4UCQA

Structure of the t18d small subunit mutant of d. fructosovorans nife- hydrogenase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECDGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
publication title A threonine stabilizes the NiC and NiR catalytic intermediates of [NiFe]-hydrogenase.
pubmed doi rcsb
source organism Desulfovibrio fructosivorans
total genus 82
structure length 262
sequence length 262
chains with identical sequence B, C
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ucqA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ucqA02
1H2AS 4UD2A 3CURA 3AYZB 1UBTS 4U9HS 5JSHA 4UQLA 4OMFG 1UBOS 1WUKS 1CC1S 4URHA 3USCS 3ZEAA 3AYXB 4UCQA 1WUIS 3RGWS 3USES 1WULS 4U9IS 4UQPA 4UPEA 3MYRA 4C3OB 4UE6A 1WUJS 3ZE9A 1YQ9A 3ZE7A 4UEQA 2FRVA 1FRVA 5JT1A 5A4MS 3ZE8A 4UEWA 1UBKS 4UE3S 4CI0B 1YRQA 4UE2A 3CUSA 1H2RS 4KL8S 4IUBS 3ZE6A 2WPNA 1UBJS 3H3XA 4IUCS 1FRFS 4KO1S 4TTTS 4UPVA 5JRDS 1UBRS 1UBLS 3UQYS 4GD3Q 4IUDS 5ADUS 4UCXA 5JSKA 4UD6A 4UCWA 5D51S 5A4IS 1UBUS 5A4FS 4KO2S 4KN9S 1UBMS 4KO4S 1UBHS 1E3DA 1WUHS 4KO3S 5JSUA 1YQWA 5JSYA
chains in the Genus database with same CATH superfamily
1B76A 3BE5A 4P7FA 2JB9A 2H1OA 1C29B 1O97C 4AN1A 5AK3A 4E5UA 2QTGA 4G0PA 4HVCA 1RRFA 4O08A 4A0GA 1E79A 1WB4A 4ZP1A 2OHHA 4M1SA 1VM6A 1MW9X 1PL6A 1PS0A 1QH8A 2BF7A 2GPYA 4OMFG 4CMJA 1USVA 3K1AB 3USZA 1LJUA 3EY4A 3KB2A 5B12A 5C8XA 2H9IA 4H3SA 4CLOB 2C96A 4GGPA 5I6DA 4QZVA 2ZRLA 4ZK2A 4PGHA 1JXOA 1ZN9A 1DX4A 1PVOA 4ZEXA 1UWLA 3E5NA 4R6XA 4F9GA 3JR3A 4WY8A 1A98A 1CZNA 1T26A 3G0BA 1Z26A 3PXGA 2RSLA 2Q0QA 4WESB 4BCDA 3I45A 5E3HA 1RMYA 2B7LA 1KMMA 4ESVA 3E7DA 3FPKA 4B3IA 4MW9A 2ZZMA 3SU8A 3LGXA 1QH8B 1G5PA 1K98A 2H57A 4YAJA 3NNDA 2QRPA 2I3BA 3FSEA 2C5SA 3GK3A 2QL6A 2X15A 5GZ1A 4HQOA 4KSBA 1NM5C 3BOSA 3UT5A 2FZ4A 3BXEA 3VZDA 1HDCA 2GO1A 2QTNA 3NDIA 2WB2A 1ZRMA 3N2YA 1JR3A 3JQPA 2JFWA 4OQEA 1D4FA 4DNFA 3MXOA 1T10A 1UK6A 2HLDA 3DVAA 1THTA 3NBAA 4FNGA 2IH2A 1CUJA 2V4ZA 4YROA 3X43A 5B30A 4MW7A 4ILEA 3B60A 4IIGA 2V59A 1N6RA 1NI3A 1WZNA 3BRCA 4FLMA 2BKXA 3LT5A 2ZJBA 1V4VA 2P5YA 3OPYI 3PZRA 4KR2A 1GAQA 2YHBA 1VCNA 1IU9A 4AZVA 1DFIA 1MV8A 2JAWA 2MSEB 2B69A 3E4DA 1VB5A 1J09A 4RMNA 2C97A 5C3UA 2SICE 2R7MA 4KNWA 4R40A 3G49A 3MMNA 4IRXA 3F74A 4BWFB 5LWHA 1DG3A 2Q1UA 2E2WA 2HQSA 1H2RS 4H3KB 3WK4A 2HC9A 1YRLA 4HWTA 4F3TA 1T5SA 3NIFB 3GPLA 2ZYGA 3EXAA 1TQ2A 2C42A 5JZSA 1SMKA 3T6KA 4NSNA 1ATIA 3O3NB 1T13A 1TAGA 2WE7A 1MAUA 1XVIA 1NMEA 4WNAB 2NN3C 2QG9A 3HDJA 1ULBA 2J3EA 3MWEB 1FXWF 1C4KA 4IVQA 5DYIA 5BYJA 1EK0A 2ZBRA 3LA8A 1BVYF 3JW8A 3C6KA 3TXYA 5J63A 4ZV9A 4DNPA 2PQMA 5IDQA 1JVNA 4P4NA 2VXOA 1Q15A 8ABPA 1OZGA 2GAOA 1G0NA 3B7PA 4M8SA 2NZXA 3R3XA 3W1WA 3W5UA 1S02A 1T2DA 2DQ4A 2LKDA 1VCMA 2RIRA 3PD7A 3PFGA 2C0PA 2OP0A 4TWJA 3AEKB 1KHHA 3E5MA 4QNNA 1W47A 1M1ZA 1EVYA 5CM8B 5DYTA 4EFDA 1XNRB 2XR1A 4S24A 4WN9B 4X94A 2QKYA 3CJRA 4HLUA 1ZR2A 1A5SB 3AUFA 3P0FA 1PV2A 4PNPA 1EAMA 1P8JA 2CLIB 3JQ9A 2FEWB 2C2OA 4LXTA 1X3LA 4P7BA 1XMPA 1DUIA 2BM9A 4V0KA 1LX7A 5TVGA 5JXHA 3L2OB 1ACJA 3IESA 3A6DA 2XUGA 1W1UA 3KO8A 4L6AA 4PO1A 5I7WA 3DE0X 4AYXA 4EPRA 2PPLA 1L4BA 5F5LA 5C8DA 1FMJA 4LCEA 3FMVA 4MVJA 3IPRA 3W6UA 3STHA 3SYTA 1NLZA 1CVLA 1S2GA 3AR5A 3RNLA 2YL2A 3OP1A 2H3EA 5LZ7A 3WXMA 1FTQA 3V6MA 1B16A 5AVVA 3P96A 1Y3DE 2J3MA 2UYHA 2FZ5A 1GGFA 3G8BA 1X9GA 3I1FA 5GY7A 3X2EA 4GP9A 3L0ZA 5K0EA 1QFJA 3G13A 1W0KD 4NICA 3SSMA 3ZZUA 3RSCA 1B26A 3G2PA 2BY4A 3PFHA 4ZDWA 1HF3A 1NVGA 4JB8A 5LZ5A 2JLVA 5CCXA 4EGJA 2ZQ5A 4X65B 4O29A 4KLAA 1SVMA 2BH9A 1KJWA 2PUGA 3JSXA 1W581 1Y98A 2REQA 2CHGA 3HUEA 4G0YA 2L69A 2VJCA 4KUEA 4X1OA 3BRWA 3K5HA 3NHBA 1XA0A 3ANNA 1CULC 1DIRA 1LPPA 3A1DA 3R6WA 4M86A 5IARA 2WV9A 2EZ4A 4QGSA 2E4VA 4X91A 5AKJA 2O3RA 1L4FA 3P5BA 4BNWA 5IT0A 1K97A 4MRAA 2X14A 2BMFA 4UBJA 3TAHA 1WHTB 3HXMA 3ACDA 4JAVC 5H68A 1DKPA 2JFBA 4ZO9A 2Z0MA 3KLBA 3CMMA 5ETJA 4E14A 4RJLA 3FMGA 2XNKA 4YP9A 2I7DA 5HZMA 3IXLA 1S5PA 4Q7LA 1BFDA 2I4NA 2R66A 2HOQA 1ZUNA 4JLSA 1USWA 2PANA 1UMDB 3K4QA 3D4OA 4B47A 4DQ0A 5J5VA 3VJMA 1BFUA 2X4GA 2WSSD 4IEEA 2B8WA 3LC7O 5FWDA 3ONWA 2IA5A 2QM8A 3EBLA 3COZA 4MW2A 2WTMA 5G4KB 1Z9BA 3GUCA 3RLFA 3JQ8A 4C0HA 1I3OA 3TFWA 1T4DA 1A3CA 4D98A 3UWDA 1CUDA 1KBZA 3NIWA 3QUTA 4OA8A 5EHGA 3S8MA 1Q74A 4Y7DA 1RVDA 1U4SA 2VNJA 2DXIA 4G4SO 2A9VA 3G0IA 3KOWA 4YRQA 4F6LA 4OFZA 4WY5A 3H9BA 1Q17A 4UHKA 5K7SA 1NONA 3I73A 3JZAA 3MPUA 4NULA 5GIOE 5C5IA 2CCKA 3K6KA 1DRJA 3G6WA 1T3GA 3ZQUA 1KJZA 3KYIB 3C5VA 6NULA 5HRAA 3IIIA 3UB3A 2FPMA 1MKYA 1QK5A 4CZ2A 3DDWA 3IXQA 1WBJB 2H5LA 2OVBA 2RHLA 3A3PA 3QOXA 3KT0A 1GR1A 6YASA 1XRLA 1L8QA 1MX3A 1VLMA 2JFNA 2MWMA 3E22B 3ZHYA 1PJ4A 3QM1A 2FN9A 2Q46A 2HMAA 2I62A 2VF5X 3OT5A 2H6EA 2W8BA 1LKZA 5EEHA 1XXHA 3T38A 2P2DA 3F49S 1EZ1A 2HIMA 3JVUA 3MS4A 3OOSA 1U0OC 2L18A 5FNVF 3D7LA 1UBHS 4C1BA 4EY4A 5AKLA 1BHO1 3TZEA 2Z95A 2A86A 2X0NA 3BSSA 3OX4A 3KAPA 2CGEA 2Q4OA 3QQPA 1K4KA 2AD1A 4FFSA 4HMPA 3ETJA 2C4KA 2QZJA 4MGEA 4YT8A 1Z15A 4TLLB 5BWLA 1N3BA 3FAKA 3EUWA 1B2LA 4MWOA 5FTNA 1BCSA 1X3SA 3LT0A 4H27A 4JWKA 3GPIA 4MKZA 4Y9RA 5FUBA 1A2OA 1SCAA 1PYOA 1G4UR 4M1TA 4N8DA 5IAJA 3SY8A 2FU5C 1XELA 2W8BB 2W6JA 3WRYA 2A92A 1C0LA 2Q62A 3IEVA 5CRIA 1XXHB 4JBYA 4XFKA 5ALSA 4J3FA 5G1OA 2B36A 1WS6A 1HZZC 2ZIAA 1RRKA 4JBXA 1O9BA 1MUUA 1QTRA 4IV5A 1I1QB 1LW7A 1Y1LA 3ND9A 5A7HA 1UJCA 3RGWS 4UFPA 1A9TA 4JSYA 4QGGA 3H2JA 4CDRA 2LPMA 2Z1MA 5JS6A 1ZI8A 4YONB 3T7AA 2CDCA 3FCYA 4FDUA 1BCSB 2VJYA 3K8ZA 2GPWA 4GQBA 2NU8B 4EO9A 821PA 2IEZA 2KBEA 3CZRA 1DAIA 1SULA 2WSBA 3BREA 1RAGA 4MYUA 1PT8A 5K0LA 5BMOA 1W4BA 4X1IA 5FBLB 1J07A 5DASA 2CXOA 4F12A 3L92A 5D3QA 3H6KA 4YRFA 3GRRA 5KPDA 3FFWA 4AY6A 4DADA 5FR2A 2SKCA 4Q15A 5IK2A 4B3TB 4UFOA 4NBSA 5E4FA 3FRIA 3QKSB 1G20A 4F4IA 3LRPA 4PHTA 3RLIA 3RPEA 3EBOA 2ZZNA 2G7ZA 1EH5A 2GX6A 3Q12A 2HI0A 2EOAA 2WD7A 1X42A 5EJEA 4MUAA 4B45A 1P72A 1F4LA 1V2GA 1MNAA 4EG1A 2JVIA 1JFSA 1SC3A 1GSIA 2WPDA 1T2VA 1MDFA 2RHMA 3FA2A 4ND7A 4EW6A 4P82A 1P62B 3ICPA 4OYLA 3LBIA 5BSEA 3E9QA 5KNLA 4R2XA 3WAKA 1DZ3A 2ZUEA 5LVAA 4JP3A 5WRFA 2XVAA 3K4PA 1YCGA 3PFFA 4Z51A 1CDEA 4HAVA 3EWSA 2WJJA 4KK4A 1AV6A 1TJ3A 4R9NA 2BSAA 5ECWA 3NI2A 5AHOA 4F85A 4RQTA 4JI8B 1DAHA 3V8RA 1ZCBA 4RZUA 2XB9A 1QVAA 3LX6A 4PC2A 3ESCA 1AKRA 4TTPA 4WERA 1L4HA 5KOJB 3ZD7A 1MBZA 2DTEA 2IWRA 2V6BA 2VQ3A 2G77B 2JA2A 4OP2A 4NBWA 1SZCA 4X3OA 5MHTA 4ZV7A 2IHJA 1ZM2A 1X77A 2FQXA 3AY0A 5IUNC 2XQGA 1DDOA 3OE1A 5IBCA 2G9UA 1R0SA 3DVLA 3TJZA 5EHQA 4ZZ1A 5LQRA 1YK1A 4P0QB 1A9ZA 3UGKA 3KEGA 3H17A 1EWKA 5J40A 5DIZA 1ZD1A 3DO5A 3I39X 2RGAA 4FEGA 1CW2B 2X58A 3RVOA 3WC4A 4BNXA 1FU4A 1AUXA 1W6RA 2XMDA 3HFRA 3AHIA 4ZU1X 3UV7A 2R8YA 2JLSA 1RWQA 2NPOA 1RMQA 4E4YA 1FFDA 2BZSA 3K2EA 4L02A 2LCQA 1NATA 3NAZA 5LN1A 5HJ5A 1ENYA 1JG2A 3NGMA 3JQBC 3FZQA 1QGDA 1T34A 1YZVA 2WWHA 4RD0A 4V0MA 3X1YA 4TVSA 3A9UA 4KMOA 16PKA 4HQRA 1XAJA 3AT1A 4CETA 3K92A 3HI6A 4NR0A 4KAJA 5EE5B 3C5HA 2F00A 4BV8A 1O87A 5E2BA 4UNQA 5IZCA 3PNMA 4XZ3A 2X77A 1NYQA 4LVNA 2B5WA 4CFYA 4NESA 3H9CA 4X6YA 421PA 1RWOA 1U2EA 1JKJA 4NS4A 1FUIA 3ORSA 5AI9A 1U2DC 1GLVA 3ESRA 4C1NA 2O2CA 1CUSA 4K9KA 4W5QA 2JFZA 3RUIA 2AN4A 4UU8A 3PGJA 4JBGA 4Y2XA 3JAMA 2BMVA 1QYCA 2VJMA 2FWMX 3ZX4A 5TGTA 2EP5A 3A25A 2WU4A 2ZW9A 3HA3A 4KMRA 1PR9A 2JKYA 5A9SA 4IDNA 1VPWA 1V4NA 4FFLA 2Y76A 4DA6A 4L9RA 2HK6A 4DSZA 1PV4A 1Z25A 2CHVA 4OB6A 3WWPA 4NCBA 5KTMA 4AQ7A 2I78A 3C85A 4UHBA 2ZSAA 4OL9A 4AJIA 2PTGA 4BZZA 1VLHA 4ZYVA 3VPSA 4GMGA 3V8QA 3THYB 2XJ4A 3IAS1 1O6BA 2XOXA 3N7AA 5LP6B 1ZWLA 4RHCA 2VZLA 2VJMB 3MZ0A 2R751 5DXFA 4DM7A 1OJ7A 3BUSA 2B21A 1C14A 4MTCA 2VIIA 5EP2A 4BO1A 2ZBQA 2I9PA 4E21A 3VVCA 2CJXA 4A27A 5T57A 2C3PA 4A0FA 4YT4A 5IKPA 4BFVA 2PX8A 4RIFA 3PHBE 5LR6A 4QEZA 3E8MA 5KAPA 2GM9A 2VT6A 3C7CB 3Q72A 4BJ3A 1FYEA 1Z35A 4C2AA 3ETNA 4PIPA 5HUHA 4GRAA 4CN8A 5EMJA 1W36C 2B8TA 4RNCA 5IYZF 1NQOA 2IU0A 3ZW8A 2GZDA 2ZBGA 3KQWA 4HQLA 3TBKA 3V8BA 5FP0A 1DC6A 1XD9A 1Z17A 2B3DA 3X2FA 2PKEA 1QCZA 2N9UA 4CYMA 5JJCA 4I8XA 4HXFB 1Q5PA 5F77A 1RIFA 3M2TA 1JT2A 3HKDA 3FGOA 4K9RA 3TXAA 3V7FA 2P3QA 2BOVA 3KIPA 4NG4A 4KREA 2AKAB 2ZBEA 2VOEA 4LKOA 1K9SA 4G84A 4EBBA 4CL8A 3W4KA 4WLOA 3T4UA 1E66A 1SBCA 2W83A 1XTKA 4PLVA 4DLPA 1AGRA 1GVHA 1MABB 1PT5A 2KQUA 1UXHA 2WF8A 4WZZA 3C4VA 5K20A 1LWNA 2IYOA 1B0AA 4KAFA 3HN2A 2EJCA 2ONKA 2JCVA 3HVKA 1I0IA 4DJEC 3VSCA 3AP1A 1SHTX 2G9NA 4BLTA 1AO0A 2R84A 3FW1A 3OZUA 1P5ZB 4DLYA 2JDID 4G24A 1ZGHA 2GEFA 3P9CA 5LMCA 2CL5A 3Q10A 1KYQA 1NXWA 2IEIA 3BN3A 4L4SA 3NDPA 3O4VA 4EZIA 5BR1A 4V3CA 2D2IA 4RH0A 5T3UA 3VC1A 1MJGA 5HQ3B 3HNPA 1K2VN 3KFLA 3L6DA 1AZLA 1TCCA 2FMFA 1H85A 4I36A 4IJVA 4IVRA 1J8MF 4L5YA 4JP2A 4LA4A 1MORA 4MEBA 4RH1A 4KPFC 2P0YA 4PYJA 4ZWNA 3OPYA 1JR6A 2ODAA 2XTZA 1XHFA 4WCFA 4FONA 4B3CA 3FIUA 2EKLA 3BFJA 3DB2A 3JATA 5AJYA 1WCIA 3N5KA 5CEFA 1ZMRA 3BE4A 4JQYA 2FGJA 4B85A 4LDRA 4DC0A 4MTLA 1TYEB 3D8BA 3D4LA 1JDZA 2YWEA 2IIPA 5L3RA 1L1FA 3ZNPA 4B4UA 3ZG6A 3WLLA 1NE7A 3CRZA 4Q7MB 2PBLA 4HRAA 4DLAA 4Z6KA 1D1TA 2XZTA 1Z7WA 5SZIA 2O8DA 4UQLA 3W04A 5KKNB 4P9NA 2IP2A 3OZBA 1SXJE 1RTTA 3OPYB 2N1BA 3L49A 4WCFB 1OZHA 3UAYA 4CR6A 13PKA 1K6MA 1N3LA 4MI9A 1V11B 1UBTS 1JHQA 2VH5R 3OFJA 1CY4A 4LXXA 1T1SA 2YQZA 2GD1O 2BMWA 2Q9AA 2IEGA 3PGKA 1ESDA 2Q2OA 4NMMA 4W1RA 4BMXA 3N39C 5LBIA 4NAVA 3VTZA 1IONA 3BRSA 5JUWA 3MJFA 3JD1A 1JGTA 3QK7A 5ALKA 3OJEA 4UBLA 2ZRCA 3H8SA 4JXJA 3EPKA 1XPRA 2GA9A 3KUCA 1GITA 1FFAA 4I55F 5HMLA 4LZNA 3KUKA 4RFLA 4MUJA 4EF4A 1GA4A 1WHSB 5CA0A 3GOQA 2YHUA 4RLSA 3A1TA 3JQRA 3A4VA 3PXUA 5JNTA 1Z2OX 3O4RA 4ZQFA 1F60A 4JT4A 1ID1A 2H2GA 4CCYA 5CFMA 4OX9Y 1SU8A 1DJQA 2I22A 3OY2A 5KYGA 2VJQA 3T9DA 2XNSA 1EG7A 1DKRA 2CNWD 4FSDA 1KMCA 3SEZA 4RQBA 1I94B 1QM5A 2XB4A 3F97A 4YRAA 3P8ZA 1TZMA 3DFZA 4IL5A 1L7QA 1F2TB 3A10A 3QMMA 4HH1A 2ZPAA 4PYIA 1QRRA 2NZYA 3N2KA 4LGCA 1EJBA 4RIGA 2ZWPA 3F7NA 5CA0B 2JZOA 4BB9A 3A3OA 3OY7A 1CBUA 1VLQA 2WZQA 3H3FA 2XTAA 3NVDA 4CG2A 1Q22A 1XHLA 3OLVA 1ZNWA 2C5BA 4FZVA 2HZ7A 4CCYB 5JNRA 2VPYA 1O94D 5BUSA 1N6NA 4EGQA 2R97A 3ROXA 1PKXA 2FE1A 3ZGYA 1T9AA 3WLPA 2O6LA 5CH8A 4HB3A 3VNBA 3PENA 1Y1QA 1IUKA 1N2IA 4CLHA 4DSAA 3MB5A 1SRQA 2IUYA 5FULA 1OILA 1W94A 3INTA 1J23A 2IYPA 4LHXA 4M1EA 4NBKA 1JJ7A 4BE7B 1NI4A 2P27A 2TRSB 3LI2A 2PLFA 4K6GA 4MVJM 5L7WA 4JXZA 4Y6OA 2BM8A 3DZJA 5F2OA 2QY6A 3CZ9A 4K6OA 3KSBC 2PL1A 3N07A 3PNLA 2F1KA 3IMEA 2B99A 1DTWA 1KZGB 3DDNA 3LLMA 4R84A 1PR2A 2XV1A 2Y68A 1IHXA 1MX5A 3F9RA 1Q0TA 2P7IA 3FPHA 4GZ3A 3MOGA 1J0CA 1C1XA 1QX4A 2IZ1A 2R7LA 2VSQA 3L0YA 5HS4A 4J1SA 1DUVG 2G09A 1PS8A 1NI4B 2D0PB 4GG1A 4LC1A 3VNUA 2I67A 4ZI7A 3V8MA 1XD2B 3G85A 3UUWA 4U1RA 1YR1A 4KDFA 4PW0A 2AWOA 4REQA 2FRXA 1ODSA 2RARA 1KFBB 5TR9A 1GTL1 1USUA 2JI7A 4KLRA 4UCXA 4XIFA 2QSZA 1KOGA 1G3QA 2HO4A 3QFHA 4J7UA 4BO7A 5ILOA 1SCDA 2AQHA 2ZDGA 1C1XB 2B82A 3OAAD 4ZZ2A 4F5ZA 3EDQA 2R8PA 3C48A 3DMHA 2IHNA 1Z3IX 4FZRA 4X64B 3KETA 1XR3A 1SIWA 2XUAA 3S1AA 3Q9NA 5CT6A 3ZWBA 5IDXA 1U04A 2F1JA 3DW1X 4ZI7B 1QBKC 1T1RA 2ZIWB 1K7EB 1MIOA 3ZZTA 4REQB 4DCGA 3ZXSA 1JPNA 2E5FA 3DE5X 5KZMB 4I4LA 2PZ8A 2P5UA 2PZGA 3L0DA 1HDEA 4Q82A 2HXSA 2XVMA 2AGVA 4L8GA 4LHSA 4UHJA 1TU4A 1E1RD 1YB5A 3DAOA 4JK3A 1JKFA 3AMVA 5CH5A 3F90A 3H4IA 3CT4A 1WVIA 5HHTA 2H8KA 3QVGA 1I13A 4ZVVA 5KVAA 4FDTA 1VL0A 1TD1A 5DYYA 1R6VA 1U7XA 3S1AB 1DRKA 2AV6A 2F64A 3A37A 3UPDA 4DSTA 5JVDF 3EPJA 4NATA 3OU7A 1X0VA 4WK0B 4HLUC 1SB9A 5AOAA 1CUFA 5LP1A 4AY2A 5DGXA 2AHOA 1F6BA 1AMNA 4DUGA 2JIZA 4GSLA 4HH4A 1SVNA 3BCRA 1TD9A 1UDRA 1XCJA 2YINC 3I64A 1JG7A 3EWIA 2O0KA 1TA4A 1IZ0A 3QVGB 4WNYA 2B94A 3SN6A 1YR6A 1G5QA 2RGDA 4B0PA 5KHLB 1VCOA 3IEPA 2FPRA 4M37A 2I91A 2VPIA 4UFNA 1EUCA 3AZPA 4K6MA 4O2RA 3NXKA 5FI5A 4AB1A 2FRVA 5J2TA 4ALNA 1UKYA 2PIAA 1DRWA 1T2FA 2AKYA 2WOOA 1ZDMA 3ELWA 4XGRA 2PKRA 5G0SA 2ANCA 3NONA 4R69A 3QPVA 4UAGA 3HTXA 4G9BA 2FMIA 4CMBA 1KI1A 5IN5A 4H08A 1N2CA 4WACA 4B4VA 3NHPA 4EUNA 1I2DA 4Z2AA 4BC1A 3EIHA 1V45E 3HLKA 3N3AC 4E3ZA 1EUCB 2HQRA 1ML3A 1P0MA 2TECE 1H8HA 4Y0AA 3SX0A 4JBNA 1YKGA 1CZUA 3BMNB 3JQEA 2YC2C 5J2TB 3ORFA 1EB8A 4H77A 4KDCA 4GP7A 1U2RA 2UDPA 4CT0A 3ZI4A 3BMOA 3LQKA 2OD2A 3OE4A 4WLFA 4MP8A 4HL6A 2EFYA 2YC4C 2GXSA 2YJTD 4YMUA 3R7BA 2ARKA 4DDKA 1LUAA 4PYNA 1Y6JA 5DGTA 4E6EA 4R2HA 3F7MA 5F7OA 5JD5A 1LPAB 1QP7A 3MK31 3QIAA 1DXYA 1UJ2A 3C97A 3DKVA 2J7PA 2HA4A 3P9YA 5C7YA 3L8CA 5F1KA 1GNVA 2JG3A 1ZGCA 1JRLA 3F6YA 3WYCA 3VU9B 2CXSA 3S4YA 2VNIA 2KX7A 3SC6A 3ETCA 2FEXA 1BYIA 1Q83A 1IY9A 3BMOB 1FLDA 2UUPA 2QM0A 3OURA 3L4SO 5EIOA 3VM6A 4CL0A 1CNEA 2HSZA 3NKVA 1TVEA 4BPRA 3PXAA 3JARB 3GJ5A 1BDMA 4MPDA 4HS9A 5HWSA 3WIUA 3B2NA 4IXMA 1KDVA 2V1XA 4A2CA 4ZGBA 1FYDA 1YHNA 3BL6A 3LQ2A 4HQNA 1P4RA 4N8SA 3A1NA 2I54A 3O4FA 1WMEA 1TYAE 3IUEA 1SY7A 1P1HA 5TQVA 5A0TA 1L3CA 1EFRD 1BMTA 1H2WA 5DLYA 3DLAA 3WIEA 3NJ8A 4A8TA 3CLUC 4PN7A 4J75A 5FADA 4ESEA 2CFIA 4QUAA 3CZMA 2GAFA 1CUWA 2D74A 3AFMA 3O93A 4JDPA 5IUKC 5CDUA 3DV0A 1C1HA 2IDJA 3IP6A 1W48A 3K5IA 4ID3A 4UMVA 4XPIB 1KORA 4L27A 5CT9A 5BSWA 1SCBA 3R3ZA 2D0DA 5J5AA 5JMPA 5I4IA 1KMNA 1X1QA 2V65A 2VJDA 3K70B 2FEPA 2AVDA 3F6EX 3RKSA 2FW1A 1JF8A 2DETA 4C7XA 3TDNA 1RZRA 2J8ZA 3IPXA 3UOGA 4B6RA 2Q3EA 2GXAA 2CLMB 3U3ZA 3QFCA 5AI0A 5FV4A 5K0GA 3NT5A 4LFAB 4OGWA 4XOUA 3NEYA 3BL5A 4V0RA 4DMKA 5HKOA 4X24A 1AF4A 2RCYA 2X13A 3DV0B 5HA5A 5D1NA 5FB3A 5BW6B 2F9LA 4U9IS 2QMQA 3KELA 4M1MA 5DN6A 1AU9A 3T1VA 3WV5A 3P2EA 3EA4A 3AF2A 4M4SA 5HTKA 4AF6A 3R7WB 3U3XA 4PO9A 2X42A 3AI1A 3B52X 3JU3A 1EX7A 4XD7D 3K9FC 2W2VA 3FTCA 5JPCA 4R1QA 4OK3A 3HVRA 4E5KA 2QNBA 1DQNA 5I9MA 4BQRA 2ENUA 5I47A 1QB8A 4RKWA 4MMXB 1KP2A 1N8SA 1N5KA 4FW8A 3FLEA 1S2IA 2Q6OA 1LNQA 1YJ8A 2BL4A 3AI2A 5GVRA 1AKMA 4D3DA 2ZJ6A 4PSUA 1A5AB 1KI2A 2Q3DA 3D4IA 1A5ZA 1BWQA 2JBAA 3GLVA 4P34A 1UFKA 4W7HA 4CM9A 4LF7B 2XHEA 3QWBA 3HU1A 1M6YA 4S35A 1WSAA 5FBWB 2RI6A 4HOYA 1RFLA 5LOVA 2DKFA 4A16A 3QVXA 1POXA 4RX1A 4DJ5X 2WMOB 1ZVVA 1SC9A 3QGMA 5BSTA 3WGVA 1NGSA 2HA2A 4E70A 3LUCA 3QFSA 1BYUA 1BOFA 2FLWA 2WHPB 3CLVA 3MFQA 4QBKA 4QX6A 5ALDA 2FH5B 5FWAA 3TQRA 4R41A 5E0OA 3SK0A 4LV8B 3VH2A 1Z7YA 3NHKA 3QKUA 1QH1A 2BELA 3OUTA 2OCIA 2R5WA 3A05A 4ARZB 2G1JA 3MCAA 2UXDB 2A94A 4JYMA 2D62A 1YS1X 1KYVA 4OGGA 3A4IA 4B3GA 1V0JA 4XYEA 1DFHA 2IYXA 5E0KB 1V71A 1X1BA 2JFQA 4EOGA 4ZAWA 3KQKA 1BG6A 3A6JA 3KJFA 4US2R 3R3YA 3PR2B 5G3YA 4Q37A 2G72A 1RS0A 2VDOB 4ZOBA 4H16A 4KUHA 4MUKA 5LQSA 3TOVA 5CB4A 1YHZA 1H6CA 1QH1B 4Q66C 2WSMA 3FRHA 2DC1A 1RAAA 4HFMA 5T64A 4ZIRA 1JPUA 1C7QA 5IJAA 2YNMD 2F3TA 3BKWA 4P53A 4L5AA 4LK2A 3ZU3A 2EERA 2P11A 5JTUA 5L53A 5DX8A 1C8LA 2QQFA 3K2QA 1UBEA 4F4JA 2HSEA 5K0NA 1K7YA 5T6MA 2FZCA 2RHRA 5IJ9A 3VTAA 1LNZA 1YIOA 1ZLXA 4FBGA 7REQB 2O5VA 1E98A 1JAXA 2I99A 3ANMA 4G81A 4HBZA 2X9GA 3DVRX 1GHTA 1Y9AA 2M1ZA 1YZGA 3W0LB 4DJTA 4ZIRB 4R1LA 4AM8A 1IN1A 4TZ6A 2W98A 4WGFA 4KPYA 2W4QA 5I4KA 5BY2A 2WKQA 2C31A 1RQXA 1BZYA 3NKLA 5AVJA 2P2CA 5LU9A 1XB2A 4NMXB 3I5MA 1GCOA 4GGOA 4FOLA 1DLIA 2IXBA 3BEDA 1P2BA 4GYKA 1SXIA 3ZW9A 2ZPUA 4AZ3A 3CKKA 2XYHA 1K8RA 4PLZA 2K5UA 5TPWB 1V39A 1G21E 4LY9A 1JEJA 5EIBC 3W8EA 1NA5A 1BVHA 2G5GX 5K0BA 3PF8A 1GL3A 4AN4A 2QDKA 4KITB 5IZCC 2C7BA 4H1WA 4UOEA 1DNPA 3K7EA 2YS6A 2ECFA 3NGXA 1QTNA 2VQ6A 3OQPA 3KT6A 4S1NA 2YFQA 1K68A 1XCOA 4FGSA 4D57A 3FR7A 4KQ2A 3KD2A 1TYDE 1JFFA 2X0JA 3PF9A 1SG6A 1FX1A 5KJ1A 2B8NA 4AZ3B 2H51A 3GAFA 1RXEA 4B3XA 4C7VA 1RWKA 1MJGM 3DT9A 3UOWA 2NM0A 2JLBA 4TS1A 3U4GA 4BNYA 4X6XA 2QYTA 3FBTA 5LP6C 3EGEA 4EG5A 1ZZEA 5EIBD 1B0UA 1LPMA 1R4NA 1HTTA 1X15A 2PEZA 3AF6A 2GJ4A 4ZQGA 1EVIA 1RMTA 4YDQA 2VHEA 5DDIP 2P2YA 3QVWA 1Z0IA 4JKIA 4L08A 4O2AA 5CU7A 4JLWA 2P4UA 1AJEA 2HHCA 2Q21A 3Q3CA 2MINA 4L5JA 5A4AA 1ZA2A 3C70A 4JLJA 2FJUA 2P6MA 1RBMA 1Z8FA 2QGZA 3TLGA 3VBEA 3AM1A 2A9KA 3KM0A 3BXZA 2XF2A 1CHNA 2WFLA 4IFBA 4D4LA 1R4NB 5HIJA 1LDGA 3QBTA 3T5BA 5JY6A 1HX7A 1PKEA 4I50B 2IVFA 2V74B 3QYPA 1KYYA 4R0VA 1JU4A 4ZVUA 1DQRA 2W0SA 2W0MA 2OV6A 5DOZA 2ERXA 1VGVA 2OA0A 1NMQA 3SQLA 3T94A 2I55A 1UKZA 2RHHA 4MVJP 4OQPA 2MINB 3RJ9A 4A36A 3QE2A 5BURA 5EQTA 3D1JA 3TLGB 1W29A 2E48A 4Z4HA 2OAP1 2VHWA 1U0BB 2IH5A 1RE0A 1VI2A 2OL4A 3UFBA 3U16A 4TYNA 2WFLB 4TKVB 5GGYA 2EX0A 3GDFA 5KQPA 1E1NA 2QRUA 1YU9A 3M2PA 4IIJA 1MPXA 2D7CA 3R4VA 3GUHA 5K6AA 3AQ4A 4LZJA 2GWRA 5KYKA 3DP9A 1JFRA 4AG6A 2YMPA 4ZI2A 3FLAA 1DUSA 1HH4A 3IT1A 1E4YA 3RNOA 5KINB 4KKXB 1PW5A 2QT1A 1D8TA 4HB0A 2P3OA 3TL2A 3VJRA 2HMUA 5CX4A 5JH7A 3C1AA 2IV7A 2ODBA 3GFTA 3OPVA 1U3CA 3RSSA 3OU6A 4UKDA 1W9HA 1I1OA 1Y6RA 1MJNA 3H83A 1OAOC 3EVEA 1VPDA 2JIDA 4JLBA 3N28A 3LPCA 1OX5A 2QPAA 4IIJB 2PPVA 4PU0A 1ULUA 1H94A 1KVRA 3C8DA 4FNAA 4URFA 3G2KA 3K6SA 1Y5IA 3VR4A 3G2JA 1O95D 3UXMA 2GAJA 2R8XA 3HCFA 4UZFA 1AMUA 1RYYA 1Y3CE 1ZUIA 2D54A 4LG1A 3KOMA 3V32A 1HT0A 2IITA 2FWNA 2Z5FA 2DFTA 3F78A 2XBLA 5JH7B 1CZOA 1I7LA 3WLKX 3FDXA 1YACA 1K3TA 2NXNA 2ZUDA 2OB1A 4I9HA 3EAQA 3ESQA 4WCFC 1KXZA 4BTEA 1C0PA 2JCXA 3LVRE 4UJ5A 5KJFA 5HPYB 1R3UA 2FSPA 1NF3A 3TVTA 2AA3A 3DMNA 1GQQA 5HJ7A 2UUBB 4FSHA 4LHVA 1GFSA 1PRYA 3I83A 1W5AA 3WI7A 4RXTA 2FOIA 1CNFA 3Q0EA 2QLLA 3H7IA 3L18A 1QR6A 4UU0A 3SKVA 2V6FA 5BYBA 3R5TA 4J16A 5T4HA 3A3KA 2H18A 3IQZA 3PPWA 5EKSA 3RJTA 1WE2A 4HO1X 3UBTA 4EMSA 3VYTB 3URMA 2CFSA 1GQRA 2XRYA 3N2IA 1TQ8A 2NU8A 4DQXA 4ENQA 2E55A 1NU8A 1NN5A 3D8SA 3F5FA 1TTPB 3A1WA 3TQOA 3VR1A 1RJ9A 3OUUA 1V41E 1QGYA 1KZ6A 3W2IA 1OA0A 3FVQA 4R1OA 4RPGA 1BE1A 4WFQA 3GRCA 4YDSA 1FOEB 3RTEA 3OJCA 1BDHA 1FNMA 1V1RB 1RJDA 3BQ9A 4LCJA 5ILQA 4TYYA 2C54A 5L3SA 2D7DA 1L8LA 2E21A 3P52A 2Q6IA 1ZI9A 5EUMA 4BQEA 3ADBA 2FUEA 5EXXA 4ZYTA 3IIJA 3QMPA 3H0KA 5DGCA 2C99A 1SQFA 3UK6A 3ZOKA 3OI7A 3AVVA 4DHEA 3VHQA 1WKBA 2VP6A 2GB4A 3OTIA 4D92A 2D5BA 5EJ7A 5B2ZA 5KVSA 3V1LA 5F2EA 4L7QA 1Z56C 3EPLA 3KFXA 1EHYA 1RC0A 4MLZA 2E4ZA 1QGOA 1WXHA 4EVSA 5L3SB 1YQDA 3LBFA 2P9HA 4NOMA 1WUTA 3LV8A 3RYCA 4AG3A 1EDOA 1XEXA 2XNDD 3I9FA 1HFWA 2AQIA 1YRYE 4TZTA 4ON9A 1EGVB 4EHJA 1IMJA 3LZCA 4D3FA 4E13A 3UKJA 5H16A 4O3MA 2LIPA 2DPYA 2D4HA 2DH5A 2PQ2A 5EXDA 3RM3A 4LRSB 1FRFS 1KQFA 3OCXA 5CXSA 2I4IA 3R9IA 1E60A 3TDMA 4HYEA 4QUKA 2IHVA 2X1LA 3BH6A 1X13A 3OZIA 4GC5A 1JS1X 2L42A 2RMKA 1GTJ1 1IATA 1RD4A 4PG7A 4UVHA 4C06A 4EJSA 2BGGA 4R71A 1AZSC 1E59A 4AD8A 3OQ6A 4GAEA 3KQYA 2HY7A 3RYCB 1RRVA 1KI7A 1XEXB 5CH3A 4ZJUA 1JSLA 1VBNA 3G1WA 1IE3A 1K6EA 4ZYZA 2OG2A 4GI5A 5BQOA 3LC2O 4I8IA 4QSHA 4DCSA 1H2XA 3WGJA 4ZDJA 1P1CA 3Q9UA 1O6FA 1JMYA 3EVGA 1XZPA 3S6JA 4EATA 1RZUA 4BFXA 1K08A 4CQNA 3KB8A 3QLUA 2ZRQA 4X66B 4TLEA 1TF7A 3UWSA 4BRZA 4PLYA 4EJSB 5B7QA 4TKMA 3QEMB 4ROSA 2G63A 4M0LA 1EB9A 3RROA 4CMIB 2VQFB 1UJ5A 1Z2DA 1MQ8B 3KSZO 1SPXA 1YQWA 1D2NA 2DFVA 1T8TA 2FTKE 3NLLA 2YTZA 4H9GA 3W9YA 2GGSA 1QORA 3WWYA 4DSUA 4GEKA 3PDCA 2C8KA 1E7QA 2HCBA 4Y2GA 4CLEA 3UMJA 3U44A 1L7NA 1EDBA 1RXSA 3KQTA 5FKJA 1X2BA 5GOTA 3UF0A 3QHPA 2ECOA 3L6OO 3O84A 1L4YA 2POCA 1CC1S 1X7XA 2W8ZA 4URWR 2RKWA 1YHYA 1OR8A 3MLEA 5L45A 5GMOA 2FN7A 2BGMA 3EC2A 1ISGA 3O3MB 3UG7A 3AHEA 3JXEA 4AJLA 4D9BA 3KKQA 3E1KA 2QP3A 3F46A 3H1AA 2C57A 1RPJA 3SGLA 4FCTA 1YVEI 1RNLA 4D5GA 3ISJA 1AA9A 3LQ4A 3SX4A 1T6ZA 3JQCA 4Z4FA 2ZR7A 2EKDA 4K05A 1U9ZA 2B30A 1QOQB 4WT7A 3OE7A 3ZUGA 4TKLA 1R5JA 2E0IA 4HDAA 5FPSA 4YYZA 2GDJA 1VMEA 5BOSA 5HW0A 1U8AA 3EG5A 3KZ1E 4E22A 4EG0A 2PUAA 1GKUB 3X1DA 2IH4A 2PIDA 2OGTA 1U3TA 3EXHA 2CD9A 2NZUG 1HI9A 3HZZA 3ND8A 4KXNA 3GJZA 4M21A 4YQFA 2AVNA 1BU5A 3UMMA 4RTKA 3U0VA 1GU1A 3A4YA 1LDYA 1KEPA 3B6ZA 3BFXA 1U0RA 5KREA 1EE2A 4M98A 4RHEA 2IYVA 4EL0A 1JHUA 5GGXA 2PUHA 2C29D 3DF7A 5CT4A 3I9V6 3V9PA 5AW6A 2QLNA 1YJCA 3ZHTA 1HLFA 4YECA 3TRJA 221PA 1XTPA 3DCYA 1EXWA 3CUUA 3VYRB 3ZCUA 1RWXA 2GBLC 1G98A 2PS0A 4JMPA 1U5BA 3EXHB 1PZMA 3LCCA 1T3TA 2O3SA 1W9MA 3ANXA 3D9QX 4WCDA 2JZNA 4TKZA 1P1KA 4FHDA 1PFQA 4U8HA 2JKZA 4YJFA 1D2GA 1LDMA 3ZNNA 1M34E 3FETA 2CE7A 3TIIA 3WGOA 2OV2A 1TUIA 3K1YA 3OZFA 4JIMA 4DCCA 1ACLA 3O0TA 1L0BA 3B8HA 1AB6A 2CXNA 3A9WA 3FDIA 4JJ4A 4IRUB 1TE2A 4LJ9A 3HV2A 4CM4B 4EHDA 5KYYA 4L4UA 2ZM5A 1WSWA 2DLDA 4XWWA 4KWHA 1Y0BA 3NCHA 2J41A 3MGGA 4WLUA 4HAYA 2ZQYA 4NOJA 5DLEA 5FPKA 4R2MA 1T0JB 3SFTA 1Q95A 1OAKA 2WT9A 5JOQA 3TE6A 3N76A 4V39A 4B3JA 3SF0A 3MAAC 4RENA 2AW3A 4QQNA 1XU4A 1EBUA 5EP1A 4BFSA 4WL0A 1SD5A 2PD6A 2IHBA 3G5TA 1U3DA 1QZZA 3RE1A 4RV5A 2AFIA 5LL6P 3QUCA 1MGPA 3EZ7A 3LPAA 3C3YA 4AWAA 3VH4A 4DM3A 2HADA 2WBLC 4JR2A 4MA5A 5IJXA 1V8OA 4CUJA 4O4IF 1QIGA 3K16A 2JGFA 2YRFA 3DEZA 3SR4A 5K8TA 1V1MB 4GWGA 5A4IS 1IJFA 5I9IA 2I7VA 3IC5A 3RUAA 3PQCA 1J5XA 4ASUD 2QK4A 1E3DA 2FPSA 2X9LA 4OD0A 3KR1A 3ZQ6A 4BO5A 2PUBA 1XLTC 1R8JA 1EM6A 1G2IA 3OM1A 1SKQA 3KD3A 3LIPA 3WG9A 5GJBA 1YVDA 4EB0A 3WWDA 5MN6A 1I30A 1QV9A 2JD1A 4V02A 4DV5B 1RXCA 2WIJA 3PCRB 4GR9A 1ZH0A 2ZE6A 4JQOA 3LWDA 4GP6A 3RRMA 4C3UA 3LC0A 4CKWA 5IX8A 3Q98A 1WVMA 4J90A 4RJTA 1WUKS 3WRXC 3S2YA 5BQFA 1JKMA 1XZBA 2XYRA 3QJYA 3WSTA 3J81A 2WJVA 5J4VA 1EXMA 3CVWA 4CCWA 4UBOA 4A8PA 3K70C 1T6XA 3HG7A 3L7AA 3M5DA 1SC6A 4IDDA 3BPSA 4RF5A 1HY3A 1H2HA 1GO2A 2P4QA 3KZMA 2X8LA 3LQRA 3MWDB 4PRLA 1HR0B 1G8KA 3LX8A 2Q2QA 3PKJA 1TJNA 5T5QA 1T29A 2KI5A 1RRPA 2OKCA 3I8OA 4J0GA 3VJLA 2R6HA 5GONA 4LJ4A 3S2UA 2H4XA 3R5HA 3EXFB 3ZBUA 4EA6A 2ZT7A 3T5MA 4FYHA 4F2DA 3QNMA 3GHHA 2EATA 4ZARA 4F8EA 3L8YA 3CH4B 4IKOA 3VNSA 4F4FA 4EG4A 3K70D 3D2CA 2O8FA 2WHQA 1CR2A 4LOHA 5BV7A 5KWEA 1XL1A 1OYYA 3T12A 1I6WA 3TR5A 4EPTA 5JHGB 1XZAA 1VDZA 2QN6A 3C3MA 1ITZA 3LHKA 3CEPB 4YNBA 5GONB 3FHTA 4LXHA 1T5LA 3GQBB 3MPOA 4J7XA 5GM1A 4DCVA 5JXIA 5GP1A 4Q7QA 2WUFA 2GFHA 3PJGA 3Q6IA 1P61B 5C81A 4OXRA 4CNQA 2AEFA 4W9NC 3T1QA 3ZE2B 3GG2A 4RVCA 4Z3DA 4ZCMA 1SBZA 5IJ0B 2OECA 1RBQA 3ML1A 2C5HA 3R6TA 2O8FB 1Y5RA 3EDRA 3DT8A 4HDCA 4D9NA 1GG8A 3BCUA 4UTZA 4AUMA 3CF2A 1TAHA 5AK4A 4D3XA 2MDTA 3BE6A 3GGSA 2RIPA 1EP2B 3CUSA 5A06A 2DJIA 2P77A 3DCJA 4XGQA 3FPAA 2ODEA 1XDWA 5EZ5A 4D5EA 3WL6A 3JYQA 1T9HA 3K72B 5EWLA 4CI9A 3GFSA 3E9MA 4Q1EA 3PNPA 1RPAA 5IBQA 5IABA 1ZICA 3GCWA 4Q1AA 5CM9C 4RTMA 2YWCA 2RAFA 4RVHA 4HEA6 1M67A 4KO1S 5EKUA 4BCCA 2XE6A 1Y9JA 3G1UA 3A9RA 4OHKA 4JR1A 4PLCA 4IIUA 1IG0A 2Z98A 4CEHB 2ZFUA 3HWX1 1M54A 5ERXA 2XSZA 2AI3A 3UPUA 3PUYA 5EWLB 3VHRA 1GKYA 4JUAA 2H1LA 2PA0A 2XF8A 3GAMA 4INOA 5AVZA 1LBEA 2IYFA 3DD5A 3B38A 3NIGB 3VOTA 4TTRA 4Y2RA 2JAOA 3DZKA 5D84A 2WF7A 4PSKA 5L3ZA 4QOEA 4YMVA 4P4TA 3BD7A 2EBUA 4TTQA 3WMGA 1TJPB 2IX3A 2JJYA 2V7XA 4JASB 2BCEA 4DANA 2AOVA 2YXPX 5HS6A 1AZWA 1W5FA 1J2TA 4RACA 4V1CA 1CJSA 1QQTA 4FYVA 1S1CA 3D31A 2OLKA 4XQCA 2IW1A 3UOAB 5K0JA 4BB0A 4BQIA 2A30A 4C0KA 3D6HA 1IOWA 1L5HA 3HR4A 3R75A 3RBVA 2NXCA 2ZREA 3TLCA 1F0YA 2PKCA 4BNVA 1NZDA 2OMEA 5KOYA 1V9CA 4O4LF 2QL9A 1L5QA 2ZJ7A 1PR1A 5L40A 1Q1AA 2ECPA 4E03A 3GVCA 5B4UA 3EMKA 2AFHE 4KHPB 3ICOA 4EVRA 1OJLA 2A7QA 5KNBD 1L3IA 5ECYA 1VJ1A 2GJKA 1YB2A 1O0CA 2H2DA 2D4AA 4OATA 4MYHA 4YWHA 3NC0C 2XLCA 4CMEC 1HE3A 4DREA 1M1YA 2O5RA 1S4MA 4JVSB 1HDIA 3U7IA 4ZCLA 4M6WA 2IF0A 4XUDA 2B37A 4NZ9A 3H2ZA 4TV9A 4OH1A 1IHOA 4HWKA 4CW7A 4Z7JA 1IFXA 2PFKA 4RGQA 4MGZR 3MUNA 1ZJWA 4DV7B 3KDSE 3DBRA 2AG6A 1Q1QA 1A97A 1NLYA 2GA8A 3GYGA 1J39A 2KW5A 2WYIA 2G5CA 1AV7A 2WWFA 3UMBA 4PGGA 2QVCA 2C88A 3NALA 2GS9A 4I6GA 2OKGA 1YMQA 2D6FA 2J87A 4FLEA 3NM6B 4I4TA 1M2WA 2C8JA 1XTBA 1HFJA 2X4DA 3INGA 4X20A 1M76A 3SSAA 1JLMA 5KTSA 3CTPA 1UF9A 3STTA 3X3HA 4QXOA 3UJ9A 3QTBA 1QQAA 1NQ5A 5JCXA 2WUGA 3ZE8A 2QT0A 4MQ6A 3FH0A 3T9BA 4M1KA 4XVQA 3HXQA 3OKPA 3DAHA 4XARA 1Z7GA 1QAQA 1C7EA 2V7BA 4FFRA 2AK3A 3GAAA 3EVBA 1SO8A 4IS2A 2KWIA 4ZAGA 4NZPA 3SX2A 1R88A 1EXNA 1YRQA 4JJ8A 1S4QA 1X86B 1RLTA 2ZSJA 4GXTA 1FP6A 5HKKD 3UJ8A 5SY9A 4KL8S 4YUWA 1PJ8A 3BXGA 4RDHA 2PGAA 4ZAVA 2J9ZB 3MCWA 2VH2A 1QHSA 1M2KA 1WVGA 1FDRA 4GPBA 4RS3A 1D6SA 1QO7A 2KJQA 5C34B 3C3CA 4BASA 7ABPA 4WZBA 1E1CA 3I05A 3VXKA 5AM4A 3PTAA 2XWBF 4U7GA 1VGRA 4P3YA 1XU9A 3H3JA 4P2BA 1H9CA 4RCYA 1VJCA 2ZCUA 5JS7A 3QV2A 3HUDA 4GE0A 1WDTA 4IQ4A 4U2BA 4DUZB 2COEA 4RGVA 1BH6A 4UTOA 4WFKA 3RW9A 2CVFA 1B42A 4AY3A 3WR5A 1L5LA 5B36A 3EYAA 4JVMA 4GI1A 1QQ6A 4XE5A 3HO8A 4Q6BA 1XMIA 5A1JA 2IDMA 1GYPA 1QRAA 4PY2A 3BWXA 5LQAA 5KO2A 3ZZ0A 1UXOA 3V7NA 3OM9A 1QPGA 2ZYDA 3P2KA 4FS8A 4NBUA 1F1BA 1ZK3A 1E1CB 5KDOA 1AQUA 1LK0A 4S0XA 2C3MA 5C0OE 1TEXA 3K9CA 3UAVA 3VPHA 1IZZA 3ZLBA 1T0HB 4C4SA 2ZUBA 4BWVA 4HNRA 1L1RA 2OXIA 4AF7A 3IUNA 4RC9A 4C4ZA 3D7MA 1J8QA 4OHXA 1S3SA 5DH9A 3FTEA 3TGPA 2VXYA 3BEOA 4NE9A 4H1HA 3UJCA 2XECA 3NETA 1NTRA 3NTQA 3NAMA 4I7EA 4EB8A 5AJHA 1VTKA 4W8OA 3F9CA 1BA2A 2FPLA 2VO1A 4AU1A 2EW1A 4I6EA 1PR5A 4YMSA 3J81k 2YYZA 1Z4QA 5AW4A 3COPA 1GUZA 1E4EA 3FSGD 1KKUA 2BBSA 4BO0A 1WO8A 2CVQA 4XVUA 4TWIA 3F8TA 1C2YA 1Y4SA 3M34A 4C22A 1ELOA 1GNLA 2X2FA 5CCBA 4WY2A 1QONA 2DRIA 4R5HA 2A2ZA 3QG1A 1LLUA 3MNFA 2PMDA 3MBKA 1I33A 4IF4A 1I51A 1U81A 1XJQA 2QBYA 1NVMB 3EEQA 4U6SA 3L6BA 2BC9A 2GWHA 3JAKB 3U7EB 5BW8A 3R0VA 3JVIA 3WMFA 2VATA 3BGIA 4WCVA 5I9LA 3EVFA 1CUVA 1E4EB 4Y2YA 1IB0A 3EG9A 3PWTA 3WQHA 3EQ8A 3RIGA 1G6HA 1IL0A 3TNYA 4E4TA 2A88A 5A6VA 4KQCA 2XAUA 1SXJA 2AEJA 3CH5A 5F98A 2ZYAA 4WASA 1E9DA 4JI3B 4Z3KA 1GN8A 3ZY2A 3O1IC 2TMGA 4L4YA 4WFJA 2J59A 1TZKA 1MB9A 3AY3A 1E0DA 1T2EA 2AQKA 2WRZA 4NTZA 4P5PA 2OPHA 3RB8A 3WKAA 4L76A 1GYQA 1JHMA 3OOJA 1XVLA 3FWYA 3KQMA 4OJKA 5DMXA 1KSGA 4LV6A 4L72A 1KVSA 4J16C 5SICE 1K2WA 3EG9B 3P0JA 2Z2IA 3LXXA 2PRIA 3F67A 3AVYA 1G8FA 3KSMA 1TVCA 2FQQA 3K0KA 3LSTA 3O4HA 1SXJB 2NO1A 3D8RA 4KACA 3WBBA 2ZJFA 4RDXA 3K0AA 3MMXA 4CTMA 4HXGA 1FSFA 1OWNA 4P8RA 4JU8A 4K9SA 3W8RA 3QV1A 3Q8KA 2CF5A 3WA7A 3OZEA 1IBLB 1TO1E 5HM8A 3OFSA 3IQWA 4L4XA 1V5GA 2QXUA 2V97A 2VHUA 3CINA 3KVRA 4JGGA 1Q7TA 1UJMA 2M6LA 3T1OA 3QVKA 1N3IA 2VHTA 3R3WA 2OGZA 1OXBB 4AG5A 1SVWA 3S5JA 1IUNA 3IMGA 1CQJB 4K6KA 3LWZA 1WEKA 2VKQA 5U9CA 2LP4Y 3SD7A 4QUIA 2A1UB 3OT1B 1R4MA 4ED9A 1CNMA 5BW5A 3IFSA 2PZLA 5BQ3A 4IY1A 5DX1A 1UWVA 5A2QA 1SCKA 2BSXA 3F6SA 3I6YA 3K96A 1QU2A 3V1TC 3KJEA 2E49A 3JYNA 4WOCA 4XQEA 1CS4C 5KYUA 1KDYA 3UWPA 4B7UA 4TSFD 2YDXA 1NQXA 4ROTA 2NG1A 3NXSA 4ZEMA 1IWOA 4P5DA 4HGRA 2HU2A 4WD3A 2FW6A 2B9EA 7ADHA 1H22A 1WSBA 2ZBDA 1XZCA 4D9CA 5IANA 1XWIA 2LZ0A 1GNPA 1RM5A 4EELA 1A4UA 1KKMA 2JASA 4INZA 2DG2A 2AR9A 3BK2A 4NXNB 1HQYE 5I01A 1OBFO 3BFKA 1T4CA 2NUPA 1SG9A 2OGSA 5A4FS 3KVVA 3K31A 4QDZA 1UXKA 2OORA 4DR7B 2XMCA 3I53A 4RPJA 3WZ2A 3RQIA 2OCAA 3QU5A 4OYYA 3MMPA 3OKAA 4Q3CA 1OGYA 4G01B 4IDGA 1B00A 1GPMA 5CX1B 2HW8A 4EJSC 3WZMA 3UK0A 2DUUA 3C1UA 5DSXA 3VDRA 2ORIA 1GA6A 4YRSA 1TO6A 1GOTA 2IYUA 1E0JA 3GJ3A 1W4AA 3VZQA 1ODLA 3AI7A 1TTQB 2FJ0A 2WIGA 5FPTA 1W49A 2XIJA 3A0RB 3RYIB 1Z12A 1U99A 4I1RA 3PTLA 3R74A 3T5PA 2XE4A 1IM2A 1UQTA 1FP4A 3LUJA 5KDLA 3REOA 3ZDCA 4R01A 5TF4A 4MDFA 3CNBA 4YAEA 4ZU3A 3IALA 3LUAA 4Q9JA 4L85A 2VHJA 2GZ1A 4MS1A 1SKBA 5KOIA 2WSIA 4XCXA 2HBQA 2QR2A 1L7XA 1PJRA 4FJ1A 4Z8XA 1VL2A 4JJAA 4NONA 3O95A 1IXYA 1GGNA 3LCJA 4HAUA 4H3VA 1U7HA 4XM2A 2UXBB 3GDHA 3ZK8A 4BLUA 4XCVA 5K8UA 1DELA 1H1LB 5CD1A 1WUJS 3L7IA 1K6XA 1JDNA 3T7JA 1FP4B 3CRW1 2DYKA 4ND3A 1ZK4A 3CH7A 4M83A 1Z37A 5FTMA 1ESZA 3RH0A 3DCIA 1L4GA 5L4LA 3PSHA 4RYLA 2H2FA 3DBOB 4YTEA 5EI5A 2J9YB 4Y6RA 4S12A 4MS1B 3RRFA 4D46A 4Z4EA 1BXGB 2A1TS 2IOYA 1KZ7B 3D02A 4HAWA 3IJEB 4C6RA 2YVQA 1FJHA 1MJHA 4ENRA 3JALA 1VGQA 4TXMA 5DSZA 4UUPA 4LNUA 3TQCA 4EDFA 4KO8A 2JPDA 1TM1E 3KUDA 3LWBA 3H9QA 4GOOD 5C2JB 3IHWA 4UCFA 1US8B 3PWZA 1EA5A 3D6VA 4NYIQ 1YGYA 3ZHZA 1A4RA 1SU4A 2GN1A 4ZKDA 5ADWA 3LPNA 2G8NA 3DZFA 2YMMA 3NYIA 4F86A 1S2NA 2V7WA 3EXHC 4MZXA 5B37A 2PQ0A 5IBRA 4ZAZA 1A8QA 1FFEA 1OBVA 2SNIE 3ONNA 2V7GA 5I51A 3W5VA 4LNUB 3EJWA 1E89A 1P4GA 1GWNA 2PG3A 4LRQA 4R05A 4O1MA 1W4LA 2SCUB 3S44A 2B5VA 1D5CA 1IXSB 1LVHA 2BHNA 2YR0A 4V0QA 2CVZA 4C0BA 4N41A 5CNJA 3EYWA 2EKPA 2PMKA 1DG9A 1UWCA 1W1WA 1J0XO 3VR5D 1KWKA 2YWBA 4LHYA 4S0ZA 2QAGA 2ZE8A 3NRJA 3OX2A 4UPVA 1FJ2A 1XP5A 3IAXA 1I6MA 2WWGA 1KK0A 2IEBA 4O4JF 1NF9A 1LS6A 4LMRA 4EITA 3ZJUA 3ZOZA 1J6UA 4G86A 3A1EA 3RWMB 3AG5A 5H80A 3R5KA 4QLAA 3GEPA 4D0SA 3N75A 4WJZA 3S68A 4MV0A 1F0PA 1HLDA 2FPPB 3CCBA 3CRQA 1N8NA 1NFFA 4JP1A 5AW7A 1JT9A 1X94A 4Z7NB 3L07A 3ZXIA 4NOLA 2QAGB 1NW3A 3RADC 1YO6A 1FJXA 1KY4A 4QNMA 5IH3A 4FBLA 121PA 1YAJA 2WSLA 3GJQA 4G5RA 1KI8A 3P9IA 3TRHA 2TMYA 3F5MA 3OM0A 5JRJA 2H29A 1P2GA 4YP1A 4AP5A 3ABZA 4ABTA 2PS3A 2ODTX 2Q6LA 2VBCA 4R83A 4AJKA 4ATNA 2M2IA 2WWVD 1F38A 4LTMA 4E5DA 1EFUA 4B3DA 2Y1XA 1Q6ZA 2I76A 4HB4A 4AJEA 4OAPA 2P2SA 3PFKA 2BVNA 1D2AA 4B3RB 2FUG1 2V7TA 1R6AA 2C2YA 1KK3A 2G83A 4IJUA 4PBRA 4QQFA 4OQMA 4UOQA 3FDZB 1JP7A 5HXAA 3CBQA 5C46F 1Q11A 5ULLA 3FOEC 5GAJA 2CNNA 5D01A 2QPTA 5B3JA 4E5MA 2FOLA 2XAAA 5LM3A 4OI1A 4LE2A 2XH8A 4L75A 3AILA 4HAXA 1RFGE 2Y8EA 2IP1A 4WIAA 3KQUA 2AG0A 3OLZA 3GMTA 3T3IA 4TL6A 3HCBA 4AKEA 2QTLA 1FVHA 4P3OA 4V03A 3EF1A 3S29A 3KKZA 4ZHQF 2E4AA 2LVBA 2R11A 4Q4DA 3EWNA 4EUKA 2EDAA 2FMUA 2NQTA 3FGNA 1N77A 1HQCA 1OH8A 5IKXA 1YTLA 3D0KA 1JUDA 3EVAA 3PQ6A 2RJ3A 2VF4X 3PVZA 4P4SB 1ADBA 1KR2A 1WV0A 3LUPA 2C5EA 3WYGA 2Z2JA 1O5OA 1IHYA 4D0RA 1NBHA 2VSFA 2C2WA 2EZTA 2ZWMA 4H7FA 5CNIA 1PLKA 3HKEA 2Q7OE 4OO3A 2QTBA 5LLDA 2H9AA 4FWBA 4EMBA 1JALA 1IWBB 1EK6A 4QXRA 4J07A 4I9FA 4UUAA 5EYPA 4DARA 2YBEA 1RI1A 3TSWA 4OG2A 4IPTA 4EEXA 4X61A 3WLFA 4AWBA 2PU5A 1J7JA 1U1CA 2Z2ZA 4WOKA 3J7TA 1IPFA 2FDRA 4YV2A 1UMBA 1GUYA 4UDNA 4N9WA 5J4KA 1CY6A 1YRHA 4M49A 1L5KA 1IN5A 3D6NB 3LKBA 3QUAA 4QT0A 4JXXA 5JJKA 1OGIA 1U7WA 3HKEB 3NT4A 2XDQA 3L7LA 4ZOQI 3IT0A 2WF9A 2NIPA 3B6KA 4LISA 4CI0B 1M5TA 4HVLA 3ZDBA 5IAKA 3PZBA 3UT0A 1UBCA 2FSSA 1XFDA 3BILA 4YJHA 3B9PA 2FZVA 3G7NA 4EHNA 2FW7A 4OI0A 1TLLA 2I29A 2I6XA 5HK8A 2H17A 4MIKA 1W93A 4BEJA 2CF6A 1HDXA 2CN1A 3TQTA 1T8SA 5JAIA 1BD4A 1DKMA 1GUBA 1RM4A 1EQ2A 1UMBB 2FG5A 5H59A 1AN0A 1IQRA 4I0WB 4J91A 2D1QA 2W58A 1KRWA 2HMWA 1M66A 4NFYA 4AZSA 1E2LA 1M7HA 3GCXA 1UZAA 4JODA 4HYTA 4P81A 4RK6A 2JIRA 4JT2A 1G8SA 3GJ6A 3KQHA 1N6IA 1YJ5A 2BGRA 4BMZA 4L78A 1NR7A 1L8OA 2FR8A 2ZJ8A 3HQ4O 3RBXA 4YJHB 2DPHA 3N59A 1YE5A 2Y1CA 3R5XA 1P81A 4GXRA 5EZYF 2Z8ZA 4DR3B 1DC8A 2I65A 3PHGA 5HGXA 5K3FB 2ZI9A 2KBFA 1Y3IA 2IEYA 3GBPA 2WV7A 5AKGA 2X5KO 1XCLA 3EA0A 1QIIA 2NLOA 4PC3A 1H2YA 2JGDA 3NGLA 3LJKA 1NJ6A 4UUOA 3PCXA 2R4QA 3TTTA 1Y8AA 3CLRC 4QAJA 3WIVA 3HN7A 5MFPA 1E8MA 1XFAA 3E48A 3STXA 4JT9A 5K3OA 4EW3A 2BFPA 1DFGA 1Q1EA 2N47A 2RB5A 4JYZA 1P0PA 3OC6A 2OZVA 1JTEA 4EEZA 3U3JA 3HDGA 3CT6A 2RGYA 4DRYA 2GASA 1TQ4A 4N6OA 3FWPA 4P6VF 3OIVA 3WLNA 1JEOA 4TQUS 5DWVA 1LH0A 3FYDA 4JBWA 4PZ9A 3JQ6A 4HY3A 1TVKA 2RAPA 4ZREA 3VVLA 4MPPA 1F2UA 4XXHA 4CF6A 2OLJA 2WM8A 1C9NA 2F90A 3LOQA 3R0JA 2GUGA 4JA0A 4OFBA 3USCS 5KSOA 2GTPA 4TTAA 3I4LA 3G79A 1RJFA 1UPCA 3NTVA 2PUFA 4CEIA 5KNCD 1DPGA 3CNHA 3MJVA 3PNQA 1XALA 1WR8A 2X40A 3V4ZA 2ZP1A 1C7IA 1V8PA 1V7QA 4NCIA 3W7VA 2PWZA 3QWFA 3UH0A 4DILA 2YN2A 4LRTB 3FZYA 2A59A 2NYVA 3GV0A 3MTBA 3IMFA 3W2HA 3T5TA 5FWXB 5FUQA 1N25A 4UBIA 1PDVA 1AKWA 4KG7A 2Q9CA 4KYVA 1F2UB 3K8OE 4BGDA 5ALQA 1UKBA 5AW5A 3GD5A 2HPVA 3SZGA 3KE9A 4ZYXA 4DIUA 4JEUA 4V0OA 1YC2A 4W6QA 1QYIA 5ICGA 2ZROA 4PXSA 1FMTA 1U0EA 2XUDA 3ZD6A 1QIEA 1YQEA 1U2TA 4N3AA 4QOGA 1USIA 3PHIA 4BVBA 1X8JA 4EJ2A 5K4HA 1CQXA 1RACA 3N8NA 9LDBA 3RUCA 1PZGA 1W4RA 2BI4A 4ACBA 3KEMA 2WHRA 3NAQA 5A7FA 1ZK1A 3NTUA 3L5KA 3QSYA 1VLLA 3KT8A 3OCYA 3TI7A 1EJ6A 1I5OA 1PEYA 4GT1A 2JVKA 4M9ZA 1C3OB 3A1FA 1OU4A 1ZU5A 1HZJA 2IUEA 3IEMA 2IRWA 1NOIA 3ZWNA 2R2AA 1EUQA 4TXJA 4BV9A 3A2KA 4GI3A 4GPAA 2WM3A 2QVXX 4OBEA 1WJGA 2ADFA 4Q7KA 4FEEA 3HJNA 3R5SA 2XADA 5ALEA 4GZMA 1T15A 3BAFA 2ZJ1A 4G37A 4U7PB 3CY6A 5FOTA 5IDYA 3ZCVA 4BO2A 2J0SA 1FE8A 4RH3A 1VZ2A 3AHDA 1XQVA 3PEFA 4RESA 1G21B 2XODA 3LBHA 2RGGA 4IIFA 3VOBA 2H9YA 3LT4A 3QYJA 4IGFA 4M1ZA 5I9NA 2HL6A 3OCJA 1QG0A 2RB4A 2LNDA 2YUTA 1HNNA 4JJFA 3ZGLA 2XYVA 5A03A 4U2DA 5AW1A 2WHYA 2XDAA 1PT7A 1PWHA 4NE7A 1T9GS 3KKPA 3WYBA 1UXJA 1AGYA 2PX4A 3LMKA 2VDVE 3FF4A 4NC9A 4XUEA 3RC7A 1KI6B 4FKZA 4LJLA 3ZIAD 3ZDRA 6REQA 1DKOA 4R9RA 4B8YA 2OZEA 4Z2YA 2AD5A 3ENQA 3HGMA 2Q6KA 5TS3A 5KU1A 4NPHA 1HDZA 2BFDB 5MGNA 1HGXA 3U48A 5E9JA 4JYBA 3WDKA 3U0BA 2P3SA 1P3Y1 3F1LA 4L95C 1J70A 3KZKA 5E8RA 4CM8A 1Z0UA 4FMCF 1HPLA 3FNBA 3IQXA 5JIBA 2QR5A 1OVGA 4Y2HA 3JZDA 4UCWA 4DTIA 4WPGA 4YR7A 5ICCA 1ZGJA 1QE5A 1DE0A 1AO3A 1JPVA 1JW9B 1NPTO 3K4HA 4B4KA 2DCMA 4N18A 2WKWA 3PG5A 3MQ2A 5H3HA 2QLMA 2CLFB 4H0NA 3F3SA 4ZKEA 2Q5JA 3TW6A 4F2WA 5BPFA 3ROQA 5I7SA 2BKAA 4P0TA 4WBNF 4ASUA 2YXDA 5CFOA 2I33A 4RS4A 5BQPA 2PUEA 1KOFA 1MJFA 1U94A 4PCVA 2GD2A 4LJRA 2RH9B 2YW2A 1SD2A 4FFDA 2Z9CA 3LYHA 3ESBA 3NV9A 4ZVLA 1KDPA 1WDWB 4BNZA 1L7EA 3N3BC 4RIEA 3UMRA 1EFDN 2YCBA 3X0DA 1QG6A 3WJ7A 5I7VA 4W63A 5CMLA 4AS2A 3GRFA 5BYKA 3STYA 1LF5A 3ONDA 4XEHA 3UC9A 2VHYA 3ZUPA 1D6MA 4NH0A 4BTVA 2V6GA 4FGKA 4XUGB 1DRVA 3ET4A 521PA 3RSLA 3TNFA 3UT6A 4E7PA 4LWPA 2QD1A 4HTFA 4JBLA 4Z1MA 3UYLA 1NVBA 4ZZIA 3GT3A 3FN4A 4PHCA 2NU6A 1VE6A 5ALZA 3U4HA 2OPBA 3VNAA 1T91A 5E6RA 1VLZA 4M2LA 3QKRB 1L5WA 2H92A 4HNSA 3MJRA 5KI6A 1N6PA 3AKYA 2IXGA 2OO7A 3IKVA 1DQPA 4NENB 5G0UA 2FEAA 3LLSA 1HQKA 1P29A 2ZUWA 3HKBA 4I1VA 4HLDA 6LDHA 5D5QA 2PKQP 3LL4A 4ES6A 4RY2A 1FFXB 4BVKA 4FFMA 4QOSA 1VA4A 2ZULA 1GXSA 1TKCA 3L46A 3DC7A 3RVQA 1P4HA 2VS1A 2HXYA 3W6OA 1I0LA 4E5YA 1Z5NA 1FSSA 4MRVA 2PGXA 2NU6B 1HL7A 4QOIA 3VVMA 1Q0LA 4CR7A 8OHMA 5CA1A 2HO5A 4CIDA 1XLVA 2JJ1D 4IS3A 4M1OA 3PYMA 4EUHA 1KOJA 1SXJC 5JEEA 4IQGA 4RK4A 5CR9A 4MPTA 2I9KA 2IODA 4WWHA 1C7ZA 2G5PA 1CRPA 1RCFA 1NDUA 2FSVA 4BMPB 4EHAA 2BEVA 5DXAA 4D43A 3Q87B 3C4QA 4Q3OA 2I4LA 4HGYA 4LFCB 1SIOA 3ZE6A 3P9KA 1H5QA 1XQ1A 1MO3A 2C1EA 4LPKA 1R0XA 2J0VA 2X7JA 3GJYA 1ZPDA 3RTBA 1YA4A 3TM5A 5CA1B 1QIDA 3CF4A 4IO1A 4L16A 3UJ6A 5JAQA 4D9JA 4M8KA 2QXYA 2LIVA 2UVPA 5CYGA 1VHWA 1EU1A 1O57A 3HB4X 4ZC1A 5BWBA 5CDGA 2FEMA 3O5AA 4F93B 2ZT5A 4JB0A 1NBAA 1GV1A 5AUQA 3PXEA 5LKRA 1T3ZA 2BJHA 3EOBI 3ETLA 1Y4UA 1RQNA 3GZNB 3AUJB 4LUCA 1CTQA 1WX1A 2BBTA 1JAHA 5AI4A 1P4AA 1VKNA 2NYUA 3JD2A 2H5JA 3KC2A 1A9RA 3LNCA 4Q6WA 1AVTA 4BFZA 4IX1A 3SVLA 4HPXB 3QVJA 4QJ4A 1ZMOA 3FWZA 2A0KA 4XVCA 1QFMA 5HF5A 1SJ9A 2PU7A 1J21A 1XBTA 2QU8A 1PNTA 3PIIA 1ULAA 1B8NA 1QK3A 3BMQB 2J6CA 1FDWA 1M73E 1SG0A 3HBNA 3THWB 2HSJA 2C0CA 1DX6A 3E3AA 2EBWA 3H16A 1U7ZA 3GA7A 4CGYA 1IYZA 1YZLA 3IGFA 1D2EA 2J0EA 1I7DA 5FNZA 4IGAA 1ZESA 4RO0A 1TAQA 4WNCA 1FPMA 5L8VA 1U0LA 2QRNA 5H83A 1OBOA 1CUZA 5DGDA 3K2BA 4HV4A 3KVNA 4BBPA 1QMGA 4C0AC 2BFCA 2EKZA 2D2VA 1EJ0A 3SJUA 4ENUA 1MRNA 2GR9A 2P9GA 3F4LA 3V2GA 3SSNA 1E6WA 4JI0B 1LC0A 2GYVA 1ECBA 2WAXA 2OORC 1MRZA 1NVWQ 1MJ5A 2PH7A 3E0QA 5KNBA 1WPRA 3E7PA 4N6NA 1GRQA 2ZIUB 4JBIA 3U4AA 3PUKA 3N5CA 1N4DA 3A6HA 4R1NA 2D13A 4NHEA 4ZZ0A 4FR0A 4DMFA 4LEIA 1V5WA 1W5BA 5B3KA 3Q3GE 5K3BA 1JHRA 5DCLA 4DMMA 1CRZA 4B35A 3Q9LA 1NR1A 3FKSD 1IIBA 3GA5A 5DYNA 2BFCB 1TUGA 3P9ZA 4Z9BA 4BJ5A 1TYBE 2X7HA 4XTCS 2VN8A 2VL7A 1KERA 1D2HA 4QJIA 3ZLTA 2XQFA 2P8SA 4BMSA 2CL6X 1NG1A 3GT7A 2C9CA 4D96A 4UNRA 5JQGB 1MTZA 3AB7A 3HJFA 4RCZA 1U2ZA 3VHLB 4RXMA 4EQ6B 2PQ6A 4NZNA 4DG8A 1B8UA 1L5NA 4C04A 1CR1A 3FMFA 2WTNA 1YIDA 2GKGA 4LDZA 3DLPX 1NLMA 3VC3A 3U7FB 2KM1A 3ZHOA 3N8IA 1S8AA 2RBEA 2JIMA 3L40A 3UJDA 3ZWMA 4BVJA 3CBGA 3NFYA 4KX3A 4HUTA 1YZFA 4IJWA 5DWQA 4OM7A 3LFUA 2DUMA 3GQVA 1P0FA 3G7SA 3Q7SA 4YDHB 3Q3JB 3W1EA 4B6FA 3FROA 1L9KA 1II9A 3LYLA 3P4YA 3P97A 4IHKA 2XCRB 4F3CA 2C4TA 1DARA 2QORA 1NJ8A 3HB5X 1DIHA 4J4TA 4Q9KA 1XMJA 2AJ8A 2UYYA 5H82A 1CQIA 3DOUA 2OXEA 2DFLA 2HA3A 3T5AA 4C08A 2RGNA 4RTRA 1SIBE 3K5WA 2YZNA 2REXB 3LHIA 3FZEA 3O8NA 2RGRA 1FW6A 4JMLA 3T3PB 3IHKA 4B46A 5JSQA 4U39A 3CNLA 3F9IA 4OKIA 1V47A 3N2LA 5JATA 2VSNA 3Q2IA 4ZN6A 2ZANA 1CFJA 4IILA 3VYUB 1MB3A 3MWLA 4JLDA 3GJSA 1E3WB 4JEMA 5CDFA 3T3NA 1ST2A 2QRMA 1R9MA 2P41A 3PC8A 4UMDA 5C8ZA 3ICCA 3P71T 3G0HA 2HQOA 2OOKA 2OK8A 4ARIA 1Y82A 2HM7A 2PSSA 4PYLA 1HK7A 1CFZA 1HDYA 4ZQEA 1R0LA 1PGPA 2AI1A 1KQPA 2WYUA 2XWJI 3HVHA 3M6UA 2HA7A 2IDKA 3FOWA 5EJ6A 5KNDA 1RYFA 3AB8A 3AEXA 2H7YA 5DW0A 3UM9A 2A9QA 3KRTA 3ORYA 1FW8A 3QE4A 3T99A 3UAXA 1USGA 1R15A 2OAEA 2EZ9A 2QAGC 2WU0A 2FWAA 3FZNA 2G06A 2I8AA 1UXIA 1NN0A 2CNKA 4PPYA 4D9GA 2GD6A 5EESA 4NXMB 3AG6A 3B3AA 2LBPA 4KE8A 4QYSA 5BO5A 2F3UA 1H3NA 3YASA 5CVJA 4QDJA 4O2BF 4EYGA 2O8CA 3DZGA 3GRVA 2HXGA 3OO1A 1OGJA 1M34B 1WF3A 4O33A 2PY6A 4COOA 1FSPA 3EASA 3UHJA 2EBFX 3WWCA 3K71B 1TQDA 1HORA 3D0OA 3LLVA 1NVTA 3NVKI 3PNBA 4JL5A 1T5OA 2QLFA 3WE7A 1DB3A 3ER6A 1FXWA 3R7FA 1EFVA 3VU0A 3W6ZA 1NZJA 5JTTA 1BN6A 4QUBA 1CP2A 1SM4A 1F2VA 4W4TA 2A78A 2LV8A 1QCDA 4N6GA 4PAWA 1G63A 1QTIA 1WMAA 2NP7A 1JR4A 1N1GA 2YJ6A 4OF4A 4C2TA 1ZK0A 3CZ5A 4TXNA 1CPYA 2H65A 2O8CB 1Z0DA 1P0QA 5BMVF 3GLQA 1AQ6A 5AIAA 1ESMA 1XRQA 3IQHX 2WY2D 1DIBA 1YB4A 2ZIFA 4G63A 3IURA 5DBEX 3GIDA 5HFAA 4DCNA 3ICQB 4LC0A 4NEGA 3A2NA 2IZOA 2LXNA 1L5GB 2NPIA 1CQWA 1JLKA 1HBJA 1Q84A 3TLMA 4MYDA 3H19A 5ESDA 1XZMA 1LEHA 2X9NA 4O5AA 3MWFA 3QWIA 4U3JB 3HB0A 1MO6A 7MDHA 1EWVA 2HF8A 3CEHA 5KHOC 3KSRA 1P2SA 2OQVA 1FVFA 4JEHA 2C61A 4TV8F 1R5OA 3O2QB 1V7ZA 2DGDA 3TBHA 1E6MA 3P0RA 4AFNA 2JVJA 3AI3A 2H06A 2VF2A 3WICA 1JYSA 5ALFA 1QYDA 1MFZA 2CJPA 1DTSA 2WJPA 5AXBA 3WGMA 4AP6A 2QVZX 4BVLA 1E99A 2VZ8A 1KMQA 1P7PA 2HEGA 1UFRA 5INTA 2NO4A 3RV3A 4EB3A 1UC5B 1V5EA 3KTFA 4LS3A 4E07A 4UTRA 4HSEA 4TMYA 1PL7A 4PWZA 5DM70 4IJ5A 2N42A 1QE3A 4J2HA 2VG8A 4MRPA 5IC6A 1KOLA 3VR3A 5CFQA 3VKGA 4KVGA 1NQUA 4G5QA 2A9PA 3EIEA 4LYJA 2QRHA 2FPIA 1TT5A 5EIEA 1SUSA 4RHXA 1ORWA 3IEUA 4RZ3A 1PLLA 1A1SA 2DPMA 4QUJA 4P3XA 2Q28A 5D86A 4YWJA 4B2YA 4C7MA 5AVTA 1K0FA 5LQUA 2D1RA 1P73A 3OBIA 2JGEA 1W30A 2R48A 2PWAA 2YXBA 1DAGA 2B1GA 3I6BA 4KPGA 3I3OA 4QJBA 2X0EA 5GINE 1M0EA 4CQMD 4LV5B 4B83A 2X1MA 9LDTA 4DMGA 2GD0A 3NYQA 4CV0A 1LRJA 2PZFA 3II6X 1FVXA 4NZZA 3BC1A 4O0LA 2H07A 1OSNA 2FPIB 1TT5B 1VCHA 2NNLD 3ZWPA 2C4UA 4FTWA 5FA6A 4FKBA 2F7SA 3TUJC 1YQGA 4IUDS 1JR3E 4X8LA 1JIJA 5AKXA 5FAKA 4C29A 3SR0A 2OCKA 4YV7A 3D2BA 2C4HA 2X8AA 5F64A 1NBME 3DLBA 2J32A 3G8CA 1ECPA 1ZM4A 2PXXA 3H2BA 1XRNA 1DADA 1PX2A 1FX0B 1ZGGA 4BQPA 5K8LA 4XR9A 2PT7A 2OHGA 1H0KA 3EFHA 1XK6A 1JX6A 3CWZA 3ILHA 3L1UA 4HNGA 4RA9A 4E15A 3RABA 3Q15C 1Q14A 4FEAA 4M38A 3SIPA 4ND8A 7MHTA 1FTYA 3GEGA 1AXRA 2PGIA 1UPAA 1YQTA 3E03A 1E4OA 1MC5A 4TQGA 4GKVA 5KQMA 2AG1A 3RUHA 1YI1A 3AYZB 4A26A 4DVGA 4KXUA 1XCBA 1VI5A 2UAGA 5HMMA 1DBIA 3A6KA 4OAOA 1LW6E 3WGHA 4AYWA 4OHFA 1NN3A 1ZBQA 4RA9B 3NFRA 2OV3A 4IZ6A 1JHOA 1X7YB 1OVMA 1B1CA 4LF6B 5I7AA 2QTZA 3WLJA 1C0KA 4UCQA 3V8VA 1HDGO 4MR8A 2H8GA 4YJ2F 4ZXFA 5KEIA 1NJGA 3FNHA 3BMCB 2KHZA 2OHFA 4M1YA 4PYRA 4BTLA 1CS0A 5FUXA 4YRNA 1IJBA 3D6AA 1KEVA 3HJTA 2BGNA 2CYCA 3OQJA 4QELA 2GNAA 4DFDA 4Q3EA 3IAM1 4N7BA 5G53C 3BXPA 1NMSA 5CIYA 4Q1VA 4R6WA 5ER9A 3AL3A 4HDRA 4YI3A 2C07A 2Q1WA 5FNVA 1M6VB 3W6NA 4EA7A 1B3BA 5EMMA 1I3LA 5DKFA 2QSYA 3UWKA 4LXGA 1OPRA 5KPJA 2BAGA 2UZAA 2DX7A 4Z1OA 2YZ2A 3W8DA 3HFSA 2O0LA 5BORA 1JLLA 3K9BA 3NIBA 1QS0A 1GRNA 4QJ5A 5LZ9A 3SMVA 2XCLA 2CDBA 5CCDA 4MV8A 1CS0B 1PAUA 1QFZA 1EFHA 4KR9A 1YF3A 5IVKA 2D0OB 1S7CA 2VCHA 4LMBA 1E2NA 3WGKA 1UBSB 1NLFA 2I0FA 1IZ7A 2LCFA 5EN4A 5TMBA 4L1KA 1SHKA 3DLHA 4MW5A 2Z58A 2O1SA 3P45A 4Q93A 3SOZA 1PX0A 5FNVB 4D0GA 1QRUA 3DXFA 1MCZA 2BRUC 4NE2A 1KDTA 1VIAA 2CXHA 2MSWA 4JLUA 1XT6A 1QYVA 4R2JA 4RD1A 5CP8A 5C8VA 1H65A 2I87A 4LQ4A 1N6OA 2YW9A 3LY7A 1KDRA 1LLDA 1QS0B 3CUVA 4MVJE 4QXMA 2GFQA 4LE0A 1G2OA 2QM7A 1AF7A 1GAEO 1YB7A 4M1WA 4BDTA 2GVNA 3HYLA 3DHVA 2BBOA 1P17A 2ILVA 2VPPA 2W93A 1I01A 3DNFA 4DIKA 2XRFA 2BCJQ 2EJVA 1Z6QA 4DEVA 4NY1A 1A9PA 3CA8A 2VTEA 4RVFA 4ZALA 1H6DA 3K0HA 4Y2PA 2FHPA 1LGYA 4DRXB 1G4HA 2PEYA 4QU0A 4PQFA 1CJTC 1CF4A 4II7A 4LJ6A 1LXCA 4MLPA 1BXKA 5EY5B 3T4XA 2AOTB 3NIDB 4FN5A 3RASA 2ZG6A 4AC9A 2BSQA 5HNKA 4YUAA 3DTYA 2Z3VA 3OF3A 4TRRA 3N2EA 3IHTA 3VR5A 2FCRA 2WFMA 2YCLA 3SS9X 4P36A 2SHKA 2XDWA 5I9BA 1NUTA 2B4RO 3EARA 3Q0TA 5B4TA 3I6QA 2WDZA 4QNRA 3T7RA 4HRVA 4NYJQ 4AO6A 1G4AE 3I2YX 2YV2A 5BSRA 3CVXA 4PINA 2NZ8A 5JO9A 1XRPA 1EXDA 2DHQA 1Z8NA 3M6MD 3IPCA 5HP4A 1XEWX 3ZGZA 5FLXA 2QJRA 2ZBUA 3DE1X 1R66A 1QH0A 2YS7A 1KEEA 3DVQX 4DWJA 3AVUA 3BHIA 4TRMA 2EG9A 3PDJA 2P9BA 4RAOA 1QWOA 3Q1KA 4IVNA 4AICA 4ZOCA 5EJ2A 5TGDA 2C77A 4DQDA 2IOHA 2NT4A 3WVNA 4WJLA 3JD0A 1CJBA 1GU0A 4RHYA 4QFMA 1EUDB 1I4EB 5AW3A 2FSFA 1TI7A 2D2FA 1YVUA 5EGNA 4MWZA 4TSRA 2DHRA 2Q5EA 3B5IA 4KR6A 1QNFA 3S70A 4LC9A 1EZZA 2HA0A 2VXCA 3QHQA 4QVKA 5E2AA 1SWWA 1WZIA 4HWPA 3WJAA 3RHSA 1KEEB 3B48A 1J8FA 1Z7EA 1G17A 4H7KA 2FVXA 1PQYA 2DVMA 2GPTA 2XB6A 4RUKA 1ODFA 3L1IA 5EMHA 3F5QA 4G41A 1HMPA 4PTZA 4OLFA 1YTUA 2NSHA 3A4NA 1RHMA 3MMSA 1JIUA 5CVCA 1SHZA 3LOUA 3PT9A 4ZT6A 4MGHA 4XD2A 4B2IA 3KKLA 1TA0A 2B4KA 5CLIA 3P4XA 4B81A 3K32A 2FN4A 1TDJA 2CE2X 2IIQA 2JIPA 3AUSA 3SDSA 4ZMSA 1NV8A 4BKMA 1W2WB 5K3EA 1B8VA 1CD5A 3CNEA 4YRZA 3ZXXA 4DDUA 2PSDA 4KXFB 1M2NA 2WIBA 3JYHA 2HCFA 1KGDA 1MB4A 4RWEA 3CX6A 3PD1A 4HEHA 4NL4H 5A5GA 4CF7A 2B20A 2B2CA 2I7CA 3WYNA 1LBHA 1P0IA 2XXBA 1TECE 3P1JA 3SYLA 2ZSHA 1U28A 2J9FA 2ONZA 3Q40A 4J0KA 5HJ2A 4Z9FA 1GLGA 2QRVB 2X8JA 2A0XA 3T3HA 3ZYCA 1BKDR 3EGOA 1Y80A 3GLIA 5SZJA 3AC0A 2JHAA 3TO5A 2IYEA 5JAZA 1Z08A 3WS7A 1V8ZA 1BHSA 3AWDA 5EWMA 3HYRA 2QLJA 1JJIA 3Q9SA 1X92A 3V55A 1ZIPA 2BKLA 1ZIXA 2CXQA 3EXIA 3QOYA 3RT1A 4IHAA 3IBYA 4URXR 4DMHA 4UDYX 2HJ9A 4OOEA 2RH5A 3VR4H 2CSUA 1PCXA 1O7JA 2HCRA 4XDHA 3O3OB 3TMYA 4C88A 5BOVA 4INPA 4S1OA 5LCXA 3SJCA 1TEZA 3KVOA 4JC8A 1AHIA 2X8JB 3TOZA 5FJJA 4AVYA 1XHEA 4HN9A 2EQAA 3DVSX 3R8XA 4EG6A 3D6TB 5EUCA