4R2LA

Crystal structure of ynaf (universal stress protein f) from salmonella typhimurium
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
142
Chain Sequence
NRTILVPIDISDSELTQRVISHVEAEAKIDDAKVHFLTVIPSLPYYASLGLASAELPAMDDLKAEAKSQLEAIIKKFNLPADRVQAHVAEGSPKDKILEMAKKLPADMVIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Universal stress protein F
publication title Structural and functional analysis of two universal stress proteins YdaA and YnaF from Salmonella typhimurium: Possible roles in microbial stress tolerance
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Unknown function
total genus 40
structure length 142
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4r2lA00
4DE5A 1PG0A 2NZ2A 4F4HA 2E18A 3RJZA 5KHAA 1M8PA 4JYZA 1KH1A 1Q15A 4JXZA 4MUNA 2J5BA 4MUKA 2JAXA 3FOCA 2CYBA 1KAQA 1OWNA 2J4DA 4MUJA 4ARIA 2R5WA 2A84A 2OQ2A 1PFUA 1YUMA 1U0BB 4DNXA 1JIIA 4DJAA 3AL0C 3IVCA 4DDHA 1GN8A 4F3RA 4MW4A 2RE8A 1EFPA 2DPLA 2Z08A 2CSXA 3KT0A 3E27A 3MLAA 3CLUD 1GZUA 2C5SA 4YBRA 1MAUA 4RPIA 1GTRA 2VTBB 2QTMA 3COYA 2HGZA 3SEZA 1JEEA 3HL4A 1YULA 1CT9A 1N2IA 3A4IA 1IH8A 3D6UA 5J58A 2PG3A 1QRTA 1N2JA 3CLSD 4NAUA 3HGMA 1NUUA 4MUGA 3N05A 2WB2A 3CLTC 1N2BA 1T6ZA 3ZGZA 4TS1A 2J08A 4ZCSA 3DPIA 3QE4A 3RHSA 4EG6A 4ZT6A 3L93A 3SEQA 4MUEA 1NZJA 3GUZA 4MQ6A 1ZH6A 3QTBA 4G5FA 4UZFA 4ZT3A 1IHOA 1OBHA 1O96B 4E1AA 4JXXA 1IFXA 1GLNA 3ZJUA 4J75A 5FNZA 1KKUA 2AKEA 2PZAA 2QUKA 1J1ZA 3N9IA 3MUEA 1I6MA 5KCMA 4XFJA 3IMGA 4YP7A 1NI5A 3D6VA 1N2GA 4ND7A 1JECA 3NV7A 4AS1A 1JMVA 3FNRA 4JFAA 3IUEA 5DK4A 1TYCA 1O0BA 1MRZA 1QNFA 5FO1A 5H7XA 3CR8A 1MBZA 1O97C 1N2EA 1JZQA 5EKDA 3F3MA 3ZJTA 4R2LA 2GKSA 1IQ0A 1H3EA 2GOYA 1TFUA 3G6KA 1KP3A 3G5AA 2D54A 1Q77A 5KWVA 3CLTD 1VBMA 4MW5A 3IMEA 3Q4GA 4DDKA 1NUPA 3ND5A 2VTBA 2CV0A 1FYDA 1NUQA 1XNGA 4ZT7A 2A7XA 3SZGA 1KH3A 3MMXA 2E0IA 3H05A 4KPUB 1MAWA 1ZUNA 1T6YA 1WKBA 2I1LA 2ZUEA 3CLSC 1O6BA 4XFDA 4L2IB 5J5AA 4PBRA 3DLAA 3ISJA 4I6EA 4YP5A 4NDAA 4ND6A 3A2KA 1G8HA 4NX2A 3RBAA 1LI5A 2A1TS 4MW1A 3TQIA 1M8JA 2E89A 2TS1A 2CV1A 4EGAA 1EE1A 1OWPA 1OD6A 2YXNA 1U7DA 4YMIA 2PZ8A 3H99A 1O96A 1O97D 3COZA 3IVGA 4ZCQA 1V8FA 2OV4A 1VL2A 3HMQA 4EG5A 4UZEA 4HK4A 2QJTA 1UFVA 2WSIA 3KFLA 1EXDA 4MW7A 4XSVA 2EJCA 3IOBA 3N8HA 4HJRA 3FI0A 4Q93A 4OJMX 2ZP1A 1NP7A 3M5WA 3QTTA 1IQUA 4MVWA 1JGTA 1ZH0A 3H97A 5IHXA 1KORA 1A8HA 3ZXSA 1HYBA 3HV0A 4X0EA 1MC1A 1N1DA 1O95C 1PFWA 2A4MA 2V0CA 2RD2A 3COWA 4RUKA 1I6LA 3UK2A 1JIKA 2AG6A 1O5TA 1N2OA 2QJOA 3IDFA 1JHDA 4BWVA 1MJHA 1GAXA 1OWOA 2D13A 3CVYA 1LW7A 5F23A 1U7XA 3KT6A 4MWEA 3NBKA 4HJXA 1IQRA 2WQ7A 3X1JA 1WY5A 2QUJA 2ZUFA 4ARCA 1U3DA 3PNVA 4ZCTA 3S3TA 4DDMA 1PFYA 1M8GA 1TYAE 1NURA 4MAFA 3RFFA 1F4LA 1N78A 4MVCA 4R0NA 2YWCA 2D5BA 3ELBA 4KKVA 1LI7A 1XJQA 1KQPA 4KPUA 3CVUA 4CDNA 2JANA 3COVA 4QRDA 1NUSA 5TS2A 3FIUA 3FH0A 4K03A 4CQNA 1M8FA 4G5YA 4L2IA 1T6XA 2BYTA 1EFVB 2O8VA 1YUNA 4DLPA 1NUTA 4CDMA 2HMAA 4ZT5A 5K0SA 5H16A 3K9WA 1WXGA 4OUDB 1VLHA 3P0HA 4MWDA 4QBTA 4U8HA 2VXOA 4AQ7A 3HFJA 4MW0A 3RK0A 3RK1A 2QTRA 2YWBA 1J21A 2H2AA 4EFKA 2DLCX 1O95D 3IVXA 3IOEA 5LLTA 3JXEA 1M8KA 1N77A 3CVXA 1BS2A 3AG5A 2DR2A 1R6TA 2CUZA 3NBAA 2CT8A 1Q19A 5JBNA 1YIDA 4NAHA 1NYLA 1O94C 5J59A 3A05A 3FG9A 5K0TA 2PXHA 3LOQA 4EG8A 4G6ZA 1WXEA 1KR2A 1QRUA 2X1LA 3VRHA 1G59A 1T9GR 3AFHA 2CYAA 1JEDA 3N2YA 3UMVA 1WQ3A 3L92A 2EL7A 1TYDE 1WQ4A 5IJXA 1MOPA 2DERA 2X0KA 1WXHA 3Q10A 4H3SA 1G8GA 3A04A 2HZ7A 4K0RA 3SZ3A 3AKZA 4EF6A 4ZCRA 1QQTA 4MUFA 3FETA 2QUIA 4ZCPA 3IH5A 4MW9A 1IRXA 1N75A 2QTNA 4PY2A 5TGTA 1H3FA 3TNJA 4CT0A 3KT8A 2CV2A 3X1KA 1J20A 3IOCA 2X3FA 1WJGA 3TS1A 1EJ2A 5TEVA 3MXTA 3P0JA 1XNJA 4MW6A 2A1UB 3K32A 2IJGX 5HG0A 1X6VA 3PNBA 1JZSA 3CLRC 4J76A 5LFAA 5LM3A 4KR6A 1U3CA 3SP1A 4MWCA 5TEWA 3FHJA 3LE8A 5FO0A 2CYCA 3ZIUA 4S1OA 1KH2A 2B7LA 1EFVA 4HPWA 1ULHA 4NZPA 1O94D 4MULA 5AHWA 2V0GA 4KR9A 4EG7A 1WZ2A 4YP6A 4GRIA 4OUDA 2XRZA 1TYBE 1PG2A 3UOWA 3ND6A 1S4MA 3ZJVA 1N2HA 1J70A 1GTSA 3C8ZA 2O5RA 3H9CA 4MUHA 4ZT2A 2IELA 2YY5A 2QJFA 3P52A 1TQ8A 4U7JA 5HUJA 4NATA 2Z09A 1DNPA 4R2MA 2NSYA 1JIJA 1KAMA 3BL5A 1JILA 3CVWA 3FWKA 2PZBA 3SDBA 3ILVA 4MW2A 3LCJA 3UY4A 3X1MA 1F7UA 5BNZA 1N3LA 1Y42X 2QUHA 4P2BA 3TQOA 4EG4A 1O0CA 1M83A 2A86A 4GU5A 1FFYA 4MUIA 1QRSA 3UC5A 2DETA 3IUBA 2CFOA 1R6UA 4I6JA 2AZXA 1QU2A 4JZYA 4Q16A 1QTQA 1H3NA 5HUHA 3ZUGA 1KQOA 1VBNA 3DO8A 4MLPA 2H29A 1K4MA 3INNA 2PFSA 3CLRD 1MB2A 1IVSA 1K4KA 1K92A 1YIAA 1M1ZA 1QJCA 1D2RA 1ILEA 4ZT4A 1Q11A 4PBSA 3HZRA 3AG6A 3CA8A 1GPMA 3MLBA 1OWMA 3OP1A 3VGJA 1EUQA 4FZJA 3G59A 2GM3A 1WXIA 3PNYA 4A91A 3ZXIA 2PIDA 2J07A 2J09A 2Z3VA 1J09A 3TZLA 1TEZA 1I6KA 2A1UA 1EFPB 1G8FA 1X8XA 2X1MA 3OTWA 2BTEA 1COZA 1YI8A 4MVXA 3TZEA 1K97A 5DEOA 1F7VA 2XRYA 3CVVA 4MWBA 1NSYA 4WNYA 1WXFA 1PFVA 1OWLA 2DEUA 3PRHA 3DV2A 5DB4A 2DUMA 3I05A 3PXUA 4EG3A 3IODA 4EG1A 4PBTA 4KR7A 3FDXA 1WOYA 3ND7A 4I6GA 1T9GS 1OBCA 2WQ6A 1EUYA 3GMIA 3SYTA 1B6TA 1P7PA 3H9BA 3CLUC 3GLVA 3AIIA 2DXIA 3FY4A 1KP2A 1SURA 1VBKA 2G36A 3IMCA 1KQNA 3Q12A 2JA2A 3U1VA 4U63A 3VU8A 1I2DA 1J1UA 1ZJWA 2E21A 3KT3A 1XNHA 1F9AA 1V47A 4WSOA 2IP1A 5DASA 1R6XA 2A88A 4QREA 3P0IA 1MB9A 1H1TA 2A1TR 4MVYA 1QU3A 1RQGA
chains in the Genus database with same CATH superfamily
4HY3A 3QEJA 3RAJA 1JXOA 1UKEA 3UAWA 3STHA 1P81A 1Q5PA 1ORHA 1YZQA 3G7NA 4F5EA 1DDIA 3W79A 5IFKA 1QP8A 2R7MA 2NU6A 4X1OA 3WLPA 1RYNA 4MUNA 1ZJ6A 3BDVA 4GMKA 3AJDA 3MMZA 1FSZA 3QXJA 3RH0A 2FPPB 4D3FA 4UOEA 5C0OE 2RHGB 1C7JA 4YR7A 1BVYF 3EFHA 3F1LA 5G0UA 1WXQA 1OWNA 1V35A 2CKDA 3L8YA 2J4DA 1EFDN 1JXAA 1MO3A 4MUJA 1O8CA 2B25A 4OK5A 4TSRA 2ZYRA 3FFTA 2IYTA 4JBNA 2OC9A 1NVMB 3AV3A 2WF9A 1A04A 2GEBA 2QMQA 2CXRA 3K1JA 1O0SA 2C57A 1LBHA 4D6PA 4DIMA 3GEGA 3M1IA 5T8KC 1CRPA 2X0RA 4JZKA 4LOLA 1L4LA 2WG0A 1GUFA 1P9NA 3ZGXA 3R8FA 4O08A 1C1DA 1GUZA 1CUGA 1VMIA 4DF3A 4ZYWA 2YVQA 4A2PA 3G23A 1GTRA 1UC8A 3MIZA 4XRRA 1R8XA 2ORVA 5ADVA 4KWHA 2PA3A 4YMVA 3LQQA 3AWDA 3NOOA 2ONKA 4O02B 4LFCB 1JG3A 4HL6A 3RFVA 5B7GA 1T3LA 4G2NA 4QFBA 1PS8A 2AOUA 4NXNB 4XQEA 5D2CA 1Z08A 1XTBA 4IOMA 1PD0A 3UN1A 4YLGA 3N2LA 1Y7HA 4J0DA 5C18A 1TFRA 1A9OA 4NI5A 3HDJA 3RSCA 3NWJA 2BKLA 3VR4D 1Y5NA 2JJ8A 2X4LA 5C4IA 4WY8A 4YH1A 4BMYA 1ZMOA 2WD9A 1AHPA 1PGPA 4WXEA 1EQ2A 3ROMA 1L7BA 4NICA 2B92A 1X8KA 4JI6B 2XWJI 5LP1A 4JWTA 2YN2A 3PDWA 2KQUA 5J5CA 5KNDA 3UK1A 4ESOA 3M5DA 1W0JD 4I4IA 4H31A 4J94A 4MUEA 1CY2A 3HKDA 1XVUA 3EDCA 3KLMX 4I5EA 1PZFA 2ID7A 3ENVA 2JGKA 2QLTA 1FSGA 2R3SA 5FOXA 2FMIA 3Q7SA 2CEKA 4JVOA 3AEKB 2OYCA 2HWYA 4RVUA 4RDHA 4AI6A 2QN8A 5IUNC 3PA6A 1RLOA 1F48A 1NAIA 4NDNE 4ZEOA 2AI2A 2PMBA 3RU7A 1IEXA 3EQ2A 4AKEA 4B7AA 2XH8A 4UU1A 1XPRA 2I22A 2QGFA 3I1IA 5D3KA 3S1LA 2D4AA 3VU3A 1RRCA 3ESXA 1IBSA 2DMRA 2I0FA 3TGWA 4YAGA 2AHOA 1QIGA 2XV1A 4F5YA 1U6JA 2GPTA 1P7CA 1Z5NA 2QTHA 3GZTB 4IUDS 3HGQA 4XB6B 5DW3A 1V2HE 1AA9A 2DKNA 1TLTA 1EX6A 4NCAA 3FCYA 4YFVA 1DE0A 1ZCBA 1O0BA 3VISA 1P0QA 2BFCA 2BMFA 3OT1B 2VBGA 1KJ8A 1OFTA 4H1UA 1HFEL 4H59A 3ZU2A 1UKYA 3O4HA 3JZAA 4YXWA 1D4ZA 1UM8A 2AZ4A 4DGQA 5KREA 3WLQA 3IE1A 3ONFA 2PKWA 4X95A 4D81A 3UV7A 4OQPA 4WHMA 5EG5A 1FDVA 3E5HA 1UIRA 3NT2A 4LRXA 1OZGA 2VSXA 2OZLB 2YHBA 2R66A 3I76A 3M6XA 5JE8A 5CDHA 1IQ0A 3QYJA 1SHKA 1YC5A 1WUJS 3H87A 4UUQA 3UMJA 3G6KA 4MQLA 2ERCA 2Z2XA 2I7TA 3CUEF 4CTKA 4MHTA 1UXGA 3BL8A 3GEDA 1QGUA 1B6GA 1T25A 3UJCA 3W6ZA 4D42A 3KWLA 1PEKE 3ISTA 3Q72A 1PE0A 5GONB 2SICE 4OM7A 4LWZA 3ZOKA 4CIBA 2ATVA 2GPSA 4PFQA 1MKYA 3F47A 4FS8A 4MX8A 2NUTB 3W1VA 4K9PA 2HB6A 3ZYZA 2GNOA 1L4FA 3L7YA 1FSPA 4WPGA 3RLIA 1ZXXA 3JW8A 3AUXA 2C7OA 3BPSA 3T94A 3MMXA 3LFHA 3KJQA 4BIIA 5JXGA 1YI1A 5HBGA 5THQA 2G8LA 1A97A 4KRXA 4TYPA 3ZZNA 4OHXA 3E4DA 2VTVA 4IWNA 3IFSA 3NNNA 2D74A 4HSEA 3QXXA 4XI9A 1YR2A 4KXFB 2JRCA 3WL6A 4NDAA 5GTDA 2WYWA 3SQDA 4OXRA 3ER6A 3H4TA 1D6JA 2RB4A 1RNLA 1SXJE 1ID1A 3GUVA 2GWRA 4O2AF 1EZZA 1Z7GA 3AI1A 4OX9B 3TQIA 4HUQB 1DRKA 5KKCA 3NHZA 1EJ0A 2EFGA 3FPEA 4R1OA 1V45E 2Q1YA 2FAXA 1ZJZA 2PR2A 3U16A 1P17A 2H18A 1D2CA 2L17A 3U0VA 2YBDA 1OWPA 3LJKA 4BNGA 2ZBRA 3OQOA 2G0AA 4NJMB 3VYTB 4OSOA 1OXSC 3FOWA 4QJIA 2NNLD 4Y0NA 3F8TA 5FR1A 3FZEA 4ZCQA 1LPPA 1QPGA 2O2CA 1NW5A 1TF2A 1W87A 2QYOA 4MYTA 4CCAA 2EF1A 1JF8A 4X92A 3ETGA 3GZNA 3MCAA 2X86A 3HA7A 3HMKA 4CM8B 1B0AA 3N28A 4IOJA 3A9CA 1XHLA 1T29A 5F7JA 1JSCA 2HV9A 3FGZA 3O21A 4HJRA 3TZ6A 3TIVA 2VK1A 1JTVA 4NJEB 1R0WA 4BNFA 1W2GA 1QV9A 3V33A 1KEEB 4IMJB 3WADA 3DULA 2RK4A 3N8IA 1T3SA 2R68A 2PX2A 2ZRMA 3K96A 4G07A 4K9OA 5AD1A 4DYVA 3NNSA 5KI6A 1S1CA 2NZYA 4IQGA 5GOTA 8ADHA 1JU3A 1U2QA 1WV0A 3A6KA 4JBLA 3T9EA 1XJCA 1Z2DA 2IV3A 1THTA 4Q7KA 3UUEA 1DIGA 1IY8A 1IQPA 2WM8A 4RSHA 3KUDA 4ZCLA 1NM5C 1XLWA 2Z8XA 4OQDA 5HA5A 3BXEA 3KT6A 4E5UA 3TF5A 3RSOA 4UJ3A 5EHZA 3VC1A 3ETHA 4JLVA 4OXKA 3N6XA 3X1JA 3GF4A 3MHTA 4X41A 1UZNA 3DEFA 5KSOA 4MTCA 1E6MA 1GL9B 2O7VA 3IJPA 4IH4A 4ZOEA 5E6RB 3S3TA 3VNVA 1CZLA 2BHNA 2V3WA 3NALA 4CWAA 1NQVA 3AZOA 2YWEA 2PJZA 4AFNA 1OAKA 4MUYA 2WJIA 3RFFA 4FB4A 5B12A 3C6YA 2I55A 4FYPA 2ATIA 1NY5A 2RMKA 1GUBA 4KKVA 4E08A 5P21A 1D3AA 5FX2A 3LFUA 4MCIA 3JQDA 4NE9A 5REQB 2QDXA 3HYTA 2FWPA 3JPWA 3OOHA 6LDHA 3TG2A 1G5IA 4JUCA 1T2UA 4BC1A 2HN9A 1KI3A 2D0DA 4IZIA 4UE6A 4G4SO 2P40A 1TMYA 3RT9A 1T6XA 2GRAA 4HBGA 3TMAA 4B46A 1XPJA 3I37X 1K08A 2J31A 3ZJ4A 1GR0A 1PBNA 1WW3A 2WWRA 2O2IA 2PT6A 1MC4A 1Z18A 2WWYA 2ASVA 5KTTA 2VS1A 3QUQA 2WFMA 4YAFA 2INGX 4KN5A 1TUEA 5ALFA 4CMBA 1P0CA 4UHCA 2C95A 4ESEA 1IN6A 2DJ5A 2XTJA 1DKQA 4P92A 2GNPA 3V2GA 4C5CA 4CEIB 3BGSA 1FXSA 3FTNA 3FKSA 4MA5A 5FL3A 4FYIA 5K0JA 4GO1A 5F9FA 2I91A 4AIRA 2P30A 4C21A 2IUYA 1EVKA 5CX4A 1JHPA 3A31A 1WTCA 3Q6NA 3BERA 4QBKA 2CT8A 3A6PC 4NAHA 2ZKIA 1Q3TA 1PAUA 4BCCA 2C2HA 2C2ZA 4LV8B 3VX3A 4QDTA 2ETXA 3A05A 4IIJB 5ALQA 1TD1A 5CR9A 3FTDA 3GVXA 3NEPX 4N0PA 4JT2A 4CLXA 1R12A 2ZJOA 4KO1S 4EB3A 3AFHA 3PWKA 2QAIA 5ERYA 4Y6QA 4OXNA 4DAOA 2DBZA 2YXDA 5AKXA 1UF9A 3IUQA 1J0AA 1EE9A 2J6CA 3OCWA 3R5HA 3UMRA 3WJ1A 1I2CA 5D84A 2DFKB 1DFGA 3AB8A 3BCSA 2B4AA 3DEYX 3DZHA 1P1CA 3HDYA 4H3SA 3LLMA 2EOAA 4UTZA 2HZ7A 3TOZA 2QVBA 1U1DA 1GDHA 1A8PA 1IUPA 2QJWA 2J0UA 4BO8A 1E5LA 2GN0A 1E1DA 4MR9B 3G89A 5DEIA 5AP9A 5TQ2A 3RVLA 3AY6A 3S2ZA 2XEDA 4A0QA 5AVYA 4B3MB 2OMEA 2CDNA 3CQ9A 5CD1A 1ZD9A 4C2UA 1IATA 5GIPE 1W36B 2FSHA 4O8CA 4CQLA 3EDQA 5LP6C 2CNNA 1HE1C 1NJ2A 3BSFA 4WEOA 3WISA 3O4VA 4OV6B 2REQB 5FNVA 2HOQA 2GPWA 2JIBA 3OX4A 1P5HA 3TS1A 5DNAA 1FL9A 1CY6A 1Y98A 3WFIA 2RGEA 3VKWA 3AKDA 3F7TA 3LWZA 5JEEA 3L0BA 3NAZA 3WWCA 4Z7QB 3FDZB 2BSXA 4C7MA 2YV3A 6Q21A 5C9ZA 3CLRC 4J76A 4PZPA 2A4KA 1LPAB 4Y1RB 2O5EA 2FN4A 2CMFA 3L1VA 3Q3GE 3KX2A 3LF1A 1ZK1A 2LW7A 4L51A 4RZXA 1DBRA 1C1HA 4CCYA 2BR4A 2GHTA 4F4CA 1G20B 1AHIA 2EQAA 3I9FA 4TTVA 3UW3A 1UAYA 1V3UA 2DH6A 3NBYC 1XP5A 5EJGA 1XZCA 5ILGA 4UPEA 4HDKA 5JZVA 2JLXA 3IV7A 2QW8A 5DI9A 1CDZA 5FLEX 3RAFC 3E9QA 3Q7RA 3KG2A 2AW3A 3ACCA 4POOA 1NF3A 2XMSA 4RMGA 1RRFA 4A10A 1NYTA 3KAJA 2AEMA 2P3QA 4XLZA 3SZLA 5ICCA 2G1AA 2ZR8A 4TKVA 3ITDA 1U28C 2X5XA 2B21A 4IV0A 1E4EA 3QYFA 2IT1A 4MRMA 5IDQA 1MVOA 2WSSA 3DBHB 2JLZA 1GRRA 2PWBA 1WDTA 3BWDD 4KRYA 3SE0A 3VPAA 1VG8A 5EMJA 2ID9A 3DMGA 4MHSA 4GMXA 5FORA 2AR9A 2CL5A 4BWYA 3OKAA 4TMVA 3RGWS 3H6KA 1I6WA 1JFVA 3SDBA 4EITA 5H1YA 2WFLA 1CDOA 4C0XA 3KYCA 2NAPA 3M1YA 3OZAA 2JGDB 3GWGA 4HX9A 2VWHA 4G1EB 2OT3B 5ECGC 3U1TA 4BKUA 3BGOS 4DMGA 1QDUA 4FYHA 1M34B 2C3OA 2R85A 3GARA 3L77A 1ISPA 4D41A 5DHQA 4DTIA 4X7MA 2AZXA 3ORQA 4HC4A 1V1RB 2ZZNA 4N7RA 1KMCA 3SHVA 2C31A 2JKVA 1FW8A 3BMOB 1X1BA 2P9FA 1HDXA 1YRAA 2AD5A 1JL3A 1FZQA 4WESB 2Z3WA 3IEKA 2F67A 4M49A 3DZBA 3GRRA 4K40A 2R11A 5CK5A 2EBUA 1OA1A 3CX7A 4YDQA 3MPOA 3UUFA 1XHEA 1EFKA 5SYMA 3G0DA 3TEMA 4TZ6A 4M9XA 4NVRA 3GG2A 4J0HA 4DN6A 2MDTA 3TQCA 1QYVA 3GCWA 4Y30A 1PG5A 3PX3A 2DHDA 3BTUA 1C3OB 3QM1A 1Y1SA 2A5YB 2X3UA 4LXYA 4BQQA 4HVCA 1V3QE 3KL2A 3PD1A 3EG9B 3VGJA 1RMTA 3SFTA 2DBVO 2PO5A 1IXRC 1KNXA 3CTMA 4CMEC 4RENA 1SG6A 1L3BA 2PH1A 5DZSA 1OVMA 2I7XA 3FF1A 4GZLA 3GT0A 4A91A 4CGYA 5M04A 3D3JA 1KE1A 2I7DA 4BB6A 4EA9A 3S81A 1J09A 3GRVA 1O58A 1W4LA 3FDJA 1E79D 5AJXA 5K1ZA 3TOXA 1ECCA 3OTOB 3EZ9A 5FL7D 4ZPJA 4RJKA 1JPJA 1XRNA 4I9NA 5FA6A 3RUDA 2WHQA 1QONA 5LDGA 1RHJA 3BH6A 2QM8A 3KO8A 4F3YA 1CNFA 4WNYA 1B8UA 2EDCA 4P93A 3TJRA 2VLBA 3QY9A 3ZYCA 2YASA 4Q1CA 3CX8A 4TV8A 5KTMA 1EHCA 2PZFA 3DV2A 4JJKA 1OH8A 1OBVA 1Z0FA 3GUYA 1D6MA 5JS6A 3QIVA 5CUQA 4EABA 1CUUA 3AKEA 3KLNA 1P0MA 2WG2A 3L1UA 3UFXB 1J4AA 4H1TA 4D9CA 1YONA 4I0WB 5LJLA 4MRVA 2H1IA 1G9TA 1AK2A 3KU1A 4NYJR 2XWSA 5DRYA 3HRIA 3TBKA 2O1WA 3K0FA 3O82A 1G5RA 1LRJA 2L0XA 2Q5OA 2PSEA 2XDWA 1IULA 4TSFD 3U62A 3U7IA 4FMCB 4LWPA 1KP2A 1ONSA 3UMSA 4ZJUA 3WGKA 5L45A 2KBFA 1KSJA 1VBKA 3WKAA 1WU8A 3C48A 3R3WA 2JVIA 2R4QA 1W8DA 3UHAA 1BXKA 4I5GA 4B74A 3VTKA 3IPXA 2JB9A 5JARA 3CR3C 5IAOA 1J1UA 4BNVA 3OIYA 1L5GB 1QO0D 1SC6A 4UNRA 5A0VA 3AO0B 2JFYA 2QTAA 2WWIA 4ZVPA 4CM4B 4CUZA 1F4PA 4TTQA 4EAQA 1MH9A 5GY7A 1GU1A 1A5BB 4IGKA 3K70B 1V5WA 4QG7A 1CVRA 1Z4QA 2Y2UA 4OOEA 5DVZA 2IWRA 1W5AA 2C59A 2GTPA 2XMQA 3WAGA 4M8IA 4HATA 5GM1A 1EFTA 2QLLA 2RAUA 4O1IA 4CIDA 1P3DA 1MB9A 4D9BA 3Q0TA 5F7ZA 3X1XA 2CWWA 1K0FA 1MOQA 1PUXA 4FE3A 4KBGA 1IWBB 4PU0A 2OESA 4R51A 2DFNA 5AIBA 1M8PA 5AOAA 1DUIA 2W6OA 2WD7A 3QKSA 1XTTA 4JN6B 4MUKA 1X80B 2CNOA 3BHNA 3LQ2A 3DYBA 1GGKA 3NGLA 1ZR2A 1RAIA 4RLHA 4ABYA 3R3VA 3JAMA 4P22A 1R4ZA 1OA0A 2YHSA 2DYKA 1XPOA 1R88A 1RXIA 1Z2PX 3I01M 1SBNE 2GAJA 2HIMA 4FFVA 2BSQA 3AL0C 2APJA 3VYSB 2NO7A 5FUXA 3O94A 1NKVA 1VE7A 2CSUA 1N5LA 3PJRA 3ZQUA 1WUHS 1ARZA 2Q5IA 3TTUA 5T6MA 5FCDA 1Y3AA 3IIIA 1PK7A 1AGPA 2ZIAA 3DOFA 4TRNA 4UFNA 5DP2A 1ZM9A 2HMWA 4ZTUB 4B40A 3G7SA 1JN0A 1C8VB 1Y8QA 3VPBA 1BE6A 3LA6A 3LC2O 2IY8A 1DRVA 2Q3LA 1H65A 2ODPA 2VHYA 3B2EA 4HTFB 3IOYA 1SRRA 1ZY2A 5DBEX 4JB0A 4EJ6A 1PZNA 3F6PA 2NM0A 1U0SY 2RHRA 2WAYA 3B3QA 2R2AA 2YDYA 5L7YA 4JD5A 4K2AA 1KDRA 3MELA 5EC8A 1U0EA 1U4OA 2GARA 2OHVA 4IJVA 1QC5A 4EO4A 5GZ1A 1NF9A 1JW9B 1Y7LA 4FDAA 4GPZA 2XDQB 5GMOA 2HRRA 1O7JA 4WZZA 4BRZA 4YGXB 3CLTC 1V11A 4B87A 2CJWB 3NWPA 4ZANA 4BNLA 2XCTB 4L3VA 5JQWA 1YOVA 2PGIA 2JW5A 2JAQA 1G17A 1OT5A 2UVPB 3JQQA 3KQMA 3A1FA 4G3XA 3EVDA 1F2VA 2A9VA 2C29D 4JLMA 4LYDA 2P6UA 4TT3A 1NFQA 3ZWOA 4ARSA 4CT5A 3FSJX 3GEPA 5J1SB 1QF9A 3N0RA 4ZT3A 3H8WA 3T38A 1TTTA 1TNDA 5T4HA 1RWQA 3PXGA 4JGGA 5AM1A 1ZHFA 1W4CA 3KOUA 2ACWA 2JJ2D 4Y1GA 1CP3A 2G88A 2O4UX 1Z4KA 4FWIB 1DSSG 2R1VB 4P4GA 4BMCA 4A92A 3OKFA 3GAMA 1KKUA 1M0TA 3GA5A 4ZXFA 1JWBB 1EGAA 3W5AA 3GWZA 5KC8A 1CUVA 1KHTA 1EK1A 4RF5A 3VYVA 4LPKA 1KHHA 1N0WA 1P44A 4TWZA 1SCIA 5DT2A 2GRJA 3ZD6A 1BJTA 2CZQA 4FCWA 1EHYA 1XZPA 4C2AA 2G17A 2NLOA 4MXDA 2MSKA 2QMHA 2UUPA 1KI8A 2LKCA 1H42A 4QAQA 3WWPA 1CQXA 4AZ3B 2X2EA 4XD7D 3OM1A 4B6FA 2GBCA 5JC1A 4N01A 4MB6A 5E7MA 1QNFA 4JUIA 1KMHB 4IXNA 3CR8A 1JSLA 3EGWA 3NOVA 1MBZA 4UUBA 1O97C 4RAQA 2FZVA 4CIYA 2B4KA 5AESA 2AZDA 3PZBA 4HKTA 2AX4A 3GLGA 1LI4A 3RF6A 1C81A 4BBJA 4EHKA 5BMVA 3E53A 4GX1A 1XDWA 3L0YA 2PANA 4YCLA 1RVV1 1E96A 3ZLTA 1K6JA 4MPPA 1U8ZA 2QRNA 3P0EA 3SJCA 4CKCA 5IX8A 4B8WA 1TM3E 3B7GA 5KCZA 1OHHD 5KWVA 3B1ZA 1KFKB 3LZ6A 4ZARA 1Z6QA 5IT4A 3LLCA 2FN7A 3CM0A 1FP1D 3MM4A 3RC9A 1FJXA 1NWHA 3CN9A 5JWRA 5FHRA 2OFOA 2GSWA 1XNGA 2NO6A 1CUDA 3IVAA 4KLAA 3VZRA 5FOSA 4AURA 2BW0A 4P0PB 4HH4A 2W11A 4LECA 1AH2A 3AF1A 3CLSC 5KYUA 3E3OA 3TUZC 3C1UA 4XFDA 1KVQA 2Y0BA 1QFXA 2I5PO 4TYWA 4P38A 3WL5A 2VH1A 3GCDA 4XB2A 1ZDMA 3ND8A 3A7DA 1DX4A 3C74A 4O4JB 2B0JA 1L1RA 4LY3A 3ANMA 1HF3A 3KXDA 4HH1A 2J9GA 1ZSYA 2QDKA 1KL7A 2AF4C 3SJBA 2GM4A 3AVWA 2RGUA 3RANA 3OY7A 5TMPA 2PU7A 3WNVA 2LCFA 3MAGA 3MT0A 1YGYA 1YZLA 1IY2A 1JNXX 1L5VA 1DO2A 4LBZA 1X15A 3IUPA 3L6CA 1FU4A 4G5XA 1G21B 4I8XA 2IYQA 2X9VA 3DCJA 2ZZMA 1CTQA 4RVSA 1W46A 3K0HA 4XJTA 3W05A 1GUDA 1KYTA 1T4BA 1H4VB 1V8FA 5F12A 4D4HA 4E2WA 5DNVA 3CUVA 5I7UA 4A8PA 7REQB 1N0UA 4YN3A 1NJFA 4G41A 1QOPB 3OJ0A 4WNCA 3TBFA 4GIBA 1ZJYA 3KJNA 2XVXA 3NS7A 4JA0A 4XSVA 5C7IO 1CF2O 4DV5B 4LJ5A 4HD8A 3COJA 1ADBA 1O6GA 2VWGA 3A58B 3CZ5A 4X8MA 3QTTA 5T67A 4GM0A 2V97A 2GFHA 1DTSA 3I9KA 1REQB 1EP9A 4JCOA 4E22A 3KJZA 4IMIB 3EOBI 4NCIA 4OQXA 2I2DA 1L1FA 4K6HA 3G9ZA 2Y77A 3RSGA 3VKFA 2JLCA 2NXWA 2WZDA 1XU4A 3LCUA 1GSHA 5A7FA 2AKYA 3I3OA 4QXPA 1JUDA 2COKA 1XLTA 2P7IA 4BWVA 5HYVA 1U5BB 4LYHA 1OWOA 3AL2A 3H5AA 1LW7A 4TRRA 4TZTA 3H75A 1U7XA 5JADA 2C8KA 1W36C 1TU3A 5EEHA 4TX1A 3D3KA 4OOFA 3P8ZA 5HK9A 2Y0DA 5DBHX 2BSAA 1V9LA 1E3SA 1EH5A 3ZDAA 4B31A 4ZCTA 3EGVA 5EUQB 2G4CA 2ID4A 1WUTA 5JSYA 3EIEA 1VKNA 1ZGGA 1RACA 1Z8NA 3L6BA 4J91A 3VR2A 3VC7A 1AQJA 4N65A 1F6DA 4MYUA 2WNSA 3PXBA 2QM7A 3I83A 3AM1A 2FSPA 5JAZA 1LI7A 3OPYB 4Y3UA 3KSZO 1WHTB 1PNTA 3UWSA 5KVVA 2ZSJA 3VI3B 4G8CA 1Q7EA 3COVA 1VBFA 4N5LA 1NUSA 2UZ0A 3LPLA 4DKJA 1B15A 4HYEA 1JHVA 4N47A 4Q7QA 4CEHA 2WSMA 1A27A 1NVAA 4KYVA 3OH8A 5L3VA 1X77A 2NO1A 4WE3A 2QSYA 3D4PA 1D0SA 1XQ9A 1NOIA 1Q22A 3JQAA 2FDCA 2PAAA 2IIVA 1USVA 4ZT5A 1V5FA 3QVOA 5DCLA 5A9SA 4XDHA 2RI1A 1S3SA 1WXGA 1FNSA 5BVGB 2BCGY 1QIDA 4MW0A 4PICA 4P7KA 3QMVA 3VXKA 1ZCAA 4JMPA 2XTZA 4LZOA 5AW7A 1N7IA 1BVUA 2RGGA 1U1CA 3IUJA 2XBMA 4ZTBA 4DMMA 1A4RA 2PZJA 4KPGA 4M98A 1G5TA 4YO7A 4BNUA 2NX2A 3HP4A 4H35A 2C4NA 1HKUA 4N18A 5K6AA 1EIZA 1S4QA 4KO4S 1XD9A 4EEZA 3MEQA 3W3AH 1CY4A 2R8OA 3NOXA 3SWWA 5ARDA 2Z5FA 3IUYA 3UANA 1DAIA 3VBCA 4D4KA 5L3RA 1LPOA 4CF7A 3M34A 1T3HA 2W9XA 5EQFA 2NZWA 4FHZA 3TW8B 5HCNA 1XTVA 4V0RA 3RRMA 1U7HA 2GO1A 1VI2A 4N4AA 4MEJA 4NCJA 3H5LA 4KB5A 1QNLA 1JDPA 4DT1B 2EVWX 5K99A 1K89A 3E8MA 4EVQA 1CFJA 2Y1CA 2QV7A 1LSJA 1ZL2A 1K8ZB 1G8GA 1UMCB 1UXJA 2YHUA 1HSZA 1YC2A 3A04A 3GFPA 4QTZA 5BOVA 4J7AA 5AW6A 3I61A 2LDBA 2HRQA 1WS6A 3LHFA 4KQFA 3RVJA 4EF6A 2B4QA 2HIAA 4IZHA 3P45A 4MVJA 4TTAA 1W7AA 2HLPA 3E2PA 1ONOA 4HGNA 4E2FA 2PS0A 3WKEA 3A1TA 1XAGA 2R25B 3CSDA 4Q1AA 3IEIA 5CYPA 4YXWD 3LT0A 3S2UA 1RE0A 1N5MA 1SC3A 2DJIA 5DCUA 1GT6A 4UUNA 5F3RA 5A7HA 1F8YA 1MEEA 2G06A 3N5CA 4LFBB 1J20A 3ILXA 3RE1A 3FMVA 3UJ9A 3CRRA 1EVIA 2X6TA 2P90A 3KJFA 2AH5A 3QXHA 4W5TA 2C20A 2ES4A 4Q02A 1KAEA 3RKUA 1BAPA 1FQJA 4X1IB 4OP3A 1GFIA 2B36A 4FZVA 2OZPA 1HV8A 1WOMA 2XMCA 4M1SA 4BLRA 5L4SA 3DV9A 4L9SA 1CR6A 3V1LA 1NNUA 3Q8LA 4KBFA 1WWKA 1S3GA 3MJ4A 4XE5A 4EHNA 1NJ5A 1NASA 5KPJA 2R1UA 2V4UA 4RIFA 4YRFA 4E4YA 1NHGA 2WYOA 3FYHA 5E7IA 4KVZA 4F9GA 1NFFA 1MQ9A 2JAOA 4RADA 4BMVA 1L7AA 4Q66C 1JRLA 1P29A 2H2FA 3WRYC 4XWOA 2F3UA 2QX4A 3I8XA 1PJRA 3ODPA 5JD5A 2R8ZA 3GVCA 3DV0B 4M7OA 3E7PA 4Z9YA 4OLFA 1NNEA 2OSBA 1CQJA 4A5SA 3KQVA 3ZWQA 4E5VA 2Y1EA 3JYOA 4JI8B 2O57A 1BX1A 1RQPA 4PFSA 1DADA 2EKZA 4B0OA 1YS2X 4LF6B 2VYQA 1JTFA 1NHWA 1GD1O 4OI0A 2R0QC 4GBJA 3SK0A 2IELA 4C4AA 4RZQA 1NXPA 5ESDA 3F7OA 1CR4A 1TQ8A 2F3SA 4TS3A 2BISA 1R8YA 2YZGA 4NATA 4EUEA 1JMKC 3MJHA 2FK8A 3T54A 3EW7A 4HDMB 5LOVB 1DGQA 5AHKA 3R4VA 2G9VA 1R6VA 3HYLA 1QMGA 2GJSA 4XWTA 2I6UA 3LIIA 4IEEA 3AZPA 2R8YA 3IO5A 1ZM2A 2ZTSA 1MHPA 4WX2B 3LCJA 1V1MB 2H59A 1T0HB 4B43A 1QIFA 5A0FA 2VF4X 3GEIA 3VR3A 4P2BA 1L4NA 2HNKA 3UXHA 3K70C 2A3NA 4ARUA 4EHAA 2OPBA 3VU1A 3WWDA 1RPNA 1FE8A 1N5DA 1TL7C 4JLDA 2BE7A 3UC5A 2X0DA 3GZ4A 3NUZA 3OZGA 5KTPA 3L84A 1QU2A 4MI1A 4RJIA 3D1LA 5D3ZA 5I3ZA 2B4RO 4ALKA 5KX5F 1YRHA 3R3SA 1TW3A 1QRAA 3Q98A 2XDAA 3K0KA 4LVUA 1VL6A 4Q1EA 4X97A 2IU0A 2XZOA 2PFSA 5DULA 5DWQA 1J90A 1NN3A 2HK7A 2Z04A 1QHIA 2FFHA 2I6QA 4G37A 1D9XA 3RSZA 1XNRB 4GYJA 1G0OA 2O3UA 2DAPA 2Q4EA 2V6MA 3B6ZA 3V3KA 4K87A 1PYDA 3RAPR 2PCJA 1GL6A 1E3IA 2VHUA 3Q41A 4R9VA 2RHCA 3ETEA 3WHLA 1IZ0A 2JIZD 3FPFA 3PVSA 1BIFA 4ENWA 4L9AA 5E9QA 3TL6A 3C7CB 1OWMA 3A1SA 3LVFO 4F97A 1PS9A 2LP4Y 2XOXA 1JLSA 2VSNA 5I9LA 2JLYA 1O77A 1S2GA 4AP6A 2C07A 1NTOA 1OIXA 5JDIA 1F5NA 2CXPA 5IAAA 1EFPB 2IEZA 2I8CA 2X1MA 3WIVA 4KFSA 1PHRA 3C8UA 4OVKA 4F04A 5BN5A 5JECA 5LMNB 4KFCA 1UBGA 1OTYA 3BHJA 4CM1A 4Q4AA 2C84A 3U4QB 4Q39A 4X00A 4JI2B 1WCIB 2QAGC 2GCIA 4BQRA 4MWBA 1YHYA 2GILA 2W6JD 3WMFA 1IWOA 2GSDA 2XUOA 5EP4A 4WXPA 3MJCA 3TQQA 4F3KA 4QGAA 1IJFA 3W6PA 2Q9CA 5BQPA 4ZI3A 1AMOA 5AICA 4LE0A 2YN4A 4REQB 5LBIA 3JQ9C 2VDQB 2HBRA 2O3JA 3I23A 4MP3A 4C7OA 2OV2A 3I05A 4AX8A 2RG1A 3OFJA 3IURA 1P62B 3UMYA 1U3VA 2AWNA 4FOPA 1PZXA 1W4RA 7MHTA 4MWZA 4TMZA 3SVTA 2OXFA 3ILYA 5FYDA 4MUXA 4ENTA 3ICEA 3LUHA 2VPXA 3QMMA 4R9NA 1V5GA 1K5DA 2BV3A 4D8TA 3TOVA 5KDOA 3LVRE 1E9RA 2QW1A 4X71A 4JOQA 4MMZB 2WU4A 1ZCZA 4HDCA 4O25A 4TKLA 2G6BA 2V7VA 1SURA 1C2TA 1Z7WA 4KR2A 1X9IA 4MIKA 2VHCA 3IP5A 4GSKA 4KX3A 1UPUA 4Q9JA 3BJIC 1HNNA 3AY0A 1HDGO 2QN1A 3IP3A 4TMKA 4Y2GA 2X4IA 3DW1X 3T9AA 1RWOA 3IO3A 5CLQA 3UWOA 4EM6A 4OK3A 3GFVA 4X85A 1LPMA 4JJEA 3U5TA 3G88A 1G2QA 4X20A 5F1PA 1JKJB 1UXIA 3WB2A 1Z9BA 5HJ7A 2ODNA 1T24A 1HT3A 4D0GA 3AUFA 4LWOA 1NNSA 3FTEA 4WSOA 1VL1A 1H6CA 1TCBA 3GRUA 4U2DA 1N6KA 1FUUA 2MMGA 2VP6A 3K4QA 3SAJA 3VNQA 4BFWA 2HSZA 3QLUA 1KK2A 2BFAA 4M86A 5EGNA 4RM3A 5B5SA 1NQXA 3W3AA 3KSBC 3TCKA 1PJ2A 5CVEA 4JGIA 2PNJA 2E18A 4B75A 1W30A 2VBFA 2CZGA 3PQ7A 2J5BA 3FA2A 1DX6A 1KIFA 3DKIA 3HUEA 3LUGA 4IHAA 1O8BA 2FUG1 4RFSA 4V0NA 1JPNA 3ZE2B 3WGVA 3BIJA 1H9CA 2IPOA 3FSRA 1RWWA 3N53A 1Z0ZA 1EDOA 1K68A 2IXAA 1G6OA 5BQFA 3ET5A 4L5BA 1KK0A 3I9JA 3KYDB 2A84A 4MIYA 1U65A 5DN9A 4MUMA 5F33A 1FUIA 3AB7A 4YAKA 2JI6A 2FFAA 1SXGA 1M76A 4LJ9A 2P2SA 4UTOA 3RVQA 2UUBB 4PZDA 3WLSA 3DEJA 5KAMA 4GNKA 1AQIA 4FN5A 3GB9A 1U3TA 2J85A 3FMFA 5TMBA 1E2QA 1KQ3A 4HEJA 1TXGA 3PK0A 1M0SA 2Q7XA 3CLHA 4DJFC 3CJTA 2Y27A 3OQ1A 1SZCA 2FW9A 1RVDA 1OGIA 4D9MA 3MK31 3OBBA 4MYDA 2DT8A 1FC0A 1WF6A 3DE0X 1Z06A 2G09A 1E1MA 3FVQA 3G9QA 2I8AA 2BM0A 4LCEA 2OHGA 4N7JA 2FSFA 2NV0A 3I32A 1UDAA 4IHQA 1VCNA 3RTEA 3T95A 4DA4A 4I66A 4BNIA 2IHNA 1HTTA 1VXRA 3P26A 3HEBA 4JI3B 2XYVA 2ZROA 1KEVA 1UKCA 1L8LA 3PHHA 5J4KA 3ZHUA 2Z5LA 4G1VA 3AONB 3I4FA 4D57A 1G8JA 3IVMA 4JBWA 4JT9A 4L8WB 1LZKA 3FNHA 3H6GA 2WB2A 4E33A 2BGRA 5CHEA 2OCLA 5LMCA 1ZC4A 1YKSA 4JYBA 3DMTC 5JPCA 4D6XA 4UVGA 5IVKA 4PQYA 2WIBA 1U7ZA 5AKJA 1E2UA 2JLAA 2I9KA 2CGEA 4DC9A 1EXWA 1ZH6A 2ZJ8A 2YICA 5G1NA 3RVRA 4CMKA 5A6VA 4J2OA 1QH8B 3I09A 4U7TB 1ZMXA 2HK8A 3H7IA 3SZOA 4ALLA 2VPQA 4RVFA 1Y6GA 4RYDA 1A7JA 2YY6A 2VHJA 2JK0A 4LDZA 1PT7A 5HGXA 4DC0A 1PEYA 4ALJA 3SIPA 5JY6A 3I4LA 1CR0A 1NVEA 5I9IA 5IVPA 4RVCA 4JY7A 1D7AA 4X61A 1W4ZA 3OWOA 3G0BA 4XARA 2DWQA 2QRJA 2IZ5A 1VKRA 2FGJA 1JA0A 1N6HA 3T7KA 4WFQA 1T9BA 1TCCA 5AKIA 4KKXB 4E5KA 3C43A 1O3YA 2AXPA 4FHEA 1E0DA 1TT5A 4EW2A 2MINB 1ZK2A 1MRZA 2WHRA 4EY5A 1CIVA 3DONA 5H7XA 5TARA 1HDIA 1YZNA 2J3QA 2HUPA 3ZJTA 4PTLA 5EMLA 3M0EA 3GEMA 5AI4A 5EIEA 1A9SA 3CZRA 1FQWA 4KAXA 4LJYA 4FT4A 1DWPA 2AMYA 1TLFA 1BA3A 1OMOA 1P9RA 1ATZA 5FJIA 3ZQ6A 2V4MA 1RAFA 1PWYE 4DNOA 4DMKA 1V7PC 1ZOSA 1CY1A 2EX1A 2JLSA 4MDHA 3AESB 3DD1A 3ND5A 2E87A 2DKFA 2FPSA 1U8UA 2G4LA 3DAHA 3RNOA 1GTJ1 3IMFA 1B93A 1J97A 5I45A 3ZTTA 1QHGA 3H9QA 2JBHA 1JYEA 2QQ0A 1ZK0A 1QHYA 3WYFA 2GN6A 1RJFA 1Y8CA 3N70A 2BHSA 2YWGA 5HF9A 4YJGB 2NZXA 1EGQA 4LJ6A 2ZB7A 3G85A 5FBKA 5A1TA 4F96A 4QFDA 5K2OA 3P5BA 4BU1A 2ATEA 3DC2A 3DFMA 1ZOPA 3N2IA 3NBFA 4RZIA 4PBRA 2L2QA 1R1DA 1RPJA 5G1OA 2VWQA 4CV2A 1RWBA 3TLCA 2FVXA 5JATA 2CKMA 1QQAA 1PWZA 1C9MA 2HMUA 3GDFA 4KQHA 2P9ZA 4QL3A 3L7JA 3K2EA 2XCSB 3JSAA 4KX5A 2NPFA 2VJPA 2A1TS 2HPVA 2MSWA 3ESQA 1K0UA 1P0PA 3NHMA 4F8JA 1YASA 4QHYA 5ALEA 3MCTA 1Q44A 2TS1A 4FEYA 4DR3B 3GJ8A 1ZP6A 1X42A 2AB0A 2D1YA 2EW8A 4D8YA 3D2AA 5KMGB 2DKOA 1U7DA 2OGUA 5KYVA 3I2IA 1FUKA 4Y0AA 4AF8A 3H99A 4B6QA 3OQNA 1NUAA 2D2VA 2GN9A 3THWB 3U4MA 3T7IA 1V6CA 2P7HA 1ZX1A 3CF0A 3U17A 4RTKA 3DT9A 4Q34A 3VA7A 1H4TA 4FFMA 2PRYA 3HDHA 4JLNA 3WOHA 3FXAA 4YQFA 1PLLA 2RGDA 2ZRGA 5C1DA 2FG6C 1P1FA 3OZTA 1M1YB 4AT1A 3QBDA 4KQXA 4E13A 5JO9A 4UPVA 2HYDA 1SPBS 2VF2A 1J9EA 2C0QA 5SV2A 2RHOA 3JWJA 3PNQA 3DBRA 3H2YA 1L5NA 1EM6A 2DOKA 1VLZA 3H97A 2XPCA 4LK2A 4BLQA 1ZM3A 4IEFB 2R60A 3H17A 4N5IX 4ZZ3A 5B6IA 5BW8A 2JBAB 1Y5MA 1KI6A 3FPCA 4FKZA 2Q5CA 1PF7E 3PLAE 1IL0A 2AFIA 2GAAA 2VYFA 2J3MA 1IZ8A 2FPMA 4H0CA 4F2DA 2GVZC 2ONYA 3T61A 4DA9A 4RQUA 1TUIA 1YB1A 4RA9B 2OYRA 1P7YA 2AG8A 3GJRA 4Y1EA 1NDHA 3P94A 4EKGA 4YUXA 1IQRA 4QA9A 3GXBA 3MRTA 4ZZ1A 3V9AA 3HJGA 4ZMSA 3G0GA 1J6UA 4W1QA 5IBPA 4BNKA 5K8CA 2G3YA 4KTTE 1NVUQ 1I1HA 1YQDA 2NZUG 3O3OB 1DBVO 2YJNA 2M6LA 4EHHA 4ZVUA 1PFYA 3JZIA 3MRSA 4TLCA 3RWMB 2RGRA 1U9IC 3DHEA 5HILA 2HFJA 1RAEA 1TYAE 3KQKA 5I9SA 1C7IA 2DP4E 1MMFB 3AFMA 3MOGA 4BO9A 1DI0A 3OUZA 3L05A 3QVGB 1GQRA 3M5CA 5CCXA 2TYSB 1XWFA 4L1KA 4J29A 3ZU4A 3L1KA 1Z0AA 4OK6A 1BFDA 4EY7A 3OZEA 1A9RA 4HZIA 2XMGA 4OH7A 5DNEA 3JVIA 5CDUA 1KS9A 1RHQA 2QTZA 3ED1A 1M8FA 2ADOA 1TZBA 1Z6YA 4TZ0A 3X43A 3K35A 4X62B 3KQNA 2IH5A 1H2XA 1XFAA 5TDHA 5TVKA 5L3QB 4QASA 1NSTA 2ZUUA 4NF2A 2NTJA 4BJ3A 1EFRA 2ZTHA 9ABPA 4GLJA 5K0SA 2QLBA 2HU8A 3FAKA 5ER6A 5FTKA 3GGJA 4DUPA 3P0HA 1Y7IA 3PHCA 2A9KA 1NMSA 3VV3A 2I4TA 4FCVA 1UP7A 4TXHA 4CEJA 4WI1A 3EWAA 4M55A 1L5WA 2X5NA 3H5OA 1CUWA 3QWIA 3QZUA 2PXAA 4RE6A 4C5BA 2ZM6B 3NHUA 2QU8A 1J21A 1GNLA 4FX5A 2DQSA 2Q8PA 2EZUA 1NG9A 2FXIA 4QX6A 5GJCA 2EX0A 2J33A 2AE2A 1R4MA 5CXQA 4WXMA 1K8QA 1S0UA 4FZ3A 4TQ9A 1SC1A 4EF5A 1S2IA 4JNKA 4F1JA 3CVXA 1IVNA 4BVLA 3KR0A 4Z7JA 1WHSA 4CKZA 3GLFA 3I0MA 3OPYI 4BQSA 4KYIB 1VKZA 4EYEA 2WBLC 3R74A 4XIJA 3TUIC 2Q2VA 10MHA 2JH8A 3ZV3A 3M2PA 4DNPA 3I2YX 1HG1A 4AP5A 2HADA 2FRVA 2VDVE 1EHIA 4QQFA 4XQGA 1KXZA 3MYRA 4JQCA 3THOA 1T9GR 1G59A 1VQ1A 3BH0A 1TVMA 1UBSB 3OPQA 4E31A 3A6GA 1P5JA 3CRVA 1BDHA 3GR6A 4UAGA 3CEAA 1MDBA 2NSDA 4K86A 1UJCA 2AYXA 4DZTA 4DQ0A 3E5MA 3TLGB 3H9UA 1A5ZA 4GVPA 3NT5A 2IYNA 4BMOB 4YK7A 3NPMA 4XGNA 3EXIA 1I1NA 1SR8A 1PGJA 1TMKA 5EMMA 2E5LB 3C7TA 4ZCRA 3HLYA 1DTEA 1QQTA 2GXQA 3IAAA 1LV7A 4G5OA 4MUFA 2GZ3A 4NC9A 1EXMA 1PDWA 3K1AB 1VIAA 4JC8A 4QOGA 3UC9A 1TLLA 2PV7A 2V7PA 3UV6A 1HYGA 5CFLA 4WFIA 3RDPA 1IRXA 1SQ0A 2IW3A 2VAPA 4JJ6A 1WUYA 4CCSA 4I1OA 3P0FA 1H3FA 2VZLA 5CGQB 2WAOA 4RSGA 2IE0A 4NNJA 2CN1A 4LMBA 5D5PA 4TV9F 3MRVA 1PTJA 3AHDA 2PH3A 4Y1FA 5E4TA 2DFVA 3P27A 4WECA 1OFUA 1XNJA 2O8BB 1SU6A 4PPNA 4XGIA 4GLLA 2QPLA 4X64B 1V6SA 1Q0RA 3HCOA 1ZS9A 3FLEA 2AN1A 1X92A 3IQXA 4D3YA 3OMWA 1H2AS 5EWMB 4Z0TA 4NYIR 4ZOLF 1E2BA 1BMFA 4PPYA 3OD5A 4ZREA 1EXVA 3R7BA 4MQUA 1OZ0A 5CDFA 4MULA 2IHJA 2WUGA 4NOKA 3QWBA 1R15A 4EG7A 5KU1A 3KQWA 4YP6A 2WTXA 4GRIA 1PW7A 4H16A 1V7CA 1QHHB 2XRZA 2P9YA 2WTEA 2GQ0A 2VZ8A 2XKAA 5GOZA 4XEHA 3L7MA 1OLXB 2IXEA 2WJ4A 4N5DA 4FDUA 3UHPA 2QBYA 2O06A 1XQ6A 2YXEA 3C7KA 3K9CA 2QA5A 3E58A 1Q7BA 3P5SA 3M33A 3QVJA 4ISBA 4LX8A 4I1RA 3LRXA 2RHDA 4AUNA 4F92B 4KSCA 1CSEE 3E9ZA 3BCUA 1GZHB 3VM6A 4F4IA 3THYB 1SCKA 1FS5A 3H9EO 3K09C 4B2PA 5HUJA 3ZWMA 1N6NA 1I5EA 2OBMA 4QD3A 1DTWB 4BLUA 1BD4A 1BU5A 5HTOA 3L18A 2GNAA 4CV1A 3HCNA 4L9WA 3KE9A 4R2MA 1QH0A 1PUIA 4Q3OA 3FUUA 1JILA 2AXEA 2GZDA 2NXCA 2XLBA 2GM9A 1OLUB 1IM5A 3K73O 4OA8A 3WHPA 3GD7A 4F9FA 2PZGA 1T0BA 4GUAA 4NECA 3TUJC 4DIKA 2B3DA 3B1YA 3PNSA 3AUYA 3D9QX 5T8KA 3V48A 1H8HD 4OQLA 4JV5B 1ID8A 1KMIY 2XCLA 3FJ1A 3K0CC 4HN4B 4CM9D 4XGQA 3H65A 4Z7NB 3CEMA 1Q0HA 3M9LA 1FTGA 1I33A 2QLJA 4QUDA 3BXHA 3EEYA 3GEBA 4MO2A 3RB8A 2G4VA 1CQPA 5EYPA 2C00A 4HRXA 3GNSA 1Z17A 1IN4A 5FHQA 2HDWA 5DLPA 2GPYA 2XDYA 4JC5A 1KQOA 1U9ZA 1QYCA 1VBNA 2PZKA 3LNTA 4NSNA 4OJKA 4QPDA 3UUWA 4R68A 3WBFA 5BXYA 1OGJA 5BW4A 5JH7B 4I19A 4KN6A 3V46A 2GETA 3WK8A 5F2NA 1IVSA 1RYMA 3RV3A 4DGSA 4GLBA 1VYTA 3W6NA 4KSBA 5K8LA 1KI9A 2HJSA 1A95A 2AFHB 1EVLA 2FUG6 2PMWB 2V5VA 1NBME 1N2CB 3KKQA 3NHKA 4FEEA 4RL4A 4TM8A 4W1SA 3E0QA 2OKGA 3NJ8A 5LWHA 3HZRA 2LNDA 4HO1X 1YMQA 4CLOA 1UJ5A 1PR3A 3DKRA 3HCDA 1L1QA 3RWBA 6CHYA 5IJZA 4EF4A 3GDWA 1R0SA 1U2RA 1EZ1A 2I4RA 3PUVA 4N6NA 4QAJA 5GGYA 4ER3A 2D1SA 3MUFA 4DUGD 1O6ZA 5EE1A 4OPMA 1EWYA 2VHXA 1HDEA 4JKOA 1VL5A 1I32A 1RQ2A 2EP7A 1I6KA 3IQGX 1IDN1 3ZE0B 2N3ZA 4BB0A 5EHXA 3GGCA 4G1UC 1X7GA 3KXPA 3PVCA 1PUJA 5LYJA 1P4RA 1Q3HA 3N2GA 2ZU0C 1QG2A 3FCSB 3FW1A 6REQB 3L8ZA 4ZDKA 4YB8A 5DHRA 5A04A 5DCYA 3ZDFA 1OI4A 2F1KA 1GRQA 3B9BA 3HM9A 4MYHA 4FKMA 4YGYA 5FTLA 1H6DA 3OLXA 4H4EA 3TIFA 1EEXB 2AIRA 2WOJA 2ZSIA 5HVNA 2PRKA 2B0CA 4EATA 3CBGA 3WC4A 2M32A 5KVSA 4NS4A 3VOTA 4GDMA 4S0XA 2QNBA 3NHBA 4LJ4A 4S35A 5IH3A 1G7CA 1HE2A 5FWYB 3V42A 4F2WA 1OLSB 4E51A 3IIMA 5JZ9A 4I6GA 3PYXA 2HJVA 3ZK8A 4ZDJA 3Q8KA 3JU3A 4KK4A 1DAPA 1H0RA 3AEYA 3JQAD 4MVJE 4DMFA 5C7LO 3ERCA 2ESRA 3UB4A 3UGQA 4AXXA 4AJHA 1EA5A 1TYEB 2NO5A 1X0XA 4KGDA 4DMRA 1Z2EA 4ONEA 1ZI6A 3RODA 3QU9A 5DLYA 4B7UA 3AJ8A 3B1WA 1C41A 4J49A 2G6TA 3OIDA 4RK0A 2BEWA 1V4BA 1M34E 1YCFA 2A0KA 1ISSA 3U1VA 4H17A 5J2UF 2EJUA 4G85A 3Q3VA 3OQJA 2OV6A 4N7MA 1KYIA 4MV0A 1AF7A 4URVR 5CEFA 3R9XA 2QG4A 4FLFA 3AERA 2JH9A 5MGNA 1XZNA 2EGGA 1F9AA 3OT5A 4D9NA 3F5QA 3GLUA 1D5CA 5FD8A 3SKXA 1GQOA 3T35A 4BNJA 2GD1O 4LMRA 5AW1A 2IYYA 3NM4A 4NDZA 3PUKA 1QKIA 4WCVA 3HBAA 2JGMA 3RYIA 3RI3A 3P19A 4COOA 5KYXA 4AWAA 2DBYA 3KAQA 3E5NA 3BREA 2HPHA 4EQZA 4B6GA 2YDXA 3HBNA 4ZA2A 2J3IA 5ECWA 3MGKA 4QPPA 5J3JA 3IDQA 2HNBA 3F49S 1QANA 2H3EA 1XCGB 2GGSA 2W2QA 3PXDA 4FXPA 4ZEWA 2Z0MA 2QTGA 3FOCA 3MUNA 2Q6IA 2H48A 5DWVA 4PN7A 2D5IA 1A7AA 3MUOA 2RIPA 4IY1A 3P2MA 1PFUA 4M21A 1XMQB 2VP2A 4RWEA 4BEVA 5EAIA 3KTDA 1QYXA 4BPBA 1CP2A 1Z12A 4A0SA 1DQRA 4MW4A 4AG6A 3TZCA 2CJYA 2IYFA 3CF2A 4D9GA 1F9EA 2FPLA 4DOMA 2GLUA 2CSXA 4RTPA 4DR1B 3MLAA 1GSAA 4D02A 4N76A 1XL1A 1GG9A 3MS2A 4OHRA 3L7LA 4P58A 1PT5A 2VHWA 3L4BA 3T9DA 2OCBA 3B5EA 2QTMA 2ZAYA 5JROA 1K1EA 4ARZB 1JEEA 1IC6A 3RFXA 1YULA 3T15A 4BO5A 4DMUB 1U3UA 4E5MA 3OQPA 4CHGA 2ANBA 4ON9A 5FOQA 1BMTA 4JWKA 3ESCA 3NYQA 1MD9A 2GD6A 3DXFA 3LWNA 4P3KA 3CUYA 1VLVA 3JVDA 2RH8A 2YJ6A 1IH8A 4X54A 5LA6F 2XYRA 1DWQA 1K5HA 1UBHS 4DLNA 2R7NA 3PEYA 5IUJC 2WSYB 3AZQA 4K9MA 3OLQA 4AN0A 5LQCA 4QXAA 3QU5A 3I12A 4L0DA 3OZWA 4PLCA 5ERGB 4HUJA 4DRXB 1DCFA 2FPIB 3H16A 2NYRA 4KOAA 5EZ5A 1T6ZA 3C1AA 3H2SA 4UHKA 4B5LA 2YX1A 1ZO8A 3P2EA 5D86A 5BPFA 2OXRA 4IIVA 2QXTA 6AT1A 4ZP1A 1RI5A 2BTQB 2IHUA 5IRCD 1A0OA 1NM5A 3N2KA 4UD2A 1UZLA 1GXSA 2IVFA 4B7CA 4FSHA 1QHSA 3KTAB 5DFAA 1VMEA 2H5EA 1Q17A 1Y8RA 2OGSA 3F5FA 4UAUA 1IHOA 2HUNA 3N6RA 1Z5VA 4ED9A 4NBNA 4Q0MA 2GLTA 4ZGBA 1DXYA 2XGOA 5J5VA 4DV2B 3MMPA 1SUCA 5HIAA 5GAJA 2WSBA 2C2YA 4L72A 3DWIA 4JDUA 5CVDA 4Q4JB 3H11B 2W2KA 3A27A 4IIHA 4F06A 4ZGWA 3M4ZA 3WLHA 1TEHA 4IQ8A 3LBYA 5KCMA 4YJFA 4KSYA 4BTLA 3F3KA 3VPXA 1D2EA 5AKLA 3EPKA 1N3IA 1YKGA 2YL2A 3K9BA 3W5HA 2GK7A 1RZ3A 3D6VA 5C4GB 1E3DA 1H22A 2B5VA 3LT5A 1MV5A 2YRFA 4LJAA 2YWXA 5JCOA 2ZIEA 3TOSA 5J4YA 1KYXA 4JBXA 1SQSA 3A4TA 1W96A 3AR8A 1BJRE 2XUJA 4LRYA 1IUNA 5CMLA 3IQFA 3ZKWB 4C6TA 2BF4A 1EIWA 3CS3A 2V8BA 4GKBA 4W9NC 4C0HA 1CVIA 1ODIA 3B12A 3I64A 1GCAA 4J7UA 3PQFA 3MFYA 4PG4A 1RHUA 4TMYA 4ZVRA 4YRKA 1JHUA 1XCLA 5IARA 1FTNA 1G3UA 1AQLA 1LW6E 3QJYA 4GYWA 1U6KA 2FZEA 1VZ3A 2OCGA 3ND9A 1WL8A 1ZA2A 1Z5ZA 3BICA 1BQ4A 2RSLA 1ZUIA 3L0CA 4GS5A 4RD0A 3AXSA 5I7VA 4JXJA 2NUAA 1QFYA 2J46A 3MWGA 2HPAA 3F1KA 2FMXA 2D54A 5JT1A 4Y2JA 3PJFA 2EL9A 1DG9A 1M6EX 2RKOA 2VXYA 3EDYA 3UHOA 4DQKA 3KLPX 3Q4GA 3SS9X 1QYDA 4D3XA 1Z07A 2EKLA 2NXNA 1QO7A 2D1FA 4MA4A 5K3FA 2CV0A 2IV2X 1HXHA 3GZJA 3EBPA 3IBCA 3ODGA 1TK2A 4FQ8A 4ZT7A 4QLOA 3QJGA 2E0IA 1DAMA 4B33A 4HLQB 3WYGA 2EHJA 2GK6A 1T6YA 1WKBA 1OY1A 1U0HC 3JR3A 4U6NA 5K0EA 1NN0A 4I1UA 4Y9UA 2H2DA 1XPUA 4ND4A 2DH5A 1O6BA 5J2TB 1DC6A 1T6NA 1MPTA 2YUIA 5DOVA 5K45A 1C0PA 2CLIB 4TVKA 3REQA 3HS3A 2H4XA 4M54A 5G0VA 4G65A 1JHOA 2XCUA 3CO5A 4MKHA 4EGSA 3R6WA 1ISFA 1LI5A 2CL6X 1LRKA 2OENG 2G9RA 2YCLA 3BE5A 3HJNA 1FCJA 1NW8A 2PS3A 3MOSA 5K3SA 5C8YB 2K2WA 1ENPA 2YRWA 5WRFA 2ZB8A 1XZGA 3EVGA 3RT7A 2IODA 4ER7A 1NZDA 2BBTA 1UMDB 2GM5A 3QVGA 2YVUA 3BWYA 2C54A 3ITNA 3C2QA 4HDNB 3T1QA 3T7RA 3H2KA 4RK7A 2H9AA 4H4CA 1Q16A 3CG4A 3T5BA 4OXXA 5KYYB 5LP6F 1Y6ZA 4UZEA 3U4AA 1C7RA 1UFVA 4BRSA 3BK1A 3N3AC 1IG3A 1RMYA 4IILA 4QOFA 3EVTA 2XD4A 3I34X 3SBOA 2OXCA 4OY3A 4HAIA 5CFQA 2RCNA 1C9KA 1L7MA 1T4MA 5COAA 4IWYA 1Y80A 4RHYA 2ZP1A 4IG4A 3D02A 3GLQA 4YJHA 1I7QB 1VJGA 4LK3A 4YRAA 3IQHX 2JFOA 2CVHA 4Q1BA 4Y6OA 5GGXA 4RPGA 3SBDA 4DY6A 2ZXUA 1WPQA 2JJ1A 2BZGA 4M46A 2C0PA 1ONNA 3U7FB 3FNGA 3W7AA 7AT1A 3DE3X 2OV1A 1T9CA 2UVDA 3IT3A 3CUKA 4RUKA 3H4IA 5T3YA 4B6PA 1LXCA 2JFPA 3B1KA 4J1SA 3PSAA 3IDFA 1RWPA 1JHDA 3W3AD 4HWSA 4UPDA 3EZFA 2A9JA 4W9RA 5K0GA 4I50F 4I55B 5C5EA 1QGDA 3UMFA 2W58A 5LZ7A 3BXPA 4IF6A 1I24A 2VYVD 2C9BA 3I2GA 1O2DA 2QUJA 4ZDWA 1QVRA 4UDNA 3CCFA 4LY0A 2E1RA 4C0WA 3IESA 2OFWA 3H42B 1JDZA 1ZD4A 4KUGA 4WIAA 3OC6A 5DM0A 1KEWA 4EW6A 5JAOA 2H7YA 2C8JA 3ZWBA 3MT7A 1GFZA 1B8PA 1ZINA 4YJ2F 1VHQA 2GEJA 3NMUF 1KZYC 4MP8A 5HKKA 3AU8A 4NESA 2C61A 2MU1A 1PT9A 3G9UA 1NUHA 4KPUA 3ZWKA 4BP1A 3EHDA 4G5HA 2O7RA 4WN3A 3C8MA 1GPUA 1K06A 2IEBA 3DWFA 4FCTA 3VH4A 4CQNA 4HXEB 4DWJA 1PFQA 5IBQA 1ISRA 3R0QA 2CNBA 3OFVA 4AXBA 1CJVC 4Z1OA 1IPEA 1A4UA 4AJ1A 2GHRA 4F4UA 1L7OA 2YJZA 3TIIA 1GV0A 1G21E 1N92A 2GCEA 4RIIA 5COBA 3CCCA 2I7VA 1H5UA 3K72B 4MJ7A 4MQFB 2JCSA 3HFJA 3CV3A 1ICEA 4KI0A 2DPYA 3FTCA 3HUUA 2YC2C 4OIFA 1QS0B 2H2AA 2KHZA 2C2KA 1FFHA 2XA1A 4G0YA 1XU9A 3TPZA 1V43A 4S04A 3I5MA 3D7LA 4R0MA 1OXTA 5AVVA 1B1CA 1PK9A 1M5TA 2DR2A 1T2AA 4JCCA 1ZN7A 3NBAA 2XUFA 3OT4A 5JBNA 2OD7A 1H1DA 1NKSA 4EUHA 4PW0A 2JLWA 4GM4A 1V95A 3KHSA 5T6BA 2WIAA 5D7NA 3CSUA 5EJIA 1Q2XA 1WSWA 1HC7A 2PL9A 4OU5A 4B6SA 5CFZA 2W0MA 2QXYA 1H69A 1WCWA 3M6VA 4BFCA 4G6ZA 4A0HA 3WV4A 3W8DA 3IIJA 1NVTA 1ZEJA 4FC7A 4JXKA 4TQGA 3VRHA 2IH2A 1ZQ9A 2CD7A 3R5SA 1Y6QA 2JFZA 1X8JA 3I6YA 3WQHA 5CVVA 2ACEA 2O9JA 1IXYA 2FHSA 3BSYA 3N7AA 1FMFA 2JFBA 3M70A 4WWHA 5GZ6A 3RYHA 1O9HA 4YBZA 3M6WA 1L5SA 4TMTA 5IJXA 1SQGA 1X3LA 2BHRA 3PS9A 4CKWB 5B2FA 2OAQ1 1ACMA 2ZIVB 3RVPA 4PN3A 4JI7B 2VDPB 3ZX4A 4HN2A 1V3VA 2QR2A 2DLNA 5BR7A 4Z0NA 2E4XA 1R0RE 3THXB 4PSAA 1YZVA 4R4JA 4KZPA 4X91A 3TKYA 3IH5A 4AF6A 2JLQA 3N7UA 4B3TB 2ZBPA 2G25A 5LDDC 1ENZA 1Z6AA 2IQIA 2HSGA 2QQEA 4Q6BA 1OPXA 2P79A 3K16A 3IOCA 3PPWA 4TPKA 1NBWB 3K1TA 5C32A 5HZKA 1EJ2A 2I2BA 3L02A 4OQNA 3B8HA 1JR3D 1M6VB 3KU4A 1LFAA 5JOQA 1SFRA 1Z8FA 3QLVA 1WSDA 2PSFA 3E3MA 4PLTA 1WDWB 2XB6A 1BRMA 5CEJA 3OWHA 4TMWA 3MTDA 4BNDA 4RK4A 2FSSA 1LSSA 2P9JA 4LZZA 2HGSA 3CJRA 3RKRA 1XJ5A 4Z9BA 4NY1A 4DCGA 3WLEA 1E4OA 4KHZA 3RYFB 2FE4A 4XVUA 4OHBA 5JDCA 1ZUD1 2AFIE 2GEKA 2OMKA 2VDLB 3I45A 2OLJA 1QGYA 4Q9KA 1BOOA 3KVVA 4KXVA 4KQKA 1WETA 4V3BA 3PDIB 4FD2A 5GPBA 4NIMA 2XNSA 4FBMA 3CC8A 3WQSB 1FX0A 2NG1A 2PXCA 1KDYA 5KIAA 3OQHA 3KKKA 4N12A 4AZ0B 4G0WA 1FVHA 2XKJE 3BA6A 4DS3A 1GY8A 3D3WB 3BB4A 3LI2A 1POWA 5BNFA 1TJ4A 1T5BA 5KJEA 4L9RA 2XB8A 2ZE5A 1JPUA 2ZYIA 3W2FA 4CQMA 3G13A 4DREA 4U1RA 2O54A 1W9HA 2ZATA 3P71T 2NU7B 5ALWA 4HNUA 2ZYVX 3R5XA 1DNPA 3TEFA 3O8NA 5CX1B 3KPYA 3U7QB 5AJUA 3C5WP 2I2FA 5G4KA 5A5FA 1M1NA 1OAAA 2GEUA 3ACBA 3GIWA 2B3TA 3OE7A 4HLUC 5JS2A 3MN1A 4IJKA 5EJ8A 2KSQA 1YZKA 4EO9A 2AQHA 3ONVA 5U4QA 1Y5IA 4ZZIA 3EY4A 3OOYA 2EF0A 4MLCA 2BMVA 1RHMA 3FDFA 5GONF 2WUDA 2FXVA 2NV2B 3C1TA 3VOSA 1A9XB 1AXEA 1BFKA 1YZHA 4YUWA 1X1EA 2CFOA 4MQ4A 4X3CA 1WB9A 1NF2A 5A05A 2F48A 1OAOA 3FKJA 3HBMA 4MQEA 3UJ8A 2ZE6A 3TW6A 5FDFA 2JEOA 2AVDA 3TMKA 2I3DA 4LCJA 1UC4B 2MSNA 4AS3A 1SUBA 2XUGA 3WXBA 1X1TA 1BG6A 3AUAA 1O95A 1SBHA 1YNOA 4TUYB 1JG1A 3LV8A 4LZLA 1B23P 4HPXB 1LCIA 1LK5A 2XCQA 5B7QA 4I5FA 3I9NA 1XRLA 5DV9A 4BQNA 2WHPA 1KEUA 5B64A 3DUWA 3OSZA 1SJ9A 4FSDA 5EWLB 2CLHB 4F9TA 2BJVA 2N1MA 3JVEA 5IN5A 3BMCA 3A2NA 3BTVA 4L5IA 3QRWA 1F2TB 3EQ7A 1QCZA 1DAHA 1Z0UA 3D3QA 4LC1A 1TM1E 3G5LA 2J5XA 3DDHA 1AJEA 1EEHA 5AI6A 3ZCQA 4C22A 5JSQA 2QT9A 2D6FA 1ISJA 1TD9A 3GLFE 1UR5A 3Q3JB 1P2VA 3R3XA 5J4VA 1JLLA 4OJQA 4AMZA 5KEIA 1KO1A 1U2TA 2CBXA 3ONDA 5IG2A 3BB1A 3FB1A 2QSUA 5HE9A 4C6SA 1AO3A 2I87A 5JO0A 3RM3A 3CH6A 4KNWA 2OORC 4IO0A 3CRQA 3NNDA 3CVVA 1S3FA 1MCZA 1WXFA 2GN1A 5IKPA 4I7EA 3L46A 5LQJA 1U8XX 1P4SA 2IUSA 3GYGA 4HVTA 3U56A 2UZ4A 4C0BA 1I3NA 2ZRAA 2QTVB 2ZRIA 5AK3A 3B7PA 2CHFA 1QYIA 1IK6A 2DUMA 4WOCA 1R8QA 3BL6A 1XJWA 1M7HA 3JVVA 3M4JA 4X1YA 5FUVA 2REOA 1NSFA 3UJPA 2CF5A 2ZJ7A 3LUFA 4FFDA 1S8AA 3SG0A 1OBCA 2R4UA 4ES6A 3PFBA 2WQ6A 4ESVA 1U6IA 3RIYA 2GBIA 3OOEA 5CH8A 2SKDA 3HFGA 1L2TA 3SD7A 3NASA 3PPIA 5AKEA 1V16A 2HX1A 1E59A 5A9TA 3WGNA 3V6MA 3KETA 2BI4A 3W5CA 3W5VA 3DUFA 1OUMA 3HKCA 1K8RA 4Y9RA 2Y1XA 3E82A 5FV7A 3N7TA 4QJ3A 4LYEA 5AW3A 1CC1S 3FBGA 1X7HA 3FZNA 3L4SO 4IDGA 4Q48A 4B3DA 2D62A 4RHCA 1XNHA 2W2PA 4WOPA 3TKAA 1G8SA 3SEFA 2FSGA 4Y2QA 3OCCA 3ZG6A 2BUCA 2BFDB 4PLHA 3S2IA 1A8IA 2O3TA 2JVKA 5CDFE 3SBEA 3AYXB 1OYYA 3P9PA 4PAQA 4XR9A 2BH9A 1PNQA 1NC3A 2Q07A 3EXHC 3AQIA 3IBSA 5H4HA 3AF3A 3WLAA 4ATNA 2HLHA 3UKJA 4DE5A 1D4AA 1BC5A 4HNTA 3E8XA 2HI0A 1PK8A 5HKLA 3CWQA 1ZIDA 2PO7A 3AUSA 3M83A 2OBFA 2OBYA 3I5AA 3RJZA 1E6EA 1T9AA 1RP7A 5IXSA 2FEMA 2WVAA 3ZVLA 4ZHQF 3DBOB 2VP4A 2EG9A 2XUDA 1PGNA 3AVPA 5ALYA 1UDWA 3L5OA 3WI7A 1YA8A 1BMDA 3LQ4A 3T7JA 1QJ4A 2CB0A 5JNVA 3HA2A 4PO1A 3HXMA 2AVNA 2HA5A 5AVZA 1C8KA 1MT0A 2WA1A 3RUCA 2ASEA 2QM0A 1UOPA 1NE7A 1XRSB 4Y8VA 2Q21A 1YFLA 5BSWA 3IVCA 4F3RA 1MFPA 2BGUA 5TQ0A 4BE4A 2QOEA 1XDBA 3D0OA 4IXDA 5I51A 2Q1SA 3IILA 1TVKB 4M1KA 4RU1A 1DCMA 2QD3A 4EA7A 3E27A 1GL3A 3KD3A 3A9RA 3MINA 5IEBA 4QSMA 2ILVA 1GZUA 3DHWC 2ECQA 4N8DA 5EWJA 4DHEA 2WKPA 4JC0A 3OPVA 1XK6A 3ROEA 4O63O 2O8EB 3DAOA 1YCGA 5CA0A 4U7FA 3SEAA 1DBQA 4C20A 4Q4HB 1MFZA 4IIJF 4JL5A 1CUHA 1PWXA 4O2BA 5E0KB 4XWKA 4YHHB 3H2GA 3PEUA 3VHQA 1D6NA 5H3CA 1CEXA 1H2FA 5NULA 1BMFD 2BPOA 3UNXA 5GVSA 4QM7A 1PGQA 3V1KA 4ENVA 1MJNA 1W6UA 5ALHA 4BQFA 1FUYB 3IUNA 1BCRA 4JR0A 3BWXA 4HB0A 5JNSA 1UWLA 5JZSA 1JEOA 1RMQA 2BM9A 1HE3A 1H6BA 2H5LA 3MJSA 4N1AA 3T7DA 3ZDXB 1G3RA 2BE9A 4CMIB 3WMXA 4W82A 2JZCA 3BXZA 3U80A 1YK0A 1YS4A 2AMLA 2HQRA 5EA2A 2GJ4A 5CAEB 3UJHA 2WTMA 1D5WA 2FY8A 1L5LA 1GZDA 4NPAA 3ZY2A 4D92A 2XZLA 2P2CA 1E3WA 4RZ2A 1CE8A 2HZBA 1E3QA 2VZ9A 4G01B 3M3DA 1R4AA 5G0SA 4DJTA 4IQ4A 3OI7A 2CEAA 1DBIA 3A6FA 3DPUA 2CHVA 3MTBA 5DIFA 4JUFA 3FTFA 1ZNZA 3FMIA 3F6RA 1RS0A 4YROA 3W5IA 3DFIA 2ZJ2A 3TR6A 3NTRA 4NENA 2NT3A 4GOOD 1WB4A 4TKUB 3NKVA 4V2UA 2G7ZA 2GHIA 3JASA 1XDDA 1G9XA 1WB6A 4KU4A 1US8A 4CGZA 2YWJA 4MIOA 3OZRA 1J06A 1J1ZA 1IHXA 1I6MA 1LS1A 3FYUC 3D8UA 3F6YA 3ESDA 4ZI7F 4OGKA 2OV3A 4G25A 4W5OA 5EIXA 1AHNA 1EG2A 1JECA 4LDAA 1YHNA 2F6RA 4OBXA 5AVJA 1JMVA 4A8TA 3O8RA 5DWDA 5E95A 4QBHA 1AF4A 1E77A 2R8BA 1OZHA 1KFEB 2XE6A 1QCDA 1XN4A 4WJLA 5CA1F 1RXVA 3FJYA 3ILHA 1Z6PA 3VSBA 2PYDA 1FFXB 2JFXA 2FE1A 1YWGO 1T10A 2ZYUX 1T1EA 1N3BA 2X6QA 5F9HA 4NAVA 5A3SA 1E2GA 4JQYA 2QTTA 3EUFA 1JDNA 4NTZA 4I1VA 4MO9A 4XKJA 5EFZA 1NNI1 3FPLA 4BJ6A 4CUJA 4ZHSA 2GOYA 4JB8A 1TX4B 2FOXA 2XGGA 2C5GA 4TL8A 2X7XA 1R9JA 1C0LA 5FT9A 5L9AA 5FUWA 2VCEA 5ADUS 4EX7A 2J6IA 3IMEA 2XI4A 1GEGA 2P5TB 1PX2A 3HEMA 3S7ZA 4GI3A 5GP1A 4F5WA 4TM7A 5B1YA 2G72A 1YBAA 1FSSA 2HKIA 5BN3A 5JRJA 2VTBA 4EVIA 2H2GA 1Z16A 2M1XA 4A7PA 4OGWA 3VYRB 3D64A 1F4VA 1RLTA 5EP2A 2GXSA 2LZ0A 4I9FA 3SFVA 2QI9C 4YX9A 5HQ3A 3RGGA 3FR7A 1UZAA 3G1WA 3S55A 3UA3A 4L85A 1JJ7A 4C29A 3T3DA 1E1QD 3P9CA 3CFYA 4RKEA 1USKA 3O7WA 3EFOA 3MZ0A 2HHCA 3WGQA 4JX8A 3V4SA 4L2IB 2ZRHA 2BGMA 2GYUA 2XNCA 1LBTA 1DBWA 4I14A 4IFEA 3TZQA 4BE9A 1N1EA 1OBFO 1MIOB 3ZDBA 5EJEA 2ZB3A 4X65B 1GZVA 2D59A 5HSGA 3TI9A 3U39A 3HA3A 4GT1A 3BTOA 3IAS1 1SEVA 1JA1A 1LWNA 1W35A 1HI9A 2OGZA 3A1WA 3BJMA 3DYVA 4QUAA 5MN5A 1TKRA 4L4RA 2I2AA 2XXJA 2FEOA 3F3SA 1EI9A 4JASB 4A6PA 4L7QA 3ROPA 3FROA 621PA 3DMPA 1GM5A 4E07A 4XQ9A 3SF8A 1E9AA 3BE4A 2IF0A 4YUZA 5MN4A 2YXNA 4ZQEA 3CO0S 1A5AB 4LTNA 1X1RA 5EZYA 4BP3A 1X1DA 4ZIRB 2J5RA 2OV4A 1WSBA 1LX6A 2FLVA 1TTPB 2D2EA 3PUHA 4XD2A 4UMEA 2ZUBA 1E9SA 4FFNA 1DEXA 1JR4A 3G79A 1WZNA 4FUQA 5LLDA 1FP4A 2JL1A 2XB9A 5B7PA 2WSIA 3HJAA 2Y76A 1EP2B 3K4HA 2GXAA 2JIQA 3NAMA 4FNGA 1K4YA 3RR2A 5CBPA 4N6OA 2PS1A 3JTMA 1JYSA 2QL9A 5B58C 2GZAA 3HKEB 4DQLA 4PZCA 5AFSA 4YJ3A 2FQXA 3IAHA 2GN4A 4QYIA 3ZTYA 1ZSVA 1KKLA 4X1KB 5CB4B 2V0CA 1SIOA 2WFAA 5EQTA 3RS2A 2H65A 1ORRA 2J3LA 4D4LA 5DOZA 2PBRA 1CRWG 4M2LA 3L8GA 3PHLA 4ANFA 2D13A 2VDWB 3G5TA 4OAOA 5AJVB 2HA7A 1BX3A 3E9NA 2E5FA 3MTJA 4JYCA 3WSTA 2FKAA 4KPFC 3ZR4B 5AK4A 4YT5A 1SCUB 3KRTA 4Y9TA 4FKBA 3FN4A 3D5EA 3B5IA 3W06A 4FMCF 1DIRA 1ZD3A 3OHMA 1L3IA 5DMXA 2DCUA 5HDBB 1Q0SA 1PTKA 4MKXA 3ZWXA 5C1OA 1BVHA 4FD3A 4EI2A 3OCYA 1HT0A 3HVUA 1CEYA 1N9GB 2O1EA 1CJMA 3CX3A 5B53A 4XPIB 3U37A 3KUCA 1DJPA 2V59A 2WPDA 4ND1A 3AJ9A 4UCXA 5I4CA 1EWVA 1G41A 3KLBA 5ICFA 5A3RA 5LZ9A 1PGOA 3L01A 4F8EA 1ZK3A 4EX6A 5JVDA 1E9FA 4ECEA 3AJAA 3M3PA 5IP5A 3USES 3H5RA 1QZUA 2E9SA 3X0DA 3M4XA 3ABIA 5IKXA 3ONNA 2J0VA 4IGIA 5ALXA 4KG7A 2VQDA 3RVSA 5IJ9B 4FQ7A 1N8NA 2GUWA 2ZGVA 1H2RS 3DBVO 5H16A 4QPCA 2NV6A 3V8VA 4QIHA 1DWOA 3WA7A 2A0XA 2Y2VA 3VHXB 1R8JA 2XQIA 1HLGA 2UKDA 3MNFA 4TRJA 5DJ5A 5IM4F 3FTPA 1MX5A 3T9FA 4CL8A 3P96A 4ZI2A 4EGJA 1TT7A 3RFTA 3RD5A 4EFKA 1ZAYA 4L3WA 2WZCA 3FLMA 3HNOA 1ZH2A 4CLDA 2EEPA 3T5PA 3CPEA 4ZJYA 2IKSA 1C1YA 2V58A 1B14A 1M1YE 3I9LA 3MLEA 4FNAA 5IYZB 3QYAA 5L3SB 2QRKA 3H5VA 4WBSA 1SQ6A 4ZWNA 4QDZA 1RBQA 2OUIA 4YLYA 4WN9B 2BMEA 3DCNA 1T0UA 3UT0A 2HC9A 3NVKI 3IYLW 4RZSA 4AWBA 4BZZA 3VNUA 5FIUA 1FP7A 3LOQA 4YRTA 1SA0A 1QRUA 2RDMA 3UAVA 2XAAA 1DRJA 4LOKA 1VP9A 4KH0A 4D5EA 1WULS 5HF8A 4BNYA 1G5QA 1RKVA 1FFBA 5LSAA 2FP4A 3W5SA 1VTKA 3MWEB 1VHDA 1NWCA 1F12A 1XXHA 2CFCA 2YOGA 3HCFA 3Q9NA 4IMRA 2QPTA 4PSDA 3IJEB 4Y7DA 5NLLA 3TCNA 3SVLA 4KWIA 4BFUA 1YU9A 3RASA 4RVGA 13PKA 4DLZA 4K8OA 4G0XA 2G76A 4B4KA 4BUJA 1P0IA 1ORIA 2PNFA 2AA3A 4CMHA 1F2DA 3SHWA 5BSFA 2FEWB 4G0NA 5CLIA 4Q9AA 2JAHA 2R62A 3DTVB 1E1CA 3K5PA 4I4NA 1FNCA 3A26A 3V1MA 1B4DA 2XCOA 3FPKA 1K3FA 2C2WA 1J0CA 2ZQYA 3GP3A 4Q03A 5F4BA 5M29A 4L22A 3DOEA