4H31A

Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoyl phosphate and l-norvaline
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
335
structure length
335
Chain Sequence
NAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ornithine carbamoyltransferase
publication title Structural studies of ornithine carbamoyltransferase from various pathogens
rcsb
source organism Vibrio vulnificus
total genus 133
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4h31A01
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4h31A02
4A8TA 9ATCA 1RAGA 3L04A 3NPMA 4AM8A 6AT1A 1VLVA 2HSEA 3MPUA 4FYVA 1ML4A 4KGXA 3D6NB 3KZCA 3R7DA 3E2PA 2RGWA 1R0BA 4F2GA 4FYXA 2OTCA 1AKMA 3KZNA 3TPFA 1DUVG 2AT1A 2G7MC 1D09A 3GRFA 1RACA 2FG6C 1AT1A 5G1NA 2AIRA 1PVVA 4BJHB 1ORTA 1RAIA 4EP1A 5G1OA 1ACMA 3KZOA 3SDSA 4KGVA 3UPDA 4KH1A 5AT1A 3M4NA 1PG5A 2QGFA 4NF2A 3L05A 1OTHA 1TUGA 4KGZA 1RAEA 2P2GA 2FZGA 2W37A 2H3EA 4H31A 4IV5A 4JQOA 1RADA 1FVOA 3D7SA 1RABA 1RAFA 4WTOA 2YFKA 1EKXA 2I6UA 3R7FA 8ATCA 5G1PA 1I5OA 4KH0A 2EF0A 7AT1A 3AT1A 3KZMA 2ATCA 1XJWA 3Q98A 3GD5A 3L06A 4A8HA 3KZKA 2FZCA 3CSUA 4FYYA 3M5DA 1R0CA 1DXHA 8AT1A 1TU0A 1A1SA 1RAHA 1RAAA 2QG9A 4JHXA 4KWTA 1JS1X 3L02A 1TTHA 1EZZA 4AMUA 1C9YA 4AT1A 3LXMA 3M5CA 4ANFA 2A0FA 4EKNB 1SKUA 2BE7A 4JFRA 2BE9A 4FYWA 1Q95A 1FB5A 3TXXA 4F04A 1EP9A 5ILQA 1ZA2A 1F1BA 4OH7A 1ZA1A 1NBEA 4A8PA 2FZKA 4E2FA 2FG7C 3R7LA 3M4JA 2IPOA
chains in the Genus database with same CATH superfamily
3AEZA 1VE3A 4BX8A 2VOEA 3L04A 3FAKA 4HDKB 5TPWA 1GQFA 4D3ZA 3B1XA 4B4VA 1A77A 4Y9TA 4QRDA 4NNPA 1L5MA 1HXHA 1I3KA 1NOIA 2VWQA 4QECA 4KGXA 2I2AA 1C8LA 2OORA 4DR1B 1JEQA 2COUA 5EWLA 4KZPA 1AQNA 2ZULA 1F8YA 4MIOA 2PUJA 2ZQ5A 4J9VA 4RY8A 5K3FB 3VOSA 3K4PA 4HTFA 4RPIA 4UM9B 1NI5A 1PWZA 4LJ7A 5KC9A 3TL2A 4MP8A 4RVHA 2E3JA 4YQEA 3I39X 2DJIA 3Q3GE 1G3RA 1Y80A 3UAVA 1E3MA 4YV2A 1NZJA 1CB7A 1GRNA 3MOIA 5K0LA 4HQFA 2I2XB 2PG3A 2NSYA 1SUWA 4V0RA 3DLCA 3CN7A 3H11B 4R6XA 1NTOA 1F06A 1NXTA 5A4AA 4DJ5X 3H11A 3KDSE 4IMRA 4ZQCB 1BEEA 1XEXA 3I32A 1LC3A 1H05A 1UBTS 2C3UA 3RM3A 4D8YA 2P11A 3JD3A 3CLUD 4CFZA 1QFSA 4FFNA 4BNIA 2GWHA 4C0XA 2IYFA 4IIEA 4CIDA 1OI3A 1X74A 1Y4ZA 4BN4A 1L5KA 3LQ2A 4BMCA 3EUFA 4NCAA 1AV6A 3D0QA 1XTPA 3OWOA 1M0SA 2FFAA 5JCOC 2MR6A 1NDUA 1IBMB 3N70A 5G40A 3MRXA 2LUOA 3JSAA 4B3FX 2ACWA 2REQB 1IUPA 3PR3A 5FNVA 2WW8A 2A5LA 1KTVA 1WUHS 5FO0A 2TRSB 3ORSA 4D0GA 3QKIA 3QBEA 1ZMRA 3EVNA 4I6EA 4F86A 1G4UR 5FFFA 5SYNA 1E2UA 2Q1WA 4G3XA 5DN6D 4LGCA 5B3AA 2QTFA 1ECPA 4TMXA 4D8TA 4QSMA 3LVQE 4GMHA 2FPLA 5E1MA 4FHEA 3H1FA 2RAFA 3HN2A 3AR9A 3O8LA 4AROA 1QP8A 2CF6A 3Q8XB 3QLTA 1L7RA 4TQ9A 4CDGA 4JLWA 4U02A 3SDBA 3L7JA 1CRPA 2HQRA 1SQFA 3PBKA 2WAOA 3RO7A 1U2DC 1Z4NA 3MW8A 4BBZA 4BN0A 4UHFA 1MAAA 1C0LA 5BNTA 5F73A 4N8DA 3NVDA 1OPRA 1RVV1 2H4FA 4I2VA 3D3NA 2ZBVA 3HR7A 1IQPA 4L8YA 1DKPA 2VHTA 1B00A 4XVCA 4PQRA 1KI4A 4I2NA 5KSZA 4RAOA 4DIDA 1HX7A 1I3MA 3G88A 4UVEA 5SY4A 4BFLA 5KC8A 4GX1A 4HVLA 4E1AA 1JPVA 2C57A 1U94A 4M8IA 2BSQA 4UTZA 1YR9A 3C3KA 3EYAA 2AW5A 3MT9A 1F48A 1M1ZA 2IT1A 3BH0A 1EP9A 4KK3A 5ILQA 4RC9A 4NVRA 4JLVA 5K09A 1K98A 4OMDA 1HZZA 2G3YA 2H85A 4NH0A 4ARAA 4F93B 1A95A 2IDZA 2PM8A 2FA9A 2LD4A 4AMVA 2JLAA 3DFUA 1A88A 3MWDB 5BQ3A 2AX4A 3R7LA 4HXEB 2Z1NA 2OFPA 4F4FA 1G55A 4QJ4A 1U2TA 1ESNA 3QFCA 5H1YA 4DV6B 3WIUA 1ADFA 1RBZA 1E3JA 1XSEA 3U13A 4AS2A 4RFSA 1LSUA 1NIJA 3ON5A 2HWYA 1PGQA 2PGXA 1M0TA 3P9QA 1T5IA 1KI8A 3X3HA 3HFJA 2YWRA 1GN8A 3AHIA 5FCDA 1U7TA 1RFLA 4JBHA 2CL5A 4Q7MB 3Q8WA 4CGZA 1I13A 2HO5A 1YQUA 4CQLB 1FDRA 2WF7A 1XL0A 4QJBA 2FEPA 1B15A 2GO1A 4HH4A 1E1QA 2PV0A 4Q82A 4CQLA 2JGFA 5DTIA 4UM8B 1NVKA 5AO9A 3HLYA 4ERNA 1C1HA 1XZHA 2WAYA 5A1JA 5CIWA 5IUKC 3GPIA 1DCFA 3NHZA 4BE4A 1KFCB 1QOPB 1ZZGA 2JKVA 1GPAA 1JZTA 2D2FA 2ETVA 3ZK9A 3O31A 4YRZA 2X7XA 3QENA 4FOLA 1JG1A 1HTWA 4LC1A 2A86A 3DXFA 1TVKB 4JXJA 3L8MA 3GT4A 1KRXA 3ORFA 5HKBA 1XZEA 2IUFA 3A4NA 4DRXB 1KBOA 3R8XA 4KN8A 3K0HA 2Y1FA 2QTMA 1CJCA 4KQ2A 5K3DA 1O6BA 3K73O 4LX8A 5AR1A 5K8LA 1YONA 5EP3A 1JR6A 3CJQA 4N01A 4Q9AA 4KRFA 4M36A 1NX9A 2QR3A 4J0FA 1FS5A 3D7SA 4INPA 1FFWA 1MC1A 2V7EA 4XR9A 2D2VA 1ZC4A 3EJ6A 3G5MA 2QU7A 3WMRA 1SA0B 2RGBA 3W7BA 4XI9A 2H1VA 4Y9UA 1FP4B 1CJTC 1FNDA 1T2VA 2WSSD 1WP4A 1L6RA 2QUZA 1Z6PA 2EWWA 3NIWA 2XUOA 3O21A 8ATCA 4V1CB 4ZO7A 3RAPR 5FWYB 2CXNA 3LDUA 3LX6A 3NO4A 1E1CB 1T8YA 2IYUA 4MKRA 1IDOA 3RRXA 3G6WA 4V1CA 3NORA 2ATVA 3ZV7A 2QLLA 1B14A 1ABFA 1E32A 1E1CA 3DQZA 4W1RA 4HN4B 1XDDA 5LUBA 3VYSB 4BNDA 5BN3A 3ZJUA 1HH4A 4QUIA 5EZ6B 5CLFA 4I55A 3QGMA 1ENOA 1Z0UA 2ZAGA 4MV1A 4U2BA 3KLBA 5E3IA 2VZLA 1XKTA 2L69A 5I9TA 4KIGA 1J2YA 2X22A 5D5PA 2YIDA 3HU3A 5AJVB 2JLWA 1Z0SA 2PWYA 3EXG2 3ESBA 4B43A 1M54A 1E5XA 5GVSA 1XCBA 3G5TA 1X1BA 4P98A 3AG6A 1XDWA 3LY7A 3HR4A 2DBYA 3OTHA 2GBLC 2G70A 2IZOA 4OL9A 4RANA 1SVSA 5CLGA 3QYJA 1TK9A 4WLNA 1DRUA 1E6CA 2FXVA 3ZCQA 4UTRA 3KKOA 4HNGA 3TW0A 1B7GO 1XC7A 2DUNA 2VPTA 4FJ1A 3PWKA 4QVGA 3AOGA 1CPYA 5HILA 4LRQA 1YA6A 3U39A 3RC7A 1XZNA 3TDMA 4OHUA 1KK3A 2FMXA 4F5WA 2A9FA 1IHPA 1KJZA 1NYLA 2JIQA 4O4JA 5K0TA 1D2AA 1Z6AA 2EQ5A 2MSLA 2R6JA 2PCLA 3NIGB 4FN5A 4RNDB 4Z8YA 2CXPA 2DBZA 2V7QA 7MDHA 1IQ0A 2N75A 1NNI1 2ZRCA 2OFXA 1WXWA 2NQTA 2PGLA 2WFMA 3DHYA 3PRHA 3NB0A 3ADPA 3ZY5A 4I50B 5IDXA 5DSXA 1P6XA 3E3AA 2NQ8A 4PG8A 1YJXA 2XOKA 4RA6A 4YJ3B 2ZZKA 2PZKA 2OCYC 3PEVA 1A76A 1RPJA 4J75A 2PJUA 4BRSA 5C1OA 4WJKB 1UC5B 1QVVA 4MV5A 1VLJA 3JQ8A 4NBLA 3VR5A 4CF5A 3K8ZA 3K70B 3I05A 2O8FB 1X2EA 3PCRB 3QVGA 1TOAA 3KT0A 2QG6A 3PE6A 1R0YA 1WIWA 4JKIA 1J8QA 2FAXA 1YOBA 2N0SA 1WMDA 3HGQA 2O8FA 3K2BA 3VKWA 1TAHA 3CF6R 4CV1A 4LGYA 2O2DA 3UO8B 5CFZA 4NECA 1TQ8A 5JJBA 2GEBA 3SICE 1HM5A 4KOAA 2E4ZA 4JJAA 4GOXA 1UBHS 3L7DA 1U7PA 2BSAA 2Z4SA 4XLZA 5C5CA 1M9NA 1ZESA 4UMFA 2AFIE 1IHYA 1T3TA 4Y2JA 4L7QA 3K31A 2L0XA 2C4KA 2V7TA 2WPDA 4IEIA 1VL0A 2ZJ7A 1HORA 3FLEA 3VR4D 5ARBA 3UAYA 1D03A 3CZ9A 4G67A 3OQVA 3FNGA 5E7JA 4RLHA 3DYBA 4MLCA 4IXTA 1JHOA 2I6QA 4Z53A 4LF7B 2ROQA 2OD9A 4K9OA 2UZ4A 4EHFA 2NUTA 4AG3A 3L4JA 1SD2A 2PJRA 1N1GA 2OXRA 3NP7A 4X90A 1YRWA 2F2TA 2HU2A 1JSRA 2H31A 1E2DA 1J5PA 3G9ZA 4P2GA 5FI5A 5IP5A 1JEJA 4NF2A 1TXGA 1NUUA 1FTQA 3CWCA 3L0ZA 1L7VC 4GPIB 4Y2RA 3T3OA 1JB1A 1OBVA 2QSUA 1EP3B 1I80A 2ZIWB 1Z2EA 2AZMA 2EDCA 4J8PA 4MUKA 3TSCA 2P2LA 3ZDQA 4B74A 2EJVA 5KJCA 3NBQA 5KTKA 1PNVA 3NKFA 3BZWA 1Y5RA 2QIOA 1RWQA 4E5UA 2B5WA 2BR5A 1D4ZA 4LG1A 3L8DA 4XTRA 2IZZA 3F96A 1EXDA 2RBEA 1I6LA 2W2KA 1GHTA 1VA4A 2XOEA 3NBYC 4KMMA 4WZ6A 1G17A 1S01A 2PU7A 3T9DA 4ZZ3A 3FCOA 2XNDD 5ALDA 3WJ1A 2FU5C 2Z3VA 1GPMA 4ITVA 1W5BA 4G5OA 4IZHA 3COZA 4OHOA 4YO8A 1UXHA 2ZJ2A 4JA0A 4J2HA 4IHAA 1SC3A 4M9XA 2XUJA 4FVTA 2BI4A 5DFAA 4OJMX 4BV2A 3A4IA 3HY3A 4C08A 2AFIA 1CDZA 2WEKA 3UAWA 1JIVA 1AKQA 3R6LA 3UJ6A 1YZYA 1Z73A 5GWXA 1WPXA 1CZRA 2H9YA 3FW1A 3P20A 1WW2A 5EE1A 4REQB 4LE0A 5DM4A 3BXZA 1XMVA 2G28A 2VHEA 1EPUA 2RB4A 4K86A 2DUMA 5EIWA 1H5NA 1SELA 3G2QA 3GF4A 4WXHA 5KOJA 2H07A 2NPFA 1KY2A 3TXYA 1Q84A 2HA6A 4HC4A 3ZDEA 1Y5NA 5EJGA 2W2LA 5IEBA 4B6PA 3KZ1E 4KFUA 2Q99A 5DEIA 2M6LA 3UXMA 3ZHTA 1E66A 4J2OA 4K6OA 1MKYA 2G9VA 4FYWA 4QUKA 5E8RA 1Z8HA 1UINA 1T1IA 3FSRA 1JFRA 3JVEA 3SLKA 1AS2A 3I45A 1PW7A 2CLOB 3WJ7A 3I1JA 1GNSA 2QTGA 3K20A 4GI3A 3EHDA 4LZZA 4RQBA 3W1WA 5ECYA 4BZZA 4ER7A 1PG2A 3B3QA 4UUBA 4ARZB 4QXAA 3ZWKA 4EB6B 2AOTB 2PX4A 2A4KA 2IS1A 1OVMA 3DV9A 1J2JA 1K66A 2JBAA 2IFTA 2OCKA 1DP4A 1XZAA 3B9QA 4XQCA 2OECA 5HKLA 2J9XB 4PG4A 1A71A 3HCPA 5EE0A 1DRWA 1U0BB 4XYGA 4L8LA 2IDMA 4FQ5A 4TL8A 4RIEA 5DNVA 3FMPB 4LZJA 1KFEB 5C81A 1DAMA 3W77A 1TZCA 1W1WA 3CLKA 3V6LA 4F9TA 3EZYA 5CFRA 4O3MA 2BHLA 2V1XA 3KWFA 1A2BA 1N6OA 4BCBA 1DADA 2Z8ZA 4LRTB 4BQIA 4J16C 2AOUA 3K4HA 2XTJA 4HLDA 4F1JA 3DKRA 3GLUA 5EJ5A 4GS5A 3ROTA 8ABPA 4AP5A 2DHRA 2V6BA 3PHIA 4KL8S 4E5PA 4HAZA 3WLLA 1S9HA 3OLZA 3ILHA 3QE2A 4G0XA 3OX1A 2VHJA 1GADO 5LQAA 3IPAA 5IBPA 4Q03A 4US0R 1F2DA 3ABSB 5IAJA 4Z1MD 5AQ1A 1NG9A 2UZ0A 3EBOA 1JU4A 3GEHA 2BR3A 3KOUA 1Q1NA 2HRRA 2QTAA 3QI7A 5REQB 3RBAA 1CE8B 1TRHA 2JPDA 4EY3A 4QLBA 2B94A 5M7EA 3I5YA 5REQA 4XIJA 1CE8A 1KBQA 2VRNA 4FGWA 5ETJA 1UM8A 2OKCA 1JHVA 1P33A 4MCIA 2OGUA 4DB2A 2GD2A 5G1OA 4QPZA 1SURA 3CW2A 3U1TA 5AM4A 3A4MA 3SDSA 1O94A 3L77A 3EGXB 1U2EA 3X2FA 1LX7A 2VA9A 3CNNA 3HDTA 3EIFA 2PRIA 1B6TA 3EGXA 4ZVKA 5LMNB 2E5FA 4AZ0B 2GLTA 5IJAA 2VTBB 1PQ4A 1D1PA 1ZJJA 3HSKA 1SD1A 2XCTB 5DDIP 5BVGB 2D06A 3SIPA 5KOIA 4HK4A 3UN1A 4MJXA 1KEEB 4QHSA 5BVGA 3VKUA 4FHDA 1FMCA 2OP1A 3JYHA 4HSGA 3T3DA 1G5FA 1SD5A 1ESDA 4L16A 4R5HA 5C8YF 3IPCA 2G0TA 1TM2A 4K81B 3ZOZA 1ULBA 3JW8A 2ACEA 2FP4B 4W6QA 2MSEB 4W7SA 2JA2A 4CG3A 3H2IA 5EMJA 5J58A 1U3WA 1QONA 2FP4A 3MCTA 4J7UA 3AHGA 5C4MA 1LLCA 2I1LA 1EA7A 2EZ4A 2Q4EA 3DNFA 4OKNA 1VL1A 2KSQA 3ECCA 3IQIX 5C4IA 1HNXB 1A8UA 2I66A 2I7VA 4RO0A 2B69A 2GUGA 2BMFA 3IAS6 3SQDA 4TYNA 3Q6NA 3ZGZA 3MOGA 2P67A 2ZDGA 4I1VA 3T35A 2EARA 2FFJA 4PLZA 2OZKA 1W0CA 3CMCO 3AU8A 3V8VA 1ZNWA 1SOUA 1BN6A 2QXUA 2Z2YA 4UUMA 4L3OA 4DB4A 3CF4A 2Q6IA 3GFGA 3EEOA 2BM8A 3EXFB 4Q39A 3QX9A 2XIJA 2R7NA 3GELA 2C83A 3F7NA 4MQFB 4YYEA 1OZFA 1XU9A 3JTEA 3EXFA 1OC4A 3BCUA 4Y9RA 2VKTA 5FTLA 1KR2A 2O20A 4G5FA 4R8KA 2CXHA 1DQPA 3CS3A 4JEMA 3CNHA 1VOTA 4U2GA 1YHNA 4XUCA 5ALLA 2RG1A 4DC9A 3IHKA 3PLNA 2CWDA 3FPBA 1KNQA 1YZHA 4A5OA 1FYVA 8OHMA 3BIWA 3VJRA 1L8XA 1NBEA 4NPAA 5TY0A 3FRJA 3U26A 3WMXA 3ABZA 1HDXA 5C2JB 3INTA 4P4UA 5K0JA 5LP6F 3AV3A 3NATA 4Q3NA 4H4EA 2VJYA 1EXNA 3O4HA 5KYXB 2WOOA 3I2YX 3PNBA 4B84A 5JJLA 4NZNA 3AJ9A 3HN6A 3KLOA 5EWJB 1WCXA 1WZNA 3DXZA 4EA7A 5IH7A 2P68A 3PGLA 2WDPA 1BE8A 1Q57A 1N92A 2WYVA 4X8LA 1RM0A 2L2QA 1V8ZA 1MXFA 1OA1A 1B0PA 2QENA 3NRCA 4FOSA 4Q1DA 2N3ZA 4RMJA 1NVFA 1OT5A 1V48A 4EM6A 3O8CA 7REQA 1ATZA 1AX9A 3AVUA 4I9NA 1U2SA 4G4JA 5FF9A 1NYRA 1UPXA 3CE9A 1BS2A 4WJZA 3ZY3A 4YUZA 3RTEA 1AV7A 2X7HA 1WM1A 1SIUA 2Y1XA 4X41A 5DO9A 3GR6A 3PHJA 3V7YA 4ABYA 1GQYA 1BKYA 5EUBA 1N7JA 3KQHA 3DBRB 4UD6A 3V9AA 5BQXA 2ZJBA 3JQFC 1ZY2A 3OM9A 3I3SR 1R4MA 5A2GA 3DBRA 5J47A 1GAJA 5ILGA 1YL6A 2FJPA 2ZSIA 1KSGA 1CEQA 3PXAA 1OKKA 3EN0A 3QH4A 1ZCFA 4U7GA 4M0UA 2NXCA 4FHCA 5D3MA 3IAHA 3ZE8A 5ALFA 1O1YA 1T29A 1VKRA 2W0MA 3KQVA 3Q88A 5FAKA 4R1UA 2XA2A 1FW8A 1I94B 3GK3A 4W5HA 2Q5EA 1WCWA 2YDYA 1MOSA 3T7JA 4JVOA 5IM4F 1N3IA 2JFNA 3DOIA 4BWYA 1R74A 1D3AA 4PGMA 3TD2A 1VG8A 4N0PA 5HIJA 2FWRA 2IYNA 4H4CA 4U8HA 2HJRA 1TMGE 3HP7A 4JROA 3C3DA 2P6NA 3KQNA 1WBDA 3P45A 1ZVKA 2IP2A 5GADl 2ID9A 4R9UC 4LYJA 1JRLA 1X7XB 2CUTA 3IRVA 2QXYA 3JD2A 2D54A 3BH7A 3BREA 1OGYA 3EZ2A 3M89A 4J4BA 4PTYA 3VSDA 1QU3A 1Y1QA 3KKKA 1DEAA 1H9BA 1X7XA 4UPVA 1XZQA 4QUAA 2D5CA 5CTJA 2FQWA 3ABQB 4R2XA 4KC0A 4S1NA 4AY4A 4PONA 3I6BA 1F5NA 2HLDD 1NQOA 3CH7A 3QVXA 1EK2A 1LPAB 4V24A 1FFBA 5LLTA 4QOFA 4D44A 2O7NA 1PFWA 5ALIA 1HZJA 2VUHB 4BVHA 2ZU0C 3F6CA 4M37A 3ZHYA 3U1BA 3IT1A 1XBTA 5JALA 3WHIA 1PFUA 2VFAA 2WJYA 4ZZ1A 3W7VA 4CFYA 5KTPA 1UBUS 4QGAA 1Z07A 4QU0A 4U7WA 3TL3A 1KKMA 1CS4C 1F8GA 1TPZA 4A36A 3L0CA 4TSFD 4UAJA 2WJGA 4RGVA 3S2GA 4WINA 2JCYA 3P9YA 3PXXA 2C4NA 2HREA 4OP2A 4MWTA 4MUYA 5DJ5A 1ZJWA 1SC1A 3KAKA 1T2FA 4Y2GA 3C98A 5FUMA 1P1FA 4JUDX 1HFKA 2GGSA 1N8NA 4QNMA 4IJ6A 3LU1A 1MIOA 2CYCA 2F64A 2V03A 1Y63A 2DPLA 2HNBA 3BM5A 3MJCA 2I55A 5BVHB 3BFPA 3TSZA 2QAIA 3CX4A 4WV3A 1RQPA 3JV7A 4YAKA 4RQAA 4Q9HA 5BVHA 1NW3A 1EDZA 2JFBA 2V3VA 2ZJZA 3G49A 4IM7A 3D6VA 5HE9A 3ICPA 3TE7A 2LZ0A 1T8UA 4NICA 4URWR 2ZS9A 4YLEA 5DK6A 1JEOA 4G0PA 4JX8A 4E5YA 1KQOA 3UJNA 1GM5A 1YS6A 5LUAA 3BXFA 1VLHA 1SEPA 4HFNA 2WTNA 1IVYA 1O9GA 1XTBA 1Z6TA 2PPLA 5IT9A 1DHRA 3C5HA 1E0SA 3DMHA 1JIIA 3CKKA 5MF6A 1QIHA 3KJQA 4MV6A 3UAXA 3VH2A 2X9VA 3RWBA 2NXNA 2UZ1B 4PSUA 2EKPA 3KLNA 5T57A 3K6KA 2DHCA 2AYYA 3CC8A 4J07A 5EXTA 1WDLA 4Z99A 2J9GA 2LRHA 2QQGA 1OYVA 4YHBA 3EGDB 1D5WA 4QXOA 3W90A 4BLPA 5AD1A 3MINA 3A0UA 2A1IA 1SR8A 4MUXA 3WRXC 4AXXA 4BQFA 4BO9A 2JIDA 2W8ZA 1XMQB 3QQ5A 4LXXA 5D6NA 1KI6B 3SF0A 2BPOA 1MAUA 1K92A 3LDAA 4Q4AB 5L3VA 1F0KA 2JLCA 3VDQA 1VG1A 5CJJA 4QA9A 1EFHA 3ESQA 3UV6A 1EU1A 3K0EA 4OHKA 3IAM1 3FE2A 1BVYF 3EXAA 4OQZA 4BZXA 3NUZA 3EMBA 1AB5A 1KOFA 1KMHA 4JL8A 1W5TA 2MYTA 2OV2A 4ZVUA 1R0KA 3N58A 3NJ8A 4Q02A 3HJFA 2R79A 2V7XA 3L1JA 1Q50A 3ODPA 1M5RA 1E1RD 1SHLA 4F8YA 2Z2KA 2P2GA 5BYBA 2NMVA 5ITWA 4HDSB 1RCTE 5ARDA 4MIEA 2AG5A 4M1KA 1OY1A 4Q1AA 5A4DA 1D7AA 3G0DA 2G9QA 3KKZA 3I01M 4KBGA 4R3WA 4YJHB 4HDSA 3UOGA 2IUTA 4NMHA 3DE2X 2F90A 2ISCA 2RGNA 3QOWA 1QG0A 3T1VA 4D4IA 2Q62A 1FDWA 2C84A 3LC7O 2IF0A 5CXQA 1O6FA 3R3WA 5E6RB 3HXTA 4QOJA 3NBUA 3EA5A 5AK6A 2HPZA 3NHPA 3WYDA 3WAGA 3LYUA 4BQEA 3BEOA 1XXLA 2O9JA 4OBXA 1KEPA 3NDJA 1GILA 4AKEA 4EUNA 4ED9A 1E79A 1Z9BA 2YWEA 2YYYA 2OWEA 3D8SA 5E8JA 3DDCA 4DYHA 2CHQA 1AF7A 4PF1A 2HC9A 3THOA 4W5OA 2KWIA 1A9XB 1LTHR 4E5NA 2ZJ3A 4AMZA 2OL4A 4V2IA 5HDBB 2PKEA 2IPNA 3BTSA 3IBYA 2O1XA 2FR0A 3MA0A 3UUWA 3A2NA 3DLPX 4LK3A 1Q14A 1A4IA 2O2EA 4RV9A 3LP8A 1BAPA 3KQOA 3QWIA 3U4MA 1WX1A 1DBSA 3V2HA 1JDBC 3FMIA 3PCXA 3CZ5A 4GXQA 4RM3A 5HKKA 2DCMA 3PQ6A 3DTTA 1P19A 2Z2XA 4DCPA 3SYMA 5D01A 4I46A 4AF6A 3MXTA 2QMZA 3ND7A 4MH0R 3KO8A 3I61A 5LA6A 3CEAA 2J3EA 2CLMB 2Y6UA 3ZLBA 1TA9A 3E70C 2ZJ1A 4OHWA 1GO2A 2P9TA 3OM1A 2RARA 3D1JA 4WNAB 4PNEA 4DY6A 1JKXA 1SK9A 2FLVA 1TO6A 5KQSA 4J43A 4BIMA 3G5AA 3IRUA 3JQDA 3ANNA 4YRPA 5B1YA 5AVSA 3C7AA 3DNPA 5I51A 2XI4A 4IIDA 4E4RA 2V7PA 5C80A 1P2VA 3D8TA 1ZGBA 5EP2A 2FETA 3K8OE 4UDOA 4JLJA 5H83A 4BYMA 4LPKA 1QHXA 4B09A 1Q15A 6AT1A 2GCPA 1VCHA 3EBPA 4KCGA 4WVFA 3BSWA 1TUBB 2C5SA 4K9QA 1DLIA 5J5VA 3RUAA 1X80B 3K0AA 3EARA 3CRQA 4B8ZA 1BROA 1ZGAA 2NO7A 4TVBA 4LZNA 4QL3A 3DB2A 2OGTA 5ICGA 1SHKA 3E1SA 5CMLA 3ISJA 5JNUA 1A1VA 1SUSA 1SU7A 3L79A 2FR8A 5K3EA 1JBEA 2AF3C 4LZAA 2WNIA 4AL4A 3PFFA 1N2JA 2P5TB 3IMCA 1QGED 3PFNA 4ZQGA 1C1YA 5ENDA 1NVVQ 3R3HA 3MEQA 2BKAA 3FGPA 3NRJA 4PZ0A 2OC9A 1R0LA 4J7AA 1UP4A 3HM9A 2ZITA 4P33A 2J6IA 1NTRA 3IXMA 3QBDA 4M54A 2AOXA 1KA9H 5G53C 3L8ZA 1KDOA 4X1IB 2N46A 3BWMA 3H5VA 3ZS8A 4E2ZA 5A7FA 1T8TA 1L6IA 1O95C 3B8HA 1RYHA 3F46A 4NEQA 1XQ6A 1ONNA 2D5AA 2PZ8A 1XJ0A 1SH7A 4HGZA 4PO9A 1AZWA 1MF7A 4UUAA 5HMLA 1Y3CE 1A82A 1FDSA 1UKZA 3PWZA 4LECA 5FTWA 1GXSA 2XYRA 3SR3A 3OFSA 2RBGA 2ZAMA 3O2NA 1ODKA 1QU2A 5AQEA 1ZH8A 4LE2A 3T3MB 3ZXIA 4KTVE 2G6TA 4LRYA 1E6UA 3LFUA 4ID3A 2XQIA 3VR2D 3ZGXA 1U2PA 4O29A 1U1DA 3R7SA 2B1IA 2C5FA 5JJIA 1IZYA 3VSAA 1YI8A 2VTVA 4MV3A 4QODA 5I45A 3QRWA 1W96A 2GZAA 3T4EA 3T3EA 2I91A 1THGA 2XE8A 1KSHA 3B3AA 1JMVA 4C43A 4HEHA 1SU6A 4DLBA 1RQ2A 3V3TA 1EVIA 2H16A 2QKYA 4UPDA 3TRIA 4E09A 1N7HA 3HCAA 3R4CA 4OQFA 1ABEA 3LPLA 3TECE 1GG5A 1PSDA 1ZIYA 1PZMA 1C4KA 2PUVA 4GUDA 1RS0A 2NZJA 1KJYA 1Q7BA 3PUXA 1RPZA 3TNFA 1NAIA 2IKSA 1H4SA 3E9RA 2VP6A 1PT6A 1UJCA 2AMVA 2FFHA 4LGVA 1Z13A 1SU8A 3UUEA 1E6EA 2AUTA 4EKDA 2YXDA 4Q9KA 4O5OA 4JCOA 2ZREA 4YJ2B 1UXJA 1OROA 3RLFA 2HWXA 3T94A 1ULAA 1GLVA 4LJSA 4PC2A 4F4HA 2I54A 1EH5A 3RROA 1IRXA 2HJGA 3ESCA 4KXQA 4YJ2A 1MHTA 3SC6A 1CJBA 4LOJA 2PLNA 4K7JA 4OMFG 1RR6A 3SEZA 2V9CA 4TMYA 4WY5A 1DJQA 1P0QA 1NMEA 2DBQA 2VRBA 1VLQA 1JHXA 1ONBA 4UXIA 3P1JA 2P4EA 4TTIA 2AE1A 3V7WA 3OZFA 3O1LA 4FOPA 3IIEA 4DARA 3GAMA 2WD7A 3AHHA 2NWQA 2O8EB 2NX2A 2ZT7A 1EIWA 4GECA 2WAMA 4JUCA 2FCAA 2XT0A 5JH7A 1IHXA 5EYPA 3TZBA 9MHTA 4KLCA 3IUPA 3BQNB 3Q3JB 3RFVA 1GNQA 4IQ4A 2F17A 3IEPA 5EEGA 1E5LA 4XQEA 3B85A 2HBZA 3M6XA 4CR8A 4B71A 4F2GA 2EBHX 3RS3A 3VO8A 3QYAA 3WRWA 1GSIA 1QS0B 3EVEA 3Q9NA 4FDVA 4GOND 4XWTA 5LZ2A 1TK3A 4DJAA 3U3DA 1P7CA 2CLEB 2F4NA 1KFJB 1DUVG 1A2QA 4CWAA 2AA3A 4KYUA 4PSAA 2EFJA 3LG2A 4EI2A 4DLRA 2ZCJA 3WK9A 4YX9A 4AUEA 2KYRA 1B41A 1MMFB 1JAYA 1L4HA 4W9RA 5AI9A 3JRWA 4TTJA 1OFVA 2J7PA 4RZHA 1JVSA 3EZNA 4BC0A 3VMFA 4ZREA 1R64A 1VB5A 2XDYA 3NHAA 2C7OA 3I23A 1J9EA 3QUSA 4KE6A 1DQNA 5JRZA 2HPAA 2F3QA 3N2LA 2AC4A 2ZYWX 3QF4B 2VQSA 4HAWA 4CU5A 2XMZA 3B8EA 8MHTA 2JI9A 3FHCB 1WV0A 1ZK0A 4R40A 1I2MA 1HE8B 1WZIA 2CB9A 2C59A 2JD2A 2EP7A 4RTQA 3K6SA 2ORIA 2BIFA 2AZ4A 5E9WA 1LTKA 1P29A 2C5GA 3HRIA 1GEEA 2LKDA 3ZCUA 2ZBPA 4LYHA 3RRNA 1E3WB 2AL7A 3TUIC 1QB7A 1QH1B 2LDXA 3B13B 1OWMA 4HUTA 5K51A 1TGYA 2ZTSA 1GSHA 3TB6A 2VBGA 2QV0A 1QH1A 5F78A 1OHHA 2W2NA 3QFSA 2C98A 1E1YA 4XYMA 2QY6A 3HJNA 3TG8A 2P8SA 1H1TA 1ZQ9A 4HNUA 1RFGE 4AO7A 4QE3A 2EGHA 2GHIA 2P3QA 3F3MA 2V5AA 2VF7A 2RGYA 1HE2A 3RHFA 4JN6B 5JYDA 2OCXA 4Q1FA 1ISRA 1ZVJA 3KE8A 1U7XA 1ZS9A 1A9TA 3V1LA 1JDTA 4ZFNA 3L7BA 4JLUA 2OFWA 3WLRA 2IK8A 2FLWA 3ZE9A 3KTDA 3N2YA 2J7KA 3GT0A 1RKBA 4Y0VA 2ZM5A 2Q9AA 4OB8A 4P7BA 3PTZA 2Q41A 4LMAA 1TJYA 3AV0B 2DQKA 3SS7X 4GT1A 1HYEA 4QGFA 1XRPA 2Z95A 4HATA 2Q5OA 3PG5A 2H4JA 4I8IA 4X7PA 3ID6C 4NOKA 3BS4A 3R9WA 4PGGA 1Z28A 1IOVA 3TSAA 4C2AA 1RXIA 1LJUA 4TV8A 1T5LA 3M3HA 1HEYA 2PSFA 1WJGA 3UM9A 2NTVA 5CB0A 4G5SA 5JYBA 4UARA 1ZRNA 2YVQA 3FYSA 2RKOA 3T5MA 5M29A 2HU5A 1H4QA 4I19A 5BW8A 3KIPA 1U1FA 1SBNE 2ZCUA 4XX0A 1SKAA 1UEXC 2SCUB 3P4XA 1Z0DA 1W47A 3JWHA 1P3DA 2RIPA 2O5EA 2IOHA 2W2TA 1H65A 1H2WA 3NUQA 2JHPA 3OJCA 4B7XA 1N2CB 4OSOA 4X7MA 5KQMA 2IL1A 4W63A 1WG8A 2QTNA 5CVUA 3AW9A 3DMGA 4UQPA 3V6MA 2X0NA 2IKQA 4K5QA 2O8CB 2JHCA 5CX1A 3DBOB 5E2AA 2O14A 3R5SA 5HS6A 3RYHB 3PGVA 2PWAA 4DLVA 2O8CA 4Y9SA 1F9AA 4ZT3A 1B6SA 1KGDA 2VEDA 1KYYA 1P5HA 2FWPA 2XYPA 1FXWF 4GI5A 1S8AA 2O0KA 3S1LA 3GWGA 3OHPA 2SKEA 4N40A 2Y1DA 1KQPA 4GMFA 2C5HA 2C2BA 5IKOA 5A05A 3L9XA 3WZ2A 3B1YA 1U8ZA 5IEJA 5JD5A 3N7UA 1P8AA 2FVYA 9GPBA 1E3SA 5ESDA 1E5TA 4BC1A 1Z7YA 2NZ8A 3JYOA 4OFXA 5K2OA 1BGWA 1VJ0A 2FQYA 5CCEA 2PLRA 2FMFA 4DBLC 4MV4A 2CHEA 2SKCA 4EHAA 1HDZA 1UPCA 2VQ6A 3M4NA 4XB6B 3V9PA 1OXMA 1PWHA 1UBKS 4BV8A 4WNYA 4MULA 4QJIA 4JP2A 1U7HA 2O8BA 3A7DA 3LP5A 3GCWA 1JSCA 1KI7A 3G2HA 5TQVA 3SG0A 4L75A 4HFJA 2ZGVA 4TWIA 3B7PA 3HC7A 4XJTA 4Q1VA 3TZHA 3N2ZB 5CUQA 3EFEA 5L40A 3PA8A 3H6KA 4FE4A 4YRCA 5JSHA 2HLHA 2GO7A 4AY3A 3QU7A 2CL6X 2V5UA 3KOMA 2A78A 3HXLA 4NAUA 3K30A 2DC1A 4RDHA 5F9MA 2DFTA 4ESHA 1WTCA 4N0EA 1AB6A 2NXEA 1JXMA 4JITA 2XT6A 4BFVA 1TE2A 1YI0A 4DXDA 4EI7A 3M1YA 2GCGA 5BWNA 5ALQA 3N8NA 5CXUA 4G4GA 4RXTA 4X95A 1MRSA 3ROFA 4U2CA 4G09A 1L7DA 1S7CA 2MYUA 3CSUA 3MGBA 3QFRA 5IC6A 4CKYA 5JFOA 2ZSUA 4U2KA 3OMLA 4JHXA 4DCTA 2F00A 1NPYA 2Q3CA 5KQGA 1PJLA 1ZVMA 2JVIA 3RSCA 2LNDA 3H5NA 2Y9PB 4Y6OA 1CX9B 3CT6A 4KRYA 3VPSA 4ZYLA 3HCWA 3ZDCA 1NP6A 3OPMA 3KUCA 2BM9A 5JCOA 1G291 1C3JA 2AE2A 2WFLB 4JFRA 4TMVA 3RS4A 4B80A 5IULC 4RLSA 5JOQA 3FUCA 1YQTA 1JDUA 1SQ0A 3W5JA 1ULTA 3JS5A 2WD9A 4F3RA 3H4VA 3O4GA 3OPXA 3GLIE 4FEAA 1CFZA 3IEMA 1KI2A 1ULSA 2VHQA 2I3BA 2PD6A 2W22A 1YR3A 3LWZA 2YV3A 4NY1A 2CLDX 1E5DA 5KYKA 5TMBA 2OMEA 3WL4A 1APBA 1R6XA 5HK9A 1LI4A 2UU9B 1HDGO 2CDAA 4G6ZA 5KO2A 1KU6A 2EAUA 1ZP6A 3IEUA 3CR8A 3LFHA 4JEUA 3UKDA 4GGPA 1ZOSA 4X94A 1MX5A 4GVPA 3N2NA 5GGXA 4CEHA 4P0TA 1QJ4A 1CG6A 1GGVA 1U3DA 5ERGB 1EBFA 1TA4A 1ADCA 4PBSA 5JAUA 2YWJA 3F5QA 3U7RA 4HAIA 4GLLA 4LY9A 2A7XA 4FWBA 3PUVA 4EJ2A 4OJQA 1HBJA 4FYVA 1WXFA 3K1AA 3KZCA 3FN4A 2Q7DA 3SX0A 4DMLA 4NI5A 4F97A 1L7BA 2J67A 3ZCVA 1CYEA 2ZKLA 2IYRA 3W8FA 4YONB 1YRYE 4AUKA 5ICEA 1P60A 5ICFA 2VF8A 3EODA 1TYEB 3ITKA 4FFPA 1TL7C 3PX7A 3SM9A 4YCLA 4U00A 4KR2A 1L4BA 4FGLA 1NQAO 4OGGA 4PS0A 1QCDA 1NR5A 5F35A 5B12A 5JS7A 1K75A 1QX3A 4I5EA 3B3FA 2W8BB 1BHSA 2RHJA 3GVPA 4ZOLB 4GMGA 4IUDS 3EGOA 4UOEA 2E6UX 4UEWA 1VYHA 2CB0A 3E18A 5GZ3A 3EQ7A 1G2QA 3HBNA 3GLIB 1UFQA 1G3MA 5ES3A 2CDNA 1CSEE 4ZVNA 1SZCA 3HLTA 4L6IA 4BGUA 3LRTA 2E1PA 4URZR 4I3GA 3GLGA 3IVRA 3KYDB 3GLIA 3H97A 4URFA 1OJLA 4F3CA 3BWVA 1UBJS 4AJ9A 4DT1A 4K9NA 4ISBA 4LZWA 5ALXA 2H1RA 4JEHA 1Z4LA 2E21A 1OPXA 1QYIA 3I2IA 3K92A 4WESA 3ZCXA 4JXXA 3IDFA 2XZDA 3DE0X 1H0HA 4GKVA 2VH5R 4H59A 4IJMA 2Z04A 1JQKA 3F5SA 1X1DA 3ENWA 5LSAA 2B1QA 1EB8A 1P0IA 1US8B 4N7BA 1LF5A 4O4HF 3KEQA 3N0XA 3RVNA 1JAIA 2F59A 2INGX 2FK7A 3KJNA 1LPMA 2PLAA 1I2AA 3QKRB 4ZVLA 3JARA 4L0CA 1TMYA 1MAHA 1UJBA 5CA1F 2FEAA 4KDCA 4Q21A 1Q1ZA 2AEEA 5K3BA 5HIMA 1K6IA 1MX1A 2YIJA 3NCTA 1FZTA 3KQSA 1C4WA 1AKUA 1MPXA 4JV5B 5EFZA 1PO7A 1YBHA 4PZPA 1NF8A 3IEXA 3UMSA 3NFYA 3ZHZA 1E3EA 1EHCA 3BWXA 3F6EX 4MLDA 4A6XA 1C9NA 3VJKA 4AO6A 4BLQA 1BWRA 4P0QB 3H2YA 5KINB 4ETIA 4XEUA 1Y9EA 2O1SA 4CCYA 1M6EX 1S8FA 3FFTA 4D8UA 1I7PA 3RRZA 5C9ZA 3IO3A 4ZAWA 5CURA 3QU5A 4XM0A 3IIJA 4M22A 2NO0A 4LZPA 5J1TB 5GGYA 1XK6A 5K8UA 2B6HA 3DEJA 3Q7QA 5B4UA 1K7EB 4CM9A 4RYDA 2E7ZA 4P54A 3VNVA 3TLAA 3ZWMA 1ZA2A 1Y1RA 2EG9A 3Q9UA 1AQ6A 1D6SA 4WZZA 2GZ1A 1PE0A 3BB4A 3LBYA 4OGWA 4ZO8A 4G8CA 1SPXA 1L3BA 3QXSA 3QPAA 4KR3A 1W0KA 3QY9A 5AK5A 5DHPA 4MPDA 5EZYA 2HMYB 2RSLA 1BWSA 3O91A 4TYQA 1E2PA 2VJBA 9ATCA 2QLJA 2R7KA 3O94A 2WWHA 5ALHA 3MJVA 2OHVA 4XOUA 2PSEA 2YYZA 4DJFC 1V41E 2QM0A 3X2EA 1J8FA 1NVEA 1FRVA 1SVWA 3UAZA 4ES6A 3ZDAA 4KAAA 1Z6ZA 2IU6A 2GBLA 3ZEIA 5JSUA 2UVDA 3ED5A 5KSOA 2W42A 1NBHA 2VJMB 1PYOA 2ZIXB 1IEWA 2FV8A 2RGAA 3CLVA 1JA1A 2GN1A 3N3AC 5AKEA 3FD8A 5HRCA 2W43A 2ZIXA 3DHEA 4K3VA 5EUCA 2BEWB 2GOYA 4AAYA 1PKEA 4JU9A 3BHNA 5IZCA 2LXNA 4HNQA 5DGDA 1L9XA 1VPWA 3LRXA 4ZYXA 4FCTA 3DP9A 3NBKA 4L22A 2QLFA 5FBVB 3L7OA 3QU9A 4L4RA 1ZN2A 2NIPA 3OZWA 4GPD1 4V1CI 3O4IA 1WSWA 1YU6A 2W6NA 4HZUB 1Z75A 4HRYA 5FQOA 3UZUA 4YYZA 4YGXB 2OO5A 5B7NA 4N6GA 1JZSA 1Y1KE 1ZLYA 1AMUA 1PX2A 4C7OA 4RJLA 2HNAA 2P2CA 2FR1A 3U4DA 1GD1O 2GAOA 4IKOA 1UDXA 3V80A 2YXLA 4W82A 4UBOA 5C37A 3NBXX 3OQJA 1HQDA 1RAEA 2EEPA 3ABIA 4KVGA 3MD0A 2BMWA 3SHQA 1S2LA 4K6KA 4NV0A 5FPTA 1JYEA 3G2IA 5C3MA 1L5FA 2UYYA 3LC2O 2YWHA 3RVPA 1LDMA 3TUZC 5A9RA 4KFRA 2GVZC 3NTVA 1J33A 1MT0A 3ITNA 3UW1A 4KQXA 2A9QA 5HS4A 1VM6A 1LS1A 2Y66A 1L5ZA 3HSYA 1QVZA 3Q0IA 4BMVA 4QX6A 1ULHA 4ZVMA 3G13A 5B53A 1P1KA 3IESA 1K9VF 4LJ8A 1ZRMA 3BRCA 5GP1A 3DV0A 1PGPA 3NWPA 5AIAA 3ZCTA 1PDVA 1HNZB 5M3BA 4Q00A 2IVZA 5B57C 2O3RA 2J9FA 2VT2A 4LFBB 2R8BA 3U4AA 1X7WB 3LOUA 4LXGA 4JXZA 5L6LB 1X70A 4DR2B 1L2TA 2OHHA 2YQ4A 4OLJA 3EMKA 1X7WA 1GV1A 1PK8A 4PW0A 1XZFA 5FNVF 3WICA 2CY0A 3UGQA 3G85A 3FR7A 4RZXA 1A1SA 4FCVA 1F4PA 3K7EA 4P3YA 4ALMA 3VPBA 1RXYA 2CFIA 5GONB 1C0KA 2E1RA 3I5AA 4RJTA 4KJXA 2XODA 1WO8A 4L72A 3EVDA 1T4CB 1UAGA 2HZ7A 1AE1A 3A4YA 4AC9A 1VI6A 2DX7A 2O2ZA 3JYPA 1Z15A 2WKSA 1DRVA 3PU6A 2A0UA 3QJ5A 2FWAA 1D8TA 4HB3A 5C51B 3NAGA 3HV0A 3H75A 3BHMA 4WK6A 1MJFA 1ZMOA 2JIRA 2V97A 4N47A 4LY6A 1RLOA 3LRPA 4AJ2A 4G37A 2JCSA 5DLQC 1HDYA 1KI3A 1PEYA 2G9NA 4BQQA 4EMSA 2FZKA 5L7YA 2VDVE 1CUHA 4DIUA 1TAUA 1BX3A 4YJFB 1XZKA 1W4ZA 4YJFA 3PYMA 2GBFA 5AHKA 2OZEA 3JQRA 3LMKA 1PWYE 3ABRB 2V6JA 2XNHA 3FBGA 3N8IA 4HUQB 2NQ2C 1P1IA 3HZRA 4F84A 2A5GA 2J5XA 4WCFA 3O2QB 4LJ4A 1NULA 3R20A 4PRKA 3HMQA 1I0IA 1QCCA 4OI4A 5ELXA 4WUTA 2VTEA 5E3HA 1EVYA 4HD8A 2DULA 1I01A 3TCKA 1ML4A 2O7RA 4U7FA 2CD7A 5CFMA 2FZWA 4PS1A 3LCUA 2IC5A 4FR2A 1RSZA 5CJ2A 4CE6A 1TX4B 4K28A 1Z36A 3NAMA 5U4XA 1V5EA 1MX3A 1V6CA 2I3DA 4NMMA 4BO3A 4FYXA 4HAOA 3R1IA 2HK9A 3KJZA 3VUFA 3VMMA 1XAGA 3UFXB 1MG5A 3MTDA 2EJWA 1K8XB 2I7XA 3FDXA 2O48X 2VJQA 4HAUA 5CA0B 3CBGA 3ZJTA 1K06A 4KR7A 3FETA 1U0SY 3UFXA 4B35A 1J5XA 1MH9A 1T35A 2H1CA 3A2LA 3D3KA 3NTUA 3NTOA 5CA0A 3T5GA 3U4GA 3UWDA 4QVKA 2VJNA 3JZMA 4DMRA 3G1UA 4G0WA 3QNWA 1PGOA 1VPVA 3TE6A 3T3GA 5JD3A 5EGNA 1UIMA 1QMPA 4PHGA 4I8DA 5LQKA 1WA5A 4MTLA 4ZCIA 3WKAA 3BOSA 3D4LA 4BGDA 2OBBA 4WN9A 1YZFA 4YRQA 4BFZA 2IXEA 2RC6A 1GYRA 3GCZA 3I9V6 3C4QA 4ZEOA 5JLAA 4BBAA 3GUYA 2J9ZB 4KNWA 2F62A 3VC2A 5JC8A 3JQ7A 3LPNA 4OHRA 4TS9A 4J16A 2BH9A 4P84A 5EMKA 1II8A 4B6OA 3DE3X 1XGKA 4YRGA 1SMKA 3LZ6A 1CW2B 1V1RB 2VDPB 1OX4A 2Q7XA 2Y9MB 3TUJC 3URKA 1QHGA 3PPWA 3RODA 4BLSA 3M9WA 3USZA 3DWEX 3LA6A 3LL4A 4ARBA 1I7SB 1DQZA 1E3IA 2NNLD 2WRZA 4YWJA 3QPCA 1WZUA 4E33A 1IY8A 3KAPA 3Q72A 2YWBA 4EPXA 1TAGA 3O84A 4OK6A 4E5MA 2BFNA 4I66A 2FDXA 1ESCA 5D5QA 4PNPA 3RBXA 4P82A 3Q41A 3NDPA 4PCVA 3RK4A 3O2JA 4IIJB 1I7NA 1E2KA 5DIZA 1OZAA 2Q8NA 4UHCA 2PT9A 3ND5A 1YCFA 2ZTLA 4IIJA 2VDQB 3NG1A 4X1YB 1NRWA 2J32A 5IDVA 4C21A 4ZI3A 4D92A 1DT3A 2P0YA 4J7XA 2OZPA 4O4IB 5E9QA 4YBZA 4PIMA 1E58A 3BJRA 1UBSB 1GCUA 3E9ZA 3GEEA 1NBOA 3KTAA 2I4RA 4Q16A 3KQPA 1KOLA 2JFVA 1XN4A 3UIEA 4C14A 1JWBB 3DUFB 4OMCA 3FIUA 1RBMA 2BP7A 4FNMA 3R41A 5K7SA 1AZSC 2AG8A 2HEGA 2ZJOA 4YRDA 1GR1A 4R2JA 4QWMA 3UCEA 4PX2A 1KAOA 4E2WA 2EW2A 1VG9B 1TT5A 2NVOA 3RSQA 4CN9A 3QFFA 1XRQA 1FVHA 1QLJA 4HQNA 4J2TA 4LHZA 4CLEA 2BF4A 5BR7A 1ST3A 2PKQO 2YFHA 4HDOB 4FFSA 5D1HA 3NH9A 4JVNA 4ZAZA 3VR4H 4TL9A 4YFVA 4BDSA 2G0AA 3CUVA 2W58A 4Q66C 3X2SA 3FOEC 4AKHA 3BZUA 2KMLA 1GDDA 1Z12A 3AVOA 2WIGA 4O2BA 3SZUA 5MN5A 4M98A 3PFHA 3QLUC 3R77A 4Y6SA 2GPWA 3L1VA 4PQGA 3T3NA 2IYSA 3VX4A 3ZI7A 4NIMA 2JGKA 5I3CA 4JS0A 1RYFA 4BFCA 3WB2A 5ED4A 2MU1A 3JU3A 3ZDBA 1LBSA 1N0IA 4HWRA 5IBRA 5JAQA 2BN4A 1EX1A 3WLAA 4DZZA 4OK3A 1IBSA 2PUFA 3L6DA 1IHUA 4Z4HA 1MP0A 3RG8A 4I50F 3U7JA 3TGWA 1EHIA 1FDOA 3A1EA 3VZPA 4PLGA 3R7WB 1JQ5A 2YZNA 2GZ2A 3T1YB 3GH3A 3GRFA 1E3QA 1PJZA 4LDAA 3K9CA 2IITA 3MWJA 3AM5A 5ALRA 3WQSB 1M3SA 5SZIA 1KR5A 3P96A 4XYBA 4PVCA 2QRUA 1W48A 2ZUCA 4LRSB 3ILYA 3MGGA 3TOCA 1HL3A 2X0KA 4GKAA 3OJEA 3HKEB 4XDGA 1Z4KA 2XYHA 4U5XA 4NU8X 3SYLA 3HI4A 5PGMA 4AXBA 3ADBA 2ODTX 4FHGA 2A6PA 2JIBA 3QMMA 4KQEA 1C0IA 3BMNA 1N9ZA 2WFZA 3BJEA 1FFEA 1MQ8B 2CLLB 2AQIA 3HBJA 4B40A 3A9VA 3OLVA 2H48A 3JPYA 4DS3A 2XB8A 1ZMTA 4WBNB 5G3ZA 4GR4A 4TN5A 1RAFA 4PRLA 1TKAA 4JQCA 4WBNA 1U6KA 5B2FA 1CVLA 1VJRA 2ONCA 3ER9A 2F43B 1E5QA 4RTMA 3UG6A 3C1UA 3OFND 4Z4EA 2I71A 4MO2A 2F43A 4B4DA 3ZLVA 5ENZA 2P27A 3LXUX 3LZCA 2JCGA 4HFRA 5FR1A 3PV0A 5F1YA 1YC2A 3O8DA 3VUEA 1EVQA 1Z6YA 1VXRA 4Y1RA 1DCMA 2R8XA 4QARA 2P7IA 2QD5A 4DY4A 3AB3A 4GPAA 5FL7A 3LQ4A 4D2IA 3L6UA 1T25A 4ZYUA 1WKBA 2P2DA 4QULA 3N5CA 3RVJA 3KL4A 1XHLA 3IBTA 4COKA 4DXAA 3WGIA 2IV7A 1SUPA 2ZRPA 2PEYA 1UC8A 1DKQA 5FPSA 1TLFA 1UOEA 2P9HA 4EECA 3V4VB 4ESEA 3D7MA 3HXQA 3HZOA 1AXEA 1XZMA 1YQGA 2H2WA 3C3AA 4FFWA 5TDHA 4CMCA 3W5AA 5I7VA 1KJJA 1ZZEA 3BULA 3BYZA 5JV5A 4N3BA 2H1FA 3F2IA 4NE7A 2Q2OA 1PG0A 4GP7A 4PXYA 4ENTA 1FTYA 1GYPA 1T3GA 2QZJA 1BXKA 3MYYA 5TQ0B 5EJ2A 3IP6A 2SBTA 1C9DB 1XVLA 4KYTA 1DCTA 1SB9A 2QAGC 2DR3A 3DAGA 5TQ0A 2FSSA 3DBHB 3ZNNA 2BVNA 4KE7A 4PZCA 3TLYA 4CFSA 3WZLA 2E49A 1IXKA 3EFHA 1V5GA 2NPIA 3KM0A 4ZXPA 2QPAA 2XPCA 4DLLA 4EX7A 2ZBFA 4NU5A 1QDLB 5ECDA 4BMOB 2Z1MA 5JD6A 1QBGA 3AXSA 4M9SA 1PR6A 1P18A 2GCOB 2OESA 4MQBA 4IJKA 3NHWA 3EFOA 1I6KA 2GVNA 4X6UA 2B92A 4BNUA 2YJTD 3GFBA 5A3VA 2CVFA 3LUHA 2B9VA 5H4HA 1JVBA 1VP3A 2VF5X 3FUWA 4CF4A 4JQZA 1IAQA 2IHVA 1F0PA 4ZCRA 2ODEA 2Z5VA 4NONA 2Z30A 4J76A 3HJHA 3QLVC 3OF5A 3JZFA 1VRWA 3OPNA 5E1OA 3RB8A 4CMBA 5MFZA 3F3KA 2Q1TA 3JWPA 3K8YA 3ESDA 4BNKA 4D9JA 3IAEA 4KFTA 3S55A 1I2DA 1V8OA 4DQKA 4DZTA 3GA7A 2H9AA 4JOCA 1QHSA 2FQQA 4Q9JA 5C0OE 3N2KB 2JEOA 2J6CA 1J90A 4TVOA 1JJBA 1GRCA 3LVRE 3S0JA 2KBFA 3HCFA 4D56A 721PA 2FPIA 3KUKA 3FDZB 4EAAA 5TQJA 4MTCA 1V16A 2J4CA 1AUOA 1NKTA 4YQZA 5EQTA 2G7MC 3FDZA 4LK2A 3I52A 2DWQA 2FG6C 3VBEA 5J3JA 1P2DA 1PVVA 4RACA 4C03A 1VSQA 3DEZA 3U17A 3GA5A 4IG9A 3GFPA 4MUNA 4HPWA 1GQOA 4UJ3A 2QZSA 1W5SA 2CMDA 2REXB 2GAJA 1T2UA 3WQRA 1JDPA 3QSYA 4F5DA 4CIVA 2ZJ5A 1ZGJA 1Y3BE 3BD9A 2AI1A 3RIXA 1JH8A 2NVWA 2P4SA 1MIHA 4P3NA 1E2HA 4A0FA 3HYNA 4BECA 1Z26A 2CDRA 4LGMA 4DQLA 2UVPA 5HR5A 1U5BB 5CBPA 2B25A 4UQLA 4LAFA 1O2DA 5AKXA 3DT9A 4E15A 1U5BA 3EDRA 4DC1A 4OFZA 4MK4A 1G21A 3A9WA 4MPPA 4F2DA 4TUYB 3BRWA 3EW9A 4PRYA 3GJZA 4FT4A 4U39A 1VB3A 4K1XA 3WRXA 4MJ3A 4EB8A 3HXMA 6PFKA 3C2QA 3N0TA 3RF6A 2CGEA 5ALYA 2B0CA 3LVFO 3HJTA 3M81A 3BGIA 3GXBA 1A50B 3MLEA 3U60B 4DLKA 5HP4A 4PIPA 2BMVA 1BX0A 1JYFA 2HXYA 1PF7E 1A5TA 3AVWA 4AJKA 1T9HA 2BL4A 2ZPTX 3WGJA 2C20A 4QEDA 4JUAA 4D99A 4RVUA 5AJUA 2XDWA 5ELLA 1RAAA 5LL6P 3OSUA 1M74A 2PS3A 3X1WA 3CVYA 4BNNA 2CV0A 5CVEA 2FZLA 1A9RA 3DOFA 5FLKA 4PY2A 3ISVA 3EEIA 3GUVA 4WFKA 421PA 4C01A 3CVUA 4LOHA 3VOBA 3WRYC 1GCIA 5KWIA 3MVEA 5FOTA 5KOYA 3CVJA 5F23A 2VT7A 1P1CA 2YOFA 1PV4A 2WU1A 2X77A 3JD0A 3VVCA 2F55A 2YQ5A 3L0YA 4ZO4A 1T43A 3O47A 3U44B 3BIXA 3N59A 3VKHA 4P7FA 3GMTA 3DD1A 5A5DA 2GBGA 3L07A 3RUEA 3R5FA 4CM3A 4Q7QA 3OQOA 3TIGA 3L7IA 3G1TA 4YRKA 3LECA 1GA4A 2H1OA 4HQOA 4MUAA 1XF1A 4PXSA 3MMPA 5AVVA 3WWZA 4AJHA 4YRRA 2ALJA 4HX5A 4NCHA 4WA7A 3OEYA 3WGHA 1DOHA 4JI4B 1DWUA 2QD2A 4N03A 5IW8A 1MO4A 1Q7CA 2FUKA 4P53A 2A8YA 1FDVA 3LT4A 1G3UA 1KDTA 2PR7A 3IA7A 4JC8A 1BJKA 1JHDA 2BFFA 1R18A 4NWIA 4JYZA 2O0JA 3TRDA 2A0WA 2HSEA 3K0BA 2C61A 4II7A 5AJYA 1SHUX 1DKLA 3OP1A 1JSXA 3OWXA 3UK6A 1JDBB 2VPZA 3G8DA 2A0KA 2ZB7A 2ZR9A 1JWLA 2NTYC 2V7GA 1MB2A 3GQVA 5TPZA 4ZOBA 5KWJA 2VYND 4X1KA 3GN1A 1E2QA 1PWXA 2GEUA 1ZCAA 9LDBA 4RVNA 5E7MA 2XVZA 1V95A 4RTRA 1VCMA 3PIRA 1PS8A 1VBMA 4ZCPA 4Z4IA 3OOWA 1AHIA 3B2QA 3CKYA 3EVZA 3W78A 3WR5A 4R1PA 4XDZA 1SY7A 2QDXA 2WYUA 4G26A 5AKLA 5GOTA 5HKOA 2XQFA 4AJIA 1GUBA 4CQMD 2XGMA 1EFTA 4KXUA 1HRKA 4ZU1X 4I36A 4PU0A 3UCXA 3ZHVA 4L27A 4C3OB 4CIXA 3ZWOA 4ENRA 5HSGA 1XJQA 5IKMA 2EFCB 2XADA 2P4QA 5DWQA 3R3SA 2XF2A 1B1CA 2H4WA 2YFYA 5C32A 1X14A 4ZTUB 2FN4A 1DG3A 2EVWX 4A16A 3QVMA 5JANA 3V8MA 5EQJB 1LTQA 1NJFA 1LBIA 2AN9A 3NNSA 2Q2VA 2D1YA 2H7XA 3EC1A 4KUHA 2OB2A 4CKZA 1CHDA 1FRZA 3R9XB 3L5KA 4OKSA 4DTIA 4IRXA 2ZQYA 4KGDA 5E0KB 4UZEA 4ZCMA 4BFTA 3DD5A 4NJMA 5A4KA 3TOXA 5HKAA 3R9XA 4YAWA 3AOEA 3DO6A 3GRCA 3OLQA 5J43A 1ZK1A 3PNYA 1WTAA 3M1IA 3C8ZA 2Z5FA 4PYIA 1HG0A 2RGUA 3UMMA 3RR2A 1JLMA 2WU3A 3CNLA 2VK2A 3DFFA 3JQ6A 4YAIA 3ZWBA 2CLCX 1FL9A 3TSWA 1LQUA 3WL6A 3MQ4A 3WWYA 2ZBEA 1MT3A 4UBJA 3AKEA 3H2SA 1KJ8A 3ESXA 4GP6A 2DAPA 4LYFA 2I80A 4RJ2A 2B21A 2W70A 2CDBA 5JASA 1Y48E 1C4XA 2WVJA 3MB5A 4CMIB 3A0RB 1IJKA 3C6BA 3ISTA 3EGWA 4IIFA 2JI8A 5KJFA 1G7SA 5GJBA 3IUJA 1JFVA 4CMIA 3OQMA 1P7PA 1UJ5A 1VCOA 2RHTA 2Q4RA 3AY7A 1FYWA 2B3DA 2F1HA 2Q2NA 1VJGA 1U8EA 1EFLA 1Z0IA 5IH3A 1H0RA 4F92B 4LDPA 1V0JA 3KYBA 1XTZA 1N5IA 1CUCA 4LTMA 1T6ZA 4Q0MA 1QO0D 1O58A 1VJTA 1W2WB 3NT4A 3BPSA 1O95A 4M38A 5FPYA 2PKCA 1J8MF 3GVCA 3HGMA 4QATA 3V4PB 2RFLA 4DEXA 1VE1A 3JQQA 3GLFA 3U3ZA 1YS7A 2Z9BA 1AK9A 4DCGA 3N6VA 3ROEA 1EUDB 3GP5A 1I1NA 2JCVA 3SJCA 4B75A 2A4MA 3KT6A 2HLPA 3R76A 1IXYA 1PCXA 1V8DA 2FF7A 1DKNA 3RADC 5I9SA 3RIMA 3ONEA 4OOEA 2Y2UA 1F2UB 3LUBA 3P19A 1O3YA 5J23A 2CXQA 5CT8A 5CAEB 3EAGA 1XF9A 1IU9A 1HNNA 4RS4A 1F2UA 4U4AA 4EIWA 3BG5A 3OKCA 2G8NA 4GL4A 3ZWWA 4LSZA 4IIBA 4MW5A 4GPBA 1OWOA 1QTRA 3CRRA 1C7JA 3EPRA 3R5KA 4OSEA 5EERA 2NU7B 3RW9A 3U9LA 5AW7A 1R7RA 2I03A 1Y1TA 2HSDA 5COAA 4EGQA 4B7AA 1WY7A 3O73A 5K05A 1VYUA 1BZYA 2G5GX 2R6CA 3G0CA 4QREA 5KDLA 5JCZA 2J85A 1N5MA 2B4YA 1NR1A 4OJKA 1UWCA 3GRKA 3ZJVA 1U9IC 2OBXA 3HZZA 2PX2A 5KOHA 1UBNA 2UKDA 3HYRA 1ZBDA 4C0WA 2POCA 3RS9A 2GAAA 5DXAA 3X43A 3ZD9A 3TQSA 1ZD3A 2XB4A 1P73A 5JISA 3HCEA 2PT5A 2WKPA 1LRLA 1CF9A 2X5OA 3EGEA 3VU1A 6CHYA 5G02A 5LQMA 3Q2OA 2X9NA 1M2OA 1S2DA 1U3GA 4QAQA 4EMBA 2O50A 5CVDA 5CDFA 1FYFA 3WGVA 4CW7A 1W44A 1LPBB 1MLDA 2W11A 5L95A 4I4TA 3HLKA 2IVFA 2YWGA 5EHZA 4U3JA 3NH6A 3D1VA 1ADJA 3N8GA 4GR5A 5B7PA 4B3MB 1R10A 4Z0NA 3SZLA 3LUCA 1KH2A 1IE3A 1WOYA 1GCAA 2P9EA 1YKSA 2PUWA 3WXMA 2I6FA 2J31A 2QT0A 3RQSA 1IB6A 2LCQA 1H8HA 1O7JA 3T3HA 5FLXA 4LX0A 1ST2A 3I9LA 3AKZA 3FPCA 3EJWA 2OV8A 4TMZA 5KCMA 4DAEA 2DQSA 1VKHA 2VYVD 1Y4UA 2W6IA 2IOFK 3EVFA 3H8SA 5ECWA 1SUCA 5FPKA 2R6HA 4NYIR 3V1KA 3G2JA 4JP3A 1ONSA 1VPEA 3GVIA 5KDOA 2R62A 3FCCA 2Y0BA 4UJ5A 3VZSA 1KC1A 1V2GA 2FW1A 3AI1A 3DZJA 2HMUA 4FSHA 3FJ1A 4LBWA 7AT1A 2MOKA 4D79A 4EENA 2HGSA 3PENA 3FPEA 2YN2A 5DIFA 4XGNA 4NXNB 2P1RA 3ZQUA 1Y1LA 4QUHA 4P7GA 5D84A 1C1XB 2OKGA 5DM60 3HXOA 2B4TO 2X4IA 2DUJA 3FMVA 4MPRA 2XWSA 4GQAA 3RWMB 4B6JA 2H0QA 2ZJYA 3BXGA 4L0MA 5J2TA 3LSTA 1ZHOA 1L7XA 2A14A 3FWHA 1GZ3A 3GBPA 4S1PA 2QP9X 2CJXA 4X20B 2OPHA 4B82A 1J2TA 2ECPA 1O87A 4B85A 4ZQBA 1GAQA 1RM4A 4R1TA 5EMMA 2H17A 1ZUD1 5LPNA 2HCRA 1VPDA 5FOSA 4OHZA 1B6RA 1XV5A 2AS0A 5F1OA 3RABA 1H1LA 1IYZA 2CJYA 3K3PA 4IH1A 3IPRA 3K9FC 2ENUA 4BNMA 4ZK6A 1UWKA 5BV8A 2B78A 1QP0A 4DL9A 3UAOA 1EA5A 3HZHA 3A4LA 3AUSA 1D9ZA 1LDBA 5DYWA 1VMKA 5D5HA 4C5BA 3GFOA 1AK1A 3OIYA 4MJ7A 2P79A 1WL8A 3H65A 4OFBA 4P3XA 5KYYA 1SXJD 2Q9UA 3N0RA 4XIFA 2XB9A 1Z25A 2IE0A 2VK4A 4BP3A 2IEGA 4C5CA 1ORIA 2QZPA 3ELUA 4R01A 4XSGA 3X1YA 1OXXK 3UHJA 4DCOA 1HO3A 5DNYB 3Q8MA 1FLNA 3L8GA 3BDIA 5AK0A 4EWLA 4U5QA 3E48A 3GYBA 4GAEA 2FP3A 3PWTA 4RTPA 3M6IA 3QVUA 3OQPA 2C0PA 1HNWB 5AKZA 4ZRNA 3B12A 4RUKA 1N9KA 1PJ2A 1UPTA 1R3UA 2HTEA 2UYQA 4NJEB 2VHZA 4WEQA 3PJGA 4ZAFA 4GXTA 2G76A 3SIXA 1QRUA 4B3CA 5LCXA 1SVLA 1W46A 4L0DA 3BWEA 1V5WA 2FWMX 3CZAA 2CKMA 3KFVA 2WA1A 3PUYA 3DE7X 3RUFA 3UGJA 5J4YA 3KUXA 4PHFA 1U0JA 1HT0A 3IIIA 5EZ5A 1LK7A 3V34A 4JEIA 1KAEA 2BM0A 4LHVA 4MUFA 5DTQA 3WGZA 2OHXA 4B33A 1G19A 1AQYA 2R87A 2V74B 4PZZA 2WJVA 3IAXA 3KB2A 2TYSB 3UTDA 4BCDA 1XQ9A 5TT1A 4DBLE 4QKQA 4ZHSA 1KL7A 1YGPA 3FPLA 3A9UA 4U6QA 3B7WA 4KMRA 1M75A 4LYAA 4DRYA 4GE3A 3RIGA 4IS3A 1N3LA 2W6OA 5EZQA 1X8LA 4PBRA 3MILA 1HL7A 4G1UC 1U9YA 1NLYA 1C5KA 3C5EA 2VH1A 3ZIAA 4LYEA 1XE3A 4KDFA 2Q8PA 4G1MB 4Y67A 4YPFA 2ORWA 3T41A 4C0SA 5I7EA 3O83A 3IVGA 2Z57A 3BORA 4AZVA 2H2GA 4OK5A 2YWDA 2Q4OA 3Q11A 4C4TA 4L02A 4X91A 2M1ZA 2ZSDA 1J6UA 1LI5A 1GAEO 1XTKA 1Y8QB 3C15C 3Q3VA 1QTQA 1M83A 3C4VA 4J1QA 1RABA 4LF8B 2HW8A 1J7KA 3C4JA 1E2BA 3USES 5ITZA 1Y8QA 5DI3A 2RI6A 3PEFA 1LVGA 121PA 5LBTA 1TLLA 4KQ1A 3G3EA 4AX4A 4JASB 2G1KA 1KH3A 4MV7A 5ALGA 4BV3A 4KWEA 5F1KA 5EJAA 2QJRA 3FH0A 4FR0A 4OQMA 3VPCA 3D5TA 1BFUA 4GZ3A 3CJTA 3P5SA 5ULLA 2JW5A 4KI0A 3SXJA 1Q22A 3WK6A 3TZQA 2E82A 4II2A 3IIKA 5BN4B 1CUBA 3QNUA 1VKJA 3N2EA 4QYXA 4EITA 2J9YB 4LBVA 4YJGB 4N3NA 5BN4A 3QVSA 5LD2C 3FRIA 2V6MA 4IKEA 4D5EA 4GF5A 1QIDA 2PS9A 2PYIA 5DT9A 1N57A 3LCMA 3EVCA 5TVGA 2DFNA 2QN6A 3JQBA 4P4SB 3UUFA 1TPYA 3HCBA 1U0OC 4M0EA 2WG1A 3Q1LA 4MZDA 1A7AA 3UXEA 1OXUA 1EZ4A 2W6CX 3K72B 4FX2A 3RVRA 4BMYA 4YUXA 1UKAA 3KR2A 5KNCD 4Y18A 2PMEA 3S8YA 2XR1A 5T3UA 3PQ8A 5TEVA 3WL7A 5IAEA 5HA5A 2AJTA 4OCZA 2BAGA 4CR6A 1FFYA 5B6IA 1GUYA 3FNFA 3BSSA 4M1QA 4EHLA 1Q12A 3GGJA 4X3CA 3OX4A 2LBPA 4JDPA 4E2YA 4HDMB 1Z7WA 4Y7CA 2XGJA 4QFDA 5HCUA 3DONA 1KPGA 1XD2B 4LYGA 3PD7A 4NPHA 4JC5A 4TKUB 1ZU5A 3D1LA 4HDMA 4TZTA 3A26A 3T12A 3WL3A 1SN7A 2VPQA 4RZ2A 4TKUA 5F2KA 5H82A 4R71A 3MGAA 1U4SA 4OYYA 3VXKA 3IHWA 4TRMA 1IEVA 1CHNA 3WV5A 4R2HA 1GAWA 4IIGA 1K6JA 1HYGA 4CHGA 2K7FA 1OFUX 2GK6A 3B5JA 3GJ7A 4EUHA 1J0BA 4V0ME 2WHPB 4EVSA 3FY4A 2XZTA 5FOWA 521PA 4WVLA 2EZ8A 4YJ2F 4P92A 4V38A 4ERXA 2ZB2A 1I3NA 2C2HA 1M6HA 1TTPB 1OFGA 3R7AA 2GKSA 3L2OB 3MRVA 2NXWA 3KTFA 4TKVB 2D5IA 2NU8B 4ZYWA 1MJHA 5JDCC 4AW9A 3AZOA 5AK4A 3ET4A 2IP1A 2NU8A 2VF2A 3KYIB 3TPFA 4IEEA 4RELA 3DZKA 3GDOA 3UATA 4E46A 3NOQA 3B2EA 1QC5A 1MG0A 1WVIA 5JXWA 2QT1A 3D5EA 3WTCA 2CHUA 5AVRA 1KJ9A 4KPYA 4YRAA 3JR3A 3UJ9A 3FJOA 1E7QA 3U48A 1CJVC 2DWPA 3DLAA 4C1NA 4DDUA 5NLLA 1YD7A 2H5LA 3A6DA 4IY1A 2H5JA 2JGJA 1ZJ4A 1F1JA 1NXOA 3AP2A 1DIGA 2WYIA 3FBWA 4LZOA 2QUBA 2BHSA 4AJLA 2RD2A 4P0PB 4AQYB 1E0KA 3AYXB 4B6GA 1OIVA 3NFRA 2X0FA 2JZNA 3ZBPA 3N1UA 3DEIA 1E1LA 1GU0A 2F8LA 3LTEA 2Y0CA 5AXAA 5GM2A 1X92A 4R1SA 2ZRLA 3BXEA 4B3JA 4J0IA 5IT4A 4PG6A 1WPQA 2C04A 1MORA 4PZAA 5FR2A 4KQFA 3VKFA 3ANXA 3HUTA 1OASA 1XQ1A 1WW3A 5ESWA 3DB1A 1MOQA 3CX6A 1HT3A 3HHEA 4V0MA 1P61B 2KQUA 3LGAA 4N3GA 2FSGA 1Q1QA 1W8DA 2BFEB 1VE6A 4MX8A 1RKXA 1BFKA 3GGSA 2GKOA 3K9BA 3OT5A 4RJKA 3WHLA 1E8NA 2Y4NA 4MWZA 1QK3A 4BEWA 5CG1A 5FQNA 1XKLA 4PWYA 3GJ5A 4OD0A 4TTVA 5CIYA 3U3XA 1JQ3A 1PEAA 4B73A 2FI1A 1TJPB 4FIZA 1SUFA 4GI1A 5EXSA 4EHJA 1NOKA 4C7BA 1X86B 5LWQA 1EAMA 1J42A 5AM0A 1B93A 3O92A 5BQOA 1N36B 1GU7A 2ZJAA 3Q7IA 1DX6A 4L8VA 1TKBA 4KXYA 4NZ9A 2IYQA 3PQ3A 3CINA 1J06A 3GRVA 4R0VA 4ENQA 5JEEA 2H4XA 5J1SB 1XWFA 4C2TA 3THSA 3FKQA 4ZAGA 5F4BA 2R4TA 1Q0SA 2WYWA 5I7FA 1YV9A 1FLAA 4ZKDA 2HXSA 2QTWB 4LV8B 3M70A 5JCPA 3F1KA 4FOOA 5TS3A 1PZGA 2Q0SA 4HV4A 2WF6A 2GEKA 4LS3A 4CL8A 1GQRA 1JIJA 2ZYVX 2BE7A 4HAVA 4MEBA 1GTVA 3KD2A 3D7KA 2BFPA 4EYEA 3UK7A 2D59A 1FEZA 3W7AA 3MIZA 2HF7A 2O6LA 1C2YA 1DC8A 1NUHA 1K0UA 2QX9A 5T3YA 4DM3A 4EYGA 3U61B 1OB2A 1OWPA 1ISJA 4WUVA 2WSSA 5KS2A 3TCNA 1UBLS 1EBUA 5JMWA 3AERB 2A2ZA 5BWLA 3I2JA 1IY0A 5AJHA 1X19A 4MI6A 5A4FS 3NVMB 3HB5X 1E9CA 2OILA 3WC4A 3VGPA 3GFVA 1K68A 2CFTA 1X7YB 2YINC 3AEXA 1WXGA 4CT4B 1RI5A 1VLLA 2O3UA 4RY9A 2AVNA 3ZWYA 3U0BA 2RCNA 3A3NA 4TYPA 4JYPA 4CTJA 2I29A 1GL3A 1VJ5A 1XCMA 2QW0X 1JDVA 2GS9A 1T8RA 3BL6A 1U8UA 1N77A 5DM2A 4Y8VA 3B5EA 1XXHE 3LAWA 1DIRA 1PFKA 2COKA 4DNOA 3KEGA 3AESA 1T34A 3LUPA 5DX8A 4CG1A 2CC2A 3SOZA 4MRPA 3DR3A 3RHTA 2JNWA 3R3ZA 1ZDMA 4CCSA 2FG5A 3W2FA 5KVSA 3EOAI 5HTKA 1OZHA 3VNSA 4EFMA 2QJOA 4C89A 1C7FA 1QAMA 5EIOA 1PW5A 2GX6A 2EBWA 3RH0A 4EYSA 1IDN1 4XXHA 1KDYA 1U7OA 4LJ5A 4D45A 1N2OA 1QUEA 5A9SB 2EC5A 2HJWA 1S7GA 1YAJA 1UUFA 4Q9IA 3UPDA 4RPJA 4ZVPA 2O2JA 4XYEA 5A9SA 4FU0A 4HTAA 4PC6A 3NHMA 4XUGB 1PLLA 4QU9A 4R3UC 1Y4SA 4D9IA 1NRJB 2CN1A 2DWCA 3ELBA 3LNTA 3O4JA 3NEYA 1A0OA 5CVCA 2AFHB 4B83A 1KOJA 4CLHA 1R8XA 3OLXA 3RREA 1OUMA 4M6WA 2DFVA 2YKGA 5BSVA 2Y68A 2KI5A 2XMGA 2EBUA 2VSYA 3VPDA 2WTUA 4P58A 2F3SA 1KMIY 2HCTA 2XZPA 2ZSBA 3A14A 3NWBA 4IYRA 2WWVD 3OCWA 1CNFA 1UR5A 2GBIA 3FKSD 1ZD1A 4H2DA 2YFKA 2B1RA 1YJ5A 3UBMA 3KVNA 2FW9A 1U1IA 2ODPA 1XXHB 3LCRA 2ZR0A 3G1WA 5AVJA 1EEXB 2BFBA 2FWIA 2Q5LA 3OEED 3PT9A 3RRBA 3QE0A 4B4OA 4MYDA 1IBKB 3BD8A 3H42B 3S68A 3V1UA 1U2QA 1GL6A 3CTMA 1YZ3A 3U4CA 4PN3A 5DPMA 4AD8A 1I3CA 2ZE7A 1EIZA 1Q7TA 1Z2CA 1PJ8A 2OHFA 2YC4C 3D2BA 4K03A 4M9QA 5FULA 3TLJA 5EE3A 3GGCA 3VR4A 5BORA 3HEMA 4DUPA 4H17A 3U4IA 1L7MA 2H7YA 3B53X 1EXMA 5DHQA 1RM3A 1T36B 4MW1A 1ILEA 3DXXA 3RC2A 5C8DA 4Y98A 1RZRD 3UT6A 1NUTA 4TXHA 1TMOA 3AUYA 1EZZA 4RSHA 4AT1A 1P39A 2JIMA 5T4HA 1XCOA 2XBUA 3G82C 4JYMA 3T9AA 4ANFA 4KPFC 4QOEA 3CLTC 4GM1A 3CV3A 3T4UA 2EKLA 3B1ZA 3BEDA 4PRZA 4LXIA 3AVYA 4H3KB 3Q15C 1MV8A 4MUBA 1IUNA 1FK8A 4YLGA 4PBTA 4RTLA 2YOGA 5BWCA 3HA3A 2NU9A 5T7BA 2JB9A 1FUUA 1IG0A 2RHGB 2BT4A 4YXWD 1HKHA 2JEZA 2NTJA 3UANA 1UL1X 1T24A 1ZNYA 1ZXLA 3NGMA 1S3GA 4ITUA 4E6EA 3LHSA 1KE1A 3I1IA 3IULA 3R5TA 4LDNA 2XNDA 4BAGA 3K0CA 4EGCB 1C8VB 2PL3A 2VDMB 3C1OA 5EPUA 3SJBA 2G1AA 3MWYW 3CZMA 1DNPA 1FU4A 3UKJA 4B4WA 4Q48A 3IVXA 3QKSA 4BB5A 1IWPB 2HA5A 1Q7RA 2J59A 3PQ2A 4CYMA 3E53A 1M7BA 3GP3A 2M6KA 1P7YA 2MR5A 4PYOA 3RS8A 1G59A 4H4DA 1JN0A 3BWDD 3AEQA 4C07A 3KWMA 4WAUA 5I8ZA 1XI2A 4HX2A 2XXJA 3CVVA 1I6WA 1V71A 4UAVA 4UEQA 1F3OA 3DFZA 5IUNC 4G0ZA 3H1EA 4FINA 4PX9A 4KJZA 2NOAA 4WOCA 4OG2A 5IT0A 1QH8B 1CJUC 3EQ9A 2V5VA 1SG9A 1W9MA 4HLCA 3E9CA 1OFTA 4ZZ0A 2UUAB 2BH2A 1J9ZA 4JKOA 1G4HA 2VSQA 3QEKA 4HZIA 4KDRA 4L2IB 1NW7A 1QH8A 3A36A 1OH6A 1YS9A 1QFYA 2IYWA 3CM0A 1OV4A 5B3JC 4BLTA 1OU4A 3CF0A 4MAAA 1J70A 1YIOA 4RKRA 3FNIA 2DKNA 4ALIA 1ZGCA 4M1ZA 2VPIA 4E08A 3WGGA 3KOYA 2HRDA 3C6XA 2RCYA 4RK4A 1DJPA 2F7SA 3C8DA 3MUEA 3UJHA 2PH7A 4BEJA 2HFJA 3VGJA 5H3LA 1HR0B 2Z5LA 3HPQA 3PT5A 4C87A 4DLPA 1G8MA 2HADA 3I4CA 4NHEA 1MW8X 3FFBA 1VE7A 1ZCJA 2P9GA 3ETGA 4Z7QB 1XRSB 5KI6A 2J5QA 1L7QA 4HGPA 3TTWA 3WYNA 2JFYA 4OHBA 2ZBDA 5K4HA 1KQFA 5LN1A 4ZOLF 3PFWO 5FI0B 1YF3A 4DMKA 1ES9A 4L57A 5L7WA 1Q2UA 1GRQA 4ZI7B 1LB1B 3DTYA 3V4ZA 5K99A 1K8QA 3WB0A 1RLMA 2ZTVA 5LZ4A 4ZI7A 4JD5A 2NO9A 4TVSA 1R15A 3NDIA 1JUDA 1W35A 1KARA 2W93A 5CPFA 1ECJA 3AF0A 3P27A 3T7RA 2HDHA 1QV9A 3BC1A 4P5DA 4HNVA 3G2OA 1PWEA 5BRJA 4AJJA 1UOPA 1JV2B 2YHIB 3MS2A 3RRFA 3W9UA 2NP6A 2BTOA 2AJCA 1NV9A 2A1TR 4ZZ2A 2ZWOA 4WZBA 2YHIA 2DHDA 3GOHA 1D2GA 3HJRA 1V39A 2XJ9A 4Q4CA 5DYNA 4D9KA 2YZ7A 1AMOA 1PVDA 5F7OA 1IFXA 4W6ZA 3UB2A 4G1BA 4EL0A 2IQ5A 1XTQA 4EW1A 2Q6VA 3Q7TA 4M7OA 5EESA 5A0TA 4OPMA 3OJ0A 2VAWA 5E1DA 4UUOA 2O05A 3RYFB 3N05A 1KO1A 1K5DA 1G5QA 4MR7B 3ICQB 3O3OB 5EA2A 4GP9A 4DBVO 4U7DA 5A62A 3D6MA 2HJHA 4QFMA 5SZHB 4B7ZA 5K5EA 2W6JD 3CGGA 3VH3A 2JFGA 2Q3FA 1KC3A 5DP1A 3HNOA 2NUAB 3MWFA 4F6RB 1J99A 4Z4GA 3KTOA 1R6UA 3MJDA 2JDIA 3KKLA 1UCFA 3TLZA 4BZWA 2VK1A 1NV8A 4KNVA 4P4TA 3T7DA 4OQXA 1NJ1A 3DJYA 3V7UA 1YR8A 1AQIA 5KNDD 3IELA 1G6OA 2BW0A 4BO6A 5JSZA 3S2YA 5MGBA 1IEQA 4X84A 2W90A 1GJRA 5BN5A 4ROSA 5JWOA 2FPWA 1LK0A 3AETB 1P4SA 2IW3A 3JATB 2ZRGA 2R6AA 4GZ6A 1FLVA 3SIRA 5JBNA 3CPHA 2YV5A 4HBGA 3P9RA 1QQ6A 4FFBA 4AMYA 4H0FA 4HGNA 4AVYA 4LJ6A 4HDRB 2C2KA 4PLWA 4TV9B 1FP7A 2OZLA 3VPHA 3NI2A 1PZEA 3M4YA 3NMUF 1L7NA 3NHJA 1QGUB 5EQDA 4CM4B 3N07A 4R2KA 4TV9A 1WS6A 4L0QA 4I4LA 1D6MA 4CM4A 1QGUA 1NT4A 1AKMA 1S89A 3SJAA 3TOVA 3OA0A 1KMMA 1Q2XA 1AZLA 2XQVA 2XYGA 3B1JA 1V4VA 3KB1A 3DEKA 4NCNA 2CXTA 4RW0A 3JQGA 2JKZA 1KYWA 2B2NA 4ZQEA 4DG9A 1OTYA 5HNKA 4IICA 1MO2A 3CNBA 1GZ6A 3H9QA 2DF8A 3TK1A 5BV7A 1W8IA 4TPKA 4CI9A 2V7VA 4OX9B 3BMCA 2VWHA 1FSSA 1ZSVA 2AB0A 3AHFA 3FCXA 2DJ5A 1KFKB 2N1BA 1YMQA 3E7XA 3KZOA 1SCUA 2WTAA 3AFNA 4YUAA 3B7GA 4M4SA 1A5ZA 2PBZA 3BE5A 3LWBA 4ZYTA 1J5EB 1YOVA 3EZLA 3BGWA 4DREA 3M9XA 5LDHA 1O5OA 3RVQA 2JGEA 4PQFA 2CVOA 4LJKA 1VL6A 4JVLA 5AP9A 4UAGA 4LXTA 2CNWA 3HKCB 3MWGA 4HJXA 2GI4A 5LKAA 4CDNA 2JHGA 2PRYA 3SDZA 3HKCA 1GGFA 4W1PA 5AVYA 4KVAA 3SMQA 4GRAA 3EBLA 1QE0A 4KQGA 3H5RA 4NLLA 4LMBA 3COYA 3IAS1 2F67A 1T15A 5HF6A 4ZEWA 1NN5A 3RVSA 4C0QC 5LWHA 3E22B 3UC9A 2CCJA 1V3QE 1LX6A 2NUBA 2HLNA 2I4IA 4FNOA 1HLPA 4RWZA 2VDLB 2IYVA 2ACKA 3TZEA 2HZBA 3STWA 5JMTA 1T8WA 3I9FA 5BOVA 2RGDA 3IP3A 1H5QA 4H15A 4IW3B 2A59A 5E4TA 5FJIA 3SGLA 3HUDA 3SBEA 3RAJA 4HQLA 4XM1A 3KHTA 2X6QA 4P4NA 1OQAA 2ZI3A 2H59A 4MR8A 2EJBA 1SHZA 2I62A 5LYJA 5C8VA 4PC1A 1GTRA 4GKBA 1LFAA 1PL6A 3MOSA 2Z8YM