3PCRB

Structure of espg-arf6 complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EspG
publication title The assembly of a GTPase-kinase signalling complex by a bacterial catalytic scaffold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 40
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2010-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pcrB00
1CS4C 4JS0A 1Q0UA 4PQRA 3P26A 4D4MA 3AVTA 1SXJA 2NPIA 3F8TA 3X1WA 4DLXA 2XAUA 4MA4A 4UNPA 1KZGB 5CYOA 1HQCA 5C2JB 4QBGB 3AVPA 4MYUA 4TYQA 4GMDA 2YOHA 3RS2A 1XD2A 2QA5A 3BXZA 1X1SA 2VSXA 4KJZA 3I4LA 4CT5A 3RRNA 1G7RA 4DT1B 2J87A 2P5TB 2IYRA 4DDVA 1XF9A 2ZJ8A 4IOMA 4PAMA 4JBYA 3OZXA 4IRUB 3K0EA 2IWRA 3CLVA 3SYLA 3BK7A 4HLUC 3RVBA 2IYYA 2VP5A 1GL6A 1HA3A 4I1VA 1J8MF 3ASZA 4B71A 5L3QA 2IT1A 3WNBA 1XJQA 1JQJC 1X8LA 2GA8A 3AUYA 4JBWA 3NG1A 3EC2A 3R7WB 3T1OA 5IHPA 1D2EA 1JEDA 2WKQA 5EP1A 4B32A 1BMFD 3PUZA 2BMFA 3ZZ0A 3RS0A 3W9YA 1Q22A 4FI3C 3TQFA 3WMFA 1HV8A 3FKSD 3QKRB 2WIAA 3KJGA 4F93B 2G6BA 1ESNA 4MGYR 4GZMA 3RWOA 1JXMA 2IYUA 1QHHB 1TADA 1TUIA 4CGZA 1LVGA 3CRW1 3CH5A 3WYFA 2D74A 4DSNA 3WMGA 1TQDA 3C7KA 2WKPA 1E3MA 2I1QA 4B47A 1RW4A 4OQLA 2OILA 5KPJA 1OB5A 3E5HA 1JXOA 1RRPA 3HU3A 4MRNA 1OW3B 5HCNA 5TDHA 4BFSA 2GEDA 4D4LA 3TUIC 1NN3A 5F3WB 1VMAA 1E1QA 121PA 1EFUA 2ZYWX 2A5GA 1YZNA 4JLMA 3C15C 3B85A 3S1AB 4P0TA 3TJZA 4PC6A 2D06A 4YQFA 2FPKA 3ZIAA 5JECA 4LJYA 5FL7D 1G3MA 4YDHB 1CU1A 2KJQA 4UKDA 5DYIA 5KDOA 1COWD 2FSFA 1U8AA 1WCV1 1ZW6A 4N1AA 1QHNA 1XNJA 4XWOA 1XRJA 3ZD7A 2WSMA 3FDIA 5JSZB 1EWQA 2QAGA 1P9NA 3AKYA 4HAXA 3LNCA 1JR3A 4JIMA 1C9KA 1G9XA 1R7RA 3A58B 3T1QA 5IDVA 4JLBA 2GCNA 2CL7X 3LX8A 1OKKD 1P2TA 4OK6A 1G7TA 5IK2A 3RS5A 2P3SA 4G5GA 1Q20A 1OF1A 4CDGA 1IJFA 4LGMA 4V0MA 5SZHB 2CDNA 5TV2A 2HJVA 4NCKA 3VNVA 3UXMA 4TSFA 2P0EA 1T0JB 1S3SA 2ZRHA 4JL8A 1YU9A 1Z2CA 1CP2A 2WWFA 1XXHE 2CCJA 2VHCA 4BEBA 4C0BA 2IYXA 3PFIA 1SQ5A 2QZ4A 3SOPA 3TLXA 3MJHA 5FBLB 1QF9A 2CL0X 2CL6X 1MABB 1UKEA 2WPDD 4TMWA 4JSTA 1Z6XA 1S9HA 1ZM2A 3SYKA 1UBFA 1R0YA 3PQCA 1P73A 3A4NA 3U44A 4ZKDA 3E2IA 1Q1EA 1Q12A 5D3MB 1N6NA 3MLEA 4URXR 1VYTA 5AJZA 1GTVA 3F5FA 5EP3A 4GT1A 4BLSA 2HXYA 2QP3A 4PC7A 1Z07A 2N42A 2ORIA 3SBEA 1E94E 3V9PA 3DL0A 4C9BA 2A5FA 3AB3A 2G3YA 4DLWA 3QXHA 1NLZA 2ZJAA 2EVWX 3B8HA 3LLUA 2X2EA 4Q9KA 5FOWA 4BZQA 5F9FA 1U81A 1TQ6A 1CR2A 3M4YA 3Q5DA 1ZNXA 3VR4A 2QMUA 3A1UA 4PHHA 1II9A 5KDLA 4RJLA 2O0HA 1J7KA 1EG7A 2CMKA 3EXAA 2R6CA 1I2DA 3WP1B 1QG2A 3UMSA 1SXJB 2ZYTX 3Q9LA 1T6NA 3QPWA 4XSHA 4KAXA 4YONB 4A1FA 4BGDA 4Q66C 1QRAA 1JALA 2QSZA 1UDXA 1Z0FA 2O0KA 1S96A 1ZM9A 3M0EA 4DCUA 2MMCA 4TLAA 4OHYA 1UKZA 1Z63A 3X1YA 1CBUA 1XD2B 5ANRB 5JEEA 2WJYA 2ZU6A 1AZSC 2IXFA 1X86B 3FWYA 2W0MA 1RPZA 5EXSA 4IDPA 4BFTA 2IS1A 1VTKA 5E4FA 3FYHA 3EPHA 1OFIA 1PUIA 2W6ID 1YJ5A 1VPLA 1N5IA 1E9RA 5DIFA 2EFHB 2ZI4A 3CF6R 3R8FA 2BKUA 1P3JA 3LH5A 4S2EA 1KHTA 1LF0A 3IIMA 3QI2A 1XEXA 3KB1A 1EFRA 2ZE6A 1IXZA 4DCNA 3AVQA 1KSHA 4Q5IA 3OFNA 3OAAD 2HT1A 3U61B 3PUXA 1JPJA 3A1WA 4JVSB 4Y0VA 3AH8A 2AXPA 2BVNA 2ZE8A 3PIRA 1AZTA 4JMPA 2JLXA 4ACAA 4Q00A 1VCMA 4IOLA 2BWJA 4LY6A 1KZ7B 1IAQA 4XIGS 3ZVLA 3THWA 2RGCA 4AK9A 1Z0IA 1E2EA 4FW9A 4DBLC 1E2GA 1IJEA 1U9IC 2NO6A 3P27A 4PO8A 5FI0B 4DEYA 4D4JA 4ITRC 4QBFA 1JI0A 2ZYVX 4R9UC 1IN4A 1W2HA 5TMPA 1CIPA 2FG5A 3Q7QA 2WZQA 4JVMA 4PZYA 4PC2A 2F9MA 3KFXA 4ERNA 3GLFE 1G16A 2CNWD 5J4LA 3E70C 4XD7D 2PT5A 1T91A 2OCBA 1S1CA 5BW8A 2WOJA 5LD2C 4BASA 4HAYA 5H70A 2VHUA 4TT3D 2J59A 2Q6TA 5FFMA 3T1VA 1OE0A 2O8BA 1HUQA 3R9IA 2EU8A 1KOFA 4DDTA 1G7SA 2XGJA 4AC9A 4MKGA 1KNQA 4Z51A 1CR0A 5DI9A 2QAGB 4U00A 4HB0A 4K46A 4EAQA 2V4ZA 3N5CA 2F55A 2FMXA 2Z4SA 4A0HA 1E9BA 4DWJA 1W4CA 2JJ1D 3L8ZA 5B30A 5FTJA 3KJEA 4TYNA 3KQLA 1A2BA 2YWHA 1DBSA 1L8QA 3A1SA 5CJ2A 1ZVQA 3U7FB 4F4IA 1TMKA 1P5ZB 4A0FA 1B0UA 1RVDA 2OCYC 3IHWA 4MDEA 3CIOA 3UK6A 1AS3A 2JIZD 1KKMA 3FKSA 3RRZA 1ZM4A 3B1YA 3CR8A 2FSGA 4LBVA 4M1SA 1RC8A 3FMFA 2P65A 3ADCA 3L0SA 4B43A 4PSAA 3HYTA 4M21A 2OCAA 2VA8A 2XZOA 1Z2AA 3IBGA 5FOSA 3WBJA 3ZDQA 5J4KA 3QXCA 2PEYA 2QPTA 2JJ2D 4OI2A 5CM8B 1OXTA 2QTVB 1RRGA 4GL2A 2RCNA 3HU2A 4HUQA 3TKLA 4ILEA 1R2QA 1VECA 4A2QA 1T8TA 2ZU0C 4RCZA 4BRWA 2ERYA 1R10A 1Q1ZA 3GLIE 1OHHA 1XD9A 4LDJA 5DE3A 3MGCA 2ZS7A 3I92A 2DCUA 3TVTA 3U44B 3ZVMA 1W46A 1RYFA 3QF7A 3QE0A 3EARA 5KSYA 1E98A 1XTIA 1Z22A 4CIDA 4LBZA 1TF5A 2OEPA 2VP6A 4UJ5A 4CYMA 5L3VA 4HYYA 4MKIA 3WNDA 1COWA 3TVDA 4QJ3A 4ZCLA 4M1WA 4V02A 4HB2A 5FH9A 1UKVY 4C0LA 1G8GA 1LFDB 1QG4A 2ZRDA 3CH4B 1HEIA 4WZBE 2H16A 1AJEA 1E9AA 1CTQA 2J9RA 4RKEA 3KTAA 1SXJD 4NH0A 2GJ9A 1VCOA 3K70C 4LJ7A 4OI1A 3SJZA 4TL6A 3IUYA 2QBYA 4B3DA 1NVUQ 1P2SA 1VCIA 2G1JA 1CKEA 2ASEA 3FFBA 4IDOA 4OHZA 3VKHA 4XSGA 4MRRA 3ICQB 3OHMA 4EPXA 3AGPA 4DJTA 1TTTA 1ZNZA 1E0JA 5KHOC 2AKAB 3W6OA 1R6BX 2ZROA 3OE7D 1WQ1R 1UDWA 2F1JA 4B74A 1II8B 4ZDKA 4HDOB 2ZUDA 1XZPA 1QVAA 2G0NA 3G82C 4JVNA 1IXRC 4GP7A 4MH0R 3PXGA 5DN6D 2C98A 2B92A 4A2WA 4AURA 4GOXA 1W4RA 2FSHA 2VH5R 2CJWA 5CB6A 1H65A 1G1MA 2IF0A 2NO9A 2DFLA 3U60B 1IN6A 4B6EA 1OH7A 1AKYA 4E22A 1R0ZA 1K5GA 1PZNA 3PEVA 1DEKA 3RHFA 1PJRA 4DIDA 1VHLA 4HATA 4YXWD 3AP2A 1XEXB 3NDBB 4RD0A 1JNYA 4I1SA 4QBIA 4NHOA 1Z83A 4OKSA 2F43A 3D6TB 4PX9A 1ZM7A 1KI3A 2H18A 1QZXA 1CJTC 2AN9A 4JLAA 4LPSA 1ZNYA 1G18A 2NMVA 3CNLA 2WTUA 1Z28A 3DHWC 5CIWA 3ECCA 5LB2A 3DZDA 1KMHA 1X8JA 4XVRA 1R5BA 4IHQA 1DG3A 3THWB 1WRBA 2QP9X 2XTMA 2Z0MA 1Q44A 2BOVA 1Z0KA 3EC1A 2GXQA 3SQXA 3U7HB 3H84A 1E1QD 5EXXA 1WF3A 3Q3JB 4B6FA 4I4LA 2GWHA 4NZYA 4Q48A 5HZKA 3ZLJA 3LLMA 3K0FA 4U7DA 1KMQA 2KB0A 1XBTA 4D2IA 3MSXA 5GJCA 3HR8A 3PUYA 4FCTA 4OI4A 2X19A 5FTLA 3QIAA 3UG6A 3K0SA 1KGDA 2NQ2C 1P7CA 4G5OA 4YMTA 1YRAA 2WSSA 3RC8A 3GLHE 3CR7A 2ZXUA 2PEZA 2GVZC 2JCSA 4II7A 1XD8A 2Q0HA 4US0R 5FPSA 5BXQC 4DB4A 5CDFE 4M1OA 4NYIQ 4PFSA 1CRQA 1IN7A 3FTQA 1JR3D 3TW8B 3W8NA 5DISB 3KQHA 1FW6A 2O8BB 3M6AA 4PQFA 1LB1B 3CX8A 1XDBA 2OSBA 4D4KA 4EJSA 3VHXA 2PJZA 2BJWA 4A4DA 4N0DA 3LD9A 3CKLA 2J46A 3CW2A 3EWSA 4MYHA 4D25A 4C7OA 2J0VA 1KI1A 2ZANA 4R71A 4TSFD 1MOZA 2FPLA 3CNOA 2R8RA 2LKDA 3NH6A 1E0AA 1DE0A 2QU8A 3QOFA 4V0LA 1PLJA 5LB4A 1G64A 1L4UA 5HPYB 1WB9A 3A1TA 2FOLA 2WBLC 5JHHB 1GL9B 2ERXA 1FX0A 2QPOA 4UXJA 3RS7A 4NPHA 3OIVA 2D2EA 3WRXC 2VIIA 2P2LA 2PCJA 2VRWA 4FMDB 4KODA 4YC7A 2ZSFA 3VKWA 1PLKA 3NXSA 5CLQA 2D7CA 3BFXA 2QT1A 1M2OB 2F6RA 2Q21A 3BD9A 4GOJA 1W36B 3AKEA 1VG9B 3OIYA 5AUOB 1MKYA 2ZUCA 3GQBA 5JLJA 3NDPA 4LSGA 4PPQA 3A4MA 5JRZA 1OFTA 4RD2A 3N2EA 4PHTA 2NZ8A 3I73A 4BLTA 4HUQB 4B2LA 4ZI3A 4C0HA 1CJMA 2NGRA 5DHAA 1KO7A 1ZNWA 2CLDX 1CRPA 1PV4A 5A5GA 1NVVQ 2BEKA 2XTNA 4FXPA 4PO9A 1MO3A 1RRFA 1DADA 4WZ6A 4XD7A 3KQNA 2W83A 4BFWA 3X2SA 5CB8A 1EX7A 2JLZA 1SHZA 2P67A 4TT3A 4LUCA 4NE2A 5AUQA 5FUYA 1W0JD 2RKOA 1CEEA 5BWMA 5DH9A 3GEEA 3UKDA 3EA5A 1E69A 3L2OB 2XB4A 2PZFA 4QM6A 3TH5A 3NBYC 4Q19A 5TXGA 2ZUBA 2BM0A 3MG9A 4Q7KA 5C18A 2ZREA 2C2HA 4PC1A 5KSOA 1ZU5A 2ZM5A 5HTKA 5KU1A 3KX2A 3KTAB 1IOZA 1HYQA 2RMKA 4HLUA 5TY0A 4A6XA 3DDCA 1OYWA 2KBEA 4M53A 3C41J 4W9MC 2QE7A 1FPMA 4WZAE 2QBYB 2YWFA 4IVRA 5JWOA 2QTHA 1E9CA 3FHTA 1NF3A 1Y3AA 1OYYA 3AP1A 2V55B 2VF8A 5B2ZA 5KO2A 3JVUA 4H9GA 3VKGA 1F5NA 2ANCA 4BEJA 2JIZA 1P6XA 4KO8A 4JT2A 2RAPA 1OPXA 2JA1A 1DAEA 1JJVA 4QM7A 4URYR 4DVGA 2Z4RA 3QKSA 3NC0C 1T5IA 4G1UC 3W6NA 4Q4HA 3SEAA 1G8FA 3CZPA 4LPKA 3RNLA 2CJWB 3UWOA 2RGDA 2QAJA 3FE2A 2PZEA 1L7VC 1EFRD 3BH6A 5TB5A 1N5LA 4JYBA 3U4QA 2FN4A 1HE8B 2G0TA 3MJRA 3OFND 4OQNA 2IBMA 4LC1A 5K8UA 2AHOA 3BH0A 1G41A 4TTRA 3TAHA 4KYUA 2CVFA 2NIPA 4JJKA 1ZCAA 1G20E 2QNRA 2DB3A 5GVSA 2F43B 2O0JA 1T3LA 2WWIA 2OBMA 3U3RA 5JJIA 5AR1A 2IWHA 2IW3A 2QL6A 3TUZC 1KI7A 4JVLA 3SU8A 3HPQA 4O2LA 5EZ5A 2NPFA 3PCRB 3SE0A 2X2FA 2P6UA 3U3JA 3W6PA 1KMHB 2RGNC 2FDCA 3EZ6A 3OIUA 2HCBA 2ATVA 3SFVA 2KBFA 1E2NA 1VYUA 1S4QA 2WJJA 5C46F 2QENA 1YZKA 4GZLA 3ZZUA 3K0FB 1C4OA 4L4UA 1GNRA 2V7QD 3CPEA 2OUKA 1WBBA 4KHZA 1SKYE 5FTNA 3QSYA 2ATXA 3CRVA 2WJGA 5HE9A 3BFVA 3IIJA 2A78A 3OE7A 4NBSA 2BHRA 3DMDA 3W90A 3GFTA 3GMTA 1WBDA 1EK0A 1KKLA 1G5TA 2QGZA 5DN6A 4MKFA 1MV5A 4P33A 2PH1A 3AEZA 4EJSB 4K81B 1N6LA 2ZRJA 3LV8A 1OH6A 3PUVA 5IF9A 2C9YA 2HLDD 3HYRA 5EE5B 4C7OB 3CRRA 3BORA 5FL3A 5EE1A 1Z6GA 5H68A 3MD0A 4YXWA 1W2GA 2WM9B 4DLUA 4C4PA 4DZZA 1IHUA 1NN0A 2F1IA 4DSUA 1BH2A 2Z6VA 5GJWC 1FX0B 3CONA 1K5DA 1W36D 4MRPA 1KY2A 1XZQA 2CE2X 2OAQ1 3T5DA 4TYWA 1XTQA 4WVFA 1UBCA 4B2PA 4B34A 1EWRA 2EFCB 2YOGA 3A36A 3SR0A 3LXXA 2QTFA 2V6IA 3NIBA 3UMRA 4DLYA 2O8CA 4Q9LA 2V8OA 4A6PA 3PITA 1AIPA 4HB4A 4KSCA 4DLZA 3W3AA 3FMIA 3B2EA 2J45A 1IM2A 4QGGA 2R6FA 2IS6A 1OHHD 2BDTA 2ZS9A 2RHMA 5FR1A 3BWDD 3TE6A 2YC4C 2F7SA 4I1UA 1U8YA 3DOEA 2YNMA 1TEXA 2C77A 2IS2A 2ZVQX 5FPHA 1KJZA 3TSZA 3ND9A 4GI7A 5J40A 3K09C 2ONJA 4IXMA 3T06B 3LVRE 3WRYC 1FTSA 1EGAA 4A8JC 2OLKA 3QPUA 1HURA 2GZDA 4D0NA 4FMBB 1P62B 5BYJA 1GP2A 4RD4A 1XEFA 1FP7A 3Q85A 3RC3A 1E1RA 1IN8A 4M1MA 5FR2A 5DI3B 1YRBA 1OIVA 1D5CA 3CX6A 4Q9HA 5FI1B 4BPBA 3PUWA 4FINA 2R62A 4MRSA 2H5EA 4V0NA 3ZZTA 4ZI2A 5KTYA 1NRJB 1D2NA 2GEVA 4ZO4A 2D2FA 2REXB 4NU0A 1DAKA 2JDID 2UZIR 3BERA 3REGA 4C2UA 1OB2A 3NEJA 1Z08A 1W44A 3EG5A 3GLHA 3IBYA 2FGJA 4D6PA 1EFCA 4Z1MA 2DY1A 5CDFA 4Q7MB 4CZ2A 1JB1A 5JZVA 2FF7A 1E32A 2P6NA 2H7VA 2GCOA 2EYQA 3O8BA 1OLOA 3VR5A 1XPOA 4HAWA 1EX6A 1KIMA 5FBQB 3AM1A 4G01B 4EIWA 2NZJA 4HAZA 4KU4A 2N46A 4UNQA 4DIEA 2XZLA 5AJWA 3SBDA 5DNYB 2G88A 1VG8A 2VSOA 2FWRA 2WJHA 1DS6A 4PZLA 1GUAA 3QKSB 5BN3A 1G21E 4Q01A 3GP8A 4Q4HB 2WICA 1U9IA 4P3YA 5GADl 2IS4A 1N6KA 3SJBA 3DO6A 3C5HA 1NSFA 5B57C 1J8YF 4GOKA 1YZQA 3U4QB 1VDZA 1QHXA 4M22A 3K9NA 5L3SA 4D0LB 1PLLA 5J4HA 1VG1A 2CE7A 4EFMA 1WA5A 3V4FA 1XCMA 2ZJBA 1KK2A 4NYMQ 4OHXA 1W0JA 2ZRMA 3UANA 5HR5A 1ZIPA 5DYGA 2WWYA 3O47A 2IEYA 2ZJOA 3WXMA 3EWAA 1KNXA 4L9WA 3QJYA 1Z8FA 1UBGA 4FCVA 3TSWA 2A9KA 2X77A 2ZRKA 4NCJA 5IRCD 1NY6A 3Q5EA 4LJ8A 5CM9C 2NO0A 3H86A 5FOTA 3WYAA 3ZVNA 1LW7A 1FTNA 2FZLA 2C03A 2IK8A 2WSSD 4OHWA 2C95A 2HEIA 5KSPA 3GLGA 1G3RA 1Q1BA 3KXKA 4KVAA 2YINC 1T4GA 1XPUA 1AN0A 3K53A 4MGKR 1SZPA 5EUMA 3B9PA 3AF3A 3GJ5A 3TW4A 4ZDJA 2OG2A 4ZKEA 1KI8A 2ZI9A 4A2PA 3I8XA 4DXAA 2IF2A 2GK7A 5LPNA 1RJ9A 4LV5B 2OM2A 4QJ5A 5EP2A 1D8TA 2GXAA 4LHZA 2LCFA 4BFVA 4NYJQ 3KXLA 3RSLA 2IYZA 1FP6A 3FMOB 1ZCBA 2ZJYA 2V54A 1G3UA 1J70A 4PAOA 5L3QB 5FTMA 2QMEA 2ODNA 1VYVA 3I1FA 4QNMA 1JEEA 3QVUA 1IBRA 1ANKA 2VYFA 1AM4D 2IX3A 1NI3A 4LJ9A 1KK3A 1ZJ6A 1CF4A 3U6BA 4ON9A 4M9SA 6Q21A 3FFAA 1QHYA 1P60A 2F1HA 3WMEA 2YV5A 4Q1FA 4QXAA 1FUUA 3EZFA 2CHGA 4MGIR 3KJIA 1FQKA 4Q1BA 2NOAA 2RGEA 2YOFA 4QG7A 5B64A 3AVYA 2B8TA 3CWZA 4AG6A 1DO2A 5FTKA 2O8CB 1DARA 4K8OA 4QJ4A 4TLEA 4TLDA 3VFDA 1RE0A 2V9PA 4YMUA 4GDFA 2QEQA 1NG1A 2W2XA 4Q02A 2GJ8A 1N0VC 5JEDA 3C8UA 4L9SA 5J4VA 2VP4A 2ZE7A 4CEHA 1GAJA 5E7IA 5TVKA 3TNFA 1H8HD 4ASUA 1OIXA 4LHXA 3IEVA 1K6MA 2YWGA 4ZDWA 3B13B 2VP0A 3GPLA 3AVVA 3FHCB 4BUJA 1YVDA 2QORA 1R8QA 5AWFC 2V7QA 2C04A 4OYHA 4A0RA 2ODEA 5M04A 2RGGA 1KI2A 1P9RA 1FOEB 3T5GA 2J5XA 1L2TA 4R2IA 5E7JA 2VTKA 4HLQB 5AK0A 2E9SA 4IOJA 4OQFA 2D4HA 2AK2A 4TTQA 3AF0A 2WVJA 5JJLA 1I4DD 4PSVA 5KNBA 2E87A 3AGQA 3LO5A 1JR6A 5DGXA 5FBWB 4AKEA 1E2LA 4IVQA 1BO6A 2GF9A 4KXFB 1SVIA 3BB3A 4AIIA 2PMKA 2QE7D 4QGAA 3W8RA 4F7WA 5KNCA 1E99A 4CF7A 4KITB 2ZETA 3PEUA 2HLDA 1MR3F 3GLHB 4LHYA 1GRRA 3ADKA 4HEJA 4Q9IA 4YMWA 3U5ZB 2Y8EA 2A30A 4FCWA 2JLUA 4NCIA 4ACBA 4TMKA 4BFXA 1KK1A 2A5YB 4GBMA 4AKIA 4IFBA 1ONBA 2GCOB 4O0MA 5EZ6B 1EESA 2JLWA 4EPRA 4E07A 1VHTA 4L5BA 1NIPA 1CJVC 1S9DA 3BC1A 3D7MA 2XITA 3CRMA 2WKRA 1U8ZA 2FSIA 2ZRAA 4P4TA 1KI9A 1KK0A 1VCNA 3SI7A 1T0HB 4C0KA 3L43A 3VR3A 3I8SA 1N6PA 1ODFA 4AD8A 1QDEA 3KKMA 4W5JA 3AVOA 3AUXA 4NMMA 3QG1A 4PZZA 1IN5A 1XTKA 1ZMXA 2EFGA 3KKNA 3ADDA 2ZI3A 3ZQJA 2VO1A 2GILA 1HTWA 2JLSA 2H17A 1CLUA 3OF5A 1NNEA 1RRCA 3LFUA 1Z29A 2EQBA 2J7KA 1OH8A 2GAAA 2VP2A 1RIFA 2ZRLA 3REFA 1N6IA 5CK4A 4L8GA 2C8VA 3SC3A 1DO0A 1R4AA 5L3SB 4DKXA 4QGFA 5E7MA 3B7GA 3OEHA 2HF8A 3CZQA 1SVLA 4E03A 4LOAA 3TR0A 1FZQA 5LD2B 3P32A 1FMLA 3LRPA 5LDDC 5AJVB 5JS7A 1QHGA 4R2HA 2R9VA 1KJYA 2YVUA 3TIFA 4LYFA 1U94A 3BIFA 4A36A 1SGWA 4C0QC 2J7PD 1MRNA 5CITA 3C16C 2YC2C 2HYIC 2AL7A 3L0IB 2VQSA 4UJ3A 1N0UA 3T1TA 3PJRA 1CR1A 1HY3A 4TMVA 1Z6TA 5CJPA 3TK1A 1F2UA 4PANA 2VSFA 1SVMA 5DSZA 3I62A 2ZRPA 1W1WA 1SVKA 1YZTA 2QQEA 2JDIA 2VHQA 3K1JA 3FOZA 4CRWB 4NYIR 2ZAMA 1ZD1A 1KAOA 1VIAA 1XMVA 3JVVA 4JBXA 3UWKA 1TQ2A 4HUTA 4DDWA 2F3RA 4G5RA 2ODWA 3EA0A 5FPYA 1S3GA 1W48A 3GLGB 3LWNA 2I4IA 1E96A 1KO5A 2R6DA 1WP9A 4HDCA 1XTRA 2GESA 2PCLA 2EW1A 1UADA 2FA9A 2JASA 1ZUHA 4XH9B 2ZR9A 2ZSEA 3WY9A 4D26A 3R9XA 5FPTA 4M9QA 4IEEA 3VR2A 1X1RA 1Z47A 1OFUX 4JYCA 4C30A 1P2VA 3NH9A 4JLJA 1AKEA 1RJ9B 1ZC4A 2WMNB 2ZSDA 2TMKA 3PENA 5EP4A 5AUNB 1G291 2HJGA 3EAQA 4HI0E 3IDQA 1S2MA 1IY0A 3ASYA 1NBME 2DBYA 1Z0AA 3KQKA 3HPRA 4B3BA 4US2R 4LWZA 4DSOA 1T8UA 4GP6A 1XXHA 1WXQA 1CR4A 2WAYA 1OXUA 2I1VB 4OQXA 3NHAA 3NBZC 4B73A 4BLOA 1DAHA 2J3EA 2PX3A 2D7DA 3RDPA 3RSOA 2ZAOA 1BYUA 3EIHA 1QHSA 3CF0A 1HT2E 1NBMD 2AKYA 4DCVA 4EPWA 4LV8B 4UNSA 5EXTA 4ESHA 2JLQA 4PSKA 2RGXA 2WWHA 1OT3A 1TU4A 2CHQA 3FPAA 4BE7B 3A1VA 2GNOA 2YHSA 2QRNA 1AA9A 3PEYA 3DMNA 4WA7A 4Q4JA 3K8YA 4WBSA 1DAMA 5L3RA 2IYQA 4B35A 4MGZR 3EPJA 5FOXA 1NVVR 2J1LA 3LXRA 3VR6A 2AFIE 2QI9C 2AX4A 2XOKD 4KFUA 4D82A 3HDTA 3KDSE 2QROA 4RFSA 2WHXA 1YKSA 2ZR7A 1OH5A 1W0KD 3T12A 3T35A 4URUR 3LW8A 1NKSA 5SZIA 4CEHB 5FUXA 2GEUA 3SDZA 4DLSA 3K70B 3CF2A 4NKRA 1E2MA 2QY9A 4XJXA 1KDPA 4YDSA 1ZU4A 2J0SA 2BKEA 2IC5A 2QM7A 1R0WA 2VEDA 4JJZA 4TL9A 3W5IA 1E1RD 2IYSA 4JSYA 3TBKA 5G40A 2XB2A 1GZSA 3RABA 4I99A 4B3XA 2FX3A 1KSJA 1UM8A 5A4JA 4LI0A 1K8RA 1R8SA 4UXHA 2GTPA 3DM9B 2XNDA 4UXIA 1SULA 5BN4A 3ONWA 1II0A 1XB2A 4KFTA 4XOIA 3BOSA 1P75A 4Z1MD 2MMGA 5AJYA 1XJ0A 1LS1A 2MSCB 3QKTA 2BC9A 5HE8A 4LC0A 1HH4A 3NVAA 2GVDC 3B60A 1A4RA 1SKYB 1U0HC 3QENA 3QF4A 5H1YA 3SYNA 4UNRA 3L0OA 2FGKA 3H0KA 4OK3A 4X8OA 5CLLA 2JLVA 4JZKA 3LBHA 3IHLA 1KDOA 4AG5A 4V0KA 2VP9A 1GKYA 5HKKA 4Q1AA 3L82B 4PTLA 2GF0A 4Q7JB 4F4CA 2VBCA 4V03A 2I3BA 4PXAA 5SZKB 4URWR 3KUDA 2CVHA 2FEMA 4RVCA 2H57A 3GFOA 3AVUA 1GIAA 2QN6A 2XEXA 2OBLA 2JGNA 4US1R 3RS4A 1E2JA 3IIKA 4LRWA 3ZS8A 1FNMA 3GJ6A 4B2IA 4UQOA 2ZJ2A 3FKQA 4YMVA 1Z06A 2REBA 2FFHA 2WWWA 3ZGXA 1ZC3A 1M7GA 2RGNA 1M6NA 1Q21A 2DFKB 4L16A 3DVLA 5A0FA 4TYYA 1CXZA 4Z8XA 1F48A 4A82A 4EPTA 4DLVA 1H8HA 3U3OA 3V4RA 2XZPA 2FE4A 1OXVA 1OXXK 3IKJA 4KBGA 5EE0A 2QSYA 4EKDA 3U7GA 1G3IA 4TZ0A 4X8HA 3PEWA 2OT3B 1XU4A 5DO9A 3SNHA 3CPJB 2O8FA 4RCYA 3CBQA 3MMPA 4FIDA 4JLOA 2P5SA 1G8HA 3EPKA 2FU5C 1E0SA 2FPMA 2ZE5A 3GLFA 3MWJA 5CK5A 1FUKA 1CJUC 1GRQA 1WE2A 1XMJA 1XTSA 2ZR0A 3GJ0A 3JZMA 3R9WA 4G3XA 1ZUNB 1G7CA 3L8YA 1E2IA 1Q1QA 2OBNA 1KYIA 1F2UB 1ZIOA 2BCGY 2UKDA 1T5LA 4DC9A 4WXRA 4QHYA 1US8A 3TQCA 3K9HA 1X8KA 1ZRHA 4M4SA 3QXSA 4OJQA 2GCPA 4W7SA 5KDDA 3RRYA 3ND8A 1R0XA 3QY0A 821PA 4C2TA 3CO5A 2ZI6A 3KFVA 5FOVA 1E4YA 1LV7A 4MYTA 4MUAA 1D9XA 4HDQB 3LQQA 3LY5A 1NMYA 4F4JA 1MRSA 1U0JA 3U2QA 3AVWA 1UAAA 3IO5A 4BQSA 2PBRA 4B33A 3MFYA 1F3OA 5GJVC 1JAIA 3VTKA 3ZD6A 1KAGA 1KDTA 5ELXA 4AI6A 3ZS9A 2IXEA 1XXHB 3O8CA 5TARA 5FOUA 3WNCA 3B1VA 1XCGB 2IUTA 2OHFA 3BBPA 3K09A 4ESVA 4POAA 4CW7A 3G0HA 2ANBA 1E2PA 4M0LA 4A8JA 2W6JA 4N0EA 1NN1A 4LJAA 2J41A 1KJWA 1YQTA 2B7CA 4AY2A 2ZSBA 4P4UA 5UKDA 5JWHA 1I4TD 1EXMA 3I72A 3BB1A 2V6JA 3X1ZA 1H8EA 3DPUA 1R5OA 3GLIA 4HAVA 3B1WA 4Q4JB 3O8RA 2OFWA 4TN1A 1RYHA 2J0UA 4XTRA 1PUJA 2PL3A 2J7PA 3AF2A 1OJLA 2AD1A 2QP4A 3PV0A 4G5SA 4TTPA 1Z5ZA 4ASUD 3QEOA 3K70D 3SFZA 2V1XA 1V43A 2A7QA 1F60A 3BRWD 4RFSB 1BS1A 3B5JA 3WP0A 2O8DA 1PVOA 4HB3A 1ZUIA 4W5WA 5GJBA 1NLYA 4IVPA 1GDDA 1O3YA 2EFEB 3CPHA 3EZ2A 3VR1A 4F91B 4KCGA 2BIFA 3SHFA 4TQAA 3LX5A 3K0CC 2VHJA 4DUGA 5JMTA 2HF9A 2W2VA 4RFVA 1W49A 1J99A 2HUPA 1G4UR 1G6HA 2OZEA 4IDNA 8OHMA 4KBFA 1OFHA 4EFLA 1IY2A 1OSNA 1B23P 1XPRA 3DOFA 4JKYA 5HZHA 3Q72A 3D8BA 2GDJA 1AGRA 2ZRCA 5KSZA 2BBTA 1DPFA 2ZJZA 2IYVA 2J0QA 3THYA 1ZD8A 3QF4B 4AYWA 1VKJA 2F1RA 3K0AA 4LYJA 2LWIA 3QNUA 2CXXA 3RRMA 2AFHE 3BFKA 1I4LD 1GVNB 4QL3A 1KO4A 1NBMA 3KJHA 4JLPA 1WMSA 4JKIA 3C5CA 3QUSA 5G41A 2WJVA 2YYZA 2W0SA 4B75A 3CRQA 221PA 2G9NA 1UKYA 1FNNA 3H4MA 2V3CC 1E79D 4D81A 5F2EA 2XTZA 3EX7C 2XNSA 4GRAA 1YE8A 3OIWA 3TR5A 2XOKA 3ETLA 4Q4AA 2CK3A 4B3GA 2DHRA 2H1LA 1MT0A 1UF9A 3DZ8A 1D6JA 2RB4A 4E09A 4M8NE 3HP1A 621PA 4AKHA 1ELOA 5JCPA 2L0XA 1AQUA 5DLQC 3BGWA 3ADBA 4NYMR 1W0KA 5EXPA 1OV4A 5K8IA 5B58C 5IT5A 4ABYA 3MRSA 3OEHD 4O2RA 3U6KA 4C0AC 2XXAA 1ZP6A 1GNQA 1Z6AA 2HT6A 1L4YA 3OEEA 3GJ8A 2JEOA 1BYIA 2WJIA 3EIEA 3F3YA 4EPVA 4ZIRA 1DVRA 1X3SA 2ZRIA 3EASA 4BZXA 3IQWA 1QBKC 1G17A 4CEJA 2O8FB 2IEZA 2B7BA 3W5JA 5JWRA 4LZZA 4URZR 3KQUA 4C0JA 3QQ5A 4OK5A 3AV0B 3AVXA 2PX0A 1E9DA 2OAP1 3KKPA 4NCHA 3GLFB 2ZVPX 3B82A 3PVSA 3CWQA 2GKSA 3AF1A 1OXSC 3KB2A 2GBLC 4RZUA 1GKIA 4OHVA 1E2DA 3NBXX 5FUWA 4MDFA 4LV6A 1ZD9A 4HZIA 1SVSA 2ZRNA 1Q57A 1SXJC 1US8B 1NIJA 1QHIA 1N2CE 4LJ4A 4P4SA 3TSOA 3GJ4A 4NYJR 3VAAA 4BECA 3I61A 1KO1A 1J2JA 3CNNA 1Z0DA 2QQ0A 3QKUA 2D3WA 5JS8A 4TYPA 1HE1C 4Z8YA 4TQUS 4V0OA 3AKDA 5JBQA 2R44A 3IPXA 2REOA 2RGBA 1JAHA 4O25A 4P32A 2AXNA 1AS0A 3GCGA 3C4JA 2WV9A 5JCZA 1YR7A 2EFDB 2AD5A 1KO8A 2H92A 4LYHA 2NTYC 2WWGA 4IXNA 2ORWA 2AWNA 2GHIA 4DCTA 2Q3MA 5FBRB 2LKCA 4Q47A 4XTCS 4S35A 1W5SA 2Q9AA 3LAWA 4D80A 1G3QA 4LCBA 2Q9CA 1VG0B 4TMZA 3ZH9B 4LYAA 1S8FA 4XWAA 2JLYA 2ZI5A 4QHSA 4Q7LA 4A8JB 1ZYUA 2F9LA 3CM0A 4NP6A 3FVQA 4J0QA 4JL5A 3RLFA 2XX3A 4CT4B 2NO7A 4KFRA 2GRJA 4ARZA 2X8AA 1CULC 2W58A 3P1JA 2V1UA 3GLIB 3PR1A 1A2KC 3L0PA 2BBWA 1F2TA 2BMDA 4PR0A 2J0UB 5JI3E 1XEWY 2PLRA 4AYTA 4BWYA 4L15A 1KY3A 4TLCA 4QC2A 4A9AA 4B3CA 1U0LA 3A6PC 1N3BA 2ZQ5A 3M1IA 4X8LA 1G5PA 4GFDA 3LBNA 2O8DB 3NHBA 4BLPA 4NL4H 4KSBA 2MSDB 4FWTA 2OFXA 2B8WA 4B3FX 2O5VA 3C14C 3QXXA 1KSFX 2XNDD 3TUJC 2GXUA 4KFSA 2PT7A 3TAUA 1HQYE 2QMOA 2WOOA 3DKPA 4U02A 3EIQA 4QRHA 4OI0A 1GFIA 3H2YA 2FNAA 1II8A 2QAGC 1C1YA 1AGPA 3SS8A 1IXSB 1TL7C 4LJ6A 1M8PA 4FMCB 4A92A 2YKGA 1E2QA 5KOYA 1E6CA 4BLQA 5HKKD 1G6OA 2C99A 5DHFA 2BBOA 1S1MA 2ZS8A 3BS4A 2ONKA 3THYB 5FPKA 3VQTA 4AKGA 3WBKA 3FGNA 2FJUA 1NMZA 3HJNA 3K0AB 2Q9BA 4FN5A 1GSIA 2GJKA 3RAPR 1I2MA 1G5RA 2VHTA 3QG5A 1HT1E 3KKQA 3GFPA 1MO4A 3FMPB 4FMDF 1TPZA 1UFQA 3BH7A 5J5CA 4EQ6A 1FL9A 2CLCX 4NONA 1A1VA 1UBEA 3UG7A 4MRVA 1NL3A 4AYXA 1MH1A 2DWPA 1E2KA 5J47A 2CLSA 4Q4AB 3SQWA 5JRJA 4IDHA 5C4GB 5G3ZA 1RFLA 1D9ZA 1RZ3A 3UMFA 2BMEA 2YJTD 1BIFA 4F38A 1G4AE 1XTJA 1Z6YA 2HYDA 3TRFA 1WDTA 5F9HA 4CVNA 1YZLA 4YMSA 1KI6A 2OLJA 2W2TA 1TAGA 3AKCA 2XXAB 5JJKA 4WW0A 1E2FA 1W5TA 2AR7A 4FD2A 4HAUA 3N2IA 4ZIRB 1UEJA 2O52A 2MSEB 521PA 1BKDR 4R7ZA 4CEJB 1TQ4A 2NG1A 5E3HA 2IXGA 2ZIAA 1TF2A 4MUBA 3KKOA 3KXIA 4QHTA 3B1ZA 4OQMA 1YR8A 3VMFA 4XVUA 4RKFA 4XVQA 5F98A 2ZRBA 2ZEJA 1IY1A 2PLFA 3VU9A 1G8PA 3W34A 1DTSA 2ZI7A 4TL7A 2CCKA 4WAUA 4Q9JA 5K8LA 1AS2A 1JECA 2BCJQ 4QFMA 4RZ3A 1JQLB 4PO1A 3DEFA 4DCSA 2Z43A 1ZM3A 2Q3FA 4IFEA 2C78A 3X1DA 2JATA 4IKEA 2FH5B 1IQPA 4P4SB 5J4YA 1EFHA 3NTUA 1V5WA 3U3MA 2OXRA 1U90A 3IQXA 1GITA 3JZAA 2OFOA 2R2AA 4TL8A 4I1OA 5KNDA 1BMFA 1XFAA 4G0NA 2QGNA 4MKHA 1EFTA 3ICEA 4OBEA 3DKVA 2IHYA 1E79A 2QM8A 4OL0A 2WIBA 2DWOA 3T15A 4TMXA 4KV9A 2F3TA 4RD1A 4RZXA 4BFYA 1KI4A 5JFGA 4CEIA 721PA 2GZAA 5C1BA 4ZCIA 1FFHA 4JLDA 1DOAA 4EUNA 4Q1EA 1LNZA 5P21A 2W6JD 2Q3HA 2NO1A 4KYIB 2QUZA 4LBWA 1JBKA 2XSZD 2K5UA 2PMDA 4DRZA 1LTQA 4DB2A 2FZ4A 1H8ED 1NLFA 1XCPA 1AK2A 1UJ2A 4Q03A 3ZQ6A 2ODBA 3P20A 3SN6A 4NTZA 1LS6A 2CHVA 4KLZA 3IO3A 4C0SA 3R20A 3BE4A 3O8DA 3QEJA 3H1TA 3P4YA 2E1RA 4ARZB 1W7AA 1SXJE 3GEIA 2C96A 1M34E 2WMOB 1GG2A 5BQ5A 2H8KA 1F2TB 3MUFA 3LDAA 2ZYUX 5FL7A 2D62A 2RHDA 4M1KA 4QNRA 1OIWA 4NCNA 4IJMA 4LK2A 4HZUA 4Z54A 4XWKA 1XX6A 3VX4A 2VLIA 3I32A 2UZ3A 5EE3A 4DUGD 5JHGB 1DAGA 4H1UA 4URVR 3DM5A 3KUCA 1XMIA 1FMJA 2BM1A 3IPYA 1OKKA 1N6OA 2QG6A 2G1KA 3K9LA 2KI5A 2GAOA 2ZRFA 4RY2A 2GZHA 3BAFA 1YZGA 4M1TA 4M2LA 2B6HA 1Y63A 2R65A 4IOKA 1CJKC 4JLVA 4Q1DA 4TQ9A 4EDHA 1YZUA 1W47A 3P4XA 3FB4A 4JLNA 2OV2A 3GJ3A 3A4LA 3GJXC 4R98A 4IEIA 2FFQA 4B48A 1DELA 3RYTC 1R5NA 1DAIA 2XJ9A 3W3ZB 2RH5A 1GWNA 2ECKA 1TEVA 1IONA 1P9WA 421PA 1VIYA 3WYGA 2EWWA 1NG9A 2CBZA 2A5JA 2HV8A 3LVQE 4KLNA 2WPDA 4UNNA 1M7HA 1NSTA 3AQ4A 1NY5A 5EJEA 3NBFA 4F92B 3I5YA 4H1VA 2FFAA 1W4BA 2GK6A 5CYPA 3VNUA 3IGFA 4C3ZA 4ZCMA 5JI2E 1XJCA 3THOA 1MO6A 4PPGA 1ZINA 2CK3D 3Q7PA 1A7JA 1SHKA 4Q4LA 2DPXA 4ZPXA 4O3MA 3GD7A 1W36C 1TU3A 3F0TA 1P2UA 4JLKA 1Q3HA 2GJSA 4EQ6B 1SVOA 2A5DA 2O8EA 3SJAA 4WIAA 1XP8A 4MYCA 2EYUA 4BFZA 1SVWA 5AUPB 2IYWA 5FBVB 3UIEA 3NKVA 1XWIA 1ESMA 2C5LA 2CEAA 3OEED 1TF7A 5EE9A 3THXA 2G83A 2IUSA 2QRZA 4HSEA 3U3KA 1NVWQ 1M1YE 4LHWA 4QOSA 3SHWA 2GETA 3IEUA 2QPAA 3UPUA 3EZ9A 1JR3E 1KI6B 2BBSA 1YR9A 2A2ZA 2IL1A 2KWIA 3PG5A 4ZDIA 2EWVA 3MAAC 2JJ8A 3RANA 3LA6A 4GMXA 4OJKA 2UVQA 3ZIAD 3ZJYA 3T61A 3R8CA 3N70A 4KVGA 4TLBA 4KI0A 5CIQA 3CX7A 4GNKA 1Z3IX 2FV8A 4NDZA 4V0ME 4PQYA 1U99A 4DLTA 4PPNA 1JPNA 4DT1A 3QVVA 4PHFA 1YR6A 3NEYA 1Q3TA 1GOTA 3VU9B 1ETUA 4D0GA 4AWXA 1G8YA 4RD3A 5BN5A 5E95A 4DEXA 1LY1A 4DSTA 5IK2D 1UEIA 2IYTA 4WXPA 2DFNA 3R7WA 1NMXA 4DLRA 3TGPA 1E9FA 1G19A 1GKUB 2C9OA 3AF4A 1SKQA 2DFTA 3NC1C 3CB4A 2W6IA 1KDRA 3SJCA 3X1XA 3CUEF 3J81k 3IILA 2ZSAA 3E1SA 4LJ5A 1N0WA 1W4AA 2C9CA 1N6HA 3QKRA 4G5QA 3LQRA 2HXSA 3G5UA 4I81A 4MQBA 3TMKA 3GJ7A 2XJ4A 3HWSA 4HLDA 3GEHA 1GNPA 1NN5A 1QHHA 1QVRA 3I3SR 2QT0A 4RZ2A 4TMTA 3ZYCA 4LX0A 4E5UA 1NKTA 2BMJA 4EPYA 4A0GA 3OAAA 5FUVA 4B44A 3D3QA 2IYLD 4FWIB 5HCIA 1GILA 2VF7A 5AJXA 5KPDA 1A82A 1J90A 1TNDA 3MWLA 4QBHA 2VL7A 5G53C 4CEIB 4P31A 2GXSA 4JT4A 4PPFA 2DYKA 2BV3A 2JAQA 4YLGA 1E9EA 2OO7A 1NJFA 3BB4A 2G77B 1M7BA 4RSGA 5L8VA 4M9XA 1T9HA 2P6RA 4W5HA 4PAQA 4BZPA 4QKQA 1RKBA 1YHNA 2CCGA 1D2MA 3S1AA 4Q1CA 3K0CA 2DWQA 1GL7A 3HR7A 1KSGA 1FQJA 3B1XA 3QBTA 3LBIA 3UATA 5BYKA 1BOFA 2CNWA 2ZRGA 3MWYW 4TZ6A 4M1YA 1XEWX 3B9QA 5EUQB 4B76A 5JSZA 3RWMB 2ORVA 2YWEA 1UPTA 2BJVA 2B21A 5DI3A 3GLGE 3SZRA 4BFUA 4PHGA 2FFBA 1KTVA 1E9SA 4MITA 1U2RA 4TWZA 3MWKA 4HZUB 3LW7A 3QBVA 1MO5A 2R6GA 4HLCA 2KE5A 2ZTSA 3OESA 4EFNA 1XMSA 3T34A 3FHOA 3MCAA 1Z0JA 3B6EA 4A15A 1N25A 1T3SA 1P4SA 1DG1G 2RGAA 3A8TA 2HCJB 3VX3A 4ZV4A 5KUTA 1T3HA 2JJ1A 1GRNA 5GVRA 2QMHA 1X6VA 2ZITA 2WWXA 2IA5A 2A3RA 3BJIC 2OESA 3KZ1E 1M74A 2GJAA 5G3YA 4DHEA 2AWOA 4Q18A 1NP6A 1E0KA 2PJRA 2WAXA 1DAFA 1AQYA 5LBIA 4EJSC 2YZ2A 2OCPA 2DR3A 1ZBDA 1N5JA 4RD6A 1TX4B 2FEOA 1MABA 2BEJA 3QPVA 3Q8XB 4IW3B 4BLRA 3I5XA 3EZ7A 2N1BA 1NJGA 1E2HA 5SZJA 3VHLB 1TUEA 1A5TA 1F6BA 3A37A 3EPLA 2Z5FA 4PC3A 4U5XA 2JJ2A 4LBYA 1GM5A 2HDNB 4FMCF 5D3MA 2IHBA 2XSZA 4N3NA 3WHKA 2X1VA 1LF5A 2ZJ5A 1P61B 3HU1A 4WOPA 2KSQA 2R6AA 1ZAKA 3B78A 2Z83A 1N6RA 2IUUA 3D31A 4QGHA 3QXJA 4X8MA 2SHKA 2W00A 5D3QA 2AK3A 3RS3A 5H8WA 2OXCA 2OE2A 3EW9A 1JJ7A 3NWJA 4DDUA 1E4VA 1O87A 1P72A 4Y0AA 3V00A 3ZVRA 5KYKA 4M9ZA 4Q21A 3U7EB 5K8TA 2JLRA 4IDQA 4BRUA 1S0UA 2O8EB 5EQTA 5C4MA 1N5KA 4GSYA 3KL4A 1U98A 2PZGA 3K9GA 4GPTA 2GBLA 1NVXQ 2VPPA 4LHVA 4JL6A 2ZPTX 3AP3A 3WHLA 3THXB
chains in the Genus database with same CATH superfamily
2AQ8A 1P5HA 1YE3A 2ZT5A 3JXEA 5DGTA 3P26A 3DOHA 4BP3A 2AN1A 1MNAA 4U7TB 1MDFA 2I3AA 1L6RA 1ZL0A 2NPIA 3PXXA 4MZDA 3AEQA 4KAJA 2C8KA 2G06A 1DJLA 5IJXA 5CYOA 2H1RA 3RK1A 4F1WA 1WAMA 1DBWA 3RO7A 4MPDA 2JFGA 3T1NA 1HX7A 1MJ5A 1L9XA 2CVZA 5KYYA 1Y6FA 2QA5A 4KJZA 1C7QA 2FG6C 2B3TA 2XBLA 3M89A 4QOHA 1M1UA 1P0PA 4QOFA 4DT1B 2J87A 4RQUA 5LOVB 5IVKA 1Y9DA 1THTA 1OLXA 2JFZA 4GPEA 4IOMA 2WUFA 2C59A 4JBYA 1RRKA 4Y2TA 5ARDA 1N36B 4MAAA 2CLKB 3VYUB 5AJUA 3CLVA 3P9YA 1AHHA 3SYLA 4I1PA 3LRXA 2BLNA 3LX4A 3I45A 4H6PA 4HLUC 4PQEA 5LQCA 4XYMA 4ENTA 1R6VA 1N2SA 5IUNC 3I01M 2V6MA 5JV5A 3H3XA 3RTCA 4WFIA 1NDUA 2DG2A 3GVIA 3HZHA 3ER6A 4NQZA 1QF7A 1ZVMA 1QTIA 3VAZA 1JQJC 3T1OA 3RVQA 4JBWA 3NG1A 4NULA 4M76B 2Y0CA 2AXEA 1T26A 4A91A 2VYQA 5CBPA 1RLOA 1BMFD 1E18A 1GPKA 5EJ9A 1UOQA 5IHXA 2RK4A 1PFUA 1Q22A 2CFCA 3DZIA 3LK6A 3QPAA 3TQFA 3D3JA 2WIAA 4F93B 4YAEA 2PSDA 1SUAA 1VJ0A 2YRFA 3EXHB 3NEPX 4JELA 4D4GA 1AX9A 1JXMA 1ZVJA 4CGZA 1TUIA 3MTIA 1LVGA 1RI3A 3RVDA 2X5OA 5CT6A 1I7NA 5BMVA 4O1IA 4UVHA 5F1YA 5H0IA 1VI6A 3ZY6A 1JUDA 4F8EA 3AUFA 2X0DA 3I5UA 4RIGA 4PNZA 5EGSA 5FIUA 5AKJA 3T7JA 1XV5A 3FX2A 5K9ZA 4R2KA 1RRPA 4HX2A 1YV9A 5KVCA 2ZBPA 4MRNA 1OW3B 5KJCA 1EIZA 4OXIA 2AFIA 5JNLA 3ROFA 3C43A 4D4LA 1PKXA 4G1FA 3BWEA 3GQVA 3EGDB 1FDOA 1W76A 3EGIA 1XKTA 1VMAA 1U2SA 2DP4E 3S2UA 1AKUA 2YCLA 4HS9A 2VHVA 1N8SA 2CXPA 2E3JA 2ZYWX 2R6HA 5DOZA 1Y5NA 4X6XA 2A35A 3B85A 1A9OA 5I6DA 1O77A 5F7XA 3FXAA 4LX8A 2RGRA 5B58T 4IRXA 5JECA 1ADBA 2QNBA 1DC4A 4BLVA 1CUIA 4F6RA 3H4IA 3IP9A 1LBTA 4FT2A 4NJMA 2KJQA 4YRZA 4UKDA 5KDOA 1HEUA 1ZW6A 2PUHA 3BWVA 1QHNA 1SAYA 3GMDA 1J5EB 1XNGA 2WSMA 4HMQA 2QTRA 1JIKA 1H23A 2PUVA 1XSEA 2C5BA 1RAEA 1L4EA 3LPMA 3AEUA 2HI0A 1IIRA 1C9KA 1J2YA 1EINA 2M6SA 4WACA 3T1QA 1WABA 3MTEA 3F4BA 5KWVA 5EHIA 4XB6B 4ZVNA 3HYCA 5DM60 1XRMA 3ILXA 3UGTA 2P3SA 3H2IA 3OG9A 4G5GA 1U11A 4JGIA 1ABFA 3HJUA 4JI0B 1QRRA 3PE3A 4V0MA 4V24A 3AR4A 2PQ0A 2RG7A 4FHGA 5SZHB 5TV2A 2HJVA 1KZ1A 4RMGA 1LSSA 2WABA 3JX9A 1I4WA 5BSMA 1DTWB 3DCJA 3WWDA 1DOZA 1V9SA 2FLWA 4QECA 1TGYA 3P96A 4JU8A 1UH5A 4KQ1A 3HY4A 3OQ1A 1U2PA 4F4DA 3CVWA 1SELA 4MW2A 2CCJA 3COPA 2DLDA 1QKJA 4IKOA 4RVSA 4I2VA 1RWOA 1SQ5A 2QZ4A 4NF2A 4RGBA 2PQ2A 1YIDA 4MXDA 1PQYA 4IQ0A 3ORQA 2K4MA 3RB8A 2CL0X 3FIUA 1MABB 1TD9A 2WSBA 4K2AA 3NT2A 2WPDD 3LYAA 5JISA 2DR2A 2PSJA 4V3CA 1ZICA 3A10A 4BNKA 1Z6XA 2RI0A 3DV0A 1ENYA 3HA3A 2ZB4A 3DDHA 4UHHA 3MT0A 1UMBA 3OUZA 1R0YA 1XHLA 3C6YA 2UV8A 3JU3A 4DLLA 3E2IA 5IJZA 1UBKS 3UTDA 2XW6A 5D3MB 3ZCSA 2ARKA 3HVKA 2YXNA 1B8UA 3HFGA 3QPBA 4URXR 4YRSA 1Q1GA 4OSEA 2NU9A 5LP1A 3NHRA 1CQJA 5PGMA 4NJEB 2YXBA 1E62A 4FGLA 3WWYA 1TM3E 2HQSA 2L42A 4R84A 2BSAA 1RXCA 3HP7A 3OUUA 5KQRA 4TPKA 4DJ5X 4FM9A 2JKYA 3RF7A 4JHXA 1FXUA 3U17A 2XD4A 2X2OA 3K1TA 1CUEA 4WV3A 1LW6E 3HB5X 4BE4A 1Z07A 1YD7A 3FZNA 2QAIA 5B2EA 1C2YA 3IP5A 2GEBA 4I1IA 1J1ZA 1PK9A 2HGSA 2JJYA 2QLJA 2O1SA 2WZDA 3O94A 4NX2A 4YFYA 4DLWA 3ZHRA 2A58A 5B7NA 1Y6GA 3LLUA 4KLCA 1TYDE 2X2EA 4PIMA 3DYVA 1U3FA 1U81A 2OKGA 5JS2A 5AVQA 3V55A 3GAZA 3SEFA 3I2JA 4RJLA 3H3FA 1NFRA 1CEQA 1J7KA 2PRZA 4DTCA 3IVAA 3WTBA 2AFRA 4QDTA 3X3HA 2C7RA 1Q7TA 2XUJA 3QUQA 4DTIA 2YXDA 4RS4A 2R6CA 1OAOA 4IIGA 4M0DA 3TIIA 1SXJB 5ALYA 1PR2A 2B5OA 3BHIA 1JDSA 2WJAA 4H0FA 4A1FA 4B7XA 4Q66C 3LTNC 1QRAA 2G7MC 3RC7A 4C2BA 3MWDA 1UDXA 2O0KA 5EXEA 4YWHA 3AR6A 2QRKA 3M0EA 1JTFA 1UC5B 4OHYA 1UKZA 4BLWA 1T43A 4DV6B 4KDEA 4RZQA 5JEEA 3P94A 4KXMA 4R41A 3QA3E 1KPIA 1AZSC 2CB0A 2LRHA 2BFDB 3DFIA 5LZ7A 3FWYA 5F23A 5IC4A 1R0SA 3S0JA 4BFTA 4KTTE 6REQA 1VTKA 1Z35A 3L7JA 3FYHA 1OFIA 4TTIA 2APJA 1WNFA 1A9RA 2OO3A 2AX3A 5HKAA 3UWDA 1DRKA 2WHPB 3WMRA 2QN1A 2WJ3A 1KHTA 2Q2QA 3ANYB 1OILA 1R6TA 3QI2A 3F6RA 3G7SA 2UZ1B 4FKBA 1PZGA 1RQGA 4RVDA 2OD9A 3C3CA 2VXBA 1WVIA 4F60A 1I01A 4NDAA 1ZVVA 1ZLXA 3PUXA 1OTXA 1GTG1 1RE1A 4M87A 2P9FA 5C7YA 1UR5A 4ER6A 2AXPA 4W5RA 3MTGA 4CG3A 2WG1A 3R24A 1VE3A 2HKIA 2WEKA 3LUKA 5LNK1 3FPLA 2PMCA 2VRCD 4IBOA 4B84A 4Q3LA 3ZVLA 2UYGA 4G9GA 1ABBA 1REQB 2VR1A 5I47A 3TL6A 1UMKA 1IJEA 4K26A 5EZYF 3RCBA 2DBVO 1WHTA 1WSDA 4DRXB 2OGUA 3LUFA 4D4JA 4LOLA 3RBZA 4ITRC 2WI8A 3DZGA 2E82A 1HE3A 2XUIA 3PDUA 4S24A 2H3HA 1BHO1 2DR0A 4PTYA 2XMSA 2AR0A 1CIPA 2FG5A 3I8OA 3OD1A 2JZOA 3ABRB 4S1TA 3GFBA 3CLSD 4PC2A 5IN4A 3KFXA 4G1EB 3DBHA 5CNIA 4BN4A 4ZOLA 3ABQB 3LCRA 2WG2A 2OV1A 4QGBA 1HG1A 4WBXC 1USIA 1XZJA 1S1CA 4XM2A 5CXXA 4G0VA 3NDJA 3B20A 2VNJA 5IMBA 4HAYA 5JALA 2VHUA 1PJAA 3EEFA 2J59A 5DT9A 1MD9A 2WJZB 2TRSB 4H16A 5FFMA 3T1VA 3TW8A 4A16A 5DNUA 1EDDA 5AW9A 3D6UA 4G86A 2OKCA 1ZPDA 3R3YA 5EMHA 1G7SA 1VIDA 3D3NA 4N6OA 3UFXA 4AC9A 1TAHA 2IOYA 3OTOB 4XB1A 3E1GA 1OX6A 3GA0A 4U00A 3R41A 1CV2A 3EGOA 4HB0A 1W6UA 3K05A 1PSWA 4MVJH 1QHFA 2D13A 4K46A 1O97D 1W5AA 4C3UA 5KQMA 4UEOA 3FNIA 4ZEXA 1CZOA 1EVIA 3IALA 4ANFA 1E9BA 2GVNA 2O14A 2WTAA 2C4NA 3CLRD 2RDMA 3DO8A 3L8ZA 3JQBA 4FZJA 5TSDA 1R4NB 1ZOPA 3KQLA 3EW7A 2WF9A 1FJ2A 1FRVA 3A1SA 4J94A 4MV6A 5JYCA 3WKBA 4G4GA 1PL6A 1I3LA 2EX0A 2XQFA 3DKKA 2VF4X 2A9OA 2OCYC 4MDEA 2HUNA 2JIZD 3FKSA 1KKMA 3RRZA 4DYDA 5JYBA 2O20A 5LYJF 1ZM4A 3B1YA 3CR8A 2OCIA 4UFOA 5ITZA 1QQBA 2HF7A 1FK8A 1EWVA 1UJCA 3HE3A 1JEQA 1JRLA 4WNIA 3L0SA 4FEYA 4I2NA 4B43A 2OCAA 1FUIA 2VA8A 1Z2AA 2DH5A 5J4KA 2GPJA 3QXCA 2C07A 2PEYA 3KPYA 4OI2A 1FB5A 1ATIA 1K6XA 3M81A 1LZLA 3PFBA 4I3GA 3HN6A 5BR4A 2EQ5A 1KBZA 4HUQA 4WINA 1R2QA 1VECA 3QEBZ 5JO0A 1T8TA 4CTKA 3ETGA 4BRWA 1D1SA 4UM8B 4C87A 4J0HA 2BKLA 1DU4A 3FRHA 5EMMA 1JYSA 1OZAA 1Q1ZA 2Q3EA 3D4PA 3KB8A 4X64B 2RD2A 5BVGA 5B3JA 3VRHA 3MGCA 2DCUA 4EUKA 4O63O 3WICA 3OZ7A 4DNOA 4AF6A 2I6UA 2I7XA 4LA4A 3QF7A 5HILA 2BGJA 4HDAA 4MR8A 1BZYA 1M6EX 3K0HA 1VSTA 3F4LA 4LBZA 4ZT6A 1TF5A 4J1TC 4PONA 3G49A 2VP6A 5DMHA 4CFYA 3VR0A 1RM5A 4RHTA 4CYMA 3RK4A 2I65A 2H4XA 4HYYA 4ZJPA 3UMVA 1COWA 1UPFA 2CUKA 2ZT7A 5A3JA 1OBHA 4RF2A 3M5WA 1U2GC 1POXA 3JQRA 3GG2A 4M1WA 5JPIA 1MB0A 3JSXA 3DAGA 2A9FA 2QRVA 3BTOA 3KUXA 1AJEA 2ZRDA 1DBQA 1G1AA 1TGVA 3LP6A 4MUHA 1YJCA 2C5AA 2J9RA 1CTQA 4FDUA 1KWKA 1SXJD 2CL5A 3OEYA 2IQ5A 3HXMA 2CXRA 1S7CA 3F3MA 1JR2A 1QOPB 1Z37A 4N0QA 3NI2A 4U2KA 5JXHA 3RHZA 5ES4B 3IE1A 3C3JA 4DRYA 2B6NA 2R2GA 4KR3A 1BHJA 2IYPA 2D6FA 5CT5A 1NVUQ 3COSA 1FMFA 3B6IA 4AZ0A 1LA2A 1MJHA 1ZISA 3FFBA 2H0QA 4JKOA 3MLBA 3VDMA 3V8VA 3D2CA 3OQ6A 4K9SA 4L7QA 3UYLA 1P1BA 3ICQB 2E49A 3L8MA 5T4HA 1KC1A 4C78A 1Z5UA 2H65A 2HLNA 3W6OA 2ZROA 3OE7D 1KP9A 2JJMA 2C1XA 4EOGA 4EYEA 4F56A 1ISIA 4ZDKA 2HDHA 3B3GA 5CDUA 4HDOB 1E1YA 3WLMA 5LXTB 4EZEA 2CY0A 2EZTA 2Y0EA 3KCNA 4GP7A 3PWKA 2C98A 3H6GA 1GNTA 1K6EA 5BSWA 1S3IA 4FOLA 2WTNA 1K7YA 1G1MA 1U3VA 2IF0A 3H97A 1UP6A 2DFLA 3U60B 1IN6A 1PEAA 4NH4A 4B6EA 3TX6A 3WJ1A 3C7DB 4F6LA 1PZNA 5IYZB 5I4IA 1DEKA 2R96A 5BR8B 1PJRA 1PK8A 3I0ZA 1VHLA 3QWHA 4YXWD 2VQ6A 3AP2A 3I4FA 3N75A 4XUCA 3TB6A 3UXHA 1PZEA 3AFNA 2Y05A 4K9LA 1FW8A 1XJWA 5HNKA 4M89A 3DNPA 1TOAA 3QMPA 4PLWA 3U09A 1PZFA 3OQNA 3D6TB 4CFSA 2JS7A 3WRVA 4Q7QA 4EHAA 1DJNA 1KI3A 1SHTX 4YEDA 1QZXA 3CUWA 2N3ZA 2AN9A 2PZ8A 3C4QA 3G2KA 3NC4A 4JLAA 1FFDA 3ZDFA 2W4MA 3FW1A 1S2LA 1UPCA 2XDYA 5CIWA 2G82A 4CM5A 1M5RA 1U0FA 1KMHA 3S68A 4WBNA 5I4KA 1O7JA 1Y8QA 1DG3A 3ROKA 3BD8A 2YXLA 4C20A 3G7UA 5FPQA 1Z0KA 2Q49A 5COBA 4QUJA 2EP8A 3SQXA 3QLJA 3JW8A 4HP8A 5JCJA 1E1QD 1H0RA 1HTTA 4B6FA 4HX9A 4H31A 1FFSA 3K0FA 3LLMA 5DXFA 1VL5A 1KMQA 1T5HX 1U4SA 5HRCA 5ERGB 3MCUA 1LBEA 4E6EA 1DRUA 4D2IA 4P0PB 3MXOA 5GJCA 3AHIA 2PGLA 2X19A 3A0UA 5IKOA 3N2KB 1EX1A 4BUZA 3WL8A 1KGDA 4UFNA 3MIZA 3PUKA 3NONA 1J22A 1S02A 4YMTA 2E1PA 2HJ9A 1PWEA 5IXSA 3CR7A 1C3LA 2GVZC 2JCSA 1XD8A 4WUTA 4WXYB 5E38A 5BXQC 3ZCTA 4DB4A 4YUXA 5DNEA 1IN7A 5CXUA 3PL5A 5F7OA 1LB1B 2RH9B 1XDBA 4MYSA 2OSBA 2E4AA 1TVCA 1UWKA 5ALIA 3QFTA 3W5CA 2PYZA 1YQUA 4EJ6A 2Q2NA 3KEMA 4I46A 5LWQA 4KPYA 1J9ZA 3LD9A 3QFRA 3CW2A 4OJTA 1KVRA 5CLJA 1YI1A 1KI1A 2R1VA 2ZANA 4R71A 4TSFD 2W2LD 2EIHA 1GYPA 1E0AA 1DE0A 2QU8A 3SR4A 3RAEC 4AZ3B 3QV1A 2FUG6 3A1TA 4FJ2A 5T4FA 2FOLA 4MB2A 4DBLE 2JD1A 3VGPA 4FR5A 1NJ2A 3OIVA 2O2GA 3IAUA 4B7ZA 1Z36A 3H75A 2VIIA 2P2LA 4E51A 4MV9A 4OHCA 2VKQA 2Q50A 3RYIA 2C84A 1V95A 5CLQA 2H9AA 5BSFA 1TLFA 1MHTA 1DLJA 1GO2A 2QT1A 3BD9A 3BFXA 1W4ZA 3RSCA 1UDRA 4FX2A 5DGIA 3VPFA 1QUEA 2JLBA 3ZV7A 1X2BA 2ZUCA 4D0SA 5EGNA 1Y1PA 4HK4A 4JEMA 4PPQA 5JRZA 1UOEA 1ZK2A 3AF6A 1X1QA 4M8LA 1OFTA 4HN2A 1NOKA 4PEVA 3ISTA 1JXAA 4XZ3A 4YRTA 4O4LB 5IAOA 4RCVA 1UBHS 4F3CA 4WKNA 4XFJA 4ZVPA 2AC2A 1CJMA 3IE2A 4IUCS 3UJ9A 3R6GA 3DOOA 2ATIA 4ZJUA 1CRPA 3WDLA 5I51A 4ETMA 1PV4A 5A5GA 2XTNA 5FHQA 1SQFA 1NFFA 5AK4A 3RTAA 1JB9A 2O0MA 1RRFA 3BRSA 3JQ7B 4GIBA 5JVDB 5C7IO 1XELA 3KQNA 2Z9CA 4MINA 4E5SA 3Q8LA 5FLYA 5IMSA 3X2SA 2DBZA 1WULS 1SMKA 1RYMA 4XGKA 4TT3A 5AUQA 2XGSA 3LGSA 3KQVA 3QEMA 4TYMA 2RKOA 3TOCA 4JROA 1DJMA 4IGEA 1QMPA 1ARZA 3D9QX 4GWLA 4P5EA 4QWWA 5AIAA 3I53A 1P5FA 4ISCA 1IZYA 5D84A 3WGGA 3L2OB 3GGGA 3A70A 4XJVA 3TH5A 2ZTLA 5TXGA 5JSYA 3IA7A 2GN1A 2ZUBA 4BY9E 3IVRA 4RU1A 1UMCA 4NFYA 3ELYA 2C2HA 4JH0A 4OXRA 5EIBD 2RHBA 3E5MA 4C88A 2ZM5A 1TA4A 2GN6A 5KU1A 1IOZA 4ZCTA 2J08A 2FWNA 2QD2A 2RMKA 4HLUA 2DSTA 5TY0A 1FBTA 1OI2A 2AVNA 2EQAA 4M53A 4RDCA 5KNDH 4W9MC 1FPMA 1Y42X 2GDZA 3RBAA 2CMGA 2ZXEA 3ZGNA 5JWOA 2VUUA 2P2NA 5I7RA 4GOMD 1OYYA 3JTMA 3Q2KA 1E1DA 1X74A 3Q6MA 5EINA 3V1NA 4B3RB 3AUTA 1V11A 4O4HA 1TIKA 5E1OA 5KEIA 2NUPA 1U9YA 4NC9A 4GRDA 4DARA 2ZWVA 3C1OA 4KO8A 2RAPA 3G8YA 3LP5A 2ISCA 4E08A 1BQ3A 1EQAA 1KQPA 3M83A 1DAEA 5GMOA 5FEUA 4C4TA 1VLQA 1RCTE 3H9BA 5J2UA 1S89A 2Y1CA 3WGMA 5LQSA 1PZMA 1T5IA 3NC0C 3S3TA 3UAXA 5A03A 1KEVA 3L04A 3OE4A 3WOHA 7REQA 1PJBA 2CJWB 4P35A 1V5IA 3TCXB 3UWOA 3RYHA 1L7VC 1MA0A 3F98A 2Q27A 2NAFA 3ONFA 4D99A 4I9NA 1NYRA 4LSZA 4X97A 5CVTA 3S8YA 3U4QA 3S5UA 5T6MA 2SBTA 1F5SA 2PX2A 2PGIA 2QJFA 1NPTO 2DLNA 2I3DA 2Z56A 5K8UA 3GHYA 4IJUA 3SHQA 3TAHA 4YCSA 2V7XA 4L4RA 3ETJA 3VVCA 2LDXA 4D3FA 3D8HA 4F1KA 1NVTA 1OX4B 1JKIA 2NIPA 4WJLA 4WOCA 4EYGA 5JR3A 3FHLA 3IMFA 1XDSA 1G20E 3GDGA 1QO0A 3JPWA 4IUYA 3VO9A 5DZSA 2NU8A 1KU0A 2O0JA 2WLSA 3MOSA 1U1EA 3O83A 2WWIA 2OBMA 2NZYA 3ZX4A 4DCCA 4ED9A 2RC5A 4E31A 4IQ4A 1I9GA 3LLVA 3OKAA 3T9FA 4JVLA 5AESA 1XZDA 3OZSA 3WGTA 4O2LA 5EZ5A 3SE0A 3OTIA 3R0JA 3IEKA 3U3JA 1IMOA 3NVDA 4NFHA 2E5WA 3EZ6A 4CMHA 2CMHA 4YV1A 1CB7A 2Y0PA 3SFVA 3UV6A 4LYYA 4Y67A 1LC0A 5IVIA 3DL7A 1GRCA 2G28A 2QTMA 5CEEA 1Q16A 1YZKA 3F6CA 4MVJP 4GZLA 1I30A 4RVUA 4KOEC 2VAWA 3HHPA 4EY8A 2MWMA 1A2OA 4X93A 3BCSA 2L19A 1MB9A 3DXFA 3X2FA 4WBNB 1OAKA 4LCEA 5JH7A 2ZJFA 3PQFA 3F9RA 4KK4A 4N8DA 5J5AA 3FYTA 1I10A 3QOYA 5B3KA 1WBBA 2BUAA 1DUSA 3TLZA 1BCSB 3PPWA 4WMLA 4YQEA 1QZZA 3BFVA 5HE9A 2A78A 4M37A 1Y5LA 1QM5A 4NBSA 3W90A 5EKDA 4B40A 1J24A 5C34B 5KNBD 1YCFA 1E7RA 5EWLB 2QGZA 3O4JA 4ID3A 1OWNA 4P33A 2X8JB 4L1KA 1MVNA 2PH1A 3BXEA 4EATA 3AEZA 5CA1F 4CJXA 3VHXB 3LV8A 4KKXB 3UC5A 4DQKA 4Y0NA 3PUVA 3C6MA 4YHHB 4TV9F 5FORA 4EHHA 4UMFA 1E64A 1X1CA 3MQFA 4F3NA 1QU3A 2X9QA 3GBSA 2F4NA 2D3TA 2IW1A 2NT4A 2O3SA 2NXEA 2OC9A 3BORA 5FL3A 4RF5A 1EXNA 4LECA 5MF6A 3OTQA 4MS1B 5EE1A 3MD0A 2PXXA 3DTYA 1W2GA 4MK4A 4C4PA 3GBVA 5TGDA 5COQA 1CSEE 2F1IA 2RGYA 5EJ7A 1JE0A 4Y2XA 5EMKA 4C05A 1Z7EA 3QYAA 3C1AA 3UT5B 4DIFA 3O31A 3U40A 1KY2A 2RBEA 2CE2X 2D5AA 3HUEA 4TYWA 3I9V1 3QUCA 1UZAA 4JJGA 3L0CA 8MHTA 1YZFA 3FTEA 1GV0A 2YOGA 4ME6A 4R0VA 3SR0A 3F1KA 3W7BA 2QTFA 1XZLA 3UMRA 2JIBA 5G02A 4Q9NA 1BVUA 1QH8A 4EB0A 3JAKB 1QF6A 2ZQZA 1G4HA 2A0YA 2V8OA 3UCXA 1BCRB 1RQ2A 3PITA 4KOAA 4WGFA 4DQUA 4KSCA 3OHPA 3M7IA 1WUIS 3W3AA 3K72B 3B2EA 4BB5A 4QTYA 2IS6A 1OHHD 1VP3A 4HL6A 3UKOA 1ZRNA 1KEZA 4TZKA 1Y98A 2A4MA 3EEYA 4ZARA 3TXXA 3KPUA 2YNMA 3P2JA 4BGUA 3TSZA 2BFPA 2Q07A 4Q3BA 4GI7A 4QXQA 4XA8A 1EVKA 4FZ5A 3P2YA 3CKKA 1OLSA 3LVRE 2XBMA 1EGAA 4NJOA 2OLKA 3QPUA 4UEKA 4RUKA 4E2ZA 4DR6B 1XZCA 2GZDA 4D0NA 1P62B 1BVHA 4AECA 3ML1A 4WLVA 4JFAA 1AXGA 3DL2A 1IVYA 3EVNA 1VKNA 4GQBA 2AJ8A 4L4YA 5A0TA 1EZ4A 5BYJA 1BX0A 3TNJA 3RGGA 1HNNA 3I30X 1C3OA 1YCDA 2NSYA 1AQ6A 1FP7A 1XEFA 3D2LA 5EHQA 4MAFA 5JS6A 4M1MA 3CXUA 1KS9A 2LZ0A 2WYUA 4QD3A 3TTVA 5AW4A 4BS9A 2E4YA 2Z6AA 4FYHA 2BFAA 4LMPA 1NVGA 3PDHA 1A98A 1ULSA 5ARCA 2W8BB 4FFPA 4RMNA 3EDMA 5B4VA 1RAHA 2BE9A 4GXTA 4MRSA 4R54A 3P45A 2XVZA 3PUHA 1RXWA 3I0MA 1ORHA 1X38A 3EVBA 4FYXA 3ZZTA 2NZUG 3MQ4A 5KTYA 3GJRA 3BMNA 2O7SA 2GEVA 3OPMA 2REXB 4ZO4A 5FFFA 4CL2A 5M29A 3DR3A 4BNDA 5C53B 1W75A 4DR2B 4GMFA 1M0TA 2FGJA 3GPBA 1NYQA 4D6PA 1EFCA 2VT7A 5CDFA 2FF7A 1ODIA 1ZMBA 2YWBA 2H7VA 1XCOA 1Y1QA 2GCOA 3U7QA 1WZIA 2VP3A 4HAWA 3VR5A 4BAUA 2QQGA 2QMYA 1MN6A 1KIMA 2RH4A 5FBQB 4G01B 3M6FA 4EIWA 4YLEA 1QNLA 1DB3A 2I2WA 1LWOA 4FNOA 2GHQA 3SF8A 1B6GA 1PGNA 2C83A 1F7UA 3QNWA 2BFNA 2XZLA 4X94A 3SBDA 4RADA 4DLNA 5DNYB 4MPJA 2G88A 2ORYA 1VI5A 4PZLA 4QDJA 2G8NA 1JSZA 1CZRA 2P75A 5CLFA 4Q01A 5IAGA 4MV3A 4Q4HB 1A88A 4MCAA 5HF8A 1VHDA 3C5HA 5J9FA 3U1TA 4ARUA 4MRAA 1QJ4A 1JIXA 3AJDA 2AMFA 4RIHA 1RRVA 2A0XA 4NG4A 4A1OA 3G1TA 1VDZA 3AV3A 2JI7A 1QHXA 1DT3A 4ARCA 2CVPA 4WL0A 1MUUA 4X20B 2H2DA 4D0LB 5J4HA 3CB2A 1W93A 2UXCB 1I6LA 3IVCA 4KG7A 3V4FA 2W2KB 4E7PA 1KK2A 4JXJA 2PMWB 1KJQA 3KV3O 4OHXA 4Q82A 1HZZC 4H7KA 1W0JA 3V42A 1BE1A 2ZRMA 4RVGA 3WAGA 3GGJA 4NIMA 3E9EA 4JNCA 3UANA 4EYKA 4YX9A 1HZJA 2ONCA 2WWYA 1SY7A 1W19A 2ZJOA 3WXMA 1JHPA 1KNXA 1PJ4A 2NZ2A 4HNGA 1QTNA 2WU0A 3QTBA 1W85A 2IUYA 1SEPA 3PGVA 2EHDA 3H2GA 3QMWA 1YDFA 2IY8A 4XLTA 3V7YA 2ZRKA 5CXSA 1VE6A 1OI7A 3ZW7A 5IUJC 1F4PA 2NVOA 1NY6A 4LJ8A 5CM9C 3H86A 3WWOA 1MQAA 4NENA 3TL3A 4CU2A 1FTNA 1M34B 1SN7A 3BTSA 4OHWA 2NUAA 3N6VA 3LC7O 2G8LA 3GLGA 3GJQA 3HKDB 4G0QA 1F12A 1G3RA 3TLMA 4KVAA 3KFLA 2NADA 1MJFA 2YINC 1T4GA 4N5NA 3TIVA 4E5VA 3P2IA 9MHTA 3CVJA 4MGKR 4YVFA 1W87A 3EXEB 5EUMA 3Q6IA 4HQLA 3GNQA 1IXKA 1YFKA 1WSBA 1BH6A 5JNTA 1T2AA 2FMIA 1U7XA 2GFHA 2OG2A 3D64A 4ZKEA 4A2PA 1TMOA 3I8XA 4DXAA 2IF2A 3PGA1 2GK7A 3BIOA 1RJ9A 5HDBB 5K20A 4II3A 4F72A 5EP2A 3ADOA 3OCVA 5GGXA 4O08A 1QCYA 2E7ZA 1KY5A 3LM8A 2VJYA 3LUHA 4IQ8A 2XNJA 3EY9A 4NYJQ 1ZMRA 2IYZA 2UU9B 4MIYA 5AVYA 4WERA 3H9CA 4P83A 4YN3A 2YVKA 3RBXA 3TM5A 4KQWA 3COWA 5L3QB 1DOHA 4TV8A 4AO7A 1YRWA 3I1FA 2FPIB 1UCFA 3RC1A 4RPKA 5TEVA 4ECAA 5JC1A 1B74A 2ONYA 1RAGA 2O5CA 1E6WA 2HJSA 2YVAA 2JARA 2HRCA 1IHXA 1GCAA 2OHVA 4MJLA 3TNDA 2MDTA 1I33A 1GKKA 3H0EA 1PR3A 1N7JA 2YV5A 4RKWA 1TKAA 1FUUA 3KDPA 4IIUA 1G2IA 3ZY3A 3KZMA 4C4ZA 3ROEA 3GPIA 2NOAA 3OMWA 2RGEA 4J1TA 3IR5A 4BP9A 2ABWA 3CWZA 3T7CA 3LPAA 5FTKA 2ZPUA 5MGBA 3IQFA 4KX5A 4TLEA 1WUHS 1E66A 1U2GA 1IWPB 4C7JA 1RE0A 4D1YA 3NETA 3MINA 4K2HA 4J03A 2W2XA 1EZ1A 3L7CA 2GJ8A 2W6NA 3FROA 2JNWA 2C92A 1OOEA 4CEHA 1GAJA 5E7IA 1X14A 3NBKA 3T7KA 3TNFA 3P9QA 2ZCJA 4ZDWA 1N1GA 2QU7A 2VP0A 5A4FS 3BRWA 1YVDA 4ZYZA 5LM3A 3UC9A 1WDWB 1JU3A 4BO5A 3DHEA 5AWFC 1BWSA 2V7QA 4DLKA 1SM4A 4EB6B 5M04A 5B5SA 2RGGA 2X5JO 1P9RA 2GN9A 2R4UA 4MQFA 3W1WA 1QMGA 1WZEA 2P4EA 2H7YA 2PUCA 4FLEA 4R2IA 3N39C 2EBFX 4IOJA 2V9CA 3WKAA 2AK2A 2W98A 3PIDA 2Z5LA 3AI2A 4JBNA 3QLVC 2A9JA 1WD5A 1YB1A 3C39A 1J0DA 3E9ZA 1P0CA 1CUHA 2WFLB 4OB6A 3RSSA 3P9SA 4JQCA 4J9VA 1SVIA 5DMXA 4AIIA 2QE7D 1UIMA 3CZMA 3HJFA 4C4XA 4FUTA 4MUYA 2ZTHA 3EGCA 4YPOA 3CTMA 1O9HA 3UV3A 5KNCA 2G1PA 1TVKA 2HLDA 3LQ4A 1V41E 4RVFA 3U16A 2BHTA 1GGNA 1B2LA 1GRRA 5DBIA 4AF8A 1CJBA 3ADKA 4Q9IA 1E4EB 2B69A 3U5ZB 2Y8EA 5KTRA 4ACBA 1TT5B 4BFXA 1JKJA 4AKIA 1LC3A 2ZFUA 1DCKA 3BZBA 5EZ6B 3DD5A 1KDZA 1GGVA 3SZ3A 1MAHA 3W9BA 2R1UA 4BJ3A 2O3RA 3D54D 3CCBA 1TA0A 4L5BA 4OOFA 3LVFO 4ILKA 3JQFA 2XITA 3LQ2A 2HIMA 4I8XA 4KC0A 4BU1A 1DAOA 1SG9A 2PVCA 3UJ6A 2OYCA 4KXYA 1A4UA 2HRQA 1H5NA 4UBJA 4YAIA 1Z7YA 3VYWA 4U7GA 4QTZA 1XZKA 4X84A 4B80A 3SI7A 1N33B 3LUJA 3HKEB 3PVZA 4RNDB 5EZYA 1G2PA 4ZVRA 5DTRA 1T9AA 4UVEA 3H16A 1UXOA 3AVOA 4W5JA 2IIVA 3RWBA 3QG1A 1ND5A 4PZZA 1IHYA 3DULA 1T25A 1PUXA 3F6PA 4HQFA 5DXJA 3NIDB 3UZUA 2GILA 4Q24A 4URHA 3N2YA 2OYRA 3I9MA 4C43A 4CUJA 1HTWA 4L73A 2O2HA 3TZ6A 3EQZA 1B3RA 4P2GA 4Z7JA 3BWMA 3LFUA 2EQBA 4Y6OA 2AG5A 3D1LA 5DWQA 3H5WA 2C8VA 4EI9A 5AKKA 2OPHA 3OFSA 3YASA 1F9AA 2NT3A 3B7GA 1T2NA 1ZN7A 2XQVA 3HRHA 5HX7A 5JROA 3HB9A 4E03A 4UTZA 4H1TA 2X1MA 5LD2B 4RX1A 4MUJA 5AJVB 2Y68A 4GSKA 3RTEA 4O5AA 4LYFA 1U94A 1ONOA 2VNHA 1SGWA 4WN9A 3HGMA 4EKIA 2QGFA 1IU9A 2YC2C 1ZUNA 3CA8A 3X43A 2VQSA 1N0UA 2QMQA 3JWPA 2C5FA 1HY3A 3PJRA 1Z6TA 5E9QA 4KQ6A 4OAOA 1T24A 1MQSA 1ORVA 2IDZA 3OCWA 4H35A 4PANA 1XDDA 3I62A 1QYDA 3VISA 1SVKA 1K08A 2QQEA 3K1JA 5ILQA 4E2WA 4PN7A 3ECAA 1EYZA 2XR1A 4NYIR 5ICGA 5F1OA 1KAOA 3JVVA 4FB4A 3UWKA 1TQ2A 4UVDA 1E20A 3UPDA 4DDWA 2IFTA 2WB2A 2EERA 3EA0A 5JJBA 1XCBA 4EWLA 1EDOA 1W48A 5DNWA 4ZGWA 1Y9JA 1JDVA 5DVZA 2CKDA 1CYDA 2R6DA 2C1ZA 2ZIXA 3PPIA 2PCLA 2FA9A 4MV8A 5LYJA 4D6YA 4RTRA 2ZSEA 2YV2A 3ZH2A 1V5EA 4WLNA 2OBBA 1WHSA 4NRDA 4AZTA 3EBOA 1BQEA 3JD1A 2H0AA 3GMIA 2C94A 5GV7A 1T9GS 2OQVA 2TMKA 5AKYA 1MH9A 1Q7EA 1TMYA 5F5LA 4DNXA 2CMDA 4N4AA 2WIGA 4ND7A 2OGTA 4PCLA 4D57A 2DBYA 5IT9A 5GWXA 1R9NA 3DXZA 3GA5A 3E58A 1Z34A 4R6WA 4B3BA 1YHYA 2H1WA 3S7TA 1T8UA 2BHNA 4GICA 4Q4CA 3F7NA 1ZA1A 1CR4A 3KLPX 3Q3CA 4MUIA 1T0PA 1E8DA 2Q1XA 3E35A 3NBZC 1O0SA 3UAWA 1DAHA 2TECE 3P8ZA 3GL9A 3ZVKA 1YF3A 4BXOA 3R7FA 1LI4A 3RDPA 3NTLA 3RSOA 4K6MA 3TO5A 4DWOA 1AA6A 1QHSA 3CF0A 2O59A 1HT2E 1NXVA 2PNJA 4L3WA 2AKYA 3CMMA 2V5AA 5LQAA 2W4IA 4UEQA 3SCZA 4ENQA 2WWHA 2CHQA 3Q8WA 3A1VA 4ONEA 1AA9A 1C1DA 1G21A 1RBMA 2I7VA 2UAGA 3N2NA 4Q4JA 4TXHA 5EIAA 2ZSIA 2IYQA 2WFZA 2DC1A 2BZ1A 4PIVA 5K0LA 3H6HA 1YA4A 2AFIE 3FTCA 3CYFA 2V0CA 3ZZNA 1ZD3A 1QE0A 3HWRA 4YASA 1YJAA 2FETA 3OU2A 3WIUA 4V1CA 3DLBA 2VZ0A 5FWXA 4P9NA 3L0YA 3W3AD 4FX5A 2QROA 4B6RA 2V6GA 3CO0S 3CQ9A 1C9JA 1T5OA 4NABA 4EY7A 2VBFA 2XDQA 2ZR7A 3DEKA 4URUR 2H2FA 4OY3A 1QZTA 3PE4A 3UJCA 3LU1A 2GEUA 1G20B 4GW3A 1ZJWA 2GI4A 2X4GA 3K70B 2XUHA 3CF2A 4KP7A 4JQSA 4R01A 4FLMA 2AW3A 1Q50A 3HVIA 4BJ6A 1DWUA 1Y3FE 2BKEA 1PNVA 1SBTA 2IC5A 2VEDA 3A2MA 1MOQA 4YJ3B 4BBJA 3N8DA 2CZCA 4REOA 1NHWA 2NU6A 4CBVA 3RVNA 2E6KA 1GDHA 2QX4A 3PF9A 3N8NA 4I99A 4BNJA 3PZBA 1RPNA 1P7YA 2FKAA 4FEAA 3VNAA 5A4JA 2XMGA 1ESDA 3F71A 1I94B 4ARIA 5KYXA 4ZV7A 3HDHA 4ZZ0A 2P2DA 5HS6A 4QDKA 2F