4UCQA

Structure of the t18d small subunit mutant of d. fructosovorans nife- hydrogenase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECDGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
publication title A threonine stabilizes the NiC and NiR catalytic intermediates of [NiFe]-hydrogenase.
pubmed doi rcsb
source organism Desulfovibrio fructosivorans
molecule tags Oxidoreductase
total genus 82
structure length 262
sequence length 262
chains with identical sequence B, C
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ucqA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ucqA02
5ADUS 1UBOS 4KO2S 5JSYA 1UBJS 1YQ9A 3ZE6A 2WPNA 4UQPA 4URHA 1YQWA 4UD6A 1E3DA 4GD3Q 1FRFS 5JRDS 2FRVA 1CC1S 1WUJS 3CURA 1WUKS 4UE6A 5JSKA 1FRVA 4UCXA 5A4MS 5JSUA 4UEWA 4UD2A 3USES 1UBKS 3H3XA 4KO1S 5JSHA 3ZEAA 4KO4S 1UBHS 4UEQA 3USCS 3ZE8A 1UBRS 1H2AS 3AYZB 3AYXB 4IUBS 1YRQA 1WUHS 3MYRA 4IUCS 4UE2A 4OMFG 1UBLS 3ZE9A 4UE3S 4CI0B 4U9IS 5JT1A 3UQYS 5A4FS 4KL8S 3CUSA 3ZE7A 4C3OB 4UPVA 4KN9S 5A4IS 4KO3S 1UBUS 1UBMS 4UQLA 4UCQA 5D51S 1UBTS 1WUIS 4U9HS 4UCWA 4IUDS 4TTTS 3RGWS 4UPEA 1H2RS 1WULS
chains in the Genus database with same CATH superfamily
3LLCA 2VP2A 1GZHB 2QA5A 3SMQA 1UJ5A 3A58B 1U6IA 4HPXB 2FW0A 1V7CA 4UAVA 1Z17A 1FX1A 2FLKA 1UQRA 4XTCS 4WBSA 1XRMA 3Q3IA 1DBPA 4RSMA 3UW3A 1NXTA 5JCOC 1GFIA 4P0TA 4YCDA 1WR8A 2JHCA 2J9RA 1N4DA 3K5IA 1X8KA 4ENRA 4MRAA 4BZPA 1NW6A 1A98A 4NZOA 3G1UA 5FDFA 3TSYA 4YECA 3DM9B 3E9QA 3P4YA 1JR4A 3QMPA 3QUTA 4P31A 5JCPA 2J30A 1NHWA 2VZ8A 4BLOA 1A9RA 1JIVA 2PUVA 3H5VA 3KKOA 1TDJA 1G7RA 2ZRJA 3ZD6A 2AJTA 4JYBA 2BJWA 3NHRA 3PP8A 5A6VA 5LJIA 2AFHE 4YXWD 1YR1A 3PEVA 2W2XA 3BXEA 4TYQA 5FUYA 5LLTA 1BOOA 4L1KA 8OHMA 2B1RA 3OCYA 2FH5B 3OIVA 3HYTA 2VKTA 3M82A 1LTQA 2WJPA 1UZMA 3KFXA 3RVSA 5BQXA 1FFBA 4Q7JB 3KSAC 2ZSFA 3R5FA 1DKPA 2AMLA 2GYVA 2ACEA 2OB2A 5BYAA 3TX6A 2WI8A 3NBKA 3ZCUA 4XAQA 3FG9A 1N75A 2YTZA 4LECA 3EXEA 2ZWMA 3BMXA 2FDRA 2P0EA 3QY0A 4OYLA 4PLZA 5G0TA 2NU9B 1YBHA 2ZSEA 4DIMA 5BXYA 3PSAA 1HYHA 2BD0A 2BGMA 2PHZA 3FMOB 2Z9BA 1JX6A 1DAFA 3MG9A 3QMWA 4HFRA 4BQOA 1TD9A 2EW1A 3DWEX 3B7PA 1I9GA 1TM5E 2H85A 5EG5A 3SQXA 3ZTWA 3TGWA 4LE0A 4RXUA 1P2VA 4CUKA 4E2ZA 4KXUA 4HAYA 3OKFA 4QXAA 2DPYA 2QD2A 2ZIXA 4GVXA 3HG7A 4PCAA 4Q47A 4D3ZA 4F3YA 5EZYF 1OX4B 2H9YA 4F45A 5DKFA 2WEKA 4ZYTA 2IF0A 2UVDA 2C98A 2V4MA 1TVKB 3BH6A 3EZGA 3Q3EA 5BWNA 1T2CA 3LUAA 5JS7A 3HJCA 4YJFA 4LJSA 4JCCA 9ABPA 1ESZA 1MX9A 1GPKA 3B1XA 3I2FA 3MHTA 4U9IS 3EGDA 3FDJA 1DJQA 3T1YB 5EWMB 1FVFA 3T38A 1V5EA 1B76A 3EZXA 3I1JA 4NH4A 4HDSB 2YCLA 5A71A 1R0BA 2H57A 3E5MA 3PFKA 4PCLA 3D4BA 2JFGA 3FZYA 3ASZA 1IHPA 3DE4X 3H2ZA 3LPDA 3WMGA 1JLMA 2BFCA 4XPZA 3U19A 3KOMA 3OTGA 1JU4A 3FSRA 1ECBA 2TMGA 2W4MA 3D7SA 4Q1DA 1F20A 1GZ5A 1KJQA 1ZCAA 4RY8A 1EUQA 4FYMA 2NZUG 4XVRA 2QUZA 3CLRC 2IHKA 3GJXC 1KP3A 5LUAA 3FCEA 3TJRA 3NBMA 4PFSA 2R68A 2ZVQX 4MWOA 2IYRA 3CSDA 1QB7A 2QD1A 4ENWA 1F2TA 2P30A 1KXZA 4XB1A 5ALGA 3VR5A 4ITRC 2GUWA 2DPXA 3QKSA 4B3DA 3EIFA 3QV1A 1IK4A 1Z35A 2C4UA 3GUZA 4K9NA 2VIIA 1GA6A 1FXSA 3LFHA 1RRPA 4XASA 3HLYA 1CIPA 2D2EA 2WAXA 5K8JB 1NJFA 4IIFA 4WLVA 1OU0A 4CVNA 3ZS8A 3F6PA 2MU1A 1XCGB 4ND2A 4BJ5A 1UMKA 3I09A 4RD4A 5TV2A 4C6TA 3H7AA 3O73A 3MLBA 4G5XA 1E9SA 1KERA 1Q77A 2HOQA 4Q4DA 5DIZA 2I4RA 3A1CA 2FF5A 4DARA 3VA7A 2PX4A 1OVMA 4GI7A 3U6BA 4I8XA 5PGMA 2QVCA 1N5MA 3JQEA 1JH8A 4J0FA 3ZY6A 1ULZA 4M6WA 5B5SA 6ADHA 1TT7A 4YRFA 5KC8A 4MLDA 1VG9B 4CQLB 5A02A 3QNUA 1AM4D 1OF1A 2WTXA 2BSAA 2B7BA 2CHEA 3DXZA 4JR0A 2X0KA 4KKXB 5B58C 2P9FA 4LY0A 4GEKA 3ZHSA 1MRNA 2XRFA 1K6XA 3DBOB 2Q0HA 3PUIA 3UAXA 3VR0A 4LYYA 3MCWA 4HDRB 1CJSA 3M6WA 3MWDA 5DT9A 4YAGA 4G4SP 3IE0A 2JH3A 4YO8A 3MMPA 2EX1A 1JKJA 4TL7A 4D79A 3BIFA 3LY7A 4J0EA 5CVEA 4H4EA 4FEAA 4C1NA 4R8LA 5JSUA 1FMTA 2PS1A 4HDMB 3QHPA 3VYVA 3O4HA 5WRFA 4M7RA 4L3OA 2GRAA 1J7KA 1NLMA 2PWAA 2Q5CA 4RZHA 3EDMA 4KQ9A 4QBHA 1L7XA 3K1TA 4WXPA 5EJ2A 1S01A 3OEEA 4GLOA 2QW8A 1N0HA 4L85A 3RC1A 5CT4A 3WL6A 1HT0A 2P5UA 1Q83A 2VDPB 3JS5A 1BHJA 5K3CA 3IOMA 1TUGA 2AUTA 2WPDD 5G53C 3U26A 3L0IB 5IYZA 3GMIA 1XXHA 4C6RA 5EWJA 3R8CA 3B52X 2A67A 3BMCA 1VLMA 5LQAA 2X8WA 4ZU1X 5DSTA 2A6PA 1UXKA 4DSUA 5JJBA 2H4JA 3QZUA 4H1UA 1VL8A 2EV9A 4A6DA 2BFPA 3W79A 1QHHB 4V2IA 4I5GA 1U28A 2I1QA 3L7LA 1S4MA 1I5RA 2WWGA 2HRRA 4MS1B 4HWTA 2ZYTX 2G1UA 2HHJA 3ZTYA 2VYVD 3TB6A 2EFDB 1J4AA 2CJWA 1BFDA 3LLMA 4Y1FA 5K99A 4H31A 4IFIA 3T7EA 3BMOA 3ZZUA 2XRZA 4D9NA 3FNIA 3IBGA 2JG3A 2UAGA 2H6EA 5EKTA 2NVWA 3QPWA 1ZISA 3MQFA 4JQZA 1U9YA 4TQGA 3D4OA 2M98A 3EXHA 1OT3A 3VH1A 1RLOA 1DB3A 2B99A 2O1EA 2HWXA 3WXMA 2XCIA 4LXGA 2L2QA 3UUFA 2F17A 1O54A 1RYZA 3O38A 3U9SA 4C2AA 5KNCH 2DU8A 2V7BA 2XR1A 5CFNA 1TF5A 3DE2X 2HIGA 4UCFA 5H9VA 3AGPA 2VDJA 1NOJA 2IYUA 4EUEA 1IB0A 4GMGA 1M2OA 4FFRA 3TRKA 2XOKD 4JI5B 1UWVA 1K06A 3L79A 3U81A 4DILA 2Q2VA 2DEUA 1N36B 4PIMA 1KORA 5JS2A 2HR1A 4ZO8A 2HDHA 1Z37A 1IG3A 3PQEA 3T7IA 1HE1C 1QQTA 2JGDB 4TTTS 3CW8X 2XSZD 3LZ6A 2AOTB 2BGWA 1H2ZA 2CJPA 2XLCA 5KX5A 1ML4A 4H3HB 3CF4G 1MJFA 1RJGA 2QSYA 3G2HA 4LWOA 3MMSA 4PCVA 1YZYA 1V1RB 3AEXA 1SBIA 1KYXA 3B1JA 4ESHA 3F1KA 5A05A 3RFCA 5ADUS 2QPOA 3A1VA 3ESAA 1OQAA 1K9SA 3SZ3A 1GA4A 1WXWA 4S12A 1KQFA 1TU0A 1TTTA 3EZ7A 1D4OA 1OILA 3R20A 2HDNB 1OBFO 5HE9A 2OXIA 5FI1B 4NQRA 5IC4A 2XHZA 4LRYA 2ORVA 3CG0A 4XARA 4N82A 4P36A 5AJYA 1Y89A 5C7LO 3DDSA 4E22A 2CHUA 4MS4B 3ZWNA 4Q3OA 2R79A 4A4DA 3AF2A 4AD8A 1N2CE 4M3NA 1IEWA 4R68A 5KYWB 4LKRA 1XNQB 2PWYA 5BWLA 2NVUB 1S3SA 3DSRA 3O4RA 3B1FA 4TV8F 3MELA 4DREA 521PA 3HPQA 1J9GA 2GCPA 2DHCA 1NR5A 3R7WB 1WKBA 3Q9LA 4NSNA 2FWBA 4INJA 2OEPA 1IRXA 2YW2A 3KXLA 2YJ4A 4LZAA 3AVTA 2IYZA 2SBTA 4X1OA 5HJ5A 2HK8A 3QU9A 2QTAA 3L0DA 4NMWA 5ILOA 4K2HA 4RGBA 4J1QA 3DCJA 1XTZA 3CR3C 3LLSA 2F1HA 4FMDF 3AO0B 3UWOA 2C9CA 3G5UA 5A5FA 1E1KA 4KUGA 2N46A 1UDAA 1EYZA 2PX6A 1FSSA 3SZUA 2QP3A 1PGQA 4DMGA 1DFGA 5JNRA 1KZ6A 2JFHA 3JAKA 5FF9A 4O4JA 3WYAA 2C20A 1UM8A 2FEKA 2VK1A 3K94A 4D3XA 2PE5A 2A5JA 2HO5A 2VHQA 3WS7A 5T7BA 3AEZA 2ZI9A 1G8YA 2KLHA 4JXJA 3BGSA 4ZAZA 3ICOA 4FW9A 1BDIA 4EFKA 3OY2A 4A27A 1W5FA 4X63A 5G40A 3R9IA 4ZZ3A 4O1MA 1U63A 3EEOA 3QEBZ 3RBAA 4G5HA 1ESDA 4Z7QB 3MYRA 1NC3A 3EG5A 1S1MA 1UJNA 3DNMA 4PNEA 1VMIA 3AR5A 5AIAA 1T5OA 3PYXA 4ZI2A 1T1IA 4RK4A 4Q5IA 1KEEB 2GSDA 1P8JA 2AV6A 4HB4A 1W1IA 1NSFA 3IIMA 4FN5A 4MA0A 4P84A 5CX1A 3LQRA 3FR7A 1XROA 5BR1A 2ATEA 4G4IA 2I6XA 1PJZA 2ATVA 3F5SA 1HDEA 2XA1A 1KXJA 5K3AA 1ZWLA 1NAHA 3M4NA 4HFMA 1OIWA 2F62A 1GL6A 4EGSA 1CLEA 1MZVA 3KB8A 1EFPA 2C7VA 2ZUSA 4YRTA 1P1FA 3PF9A 3OPNA 5I51A 2X2OA 2E37A 4O4IA 2OAQ1 3GQBA 1I7NA 4D0NA 3VYRB 3MJFA 4MR9B 4YMHA 4HY3A 4KODA 2VBFA 5J23A 4XA8A 3SOZA 1CE8A 2Y92A 4RHCA 5LB4A 2VWHA 4WVFA 5FWNA 5ITSA 1N0WA 1U0TA 1CU1A 1TK3A 3GDHA 4JLMA 1X70A 4WNIA 5EA2A 1R0RE 4IQFA 5EEGA 5GMOA 3SYLA 4YR9A 2G1PA 1J07A 1J1IA 1I6MA 3Q6IA 2VJMB 3AW9A 3EMDA 1NMEA 3K9FC 3V55A 4I81A 3OZ7A 4OU4A 4QXRA 4F4IA 1JUDA 1ZW6A 1TJYA 5FA8A 1VBMA 2WZCA 3KQVA 3QI7A 5B1HA 1UBNA 3ZTTA 2ZRBA 3VC3A 1FFWA 4O02B 3KBBA 3NTUA 2A0FA 4DNFA 3DBIA 1O5TA 2IOFA 3AVVA 2CHFA 3J81k 2H5LA 3SC4A 1V4VA 2WZQA 3ILHA 3MJ4A 5D87A 3WWPA 3D7NA 3OCUA 4L73A 2OHVA 4NE7A 5I45A 1C30A 5CW1A 4FNGA 3ESXA 3IUPA 2J6CA 5PNTA 3PEFA 5K4HA 5CT6A 4CBVA 1LWOA 1ZOIA 3MEQA 3CV3A 4XVQA 3GRCA 3TLAA 4B45A 5A0FA 3H2BA 2KHZA 4F4DA 2PM8A 2UZ1B 4RACA 5EERA 1ULTA 4NJEA 2YY5A 5TB5A 3ZNQA 1E69A 1Z0SA 4KZKA 4QU9A 2H11A 5DEIA 4JAVC 5LBTA 5IDVA 4XFJA 4AKHA 4PR0A 2G36A 3K6KA 4E70A 5DCUA 3B48A 1G7SA 3VQTA 3OJFA 4DMCA 3CRNA 1BEZA 3CNNA 3VTFA 2FW1A 4QBFA 4NCBA 4I1UA 2HBYA 4C2BA 1CY0A 3WK6A 3K9LA 1AY0A 2DKFA 1SD5A 4Q21A 1E1CB 3NR2A 1BKYA 1RYBA 4ZCPA 4CLEA 1GNSA 2LCFA 2XODA 3AHGA 4HQLA 4AJOA 1ZOLA 1NULA 3RQSA 2A3RA 5I9SA 4KE7A 5M3BA 4YUXA 4L5CA 1GSAA 2A3NA 4H7HA 4MV6A 5C8XA 1RZRA 2MINA 2AZ4A 1UK6A 3E9DA 3JQBA 4XIIA 3WBKA 4RVDA 4H6VA 4X1IB 1BYUA 4CG2A 4EQZA 1CLUA 1BHSA 1O96B 2V9ZA 2F67A 3DL7A 2I2FA 3HLKA 2ILVA 2V96A 1V2HE 2YFQA 4NBSA 4CW7A 3MRVA 2FEXA 3TI9A 4EI9A 1M34E 4C0JA 2ZTVA 4IOMA 1D0VA 3PFWO 3QELA 5BSWA 2G25A 3DE5X 2YY6A 5CPBA 1IN4A 1G3UA 5FTLA 1WMSA 1R3DA 2ZE6A 1KIAA 3K0CA 5EIWA 1U3UA 1SCDA 2B4YA 2CDBA 3D8NA 3EQ8A 4EMTA 1LNSA 1RQPA 2XMGA 2XT0A 4AN0A 4PSAA 4QBGB 5G4LA 3C2QA 1VKNA 2ZU6A 1WPRA 1L5ZA 2X0EA 3RG8A 4ETMA 1QRUA 4MJXA 4EKGA 2Q8PA 4IR7A 1CFZA 3KJXA 3DOIA 4W7SA 3WGIA 1YL6A 4IV0A 4KQWA 2HQ1A 1MXHA 1ZITA 4L8LA 1K27A 3FSGA 2XDWA 1U8TA 4BLWA 1EZZA 3WKAA 2DOKA 1DIBA 4FFWA 3VVCA 1QF6A 2Q5EA 2CY0A 1XDDA 4O4LB 4AMBA 3BD7A 4EEKA 2CJFA 4OPMA 3VVLA 2VDVE 1JDVA 3QLEA 4KN9S 1D4FA 4QZVA 4HH3C 3HCPA 2NW6A 1IAQA 2HJWA 4RA6B 2O20A 2XVXA 5IM4A 1T3LA 3TYXA 2D0DA 3ZE2B 1D3AA 3I37X 3TTYA 1E7SA 2P79A 1EMDA 2O8FA 3ET5A 4G01B 3P20A 4NENB 2OYCA 3DZHA 3FOWA 4AZ3A 4DBVO 5MDHA 3T1NA 4ZVKA 1TK2A 2ZR9A 1G17A 2A92A 4MI9A 1C7FA 2JGIA 1DKRA 1U7HA 2NYUA 5JW6A 1I1OA 1CUAA 1SQ5A 1TM1E 2V45A 4IJKA 1XKLA 4AJ2A 5AJXA 5LD2B 1SVIA 2B5OA 3W5SA 1YQQA 4HWGA 2DT8A 4UHKA 3AEQB 4HHEA 4MO9A 3TEMA 3FVWA 3DYIA 5KWJA 1H42A 1Q22A 1OMOA 4MTLA 3M6IA 4Q7EA 1BZYA 3AKYA 2GXUA 1S2IA 3HYCA 3L02A 3PHCA 4UZEA 3I6IA 3SE0A 1VFPA 3ZQJA 3U1TA 1ZUIA 1RQRA 3NWPA 5GM1A 1E9CA 1FRQA 4AN4A 2G9RA 3LK7A 4OQXA 3H0KA 3OY7A 3KTFA 4AWAA 3MB5A 4AY5A 3UKOA 2Q5HA 5EI5A 3H0EA 4JR2A 1FA9A 1QG4A 4OLFA 5L3QA 4B3RB 1HPLA 5JALA 2BJHA 2QZ4A 2EJWA 4EHHA 4EELA 2ONJA 3G2KA 1QPBA 1VHLA 3T3EA 4B6QA 4EMBA 1YKSA 5F9FA 2C2HA 2CFTA 1ZP6A 5G1NA 3K0AB 3RAFC 1JG7A 3OA2A 3C4QA 2E48A 2ODTX 2E4ZA 1JW9B 4RK0A 5HF6A 1B0AA 1DJPA 1Z6AA 2H1RA 4G4JA 4B7ZA 5J4LA 3R0JA 2O2EA 2VYCA 3P9RA 4PLHA 4UCXA 1KR5A 2VLBA 1J2RA 3ONEA 2CWDA 3GRYA 3PQ7A 1NF2A 2ZDQA 1C8LA 3FNHA 4W5JA 3UY4A 4F60A 4B75A 2YS6A 9GPBA 1KP2A 3ORHA 3ANMA 4FSXA 8LDHA 2LNDA 4MLPA 1XQWA 2GEVA 2XMZA 3ZX5A 2F9FA 2O59A 3L7AA 4G0WA 1HK7A 3IS3A 4JGGA 5BSRA 5C52B 2ZJFA 5C80A 2YBEA 2C2BA 2X14A 3R5TA 1F38A 3N2IA 2WR8A 4LHZA 3S8MA 3SYTA 1NVUQ 2D1FA 2K4MA 4PYRA 5LFAA 4OXQA 4EMSA 4Z3OA 3GLQA 4LBYA 1YR9A 5T6MA 1ZK0A 4AZTA 1KEUA 3DUFA 1D6SA 4Z5XA 1DEOA 1P0QA 2CFIA 4IXMA 4FN4A 3ODGA 3UFBA 5JUWA 4HFNA 4MB6A 3QVGB 1Z0FA 4QTXA 4KYIB 3VR6A 3EVCA 3QMVA 1SR8A 3TQHA 1HMPA 1QB8A 4ZJZA 4X1KA 5B7NA 9ATCA 4D26A 1K7FB 4UBJA 1D0SA 3ETNA 2XB6A 5A1JA 2JGFA 5A4AA 5JXWA 1M34A 1LDEA 2AJDA 3OX4A 4Q93A 5GJWC 2FFRA 3CINA 3LZCA 2DWQA 5CBPA 1LK0A 1RD4A 3E8SA 3QJGA 4KAAA 1GCGA 5BSMA 5ALNA 5JYDA 2Q1WA 2HCFA 3OZGA 3SJUA 2DGDA 5C5EA 2IVFA 3B3QA 3M7IA 2B3TA 2WVGA 4WCFC 2GKSA 4QFBA 4UNNA 1JJBA 3TAXA 3CIOA 2UUBB 1QK5A 5AI4A 2OVFA 5B6JA 1F7VA 1HH4A 1CJMA 1VI6A 2O8EB 2ZG6A 2EGHA 3WIBA 4M7WA 3GMDA 4F7WA 4TSRA 3C5VA 1ID1A 1T2DA 3QLUC 1P73A 3WY9A 1HE8B 4R01A 1JR3A 4DG5A 2H8GA 5KAMA 3BFKA 1V4BA 1V45E 3IALA 5E1OA 1SA0B 2Y68A 5EJFA 3F7MA 4F4FA 3AJ9A 2P8JA 4HG2A 2GEUA 2VO1A 4WADA 2A0KA 1Q19A 2Y67A 2QAIA 1Z4LA 3QU2A 4PO9A 5LQRA 1P7PA 1EVEA 1X2BA 1Z6TA 4HO1X 5L7TA 3LIPA 3UV6A 1P0FA 1UADA 2X2EA 4YMLA 1Z36A 1OGIA 1V8ZA 3FX2A 4GMDA 4KO8A 4CMBA 1JFTA 5ELLA 1RBMA 4B17A 3HO1A 2O6HA 2VQSA 4WKCA 1G5IA 2EFYA 5F2OA 2POCA 4C1BA 1AV6A 3PFNA 2R8XA 2DFDA 4FFLA 4Y0NA 5E1BA 3S3TA 2CNWA 2AN9A 1OWPA 2C84A 2NPOA 2Y4OA 1DC8A 3HN2A 3B6KA 4WCDA 4ZAWA 3JZMA 3GAAA 1DRKA 2ZK7A 4KRXA 3GLTA 1OI3A 4D4MA 1ISGA 3AILA 6AT1A 1WX1A 3KE8A 4OCZA 1PS0A 3MLAA 3NWBA 3OLYA 4KGDA 2R44A 3CJQA 1QVAA 2PO5A 3ZDEA 4F56A 3QUSA 4RZQA 3LTNC 2VTBA 2WT8A 3WGZA 2B8NA 2P9HA 1DZ3A 5JO9A 2ZWIA 4B4VA 3IP1A 3PFFA 1CF9A 4IP0A 1Q92A 3BWEA 4ALJA 1VDMA 4RJTA 5IT0A 4JXZA 1Z6PA 4J90A 5CLJA 3DMHA 3QKUA 3T9AA 3R9XA 5IWAB 2GBLC 4EPTA 1WF3A 1NW9B 3DWIA 4MP3A 4PX5A 3MJSA 4PSCA 4IRUB 3E03A 5LNK1 1JLKA 3OCXA 3SI7A 4JIMA 4IZIA 5LJLA 1HE2A 1HNXB 4JSTA 3LLUA 3JW8A 4XYLA 1V37A 4FMBB 1I3NA 1N6IA 3DT9A 1DOZA 3EEBA 1OZ0A 1ZMTA 1M5TA 2FZKA 2J87A 2MYNA 5TQJA 5LYJF 3ZS9A 4EHBA 3IB3A 3L8ZA 4GE3A 1DPFA 1YQGA 2Q6LA 1Y8CA 2X8AA 2OGSA 1CDEA 3IIEA 1GFWA 1WF6A 3R9KA 3AKCA 3DWGA 2ETVA 3NLLA 1PDWA 4LQCA 4GXQA 2ZIGA 2QG9A 3V1LA 2WTBA 3HFRA 3W2EA 1Z4KA 2R8YA 3UMVA 4RTJA 3D3WA 1E59A 2GZSA 3O4JA 4AROA 1M1NA 1G1MA 2Q1TA 4LX0A 2O54A 4CTNA 1GV0A 2AFIA 3AR9A 4KPFC 2V98A 2Z2ZA 4LHVA 1F6WA 3IE2A 4UHHA 1TW2A 4ME6A 3G8YA 1XHLA 3IQHX 4MHTA 1MENA 1JHYA 1ORDA 2HNKA 2JJQA 2TMYA 1FNSA 4KOAA 4TXLA 3VH3A 3S99A 1C7ZA 1DUVG 1E58A 1SXGA 2OYSA 2XMBA 5LC1A 4A03A 3HGQA 3ECSA 1ZY2A 3LCCA 3OIGA 1F8FA 3DAFA 3HXKA 1U8YA 4P5DA 5AQ1A 1PJAA 1E6MA 5JT1A 3AY3A 4GVPA 3QG5A 4TVOA 4OXKA 1QIMA 5ES4B 5E3IA 5AJUA 4CLOB 2A5GA 2VSYA 3AXSA 4EZIA 1VPVA 2X2FA 1KI1A 2YNMD 2CDCA 1SHLA 2CBGA 1TZJA 3R75A 4BFSA 3AJDA 3HZOA 2CDAA 2D0OB 4HUQA 1ISFA 3IEMA 1YZFA 4Z8XA 1IHUA 3CFYA 4JT9A 3JPYA 1QHGA 4NOMA 3L5KA 3P5BA 4ARSA 4RPGA 3SJZA 3T9EA 5F5LA 2I8LA 1FLVA 3A6ZA 3C7DB 3WRYA 5D3KA 1TD1A 1TL7C 2IA5A 2ZUDA 1PL7A 1G9SA 1YAJA 1KZ1A 3HM2A 4KXXA 2FVYA 3NVAA 2W2LA 4QICA 3ECCA 3ES9A 1YI8A 5FOTA 1PVDA 2CNBA 1T9BA 2HHHB 2ZRFA 5DM4A 4KXFB 1KMMA 2C95A 3EXG2 3D0QA 2WBLC 1CW2B 4PXAA 2XNSA 4J16C 1EVLA 1NF3A 3VUFA 3FUWA 2QL5A 4H6PA 3CWZA 4KE8A 3CY6A 1QRRA 3ELWA 4H77A 2Q2QA 2XAAA 4DNQA 2X0NA 3IAS6 2FZWA 5DI3B 3F7TA 4P3PA 4XEHA 1HZZA 4XOUA 5IJ9B 1FQKA 3G9QA 2CUTA 4S1TA 3PZBA 4ZOEA 5LIPA 3AVXA 4XZ3A 3IP8A 4FC6A 1HTWA 3CLVA 1YDEA 2FN4A 3TQIA 2GJ9A 1ZX1A 3FPHA 1YB6A 2PTGA 3NEPX 4KWEA 4YWHA 1V5IA 3KZOA 1OW3B 4PIVA 2QBYB 2OGZA 4G84A 3X2SA 2Y2UA 1NNSA 1CB0A 1VQ1A 1G0NA 4TQUS 1NKSA 4M0EA 5KJEA 3TTUA 1GQSA 3O9ZA 4I4TA 3DOOA 1GU0A 4INAA 3IUJA 5G1OA 4BNDB 2MSLA 3FPSA 4WW0A 2GYWA 4CHTA 1Q1QA 1SIBE 4DCJA 5JAHA 1GPBA 2ID7A 1EK1A 1WHTA 2QRPA 3PNVA 4F86A 2YICA 4DF3A 4HNHA 1VSVA 3V5NA 5JATA 2CD9A 2QXYA 2ZYGA 4DNXA 4EPVA 5DCYA 1HOXA 5J5VA 5CCXA 4OBWA 5IKXA 3H9BA 3H2YA 3E15A 1GKLA 3P0JA 1Q5PA 1XWFA 4YMSA 2X6RA 3OPVA 4MIYA 4C0KA 2BMDA 3VGPA 4EDFA 1CT9A 5J59A 5IJ9A 2NU6A 2GJSA 1UMDA 1BX0A 5EXDA 3BWXA 3X3HA 4MWDA 2CBZA 1JDSA 2BAGA 1QZ3A 1V71A 1ZH8A 2Q8NA 2ZDHA 3H8WA 2RG7A 3O74A 1BJKA 1Y5MA 2VUUA 3HU2A 4LXUA 4X7MA 1IBMB 2PSDA 2JAUA 2BFAA 1KO7A 1NBHA 4KOEC 4I1IA 4I50A 5DXFA 2V6JA 2DH5A 2PRJA 2FQ1A 2JKYA 4IEFB 1FDWA 3TR5A 4AVYA 5FAKA 5JI3E 5AVJA 3H5NA 1Z7YA 1DHTA 1WXHA 2I3DA 3CEAA 4YA6A 2C4TA 2GB4A 1PR4A 2ZB2A 3Q2KA 3VDXA 4YROA 3WP1B 3U49A 1E6EA 3SG0A 2V7QA 3NYRA 2IHJA 4R5HA 4HQFA 4S24A 3QF4A 1U3DA 2B98A 3IJRA 4B2YA 4ZT3A 4WSOA 4FPXA 2QMOA 2Y1GA 2V1UA 5JCXA 5COQA 2GPSA 3GFGA 3FYCA 3SR0A 1M83A 5DH9A 1VMKA 2VLIA 4V0OA 1QX3A 1RRFA 4CL8A 3I04M 2ORYA 1N25A 5FOVA 5JE8A 5LQJA 1E62A 3OT5A 4QBKA 4QXOA 2ACKA 5ALTA 3JVUA 4DEYA 4M1TA 1FPQA 1NN3A 1OA1A 1PUXA 2X13A 4HEA1 4IJMA 5I4BA 3IT0A 4QDJA 2R3SA 3JYNA 5DBIA 2EFEB 1ZIXA 2HH9A 3UA3A 4ZEMA 1GXSA 4MTCA 5HQTA 3VISA 1GFZA 3GWGA 2JIQA 4GIBA 4U3JB 2G5TA 1SRQA 4R3UC 4V38A 1AHNA 1E1MA 3OKCA 2VWGA 4G4SO 5FA5A 3BD9A 3MWJA 5IHXA 4WBNA 3RI3A 2O3RA 2N0SA 3EVDA 2OQIA 3MCZA 3PKZA 4OHUA 1UJ6A 3TIGA 2OOKA 1E7RA 2QTWB 2ZYWX 4M89A 4UHJA 3U7EB 4B79A 3UPUA 1QP7A 1HE5A 4XGQA 1FLDA 2QP4A 2GM9A 3MUEA 1WSDA 3SHTA 1G42A 3K8OE 2XZDA 4FFSA 1AS3A 2JLXA 3SXUB 1VI5A 1C4XA 2G9ZA 2ZRQA 3N2YA 2ZS7A 4ZGBA 5I7SA 1EM8A 2XB8A 4KDFA 5BRJA 4LJ4A 1W0KD 1PSZA 4ZI5A 3LHDA 1OREA 4HNVA 2CT8A 4CWAA 1MVNA 2CCJA 3CPEA 2F55A 1QGUA 2BGLA 3ETLA 2C9BA 1G63A 3QKRB 1MW8X 3KR9A 5D84A 3U2QA 4NH0A 4QE3A 5LMZA 2PZGA 1XAHA 2OUIA 3GRUA 4IX9A 4EB0A 1IBKB 1ZJ6A 3DBLB 4AY3A 4PIPA 5DW0A 2XWSA 3PJFA 4A7PA 1TX4B 4W5RA 1NFRA 4OEHA 5B4TA 1NNEA 5KYUA 3AEUA 1E66A 1U4OA 3DT8A 4MPPA 1Y6QA 3DV2A 2Q5OA 1Z8FA 1XK6A 4D57A 2WG1A 3AP1A 1NV8A 1TF2A 1X8JA 1XHFA 2G04A 2OD9A 3A1UA 1T1GA 2MIIA 3DMNA 4IIXA 4O29A 3V42A 3HO6A 3VBEA 4AJ9A 4MW4A 1R0SA 5BR8B 5EZ6B 1W4LA 4CF3A 4NBNA 1M5UA 1ONSA 1VLLA 2NXNA 4RA9A 2K2WA 2GBLA 4TKUA 5MGNA 1U98A 3C74A 1ATIA 1P3JA 3LUCA 4LNUA 3OX1A 3SQOA 2R00C 3DONA 3GJYA 3UOGA 1OLSA 5DASA 4C04A 2V4ZA 3Q7QA 4R1UA 3SYKA 2OXEA 3GUHA 5KQSA 3AI7A 1IMOA 1Y8RA 3O6VA 5CD1A 1ADGA 4E5PA 1WUKS 5H81A 3H11B 4WUTA 3RIGA 2Z2JA 4G0PA 3G13A 4UM9B 4OMUA 1T0JB 3WO0A 1I6KA 3AUSA 1CUEA 1A7UA 1M10A 3GAFA 2VZ9A 2AEEA 2BFEB 4OQZA 4Q3LA 4ZT5A 1YR2A 4NYJQ 1MB3A 5FWYA 3RRBA 4ENTA 1JTEA 1U1FA 2B1GA 4BC0A 2ADOA 3ZKWB 2Q1SA 2WUWE 2ZSJA 4RC9A 1GQFA 4UHCA 3VAZA 5C35A 4HQOA 3A1WA 3NO4A 1Z4NA 1N9GB 3PD1A 1CRQA 1RE1A 3LP5A 1UOPA 3NQ41 5EWLA 3GUUA 4V0SA 4TTSA 2LPMA 3CX6A 2V5VA 1RYNA 4BVHA 121PA 4C0HA 2XIJA 3W90A 5B3AA 3P2MA 3L4EA 1S2MA 2DPMA 3QRWA 1XYYA 4ZK2A 3DE3X 2J3QA 5AVRA 3ROQA 1WE2A 1ZRHA 3WNDA 4QAQA 4JIGA 4BVJA 2DPHA 1C7RA 2DFTA 3ELBA 3FF1A 4RZSA 2W48A 3QE4A 4Z1OA 1BMTA 2CE2X 3RUPA 3Q5DA 3RU3A 2QT9A 4DLKA 3FN4A 5KOHA 4DDVA 3HFSA 2QTCA 1G3RA 4RY0A 1XZCA 3BWYA 2PS9A 1JEAA 4GG1A 3ABRB 3PX7A 2GD0A 1T1JA 1KH1A 3N7AA 1MO2A 1WCYA 4PF1A 2EWVA 4BEVA 2H1LA 1DDGA 1K6MA 4DZZA 1AUQA 4IO1A 1XKXA 4PONA 4TUYB 4XR4A 2IHUA 3S40A 4EFLA 1U0BB 1Q0QA 3S5JA 4DXAA 5LQMA 1NVFA 2WUGA 4OTZA 5BUZA 4G85A 1X7XB 3EGCA 4KXLA 5ALYA 4H0FA 1SU4A 2Z8YA 3SWWA 5REQA 4ZPXA 3REFA 1L5FA 3DO6A 4CM1A 5B7PA 1AQIA 4XOIA 5I4KA 4MI1A 3CE9A 5F5NA 3HI4A 1H0KA 3OWHA 3N0VA 2VCEA 1DG1G 1AS0A 2VHEA 3DEFA 3Q15C 4HWKA 4J8PA 2OHHA 1UBFA 4NU6A 1V4NA 4L08A 4BLPA 1TEXA 3IHLA 4X3PA 5B2EA 5K5EA 4UXJA 1XV5A 3HBAA 2RHHA 3N75A 4XX0B 3S27A 4DABA 2XX3A 2G8LA 1G5QA 1GDDA 2XQFA 1KOJA 4WASA 3RTAA 1LSUA 2A4KA 4MB0A 4OKIA 1IQRA 1B26A 1BJRE 3AOGA 4JL5A 5FOSA 2AHRA 4QM6A 2ZP1A 5DFAA 4RZUA 3AFMA 2JHPA 3AFNA 3ELDA 1QCYA 4U0JA 3QBDA 4WECA 2HCRA 3U6KA 4J03A 3TQCA 1ZU4A 4MGIR 2JS7A 3EC1A 2QRZA 2XUKA 4LUCA 1JBEA 1ZNYA 4HV4A 2P6UA 1Q7BA 3O8LA 3DD5A 4EI2A 5BSVA 2CVOA 3LHSA 5IEJA 4DAEA 2GN9A 2I7VA 4RMHA 5DMXA 4BNKA 4CG3A 1P4SA 3Q98A 1EESA 3LKVA 3FTFA 1WABA 2EZ8A 3P2JA 1Z56C 4NFSA 3VNQA 2CWWA 1C3EA 4RD3A 3MTAA 1DBQA 2P2SA 3WIEA 1FUEA 1SZCA 3HY6A 2QAJA 3I1FA 4IOLA 4JP2A 3TW8B 1EGHA 1SKUA 2CKDA 2D7JA 2HU7A 3QI2A 3AFHA 2ZBPA 1E1QD 3HEBA 1GAQA 4FXPA 1YUNA 1HM5A 1WUJS 4E09A 1K7SN 2WG0A 2YMQA 1ND6A 4HNAB 3HUTA 1FUUA 4OXNA 3FHTA 3H0CA 4EUNA 2DFPA 2ZBRA 5CR9A 1R5OA 2W6JD 3E18A 3DOHA 2VDUE 4B44A 1KZYC 4QJ4A 2CE7A 1GRCA 4E1AA 1UDBA 4HGPA 4NICA 2CYAA 1IBCA 1FK8A 4INOA 2O5CA 3VI4B 1OYVA 4W4TA 2IP2A 5JECA 1U8CB 2C78A 2JGAA 2A9FA 4GPZA 4KO4S 4MRRA 4X97A 1RXWA 1L4NA 2V74B 3BTSA 2IZ0A 4GOOD 3OQIA 1WPQA 4JLJA 2AG0A 2COUA 2E7ZA 2GN6A 3LAWA 4UEKA 1ONBA 4JVSB 1HG1A 1QG0A 3D1VA 3WZMA 3VRHA 3AYZB 1FMLA 3BCSA 4M83A 4C87A 5M2QA 4NS4A 4B4UA 3VXKA 3RU2A 2QK4A 3MPUA 4R9UC 1O2DA 2O4CA 1CZUA 2OV4A 2XNCA 3QOXA 4XE5A 3T3OA 2AX4A 2F2TA 2NQ8A 2QY9A 2Y77A 3DGFC 4NBVA 2NXJA 3INYA 3DXXA 1CS0A 3IQDB 1RPNA 1JN0A 5D5HA 5A4KA 1QGDA 3M6MD 3MN1A 4L28A 3DB2A 2CL5A 3BSSA 1XZ8A 1HX7A 2IDKA 1CK4A 2ISQA 3IT1A 221PA 3J81A 1N5OX 4DLNA 3ABSB 3G49A 4QYXA 4JB8A 1JEDA 4Q66C 3ZEIA 5HJEA 4MKGA 3E3LA 1H6CA 2QGZA 4RIFA 4IDDA 4EUFA 4JLOA 5FUMA 1T26A 2V59A 3G82C 2FRDA 2QYOA 1FNNA 1QAOA 4B87A 1A8IA 1T2EA 3ILYA 2ZWAA 3HA2A 4RLFA 3IILA 4MQEA 4K9PA 2QMYA 5KYYB 3K71B 3GN2A 4G26A 1GZ7A 3EUWA 4FJ0A 4ZVVA 3AHIA 5BT9A 2IXFA 1A9YA 2BGIA 4LI3X 1RNLA 1EP9A 7GPBA 1GL3A 4PFJA 3ZIDA 4H08A 2WUDA 4IGFA 1V25A 2DT5A 4FGKA 5EFZA 3UQZA 1I8TA 3ELYA 5LQDA 1KEKA 1Y8AA 3V1YA 3E35A 4Y18A 3FOAA 1PK9A 5JAZA 2ZIWB 4GQBA 2QROA 5I01A 4QGGA 5FTNA 3QVJA 3MWEA 1DSSG 3ZWAA 1M7GA 1IBLB 1G21A 3LECA 4RL6A 3IAXA 4BO0A 1EFUA 2JLUA 3A70A 2I7CA 5HTKA 3L6BA 1JFLA 3IOEA 1LY1A 3ZHRA 4FP9A 3GH1A 2BP7B 4JV5B 2E6UX 4QSMA 2GD6A 3R6GA 5K0SA 5T4EA 1WDLA 4XSGA 4Q12A 2VA8A 2V6GA 4LJKA 5H83A 3OF3A 1QF9A 3KQQA 5CNMA 1OFUX 4BC1A 4C0AC 2AZXA 1UZNA 4QFMA 5DTEA 2C04A 4BCCA 3RJ9A 4JENA 4NV0A 4YCAA 3TL3A 3ZG6A 2IYFA 2GK6A 4HT3B 3PFHA 1TF7A 1JB1A 1SY7A 3DL0A 1BWQA 1JBQA 3REOA 3U7QB 3FUUA 4DL9A 1VE1A 1DBRA 1TLFA 1QRDA 3Q5GA 3BK2A 3CXUA 2GCOA 1F4LA 4IIUA 4JBLA 2PLRA 1P44A 2VTDA 4WOKA 4DQLA 4EA9A 3DCNA 2XMPA 2C7PA 4BP3A 3ZLJA 1NUAA 2I78A 2X9LA 2Q46A 3AL2A 3DR5A 4PBRA 2DYKA 2ICAA 2XGOA 4FFNA 3RROA 2NADA 1NYTA 1PL8A 1YBFA 5ITVA 1JQBA 5I8PA 4IUYA 4II7A 4WE3A 5LXTF 3WL3A 4ISBA 1I7DA 3LSTA 1E2NA 5C18A 3R7FA 3HVKA 5ICMA 3QFRA 2FR8A 4MARA 1SZPA 2OBMA 2BR5A 2PLAA 5CCEA 1EUCB 5IKPA 1XJ0A 2PZFA 4F96A 1YBMA 3GEBA 3RANA 2V7WA 1GD1O 1RWPA 4FHEA 4QDXA 1GZDA 3AY0A 3ZE8A 4DQDA 1U4NA 5BPFA 3OZVA 4IYJA 1B6TA 2ZR7A 4XYBA 1R00A 2OAEA 3IDSA 3VR3D 1JP7A 4R7TA 2J5RA 2Y8EA 3VHRA 3UM9A 4YJHB 3LSYA 3KYDB 1XA3A 1SG0A 3TIXB 3GMTA 2YHIA 4X6LA 3R8XA 2QVGA 2VHTA 4KQKA 4I36A 4HAZA 4ZU3A 2OV1A 1CVRA 1XD2B 4IHJA 4PICA 3D6AA 4RSHA 3ETEA 1DC6A 4JN6B 1YNSA 1R66A 4GBED 2O7SA 4DADA 4CKWA 1K9VF 2OT3B 2HQBA 3AFOA 3RS8A 2APJA 2W2KA 4BBZA 1MHTA 3T4EA 4OJKA 3OLCX 3UMSA 2ZTUA 2VHCA 2X6TA 3WGLA 4MVJI 5HWSA 2PTHA 3CLUD 3G23A 3I45A 1OIXA 3ZDCA 3T06B 3KLOA 3QVOA 3V2HA 5KDOA 1RYFA 4U1RA 3E27A 3ZE7A 5A0TA 5C8YA 5A3JA 2J9YB 3DDZX 2GDZA 2WTEA 2POQX 4ED9A 3IQWA 3UENA 2C8VA 3FNRA 4WNAA 4DKJA 1US8B 1NVMB 1YGPA 2AC7A 4TWIA 2XB2A 5I7AA 5T64A 1O6BA 1Z8DA 1VKHA 1XUOA 2GAOA 2RBGA 2G7ZA 4IF4A 1M7BA 4Z0NA 3QH4A 3F6SA 4RV4A 5GOTA 1X8LA 1KI3A 3BMNA 3R0ZA 1N6OA 4PG6A 4X3OA 4BQPA 4XIFA 3BZUA 3OCJA 4KTTE 4A2PA 2P9GA 4N65A 1SXJD 2PCJA 5DWDA 4PQRA 5EIFA 5SYMA 1DIOB 3HVHA 4UW9A 1WLSA 2NM0A 3GUVA 1L5QA 1S2OA 5AK4A 4B3BA 3NCTA 1K8XB 1TM2A 2IIBA 2QMHA 2WD8A 1RRKA 3BTVA 3BCRA 3B70A 1L5KA 4F11A 4FZRA 3BJRA 3VR5H 1U1DA 4B3GA 3GW8A 5BT8A 2J85A 1NQVA 2EWWA 1Y33E 5GV8A 1T29A 1IZ7A 1R64A 2OO5C 2JFOA 3P71T 1IM2A 3NUQA 1S3IA 5JWRA 2JDID 3PCRB 5CYFA 1OWOA 4FFBB 3A4NA 5FWXB 1E20A 1SCQA 2I29A 3QE0A 3DWFA 3KJFA 4LBWA 3NOQA 5DK4A 4C4AA 1VL0A 2ZCJA 5HBGA 1WCV1 5TPWA 4MQ6A 3K16A 1RWMA 2XF2A 1PR3A 3G0BA 3NP9A 3DM5A 3KPUA 1TJ4A 4P4SB 1BH6A 5HCNA 4DR1B 2G1JA 4PPQA 5AXDA 3BEOA 3T5GA 4TWBA 2YWCA 3OO0A 4CKEB 1Y9JA 2H3EA 4JBGA 2C0CA 1TZ2A 4D5GA 1GUFA 3M3HA 4EMUA 4F1WA 2C9ZA 3OA0A 5A9SB 1RM5A 3KVVA 3Q12A 4Z3DA 1TAHA 1Z06A 4V03A 2X5JO 2GXQA 4Y2QA 2G08A 4A0RA 4BVKA 4OYRA 2LUOA 1U0NA 3CUWA 2PX0A 3IOCA 4IXWA 2FEMA 4LHYA 4RFVA 4UUAA 5DHPA 4A0SA 1F51E 5BQPA 3P9KA 3WAJA 4EUSA 4JASB 1KKMA 4MIEA 2AR0A 2YNMC 5IX8A 4MVYA 4WY2A 1I2ZA 1BQEA 1WJGA 2NXEA 2R1ZA 3F5MA 1EUDB 3P52A 4ZOBA 5LCXA 1L1FA 3WK9A 4G0UA 3IV9A 3Q2OA 4JKOA 3RVOA 1KS9A 5F64A 3NHYA 4CL2A 1PNTA 2J0UB 4YJGB 3ADDA 4YP6A 3N0TA 2YZ2A 4P92A 4YGYA 3K1AA 5B3JC 2HSDA 3E7WA 3E5HA 1T2UA 4RPHA 3DTVB 4B46A 3LCJA 4DV4B 5CFPA 1OX6A 3A4IA 1FVOA 3Q8WA 2PUEA 1OLXA 2DFLA 5K8IA 4YLEA 1AGXA 3H2IA 4POAA 2CCGA 1G20A 1QX4A 2DY0A 3LPAA 3Q3HA 1G18A 2Q1XA 2WFZA 4PYNA 1IVSA 1DS6A 4H18A 5DHFA 3A2MA 4G1VA 2N9UA 2WT4A 3ET4A 1XOIA 4XQ9A 2H4HA 1GHTA 1VPLA 3R1IA 4JJEA 4CQMA 1G4AE 1V26A 2BMFA 2K6GA 4ALNA 1RYEA 5JY1A 1ECCA 4MR7B 4MNTA 4BWYA 3A8TA 5JZSA 1ODJA 3LY9A 4RSGA 1P62B 3T5BA 1GPJA 1S9HA 4K9RA 4RK5A 4XCXA 4ZT7A 2XF8A 4E51A 2CMHA 4R1PA 4F9EA 2JHFA 5HS6A 1ZVVA 4IS3A 3IH5A 4WGFA 1C29B 4LC9A 5EP4A 4M0LA 3L5OA 3LDAA 5C53B 5H9WA 1L4YA 3T5CA 4YQZA 3PNYA 3LOQA 3VH4A 3JALB 3GA7A 4WK0B 3EPPA 1EJ6A 3G0GA 3PC8C 1IL0A 3OF2A 4FYYA 4BQNA 1XR3A 1YR6A 1HDZA 4P1ZA 5K8UA 4QWMA 1I3CA 3AFGA 3ROKA 3NEJA 1B4DA 3EZ6A 4L72A 3FPBA 1I4TD 2YCBA 2X77A 2RI0A 1PD1A 2ZBDA 3FYHA 5C4GB 2FHSA 4J2TA 3TVDA 4DLSA 1PZGA 3L7MA 4D3FA 2Z4RA 4A8TA 4AMYA 2MR6A 5KOYA 2H4ZA 4YJ2A 3EPHA 5E4JA 3F6RA 4TV9A 3KQWA 2V97A 1Y42X 1DWPA 3I01A 2OBLA 1JYEA 1Z8HA 3W04A 1FQOA 4I5IA 3P9CA 4REQB 2RHGB 1FSGA 5DTMA 1EFRD 3K5WA 5LWQA 4OA5A 3ZCVA 1NNI1 2IEYA 2I8CA 2JCSA 4KQEA 1WRBA 3EISA 2ZAIA 4KQGA 1L7PA 4FDUA 4UM5A 2ZSHA 4F46A 1UM9B 5LR6A 1KI6B 5EP2A 3SEQA 1JJIA 1M6HA 1QOQB 3FRJA 3QSGA 4EG6A 1QO0A 3QLTA 1E9AA 3PEYA 1FYWA 3SHWA 5BVGB 4TUYF 5EJIA 1AB6A 1YVEI 2HIAA 1XCLA 3KC2A 1P1JA 3K6SA 3GRFA 1EXNA 2QZSA 1F2UA 3L06A 3L6CA 1ES9A 1FFGA 1JZQA 2A84A 2AS0A 2GBGA 1NYLA 2NUBA 3FI9A 2VZEA 4R31A 4RY9A 3BMQB 3T8YA 2RAFA 2V4UA 5DM60 4LXQA 4DR7B 3OZXA 5FO1A 3EZFA 4H2DA 2OESA 3TBFA 1WPXA 4KXYA 3DULA 4CM9D 4DA4A 4Z99A 4K6MA 3KJQA 5I7VA 2OKGA 4QYWA 4HEHA 1PSDA 5ICGA 4DV2B 4DHWA 1NFQA 4IIYA 4QNRA 1C14A 1VM6A 1Z22A 2EDAA 3PDJA 4TS1A 1Q0RA 3LBIA 3NRBA 5EKXA 4BNVA 4YRAA 4Z8YA 1TB4A 5CLLA 1FFSA 4PYQA 2QU7A 2X4GA 3A27A 2OQRA 3QXGA 3OM9A 4ZO6A 4EZEA 2NU8B 3U0BA 3OO1A 2UVPB 3H9QA 5BQOA 4FKZA 2JC3A 1GQ2A 1YBAA 3OECA 4X84A 1KDYA 4CM7A 4R40A 5F23A 3WGQA 4KK3A 1E7MA 1E3IA 1SEVA 3H4VA 2ZVJA 4F8YA 2IDMA 4Z4HA 3OFJA 4CDNA 2G63A 4RHTA 3EVZA 1IVNA 5F9MA 3UT0A 4C14A 1ST2A 4BMCA 5B1SA 1KI2A 2XH8A 3GF4A 1MX5A 2O8CA 3D6HA 5AW7A 2QY6A 2COEA 2Z9CA 4Z7JA 2NV6A 2PGDA 1V8BA 1TQ6A 2Q6IA 3IEIA 4BO4A 2WWVD 6GPBA 2ENWA 1NUPA 2B4TO 3ANNA 4PGAA 3NDJA 4RTPA 3I6MA 4O0LA 1AKMA 2ECFA 3REGA 1MG5A 4XR9A 1I7LA 1T36B 4KGXA 1JHZA 2YINC 3LDFA 1P0CA 3C3YA 1YJBA 1JF8A 3ZDQA 1BDHA 2Y71A 5B4VA 1FS5A 5HP4A 2ZR0A 2ZJ0A 2ZYVX 4GOND 1LA2A 4OHWA 4X3CA 5AT1A 5K3FB 3JARA 4YWJA 2EFJA 3N74A 5BSKA 4F3TA 3ZIAA 4PX9A 2Y99A 3GPLA 4B09A 4AP9A 1PU2A 4IJUA 2C2MA 1PCXA 1W52X 4MWGA 4KSYA 2NUTB 4CLXA 2JLZA 4ZRDA 1KMQA 2MSWA 1M75A 4UQLA 1L8QA 1XB2A 2XTAA 3LPNA 4HMQA 3CGWA 4TMFA 2ORED 2WHPA 3G2LA 3HCCA 1UPBA 1XA4A 3MBOA 1YIAA 1WBDA 4ZGWA 4CXMA 2H2FA 3EEQA 3BG5A 4LTNA 3ZUPA 4TLLB 1DC4A 4MLCA 5EE3A 4KR7A 1WM1A 4CEIB 1P1BA 2D8AA 3V8QA 5IDWA 1KR2A 3R09A 4Y0VA 3FH0A 1P3DA 2I6QA 1KJWA 2JD0A 3EZYA 4F21A 1QV9A 4G97A 4URZR 2RE8A 1U2ZA 2IE8A 4JXKA 3ZDBA 1EWKA 1P9RA 5EE5B 4WZAB 3ACCA 3BBPA 1IOLA 4Y2UA 4CF4A 1E18A 3GAZA 1GTG1 4YP5A 4ZMBA 3AHCA 4MJ3A 3K0FA 3CTMA 1KEVA 1ZGHA 1ZGCA 2JJ2A 3VJLA 1VL2A 2ZXUA 1QUFA 3MUOA 3QITA 5DTQA 1E6CA 1IBRA 1PT9A 3LQFA 3PKIA 2C83A 1RR6A 1AKTA 2W8BA 4TTAA 5KNBA 1G5HA 1JT2A 3CZAA 5HOQA 3CXRA 1JFFB 1E64A 1YKFA 1Z3IX 1KQOA 1WLYA 5AFSA 1N33B 1XELA 4KQ1A 4RKEA 3RODA 4UJ5A 4G1EB 2OXFA 3GFBA 2O7NA 1LDMA 1KWGA 1A5AB 4KQ2A 3HXOA 3K70B 2AG1A 2LV8A 2IXDA 3R5JA 1QDUA 2H00A 3EG9B 1X1EA 5JD3A 5AOBA 4RF5A 1T9ZA 5E7QA 4M36A 2YIVX 3FR8A 3N58A 4BQIA 2W4QA 4DIKA 1Q0ZA 4UBLA 4WXHA 1MABA 1EWQA 4XYGA 1J42A 4E08A 2CBXA 1TQ2A 2WSMA 3F4KA 1RQNA 4C6SA 4LZWA 1AUXA 1RBZA 4J49A 4ZYYA 1Q84A 1HL7A 3K3PA 3NTLA 3NB0A 4GPD1 6PFKA 1N5JA 2BI4A 3I9KA 4WT7A 1H3FA 2YVLA 4TGLA 4IXNA 5FJIA 3EA5A 1C4WA 5FWDA 3G8CA 4EX6A 1NSYA 3TRIA 3EEYA 3U62A 3UT5A 1TIPA 1YMUA 2TRSB 3EQ7A 2OZPA 1C1DB 1Z6YA 1COWD 1RHJA 4TM8A 1A1VA 1ZIOA 1DAEA 2XXAB 2H17A 3LC7O 1V9LA 3CO0S 4MRMB 4AW9A 3PC7A 4H27A 3V7WA 4D3YA 2A57A 2BKAA 2ZJ6A 4A9AA 3CH4B 5FFNA 3SD7A 3ZVLA 2DG2A 4DWJA 4RELA 3CEMA 4AYTA 1BCRB 1QIIA 4AQ7A 1JEYA 2GAAA 3O4IA 3DDWA 4F1KA 4ACAA 4PGFA 1E3QA 2JAPA 2HV9A 4QJIA 4UM7A 4DBZA 3ZE9A 3CH5A 5IUKC 3WA7A 4HPWA 3B78A 1NKTA 1I51A 1ZCZA 2Y0EA 3JQ9C 4N0QA 1ULBA 2DHDA 2CNNA 3SPXA 5KS2A 4ER7A 1M66A 2UU9B 1V95A 2XGSA 3A4YA 4GPAA 5AHRA 2A5YB 5KJ1A 1B2LA 4OSOA 3S28A 3CRRA 4OOEA 3GP8A 3E8XA 4BMZA 4X60A 1OLUA 1W4BA 3B2QA 2FQWA 3PVZA 1KDTA 4KQCA 3VHXB 1FFYA 1JTFA 4NOLA 2CGEA 4ARAA 4FYHA 1KZGB 2DE0X 2EBHX 5D51S 2OZKA 2XUDA 4JCOA 2ZXEA 3RARA 4KFCA 1JYSA 4IWXA 1YR7A 5EHNA 5J1SB 3U4QA 4D9CA 5J3JA 2W6NA 3U39A 2GXAA 3IPYA 3HJFA 1VJCA 4HCJA 2H92A 3TQSA 1NG9A 4IVRA 4ZU6X 1F60A 1J1ZA 1QG2A 4KLZA 5FJJA 3ZXIA 1OKKA 3HYSA 4JLUA 4D4IA 1H2RS 3F4LA 1Q1NA 1Y34E 1EVKA 3VU9A 1DT3A 3FPKA 5CH8A 1A9XB 4EJMA 4ADSG 2C1XA 5FLKA 1P1IA 1R4NB 1T34A 4M1WA 4TLMB 3I9LA 2ZYDA 3HZHA 4IJWA 4Q4JB 4F3CA 1PT5A 4BXOB 2J0SA 5HJ7A 2KWIA 3ZGXA 3I3SR 3HTXA 5DSXA 2N42A 5H3HA 1Y3DE 5KU7A 2NVBA 3KKNA 3H5WA 4CFYA 5KSWB 5KO2A 1RKUA 1FTQA 2GNAA 3HSSA 2AZMA 1VRCA 5HQ3A 3OX2A 4H7IA 4J0HA 4G8CA 3HWX1 4IDBA 3RUDA 1Z16A 3N39C 4L2IA 3TR0A 3G5TA 1N2GA 1TRHA 1A88A 2I71A 2JCVA 4Y9DA 5F9HA 2XQGA 2OOSA 3Q6NA 4B80A 1ODTC 3GOHA 2FQYA 2CV1A 2PH7A 4GXTA 1DV1A 3ZWDA 4E4YA 3DD1A 3DMPA 3PNPA 4XLTA 4UFPA 3UJ8A 3Q5EA 3KU4A 2OAP1 1KI9A 3AUKA 4I1SA 3YASA 1DIRA 4OHZA 5BR7A 5HKOA 1WA5A 2HB6A 4M53A 4QGFA 4RWZA 4IF6A 5MN5A 3EBOA 4UVHA 4WDQA 4Z53A 4WZBE 3ASVA 3PGA1 3QFFA 4GO1A 4C2UA 4CUZA 2HMTA 5LA6F 3NKLA 1C2TA 1RJDA 1CUCA 4LFAB 4Q7MB 1Q1GA 2VDWB 2QAGB 1JAXA 5EQJB 5H82A 2RI1A 1NPDA 2OM6A 2Q3DA 2XQKA 4P3NA 4CMGA 5FPPA 1VZ3A 3VR2D 1WDTA 3P0EA 1GILA 1HOTA 1XL1A 2QOEA 3MK31 2PXHA 4R9RA 5HDBB 4ROSA 3JD0A 2WYWA 3OEHA 4BO9A 2GBPA 3EZ9A 1M2FA 2Q5IA 2FKAA 2GLTA 4R6XA 4KC0A 1Z15A 2I33A 2RJ3A 2WHQA 4HAOA 4S04A 1EDOA 3EWSA 4GZ3A 4CZ2A 1G291 3GFFA 1GGVA 1ZL0A 2CDNA 2GJKA 3KEGA 4MUKA 4OQYA 1C3JA 1W44A 3WDSA 1H2HA 1SQGA 4CEHA 4L4YA 3FKQA 1YB5A 4LDRA 3BEDA 3RW9A 4BGVA 2ZM5A 3LHIA 3ZOKA 4ENVA 2D2IA 4AS2A 1C4KA 3KDPA 4CM8A 1CQIB 3MS4A 2ZTHA 4AZVA 4G0ZA 4AKGA 1KZHA 2XT9A 1ZKDA 4NI5A 5EAIA 2C2GA 1U5AA 3F8TA 1D2NA 1PTKA 4H60A 3UQYS 1R5NA 3VR6H 4OQ4A 4DSAA 5KOJA 5H0IA 3VDNB 4DA7A 1W4ZA 4UHEA 3PR3A 1E2QA 1B93A 2WJHA 5LP6B 2GHIA 2P1ZA 3GK3A 4S1NA 2P41A 4KU4A 3TLJA 1RWWA 5JVDA 1PFKA 3KSDO 4MVJA 1RJFA 2RGGA 4HR7A 3EFOB 4KV7A 3F98A 1L5MA 4WY5A 4HNTA 2WOOA 4Z9BA 4QDOA 3AF6A 1YVPA 4WH0A 2ASVA 1CRPA 2B8EA 2IYSA 5LDGA 4P53A 1VIYA 5GY7A 4D8WA 1MB0A 1VJDA 3HCEA 4WKNA 5IEBA 3ABIA 3MERA 1NN5A 5AJHA 3IDOA 3OZUA 2PAFA 4YY3B 2YRXA 2AB0A 4HVLA 3K7EA 3V9PA 4E2YA 1CJTC 3I9NA 3T3HA 2FSVA 1U3WA 4ZCSA 4M0CA 3TW4A 1P60A 1ZSNA 3TJZA 4UNQA 4CKCA 3U9LA 4LV8B 2Z6AA 3SZOA 3EQZA 4UFNA 4C3UA 3D31A 2HBQA 1EFKA 2WRZA 5U9CA 2WTMA 1CR1A 3ZOZA 3KXKA 2RGDA 2ZR8A 1MTOA 3R3VA 3PJEA 1DARA 3EWNA 2IIQA 3LH5A 3BE8A 2Z6VA 1V5FA 4S2EA 4R1TA 1IN8A 1F6DA 4E15A 4YFVA 3ZGVA 4F2HA 1NXPA 3RVKA 4B47A 1WVGA 1IQPA 3BULA 5JTTA 3QEAZ 3KBOA 1AKYA 2X5KO 1VGVA 3FE2A 3JYHA 1ZJZA 4OBXA 3V8VA 2RGEA 5FR2A 1ZI8A 3IMKA 2WJ4A 5CLQA 3IVCA 2YJGA 3ETJA 1E2DA 5KTNA 3L8CA 3MWYW 4DLUA 1NF9A 4BU0A 1GAXA 1JI0A 1WEKA 4F4UA 2FMHA 3DMRA 1Q7EA 1WD5A 3Q9NA 2FF7A 1CC1S 3CWQA 3UUWA 4ZC8A 3ZU6A 3RK0A 4MUGA 3CLUC 1SQ6A 3DYBA 3M1LA 2JAXA 1GN9A 3EQ6A 3LBAA 4A82A 2VVTA 2NZWA 3L7OA 2FZLA 2P62A 3KR2A 1U8UA 1A2KC 3FNGA 1RYYA 1HSOA 4JELA 1W8IA 2I0FA 2FUNB 3HQ4O 2FPIA 1TPYA 2QJWA 2HSEA 1TVEA 4LXYA 4UNRA 2AYZA 4JYCA 2X8LA 5AP9A 5YASA 1JIIA 2OK8A 3ZEAA 4QJ3A 1SCNE 1FJXA 1HT1E 1S96A 1T9GR 2Q5LA 4QRDA 2ZIXB 2X8JB 1VJGA 3PXCX 1QR6A 1N2JA 3M5PA 1SXJC 4P6VF 1SBYA 1VIAA 5HA5A 2HLHA 2ZWOA 3ZNOA 1ZC4A 5F2NA 2PJRA 2D4HA 3ONDA 1M8FA 1NOIA 2OSBA 1B0UA 4YJFB 2OE2A 2RGWA 1MIHA 1OI4A 3BA1A 4XD7D 4B34A 1W49A 3D6UA 4MVCA 1WXDA 3B6IA 4N7BA 4X61A 3FTEA 3AR7A 3IAFA 4FFDA 2IDJA 3NWOA 3U40A 4ECEA 2GPAA 3EGDB 4AKIA 5G3ZA 5F4ZA 2I1WA 2EEPA 4GH5A 4TMKA 4ZDJA 5GZ3A 2O1SA 1CPYA 1RCTE 4ZO7A 4BNJA 3E5RA 3DP9A 3NUZA 1K2WA 3TPFA 3MFYA 4Z4FA 3AW8A 3JQ9A 4ARZA 3WLIA 1WD7A 4DR4B 4A8PA 3NORA 2PKYX 3ZYCA 4YCLA 5IH7A 3UAVA 2YN4A 5EE1A 1D1QA 3VPCA 4RGQA 2B1JA 5C34B 4NXMB 2FGJA 2FZEA 2PH5A 3ACBA 3GLGA 1TTQB 1PV2A 3LBNA 1E9VA 2H4XA 4KSCA 3UYLA 2XJ9A 1BROA 4FJ2A 4PYMA 5AVQA 1IHYA 2GPWA 1F2TB 1JAZA 3VOBA 5FD8A 4HZUA 2HZBA 5U1PA 2Q49A 4L02A 4MWBA 3QKSB 3ROPA 1E1QA 4MICA 3DZDA 1E2UA 3Q7IA 2EZ9A 3QUAA 4ZEVA 1P1RA 4TXNA 2CLEB 4WOPA 4C78A 5CT9A 4C6TB 16PKA 1XVLA 1KMHB 4NZZA 4AK9A 1FDVA 1JDUA 4X8MA 4GYWA 4BE9A 2J48A 2W8ZA 5ILQA 4Y6PA 4UJ3A 2ZUBA 4QQ8A 1VPWA 4C4SA 4U02A 1CRZA 1DU4A 3N2GA 4M6WB 4RD6A 1U90A 2JLBA 5JNUA 2NQTA 1ULHA 3BDAA 1IIRA 1K88A 3EDYA 4LSMA 3ZJVA 3G5MA 4J7AA 1UK8A 2PX2A 3BH0A 4MQFB 4YCNA 2CJXA 1CJBA 4BNUA 1FW8A 2GEJA 2W4IA 2FFJA 5FOQA 5J58A 1L4LA 3VMFA 2ZJ3A 3N53A 1MOZA 3T1VA 3HL0A 1IYZA 2P6OA 3O7WA 4BRWA 4BYGA 1Z5UA 5BO5A 2I9KA 3MWDB 2EJCA 4NABA 4D4JA 4BGUA 4RVOA 4L6AA 5IAAA 2WU3A 2N1BA 1SU8A 3LGSA 4JJZA 5IKMA 4LX8A 4OK3A 3ZWBA 5AVOA 1L4BA 5JRJA 1C1XB 1OCEA 1NBEA 1R8JA 4ONEA 4C9BA 2ZJ7A 3OWOA 4BECA 5DM0A 3TCKA 3WZ2A 2E3JA 2W6CX 3B82A 4MZDA 3VC2A 5CG2A 4Z4CA 1SXJE 3OOWA 4RLHA 2QPAA 1GR1A 1EK5A 2PQ6A 5FORA 3RBXA 2DJIA 4FOTA 3ZK7A 4CIXA 3S2SA 5LPNA 1XWWA 3X0DA 5K6TA 2PPLA 1VL5A 1P4RA 3B60A 4PZZA 3MUNA 4MHOA 4BX8A 5AVVA 1XXHB 4NPAA 4KBFA 5EWJB 4EB3A 5JR3A 1F0YA 2R60A 1QGAA 1VG8A 1ZXXA 4B7UA 1UJ4A 4D81A 3FCXA 1HZJA 3OJCA 4HGZA 4M2LA 4PRZA 5HCIA 4U4AA 3O3CA 1N3LA 3T99A 1YI0A 4NV1A 2RH4A 4PTYA 1I2MA 4EJFA 1SJ9A 4WLEA 4V3CA 1QO7A 3ZHZA 2VJNA 2ODEA 5BNFA 1PSWA 5JEDA 2R7KA 1E3SA 2J3DA 3O21A 3PQ5A 3HM9A 4EPYA 4BB5A 2MOKA 2CJWB 1EAMA 1KF0A 1RC0A 2YN0A 1I32A 1KBOA 1U7OA 3HJUA 4RLSA 3BMOB 2FN9A 2BBSA 4Z2YA 3U17A 2KLBA 2H52A 2ZIZA 4BMYA 1ZHOA 4C30A 3Q8XB 2O3QA 1TNDA 4KR9A 3EXHB 4KV9A 1N32B 3L7YA 1LH0A 1S3FA 3NIDB 1USKA 4ZQFA 1E6UA 3VV2A 1R6BX 5IASA 1Z0AA 5HGXA 4JQOA 1T4CA 1TC2A 3EJ6A 3NW9A 2J07A 3LS2A 3HN7A 4XXHA 4EO4A 1KRXA 5IAOA 2H1OA 2XBUA 5EHXA 1NBMD 1G8SA 2QQ5A 3S5UA 1E9BA 3KB6A 1M72A 2ADFA 1Q0SA 4B7AA 2FPXA 1CUWA 1M2OB 1YQXA 2MSKA 3E3AA 2EBUA 2Q0XA 2Q8QA 4GT1A 3NKFA 4R8RA 4Y6RA 2O3JA 4CLRA 3S4YA 3RTGA 3I6BA 2ZU0C 4A73A 2NO5A 4M86A 1YGYA 1GGFA 2IYNA 5B1IA 2PH3A 4S1WA 2HFKA 1Y7PA 3HFGA 4QDZA 5IW8A 5M7EA 1UPXA 3UAGA 3ITNA 4EJ6A 3P7MA 3ZW8A 1WIWA 5JLAA 3HYLA 2EGGA 2H9IA 3GH3A 4EY3A 1LTHR 1MB4A 3OCWA 4KNWA 2WD7A 4B43A 1VJ1A 3RAGA 3ZDXB 3L46A 5I9LA 3D43A 2ODQA 1HDRA 3LM8A 1XNHA 5F35A 1QAQA 3THYA 1E7YA 1ZNWA 1QHYA 1GP2A 3OQHA 3FFTA 4ZYVA 5KSYA 2FFAA 3AY7A 3NT2A 2PYIA 3K4HA 1XVTA 3NYQA 4LOAA 3BPSA 2G28A 4H6WA 4J2OA 4Q4HA 3FMIA 2KJQA 5EMLA 4EGAA 1H66A 5K0BA 4LRSB 4MCHA 1P0MA 2RGYA 3E3OA 1M2VA 1NXQA 3CB4A 3VUEA 1SC4A 1IN6A 3O2SB 4RCYA 1DO2A 1KVUA 5DBOA 1TQHA 5JAQA 4EPRA 2ZSAA 5B57C 1RRCA 3WB9A 4WNYA 3WGVA 1X1SA 4N9WA 2YW9A 3NTXA 4LHEA 1QYWA 5CYOA 3IVXA 3NIGB 4IIJA 3VYUB 4EFDA 2M1XA 1P8AA 2VA9A 1ZD8A 4NU0A 5EZQA 4MW1A 3ABQB 4RNCA 4IMRA 3E05A 1U0OC 2O2IA 3E9ZA 3WB0A 2ZREA 2ZTMA 3IHKA 3LBYA 4FC7A 1ACLA 5FB3A 4BVLA 4QPNA 3CLSD 1L8OA 3OTQA 3P97A 2XEDA 3JZFA 2WYIA 1GGKA 3KB1A 3OMLA 1CUXA 4RPKA 4RU1A 4B31A 4NLLA 4P4LA 1N4AA 5K9ZA 1U6JA 4EYKA 5KREA 1MIOA 3AM3A 5AKKA 2C2WA 2ZYRA 2ATIA 3F74A 3IBTA 2H5JA 3LUDA 3ND7A 1IDN1 3EVTA 1WO8A 3N59A 4A2CA 2Z08A 3ZHUA 2QQFA 1QE3A 3KTOA 4ZT4A 2JVIA 4I66A 4BBPA 3JAKB 5LQKA 4O4JB 3F46A 3NNDA 3NAZA 3VVBA 2PIAA 3HBMA 3W1EA 1J21A 3DBHA 1RJ9A 3AEKB 2M6KA 3R8FA 1II9A 4KWCA 1VIDA 4ARBA 4LF6B 3L04A 2H4WA 3A1TA 2XDYA 3LG2A 4XUDA 3VSDA 4DGSA 3R3JA 3W5UA 4G8JA 3I6ZA 4D02A 5JY6A 3ZLVA 1A5TA 3BERA 3LW7A 2GARA 4PZEA 4QYIA 3LV8A 5CHYA 5IFLA 4X6UA 1INLA 1YACA 5IJ0A 2B92A 3AU9A 1I6LA 4HXGA 3SE7A 5K8VA 4L8GA 4WESA 4I8DA 2IWHA 3DOEA 1A8PA 1D1SA 5B36A 1Z7EA 2RHLA 5A1TA 3Q0TA 3QA9A 2NUPA 1Z73A 3EF3A 4AI6A 1WCXA 3T61A 1ZAKA 1BO6A 3Q7RA 1LDYA 3C0KA 3RCBA 2DKNA 4FGUA 1PWXA 5CX1B 3KLNA 4QARA 5FULA 2G67A 4RNDB 4TMTA 2VPTA 5CTAA 1L7BA 2BFFB 3DHNA 3EIEA 2XA2A 1A7JA 2DXIA 1U7DA 2JDIA 5CP8A 4F5YA 2O5VA 3FZEA 3DEYX 1MAVA 4DLPA 1OXXK 5H3LA 3KSMA 4RK7A 2PK3A 3GVCA 1EFPB 3HCFA 3BXPA 4QRHA 4UMEA 4V24A 4AF6A 1QUEA 1WL8A 3AM4A 4HLNA 4CF6A 3U1BA 1KRHA 3C8DA 3DTVD 5JYEA 5JPIA 4MUIA 4O4IB 1MC5A 3GQBB 5IT5A 1TIBA 4WY8A 4OAQA 4YPOA 1PN3A 3VZPA 2Q3MA 1CE8B 1HI9A 3TIFA 5C8VA 1VLJA 1BS1A 2Z1MA 4QLOA 2IYOA 2XZOA 3L8GA 1WB6A 4H4DA 3QFTA 1O77A 5IDXA 4G4GA 5CX4A 3OWXA 1ZS9A 2QQ0A 4LDQA 5ADVA 3WGOA 3COPA 2AI2A 4ZYUA 3L7KA 1QHSA 2JB9A 1DXHA 1OTHA 3VYSB 1EHYA 4ER0A 5C7IO 3IO3A 2LR0A 5BNWA 2YUTA 3NM4A 2HF9A 5CHEA 1ZVQA 2VK2A 3HB1A 3WB2A 1USVA 3K9NA 3IEPA 4BNMA 3CZ9A 3STVA 4KEAA 4YUWA 3BRWD 2LTAA 1E9EA 1DJOA 2R86A 4GI5A 3ZHCA 3ETCA 3MJVA 1J06A 1JIKA 4B8WA 3WNCA 3ZQ6A 3SFZA 2I2CA 4F8JA 2ODPA 1L7AA 5EFOA 5SY9A 1ELOA 4EKEA 3FGZA 2N47A 2VDKB 4LV5B 1AKWA 4OM7A 4R7GA 3WLTA 2DM6A 3TFOA 3O4VA 4AP6A 2YWFA 5DN6D 1G2PA 3HC7A 3LD9A 3QX9A 4OATA 2HO4A 3VOSA 1NU8A 4E5KA 3UW1A 2JKVA 1DL5A 3CUKA 5AHOA 2IUYA 1RZ3A 2AEJA 3KQUA 1JECA 1GUDA 4UTVA 1ADJA 4LSZA 4PHHA 5BOVA 4CIDA 2GM4A 1MC1A 4Y2PA 4AX8A 3TZKA 1TYCA 3KKZA 4WUVA 4P33A 4I4CA 1DTEA 2FWIA 3DL4A 4GGPA 3ESRA 1PV1A 3V3TA 3GRKA 5AK6A 5CA0A 4ARVA 4V02A 2NV2B 1O6CA 3CW2A 1ZJYA 4X95A 4ZEOA 3KKLA 4J9UE 1A7KA 2NO0A 3QWHA 2P4HX 1JL3A 4OP2A 4YRLA 3ZCTA 4V1CI 3UMGA 4LE2A 1B3BA 3ZDRA 3MMXA 3QK7A 1D0IA 4J6EA 3USES 3ZZ0A 1UEIA 2JI9A 2AXNA 1AZTA 1ISSA 3F6YA 1FFXB 2CXSA 3QELB 4GKVA 4RPIA 3ZWXA 3FLBA 4DJFC 2G40A 2P3OA 1XQ6A 3ABOB 3I9V6 1XPJA 1W88B 2C5AA 3HWRA 2RK4A 5AK0A 4UOEA 3VNVA 2GESA 4UAGA 2A58A 4HVCA 4LG1A 3WI7A 2HM7A 2C58A 4NYIQ 1KBZA 2HJRA 3HB7A 4NWIA 4X5OA 3FUTA 2JLSA 3JQAA 5SZJA 5TARA 1IM8A 4J4BA 1IHXA 1G5RA 2DR3A 1UZLA 3EAQA 1U0EA 3PXDA 1THZA 3E70C 4EF6A 1MF7A 3HCWA 1W96A 4ZAYA 3SDBA 2ZBVA 3GU3A 3VZRA 4HZIA 4L4SA 3WMRA 5A2GA 4X91A 1JG6A 1LLQA 1UBLS 2VJKA 2Q9BA 1L1RA 1ZM9A 1JNYA 2FY8A 2HC9A 1ABBA 4K7JA 1IY1A 2VJYA 3MF4A 2JFUA 2JBHA 3EOBI 4OG2A 1PGPA 2YWRA 5LB2A 4CV1A 3SSOA 4TZKA 4YUYA 3PNOA 4WRRA 1ACJA 1K97A 1KGDA 1Z38A 1SUEA 2V0GA 5JZMA 2O8FB 1AK9A 5KYVA 2Z83A 3FSJX 4NEHB 4NZPA 5AW6A 2VT6A 2YJTD 4R1SA 2FKNA 4IJQA 4YK7A 3V6LA 3WLJA 3X44A 1B14A 2PSJA 1WCIA 1NVDA 3GJZA 1E2GA 5JD5A 4JJAA 2WZBA 4S05A 2IU4A 1MQ8B 3HCRA 1KZ4A 4GOKA 2GASA 4JGBA 2OYRA 2IZ1A 3HFJA 1Y4ZA 2VSXA 1UP4A 4PGGA 3HWSA 5SZKB 421PA 2GAFA 4RTLA 1GPMA 1TAGA 1TKBA 1Z5OA 3V1NA 3QUBA 3RE1A 3I72A 3D1LA 4R54A 4OQDA 2A30A 1JHVA 4RHXA 2NYAA 1OWMA 2JGJA 4QQRA 5H3CA 3EVFA 2HWYA 5SZHB 1MJGM 3SEZA 1KE2A 1QCZA 2BWJA 1CJVC 1NQOA 3IERA 1UC5B 2PXAA 1DCKA 4E88A 3O31A 5L3QB 1A5SB 1KKLA 3D8UA 1C7EA 3DOJA 3WG9A 4E4TA 4XWWA 4G86A 3FWYA 4FOPA 1BE6A 2GBFA 4CR7A 3WQQA 3SIXA 2CL6X 1EH5A 4WN9B 3AOEC 5HM6A 4IZ6A 4EVIA 3SK0A 3E61A 1B6GA 2EG5A 1FTYA 4C01A 1UT5A 3RO7A 4DG8A 4TTRA 1WUTA 1T5SA 3GLSA 2R6CA 3SXPA 3ZR4B 4CEJA 4UATA 1L0BA 3EIXA 2EW2A 3VSCA 5GJCA 2C94A 4M88A 4Y9UA 3GT4A 4DYHA 9LDBA 1TK9A 1MB2A 1DQYA 1P17A 2OORC 1OXKB 1PUIA 3LX6A 4EHKA 1HDYA 3UK2A 2FUCA 3ZV4A 2YZKA 2VBGA 3LL7A 2ZCUA 1JEJA 3FFBA 3LA6A 4QYMA 3GL9A 2LKCA 5TT1A 4TZ0A 3HU5A 3ELUA 3IIKA 4JP5A 4ND7A 3T5AA 3U44A 3SS8A 3UANA 1KS2A 1K5GA 2VWQA 4BGIA 1LBHA 1VE3A 4IX1A 3FYSA 1Q14A 4XGNA 3W5CA 4JA0A 1T10A 4NEGA 4LF8B 4M1KA 5EEHA 1Y80A 3NDIA 4IIVA 3NT5A 5ALJA 4RE5A 2HA7A 2ZDGA 3DUFB 3JYLA 4JEMA 3KJNA 4W5HA 4WI1A 5E7JA 1YD7A 5EESA 1KYZA 1NNLA 5ERXA 3G2MA 4NQZA 3UWKA 3K8QA 4LTMA 2SKCA 1GCIA 2DP4E 4K9DA 4L0CA 5T8KC 5JYCA 1A8QA 1FP1D 1UBGA 3C3AA 3UAYA 5JH7B 2V8BA 4MUXA 3IDQA 1DBIA 3NG1A 5DSZA 5GIOE 3D0RA 4I2NA 3TH5A 1YFZA 5KDLA 2C5LA 5IMBA 2YV2A 1M34B 2BFNA 3OZSA 4O6VA 1R37A 4IDQA 4YLGA 5AOAA 1G3IA 5BOSA 5CBPB 4TS9A 4XIYA 4UUNA 5KJFA 3EDCA 3VKUA 1SXHA 4JBHA 4BAGA 1EE9A 3KEFA 3MTJA 5ISMA 3PC3A 2DBQA 1CD5A 2WF7A 4M8NE 4OQEA 4G2TA 2RHWA 4DR2B 5EXPA 1Y5NA 4DW8A 2WIDA 5TMEA 1S8OA 3HU3A 2JFBA 1YVDA 4TQ9A 1YZVA 4LCBA 2XVZA 3H9GA 4R1QA 4MQ4A 4Y1GA 3BWBA 1HNZB 4MP8A 1KOFA 1V16A 5FBRB 3DB1A 3F2VA 5AOCA 3V34A 1XRRA 1D03A 4GU5A 1ZN8A 2CK3A 3A2NA 3EODA 1PZEA 5J5CA 4F2DA 2BM0A 1NBAA 5F3RA 2BJVA 2FSGA 4FB5A 1J33A 2Z09A 3L8MA 4CCAA 1NIPA 2I8AA 4HNGA 4B3TB 3WLRA 4IAOA 4KN6A 5DU2A 2IV3A 3PSHA 3X1DA 5A03A 1N8SA 2WYUA 4W5NA 5JLJA 4ZT2A 1IBSA 1MB9A 1ZCFA 1QYVA 1L3IA 4I1VA 3A2KA 1NXOA 1XJ5A 3ODPA 3AF0A 2G9UA 3EC2A 4ESEA 4HP8A 5ALZA 2DHEA 2HMVA 4ZK6A 3SMVA 4D9HA 4HYTA 4EGJA 1RQ7A 1O4VA 3FIUA 1XAIA 2P9CA 3DVLA 4HNUA 2EP7A 4NFLA 3B7GA 5IRCD 3S2FA 2P6NA 5FNZA 4HB3A 1ZSYA 5DBGA 1DUIA 3PA6A 1L4UA 1LSOA 3IP3A 3JWHA 3BAZA 3PTLA 3M3PA 2IW3A 2LCIA 1N1EA 4I55A 1R27A 2AEMA 5CYPA 1JSRA 3FKJA 1CJCA 4DV7B 2OGWA 3F0TA 2XVYA 4RKYA 3NBFA 1K6JA 1QE0A 2O8NA 2WP8J 4AJPA 4B0OA 4GMFA 4EL0A 2R8OA 2RHTA 5KWVA 4IZOA 1LNQA 1UIRA 3ZDZB 4A6XA 3EZLA 3AINA 4K1XA 3KDAA 1QWOA 1CBUA 1R6AA 3AC0A 4W99A 5KX5F 2PXXA 5JPCA 3KRTA 2DWCA 2YC2C 1U31A 2DKOA 4MKIA 4PBTA 1PT7A 4XVCA 1JB9A 4R3WA 4DT1B 4P7JA 1FW6A 7MHTA 2ZIVB 5ADHA 3IVMA 2GKGA 3PX2A 4TVBA 1U0HC 2WY2D 3ZXSA 5K09A 3IGFA 2VZ0A 5G0UA 3DDCA 3IAUA 3KHKA 1R9JA 1P9WA 3H2HA 1N5KA 4JKYA 1GOTA 2XUZA 2QLNA 3CPSA 3FYTA 3D3WB 3LY5A 3QJ5A 5BYBA 3W06A 2ECQA 3GFOA 1M1NB 3REQA 2I7XA 4D46A 3N0RA 1ARZA 3KOXA 3B3JA 4DDMA 4NMMA 3A10A 1I24A 1X38A 3CLKA 3VSAA 4Q1EA 4RANA 4RPLA 5U4XA 1NBOA 4GR9A 3DPIA 4KVGA 3O1HB 4XYMA 1OXUA 3JATA 4KJXA 1JE0A 4Q16A 1ORVA 1OASA 1ZN9A 1SHTX 4RD2A 4TMZA 2BEUA 1M0SA 1XZHA 2ZAGA 3IR5A 4WKGA 4P0QB 2R6GA 2NU7A 4CGZA 2IXAA 2BZSA 3IOBA 3S2YA 2P9TA 1FDUA 4PSVA 4RK1A 4U6QA 5EIBD 4LAFA 2W0SA 1NVVQ 1I7PA 4U7PB 1XI2A 1YIOA 2RGRA 3EE6A 2D5IA 3K2IA 4EO7A 4M55A 1WUYA 1T4BA 1I2AA 2CD7A 2GLUA 3QYFA 4NULA 3KPWA 4Z1MA 4BKPA 1X87A 1BCSB 5A06A 4LZNA 4HUQB 1EVQA 3SX0A 4ERNA 1TPZA 3BD6A 1ECPA 2BEWB 5ELXA 4EH1A 4AWBA 4BJ6A 4BLVA 4BZWA 3E84A 2X41A 2J9FA 4O4JF 4QIHA 4COOA 2AG6A 1IULA 4N0PA 4AU1A 3JQPA 3S2ZA 3QHAA 3TDNA 2CNLA 5IC5A 3TLBA 3QWAA 5HX7A 5FAXA 5IBPA 3O8BA 3P5SA 3CX8A 3TW6A 4HQ6A 2VCHA 3GLIA 2GQ0A 2A9QA 1I14A 1LZLA 4HWSA 2D59A 2DB3A 1CZNA 1JVNA 2RHJA 5JANA 1AZWA 1XTRA 5E4YA 3WMWA 4E33A 3GCWA 3HUUA 2H07A 3LCVB 4GP6A 3DV0B 1M2HA 3GLHA 2C0QA 1EP3B 1PE0A 1TE2A 1VSTA 5CDTA 4CIYA 1A9QA 4XX1A 3MA0A 1FVXA 4FWBA 1Z75A 1J8DA 2YXEA 2IY8A 3LQYA 3MT9A 4MUNA 3TZEA 1IEXA 1L7MA 1NW5A 2VHUA 3IPAA 4M7OA 1NQUA 5E9WA 3U3JA 5EJEA 4PLWA 1YZKA 3P96A 3AVWA 1PTJA 2SICE 2Q6VA 3F97A 2GFIA 1P7CA 4WKBA 4X9XA 1TC1A 4JI0B 1D1PA 1DO8A 1PT6A 1FDRA 2QGNA 4I4TB 1M8JA 2FYTA 1ZN2A 2I2AA 5T67A 3V00A 4F93B 5CB0A 1TA9A 3GN1A 4TWRA 1RADA 3ED1A 3IA7A 4QOHA 4BGEA 1WHTB 4JX9A 4MB2A 3HBJA 2RJNA 3R7DA 4BS9A 4AG6A 3Q8LA 5T6BA 1T6ZA 2GO7A 4ZAXA 3W8DA 1D4ZA 2I91A 3FUXA 3H9UA 1UIMA 2GRUA 2PMFA 4O4IF 4ZOLF 1M6EX 3RSSA 1H93A 4YX9A 5KVAA 4KE9A 3RJTA 1FFAA 4JA2A 1V8DA 3TM4A 3ZD9A 1FRFS 5TIIA 4HAUA 3NHBA 4QGAA 4YAFA 1BVHA 4DV5B 3ZCQA 3GGOA 2CF6A 3N7UA 2NU6B 4IQ4A 1UMDB 2O4UX 2EHJA 1FTSA 1NM5A 1W5BA 4KDEA 5SYNA 1AC5A 4NOKA 2RKOA 4NNOA 5KBYA 4E2WA 1W5EA 2AGVA 3GBVA 3PIDA 3D3NA 4I3HA 1Z4OA 5LDHA 2XPCA 3DZGA 1GQYA 3X1WA 3QLJA 4EKNB 2HBZA 3WHLA 5E8RA 4F12A 2C1ZA 5HSGA 4N5IX 3MOIA 2KX7A 3NOXA 3K8ZA 4FDAA 1W94A 2WQZA 2G06A 4UBKA 4DDTA 3WQSB 4KGVA 3M1YA 3OSZA 2D3TA 5ED0A 1VC2A 2Y66A 4HSGA 3UMJA 3PEEA 3W5DA 4ZREA 1L9XA 3V8PA 1HR0B 1NUQA 3GY0A 1YI1A 5HTOA 1GU1A 1RQXA 1LDBA 3B8HA 4UTRA 1PJ2A