3PCRB

Structure of espg-arf6 complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The assembly of a GTPase-kinase signalling complex by a bacterial catalytic scaffold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords EspG
total genus 40
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2010-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pcrB00
1GP2A 3SJCA 4WZBE 2OLJA 1WXQA 2AFHE 2WWHA 2BCJQ 5CYPA 1AK2A 3U6KA 3EZFA 5D3QA 3A1VA 2RMKA 1Y3AA 1VMAA 1OYWA 1YE8A 1KI3A 2WKRA 2ZI6A 3WMFA 1ZBDA 2PCJA 4HATA 4Q7KA 1KDOA 2GBLC 4LZZA 3AV0B 3DM9B 5DSZA 1G9XA 3WBKA 4DLRA 1XJQA 3R9WA 3A4MA 3SU8A 4EPTA 1IJFA 4YMVA 1XEWY 2RGGA 2N46A 3ND9A 4TLDA 2ERYA 2CJWB 2ZS8A 2QZ4A 2OV2A 3LW8A 3QXCA 4KFRA 1MV5A 5AJXA 5G41A 5HE9A 3RC3A 3ZZ0A 5BN4A 1HTWA 4TQUS 1CJUC 2XOKD 5FUWA 2QBYB 2ZE5A 3CW2A 1G17A 5JEEA 2XXAB 2EQBA 1Z6TA 1EG7A 2JLQA 3QG5A 3ZIAD 3B5JA 3A37A 3AKCA 4C0BA 1DG1G 2ODBA 3AUYA 3AVTA 2L0XA 2Z5FA 4G0NA 1ESNA 1G5TA 4Q4LA 3CPEA 4I1VA 5EE1A 3QXSA 1KK0A 4ITRC 2QP9X 1GOTA 4B3FX 4B6EA 1JALA 2G0NA 2Q9BA 2WWFA 2ZTSA 4XTRA 1NMYA 2V6JA 5DN6A 3U3KA 3IDQA 4PO9A 4LBVA 3K9HA 1DG3A 3MLEA 2CNWD 2WPDD 1JPNA 4HZUA 1ZC3A 2C2HA 3L82B 1YR8A 4UNRA 4QGFA 2VP0A 5TB5A 2EW1A 4C0LA 1OLOA 1E9SA 2OCYC 4B48A 5EJEA 1EGAA 1C9KA 2REXB 4LV8B 1G8FA 5JECA 4BFWA 2VYFA 3EPJA 2D7DA 3F8TA 3U7HB 1XWIA 1RW4A 1IOZA 2J87A 3I92A 4IJMA 4NTZA 4QC2A 2AD1A 1TF7A 2HYIC 2QAJA 4RJLA 4WZAE 5DYIA 2J7PA 1EX6A 2ZYTX 2GEUA 1G8YA 3OE7A 5FUYA 3AF4A 3SR0A 2ZR0A 1W5TA 3QXJA 1T0HB 3SOPA 2B8TA 1XZQA 2RGBA 3LXXA 2WOOA 3AQ4A 3WMEA 3C7KA 2J0VA 3JVVA 3QIAA 1D2MA 4BEBA 4US0R 2IS4A 2OAP1 3V9PA 3VKHA 1ZD1A 1SQ5A 5JWOA 4US2R 5H8WA 2VTKA 1U90A 4AYWA 3GLIA 3T1VA 5JI3E 2XSZD 1H65A 1YR6A 4PC1A 1E3MA 2YKGA 3TLXA 2D4HA 5KU1A 3KQNA 3WNBA 4ZCIA 4DXAA 3TR0A 3THXB 1A7JA 2CHGA 3GJ6A 1KMHB 3KXLA 5JS8A 2QMEA 4XVRA 1H8HA 3QY0A 4X8OA 1YKSA 3I5XA 4DCNA 1YZLA 3ZGXA 1G4AE 1PUIA 4N0DA 2WAYA 3PUZA 2RHMA 3RSOA 1N5JA 1TEVA 3QJYA 1E1QD 1XXHB 2FE4A 2Z4SA 5FR2A 2YC2C 4AKGA 1G6OA 2O8FA 3C4JA 2QRNA 2H1LA 4A0HA 4NYJR 1S3GA 2Z43A 2JJ2D 5H70A 3LXRA 3C15C 3GFPA 2VP5A 3A4NA 4QGGA 1W4AA 5FUXA 3THYB 4CDGA 1NBMA 4JKIA 4TT3D 1UBFA 5CIWA 1F2UA 2DB3A 1TUEA 5G53C 4XVUA 3OFNA 4HAWA 1CU1A 2IUTA 3FPAA 2SHKA 3ZVNA 2ZRBA 3K0CA 1E0JA 1S8FA 4YXWA 3OE7D 3K8YA 3Q7QA 4KJZA 3B2EA 3QXXA 1CP2A 4OQMA 4LGMA 1TF2A 2BM1A 3NG1A 4URVR 2IEYA 2J46A 3ZVMA 1R4AA 4DEXA 2I1QA 3H86A 2EYUA 2NMVA 4X8HA 4Q4JB 5GVRA 5C18A 2ZYUX 4GSYA 1UBGA 4D25A 3TR5A 1I4DD 1W46A 3I62A 3W34A 5FOUA 3IEUA 4NE2A 1LW7A 3KKOA 3DKVA 2LWIA 5EP2A 1V43A 2VSFA 5DHFA 1XTQA 2R6GA 4EPXA 4CEJA 4WA7A 4BFVA 2ZU0C 2GK6A 4LHYA 1MABA 3TGPA 2OUKA 3CPJB 4XWAA 4GZMA 4Q9IA 3HU1A 3B1VA 5L3VA 1X8KA 1KI7A 2EFEB 1E94E 3ZYCA 5GJBA 3P4YA 3EWAA 4QNRA 5IK2D 4MYTA 4Q00A 1Z6AA 1J90A 4MH0R 2QBYA 1NVWQ 1ZCBA 1SVKA 2C03A 1FX0A 1NRJB 4TSFA 2IYYA 2QI9C 3ASYA 1MABB 1NP6A 2FJUA 4NYJQ 2PL3A 2V9PA 2W0SA 4BZXA 2P65A 5E7MA 5UKDA 1SKYE 1Q3TA 2OG2A 2MMGA 2QUZA 4MA4A 3LRPA 4QJ5A 1B23P 4S35A 5FL7A 1N6LA 4X8LA 1NNEA 1EFCA 2FEOA 2BVNA 2GJ8A 2IXGA 3JZAA 2DFKB 3K09A 4BEJA 1A5TA 4L8GA 4YMSA 4NCHA 5DI9A 2IXFA 2ZUBA 4Q7LA 1YR9A 1BKDR 1COWA 3EZ9A 5CK4A 1U9IC 1D2NA 2J7KA 3FE2A 5B57C 4II7A 1KI2A 2ZVPX 1JAHA 4JVNA 5FBLB 1NVVQ 2JJ1A 4EUNA 1DOAA 3WXMA 4KXFB 4AK9A 2EFCB 2IS1A 3LLMA 5LD2B 3SHFA 1TEXA 5K8IA 1U0HC 4LHZA 2BBOA 2FPMA 2GF0A 4PPGA 4IVQA 3HWSA 4IFEA 4NYMQ 1DPFA 3PEYA 2J45A 1ANKA 2OZEA 1LY1A 4P32A 3LAWA 2IHBA 4JT2A 4D0NA 4A2WA 4FINA 3WY9A 4UJ3A 4M1WA 4OQXA 2P5TB 1J7KA 3CIOA 2ZUDA 3IO5A 3PEVA 1N6RA 3ETLA 2J7PD 4BLRA 2BMJA 2C9OA 2R6CA 4ILEA 4DKXA 2O0HA 1RPZA 2GF9A 2VHCA 3C8UA 2NPIA 5BN3A 2X2FA 4TLEA 2NO7A 1RKBA 1RJ9B 2QM7A 4EQ6B 4M22A 3OF5A 5FBRB 3X1ZA 4NH0A 3R9IA 1KI6A 3IQXA 4ACBA 3A1SA 1G3IA 1A4RA 2VP9A 2QRZA 4DLSA 2ZIAA 4FMDF 2JDID 3REFA 3TVDA 2XTMA 1XB2A 2DHRA 1WCV1 2ZJ2A 4XD7A 1YQTA 1S1CA 1UDXA 1Z07A 2JA1A 4LYFA 3KTAA 2YJTD 5E3HA 3C5HA 4TMKA 2ZREA 3SJAA 2Z6VA 4OI2A 1OFTA 2C78A 3WYGA 1IONA 4JLDA 1C4OA 4JLVA 3EPKA 4GPTA 1YR7A 3BBPA 4CEIB 4TL7A 1PLKA 1ZD8A 2VHQA 3Q7PA 3D8BA 1KO1A 3SBEA 1G21E 3EPHA 3BXZA 3FYHA 4C9BA 4JLJA 2IK8A 1KTVA 2P6UA 3GJ7A 2W2TA 3SEAA 2OEPA 2JJ1D 2OBMA 1ZM4A 1TUIA 1NVXQ 4B3BA 5J4YA 1G7RA 4RD3A 3RWMB 1X6VA 1IJEA 2CVFA 3NDBB 4IXNA 4ZKEA 2E9SA 1E2JA 2EFGA 4V0KA 5FR1A 1LTQA 3UANA 3E70C 3OAAD 1TL7C 4RZ3A 2DFNA 1ZNYA 4HUQB 4IVRA 1MT0A 1BMFA 1OIWA 2CBZA 2W00A 4H1VA 4N3NA 1D2EA 5AR1A 4DHEA 2ZU6A 3IPXA 3RHFA 1DAMA 2OXCA 1E0SA 4M0LA 4BLTA 2VLIA 3MMPA 2JLZA 4B34A 3L0OA 4B3CA 3LO5A 1E2FA 4GMXA 3KUCA 2BMDA 2OSBA 4IRUB 4PHTA 5F2EA 5EE5B 3QXHA 1RZ3A 1N6NA 1G41A 3BC1A 1GILA 3AKDA 1RIFA 2C8VA 5HCIA 2HLDD 5LDDC 2Z4RA 4C0QC 2O5VA 3IIJA 5FL7D 3SNHA 4OQFA 2J5XA 2IXEA 1M2OB 2GRJA 1U9IA 5BXQC 1OXVA 2WICA 4RSGA 3VR1A 2BKEA 3RVBA 2QTHA 2REOA 4ZCMA 4RD6A 1Z0AA 1FNMA 4FIDA 4LDJA 1LS6A 1OB5A 1NIPA 1KK3A 2DYKA 1D5CA 3ASZA 3QG1A 4F4JA 1AA9A 2ZJBA 2CLDX 4W9MC 2QAGC 1SHKA 2WTUA 1K8RA 5FPTA 4GOXA 3LVQE 4MRNA 2GXUA 5CDFA 1Z47A 2C9YA 1BH2A 1DS6A 4JL8A 4FWTA 5TV2A 1Q20A 2AN9A 3Q3JB 1FX0B 4NBSA 3RRNA 3EASA 3FMIA 3B13B 2GJ9A 4B47A 1YZUA 1KI9A 1KO8A 1NN5A 2GJAA 2WOJA 4TN1A 2FZ4A 1DTSA 3Q5DA 1N6IA 1XJ0A 3TUIC 1II0A 2PEZA 4D6PA 2RGNA 2FF7A 2VP6A 4JLNA 1IN5A 1A1VA 3GQBA 5IDVA 3W9YA 3T5GA 1ZC4A 1P9NA 1E79A 4URXR 2MSCB 1CJKC 4M9SA 4NCJA 2R62A 3QPWA 2ZS9A 3T35A 3KX2A 1P9WA 2OFOA 4YC7A 3MWYW 4EFNA 3RABA 5CM8B 3SYKA 4BFSA 1HT1E 4Q1CA 2PH1A 2QY9A 1VG9B 2F43A 3GLHA 2AK2A 1M8PA 4JL5A 4QOSA 2XZOA 3I3SR 1US8B 1TQ2A 2ZRDA 5BYKA 1S0UA 1E6CA 1M7HA 2JATA 3A1WA 3GLGA 1GKIA 3BFXA 121PA 1UM8A 4JVMA 1U0JA 1Z0KA 3OIVA 4CT4B 2IYUA 1G8HA 4S2EA 5J4HA 4EQ6A 5J40A 2J1LA 4HLCA 4L9WA 3VR3A 5E7IA 4Q9KA 1D9ZA 2FG5A 2PZFA 2R65A 5FTNA 4EPYA 5FOSA 3FFBA 2A9KA 1GIAA 4JJKA 1W4RA 5L3SB 1JQJC 1TPZA 1MH1A 1GL6A 4V0MA 1IAQA 1XJCA 1XXHA 4B73A 1D9XA 4I4LA 5G3ZA 1G8PA 4AKHA 1N3BA 4Z8XA 1RC8A 5AWFC 5F3WB 4L4UA 4LYAA 1W0JA 4AIIA 1IN4A 1KY2A 2C5LA 4CGZA 4V0ME 4O3MA 4Q4JA 2P0EA 4OHVA 1KMHA 1EESA 5GJCA 2OE2A 1OH5A 2E1RA 1YZKA 1CKEA 4RFVA 1KKMA 3A58B 5GADl 1LVGA 2HEIA 2NZJA 3MWLA 1GRRA 4Q9HA 1M74A 3ZIAA 2H92A 1KSJA 2D2FA 4OQLA 3QKRB 2JLVA 4XJXA 3HYRA 1ZD9A 4MYHA 4B2IA 1DAEA 1G3QA 1R7RA 4Q9JA 2BBSA 5C4MA 4W5HA 1H8HD 5AJYA 2QNRA 4TQAA 1XCPA 4QBIA 2GVDC 2GWHA 2A2ZA 3PQCA 4QXAA 4D2IA 1ZIPA 4R98A 4JS0A 1GRNA 3JZMA 2ZSEA 1O3YA 1ODFA 3L0IB 1SZPA 2F3TA 5GVSA 3U6BA 2IBMA 2V7QA 4GOJA 1SXJE 2GDJA 4BWYA 5KSZA 1ZIOA 1KOFA 1W2GA 2FSHA 2Z83A 4HAZA 3IUYA 4WZ6A 5E7JA 4DBLC 2OM2A 1M7BA 1S9DA 1DE0A 2W6JA 1XMJA 4IEIA 2FPLA 1JAIA 3EA5A 3EXAA 3G5UA 4FMCB 2GETA 4DT1A 3THXA 2Q9AA 3R20A 4PAOA 1GNRA 2B21A 2IF2A 4TT3A 1NL3A 2AL7A 3LV8A 3GLIB 5DIFA 1MOZA 2CHQA 2ZRMA 2J0SA 4M4SA 1VTKA 4KSBA 3T34A 2ZRPA 2BJVA 1XEFA 4LJ9A 1II9A 1R6BX 4LJ4A 5E4FA 4Z54A 4LBYA 1HQYE 2CXXA 5LB2A 4CEHA 1F60A 1Z0DA 2G1JA 1DAFA 3B1ZA 3IPYA 2PMKA 1XTIA 4M1YA 5JRZA 1Q0UA 2B7BA 3DDCA 2EFHB 3NBXX 3KJIA 3FVQA 4B3DA 3T1OA 3SQXA 2R6DA 1IXZA 5FBVB 3PUVA 2QQ0A 5BW8A 1A82A 1FOEB 2XX3A 5BN5A 2XXAA 2Q6TA 1QVRA 5HZKA 2RH5A 3QKSA 1GZSA 4PC6A 1WQ1R 3ZZTA 1Z29A 4BLPA 4M9QA 3CF6R 4C0SA 1L8QA 4Q1FA 2XZLA 1HY3A 1FL9A 2NO6A 4NCKA 5IK2A 2P6RA 4IOJA 3K53A 2CCJA 1M1YE 4H9GA 3TBKA 3W6PA 2LKDA 1FTSA 5DO9A 2F1HA 5FPHA 5ANRB 1CRPA 4QGHA 5B58C 5JZVA 1XFAA 1E2PA 1ZUHA 4LJ8A 3NHBA 2WMNB 4LJ5A 2WMOB 2ZQ5A 4Q4HB 5GJVC 2G83A 4TYNA 1Z83A 4ASUD 3FWYA 5KDLA 3DOFA 1Q21A 2PCLA 4I99A 1HURA 3F3YA 1RRGA 3AVQA 3QBVA 3IGFA 4JLOA 4CIDA 3VR4A 3K9LA 2X2EA 4ZDIA 4NDZA 2ZR7A 1E98A 3FKSA 1TU4A 3WMGA 4EAQA 1JB1A 2GCPA 4LOAA 2HT6A 1COWD 3P27A 2WIAA 4LWZA 2X1VA 4M21A 1J99A 4YXWD 1E2LA 1SVMA 2DY1A 1G3MA 5KSYA 4QKQA 5L8VA 2QQEA 1J70A 1W0KD 1XTKA 4KFTA 4X8MA 721PA 2X19A 1E2QA 2NGRA 4Q7JB 3GFOA 1SVLA 1UKVY 3X1WA 4BECA 2CJWA 4IVPA 2IUUA 1HEIA 5TXGA 2IYWA 4URWR 3AEZA 3U4QA 3AKEA 4Q4AB 3AF2A 3KQLA 1IHUA 2UZIR 4AKIA 1N0VC 1X86B 3VX4A 4BFXA 4XWOA 4M9XA 3RC8A 3TRFA 3VMFA 3IHWA 1XD9A 2DWPA 4G3XA 4HB4A 4R2IA 4QJ4A 3UPUA 3HPRA 4NHOA 2A3RA 3VR6A 3LDAA 2G77B 1E9FA 4HB3A 1QHHA 3TW4A 5JI2E 3BWDD 3QUSA 2HCJB 3SN6A 4PAQA 4PSVA 3T61A 2QTFA 4TMXA 4MKFA 2C04A 5FTJA 1JNYA 4AURA 3MWKA 2WM9B 1AIPA 4K81B 2PBRA 2ZM5A 4HB2A 3K0AA 2G9NA 1T91A 5DI3A 3SJZA 3EIHA 2BCGY 3GEHA 4DIEA 5JEDA 1A2BA 4D80A 2O52A 4AYTA 3KKNA 5SZJA 2RGAA 3B1YA 4TLCA 1T4GA 5FTKA 1IY2A 2P67A 3T15A 2VSOA 3AGPA 4F38A 4JT4A 3X1YA 1Z5ZA 5FUVA 4LPSA 2GILA 4CF7A 5DLQC 4LI0A 5EXXA 2ZJ5A 3H1TA 4KFSA 3R7WB 1QRAA 5L3RA 1OH6A 4GL2A 3PXGA 5F98A 4V0NA 2VHTA 2CHVA 3I1FA 1R2QA 2XB4A 5EP1A 4HAUA 2J59A 4DVGA 4LX0A 2R6AA 2F7SA 5G40A 3BERA 1PV4A 2BDTA 1S4QA 2WWGA 4KBFA 1HH4A 3TNFA 2GXQA 2V4ZA 2H8KA 5DH9A 2J41A 4QJ3A 1ZP6A 4LYJA 3TAHA 3CRQA 4AKEA 2QE7A 2GCOA 3UMSA 4ERNA 2XZPA 4IFBA 1W48A 4ZO4A 4AC9A 4PPQA 5H1YA 1VPLA 2JCSA 3FHOA 5CM9C 2QSZA 3SE0A 1KSFX 4QBHA 5TDHA 2ZVQX 4OHYA 4HDCA 3LD9A 1FFHA 4L9SA 1ZINA 5CK5A 4OQNA 1FTNA 2R9VA 1QG2A 1IN6A 2IX3A 1WE2A 1OHHA 3DHWC 3CRMA 4HAVA 1EFRD 4L16A 3OEHA 2ZJOA 1R5BA 5KUTA 3EW9A 2JASA 4UXJA 2ATVA 1FP6A 3ZJYA 2PT5A 1Z22A 4WXPA 5DHAA 1Q1QA 4IOMA 3AF1A 3MGCA 4TYYA 2A5GA 3CR8A 2VEDA 2KE5A 2WJJA 4JL6A 4TWZA 3D7MA 3SFVA 1AM4D 4M53A 3T1QA 4EJSC 2EVWX 4PPFA 1OIXA 4OYHA 4Y0AA 1JXOA 1P75A 2QMUA 4L15A 3KXKA 1XTSA 2FOLA 1UJ2A 2ZI9A 4G5RA 4JSYA 1KHTA 4D4LA 3T12A 3U60B 2O8DB 4G5GA 2A5YB 4NPHA 3W8NA 1ELOA 3U44A 5KPJA 3OAAA 3GLFB 1KSGA 1Q22A 4M1TA 5JCZA 2IYZA 1YZQA 2RKOA 4KYUA 3QBTA 1L4UA 4XH9B 2YV5A 1YZNA 1OJLA 2ZJYA 4Q19A 3SZRA 4RKEA 5J5CA 1XU4A 3CNOA 2FWRA 4TL6A 4TYPA 3VQTA 3K0EA 4B74A 4PANA 4AI6A 2OHFA 2JLXA 2JLUA 4B44A 4PR0A 5F9HA 4HLUC 3FFAA 3MWJA 3KUDA 4M1KA 2BBTA 4MKGA 3FTQA 5CLQA 1VDZA 3FMFA 4HDQB 4MDFA 2OCBA 1YZTA 3AF3A 3H2YA 2NG1A 3L2OB 3LFUA 4OK6A 4B33A 2Q3HA 1ZUNB 1R0XA 3CM0A 1E2DA 4BLSA 4FWIB 4M8NE 1A2KC 3OHMA 3KJHA 2B7CA 1KIMA 1Z2AA 1VG8A 2DWQA 2OFWA 2QP3A 3UMFA 3NH9A 1C1YA 1N25A 3EZ2A 3O8DA 5KYKA 3K9GA 4M2LA 2IYXA 2EWWA 3E2IA 4FN5A 4PQYA 6Q21A 2C99A 5JFGA 4HDOB 1P2SA 4QBFA 1CR4A 3TMKA 2YYZA 4J0QA 5FBWB 2QL6A 3ZH9B 4BZQA 2FU5C 4JLBA 4G5QA 2PJZA 4B6FA 5JWHA 2ZE7A 3U3MA 2WAXA 3B85A 4D0GA 5DE3A 1YZGA 1UKZA 2REBA 1E0KA 2KJQA 4P31A 2VHJA 5K8LA 1GAJA 1VYVA 5CIQA 4R7ZA 4WOPA 5CITA 3QOFA 2XJ4A 1E0AA 2RGNC 1U94A 2JDIA 2OBLA 3K0CC 1KY3A 1SVWA 2YOHA 3LBNA 1EFTA 3OIWA 5DYGA 1ETUA 3R8FA 2D7CA 3U61B 2GXAA 3SDZA 1YVDA 3BK7A 4GBMA 4JMPA 1P61B 3NC0C 1UPTA 4LK2A 3DVLA 1CR1A 1JBKA 1HE8B 4FCVA 3TSOA 4D4JA 2FFHA 4R71A 4A36A 1MRSA 1AGRA 3P20A 1P2VA 4HUQA 4NP6A 5J47A 4F4IA 4D4MA 4C7OA 2J0QA 4EJSA 2EFDB 2MSEB 3GFTA 3PUWA 2PX0A 1S1MA 4Q48A 3V00A 2KBFA 3DL0A 3DMNA 3ONWA 3D3QA 1T5LA 3O8RA 3KJGA 2O8CB 2B92A 3H0KA 3TQFA 3KKQA 2N1BA 3NHAA 2IL1A 1ESMA 1G16A 3UK6A 3QI2A 4CEHB 1OXTA 1U99A 3RNLA 3EC1A 2ZI5A 5AJZA 2ATXA 4ZIRA 5FTLA 3C16C 4U02A 4GZLA 1OKKA 1HYQA 2BMFA 2F9MA 4E22A 4CEIA 1KDPA 5CJ2A 1ZYUA 2H16A 4LUCA 1F6BA 1EK0A 3I61A 3LBIA 3EX7C 4RZUA 2XNDA 1YJ5A 3PEUA 2GEDA 2QPAA 1XMIA 3EZ7A 4FMBB 4ZIRB 1E79D 2ERXA 2QMHA 3KTAB 5EXTA 1IBRA 1GKUB 2VPPA 1Z8FA 1AJEA 1GITA 2Q21A 5EZ5A 3SYNA 1AS3A 2WSSA 5JJIA 3UXMA 2FEMA 4QHYA 3IILA 4GNKA 3O47A 2G3YA 2QAGA 1SXJA 1RRFA 3U2QA 4B3XA 2C9CA 2ZAOA 3RANA 3MD0A 1CF4A 3CWZA 4ZI2A 2ZRJA 1ZM7A 4A6XA 4ZV4A 1N5KA 5FOTA 2HF8A 4NMMA 3ZD7A 4FMCF 1G3UA 2GJSA 4JKYA 5C1BA 1N0WA 3RLFA 1J2JA 2HT1A 1TNDA 3QKSB 2O8DA 2P6NA 4EPRA 1OHHD 1KAGA 1TQ4A 2ZRCA 4FMDB 4TQ9A 1TF5A 5A0FA 2ZE8A 1S2MA 3UMRA 1H8EA 1KGDA 4RFSB 1OYYA 4RCYA 3TUJC 4D0LB 2O0JA 3TSWA 1KJWA 2PX3A 1E9RA 1FP7A 3EA0A 4B2PA 4DUGA 1CXZA 1R5OA 5JBQA 3L8ZA 4TL9A 1OH8A 4RZ2A 3K0FA 1E96A 2RGEA 1W1WA 1KI4A 2JIZD 4N0EA 5CDFE 1JR3E 1VCMA 4YONB 2QGNA 3CF2A 4PPNA 4TMZA 3F0TA 3AGQA 1QHGA 1XCMA 2XITA 4Q5IA 5A5GA 2HXYA 2EYQA 3GEIA 1XZPA 3PV0A 2GBLA 2OLKA 4D26A 2BWJA 4BQSA 5CLLA 2XGJA 2OFXA 3DKPA 4URYR 3RRYA 2O8FB 1T3SA 1QDEA 3GP8A 1E69A 1KSHA 1IN7A 1F2TA 2WSSD 4LHXA 4I1UA 4JBXA 2CVHA 3BE4A 3X1DA 1VYUA 4DT1B 1UDWA 2HDNB 3THYA 1EXMA 5TARA 3WRYC 1KAOA 2CCKA 1E4VA 4IDHA 3ZS9A 2GHIA 3WNDA 3KB1A 1BOFA 2YC4C 5EXSA 1W4BA 3N2EA 2VF7A 3TQCA 3QPVA 1MO5A 4NL4H 4Q01A 1G8GA 4IOKA 3RDPA 3KZ1E 4JBYA 2J9RA 4FCWA 1N6KA 2ZYWX 3RWOA 3ICQB 1VKJA 3LLUA 3CZQA 5FI1B 1E2HA 2GKSA 3FHTA 2W2XA 3AP1A 3W3AA 1ZM9A 3OIUA 1X1SA 2JGNA 1E9BA 5DNYB 5EXPA 2WVJA 1W36B 5H68A 3CF0A 2J0UB 5SZHB 2ZYVX 1OH7A 1Q1ZA 1Q3HA 2ZJZA 5FI0B 3KL4A 3ZZUA 1GVNB 1I2MA 4Z1MA 3UIEA 2LCFA 1GNPA 3OFND 4F92B 3D31A 1DBSA 4PC7A 1KZGB 3CO5A 3NVAA 3K70C 1F3OA 2XB2A 2IS2A 1NBME 1ZW6A 4QGAA 1VIYA 4PZYA 1XP8A 3BH0A 1Z0FA 2WWYA 2BIFA 2GXSA 4OHXA 3NDPA 4Q21A 1XBTA 4KITB 3VTKA 2V8OA 4Q1AA 4QL3A 1J8YF 1QHNA 1QZXA 3K70B 4D4KA 3LQQA 1F48A 4ABYA 1SKYB 2NO9A 2R44A 1F2TB 2ZITA 3T06B 4NYIQ 3QKRA 4A8JA 2AK3A 4G5SA 4DJTA 1R10A 4HZUB 3VU9B 1T5IA 4MRVA 2B8WA 3M4YA 2GAAA 2IYVA 2XNSA 1ZM2A 1CS4C 4FXPA 1E2NA 1KI1A 5E95A 2R2AA 3VFDA 3NKVA 4JSTA 4TZ6A 1NLFA 1TADA 4LJ6A 1JR3A 1AQUA 1OW3B 2QT0A 1G291 1W2HA 2I1VB 3HR7A 821PA 3U4QB 3S1AA 3I32A 1NN3A 1GL7A 4M1SA 1XPRA 2BV3A 2AHOA 1KJZA 2QU8A 4QNMA 1BO6A 3CUEF 1E4YA 2XOKA 3IIMA 3GJ8A 5LBIA 4AY2A 1DAIA 4P4SB 2F1RA 2ZI4A 1PLJA 2GCOB 1OFUX 2JIZA 1QVAA 2IHYA 2ODEA 4UXIA 2PEYA 1T0JB 4BFYA 4BLOA 2ZRKA 1OKKD 1QHIA 2CEAA 4KCGA 3NBZC 2VO1A 3SI7A 5L3QA 3TSZA 4PC2A 3CX7A 1QF9A 1Q44A 1LFDB 1N2CE 2EWVA 3HU2A 4XTCS 1JECA 5HCNA 1FNNA 1Y63A 1TQDA 3FHCB 3AKYA 3GJ0A 4UNNA 4HLDA 3SYLA 1HQCA 2D2EA 2QEQA 4PQRA 5EUMA 4OI0A 3CH4B 3FMPB 3UWKA 1AS2A 2ASEA 3V4FA 4DLVA 4IDQA 1IM2A 1P9RA 2FX3A 2CE7A 2CL0X 3B6EA 4B43A 2F6RA 1UFQA 2IYTA 2QM8A 3AUXA 4F4CA 3CNNA 3GJ3A 2BHRA 3AH8A 1N6OA 3EC2A 1GKYA 4Q1BA 2RGXA 4RY2A 2ZRIA 4K46A 1Q57A 1XTJA 4MRPA 2QPTA 3LQRA 3AVXA 5IF9A 1PUJA 1VYTA 2X8AA 2OXRA 1RYHA 2FA9A 4Q1EA 1KK1A 1XEXA 3PCRB 1AKYA 1M7GA 4PFSA 3OZXA 3QPUA 4ON9A 3THOA 5KNCA 2IYQA 2XEXA 1HUQA 2K5UA 5AJWA 1MKYA 1PVOA 3P26A 2O8CA 3IBGA 1ZM3A 3OIYA 3ZLJA 1RVDA 1K5DA 4EPWA 2W0MA 1GDDA 2OESA 2IYLD 3C5CA 4UQOA 3NEYA 3A4LA 4JLPA 2XJ9A 221PA 4DCUA 4HUTA 3NH6A 1LS1A 1IXSB 2WWWA 3PITA 2AKYA 2V1XA 4PQFA 5EQTA 1CJMA 1E2EA 1OFHA 4AYXA 2ZJ8A 2W58A 3LY5A 4DLWA 1J8MF 3WHKA 4KBGA 4LYHA 3K70D 1KDTA 3LH5A 1OFIA 1L4YA 5G3YA 1N6PA 3VHLB 5KHOC 2KBEA 2P5SA 1KK2A 4NONA 4ZKDA 1UKEA 1EFRA 3KQHA 4ARZB 2H57A 2GZAA 4PAMA 3CRRA 5EP4A 4XSGA 4E5UA 3I5YA 4GFDA 1V5WA 5LPNA 3AVYA 5IT5A 1P6XA 5FFMA 2HJVA 2HV8A 1CULC 1QG4A 1JR6A 3VNVA 2YZ2A 3U3OA 4ARZA 2PLRA 3VAAA 3QF4B 2TMKA 4RD2A 3U7FB 3H4MA 1FUKA 5LB4A 3MFYA 2KSQA 1DO0A 2GZDA 3B7GA 2CCGA 4OJQA 3R9XA 2WZQA 3N70A 5JJLA 2J3EA 2QE7D 1NF3A 5JSZB 2GZHA 1P73A 2D3WA 5SZKB 1P3JA 1NLZA 3BAFA 3TVTA 4BRUA 3GMTA 2RGCA 3PIRA 3Q72A 5KPDA 1DAKA 3B60A 1PLLA 2ZSAA 4TTPA 3U5ZB 2OBNA 3QEOA 3BFVA 3HP1A 3NC1C 3H84A 4FD2A 1GWNA 4BFZA 5TMPA 2VRWA 3EIEA 3CPHA 4A92A 3PJRA 2FV8A 2F9LA 4LC0A 1NSTA 3OEHD 2FPKA 4HLUA 5HKKD 1Q1EA 2WJHA 2IWRA 2GVZC 3TW8B 4BE7B 4C4PA 3UWOA 1NI3A 1Z63A 1E2MA 4B2LA 1JEEA 1GRQA 3AVPA 1JXMA 3CZPA 5B30A 1D6JA 3D6TB 4NU0A 1T3HA 2AXNA 5J4VA 1NIJA 4KV9A 2HF9A 1U0LA 1UBCA 4RFSA 1LV7A 5D3MB 1Z2CA 1E9AA 2IC5A 4G1UC 1W5SA 4DSOA 4U5XA 5LD2C 4TTRA 1G5RA 2HCBA 1P4SA 1TMKA 1W49A 3P4XA 4IDOA 421PA 5FOXA 2FH5B 4JIMA 3X1XA 4CW7A 5L3SA 3GJ4A 1NSFA 4TLBA 4DDVA 3MAAC 1E9CA 1KJYA 1FPMA 1G64A 3ZQJA 2HYDA 3LX5A 2YOGA 4D81A 3SC3A 3B9PA 4DLTA 4PX9A 1AKEA 1CRQA 1NG9A 1P60A 5FOWA 1XXHE 1OXSC 1QBKC 4MYUA 2QG6A 3FDIA 3IO3A 4QHSA 4DB2A 4PHHA 5KDOA 2YOFA 2PT7A 3LA6A 1Q12A 4PC3A 2VF8A 5JHGB 4BUJA 1US8A 1WDTA 3GLGB 4WVFA 1G7SA 4M9ZA 1UF9A 2RB4A 4BFTA 4KO8A 3L43A 4YDHB 2BC9A 4P4SA 5KSPA 3BB4A 2VIIA 4Y0VA 1CJTC 4CYMA 5GJWC 3F5FA 5HZHA 1XMVA 4IOLA 4M1MA 2YINC 4LJYA 3Q5EA 2WJGA 4W7SA 1BS1A 1YHNA 2DPXA 3ADBA 1O87A 4QRHA 1IY1A 2R6FA 3QKUA 4OHWA 4MGZR 1ZU5A 5BWMA 1VCIA 3I4LA 1DVRA 4DUGD 4Q66C 3WRXC 4Q4HA 1E99A 2VQSA 4A9AA 2ZEJA 1T8TA 1P62B 2CMKA 3M0EA 4OHZA 1G4UR 2FGJA 3CB4A 3MCAA 2PZEA 3SHWA 1ONBA 4TZ0A 3I8XA 3UATA 1SVSA 4A0FA 3CONA 4LV5B 4ZDWA 1W47A 3GPLA 3AVUA 2FMXA 2FDCA 4LHWA 1XEWX 1GM5A 1WP9A 1E9EA 1QHHB 1ZAKA 2IT1A 3MJHA 4D82A 4QM6A 3B8HA 3PR1A 5ELXA 3KKPA 4E03A 2NIPA 2VH5R 3IHLA 3G82C 2HUPA 3PUYA 3C41J 3RS2A 2YWGA 1IXRC 5A4JA 4C7OB 1HT2E 2BKUA 2NPFA 5F9FA 2VP4A 2BOVA 1NY5A 3HYTA 5DI3B 4CRWB 2WWXA 2OCAA 1GL9B 3HDTA 3B1WA 1R5NA 4C3ZA 1ZRHA 5D3MA 3GLIE 2GAOA 3V4RA 1NMZA 2GEVA 4O2RA 1W36D 4GP6A 4JLAA 2J0UA 4GI7A 2P3SA 2UKDA 4E09A 1RE0A 1IQPA 2V54A 3A6PC 1GTVA 3CR7A 3J81k 1ZMXA 4C2UA 3QEJA 3VX3A 1E2IA 2IWHA 1G20E 1Z28A 2CL7X 2O8BB 3UKDA 1KDRA 2QSYA 1WRBA 4RD4A 1CBUA 3B82A 2F1JA 2O0KA 4KI0A 4PZZA 4EFLA 1N5IA 1NLYA 4HEJA 4UNPA 3T5DA 2WJIA 2H18A 1NBMD 1VCNA 2OT3B 1QHSA 4BASA 1EWRA 1G18A 4EIWA 4GP7A 4TTQA 1DARA 2YNMA 5JCPA 3U7GA 3TUZC 3ND8A 2YWFA 3TIFA 4C0AC 3FKQA 4TMTA 3R8CA 4EFMA 1EWQA 3PFIA 3WBJA 3L8YA 5JMTA 4YDSA 3CRW1 1NVUQ 1MRNA 1Z6YA 4QHTA 4LJ7A 5L3QB 4DC9A 4JJZA 1CEEA 4DDTA 4KHZA 3U3JA 4RKFA 1P5ZB 1DADA 5JHHB 4POAA 4V03A 4Q7MB 1K6MA 4DLUA 4BGDA 3K0FB 2D62A 1T6NA 1YRBA 1CLUA 5KOYA 4Q18A 1SVIA 4P0TA 5AUPB 2OILA 1WMSA 5JJKA 1WBDA 1WA5A 2GJKA 2FGKA 1JI0A 3RS3A 4WBSA 1TAGA 3TH5A 3IQWA 5FL3A 4P3YA 4ZCLA 3B9QA 4KLNA 2OAQ1 1GNQA 4US1R 3U44B 3KQKA 1AGPA 3RS4A 5KNBA 2DFTA 3CKLA 4NKRA 2R8RA 1NVVR 3AVOA 4ZDKA 2WBLC 2ONJA 5KSOA 2PMDA 1CJVC 1M34E 1ZNXA 1XMSA 2ZRGA 1UEJA 4MGYR 4GT1A 1Z08A 4P4UA 3W6NA 1KO4A 3MJRA 1AQYA 2NQ2C 1KYIA 2IF0A 3MSXA 2O8EB 4IDPA 4BPBA 1RFLA 3RS7A 2ZRHA 4TL8A 2GA8A 4Q1DA 4KODA 2C98A 2KB0A 3SBDA 1D8TA 3HU3A 1SXJD 2BBWA 3BB1A 1W36C 3AVVA 3REGA 2JLYA 3VKGA 4V02A 5TY0A 1G19A 3A8TA 1VHLA 2GTPA 2QROA 1LB1B 4PO8A 2VHUA 4PZLA 4A82A 2QPOA 1FMLA 3EZ6A 4MGIR 2JLSA 4QBGB 4DZZA 2WIBA 4IKEA 1X8JA 1XRJA 2E87A 1KNXA 4YLGA 2KWIA 2ORVA 3P1JA 2DBYA 3I73A 4LSGA 3O8BA 4MDEA 1II8A 1P72A 1ZCAA 1U8ZA 1W4CA 2WJVA 1N6HA 3R7WA 1VECA 1KO5A 4HYYA 1S9HA 1X3SA 3BORA 2AWNA 4C30A 5KNDA 4KYIB 4TSFD 3S1AB 1NKTA 2RGDA 2O8EA 1XD2B 3RSLA 1TX4B 4Q03A 4KU4A 4UNSA 1RRCA 3RAPR 3K9NA 3K09C 2AKAB 1XDBA 2NO1A 1SGWA 4DSUA 4DSNA 2NTYC 2Q9CA 2CLSA 2WKPA 1ZVQA 1Z0JA 2PJRA 2F1IA 1MR3F 2IEZA 1W7AA 3MUFA 4BLQA 2OCPA 4DLXA 4PSAA 1U8AA 4DCTA 5HKKA 1KZ7B 3PUXA 1WF3A 4AG5A 1F2UB 4DLZA 4WIAA 2V7QD 4MUAA 2A78A 3B1XA 4CVNA 2WJYA 3NIBA 4LPKA 3M6AA 1G5PA 2FZLA 5KDDA 4QM7A 1CR0A 2CE2X 3NBFA 3E5HA 3OESA 1RYFA 1FZQA 1SHZA 2C77A 2W6JD 1GUAA 2FNAA 1FW6A 3ECCA 1BMFD 2YWHA 3JVUA 4MKHA 4ZI3A 2WV9A 4LBWA 2CK3D 1R0WA 1QHYA 3THWB 1I4LD 2H5EA 3TAUA 4P4TA 1FQKA 3RS5A 4M1OA 2NOAA 3BFKA 2BM0A 4RD0A 1U8YA 4HAYA 3BB3A 2KI5A 3GLHE 4KSCA 4OBEA 3ZQ6A 1P7CA 5FPKA 2ANCA 3CLVA 1Z6GA 3I72A 4P33A 1TTTA 4GMDA 3LW7A 2QA5A 4E07A 2QORA 2ONKA 2WHXA 1B0UA 2NZ8A 5FBQB 1P2TA 4MGKR 3QF7A 2V1UA 1AN0A 4OJKA 3O8CA 3MRSA 2QENA 2AR7A 1PJRA 3IKJA 3GLFE 3QVVA 1R0ZA 2ZS7A 5C46F 4N1AA 4DRZA 1LNZA 1H8ED 2A5JA 3LNCA 3THWA 3FGNA 2FSIA 3IBYA 3NEJA 4YMTA 5K8TA 3NTUA 1SULA 3SJBA 3RS0A 4IW3B 1IN8A 2P2LA 3AP3A 4MUBA 3TK1A 2JJ2A 4GDFA 4NCNA 1X1RA 2ZE6A 2AFIE 2UZ3A 1EFHA 2YVUA 4EPVA 4BRWA 1EFUA 1JJVA 5P21A 1XX6A 2D06A 1R0YA 4I1SA 2Q3FA 4MKIA 2ZRNA 3ZVLA 1WB9A 1KO7A 4KAXA 1RJ9A 1G3RA 1KI8A 2DCUA 4ZDJA 2BEJA 1Z3IX 5CYOA 1G1MA 2RCNA 3RRMA 4A8JB 1ZUIA 4TYQA 3LX8A 5K8UA 1VG1A 2IYRA 4JVSB 4RCZA 8OHMA 2G6BA 2DWOA 2XNDD 3BJIC 4UNQA 3CWQA 3ZVRA 2ZSDA 2ZRFA 2ZI7A 2ZXUA 1UADA 1SXJB 2F3RA 2VL7A 2ZJAA 4G5OA 3U7EB 2V6IA 2A5DA 3VHXA 4UXHA 5J4KA 3SQWA 4F93B 5SZIA 5KTYA 3NBYC 1NG1A 2CNWA 2WPDA 5JLJA 4NYIR 5AUQA 2D74A 2C95A 4LHVA 2ORIA 1Z0IA 2UVQA 1IY0A 1OV4A 1I4TD 1NJGA 1II8B 4B35A 2G0TA 3ICEA 2AXPA 2FN4A 2ZRLA 4XIGS 3MG9A 3GLGE 4G01B 4KVGA 2AD5A 3B78A 1XPOA 1UEIA 4KVAA 2AWOA 2JEOA 4MYCA 2I4IA 3PENA 4TMWA 3QENA 2JLRA 3K1JA 2N42A 4YMWA 4B76A 4LCBA 3ZS8A 3ZD6A 5EE0A 4A15A 1N5LA 3GJ5A 3KXIA 1UAAA 4XSHA 5AJVB 1DAGA 2ZPTX 4TYWA 1I2DA 3BRWD 3UG7A 5B64A 4U7DA 3HJNA 1LF0A 3EPLA 3L0SA 2MMCA 4WW0A 4EJSB 1SVOA 4UJ5A 3DPUA 2X77A 2BEKA 1TU3A 2ORWA 1L7VC 3CNLA 3KB2A 2AX4A 4NZYA 4XD7D 4TMVA 5EE3A 1W0JD 4RZXA 4URZR 2ZI3A 3A1TA 2QT1A 4GRAA 4LBZA 3FKSD 1DEKA 4JYBA 4WAUA 3M1IA 4JBWA 3VR5A 1DELA 2H7VA 2JJ8A 4A2QA 3VR2A 4Q02A 4W5WA 3LBHA 5FPSA 2VP2A 4JVLA 3BD9A 4HSEA 1VHTA 4JLKA 5EUQB 2IYSA 1DAHA 1NN1A 1W0KA 4V0OA 3WP0A 2RAPA 2YWEA 3VNUA 1YU9A 1UKYA 1XPUA 2B6HA 2YHSA 2QTVB 1U2RA 2VA8A 3W3ZB 4O0MA 4ESVA 1OB2A 1SKQA 2ZAMA 4HB0A 2O8BA 1OXUA 4NCIA 1CR2A 3FB4A 521PA 2BJWA 1AZTA 1ZU4A 3ADCA 1KNQA 4PHFA 3BH7A 1KI6B 5FOVA 4RD1A 1GG2A 5HPYB 4IXMA 2Z0MA 3GLFA 4OI4A 2ODWA 1T9HA 2GESA 4C0JA 2BMEA 1M6NA 4OL0A 4BFUA 4UKDA 2NO0A 3G0HA 4PXAA 5IHPA 2ODNA 3GD7A 5DISB 2VBCA 1OSNA 3VU9A 4C0KA 3P32A 3TKLA 4CZ2A 2F55A 3NXSA 5CJPA 3ZDQA 1P2UA 1BIFA 2QN6A 1G6HA 4A4DA 1OIVA 4O25A 4Z1MD 3IIKA 3EAQA 1MO6A 4ZPXA 3DMDA 3A36A 3BOSA 2A30A 4PHGA 1NN0A 2GNOA 1MO3A 3BGWA 1CTQA 1NKSA 3Q9LA 4FW9A 3WHLA 3T1TA 4DDWA 5CB8A 2GK7A 5AK0A 2EU8A 3DO6A 2A7QA 4QFMA 4FI3C 2ZUCA 2QAGB 3WNCA 1FUUA 1OF1A 4Q9LA 2WSMA 1LF5A 2V3CC 1XCGB 3N5CA 5HTKA 3LVRE 3AB3A 3DM5A 3DZDA 3QF4A 1T3LA 1OXXK 1XF9A 2Y8EA 4DSTA 2LKCA 5JS7A 4AWXA 4W5JA 1XNJA 1CIPA 5BYJA 4B71A 1ZNZA 1TQ6A 2Q0HA 2HJGA 4A6PA 2ANBA 1F5NA 4JZKA 1K5GA 2V55B 3DZ8A 1YRAA 1N0UA 2FSGA 1MO4A 2W6ID 1RRPA 4OKSA 1U81A 2QGZA 3LWNA 4AG6A 4DEYA 3RYTC 4C2TA 3NWJA 3TE6A 4PTLA 3CRVA 4H1UA 1JPJA 1KKLA 1E32A 4PO1A 4DIDA 4DDUA 2Q3MA 1Q1BA 1HV8A 2DR3A 2HXSA 1T8UA 2WKQA 1XTRA 4F7WA 3HPQA 4MITA 3QSYA 3EARA 3DOEA 4JYCA 2FFBA 4GOKA 4R2HA 5EZ6B 3ADKA 3W90A 4YMUA 5DGXA 1OPXA 3HR8A 3WYFA 4Z51A 1JQLB 1VG0B 3EWSA 5TVKA 4EDHA 2G1KA 4JLMA 4XOIA 3N2IA 4FCTA 2FSFA 3VKWA 2JAQA 4DLYA 3W6OA 3AVWA 1QHXA 4EKDA 2CL6X 4MRRA 1S3SA 4R9UC 5CB6A 2WWIA 4IEEA 3QQ5A 2H17A 4QG7A 4WXRA 3UG6A 4CEJB 1AZSC 3AP2A 5AUOB 1AS0A 3E1SA 4V0LA 1JJ7A 2ZRAA 3AM1A 4XVQA 1XEXB 4MRSA 3C14C 1GSIA 1ZJ6A 1WBBA 2CDNA 3K0SA 2PLFA 1E1RA 4ESHA 3I8SA 1Z06A 4YQFA 1HE1C 5DN6D 1EX7A 1E1RD 2CLCX 3ADDA 3GCGA 5FTMA 2CK3A 4URUR 2DFLA 2GCNA 3QKTA 2IS6A 1R8QA 2ZANA 1FMJA 2ZROA 1X8LA 3SFZA 2XTZA 4B32A 4O2LA 2QMOA 4LY6A 3GEEA 4B3GA 1E9DA 1DO2A 4RVCA 2W83A 1Z6XA 2IW3A 4B75A 3CX8A 3OEEA 1NJFA 4I1OA 1G7TA 3FMOB 3BIFA 1E2KA 3PVSA 4KLZA 4K8OA 3OEED 1ZNWA 4Q4AA 2QP4A 2RHDA 1G7CA 1KMQA 4KFUA 2HLDA 3AF0A 3GJXC 4CT5A 4PSKA 1UBEA 1BYIA 3W5JA 1W44A 4MQBA 1OT3A 2IUSA 3QVUA 2FFAA 5M04A 1NY6A 621PA 4ASUA 3A1UA 5KO2A 4NYMR 4DCSA 2MSDB 4F91B 3Q85A 5JWRA 4C0HA 5EP3A 3KKMA 1BYUA 1NMXA 3KJEA 3L0PA 4OK5A 2PZGA 3EIQA 2C96A 2ECKA 4DCVA 1XD8A 3CBQA 4HI0E 2VSXA 4I81A 5FH9A 3KDSE 4OI1A 4HLQB 4OK3A 2JLWA 5C2JB 4A0GA 4ACAA 3BS4A 4A8JC 3DEFA 1U98A 1VIAA 4HAXA 4Z8YA 1S96A 2A5FA 2ZETA 3CX6A 4Q47A 3X2SA 3FOZA 5HE8A 2FFQA 3KFVA 4L5BA 3K0AB 3QE0A 4AD8A 3Q8XB 1VCOA 3SS8A 1FQJA 3CH5A 2OO7A 5AUNB 3W8RA 4A2PA 2W6IA 1SXJC 2W2VA 4IDNA 1JR3D 3PEWA 2I3BA 1E1QA 4LC1A 3U3RA 4TLAA 4A1FA 5IRCD 1PZNA 4XWKA 2XAUA 3KFXA 1R8SA 3WYAA 2ZR9A 1E2GA 5BQ5A 3KQUA 3EG5A 4IHQA 4LRWA 3QNUA 5B2ZA 1L2TA 5HR5A 3TJZA 5FPYA 2XTNA 3WP1B 2F43B 1GFIA 2G88A 3GLHB 3IEVA 1OE0A 4DWJA 4LJAA 5JSZA 1HA3A 4BZPA 5J4LA 4A0RA 4U00A 5JRJA 1XD2A 2XSZA 3PG5A 4HZIA 2ZSBA 3RRZA 3W5IA 2IA5A 3BH6A 5C4GB 1JEDA 5EE9A 2ZSFA 4DB4A 4LV6A
chains in the Genus database with same CATH superfamily
4BMVA 1WXQA 2OP1A 2Z8XA 4HAOA 5MHTA 1AK2A 3FYUC 4DV6B 1JIVA 4IL5A 4EI7A 2CLLB 1IK4A 3ANXA 5D3QA 4LJLA 1EWKA 3A1VA 4JOQA 4QYIB 3ZGOA 4KO4S 5EYPB 1MEJA 2FHSA 3G2KA 4KQKA 1Y7IA 3M6VA 4WQMA 5FJIA 2MYPA 3WMFA 2PCJA 2OQRA 4JI5B 1KDOA 2G7ZA 1ZIYA 1YA8A 2ZIUB 3EGWA 4CQLA 3WBKA 2PUWA 4FS3A 4OBXA 5DSZA 3I01M 3ABQB 1N4AA 3R76A 2C29D 3KSRA 2PKRA 5J1TB 3S55A 3WL4A 2PUBA 3D6AA 3T1NA 3JVDA 4ZEWA 4YMVA 1XZCA 4RDCA 2IHUA 3FI9A 5DYNA 1YOVA 3ND9A 1WETA 4FE4A 1OWLA 5CVDA 2I87A 1A5AB 1E6WA 2ZT7A 5JALA 2GO7A 1PZEA 1TD9A 2RONA 4IGEA 2XEDA 4S3MA 4UE2A 5AJXA 5LA6B 1GV1A 4X3CA 1PZXA 3QLUC 4G23A 2N75A 1ZMBA 2XXAB 4J43A 3KPVA 1PFGA 1Z6TA 2ZB2A 2P2YA 2JLQA 2QDKA 3ZKWB 2HIGA 4JDPA 5TMBA 3L8EA 1PS8A 2GOYA 3AR4A 1D2RA 2R86A 4ENRA 2AT1A 2VOEA 1NT2A 1WHTA 2L0XA 3C3YA 2P4SA 4G0NA 1FFSA 4QU0A 5SYAA 1I7DA 1G5TA 1IUNA 4YT2A 1XQ9A 3D6NB 1KK0A 5E38A 3ITDA 4EO4A 5F5XA 2WWFA 2ZTSA 2Z5VA 4KNWA 3BT7A 1WIWA 4FBGA 4B3RB 1U3FA 3K9HA 8AT1A 1UIRA 4UDYX 2WPDD 2BGNA 3GZJA 3OQJA 1I6KA 2C2HA 2Q8PA 1BGXT 2PH5A 5FHQA 4D9JA 4YRKA 4WACA 4LMRA 5SY9A 3THRA 4ARBA 2JGKA 2R1UA 1OLOA 4O5OA 3A1EA 3PXUA 2O9JA 4JEIA 4L8LA 5GMOA 2FLVA 4G97A 3UXHA 1EGAA 3M6FA 1C9KA 1U2DA 4KMMA 1NUAA 4F8YA 2OO5C 2W4IA 2REXB 4ZVKA 5A0VA 4BO6A 1ULBA 3MCZA 3VUFA 1IOZA 5FO1A 1H2RS 2BFDA 2HYIC 4RJLA 5KQGA 3R7SA 3A6GA 2CD7A 1EX6A 4KBYA 1G8YA 2B5WA 4TYMA 4U6SA 3SR0A 2ZR0A 2HK7A 4ZALA 2Q5EA 2X76A 3PNLA 1JWBB 2B8TA 4FZRA 3NHWA 3KCQA 2RGBA 3AY6A 3G9UA 3KAKA 4WBNA 5EIBD 2YQ5A 4BX3A 3JVVA 1QQAA 1H6CA 1JAXA 3QIAA 1XKLA 1T4CA 4BEBA 3EZGA 2W6NA 1B93A 1DMSA 2Q7DA 3JXEA 3ZDRA 1ZD1A 1ZLYA 2X13A 3LK6A 4X97A 2DKNA 2HSWA 3ZD9A 4BUCA 4US2R 5JWOA 2HHLA 4C06A 3ACCA 4AYWA 3WGHA 2RAVA 4XA8A 3T1VA 1C9EA 1GNTA 2XSZD 1H5UA 5JI3E 4C04A 4RTPA 5DMHA 4QUBA 2D4HA 2YJGA 1C9NA 4ZCIA 3M1LA 1W85B 3TR0A 4PINA 4I50F 4KE7A 1QIMA 4XVRA 2HU5A 5DM70 3VDNB 3W7AA 4B9AA 3Q4GA 1H8HA 4X8OA 3B51X 5FNZA 4R83A 3CUUA 3WC4A 4BN0A 4C3OB 1MA3A 1PUIA 3SKXA 1TEVA 3BXGA 1SZJG 3AFNA 1E1CA 1E1QD 1HTBA 1XXHB 1XZIA 2C82A 2FE4A 4FDMA 4QQKA 2P2DA 1V0JA 4Z9XA 3ORHA 5FR2A 1Z5WA 2OK7A 1H3NA 3C4JA 2PUVA 3DOHA 3EYWA 2JIMA 3OBBA 3UH0A 1WG8A 4A0HA 4C87A 2WSYB 3O9MA 3OE4A 3K3PA 1TCUA 2RB5A 1STOA 3C15C 3GARA 3GFPA 3AESB 4DGQA 2J6BA 1H5QA 5FUXA 1WHSB 3ZBQA 3THYB 4CDGA 1ESZA 5JDIC 1UBFA 1CP3A 1YB6A 2OOSA 2RK3A 5CIWA 1SPBS 3CEJA 4Z86A 4RPHA 1TUEA 2FKNA 3P0EA 3QBDA 3TL3A 1M2WA 4HAWA 1CU1A 2BFDB 5EZYA 3TM5A 1BDMA 1UZLA 2IUTA 3AIMA 5IFKA 3GZ4A 5HKKA 3ZVNA 4MJXA 2ISSD 2O2HA 2WZDA 5ALUA 5GZ1A 2XW6A 1E0JA 1JHDA 1NW6A 2H7CA 2C58A 3KOXA 4CTOA 2O06A 1XAGA 1LU9A 1IJKA 4WCFC 5AI8A 4E11A 4E14A 2I6SA 1CP2A 1Z34A 4KLAA 1TF2A 1CUSA 3M3DA 4W5OA 2IEYA 1E3DA 3D3KA 4U1RA 2NMVA 1LZKA 2ZYUX 3CKMA 3V8VA 4D25A 3FYUB 5KYVA 3TR5A 1CQJB 3G17A 3L41A 1J0AA 2HLHA 1W46A 2G72A 1Z4QA 3PGKA 4N40A 3GRRA 3ETDA 2L17A 3KKOA 4L7VA 2D6FA 3DKVA 2PUEA 2ZZNA 3IULA 4RYDA 1V8DA 2LWIA 3F3SA 2BHSA 5EP2A 1XTQA 2R6GA 4TUYB 5LZ7A 5KX5B 4CEJA 1MJGA 1HO3A 1RTKA 4BFVA 4QOJA 1OBOA 1S8OA 1DX4A 1QO9A 4BP1A 3JZDA 1MABA 5JAHA 2OMEA 3CPJB 4I1IA 4TWAA 3KYCA 1GCAA 1TA4A 3HBMA 2ECFA 4F85A 5B7PA 1X8KA 2EFEB 5GJBA 1NVEA 2BY4A 1Y3DE 1WUJS 2D5LA 3TCNA 5JOQA 1ZCFA 3GGSA 4P54A 1J90A 3GA7A 1NVWQ 3KJQA 3GH1A 3GNQA 4B3HA 1NRJB 1E18A 4TSFA 1IUPA 1K4KA 1Z45A 1R74A 2QI9C 3MJVA 3ZI4A 4BCBA 4C5AA 1W8DA 3FPFA 1G0NA 2PKQO 4YROA 5A6VA 4IHJB 2VC2B 4K8OA 3E9MA 4E70A 5E7MA 1SKYE 2Z3VA 2BF7A 5F7XA 3SS9X 4P53A 1PUXA 3LRPA 3ROXA 1IPHA 5EPOA 4EA7A 2FEOA 2IXGA 2BVNA 2WVAA 1LC0A 1Q0QA 1BWRA 1GG9A 2BM9A 2NO4A 3LY8A 1TK3A 4NCHA 5DI9A 5JDCC 3OOYA 5A9TA 2ZIXB 1BKDR 1UBLS 1COWA 1JJBA 2RHBA 2ZP1A 1T9DA 4YMIA 4GVXA 4DREA 1T35A 3JU3A 5K6RA 1KI2A 3LKBA 5FBLB 5CVTA 1LQTA 1NVVQ 2JJ1A 3L04A 2HK9A 3HCEA 3FETA 2XMQA 2EFCB 3OSUA 3HKEA 3LLMA 3LQFA 3RREA 4WJZA 4F4UA 5LD2B 3DZCA 2HO4A 3EXG1 4NEGA 4AJHA 2GNAA 4O2BB 3FSRA 3HB0A 5JW6A 3NV9A 2VHXA 7MDHA 1UFVA 3GLUA 5CURA 2J45A 1V8OA 3V8EA 3HA2A 4P32A 4G26A 3WY9A 2IIQA 3C3MA 3IRUA 4UJ3A 3IAM1 3H1PA 4QYSA 1L8AA 2O2IA 2P5TB 4A2CA 2WHQA 4QFBA 1KYVA 3GHYA 3IKLA 4RXMA 3IO5A 4I66A 4WOJA 1N6RA 2IDKA 3D7RA 2C9OA 4ILEA 1H4TA 4KN6A 4X92A 5ALXA 3W5SA 4D9NA 4DKXA 5KTOA 2O0HA 1N8NA 1IEQA 1QVVA 1TI7A 1C3JA 2VHVA 3FUWA 3MMSA 1RHJA 5BN3A 2X9GA 2WJZB 3KD2A 1U80A 2PRIA 4XIIA 1W5AA 4TLEA 1KRWA 2BPOA 1RJ9B 4ZRDA 4YIHA 3OF5A 4REOA 1W34A 5FBRB 3HKBA 1A4RA 5FQOA 2RC5A 2OFFA 2QRZA 2UZ1A 3UAVA 1VSTA 4QAJA 2A57A 3NAMA 3REFA 1L5YA 3DBIA 3DTVA 3QVGB 4YJ2F 3TVDA 4DWVA 1DTWB 1VLHA 2XTMA 5GZ6A 3T9EA 1XB2A 2BE9A 1SIBE 1ZEJA 1WCV1 3HKEB 3IB3A 4R40A 1LDYA 1YQTA 1P2FA 1Z07A 2CLMB 3GN2A 3H8VA 3N05A 3PD1A 2H51A 1UH5A 4Q24A 5EGSA 1X9HA 1JAZA 5FI3A 5FP0A 3WXBA 1MRZA 2XMZA 2NXEA 4M6WB 4OI2A 1OFTA 4B3SB 4M99A 4KK4A 2VAXA 3VPCA 4JLVA 4BAUA 4GPTA 4JWKA 5AM0A 5KTSA 4ARIA 4CEIB 5EVCA 4RULA 1PLKA 1ZD8A 3SXPA 2FQWA 1BD4A 3LCJA 1G21E 4S24A 5CMLA 2D3TA 3FYHA 1WUIS 3ZKAA 1UJBA 5DM0A 1KTVA 1SQGA 1Z9BA 1J00A 2P6UA 4MUYA 3VPGA 2B82A 2OBMA 4G36A 1ZM4A 2AN4A 1UEXC 4LX8A 4B3BA 1M1YA 3QBEA 4BGEA 1X7YB 1G6KA 1R6VA 4X7MA 4JHLA 3NDBB 2E9SA 4C14A 1E2JA 5K0ZA 2OLEA 4P7GA 1CS0A 3OF2A 4RACA 5LP6F 1W94A 3AETB 2CBGA 2AFVA 4YCAA 1IQUA 2PS9A 3DV0A 3OAAD 5D2CA 5FR1A 3WTBA 4YWJA 2DFNA 4E2FA 1M1ZA 3DMGA 4G5HA 1LD3A 2RGYA 1MT0A 1BMFA 2W00A 1WZNA 1PD1A 3FZNA 5IYZF 3RKUA 4KRXA 4OA8A 3VDRA 1Q91A 5EKDA 4D6XA 3LDHA 2A9PA 4YALA 5E6UA 1V41E 3TQOA 5JZBA 5BR1A 2X7JA 1JZQA 4MWTA 2O2CA 3FWKA 5FFNA 3FMGA 1PG5A 2X8LA 1UT8A 4GMXA 1CZRA 3KUCA 4N7BA 3VTFA 3LZCA 2OSBA 4X6YA 4IRUB 4B7ZA 2V65A 5T67A 3DV9A 3QYPA 5I9BA 5T8KA 2ODQA 4CHGA 2WHPA 2DQKA 1GJRA 3A2LA 1OLSB 1REQA 3ZGZA 2YASA 4RKWA 2C8VA 2E7ZA 5HCIA 3CVOA 3VYTB 2Z4RA 5LDDC 2A0YA 5FL7D 2QD4A 1JT9A 1HYBA 2HCFA 3KZNA 2RGUA 3QE2A 4ZVMA 1O58A 4UMEA 4CMIB 2BKVA 4HNTA 3IPCA 1U9IA 5AW6A 3CUWA 1KY5A 1OXVA 4MR9A 4AUKA 1L4EA 2YTZA 2QTHA 5AK3A 1DIRA 1N7GA 2DY0A 2QRLA 3FTNA 1Z0AA 2Z5LA 3IKVA 4L4YA 4RD6A 3SZ3A 4G85A 5KTRA 3O4JA 1JMKC 1YIAA 4PN7A 1RMQA 3STYA 4BQNA 4LMPA 1OB5A 2Q45A 4DRYA 1NIPA 1KK3A 2DYKA 2VJDA 4G0PA 2FRXA 4CLHA 1JA0A 4L5CA 2ZJBA 1DBRA 3L4BA 3K32A 1SHKA 4Z6KA 2UZ0A 4CFSA 5A5EA 1P1KA 4KOAA 1Z0SA 1TLLA 3LVQE 4HZGA 4G8CA 4MRNA 2FWBA 2GXUA 1NW7A 4WZBB 1NDQA 1Z47A 4C1BA 1RAIA 4JL8A 4F4HA 4FWTA 1EK5A 1FX0B 3I2FA 3T3HA 4AF7A 3FMIA 4P98A 3WQHA 3QLUA 2AEEA 2WOJA 3OLZA 3IOMA 1WV1A 1XE3A 3VKVA 1N6IA 4RWEA 1II0A 2HBQA 2RGNA 2Q41A 3HVUA 4JLNA 4ETNA 3OQNA 3WGMA 3N8HA 1ZVMA 5IDVA 3OEWA 1YQDA 1CIJA 3PFWO 4UATA 4ID9A 3QWHA 4B3IA 1S6YA 5C51B 1NP7A 2RI0A 2Q5HA 1QG6A 4Y2QA 4NAVA 1AGXA 4URXR 1ODJA 4TLMB 2ZRQA 3AIOA 3VH1A 3H9QA 4HVLA 3LBFA 4RVGA 1CJKC 2ZQYA 3H1AA 3VYVA 3UJPA 3CZMA 1GNLA 1P9WA 3SHOA 2OFOA 4YC7A 4YR9A 3WWOA 4HVTA 3RABA 3BSYA 3SYKA 4BFSA 1FIUA 3RNOA 3VOTA 2F3UA 2QY9A 1UFRA 2GI4A 2ONCA 1A7KA 3GLHA 3RC1A 4JT9A 2VSQA 2EHJA 3AI3A 2ZRDA 4KMSA 1YAJA 3WLHA 2C4NA 4YUWA 5AHOA 1ZK3A 2XVXA 4FTWA 1GUFA 4LFCB 4MA5A 1Z26A 3IP3A 1K6EA 5BO5A 3AOGA 1U0JA 3OJOA 1JHVA 2I34A 3F6EX 5J4HA 1K4YA 4K7JA 4L76A 1KP9A 1LQUA 5L4LA 3D8RA 1K7XB 4HLCA 5KYXB 3VR3A 2FUEA 2GNPA 3FFXA 2IEBA 2NUAA 4Y6GB 1FSFA 2FG5A 5HJEA 5FTNA 1R4NA 4ZCQA 5TQ0A 3T99A 3VKFA 4NQRA 2H1CA 4L07A 5AI6A 5L3SB 1YI0A 4ER7A 5IN4A 4N7RA 3O4IA 3L06A 1XJCA 1THGA 3QFFA 4DWOA 4I4LA 5G3ZA 5A2QA 4ZHQB 1G8PA 1OVMA 4ND5A 4PGFA 3AKZA 4D8XA 2Z6UA 3AIIA 4DUZB 4CTMA 5CNIA 1RC8A 1VLJA 4F4FA 3SG0A 3ZJVA 3V1YA 4JR0A 4DCCA 1IDN1 1TZ2A 3CO0S 1BVUA 4L85A 4N0MA 3HO8A 1KMHA 4N65A 3CURA 2OE2A 2VFAA 1OH5A 1NBEA 1P6UA 1XZEA 3ECAA 3KAQA 1KKMA 1ZICA 4H1HA 1PW5A 4L75A 4R2LA 5IP5A 5GADl 3REOA 3HVRA 2G1PA 4Z7NB 3MMNA 3KG2A 1UJMA 2HEIA 2VK8A 4TV8B 4BNNA 4PGGA 4IIDA 5H82A 4DA8A 1T3TA 1PFUA 3FNBA 3PHCA 3UA3A 3Q6IA 4QPPA 4RVOA 2A0FA 3G0OA 4RO0A 4FDUA 5HCUA 1CUYA 1T9ZA 1V4BA 4B2IA 3KIPA 3O31A 4LG1A 3TZEA 1G3QA 3F5QA 3OIDA 2VBIA 3JRXA 1H8HD 4W5HA 2ID4A 4TQAA 3TLGB 4QBIA 2FZVA 2GWHA 4IDFA 1SUEA 4RJTA 3JZMA 1NF8A 1O3YA 3L0IB 1HR0B 4OB8A 1TCBA 3U16A 3PUKA 4DIFA 5I8WA 3TOXA 1ZD2P 3BMCA 3NKFA 2Z58A 4GSKA 1ZJWA 4BP9A 4PYRA 2H8GA 1ZIOA 3B12A 3KYJB 4XKJA 4XWYA 5TSDA 3TSAA 4BWYA 4HAZA 1CNMA 2OO3A 4RDHA 4H7FA 5E7JA 3WFZA 2AMYA 3PE3A 4HDNA 1E1KA 2QRPA 4LAFA 1NXOA 1S9DA 2A0XA 3WGKA 5JNWA 3C5WP 4HTFB 5AOCA 5EZSA 1QO7A 1NE2A 1X7GA 2BKAA 5CH8A 3HN7A 1Y1QA 3RU7A 1VB3A 4FMCB 2GETA 4E1BA 4UVGA 3THXA 4ZEOA 1YBHA 2O1WA 3QJGA 1OTHA 2FPPB 3E5NA 1Y48E 2DR0A 3HGTA 3RR2A 2R8OA 1VFNA 1JYSA 2GPYA 3LV8A 3GLIB 1LDEA 2ZRMA 2J0SA 1AX9A 1M1XB 4KSBA 3T34A 1NPDA 4PLHA 2BJVA 1XEFA 4YRPA 1R5JA 3HXPA 3UYKA 4PLVA 5K3EA 2QMYA 3BWXA 4MO9A 2CXXA 3ZJUA 1Q5PA 4CEHA 1ISRA 2CNNA 2ZIGA 4J9UE 2HKIA 3DC7A 4M1YA 4GR4A 5JRZA 1V37A 1TJ3A 5K2OA 3DDCA 2XMDA 1TJ4A 1JKXA 3TBHA 4MEAA 2X1MA 4E1VA 3FVQA 3KTOA 3TM4A 4B3DA 5KTNA 1HOTA 3R5FA 2CDCA 3T1OA 1U7HA 5JD4A 3DL2A 4RSRA 5JY1A 3KQVA 1LBSA 1A82A 5BN5A 3RRXA 3ER8A 5AM3A 3DHYA 2CSUA 3LUBA 3PQEA 3WL5A 4DEVA 3QKSA 4PC6A 4PX5A 3ZZTA 1NUQA 1DKUA 5WRFA 5AVSA 5EIEA 1YWGO 1FP4A 1ZOSA 2O4UX 3BEOA 3CF6R 3JYPA 3G7UA 4O2AB 3O92A 2YVLA 1SRRA 3JS5A 2E4WA 5EMKA 4NCKA 1OAKA 5CA0F 1AUOA 5B53A 1SNYA 4U7JA 3WGJA 1L1EA 1C9JA 4PSDA 1O4WA 1VLLA 2CCJA 3JD1A 3LI2A 4MZDA 2VSYA 1B6GA 3JQBC 1W76A 3VR0A 2C8KA 3ZBPA 1CR6A 3L8GA 3G1UA 5ALDA 3OQVA 1A9XB 3PDJA 2ET6A 3QVWA 3BKWA 4I4TA 5HWSA 3O4RA 4JP1A 5JZVA 2FUNB 4GKJB 1ZUHA 3HNRA 1EDOA 3QKIA 2WMNB 4FFDA 4F3RA 1CVRA 4KNYA 3EXG2 2PSDA 2BTEA 2EX0A 1U6IA 5JC8A 1GCIA 1RC0A 1RYDA 1SJ9A 1R66A 4MS1B 1XXLA 3KE8A 5AW9A 4OBBA 1Q21A 1VJ0A 2WTNA 1V8FA 3IQHX 4IP0A 3H9UA 3SR3A 3GLTA 4OXYA 5DTQA 1R4ZA 2X2EA 2ZT8A 3MQ4A 3ETCA 4ODIA 4NDZA 4BN4A 1E98A 3WGTA 4AULA 2B5OA 1COWD 1MNAA 2WIAA 3P27A 4FHCA 1L5QA 3S5JA 2X1VA 4M21A 3PXDA 2ADMA 1J99A 1NVFA 4B0PA 4YXWD 1G3MA 3QOWA 5KSYA 1G60A 2Q2WA 3IXMA 3EUWA 2XTAA 3L3BA 2XDAA 1XTKA 4HDRB 2HWWA 4WD3A 3PFHA 1HE4A 2YV3A 4N9WA 3GVPA 1P39A 4HK4A 3IFSA 1UKVY 2R4QA 3ODPA 2CJWA 1YBMA 2HY7A 5T6MA 3ZE0B 1QK4A 3FNFA 2YY5A 3AL0C 1UPBA 3F4KA 3G49A 3K1TA 3L4EA 4J3FA 4HP8A 5TXGA 2SKCA 2IYWA 3IAXA 1A9XA 3RODA 3U4QA 3AKEA 4Q4AB 3AF2A 4Z0NA 2AI1A 1T5TA 4GOMD 2CKDA 4JFRA 3HZZA 2I2AA 4PG4A 1IVSA 5ARCA 1IHUA 2HDWA 1NAIA 2XUQA 3QEMA 5IABA 1MJHA 4ZO8A 2PUCA 2AOWA 1WV0A 3VX4A 4BFXA 4M9XA 3H5WA 4F11A 3RC8A 2WF8A 4R3WA 1R0SA 3K20A 1YF3A 1DX9A 1X7ZA 4QUEA 3UPUA 1PR4A 2A3RA 3RYCA 3HG7A 4KB5A 2OOKA 2NZVG 1E9FA 1J20A 5T8KC 3IPAA 1HMPA 2HDHA 1VPDA 4AQYB 2OCKA 1V9SA 4X6LA 3AFMA 3ZE9A 4M0UA 2P69A 3WLSA 3JQ8B 3Q7RA 4P2GA 1GA1A 2HCJB 5DM1A 4C6RA 4XCVA 5FB3A 3T61A 5B4TA 4TMXA 2FW1A 2K2WA 2C04A 1OASA 3HQ4O 3SAJA 1AIPA 2OHHA 1TA9A 1UBTS 2PBRA 2I2WA 4EG0A 3DSRA 1SHJA 1X94A 3K0AA 4HX2A 1V1MB 1T91A 4G41A 2G9NA 3WDMA 2BCGY 3FPJA 4DIEA 1BCRB 5HIAA 3K05A 5JEDA 1A2BA 2AR9A 2I78A 3E6AA 5SZJA 1P4RA 4LE2A 3JSXA 4TLCA 3U9LA 5KQLA 1QCCA 3FOZA 5KCZA 2ERCA 4FNGA 3HBJA 1IY2A 4BVJA 2VSOA 3Q9NA 2WJ4A 4F38A 1R50A 1WCIB 2HTFA 4JT4A 5I7UA 1NBOA 3M4XA 1ACMA 3CZ4A 3X1YA 1YK0A 3OIGA 1YMVA 4LPSA 4MVJI 4TS3A 4P4LA 1ZQ1A 5AKJA 3D54D 3NOOA 1YIOA 3P97A 4YJGB 4GL2A 2GF2A 1UOQA 5F98A 1C1HA 3H1FA 4ZAGA 1F8YA 3EDYA 2CHVA 3NEAA 5HFNA 2J59A 2WJAA 4BKQA 4F1KA 4ZGBA 1YE3A 2J6IA 1GD1O 5HKOA 1PV4A 1I8TA 1SC1A 4XPIA 5DT9A 5G0SA 3R7LA 3HO1A 3GIDA 2J9ZB 2V4ZA 2J41A 3OOEA 1YRWA 3WAGA 3HMQA 1QTNA 3WNZA 3COVA 3AWIA 5AXBA 3CRQA 3ON5A 4P2BA 3UMSA 2JI8A 3WSVA 3IAAA 2XZPA 4AVYA 1TDJA 1F2VA 4ZO4A 1HNZB 3M83A 1EFPB 1WD5A 2C7QA 4M7RA 5H1YA 1AKUA 3K5PA 4NHEA 5A3RA 3BJZA 4YJ3B 5C53B 2XKJE 1M5RA 2ZVQX 3VC7A 4W8GA 4HDCA 5T7BA 3IUMA 3CLSD 2XCTB 4OHYA 1VSQA 1SFRA 2JIQA 1TJPB 2NXWA 2X40A 4B83A 5KHAA 4BB5A 3P9XA 1QG2A 1IN6A 3VNBA 1PL0A 2C9DA 2AC7A 2WYOA 3H65A 2J4CA 3PT9A 4XI9A 4P7KA 4EHFA 2PD4A 2IX3A 3TW0A 3DHWC 4W4TA 1RHUA 4PGMA 1CVLA 2DOKA 1EFRD 4W63A 4EHJA 2JVKA 3S70A 2PUDA 1NAHA 2ZJOA 1JLMA 3HZHA 3FOBA 3PPXA 2KQUA 3RFVA 5JYBA 1OV6A 5KUTA 4X7RA 3OOHA 3O1JC 4FUTA 1RQXA 1Z22A 1GAQA 4IOMA 4P9NA 4TYYA 2J85A 5JAQA 3VYRB 3IL2A 2WJJA 4R7TA 4M53A 1JJIA 3U4MA 3MWGA 4OGGA 1LSJA 1DXOA 1P45A 1QE5A 2QYTA 2EKBA 2FRDA 2O57A 3B7WA 1P75A 3LCCA 3NQ41 4TRNA 3WDLA 5L7TA 3KXKA 4XFKA 5D87A 1UJ2A 3BRCA 4G5RA 3WHPA 3PGJA 1KHTA 3D0QA 2XZDA 4AF6A 1T2AA 4D4LA 2ISCA 4I5EA 3B38A 2RH9B 4IG9A 3S99A 2Q5CA 1IZ9A 1EZ1A 5F7ZA 2GMWA 2O2ZA 1AK9A 2IXTA 2NPOA 3F74A 3AM3A 4RQBA 1Q22A 4U9UA 5B1IA 5DLPA 5IF3A 1EFPA 3UGTA 2AX3A 1HDOA 5J43A 4KYUA 1L4UA 3UJCA 4EYKA 1D4ZA 2JANA 3I2KA 4L0QA 2NYRA 1CIVA 3U0BA 1F4PA 2PTGA 3SZRA 1PNQA 2BZ1A 5J5CA 4CV1A 2QV7A 2X6TA 5BQFA 1SN7A 2PKYX 3GXOA 5EINA 4QGBA 1C7JA 4TL6A 4V0RA 2E4UA 2Y6UA 3VQTA 4B74A 2PZ8A 3VAYA 1FVXA 4OP2A 3KR0A 6REQB 3ESQA 4L28A 2P9EA 4YQYA 3O2SB 1FA9A 1H6BA 4OL9A 3K8OE 4RFLA 2OYSA 4MKGA 1JTEA 3DCJA 3TW6A 5HKAA 3F6BX 3E61A 4TTVA 3VZPA 3HJAA 1E3LA 2CMDA 1ENYA 1PFWA 3TB6A 4MDFA 1E1DA 3AF3A 1DUIA 5DN9A 2VT6A 3TEMA 2ZB8A 1FSPA 3ILXA 2J31A 4V0QA 5L6LB 4EBFA 3LHSA 3NANA 5JNLA 1JG6A 3CM0A 3H18A 4JJFA 1BVRA 1E2DA 1SH7A 2MWMA 3RW9A 3ZY6A 3U13A 3OHMA 3TE7A 2DWQA 2J4DA 4AJ4A 1TYDE 3KYDB 3UEOA 1VZ2A 1EDEA 4FEYA 5JIBA 3KS9A 1GEEA 3ZDFA 2G9QA 3LYHA 1M1NA 1XZAA 2ZSUA 2C99A 3TO5A 4HVCA 2Q0QA 4GE0A 3FB1A 2XQVA 3KUUA 1L7QA 5HG0A 3WLAA 4B31A 3I5MA 1G2IA 2CJYA 2FU5C 3FLAA 4B6FA 5DX1A 4FFLA 4WA8A 5FBKA 2H1SA 1UKZA 4NVRA 1E0KA 2KJQA 2QF7A 4P31A 4S2UA 3U37A 3SHWA 5DLYA 5K8LA 2VKQA 4A7PA 1YCFA 1WB6A 4GG1A 1E0AA 4KC0A 1ULAA 2GZMA 3LUGA 2Q5OA 3UH1A 2Q5JA 1KQ3A 3OQIA 1VHDA 3BSWA 5EIWA 3YASA 1TGVA 1RQLA 2EZ4A 1L9KA 4UASA 1EIZA 2WSIA 2ZDQA 3EQ8A 2QUKA 1SVWA 4W9RA 3OIWA 1RWVA 3FNRA 4J07A 3VYSB 2D7CA 3MYRA 4KQJA 1KYTA 3E84A 3FPKA 5LNK6 3U4GA 4B80A 3R75A 4OREX 5T5QA 1DB3A 3GCXA 1P61B 3NC0C 1T5HX 4OQEA 2Y3IA 4FCVA 4D4JA 2BEUA 2V7UA 4KTVE 2FMTA 3P20A 5IAAA 1P2VA 4NP6A 2M6RA 7MHTA 4XYBA 2J0QA 1SXIA 3FF1A 3FYDA 4EJSA 1MOQA 1XQXA 4P35A 2HOQA 1MX5A 2R25B 3C85A 5JJCA 1FC0A 3B3GA 4UFOA 1S1MA 1IULA 1Y4UA 3RUFA 3V00A 1FFWA 3DW3X 3DMNA 5BSWA 3O8RA 2O8CB 4WLOA 4FGJA 1UBRS 3MGKA 3I0NA 5FWDA 1O9GA 2FZ5A 2KM1A 3WRWA 3LGSA 1OXTA 5D7BA 4B2YA 1T0BA 4NU6A 1MLDA 1RABA 3ZUPA 3BD6A 2G63A 3UGQA 4JXJA 1OKKA 4M9RA 2BMFA 2D1TA 4AQDA 5JVDF 5HRAA 5JY6A 4ZZ2A 1UKCA 5LQKA 4FNMA 2HJHA 1F6BA 1HZZA 1N57A 2DBQA 2GD0A 4DFDA 5EHXA 5JH7A 3I61A 2BONA 5HZMA 1IK6A 3PEUA 1CY7A 4L0DA 4LWPA 4K6GA 1WUKS 3UFXA 2DQZA 3GUHA 2FMIA 1B6TA 1JLRA 2QMHA 5EXTA 2AVNA 3KV1A 1AJEA 2O3RA 4AZWA 2Q21A 2XYPA 1JDTA 5CCDA 3WK6A 4QOGA 1XRQA 3VBCA 4UTPA 1S2IA 4NMXB 1DUSA 4IJKA 1C2TA 2QAGA 5AVRA 4QJBA 4B6PA 2C9CA 4WZAB 1QIHA 2UZ1B 3MD0A 1GUZA 4OXXA 2XUJA 3RANA 3PXAA 3UNXA 5FWNA 4BNTA 2PRKA 1OAOC 2NV6A 4U39A 4JGIA 4A6XA 3UF0A 1N5KA 5FOTA 2CDBA 3EGDA 4FMCF 2PRZA 5C1BA 4MVWA 2PJDA 3QKSB 2E55A 2XMRA 2Y0EA 1I1HA 1QQ6A 4C7XA 1SAYA 4F5DA 5HW0A 1D4OA 4BJ1A 4XFJA 3PFFA 3NTRA 3AILA 3IE2A 2NVUA 2VZEA 1B74A 3H75A 1H8EA 1KGDA 4D3DA 3JYHA 2PPLA 1NV8A 4AUEA 5ICEA 2XRYA 1HEYA 1XTUA 3I4CA 5H0IA 1O6BA 1R0RE 2PX3A 1LPAB 4ITVA 4NU8X 3OQIB 4TTIA 4B2PA 4AO6A 4H7KA 4X93A 4B45A 3VTAA 1V5GA 4U7GA 1XQVA 2GK3A 3H1EA 2XHEA 2I1LA 2XBMA 2MTBA 1OH8A 2JCYA 1HI9A 2ROQA 4GBED 5JZ9A 2WHRA 1T6ZA 2RGEA 3LXMA 1RE1A 4RY0A 1MV8A 3T3GA 3DE6X 2B35A 3GR6A 1Y4ZA 4XOUA 4A0QA 4RIGA 4KR3A 4TMZA 1NJ6A 5CCXA 2ZJ4A 4C4SA 4ZQBA 1SCDA 1QHGA 4Q5IA 3ZY3A 1XZPA 1GZHB 3EDQA 2WWRA 2BWJA 4R2KA 5C3MA 3MWFA 2UXCB 2OFXA 2QL5A 1D04A 1HDIA 1Z7GA 3KSBC 4U2KA 1NI5A 3V6MA 3ZNNA 5BV1A 3GP8A 4NENA 3K6SB 1U7ZA 5DJ5A 3KLOA 4GLJA 4G63A 3SS7X 5DTRA 5JXIA 1BHJA 2JI7A 1G8MA 4JBXA 4KGXA 4MVJH 3BE4A 5GM1A 1VYUA 3HYCA 1UDWA 5JU6A 3JYQA 2HDNB 4JCOA 4CIWA 1EXMA 5TARA 1LJLA 1E4VA 3U7QB 3VOSA 3W5VA 3ZS9A 1Y33E 1FUIA 1BOFA 3TLGA 2YH2A 3K1ZA 4HDKB 4LMBA 3SM9A 4NL4H 1O97C 3CXUA 1XZFA 4IHKA 3SSAA 5K6AC 1QGUA 4JBYA 1A9TA 2J9RA 1N6KA 4FCWA 1H0KA 4EB0A 1VMEA 1VKJA 3T7DA 4JI1B 3OTGA 3CZQA 6PFKA 2GKSA 3TX2A 5EQDA 5DBGA 2NU9B 4K6HA 4AECA 3ZZ1A 2YRXA 3NIGB 3LT0A 5KCMA 1E9BA 3QOXA 5EXPA 1Z17A 1W36B 3Q3IA 4QOFA 5SZHB 2CNBA 1F8UA 2FP4B 2WYUA 1CHNA 1GVNB 1I2MA 1WL8A 1ZD5A 4GXNA 4ISCA 1LBTA 2LCFA 4P80A 3OFND 4URFA 3UIEA 3ZW7A 3D31A 3V1MA 4EHIA 2JKVA 3R5KA 5HBRA 1PYOA 1Y4SA 4UFNA 1DKQA 1CYEA 1JKMA 1CV2A 1EH5A 1F3OA 1FUYB 3KU4A 4GLLA 2XB2A 1Q0HA 2IS2A 4JBHA 4NENB 1ZW6A 2NTNA 4O4IB 3AY3A 4QGAA 4YCSA 4RGQA 4PZYA 3DDUA 3ZGYA 4PNPA 1IXKA 1Z0FA 3SF0A 2PXHA 2WWYA 3N7TA 2BIFA 4OHXA 1ZGCA 4GXRA 1SIWA 2OUIA 1VJTA 2VYQA 4Q21A 5H4GA 3U7QA 1VRVA 4QL3A 3HV0A 4S1NA 1QHNA 2P62A 4FILA 4G0OA 3ZW8A 4NULA 3COSA 4L0CA 3HDGA 1F48A 3BGIA 2NU8A 1W5EA 2ZITA 3LUPA 1N5DA 2X0RA 2XMBA 3M6IA 3QVJA 5I7FA 2C4HA 3OPMA 1CDZA 1R10A 1YB2A 1FRQA 3E4DA 3LHIA 3KJXA 4UEKA 1YKGA 2GAAA 1DXYA 4WNAB 1OUMA 2XNSA 4FXPA 4J7CA 3LO8A 3X1MA 2R2AA 1L7EA 5AESA 3VFDA 4KXXA 3OZDA 2HIMA 1DKMA 1WU8A 1IJBA 2V5AA 1TADA 3FNGA 4IVNA 4DM3A 5K3OA 2C4VA 5CHEA 2WDZA 1M2OA 4MVCA 3WO1A 1BRMA 3S1AA 1XP5A 3F4BA 4M1SA 5CBKA 2NZXA 2VVTA 1NYLA 2QU8A 1WSDA 1BO6A 4QNMA 1E4YA 1F4LA 1A8PA 3PX3A 4REQB 1JU9A 2X15A 7YASA 3IJ5A 3TIVA 3EJWA 3GJ8A 2JH8A 3MS7A 3K5HA 3AXTA 5LBIA 3NTLA 5A03A 4AY2A 1P2DA 2JFGA 2H63A 2X0NA 4R8RA 4J3NA 3NVMB 3BHIA 4XEHA 5J1SB 1OFUX 3QOYA 3OM0A 4FONA 4DL9A 1B76A 2ODEA 3BCRA 2F17A 2PEYA 3FSGA 4ER5A 3LUHA 1ISIA 1Q14A 2ZRKA 1OKKD 2CEAA 1K6JA 1ZUWA 1RI3A 1X1EA 3BE5A 5L3QA 4XPIB 3TSZA 1ZGJA 4AB1A 2RSLA 2EWVA 4XTCS 2P9QA 1V9LA 4U6QA 2IPOA 3GYGA 4YP9A 5HCNA 2WZCA 1Y63A 1H9CA 2QG9A 2NV0A 1XG5A 2Q3BA 3LUAA 3I6YA 1C29B 1YZ3A 4UNNA 4GO1A 3V8RA 3WNVA 4J4TA 5HS6A 3SYLA 4E32A 1QGED 2C4MA 4UBIA 1ZD3A 4RWZA 2IKSA 4I55F 3CH4B 2FPWA 5EEGA 3FNQA 4KXVA 5BVHB 3N8NA 3UWKA 2ASEA 1NM5A 3V4FA 4NE7A 3T3OA 5KOHA 3WLLA 4Z3KA 1ZOIA 2FX3A 3U19A 3B6EA 3OPXA 3KU1A 4R0VA 3LBAA 2F6RA 4MCJA 2CXTA 1DSSG 1IU9A 4F4CA 3CNNA 5C9ZA 1J8VA 3HBNA 1H4VB 1H2XA 3LUKA 3ZIUA 3AH8A 1F3LA 4KQ1A 4Q1BA 2PXCA 4WZBA 1DMRA 4HQNA 3T7CA 1EI9A 2CDAA 1E7QA 3LPAA 3KB6A 5IF9A 2YWDA 3AJ9A 4UUBA 1D0VA 3LGXA 5AMXA 1HE3A 3V8BA 4EJ2A 2ZUSA 3KOZA 1RYHA 1T9GS 2JLAA 1J09A 3HR4A 1NWHA 1CERA 4JQSA 5C7YA 3EW7A 2IE8A 5CGZA 3P5BA 3OZXA 3PHBE 3ZDCA 1K7FB 3LUJA 5TMEA 4QUGA 3OPNA 4BBPA 3A6HA 4YR7A 4CCWA 2XEXA 1A3CA 1PVOA 1NNI1 1DIOB 1HYGA 1MX3A 1XFDA 3LGAA 3P26A 1X7HA 4GM0A 3UAOA 2O8CA 3OIYA