3W9YA

Crystal structure of the human dlg1 guanylate kinase domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
175
Chain Sequence
NYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the guanylate kinase domain from discs large homolog 1 (DLG1/SAP97)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Disks large homolog 1
total genus 52
structure length 175
sequence length 193
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3w9yA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w9yA01
1ZC3A 1FTSA 3L8ZA 3U4QA 3OHMA 1RPZA 3BERA 4LYFA 3W90A 1D2EA 1NN1A 3VR2A 2D2FA 3ICQB 1P2SA 2YINC 1Z83A 1CXZA 4M1KA 1F2UB 1KNXA 1XJCA 3QG5A 5IK2A 3RWOA 3SYNA 4GOJA 4I1SA 4GZLA 1NKTA 1ZIPA 3H4MA 3DOEA 1NP6A 2A5YB 3RRNA 2L0XA 4UNPA 2VP9A 4CEHA 2GZDA 3T1QA 2C9OA 4FMDF 2WSSD 2GXQA 1AS2A 1J8MF 5FTJA 1VMAA 2JJ2D 2N1BA 3KQLA 1N6KA 2QGZA 5G53C 4LC1A 4IFBA 1G3QA 1EG7A 1FMJA 5JFGA 1HE1C 3MJHA 3PUZA 2GZAA 2RKOA 2A7QA 4FIDA 5CYOA 5F98A 1E2PA 1YZLA 2R9VA 4YLGA 1GNPA 4IDPA 5EJEA 3W8RA 2IXGA 2AWOA 5K8UA 4JLOA 3BD9A 5CLQA 2RB4A 1M34E 4Q4HB 1CULC 1TX4B 5JCZA 1BOFA 1S9HA 1OJLA 2PMDA 4PSKA 2J87A 4BLRA 821PA 4B3BA 2VBCA 4HZUB 4LYAA 3LW7A 1FW6A 3IILA 4PZLA 4MYHA 1CEEA 1UBFA 2OO7A 3NXSA 2FF7A 2ZQ5A 4G5QA 5AUQA 2CL7X 2QA5A 5FBWB 4A6PA 4IOKA 4KLZA 2JDID 1FTNA 1MO6A 4RZ3A 3SS8A 5C2JB 1TEXA 2CHVA 2PT5A 1YJ5A 2WOOA 4DWJA 4CIDA 2DCUA 5FOWA 2IYXA 4KSCA 2P6RA 3B9QA 1ZINA 4UXHA 4D2IA 3VX3A 2GK7A 4NKRA 1ELOA 4B3GA 4DDWA 3VR1A 2QAGC 4PPNA 3L0OA 1SKYE 3T5DA 4EPTA 2ZREA 4TLEA 2WICA 3WNBA 2SHKA 3ZYCA 4BLTA 1EFHA 2RGNC 5AJZA 4DLTA 2LCFA 2D62A 2PEZA 4W5WA 4MYUA 1XEWY 1VYTA 2YYZA 2BKUA 4AKEA 1XTKA 3A4NA 2WWWA 3DZDA 4JS0A 3B1YA 2Q6TA 1TU4A 4HB0A 4ITRC 4IXNA 1SQ5A 2C96A 2VL7A 3QF4B 4NCHA 3RC3A 4QC2A 4C4PA 1NVVR 2I1VB 4TQAA 2FFHA 3BWDD 4HUQA 1SVMA 5BW8A 1DAHA 3KJGA 4FMCB 5FUVA 1E2HA 3W6NA 4A0HA 2CLSA 1T0JB 4LY6A 4C0BA 4PC3A 3AVXA 5B58C 5L3VA 3AP1A 1N6LA 1N0UA 1ZJ6A 4MGYR 3CRMA 1NG9A 3QEOA 3QIAA 2IYSA 1JR3D 1W1WA 3CM0A 5JHHB 1OH6A 3RWMB 1US8B 4HAXA 1XEFA 3KKOA 4P4TA 3ASYA 4M1WA 2XNDD 1RJ9A 2QENA 5LDDC 4EFMA 4M9SA 4TZ6A 3QJYA 2CVFA 1BIFA 3GLIA 4D0GA 2DB3A 3IBGA 1AGRA 3EC1A 3M0EA 3U3JA 3TW4A 3THWA 1E3MA 2J0VA 1R5BA 3UK6A 1OT3A 2W00A 4D4MA 3ZDQA 2GILA 3U3RA 3CF6R 1E9EA 1F48A 3LFUA 5L3RA 1AZSC 1KI1A 4M9XA 2VP4A 4KYUA 2PX3A 4XIGS 2I1QA 3TBKA 4ZO4A 2GKSA 1YZNA 2CLDX 2PJZA 3K0CA 4LHXA 5BXQC 2RMKA 3WYFA 1W36D 3TVDA 2J5XA 1E9AA 1OXXK 1S2MA 1XXHA 3ZZUA 4Z51A 2PEYA 4FINA 1R8SA 1U0LA 1SHZA 1W0JA 2AHOA 3PITA 2V55B 1WE2A 3DMDA 4JLNA 2E1RA 1E2GA 1GRQA 3AKEA 2F1IA 3DKPA 1P2UA 1VHLA 4WW0A 4QJ3A 1N6OA 5LD2C 1R0YA 1DAEA 4Q1DA 4O25A 3Q5DA 4LJAA 3LWNA 3R9IA 2ODNA 2RGDA 4R2HA 2C98A 3GEEA 4YDSA 3UKDA 4UKDA 4QBIA 2BKEA 1TQ6A 2KE5A 2WM9B 3NH9A 4G1UC 1CJVC 3SJCA 1U90A 4XH9B 2YWGA 3R7WB 2MSCB 3SDZA 2KJQA 1Z5ZA 3U7FB 3E1SA 3JVVA 1Z3IX 2QRNA 4M1TA 2ZRKA 1VCNA 1Z0JA 1XCMA 3OESA 1YR7A 2F9MA 3KX2A 4FN5A 4L5BA 2XXAA 5HKKD 4RD3A 2J46A 3NBXX 3WP0A 4QG7A 3OEHA 3GPLA 1KAGA 2GHIA 4WXRA 1VCIA 3CF2A 3KFXA 1MKYA 5FI1B 1JR3A 1QHHA 1QHSA 2GESA 2REOA 1COWA 1IAQA 2GETA 4EPXA 2V3CC 1IXRC 4KXFB 3AVYA 1R2QA 3LDAA 2D3WA 4QJ5A 2XXAB 3IQXA 5E95A 5JRJA 3ZVRA 1XD2B 4N3NA 1VYVA 1FQKA 1E9RA 2H8KA 1Z47A 2GVZC 1N0WA 4C7OA 4B2LA 1AQYA 2OILA 2QRZA 1ZUHA 2ZSBA 3KTAA 3OAAD 1GSIA 2GXSA 4OI2A 3K9GA 4JL6A 1NY6A 3F3YA 2ORVA 2W6ID 1Z08A 4V02A 2WSSA 3AVQA 5BYJA 2C95A 2RH5A 4KFUA 4NBSA 3C16C 4DLZA 2ODWA 4NE2A 1E2KA 4LK2A 4H1UA 3I8XA 2VLIA 4EUNA 1G3RA 1F5NA 2JA1A 1T91A 1KIMA 1X8LA 2VP6A 1AZTA 2XOKA 2IHYA 3P4YA 4Q4HA 4S2EA 421PA 5LB4A 3GLHE 4RD0A 4RVCA 3VKHA 4F92B 1XJQA 4PPQA 3I61A 4GFDA 1GNRA 4ZCLA 4ZIRB 1Q3TA 3GJ6A 1XFAA 5ANRB 5C18A 4BPBA 1E2MA 2FA9A 4FWIB 4TT3D 2ZSEA 3SBDA 1DTSA 2OM2A 4DRZA 1ZVQA 3T15A 1W36C 1IXZA 1AS3A 1J2JA 1JECA 1YZGA 5FL3A 3QEJA 4TYNA 2BBOA 1IXSB 2Z43A 3EZ6A 3QVVA 4TLCA 4EJSB 1CJMA 2QL6A 2GJ9A 2QM7A 1MABA 1FX0A 4JKYA 3P27A 4II7A 4XD7D 2DHRA 1EX6A 4LPKA 2B7BA 1OXVA 1A4RA 3DDCA 3MWJA 3D3QA 1AA9A 1NG1A 5E3HA 2YC4C 5FTMA 1W7AA 5KNCA 4PQFA 2YOFA 3HYTA 2ZEJA 4Q7KA 4Q9HA 1I2MA 2X19A 3RS2A 2JLWA 1I2DA 3QE0A 5KUTA 5KYKA 1R0WA 1RVDA 3QBTA 4V0KA 2Z0MA 2VP0A 3ND9A 1NF3A 1HV8A 2AXNA 2F1RA 2Q9AA 5KPDA 3KQHA 2XSZA 2OBLA 2G77B 1JEDA 1DG1G 1KK1A 3GJ0A 5GVSA 1G8YA 4DB2A 1E2QA 1S1CA 3CH5A 2HLDD 2BWJA 4WBSA 1KY3A 1TL7C 3PG5A 1SXJD 1XF9A 3QKUA 1YZQA 4GMDA 4HLCA 5D3MA 4EKDA 3EX7C 1T4GA 1IONA 4RD4A 4P33A 4HEJA 1FUKA 2QTVB 3T1TA 4DKXA 4XSHA 4K81B 4AWXA 2ZYVX 2VEDA 2QEQA 2ZJOA 4ILEA 4HATA 4D81A 1N6RA 4ARZB 1FL9A 1JAIA 2X1VA 1PLLA 3G0HA 1E1RA 1EESA 4GRAA 1DELA 1FPMA 1BS1A 3EA0A 1T5LA 2KBFA 3FFBA 3R20A 3WP1B 2J7KA 2J0UA 4MDEA 4LZZA 2XNSA 4FW9A 4AKHA 4PHFA 3KKQA 4Q48A 1AM4D 1RFLA 2WJIA 2G0NA 4GNKA 2ANBA 1GKUB 2JLSA 3Q3JB 2IYVA 5TMPA 3ADDA 4ESVA 1Z07A 2XZOA 1EXMA 1RZ3A 2CE2X 1AIPA 1UF9A 2C03A 5FI0B 1GUAA 2EW1A 5FH9A 3IQWA 1UDWA 2VF8A 3BB3A 5FL7A 5FFMA 4DZZA 3K70C 1E0KA 4DUGA 2ZUCA 2IHBA 4Q1FA 4OL0A 4W5JA 2Z4SA 2GCPA 4HB3A 4RCYA 1MOZA 1U99A 2ZS9A 1KO5A 2PCLA 1YZKA 5HCIA 3L8YA 2ZI9A 4OQMA 1J90A 4B75A 4DLSA 1M7BA 1SVLA 2ONKA 2WPDA 2ZSFA 2ZU0C 3ADBA 2KBEA 5IT5A 1QDEA 4Q19A 3DL0A 2ZYUX 1LNZA 1SVIA 1SGWA 3AF3A 1OXUA 2QP3A 2ZUDA 3FMPB 2G1JA 3LA6A 1PUJA 3H0KA 4PR0A 5LD2B 4TYWA 2JLUA 1UAAA 3TAUA 4W7SA 4BFWA 4JKIA 1VG0B 4M1OA 5TY0A 3NHAA 1TUIA 4C9BA 4NYMR 4EDHA 3K0SA 1O3YA 1S0UA 5L3SA 4OYHA 5FPHA 3KKNA 721PA 2HJGA 4TLBA 2ZRGA 1KDTA 1G4UR 3T34A 3TUIC 1EX7A 1W0KD 3B5JA 2V1XA 4LJ5A 4Y0VA 3P4XA 1G1MA 1GRNA 4JMPA 5JZVA 4BLPA 1L7VC 1E99A 4DVGA 3EPJA 4YMTA 1WXQA 5J40A 3LH5A 3RYTC 2PZGA 2YKGA 3QKRA 1S4QA 1GIAA 5FOSA 1ZM7A 3AF0A 2FDCA 2QMOA 4F91B 2JLVA 1A2BA 2HUPA 1HEIA 1W4AA 1ESMA 4TYPA 5FTNA 4IRUB 2QU8A 3DVLA 3K8YA 3RAPR 1UBGA 2NMVA 1XTRA 4AKGA 5JS8A 1XXHE 3BH6A 4TMVA 3CO5A 2A3RA 1Q1QA 1N6NA 2QAJA 2FU5C 2O8BB 4ARZA 1SXJE 3B1WA 2WWIA 3A6PC 4RZ2A 3RRZA 2IA5A 3W9YA 2G0TA 3W5IA 2QQ0A 2YHSA 3MLEA 4FXPA 4TMTA 2HT6A 3LVQE 2QE7D 2VHTA 5DI3A 4B35A 1HTWA 4FCTA 3U7GA 2IS6A 4A0RA 3U6BA 4PX9A 2NOAA 4TL7A 1IHUA 4OI4A 2F3TA 3HU3A 2A5FA 1CRQA 4IJMA 1VYUA 4R7ZA 4JBYA 2J0UB 4G3XA 4WZ6A 1P6XA 1IN6A 5G3YA 1UFQA 1UKEA 5KDLA 2J3EA 4DSTA 3QSYA 2QPAA 2IEYA 4O2RA 1G7RA 3PJRA 2W2TA 1JR3E 2OSBA 2DPXA 4LRWA 2FX3A 3U3KA 4IDHA 4GOXA 2WKQA 4IVPA 4LGMA 4MA4A 1KK0A 3PUWA 4JLKA 5A0FA 4AKIA 1FX0B 2CCKA 4FMCF 1F60A 2QP9X 4QGGA 4JBXA 2GTPA 4KBFA 4A8JB 1OYWA 4LHZA 1D2NA 3CR7A 4A2PA 3G82C 5FOTA 4R9UC 2YNMA 1PLJA 621PA 4PPFA 2BOVA 1G8PA 3ASZA 1CIPA 1HA3A 1S9DA 1TF7A 4PO9A 3OFND 5EP1A 1AKEA 3RSOA 4B71A 4D26A 1U98A 4PZZA 3AEZA 3KKPA 2RHDA 4QJ4A 2YOGA 4AURA 3R8FA 3QUSA 3KXIA 2O8CB 2ORWA 1XXHB 4CF7A 3TVTA 1JR6A 2CDNA 5CK5A 1EWQA 1GVNB 2JIZD 4M21A 2O8EA 5TB5A 3AKYA 3KXKA 3IEVA 4JYBA 4LOAA 5EE0A 2OV2A 2DBYA 3A58B 4UXJA 4NZYA 1DOAA 2R6DA 3AVWA 5HZKA 3LX5A 3B78A 1NLYA 2QE7A 5JJKA 3C4JA 1E0AA 1WF3A 1W36B 4RZXA 4I81A 2VO1A 1KSHA 2VIIA 6Q21A 2ZUBA 1U8AA 3PENA 4FMDB 3UMRA 3QXXA 2W0SA 2XGJA 1CJTC 4JZKA 5F9FA 3MFYA 4Q66C 3MCAA 3THXB 1KDRA 4KI0A 2F1HA 1VIAA 4I99A 1G18A 1KKMA 1HQCA 2QY9A 2WIBA 2RGNA 1CR1A 5E7IA 4L4UA 1XJ0A 2R2AA 4Z8YA 1E69A 1MRNA 2ZS8A 2QBYB 3VNVA 2J41A 4IVQA 4LX0A 1DAGA 1ZUNB 3RHFA 1XCPA 4TMXA 2QG6A 3BXZA 4C0HA 4FI3C 3NEYA 1G21E 3BH0A 4NTZA 4V03A 3SHFA 2FFBA 4L15A 1IN8A 1QZXA 1E32A 4P4SB 1ESNA 4ZCIA 1OH7A 1VHTA 3J81k 3K0AB 3WYAA 3EARA 3FKSD 3KJEA 4HUQB 1G9XA 1Q20A 3Q8XB 2OUKA 4D4KA 5JI2E 3ZS8A 3GLFA 3FMIA 1GFIA 2ZI5A 1W47A 4GT1A 4DEYA 3KTAB 1M2OB 2A5JA 4X8HA 4Z54A 1VTKA 5J4HA 1H8HA 1YQTA 1IY0A 3NEJA 3ZH9B 5J47A 1GRRA 4U02A 1DAMA 4QM7A 2XAUA 2O8FA 2DFTA 3D8BA 1G7SA 1TAGA 2AN9A 5L3QB 5DH9A 5EXSA 2NZJA 1E2NA 2IS1A 4N0EA 2JDIA 2ZRPA 4CVNA 2WWXA 1UKVY 2JATA 5DNYB 3UANA 2A5DA 1T0HB 3GLGB 2WAXA 2FPLA 1BKDR 2IS2A 5JWHA 4HUTA 5FPSA 1E6CA 2WAYA 2IC5A 2OFOA 4OKSA 2GXAA 3GLHB 3VHLB 4BEBA 5KDOA 3EIQA 1F6BA 1IN4A 2JIZA 2XX3A 1XEWX 2BM1A 2DWPA 1OH8A 4ZI2A 3KUDA 1MRSA 2BBTA 4KFSA 5LPNA 2KB0A 1TNDA 2IYLD 2YV5A 1GTVA 3SYLA 4CRWB 2OFWA 4PHTA 4BFXA 4LJ4A 2VSFA 1J99A 1FZQA 2Z4RA 3EZ9A 1J70A 5H70A 4XWKA 1UEJA 4C0KA 1CJKC 1XD9A 2J7PA 4M53A 4B33A 4CYMA 3PIRA 4AYWA 1QVAA 4KHZA 4Q4LA 2LKCA 3H2YA 3RSLA 4QOSA 2WVJA 4OQLA 5H68A 2IYZA 1K5GA 2P67A 3BFKA 1KY2A 2O0JA 1Z2AA 4DLXA 2I3BA 2DWOA 2IYTA 2FFQA 2BMDA 2Z6VA 2OXRA 4XVQA 4KCGA 5BN3A 1P5ZB 4PO1A 1T3HA 3IO5A 4E03A 1ZM2A 3PEVA 3OEED 5HE9A 2O8CA 2HEIA 2ZJAA 3FYHA 3NTUA 4P0TA 1RE0A 1OKKD 1GG2A 4HYYA 3VFDA 1WB9A 2B92A 5IRCD 3K1JA 4ZI3A 2AD1A 2F3RA 2ZJYA 1XDBA 2A78A 3K9HA 4PC1A 2J59A 1D9XA 4MKIA 3T12A 3CRVA 4JJZA 2ECKA 1X8KA 4QRHA 2BJWA 3M1IA 5FBQB 4A2QA 2OBNA 2IUUA 3W3ZB 3CZQA 4A15A 4CEHB 4YONB 4PFSA 3RC8A 1RRGA 4JIMA 2FV8A 3GFOA 2V6IA 5DI9A 4TMKA 3G5UA 5HZHA 3X1DA 1T8TA 2V7QD 1EFCA 2VRWA 4DXAA 1KHTA 1QHHB 3K0AA 1NVVQ 2J45A 1KK2A 2O5VA 1KI6A 1YR9A 4QBHA 1U2RA 3LQRA 4US1R 5FPTA 3VHXA 4QL3A 3OZXA 1FNMA 2ANCA 3LO5A 1OE0A 2ZRCA 1SHKA 3WYGA 3W34A 2WJJA 2H7VA 3L0IB 1KI9A 2OFXA 2YWFA 3LBNA 4JL5A 3LD9A 4PXAA 1Q1EA 1QF9A 4F4IA 1NNEA 1DBSA 1Z6GA 3KKMA 2QN6A 4V0LA 4XSGA 1M7GA 4Q01A 2NO6A 1BMFA 5AUPB 3TSWA 3LQQA 3H1TA 3QPUA 1RRPA 3ECCA 5CB8A 4DIDA 2XJ9A 4G0NA 4PSVA 1OPXA 1RKBA 3NDBB 2ZYTX 5DHAA 2CVHA 1R8QA 1T3LA 2H92A 1NSTA 4EFNA 1W48A 1CTQA 1YZTA 4P32A 1XP8A 1KOFA 2NG1A 5DO9A 1N5KA 5EZ6B 1JALA 5FOXA 1NN3A 3D7MA 1OF1A 5CITA 4DDVA 3QXJA 3C5CA 4YXWA 4B32A 4URXR 1COWD 1LF5A 4I4LA 3BE4A 1E2DA 4KFRA 4B2IA 4JVMA 3ZQJA 5DE3A 1VCOA 3ND8A 4OHXA 1NBMA 3QI2A 2G9NA 4O2LA 4DBLC 1OFTA 3BBPA 3X1WA 1NVUQ 3T5GA 4OK3A 1TMKA 2WPDD 1U0JA 2R6GA 3I5YA 3HU2A 3MRSA 2GVDC 2FZLA 2IS4A 4MKHA 1LS6A 3CX7A 3O8BA 1TQDA 2ZVPX 2XITA 1B23P 1E79A 1R10A 2VH5R 3AB3A 1Z6TA 3AVOA 2VHJA 3HPRA 2GJSA 4NCKA 5JJLA 1W5SA 5SZKB 4MYTA 1KSFX 4RFVA 2OXCA 2PJRA 3VR5A 2QT1A 2QAGA 1EFTA 2PH1A 1NJFA 1CRPA 4IW3B 4DC9A 1J7KA 3ZIAD 5KHOC 5KU1A 4MGKR 2WJGA 3V4RA 3BFVA 2EYQA 2O0KA 4GOKA 2CK3D 3ZS9A 4HB2A 4B47A 3VAAA 1EFRA 2C78A 4PAOA 5FBVB 3VX4A 1W2GA 5KO2A 3TSZA 1OHHA 4POAA 4US0R 2W58A 3N2IA 3PCRB 2NZ8A 3TQFA 3W6OA 2R6CA 3LBHA 3GFTA 4ZKEA 4DLUA 1R6BX 3PR1A 5FUXA 3FWYA 3SZRA 2OCPA 3TGPA 1II8B 1N6IA 3LLMA 4UJ5A 1JPNA 1E4YA 3T61A 4B44A 4D0LB 5KOYA 4EQ6B 3ADCA 3GLGE 4MDFA 1KDPA 1NI3A 3U61B 1N6HA 4F38A 4CEJB 2X8AA 4TL9A 3AH8A 2R65A 3U4QB 3SJZA 1XMJA 1W4CA 2N42A 3FVQA 3TQCA 3R9WA 5CDFA 1KMHA 3NBFA 1XZQA 5M04A 2ORIA 3SI7A 1O87A 4B73A 1ZIOA 1X86B 2ZRNA 5GVRA 2GJ8A 4UNSA 1P2TA 2C8VA 1HURA 5CJ2A 2XB2A 1KDOA 2GEDA 4HAWA 2F43A 3WBJA 3HU1A 2QT0A 2Y8EA 1X1SA 2VA8A 3A1WA 3S1AA 3VR6A 5HTKA 1G41A 3WMGA 1Z8FA 4KODA 2NPFA 1KO7A 1E9SA 1CR4A 1C4OA 1G3IA 1KI7A 2P65A 2WKRA 2QM8A 3GD7A 4LBYA 1W2HA 4DCUA 2YOHA 1VG1A 1L2TA 2C77A 1DAKA 2NO1A 4W5HA 4BLQA 3U44A 1P2VA 5FR1A 1OB2A 3OIUA 3OIVA 1NLZA 4D0NA 3IHWA 3KXLA 1FQJA 1LFDB 2EFGA 4WXPA 2ZRLA 3A1UA 4TSFD 1OH5A 4L16A 1OB5A 3K0CC 5JEDA 2VHQA 4DCTA 1AQUA 1XTQA 3F8TA 3GEHA 3KB2A 4BFSA 1II9A 4YMVA 5D3QA 1NSFA 1XMVA 3NHBA 5JSZB 3TUZC 1CS4C 4GSYA 4N0DA 4ON9A 3GJ7A 1UKZA 2QAGB 4ZPXA 5LBIA 4B6EA 3FTQA 2FNAA 2VYFA 4K46A 1QHIA 4PC2A 4BECA 1CLUA 4LHYA 4HI0E 1QVRA 3MWYW 3BK7A 1S3GA 5JECA 2FSHA 2AD5A 3MAAC 3SQXA 4HDOB 4JSYA 2BMFA 4L8GA 2UKDA 3B7GA 1E98A 4C0QC 4X8MA 4UNRA 2WWFA 3CRQA 2VP5A 2JCSA 3CLVA 2B8WA 4Z1MA 1MABB 4Q7MB 4V0OA 3IEUA 1CF4A 1YR6A 3SEAA 2P5TB 1KAOA 4MUBA 5P21A 2OE2A 1JJVA 1V43A 2N46A 1C1YA 1OLOA 3OE7D 3TIFA 3T35A 1TF5A 2GJKA 3QKSA 1KI8A 1NN5A 2CEAA 3K0FB 1E0SA 2WV9A 3PFIA 2ZROA 3ZGXA 4QXAA 1MR3F 4QGHA 5JSZA 5CDFE 2BCJQ 4CZ2A 2ZU6A 1DEKA 2IF2A 3IUYA 4JLAA 1Q57A 4Q7JB 4M4SA 3FPAA 2Q9BA 1I4LD 1XTSA 2QMUA 1G6HA 5C46F 2EU8A 1XMIA 2F43B 3WNDA 1Z6AA 3TUJC 4M0LA 2FGJA 4Q9KA 3SJAA 1D8TA 4YDHB 4C0JA 5E7JA 3BORA 1ZD9A 2F7SA 3RS7A 1KI3A 3PEUA 3RABA 5FPYA 4EFLA 4IOMA 4CDGA 4LBWA 1LW7A 2IYRA 1K8RA 1GAJA 4R71A 3QQ5A 3IDQA 5DI3B 1NY5A 2D74A 3GJ3A 3VQTA 3I5XA 3ZLJA 2DR3A 1G20E 2G1KA 3K70D 3Q72A 1IQPA 2YWEA 4B2PA 3EPHA 4GP7A 3BB4A 4D25A 1G291 3IIJA 2V8OA 4P31A 4Q03A 2D06A 2GZHA 4M1MA 3UMSA 1IBRA 1W0KA 1R7RA 2G88A 4LPSA 1CKEA 1GKYA 2UZIR 3CPJB 1LV7A 3RS0A 3M4YA 5DIFA 4C7OB 4FCWA 4LI0A 1DG3A 4KVGA 3A36A 2ASEA 4TMZA 3EWSA 2ERYA 3GQBA 4F93B 1NIJA 3HR7A 1P7CA 3O8CA 3K9LA 4F7WA 1ZM3A 2FE4A 2ZAOA 3SQWA 3EPKA 4V0NA 3RDPA 4B3CA 4US2R 3QKRB 2RGAA 5B30A 5HE8A 3CWZA 4V0MA 1VCMA 4AK9A 3RS3A 2HDNB 1KGDA 2RGGA 1P9WA 2G3YA 4S35A 2X2FA 5DLQC 3X2SA 1PLKA 2K5UA 3QY0A 2CNWA 2V6JA 4LYHA 4U00A 3TH5A 5DN6D 1YHNA 1R0XA 3GEIA 2O0HA 1XEXA 2ZE7A 2HYIC 5A5GA 3NBYC 3KJIA 4TMWA 5EE1A 5H8WA 3JZMA 1A7JA 4GI7A 1XCGB 1P4SA 2AFIE 4N1AA 1N6PA 4C0AC 1ZCAA 3CWQA 4ZDWA 4YQFA 3B13B 1QHYA 3WHLA 1II0A 4XWAA 1Z22A 2GXUA 3SYKA 2G6BA 4PZYA 3Q9LA 3UMFA 2GNOA 3MUFA 1KJWA 3IIKA 2ATXA 3AF4A 4LV5B 1U9IC 2WMNB 3R8CA 1KSJA 1IOZA 1W4BA 2V4ZA 3GLIE 4URZR 1E1RD 2JJ8A 3AP2A 3SBEA 5AR1A 3C8UA 5SZIA 1P75A 5FOVA 1EGAA 2CLCX 1MO5A 3A37A 1FOEB 2BEKA 2WWHA 5FTKA 2VF7A 5HR5A 3IBYA 1Q1BA 5B57C 1U94A 5HPYB 3CKLA 3S1AB 1ZD8A 1W4RA 3TR5A 1M74A 121PA 4B43A 4B3FX 3OAAA 5DYGA 2FWRA 2VTKA 4JYCA 3GLFE 4G5RA 1TEVA 3NIBA 1XWIA 1RJ9B 2IYYA 1T5IA 4B3XA 2HCJB 1DE0A 1XTJA 4URYR 4ZDKA 3CONA 1GL7A 4JVNA 4RCZA 5G3ZA 4DUGD 2X77A 4X8LA 2Q3MA 1AK2A 1G19A 4MKGA 5DYIA 1X8JA 3QG1A 2P2LA 3CX6A 5CIWA 4IDNA 5AWFC 4MUAA 5ELXA 1KI4A 3CZPA 2ZE6A 4TN1A 3B85A 1E1QA 1R0ZA 3WBKA 2DFLA 1S1MA 1VG9B 2E9SA 3RS5A 2WJHA 2IXFA 2Z5FA 2IT1A 2H16A 3FE2A 5EE3A 4OJQA 4LJ9A 4HB4A 1EFUA 2ATVA 1RC8A 1IJFA 2GA8A 2W0MA 4CEIB 3T06B 2O8DB 2QNRA 5C4MA 2NO9A 1Z28A 4LYJA 3WMEA 2AL7A 4HLUC 2CHQA 4K8OA 3C5HA 2I4IA 3LV8A 1SXJC 3L2OB 5TXGA 1E4VA 4O3MA 5DSZA 1G8FA 1KI6B 2XOKD 1KJYA 3DM5A 3LBIA 3UIEA 3THYA 5C4GB 4EJSC 4XTCS 1NKSA 4NYIR 1E2IA 2QP4A 2V9PA 2FSFA 4Q7LA 5CM8B 4MRPA 2IYQA 4AD8A 2W2XA 2ZITA 4TYQA 1Q22A 3FHOA 2Q21A 4B48A 4TZ0A 1Q44A 4RJLA 4AY2A 3MWKA 4A0GA 4EAQA 4A36A 1Z6YA 1G8HA 3UWOA 2OG2A 3D31A 3Q7QA 1KNQA 1G64A 2DFKB 5G41A 2O52A 4Q1EA 2P3SA 1WQ1R 1IN5A 4GPTA 1TU3A 2FSGA 3RRYA 4DLYA 2QPOA 2ZRHA 3LAWA 1UBEA 4LJ7A 4QNMA 2ZRJA 3UG6A 2C2HA 1HH4A 4MGZR 3NKVA 4NH0A 2AK3A 5J4LA 4LUCA 4ESHA 1G5PA 2GEUA 1UDXA 2IUSA 3B8HA 4M22A 2NQ2C 5EUMA 1KTVA 2AX4A 2BMJA 4JL8A 4RD6A 3JVUA 1US8A 1XBTA 4RKFA 2PLFA 4LDJA 3QPWA 5FBRB 4Y0AA 3AM1A 2R8RA 2J7PD 1D5CA 3LY5A 4ABYA 2A9KA 1KYIA 4OHZA 2FPKA 3WNCA 1VDZA 4M1YA 3THYB 1ZMXA 2ZE5A 4JT2A 4WA7A 4DSOA 2ERXA 3ZVNA 4JSTA 2GJAA 1E79D 4HAYA 4RFSA 2ZAMA 3B82A 5FBLB 2AWNA 4BQSA 1IY2A 5EP2A 2OESA 4Q47A 2JASA 5TV2A 2ZTSA 3OEEA 1QBKC 1ZW6A 4C3ZA 3QKTA 3AP3A 4MRVA 2RGCA 2FSIA 2D4HA 2IEZA 5IDVA 2CCJA 4MH0R 4Z8XA 4RKEA 1EK0A 3KFVA 1N5LA 2ZIAA 1GDDA 3REGA 1UM8A 4M2LA 5EXTA 5B2ZA 4E07A 3QXSA 5KSOA 2IX3A 1AJEA 3CH4B 4IHQA 1GNQA 2OT3B 4PSAA 2QMHA 1TQ2A 1JJ7A 3M6AA 4C2UA 2RGBA 3MMPA 3SU8A 2VQSA 3QF4A 3L82B 3AGQA 1Z0KA 1XPRA 4TQ9A 1G3UA 4URWR 3R7WA 1SVWA 2AR7A 3EZFA 4D82A 4ZDJA 3U7EB 3CUEF 2BCGY 2V7QA 4DCSA 5IF9A 5BWMA 1CJUC 4UXIA 3C41J 1P62B 2W6JA 1NLFA 3THOA 3IKJA 4URUR 1XD8A 521PA 1MH1A 3HYRA 4DLVA 1E96A 2QSZA 3A8TA 4JVSB 4CGZA 3D6TB 4IKEA 4Q21A 4XTRA 3ZD6A 1L4YA 1OYYA 2GF9A 4TQUS 5LB2A 2CJWB 1S3SA 3WHKA 2GK6A 3SFVA 1NMYA 2CMKA 3HP1A 1Z0DA 4Q18A 3E2IA 4UQOA 2GF0A 4CW7A 2REXB 4L9WA 3TSOA 2AKAB 1N25A 3THXA 1E2LA 2JLYA 1JQJC 4NPHA 4Q4JA 2PZFA 3IIMA 3KJHA 1F2TA 2H5EA 3A1VA 2B7CA 4TSFA 4V0ME 2VP2A 4A6XA 4YMWA 2WWYA 3RVBA 3ICEA 4B76A 1AGPA 1RYFA 2QMEA 4HZUA 1OFUX 1A5TA 4OJKA 4NDZA 2AKYA 3BAFA 3KB1A 4Q1BA 3PEWA 5JWOA 3LXRA 3NVAA 5F9HA 1TUEA 1HY3A 5L3SB 1G6OA 5JRZA 4GL2A 4IVRA 3CW2A 5JJIA 1F2UA 2WWGA 3LW8A 3EASA 1NMXA 3EIHA 4F4CA 1NVWQ 4G5SA 2QSYA 1CBUA 5A4JA 2ZE8A 3N5CA 4FD2A 2CXXA 2R44A 3DPUA 4LCBA 4DEXA 1GP2A 1T8UA 2ZJ5A 3KQKA 2H57A 3HPQA 3N2EA 3RS4A 1E9DA 4OQFA 3PUVA 1BO6A 5L8VA 1M7HA 4QBGB 4KFTA 2LWIA 3CPEA 4KYIB 1WP9A 2ZRIA 3UXMA 1A2KC 2O8FB 2B6HA 2P6NA 3EW9A 2NO7A 2A5GA 4KU4A 1DVRA 1DS6A 1KO1A 4LV8B 4DHEA 4Q4AB 2BVNA 5KSYA 3EWAA 2A2ZA 2XTNA 5JWRA 4XVRA 3U44B 4H1VA 1OFIA 4D4JA 3ETLA 5EXXA 4BFTA 5KTYA 4DT1B 1ZNZA 4I1VA 1G5RA 1OV4A 1P9NA 4MRSA 4PHHA 1IM2A 3CIOA 4O0MA 1E0JA 2XZPA 3CRRA 3ZQ6A 1Y63A 1PV4A 4H9GA 3VKWA 4YMUA 3AUXA 5F2EA 1YR8A 5BQ5A 4IFEA 5FOUA 3OEHD 1FP7A 3I32A 2BM0A 4A2WA 1NJGA 1P72A 2ZR9A 5FPKA 3LRPA 2IW3A 1OIXA 3GMTA 1KKLA 1QG4A 5EQTA 4C2TA 3DKVA 1ZUIA 3OFNA 1FMLA 2IL1A 3FKQA 3AQ4A 4LJYA 3VR4A 3PUYA 5F3WB 2DY1A 2HF9A 3K0FA 5GADl 4BRWA 1DO2A 4DT1A 1Z2CA 3Q5EA 1OHHD 3QKSB 1VIYA 2ZJBA 3FB4A 4EIWA 2HXYA 1AS0A 1YU9A 2WHXA 4TLDA 4BFZA 3W5JA 4TWZA 3P32A 4QHTA 2WZQA 3W3AA 1H8EA 1TF2A 3B60A 4JT4A 1GITA 4C0SA 4XWOA 3F5FA 2WBLC 4TTPA 4EPWA 4BGDA 4IDOA 1ZRHA 2ZRBA 3EZ2A 3A4LA 4UJ3A 3U3MA 2R62A 221PA 1ZCBA 2JLZA 1JEEA 1XPOA 1NN0A 5JBQA 3Q85A 1ANKA 2ZJ8A 4J0QA 1XMSA 2GEVA 1XRJA 3W6PA 2QPTA 1OSNA 2BBSA 4LJ6A 1UBCA 3V9PA 3I62A 4JJKA 5FUWA 3L0PA 1BH2A 3C14C 3VU9A 4IDQA 3C7KA 2OZEA 3DMNA 3EAQA 4WZBE 1NL3A 1QG2A 4RD2A 2ZI7A 4JLPA 1ETUA 4LC0A 4NMMA 5KNDA 5CK4A 2Q3FA 1XNJA 1RYHA 3LLUA 3SR0A 1LS1A 2HT1A 1F2TB 1KK3A 1P60A 1ZP6A 3PXGA 2C9YA 1KJZA 5L3QA 1SZPA 3GJ8A 3GP8A 2GDJA 4NHOA 2FFAA 3QF7A 3WRYC 2BHRA 3EIEA 3TR0A 2REBA 1Z0FA 2MMCA 2MSEB 5G40A 3AGPA 3TLXA 2OLJA 1S8FA 4OK6A 2FOLA 3OE7A 3BRWD 1QHXA 5SZHB 4E22A 2GWHA 3WRXC 1UADA 2HCBA 3GJXC 4U5XA 3BH7A 1H8HD 1N3BA 2BJVA 2ODBA 3ZVLA 3O8RA 2EFDB 1NMZA 1KO8A 4NCIA 4NYIQ 5CJPA 4JVLA 1H8ED 3VR3A 1G3MA 1YVDA 1Y3AA 2NO0A 2FEMA 3P20A 2GBLA 5AJVB 1II8A 3AVVA 4ACAA 1W44A 5IK2D 1NBMD 4ASUA 1ZAKA 3X1XA 2OEPA 1K5DA 4HLUA 1JXMA 4AI6A 4PAQA 3EZ7A 4EPVA 2PCJA 1FUUA 3OF5A 4IOJA 3GJ4A 4HZIA 2EFHB 3P1JA 4HLDA 1G17A 1I4DD 3DEFA 4ZKDA 2JJ1D 3CNLA 4KBGA 3LNCA 3BFXA 3ZD7A 4PPGA 3FDIA 1FFHA 1FNNA 3ADKA 1G16A 2ZI3A 3I3SR 2RGXA 1Z0AA 2ZI6A 3I1FA 1IY1A 1P73A 3DHWC 3GCGA 1YRAA 5D3MB 1D2MA 3ZIAA 1ZM4A 2ZSDA 4IXMA 1GZSA 2XJ4A 3VU9B 1N5JA 3ZJYA 3VNUA 5KPJA 3IGFA 3FFAA 5FL7D 4BFVA 1G4AE 1G8GA 1ZM9A 2ZPTX 5FTLA 5K8IA 3IO3A 2F9LA 4P4UA 2EFCB 3SNHA 4D4LA 2TMKA 2QORA 4IOLA 2ZI4A 3QXHA 3B1XA 4OQXA 4RD1A 3I73A 1A82A 1J8YF 5AK0A 5E7MA 3UG7A 4OI0A 2ZRAA 2QZ4A 3MJRA 2PLRA 1NBME 2CL6X 2XEXA 4TL6A 2WSMA 4PANA 4HDCA 3NH6A 2JLRA 1HE8B 3GFPA 4B74A 1E9CA 2RCNA 3B6EA 1LF0A 4HAVA 3MWLA 2YZ2A 3MD0A 3JZAA 3K70B 3IPXA 2E87A 2G83A 3AVPA 2D7DA 1OXSC 3SHWA 2EVWX 5CB6A 3AKCA 3ZZ0A 1NIPA 4BZPA 1LVGA 3CRW1 4OI1A 3TRFA 4LBZA 4PQRA 5AJWA 3NC1C 1D9ZA 1OIVA 2GCOA 2PBRA 4I1OA 4XJXA 3U60B 1SKYB 2IXEA 4LJ8A 2F55A 4LHWA 4OHVA 2OBMA 3AF1A 2D2EA 3RRMA 2XZLA 4UNQA 3AVTA 1KI2A 3U7HB 4A9AA 2MSDB 3TKLA 4DDUA 4QHYA 2GAOA 2IF0A 4P3YA 4ZV4A 3SJBA 1XD2A 2V1UA 1OIWA 4BASA 1W46A 1P9RA 4DB4A 2IBMA 1MV5A 4KJZA 4DIEA 3GLHA 1AKYA 1T3SA 1ZU4A 2JLQA 3T1OA 4GDFA 3HR8A 2XTZA 4B3DA 3QPVA 5HCNA 2KWIA 3PUXA 2FMXA 1MO4A 2PZEA 3RLFA 3TJZA 2W2VA 4KITB 3GLGA 1UEIA 1X6VA 3SOPA 4LWZA 1TPZA 4IEEA 4EQ6A 4NYJR 2OAQ1 5JI3E 3CF0A 1BMFD 1GL6A 4WZAE 4TTRA 2EQBA 4NP6A 1GOTA 2ZYWX 3A1SA 1C9KA 1R5OA 1U81A 4MRRA 4DCVA 3PEYA 4DCNA 5K8LA 1GILA 1ODFA 3QENA 2NPIA 3U3OA 3H84A 2A30A 3O47A 4BEJA 1QHNA 3NWJA 1EWRA 3CNOA 2HF8A 3I8SA 3LVRE 5JEEA 4NCJA 1PVOA 4QNRA 3FMFA 4QFMA 1S96A 3RNLA 3MSXA 4P4SA 2CCGA 1JI0A 3FHCB 1U8YA 1WMSA 3AKDA 5B64A 2QTFA 4CT4B 1G7CA 1W5TA 4W9MC 1T9HA 1UPTA 2V54A 3PVSA 4BE7B 5KSZA 4YXWD 4PO8A 1RW4A 2GAAA 3FHTA 1ZNWA 1JQLB 4GMXA 1HT2E 2HJVA 1N5IA 4YC7A 3K9NA 1IJEA 2ZRDA 2H18A 3BOSA 1MO3A 5TVKA 1Z06A 1OXTA 2J9RA 4RFSB 1PZNA 1KZGB 5AUOB 1Z63A 2XB4A 1W0JD 2DWQA 2H1LA 3CX8A 2RHMA 5AJYA 5EE5B 1B0UA 2R6FA 2GBLC 2P6UA 1ZU5A 1XTIA 4NU0A 4AC9A 1RIFA 1JNYA 5J4YA 3SFZA 4ZIRA 5EUQB 4Q4JB 1Q21A 3MGCA 1L8QA 2FH5B 4AG5A 5JMTA 4AYXA 4BLOA 3GLIB 1WRBA 2NTYC 3KL4A 4QBFA 3X1ZA 1XB2A 4BFUA 2DYKA 5TARA 3CBQA 3FGNA 1Z6XA 4D80A 4IEIA 3AV0B 1DAFA 3QBVA 5DISB 2CJWA 4DLWA 2FN4A 5TDHA 2CK3A 3NC0C 4M8NE 4Q9LA 5FR2A 4R2IA 3VKGA 2WKPA 2PX0A 1GL9B 1ZBDA 4UNNA 4WAUA 2EFEB 2QROA 4JLJA 4A8JC 2BV3A 1YKSA 4BUJA 5KDDA 1ZD1A 2OCYC 1HUQA 3H86A 4HDQB 1SVOA 4GZMA 1DO0A 3I92A 4OHWA 1CR0A 4HSEA 4NCNA 4PHGA 3REFA 3THWB 3ZZTA 4JLVA 2J0SA 1M8PA 1JBKA 2AK2A 2IYUA 1XEXB 2QGNA 5CLLA 1ZYUA 2O8DA 3MG9A 2WOJA 1G7TA 3EA5A 4ASUD 1XX6A 3QXCA 3SE0A 4DJTA 1U9IA 2IK8A 2CE7A 3CB4A 4KAXA 3B9PA 2MMGA 2FEOA 2IWHA 4MITA 1N0VC 3DM9B 4KO8A 2CL0X 4BZQA 1TTTA 2F1JA 3WXMA 1PUIA 2BEJA 1WA5A 2ZRMA 4TL8A 2B8TA 2QQEA 3TE6A 5JHGB 2QTHA 4QM6A 1JAHA 2OCBA 4M1SA 3NG1A 2VPPA 3FOZA 2BBWA 2KSQA 3DOFA 3IHLA 3NDPA 1DPFA 2B21A 3HWSA 4LHVA 2P0EA 4NONA 3CPHA 1UJ2A 3EPLA 3GLFB 1SKQA 1ZC4A 1N2CE 2ZRFA 4DLRA 4XD7A 1JB1A 4A82A 3E70C 2JEOA 1YRBA 4TT3A 2XNDA 1I4TD 4PC6A 4WVFA 1JPJA 1WBDA 3HDTA 3OIYA 4DDTA 3UATA 3HJNA 1NVXQ 1VKJA 3V4FA 2RAPA 2UZ3A 2YC2C 1QRAA 2ZS7A 5JLJA 3DZ8A 2QBYA 1LTQA 2PT7A 3N70A 2FGKA 1YZUA 3K53A 5GJWC 4TLAA 2XSZD 5K8TA 1YE8A 2YVUA 2W6JD 1IN7A 5J4VA 1SVKA 1M6NA 2D7CA 1GKIA 3KQUA 2RGEA 2JAQA 5BN4A 2EYUA 4BZXA 5IHPA 4TTQA 1SXJA 4JBWA 4A92A 4Z1MD 2VHCA 2BDTA 1FP6A 1SULA 2R6AA 2CBZA 2WJVA 3O8DA 5GJVC 4PC7A 4BRUA 5JS7A 5EP3A 1E2FA 5EP4A 4M9ZA 4WOPA 4EPRA 2ZANA 4Q02A 2ZSAA 2O8EB 2GCNA 3TW8B 4QGFA 1E1QD 4ACBA 2FJUA 4KV9A 2ZM5A 4BLSA 1NRJB 1R5NA 2ZR0A 3BS4A 3CR8A 3E5HA 3TK1A 2C99A 3EG5A 2HXSA 4MQBA 1SVSA 2JJ2A 1E94E 1E2EA 1WDTA 1R4AA 4CT5A 1VPLA 3BJIC 4OBEA 4ERNA 3A1TA 3BIFA 4ZCMA 2ZJZA 4A0FA 2IWRA 5KNBA 5FUYA 3BGWA 1KSGA 2WIAA 4PQYA 2LKDA 5CYPA 1T6NA 4FMBB 4PTLA 2NGRA 2H17A 4AIIA 2W83A 1WBBA 2QUZA 2C5LA 4FWTA 1XPUA 4CEIA 5J5CA 1TQ4A 3RANA 2ZVQX 5SZJA 5GJBA 4U7DA 2C9CA 1ONBA 3OIWA 2YWHA 4LSGA 2WJYA 4MYCA 1XU4A 3SN6A 2JLXA 1AN0A 1DADA 5CM9C 3NBZC 2OAP1 4HAZA 2JGNA 4R98A 3BB1A 1UKYA 4E5UA 3VMFA 3VTKA 4URVR 4L9SA 2WTUA 8OHMA 2YJTD 2W6IA 2OCAA 3F0TA 2P5SA 4Q9JA 4F4JA 3K09A 3LX8A 3L0SA 1Z0IA 2WMOB 5H1YA 4G5OA 3B2EA 1KMQA 5GJCA 1KO4A 2FZ4A 1Q1ZA 1GWNA 1OFHA 3BC1A 4NYMQ 4JLDA 4Q5IA 2NIPA 4JLMA 3Q7PA 2FPMA 2ZR7A 4Q00A 5EZ5A 1OW3B 2PMKA 1U8ZA 3U6KA 2IYWA 2UVQA 2AXPA 4MGIR 4EPYA 1Q12A 2GCOB 3WY9A 1XZPA 2CNWD 1M1YE 2HV8A 5DN6A 1MT0A 4LV6A 4Q1AA 2BMEA 4CEJA 2ZJ2A 3WMFA 4QHSA 5EE9A 2IUTA 4B6FA 5BYKA 3R9XA 5AUNB 1RRFA 2XTMA 2O8BA 1Q3HA 2VHUA 3V00A 4NL4H 4Q4AA 4XVUA 1F3OA 4HAUA 4GBMA 5AJXA 2AFHE 1H65A 1PJRA 3K09C 2JJ1A 4C0LA 3QNUA 4A4DA 1VG8A 2X2EA 5CIQA 1TADA 1LB1B 3FKSA 3KDSE 1KZ7B 2C04A 4C30A 4DSUA 3I4LA 1A1VA 1ZNXA 4MRNA 1HT1E 1HQYE 2KI5A 4LBVA 2Z83A 3PV0A 3CNNA 1WCV1 3GJ5A 3X1YA 4E09A 4D6PA 2EWWA 2F6RA 4HLQB 3LXXA 4OQNA 4GP6A 1G5TA 4TYYA 3W8NA 1LY1A 4YMSA 4Q1CA 2BC9A 3KZ1E 4A8JA 2ZETA 4AG6A 1JXOA 3FMOB 4RZUA 3DO6A 2FG5A 1E9FA 2BIFA 2ZXUA 4WIAA 4A1FA 1CP2A 4G01B 4EJSA 2GRJA 1DARA 4DSNA 2VSOA 3U5ZB 2OHFA 4XOIA 1Q0UA 4MKFA 3ONWA 3P26A 1D6JA 4RSGA 2PL3A 2HLDA 3KQNA 2Q3HA 1P61B 1SXJB 1CU1A 1QHGA 4RY2A 5KSPA 1V5WA 3AF2A 5JCPA 3QOFA 4BWYA 3SC3A 2OLKA 4G5GA 3TNFA 2J0QA 4PAMA 3T1VA 3UPUA 3AUYA 4OK5A 3ZVMA 1BYIA 4NYJQ 3B1VA 3TMKA 2J1LA 2Q0HA 2QI9C 1DAIA 1X3SA 3B1ZA 5UKDA 1K6MA 1W49A 2ODEA 3IPYA 3I72A 1P3JA 1BYUA 1E2JA 3L43A 2EWVA 3QVUA 3AVUA 3EC2A 3KUCA 5E4FA 2VSXA 5DGXA 1E9BA 3K0EA 4Q9IA 4ZDIA 3UWKA 4QGAA 2HYDA 4X8OA 2DFNA 3C15C 5BN5A 1ZNYA 1HYQA 4JLBA 1CR2A 4KLNA 5EXPA 3EXAA 4FCVA 4M9QA 3TAHA 1OKKA 2ONJA 1VECA 2Q9CA 3PQCA 5C1BA 1Z29A 4AYTA 1U0HC 1X1RA 4B34A 4KVAA 1RRCA 4OHYA 2CHGA 1EFRD 1L4UA 4I1UA 1GM5A 4QKQA 5DHFA 5HKKA 5J4KA 4BFYA 1KMHB 3A4MA 3U2QA 4KSBA
chains in the Genus database with same CATH superfamily
1TW2A 2X3UA 4UHKA 2XMRA 3L8ZA 3KB8A 2LXNA 1AKWA 1NN1A 5CBPA 4OPMA 1YS4A 2D2FA 3DZCA 1EFPA 1P2SA 1V48A 4G5HA 5BYBA 3TRDA 4KNYA 3ICQB 4ZOCA 4BNWA 1CXZA 4M1KA 1Y81A 3QG5A 5IK2A 1GPUA 1Y9ZA 3SYNA 4MW5A 4IXWA 2FXVA 1VLVA 5M34A 2P9BA 2D1QA 2MINA 2OCGA 4I1SA 4W7HA 4UFPA 2VA9A 3RUCA 4S05A 4LGCA 3KQQA 3H4MA 2L0XA 3O7WA 1LDBA 2VP9A 2WT4A 3NB0A 3NEAA 4KE8A 4EB6B 4DF3A 3AUAA 5FTJA 1M76A 1W8DA 2CXNA 2EKDA 3MINB 5LU8A 3KQLA 1KP2A 3IEKA 2YS7A 5A6VA 4PINA 4I9UA 4QYIA 1EDOA 1M1NB 1OI2A 4LC1A 4M0UA 2ES4A 3TOCA 4B3IA 1X1AA 1DU4A 1HO3A 2F00A 2EF0A 3B6IA 3DP9A 4C3OB 1PVVA 3C6KA 3QY9A 1B0AA 4G0XA 1GNPA 5EJEA 1E58A 3W8RA 4P36A 1RHMA 5HBRA 1DOZA 4JLOA 4KXQA 3BD9A 2YXBA 5CLQA 2OUIA 2XUZA 1OWOA 1ISGA 1RJFA 4IDBA 3ZJ5A 1M6VB 2DBRA 2X7HA 3VJKA 2QTAA 3T3DA 4C08A 1I36A 3OZTA 2PMDA 1D4ZA 4U2KA 1PJLA 4UOQA 4E2YA 821PA 3IOCA 4S0ZA 5AQEA 5LLTA 3OTOB 1DC8A 1RZRD 1CHNA 4PX5A 1IPHA 3C7CB 5AKHA 1Z4QA 5AUQA 3K6SA 1XALA 1B6GA 1PG2A 3COYA 4A6PA 4IOKA 4YMLA 3DE1X 4KLZA 4INJA 4R8SA 1MO6A 3BRSA 4AY5A 4DARA 3VO9A 5C2JB 1TEXA 3T3NA 4NFSA 2YWBA 5IC5A 3T9BA 1CQIB 2P6RA 4B3MB 1EK6A 4N39A 1T9ZA 1QR2A 4D2IA 4D0SA 3FOEC 3BMQA 1IQ0A 2XQJA 4LRTB 3USES 2XA9A 1QRTA 4AMGA 2WK1A 4FDLA 1UFKA 1EZZA 4DDWA 2BTQA 5C37A 2QAGC 3EVNA 1AK1A 5L9AA 1Y48E 1USIA 3SEFA 2BT4A 3T5DA 3PGVA 4DIKA 1RTKA 3D3KA 4YRSA 2K7FA 1EVEA 5JY6A 4YRLA 2I8CA 2QTMA 3TTYA 4ML3A 4FB4A 3F78A 3GZ4A 5I3CA 1T0PA 1SEVA 1ZGCA 2XUQA 2B69A 3AESB 4H4DA 1MIOA 4ROSA 3FFWA 1VYTA 2YYZA 1NV9A 3ZNOA 3BFPA 1VJCA 3PVCA 4CNQA 2O2CA 2FPGB 4RANA 1TJNA 5ENDA 3S2IA 1VJ1A 3B1YA 4IGAA 3INYA 3QF4B 4D8UA 4P7KA 5F1PA 1NVVR 2OHIA 1U3FA 1Q7BA 4EKEA 2PMBA 1W59A 1OLUB 1SVMA 4Q0MA 2OBYA 3KJGA 4DMHA 1XKQA 3W6NA 3OX3A 5CXUA 2AZXA 2EX4A 2OKCA 4PC3A 1L3BA 3AVXA 1QH8A 4QWWA 3S68A 5L3VA 1X7WB 1BQ3A 1FBTA 3CRMA 1NG9A 4N4AA 4NG4A 2IYSA 3V8NA 3CM0A 3ROKA 5JHHB 4YP9A 4BATA 3P5SA 3RWMB 1US8B 1VI2A 4HAXA 3V2UA 1JHMA 1UCFA 3QYAA 4M1WA 4P4TA 2AYXA 1RXEA 2FPIA 2GBPA 8MHTA 2VZ9A 5DM60 3RRJA 1BIFA 2AN1A 2NQ8A 3D43A 4LA4A 3GLIA 3WOHA 2V7VA 1CUXA 1ID1A 1E3MA 7ABPA 4UZSA 3VNAA 3CNHA 3S99A 4FJ1A 4OYLA 1HNWB 3ABSB 3EUFA 1OT3A 2VYQA 2W00A 1QYIA 3ZDQA 4DNXA 5DF1A 2FDXA 1ENYA 4L2IB 4H7PA 1DG9A 2HA6A 3V4SA 1ULZA 1DKUA 1QMGA 1KL7A 4ZO4A 2PA0A 5ALTA 2WG2A 4JI4B 3AIOA 4K26A 4XLZA 2RC6A 5HMLA 5DWVA 1MJNA 4EI9A 2C0CA 1UZAA 2J5XA 1OXXK 1XXHA 2B35A 4MCAA 1L8OA 1D0VA 4Z51A 5BT8A 4RKWA 1R8SA 4YVFA 3K30A 4DQLA 1VOTA 3PITA 4NZOA 4RF5A 4TXHA 2V55B 1PVDA 3B89A 3RROA 1A2OA 1ZH0A 4JLNA 4X1YA 4XAQA 1JSLA 3AKEA 3GAFA 1P2UA 3N59A 1N75A 4MEJA 1SH7A 2R7MA 4I66A 5LD2C 1M1NA 4Q1DA 1KYTA 2W43A 3Q5DA 3NTRA 1TIKA 2G09A 4LJAA 1ZOLA 3ESBA 2SKCA 3FG9A 1NURA 1DL5A 2WJPA 4R2HA 3REQB 3KYCA 1CF2O 2BKEA 1TQ6A 4QPNA 4GEGA 3O82A 3V8RA 1U90A 3QMVA 4XH9B 4BQFA 4P7GA 1ZR2A 2AR0A 1DKQA 2CMFA 2MSCB 4L5YA 3R7WB 3U7FB 4X84A 4B6GA 3JVVA 2QRNA 2X5OA 2J9YB 4UTRA 2B98A 4M1TA 4S1NA 3JV7A 2WG0A 1JAXA 4RMJA 3WWYA 4YRAA 2NU6A 5F23A 4L5BA 5TE9A 2XXAA 1U1DA 5HKKD 3QYJA 5ALLA 4PZ9A 2GN4A 4R3UC 1ZJZA 2P78A 4QG7A 2HO5A 4RZIA 3HM9A 3T1YB 4AG3A 2H2WA 3TLGA 8ADHA 3A4YA 5FI1B 1FFWA 1JR3A 1QHSA 2REOA 2VDUE 1IAQA 1P8AA 2GETA 4TPKA 3VZPA 4ADSG 1DJPA 2P6OA 2D3WA 2XXAB 2UUCB 3WK8A 3K5WA 3IMFA 1V11B 2WHRA 1WDLA 1EPUA 3VNBA 5JT1A 4LSMA 4N3NA 3GJSA 3JAWB 1Z47A 1N0WA 5LZ2A 4CMKA 4C7OA 3ND5A 5TQ2A 1AQYA 1CQIA 2OILA 1ZUHA 2ZSBA 3OAAD 3NJ8A 4D9GA 3EGXA 1W93A 1PQUA 3F3YA 3I42A 4F8EA 5LDHA 4NSNA 3PQ7A 4BO4A 1ULAA 2HMAA 1BHQ1 2WSSA 1H5UA 3C6YA 4JT8A 1N2JA 1L5OA 3ABZA 3DHEA 2C95A 5A2QA 4RJKA 4JQCA 1P19A 2RH5A 4NBSA 2NYRA 4BLWA 3C16C 3M3PA 5M2QA 4QDOA 2QN3A 4YI5A 1N1EA 4FD3A 4NE2A 2XNKA 1G8SA 1SBHA 4LK2A 1N0HA 1TRKA 2BTQB 2GEBA 1C7IA 3CXUA 4KG7A 3I8XA 1G3RA 1XROA 1KA9H 1RHQA 5BSRA 3LL4A 2ONYA 1X8LA 2W4IA 2J9FA 5I7WA 1AZTA 1QGOA 3OQIA 2XR1A 2XOKA 3C39A 3KP1A 2IHYA 3V3KA 1VB3A 3D4IA 3I2KA 4MLZA 5LB4A 3VKHA 1NQXA 4G37A 2WA2A 1MOQA 4MQ5A 5GGYA 3ZDFA 1JLMA 2FZGA 2C2GA 4GFDA 4AT1A 4DV2B 1VPWA 2Z6AA 1BDJA 4ZIRB 3HS3A 3U7IA 2FA9A 4KPGA 1T5OA 1YBAA 4LOIA 3SBDA 4UBLA 3IAM1 1ZVQA 1HYHA 4IZHA 5A9SB 3PIDA 4W1RA 4HH3C 4TYNA 3OPQA 2BBOA 1IXSB 1G2QA 3LBFA 1KH1A 3JSAA 2PQMA 3KS9A 4YRZA 4EJSB 2OZPA 1XWFA 3RV4A 2QM7A 2WV7A 1Y4ZA 5LCXA 3WGQA 1FX0A 1DKPA 4EHNA 2D8AA 1C4KA 1H4VB 1MW9X 2DHRA 3KELA 4MVJE 2H7CA 1EX6A 4LPKA 1PHRA 2B7BA 1NUQA 2FUCA 1QE5A 4KLRA 3DDCA 3O3OB 4N82A 3LT5A 3HSSA 2I66A 3RBAA 2YC4C 2GOYA 1B6SA 3V55A 4BKPA 3RTAA 3OLVA 2OB1A 1W7AA 4E14A 3JR3A 5ED0A 4DYVA 4FGZA 2OK8A 3T7SA 5E9JA 4NS1A 5LIPA 3ZGLA 1RHJA 4YCNA 3GEPA 5KUTA 3QBTA 3ND9A 1NF3A 3E5MA 3V7UA 1X9HA 5EUBA 3T95A 5TJHA 3HK2A 4FYHA 1CY1A 3L1UA 1BTOA 1EG2A 3ICOA 2LRHA 3DOOA 1XTPA 3OCJA 5A4AA 1ENPA 4KYTA 4EKDA 4MAAA 4ND6A 1FXWA 1T4GA 3PPVA 3GCXA 5JIBA 4J6FA 4LXIA 3C43A 1V8BA 2XCQA 4IIVA 3ZY2A 1K2WA 3Q4GA 4PWYA 3RVPA 1LDNA 4GPEA 4OXIA 2UUBB 3JWHA 3Q41A 4WRRA 4AWXA 1PDOA 1UINA 2GJ4A 2GMWA 3LDFA 1HI9A 2ZJOA 4KIUA 3ITNA 4D81A 5E6RA 2CB0A 4PYNA 5AXCA 1X19A 1FL9A 2W2OA 1Q2UA 1PLLA 2X1VA 2B5OA 1E1RA 3G0HA 4GGMX 2PUHA 3MBKA 3UUEA 4KQIA 4HX5A 1I0ZA 5I7RA 3U31A 1DTWB 1TB4A 3THRA 4QELA 4C4ZA 3FFBA 3QSGA 2O3TA 1SBCA 3WP1B 5BWBA 5CA1A 1R66A 1RRVA 5LKAA 4LZZA 2XNSA 4BIIA 1BXRB 1Z4NA 2B36A 3GUUA 3Q9SA 2VK2A 1BVUA 1H1LB 1UM9B 1JMKC 1BWRA 3KKQA 4Q48A 3IL2A 5HUJA 3C5VA 4GL4A 1AXEA 3JATB 4GYKA 3FSGA 1PR1A 2JLSA 4Z5XA 3H3XA 3BILA 3TFQA 3U40A 2RHWA 3ADDA 2HR1A 3GVHA 1PJSA 1EXMA 1RZ3A 1ZZGA 4PSUA 1X39A 2BKVA 2C03A 3ZE6A 3HZOA 2EW1A 2VF8A 1ND5A 5E0KB 3OF2A 4EW3A 4PX2A 4D3ZA 5FFMA 4RTPA 1GGNA 1RKXA 3B8EA 1J2TA 4DUGA 5BWOA 2ZUCA 3T94A 1ICIA 2DULA 2SCUA 2E1PA 1JGTA 2OGZA 2XMQA 1MOZA 2B4YA 2FRXA 3DNFA 4WMLA 1DBRA 1YS1X 3WIVA 1KO5A 2Q2OA 4BBJA 3M9XA 2ZI9A 4DLSA 3F6BX 1YRWA 2ONKA 2ZSFA 3ADBA 4P8RA 3CN7A 3GJZA 3ZHBA 2VH2A 4JYZA 3IT0A 5IT5A 4Q15A 1L4KA 3MW8A 3ONDA 2ZYUX 5LC1A 3SWWA 1SGWA 3AF3A 3KWMA 3OU6A 4I14A 4CF4A 4TYWA 3H0KA 4JQOA 4J07A 1UAAA 3WADA 5B3JA 2BFBB 4JKIA 5TY0A 2ECOA 4RELA 5JCJD 4CMJA 4JYAB 1TUIA 1KJQA 2Q3CA 1P4JA 3LUHA 5CVDA 1EFVB 3BX1A 1O3YA 4P53A 4KLAA 4Q39A 2QRUA 3E82A 4OYHA 1E1CA 5H3LA 2PUTA 3AY7A 3KKNA 3SKYA 4ER3A 1Y42X 1TMGE 3E5NA 5JDCA 1EX7A 1KVUA 3B5JA 4LJ5A 1AV6A 1G1MA 1GRNA 4N0PA 4YRKA 3JASA 3NBAA 1EE9A 1T5HX 4JMPA 4AJ9A 4BLPA 5JZVA 3EPJA 1TAUA 4MVJG 4H7IA 4YMTA 1N34B 1WW2A 1LTKA 3R7BA 3P19A 1CR6A 4E2FA 1GIAA 3RWBA 1GPNA 1HNZB 4HNHA 4UZEA 3P2YA 3QEMB 3L79A 3GI1A 3I23A 2ST1A 3UPDA 1IZ8A 1W4AA 1SCQA 1KS9A 2PYIA 3J7TA 3OJWA 1UWLA 3TTVA 3VVCA 2QU8A 4Q4CA 5KYWB 4OXYA 2FFRA 3H9GA 3RAEC 1OV6A 3EJ6A 5DBOA 1XXHE 3JD4A 4GAEA 5AMXA 3R0VA 3FTCA 4B40A 1H4QA 1DKMA 4TMVA 1ILWA 3L8CA 1O0CA 4RETA 5I3ZA 4RJTA 4HH4A 3U3ZA 5E4JA 4DQUA 3CGWA 5LWQA 3FVWA 3HVUA 2ZRQA 1SN7A 2YYAA 3HJUA 3ZLUA 1EUDA 4HH1A 3MQ2A 1OX6A 1KYZA 1SBIA 3W5IA 2QQ0A 2FETA 3MLEA 4TMTA 4R8RA 2HT6A 2PLAA 2Y27A 3B52X 3P2OA 3QIVA 2PVSA 4MX8A 1KDYA 3UJBA 4JR2A 1GQOA 4OI4A 3PE6A 4FC7A 3G7NA 3FDXA 1CERA 2IFTA 2TMDA 1D2RA 3N2ZB 4FHEA 4FYIA 5AK5A 3V1KA 5CFZA 1MVOA 5G3YA 1HNXB 5G0UA 4CQNA 4OHMA 5KDLA 2J3EA 4X41A 3D8SA 1AQNA 1AZWA 1NPTO 4PLFA 3D6MA 3W4JA 2K4MA 2QPAA 2ZCUA 4FE3A 1F8FA 3GJYA 4O2RA 4CPDA 2RH4A 1QFXA 4F5YA 2WMYA 3Q8LA 3VOAA 5T3UA 1A7AA 1U2ZA 3QU5A 4GR4A 3UKOA 4DGQA 1JR3E 3PHHA 5FIUA 1BAPA 2X0KA 3VC1A 3OLZA 5FUQA 4K9OA 2O07A 1EBFA 3U3KA 4FEYA 1SCNE 1IATA 5EN4A 2UYHA 4GOXA 5IDQA 4G1MB 1NTOA 1Z13A 2CFSA 3ZHCA 2IV2X 4MA4A 4NENA 4EKIA 4B85A 1JZQA 1JHQA 4CM8A 2CVOA 2VT2A 4CTJA 2REQB 3PUWA 1NR7A 1MC8A 5A0FA 1TOAA 4EHKA 1MGOA 2C8JA 3PA6A 3TNYA 3ZWPA 4OUDA 4BKQA 3EISA 2WB2A 4JBXA 3HCCA 1UMKA 2WJ6A 3WKCA 4ZRNA 1UANA 5GY7A 4R9UC 1DOHA 2YNMA 5ITWA 2DP4E 2M32A 4I3HA 5A9SA 3MWDA 3JQ8A 1A9RA 3HKDB 4R2XA 2E4UA 3HB4X 4WASA 1FDIA 1A98A 2EJBA 4ZV9A 5DW0A 3BD8A 3OFND 4D26A 3HUDA 4PZZA 1B42A 4MP6A 4PNZA 4QUAA 3AEZA 1GNSA 3HLKA 3R3UA 2AQKA 1C7ZA 1U5CA 2RHDA 2HD4A 2W6OA 3KKPA 3PQFA 3QW2A 4QJ4A 3PDWA 4TTJA 5I9SA 4AURA 2ORWA 1U8TA 1VJTA 1J7JA 3LKVA 4FKMA 4KQXA 4MKZA 1UJ6A 4PE5B 1TGVA 1CJCA 1VI6A 5B2FA 1I4OA 4C14A 1UBLS 3FM9A 4OU4A 1CZNA 2O8EA 3EMDA 3CINA 5TB5A 1RAHA 1EH5A 3M6LA 4LOAA 4JI6B 1T8SA 3A58B 4IGKA 1GLGA 4N9WA 1M8JA 3CWCA 1DOAA 2R6DA 1N2GA 5EKUA 1GTRA 1EIZA 3LX5A 1EGMB 5ER9A 4R41A 3L7LA 3AVWA 3CCBA 3MJVA 5FWDA 4ZQCB 4D8VA 2IUEA 4KWCA 5C8ZA 2QBYB 2VAXA 3NHFA 2HA2A 1P18A 5KX5B 4OIMA 1R12A 6Q21A 4FFPA 2G9ZA 4X97A 3UMRA 3VJMA 1U9JA 3SIPA 3SCZA 3F6CA 1WNFA 4I99A 1OXMA 1G18A 4OGWA 1YIAA 3TLYA 1CR1A 5E7IA 1CUIA 4QU5A 5AVVA 5HWSA 4Z8YA 1WV1A 2FJPA 3G8AA 3PDCA 2J41A 1OAAA 5IYZF 5MHTA 3BULA 4QICA 2Q7OE 2JPDA 3NM4A 5GIOE 4RVFA 4P3NA 1LDGA 1N1DA 3BXZA 3PGMA 4LKRA 1P44A 3BMOB 3O2QB 1Z18A 5HFJA 4C0HA 3BMCB 1DQSA 1SBYA 3SHFA 2FFBA 1WSBA 4P5DA 4P4SB 3U4AA 1ESNA 3JCZA 2DG2A 2XMDA 2Y0CA 2ENWA 1XQYA 2MOKA 3FKSD 2GQ0A 1YASA 2H5LA 3KJEA 4RPKA 1Q20A 2WNIA 3Q8XB 4LQDA 1GG9A 3INRA 5JI2E 2IHKA 4DMCA 1B4DA 1KMNA 2O0LA 1I3NA 4WY5A 2C7BA 2PGDA 3KTAB 1M2OB 5J4HA 2C9MA 4PVDA 4W7IA 4YI3A 3NEJA 4L22A 3B48A 1GRRA 4U02A 2OQVA 1DAMA 4AN1A 2O8FA 1BHJA 3D8BA 3D02A 5EIWA 2H1OA 1HSOA 2QJWA 1W35A 1X7XB 5DH9A 5EXSA 1VYHA 3AG6A 4RHUA 3TDKA 4CVNA 1E3QA 1X7ZA 2PL5A 2RGUA 5DHUA 3AM4A 4ZCMA 1RJDA 1Y8QB 2NYVA 3DBVO 4LYEA 4M6WA 2WAXA 1V9LA 1BKDR 3LGXA 1L1FA 4LN1A 5GPBA 3W1VA 1E6CA 2DUWA 2IC5A 1GKLA 3IC5A 4OKSA 1FFBA 5IJAA 4XQGA 4B4OA 3EIQA 5KDOA 5JS2A 6REQA 3EVGA 4FS8A 2RBGA 4Z9YA 4HNVA 2HMTA 2NT3A 3G1UA 5H4GA 5T6MA 4ZI2A 1K8XB 1MRSA 2BBTA 3L9WA 5AVXA 4W5OA 4CRWB 1DFHA 3AFGA 4D5GA 4YRGA 1MZPA 4PHTA 3FIUA 2VSFA 1UK9A 2WF6A 5CJJA 2SKDA 4UHEA 2NU8A 4DQ0A 5JZMA 1Z4MA 1DQRA 1CJKC 1XD9A 2G5GX 2J7PA 2JC3A 2P40A 3IBTA 3QYFA 4M60A 1THZA 4M53A 4PEVA 3GLVA 1FFYA 3N53A 1Q0HA 5HKLA 1QGZA 4HXFB 1WKBA 2YIDA 3H2YA 3PCXA 3CVJA 4QOSA 1XQ1A 2I87A 1Y1PA 1YB6A 2VT6A 3DR5A 3BFKA 4UBJA 4Y2TA 3FBWA 1ECFA 1N0IA 1HLPA 4ARSA 2I3BA 2DWOA 2IYTA 3K31A 2ESRA 4XVQA 2DUUA 3CSDA 2PS1A 4DIFA 3MBOA 3U1TA 4EITA 2V0NA 2Z8ZA 1MJGA 4KPFC 2OOKA 1A9XA 3IO5A 5BPHA 1VL5A 3ZXYA 3OEED 3DHNA 1D6SA 2HEIA 2ZJAA 3CLTD 3DYVA 1JWBB 4P0TA 2O8CA 1YD7A 4O4JF 2B92A 4FT4A 1SA0B 1LV8A 2RH9B 2Z58A 5AHOA 1B3RA 3CLUD 3K9HA 2A78A 4JX9A 4OMFG 5I5GA 2YZGA 3EDCA 5ISMA 1SZDA 4R2WA 4UEQA 3ML1A 4G1BA 2UXCB 5CYGA 1I3OA 5EQFA 1SD2A 4BO1A 3T12A 3CRVA 1UBMS 2G1PA 1A9SA 1C9JA 2ECKA 3NJ4A 2LGJA 3BJZA 1LU9A 1LI7A 4B4UA 5FBQB 4A2QA 1JH9A 5ALPA 3FF4A 5KTSA 4YONB 4PFSA 5TQ0A 3D4OA 4ENRA 4BV9A 1ZW1A 5K0CA 1H42A 3C87A 1UBKS 4XZ3A 1X1QA 2MHCA 1NQWA 2FV8A 2O2YA 2WJZB 3AHGA 2ZIXB 5IN5A 4IIGA 5DI9A 3KTFA 3SLGA 3G5UA 2Q8PA 4AJIA 4EMTA 1PU2A 1UZNA 1MTOA 4HRVA 3HVKA 1QP0A 5JNRA 3CE6A 3T4EA 2B4TO 3D6HA 2FRVA 3QRWA 1GAWA 2AG0A 1Q0RA 2NADA 2BCEA 4FGKA 1JFSA 4H7FA 3HCNA 3QPAA 3T5TA 3QI7A 4LEIA 1NAIA 1K6EA 1YR9A 2WP8J 2Y1XA 3UHOA 1I8TA 2NM0A 2XKJE 2GKOA 2ICAA 3EQ2A 1PK9A 4OBXA 3LUFA 1IY8A 1UPUA 2XPCA 3EZXA 5AVKA 4UBNA 4JNKA 3VI4B 4CGYA 2F4NA 4ONEA 3WYGA 1MT3A 4B6QA 3D7LA 1S4MA 1YC5A 1FU4A 2GZRA 4R1QA 4B31A 1WZNA 3FSJX 4ZAVA 3BM5A 3F1LA 3LPCA 4AJHA 5C80A 2OORA 2DFVA 3PC8C 1THTA 2GHTA 4J1TA 4AL4A 5IJ0B 4XXHA 3C7TA 5LQSA 2FWNA 1Z6GA 3KKMA 2QN6A 4V0LA 4TTSA 4EB0A 4Q01A 2X8JA 5DK4A 3PC3A 1BMFA 1BFKA 4HDRB 3DXYA 4R69A 5DNUA 1EM6A 4ZHQA 2CFIA 2DJ5A 2XJ9A 4PSVA 1OPXA 2DHCA 4K7JA 4QYSA 3PI7A 5B1DA 3WMXA 1N3IA 1TKAA 4ZANA 1NBHA 3UGKA 1T3LA 4HFJA 2H92A 4BBPA 4F4HA 1NSTA 2J3MA 3W9UA 4Q3NA 2CFCA 2OV6A 4FZVA 1H9CA 3MRXA 4WHMA 3UK1A 5DO9A 2BI8A 2XI4A 1FS6A 3OPYA 1O6BA 1SR8A 4FILA 5ALQA 2VF2A 1WVGA 1GA6A 2YIMA 5FAXA 2JGFA 5CH8A 3LL7A 1QVWA 4HN2A 3QXJA 3C5CA 3S1SA 2ZYIA 1GTG1 4R1TA 4X6UA 4L75A 5K1ZA 4FPXA 4URXR 2B5VA 1BW9A 5AHRA 1JFVA 1K4YA 2FPRA 3WV5A 4KFRA 5J1TB 4BS9A 2VJCA 2CDBA 2PKEA 1KR2A 2VCYA 4O2LA 2BFAA 1JWLA 5DNCA 3H19A 1ZESA 3P0JA 2J33A 2D0DA 5EZYF 1XA4A 4OK3A 1LEHA 2NXWA 3CW8X 1UODA 1TMKA 4EI8A 4F3CA 4ZYXA 3OOHA 3ENNA 3MRSA 7MHTA 5A5FA 1QWSA 2JFWA 5IT4A 3HGMA 2BFCB 3E3LA 4U3JB 4MIOA 3CX7A 3VSCA 4JJ7A 4II2A 4RK1A 3WV4A 3E23A 2GPTA 4F5WA 5ILOA 4RXUA 3ESQA 4BP8A 4ER5A 1R10A 1H05A 3OZBA 4CR6A 3LSYA 4KVZA 1Z6TA 4LJRA 2GJSA 3DCJA 5SZKB 4ZMBA 2D6FA 2PJRA 2QAGA 1HZZA 1EFTA 2PH1A 5ALUA 4ZYWA 4AKSA 4M0KA 1NJFA 2NAFA 1D7OA 2YX1A 2RC5A 3WR5A 1NF9A 4EX7A 3L92A 1HGXA 2O0KA 5LDGA 3WRWA 4HB2A 5K0TA 1VFPA 4B47A 4GX2A 5G1PA 2Y1FA 2C78A 4PAOA 2IH4A 2PMEA 5FBVB 3HJHA 4OUDB 2L17A 3HN6A 5BSMA 3GY0A 3HNRA 4J6EA 1T36B 1UZLA 4MA0A 4US0R 3TSZA 5KQSA 3VYVA 1JEQB 1SQFA 3Q2KA 1G2OA 2JGMA 1FEZA 2IYAA 2P6PA 2R6CA 3HMQA 3LBHA 4IO1A 4DLUA 4ZKEA 3PGXA 4S24A 5FUXA 4TMFA 6GPBA 3SZRA 4AS2A 4HZGA 2I55A 1KZHA 3LLMA 3UK0A 4EQ6B 1ECGA 2LDBA 3TOZA 4WEOA 1TA4A 2QIPA 4MDFA 1XHLA 4KUHA 4CLOA 1RWKA 2XLBA 4JJAA 3OSUA 3SS7X 1F1JA 4BVHA 4ZVOA 3SJZA 1F7UA 1H66A 4O1MA 2B0JA 3T3OA 4PU0A 4XCXA 5FKJA 3JATA 4ZRDA 3CURA 3NBFA 1XZQA 4PLTA 1ZJ5A 3VC2A 3N07A 3G9QA 1QGED 3G2MA 4MGEA 5GONF 1ZIOA 1TUBB 1X86B 2HA7A 3JVEA 1J8DA 4UNSA 5F7JA 4N5LA 4OLHA 2GPSA 4RIFA 4EOGA 4PIMA 4MI9A 2GEDA 4X3CA 5HS4A 5IPFA 3WBJA 4WKBA 3EDOA 1K8ZB 2OBXA 4HQOA 3CISA 1O57A 2FQ1A 3UB4A 2YFQA 1G21A 1WAMA 2HNKA 1X1SA 1H2WA 2VA8A 3A1WA 4Y1FA 3CEPB 4IZ6A 5GOTA 3S1AA 4KUEA 3EVBA 5FQOA 3FX2A 2PWYA 4MCJA 1NW7A 3F9CA 4PZAA 3S29A 3ED1A 1G3IA 1NZJA 2IELA 2QM8A 3CW9A 3GD7A 3PUHA 2Q2WA 4ZU6X 1BDHA 2Z04A 2Z3WA 3ANXA 3B3QA 4P81A 1L2TA 2VSYA 2I3AA 1DAKA 2X0EA 2YV3A 3S4YA 4BLQA 1QG0A 1P2VA 3H9QA 5ADHA 3K72B 2HMVA 1E1YA 1B8OA 4KXXA 1KFKB 1FQJA 4FDVA 2EFGA 2F17A 1LPPA 2CNNA 4IWYA 4WXPA 2CF6A 4BO5A 4KIFA 3DEHA 2QKYA 4QYMA 1P39A 2E5FA 2VHQA 3ZU3A 5CEFA 1PV2A 4DCTA 3F8TA 1H2YA 3R2JA 4EELA 1BX3A 1II9A 1IVYA 4IV5A 7ADHA 1U02A 3FNFA 3I09A 1B8VA 4CM3A 2BFBA 3KO8A 2GD0A 3AR8A 3OCCA 3C3DA 1CS4C 3WIBA 5DOZA 3RW9A 4ON9A 2QAGB 3CUVA 4LXHA 2MIIA 3DD1A 4IJKA 3HR4A 3OJLA 2W2PA 1QHIA 3IDSA 3IULA 2AE1A 1E3TA 4HDOB 4L8GA 1I1OA 4BVAA 2ZUVA 4X8MA 4FC6A 2WWFA 5ES4B 1G5QA 4CL8A 4M1EA 3WB9A 1TAQA 3H9JA 3QBDA 2VF5X 4V0OA 2DRIA 3IEUA 2LCIA 1YR6A 3GHYA 3U26A 4B81A 2ZR8A 1N5RA 2A1TS 5B5SA 2V45A 2SKEA 2FWPA 1C1YA 1CPYA 3H0EA 3X1MA 4O5OA 4BPRA 2WSBA 4K3VA 1K6JA 3KEQA 3UJ7A 1KI8A 5HX7A 2CEAA 2BGKA 4BJ1A 3ZDCA 1FLDA 1MVLA 2YY6A 4M98A 4QXAA 4CLRB 3WAJA 2VPYA 4OHBA 5CDFE 5EIBC 1Y3DE 4CZ2A 2XCOA 2R4QA 3UGJA 4XWWA 2WJWA 1DEKA 2IF2A 1VXRA 2J5RA 1CDDA 2FMFA 1XYYA 2ZQYA 2ZU6A 3IUYA 2H1RA 1XRRA 2WU4A 4M4SA 4P3PA 4XPIB 5DLYA 3T7TA 5DULA 2A88A 1G6HA 1SOUA 1A4UA 2EU8A 1E5QA 3R1IA 3ROXA 3TMYA 4DN6A 3TUJC 5A06A 3E3MA 1D8TA 1GUBA 3FGOA 4NCBA 4CJXA 1D4FA 3KCNA 2X4DA 4Y6LA 1QF6A 5U1PA 5FPYA 4LJSA 4I50B 1LKZA 1QQ7A 3TDMA 5JPDA 3VV3A 2C29D 3AETA 1PX0A 1JFFA 4MI6A 3IEXA 3O9MA 1M75A 2NYAA 1J8VA 4QYXA 2DR3A 1G20E 4BNIA 1D2GA 1JG1A 4NH4A 1C8BA 4EP1A 1IQPA 3EPHA 3QVWA 4GKJB 3NWOA 3O3MB 4D25A 1KARA 2DSTA 3H87A 3KSUA 1SCUA 4LI3X 1MNQA 4P31A 3PX7A 1VIDA 4MV7A 3SZOA 2CLFB 3E48A 3CPJB 3DBOB 3FA2A 4QDKA 1WXXA 2WHPB 4ID9A 4FFSA 5EHGA 1PTJA 3RVJA 3OWXA 2RAUA 1UMBA 2ADFA 3A9WA 4MRAA 3RSFA 3RVRA 5JNVA 5LNK6 4UC0A 3A36A 2X1LA 2QQFA 4DR7B 2COEA 3RQSA 3A04A 2OC4A 3KPJA 5I9IA 3KPWA 5TNXA 3RG8A 3HNOA 5K3OA 3HR7A 1O6GA 4F7WA 1ZM3A 2Q2NA 3VVLA 1NI5A 1QCDA 4FK8A 1J0CA 1FB5A 4JZYA 1ONPA 3PPXA 4HX2A 1TCVA 3G0BA 3IP3A 4MWEA 4NC9A 5J2TA 1VCMA 4RZSA 3T6KA 1WHTB 1KGDA 1ZISA 3FD8A 4XVHA 5BUQA 4XR4A 3KAPA 1WMBA 1K3TA 2AZMA 5HFAA 5DLQC 5KVSA 3X2SA 5FWAA 2GA9A 4CMCA 1XZGA 2XHZA 4RIHA 2H2FA 4V2IA 3TH5A 2GTHA 5HIMA 4Q7JB 1R0XA 1SC9A 4XYLA 5ELMA 1R0CA 4WH0A 3PEFA 1WZIA 4MV0A 1XEXA 4EO9A 4QQNA 3FF1A 2LNDA 3UK7A 1ISMA 1KVQA 3NBYC 3TTSA 5H8WA 2NUAA 2JGDB 3PLNA 3JZMA 4IJQA 1UKCA 2AFIE 3JYHA 5KYUA 4N1AA 2KW5A 1N6PA 3HB7A 3E0XA 4XDGA 2X3FA 4C0AC 3RFTA 3F1KA 4G07A 3B13B 1QHYA 5FJJA 4ZDWA 4AXXA 4XWAA 4GKAA 2QAIA 4V3CA 1FNCA 2YVKA 4QOIA 2G6BA 3FLBA 4AY4A 1Y89A 3OZVA 4OHPA 1AOXA 1NQ5A 1QPBA 1U3TA 2CGEA 5TC4A 2FQQA 1LPMA 4YUWA 1PJAA 2ATXA 3ZXIA 3WGVA 2BYTA 1U9IC 1W4BA 1IOZA 1T4DA 1YL5A 1PEDA 3WGMA 3HMKA 3N76A 1XZJA 1E1RD 1TDJA 2JJ8A 2V65A 5DCLA 1JLSA 4F21A 2OXEA 4RGQA 5LP6C 2YNMD 4G9EA 4XFJA 1D1SA 3SBEA 3VJLA 1CUVA 3IVXA 5ESDA 3VPCA 3DG9A 3HKCA 5LP1A 2BEKA 2XDYA 5FTKA 3L46A 5HR5A 5L45A 1Z7WA 1Q1BA 5ALYA 5FWXA 1VLJA 3FCAA 2A67A 5BN4B 3AIMA 1M74A 3C85A 3TNJA 2JGRA 4B43A 2FWJA 4DCMA 1BDBA 1RAGA 2AN5A 4BNTA 1TEVA 1RJ9B 4KOAA 3T0FA 1T5IA 3HLYA 3SYRA 3UXYA 2YN2A 1XTJA 2JF0A 3JAWA 5CR9A 4ZDKA 3QELB 4IGIA 4RCZA 3HJFA 4DUGD 2C97A 2X77A 2ID8A 2IEGA 3MIZA 5AKEA 1ORVA 2IDMA 1G19A 1ZI8A 5EI5A 1NXPA 3HYNA 1X8JA 2PR2A 1N2EA 4MUAA 1VE1A 2PDAA 3A6FA 2ZE6A 4QX6A 4YBZA 1F8UA 1CY2A 3PHCA 4BLUA 5CBPB 2C7RA 4JY7A 1NU8A 3GV0A 2FK8A 1FYWA 3NBMA 4LNHA 3C1AA 2DFLA 2E9SA 1H1TA 3EGOA 3QX8A 3CZAA 2WAAA 3F97A 4NAHA 5JPIA 3UF0A 4AB1A 5IG2A 2VHWA 1T6YA 3FE2A 4NV0A 5EE3A 3D9QX 4OJQA 4HC4A 2Q27A 4HB4A 1WMAA 4W6ZA 2ATVA 1SC3A 4QTXA 2GA8A 4M83A 4XRRA 4XYBA 4A8HA 1SUEA 4ALJA 1OOEA 1DHTA 1Q0LA 2P4HX 2VXYA 2QNRA 4EHHA 4WACA 5FNVF 3DLCA 3JQAA 3PKIA 5C4MA 3NPMA 5EMJA 3Q7SA 3PHIA 5TQ0B 4P9NA 4DFDA 3VDXA 5LMNB 2AL7A 1TUGA 3CJTA 5DTJA 3LK7A 3M4ZA 3C5HA 5C8DA 3R0JA 3L2OB 2UUOA 1E4VA 1JR4A 4BMZA 4KQEA 4O3MA 4DEYA 1YQUA 2I7XA 3U0VA 2XOKD 2ACEA 5LSAA 1D0IA 3THYA 4LTDA 3AF5A 4QU0A 4ZOLB 4G41A 4XTCS 1NKSA 1RM3A 2V9PA 3I58A 5B53A 5ITSA 4F11A 4REQA 2WJ3A 2IYQA 2Y1GA 3UMJA 3ZCSA 5KJFA 3OKFA 2NZYA 2QLLA 3UUWA 1JA9A 2Z2YA 4YCAA 1Q22A 1UMCA 2Q21A 1HLDA 3PJDA 5GAJA 4TZ0A 1TJYA 4JQSA 1GGFA 3TLAA 4AJLA 3GNTA 2Z08A 1X7YA 4A0GA 4CL3A 1Z73A 2NZWA 5ECGC 4EAQA 5BSEA 1G8HA 4RLFA 5AICA 1R6UA 3P9NA 1OROA 4IHAA 3UWOA 3ZCTA 4C4TA 2DFKB 1OAOA 3AL3A 2ISCA 4JI1B 4Q1EA 2E0IA 4FQ8A 3WGJA 2P3SA 1WQ1R 3T9CA 3M89A 4EK9A 5YASA 2X2PA 5G2OA 4PN3A 3E2MA 3IAAA 3ANSA 4RPJA 3FVVA 1V47A 1Y1QA 3C8ZA 4LJ7A 3L8EA 4QNMA 2ZRJA 4LZPA 1FVOA 5DEIA 1HH4A 3RBVA 3NKVA 1PAUA 5D01A 2AK3A 4PWZA 1ZHOA 1G5PA 2E3JA 2V4UA 3HDVA 3B8HA 1HZZC 3TGWA 2JEZA 3I04A 3AL0C 3P2EA 3GRAA 1C9EA 4JL8A 2DFDA 1ZHFA 3HDGA 4UVHA 3BIXA 3R5SA 4LDNA 1VIMA 2J7PD 3LY5A 4H6XA 2R8PA 2VHVA 3HRHA 3U4HA 3VRHA 1KRHA 4JOCA 3OUTA 4P2BA 2X4GA 4KZKA 4MWGA 4MV1A 2RH8A 1K7XB 3HRKA 1VLHA 1PKXA 5JATA 4GE3A 3MINA 4JSTA 2D1FA 4B09A 4D8YA 1E79D 4RF3A 5CFNA 5DYYA 5IZ4A 3N7TA 4B4WA 3L7NA 4AUKA 4BQSA 1Q7EA 3AILA 2WNSA 4MB6A