3AGQA 1KI2A 3SYNA 5KTYA 2PCJA 4JVMA 2ZR0A 1ZP6A 1TUEA 2DWQA 2ZVPX 3RSOA 4PC1A 1ETUA 1A2KC 3KFXA 1QRAA 4TL8A 5EQTA 4NYIQ 3JZMA 1DPFA 2ZI7A 4KBGA 3A1VA 3UIEA 1MO3A 1JBKA 3IPXA 4KSCA 1ZD1A 4XWAA 5K8IA 4HB2A 4NPHA 3FMOB 4LJ9A 4EQ6B 3L43A 1W2GA 2ZS8A 1W48A 3MG9A 1E2PA 1VYVA 4HLUA 3ZVMA 1A4RA 3PV0A 3I62A 2W83A 1OSNA 1T8UA 5EZ5A 1G21E 4JLKA 2JDID 3C14C 2C9OA 3EASA 4Q1FA 3KKPA 5HZKA 3SHFA 2O8CA 5HKKD 2GVDC 2QP3A 1GOTA 2VO1A 4U7DA 4ZIRB 2CMKA 1PUIA 1SKYB 3BOSA 3EZ2A 4HDQB 3C16C 1SXJB 1TUIA 3WBJA 1KI8A 1MT0A 2P2LA 3L0IB 1OIVA 4MH0R 4LV6A 3EZ7A 4KFTA 2H57A 1XJQA 4G0NA 3AF4A 5CIWA 3RYTC 4P4TA 3SR0A 4C9BA 2BIFA 1XNJA 3ZS8A 4PQRA 4AWXA 4R7ZA 1J8MF 1Z0KA 2P67A 3ZYCA 4L8GA 1FX0A 3A1UA 3PEVA 1FFHA 5F9HA 3SEAA 4DDVA 1OXTA 1MR3F 2B8TA 5SZHB 1WF3A 2P6UA 3NBZC 3AVTA 1W46A 2RHDA 1XXHE 4QHYA 2L0XA 2PCLA 2ZSBA 4TLCA 3CWQA 4XD7D 1W0JA 1HA3A 3TGPA 3C15C 2YOHA 4OQMA 1RIFA 3VU9A 4F4JA 4A8JB 1SHZA 2FFAA 4KODA 5B30A 5KOYA 4C2UA 4Q7JB 1LS6A 4LGMA 1GG2A 5L3VA 1XDBA 3B78A 4EJSB 1FTSA 3H84A 2IX3A 2BBSA 3QXHA 4BFYA 4WW0A 4DJTA 3ETLA 3SYLA 2ECKA 2C04A 3MJRA 2JLQA 1R0ZA 2QM8A 3K0EA 3PUXA 3QBTA 3U7FB 4MQBA 4PSKA 4Q1AA 4NHOA 2YZ2A 3DO6A 1ODFA 2LCFA 3AVWA 3U4QB 1C1YA 2E9SA 4W5HA 1TQ2A 4HATA 1XMJA 4E22A 2ZAOA 2W0MA 4Q9JA 3ZVRA 4TQ9A 4OHVA 2A5FA 2Z4RA 1GL9B 1UBEA 1XP8A 5FL7D 4Q4JA 3IHLA 1KDPA 2ASEA 2RHMA 2XOKA 4BASA 3Q3JB 4DCSA 3A4MA 4ZV4A 1GWNA 2RGXA 1BOFA 3R7WB 3W6NA 4YMTA 4YMVA 5CLLA 4IOMA 1DAHA 2G1KA 1ZIPA 1QDEA 3LVRE 1DAIA 5C4GB 2ZU6A 5LD2C 2IF2A 1KI6A 1W4AA 2JIZA 1RYFA 3QPVA 4MRSA 2JJ8A 2QPOA 2QA5A 3U3JA 3CWZA 2HEIA 5JI2E 1XTKA 2FOLA 1KAGA 3QIAA 4G1UC 4LJ8A 1G7TA 3GFOA 1K8RA 3GMTA 4B43A 3C5CA 4JT4A 1GRRA 2OBNA 4L16A 3LD9A 2VPPA 2XJ4A 4B73A 1U9IC 1P2UA 4G5SA 4Q02A 1M34E 3OAAA 4XSGA 3WNDA 2IF0A 1GZSA 2GEVA 2D06A 2YINC 1NL3A 3LQQA 3ND9A 2ZR7A 2BM1A 2B21A 1W47A 4D4JA 4TYNA 2PLFA 4BRWA 4UNQA 4JLOA 2AK2A 3K0AB 5HR5A 2NG1A 1W36D 4C4PA 3KDSE 4DLZA 2EYUA 2ERYA 3RHFA 4QBIA 2EYQA 5G3YA 4D4KA 4RY2A 5CB8A 1QHGA 5JZVA 4B74A 1W5TA 3E1SA 4TMWA 3FGNA 4Q4LA 1XEWX 4Q4HB 5K8UA 3ZQJA 2DFTA 2GK7A 2EWWA 3ECCA 5TDHA 3LXXA 1ZINA 1JPNA 5BW8A 2P5SA 1E0JA 3CPHA 5JS7A 3W9YA 1QZXA 1E2EA 2VP4A 2ODWA 1KYIA 3RNLA 2IYUA 4IDPA 2KB0A 2ANCA 2WBLC 3TK1A 3RWOA 4K8OA 2REBA 4FCWA 2VLIA 2JLZA 2G1JA 4DB2A 2D74A 4RFVA 3PITA 1UKVY 4FMDB 1TQDA 2FF7A 1IOZA 3C4JA 1PJRA 1KSFX 4A4DA 1IY0A 521PA 4BEBA 1OB5A 3QSYA 3NKVA 1V5WA 4IDNA 2XZPA 2LKCA 1JEEA 1AS0A 2CE7A 3QI2A 4LJ7A 3TUJC 2WTUA 2R9VA 3HYRA 3MWKA 2FE4A 4HLQB 3QF4B 2IYWA 5EP3A 1QVAA 3DKVA 2ZRIA 1P2SA 5HE9A 2XTNA 2G88A 4Q01A 3SZRA 5P21A 2GZDA 4O2RA 2IBMA 2ONKA 4NYMQ 4QC2A 4TSFA 4KYIB 2GF0A 2GJAA 2Z6VA 4FMDF 3EIEA 3ZIAA 2YKGA 1XJ0A 2IUTA 4QHTA 1S96A 2QRZA 1MABA 2HYDA 3LWNA 4H1UA 4E09A 1NMXA 5HCIA 4A36A 2CCKA 3W8NA 2LKDA 1Q1BA 1T8TA 1XMVA 3VNVA 1S0UA 1JR3D 4IRUB 1CEEA 1FQJA 2VHTA 2J0QA 2CL6X 1VKJA 4B76A 4WZAE 2FDCA 1E69A 5IHPA 4Q9KA 2C2HA 1XD2A 4GDFA 3D6TB 4KU4A 1LF5A 4MGKR 4WXPA 5A0FA 1W5SA 4Q1DA 5H70A 3KB1A 3TW8B 1Z6TA 2J45A 4Q1BA 2PMDA 1EFUA 2FSHA 2G3YA 1F2UA 5JECA 2WWGA 1Q21A 1Q57A 5AK0A 4HAYA 4DCUA 4V0KA 1NF3A 3I5YA 3BAFA 3T1TA 3K9GA 5L3RA 1ZBDA 4OQNA 1Z6AA 2CNWD 3O8CA 1VCNA 2ZI3A 2ZYVX 3GLHE 5IF9A 4N0EA 5EP4A 5KNDA 1VG1A 2MSDB 3EZ6A 4NYMR 2DPXA 3PEUA 1UDXA 2WJIA 1U9IA 3G82C 2J3EA 1G19A 3PUWA 4V02A 4Y0VA 2CLDX 121PA 2X2EA 3D7MA 3G5UA 4FMCF 4P4SB 1G4UR 5EXXA 3HWSA 2R6FA 2V55B 4EIWA 2J7PD 2C77A 5H68A 3GJ0A 3EIHA 3KQHA 3CX6A 5C4MA 5FUYA 1BMFA 2QAJA 1XTIA 4DT1A 3EIQA 1XXHB 4AC9A 1ZMXA 1VYTA 3HU2A 3AVXA 1BYUA 1CU1A 2OCPA 3UATA 4A2WA 2XJ9A 2EFCB 3EC2A 2CK3A 2N46A 1ZC4A 1VDZA 1Q12A 2BMEA 2YHSA 2YC2C 1Z2AA 4TL7A 1ESMA 3PXGA 4BFUA 4OI0A 1SXJC 2XNDD 5H1YA 1ONBA 2C8VA 3BWDD 4KXFB 2EW1A 3OIVA 4D82A 2FX3A 4EFMA 1E2MA 1Z2CA 1C4OA 1N6PA 1NVVQ 1OKKA 3O8BA 3VR6A 5J47A 3GLFE 1E2FA 4QGFA 4PC2A 4DLYA 4JLVA 5FPTA 1FW6A 3QNUA 3U6KA 2A9KA 2GCNA 3VNUA 1CJMA 4PC6A 1IJFA 3RWMB 2WJHA 1P7CA 4ABYA 5KNCA 1XEFA 2WPDA 3SU8A 5M04A 5JCPA 4MRVA 4CEHB 4AK9A 4A8JC 3FDIA 1Q3TA 1FQKA 2HXSA 5DGXA 1TNDA 3NDBB 1GL7A 3KKOA 2OG2A 1CRPA 1N5IA 2WSMA 3BJIC 4EJSC 4JBWA 2QBYB 1BH2A 1FUKA 5E7IA 4V0OA 4I1UA 3FFBA 4TL9A 1UM8A 2HXYA 2O8BA 2QU8A 3ZH9B 2ZS9A 3ND8A 3DKPA 3K0FA 5FI1B 5G53C 4TT3D 5C46F 1VCIA 1SULA 4JYBA 3D31A 3T5GA 1P73A 3BS4A 3TLXA 5FBWB 2HLDD 3NH9A 2F7SA 4IXMA 3K8YA 4ZO4A 4KHZA 4M1MA 5D3QA 4TYQA 1N3BA 1QHHA 4HDCA 3HYTA 2PZEA 1IM2A 4HZUA 2ZPTX 5AJYA 4HDOB 2ZYTX 3FKQA 3K9HA 4BPBA 1Q3HA 2Q9BA 4PPFA 1HT1E 4LJ6A 1NMZA 4MUBA 1EWQA 5FTKA 4A2QA 5AUPB 1KMHA 2ZSFA 3W5JA 3F8TA 4BLTA 3Q5EA 2VP9A 2OESA 1S3SA 5DE3A 3SQXA 4LX0A 3C7KA 3KJEA 4TYPA 3A1TA 2ZJOA 4ZDKA 4Z1MD 4URUR 4DUGD 4X8LA 3RANA 2Q9CA 4PHTA 1F5NA 2G77B 3SE0A 5CDFE 3AVQA 2QAGB 4L5BA 4DLSA 4YQFA 1XD8A 3MGCA 3MFYA 3LQRA 4ZI2A 3GLIE 4DB4A 4LBZA 1UEIA 1IN8A 2GF9A 4LJ4A 4X8MA 3I5XA 1QHSA 3FOZA 3ZD7A 3FKSD 4IDOA 3BE4A 4EPYA 3EPHA 2C95A 2ATXA 1CKEA 2PL3A 3NEYA 1FNMA 1M1YE 4U00A 1Q20A 3QKRB 1NVUQ 1YZTA 2GXSA 4C0HA 5GVRA 2QMEA 4GBMA 4EQ6A 3AV0B 1XEXB 4TTPA 5AUNB 4V03A 1OF1A 1E4VA 3T15A 2B7CA 2CLCX 4KVGA 4KLNA 1AK2A 1YZUA 1KSGA 5TY0A 3WBKA 3CPJB 3ZZTA 1BYIA 1D2MA 1RC8A 1NN1A 3I32A 4C0QC 2BDTA 3GJ8A 1UBCA 3AKEA 1C9KA 1X8LA 4M9XA 2KE5A 2EVWX 2WJGA 4N1AA 2EFDB 1U8ZA 3Q9LA 3EARA 1TMKA 3RABA 1DAEA 4KSBA 2F3RA 4ILEA 1XCMA 1RVDA 1PV4A 4S2EA 2H8KA 3OHMA 3Q85A 3RC3A 4PZYA 3IQWA 2OCBA 4LV8B 2OCYC 2ORVA 5DI3B 4TYWA 5CJ2A 5TARA 4TMZA 3ZZ0A 4ITRC 4RD1A 5JJKA 3KX2A 3I73A 2V3CC 2BMJA 4LI0A 2RGCA 1COWD 2JLWA 4NCKA 3F3YA 1P60A 2W2XA 3U60B 2BM0A 4PR0A 2ZJZA 2J0UA 4KLZA 2IUSA 3R9XA 2GILA 5JWOA 1YR9A 4M4SA 2IS2A 4Q21A 1EX6A 4D26A 3PEYA 4D80A 1IAQA 5L3QB 1A5TA 3TSOA 1KY2A 4LDJA 5KDOA 4HAUA 1VG0B 2Q9AA 4ZKDA 5L8VA 3AVVA 1ZNWA 2X77A 4EJSA 2O8FA 2G6BA 1DADA 4B32A 1P2VA 3KJIA 1D9ZA 4V0MA 2QY9A 2IS6A 2J0VA 1G8FA 2QE7A 3BBPA 3WYGA 4LBVA 4BFZA 4BZPA 3RAPR 1D9XA 2O0HA 5IDVA 3SJZA 3TVDA 2FFBA 4BGDA 4Z51A 4DSUA 2W6ID 1T3HA 3GLHB 4ZKEA 4XTRA 3WRYC 4TMKA 1NG1A 1ZNZA 4ON9A 2W00A 2ZRHA 1G7SA 1YJ5A 2VHCA 3NIBA 1HQCA 3A4NA 4AYWA 1AQYA 2GBLC 3LY5A 4PC3A 2GHIA 4D81A 1SVWA 2ZTSA 1P3JA 2ZE8A 2LWIA 4H1VA 3T06B 3A4LA 3M4YA 1NP6A 3R7WA 4C0JA 4CEIB 3MMPA 3KQKA 5KYKA 3MUFA 5HTKA 4Q9IA 1TU3A 2MMCA 4JMPA 4TLEA 1EK0A 4PQFA 4HLDA 3E70C 4LJAA 2ATVA 4DDWA 1A2BA 2VP5A 2GK6A 5AUQA 3GPLA 4DLRA 4Q18A 1NIJA 3CONA 4JS0A 2FEMA 1KZGB 1P6XA 3CNLA 4P3YA 2A5GA 2QG6A 4HZIA 4KVAA 4QGGA 3VX3A 3RLFA 2ZSDA 3PENA 4GFDA 4OHZA 4D4MA 2RGNC 5C18A 3LBHA 2P3SA 5DLQC 3GLFB 5TV2A 1I4TD 1W0KA 3AP3A 4I1OA 4RD2A 2KJQA 4QJ3A 4WAUA 4PPQA 2WOOA 1CIPA 1II8B 3B7GA 2D7DA 1NSFA 1Y63A 5FOSA 5FPSA 2WMOB 2ZANA 3KTAB 2KBFA 3CZPA 3K0AA 5CLQA 2VIIA 1HY3A 3CH4B 4LWZA 1Z8FA 4TLAA 2SHKA 1JQJC 2V1UA 1J70A 1HYQA 1WRBA 2J1LA 2ZJ8A 1D6JA 3AUYA 3LDAA 1OXXK 1E2DA 5KSYA 1YZGA 2F43B 2ZJBA 2JLSA 3J81k 2GXAA 2R8RA 4X8HA 1IONA 4FWTA 3EC1A 3GEIA 4YDSA 4TLBA 1GITA 2IYTA 4Q48A 2ZQ5A 1JQLB 3I8SA 2JCSA 3HR8A 3QVUA 2PLRA 2D4HA 3F5FA 1OW3B 3B1YA 2V4ZA 4XVUA 1GNPA 3C8UA 4BLRA 1FUUA 3CW2A 4WXRA 1E96A 2GCOA 1OFUX 4S35A 3VQTA 4PHFA 4M2LA 1KSHA 1NVWQ 2IUUA 1YU9A 2V8OA 3QQ5A 3K0CC 1G6HA 3U7HB 1K6MA 3IQXA 5B57C 1W4CA 2CEAA 4A15A 1WBDA 2HT1A 1F6BA 2YYZA 4QHSA 5CB6A 2YJTD 2H5EA 1XRJA 2V1XA 5BYKA 2BKEA 2XEXA 5CIQA 3CPEA 1QHYA 4PAOA 1LS1A 3T61A 3ASYA 4MDFA 4PAMA 3RS3A 5F98A 4QRHA 1M6NA 3VX4A 2E87A 1AS3A 2AXPA 3CBQA 3Q8XB 1GTVA 1NN5A 2QT1A 4U5XA 4NE2A 3CNNA 3QBVA 4IFEA 1EFCA 4DLTA 3V4FA 1G17A 4Q1CA 1YHNA 1KHTA 3VKGA 3RC8A 1KJYA 2PT7A 3D8BA 4RCYA 3OFND 1KJZA 3UXMA 5EE1A 2QTVB 4FD2A 1W0JD 3K70D 1F3OA 3GLIB 3T1VA 4C0SA 2QM7A 2HDNB 4Q7MB 4BE7B 2R6AA 3ICQB 1XCGB 2QL6A 3QPWA 3SFZA 2CVFA 2CVHA 2ZE5A 4O3MA 4GSYA 4DC9A 3SBDA 3WHLA 4CW7A 2XXAA 2GA8A 1NMYA 2GBLA 4RJLA 4JLMA 2JLXA 3GFPA 4J0QA 1T6NA 1N25A 1I2MA 2ZS7A 4C7OB 5G41A 1KI3A 5JHHB 3A6PC 1N0WA 4KI0A 1GDDA 2AWOA 4C30A 4BLSA 4W5WA 2R2AA 4OI2A 1E4YA 2NO0A 2QAGC 1GSIA 1E0KA 1H8EA 1T5LA 3RRZA 2Q6TA 3BFKA 1G16A 4AURA 2OZEA 1L2TA 2XSZA 4B6EA 4RZ2A 3VHXA 4M9ZA 1IHUA 1U81A 5KO2A 3OZXA 1IN4A 3RS7A 3SYKA 5EJEA 1X1RA 1D2EA 2HUPA 4KITB 3TNFA 2HV8A 4P4SA 4LOAA 5KNBA 4DSOA 4XVRA 2VSOA 2YNMA 3LV8A 1WQ1R 4E5UA 3CH5A 2XOKD 2RGNA 3EAQA 3IILA 4DDUA 2YOGA 4YXWA 2V54A 5IT5A 4C3ZA 4AKGA 5JEDA 2ZM5A 4MDEA 2IXEA 2WHXA 4C0LA 1T3SA 3V4RA 4W9MC 4Z8XA 2JIZD 3LW8A 3OFNA 4M9SA 2GTPA 3MCAA 1NJGA 4HYYA 4XJXA 1U94A 1HT2E 3QXSA 4KYUA 1G5TA 3CR8A 3VHLB 1KO1A 2DB3A 1KIMA 3RRMA 2P6RA 3OAAD 1W4RA 3KKQA 4W7SA 3DPUA 3GJ7A 2F1RA 2FZ4A 2DFKB 4NDZA 2KSQA 2REXB 4MRPA 1CR4A 1XU4A 2PMKA 4Q5IA 4AKHA 1UFQA 2WAYA 2Y8EA 5DSZA 1Z28A 1NIPA 3FMFA 2FN4A 1TQ6A 4LHWA 3SJAA 2ZROA 1Z29A 3LLMA 5KSOA 1DEKA 4OL0A 5AJZA 2IWHA 4WA7A 1G291 3THYA 4OK5A 3BD9A 1MRSA 3OE7A 3Q7QA 1HE1C 2FG5A 1R5BA 2DR3A 3NBYC 1T0HB 4RKEA 3O47A 2ZYWX 1DG1G 1AGRA 5E4FA 2WSSA 1N6IA 4MITA 4I99A 2IK8A 2J46A 1IQPA 4IVQA 4OQLA 4BFXA 4DXAA 1US8A 4QJ4A 4I81A 1VHTA 1U0JA 4CEJB 4RSGA 1IBRA 1Z0IA 2GJ8A 3DMNA 4QG7A 4YONB 5J5CA 3U44B 1ZD9A 2ORWA 4B44A 3EX7C 1E0AA 4O25A 1UKYA 5IK2A 1E0SA 4A82A 4QL3A 2H92A 1E79A 3R9IA 1S9HA 3CX7A 3L0SA 2GAAA 3BH7A 1OHHA 2OV2A 1X86B 4ZDWA 1NY5A 4UJ5A 4MYUA 1F2TA 4BZQA 4R98A 3OEHA 2IS1A 1T91A 3QEOA 2NPFA 4NP6A 5HCNA 2CHVA 3I4LA 4D4LA 1ZAKA 3X2SA 4BFSA 2C5LA 2JAQA 3LW7A 5EXSA 2CJWA 1ZM4A 3QUSA 1NBMA 1NN3A 1E1RA 1FTNA 2A2ZA 4MYHA 4URXR 1SQ5A 5JFGA 4DCNA 3NWJA 1TF7A 2WWWA 5FFMA 2RGBA 1LTQA 1YR7A 5EXTA 1DO0A 5HE8A 4TSFD 3SI7A 2OSBA 3EPLA 3HU3A 1G5RA 2OT3B 1NLFA 3ZIAD 4Y0AA 2FA9A 3QKTA 4L9WA 2NO9A 3S1AB 1DAKA 4G5QA 4IVPA 1XMSA 2EFEB 1DO2A 2QAGA 2CCJA 1EG7A 1MH1A 1OFTA 2F1JA 4LHVA 2IYLD 5BN4A 2QGZA 3B1XA 1NLYA 2JA1A 2UVQA 1QG2A 4ZCIA 1JNYA 2RGEA 2V7QA 2WIBA 4XH9B 4LK2A 5FOUA 4ASUA 3TR0A 1ZJ6A 2BMDA 2JATA 2WJJA 4KO8A 4LZZA 3GEEA 1OH5A 1F60A 4BLOA 1MO4A 2AD5A 2WWFA 1HE8B 1EFRA 4EFNA 3AGPA 4TQUS 2I4IA 1QF9A 1V43A 4TTQA 4QFMA 5CM8B 1JI0A 1NVXQ 1Z0JA 2FPKA 4IOLA 4L9SA 2OFXA 1KMQA 2FU5C 5GADl 4BZXA 4E03A 2CDNA 1GUAA 2VA8A 2JLRA 4LYAA 2I1QA 2BV3A 3JZAA 1G8PA 1XMIA 2ZI9A 2AWNA 2FH5B 2OE2A 2ZI4A 3Q7PA 1DE0A 3U61B 2O8EB 1R7RA 1ZRHA 3WP0A 3B5JA 3X1XA 4ZCLA 4CF7A 1UEJA 2ZE6A 1J8YF 2N42A 1K5GA 3M1IA 3MD0A 3EG5A 1LW7A 2PX3A 2ZUDA 2FPLA 3MJHA 2FZLA 4BQSA 4Q7KA 5K8TA 1QG4A 1W1WA 1HH4A 2YWGA 1BMFD 4M1KA 4GT1A 2G83A 3KJHA 4IDHA 3X1YA 3AVYA 3V9PA 5TVKA 5G40A 1AQUA 3QKSB 3GP8A 4XVQA 2CK3D 1EWRA 3T12A 4TQAA 1G8YA 1Q22A 1EXMA 1OIWA 3DOFA 2FPMA 2YWHA 4NCHA 4LBWA 3UG6A 3C41J 4FMCB 4EPTA 2IYQA 5H8WA 4LPKA 1XTSA 2YWFA 1WMSA 2NQ2C 5DO9A 5DN6A 3VKHA 1OKKD 1WB9A 5KDLA 3LNCA 3ZDQA 3OEEA 2B92A 3GJ4A 1PVOA 2ZJAA 1DAGA 1YZNA 2XTMA 4KJZA 3B82A 1KTVA 3E5HA 3FFAA 2JJ2A 2CHQA 2GEDA 2BVNA 4A0GA 821PA 2ZJYA 4AG5A 4TYYA 2XAUA 2VHJA 2WPDD 2GWHA 1M7GA 2WM9B 2FNAA 4HEJA 1RE0A 3SNHA 1E2LA 3A1WA 1E2IA 5FUWA 4KFSA 3SC3A 3IPYA 5LB2A 4BECA 2AXNA 3MWYW 1P72A 3GJ3A 2O8CB 5KSPA 4JLJA 3O8RA 2VTKA 4D0LB 1GNRA 6Q21A 4M53A 1NY6A 2X2FA 1KK3A 4OJQA 2J9RA 3DVLA 4IXNA 1M74A 5E7JA 2WWYA 2VQSA 2C99A 5LDDC 5DNYB 5JJLA 1LV7A 1ZUIA 4TTRA 1E9DA 1WA5A 1FX0B 5LBIA 1GFIA 3IHWA 2JLYA 1NJFA 3TUZC 4A9AA 5CITA 1KO4A 1N6RA 1UDWA 3BB1A 3T34A 3UK6A 4P32A 3GLFA 1EESA 2QPAA 4D6PA 5DHFA 1KAOA 2QUZA 3MRSA 5HPYB 4D25A 2ZRNA 2QENA 2MMGA 4KV9A 4PXAA 4JBXA 1II8A 1UAAA 3CF0A 5C2JB 3KB2A 1JR3E 1W2HA 2HT6A 3LO5A 4URZR 4Z54A 3VU9B 2IXFA 3SBEA 1D5CA 5EE9A 4GOJA 4LV5B 1PLKA 4URYR 4HAZA 3L2OB 3LFUA 3SQWA 2BHRA 2VF8A 4PZZA 1Y3AA 1OB2A 1GKUB 4O0MA 1E9CA 1Z3IX 5B64A 1KNQA 2ERXA 3G0HA 2XNSA 3RRYA 1T4GA 3BFXA 1CJVC 4UXIA 3THXB 2GXUA 1DTSA 1E98A 1O3YA 5L3SA 2GJSA 2VHUA 1RJ9B 1U0HC 3AF0A 3H86A 1NLZA 4EFLA 5CJPA 4GZLA 4UNPA 1R4AA 1OT3A 1Q1QA 1P9WA 2A5DA 2DCUA 3CNOA 4JL6A 3RDPA 4UXJA 2F1IA 2WAXA 2W6JA 4OYHA 1B23P 3EWSA 1Z0AA 1EGAA 4M1TA 3TIFA 3FE2A 4L4UA 3VR1A 4B3XA 3B6EA 2YOFA 1AJEA 1A7JA 5FBVB 2FWRA 3P1JA 4F4CA 2VSXA 4ZPXA 2A30A 1XWIA 2HJVA 1T0JB 1KI6B 1XEWY 4Z8YA 1AIPA 5KDDA 1KKLA 4CT4B 5FPKA 5JWRA 3BH6A 4OI4A 5FOTA 2AFIE 4MYTA 1M7HA 4PQYA 5GJVC 2BBOA 1YR8A 1VCOA 2W0SA 5JMTA 5EXPA 4EPXA 5DIFA 3W34A 1SVOA 3IIMA 4DEXA 2ZRPA 3CR7A 5KU1A 1WBBA 3AF2A 1P2TA 4OHWA 2D2EA 3HPQA 1BKDR 5CDFA 4MGYR 4CDGA 2Z83A 3LRPA 3FMIA 5JEEA 1KJWA 2IWRA 3L0PA 5CYOA 1ZU4A 4BFVA 2QQEA 2AK3A 3TSZA 3SOPA 5EUQB 1H8HA 3U7EB 2A5JA 2Q3HA 1RPZA 3UPUA 1L7VC 4RD3A 4OQXA 4QBFA 3THWB 1R0XA 1JECA 5E7MA 3PJRA 1KK2A 3CX8A 5LPNA 3KKMA 4OI1A 4UNNA 1MO6A 1SKQA 4BRUA 2REOA 1FMLA 3LH5A 2VP6A 2DWOA 2GESA 4B3CA 1G7RA 2QE7D 5JCZA 3R20A 2H1LA 4LUCA 3IBYA 1DELA 1NRJB 3K53A 5BN3A 1E9FA 1IN7A 4A6XA 4M22A 1KK1A 3RS5A 1E99A 3CIOA 3IEUA 4ZIRA 4JKIA 5DH9A 1U2RA 3B9QA 3HR7A 4NH0A 1SXJA 1E9BA 1CJKC 4PSAA 4B3FX 2BMFA 3FHCB 2WWIA 2P5TB 3IBGA 3ZVLA 3L8YA 3LAWA 5A5GA 4CGZA 5KSZA 3TRFA 4B33A 1Z07A 3KQNA 4XSHA 2BKUA 1D2NA 3MLEA 3M0EA 4PFSA 1X8KA 4A0FA 2FSFA 1P75A 2B7BA 2OUKA 1AKYA 2DFNA 1WP9A 3EW9A 4WZ6A 2J59A 2RCNA 4OHXA 4AYTA 4A0HA 4FCVA 1XZPA 4ARZB 1LY1A 4OJKA 1LNZA 1AZTA 5AWFC 4P4UA 3CRW1 1W36B 2F9MA 5DI9A 3SDZA 2WICA 2QMUA 1IN6A 1OYWA 4A8JA 1SVIA 4FINA 5K8LA 4NCNA 5SZKB 3HDTA 1Z0FA 3CRQA 2VSFA 3VR4A 2GDJA 3BB4A 5JRZA 3H0KA 3IKJA 1MABB 1W0KD 3M6AA 1SVKA 2O52A 2BWJA 1CS4C 3EXAA 4DHEA 2GRJA 2NTYC 2DHRA 4QJ5A 1SHKA 2BJWA 4II7A 3KUDA 4EPRA 4AIIA 2BEJA 2DFLA 4JJZA 5FBRB 2P0EA 3NTUA 2OAP1 4B47A 1XD2B 4IW3B 3U4QA 1Q44A 5EE0A 2HJGA 1S4QA 2F3TA 2F9LA 3MWLA 221PA 3ZQ6A 1FMJA 2ZETA 1OE0A 4B2IA 4V0ME 4G5GA 1UADA 1QHXA 4LHZA 3VMFA 1GL6A 3ZD6A 1DBSA 4RKFA 2EQBA 3B9PA 2O5VA 3DM5A 3TQCA 4CEJA 1JAIA 1PLLA 1QVRA 1KKMA 3P27A 5D3MB 5FBQB 1CRQA 4BFWA 1R2QA 2C03A 1KO5A 4DLVA 5FBLB 1CJUC 3FB4A 2H16A 3GQBA 3LX8A 1ZCAA 4POAA 2QTFA 3LLUA 2O8DB 2YVUA 3L8ZA 2QP9X 5JWHA 2GZHA 5AJXA 1YRAA 3NBXX 4HLUC 2YC4C 4NU0A 4YC7A 3FMPB 1RZ3A 3HJNA 3REFA 3UG7A 3EWAA 5AJVB 2DY1A 5JRJA 2RMKA 4PPNA 2C96A 1P4SA 1JR6A 2KI5A 3B1WA 2CL0X 2AN9A 3GEHA 4PTLA 5KUTA 4JZKA 2QSYA 3NC1C 4NCIA 3W3ZB 1G5PA 1TQ4A 2C78A 4GMDA 1VTKA 4P0TA 2WWHA 4QM6A 1GP2A 4CVNA 5AUOB 1P9NA 2WKQA 5KPJA 4PO8A 3S1AA 2WKPA 5J4HA 2Q3FA 2YV5A 3IO3A 1PUJA 5ELXA 5F3WB 1JEDA 3B13B 2XITA 4B48A 2WJVA 1U99A 4QNMA 4Q4HA 5FTMA 4RD4A 3O8DA 4V0NA 2J87A 5C1BA 4V0LA 3VKWA 3GCGA 2IYSA 2I1VB 4LJ5A 1CXZA 4G3XA 1E9SA 1Q0UA 3WMFA 1Z06A 3K70C 5EE5B 2VRWA 2V9PA 3NHAA 3CRMA 621PA 3CO5A 3CM0A 4NBSA 3ZLJA 1YE8A 3GLGE 1E9AA 1R5OA 1IJEA 3FWYA 4P31A 4NZYA 1WCV1 3GFTA 3THOA 1UF9A 4PHHA 4RCZA 1L8QA 1H8ED 1NI3A 1VG8A 1Q1ZA 2JJ1A 3AP1A 3N2EA 3UWKA 5TMPA 4DRZA 2XSZD 4M1YA 1E1QA 2XZOA 2O8BB 4HAVA 4LCBA 4FN5A 3OIWA 2IYRA 4PZLA 4ESHA 3K0FB 4B3BA 5CK4A 3A8TA 5F2EA 2QEQA 1NKSA 1ZVQA 3QF4A 2X1VA 4U02A 2EFHB 2Z5FA 1J90A 3SN6A 4Q19A 3PVSA 3KQUA 2CHGA 2Q21A 2P65A 3CRRA 4WOPA 1JALA 3BGWA 3HP1A 2IYZA 4DCTA 5FUXA 3T1OA 2BCGY 3AQ4A 2UZ3A 4P33A 4YXWD 1QHHB 2ZRBA 4IFBA 1CR2A 4NTZA 3ASZA 4B2PA 1MOZA 2OHFA 2ZE7A 2BOVA 3EA5A 3T1QA 2JLVA 4DZZA 1M2OB 4M1SA 3U5ZB 3V00A 1G7CA 2HCJB 1G41A 1KGDA 2PZGA 4QGAA 2QNRA 2ZYUX 1CR1A 4Q1EA 4GI7A 1JJVA 4LHXA 3FVQA 2WMNB 1S1MA 4B34A 1L4YA 1XB2A 2IYYA 3QENA 1P62B 4RFSB 1LVGA 1UBGA 2BCJQ 3P32A 2B8WA 5B2ZA 5FH9A 1BS1A 2QROA 3LBNA 4BEJA 1E2KA 4CZ2A 2QTHA 3REGA 3DL0A 3KJGA 3PFIA 4OK3A 2HF8A 2BBWA 1OH7A 5KHOC 4TMXA 1YZLA 3U3MA 1Z63A 1E9RA 2OILA 1VIAA 1K5DA 1XD9A 1X6VA 1X3SA 4JSYA 2GNOA 4HLCA 2IA5A 3OE7D 2W2TA 2V6IA 3DEFA 4EKDA 4GPTA 5DHAA 1XPOA 3CUEF 5EZ6B 1E2GA 4LSGA 1G6OA 1DAMA 2GEUA 2GZAA 2NOAA 2VEDA 5AR1A 2PZFA 4DEYA 1ZM7A 1VG9B 2NPIA 3D3QA 3MSXA 4HI0E 4E07A 2WSSD 1CULC 5CYPA 1EFHA 1A82A 2IL1A 3ZS9A 4BUJA 2PEZA 3R8FA 3IUYA 2R6GA 1N6OA 4QGHA 3U3KA 4TZ0A 3BRWD 1KI1A 1J2JA 4ERNA 3AKYA 1U98A 2FFHA 2JEOA 5IK2D 3NC0C 4XTCS 3WHKA 1E79D 5BWMA 3DHWC 3KQLA 1XXHA 1E2NA 1G64A 1OYYA 4D0NA 1OHHD 3KXLA 4Q4AB 2R6DA 3PIRA 2ZJ5A 1N5JA 1P61B 4D0GA 4OK6A 1A1VA 3KZ1E 4G5RA 3VAAA 1OXSC 3OEHD 1TTTA 2ZRDA 2G0TA 2H18A 1AKEA 4Q47A 4D2IA 2QZ4A 5J4KA 4B71A 1XPUA 5CK5A 4AKEA 1RFLA 3IGFA 3QJYA 3K0SA 2F6RA 1E2QA 3N70A 3PCRB 1TPZA 1ZM2A 1NBMD 4BLQA 1E1RD 1YZKA 4NYIR 1IXRC 4JVSB 3HPRA 4CYMA 1TEXA 1Z08A 4MKGA 2J0UB 1JJ7A 1B0UA 1ZM3A 2XB4A 2A5YB 2QMOA 1N6HA 1IN5A 1EX7A 4HAWA 2A3RA 4CIDA 1T5IA 3K0CA 1ZNXA 5JI3E 5FTNA 2AX4A 2ZEJA 5JS8A 2ZVQX 2NZJA 4JVLA 3ONWA 1X8JA 4DWJA 3AEZA 4PO9A 3W6OA 4CEHA 2O8FB 1W36C 4Q03A 5CM9C 2ONJA 4DVGA 4F38A 4MKHA 3F0TA 3T35A 1N0VC 2QSZA 2NO7A 4EAQA 1H65A 2V7QD 1E9EA 2JDIA 2ZRAA 3GJXC 4UXHA 3U2QA 3THXA 2QBYA 4IEEA 2QQ0A 4C0BA 5HKKA 1RJ9A 2UKDA 3KFVA 4ASUD 4KCGA 2DYKA 3B60A 2G9NA 1EFRD 2X19A 1TEVA 2XGJA 1R0YA 2ODEA 4HUQB 1SGWA 1JAHA 2VH5R 3KL4A 1GILA 1S1CA 4HSEA 4UQOA 2HCBA 3SHWA 1GKIA 1FP6A 2ZSEA 2XTZA 1SZPA 2Z0MA 4IOKA 3WMGA 3R9WA 3PUZA 721PA 1GM5A 4A92A 4JIMA 3P4XA 1W4BA 3NEJA 1N5LA 1TF2A 4ZI3A 2Q0HA 2ZUCA 2ZJ2A 4R2IA 4LJYA 2PJZA 5JSZB 3FHOA 1IY2A 2AKAB 2CE2X 3AVUA 1ANKA 2DBYA 5AJWA 2NMVA 4XD7A 1W7AA 1II9A 1FPMA 2H7VA 2K5UA 3A58B 1OPXA 2EWVA 1I2DA 4O2LA 2W58A 4B3GA 2VF7A 1KNXA 3VFDA 1ZM9A 1R10A 3QG5A 4FCTA 3WYAA 1TU4A 5J4VA 3P4YA 3QE0A 1Q1EA 3WXMA 3I61A 1NNEA 1NG9A 1S8FA 1Z6GA 2OO7A 3CF6R 4R71A 1GIAA 1NBME 2JLUA 5BXQC
chains in the Genus database with same CATH superfamily
1Z0UA 1NKTA 4LTNA 3BD8A 2UUAB 3I0NA 1M2EA 4TMVA 1WZEA 2NZ8A 1LDBA 3NW9A 3VDQA 2C7RA 3W90A 3FN4A 2ZW9A 1J2UA 1NATA 2ZRKA 1AZSC 3MPOA 4XXHA 5EE3A 4ZTBA 5HZHA 3EFOB 1CZUA 1KYTA 4FILA 3OO0A 1P0IA 3A25A 3D0QA 3CV3A 1XTJA 2OKGA 3HV2A 5DCWA 1RMYA 3CVVA 2LDBA 2B6HA 4LZPA 1YBFA 3MC1A 4M8NE 2F8TA 1GFZA 1VIDA 4LXHA 3GLGB 3MAAC 2P9FA 3IT2A 3KZMA 3OEED 2AMVA 4TZ6A 1LBQA 5GJWC 4EJ6A 2W93A 1KJIA 1EP2B 5K8VA 2EJVA 1O95C 5DLYA 2BEKA 2RGRA 1Y3DE 2GVZC 5FUQA 4UBIA 5MDHA 1FTGA 1NV9A 1KDRA 3BF7A 3B85A 3TLCA 3D43A 2JJ2D 5L9AA 1V8DA 1J5EB 3JD3A 3IIJA 2P7HA 1I80A 2C9ZA 2C3UA 2VSYA 1XTRA 4M86A 4YBRA 1MV8A 1SVMA 4UKDA 4CGZA 2GCOB 3C7TA 3DP9A 4PEVA 4M0UA 1NQ5A 1ZW1A 4NL4H 5I9IA 1DAFA 1KI4A 3EF1A 1SVLA 4L3VA 3QU5A 1ZMBA 4MQUA 5BQPA 4WNAB 2G1PA 2B5WA 3JVEA 3W1VA 3NAQA 4B9EA 5CEJA 1Q84A 1O96A 1RWBA 4HNAA 3DT9A 3NVAA 1KSJA 1Q7RA 2G80A 2NU6A 3X1DA 3HWWA 1ECJA 4ZEVA 2XE4A 4KLCA 3I8XA 1HMPA 1MV5A 3U17A 3FTQA 3PJGA 3VRHA 4AKIA 1XQXA 1WZ2A 3ZV6A 4FOLA 1VLHA 3MN1A 2Q41A 4LG1A 4OMCA 2I54A 3QLEA 3UANA 2MR6A 2IW3A 4FFPA 1DQZA 1TA9A 3AR9A 1EWVA 1ZITA 1XVVA 2R6ZA 4B85A 5DRYA 1Z4KA 4LECA 1FMFA 3HBLA 1T3LA 1T4BA 4ARZA 5IFKA 1J8FA 1JA0A 1A8PA 1SCBA 1JVBA 2ILTA 4Q3DA 4WZAA 5DYGA 3M6WA 5FR2A 1Y1LA 2X9GA 2M6SA 1DT5A 3KLNA 4PFKA 1CY2A 1QQAA 1QIMA 4ZVNA 2A78A 2DPMA 4J7CA 2PKQO 3IUJA 3FHTA 4XGKA 4BFLA 1PZXA 4HUJA 3CLVA 1TDJA 2BFFB 2CUTA 4KLAA 5IVIA 1CG6A 3CN7A 1ABEA 2I8LA 5IAKA 1JHZA 4AQ7A 2ZRFA 3O38A 4I5EA 1F2VA 1XAIA 5HFAA 1B6SA 2VDPB 1KJQA 2QN8A 4MX8A 5IXSA 1V6AA 2J0SA 1DC6A 4TL6A 3TNJA 2ZBUA 3GLHA 1KI7A 4UUAA 1Q92A 2VI5A 3OF5A 4RD0A 4FHFA 3GB9A 5IG2A 3T5DA 1PDOA 1ZSVA 4PNEA 1D03A 4J2OA 3K6RA 1OZ0A 3RBVA 4XFKA 3L1JA 1G3MA 1PGOA 1RXEA 4FQ5A 2JIDA 5AJTA 5JCJD 1EWKA 4Y2HA 2VL7A 1JFRA 5F9FA 1RRPA 4EF6A 5JNUA 2C5HA 2ZJ6A 1YR6A 1A9TA 4J07A 4FIDA 1DKRA 4M0PA 4CEIA 4HXFB 1NPTO 3L4JA 2DFVA 2GBPA 5D3MA 4YDQA 3PD1A 3ZKWB 1N1MA 2PKRA 4A91A 4P7KA 3LPMA 2PANA 4MQMA 4UZEA 3OIUA 4KWHA 3SC6A 1C0IA 3CO0S 1CVRA 1XFDA 4NU5A 4RLQA 5D87A 1V45E 3QOWA 1PD0A 4O2BF 3O92A 4H9GA 5ALRA 1XCPA 1DRKA 1BMQA 1A9XA 3H9GA 4M6WB 5LMCA 2JK1A 4GYYA 3CB4A 1M0TA 1AHHA 3EZGA 4MMYB 4QREA 5H59A 1O5OA 3N3AC 3EEYA 3H0EA 5JQGF 1TJ3A 4FC7A 1ZI6A 3GXBA 1RE1A 4OCZA 3A27A 4P82A 4R5MA 1SBZA 1JEAA 2WU0A 3Q0IA 2CMGA 2X8AA 5C3MA 4BX3A 3ICOA 5JJBA 4MWDA 5IAAA 4UVHA 2DECA 3OQIB 2I99A 1W5BA 4WERA 2QHXA 4QBTA 3ZV5A 1E2HA 4GZMA 1B8OA 2IKQA 3R8CA 2G0NA 1JB1A 1JR3A 3IAHA 3L8MA 3UUFA 3I37X 4PZCA 4Y1RB 5JZBA 1AVTA 1YGPA 3AXSA 1NT4A 1Y6QA 5FULA 4GOXA 5T4FA 5CCEA 3L7BA 3KD2A 3N6XA 5T4BA 1L0BA 3TIIA 1K7XB 1KP3A 1FJHA 1IBMB 2II6A 4GP6A 1TQ8A 2BUAA 3W2IA 3X2FA 4II2A 3L06A 4M87A 4HAXA 1M8FA 1DHRA 3BX1A 4L0MA 4QKQA 5IRCD 2EJTA 2WVGA 2FQQA 1PV1A 1J39A 4U1RA 2WAAA 4ZK2A 2WIGA 4DNQA 1TADA 4NKRA 5BQXA 2VPYA 4N7JA 1L1FA 1I4LD 2NZXA 3ZUPA 5B7NA 2PUAA 3KKNA 2XNJA 2P4UA 3ZWVA 5IM4F 3SICE 4D9NA 4L73A 1UFKA 1I6MA 1E6EA 3V3KA 1EWTA 2FGKA 3GJ5A 2YL2A 2VZ9A 5F64A 4L5JA 3UUGA 4EMUA 2NSYA 2W2PA 4DDKA 5B4UA 2O0LA 1JR4A 1PJ3A 4EHDA 4Q39A 1QU2A 1P4HA 4L57A 2CZGA 2CKMA 1ZXLA 2PH1A 2CVOA 1D6MA 3EA0A 4XIIA 2BGJA 2IHBA 2JKZA 2I71A 2Z04A 3QE3A 4EFDA 3FOWA 2EFGA 1SPBS 5ALXA 1HV8A 3O6VA 2VT6A 2J5QA 2VP2A 4XASA 3ZZTA 4R81A 4QYWA 4HNUA 5JDIC 2IDZA 1YSCA 1S9DA 1P17A 1T5OA 2VK2A 3IDOA 3MJTA 1IZ9A 2WYOA 1A4XA 3JYPA 3V5NA 4KFUA 1OX6A 2PSDA 1RBQA 1X3LA 1IMJA 5SYAA 3RLIA 1ZUHA 4YHBA 3DNMA 3P26A 1RP1A 3PX2A 3QA3E 4N3NA 2R5NA 1GPMA 1WKCA 5EZSA 3URMA 1G3QA 4Q1VA 4AZ0B 1BHO1 4LYJA 2WZDA 4IUCS 1PX0A 1EJ0A 2FVYA 2RAPA 4MEAA 4PO1A 2F55A 1OIXA 3A10A 3KU1A 4XGRA 2H08A 1DKMA 1JE1A 2HA5A 4YUAA 1G5HA 4WA8A 5EHXA 4F12A 3EGCA 4II3A 4ZD6A 2PBLA 2ODBA 3AR7A 4F6CA 1RKBA 1X1BA 2AYZA 5KKNB 4WY8A 3JY6A 3CJRA 5IKPA 1NQVA 3VM6A 4ND5A 4PHCA 1XQ6A 1E2JA 1CYDA 1VMDA 3SS8A 2EXXA 5CVDA 1D0SA 1CUVA 1BE0A 2VQDA 3PC3A 3LVQE 3DR5A 5L4SA 2ZRLA 3E03A 1SCUB 2QV7A 4AG6A 1SBNE 2ZUBA 2P4HX 1VSUA 3OSUA 1U90A 1XDWA 1ZNYA 1DXYA 5IBQA 3SLRA 4Q4CA 2QPTA 2BSQA 2J41A 1P4GA 3LBFA 4KAXA 8OHMA 1S2MA 1TJYA 3JQ9A 4EHFA 1CP2A 1U0LA 1PR1A 4TN5A 4F5WA 4DFDA 3INRA 4Y2VA 1KAMA 3VVBA 5A4DA 5EEHA 1E58A 2I6QA 3VTKA 4AZTA 1FXUA 3AP2A 1PZHA 1ZK4A 4PC7A 3LFHA 4FD3A 3QYFA 2AX3A 4QYIB 3IA2A 4ZVSA 2AZ4A 5BSKA 1SUPA 1HYGA 3CNBA 5IWCA 4LYYA 4UEQA 1K0UA 3K09C 1N2CE 4NCXA 4QPNA 5FOVA 3ZDXB 3ZE7A 2V6FA 3THSA 2OFOA 2R1TB 5G1PA 4AD8A 1VGVA 4FYJA 5E7QA 4CMEA 2IC5A 4YJDA 4BMVA 1KY3A 2EIXA 3OP4A 2QORA 1JG2A 1L5RA 1QDUA 1ZW6A 1BJTA 4UC0A 4KYVA 4QEKA 4G01B 2LGJA 1BN6A 4GS5A 4JLBA 2XGSA 1A27A 2WWXA 4PQGA 4QEDA 4BU0A 4CLDA 5KNLA 1GDTA 1HE3A 3AWDA 2E1RA 1YVPA 4IILA 3QITA 1R6BX 5A4FS 3DZBA 4TRJA 3KL2A 1SXJE 2YFYA 4IGAA 1OLSA 1RBMA 1LKZA 5T8KA 1T34A 1ZIXA 2A9QA 2ZU0C 2A67A 1K5PA 2HO4A 1E5VA 1HZZC 3EGEA 4G07A 5K3DA 3TJRA 3HSKA 2ZI6A 4P36A 3GT0A 1RYEA 2E55A 5EXDA 1GPLA 2QN7A 4JBYA 4LF8B 2UYOA 4BQRA 2VKQA 2E4ZA 4Z1MA 4DUGA 4H0CA 5BWOA 4DDHA 1EFPA 2JBAA 1J99A 2V96A 2NXEA 2F1HA 2ZCVA 2RGAA 2X40A 1N9KA 3DDUA 3DW1X 3UNXA 1PNVA 4E2FA 2XVYA 1UDCA 1P0QA 3D1VA 2LDXA 3EB9A 3G5LA 4N5IX 3GRAA 4F2GA 4WOCA 3AHIA 1Y5NA 4JB0A 2GO1A 1IDN1 1GYPA 1OPRA 1GV0A 1EHCA 1UBLS 2O0KA 3DEJA 1OXUA 3FKSA 1FXWA 1MENA 1GZDA 4RVCA 5MN6A 4A5OA 1SUIA 5FPYA 1M6HA 5HDBB 3ZV3A 3I12A 2OVFA 4WBSA 1SURA 5BWCA 1CTQA 5ICMA 2PL1A 1ZS9A 4C43A 1VHQA 2GB4A 3OZGA 3F4KA 2QP4A 1EIZA 1E32A 1BNCA 5TMBA 1WMEA 1EFTA 1TB4A 4Q3EA 5HJ2A 5LNK1 5AVUA 4A8TA 1NQTA 3EXFA 2CJPA 1DVRA 3AF3A 1J1UA 3UV7A 2VOEA 5FUVA 1ESNA 3ZGXA 3PHLA 3N5KA 4TUYB 3RKSA 4EFKA 4EJFA 2NNLD 3I9KA 1XQWA 2QVCA 1R1DA 3UWSA 4CMKA 2I7DA 3NXSA 1ZJWA 3ICEA 4ZMBA 3AY7A 1A8HA 2OCDA 2FQWA 2E49A 4DSNA 1GPKA 3ENWA 1V71A 3TTUA 1TEZA 4OUKX 3ZHCA 5B58C 2Y71A 5C5CA 4IIJA 3DT8A 2O07A 1LD3A 1KQNA 1P44A 4WGFA 1N2ZA 1QCCA 1XN4A 3TMYA 1CUAA 2A0YA 3IAXA 4BVHA 1BGWA 3A3OA 1ECBA 3RVQA 4G0UA 1KXJA 1AUOA 2ZRJA 1EP9A 5K20A 3JALA 2VA9A 1HTWA 2DTEA 5C5DA 5EG5A 2ZFUA 1VE1A 4HPJB 4TGLA 1XLUA 4QO7A 4Q9HA 2HMTA 1RXWA 4TMTA 2NUPB 3BF8A 3RK1A 4XIFA 2G63A 5K6AC 3QY0A 2ZT8A 2MSNA 4PNPA 3I53A 5BORA 2AD1A 3E7WA 3LE8A 1AM4D 4B6RA 3I9LA 3JQDA 1SKBA 1UBOS 3CRVA 4JQOA 3SVLA 2HYIC 3WLAA 1BQEA 5J59A 1UJ2A 3FBGA 4IINA 2XCSB 2DWUA 2I1LA 1QAOA 3FPBA 3KTDA 3QFCA 1KI9A 3KZKA 4LYFA 3Q2KA 2IS4A 3OIYA 2YNMC 2PSJA 4C6TA 5EUCA 1PIWA 1P9RA 1VP9A 2Y27A 4ZI2A 1THMA 4XIGS 3R41A 4FWIB 3RRFA 4BMYA 2F2TA 3G85A 4OQDA 1GUYA 1I4EB 1F0PA 2AL7A 3FF1A 4EF5A 5HEKA 1ZAYA 2Z6UA 1C7ZA 4AF6A 4NK5A 4U2DA 3VR2A 1O0SA 3VYSB 1KDTA 7MDHA 2WJWA 3DUFA 2E7ZA 5JXIA 3LUJA 4NNOA 5FHRA 3TVTA 4MQLA 3TR5A 3ED1A 3PQCA 2VVTA 1SBQA 2MHCA 2Z9BA 4I8XA 1RKXA 4BMNA 4G63A 5CFZA 4I9NA 4Q16A 1OJ7A 3QEMA 3VAZA 1AGXA 3GMIA 3QXJA 4JEMA 1YRLA 5KWJA 1V6CA 1J9EA 1WXDA 2B4TO 5KZMB 4M1OA 1BMDA 5L3SB 3S8EA 5L95A 2IDJA 4DTIA 1TAGA 1XGKA 3PT5A 1OLOA 4AFNA 1GTSA 1JXOA 2O4UX 3AERA 2Q6VA 3L1KA 4MVJP 3B6JA 1LTKA 1PR3A 3GJ6A 3W5IA 3HZOA 4F2HA 5T5QA 1XZQA 2CYBA 3NUZA 3V7FA 4EBBA 2B5VA 4JR0A 1KEEA 2B5OA 3KQVA 4X92A 3OZBA 2IPXA 1E4OA 5JT1A 3PNOA 3L93A 3RSLA 1GQYA 3VR5A 4MQFA 4F0JA 3PHIA 3JQAB 3LWZA 1EHIA 2Q49A 3GJQA 5T7BA 4HZUB 4I5FA 2VJAA 2JIOA 5HHTA 1F4PA 3A37A 3DXYA 5LCXA 1UPTA 1LDGA 3BMCA 4LXUA 5IC5A 2EX0A 3PSHA 4IHJB 5JD6A 2FPOA 2ZAMA 5C1OA 4B3DA 4F4IA 1KMHB 3TE7A 4CRWB 1F7UA 1UPXA 1FP4A 1L3BA 1XZFA 3ZWCA 4A2PA 4YJGB 3EVCA 4MGIR 1CIVA 1XCOA 4JLPA 2PLAA 4GP7A 2VAVA 1YZYA 2IPMA 2GTHA 2Y67A 4D98A 1TAUA 4IIHA 1JLHA 5FBHA 3TPFA 5CLGA 2GI4A 1OXKB 3K5HA 3CJQA 5EGNA 3UHOA 1ZP6A 1Y9AA 2W6CX 3OE1A 1Y1KE 1JLSA 1GSAA 3ZTWA 1X2EA 5HFNA 3EDQA 4MUIA 2V7PA 2ISSD 3BN3A 1QIKA 2CKDA 3IB6A 3LDUA 4JFRA 4LOHA 3PQ2A 1QOQB 4LRQA 4NYIQ 3T9EA 3JZMA 1ZL2A 1DPFA 4ZI5A 4QUGA 3PQ8A 1ISHA 4U9IS 5J5AA 2ZI7A 2XOEA 4NNJA 4CE6A 3A1VA 3C3YA 5ARDA 4UTZA 1MO3A 1QO0A 2W6PA 3IPXA 4KSCA 1POWA 2CFTA 3C48A 4PBRA 4BATA 4P4NA 3DLPX 5GOTA 4LJ9A 3REQB 2XDQA 1MP0A 3HSSA 3MG9A 4HDKA 2DPLA 3I62A 4HLUA 3SE7A 1V39A 4QGBA 3PBKA 4FOTA 2BH2A 1LWNA 3WGGA 3AIOA 5KWVA 2XOXA 3C3JA 1X1EA 5EWMA 5EZ5A 3U56A 1G21E 2HBQA 3C5WP 3RJ5A 2VK1A 2KHZA 3KQTA 3SHFA 3EUWA 2O8CA 5HKKD 4HGPA 5AW4A 4IAOA 4MB2A 1V41E 2QRGA 2B4YA 3EUEA 5IW8A 3WK5A 4ZIRB 5ESDA 3GUCA 5KYWB 4RIEA 1PUIA 3IEXA 3R5TA 3IIIA 4HYTA 4HDQB 3C16C 3VPGA 2P2LA 1MT0A 1DV1A 1ISIA 1OIVA 4N8SA 4MH0R 4TL8A 1XJQA 4G0NA 5EJGA 1Q7TA 2BIFA 4TOIA 4EYSA 1E3DA 1FNDA 1J8MF 2JCBA 2RHHA 4KWIA 3ZYCA 3ZHSA 3A1UA 5F9HA 3LUGA 4UMEA 4CMAA 4DCJA 1XDUA 3GO4A 4DDVA 1FDOA 3MQ2A 5K0SA 1QRRA 2DT5A 3S1LA 4MCAA 3ZCPA 4F45A 3UMVA 1Z25A 3AVTA 1U2QA 4Y9UA 2X5JO 4ZJUA 3WL6A 1LSUA 1XRLA 1JEYA 2RJOA 3CWQA 2QX4A 3A31A 3O94A 3TGPA 2XCLA 2QYSA 1BC5A 1W9MA 1RIFA 3KPYA 1CRLA 3U13A 1VJGA 1NUTA 3PXEA 4UDOA 1TLLA 1MU0A 2FFAA 5EJIA 5B30A 1Q95A 4LGMA 3DR3A 1B00A 4U2BA 5L3VA 4WBNA 4NICA 3CZCA 1XDBA 2COUA 3K0HA 1FTSA 4EJSB 2ZJ4A 4N3AA 1CRWG 3RIGA 4NNPA 1R9GA 3HABA 4X54A 4GI2A 4QDXA 4BFYA 4CKEB 3RT1A 4DJTA 1SUSA 3ETLA 3IUEA 1EDOA 3VR5H 1GARA 2ECKA 3QLTA 4UPDA 2W8BB 4XB2A 3A05A 3LL7A 5IC6A 1V3QE 3X1JA 3MJRA 3QVGB 2JLQA 2ONYA 3KEOA 3PUXA 2PSEA 3RVRA 5J5VA 1ISRA 3ETHA 3WAKA 5AVWA 4RC9A 2C83A 1KU6A 1ODFA 2LCFA 1MDBA 5EYPB 3U4QB 5F78A 2SICE 3P0EA 4IPTA 4ROTA 1P5HA 4E33A 2E9SA 4W5HA 1TQ2A 5CR9A 1N2XA 2XLBA 3SX2A 4KR0A 1L4BA 1QBGA 3HRHA 2A5FA 1D4ZA 3NOQA 1CUGA 4OHVA 3K94A 3GOQA 5DBOA 1S89A 5FL7D 3CSUA 4KQIA 1J0BA 4ZC8A 2ASEA 1EVLA 1XR3A 5HF8A 2XWSA 2O2XA 4DCSA 4EY7A 5JS2A 2YCBA 2GH1A 2O50A 2FPIB 4YMTA 1GZ6A 4IOMA 1CZOA 1TOAA 4LE2A 4R16A 3T3PB 5EKSA 3ZGLA 3BIJA 5C4GB 1PL8A 2J6HA 3MMZA 1YK1A 1RYFA 4MRSA 1HRKA 3Q4GA 3SPXA 4Y2JA 4TZ0A 3LF2A 3CWZA 4JBNA 2I76A 4RQAA 3HJUA 1PEAA 4TTVA 4LJ8A 1GAEO 5A4AA 2TMDA 2EBWA 3HUEA 3FD8A 4HNQA 4D9FA 3V8BA 3CVOA 3W0LB 3AV3A 3SFTA 2FW9A 5L51A 5AMXA 4RH3A 3FVRA 3J81A 1NVBA 4E31A 4Q24A 1P2UA 2IHZA 4Q02A 4AXXA 4DIKA 1VB3A 1ZIYA 1PR4A 3I09A 4G97A 1MORA 3WNDA 3BXHA 5L7YA 1QFZA 5I9LA 5HK9A 1VLLA 1GZSA 3DVAB 3CEHA 4BQNA 1UK7A 2KLBA 3X43A 2JIQA 2RK6A 2EZUA 2PKYX 4UHJA 1U7UA 4UCFA 2ZR7A 3FI0A 1QIFA 4R2JA 4LQ4A 4CMIA 4J43A 2PLFA 1NR5A 2QTMA 2I55A 4UNQA 4JLOA 5AHOA 4MWZA 1H66A 1E92A 2NG1A 4OQPA 1DTEA 2YJ4A 5JAHA 1A2OA 4YUVA 1UINA 2ERYA 3DBIA 2EYQA 4HNSA 4YAGA 1QHGA 3NHRA 3O95A 1TCBA 1ZUNA 4BE9A 2CN1A 4CTNA 4KXNA 2IZ0A 1PCXA 1E1DA 1T2FA 1BAPA 3AI1A 3ESRA 4H7JA 1BU8A 5TPWA 4Q4HB 1INLA 1OGJA 1GG9A 1SKAA 3E1KA 5K8UA 2VDVE 3NFYA 1PW7A 3ZQJA 2EWWA 1FYVA 2O48X 2Q3LA 1WCIB 3DXZA 3SVZA 1SBHA 3LXXA 3I9JA 4RK4A 2YY6A 4QDUA 1K8QA 4QLAA 1MTZA 4QEZA 3U0VA 1KF0A 4MKRA 3CPHA 2PM8A 3TNDA 1OFGA 3ISJA 2REQB 1V9CA 3VR3D 3LGXA 2IGTA 3M9LA 2M1ZA 3KIPA 2KB0A 2ANCA 1VPDA 2AZTA 5MFZA 1EVZA 2JLZA 4DB2A 2D74A 2IHUA 2FPWA 3PITA 1UCFA 5HA5A 2X0EA 4OXRA 1TQDA 5KQSA 1TPYA 3QRWA 1SWWA 3JQ8B 3G5AA 1FTQA 1WSWA 1UJCA 2DU8A 3TEJA 521PA 3RO7A 5IT4A 1YIAA 4P7JA 4BEBA 4D8WA 8AT1A 3QMPA 1V5WA 5LNK6 1I4OA 4LOKA 4FJ1A 3DGFC 1JEEA 4W9RA 3QI2A 1DMSA 3GEMA 4LJ7A 1U28A 4Y1GA 4RWEA 4NR0A 3NP9A 1OREA 2F90A 1VE6A 2GD2A 4BLVA 4DHWA 2OB2A 1EIWA 1U3DA 2ZBFA 3EDCA 4MTCA 4EHLA 2ZRIA 1D2RA 2QDKA 3TX6A 2XTNA 4YUYA 2C7QA 7MHTA 5JADA 2BKVA 3NGMA 4O2RA 1XZBA 2FW7A 4TVBA 1H05A 4KYIB 1PQWA 3QTLA 5F1YA 2GF0A 2Z6VA 1QXSA 2XTAA 3BL8A 4DARA 4ETMA 4FMDF 4PFJA 5JROA 1BGVA 2YKGA 1VMKA 2WMDA 2ODQA 3T3NA 3GUYA 4EW6A 3NTQA 4QHTA 2HMYB 2Q5FA 2BLLA 4CQNA 3HKCB 4RTJA 4AJ9A 1QCYA 4A36A 1EDEA 1I14A 2CCKA 2NYVA 1JKJA 1XMVA 1L5OA 1VBKA 2WYIA 1E7MA 1KDVA 3HP7A 5TIIA 2HA7A 5T3YA 2AC7A 2J3KA 5EWJB 4BNHA 2VHTA 2J0QA 2QVZX 3D8HA 4BDTA 5FWXB 2OV6A 2MYUA 1VKJA 1R0CA 4UUOA 5J9FA 3USZA 4B8WA 4B76A 4CCYA 4F3YA 1XD2A 4GDFA 4YT8A 1NPDA 5LKAA 3AJRA 3HP4A 1R9MA 1W5SA 3F49S 1BZYA 1PQPA 3TW8B 3HXLA 5AVOA 3S81A 4HJRA 5EN4A 1B74A 3G2HA 3D5QA 4LTMA 1CW2B 1F2UA 2H52A 4RPCA 2GN1A 1R6XA 3IUMA 3JVDA 1DCMA 2WYWA 5K0FA 3DPSA 4BJ5A 4EBFA 1HG1A 3MS4A 5BYAA 4XW2A 2XGMA 3F6PA 4Z2YA 2VK4A 4OQNA 1Y98A 1BG6A 4CUJA 1P5JA 3PQ7A 3R7FA 1VCNA 2ZI3A 2ZYVX 2Q6LA 2HWXA 4ZVTA 4QQNA 4WECA 2ZJ7A 2ZUVA 1VG1A 3GDGA 3EZ6A 1EUZA 1OAOA 3GY0A 1UDXA 3HBNA 1U9IA 2GBIA 4FYIA 4V02A 1ZQ1A 3OU7A 3JASA 2P1ZA 5DM60 2HB6A 7GPBA 1RQ7A 1FYWA 1YOVB 3MUOA 4JEUA 3TAXA 2ZWIA 3HWSA 2IH5A 3A2KA 4KVZA 3V97A 4QVKA 2VDWA 4B46A 5BO5A 4O4HA 1RC0A 5GY7A 4GQIA 2Y1KA 3EIQA 4C4OA 2ORED 2RGUA 3K31A 2QTBA 1H5UA 3HU2A 2G40A 4KHPB 5DX1A 2FLKA 1SUEA 2EFCB 2O3TA 4HJXA 2JLAA 4QARA 1OVMA 4WXMA 2ZSKA 1ZH8A 2BMEA 1Z4NA 3OTWA 1ESMA 1JMKC 1YC2A 1IRXA 4XWGA 2XNDD 3PXGA 4BFUA 5KJFA 4OI0A 1UBSB 3N0WA 2ZPAA 2ZB7A 4O33A 4HGYA 2IEGA 3KJFA 1BN7A 5JVDF 4FZ3A 1G38A 1Z2CA 1NVVQ 4GM1A 1YB7A 3IOEA 4ZVRA 3AOGA 1BRMA 1IZYA 2UZ1B 3O8BA 3VR6A 5IBPA 3EVDA 5EIAA 4ENVA 4BN4A 5AKKA 4JLVA 5KHAA 1N1GA 1I5RA 2VFAA 4YAJA 5EPUA 3KC2A 4PIPA 5TQ0A 1HI9A 3AEYA 5K0NA 4HYQA 2H0AA 4PC6A 2IHKA 1KXZA 2QPLA 3DLCA 3H75A 4IS2A 4LJLA 4MZDA 1TEHA 3RWMB 1SXPA 4HWPA 4TTJA 1C7JA 3JZFA 3TS1A 4P8RA 3EODA 6CHYA 2WIDA 4B3RB 1VXOA 3KFLA 2H06A 2IVZA 1Z2DA 2XVZA 5DGXA 3NDBB 3KKOA 2OG2A 5CX4A 3KAPA 1EE1A 1CRPA 1N5IA 2WSMA 4EJSC 1XNHA 1LEHA 3DFUA 1BH2A 3GN2A 1ZVJA 2IU4A 2WM2A 1UZMA 4LYEA 4V0OA 4W99A 1PZGA 1MX9A 1X70A 1UK8A 2Z2YA 4KL8S 1KEKA 3CW9A 1TKAA 2AQKA 3P94A 1E6WA 3ZH9B 4YJ2A 5LL6P 3ND8A 5C46F 2RI0A 4HEHA 2R7KA 3MCVA 1QO9A 5HCUA 2W9XA 4P86A 3L8FA 4M8IA 4GPAA 2ZB3A 3BS4A 2D3TA 2J30A 5AKIA 3NH9A 3TLXA 1G9TA 3K8YA 4ZO4A 1PWHA 5D3QA 4Q4DA 1YRHA 5AI4A 1UJ6A 2R85A 3K2QA 5DNAA 5JZ9A 1RWNA 3M1AA 1YE5A 2AEJA 3NASA 1DJMA 1XWFA 2YN2A 4Z4CA 3WAJA 3GAAA 3HYTA 4KNVA 1IM2A 2ZPTX 4EI8A 3FKQA 2I4TA 3VPAA 4BPBA 1EUCA 1P45A 3DVQX 4CHTA 2HW8A 1M83A 1ZEMA 2PZJA 3OZVA 4ZT6A 1W85B 5IP5A 3UFBA 2Q9BA 1U2DC 1ZK1A 4OU4A 3S4YA 5CFMA 7REQB 4NMWA 4LNAA 3VDNB 4IYRA 2JCXA 1X87A 5AUPB 3W5JA 1KE1A 3SSNA 4FFLA 2OESA 4G4JA 1FSPA 4MS3A 1I0LA 4LX0A 2RG7A 2G8NA 4KQKA 4TYPA 5C53B 3OQPA 3CG0A 3BZUA 4OTZA 5GM1A 3C8DA 5ES3A 1T4MA 3OJEA 5EIBD 1PD1A 2CLKB 2E4XA 2Q9CA 2NVWA 4PHTA 3SE0A 3ZCTA 4NFYA 4B83A 1JDZA 2IP1A 4L5BA 3C5EA 4WXRA 3PA6A 2ZTHA 2GD1O 3RAFC 1R0RE 3MFYA 1Q7CA 1UWLA 3LQRA 3P7MA 3KSUA 3HEBA 3AHGA 3R09A 3CZ4A 4LC9A 3BGSA 2C5BA 2O6HA 3JQBC 4O2AF 1I2CA 4LW8A 1UEIA 1IN8A 1P1KA 4X8MA 4YBZA 3ENQA 1QHSA 2X58A 3A3NA 3LUAA 1XKLA 1VKZA 4MCJA 4OLFA 2CSUA 3ZD7A 5K0BA 4ZOQI 2IPLA 5C1IA 4ZGGA 1ZRMA 4JA0A 1RQ2A 1XUOA 1CPYA 3CZRA 4FLFA 3VSAA 4C0HA 2QM0A 2WD8A 3AYXB 4IGEA 4KB5A 5GVRA 4EQ6A 3NBAA 3EPPA 5P8WA 3P9CA 1Z7BA 1USVA 2R11A 2WSIA 3TOSA 2OMKA 4EY8A 1PBTA 4X20B 1EBUA 1PN3A 5TY0A 1L5YA 2QTTA 4GR5A 2YYSA 2H2AA 5BRJA 4BP8A 2I2AA 1RC8A 2EX1A 1MAHA 2X22A 4FXOA 2BGWA 4C0QC 2NUTB 3HBJA 2FR0A 3WK7A 1FY2A 3RTGA 3E9MA 4CMGA 4K88A 1ADJA 2EVWX 1PJ2A 1LV8A 4M9XA 4U39A 4IM7A 5C8YA 1U8ZA 3EARA 1YHYA 2V7EA 3VR6H 3R7BA 2XMRA 1ZXBA 5IAEA 2F3RA 1VIMA 2ECFA 4MJXA 3ZCXA 3ZLVA 1XCMA 3I52A 1IAVA 2XQJA 3TTVA 4DWWA 5I7RA 3MGAA 2OECA 1LI7A 4J16C 4S2EA 1PV4A 1XJ5A 1P7ZA 1Y8AA 2EQ5A 4DQDA 1HFEL 3NHSA 3RHSA 3D1LA 4Z0NA 2Q3JA 4IJ5A 1A9ZA 2OCBA 4PZYA 3HK2A 1DUSA 4YV1A 2FZEA 4NBUA 3ROKA 5DI3B 1LQ2A 3EGXA 4HWTA 2IOHA 1HYBA 5CJ2A 4XFJA 5KTTA 3E7PA 3B89A 3UAWA 4ITRC 5IJ0B 3E8MA 1CUSA 3TLZA 2BMJA 1VB5A 1COWD 3U3DA 2O1WA 1B93A 4BQQA 4X3CA 3QELB 4B80A 2HMVA 4OHOA 2IUSA 3COYA 4BP3A 1OMOA 1HLDA 2C1XA 3MRXA 4IFTA 5AP9A 1YR9A 3VZBA 3K6SB 4KR3A 2IS2A 4U63A 2HY7A 3KDPA 1HMYA 1M5RA 1ADYA 4LDJA 3FGZA 4B84A 4C7JA 3RREA 4D9CA 3FLMA 5EZYB 1MVNA 2VOJA 3QI7A 5FI5A 4ZKDA 1ZNWA 1RLMA 3A9VA 1DADA 1EGQA 4UEOA 1FUIA 2IS6A 4RJIA 1TO1E 3BBPA 3MLAA 3ESBA 3LTEA 2LD4A 3RK0A 5B3KA 3KQSA 5DNWA 2H1RA 3BXFA 4HVTA 3ZBQA 4BGDA 2FN9A 1KAQA 4DSUA 5BVGA 5IKMA 4G8BA 4KTVE 1OX4B 4Z9XA 1QVVA 2X2OA 3ONNA 2XVMA 2Z1NA 3GFRA 3RJMA 4XTRA 4KQHA 5HJ7A 4M1EA 3JQRA 4CL3A 2GYVA 1UT8A 4LEIA 4C6RA 1O0BA 2WUFA 4EG1A 3UOAB 4GMHA 3EHEA 4PYKA 4B3HA 3W2HA 1IPEA 5DKFA 4Z3OA 4G09A 3FOCA 4PC3A 2OA0A 1TJ4A 3DOIA 4HDRB 1UZUA 1H4VB 4PYIA 2AUTA 4CU5A 3R7WA 4C0JA 2WPNA 3ENZA 2PL9A 2WSLA 4AO7A 2ZGVA 1I6LA 2B61A 1RI5A 2WF9A 3NWPA 2H29A 5DM4A 5KYKA 3MUFA 4Q9IA 4AY3A 3LOPA 1DKPA 2CXNA 1EJ2A 4ABTA 2JGDB 4UFPA 2FQ1A 4PQFA 3O4IA 2DLDA 1F17A 2ATVA 1A2BA 4H7HA 2GZMA 1N7GA 1CC1S 1WPRA 1HE4A 4ZOCA 5AUQA 5JO0A 3LY7A 3G7SA 4I5DA 5LIPA 4Q18A 1NIJA 2PKWA 2XCIA 2JZCA 4NE7A 2DHCA 1P6XA 4P3YA 2A5GA 3L7JA 1E18A 1I01A 3P0IA 4HZIA 1SUDA 2JGRA 3EDYA 4NESA 4QGGA 2QRVA 1M33A 3VX3A 1UDRA 2MR5A 4GFDA 5BN5B 1VJ0A 3HM9A 4K3VA 5LZ5A 1MMFB 1NWCA 3WKDA 3EQ7A 3N2ZB 4JUIA 5TS3A 5TV2A 2L19A 4UHFA 3GRYA 4QJ3A 1Z35A 3FF4A 2WYVA 4CKWB 3AFHA 4BWVA 1K98A 1RU3A 1DC4A 2ABWA 2K2WA 5JISA 4RXMA 3FUCA 3CZPA 3K0AA 1GAWA 2B2NA 4A1OA 1HY3A 3CH4B 1SHJA 1NLUA 4KXWA 2SHKA 1T6XA 1V7PC 1NU6A 1J70A 1QUEA 4QUKA 2J1LA 4DEVA 4XIYA 4Z4IA 2I80A 1QFSA 4HKTA 5KSYA 2ZJBA 3AFGA 3OETA 2GXAA 2B0CA 3TD2A 4FWTA 4HWOA 1PTJA 2WHEA 2C07A 3DSRA 4YDSA 5DBHX 1GITA 3UK1A 1EEXB 4L5CA 3MBKA 1RRKA 2Q5CA 1UXGA 1GA6A 3HR8A 1KU0A 3ZNQA 1KVRA 5KI6A 2D4HA 2FK8A 1VSTA 4O0LA 4BB9A 3PNYA 4REQA 5KX5A 4MQ4A 2F3SA 3O8OB 4YRPA 3LCUA 3SHTA 2GFQA 4JUFA 4F4DA 1YJAA 2QW1A 2GBGA 1U0SY 2D5BA 5I7AA 3I2GA 1KSHA 1NVWQ 2IUUA 2XDWA 2HAEA 1YU9A 1DDGA 3RVDA 1IHPA 3NTRA 1K6MA 2YJNA 3IQXA 4JC0A 4EB0A 1Y6GA 4MLZA 1SU7A 2DLCX 2ZIUB 1WF6A 6ABPA 1K4KA 1F6BA 2PRYA 3UFXB 2Y1FA 2ZIVB 4K9PA 1WBDA 4LF9B 4IZIA 5CB6A 4JYZA 1DINA 1EUDA 3KVVA 3C1UA 4HMQA 3GCDA 2C7BA 4TRRA 2JI7A 3F7MA 4NIMA 5KWSA 4RHFA 4EELA 3CLRD 4CLOA 5ALGA 4PAOA 4RA9B 3V9AA 5ALQA 4YYZA 2UYCA 1WHSB 2WWVD 3P5SA 4QRHA 3PF8A 3BULA 4D4IA 1H6BA 2MTBA 3DAGA 3Q8XB 1GGHA 1NN5A 2BW0A 2J6BA 2WC1A 1L7PA 3OCCA 4FI3F 4HWGA 4R8MA 4U5XA 1HDGO 3URKA 4IFEA 1DZ3A 1NC3A 4X97A 4Q3BA 4DMCA 1R0BA 5DEOA 1G17A 1L5ZA 2R4QA 3HUUA 3IJRA 4MYSA 1YHNA 5ADUS 1CWUA 2YV1A 4QLOA 1JR2A 1BXRA 2PT7A 3EYWA 4LTDA 4UE6A 3MCUA 2CNKA 5KMGA 3RD5A 4YP9A 2Q8QA 1SNYA 3F9RA 3KSDO 1X80A 4KRGA 3PLNA 2VUIB 3ZTTA 1F8XA 2PZMA 3GLIB 3F6EX 1USGA 3I1JA 2XCRB 1JQKA 1JIQA 2QLTA 2GD0A 2PYIA 3BM5A 3DV0B 4QOIA 4BX2A 4ZU6X 4BE7B 4JXJA 3Q7TA 5HUHA 1J07A 2V6GA 2DH6A 3TLGB 3PF9A 2ZE5A 4OP3A 5A7HA 4GSYA 4EB8A 1CNEA 1MX1A 3GA5A 4RJLA 4JLMA 2JLXA 2FCRA 2P5UA 4J0QA 2CXRA 1OA1A 1T3TA 4EMTA 3HDVA 2HPAA 2ZS7A 1MB2A 3JD1A 3SDSA 5G41A 1KI3A 5JHHB 5CXXA 3F5MA 1UPUA 1T1IA 3AEUA 3F8SA 3MBOA 5CXUA 1PJTA 1GSIA 1T4CB 2LCIA 1E0KA