3PCRB

Structure of espg-arf6 complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The assembly of a GTPase-kinase signalling complex by a bacterial catalytic scaffold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords EspG
total genus 40
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2010-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pcrB00
3MWJA 4DB4A 1KSHA 3NDPA 1TF7A 1US8B 3VMFA 5FBLB 2R8RA 3PEUA 2NZJA 5L3QB 1E2LA 1T3LA 3PUYA 1WDTA 3GJ4A 1EFCA 2R44A 4MYTA 4M1SA 3K8YA 3L0OA 4A6PA 2R62A 1L7VC 5EP4A 3FKSA 5K8UA 3NC0C 2A3RA 1CJTC 1L4YA 1VG8A 4Q47A 5KDLA 3GLIE 4I99A 4ZO4A 1F48A 1AQUA 3RWMB 1N25A 1R10A 1T8TA 4B76A 1A2KC 4DUGA 2DYKA 4PC6A 3SJAA 3WBKA 5EP3A 3ZIAD 4P33A 4PR0A 1II0A 2J0SA 4PO1A 3FVQA 1G6HA 2VHCA 721PA 1AS3A 2XJ4A 2FH5B 4PX9A 3TW4A 3BORA 1CF4A 1FL9A 1FNNA 4B3XA 2VP4A 4LCBA 1YZUA 2VA8A 1GITA 4NZYA 3X1ZA 1E2KA 4Q4JA 2V4ZA 3KKPA 2NTYC 2YV5A 3GPLA 2OESA 4BZXA 1J70A 1NVVQ 2FX3A 4IFEA 4Q02A 1PVOA 3VU9A 4EUNA 2I4IA 5E7IA 3U61B 3K53A 4KAXA 5CDFE 1D9XA 2YWHA 2C03A 4DBLC 1N6PA 1OXXK 5JHGB 1O3YA 2O0HA 4P3YA 2YC2C 1N6IA 2XAUA 3U6BA 1OFIA 1W1WA 5AK0A 3CNLA 4B71A 1KDRA 3B2EA 1W2GA 1U9IC 2QAGA 3EASA 4ZCIA 2RGDA 5D3QA 3MAAC 2VHJA 3CPHA 1W4BA 5CIWA 4BLPA 3DZ8A 4L15A 3UIEA 3TVTA 2QSYA 2IXGA 4QGGA 2RGNA 5A5GA 1NVXQ 3F8TA 1NLZA 4C9BA 1OXUA 3F5FA 3TUJC 4TQUS 4B3BA 4EAQA 2GJSA 1AKEA 4RJLA 3FKSD 4US0R 5IRCD 1OPXA 2QAGC 4JLVA 1YU9A 1DPFA 3QVVA 2H1LA 1HURA 2G3YA 5L3VA 2VP6A 1ZW6A 4JKIA 1YRBA 2AFIE 1G3IA 3ZD6A 2ZUDA 1JJ7A 2QGZA 5SZHB 3A58B 1Z6XA 4BE7B 4MYUA 3SHFA 1I4DD 1PLJA 3RDPA 5AUOB 4OJQA 1NLYA 3DZDA 4QHTA 3EWAA 4TL8A 2F1JA 1IONA 3QQ5A 2RH5A 2ZIAA 4KBFA 4HAZA 4HATA 1UPTA 4GT1A 2CVHA 1XTRA 3BWDD 2IWHA 1YJ5A 2CNWD 1RPZA 1VYUA 3BAFA 4DLYA 5KPDA 3NDBB 4AKHA 3OAAD 4DLZA 1YZGA 1TNDA 2L0XA 1Z0AA 5CJ2A 2XXAA 3PCRB 3GFTA 3CB4A 4LYHA 5EXTA 5EE5B 5A4JA 1JALA 5TVKA 1ZIOA 4AY2A 1R8QA 4HDOB 3SR0A 3QKRB 2Z83A 3C4JA 3QUSA 4EPWA 1W7AA 1OIWA 2N1BA 4OQLA 4WZAE 2HXYA 2QI9C 4US1R 1L2TA 4YLGA 1Q57A 1W4CA 4IRUB 1HYQA 4MKHA 2H16A 2RHMA 1FPMA 2J9RA 2WWHA 1AS2A 1EFTA 1P62B 3QXCA 1E98A 4PHFA 3TUIC 2JJ2D 3BRWD 2IX3A 1XEFA 3DHWC 4TTRA 2IS2A 1P60A 5EQTA 1XPRA 1IY0A 2NO7A 3KFXA 3AF1A 1DS6A 1XBTA 2RMKA 5B2ZA 2XSZD 4ACBA 4EJSB 4HAXA 4C2TA 3K70D 4JL5A 2ZSDA 3C8UA 1I4TD 1IJFA 3ZVNA 2ODEA 1N6KA 3AH8A 1CEEA 3R9XA 3R8CA 2IYZA 4LHYA 1NLFA 1T0HB 2OM2A 2OEPA 3TE6A 4TZ0A 3R9WA 2D2EA 2ORVA 1S0UA 3GEIA 5TDHA 2VEDA 2D74A 2CK3A 2JJ8A 3LWNA 5IK2A 4Q1FA 3RVBA 5KUTA 1UBEA 4CEJB 4QHSA 1MABB 5KNCA 2GCOB 1UBGA 3K0SA 3Q7QA 2WKQA 1NI3A 4EPTA 1NG1A 4RFSB 1UBCA 4NYIQ 2CVFA 1GG2A 1MO3A 2RGEA 4PZYA 4JVNA 4R98A 1J8MF 1MR3F 1D9ZA 1SHKA 2W83A 1E2PA 2V1UA 1LVGA 1WQ1R 4UJ5A 5LPNA 5F3WB 3BIFA 1IN6A 4FI3C 1DAIA 2GZAA 3QKSA 2FV8A 4PQYA 3T5DA 3GQBA 3X1YA 1W48A 1RE0A 2NOAA 3QJYA 1NL3A 2QMUA 2WJIA 2JIZA 2WPDD 3K9GA 2B92A 2A7QA 1RZ3A 1KI6A 4BFWA 1I2DA 3ZQ6A 1QZXA 1G3MA 1SKYE 2I1QA 3GLHA 4FD2A 1GAJA 2QTVB 3OIUA 1Z0FA 2PEZA 4JLNA 3CRW1 4Q1BA 1ETUA 2IHBA 2WWXA 3PUWA 1OH6A 2V7QA 1OXSC 5AR1A 3J81k 3TR5A 2XB4A 3VR5A 3OZXA 1G41A 2V9PA 5FUYA 2XTNA 3UKDA 1A1VA 1CULC 1Z07A 2FZ4A 1KK1A 5SZIA 4Q01A 2OFWA 3KKQA 2IF2A 4C0KA 1J8YF 2WKPA 4ZPXA 4DCNA 3KUDA 1C1YA 1XEWX 3BB3A 4KVGA 3HJNA 2J0QA 2ECKA 1SHZA 4FW9A 2XITA 3W5IA 1G8GA 3B1XA 2GCNA 1GFIA 4UJ3A 3KQHA 1IY2A 4TLCA 4PSAA 5L8VA 3AVVA 2ZVPX 2X1VA 4D0NA 5CYPA 3Q9LA 2AD5A 3T1VA 4IKEA 3KJGA 4LJ8A 2ZXUA 5JS7A 3LH5A 1FOEB 1Q20A 4PPGA 3RS7A 1ZIPA 1SVKA 2JJ1D 2EFGA 3MG9A 2ZS8A 4GMXA 4NU0A 3SDZA 1S1CA 3H0KA 2HEIA 1JPNA 2YINC 4RZXA 1Q21A 4JJZA 2CL6X 2OBLA 3NXSA 3PJRA 1X1SA 2ZE5A 2J1LA 2OXCA 5DHAA 3REGA 4A2QA 3KZ1E 2P5TB 4Q9KA 3X2SA 4LJ4A 4HLDA 1FTSA 3BD9A 1ZP6A 1M8PA 4A15A 1DAHA 5C18A 2ZAOA 2NGRA 3GCGA 2H5EA 4PQRA 2VHUA 3BGWA 1CR1A 4RKEA 1TEXA 5EJEA 1E9EA 2OFXA 5K8LA 1W0KA 4P4SB 4LSGA 3MUFA 2EU8A 4TLAA 4KLNA 3NIBA 5CK4A 1EX6A 2QE7A 2OUKA 4HZUA 4LYJA 2GHIA 3D3QA 5B58C 5HKKA 3H4MA 1G5PA 2DFNA 2VH5R 1ZJ6A 5UKDA 2REXB 2VLIA 4YONB 5FTJA 5BN3A 2V54A 5E7JA 3B13B 1VYTA 3L0PA 5AJVB 4LHXA 3KTAB 4PO9A 3EPLA 4HI0E 1G7TA 2AK3A 4PTLA 2DWQA 1TQDA 1XTSA 1GSIA 3WYAA 3QPVA 1EGAA 4D4LA 5FPHA 2ZI9A 3UATA 3H86A 1KY3A 2JLRA 2VHTA 3A4MA 4X8HA 1NN3A 1AN0A 4WXPA 4F92B 4M9SA 1E3MA 4NYJQ 1M74A 2ZRNA 5ANRB 5CDFA 3T5GA 2ZSAA 3GJ6A 2P6NA 3IBYA 3U6KA 1UKYA 3N70A 2RGCA 2CBZA 4FMDF 3VHLB 5F98A 1Z6YA 3AVOA 1Z8FA 4EQ6B 2ZJZA 1E9SA 2J0UB 2QPTA 1ELOA 5L3RA 1MO6A 3B85A 3VR2A 4ZDWA 4BFXA 5FPYA 1OYYA 1T91A 2GA8A 2HF8A 3HR8A 4JL8A 4POAA 4DDTA 3IEUA 1D2MA 5HR5A 4JYCA 2JASA 2OZEA 3SU8A 1E9BA 3MD0A 1M34E 4M0LA 1IN7A 2WJHA 1UFQA 1G7CA 2XTZA 4AKIA 2ZR0A 1N6HA 2PCLA 2P5SA 1AZTA 5HZKA 2JLSA 3E2IA 2G77B 5KHOC 1IN5A 1SXJE 3AVXA 3QF4B 2DY1A 4DRZA 3TUZC 2EFCB 4OYHA 1IY1A 3LFUA 5JCZA 2OLKA 1QHHA 4TMXA 1R0XA 3KTAA 3VQTA 4RKFA 4C0AC 1XP8A 1R7RA 3CBQA 3RSLA 2DCUA 4LBZA 3DL0A 2ZRBA 4D0GA 3F0TA 1OH5A 3ZZUA 4XJXA 4A2WA 3ECCA 2OCYC 4G5SA 1N2CE 221PA 4LRWA 4MRVA 4C30A 5BYKA 2ZAMA 4FMCF 1NMZA 1ODFA 2PZFA 4IEIA 2IUTA 1KO7A 1YZNA 2IXEA 2PX0A 5TB5A 1OLOA 3LBHA 3NG1A 3JVVA 5DE3A 3Q7PA 2PMKA 4H9GA 3ZDQA 5IK2D 3IIKA 4TMWA 3RS3A 2G9NA 4HEJA 3EZ9A 2IWRA 4HAUA 5CM8B 1KO1A 2WJVA 2F43B 3CM0A 1N5LA 2D4HA 1CJUC 1CR2A 2SHKA 4JZKA 3WNCA 1G4UR 3ZGXA 3FGNA 2F7SA 1HE8B 5JSZA 5JECA 2AD1A 1OE0A 1MO4A 2V1XA 1EXMA 2XSZA 3KUCA 4QOSA 3SQWA 4IVRA 2F9LA 2EFEB 3SNHA 5TMPA 4P4SA 2OO7A 3EWSA 1VCMA 4JKYA 1P9NA 3OEED 5KSYA 4JT2A 5EE0A 3HR7A 2BDTA 4BLTA 4PFSA 3PQCA 4I4LA 3THXA 5FOSA 3AF3A 1WE2A 5DGXA 2F1RA 5KPJA 1KSFX 1UM8A 2J45A 3K70C 4QFMA 4Q7JB 3GJ7A 1WMSA 5EUQB 5HTKA 4L9WA 3QNUA 4X8OA 2Z4SA 4OQFA 2VHQA 2QUZA 2VSFA 4QGAA 4LJ6A 4ARZB 5KDDA 3U3OA 2ZQ5A 2CHQA 3AUYA 2BJWA 3PXGA 4ESVA 1XMJA 2FGJA 1X8KA 4NTZA 4NP6A 1E4VA 3OHMA 3PEWA 2EFDB 3CRMA 4Q9JA 5C4GB 4IDHA 1T0JB 1UKVY 1F3OA 4QJ4A 1XEWY 4ZKEA 1QBKC 4A8JC 4EFLA 4H1VA 1UJ2A 4MITA 3KQKA 3EA5A 2JATA 2J87A 5FR2A 4NYMQ 3AKDA 1N6LA 5HZHA 1A5TA 4G5QA 4V02A 1QHXA 2IYSA 2A9KA 3O8CA 3PEYA 1WB9A 4XSHA 1JNYA 3DMDA 1Z47A 3NHAA 4LUCA 3A37A 4XIGS 4TZ6A 2G88A 3LAWA 3B9QA 5CLQA 3RC8A 3T1OA 4XD7D 2C2HA 3AVWA 2HCBA 1XD2B 1G8HA 4MRNA 2UZIR 1AJEA 4LYFA 5DO9A 3K9HA 2ORIA 1M7HA 4FCTA 4CEIA 3QXSA 4PZLA 2NO1A 3S1AA 4CGZA 1TADA 5JRJA 2UZ3A 2W0SA 4HB3A 3KKOA 4RFSA 3EZFA 1N6NA 2XNSA 3EPHA 3MJRA 5KSOA 4TMKA 3K09A 2DR3A 5FUXA 4CEJA 2BBTA 2JLZA 5KNDA 3TRFA 2BKUA 2DB3A 2Q3HA 2WAYA 2PLFA 4DDWA 3C5HA 4LBVA 4QNMA 2BCGY 5AJWA 1NVVR 1Q44A 5C4MA 4XVUA 3UANA 2C96A 2HYIC 1DADA 5DI3A 4JLBA 1XPUA 3FE2A 3FMIA 4C0QC 1R0WA 5FOTA 2BM0A 2C5LA 3KJIA 4MYCA 4NMMA 5DSZA 3GLHB 1GRNA 2C77A 3QE0A 4NCHA 5LB4A 4EPRA 2YC4C 1IJEA 3TAHA 3MMPA 4O25A 1NP6A 5A0FA 5JWOA 5JHHB 5KSZA 3C5CA 1LW7A 1OKKD 3I3SR 3B1WA 3SYKA 4LJAA 4TYQA 3BK7A 1EESA 3THYB 4JLKA 1QVRA 2QU8A 5FOWA 3OF5A 2ZE6A 1DBSA 3HWSA 5E4FA 1K5DA 3DVLA 1PUIA 4ZCMA 3K0CA 1U90A 5AUPB 2E1RA 3ZVMA 5FUVA 2G0NA 1CJVC 4F7WA 4ZDJA 1KHTA 2QMEA 1N0WA 2W6JD 3AKCA 4Z51A 1CLUA 2R6GA 5HE9A 1ANKA 1QG2A 4I1SA 4GP6A 2QQ0A 3TH5A 3R7WA 4OI0A 1X6VA 2P6UA 5CM9C 1MH1A 3KJEA 4EPXA 1K6MA 1G7RA 4Q7KA 2NPIA 2OBMA 2OE2A 2D3WA 4FMCB 2RHDA 2X8AA 2GAOA 1P4SA 1KYIA 1NIJA 2GEUA 2ZJOA 4JLOA 3I62A 1ZNXA 3PR1A 4R71A 2WVJA 4JBWA 1FTNA 4JIMA 1AM4D 2QPAA 3B9PA 2G1KA 4JVMA 1P72A 1ZC4A 2Z4RA 3TAUA 1FQJA 4OJKA 1XTKA 2FE4A 2OBNA 2LCFA 3K1JA 4OHXA 1SQ5A 1SZPA 3T15A 4OI2A 2ORWA 3I5YA 3WRXC 3BH7A 1U0HC 2GETA 2AX4A 1XTQA 4PPQA 5JJIA 1EFUA 4NCIA 1ZMXA 4YXWD 5CLLA 5J4LA 1TU3A 1CKEA 5G53C 3PUZA 4ZIRA 1V5WA 3ZH9B 2DHRA 2XOKA 5H70A 5FTNA 2WM9B 6Q21A 3L0SA 3O8DA 3DPUA 1XXHE 2WV9A 2IYVA 1N6RA 2JEOA 4KJZA 3AVTA 4JVLA 2NO0A 3Q5DA 3EC2A 3ZJYA 2Z0MA 1XF9A 3SBEA 4BLOA 4M1TA 3AGPA 5FTLA 4Z1MD 1A82A 4XH9B 2FSIA 1RJ9B 5GJWC 4KLZA 5JSZB 1F2UB 3IHWA 2N46A 2GWHA 4M53A 1OH8A 1E0JA 2BM1A 5IT5A 4CEHB 2WMOB 3QBVA 2CL7X 1HV8A 5AWFC 2GZDA 2J7PD 4TYYA 1KOFA 4OHYA 3KB1A 2W58A 1VMAA 3G82C 4L9SA 2FNAA 4II7A 2O8CB 2WMNB 1P2UA 4LJ5A 3IEVA 1VYVA 5KNBA 2LKDA 1P7CA 3GFOA 1EK0A 1KZ7B 421PA 2IEYA 4DLUA 1HEIA 1TEVA 3R8FA 2VL7A 1U99A 3WRYC 5CB6A 3CW2A 5KOYA 3U5ZB 4KSCA 1E32A 2PCJA 2VP0A 3HDTA 3G0HA 1BH2A 4B2IA 4G5GA 2GF0A 1HTWA 2OV2A 4ACAA 2ODWA 4TL7A 3SC3A 1US8A 4PAOA 1FNMA 2HXSA 1AA9A 3QXJA 1RYFA 2H57A 2XTMA 1RRPA 1P6XA 3LVRE 5D3MB 2CMKA 1PLKA 2WOOA 4MH0R 1ZVQA 2ZR9A 1YZTA 4KFSA 1E2GA 2AWOA 2W00A 2AHOA 1IN8A 1BO6A 4M8NE 1E1RA 1XD2A 1EFRA 3FMOB 3CONA 1NNEA 1JAIA 3QKSB 5FTMA 1KO4A 1M1YE 4ILEA 3U2QA 1J2JA 3V9PA 3W8NA 2P2LA 4UXJA 4IDPA 3B82A 4URYR 2QENA 2ZR7A 2QSZA 1NSTA 4IOJA 2RGNC 4Q9HA 1OF1A 3LW7A 2BMJA 5FOXA 1Q1QA 2A5JA 4G01B 1SVMA 3B1YA 2GK7A 2QMHA 3EIHA 5HE8A 5KU1A 1F2TB 3GJXC 5AJXA 4KODA 4EJSC 4XVRA 3NBFA 1T5LA 2VRWA 1NVWQ 4W9MC 2HF9A 4TL9A 5TV2A 4AI6A 2QZ4A 1YZKA 3QPWA 4JSTA 4Q03A 3ADBA 2RB4A 1JXOA 3A4NA 4Q9IA 1GTVA 3OFNA 2O8EA 1E69A 1XNJA 5FL3A 3DKPA 1YRAA 1UF9A 4RFVA 3EX7C 1GDDA 4A6XA 4WW0A 2QTHA 2H8KA 1KO8A 4EJSA 2XB2A 4LV6A 2JIZD 3PUXA 3K0FB 4CT4B 3O8RA 1LFDB 2YOGA 3SS8A 1XCMA 2ZJ5A 2QM8A 3GLIB 1FZQA 5F9FA 2B8WA 3I8XA 3OEHA 3VR1A 3LW8A 1ZC3A 1LY1A 2QGNA 2P3SA 2HJGA 1HA3A 4MGIR 1MRSA 3A1TA 1E2QA 4OQMA 3WXMA 2ZRMA 4A0FA 1VG9B 3IO3A 1V43A 2V6IA 1TQ6A 3ASZA 4TT3D 3IKJA 1G291 1YKSA 3KXKA 4UXIA 2QP3A 3AF0A 3EZ2A 4Q4HB 1L8QA 2WSSD 3EXAA 2ONJA 4R2IA 1P2TA 2CHVA 3ZS9A 3I73A 1GKYA 3HPQA 1UEJA 4LK2A 3HU3A 4TMVA 2GEVA 2YYZA 4Q5IA 1ZD8A 1E4YA 2O5VA 3W34A 4DB2A 4QBGB 4FWIB 4NH0A 1R0YA 1JAHA 4KV9A 4D4MA 4IW3B 3EPKA 3PEVA 2YWGA 1P61B 2ZYUX 3KFVA 4Q21A 3UK6A 3LXRA 1DG1G 5FPKA 3GLFA 3B7GA 1VIYA 5EXXA 1G3UA 1WA5A 4UQOA 1RVDA 1MV5A 2FG5A 3N5CA 4Q1AA 2J59A 2ZRLA 2JJ2A 1KI9A 2D7DA 4B32A 1RYHA 4HB2A 4Q4AB 1U0JA 3L82B 3X1DA 2Q9CA 2ZM5A 4FCVA 2D06A 2JLQA 3IILA 1GVNB 4B6FA 4N0DA 4HUQB 2IUSA 5IF9A 2IL1A 1OB5A 4QJ5A 4Q48A 1U81A 1ZU5A 2FSFA 1II9A 5EUMA 4KYUA 1AKYA 4HAWA 4JYBA 2JDIA 2ERYA 4DWJA 2BV3A 4PAMA 1P2SA 2DWOA 2FSGA 3VX3A 4CZ2A 1FX0B 5C46F 2O8BB 2FFQA 2MSDB 1JPJA 2ZRKA 2W0MA 2I3BA 5J4KA 5FL7D 5FUWA 3GP8A 2EYUA 4RD0A 2WWYA 1UKZA 4QC2A 1YR8A 3A1SA 4B74A 3I72A 5HPYB 1X86B 4LYAA 3C7KA 4PHTA 2AK2A 1COWD 2OCBA 4LI0A 4JLPA 3GLHE 4A0HA 3KKNA 2X2FA 3LX8A 3NBXX 3IDQA 4Q00A 1VKJA 2GVDC 3EZ6A 1FUUA 3TVDA 1XZQA 4ZI3A 1E0SA 3DM5A 4B75A 2Q6TA 1Z63A 3A1VA 2KWIA 2ZRIA 1I2MA 1E1QD 1DELA 4KBGA 4MYHA 4O2RA 1VPLA 2GXSA 4C4PA 2GCPA 3BJIC 3L8YA 1CU1A 5KYKA 2CLSA 3CIOA 1BKDR 2AR7A 3QI2A 5GJBA 5LD2C 3KXLA 5FBWB 4URVR 3SI7A 3GJ5A 3FTQA 4Q9LA 3QPUA 4CRWB 3T06B 2J41A 4MKFA 1W49A 1ZINA 1JQLB 2VO1A 1TQ4A 4M1OA 4GFDA 1ONBA 3QG5A 1NVUQ 4HZIA 3IIMA 2AKYA 4D2IA 1DE0A 2RAPA 5B57C 3I92A 1CR0A 1LF0A 2GXAA 3W90A 3HU2A 5FL7A 2XZPA 1XPOA 1PUJA 5EXSA 2WWWA 1Z08A 1Z29A 3FFAA 5J4HA 1NN5A 3FHCB 4CT5A 1Q3HA 3CWZA 1G3QA 2F3TA 3D31A 1QHIA 3LRPA 5G41A 1S4QA 5G3ZA 1RC8A 2ZJBA 1RRFA 2ZRJA 4UNSA 2GJKA 1VCOA 4S35A 2O8EB 1OH7A 2XXAB 3FB4A 4RY2A 3RSOA 2J3EA 2ATVA 3EARA 4TTQA 2QBYA 3AF4A 4O2LA 3TR0A 4WAUA 1BMFD 3BERA 3D7MA 3DO6A 4F93B 1KAOA 2ZRCA 4DUGD 3ADKA 2FWRA 4F38A 2MMCA 2FA9A 3QY0A 4NCJA 3FPAA 2IYTA 1UBFA 4Y0AA 4OK6A 3K9LA 2QPOA 3TSWA 3ADDA 3B60A 2AXNA 3I1FA 1OV4A 2XZLA 3GMTA 3THXB 4B3DA 1DAGA 2WJGA 2WBLC 2BIFA 2O0KA 3A8TA 5FPTA 2ZRPA 4NYMR 5JCPA 1KKMA 4PPFA 1Z28A 4A0GA 1KIMA 3F3YA 3AVPA 4EPVA 2GBLC 3GD7A 1GKUB 2D7CA 3BB4A 4BRUA 2WAXA 1HE1C 4WVFA 1JJVA 3A4LA 4M1MA 4CW7A 1NMXA 2PBRA 1YVDA 1CRQA 1JI0A 4JLMA 3GJ0A 2R6DA 1KK2A 3B1ZA 4AYTA 4OL0A 3BE4A 4LC0A 4NCNA 4O3MA 1KI4A 1OT3A 1VG0B 2AKAB 1P9WA 1TX4B 3GLGA 5FOUA 4AKGA 3U60B 1E2JA 2P0EA 1OW3B 1BYIA 1YQTA 2C99A 1G5TA 3DOFA 2QROA 1PJRA 4R9UC 1ZYUA 4XTCS 3LQRA 1ZNZA 4MRSA 4OBEA 4IVPA 4B2PA 3NBYC 5IHPA 1OSNA 1NBMD 5ELXA 4EPYA 1SVWA 1FQKA 3OE7A 1LF5A 4GL2A 3EZ7A 3QKUA 2A2ZA 2O52A 3W5JA 2HLDA 2BMDA 4DLRA 4ARZA 3TIFA 1NKSA 1Z6AA 1KMQA 3EC1A 1QHNA 1W46A 2EQBA 2QM7A 4CF7A 3U7GA 1KO5A 4TSFD 3FWYA 3L8ZA 4M22A 4DLTA 2MSEB 3CO5A 1RRGA 4DCVA 5JMTA 1OFTA 3SYNA 5C1BA 4GOXA 3W6OA 4URWR 2GTPA 2XGJA 1VDZA 1XTJA 3PIRA 4KCGA 3AVYA 4A9AA 4Q4HA 3K09C 3BFKA 1N0UA 1EG7A 4FMBB 4L5BA 4TTPA 3AGQA 4Z54A 1FW6A 2REBA 4D6PA 2E87A 1MABA 3EIEA 4IOLA 4NPHA 4A8JB 4E09A 3UWOA 4G3XA 4IDNA 5FI0B 1ZM4A 4DSNA 5B64A 3MRSA 1Q0UA 3R9IA 2W6ID 1N5JA 1ZUHA 4NL4H 1II8A 2IC5A 2IYLD 3CR7A 3TBKA 2GAAA 2QBYB 4G1UC 1KNQA 4NDZA 4R7ZA 2GF9A 2QQEA 4FXPA 1A2BA 1IHUA 2IHYA 1GILA 3RNLA 4MGYR 4KU4A 5CYOA 4TYWA 2HT1A 4HB4A 3E1SA 4MRRA 4KSBA 3T1TA 3TSOA 4JL6A 1TUEA 2EFHB 1XB2A 1XRJA 4MRPA 4BFVA 2CL0X 2ZJ8A 4AG5A 3THYA 2JLXA 4ZDIA 2BOVA 5BQ5A 3U7EB 1MRNA 3LXXA 4QRHA 3QBTA 2OCAA 3A36A 1WP9A 3GFPA 5JRZA 3ADCA 3Q8XB 4HDCA 2A5DA 4O0MA 1G19A 1PZNA 1J99A 1WCV1 2RGAA 3L2OB 1M7BA 2QRNA 4TSFA 2OT3B 4OK3A 4BLQA 1IOZA 2PLRA 2F1IA 4BPBA 2IS1A 4Z1MA 3RWOA 3IGFA 3QXHA 4DLWA 1DVRA 2DFTA 4HSEA 4L4UA 2CJWB 1II8B 4IHQA 4RSGA 1ESMA 1QDEA 2R9VA 3SN6A 2PEYA 4PO8A 2RKOA 1DO0A 4BFZA 5CK5A 5JZVA 2BHRA 2ZU6A 4QJ3A 5KO2A 2FPMA 1TUIA 1YR6A 4DHEA 1T3SA 4A82A 4LPSA 1G20E 2B6HA 3CF2A 1X1RA 4AC9A 2H18A 2AXPA 3L0IB 3L43A 2XJ9A 3M6AA 2Q21A 2N42A 3SEAA 4D80A 2R65A 3CNNA 4N1AA 4PPNA 4C3ZA 1Q22A 1KJYA 3REFA 4LHZA 3THWA 3RRYA 1P9RA 1XWIA 4LJYA 4V0MA 4I1UA 1Q3TA 2QORA 1G9XA 3WYGA 1G1MA 3GLFB 2FPKA 4GZMA 2FOLA 2ZU0C 5DISB 3EW9A 2BCJQ 1U94A 3WNBA 4PC7A 1AGPA 5JFGA 3G5UA 1N0VC 1HT1E 5CB8A 1OJLA 4BZPA 1KY2A 2GEDA 2ZJ2A 5FOVA 1ZNYA 1G8FA 2P6RA 2DWPA 5JJKA 2OAP1 3KL4A 2Z6VA 4MKGA 1XDBA 1FX0A 4GSYA 2VP9A 1G18A 1XU4A 3WBJA 3GEHA 4TLBA 1VCIA 2GZHA 3C41J 3K70B 1R5NA 2CXXA 5EE3A 5K8IA 1S2MA 4WIAA 1VTKA 4QGHA 3MFYA 3SJZA 4S2EA 3LLMA 3K0AA 4HUQA 4DC9A 4DEYA 2IYRA 2ZSFA 1S1MA 3Q72A 2GDJA 1SXJD 2VSOA 3H2YA 3RANA 1OKKA 4ZCLA 1U8AA 5GJCA 1JBKA 1BMFA 4KFUA 5DNYB 1JR3E 1CR4A 4HLQB 4V03A 1KMHB 1ZD9A 1CJMA 4JBYA 1CJKC 3I5XA 4ON9A 4IXMA 1KTVA 1Q1EA 3WHLA 4ESHA 1GL7A 2Q3MA 1I4LD 2WTUA 3Q85A 3VX4A 2CHGA 1CIPA 4M9ZA 3R7WB 5BWMA 1IAQA 1NIPA 3U3RA 4YQFA 1W4RA 2OSBA 3FDIA 4WOPA 4JS0A 3WYFA 2IW3A 1KMHA 1MKYA 3RLFA 3KQNA 1GP2A 4M9QA 2REOA 1XCGB 3QKTA 4TQ9A 4HDQB 3UMRA 3P27A 2O8DB 1N5IA 1XEXB 2ZUBA 5BN5A 1E2IA 1TL7C 1M2OB 5JI3E 3MWYW 4WZBE 2PT5A 3SYLA 4TMZA 3BBPA 5LD2B 4KI0A 1XJCA 3I8SA 4C7OA 1E99A 1N3BA 4RD3A 1YE8A 1XTIA 2IBMA 1XD9A 5EXPA 3BH6A 4I81A 4RD4A 5IDVA 1F2TA 3NC1C 4GMDA 2WZQA 1YR7A 3V00A 4NYIR 4IDQA 4LJ7A 4PXAA 4B6EA 4D4JA 4LGMA 4B3CA 2JLUA 2KE5A 3CF0A 3HYRA 2WIBA 1OYWA 2PX3A 1QRAA 4XD7A 5JEDA 4URZR 3WP0A 1JQJC 4UNNA 4DCSA 2KJQA 2HDNB 1HUQA 2YOFA 3OIYA 1BIFA 1P2VA 2FN4A 2X19A 4LPKA 5M04A 3V4FA 2Y8EA 2YWFA 4IXNA 3FMPB 5HCNA 5J5CA 4NKRA 1MO5A 4QG7A 3LBIA 3N2IA 1HY3A 4PHGA 4K8OA 4A0RA 2QY9A 3A1UA 3TJZA 2X2EA 4BWYA 1KKLA 2FF7A 2A5YB 3C15C 3ICEA 4NCKA 3Q3JB 4ZKDA 1VHLA 2C95A 3WNDA 2HV8A 4ASUD 2B21A 4IEEA 1CTQA 3ICQB 3BS4A 4DSUA 2ZRDA 3AKEA 4BLSA 3ZD7A 4HYYA 4OHZA 3RRMA 1Q12A 3B1VA 1E9DA 3RS5A 3UXMA 4G5RA 2HCJB 5JEEA 2NIPA 3MWLA 1W5SA 2RCNA 3WY9A 4FCWA 4HAVA 5BXQC 1RRCA 1HH4A 2JLWA 2C9YA 3PVSA 4WA7A 4BFYA 2PMDA 2KB0A 3VR3A 4PQFA 4B44A 1H65A 2FSHA 5HCIA 4M4SA 3PITA 3H84A 4P32A 3OEEA 2IK8A 4DSOA 2YWEA 1H8ED 3TGPA 5JLJA 1GNPA 5SZKB 2O8CA 1W47A 5B30A 2XX3A 2Z5FA 4ASUA 4B3GA 2ANCA 3PUVA 3SJCA 3V4RA 3OIVA 3U3KA 1UKEA 5CIQA 3BFVA 1EWQA 4BFTA 4AG6A 3U3MA 2GCOA 3LDAA 4JVSB 1Q1ZA 3CH5A 1NRJB 4B33A 1F2UA 4CEHA 1W2HA 3PFIA 2BJVA 4WXRA 3LO5A 4CIDA 4E5UA 4YMTA 4Q19A 3QXXA 4C2UA 2QAJA 3NWJA 3RS4A 4LBYA 4C7OB 2DBYA 2MMGA 4Q4JB 2IYYA 3QIAA 1GZSA 5DN6A 3QEJA 1CRPA 3A1WA 4RD6A 4TT3A 4Q4AA 2ZJYA 1EX7A 4K81B 2OG2A 4MKIA 4BFUA 3HYTA 2IS6A 2WHXA 1N5KA 1OB2A 1P3JA 2ZI4A 1GRRA 3NTUA 3PENA 2ZANA 1ZNWA 2ZRFA 2VPPA 4F4JA 3OEHD 1ZRHA 1F60A 3C14C 4DT1B 3GJ3A 2GXQA 4BRWA 3ZVRA 1NJGA 1SKQA 2YJTD 3CWQA 1QHSA 5F2EA 4KITB 2BMEA 1OXTA 4Y0VA 3KB2A 2VP5A 4LHWA 1VCNA 1TQ2A 3RRNA 2FFAA 1U0LA 3QKRA 2P65A 2C9OA 2D62A 5DLQC 4DKXA 1ZAKA 3DDCA 3VR6A 2BBSA 4KFRA 3T35A 3KKMA 3X1XA 4A1FA 1KI2A 821PA 3RC3A 1U8ZA 1P5ZB 4EFMA 1NG9A 3IHLA 1W4AA 4MGZR 4MUBA 5H68A 4AIIA 5P21A 4P4UA 4LY6A 4FWTA 4TMTA 1NMYA 4GP7A 4E22A 5KSPA 1Y63A 1G4AE 1GL9B 2ONKA 1G21E 3W3ZB 3VFDA 4HB0A 1LV7A 4DDVA 1W36B 2GK6A 4DDUA 2QAGB 4DEXA 3IQXA 2GNOA 1GRQA 2F43A 1KI3A 1KDPA 2ZREA 1SXJA 4V0NA 1SVOA 3BC1A 4J0QA 5TY0A 5J47A 3AP3A 4LV8B 2XZOA 3NBZC 1T8UA 2KBEA 4CYMA 2A5FA 3B78A 2ZS9A 5SZJA 4TLDA 4U00A 1E2EA 2TMKA 4JMPA 4U02A 4DXAA 4RZUA 4V0ME 4Q4LA 1P73A 3P1JA 3E5HA 4DLVA 3DOEA 5FBQB 4GDFA 4Z8YA 1WRBA 2F1HA 3GEEA 4F4CA 1W5TA 3T61A 3WMEA 2WICA 4PSKA 2EYQA 1R5OA 1NY6A 4PZZA 2QG6A 1E79A 4D82A 3CX6A 5DHFA 3KQLA 1G17A 2QE7D 5DI3B 4W7SA 2I1VB 2ZROA 2V6JA 2J5XA 4HLUA 2OFOA 3I32A 3S1AB 1Q1BA 3QF4A 3TQCA 4QKQA 2GBLA 1LNZA 5FBVB 1W0KD 2YVUA 4URXR 4UNRA 1W0JA 2R6FA 4KVAA 4DLSA 4WBSA 4DCTA 5KTYA 1S3SA 4OQNA 1KI6B 4Q18A 3TKLA 2K5UA 2JCSA 1H8HA 5AUNB 2NMVA 4V0LA 1IM2A 2R2AA 1KZGB 1S3GA 1UDXA 2E9SA 4RVCA 1GOTA 1LS6A 4AYXA 5EZ5A 4PANA 3OESA 4KHZA 2PH1A 2H7VA 2A78A 2J7PA 1K5GA 2ZI6A 4N0EA 4BQSA 3T12A 3W6PA 3CX7A 5GADl 4Q66C 4PHHA 3K0FA 2NG1A 4MDFA 3CF6R 1R6BX 4HUTA 2JA1A 1TMKA 2V8OA 3DM9B 2FZLA 4A92A 4AKEA 3P4YA 2EWVA 4LX0A 2ODNA 2O8DA 2WWFA 4D25A 2ASEA 4Q7MB 2QA5A 3QSYA 1KI1A 1G8PA 4GPTA 3PV0A 1S9HA 3RHFA 1XZPA 1T6NA 3ZZ0A 5L3QA 3U7HB 3P4XA 5TARA 4FMDB 3LBNA 2XOKD 2BWJA 1N6OA 4OKSA 2O0JA 5DYGA 2QTFA 5EP2A 1QVAA 3CNOA 2F3RA 3NKVA 1IBRA 3MJHA 1J7KA 1KI8A 4Q1CA 3CZQA 2KBFA 2QT1A 2WIAA 5H8WA 2J7KA 2OAQ1 1Z83A 1EWRA 1RFLA 2ANBA 2IS4A 3WMFA 4TWZA 4IDOA 1H8HD 2ODBA 2IT1A 3BH0A 2PZGA 1F6BA 3M1IA 2IYQA 1KK0A 2OCPA 1W0JD 2ZE7A 4DLXA 3UPUA 2O8FA 3R20A 2QP9X 4P31A 4LOAA 2FGKA 1Z0JA 5FTKA 3QG1A 2BC9A 2NO9A 1OFHA 4X8LA 1DO2A 2EVWX 1Z0KA 1AK2A 4P0TA 5J4YA 1E79D 4CVNA 2DFLA 1ZBDA 4GZLA 3UWKA 1GNRA 3EPJA 2W6IA 1ZCAA 1SXJC 4IOKA 4PC1A 1GM5A 2GILA 3CRQA 2W6JA 3EAQA 4YMSA 3VHXA 3NH9A 3FFBA 4C0SA 1G64A 1GWNA 3DMNA 1TF2A 4GRAA 4YMWA 4BZQA 2C78A 3Q5EA 4TN1A 4MGKR 1KSGA 4TYPA 3CRRA 4QBFA 1G8YA 4US2R 2W2TA 1Z6TA 2GJAA 2IYXA 4AYWA 5DIFA 3KJHA 4H1UA 621PA 1KK3A 1U9IA 4B48A 3ZVLA 3JZMA 3CKLA 3TK1A 1RKBA 4E07A 2Q9AA 2MSCB 3TLXA 5E95A 3AUXA 1BS1A 5LBIA 1YZLA 3QOFA 1D2EA 4BEBA 1R5BA 2KI5A 5EE9A 2ZYTX 1X3SA 2HLDD 3QENA 2ZE8A 4QM6A 5FBRB 3OE7D 3VR4A 2NPFA 3VNUA 1XJ0A 1ZD1A 1KSJA 2R6AA 2J46A 4AWXA 5C2JB 2YKGA 4V0OA 1M6NA 5DI9A 2VSXA 1NKTA 4TLEA 3W8RA 1KI7A 1ESNA 1GKIA 2CJWA 2KSQA 5G3YA 4C0BA 3MWKA 3T34A 4ZV4A 5GJVC 4C0JA 3AB3A 1YZQA 4PC2A 4ZIRB 3ND9A 4TL6A 2PJRA 4EQ6A 2BMFA 4XWKA 1WXQA 2CE7A 3BOSA 3K9NA 3QVUA 4D4KA 3AKYA 3SJBA 1E0KA 3AF2A 4E03A 1KAGA 2IUUA 1NF3A 1KDTA 5J40A 1HQCA 4MUAA 1RW4A 4UNQA 2JAQA 5BYJA 1E6CA 1TF5A 1XMVA 1Z0DA 3OAAA 3RS2A 3SOPA 1E9AA 4EKDA 2CNWA 2IF0A 4PAQA 3SFZA 2B8TA 3U44B 3OIWA 2ZI3A 4ABYA 3WP1B 4AD8A 4WZ6A 4DJTA 4OHVA 2BBOA 3FMFA 2CE2X 5E3HA 2GJ9A 3VNVA 2VYFA 5TXGA 2ZSEA 4MA4A 4M1WA 1OFUX 5FI1B 2GXUA 2Q9BA 4A36A 1C9KA 3AV0B 1S96A 1S9DA 4U7DA 2AFHE 5BW8A 2IYWA 1KJZA 1SXJB 3VTKA 1XX6A 4B47A 2BBWA 2R6CA 4AK9A 2V55B 3AQ4A 4G5OA 4N3NA 2Q3FA 1L4UA 5E7MA 3SFVA 5JBQA 2VF8A 4URUR 1FUKA 1Z22A 2C04A 2FU5C 3W3AA 4DIDA 1H8EA 2WOJA 4ITRC 3DKVA 2OXRA 1XXHA 3CH4B 1VIAA 3SBDA 2UKDA 1E96A 3TQFA 4LC1A 3ZZTA 4UNPA 2F6RA 4YC7A 1XFAA 2VTKA 4LJ9A 3FHOA 4M1KA 4RZ3A 2LKCA 1IXZA 2GRJA 4BEJA 5K8TA 1IN4A 1O87A 3CX8A 1JR6A 4FN5A 1FMJA 1QF9A 4Q1EA 2CEAA 3ZS8A 2W2XA 1ZU4A 1NBME 3JZAA 2FJUA 4ZDKA 1MT0A 3HP1A 2Q0HA 4W5WA 4DSTA 5L3SA 3H1TA 1G3RA 2G0TA 2CCKA 1QHYA 4NBSA 1DAKA 4PSVA 1NY5A 5DYIA 3ZYCA 3I61A 2C8VA 3JVUA 4XOIA 5JWHA 4GOJA 2ZTSA 3D6TB 2IXFA 2JGNA 4CDGA 1R4AA 1NSFA 2OLJA 4QHYA 2FDCA 3MCAA 1AQYA 4V0KA 4Q7LA 3UG7A 4BLRA 4OI4A 4Z8XA 4A4DA 3LD9A 1NJFA 2HUPA 1OXVA 2HJVA 5L3SB 3FHTA 4IFBA 3TW8B 2PJZA 4L8GA 3ZIAA 2HT6A 3EA0A 2ZS7A 3IPXA 3K0AB 1DOAA 4QBIA 3K0EA 3U3JA 2EW1A 2NQ2C 4DT1A 4LBWA 4B35A 4MDEA 4JLDA 4QM7A 3HPRA 4YDSA 1FFHA 1P75A 4XVQA 3HU1A 2DPXA 1E1QA 2ZYWX 2BVNA 2W2VA 4P4TA 3EIQA 3LNCA 4JSYA 1JB1A 3RAPR 2AN9A 3KQUA 3TSZA 4EIWA 1B0UA 4JT4A 2GVZC 1HQYE 1E94E 4M21A 2VP2A 2CCGA 4F4IA 3GJ8A 1ZM3A 3DEFA 2ZITA 3A6PC 1W44A 3NHBA 5JI2E 2CCJA 3IBGA 3M0EA 1COWA 4F91B 3B8HA 3VU9B 1TPZA 2ZPTX 4QXAA 3LQQA 4JJKA 1G7SA 4NHOA 1KGDA 4LWZA 2PT7A 3AVQA 1AGRA 4DIEA 1W36C 1GNQA 3TMKA 4EDHA 1JXMA 2IEZA 1BOFA 5DN6D 1E0AA 1ZUIA 3ETLA 3PG5A 4B73A 4R2HA 4LDJA 1R2QA 3ONWA 3RYTC 1WBDA 2VBCA 3VKWA 3D8BA 4DVGA 1DTSA 2H17A 4BGDA 4NE2A 4RCZA 2ATXA 5FH9A 2JDID 4UKDA 2PZEA 2AL7A 1QHHB 3IO5A 2YOHA 1SGWA 2CLCX 2OILA 2QL6A 2ZI5A 1E9RA 1XMSA 3CLVA 3NEYA 3CUEF 3FOZA 4OK5A 3CZPA 4HLCA 3LY5A 2F9MA 2RGGA 4UXHA 3IQWA 2JLYA 2ZEJA 3UMFA 1B23P 1A4RA 4G0NA 3VKHA 5LB2A 4OQXA 4I1VA 1AZSC 1DG3A 4DCUA 3TNFA 4YMUA 4QNRA 1SVSA 1LS1A 2FPLA 3BFXA 4JBXA 4A2PA 5JJLA 1KJWA 1WF3A 1IXSB 2X77A 2VIIA 3P32A 4PC3A 4XWAA 2B7CA 2IYUA 4LHVA 3UMSA 4CEIB 4B3FX 1XXHB 3NH6A 3WMGA 1UAAA 1T9HA 4JLJA 4OHWA 2WSMA 2CLDX 4K46A 5BN4A 3AP1A 3QF7A 4IOMA 3AM1A 4BUJA 3KX2A 1CP2A 2WSSA 4HLUC 3MGCA 4RZ2A 3IUYA 4KFTA 1F5NA 2G1JA 5HKKD 2J0VA 1Z0IA 4RCYA 1T4GA 1E2HA 4U5XA 4FINA 4XSGA 4Q1DA 3RRZA 4BECA 2ZRGA 3VKGA 1CS4C 1UADA 2GJ8A 4QL3A 2A5GA 2XNDD 3MSXA 2CDNA 5AJZA 1GIAA 1UDWA 4BASA 1MOZA 2B7BA 2ZJAA 1GUAA 3IPYA 1Y3AA 4HZUB 4M2LA 3B5JA 1DAFA 1ZM2A 1Z2AA 2BKEA 1E2FA 1LTQA 4A8JA 1LB1B 3OFND 4BFSA 2DFKB 3W9YA 4LZZA 4YDHB 2ZRHA 3ASYA 1E2DA 2BEKA 2C98A 3I4LA 4NONA 2BEJA 3W6NA 4B34A 2V3CC 1JECA 5FFMA 2FMXA 5G40A 2JJ1A 1XJQA 2FEMA 3CPEA 3WHKA 4NYJR 3GLFE 3ZLJA 1KDOA 1JR3A 1G16A 2O8BA 5CJPA 4M9XA 2Z43A 3U4QA 1RIFA 2G83A 1GL6A 1XD8A 1Z6GA 3AEZA 1OHHD 1IQPA 4HAYA 2YZ2A 3C16C 5JS8A 2O8FB 2J0UA 2QRZA 3ND8A 1E2MA 1OHHA 4AURA 1JEDA 1KNXA 1D8TA 2YNMA 1SKYB 1K8RA 1SULA 2WKRA 1XCPA 4I1OA 4XWOA 2QEQA 4L16A 5H1YA 3THOA 4DZZA 1EFRD 3GLGE 3U44A 4QGFA 1JR3D 1SVIA 3SZRA 4FIDA 1VECA 1E1RD 4RD1A 1Z06A 1WBBA 1VHTA 3MLEA 3LA6A 3RS0A 2XEXA 121PA 1CBUA 5AJYA 4EFNA 5LDDC 4TYNA 2V7QD 3B6EA 3NVAA 1HT2E 2WJYA 4B43A 1T5IA 2ZYVX 3O8BA 5KDOA 4KO8A 1RJ9A 2QP4A 4KXFB 1E9CA 1Z2CA 2FEOA 2IA5A 1YR9A 5FR1A 1ZM9A 2ERXA 2RGXA 2WPDA 1Z3IX 3SHWA 5EZ6B 8OHMA 2ZI7A 2RGBA 2VQSA 3UG6A 2WWGA 3NEJA 3U7FB 4LV5B 1TAGA 2GKSA 4RD2A 5FPSA 2XNDA 2FFHA 2UVQA 2EWWA 1BYUA 5JWRA 3KXIA 5GVRA 2QNRA 3GLGB 4B2LA 1TU4A 4W5HA 3P26A 5F9HA 2JLVA 1JEEA 3FYHA 4X8MA 1DEKA 3T1QA 3X1WA 1ZUNB 1UEIA 2F55A 5EE1A 1YHNA 1NN1A 3LV8A 3U4QB 1OIXA 3THWB 1X8LA 3CR8A 2ZSBA 4YMVA 2P67A 1X8JA 1ZCBA 1E9FA 3LLUA 4D81A 3K0CC 3AVUA 521PA 4GBMA 2CK3D 5D3MA 1SVLA 4IVQA 5GVSA 1DAMA 2AWNA 3ZQJA 1IXRC 3QEOA 3RABA 3SE0A 2QT0A 4KYIB 2FFBA 1M7GA 3EG5A 1Z5ZA 5J4VA 1D5CA 4ERNA 3FKQA 2PL3A 1AIPA 1NBMA 2VF7A 1FP7A 1U98A 2C9CA 3BB1A 1E2NA 4W5JA 4JLAA 4C0HA 3SQXA 4QBHA 1VG1A 2YHSA 2WWIA 2QMOA 1J90A 2HYDA 2NO6A 5DH9A 3LVQE 4IJMA 4C0LA 4YXWA 1ZM7A 3KDSE 1D2NA 4GOKA 5EP1A 1NN0A 2OHFA 3M4YA 4GNKA 3N2EA 1R0ZA 4MQBA 1G5RA 2ZETA 5CITA 4XTRA 4D0LB 3BXZA 1C4OA 3AP2A 3LX5A 1W36D 3CRVA 2ZVQX 1CXZA 1OIVA 1DARA 2NZ8A 1FP6A 2GESA 1R8SA 2A30A 3P20A 4M1YA 3VAAA 1PV4A 4ZI2A 4TQAA 1EFHA 1QG4A 3E70C 4GI7A 4OI1A 3O47A 1QHGA 2WJJA 3IIJA 3CPJB 1TTTA 4D26A 1FMLA 1T3HA 3GLIA 1G6OA 1S8FA 1PLLA 1U2RA 2QN6A 2ZRAA 1D6JA 5AUQA 1U8YA 2D2FA 1XMIA 2H92A 2LWIA 2ZUCA 2G6BA 1AS0A 1A7JA 1XEXA 1DAEA
chains in the Genus database with same CATH superfamily
3MWJA 4Y6GB 1BDJA 3NDPA 2ZKIA 3PR2B 3Q1LA 2H1CA 2SKCA 2NZJA 3IAFA 3PGLA 5DCUA 3WIVA 1PJAA 1LZKA 4MYTA 1GV1A 3NOVA 3PHCA 4NNJA 1U5AA 1CX9B 3L0OA 1SHLA 2R62A 1A69A 2XYQA 4F12A 3DE7X 3WK5A 3DVAA 1O5TA 1GT6A 2BFPA 2WV7A 3GFRA 4HJRA 1UDAA 2X0EA 3V48A 4ICIA 1F48A 1Y5MA 2DT5A 3JQFA 4GL4A 4WN3A 3V42A 4LS3A 1I80A 1T8TA 2B36A 3L4EA 4DBVO 4WL0A 1GA6A 4J0DA 3T3OA 1CEYA 4PC6A 5KVAA 4P33A 2W2KB 3IDSA 4PLYA 2VHCA 721PA 4AMUA 3IAS1 2H4JA 4HXYA 3TQHA 2XJ4A 3BD7A 2FH5B 2XB6A 3GUZA 3HJRA 3ICVA 4QUHA 2YQ4A 2WMYA 3G23A 1FNNA 2PWAA 3FOEC 4LCBA 2B4AA 2VA8A 4Y7DA 5H0IA 1POWA 3FG9A 4IJQA 2G36A 4OM8A 1AMOA 3JQRA 3JAKA 4U2GA 4J43A 2NTYC 2WAOA 3GPLA 4BZXA 2ZZNA 5F1KA 3IQDB 2GWRA 1D6MA 4Q02A 3QYFA 4HAOA 4V24A 4DTIA 3GAAA 2JLAA 4JYMA 1IUNA 4N9QA 1OLXA 1PJLA 2PYDA 1S8NA 1MNAA 4DBLC 1W8DA 3GYBA 5JR3A 1APBA 4G4JA 2Y66A 4R3NA 1RXWA 4N5LA 1A88A 4ML3A 3IFSA 4MQFA 2NU6A 3OCVA 4B3GA 5KTNA 3I2KA 3U6BA 1CDEA 4NX2A 1U5CA 1IZ7A 3ZJ5A 5AK0A 5G0TA 3B2EA 1H0HA 3G1UA 3PC6A 3BTVA 4G8DA 1U9IC 4AP6A 4DLPA 1T25A 3GWGA 2G71A 2RGDA 4EH1A 4ZCIA 3K2BA 4JX8A 4BGUA 2PU5A 1UAGA 4BLPA 5ICEA 1MP0A 3DZ8A 4L15A 1U1EA 3TVTA 3UIEA 4QT4A 1R0CA 2R4QA 2RGNA 5AXAA 4YRIA 3HNPA 2ISSD 1JNXX 4YLYA 3TUJC 4TQUS 3GNLA 1EWYA 3FUTA 4X94A 4B3BA 2GJSA 4EAQA 5JMWA 3W2IA 1MA3A 3G9QA 4XA8A 2PZLA 3FKSD 5IRCD 2QTBA 1LUAA 5HKBA 5KJFA 4MWSA 1YU9A 1RHMA 3GJQA 2HTEA 2G3YA 3F6CA 1F17A 5LUAA 1CUZA 2EFYA 2FWPA 3CY6A 3DOUA 3UB2A 4FD3A 3SCZA 5BWCA 5IZCA 1OZGA 1C9NA 1QP0A 3QVWA 2ONYA 4MYUA 1I4DD 1WUIS 1IPEA 4QHTA 1PJBA 3EWAA 2D0IA 4KP7A 4EKYA 1L7PA 2E4VA 1QFXA 5FEMA 4HATA 1YHZA 4F56A 4QELA 3C5VA 5DT2A 4GT1A 1JE0A 4ZVKA 3NDBB 5KPDA 1MC1A 4DLZA 4P0QB 3VDNB 2Q5QA 1YZGA 3VPSA 1MENA 1TNDA 4BFXA 5LC1A 5IEBA 4E3WA 1Y3IA 4XAQA 5DMXA 1SCUA 3PCRB 2CFCA 3GFTA 4B7AA 1V39A 5EXTA 5ALVA 1UXHA 1Z34A 1OI7A 2JD2A 3ITDA 3INGA 1ZIOA 3OVMA 2XKAA 1IXYA 2MSLA 1GTSA 2Z83A 5GPBA 4DG5A 4JC8A 2Y68A 1Q3KA 3N05A 1JDVA 4QDXA 4PGAA 1AC5A 4WZAE 1E6EA 2I8LA 2QI9C 1WMFA 3OUTA 2IPOA 3FJ1A 1L2TA 3O4RA 1JT9A 1USKA 1E7WA 3FPFA 1WPXA 2O2EA 4YLGA 4ARZB 3OOEA 4Y2PA 3N2GA 1ND5A 1OI4A 4MS3A 3O7MA 1VJTA 4I7EA 4MKHA 2PR2A 3KYCB 1FPMA 4LE0A 4E5MA 3QXCA 1P62B 2OGUA 4OQQA 4W8GA 4YYEA 3BRWD 4LHEA 1QHFA 1DCFA 4EVQA 3FTFA 2GK4A 1X14A 3GLVA 4JJFA 5EQTA 4R1LA 2ZCJA 2NU6B 2HHHB 3PDIB 3ANTA 4NDAA 4U39A 2YN0A 1DS6A 1QQAA 4C2TA 4ACBA 4EJSB 2PX6A 1DLIA 1P8AA 3Q2KA 3JWIA 4RO0A 2ZSDA 4MW2A 4UBLA 5JFOA 3C8UA 1IJFA 1LNSA 3GMSA 1GAXA 1ESZA 1AO3A 1N6KA 1OLXB 1Y9AA 2EZ4A 1JDBC 3AH8A 4WH0A 4EA8A 4YRGA 4NV0A 2PGDA 1I2CA 4LHYA 1T0HB 2BPOA 4EYOA 3TE6A 1KMMA 1HDRA 2AS0A 1NAIA 1ZY2A 2D2EA 2NSDA 1OWOA 3GEIA 3HJUA 5TDHA 1VPWA 5EJIA 4HFJA 1E60A 2DJ5A 1T2EA 2RG7A 2PX4A 1UBEA 4CEJB 4QHSA 1DXYA 1QYCA 3OJCA 1MABB 5KNCA 2GCOB 1KORA 1SFRA 4KPUB 1NI3A 2ADOA 3EDOA 4TWRA 1NG1A 3D8TA 5AW6A 4DR1B 3GGCA 4RMHA 3KNZA 3X1KA 5AVQA 4FJ0A 3W2TA 4U4AA 1E7MA 4C4RA 2JD0A 2PKWA 1L4LA 1E2PA 4MQEA 2V1UA 3PGA1 1Q1AA 3ZGNA 4RJJA 1GEEA 1YZHA 5LPNA 1IN6A 3KRTA 1TKCA 1BXKA 4RTMA 2GZAA 1Z7YA 3MWGA 4PYMA 4WJKB 3RJMA 3X1YA 3A4VA 5GINE 4KR2A 3D64A 1THTA 3KOMA 3FY4A 4E2ZA 4HDAA 2OZPA 1Q91A 2WPDD 4ILKA 3PICA 1RZ3A 5ESDA 2H1WA 4UEKA 4BFWA 1ESCA 1G3MA 3WVNA 2VSNA 5KNBH 4LZNA 1GAJA 4J0EA 4EJ6A 3AM3A 3CZ4A 3OCUA 1P0CA 3OOHA 2GCIA 3BE6A 4GX5A 4JLNA 1M0TA 2J3LA 2WR8A 4U2BA 1ETUA 2WWXA 3PUWA 5H3LA 1OH6A 1OXSC 3QX9A 2O48X 4D8WA 1BXRB 4HUJA 4M8LA 4I8IA 4C6TB 3VR5A 3BWXA 3AJ8A 4I9UA 3G79A 4XQEA 1Z4IA 3IUBA 5FUYA 4FNMA 5IF3A 1A1VA 4H16A 3TLYA 2OO3A 4PN7A 3UWMA 1R9GA 1J8YF 3CCCA 1L4NA 4AJ4A 5IZCC 3BB3A 3AM5A 1RQPA 4FDMA 1REQB 4YRNA 1CUWA 4WACA 2WPNA 2J0QA 2ECKA 3DBHB 1G6Q1 3OZSA 1TM5E 2MSNA 1SG0A 3Q3GE 3O95A 4TLCA 4GDMA 2GR9A 3AJ9A 3PXEA 1QTIA 2VTEA 2YS7A 3LPCA 2G9QA 4NATA 1VHJA 3RU9A 4IKEA 3I9JA 1N7HA 4ENPA 5JS7A 1S2DA 2WU3A 1F14A 3Q9SA 4GYJA 5EJMA 2C4NA 2CYBA 3ZLTA 2O2CA 3O9VA 3DBLA 1JS1X 4R6XA 5IVHA 3UGKA 3IQEA 3JARA 4RTLA 2YMMA 3GLRA 3KFLA 4GKVA 1UZNA 3HR4A 4OMFG 1DKNA 5KTKA 3TECE 1I1OA 2QTGA 2EJCA 3WLNA 4EO4A 4JDPA 2UXBB 4ZYYA 2E0IA 1B41A 1Q21A 1C9DB 1EK6A 3WDSA 4DYVA 2I67A 1V11B 2OBLA 1FRFS 3I52A 2M1XA 1X1SA 5CT9A 3RS8A 3PJRA 4Q4CA 2OXCA 3REGA 1F7UA 3L46A 3GROA 3UH0A 2P5TB 4EJSC 2ZFUA 4JC5A 1XAHA 3IMKA 3X2SA 5AESA 4ITVA 1FTSA 3EWIA 2ZUUA 2NTVA 3MJTA 5IYZB 4V39A 4KQGA 3KUKA 1B3RA 2DX7A 4BVAA 1N2GA 3V7YA 1PF7E 2ZAOA 2NGRA 3AQIA 1RFGE 4MVJD 2FW9A 4J1SA 4ZT3A 2GN1A 4RA9A 3RU3A 4C7KA 2DGDA 2VCYA 3PHBE 4I5GA 3T9BA 2WHEA 1U1CA 4KLCA 5HM6A 3FOBA 3N86A 3NAZA 1W0KA 4RMGA 3ZXYA 2W2OA 1DEOA 1FXSA 2EU8A 1USUA 2AMFA 5FBZA 2ZUVA 1LLUA 3K6KA 3SP1A 3NIBA 4KN9S 5CK4A 4HOYA 1I01A 1CCWA 1MB0A 2QR2A 2QE7A 1WJGA 2IYOA 3TOCA 2O3TA 2BEWA 2R79A 4UUQA 2XCUA 5KCZA 1T1GA 1TKBA 3C70A 2UUBB 2XZTA 1ZCJA 1MC5A 2REXB 4NICA 1KXZA 1PJSA 3G2LA 2JGAA 3R5SA 4R8MA 3L0PA 4LHXA 1OROA 3KTAB 4PO9A 4PG8A 4ZHQF 3CEHA 4CU5A 4Y6RA 3WYAA 1GSIA 2YVKA 3U7IA 3R2JA 3W2HA 3ZU4A 4HV4A 3IOEA 2IOQA 2CLKB 1DKRA 5FPHA 4UCFA 4DOMA 1EJBA 3A6ZA 3LY8A 1Z45A 4E0BA 1J9GA 1PEDA 3U16A 1OLSB 2NUAA 1KY3A 2HHAA 3R0IA 4UZSA 2EP5A 1T24A 1QTQA 2LDBA 2PD4A 4WXPA 1D03A 3C4QA 1O8BA 1SCKA 4EW1A 4KX3A 4NYJQ 3T8YA 3TXXA 4OXKA 2Z30A 5K5EA 3A6JA 2VXYA 1NDUA 2Q6VA 3T5GA 4BY9E 2G0AA 4ZMSA 3IBYA 2H2GA 1C41A 1C8KA 3Q6MA 4FMDF 1MOPA 2FEKA 3Q0EA 3MRXA 2J9ZB 1KPHA 3MINA 4EQ6B 2ZJZA 4OHPA 1BWSA 3A1DA 3BL5A 5CCBA 3TLEA 3W2GA 4XCXA 5BVGA 1MO6A 5J23A 3L02A 1JDJA 4ZDWA 2CXTA 1U7WA 3NWPA 4X61A 2GA8A 4JL8A 4AN1A 1R9NA 4J16C 4D74A 4N3CA 1BCRA 1T2VA 5JSQA 3FJYA 5HR5A 4HQ0A 2JASA 3H11A 5CTJA 3WK6A 3DWFA 2XODA 3AOEA 3MD0A 1M34E 3GBVA 4GOND 4M0LA 1G98A 4BE9A 5IM4A 1UFQA 4DV4B 4ZI7A 2PCLA 4AMVA 3B20A 5HZKA 1SY7A 2JLSA 2RHHA 5IJAA 2DAPA 2A0YA 3A9SA 1SXJE 3QMVA 2DY1A 3LK6A 2HGSA 4PS0A 3AEQB 2EFCB 2YZGA 5BP7A 4AJNA 4P53A 1M8GA 5HWSA 3P5SA 5CD9A 5FWYA 5KOIA 1QHHA 4OUDA 4EA9A 3PNPA 1HDIA 4AJ9A 1BQEA 1R0XA 3ZOZA 4C0AC 1GAWA 3CBQA 4MWOA 1Y9DA 3CLSC 2DCUA 4IIDA 3C1UA 4WCFA 5EA2A 4CIYA 2ZRBA 3BA1A 2WFAA 4U2EA 1IUKA 1OH5A 4EUKA 4LISA 2CNKA 3ICOA 3KS9A 5EIBD 4G5SA 1N2CE 3WQSB 3Q7IA 2F9FA 4MRVA 4C30A 2IPXA 5K3EA 4REOA 4KQ6A 1RHRA 2UU9B 1AXRA 3D6HA 3R3VA 1PW7A 2IUTA 1KO7A 3A3KA 3ZDZB 5A9RA 1ZH8A 3PNBA 1OLOA 3VYWA 1JLHA 5DGDA 1IE3A 3OT1A 5DE3A 5BN3B 2XDYA 3TX2A 4YJHB 1NBWB 4YAOA 1N0IA 4HEJA 2FYTA 4WADA 4YCJA 3CURA 1X19A 3PHGA 3RYFA 2C88A 2IH4A 5CM8B 5AXBA 2Z3ZA 1Q7RA 3II6X 4UZEA 5THQA 3W79A 4F6RB 3Q9NA 4F9FA 2JIMA 4JZKA 4W5TA 1WZCA 1CY2A 4DMLA 1NBIA 2F7SA 2ZAIA 3FGNA 4DR7B 1BGWA 1DQRA 3U7JA 5JSZA 4E4RA 2R1VB 4EHLA 4EG1A 5IDWA 2AD1A 3JRNA 2IQ5A 1YQ9A 1H2WA 4HRVA 4LXHA 1OE0A 3RUEA 1IFXA 4ALKA 1RQXA 4QG3A 3ESYA 4NF2A 4NBVA 1GCGA 1XKTA 2HK8A 2V1XA 2W8ZA 1SC1A 4QOSA 4LW8A 3RFTA 2F9LA 1SXGA 3EAFA 3SNHA 1Z26A 3IXQA 1MB3A 4KN6A 4JKYA 1VCMA 3M4ZA 4P4SA 4CN8A 3QEMB 4FTWA 5EE0A 3HR7A 4I4TB 2XVMA 4RK5A 3THXA 3PQCA 4D9GA 3MBOA 5DGXA 3DZKA 3LSTA 2A88A 5KPJA 4K6HA 5GJBA 1ULBA 1UWVA 3CU5A 3PFCA 2HA2A 1LXCA 1E2UA 1FSFA 3ETEA 3MWDA 5I5GA 3RFCA 4P5EA 3RVJA 4RY0A 4WKOA 3R7AA 4OFBA 1LBHA 4WK4B 4DV1B 1UT6A 2NAFA 5JXJA 1TUBA 4CM1A 1X7WA 5KREA 3PDHA 2VHQA 4TXMA 3LZCA 2X5KO 5B3AA 1VPDA 4YV0A 2XW6A 3U3OA 5KDDA 1N2EA 3HTXA 1VSVA 3PXGA 2D3TA 1HE4A 3USZA 5K0LA 4DANA 1X8KA 2C59A 2G25A 3CZ5A 1P81A 4NP6A 4PPYA 1U8TA 4RHTA 5EKXA 3RTEA 3NEPX 3MQFA 4JI6B 4CQJA 5C4GB 5DTMA 3C3JA 2BLNA 3UA4A 1K7FB 4ZEVA 1T0JB 4QJ4A 3DJFA 3UK0A 3CXRA 4DM4A 5FIUA 2WIGA 3HV2A 3OHPA 3RUPA 4AT1A 1J09A 5FR2A 4NYMQ 1T3ZA 2NZYA 2O20A 3Q0TA 5ALLA 3V9AA 1QRTA 3JQ6A 5IDQA 8ATCA 1XQ9A 2J08A 3HBLA 4Q93A 1JG1A 3B52X 1JTEA 3EXHB 4MWEA 4YVFA 2BL4A 3EB9A 4KQMA 4RVSA 2RD2A 3B6JA 2R97A 4PLHA 1V5GA 3IERA 3DMDA 3NGLA 3NB0A 1WB9A 2P4UA 2BE9A 2Z9CA 1RPTA 3V1MA 2CJYA 4ZOAA 4DJFC 4E12A 4ESOA 2VOEA 4KYVA 3I6BA 2QMZA 3CGWA 3QPDA 4LTNA 2C2HA 2HWWA 5ITVA 2HBQA 1XD2B 3AIOA 4YT5A 4KG7A 1KQGA 1V95A 3FRJA 4C14A 3QVKA 3DV9A 1LDNA 2OZLA 2W6CX 3OZIA 4LYFA 3GGPA 3PPYA 1FRNA 3W1VA 1ZXLA 2G07A 1ENYA 1PS9A 1M7HA 4RXTA 3ID6C 1QYXA 3FF1A 4W7IA 3D4LA 1D1QA 3C43A 3S1AA 4ER3A 1QV7A 1FC0A 3T5MA 5CDGA 1JQKA 1A9PA 4FQ5A 3EZFA 1N6NA 3EPHA 5KSOA 3H99A 1XNRB 1L4KA 3RRJA 2BBTA 1N8KA 1L5HA 3U1TA 2OHHA 4EENA 3HXQA 1PKXA 2JS7A 1ST3A 2WD7B 4BMOB 2V98A 3GY0A 2O1WA 4E94A 4KUHA 2TMYA 5ESXA 3M81A 3E7FA 1UJCA 5FA8A 4QNMA 4XWYA 1TFUA 3AU8A 4B3SB 1PQPA 3GUVA 4OB6A 2VK8A 3ZDXB 3Q3HA 2C96A 2HYIC 2Q8NA 2R7KA 4C21A 4DW8A 1W0CA 2V3WA 5JPDA 1R0WA 1EJ2A 3K9WA 3U26A 3C7TA 4GX0A 5DSZA 3P9YA 1NBAA 2BI7A 1GRNA 2X22A 4XR9A 5CNIA 5F3RA 2C57A 4BJ6A 3K9QO 3R6WA 3OY2A 5BQ5A 3GBPA 4XI9A 3P9XA 1PU2A 1E3SA 2ES4A 5DNAA 4BX2A 4UTPA 4ZJUA 5AW7A 3DMPA 3K4QA 3IAAA 4QPNA 3GBSA 4WDQA 5LKRA 3QOWA 1E1MA 3M1LA 5KSZA 3NETA 4Y2QA 1LW7A 2V03A 4E31A 3B1WA 4LJAA 2I76A 5TF4A 4LOLA 1I4EB 3GGGA 1IHOA 4RHUA 1L7RA 3UK2A 1TJ5A 1BN6A 1CT9A 4RF5A 5HOQA 1WQ3A 2ZE6A 3ZHRA 4E2FA 2J6CA 3P4UA 3DE6X 4CLXA 1XHEA 1GPKA 4LRTB 1T2NA 4I3HA 3SJUA 4ZCMA 1XQ1A 3K0CA 2RGWA 1A9ZA 1TE2A 2PIDA 3VV3A 2IBTA 1TT5A 4EZEA 3G2QA 3ZVMA 1XTBA 2XMZA 3DXFA 3MJEA 4ZDJA 4DIBA 4RBNA 4OSPA 2ADMA 3K73O 2W6JD 3AKCA 4V3BA 3EULA 2C4VA 5CB4A 5JSYA 1CLUA 5EHIA 1BS9A 1N9ZA 2R84A 1QG2A 3TH5A 3RWBA 3R7WA 3YASA 1CRZA 3Q6IA 4BVFA 2FFRA 2P6UA 1GPMA 1A27A 3FIJA 1EFPA 1R15A 4EPXA 1G7RA 1NASA 4Q7KA 1VBKA 2OE2A 3F46A 4XVHA 2D3WA 3KL2A 4FMCB 1L5QA 3AF5A 4MVCA 3ZG6A 2X8AA 4YP0A 1T26A 5IT4A 2Z8YA 2GEUA 3BKWA 4JLOA 5IBQA 2QYSA 3VU3A 3DTYA 2WVJA 5LFAA 2GX6A 3HWRA 4LZLA 3VVLA 4FX2A 1CIJA 3NKFA 2FZGA 1ZC4A 2AOXA 2QRHA 4OJKA 2PWBA 5JISA 4NFSA 1XGKA 2OBNA 2GA9A 3FGZA 3KR0A 3K1JA 4ZC8A 3E82A 1SQ5A 2DTEA 2V0CA 4OHXA 1RRKA 5K3AA 2I3AA 3BH7A 1CQJB 3V2UA 3WRXC 5HQTA 1PD0A 4L7VA 5JD5A 1QGYA 1EFUA 3DAHA 4FDTA 5L3ZA 2OV6A 1TU3A 2WEKA 1V5WA 4FFVA 1RWWA 2NSHA 3CRNA 2JD1A 4HQKA 2XOKA 5H70A 5FTNA 2Z1MA 2WE7A 3DW1X 3QPBA 1HM5A 1NONA 6Q21A 1RRMA 4A10A 1NVTA 3DPUA 2PSSA 2ZYGA 2WV9A 3AVTA 3CKMA 1JKIA 4YI5A 2IOFA 1M66A 3CSDA 3NHUA 4CM8B 5EVJA 3UJ6A 3ZJYA 3RJ5A 2E5WA 1FA9A 3H97A 4UTOA 3A6FA 2VEOA 2YCLA 4QFDA 4U1RA 5EWJB 1ML3A 2FSIA 3GZ4A 1TLLA 1ZGZA 2P4QA 2QV7A 1F2UB 2VBGA 1KEPA 2PXXA 4UNIA 4Z1OA 4EF4A 5I8PA 1GR0A 3E5NA 3CJTA 3A1EA 3ETJA 1OBFO 2XQVA 4XWTA 5GGXA 1YRQA 3ZWVA 4YJ2A 1ZSNA 2BR3A 2BHLA 2WMOB 4ZZ1A 2YY7A 1HV8A 3N0VA 1Y1PA 4UAJA 4Y2UA 1FFDA 1DQZA 2R11A 2WVAA 3KR2A 1Z13A 3FNIA 1V45E 4AMBA 3D81A 4XKJA 1UC9A 5C8YA 1YDHA 3LBFA 5D00A 3S6JA 2QZ9A 2W58A 4ZYVA 1Y33E 1VMAA 3G82C 4LC9A 1SUDA 2FNAA 2REQA 1XL1A 2RHJA 3EXIB 3LO8A 3PFHA 2KPOA 4ZOBA 2P9ZA 1CUXA 3HUUA 4YP9A 3TDNA 4BB9A 1PFWA 2JGRA 1Y1LA 2QI9F 4FW8A 1VYVA 4MUFA 1H4VB 2BGLA 4LF6B 5M3BA 4DLUA 3S2EA 5I9BA 4B82A 1U99A 5CB6A 4ZQIA 5E6SB 5KOYA 4LMAA 3LTEA 3U5ZB 4JIGA 2PCJA 2WJWA 3UBTA 4OH7A 2H2AA 4P35A 4G5GA 4UVDA 5JSKA 2HZBA 1OD6A 2OV2A 2ODWA 5DGIA 2FRVA 2H9YA 3SC3A 1FNMA 2GN4A 2HXSA 1AA9A 3GA7A 4J76A 1A8SA 2CZCA 4FHDA 5ALEA 5A1TA 3FVRA 3RT7A 4QOIA 1PUXA 5HDBB 5K2OA 1WZNA 4NMHA 3WOVA 3UZUA 2VRCD 5KYWB 2QSUA 1Y37A 2AHOA 3UKJA 2VDQB 3KWLA 1SOAA 1UMDB 3M83A 3QTBA 2CLEB 3GV0A 4BV3A 1WLSA 1EWKA 2O5CA 2Q6LA 4NEQA 1YONA 2OP1A 2O07A 1BFUA 3NP7A 4NBUA 5F23A 4U8HA 1Q2XA 3BM5A 1J2JA 1VMIA 4ILEA 5D1NA 3V9PA 3VSCA 3ZY5A 1ADJA 2WE8A 1EVIA 4MQLA 1FVOA 4YRFA 1ZH0A 1KGSA 5LOVF 5LMNB 2JCYA 1VKRA 4G97A 4KRXA 4K03A 4EUHA 2E4ZA 3UOGA 4Q9HA 1OF1A 3B70A 1SOUA 3WWEA 2NVUA 3ZBTA 1Q1QA 5KC8A 5EKUA 1ACLA 4HD8A 1SVMA 1L1FA 1RDFA 5K7SA 4HWOA 5EC8A 2PLAA 4GRIA 3UHPA 3JRXA 3QWHA 1EFAA 5KU1A 4O2BB 2FEPA 3TQQA 4FHFA 2YJ4A 5JLAA 4IRMA 1T5LA 1IL0A 3LHDA 4YJ2B 4E3ZA 4QEZA 1E58A 3RADC 2QZ4A 1I4WA 3GELA 3JS5A 5BVHA 1P4AA 2XRZA 5I51A 2QZJA 1NNUA 1JXOA 1SUCA 4KIFA 2ZUFA 1GTVA 2HRDA 3ABOB 2RIRA 5FL3A 3PD1A 2F4NA 3DKPA 4R2KA 1YRAA 4P2BA 4RFVA 5D84A 3SXJA 4CTOA 4A6XA 1XELA 1CUEA 1WV1A 2QTHA 2WG0A 3V1TC 1KO8A 1IZZA 3BGDA 4OAPA 4LV6A 2XB2A 2Q3BA 1KMNA 2P8SA 3PUXA 1VL5A 1VRWA 1XCMA 2CBXA 4P3XA 4DJEC 1FZQA 1L4EA 2L17A 1E5TA 2HDWA 3I8XA 2PLNA 1NKVA 4IJ5A 1ADGA 3O93A 1Y6RA 1MNQA 1FMTA 2Q1YA 2C3YA 3C8DA 4JR2A 4I9GA 3H16A 3NPMA 3WXMA 4YRCA 3PRJA 1MG5A 2PQ6A 4BRSA 1V26A 2RGUA 3IO3A 3O73A 3OJFA 2CFTA 4TLMB 4MR7A 5G0SA 5HUQA 1GU7A 1P39A 3VV2A 1JZSA 2OAEA 4UXIA 4E15A 3U5TA 3THRA 3D8SA 1W5EA 3ZHYA 3U0VA 1O95D 5ER6A 1L8QA 5IAAA 5TPZA 4W5OA 4CDNA 1L7BA 3WWZA 4KL8S 3IKTA 4ZMBA 2B2XA 4I50F 1JKJA 1X15A 1ZD4A 1EHCA 3I73A 3BWBA 4G24A 4IS3A 2I9KA 4WZBB 1E3WB 3HPQA 5CDTA 1WCXA 1A77A 3P2JA 4IWYA 1HNWB 2YYZA 3HO1A 2NVOA 4C4ZA 4IJWA 4O2AA 3U39A 3T99A 2FEWB 1TZJA 2IVFA 1K5HA 2MWMA 1I51A 3PXCX 4LXGA 4RUKA 2Q2WA 3T9DA 3M6MD 5EPOA 2C31A 5A4DA 3WGTA 4KV9A 4D4MA 3UV7A 4G37A 3KYIB 3HU5A 4EUFA 3PRYA 4IYRA 4CTJA 2GARA 1P61B 2QD4A 4Q21A 4DQLA 3LXRA 5FPKA 1QE0A 1IJBA 1QYWA 3GJRA 4BVLA 2GPYA 4UQOA 2B3DA 2R7AA 3L49A 4Q1AA 5TQVA 2ZRLA 3FB1A 4F60A 5C53B 2GTIA 3KSMA 1ZW1A 4OY3A 5D6OA 4HB2A 4Y2XA 1U0JA 3HABA 3L82B 4MUNA 4HFMA 4O4HF 4TM8A 3X1DA 1WY5A 1GCIA 1QCYA 2Y6UA 3KXDA 5DN9A 2YDXA 1F0PA 2IL1A 4QJ5A 3A9RA 4L08A 5FD8A 1GARA 4Q48A 3ZHUA 2FMKA 1ZU5A 3F5SA 5EUMA 4JJIA 2H52A 3V8QA 1K08A 3SIXA 1V1JA 2JDIA 1CETA 2ZSHA 3DLHA 1C8VB 4DWJA 3RSQA 1P2SA 1ACMA 4CZ2A 3Q12A 1AUXA 2O8BB 2X2PA 2MSDB 4GPEA 5DW3A 3I2IA 4AKTA 1OPRA 3G9UA 4RD0A 3NS7A 1MT3A 1UKZA 1FYVA 1DIHA 1YR8A 2CSUA 2FAXA 2GF2A 3A1SA 3DHNA 4G1CA 3I72A 5IVIA 2ZJ7A 1UJBA 5F4BA 5HPYB 1XRMA 1COWD 4N39A 1SPBS 2CHFA 4V0SA 1E5XA 3UGQA 3WB0A 4JLPA 1X9HA 3GLHE 4W9NC 2ZVDA 5E4TA 1DX6A 3Q4GA 3NX4A 4TWJA 4A16A 2FN8A 2XCLA 2FQYA 1EZZA 2GVDC 1RCTE 3ECSA 2GUGA 5DBFA 2Z6QA 2Z6AA 1YE5A 5MDHA 1GTRA 3HCEA 2IXDA 3DM5A 1G9SA 4JAVC 3SXUB 2ZRIA 4MYHA 4QFBA 1VPLA 5CT5A 4TTJA 3AW8A 5K8VA 3NIWA 4OUDB 5L53A 1NURA 3R6DA 1X74A 4QVIA 1PZHA 3L8YA 3O9MA 1ZK1A 2OUIA 2ZIVB 1ZA2A 3M6FA 2MU1A 4K1XA 3C97A 1ULTA 3CIOA 3BICA 3QI2A 4NENA 4QD3A 1BX1A 3E53A 3LDGA 4TV8F 5FBWB 3S3TA 3A9TA 3ME5A 5LD2C 2ZB3A 3GJ5A 1JFFA 2QX8A 4Q9LA 2G82A 1GO2A 1NVFA 3KEFA 3V2IA 4YJFA 2IJGX 4GFDA 3RTDA 2GYYA 2JCVA 4HH0A 5BQPA 1U02A 3QELA 1NLMA 2FZWA 2EX1A 3O4JA 4J9VA 1DE0A 3I92A 5BPHA 2YXBA 4XUDA 4QO8A 4FOPA 1J7JA 1OBVA 3CG0A 2QRJA 4DUPA 3HU2A 1ZXXA 3OE4A 2EZTA 4IG4A 5HFJA 4RA6B 1SQSA 2FR8A 1Z08A 4RZSA 1H05A 2WWVD 4ZI7F 1TFRA 3C48A 4G25A 3MZ0A 1Q3HA 2W4QA 1V8PA 5G41A 2FLKA 4WOCA 2BFNA 3IAM1 5KNDH 2ISQA 4YCMA 1M6VA 1YBHA 2ZJBA 2ZRJA 4IUBS 1KERA 4ZV7A 1RC8A 1UUFA 2NZ2A 3RU2A 4KDCA 1ULUA 4RKQA 3SKYA 3I37X 1R50A 1KH1A 2G9ZA 4R3UC 3ZLVA 1BDHA 1OH7A 3FB4A 4UUAA 3IJRA 5KMGB 4RLHA 2X8LA 3FTNA 3K2EA 5HIIA 1KY4A 4TTQA 2XT0A 1U2QA 1FXUA 1WD7A 3GRAA 4HWKA 2YZMA 3TR0A 1AV7A 3DO6A 3D7MA 4KPYA 4UAUA 2JZCA 4F93B 3F6PA 4BNMA 4J90A 4L9AA 2ZRCA 4JK3A 3T1NA 1SZCA 2Q45A 5F7ZA 3X44A 1M2WA 1A0OA 2FA9A 3KWMA 3QY0A 1XZJA 2C4KA 3FPAA 2ZULA 3KM0A 4FYWA 4PGGA 4FYHA 2RH4A 4Y0AA 4ZJYA 3K4PA 5LSAA 3PWZA 4Q24A 3B60A 2R4UA 4JU9A 1GFWA 1OV4A 4ZRMA 3COSA 1PG2A 1NI4A 3I05A 5IKOA 2W4IA 1P5FA 3TRIA 1AB6A 1JJFA 1V5IA 2AV6A 3KTFA 4RHFA 5ALYA 1P6QA 1XZNA 1WP4A 4B3DA 1O6BA 1RPAA 1ONPA 2B37A 2P79A 1FXWA 3A8TA 3H11B 4XDGA 5FPTA 1LJUA 4E08A 4YGYA 5CBPA 1JHYA 2CXRA 4LKOA 1TCUA 3DKKA 4G23A 1Z5VA 4X85A 1KIMA 3R41A 1BX3A 2GBLC 1FBNA 1GKUB 2GASA 2I29A 5CRIA 2HNKA 2V9CA 1HE1C 2HY7A 2V4MA 4WVFA 2X5XA 3VPBA 1CQPA 1OX4A 2CV1A 4FPXA 3UW3A 1NMXA 2PBRA 1YVDA 3B1JA 5HMMA 4ZZ3A 2IY9A 4BOYA 2DP4E 2FX2A 2IUFA 5FBHA 5KWVA 2G4LA 4FOOA 1C3VA 5BURA 1FDOA 4ZQCB 2QJFA 4MVJP 2D2VA 4AYTA 3QE3A 3M6UA 4ND6A 1QNFA 3DLPX 3O9ZA 3OZTA 4HVTA 4L4XA 4LC0A 4N0PA 4NCNA 3KOZA 3V1LA 3WIUA 4JLUA 2VDUE 1JHRA 2HWUA 4YN3A 4KN5A 4M7WA 2HHJA 4IH9A 3JQGB 4YCNA 1RWMA 4FC7A 4O3MA 5BV8A 4W9NA 1TX4B 1UXGA 2P2DA 3ORHA 4ER5A 4AKGA 3U60B 4QLAA 1SRQA 3PL1A 3ROXA 4TTIA 4YBRA 2VC2B 1X80A 3U1VA 4DNFA 2ZGVA 2QROA 1N3YA 3DULA 5ERXA 5ENVA 4DJJA 3SOZA 4RACA 2GD1O 4MRSA 1YS2X 4IVPA 5INTA 4NNPA 3TSCA 1DJLA 5ELXA 1LWOA 2EZ8A 2PUTA 4C2BA 1LLFA 1ZKDA 3BFPA 1RXIA 3P2YA 4J2HA 4LQLA 3TD6A 1I0IA 1K7XB 2A2ZA 2HFJA 5EERA 3SD7A 4CPDA 1R3UA 1YKGA 5BNTA 2HLDA 2SICE 2BMDA 2JHCA 2QTVA 1RM3A 2X3UA 3D4IA 4K87A 4CV1A 5EHGA 1NKSA 1Z6AA 1QHNA 3Q10A 3G59A 4WTOA 1O94C 3FM9A 3U7GA 3FTCA 4TSFD 4E4TA 4IJKA 3T1HB 2Y1KA 3L8ZA 4M22A 1R0KA 4DLTA 4ENTA 5GM2A 4YUZA 1OFTA 3FNBA 2EOAA 1VRVA 4I6JA 1SBZA 4GOXA 3W6OA 5C1BA 3P0EA 1UJ4A 1VLQA 3Q98A 4L75A 4EHBA 2GTPA 4RK6A 1DMSA 2V7WA 6LDHA 1LDMA 5C1IA 2D59A 4B31A 4C5AA 3GAZA 1XTTA 4A9AA 3LZDA 2X6QA 3K09C 3IQGX 5K6AC 1H6DA 3FYUB 4IDGA 4AMZA 1EDZA 4R6WA 4R9NA 3L6RA 4FMBB 2BZGA 4S0ZA 1JEYB 4Z54A 1FW6A 2OAGA 2REBA 4U0KA 2HSDA 1PYDA 4G3XA 2YXNA 1ZM4A 3H18A 3MRSA 1C1DA 1Q0UA 1OGJA 2WB4A 1N5JA 3A6KA 2OR3A 2PHZA 1II8A 4NL4H 2XIJA 2WINI 3B3JA 3WO1A 4V0QA 3W5VA 3OY7A 3A6DA 3GGDA 3UPTA 2GAAA 1PDWA 4EKIA 1GPUA 1KNQA 4NDZA 1SCBA 4GM0A 3RNLA 2HQOA 4RELA 4IO0A 2C92A 1M2HA 4LAFA 2B1GA 3E35A 2O2SA 1NF9A 4YT2A 5F21A 1MC4A 3DZFA 3T1TA 1B8OA 2BISA 5ALGA 2GZMA 4TZKA 2IXTA 1XZGA 5IH3A 3N6XA 2P11A 1XB2A 1ORDA 4FLEA 4BFVA 4AG5A 3NAQA 1RPNA 1WHTB 4FDVA 3THYA 1VJDA 2D5AA 5IAJA 4F21A 3CC8A 1RKXA 3EK2A 4D0SA 3VI4B 4X63A 4QZVA 1DQPA 1S8AA 2XUJA 2IZ0A 3IBTA 1M76A 4QRHA 5JXIA 1TRKA 4JGGA 4GXQA 1GG5A 3Q8XB 4LF7B 5CA0A 3WWYA 2A5DA 4JA0A 1EVJA 1CHNA 4H0NA 1M7BA 1R16A 2GI4A 3BTSA 1OVMA 4OK3A 5TS2A 2O0MA 3WRXA 4BMCA 4LJSA 3WR5A 2BEVA 2F1IA 2WF7A 3RJTA 2Q2QA 4Y2RA 1VE6A 1WUYA 2X2OA 2RC5A 3C6XA 5HOEA 1TU0A 2NU9A 2NU7B 1EUZA 3EGCA 3QXHA 2VVTA 3SBOA 5B2FA 4L4UA 1X9IA 4EQZA 4RKWA 1R88A 5IBRA 2VTBB 5F77A 1JIXA 4XLZA 4G07A 4MV4A 2RCYA 4RV9A 3WL6A 4TXJA 1C0LA 3QV1A 3AI3A 2HDHA 4UTRA 2BHRA 4B3RB 4A26A 1I0ZA 2ZU6A 4WCVA 5KQMA 2FPMA 2P35A 3PNSA 2XPCA 3MTJA 1G20E 1HETA 4PWYA 3U62A 5COAA 3CF2A 3IV9A 3O3CA 3KZVA 5EXDA 1NLUA 4AC9A 3AR8A 5CGZA 2P1RA 4TWAA 5C51B 2YN4A 1WPQA 5BNFA 3L0IB 1GUDA 4UCXA 3M6AA 5KB3A 3H83A 1NW3A 2E4UA 5D7NA 5JCOA 2IGBA 4QYWA 4MS4A 5LJLA 1HNNA 2H65A 2R6R1 3REFA 1SRRA 2V7GA 3P97A 2P5YA 1P9RA 1U0NA 4LJYA 2TECE 4JR1A 2HNAA 1S2OA 1PZGA 3ZI4A 4DDMA 1SUAA 1LDGA 1ATIA 3SIPA 3WLIA 1F3LA 1Q3TA 2R1TB 2ZLBA 4N4AA 5AI8A 4KQKA 3WYGA 2FOIA 4GMHA 1B15A 3QQPA 1XVUA 4UHEA 2JL1A 5AHOA 5I7FA 2FPKA 3PB3A 4K9QA 3I9FA 1Z2DA 4PC7A 5JFGA 2HBZA 1M6YA 5EIWA 4TKVA 4AF7A 3R5XA 4F4UA 3C3WA 4OHFA 1C4KA