3PCRB

Structure of espg-arf6 complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EspG
publication title The assembly of a GTPase-kinase signalling complex by a bacterial catalytic scaffold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 40
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2010-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pcrB00
4CEIA 1EFUA 1E9BA 1VG0B 1SVIA 2J0UA 4QC2A 3AUYA 2I1QA 4C9BA 2Z83A 1Z6YA 4PHGA 4C0HA 2NOAA 4DJTA 3B60A 1ZD9A 2C8VA 4BEBA 4TMTA 1O87A 4C30A 2L0XA 1E2NA 3IO3A 5JJKA 1VG9B 3CW2A 5AUPB 1T0JB 2ZANA 2F43A 4IVPA 2E9SA 3PQCA 4GT1A 3TSZA 1N5LA 2DYKA 3E5HA 3L43A 3VNVA 3UMFA 3T34A 4YDSA 4KODA 4A0HA 2ZYTX 4A1FA 4YDHB 5DGXA 3KTAB 2WWYA 5HE8A 2F1IA 1HQYE 4IHQA 1WBDA 4GL2A 4M1OA 4B48A 2DFKB 4RD4A 4WXPA 2ZAOA 1AIPA 1P9WA 4KITB 2G77B 5GJBA 4DDWA 4B34A 2Z4RA 4KSCA 1G4UR 1NG9A 1TAGA 1X8JA 3U3OA 4W5JA 1T8UA 3AGQA 2WSSD 3LFUA 4BLOA 4D4MA 2EFDB 2ZJOA 2VP9A 2QBYA 4LOAA 1XCMA 2ZE8A 3K0CA 2BCJQ 4OI2A 4MKFA 3O8CA 1QBKC 1TUIA 3NDBB 2O8FB 4P0TA 4YLGA 4OQXA 1LV7A 4JSYA 4AIIA 4TYQA 4P4UA 2R6DA 4PSKA 1FOEB 3THOA 3BB3A 1MABB 4KLZA 4L8GA 1ZBDA 5IDVA 1JR3E 3TW8B 5FTMA 1TQ6A 3R20A 4R2HA 2DFLA 3OFNA 2H57A 4G5GA 4CVNA 4AK9A 2ODBA 1KHTA 1P60A 2XTZA 3VR4A 3TK1A 1OB2A 4Q5IA 2CVFA 2JJ2A 1QG2A 521PA 3NHAA 4KBFA 4B2LA 1D5CA 1E2JA 4OI0A 2WMOB 3KX2A 4EQ6A 4K8OA 1L8QA 3J81k 4L15A 1VTKA 3LWNA 1G64A 2J41A 3O8BA 1Q12A 4DDVA 3AB3A 4OHZA 1W0JD 2ZI3A 4GSYA 1FX0A 4WW0A 3ZVRA 1U8AA 3P1JA 3THXA 1W7AA 2VIIA 4ASUA 1DO2A 1K5GA 4DLRA 4EPXA 2XXAB 3U60B 3RWMB 2GAAA 5C18A 3C41J 5FTKA 2XSZA 4LDJA 3KTAA 1W4BA 1TMKA 1DE0A 4IOLA 2R6GA 3UK6A 4ARZB 1MT0A 3QBTA 2XNSA 1BH2A 1E0SA 2QU8A 4DVGA 5JLJA 4M2LA 3LVQE 3Q85A 1F2UB 1II0A 5JJIA 2E1RA 1TPZA 1D6JA 1KSFX 2GKSA 3LW7A 4Q9JA 5J4KA 3P4XA 2FFAA 3AP2A 2CK3A 2IYLD 3I3SR 1JB1A 4LV6A 3TSWA 1GRRA 2XTMA 3I62A 1E9EA 4ON9A 2WAYA 1OF1A 1IXRC 4NTZA 3B9PA 1XU4A 4V03A 2H92A 4QHYA 5F2EA 2HEIA 2BEJA 2HT1A 1G7CA 2ERYA 4ESVA 3MAAC 2OSBA 2Z4SA 4M1SA 4XJXA 2IYQA 3ZD7A 1G8FA 1JR3A 1E9SA 1XDBA 1YU9A 1N6PA 1S4QA 3GPLA 4Q48A 4OHWA 1GRQA 1Z6AA 2BKEA 2Q9BA 2BBTA 3CLVA 4HB4A 4C0JA 2IS1A 1JPJA 3SU8A 1G9XA 1O3YA 2IS4A 2HUPA 5JBQA 1TEVA 2FFBA 2NGRA 4B73A 4OK5A 4MRSA 2W83A 2HDNB 4LHWA 5CITA 1CBUA 3EZ9A 2FE4A 3K0FA 4Z8YA 1F48A 5FTNA 4A9AA 3C8UA 4R71A 4A6XA 3RC8A 3PENA 1KSJA 2GZHA 4NCJA 1XEWY 3WMEA 4BUJA 2VBCA 4XH9B 3AF4A 3LDAA 1G6OA 3OEEA 4EKDA 2B6HA 1QHYA 1KJZA 5IK2A 5KDOA 4M9XA 3PITA 2IS6A 1E96A 1G3MA 3X1YA 1DG1G 3KQHA 2FSIA 5D3MA 4F92B 3SJZA 2FFHA 4LC1A 3AVOA 1D9ZA 4HYYA 2MMGA 4ZV4A 3L0SA 3BRWD 3RS0A 4XSGA 1EG7A 4G01B 1XB2A 3BOSA 3FVQA 1SXJE 5A5GA 2D7CA 4YQFA 2JJ8A 2GCOA 2GXAA 3EAQA 3L0IB 1KAOA 3C5CA 3SYLA 4D2IA 3A37A 3N70A 4B44A 1WB9A 3RS3A 2BMJA 5EUQB 5CB6A 4AYTA 3ZLJA 1CKEA 3B2EA 2PZFA 3CX8A 4QJ5A 2JLVA 3UKDA 1FP6A 4Q66C 4QM7A 2ATXA 4P4SB 5FOTA 4Q1AA 4UNNA 3AVVA 4KFRA 2IYXA 3GJ7A 1HEIA 1KK0A 2Q3MA 2C95A 5JWOA 5FL7D 3L0PA 3TVTA 1E0JA 3PR1A 1GUAA 2QROA 3L82B 4BLPA 2XSZD 2DWQA 3WNBA 4CIDA 2LCFA 2QP9X 3ZYCA 4ITRC 3CNOA 2QM7A 3UWKA 5ELXA 4FI3C 1WMSA 4LUCA 5E7JA 3D6TB 2XZLA 2J5XA 4V0ME 3PUYA 5KNBA 1OHHA 3CPEA 1RYFA 1QHIA 1Z47A 2D06A 2JASA 1VMAA 4RJLA 5EE9A 4CYMA 3Q9LA 1NSTA 2G0NA 3GJ3A 2W2VA 4GMXA 4Q9KA 4QNRA 2OM2A 4F91B 1XTQA 2ZM5A 1II9A 3FHOA 3T1VA 1U99A 5AR1A 1AA9A 4RD1A 1JXOA 2FF7A 4MYUA 5EE3A 1MO6A 2CLDX 1W4CA 2O8CB 2CL0X 1X1RA 4O2RA 2ZRCA 2G83A 4D82A 2VP4A 4BECA 5G3YA 3W6OA 4LBYA 3NBXX 4QJ4A 2IXEA 4D0NA 5J4YA 1G1MA 1EFCA 3NBZC 4JJZA 4KLNA 2C9YA 3SQXA 1ZINA 4OK3A 5DLQC 3VKWA 2ZRBA 2OFXA 4JLMA 4LX0A 4HLCA 4XTRA 1YVDA 3I61A 4ZKEA 5EP1A 1HT1E 1SXJA 1XCGB 1E9DA 2ZRJA 3HR7A 1FQKA 2VP0A 2QENA 4QBFA 4TTPA 4D4KA 2FPLA 3UWOA 4Q01A 2WOOA 4TMWA 2ZJ2A 2NPIA 2AFIE 1CTQA 3LW8A 4OK6A 1RKBA 2KE5A 3F3YA 1GDDA 4MKHA 1BOFA 4F38A 1ZD8A 3FMFA 3GLIB 3EZ2A 3CM0A 3DDCA 1XP8A 1T3SA 3ZH9B 1ZYUA 4CEJB 2P0EA 2BMEA 2RHDA 3BE4A 5EXPA 3OEED 5BQ5A 1T9HA 3VR6A 5BN4A 2WWGA 1YZQA 1HTWA 4QRHA 4Q4JA 2YOFA 1U98A 2BOVA 2KBEA 1SVSA 2P3SA 2WMNB 3SBDA 3B85A 2XJ4A 1R10A 3RABA 4EPTA 1IONA 1ZM9A 1G8HA 2CE7A 4V0MA 5M04A 2QSYA 2IXFA 4Q1BA 1HURA 3EIEA 3HU1A 4M9QA 2WJIA 1W46A 4HAVA 3VR2A 4LC0A 2ZYWX 1KNQA 4YMTA 3EPLA 4Q4AB 3DMNA 3S1AB 1Z63A 1L7VC 4I1VA 3U7EB 1P73A 2HLDA 2GXSA 4ZCLA 2QE7A 1VPLA 4NYJR 4DIEA 4GPTA 1GZSA 3B1ZA 4V0NA 4BFTA 3I1FA 1XEXB 4C0SA 2XNDA 3FFBA 3OEHD 4PANA 2A5DA 4RY2A 1NY6A 3ZDQA 3P20A 5L8VA 2H18A 5B57C 5AJVB 3R9IA 1NVVR 3T12A 3SC3A 3U61B 2BBWA 5GJVC 1DAKA 1XPOA 2IYYA 1PV4A 4OHYA 1RRFA 1S9DA 2P6UA 3SR0A 4H1UA 4DB2A 1N2CE 2QAGB 1SKQA 3MD0A 2CXXA 3L0OA 1WE2A 3BB4A 2JIZA 2QAJA 2GETA 4IOKA 3WRYC 3DKVA 1XXHE 1ZUNB 3DM5A 5K8LA 2WICA 3B82A 4KVAA 3SJBA 3BH0A 4JIMA 2XB4A 4W9MC 3WBJA 5JFGA 3WP1B 1ZC4A 4PSAA 3CBQA 4CRWB 4DSNA 1LB1B 2GEVA 3K0AA 1KI7A 1R0YA 5FBVB 5BXQC 4TSFA 1RYHA 2VF7A 3DOFA 3FB4A 4GI7A 3P27A 4BFSA 1Z29A 2PBRA 4P4TA 4B3FX 1KI4A 3U3KA 3GJ6A 1E9RA 4B71A 2XB2A 1Q21A 2GBLA 2OAQ1 4B74A 4MRPA 1Z6TA 3FKSA 1W2HA 4JVMA 3REFA 1R7RA 1GNPA 3EXAA 2C5LA 3ICEA 3EC1A 1P75A 2C9CA 3NDPA 2XX3A 3QXCA 3BH7A 1UEJA 2QPAA 4IDOA 1KSGA 5EXTA 2XOKA 1SXJD 2AHOA 2ZJBA 3X1XA 4DIDA 5C2JB 1KZ7B 1L2TA 3SHFA 4NCNA 1ZNZA 5EP2A 4DLWA 1B23P 4AYWA 4E22A 4FWIB 1CEEA 1GL6A 4RVCA 5DHAA 3KXIA 1XEXA 4IDNA 4PSVA 3TIFA 3WHKA 3LY5A 1EFTA 1MO5A 1QG4A 1QVRA 3K9NA 1GOTA 2WKQA 3U3JA 2ZVPX 1CJTC 3HP1A 1OXXK 1Q20A 1W36D 2DPXA 2JA1A 1KO5A 2R8RA 2VHCA 1CJKC 3HDTA 2IUSA 1BYIA 1N3BA 1Q57A 3HPRA 1SULA 1D9XA 1R4AA 3Q3JB 4MQBA 1YZUA 1RE0A 3FPAA 1SVMA 1JEEA 1Z06A 2JJ1A 2XZPA 1XTRA 4QHTA 4EFMA 5FL3A 1P3JA 1F2TA 4DLZA 1I2MA 3U6BA 1OH8A 1G4AE 1NN5A 1TF7A 4HAUA 1XXHA 1TX4B 4OQLA 1F6BA 1GP2A 2OAP1 2YWFA 1IY0A 2NZ8A 4XD7D 4Z1MA 4A36A 4LBVA 1XCPA 4HAYA 3EPHA 5JJLA 1N6LA 1TL7C 3BJIC 1YRBA 4C2TA 2VP5A 3I8XA 5LBIA 2C03A 4QHSA 3AUXA 4X8LA 4CEHA 2PX0A 4ABYA 1U81A 3U44B 2PX3A 2YWEA 1YKSA 2D74A 3SNHA 2ANCA 3RS7A 3GLFE 5H8WA 2RGBA 2CHVA 2XITA 5KDLA 4UJ5A 1JALA 2FGJA 3SYNA 3GLFB 2P5SA 1J8YF 2Z43A 4NYMR 3P4YA 1ANKA 4UQOA 3PXGA 3RAPR 4B76A 1VECA 4PC6A 721PA 1VYTA 2J0QA 1DTSA 4B2PA 2EW1A 3IPXA 2NO1A 5GJCA 3UATA 1CF4A 4MRNA 2GDJA 4RKEA 5JI2E 2GEDA 1Z6XA 4OJKA 4Q02A 2XGJA 3UMRA 2JLYA 1FNNA 2PLRA 3THWB 1MOZA 1QDEA 1DO0A 1X8KA 1XX6A 1N6RA 2TMKA 2YYZA 2CDNA 2GVDC 4URVR 1Z2CA 2OV2A 3BFKA 2RB4A 1WF3A 3CPJB 3QVVA 5FBRB 5DYIA 1W36C 5KTYA 1A82A 1I4TD 421PA 4DLTA 4BLQA 3EIQA 3MJRA 4KFUA 2GF9A 1ZUIA 1XRJA 3KB2A 4LYAA 4TSFD 4HUTA 2GXQA 3LBIA 3K9LA 5B30A 2G6BA 3K70D 5DI3B 3QKSA 5F9HA 1E2MA 3FTQA 4LZZA 4EAQA 2ZREA 5JEDA 1R0ZA 2G88A 2OCBA 1ZIPA 3FKSD 1Q3HA 3FFAA 5KPJA 3RSOA 1AS0A 4FIDA 1GWNA 1NNEA 1JJVA 2PT7A 2QQ0A 3SOPA 1SVOA 3BXZA 3CB4A 3ZQ6A 1CR2A 1A5TA 2UZIR 4QBHA 1U2RA 2CBZA 2W00A 1BMFA 3B1YA 2FSFA 2WSSA 3GFOA 1JEDA 2W6IA 2IT1A 2Q6TA 3OE7A 5JRZA 1U8YA 4P33A 4B3GA 4LK2A 1W4AA 3KJEA 1D8TA 2ZIAA 2WSMA 3LQQA 1C9KA 4HLQB 3GLFA 4CEIB 2J0UB 4L16A 4TMKA 3CR7A 1AS3A 3IIMA 3VHLB 3VX4A 1U90A 1E79A 1ZM4A 3RRZA 4EPYA 4Q1DA 2ZPTX 2GJ8A 4LYJA 5C4GB 4IOJA 5HE9A 3CH5A 4TL9A 4OQNA 4PC2A 1NKTA 3W5IA 2F43B 4D26A 3I5XA 3NEYA 1JECA 1G21E 3VTKA 2QN6A 3E2IA 4NPHA 4Q00A 1FUKA 3NBYC 5CJPA 3KXLA 3TBKA 4HDCA 4IW3B 1DVRA 3QG1A 4MGIR 1EX7A 4DLUA 1S2MA 4WOPA 4X8MA 1EX6A 2NTYC 2J7PD 4A4DA 3ZZ0A 3OIYA 4I99A 4NYIR 2DWPA 3SI7A 3ZIAA 3EA0A 2ZI9A 5ANRB 2J9RA 3VX3A 1AZSC 4C7OA 1KDTA 1QHSA 3F0TA 4Z1MD 1W0JA 2DB3A 3I92A 5CK4A 1ZU5A 2JATA 1JI0A 3LXXA 3P26A 4B3BA 2BEKA 3X2SA 3K70C 1TQ2A 3L8ZA 3TR5A 3DVLA 5DI3A 4K81B 1WDTA 2CE2X 2WKRA 1OKKD 2FSHA 2NQ2C 2ZRLA 5JHGB 5TMPA 2QZ4A 5CK5A 3BC1A 5CDFE 2QBYB 4TN1A 3TRFA 4B3DA 3BBPA 2ZRKA 1G41A 4W5HA 2HYDA 4ILEA 1X8LA 2BBOA 2ZRPA 4F93B 4OHXA 2B8WA 4ZDKA 2WKPA 1X3SA 1G6HA 4O3MA 2JLZA 2D7DA 1OV4A 2A78A 5CIQA 4RCYA 2BJWA 4I4LA 2OXCA 4O0MA 4IVRA 2W2XA 2QM8A 4DCTA 4QJ3A 3ZVLA 3M6AA 2LWIA 3SJCA 5TVKA 3RRMA 2D3WA 3ZGXA 4EQ6B 2A5JA 3F8TA 4KFTA 4ZIRA 1LTQA 3GCGA 1IN8A 3HR8A 2CJWA 1BKDR 5IT5A 3CR8A 3RS2A 2R9VA 5DHFA 3TGPA 2VA8A 5AUQA 1W2GA 1CLUA 4TLDA 1MH1A 1FX0B 4BQSA 1E2HA 1P2VA 1QVAA 3THXB 2ODEA 3LXRA 3I32A 4LHZA 3VR3A 1HH4A 4BASA 3BFVA 5TARA 4LHYA 3WMFA 5CM8B 4F7WA 4NCIA 2GILA 1G19A 2C77A 4DCVA 4L9WA 1AM4D 3T1QA 2ERXA 4RSGA 3RRNA 3U3RA 3R8CA 2C78A 1OFUX 4WXRA 5J4VA 3JZAA 1CR0A 2FA9A 5FOVA 1BMFD 1OXUA 2Y8EA 3GEEA 3AEZA 2DFTA 1GAJA 2W6ID 3TQCA 3O8RA 4AC9A 3OE7D 1R5OA 4UNSA 3SFVA 5BWMA 5JCPA 3T5GA 1QHXA 1S1CA 3TW4A 3SS8A 4EDHA 3GJ4A 4AYXA 5B2ZA 3THYA 2WTUA 4TT3A 2GEUA 1KZGB 5CDFA 3NHBA 5FFMA 2GJ9A 3A1SA 4RFVA 4LV8B 4MDEA 1ZJ6A 1E79D 4JLJA 3ASZA 4E03A 5KNCA 5KNDA 4LHXA 3EZ6A 4PC3A 2AN9A 3U4QA 1VYUA 3FOZA 3PIRA 3VU9A 4A82A 1NI3A 3GD7A 1KAGA 3MWKA 4GZLA 3FYHA 2CCGA 1AKYA 3QKRA 2BMDA 2MSDB 2A9KA 3BB1A 4EIWA 2VO1A 1G16A 2ZSFA 2AK3A 2GK7A 3BORA 1TQ4A 3QXXA 3RLFA 3ZIAD 1ONBA 3TLXA 4JVSB 2QEQA 3DM9B 4KU4A 4RD6A 2IYTA 3RHFA 4N0DA 2HJVA 1EWRA 1ZVQA 3MLEA 1E1RD 2R6CA 2B7BA 4MH0R 4NONA 3TMKA 4A8JC 3K0SA 5KO2A 1KK2A 3K0FB 3H86A 2QT0A 2WWIA 2R6FA 4DDUA 3C16C 4KBGA 3NXSA 4OL0A 3ZZTA 3BFXA 2JLQA 2VSXA 1W5TA 5FL7A 5KSOA 4DXAA 2C96A 3I72A 1ZD1A 3I5YA 4TWZA 2GZDA 3IILA 3KXKA 3ZZUA 1T5IA 4UKDA 2F3TA 4IOMA 1XD2A 2ZU0C 5J47A 5HCIA 4D25A 2QI9C 2RHMA 4LJ9A 5D3MB 4A0FA 3Q5EA 1JAHA 3V00A 4BZQA 3H84A 3CZPA 2LKDA 1DOAA 1NIPA 2FWRA 4HATA 2QMOA 5FPHA 2OZEA 3RWOA 3RYTC 2ZJYA 4XTCS 1GNQA 121PA 4WAUA 5IRCD 1OPXA 3R7WA 2GCOB 1MRNA 2GA8A 3N5CA 1P9RA 3Q72A 2QMUA 2P2LA 4GRAA 4XWAA 1HE1C 3QKTA 3ZJYA 1UKEA 1TU4A 2XEXA 3KDSE 5HPYB 2DY1A 1LVGA 1DAEA 4F4IA 3QVUA 2WVJA 1G3QA 3CZQA 1HUQA 1Q3TA 3GLHE 5AJZA 5JWHA 5FH9A 4C4PA 3LX5A 4G0NA 3SN6A 2ZROA 1KKMA 2FEOA 4FCTA 4JLNA 2KB0A 1A2BA 2OBNA 3TUIC 4PHHA 2GTPA 2O8EA 1RIFA 4JZKA 4Q7MB 4E07A 3GLGE 3HYTA 3IBYA 5CJ2A 2PH1A 3PUWA 4US0R 5HZHA 2C99A 1ESMA 2AR7A 3MFYA 2HT6A 4Q9LA 4FN5A 2ZRHA 1H8ED 4JLAA 3DZDA 3GP8A 3SQWA 4NDZA 4GOKA 1KO8A 3OIWA 2O0HA 4PQFA 5GJWC 4UNPA 3RDPA 2KJQA 1IN7A 4HUQA 1OIXA 3QENA 4J0QA 4K46A 4PQRA 4D0LB 3KKPA 2A2ZA 3QSYA 4TQ9A 1LW7A 5FPTA 4GDFA 2XZOA 2J3EA 4GP6A 4TT3D 3R8FA 4OI1A 3VFDA 4URYR 4RCZA 3LNCA 4Y0VA 4E09A 3LBHA 1I4DD 4AKGA 2V55B 2IWRA 3JVUA 2A5GA 1F60A 1KSHA 2A30A 4IKEA 2CL7X 1IAQA 2P67A 4LHVA 5FI1B 4DRZA 2ZS7A 1KI8A 1YR7A 1KMHA 3KQLA 2JLXA 5AJWA 2QP4A 4PHTA 2VP6A 1X86B 3QG5A 2ZU6A 3OAAD 2ASEA 3ADBA 1SXJB 3GEHA 3U5ZB 2IUUA 1NMXA 4B33A 5L3RA 4KCGA 4NKRA 4ZDJA 1BIFA 2YOHA 4O25A 4MYCA 3LLMA 5SZHB 1G20E 3VNUA 1NBMD 3OEHA 1KMQA 4NYJQ 2H7VA 5TDHA 1E32A 3B1WA 5G3ZA 4DCUA 1OXTA 4QL3A 3BS4A 1NL3A 4PC1A 2H16A 5F9FA 1T8TA 5JWRA 3GLHA 1Q0UA 4XVUA 4LJAA 4L5BA 1NLYA 1GIAA 5DN6D 4PX9A 2OFOA 4PHFA 2X19A 2XAUA 1CJVC 3AF0A 3EWSA 4Q4JB 3GLGA 4I1UA 4PPGA 2GAOA 1A4RA 5CLLA 1Y3AA 4A6PA 5L3QB 1KDOA 2A3RA 4Q1FA 2ZITA 4CGZA 2AXNA 1ZMXA 2YJTD 1HV8A 2X2FA 4P32A 2FFQA 1N5IA 4D4JA 4Q18A 1PUJA 2VHJA 5GVRA 5FBQB 2B92A 1M1YE 2ZJ8A 1H65A 3CX7A 3QOFA 1UAAA 1RRGA 3A1WA 1P61B 1FQJA 5DISB 2FN4A 3KQKA 4AI6A 221PA 3GFPA 1JBKA 1G7TA 3LH5A 2CCJA 2YWGA 5BYKA 1P2SA 5LD2C 4KJZA 4PC7A 1UJ2A 4HDOB 4WZ6A 3QEOA 1P7CA 3QQ5A 3QY0A 1XBTA 2JAQA 3NC1C 5FR2A 1UM8A 4A2PA 4ESHA 1SKYE 5AUOB 2BHRA 1E2EA 1N5JA 3DKPA 4M22A 5L3SA 5EP3A 1SVKA 4LJ8A 4HB2A 1KK3A 4U00A 4B6FA 3K9GA 3WP0A 2WPDD 4FW9A 1GKIA 1P9NA 4LWZA 2H5EA 4JLPA 3REGA 1SVLA 1E2IA 2H17A 2ZI6A 1ZM7A 3AF3A 1XWIA 2QTFA 4I81A 1N0WA 1YQTA 2IYWA 3AQ4A 3T06B 1KJWA 3FWYA 2JLWA 1DAGA 1P62B 5DI9A 3K53A 4V0KA 3ND8A 3K09C 5K8TA 5EZ5A 1UKYA 5AJXA 1E2GA 1NLZA 1TNDA 4DSOA 1NVXQ 1S9HA 2UKDA 3DZ8A 5TB5A 4EJSC 2QMEA 2C04A 4UJ3A 1YR6A 1Z22A 2OILA 4BE7B 3K0AB 1W44A 1T3HA 4LY6A 4UXIA 2KSQA 2DWOA 3FE2A 3H4MA 2GESA 4JKYA 4EPRA 2QGNA 3IHLA 5L3QA 2JGNA 4W7SA 1NVWQ 1NP6A 1N6IA 3V4FA 4B3CA 3EIHA 1J7KA 1M7HA 1OYYA 3U7FB 1YE8A 2ZSEA 4URXR 5BW8A 2ZAMA 4TZ0A 2YINC 2J0SA 4MYTA 4XD7A 5IHPA 3SDZA 4HAXA 3RVBA 1G5TA 1Z6GA 3UIEA 3K8YA 3PUXA 1VHLA 2BIFA 3SJAA 4QNMA 2Z5FA 2B7CA 3KL4A 1YR8A 2JDID 3EG5A 4NL4H 1XMVA 2FEMA 2PCLA 1XPUA 3NVAA 3EX7C 2O8BA 1AGRA 4HAWA 4B35A 2RGDA 2IX3A 3I73A 1XFAA 3IUYA 2O8DA 1DG3A 1OFIA 4YXWA 4A2QA 2ZJAA 1UBCA 2IC5A 1OXVA 2Q9CA 4TLEA 1E1QD 5E4FA 3B5JA 4JLOA 1M7BA 4WIAA 5JRJA 2FSGA 2O52A 2N42A 4JYCA 3FHTA 1CP2A 4LBZA 1US8A 2C2HA 2CLSA 5FPYA 1CULC 5FUYA 4NYMQ 5HKKA 2VH5R 4URUR 2ZR9A 2ZJZA 2F3RA 1AGPA 1OFTA 4GP7A 2DBYA 1Q44A 2BDTA 2YZ2A 4US1R 5SZKB 2W0MA 1XEFA 2IK8A 4WZBE 1KKLA 1OIWA 5G40A 3TH5A 4M53A 3TE6A 1ZIOA 1ZU4A 3A36A 2YVUA 4BZXA 1SVWA 1F2TB 5B64A 2RGCA 4JMPA 1XXHB 2MSEB 4TL8A 5FTLA 3ADCA 1K5DA 1E9FA 1OW3B 2GXUA 4BFWA 3U7HB 2ZRGA 1KJYA 2EQBA 3GQBA 4NZYA 3UMSA 5H68A 3SBEA 4C0QC 2SHKA 2ZUBA 1C1YA 4IDQA 1WXQA 4CEHB 4JVLA 4AY2A 3AH8A 3BWDD 1FW6A 2QUZA 2FNAA 1LFDB 2ZE7A 2RGEA 4PZLA 2ZS8A 4BPBA 3AKEA 2WIBA 3EPKA 3G5UA 3CH4B 2ZSAA 3V4RA 3TQFA 1Z0JA 1W0KD 5EXSA 1CIPA 1DARA 4PTLA 1XTSA 3T5DA 4LJ4A 4ZDIA 3FGNA 3U3MA 3OIUA 3G0HA 4PO8A 1S1MA 2ORVA 1P2TA 3QPWA 5AWFC 2A5FA 4M9ZA 4S2EA 3D31A 3AF2A 4OHVA 2VF8A 4Y0AA 2QNRA 1W4RA 3C4JA 1Z83A 4G5RA 2IS2A 1G17A 3QPVA 1IQPA 4XIGS 4GNKA 2QORA 1QHNA 2WJHA 4F4CA 1TU3A 1XZQA 3AVPA 2Z0MA 4AKHA 4PZZA 1IXZA 2GJAA 1YZLA 1S0UA 1D2EA 1UF9A 1Z0KA 2PJZA 3WYAA 4LYHA 3LAWA 4JT2A 3C5HA 4PO1A 1GRNA 5DO9A 1F5NA 3TNFA 5HTKA 1G3UA 3QIAA 2HF9A 3CF0A 1VCOA 2H8KA 1CU1A 1GFIA 3HJNA 4OYHA 3UPUA 4DC9A 1VDZA 4LBWA 1GITA 3QKSB 1D2MA 2OLKA 2YC2C 2B8TA 3JVVA 4HB0A 2G9NA 2J7PA 2QA5A 3LVRE 2IEYA 2IYUA 2NZJA 3AVTA 2CHQA 3NIBA 1G291 2IXGA 4AKIA 2JLSA 2J7KA 5CIWA 2I4IA 3FMOB 1PVOA 2RKOA 4MDFA 4O2LA 3VHXA 2GJSA 1N6HA 1II8A 2VTKA 1E3MA 5KSZA 2W58A 3W6NA 1E69A 5LB2A 2QMHA 4M4SA 2ZS9A 1OKKA 4JLVA 3B8HA 1M7GA 4H1VA 4RFSA 3QF4A 1R8SA 1R5NA 2ZYVX 3ASYA 4NMMA 2V4ZA 2WIAA 4HZUA 4NCHA 3DO6A 4YXWD 1NRJB 3D3QA 2WM9B 1CR4A 6Q21A 4PAMA 1ZNYA 1N6NA 4AWXA 4IFBA 5C46F 4JKIA 5L3VA 4FWTA 3EC2A 4URWR 3WHLA 2YC4C 2JLRA 3AVXA 5DIFA 1IBRA 1U94A 5H1YA 3H2YA 1E94E 4JVNA 1KYIA 5HKKD 1C4OA 2AFHE 2YV5A 3QEJA 4GBMA 3PCRB 4IEIA 1QHGA 1Z28A 3AP1A 3GMTA 1G5PA 5EJEA 4FCWA 1ZAKA 1DS6A 2FU5C 1S3SA 1U9IC 2KWIA 1OT3A 4EFNA 2QG6A 3OIVA 2N46A 2ANBA 3M4YA 4IDPA 2BM1A 3K9HA 4Q7KA 3PG5A 1BYUA 5DYGA 3W8NA 5SZJA 5CB8A 4C7OB 2GCNA 1XF9A 3ZS9A 1UEIA 2BCGY 1OXSC 2R6AA 4A8JA 3ZVNA 4S35A 4GOXA 1DAMA 1QHHA 4QM6A 2BJVA 2QTHA 3WRXC 1PLJA 1EGAA 2E87A 4U7DA 1E2FA 4PAOA 1E2KA 3RS4A 1XTKA 2OBMA 1GKYA 3CF2A 1KOFA 1IN5A 5TXGA 1E2PA 4M8NE 1UFQA 3QXJA 1AKEA 2B21A 3KUCA 3H1TA 3ZQJA 5KOYA 1N25A 3TSOA 4H9GA 2PCJA 1Z0IA 4C0LA 4OQMA 2MMCA 1WQ1R 4Q4LA 1GILA 1JPNA 1G7SA 2A7QA 4MRVA 3FMPB 2F9MA 5EE5B 2YNMA 4DBLC 1FTNA 4W5WA 2ZR7A 1JQLB 1J99A 2R65A 4G1UC 1Q1EA 2N1BA 4ZIRB 4DLSA 4V0LA 2CJWB 3ETLA 3LRPA 4DZZA 4QGFA 3DHWC 2F6RA 4Q7LA 1JAIA 4RZUA 2I3BA 2OG2A 4G5OA 3B78A 2PLFA 3O47A 1LS1A 3GJ5A 1T5LA 4BLTA 2IYZA 1H8HD 3BERA 3JZMA 3R9XA 3VQTA 4NBSA 4D4LA 2D2EA 4ZDWA 2PZEA 3DPUA 4Q7JB 2ZI4A 3EW9A 5DE3A 3C7KA 5DSZA 1OIVA 4JL5A 5J40A 1DEKA 3IIJA 1UKZA 3IQXA 1XMSA 1PJRA 1G7RA 3B1VA 4TLBA 1E1RA 4B43A 4C0KA 3B7GA 1UDWA 2P6RA 4DLXA 3VR5A 3IQWA 2NG1A 4RD3A 4IJMA 3AGPA 4HB3A 1E0AA 4EPWA 5E3HA 4ZKDA 4BRUA 2G1KA 4BLSA 1Q1QA 2QPTA 3W6PA 1Z0AA 1JQJC 5JMTA 4XWKA 2EWVA 1XEWX 1SHZA 4CT4B 3IO5A 1J70A 1WBBA 1XNJA 4IFEA 4YMSA 4BFUA 3THYB 2JEOA 1DADA 2CEAA 2R2AA 4R98A 3RS5A 2IYSA 2G0TA 3IGFA 5IF9A 1KTVA 2NPFA 4FMDB 3ADDA 1MRSA 4I1OA 1DAIA 1CRPA 3U4QB 4YMVA 1GM5A 3VU9B 5J4LA 4II7A 4RD0A 5LDDC 3TVDA 1E0KA 3QKRB 4ZO4A 4A92A 4FD2A 2V8OA 1DAHA 3IKJA 4GMDA 4KAXA 3R9WA 3LQRA 3QUSA 1A2KC 1OH5A 4OBEA 4E5UA 1NBME 4HAZA 1S3GA 5EQTA 3AKYA 2WJYA 4ZCMA 2RGGA 3E70C 2WWHA 1RJ9A 3PEYA 2O0JA 5J4HA 3LO5A 4DDTA 2PMDA 3PUVA 1R0WA 4QBIA 3T15A 2F55A 3MGCA 5BYJA 1AQUA 3NH9A 4C0BA 2DR3A 3QBVA 4MA4A 1VG8A 4TYWA 3A1VA 4A0RA 5JS7A 4TQUS 4X8HA 4TL7A 2X2EA 2ZUDA 3D7MA 3WMGA 2FG5A 1R8QA 3N2EA 1R6BX 2AD1A 2XTNA 3CUEF 3RSLA 3L8YA 4ERNA 1OYWA 2HYIC 1XD2B 5JHHB 1H8EA 4RKFA 1A1VA 1MV5A 4U02A 4JLBA 3HPQA 3EARA 2QAGC 2WWWA 3NH6A 4DT1A 1SQ5A 4TTQA 3W90A 1G5RA 4C3ZA 2GCPA 2OUKA 3VKHA 3CNNA 3IPYA 1KY3A 4PQYA 3KJHA 1Z5ZA 2BMFA 3R7WB 3X1DA 2W2TA 1W1WA 4TLAA 4WBSA 1EK0A 2HCJB 1YRAA 2G3YA 1SZPA 2WJGA 2EFGA 4QGAA 3KJGA 1NKSA 2WOJA 3RANA 5J5CA 1KI6A 2NO6A 3CX6A 4WA7A 4HLUC 5CYOA 2HCBA 1R0XA 2AKAB 2W6JD 2FPKA 1Z07A 4M9SA 1E2QA 3VR1A 4DKXA 3B1XA 2RCNA 1L4UA 2RGNC 1K8RA 4GZMA 3H0KA 5KPDA 2FZ4A 1ZC3A 5EP4A 4DSUA 3OAAA 1EFHA 3NC0C 2O8EB 2ORWA 3CNLA 3PEWA 2ZE6A 4MGKR 4MGZR 5JSZA 1WP9A 4JT4A 1RPZA 4OJQA 2OCAA 1YZKA 2FZLA 3AF1A 4Q1CA 4RZ2A 1UBFA 1NBMA 1UBEA 5K8UA 4MYHA 2QQEA 1RRPA 2JCSA 3Q7QA 5UKDA 3A6PC 3NWJA 1AZTA 2F1RA 2UZ3A 3K09A 4HUQB 4Q4HA 1BS1A 1L4YA 1VCNA 5LPNA 1YZTA 3QPUA 4PPFA 4EJSA 3RRYA 3MSXA 5DN6A 1ETUA 2W0SA 5EUMA 1KO4A 1G3RA 1ZW6A 2C9OA 4BFXA 2Q21A 4Q9HA 4KXFB 4NE2A 5FOWA 2ZXUA 3AVYA 2ATVA 4RZ3A 3A8TA 2DHRA 2REBA 4AG6A 4YMWA 5FTJA 2PL3A 1DBSA 4BGDA 3OF5A 4FXPA 1V43A 1KMHB 1VHTA 2BBSA 4IDHA 1KDPA 3W3AA 1HA3A 2PT5A 3BIFA 3GFTA 3DOEA 4LPKA 4BFVA 1IN6A 1CJUC 4A2WA 3CRMA 1VCIA 4BZPA 3TUJC 1VCMA 1HE8B 1IY1A 3IEVA 1AN0A 1YJ5A 2K5UA 2REXB 4CW7A 5KU1A 2GHIA 2WJVA 1XJQA 4LSGA 1KK1A 2OFWA 3V9PA 1YR9A 1ZNXA 1UPTA 2ZSDA 4TLCA 5G53C 5TY0A 1X1SA 2KBFA 1COWA 2AL7A 4JYBA 4KSBA 2WPDA 5EXXA 4KO8A 2WJJA 3GLHB 4BLRA 1PUIA 3KKOA 1TQDA 4HEJA 2O8FA 4QG7A 4AKEA 4R7ZA 1MKYA 2J59A 1GVNB 2AK2A 3QXHA 4FMBB 3TKLA 2MSCB 2FV8A 1GKUB 3GLGB 1MABA 4JL6A 1U8ZA 1M34E 1E9CA 2YOGA 4M21A 4BRWA 1EESA 3FMIA 3RNLA 3B6EA 1M74A 1QZXA 2J46A 2V1UA 3AKCA 3A1UA 1RZ3A 1JR6A 2VL7A 1ODFA 1NY5A 3CRRA 2BC9A 2FX3A 1YZGA 5GADl 4N1AA 3TUZC 3KQNA 3BK7A 5KSPA 4BFZA 1J2JA 3ZS8A 1YZNA 3QI2A 1RW4A 1N0VC 1NJFA 1T3LA 2OLJA 1OH6A 1IOZA 1AQYA 4B47A 1KO1A 2BVNA 4KYUA 1DPFA 1P2UA 2J45A 2V7QA 1Q1BA 5D3QA 2ONJA 5L3SB 1IXSB 2XXAA 2ECKA 2IYVA 4DEXA 2HV8A 2VRWA 1OJLA 4NU0A 2R44A 3CPHA 2CHGA 3NEJA 1FNMA 1Q22A 2OEPA 1LS6A 2JDIA 4HDQB 1TTTA 4B3XA 4P31A 4ARZA 5E95A 1NMYA 2G1JA 1T91A 3Q5DA 1F2UA 3AVUA 2VSFA 2NO9A 4YC7A 2WV9A 4TZ6A 4DCNA 4D0GA 3BAFA 3C14C 2I1VB 3OFND 3W9YA 4U5XA 2GWHA 1Z8FA 3MCAA 5FUVA 2NO7A 3UG7A 2ODNA 1E1QA 2CMKA 2YHSA 4I1SA 2ZI5A 3BH6A 3WYGA 1IY2A 2JJ2D 2EWWA 2V54A 4G3XA 1W36B 3BGWA 4LYFA 1PZNA 3L2OB 4OI4A 4QXAA 5H70A 1KNXA 1NVVQ 3MG9A 2VHTA 2WBLC 1XJ0A 1LF0A 2CNWA 3KKNA 3LD9A 4N0EA 4DHEA 2C98A 2IF2A 3KUDA 2X77A 2P6NA 4GOJA 4XVRA 5DH9A 2EFHB 1FUUA 3IIKA 4L9SA 3SEAA 621PA 3U6KA 4KV9A 3SZRA 2OT3B 3RC3A 4EPVA 3G82C 2ZRDA 3P32A 4AURA 4ASUD 2Q3HA 5FOUA 1E98A 4IXMA 1XD9A 3T1TA 5FI0B 1P72A 1RC8A 3ICQB 5FUXA 1G8GA 4CT5A 4B75A 3A4NA 4DEYA 2GK6A 3D8BA 4LGMA 3NTUA 3AV0B 3HYRA 3AP3A 4R9UC 4ACAA 4A0GA 2O8BB 4FMCB 3TJZA 5E7IA 1LNZA 1GG2A 1UBGA 5HZKA 4CF7A 5KHOC 5FPSA 3EA5A 2O8DB 4L4UA 1GTVA 2IHBA 4UXJA 4M1MA 1W0KA 2CK3D 3DL0A 4XWOA 1ZCBA 4F4JA 5AK0A 1COWD 1T0HB 1E6CA 1SKYB 4NCKA 1B0UA 1CRQA 4UNRA 3K0CC 5CLQA 1EWQA 2UVQA 4BFYA 2IWHA 2OBLA 3K1JA 1US8B 2XJ9A 4LJ7A 1DAFA 2IYRA 4Q47A 3UXMA 1N5KA 3K0EA 3X1ZA 4CZ2A 1EFRA 2EVWX 2GRJA 3EWAA 1Z0FA 3LBNA 3Q8XB 2D4HA 5HCNA 1VG1A 3LA6A 5DNYB 4QKQA 4FINA 1OFHA 2WWXA 3EZFA 3FHCB 3KQUA 2V9PA 1U9IA 1MO4A 1NLFA 2ZJ5A 3BD9A 1JR3D 1E9AA 1KY2A 2IUTA 1GL9B 3DMDA 4PPQA 1N0UA 4LI0A 1S96A 4MUAA 3HU3A 4RD2A 4B6EA 2VLIA 3TAUA 4OKSA 2Q0HA 5FOXA 3W3ZB 1FPMA 1RRCA 3WNCA 2CCKA 3CIOA 1IJFA 2FH5B 3QXSA 2IHYA 2ZUCA 2ZI7A 1ZP6A 4B2IA 3K70B 4URZR 3CO5A 4AG5A 1V5WA 2QRZA 3GLIE 2IBMA 2VEDA 4LJ6A 2IL1A 2QL6A 4XVQA 3EPJA 1Q1ZA 4P4SA 5CM9C 2FOLA 5A4JA 2WHXA 2V7QD 1LF5A 4KFSA 2PZGA 4JL8A 2EYQA 4PR0A 4LRWA 2ORIA 4LJYA 2J1LA 4NHOA 1IJEA 4IVQA 3WY9A 4US2R 4G5SA 2ZRMA 3HWSA 5FUWA 2ZYUX 1VKJA 3Q7PA 1EXMA 2WAXA 4MRRA 5IK2D 2O0KA 2ZSBA 3A58B 3VKGA 2P5TB 4M1TA 5FBLB 4UXHA 3I4LA 1T6NA 4DLVA 5B58C 4TMXA 1KI1A 2OCPA 3PV0A 1KI9A 2HJGA 2RH5A 3CONA 2VYFA 5TV2A 4PO9A 1UKVY 4TMVA 4Z51A 4XOIA 2PEYA 1XTIA 3A1TA 2HXYA 2F1JA 4FMDF 3CRW1 1N6KA 1ZUHA 4DLYA 2QTVB 1CXZA 2HF8A 3ADKA 2F9LA 3QKUA 3AVWA 3N2IA 2FPMA 1FP7A 1E99A 2FGKA 3KFXA 2O8CA 2CNWD 2ZRNA 1T4GA 3NBFA 2PJRA 4LV5B 2VPPA 4BWYA 4M1WA 1KDRA 2CVHA 3NG1A 1JJ7A 2IF0A 2ZVQX 3EZ7A 1OLOA 4HSEA 1FFHA 4WVFA 3TR0A 4KI0A 4C0AC 1ZCAA 1P5ZB 4HLDA 5JECA 5KSYA 4LPSA 1Z3IX 1I2DA 4Q03A 2ZETA 1Z08A 2Q9AA 3A4MA 3C15C 1E2LA 1QRAA 1W47A 3FDIA 1E4VA 1W48A 4BEJA 2QT1A 1SGWA 3M0EA 3KKMA 1NF3A 2NMVA 2FMXA 1VIAA 1II8B 3T1OA 4HZIA 2ZTSA 5FR1A 1NJGA 4DSTA 4M1KA 4RFSB 3QF4B 1OHHD 5CYPA 1JNYA 2QPOA 4HZUB 1ELOA 1WRBA 2NO0A 3GLIA 1KI3A 1K6MA 3SE0A 3SFZA 4DCSA 2GNOA 2V1XA 4CEJA 3KZ1E 4JBWA 1OB5A 1J90A 4GFDA 3T35A 1CS4C 4JBYA 1E4YA 4A15A 3O8DA 1E2DA 1R5BA 4PAQA 5BN3A 1HQCA 3GJ0A 2EU8A 1KO7A 2X1VA 3GJXC 2ZE5A 3LV8A 1GL7A 1EFRD 1U0LA 5HR5A 4UNQA 4QOSA 5JEEA 2GZAA 5AJYA 2ONKA 2IW3A 5KDDA 1TF5A 2BKUA 2F1HA 1W49A 3ZD6A 4Q4AA 3S1AA 3GEIA 3CRQA 1RFLA 4TQAA 3IHWA 1ZNWA 1ESNA 1ZM2A 4KVGA 3E1SA 3MJHA 5FOSA 4A8JB 3QE0A 1QHHB 3GJ8A 3AM1A 2ODWA 5EZ6B 1H8HA 1MO3A 1GSIA 3ONWA 2GVZC 1IN4A 2CL6X 3QNUA 2REOA 1U0HC 4R2IA 1Z0DA 3LLUA 3PEUA 1R2QA 2EFCB 1X6VA 2JLUA 4CDGA 1KI2A 3KFVA 4M1YA 3PEVA 1RVDA 2BV3A 5GVSA 1I4LD 4IRUB 4NYIQ 2AWOA 3VMFA 2QAGA 1U0JA 3OHMA 2VHUA 4JS0A 1QF9A 4KYIB 2GF0A 3CWZA 3AKDA 3DEFA 4C2UA 3QF7A 1NMZA 1XTJA 3AVQA 1NSFA 3W8RA 5AUNB 3HU2A 5JS8A 1Y63A 2AX4A 1NN1A 3OZXA 3WNDA 1UADA 4HLUA 4ACBA 2HLDD 2QE7D 2O5VA 4D80A 3IDQA 3PFIA 2IEZA 2ZRFA 1KIMA 2DCUA 2PMKA 2WZQA 4DUGA 3U7GA 2RGNA 1CR1A 2RAPA 3NKVA 5LB4A 2XNDD 4QBGB 4Q19A 4X8OA 4TMZA 5SZIA 3ND9A 2PEZA 2WWFA 4DB4A 4RZXA 1NN0A 1XJCA 1NG1A 1XMJA 5F98A 4IEEA 5JCZA 2Z6VA 4Q21A 1HYQA 1SXJC 2EYUA 1AS2A 4NH0A 1VYVA 3KB1A 3CF6R 3I8SA 4LJ5A 1PLLA 3ECCA 2AD5A 4TYPA 2J87A 4POAA 5FBWB 2ZEJA 2D2FA 1AK2A 1D2NA 3PUZA 4AD8A 2OCYC 5A0FA 1CJMA 8OHMA 3A4LA 1UDXA 1Z2AA 4YMUA 4OQFA 2AXPA 4ZI2A 2JIZD 2X8AA 2NIPA 2HXSA 3UG6A 5KYKA 2R62A 4XSHA 1XMIA 3B9QA 1TF2A 2YWHA 1NIJA 2VSOA 5E7MA 2VQSA 1FL9A 1W5SA 1OE0A 1M2OB 1F3OA 2ZR0A 5JZVA 1TUEA 1TADA 4ZPXA 4Q9IA 4JBXA 2P65A 1PLKA 3MWYW 4P3YA 3T61A 4MGYR 5JI3E 4M0LA 4ZCIA 1DELA 4JSTA 4N3NA 4PPNA 4IXNA 3W34A 3WXMA 1LY1A 3LX8A 4PFSA 3SYKA 3IEUA 4MUBA 1XPRA 2VP2A 3SHWA 4JLDA 4TL6A 1MR3F 3MWLA 2EFEB 4KHZA 1XZPA 2XOKD 4PZYA 2W6JA 1RJ9B 2VHQA 4LCBA 1N6OA 5KUTA 1A7JA 2V3CC 1G3IA 1G8YA 2FJUA 2QP3A 5C4MA 3U44A 2H1LA 3U2QA 3EASA 3ZVMA 5EE1A 1GNRA 2RGXA 1NN3A 4TTRA 4PXAA 4D81A 1NVUQ 1VIYA 3TAHA 5EE0A 5G41A 5C1BA 2AWNA 4QGGA 3WBKA 4B32A 1M6NA 1FMLA 4TYYA 3UANA 3MMPA 2BWJA 1HT2E 5P21A 2KI5A 4EUNA 4D6PA 4QFMA 1KGDA 1XD8A 3MWJA 3PVSA 1HY3A 1YHNA 2AKYA 2ZRAA 2V6IA 4Z8XA 4DT1B 3KJIA 3THWA 3VAAA 4ZI3A 2OXRA 821PA 2OHFA 1S8FA 1BO6A 5F3WB 3MUFA 4Z54A 2JJ1D 1FTSA 3FKQA 2D62A 1G8PA 2V6JA 4NP6A 2GJKA 4MITA 3QJYA 2RMKA 2QY9A 4TYNA 1P6XA 4WZAE 4G5QA 5LD2B 1JXMA 1KI6B 2QRNA 1ZM3A 3OESA 1WA5A 3WYFA 5BN5A 3PJRA 1SHKA 3MRSA 1M8PA 2LKCA 2F7SA 2OE2A 4V0OA 1P4SA 1TEXA 1WCV1 2QGZA 2BM0A 2GBLC 4DUGD 4FCVA 4HI0E 4EFLA 5FPKA 4Q1EA 1IHUA 1J8MF 3IBGA 4MKGA 2QSZA 2ZRIA 4FMCF 4MKIA 3W5JA 4DWJA 2YKGA 5JSZB 2FDCA 1FMJA 2J0VA 4YONB 2OESA 3CKLA 1G18A 2CLCX 1ZRHA 3B13B 2RGAA 3F5FA 1OSNA 4JJKA 5K8IA 2IA5A 3X1WA 3M1IA 1IM2A 2A5YB 3CRVA 2Q3FA 4V02A 1AJEA 1OH7A 4QGHA 4Q4HB 3KKQA 2DFNA 4JLKA 1FZQA 3CWQA 2ZQ5A 2OO7A 4EJSB
chains in the Genus database with same CATH superfamily
5FEUA 2PE5A 2WIJA 1FXWA 1NQXA 1Z8HA 2IUYA 3GGPA 4RKQA 4YJFB 1Z6YA 4X66B 1QK4A 2GX6A 3B60A 1ZD9A 5DT9A 2WQ7A 4TMTA 1E2NA 1CUZA 2GZ1A 4W1SA 4U9IS 1T0JB 4B7UA 1FFWA 2F43A 2WYHA 3QEKA 1XCOA 4E14A 4LF4B 1QKKA 2WP8J 2E9SA 3AY3A 4EB6A 3TSZA 1N5LA 4O2BB 2ZXEA 4YVFA 3DNFA 1JJFA 1DUSA 3WSTA 4UD6A 3TNJA 3VNVA 5AJHA 1XNGA 1LJUA 3T34A 2DVMA 3JVEA 4ZOCA 3CX3A 3G17A 3BGVA 3QA9A 2ZYTX 4MVJF 4QD3A 2HC9A 1CUIA 1UJBA 1VL2A 3MUEA 4JI6B 2PYIA 5IFKA 3KJNA 5HE8A 4IHQA 4WFJA 3UMJA 3EH1A 5L6LB 1JWLA 2A1TR 4O1MA 4WXPA 3TCKA 4KITB 2MYPA 4NEQA 3U3XA 4AECA 4BOYA 3HJFA 1KFEB 2YFHA 1IH8A 5GJBA 3DMHA 2Z4RA 4QYMA 4B34A 2R68A 2W2NA 1XQXA 3C7TA 1C50A 1X8JA 4GEGA 4W5JA 5F7XA 1T8UA 4Y1RB 3I12A 5EGNA 1GZ4A 3WRWA 1QX3A 3LFUA 4NFLA 3ED5A 1ZG3A 1PSDA 1CUSA 4IV5A 4MYDA 2DERA 5KTOA 3KCQA 1OWLA 4B4WA 4E5KA 1P17A 3TZQA 1ZK1A 2QBYA 1C41A 4B84A 1GGFA 2VDQB 2ZE8A 2V0CA 2KHZA 4OI2A 4B82A 1QBKC 3PPVA 4M1QA 3O8CA 4P0TA 3WHPA 4YLGA 1PJBA 4OQXA 2YIMA 2ST1A 1H6BA 2PD4A 1DIGA 2R6DA 2PX8A 1RXWA 3TFWA 3M9XA 4DRXB 4B2PA 4KLZA 1UFKA 2HGZA 3N8DA 3TW8B 1JR3E 4R2HA 1TXGA 4R6WA 4CVNA 1AGYA 3UCEA 2Q4TA 2ODBA 3VR4A 1MF7A 1N3IA 3KR9A 1XWFA 3LF1A 1QG2A 2CLKB 1U4OA 4X97A 4B2LA 1TEZA 3EIWA 2JHAA 2XAAA 1QU2A 4OI0A 3KX2A 4EQ6A 3U4AA 5JYCA 4RDIA 5DK6A 4QYTA 4YWJA 3J81k 3LZ6A 1BVRA 2AUMA 3LWNA 2J41A 2VRBA 3O8BA 1Q12A 3HLTA 1E63A 3DCNA 1G9TA 4X3OA 4F9GA 2X6QA 2NP7A 2X0DA 3RSZA 1IB0A 1W0JD 4GSYA 3EEFA 2K7ZA 1RKXA 5DHQA 4MJXA 1Y9JA 4B3JA 4DVJA 3A1FA 3KSDO 3WIVA 2VSNA 3ECSA 2GYUA 3ROZA 2DR2A 1IAVA 1OAOC 1L8OA 4UNIA 1DO2A 5C81A 3AEKB 3TI7A 4EPXA 2E37A 3FGPA 5TPWB 5C18A 3HCEA 4H3SA 3C41J 4X7PA 2CUNA 4EI8A 2ZBVA 1C0KA 3LOQA 1J56A 2DOKA 3IESA 2XOEA 4AZTA 3OOJA 1MT0A 5EIOA 4RPGA 4F1JA 1RADA 3N2ZB 1WIWA 1BH2A 1Y8RB 1Z4KA 2O2CA 4BVFA 4M2LA 3R3JA 2N47A 3Q85A 5DKFA 5FFFA 2JFNA 1NR1A 5FO1A 5T3YA 2FN7A 3ZBUA 5JJIA 1KYWA 4KQGA 1F5SA 3LC2O 1UL1X 2IU6A 3FYUA 3ME5A 1B8VA 2O2EA 3NGLA 1NMQA 4YQEA 3IV6A 1F7UA 1F0YA 4TKVA 1O6GA 2CK3A 1C0IA 3I3SR 5A04A 5CG2A 1GRRA 3P0HA 4I8XA 3GMSA 2AYXA 5AP9A 1EUDA 1RWWA 5TE9A 1OF1A 3RU2A 1IXRC 2OCDA 3P19A 3QFSA 1XU4A 4NTZA 5FOQA 1AXEA 2PIAA 3RJTA 1V39A 4IAOA 3BE5A 3AI3A 3HB0A 4PZAA 4CCYA 2HT1A 3QP9A 5LZ9A 4NE7A 1K3UB 1PQWA 4ESVA 3IOMA 1DJOA 3LMKA 3UMCA 3GDOA 3UJNA 3MQFA 3LLVA 4NDAA 5HRCA 2JCGA 3AR2A 2AN5A 4IIJA 3ZD7A 4QRIA 1HL7A 2FN9A 1XDBA 4J0FA 1XXLA 5H81A 1F8YA 5C8ZA 1N6PA 4J3FA 3UHFA 2CJPA 2HSWA 1C0LA 1C2TA 2E4XA 4OHWA 3ASUA 3O1JC 2BKEA 4ID9A 2F4VB 2V7GA 2XMQA 4S0XA 5TF4A 3OX3A 4KN8A 4AQDA 1B26A 2W37A 2ZT6A 4CIYA 4ZPJA 2IS4A 4K9KA 5JBQA 5AVZA 2NGRA 1WOYA 4RADA 4KDFA 3ELYA 1X9IA 4I6GA 2C3MA 2OPBA 3VNQA 5CB0A 4LHWA 1MX5A 2EF0A 4AJLA 2EZ9A 1CBUA 1XRQA 4JQZA 5BNFA 3QWHA 4DJDC 4HDSB 1IQUA 1F48A 1A4UA 2RAVA 3VDNB 4LHSA 3LT0A 1Y4AE 2L2QA 2WABA 1H2YA 1GA1A 2VWPA 1P0PA 1WSWA 1E6LA 1LWOA 1KSJA 1VKHA 1SD1A 4A6XA 1V45E 3R0XA 3RUCA 3IVGA 5DBIA 2VBCA 2R84A 3KSUA 5DDIP 4KR3A 2BF7A 2QQ5A 2OZPA 5IK2A 4OIMA 4WN9A 3OZWA 3SYRA 3DE0X 2ZP1A 3CCFA 4CL2A 1X42A 2FMIA 4QPPA 1FQOA 2FSIA 3WG9A 3ABSB 2YJ5A 5ALDA 4LC1A 2R4QA 1Y3FE 1PAUA 2X8BA 2BTQB 4XSGA 2EJTA 2XXBA 4MP6A 3GBVA 3O92A 3GRKA 1XJ5A 2P1RA 1TECE 1CUUA 1U6KA 2JRCA 4I5GA 4FQ8A 1P7PA 4BB6A 4D02A 4XX0A 3FX2A 1F6DA 4MW9A 4L8YA 5C34B 4QWMA 4D2IA 3EXHB 3O21A 1QZTA 1QJCA 1V8PA 4OHMA 3O84A 4I9UA 2CJYA 2DU8A 5TQJA 3T7IA 4ALIA 3S40A 5LYYA 4LXQA 3ZLJA 1MGOA 4L8FA 4QJ5A 4WI1A 1GLVA 2BGUA 3OPYB 4Y6OA 4R1NA 1QGAA 1FP6A 4Q66C 3DDHA 4QUKA 3VYRB 5BYAA 2ATXA 4X6LA 3KKLA 5ERGB 4BNZA 4QM7A 2YFQA 2OXEA 3H5VA 3KV1A 2G8LA 1YUMA 2QDXA 4UNNA 5JPIA 5HDBB 3AY0A 13PKA 2NV2B 5FKJA 3TOXA 5J58A 4PLPA 3JR7A 3TVTA 4G9GA 1CNMA 2E4UA 4KHPB 3OJOA 3WNBA 5J5VA 1B3RA 2LCFA 3ML1A 2A0UA 1ODJA 5ELXA 4LY9A 5EA2A 2QVCA 4KJXA 4FI3C 4LUCA 2AZTA 2W8BA 3D6TB 5E7JA 2XZLA 4U3JA 1T25A 4V0ME 4F2DA 4M6WB 4WQMA 1AHNA 3A6KA 3ICWA 1P8AA 1VMAA 1V96A 1X1DA 1C30A 2PK3A 4RJLA 3DEAA 6PFKA 3GJ3A 3IERA 1JLSA 1QUFA 4L57A 4KR9A 3STVA 3CZ9A 4BBZA 2RI6A 4GMXA 4R7TA 2HEGA 4UU8A 1XTQA 5LU8A 3PC7A 1II9A 3GLQA 3FHOA 5AR1A 4NMWA 3A11A 5A71A 3AYXB 3BVPA 2FF7A 2IOHA 3VR5H 2CLDX 3W3AH 1GG5A 1U4SA 2WT8A 3FZNA 5D51S 4C14A 2UXDB 2O8CB 1X1RA 4GM1A 4DR6B 4NJMA 5G3YA 1ZMRA 3DJYA 3H04A 4LBYA 1Z39A 4QJ4A 5HKAA 2IXEA 5MF6A 4Q9DA 2C7RA 1G1MA 4H7IA 3VU0A 5HQTA 1Y8CA 1XIVA 3II6X 2PKYX 3MOIA 3UAYA 5GZ3A 5K0GA 1QB7A 3G6KA 3D5TA 4HDMA 4KLNA 5DNEA 3VPSA 5I7AA 4V0RA 1D2CA 3KYJB 1TD9A 2AW5A 2GPBA 2OFXA 1Z4NA 3GROA 1J2TA 3KYDA 4YJGA 5G4LA 5PGMA 1JSXA 3ABZA 5HS6A 3O94A 1PNQA 1SXJA 1ORWA 2HTFA 5CVCA 1M2KA 1UDBA 2EC5A 1ZD4A 4QBFA 4Y2YA 3DGEC 5HHTA 1TYEB 2FPLA 4Z7JA 5AOAA 1T3TA 3E6AA 3OJLA 1GRVA 4NBWA 2F64A 2AFIE 3P9CA 1QO7A 4PM4A 4MW1A 2HHHB 3UENA 3QVSA 3P45A 3R6GA 1QS0B 2OWDA 4G56A 5AOCA 2KE5A 1ADFA 3B51X 3CWCA 2CFIA 3HJUA 3HL4A 1GKKA 3NWEA 4MTCA 3GLIB 3EZ2A 4HN4B 4D3DA 5TVGA 1XP8A 1T3SA 3AW9A 1ZYUA 1DKOA 3QXGA 4UAGA 2DUUA 4J91A 2I3AA 5I6DA 4WNAB 4ZZ3A 3PRKE 3VR6A 4EMTA 4S1VA 3DFIA 4TKMA 2WWGA 4YJKA 1YZQA 4N12A 5DM2A 4M8SA 4QRHA 3BMQB 4QREA 1SC4A 3N7UA 1U1FA 2RIPA 3H7AA 3KWMA 1OX5A 2BOVA 2KBEA 5COAA 1VB5A 3SX2A 4CIBA 3CUVA 3L7YA 1Z35A 1R10A 5A3QA 3K6SB 3KUUA 3C3CA 3RABA 4B09A 4EPTA 4GC5A 3DONA 5KTRA 2Q5CA 4Z4GA 2CE7A 1JU3A 3LBYA 3W4KA 4Q1BA 2A9RA 3HU1A 4H16A 2UZ1A 1U9CA 3PDIA 4Y2RA 4ZVPA 2A0XA 1R0SA 1RC1A 4Q4AB 1MJHA 1YJ8A 1L7VC 3U7EB 4QXRA 3EEQA 3Q6NA 3COWA 4Y9SA 2QE7A 1VPLA 1L7BA 2MTBA 1HDIA 2ZIXA 2GFIA 3ENVA 1T10A 1GZSA 3NM4A 1SU6A 3OJEA 1OBVA 5LA6B 4EG0A 2HA6A 5FWXB 3I1FA 1OLXB 4UU7A 1NJ1A 3OEHD 1HG0A 1JG2A 5IYZB 1NY6A 2PO5A 1WVIA 3RK4A 4MWEA 2CF6A 3L8EA 5B57C 1UIRA 2XUQA 1GZDA 4WA8A 4ZU6X 4ZHQF 5FAKA 2WINI 4HNQA 3T12A 1T35A 1AMNA 1O95A 3HO6A 4G81A 2BBWA 4I08A 4P8RA 2QW0X 4UM9B 4YMVA 1RPJA 2JIRA 1V47A 2IYYA 5KI6A 3JX9A 1ORHA 1FVFA 2VXBA 4FWBA 2C7BA 3DDNA 2CMHA 2ATIA 3SR0A 1UZLA 2QAGB 1WSAA 2Q07A 2Z5VA 3PF9A 4L4ZA 5HX7A 2Q46A 3CUTA 3MTGA 5EUCA 3SAJA 2VUIB 2JIZA 5BPFA 3JQRA 4MV0A 4ZXPA 4ABTA 1GGVA 2ROQA 1XXHE 3RADC 1A5ZA 1ZUNB 2ZW9A 3DL2A 1RM4A 1WMBA 2H5LA 3P94A 4EHDA 5K8LA 5LQUA 2O3QA 4MW6A 2MSLA 3KLNA 3K15A 2JGKA 4CT0A 4Z6KA 2YRWA 4PSAA 1W88A 3CBQA 1OXBB 1V1MA 1ZY2A 2JFHA 2XUHA 2FEAA 3A9SA 2GEVA 4OAOA 3SD7A 3RC8A 5TS3A 3W5VA 5AFSA 1B7GO 4TSFA 5IXSA 5CA0A 3K20A 4H27A 3P27A 3MCWA 2YJ6A 3Q7EA 4P4TA 1Z4JA 4B3FX 3PR2B 5ILOA 1FTGA 2SKEA 3ZCPA 1ABEA 5L95A 4B71A 1E9RA 1DRJA 3I2HA 4M0UA 2GBLA 4K6GA 4MRPA 4XB1A 3FKSA 4QU5A 4KK3A 1TUBA 2C5AA 3REFA 4R1MA 4BEWA 4HT3B 2VDOB 2X3FA 2RBEA 2A4KA 3EC1A 3O95A 1GPKA 1STOA 2C58A 4MV1A 5KQPA 4G26A 3HXLA 3L4EA 3EIXA 1KE1A 3A6GA 1GPBA 1TO2E 3NRBA 1SU4A 1I1QB 2H54A 4MVJP 1QOZA 2WUDA 3QVOA 4GXNA 5C2JB 2XE4A 4NATA 4Q6BA 3C4VA 3A6HA 5IBCA 1ZNZA 3OZGA 1VLVA 4DG9A 1I2BA 1P4GA 2AEFA 4FWIB 1ZK2A 3BTUA 3DKRA 3JWJA 3R3UA 2JFWA 5T6BA 3CVUA 1G0NA 3KXIA 5ENZA 2OVFA 3OLYA 1TA4A 1YBFA 2AIRA 3GGGA 1XN4A 1W93A 3QH4A 1QVRA 2Q1YA 3K9NA 2WKQA 1JA0A 4NY1A 3NWOA 4C20A 2ZVPX 4I4CA 1CJTC 4TKUA 1U2DC 3OJXA 1QQ7A 1Q20A 5I4IA 2R8RA 1D4ZA 2EG5A 5K8UA 1YMQA 2VHCA 2WQ6A 4IRXA 3TDNA 1JYEA 5DWVA 5B36A 1YQEA 1YSCA 4RY0A 2JCYA 1M2HA 1P80A 3NAMA 4NK5A 2BGLA 1SULA 2O7NA 1D9XA 3GFRA 3QX7A 5AM1A 4CV0A 1MP0A 3Q3JB 7ADHA 3GRFA 2JJYA 2QUJA 5J2TB 4O5AA 1V26A 2WM3A 5AHXA 1O1YA 4G1CA 3RARA 3I83A 1SUWA 3IXQA 4RJ2A 1Z06A 5JJ5A 5LR6A 2IOFK 2WLSA 1XTRA 3LC0A 3TVYA 1BWQA 4KMSA 5AM5A 5TJHA 4EFMA 3RIXA 2HU5A 4RH1A 1P3JA 4EDFA 1V95A 1F2TA 1PGQA 1MB2A 2FUEA 3AL3A 1TKBA 3DE2X 1G4AE 1TF7A 3PDCA 3RI3A 4F3CA 2PUHA 1TW3A 2OAP1 1IY0A 2NZ8A 5DVZA 4Z1MA 3DSRA 5BW4A 1V6AA 3GVXA 4DMCA 2QTRA 3W1EA 4A36A 4PCUA 3IAM1 1YRBA 4JA2A 4L8LA 2Z4TA 5TIIA 5F51A 2VP5A 3EY4A 4FONA 4MMZB 2VFAA 2C03A 5LBIA 5LNK6 4U7PB 2AQHA 4QJIA 2PX3A 5F2KA 5K3BA 7GPBA 2D74A 1L7RA 3P7MA 3GLFE 1WPXA 1OPRA 4LQCA 2CHVA 2XITA 5AMXA 1HE2A 3OU2A 2W6OA 5DLYA 5KDLA 3EIOA 4XLZA 2FGJA 4JXZA 2P5SA 1FS5A 1VA4A 5F1YA 2E55A 1ANKA 1U3TA 4GNRA 5K0TA 1VECA 721PA 3ZN2A 2OTCA 3Q7TA 3GA7A 5BOVA 2ISSD 2H4HA 3NYRA 4IWNA 2EW1A 1P4HA 1VMEA 1OASA 1R64A 3IPXA 5B1DA 3HFJA 5HVNA 3OF2A 1O8BA 2GEDA 4Q02A 5ALMA 3ICPA 3KP1A 2J09A 3LFTA 4AX4A 4ZOEA 1MOZA 1QDEA 1VBNA 1SRRA 3GLRA 1X8KA 3L0BA 3PXAA 5EKDA 5JH7B 1Q7RA 1NHWA 2HGSA 3MBOA 3KXPA 5CP8A 2WF9A 1L3CA 1V5FA 4E2ZA 4PW0A 4ZN6A 4PYLA 2QV0A 3C6MA 1I5RA 5DYIA 5EMKA 1GZ6A 2AZXA 1UJMA 421PA 1D2GA 3HCBA 1PV1A 1SKUA 3T7CA 2IP4A 1X7WA 3A7DA 4CCAA 2IU3A 4RSHA 1RJGA 1Y9ZA 4Q3AA 4G5XA 3K9LA 5B30A 2G6BA 4WHMA 4HX2A 5IM4F 5F9HA 1RLIA 2QRVB 3HBMA 3U40A 3ET4A 4LZZA 2NU7A 1S8OA 3BE6A 2JKYA 1KAHA 1WCXA 2ZREA 1R0ZA 1WY7A 3PGJA 3ZYZA 4R6XA 1Q3HA 5E38A 4G41A 4AY5A 5I9IA 5THXA 5JATA 5KPJA 3MFQA 3GFFA 1CEQA 2EX0A 4C1NA 5T8KC 3UJ3X 2E2WA 4DRYA 4Z4EA 4U7GA 3CB4A 2QG4A 3ZQ6A 1M0EA 3WFIA 4AN0A 1QWSA 1XGKA 2CBZA 1SOMA 1ZK4A 4QBHA 3UOGA 2BPOA 3VH1A 4B8YA 3B1YA 1OYOA 2F48A 1B15A 10MHA 1JEDA 1DQYA 2Q6TA 3V1UA 2KLBA 3LDGA 5A4AA 1E1LA 2M9MA 3WWPA 1U8YA 5FBZA 4O5OA 2D00A 3UAOA 2E6UX 1XQ9A 2O4CA 3HJCA 2VTBB 1D8TA 3M5WA 4HLQB 4CLXA 1C9KA 5K0CA 4JI0B 1Z36A 3QM1A 3TLBA 2HRBA 4ZGBA 4GECA 4TMKA 4TM8A 2I65A 4WSOA 1NE2A 1ZWKA 4YGYA 3RRZA 3HZRA 2FZKA 1SD2A 2DF8A 2RHOA 3L6CA 1K1EA 2GJ8A 2IEBA 2VZLA 3EFOA 3F5QA 3HR4A 4LXUA 1X9HA 5E6SA 5C4GB 3L8HA 1H66A 4NRDA 4DWVA 3FCEA 4GYKA 4DQKA 3NTQA 2Z58A 1K4YA 2QN6A 2VNSA 4CR6A 1YMUA 4Z9FA 4AX8A 3LI2A 1GN9A 4FKBA 1JI3A 4HDCA 4A0QA 5EJ7A 4GDMA 1EX7A 2EBWA 4DLUA 1MN6A 4K88A 4PAWA 1P2GA 2NTYC 3SS9X 1YI8A 3ZXUB 1LX7A 1ONNA 4ZRDA 4AUKA 4BZQA 3LSTA 4I99A 2G8NA 1EMDA 1XDGA 2K87A 5ANRB 2ZI9A 4MJ7A 4F6RB 3S5JA 1NMEA 3CN7A 1UMCB 1E7SA 1W0JA 2RK4A 2GR9A 4ZALA 2C57A 4I0WB 4WADA 4Y9RA 1L8LA 1Y81A 2HMWA 4FGLA 5DP1A 4Z9YA 1JI0A 2DFPA 2Q3JA 3SLGA 1CW2B 1RJFA 4GVLA 4B3BA 1Y5LA 2BUAA 2BEKA 2IZOA 2NTVA 1C0PA 3L8ZA 5DI3A 2OHJA 1Z62A 2CE2X 5G4KB 3RQIA 4D98A 2QR3A 1B76A 3LHFA 2QUKA 1GD1O 4YRIA 2G9VA 5LSAA 3D59A 4DA8A 1RI4A 4UARA 4FTWA 4MW4A 1SXQA 2JHGA 3BL6A 3ZDFA 4DE5A 5BSEA 1W8DA 5J43A 3CBGA 3W0LB 3KT6A 4FP9A 4I5DA 2P2NA 2IGBA 4L22A 1FDTA 1G41A 1TM5E 4PX2A 4W5HA 4ZJUA 3HJRA 1K98A 1PYGA 1YCDA 2W2KB 3KOOA 2ZJ6A 2W2PA 4ER6A 5BR7A 5G0UA 3MWFA 4QLAA 1BC5A 3TBFA 1L4FA 1X3SA 4O3MA 1SU7A 3IEMA 3DCJA 1MEJA 4OCZA 3OC0A 1G4HA 2WE8A 1O6FA 5FORA 1IIBA 1Z34A 2WYVA 3LCRA 3D4LA 3BK2A 2QJRA 4GL4A 4WXEA 5I7RA 1TMYA 3JARB 2QM8A 2E18A 4IMJB 4R2KA 2LWIA 4IBOA 2A5JA 3TEJA 4R84A 4ZIRA 5EJ4A 4WKCA 1DQRA 4Q34A 1UT5A 2GPSA 3HR8A 3L0ZA 4AO7A 2R9VA 3HYCA 3G2KA 3ANTA 3FR8A 1BD3A 4WT7A 1K06A 5DW0A 5REQB 2CXSA 1D04A 3IE0A 4ER7A 4E21A 3SSOA 1SCNE 5BUZA 2PUBA 1E2HA 4TTSA 4QPDA 2ODEA 3LXRA 1EFVB 3KKEA 4BASA 1G21A 3LXUX 4S1TA 1FTYA 3WMFA 3RTDA 2B1GA 3GEDA 1ABFA 2KW5A 2P41A 1NAHA 2PL9A 4NCIA 4FM9A 3L02A 4WN3A 1XMQB 2JGEA 5HJ5A 4WH0A 2A33A 5FBKA 1WPGA 2Z8XA 4M0KA 4R5MA 3T1QA 2ERXA 2C4WA 1F20A 3QNWA 3R2JA 5H3HA 3W2FA 3R8CA 1JLMA 5FNVF 5EJ6A 2C78A 2YBDA 1JNXX 4IYRA 4BO7A 3CINA 2ZKLA 2HJ9A 2HMSA 4WZAA 5DX0A 1U3GA 1UK6A 2Y8EA 1N2JA 2DFTA 3G9UA 4GO1A 3O8RA 5JARA 1R5OA 1GPWB 3TOSA 2F4NA 3T5GA 1ZLYA 4Q0MA 3SS8A 1I6LA 3KYBA 2AB0A 4QTZA 3QLUA 3A6DA 1A9RA 5CDFA 4EM6A 5LOVF 3NHBA 1RQNA 2IZ5A 2AG6A 1Z5GA 1DSSG 2GJ9A 5FFMA 3TIGA 1MFZA 3AIMA 3EWNA 3P8ZA 4BKQA 2CVOA 1GTSA 4TLMB 2I55A 4OA5A 3SFTA 4AF8A 4DN6A 2AN9A 2YZNA 1VYUA 3JQCA 1RJEA 2Y77A 3MWKA 1KAGA 4N0MA 3FYHA 5HNKA 3RTEA 1AKYA 2IYNA 3QKRA 3G0OA 1PT9A 3PS9A 2Y1CA 3DBOB 1VGQA 1GNTA 2SECE 3BHNA 3VPCA 4B3RB 3BB1A 3PVZA 4C87A 5D6OA 4QOJA 1OTYA 3V2IA 2ZSFA 5LLTA 5HDQA 2BDUA 4K1LA 2WP0A 3TN7A 3ZIAD 1E59A 4JYAB 4CE6A 2C2OA 4EG5A 2QJWA 4KU4A 4RD6A 5C8YA 3RHFA 2HJVA 1VQ1A 1ZVQA 3KU4A 3MLEA 2I9PA 4MH0R 4NONA 2MYNA 3TMKA 4HXYA 4RYLA 2XVZA 2ZBRA 3K0FB 3EQZA 5SY4A 3U26A 4G37A 5IVDA 2O59A 3C16C 3O9ZA 1CP3A 2W2QA 3BDAA 2COEA 1RJWA 2WF8A 2FQWA 4EG6A 1R0LA 1YS2X 4OSOA 4DXAA 4S12A 4ZMBA 3I72A 1NXWA 2PGXA 1LI7A 4TWZA 2GZDA 1WR8A 4AB1A 2R00A 3CNHA 3KBBA 1E92A 1PHPA 3AI7A 4UKDA 2F3TA 3CZMA 1G0OA 3EC7A 4XIIA 4J9UE 4JGGA 2PMFA 2XRYA 5HCIA 2O05A 3NGMA 2OXTA 1VMIA 5IVKA 5DGCA 5BNWA 5D3MB 4A0FA 1Y3DE 2M6KA 1JAHA 4FJ0A 1WUKS 4QNNA 5FA5A 1LPNA 2IP1A 1AZWA 3NTXA 3AR9A 2D0OB 4G24A 2FWRA 3FWNA 1RPAA 4UMEA 5FPHA 4BNNA 1DWQA 4XTCS 1BX3A 2X8LA 3OQOA 4WAUA 1AH2A 3R7WA 3VO2A 2J6BA 1VLZA 1MRNA 4NU5A 1IUPA 1L7QA 2AS0A 1KXZA 3AMVA 2Y0BA 4KEAA 4U63A 4EO9A 3OQBA 5CDTA 2VUHB 3A2NA 3RG8A 2J3MA 4ZQHA 1KDYA 1FFCA 4XWAA 3ZJYA 3VBEA 5H80A 1UKEA 2DY1A 4UVEA 3L7LA 3OTQA 3IKLA 5LXTB 1Q74A 3WGZA 1YS9A 3QVUA 4N5DA 2WYWA 4M76B 3PF8A 5AJZA 4IFTA 4Y2GA 5DU2A 4HF7A 4MKRA 4C4PA 1KU0A 3BKWA 4G0NA 3SN6A 5ADWA 5IASA 2EDCA 3CSDA 4JLNA 4MWTA 1VM6A 2ZUWA 4BV9A 4LRUA 2O8EA 1E7RA 4Q7MB 1BE6A 3HKBB 3QELB 1KZ9A 4E07A 3IBYA 4E32A 3ZCTA 5KNCA 1V2GA 1PR0A 1ZJ4A 3PUWA 4US0R 1W34A 4ITVA 3SQOA 4Z7NB 2UVPB 4HAOA 3AFOA 3JQGA 3U7JA 3H11A 1GFZA 4HWOA 4U7TB 5DN9A 5ALXA 4NDZA 3AM3A 3HI6A 5CTAA 4MV8A 1N2OA 2Y6VA 3AX6A 1IN7A 3WWZA 3HWX1 1GCUA 4MICA 4PFQA 2ZBQA 4J0QA 3VZBA 4XQEA 4GICA 5BN1A 4WY2A 3TINA 4RTLA 2A2ZA 3QRWA 4GDFA 4M0DA 3TSAA 3ZKWB 2DHDA 2XZOA 3QTBA 4GP6A 4KYTA 4PYQA 1AHPA 1QSGA 3GH3A 3VFDA 1ULTA 4URYR 3PWSA 1M6VA 2ZXFA 5TQ0B 1I4DD 4M37A 2XMPA 2H2HA 2A5GA 1F60A 1U2PA 1W30A 4RHXA 2EG9A 2CL7X 2Y0DA 1CZKA 2ZS7A 4QSHA 2CNBA 4PXYA 4AO6A 1O94A 3V8NA 4ZT3A 3WK5A 4B83A 4ED9A 3INTA 4R8SA 4QVGA 5IANA 3MTJA 2BGIA 4N49A 4PBSA 4B6PA 4QQKA 1PW7A 2YFYA 3ZCVA 1BW9B 1NDUA 1UC5B 5TX7A 3GEHA 4A2CA 4KCGA 3FAKA 2WM8A 4V3CA 4BNFA 3NVMB 4J4HA 5SZHB 3VNUA 1JHAA 1LLCA 3OEHA 3QW4B 1QIMA 2H7VA 2Y0EA 1E32A 1WW3A 2IDJA 4QEZA 4OBWA 4OQEA 1LLDA 1G8KA 3BFPA 3DTVD 4N18A 1OXTA 4O4IB 4QARA 4JP2A 3BS4A 4QL3A 4WCFC 5ARDA 3AWIA 3O4GA 4ZQEA 1JAZA 1T8TA 5JWRA 2OMEA 3NW9A 2XUDA 2NUBA 1NUTA 4WXYB 1RYMA 4BATA 2ADMA 1GIAA 2AXQA 2BFPA 2JFOA 3EHDA 3NBMA 1M2VB 1MVOA 2DUNA 2OFOA 2QTZA 2XIQA 2CFOA 3EGDA 3NZEA 2YS7A 5CA1F 3WAGA 2XAUA 1CJVC 4WXHA 2VOEA 3S2EA 1A4RA 1J22A 1UWVA 4LSZA 5ENVA 4TV8F 1GU0A 3I9MA 4A6PA 4GF5A 7REQA 1KDOA 2ZITA 5HJEA 2ZIVB 4Q12A 1ZMXA 4P32A 1CSEE 2FFQA 3P2MA 4JB0A 4RGBA 4M8KA 1IE3A 2QV7A 4FQ5A 5JLAA 3ZHVA 2ZCUA 4BO5A 1XRLA 1Y8AA 2B92A 1M1YE 2WM2A 2ZJ8A 2V9CA 1RRGA 3NHFA 3LUDA 1FQJA 3ILHA 2YMLA 2VT3A 4AI6A 2FMTA 3U5TA 3M6VA 3GFPA 4Y0NA 5CAEA 1E3WA 3C3KA 2HI0A 2YWGA 3LH5A 2HSZA 2FQXA 4RJIA 5IEBA 3VVCA 4HFNA 4UTZA 2WNIA 1CNEA 1RRKA 4WZ6A 2IDKA 1P7CA 4RACA 1KQOA 4X7BA 3NC1C 3BWBA 1UM8A 3PDUA 4JNKA 3ECAA 5FADA 4CUKA 5C7YA 3IAXA 2VJMA 3HI4A 3WZLA 4OHKA 4WUTA 5L3SA 3NPMA 2F8MA 4LJ8A 1EK6A 1YRWA 1OC4A 2JKZA 2VHVA 4WZZA 2IU0A 2BGWA 2DJIA 2WPDD 4C6RA 4G9EA 4HPJB 5CX1A 1HSOA 1PJ3A 2ZSKA 2X7XA 1P9NA 4BN0A 4JLPA 3REGA 5AQ1A 1VB3A 4B5LA 4XM2A 3CGWA 1DIOB 3GCXA 2H17A 2ZI6A 4TZTA 5CH3A 1XWIA 2QLNA 5DEIA 2QNIA 2QLLA 2AE1A 1JPVA 2IYWA 4HXEB 1A7KA 2EHJA 3GXOA 1QDLB 4HDKA 1AO0A 5DCWA 2PFSA 3V6LA 3FWYA 1WEHA 3ZD9A 2Z6QA 2NAPA 3W6UA 5AVVA 4RF4A 4QEDA 2YMQA 2Q6LA 3ND8A 4EL0A 5I01A 4KXWA 1DLJA 1J2EA 1U9JA 3NS7A 4YI5A 5EIBC 3EBPA 4PIVA 4KNVA 4DSOA 1S9HA 2O2ZA 4EJSC 1JFVA 4MVJE 4C4YA 3OSZA 1U3CA 1DBPA 4LY6A 1NWCA 5HIAA 4MW0A 3FE2A 3KVOA 4PG7A 3DVQX 5DSXA 4OGFA 4BNKA 1KS2A 1JLRA 1EK1A 1XVIA 2QGNA 4KKXB 1C4WA 3PTAA 1X7XB 4ZO6A 4KIGA 3VZCA 5L3ZA 1NP6A 1N6IA 1K97A 1QE5A 1U65A 3EIHA 4KL8S 3TL3A 1N9GA 1OYYA 1SBYA 5C7LO 1USUA 2ZAMA 1FJ2A 3JS5A 5TGDA 3UUFA 3WADA 2J0SA 2H9IA 2I8LA 2SKDA 2QRLA 1YA4A 2OV1A 3C48A 4LAFA 4X85A 3MF4A 3TRDA 2I4LA 4EARA 1FPQA 5SYAA 3DZBA 1G5TA 2UUOA 3BMOB 5CT4A 1LDNA 3PUXA 2UUPA 1OX4B 3FD8A 4QNMA 2YICA 1JF8A 1W4LA 4L76A 4J3NA 2JDID 4JDUA 5JYEA 2NZUG 2FEMA 3D3KA 3EX7C 3PFWO 3LYUA 4C88A 3RHSA 4HAWA 1SUFA 2QX8A 3BIOA 1NDQA 1A1SA 1SHTX 4N39A 2GEJA 3I73A 4UQPA 5DHTA 5CG1A 4JOCA 5M3BA 4MWOA 1DG3A 4J1TA 5LYJA 3N74A 4YXWA 4D3SA 4F9TA 2ZJAA 2IC5A 2Q9CA 3IJRA 2DEUA 1FXSA 4IDGA 1ZOSA 1VKRA 4RQUA 3FF1A 5JRJA 2FLWA 2FSGA 3FCSB 3OO0A 4PS0A 2PWZA 1ADBA 3SXUB 1XK7A 1CULC 1SBZA 1ZJ5A 3ODPA 1GTL1 3G9ZA 2YY5A 1IPEA 3I6BA 2YW2A 2ZR9A 4CM9D 1MB9A 3WGKA 3SF8B 1GN8A 3F74A 3PHGA 2DBYA 2DTEA 2BDTA 2YZ2A 2PANA 4MVWA 3NAQA 1XEFA 2IRWA 4JU9A 4UREA 1UQRA 5G40A 3SZGA 2XBLA 1ENPA 3INNA 3TE6A 1OBFO 5I7OA 3A36A 1ZU4A 4BMZA 2IY9A 2YVUA 5AD1A 1SVWA 1DHRA 5B64A 2RGCA 2IHTA 4JMPA 2FWNA 5CX4A 5FTLA 5KVCA 1SHJA 2W90A 3BGOS 1U1CA 4F72A 5FO0A 1J8FA 4G0XA 1VZ3A 4A6EA 4NZYA 1JXQA 3UMSA 5H68A 4EVSA 3S1LA 1W4ZA 1FMFA 3OZ7A 4IDQA 3KDAA 2DECA 1J9ZA 1WTAA 4CEHB 3F6SA 3BWDD 3LCCA 3RYCA 3UA3A 1FW6A 2EJBA 1EJBA 4XEUA 5EHQA 1X2BA 2FNAA 2X86A 2NQ8A 4TV9B 4C4AA 5KOHB 2YXPX 2PMCA 1LGYA 5EIEA 1BGWA 2MINA 4YECA 4EKYA 4BKPA 3W3ZB 2AF3C 3TB4A 1H3FA 1P4JA 1W0KD 2ADFA 3AQIA 1CDEA 3Q87B 1CIPA 1UFRA 3JQ9A 4MV5A 5JMWA 1V4VA 3EVBA 3FGNA 3PLRA 4G67A 3N0XA 3O9VA 4OSEA 3NIFB 1XYYA 3GPBA 4IP0A 2O3RA 4R1TA 1P81A 5AWFC 1I9CA 5CCBA 3T3PB 4HN9A 5JNVA 2ENUA 2I2WA 3MLBA 3T9FA 4NR0A 6REQA 1GDHA 3AF2A 3GR6A 3GRZA 1ND6A 2IPXA 1BRMA 4RZQA 1W4RA 4RIGA 1RVV1 5HSGA 3CZ4A 4G5RA 5KJ6A 4UBJA 2IS2A 3BHIA 3C43A 2Z95A 1C14A 1G17A 3D8TA 4HDNA 3HVHA 4KNWA 3TX2A 1K63A 1QHNA 2VHEA 1F14A 3AVPA 3FGZA 4FDLA 5KVAA 2PGJA 3PKZA 5DBEX 4CMGA 2XIJA 3ISTA 5AIBA 1NTRA 1YZLA 1Q0QA 1D2EA 1UF9A 1Z0KA 2C97A 4G6ZA 2H7YA 3V8RA 3PYXA 5EIHA 4KR2A 3GFQA 3LHIA 1GRNA 3G7SA 1S2IA 3EAFA 5DO9A 1EVEA 2QTLA 4G89A 5F4ZA 5LQSA 2AC4A 3AJ8A 1T13A 1G5FA 2GT1A 2V59A 3KFLA 4JLUA 1MOSA 1CU1A 5ECGC 4ESOA 4KPYA 1NBAA 3UPUA 4DC9A 2D5CA 1GITA 2JANA 3QKSB 4P2GA 1MIOA 3F3KA 4ZODA 4J7AA 5K6AC 3ETCA 2GZMA 5CVEA 3Q3VA 1RPTA 4WZBA 3G8AA 3PJEA 4PCVA 4A03A 3IP7A 5IABA 2CHQA 2D3TA 3VOSA 4IG4A 2Z3ZA 2FMKA 3MM4A 4M86A 4AKIA 2ZYHA 1PD1A 3L18A 4WFIA 2HL6A 4KSYA 1T5TA 3FMOB 1PVOA 3T7DA 2YZGA 2C5FA 4L72A 3VHXA 1II8A 2FWIA 3WI7A 1PS8A 3ORYA 1QQBA 1E8NA 3JASB 2BZGA 1KZ6A 1CS0A 3NDRA 1E3JA 3G6WA 4TOIA 4YO8A 3RV3A 3W6NA 4JLVA 4C0KA 2C4HA 4H1VA 4RFSA 4RORA 3VBCA 1R5NA 2VBIA 2ZYVX 4NMMA 1X80B 3LX4A 1LPMA 4R54A 5B3KA 4NCHA 3TYXA 3O2NA 1NV9A 4AJIA 3D3QA 2WM9B 5D00A 4PAMA 2O7RA 2J6IA 3QOWA 4ZD6A 1J7JA 2EFJA 2VJAA 3U7RA 4C89A 5ECYA 4MS1A 5C46F 3BCUA 3N8HA 1RMYA 1NRIA 1RT9A 3FUTA 1MX1A 1MNQA 5KVQA 4CG1A 1I7DA 2YC4C 3L4BA 4FSHA 5IVPA 3AVXA 3LP6A 1U2TA 5HQJA 1U94A 4OM7A 1E94E 1KYIA 1ZCZA 2Q5LA 3INYA 1PK8A 4I