4R2LA

Crystal structure of ynaf (universal stress protein f) from salmonella typhimurium
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
142
Chain Sequence
NRTILVPIDISDSELTQRVISHVEAEAKIDDAKVHFLTVIPSLPYYASLGLASAELPAMDDLKAEAKSQLEAIIKKFNLPADRVQAHVAEGSPKDKILEMAKKLPADMVIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Universal stress protein F
publication title Structural and functional analysis of two universal stress proteins YdaA and YnaF from Salmonella typhimurium: Possible roles in microbial stress tolerance
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
total genus 40
structure length 142
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4r2lA00
2QTMA 5J58A 1JIJA 2HMAA 5TS2A 3X1KA 1IQ0A 3ND6A 3RHSA 4MW6A 1WQ3A 4HK4A 2DUMA 3H97A 4WSOA 2R5WA 1Q77A 3CVYA 1R6XA 3IODA 4UZFA 5J5AA 1YUMA 4K03A 5TEWA 4JXZA 4EG3A 2AG6A 3RK1A 2IELA 1PFVA 3ZUGA 1B6TA 1ZH6A 2PFSA 4XFJA 1TYCA 1YI8A 1N3LA 1KORA 1S4MA 2J5BA 2DLCX 4U8HA 1F4LA 2E18A 3IH5A 4ZCSA 1KQOA 3K32A 1OWMA 5JBNA 5DK4A 1WXEA 2CT8A 4EG8A 3DLAA 5IJXA 2V0GA 2VTBB 1P7PA 1Q19A 1M8GA 1NP7A 3CLRC 2OV4A 3L93A 4YBRA 2QUHA 5EKDA 4K0RA 2DEUA 3FHJA 3IVXA 3SZ3A 1KH2A 1M8PA 1J09A 1K4KA 1K97A 1EXDA 4OUDB 3DO8A 1MRZA 2CYBA 2J09A 2A7XA 1QRTA 2A88A 4FZJA 1F9AA 2CFOA 4HPWA 4ZCQA 4ZCTA 2YWBA 2QTRA 3CLTD 1JGTA 1QU3A 1KH1A 3SEZA 3ZJTA 1FYDA 2E89A 2ZP1A 4KPUB 1YIDA 2WQ6A 2C5SA 1TEZA 3COYA 4NAHA 1PFUA 4DDMA 4EG5A 1IFXA 4MUFA 4MVCA 4MWEA 1O96B 2CV0A 4QREA 3HFJA 3A4IA 3QTTA 3FNRA 2YY5A 4MVXA 3SEQA 4GU5A 1TYDE 3CA8A 4I6GA 4MUNA 4MWDA 3KT0A 2X1MA 4NX2A 1O6BA 1X6VA 2PG3A 4TS1A 1EJ2A 4ZT5A 2DETA 1MBZA 1X8XA 5DEOA 2B7LA 3COZA 3VRHA 2ZUFA 1WXFA 4MW2A 2Z3VA 1KQPA 3KT8A 1QU2A 4DDHA 2XRZA 1O97D 2QUIA 3IOCA 3CLUD 3Q10A 3FH0A 3MLBA 5TGTA 3SP1A 2D13A 2X3FA 2YWCA 4MW5A 1N77A 2D54A 1QNFA 4ZT4A 4HJRA 2A1TS 1QTQA 2CYCA 3CLRD 3CLSD 3HMQA 3AKZA 2EJCA 5J59A 4MUJA 3PNYA 2PIDA 1WKBA 3COVA 2CUZA 4ZCPA 1ZJWA 4X0EA 4MUHA 4MW7A 1TYBE 1T9GS 2WSIA 4ARCA 5K0TA 1R6TA 3NV7A 3A05A 1O94C 3G6KA 4MULA 2E0IA 1NYLA 2GKSA 1OBHA 2NZ2A 2DXIA 1ZH0A 3RFFA 3HZRA 3RJZA 3MUEA 1QRSA 3Q12A 1J1ZA 1I2DA 5LM3A 4NATA 5BNZA 5KHAA 3RBAA 3UK2A 2DR2A 4AS1A 1FFYA 3QTBA 1G8HA 4J76A 1M8JA 1U3CA 1IQUA 3HGMA 3OP1A 1BS2A 3IMEA 3IUEA 4JFAA 1T6ZA 2A86A 5KCMA 4YMIA 1IVSA 2RE8A 3Q4GA 4MAFA 1LI7A 1CT9A 1Y42X 4PBTA 1O95D 2D5BA 4L2IA 1N2EA 3CVXA 3NBKA 4MW1A 3G5AA 1Q11A 3F3MA 3HV0A 4ZT3A 2A1UB 1N2JA 4ZT7A 1IHOA 1KR2A 1OWOA 1I6KA 1WOYA 1MOPA 3H05A 2O8VA 5AHWA 1G8FA 1LW7A 2QUJA 5LFAA 1Q15A 1WXHA 2O5RA 3DPIA 2PZ8A 4PBSA 1F7UA 1WJGA 5DB4A 2VXOA 2CSXA 1EFVA 3P0JA 4EF6A 1H3NA 3IOBA 1MJHA 1OWPA 2WQ7A 2ZUEA 3TQOA 3VU8A 2Z09A 4G5FA 1KH3A 4JZYA 2QJTA 2DERA 3MXTA 4PBRA 1EUYA 2H2AA 2PZAA 1T6YA 2QUKA 4MWBA 3RK0A 1N2IA 2JAXA 1M8KA 2QJFA 1NUSA 3GUZA 1J70A 2I1LA 1MAWA 1HYBA 2A1TR 1JIIA 4YP6A 3FOCA 3UC5A 4KR9A 2DPLA 2E21A 2HGZA 2CV2A 1MB2A 1PFWA 2J08A 4ZT2A 1IRXA 1O0BA 1SURA 2TS1A 3CR8A 1T9GR 1GTSA 1XJQA 3VGJA 3ZXSA 4ZT6A 3UOWA 1YIAA 1G8GA 2J07A 1EE1A 1WXGA 3L92A 3K9WA 4NZPA 4MW9A 1M83A 3IMCA 3TQIA 1T6XA 3ND5A 3ND7A 4G6ZA 3CLTC 4ARIA 2HZ7A 1JEEA 1NI5A 4R2MA 4E1AA 1I6LA 1EFPA 1V8FA 3AL0C 1ULHA 5K0SA 4OJMX 1N78A 3ZJVA 1O94D 4KKVA 3DV2A 3SDBA 4U7JA 1DNPA 1OD6A 2V0CA 3SYTA 2CV1A 4ND7A 3PNVA 3FG9A 4CQNA 4DNXA 3I05A 4PY2A 5FO0A 4R2LA 1WXIA 2VTBA 2IJGX 4KR7A 1VBMA 5HUJA 3ELBA 4A91A 1H3FA 1O0CA 3G59A 3E27A 4ND6A 2H29A 1EFVB 1JMVA 1RQGA 1J21A 1VLHA 1GPMA 4CDMA 4OUDA 5HUHA 1U0BB 3ZXIA 4MW0A 1U7DA 1MB9A 3KT3A 5KWVA 4MWCA 4NAUA 3INNA 4EG4A 1N2BA 3A2KA 2GOYA 2JANA 5TEVA 1KAMA 4MLPA 1VL2A 1GTRA 4EGAA 2J4DA 3H9CA 1NURA 3CVUA 1O97C 3CLUC 3TZLA 5DASA 2PZBA 2QJOA 4F4HA 1JECA 3P0HA 3QE4A 1KP2A 3IDFA 4DE5A 2IP1A 3FY4A 1PFYA 1O96A 2AZXA 4EG7A 1GLNA 3N9IA 3ZJUA 4Q93A 3IVGA 1N2GA 3TNJA 3N8HA 4BWVA 3TS1A 3OTWA 4Q16A 2JA2A 1K92A 5H16A 4S1OA 1WQ4A 3KT6A 3N2YA 2AKEA 4EG1A 1KKUA 1YULA 3D6VA 2CYAA 3U1VA 4G5YA 1WY5A 1K4MA 3LOQA 1EFPB 1PG2A 3X1MA 2BYTA 4MUEA 3KFLA 1WZ2A 3UMVA 4J75A 1H1TA 4MVWA 4RPIA 2NSYA 1JEDA 3COWA 3P0IA 4CDNA 3FIUA 2OQ2A 4U63A 1JHDA 2XRYA 3LCJA 1A8HA 3ISJA 4F3RA 1N1DA 4HJXA 3FDXA 3CVVA 1V47A 3N05A 1O5TA 2BTEA 1OWNA 3AFHA 2X1LA 3PRHA 1D2RA 4CT0A 3CVWA 5IHXA 4H3SA 3SZGA 3H99A 1NUQA 2QTNA 1NSYA 1O95C 1QRUA 1JILA 1MC1A 5F23A 1TQ8A 4DDKA 2X0KA 1IQRA 1ZUNA 1COZA 1UFVA 1OBCA 1H3EA 3JXEA 1J20A 4GRIA 3IOEA 1GN8A 1M8FA 3AG5A 4MUIA 1I6MA 4RUKA 3PXUA 3HL4A 1XNHA 4MUGA 4YP5A 5H7XA 4MQ6A 3ZGZA 3D6UA 4DLPA 3BL5A 3PNBA 1F7VA 4NDAA 4JYZA 2WB2A 1R6UA 2PXHA 1NUUA 3NBAA 3H9BA 4AQ7A 4YP7A 4MW4A 4QRDA 4P2BA 1U3DA 4UZEA 1GAXA 4L2IB 1GZUA 1M1ZA 2A84A 1EUQA 3TZEA 1KQNA 2RD2A 4XSVA 4MUKA 1ILEA 1KP3A 2G36A 1MAUA 4EFKA 4R0NA 3C8ZA 3S3TA 1PG0A 3AIIA 3AG6A 5HG0A 4I6EA 3IMGA 4I6JA 3IVCA 3ZIUA 3X1JA 2A1UA 4JXXA 4DJAA 1QQTA 1OWLA 2A4MA 5FO1A 1TYAE 3FI0A 3FWKA 1IH8A 2GM3A 1XNJA 1J1UA 4KR6A 1VBNA 5LLTA 2Z08A 1QJCA 4MVYA 3MLAA 4EG6A 3IUBA 3M5WA 2EL7A 1NZJA 3ILVA 5FNZA 1G59A 2YXNA 1N2OA 3P52A 4ZCRA 4XFDA 3UY4A 3FETA 4QBTA 1U7XA 1LI5A 3MMXA 1TFUA 1N75A 1XNGA 1KAQA 4KPUA 3GMIA 1VBKA 1YUNA 1JIKA 3A04A 1NUPA 1JZQA 1NUTA 1JZSA 3LE8A 4WNYA 1N2HA 3GLVA 3CLSC
chains in the Genus database with same CATH superfamily
1CWUA 4E07A 3UHFA 2NO7A 2RG7A 3PZBA 5AM1A 2NWQA 5E7MA 4QC2A 1BAPA 5B2ZA 5A4KA 5JFTA 4JN6B 2OQRA 4FCWA 4FEYA 4OBBA 2XMGA 3AVPA 3I34X 4HK4A 4QARA 3BWBA 1V26A 3Q2KA 1NR7A 2QRKA 4LBYA 3U0VA 3ZD6A 3T4UA 1BX1A 1EVYA 1OTHA 2GZ2A 2QB5A 2UUPA 3PTLA 4B8YA 3OU6A 5B58C 4E2XA 1NW7A 4LQCA 2RGXA 2FXIA 4TLDA 2DF8A 2G71A 4OHVA 2XB6A 5TS3A 4FM9A 3QBDA 4ENPA 3G0OA 4F3NA 1P3JA 2G72A 2C95A 4X44A 1ZUIA 2OR3A 2R4TA 4QOFA 1U3UA 4XPIA 3VU9A 1QUFA 2VVTA 1Q50A 4HKTA 4F8EA 2B1GA 1HEUA 3E58A 2J0SA 1V37A 1M2WA 4RS4A 2WAYA 2HFKA 5AVTA 1ESDA 3C7TA 1XLWA 4J7CA 3KDPA 5K4HA 5KVCA 4Q1EA 4X20B 4LOJA 1F4LA 4GMKA 3HHEA 2QRLA 4URWR 3ZTYA 5JG7A 4KIUA 4G0UA 5F64A 1OF1A 3RB8A 4HBZA 4ZYZA 1ABBA 3SZLA 4JOQA 1ZVMA 2R6JA 3GPCA 3QUAA 4LF7B 1DIGA 4CKCA 1JR2A 1N5MA 4BAGA 1UWKA 3R6TA 2Z2XA 1DBWA 1P9RA 1UR5A 3BE4A 3L79A 1DJLA 2P77A 3IVXA 3PFGA 1E9SA 2MIIA 2ZM6B 1NATA 2PSDA 2QRUA 2Z4SA 3BJEA 3HCWA 3JYQA 4EO4A 4GKBA 4LKRA 3EPKA 4D43A 2G1AA 1D09A 5FUQA 2GLXA 1EUDB 4HXEB 1MRZA 2IYTA 4HC4A 1ZH4A 4V03A 1KI2A 5F3DA 5AJHA 3S2GA 3MOGA 3PX2A 4QFDA 1NU8A 2ZYGA 1XXHA 3NVKI 2QD2A 1JB1A 3F6BX 4NCHA 4TV8F 1KKMA 5DRTA 5E1DA 5KKCA 2H2FA 1KC3A 2OGSA 2GZSA 2HSZA 4QYMA 3QIAA 3SKXA 5LNK6 3ZWKA 3DQPA 2OPBA 3IR6A 4M87A 2JNWA 4J1TA 4LVOA 3KJEA 3PITA 4GLJA 4ZOLB 2DP4E 2O3UA 2EFHB 4EMSA 1TUBB 3DQZA 3II6X 4RIHA 2Z6AA 3S2SA 1LLFA 3QE3A 4S1VA 3A11A 2MTBA 3HFJA 2AMYA 5LDDC 2YUIA 2QSJA 3ZY3A 5KNCA 3O1HB 2BKVA 3KTDA 2H3EA 3RV3A 3WGIA 1TCCA 2YY5A 4JLMA 1G0OA 1WB6A 1K8ZB 1C3OA 4RJIA 3EA0A 1KYTA 5EP4A 4CTMA 4DGSA 5L3QA 3VJRA 1T24A 2VOEA 1AQUA 4YGXB 3NX4A 4UJ3A 4NZMA 4D9HA 4E5NA 2VJMB 1DV1A 4V0NA 4MR7B 4WNAA 5J4HA 2MHCA 4MV5A 2WUVA 4ENTA 2B7LA 2OBFA 1OVGA 2PX0A 2WJ6A 1LSOA 1YRLA 4ZTZB 2XYRA 3GLHB 2HTEA 3TD9A 4DV4B 4UHJA 1FDTA 1KU0A 1S2NA 2GFHA 3QLVA 5DGDA 4GRAA 3DOIA 4RVSA 3HP1A 4OB8A 3F4BA 1WZEA 1UWLA 2QDKA 3QVMA 4QUHA 2VHQA 4TUYB 2W6IA 4Y9TA 3ZY2A 3IP6A 1QNFA 3BUSA 1A2QA 4K26A 2J5XA 3FNQA 4X91A 2J48A 4K9QA 5IJWA 2PRJA 1ZVKA 1DG9A 4QPDA 4R1MA 4WESB 4XJVA 3B9PA 1Y4SA 4C08A 1C5KA 4TMWA 2NZUG 2CXOA 2R84A 1NGSA 3OPNA 4E30A 3R9WA 1Z7EA 1FSFA 2HY7A 1OYYA 1ZC4A 1HE8B 2FJUA 1HO3A 2PX4A 3G0BA 1F6WA 4P82A 5H68A 2NU9B 1JA1A 1NMZA 2VEDA 1NAIA 4OLHA 2N1MA 3WV5A 4EA6A 3LX8A 4KXNA 1W5EA 4AO8A 2YZNA 2ZJBA 3V4PB 3BFPA 3UWKA 1EFCA 1FU4A 3WKEA 1OIWA 3UKDA 2OYRA 2RMKA 4FCCA 4WA8A 4ACAA 4XX1A 2DXIA 2ZJ3A 3F8SA 1UJBA 4PAWA 2L17A 3N0RA 1U3WA 3AUTA 2BTQB 2Q8PA 1EWVA 3AVOA 3DYBA 4MO9A 4WHMA 4FXPA 3H2HA 4AQYB 3UT0A 3WO0A 2P75A 4UFOA 4ADSG 4K7JA 4YRKA 2L2QA 5K3SA 4GL4A 1GYPA 4BP1A 2WD8A 5GV7A 3UJCA 3MA0A 5EKSA 3UA3A 2V1XA 3E7DA 4NU0A 4RD2A 3A4NA 1NP3A 4LZNA 4AO7A 4D3FA 1DHTA 3IAEA 4N40A 1MRNA 2WNSA 3UWDA 2HLDA 4QBKA 3NASA 4IV5A 5TY0A 4ZYXA 2VYVD 2AH5A 5JZSA 4GO1A 5DFAA 5TXGA 5KB3A 1XA3A 1ZQ1A 3DNFA 5BW5A 5EIEA 2BUBA 2I55A 1YB6A 3HCRA 5BSGA 4P36A 4C0KA 3U44B 3BTSA 4PAOA 1O4VA 2ZIWB 3PQFA 5ADHA 4RTNA 4R81A 2E82A 1C0KA 2DKOA 3VR3A 3EGWA 4EB3A 3WZLA 3CEJA 3VUEA 1SVIA 2WC1A 3MOIA 3PXAA 2XD9A 4NZNA 4HEA1 4TKMA 4XH9B 5IMBA 3TB4A 3ZU6A 4CLOA 1NDUA 2G9RA 4PO8A 4G36A 1VIDA 3H83A 2AN5A 2I9PA 3G8CA 3RS8A 1E3EA 4BHTA 3DVRX 2F3RA 1L3BA 4JT9A 4CG1A 2JJ1D 2ZSIA 4P3KA 4KE6A 2CSUA 3OD5A 1QFYA 3ZGNA 1UIMA 1E61A 5FQNA 3BDIA 4AG5A 3JPYA 4QATA 4X1IB 3JATA 3MRSA 2CLCX 1FP6A 3MJHA 4JLUA 3VDNB 1I0LA 1KU6A 1VG8A 3G2KA 4AJ9A 3ER9A 4DB4A 5A3QA 1QHHA 3MOSA 5FB3A 3UUGA 4BBPA 1QMPA 5DCLA 4C6TB 4ND5A 3M4ZA 1FDVA 3G2LA 3H04A 4G56A 3L6BA 3OD1A 3R4CA 4IVPA 1I4DD 1U9IA 1RCUA 2G4CA 4I4CA 5I8ZA 4B73A 2QYSA 2QUKA 3DXZA 5L95A 3C1UA 3DXFA 4HRXA 2WDPA 4LHYA 4WKOA 3WO1A 5KINB 4YWHA 4ZCIA 1U9ZA 2EQBA 3OIYA 3H6HA 5BVGA 4AY4A 5JHHB 1HYBA 4EKNB 4TZKA 2HKIA 1JIIA 4YP6A 4EABA 2Z2IA 3BWMA 2QM7A 2B20A 3S68A 1NW8A 1GYRA 3AK4A 3GGOA 1EWQA 3ZWWA 1GU1A 1U3TA 3DUWA 3DHNA 1KOJA 2GHRA 3PKJA 3Q7PA 1BCRB 1G3RA 1RCTE 3F78A 3CB2A 4J29A 4PLWA 2AOUB 3B5EA 3X0DA 4QOIA 3P9NA 4IVQA 4UCQA 4GKJB 4QDZA 2PLAA 4RF5A 2BKUA 4N7RA 1T3ZA 4NAVA 3T15A 1SRQA 2J07A 3AHDA 2IIPA 1WXGA 4FI3C 3D6FA 2GVZC 3NNSA 4AG6A 2D3WA 5IDYA 3TZ6A 1LPBB 4RKQA 4ZALA 4LUCA 5TB5A 2QWXA 6ABPA 1UQTA 3C7KA 3DONA 1CJMA 2VRNA 3VAYA 3LA8A 4W5WA 3RVJA 4A36A 2A5FA 1JMYA 1EFPA 3QUQA 3VR6A 5E6RA 4CM9A 1O94D 4KKVA 4YRRA 3FPCA 2JFZA 5FDFA 2H4HA 1E3DA 3PB3A 2H59A 2YJNA 3K0HA 3PGA1 5AI9A 3TPFA 3IV9A 4FVTA 4ND7A 3T35A 4R8SA 3QRWA 4RHXA 3GMDA 5THQA 1Z7YA 1KC1A 1DKPA 3Q9LA 5EIFA 5EZ5A 1HE1C 3URKA 2B78A 1UMBB 1BA2A 2P3SA 1N1MA 1BHO1 1E6WA 4U9UA 1Y4AE 4B2PA 3A2LA 5HKAA 1H3FA 1E0DA 2DC1A 3WQBA 2CHEA 2IZ7A 2RHJA 2ZJYA 3KD3A 3L1JA 2BFEB 1EFVB 3JD3A 4Y1FA 5ICSA 4JQYA 3HADA 3MWDB 3O8CA 4GR5A 3EXHB 2OEPA 1WL8A 1A71A 4O02B 1N9KA 4OVKA 4MW0A 1XPOA 3DMRA 3OY2A 3P9QA 1XAHA 5IBRA 2AKYA 1F51E 4B44A 1NONA 1IMOA 1A9PA 2ZE7A 4PR3A 1KQ3A 5LJIA 5BUSA 1AQLA 3GHHA 5JWRA 2A3NA 1MO3A 1Y9JA 2Y9PB 1I6WA 3O21A 5L3QB 3HUFA 3C8UA 4II3A 4O4HB 3WIOA 5AJTA 4RXMA 4KQMA 4DSZA 1DWUA 1G5HA 5IJ9B 3P0HA 4KYVA 1UC5B 4OBXA 1ECCA 1XK6A 4KQKA 3GLIE 1M7BA 1VHQA 2WEKA 4NBUA 4QO7A 1O4WA 3ESRA 4Q4AA 1GVNB 1ZGCA 1MJFA 3LHFA 3DFFA 4G84A 2JIZD 3K5IA 4YV2A 1CDOA 2FDCA 3CR7A 1I2MA 4KSBA 1G2OA 3GEGA 1H8HA 4JBNA 4EHAA 2VXYA 2D4AA 1U0NA 3N8HA 2BJWA 4ZMSA 1PK9A 3ETJA 5AIAA 2AZDA 4D98A 1YB2A 1S8AA 3FPGA 4BQOA 3PCTA 1R6BX 1ODJA 5DNDA 1U2SA 2JA2A 5ALUA 3T0FA 1VRVA 4NBNA 1JQLB 3N5KA 1S2MA 1LBTA 3AR3A 2BGMA 4L0QA 1VG0B 2JFNA 3KT6A 4YROA 3BORA 3VJLA 5BOSB 1BFKA 2XQIA 4MHSA 5ITWA 3TQSA 3MCWA 5IDXA 3IB3A 3D3JA 1VE1A 3ZXUB 2V8OA 4GP6A 1KY5A 2HHCA 3Q6NA 3PUWA 1K08A 3QVTA 3KR9A 2ZYAA 1MO5A 2BYTA 4F8JA 1AKUA 1XB2A 2I62A 4HLUC 3GJYA 2H7YA 1MTZA 1M1NB 3DBHB 3GG9A 3GFRA 1JQ5A 2VATA 2WZDA 3E1SA 3OCVA 1FYEA 2CVQA 1LC3A 2CVZA 2GNPA 2VKQA 3CFYA 1MO6A 1A8HA 2PMFA 1KDZA 3AT1A 5HPYB 3GDWA 1YZ3A 3FDXA 3S44A 4EDHA 1VPEA 4HFMA 4ZXFA 3AI7A 1OWNA 5A2GA 4Z9YA 1SUDA 4WBNA 2EKBA 1SG9A 3L8DA 2I4MA 1WDKA 4U2KA 3CH6A 5DM0A 5F7JA 3ME5A 1NPYA 4BFYA 5JJBA 5K5EA 5EHIA 3E70C 1BEUB 1RTTA 2C61A 2CVOA 2N1BA 2WAXA 3HWSA 2CHGA 3JQ9A 4R40A 5LA6B 1WPRA 3OF3A 4OQNA 4U0JA 4QJIA 3V55A 1VYTA 3EY4A 3KU4A 4RACA 4HMQA 4ME6A 1CHDA 4IJMA 3X3HA 2VUUA 3L04A 1O3YA 4Y2QA 3OJOA 5FPHA 2DQSA 2VDLB 3RYHB 3R6GA 5TMBA 2HK6A 3AERB 2Y2UA 5EE9A 4GX5A 3PDWA 2KE5A 4KO8A 4UPDA 3T94A 2Y0BA 3DB1A 3RAJA 4AKHA 4FUQA 2CL0X 1QHYA 3V6LA 1F7VA 4R5MA 3FWNA 1PL7A 1FA9A 2GHQA 3RKSA 1BKDR 1RYFA 2UZAA 4YP7A 4C0WA 2CCJA 3D7SA 1LK0A 1PQ4A 5C5DA 3I6ZA 5IAAA 3IT2A 2JI4A 3HN2A 3L1KA 4QXAA 4RELA 2QV7A 4RX1A 1JLHA 3UM9A 2X58A 2FPPB 3WTCA 3KWMA 3ZHOA 4WCFA 5I7FA 2APJA 1TU4A 3DA8A 4MA4A 1MV8A 3GJ4A 4HWOA 1L5YA 4UNIA 4PRLA 2PJDA 1UZNA 1L5QA 3D3NA 1AF4A 3LKBA 2JLXA 1TCUA 4AY3A 1RKQA 3O8QB 4I6EA 4U00A 3GP3A 3L8HA 4U7GA 1KMMA 1IMJA 1THTA 4JI4B 5KJEA 1ZGBA 2ON6A 3GAFA 1ZDMA 4V0ME 2LP4Y 1J5PA 2IHNA 8MHTA 4NBLA 5KTTA 1JBKA 4I4TF 5DXFA 4DA4A 4PR0A 2OUKA 3V46A 1TZKA 3ZHRA 3FYUB 3FI0A 4J7XA 5ULLA 4BFZA 3QMVA 2CNOA 4HWKA 4LOIA 3IIKA 1VBNA 4CEIB 1X13A 2V6BA 4W9MC 1M76A 3M6IA 3AWIA 5LP1A 2GK3A 3DG9A 4RO0A 4B3JA 4UW9A 1SWVA 3IUBA 3DLCA 1XTSA 3TAXA 4OHPA 1QQ7A 2HJGA 3EOZA 3FE2A 4B4KA 3U4GA 2IKQA 3EISA 3FETA 4C3OB 5BV8A 1OFTA 1P5RA 1WSWA 3NOQA 4OFBA 1NSFA 5FBHA 1G7TA 2HNKA 3BGVA 3JARB 1B8VA 5CLIA 2C78A 5D51S 2VF4X 3FHTA 5K51A 4RVCA 1D0SA 4TS3A 5LZ4A 3UW3A 1R4MB 1HMPA 1VL8A 2JKYA 4I0WB 3CRNA 2AHOA 2WPNA 4S1WA 3HNPA 5EUQB 3ZHSA 4A03A 4CMIA 1K98A 5TV2A 5BMVF 1AKYA 1B41A 1MJNA 2YYAA 5D8DA 4DUZB 1EX9A 1P2TA 3ZVMA 4U6QA 4KQFA 5KDDA 4QVIA 5JJIA 4FHZA 1U7OA 2O57A 1HUQA 4DT1A 4JXKA 2ZB4A 1Y48E 3E5RA 5GVSA 1QLHA 2H31A 3CM0A 3S27A 5J58A 2PSSA 5FAKA 4F38A 4CFZA 4QJBA 5BY2A 5IBPA 3DR5A 1NPTO 3RSQA 3WZ2A 2J30A 5IANA 2D7DA 3LKVA 3D4OA 4IV8A 3QU9A 4PX5A 4E5MA 2IYNA 5FJJA 4WCDA 1PD1A 3JASB 1SVNA 2QM3A 4RDIA 4KJZA 1TT5A 5A9TA 4XLZA 1CR2A 1PJQA 3CY6A 4EPWA 2XQKA 2YBEA 1HFWA 1T0UA 3V33A 5AXCA 1E3SA 1U9CA 3TEJA 4OHBA 1NVTA 4Q4HB 5I7SA 1G8AA 2VP9A 1ZH6A 4HO1X 2WTNA 3GVXA 2EQAA 1YI8A 3W2GA 2F9FA 2D4HA 1KORA 3KYIB 4IX9A 5I4BA 2CZGA 3DTVA 3QKWA 3UKJA 1KQOA 3AR8A 1V8BA 1CQZA 2BF7A 2FR1A 1HT2E 2Q2WA 2I78A 4FFRA 4Y8VA 5C46F 5HJEA 1N8KA 1Y7PA 5AKLA 2ZUVA 1MN6A 5JBQA 1P7PA 3RUDA 4DR3B 3TCKA 2J3IA 2DQZA 2GCOA 2PX2A 3LFUA 2ATXA 4K0RA 4R1TA 1FXWF 1WBBA 3OE4A 1E3WB 3FCOA 4B3BA 4JUFA 3NKVA 4YTEA 5JW6A 1KGDA 1X7YB 1E5XA 2HEGA 1FP4B 1IDN1 2BMAA 2Z4TA 4QUKA 3HWX1 4CEHB 5H9VA 4NY1A 1IB0A 2O0LA 1JTFA 1Y98A 1G8PA 2Y1KA 2H1LA 2PH5A 2QGZA 5T41A 4B46A 4DV5B 2BFPA 2GPWA 2TRSB 1RHUA 2QY9A 2WHPB 5JY1A 3W34A 2DHDA 3BXXA 2HPVA 2VH2A 3OA0A 4DA0A 4ZCTA 2QTRA 3NBXX 4DCPA 5DKFA 3RODA 3SJAA 1YQDA 1GWNA 4ZVTA 4LXGA 3M4JA 2I87A 4HDKB 4HN2A 4I50F 2HZBA 3ZH2A 3VHXA 2VJQA 4DLYA 1L5SA 1R88A 1GRRA 1HQDA 5FWDA 2G80A 2G1JA 2ZVQX 4ER7A 3A4VA 4G4SP 4O1IA 5DBHX 2CK3D 3H7AA 3GNLA 4NARA 5AOAA 3QX9A 4WEQA 3DNPA 1PE0A 2CBGA 3R2JA 1CUCA 3RVRA 4W1RA 4E0BA 3RKUA 1YRWA 3PE6A 3SXUB 1LVUA 1QSGA 3F98A 3FDJA 1WCWA 3AJEA 3O3CA 5DCYA 3L6EA 3ZKWB 5HW0A 2ETXA 3FOFC 1SY7A 2WIBA 2J3MA 1VSTA 4MS1B 3P2MA 1Y6JA 2OLEA 4LMRA 1N36B 1C30B 1SVLA 5JATA 5I3CA 1JHMA 4LA4A 4Q7MB 4DM4A 1L4HA 2Q5OA 4NXMB 4DSNA 3FJ1A 3A31A 3D0RA 4EUSA 4A0FA 1W5TA 5HQ3B 2E1RA 1Q0LA 2NUBA 1P0CA 3AH8A 5EERA 4KG7A 5LBUA 1KO5A 5BPHA 4OHRA 4FEEA 2DETA 3C2QA 4Y1GA 3D7KA 1KEUA 4EYSA 2P0EA 2VG8A 3COZA 2KM1A 2PN1A 2QAJA 3OFND 2Y93A 5JVDF 3GNTA 2OFFA 4NR0A 4UUNA 3KQHA 5K3DA 4BDTA 2PYDA 3UH1A 5LQCA 5ES4B 4LNUB 3EZ9A 2FMUA 2XPCA 3SC4A 5EJ4A 3EDQA 5JPCA 4Q5IA 4JUBA 5K3EA 3CUWA 1OIVA 4QYXA 1Y8CA 3LDHA 1JQBA 3AEXA 4I3FA 3VO1A 5C8ZA 1UZUA 4BFXA 1WQ1R 2GRJA 1YBMA 3HBNA 4G5HA 1YFZA 4LHEA 5LB2A 5SZJA 1D2NA 3RRFA 3S2ZA 4XPZA 1ZITA 2BLNA 1PJCA 5HK9A 3P5SA 4X5OA 4RHUA 1CQPA 3OY7A 1PN3A 4JBXA 5K3FA 5AFSA 3U4QA 1EWTA 5F1OA 1U7ZA 2PGXA 1FFHA 2FWIA 2GJ9A 3X2FA 5K0CA 2LCQA 3GEMA 3OWOA 5KTKA 2ZXUA 5K2OA 4PCLA 2AG5A 1A95A 3KZCA 4A3SA 4DY6A 1U8AA 5DLEA 1CJTC 2AMFA 4KEAA 3ZWMA 5DBFA 5L9AA 3IRVA 3B60A 2GXUA 3EOBI 1O94C 1KSHA 1LLQA 1GDHA 3DGEC 2BEJA 1J2YA 2HJ9A 1VJCA 2Q8QA 1KFCB 4NRDA 2C7RA 1U7PA 2C07A 1UZLA 2JFYA 3EGXB 2AYYA 3KALA 1AURA 4I8IA 4TVBA 4D8VA 1TYZA 3DEHA 2BM8A 2YXPX 2EC5A 3GJ8A 3OLVA 4NS4A 3RS7A 5LSAA 1ZBQA 3A26A 4DM3A 4NATA 5ELLA 2IHVA 3E82A 3LWZA 1Z08A 2VHJA 1YQXA 5HZHA 2PQ2A 1O9GA 1K5HA 2DSTA 3QTBA 4RE6A 3S1AA 3NUZA 3CJQA 2G8LA 4M7PA 4HMPA 3COSA 4MRMB 1RAHA 2IVZA 1LKZA 2WUDA 3KCQA 4Z9XA 5FFFA 3TX2A 1UDBA 5CTJA 1QDEA 3IUEA 4BCCA 1U8XX 2YBDA 4AUKA 5I4CA 2W2KB 4DSAA 4DS3A 1W6RA 1F0PA 4MAFA 1P31A 4PN7A 3HH8A 1Z62A 3PFNA 2QQFA 4HNQA 4OCZA 3NTLA 1FLAA 1GR0A 1JQ3A 2O9JA 5A7HA 4Q39A 5KNBD 1Y5RA 1FZTA 4IWXA 1OH7A 4L8WB 5ENVA 1CTQA 2IA5A 3EAFA 2C5HA 1A7KA 1ZG3A 5C1OA 5FH9A 3RFVA 3AETB 1T3TA 3HKEA 1WBDA 1WUKS 2WJYA 1E9RA 4HZIA 1MC4A 5EJIA 4AN1A 3T1YB 1SBHA 4YCSA 4B3TB 1VE6A 1MT3A 1K3FA 3CWZA 1YZVA 2I2XB 1CZLA 2XITA 3T9CA 4EARA 4RZUA 2O5EA 5CYFA 1G20B 1UKBA 3BC1A 2ATEA 3G85A 3GOHA 3ROKA 4E14A 1DAOA 4OHKA 3NYWA 1RPAA 3SLGA 2YV3A 1WXHA 1XQYA 1SAYA 4RIFA 5FHQA 1ZJ4A 1JP7A 2FWBA 3EXHC 4YI3A 3TOVA 2WMOB 2QAGA 4KN9S 3EGCA 3P0JA 1RYEA 3NWEA 4B7CA 1ZN2A 3W8RA 2XVAA 3ZK7A 3PNKA 2ZM5A 3D2CA 3KQYA 4FU0A 1QG0A 3DM5A 1UMCA 2YNMD 2Z09A 1SJ9A 4BN4A 5KJCA 3RSLA 3T0IA 4UUQA 4MV7A 4BX2A 2HW8A 3EXEB 4MLZA 5CVCA 3KLMX 1AK9A 3CXUA 3N5CA 2CXTA 3M6XA 3ZHYA 3GNQA 3HCFA 1R3UA 1O7JA 1V16B 2RJ3A 3D0QA 4Q4DA 4QDKA 3RS4A 3TR0A 1P2VA 1X86B 4FKZA 5CIQA 2IZ5A 1ELOA 2C5AA 1H9AA 2Y76A 4HMOA 4QODA 5EKUA 4EOGA 1GSOA 2GN8A 5A5EA 4ZKDA 2C1ZA 2AX4A 1M33A 4DIOA 3DDOA 2F43A 3NLLA 2IHUA 5L45A 4HH4A 5EA2A 4OBWA 3OMWA 5EAIA 2C4TA 3A4TA 4DPLA 1Z9BA 3ZBPA 5DM70 4MVJA 3VKWA 2OXCA 2XNSA 3W5AA 4DFDA 1LLCA 2H5LA 1JG6A 2XZTA 3EQ7A 3VGJA 2C99A 3ONWA 3ZXSA 3U1BA 3CZCA 1N3IA 1YI0A 2AN9A 2XDWA 1MOQA 1UC9A 2ZRKA 3ESBA 1HI9A 5E9JA 4YREA 2PUVA 2EP8A 3G2JA 2Q1TA 5ANRB 2JLUA 4CEJB 1NTRA 3RU3A 4RPLA 3ZZMA 7REQA 4GDMA 5F5NA 3O2JA 5JLAA 3QFSA 3O7WA 3DYIA 3MSXA 5D00A 1UFKA 1V8FA 5LOVB 5A6SA 1WWKA 2YS7A 4J0HA 1U2RA 1Q7TA 4S1NA 2H8GA 4S3MA 1D6JA 4CL2A 2IYVA 2QG9A 2W6JA 2V0CA 5JZ9A 2YZ2A 2JFFA 2IRWA 3AOEA 1E6UA 3FGZA 4RLFA 5M3BA 2ZWVA 3M82A 3PS9A 3WWZA 3USES 2RI1A 3FIJA 1XK7A 1TJPB 4IF4A 2QM8A 4LAFA 3R7WA 3E5MA 3I6MA 5JO9A 3GUHA 1ZRMA 1L5MA 1SEPA 3AM1A 1G4HA 3JQFC 2ZJ6A 1S1MA 3NGLA 3GQVA 4LV5B 4R69A 4DSOA 5DSTA 4E5PA 1YSCA 3GLFB 4MV0A 2WIKA 2R8PA 1XJ5A 2WRZA 1YH3A 1E2NA 1SIOA 5GINE 1V4VA 1QZTA 4JFRA 4HDRA 1BHQ1 3NDBB 5GADl 1CKEA 2ZAIA 1DAPA 1PSWA 5CH5A 4UXHA 3DBRB 2ZAGA 3I2KA 4LISA 2Q3HA 2X5JO 2QN8A 4LW8A 1U4OA 4OQLA 3GD5A 3KOOA 1BJTA 1VL2A 2FPOA 5TQ0B 1TE2A 2JI9A 4J49A 1OX6A 3DH0A 5EZQA 3LK6A 3CLUC 3QWFA 3KLNA 3JQGB 4MPDA 3FOBA 3NJRA 2ODNA 3VR2D 2I2CA 4M6WA 5ALKA 4G85A 3JAKA 3OAAA 1A5AB 1QRRA 4J07A 5B1YA 3GRRA 3H5AA 4BQFA 3HJGA 5HIJA 3DWGA 4JYAB 3L41A 3AUYA 4CNQA 3F5SA 1V11B 4EKEA 4RQAA 1N2GA 5LDGA 1R0CA 4GYJA 1P6QA 4B85A 1WZCA 3I04A 3QLEA 2E4ZA 1ILWA 4D3DA 1H23A 1E2EA 2BRUC 3OCZA 1PVVA 2RSLA 4QQ8A 3MC1A 1JAHA 4JP1A 1DBPA 2Y0EA 4NVRA 4Y2PA 4TKZA 3N2YA 1V5IA 1SU8A 5A4IS 2AGVA 4ZVMA 2W8BA 3M0EA 4E15A 4PO1A 4I1PA 2YXEA 1OLUA 5COBA 1OV6A 2VSYA 5P21A 1NVFA 1ZZGA 4OQMA 4EUHA 1TZ2A 1XF1A 1MQ8B 4QVGA 1WZ2A 2PXAA 4WN9B 5DHQA 4LGMA 1T2NA 2CUTA 3H9QA 3O8OB 3Q5EA 3LC0A 1D7AA 1GGKA 2NSYA 2ZRDA 1L1RA 5FYQA 4FDUA 3KKLA 5ILOA 3G23A 3LCJA 1M0EA 4LJLA 2XMDA 2ZWAA 3EQ2A 5TGDA 1X0XA 1P7CA 2FSFA 5A6VA 6REQB 2EARA 1KQFA 3BHIA 3CU5A 3TFOA 1HKHA 5JS8A 3HI6A 3MB5A 4JKIA 3QFRA 2C4WA 1MIOA 2FZWA 1NQTA 1M10A 3AUAA 3QELB 4DADA 4M49A 5JAQA 1AKQA 1DQNA 2QW1A 4PNEA 2K5UA 2AI1A 3QLUA 5AT1A 3UN1A 1UFQA 1RLIA 1OX4A 3ETLA 4CKWB 2QE6A 4ETNA 3G17A 1QRUA 2JAQA 3GCDA 2B3TA 1YZYA 5FIUA 4I1YA 5H59A 3IUPA 3V7FA 5BV7A 1XKQA 3PNPA 3QSGA 4FBGA 4DREA 4US0R 1HWYA 2H7XA 4X3PA 5JXIA 4KV9A 1V5WA 1ZOPA 4D79A 1H1LB 2IOFA 4EHFA 1HRDA 5KSYA 1DS6A 3UH0A 4QTXA 3C3JA 5REQB 2YFQA 1M8FA 2YQ5A 2CJXA 1RM0A 2PWZA 5TT0A 4TTVA 3VYRB 5LXTA 1O5IA 1Z5GA 3BB1A 3C3XA 1T4CA 1XNHA 4KDCA 4LYYA 4RHTA 3AW9A 4ZVNA 5K0EA 1FNDA 3LP5A 3FW1A 4TVOA 3HBFA 3A1CA 4EQ6B 1XMOB 3B8HA 1QH0A 1LB1B 3E9MA 4IQFA 5ICCA 1M9NA 1OI7A 3LGAA 3PGMA 4GXTA 4JR2A 2WB2A 2J1LA 221PA 4AJ1A 1RRPA 3ZU4A 1TC1A 1CDDA 1XKTA 2XMCA 3KPVA 4HVAA 4Q3AA 4J4HA 4ZOAA 5JDIC 1ODSA 5E0KB 3SMVA 3MJEA 3OC6A 3K9NA 1U3DA 4XYBA 1QS0A 2I66A 4UZEA 3RVLA 4L2IB 4XR9A 1ZGAA 5T6MA 5FOXA 1XO1A 1N7JA 5BORA 1SD2A 3EXG2 3B13B 4YRBA 2OBLA 1JVSA 5CU7A 2CVFA 2CXXA 4RFSB 4RTRA 2W2LD 4RTMA 4MROA 3LECA 1MAUA 2I4RA 3HB0A 3LT1A 4OJKA 3QENA 3KR2A 3SQDA 4WJLA 2KQUA 2P1RA 2VP5A 4LY0A 1PQYA 3DUFA 3RJ9A 4XM0A 4EITA 3X1JA 3PEYA 2HHJA 3FZGA 1Z6GA 4XVQA 4FOTA 4HUQA 4JXXA 3LYUA 4KQ2A 4CVNA 4BVKA 1YJXA 4PYKA 4O6VA 3FXAA 5EZYA 5JH7A 2JJ2D 3FWKA 3GRZA 4HX2A 5E9QA 4RV4A 1K0UA 4GMDA 1IZ9A 4HSGA 1LQ2A 4P86A 1YBFA 2D7JA 3HCEA 5L3SA 4KU4A 4BMDA 3QVLA 5ECDA 1IY0A 2ZYUX 3H1PA 1DFHA 2IX9A 4JI5B 3ILVA 4MS4A 3QVXA 2JIOA 3EBOA 4MYSA 3ADKA 2JBAB 1Z4PX 4ZCRA 1XDWA 2FPGA 3HUEA 3LYHA 4IJKA 1I13A 1V4BA 2TSYB 3A0RB 4J43A 4QTTB 5D6OA 4UFNA 5F52A 1TZCA 2WABA 1LBIA 1A9YA 1LI5A 2O4CA 3GQBA 4C3UA 2P4QA 4P0PB 4INOA 2VP6A 4FZ5A 2GXAA 1SBZA 2BFOA 3O1LA 4HZGA 2XMSA 2ZI6A 1N6HA 5HZMA 1KAGA 1SB8A 3EIUA 4E09A 5A04A 1JZQA 1T1EA 3ER8A 3ESCA 3TKYA 4H18A 4YRDA 1KJNA 3PJDA 3MT9A 1N2HA 4KLAA 1WUJS 2ZPTX 4JI1B 2Y1DA 3MHTA 3KBBA 1DEKA 1KYVA 2X8BA 3LLSA 1Z0UA 1XWWA 5CT4A 3OCYA 4KK3A 5CBKA 1XQ9A 3MPOA 2VA8A 3INTA 4IDHA 4XYMA 2BL4A 1GZ5A 2EP5A 4GW3A 5D84A 4FYYA 2VP3A 1M1YB 3L8CA 2PLRA 4DA7A 3PUZA 1ZISA 5A3RA 3OM0A 1Q0RA 3PFIA 3Q1KA 1UKAA 2YASA 3H87A 3IRUA 4RORA 2PMEA 3WNVA 1E1QD 2OO7A 2XTZA 3C4JA 4K03A 2GPTA 5DLYA 4B6SA 3MTQA 1FX0B 2XUJA 3WMRA 1ICIA 4OYLA 3K09A 1E66A 3K4HA 2NAPA 2PGAA 2VPIA 1HTWA 3QOYA 1UT8A 4XW2A 3ICQB 1SUEA 3WHIA 2UYCA 1Z5NA 1C0PA 4BUCA 3MTJA 2PUFA 5FUXA 1E98A 4RD6A 4D9KA 4LMPA 3I52A 4WECA 4NPHA 4IXDA 5KNBH 3GCGA 1T9CA 1ML3A 4TLMB 3DVAA 5DP1A 5FWXB 2ZVDA 3PSAA 1CYDA 2OXFA 4ARZA 4YAGA 5KDOA 4X66B 1P1JA 1RZVA 3CURA 4H7FA 4OREX 1N3BA 1IK6A 2PXCA 2Z57A 3SSAA 2G77B 2GN6A 1U8CB 1JXMA 2NU8B 3QBEA 4D8UA 1XN4A 3ZWOA 4FYMA 3H5OA 1OCEA 2DUWA 1ZOLA 4UPVA 1AZTA 1M2KA 2Z2YA 1MXFA 2X40A 4OXIA 5K3AA 1NBOA 2YJZA 4KO3S 5FOQA 5EIAA 4A6XA 5ALPA 3E1GA 4GBGA 1HFKA 3DR3A 1QRTA 3A3OA 4FSDA 3ZDYB 3G79A 3H5NA 1QYIA 3K3PA 5DGIA 4D42A 1Y8ZA 1GUAA 4HPWA 1KFJB 1AHIA 2D0IA 5HR5A 3ZI0A 3Q8KA 4GI7A 1ULBA 3T61A 3ANNA 4WI1A 4HZUA 3V34A 1BMQA 2R7KA 3ZWNA 3A1SA 2F55A 2P65A 4F3YA 3COYA 1Z29A 1U6KA 3IBSA 3AEUA 2XVYA 4OM8A 2JD1A 2RKWA 4YQFA 4JIGA 4C07A 3E0XA 2ZJ4A 3LPLA 4C14A 4FB4A 3GJXC 3VHRA 2IKSA 4HNVA 3LY7A 4CKZA 4MB6A 1Z13A 2YZKA 4I55B 2BLLA 2O7VA 2YNMC 4ZZ0A 1FBTA 4DCJA 4Y2VA 2J6HA 4D5EA 2FRDA 4UMVA 1GCOA 3BWCA 2I3GA 3MJSA 4JC5A 4JSRA 3TUIC 5CAEB 4HXGA 4RD3A 3UB3A 3WLRA 5B55A 1XFAA 1CIPA 1ZMOA 4TV8B 5DM60 1O6BA 3SY8A 1OLSB 4YDQA 2RBKA 4HFRA 1MBZA 1FSGA 2H4ZA 4WZ6A 5ESWA 2IF0A 1VDMA 1Z47A 4M38A 1GT91 2MINB 2IXGA 1RKVA 3IT1A 2AOTA 1I80A 1JLSA 2QU8A 3I0MA 4UNQA 2J32A 4AKEA 1DINA 3I3SR 4DC9A 3K6SB 4L5JA 1FFBA 1P61B 1USUA 3MW8A 3JZFA 4PRKA 1U3FA 3A4YA 4DIBA 2IYAA 3G88A 3QV1A 3NMUF 2D13A 4H6XA 4QOHA 4MCIA 1G2PA 1YVEI 4DMLA 5FPKA 3ZLBA 3KOYA 4J7UA 4MLDA 2JLSA 4LE0A 5EEGA 4ALLA 3U7FB 1O54A 2D54A 4TKVA 2XOKA 3FCSB 5EP1A 1YQTA 3CLRD 3MBIA 2RGCA 3GZTB 2VHCA 2M6KA 1W9MA 3I92A 4X94A 3WHPA 4L75A 4R1PA 4RA6B 3JWJA 4OTZA 1H22A 3THRA 1KOFA 1AQIA 1TQ2A 4O2LA 5AVXA 3E3OA 1ZINA 4HB3A 1V6SA 3CJTA 3CUEF 3IDQA 3PGLA 1TLLA 4LBWA 4K5QA 4UHDA 1JJAA 4OGKA 5K0TA 3EIHA 3KC2A 1DWQA 1U0JA 4CQMB 3D7MA 1IHUA 1PQWA 2R68A 5JNUA 1L4FA 2I67A 2QLFA 4RV9A 2NZ2A 4EI2A 4Z1OA 4LNAA 2C3PA 4BMZA 2FMXA 2OXRA 1RU3A 4XJTA 1ZH8A 1DC7A 4OQZA 2M2IA 3KTAA 1JTEA 2WMNB 4DQDA 4YCLA 5K0ZA 2CJWA 5AOBA 1ZW1A 4QDXA 2P62A 2UXDB 1GSIA 4P4LA 3N59A 1DMSA 4FUTA 1D2MA 1FTNA 2ZYHA 3RBAA 3UK2A 3UA4A 5HIKA 1Q84A 3WAJA 1KJZA 1J8VA 1FMJA 4QYSA 1E9DA 5AW1A 1GCGA 1U3CA 3E2IA 2RB4A 2J9FB 4IMJB 5JD6A 4P3PA 4MLCA 5CLQA 5SZHB 4RNCA 4CN9A 5CDSA 2HQBA 4TWIA 2C92A 3I2YX 4L16A 5A71A 1HFJA 4JSYA 3T1OA 3DOFA 1LI7A 3A1EA 4QHSA 4ZEOA 1ZN9A 3UMGA 1EXNA 1UCFA 4NU8X 4CQMD 4RY2A 4MA5A 2KB0A 1AUVA 3F6RA 4M8LA 1R8JA 5IXYA 3G9UA 1HXHA 4Q3LA 1DBSA 1JPJA 2ZIVB 5EEHA 2WYVA 1V3TA 2FX3A 3NWJA 3V32A 5GZ1A 2DCMA 1YBVA 3I09A 1ESCA 3JZDA 1ULSA 3RU2A 4EYGA 5ISMA 2AXEA 1B42A 3DCJA 1JR6A 3L07A 1PT5A 2QU7A 5J4VA 4DSTA 2IYLD 3G8BA 1M34E 3EZYA 4YJ3A 3ZS9A 5J2TA 1V71A 1M0WA 1SIWA 4DLXA 3JQ6A 1PTJA 2QUJA 1XT6A 5LFAA 2WFLA 5CLLA 1Q15A 3OE7D 3FOZA 3IE2A 4UEJA 2JHGA 2O0JA 4RZIA 4PG6A 2PX3A 3A0UA 3FZNA 2XKJE 1Y37A 2QUZA 5TSDA 1TIPA 1MJHA 3MJCA 3OOYA 2A9KA 3H65A 1BWRA 2FSHA 3KM0A 4P58A 3TQCA 3TLMA 4QUAA 2J6CA 1GA6A 3VU8A 1YE5A 4EZBA 3MT7A 5BQXA 4M1TA 4LJRA 2DWOA 5HOQA 1RAFA 5IKXA 2C5FA 3ZW8A 3THYB 3V4RA 4CHTA 2PZJA 2DQKA 2QPOA 3ON5A 2V03A 3PCRB 1J6UA 3UPDA 3EEOA 3K6JA 4BP3A 2WSYB 4ETMA 2QRQA 4MV4A 3HI4A 3GXOA 4CI0B 2R1ZA 4TZ6A 3QPCA 1DRJA 4HAUA 2WT4A 3N8NA 3OZVA 3HM2A 2IZ6A 4P9NA 5LC1A 5JALA 4S24A 2JGMA 3V7YA 3F4KA 4RFLA 5IEJA 4IDPA 2H1SA 5HBGA 2Q4TA 4QTYA 1TJNA 3I62A 2BM1A 2QMOA 3E5NA 3ZJ4A 1KDOA 3K8YA 1VCIA 1MH9A 1YS4A 1SURA 2Q21A 2QW8A 4IMRA 4BMPB 4G2TA 1RQ2A 1OZFA 1QK3A 1O57A 4ZT6A 4Z1MD 2G5TA 1C29B 3DKRA 4K88A 4EZIA 5JDCA 3WQSB 1OKKA 4EY5A 1V1RA 2AJBA 3SXJA 2BJVA 4O2RA 4BKRA 3PPWA 4QLBA 4RQUA 3HYSA 1NI5A 1TAQA 4G9BA 1SUPA 3LGSA 5DIZA 1WO8A 1R9GA 2XH8A 2AMJA 1LF5A 2O3SA 1FCJA 1L7PA 5D3ZA 1LDGA 2X2EA 5ICMA 3O75A 4U7JA 4L8VA 3PRKE 4RETA 3L4JA 4EBFA 4II7A 3ZU3A 5FR2A 2EFDB 3AU8A 2J9GA 1KRXA 1TLFA 2G88A 5HP4A 4MR9A 1QP0A 2BUCA 2IJGX 4M86A 1KJ9A 4K6HA 5G4KB 4KNYA 1G5FA 2H4YA 3DL4A 2Z9CA 5M29A 1EHCA 3AP2A 3NBMA 4DMGA 5CFQA 3L0DA 3MT8A 2IOQA 1H2XA 2C7PA 5EXPA 3F9RA 3TW6A 5A4AA 1RQGA 3RC2A 4MI9A 5C7LO 2BHLA 2ACEA 3JS5A 4I9NA 4UVIA 1LCIA 3L8ZA 1P73A 2HNAA 2QYTA 3BMOA 3FYDA 1T3SA 3KT3A 3WK8A 1Z4KA 4ZV4A 3INNA 4YMHA 2XCTB 5CDUA 2PTHA 4IJ5A 4N5LA 5FOTA 4DCSA 1HK7A 2DYKA 3NFRA 1OZGA 3PQ3A 1PSDA 4OHUA 4MLPA 3O92A 2BGLA 5E3HA 4H3KB 4UQPA 2WM3A 2V98A 1U65A 4QOEA 2VYNA 1DEOA 5HILA 4W5RA 1BVHA 4KFRA 3MQFA 4JQOA 1CZUA 3PX3A 1WUTA 4DANA 5GJWC 2A5LA 2DUNA 2WM2A 5AK5A 1DUIA 1BE0A 5CCDA 4I4IA 1NSTA 2CXQA 4M8IA 3FN4A 4Y9DA 4UUMA 2I1QA 5F2NA 3EXAA 2Q6IA 3KOZA 1VCOA 3OLXA 3ZDQA 1GV0A 3NM5A 3AWDA 3JYHA 4CR8A 4IDCA 2OCYC 1V7CA 4KV7A 4F4CA 4Q19A 3DMPA 4FYXA 2K4MA 4PM4A 4UQLA 4C4PA 1UMDA 3A3PA 1B2LA 1B26A 3TB6A 3K0AB 2JJYA 2X1HA 4JC0A 1AX9A 4MRRA 2JPDA 2SECE 1B0PA 1ZK1A 4QNMA 2NXNA 4BO5A 1URPA 2YH2A 4C88A 1N33B 5AVOA 1FDOA 3KX2A 1LJ8A 1FSSA 4PYNA 1PFQA 2O52A 1ZMTA 3MILA 4GX2A 4Q3BA 2UZ4A 3OX4A 4UMFA 4D44A 3G1TA 2B4KA 3FTQA 2JBWA 3AJ8A 3DMGA 2YOGA 3BTOA 3KZKA 3ZZUA 4JLBA 5JJCA 1FS4A 3R0ZA 4IIBA 1B6RA 4H2DA 3B5IA 3C7CB 4WK0B 3RYCB 4D9MA 1QF9A 4XWWA 1ZNQO 2I3BA 3N05A 3GLIA 3DAFA 2XA1A 4AUNA 1CYEA 2BSXA 4OXNA 1DBIA 4LQ4A 4PPGA 4V3CA 2X1LA 1TYEB 1PGPA 3CVOA 3EFOB 4GOJA 5ICGA 2A59A 5L3VA 1HNZB 4CBVA 4XVHA 1VKHA 3K05A 1ENYA 5TLSA 1QH1A 3LS2A 3P32A 2ZI5A 4V0QA 5DTQA 3MMSA 1CIVA 4E6EA 1T1RA 1GPNA 1YRAA 2R8OA 5JRDS 3SC2B 3MMPA 2AI3A 3L7KA 1JXAA 5K0BA 3RC8A 3WWEA 3VU1A 1O95A 1TQ6A 2RJNA 3UJAA 5K99A 2UXCB 5CM8B 1KNQA 2L18A 1G1AA 1WW8A 2X0KA 4O4LA 4R1NA 2FWAA 1YZFA 4FGUA 1JAXA 3QVWA 2B98A 5BNIA 1WD7A 3ZXXA 1ORRA 1WMDA 2HJHA 1BDMA 2J3KA 2P78A 2DJIA 1GN8A 2WLTA 2X0IA 5IG2A 5KCZA 2WU4A 1V35A 4UREA 3FVTA 2HRDA 3SPXA 3HEMA 2ID7A 1TF7A 3ND8A 1IATA 4AKTA 4JBLA 5KKNB 2PGIA 1GZDA 3EMBA 1MD9A 3KB1A 4NDAA 5D3MA 3ZDZB 2XXAA 3JCZA 5CB0A 3W9SA 5K01A 4O5OA 2J9RA 1NBMD 4F5ZA 3B1ZA 4AMUA 3QFHA 4BLRA 4ZANA 1YDFA 5CG2A 5C8VA 1GAXA 5KYUA 4YT2A 4EKIA 4KR0A 2DR3A 1LH0A 1JQKA 3TZEA 2ZE8A 3D8HA 2XKBA 2BBWA 4XSVA 4MUKA 4Y2XA 3OHSX 2XZPA 4QOGA 4U7TB 1USGA 4A10A 2BGWA 1Y9AA 3W8DA 1KRWA 3C74A 4MXDA 1PG0A 4JEHA 5ESXA 3PDIB 3D4LA 3SQOA 5KPDA 2QY6A 3HDYA 4MDYA 1T25A 2AJCA 5EPUA 3RGGA 1DAKA 4Z4HA 2YYSA 3GUCA 2ZTSA 1ZSVA 4HPXB 2ENWA 2K87A 1N2ZA 2ZVPX 4HLDA 4QDOA 3EVGA 4NFHA 1XCMA 3F1KA 4BPBA 1PKEA 3JAWB 5A9SB 4DG5A 1QKJA 4V3BA 4V38A 4MS3B 2ID9A 2A5JA 2CHQA 2ATVA 3V1MA 2O7NA 2QL6A 4S35A 1COWA 3RCBA 3TIVA 5B7PA 3FOEC 3WK9A 4WLOA 2EL7A 4EPXA 3FB4A 2ZG6A 1C7ZA 3IP3A 3AVYA 1GUDA 3EGDB 1MX1A 4R54A 1L8AA 3A37A 3N2NA 2IZOA 4OXYA 1HE4A 4GPD1 3X1WA 5A2QA 1SOAA 4YQZA 2VQEB 3G0HA 3AIMA 2N3ZA 3CTMA 2G09A 1PNOA 2FSIA 3EC2A 1F8GA 4TT3A 1YUNA 2XI4A 1W88B 1WETA 3FAKA 5AKEA 4EO7A 1ZIYA 3CVJA 2P40A 3SFZA 3WSWA 4C4AA 3OCUA 4RJTA 2P2YA 1EJ0A 3AVXA 3BIOA 1RJ9B 1OU4A 1YDEA 2H1OA 1NHGA 5BOVA 4I4TB 2B5VA 4LXTA 2VT2A 2PLWA 1CUWA 3IAFA 4Z9AA 3GLVA 2V7TA 4IILA 3CLRC 8AT1A 2PD4A 1QO9A 3FMOB 4C87A 3F3KA 4EA9A 4V0MA 3R0QA 4NV0A 1YR3A 4H6VA 1REQA 4NONA 3ZGXA 1BCSB 4A2WA 4W1PA 3K70B 3WFIA 5TIIA 3OZXA 3GPIA 3QK7A 5JRJA 1F17A 3BRSA 3VC1A 4WSOA 1J2EA 1RM5A 1EQUA 3AHCA 4OMFG 1WUYA 1R6XA 3AUSA 8ADHA 2ECOA 3EIEA 4PQYA 3GPLA 3VGPA 4LCEA 5ALXA 4J0CA 1NBIA 5TEWA 1WNFA 2LE0A 3E5HA 2HIAA 3N6RA 5JC8A 1D1QA 3BXEA 4MYHA 5DYYA 2EX1A 5FLKA 3GFFA 1TOAA 3PYMA 3ENQA 1GV1A 5I7VA 1YR1A 3T7IA 3F9IA 4JJZA 1E79D 3EGIA 3M8KA 1VCMA 4CF4A 1Q6ZA 3W2HA 4WNIA 1C0EA 3TOCA 4IHJB 4OJTA 1KK0A 2ATCA 2WY2D 5E6SA 4DEYA 5HZKA 4U8HA 3S7TA 5KC9A 3I9OA 4L4ZA 5CLJA 5I9LA 3QNUA 5DHRA 2GQ0A 1OWMA 2CDNA 3IXLA 1J4AA 1GIAA 1Q1NA 2CXPA 3K31A 4JT4A 1EVIA 2OESA 3LK7A 4O29A 1MV5A 2CVPA 3SN6A 1A96A 1M8GA 1YVUA 2X5KO 5LD2B 3KJFA 3ZLTA 3N2IA 3W79A 2ASVA 1E2QA 1E1RA 3AEQB 2YZMA 2O0KA 4JJKA 3DDWA 1W8DA 2BFMA 1Z25A 2CLKB 1SXJD 4GBMA 1GGVA 1UPTA 2SHKA 3I58A 3LQFA 1PW5A 2JFUA 1R0RE 3B1FA 4DVGA 1HDIA 2Q6KA 1T13A 1UXOA 4Q47A 3GV0A 3OFKA 5J2UA 3WRXC 1U0GA 1V39A 1P1IA 5IFKA 1QP4A 4ZCQA 5BN5A 1CHNA 1Z5PA 3CLTD 6ADHA 4NYIR 1Q83A 2C5EA 3BFVA 1WU8A 6AT1A 5L7WA 1I7LA 1E4EB 1EA5A 2AT1A 1LDBA 2XUAA 2WWVD 1KAOA 3I8XA 1NVDA 4NBRA 5IZCA 5MGBA 2GO1A 5FOUA 1TEZA 3BWVA 5D5PA 1N1EA 1PR4A 1ZJJA 3B3GA 5FTKA 1NVKA 4MV1A 3WWPA 1K8QA 3H84A 3AUKA 4MJ3A 1FYWA 1P39A 4DXDA 1ZGGA 4AF8A 2JAOA 1H2WA 2P6RA 3IDAA 4L3OA 5IMSA 3DTYA 3HB1A 3QTTA 1DCTA 2BM0A 4NH4A 3BKXA 4PC7A 4PZPA 5DW0A 4WBNF 3FMIA 5HFJA 1GHTA 3OEHD 2BFCB 4KACA 1WHTA 4ZN6A 4CTOA 4NXNB 1GTZA 5KUTA 3UK0A 3KT0A 4HH3C 3H6GA 1W4ZA 2CMDA 1CR4A 3ABSB 2Y6UA 3CNOA 5JMOA 3WQQA 4Q7QA 1AO0A 4I50B 2YN4A 2AXPA 3LPAA 4R4JA 1UWCA 1XZQA 2PBRA 1L4LA 1WTAA 1GPDG 2J87A 2WJZB 3CPEA 3ITNA 3QW4B 4IGIA 5CVUA 1KRHA 3UC9A 4MW2A 3HN6A 3YASA 1OLXB 2Z9BA 4LF9B 1YQEA 1JXQA 3AB8A 5E7QA 2MSWA 3NRCA 1FUUA 1EK6A 1NFQA 3BIJA 2ZS8A 4N9QA 1KIAA 4AU1A 3H1BA 1ND6A 4M8NE 3REOA 3GMSA 1U28A 3R9XA 4P80A 1PAUA 1CZHA 3HNOA 1FFXA 2CFCA 3OLQA 4G2NA 1W0CA 3KZ1E 4LDNA 1Y6QA 4WW0A 5DGTA 3UGQA 3AI2A 2IXEA 4B3RB 3B85A 5FWYB 1H5QA 3U3XA 1Q20A 5AVRA 4I4LA 2O8BB 1WU7A 2CLMB 1Z2DA 3QWIA 4Q1VA 3HR8A 1KA9H 3KTFA 1RVDA 2FX5A 1I33A 3NRBA 4Q9AA 4QPPA 2Q5HA 2H65A 3VH4A 1JDTA 1LTHR 3COVA 3KE9A 3KV3O 2ZJ8A 3JQBA 3HNRA 3OQ1A 2E6UX 1HZJA 4P0QB 4R6WA 2XMZA 1A7AA 1PYOA 4JU9A 2Q2NA 5IPFA 1RFGE 3OZCA 1TRKA 1DRVA 4Z9FA 3RNLA 4KX3A 1KMIY 2O8EA 3PR3A 1GLGA 1GU0A 5JVDB 2E4XA 3AV0B 3QJYA 3EXFB 3I9KA 3D8RA 2XVXA 4RTPA 2J7KA 1M6HA 3UJ9A 2YWHA 5A3JA 2GKSA 3ZHXA 1ZK2A 3C8HA 2XMQA 2VAMA 2HPHA 1PX2A 1OXSC 2ZJ7A 3D8BA 4JC4A 1UPCA 3D43A 5LQDA 2GAFA 1PK8A 4XCQA 1SZJG 1ZA2A 5KSPA 5LP6A 2R6R1 3LTNC 1LTKA 1I2DA 3QMPA 1D4FA 3BQNB 2QTVA 3PSHA 1OPXA 4J2HA 3RRNA 1BJRE 3QMMA 2YWXA 2ZAMA 3V48A 3CWCA 1FU8A 1CJBA 4FYIA 2FP4A 4GZ3A 3HSSA 2F2TA 3AXSA 4MV3A 2PBLA 1KEPA 2R6HA 3C8MA 3FNEA 3IMEA 1CQJA 3N0VA 1VLJA 4GWKA 4UC0A 2A5YB 4ZAWA 1H2HA 4XDZA 2Z58A 5ILQA 1XTBA 1FYFA 1AHHA 3IBYA 4JUDX 5HF8A 1RHQA 4W8OA 1Q0SA 3I9FA 1JJFA 1VLZA 1ZD5A 4GBJA 3VZRA 1XZFA 1DI0A 2W11A 2BEWB 1YE8A 4PLCA 2C94A 2YHIB 1N2EA 5K6AC 5E1BA 4EELA 4M0CA 2HIHA 4F11A 1OI2A 5AQ1A 5FX2A 5EWMB 2BSAA 4IXMA 4OMUA 2YIJA 4A0SA 3QF4A 3K2EA 2IITA 3U3KA 1X7ZB 4KAXA 4ZT3A 5L4NA 2N75A 5LU8A 2HLHA 1N6NA 1Y63A 1QFZA 2OUIA 2JLAA 3KB8A 2XW6A 2YXLA 3L7IA 2Z8YM 5K03A 2JHPA 2BFAA 3JQPA 1OWOA 2HK8A 2OLJA 3S55A 2BISA 2W70A 1DIAA 1T4BA 1E6CA 3DL7A 4FD2A 3DJFA 3M81A 4IUYA 4LXQA 4BU1A 2XRFA 2ZBRA 1NOKA 5FPSA 2O5RA 4TXNA 3ZE7A 3D6MA 4HXYA 4LRXA 2OV8A 5ALLA 1IY8A 4UMDA 5T4FA 1U2PA 5DB4A 2VXOA 4AZ0A 3M6FA 1AD2A 1P9WA 3WDSA 1XHFA 4DLBA 3UYLA 2EX0A 2VXCA 1C80A 1RPNA 1JE1A 3U7JA 2WTBA 3OKPA 1VDZA 2IV7A 4EI9A 2WVAA 4OLBA 1KO4A 5KTYA 1VHWA 1LV8A 3WDKA 1QNLA 2I8CA 3DCIA 4D0RA 4NK4A 1M5RA 1YQGA 1X7WA 3KQQA 1WMSA 5G53C 1RP7A 2C2KA 5AJVB 2YICA 1FVOA 4PFQA 2HCJB 3CIOA 1CR0A 4LYGA 3DW1X 4IOJA 1JXOA 1SUIA 3LT2A 2IU0A 4ENSA 2IF2A 2O7SA 5FWAA 1LDEA 1UJ5A 3HVKA 1J70A 5INTA 1R0YA 4DCNA 1RYDA 3QNWA 4OLJA 4TQ9A 4ZHQA 5M04A 3UC5A 4YQEA 4UNSA 4QGFA 1YO6A 3R7DA 1UH5A 1PL6A 1DOAA 2CV2A 3HBMA 1UM9B 3T38A 1SULA 2YVKA 4ZT2A 2FR8A 3LQ4A 1RHMA 4EGFA 1NRXA 4I7EA 4X54A 2WZQA 4BCBA 4CPDA 1VPDA 4ZDWA 5GP1A 3HMKA 4I1RA 5JV5A 1C9KA 4JDUA 1EFRD 5M5BA 4TYNA 2AC7A 4Q7LA 1YIAA 2KJQA 3JQAA 3W5CA 3JTMA 3R3VA 3LUKA 2GJ4A 2L82A 2XWQA 4MQFA 3PNMA 4DEXA 4FDLA 5FEUA 1FUIA 1E1MA 3D64A 1C9NA 1IIBA 5T4HA 3FKQA 5C7IO 1T43A 1TKCA 5JROA 2HSGA 4PRYA 4GVPA 3WQRA 3GLQA 2WFMA 4OU4A 5EGSA 4E1AA 2CY0A 1SC4A 3ZJ5A 1YFKA 4JBYA 2C7QA 3OOHA 2R00A 3I9MA 1F2DA 2CNBA 2Y4OA 4MCAA 2HGSA 2X2PA 3LQQA 3QNMA 3CLKA 3V8RA 1Z28A 1ZJYA 3LUAA 3GI1A 4Y6QA 1X1EA 2HQOA 3BREA 5JAOA 2HIMA 3TBKA 2OQVA 2JFWA 4R2LA 3UGKA 1DVRA 1F8FA 1FNNA 3ELBA 4XASA 4GR9A 5LZ9A 1LNSA 2G1PA 4MOWA 1B3RA 2JIRA 2R6AA 5JYDA 2G06A 1ECJA 1BU8A 2A0WA 1A8SA 2Z1MA 4LSWA 3U7IA 2WG1A 4KHPB 1RAGA 1CRQA 1J21A 2VZLA 1GPMA 3E61A 3LUDA 4OKSA 3GARA 3BMNB 4OUDA 2H3HA 3W6OA 2I03A 5KWVA 3CO5A 4HGPA 4NYJQ 2Y4NA 3HB5X 1N2BA 3EPJA 3P7MA 3TRFA 2F1RA 4JI3B 2P4EA 1JQEA 2XXBA 3VNRA 4Q4CA 1Q0ZA 2R3SA 5DI3A 1QGUB 4D0LB 3IUQA 5BPFA 4FN5A 3PLAE 3DEZA 2W83A 5EY5B 4LOKA 2ZQZA 3H8WA 3PEWA 3A6LA 1CUHA 4ZQEA 3PPXA 3IP8A 3TZLA 5DASA 1RYBA 2PZBA 3RIXA 4PGGA 3IKJA 4Z54A 2JGLA 2GM4A 4LTDA 2B0CA 1JECA 3QE0A 3TMYA 3Q7RA 4JBHA 1E2PA 3OP4A 4RK4A 2H4JA 4TZTA 2CVHA 1PFYA 1HF3A 3BXHA 2Z04A 2FEWB 4EG7A 4EHDA 1BC5A 1N57A 1GNQA 4KQEA 5DK6A 3HU5A 3KOMA 1Q1ZA 1ZO8A 1MQSA 2V97A 3ENZA 4GKAA 4O2AB 3BH7A 1F9EA 4FFOA 2W2TA 3HB7A 2VRCD 4NCBA 2I80A 1UBOS 1K68A 3QWHA 5TT1A 3DT6A 1PGJA 3T5BA 3V1NA 8GPBA 3STTA 2IS1A 2ZR8A 2Z0MA 1OOEA 3LQ2A 4R0VA 3HA2A 2ZUUA 1EUCA 5JU6A 1PU2A 4WA7A 4WZZA 2OORC 4HFJA 4YQYA 2ZITA 4U3JB 1NM5A 5EFZA 3O0DA 1ZM2A 4CT5A 1BVRA 1PG2A 2BR5A 1SA0B 3SS8A 1QIFA 2B9EA 4BATA 1T5TA 1QGAA 4J75A 2R8ZA 1A98A 4AB1A 2G9VA 1RPZA 3PT9A 1AF7A 1HDOA 1QIJA 1CV2A 3BPSA 4CV2A 4C7OA 5AHKA 5B1EA 1XTJA 2VF5X 2QQGA 3PPYA 4RK1A 4CDRA 4OQQA 3CZAA 1V47A 3ROQA 1CRPA 5E4JA 3THWA 1F2VA 3A3YA 3GT3A 4PGHA 2DCUA 4B80A 4RC9A 2ZYTX 1HDYA 3I8SA 4RA9A 4DIKA 4CLDA 4NOLA 2GKOA 3X2SA 5A4JA 1K1EA 2BJHA 1USKA 2V5AA 3OQBA 1B0UA 3KZVA 1JKIA 4J9VA 3EARA 2OCAA 3LXMA 5C4MA 2GXQA 5J47A 4O5AA 4NIMA 2H52A 2EKPA 2XBUA 1VG1A 5FYDA 2O8NA 4ID3A 4PQRA 5KAMA 4WY8A 2BGIA 1O2DA 2Z30A 2YIDA 5JSHA 2QTLA 1JILA 2WICA 2G17A 1MC1A 2IYQA 2BEKA 4DDKA 4QPZA 3FDZA 4YRTA 2ZT6A 4HH0A 2WSLA 3KJXA 3OH8A 5IAOA 2YHUA 4WK2B 4AVYA 2F17A 5CEFA 1XZEA 3IGFA 1CQIB 1W9HA 4XRGA 3KTOA 5EWLA 4EJSB 4YJKA 3O4HA 1Y6ZA 1Y8QB 1LS1A 1I1HA 1Y7LA 3HJCA 5TQ2B 3WA6A 4FHEA 4BP9A 5BVHA 1SXJC 2QXYA 2DY1A 1J9EA 4IH9A 4YJFA 4TXHA 5KX5A 4OH1A 2RHWA 2ZIUB 3KR1A 4RTOA 2BFBA 4AF7A 1FFAA 2M9MA 3DL2A 4RSMA 5DHAA 4GKKB 1MQ9A 1QH8A 4UU1A 2V9ZA 2V9PA 3ETNA 1XGKA 3OT1A 4IDGA 4P4SA 1EVJA 3RARA 4F60A 2B2CA 4IQGA 1NPDA 2YV5A 4FXOA 3I9V6 4KPGA 4F4FA 4YC7A 1BKYA 2P9CA 5BURA 2WF5A 2WYUA 4GHWA 4BQRA 1UDXA 2ZBUA 3ZIDA 5A4FS 1RXWA 2GBGA 2L69A 2IZ0A 2QPAA 4CNBA 2ZSKA 2MJLA 3C8ZA 1JWAB 4E4RA 5E6UA 1ULUA 2QL5A 1F3OA 3ZPXA 4YRPA 4ER6A 2VNKA 3KZOA 4PX9A 3H5VA 3WWOA 4WXHA 2AUTA 2BW0A 5DXJA 1KZ4A 2H9IA 3C87A 4H9GA 5K3OA 5CCBA 4HQNA 2EW2A 2XNCA 4D56A 1J7KA 1PQUA 1DEXA 2VHXA 4UEOA 5T5QA 3OPVA 5JCJD 4IQ0A 3QX8A 2BHSA 5C5CA 2I8LA 1AZLA 2JFOA 4EA7A 4MVJF 4KMRA 4Q03A 1SWWA 2H1IA 13PKA 1ML4A 3RM3A 5JEEA 5KKAA 5BSFA 2JG3A 4IVRA 2NZJA 1DKRA 1GLVA 3BS4A 3HABA 2PJZA 3QVKA 2YXNA 1ECLA 1JEJA 2WUFA 1Z6XA 1NT2A 1I3LA 3QQ5A 4ZREA 2LUOA 2WKWA 2WUGA 5EC8A 4KXLA 5G41A 1HYQA 5T8KA 2V55B 3ZCTA 5LWQA 1GP2A 3AZPA 1IXZA 2RH9B 2HCBA 4RJKA 2EBUA 3KG2A 4Y6LA 1ISRA 4IM7A 3G9QA 4MTLA 5EL0A 1GR1A 2NVOA 2BKAA 2BP7A 4LJYA 3R3YA 3EPLA 2BFDB 1E2MA 2FW0A 3FNGA 5DBGA 1C1DB 2VDKB 5ITZB 5BSRA 1Z6AA 4DHWA 4ZU6X 4IF6A 1N0WA 3AVUA 3B12A 3I4CA 1T2FA 2BFFA 3BF8A 2YDXA 3W78A 3WLPA 1GTL1 4HH1A 1JA0A 1IZYA 1SMKA 2Q2VA 4JCCA 3RUCA 4DUGA 1CBUA 3C43A 4HNGA 5HF6A 1YDMA 3EPHA 4YI5A 3MJDA 4YXWA 3OIDA 4IRXA 4UZFA 2ZI9A 2H4XA 3LPNA 4L95C 4XWOA 1EAYA 1PNVA 2VCHA 2VYCA 2G5PA 3D0OA 2Q4BA 4I5DA 4XWYA 3RHZA 3CUUA 1I9GA 4EG3A 4MDEA 3PD1A 3W5DA 5AW6A 2YTZA 4OHMA 5JECA 2P9GA 3PXXA 1L9XA 2DB3A 4N6OA 4NULA 3U5ZB 1UBRS 2QIPA 3E7PA 1DTWA 1CY4A 4BRWA 5BWNA 3IAS6 5G3YA 3BAZA 1UP7A 1TYCA 1N3LA 2XAUA 4QLAA 3FSGD 3HJFA 4YCAA 1M2HA 4F56A 2VDWB 3BRWA 5B3AA 1NWCA 2PS3A 2QX4A 1RJWA 4A1FA 1LX6A 1Y4DE 4M99A 1QO0A 4XQCA 5H02A 3REQB 4OX9B 1M2OB 3T7DA 1YJCA 3ED5A 1FQKA 1VE7A 1Z83A 4GI5A 2ZB7A 3B7PA 2QUHA 5JSZA 4E2ZA 5D7NA 2IPOA 1A7JA 2C9MA 4DWVA 4YRAA 1KJJA 4L4UA 5C1IA 1XVVA 2R96A 3H5TA 4QLOA 1F4PA 1JDJA 4L4YA 3HKDB 3RO7A 2MR5A 1J8YF 3VPBA 2EFJA 1HDGO 3GNSA 2BWJA 4OI2A 2NV6A 2GZDA 2XXJA 4XGNA 5CB6A 3SQNA 2E37A 3R8XA 4B84A 3SYRA 5D7BA 4J03A 1UDCA 2P9ZA 1PF7E 2GGSA 4O4JA 3EEYA 4A9AA 3ID6C 1CVLA 1JGTA 1G21E 1G98A 1RMYA 1XDDA 2Q8NA 2VHUA 1K6JA 2ZB8A 1E1NA 3ICWA 1K6MA 1G20E 3JWHA 4F85A 2ZT5A 1JG1A 3FCXA 2FSGA 4DCOA 1NVBA 2RFLA 4EFDA 5EIXA 4FQ5A 3I12A 4Q6BA 1NQXA 1RYZA 1TFRA 2EBHX 2Z4RA 1PTKA 1HE2A 5C51B 4NAHA 4HVLA 4DV7B 1PR3A 5KWJA 4KXVA 3ECCA 1IFXA 2CDRA 4KE7A 2B82A 4FCVA 1P33A 3PIDA 4NS1A 1Q95A 3SEAA 3ZHZA 5I7WA 1PFKA 1PFGA 1TM7E 1HE5A 1V25A 2MMCA 3KAPA 4KN8A 4PXAA 1WBJB 4OJQA 3B82A 1NXXA 5F9MA 4PW0A 4R9RA 3K1AB 1Q44A 1TDJA 2IX3A 3JZAA 3B9RA 1XVTA 4KUHA 5E7IA 4R8KA 2O2HA 4FWBA 4I9UA 1CVIA 1YT5A 2PEYA 2UUAB 1O87A 3FI9A 1KS2A 4ZRDA 1HX7A 4EMTA 2FW7A 1ZAYA 4QYWA 4D81A 2A0UA 4MRNA 4IDBA 4KQ9A 1JNXX 1UKZA 3TVYA 4BPRA 4BX3A 4ZKEA 3T7AA 4A7PA 3Q2OA 2Q46A 2FW9A 2QTHA 5G3ZA 3LOUA 1AKVA 4D4KA 3RGWS 4R7ZA 4DDHA 2XRZA 1W85A 3H9EO 1F5NA 1AB6A 2B2NA 3KKNA 5TGTA 2AK2A 3FH0A 1SVMA 2IUUA 4FP9A 4HDMA 1X70A 3W9UA 4D02A 3FB1A 4OYRA 1EINA 1STOA 5LXTF 4B4UA 4DA9A 3UTCA 5AVWA 2B1JA 1QRAA 1RWMA 3LNTA 4GC9A 2VL7A 2O8CA 1R5BA 4LK3A 4NEGA 4ZO6A 2EJCA 2V7QA 4OGWA 3A1WA 4I9HA 4RPGA 2A5GA 3C6ZA 5J59A 1YBHA 4EPTA 1GXSA 4U5QA 1ZFNA 1QV6A 3T9DA 1BWPA 5C80A 1CNFA 1MEEA 1WXQA 7MHTA 2FZGA 1G9TA 2C4UA 1Y8RB 2AQIA 4MV8A 3BIWA 2OV1A 1OZAA 3TIFA 1NDHA 1ZBDA 3HKBB 5KJ1A 3WLFA 1WXWA 5D5QA 3SVLA 3D8SA 5GOZA 1H42A 2HA6A 3G6KA 3AHJA 2GZRA 3SJZA 4UXIA 4ZCMA 3V2UA 2X0FA 3E7WA 3Q41A 1YK0A 4RF2A 1R9NA 3L1HA 2XD4A 3QBJA 4G5XA 4GVLA 4YGYA 1R74A 1AKMA 2YJ4A 4X00A 5BYJA 3WSVA 4RW0A 1MABB 1TM3E 2CB0A 2A7QA 4M9ZA 4YECA 5BSKA 5AW0A 5L53A 4M1YA 3HU1A 4GOLD 2IBTA 3DE6X 4MJLA 3PP8A 4UDNA 4UTZA 3LRXA 5EZYF 5JH7F 4ILEA 4JIMA 3F3YA 1EEXB 2GEBA 4BASA 3U19A 2R1TA 1NKTA 4H31A 3SS7X 3FNBA 4Z2AA 2X8JA 1TUEA 2XR1A 3ONVA 1H5NA 4DMKA 3E18A 5DPMA 5EMKA 4PNHA 1VM6A 3QXJA 3CUYA 3R20A 3AONB 2C54A 4UNNA 5BSUA 2FQXA 1OASA 4GPZA 3DP9A 1MJ5A 1G64A 3X1ZA 3H1AA 1ST3A 4KWEA 1QZZA 1W1WA 2WZCA 3NBKA 3U37A 1O03A 4JHXA 4V39A 3CH5A 2Q6TA 4XYEA 3S8YA 2R86A 4LY9A 1XELA 1VJGA 4IDEA 4A15A 2OD2A 3HV0A 4BFUA 2FH5B 4DL9A 4ON9A 5A5GA 1THZA 2A1UB 1FF9A 2BMFA 2FUNB 1GGNA 2P0AA 4UFPA 4HAYA 1CXZA 1VQ1A 3KQPA 1KE1A 2A9VA 1FDRA 1TA4A 2NPOA 1TUIA 1YZNA 3FNHA 1UKVY 3Q0IA 5LYYA 1II8A 2IEGA 3UMMA 2ZZNA 1XTQA 5ICEA 4AM8A 4EBBA 1QH9A 3LDUA 2J41A 4LYHA 4CMCA 3OZEA 3I32A 4P38A 2ZI7A 2QT0A 3RYIB 1VI2A 3WKAA 3WIBA 4KITB 3SDZA 2KS6A 1CW2B 1NYQA 3JQ8B 4O4IA 1JSXA 2IK8A 4M0UA 3WBJA 4UAGA 3FUCA 3H18A 3W7AA 3ZHBA 2FDRA 3G7NA 1WD5A 1XRQA 3IFSA 4M9CA 1KH3A 1A5SB 5GPBA 1EM8B 3T5MA 3D5TA 3W5UA 5BWLA 3CNNA 3CG4A 4M89A 3V4VB 4F9EA 3Q3CA 1SRRA 2OO5C 1V3QE 5BV2P 2M6SA 4N03A 5EJ8A 3WYFA 2RAVA 1P75A 1A69A 3DLTA 1IPHA 1FS5A 1WCIB 4JP2A 4JI6B 3KZMA 3BGWA 1Z45A 3HLYA 2PFKA 4MWBA 1GFIA 4DZRA 5J4YA 1P80A 2HWXA 3QOFA 1M8KA 1UBCA 3EVNA 5CYGA 5AUPB 2XNKA 4DWJA 2FLKA 1XP5A 4LWZA 4BJ3A 1M34A 2ORVA 4KWTA 3Q9SA 2HAEA 3WLSA 4KR9A 4DV6B 2AR0A 1PJBA 5LL6P 3W5HA 3GEIA 2XJ4A 2QJRA 1YHNA 2Q62A 2VZEA 5MF6A 3TBHA 3WRYC 2PVSA 2QTFA 2NSHA 1ZWLA 2ZRCA 3L84A 4KGVA 4S1PA 4ZVSA 2IBMA 4GXQA 4J0JA 2HR1A 3CR8A 3M3DA 3ETGA 4V2UA 3V3TA 3VKUA 5KAPA 2ROQA 2NX2A 4PU0A 4J9UE 4EFMA 3EYWA 2DMRA 2XT0A 3BJZA 2PMWB 3NS7A 1JH8A 4UVGA 3UOWA 4JYMA 1EE1A 3O9ZA 3EZGA 3DVQX 4OAOA 5ALSA 4XPIB 4QYIA 3OQNA 1W1UA 1Q5PA 3VU9B 3DVLA 1XZBA 3K2QA 4MW9A 1TCAA 1M3SA 4BB0A 4JJIA 2XGMA 1PVOA 1JPNA 4EECA 4E3WA 3KJGA 4P08A 1ETUA 2EX4A 4ROSA 3LHIA 1OC4A 5JSKA 1S5PA 3RIMA 3AIOA 1A2KC 1FW8A 2G0TA 3AMVA 1GTMA 5I48A 4GYYA 3QG1A 1QHXA 3HU3A 3BWYA 1VI6A 2PL1A 3EB9A 4EVIA 4YCMA 3OTIA 1OT3A 4G9EA 5DN6A 1MEOA 2HRZA 4D9CA 3P2YA 3D4NA 3GGDA 1NA5A 1G3IA 1ZESA 6CHYA 4CKCB 3GT4A 2QLMA 3IIIA 4WTOA 1P1HA 3OJXA 3T9AA 1NG1A 2F59A 4QQNA 3NYQA 3TDNA 4R1LA 1WXIA 5DTRA 4A23A 1QCZA 2Q45A 1F60A 2DLDA 2XTNA 3K5WA 4M9SA 4ND6A 2VK8A 2OD9A 2B4YA 3CO0S 5KJFA 1ENZA 5KPJA 4MDFA 1U8UA 1SK8A 1KF0A 2FPWA 1EX7A 3HXKA 2D2XA 2NVUA 4KIFA 4PG8A 5B4UA 5HQTA 5HUHA 1D2AA 5JTTA 1DIOB 3DT8A 5H3CA 2X0RA 3ZTTA 2J59A 2RHBA 2PX6A 2IBSA 5UKDA 4UBNA 4DEVA 3ZDBA 1E1CA 2HSDA 1UL1X 1DEAA 3DWEX 3WOHA 1N9GA 1A82A 5CDGA 3K20A 2C2OA 2EWWA 3FVRA 1D1TA 1Y7TA 2QDXA 2GFQA 2X9GA 3PHGA 2GTIA 2WTAA 1GTRA 1Z33A 3RVSA 1BG6A 5AJYA 4ZEMA 1II0A 4H59A 1O97C 4UBJA 1G63A 1YR6A 1U8TA 2JLZA 1KYIA 3HO8A 3CZRA 3IOYA 3BXOA 3H9UA 5FL7A 1MZPA 1FEZA 1W30A 3GRUA 5J5VA 2EVWX 1KP2A 3EPRA 4I66A 1GZSA 4YY3B 1MHTA 1XZMA 4EAQA 3GGCA 4LGVA 3TJRA 4G0VA 3DAHA 1Z4NA 3L4KA 1H4VB 3T1NA 1CZRA 1WZNA 3AU9A 3W6PA 1C3OB 3INGA 4CQLA 4OUKX 4B4DA 3ZJUA 1QFJA 3BMQA 4OLFA 1RYHA 1GRCA 2FZKA 1PJAA 3UXMA 1KO1A 3UJNA 4NBKA 2PAAA 3WY9A 4WNAB 1WMAA 2QOEA 4I8XA 5T57A 1V5GA 2QUBA 1XEWX 3HEBA 5EUBA 3FBGA 1I1OA 3A06A 4CTNA 1EB8A 4ITUA 3TE6A 3GA7A 1QMGA 1IY2A 2NO4A 1QZUA 3R5JA 5CT9A 2CYAA 2X4IA 4DMMA 3E22A 1NX9A 1QB8A 5DBIA 5DNCA 1J5EB 3H2JA 4EW6A 3EY9A 2I2WA 5ALQA 2J3HA 4B3DA 3QPAA 2NTVA 2KLBA 2C2YA 4AJJA 4LSGA 2PS9A 4MNTA 2P5TB 2FHPA 5DN9A 4HLUA 5B6JA 3W7VA 1U1EA 2WU3A 2ZSHA 1JHDA 2ZYSA 1KDRA 2ETVA 2HF7A 3R44A 2GPAA 4QPCA 1K89A 4KI7A 3HY3A