3W9YA

Crystal structure of the human dlg1 guanylate kinase domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
175
Chain Sequence
b'NYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAKEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
publication title Crystal structure of the guanylate kinase domain from discs large homolog 1 (DLG1/SAP97)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 52
structure length 175
sequence length 193
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3w9yA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w9yA01
4M1YA 5FPSA 2F3RA 3ZZUA 3LX8A 4EKDA 3QBVA 2LKCA 2J7PA 3QKSA 3PQCA 4ERNA 1QHGA 2G9NA 5JECA 4BFWA 5KO2A 2VL7A 1UBGA 3QG1A 4IOMA 1DOAA 3U4QB 1YR8A 2BIFA 4M1TA 4AKEA 4DDTA 3IHLA 2C99A 1W36B 1GNRA 3ZVMA 2RCNA 3JVVA 4NE2A 4BZXA 1YR7A 4UNQA 4DHEA 2W6JA 3DHWC 3BE4A 4PHFA 3W3AA 2ZVPX 2OAQ1 4X8LA 5D3MA 4ZCLA 1G21E 3NC1C 1HA3A 4F38A 4ZKDA 4C30A 2XZPA 1OHHD 4W9MC 2JJ8A 2VLIA 2A7QA 4QXAA 1JR3A 1R5BA 4Q4AA 2WSSD 1G3RA 1R10A 2PJZA 5HCNA 4DUGD 4KU4A 1LFDB 5TDHA 2WZQA 1BIFA 3Q8XB 3A1UA 2ZIAA 1XEXA 2CE7A 2WICA 4G5QA 1KYIA 2ZVQX 5AWFC 4DWJA 3NG1A 2JLYA 2J1LA 521PA 4C2UA 1JALA 4LOAA 4F7WA 4RCZA 2V54A 1Q57A 4M9XA 1QHXA 3KUCA 3CM0A 1S8FA 2HJGA 2PZGA 3VR6A 4AWXA 3EZ2A 4Q48A 1E2LA 1JQLB 1R4AA 2FOLA 2OCPA 4DVGA 3C14C 4GNKA 5KU1A 3GFOA 4B48A 2XZLA 1PLKA 4PQRA 2HEIA 4IDOA 1UKVY 1FMLA 1GVNB 3LH5A 5B30A 1G4UR 3NVAA 3NBYC 1TUEA 3EC1A 5FFMA 2GTPA 5BXQC 2AHOA 1LS6A 1NLFA 4QM6A 2WWIA 4FMCF 5H1YA 2WMNB 3IEVA 4O3MA 2WJIA 3FE2A 3OAAD 4PO9A 2QE7D 3ADKA 3BH6A 4A6XA 5SZKB 5FH9A 2DY1A 1G8GA 5E7MA 1VKJA 2D2EA 4FMDF 1RE0A 2IS4A 1DE0A 4JT4A 3KJHA 3CH4B 4URWR 2CNWD 5JCZA 4HUQB 1I4LD 3C5CA 2D7CA 3RHFA 4BFVA 5FBRB 2RGGA 3OHMA 5J4LA 1BO6A 1P3JA 2V7QD 1RFLA 3PR1A 3Q5DA 2VHCA 4R2IA 5FOUA 1XD2B 3SN6A 2ZPTX 4TL6A 3GPLA 3O8CA 1H8HD 3OIYA 4OBEA 2O0JA 4L9WA 3WMGA 3GLGA 1T9HA 3IQWA 4GI7A 4KSCA 1U0JA 1KAGA 3LX5A 2ZJYA 4X8MA 5JSZA 4Q9JA 4LHYA 1RC8A 4MH0R 2XSZD 4OYHA 3I61A 4N0EA 3AV0B 1MKYA 2IC5A 1XX6A 5KTYA 3WP1B 2REXB 4DLVA 1R7RA 2X2EA 3P4YA 3T12A 3BB3A 3KXIA 2P67A 5EP3A 1JPJA 1KK3A 4BFUA 1Z22A 4FMBB 1X8LA 4MGYR 1S0UA 3UMFA 3R8CA 4BFZA 2RGEA 2BWJA 3BIFA 4NYMR 3VTKA 3P1JA 1J90A 1DO2A 2HXYA 1ZNYA 4QRHA 4HZUB 3K9NA 1ZAKA 1ZP6A 5EE3A 3MGCA 2A5YB 3AH8A 1ZNZA 4JKIA 4AYTA 4DKXA 2BCGY 4KYUA 2IBMA 4HSEA 1KI9A 1K6MA 5JJKA 1FFHA 3T61A 1VYVA 1EFCA 2JATA 2ZUCA 4DT1A 4IEIA 3K9GA 2QRZA 1OFTA 1ZVQA 5LDDC 1SQ5A 2WM9B 2NO7A 4PC2A 4M1SA 1XJ0A 4IHQA 3FHCB 1VHLA 2AD5A 4TYPA 3FWYA 1AN0A 4MQBA 5C4GB 3U7EB 3OIVA 2IHYA 3VX4A 2K5UA 3X1ZA 1N5JA 2XNDD 4NCKA 1KI2A 4IJMA 1QG4A 2ANCA 3QVUA 4NHOA 4NTZA 2NMVA 2FA9A 5FTNA 2OG2A 4FN5A 4CT4B 1EK0A 5GADl 2A78A 3N2IA 1SKYB 3GLIB 1T3SA 1W4AA 5JHHB 1EFRA 1CJVC 1SVSA 1XCMA 4F4IA 3AVYA 2F55A 3X2SA 4C0SA 3KQHA 3PUVA 2CCJA 4A8JB 2D2FA 3SYKA 3Q7PA 4B76A 3TNFA 2WAXA 2Z83A 1TAGA 4BPBA 1GNPA 3WRYC 3E1SA 4JLOA 1RYHA 3T15A 3EWSA 3FHOA 3ZJYA 1S3SA 1COWA 5J5CA 4DLZA 1GIAA 1HT1E 5CK4A 2F1IA 3H4MA 4YDHB 1X8KA 2JCSA 2OT3B 4LDJA 1ZMXA 3BH7A 4QG7A 1P73A 2N1BA 3CR7A 4YLGA 2ZU0C 4IDQA 4Q9IA 4X8OA 3SS8A 2X2FA 1FW6A 3FOZA 2G1JA 4TMTA 1DAFA 2OLKA 2GJ9A 4KBFA 1G5TA 3ADDA 1BOFA 1HQCA 5HZHA 2ZSFA 1XFAA 2Y8EA 3EPJA 1EG7A 2FH5B 2QBYB 3L8ZA 1E0AA 3QI2A 2H57A 4RJLA 5L3QA 3G5UA 2V1UA 1IN4A 4M1WA 3KZ1E 2O8CA 2CEAA 1XPOA 1GTVA 2AN9A 2O8DA 1ZUIA 4URUR 2VYFA 4PQYA 1IONA 1HH4A 3T1TA 1EXMA 4BFYA 3THYB 3KKQA 3E2IA 2QTHA 1EFTA 4A2QA 2QGNA 4LC0A 1QRAA 2GVDC 1G18A 2WKQA 4MYHA 4TYQA 1XPRA 1UDXA 1N6RA 1W4BA 1XCGB 4GDFA 3P4XA 1GAJA 5FL7A 4UNNA 3NDPA 1NY6A 1ZM4A 4PHGA 2PL3A 5KPJA 1P62B 1YZKA 4CEHB 1S3GA 3PG5A 2QTVB 4HYYA 5FOSA 4XVRA 4WZAE 2I1QA 3MUFA 4GRAA 1XBTA 1T6NA 1TQ6A 4H1UA 1KO4A 1KI4A 1NSTA 1S1CA 4C0LA 4C7OA 5EP2A 1G3IA 2WKPA 1P9RA 5FOWA 1ONBA 2CHGA 1W0KA 2Z0MA 1OXSC 3FVQA 4DB4A 4BFXA 1OH5A 3TMKA 1G7SA 1R0YA 2CK3D 3A4LA 1R0WA 2VA8A 3ZS8A 1YU9A 1NVVR 4JYBA 5FUYA 1E9RA 2QN6A 4E03A 4ZCMA 4PPGA 1A82A 4CRWB 2B21A 5K8UA 1W2HA 1G7RA 4KYIB 4LBVA 3MJRA 1P2SA 1O3YA 1ZM9A 5E7IA 1P61B 4HAXA 1KJZA 2A3RA 3P32A 3AF2A 4JT2A 2DB3A 3U3RA 3UWKA 1P2UA 4KVAA 2GNOA 2FZLA 2D3WA 2G6BA 1SXJC 4PC1A 2NGRA 2KJQA 2MMCA 1CR1A 4ILEA 3CO5A 2G77B 2FPKA 4KHZA 3SJZA 2QSZA 1IN8A 3CBQA 2RAPA 1H8ED 2MMGA 2ZSDA 4JL6A 4LX0A 1JEDA 1VTKA 4IOJA 3AKCA 5A5GA 2JLRA 3AVUA 5SZIA 1JJ7A 3EASA 3KQKA 4EUNA 2QAGA 1G20E 2WWYA 2IF2A 1E9BA 3ZH9B 3K9LA 2XNSA 4OHXA 1GNQA 1KDPA 1H65A 4GPTA 2PZEA 3AF1A 3SE0A 4NYJR 2H5EA 3FKSA 2HT6A 4BASA 5P21A 2ZJ2A 2GCPA 2WV9A 5L3SB 3MMPA 1IXRC 1ODFA 1HUQA 1UKZA 2OV2A 3AUYA 2WIBA 4M4SA 3ZQ6A 1FNMA 2ZSAA 4OQNA 1J70A 2ZRFA 2WIAA 2JEOA 2NO6A 2JDIA 2WPDD 1P5ZB 4JVNA 1N6OA 4NCIA 4D4KA 3QOFA 3GLFE 3LBIA 3KQNA 3PUZA 3QXHA 3GJ8A 2SHKA 4D0NA 4QOSA 2J0VA 3DMDA 5IK2D 4XWAA 2ANBA 3WY9A 1G4AE 3Q3JB 4RD1A 1FOEB 2ATVA 1WXQA 1Q21A 2CHQA 4QFMA 3GJ7A 1FNNA 5AJXA 4D81A 3I73A 1AZTA 2F3TA 1Q3TA 4JLAA 5AUOB 1IY0A 1KJWA 2J9RA 3EZ6A 4EPVA 4Q00A 2BMFA 1G8HA 4R2HA 2Q6TA 1ZIOA 2JJ2A 5TB5A 3H84A 4B2LA 1JB1A 2BMEA 2RGDA 1R5OA 4JL8A 4NMMA 3A8TA 4HATA 2PEYA 2QAJA 3WRXC 5DSZA 2IWRA 3CRW1 5DH9A 1VG8A 2P5TB 4PSVA 1J8MF 3GFTA 3R7WB 2GK7A 1GITA 1NL3A 3T1QA 1HTWA 4YMTA 1G5RA 5CDFA 3QKRA 5AJZA 1NG1A 1E98A 3MFYA 5FTKA 2GZAA 5UKDA 5DHAA 4FINA 1CJUC 2ZRGA 4K46A 1MV5A 1TPZA 3QBTA 4AIIA 2ZR7A 4IRUB 1EX7A 4WZ6A 2GEVA 1KSJA 4P0TA 4BE7B 5KDOA 3PITA 1LF0A 4G01B 5M04A 2CJWB 1RRCA 221PA 4XVQA 3W6NA 2ZRKA 1QHSA 2OBLA 2OESA 3DKPA 4HB4A 1BMFA 1MOZA 5C1BA 4TZ0A 4MRRA 3Q85A 2DWQA 2OEPA 5JBQA 3CX8A 4HAUA 4JLVA 1TNDA 3OEHA 5IF9A 3U3KA 2CBZA 3I4LA 3X1WA 3EAQA 4IDNA 4MA4A 4UXHA 3BOSA 2ZYUX 5HZKA 1ZINA 4UQOA 2HYIC 3U7HB 4A36A 2O8FB 2Q3HA 4IXNA 2FN4A 2RGAA 1BKDR 4LJ4A 1SHZA 1DAIA 2PH1A 4AD8A 3EPLA 1KMHB 2PLRA 2WMOB 2C78A 4NBSA 5EZ5A 3QQ5A 4WA7A 3VKWA 4UJ3A 3T1OA 4GSYA 4MYTA 1G16A 3SI7A 2CVHA 3VKGA 2G88A 4Q9HA 4EIWA 1TX4B 1A1VA 4TL8A 1GOTA 4OHYA 3BERA 2HF9A 1W7AA 1VDZA 4OI0A 3CX6A 1W5SA 5KPDA 5EP1A 4MRSA 1IY1A 5HE8A 3SJAA 1A5TA 1JXOA 3ASYA 4KI0A 2GF9A 3OE7D 2VSOA 3LLMA 4D4JA 1VECA 4Q1DA 1SXJD 4PXAA 5EE1A 1L7VC 3V00A 1ZM2A 4ZDJA 1GRQA 1AGPA 4OK3A 2XGJA 1JXMA 1UBFA 4L4UA 3AVPA 4K81B 3VU9A 4RFSA 5ELXA 1Q1BA 1EGAA 4LV8B 4BZQA 2V8OA 5FOXA 4D4LA 2ZRMA 4GMXA 1XPUA 4ACBA 1N6NA 1T5LA 2BM1A 2R6DA 2D06A 1G41A 1Q3HA 2B8TA 5E4FA 2QP9X 1DBSA 4OL0A 3QF4A 1SGWA 3C7KA 1JR3E 3C8UA 1QHYA 1KI6A 5G53C 1NVUQ 1US8B 2ODEA 1Z07A 1K5GA 4G5SA 4CEIB 4DSUA 3SBDA 3LVQE 2BBSA 2YKGA 2ZTSA 4B6FA 2J0UA 2VP6A 1DG1G 2NPFA 1WP9A 2A5GA 2Q0HA 3GLFA 2FV8A 1XD9A 4KFRA 1VCIA 5H70A 1N6KA 3UPUA 1PVOA 1Q44A 1VIYA 1D6JA 1MO5A 4DLWA 2Z6VA 1G19A 4LHZA 3THXB 2FSGA 2NO1A 5KHOC 4GBMA 1KTVA 3RS3A 2GVZC 3FMOB 4US0R 3R8FA 2JA1A 4B2PA 2OCYC 5IT5A 2PEZA 2ZAMA 1UKEA 1W1WA 1HE8B 2QTFA 4GMDA 4DLXA 5CIWA 1JI0A 4KBGA 4Q9LA 5DISB 4XIGS 3QSYA 1OF1A 2JAQA 4DBLC 2H17A 4TQAA 1SZPA 4U00A 1NRJB 3M4YA 3HR7A 2XITA 4LGMA 2BDTA 2ONKA 3KKNA 3TH5A 3GLIE 2NQ2C 5EE9A 3IKJA 4MGKR 4UXJA 3B9QA 2FEMA 4JBXA 3VQTA 1KI8A 3A6PC 3AKDA 3QENA 4QGGA 4NP6A 1XNJA 3IHWA 2JGNA 4LUCA 2JJ1A 1FPMA 1OFIA 2ONJA 3C4JA 4B3DA 3ZD7A 3C16C 3KKPA 4DJTA 3LBHA 3EA0A 1E0SA 3SR0A 2ZI7A 3UATA 2RKOA 4QGAA 1NLYA 4M1OA 1U81A 2GXQA 3K0FA 4OJQA 2F43B 3B8HA 2GJAA 4TQUS 4PC3A 2WJHA 4C0AC 5FL3A 1LY1A 3V4RA 5DI3B 4NKRA 2WKRA 1P2VA 3ICEA 2P6NA 1W4CA 3RSOA 2J45A 3K09A 1S4QA 3QKTA 4P4SB 1M74A 1P72A 4LJ8A 1II0A 3CR8A 1D8TA 1SXJB 3IDQA 5A0FA 5L3RA 4ZDKA 3K1JA 1OB2A 1JR6A 8OHMA 3OFNA 2G83A 1NMZA 1E32A 3P27A 3TBKA 5JZVA 1K5DA 1Z6TA 5EXPA 4TLEA 1Q22A 4DSNA 3G0HA 4URVR 3B9PA 1OLOA 4OQLA 2ZYTX 3SQXA 2VP5A 1E79A 2J87A 3K0AA 4GP7A 1UPTA 1Z83A 3F5FA 4RFVA 4C0KA 3TUJC 1MR3F 2ZI9A 4PX9A 4A0RA 1OYYA 1XMIA 2MSCB 4HUQA 4TYNA 2IS1A 3N2EA 3LVRE 4H1VA 3K0CA 5CJ2A 4EPRA 5EJEA 4Q03A 1DAKA 3QY0A 5JS8A 3U60B 1B23P 2O8BB 1JECA 1Z6YA 4NCNA 1G291 4OHVA 3W8NA 2IXGA 3DL0A 3TKLA 1GM5A 1M6NA 1IM2A 4LYAA 2FX3A 1OT3A 3IIMA 2J7PD 2ZI3A 3BGWA 1AM4D 4XTCS 3X1XA 1EESA 2BKUA 1LW7A 1N25A 4KFTA 3AM1A 4M2LA 3WMEA 1HURA 2JASA 5FPTA 1RVDA 1PJRA 4BEJA 1VIAA 3L8YA 4AG5A 2JLSA 4GP6A 2AR7A 1V43A 4ARZB 1PUJA 5JMTA 2ATXA 1JAHA 1K8RA 2OFXA 1KI3A 2ZANA 3B1WA 1FTNA 3LA6A 4DXAA 3RS4A 3FKQA 2JIZD 4IEEA 1Z0FA 1IN6A 1KO7A 3DVLA 3UMRA 3UXMA 4C0JA 2QT0A 2ZAOA 5KYKA 4JBYA 4D26A 4LPKA 1N6PA 1W49A 4JLPA 4HZUA 2EW1A 1OHHA 2OILA 2IT1A 1E1RD 2QPOA 2BBTA 1F2TA 5GJCA 2WSSA 4O25A 4YMSA 3W5IA 1NI3A 1OIXA 2IL1A 2R44A 2ZRHA 3KB2A 4DUGA 4DDUA 5JCPA 4ACAA 4V02A 1ZJ6A 1G8FA 2AK3A 4EPTA 3B6EA 1XTKA 1E4VA 3ZZTA 3BC1A 4QJ5A 2GBLA 2ZE5A 3BWDD 1FMJA 1SVLA 2L0XA 5TVKA 1X86B 3FFBA 5FOVA 2UKDA 1KSFX 2C96A 4M22A 3OIWA 1DEKA 1DAHA 4M9QA 1DELA 4RY2A 3TW4A 4US2R 3M1IA 4DEYA 1T91A 5TARA 4HLDA 5TV2A 3NBXX 2GXAA 1OH8A 3HDTA 4KODA 2BC9A 4FMCB 4YMVA 4YC7A 3KTAB 3LXRA 4HB0A 1IJFA 2CL7X 4A2WA 4V0MA 2HLDD 2YWFA 4B3XA 3GLIA 4NYIQ 3ZIAD 3GLHB 3K70C 2XZOA 3T35A 3PEYA 4B43A 1KGDA 3FTQA 3B13B 1G6HA 5CJPA 4MKGA 4PANA 3KDSE 4FMDB 4A8JA 3NIBA 3AP2A 4B73A 3OAAA 2QNRA 2ZRBA 4PAMA 1AIPA 2BHRA 5F2EA 3VMFA 4RZUA 2QT1A 621PA 1FQJA 4EJSC 1XJQA 421PA 1L2TA 2C03A 1DPFA 2GCOB 2PJRA 3Q72A 3B60A 4R71A 1DO0A 2ZR9A 4AC9A 1NP6A 3ZZ0A 3H2YA 5FBQB 3SQWA 4DB2A 1E9EA 2FSHA 1GRNA 3ADBA 4ZO4A 2JLWA 2C04A 4MYUA 2WJGA 1GKIA 3LV8A 4NCJA 2CNWA 1E94E 2A5DA 4RD3A 3LLUA 4WIAA 1G7CA 1P9WA 4BRUA 3CKLA 3CPJB 4X8HA 3NWJA 2GDJA 1PUIA 4Z1MA 2V7QA 2XOKD 4IKEA 4PZZA 3QKSB 4P31A 2WJVA 3TUIC 2PMDA 4N3NA 4W5WA 5DHFA 2C98A 2N46A 3SJCA 2GWHA 4EQ6A 1NVXQ 4LYHA 3DOEA 1E0KA 1AA9A 1HE1C 4FWIB 2XSZA 2Q9BA 3CWZA 1S9DA 2QQEA 2X19A 2B7BA 2EYQA 2VP9A 3BS4A 4V0LA 1F6BA 1YHNA 3S1AB 2FU5C 5KSPA 2P3SA 1WQ1R 4R7ZA 3A4MA 4D0GA 2RGXA 2ZUDA 3I8SA 4B3CA 2O5VA 1XTQA 5KDDA 3PXGA 2WWWA 3BORA 3THWB 2P65A 2FEOA 3RABA 2NPIA 3EW9A 4B3FX 2JLUA 3L82B 1OE0A 3BK7A 3NH6A 4CEHA 5B57C 2P2LA 3IIKA 4YMWA 4YQFA 1CRPA 3KJGA 2CMKA 1XEXB 3REGA 3AGQA 5D3QA 4I1OA 3U44B 1UAAA 3LO5A 4URYR 1KAOA 4YMUA 5KSYA 3A1VA 3RANA 1QVRA 2IYRA 3HR8A 2ZM5A 721PA 2H8KA 4OHWA 3TVDA 2EYUA 2WOJA 2V1XA 2BV3A 1XTRA 2C9OA 1YZGA 1AQUA 5BYJA 2HV8A 3V9PA 1A2BA 3T5GA 3GJXC 3EZFA 4HI0E 1OKKD 3D8BA 4P4TA 2BVNA 1A7JA 4LCBA 1W0JA 3CNOA 1P4SA 2VP0A 5AJYA 1KY3A 3AP3A 3CNLA 3I32A 1WCV1 1G7TA 4Q7LA 2J0SA 2HCBA 5JJLA 2W0MA 4JVLA 1AJEA 1NN0A 2YJTD 3EC2A 2IYLD 1D2MA 1GL7A 4S35A 2FZ4A 2VHJA 5FUWA 1COWD 2F1RA 2FGJA 2XTNA 4NDZA 4D80A 1KNXA 3B7GA 1DARA 4G5OA 2BEKA 1SVMA 5FBWB 2GESA 1NKTA 2QL6A 3NTUA 3Q5EA 3B5JA 4CDGA 3MWLA 2HXSA 1E69A 3QF7A 1OV4A 3LWNA 2XAUA 4JL5A 5FBLB 5J4YA 1GKUB 1XEWY 5C18A 2QUZA 2E9SA 2B6HA 2AFIE 5AUQA 1QHHB 2C8VA 3U3JA 4TLBA 5J4KA 1KMQA 1NJFA 4TMKA 3GLGB 3BB1A 1QZXA 3RRMA 2GKSA 3QXXA 3DZDA 4ZCIA 3VAAA 3QEOA 3DPUA 1R6BX 2ORIA 2ZEJA 1RRFA 3PEWA 5KDLA 1T8UA 3TVTA 3C5HA 3RYTC 4PAQA 5IHPA 4XD7D 1X8JA 4LYJA 3T34A 5CDFE 2VTKA 5DE3A 2V3CC 2W00A 4RZXA 1BH2A 5L3SA 1SKQA 3TW8B 4MDFA 4H9GA 4P4UA 4LYFA 2QMEA 1KO5A 5JFGA 1E9AA 1F2UB 1Z47A 1C9KA 1ZW6A 4ABYA 4LJ9A 5G3YA 2XJ9A 3AF3A 1Z6XA 3EX7C 3CF6R 3FMIA 3QPWA 3D3QA 2BKEA 5GJVC 4OHZA 4K8OA 4WVFA 4D6PA 3GP8A 1WMSA 2DFNA 3NEJA 3IQXA 4MKFA 4POAA 3QJYA 2XEXA 2W0SA 4Q21A 5G41A 3VX3A 1OXUA 1ZD9A 4Z8YA 4FIDA 4DSOA 4ASUD 4U7DA 2IW3A 4HAVA 1VG1A 1XZPA 1UM8A 1LNZA 2FG5A 2YOFA 4KSBA 1MRNA 1U9IA 4AURA 4YXWD 4FXPA 2J46A 4TSFD 3X1YA 3L0PA 3OIUA 1XB2A 2YC4C 4A4DA 1VG9B 1KIMA 1MO4A 2IEZA 2LKDA 3ZGXA 2CK3A 4PO1A 5FUXA 5EXSA 4KO8A 3R7WA 4II7A 1FTSA 1D2NA 2QROA 1IJEA 1XMVA 4G5RA 4F93B 1X1SA 3ECCA 3UK6A 1A2KC 3AVWA 4UNPA 1J7KA 3KX2A 3UG6A 3RRNA 1X1RA 1YKSA 2IHBA 1T8TA 2ZS9A 3SYLA 2J3EA 4JLKA 4TT3D 3ADCA 1KKMA 3L2OB 4GZMA 3T5DA 4EFMA 3CZPA 4LI0A 4CIDA 4Q47A 1Q0UA 3U7GA 1ZNWA 2W6ID 5FI0B 1TEXA 3REFA 2ORVA 2R6CA 4Q4LA 1VCMA 4TL9A 1GKYA 2IYTA 2XTMA 1GRRA 2GCNA 5FUVA 2CCKA 3UIEA 3K0EA 1NY5A 4MRNA 4FWTA 2YWHA 4DCNA 2IK8A 4BEBA 1OJLA 4CGZA 1WE2A 2RGNA 4I4LA 1JJVA 4KV9A 5C2JB 1RRPA 1SVKA 4BFSA 1G64A 2ZRAA 3CF2A 2VEDA 2O0KA 2XXAB 1NF3A 2O52A 3LRPA 1H8EA 2PT7A 1QVAA 4M9ZA 4HZIA 1MABB 4Z54A 2O8FA 4XSHA 1VPLA 3IPXA 5TY0A 2IS2A 3RDPA 4WZBE 4B47A 5LPNA 3GD7A 4IW3B 1P9NA 3MAAC 1AKEA 4BLRA 1ZBDA 1XXHE 1Q1QA 3ZYCA 3IBGA 3L43A 3KJIA 2O8CB 3K70B 1UKYA 2NZ8A 4DCSA 2E1RA 1DS6A 4IDHA 2O8DB 3GEEA 2QENA 2G3YA 1OIVA 2R65A 3A1SA 3FFAA 2DHRA 3U3OA 2FF7A 4QBFA 1CBUA 4CF7A 4ZIRA 2A9KA 4ZI2A 4QBGB 4JZKA 1TQ4A 2PX3A 3RVBA 4AYXA 4EJSB 2AFHE 2ASEA 4LBWA 1KSGA 2WPDA 2DFKB 3RC8A 4CYMA 1L8QA 2A2ZA 1R8SA 3MSXA 4RSGA 4XH9B 1EFUA 3ND8A 2VHQA 1I2DA 5KNDA 2CL6X 4TMXA 1R0ZA 1W36C 2GA8A 2ZS7A 1J8YF 3OZXA 3NC0C 5IK2A 4DRZA 1TUIA 2VBCA 3SYNA 4M8NE 1NVVQ 1G5PA 2O8EA 1WF3A 3HYRA 3I3SR 4GOKA 2IYXA 2JJ2D 2ZREA 2XX3A 5FPKA 1NN1A 1PZNA 4OKSA 4I1VA 3K0SA 2RMKA 1Q12A 4LHXA 2ZQ5A 1M7BA 5CLQA 3H86A 1US8A 1N0UA 2IXFA 3LAWA 4QGHA 1U2RA 2Q9AA 4KFSA 3UKDA 4JLMA 1Z0JA 2FSIA 1OXVA 4PQFA 2MSDB 4I1UA 3AB3A 2AWOA 1E2MA 3WHLA 1QDEA 2LCFA 1Z6AA 1I4TD 2NO9A 2QQ0A 1VHTA 1GG2A 5DYGA 5JWHA 1XTJA 4WW0A 1S2MA 2IYVA 3IILA 3OF5A 2JLVA 2X77A 1RW4A 4FCVA 4HUTA 4PSAA 1YJ5A 3WNCA 4HAYA 4IDPA 4Q01A 1E4YA 5G3ZA 3K09C 1OPXA 1G17A 1N0VC 1F60A 2G1KA 2ZJ8A 2CXXA 4TLAA 3PEUA 3HU1A 3A37A 3SHFA 2H18A 3OEHD 2QORA 4US1R 3PENA 4NYJQ 1ZU4A 2DCUA 4KCGA 2GEUA 3FGNA 1UEJA 3EPHA 3RSLA 3AVXA 1WBDA 3ASZA 4IOLA 3CIOA 2GAAA 4LJYA 3HU3A 3W6OA 3Q7QA 1Q1EA 1XEFA 1BYIA 3WNDA 1NNEA 1ESNA 2N42A 2RHMA 4MGZR 2I1VB 3WYGA 3PIRA 1AS3A 4B3BA 2VF7A 3QUSA 4DLRA 2FFBA 4LC1A 4OK5A 4QJ3A 1RIFA 3K0CC 4Q66C 4BZPA 3O8BA 2NOAA 4PPFA 5JEEA 1FX0A 2HDNB 4ESHA 5GVSA 1KKLA 2ZYWX 1II8A 4Q9KA 3KKMA 5AJWA 1RYFA 1TF5A 3B1ZA 1UF9A 5DI3A 2YOHA 4A0HA 1LF5A 1E1QD 5GJWC 1Z2CA 5H68A 1OXTA 2FDCA 4E07A 4P4SA 2IUSA 3OE7A 4TTPA 4CEJA 1SXJA 2X8AA 4PR0A 3SC3A 3DDCA 3VR1A 2B92A 3TIFA 4QNMA 2GILA 3TRFA 2EFDB 4UKDA 1W46A 3HPRA 3OEED 3R20A 4DLYA 1F3OA 4NCHA 1NIPA 4PC6A 4KITB 3O8DA 1R5NA 1XXHA 3ZLJA 3FHTA 2GRJA 1Z8FA 4WXPA 4NH0A 1YZQA 1PV4A 5CM8B 1ZC4A 3LXXA 4PFSA 3SOPA 3GEIA 4HLUA 2VQSA 4F4CA 2KBFA 4HDOB 1Z28A 4AKHA 2OE2A 3CWQA 1M34E 3CH5A 3D31A 1GZSA 2R62A 2VSFA 1M7GA 4B34A 3WMFA 3QKRB 2DWOA 4AK9A 3N70A 2GBLC 2CCGA 3VHLB 4DC9A 3WBKA 3PV0A 1E99A 2ZITA 4MKIA 3U4QA 2DFTA 4WAUA 1E9FA 2OM2A 2QM8A 4WBSA 5HKKA 1CKEA 2KI5A 1SVWA 2RHDA 3LW8A 2QM7A 1N6LA 4DCTA 4RD4A 3EIEA 1KO8A 1C4OA 3NKVA 1GL9B 4DLUA 3GJ5A 3VKHA 5BWMA 2ZRPA 2ZI5A 4Q1EA 1D9XA 1ETUA 3CB4A 5KSOA 4ARZA 1U8AA 1L4YA 1E2JA 2GJSA 2QU8A 4TTQA 3WHKA 5HPYB 4V0ME 1KDTA 1CJTC 1D2EA 1NBMD 1SKYE 1N0WA 3D6TB 2GJ8A 3FMPB 2OUKA 2ZRIA 5CYPA 3AF0A 2E87A 5EXTA 4DLSA 3DZ8A 2QMUA 4A8JC 3KXLA 3A58B 1Z5ZA 4GZLA 3AVTA 4W5JA 2W2XA 1JEEA 4WXRA 1J99A 3M0EA 3THOA 4L9SA 1X6VA 4W7SA 2IYZA 1KY2A 2JJ1D 3BD9A 3BH0A 5EE0A 4DCVA 3EA5A 2FMXA 1U8YA 4JLJA 2GXUA 1TTTA 1CR4A 3PUXA 2LWIA 3WYAA 1CIPA 5JI2E 5H8WA 2BM0A 4QKQA 1KNQA 2VHTA 2WHXA 3QE0A 1CJKC 1CF4A 2FE4A 5JRJA 1GILA 4ZI3A 3WBJA 1TADA 2FFHA 3UWOA 1P60A 4LY6A 5FR1A 4B44A 3TSWA 5GJBA 1Q1ZA 4HLCA 1BS1A 4QL3A 2OCAA 4N1AA 4G1UC 1RJ9B 5DN6D 3CONA 1DAGA 3GFPA 3NHAA 1UBCA 3KTAA 4TN1A 3V4FA 4Q4JB 2A30A 1LS1A 3CZQA 1XRJA 5DYIA 2H16A 1KHTA 3RS5A 2V4ZA 4BECA 3GLHA 3RAPR 2YWGA 2JLQA 3I72A 4RFSB 3U2QA 1AKYA 1UFQA 1ZIPA 4E22A 1XDBA 1P2TA 3ZQJA 1WBBA 4OI1A 4Q7KA 4RKFA 5DLQC 3L0SA 3BFXA 4TMZA 2J7KA 1G1MA 2GCOA 2ZETA 3QF4B 4M21A 4KVGA 1JAIA 4HDCA 4LK2A 4ITRC 4M9SA 2V9PA 1KI6B 5CLLA 4E09A 5EE5B 1MT0A 4F91B 1ELOA 1XD2A 1QBKC 1YR6A 2Q9CA 2YVUA 3B1XA 5JEDA 1WB9A 1EFHA 1Z29A 4HLQB 1NG9A 1HEIA 1NMYA 2J0UB 3CLVA 1P6XA 3GLFB 1AZSC 5G40A 4YONB 1FUKA 1W48A 5TXGA 5HTKA 3RS2A 4RZ3A 3FYHA 4DIEA 1YZNA 2EFHB 2VP2A 4CW7A 3NDBB 3RWOA 2VH5R 4G0NA 3SNHA 4AG6A 2ZROA 1LB1B 2W6JD 4LJAA 3GEHA 1T4GA 2NO0A 2ZU6A 2AKYA 3H1TA 4JVSB 3TAUA 2KBEA 4M0LA 2UZ3A 2RB4A 5J40A 4PHHA 4OQMA 2JLXA 2PX0A 1WA5A 1E2EA 3CPHA 3SU8A 2AD1A 1JR3D 3S1AA 1LV7A 4IFEA 3Q9LA 2D7DA 3ZD6A 4JBWA 2JIZA 4PO8A 3W9YA 3WYFA 2ODWA 3ZS9A 4A1FA 3BFKA 1E2QA 2J5XA 1TF2A 3C15C 1DAEA 1KZGB 3MCAA 4PSKA 4Q5IA 2YZ2A 4W5HA 4TLCA 4TYWA 3SDZA 2Z5FA 3ZDQA 3THWA 1XTIA 1KDOA 1X3SA 2ECKA 1E1RA 5EP4A 5EQTA 3ZVRA 1E2KA 1NMXA 5FTJA 3TUZC 4WOPA 2ZI4A 4KLNA 3R9WA 2VP4A 1FQKA 5JI3E 3ICQB 4JLDA 3O47A 2QSYA 4L16A 3HP1A 2ERYA 4M1MA 5B58C 3U44A 3TSZA 1NN3A 2R9VA 2WAYA 4MRVA 3RLFA 4QHSA 4BLPA 5CITA 1QHIA 2EFGA 4OI2A 4V03A 1EWQA 3A1WA 4Q7MB 4GFDA 1MO6A 3QXSA 4O2LA 3SFZA 1E0JA 3K0FB 4EAQA 3FDIA 4Q4HB 1IXSB 4LJ5A 4A0FA 1OFUX 2C5LA 3W3ZB 1KO1A 2HT1A 4JSTA 3QEJA 1KSHA 4LBYA 4OK6A 1YRBA 2BOVA 1DTSA 5EUMA 3HU2A 2QPTA 1U8ZA 3G82C 1N5LA 1FP7A 1CJMA 4N0DA 5DI9A 2QE7A 1J2JA 4FCTA 4JJKA 2IF0A 4MDEA 2HLDA 2WVJA 4LBZA 1C1YA 4MGIR 1AK2A 1TU4A 3R9IA 2QMOA 3GCGA 3ZIAA 1Z0AA 3B78A 1YZLA 5K8TA 3RWMB 4BWYA 4HB3A 4B71A 3MRSA 1WRBA 4I99A 2AL7A 3CNNA 4LRWA 1E9SA 2PCJA 3K0AB 2XB4A 3EZ9A 4JJZA 1CTQA 5BW8A 2IYSA 1XCPA 1KI1A 2CDNA 3VNUA 3NHBA 1KJYA 1TU3A 3KQLA 2FNAA 2G0TA 3TSOA 1WDTA 4AKGA 1NVWQ 1G6OA 1H8HA 2AXNA 2ZSEA 3CW2A 4QNRA 1GDDA 2OZEA 2WSMA 4RD0A 4EDHA 4Z1MD 1YZTA 2UVQA 2QBYA 1HYQA 5KOYA 4LSGA 5LD2C 3U6BA 1U9IC 2OFOA 1VYTA 1QHHA 1M1YE 3AUXA 4Q02A 1AS0A 2WWGA 4FW9A 2XOKA 4URXR 2R8RA 3AEZA 3DM5A 1T0JB 4BLSA 2BJWA 4KJZA 4Q19A 1E2IA 4QM7A 1UDWA 1U99A 3W6PA 3ONWA 5JS7A 1KK2A 4EPYA 2KB0A 2TMKA 3IGFA 5D3MB 5K8IA 2P6RA 3A36A 4B3GA 3B85A 1GSIA 2IYUA 5B64A 2OXRA 3BFVA 2J59A 5HCIA 4Q4AB 1U0HC 2ZUBA 4D0LB 2W2VA 2IYYA 4R98A 4R9UC 4D4MA 2BMJA 4TZ6A 1GWNA 1E2DA 4QJ4A 1F2UA 4LJ7A 3EIQA 4C9BA 5A4JA 1OYWA 2GZHA 1QHNA 3R9XA 1DVRA 1JQJC 3TE6A 2ZJAA 4BLTA 4PZYA 4TWZA 2GEDA 2P6UA 1F2TB 2ZJZA 1XEWX 2EWVA 2F6RA 4DLTA 3I5YA 1IY2A 3GJ0A 5AUNB 2FFQA 3RRYA 5DGXA 1XP8A 1T3LA 1YQTA 1OFHA 2QAGC 2QMHA 4Q7JB 2YV5A 1Z0DA 5AR1A 4QC2A 5ANRB 3QNUA 2RGNC 1RKBA 2QZ4A 2XNDA 1M2OB 4LWZA 2GK6A 1VG0B 4C4PA 1YZUA 4E5UA 1MRSA 4BQSA 5E95A 3AKYA 2C2HA 1E2NA 3LDAA 2ZE7A 3MJHA 1Z63A 1CP2A 1BYUA 1EFRD 2DWPA 1A4RA 4OI4A 1ZYUA 2F9MA 3GQBA 4XOIA 2QI9C 3KB1A 1KDRA 1R8QA 3GJ4A 3I1FA 2RGCA 4G3XA 1W0JD 4LPSA 1OKKA 3VR5A 3HPQA 1IXZA 2FSFA 1AGRA 3PCRB 4C3ZA 5LB4A 3VFDA 2BEJA 1N5IA 2ERXA 1M8PA 4V0OA 1NKSA 4MUAA 4JS0A 5FOTA 4HAZA 4U02A 5C46F 1ZC3A 1XZQA 1UADA 1P7CA 3SBEA 4NPHA 4IFBA 4MRPA 1RPZA 4PZLA 5CK5A 2OSBA 3AVVA 4C0QC 3CRRA 5J4HA 1SVIA 4NONA 2GHIA 1P75A 1CULC 2DPXA 4D82A 2OBNA 2C77A 2ZS8A 1E2FA 3U61B 3VR3A 2FFAA 2ZI6A 4M53A 1XWIA 3AVQA 4NYMQ 4RD6A 1G3QA 2D4HA 2FPMA 1VMAA 2CLSA 5JSZB 1D9ZA 2D74A 1HY3A 2REOA 2XXAA 5KNBA 2OXCA 1TQ2A 1OIWA 1G9XA 1W47A 4L15A 1MABA 5FTLA 3KQUA 1G8PA 3K70D 1LTQA 1Z3IX 2ODNA 3CF0A 3LW7A 5EUQB 1Y63A 3EG5A 2A5JA 4AYWA 5JHGB 4TMVA 1ANKA 1F5NA 4IOKA 3HJNA 4EQ6B 2Q3FA 2H92A 4KFUA 4LV6A 4Q18A 2DR3A 4JVMA 2C9YA 3LFUA 4J0QA 4M1KA 4S2EA 2ZRNA 5CM9C 3JZAA 5DNYB 4RD2A 3AVOA 5FL7D 4XD7A 1IN5A 1W2GA 3NXSA 5LB2A 3PFIA 3UMSA 4Z51A 5C4MA 1N6IA 1RZ3A 3I62A 5JJIA 4EJSA 3UANA 1XF9A 2EFCB 3FMFA 3IEUA 2Q3MA 2V6IA 4QBIA 5GVRA 2R6FA 4DT1B 5JWOA 1XMJA 2PT5A 1IHUA 2RGBA 2H7VA 2YNMA 3RC3A 1W0KD 3W5JA 2IEYA 4B75A 1O87A 2ZRDA 1FUUA 1IBRA 4BLQA 4ASUA 5BN5A 2A5FA 5IDVA 5BQ5A 2HUPA 2QY9A 4YXWA 3DOFA 1NLZA 4NL4H 1HQYE 2KWIA 1U98A 4TSFA 2CHVA 2YOGA 2AX4A 5SZJA 4PHTA 1HT2E 3BBPA 1KZ7B 4KAXA 3MLEA 1G8YA 1CS4C 2FGKA 3SJBA 4CVNA 4ZKEA 2XJ4A 4QBHA 1OB5A 2QPAA 4FCWA 4BGDA 1KI7A 4Q1FA 4F92B 2WWXA 6Q21A 3AF4A 2QA5A 1W44A 4FD2A 2V6JA 5CB6A 1YVDA 3AQ4A 1U0LA 2VSXA 1FL9A 2EQBA 2CJWA 3B82A 1ZRHA 1L4UA 3TK1A 3I92A 2NZJA 4RCYA 4RZ2A 5F9HA 2IYQA 1XMSA 4TT3A 3TR5A 4TQ9A 2F7SA 4B35A 1ESMA 3CX7A 3O8RA 1Q20A 1N6HA 1HV8A 2DBYA 1QF9A 4ZV4A 121PA 1E2HA 2O0HA 4AY2A 2W6IA 1S1MA 3SEAA 4LV5B 3BB4A 4P3YA 1S96A 5DIFA 3AP1A 4Q1CA 3D7MA 4B32A 3QG5A 1NJGA 1SXJE 4OQFA 3HYTA 3IBYA 2RH5A 2B8WA 2EWWA 3QKUA 4UNSA 3TQCA 4UNRA 4GOJA 5BN4A 2BBOA 1UEIA 3TQFA 1KMHA 2PLFA 3IO5A 3LQQA 5L3QB 1M7HA 4DIDA 1ZD1A 3PUWA 2CLCX 1OXXK 4O0MA 3QXCA 3FKSD 4EFNA 2HYDA 4HDQB 1N5KA 1Z6GA 1Z0IA 2R2AA 2ODBA 4DDWA 4TMWA 4XTRA 4HLUC 3ZVLA 4JSYA 2X1VA 2QP4A 3IPYA 2OFWA 4P33A 4QHTA 4TTRA 1ZM7A 1SHKA 3TGPA 1XU4A 2BMDA 1CXZA 2GF0A 2JDID 4LHVA 3LQRA 3QPVA 5JWRA 2VIIA 2AWNA 1N2CE 3KKOA 4A92A 3L0OA 4DZZA 1CR2A 1IN7A 4B74A 2HF8A 2HJVA 5AK0A 1XTSA 4PPQA 4DSTA 3K8YA 3L0IB 3RNLA 3T1VA 1GP2A 2P0EA 4UJ5A 4BFTA 3LNCA 3KUDA 2ZJOA 4V0NA 3FPAA 4HAWA 3KL4A 4EPWA 1JNYA 5E3HA 1V5WA 4JYCA 1QG2A 4JLBA 1KK1A 2F1HA 2QG6A 3CRQA 4XWOA 5TMPA 1VCOA 3B1VA 5FPYA 4C7OB 4F4JA 5CIQA 3UG7A 2NIPA 1OW3B 2VHUA 2WJYA 3MG9A 1T3HA 2IX3A 1TL7C 3KXKA 3F8TA 1TMKA 4BRWA 5LD2B 1OH6A 4FI3C 4Q1BA 2R6GA 3J81k 3ETLA 4CEIA 4AI6A 1KOFA 1E3MA 2EU8A 2P5SA 1ZCBA 2PBRA 3U3MA 4GL2A 1NBME 3SHWA 3P26A 2HCJB 4XVUA 1U90A 2R6AA 4HB2A 1UJ2A 4BLOA 1YE8A 5JLJA 1GFIA 2QRNA 4ESVA 2C9CA 4ZDWA 3THXA 4ON9A 4D25A 2YYZA 2IS6A 4EPXA 4JKYA 3K9HA 2FWRA 4IVPA 5F3WB 4Y0VA 3MWJA 2CLDX 1SVOA 4LZZA 4QHYA 3TR0A 3SZRA 1PLLA 1TEVA 1BMFD 1RRGA 3IIJA 1FZQA 3MWYW 1CR0A 1I2MA 1ZNXA 4JIMA 4MYCA 1VCNA 5JRZA 4O2RA 4AKIA 4CT5A 2ZRCA 1NN5A 3W90A 5FI1B 4L8GA 1MO3A 3LD9A 4OQXA 4TLDA 5AUPB 3A4NA 2IA5A 3DKVA 2EFEB 2VPPA 3GJ3A 2VO1A 2OCBA 3THYA 4GOXA 4OJKA 3LY5A 1JBKA 3F3YA 2W2TA 3GLHE 2QAGB 2YHSA 3OESA 2QP3A 4LJ6A 4LHWA 3DM9B 3PEVA 2W58A 2D62A 1JPNA 3QPUA 2C95A 5KSZA 1W5TA 3ZVNA 4U5XA 2ZE6A 2WWHA 2Q21A 3E5HA 4I1SA 2BBWA 1R2QA 4Y0AA 3RRZA 2GXSA 4ZPXA 2G0NA 3BXZA 1E2PA 5FBVB 3NH9A 3KFVA 2GAOA 2Z43A 1XJCA 1VYUA 1II9A 1B0UA 2ZRJA 5F98A 3E70C 3IUYA 2F43A 4P32A 2KSQA 3KFXA 2REBA 4PPNA 1XD8A 3AGPA 5J4VA 3TLXA 2ZJBA 5L8VA 3TJZA 3JVUA 4L5BA 2ZYVX 3BJIC 1IAQA 3CPEA 3B2EA 2WWFA 2WTUA 3PJRA 2AK2A 3GJ6A 4ZIRB 3VNVA 1CEEA 2DYKA 4A82A 1AQYA 3P20A 1UBEA 3QIAA 5FR2A 1SULA 3JZMA 4BUJA 2J0QA 4MITA 1RJ9A 1W4RA 5EXXA 2ORWA 2Z4RA 1E1QA 1KK0A 1OSNA 2OO7A 4Q4JA 4DCUA 2IYWA 3I5XA 4I81A 1Y3AA 4G5GA 5FTMA 3W34A 4CZ2A 4C0HA 4B33A 2PCLA 2FPLA 2B7CA 2W83A 2ZE8A 2IUTA 1ZUNB 2ZJ5A 3BAFA 4IVRA 4PC7A 821PA 2YC2C 3CRVA 2VF8A 1GL6A 2J41A 3NBZC 2O8EB 5F9FA 1IQPA 3OEEA 1E9DA 1YR9A 1ZD8A 3C41J 2O8BA 3EARA 3EIHA 3GMTA 3U5ZB 1GUAA 1G3MA 1T0HB 2QEQA 1T5IA 2JLZA 4UXIA 1DAMA 2IUUA 1YRAA 4KXFB 2DFLA 4NZYA 3VHXA 2F9LA 5B2ZA 3W8RA 5IRCD 2KE5A 4URZR 4MUBA 5BYKA 3BRWD 1IOZA 3EXAA 5HR5A 4YDSA 5HKKD 3H0KA 4Z8XA 3IO3A 1W36D 3TAHA 1TQDA 5CB8A 2XTZA 3EPKA 1D5CA 2H1LA 5L3VA 3F0TA 3FB4A 3T06B 3WNBA 1E6CA 1ZU5A 2F1JA 2WJJA 4A0GA 4PTLA 2CE2X 2PZFA 5J47A 3LBNA 3QVVA 4DEXA 1Z06A 1ZCAA 3A1TA 3B1YA 3EZ7A 3NEYA 3RS0A 2AKAB 1F48A 1ZM3A 2AXPA 3CUEF 4EFLA 2MSEB 3ND9A 1R0XA 1NBMA 4TL7A 3RS7A 1CRQA 2GETA 3KJEA 4IVQA 4XSGA 2YWEA 4PAOA 2Z4SA 4GT1A 2WBLC 2ZRLA 4C0BA 4RKEA 2EVWX 1EWRA 4JMPA 4QGFA 3X1DA 3M6AA 5CYOA 5HE9A 3DO6A 1Z08A 2IWHA 2OHFA 3DMNA 5DO9A 1OH7A 1NIJA 2XB2A 3CRMA 3MD0A 2I4IA 2OLJA 2ZR0A 4B6EA 5KNCA 4A9AA 1N3BA 2YINC 3QXJA 4A6PA 4A15A 1E96A 2ZSBA 1DG3A 4MKHA 1E9CA 4JLNA 5E7JA 2CVFA 3N5CA 5SZHB 5KUTA 4C2TA 1Z2AA 1FX0B 1CU1A 2BJVA 4Q1AA 5K8LA 4V0KA 1ZUHA 1E2GA 2PMKA 2UZIR 2NG1A 4B2IA 1II8B 3AKEA 4Q4HA 1AS2A 3OFND 3WXMA 1S9HA 4ZDIA 2NTYC 3I8XA 3HWSA 2V55B 1FP6A 3GLGE 2OBMA 3VU9B 4IXMA 1LVGA 5FPHA 1DADA 3EWAA 4A2PA 2GJKA 5DN6A 4TYYA 1EX6A 4KLZA 4XWKA 5AJVB 3K53A 1E79D 1MH1A 2I3BA 2OAP1 4CEJB 4DDVA 1G3UA 5EZ6B 3VR2A 3U6KA 3DEFA 4XJXA 1CLUA 3MWKA 2IXEA 3PUYA 4RVCA 2CL0X 3U7FB 1NSFA 3WP0A 3NBFA 4D2IA 5BN3A 2FJUA 1Z0KA 4NYIR 1XXHB 2BCJQ 2WOOA 2VRWA 4HEJA 4NU0A 1U94A 3PVSA 3VR4A 3SFVA 5LBIA 2GZDA 2QGZA 2ZXUA 1I4DD 1PLJA 1TF7A
chains in the Genus database with same CATH superfamily
1PJCA 4M1YA 4F45A 1PEAA 4ER5A 4OTZA 4QAJA 4EKDA 2AJCA 3NANA 3H5OA 1J23A 4BBPA 1V96A 3PQCA 4NMXB 4ERNA 2I5PO 3IH5A 3AUUA 2HSWA 1I13A 2JD2A 1U3TA 3W2EA 1Z2NX 2OYCA 3KJFA 3TZQA 5I4CA 2VL7A 5IT0A 3WFZA 1JHOA 1PGOA 5CNKA 2WT8A 1DFIA 3KG2A 2XCTB 1IU9A 2ZQZA 2C99A 3QU7A 1O94D 2R79A 5JNWA 3KYCA 4FLMA 4P5EA 1CIVA 1GNRA 3OEWA 4K9QA 5LP6C 2WK1A 4BZXA 4ROTA 4LWPA 4PGHA 2W6JA 4PHFA 1ZUD1 1CSEE 4C0WA 3W3AA 3NYIA 2PRYA 4P81A 1IMOA 5ALQA 1V2GA 2XODA 3H5LA 3EDYA 4Y0NA 4J2TA 3TI9A 3V1LA 4AJKA 1ZS9A 3S28A 1ZFNA 3ZI0A 3DMYA 5IT9A 4AF6A 1WZNA 1HC7A 4ZI5A 2VLIA 2A7QA 4QXAA 1JR3A 2ZJ4A 1R5BA 5K4GA 4L4XA 1HDRA 1R10A 5HCNA 2N0SA 1E62A 2IPMA 2P9JA 1LFDB 3OZGA 2WG2A 3D81A 3BGSA 2C5FA 3LRXA 2C3MA 4EK9A 2XH8A 3AWIA 5ICFA 2BZGA 2ZIAA 2CE7A 2HBQA 4OMCA 4G5QA 1QPBA 5ENZA 5IP5A 1PJ2A 3WGNA 5JCJD 4ZZIA 1CQIB 5HK9A 1JZTA 5K4HA 4QXPA 3NG1A 2P0AA 3KYJB 3DC7A 3GT0A 4U9HS 4IIEA 1E77A 4LOAA 5FA6A 5IJZA 3CNHA 4G8CA 1H3NA 1NX9A 1OPRA 3VR4H 2V54A 4ZJYA 3DDSA 4TTJA 2FR8C 3CM0A 3FDJA 5FO1A 4CIVA 2I6XA 3CVXA 4AWXA 3GVPA 3F7MA 1HFJA 5MDHA 3RQSA 4BVHA 1CV2A 1R4AA 3L93A 5F51A 5D51S 4GLLA 5KU1A 3GFOA 4UOQA 2OOSA 1PLKA 4HEA1 4IDOA 2YXBA 2B20A 1CG6A 1UKVY 4O6VA 1FMLA 4O4JB 2QZSA 2H4YA 3EDMA 3NVAA 1RAHA 3JQCA 3P2YA 3PYLA 1TUEA 4B82A 4F1KA 4FBLA 4R31A 5ERGB 2AHOA 4LMRA 5FFMA 4BBZA 1LS6A 4FMCF 2ZIUB 4QQRA 2WMNB 3R3XA 5DASA 3IEVA 1SXGA 1RBMA 4Y1RB 2JFUA 3K15A 5ENDA 3WMRA 3ADKA 3MT8A 2AOXA 3AR4A 4ZT6A 4IO1A 2ZBDA 3VPBA 4ENPA 4L76A 3W3AH 4TROA 1G8GA 5HIKA 1SZDA 4S1WA 1WTAA 1VKJA 2GSWA 3KV3O 1OT5A 1TMOA 2XD4A 3KYDA 1G60A 4AUNA 4EB0A 3UXEA 1JZSA 4JJAA 4KK4A 4ODIA 5EERA 3VVBA 4YRJA 5AKGA 1H85A 3GR6A 3FTDA 1I4LD 4HX9A 3L7IA 3BL8A 3UJDA 1JN0A 3CLRC 2Q5OA 1D3AA 3Q3GE 3OHMA 3OIGA 4WOCA 1WQ4A 5DBFA 1BO6A 5LUBA 2AXEA 1FCJA 3K4HA 2UYGA 1RFLA 1SAYA 1U8EA 3NT5A 2WTNA 2XNKA 3PR1A 5CCXA 3I1YA 4LW8A 1XD2B 1PR6A 2AT1A 3OM8A 4BAUA 4QPDA 3K3PA 3EOZA 5DKFA 4J0FA 4L9WA 3GLGA 2Y1FA 3C3DA 3RFTA 1U0JA 1KAGA 3M5CA 4K40A 4EG3A 3DOCA 4AZVA 5C31A 2D6FA 4PFQA 1QIMA 4RGBA 1E3IA 5A05A 4F2PA 3RAEC 4OYHA 5FLEX 2YXEA 3C74A 1JLKA 2BDUA 2LPMA 2IC5A 3HB4X 5I3CA 1R7RA 2W22A 3VO2A 3P4YA 1U3FA 5FA5A 1WKBA 2ZM6B 2G9QA 1JPJA 3JATB 3ZDZB 2JKZA 1O6FA 1KK3A 3CLTC 4P7JA 1KFEB 2HSZA 3MMSA 3A0UA 4FMBB 3TPCA 2DH5A 4MGYR 1F0PA 2B0CA 4IBOA 2YV1A 3A3OA 3BIFA 2I03A 1LDBA 2QTGA 5JV5A 4ZYWA 4ETNA 5L51A 3ENVA 4TN5A 4HZUB 4QRHA 2B1RA 4IUCS 1ZAKA 3Q88A 3WYDA 2V7BA 1XE3A 3LC1O 2YS6A 1MUUA 5AJHA 4NBUA 2IHKA 1K6MA 1FBTA 1UM9B 3EEBA 5I7AA 5FLXA 1EVQA 1SUPA 4FS8A 3CH7A 4N7MA 5HTOA 4UDYX 3DL2A 3R4VA 1KETA 3K9GA 1Y5MA 3JARA 1TVKA 3ABSB 1OFTA 4FR5A 2I4NA 4MPPA 3ZWWA 1UBLS 2E37A 5LDDC 5CYFA 3HI4A 3ZGVA 2OL4A 4OV6B 3VVMA 1XJ0A 1I6KA 4DC1A 2JC3A 1VHLA 2E55A 3OPQA 3JYPA 2IXAA 1EVYA 1YZYA 5IJXA 3R5JA 3MPOA 3WKBA 4UFPA 2K5UA 5GOTA 2SKDA 3IQFA 5ER6A 4GBJA 1M2NA 4RHYA 1IIBA 3H7AA 3QVUA 5HJEA 1RHUA 5FTNA 4EI2A 4YPOA 3DQZA 2V8BA 2YDYA 5JQGA 5KCMA 1NGSA 5G1PA 1EFDN 3E4DA 3N2IA 3FYCA 1QRRA 2C8KA 4IJ6A 4GUDA 5JHHB 3P19A 1AO3A 4ND3A 1PJZA 4YV2A 1ISIA 1XCMA 5KTKA 1F5SA 2EQAA 5F33A 3HEBA 4MEBA 4GM1A 2BSQA 2CCJA 2NUBA 4DV2B 2D2FA 4MW0A 4LFAB 1ZWKA 2C83A 1TAGA 2XUQA 3BIJA 3HVUA 1IM8A 3PC3A 3U7QA 5DK4A 3MIIA 3RBZA 1YFLA 1AF4A 1OAKA 4B83A 4RX1A 3WWDA 7MHTA 3VPHA 1PEKE 3EY9A 3GUYA 3VH4A 2JL1A 3VKUA 5ADHA 5CK4A 4NEGA 2PUCA 3SHVA 2WAOA 5C34B 5GINE 3E5RA 4DJDC 3STTA 2C00A 2IQIA 5JSHA 2JCSA 2MYNA 4HF7A 5T8KA 1M8JA 5C3UA 4QG7A 4GXNA 4N6NA 2G36A 2NSLA 4ZARA 1WB5A 4UAGA 3RCBA 2CSXA 5IYZA 3GA0A 2ZU0C 1JHZA 4M49A 3FWHA 4RAQA 2F3UA 4UAUA 4Q9IA 5B4VA 2X2FA 1G2PA 1POXA 2I33A 4TMTA 4YP7A 2OBYA 3DP7A 4PNZA 4BX0A 1BOFA 2QLJA 1YULA 1OWNA 1J39A 1D6MA 1IEVA 3O92A 4AJ1A 5HZHA 2VJMA 3ZD9A 1EG7A 1QO0A 1SUSA 1E20A 2EBWA 3L8ZA 1T0UA 3PL1A 1E0AA 2K6GA 3F78A 4A7PA 1JGTA 3G5UA 3HACA 1WVMA 1QB8A 1K97A 2ZCVA 5B58T 2CEAA 2HDOA 1XPOA 3LHDA 2YV3A 3RRJA 1TU0A 3PD0A 2Y68A 1I7PA 1O5TA 1WD5A 2PGOA 1HH4A 3T1TA 3WKCA 2CMDA 4NIMA 4DY4A 2QJOA 5DZSA 4A2QA 1Y4DE 2GPNA 3DTYA 4LC0A 3Q10A 3H2SA 2VPXA 3U48A 2P9YA 3A70A 1D2AA 2NU8B 4P34A 2XMBA 2OP0A 4EMUA 2QQ5A 1N6RA 2GN8A 4QDOA 1PYGA 1SXHA 3N8HA 3P4XA 2W2LA 3AFNA 3W2FA 1SN7A 2RI1A 3YASA 1ZM4A 2HQRA 5KPJA 1YO6A 3D3JA 4EG1A 1YZKA 2FW6A 2GX6A 1EAYA 1BWPA 3PNMA 4O4LA 1BMTA 4HYYA 4BV2A 2HWUA 3H1BA 2BI4A 1VI2A 2I1QA 4UZEA 3MTDA 4RVGA 1YGPA 2M6SA 5CLIA 4H1UA 3K9QO 1BGXT 4PLGA 4YYEA 2EF0A 4CM6A 5EXDA 4B8YA 1FFSA 5EP2A 4QULA 4YAOA 1NU6A 3HBLA 2QR2A 3QUBA 1ONBA 3HKEA 1W0KA 2Z0MA 1I5EA 1MAAA 3L6CA 5K9ZA 5IVKA 4RQTA 1R0YA 4L0MA 3K72B 1JFFA 1ULTA 3IEIA 3FROA 3NTVA 1XZHA 4DHWA 1MEEA 4H7FA 1UBRS 3MA0A 5ECGC 5EY5B 2BSAA 1WEKA 3RBVA 4RK7A 1NVVR 5FUYA 3EC7A 4DW8A 4BL5A 2VAPA 4NFYA 4TSKA 2XRZA 1CZLA 4MIKA 3AFIA 3GOHA 3HJGA 4WK0B 4PPGA 3RROA 3L6UA 2W90A 5HIIA 3R44A 3WLAA 5ADVA 4RY9A 3GELA 1NLUA 1E3LA 1HTBA 3DWIA 4IQ8A 4UBIA 2DF8A 4QTTB 1O3YA 2EZTA 2PUVA 2XUPA 3LF2A 1ZN2A 1NW6A 3NOXA 1LU9A 4J6EA 4QGBA 1DFHA 5C1IA 3WNVA 3P32A 1A5AB 3Q9UA 3K5IA 2YBEA 2GZ1A 3T3PB 3UWKA 5FRDA 4LXUA 4D02A 2WJ6A 3PNLA 4MQMA 2FZLA 1PJBA 3UTCA 3D6VA 5FBHA 4PC1A 1SXJC 2CVOA 3H9EO 3TRJA 4J8PA 5LOVA 3KCNA 1TD9A 1JKJB 2O6LA 4FFRA 1P45A 1U8FO 2QKYA 4Q3AA 1THMA 1CR1A 3KEQA 4KHZA 1BGVA 2FPKA 1Z36A 2G77B 3DT9A 4RJIA 3SJZA 4RPHA 4V0RA 1IN8A 2JJQA 2ZSDA 4JEMA 5JDCA 4DCPA 3HKCA 1JEDA 4MRMA 5KJEA 4D0LB 4N5LA 5COAA 1RMYA 4U3JB 3AVUA 1JJ7A 1GPMA 1ZO8A 1U0RA 2A67A 2PJUA 1YJXA 2WFMA 3GB9A 3HGMA 1ZL2A 1M75A 5AXAA 3RFUA 3KSAC 1P2DA 1OMOA 1ZISA 3GUCA 2NYVA 2PBLA 2YX1A 4UBNA 4X90A 3KOWA 2VHWA 3GROA 3AEQA 3ZH9B 4FHGA 4DKJA 5JD3A 1B6RA 1GNQA 2IPOA 2ZIWB 4OXNA 3VR0A 1S2DA 5IKEA 5A3VA 1I6WA 5IEBA 3DOUA 4O2BF 5FHQA 1FTWA 1Y33E 1UAGA 1EM8A 2H3EA 2HT6A 3ZCXA 1IWBB 3I9V6 1YCGA 5P21A 4C6TB 2J3DA 3RBXA 3ZE2B 5EYPB 1XTVA 1ZHHA 1WPGA 1SOVA 1Y4SA 2X8LA 3DDWA 4Z0NA 5L3SB 1BVUA 1IXRC 1ODFA 2OV2A 3FPLA 4I50B 3HBNA 5B7NA 3FJYA 4RL4A 3H0EA 2ZSAA 1MEOA 2FRXA 1P3Y1 4ZAZA 4BJ1A 4ROSA 4NCIA 4YASA 1F8YA 4CODB 2DQSA 3KD2A 3NGMA 4RPCA 1VSUA 4NHEA 3GLFE 3LBIA 4GKVA 3QXHA 4EHBA 5EKXA 5A3RA 3RS8A 3T9FA 5LMZA 1I0ZA 2SHKA 4QFCA 4CE6A 4D0NA 5KNDD 2OA0A 2BEWB 3AIMA 5AW7A 2ANBA 1EXDA 1G4AE 1K88A 4X6XA 3GCXA 4FLFA 3WKDA 2JGAA 1FNNA 3GNSA 1NPYA 2F3TA 1X74A 2C58A 3DAGA 2RHJA 5AUOB 4EARA 5CA0F 4TUYF 3CW9A 4X85A 2Y1GA 3ZGNA 3WC4A 2AN5A 2Q6TA 3COWA 1TZ2A 2B4TO 1TW2A 2VCYA 3H84A 3K4PA 5TB5A 4RKQA 4BZWA 2RGDA 3L1HA 4JL8A 1O8CA 4NMMA 3TVYA 5F7XA 3WGIA 3OZCA 4LE2A 5DTIA 5CFQA 4UPVA 4EG6A 1Z5PA 3WHPA 3UT5B 1P39A 3WRXC 1Y81A 3CRW1 3N07A 2P5TB 2X14A 4PSVA 3G6WA 3GFTA 4CTOA 3L1JA 1LPMA 1JAYA 1GITA 5AFSA 2X6TA 2ZPUA 3T0FA 1KRWA 1C2YA 3JYQA 1V11A 1G5RA 1I9GA 3UUFA 4YMTA 1Z17A 1T13A 4HXFB 5CDFA 1J9ZA 4BE9A 4BQEA 3MFYA 1UJMA 4ANFA 1TVCA 5K0ZA 4Z7QB 3ABOB 3LC2O 4FINA 2GEJA 4K46A 1MV5A 3R7DA 1TPZA 5CW1A 3VOAA 1EUDB 1BSVA 1EX7A 1TAQA 3K0HA 3R6LA 5D5PA 2WHYA 3SC6A 2GEVA 1EIZA 4BE7B 3T7CA 2OR3A 1CB7A 3B1FA 3DBRB 5JH7A 4C20A 4HN2A 1ODKA 1KYXA 3LUFA 1ZH6A 2CJWB 3VPXA 4BS9A 3FZGA 1BHSA 3ZWXA 4JU9A 3ZHBA 1NQOA 5BWBA 1EWTA 2OESA 5LKAA 1MOZA 1TCAA 5KS2A 3P0JA 1PL0A 3DLAA 4IX9A 4RVHA 5AKEA 7YASA 4W5TA 3E0XA 4DYDA 3OEHA 1B3BA 3HBFA 2Q2VA 2CBZA 2G17A 2ZCUA 3O3NB 4ICIA 1EBBA 3DZBA 3X1WA 3Q41A 4DLKA 1D7OA 4LDAA 4UXHA 2PKQP 1BDIA 3RK1A 5JZMA 3NM4A 4KN6A 3IUMA 3D3KA 2Q3HA 4L4RA 4HNRA 3LCVB 1H2XA 3AIKA 3TEJA 1SHZA 3PPYA 2W7TA 1WZCA 3EPLA 2VDNB 1R6DA 1XIVA 4G8JA 3KVRA 4RU1A 1DC5A 1WSDA 1CUUA 3QQ5A 3AFMA 4WA7A 4L27A 3O84A 4MZDA 3I28A 4ENQA 3KP1A 4GSYA 4MYTA 2UYHA 2CVHA 5BSKA 5J43A 1RM5A 2Q46A 3LCUA 3CEJA 1KYTA 1OBHA 3HZOA 3S99A 4TTIA 1QQ7A 1UJ5A 4TL8A 3RFFA 1MH9A 3AL0C 1L4BA 4OHYA 1QH8B 2WNIA 3CH6A 3I2YX 3NIWA 1A98A 2CNKA 4FJ1A 3LCCA 3EF1A 1KE1A 4OI0A 4G5HA 1W5SA 3IVGA 1NXSA 3V5NA 2LTAA 5IF3A 4E2YA 3HCDA 5DH9A 5HE8A 3SJAA 2EL7A 3F3SA 5THQA 2VSOA 3LLMA 4D4JA 5DDIP 1VECA 4N5MA 3C3EA 4I1YA 4D5GA 3UB2A 2B4QA 1FUYB 1L7VC 4RPGA 1ZM2A 4ZDJA 4OK3A 4BRZA 4KI7A 2BHLA 2VATA 5ELXA 4WJKB 5M2QA 1Q1BA 1E6EA 2X58A 1N5MA 3JZFA 3VHQA 5JJ5A 5FOXA 3CEPB 1YS2X 3U3XA 2COKA 2ZRMA 2SCUB 1N6NA 3BWEA 3DCYA 2R6DA 2D06A 1G41A 4JUFA 1Z7GA 2WUGA 4HRXA 3TLAA 3S1SA 1DRWA 2P2CA 3VTFA 1JYEA 4WZBA 4I4CA 4EW1A 2OQIA 1YIDA 2I2XB 3OZ7A 2NXJA 2P2SA 2YQ4A 3NKFA 4F1JA 4NECA 1QHYA 1KI6A 3QLVC 3EAGA 3KDAA 5E8RA 5DBHX 2Y0CA 4P92A 3GEGA 3NFRA 1UPCA 1U1CA 3SBDA 4DNPA 3LVQE 1Y7IA 2F8LA 2YKGA 2V3VA 1AHIA 2ILTA 4J03A 1VSBA 3A9VA 1JE0A 2FCAA 2VP6A 5FV7A 3IUEA 4KQIA 1WP9A 2VYCA 2B99A 4XLTA 5KYVA 3GLFA 2ZJ0A 1XD9A 1Y7HA 4WDRA 1BA3A 3C7CB 4EJFA 1N6KA 4Y7CA 3PBKA 1TIBA 5EWMA 4DLWA 1D6JA 1MO5A 2DSNA 5LQSA 5AW6A 3NUZA 3PVZA 2FSGA 2AFHA 3UK7A 4HXEB 4CUKA 1I0LA 3PSAA 4MJLA 5IT5A 4RJTA 5LDHA 2ZAMA 3PC7A 4EKEA 1KU6A 3FRJA 4QXMA 1HE8B 4FFBB 3WB2A 1VJRA 1O89A 2I4OA 3OQHA 2Z6QA 4ZYXA 1JI0A 1E3SA 3WWYA 1K0UA 3G9TA 4XIGS 1LBIA 4UUAA 1PFKA 3AJEA 5E9WA 5AHRA 1RM0A 1Z5GA 2OOKA 4MQLA 3OUTA 4M76B 1EJ2A 3QBEA 2XITA 4LGMA 2BDTA 2DR2A 1U2QA 4JJFA 3RYHB 3RYFB 4PQGA 4I9FA 2QUBA 5EE9A 2O2EA 3VSEA 2HIHA 3AU9A 2FEMA 5DNWA 1KI8A 1QGAA 1UZNA 3A6PC 3O4IA 4O33A 1SRRA 3AIIA 3LHFA 4DA7A 5E4YA 4GQIA 5IHXA 1DCTA 2YY5A 2J3KA 2X0FA 4E4YA 1GNSA 1XNJA 4QVKA 2BKXA 3M9LA 3IHWA 2JGNA 1YQGA 5JSYA 3VO8A 4D3ZA 3TGLA 2JHFA 4JEIA 3DAFA 1JJIA 1FVOA 1WBJB 1WXHA 2YRXA 4OKIA 3LUKA 4TXLA 3WADA 3ZCSA 2Q6VA 1N2OA 3R3VA 3EA0A 2BZ1A 3BREA 2XBLA 1ZN9A 5ECWA 4X6UA 4D8WA 2PSSA 5LSAA 5ALNA 4UTRA 1NLYA 1DJMA 3H11B 4M1OA 4HFRA 4EWLA 3WMWA 2PUTA 1DPGA 1KVUA 3IDSA 2X8WA 3L46A 4HY3A 4TQUS 3FJOA 5H4GA 1YFJA 1QE3A 4HNUA 4JVOA 5FL3A 4D97A 3V4RA 2OORC 3LY9A 4NKRA 3QXGA 4MDYA 5BOSB 5EHQA 1UKBA 2NAFA 3R5FA 3PGJA 3QKTA 1S2NA 1M74A 3EXHB 3ZWVA 4LJ8A 2VPWA 4IGFA 2B4KA 4TRMA 2GNPA 1GGVA 4MROA 3B1JA 2JFBA 3PWKA 4CNQA 2AC2A 1OB2A 3OFNA 1E32A 1T9BA 3LY7A 4MA5A 4OA8A 5K2MA 3IT0A 2H2DA 1IWPB 1ZX1A 1Z6TA 3A10A 3CX3A 2FRDA 5EXPA 5GWXA 5TF0A 3SBXA 3NMUF 1XLVA 3ROKA 1GR1A 3G0HA 1LH0A 3IPAA 4URVR 4Y6GB 1XQ9A 4P3OA 5HEKA 1E79A 1JDSA 1UZMA 5ALEA 2W2KA 1JKIA 4JKOA 3SSMA 2H1SA 2WVAA 3AFHA 3LC0A 4HL6A 3FRHA 5A5EA 1Q7BA 1T36A 2ZI9A 1W6RA 1RYBA 2H1OA 3HJBA 2XI4A 4HUQA 3A3KA 2IS1A 1E3WB 1T5OA 2FMIA 2RGUA 3LWDA 5CJ2A 5HCUA 2ENUA 2HNKA 2RFLA 4GI1A 1WUTA 1ZJ4A 4Q03A 1J5PA 3U60B 4ISBA 1B23P 1N2CB 1YF3A 2PD6A 2IXGA 2ZDQA 3TKLA 5CNJA 1GM5A 3CW8X 3EWIA 1M6NA 4RQAA 3V3TA 4JI0B 1JILA 5KAPA 4CKBB 1OT3A 3K1AB 5JUWA 2XYGA 4FHFA 4JC8A 4OXXA 4KFTA 2B3DA 2DT8A 2VYNA 3VZRA 4UEWA 2BGGA 5A4MS 1FFWA 3K8OE 3SGLA 3EXEB 1HURA 4ZT3A 5BUZA 4QDKA 5HQ3A 4D9IA 3DFZA 3ZR4B 1A1SA 1L7OA 4GP6A 2O14A 4KWEA 5EFOA 1SO8A 2VT7A 4C4XA 5C9ZA 2Q28A 1K8RA 2ZANA 3B1WA 4R2WA 3LA6A 1C3EA 4WQMA 5J23A 3O8QA 3RS4A 2GPJA 3FKQA 1ZZEA 2XYHA 2JIZD 4LMBA 3UMJA 3TLGA 3DVLA 1J2RA 5BO5A 4U8GA 4ENVA 3KNZA 5K3SA 3UV7A 4AJ4A 2IBSA 4BKQA 1AKNA 4U6SA 1W49A 3HV0A 4ENSA 4Y2VA 1CP3A 1OHHA 5D6OA 3ROMA 1EXVA 4CPDA 4MLZA 1SBCA 3OKCA 2GR9A 3SSAA 2OHHA 2WSSA 2XR1A 4UHHA 4WA8A 2R44A 1OIXA 1PK7A 2IL1A 3EZYA 3VJMA 4DUGA 4X65B 3JWEA 2XQKA 1W88A 2ADMA 2O5EA 4V02A 4DMMA 3FVRA 3UW1A 2AHRA 5JPDA 3I9NA 3NZEA 4L2IB 5E1OA 4XM1A 3FNFA 2UUOA 1MHTA 2KS6A 3I2IA 2OPBA 3BC1A 3FD8A 4BLWA 4FOOA 5IX8A 5HOEA 4LWOA 3BWDD 1FMJA 1UINA 3IP7A 4YHBA 1QH0A 3IUJA 4A91A 5FOVA 2UKDA 2FR0A 2C96A 3RS9A 2J9FB 1QNFA 1UK9A 1DEKA 2YIJA 1Z7BA 3D3NA 3D0KA 3GGOA 1A9TA 1DAHA 3OIWA 3QTTA 1TM2A 1DELA 3G0GA 4HDKA 4M9QA 2H5LA 4MV0A 1MC8A 2JHAA 5H8WA 4US2R 2TMGA 2XQIA 2HLHA 3VOTA 4CM1A 4DEYA 1PD0A 3VMMA 4QGSA 1GCAA 1RHMA 4EB6B 3DVSX 3HDTA 2QXTA 4FMCB 2WJZB 4PBTA 2FEAA 3LXRA 4YC7A 4TLMB 1PFQA 4HB0A 4NV1A 4Y2UA 1DDOA 2PRJA 2O2DA 2PO7A 4HNVA 1DX9A 2LIPA 4NYIQ 1XALA 3GLHB 5HJ5A 4BPRA 3OCVA 4P5DA 4A8HA 2GCGA 1QGZA 3PEYA 4BGVA 1KGDA 3EQ8A 3FTQA 5EKTA 2AC4A 3NIBA 2QNRA 3VMFA 1AIPA 1YBMA 2BHRA 1OLSA 2WJPA 2ZBEA 3P9RA 1T1IA 4MUMA 4EJSC 3AR9A 1XJQA 2YWXA 2FQ1A 1I01A 4MMXB 3DV9A 5ALTA 4EHFA 1WAMA 2PJRA 1T4CB 3B2QA 4D3XA 4YWHA 2B1GA 3K2BA 4HG2A 3DYIA 3SQWA 1GRNA 2C7RA 3F9IA 1W59A 4AFNA 2IOQA 3PQ5A 1N8KA 1MXHA 4I3GA 4MYUA 1TLFA 2CNWA 1E94E 2YQZA 4J4HA 4RD3A 4RKYA 2RE8A 3KQKA 3P9YA 5IJ9B 1G7CA 2HQSA 3ZKAA 3MQ2A 4X8HA 3CXUA 5I4IA 3DMHA 3AJ9A 2W93A 3OHSX 2CFTA 3NQ41 5BSTA 2JI6A 3H18A 2V7QA 2F48A 2NZWA 4U2EA 1O9GA 2WIKA 4F84A 2O5CA 3F5SA 5B3KA 4AROA 3VTZA 5JASA 1FVXA 1CJSA 2PMDA 4N3NA 4C3OB 5M7EA 3M4XA 4RAOA 5KI6A 2C98A 4M37A 4RVOA 4V2UA 5CLGA 1YL7A 3SJCA 1L5ZA 2X9QA 2ZWIA 1C14A 3N0XA 4JY7A 4C2BA 3CNEA 4CG3A 3TG8A 1HE1C 4FWIB 2NUPA 4CLXA 3U09A 1BS2A 3TYXA 3DMFA 1S9DA 3A4TA 1TAUA 3AR7A 3I9FA 4RTSA 2B7BA 1X15A 1YRQA 2QN2A 1Z62A 3DKIA 1LW6E 3GCWA 1J0AA 4FNGA 3L07A 4DE5A 2DERA 3TQTA 1T1SA 1JQ5A 1FP4B 4EY3A 1H3EA 4EO7A 4KMSA 1Z0ZA 3AF6A 2DJ5A 2WYIA 2Q41A 2VEOA 5L4NA 4D0GA 2NVUA 3H2HA 4YRQA 1M67A 2UUBB 2E85A 3SXUA 4V1CI 1XNHA 4DNFA 4B3CA 4K05A 2PFSA 1XKLA 1ZY2A 3P9ZA 1RU3A 4FZVA 1JDTA 1P4GA 1GHTA 3VYRB 1P4JA 3BORA 2OQ2A 3H5IA 2P65A 2FEOA 3MLBA 2JLUA 4ZOCA 4N6OA 2FHPA 4GQBA 3OKFA 5B57C 2P2LA 3IIKA 4AKTA 1CRPA 3AINA 3GFGA 3KJGA 4DYHA 2QTLA 1R4MB 2A9QA 2W6QA 3BE6A 5FV4A 4PZAA 3VOBA 5D3QA 4LZOA 2P1DA 1FX1A 1QMPA 2HCTA 3BM5A 1QC5A 2I3ZA 1GKKA 5EJ5A 4NCAA 1BDMA 3K2EA 3RANA 1V1JA 4F11A 4ESEA 1N34B 2IYRA 1JDVA 2A4MA 4MWDA 4MI3A 5HF5A 2EYUA 3V8QA 2I54A 4HGPA 1RI3A 1CNMA 2V1XA 3Q7RA 4MQEA 3X2FA 4AMYA 3QV2A 3GRPA 2ZULA 2O2XA 1THTA 1Q95A 2M98A 1U0BB 1Y82A 4MW2A 2XWSA 4GVPA 4JA2A 4JH0A 1PJAA 1W93A 2OBBA 3ZY2A 4EUFA 1OFGA 5ENVA 1Z4IA 3WDMA 5LFAA 2Q8NA 3GJXC 3EZFA 4HI0E 4NI5A 5IM4A 1L7EA 3VR5D 1C0LA 4P4TA 2BVNA 2CF5A 3LK6A 1YCFA 1F2VA 4LCBA 4FGSA 3H19A 3CNOA 2PS9A 1P4SA 3ILXA 5CRIA 4FK8A 5AJYA 1H6BA 1EH5A 2P27A 4TVKA 1G7TA 4RYDA 1A96A 2G1PA 1F20A 3IOCA 3NX4A 1JSZA 4M7PA 4MPRA 5BRNA 4S35A 3RVPA 1MG0A 2JARA 2I99A 3NUGA 4YCJA 2FZ4A 3V7YA 4AZWA 4BKPA 5LIPA 5FUWA 2Y1OA 3UMYA 1K4KA 2AOUB 4NDZA 1KNXA 3G49A 3HM2A 2FPRA 3N2KB 4K3VA 5CMLA 2GZ3A 4K6CA 5ERYA 4BIIA 4MUNA 1KP9A 4Z5XA 5AIBA 1EVJA 2XKBA 3F3MA 3JVEA 3NRJA 4YAWA 2GESA 1NKTA 2WHPA 2QL6A 3NTUA 4BUZA 5AOAA 3RB8A 4DQLA 3I34X 3UAVA 1SUFA 2CMGA 2V9CA 4CDGA 4PG5A 4UTOA 1NZJA 4EUHA 1OV4A 1UJNA 1U0NA 2XAUA 2NVOA 1QTQA 1BC5A 3PR2B 4MVYA 1AKVA 4BN4A 2QUZA 2GJ4A 4R05A 1Q0PA 3M5DA 2DX7A 2AFIE 2C8VA 4JX8A 2ZSKA 4PGFA 3BIOA 4F6RA 1NJFA 4TMKA 2IOYA 1GT91 1QO0D 3Q9NA 4PYKA 4UOZA 3EW7A 4ZCIA 2ECFA 2YV2A 5D3ZA 3TQRA 3DPUA 1G66A 1X9IA 1R6BX 4OBWA 2YFQA 3EH1A 5EC8A 4QVGA 1YASA 3TEFA 3REQB 3I53A 3C5HA 1GV1A 4G0ZA 4PAQA 3D8NA 3COPA 1YQUA 2OZPA 2Y71A 4JQOA 1AV6A 2O4UX 3JQ9C 3P2EA 4JB3A 3AHCA 2ZBRA 3D7LA 2EC5A 1RLJA 3EQ9A 1Z47A 3CLRD 1RCFA 4PZEA 1MB0A 3KHUA 2R7MA 2XJ9A 3KWMA 4PVCA 2JFGA 3A27A 4KTVE 3JWHA 4D1YA 4D99A 1HXHA 2W2LD 2XZTA 3QPWA 1QV9A 1YVUA 2H2HA 4JUAA 3D1JA 5DGDA 4A8PA 3K6SA 1NMQA 5AKIA 2AF4C 2QVXX 2FDXA 1F9AA 4MNTA 4O4HA 3IAM1 4MKFA 3QJYA 3U81A 1JS1X 1UK8A 4HNSA 4Q21A 4ZQGA 5E6UB 3S40A 1OXUA 1ZD9A 3VX3A 1HOTA 4FIDA 4MWBA 5KYUB 4U7DA 1RI5A 2FP4A 4W8GA 5A4DA 1VG1A 5LQKA 1LNZA 2YOFA 1MRNA 1U9IA 3IA2A 2GYVA 4PICA 3UFXB 4NU6A 2J4CA 5HA5A 1T34A 2CFRA 1AKMA 4KWTA 2IEDA 1LLDA 1XB2A 2BTQB 4XXHA 3I1JA 3UCEA 1VG9B 4KRXA 3WO1A 4A4DA 2IEZA 3CLTD 3L6RA 2VAXA 3H9QA 2VSNA 2PKWA 1UMCA 5DYYA 4B3IA 4PO1A 5FUXA 5EXSA 3D0QA 4II7A 1FTSA 4QEZA 3R7WA 4Z1OA 1OLUB 2AN4A 4G5RA 1WSAA 1X1SA 3ECCA 4B0PA 1OV6A 1QCCA 2DBVO 3FCSB 2XCQA 5KNBH 5LQCA 1EX1A 1U1GA 2AMLA 2C2YA 1EUCB 1QZUA 4KDCA 3NYWA 4QU8A 3R3JA 4F3TA 1T8TA 4AX4A 1X1QA 1RJFA 5KREA 2E5LB 3E03A 3F2VA 1SCJA 1IH8A 4JLKA 4CV1A 3D7NA 3JQ8A 3PFNA 5EHIA 4EFMA 4EG4A 1NXOA 1TTPB 4L08A 5AHOA 3RVNA 3V7UA 5BNIA 1VL8A 1GUBA 4LI0A 4CETA 1RWQA 5JBIA 1X7DA 2PX8A 3OECA 3U7GA 1LDNA 4AZ0B 1TA4A 1LI5A 1HDYA 1N1DA 1YDFA 2ORVA 4YLYA 1VCMA 3PP8A 4B81A 5HJ7A 3VSDA 2ISQA 5H7XA 3EYWA 2CCKA 4UCFA 1NY5A 2GRAA 2LV8A 4H6VA 3CZ4A 1T9AA 2QM3A 5BMVA 3PGXA 4I9NA 1SPBS 2XDQA 4I4LA 3UHOA 5C2JB 3BMNA 3F49S 2WQ6A 1Q6ZA 4BX3A 1EP9A 2JBAA 2FEKA 1H8EA 2PT7A 1QVAA 1XDWA 2G4CA 3F6SA 3KR2A 4BMDA 2DUMA 3S6JA 4XSHA 5TY0A 4C03A 4YJFA 4C4YA 4DA6A 5FF9A 4RQUA 4MLDA 4O2BB 2YMPA 1M6WA 1U2PA 1H42A 3Q0IA 4J16C 4R69A 4ZVTA 5T4BA 3ZDXB 4ECEA 4EY5A 2XCSB 2CF6A 3UPDA 5CCEA 1XXHE 3UA4A 3WAGA 1NP3A 1UMBB 3G89A 3WJAA 2HU8A 4O1IA 3OPMA 5KWEA 3K70B 1JDUA 5FULA 3ZW7A 1I2CA 3LC7O 4IDHA 2H11A 3BF7A 3TAXA 2O8DB 5CHEA 1P0IA 1BCSA 2QENA 1AKRA 3U3OA 1QDUA 1CUWA 1I10A 2CFCA 4M89A 4QBFA 5G4KA 4EJ6A 1E64A 2BSXA 2CHUA 2VDVE 3EE6A 1KP3A 3JYOA 4JZKA 2PX3A 4DR6B 4AYXA 1CDDA 4WNCA 1XL0A 4LBWA 1YRYE 4E32A 3PC8C 4K1XA 2V7WA 1YOVA 2WPDA 4EX7A 3RC8A 3OA0A 1HG1A 1LWOA 1L8QA 2Q07A 2V5VA 1JEOA 2VF5X 1JHUA 3JQQA 2PMBA 3MSXA 4IWXA 5CA0B 1P18A 3UWPA 1I2DA 2PQMA 1ENOA 4TMXA 5DYWA 2AFIA 1R0ZA 2H5JA 2AOTA 1J8YF 1OWLA 4AJ9A 4RKWA 1SXQA 1UBMS 1I7DA 1TUIA 5IW8A 1Q14A 1ZK0A 3SYNA 2QL5A 3U4IA 4DL9A 3RADC 1NVVQ 2B9VA 4X1OA 1A7UA 1E1LA 5T3UA 3MRVA 2H29A 4NULA 3E22B 5DSXA 1C3XA 2I9KA 2IYXA 2X5OA 1HDCA 3GAZA 3JQRA 2XX3A 3H2JA 4M3NA 3ESBA 4OKSA 4GX5A 1MFZA 4I1VA 1SY7A 1CD5A 1Z25A 4XUGB 3D8RA 1JQKA 1NJ8A 3I6ZA 1FYDA 1Q12A 2CLIB 3DXYA 1Y7TA 3Q98A 1KQPA 1T2AA 2X5XA 5CLQA 3ELBA 4JROA 4B46A 3LAWA 2IXFA 1ISPA 1KL7A 3GC6A 1R9GA 2YJNA 3NRBA 4II3A 1FFXB 3AR6A 3DZCA 3C3BA 4JLMA 1QQBA 1D2HA 3KPYA 2CXHA 4PQFA 4TTTS 4Y2YA 1QHEA 5CU7A 4ZVPA 3MB8A 4OMFG 2I6SA 2OUIA 1ZHFA 4Q3EA 3W79A 2H7YA 3CG4A 5A6SB 3ZHRA 1Y1LA 1TJPB 1Z6AA 1I4TD 2C7PA 1Y8ZA 1QFXA 5DYGA 1VHTA 2R6JA 2ONZA 4I46A 4RHTA 2CGEA 3R74A 4WGGA 2JLVA 2X77A 1ZEMA 1RW4A 2INGX 3IP3A 3K5HA 4FCVA 1MJGA 1CUHA 1J4AA 2AG0A 3FCXA 4HUTA 1YJ5A 3SIWA 5A9SA 3IT1A 4IDPA 4NEQA 4Q01A 4JGGA 5G3ZA 4CQMB 2GARA 2P1RA 1OPXA 4PYOA 5TJHA 2OTCA 4ARCA 4C06A 2ZJ8A 3A31A 3WDSA 1X2EA 4TLAA 4PZCA 3DAPA 4MIOA 3HU1A 3KPUA 3SHFA 1QGUB 3OEHD 2PD4A 3VJKA 1USKA 3PWSA 4XWWA 3DGEC 2Q1UA 2HHHB 2HSGA 5EWJB 4KCGA 2GEUA 2Q3BA 2IXDA 3L8EA 1P2FA 3O91A 1V2HE 4OJMX 3RSLA 2CDRA 1WBDA 1XRSB 4B6JA 1ZNQO 5BT9A 1SUBA 2FN7A 1V35A 2OBXA 3CIOA 3HU3A 1PZGA 5BYBA 3W6OA 5K6AC 1NNEA 2XECA 1GN9A 2WYOA 2PZJA 3SNKA 2L18A 1B4DA 2A8YA 3SC2A 1YBFA 5J58A 3QOYA 2FN9A 2V4UA 1RMTA 5TT1A 4KXWA 3PEFA 4QZVA 4CLHA 2ZKIA 3O94A 4QJ3A 3K0CC 1RIIA 3O8BA 1RWMA 4PPFA 4YI3A 5JEEA 1SA0B 1Y7LA 1R00A 2QI9F 3FSRA 2Q5EA 4ZI7A