1O5OA

Crystal structure of uracil phosphoribosyltransferase (tm0721) from thermotoga maritima at 2.30 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
210
structure length
210
Chain Sequence
HMKNLVVVDHPLIKHKLTIMRDKNTGPKEFRELLREITLLLAYEATRHLKCEEVEVETPITKTIGYRINDKDIVVVPILRAGLVMADGILELLPNASVGHIGIYRDPETLQAVEYYAKLPPLNDDKEVFLLDPMLATGVSSIKAIEILKENGAKKITLVALIAAPEGVEAVEKKYEDVKIYVAALDERLNDHGYIIPGLGDAGDRLFRTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Uracil phosphoribosyltransferase (TM0721) from Thermotoga maritima at 2.30 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Uracil phosphoribosyltransferase
total genus 56
structure length 210
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1o5oA00
3QW4B 4QYIB 2JKYA 4PFQA 1QB7A 1STOA 3G6WA 1BZYA 4RV4A 1A97A 3O7MA 1QCCA 1O57A 5K51A 5KAPA 1VCHA 3GGJA 2IGBA 1QK4A 1UPUA 5BQPA 4KN6A 3MBIA 1P19A 1GRVA 2H06A 3ACCA 4LYGA 1Y0BA 3N2LA 1V9SA 1L1RA 2PS1A 1NONA 1WD5A 1A96A 2E55A 1OROA 2JI4A 3OZGA 5ESXA 4RQBA 1XTUA 1CJBA 3H83A 4IJQA 3NAGA 2P1ZA 1G2PA 1QCDA 1JLRA 1UFRA 1XTTA 3OZFA 3M3HA 4Z1OA 1AO0A 2C4KA 3OHPA 1I5EA 5IPFA 1A95A 1UPFA 5BQOA 1YFZA 3LPNA 1TC2A 3DEZA 1QB8A 3MJDA 5E38A 3S5JA 2EHJA 1IBSA 4LZNA 3HVUA 1DBRA 3ACDA 4RHUA 5JV5A 2AEEA 1QK5A 1ECCA 2VFAA 5HKLA 1J7JA 1U9ZA 1ZN9A 1DKUA 1Z7GA 3DMPA 4LYYA 5ESWA 5BSKA 1L1QA 1HGXA 2WNSA 4P3KA 4RAOA 4RQAA 1I0IA 4QYIA 1I14A 1BD3A 3LRTA 1PZMA 1XZNA 4P86A 2XBUA 2PRZA 1A4XA 4M0KA 1VSTA 1LH0A 4P82A 4X45A 1DQPA 4ZFNA 4M0PA 3KB8A 3ACBA 1I0LA 4X44A 1MZVA 2PRYA 3EFHA 1U9YA 4LZOA 4PAWA 1D6NA 1DQNA 5BRNA 4RHTA 1TC1A 2JKZA 4RANA 1ZN7A 1DKRA 5IAOA 4OHCA 5JSQA 1XZ8A 1NULA 5KAMA 1ZN8A 4F8EA 1XTVA 2JBHA 1G9TA 1R3UA 4JLSA 1P17A 3DAHA 3GEPA 4RHXA 1ECBA 1ECFA 1HMPA 1G9SA 2FXVA 1P18A 4M0UA 4FYMA 1OREA 2H08A 4QRIA 1A98A 4RABA 1VDMA 2HCRA 1W30A 1ECGA 2GEBA 1OPRA 4WMLA 5HIAA 4RAQA 4P83A 1BD4A 1JLSA 4WN3A 4P80A 2YZKA 1A3CA 1G2QA 2DY0A 4RADA 4JITA 1O5OA 1ECJA 1P4AA 1QK3A 2H07A 4MB6A 4P81A 4P84A 5EUCA 4LZAA 1I13A 4S2UA 4TWBA 4RHYA 4RACA 1GPH1 3GGCA 1FSGA
chains in the Genus database with same CATH superfamily
421PA 4K9NA 3FFAA 5E7JA 3G2OA 5C31A 5CA0A 3SJZA 2VUSA 3DQQA 4PCLA 2Q8NA 1SOWA 1G8HA 1M1YB 2QUJA 4TLCA 3P27A 5DISB 5A62A 1Z4OA 1PEKE 4I4NA 2QORA 5FPHA 4NNJA 3SEFA 2DLCX 5BN5B 3WC4A 3RSSA 3QOXA 3DT6A 4R40A 1YTLA 2C2KA 3T7CA 1JB1A 2ZTLA 1M5UA 1VE1A 4R8KA 5BUSA 1K7XB 1ZHFA 1V3VA 2ZU6A 3B6MA 1N1MA 1SUIA 4YECA 3MUNA 4RHEA 2O8DB 1KY2A 3K6JA 4TRMA 3RTEA 5BURA 3QRWA 1NXTA 4JLMA 3ADBA 1ZSYA 3CBQA 4XIFA 5FI0B 2FSVA 4BO9A 3T38A 3ZTTA 2C3YA 2R8BA 3OEED 2H8KA 1VJTA 1CP2A 1V96A 3GDHA 4Q24A 4X66B 2RE8A 2Y0BA 2DJ5A 3H17A 1XU9A 4EF5A 2ID8A 3M83A 3V1TC 2C3OA 4DLPA 1X1QA 2YIMA 1MVLA 4DA9A 2NXCA 2X7JA 4GIBA 4R71A 1BRMA 2PSHA 3PCTA 2HL6A 5L3RA 1OFHA 2UKDA 1QYRA 3N2ZB 4YAWA 5JEEA 3W5CA 4UNPA 5H5JA 3AR4A 1Z5WA 2CJWB 3IBYA 3PDIB 5B4UA 1HOXA 1N8KA 2FTKE 2FU5C 3RJMA 3OD5A 5AI8A 1FU7A 1UEIA 1KOJA 4DCNA 1THTA 2OCDA 2OOSA 2HWXA 4CLEA 3Q5DA 4QBKA 1VIYA 3G2QA 4DRXB 2HU5A 1REQB 2F64A 4S05A 3VDXA 3EVZA 2KE5A 3RQIA 1W2GA 3YASA 5KYKA 1LPPA 1J8MF 4MVJA 2H18A 1S6YA 4WK6A 5CB4A 3QVVA 4DR4B 2OHIA 1RC8A 4ZHQB 2VPPA 4YLYA 3JD1A 1QQBA 4BKQA 2I2FA 4RD0A 4RPLA 3OIVA 3PHIA 3AU9A 5DOZA 4B7XA 4PN3A 4CKBA 1IEXA 3H6KA 1K4KA 4D1YA 4L16A 3DEHA 3LWDA 1MRNA 2YNMA 1IZ9A 3C8ZA 3V4RA 2BP7B 4LJYA 2OO5C 2Q5IA 1UIRA 1Q16A 2OGUA 4FR5A 4FOLA 4W63A 2W90A 4BFYA 3ZU3A 1CEQA 3B60A 3UGTA 1QZTA 1T9BA 1DIBA 4ZVSA 5FX2A 1DVRA 4K05A 4QRIA 3UM9A 1T8PA 3EG9A 5GJCA 3A36A 1VDMA 3SX4A 3QU7A 2AYYA 5FLEX 4YUZA 1XMPA 4DY6A 3TZHA 5HRAA 1NXOA 4UJ5A 2G4LA 1EFDN 4L8VA 4BTLA 4BO5A 3WBJA 4BBZA 1J0BA 4CTOA 4P83A 5M29A 2C7OA 4JJ8A 3VQTA 2O2JA 3LJKA 5K0TA 3UPTA 2PJUA 1T9KA 4Y2JA 4N82A 5FL7D 2GI4A 2AWOA 4Q1EA 2HA6A 4ZI2A 5JSUA 4F92B 2D0PB 3OFJA 2YFKA 5DU2A 1M34A 3AOEA 4HY3A 3VBEA 3UGKA 5EZSA 5JS8A 3ROKA 1FY2A 3QKTA 1N0IA 1VE9A 1L7QA 2JFHA 4U2CA 2QYTA 2OLJA 2W93A 4X6XA 5JNRA 4S2UA 1PG0A 3IURA 2CL5A 4G0YA 4YNBA 4G8BA 5H80A 4B31A 1FSSA 2WF6A 3ASUA 4Z1MD 1QNFA 5I9BA 4WBNB 4MGKR 2BDUA 2ERXA 1Z4NA 3FWPA 4OREX 3THOA 1BZYA 3DO6A 2FP4B 4U2GA 1LFDB 5LZ4A 2NP7A 3ESYA 4MDEA 4WADA 4G1FA 5D5HA 4DG8A 3IAM6 4URHA 1IMOA 4KSBA 4IVQA 2ZROA 2VKQA 1K08A 1KBZA 3U37A 1UKCA 2C83A 2ZIWB 2VUHB 1OROA 4UZFA 3ILHA 5K8IA 4Y8VA 4YJ3B 2PJDA 5FBHA 1EKXA 4FMDB 2ZIXA 4BHTA 3CJTA 1WCWA 2G83A 5AVXA 2FPIA 1WULS 2QHXA 2G8LA 2O2DA 3IMKA 3H8WA 4GFDA 4ARZB 2W6CX 4NCIA 1QYCA 1RZUA 3MCZA 3T12A 1Y5RA 2FSIA 1AGNA 4K9PA 1T8RA 2ARKA 1WU8A 3VH3A 5F2NA 1JDBC 5BSUA 3MMSA 1QVVA 3FUWA 4ZI7A 1J24A 3KO8A 4ARBA 4BJ5A 5KVVA 1HNWB 1CRWG 1TLFA 1UP4A 1XMXA 3GT0A 4JHLA 4TS3A 4ZRNA 3W6OA 4D96A 5EHQA 4WECA 5CK5A 1JHXA 2XVAA 5FBVB 2X1HA 4XDZA 4YI5A 1B8UA 3QX9A 4UE2A 4W5NA 4BNVA 4YO7A 1YE5A 4ZZ0A 2M98A 4GC5A 1C1DB 2DY1A 3C3AA 5TPWA 3FTEA 4UEQA 1DRUA 4DWJA 2G08A 2OBXA 4H7KA 4YYEA 1IIBA 4MKIA 1OLUA 1P75A 5KPDA 3TW4A 2GF2A 1X1BA 3IRUA 3HFJA 2VJCA 3RJ5A 3CRQA 1J07A 2PRJA 1GG9A 2H57A 3RS3A 1IVSA 1O0SA 3K5HA 2C5HA 2PVPA 3VU1A 5GIPE 1PVDA 3B1JA 3DM9B 4X1OA 1JNXX 3IUYA 3FGPA 4UMDA 4WK2B 1Q44A 4XDHA 1B8PA 1PYDA 4K40A 4N0MA 2X23A 3BD8A 3B89A 2HT1A 4LQDA 1KC1A 4RDIA 1N32B 1U0TA 1UFKA 2EJVA 4OHCA 1OBFO 2C7BA 2FW9A 3UAGA 4BB5A 1NT2A 1Y8CA 4YP5A 5CVEA 4BO7A 4E30A 2FXIA 1E2PA 1IH8A 3L7AA 1N2EA 2CMHA 2QRHA 7GPBA 1GCAA 4X64B 4LVUA 5JBNA 1XQ1A 1NXQA 1GILA 2BFOA 3GJQA 1WD7A 3KXKA 4Q3EA 2J4FA 3RKRA 3INGA 3ZW8A 1CT9A 2AOXA 2WMDA 5FR2A 2NV0A 4AROA 2UUCB 3S5UA 1NLUA 2Q1YA 1JS1X 3K70B 2OR3A 3R0IA 1I94B 3NVDA 4ZZ2A 1VSUA 2H1OA 3B9BA 2WDPA 2P3SA 3IB6A 2BEKA 4QPNA 1EJBA 1KK0A 3DL0A 4PIMA 3HS3A 2CFSA 2Z0MA 1NJ2A 2V03A 1F0YA 3R7FA 3V1YA 4TLAA 4A1OA 4F6RB 1JLSA 1SBQA 2QVXX 4HPXB 1U9JA 1EUCA 4BVAA 1KMMA 4QYWA 1Q0HA 2V54A 4G9EA 1KJ9A 2I6XA 4GGMX 1L4GA 1PS8A 4PRYA 3VOTA 2E9SA 2VWQA 1R6TA 4GPIB 1ZIXA 3PQDA 4Z0TA 4IZOA 3HZZA 2PYDA 4Z2YA 2ZYRA 3LDAA 1H8ED 2WM2A 5F3DA 3RT7A 2Z4SA 2IU4A 3T7EA 2H9AA 3HACA 1OIVA 3HP4A 2H52A 3FMFA 3K20A 2HU2A 4Y30A 4PRKA 5JJCA 1QTNA 2TMKA 2QPOA 3EMDA 5JCJD 4K87A 3K7EA 1GUFA 1KWKA 1RMYA 3EPRA 3BERA 1P1IA 2IDMA 3G9ZA 3OUTA 4H7DA 3JQRA 3KQQA 3FX2A 1M2HA 4DMCA 3QYJA 4UNRA 1FYEA 4OGKA 5AUNB 3V32A 3RASA 4F96A 2WWTA 2FRVA 4U63A 3WLKX 3IUBA 1KU6A 5CB4B 2PXXA 1RCUA 3DWGA 3GXBA 4WUTA 5COAA 3T94A 3TVDA 4E5NA 4KR7A 3AR6A 3I52A 3DW1X 5ALIA 4ARVA 1NSTA 1E2HA 4CUJA 2GKGA 4OU4A 3KRTA 2H3EA 3TRDA 4K46A 4PZEA 2WZQA 1Y4ZA 3EOBI 4TN5A 1SVMA 3UF0A 5JXHA 2FWAA 5KREA 3PNMA 3UNXA 5I4BA 1U8YA 3IKLA 3WMEA 2VHUA 3SQDA 1DKQA 4C76A 721PA 1T3ZA 2GTPA 2C5FA 4PF1A 1E9VA 4JC8A 4HX9A 1CF9A 3HMQA 1NQWA 4HZIA 3EXHB 5AW2A 2V4UA 4OUDA 2BKXA 3O3NB 4UTOA 1G3QA 4JKYA 4OI2A 3C98A 5ALQA 5AHXA 5JY6A 4ESEA 1Q0PA 1XMJA 2H00A 3BWVA 4ND7A 4U0JA 2PUHA 2UVPA 3SJUA 1CRZA 2CNLA 2P2SA 1AURA 2QQ0A 3PUWA 4BNJA 4N7JA 2I66A 1GWNA 4Q1FA 1WXFA 1PZMA 1P9LA 3DE6X 3EAFA 5K9ZA 2OSVA 3LPDA 3SF8B 4CV0A 2YXPX 3GLHE 4DDUA 1L4MA 1YOVB 3ONWA 4KFRA 1TEZA 4K1XA 3E82A 2COEA 1USKA 5CJPA 5KOJB 3VDNB 2EJTA 2YV1A 2B99A 3OZIA 4JGIA 5G0SA 5HFNA 3DBLA 3ODPA 2Q4RA 4TT3D 3SOPA 2OUKA 1BMDA 1LBSA 3O93A 2C84A 2FX5A 4EFLA 2DFTA 3LQ4A 2WJ4A 3E9YA 1O4WA 2EBUA 4JLSA 3U7JA 1XTBA 1CDEA 1DC5A 2ZTMA 4NULA 3S2UA 3BXOA 4AO8A 2VNKA 1EAMA 4MZDA 2QW0X 1O95C 2XUKA 2VYFA 3EPPA 3OZEA 2XZLA 2JJ8A 2VDMB 4PYRA 1PWXA 2B2XA 3U40A 5CA0F 3B6JA 3I9V1 5LN1A 1K4MA 1Q7GA 3O82A 4R1LA 2YQ5A 5FLYA 4RTSA 2PU5A 2QAGB 3RWOA 5KOHA 4R3WA 1PSWA 5DBFA 3R9WA 2F00A 3OUZA 1MC4A 4JI1B 4CN8A 4HEJA 2YTZA 3PK0A 1VJDA 4L9AA 4UDOA 2RHRA 2OILA 4DNPA 5LA6F 3WA6A 2OGWA 3UK7A 3VAYA 3O94A 4TV8B 4CVNA 3NT2A 1RHKA 3NKFA 4ES6A 4FFNA 3SEQA 3SQLA 4RXUA 1QRDA 1K89A 1F2VA 2A9OA 2F43B 4ZAYA 2P2CA 4OQDA 5K0JA 5A1TA 4TTSA 1FSGA 3QF7A 3QW4B 4BGEA 1R74A 5EE5B 1JQAA 4YMTA 2A9JA 1U2SA 3V3TA 3U4QB 3O8RA 4GKKB 4RV4A 1Q84A 5CVUA 1MXFA 4PY2A 1RWWA 1ZRNA 3HNPA 2Y1KA 3IAEA 3HLKA 1T6ZA 3K2BA 4WLNA 2P62A 2C5LA 1PFUA 1S8OA 5DZSA 1BWRA 2V59A 4BB6A 3LBNA 2XCOA 1SIOA 3PEUA 4HDAA 1ISGA 3OCWA 4GI1A 3BXEA 4J49A 3H86A 4OHFA 4FFWA 4BZXA 1TKCA 2X0IA 1L4BA 1WXWA 2EC5A 2OFPA 2OWEA 4QUGA 5JXIA 1Y1LA 1UFRA 2R66A 2V3VA 4H7EA 2Q0QA 4NYJR 5J4LA 1O96A 1N2IA 2Y1EA 2IRWA 2ZATA 3I42A 1JHVA 3WX0A 4A16A 3LUFA 2GZHA 3GJ5A 2Q3CA 2PZFA 1IVNA 2OT3B 3PXCX 4MHTA 4AFNA 3QVWA 1KK3A 3ZCUA 3IE0A 1QZ3A 4WACA 3F6YA 1QC5A 2NQ2C 3L0PA 1ND6A 2CV0A 2A3NA 2BR4A 3GLRA 3UB3A 4QXQA 3UMRA 4RCYA 2KPOA 3ND8A 4B82A 3UMVA 3UBMA 1I3LA 5I3CA 2W2LA 3ZG6A 5KDDA 1T6XA 2FUCA 2W2VA 3JQ7A 2C1EA 2ZT5A 1LDGA 4L8LA 3IE2A 4RU1A 4Y6GB 1U7PA 4G41A 4ZODA 4OLJA 5KTKA 3X43A 2XVXA 1HGXA 2SBTA 3LX8A 1BS2A 3LBYA 2B2CA 2HIHA 3EH2A 5G02A 5FWAA 3Q8LA 2F4VB 2HO5A 5ICFA 3AEXA 1CRLA 4FGJA 4KPGA 2B7LA 3K9CA 4KPUB 4L2IB 1IM8A 3EGVA 4JJ6A 1XZNA 4M1WA 4RA9B 1TUBB 2XTJA 1P2SA 2FWMX 2JGLA 3G1WA 2ZZNA 1Q1GA 4MRAA 4KFTA 4XDGA 1C4OA 2PMKA 3O2SB 2A7QA 3BM5A 3Q3GE 4IH4A 4L76A 4GEKA 5HFAA 1I4LD 2JCYA 4ZO9A 4F56A 4F97A 3I01M 2ONKA 4HDMB 4RIFA 1P5JA 5FTKA 4Y2XA 3IL2A 2GN9A 4J7AA 4A8JC 1XNHA 4WZBE 4X3OA 4CFSA 4EB6B 1ONSA 4NESA 3L4BA 3UA3A 1JEQB 3ZBUA 3KQMA 4XFDA 3RBZA 1ULSA 3GEDA 2VI5A 4TTAA 1CUUA 1RC1A 3JAWA 1RXSA 3KKMA 4YEDA 4MDHA 3EY4A 1FBNA 3JY6A 4A4DA 1EA7A 1K3FA 1D09A 1CUZA 2XRMA 2NVWA 4U7FA 1JDBB 3RWMB 2F7SA 2VP4A 4FUTA 2BUBA 1K5HA 2B1IA 4CQJA 5C7LO 2A84A 9ABPA 5FEUA 2D7DA 4P38A 4B6JA 1PNVA 2KX7A 3KSUA 3KS9A 1A9QA 4QBGB 5EXSA 1PQWA 3VPGA 3U16A 1BXGB 1NW8A 4X93A 4EIWA 4IL5A 2CXRA 3SE0A 3F6SA 3M3PA 1GZ6A 3HTXA 1MV8A 2BEUB 3LV8A 4KE9A 4C6SA 2GLXA 5PNTA 1OYWA 4YCCA 3P0EA 5JT1A 2O7QA 5CNMA 1E77A 3FPJA 3AVPA 1DARA 1BMFA 1K97A 2IKQA 3P4XA 4N6OA 3S70A 5LBTA 1Q0TA 2BTQA 4W1QA 4N54A 2VVTA 2L0XA 1WB6A 4GR5A 2YVQA 4GKJB 2C04A 3FUCA 4ZEOA 3DE1X 2ASEA 4CNBA 3L7LA 4OJNA 2GUWA 2PU7A 4XW2A 2ZR9A 1AG9A 2MJLA 1ZK4A 3WJ1A 3ZWVA 2ZE8A 3CA8A 4P0QB 1QZXA 5DNWA 2FZVA 2ZI9A 5BO5A 1AUPA 2BI4A 3H2ZA 3IODA 2GKOA 3FWHA 1ECLA 1U04A 2C3MA 4QYSA 2DUWA 2PEZA 3Q4GA 3QHPA 3L0SA 5SYAA 3ANTA 4FMBB 1J70A 2X22A 4M9RA 2QN8A 4GOND 3R6GA 1YJXA 1TM1E 2QY6A 4XH9B 4EDHA 1FNMA 1QAMA 3T35A 3FTNA 3MTJA 3IPCA 4FE4A 1ZMBA 1JHMA 2AQIA 1XTUA 1LFAA 1G64A 1OX5A 1T3LA 1MABB 3AH8A 3DZBA 3P4YA 2A9FA 2DRIA 4HYYA 4KKVA 4NCXA 5DGCA 3HXOA 3WYGA 5DLQC 5J9FA 3BIOA 4UTVA 1C4WA 2V0NA 2V98A 3D7KA 2I0FA 4FZ5A 5G0TA 3IKJA 3I9NA 2QJRA 2COKA 1RI3A 2P5TB 4LTDA 5FPPA 4KXQA 1U0RA 5LLSA 5GINE 4AKHA 4QG3A 2YIJA 1MVNA 1IDOA 1P4RA 4GE0A 5ED4A 1MBZA 3GHHA 3SS8A 5BR7A 4PZDA 5C8ZA 1PP4A 4BC1A 3ZBQA 1WDTA 2I54A 4N0QA 5B7QA 4V1CI 3UUEA 5KNCH 1IK4A 4Z99A 3VZCA 3V4PB 1YF3A 3RVRA 2GXUA 4DMMA 3ZZ1A 3VX4A 5A2GA 5BSKA 4I8XA 2XMQA 3VU3A 4PGAA 2G1KA 5K2MA 1HNNA 1BD3A 5CVCA 2LPMA 3DDNA 4EO4A 1XPUA 4RK5A 3LUGA 1IFXA 1KRHA 2HO4A 3M4ZA 2IC5A 3E0XA 4JXJA 1ZCBA 3DBOB 2FUNB 3G17A 4MIYA 3UC5A 4BX9A 3GAZA 2BZSA 4Z7NB 1XLUA 4E0BA 1P2DA 2VF7A 3EIFA 2V1XA 2HA7A 4OL0A 5T8KA 4BTEA 1PR3A 2H8GA 1ABFA 5GJVC 2RDMA 3E1GA 4BQQA 1IHYA 1DIHA 5AD1A 5L4LA 4TZ0A 2OL4A 4C3VA 2VHZA 1L5KA 2DFKB 3L3BA 5E6SA 3SSMA 1IPFA 3IKMB 2YWFA 3LE8A 3R7BA 2JIZD 1SOVA 3UWDA 3N0WA 3EQ9A 4KO8A 1NKTA 1JBQA 1QP4A 5LZ5A 2I4RA 4F9FA 4IOKA 5JANA 2QPTA 4IDGA 4HNGA 1OV4A 3ZBPA 3L0OA 3ZGZA 1EWYA 3O5AA 4ML3A 3DMYA 3F3MA 3N0TA 1Z4MA 3GVCA 1OFTA 4O2AF 4AWXA 3AVTA 3B13B 1P33A 1PLJA 1GN8A 1GAQA 1QVWA 4F6LA 5A4DA 2BFPA 2RIPA 3H9BA 4H6WA 4C7OA 3PKZA 1KKLA 4OJQA 3T4PA 4WN3A 1U0EA 1ILWA 4UXJA 1MV5A 5JJ5A 2HGSA 2XI4A 3AEKA 3I6IA 3RS7A 1OAOA 3AFIA 3D0RA 1GZ4A 3UVEA 5HE8A 4AURA 1H8EA 1KFBB 1FUKA 4RSMA 1DXHA 3EULA 2D5IA 3OOWA 2C9ZA 4G5OA 4Q7KA 1HT1E 1N0WA 1P7CA 1IQPA 1SKYB 1YZFA 1VE3A 5GOTA 621PA 4X94A 1APBA 4W5OA 3L46A 5LOVF 2ZQZA 2IZZA 1W29A 5JXJA 5KB3A 4B3IA 3DKIA 3WGGA 2C61A 2CXQA 4OJKA 2I4MA 3SJAA 2R8XA 2YS7A 4LY3A 3TLXA 1F5SA 1XZIA 4MI9A 4FFSA 2QL5A 3HJTA 3LDFA 2WKSA 2YWEA 4GSLA 3PS9A 2JI4A 2VUUA 4I2VA 4LS3A 1AK1A 1SA0B 4HSEA 1BW9B 3RU7A 4B5KA 3J7AC 4UVHA 3KEGA 4TN1A 4EUSA 1RCFA 5KVAA 2A9QA 4PONA 1F14A 4TVSA 4RTJA 5LP1A 4FHZA 3I12A 5DYIA 3I9FA 2P9YA 1J1UA 3PUVA 4GX5A 1ZM9A 2VCYA 3A9SA 1HYHA 5KHAA 4AF6A 2O1SA 5FYDA 3VVLA 1IBCA 1W5FA 3EISA 4K6GA 3CY6A 1I7LA 1LS6A 1QQ5A 3WXMA 1ZAYA 2HJVA 5HFJA 3USZA 5C8VA 3CPJB 3ZEAA 1FVHA 2PBZA 1K8QA 1AKYA 3EOZA 1KMHB 4HH3C 1EQUA 1P7WA 2G6BA 4YS6A 4G8JA 1OASA 2Q9BA 3MBKA 4F11A 1U3TA 2RGRA 4MUAA 1ECCA 5IKXA 5D3MA 2JEZA 4F1WA 4XAQA 5LU9A 4DJTA 5TGTA 1G8JA 5DI3A 4YCSA 4JU8A 3TSYA 3ZVLA 2DQSA 1PBTA 3MSXA 1BWPA 2I1QA 4R1TA 4RCZA 3PHBE 3A04A 4B6EA 1S02A 4PWYA 3U56A 5H3CA 1I14A 3R7WB 1H6BA 2IOQA 3HRIA 4MS3A 5IVDA 1A1SA 3UJDA 3GG9A 1X92A 3M8KA 3GRZA 2SECE 4JYPA 1J06A 2QJFA 2QU7A 3NHFA 5K8TA 1X70A 1ZJ6A 1CSEE 1FJ2A 2QUKA 4OXXA 4WX2B 3CEJA 3DAFA 2GPWA 4MLCA 1ATIA 2JLYA 2VPQA 3SHFA 4TRJA 1EPUA 3A1UA 5ALHA 3WKAA 4RSRA 3UG7A 2VHXA 4TGLA 4I5EA 5LYJA 2FETA 2ZYGA 1SUWA 1SMKA 3RWBA 1K5GA 1VI6A 3OF2A 1LD3A 3OZ7A 5K6RA 2I5PO 4DZTA 4ZIRB 4FWTA 1GGFA 3HCCA 2KMLA 3CHYA 3KAJA 5HDBB 1LDNA 1Y8RA 2GLTA 3ZDZB 2BC9A 4F8EA 2JAOA 4CKEA 4JKOA 2F17A 1ETUA 4RMJA 4ZU3A 1NR5A 2Z6AA 2WINI 1C9KA 3MYRA 5TMDA 1MC1A 1M2JA 2POQX 1GCUA 4JOBA 5AUOB 4Z4GA 1A8SA 1MIHA 2W8ZA 2EGUA 4GYWA 5C8YF 4HWPA 4P2GA 5BVHA 1ISMA 1DGQA 4XVHA 5ES3A 4UHCA 1BGXT 1H2XA 3WLOA 3ZLTA 1OBCA 1DKOA 1SZPA 3OQOA 5C1PA 3QI7A 3LHSA 4CM9A 1RM5A 4HN4B 3TUIC 4EO7A 1MABA 3OAAD 5IM4F 3RC8A 4JVLA 4BEBA 1IUNA 3BQNB 1PV2A 3RPEA 2HAEA 2VWHA 1S0UA 4QOHA 2XT0A 3LUHA 1RFLA 2FN8A 1VKRA 1Z28A 4U6QA 3DM5A 4O02B 3DQZA 3OU7A 1TVEA 3DL4A 4RW0A 2Q8PA 1NE2A 3TSWA 1RM3A 4M7RA 4KXYA 2DHDA 2HZ7A 1JW9B 3HCAA 2HCFA 5HTKA 3TQTA 3CZPA 3ETJA 4E22A 4XWKA 3GLGE 2ZB3A 2A2ZA 1PKXA 3F47A 5DKFA 5CDFE 5ECGC 3J81A 1T1EA 1WSDA 4QRHA 4BRZA 4KR9A 1YZYA 2HWYA 1FRVA 3DBRB 4AXBA 1B73A 4GVLA 4H1VA 4MQEA 3P2OA 5L40A 1W7AA 5FTNA 3DZKA 2PZGA 5KTPA 2QRUA 3PPXA 3WJAA 2FG7C 4XJSA 3ONVA 3EA0A 2PY6A 4TKMA 3C4QA 3LUCA 3AHCA 1W35A 1R8YA 2CZGA 2XUJA 2FEWB 4N3GA 5H3LA 2H5JA 2LCQA 4ZCPA 2QU8A 2FQXA 4JODA 3ZHBA 2W2NA 3QH4A 4YCNA 1AB6A 1EGHA 3DJFA 1RWBA 3AMVA 5LQAA 2MOKA 2XZTA 3LBFA 5MN5A 1EVYA 3PFNA 4EJSA 3K0CC 2ZBEA 1Z0FA 3P9PA 1ZD8A 3KCQA 4KYTA 3RFVA 1R5BA 1JJIA 4UOQA 2CXPA 2IZ7A 2R6DA 4Y6SA 3T15A 2IEAA 5CEFA 4UUAA 4FT4A 1NR7A 5HCIA 4LYAA 1THZA 1GAXA 3GQVA 3VRHA 1DIRA 1ZY2A 1ZK1A 3ODGA 3AEQB 5JLJA 5KJ6A 4LI0A 1Y8ZA 3NZEA 1MTZA 3EGWA 5AOCA 3IMGA 3IR7A 3AF3A 5F7JA 4LWPA 4G09A 4YRFA 2WF9A 3F71A 5KU1A 5J63A 5KWEA 1U11A 3GJYA 3MJSA 3A6LA 4LKRA 4MIKA 3RM3A 2W8BA 1J2TA 4A0GA 2I8CA 3LTNC 1E1QA 2QZSA 3H16A 1KU0A 2PZMA 2WKRA 1OH5A 3DTVD 1H6AA 3SNKA 4ER0A 1SK8A 2NU7B 1M1YA 3AFHA 2QT9A 3L0YA 2XCUA 3K1AB 1GZ5A 2X9VA 2YYZA 3LKZA 3MW8A 1WUHS 1JJ7A 1H0RA 1Y4DE 2I2WA 4PSAA 4DQXA 4FDUA 1L6IA 3QY0A 2FZGA 5CUQA 3STVA 3BMQA 1DQNA 4HDRB 4JUFA 4WD3A 5FP0A 2Z57A 4LSZA 5ENZA 5AM0A 5HXAA 3TG2A 1GIAA 4CL2A 4B74A 3A3KA 3FDZA 1ADYA 2JHGA 3D0KA 3FY4A 4KLNA 3VZPA 2HMUA 4N39A 1BHSA 1VYHA 2I2AA 3WLPA 2XHZA 1GGJA 2A3RA 3R41A 3K9NA 4RHXA 5H70A 2ZEJA 1JF8A 4HS4A 4OHYA 3KAQA 1IATA 1G9SA 2C00A 3MAGA 4YPVA 1RM4A 2WQ7A 3VXKA 2GB4A 4DM7A 3VVMA 4JC5A 1ECPA 3HCOA 4NG5A 1NFRA 4V39A 3ZQKA 3FYUB 4MQ4A 4H7JA 3SQWA 1RKBA 1LJUA 3NJ4A 5EWLA 3ZLUA 1H1DA 1YXMA 1R1DA 1SIBE 5GJWC 1BCRB 2FG5A 1S3FA 3AESA 4MGZR 4ZEVA 2NNWB 3CNNA 3N75A 1UBEA 4WNAA 3VR3A 3X1ZA 5CBPA 10MHA 3DYBA 2LZ0A 4EARA 4O8CA 3G49A 2VEOA 1MJFA 2Q5JA 5E7QA 1YFKA 4EF6A 1T5BA 3FCUB 2UXCB 4ZYVA 1G7CA 2KLHA 1TYZA 1F1JA 4WK0B 3G2LA 2XCLA 2Q6LA 2PFKA 2ZBRA 3MXOA 4MI1A 4RD1A 1T1SA 4HLQB 3MCWA 5AOBA 3EGCA 4B2YA 5JMPA 1K9SA 1V1RB 4IUBS 4LISA 1JHPA 1JSZA 1VG9B 1G42A 3E18A 4KR3A 1QZUA 3NBQA 2CHVA 4RTMA 2OV8A 4XUGB 1CQPA 1GITA 2VHQA 2YWJA 4FQ5A 3QVJA 3KQUA 2I7VA 4EY7A 4OH1A 1GZUA 1XA3A 4E2WA 2R6CA 3GCZA 1CYDA 6Q21A 3O2NA 2OFWA 1Y9ZA 3RODA 3ABZA 1A9SA 3L6RA 1Q22A 1YB1A 3K5IA 4IJQA 4KQ1A 1RWKA 4LYDA 1FLAA 2BRUC 2EVWX 4ZT7A 4AP5A 2QLMA 4DT1A 1IOVA 3CLSC 4P5PA 5KQMA 3BGOS 2XWQA 1CVIA 2R44A 3NS7A 2QG4A 3E2MA 1IHPA 2IIQA 3M3HA 4Q3KA 5E6UA 3KWMA 3PT9A 4KO2S 4A8HA 5CB6A 2CJFA 4Q3OA 1EK2A 5GGXA 2RJOA 2C8KA 2FNAA 1N5RA 1ULTA 3ZY3A 3V6MA 5JHHB 3BCSA 3DVLA 3VKHA 1CQIA 4L4ZA 5EXPA 3C5EA 1Z25A 2J9RA 3AI3A 4R2KA 5LKAA 2FMXA 1C30B 3EJWA 4W7IA 3RABA 3DLHA 4W5RA 4M9SA 1S4QA 3NTVA 1E9EA 2F1IA 1JA9A 2VWGA 3C16C 1LA2A 3TSOA 4FZJA 2HM7A 3MJFA 1OGIA 2EARA 2AR7A 3B9RA 4F4DA 2QR2A 1JPUA 3TM5A 2Z9DA 1PFQA 4Y9TA 2DPXA 1L7DA 1PQYA 4DNOA 1S1CA 4FP9A 2JFFA 1I3OA 1HZZA 1PL0A 3N3AC 2DETA 5A6VA 4R9UC 5AJVB 1A9TA 1NQVA 1PSDA 3WO0A 2OAEA 1IWBB 1IZYA 3VR5H 1IDN1 3LZ6A 4CLHA 5JQGF 3CF6R 3EFHA 3EIEA 4IIFA 5D86A 3ZNPA 3DCYA 1MX1A 2RHTA 3K1TA 3PNSA 4YN3A 1XDGA 3R09A 3NYWA 1V41E 1M2NA 1NBOA 1AK9A 1J0DA 1Z26A 2P9FA 3FSGA 2PN1A 3MRXA 4ZCIA 1QYWA 3HA2A 4DQLA 4Z4QA 1Z63A 3DBHA 4PN7A 1I3CA 1XZPA 3BWEA 3PPVA 1PS0A 2D2IA 4F45A 1M1NB 5KJFA 3ZXXA 2GASA 2RHBA 3QFSA 2Q46A 1II8A 3CUVA 2PSFA 4G0QA 5BQ5A 3TEMA 3V8NA 4B40A 1BG6A 4C0HA 4ENPA 2AC7A 3WSVA 3ZD8A 2Y1OA 1KIFA 1LY1A 2JIPA 4KVAA 4EJMA 2NXWA 3T5PA 4D3XA 1HDCA 5CX1A 1QANA 1JFTA 4GMHA 3OQ6A 3RUHA 4C6TB 3B1FA 4TVKA 3V8BA 3CRVA 3L7NA 1T0PA 3HWSA 4QDXA 4HWKA 3WMRA 5BSVA 3WYDA 3KQHA 4BO8A 1QK3A 2B98A 2HU7A 2FKAA 5A7FA 4G5YA 3RKUA 4ZGBA 4ZTUB 1DX4A 5FUQA 3I76A 4RACA 2OQIA 1OY1A 4LTMA 5ALSA 4GPD1 2WWGA 4FHCA 1JFFA 5K1ZA 5D87A 2QNIA 2VDUE 1M1ZA 4KR0A 3FBGA 5JFOA 1PJSA 2P3LA 1NOJA 2LIVA 4YRLA 1T9GS 3NYIA 3KDPA 5CX1B 4PXYA 4YYZA 2Z09A 3EVEA 2PMDA 4JGBA 3UAOA 1U0OC 1UMKA 4ARZA 5KNDA 3VGJA 1ZA2A 2D0OB 1Q92A 3H3XA 3QJYA 5JZ9A 1F2UA 2AH5A 4FONA 5KU7A 3FETA 3STWA 4LK2A 3SI7A 3O95A 3THYB 3CN7A 4ZC8A 3THYA 5F51A 1PT5A 3FPHA 4KH0A 3ZW9A 3CB2A 1W36D 1UK9A 4XQ9A 1IBLB 1E3SA 3DTYA 4AZ3B 1F0PA 5THXA 5F3WB 2Z9BA 5CLFA 2WUVA 4DJ5X 1KJ8A 2XWJI 4DANA 2G36A 5DLPA 5DRTA 4HWTA 4D8UA 1E32A 2C1ZA 1Y8QA 4MV4A 3T7RA 3IPAA 2QVCA 4C0JA 1U8UA 4MUGA 3TVYA 4TSFD 3HEMA 3FHCB 3ZZUA 2ZP1A 4IHKA 4B4UA 1QWOA 2HA5A 2IYUA 2LTAA 1A5ZA 4CDMA 3IC5A 3G82C 4UOEA 1LPBB 3RFCA 2AL7A 2EGGA 2R6FA 4J2HA 4QDZA 3E4DA 4XIGS 3M5CA 5C51B 1MB9A 3KZ1E 3ADDA 5E9AA 5KYYB 3AI1A 5CXUA 1IY2A 4YIHA 1FFGA 5JMTA 4FXPA 1O4VA 1VA5A 5CDFA 4HK4A 1QUFA 3GFFA 3HPQA 1NP6A 1ONNA 4URWR 2VC2B 4I4CA 2Q0SA 3FPFA 5J2UB 1MJGM 5GONA 4ISBA 2C7PA 1SXPA 2QX7A 3EDQA 5COQA 1L5SA 2WHRA 1HX7A 1KI7A 3MGCA 3F7OA 4J9VA 3JQ6A 3OQBA 3HDQA 1EFPA 4DIKA 4BFSA 1RPZA 2ETXA 3EPLA 1MOZA 2CNNA 3V1LA 2ATEA 3W04A 4V0LA 3A9VA 2Q0HA 4LNAA 4QOGA 5LQCA 1CXZA 4D9GA 3IOEA 4IDDA 4US1R 5KNDH 1WBDA 3PHCA 4Z5XA 2CHUA 2VF4X 3KJNA 1E8DA 4BNTA 3BTOA 4I5GA 5KYYA 2D4AA 4YIKA 4HAOA 1P62B 4FILA 3HLYA 1HDEA 2QQEA 1A4IA 2R4UA 1UBKS 2IY8A 3AUTA 4BVBA 4HEA1 3LNTA 5A03A 2HA0A 1SU7A 3KJQA 5IKMA 4IFIA 2XBMA 3V7YA 2VATA 2QLBA 4M9XA 4MIOA 4P3OA 1B26A 4Q0MA 3H9CA 4UC0A 2DQYA 1UOEA 2Z5FA 1W0JD 1P39A 4LZPA 3EHDA 4N3NA 4QOSA 1LJLA 4TTTS 2GPSA 4IIJA 2C29D 4JCOA 4L4SA 2VJOA 5EJMA 1TTHA 1ABBA 1HR0B 4DIBA 4D4LA 3W1WA 2ZOSA 1YWGO 1EXNA 1XQ9A 3KKKA 5EKSA 4IDOA 2F9FA 3P2JA 4PO9A 4WH0A 3IDAA 3EYWA 1QU3A 3CX4A 3D8BA 3MMPA 1JYEA 3MZ0A 1FLDA 2JZCA 4DCOA 3H5AA 3AC0A 4D42A 3T0GA 4F71A 2OO3A 3FFXA 5E4YA 1H4VB 1W25A 2QZPA 3GIWA 1TB4A 1U2QA 3IHTA 1NTRA 3OQIB 1RHUA 3E6AA 3C8MA 4G9BA 5FT9A 3UHOA 3DR5A 4NQRA 1TVCA 4FFBB 1SHKA 4MUKA 4QNMA 3DR3A 1YQXA 4CMAA 4MVJG 2H0QA 2XTNA 2IYTA 4IM7A 3WGYA 3PGKA 3JQGA 4YP7A 1YI1A 1LGYA 2OBNA 2RAVA 3H5LA 2HX1A 1T4MA 4D97A 4XA8A 3FVVA 5AYVA 1X1RA 4TTRA 4OCZA 4EA7A 1AHHA 1RMTA 3EMBA 3HCNA 4PO8A 2PQMA 4ZCMA 2J32A 4OQ4A 4PGMA 4RHCA 3LUJA 5KCMA 1GU1A 1QYVA 3B7PA 5EY5B 1Z2CA 1JXOA 2Q5OA 3N8DA 1Q1EA 5H9VA 1K6EA 1T2VA 1FDRA 1Y1RA 2XECA 3LC7O 5K09A 4EDFA 1KSFX 2AG6A 4CE6A 1A5SB 3DVQX 1PJQA 5I5GA 1B2RA 5LBIA 3UAVA 4BO4A 1JEYA 3WDSA 1W87A 3ACDA 3U3MA 4CUKA 4EOGA 1Z5GA 2IUTA 1M10A 1Z4QA 2HJSA 3QKUA 4YR7A 1KFEB 1Z9BA 3RSQA 2IA5A 3CRRA 4FX2A 1NVFA 3TNYA 2WUWE 3W3AD 3L8MA 5HSGA 1J42A 2ZRLA 3WRXA 1BQ3A 4WWHA 3NDRA 1ZOOA 2JL1A 3BGIA 2OXIA 1KO7A 4XIIA 3UJBA 4EJFA 1SK9A 3NHAA 5KMGA 1EVLA 4FFLA 5THQA 4ZZ1A 2JJ2D 1G2OA 1PHRA 4PXAA 4C6TA 2AEFA 1NNLA 2UYQA 3MTBA 4KDRA 4KE8A 4KLZA 4MAFA 5CXQA 2NP6A 4UAVA 4KFUA 1F8UA 3OQ1A 3N6RA 2K2WA 4W8HA 2IBSA 4JYMA 1ZUD1 3EEYA 4LUCA 4YJHB 4KW7A 4KB5A 4NZZA 4KDCA 2BFAA 3INNA 3VDRA 3VYVA 3DOUA 2YWHA 2IKSA 3LY8A 1M54A 2DKOA 1RRKA 2VJMA 4Q47A 4Y6OA 4YAOA 1R5JA 3RTGA 1TYCA 2HJ9A 3GVIA 4JQCA 1E3IA 2R6HA 3GP8A 2ZT7A 2VDJA 1BW9A 3R3JA 3TLJA 1PQUA 3BZBA 2VXOA 3PJEA 4BNDA 5GM1A 2C0QA 4NMWA 4DZRA 2GESA 3IT1A 4HQ6A 1DC3A 4QBTA 4RL4A 3I37X 4Y67A 3RYTC 3RARA 2F55A 4M0DA 3AY7A 3I45A 3JQFC 1B14A 5BSRA 3TLYA 3EIUA 5FOQA 4E5VA 1EVJA 1F2TA 1I4DD 1ND5A 1QM5A 1NU8A 1UKYA 2O52A 4IEEA 2I6TA 1F8GA 1JZTA 1Q3KA 1YNSA 1RLOA 2BF4A 2FB9A 3MJHA 3BMOA 1K6JA 2EU8A 2F3SA 2CD7A 2G5GX 1XZFA 2ZYAA 4Q9HA 5FLXA 4LI3X 9LDTA 3SKXA 3W3AA 3DNPA 3D6MA 1AVTA 4C4TA 2B92A 5HUHA 1CKEA 1G2IA 2WYVA 4BMOB 4DJJA 4PAOA 5L3QB 2GBCA 1V71A 3AB8A 3N5KA 4JD5A 3A10A 1P4JA 2ISQA 2NO1A 4Z54A 1U7DA 1BEUB 2BHTA 3HHPA 5K8UA 1DUSA 3HJGA 1VGVA 3AKYA 2Z5LA 1HTBA 1S5PA 2QX8A 1URPA 1CQZA 4YQYA 1ODLA 1YC2A 3B1KA 3EOAI 1YBAA 3I1IA 3OX3A 4MW2A 4BCBA 3AOGA 2ZQYA 4P4TA 4CM1A 2ZYHA 3DMRA 3WGKA 2JJQA 4IDQA 3AHJA 1VSBA 1EUCB 1R27A 2PK3A 2LCIA 4WZAB 3I6YA 2AOUA 4Q7LA 4KQEA 3AB7A 4NARA 2G9RA 3TTUA 1LQ2A 2EKZA 2XMBA 4WESA 4FU0A 4D98A 2CSUA 2OXFA 2ZK7A 1N7IA 3E7FA 3NRCA 3OZTA 5G2OA 1AOXA 4ENQA 4RTOA 5J4VA 1YCFA 2NO4A 3AR2A 1QGAA 3QUAA 1GDHA 3EASA 4WNCA 2D7CA 4WQMA 5CLHA 3WB0A 2R11A 1ODSA 4AQYB 2GJ9A 1Z15A 1DCFA 1T4CB 3LECA 1GZDA 4UXHA 1XYVA 2BR3A 1YB5A 2QN1A 3GB9A 5E2AA 2I3BA 4XQCA 2REOA 4FYWA 4L8GA 1M6YA 4LG1A 5DGDA 5DT2A 1YRHA 1NPTO 3PUHA 1Q19A 1FE8A 1IMJA 3R2JA 3U3OA 1XALA 3L04A 2PLWA 2EFYA 3F74A 3WK8A 2C94A 4QICA 3G89A 2B94A 5EVCA 5FUVA 2OQRA 1Z8NA 1RBMA 3ZS8A 4UTPA 4EBFA 5HYVA 5J4KA 3OA2A 3S8EA 2VUIB 2CLHB 1RQRA 4HDCA 4F1KA 5CDGA 1YFLA 4NECA 3BJZA 2WTNA 5CVDA 2BGLA 3WK9A 2WJGA 4R5MA 1OXTA 4I08A 3HBMA 4RV9A 3JD3A 1GUDA 1I5RA 4H0CA 2PWZA 4MLPA 5FI5A 4WLVA 1SUFA 3KFXA 1MNAA 1B4DA 1CJKC 1V8OA 3CKYA 3IIIA 4IHJB 2EFCB 1VM6A 1BMFD 2ZUWA 3QU9A 4Q7MB 3WLFA 4E31A 4HPJB 5I9LA 4AY6A 1Q17A 2GO1A 1WABA 4NSNA 2QP4A 2IOHA 2QTVA 1DFGA 2WAAA 1DBSA 2UZ3A 5BV1A 4E46A 3SP1A 3MYYA 2YC2C 3PR3A 1IOLA 1EFTA 4G1VA 3T1TA 1RQ2A 3CNBA 4LVOA 2J87A 3GJXC 3FHOA 2G0TA 5ADWA 3LRXA 4MCAA 2JGJA 2IVFA 4K1LA 2FSFA 1KJYA 3H7IA 1NBHA 3C39A 3LX6A 3N8IA 3O2QB 1O5IA 3WL3A 1IZ0A 4ZHQA 3HZHA 3D4IA 2MSLA 3KE9A 2C98A 4UVDA 5ALKA 3OLXA 2CVOA 2ZDHA 2WTXA 3NBZC 4OYLA 4RNCA 2IX9A 4TRRA 4KWHA 3SHWA 3EPHA 3EWSA 1WLSA 2EWVA 1AGXA 1YL6A 3OTOB 2G7MC 2ZKLA 1CUGA 5LD2B 1KI8A 1KYVA 4X3PA 4IGIA 4XWAA 2ZJZA 4I1RA 1MUUA 2GXQA 4P2BA 5JNWA 1N7GA 1SQ5A 1DIGA 1E4YA 3H4VA 4MR7B 5JSYA 4MMYB 3B9PA 3C7AA 1PJ3A 3ZUGA 5BNWA 1ZU5A 3RSCA 5JAMA 4COKA 2J0SA 1FTYA 3T0IA 5KTSA 3OETA 2PL9A 3D8RA 3O4RA 4RK4A 2PTHA 1IXKA 4FJ2A 5TY0A 3O9VA 4XTCS 2WYIA 2D5BA 3R5JA 5JD6A 1BE1A 2H31A 1R66A 3L7JA 3W7BA 3PEEA 3S7ZA 5TF0A 4RSGA 3V34A 1UAYA 4MYUA 3TJRA 1JU9A 1OU4A 1KYXA 2ENWA 4Y2YA 4CQLA 4DA7A 3U61B 1RXCA 2B6HA 2RKWA 3PF8A 1Y6JA 1C9EA 5AM5A 3RVBA 1P1KA 5JNUA 1R5OA 2BCGY 5ICGA 1L4EA 3KG2A 1N1DA 1Q0QA 1EE2A 3RS9A 3RC7A 1WHSA 3ZE9A 2J7PD 1K8YB 2JHAA 4A5SA 3A6KA 1RABA 3WAJA 1VE7A 1OXBB 4U7DA 2LW7A 1XP8A 3UJPA 4O5OA 3GJ3A 2Y2UA 2YZ7A 3C8HA 3AG5A 4F2DA 1WV1A 3QVOA 4KPUA 1KHTA 3VM6A 5I7HA 1E69A 3T9DA 5L7TA 1B76A 3SK0A 4WA8A 1VCIA 4E1VA 5DNCA 1Z6XA 3GT7A 4LZLA 1UDAA 4XB6B 2CNDA 5B6IA 1E6EA 1DPGA 3COYA 5AXAA 5KNBH 4AKSA 4FDLA 4JJIA 2Z4RA 4JAVC 5CXXA 4DCGA 1BGWA 1CEXA 4JASB 4RGVA 2PMFA 2QGNA 1G3UA 2EERA 2GVDC 2QWXA 4UNIA 5KVQA 2FPOA 3BE8A 2GZMA 5A4IS 4Q4DA 3AR8A 5GGYA 4B8YA 3Q88A 1ES9A 3QBVA 5JO0A 2JLZA 2RGGA 4AWBA 5JCOA 4EA6A 4BJ3A 1YDWA 4YFYA 2OLKA 4QYTA 1BRTA 4M0CA 1SH7A 4JGGA 2Q5CA 1K88A 4G5HA 1KERA 2FKNA 3LQ1A 4JHXA 2ZAMA 4L8WB 5JO9A 4CG0A 5IASA 3U2QA 2B36A 4D9EA 3NAMA 4RYDA 4ENVA 3BCHA 3K0HA 1IB6A 3UMBA 3PB3A 4TMYA 4D9FA 2WIJA 4HEA6 4TS9A 4A7PA 3NWOA 2AF4C 1ZR4A 1L1QA 4OMFG 4AIRA 3RVQA 1QQAA 2Y1WA 1NURA 2WE8A 3WBFA 3LRTA 2HLPA 1CPYA 1P80A 1J56A 5LWQA 1RPJA 4FFVA 4MRMA 9LDBA 3A28A 1NN0A 1QRUA 4WJLA 4KMMA 4WKNA 5AK4A 1EB8A 1JQJC 4O59O 1RLMA 3GRFA 3FMIA 2I7CA 3GFQA 5JTUA 3N2YA 1M8JA 3U4HA 4L4UA 2BBOA 3N07A 4FYIA 1N5KA 1DKPA 1Y37A 3UPUA 4CEIA 3TEJA 3C41J 1T4CA 2RG1A 3TQQA 3BXFA 3O1HB 3RGGA 1NT4A 3MK31 4WY8A 3HUFA 3I05A 1P0FA 1ADJA 3CX6A 3QUCA 4M55A 2A8YA 3ME5A 4X62B 3W5AA 1XTSA 3ND6A 4HFRA 5ALYA 4DV1B 4KQ2A 2FXVA 4IRUB 2GFQA 4Q21A 5BSTA 4EB0A 4HDQB 1P2TA 4KITB 2FPPA 3DMGA 3SIRA 1OE0A 3BX1A 3ZHXA 5DP2A 4JDPA 4JVMA 4HNUA 1LW7A 4LV5B 1E2UA 4IHJF 1OXKB 2V96A 3DAOA 4MNTA 4IQFA 3JD4A 3AY6A 3M1YA 5ALDA 1W96A 5EC8A 1C2TA 5FPSA 2O2SA 4IV8A 5ITVA 5JZOA 1KEEA 1BD4A 4C7OB 5F64A 3ZVRA 3CNLA 4EGJA 3VU9B 5FOTA 4EKYA 2ZS7A 2C92A 3HO6A 1Q3HA 3LHFA 3PG5A 1H65A 4XWWA 3OO1A 1X7ZB 3TN7A 1V26A 3R77A 1R4MB 4UDXX 2C4HA 5E1DA 3WYAA 4RA6B 2ZTSA 1W88A 4B81A 8ABPA 1W76A 1A2OA 3ZE2B 5IYZB 5EUBA 2IPLA 3F2IA 3VZSA 2GPJA 2O2IA 3B7WA 2L18A 3OD1A 2IOFA 3A0RB 4M86A 3QMWA 1RXUA 2G1JA 4XASA 3NC0C 4AULA 3LU1A 3IE1A 4DCPA 1N8SA 2QENA 3HJCA 3MTGA 3KJIA 4GI2A 3EGXA 1EM8B 5LQKA 2GH1A 5DW3A 2OCPA 1NVXQ 5G3YA 1UXKA 3W6NA 3AEQA 4J1NA 2BPOA 3OCXA 4C78A 3DUWA 3VYSB 2WP0A 2WVJA 1CB7A 2E55A 4N40A 4M36A 1VDZA 4OFXA 1G4HA 1F17A 2JB9A 3P8ZA 1XL0A 4YT8A 4MUIA 2JANA 1Y3AA 2Z08A 3N7TA 2O0LA 1GUAA 3H0CA 2BE9A 4AUEA 1YR2A 3RI3A 1TECE 2H2IA 2WIAA 2XV1A 2WHQA 4D26A 2PIDA 2DC1A 3REGA 3E53A 1QWSA 3AFOA 1QP0A 4KR2A 1YVEI 2V7QA 4KIUA 2R6ZA 3BWYA 1QIFA 3FDFA 3HI6A 1TTPB 3G85A 3WDMA 4P1ZA 1I10A 1N0HA 3N0VA 4IG4A 1V8ZA 5KKNB 3WQSB 1U0LA 3DA8A 1X7WB 4EAQA 5JUWA 1TEXA 1ZJJA 3OICA 4OK5A 3X1WA 4B6RA 3M6IA 1XZJA 2A6PA 2OOKA 4JLAA 3QXHA 1WSAA 5IXJA 2RHOA 2ZZKA 4LOHA 5KVSA 1MMFB 1PGQA 4EENA 5L8VA 3HJRA 3I32A 1ZD4A 4OD0A 4OLAA 1K2WA 4EO9A 1JVNA 4UD2A 3ZHZA 5MF6A 1RXYA 3RQSA 3I0ZA 2PANA 1Z7GA 3JYNA 1OJLA 3A1EA 3JVEA 2JVIA 4BNGA 3F9CA 2QLLA 5CB8A 4M2LA 1JWLA 1H9CA 4JB8A 4J3JA 1XAJA 2CB0A 2GPTA 5KYGA 3A1CA 3ZHQA 2RGDA 3BHJA 1C9DB 5J3JA 3MEQA 4RLSA 3DFZA 4X45A 1U81A 2VJBA 3DMDA 5REQB 5IBCA 1AZSC 3ACBA 1QO0A 1FYVA 4C5AA 3ZVMA 3QNMA 1JXAA 3WGVA 1B0PA 2EYUA 3PC3A 3AGQA 3DZIA 2ZT6A 4BMPB 3OE1A 1I4WA 3FYTA 4ZEXA 3ZEIA 4BP9A 2VHTA 1N9ZA 1EU1A 2X2EA 3OZCA 4H18A 4MWBA 2E0IA 3WGJA 1ZL0A 3L93A 5EJ7A 3I4CA 1T25A 2UZ1B 4G1MB 1H05A 3NHUA 4DEYA 1SC1A 1XL1A 4DMRA 2QYSA 2DFVA 2ZRHA 3KD2A 4IHQA 2QTZA 5EPEA 1HSZA 3IPXA 2ZB7A 4YC7A 1OIWA 3JQQA 1VHLA 1U99A 2VPZA 4CMIA 3ND7A 3C2QA 2R60A 5JS2A 3RB8A 3V4OA 1V1MB 1YJQA 3KLBA 4FI3F 4WY2A 1IBMB 2P6RA 4FOTA 3BL5A 3JYQA 5F5LA 4WV3A 1W8IA 2QM8A 3Q7TA 4N7RA 1NBWB 1RLIA 3GO4A 4JB3A 4RENA 4CKYA 4DLVA 3FDJA 2HMTA 1N25A 4FSDA 1DT5A 4OQNA 4PQRA 1LDBA 3W7AA 3WY9A 1WB9A 1J5EB 2D5LA 4DC1A 3A05A 3EW9A 4PE5B 2JFVA 4CDGA 4QGFA 3UQZA 5JOQA 2PSEA 2MSEB 4WL0A 2NSDA 4B0OA 5B3LA 1TADA 3KXDA 3P0RA 4CMIB 1RM0A 2R9VA 2JIOA 2FHSA 4H7PA 1HLFA 3W2HA 3PNOA 5CFNA 3R9XB 5BXYA 1JQ5A 3D02A 1DRJA 1YZTA 4BX2A 3M81A 3WB1A 2QX4A 1IB0A 1AHNA 3MCVA 2GPBA 4TYMA 5M34A 2JH8A 1P2VA 3TFQA 2QTCA 1QG4A 3C7DB 2PKYX 3JSAA 4MJ7A 1I33A 5U1PA 2BZGA 3K9QO 1PCXA 1UBGA 4G0XA 4MUEA 4OOEA 1W44A 3C4JA 4LNUB 4YJ3F 1BKYA 3SX0A 1QGUA 3ROXA 1EUDA 2A5JA 1FU4A 3K0FB 1E1CB 1Z5VA 3C3EA 5JVDA 5BVGB 4QNRA 4NU5A 5JPIA 3TBFA 3R0VA 5CD1A 1NYTA 1MP0A 4U5QA 3VKUA 4I50A 4KPFC 2YVUA 3OLVA 3DEZA 1VXRA 4IYJA 4YAKA 5KVCA 3L0CA 4K2HA 5K5EA 1KP9A 1HFKA 1I6WA 1ICEA 2MYNA 2DTXA 4NXNB 3A2KA 2FUG6 3ZIUA 4J29A 3WGIA 4MP6A 3UEOA 3ICEA 3OHSX 1DKUA 3KCNA 2Y9PB 4D46A 2GPYA 3NPMA 3PI7A 1PU2A 3AP1A 2OZKA 2MR6A 2AF3C 4H7HA 2NVOA 4LXHA 4R1MA 1E5DA 1KNQA 4D56A 1ZH4A 2Z6QA 2NUTA 3PFHA 1JPVA 5FFNA 4ZAVA 5KSOA 3ZCSA 2QRNA 2X0JA 1RHRA 4GLLA 2GM9A 3X1XA 5AI9A 2Y66A 4UNNA 3SC2B 3RYHB 5K01A 3SR3A 2QTBA 4KODA 1N6HA 2QUZA 5HBGA 5K3SA 2P2LA 3ENQA 4NTZA 5A71A 4BDSA 4LFBB 3RS2A 1EK0A 2V65A 2R2GA 2X8BA 3BAFA 3GN1A 2ATCA 4L3WA 2I1VB 1A5BB 2YV5A 5HKBA 2C4NA 1GG8A 2DM6A 2AK2A 2N0SA 3P9NA 4H0FA 4TWAA 2OCGA 1ZM4A 2CE7A 3KOOA 3FVWA 1WXDA 2RHDA 3C45A 2HJHA 4XUEA 3TMAA 3RHZA 2RHMA 2ZAGA 1AC5A 1FFWA 3OJXA 1JI3A 3RUIA 1F12A 4ND4A 4D3ZA 1XN4A 1VQ1A 4BAZA 5KTNA 4RTKA 2FK7A 4AW9A 4ZJPA 3GUYA 4FGKA 4GR4A 4R54A 5I4CA 1JDVA 2P6UA 2NLOA 2ZDGA 3CRMA 4O08A 4TOIA 2PYZA 1BSVA 3FOWA 1YRLA 4WZAE 5TR9A 1Y42X 1K4YA 1TU3A 2PL1A 2GEBA 3M6WA 3HPRA 4EYSA 2QT0A 1VSQA 4IHAA 2OHXA 1L3CA 2ECOA 5BSFA 1LBTA 5BWNA 3KXIA 5F23A 5IU6A 5JSKA 2BBSA 4OFBA 4BPBA 3H5NA 1G17A 1EUZA 2DY0A 4X61A 2ORVA 2QZJA 3JWEA 3CS3A 3MWFA 3NJRA 4GR9A 3RNOA 4NEQA 4RKWA 4BNKA 3HG7A 1D0VA 1Z12A 4EPWA 4AN1A 3UGQA 2JJ1A 3GLFA 2A30A 4GLJA 1WETA 3ZDAA 1F8XA 1WCV1 4ZI7F 3Q6MA 1OYOA 2HHAA 5EJFA 1JIQA 1JTVA 1ST3A 3E58A 4KI7A 5CYFA 5JYBA 1JPJA 1SBZA 2VK4A 2WJZB 3G1TA 3SIPA 1QFYA 2BSXA 4XEHA 3ZVKA 1OGYA 1TZJA 3UK1A 4DXDA 1I1HA 3DD1A 3VOSA 1W581 4J94A 4DC0A 2O8EA 2R79A 3E7PA 1R37A 3VISA 3IT0A 3H04A 4DCUA 4Z0HO 4N5DA 4E2XA 3QEAZ 3CLUD 5HF5A 4EM6A 2QA5A 2Q99A 3WNZA 2IYWA 4HRXA 3U5ZB 3BCRA 3KDSE 2ZPUA 3C5CA 4JYCA 2PKRA 2DTDA 1E1NA 1WXQA 4C4YA 3EMKA 1CC1S 1KE1A 3IVXA 4TWJA 1FUIA 1NVAA 2JHPA 2P1ZA 1KAQA 3FCXA 3JYPA 3KLPX 1DBVO 1U1FA 1DKMA 3MB5A 2VBGA 5FYQA 4QPDA 2FR8A 1ZR2A 3QXGA 2HRRA 1RAIA 1WDLA 3R7NA 1W1IA 2A1IA 3FTCA 3E5NA 1ZPDA 2GCIA 1SRRA 3T95A 1F4PA 5KC9A 3TIXB 2JEYA 1K68A 3Q6NA 1TMOA 4Y0VA 3ANYB 4OSPA 5EFOA 4YDHB 5K0EA 4KRGA 2C8JA 3STXA 4PSKA 3KT8A 2A59A 3DFMA 3QVMA 2Y4OA 4JR0A 5ALFA 5C0OE 2VHVA 4S1WA 1Y3DE 1UJNA 3P2EA 3KETA 4GECA 1MX9A 3EG5A 4M8SA 2IYQA 2PX3A 3EODA 3MN1A 4E21A 4GOXA 1DAIA 2PRSA 5D00A 2WM9B 5KYXB 1DP4A 1J0AA 5GWXA 4MV3A 2IHUA 2ZIUB 3C1AA 3LI2A 1CJTC 2UVDA 1QH9A 1SFRA 2BZ0A 2HTFA 2VYVA 5BXQC 1Z0ZA 3TECE 3WQBA 3U1BA 2ECPA 2IHNA 4ISCA 1D9ZA 3DZFA 3Q9SA 1NYRA 4KZKA 1DTEA 4D9IA 4MKZA 4ZT2A 3H11B 2VRBA 4DA0A 3PRJA 1HXHA 2O5RA 3THXB 4XM0A 4D6YA 3BSFA 2VYNA 1FP2A 1DBPA 4IO1A 1PNQA 3AVUA 1O95D 4EMSA 5C4GB 2VSNA 1E9SA 4JA2A 3STTA 4BEJA 1O0BA 1AB5A 4C08A 1ZUNB 2XSZD 3H2GA 1NUHA 2XZPA 3D3WA 4KXLA 5EHNA 5E0KB 2EZUA 1DI0A 2VK8A 3I72A 4B9AA 2B2NA 3BWMA 1DJQA 4NL4H 1UPXA 3QU2A 1YASA 3U81A 4PQYA 5BMVA 2XCRB 3QF4A 1CVRA 2PFSA 4G0MA 1AKNA 1L7BA 2HK7A 2PIAA 4NOKA 5BOVA 4BO1A 1WM1A 4E09A 1YRWA 3COZA 3FHLA 4HNAA 4X95A 2O2GA 1ECGA 3ECSA 3N2KB 4C6HA 2GM4A 2ZG6A 4NDZA 2R47A 5DV9A 2RGYA 1FQOA 3M5WA 1AN0A 4N4AA 4PTLA 5BWBA 3QLJA 4CLXA 3TFWA 3IA7A 5K05A 4ZP1A 5LZ2A 3AV3A 2EFDB 3OPYB 1NWHA 4QHYA 4RMHA 4DLZA 4FX5A 2QD3A 1Q83A 1R4AA 1NW3A 2FWPA 2XYPA 1NUQA 3GRCA 3RF7A 3VR4D 3EQ8A 1UOQA 1BU5A 1T8UA 4Z51A 1YJBA 3PQ3A 4L4XA 1D03A 4W1RA 3Q12A 4JUCA 2E4UA 4Y9DA 1R15A 3E2PA 4XFJA 3U3DA 2A9VA 1RLTA 1U6IA 3R8XA 2AKYA 1ZRHA 4CKWA 1Y9AA 2TS1A 3IOBA 3ZWNA 1IOZA 2DWCA 2DMRA 1F2UB 4NY1A 5C4MA 3FJOA 2ZUCA 5MGBA 1XF9A 5B4VA 1IQUA 1U02A 1UPCA 5IM4A 3FHTA 3RSZA 2XMCA 3EVFA 3MFQA 3WQRA 2HPHA 5EZYF 4DLYA 1A4RA 4G36A 4BTVA 2QNRA 3FDIA 1FTWA 2XWSA 4PYNA 2G25A 3AG6A 1EFRD 4IUCS 4B6SA 1ISSA 1OC4A 4G1UC 1DX9A 4PW0A 5JSHA 2CWDA 1NBIA 1KPHA 1PWHA 2BFCA 2PGNA 4EHNA 1I9GA 1X7DA 1QKIA 2QX6A 5EXDA 1GFSA 4YAJA 1U0BB 2QTRA 5K2OA 1NVGA 1FLVA 3JCZA 3IEVA 1TU0A 1KBQA 3LDGA 4V0ME 2HQOA 2CL0X 2BEUA 1JHOA 1E0JA 2VSOA 2ZUTA 3K16A 3ZGLA 4Z7OB 4UU7A 4EVIA 3H1FA 4Z8XA 5U9CA 2QSJA 5HTOA 5JXGA 1Z0UA 5LZ9A 1OB5A 4C1BA 4MEJA 3ZYCA 2P4SA 4NFSA 3QG1A 3JRWA 4JU9A 3VHXB 3G5MA 1XRMA 2B34A 2GD2A 3HJAA 3R0JA 3T4UA 3N59A 2HNAA 1BX0A 1USVA 1C14A 1XJ5A 3EXFA 5GONB 5FH9A 4PFSA 5CM8B 4L22A 5G1NA 3UMSA 4DZZA 3WLEA 4MPTA 3WZ2A 1X1SA 1D4OA 2ZTUA 4AJLA 1AZWA 2YHUA 2V6GA 4MGIR 4F3NA 5A6SB 1GFIA 1NHGA 1T9HA 2ONYA 3KKPA 4UNQA 1E99A 1PX0A 2DE0X 5AHKA 3RUEA 1FW6A 2AZXA 5FR1A 3GRUA 1ZXBA 4HP8A 1GHTA 2BFMA 5HKKD 5DXAA 3K09A 1P81A 2Z8YM 1OU0A 4PC3A 1G9TA 1XD2A 3DLBA 1UJ5A 3WZMA 2OECA 4MARA 3OSUA 1WKBA 3OWOA 4D0SA 2AG1A 1GQRA 4HNTA 1M0SA 1VXOA 2Y92A 1YGPA 2AXQA 2PH3A 2WJYA 2E7ZA 4A8PA 1A8PA 1Z8HA 5DYYA 5JWHA 3J7TA 3BRCA 2X42A 3GJRA 1UBUS 4QLAA 3KQYA 3W34A 3A14A 4BUCA 4EATA 1Z0KA 1BROA 1QIDA 1YI8A 4YRIA 1EP3B 4BYMA 4WEOA 4IIEA 3OQNA 3DHNA 4FMDF 2Z98A 1QGZA 5JCXA 3PE4A 1EWVA 3HB9A 3A70A 3K0EA 1QRTA 2Z95A 1J0XO 5EHGA 3L79A 5A6SA 5AT1A 3PXXA 4E7OA 4RKRA 3ZK7A 2IHYA 1ZM7A 4YJFB 1GNLA 1DG9A 4WLEA 4RZXA 1YJ5A 3BPSA 4NV0A 4QPPA 4TTQA 5IWAB 2R1TA 4NG4A 4D4JA 2VYCA 4G6ZA 3WYEA 4EZBA 3MG9A 4WNAB 4ADSG 2CNBA 1Z35A 2VZ8A 1J5PA 2MSDB 2RHLA 3EFOB 1SCJA 4MLDA 3GLFE 4GF5A 2JH9A 1XYGA 1D5CA 1QC5B 2X6QA 1ONBA 3BXPA 5C4IA 4R9RA 3SY8A 2XGOA 6LDHA 3N7UA 2GSWA 1L9XA 2ENUA 1NV9A 3BJIC 2PUTA 4IV5A 1Z36A 4R9VA 1TEHA 1T0HB 1XRQA 3JQ9A 4REQB 3TCXB 3RUPA 4E07A 2UYHA 1L5RA 2JGDB 1GY8A 2R1UA 1QF9A 4MYSA 5IH7A 1V4VA 5JCPA 5ITZB 2XCTB 4GW3A 4KMRA 4RFVA 2WVHA 1U0HC 4J8PA 1QE3A 3BB3A 4R2WA 4M9ZA 4PSDA 2V4MA 9ATCA 3OHMA 5JFGA 3D7SA 1WX1A 3Q9NA 2FE4A 2GJ4A 2P6OA 3NONA 1Y6GA 2XGJA 3SVTA 3TINA 2PGIA 1KA9H 2VXCA 1JAZA 1Z2AA 3DOJA 3GIDA 2BFCB 1UBLS 3HBAA 1GTG1 4K28A 1P2GA 4A27A 1HORA 3LP8A 3UHPA 1NVUQ 5AHOA 3ZYZA 1E6KA 4CMEC 3OE5A 1TKBA 2DBYA 2ZRDA 1XE3A 3EK2A 3O1LA 3W9UA 2V5VA 4I4TA 5EWJA 2GTIA 2YX1A 4A26A 4YQEA 1AK2A 1NLFA 2PLRA 1Q20A 3TD9A 3HFGA 3BT7A 1AXGA 2FSGA 4Q9NA 2ZVDA 3D8SA 1Y9JA 3LKBA 2HDNB 2VL7A 3RSLA 3TB6A 5KMGB 4J7CA 4H4DA 4AUNA 2YIVX 3PUZA 2ZJOA 4KXNA 5D51S 3TTTA 2WR8A 4DUGA 3NH6A 3P9QA 3CN9A 5FOWA 4OB6A 2IYFA 1GKUB 4EY3A 3TW6A 2AMJA 1QIEA 2R00C 1EQAA 4JOQA 4WSOA 3FZEA 3DYIA 3JR3A 1FP4B 3U9TA 5KOYA 3X2FA 4ZC1A 4G4IA 1MQ9A 4JQSA 3VA7A 1X80B 3EAGA 1XLTC 2AFHB 2QTHA 2ZVQX 2P90A 4RDCA 4INJA 4WN9A 2BI7A 3V7FA 4F5EA 1TCVA 4IH9A 2HWWA 1LRLA 5H7XA 4ZHSA 4JI7B 1F7UA 3FMOB 4HDKB 1GL7A 1JEEA 5B2EA 1FS6A 3F7MA 2VHYA 3U7HB 2O8CB 1LLDA 3A06A 4GM4A 2A0UA 1JQ3A 3K2EA 3GD7A 5D85A 1I4OA 3PQ2A 1A7KA 1EK5A 3WA7A 4OXKA 1T5HX 4GPTA 2ODPA 3BK2A 2OG1A 1GO2A 1TPYA 2H1SA 3GT3A 3QQPA 3RTCA 2BN4A 4XIJA 2XVYA 2IP4A 2B4TO 3NYQA 3O0TA 4FCVA 1ZIDA 1NMXA 3ED1A 4HTFA 3U19A 3LYLA 4QODA 2GQ0A 2H9IA 4BNDB 3HCEA 3LY9A 5H68A 4BKMA 1U1GA 4DT1B 3THXA 4RGBA 3CLTC 2DPLA 1KMQA 3R6DA 2HEGA 2GN0A 4ARIA 3QSYA 1T2DA 1MC8A 1GUYA 1YB4A 1YKSA 4O25A 3X0DA 2QJOA 4QU5A 4N8EA 1ZD1A 2BFFA 4GVXA 4TL9A 1CUYA 2OAGA 5DNDA 3K0AA 2O5CA 4LGMA 2B5VA 1PGPA 3F4LA 4UAGA 2W6JD 4Q4HB 4HGPA 1TJ5A 4RH1A 1B42A 2I9KA 3QLEA 4QBFA 3W2TA 1JZQA 4RVDA 1YL7A 2V74B 1R0ZA 3MTAA 2IWRA 4CT4B 1D6MA 2XKBA 3I6MA 3IIKA 1Z6YA 3KWLA 2H5EA 3BXXA 3BUSA 5EJ9A 3LA6A 4PIPA 1D2HA 4HZUB 1M2WA 4CHTA 3UT6A 1KPGA 4DLLA 1JMKC 1TX4B 2NWQA 3FNQA 3RUCA 4CPDA 5K3EA 4RZHA 3DVSX 1IAQA 2YWBA 1GCGA 1Y1SA 1DTWA 3GH1A 3L0ZA 2AQHA 1PR2A 1U4SA 3AZOA 2J31A 2QZZA 3IBFA 2BMFA 2ORED 5FB3A 5H81A 5DP1A 3AF2A 3EIXA 3RK4A 1I7NA 4G24A 1WV0A 3WWEA 3IUJA 3UT5B 4RVSA 4PG8A 1USUA 2X77A 2RD2A 3KJGA 4KKXB 4AUKA 1I0ZA 2XDYA 1C3JA 2ODAA 4HAWA 5AHRA 2ATIA 1MDFA 4NE9A 4GXNA 1FEZA 4EY6A 4MMXB 3CCFA 1R0BA 1Z4LA 2FGJA 4FYVA 3L4KA 1SKYE 5EINA 2GDZA 3MJ4A 5IKOA 3C4VA 1YRAA 1CUSA 1UKEA 1UPBA 4PS1A 5KUTA 2ERYA 5GIOE 1VHJA 2OD2A 3PX3A 1DBWA 4J3FA 2J3MA 5CTAA 3R5FA 4RBNA 4H3SA 2H63A 1UMDB 3N6XA 2AR9A 2H4WA 1ZCJA 4HJXA 4XGKA 2XQGA 4KIFA 2Y67A 3K6RA 4O4JB 1RE1A 4UQPA 4YAIA 1F3LA 1KH1A 4B3JA 1NF9A 1W9MA 4ARCA 3NCHA 4RAOA 3FTPA 3NB0A 2ZR0A 3AHGA 3FDZB 1KAHA 4WT7A 3WGZA 9MHTA 2BJHA 3OM8A 1OW3B 2G8NA 4IXMA 5FOXA 3CNOA 2V6BA 2F3PA 2QMEA 3U39A 3WS7A 5IT9A 3BORA 1JIUA 1A50B 1WQ4A 3DDWA 1R4ZA 4M1OA 2XQFA 2ZSDA 4ZFNA 1RQPA 5TMBA 3U1TA 2AXNA 1OWOA 1Q0UA 3I2HA 3N58A 1LB1B 2QTTA 1RS0A 2W11A 2JGMA 4RIEA 1OZ0A 2H7VA 1ORDA 5CYGA 2C3UA 4DUGD 4EGSA 1B41A 5C37A 3CISA 4MSUA 4U8GA 3RHSA 1NULA 4CCSA 1XNQB 3BHMA 4V3BA 2FPSA 2ZFUA 4IXNA 5ELMA 3WYCA 1PVVA 1SXHA 2AVDA 4FKMA 4I66A 4ZU1X 3QENA 3T41A 2VHEA 2X5KO 3LLVA 1DLJA 2BGRA 2HV8A 3M70A 4XQGA 5D84A 4TQ9A 5EPUA 2QT1A 2FR1A 2HWKA 1DU4A 1G3RA 1NNSA 1OLUB 1TAQA 2I6SA 2N1MA 5CPFA 5E3IA 3X1YA 2ZJYA 3IH5A 2AHOA 2QMZA 3M4YA 2OM2A 3BMCA 7YASA 4LYJA 4RD6A 3AVWA 1GRQA 1N2JA 1WQ1R 2JLSA 3FR7A 2HYDA 1BXZA 1ENYA 2H2DA 2WSBA 2C5BA 3EEQA 3LW8A 2L42A 1L5WA 1N2XA 2B83A 2IXTA 1GQFA 5LPNA 1QIIA 4M1YA 3JU3A 4R2MA 1DXYA 2B37A 4YRZA 3V9PA 4TSRA 1OOEA 1W5AA 1UPAA 4K6KA 1QXSA 4WPGA 3B20A 5AH0A 1AXRA 1UDRA 3FWZA 3RANA 5HPYB 5AW1A 4LZAA 1Y5MA 4JI8B 5T67A 4J1QA 2ASVA 2NTVA 2HXYA 1XBTA 8ADHA 1WS6A 4IIGA 4MVJI 4HKTA 1VIAA 3GRKA 2YVAA 5CDSA 4NDNE 5ALWA 4FFPA 3NI2A 5GM2A 2G9ZA 1MGOA 4EUEA 2O3SA 4MDFA 1I3MA 1B1AA 3NRJA 5HZHA 3EGOA 2G06A 4JI4B 3RYFA 2IIBA 2Q50A 3C1OA 3PFGA 1XVTA 2H48A 3VPDA 4EVSA 2NTNA 4BQFA 2OPHA 4R69A 5HQTA 3VKGA 5CLJA 2BGUA 1KYQA 3WVNA 1X19A 2YZMA 3AR7A 1K0FA 3NUZA 2W9XA 3GDGA 1PTKA 3ONFA 4EGQA 3HM9A 3AVOA 1QNLA 4GMXA 3HJNA 3ZZNA 1HDZA 2DPYA 5BT8A 1TA4A 3KZXA 5KQLA 4QM7A 1FVFA 1Z5UA 3IUSA 1JHYA 4L9WA 3CPEA 1DBIA 1R8XA 3LO8A 3MTQA 4IDFA 1GZSA 3WKEA 4AG6A 2EW1A 3H8VA 1Z5PA 2ICAA 3AETB 2OKCA 4CV1A 2C9OA 3OFSA 1NQTA 3KR0A 3SHOA 4WKGA 3VSDA 1PHPA 3C85A 3R7SA 4EA8A 4FHFA 3FGNA 5JLAA 4RZ3A 1U65A 3I0NA 1Z0IA 3OLWA 5FEMA 5J2UF 2A78A 1VG0B 2QVLA 4X8MA 1J7JA 5EJ4A 3BREA 4BO0A 2A94A 3E7DA 3GEHA 2JA1A 3OJWA 2I6UA 4PYKA 3ESBA 4QVGA 4QEKA 5FIUA 3BWCA 3OOEA 4LF4B 5FL7A 3AB3A 4UPDA 2HRCA 3HN7A 1P1BA 1NP7A 1LF0A 2VDWB 3CB4A 1YS7A 2JASA 5G0WA 5K3FA 5FWNA 4OL9A 1K8XB 4PLVA 5LQNA 1XDDA 2WD8A 4B44A 4X60A 4GH5A 2ISCA 4P82A 4QSMA 4W1SA 4QULA 4GP7A 5FI3A 2PXHA 1YBMA 2P2YA 2WFLA 3GWZA 3D6TB 1W0KD 3U4GA 1B6SA 5CG2A 3OFND 3L6OO 1DQRA 2H65A 1A0OA 3CE6A 2O14A 3IELA 4CGYA 3ZDCA 1R0WA 1ZMXA 1X3LA 1Z16A 1L7OA 4I9FA 1WP4A 2YMLA 3A4VA 4QDOA 3TIFA 4AZSA 1FDOA 2O2XA 5KNBA 3O8OA 1U8EA 1R3UA 2J8ZA 2NX2A 2OGTA 3UUFA 1XDWA 2FOIA 3WDLA 3KVVA 1YB2A 4RV5A 2Y1FA 3VR6A 2PGAA 4QAJA 4TVOA 1BIFA 4V0RA 1AKVA 4YRSA 1OA1A 1L5HA 1GTZA 2X40A 4NBNA 2EP5A 2Y77A 3B3QA 4M9UA 4MVJD 4MYRA 2QPLA 1FYDA 3FYDA 5HOQA 2FMFA 1NQ5A 2LIPA 2DZDA 3KKZA 3VR1A 1BVHA 4W5JA 1CJUC 1THMA 2SKDA 5F1YA 4BNIA 1EFRA 2R8YA 3PGVA 1NUSA 1H8HD 2EEZA 2EZ4A 3QVLA 2YWGA 3AGPA 1XXHE 3F5SA 3LQRA 3CC8A 3VR4H 2Q5EA 3B48A 1NDQA 5BYAA 3SPXA 1F2TB 2BHLA 1NRWA 3WGMA 1P4AA 1Z0AA 4PV7A 3MVEA 4UARA 3ITKA 4L0DA 4TYQA 3JD0A 1ML4A 2CUKA 1KZ6A 1KEPA 3UICA 5L9AA 1LSSA 1MB0A 1NF2A 3MT7A 1N5JA 4X1IA 4BV9A 4NV1A 1R64A 1OUMA 4B5LA 2PLFA 1M2KA 2FJPA 3KVYA 3WLSA 7ADHA 3AHFA 3H19A 3CNHA 3Q2IA 3IQZA 3T6KA 1HH4A 1UDWA 3BXGA 5KWSA 1YRBA 2HK9A 3FYSA 3GZJA 3Q0TA 1E9DA 3WLLA 5KHOC 4LDPA 5F1OA 1N92A 3L5KA 4CKWB 2PVCA 1U8TA 1UBRS 3NIDB 3WYNA 2VJNA 2I2CA 2GMWA 1JT9A 4ZOLF 4OHPA 3CJQA 4B87A 4CG3A 2CCKA 3IP7A 1YI0A 2QSZA 3H83A 4MV0A 1IN7A 1QFSA 1Y1KE 2WQZA 3QWFA 4J6EA 4CM8A 5ICEA 4I1UA 2JH3A 3V97A 3DOOA 4KV7A 3W2EA 3KLMX 4D2IA 1XFDA 3TQHA 4UM8B 1GYRA 3PQ4A 3JW8A 3UB2A 1Q7TA 4HEQA 4RK0A 5IVIA 1E0KA 1WWKA 4GYJA 4O29A 4E12A 3PPWA 4UAJA 1JIKA 2H1IA 1WKCA 2VH2A 3NAZA 5IEBA 2DH5A 4GQBA 2O7RA 4UJ3A 1B0ZA 2ODQA 2CEKA 3LQFA 4TMWA 2YJTD 5CEEA 4ZVUA 5IDXA 4IUYA 1B3BA 1NJGA 4H16A 1WHSB 2D06A 5SYMA 3ZW7A 3AVXA 3P0HA 4S1TA 3UC9A 1NKVA 2QE7D 4DEXA 4QQNA 1Q77A 1UJMA 2C95A 2Q49A 4IG9A 5EJAA 5L3QA 2WAMA 2HD4A 2OD9A 4EGFA 4P54A 3HUUA 1GTSA 5JCOC 5GVSA 4D5GA 2C8VA 4C0WA 4F3YA 2J9FB 4WZBA 2NTYC 5INTA 3VC2A 1DQPA 3EXEB 4CLOA 3CLKA 5AKGA 5REQA 4CTNA 4PLPA 2VHJA 4EKIA 4YCJA 2ZJ1A 1FP1D 2ZUUA 4PAWA 3K6SA 4HQKA 1N3IA 2Z6UA 3VNUA 3HSKA 3T06B 1J00A 1HTTA 4RIHA 3UHAA 1KBOA 1RTKA 2JFWA 3JZMA 3FWYA 3M2TA 4MV5A 4O6VA 3RK0A 4P33A 2C5EA 1J2YA 2ZXFA 1CEYA 1RKQA 1TCCA 2BMJA 2IVZA 4S12A 3H13A 2NZJA 4MRPA 3MMXA 1OBVA 3KTOA 3MMZA 4QDTA 1VYTA 1FNBA 3PGLA 2HBQA 2VAPA 4U9HS 1M9NA 1P31A 2D2XA 3EBLA 1VRVA 3H5VA 3I5UA 4UZEA 3ZU2A 4AY5A 1EDZA 3GAFA 5FV4A 3CF4G 3NXSA 4Y6RA 3V9AA 3KQTA 3RHFA 5HHTA 1M74A 1WVGA 2WU8A 4LDRA 1TAGA 1T8YA 2BZ1A 2DBRA 2QXTA 3IQIX 4PGFA 2KB0A 4Y1FA 3U0BA 2P69A 4S2EA 1P6QA 2WJAA 3N05A 2WT9A 1PR6A 2P6PA 4QIHA 4EPRA 3FKQA 1ISPA 4RDHA 2FF7A 4BE4A 2OZVA 4BE7B 4GPBA 3CVJA 2AK3A 3DPUA 2QG6A 2JGIA 3PXGA 2OAQ1 4FCTA 4NP6A 4YCAA 4F5WA 4LY0A 4EMTA 4GWGA 3S1SA 1C7QA 4V3CA 4UEOA 4NPCA 3DFFA 3AV0B 1DJOA 3RVLA 4DXHA 1NOKA 1GEGA 2HMAA 4J0EA 4R9SA 5CX4A 2UYGA 5ARCA 5HQJA 4PRZA 5A7HA 1XU4A 1DZ3A 2W2OA 3A4IA 3MAAC 4UPVA 3WLMA 2XXAB 1V9LA 4AN4A 1FFXA 4E5PA 1FMCA 2FLWA 4RORA 4AJ2A 2OBBA 5KYVA 4NS4A 1XCGB 1K6IA 1OC2A 5EIOA 4EYKA 2JHCA 1ENOA 3T9EA 4S1NA 5LDDC 4N48A 3QHQA 3MBIA 1H8HA 4PNEA 3T5GA 5JASA 2Z1NA 4J7XA 4N41A 1GZ7A 3NHYA 4KRFA 1RZ3A 4I0WB 2Z3ZA 1D2RA 3M6UA 4YV1A 1KRXA 3A25A 1EGMB 4YVFA 3N76A 2YZNA 4GU5A 4RJKA 4BFWA 4EKGA 1MB2A 3WK7A 1D1PA 2HV9A 2BISA 2ZPAA 4IP0A 3ZLBA 1NW7A 1DELA 2P4UA 2FMHA 4Y9RA 3WL8A 1NW4A 3I64A 3CF0A 1JHQA 2PMCA 3L8EA 1ZC4A 5C5CA 1Q14A 1D2CA 1CLEA 2WRZA 3HSSA 4B76A 5HX7A 1QKKA 2GK3A 3PKJA 4RF4A 3V4LA 4LXYA 4NONA 1EIWA 3FAZA 2Q45A 1Z8DA 4O33A 4RK7A 5CNJA 4LGYA 4LE2A 5K0ZA 3ORRA 5FJJA 1CQXA 2X0NA 5LR6A 2YYYA 5HKLA 1LCIA 2QAGA 2XRYA 4H6PA 4IGAA 4C2BA 5KOHB 1AGPA 1H42A 3ER9A 3FYUC 1P1RA 3TRHA 3WAKA 3DMPA 2UVPB 2G67A 5BV0A 2WI8A 1N5OX 2IP1A 3HO1A 1BWSA 2VJMB 4QBHA 1G4UR 3MT9A 2EXXA 4ITVA 2ZWAA 5T41A 3UXHA 1JIIA 4EJ6A 3QIVA 1G60A 4BBAA 2X19A 2CW5A 4ZV7A 1C8LA 1VMAA 3W5VA 2HCJB 3BJMA 2GAOA 3L4EA 4BLTA 1RHMA 1P1CA 1KDTA 5GADl 1CUBA 4DCVA 3C3MA 2PUBA 1ZSNA 2A88A 3L0IB 4XCXA 1AIPA 2ADMA 3G9UA 3BK1A 1KY3A 4I9HA 3U3JA 1VSVA 1A9RA 2WICA 4MWEA 2IHKA 2O3TA 4ZO6A 5BNTA 1AQ6A 2CLIB 4EPYA 2VJPA 1XG5A 3OFKA 3UOWA 5JJIA 3E4CA 2X0DA 1T4DA 1J5XA 1EX1A 4RFLA 3N2GB 3K2IA 1SA0A 2IHZA 1VP3A 1Y82A 3PL1A 2L17A 4IDAA 5TEWA 3RHTA 2UDPA 3TGPA 1F4VA 1Q1AA 4JLBA 1DC6A 1S2LA 7MDHA 3TSAA 2C3PA 3TTSA 1W47A 4C7KA 2D1RA 2N46A 4XSGA 4E1BA 3IBSA 1DOAA 1NG9A 1FP7A 4Q39A 5JNLA 5LMNB 4OAQA 4QXRA 2PUJA 1U0GA 1D2GA 4DBLC 1V7QA 2C7GA 2FZ5A 4IRMA 1RJEA 4NABA 2WYOA 4G65A 4R1OA 4NHOA 3N74A 1FRFS 1VMIA 4B3CA 2NU6B 2C2WA 2W2XA 2Z4TA 1C50A 5AKIA