3PCRB

Structure of espg-arf6 complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
b'MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EspG
publication title The assembly of a GTPase-kinase signalling complex by a bacterial catalytic scaffold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 40
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2010-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pcrB00
2I3BA 2FE4A 4ZI2A 3O8RA 2CVFA 1SZPA 1E2LA 3Q85A 1XRJA 1I2MA 2A5DA 3GLHE 3HYTA 4BE7B 1TTTA 2IF2A 3T5GA 1VCIA 2OO7A 4V02A 1Q0UA 2WWFA 1N2CE 1OXSC 4WAUA 3E2IA 3TJZA 4TLAA 5E95A 2CK3A 5LB2A 4NU0A 2BMFA 3AP2A 2IYRA 3LBIA 1MO3A 4AG5A 4G5QA 3LV8A 4F38A 4QNMA 1T4GA 4EJSB 3NEJA 2XTZA 2ORVA 4M9XA 1OPXA 1ZINA 3AKCA 1R4AA 2QP3A 4NMMA 3CUEF 3DPUA 2G88A 1OW3B 4X8MA 1L8QA 3A4NA 2WWWA 1Q1BA 3RRNA 3SHWA 3ZVRA 5JFGA 2VTKA 3EPJA 1JAIA 1W2GA 3M0EA 1UKYA 3KXIA 3N2IA 3QF7A 2HJGA 2OILA 3QG1A 2Q3FA 2FU5C 2AL7A 4LSGA 4HZIA 1ONBA 3U6BA 2V9PA 5EP1A 3IDQA 2VHUA 1OE0A 3QSYA 5SZKB 1CJTC 1US8B 1KO1A 2AKAB 2HF9A 4RD1A 3AVQA 3C8UA 2ZS8A 4LBYA 4TYNA 1WE2A 2KE5A 5EP2A 1NIPA 1DG1G 5C2JB 2J46A 1JECA 3KX2A 4NCKA 1XEFA 4XVQA 2ZSFA 1E4VA 5FBQB 4LJ8A 1OH8A 3LX8A 2WSSA 1D9ZA 5DE3A 2VYFA 3TKLA 3WHLA 4M0LA 4U00A 1W0KD 4A8JC 4GL2A 3OEHA 3K0AA 4NHOA 4IDQA 2B21A 3BJIC 2NO6A 4IDNA 1J90A 1TU4A 1GITA 4PC6A 1A5TA 1HUQA 2YWHA 4LBVA 4D4MA 2QPAA 1A2KC 4RFSA 3LVQE 4G3XA 4LJ7A 5EE9A 4XTRA 3TW8B 4LV8B 2ZS7A 5KNDA 3IBGA 1E79D 2RCNA 2VSOA 1E9CA 1EFHA 2PEZA 4DVGA 1IHUA 4DDUA 2ZVQX 1K5DA 3A58B 1XBTA 4R2IA 3OF5A 2JLYA 3B6EA 2BM0A 1XXHA 2G9NA 1XPRA 5TMPA 1NVXQ 2ZR7A 1W36C 4IRUB 3AVUA 1O87A 1TPZA 1XD2A 4QHTA 2JA1A 1DPFA 1Z0AA 4FCVA 4A6XA 2XGJA 4PANA 2HDNB 4TMTA 1M6NA 3IIJA 3ICEA 2CLSA 1ZUHA 4BUJA 2GCOA 3RSLA 2OBNA 3ICQB 1KNQA 2LCFA 2MMGA 1XEWY 2C96A 1W44A 2EW1A 2PCJA 4W5WA 4YMSA 2J1LA 4ARZA 1FUUA 1KO5A 3VX3A 4CEHA 4IVPA 4I1OA 5AJZA 5H8WA 1ZCBA 4YMUA 1UBEA 3ZGXA 1WQ1R 1P60A 4NTZA 1OH7A 2O0HA 3FFBA 4A0RA 1KSHA 1QHSA 1E2JA 1NVWQ 3WYGA 3C5HA 2I4IA 2ONJA 3LWNA 4NKRA 2PL3A 4D26A 2AN9A 1BIFA 4BZPA 2FMXA 221PA 4ZCIA 1Y3AA 3O47A 2PLRA 4ON9A 5L3VA 1P2TA 2QZ4A 4HZUA 1G7RA 2RHMA 2K5UA 3A4MA 4PPQA 5HCNA 3KKQA 1WRBA 4B33A 3UMFA 1QZXA 2RMKA 3B1XA 4DT1A 3DKPA 2WIAA 1GKIA 1OT3A 2XEXA 4Q4AB 1KDRA 3K09C 1G7CA 2D74A 3A1VA 3Q3JB 2RKOA 1Z0FA 2GVZC 3KKMA 4DEXA 4Q7MB 4B47A 1WXQA 4PXAA 4B3BA 5FPSA 2C8VA 3EXAA 3K9HA 4V0LA 1FL9A 2GJSA 3IGFA 2ZS9A 1BYUA 1UKZA 1D2EA 4MA4A 1T5IA 1W7AA 1M34E 3LFUA 5BWMA 5KUTA 4DIEA 3EZ6A 2C78A 3U5ZB 4TTQA 4JLMA 4Z1MA 3KZ1E 3W3AA 3GPLA 4PQYA 3KQLA 2CL0X 3BORA 1DADA 2REBA 2OE2A 2CJWB 1G9XA 4YLGA 2ATVA 4GRAA 3W8RA 2ZJBA 5KDOA 3ONWA 3W9YA 4LDJA 4JBWA 3TGPA 5DYGA 3FHCB 4WA7A 1VG0B 3KJIA 4A15A 1ZD9A 3LLUA 4ZO4A 3D6TB 4ERNA 1E1RA 1GTVA 5BW8A 2IW3A 4FMDB 5EXPA 4Z54A 5KTYA 2OEPA 3EPLA 4C7OA 3FMIA 2E9SA 2I1VB 3F0TA 2ZE7A 3X1DA 1DBSA 2XOKD 3PV0A 2FZ4A 1XTSA 4Z8YA 4KSCA 4D4KA 3KFVA 4GMDA 1NG9A 2QMEA 3KTAB 2ODBA 2P67A 2C98A 2FEOA 3AVOA 4WXPA 1HE8B 1KO8A 1VPLA 4JLJA 1UBCA 1F2UA 2D06A 3X2SA 3K9LA 1KSGA 1G8HA 2IYXA 4GMXA 3T1VA 1W4CA 4TLCA 1HV8A 1W46A 2CLCX 3T35A 5KSZA 2O8EB 4I1SA 4IHQA 5CJ2A 3E5HA 3EPHA 4DXAA 4LJAA 2A5JA 1M1YE 3IQXA 1XXHE 4DCVA 1R5NA 3A1TA 4FIDA 4W7SA 2GAAA 4RZ2A 4AC9A 5D3QA 4MGYR 1E69A 2RAPA 4LUCA 1CIPA 2HLDD 4CT5A 3UG7A 4JT2A 3GJ3A 1T0HB 5FL7D 4LHXA 2OXRA 1PUIA 3BE4A 3NEYA 3H84A 1KI2A 4HAXA 3I72A 2ZAOA 2GWHA 3LA6A 1AS3A 5JJIA 3CX6A 5FR2A 3W8NA 3SJAA 1CP2A 1U90A 2GETA 5HZHA 3C15C 1N3BA 1FQKA 2X2EA 2WJIA 3M1IA 2EFHB 3K8YA 5JECA 2R8RA 1E2DA 2BBSA 5C18A 2QAGC 4MGIR 2Q3MA 4QGAA 3GJ6A 1QVRA 5HCIA 4S2EA 1PV4A 3THWB 1FMJA 2O0JA 2ZRDA 2ERXA 1UDXA 2YZ2A 1NN5A 4D80A 4DRZA 2QMHA 2F1HA 2QA5A 1G16A 3EAQA 4TMXA 4JJKA 2WWIA 4NCIA 2QRZA 1TAGA 1Z08A 4ZI3A 4BLRA 4GOJA 5JRJA 1TQ2A 3AEZA 1S3GA 4HAWA 3X1YA 3SYKA 3ZIAD 1KZGB 3ZQJA 1SVOA 3PEYA 1SXJC 4UKDA 4C0LA 1ZM9A 3NIBA 4OL0A 2RGDA 3U3RA 3SC3A 5DYIA 2Z83A 3C5CA 1Z2CA 5KNCA 4HB2A 4HB0A 2AR7A 1MO4A 4Q1DA 5FTKA 1MR3F 3KKNA 3MJRA 4XTCS 4P4SA 1TF2A 4G1UC 2BIFA 4L8GA 1KI1A 3ECCA 2O8BA 1LNZA 1XEXA 3F5FA 1N0VC 4MKGA 2BCJQ 2YV5A 5E3HA 3BH0A 3CRQA 2ZRAA 1JR3D 4TWZA 1X3SA 5FUXA 3TSZA 2X19A 1GVNB 1NKSA 1UEIA 1Q22A 4Q18A 2IXGA 4Z8XA 2EQBA 5DSZA 1Q44A 4NYJR 4BFWA 1WBDA 1F48A 2QAJA 5JMTA 2XOKA 5G40A 3GJXC 1VYVA 3RANA 4KVGA 3SQXA 4DDWA 1OFTA 3NG1A 1PLLA 4LZZA 4Q9JA 1U9IC 2QT0A 3C7KA 5DH9A 2R62A 3WNDA 1JPJA 2QQ0A 3QY0A 4TTPA 1VCOA 3LD9A 4B48A 3D3QA 2FDCA 1JEEA 1X8JA 4PSKA 2I1QA 1ZVQA 3BH6A 3LY5A 3A6PC 3PITA 5JJKA 3LAWA 1YR8A 4FCWA 4LHWA 1Q1ZA 4HAZA 4CYMA 4BLOA 2R6GA 4PC1A 3MGCA 4QOSA 1R8QA 1PLJA 1S0UA 5SZIA 3WBJA 3LO5A 5CYOA 1DTSA 2NO1A 5FL7A 1OFUX 1E0SA 2CNWD 4KO8A 2RGEA 2L0XA 1XTQA 4QBFA 3VU9A 2ZE5A 4C9BA 1N6RA 3I32A 2F6RA 1OKKD 3OAAD 5TV2A 2JAQA 4OHVA 3GLFA 3FPAA 2R6FA 3QVVA 1LB1B 2C95A 4Q9HA 2XX3A 3W3ZB 1OFHA 2V6IA 1N0UA 2KB0A 2ZJOA 2ZRPA 2V1XA 3H0KA 1JQLB 1W48A 4AYXA 1NRJB 3QUSA 4OI1A 1P2UA 2BEJA 2C5LA 4Z51A 1IXSB 1P9NA 5CB6A 4MKIA 1DAIA 2OBLA 5KOYA 1LV7A 5G3ZA 1QHNA 3AVVA 5J5CA 2QU8A 1DELA 3LW7A 3R7WB 3ZD6A 4BLQA 3BXZA 3P4XA 2D62A 4JYBA 1ZYUA 4IVQA 4A2QA 4NPHA 3ADCA 2QSZA 3TSWA 4C0HA 4HDOB 3MJHA 5D3MA 1L7VC 3BFKA 2QM8A 5FUYA 1W1WA 4Q7JB 4C0QC 5HPYB 1CJVC 4DSNA 4Q1BA 1OIVA 4V0KA 2OV2A 2IS1A 1YZTA 2YWFA 3U6KA 2VSFA 5L3SB 4NYIR 3THYB 1S9DA 3BAFA 3MLEA 2VH5R 2NPIA 2PJRA 1T0JB 1XJQA 1HYQA 3ND9A 1UJ2A 3SHFA 4KFTA 2DFKB 1S1MA 2NMVA 2YINC 1W2HA 2Z4SA 4NCHA 3I5YA 4A8JB 2QMUA 3RSOA 3BB3A 4EPRA 2J7PD 1JR3A 1M7HA 3CWZA 5TARA 1DAMA 2F1IA 3EG5A 4HB3A 1G3QA 4IVRA 5LDDC 3NDBB 3RS7A 4B6EA 3RAPR 2A30A 4M1WA 2FSHA 4I99A 1YVDA 4EJSA 2GEDA 4EIWA 4QBHA 1DAKA 4D0NA 3VTKA 1SVIA 4A0FA 4N0DA 2D3WA 1G291 3ADKA 1UADA 4JJZA 4Q1FA 3U7HB 2IWHA 721PA 2Z4RA 3QXXA 2WVJA 2OESA 3QG5A 3CF2A 2WSMA 2CE2X 4JBYA 3AV0B 3VR3A 2WWGA 1US8A 2ODNA 1W36B 1DO0A 3ZD7A 4UQOA 2ANCA 2VHTA 4H9GA 2CBZA 1JQJC 3CF6R 4J0QA 3SR0A 3I62A 1KMHB 4US0R 4FW9A 3CRRA 5BN5A 4CW7A 4MUAA 5LD2B 2A3RA 3B1YA 3RNLA 2E1RA 4WZBE 3ZH9B 2V1UA 4M4SA 4POAA 1T8TA 1Z0DA 2MSEB 2CNWA 2WKRA 2NG1A 4NBSA 2F1RA 4P4UA 4JIMA 4MITA 3EZ9A 4JVNA 4IKEA 5JWRA 1OKKA 5KYKA 3OAAA 4W9MC 4MYUA 1TL7C 3GLIB 3N5CA 3FTQA 4TZ0A 2XNSA 3AKYA 2XZOA 1KTVA 3DHWC 5SZHB 1V5WA 3K9GA 2R6DA 3SU8A 2MSCB 2IYSA 4GFDA 3GLFE 1GL7A 4WVFA 5LBIA 1GRQA 3D31A 3PFIA 4OK5A 1W4RA 2ZQ5A 4CVNA 3AVTA 2FPMA 3AVPA 1FPMA 1XWIA 2IYQA 2OCBA 1H65A 2YOFA 4JLVA 1AIPA 1FUKA 1XTRA 2P5SA 4ITRC 2CHVA 1NVVQ 4TLEA 2ZUCA 3TQFA 2DHRA 4XD7D 3TAUA 3NC0C 4TN1A 4JMPA 4ZCLA 1G6OA 2REXB 4M9SA 3KKOA 4OHXA 3T12A 2UKDA 3AKEA 1KI7A 2R9VA 3B9PA 2P2LA 3OEED 2CCKA 4RCYA 3RRZA 3VR2A 4FMCF 2DFLA 4KV9A 4Q48A 4CZ2A 1CR0A 4EPWA 3PUYA 3U7EB 4EQ6B 4F93B 5LB4A 1GZSA 4PHGA 4GT1A 1G8YA 2OLKA 2FA9A 2N42A 2WBLC 3IEVA 1SKYE 3B78A 1E2GA 1CR2A 2CK3D 2WAXA 2XITA 3WHKA 4FINA 5B57C 2DWPA 5EE3A 5DNYB 1P3JA 1AM4D 4JZKA 1F2TB 2J7PA 4JBXA 1MH1A 4ILEA 1EX7A 1XJCA 2CLDX 3NXSA 2RGGA 4GSYA 3WXMA 4E09A 3GLGE 3C4JA 3KDSE 3U60B 1E4YA 3WNBA 1JR3E 2VF7A 1GL6A 4PSVA 2BCGY 1Q3TA 3NBXX 4Q4AA 4BLPA 4B34A 3UKDA 5G41A 4FCTA 2R65A 2WJGA 3B60A 3LQQA 1J2JA 4EFNA 5JS7A 3K53A 4Q4HA 2XB4A 1ODFA 2ZSEA 4GOXA 4DCUA 3O8CA 1EWQA 1SULA 4KYUA 1M8PA 1XD9A 5K8LA 1BO6A 4NYMR 1JI0A 4ZDJA 3V00A 1CBUA 4E5UA 1J99A 4FN5A 1JEDA 5FUWA 4OKSA 1W49A 4XWKA 2VP9A 1R7RA 2G83A 4LBWA 4OI4A 5F9FA 4BFXA 2JJ2D 4O0MA 1E0AA 1TMKA 1E32A 2AK3A 4S35A 5GJVC 1E2IA 2QPOA 3TR0A 3ZJYA 2QGZA 2FEMA 4Q66C 1NJGA 2BDTA 1SQ5A 4BZXA 4I81A 2HYDA 4Q1AA 3QBTA 4I1UA 2LWIA 2C04A 3QKRA 4URVR 3KB1A 1E9EA 2W6JA 2IS2A 2CCGA 1RJ9A 3HYRA 1CRQA 2QP4A 4DWJA 2ERYA 1E9SA 2VRWA 4URXR 3RS4A 4D25A 1OIXA 3AUXA 4JSYA 3VR4A 4GOKA 5EJEA 2N46A 1OFIA 1P62B 2G6BA 3PUZA 2P65A 4N0EA 2EFGA 3WRXC 1XPUA 1E2QA 3UWKA 2WTUA 3HDTA 1P75A 3I3SR 1Z83A 2JLVA 4XD7A 2QMOA 2QPTA 4RJLA 4BZQA 2YJTD 3RS2A 1CJKC 1NN0A 3CZQA 3FHTA 4KBGA 2WMNB 2NO0A 2YOGA 1WMSA 1EGAA 2ANBA 2AD5A 4IOKA 4B71A 5IT5A 1SXJB 1MABB 2WJYA 3QF4B 3FMOB 1AK2A 1JXOA 1VTKA 3ETLA 1G5RA 2B6HA 3OEEA 1CS4C 1J7KA 1T3LA 5EE0A 1NMYA 3UATA 3W6PA 1UPTA 4DZZA 2Q6TA 3AF2A 1EFUA 3ADBA 3ADDA 5CK5A 3T1TA 1X6VA 3KQUA 2DR3A 4ZDWA 3VR1A 4Q4LA 4YMVA 1FTNA 4DJTA 3FYHA 3TIFA 4BLTA 4HUQB 1GFIA 4LCBA 4OHYA 4O25A 2GVDC 4RVCA 2ZTSA 1XCMA 3SDZA 4ZKDA 1E98A 1KI9A 5CM9C 3NKVA 2IF0A 1DS6A 4OQMA 3FOZA 3I8XA 4B3DA 4M1OA 4AKHA 1IQPA 2JCSA 2TMKA 1XF9A 1RC8A 4MDEA 3IBYA 5JI2E 2A5GA 2B7CA 1E96A 1XB2A 4DCNA 1G3MA 2VHJA 1TU3A 3LX5A 1CR4A 4XOIA 3EA5A 3THWA 3U44B 4DHEA 1SVKA 5G53C 5EUMA 1G7TA 1YZQA 3NC1C 1FNMA 1OH5A 4DDTA 1IXZA 5JSZB 4QHSA 3IO5A 3WYAA 1ZM3A 2QUZA 1JNYA 4RKEA 3U3MA 1D2NA 4UNSA 4BFYA 1ZRHA 2HXSA 5DN6D 5JJLA 2EVWX 2GA8A 2ZR9A 4C2UA 4Z1MD 3QPUA 2OT3B 4YMTA 3DL0A 4V03A 5EUQB 2AXPA 1R6BX 2JDIA 2IHYA 2W58A 2DY1A 2O0KA 1E2PA 3T06B 4NP6A 2JJ2A 4GI7A 2YC4C 1MKYA 3A1UA 2FH5B 1AS2A 4D81A 2VQSA 1OB5A 2D2FA 3NVAA 4DSOA 1E1RD 2QBYB 2OBMA 1FP6A 3CH5A 2ZEJA 3RRMA 5FBLB 1E94E 2B8WA 1VG9B 5KDDA 1PZNA 2QTFA 5G3YA 2BVNA 4BASA 2V54A 4ZKEA 1KI6B 4JS0A 1KI8A 3SQWA 4LX0A 4OHZA 1ZC4A 2NGRA 1W47A 3QXSA 2OAQ1 4B35A 3AP3A 3UANA 3DM5A 5ELXA 1G5TA 1G8PA 2OCPA 2QRNA 4YONB 1G20E 4URWR 1GOTA 1DOAA 2V4ZA 5CIQA 3HR7A 5FI1B 4ZIRB 1W36D 5LD2C 2WAYA 1BS1A 3TAHA 3PEVA 3BIFA 5JI3E 1VDZA 4TLDA 2ZSBA 4YC7A 4UNPA 2JLZA 4I1VA 1IY0A 3ZYCA 2ZSAA 5UKDA 5DO9A 4OHWA 3KQHA 3T61A 2KBFA 4PSAA 3NHBA 3MAAC 4Q47A 3MWYW 4JKYA 3SS8A 4Q1EA 1IJEA 4RZUA 1E2FA 2BHRA 4ZV4A 4L16A 2ZREA 2W83A 4IJMA 3GLHB 1B23P 5E7JA 1IN4A 1S8FA 1FP7A 1XJ0A 2BOVA 3BGWA 2FSGA 4LWZA 2ZE8A 2JLXA 2G0TA 3T5DA 1KOFA 5FOTA 3QKUA 2ZJAA 1QHHB 1NMZA 4WXRA 5JEEA 4HDQB 3RYTC 3TUZC 5KSOA 4CEJB 1A2BA 4QRHA 3DOEA 1GM5A 1YR9A 3A8TA 5DHFA 1U81A 3IPXA 3W34A 3AH8A 4B3CA 4TQAA 5FTMA 5IK2D 1F5NA 3L8ZA 3PEUA 4M21A 4C0AC 3CX7A 4P0TA 3A4LA 2B8TA 1KI4A 1ZNYA 2F1JA 2D2EA 3ZDQA 4TTRA 1AGRA 3NWJA 4TL8A 2PH1A 5DN6A 3TLXA 3FDIA 3AP1A 3GJ0A 3GCGA 1GG2A 2HJVA 2GESA 2P6RA 2XZLA 3MUFA 4KBFA 2DBYA 2YYZA 4PZZA 3THYA 2EFCB 2H57A 1AKEA 2A7QA 3U3OA 1EK0A 1P4SA 1AN0A 3W5IA 2IHBA 5JHHB 2GJ8A 2F9MA 3H4MA 3ZVNA 2H1LA 4P3YA 3LW8A 4A8JA 4JL8A 3TR5A 2WM9B 3QIAA 2GEVA 3GEHA 4U5XA 3ZVMA 4EPXA 1KAOA 4PX9A 4DLXA 3Q7PA 3SFZA 4YDHB 2J5XA 3THXB 5A4JA 5ANRB 1E9FA 5L8VA 1DEKA 1OSNA 5LPNA 1Z5ZA 1QHYA 3REGA 1IN8A 1CLUA 2GILA 3QOFA 2YNMA 1Q1QA 3DOFA 5KSPA 1NG1A 1DAEA 3MWJA 5FH9A 3NTUA 1T3HA 4XH9B 2EWVA 5KO2A 5JWOA 1FNNA 2VBCA 3EASA 2AFHE 4M1SA 2EWWA 2J0UB 2QP9X 2VP6A 3BB1A 1M2OB 2W2XA 3FWYA 4XVRA 2RGNC 4A36A 2J45A 2GCPA 4LJ6A 3LRPA 2YVUA 4FMBB 2GTPA 1XTKA 3PUXA 5AK0A 2LKCA 4MH0R 2PT7A 2P5TB 5JHGB 1TQ6A 2ZROA 3P32A 1EFCA 2PZFA 1N25A 5CM8B 1SVWA 1XMSA 2W0SA 3OIYA 2ZJ2A 3W6NA 3SJBA 1E0KA 3BFXA 5J47A 1YQTA 2IYZA 2IYWA 3DZDA 4TT3D 3NBYC 1NY5A 1II8A 3ZZTA 3DO6A 1COWD 4A82A 4M1YA 3TUJC 1NKTA 3FMPB 4F4JA 3GLIA 3BC1A 2QN6A 3RHFA 1BOFA 4BWYA 3ZS9A 2C9CA 2IYTA 4E03A 3AM1A 1KMQA 3IKJA 2XTNA 4FI3C 3QENA 1OLOA 2P6NA 4Y0AA 2YC2C 1GWNA 3U7GA 4HLDA 1U99A 2VLIA 4QJ5A 3EW9A 2DCUA 4MYHA 1UBFA 1EXMA 5BXQC 1Q20A 4PAMA 1KIMA 4B73A 4AK9A 4LJYA 5IK2A 3EPKA 5FBVB 2A5FA 2VP5A 4ESVA 2OCAA 1HURA 2PMKA 4EFLA 3K09A 2FGKA 1TUIA 1CEEA 3B82A 3K70B 2O8FA 4JLDA 2BJVA 3U4QB 2VHQA 2IS6A 4R2HA 1RRPA 5K8TA 2GXUA 1V43A 2CXXA 2ZITA 4D6PA 2XJ4A 1H8HD 4MGZR 1SXJD 2W6ID 2QTHA 5DIFA 2CE7A 4DLVA 4YXWD 3I61A 4A6PA 5H68A 3QKSB 4URYR 5EP4A 5FOSA 1U94A 4FMDF 3B2EA 3BH7A 4KHZA 5GJWC 3TQCA 4QL3A 5FTNA 3EIEA 5KDLA 4L15A 1KDTA 4B2IA 1UFQA 1YRAA 1N6IA 3BB4A 1OXVA 2AHOA 4KU4A 4LC0A 1F2TA 5J4KA 4ESHA 2IUUA 2GBLC 3R9XA 1I2DA 1W4BA 2FF7A 2Q9AA 1YR7A 1KYIA 4M8NE 1AZTA 2BJWA 1IN6A 4MRRA 1UBGA 4DBLC 1F6BA 5EXTA 5FUVA 3L0PA 4JT4A 1L2TA 2QTVB 3SBDA 5JCZA 4NL4H 3B85A 4G01B 1Z6TA 5AJVB 2RB4A 4AWXA 4DSTA 1CXZA 2UZIR 1NN1A 3I8SA 4PPGA 3VNUA 3TVDA 4P33A 2AK2A 1I4TD 5E7MA 4RFSB 3QI2A 3REFA 2PMDA 2FJUA 1QG4A 4GBMA 4LOAA 1QDEA 2QI9C 2XB2A 1E9DA 4GZMA 1E1QD 1HQCA 3CNNA 4AG6A 3AF3A 4LHVA 4MRNA 5C4MA 1XXHB 3I92A 2V55B 3CB4A 4LHZA 3B1VA 1S1CA 3R8CA 2O8DA 1H8ED 1P61B 1XD2B 3B13B 4HEJA 4B6FA 2ZE6A 3IUYA 1KGDA 2VIIA 4ASUD 3AF0A 3FVQA 2GCOB 5FOWA 4YMWA 3OIWA 4G5SA 3K0SA 2ZRNA 4TT3A 1M7GA 2FN4A 1YHNA 1OIWA 4ARZB 1COWA 1ZD1A 3L0OA 3B1WA 4JL5A 1U8ZA 1FOEB 4FWIB 2EYQA 1JXMA 2NPFA 1KJZA 4DB4A 4MYCA 4RD4A 1DG3A 5IDVA 4B44A 1VIAA 3GLIE 3Q9LA 4LYAA 3TW4A 1IAQA 2Z43A 3FKSD 3WNCA 2QAGA 3L8YA 2IX3A 5F3WB 4K46A 5TB5A 5B2ZA 1FFHA 2IXFA 1E6CA 1J70A 3S1AB 4DT1B 1N6PA 3L0SA 4KCGA 4R71A 4F4CA 1YZGA 4TMWA 2GHIA 4QM6A 2AXNA 1H8HA 3PJRA 4KFRA 1SXJA 2W6IA 1D5CA 1MABA 1ZMXA 3MCAA 4HLQB 4YXWA 3QF4A 1FQJA 3VKGA 2CVHA 1BKDR 4FXPA 4ABYA 1S4QA 3VNVA 4RFVA 2AWNA 3UPUA 1W0JD 2AD1A 3WP0A 1U98A 2ZUDA 3CPEA 1WF3A 4HUQA 1ZAKA 4YQFA 1JJVA 5F2EA 4BEJA 2ONKA 1XNJA 2GDJA 4KI0A 8OHMA 3IIMA 2GF0A 4YDSA 5E7IA 4PPNA 3RDPA 4F4IA 2WZQA 1Q21A 4C0SA 5E4FA 1Q57A 2JJ8A 2WJVA 1GKYA 3EZFA 3MD0A 5F98A 2ZI4A 3IILA 4IOJA 1AQUA 1O3YA 2D7DA 3LBNA 2ZR0A 4KXFB 3RWMB 1ZJ6A 2QORA 4UNQA 1TQDA 4C7OB 2R2AA 1ZU4A 4MUBA 2O5VA 2C9YA 2YWEA 4QGGA 4WZAE 1P9WA 3LNCA 1G7SA 4LPSA 1U9IA 1SVMA 2WKQA 4LY6A 1NL3A 3DKVA 5GVRA 2GXQA 2FZLA 1E1QA 4URUR 2VA8A 1P5ZB 1F2UB 1KKMA 1R0WA 1FZQA 4JLPA 3THOA 5J4VA 3TSOA 4AY2A 2BBOA 1W5SA 3FHOA 2ZJZA 1H8EA 2ZU0C 4ZDKA 3OHMA 1LF0A 3P4YA 1ZM4A 3GFOA 1F3OA 3MMPA 2BMJA 2WMOB 2F9LA 4UXIA 4ASUA 2HV8A 1VG1A 3EZ2A 5HE9A 4KJZA 1YJ5A 3AKDA 4EKDA 2IYVA 2GZDA 1KNXA 2ZUBA 4KODA 1NBMD 3U3JA 2W6JD 5AUPB 5JZVA 1R0ZA 1OXUA 4TYQA 1XZQA 2P0EA 1X86B 4MGKR 521PA 1KK3A 5EP3A 4F7WA 2FPLA 4HLUC 4II7A 1QF9A 2RGCA 2ZSDA 4BQSA 3AUYA 4A0GA 2C9OA 4KLNA 4ZPXA 2FGJA 1KK0A 1Z6XA 2BMEA 4MQBA 1AKYA 2IEYA 4DLYA 1LFDB 1KI6A 2NTYC 4IDPA 3SZRA 3FKSA 4DKXA 4NDZA 3B7GA 1C4OA 5HZKA 1X1SA 1SVSA 5AWFC 3T34A 3ZVLA 1GL9B 3TBKA 2QNRA 1GDDA 2GF9A 1P2VA 3GJ8A 1RYFA 4C0BA 2WJJA 3OFNA 4DLTA 1LS6A 2OLJA 2AKYA 2GEUA 3WMEA 1G4UR 3PVSA 2CHQA 2GZHA 3PUVA 4B3XA 1AZSC 4QM7A 2RGBA 2YWGA 3DMDA 3CKLA 2F7SA 3RS5A 3UMRA 2ZRIA 3Q8XB 4FD2A 1Z3IX 4BFUA 3LBHA 3OIVA 4TMVA 5A0FA 1NSFA 2KJQA 2RH5A 3K0CC 3RRYA 1E0JA 1MO6A 3V4FA 1ETUA 1YZUA 2NQ2C 4OK3A 2GKSA 1VKJA 1W0JA 2JATA 1RRGA 1SXJE 4AYWA 4F92B 5HKKA 1ESMA 3K0EA 1XZPA 3WYFA 4TMKA 5JLJA 3QXCA 4Q03A 1HY3A 4JL6A 2FNAA 4PO8A 4PO1A 1K6MA 1AGPA 1KY3A 3CRMA 2GJKA 4P4SB 2QM7A 3HR8A 3PQCA 1Q1EA 1Z0JA 4OYHA 4Q19A 4Q7LA 1OB2A 5EZ5A 5KNBA 2OZEA 1N5LA 2BC9A 2XAUA 4M1MA 3VFDA 4EFMA 1U2RA 1QHHA 1XEXB 1E9RA 5AUNB 3ZZUA 4CEJA 3ZZ0A 2H8KA 821PA 3TRFA 3IIKA 2WICA 3SOPA 3K70C 1ZUNB 4XJXA 5IRCD 2VP2A 3VR5A 2XTMA 4LJ5A 1YU9A 4B3GA 4LYFA 2GRJA 4NYJQ 3G5UA 3SNHA 3EC2A 3CPHA 1EX6A 1G1MA 3E1SA 4UNNA 2FFBA 5FPHA 3V9PA 1WCV1 3EX7C 4ZCMA 1S3SA 1KHTA 4CT4B 4HUTA 2AFIE 4KFSA 3CONA 4XSHA 4D0GA 1YKSA 2F43B 3DVLA 3K0FB 4C2TA 2JDID 2FOLA 1ZNZA 3X1ZA 1FW6A 1DE0A 2Q9BA 3AGPA 1G5PA 2FSIA 2XSZD 1OV4A 1N6NA 2XJ9A 2KI5A 2CJWA 1FTSA 4CDGA 1ZCAA 1G18A 4F91B 5L3RA 2OFWA 2ZRBA 3TK1A 4JVSB 1EWRA 1ZIOA 4PC7A 3CO5A 1CR1A 1GSIA 1TF5A 4Y0VA 4B43A 1IN7A 4IOLA 3KKPA 1ZU5A 3CRVA 1NBMA 3AF4A 1DVRA 3QBVA 4JSTA 2J41A 5F9HA 1Z6GA 3G82C 1CF4A 1E99A 2SHKA 3NBFA 1KSFX 4LYHA 4KSBA 3KB2A 4TQUS 1VECA 2JJ1D 3GQBA 1LF5A 3R8FA 3KTAA 1VIYA 4B75A 4QGFA 2A2ZA 4TL6A 3SI7A 3WMGA 3CX8A 3KXKA 2IK8A 1GAJA 1JJ7A 1BMFA 4OK6A 1FX0B 1X8LA 4URZR 2ZM5A 4IXNA 4RD6A 2O8EA 1RRFA 2BKEA 2J0UA 2XNDD 4M9ZA 1VYUA 4C0JA 4JVLA 2GXSA 5JCPA 3P20A 3CW2A 1OXXK 5EE5B 5L3QB 1A1VA 4M1KA 4DIDA 3RC8A 2O8CB 2JIZD 1LTQA 5FPYA 3RS3A 2IUTA 3RC3A 2Q9CA 2CEAA 3EWSA 3OZXA 2ZJ8A 1CULC 2MSDB 3SEAA 5KHOC 1KJYA 4LGMA 1GRRA 5DLQC 4CGZA 2ZI3A 1IN5A 4TQ9A 1SKYB 2YHSA 3V4RA 4U7DA 2VSXA 2UVQA 3UWOA 1P9RA 1FMLA 4NYIQ 2ORIA 4L4UA 2VF8A 4JKIA 3I4LA 3MFYA 1YRBA 4Q00A 4C3ZA 1OH6A 1ZD8A 5GJBA 1U0HC 5K8UA 4P4TA 3GD7A 3GLGB 4DSUA 2J7KA 4ACAA 4G5OA 1P7CA 3GJ7A 3M6AA 4W5JA 4LRWA 1N5JA 4KITB 4M53A 1BH2A 3ND8A 5JWHA 1IM2A 2WOJA 2IBMA 1G6HA 2HF8A 2Y8EA 1P6XA 1IBRA 1RE0A 1S9HA 4M1TA 4OJKA 5BN4A 2NIPA 3OE7D 2WWXA 1G17A 3CWQA 3U4QA 3IO3A 2WIBA 3LH5A 4GNKA 3EIHA 1R0YA 3VKWA 4XVUA 3R20A 1NLZA 2W00A 5DI3B 5CLLA 2FG5A 2ODEA 2ORWA 3F8TA 3O8BA 5AUOB 5B58C 1GKUB 2H7VA 2MMCA 1GUAA 5EE1A 3ZQ6A 2XSZA 2FSFA 2R44A 3LXXA 2ODWA 3PG5A 4HDCA 1K5GA 3QKSA 2J87A 4KYIB 4Q02A 4US1R 4UNRA 4IEIA 2JLSA 4I4LA 2FX3A 4RSGA 3N2EA 4D2IA 1NIJA 4Q4JB 1UF9A 1M7BA 2HT6A 3EZ7A 5KSYA 3KFXA 2X77A 2A5YB 1XCPA 4WOPA 3FKQA 1WA5A 2UZ3A 3FE2A 2ECKA 2GZAA 1A7JA 1R2QA 3ASZA 4HI0E 1E2EA 1LS1A 2CL7X 2BM1A 2VEDA 4JYCA 3TH5A 1S2MA 1TEXA 1U8AA 2JJ1A 2ZJYA 1NN3A 3CZPA 5TDHA 1Z63A 1NBME 4AI6A 3CLVA 3GJ5A 4B2LA 2IUSA 1E2KA 2PZGA 3FMFA 4FWTA 3D8BA 2QL6A 4O2LA 4PTLA 5JRZA 4LV5B 2PBRA 2ZANA 3PIRA 3JVUA 3VHLB 1I4DD 1RZ3A 1ZM7A 4RD2A 3E70C 3NBZC 2XNDA 3JZMA 4EPYA 1K8RA 1TUEA 5SZJA 3UK6A 1CJUC 2QQEA 1HA3A 2X1VA 5B64A 4X8OA 5FPKA 2DPXA 2PCLA 4LJ9A 1UEJA 1UM8A 2JIZA 4BFVA 2IXEA 2LKDA 3HU3A 1Z28A 4QBIA 4HLCA 4R98A 5DGXA 2WV9A 3QXHA 3L43A 1YR6A 2WWHA 3B1ZA 3CF0A 4HAYA 3KQNA 3PENA 3DZ8A 3H1TA 5B30A 2FWRA 3P1JA 2HCJB 4Q7KA 1G4AE 2W0MA 2Q0HA 4XWAA 5P21A 2GJ9A 3EWAA 2GXAA 421PA 1GILA 1N5KA 2C99A 2ZAMA 5AJXA 1KK1A 4V0MA 1PUJA 4GZLA 2J0QA 1R0XA 1VHLA 2FFAA 4DLWA 4LBZA 3C16C 3R7WA 3EC1A 4RKFA 4PFSA 5HR5A 5FOVA 4P31A 1TADA 4G5GA 3W5JA 1SHZA 3QQ5A 4JLOA 1GIAA 1IJFA 5FOUA 1Z0KA 3GMTA 3UMSA 4LHYA 3NHAA 2NOAA 1UAAA 1ZW6A 2OCYC 4OQNA 2BBTA 4RY2A 4JLKA 4HATA 3S1AA 3VAAA 4C4PA 1IY2A 4EPVA 4O2RA 2PT5A 4QC2A 3OE7A 3WBKA 4D0LB 2F3RA 3PCRB 2QSYA 2OUKA 4A1FA 1TEVA 1ZIPA 1VCNA 4JLAA 4PO9A 3RABA 4CRWB 4CEIB 2FFHA 4UXHA 5J4LA 3AGQA 1G3RA 1X1RA 2RGAA 5L3SA 3CNOA 4Q4HB 4LYJA 1F60A 2W2TA 3SYLA 2ZI5A 2V8OA 2XZPA 4QKQA 3Q72A 4ACBA 1IOZA 4RZXA 4NYMQ 4DUGD 4TZ6A 3TUIC 2IS4A 3QVUA 3FB4A 5H70A 1Q12A 3CR8A 4L5BA 3L0IB 2WOOA 5C1BA 4JVMA 1VMAA 4DB2A 4OBEA 2GJAA 3CIOA 4PC3A 4D4JA 1U8YA 1KY2A 2IT1A 2ZRMA 3LQRA 4P32A 1W0KA 4TLBA 4QJ4A 5TY0A 3WP1B 4DLSA 2YKGA 3B5JA 3KL4A 3CBQA 3FGNA 1Z6YA 4GP6A 1RVDA 3Q5DA 3U3KA 2ZPTX 5TVKA 1ZP6A 1NLYA 1MO5A 2WJHA 4A92A 3QKRB 3OIUA 4H1UA 2DB3A 4HYYA 2V7QD 1GNQA 1VYTA 1D2MA 2FPKA 4BFZA 1RJ9B 4TYYA 1WP9A 4NZYA 4K81B 3IHWA 1E79A 4M2LA 4L9SA 5JBQA 1RW4A 5C46F 3B8HA 1QG2A 1KMHA 2J59A 3GP8A 1YZNA 1U0LA 5KPDA 1XTIA 4WZ6A 2OFOA 1XTJA 1AA9A 3U7FB 1ANKA 5FI0B 4U02A 3T1QA 1YE8A 4QXAA 5EXXA 2XXAB 1QVAA 4DCSA 4GDFA 2A78A 4KAXA 2V6JA 1VHTA 1OXTA 4QHYA 4ZDIA 3AF1A 1KAGA 3JVVA 1NP6A 1Z06A 3T1OA 3UIEA 1KO4A 1G41A 1AS0A 1ESNA 1HTWA 5J4YA 2RGXA 1WBBA 2QGNA 3W90A 1II0A 2H16A 4RCZA 3BERA 5FBRB 2IYYA 2C77A 5DHAA 4Q01A 1XP8A 2NZJA 4GP7A 3F3YA 2JASA 1NY6A 3QEOA 5HE8A 1Z47A 3D7MA 3Q7QA 4KFUA 3PUWA 1OYYA 2ZU6A 1VG8A 4V0OA 1NVVR 3KQKA 1IXRC 1ZBDA 4BFSA 1KI3A 5CK4A 1CJMA 4V0ME 1JALA 4IDOA 1N6HA 2PX3A 4DLRA 1KK2A 2G1KA 2ZRLA 1IONA 1KSJA 1E2NA 3DMNA 1BYIA 4EPTA 4TYWA 3P26A 1RKBA 2NO9A 2DFNA 3BWDD 4BFTA 3KJHA 3CH4B 3P27A 2C03A 3DDCA 3NDPA 2B92A 2OXCA 4NH0A 5FL3A 4MYTA 2HCBA 2J9RA 3GJ4A 4EQ6A 2V3CC 3KUDA 3SE0A 2OM2A 1WB9A 3LLMA 5J40A 1EFTA 3QKTA 3HJNA 3HPQA 2AWOA 1PJRA 2QEQA 2EFEB 1N5IA 1JB1A 2B7BA 1LVGA 1T91A 4DUGA 2F3TA 3SJZA 2ZJ5A 3I1FA 5AJWA 2D4HA 4DLUA 1XCGB 3A36A 4LI0A 4IOMA 4TSFD 3KJEA 3K0AB 5EXSA 1HH4A 1Z6AA 5TXGA 3WRYC 1DO2A 1CTQA 4UJ5A 2VP0A 1C1YA 1QHIA 2KSQA 3DM9B 3EARA 3G0HA 4A2WA 4EJSC 3EA0A 1MV5A 4BLSA 4DLZA 4UXJA 1T9HA 3SJCA 1T5LA 4EAQA 4QBGB 2ZYUX 3A37A 4X8LA 4NCJA 2BEKA 1YZLA 3K9NA 1E9AA 4JLNA 1LW7A 2FFQA 2V7QA 3VR6A 4G5RA 1P2SA 1CKEA 2Q3HA 1Z22A 2BBWA 2F55A 4WIAA 3L82B 5FBWB 4MDFA 2ZYVX 1D8TA 4B2PA 1KDOA 4TL9A 2F43A 1QBKC 3H2YA 3K0FA 1J8MF 3IQWA 5A5GA 3TVTA 4OQLA 3M4YA 3UXMA 3GFTA 2RGNA 3MWLA 3SYNA 3AB3A 2X2FA 4D82A 3HP1A 1N6LA 1UKVY 4QGHA 2VHCA 4IFBA 4PZYA 2ZRHA 1JAHA 1RRCA 5DI9A 4JLBA 3RWOA 1ZC3A 1KKLA 1U0JA 1TQ4A 1M74A 2ZRGA 3L2OB 3O8DA 5K8IA 4CEHB 1ZNWA 4XWOA 2OHFA 2CL6X 5GJCA 4X8HA 4BPBA 5FR1A 2HLDA 1RIFA 1HQYE 3QPWA 4HSEA 2RHDA 5FFMA 2EYUA 1GNRA 1OHHD 4C0KA 5FPTA 1P72A 3B9QA 1RYHA 1Z07A 5AR1A 4B32A 5GVSA 4IDHA 3CRW1 1E9BA 1KO7A 1NMXA 3CM0A 2PJZA 1DAGA 2ZETA 2EFDB 4C30A 4HZUB 3SFVA 1JPNA 3OFND 1N6KA 4B74A 1FX0A 2WKPA 4QFMA 4MRVA 2ZYTX 1DAFA 1KDPA 3JZAA 4A4DA 2ZRFA 4PZLA 3BOSA 4PHHA 2WWYA 1Z8FA 1HEIA 1G8GA 1XDBA 2G1JA 4D4LA 2W2VA 3NH6A 4OJQA 5L3QA 1EG7A 4AKGA 2O8CA 3AVWA 3ASYA 3X1WA 4NONA 5BYKA 4O3MA 4W5HA 1L4YA 3QE0A 1SVLA 2AX4A 3ZIAA 1G8FA 1G19A 5HKKD 1NSTA 1ELOA 2DWQA 3HWSA 1ZUIA 3HPRA 2ZVPX 4PQRA 2DYKA 1XFAA 3TE6A 4KVAA 1ZM2A 3K1JA 2JLWA 1TNDA 2O52A 3CR7A 5KPJA 2G0NA 2ZI9A 1NF3A 2VP4A 4OI0A 2WHXA 4IW3B 5AJYA 1G21E 2GNOA 4BRUA 3N70A 1XEWX 4PHTA 3QXJA 4TSFA 3AVYA 1DARA 2VPPA 4A9AA 4R9UC 5M04A 4E22A 3KJGA 1MRNA 3SBEA 2GBLA 4GPTA 3U44A 2HT1A 5CDFA 2IYLD 2DFTA 3GLGA 3H86A 4RZ3A 4FMCB 4Q1CA 5BYJA 1SHKA 4BRWA 5BN3A 1MRSA 3VQTA 2H18A 1XU4A 5JSZA 4QG7A 1HT2E 1RPZA 3QPVA 1XD8A 2ZRCA 2R6CA 621PA 5JS8A 5H1YA 4E07A 4DCTA 2BKUA 2JGNA 5EZ6B 1N6OA 4WW0A 2ATXA 4Q9IA 3MSXA 4DC9A 2OAP1 2WPDD 1TF7A 2VL7A 3GEEA 3VX4A 3PR1A 5DI3A 2REOA 1PLKA 1MT0A 1EESA 5IF9A 2QT1A 3BFVA 2KWIA 1NLFA 3LVRE 4RD0A 4AYTA 4IEEA 4Q5IA 1AQYA 2NZ8A 4PAOA 1JR6A 1QHGA 1W5TA 3HU2A 2GK6A 1R10A 1SGWA 4MRPA 1E2MA 3IHLA 1S96A 3W6OA 1XPOA 3MG9A 4Q21A 2J3EA 2FV8A 2IL1A 4Q4JA 4DEYA 1A82A 3TMKA 4IXMA 2QBYA 2ZRKA 1EFRD 4V0NA 1OF1A 5J4HA 4LK2A 3PEWA 2CCJA 3T15A 2CMKA 4BEBA 1C9KA 1AJEA 1UKEA 1JBKA 1W4AA 1D6JA 1OHHA 2ZYWX 1Q3HA 2D7CA 4N3NA 1NI3A 3AVXA 2HYIC 3R9WA 1II8B 1BMFD 4QJ3A 4AURA 1OJLA 4B76A 3A1WA 2PX0A 2IWRA 2G77B 2IC5A 1I4LD 4MKHA 4AIIA 2Z0MA 3IPYA 4N1AA 2ASEA 2JEOA 4HB4A 4QNRA 1L4UA 4ZIRA 4L9WA 1ZNXA 3BK7A 2IEZA 2G3YA 2QENA 3FFAA 4OQXA 1PVOA 2JLRA 1WDTA 5CJPA 5CYPA 2QE7D 4IFEA 5CIWA 2OFXA 4TYPA 3BRWD 1YZKA 2GK7A 4Q9LA 2GAOA 1KZ7B 1QRAA 3HU1A 2O8FB 4RD3A 2E87A 2QROA 5IHPA 2QY9A 1GP2A 1R5BA 3ZLJA 3OESA 4NE2A 2H92A 2Z6VA 3GLHA 4OI2A 4PQFA 1NJFA 3CNLA 1LY1A 4AKEA 4PAQA 5EQTA 2PEYA 2ZI6A 1HE1C 4TL7A 2A9KA 3BBPA 4EDHA 1D9XA 4K8OA 4G0NA 5CITA 5GADl 121PA 2O8BB 4WBSA 2ZI7A 3QEJA 3GFPA 1R5OA 2H17A 4M9QA 5CLQA 2EU8A 2CDNA 3WMFA 2KBEA 4BECA 5FOXA 4EUNA 3VMFA 1XMVA 3KUCA 4XIGS 4DDVA 2HXYA 2Q21A 4KLZA 1II9A 5FTLA 4AKIA 4A2PA 1MOZA 2GCNA 1A4RA 4Q9KA 3IEUA 4LPKA 3RVBA 2J0SA 3TNFA 1GNPA 1GRNA 3LDAA 3K70D 5CDFE 1TX4B 3BD9A 5JEDA 4BGDA 4B3FX 3UG6A 1HT1E 1J8YF 3AQ4A 2P6UA 1IY1A 2WPDA 4M22A 2CHGA 3VKHA 1Y63A 2PLFA 1DAHA 2QG6A 4HAVA 2X8AA 4LJ4A 4CEIA 1E2HA 1XMJA 3C41J 3EIQA 3GEIA 1NVUQ 4H1VA 4UJ3A 2BMDA 2H5EA 3CPJB 4NCNA 2ZIAA 3DEFA 4US2R 3RLFA 5CB8A 4PPFA 1T8UA 3I73A 3QJYA 5HTKA 4PR0A 1Z29A 5FTJA 1B0UA 3C14C 2WSSD 4LC1A 2YOHA 4PHFA 2DWOA 2PZEA 4AD8A 1T6NA 1UDWA 4TMZA 1CRPA 1EFRA 2O8DB 3J81k 4MKFA 4R7ZA 3OEHD 1T3SA 2C2HA 1G3IA 1OYWA 3THXA 3VU9B 3ZS8A 1NNEA 5DISB 2N1BA 3GLFB 2JLUA 3U61B 1G64A 4MRSA 4HLUA 2BWJA 1VCMA 2R6AA 1XMIA 2ZRJA 2BV3A 1P73A 1SKQA 3X1XA 5BQ5A 1R8SA 3U2QA 2OG2A 4XSGA 1X8KA 3KXLA 1CU1A 4OQFA 5AUQA 3WY9A 3LXRA 3RS0A 3SN6A 4A0HA 2JLQA 1KJWA 3VHXA 2QAGB 1Z0IA 3A1SA 3I5XA 2IYUA 1RFLA 6Q21A 2QE7A 2Z5FA 3MWKA 2HUPA 5D3MB 2XXAA 3BS4A 2NO7A 1E3MA 1N0WA 1G3UA 2P3SA 3MRSA 3QNUA 4LV6A 3PXGA 2VO1A 3Q5EA 3NH9A 2HEIA 4PC2A 1Z2AA 3R9IA 5KU1A 3K0CA 2ZXUA 1XX6A 2IA5A 2J0VA 4CIDA 4CF7A 4HAUA 5C4GB 1QHXA 2OSBA
chains in the Genus database with same CATH superfamily
2AIRA 2I3BA 2Z09A 3I83A 3G5LA 4ZI2A 4J91A 4OP1A 3SLKA 1QWOA 4YRAA 3DV0A 3R5SA 3WA7A 3O91A 1Z75A 2X0RA 3DAPA 4OMUA 4CKYA 1M5RA 1J7JA 1TTTA 2IF2A 4MUHA 3GZ4A 4PGAA 1N2CE 4WAUA 4E5MA 2PS9A 2CK3A 1BDHA 2F4NA 5LLTA 3UA4A 2YV1A 3AP2A 2IYRA 4E21A 1MO3A 4G5QA 3LV8A 4MZDA 4IJVA 4REQB 3OBBA 5LZ9A 5E6UB 3D2LA 1WCIA 2B20A 1XELA 3QFTA 4GLBA 4CKBB 3CNQS 1R4AA 3BXGA 3KR9A 2EZ4A 2HA4A 3OM0A 4L72A 3DPUA 4Q05A 5CEFA 2WJPA 4G67A 1FFYA 2R8ZA 2WWWA 3A4NA 5E1MA 2FDRA 4WPGA 5CLHA 4B6JA 1BJKA 1E3DA 4YV1A 4L95C 4HNTA 3LVBA 3KXIA 2Y27A 3C6MA 2OILA 4MIKA 5CM2Z 1IHXA 4ZAVA 3WG9A 4LSGA 3U17A 4HZIA 1ONBA 1HNNA 2QTCA 2AJTA 2V9PA 1ISIA 3B3AA 3GRYA 2FXVA 2W6OA 2HF9A 4Y6QA 3RHZA 1IFXA 3A4VA 3SSNA 2DOKA 1H42A 1FYXA 2LTAA 3DOJA 5HKAA 3CVWA 1M33A 5K6AC 3GXOA 1NIPA 1DG1G 5C2JB 3B6IA 5SY9A 4QIHA 4F3KA 3TLGB 4BY9E 1XEFA 3LHKA 1RJEA 4KIUA 5HFJA 1GGNA 1Q50A 4C04A 1YIAA 1CQJA 1C8LA 2WSSA 3LX8A 4FI3F 3RUEA 4BP8A 1Z5WA 3MJCA 3TKLA 2WIFA 4M0LA 3UW1A 3NHRA 3G17A 3OZUA 4O4HB 3I1IA 1CS0B 3KT0A 3MWDA 4Z49A 1YBAA 3RUCA 1YQQA 3PU6A 3G7UA 1H4TA 2B21A 2EHJA 2W22A 2XA1A 4IDNA 4MUXA 4MINA 4FILA 1ZICA 2VDUE 4R1MA 3RYCA 4YRIA 1KJIA 2FWNA 3KPUA 2QPAA 4R1SA 3DBLB 2GQ0A 2QLTA 1A9PA 1F14A 2IZOA 4LJ7A 1V1JA 4OXKA 4P54A 4XTRA 2CXHA 3IBGA 4R0MA 1E79D 1H69A 4TMFA 1E9CA 4EYOA 2AG1A 3TTYA 1IHUA 3QOWA 2O3QA 4R2IA 1XBTA 4J7CA 2JLYA 3B6EA 2FR8A 4OJYA 5K2OA 2BM0A 2VFAA 1WY5A 3SLGA 1W36C 2WAMA 4MQLA 5GMOA 4KQ6A 1ECBA 4QHTA 1BG6A 3JQCA 1Z0AA 1GCAA 2Q4BA 3D2CA 3IE0A 3WSTA 2ODAA 2DE0X 2FUG1 2Q6KA 3BCRA 3HLKA 4GPAA 2UXCB 3HFRA 1JU3A 4TKUB 2P9HA 2WYUA 2Y66A 4BUJA 2GCOA 1U2DC 2EJVA 3O1JC 3C3BA 4HQOA 1PK8A 4LXTA 4RM3A 4C01A 1U9JA 2GD0A 3EHDA 1XEWY 5AFSA 3UH0A 5ARBA 5B7QA 3T9CA 2EW1A 4YMSA 1EM6A 2OWDA 2J1LA 4KXLA 3PS9A 3UB4A 4WA8A 3VPFA 2ZM6B 1JFFB 2BHNA 4IVPA 1HSZA 2VC2B 4NZOA 2Y4OA 4YMUA 4FONA 3ZGXA 2M98A 1WQ1R 5H7XA 3LTEA 5HM6A 1B6SA 2RI6A 1OH7A 1KSHA 1QHSA 4IIFA 2BI8A 3HUFA 1PE0A 1YXMA 2GVNA 3QLVC 2I4IA 5AW0A 3LWNA 4X92A 1G66A 4D26A 5B55A 4OKNA 4XW2A 1BIFA 5G0TA 2OKCA 1M54A 2QI9F 3T7JA 4JHLA 5CVCA 1N78A 3UCXA 5L3VA 3KIPA 3IAS6 3E1KA 1G7RA 1N57A 4MEBA 3NDJA 3LHIA 4PONA 3A4MA 4UAVA 3W3AH 5AOBA 3B1XA 4ZOLA 1NW6A 1ZIDA 3HACA 4MI3A 3VSDA 2WIAA 4D9IA 3DZCA 4H17A 5K8JB 2XEXA 3F9CA 2VHYA 2P11A 3A1VA 2ATCA 3JWJA 4FP9A 1U3TA 1C30B 2HMUA 3HDQA 4E88A 5EI5A 4BVFA 3KKMA 5JH7F 4INPA 1GV0A 1U7WA 2ZBPA 1GTMA 3CF4A 3F2IA 3GLKA 1FJGB 1G8MA 3CE6A 3K6RA 1C1DB 3BHMA 2QYHA 2X0DA 1RWBA 4V0LA 1FL9A 1W581 2AQ8A 2VLBA 2VF2A 2XYVA 2X0KA 3IGFA 1UKZA 4CM7A 5JFTA 3F7TA 4BKMA 2VSYA 1UK7A 4B40A 4BLVA 4QTTB 1J5EB 1M34E 4LTMA 5BWMA 1XYVA 1OU4A 1T6BY 2I8LA 3C1OA 3EZ6A 4RNDB 2PUHA 5FFFA 3IS3A 5KWSA 4TTQA 4ER7A 5CYGA 4ZTZB 4RESA 4LS3A 4FHEA 5AXCA 2J3IA 3W3AA 1ZJ4A 4PQYA 5IPFA 3KQLA 4G09A 2CL0X 4OJMX 1AUQA 2ZUFA 1G9XA 1V6AA 2Y1KA 4EABA 1ZW1A 2X9QA 2YJ3A 3UXHA 4QO7A 2ZJBA 5KDOA 1QVVA 4JBWA 4R1PA 3TGPA 5DYGA 4MVJE 3MCUA 1EU1A 4X1KA 4YT5A 1NXWA 1VG0B 4CM6A 4A15A 1VXRA 2E4XA 2J0EA 2V7UA 4DG5A 1HT3A 1B2RA 3D6TB 4OU5A 3SLRA 4AY5A 5I9BA 1GTVA 1Y4ZA 4MI9A 2IW3A 4FMDB 3EPLA 3K5PA 1R88A 1MAVA 3FMIA 2HCRA 2OOSA 2RAUA 4XWGA 3TJRA 1DRVA 4GYYA 3M1AA 4MR7A 3NHYA 5FX2A 4EL5A 3R6WA 1NG9A 1SBCA 1Z73A 1K86A 2QMEA 3CLRD 3WLKX 3ZEIA 2BTQA 1HE8B 4JLJA 2ZUTA 3TI7A 3LC7O 1DLJA 2QT9A 4WINA 1DRKA 1VHDA 1CF2O 3TLAA 5FUMA 3X2SA 1WG8A 2KYRA 1R6TA 4OPMA 3LYUA 2E4VA 3C3YA 4QQ8A 5T4FA 3Q41A 4IG9A 4GMFA 1ISJA 1JW9B 3M70A 1U04A 4WK6A 4ZCPA 1QIDA 2H48A 5TQ0A 3HBMA 4IHQA 5CJ2A 3NALA 5EHNA 4LJAA 3IQXA 1M1YE 3SHOA 3H75A 3TFOA 1R3DA 2FN9A 4RA9A 1B0PA 2MU1A 3DZJA 3A1TA 3UJBA 5F1YA 4DIMA 1IM5A 3WDKA 4EO7A 2QRQA 2JGDB 1DIGA 2C7BA 3MT8A 4UQPA 4MW4A 5KREA 2FZWA 2RAPA 4LUCA 3WKCA 4CIXA 1W6UA 1CIPA 2KW5A 3HS3A 2VWPA 3QUTA 4H3VA 4K5QA 5CPBA 3VUFA 3GJ3A 3WDSA 3P2MA 4D57A 1DKQA 1T0HB 1IM8A 3VZCA 2JLCA 1EGMB 3HJFA 1PUIA 3WAKA 3NEYA 2XCIA 1KI2A 1Y8AA 4I50A 4L51A 3UJ9A 4W99A 2PD6A 3UXYA 5LQCA 3JQ6A 1OTHA 2P8SA 2C9DA 2GETA 2PXCA 5HZHA 4HZGA 1FQKA 2X2EA 3M1IA 2Q4TA 5CFOA 4KIJA 3MT7A 3R6LA 3MEQA 2OY0A 5KNCH 4N5NA 1L7RA 3M1LA 3TM5A 5I3ZA 1Q0HA 2QAGC 5JSUA 2Q3MA 5DP2A 4C22A 4ZK6A 3ZJ4A 1BWRA 1CY0A 1FMJA 2ZRDA 2ERXA 3GGOA 4LSWA 1RXSA 2DPYA 2PSSA 1JR2A 3SZOA 4D80A 3S6JA 1CZOA 3A3NA 4NCIA 3EY9A 4OXXA 5AJTA 4B4VA 3FWPA 4IG4A 1TU0A 1E4EB 3UOAB 1TKCA 1Z8DA 4GOJA 3PFHA 2RDMA 3AEZA 1E3JA 4L3VA 3SYKA 3G5AA 3CKMA 1KZGB 3ZQJA 4R1QA 3RNOA 1BEEA 1SVOA 1LLQA 3EPRA 5E8JA 1SXJC 5LYJF 1Y3CE 1ZM9A 2JAXA 4OFZA 4HDRB 1JFSA 2RGDA 2HBYA 3U3RA 1R0KA 4CTOA 2NZVG 5KNCA 3EGDB 4D92A 3VH3A 4ATNA 1MO4A 1PP4A 1MR3F 2Z9CA 4K1XA 4Q9NA 1HDEA 4LXQA 4CN9A 1A76A 2YHIB 4WH0A 5KWJA 1TZKA 1KJQA 3I6YA 2OHVA 1RLTA 2JFFA 3GBVA 1WHSA 2PX8A 4X90A 2FPRA 4D3YA 3F5FA 3ENKA 2AYYA 3NNSA 3G02A 2BCJQ 5DGCA 2Y0PA 3CRQA 4WDQA 1U0RA 1JR3D 2Z2JA 1H6CA 3OLZA 2ZT6A 4RJKA 1ISFA 3A9VA 2GPAA 3DEZA 3M6WA 4M0KA 4WFQA 1WD7A 1NKSA 4AJ2A 3QP9A 1ZPDA 1LI7A 1TKAA 2O2GA 3AUAA 1M2VA 3EQ2A 2Q4OA 3FYSA 1ZH0A 4IWXA 4BC1A 4WXEA 4CFYA 4DQDA 1F48A 1KFKB 3IELA 5JS1A 4GBGA 5JMTA 3V3TA 3O7MA 3RIHA 1DAPA 1LPNA 1P3DA 3GJXC 4HXFB 4RIEA 3NG1A 4LZZA 4P82A 2QT0A 3C7KA 2O2CA 2ZDQA 1QO0A 4LVOA 4CL0A 2R62A 3F7MA 3OKFA 3QELA 2Q0QA 1QPZA 2RHCA 3LVFO 3QY0A 1Q0TA 1VCOA 3D8SA 4B48A 2BRUA 2P8JA 3E22B 3E84A 2CB9A 3HVRA 4NJEB 3PITA 3G9QA 5B7GA 1OWLA 3Q5GA 3FD8A 2PD3A 4YUXA 4BQOA 3T3OA 4HAZA 5ALLA 3IP6A 1Z34A 5EPEA 4HVLA 5EHIA 3NHLA 3CEMA 4MWDA 3IVGA 4PC1A 1JG2A 4IZIA 4TTJA 4Z86A 4QFBA 1PLJA 1P19A 1S0UA 3TLEA 3W7AA 5MFZA 1N4DA 2GEFA 3LO5A 5CYOA 1DTSA 1A5AB 3ZY3A 4DBVO 4EKNB 4BMZA 1IB6A 1ULTA 2OO3A 1M67A 2PA3A 1E0SA 2E82A 4I8DA 3QNWA 4ZU6X 3VA7A 1KPGA 1XTQA 3OIFA 5FBZA 2F6RA 3SZMA 3OAAD 5HKLA 2AZ4A 1PGOA 5A9TA 1OAKA 3QVVA 3SKXA 4DL9A 5A3RA 2C95A 4RJJA 2PVPA 3GP3A 5GGYA 3W3ZB 3QMVA 3OFVA 4QTXA 1OFHA 2V6IA 5AI6A 5CB4B 2G82A 2ZJOA 2FEXA 2V1XA 1JQLB 3Q6NA 4OEHA 4RY9A 4UCQA 4AB1A 1P2UA 1Z0UA 1HDRA 2CYAA 2TS1A 3E7FA 3KEOA 3LF2A 4MKIA 4YT8A 1RYNA 1PBNA 4MJ7A 1LV7A 2IE0A 1TMYA 4YGYA 1LBEA 4ND1A 4WLVA 1RQNA 3KYIB 2QU8A 4LSZA 3LW7A 1V25A 5U4XA 4BLQA 5C7IO 4UEJA 4JYBA 2C8KA 2JIDA 1LQ2A 4MVJF 1AK9A 3WRVA 2IKQA 4DQ0A 4N01A 4OJTA 4KREA 2Z1NA 3JWIA 4GMHA 1B6GA 2HOQA 3LPLA 1QZZA 1L7VC 2Q49A 5IJ0B 4ZQBA 1YJBA 2QM8A 5HPYB 1UJ4A 1UZUA 3SYTA 5A4DA 1H9AA 3HADA 4KE7A 4OXRA 1E3IA 4IFIA 4Q0MA 1DKMA 3MFQA 4Q1BA 2LRHA 2YWXA 3LLCA 4CL8A 5ED4A 2H2GA 3EDMA 3I8OA 1JWAB 2A35A 3JQGA 4GHWA 3HWX1 3A3PA 3GUUA 4WOKA 1MUUA 3A1NA 2RIPA 3MCZA 2D1QA 4FPXA 3VYSB 2DTXA 3G59A 5JR3A 3FYDA 5L3SB 4P58A 3BAFA 3TIXB 4W5OA 4X1IA 2NPIA 4D3SA 1E6KA 1RRVA 2PJRA 1HYQA 5ALDA 1RC0A 1UJ2A 3SHFA 1I0ZA 1DP4A 2DFKB 4MO2A 4AL4A 4FFBB 5EJ6A 2NMVA 1UM9B 2CD9A 2AJ8A 4A8JB 3DKIA 2X42A 3CUYA 4EPRA 3A4IA 1ZJYA 3CWZA 4HRXA 1EUZA 1OFUA 4HB3A 3V8PA 1BDBA 4F5DA 3NDBB 3RS7A 1KU0A 4JC5A 2P6MA 1EHCA 2WYWA 3QE9Y 3AO0B 4QBHA 1DAKA 4Q9AA 4D0NA 3PCTA 4MQ4A 5AI9A 3T8YA 4J7XA 4A0FA 3U9SA 4N0DA 2QV0A 3F1KA 4BN4A 1Z4OA 2QRMA 3ADKA 2FKNA 1QBGA 4JJZA 1P1KA 4Q1FA 4F45A 2CHUA 2HJWA 2R7NA 3T3MB 2Z4RA 2FEAA 2RHRA 1T35A 3LWBA 1RCUA 2LW7A 4FDAA 4J2OA 1TCVA 2NACA 4UVGA 2WSMA 4AUMA 4EA7A 1NX9A 4JBYA 3AV0B 3VR3A 1AZLA 2WWGA 2J3JA 1U1DA 5SYNA 2ODNA 3RJTA 1ADFA 2FZKA 1N7JA 2BHLA 1ZAYA 4Q24A 1YA6A 1PD0A 3LPNA 3JALB 1J0BA 1N32B 3LZDA 2CBZA 2YIMA 4H9GA 3SR0A 3N8NA 3I62A 1LNSA 4US0R 5MGBA 1NQ5A 1MX9A 3HXOA 1JWLA 4R40A 5HGJA 4YV7A 4GWKA 1V11A 2A9PA 3UICA 2QW0X 2BJHA 2OORC 4U3JA 4IF4A 3NPAA 2V1UA 2AOTB 4OO3A 3OM8A 4MVYA 4POAA 1KARA 4NENB 2VTBB 1Z0DA 1JIUA 4HP8A 5C81A 1WB5A 5HJ7A 1UBSB 3W5SA 2L19A 1X9GA 2B4AA 3MERA 4JVNA 4CQMA 5JWRA 3MGKA 4W9MC 1A0OA 5T8KC 1TL7C 3PTLA 4KR0A 3GLIB 5HIAA 1Z2EA 2E5WA 4WNAA 2XZOA 3DHWC 5SZHB 2IV7A 1V5WA 1Z4MA 2FN8A 3A25A 3U80A 1VPVA 2BFBB 3OOHA 4MUEA 5EVCA 3TSYA 2EC5A 4QECA 1GL7A 2IZZA 5LBIA 4OGWA 2Y0CA 3ZK8A 3PFIA 2O2YA 3N0RA 3O31A 5D6NA 2ZQ5A 4CVNA 1EDDA 3QEKA 3TQSA 3K5WA 3AVPA 3O4GA 4ZRNA 2RI0A 4Y3UA 3IAFA 2FRDA 2OCBA 4JLVA 3DXXA 4IHJF 1XTRA 4F56A 5KVSA 3NANA 2CHVA 1NVVQ 5CU7A 2P0AA 4NMLA 4OHMA 2H9YA 2ATEA 1KU6A 2O9JA 1SU6A 3D1JA 3MGAA 2NUTA 4DSAA 4DMRA 3PUJA 1UKAA 2HD4A 4L08A 3NCTA 4ZYZA 4M9SA 3L6OO 3KKOA 5F5XA 3ROEA 1KAHA 2DBQA 4OHXA 3HK2A 1V45E 3OZSA 1YOBA 1TTPB 3HCRA 4YR9A 4MV8A 2R9VA 2CFIA 1W0CA 2EF1A 1WVIA 2PZAA 3B9PA 3LUAA 4R7GA 3BTSA 2CCKA 3VR2A 4B6PA 1C9NA 3NIGB 2EFYA 2DFLA 1DKUA 2BFNA 2FPIA 3K2QA 4KV9A 5JLAA 4D42A 1CR0A 2E21A 3PUYA 4EQ6B 4WZZA 4CJXA 3DJFA 2OLKA 1L7NA 2FA9A 3NC4A 2WBLC 3B78A 3H5WA 4GAEA 2YY7A 3FWZA 3UKOA 3FCSB 4FINA 2FJPA 5FAXA 2IEGA 5DXJA 3EXHB 3ESYA 3RV4A 3EVFA 5JSHA 3KTFA 1QDLB 3IMFA 1WUKS 3OZIA 3NAQA 2J7PA 1MH1A 2EJUA 3H5RA 4UTRA 1MNQA 5ALRA 5KCZA 2MYUA 1NMSA 1V8PA 5DCWA 3VSEA 3ABRB 2XLCA 3QGMA 1P45A 2O8VA 4E09A 1TCUA 4FOTA 1Z2PX 5TT1A 4F4HA 4ZFNA 3U60B 4B3TB 5CEEA 2V7TA 2XE8A 1JR3E 3BGDA 5IM5A 1J4AA 1QCYA 2V65A 2VF7A 4KGXA 1Q84A 1GYPA 3FCEA 4N7MA 2NXCA 4MRAA 4PSVA 3RRFA 1YR1A 2BCGY 1Q3TA 4Q4AA 2OL4A 5I9IA 2OD7A 1Z16A 3UKDA 3VGPA 5K8VA 2Q0SA 2R65A 1Y89A 3RSSA 2PRZA 2J5BA 3VAZA 4G0MA 5KZMB 5IDWA 4HEA6 4EFNA 3K53A 3O8CA 4DCUA 4GOXA 3IJPA 5EINA 2J3KA 1AT1A 2C2GA 4MS3A 2PZBA 4DJEC 3IUBA 2C7RA 1T6YA 4CUJA 3LXUX 3V00A 2XQVA 4NE9A 5JANA 5TQVA 3IMGA 2XCSB 4Y9TA 5FEUA 4FN5A 4NFHA 1JEDA 5FUWA 1PUXA 2Q1YA 3D9QX 4LBWA 3SM9A 4XWKA 3I05A 3FSEA 4OI4A 4EELA 2JG3A 4HDSA 1S8AA 5F9FA 4O0MA 3UT5B 1RACA 4PAGA 2AK3A 4LX8A 3SCZA 1E2IA 3JD1A 3ZJYA 4X6XA 2CUKA 4J1QA 2XUOA 5JDIA 3L1JA 4AZWA 4D41A 1SQ5A 1GU1A 5EZYF 3ANTA 4ZVNA 1Y0BA 1V5GA 4Q1AA 3ICVA 4MLPA 1JI3A 2XB9A 3PD7A 3QBTA 4Q3KA 4BO7A 1PDWA 2AMYA 2C04A 2HF7A 4TV8A 2ZG6A 3KB1A 1E9EA 1NAIA 2CCGA 1YCDA 3PUHA 4LKRA 3E9CA 4LE1A 1NW3A 4PNPA 1CRQA 1T26A 6PFKA 5IFLA 2DG2A 5TPWA 2C61A 4ZTBA 2BFDB 1GGKA 3OF2A 4H2DA 5EQFA 4AY4A 4FS3A 4EL0A 1BOOA 1AKTA 2VH2A 3AUXA 3GN2A 2YJNA 4BWVA 2N46A 4AZVA 4KSYA 3WRXC 1I7PA 2P65A 2C2BA 4RVGA 5DRTA 3UWKA 3ZHOA 2X0IA 4CQLB 2P9FA 4B3RB 1PR9A 2C59A 3KK0A 1IOLA 5CJJA 3ZIUA 3DEAA 2WKSA 3QFCA 3SQOA 4HG2A 2R5FA 2CMFA 2YMQA 4MPPA 1ZH8A 2VDNB 2YJTD 1SR8A 4BZWA 4KBGA 2NO0A 1L5HB 1PTKA 1WMSA 2GBIA 2ANBA 1L7DA 3GD5A 3GNQA 4WX2B 4B71A 5IT5A 2CVZA 1JHDA 1X7ZB 3I28A 3QF4B 8LDHA 2VYND 1B0AA 3FMOB 3ENWA 4GX2A 3KD3A 4PYLA 3R7LA 3UC5A 4DYHA 3ETLA 1J09A 2R7AA 3OEEA 1OX5A 2W6NA 4TZTA 2GUWA 1RKXA 1V9CA 1RTTA 3W6PA 2CB0A 3LZCA 4YRGA 3I37X 1KP9A 5FJIA 3ZWPA 3HCEA 1PWXA 4MJLA 2H5IA 3ADBA 3ADDA 2RKBA 4KMMA 3KQUA 1Q11A 1ND5A 2O2HA 1ZDMA 3C39A 4AM8A 1EIWA 1C3JA 1FTNA 1PI3A 4KN6A 3TIFA 4BLTA 4HUQB 1YCHA 4QO8A 4LCBA 3K2BA 4ARVA 4O25A 1SKBA 2IZ6A 4RVCA 2ZTSA 4QDOA 2J3DA 3RYFB 1E98A 1KI9A 5CM9C 2ZB4A 3HBAA 1EQAA 3SZUA 1SU7A 1D0VA 3FOZA 1YBMA 1ONSA 2YJ4A 1NDHA 1IQPA 2ENUA 3BQMB 1MA0A 4D99A 3ZDZB 5ITWA 1ECCA 5I7RA 3EBPA 2A5GA 4IIJF 1E96A 1XB2A 2C42A 3IRVA 4CL3A 5CUQA 1TU3A 3LX5A 2XZTA 1IMJA 3EA5A 2Z9BA 5I7HA 2OD9A 4RLFA 3VDXA 2AV6A 4AS2A 4DHEA 2VUSA 2XEDA 3PF9A 4F4UA 2AFIB 3NC1C 2D1YA 2B2NA 2A3NA 3LLSA 4TMYA 5JSZB 3OHPA 2GZRA 5ENVA 1ZZEA 2VHXA 5H3HA 3GFFA 3H17A 3I01M 1BDJA 3OCUA 4RY8A 1ZRHA 1DSSG 1CB0A 5JJLA 1U7DA 3VRHA 1Z2OX 3KWMA 5T4BA 4TUYB 5DCLA 3FTDA 4M7PA 3VYVA 2HK8A 1JU4A 1I0LA 3QPUA 1OBFO 1P2GA 2PA0A 4N0QA 4YP5A 2JI4A 3T52A 5ALIA 5EUQB 2AXPA 1R6BX 5KVAA 3OT1A 2VTDA 3RJ9A 5F7OA 4L0QA 4GYJA 2IHYA 1E3QA 3IP3A 2O0KA 1E2PA 1FNBA 3O4JA 2BF7A 1IVNA 2R7MA 4JJ6A 4MROA 1B3BA 4I3HA 1UT8A 2OTCA 3DAGA 3UFBA 1V5IA 4G25A 4P34A 2OPBA 2YC4C 1MKYA 2PMEA 1Y1KE 2GYVA 2O7NA 3H5OA 3TD9A 3V55A 4D81A 2DECA 1JFVA 3H8JA 2FE1A 1EVZA 3V1YA 1OB5A 1LSUA 1D1SA 2FR0A 2HMWA 3OEWA 5F21A 2W2OA 2QBYB 1FP6A 1MGOA 5LQSA 2ZEJA 1QORA 3IJRA 4ZT7A 1UXOA 2Q5QA 5FBLB 3SYMA 3DLHA 2EAUA 2VHVA 2B8WA 1VG9B 2IELA 4B32A 3E81A 1PZNA 1C50A 2QTFA 3I76A 4KQWA 2ZBRA 2R87A 4IMJB 4YS6A 2ECQA 4GM1A 3HVUA 1T0UA 3MBKA 2QSJA 2HK9A 2YNMD 2Y77A 3WGKA 2AOUA 2QNBA 4G84A 3TEFA 2AFRA 1SD5A 1DDIA 4OXYA 4W63A 3QVJA 1A2OA 4MWSA 1TT5B 2Q8NA 4B31A 4LEIA 1RAIA 1G20E 3J7AC 1GOTA 1YQGA 1DOAA 5CIQA 3OE5A 3DMHA 5FI1B 2K87A 5IVIA 3U0BA 2EIHA 3AERB 2P2GA 4BLUA 4ZIRB 5FWXA 4E2FA 5G0UA 1UAYA 2WAYA 2F2TA 4PSCA 3DKKA 5TNXA 3LFTA 3PSAA 3M4JA 1WY7A 1OX4B 1U6JA 2QG4A 3HJCA 5UKDA 3T61A 3U56A 3M89A 4TVKA 1JKXA 3FCAA 4Z9BA 3TR6A 1ZISA 3MAAC 5JXIA 3MWYW 3SS8A 2CNDA 1E2FA 3LDUA 1M6WA 5MGNA 2VPQA 4I5EA 1V9SA 4IJMA 2IE8A 4K28A 4WNCA 2Q45A 5CNKA 1B23P 1ES9A 1T8SA 2JAUA 1AF4A 3CRNA 3I04M 1NVGA 3KU1A 4B79A 3RROA 4CLRB 2BOVA 3WLIA 2ZE8A 2G0TA 3T5DA 4YRNA 3B6ZA 1UL1X 1TMGE 4H16A 1RCFA 3DGFC 4O4JA 4HDQB 4QPNA 3RYTC 4DAOA 5I7UA 3CUVA 4P7GA 4QRHA 4HQ0A 2Z6QA 1UZNA 3DAOA 4X44A 5DHFA 4B3CA 1U81A 3IPXA 5DF1A 5IYZB 4PW0A 4I0WB 2PTGA 4X65B 1D2CA 1HTBA 4JBGA 2I33A 2QPLA 2R8BA 4CMEC 3GOQA 3HFSA 1HRDA 4RE5A 3W5BA 1KMIY 1X15A 3A4LA 4P0TA 2B8TA 2JGRA 3E5NA 5EA2A 2ORYA 3FTEA 4KB5A 2F1JA 3JXEA 1RLJA 2J6HA 3ZDQA 3AEYA 3ZY5A 1GKLA 1CUVA 4UVDA 4O4HF 4RK7A 4ZV9A 2QUIA 4QUBA 5HS6A 3SXUB 5DN6A 4CFSA 4I5DA 2F90A 3BWBA 3OPXA 1U3VA 3GGSA 3GCGA 4QTUB 1FYFA 2H4FA 4Z9XA 2DEUA 2WFZA 4IO0A 1U8FO 1XL1A 1A8UA 1S2OA 2P5YA 3WR5A 3MINA 3ADOA 5EJIA 5K0JA 1WZ2A 2DBYA 3L0ZA 3PT5A 3WKAA 3GLQA 3EXHC 4EW1A 1ZFNA 3THYA 4N03A 1NYLA 1PV2A 2AG8A 2H57A 2X3UA 1DXHA 1EDZA 3W5HA 3V7UA 4PYJA 3QPAA 3WHIA 1MV8A 1AN0A 1JTEA 2IHBA 3LECA 1MHTA 2MHCA 2GPJA 3FOAA 1ZCZA 1BX0A 2E7ZA 2H1LA 1M2FA 1XRSB 2PUJA 2XUQA 2ZTHA 3A28A 4P3YA 1UBUS 4C7KA 4JL8A 2Y1EA 5LA6A 1YFLA 1FCJA 2PFSA 1L9KA 3A32A 4U5XA 3ZVMA 2IPLA 5EXDA 5BT9A 2NZ2A 5B6PA 4PX9A 2PKQP 1PGPA 1M6VA 2PKXA 3L7YA 4N5IX 4O29A 3Q7PA 3SFZA 4CV0A 4E15A 2J5XA 4L8LA 4ZJZA 3THXB 5L6LB 1DKPA 1Z12A 4JX9A 4FK8A 5SV2A 3AHGA 1E9FA 5LPNA 4TT8A 1Z5ZA 1QHYA 1IN8A 4R1TA 3I2GA 4FT4A 4GLJA 1P4GA 1Q1QA 4ZVSA 4ZYVA 1NG1A 3KQVA 4RTLA 3P96A 3NTUA 1T3HA 4BQRA 2M1XA 3DWGA 2HQOA 4CLXA 5JNRA 3H5AA 4OX9Y 1FNNA 2GAIA 2VBCA 2AFHE 3EASA 2CUNA 4M1SA 2O7VA 5G1NA 1OAOA 3R76A 3EUAA 4R9VA 3P9PA 4FDVA 2VP6A 1PJSA 3S3TA 2AN4A 2PGDA 2W2XA 1Z39A 3GT4A 3LUPA 4HT3B 3GVIA 3FPSA 3HH8A 4FEYA 3EOBI 2BR3A 3VHXB 2NM0A 2VDQB 4BBZA 3IALA 3PUXA 4FUTA 3D8TA 3LKVA 2VJBA 2VNAA 1ORTA 2LKCA 2ONCA 4OOEA 5LNK6 3BMOA 4PE5B 2I9KA 4LF4B 1TQ6A 1DRJA 5I4BA 1UC5B 1VSBA 2PZFA 4YQYA 2PUEA 4QU9A 4CLDA 3RKSA 3MJTA 1FYVA 1DC7A 3LE8A 4IH1A 1SZCA 4YRFA 4L02A 5HIMA 5J47A 1YQTA 3A1FA 1M2EA 3A3KA 3DZDA 4TT3D 3LNTA 2W11A 2I1WA 4BVLA 5H4GA 1II8A 4GZ5A 1HKHA 3P9ZA 2PSJA 3PGA1 4M1YA 1UODA 3TUJC 1V8OA 3L4SO 4F4JA 2IUEA 4OATA 2VHWA 1BOFA 2J9FA 4OREX 5HRUA 2C9CA 4F6LA 1HZZC 1X2BA 4EG3A 2RI1A 1UMKA 3B38A 5DM0A 2ACEA 3U4HA 1ZR4A 4JI7B 1A5SB 4G56A 5AM1A 2YC2C 4D6YA 4HLDA 5H5JA 4BN5A 2VLIA 3KD2A 2AN3A 5EIBD 1BQ3A 2V59A 4IMRA 1OZ0A 1UBFA 2XUDA 1EXMA 3QUAA 4MEJA 4MYHA 5IBQA 5BXQC 2QRHA 4NU8X 4B73A 4TVOA 5I47A 1YCGA 1DQZA 1JFLA 2RJ3A 2G17A 2IHVA 2VP5A 1ZOIA 3HMQA 1LDBA 2HEGA 4KHPB 1WCIB 2PMKA 2PUCA 3W9BA 3K09A 1NA5A 1XCBA 4NBVA 4JLDA 3ZLTA 5LSAA 2AB0A 1C29B 2O4CA 4R2HA 2ZXEA 3L1KA 3NAGA 5ALOA 5EEGA 5I7VA 5JAIA 1G5HA 3PPVA 2XJ4A 1H8HD 3BHIA 1PRYA 4MGZR 4CM4A 3QVOA 2SCUB 2QTHA 3CLTD 4QXOA 4GRIA 4AMYA 1SQFA 3KSRA 1F8FA 5H68A 5K0ZA 1U80A 5FOSA 1GDHA 3TVYA 1Y1RA 4FMDF 3B2EA 3M6IA 1J8VA 2MR6A 4R1OA 3PXXA 1SZDA 3E15A 3GRFA 5BUZA 3KQMA 3KTOA 2NSHA 4K0RA 1TIKA 1FFBA 3HCNA 3Q9NA 3NYRA 4RMHA 4L15A 1KDTA 4AMVA 4B2IA 1P81A 1NHGA 3DLTA 1WWKA 3RADC 2NYUA 1N6IA 1OXVA 2H29A 2ZXFA 5DVZA 1Y6JA 3FJOA 4LC0A 1F2TA 4ND8A 4OFXA 5J4KA 3REQB 2GBLC 3R9XA 1I2DA 5BSHA 2FF7A 2WA1A 2WM8A 3HY3A 4M8NE 4OHKA 1IN6A 1RI3A 1NZDA 3B20A 2JD1A 4TM8A 1SXPA 1FFXA 3ZIDA 5EXTA 5FUVA 4AKSA 1L2TA 5IMBA 1IG0A 4XQ9A 1ZI9A 2AG6A 4IQFA 2FPXA 4N9QA 4N3AA 3B85A 3OCXA 1Z6TA 3AIIA 4XFJA 5D5PA 1RQRA 5AJVB 4IZHA 1CXZA 3RYCB 2UZIR 3DUFA 3GUZA 3I9JA 3VNUA 4P33A 4QWMA 4FM9A 5LIPA 5CFNA 2VQDA 3ZN2A 2C5SA 3GO4A 2FJUA 2RG1A 2JK0A 3C7DB 4FBMA 2Y1XA 5TT0A 2BMAA 4FFPA 2YHAA 1C7RA 2I3GA 1E9DA 3B52X 1PVDA 4GZMA 4K9LA 3RREA 3CNNA 4AG6A 3CX4A 3AF3A 5JZ9A 4WL0A 2J07A 4LHVA 5B1HA 3QU9A 3GJTA 2G7ZA 2V55B 1TVKA 4J94A 4LHZA 2B1JA 3B1VA 3DBHA 5A5VA 1H8ED 1GSOA 3ESAA 3NZEA 4I5FA 3RVKA 3VH1A 5A2GA 1DEOA 1WW8A 4QELA 2DTDA 4JD5A 4J2TA 3FVQA 2GCOB 4D02A 1G55A 2HFKA 4MVJP 4YMWA 3T7CA 1YB4A 2INGX 2HUNA 1X87A 2ZRNA 5CNJA 3TB6A 2HR1A 3C6KA 3KEGA 5KKCA 3K9QO 2I6TA 1RXCA 2FN4A 1K88A 1U3GA 2SKCA 1COWA 1JZTA 3H42B 3D8RA 4QUHA 1L5FA 5EJ2A 1QRRA 3L0OA 1JEJA 3I9OA 1ST2A 2VK1A 4N39A 3GUHA 1GPAA 4DB4A 4MYCA 1DZIA 4RD4A 4RPJA 4CQJA 1RAFA 2QN7A 1DG3A 1QNLA 2C0CA 4RZQA 5IDVA 3V7FA 4B44A 3GLIE 3Q9LA 3WNCA 3OZGA 3EMBA 3CHYA 4YTEA 4CMBA 3UAWA 5HJ2A 3PRJA 2GN1A 2AE1A 2XIJA 1FA9A 1D6NA 2PG3A 3SK0A 3ZHZA 1Q77A 4ARBA 1FFHA 1NXSA 1E6CA 5EAIA 1J70A 3TTUA 1AKVA 1U6KA 4WUVA 3S1AB 3U40A 4ZOLB 2Z5LA 1B1AA 1O6GA 3F73A 4KCGA 4HJXA 4F4CA 1VHQA 4ZOCA 4QTYA 3W7VA 2UZ1A 3HFGA 2HMAA 1YZGA 2QLMA 1UWCA 3HC7A 1O77A 3TEMA 4JYZA 3PJRA 4BKRA 2W6IA 4F9FA 1PQWA 1ZMXA 4YXWA 1E1YA 3JPWA 1WXXA 2X15A 1XRQA 2CXQA 3VKGA 4KKXB 4KGVA 3GFBA 4ABYA 4B7XA 2ZIUB 4I7EA 3LY9A 4YJGA 2PIDA 4DEVA 4JP2A 5D7BA 1H6DA 2A1UA 1H93A 1TKRA 4WN9A 1A96A 1CYDA 4AROA 4G1BA 5K7SA 2UYOA 1BA3A 5LKAA 2D1TA 2C8LA 1HOXA 2ZBGA 3RJ5A 4IDBA 1Z5OA 4DLAA 2GDJA 3QRWA 8OHMA 3LBYA 1XRLA 1LPOA 1JIKA 3WRWA 4YDSA 5KNBD 3ZJUA 2YIDA 2FDXA 3L9WA 4PPNA 4KR9A 1AN9A 4RL4A 5DGHA 1DQNA 3FF1A 1FLAA 3HJGA 1O0BA 1USGA 1BXZA 2PV7A 3MD0A 2WWRA 4X1KB 4YN3A 1TLTA 3IDSA 3IILA 4IOJA 4DLBA 1AQUA 2EW2A 3CO0S 3R9KA 5DM70 2O6LA 3BZWA 2D7DA 3TZBA 3LBNA 1SCBA 4QLOA 3D1LA 5ENZA 3RWMB 1KH2A 5HQ3A 3AEUB 5DXFA 2O5VA 2C9YA 3C6BA 4FU0A 1XZDA 1P9WA 5DX1A 2PUGA 2BZGA 2G9RA 2PGXA 4LPSA 1TYBE 2MOKA 5JAMA 1I30A 1NL3A 1E6UA 1XAJA 2G0AA 3FWHA 3LCMA 2I91A 2BTQB 2X14A 4QYIA 2VA8A 2L18A 1MXHA 1J1UA 4AUNA 2WY2D 4DA0A 2RBKA 3THOA 5ILOA 4LA4A 1E7WA 2XDWA 4MA0A 1RM4A 3P4UA 3PX7A 5E6SA 2ZJZA 2ZU0C 4AJNA 3OHMA 3X1MA 2D8MA 4ZJUA 3GFOA 3T3DA 3BJRA 5CB4F 1FUIA 2J5QA 3SMQA 1NV9A 4RA9B 1RD4A 2ID8A 5KCMA 1I6WA 3EZ2A 2PRSA 1WCWA 3C4VA 3Q3IA 2DKFA 3AKDA 4EKDA 9LDTA 3HB0A 1P77A 1U0GA 2QIPA 2ZUBA 3PFBA 3PDIB 3PXUA 4K6MA 4WCFA 5HKBA 1C4WA 4TYQA 2P9JA 1ZN9A 3DXFA 2P0EA 1QQ6A 3IVAA 4TTTS 3RO7A 2GHQA 3H4VA 2H4XA 5DBFA 3R4VA 3CVUA 5TLSA 2ZZNA 5BSVA