3PCRB

Structure of espg-arf6 complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords EspG
publication title The assembly of a GTPase-kinase signalling complex by a bacterial catalytic scaffold.
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2010-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pcrB00
4BFTA 1MKYA 4P32A 5JCZA 1DAFA 1P75A 5K8UA 1ZD1A 3B82A 1NJFA 4YDSA 2AKAB 1KJZA 3LLUA 4ZI2A 3NBFA 1E94E 3SFZA 3R9IA 1XEFA 2YWGA 3BC1A 1LFDB 1KI1A 5G53C 2ODNA 2FFBA 1SXJD 3PEYA 1G3UA 1PJRA 1NN5A 3KDSE 5EUQB 3NC0C 4A4DA 1G4UR 3D6TB 5J5CA 2QRNA 3PUZA 3VR4A 1R6BX 1Z47A 4A6XA 4ABYA 4BPBA 2IYXA 4LV8B 5E7JA 2PBRA 5B30A 2QI9C 1G5TA 4A36A 3C41J 1KI2A 1R4AA 3BE4A 1E2JA 1LNZA 4TWZA 2FJUA 2VP6A 1Z3IX 4HUTA 3CH5A 3AVYA 2W0MA 4HZUA 5FTJA 2LKCA 4M9SA 2ZQ5A 4HDOB 1XBTA 4DRZA 1QDEA 4DLSA 4PSVA 2OE2A 5JS7A 1ODFA 1ZINA 3NG1A 2ZROA 4BFUA 2ZJ8A 3QKSA 5E7MA 3SHFA 2A30A 2AHOA 2WJHA 2ZRKA 2WJVA 1Z07A 1VCIA 2G0NA 3FDIA 4KODA 4FD2A 2VLIA 2JGNA 1CS4C 2GXUA 3TE6A 3W8NA 4KBGA 2O0JA 3OEHD 3W6PA 2XXAB 4IDPA 5FPTA 4M1KA 5EE0A 3GPLA 4JVNA 1YZNA 1ZC3A 1E9RA 1YR8A 2VHTA 2IUTA 3VU9A 4JLKA 1UDWA 4RVCA 2GWHA 4BFWA 3ASZA 3RS5A 3IPYA 1C9KA 1E79D 1E4VA 2PL3A 2IYUA 1WMSA 4LJ7A 3MGCA 5CM9C 1P62B 3B7GA 1E4YA 2O0HA 1N5JA 5L3SB 4I1SA 1Z6XA 4JSYA 4YLGA 4YXWA 4BLTA 2IXGA 2UKDA 2VL7A 2ZPTX 4YMTA 4US1R 1COWA 4X8MA 1MRSA 3FHTA 1KMQA 1T3SA 3QOFA 2FPKA 4LV5B 4I1VA 1WE2A 2NGRA 2ZVQX 3TW8B 3WP0A 1S9HA 2V9PA 3U6BA 4F93B 5SZKB 1KIMA 1G4AE 2EFHB 2XNDA 4OI2A 2OFXA 3QG1A 2FDCA 2BV3A 4ON9A 1KAGA 4CT4B 3CR8A 1G5RA 2Q3MA 1Q1QA 1Y3AA 4JLJA 5EP3A 5DNYB 4DHEA 4JVLA 4M22A 3TVDA 3GLGB 3AKYA 4MYHA 1OYYA 3QJYA 2O8CA 2OLKA 3ONWA 2XB4A 1P9RA 5CDFA 5FTLA 4LZZA 4GT1A 4DCNA 3I92A 1VHLA 4FWIB 3I1FA 5L3QB 1UF9A 2ODWA 2VA8A 1W0KA 4RZ2A 4QGHA 1WF3A 4MRNA 2N46A 2FF7A 1GM5A 3SNHA 4B3DA 2ANCA 3CPEA 5LD2C 3E70C 4BASA 2WSSD 2G6BA 4DCSA 3FKSD 3LO5A 2Q9BA 3LXXA 2BMFA 4AYTA 4V0NA 3K53A 3QPUA 4PC7A 4PZZA 3VR6A 3GD7A 3WRXC 4NPHA 4DVGA 1AM4D 3G0HA 2BBOA 3L0SA 2G9NA 1P2UA 2CL6X 4HLQB 2ZS7A 1LW7A 2W0SA 3WYGA 1QF9A 1G8FA 2XITA 5FBRB 2GCPA 3BFVA 2WPDD 3IGFA 1YRBA 2ECKA 4A8JB 1QVRA 2JJ2A 1XPOA 2ZUBA 4BEBA 2BCGY 3PV0A 3TMKA 4CF7A 1W36B 2RCNA 3KXIA 2VSFA 4OQLA 2IS4A 2ZS9A 1G19A 2AD5A 3EZ9A 3V00A 1GL6A 2NO9A 3AM1A 1R10A 1T8TA 1RVDA 1MOZA 3T12A 5JWRA 2X19A 4PAQA 2PLRA 3RLFA 1ZW6A 4RFSA 2E1RA 1TAGA 2D2EA 1Z08A 1UKVY 2XOKD 3WNCA 4B2IA 5EXXA 3ZGXA 2P67A 2ZSDA 4TL6A 3THYB 2GETA 3F5FA 3B5JA 4LWZA 4V0KA 2PMDA 4DSUA 2BEKA 4TLAA 4QBIA 1NVVQ 3A4MA 3ADCA 3BFKA 5KSOA 1RC8A 2WJYA 4Q03A 4NCKA 4Q1DA 1XTRA 1BMFA 1GWNA 1EWRA 3PG5A 3H84A 3GJ4A 4AI6A 4ZO4A 2DR3A 2ZEJA 2FE4A 4Q7KA 2XTZA 4XWAA 1NBME 1ZP6A 1RRCA 1KY2A 2BIFA 1VCMA 4PAMA 3C8UA 4A82A 4F92B 3GLIB 1E2MA 5SZHB 4ZDJA 3H86A 4A8JA 2ZR9A 3UATA 2NQ2C 2XZPA 5LDDC 3C7KA 1IQPA 3GMTA 5BN5A 2DFLA 1CJMA 4S35A 2FV8A 4EPWA 1EFTA 3AVXA 4JVMA 4TSFA 1J99A 1LTQA 2DWQA 4HLUC 4Q18A 3ADBA 4MGIR 3DKPA 4LHWA 2IEYA 3GJ8A 2X77A 4CRWB 3A1VA 4LK2A 2CJWA 2RB4A 3BFXA 4PC1A 4DDUA 3TR5A 4MRSA 4WZAE 3GEIA 5E4FA 2O8EA 4V0OA 5E7IA 2O8BA 3AH8A 4R71A 3REFA 2YKGA 1Z0KA 3KKPA 3X1XA 2PEZA 4HLDA 5JJKA 1H65A 4EJSA 5BW8A 3LA6A 1XX6A 3K70B 3GLHA 2IWRA 3IQWA 4XWOA 1IN8A 2JEOA 1JR3E 2ZI5A 2BJWA 4ASUA 1JB1A 4HDQB 4PHTA 3WMFA 4CEJA 3VQTA 3ICEA 4URVR 4ILEA 3HU1A 1W5SA 3WMGA 1S1MA 4WIAA 3R7WA 1I4TD 121PA 3CLVA 4IKEA 1UKYA 1D5CA 3QY0A 4BQSA 2QGNA 4WZ6A 2GNOA 4HUQA 4QHTA 1II8A 5DO9A 1UBFA 3U7GA 4B73A 4KU4A 3ND9A 1G5PA 2IYVA 1XDBA 2DCUA 4RD6A 3I5XA 1DAMA 4FMDB 2ANBA 5KHOC 2Z4SA 3RC8A 4EFMA 3ZQ6A 1DBSA 3FWYA 4D4MA 2ERYA 1AN0A 4GNKA 5JHHB 1MH1A 2REXB 2NZ8A 2Z43A 4P4SA 4EIWA 5CITA 1W47A 5EXTA 3CRRA 2LWIA 2B21A 1NP6A 2N42A 4MKGA 5CYPA 2BJVA 3SZRA 3T06B 2PJZA 4YXWD 3BRWD 4Q4AB 5J47A 3RRYA 1WB9A 4ZDWA 1R5BA 2F1HA 3NIBA 1S8FA 4F4CA 1BS1A 1VKJA 2GF0A 2IUUA 1KTVA 1COWD 4P0TA 2CMKA 4O2LA 1W2GA 1QG2A 2RH5A 3K0FB 4HDCA 3E5HA 4OK3A 3RYTC 3D3QA 4GOXA 4DT1B 1YJ5A 2XJ4A 1KO5A 2ZJZA 4UJ3A 4DEXA 3BAFA 5DE3A 4MRRA 2RHDA 3HR7A 4I1OA 2V7QA 4PC2A 1DAIA 2W2TA 1U81A 1XXHA 2ZRHA 2OILA 2X2EA 3UG6A 4ESHA 1E2IA 1XB2A 1Z0AA 4X8HA 5KDOA 4C0LA 3M1IA 4D26A 2EYQA 2ZRBA 2EFDB 2J7PA 1GKUB 3ZZUA 2AWNA 1NIJA 4XH9B 4PSAA 2HXSA 4KI0A 3CWZA 1RIFA 3TAHA 2PMKA 2BKUA 1LF0A 1W0KD 1E2QA 3UWKA 3CZPA 4IOKA 4BZPA 2HDNB 3OHMA 2ZJOA 1HYQA 4ERNA 4IDOA 1GNRA 2GESA 5DI3B 3MWYW 2ZJ2A 3IIMA 3UG7A 3CKLA 3SR0A 1VG1A 5D3QA 5AUNB 4IFEA 4QXAA 3EX7C 5IK2A 2EFGA 4C0JA 5CLLA 2BDTA 221PA 3SBDA 1TMKA 1W4BA 1QHYA 2ZE8A 3MG9A 2JATA 5J4KA 3AP1A 3GFOA 4YDHB 5CK4A 1CRQA 2C9OA 3L8YA 4D4KA 3U5ZB 4OKSA 2J59A 4LGMA 3VX4A 2CDNA 3THWA 4TN1A 5B57C 4HAXA 1IY2A 2DWPA 2CNWA 3F0TA 3PEVA 1X8KA 4PQFA 4JLMA 2PT5A 3LX8A 4G1UC 1QHHA 3FYHA 3NDPA 2V55B 4JL6A 3FB4A 4JIMA 2GXQA 2ZUCA 4TYWA 4KXFB 3FFBA 1W0JA 1YZQA 2JJ2D 4BFYA 4BRUA 2UZIR 3R20A 4B43A 4M1OA 2AK3A 2JLYA 1SXJE 1N25A 1SXJB 4JLNA 3K0SA 1AZTA 2EYUA 3X1ZA 2MMCA 4IXNA 3AVTA 2FZ4A 1FP7A 2A5DA 1O87A 3PENA 4G5SA 4TYYA 4OI4A 1OXVA 2XNSA 1F2UA 4Q19A 3GLFB 2JLQA 4JLDA 4OQMA 4OI0A 4ITRC 1OFUX 1P72A 4C3ZA 4A8JC 1CXZA 3M0EA 1FTSA 2D4HA 3CH4B 3C15C 4JSTA 1KO1A 3CNOA 5G40A 1Z2AA 1ZAKA 3PR1A 4XOIA 2GBLC 1KK3A 3TUIC 2ZSBA 2WWHA 1NLFA 5C1BA 1BMFD 3F8TA 1T4GA 2AN9A 1NG9A 1ETUA 1S96A 1U90A 2R62A 4HAVA 1OB5A 1SVLA 4H1VA 4C30A 3ADDA 3EA5A 4D81A 4GDFA 1F60A 1J90A 1OYWA 1X86B 3EPKA 1DOAA 2QAGB 2D7DA 1E0AA 4D2IA 2ZSAA 4LJ5A 3EZFA 3O8BA 4S2EA 4R2IA 2AFHE 1AKEA 3OZXA 1RPZA 2QTVB 1P6XA 4TSFD 2AX4A 1R7RA 2QMOA 4JL5A 1D2EA 3MD0A 3ZVMA 1GKYA 3BBPA 2G83A 2P5SA 2JAQA 3T35A 2B6HA 1ZBDA 3V9PA 4LC0A 3QPVA 1NI3A 4QBFA 5SZJA 2E87A 4Z54A 5B58C 3TGPA 3Q7QA 4JJKA 1SVWA 2BC9A 4A2WA 4O0MA 1IHUA 2WOOA 3EA0A 3K1JA 3TJZA 2ZRGA 2FA9A 1GL7A 5FI1B 1TUEA 3I3SR 4C0QC 2KJQA 2V6IA 1G6HA 4EDHA 4QM7A 1YR7A 1CBUA 3CZQA 4RD0A 1N6NA 1SVSA 4D25A 3OEEA 3X1WA 5B64A 3I72A 4TL7A 3RRMA 5AJWA 2GJSA 5C2JB 5DN6A 4ASUD 5A4JA 4LUCA 4ARZA 3I73A 4FW9A 4JBXA 5AUOB 3HYRA 3SJAA 3SYKA 3OESA 1UM8A 3GFTA 3PITA 5CK5A 3K9GA 4BWYA 2ZUDA 1U99A 2ZR0A 5F3WB 5FOUA 3Q9LA 5FFMA 1N3BA 2O8FA 1KK1A 2JDIA 2G1JA 2C77A 3UKDA 3K70C 3DMNA 2GJ8A 1EK0A 2NMVA 5JWOA 4OHYA 4HB3A 1HA3A 4DLWA 4PR0A 3HR8A 2KI5A 4YC7A 4ACBA 4MYUA 4DLTA 2FZLA 2A3RA 3R9WA 3AEZA 1U9IA 3P26A 4TT3A 4GL2A 2Z4RA 1D2MA 5KUTA 2QBYA 2OCYC 1YQTA 5JJLA 5AR1A 3OIUA 1W7AA 4XSGA 4Q5IA 1V5WA 4TQ9A 4KLNA 5BN3A 2J45A 5CB8A 1BYIA 3Q8XB 5KSYA 2I3BA 1TU3A 2RAPA 1KI3A 3AF0A 2C9CA 3EIEA 1EX6A 1Z29A 2MSDB 5HTKA 1UBEA 3VFDA 1HT1E 3ZD6A 1C1YA 1DG1G 2MSEB 2WWIA 2JLSA 4QGGA 3T61A 3U6KA 2GVZC 2IHBA 2ZAMA 1VIAA 2G88A 1T6NA 2UZ3A 3LXRA 1N0VC 4KFUA 2V7QD 2JIZA 3BORA 4OQNA 4D0NA 4DXAA 1XFAA 2P65A 2QE7A 3GP8A 4MGYR 2JLWA 3VNVA 4F4JA 2F1JA 3WBJA 1OE0A 1KSGA 3P27A 4TTPA 2J7PD 1G18A 3FMIA 5LD2B 1IXRC 4NYJQ 3KQHA 5JLJA 2QUZA 3CRQA 3WXMA 2QORA 4ZIRA 3U3KA 4B44A 2QQ0A 3DZ8A 2ATXA 4NU0A 1TADA 4O25A 4YONB 2ZYVX 3FMPB 3G82C 1OFHA 4G01B 4EQ6A 1S9DA 3K0AA 3TIFA 4DZZA 3WRYC 4NTZA 3RHFA 4Q7JB 2X2FA 3KFXA 3X1YA 5IK2D 5J4VA 3ADKA 4PHFA 1KI4A 1Z0IA 2C2HA 2C98A 3BOSA 3TRFA 1Q1BA 3AGPA 1FP6A 1S1CA 1KK0A 1Z0JA 1RKBA 4A1FA 1LV7A 2QM7A 4OHZA 2K5UA 4CEIB 3LW7A 1F2TA 1W46A 1X8JA 2ZI6A 5F9HA 2CNWD 1AZSC 4AC9A 5A5GA 2IS1A 3CO5A 1A5TA 2W00A 4JLOA 4NDZA 4C2UA 4AKHA 1W0JD 1OXXK 1HUQA 1TQ4A 2ORIA 4CEHA 2H7VA 2QAJA 1Z6TA 2F6RA 4DWJA 2WWXA 3U2QA 2GCOA 3I62A 3CPJB 2NPIA 1IN5A 3A4LA 4BLOA 4MDEA 1IXZA 1XMIA 2D62A 1WXQA 1JJVA 4XJXA 2VP4A 2H16A 4DCUA 1LB1B 2BBTA 2R2AA 2ZI9A 4P3YA 3BD9A 3X2SA 3PUWA 3U4QA 1E0KA 1JR6A 5J40A 2QU8A 2J0SA 4URXR 4MYTA 1E2HA 3EAQA 4NHOA 4PXAA 3ND8A 4M1TA 2FX3A 1A82A 2FEMA 4XD7A 1E2LA 4XSHA 3W90A 2ZJBA 1SXJC 2AXPA 2XTNA 4G5RA 1A1VA 5IF9A 1R0YA 1ZD9A 4HZUB 4V0MA 3UXMA 1ANKA 3WYFA 2Q21A 1OHHA 1YR9A 2GEUA 4B3CA 1E9CA 1A4RA 1Z0DA 2IL1A 3RABA 3FTQA 1G17A 2C03A 4HAUA 1CR0A 2IBMA 1Z83A 3QKSB 5FL3A 3RDPA 1P5ZB 5DYIA 1H8EA 4RY2A 1E2DA 1F6BA 4OJKA 2QZ4A 2WTUA 2VP2A 4CIDA 2R6GA 4OQFA 2NO6A 3ETLA 3FE2A 3CUEF 2ZJ5A 521PA 2F43A 1IAQA 1UPTA 3RANA 2OCAA 3RS7A 1FL9A 4Y0VA 4Q00A 3EASA 2QAGC 3VHXA 2F9MA 4Q1AA 3VU9B 4FWTA 4Q1BA 1QHIA 2WKPA 3UK6A 1DO0A 4FMCF 3T1QA 3WY9A 1ZCAA 1H8HA 3B78A 4Q9IA 5M04A 4P4UA 1OH6A 5DIFA 3OEED 1RYFA 1Z28A 2W6JA 4C9BA 5DN6D 2RGCA 2GAOA 2VQSA 3ASYA 4DSTA 3IDQA 1ZM2A 2GZHA 2QG6A 3HPRA 3RVBA 1YVDA 2R65A 3P32A 1UDXA 1XTQA 4HB4A 1GRQA 5J4YA 1Q3HA 2QNRA 1G7TA 2JDID 5BYJA 5JHGB 2Q0HA 3TQFA 1FX0A 1G3MA 2FOLA 4DLXA 2ZVPX 1G20E 4B2LA 2VF7A 4R7ZA 1QHXA 3SDZA 2ZRFA 2V4ZA 5AJYA 1E1RA 1XRJA 3QUSA 2BVNA 3KKMA 2REOA 1E2FA 5FOVA 4TT3D 2O8CB 1M34E 1Z5ZA 3AUXA 4PC6A 3AGQA 1OH7A 2H8KA 1XPUA 1KI7A 1HTWA 1ZUNB 2AWOA 1N6RA 4LY6A 4Q1FA 4RD3A 2TMKA 4DJTA 4JLVA 2Z0MA 3QXSA 1KZGB 3IQXA 4C2TA 5KU1A 1KDPA 2HEIA 4M1MA 3U3RA 4IDHA 4KJZA 3IEVA 1E9AA 1VYTA 5KO2A 4TZ6A 2ZJYA 1X8LA 2J9RA 4IOMA 2YZ2A 3FMFA 2BCJQ 4Q7LA 4D0LB 2HV8A 1QHNA 1P2TA 2JIZD 3CIOA 1N6KA 2BWJA 4AYWA 3FPAA 4HEJA 5LB4A 3QKRA 2QE7D 4V03A 2HUPA 3B13B 3CRMA 5G41A 3LX5A 5AJZA 3TR0A 3VAAA 3QKTA 4OK5A 2BEJA 3LDAA 4BLRA 1LY1A 3GLGE 2F55A 2IT1A 5FOSA 4Q66C 1D9XA 3PQCA 2RHMA 3RAPR 1KSJA 3QXCA 3SI7A 5DGXA 1E9FA 4LPSA 3LW8A 2BM1A 4X8LA 1DPFA 5H70A 1WRBA 4GZMA 2ORWA 3KZ1E 2A5JA 2CVFA 4LBWA 1ZIOA 3VR2A 3LD9A 4HAYA 4LX0A 1EG7A 1MABA 4LJYA 1MO6A 2CHGA 3A36A 4I99A 4A0FA 4EPXA 3WBKA 2OZEA 4MUAA 5EE1A 2X1VA 3QBTA 3PUVA 3SS8A 1XCMA 4RFSB 1AQYA 5CB6A 4MGKR 1G16A 5FUYA 1G64A 1IBRA 1KI6A 4HI0E 5FI0B 4Z1MA 4WA7A 3VTKA 5IDVA 1L7VC 3VKHA 1GP2A 4QJ4A 5FTMA 4KVAA 4TYQA 1ONBA 2PT7A 2Q3HA 3B1XA 1XEXA 3W5IA 1NMXA 1HEIA 1NN3A 3NBXX 4B6EA 1U8YA 2J41A 2WZQA 3RRZA 1WA5A 3K0CC 5G3ZA 1OV4A 1S3GA 1GSIA 2YV5A 5FUXA 5HZKA 4OBEA 4FI3C 1JNYA 1XNJA 3N2IA 3BH6A 4JLAA 3I32A 5AUQA 1QHSA 4J0QA 4HYYA 1RRGA 1A7JA 4L4UA 1NSTA 4ZI3A 4MITA 1ZNYA 1Q20A 1RW4A 2FN4A 4M0LA 5TV2A 1I2DA 4CVNA 3VHLB 3RWOA 1RZ3A 3JZAA 2QMHA 4URZR 5CJ2A 1ZUHA 2QENA 4MUBA 5CM8B 1P4SA 3QF4A 4C7OA 3GEEA 1YZLA 2CJWB 5FBVB 1NY5A 1XCPA 1XJ0A 1Z0FA 3N70A 4NYJR 2P6NA 4JVSB 2O8EB 4MKHA 4XD7D 1E2KA 2O8BB 1OLOA 2DBYA 1X1RA 3A6PC 5BN4A 2J46A 1JXMA 2UVQA 3NWJA 3GLHE 4D0GA 4EJSB 1OHHD 3NBYC 2V3CC 3GLHB 3TSWA 3U44A 3AB3A 3N5CA 3Q3JB 3QVVA 1HQCA 1G41A 4QBHA 2KBFA 5JWHA 3VKWA 3VR1A 2B92A 3OIVA 5H1YA 3GLIE 2IS6A 4CEJB 4BFXA 1I4LD 1H8ED 5KOYA 1W49A 1FNMA 4LJAA 1AKYA 4P33A 2OUKA 3RNLA 2F3RA 4Z8YA 2OT3B 1G9XA 3O47A 1GILA 4IXMA 3R7WB 1GRNA 5JJIA 3H0KA 2VIIA 2I1VB 2OAQ1 4Q1EA 1WBBA 4HUQB 1II8B 1T0HB 4KSBA 1NNEA 4LI0A 1R8SA 2RMKA 2ZRLA 4M21A 3E2IA 4OJQA 1GRRA 2IYWA 2CL7X 2H18A 3GJXC 3QIAA 1XTJA 2NZJA 1CRPA 3A1WA 3SJZA 1H8HD 1GTVA 4BLSA 2JCSA 2GRJA 4P4SB 1CR1A 4JZKA 3LY5A 1ZU5A 5KSZA 5TXGA 4IEIA 2W6JD 3SYLA 1JXOA 1RYHA 1W4AA 2ZRDA 3CR7A 2FFAA 4DLVA 2GEDA 1VIYA 1Q3TA 4BGDA 1GIAA 3PEUA 2F1RA 1KNXA 5C4MA 2EVWX 4B47A 2VP0A 3NEYA 4GI7A 1R0ZA 1KY3A 4LOAA 1U98A 4X8OA 5D3MA 4D80A 4E09A 3FHCB 3DOFA 1E9SA 3VNUA 3QBVA 3AV0B 3CPHA 5J4HA 4O2RA 3KQKA 4RD4A 1TQDA 5F98A 4KCGA 3QNUA 1ZM7A 1G1MA 4LBVA 1XXHB 5JMTA 5K8IA 1KKMA 1E1RD 3B9PA 2HCBA 1T0JB 4G5OA 4NCHA 4KSCA 5HKKA 1VTKA 4JKYA 3K8YA 2W2VA 3SBEA 1N6HA 3AVOA 1KI9A 1EFCA 3LNCA 4Q01A 4C0SA 2HJGA 3CONA 4L15A 1CF4A 2WWYA 2Q9CA 2WV9A 1NRJB 5A0FA 5JSZA 1EFUA 1UKZA 3GJ3A 1QRAA 4Q9KA 4JJZA 3UIEA 2FFHA 1HE8B 1KI8A 3EC2A 2IYLD 1T3LA 3U3JA 3C16C 2DY1A 2P5TB 1W4CA 4FCTA 4IVQA 4HATA 4KVGA 3U7HB 1DTSA 1PLLA 4AY2A 1YZUA 1FPMA 5GVSA 1P9WA 1EXMA 4M9XA 3H1TA 1YRAA 4QHYA 3RWMB 1N6OA 1NVUQ 1TU4A 2QRZA 3KFVA 3PIRA 4NH0A 4RZUA 1KSHA 2XNDD 3LBHA 2CXXA 4ZKEA 1VYVA 2W58A 5DSZA 1AGPA 2J7KA 3CF2A 3OE7A 3P4YA 2OEPA 3PXGA 3THWB 4MRVA 3IILA 4PPFA 2YWHA 1OFIA 4DLYA 4ZDKA 4LHYA 2WAYA 3P1JA 1E1QA 4BLQA 3AVVA 4LV6A 1QHHB 4F7WA 5TY0A 4QL3A 3AF2A 3IKJA 3MRSA 4B3XA 5TMPA 1JR3A 4KV9A 4PC3A 2C04A 4AK9A 4Q9LA 1TUIA 4JS0A 4AIIA 2SHKA 4NCIA 3KXKA 3W6NA 1Z6GA 1RJ9A 4TMKA 4B32A 1LS1A 2OXRA 4PPQA 1G21E 2V6JA 2WVJA 3B85A 3QEJA 2QROA 2CLDX 1Z63A 4EPRA 1CP2A 1F2UB 2KE5A 2QT0A 3MLEA 1PVOA 1DVRA 2AR7A 5E95A 3T1TA 1AQUA 1XD2A 3A1UA 3NXSA 4DSOA 2CE2X 2ZU0C 1ZM4A 1RE0A 4Z1MD 3QXXA 2VEDA 4KHZA 4JKIA 3GFPA 4NZYA 4POAA 5CIQA 2RGNA 5C18A 3MWKA 2XZLA 2ZU6A 2NO1A 3H2YA 1MO4A 1FMJA 3I8XA 5FPHA 1CR4A 2IC5A 2QY9A 4PX9A 4Z51A 4AG5A 3ZJYA 2FEOA 2QSYA 4XTCS 3ZD7A 3AVQA 4XIGS 2HYDA 5JECA 1R0XA 2IYZA 3ZVRA 3UWOA 1ZM3A 2H17A 4GRAA 1CKEA 1DS6A 2REBA 3QG5A 4GFDA 4DUGA 2ZETA 2OESA 4G0NA 4TLBA 1N6IA 2YWEA 4ZKDA 2ZE6A 3EW9A 1Q0UA 4OHXA 3GLFE 2QP4A 2YHSA 4KYIB 5C4GB 2RGGA 2YNMA 5HCIA 4DKXA 3EIHA 1M8PA 4QRHA 1CTQA 3RC3A 1N2CE 3BIFA 4WVFA 1JQJC 4TMWA 4TTQA 2C78A 2O0KA 3A37A 2CL0X 2IK8A 1ESMA 3MJHA 2VTKA 1ZC4A 1FFHA 1II0A 1P9NA 4A2QA 1II9A 3Q5EA 2R6CA 1K6MA 4KO8A 4OYHA 3DPUA 3KB1A 1KO7A 3AVPA 2FMXA 1TF7A 4ARZB 1EFHA 5H68A 4Q4HA 3W34A 1AJEA 4A0GA 5AJXA 2GXSA 4JT2A 2ZAOA 5L3VA 5KYKA 5B2ZA 1OXUA 1ZD8A 2VO1A 3KL4A 4A2PA 2NG1A 4XWKA 1PUIA 4LYHA 1E3MA 4PHGA 1OXTA 1LVGA 3ZYCA 1GVNB 2O8FB 1US8A 4AURA 5EXPA 4EJSC 2D7CA 1NVWQ 2NIPA 1TF5A 4B76A 1TQ6A 2WSMA 2KSQA 3K09A 1VG0B 4ZCMA 3A1SA 3IIKA 1U2RA 4UNPA 1X3SA 2VHQA 4FXPA 2PLFA 4LHZA 3LBIA 4P31A 2DHRA 4Q7MB 4U00A 4WAUA 1L2TA 4K8OA 2YOGA 3LBNA 1E2EA 1WBDA 2QBYB 2FGKA 4PSKA 4DSNA 2CE7A 3TSZA 1NL3A 4U7DA 5EE9A 4JT4A 3EWAA 3K9NA 2XSZA 4Q4JA 4K46A 1NJGA 1Q1ZA 1J2JA 4KFTA 1FTNA 4DCVA 4DIEA 4H9GA 1G3RA 1U0JA 1ZJ6A 1CJKC 3BH0A 4LCBA 2GHIA 1CJUC 4MQBA 4Y0AA 4ZDIA 1XPRA 4M53A 3SYNA 2C9YA 2HJVA 1ZM9A 2DWOA 4JMPA 1S3SA 421PA 3GJ7A 2PCLA 1UAAA 3EPHA 2PX3A 3L82B 3WHLA 5DI9A 2WJJA 4NCJA 4NE2A 3ZS9A 4TQAA 3TK1A 1M2OB 2EU8A 2IEZA 2ZTSA 2OLJA 3TKLA 5HKKD 1NMZA 4NYIR 3LLMA 1MO5A 3EC1A 4MGZR 3MWJA 1VG8A 5LPNA 5KDDA 1I4DD 2PZFA 1Q12A 1HT2E 3WMEA 2D74A 4TMZA 2GTPA 4ZIRB 3PUYA 2J0QA 2WJIA 1O3YA 2ZRCA 5KPJA 1R2QA 1IJFA 1CU1A 4EQ6B 2QP9X 2X8AA 4G3XA 1K8RA 3CX8A 3K0AB 1PLKA 1OW3B 5BWMA 5FR1A 1GZSA 2OV2A 5FR2A 1TL7C 1DARA 2KWIA 1VDZA 4LYAA 4MYCA 2P0EA 4BFSA 3Q72A 3KTAA 4LJ4A 3DL0A 1E99A 1XTSA 1YU9A 3GQBA 2NPFA 3U60B 1GG2A 4P4TA 3Q5DA 1MV5A 2ZRIA 2O8DA 2NTYC 3OE7D 4GPTA 5AK0A 1F2TB 1EGAA 5KSPA 2QTHA 3QPWA 3QVUA 1ZU4A 4OI1A 2QN6A 5EE5B 4KYUA 1CLUA 1E1QD 1OPXA 1HURA 2QPOA 1JR3D 2BMDA 4M1SA 3KQLA 2VHCA 4CEHB 3B1YA 3X1DA 1FOEB 4QOSA 1DG3A 2IF2A 1L4UA 2GCOB 2GAAA 3KX2A 4XVQA 1XWIA 2YYZA 4BFZA 1G6OA 5EXSA 2VYFA 1DAKA 4BFVA 3K0EA 3E1SA 3U4QB 5EJEA 2IYRA 1Q22A 1VG9B 2YOHA 3NBZC 4YMWA 3SC3A 1N6PA 2OBNA 1DEKA 1T3HA 5HPYB 5F9FA 3NVAA 3B6EA 3KB2A 1KSFX 4QNMA 2PJRA 3JVVA 1D9ZA 4H1UA 4RFVA 4IVPA 2ONJA 2WAXA 1SHKA 3W5JA 2XJ9A 3CBQA 1XMSA 1JBKA 2CHVA 2JLZA 2J0UB 2WICA 4V0ME 3ZVLA 2CLCX 1CJVC 2OM2A 1P2VA 1ZUIA 4GSYA 4NMMA 2FSIA 2WKQA 3GJ0A 4DB2A 4XTRA 1OKKA 2OCPA 2IUSA 4Z8XA 1W48A 2DFKB 4CT5A 3TSOA 5TVKA 3S1AB 1JECA 2HF9A 4F38A 2B7CA 2ZRPA 1XMJA 2ZITA 4TMXA 1OFTA 5CYOA 4RD2A 1B0UA 4IDQA 3IIJA 5IHPA 4PQRA 4DUGD 5CLQA 4EUNA 4AKGA 2QMEA 2EFCB 4NL4H 4N0EA 3BJIC 3N2EA 1W2HA 5C46F 3I5YA 1I2MA 3THXA 4RCYA 2F43B 1NVXQ 1P73A 2W2XA 3L0OA 5FBWB 1MRNA 1KO4A 2FSGA 1OJLA 1G7CA 2QMUA 1DADA 3LQQA 3RRNA 4B3FX 3GJ5A 1KYIA 2DFTA 3AKCA 3EARA 1KO8A 1JPNA 2GF9A 1P2SA 2GILA 2GK6A 3B2EA 4EFLA 1N6LA 2J0UA 1ELOA 1GL9B 2JJ1A 3I4LA 3AUYA 1P7CA 2WIBA 1F3OA 2EWVA 4KITB 1E2PA 4AKIA 1ZCBA 2FWRA 1P3JA 2PZGA 4LSGA 2WHXA 5EE3A 1Q57A 1QHGA 1UBGA 4LHXA 2XZOA 2C99A 1U0LA 1QZXA 2BHRA 2F3TA 2VRWA 3D7MA 3IUYA 1M7GA 3QENA 4K81B 3S1AA 4GP6A 1BOFA 1T5IA 2QL6A 2IW3A 4L8GA 2AK2A 2ZRMA 1G8HA 4M2LA 2N1BA 5DHAA 4C4PA 2DPXA 1Z22A 5GJBA 2F1IA 1PUJA 1FX0B 1IONA 2G1KA 4B71A 5FPYA 1SVMA 1KDOA 1DO2A 4UXIA 4AG6A 3LFUA 3AF3A 2JLRA 2YINC 5FBQB 4TYPA 2A5GA 3V4FA 3CF0A 3NKVA 1R5OA 1X6VA 4JBWA 2I4IA 3CM0A 4FMDF 3FFAA 2R44A 3KJIA 1YHNA 1JPJA 5FL7A 3U3MA 3U7EB 2IHYA 5JRZA 2HLDA 3EXAA 3P20A 1SULA 1NIPA 3SQWA 1CIPA 1E0SA 2XSZD 3JVUA 4KAXA 2A5YB 1AGRA 2V1XA 2WOJA 2DYKA 1Q44A 4I81A 4PPNA 3SEAA 1OF1A 3TNFA 1KJWA 2ZSFA 1WCV1 3C14C 4NBSA 1XD8A 3U7FB 2A2ZA 2C96A 1TEXA 2B8WA 2C5LA 4URWR 1XJCA 3L2OB 1U9IC 4HB2A 2OCBA 2C95A 2IYYA 4TMTA 2O5VA 1DELA 5L3RA 1PZNA 1TX4B 1ZVQA 3IEUA 4HAWA 3QI2A 3TLXA 4DLUA 5FPKA 5P21A 2ZYTX 1ZMXA 3QKRB 3J81k 2Q9AA 3KJGA 5IRCD 1PV4A 1W44A 5FOXA 2NO0A 4HLUA 3DKVA 4ACAA 5CDFE 1YZGA 1JQLB 2VSXA 4QNRA 3NH9A 5HCNA 3REGA 3FHOA 3CRVA 4OL0A 3KJEA 1FUUA 4LYJA 1AA9A 2J87A 3ECCA 2ZI4A 2GKSA 1A2BA 1JJ7A 1SGWA 1IJEA 3NH6A 4N1AA 4WZBE 1MABB 2RGAA 3T5GA 4BZXA 4WW0A 4KFSA 2W6IA 5JI3E 1OT3A 1KZ7B 2ONKA 1UKEA 3SFVA 1MT0A 3GEHA 5K8TA 4M9ZA 3QF7A 1GOTA 4PAOA 1DAGA 4EPTA 4OHVA 4HSEA 1KI6B 2ODBA 3IPXA 4A0HA 3AVUA 3OAAA 5J4LA 4EKDA 2G3YA 4M8NE 2WM9B 3WHKA 1D2NA 1SZPA 1XF9A 4A92A 2FFQA 2IXFA 1XEXB 2PEYA 1Z2CA 4GMXA 1R5NA 2ZM5A 1VPLA 1IOZA 2VHJA 4TLDA 4FINA 3T5DA 4TZ0A 3MMPA 4LYFA 2ZJAA 2GJAA 2J3EA 3D8BA 5GVRA 2NOAA 6Q21A 1KOFA 2ZIAA 2IWHA 2J5XA 2Q3FA 4IFBA 2RGEA 1IY1A 1IM2A 5LBIA 2KBEA 4ZV4A 3BWDD 3K9HA 4RJLA 4A9AA 2W83A 2QM8A 1HE1C 2WKRA 4HAZA 1TTTA 4Q48A 4D82A 3I8SA 3TH5A 3QF4B 3HU2A 4C7OB 2XXAA 1MR3F 3SN6A 3BS4A 4IEEA 3VR5A 4UKDA 1G8GA 3MCAA 621PA 3NDBB 4NONA 2ZYWX 1E69A 1VYUA 3BB1A 3QKUA 5ANRB 4NYMQ 2WBLC 4XVUA 1CULC 3ZZ0A 4DLRA 4DDTA 1E98A 2Z83A 4UNRA 1QBKC 1KHTA 4TMVA 3FVQA 3KQNA 1RRPA 3SQXA 1AIPA 5FBLB 4BRWA 3U44B 3NHBA 2G0TA 2XX3A 2ZE7A 3DM9B 1K5DA 1OKKD 5L3SA 1NSFA 3MFYA 1GKIA 4UXJA 1FNNA 3OIYA 4Q9JA 2GA8A 3QEOA 1GITA 4IHQA 3SU8A 2JLVA 4TLCA 3IHWA 3NEJA 3HJNA 3AF1A 4US2R 4R9UC 1Y63A 3NHAA 2ASEA 4DIDA 2H5EA 4YQFA 4BEJA 1KDTA 1SQ5A 4W5JA 1W1WA 5KDLA 4B48A 1JAHA 4MRPA 2OBLA 1GNPA 3KKNA 5DYGA 3UMSA 1V43A 4WOPA 2RGBA 3FMOB 4US0R 3RSLA 3W3ZB 3A8TA 4HLCA 1NF3A 2LKDA 5HE8A 3VR3A 5E3HA 3RS3A 1CR2A 1SVKA 2WWFA 1KGDA 1VMAA 1R0WA 4ZCLA 1YE8A 4UNSA 3HPQA 2B8TA 3EPJA 4QHSA 2GVDC 1FZQA 4JYBA 4DEYA 3GLGA 4LJ6A 4JLBA 4D4JA 2JJ1D 3KXLA 2HYIC 3DDCA 1NN0A 1XTKA 4QC2A 4TL8A 1F48A 4TTRA 4B6FA 3R8FA 5F2EA 5L3QA 1M1YE 4D4LA 1NMYA 3PUXA 3QE0A 1YZTA 1AK2A 1ZRHA 3O8DA 1U8AA 1TQ2A 4TQUS 2XGJA 2FU5C 1YKSA 3QXHA 4NCNA 5D3MB 1DAHA 1JEEA 4NYIQ 5GJCA 2ZRAA 1IN6A 3B60A 4U5XA 2WWWA 3SJBA 4KBFA 1LF5A 2IS2A 4IOLA 1U0HC 4EFNA 3KKQA 1AS0A 4CGZA 1E9BA 3WNBA 1XD9A 3DHWC 4QJ3A 2EFEB 2VBCA 1VHTA 4NP6A 1KAOA 1QG4A 2VH5R 2YVUA 1NY6A 1E96A 2HT1A 4HB0A 3OF5A 2AFIE 3UMRA 5JRJA 3FGNA 4R2HA 4LDJA 4BUJA 1S4QA 1N5IA 1P60A 2ZXUA 2OFWA 3TUZC 5FL7D 1T91A 2I1QA 3MUFA 3R9XA 1L8QA 2HLDD 2IF0A 3A4NA 5UKDA 1EESA 5DISB 4B35A 4C0AC 4RKEA 5JSZB 2CBZA 2F9LA 2OAP1 2CLSA 1T5LA 3R8CA 3U61B 3PFIA 1TNDA 4LRWA 3AVWA 2GBLA 3OFNA 4IW3B 4I4LA 3HP1A 2HF8A 4RZXA 3H4MA 4AYXA 2CEAA 2XAUA 4UXHA 2CVHA 2OO7A 1FQKA 1NLYA 2ZANA 1DE0A 4LHVA 4Q9HA 2J0VA 3W6OA 5IT5A 3DMDA 2FSHA 3AKEA 3BGWA 3RS4A 2PCJA 1VCOA 1HV8A 4FCVA 4LBZA 5HE9A 4F4IA 3THYA 1YZKA 2BBWA 3CRW1 4W9MC 3IBGA 5H8WA 3B9QA 1XXHE 2IYSA 1E32A 4QFMA 2R9VA 2FSFA 1NLZA 1KNQA 1HY3A 4DDVA 1M6NA 1XMVA 1Z6AA 2EW1A 2D2FA 3IO5A 4L5BA 2CK3A 3PJRA 2FGJA 4KLZA 3GLIA 3F3YA 1NBMA 1PLJA 4QJ5A 3DZDA 1WP9A 2ERXA 1RJ9B 2WMOB 1XZQA 4UNQA 2W6ID 3MJRA 4OHWA 4CYMA 5JBQA 3LQRA 4BZQA 4JL8A 2Z5FA 3TBKA 1E2GA 1NKTA 3PCRB 2LCFA 4PHHA 1X1SA 4PO1A 4U02A 1XD2B 1XU4A 4M1YA 3DO6A 4MKIA 4FMCB 3OAAD 4CDGA 1Z06A 4CZ2A 4QBGB 1EFRA 5TB5A 5JCPA 3LH5A 1Q21A 4KFRA 2OHFA 4JBYA 1NG1A 3Q85A 3THOA 4PTLA 4B2PA 4MDFA 2MSCB 3T1VA 3FOZA 3PVSA 2VSOA 5KNCA 2AKYA 2ZE5A 2ATVA 2RGXA 2FH5B 5ELXA 4FCWA 1IN7A 1OIWA 3CNNA 2Z6VA 3M6AA 2QQEA 2EQBA 4DB4A 1W5TA 4G5GA 4YMVA 4PFSA 1JEDA 2D06A 821PA 1D6JA 3ZDQA 3ZIAA 3RS0A 2VHUA 2R6DA 5JEDA 2IXEA 4GMDA 3A58B 3TAUA 2NO7A 2ZI7A 2DB3A 4RD1A 3HU3A 1TPZA 3DVLA 1IN4A 5LB2A 4MKFA 1JAIA 4IVRA 1G7RA 5DHFA 3BB4A 4BLPA 3MWLA 5FUWA 3T15A 4C0KA 4OQXA 1JALA 3G5UA 4PQYA 1UBCA 5JI2E 2ZYUX 4DDWA 4LC1A 4BE7B 1J8YF 1DAEA 2FNAA 4M1WA 4WXPA 2OSBA 2FPMA 3AP2A 1N0UA 4DCTA 4Q4LA 3MAAC 4O3MA 3IO3A 5GJWC 3HWSA 5FH9A 1VECA 4Q4HB 2VP5A 4B3GA 2CCGA 4Q4AA 5JEEA 3L0IB 3TW4A 1T8UA 4C0BA 2CCJA 2L0XA 4GP7A 4B33A 1TEVA 2ZREA 2A5FA 5FUVA 3L43A 2ZSEA 3K0FA 5CJPA 1C4OA 4C0HA 5AWFC 4E03A 1US8B 4DT1A 5HR5A 2AD1A 4A15A 1XCGB 2OBMA 4IRUB 5FOTA 2KB0A 3UANA 4FMBB 1Z6YA 2H92A 4ZCIA 1Q1EA 4N0DA 3QSYA 2DFNA 2GK7A 1BKDR 2ORVA 2D3WA 3B8HA 4V0LA 4URUR 1E9DA 2IX3A 2IYQA 4FN5A 1OH5A 1SVOA 5KNBA 3LAWA 1OSNA 2Y8EA 5EP2A 3DOEA 5JFGA 3JZMA 3EZ2A 4N3NA 3V4RA 3HYTA 4Q4JB 2AL7A 4YMSA 3ZVNA 2QA5A 1HQYE 2YC4C 1G8YA 3C5HA 1M7BA 2WWGA 5TARA 3ZZTA 4EAQA 1SVIA 5DI3A 4L9WA 4GZLA 3SE0A 1G8PA 4M9QA 4PPGA 5EUMA 5KTYA 4NYMR 4PO8A 3SJCA 4QM6A 1JI0A 3W3AA 1GAJA 2AXNA 1ZNWA 2IA5A 3B1WA 1W36C 1K5GA 2GCNA 3CW2A 4LPKA 3P4XA 4PZLA 1R8QA 1G3QA 3WP1B 4AKEA 1E6CA 3B1VA 2QPTA 3EG5A 1G291 1FQJA 3CNLA 4G5QA 4MH0R 2MMGA 3VKGA 3O8RA 1MO3A 3D31A 3C4JA 4OK6A 3VMFA 4Q21A 2V54A 2GJKA 1M74A 2XTMA 1XP8A 1W36D 2BM0A 4QKQA 2QEQA 2VP9A 1N5LA 3OFND 2YWFA 4PZYA 1SXJA 3B1ZA 2F7SA 3K9LA 5SZIA 2HCJB 2QTFA 2ZRJA 3SOPA 2QGZA 4TYNA 4RZ3A 2Q6TA 2E9SA 2G77B 1GDDA 2YJTD 4F91B 2A9KA 2P2LA 3GLFA 2ODEA 4LBYA 3I61A 4L9SA 2PZEA 1J70A 5G3YA 3TVTA 3DEFA 1KK2A 3T1OA 4E07A 3KTAB 2OXCA 2OFOA 1Z8FA 4EPYA 2A7QA 4DC9A 4FIDA 2R6FA 4RSGA 4B74A 2YOFA 3Q7PA 3ZH9B 5K8LA 5EQTA 4GOJA 2GZDA 2O8DB 3BERA 3M4YA 2FG5A 2HT6A 4HZIA 4TL9A 3U3OA 2VF8A 4CW7A 4B34A 2ZRNA 4B75A 1XTIA 721PA 1XZPA 4URYR 2V1UA 3C5CA 3LWNA 1ZYUA 1XEWX 2BOVA 2PH1A 2CK3D 1U94A 3SHWA 2WIAA 3BB3A 4LJ9A 1RRFA 3WYAA 1G7SA 1T9HA 3EZ6A 8OHMA 3CX6A 5FTNA 4BECA 3LRPA 1NBMD 4JLPA 2QAGA 5DLQC 3NC1C 4Q1CA 1IXSB 5JZVA 2GJ9A 1P61B 2GDJA 4W5WA 1GFIA 5CIWA 2JA1A 1NVVR 5L8VA 1W4RA 3BH7A 2A78A 2BMJA 4E5UA 2C8VA 2VPPA 3LVRE 3FKQA 1ZNXA 3CB4A 4V02A 2XEXA 3WNDA 2O52A 3OEHA 3TUJC 4LJ8A 1BIFA 2JJ8A 4QGAA 1EFRD 2BMEA 3A1TA 3RS2A 3KUDA 1FMLA 1KMHB 3EWSA 3NTUA 1SHZA 4E22A 1GNQA 1L4YA 1UEIA 4ESVA 2ZR7A 2P3SA 1CEEA 1UJ2A 1E79A 2J1LA 1ZNZA 1OXSC 1B23P 3K70D 1QVAA 3EPLA 1GUAA 2XB2A 4M4SA 3OIWA 4UQOA 5BYKA 4QG7A 2B7BA 1TF2A 3CWQA 3AP3A 2H1LA 1FUKA 2OG2A 1OIXA 1D8TA 3VX3A 3ZIAD 3IBYA 4D6PA 4II7A 1KJYA 2R6AA 1XJQA 4MA4A 4IDNA 1WDTA 3QQ5A 1OIVA 3GCGA 1A2KC 1M7HA 5EZ6B 3RSOA 1EWQA 3L8ZA 3THXB 4AD8A 3KKOA 2RGNC 1OH8A 2GXAA 1AS3A 2WMNB 4W7SA 3W9YA 1SKQA 1OB2A 4I1UA 4A0RA 2P6RA 5TDHA 1U8ZA 1NKSA 4JYCA 1IY0A 5GADl 5GJVC 4YMUA 2JLXA 1UFQA 1FW6A 2CHQA 4DLZA 3MSXA 1WQ1R 1N0WA 3LV8A 3ICQB 1UADA 3ZLJA 1KDRA 1KMHA 1NN1A 4RCZA 3TQCA 3GJ6A 5FOWA 2GZAA 3CF6R 2P6UA 4XVRA 5EP1A 1UEJA 4PO9A 2R8RA 3LVQE 2CCKA 2WJGA 1F5NA 4GBMA 2HXYA 2RKOA 4TLEA 1E0JA 1CJTC 4B3BA 3KUCA 5EZ5A 1HH4A 4UNNA 5AUPB 2JASA 2BBSA 3CX7A 5BXQC 1J8MF 4UJ5A 2EWWA 1VCNA 4IOJA 2QPAA 3UMFA 3IHLA 2WSSA 5HZHA 3FKSA 4R98A 1E2NA 5AJVB 2H57A 4NKRA 4RKFA 4Q02A 4L16A 1E9EA 1S0UA 2PX0A 1S2MA 2RGDA 3BK7A 2ZS8A 3QXJA 3PEWA 5DH9A 5KNDA 3AKDA 4DBLC 4IJMA 2IYTA 5FTKA 3UPUA 1J7KA 2ZI3A 3AF4A 2QT1A 4W5HA 4EPVA 3HDTA 1YR6A 2WPDA 4GOKA 2YC2C 4AWXA 1ESNA 5KPDA 1BH2A 3KQUA 3K09C 1EX7A 2FPLA 5FPSA 2V8OA 4QGFA 3O8CA 3KJHA 1AS2A 2QSZA 5JS8A 1XEWY 4PANA 1RFLA 1ZIPA 1LS6A 1SKYE 3K0CA 3DM5A 3T34A 4ZPXA 1BO6A 4WBSA 1SKYB 5EP4A 4A6PA 3W8RA 2BKEA 3AQ4A 2QP3A 3EIQA 2XOKA 3BXZA 5BQ5A 2JLUA 3ZQJA 1KKLA 1BYUA 1G3IA 3EZ7A 4Q47A 1N5KA 3ZS8A 3L0PA 2GEVA 4WXRA 4CEIA
chains in the Genus database with same CATH superfamily
1NC3A 1UXKA 4CR6A 4ZK6A 2I4OA 4P32A 3F8SA 5K8UA 3I23A 1IVNA 1GGNA 2YX1A 3ORSA 4YDSA 1YOBA 4XWTA 3ILYA 1N2ZA 3R44A 1QLJA 4E11A 3NBFA 2DC1A 4HBZA 1E94E 1XDZA 3ZK8A 1JBEA 2B5OA 2BJHA 2TMGA 1TI7A 1XEFA 2HJSA 3I45A 2YWGA 4LDNA 4YGXB 5JRDS 5G53C 4KNVA 4XWWA 1OYVA 2ODNA 1VL2A 1UXHA 3COWA 3RFFA 2COKA 2JS7A 1DHRA 1G3UA 1TCBA 1V11B 1DJLA 4G9GA 1RWPA 3NC0C 3DZCA 4OHPA 3VR0A 1BCSA 4A4DA 4AZTA 2ILVA 4TV9A 2H59A 1SCNE 4AZ0A 4ABYA 3JYLA 5DM1A 4BPBA 1TJYA 4LV8B 4ML3A 1GGKA 1IIRA 4X1YA 3UA4A 3FNRA 1MXHA 3LIIA 1SWVA 4WFQA 1OI7A 1VJRA 3FZGA 4JH0A 4O4HB 4WGFA 4DQ0A 1G5TA 5CVEA 2RE8A 6REQB 3AHHA 3BE4A 3PQ5A 4G5HA 3UT5A 4J3NA 4RUKA 1V8ZA 1PWZA 1R5JA 5K0LA 3X1JA 1HTTA 3ZQKA 5ITZB 1QRUA 3AVYA 4HZUA 1L5MA 2R8BA 4K5QA 1JEOA 2YW9A 1XBTA 4RADA 3GUVA 3EW7A 5ICMA 3OECA 2BEUA 2OE2A 4UUMA 2D1YA 2GARA 3JQ9C 3NG1A 3TQIA 1Q3KA 1VZ3A 3VPXA 3ZJTA 1T26A 2GFIA 4P2GA 5E7MA 1SY7A 3L4JA 3ITKA 2MWMA 3W5DA 5GIPE 3PFGA 1U04A 3FTPA 2PPVA 3QIVA 5AYVA 2G0NA 3K0HA 3F97A 4KODA 3NAQA 1LSJA 3H6KA 4H1WA 2FR1A 2JGNA 4R2JA 3E9MA 3I5MA 3W4JA 4M49A 5IUJC 1AN9A 2O0JA 3EXEA 3V2GA 1FUYB 2VPWA 4FZJA 2B35A 3N58A 1C9JA 4M1KA 2A3NA 4RKRA 1JIXA 4JVNA 3GPLA 3CG4A 4WY2A 2VHTA 4RMIA 2ZYHA 3VU9A 3FOCA 3K9CA 1I51A 1T6YA 5FD8A 1JZTA 4RQAA 4YASA 4WXMA 5K2MA 1C1XB 3F46A 3QX8A 4ZQCB 2I7TA 3VU8A 4AF6A 4JP2A 3ASZA 3RS5A 4BFWA 4B4DA 1ZXLA 2VPXA 1E79D 4S2UA 1VL8A 2PL3A 5AHRA 3UKJA 2YV1A 2UXCB 2GPTA 4LJ7A 3MGCA 3AJEA 1K8YB 4CKEA 2O6HA 5CM9C 4BVBA 3N87A 4RV5A 5D85A 3VAYA 3NHJA 4OQDA 3G59A 1HX7A 1N2OA 2LDXA 1ZK4A 2OV4A 2V97A 3AOEA 4EWLA 5IEJA 1FXUA 2BFDA 1JQ3A 1B43A 1PR3A 1SFRA 2BGNA 2WFAA 1NXSA 4YLGA 4CMEC 1H94A 2ZPTX 4WI1A 1U2PA 4KKVA 1DXQA 3SS9X 2R3SA 1KQNA 1T13A 3KB6A 4X8MA 1RYEA 3KYCA 1T3SA 2VDVE 3EZXA 1UBKS 2FPKA 1BH6A 3T95A 2NGRA 3HCFA 4UPDA 3WP0A 1S9HA 1N5MA 3DZGA 5SZKB 1VLLA 2EFHB 2GO7A 1UFKA 2XNDA 3OG9A 3PGJA 2ZVDA 3QG1A 4JLWA 4P4LA 2WEKA 2Y68A 4D9GA 2VTVA 3W4KA 4CMBA 2QLFA 1Q1QA 1Y3AA 3CMMA 2JRCA 5EP3A 2HXGA 4R05A 2QM3A 1PI3A 4NECA 2ZK7A 5D7BA 4MYHA 2TSYB 1JDNA 4YIHA 4XX1A 2QN3A 4OXXA 3EHEA 4WJKB 3LBFA 3IR6A 2IDZA 4LZZA 2TMYA 1YI8A 1XTBA 4LHEA 3I92A 3HJHA 1GAQA 4FWIB 2P2DA 3GA0A 2ON6A 1AV6A 1UF9A 2HDOA 4ZCRA 1LBSA 2VRCD 1DMSA 1WXGA 3OA0A 4BKUA 4QZVA 2OZKA 3GPDG 3PKJA 3UB3A 3UGQA 3T4UA 1WF3A 2N46A 2FF7A 3SNHA 1AK1A 3QPDA 4IX9A 3HWRA 5G4LA 1LDEA 2QUBA 3PSHA 4BCBA 4EHJA 3IAM6 1RCUA 1FIUA 1B15A 2BMFA 2DUNA 3IAXA 3QFTA 4AYTA 1EDDA 1XN4A 4PC7A 5D6NA 2WT4A 3PT5A 3C6KA 4M0CA 1CF2O 1PEAA 1V4VA 5J63A 4CV2A 2YJ3A 1EVKA 1KAMA 2W4MA 2YHBA 2WYIA 3LQ2A 3LUBA 2G9NA 1H2FA 3WMWA 2BW0A 4HLQB 1MJNA 3K6SA 4FPXA 3R9XB 2BFFA 1QF9A 1USIA 1DAOA 1BHQ1 4RMNA 4YRTA 5CVUA 1JV2B 3LIPA 4I1RA 3MCWA 1YRBA 2ECKA 3VBCA 2H00A 2ZJ1A 3HRIA 4GPIB 1VJCA 2DRIA 2JJ2A 3HUUA 4XVCA 5BORA 2X9LA 3TTUA 3TMKA 4MQUA 2RCNA 3KXIA 2VSFA 2IS4A 4EYOA 1G19A 2B6NA 3BVPA 3C7CB 3G6WA 3L4KA 3DFUA 1DBQA 1ECJA 4IG9A 1MJ5A 4U8HA 1R10A 3BIOA 4Y6SA 2Q6OA 4D74A 1CZOA 3RO7A 1JS1X 2PLRA 1R9JA 5IT9A 1EK2A 2D2EA 3GRCA 2G4CA 1Z08A 4HNRA 4ZJUA 3WNCA 2G4VA 4MW0A 4B2IA 2OMEA 4DQXA 3ZGXA 2XBLA 1DGQA 2P67A 2ZSDA 1KKUA 4FNAA 5DMHA 3RI3A 1A50B 5CA0F 4DHWA 1KAQA 3K2QA 4V0KA 4DSUA 2PMDA 3QGMA 2FR8C 1P5FA 3IJ5A 4LFCB 1DKQA 2VZEA 1ACLA 4XVHA 3RFTA 2WJYA 2NU8B 4HDKA 4REQB 4NCKA 3CLSC 1P2GA 4R51A 4Y2YA 5IKXA 3DE5X 1BMFA 2Q45A 1LQUA 1NBAA 4A10A 5AKIA 3H84A 4HGPA 2IE8A 4D7AA 4ND3A 4L73A 5DLEA 4F6CA 2XTZA 1VSVA 2BIFA 2FN9A 3KPVA 2IEIA 4B3RB 4QLBA 1WHTB 1E2MA 2YXBA 4P1ZA 4LRUA 3C6ZA 3H86A 5AK5A 5ALSA 2ZR9A 5NULA 5SZHB 1J06A 3T9FA 3W3ZB 4A8JA 4MLCA 5ES3A 2GNAA 5T8KC 1UBMS 4H3VA 2P11A 2DFLA 2IPXA 5BWCA 1NFFA 1ZL2A 3KOZA 2RDMA 4WMLA 4B31A 4QU0A 3AVXA 1EVLA 1YRYE 2P9YA 5DBGA 4FYMA 1HTBA 4H6VA 4HHEA 3NMUF 3BN3A 2XBUA 3OTQA 3RFVA 4LHWA 3E7WA 1JIQA 1MMFB 1ZI6A 3RLIA 1FU8A 4H0NA 3SZMA 3TR5A 2A4MA 1CZKA 1X7WB 2ODPA 2CN1A 3GEIA 1YUBA 4MRSA 4WZAE 5CH3A 1PFQA 5E4FA 3SR3A 5LMUB 3W7AA 2LVBA 2YKGA 1OROA 1IPHA 2IGBA 2JFWA 3CJQA 2ZWVA 3P45A 1QNLA 1W94A 3FOFC 3IDAA 3S27A 1XKQA 5JJKA 2JA2A 5BV2P 4EJSA 1OXKB 5JOQA 1XX6A 1VE6A 2X14A 4XWOA 1IN8A 2IITA 4PZ9A 4H6WA 2C2MA 3HQ4O 4E1BA 2XYGA 4EW6A 3WMFA 4HDSB 1U3GA 3H11A 1J07A 5E9WA 4AZ3A 2QR3A 1CVRA 2C31A 4YB8A 2DH5A 4AROA 1FRFS 3ZWWA 1IHYA 1S1MA 1X87A 4WASA 4WIAA 1JDBB 4F8YA 3NTOA 3OPYA 4PYQA 4GXNA 1TVKB 4HH0A 2CLIB 3TCNA 4BQSA 4LVCA 1IIBA 4WZ6A 1PL6A 3RS9A 1P33A 1UBFA 2HZBA 3U7GA 3NTQA 1J5XA 5FFFA 3KHTA 3VJMA 1XDBA 1HLDA 2E5WA 3I5XA 1ICIA 2ANBA 3SQOA 5D1HA 4EFMA 5TX7A 4D3FA 1HNXB 1VSTA 1PFGA 3UUFA 3PQFA 1UMCB 2Z43A 2GK3A 2HJWA 3L1JA 3MRXA 5CITA 1W47A 2QL5A 3EQ8A 3I6ZA 3CRRA 4NENA 5FP0A 5CYPA 2XZTA 5HJEA 3OQBA 4KOAA 1QGED 1U0FA 4KXUA 1E4OA 4YCJA 1L5HB 4Q4AB 5C9ZA 5K9ZA 3NIBA 2I9PA 1CYDA 1EP1B 1BS1A 4N6GA 4IIBA 1B00A 1IZ9A 2CDRA 2LGJA 1F38A 4WBNA 4Z0PA 4TXHA 1GZDA 3I1YA 4L5IA 2GZ3A 4QT0A 2ZJ7A 1MP0A 3E5HA 4OK3A 2CB0A 3RYTC 3D3QA 4GOXA 3IURA 3NM6B 2XJ4A 5I7VA 3ZOZA 4DEXA 4DE5A 1E7QA 3BMNA 3N75A 3T4PA 2XWBF 1QAMA 4MRRA 3ANYB 3DO8A 3QHPA 5F51A 4I55F 4P08A 4DY4A 1PG5A 2V7QA 2NUPB 1I14A 2OY0A 2QRQA 1U81A 2B98A 2W48A 3T9BA 3NGXA 1BDHA 3USES 4XCXA 4R8MA 5BPHA 5BV7A 3UG6A 4ESHA 4R69A 4D3XA 2BSQA 3RYIB 4L0DA 4UBLA 5JXIA 1H4QA 4HNVA 4F93B 2PL5A 4BO9A 4D26A 1NVTA 1U7HA 3EAGA 2J7PA 4YHHB 5E9AA 4PNPA 3QU7A 1I1QB 3ZZUA 2AWNA 5I9SA 4G4SP 2OD7A 4IQGA 1OAOC 2J48A 4KI0A 4ZVNA 1LSOA 3ONFA 4FFNA 3UWKA 3H5VA 2B1GA 3OHMA 2NX2A 1YO6A 2YV3A 3PPYA 3AXSA 4EYQA 2ZJ2A 4CODB 4YUWA 2I1WA 3IOYA 3OQIA 1VG1A 4ND8B 3WK7A 5AUNB 4QXAA 5IK2A 4C0JA 2FFRA 1FFCA 3RPEA 2Q7OE 1TK2A 3IAS1 1EM6A 3L1IA 1N92A 4C1NA 3PFBA 1JU4A 1QIIA 2CXSA 2JGMA 1SBTA 2QUIA 3MG9A 3RJZA 4G2TA 1XMXA 1ZVMA 4W9NC 3ZNNA 3R7SA 1MF7A 1P1IA 3D0QA 3U5ZB 4II3A 2GAJA 2J59A 4LGMA 4DBVO 2CDNA 3THWA 4TN1A 4DCPA 1UIMA 2B25A 4HAXA 5EGSA 2PZBA 3FNQA 4PQFA 2PT5A 2CLHB 1N3LA 2CF5A 3FYHA 2UVDA 2PZAA 3FD8A 3QX7A 3V8MA 2IKQA 3K6SB 4KXFB 4F9FA 2APJA 2PS1A 1WB4A 2PZMA 2I2AA 4GF5A 4JBNA 3VPAA 4BFYA 1NVBA 2AK3A 2BEWB 5AP9A 1XRSB 2JLYA 3CZ5A 1P7YA 1XROA 2ZSUA 3G68A 2ZSIA 3O93A 1N25A 1G0OA 1GFZA 3PL5A 4GKJB 2NLOA 1SXJB 4N8EA 3X1ZA 5K0ZA 2CDAA 4PONA 3F9RA 1KE2A 4IXNA 1LNQA 3AVTA 1AE1A 1PZEA 1QFMA 1GZ4A 4DCJA 1KAHA 3BE5A 1G21A 1AA6A 1ZR4A 1YI0A 4OI4A 4YAJA 2XNSA 3OP1A 5HHTA 1S7CA 3SVTA 2Z95A 3NLLA 2DECA 2Z6AA 2XUOA 3AWIA 2PK3A 2YYSA 3DOHA 3N3BC 4Q4CA 4K3VA 1OFUX 4OJYA 4NBKA 5DTQA 5HMLA 3TFQA 4A8JC 1WMBA 3M0EA 5EJ7A 1FSZA 1FP4B 3CNOA 2W2KA 3PPWA 1Y8QB 2GT1A 2PL9A 2QYTA 3PR1A 3I01M 5YASA 1KK3A 3D1LA 1NM5A 1D1PA 1WDMA 4GEGA 5L95A 3R3ZA 1THTA 2WWHA 1NLFA 1QFSA 3TBHA 4H7PA 4FDUA 5JSFA 3VKUA 3OZWA 2V0GA 1T4GA 3KOXA 2G9ZA 3WNVA 4NXNB 1AZLA 4PZPA 1HYHA 1OB5A 4HAVA 4H1VA 4C30A 4N76A 2QRHA 3EA5A 1F60A 3EPKA 4F85A 1Y33E 1G6KA 1TO1E 4MCIA 2YUTA 4BVKA 4DZRA 3FRHA 5EWJB 2D7DA 1E0AA 4XRGA 3SD7A 2H5JA 3A32A 4S2EA 5J2TA 3J81A 4P3KA 1H2XA 5T4EA 2O1WA 2VAPA 2YVQA 2OZLB 4Y1RA 2XVAA 2DUWA 3VO8A 4UTPA 2QTVB 1K89A 1QIGA 1G5QA 3MD0A 4JJ6A 3BBPA 2G83A 3D6JA 2JAQA 1T36A 1XQ1A 1ZBDA 2B6HA 2XRYA 4OEHA 2I8LA 4QDTA 3PHCA 4QBFA 3T1HB 5SZJA 2E87A 3JSAA 4IKPA 4JR0A 3TGPA 5HFAA 4IHJF 4F84A 3UK2A 4EAAA 4JJKA 2POQX 3A6JA 2ZRGA 2FA9A 3LCMA 4RNDB 1N2CA 4HWKA 1TUEA 1FBTA 3NBQA 3I3SR 4NULA 4A5SA 4IQ4A 2GTHA 1YR7A 3PGVA 2P8SA 4YAIA 3CZQA 2E48A 3F49S 1V8BA 3HVJA 1VI6A 4OSEA 4NPAA 4OAQA 5GOZA 5B64A 1NTRA 3PVCA 2PHZA 4ZI7A 2B2NA 2NV6A 5A4JA 3M4ZA 3E03A 1GU7A 3AZQA 4MQMA 1U1FA 1F9EA 2XQFA 1PV1A 3HYRA 5G0UA 5CBPA 3SYKA 3GFFA 5BSVA 1DC3A 4JBHA 4RHFA 1D07A 5ALNA 2CVZA 2XLBA 3EUWA 1XZFA 2I65A 2CLOB 3MXOA 3M1LA 3Q9LA 3QJGA 1A9XB 2WM2A 3KHUA 3QFCA 2BMWA 3MERA 4ZT2A 4M8LA 4HVTA 1B0ZA 3BIJA 4HYQA 2Z5LA 4DQLA 1NXOA 2QNIA 3K70C 3JALB 1NRWA 2GNPA 3BL6A 1ZRMA 3IUSA 3LUHA 1EK0A 2E3JA 4I14A 4NQRA 5TMEA 4IJVA 3HBNA 3ER8A 2YQ5A 3HSYA 4QELA 4BATA 4ZD6A 4DLWA 3P9YA 1Z26A 4FE7A 4V24A 2R1VB 1I7DA 3AEZA 4GOMD 5J2UA 1U9IA 2ACEA 1DC8A 1YB5A 2HRRA 1NUUA 2XT0A 2QBYA 1HZJA 1H0KA 2IIQA 3C3WA 5SICE 5KYUB 4G07A 3ZIUA 1V5WA 1SK8A 2HO4A 3GYBA 1YZVA 5CB8A 1QV6A 3W4IA 4NJOA 2P3QA 4HN2A 3A3KA 4DV4B 1E1CB 5IJZA 1PL8A 1YB1A 2P2GA 1BXRB 4ZOLB 2C9CA 3EOBI 4IZ6A 4EEZA 5KTTA 1HZZA 3ASUA 4DR7B 1A76A 1A7AA 2C9BA 1EX6A 3EIEA 3LNTA 5LP6A 4RQTA 1KGSA 1ITZA 3ONDA 4M89A 5AVYA 3VFDA 5FQNA 1GTRA 2ZUWA 5AW7A 3ZD6A 4I5FA 1RXSA 2JLSA 3F6CA 3I39X 1K66A 2WZCA 3U3ZA 4Z7QB 1U28A 2CXQA 1JIKA 4HGQA 1DIBA 1X1DA 1Z0UA 3LXRA 3WYEA 1U9CA 3Q8MA 1X1EA 3B48A 3AB7A 3C7AA 3NTXA 2JIZA 4D0NA 3ELUA 4ZVTA 4CLRA 4RHUA 3AW9A 2C4TA 3TQSA 3U48A 3DTVD 4EVRA 2O19A 2PD4A 1JN0A 4TM7A 2VF4X 1D4OA 1XMPA 2X7JA 2FW0A 4F06A 1ORDA 2F1JA 3WDMA 1UJCA 5D5HA 4IG4A 4OHRA 5IDXA 3G13A 5LQDA 2Z2YA 2WD7B 4TTPA 4EGQA 3C6XA 4RM3A 5JLJA 1KEUA 2QUZA 1YBFA 3VXKA 3WXMA 1HDRA 4XGNA 3S70A 4B44A 1T2EA 4CM5A 8LDHA 3VR5H 3I9V1 3KWLA 3SX0A 2NSDA 1I3KA 4R9NA 4Q3NA 1KQFA 4OQEA 5D2CA 2O3UA 2ZYVX 2I87A 3FMPB 3TYXA 5I7EA 3N05A 4C2AA 5DGDA 2B20A 3PX7A 4RIHA 2J5BA 2NTJA 3WQSB 1T0PA 3TIFA 1R0LA 3WRYC 3MWFA 3I2IA 3P9PA 4JJAA 4Q7JB 3KWFA 1SQ6A 1M76A 2AIRA 2NUBA 2PWPA 3ADKA 5IAKA 1P74A 5JPCA 1WCXA 4Y2HA 1T43A 1F0NA 3CZ4A 3A9SA 1AKRA 2YYAA 3I9OA 3QWHA 3TRFA 3TPFA 1E6EA 1EEHA 2WHQA 4G41A 5L51A 5FLYA 1Z0JA 5DM0A 4A1FA 3DMHA 4J4TA 4PCUA 2B4YA 2HRCA 4MPJA 4XYGA 3ID6C 2NUAB 5JS6A 3NM4A 1Q2UA 1W46A 2ZI6A 1GLVA 3KKKA 2CNWD 3REQB 2Y2VA 3E15A 1AZSC 1OX4B 4RK6A 3W2FA 3DZBA 4G0PA 1FFSA 5I45A 3LE8A 1LVUA 4FR5A 3GYGA 2E4UA 3GW8A 1FFDA 1W0JD 2CZCA 1TQ4A 3CNEA 3I83A 4FEGA 3V5NA 4CEHA 2O7SA 1ISFA 2QAJA 3R1IA 3AINA 1BHSA 2WWXA 3UWMA 2GCOA 1H6BA 1N1MA 1U8UA 5AESA 4CETA 5IDQA 4QGBA 1JFTA 3D8RA 2NPIA 1IN5A 1Q0QA 3BFPA 1KYXA 3QX9A 1AKVA 1SRQA 1IXZA 1U2ZA 2D62A 3A3OA 4I55B 5TQ2A 1EFAA 1T2AA 4XJXA 1C9EA 2H16A 3U4QA 1HOTA 2CWDA 2VXBA 1JQBA 2AI1A 4K28A 1HFKA 4G1CA 2PL1A 1PV2A 3C1TA 4L2IB 5EEGA 1AMNA 4P5DA 1JR6A 1PGOA 3KSRA 2J0SA 4MYTA 2P6RA 4MVJM 4PXAA 1WPXA 2ZIXA 3ND8A 1A82A 4UQPA 3UJAA 3TFWA 4RK5A 2OK7A 3C3EA 5DK6A 1O89A 2PVCA 3G0GA 2VTEA 1A1VA 3GOHA 4O4IA 2CFTA 4P4GA 1P6QA 4U3JB 1EJBA 1QCCA 2JZOA 2DHQA 4V0MA 3ROKA 4B4UA 5HUJA 3VDMA 3WKEA 1T34A 1A4RA 1VGVA 1V6AA 1Q7BA 4AUEA 2D2IA 5C1OA 3BYZA 1TRHA 4DF3A 2DOKA 3FTQA 1O6BA 3G3EA 2E4ZA 1CR0A 3HVIA 1M0WA 3JVDA 3Q7IA 2PMWB 4HAUA 1Z83A 3OH8A 4HPWA 4MIYA 2FQQA 4XUCA 3Q9NA 3LCVB 2GYYA 2M6SA 2NU7A 4J7AA 1PEDA 3G88A 1E2DA 4R3NA 2WTUA 4CIDA 3T5AA 1SXQA 3G5LA 1ZWKA 4OQFA 3KNZA 3V1MA 2AW3A 2DQYA 3CUEF 1PVDA 1KXJA 4W1SA 4ZJZA 1LBQA 1YUNA 2ZB4A 2HK6A 2I8AA 2OQVA 3RS7A 4I3HA 5F3RA 1EG2A 3DVAA 2OXFA 3HXKA 1SUWA 1AOXA 4WDRA 4Y0VA 4BBAA 5LZ2A 1BX0A 1J8QA 4IGKA 1NW4A 1C1DB 1RAEA 4HJXA 3RRJA 4ALKA 4FWTA 3EPRA 3EVGA 4R7TA 4ID3A 1DO0A 2EJTA 3K2BA 1FW8A 3D2CA 1RPAA 2H31A 3C70A 3WY9A 4BXOB 4ZQGA 1P80A 1NXVA 1KBQA 4X7RA 1JEQB 5AJHA 2H08A 2VT3A 5JALA 2IV3A 1X2BA 1Z28A 3RVSA 1T4CA 4PG7A 1WPQA 2I78A 2V74B 3S5JA 2PM8A 3T1YB 2GAOA 4UPVA 3ASYA 4HCJA 5E8RA 3T52A 2WJ6A 2V7VA 3IDQA 1JB9A 2I9KA 2JJMA 2QG6A 2QRUA 3HPRA 4WZZA 3QTTA 3DD1A 2IEAA 2QB5A 3IT2A 2FEPA 3DP9A 3N2KB 3EBLA 2QNRA 2QVCA 5H4HA 3T7JA 1H5QA 2AE1A 2AN4A 3QYFA 1SCIA 3HDHA 3D6AA 3MJ4A 4EMSA 4O29A 1ZGCA 2H9AA 2XRZA 3WJ2A 2OHJA 2YVLA 2VF7A 4R1NA 4L5JA 4DRXB 3Q8LA 5E6SA 3CE6A 4MW6A 2BHTA 1OC2A 4MK4A 2ZBGA 1ONPA 5AM2A 4DG5A 3KKMA 2I76A 4CHGA 2BFCB 2BF7A 3M6WA 4JXJA 5GPBA 1MB9A 1U3UA 3L5OA 5LCXA 2X13A 4GWKA 4ALIA 3NTVA 4R2LA 5JMWA 1OH7A 2H8KA 4R41A 4RW0A 3ZDAA 3I6BA 3OJLA 2VXYA 4P7FA 2Q2NA 3UTCA 3GX1A 2VYNA 1TVCA 1N6RA 1ZLYA 2G4LA 1YDEA 2G08A 4QAQA 1JHPA 4V38A 5ALLA 1VMDA 4CMKA 4FP9A 3QKIA 2Z0MA 5HFJA 3FRIA 2XOXA 4XCVA 1T1IA 3IQXA 5KU1A 4WK0B 1WWKA 2C42A 1XQWA 3U3RA 3RK1A 4AJPA 3LT0A 4IDHA 1UMDA 2OTCA 5FORA 3U4HA 5JARA 5EIEA 4H15A 3BDVA 2RI0A 5EKUA 5KO2A 2V7GA 1OBOA 1W5FA 2XRFA 3TL2A 5JY6A 1T8YA 3UUGA 5MN5A 1TMGE 3H4TA 2ZJYA 3HR4A 2J9RA 5E7QA 2JLAA 2BCJQ 4XGQA 1O2DA 4D0LB 4D44A 1P2TA 1Z2NX 1N6KA 1Z15A 2QL7A 2EFJA 4QUJA 1NJ6A 4AJEA 5B2FA 3T0GA 3DB2A 4YV7A 5JSHA 1FFEA 3KYDA 3DBHA 3M33A 2A58A 3K72B 3NBUA 1GXSA 3CEAA 3VAAA 3WQRA 2BEJA 4BLRA 2F55A 1EX1A 5ED4A 4Q66C 1GFSA 2RHMA 1J8VA 2WAOA 1SC3A 1NRIA 3U7QA 3OC0A 1QCDA 2VZ0A 1LI4A 5C52B 2KS6A 5FHQA 4I9HA 4DPLA 1WRBA 1BXGA 2CVFA 2WK1A 4ZAWA 1ZIOA 4ARVA 3HA7A 1TYAE 2EJWA 3DH0A 4LX0A 3NHRA 2VYCA 3R75A 4L7QA 4PIMA 4MCAA 3W8FA 3WBKA 1AXGA 2Z8YM 4LY9A 3R40A 4FGUA 3RJTA 2ZUFA 3QFSA 5TPWB 3G2IA 3SS8A 5KI6A 1XCMA 4RFSB 3ZVKA 4IZOA 1E3WB 1FSFA 1X39A 1VCHA 2OM6A 1GYRA 3QXGA 4PBSA 2FDXA 1K86A 5FUYA 1F5SA 5IM5A 3U81A 3KHKA 3ZBUA 2ATEA 2HSGA 2JH3A 5J58A 3GUUA 1SUCA 3ZDEA 1L7VC 2PUTA 3BFJA 4QJ4A 5FTMA 1ONBA 2PT7A 2Q3HA 4WOJA 1NN3A 3RRZA 1WA5A 2W5UA 3KOWA 3L92A 4JNCA 1S3GA 4X61A 1VOTA 3LX6A 1YDFA 3R0XA 3P7MA 4MV1A 2YV2A 2CF6A 2GERA 1EMDA 2VHVA 3EJ6A 3FPCA 4OBEA 3USZA 2PUEA 3CUWA 1SCUB 4FDTA 2Z2JA 5TQ0B 1VPVA 2WJ3A 4L5AA 3ROQA 2QI9F 1QHSA 3BQNB 5TGDA 5C81A 1A7JA 1O57A 4G1VA 3I09A 4K9NA 4WY8A 5BN5B 3BPSA 5A5DA 2Z2XA 1EUCA 1E3QA 3MWDB 4WVLA 4ZI3A 3LL4A 3OLWA 3WIOA 2HO5A 4QNNA 3DE3X 4CVNA 3IUQA 1GTSA 3I2YX 2D5BA 1BTOA 2YRWA 1WVIA 3JZAA 4KYTA 3KT6A 2HIGA 4OKNA 2WIGA 3FXAA 3K20A 4MUBA 3D64A 5H9VA 4YWHA 4J0DA 3E4DA 3F7NA 1YZLA 4DQKA 5FBVB 4IIJF 1XJ0A 1Z0FA 4NYJR 3EIWA 2P6NA 2WTBA 1SURA 4OM8A 2EJUA 2DBYA 1X1RA 1CQZA 5DYYA 2QE6A 2FPRA 2GHQA 3WIEA 3J80A 1NTOA 1TFUA 5DRYA 4W7IA 5DNAA 3WZLA 4I19A 4R2XA 1UK6A 5BN4A 3LF1A 3R0JA 1JXMA 2UVQA 2JIDA 1GGVA 4N8DA 4UE3S 5EWLB 3S7TA 4BMPB 5A9RA 1SB8A 3GGGA 4PGMA 3HEBA 4MLPA 4NJMA 3C97A 2Q1XA 1GG8A 5KTSA 1HQCA 3R74A 4QBHA 4UARA 4RJIA 1EQ2A 5JWHA 2HU8A 3UNXA 4BLWA 5B7QA 4S04A 1J49A 3L7KA 4CEJB 1LDMA 1RDFA 5KOYA 1H8ED 1MZVA 1W49A 1FNMA 3GT4A 4LJAA 1XVVA 2EZTA 4LMAA 4MV7A 1SKAA 1PDVA 4YCLA 4M6WB 1Z13A 1UMKA 3R7WB 4DMLA 3BBLA 3U1VA 4IF6A 2B4QA 2BTQB 3H0KA 3S8YA 3FSJX 2FK8A 2OAQ1 4PFQA 1WZCA 2RHGB 1ST3A 4RLFA 2O3QA 2O48X 2GRUA 4HUQB 4Q1EA 1WBBA 3LG2A 1ZGAA 2YY6A 4LI0A 1R8SA 2RMKA 4BIMA 4YAKA 2X7XA 7MHTA 5BQXA 1QFZA 4RL6A 4OJQA 1VIVA 1GRRA 3HLKA 4L07A 3VH1A 3TM4A 4MMZB 1XTJA 3ZKWB 4KNYA 3A1WA 1JSLA 2ADOA 1BXKA 1XZKA 4J3JA 3ZCUA 5JC1A 5JNTA 2P27A 1ONSA 4JZKA 1C3OB 3LY5A 4CU5A 3OIGA 1N2EA 2VP3A 3IYLW 3LPAA 4IEIA 5TXGA 3SYLA 5KSZA 1WG8A 4Y30A 3RAFC 5TRTA 2BR4A 4F3NA 5IMBA 1QH1B 5ALHA 2OWEA 2IDJA 2V45A 3PQ7A 4QYIA 2ZGVA 3WLJA 1FSPA 3O8QA 5C4MA 1A8SA 4ARCA 3NEYA 3HKDA 1R0ZA 3QLEA 1ECBA 2Z98A 4OHOA 3OZBA 2GEKA 3R24A 4X1IA 2HBYA 5D3MA 2BFMA 2H85A 3R3UA 1RHQA 1G8MA 3DOFA 2VQFB 1QSGA 2ENUA 2QIPA 3VNUA 2Q5QA 5K3FB 4D6XA 2P75A 3I0MA 4BE9A 4RTSA 4G5FA 2DUMA 4G0MA 3CPHA 5J4HA 3FUCA 4HFNA 5A6SB 3EE6A 4B4KA 5F98A 3IS3A 4HFJA 5IKMA 1EB8A 4D4GA 2MR5A 3QNUA 2B0CA 1M5UA 1RHUA 2XWPA 5JMTA 1O58A 4LBVA 3PNPA 3W1WA 4GLBA 4AP6A 3B9PA 1PG2A 4G5OA 4DJEC 4RTMA 2Q6LA 5ICGA 1UM9A 2WA1A 2H48A 2A9OA 2OMKA 1WJGA 4JA2A 1O9GA 4LZPA 4Q01A 1N2BA 3CONA 4L15A 1RQGA 1CF4A 3OZRA 4IDAA 2MYPA 2Q9CA 1ENPA 2GRAA 5CHYA 3ZHUA 2CFOA 2JKZA 1YJAA 3TXXA 1VC2A 2W4QA 3AI7A 4HN4B 2B1RA 3IR5A 3TTVA 3ET5A 4JJZA 4JA0A 2JGJA 3KEOA 3PRHA 4XPIB 3FH0A 2QXYA 4ZZ1A 3PA6A 3U3JA 1Q77A 5FFNA 4Z4FA 5CXXA 1PSZA 3WL3A 5KQMA 2IDMA 4IVQA 1DV2A 5CXQA 3RVQA 4DYDA 3U7HB 3E61A 4NARA 1JPVA 4AY2A 1CCWA 1YZUA 4B6PA 2WY2D 1KJ9A 5GVSA 5CFOA 3FLAA 3H1TA 3TLKA 2XUPA 2AQHA 1N6OA 1TU4A 4C3VA 4DILA 3B52X 1HEYA 2C9DA 3B6MA 1KSHA 3FWPA 3KS9A 3MHTA 2XNDD 2CNOA 1GADO 4J6FA 4UEOA 4XASA 3D4LA 4RMJA 2FMUA 5DSZA 5FI5A 3E84A 4HXGA 2PU7A 1CE8A 1PJ8A 1E77A 2Y0PA 2PKEA 5HQJA 1OFIA 1V71A 4RA6A 4EGFA 3UVEA 1XU7A 3PQ3A 3TZ6A 4AJJA 4CKCB 5H3LA 2O2HA 4F7WA 1LLCA 1PE0A 3UGKA 3MJTA 4X0EA 2OV1A 3IKJA 4Y2PA 5I51A 1VGRA 2C04A 1C3EA 4AK9A 1UDCA 4Q9LA 1TUIA 4JS0A 1IRIA 3DONA 1IZ8A 2Q99A 1Z7YA 2SHKA 2GN6A 3O2QB 5L4LA 1GL3A 3W6NA 4BE4A 3IA2A 1RJ9A 2EHJA 4TMKA 5DBOA 5J9FA 1IBLB 4OHCA 2Q6KA 3N6XA 3AL3A 2QLJA 4LF7B 3L7AA 2W43A 4MVJG 3TOVA 3RFUA 1WABA 2QROA 1RQ7A 1Y7TA 4U7GA 2KE5A 3TMYA 2H2AA 3I28A 3T7RA 5BWNA 2MYNA 4WKPA 4CKXA 3F6EX 1YGPA 3TRDA 2ZIEA 3W04A 3LOUA 5KJ1A 2D5IA 3DKIA 1IBCA 1Y7HA 4LVNA 4BBZA 3ECAA 5K4AA 2F67A 4N48A 2ID7A 2VYQA 1ZPDA 1ZM4A 2ZU0C 2C2GA 3T6KA 3U9LA 1ZSYA 4N40A 4WFJA 4HYEA 4Z1MD 4FOTA 3OX4A 3IPRA 5JAQA 3HVRA 2XVMA 4NZYA 6ABPA 3E9CA 4WOKA 5C18A 2C4HA 2XNHA 2ZU6A 2NO1A 3IVCA 1PFWA 3H2YA 5DU2A 3T0IA 2QOEA 3GAAA 3TLAA 2QJRA 4F11A 3I8XA 3IXLA 3OOWA 4YRQA 3LC0A 3ZX5A 1LZLA 4PX9A 5M34A 3I58A 4G6ZA 5A0VA 2ZFUA 3ENQA 2ODAA 1MGPA 4PO3X 3PD1A 5JECA 3MCUA 3UWOA 5CLJA 2O9JA 1ND6A 2GB4A 3DZJA 4JJ7A 1C8KA 3D4BA 3VJLA 3VZBA 4YWJA 2ZETA 3C3YA 4PG8A 1IMJA 4CTJA 4KDFA 4TLBA 4UUOA 1Q6YA 3IAAA 1TEHA 2SECE 2XWQA 4JEHA 1K8QA 2Y1LA 3CRNA 2QP4A 2RGGA 2K4MA 4DKXA 4AZWA 4EFKA 1ZW1A 3EIHA 1M8PA 3HCRA 3HHEA 1Z4KA 3PI6A 2E49A 1YQDA 3LOPA 2UDPA 4TMWA 3OHSX 3WGKA 3JRNA 4KB5A 2CL0X 3B8EA 3CNQS 4UFOA 3HJBA 2IK8A 2DM6A 3DOIA 2FUKA 1FFHA 1B0PA 1PN3A 1II9A 2PX6A 3DL4A 5MGNA 1LPMA 4DLLA 1YRLA 1KZYC 5FV7A 1L7BA 4YXFA 4YACA 1WCWA 4ARZB 1EFHA 4BJ6A 4G0UA 1C14A 4GXRA 3AEKA 4JYAB 1T15A 1ZOLA 2IY7A 2ZAOA 3JD1A 2XUIA 1JXQA 4N6OA 4YJHB 2FQWA 3KYBA 3RG8A 3V8NA 2CUTA 1RXUA 3WNZA 5KYKA 1RM3A 2VQDA 4G9EA 1OXUA 2WDPA 4NDNE 4Q3KA 1ATZA 4R0MA 2NG1A 5JJCA 4PU0A 2F17A 1PUIA 1E3MA 4PHGA 1T9CA 4WCFB 2X8JB 1GVNB 2O8FB 4AURA 4M1EA 3B9RA 2WR8A 3NBKA 5CA1B 3PGKA 2Q27A 1Y4UA 1C7ZA 2PJUA 5ALGA 3W6ZA 1BS9A 1JWBB 1TF5A 1IULA 2NIPA 1NQOA 3EY9A 2VDOB 2KSQA 1Y5NA 1VG0B 2BGUA 2X4GA 1X8XA 2XMPA 3CC8A 3EMDA 4GR4A 4K6MA 2CLMB 3ZWOA 3IIKA 4CGYA 4DR5B 1PDOA 1T5DX 2VHQA 2PLFA 4FXPA 3LBIA 3IP7A 4LHZA 4OYRA 4Q7MB 4WAUA 1N32B 2YOGA 3LBNA 3PRJA 4IQ8A 1WLYA 5BNWA 1HT0A 2EBHX 1MOPA 2OV6A 1WBDA 3G1TA 1VI5A 1SUAA 2BLLA 2CE7A 2PUAA 1ZJWA 1NL3A 3DPSA 5GINE 4ZK2A 3W5BA 2F48A 4ARAA 4K46A 3WOVA 1Q1ZA 1FTNA 4DCVA 1L4LA 1U0JA 1KQ3A 1CJKC 3KK0A 1P4GA 1NUQA 1B1AA 1BWRA 5HKLA 1IUPA 5SY9A 3LRXA 3ISJA 1C7JA 2EOAA 3K6KA 2AV6A 3NHPA 3RT1A 3JQBC 4FSXA 4NBLA 2HJVA 1ECLA 1B8UA 3TIXB 1G55A 3W1VA 2O2GA 5BV1A 2ZBVA 4ZQEA 1ZRNA 1S3SA 3U3DA 2LD4A 2ZWPA 1KOGA 1VJTA 4MUJA 2V7EA 3B3AA 3UXHA 1UAAA 2PX3A 2YDYA 3WHLA 5DI9A 4HNAB 4TOIA 3K2EA 3OEYA 3OETA 4H1TA 4NE2A 2CV1A 4HEQA 3DG9A 1ZH8A 2H4WA 3FPHA 4TQAA 5HRCA 2PYZA 1O96B 4RHCA 3RM3A 3LLMA