4UCQA

Structure of the t18d small subunit mutant of d. fructosovorans nife- hydrogenase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECDGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A threonine stabilizes the NiC and NiR catalytic intermediates of [NiFe]-hydrogenase.
pubmed doi rcsb
source organism Desulfovibrio fructosivorans
molecule tags Oxidoreductase
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
total genus 82
structure length 262
sequence length 262
chains with identical sequence B, C
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ucqA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ucqA02
3CUSA 4C3OB 4UQLA 5JT1A 3ZE9A 4U9IS 1FRVA 3ZE7A 4IUDS 4KL8S 1YQWA 3H3XA 3ZE6A 3AYZB 1CC1S 4KO2S 4URHA 5ADUS 4UQPA 3UQYS 4OMFG 1WUJS 4UD2A 4UE3S 3AYXB 5JSYA 1UBLS 4GD3Q 4KO1S 4UD6A 1UBJS 1FRFS 5D51S 4UPEA 1UBRS 5JSUA 2FRVA 1UBMS 1YRQA 1WUKS 1UBOS 2WPNA 4TTTS 4UE2A 5JSKA 3ZE8A 5A4MS 5JRDS 3MYRA 4KO3S 1H2AS 1WUHS 3CURA 3RGWS 4UCQA 4KO4S 4UPVA 5A4IS 1WUIS 5A4FS 1UBTS 4IUBS 3USES 1UBKS 1WULS 4UE6A 4UEQA 1UBUS 3USCS 4UCWA 3ZEAA 5JSHA 4UEWA 4KN9S 4U9HS 4CI0B 4UCXA 1YQ9A 1UBHS 1E3DA 4IUCS 1H2RS
chains in the Genus database with same CATH superfamily
1E64A 2O1EA 4TV9A 3WP0A 2YFQA 2PXXA 3MJDA 3UTDA 3WGKA 2OD2A 3MZ0A 4J1NA 5EJ2A 2AW5A 2A57A 1XEFA 3WIDA 1LCIA 3H18A 5FR1A 1J1ZA 5CDGA 1ZPDA 4K9MA 4URZR 1YMQA 3D4BA 3OT1A 2Q5LA 4YTEA 3ILYA 4QNMA 1C1DA 4P36A 4GU5A 3H87A 4HEA1 4FBGA 3A1WA 3NWPA 1PJQA 3VZSA 1NQTA 1XZCA 1DADA 1OBOA 1DJMA 3CSDA 2YZKA 1GGFA 2DT8A 4W6QA 3W5SA 4Z3KA 1EQ2A 1QYRA 2HX1A 5TC4A 5THKA 2E5WA 1RYNA 4HDMA 1IL0A 4QYSA 5LLDA 2ZROA 1V8PA 1VBFA 2FX2A 4RJLA 1W4BA 2ZREA 3VKWA 3PJRA 2OVBA 1FUKA 1Z36A 2B2CA 2HTEA 4IDEA 1AOXA 3VR1A 3UA4A 4H7JA 1E0SA 3COSA 1S7CA 3R0XA 1WUJS 4FILA 1S02A 4QX6A 2XLCA 5TEWA 1KTIA 5IXYA 3NFRA 1G0OA 1RJGA 4Y9DA 4W7HA 1B6TA 3IE0A 1ZVJA 2JEOA 1AK9A 4TKUA 3H1EA 4BDSA 1XRQA 4DDMA 2JKZA 1YACA 1POWA 2AMFA 4ODIA 4ZHQF 3KQQA 4B45A 3VHRA 4MR9B 3EGCA 1CEQA 3Q2OA 5ER9A 2IELA 2VPWA 3HCAA 4J0DA 4E5NA 3P19A 1PJ3A 1XRRA 1BE8A 4GMFA 1KXZA 1A5BB 3DDOA 4QYWA 4Q7JB 1G3UA 3STYA 1UKZA 1QAQA 2R6GA 2VPZA 3O4VA 3O8OB 1PKEA 1SCUA 3E18A 2ZYUX 4WNIA 3T1NA 2O7VA 4I3FA 4PIVA 3IS3A 2IHKA 5HIAA 3WYAA 4LDQA 1CQZA 2I34A 3TLEA 1E1YA 4RFSA 3OKFA 4FZRA 4DGQA 8ATCA 5C53B 3PGJA 1EX9A 4CKCA 2NO6A 3NYIA 3KTAB 1ZOOA 4QRHA 4ND4A 5F3WB 2QRHA 3ET4A 3I83A 3KWJA 2RGYA 4MS3A 1I24A 1C3EA 2R2GA 2D0OB 3BGVA 4QREA 4YJ2F 1OX4B 4FHZA 4A2CA 5LB4A 1C4XA 4C2BA 1V9SA 5CLIA 3D6VA 4KLZA 3WL3A 4N8EA 4D1YA 2QZSA 4NBLA 4FD2A 4ZEXA 1A9QA 1PJ4A 4QM7A 1H2XA 4HGPA 1E94E 1UXKA 4WEQA 4CUZA 1TYEB 4Q7EA 4B6OA 2IYTA 4IHJF 3FOBA 3Q15C 3S2EA 5ICSA 2ZZMA 3A27A 2ZIZA 4GOJA 2AMVA 5FA5A 4JLNA 1SOMA 2I2XB 3FHJA 2XV1A 1N9GA 5ESWA 3WTCA 2MIIA 5CTJA 3WMRA 1D2RA 1WZIA 3GMTA 3M6MD 5KVCA 1G1AA 5LQRA 3L5KA 1K8YB 2NADA 3RC9A 1P5JA 3LBYA 1RI5A 1B8OA 3UAXA 3RW9A 2E18A 2W2QA 4RDIA 5B2EA 4CTMA 3ISVA 4QVIA 2UZ1B 4HNVA 4WACA 3QYPA 1UJ6A 4OQLA 2M6RA 3ROMA 5EN4A 3HG7A 4U6SA 2HLHA 2HZ7A 4ID3A 1FTSA 1WQ1R 5KNDD 4LRWA 4IJ5A 3QBTA 3MTGA 3H1BA 1SUBA 4WHMA 2DZDA 1MC8A 4KQKA 1K7XB 4BE9A 4BQRA 4FI3C 3Q6IA 1FJHA 5JAIA 3CSUA 1C30B 2JFPA 1X42A 5IVDA 2P91A 1EFDN 4DV4B 5HRUA 1E1CA 1J2RA 5D1NA 5E95A 1D2MA 4JXKA 3GVPA 1M34B 2FA9A 3C6MA 1GHTA 2JD0A 2VR1A 5H3CA 4BASA 1FQKA 4DBLE 1MOQA 1FNSA 5EHIA 3N86A 5E2BA 3E9RA 1SRRA 3KZVA 5KHLB 3R6GA 5IK2A 2Q7DA 3BSYA 3C8MA 1USGA 5DLEA 5IH7A 4OHXA 3FVTA 3PTLA 2GN2A 1EINA 1J0BA 3D7SA 3IDOA 1QPZA 4KNWA 1JJVA 2JFQA 4QJIA 4KI0A 4MWOA 4Z7NB 1YB4A 4RGYA 5KPJA 1N3IA 4ERNA 2OD7A 4Q1EA 4F6LA 4CTNA 1AKQA 1XZFA 4LRUA 4DNOA 3QP9A 2B34A 1PJ8A 1D1TA 2H11A 4KMRA 1NVXQ 1ZA1A 2RJOA 4MMZB 1IPEA 1L7QA 2WJ6A 1E79D 2EFDB 4ZQFA 5K6AC 3LS2A 3WGVA 2OK8A 4Q66C 5J1TB 1FS4A 2IGBA 2PSEA 2ZSFA 1IY1A 4Y2PA 5K2MA 4IWNA 1ODCA 1BG6A 2IXBA 2JFZA 4RNDB 1I94B 2JIDA 4J2OA 3ZU5A 4D92A 1AUOA 2QMUA 2I4OA 3N9IA 2NUAB 1AGXA 2BEWB 4IFTA 3M4ZA 1DBIA 4PZAA 5BVGB 3QKSA 3FMIA 4P54A 2XGOA 3LLVA 5KVQA 4CI9A 2BHRA 1U0HC 4EK9A 4MQLA 1Z2DA 2P5UA 2B1IA 1HTBA 1M2OA 3L6CA 1HYBA 4XGIA 3U5ZB 1JEYA 3BAFA 2UYGA 3HCFA 1YBFA 1P8AA 1FRNA 3SBDA 2QIPA 2XQJA 1U8EA 3CB4A 4D0LB 4UE6A 3KK0A 4OI0A 1U8YA 4CF4A 3QOWA 4QVGA 1XN1A 4HAXA 2Q4EA 1ZCFA 3GRPA 3LQ2A 4W7SA 4QGSA 1FA9A 2QN8A 5GV8A 4DMMA 4EJ0A 4JD5A 3VC2A 4H6WA 3SOZA 2B4AA 1JA0A 4KXNA 5CCDA 1QYXA 2LXNA 2OORA 2RHHA 4I6EA 5K4GA 3R23A 3LBHA 4BP1A 1Y8QA 3EFOB 3B1WA 2E89A 5EKUA 1I1OA 1ZEMA 2CYBA 4IZ6A 5IKEA 3I6MA 1E6EA 1DKUA 2DWCA 4XYEA 1Y9ZA 4DILA 4LWPA 1X8JA 4YP7A 2VJLA 4LOIA 2HMWA 1M2OB 2CJXA 2AI3A 221PA 2NTJA 3AUSA 4NOMA 4Y18A 4CHTA 5G4KB 1LU9A 3NT5A 5M29A 2FPIA 2J3KA 5DYGA 3AU9A 3JSXA 1NC3A 3UUEA 1BXGB 1YB7A 3AINA 4K03A 2I3BA 3MTBA 4O5AA 5BT9A 1D2GA 3K1YA 5JPIA 4BYMA 3EMVA 3LUPA 5CB8A 4PHTA 1RZRD 2X1VA 2OQ2A 4IQFA 1RC8A 3DLBA 1D7OA 2B0JA 3G2KA 3L5OA 5HBGA 3PIDA 4LW8A 2O8FB 3VDXA 1CC1S 1T4BA 2BMJA 2IXGA 4HD8A 4TLEA 5G0SA 4FYIA 3WNZA 3W8NA 1LBSA 4NJMB 4QPZA 4UM9B 3ZHZA 4CIWA 3UKDA 2Z1NA 5JDIC 5K0FA 4LGCA 1XD9A 1J24A 3KM0A 3NWJA 4RXMA 4XWOA 1CF9A 3PK0A 1Y5RA 1BXRB 3C8ZA 1H6BA 2YNMD 2CD7A 2EL7A 3CMCO 2ZUSA 4UUAA 4TV8B 1CY6A 1CKEA 3VHXA 5I8WA 2VPXA 3MWKA 3ICCA 4U2DA 3TTWA 4ETWA 5AW5A 4LQ4A 3TTXA 4Y98A 2WNHA 4GFDA 4MW7A 1ZVMA 3CLTD 1GNVA 2JBWA 5HTKA 1ZD3A 1J06A 2Z6VA 1AKVA 4GECA 4CLRA 3SEQA 1XLTC 4JI2B 4YCAA 2DETA 1PFVA 1P2GA 2G04A 3DZJA 2OENG 4HWSA 4WLEA 1F6WA 5D1HA 1HFKA 1NATA 1U0FA 4UE3S 4HHEA 4DRXB 2FJ0A 5FNVF 4TXLA 1GAWA 3P9YA 1PWEA 3I3SR 3GA0A 4Y2UA 6REQB 3B6MA 3I0ZA 5BYAA 1N2EA 2MSLA 5CB4A 1RPTA 1PNQA 2PUFA 1RMTA 1W5SA 1G5QA 3LHFA 4OXIA 1TPZA 3AEYA 2ROQA 3L77A 5LU8A 4LPSA 4RTMA 3IUSA 1MLDA 2F1HA 1NVMB 5H4GA 2WWWA 3ZNPA 3H5OA 1LNQA 2VBIA 4JVLA 2JH9A 3MINB 1NI4A 4CFSA 2BYTA 4MO9A 3GEBA 2GPBA 3VU1A 3P4UA 3HLYA 3SFVA 1YONA 3QUSA 1YZFA 3L8ZA 4FGKA 1E2NA 5JRJA 4QDJA 2QAIA 2PY6A 1U8FO 1U02A 1UBMS 1UFVA 1PVDA 3QF4B 5BV1A 1VE9A 4X54A 4TKVA 4BKOA 5CBKA 1BEEA 1J22A 4WKGA 1HPLA 2OD9A 3F5DA 1L5WA 3H86A 1MT0A 4MWBA 3DBHA 4S0ZA 1T2EA 4FC6A 1QR2A 4NCKA 2BPOA 4HMOA 2BFBB 4CIVA 1Y6ZA 3AH8A 5DGCA 1SZJG 1II8A 1U81A 2NOAA 4WNYA 2PRKA 3QBDA 5U4QA 1D1PA 4MW9A 3W9BA 4CF6A 3ZGOA 3HKDB 1L7RA 4ZO9A 2QTHA 4E1VA 1O94A 2YWRA 4C30A 2EX0A 5LN1A 1QSGA 1R4AA 1G8PA 4XLTA 4JOCA 4LY3A 4P5PA 3L0BA 1Y3IA 1TF5A 3A0RB 4LJSA 3VMMA 3J81k 5KYWA 5EKXA 4CCYA 1R8YA 4B4DA 1DKNA 1TCCA 3CGWA 4WBXC 3WGJA 1PW7A 4U8GA 4E0BA 4L8GA 5AI5A 1XEWY 2GAFA 2YR0A 1H65A 3Q40A 1LSUA 2JFOA 4COOA 1LS1A 3RNOA 2DWPA 5I7WA 4ZVNA 2HJHA 1Y7LA 1P1RA 4REQA 3PGMA 1Z15A 2JIOA 4TZ0A 4MJXA 1CRQA 3E27A 2QD5A 1T6NA 1CJBA 4L78A 2B8JA 3QQ5A 1B8UA 4YYZA 2BFDA 1RHKA 2M6SA 3A1UA 3RIHA 4D2IA 2W6IA 2FUG1 4YCJA 1N9ZA 3FJYA 4MYUA 1UK9A 3BJIC 3T0FA 2BMAA 3CXRA 1X1BA 2I2AA 3V97A 3Q9UA 4M1ZA 4DM3A 4D0SA 2JA1A 5ALFA 1L4LA 4P35A 4IDPA 4RHTA 3H2KA 3NATA 1I3CA 1QIKA 4X5OA 1YJCA 1RCTE 5I9BA 1J99A 3SZLA 1Y1SA 2JFUA 4RVFA 2XX3A 4F2PA 1EXDA 3WHIA 1J7KA 1SCBA 2WHQA 1K3FA 4BVBA 1UIMA 3SFTA 4M0DA 4OLFA 4YMIA 1TK3A 1JSLA 3A6GA 3I2FA 4AJ4A 2APJA 3EY4A 3PNKA 3ADOA 1V16A 1HKHA 3VR5A 3PFGA 3ROPA 1YJ8A 2BZ1A 2RH5A 3OA2A 3Q3CA 2ZATA 4RYLA 4AULA 3AOEC 1ZK4A 3VSDA 3ZQKA 1MT3A 3KSBC 1RM5A 1U9YA 2VJOA 2C1EA 2HF8A 2H52A 1KVUA 2A9FA 5DHSA 1QQTA 3NHKA 4RJJA 2LVBA 3SC4A 4GOXA 4ZVPA 3RU9A 2OP0A 1GT6A 1UDCA 4KLRA 2B37A 3KALA 3JS5A 3ZTTA 5JQGA 1M5TA 2RI1A 3QIVA 5HE8A 1RKBA 2BKXA 3GNLA 4J49A 1JT2A 5IRCD 4WDRA 5FTLA 4O4IB 5IAGA 1AT1A 1PDOA 5JI3E 1QQ5A 1YS2X 2HWWA 3DYBA 3O9VA 4JZYA 4RD0A 3L7OA 1ECBA 2XY4A 3I12A 1SXJE 2ZVPX 2BKUA 3IAS1 3PXEA 1JX6A 1ZGAA 4R8MA 2I6UA 5JH7A 3S99A 2G08A 3II6X 1OX4A 3WBKA 4OXQA 1W5FA 3DLCA 4TVOA 3QFTA 3PQ7A 4X1YB 5FHRA 4R9RA 3NETA 1CQIA 3EY9A 3CVJA 2ZS7A 1ENZA 3L84A 3PVSA 1W581 3TAUA 1G5IA 3CLRD 4UD6A 1YRBA 3P2EA 1MD9A 4D96A 1LTQA 4YK7A 2IOFA 1SBHA 4BVHA 6YASA 4CHGA 1GEEA 2W43A 1UXJA 3GOQA 4IIVA 1R8XA 3A70A 2QJRA 4NBTA 4Y2TA 3D64A 2WE8A 2K4MA 1EXMA 3LYAA 4M98A 4NEHB 4IUYA 4TRMA 3ETEA 3K5IA 1US8B 2QX4A 1KVRA 1U4SA 4IWYA 4EYEA 1QMPA 4DA7A 2W8BA 3OURA 1SCAA 3DEZA 3OUTA 3FHTA 1C9YA 1LSSA 3FDFA 4I4CA 3Q98A 1AU9A 3HZOA 3QKRB 2VP3A 2VNSA 2WMDA 2Y1WA 5LL6P 4MKZA 1AV6A 1G21A 2JRLA 3BPSA 3L6BA 2J4CA 4UU1A 3FCAA 4B4UA 2PUTA 4FE7A 3I5UA 3AHGA 6Q21A 2B21A 2ZIXA 2GZDA 3CSSA 3MRSA 3PFHA 1SG6A 5IYZA 4X85A 5C1BA 1AF4A 1G41A 1UBTS 1ZH4A 4WI1A 2ZS8A 3I3OA 2DF8A 2AN9A 1OHHD 4MYTA 4R9NA 4BNLA 1L5VA 1KU6A 3TTVA 2V7TA 3GUCA 2H4XA 3P2JA 1FU8A 1V16B 1RCFA 2OLEA 3NDBB 3F2IA 1SD5A 3CYFA 3G5AA 4JLBA 1P17A 5K0CA 1GT91 3S5UA 4IX9A 3DQZA 1X7HA 1WP9A 3FM9A 4RULA 4MEBA 3AKZA 4PG8A 2G9ZA 3DEKA 3HKBB 4OYYA 1U2GC 5EYPA 2BGRA 4BXOB 2HADA 3I58A 2Z6QA 5JG7A 3ONEA 4MWCA 3TOVA 4DTCA 1IG0A 1CJMA 3W79A 4NXNB 1QHYA 1RAEA 4HDMB 4DWOA 1UT8A 2E82A 3K31A 2XB2A 1AQNA 4M21A 4C0AC 2VG8A 3WKBA 1S7GA 4NH0A 1XTQA 3KE9A 4UHEA 2AC2A 3JWEA 3CRVA 2NO4A 1TM2A 1N8NA 3ZIAD 2UYHA 1QQ6A 1JSCA 1UCFA 4GKAA 3T5MA 1OLUB 4CU2A 2FN8A 2PLRA 3BHIA 3CKMA 3B12A 3KEQA 4UULA 4Y0NA 4B3MB 1OAOA 1JAYA 1TCAA 2FCAA 2WJVA 2E7ZA 2PKQO 1WA5A 3OJCA 4TMYA 3GLHB 4AF8A 4AFNA 4CG3A 4ER5A 1JI0A 2X4DA 3O8QB 1J39A 1R6AA 1USUA 1YS7A 3COWA 4N7RA 5A3VA 4AROA 1AZTA 3N8GA 1F7UA 2YJGA 2P4HX 2XW6A 3KV3O 4R1OA 4QG3A 4Q05A 4BNXA 1DP4A 3GEHA 3HCCA 3QFHA 1JHYA 2BW0A 4WUVA 1Q1EA 1F1BA 4R16A 3P71T 1BJTA 1EK1A 5D3MA 5JIBA 1M2WA 3S1AB 3DEIA 3JASA 1Y1KE 3DCIA 1T9ZA 3P4YA 1XP5A 1ANKA 2QVZX 3C5WP 3LPLA 4H77A 3AETB 4XYGA 5CNKA 5JSZB 5LQSA 4DA6A 1KR5A 5AUNB 5AIBA 1L1QA 2JGMA 2P2NA 4Y9UA 1BJKA 4S35A 1Z7WA 1D0VA 1BSVA 2Q3LA 1K7SN 2QTRA 3UOGA 5AO9A 3FNHA 1X1DA 5CW2A 1FFXB 1V6CA 2XJ9A 1MF7A 3FSJX 3L0YA 4YRGA 4EGAA 721PA 1TUEA 3F6PA 5FOUA 3FOAA 5C7LO 3IMCA 2XYRA 1OC2A 3REGA 3KYCB 4FJ1A 3DQQA 1ISFA 2ADFA 1MEJA 4LJYA 4X3CA 4I50F 5ARCA 5JO0A 3WL6A 3ZWCA 3A4NA 2VC2B 1ND6A 4H18A 4U5QA 2BELA 2GR9A 4GPBA 1KKLA 3QLEA 2P2ZA 4Q4AA 3A6ZA 3U61B 1OGJA 4KQMA 3F8TA 4HMQA 4WVLA 4K7JA 4X65B 2CFCA 3DO6A 3GGCA 1P1CA 3MUOA 3K9HA 2OY0A 2XMPA 3C6KA 5BSMA 5C5EA 1XNHA 3DFUA 3K0EA 3TFWA 5H9VA 3T9AA 2OAEA 2HU8A 4MINA 1NSFA 4M1SA 5KNBA 3FPCA 1XL1A 2E6UX 1MNQA 3LBNA 5B58C 1RQNA 2QW1A 5BQFA 4ND8B 2CLMB 3PT5A 2NYRA 3CG0A 2GK6A 4GPIB 1P2DA 1S3SA 1XMSA 3ETJA 4QL3A 1QBGA 4N76A 2V65A 4RHUA 3SX0A 3DE4X 4KR2A 5CFOA 3KKQA 4EL0A 1UZUA 3X44A 4DBZA 5HRAA 4WZAE 1U0SY 3R5JA 5E8RA 1OLSA 4NONA 4BKRA 1TOAA 1Z26A 3F3MA 4ETIA 5CB4B 1JJAA 2CLKB 4FLFA 2QRPA 3KDPA 1LSJA 1Y5NA 2WE7A 2ZRKA 4NS4A 3T3HA 4BV3A 4Z4CA 4XUDA 5H70A 2FE1A 3E7FA 1OIWA 3E3OA 3WL8A 4AZVA 2K6GA 3AQ4A 3N8KA 2XQFA 4GUDA 1HR0B 1O0CA 3IJ5A 2W2OA 3P9KA 3PNVA 5HP4A 3K16A 1UDBA 2VP0A 2ZTUA 4UM7A 4CDNA 3OTGA 2V4ZA 1W19A 1BS2A 3ANLA 4NQZA 4B8ZA 2OO3A 3UM9A 1EJ6A 2NU9A 3UJCA 3KL2A 3ONNA 4G1EB 4KQGA 4EABA 2FZKA 1BD4A 1VFNA 2VSOA 4TMZA 4C2TA 2D7JA 3QWHA 4N5NA 3JQDA 1ZGBA 2AB0A 2QEQA 4D0RA 4BOYA 5LLTA 1AJEA 2CLHB 3OZAA 4X20B 3OC6A 3ABSB 4UU0A 3RC2A 2EKDA 1HNWB 1SVLA 4X66B 3GO4A 2O7SA 1U9IC 2HMTA 3AF0A 2ODNA 1BGXT 1DARA 1XTJA 4BVKA 4KQIA 1XNJA 4CMAA 5LZ8A 4RO0A 1YZUA 4MRPA 2J9ZB 3MMZA 5IUNC 4KE6A 5JAHA 2I4LA 2HGSA 3ND7A 3FHCB 1RWQA 2EC5A 4H7KA 4RSGA 4UEJA 5E6SB 5FQNA 2O2SA 3ZDFA 1Y5LA 4XCQA 4YJDA 5JASA 2EFHB 2H7VA 3MQ2A 4TUYF 4B6FA 5BPFA 3FIUA 4RA6A 4JJEA 5ADHA 2JCBA 5KU1A 4US0R 4PHHA 3S4YA 2DX7A 4LOJA 5C8ZA 3VKFA 1DV2A 5F2OA 5HIMA 1BGWA 2JIZD 5JMTA 2W6QA 4ALMA 2ZB2A 3TZLA 4BMXA 1M75A 4G37A 1APBA 1R16A 5KJFA 3L05A 3PXAA 2P9TA 3QK7A 1Z0ZA 2Z6UA 4OUDB 2O8CB 3JQFA 4EHNA 1R8SA 1YL6A 3LCVB 2FPLA 2WAOA 4KR9A 4C3UA 3OIFA 4G5SA 2CCKA 4XFKA 4JUDX 5CXSA 1XTKA 3VV2A 3R6TA 1B74A 4X7BA 4L5BA 2AN1A 1OGYA 4FCVA 2H18A 4P58A 1GN8A 4DEXA 1A9PA 3D6UA 2ZR7A 2KWIA 1BQEA 4ZV9A 2EWMA 1JB1A 5CPBA 2VYFA 3DOIA 3GEPA 1ZL2A 3OE5A 4MEJA 4RD2A 1LVHA 1A1SA 3C8HA 4TX1A 2YNMC 2WHPA 3PF9A 1Q3HA 2ZJAA 1KVQA 2XGSA 4JUBA 1WHTB 2P2GA 2C29D 2C9OA 3TZHA 2WA1A 1LI7A 5EAIA 2QJWA 5D3ZA 4DVGA 5LYJA 3Q0EA 5JZVA 1UJ2A 3EVZA 2R65A 5ALXA 3ZE9A 5IJ0A 1DTEA 3GROA 1VM6A 2GOYA 3I5AA 2CUKA 5H7XA 2A5YB 4LCBA 3TJMA 5JS1A 4AP5A 4MCAA 4TKLA 5K0SA 2V98A 3SEZA 2Z9DA 1U9ZA 1X19A 5REQB 4AY2A 3WAJA 2C7PA 1TTHA 2A7QA 1KJ9A 3JWJA 1DX9A 2A1TR 5TMEA 3ZBPA 1L4BA 1PV2A 2HEIA 3WWYA 1P7YA 1TLFA 1UPUA 2A5LA 3LPNA 1W73A 3MRVA 3R5SA 4H7EA 4NZMA 4QJBA 4QPDA 3SX4A 1WXEA 1YA8A 5CH3A 4MULA 3QW4B 5CBPA 3UB2A 2G5GX 1U1GA 1CUVA 3G85A 1JQ3A 5DBOA 4DCUA 1U2QA 2J3DA 4HXGA 4XIJA 1KI3A 3IAXA 2QX9A 4Z4HA 1ZGJA 3ELWA 4JLMA 2GI4A 2O06A 5LLSA 1KAHA 1WMAA 3PGA1 2C5HA 5F21A 5TR9A 3W5IA 4U2KA 5B1EA 4ZT2A 4HNTA 5FWXA 2FSIA 3CW2A 3THWB 2AXEA 1IK6A 3RIMA 1TZKA 4L3OA 4O1HA 1OXVA 3EZ6A 4CZ2A 4GI3A 2F00A 2YXEA 5EJGA 4G5YA 3UA3A 1BVUA 3HCDA 2P4EA 3K9QO 2PLAA 4MX8A 3HA2A 3ITNA 4MICA 3WNVA 5HMLA 1L4MA 3F71A 2GUGA 1LLDA 1NDUA 3GPIA 4XJSA 5FLYA 3AR3A 1UOPA 3WV5A 4CN8A 2DE0X 4D80A 1BN6A 3G8AA 5ERGB 3B1ZA 3B1JA 3V46A 2IS6A 3K1ZA 4KLCA 3W8FA 1DSSG 4GKBA 5K3SA 3HKCB 4IXNA 1PZMA 4KVGA 1KR2A 4KR0A 2ZDGA 3EXFB 1Z5NA 3D5TA 4WKCA 2FZ4A 5ER6A 1TVKB 2VDUE 5A7FA 2C3MA 4L27A 3DWFA 1UPBA 3QF7A 2QAGA 5D3QA 2P69A 4EEXA 3HB1A 5KYYA 3TG2A 2X5JO 2QLFA 4LY0A 1ZN8A 2EXXA 1ZITA 1E58A 2JC3A 1DAPA 3CW9A 5GAJA 1XNRB 1G5TA 3DEYX 4ARBA 4MOWA 3E7DA 3PWKA 4BTVA 3DDWA 1EP3B 4J6EA 4LQLA 4QUJA 3O3OB 1C3JA 5ICCA 3AUUA 4J0JA 3AUXA 3T12A 1G20A 4WOKA 4LJ9A 1WF6A 5KJCA 2ZI6A 3K9CA 3GJZA 1XHEA 4P32A 2KE5A 3BCUA 2EGUA 2PKWA 5CJ2A 4EHKA 5KDDA 4JWTA 4ROSA 4X95A 3U1VA 3I9FA 1CB0A 5IYZF 3JXEA 2ZYAA 3RCBA 4C5CA 1VZ2A 3WK9A 3QU2A 3BGSA 4WOBA 1Q15A 2Q1WA 1GL7A 3KR2A 4BCBA 1GP2A 1GTZA 1VPEA 2E48A 2Q9BA 1OXMA 1RI3A 1KNXA 4PAOA 4JJ6A 5AJXA 1KDYA 2PUDA 1DUSA 1XZHA 3DUFB 4IRMA 4MDEA 2FEPA 3FHLA 1U1CA 2E4XA 1UAYA 1MZPA 1U0GA 2WTNA 4Z1MD 5L3ZA 2B1GA 4NH4A 1L5KA 5B7PA 2WWIA 4V3CA 1SVUA 2C2ZA 1M2HA 4B6RA 1Q21A 4L2IB 1ETUA 3JD3A 2OO7A 3AF6A 3DMPA 3RV3A 2CMGA 2J0UB 3U80A 4ANFA 4JC0A 3PNMA 3G8BA 1EWVA 5BN3A 1WCWA 2GN9A 2ZWPA 2PRSA 1S2NA 1ENYA 2CL7X 2FI1A 2W11A 1NONA 3KHKA 5HMMA 3QX3A 4YMHA 1W0KD 1SEPA 3B3FA 4OSPA 3VXKA 3S2GA 4RQUA 3SYLA 1Y80A 4JSTA 2AW3A 1A7JA 2VH2A 4H35A 3IUNA 3DMTC 1LWOA 4C0LA 1F48A 1OX5A 1MTOA 4UFNA 5GVSA 2R7NA 4RABA 4Q18A 4DIFA 1RMQA 2PYZA 4P22A 4A8TA 4OCZA 3CKYA 4NDNE 4LS3A 3PRJA 1ETHA 5L45A 3R7BA 1GZ7A 3E4CA 5AXCA 4GQBA 1JDZA 4J7CA 2F64A 3MJRA 5JQGB 1UWCA 2EW8A 1IXKA 5JNVA 3HJNA 4ROTA 4EFLA 2P6NA 1DG9A 5EEHA 3F6YA 4QELA 2I1QA 4G63A 3S2YA 2VAVA 1PJBA 4XQ0A 3T1HB 1V5FA 4WLOA 3ZCQA 1KMNA 3DHNA 1KBQA 4EKGA 2J59A 2QM8A 1NYQA 5CCEA 2IHVA 4FWBA 4HNAA 3ZCUA 1NHWA 4Q9NA 3GOHA 2IUYA 2X86A 4CCWA 1OAOC 2M32A 4KWCA 2P2YA 4OL0A 3ZI0A 4F96A 4Z5XA 2MCFA 5BR8B 2QT1A 3PGLA 2XYVA 2YTZA 1U3FA 4E2WA 1WHSA 2ZOSA 1Z5WA 3D1JA 3OG9A 4QPCA 1FCJA 5KMGB 3C6XA 4EARA 4ACBA 4GSYA 2QD2A 4K2HA 1JHQA 3B36A 1TAUA 4F2HA 1VCNA 1KPIA 1K8QA 3EDYA 1VHJA 2ZIXB 1C9KA 2B0CA 3KXDA 3NHMA 2PD4A 4WW0A 1EX6A 1V1JA 3Q41A 5GJCA 3MTAA 3WX0A 4KN9S 2H0QA 3IMFA 4JLPA 4BKMA 1TYCA 4M1TA 3RIXA 4KRXA 4FYXA 5AXAA 4YJFB 1DC4A 3R9XA 3D6MA 4E5KA 1TT5B 3RSHA 3N8HA 1QB8A 3ZH9B 1WW8A 3V8EA 2PVPA 1JYSA 3DFMA 3KVRA 4ZREA 1H2ZA 1ZNWA 4KQEA 2F43A 3UWDA 4DG8A 4QM6A 3R44A 3SBEA 2GN8A 1DPGA 1ENPA 5CYOA 3SR4A 1J9GA 2AL7A 2JGDB 2IUSA 5AJYA 2F1IA 5L9AA 3WYNA 1VP3A 3V1KA 2I29A 1Z6AA 4KPYA 3FD8A 5FTNA 1KSJA 2BSQA 3CZQA 1X1RA 5ITVA 1CQWA 3LH5A 1V3TA 1UPXA 1OASA 4B2PA 2DTXA 5EZYB 4GX0A 1DI0A 4NABA 3IOYA 2Z95A 3CR7A 1Y3HA 2H59A 3MAJA 4AG5A 5JPCA 5H81A 1ZZEA 4TWZA 1OFUX 2ZWAA 1SCUB 1NF2A 4PGFA 1JIKA 4AD8A 4BB0A 2Y0CA 3PU6A 4YA6A 4IG4A 2VUTA 2Q7XA 5IJ0B 4HT3B 3HU5A 3C0KA 1SGWA 4NU6A 1A4XA 2RAVA 4IL5A 4C21A 3ZN2A 2DTEA 1YR7A 2HO4A 3L1KA 3MCUA 2O59A 2P6UA 4C7OA 3BXFA 4PQYA 5DI3B 3UBTA 4RXTA 1FSPA 2HJVA 2X40A 2QUIA 1QFSA 4LVNA 1NMZA 4B3HA 1TQ4A 3TNDA 1F60A 4DS3A 5EMHA 1H0RA 2EKPA 1FJXA 1E4EB 2JAHA 2J0QA 1KI6A 4EATA 1USIA 1JSRA 2FSVC 5EE0A 2H2HA 3TIIA 2NP6A 1N5OX 1I0ZA 4I5GA 3D2AA 4OB7A 4PAGA 4P0QB 1T2AA 4LJ8A 1O89A 1P74A 2Z30A 5DBFA 3TR6A 3UQZA 1BDHA 1XLWA 2CY0A 2YHSA 4IXTA 1JAHA 1JKJA 1VL2A 2GPNA 4OEHA 3SIRA 3NNNA 3IDZA 2QUJA 4LNUA 1YR1A 4IGEA 4FFDA 3KKOA 3VKUA 2YV4A 3E23A 2XWQA 4FGJA 1FBTA 3SGLA 5LQNA 3OD1A 1UC9A 5H1YA 1WZEA 4CKXA 3D02A 4L9RA 3DQPA 5ILGA 3JARB 1UBOS 1YBAA 4LFBB 1DX4A 2PMCA 3GYBA 2ZRAA 2DUJA 3ENZA 2FXVA 3I0MA 2H92A 4YAGA 3GLIB 3RAPR 1X15A 3NVKI 2QUAA 4PYMA 1QGED 2CXQA 3NHJA 1KY2A 2Z3WA 2PGXA 3DTNA 4C87A 3DO5A 2XB4A 5IZ4A 2W4IA 1YZHA 3ACBA 3KL4A 3KJGA 3OPQA 5CLJA 5EHGA 1P81A 1NPYA 2AG8A 4EG4A 4B6EA 4Y0VA 3FGPA 3LI2A 1Z45A 2HBZA 4KXXA 3NHSA 3BXGA 3L7IA 3S55A 3GF4A 3GNSA 1FFHA 4CNBA 1ZUNB 3BWXA 3ELBA 1TI7A 2AF4C 4H1UA 4RLSA 3THWA 3C87A 3OLQA 1KMCA 2YYSA 4L0QA 2MSDB 3UCXA 2C07A 1D6NA 1QIIA 1YAJA 3WHPA 2BHTA 5BRAA 2YWJA 3U49A 1HA3A 5FWDA 3RG8A 3FX2A 3H5TA 1JAZA 4KYVA 4PYRA 2G0NA 1GUAA 1W76A 4P7BA 2SBTA 4JI3B 3FOEC 1R6VA 3LC1O 1CBUA 4A10A 5EIFA 4OQ4A 1NDHA 1R0KA 4KN5A 4JFRA 4KR6A 4MYCA 1E18A 4DSZA 3B6ZA 2IKQA 4QBGB 4MV1A 2ZR8A 2VTEA 4L8FA 4ZAXA 3RS8A 4J7AA 1II8B 4I99A 1E4OA 2F7SA 1VYTA 4IS3A 5CHEA 5L7WA 1MNAA 1VLQA 1YR8A 4CL3A 3QEBZ 4C7BA 4PVDA 3FHOA 3RRZA 1C8KA 1WDLA 1WV1A 1C7FA 2H1RA 3IDFA 1XWFA 4OFBA 1OLSB 1PJLA 1W6UA 4FHCA 4E4TA 3LUCA 4RTQA 1XCLA 1K6IA 2WVHA 4RU1A 3BFVA 3UAWA 3F9CA 3TLMA 1N57A 2ZE6A 3K5WA 4YVFA 1T5HX 2XAAA 2D0DA 1D04A 2BZ0A 2G7ZA 3IIKA 1V35A 1J8YF 3DKPA 4FZVA 2P65A 1TA0A 1J0EA 2YVKA 4H7PA 4R1UA 5DOVA 5JS6A 1V3VA 2P41A 3H5AA 3JYLA 4XVHA 1O08A 1Y9JA 2C7GA 4OJYA 3IAM1 4KIFA 3FZYA 1BCSA 1NU8A 2O5RA 3FYUA 2EHDA 4WRRA 4HDKB 4C22A 3H3JA 4DHWA 1C1XA 1AB5A 1VI6A 5KWEA 3O4HA 3U7JA 1M66A 3G0OA 1YBMA 4NU8X 2O14A 1PK7A 2BHSA 1C2TA 1SZDA 1T5OA 4LNHA 4W6ZA 1XDZA 1LW6E 2VNHA 2DWQA 2WUGA 2HLDD 2G80A 4KXMA 4UVIA 5HQTA 4JP5A 3MOGA 5LBIA 2I2WA 1GCIA 3CPHA 5COQA 1R1DA 2YWFA 3AJDA 3LUAA 4KAXA 4LI3X 3BE4A 3NBQA 2DY1A 1AO0A 2D5IA 2CZQA 5CT5A 3EOAI 3KP1A 2V7VA 1V47A 4YWJA 2O2YA 4K1LA 4FBLA 3S2FA 5JY1A 3L7AA 1UC8A 2Q0HA 4ND5A 5JH7B 4M9QA 5F77A 3CN9A 3FGOA 5EIHA 3Q5DA 1N2GA 1GDHA 4G5GA 3QVLA 1ZD2P 5LMUB 1MC4A 2XTZA 2V5VA 1Z56C 4OQPA 3TUIC 3VUEA 3FB1A 3HGQA 3B6KA 1X14A 3I9KA 4FHDA 1L4YA 1LNZA 4LZJA 1N3BA 1IM2A 3L7MA 3AIKA 1CNMA 5ALGA 1ZR4A 4F2DA 1L6RA 3LRTA 1M8GA 4LF6B 2HJGA 4L0MA 4N0MA 4BX9A 4DT1B 3HH8A 4YDHB 2FPGB 2BP7B 3SJCA 2JGAA 3E9EA 1X9GA 3FKJA 5BMOA 3IKTA 1EHCA 1UK6A 1MO3A 2CBXA 3MJFA 4Q4JA 4R01A 5FWYA 1Q11A 1IBCA 1QGZA 1T43A 1XLVA 2GBCA 2I1LA 2JJQA 2J85A 2QSJA 2VYND 1PL6A 4DB2A 2ZRLA 4PHGA 3SC2B 1L5QA 4A91A 3WIBA 1LLUA 2MTBA 4NE2A 4R2WA 4WECA 3ZHOA 2PYDA 3C5HA 1FRQA 3PHGA 3NT4A 2P2SA 3RS4A 3FPSA 4JI0B 1FFAA 4QGHA 3EH2A 5CB6A 2B3DA 3OPYA 3RAGA 4TYMA 4RZIA 2QENA 3B78A 3OJXA 3RWOA 1Q6YA 4UMVA 1LPMA 3I1YA 2H0RA 2HCRA 1HV8A 2A2ZA 1A7KA 3Q9SA 1PNVA 3R6DA 3VO8A 4D9EA 5IASA 1NM5A 1RABA 4PZPA 4KYIB 4RY0A 1KS2A 1Y6QA 3IHKA 3WTBA 1N8TA 1U8UA 4LBYA 4CIBA 3L01A 1TE2A 1OVMA 4B8WA 2GEFA 3R7WB 3EVFA 4MS1B 3LD9A 4EG7A 3S70A 1C1XB 3IV7A 4G1BA 3WK7A 2ZIFA 3CO5A 3LCUA 2GN6A 1GO2A 1KS9A 3ZVNA 3Q7PA 2CUTA 4IMJB 1ZIXA 4YRQA 2OOSA 2YVQA 3QUAA 1HK7A 4D9GA 3GLSA 1EFCA 1XF1A 4R8VA 4QGFA 2VDLB 2VUHB 4N3AA 5KS2A 1P29A 2BUBA 2ZIAA 4MQMA 1N77A 1KSHA 2EX1A 4EO4A 5DCWA 1IN7A 2NTNA 3FUWA 3SM9A 3IR5A 3OJFA 1OKKD 5HEKA 1XVTA 1AUVA 1H6CA 2W2PA 3O8BA 4PO8A 1DXOA 5FOXA 2JLAA 1REQB 2YOFA 4KG7A 5JT1A 2J33A 2G67A 3A9SA 1T4CA 3OD5A 3DLTA 1CDEA 5GMOA 3V55A 4BU0A 3ZD6A 2V6GA 2C9YA 2OHIA 1P0FA 3KZKA 1HRKA 3OWXA 1OFHA 1XVLA 2E2WA 2QVGA 2X6QA 3AI7A 4ZANA 3CEMA 2H3HA 3GJSA 3U9LA 2C7QA 1JMVA 1X2EA 3I53A 1Z0DA 1P61B 2PZ8A 5AKKA 3WRVA 2IX3A 5JEEA 1BMQA 1P33A 2HXGA 1WB5A 4M0MA 4J4HA 4WBSA 1IM5A 3EUAA 3ILHA 3KSZO 1QDEA 2JCYA 1H4VB 3P9IA 4ZGBA 5BV2P 3N53A 3RRMA 2O5EA 1XZGA 3IB3A 1LC3A 4QJ4A 4GM4A 1ZM7A 2BZGA 3OIUA 3RARA 4N41A 4O1MA 4S05A 4BLSA 5EIOA 4J0FA 5CYFA 2F48A 4JR2A 4Y2RA 3S8YA 1UFOA 1FZTA 1CZLA 4H1HA 1FX0B 2RGBA 4I81A 2ZTHA 1RYHA 3BXPA 1KFJB 4ML3A 4URHA 2JIZA 2ZYIA 5B3LA 1M6HA 3O7WA 4MIEA 4EOGA 2R68A 4PSCA 5B2FA 2R79A 2VS1A 4DANA 4E6EA 3MJ4A 1BA2A 2GNOA 1KAQA 2NUTB 4XVQA 1UBEA 1NR5A 3AHJA 4IGAA 4D9BA 2WLTA 2IXDA 4IXMA 5CA1A 1EI9A 3G59A 3ROXA 3GJYA 4GPTA 3VR6D 5ALNA 1IXSB 1CP3A 3I04A 1HE3A 2ZRNA 2EIXA 1CD5A 2COEA 2WT4A 1I01A 4FWIB 4RVOA 5DRTA 4ESVA 1PT5A 4ZHSA 1SN7A 2X7XA 3C3WA 4R05A 1SULA 3SNKA 1OBFO 3IQGX 3VTKA 4BMSA 3C98A 3GLFB 3ND6A 3QEAZ 1CTQA 1J2UA 1FNCA 1A5AB 2YBDA 2BEUA 3CNHA 4B7UA 5KQRA 2F17A 2V96A 1VE7A 1UKEA 4LRXA 5IDVA 4Q6BA 4BX2A 3ZDDA 1IWBB 1JAXA 4NP6A 1YE3A 1FJGB 3RC8A 3Q3GE 3KAKA 4PS0A 3EVCA 3EK2A 5KTSA 1CVRA 3GYGA 2XDYA 1ES9A 3V1UA 1L2TA 2IDZA 5JMOA 2IK8A 4OBEA 3VI4B 2O8EB 3TQTA 1J2YA 2NZVG 2WZQA 3HVJA 4IJQA 3ZWBA 2CDAA 1VXOA 2ZE7A 4WX2B 5I4CA 2PBFA 2B8WA 1H4TA 5F2KA 3F5SA 4DQ0A 2A3NA 4KXFB 3P94A 1VHLA 3HP4A 3FPGA 4X92A 1K6JA 1LQ2A 2ZZKA 4R84A 3VR4H 3I9LA 4WLNA 5JO9A 5K3EA 2W90A 3FMGA 1ESEA 2VHEA 2CF5A 3RABA 1JR3D 4IV5A 1GAJA 1K8XB 3ZU4A 1WQ4A 4RTLA 5DCUA 2WQ7A 4P7GA 4C0WA 4A8JB 3RTBA 1DL5A 3ILXA 4LVUA 3NV9A 2R8EA 1BX3A 1FBNA 1ATIA 2NVWA 2L82A 3K4HA 3ACDA 3MJHA 3NAMA 4JJZA 4KPUB 2JI4A 5TQJA 3T5DA 4AJKA 3T61A 1KWKA 3OX1A 4UARA 2GK3A 4I4LA 3RH0A 5BY2A 4PM4A 1RVDA 3T52A 4KEAA 2HWXA 3A06A 4GMKA 4D9HA 5HVNA 1BS9A 4GM1A 4FYJA 2FUNB 3WLMA 3D6AA 2R25B 4DV2B 2FK7A 1Q57A 2IH4A 3WHKA 2EWVA 5JATA 4UHDA 3AEQA 1JR2A 4KK4A 1TFUA 4YREA 3R76A 2G3YA 4Y9RA 4DY4A 3WQHA 4MW5A 2XUJA 4MV5A 3TE7A 1DC8A 1EGQA 4TT8A 4AB1A 2WR8A 2A5DA 1WVGA 2QQGA 2QTVA 3E15A 4ZYWA 3GEDA 1IB6A 2Q8PA 2VA8A 4MVCA 4HBZA 5GINE 1SIOA 4MKIA 3OO0A 2WOJA 3ZKWA 4G25A 2BRUA 1JN0A 1HNNA 1OBCA 3KQPA 1P4JA 1SU6A 1O0SA 3ZEAA 4RSHA 4EPWA 4IOLA 5I5EA 3DXYA 2O3JA 1M6NA 3WXMA 1RIIA 5GZ1A 2RKOA 4E31A 1N25A 4U7WA 5EIEA 2FR8A 3G17A 2X5KO 4H08A 4H3KB 1S2OA 3V32A 2IT1A 3PLNA 5C2JB 3B38A 5DCLA 3OO1A 1P1IA 1P3Y1 1W52X 1YTLA 1SXJD 4TRNA 5M04A 1GZSA 3EIOA 5BV8A 1ZINA 3TSOA 3VR3D 2J6CA 2HMUA 4O3MA 2KLBA 2Q1UA 2F8MA 1CQJA 3V80A 4ZYYA 3UUWA 1X80A 3OLXA 4FEGA 5JALA 3H4TA 4D56A 5KEIA 3UT0A 1J4AA 4KKXB 4MVJF 2QTMA 3RK1A 1ADYA 1TJ3A 4DLNA 1VECA 3A2NA 3AI1A 3AERA 1QFJA 1TLLA 3JTMA 1H8ED 5EJ5A 3DMFA 2MYNA 4R5MA 3HMKA 1KDTA 2ZM5A 1BDBA 4MR8B 4AY6A 1S96A 4Z4EA 2IZ0A 5EG5A 1XDGA 4QHSA 1E1RD 1PD0A 1PCXA 3KSMA 4C3OB 3VO1A 3EUFA 1J6UA 2O1WA 2N1MA 2CYCA 3AY6A 3DD5A 3HV0A 3V33A 4Z4IA 2FN4A 3NWBA 2V3CC 1FRZA 2NU6A 4QT4A 4BL5A 4LF8B 1S2DA 3HM9A 5A04A 1FYFA 3IEXA 3IBCA 4CV1A 3ASYA 2IQ5A 2MSNA 3IT3A 1E2LA 3HXMA 4J29A 4LZNA 3LL7A 3KJEA 4FT4A 5AHXA 3ADKA 5D86A 3RG2A 3SM3A 1NXVA 1ABFA 3ZWKA 1CY4A 1SCJA 4HEA6 4ZHQA 2CXSA 4WBNF 1CUHA 4WGFA 3WKAA 3K6SB 1CQPA 2OO5A 1PYGA 1FC0A 1DU4A 1LKZA 3RJTA 1MDBA 4G0WA 4PQRA 2DY0A 1GM5A 3NIFB 2A84A 3FDXA 4OXNA 5KCMA 1JG2A 4QTZA 2AOXA 1K8ZB 2W9XA 4NJMA 1T1SA 5IP5A 4CLEA 1MOSA 3IIEA 4NYIR 4CBVA 2J45A 2C82A 4JU8A 4PQFA 5BV0A 3SZGA 1C80A 4O2AB 5AVYA 2CKDA 2KX7A 1AK2A 3WLHA 4A0RA 2DFKB 2EFJA 1QCYA 2PM8A 3TVDA 4MCIA 3DOCA 4X0EA 2A86A 4L85A 3OM0A 4XX0A 4YGXB 3K1AB 3KELA 1JEEA 3TLKA 5MHTA 1PTJC 4BZWA 5ITSA 1KI7A 3D8BA 2XZLA 3RGWS 1PHRA 5ECGC 5HIIA 4XUCA 3JYNA 3LGSA 5K01A 2AWNA 1WWKA 4GBMA 3TE6A 3A9WA 1WHTA 2OE2A 3GBPA 5JFGA 1SC9A 3DBLA 4LXHA 2OXTA 1YCDA 3Q3IA 3ZDCA 3RD5A 1BIFA 4B32A 2O23A 4FQ7A 1RLUA 1NF3A 4A0QA 2J08A 5LNK6 3KPVA 5C7YA 3LDAA 1DEOA 1N34B 1NVAA 3L6DA 1K97A 1L5LA 4A0SA 3OUZA 5FKJA 4JUAA 1R66A 3WJ7A 1U7TA 5CM2Z 4YMWA 4TRRA 3AVVA 2J5BA 2FKAA 1AUQA 3QWIA 1QG4A 4LXUA 4FNMA 3NNDA 2WIFA 2GJ4A 2IZ5A 3I05A 4NV1A 4TLMB 4X6YA 4ECEA 3B1VA 5BQOA 3ZCPA 4XB1A 1MB3A 3QUCA 4M7WA 3V2HA 3EF0A 4ZVKA 1R4ZA 4B9AA 2ADMA 4MR8A 3PT9A 3EIQA 4XUGB 2ZB3A 4HWRA 3I2YX 2MSKA 3M7IA 1T2NA 1JE1A 3C6YA 1EVIA 1HOTA 4MROA 4KI7A 4IKOA 1PL8A 2XJ4A 4WXRA 4Q24A 4XOUA 2NUAA 3SAJA 3ZBQA 3CLSD 5JWRA 3OU6A 4DV1B 2HSJA 1RWMA 1WVIA 3TLXA 1SCNE 2IYQA 4J94A 4Y9SA 2PCLA 4UAVA 4W7IA 3VX4A 4QO8A 1Z4QA 5K0ZA 2PUHA 3A3YA 3DWIA 3SC2A 3ZK8A 4B73A 1VPWA 4G5HA 1LDBA 2AZXA 1Z6GA 2LWIA 2QR3A 1GYPA 1JHOA 4IV0A 1TGYA 2FP4A 4TS1A 3HLTA 1KGDA 1EG2A 2D0IA 2DBYA 3PNOA 4TV8A 3RTDA 4F21A 2B1RA 2NV6A 4PNEA 3L4JA 2AOTA 3BMQB 1H3NA 5FH9A 5MFPA 1W7AA 4G9BA 2AA3A 4EFDA 1QJ4A 3OFSA 2B20A 4GWGA 3W7VA 1Z29A 4UM8B 3OWOA 4DDWA 4RD3A 5JXWA 3A2MA 1N32B 4UASA 4H4CA 3UC5A 2Q5CA 3STHA 1EFLA 1L9KA 3GJTA 1OFTA 4I5EA 2WMOB 4RCYA 2DQZA 2NT4A 3RUEA 3ZI7A 4F72A 1F8YA 3RQSA 3PNPA 2YDXA 4BMVA 3Q7IA 4WINA 4YT2A 2DFNA 3GDGA 3U9SA 1QS0B 4OQDA 2ZCVA 5LOVB 4CG2A 4W9RA 4RV5A 2WYIA 4ZDKA 4AUNA 3EPJA 3OQPA 4JEIA 3EPKA 3KKLA 5JSQA 5K2OA 5H68A 1IIBA 3F6EX 2Z5VA 3U9TA 3CRQA 3ZXUB 1IEVA 2WAAA 3OH8A 5HE9A 3MG9A 2MYUA 2RIPA 3ORQA 4AJOA 5I9TA 5B4TA 1VLVA 2DEUA 1M2KA 1GV1A 3DM5A 4XXHA 4QSHA 2HC9A 4M36A 2WJWA 5EUBA 4QU5A 5GOTA 3ELUA 3EXIA 4LSWA 2ZT8A 3DG9A 2GKSA 3ETGA 3UHJA 2A35A 4EWLA 1T9DA 4ND6A 2OBXA 1VRCA 1AG9A 4ZDWA 2NTYC 4YIHA 3SQWA 4V1CI 2NQ2C 4LOLA 5E2IA 5H0IA 1PGOA 3L18A 4UBJA 1PU2A 4I36A 3HDQA 5ITZA 4WY2A 1WDMA 3IA7A 3MS7A 3KAQA 3DL2A 4OIFA 4ZGWA 1YHNA 4R68A 3SEFA 1RYZA 4F97A 4YUXA 2VZ8A 1F38A 5EJAA 5T3YA 4JKYA 4LZAA 1JQLB 1QXSA 1HT2E 1X74A 2VCYA 2ZUUA 1MP0A 3LUGA 4ARIA 1PIWA 1S3GA 5DNEA 2FDCA 4OTZA 3NC0C 2IEAA 3PGKA 5AJTA 1EFRA 2VPPA 3D1LA 1ONOA 4JJKA 3CX4A 4R31A 2CHFA 4XX0B 3TI9A 5IKMA 5LJLA 2FMFA 2YIMA 1JQJC 1QHFA 3U60B 3KU1A 2WB4A 4ZO4A 5BVGA 4PPQA 4LN1A 3KJFA 3EGIA 2F8TA 3QVTA 4UD2A 1EWTA 3LYUA 4LDZA 3JQEA 3GGGA 4AQDA 4OX9Y 1OXSC 3KNZA 1MIOA 4LECA 4E5MA 1SVWA 4HDNA 4F3KA 3OEHA 4BNNA 1L5FA 4NYJR 3H5IA 5EE9A 3VOAA 1ZWLA 1KKUA 2JLBA 2Y2UA 5J2TF 1Y1RA 5K0LA 5KX5B 1SD2A 3RR2A 3ITEA 4ZOLB 4AKIA 4ZCPA 2BJVA 2A0YA 1E3TA 3T4PA 3YASA 1JR4A 1B8PA 2PHZA 1SURA 4A36A 3VR2D 2AJBA 1IJFA 2IIBA 1KPHA 5FADA 2QROA 5IFKA 2OZLB 5CFRA 4ZVTA 3E9YA 3EVTA 5I9MA 1AN9A 4DIMA 1EZZA 5IT4A 4LMAA 3M89A 3O8QA 3OZVA 5DNDA 1U7DA 1Q3TA 4Y2JA 1TIKA 4R41A 4EEZA 1MORA 1CUDA 3LBIA 4P4TA 1R0YA 2DWUA 4B40A 2Q46A 4NAUA 2PQ6A 1HT1E 2ATCA 1FQOA 4POOA 4RQBA 3P9PA 4QOHA 5CP8A 4W9MC 2ZG6A 5BYBA 5AK6A 2BCJQ 3M6WA 1YL7A 2QE6A 3T95A 3ZHYA 1TJ4A 1ULTA 2VTKA 3AB8A 3BERA 3ZGZA 3FKQA 4UCWA 4JVMA 3BJEA 2B82A 1ZJ4A 4CR8A 1PQ4A 4ZYXA 3R5KA 4TTQA 3TX6A 4YJGB 4RTPA 4TZ6A 2CNWA 1HKUA 1N4DA 1XXHA 3IQXA 4I2VA 2OQRA 2XOKA 4AKSA 2Y0PA 4X63A 3UH0A 4C0BA 1FUEA 1BWRA 5A71A 4RVNA 2KBEA 1V8DA 3HN2A 4YQEA 3CEAA 3PEEA 4AUEA 5L3RA 5G3YA 2I9PA 3DEJA 2I55A 3C1TA 1YB5A 3QU9A 1E5VA 4ZYLA 2QK4A 5A4DA 1HC7A 3WOHA 2PGOA 5EI5A 2KM1A 5A0FA 5FDFA 4C9BA 3EMKA 1K1EA 4YDSA 4Z3OA 2GBLA 1RLTA 1Y5MA 1DPFA 3FTFA 4DQVA 4G0NA 4Q16A 2X42A 3C7KA 1PZNA 1SUSA 1NW8A 3KXKA 4KXYA 1SXPA 4IIJB 5BSWA 3BXEA 4YLGA 5IBCA 4HAYA 5BQ5A 4N7JA 1HDZA 2EJWA 2QR2A 3BXOA 4X9XA 3T06B 5T4FA 4IXWA 1ZU4A 1R9JA 2V7QD 3E5MA 4HNQA 2Q5IA 3DVSX 1N2CB 4LDNA 4CIAA 1JFTA 3F2VA 2D1QA 3OWHA 2IZ7A 1YZKA 1AKWA 2PL5A 2X7JA 2GEJA 3B7PA 2JARA 5IM5A 3QIAA 3BB1A 1VL0A 4EDHA 2DOKA 1F51E 2OAQ1 2ZIGA 4WOJA 2BE9A 5TGTA 2VAPA 3LQRA 1N6NA 2QLLA 3FWKA 3O4FA 3PCTA 4P84A 4TM8A 3RWMB 4ILEA 3MT9A 3D3EA 3G2QA 2CUNA 5DJ5A 3ER8A 4A92A 1E2QA 3LDGA 4HTFA 1JECA 4MQ6A 3AONB 2Q45A 3ZV5A 3ZU3A 5CFNA 3COPA 2P11A 2B6NA 3HE3A 3O8OA 4MPTA 2XT9A 3U56A 4QFCA 3QTLA 3ECAA 3DUFA 4Y2XA 3B13B 5FUYA 5T3UA 1IQUA 2GAIA 3P4XA 1ULZA 1NP6A 2RHDA 4TQAA 5SY9A 3B1XA 5JXJA 1A8HA 3NNSA 5JAMA 4J4BA 3GDHA 4JH0A 4Z8YA 3FFBA 3O73A 4XEHA 1JHAA 5DLYA 5EHQA 4TROA 2IIQA 3EVNA 4JB8A 4KX3A 1R6BX 3AQIA 3CKKA 4YRDA 3PFKA 1I2ZA 4GP7A 2VPYA 1HRDA 1RWKA 4PQGA 5DCYA 4H0NA 4DPLA 4BLWA 2DM6A 4YUVA 3I5YA 1CJTC 2QUKA 3BCSA 1OI2A 4YACA 4I8XA 2I1VB 4A6EA 3B70A 4BFUA 5A4KA 1YVDA 1R3DA 4DM7A 3THXA 5FFMA 1T8PA 3TB4A 4DQUA 4JC8A 2J3QA 2AX4A 4KDEA 5EVCA 2UXCB 1LH0A 3B1FA 3AL2A 2BJWA 1X7ZB 4DCGA 1YNOA 3BDVA 4RAQA 5HR5A 3O93A 1RAAA 3PUHA 3PB3A 2ZFUA 4OB8A 4AZSA 2ZPUA 2Y68A 3GV0A 4CCSA 5TSDA 2WWFA 2MJLA 3L7KA 4P3KA 4RVUA 4U7HA 2GA9A 1XD2B 4QYIB 2F3PA 4OHVA 4RMHA 2DQ4A 3UMGA 5AVZA 1DELA 1OJ7A 1MX3A 1N2ZA 1PJZA 1T5DX 1Z8DA 3DMGA 3FKSA 5FR2A 5BYKA 1K3TA 3NRCA 1M10A 1UEXC 2I8CA 3B6IA 1KEZA 3V42A 4AP6A 1O96A 2DQKA 4KUHA 3QLTA 2XTMA 1AZWA 4OHRA 3IX7A 3K2EA 4ZI2A 1NOJA 4MV3A 2BFDB 5EMJA 1XTTA 1QHHB 2O8DA 2Z2JA 4FFOA 5H3HA 1Q12A 2YXDA 4LBWA 4DWVA 4D46A 4RSRA 4YROA 3P7MA 3R77A 3DAGA 4KSBA 1OH5A 1ZWKA 1YKGA 3H2ZA 3T0IA 2C99A 2KB0A 2Q2VA 2Q0QA 3M9WA 3PPIA 2PAAA 3HL0A 2J5QA 4YLYA 3MBIA 5I4KA 1DOZA 4ZK2A 4TSFA 1PTJA 2RGGA 5TNXA 5GJBA 4TYPA 1Q77A 2Y1DA 2J6IA 3D3KA 1ISHA 1FK8A 3WJ2A 1CJCA 4Z3DA 4AC9A 2G1PA 1D4OA 2WYWA 5T57A 2VEDA 1HNXB 1NVGA 4HP8A 3JQFC 2IYUA 1I1HA 3PLRA 2AMJA 1NGSA 2QN9A 3D3JA 3IUMA 1I36A 3FLBA 4I4NA 5JRZA 3QU4A 4DEYA 5EJIA 3I34X 1Y8ZA 1ZGZA 1MHTA 1TK9A 1N3LA 1SWWA 2YVLA 4XLZA 1B15A 2R00A 3A3OA 1QIHA 2H08A 3IPCA 4HWPA 1G9TA 2OQVA 3WJAA 1E7MA 1ZRHA 3PGXA 1Q1QA 3N2GA 3UJAA 3H9EO 3U44B 4NFSA 5C51B 4P4NA 2B5VA 2ATXA 1G3QA 1WCIB 2OORC 5TMDA 4YJ2A 3S1SA 1P4GA 2V7GA 4TTAA 2VHYA 1YTUA 3HC7A 1DIOB 3ZW8A 4P98A 1L3IA 4A0GA 4WADA 5FBHA 2IOFK 3CRRA 3ICOA 4HV4A 3DBHB 4AY3A 2V6MA 5IAJA 1UXOA 4PSAA 1DCKA 2XMQA 2YV3A 1CUIA 3DXZA 3GN2A 4JSRA 1SHUX 2EZUA 1C9EA 2VDPB 1KP9A 4UHFA 2C88A 1A2OA 2CVOA 1P72A 2LUOA 3EA0A 2I9KA 5DWQA 1NFRA 5D6NA 4QYTA 2MDTA 1G4AE 4U3JB 1EDEA 4QSMA 1LX6A 4A0FA 1ST2A 5HS4A 1RHQA 1ULUA 2P2LA 3KLPX 4JX9A 2Q4BA 3LT0A 4GPZA 2GB4A 4MVYA 1DFHA 2OYSA 2HYIC 1IOLA 3PDHA 4XASA 3WL4A 3F78A 5FUWA 3K2QA 4R2JA 4U0JA 2IYPA 3I2KA 5IJAA 1JR6A 4IKPA 1XZPA 1BYIA 1LLCA 1ODIA 3CZ4A 1NJ1A 4G01B 4GDMA 4HRXA 1KI9A 4RWZA 5FUXA 4WXMA 3EQ6A 5AVKA 2XHEA 1JH9A 2G70A 3DCNA 1L7PA 3IHWA 1JI3A 3ML1A 5H16A 1WB4A 3UK2A 1NVUQ 2RCNA 2QN3A 1CV2A 4K6FA 3SHOA 4MR7B 3REFA 5G0WA 1U94A 3ZUPA 1XDDA 4R1QA 4KFCA 3PEYA 1DFGA 3FI9A 3UHFA 3SHWA 1QQAA 5B3JC 4AXXA 4QOIA 4I08A 5F4BA 5AKGA 4FU0A 5K3FB 4IDBA 1TJNA 1KL7A 5U1PA 3WMGA 2WKRA 1FXWF 2RGEA 2ZXFA 4L22A 5HDQA 3FNGA 5HKKD 1NVFA 1FUYB 5IZCA 1V7QA 2WUEA 4ZC1A 4M8SA 5LDGA 1UMCB 2F3QA 4FLEA 3GJRA 4ZQEA 4PLYA 7YASA 2FFBA 2C2KA 1M0SA 3F3YA 2QJFA 1V5IA 1S2MA 2Q0SA 3IDQA 1MBZA 2PH1A 1S3FA 3LPCA 3G7SA 1V2HE 3H19A 5DYNA 3TKLA 3W04A 5LPNA 5KKCA 2IEDA 3B2EA 2SICE 1A98A 2PDAA 3EVAA 3GBSA 4HB2A 1RXIA 3TW0A 1B4DA 3DPUA 4ALKA 1THMA 4DZRA 3MW8A 4N5MA 3TSYA 1NWHA 4TGLA 4BIMA 3AO0B 3FKSD 2NU9B 3DP9A 5KNLA 1HGXA 1JLMA 3AY7A 4JBXA 4EQ6B 5TGZA 1HE8B 3HA3A 5SYMA 3DAOA 2QU7A 3FW1A 1Z37A 1MXHA 1T9BA 1KTVA 3NBZC 1UDRA 1M34E 4P8RA 6PFKA 2HW8A 2QV0A 4V3BA 4LHYA 4KCGA 1LPAB 1MUUA 2OHFA 4XYLA 4YO7A 3O3NB 5FOTA 5BOVA 3MN1A 1E6CA 4KO3S 3OIDA 4M9CA 4PXAA 3IO3A 1LUAA 1TLTA 5DXFA 1EUCB 1L4UA 1ZNZA 2IC5A 3E9DA 4FINA 3RVRA 3TN7A 4N03A 4UDNA 5TGDA 1ZHFA 2O2IA 1MX1A 1QM5A 3OM9A 4L15A 4FGLA 3PD0A 1K27A 1KRHA 2AH5A 4QUAA 3STXA 5IBPA 3FNBA 4W5RA 4F1WA 4MUGA 4CUJA 1GFIA 3FI0A 4PSKA 4XVRA 3HCBA 1SOVA 2MMCA 1XHFA 4ZCQA 4IIYA 4FTWA 3T94A 2IY8A 5KWIA 3A9CA 4Y2YA 3KLBA 2Z08A 4MVJA 1RYMA 3LF2A 3W6UA 1UXGA 3N3BC 1JEYB 2E49A 1RBYA 3LKZA 5HKOA 1O57A 2P30A 2VF8A 1RD4A 1ZUHA 1T6XA 3E9NA 3HN7A 4YRLA 5CX4A 2PUJA 3BK2A 3CWCA 3C24A 3KYBA 3TXYA 3I62A 2R87A 2EQAA 5DHUA 5JQWA 3D6NB 1FTYA 1YMVA 1AC5A 1DOAA 3JATA 4MS4A 3ZIAA 3HP7A 3ZHCA 3CLHA 3CX8A 3LE8A 3WIUA 2NU8B 1PV1A 1BFKA 4HNSA 4B3RB 5AW0A 4N4AA 1B6SA 1M1NB 4P53A 4YRKA 5CA1F 4NZNA 2FMTA 4M1OA 4D8XA 5MDHA 2GM5A 4XPIA 4XSHA 4R9VA 3GWZA 2FWNA 1J42A 2W2TA 1XCBA 5ITWA 3VKHA 1W4RA 3ESYA 4JJFA 5JSKA 3H1FA 4COKA 3DR5A 1HG0A 4OU4A 4W5WA 1RAFA 2BEUB 1I2CA 2WHXA 4MIOA 3CNNA 4NWIA 4QG7A 5JJIA 3B8EA 4OBWA 3UJHA 1MVOA 2DB3A 1O77A 5F1OA 1XCMA 3A6JA 4UTZA 2BMWA 2YUTA 4QIHA 4HI0E 2FQQA 1Z5PA 1V71A 3ODGA 1VHDA 4CKEB 1NKVA 3ROQA 4ZZIA 3SZOA 3B3JA 1VYHA 2ZAMA 2X9GA 3DKKA 1DBQA 3P52A 4M83A 2J0VA 4B3TB 2LBPA 3GUZA 3KOUA 3MJTA 1NV9A 1X9IA 2WWHA 4AAYA 4HH1A 5ANRB 3MILA 1PJRA 1MRNA 5FPSA 4IZIA 4YUWA 3R09A 1ZSYA 2G8NA 4NPCA 2FMIA 5LOVF 1Y7IA 4I50A 7REQA 4RTSA 4WFIA 1ZO8A 3CNEA 3E35A 1YE5A 5E9WA 4I1VA 4E14A 3U5TA 1E69A 4Q1FA 1QH1B 4M7PA 1I30A 2AD5A 3ZV3A 2XE8A 2ZXUA 5AJZA 4PX2A 5HYVA 4E4RA 3H2BA 3LUKA 1QF6A 1DDIA 1A27A 1USWA 4EB3A 2ZJYA 2H9AA 1U2RA 1ZN9A 4BNGA 3JARA 4RTJA 1T9KA 4QBTA 3A25A 1DE0A 4ZVMA 1X8KA 1FE8A 3B5IA 4ZCIA 4RH1A 1HNZB 1Y8QB 3A26A 3EFOA 4RXUA 3ERCA 3AVOA 3M81A 3CH5A 2G36A 5JD5A 1N5RA 3CRW1 5AM4A 4U0KA 3T3MB 3E0XA 4H31A 2FPXA 2UUAB 2E9SA 2WV7A 1KFCB 2OQIA 5SV2A 1T0BA 3CT6A 5IJWA 4U3JA 3Q8LA 4WK2B 3LV8A 1UJMA 4GOOD 3OY7A 4PAQA 1OI7A 3M1IA 4F0JA 3BRCA 4D4LA 3KETA 3HXTA 5IM4F 4GBED 2XCLA 3M6LA 3VNSA 4AP9A 2V0NA 2J9GA 3QHQA 2GEKA 1AKTA 5F7XA 1QVVA 1C9NA 1X94A 3BILA 4KFUA 4MCHA 4BJ1A 4U02A 3O9ZA 1YC5A 1C3LA 2QW0X 2XT6A 1GGEA 1CRZA 4ZQHA 1FLVA 3OKAA 4JBIA 4MJ7A 1B26A 4QOGA 2GCEA 2X2FA 3GA5A 2ID8A 4K9DA 3JU3A 1YO6A 1NNI1 2B98A 3ILSA 3EEQA 1I3LA 3P20A 1WF3A 4TVSA 2MT9A 5JAQA 4DR5B 2Q3BA 3G0DA 1ZESA 3IRUA 2HFKA 1KDOA 2NZUG 3MM4A 3EDQA 4N12A 3L3BA 5BN3B 3S2UA 5HOQA 2Z2IA 3V2IA 1L7VC 5CX1B 3C7AA 1SBCA 3ZVLA 4N39A 2XAUA 3T99A 3IAS6 4ITUA 1ESCA 1M1YE 4ES6A 1KAEA 4LRSB 4CLXA 2YOHA 2BBOA 1BHQ1 4GC5A 3AU8A 1B6RA 2W6JA 1MJHA 2C5AA 4N9WA 2WINI 1OBHA 1HH4A 1L6IA 2P40A 5ICEA 1IN4A 3KQMA 2TMYA 2NXEA 4FHGA 3FRIA 4Q82A 1UBRS 2VWHA 2HRDA 4MLPA 2VP9A 4N8DA 3DBVO 1PUJA 2EFEB 4QHTA 4Y2SA 5EHXA 1CY0A 5WRFA 3TYXA 3HJHA 1KZYC 1NXWA 5FWXB 4ALNA 3SXJA 5TT0A 2R84A 2YZ2A 4Z0NA 3LQ1A 4H1TA 4HAVA 1DXQA 1IEQA 1VL1A 3LRXA 1KF0A 1QLWA 3QA3E 3FR8A 3EDCA 4YNBA 2V03A 5E4JA 5G0VA 4AZ0B 4CQMA 4MI3A 4REQB 2VF2A 4BQFA 1E2PA 3H2SA 1VJRA 4TSFD 4HQFA 5FPKA 4Q00A 2WICA 5CBPB 1OYYA 4EJSA 5HNKA 4HH3C 3KO8A 4HOYA 2JL1A 3OQJA 3T54A 2AFHB 1YU6A 4WBNA 2A14A 5AIAA 1SIBE 1YMUA 3OCZA 4KFTA 2WU3A 1QE5A 1TAGA 3VNUA 4YRJA 1DG1G 1V9LA 4JWKA 3Q0TA 3HXLA 1D2CA 3ANMA 1HT0A 4K6GA 3C85A 2VOJA 3FYSA 3L4BA 3NX4A 4HFRA 4NMXB 4N5HX 1AKUA 1FVFA 2G4CA 4LF7B 4KXWA 1N0IA 2V9PA 5I7SA 3IELA 3OT1B 4AZ0A 1NULA 1P7WA 4MVJE 4EAAA 4CQNA 1YSCA 3M82A 2V6BA 4AKEA 1N6KA 1KK3A 3L93A 2IY7A 1T3ZA 1W1WA 1XMXA 3B89A 4XTRA 3ZVKA 1C1HA 4HH0A 3V8QA 3TRDA 2HCTA 1O8BA 2OHXA 4NFLA 3E70C 4KFSA 4BN0A 3SQNA 3ZQ4A 3F6BX 1CYEA 2V7WA 1XQ9A 2G76A 3AUAA 3FOWA 4RPIA 2HSDA 4UHHA 3RJZA 1EH5A 1QNFA 2QMEA 1U31A 2PS1A 2YWGA 3MC1A 3L0IB 1U6JA 3GRZA 1QH0A 4Q3NA 1G4UR 3IUJA 4ZVVA 1RC1A 5B53A 3UATA 2BDTA 4PAWA 4FWTA 1ORDA 1E1MA 1MRZA 1DJLA 1YKSA 3TH5A 4DJDC 3EIWA 2JG3A 4KHZA 2VDVE 4INAA 3P0JA 2VI5A 1XELA 2TMKA 1ACJA 4IUCS 4R2HA 2W98A 1VQ1A 1MENA 2O5VA 2VDKB 3FZQA 3NORA 4L5JA 3HNOA 5BNTA 2Q8NA 2A5FA 2R6FA 4NVRA 4F6RB 3TUZC 3LT1A 3QEMB 3DFIA 2ZW9A 2CLDX 4WSOA 5H3LA 1PJAA 4FFPA 2H9IA 2IHUA 1ZJ5A 2W2KB 5DHTA 4YPOA 1LRLA 3MK31 1JLLA 1YK0A 1WXDA 5TJ9A 6ABPA 1DHRA 1RAHA 2ZT6A 4M0FA 3EZ9A 4LSMA 2HF9A 4RMGA 3FOCA 2C4NA 2AKEA 2R60A 3G1TA 3TEMA 5K8LA 1IATA 2UVPA 2XNDD 2JAQA 5F1YA 3RHSA 4OPMA 4HXYA 5FAKA 2CNDA 1BWSA 1RU3A 4WN3A 3QVUA 2JGNA 2PSFA 4IIHA 2GAJA 3AR6A 4TKVB 4WNAB 1PDWA 3UW3A 2GS9A 4KWHA 5B6IA 1IK4A 3HYTA 3PLAE 4B3GA 4B3XA 1NN3A 5LMZA 2BBTA 3AR9A 3UMSA 3WFIA 3JQ6A 1PTKA 1NBMD 3F6CA 3VDMA 2E5FA 3N0RA 4ZALA 4HDOB 2O20A 3B51X 1T2DA 1SBIA 2X1MA 3WLLA 1E2GA 4DAOA 1EHIA 1UM9A 3AHEA 1XZ8A 5M3BA 1SC1A 4YIKA 4R5HA 3RFVA 3RU3A 3S81A 4ME6A 4JT9A 2ZUFA 1DIGA 1NT4A 1XMIA 2O8FA 1UQRA 1I3OA 3EIUA 4RNCA 1G19A 3NBYC 2XMZA 4ZV7A 1Z38A 2J9XB 1ZJJA 2JH8A 4FDVA 1HSOA 4ZI3A 5DLQC 3SZ3A 1LX7A 3ZK7A 3CE6A 2WOOA 4MGZR 3QLVC 2WJPA 3C7DB 2GKOA 1P2SA 2GQ0A 2PT9A 3COYA 4MK4A 3CPJB 4Y6RA 4FXOA 5EESA 1N9KA 3CUSA 3DJYA 3E3AA 1G20E 1GPUA 1L5HB 3JQGA 3O74A 4HZGA 4TPKA 1IG3A 5DX8A 4DCMA 4TL6A 4XWWA 4KN8A 1TVCA 5K5EA 3GJ0A 3JW8A 4F91B 5PGMA 5IJXA 1KXJA 4M0CA 3D43A 1YFLA 4CLRB 1DEHA 4HQ6A 4X45A 5BXQC 4E70A 1WSAA 3PQ3A 5KHAA 1QLJA 1E8DA 3OIGA 2VATA 4NMWA 3W2GA 2W6PA 3RUPA 4BE7B 3H4VA 3ZU6A 4CUKA 3O3CA 5BN4B 1DO8A 1EFPB 2C57A 1F0YA 2UVDA 4OSOA 1L4GA 2GPYA 1ZHOA 3BWEA 2JAOA 2Q21A 1YNSA 4XARA 1PNOA 4OHPA 4ZRMA 5B3AA 3GUYA 3TQOA 5JZOA 3DVLA 4F04A 3DZFA 3WSVA 4A8PA 1W36B 4X3OA 3QW2A 3PC3A 4HS9A 2QG4A 1EIWA 2BJHA 3LK7A 3G2PA 1EE1A 1BYUA 5J2UB 1SU8A 1ADJA 3W78A 3QNMA 1F4VA 1RAIA 1IN6A 3CPEA 3GLUA 1DNPA 4LHWA 3WNQA 2PBZA 2P8JA 5TARA 1TKBA 4QGAA 5KNBD 1NSYA 4B1FA 1LLQA 2OAGA 4N49A 2XTAA 2P3SA 4HF7A 1OTHA 4RPJA 4G41A 5G02A 1YDHA 2VRBA 3SQDA 2GYWA 1IXRC 2H51A 2BUAA 4WZBA 3RC7A 1QONA 3FCUB 2J87A 1NZJA 2R1VB 2C7BA 2WU4A 4LJKA 3VR5H 2BEVB 1V25A 3GEEA 4Q3EA 3PWZA 2CW5A 1KO4A 3U4MA 1UJCA 1CUJA 2XKBA 4HB4A 4BP9A 4E2FA 1KEKA 3ED1A 1P9OA 1TPYA 1WEKA 4PNPA 1MN6A 5EJFA 3K6SA 1E2BA 1CS0A 2XYHA 3EIFA 5IAKA 4HXEB 4DMFA 4QZVA 2WG2A 1KMQA 3LFTA 1PGPA 4R8LA 3WKDA 3VBCA 4XVUA 3LPAA 4FUQA 4KMMA 1Q1NA 2AJ8A 3F7NA 3RSOA 3WGGA 4OM7A 2HNAA 4HLUC 3TNFA 3L8DA 1KE1A 2PE5A 1Q19A 4TLCA 1FFBA 3CEHA 3G8DA 4YQZA 4Y1EA 1CZUA 1EK2A 1AA6A 1RACA 3AGPA 3E6AA 3OESA 4PHFA 3PPVA 2GM3A 4TRJA 5FBKA 3X2SA 4EPRA 1O4VA 4WOPA 2QTZA 4EUEA 4DSAA 1Y8AA 1SEVA 3I30X 4GX1A 4BYGA 2OZEA 2EKLA 1USKA 4GP9A 3D3QA 2Q6IA 3OZEA 3RS0A 2OUIA 2WFMA 2H1HA 3SG0A 3PPWA 5EHNA 3FXAA 5F3DA 5KOIA 1KDPA 2C2YA 4FN5A 4QUHA 3EPLA 5F9FA 1JDUA 1T0JB 4HH4A 1FRFS 5I9IA 2ZYDA 4EG5A 4F93B 2CYAA 3RAFC 5TQ0A 3N87A 1PG2A 3HRIA 1O8CA 3BZUA 4KO8A 2X0JA 2XZDA 2Q28A 3L0PA 3TZEA 4LK3A 3HYLA 2IHZA 1OX6A 4RLFA 4RAOA 5HILA 3KWMA 3IOEA 1FP6A 3U19A 2UZ1A 3WLTA 5IKOA 1U1FA 2B4RO 1JIIA 4KSCA 1DX6A 1E3IA 1G8FA 1UDXA 3U4DA 4PYOA 1NJ6A 2XCRB 1YI0A 3WRWA 3AP2A 5BUQA 4IOKA 1ZD1A 3TINA 5L51A 4JJIA 4L9WA 1QU2A 5JPDA 2JA2A 1UOEA 1MR3F 3VAAA 3B2NA 1CFJA 4W8OA 2RH4A 4Y2GA 2HDNB 3F4LA 3UMBA 3V7WA 1LDMA 1TIBA 2CVQA 1X2BA 2H06A 3BH7A 3ME5A 4NS1A 1TM1E 1QBKC 2VDRB 4RBNA 5EUQB 3RU7A 4CEJA 3LY7A 1ECLA 1BMFD 3K8YA 1BAPA 4QOJA 5CH8A 1S01A 2UYOA 3U7RA 1JG6A 4LF5B 3W06A 2ACWA 2VBFA 1MW8X 5KAPA 1K6EA 1ZY2A 4BLVA 5JCXA 2R0QC 3E61A 2JHAA 4PLHA 5KTYA 2P9BA 4YECA 1JLLB 4O25A 1WKVA 1U2EA 3D8NA 4MRAA 1QCCA 4B7XA 5BW8A 3G5TA 3I8XA 4MVJP 3WYDA 2J09A 4YCNA 1YF3A 1G2QA 2AZTA 3S27A 3STVA 4M87A 1UPAA 2ZXEA 4IEEA 3SVZA 4HEQA 3ZWYA 2ZTVA 1LXCA 1OE0A 2A0UA 2BISA 2D2IA 4MVXA 4V2IA 3TB6A 3NHPA 1RYFA 4RIFA 5D6OA 3VR6H 3G2OA 1RI2A 4J03A 5B58T 5KDLA 5KYXB 2GUWA 3H1PA 2ADOA 3K70C 1I7PA 3HBFA 4HPJB 4NNJA 4DLWA 1A9RA 4IDCA 1TIPA 3CH6A 3MB5A 2DR2A 2BF7A 4RM2A 1OTYA 4CKWA 3D9QX 3ZWVA 3Q5EA 3E2MA 2UV8A 1HZZA 1E4EA 3GFOA 3OHPA 2FPPA 1MEEA 1TZ2A 4M1EA 2BM0A 2JIPA 4L73A 5C8YB 1E98A 1WUYA 1G7CA 1NQUA 3AL3A 3EYAA 3T34A 2ETXA 3AEUB 2VJKA 3KZXA 3MWDB 2AOUB 5DBGA 3HU1A 1TM4E 3EXG1 2AJCA 3K73O 5KREA 2C42A 4UMFA 5E6UB 4MUFA 1C3VA 3F67A 3OU2A 3Q11A 3KCQA 3KTDA 2BEJA 3Q8WA 1CR2A 1TCVA 2O2CA 4R2MA 2V7XA 3RYHB 4FKMA 3F7OA 2JFXA 5KYGA 2HWKA 2YRFA 2C84A 1I4WA 2E4WA 2I5PO 3QEMA 4OJMX 3RASA 5IABA 1LS6A 1H2FA 3UXHA 5B1IA 9LDBA 5JNUA 5L3SB 1GNPA 1W1IA 3D3NA 2O2ZA 4LCJA 3UJ3X 1K66A 2GERA 2Q9UA 1TKRA 4R0VA 3TLGA 2QW8A 1ZUD1 3MLEA 5EWMA 1XDBA 1JQ5A 3C39A 1IBLB 1V45E 3PCXA 1UP6A 2Z83A 2DUNA 3THXB 1IYZA 2QOEA 3DT6A 5L3QB 1G18A 2JKYA 2V5AA 1O9GA 2IBTA 4F7WA 3EFBA 2Q1TA 4IJUA 3VDNB 5AFSA 4C4OA 2W42A 3NIWA 2O48X 4Z4QA 3JPWA 3TI7A 1F8UA 1OQAA 5T4BA 4ZO7A 1ECCA 5FEUA 3IMEA 4JQOA 2QSZA 2ZJOA 2ZBEA 4GO1A 3TQHA 4ZYVA 2HA3A 2VH1A 3COZA 3UG6A 1QHHA 2GYVA 2P6OA 2QF7A 3O83A 1LI5A 2CMDA 2R6ZA 1KSFX 1VP9A 2A30A 1M34A 4U9HS 3L79A 1UAGA 3I37X 4BQOA 1E3EA 2I67A 3O90A 1CZRA 2F9LA 3A9UA 3PRHA 4OD0A 5ALWA 1KJIA 3OOYA 4HSGA 4KB5A 1OT5A 1ML4A 1PZXA 4DKXA 3IE2A 2Z09A 2X22A 3WB0A 1YDFA 1QAOA 5JYDA 1RXVA 2Z2KA 3MGBA 1D09A 3IAFA 3QVOA 3QVMA 3Q9NA 1GTL1 2QZ9A 2J0UA 1SR8A 2C5FA 2YMQA 3LC2O 3QVXA 4JL6A 2W6CX 1Z17A 5HF6A 3TM4A 5HHTA 1WZ2A 2H1FA 4JI6B 5K09A 2ATEA 1MX5A 4D0GA 3ZY4A 1Z4MA 3LCRA 1RE1A 1QIFA 4RTKA 2RKWA 2J32A 5C35A 1GFSA 3WBBA 2I2CA 3B9RA 3JQ7B 2LCQA 3UFBA 3WC4A 3D0QA 4IF6A 1JYEA 3ICEA 3SYNA 1G291 4ZT7A 1GSIA 3MWDA 4IVPA 3SQLA 4HB3A 4FP9A 1C9DB 4Z0TA 1MTZA 2BRUC 2QE7D 4AG6A 1Q0UA 2F4VB 1FFSA 3JAKA 2YJ3A 5DTMA 4UXHA 1IZ9A 4DV3B 5A5VA 1KQPA 1J8FA 3GCWA 4W1RA 1FTWA 3JVUA 1E2UA 4H7DA 5AK4A 1Z4IA 3KD2A 2Y1OA 4GOKA 4LRQA 1PR3A 2VP6A 4AS2A 5DDIP 3W5HA 3LQKA 5A4MS 1ODLA 1UOOA 1V7CA 3MWFA 1NHGA 3G8YA 3AZOA 4H7HA 1AQ6A 2QJTA 4H7FA 4DFDA 3D8HA 1Q0LA 3CEPB 2VDOB 1QYIA 1FYDA 4KODA 4Q93A 1VPLA 1WD5A 4K8OA 3FR7A 3KR9A 1P0CA 1RWPA 4EY4A 2FAXA 1I5RA 4KOAA 3ZCVA 5J4YA 3AF1A 5FEMA 2HH9A 1JHVA 3TFQA 1E99A 1VJ0A 3IAM6 1KZ9A 3KQHA 1ZEJA 1OOEA 2OFXA 3ISTA 3ZBUA 1WXWA 4XJTA 1QP0A 5ADWA 1IHOA 2P0AA 3L9XA 4BNDA 1JF8A 1DRUA 2O57A 5GY7A 4BMDA 3HN6A 5BNZA 4K05A 2JS7A 2I3GA 3JX9A 1DFIA 4MQ4A 4E32A 4KPFC 3CU5A 2O19A 4KWEA 1GEGA 3IPAA 1QK3A 3PITA 1JXQA 2D54A 1WOMA 3UT5A 1FFEA 1TZJA 3EN0A 5K7SA 1XFDA 2I2FA 3BN3A 4U63A 1N2SA 3O94A 1F14A 1FX0A 4R40A 2VHJA 1A3CA 4DLUA 3FE2A 4DWWA 3IIJA 3QTBA 3W3ZB 2VO1A 3FYCA 2M98A 3U2QA 2Q3EA 1C4OA 2FP3A 1KP2A 2IY9A 1GQOA 3NUZA 3FTEA 4FW9A 3GRAA 5DYIA 5CFQA 1EDBA 3H2IA 4MVJH 3OLVA 4PG7A 2E21A 4DSTA 2B1JA 3IEIA 1FFDA 1GPLA 2W71A 3H8WA 10MHA 3C3DA 4MA0A 1EJ0A 3A1TA 4MQEB 1XBTA 3W5BA 5I01A 1IBMB 4CKEA 4MNTA 4MEAA 4YJ3B 5AUOB 4CQLB 4XX1A 1OMOA 2RAPA 5GONF 5KYYB 1JHZA 1KORA 4YWHA 3HWX1 3FYDA 1SK9A 5KKNB 3SLGA 5CGQB 2FEOA 3I39X 2BKEA 1Z34A 1T1JA 2I33A 2QB5A 2FE4A 2H2WA 3SQOA 1ZUWA 5L6MB 2YMLA 3AF4A 4LWQA 4FMDB 3CNQS 3UBMA 2ZSAA 3G89A 1XT6A 4FX5A 2QT0A 3W7BA 1BW9A 2JVIA 4YY3B 3I8OA 1JHUA 3DE1X 3L4SO 2A92A 3VU9B 1QH1A 2HGZA 2H1WA 3K30A 4I3GA 3C41J 2RH8A 2BSAA 3PVZA 1UZLA 2D2XA 1DKQA 2MSEB 2R7LA 4JOQA 4XDHA 3RNLA 3WFJA 1E96A 1EFHA 3H6KA 3WQQA 2PWYA 4PO9A 1Q1GA 5DRYA 2QUHA 3IA2A 2ENUA 2VJMA 1FS5A 4PR0A 1JPJA 1KY3A 3KZMA 1YGYA 4B6SA 3FUCA 4JBLA 4L6AA 5DYYA 5CDSA 1ZMRA 1R8JA 3ENQA 3AR7A 3DBRB 4LTDA 3LUJA 5FBLB 5GOZA 1AMOA 2AFHE 4BJ3A 1JIJA 5AW8A 1QHEA 5FNVA 2OA0A 1CVLA 5SYNA 2BR3A 4Z86A 3NMUF 4YI3A 4HDKA 1BKDR 3IO5A