2WJ3A

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
TDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1-H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
publication title Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
total genus 104
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2009-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 2wj3A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wj3A01
3JWEA 1XQVA 5ALIA 3O4IA 1CUZA 3D4LA 3STYA 2VA9A 1LPAB 4QZVA 2QUBA 3M82A 3LS2A 4F5ZA 1YAHA 1BN6A 3D2AA 4WDRA 3M81A 1R1DA 1EK2A 3WYDA 1UKCA 5E4JA 4MWSA 2QZPA 4AN0A 3C6YA 4IH1A 2HDWA 2V9ZA 5FUMA 4B84A 4X91A 4U2GA 4F21A 3WWOA 1VA4A 4PF1A 2QKYA 2XMRA 4OUKX 2XUPA 1C4XA 3G9ZA 4UHFA 1ETHA 1HKHA 1QIDA 5CMLA 3PUIA 1CUXA 2G5PA 1IZ8A 1ZIYA 1E5TA 3UUFA 5ALYA 5DWDA 3ESBA 3C8DA 1EA5A 4MQLA 1ZJ5A 4X6YA 4HZGA 3O95A 2YASA 1AMNA 4BCBA 3DOIA 1G4HA 4AN1A 2EDAA 5JZSA 5FPPA 5LZ9A 4FWBA 2QS9A 2BGRA 2VEOA 5ALHA 3BDIA 4KE9A 1WHSA 3D59A 2CBGA 2UZ0A 1XRQA 5AI6A 1CLEA 4WFIA 1OXMA 3MUNA 4LXGA 4P92A 1RYYA 4GBGA 4A23A 4DLNA 1VLQA 4QLOA 3WK4A 3L1JA 3ZPXA 1BE0A 1PJAA 1EXWA 1O6FA 1XZJA 1JMKC 4X92A 2XQFA 2AJBA 4I3FA 4H7HA 3DKKA 4EUSA 5DTIA 5A71A 2XDWA 3A2LA 4Q1VA 3NWOA 4ZREA 5IVHA 2I3DA 1CR6A 3R0VA 3R3WA 3FLBA 3M3DA 1EK1A 4NZZA 1LPPA 4AZ3A 4H7DA 3NGMA 2XQKA 1E3QA 3DYVA 2QXTA 5CXXA 1CUJA 1BEZA 2EEPA 3FLEA 4MQMA 2D0DA 4Y2TA 2W22A 3GA7A 4G5XA 5I7UA 5AKIA 2VSQA 4I19A 4ZV9A 3AILA 5JD6A 3QYJA 2JBWA 4C4XA 1UT6A 4MYSA 2GYVA 3H17A 2VT7A 1ZI9A 4Q3KA 1L7RA 5AI9A 4Y2JA 3C8HA 3WI7A 3QVMA 5LLSA 4NS4A 5HF9A 3LIPA 2J3QA 3Q8WA 4B0PA 5JAOA 4N8DA 4UFNA 3WKBA 1DX6A 1XRLA 1SFRA 1J2EA 1WB6A 1GPNA 4RE6A 4D9JA 4BDSA 3KWFA 4B82A 1MU0A 2WJ4A 1IUPA 4WJLA 4W1QA 5IVDA 3ANTA 3PUHA 3BXPA 2PSEA 3MGAA 2WHPB 5CT6A 3B5EA 1QIJA 2XMSA 3DD5A 5AKYA 2XUAA 4MYDA 4J3JA 5ALQA 4QWWA 2GZRA 2ONCA 2PVSA 5CTAA 3D3NA 4IHAA 3AUKA 1VZ2A 4UHCA 2Y2VA 4H0CA 1NU6A 3W9UA 3QM1A 2DSNA 4FDMA 3WJ2A 4L72A 4B6GA 2AJDA 1A8UA 1BCSA 1UWCA 1Y7IA 2H7XA 2R8BA 3W05A 2QUAA 1UKBA 5AM5A 3STWA 5E2IA 1ZGBA 5AOBA 3YASA 3VKFA 3T52A 3H18A 4BB0A 4BAZA 2ZJ7A 2WU3A 1HQDA 2WM2A 1IVYA 5IVIA 4Y7DA 2ACEA 4EY4A 1R9NA 1JKMA 4W9RA 3R41A 4H77A 3JW8A 4ZGBA 4GHWA 2C7BA 2RHTA 1W4LA 1QTIA 1XKLA 5AI0A 4YASA 1QLWA 3HYSA 5ALXA 4S0XA 1UK9A 3WWCA 3O4JA 4UBNA 5ALFA 3FAKA 5ALJA 4B80A 3ESCA 1GZ7A 2WTMA 3IULA 5FPQA 2ROQA 1QIIA 4QA9A 1AZWA 5CT8A 3IIIA 4CCYA 4HVTA 3HC7A 3O9MA 5H3HA 5JADA 4ZWNA 4U2EA 5K5EA 5LIPA 1BU8A 2WIFA 4TVKA 1A8QA 4DMFA 1CRLA 1MO2A 3ZLUA 1WM1A 3E1GA 2XUQA 2GBFA 2RHWA 3VDXA 5DJ5A 1XZKA 4Y2UA 4FBMA 5ALGA 4EHBA 3V1KA 1D07A 3E3AA 1EVEA 2ECFA 3F67A 4DYHA 3BJRA 1XZAA 3ESAA 2WFLA 4UPDA 3WA7A 3G02A 2RIPA 1QIKA 1ORVA 2WIKA 4J7AA 2OGZA 3GFFA 4UHBA 4AMYA 4UBKA 3QPCA 5K3EA 4XX1A 4CCWA 2OPHA 4H18A 1UOOA 2RGUA 2K2QB 2PKYX 3D2BA 3W9BA 2ORYA 2JGJA 1XRMA 5AKJA 5AM1A 4X7BA 2O7RA 1ZJ4A 1YA8A 2XT0A 3PF9A 2JGMA 4KACA 3WK9A 1CUDA 1CUAA 3H0CA 2OQVA 1L7AA 3V9AA 3AIMA 5AKKA 3QMWA 4ARAA 2XMCA 5HF6A 3LLCA 1G42A 2BJHA 5EHNA 5EHZA 2CZQA 1VA5A 3G0IA 2Y6VA 3IUMA 1H2WA 2DQZA 4ARBA 4OU4A 3OG9A 3CCBA 3WK8A 3HABA 4X94A 5AOAA 1Q0RA 1SCKA 4GECA 2IIVA 1SOMA 5HQ3A 3WWEA 3X3HA 1XZGA 1VE6A 4QDXA 2PU5A 5ALUA 5BV7A 2BUCA 1XZFA 4FNGA 4N5IX 2Q0XA 2WG1A 3DYIA 4ETWA 1ZI8A 2DHCA 3WIOA 5JAUA 1AUOA 2DHDA 4HXFB 2WUFA 1LPMA 3FNBA 4J0CA 5K3CA 5DYTA 2FJ0A 3BL8A 3I1YA 4EB0A 1QO9A 4CIAA 2WG0A 4OU5A 3K9BA 1ZOIA 1DU4A 3EBLA 4HXGA 5E4TA 1UK8A 2LIPA 3PFBA 1UZAA 3TEJA 1R50A 2DQYA 2XMQA 1JT2A 2HIHA 2HA4A 4J0DA 5DTJA 1L7QA 3ZWQA 2QTBA 3BIXA 2V98A 4QDTA 3FVTA 3HSSA 4ROTA 1MTZA 1ODCA 4Y2YA 2RAUA 5CXUA 3AIKA 4PQEA 4P93A 3G0BA 4C4ZA 3IDAA 3BF7A 1TKRA 1W75A 4EY7A 3CXUA 4MWTA 3QITA 5AKZA 4BATA 3DEAA 1LPNA 5AH0A 4RNCA 5T4FA 5CH8A 5YASA 1P0QA 5I8PA 1JI3A 3FCXA 4UUQA 4B7ZA 2XUDA 4BRZA 1PFQA 4FBLA 4WCVA 3QZUA 2YH2A 4N8EA 3WK6A 4FFVA 1E66A 1K6EA 4QDZA 2C58A 1DX4A 5LZ7A 5AM3A 1X2BA 4LXHA 1GPLA 3STUA 1AGYA 4KRXA 1GQSA 2J3DA 1MNAA 5JD4A 4E15A 1AQLA 4EBBA 1M33A 3WZLA 2HFJA 3C6ZA 3HXKA 3STVA 2V97A 2OGTA 3FOBA 1GKLA 4OYLA 1CV2A 2QJRA 4HRXA 4Q34A 5AP9A 1R88A 3ICVA 5LZ8A 5SYNA 2I3ZA 1S8OA 2DHEA 1UOQA 3D0KA 1DWPA 2JF0A 3A6ZA 4LKOA 5A6VA 1CUHA 1DINA 3K2IA 1WCYA 4AX4A 4BCCA 2WSLA 3TJMA 5T4HA 4K6GA 2GBGA 5AK6A 1QIFA 3RLIA 2Y2UA 5JALA 2VTVA 2XI4A 1THTA 5HCUA 4BZZA 4J03A 4CG2A 3QMMA 5LZ2A 3C5VA 1W1IA 3AJAA 5IVKA 1GPKA 4Y2PA 4BE9A 2XLCA 4U2CA 4O08A 1IUNA 2OLEA 2I03A 3D2CA 5IH7A 1FSSA 1WB5A 2HA6A 3VVMA 3HLKA 1Q83A 1K63A 2VJBA 2XQIA 1DWOA 5AKHA 2ZYRA 5ESRA 5A7FA 4ZXFA 1QJ4A 3WZMA 5HFNA 1AKNA 3DLTA 2GBIA 1A8SA 2XE4A 1A7UA 3WJ1A 5LKRA 3QBJA 1MX9A 3AZOA 3GROA 3I2KA 1UK6A 3VJMA 1QFMA 3VJKA 2G5TA 2Z3WA 1LPOA 4DMCA 4PSCA 2IX9A 1YR2A 4EA6A 4E11A 3ZLVA 5AO9A 1W52X 4BVKA 1MAAA 4BTLA 4IH9A 3H1BA 4G9GA 1QGED 1YASA 5JYCA 1QIGA 4XIIA 4B9AA 2PSDA 2FX5A 1R4ZA 4AO8A 3GBSA 3RARA 2HRQA 4AB1A 4W1SA 3WL6A 1DTEA 4DNPA 1HBJA 4FLEA 1HPLA 1TCBA 1AURA 3IBTA 2BUAA 4DMHA 4BRSA 3AFIA 2GBCA 1LLFA 4HTAA 4QWMA 2XMZA 3WLAA 1P0IA 3QPDA 1LBSA 2RONA 5T4EA 4FNMA 3KWJA 1CUIA 1CIJA 1E8DA 4M0FA 3O0DA 3IUQA 5FDFA 1H2ZA 2XMGA 2VATA 1XQWA 3PICA 4J0KA 4Y2RA 4X3CA 5DYWA 1UXOA 3G0DA 3PE6A 2WHPA 4NMWA 2WHRA 3MVEA 2AXEA 5K3FA 3RK4A 1Q0ZA 1YA4A 2C0PA 4HXEB 4EY8A 4BVLA 3FYUC 5EI5A 1XZDA 3PFCA 1THGA 2ZYSA 5ISMA 2PSHA 1YSCA 1ZICA 1FFBA 1CUEA 2D5LA 5CT4A 5ALKA 2PUJA 5EHXA 1XQYA 1ACLA 1N8SA 5LZ4A 5AK3A 3I2GA 4LYDA 4YPVA 3SC2A 3ZV7A 1VJ5A 3RKSA 5SYMA 4GLBA 1QIHA 5AOCA 2QOEA 5AM0A 1JFRA 2OAEA 3BDVA 2HA3A 3G8YA 2CEKA 2JGIA 1TCAA 4H7IA 2WG2A 5A2GA 4U2FA 4I4CA 5EIAA 5DNVA 4P08A 2PSFA 1CUVA 4HRYA 4UBJA 1XKTA 3WQHA 4WFKA 4FHZA 2C5FA 3K6KA 5AKGA 4G4JA 2C0QA 5KWJA 2YXPX 3STXA 1LZLA 2OGSA 4G4IA 2XUKA 5EHQA 2ZVDA 4Y2VA 1K4YA 3R40A 4J0GA 5HKBA 4Y2QA 3H19A 5HKAA 3PDCA 4H7KA 3H2GA 3H2IA 4LYEA 5ALOA 3UUEA 4DGQA 1NU8A 1A88A 4JNCA 1SC9A 3LIIA 4HAIA 5DNUA 2G4LA 2WUGA 2Z5GA 4P9NA 1G66A 4FKBA 3I1IA 2Z8XA 4B0OA 4UBMA 1EH5A 3DQZA 5AI8A 4X90A 4A5SA 3F96A 4UFPA 3PI6A 4Y9SA 1JJBA 4N8SA 3KOOA 3P2MA 3FYUA 3GUUA 1CUYA 2H9YA 1DQYA 3SX4A 3FWHA 4Y2SA 4C6HA 1U2EA 2CUTA 1DQZA 1MPXA 4X6UA 3N0TA 2XUOA 5E4YA 3C70A 2XUIA 4CCYB 1ZD5A 3HJUA 3VVLA 3OTQA 2OCLA 4X71A 1ZD4A 2J4FA 4BE4A 3FVRA 1IZ7A 3W04A 4U2BA 1DT3A 5FKJA 4GXNA 3KD2A 3QH4A 1XZMA 3ILSA 1JJFA 4TGLA 5CH5A 1AX9A 4CFSA 3WIBA 2O2HA 1N5MA 2V96A 2O7VA 4KE6A 4TPKA 3V1NA 4E46A 2WFLB 4QNNA 4M0EA 5KBYA 1X2EA 1T4MA 2PBLA 4OD0A 4OYYA 2ZSIA 3WK7A 4CI9A 1ORWA 5JD5A 4EY5A 3SWWA 1H2YA 4KE8A 1EHYA 4BP9A 1UKAA 4AZ0A 3S8YA 2O2GA 1C7JA 4BZWA 5C8VA 1FFDA 4XWGA 5AKLA 4DNFA 2JGEA 1CPYA 1P0PA 1XQXA 2WIGA 1MAHA 3L1IA 1J06A 1XRNA 2X76A 5K3BA 1GT6A 5AHXA 3C5WP 2ZYHA 3EIOA 2QT9A 3EF3A 2J4CA 3I28A 4B85A 5CT9A 4IQ4A 3IUJA 4C88A 1HLGA 3G0GA 2GYWA 2BAGA 3OURA 2QJWA 5LKAA 1KU0A 1R9MA 4K5QA 3I6MA 3WKCA 3I2JA 1XZLA 1XLVA 2XUGA 1VXOA 1YAJA 3DKRA 3AIOA 3U1TA 5HQ3B 2WILA 4J0JA 3D7RA 4LHEA 5CT5A 1TIBA 1EB9A 3C6BA 3NOXA 2OQIA 5DNWA 4BVJA 1LGYA 1LBTA 3FBWA 2C4HA 3IB3A 3B3QA 2B9VA 3OPMA 3QPAA 4BBZA 5HK8A 2ZJ6A 1G5FA 3DJYA 2FUKA 5AM2A 2FJPA 1OILA 4BCDA 2JGLA 3CN9A 3ED1A 4QE3A 2BUBA 1J1IA 2JEYA 3FYTA 1LPSA 4K2AA 5JASA 4BTVA 5A7HA 1U4NA 4X95A 4MEAA 4ZI5A 4H7JA 1CUFA 1VE7A 1WPRA 1QTRA 1B41A 1MT3A 3UMJA 3N2ZB 3H2JA 5D6OA 1UFOA 2VAXA 2HA5A 2QXUA 1ACJA 4WDQA 1ZGCA 5JZ9A 1WOMA 4H7FA 1Y37A 4UHHA 1DWQA 4Y2XA 3BWXA 2GYUA 2ACKA 4G1FA 1QIMA 2X8BA 4JYPA 1F8UA 1TK3A 1OCEA 1JJIA 4LIPD 1YS1X 5JAHA 1CQWA 1QIEA 1QZ3A 5HK9A 3WA6A 4XJVA 1YS2X 3WL5A 2JGKA 3C43A 4L9AA 2HRRA 3JYHA 1PV1A 3WKAA 1N5RA 1XFDA 5D3KA 5JARA 1E8MA 5JANA 4PSUA 2HA2A 1QOZA 3L1HA 1EDBA 5AI5A 4Q05A 4Z49A 3F97A 2WLSA 2Y1KA 1K5PA 1HL7A 5DLPA 5C81A 2XQJA 3E4DA 3HRHA 4J0IA 5ALTA 1CUGA 2PU7A 3V1MA 5J3JA 5FOQA 4UHDA 4INZA 1IUOA 5C8XA 6YASA 1CEXA 1QONA 1BCRA 1EDDA 1HDEA 5KREA 2XMBA 2NW6A 3DOHA 2GZSA 3A2MA 1YCDA 2O2IA 4OPMA 5HFAA 4X85A 1GGVA 1P0MA 4XVCA 5JIBA 5A62A 4L0CA 4FLFA 3MUOA 3V1LA 5LP1A 3T4UA 1J07A 3DNMA 3FLAA 5ALZA 1WHTA 3S2ZA 2Y6UA 4MJ3A 1DT5A 4DNOA 5ALLA 2BKLA 3SK0A 2QR5A 4G8CA 1Q84A 3KDAA 4G8BA 2G63A 1EB8A 2HFKA 4G4GA 2XQGA 3DL4A 2OCKA 4IH4A 1X70A 5FV4A 3ICWA 5HF8A 5KWIA 3EQ9A 3GZJA 4W63A 1Y7HA 1H2XA 4JEIA 1USWA 4FTWA 5ALVA 4BAUA 1XZHA 2PM8A 2C5GA 2HU5A 4DTCA 2OCIA 2ZSHA 4KEAA 2YYSA 3IURA 2HL6A 5AIBA 3FSGD 3G9TA 1FFCA 3I2FA 4CIBA 1MNQA 3OM8A 4BC1A 5IKXA 5AIAA 1U65A 3HEAA 3R3YA 1O6GA 3BIWA 3FSGA 3D5EA 1ODTC 3DS8A 3M83A 3B12A 4FOLA 4AO7A 4X6XA 3WKEA 4WY5A 4WY8A 3R3ZA 4X97A 3W2TA 3DL7A 3C6XA 3AINA 1CUUA 2X5XA 4EZIA 2JEZA 1CUWA 4PW0A 4GW3A 3R3UA 4AMZA 4MEBA 3G9XA 3IA2A 5BWBA 2WUEA 5ALWA 4CG1A 4GI1A 3G7NA 3BE8A 4H7EA 4ZRDA 4M0MA 2HA7A 4MXDA 3DDUA 5EFZA 5C7YA 3U0VA 3QMVA 2VT6A 3LP5A 4KAFA 1E89A 1R3DA 3WL7A 5LYYA 1QE3A 1JU3A 1LZKA 1ODSA 2AJ8A 4Q3OA 3BF8A 4KE7A 5C8ZA 5BOVA 4OB6A 1TRHA 2PX6A 4C4YA 4L3WA 1BRTA 1VXRA 4EY6A 2BGNA 1YB7A 5D7BA 4W1RA 1F6WA 2AJCA 5ALEA 1JMYA 3HI4A 2VJAA 1CUBA 3WYNA 3EQ8A 4N5HX 1TCCA 2Z3ZA 5AKEA 4YX9A 1XZBA 5K3DA 1SCQA 5HF5A 4F0JA 4FMPA 1TQHA 3HZOA 3G0CA 3WK5A 4DSZA 5F4ZA 1ISPA 4IO0A 3HACA 4GWLA 5K3AA 1UOPA 1XZIA 4QDUA 5HZGA 1FFAA 3A70A 1UK7A 3H2HA 1XZEA 5K3FB 1XZCA 4H35A 2XUFA 1B6GA 4OB8A 1XRPA 3NUZA 1ZD3A 1VKHA 2IITA 1CUSA 1E8NA 2Z8ZA 4NVRA 5A7GA 5AICA 1JU4A 1RWQA 1XROA 4PNZA 3C45A 5AK5A 4BP8A 2VQ6A 1MJ5A 4B81A 3F98A 4FLMA 5ALSA 3TGLA 4GDMA 5ALNA 2ES4A 3ANSA 3R3XA 3IUNA 3IVMA 1VOTA 1EX9A 4QLAA 4U2DA 1XLUA 1CQZA 2WHQA 3VXKA 3I6ZA 3O4HA 1FJ2A 2HHAA 3GELA 3TRDA 2HADA 4ITVA 2XLBA 2WFMA 4C89A 2VAVA 4ZV7A 2RI6A 3VISA 3F9CA 3WMRA 4BC0A 1U8EA 2OG1A 3LCRA 5CRIA 2XUJA 3C87A 1T2NA 2QMQA 2QM0A 2H7YA 2BCEA 2R11A 5FLKA 3EQ7A 3R3VA 4PV7A 2WIJA 2CJPA 4UBLA 3WL8A 1I6WA 5JZBA 4KRYA 2CB9A 4Q3LA 4RE5A 3KSRA 4JYMA 3O9VA 4QDOA 5AI4A 4KR0A 4W1PA 1TAHA 2PPLA 1ZIXA 1H23A 2HM7A 2CKMA 5I9IA 4WFJA 4HS9A 4LXIA 2B61A 3A2NA 3ZI7A 3F8SA 5ALPA 1EVQA 1IMJA 2WQZA 4KJXA 1RP1A 1MN6A 5CH3A 5JAPA 3ZLTA 5ALRA 3FYUB 2WIDA 2PUHA 3I6YA 4BDTA 1KU6A 2CMFA 3WWDA 1GKKA 3G9UA 4B83A 2WTNA 1N1MA 7YASA 5FXMA 4C01A 1H22A 4PSDA 4C87A 2H1IA 3I2HA 1ZI6A 4KAAA 5CBKA 4UFOA 2OCGA 3VJLA 5CURA 2BFNA 4RPCA 3CCCA 3Q0TA 3DCNA 1EDEA 2H7CA 4UBIA 1BROA 2JIDA 3RM3A 3WWPA 1LNSA 1AC5A 2HU7A 4UBOA 4X00A 4DIUA 5EGNA 3OC0A 4E14A 5AJHA 4KYVA 1VZ3A 5DYYA 2PL5A 5AK4A 3CN7A 2QRUA 5ALMA 3I2IA 1F0NA 4F60A 4OB7A 2JGFA 1QFSA 2DCMA 3W06A 1SCIA 2WKWA 2HU8A 3STTA 2WJ3A 1K8QA 4AQDA 5ALDA 1WB4A 4K6HA 3KXPA 1XLWA 5FRDA 1MX1A 1LPBB 2XB6A 2B20A 3AZQA 2WUDA 5D3ZA 1QO7A 1BN7A 2E3JA 1FFEA 2OAGA 3FCYA 4AO6A 3WKDA 3H1AA 2P8SA 4KAJA 3H04A 1BEEA 4G8DA 5BWCA 4DMKA 1EI9A 1KEZA 5T4BA 4PO3X 4FFWA 5EIHA 4JUIA 1CUCA 3V48A 4DSAA 2PSJA 1CFJA 2WFZA 2HA0A 1BS9A 2DFPA 1ZD2P 2XUHA 5AM4A 3O4GA 4GEGA 2WU4A 2VJCA 1EINA 2I78A 1W76A 4BYMA 3E0XA 4UHEA 2W6CX 1GXSA 4QEKA 4J0HA 4G9EA 4A16A 4YK7A 4Q82A 1MX5A 2OXEA 1C7IA 1Z68A 2XMDA 1GQRA 4DM7A 5FP0A 4K6KA 4V2IA 1WPXA 4BAGA 1CVLA 4X93A 5AKXA 4AXBA 3PF8A 2B4KA 5JATA 1NX9A 1YB6A 4B9EA 1XRRA 2DR0A 4OSEA 1F0PA 5CW2A 3ESDA 4JH0A 3BJMA 4DNQA 3H2KA 4RGYA 3AZPA 4CG3A 5EIEA 2VJDA 3OOSA 2EDCA 4OCZA 5LZ5A 2ZYIA 2VF2A 2ZJFA 1W6RA 2WJ6A 2QVBA 2AJLI
chains in the Genus database with same CATH superfamily
4ZVMA 3QPUA 2NVUA 3UJ3X 1E2EA 1H2HA 2QIOA 1PQWA 2WVGA 4G07A 2BDUA 3FUWA 5EMLA 5JS1A 3AWIA 4AT1A 3JXEA 4E7PA 2OBNA 1SUDA 2W8BA 2Y71A 3DT6A 2R1ZA 4UXJA 3O82A 4BN0A 4YRDA 4QZVA 3M82A 4D25A 2FK7A 2P2DA 3KKMA 2CHVA 4OI1A 1E3IA 2ZZMA 1WQ4A 4NCIA 1RYEA 4C5BA 2M6SA 1F14A 2OCYC 2H1HA 2RSLA 2QTNA 3ZWAA 1T0PA 1I51A 4OLAA 4A5OA 1NMEA 4HCJA 1Y8QA 3NDIA 1EK2A 2X0RA 1NRXA 2G88A 2EXXA 2IYZA 2RHMA 3B3JA 4L4SA 4XARA 1UJ6A 3WYDA 3AR7A 4BZPA 1V95A 2IYRA 3WSWA 1H9AA 1EHIA 1X1AA 3MEQA 2MT9A 4FGKA 4EX6A 5EXEA 3TQRA 3EYAA 5MDHA 3FHCB 1EUZA 1I1NA 3FTPA 3REQA 4A92A 2R65A 2HDWA 1O95D 1Y4ZA 3KX2A 3PDIA 5HIKA 4KXUA 2D1RA 5LQAA 4ROSA 3AWDA 4JSTA 2JK1A 4LZNA 4F21A 2V6JA 2ZUDA 2YICA 3SS8A 3GP5A 4NCKA 1FY2A 3V7WA 4DOMA 5F98A 1RMYA 2NO4A 2QRPA 3ZTYA 4W5RA 4FW9A 1RXEA 4NNPA 1E6EA 1YMQA 2GM9A 1IN8A 3OCJA 3EBOA 4N7MA 5L7YA 1U28C 1O95A 4ZXPA 2C77A 4FGZA 2ZZNA 5ELMA 2XUPA 1GEGA 3UWDA 5HKOA 2QVZX 1J8VA 4B32A 4I36A 2BH2A 4H4EA 3IP5A 4KREA 1C4XA 4TMWA 3HB4X 1JSZA 1ZBQA 1LK5A 4RY9A 1KIAA 4UAGA 1ETHA 4R5MA 4GKVA 5EUBA 4TRNA 3PUIA 5BORA 2DBQA 3EOAI 1IZ8A 2XRYA 2CFIA 1T1IA 4A91A 3VU9A 4E5SA 2Q45A 1XC7A 4KX3A 3C1UA 1G41A 1VIYA 3BFPA 4MVWA 5J1SB 4Y18A 1PWYE 1NFQA 2DJ5A 4QUIA 2YV2A 4DJ5X 4GPZA 3SIWA 1C1XA 5DWDA 3SXUB 5M34A 4PQFA 1KF0A 2A5YB 1GV1A 1WXWA 1ESNA 4N03A 1BCRB 1JQEA 2G1PA 1L4YA 4BPRA 4PXSA 1G8FA 4GMFA 4YAGA 2ID4A 2GHQA 5FOVA 4X6YA 1Y7PA 4DRZA 1E9CA 1CXZA 1NVEA 4OOFA 4MTLA 3ETLA 1UJNA 3O95A 5HCNA 3JWGA 3KPJA 3A9CA 3MB8A 4S1OA 2AOXA 1JTFA 2E49A 3DOIA 2JIMA 5JY6A 2CNWA 1QHXA 1GKUB 3K5PA 4M99A 4NBLA 4AN1A 5DNCA 5JZSA 3QX8A 5FPPA 4IILA 5F5NA 2QTMA 1OLUB 4CLHA 5JNLA 1RLMA 3LDUA 3ML1A 2WJJA 2QS9A 1T13A 2BGRA 2XH8A 4URZR 3KXIA 4FEGA 4RKFA 5K0LA 4E4YA 3E7FA 2YJ3A 3LP6A 3V9PA 4D57A 4K28A 1WVGA 4INPA 4M6WA 4KE9A 1XU7A 3L9XA 3QVVA 3EGOA 2UYOA 2TS1A 1D09A 4NMXB 3EPJA 3D59A 4B8YA 3E15A 4P4GA 3QWFA 1T26A 5DV9A 1T9KA 1XRQA 5I3CA 3OQMA 4MW7A 3OPYI 5H68A 2W37A 3BKXA 3ZJUA 2WA1A 4F2GA 3DAPA 4NU8X 1PG5A 1F5NA 1PI3A 4M9QA 2PBFA 1C29B 4WNAA 1XJCA 1OXMA 1H8HA 3MUNA 3E9RA 3PIDA 4HGYA 3O2NA 2KW5A 2R6HA 1RYYA 4LXGA 3VZRA 4GVLA 3F4LA 1RHQA 4HJXA 4MUYA 1WDWB 3DLAA 1M1ZA 3NETA 3WXMA 2VDJA 1UBCA 4DLNA 1IWPB 2J41A 2HEGA 4GICA 1PJAA 3Q98A 4MQFA 5E9WA 1KHTA 2IIPA 2Z4RA 3CNLA 3LC1O 4MINA 2IGTA 3KVRA 2IFTA 3KQMA 1RE1A 2CE7A 3MTGA 3K30A 2FN4A 3PR3A 5CEFA 2ZPTX 4MV4A 3DVQX 3L04A 3D3QA 3UV7A 3ZXYA 1GVNB 1SKBA 2D7JA 2QMZA 3I37X 3NC0C 3KKQA 4I3FA 5GGXA 1IC6A 2FETA 3ZNOA 3KUUA 2B8EA 3DKKA 5F76A 3KQOA 4YCDA 4LOIA 3SDSA 4YMVA 2Y1GA 1IMOA 1M2JA 1PZGA 2IQ5A 4INOA 2O4CA 2JIBA 1V26A 3NWOA 4GKAA 4Q1VA 3FGNA 4YO8A 2SKEA 5DDIP 2VJMB 4IHKA 1ZA1A 2JCBA 2LNDA 4BNLA 4EUHA 4DCGA 4EHHA 4ZCTA 4YRJA 3DL2A 2R5WA 2XA1A 3R3WA 4FP9A 2ICAA 3FBTA 2O57A 4TSKA 3O8CA 3HV2A 5JJKA 2QP3A 3GLQA 1EK1A 1TYCA 2TSYB 4MYHA 3VU0A 4CM8A 5KTNA 4Z0NA 2ZS8A 4P1ZA 1OXVA 1OAOA 1Z4KA 2GARA 1NVGA 4H7DA 4N65A 4F91B 2Q4RA 4QBKA 4G23A 2XQKA 1CW2B 1UT8A 2C5LA 1NQTA 4EX7A 1GL9B 4P80A 1CZLA 2QXTA 1W59A 2PZGA 4B4KA 1F2TA 2J9YB 2R751 5IPFA 1S0UA 2GDJA 5J59A 3TSAA 4HFMA 2HREA 2RH5A 3R6GA 1JDJA 1Q6YA 2QY9A 2ZLBA 3DFFA 4HUQB 1ZMXA 4ND3A 4DB4A 3CA8A 3DTTA 4WN9B 3LG2A 5IHPA 2HXYA 5DEIA 4ESOA 4X64B 1Y1SA 4E2WA 1JI0A 2HMVA 4KGXA 4D4MA 3OWXA 3BKWA 3IP7A 1DOHA 3GFPA 3ITDA 3BA6A 4WV3A 4KUGA 1BWRA 2G0AA 1CR1A 1EM8A 4I19A 4N0EA 2BKXA 3S2FA 1TADA 1X13A 1RRCA 4DXHA 2FPGB 2JLCA 3FZEA 4FKMA 3QYJA 4U8HA 5IRCD 3HXOA 2WIBA 2P41A 2XF2A 4M55A 3UK1A 2XW6A 3IA7A 1UT6A 4MYSA 4CF7A 3ORHA 2ECKA 1KXJA 4Z9YA 5B7QA 2H2IA 2P2YA 3H0EA 3EMVA 2VT7A 3NOVA 4BNUA 3NATA 1ZI9A 1W44A 3TH5A 1GGNA 3B2EA 3DE0X 2ECQA 3OZEA 3UHJA 3WMWA 1V4BA 2FVXA 4BL5A 4D8TA 2AZ4A 1PT6A 2EG5A 2II6A 2XDQA 1KJ8A 3C8HA 5K3OA 3WLFA 1BVRA 4JEMA 2GK4A 2PX2A 3N8KA 3QVMA 1EYZA 4BQRA 5KYGA 1N5DA 2X41A 1W2HA 5HF9A 2CXTA 4U6SA 1E0DA 2XBUA 4I8XA 1PJLA 4BE7B 3TX6A 3Q8WA 2BZ1A 4UTVA 1CTQA 2GZMA 2YOGA 2PIAA 2XR1A 4MOWA 4N8DA 4UFNA 4ZQIA 3I4FA 4G41A 5DYNA 3GRCA 1G3RA 3WKBA 3LU1A 3LK7A 4DMLA 5GY7A 1DX6A 3EGIA 3L4BC 1J20A 2I4OA 2V6BA 4OLBA 1MW8X 1HDZA 3W7AA 1WB6A 5I7HA 4EHNA 5CEEA 3FFTA 1UBUS 2ZIWB 3ZOKA 3EEBA 4D3YA 1GZVA 2O2CA 2PFKA 4RE6A 3Q10A 1MORA 1TF5A 3OJWA 4JLOA 4D9JA 3HXQA 3PGJA 4IDEA 5COQA 4FPXA 2NO6A 1HETA 2HDNB 4W1QA 1EZ4A 3WTBA 2FYTA 1M2OB 2XNCA 5LBUA 3W78A 1G1MA 4ZZ1A 3VC7A 2ZI3A 2I4NA 2ACVA 1MHTA 3B1KA 4LC9A 3AV3A 4AKIA 3L7YA 4G5RA 3CMCO 4AS1A 1T5HX 4G8JA 3TMYA 3Q5GA 4Y9TA 1TRKA 4J0QA 5KWEA 1QH8B 2W83A 3P19A 2D1TA 4NU6A 1SCDA 4HWRA 2PSEA 1KZ6A 3K3PA 2PZKA 2ZTLA 4I1IA 2VWPA 3FMGA 5M2QA 1S1CA 1MUUA 3ASUA 5CT6A 4UZFA 1ZSNA 4BFXA 3SMVA 2RJOA 1FMTA 3GPBA 1EIWA 2Z9CA 3GLHA 4M8KA 3ZWKA 2FP4B 4R2IA 2C3YA 2HLPA 2R6FA 4YQYA 1DAGA 5IKMA 1BYIA 4MYDA 2ZI6A 4AX8A 5FB3A 1N2IA 1QG0A 4J3JA 3WYBA 2WWIA 1RVDA 2DXIA 4JX8A 4FGSA 4YCNA 1KL7A 2GZRA 3EGDB 2YBEA 3TB6A 2RGWA 1N0UA 4IOMA 2PVSA 2Q4EA 1KOGA 3D3NA 1Y3CE 2JB9A 4IHAA 3U48A 3KQHA 4JMLA 1X87A 5DXJA 4X1OA 1X7WA 3F6CA 4YRQA 4P4NA 3S4YA 2Z30A 2Y2VA 1X0XA 2NM0A 3ER6A 4N5DA 4DQLA 1QKJA 2EGGA 3AFMA 5HIMA 3W9UA 3EPRA 5BOSB 3EXG2 1X7HA 3ICEA 1MO6A 3D8SA 3LO5A 3UK2A 4FDMA 4DZZA 1JJ7A 3MK31 4PU0A 5JTUA 2AK2A 2DMRA 2YNMD 1LS1A 5BWOA 4UXIA 4L72A 1HFJA 1J22A 2HXSA 3AYXB 6LDHA 1JFLA 2FN9A 1A8UA 1N5OX 3DVSX 4OHVA 3V4VB 4URVR 1QANA 1MZVA 1P8AA 4K6CA 2ODWA 1V5FA 3GEPA 5K8CA 4KAXA 3M3HA 3QUQA 4DQUA 2QUAA 4RD2A 4RV5A 3STWA 2C59A 2HWKA 4YONB 5C53B 5AOBA 2ZUEA 2YNMA 4CUZA 2B25A 2NUTB 3OM1A 4OXQA 3BXFA 3CXRA 4LY6A 1JG1A 5DM2A 3T52A 4TYWA 2JAXA 2JLRA 1T6NA 1XEFA 3LVQE 2NAFA 4RPJA 4Y98A 1GGMA 2O05A 3WRXC 3K9CA 1M74A 1IIRA 2RAPA 2ZJ7A 1UDXA 4ER0A 5A04A 1HQDA 1Y9DA 2WM2A 1RQLA 4N1AA 5CNKA 4BNJA 7MHTA 2W6NA 5DO9A 2Q9AA 3NWBA 4Y7DA 1PS8A 4EY4A 1LDNA 1HUQA 2WAYA 2BGLA 2HRCA 3OZGA 5HW0A 3N05A 3R41A 4PPGA 3TVTA 2NSLA 3CJQA 4ZGBA 4Y6RA 2G07A 3LKBA 4L8LA 1Y1TA 5BPHA 4XVHA 2QLFA 3M4XA 3LXRA 4GBMA 2VBCA 1OKKD 1XKLA 3LCUA 3W4IA 3W79A 3II6X 4NBSA 4BKUA 3SJUA 5IDVA 4ME6A 3V8QA 3VO2A 2PG3A 1FU8A 1D5CA 3JX9A 4HDNB 4ERNA 3QOYA 2NVBA 3L46A 1FDSA 3O4JA 2B7CA 1IQUA 3E61A 5ALFA 4A8JA 4YV1A 4CDMA 3FAKA 4QKQA 1ZLYA 1Q7BA 4I81A 1U8XX 3ESCA 2OKGA 1NJSA 1TZMA 5FNVB 1OGJA 3CEHA 3I9MA 4AG5A 4TKVA 1DS6A 2VHJA 3IULA 5DULA 1PIWA 2ROQA 1QIIA 4FYXA 5E6RA 1L8XA 3GGJA 3HFRA 1EFVA 1URPA 2C4MA 3GRUA 3NGXA 3IIIA 2RGAA 4GBJA 4OXNA 5CT8A 5DRTA 3HC7A 5FKJA 3ZC3A 4RENA 3DZFA 5JADA 2YZMA 3HP4A 3MNFA 4U2EA 2G77B 5GWXA 1T9AA 4YO7A 4ARSA 4F45A 2JJ2A 4Q4HB 1I32A 5BURA 3FZNA 1CRLA 5TQ2B 2F9MA 3GJ8A 2HRBA 3M6UA 5IT4A 3TM5A 2FPRA 2ZBUA 1D4AA 3E1GA 2IELA 1QNLA 5IFKA 5JPDA 3EXEA 5CYPA 2ZJZA 2X1HA 1YJQA 2Q07A 3CGWA 3Q9LA 3EZYA 3GXOA 5J23A 4RZQA 2Z08A 3DXZA 3OIFA 3AEZA 4CGZA 1XZKA 2WINI 4WXRA 2PX0A 1DAHA 2BW0A 1NW7A 1V16B 1G7SA 2Y05A 4NBKA 2VP6A 3DDNA 5DK4A 4B74A 2MYNA 2H63A 2PN1A 1E9DA 4Y6QA 3E3AA 1EVEA 5TMDA 3RAPR 4WVFA 2Z57A 2J9FB 2P5TB 4DAEA 1UAGA 5SYAA 1CE8A 2WFLA 4UPDA 4XTRA 5C7LO 3WA7A 4O4LB 5LMUB 1OWNA 3OCVA 5H7XA 1TZBA 2O54A 3G02A 1G19A 3P4XA 4F3KA 4HK4A 1RI2A 1C2TA 3E8SA 3E82A 3LXXA 2O1SA 1F60A 3LPCA 5DCYA 3OUUA 5DHPA 2OGZA 2UAGA 1DC3A 1X7YB 2A58A 1FYVA 4HGNA 4OHKA 3LDAA 2A1UA 4KX5A 3I39X 4NDNE 3T35A 4R2LA 4DGSA 4EFNA 5ICEA 5H1YA 4BO2A 4AMYA 2F2TA 4UZSA 2XDAA 2WSYB 5I6DA 3INTA 4MW4A 1XO1A 4QVKA 4AKGA 4B6PA 4YJFB 3RUPA 1UFRA 5JS6A 1A2OA 3GDFA 2OPHA 3FNHA 3WL3A 4FDAA 1VCHA 2JFQA 1K4MA 1S2OA 5G02A 1HK7A 1U1IA 1V35A 3BILA 1AKRA 4D8YA 4BO8A 1PR4A 3U81A 3MFYA 1OI3A 1WXGA 2BEWA 4BKRA 3WB1A 3BGOS 1BU5A 1OZFA 5JAQA 1Y8ZA 4WBSA 5F23A 3N6XA 1I3CA 1LH0A 1YCGA 4PS1A 3PFHA 5CNJA 1ZM4A 4GP7A 1MOSA 4YIHA 1A0OA 3ROMA 4Z4IA 1R8XA 2PGOA 3DMNA 4WZBE 1Q0TA 5LR6A 2IEGA 1GG2A 2EP7A 3QMWA 3ZK8A 3B1YA 4D3DA 4JXXA 1ZO8A 2VS1A 1JR2A 2VYFA 3FDZB 1G42A 2H48A 1SXIA 2ZTUA 3LLCA 4D4JA 2CZQA 2QY6A 4LNUB 1VA5A 3GG2A 4AJNA 2ZJOA 3KJIA 2JFFA 2O8CA 4DV6B 1UMDB 1LXCA 1H2WA 1Z33A 2ZUCA 3R9IA 5BN4B 2ZAYA 5G0VA 3V8NA 1W73A 4Y6GB 3OJOA 4G0XA 4J91A 4P7KA 4RJ2A 4ARBA 1JDTA 2NUPA 3WK8A 1GPJA 3UOAB 3ZZ0A 3WAJA 3TLEA 4BO0A 2YRXA 3HABA 4QEDA 4GYWA 2WUWE 3UJBA 4DLRA 2VSYA 3G89A 3QHQA 4U7GA 4YCAA 1E32A 4Y67A 4YN3A 5JWRA 3CUWA 5LQDA 5H82A 5HJEA 3AFOA 4PR0A 5IBCA 2JFWA 3L7OA 5AVJA 3WWEA 2UVQA 2V7VA 2GO7A 5F1YA 4K81B 4KLCA 1G0NA 1MH1A 3ADOA 3SHTA 4J75A 3F9IA 4RF2A 3HYLA 5CNMA 5ITZA 3K8YA 2R1VA 4QXOA 2Z9DA 2ZKLA 2D5IA 2YOHA 2YJ6A 1KR2A 3NC4A 3QX9A 2PMBA 4FX5A 4YCMA 1U1DA 5CA0F 3EZGA 1NF8A 2C98A 2ZDQA 3CGGA 2C92A 3IMFA 4XAQA 3PDUA 4EG3A 1XZFA 3PFKA 2LD4A 1DKMA 2JNWA 4Q9DA 5H3CA 3RTCA 3VR2A 4DMUB 1V1RB 3EZ7A 4AJLA 1LX6A 2PRIA 2CYBA 3JQ8A 3OFVA 4LHVA 1FPQA 2Q3JA 1T0BA 3GMIA 2PFSA 4RPKA 3W5IA 1DOAA 4BV2A 4C78A 3N8NA 1IJFA 2DHCA 4LXYA 2QPLA 1OGYA 2JCYA 521PA 1O03A 4M36A 3D7MA 2WMOB 1OHHD 3WLOA 3U13A 4IMJB 2BEJA 1WU7A 2FMKA 3M5PA 4LQLA 2JD0A 2WUFA 1LPMA 1DWUA 2HOQA 3H4TA 3QVTA 1QAOA 2C84A 3EGXA 2YWGA 4GMDA 5CM8B 1NSFA 3BL8A 4YH1A 3EFBA 3EIUA 3OSUA 4LTDA 3UOGA 1WZ2A 3RT1A 2FPPA 3U3OA 1E1DA 3VMFA 4BJ1A 4OBBA 2JFZA 1JIUA 1YS4A 3TRJA 3U3XA 1OPXA 4O4IA 2R00A 1V5EA 1T1EA 2WG0A 4KIWA 4ZN6A 2BF4A 1HSZA 2HMTA 3EHEA 4ESVA 1YFJA 1UJ5A 3GUCA 1PGPA 3S5JA 5E4TA 1UK8A 2P1DA 2Q9UA 2ZM5A 4LZAA 1XTVA 1BXZA 5I8ZA 3WBFA 1V96A 1PSWA 1W8IA 3UNXA 4KL8S 4QTZA 4EJSC 4Q9LA 2H9IA 4J0DA 4KN5A 3HGMA 5FOWA 1FBNA 1TM5E 2J9XB 2LGJA 3OEYA 4GYJA 1SEPA 5F51A 1CQXA 3ZWQA 4QDTA 4FNAA 4OH1A 1JAYA 3D81A 3HSSA 1QV7A 4OQPA 2ZS9A 4HDRA 3HNRA 1ODCA 3PNOA 4GPIB 3OTHA 3S2GA 1JW9B 4P93A 2JIPA 1N3LA 4OBWA 1KDTA 1RCUA 4MQ5A 4OQNA 4O4JF 2PZEA 1J97A 5JLAA 3BF7A 4I99A 4HP8A 4NFHA 1T1GA 2XWPA 3AFGA 3CTPA 4FFBB 2QTVA 1T9DA 4KMOA 4RD1A 5DHAA 3KQUA 1W75A 1LF0A 2YOFA 3QU2A 4DYVA 4WXHA 4QQNA 3DLIA 4ITRC 2EKZA 3KPVA 4MWTA 5D85A 3QITA 4JI1B 2E5LB 4LZOA 3ORSA 3K0KA 1FQJA 1HY3A 621PA 4LA4A 3NR2A 5JDIC 3ST7A 3H4VA 1B43A 2CDNA 3UHOA 4RAOA 1V1JA 4NCXA 5AHKA 2XVXA 4UUBA 3AL3A 5FL3A 4AKTA 5AUOB 4D3XA 4LRYA 1BQ3A 1NR1A 4RNCA 2X9NA 5FWYB 5L6MB 3F8TA 1P0QA 3NXSA 4OLFA 4AXXA 3WP1B 1PF7E 3T5AA 4GPD1 1EWTA 4HDSB 2AE1A 4UUQA 2DCUA 2OP0A 3SS7X 4UDOA 4AY6A 3RYFB 2XUDA 4C2BA 4HH4A 5JBIA 4BRZA 1PFQA 5JV5A 3E70C 3S27A 3SYRA 4CKWA 3O91A 3QVSA 4ESHA 3H42B 2XEDA 3QZUA 4IFBA 4MUKA 1VC2A 2H57A 2YH2A 3QELB 1NLZA 2H2FA 4NEGA 3OHMA 1DPFA 1U81A 4WLOA 2BEKA 5THXA 3NEYA 3TGPA 3BB3A 4IAOA 4BEWA 4UNRA 3D4IA 5IAOA 1UWKA 2C0CA 5BNZA 1PGNA 2NXCA 4JJAA 2AEFA 1OYWA 3V97A 5HQJA 2XY4A 3K2QA 3L49A 2NQTA 4UEWA 5AM3A 4WNIA 3WGYA 4RSHA 1EESA 4DQVA 3BULA 3R3SA 2FUG6 2EJTA 1JHVA 1SY7A 4EKGA 2C8LA 3K6SB 3UZUA 4GSLA 3HS3A 1ZFNA 3CRVA 2FX3A 1WNFA 4RVHA 3EGEA 1F8YA 1GQSA 1FE8A 3H5NA 4BO7A 4YRNA 5L40A 5HILA 4QPNA 5JD4A 5T6MA 2SICE 4W8GA 1DLIA 4F6CA 4QYWA 3DWEX 1GWNA 3L4EA 4EBBA 3VU8A 3AR9A 1GTZA 1WQ3A 1O8CA 4IDHA 2ODNA 3B6EA 2PUAA 4L73A 5LD2B 2J5KA 5FPSA 2XPCA 3QXCA 1INLA 2SCUB 1NVMB 1PNOA 4ED9A 1QQ5A 4OHUA 4REOA 2REOA 1E58A 4NBRA 1TDJA 5IDWA 1A1SA 1TJPB 3HJBA 4TQAA 1Y3DE 3WGMA 4RTKA 4DR5B 1T6ZA 1VECA 3C5HA 3DHNA 3IXMA 3LBHA 4RTQA 3FOBA 2JLXA 1GKLA 1POXA 5HBGA 1G9TA 4JB0A 2C9YA 1CV2A 4YJHB 1E9BA 1HG0A 3R6WA 1LFAA 3BWDD 1TEHA 1VKOA 1R88A 3ICVA 5SYNA 3WIEA 3IHKA 5EIFA 3W2IA 3WIUA 3P94A 1Y42X 1RE0A 1SC3A 4GR5A 5EIBD 3Q5EA 5JSFA 1ISGA 4EJ2A 1UZLA 1WWKA 4LKOA 1IEWA 1WF6A 4IUCS 1OTYA 4FE4A 1AH2A 1HE8B 3K2IA 1IBSA 5LIRA 1W0CA 1JVNA 2V7EA 3QRWA 1LSSA 1P0FA 3OFNA 3SXUA 4DREA 2HN9A 3LRXA 1E7YA 3PC6A 5KUTA 1N6HA 1XNRB 4AX4A 2P5UA 3B6JA 4ZAWA 3MCVA 2GPNA 5SICE 4YB8A 2P68A 1ZL2A 4C4PA 5T3UA 4LNHA 5ECDA 5JAZA 1Z2DA 4K6GA 1LD3A 5EUMA 2GBGA 4AS2A 5AK6A 1M34B 1CDOA 2LCFA 3OOHA 4R7ZA 4N76A 1P6XA 1Q0PA 3K9QO 2Y2UA 1NXQA 2VTVA 3LZCA 4CLDA 4MS4A 2NUAA 4HSGA 4L6CA 1OLUA 4TWIA 4RVDA 3BHNA 3LC7O 4IX1A 1RQNA 4KVZA 3TSZA 1IN1A 3RYTC 4BX2A 4LSGA 1DHTA 1Z6QA 5HCUA 3S8MA 5G4KB 3ZIUA 1FJXA 1LW6E 1ODJA 1IWOA 1VJGA 2OWEA 2C83A 5LXTB 3QMMA 3UHPA 1CYEA 5TNXA 4DR4B 5LZ2A 2I2AA 1DO0A 3C5VA 2ZP1A 1W1IA 3KZCA 4XH9B 3O4FA 2C7RA 1E9AA 5IVKA 3TTYA 3ZWBA 4J0EA 4KN9S 4OQDA 1PNVA 5CVUA 1Q7GA 1K6XA 1RP7A 1I13A 2FPLA 3RYHA 5CGZA 3GAAA 3WVNA 1UC5B 1WXEA 1IUNA 2Q46A 4AJEA 2I03A 2R5FA 5FCDA 4PG8A 1YD7A 2B6HA 3K09C 4PRZA 5FPHA 1FSSA 1LLDA 2BWJA 1WB5A 1Y5NA 2FMXA 2G08A 4G0ZA 4N9WA 4HWPA 2HA6A 1SU7A 1Q74A 2CCGA 1Y8CA 4ZOLA 1GKYA 1WCV1 2PANA 1T0UA 1BHQ1 1V48A 4L4UA 3SVZA 3I34X 4NMLA 2GPWA 2HYIC 2YWHA 3KKNA 4HTFB 1W4AA 2ETVA 5KKAA 1K63A 3OJXA 3AQIA 3MTEA 4I46A 1P9NA 4YAUA 3V2IA 1DWOA 2QTGA 1TM1E 3RC1A 1EG2A 3E8MA 2M6RA 4M1KA 1GAXA 3O74A 4PAGA 4HWOA 4MKZA 4ZXFA 1E1YA 4LFBB 4Q47A 1QJ4A 2NZWA 4II7A 1AKNA 1Z4LA 2B0CA 3T7RA 1A8SA 4L8VA 5LUBA 4K9LA 4LJSA 4OQ4A 5LU8A 2VJMA 2VPTA 1GA1A 3U61B 5LKRA 1KI6B 3BMXA 1AU9A 4KWTA 2REQB 4RKWA 2FW6A 4QSHA 3GROA 3ZW9A 3O8OA 3I2KA 3FVVA 3TRFA 3ZHQA 3GGDA 4MW9A 1GLGA 1Z3IX 4KFTA 3CLSD 3K2EA 1LPOA 4DR7B 1PJQA 2XJ4A 2AC7A 3CG0A 3LOUA 4B3CA 2HSEA 3KVOA 4DMCA 4NATA 2HZ7A 2IU3A 3P0HA 1CY2A 1IAQA 4PSCA 4R2WA 1NVWQ 3U4HA 5FWXB 3CRW1 3NV9A 2AG8A 1RI5A 1YR2A 5JAMA 2HRZA 3ZBPA 4KSBA 3KYDA 2ZVQX 1C8KA 1V37A 5AO9A 4M53A 5BRAA 1DDGA 3ZS8A 4BBJA 1RHMA 1HQYE 2ZRAA 1FOEB 3EYWA 5LQMA 5K8UA 4YYZA 3TLAA 3HO8A 3AHIA 1DUVG 3T4EA 3ABIA 4R0MA 3LA8A 4IH9A 4G6ZA 4NG4A 3W5VA 4KXFB 5BQFA 3QVXA 5JQGF 1QGED 5JYCA 2L82A 5BT9A 1MEOA 5I9MA 2XCLA 3BYZA 4GZ5A 2PSDA 1AVTA 3ECSA 3HVHA 1Z56C 4G1CA 5DOVA 4O3MA 4GSYA 1AHNA 1EFUA 3EEFA 2JS7A 1CR0A 2V5VA 3IV6A 3GBSA 2R4UA 3BTOA 3KL2A 4V1CI 2WWWA 2QTAA 3WL6A 4FZ3A 4R68A 1JJAA 3UICA 5KQLA 3B78A 1FP7A 4JB8A 4MWGA 4K9SA 5KNBD 4TMTA 2AC2A 1HBJA 2E0IA 2H4XA 4PZ9A 3GRVA 5JQWA 2DPXA 1HPLA 5FHRA 5AW1A 4JFAA 4JENA 1AURA 5TGTA 5ITWA 3GB9A 5DB4A 4EO9A 3HH8A 2HO5A 4JP2A 5C18A 2QMYA 2GBCA 5CLFA 2WWVD 3VOBA 3QU5A 1FXWA 2DSTA 1TUBA 4CM4A 1IM8A 1P6QA 1RQXA 2FSGA 4Q66C 2XMZA 3WDMA 1XWIA 1E3LA 1X1TA 5KX5F 2YW2A 2H7VA 5M04A 2UYQA 3ZN2A 3W7BA 5DBGA 3QPDA 4OAPA 4HVAA 4OMFG 5EVCA 4E5YA 2RONA 2VTBB 2I7VA 3HADA 3QPBA 2PD4A 3GOQA 5AJWA 4DR1B 3O26A 4FNMA 4DLAA 1YE8A 3KWJA 1M2OA 1E8DA 4COOA 3R5TA 5K4HA 3ROTA 3U9TA 2ZJ0A 2WKSA 3O8LA 3CR3C 2ZRIA 5TSDA 3SHQA 5K0JA 4GOND 1MMFB 1JDVA 2OFOA 4I9FA 3HFGA 4J0KA 4MVJG 3AR6A 4IOKA 1Y6ZA 1XK7A 3CEAA 4R7GA 1IATA 2ZBGA 1O6ZA 1ZLXA 1OSNA 3H97A 3B7WA 2WAMA 3QG5A 3NX4A 1JX6A 1DTWA 1RMTA 2AXEA 3ZTTA 4XWAA 2J0EA 3TNLA 2XTAA 4D3ZA 3PPIA 1F7UA 2RH4A 3RQIA 4LGYA 2DQ4A 5IZCA 1WY5A 1HTBA 4BVLA 2C2HA 1KC3A 3FYUC 3COSA 1N7IA 3WGOA 5C3MA 2NO5A 5JJ5A 1VP3A 3EZLA 3FRIA 3PFCA 3NB0A 5JCOA 1M5RA 2ZYSA 4YUXA 1FLVA 4A10A 5A9TA 4ZYUA 2IA5A 1XVLA 1ETUA 3FSEA 2O5EA 1QM5A 3IQEA 5J4LA 3DLPX 1M2WA 1PEAA 2JK0A 3C3EA 3EN0A 3CZMA 3QEJA 4PNPA 4BFLA 2HXGA 2BFDB 5GJBA 1R0LA 2QRKA 3BD6A 1WMAA 1EFKA 1QK4A 3I2GA 4R8MA 4BEJA 1RPTA 4OBEA 2B34A 1XBTA 2GJAA 5FHQA 1H3FA 3GUVA 3P32A 3H13A 5E2AA 4GKJB 1IQ0A 3ZV7A 3AKEA 3SCZA 2EZ4A 4Y0VA 3TZKA 3W3AD 1KVUA 2YUTA 2C99A 3RKSA 5SYMA 1Z28A 4HLCA 1Z7YA 4R3WA 5DSTA 2YY6A 5AM0A 1ZCFA 2OLJA 2DWUA 1JAHA 3L7BA 4GUAA 2ZBRA 5AJYA 5C0OE 2Q7OE 2W70A 2OAEA 4QOIA 4XASA 5ES4B 1XCGB 2HA3A 3G5LA 3N5CA 2CVPA 1QYWA 3JASA 1TCAA 1PD0A 2G6BA 2FSIA 3OQIA 2E5FA 2NUTA 4DCCA 4ZDKA 5B57C 5M29A 5HOEA 2GEUA 5IDYA 3F5SA 4EFMA 1NT2A 1I9CA 4K86A 4P08A 3AT1A 4D98A 1MTOA 3WGUA 1CUVA 4FZJA 1C9MA 3UHFA 1G8MA 4D9IA 2OBFA 3HHPA 1E5DA 1XKTA 3ESRA 3FJ1A 4UM7A 1KJWA 1E1RD 1S4MA 3A9VA 4WFKA 4AKSA 2ZYTX 4MVXA 1JDPA 4TT8A 1CJVC 2C5FA 3AEXA 2YHSA 5D87A 1W0KA 5AKGA 5M3BA 3EPPA 3FKSD 3KR1A 4JS0A 3TZEA 3UWPA 3W77A 2B5WA 2YXPX 3DMHA 5CP8A 1E6CA 2BGIA 4FINA 3O31A 1ECGA 1TOAA 1KVQA 2X1MA 4XWTA 4BZQA 1ZITA 4CRWB 5JAIA 4YY3B 3EVGA 4Q9NA 5D01A 2ZVDA 4CHTA 2HUNA 1QYIA 3P9ZA 4BNXA 1E1RA 4ON9A 1E77A 4EHDA 3D6UA 3F7MA 2NNWB 4Q3AA 4EKNB 4KGDA 4NFYA 5FLYA 1ILEA 4EPXA 3UQYS 4IGIA 4D99A 1FX0B 5J40A 4YJ2F 3FKSA 2NTNA 4Q03A 4BMVA 1Z2EA 2YDXA 2P7IA 5AHWA 4I8DA 5ALOA 4LYEA 1RI3A 4YRTA 1T3SA 2F62A 4D26A 4UEOA 4RL6A 4X91A 1B0AA 2PUTA 2VNKA 3ONVA 4RBNA 1VBFA 1JLKA 4MX8A 1SBQA 6Q21A 4HAIA 1E6WA 3GWGA 4UULA 1KDVA 3HKEB 3AIIA 1PGOA 4IDAA 3NRCA 1VMIA 4HEA6 1JIXA 1TT5B 2Z5GA 4GL4A 3TOSA 3WYFA 4RVOA 3C7KA 4P9NA 4HF7A 1NLYA 4R9VA 3ENZA 4FKBA 4KTVE 1I3LA 5EHGA 2BTQB 4PXAA 2W43A 5LOVB 1OWMA 3LSYA 4S3MA 4RK6A 5EXSA 1FW8A 3DAFA 1LJUA 4H9GA 4JLBA 5E1BA 2YYYA 1YL6A 1UBNA 4D5GA 4EYQA 3AR8A 4E33A 5CB0A 3ZZUA 2ZRKA 5LA6A 4B2LA 3I61A 2XYRA 4MJ7A 3U7GA 2C5BA 2AMFA 3QVJA 3BZBA 1NN0A 4A5SA 1PFWA 2P1ZA 4M9XA 1NNSA 3ZVLA 2H4HA 3PHBE 2JIZD 2LW7A 1M8FA 1JJBA 1UF9A 3OEEA 4MYTA 1M73E 3KOOA 1I7QB 3R7AA 4YXFA 3KTOA 3IDSA 1XB2A 4GKBA 4QUGA 4EWLA 4F5YA 3DBVO 2P2LA 4HL6A 4QC2A 1DQYA 4G0VA 3M1AA 3SX4A 5TQ0B 4C6HA 1H2EA 5JG7A 4YYEA 1P1KA 5IF9A 2N0SA 1ZOPA 1Q95A 1QRSA 1ECPA 3KEQA 4I6JA 1CP3A 3FOAA 4F4CA 3KZNA 5CCBA 3IUEA 1G7TA 2NN3C 3OZAA 3VVBA 3L77A 1W29A 3DW1X 4GF5A 4AL4A 2QT1A 4B1FA 2XUIA 3UH1A 4B5KA 4HH1A 1KZYC 3PG5A 1DC6A 3NP7A 2GTHA 3WMXA 1K9VF 5BR4A 3V4SA 4EG8A 1GL6A 1N6KA 2QEQA 3ZWYA 5MFPA 3U4AA 1W49A 2YHAA 2PZMA 4X71A 4IXTA 5D6NA 4XD7D 5LJLA 1OFUA 1ZD4A 2I71A 4OQFA 1TEZA 1L5RA 1Z0AA 5M7EA 2ZB2A 3ZHOA 3LT4A 4RTPA 1LTHR 1H4VB 2EBUA 3A0UA 4U1RA 3W04A 1L7PA 2ORVA 5E38A 3ZWVA 3HA5A 3O8NA 1U7XA 1M83A 3IT1A 2IF0A 2YJ5A 3KD2A 3QH4A 2L42A 1N2ZA 3E2PA 2BP7B 3QU4A 3CIFA 3L84A 2D2FA 3IR6A 4XD7A 3S0JA 4C6RA 4E5KA 3ESYA 1RXWA 4KVAA 4PZ0A 4AMGA 5CH5A 4DA9A 4DIFA 1WKBA 1XCJA 1GFSA 3WIBA 3ETJA 3MC1A 4RHYA 3VSDA 2V96A 1N5MA 5BSFA 4DIMA 1OLSA 3PFWO 2GCOB 4BUJA 4J4HA 3KVVA 1A9XA 4X60A 3KJQA 2ZTVA 4ZFNA 5BV1A 5HZKA 1K92A 1T4MA 4XEHA 1Z5NA 4DCJA 4B7AA 4NAVA 5BN4A 4OD0A 1EGHA 3LRTA 3RVNA 5A2QA 2CHFA 4AJKA 3PRJA 1FRZA 4TV9F 4MLZA 1A2BA 1X9IA 5JD5A 1SU4A 4JI8B 2QJTA 2EAUA 2OZLA 1Z25A 4L9SA 4EY5A 4KLRA 2FF5A 5CJPA 3F7OA 5FA8A 2G9NA 2XYQA 2NO0A 3JSXA 3CVJA 3FGZA 1EHCA 3A4NA 3DMTC 3OA0A 1HDXA 1M1YA 4BNMA 3RC7A 3L5OA 4MAFA 4DEYA 2O2GA 4B48A 2ZREA 4DN6A 2KE5A 5DK6A 3PDHA 3JAKB 3DWFA 4QBHA 1XIVA 3BH7A 3RJ5A 4I7EA 2JLUA 1J06A 3N1UA 2BFCB 4JK3A 3AY0A 3AR4A 3Q6IA 1UADA 4GOOD 4Z9BA 5HEKA 4JI7B 3G79A 1E63A 2OK7A 2G7MC 5CD1A 2ZRBA 3C5WP 1T9CA 1ZCZA 3C6QA 1KEPA 2VDWA 3EIOA 2JLVA 2YWDA 2Q1TA 2ZBVA 1Y9JA 3N86A 2BHLA 4JP5A 3CUYA 1YMVA 1NKSA 1WKVA 3P9YA 1R37A 4TXMA 1TI7A 2X8JA 3MOGA 4ZRMA 4MAAA 2IZOA 3I28A 3WB9A 2HWWA 1P5JA 1DO8A 1Z38A 4NZPA 2ZS7A 3PC7A 1D2GA 2IYUA 5TF4A 3ELDA 2X15A 3BHMA 1BWSA 1NBEA 3EQ2A 1C9EA 2QV7A 1M8PA 1VPEA 2BZ0A 1OIWA 2AFIA 2QJWA 4RF3A 3SEQA 3WE7A 4CWAA 3UJ8A 4ENQA 3TS1A 3UJDA 5JVDF 1VKRA 4K5QA 3I6MA 1MOQA 1SRQA 3I2JA 3DC7A 2B92A 2C2XA 3BICA 3CW8X 4FFSA 3OIVA 4F6LA 3M4YA 2ZU0C 2HTFA 4RMIA 1ID1A 1PJ2A 1YE3A 2QTLA 2VDLB 1PJRA 4N3NA 3EC2A 4O02B 4TROA 4ZYVA 4UQLA 5K0GA 2BCJQ 4FYHA 3ZE9A 3DEKA 3AIOA 3QVWA 3DCYA 1JEQA 4RDIA 3T0IA 4W5WA 3U4CA 2VQEB 2O3JA 1Z0DA 2CE2X 4XZ3A 4IEIA 5K0CA 3M6AA 1KH2A 2WJGA 1Y34E 2DFDA 3PC8A 5CT5A 2E1PA 4KNWA 4BB5A 5ECYA 3EIWA 4IIJB 3QFRA 4LECA 5AW6A 3ZD7A 1DQPA 3NTLA 3GN1A 4TS1A 5DTQA 2PR7A 3RVRA 5KVVA 2O7NA 3K73O 3SR0A 5JNRA 1Z6GA 1Q16A 2C4HA 1C0KA 4RC9A 1VSUA 3B3QA 3IB3A 2AVDA 3O7WA 2B9VA 2W0MA 3H5TA 3PT5A 5GVRA 2JFNA 1G8YA 1M1XB 4I5IA 1DAFA 1JKIA 4FFBA 4PGHA 5GQSA 2VHUA 2YXEA 3UAZA 2YTZA 3FUUA 3UUGA 1R3UA 3BZWA 4BNTA 4XJSA 4BCDA 3JTEA 5I7WA 5IHXA 2K7FA 3CN9A 1YBHA 3ED1A 2NQ2C 4J2HA 1C9JA 1JEOA 1FNNA 4GU5A 2CWWA 5T7BA 3FYTA 2FPXA 3SM9A 5IXYA 3MJTA 5G1PA 4FILA 1YZFA 4UOEA 4B4WA 5TJHA 2D2IA 1U4NA 1SC4A 4M0CA 4BFWA 3UC9A 1VL0A 4LF5B 2H9AA 1IDN1 4JI0B 4ZI5A 1NQXA 2CUKA 3EUAA 4CV0A 1VE7A 4GP6A 5JSKA 3CLHA 2GTPA 4DSOA 1MT3A 2W2MA 2IOYA 3RYFA 4BO5A 3OM0A 1N9GA 2Q3MA 4L6AA 2PUEA 2O8EA 4E2ZA 1YQTA 2W2NA 4JP8A 1N3IA 1NPYA 4J43A 4YV2A 1X7DA 1JG7A 2W2OA 3OQ6A 3ANXA 3IP6A 2YZ2A 3LC0A 1XHFA 3BRSA 4BLUA 2HJRA 4RHXA 4DVGA 1ZGCA 3R8XA 1S8FA 3ZVMA 3KFXA 4IEEA 4OV6B 3BAZA 1Y37A 1B15A 2C2KA 2L69A 1WUKS 1HC7A 2CLMB 3JV7A 3OQHA 4HEA1 4IIVA 5FTWA 3AUSA 3BWXA 2GYUA 4AJPA 2R6AA 4CMKA 3GG9A 3ET4A 3N28A 4LSZA 5F73A 2P8JA 2X8BA 4U6NA 1AQNA 1TK3A 2NZUG 3HM2A 1HH4A 1GPYA 1NBHA 1UC9A 1ZD9A 2A0UA 3GPLA 3K6SA 5ARBA 4QFMA 1OIVA 1XVVA 1ZJYA 2CD7A 1PS9A 3PQ8A 2WIAA 4RZSA 5EKSA 5F52A 4C20A 3GT3A 3Q85A 1BHO1 4D45A 4XRRA 1UOEA 1QZUA 3CINA 4WN3A 2HJVA 3WL5A 1NBIA 5BRNA 1RJ9B 2PTGA 4WZ6A 2OB1A 4L9AA 1JEEA 1KNXA 1L4BA 2UV8A 3ISTA 1KP9A 1VHDA 3VC2A 1LLCA 2B37A 3VTKA 2EP8A 4FFMA 1I1QB 1N5RA 2BC9A 2JCVA 2QTRA 2SCUA 2ZJYA 3CZQA 3PZRA 4X3PA 3FTFA 1LS6A 4O2AB 1ZRHA 3DFUA 3KYJB 5JARA 2XADA 4IXMA 2R8XA 2R2GA 1YVDA 4AP6A 5ERYA 5HR5A 4YCLA 1CG6A 5D2CA 1I9GA 3W1VA 2OXRA 1ZVMA 5FUVA 1BXRB 2IYAA 3RS0A 4IIFA 1A4UA 4JVNA 1N2XA 5FUYA 3AJDA 4Z0PA 5AI5A 1OX4B 2W9XA 3PGXA 2JBAB 2WD7B 2F1HA 3FBGA 5G3ZA 5TE9A 5KDOA 2NO1A 2GEBA 3PXXA 3F97A 2Y1KA 4KPYA 2QE6A 3B6IA 2HU2A 1FVOA 1U0LA 1PT5A 3DOJA 3DZ8A 4MQBA 4EL5A 1HL7A 4HB4A 3DLHA 1FDIA 1ORIA 2ACWA 3IAS6 4ZOCA 2XQJA 1ECFA 1GKIA 1JKXA 4KQ1A 3RSSA 4J0IA 2H0AA 5HP4A 3FCUB 4AF8A 3BH6A 2PU7A 1Z2PX 5B1EA 5EEGA 3DEYX 3P20A 1TUIA 1C5KA 5J3JA 5FOQA 3UAYA 3QQ5A 4INZA 1LRJA 1CZHA 5C8XA 4P3YA 4HPJB 2TECE 4NU5A 4GIBA 1YQGA 3TIGA 3TD2A 3S55A 4B3MB 1ONBA 3FNEA 3GRYA 2PLAA 1G8GA 2FMIA 1BH6A 2RKBA 3COVA 1EQAA 4BQNA 1N5LA 4W7HA 421PA 2E4ZA 2W4MA 3TUJC 5G4KA 3T5BA 3IQFA 4RESA 1SUCA 1YCDA 2DX7A 3C4JA 4M8IA 5CYOA 5EGSA 2O2IA 3C85A 5LXTA 4UOQA 1FYWA 2WYIA 1ZHOA 3FPGA 5HFAA 4X85A 3VC3A 2C4WA 4BFVA 2E1RA 1QV9A 4U9UA 1OX6A 2QAGC 1GGVA 3NHMA 3G5TA 4L74A 3FF1A 1V6CA 1Z5ZA 4KN6A 5JIBA 5BR8B 3NUQA 1GSIA 2WUVA 3A6GA 1XEAA 3QXGA 4L0CA 4UD2A 1AUQA 1EEHA 1DG9A 1TFUA 3C8MA 1SUFA 3BMCB 2CFOA 2B78A 2ZDHA 4LHSA 1JKJB 2Y4NA 2GK6A 4MITA 4MGIR 4RX1A 2A57A 2N75A 3QF7A 3T4UA 1MFPA 1SD5A 1HT3A 2HBYA 5WRFA 3S2ZA 3TO5A 1E4EB 3T3PB 4YJGB 2Y6UA 1JL3A 3H2YA 1DT5A 3GA0A 4OA8A 3G0HA 2LPMA 1TF2A 4FYVA 3ZU6A 4Z6KA 4R2MA 2A84A 2WA2A 4G84A 5AUNB 5KPJA 3EIHA 4ND4A 3SK0A 2ATXA 2G28A 4KJZA 4YRMA 3IDOA 5BXQC 5HIAA 1Q84A 4TL8A 7YASA 2HQOA 2Z4TA 2G9ZA 3KDAA 5MHTA 1NMSA 3K0AA 2C9ZA 2G63A 4PO9A 4DLYA 2FPKA 4HH0A 1DZIA 2IY7A 4CGYA 1EB8A 1N2GA 2HFKA 4LJKA 4EJSB 2NV2B 3A26A 4ZC8A 4H59A 3D4PA 1V8PA 4HADA 2Q2NA 1CQJA 3BWYA 3HKDB 4JUFA 3VR5H 3JS5A 4C7OB 4XLTA 3H2BA 1RNLA 2RAVA 5GAJA 3HP7A 1OFHA 2ENUA 3E3NA 1XTKA 3ETHA 3GZNA 4F3CA 2ZRCA 4YV7A 3E9DA 5FV4A 2R1UA 3ICWA 1AA6A 5HF8A 3CVVA 5KWIA 1R27A 3TE7A 4S1TA 3EQ9A 3P9SA 1KFCB 3ZXSA 2CLCX 3AUAA 1M6NA 1WJGA 4EVRA 1HDCA 1USWA 2P2GA 4KQFA 4E51A 2I8AA 5CXSA 4MRSA 5ALVA 5LU9A 3K72B 4JLDA 1F0YA 5FR1A 3RD5A 3CO0S 4JR0A 4M1QA 5B6JA 2FEKA 4EFKA 5I4CA 4BV9A 5EJ4A 2Y0EA 2V45A 2OCIA 2Y9PB 1WCIB 2ZSHA 5FWXA 1PBTA 1DBQA 1VJRA 4ZCLA 8GPBA 4MW2A 4W8HA 3L92A 4TTAA 1QQAA 3ZI0A 1L4EA 1AK9A 2R79A 1T9ZA 1S8NA 2VL7A 3GMTA 2IKQA 4ZZ3A 2IOQA 5DM4A 1KZGB 3L2OB 5J2UB 1X14A 3G9TA 1H5NA 4ARUA 4MP6A 5EKXA 1PEKE 3IIJA 4XFJA 5IKXA 4BC1A 4DSUA 4ABYA 4MV3A 2ZIXB 4RZHA 2DUWA 3W2GA 4DMMA 1K3TA 4HX5A 4RTMA 3BIWA 3MINA 1C7FA 4JBYA 4NCNA 2DQSA 2I1LA 3HJAA 2IYYA 3R3JA 2GCIA 3NOOA 1NUAA 4Z99A 3CZ5A 3NHKA 2BIFA 1AOXA 1FSGA 1QWOA 1LQTA 2BL4A 3M83A 3MG9A 4KPGA 1UBKS 2JGNA 1UMCB 4Z9FA 1JNYA 1N4AA 2CKDA 3TQCA 1Y1QA 4FSDA 4L5BA 4BQQA 4PHGA 2V1XA 1TGYA 4TYMA 3MFQA 1I1HA 2IHTA 1W19A 2HT1A 1PNTA 4H1TA 1JA0A 1YKSA 1TVKA 3KJHA 2FWRA 1DELA 1U90A 2BMDA 2JCSA 1SVUA 3R3ZA 1V8ZA 4GI3A 4HB0A 4II3A 4QYXA 3RUAA 2A59A 3MXTA 2GM5A 1UC8A 2F6RA 3T5PA 3GRRA 5AVUA 1G20A 5EY5B 1JPNA 5J2UF 2BM0A 3QXHA 3TEMA 1JYFA 1ENZA 1CUWA 4IV0A 3COYA 3ENWA 4AM8A 5AESA 3Q3HA 2CF6A 3HCDA 1SBNE 4MEBA 5B4VA 4NS1A 1RYZA 4B3BA 1G2QA 5E0KB 3IA2A 3V7FA 5KYNA 5NULA 2ZRQA 1TKBA 4RLFA 4EMUA 3PBKA 3BE8A 1E69A 4LZWA 4Q16A 3THWB 3A06A 1JLLB 1Z37A 3FPAA 1U28A 3O93A 4LRWA 2F1KA 3J80A 2XA9A 1N34B 2P0EA 2HA7A 1DC7A 1BFKA 4IDBA 3DUFA 1EZ1A 4PIVA 4D56A 4ZQFA 4Z2AA 3DDUA 4KLZA 1AY0A 1IXSB 2GJKA 3OZXA 3I3SR 2I6FA 4ZYWA 2V5UA 4WINA 1QTNA 4CM1A 1GLNA 2Y99A 2YS7A 1WE2A 3NKFA 2VRBA 2X5NA 4OXKA 4ND2A 4LISA 1IXYA 1R3DA 5LYYA 2VT2A 1JU3A 1ODSA 2AJ8A 4KR9A 3S2UA 4ND5A 4LQDA 4ZK2A 1QRTA 2AS0A 1ZM7A 3BF8A 1XQ1A 2WD8A 4MWBA 1GZUA 3F9RA 1Z0IA 2EKDA 1W581 4BJ3A 5ES3A 1M2VA 3VZSA 4AJ1A 1VXRA 3RVKA 1FFWA 1ZNXA 2Y77A 5TB5A 1IXKA 1SIOA 2H4YA 4KB5A 2BGNA 1PTJC 3GR6A 5AVKA 4I1PA 1Y5RA 1E6KA 5ALEA 3GLGB 1AXRA 2P4SA 2VJAA 4RGBA 1TQ8A 4BGEA 2VJQA 1QRDA 3F0TA 4KK4A 5A6SB 3RODA 3LY5A 4M21A 2Z3ZA 4RF4A 4UE6A 4EHKA 4E03A 4YX9A 1WRBA 1XZBA 2CXQA 1H8ED 3ZBTA 5KNCH 1IVSA 2CN1A 4W4TA 4K8RB 5EWMB 3LVFO 4FMPA 1Z5OA 3WHKA 2G67A 3G0CA 2BHRA 1FK8A 2R1TA 1UIMA 2ZR7A 3R20A 2GD0A 2REXB 2H17A 4XWWA 1V25A 3WK5A 2HTEA 1C3XA 5AUQA 3RU2A 2R3SA 3ZZ1A 1NNEA 2VPPA 3LH5A 3GEHA 3GNTA 3MA0A 1PFUA 3OLXA 4R81A 4YT5A 1E4VA 1H8EA 3ZKWB 1QXSA 3NBXX 4XGKA 3ILVA 3K9LA 1VCMA 1LQ2A 4KXNA 3A70A 5H80A 1WUIS 4DCVA 3IAS1 5KJCA 1EFRD 2PD6A 2QV0A 2WWTA 4J7CA 1FRNA 3EDQA 1NVDA 1TTPB 3NRJA 4JR1A 3RTDA 3QIAA 4ZP1A 4R71A 4OX9Y 1KKMA 8MHTA 2CVZA 1PR5A 4FC7A 1IB0A 3PC4A 4YP5A 2F9FA 4QOSA 5CCXA 2WLTA 2F8LA 2IITA 2P67A 4DXDA 3FVWA 5FI1B 5HRUA 4DA8A 2XKKA 3A25A 2IIQA 2PX4A 2B4QA 4G0OA 5A05A 3C7CB 2Z8ZA 3BPSA 2FWAA 2ZUSA 3G85A 3RQSA 4EYEA 1DQNA 1QVWA 1I0ZA 4MW0A 1DAIA 3FSRA 4KH1A 4EH1A 2GVNA 3USES 1F8FA 1PR2A 3NM4A 2D1YA 3BQMB 4A8HA 5C8YB 3GDWA 4PNZA 4ZMBA 4BQSA 1COZA 4M9SA 1NVFA 2H51A 2VDUE 4WBNB 4BU0A 1PR0A 2QNRA 3C45A 3VDNB 2C2OA 3B89A 1H85A 5KNDA 2KSQA 4KI7A 5E7JA 3BD9A 5TJ9A 3SC2B 3WSTA 1YDFA 2J46A 2D8AA 4MKFA 1ZH6A 4MYUA 2Q21A 4P2BA 1D7OA 1D7AA 1K5GA 1KKLA 3CF6R 4P7JA 5BV8A 3H9GA 4ENVA 3L06A 4MQUA 3MMNA 3KO8A 3QXXA 4JHXA 3TPFA 4A2PA 3KJXA 4QVIA 1GSOA 2R60A 2HK7A 2HSDA 3EJWA 2GD6A 1ML3A 4GDMA 2FZVA 3IUNA 3J7AC 1TT5A 2HO4A 2QX8A 3IJPA 2WNIA 3MGCA 1CJUC 3T7DA 2RHLA 4OHMA 3G2NA 5K6AC 4U2DA 2YR0A 1L8LA 1NXXA 1ULHA 3FGPA 3VKWA 2E37A 3AERA 3IHWA 1U2DC 3BUSA 3I6ZA 1W94A 5AVSA 1FJ2A 3A3YA 2O7QA 3GELA 3PNBA 2BOVA 2B82A 2GT1A 2EEZA 3NALA 1L4LA 2NTYC 2QD3A 4DIBA 2OZKA 1O6CA 4I4TA 1JEDA 1QNFA 1JEAA 4Z54A 1ULBA 3K0EA 3JYOA 4FCCA 3BMOB 2ZWAA 4O4HB 3WMRA 5HRAA 2G1KA 4GRAA 1HYEA 4CUJA 1DCFA 4UMDA 2XUJA 1AQ6A 4XB6B 2QM0A 2Q3HA 3ZU5A 2J0SA 1OVGA 1PL7A 4WGGA 2VYND 2BCEA 5CA1B 2R11A 4QTUB 5GJCA 2EKLA 4UU1A 3F4BA 2XCRB 1QQBA 4IJ5A 3LE8A 5FLKA 3EQ7A 4PS0A 5BMVA 4EG5A 3T38A 1AHHA 5BR1A 3DG9A 3WFJA 4PV7A 1LC3A 4OKIA 3AOGA 3OJFA 4NBWA 3TSWA 3VNRA 3I9V6 1OH6A 2QYHA 5JZBA 1XCOA 2PFGA 4JJ4A 1NOJA 5L4NA 2IP1A 3DO6A 2GN2A 2V8BA 2VYNA 3GIWA 3BGSA 1PW5A 3EFOB 3ODPA 4BO4A 5JCJD 2D1QA 3L4BA 3OI7A 1NG1A 3A6HA 3EGVA 4EPYA 2V4UA 3HDTA 2ZYDA 1NUQA 1O5IA 2Z5FA 1ZYUA 2P5YA 3CUSA 3K9GA 2CL0X 3BWBA 4ZEXA 3O9VA 1YDMA 1E7QA 4NZMA 2TMYA 5AI4A 2E82A 5TQVA 4ARZA 1D5WA 4PRLA 4W1PA 3N70A 4K7JA 2ZRDA 4URUR 3RS4A 2R6R1 3HEBA 4UUOA 3WWZA 2ZSBA 3ORYA 2W4IA 3L7JA 3QKUA 1TAUA 4QAJA 721PA 1UUFA 5JCJA 3A4VA 4B4OA 1SKMA 2W2QA 2FWMX 5BYBA 1E1KA 3U39A 2ONZA 4GD3Q 1T8PA 4GXRA 1JXAA 1TJ5A 5K45A 2EARA 1ZQ1A 2FJUA 3A2NA 3BXEA 1QZXA 5EN4A 2APJA 4KFSA 1JKFA 3F49S 5DCUA 2WYVA 5ALPA 3RYIA 4UTNA 2XWJI 1OH7A 3B1WA 1EVQA 2D7CA 1IMJA 1KFEB 1Y3BE 9ATCA 2ZB4A 2Z2ZA 2WWHA 1AT1A 1ZD8A 1J0CA 1RZVA 1C1DA 2VZ8A 3RVBA 2G5CA 3KSZO 4K8OA 4BVBA 1SXGA 5CH3A 3LHIA 3F73A 3ZWMA 2AQIA 4WESA 1SVOA 4BTEA 1MJGM 4IPTA 2IHKA 3BD7A 3OPQA 4FEAA 1U0EA 2Q2VA 3FYUB 3HCOA 5GADl 1KSFX 3I6YA 5J2TB 2WM8A 5JISA 3T41A 1XPRA 1I7NA 2B36A 4MDEA 1KU6A 2YWCA 1CY7A 1K7SN 2FZEA 2Q5CA 3OPYA 4C76A 2BR4A 2R25B 3WWDA 3KSUA 1CCDA 2GLTA 3RGWS 2O2SA 4MYRA 3I73A 3FLMA 5IJAA 1YI0A 2DE0X 3CE9A 4IBOA 4CIWA 1UXKA 2ZUFA 1E79A 4P32A 1H22A 4MA4A 5CTJA 1FSPA 5HHTA 5H8WA 2H1IA 3FZGA 1MCZA 1VPLA 1ZI6A 4KAAA 4D8UA 1TA4A 4LWPA 1UWLA 3MCUA 2OCGA 1DQRA 2GEKA 3CNEA 4NMHA 1NJ6A 5LC1A 5DM70 5CURA 4H3SA 2Z2IA 2FW9A 4RJLA 1QORA 3EAGA 1DXHA 2SNIE 3TW8B 1ST3A 2V6GA 1ULUA 1UPAA 3D4OA 4PLCA 4PICA 1PFKA 1NGSA 1N6NA 3I9LA 4NU0A 4D46A 2H7CA 3OLZA 2M1XA 5IAGA 2GJ9A 4AP5A 1OV4A 5IN4A 1TE2A 1C0PA 2OILA 4K9NA 3RM3A 2A1TS 1AC5A 2KYRA 3NHZA 4HQLA 3TFWA 3SFVA 4MGHA 1BD4A 1JFTA 1Y6RA 4LF4B 3JVVA 4UBOA 2EWVA 1D4OA 2IXFA 4XSHA 1GDHA 4YECA 3S99A 3WRXA 2JA1A 1TIPA 2ZXEA 2D5CA 3MTDA 1NDQA 4MA5A 1P4AA 1TQDA 2EW1A 4TS4A 4TXJA 1K98A 3EVDA 5BN5A 4R1QA 1MAWA 4KYVA 5AJHA 5DTRA 4YUZA 3J81A 4RVNA 2Q6TA 3WNQA 1ES9A 2D1FA 5EJ8A 3KQWA 3QFFA 2AFVA 4RPLA 3UY4A 1FXSA 1VCIA 2HNKA 4OB7A 4C3UA 3NH9A 1Q92A 3KBBA 2VDKB 4G89A 2JGFA 3LVBA 2D0IA 1RIFA 3FPSA 4PZZA 5KCZA 2WT8A 1RD4A 4FOSA 2XYVA 2DCMA 3W06A 1J09A 4O1IA 2AEJA 4XDGA 1U6KA 4D9HA 5D1NA 1BIFA 4MGKR 2RGEA 4EEKA 2OM2A 1SN7A 4XSVA 4G0QA 1T24A 3C2QA 3GEEA 4U5QA 5I51A 4GXQA 4K6HA 5FRDA 4IIJA 2C1XA 4LE2A 3WSVA 2NU7A 3BXHA 1NHWA 2B20A 2CY0A 3E84A 2VK1A 2G9UA 2VF7A 4BNGA 1BN7A 5CDFE 3IE0A 3OOYA 4JASB 1SVNA 3E7DA 4MV8A 1P18A 5EEHA 1ZRMA 1NYTA 2X3YA 4CTMA 2B9EA 3PI7A 3QXJA 3IKLA 3VX4A 3WKDA 2VHZA 4FR2A 4LYJA 1TCVA 4N6OA 2ZCJA 3W6ZA 1GLVA 2DWPA 1K7YA 2XVAA 5MN6A 3LZ6A 4CEIB 1SB9A 3LWNA 2VF5X 3HCEA 1NAHA 1BEEA 4QSMA 5FULA 3QA9A 5KQMA 1XHLA 2PGAA 4R1TA 4YP6A 1IYZA 3G8AA 1M8GA 4JKIA 1PYOA 1HNXB 1CRZA 3VTZA 1B23P 1KYQA 2EL7A 3IMGA 1YZ3A 2C97A 1B42A 4LV6A 5FPTA 1IY1A 4DQDA 1H3NA 4KQHA 5ADWA 2P0AA 2VNJA 3PYXA 4HWSA 1KEZA 4J7UA 3BE5A 4UTOA 5AT1A 2QG6A 1JH9A 4JUIA 3CISA 1MDFA 5CLGA 3KZXA 1YU6A 1GGJA 1E92A 3R0JA 2IH4A 3V5NA 3HU1A 1R16A 1E2UA 4UE3S 1O95C 1NUSA 3W0LB 4JJ7A 4GE0A 3HBAA 4ODIA 2W7TA 3AHDA 1XU9A 3FYSA 3VAAA 1D4FA 3GH1A 3PQFA 3ESQA 2QENA 1VRCA 2AX4A 4MARA 5AMXA 4N0QA 2WU4A 2OOKA 1I5EA 1SCAA 1QFXA 2ANBA 2VJCA 3H7IA 3NW9A 5A3RA 4KZPA 2ZE8A 1FDWA 1EINA 2I78A 2Y1EA 3KLPX 3V8PA 3W3ZB 2OXTA 2ADMA 3E0XA 1HGXA 1NDUA 2W6CX 3KR0A 4N01A 1TO2E 1QMPA 3BD8A 1H1DA 2J9ZB 3T1TA 4P82A 4J0HA 5ABPA 1YQDA 4L4YA 4IIBA 1S96A 1AB5A 3M9XA 2IEAA 4YK7A 1MA0A 3GOHA 4S1WA 1Q0UA 2C5EA 2G72A 1W9MA 4MUHA 2D4HA 1SZJG 4D9MA 1OD6A 3K94A 3LX5A 1C3JA 4JROA 4YRLA 2FDRA 1BXGA 4Y1FA 3IR7A 4X7RA 1UZUA 4E4TA 4HHEA 4V2IA 2Z2XA 4I50A 1CVLA 1CZNA 2J59A 4LY3A 4QREA 4X93A 4YRRA 3D9QX 3DMDA 3G2QA 3PF8A 4G5GA 4X1KB 1HV8A 4CM6A 4XPIB 1YB6A 1HNWB 3ZGOA 4J49A 1PKEA 3MD9A 4B9EA 4YAJA 2G0TA 4RHUA 1MFZA 1TAQA 3M49A 1NMZA 1C9NA 4R8RA 4TL7A 1XRRA 5AW0A 3T1NA 1EBBA 1QH9A 2OC9A 3W6UA 4HDAA 1KI1A 3K6JA 2VHVA 1T2FA 3IAUA 4PC7A 1ZINA 2W93A 3ESDA 3LHDA 1G8SA 3P97A 3BJMA 3VR4H <