2WJ3A

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
b'TDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
publication title Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
molecule tags Oxidoreductase
total genus 104
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2009-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 2wj3A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wj3A01
4BZZA 5AK3A 2Q0XA 1LGYA 5FP0A 1K6EA 5HK9A 1DWOA 3H2IA 4C6HA 4TPKA 4GEGA 4DIUA 1QZ3A 1TCAA 2PBLA 1UOQA 3FYUC 1QLWA 1THGA 3FVTA 1C7JA 1EK1A 2QZPA 4L0CA 3GA7A 3HSSA 2PUHA 1QTIA 5ALLA 4M0EA 3BJMA 2J4CA 3STTA 1TK3A 5LZ8A 2PSJA 4K5QA 4X3CA 4U2BA 4BDSA 3W2TA 3DOIA 1SFRA 5CXXA 4BCBA 4GBGA 2FJ0A 3AIOA 2XUDA 5F4ZA 3R3WA 4P08A 2ZVDA 3A6ZA 3A2MA 2YASA 4AO8A 4YPVA 3E0XA 3KWJA 2VTVA 3W04A 2XMBA 4PO3X 5AKEA 3W05A 2BUBA 2XB6A 4H18A 5AP9A 1XZKA 3PFBA 4LKOA 1LPMA 3WWDA 2BFNA 1L7RA 3OOSA 4Q82A 2H7XA 1EH5A 3UUFA 5ALGA 2WU4A 1XFDA 2PU5A 3DYIA 5A7HA 1ZD2P 1CUUA 1BEZA 5ALFA 2QUBA 3R3VA 4GLBA 1DT5A 3ESBA 3G0BA 1ZD3A 5A62A 2DHCA 4KE8A 1MX9A 2CMFA 5JAOA 5CURA 4UHDA 2AJBA 3H2GA 1ISPA 3DS8A 1UKBA 1DINA 2QOEA 4BYMA 3WK6A 1XQVA 3STUA 3FOBA 3IIIA 4B80A 1CUGA 3QPAA 2JIDA 3IUMA 2WTNA 2OCLA 3MUOA 1ZICA 5C81A 1MTZA 1VXRA 1GKLA 3EQ7A 4HXEB 3I2HA 2HHAA 4QLOA 3HC7A 1FFDA 4C88A 2WHRA 4KE9A 3F98A 3WWEA 1Y7IA 3M82A 2XMGA 3G9TA 5DNUA 2XLBA 5ALMA 4OPMA 1DWQA 1WB5A 1M33A 4QEKA 1LPPA 2ZYHA 3TGLA 3EQ8A 5KBYA 1THTA 1TRHA 2Z3ZA 3D3NA 3OURA 4X6XA 1ZIYA 3FSGD 3WZLA 4OYLA 4J0IA 4E11A 4KRYA 1T2NA 5E4TA 2CB9A 4E14A 5LIPA 1EB8A 1KU0A 1ZGCA 1DQYA 4U2EA 1JJFA 1XLVA 3DKKA 3T4UA 4DGQA 5AOCA 4Y2RA 1FFCA 4XVCA 1QO7A 2WHQA 3IURA 2GYUA 3HACA 3H1BA 4RGYA 1PV1A 2CEKA 4Q34A 1IMJA 4EY4A 3C8HA 4HTAA 2J4FA 2WTMA 4L9AA 5AI5A 4W1RA 4KAAA 2D5LA 4K2AA 4Q1VA 3KWFA 5K3EA 3PI6A 5AI0A 1CUEA 1L7QA 5HKAA 1WPRA 1AZWA 1UXOA 5C8ZA 4UBMA 4FWBA 2OPHA 1XLUA 4C01A 3ILSA 1PFQA 2HFJA 2V97A 2O2HA 1E8MA 3O0DA 5CT6A 3F8SA 4J03A 1TCCA 2XUQA 2BKLA 2O7VA 4FBLA 1QO9A 4AZ3A 2OCGA 1CIJA 4DNQA 3WMRA 4RPCA 1XQYA 2HDWA 3OPMA 5I9IA 3R41A 4LXHA 3DKRA 4X92A 1XZIA 1BRTA 2G5TA 1TIBA 3PDCA 4Q3KA 1OXMA 3FLAA 1CFJA 3HZOA 4JH0A 2DQZA 3PFCA 1YA4A 2XUPA 4K6KA 4RE6A 1QTRA 2HU8A 2Z8ZA 2Y2VA 3W06A 5FXMA 4QDTA 5A2GA 5ALKA 2EEPA 4AX4A 3F9CA 1CRLA 3FLBA 3QZUA 5ALIA 5LZ5A 2QJWA 3STYA 5EGNA 2V9ZA 4X7BA 3G8YA 3DJYA 4WDRA 2HFKA 4IH9A 4OSEA 3STXA 2PVSA 4QWMA 4QDOA 4LYEA 4Y2QA 3H2JA 1LPOA 4PNZA 5FLKA 1D07A 3V1LA 1LPBB 1A88A 3EQ9A 2BGNA 3IB3A 3EF3A 3HLKA 1Y37A 3AJAA 4UHEA 2IX9A 4J0CA 5JD4A 4JEIA 2ORYA 5BOVA 5ALRA 1VA4A 1R50A 5ALPA 1GPKA 1R9MA 2WFZA 3ESDA 4GXNA 5AKHA 5ALOA 4EHBA 2RAUA 3DD5A 5AKGA 5AIAA 5EIEA 1LBSA 1EINA 5AM5A 4GDMA 3VDXA 1XRLA 2P8SA 2BCEA 1GPNA 4Z49A 4ZRDA 2G4LA 5DNVA 4Y2JA 3WKCA 5D3KA 1O6GA 4BE4A 3ESAA 2RHTA 4BRSA 1QIKA 5CT9A 1WOMA 2ONCA 4KRXA 1CUWA 4Y7DA 1XZDA 5JZBA 4AXBA 3EBLA 4N8EA 5D7BA 1EVEA 3ZI7A 3OG9A 4N5IX 5ALQA 3R3YA 2GBGA 1GZ7A 4I19A 1ZI6A 3B12A 3HJUA 3WK4A 3IUJA 2Y6VA 1EA5A 1CUSA 1HPLA 4H7IA 3WJ2A 5BWBA 3CCCA 3I6MA 4H0CA 1WHSA 4ITVA 4CI9A 5DYYA 3Q0TA 4MWSA 4WFJA 5K5EA 1QE3A 3O9MA 1L7AA 4XX1A 5HFNA 4CG1A 3BWXA 5H3HA 1A8UA 2XQIA 3D59A 1EVQA 1ODCA 5FOQA 5LZ2A 4KE7A 5SYMA 3G0IA 5HQ3B 4F60A 2QKYA 3O9VA 1X2BA 4X94A 4QNNA 4MQLA 5CTAA 1WB4A 2WQZA 4Y2SA 3UMJA 3WK9A 1XZMA 2JGFA 1SC9A 4ZI5A 4V2IA 4WFKA 3FNBA 5K3AA 3GELA 4X00A 2XDWA 1WCYA 1DX4A 5JYCA 5KWIA 3D4LA 5JD5A 4MYDA 1XZCA 2ECFA 1XZBA 5JARA 1MN6A 3I6ZA 2J3QA 5JZ9A 2R8BA 5CT8A 2AJCA 3WIBA 1CVLA 5IKXA 4A16A 3QMMA 3JW8A 5HQ3A 3QVMA 6YASA 1N1MA 2V96A 1X2EA 1PJAA 3CXUA 4FFWA 1LPNA 4F0JA 1VLQA 5ALWA 5IH7A 1JMKC 2DCMA 5AJHA 1G5FA 3LLCA 5IVDA 1A8QA 3H0CA 1MJ5A 1ZJ4A 4TGLA 3O95A 4XJVA 5ALDA 4BAUA 1TAHA 3F67A 4J0GA 3C6ZA 1ZD5A 1ZD4A 4BP8A 2BGRA 4X85A 4EY8A 3QMVA 3H19A 3BJRA 3H2HA 4ETWA 1XZLA 3TJMA 2X76A 1CUAA 1VKHA 5A6VA 4ROTA 4C87A 3BIWA 5EIAA 5JAPA 3QMWA 2QXUA 5AIBA 5AKKA 5JADA 1R1DA 2W6CX 4BRZA 1P0MA 1YSCA 2JGEA 3TEJA 4H7DA 4BC1A 2XUFA 2CJPA 2PSDA 3DL7A 4W1PA 1G42A 5ALXA 4EBBA 2HA5A 5AI8A 1W6RA 4I4CA 2WUDA 2RHWA 1WB6A 4FTWA 5AM3A 1VJ5A 5CH3A 5IVIA 1H2XA 4F21A 1DQZA 5K3CA 4DMHA 4M0FA 2BAGA 3VJKA 5D3ZA 5BV7A 3U0VA 4DYHA 1QIEA 1JMYA 5A7GA 2FUKA 4C4XA 3E1GA 1IUNA 3G9UA 1BROA 4IQ4A 1MNQA 3ZLVA 2Z3WA 4WFIA 4JYPA 3FYTA 1FFAA 3ZLTA 5CW2A 1B41A 2V98A 4ZREA 2YXPX 5AKLA 4BAGA 2XE4A 3LIIA 5JZSA 1IZ8A 4W1QA 3IUNA 4B6GA 2XT0A 2EDCA 1SOMA 2XMQA 3R3ZA 3DOHA 2B61A 5LZ9A 4JUIA 1UKAA 3WI7A 1XQWA 3VVMA 2NW6A 5LP1A 3WZMA 2AJDA 1ACJA 2XMRA 1ODSA 3K6KA 3S8YA 7YASA 5AM1A 5E4YA 4MJ3A 3H1AA 5FDFA 2WIFA 2PSEA 1F8UA 4G9EA 1QIGA 1IZ7A 3QPDA 1XKLA 3L1IA 1H2WA 3C87A 4CG2A 1EHYA 4J0HA 2HM7A 1GQRA 4PV7A 5CRIA 2HA6A 4ZWNA 1UZAA 2XQJA 1QIJA 3FYUB 2X8BA 2C4HA 5E2IA 1Q0RA 2GBIA 1MPXA 3ESCA 3R3XA 2FJPA 2DSNA 1J1IA 5ALEA 2ZJ6A 2PSFA 1U2EA 5ALTA 3KOOA 1CUVA 2HA0A 1IUOA 4BTLA 4IH1A 4LIPD 1YA8A 1F0PA 1G4HA 1AKNA 3RARA 1ZJ5A 2C0QA 1Y7HA 3WK7A 1MX5A 1AURA 4I3FA 1E5TA 3RM3A 1USWA 2RIPA 4KEAA 5DTJA 2XUIA 4Y2YA 5AI4A 3FYUA 3AILA 4LXIA 3I2KA 2YH2A 5E4JA 4PQEA 4B0PA 4Q3OA 2GZSA 3WKBA 5EFZA 2JGMA 2XMDA 1LZKA 4MYSA 5AOAA 5A7FA 1GGVA 2HL6A 2JBWA 4HXFB 2OLEA 3PUHA 3D2AA 4B81A 2OGSA 5FRDA 5EHNA 1W52X 2VJCA 2OCKA 4Q3LA 4Y2PA 1DWPA 3D5EA 3V48A 3DDUA 1QIMA 1UT6A 3WIOA 3CCBA 4FMPA 2B4KA 1DT3A 2ZSHA 2RGUA 2J3DA 4FBMA 1MO2A 2XLCA 3DLTA 3BIXA 4AMZA 2HA7A 2BUAA 2CKMA 4UBKA 5K3BA 4ZXFA 3FLEA 1MAAA 1FJ2A 2WHPB 2WIKA 1ZGBA 4GECA 1GQSA 3WKAA 3QYJA 2G5PA 2GZRA 3W9UA 3MVEA 1W1IA 5JATA 3U1TA 1R88A 2OQIA 3KD2A 4BP9A 4YASA 5CT5A 2QM0A 1AUOA 3N2ZB 4FDMA 2XMSA 5ALHA 5DYTA 1UK8A 2ROQA 2WJ3A 1W75A 2WFMA 3ZWQA 4AQDA 2WHPA 4FOLA 3IUQA 3I2IA 4B85A 2AXEA 2H7YA 5CXUA 3B5EA 4QZVA 3A70A 1P0PA 3D2CA 4UBLA 2JGLA 1X70A 3X3HA 2LIPA 5DYWA 3STVA 3UUEA 3I1YA 1HL7A 5AOBA 1HDEA 5JALA 4AO7A 3H18A 3E4DA 1F0NA 1E3QA 2GBCA 2WIJA 4B83A 1UWCA 1F6WA 1JJIA 2Y6UA 4NS4A 4H7EA 4DSAA 4MEBA 5SYNA 2HU5A 2VATA 4U2CA 1AQLA 3C45A 1ETHA 3BF7A 2FX5A 1HLGA 4A23A 5ESRA 1CUJA 5T4EA 5ALVA 4PF1A 1GKKA 3IVMA 3AZQA 5JASA 3FVRA 3P2MA 1W4LA 5AKYA 3IA2A 2WLSA 3R40A 5FUMA 3HYSA 4BCDA 4DM7A 4OUKX 1E66A 3HXKA 2OQVA 2WUGA 4BCCA 4UBOA 1XQXA 2BJHA 2OG1A 1NX9A 3VXKA 1BCRA 3LIPA 2VQ6A 3GZJA 5T4BA 3D7RA 4G1FA 4BVKA 3DQZA 3WL7A 2G63A 4B9AA 4HZGA 4LXGA 1YAHA 2VJDA 4J3JA 3IDAA 1N5MA 4G4IA 2WUEA 4UHFA 5C7YA 4HRYA 1YB7A 1GPLA 1MT3A 4H77A 4MEAA 2PL5A 4G8CA 4CIBA 1SCKA 4C89A 5I8PA 3VJLA 3YASA 5LKRA 3SC2A 2I3ZA 5IVKA 4YX9A 2WG2A 5DJ5A 1MU0A 3G7NA 4BC0A 3JWEA 1AMNA 3FBWA 4GI1A 5FKJA 2B20A 3E3AA 1CUHA 5AM0A 3STWA 1XZFA 4AZ0A 1XZEA 4TVKA 4UFOA 3I6YA 4E46A 4YK7A 5JD6A 4X95A 3V1KA 3A2NA 5T4HA 3QPCA 1CV2A 2CBGA 2H1IA 3I2JA 3S2ZA 5AHXA 1LZLA 3LP5A 3ANSA 4WY8A 1HBJA 4AMYA 4JYMA 1E8NA 4PSUA 3WJ1A 1TQHA 4QDXA 5ALSA 5IVHA 2X5XA 1YS1X 1YB6A 2B9VA 5AO9A 5EI5A 4X71A 5HFAA 3V1NA 1XRRA 2IIVA 4L72A 5EHZA 1FFBA 3O4HA 4FKBA 3BDVA 3BL8A 5AICA 4PSDA 5AK6A 4Q05A 2WG1A 1NU8A 2RONA 2XQFA 4G4GA 4KR0A 1CQZA 3FAKA 2DHDA 1JKMA 2H7CA 1K5PA 2C0PA 2C7BA 5K3DA 2DQYA 1DTEA 2ES4A 2Y1KA 2XUKA 3AZPA 2OXEA 5EHQA 1LLFA 2XQGA 4GHWA 5FPPA 2XMZA 1YAJA 1LPAB 3WWCA 3H17A 1J2EA 4P9NA 4WDQA 5BWCA 1MAHA 5CH5A 3Q8WA 2YYSA 1OILA 3C6XA 1A8SA 2ACEA 4FNGA 4B9EA 3C6BA 5ISMA 4S0XA 1EDDA 1XRQA 4M0MA 5ALJA 4J0DA 2PKYX 3WWOA 3RK4A 2PX6A 1BS9A 4B84A 3BF8A 4P93A 4CIAA 1KEZA 4XWGA 2Y2UA 1XZGA 4BAZA 4BDTA 3ANTA 1C4XA 4W9RA 2WKWA 4XIIA 3ZV7A 2JEZA 4FNMA 4B82A 4KAJA 4DLNA 3VVLA 1JFRA 4JNCA 4WY5A 1K63A 5HF9A 5AI9A 5FPQA 4EY5A 4BZWA 2JGIA 4GWLA 3QH4A 1YS2X 2WJ4A 4OYYA 4OB7A 2WJ6A 4ARAA 5DNWA 1J06A 2IITA 3ED1A 3SK0A 1XRNA 1MX1A 3WKDA 2I78A 1AX9A 4Y2UA 3BXPA 1RWQA 1UOPA 3RKSA 4CCYB 1QOZA 4UPDA 1W76A 3NWOA 1EK2A 2QJRA 3CN9A 1FSSA 4G5XA 1KU6A 5FV4A 4FLMA 2WG0A 3AFIA 3W9BA 3KDAA 3WK5A 5JANA 5CT4A 3IBTA 4O08A 4UBJA 5JAUA 2ZYIA 3G0GA 3PF8A 2XUAA 2PUJA 4C4ZA 2C58A 1XKTA 1O6FA 4C4YA 2GBFA 5AI6A 5I7UA 4DMCA 5LKAA 5K3FB 4N8SA 4B0OA 4CCYA 4PW0A 3V1MA 5AKJA 1A7UA 1JJBA 5ALZA 1SCQA 3C5WP 2QTBA 1CR6A 2XUHA 2XMCA 4ZV7A 4EA6A 4U2FA 4UHCA 3I2GA 3HABA 2BUCA 1QIFA 1VOTA 3FCYA 1OCEA 3WLAA 4AN1A 4MQMA 5KREA 3ICVA 2PU7A 4X93A 4ARBA 5AH0A 3QM1A 3C70A 4OU5A 4DTCA 3AUKA 4NVRA 1CUCA 1C7IA 5K3FA 5AKIA 2PPLA 1GXSA 4E15A 5A71A 2ZYSA 3RLIA 1K4YA 3WL5A 2WILA 4HS9A 4BTVA 2R11A 2XUJA 4H7KA 4U2GA 3TRDA 1N5RA 4EUSA 4K6HA 3AIKA 4X6UA 4Y9SA 5DWDA 2AJ8A 3EIOA 3OTQA 2RI6A 2XUGA 2HADA 1HKHA 5T4FA 4QDUA 1R4ZA 3CN7A 4KJXA 5C8VA 1ORVA 3OC0A 1FFEA 1ODTC 1CPYA 1S8OA 1WPXA 1VA5A 2VT6A 5CMLA 1UK7A 4G8BA 1CEXA 1H23A 4X91A 5LLSA 3G02A 1WHTA 1HQDA 1ACLA 3G0CA 3C8DA 2PM8A 2JGJA 4QDZA 1VE7A 2WU3A 4KACA 2PSHA 1EDBA 3G9ZA 3JYHA 4BVLA 1CUIA 4QE3A 3IULA 3C5VA 1BN7A 5EHXA 1Q84A 2HU7A 4RNCA 4W1SA 3WA7A 4Y2TA 1YCDA 4IH4A 1ZOIA 5AK5A 1QJ4A 5AK4A 3DL4A 4EZIA 3A2LA 4AB1A 1EXWA 2ZSIA 4HXGA 4U2DA 4UHHA 2I3DA 3HRHA 1QFMA 4W63A 3ZPXA 3FWHA 4Y2VA 4HAIA 2I03A 1XRMA 3AZOA 2ZYRA 4ZGBA 2WIGA 4H7FA 2ZJFA 2OAGA 4F5ZA 2WSLA 1Z68A 5LZ7A 1B6GA 3KXPA 3MUNA 5C8XA 1AC5A 4MXDA 2O7RA 1RYYA 1Q0ZA 2VEOA 1XROA 2QXTA 5HF5A 3AIMA 1H22A 4J0KA 5AM4A 2QMQA 2AJLI 3I1IA 2O2IA 1YR2A 1ZI9A 1QONA 1EI9A 1DX6A 1VE6A 2OAEA 2WM2A 2EDAA 1TCBA 4H35A 1ZIXA 3OM8A 1T4MA 1ORWA 2DR0A 2O2GA 1R3DA 2QVBA 1LBTA 2VT7A 2CUTA 3M81A 4EY6A 1G66A 4P92A 3NOXA 4ZV9A 4BB0A 3WK8A 4HVTA 4X90A 1H2ZA 2C5FA 1BU8A 2K2QB 2VAVA 2QRUA 3SX4A 1UFOA 5EIHA 5HF8A 1IUPA 1BEEA 1XLWA 4CCWA 4CG3A 3M3DA 3DCNA 3WKEA 1LPSA 4H7JA 2Z8XA 3ZLUA 1H2YA 3I28A 1QIIA 4INZA 1CUDA 2JEYA 1XZAA 1SCIA 3H2KA 4NZZA 1QIDA 2Z5GA 4FFVA 4NMWA 3NUZA 4FLEA 1DU4A 2OGTA 4DNFA 3L1JA 4OB6A 2XUOA 4KE6A 3LS2A 2ACKA 2VSQA 4IHAA 2UZ0A 1GT6A 5HK8A 4DMFA 4G9GA 2HA4A 1CUBA 1CUXA 1E89A 2VA9A 1AGYA 2JF0A 3G0DA 3KSRA 2H9YA 4OD0A 3WYDA 4UFPA 3BDIA 2C5GA 1UK9A 3WA6A 3QBJA 4X6YA 2WUFA 1VXOA 5HF6A 2OGZA 3D0KA 3DEAA 2HA2A 1J07A 3VKFA 3L1HA 4BATA 1CUYA 4IO0A 3DYVA 3GUUA 3N0TA 1ZI8A 5J3JA 3F97A 1I6WA 2QR5A 5ALYA 4DNOA 4QLAA 5HZGA 2QT9A 2VJAA 2XQKA 1K8QA 3GBSA 4OB8A 1E8DA 3G9XA 1IVYA 4DNPA 1CLEA 2QS9A 2ZJ7A 3M83A 4CFSA 4H7HA 5CBKA 1EX9A 1JI3A 4DSZA 4N5HX 2D0DA 3O4GA 4MWTA 4X97A 1BCSA 2GYVA 1BN6A 3VISA 1UKCA 1VZ3A 1CUFA 4AO6A 4QWWA 2XI4A 4LHEA 5JAHA 4Y2XA 2HA3A 3LCRA 4DMKA 2WIDA 3B3QA 1EDEA 5AKXA 1UOOA 3C43A 2CZQA 3WYNA 4QA9A 2JGKA 1JU4A 1QFSA 1BE0A 4WJLA 4KYVA 4UBNA 3D2BA 3FSGA 1TKRA 1YASA 4G4JA 1QIHA 5HKBA 1U8EA 1EB9A 1RP1A 3WWPA 4N8DA 2WFLB 1CQWA 1U65A 2HRQA 3WQHA 1VZ2A 3FCXA 4L3WA 3WL8A 4LYDA 1R9NA 5YASA 1P0IA 4K6GA 4UBIA 1JT2A 4FLFA 4WCVA 3HI4A 5D6OA 4D9JA 1QGED 3PF9A 3AINA 4BBZA 4J7AA 2HIHA 4J0JA 2E3JA 3PICA 1N8SA 4G8DA 5LZ4A 1XZJA 3GROA 5AKZA 3F96A 4KAFA 3O4JA 1P0QA 1Q83A 5HCUA 4OU4A 2VJBA 2WFLA 2VF2A 2GYWA 5LYYA 1XZHA 3K2IA 5DLPA 3WL6A 3PE6A 1XRPA 3C6YA 5CH8A 3SWWA 4EB0A 4RE5A 1JU3A 4EY7A 3O4IA 2DFPA 3V9AA 4UUQA 4AN0A 4UHBA 5JIBA 4HRXA 1CUZA 4BE9A 3VJMA 2DHEA 3R3UA 2QUAA 1LNSA 4UFNA 3PUIA 1WM1A 4B7ZA 5KWJA 3GFFA 1UK6A 3R0VA 4FHZA 5ALUA 3HEAA 5ALNA 5DTIA 1NU6A 4BVJA 3T52A 3QITA 3NGMA 1U4NA 1MNAA 3BE8A 3H04A 4A5SA 2VAXA 2OCIA 4PSCA 4OCZA 3DNMA 3I2FA 5AM2A 3K9BA 2HRRA 3MGAA 2W22A 3ICWA 4GW3A
chains in the Genus database with same CATH superfamily
2NZ8A 2CMGA 1Y7TA 5JBQA 1RPTA 3F4LA 3ZI4A 1JHQA 1LGYA 4W5TA 5FP0A 3T9DA 1DG3A 2KW5A 2WFAA 3IODA 4G8JA 3JALA 4LA4A 3EBOA 3T4XA 1DWOA 5HK9A 4C6HA 4EHFA 2Q9UA 2GF0A 1V5IA 4CQJA 4YAGA 3OEWA 5DM1A 3WLRA 4AG3A 4MP8A 1TCAA 5IZ4A 4RK7A 3DA8A 4NECA 1BOOA 1J4AA 1RTKA 4J0FA 5K8TA 5FLYA 2LR0A 1THGA 3I2YX 4MKFA 5LNK1 2R8XA 3SHVA 4N82A 2D1QA 5LUBA 3DVAA 4AJ4A 2CNOA 5DLYA 1WXHA 1YQQA 3G3EA 1C7FA 3GA7A 3UB2A 4GICA 5K0GA 1J8VA 1NUQA 1JB1A 5K51A 3SEAA 2JJQA 1UM8A 3W5UA 4NYMQ 3VDQA 4RWEA 2JLWA 2CSUA 3BJMA 3QSGA 4YCLA 3DR5A 1E2UA 5ITSA 2H2FA 3NHWA 3KQNA 1G6HA 4GI2A 1YKGA 4LSGA 4R1QA 2I54A 5LZ8A 2ZE5A 4RULA 5I3CA 4NZNA 5TV2A 2WMDA 4C4SA 4DJTA 2GZMA 1UJBA 3BKWA 4Q1EA 1VIDA 3W2TA 4KWCA 1NF9A 2AXPA 3SP1A 2BGWA 4UNQA 2IHKA 2BRUA 3ABRB 4BEVA 4AS1A 2FSVA 4YRNA 4BO9A 4HQLA 1BVHA 2VRWA 1SU4A 2G72A 2QMUA 2V1XA 4MB6A 1L5KA 2XUDA 2HWYA 5KYNA 4Y0AA 3ZWDA 3JWJA 5F4ZA 6AT1A 5KSWB 1EUYA 2M32A 4MOWA 3CW9A 2ERCA 2ZVDA 1BWRA 3MB5A 5E9QA 1AS0A 1B8NA 3ZXYA 3GPLA 3A6ZA 3MMXA 4WOCA 3A2MA 3ZYZA 3EDMA 1Q57A 5K0JA 2A0KA 1JF8A 3O4VA 2XVZA 5JT1A 1XNJA 3PHCA 2WVAA 2ZGVA 3KWJA 4RH1A 3RAFC 1BG6A 3NDPA 2Y1DA 3PA6A 2VTVA 4TTAA 5EVJA 1QWOA 3L0YA 3T9EA 3TW4A 3W04A 4PO3X 2AFVA 1EUQA 1HFEL 1G18A 4NMMA 4W5NA 4U00A 4CI0B 4OI4A 2BFMA 2XB6A 5AVJA 3AI7A 5A0FA 4TQUS 2R7NA 4HN9A 2XXBA 3TRIA 1XTSA 2YZGA 4R8VA 3IDQA 3RF7A 4AF8A 2GEDA 2H1RA 4I1IA 3IBFA 4LKOA 4JB0A 4JJZA 1XVLA 5HUJA 1D09A 3MB8A 3OOSA 3NKLA 2YR0A 3KNZA 4GZ5A 4J43A 4Q48A 5HZMA 3K1JA 4KQEA 4OHWA 1PUXA 3NRJA 5ALGA 1PS9A 2WU4A 3W3AA 4F56A 3FJYA 3OFVA 4OM7A 4M21A 3VSDA 1N1EA 2PU5A 3GVPA 2ZRNA 4XQ9A 1U7UA 2NV0A 4BQSA 5EMLA 5HKLA 1XVTA 1OBOA 1OV4A 3CH5A 5A7HA 5SICE 4CWAA 3NTUA 1QH0A 3LA8A 3V7UA 4I4NA 4JQYA 4CQMD 5B7NA 3MJEA 2OC9A 1W8DA 1P9NA 2QUBA 5GP1A 5DI3B 1ZR4A 4HH3C 5C4GB 3ESBA 2W2OA 3G0BA 3NIBA 3CRZA 1MA0A 5TF4A 3JRXA 2P6PA 3UAVA 1PJSA 2DHCA 2ZRKA 4R5MA 2QLJA 4AY4A 2VAWA 3FVQA 4DVJA 4LV6A 3IEMA 2Q0QA 4TMTA 4LGYA 4WKPA 1U7OA 5IKMA 1NJ8A 1B16A 1NR5A 2HT1A 2JG3A 4R8LA 1D1PA 1YKSA 3GLGE 1G2PA 3O03A 4JYBA 4R98A 1KY4A 1NVAA 1M7GA 2AMJA 1WX1A 3I42A 1HXHA 3KB8A 3NBMA 1Z6ZA 1LD3A 1QHGA 2VTEA 3GU3A 3WK6A 1XPUA 1F0KA 1YVEI 1Z2EA 3QPAA 3R8XA 4DS3A 5BNTA 4N40A 1G3QA 3L8ZA 2Q1SA 3WNQA 1W0CA 3R75A 1CLUA 3N8KA 5C81A 3EUAA 3ZK9A 2BI4A 2DWCA 1XHFA 2J3IA 2DVMA 2FEKA 3QPVA 2FSSA 1KDOA 2HHAA 4ENQA 1NWCA 2KS6A 5C7IO 2QL5A 2ZYVX 5DI3A 3UPDA 3U7HB 3SN6A 4YMSA 1WP9A 3VU9B 1M0EA 4FVTA 4P83A 5CJJA 1FFHA 1WDTA 1YB2A 3WLMA 4ZA2A 3G2LA 4NYJQ 2XE6A 2A84A 1USKA 2YN2A 3VR2D 4BMNA 2XMGA 5FX2A 3G9TA 1O6CA 5DNUA 1L5YA 4EHJA 1FDUA 4OLAA 5EP3A 3WMEA 1S6YA 3IR7A 3WLFA 3HWWA 5JCPA 2J32A 5L3SB 5HZKA 3A3OA 4OI2A 2JRLA 4DDKA 2O5EA 3HVUA 1PFUA 1UJ4A 1ZO8A 1WB5A 2FEOA 1FU7A 1SC1A 3B6ZA 4L73A 4R9VA 4QRHA 4M3NA 4BXOA 2GUWA 2O23A 3WLEA 3OOWA 1GD1O 2ZR9A 2CDAA 4FPXA 4HLNA 3ENVA 3FPLA 3OX3A 3EQ8A 3GFBA 2B8TA 2DH5A 4YMGA 1ESCA 1OX6A 3VAYA 2DXIA 1THTA 3ABOB 1XSEA 3EUWA 3IVXA 3TD6A 2NO4A 3U7FB 2Q1TA 3IAUA 1TA9A 4MSUA 5IKPA 2QP4A 1XR3A 1E92A 3VV3A 1NF2A 1TT7A 2IZOA 2IA5A 4IDAA 1C14A 4F6CA 2AX3A 4NE2A 1WNFA 4C0KA 4P54A 1B3BA 4RHEA 4NULA 4X45A 3KZOA 3O26A 4G37A 1O87A 2W71A 1WY7A 2SECE 1Y8ZA 5HJ7A 1I2BA 3VU9A 4B43A 4PTZA 2DFVA 3GGOA 1E3IA 2PX8A 3QTBA 4BFWA 3D4NA 2QAGB 1CZKA 1GUAA 5A3RA 3TTSA 5LL6P 1ISGA 3CB2A 1PNVA 4O4LB 2NU7B 4Z5XA 5B5SA 4KXNA 4E4TA 4XYMA 3FPHA 4N03A 2EKPA 4P36A 2JFYA 3VZBA 1JJFA 1NJ1A 3DKKA 2IE0A 3DBHB 1L3CA 2X7HA 3L0ZA 4JNKA 2ZWIA 4QQKA 4DGQA 2H4FA 1KEKA 1H4TA 3DMNA 2C31A 2HSDA 1FVOA 3KB2A 4HBGA 5TQ0B 3RI3A 5JZVA 3GJ4A 3VYTB 1U9JA 4QO8A 5IWAB 2CJYA 2GR9A 2FFJA 4MW2A 4ZK2A 4PHCA 2AH5A 2VOJA 2ZJAA 5EQFA 4C0BA 1MC5A 2LGJA 4W5JA 3K2BA 5FUWA 2NV6A 3WLTA 4MGEA 1KZYC 3N2EA 1JG6A 4OF4A 2G4VA 1EX1A 2HSEA 3MJVA 4DLUA 5B3LA 2QE7D 1DCTA 2ZZKA 4KX5A 1E1QA 4B7XA 3MNFA 3S81A 3C8HA 4GP6A 4AZ3B 2J4FA 3EZFA 3Q72A 4II2A 4AY6A 1XTPA 1DZIA 3K72B 4P80A 1Z83A 4R7GA 1HTTA 2NSYA 1F9EA 4DDUA 2D5LA 3OO0A 2VP2A 1Z5GA 2ORVA 5D85A 3N6RA 1N0WA 3UAGA 4CTKA 2XIQA 5HMLA 3ZIUA 1OE0A 2QAGA 1VC2A 3KJIA 3U3RA 1T2VA 3BB3A 3RABA 3CVUA 1H66A 1YZYA 2A4MA 3VR4A 2JH9A 1Z8HA 3E9DA 4O4LA 4DW8A 2CWWA 2NU7A 4RENA 2PT6A 1NVTA 4BEBA 1SY7A 4DOMA 1UXOA 1YJ5A 2E49A 3VYWA 2OPHA 2C1XA 2UUOA 3DBHA 3M5PA 4FWBA 1XLUA 4UCFA 1XMXA 1NNLA 2GAIA 1WXGA 1RWKA 1KI7A 1P2TA 2W58A 3I4LA 3RC3A 4O4IB 5E1DA 2V97A 1UFQA 3NHBA 5TQ0A 2O2HA 2L82A 2HW8A 4YRMA 3MILA 3TSZA 1G21E 2W8BB 4MYTA 3SMQA 3C97A 1T8RA 2BKXA 2JFGA 1QQTA 4CMAA 1TCCA 3D5TA 5F3RA 2VRBA 3F47A 3FY4A 4A10A 5DTMA 4EX6A 4YH1A 1ZZEA 2YWCA 1FBTA 1MV5A 1P33A 1E0JA 2XUQA 1P5JA 3ZNPA 4D4GA 1E3LA 2YW2A 1ZNYA 3T7IA 5CDGA 2AK2A 3I61A 2F55A 4AZ3A 4UATA 3P2EA 2HD4A 2J5KA 2VPYA 3WMRA 1HE3A 2IYYA 4RPCA 4GDFA 2J9YB 1P6UA 5I6DA 1P74A 1ZEMA 3M3PA 4NZ9A 2AOWA 5CG1A 3OLQA 4WJZA 1C80A 3BHJA 3EPKA 3Q11A 3LGAA 3R41A 3CRRA 3ROQA 5B64A 1JEOA 3ANMA 1K7YA 2J6IA 1XZIA 4X92A 2DWOA 1JA1A 2CLOB 2FN9A 1F1BA 1O95A 1SBNE 3SC4A 3FLAA 2ZR7A 4HEHA 4M9SA 5UKDA 1S01A 1CFJA 1CY0A 5LJIA 2GCIA 4JYZA 3TPFA 1PN3A 1DKMA 1YA4A 1JECA 1R0KA 2C8LA 3OKCA 1I8TA 4O4IA 1J5EB 2BFPA 4WZBE 4MV6A 4RZ2A 4NPAA 1TMKA 2X14A 4QDTA 4DKXA 1F8YA 3CW2A 4MW9A 3L8FA 1KEEA 1E4YA 2W8BA 4YRSA 2UUAB 2CXOA 2O5VA 2DLDA 2HF8A 2AFHB 3F9CA 4BO0A 5B12A 4BN5A 1EGAA 4PFSA 2XUZA 4GKAA 2LZ0A 1TUEA 2E5LB 5LZ5A 4M38A 3CPSA 1NTRA 1NC3A 1L1RA 2AG1A 1U7PA 2GZ3A 4OFBA 2JIRA 1Z4QA 2OV1A 3STYA 4IXWA 1UPXA 4E2WA 4AYWA 3A26A 2YY7A 2YWBA 1Y34E 2KLHA 3KZXA 3EDYA 2FRXA 1JSCA 1OBFO 1C3JA 1QV7A 2Z6VA 5TPZA 4C0JA 4QWMA 4GX0A 4LYEA 3H2JA 2O2XA 1LPOA 1WV1A 4ZOQI 4UCWA 5FUYA 3KPJA 1L5VA 1VE1A 5LQRA 1HRKA 1ZMRA 3SKVA 2R1TB 2VJKA 3V1LA 3ZXSA 4IHQA 3HFRA 3HCRA 2VT2A 3WP0A 1UPUA 2DT8A 4MKGA 1H3EA 3HP1A 3IP9A 1ESDA 2D2VA 2ZUTA 2H4XA 3P52A 2H31A 2O0LA 3QXSA 4N0EA 4UHEA 1CS4C 2PMBA 4X6LA 1E99A 1T34A 1TUIA 4J0CA 3EWNA 5EUCA 4OH7A 4D0NA 5JD4A 4KN8A 3DLBA 4KQ6A 4QUKA 3V33A 4GQAA 4LN1A 4M86A 4DJ5X 1SXGA 1PS8A 3WGGA 3T3MB 1GN9A 1H2EA 3GJQA 2EKBA 5I4BA 5J4LA 1DIHA 1XDUA 2QT0A 1VA4A 3B9RA 3FDIA 4XOIA 2AFHA 3LYAA 1PR6A 2Q3JA 3GGDA 4R51A 4LV8B 1WG8A 3UMMA 2V0GA 3L46A 1CRPA 1DXHA 2DUUA 2COKA 2CW5A 4BFXA 3TJRA 1WV0A 3NH6A 3ZDDA 3ZDQA 1YB4A 5ALOA 5IJZA 5H82A 4HDSB 4HOYA 4LJRA 5AIAA 4WY2A 1I2AA 4BMPB 1EINA 4RK1A 3T61A 5K6RA 1TEZA 1NN0A 3S5JA 4GDMA 3UWKA 3VDXA 4OQNA 3JD2A 1WMEA 3T95A 4TL6A 3W3ZB 3IGFA 3EOZA 3HEBA 4Z49A 4XUEA 3G89A 4LJ8A 4BNTA 3QWIA 1NMXA 3LNCA 1RU3A 5DNVA 2R1TA 1QYIA 2WUVA 2C2KA 1Z28A 2CDBA 3CNBA 4A0SA 4FOOA 3N5CA 2RHTA 1CJVC 2GT1A 2QU8A 4MVJM 5FPTA 1WDWB 1SOAA 2PX4A 3IUSA 1WOMA 2ONCA 4P58A 3W3AD 2GPSA 1U0RA 3NYWA 3N9IA 4GT1A 1CUWA 1SUSA 4YJHB 1XL0A 4NC9A 1BXZA 2YWXA 4NCJA 3BTSA 3GJ5A 4KQ2A 4Y7DA 2HDOA 4EFDA 3OJWA 1UT5A 3SS9X 3HJTA 1KQFA 2GN0A 3HCNA 4N8EA 4BL5A 4EO4A 4F3RA 4LRSB 5D7BA 1EVEA 1ST3A 3FNFA 4ILKA 1A8HA 1PL6A 4Z9BA 3T7SA 4IUDS 3ZI7A 1SBYA 4BUJA 1Q6YA 3NW9A 2WJYA 5ALQA 3IPRA 4RSRA 1TRKA 3KFXA 3DFZA 4KKVA 4PS0A 3GCXA 5LU8A 4D02A 1ULTA 2DRIA 5B30A 4HDSA 5CFNA 5IF3A 3T3OA 3PGVA 1XJWA 1XTQA 4ISBA 1OWNA 4NH4A 1PVOA 3B3GA 3UMVA 1EA5A 4YV2A 5AFSA 1N2CB 3G5TA 3HBNA 1JSRA 4R0NA 3WJ7A 4DLVA 3EVEA 2PCLA 1FXUA 2YYZA 3KTAB 3REQB 2J87A 1KC3A 3ZD6A 1DE0A 1GPWB 3EZ2A 3JSAA 2FA9A 4WACA 1VMEA 4H7IA 2H4ZA 2IEGA 3KDSE 1DS6A 1XEAA 4YV0A 3ZQ6A 4G36A 1N4AA 1NBAA 3ZY4A 1F2UB 3CW8X 1FLAA 3MT8A 2ALJA 4UW9A 3U1BA 1KA9H 3PQCA 5JSUA 3TCNA 4QJ4A 1N1GA 4ITVA 2VK2A 1DBWA 4PO8A 4MWSA 3BB1A 4MRPA 4WFJA 1GTMA 2ONYA 4L95C 4MTCA 2RCNA 1L7AA 5AVVA 5HFNA 4CG1A 3OLCX 4YJHA 3GVXA 1A8UA 1AGRA 2ATCA 3GMSA 1JHOA 2KJQA 4PQFA 5E3JA 2PGAA 1NF8A 1U2SA 1QAOA 3HWSA 1XL1A 1C8KA 1H6BA 3HN6A 4NCIA 1ODCA 3WXMA 3Q6MA 5B6JA 1NLFA 3QU7A 2WJPA 1A9RA 2WBLC 4H7PA 2FMXA 2QPTA 5SYMA 4I3HA 2WP0A 3IC5A 3ZW8A 2J31A 3D7NA 3LDUA 3NGXA 5CFPA 2OWEA 2DEUA 2QKYA 4OP2A 1N2CA 4ZOLB 4X94A 3QKTA 2WINI 2XNKA 1U0HC 3KTAA 3REQA 1YA6A 4L5YA 4W5HA 3RC9A 3CNEA 2HSWA 3K5IA 1YE8A 3VHRA 3A25A 2F4VB 2H8GA 2G71A 2H2AA 3WK9A 4EDHA 2WYWA 1BJTA 3UYKA 1E9RA 1F2UA 1X9HA 3P5SA 8AT1A 1SC9A 5KZMB 4PZ0A 3MMSA 3SR4A 4V2IA 6Q21A 1U1FA 1BD3A 4IDPA 3ZTTA 4XRRA 1KZHA 3GLVA 8MHTA 3IE2A 1L4BA 2XDWA 1DX4A 3DDOA 1A8IA 1XPOA 5BSVA 5COBA 3M6VA 2B30A 1OBHA 2P9GA 5JD5A 1HNNA 3R0ZA 2X19A 4URVR 1FIUA 1U7TA 3ILVA 2RKOA 4F4UA 3M4NA 2BI8A 3HMQA 4G67A 2ECFA 1AZLA 4P81A 3RV4A 1Y5IA 2E9SA 1EXVA 3DWEX 4Q1CA 1Y9ZA 1X3SA 1RQRA 1XTBA 4I9HA 1QOPB 5H02A 2R8BA 3QE4A 2IP4A 1SOUA 1JEAA 3KV1A 3RK0A 1CVLA 1HFKA 2VXBA 2CXUA 3A9WA 3I3SR 4QPDA 3DDWA 5ERXA 5IKXA 3AXTA 3LUBA 4DEYA 2BEWB 2Y1FA 5JFGA 2YUTA 3K1AB 3M8KA 6YASA 3T3DA 3RW9A 1EFPB 2Q4EA 3ZGLA 4ZOLA 2XXAB 1E5QA 2WKQA 2JW5A 2L69A 2PUVA 3E15A 2YC4C 2K7FA 1MGPA 1OQAA 1XYVA 2CFTA 4FFWA 4IJVA 5CD1A 5H9VA 1OZFA 1YRHA 1N8NA 2ZP1A 1SGWA 2IOFA 3B5JA 1Y1QA 5E1MA 4B4KA 4TX1A 1K5HA 1RPNA 2KI5A 2HCRA 1OBVA 1B26A 2FZCA 3R7BA 4LFAB 1QHYA 1VIMA 2P69A 4BLPA 2KBEA 2WP8J 3CU5A 3IALA 4ITUA 5C9ZA 4XEUA 3UJDA 5LFAA 1U4SA 2AYYA 3N8HA 4AJKA 3AR3A 4B45A 4QEDA 1NNI1 2H2HA 3HK2A 1NVBA 5ALDA 3S8MA 3HNPA 3HSKA 2VZ9A 4UPVA 4UZEA 4IFEA 3SS7X 4RDIA 3L43A 4UTNA 2Z8YA 1VMKA 3IHKA 5EJ5A 2YDXA 4OXYA 4XFDA 3MAJA 1M9NA 5PNTA 4F2PA 2B8EA 1K6IA 2R8RA 4I4IA 1OYVA 2ZUFA 5B55A 3QMVA 1JPJA 2X8WA 4ICIA 2WV9A 2O1SA 1EGQA 2Q8PA 3NOOA 4X61A 4A8HA 2IUUA 2DERA 1A72A 3JATB 3NATA 1SC4A 4FE4A 5CVDA 5IWCA 1PZMA 3DMTC 2BEWA 5TY0A 3PFIA 5EERA 3RAPR 3DTNA 4YMIA 2WC1A 3K1AA 2XXAA 1PT7A 1ZNZA 4W4TA 1EFPA 5EFOA 3R7NA 1ODKA 3W6NA 1Z08A 1I1HA 1ZXBA 3TJMA 2UTGA 1L5OA 3V6LA 1HDCA 4EHAA 4MVJH 4E32A 1PQWA 4HNSA 5TMBA 1VKHA 3FMPB 2XNCA 2YMLA 4JVMA 2YOGA 5LN1A 3L40A 3CF4G 5JAPA 1ABFA 4GOLD 3L4KA 1SUAA 3PNPA 4CDRA 2V6BA 4JT4A 1SUWA 4UHJA 4C4PA 4L57A 2REOA 3SJBA 2G36A 2P6NA 4ZK6A 1RABA 1JU9A 3AFOA 1ZESA 2I3BA 3MERA 3RREA 2R6JA 1IG0A 1V26A 3TMYA 4DUGA 1OAOA 3PUYA 3PENA 3R5XA 3AKYA 1UDCA 4Q9IA 1NY5A 1ZMXA 2HRCA 3EZ9A 4FFNA 5K3SA 3R7WB 4RK6A 1R0ZA 2ZIZA 4RYLA 1I10A 4BQQA 4TWZA 3BE5A 2FPKA 1IXZA 2ZBUA 1T15A 4W1PA 3D4IA 1T6ZA 1G42A 2QG4A 1M7HA 2ZLBA 3NBZC 4LBWA 5KQLA 1PR5A 2VNHA 2BTEA 3OIWA 3L7CA 4OL0A 4HRVA 4INAA 4EBBA 2W6MA 1A2QA 1W34A 3ZIDA 3LY8A 3EF1A 1UXJA 3RIXA 4B4VA 3FFWA 1DBQA 4I4CA 4JLAA 3W34A 3JATA 3UFBA 1ZIDA 1WB6A 4FTWA 2QI9C 3KEMA 1AO3A 1QGUB 1WDLA 3O4RA 4MPJA 3CSDA 4NHOA 4AJPA 1N8TA 1O95D 5JFOA 1EBBA 1H2XA 5G2OA 5K0NA 4YCDA 2C9DA 3TZHA 1NP3A 2IQIA 3H86A 4BVFA 1DFIA 4RVHA 4Y2HA 4QVIA 2EX1A 2V74B 4BTEA 3B7WA 1H0SA 3D2LA 3DEYX 3N3AC 4ZVLA 3VFDA 3VJKA 2ODQA 4M2LA 3RIYA 2ASEA 1NF3A 2AMVA 2CZGA 4RGQA 2H0AA 1WZNA 1E94E 2YJ3A 1J23A 1QANA 4RETA 1QIEA 4M8LA 3NXKA 1P31A 4QD3A 3ABQB 5E38A 2ETVA 2Z1DA 3V8PA 4EKYA 1IUNA 2GPTA 2AR9A 1BROA 3G9UA 3BWVA 5I5GA 3RANA 3HU5A 5IVPA 4ZO9A 1PGOA 4OGGA 3E9ZA 4REQB 2Z3WA 4XKJA 1QVAA 4Z1MA 3R7WA 3P26A 1QR6A 4MIEA 4DL9A 3FYTA 1N6NA 3OPYB 2Q9AA 3CZRA 3FROA 3WLPA 3KTOA 5TLSA 2FPIB 3ASUA 3F5FA 3ROKA 2IVFA 5LIRA 2QYSA 3DO5A 3L7OA 4ZREA 1MHTA 3NFYA 1R0BA 1NW6A 1O1YA 3IP3A 1HO3A 1NJSA 5AKLA 1Q7CA 1UJMA 2NXWA 2I5PO 1R6AA 2PMKA 2YIMA 3E9RA 4J94A 3ZCPA 4KR7A 3LIIA 4JLNA 2W90A 3DKPA 5TPZD 4BVGA 1XMVA 3HJBA 1QGUA 2OCXA 3IUNA 3LECA 4UASA 4A5OA 2XT0A 2EDCA 1SOMA 2AX4A 1H69A 3GAMA 1JHXA 3MLAA 4FZ5A 2GCGA 3D3EA 4UCXA 1EFRD 4WXYB 2PKEA 2BM1A 5BO5A 4AZVA 5LZ9A 4AQYB 5CVTA 3KDPA 1S1MA 3E3OA 2FAXA 1CHNA 4O4LF 4H27A 4A6PA 4HDRB 3PK0A 4QXPA 3KXIA 2DUWA 1QVVA 4RZXA 5HJEA 3I8OA 3L6EA 4RS3A 4WXHA 2A5YB 3CTMA 1L8QA 2NW6A 5KO2A 3BMNB 1R6TA 1KZ1A 1U28A 1KJ9A 4AD8A 1KBOA 2W2MA 4Q21A 5CB8A 5KYWB 1ZA2A 2EG9A 3D54D 4REQA 3WB0A 3K6KA 1UDXA 3CYFA 3GFRA 3GDFA 2JJ1A 4G9BA 2IYAA 3H9QA 4P5DA 1XTVA 3OPYA 2OO7A 3IDZA 3M6IA 2FPIA 1QVWA 3QJYA 1HG0A 3NP7A 3I01A 4GKKB 3IP5A 4ERNA 3UT6A 2I2FA 4PZLA 2H1HA 4NIMA 3CKYA 5JBNA 2CLDX 4MCIA 3CEHA 2FW0A 4KLZA 4EHNA 4A91A 1TEHA 3K0KA 3MLEA 3OQVA 4US0R 3SICE 3QLUC 1N2SA 4L5CA 4YDSA 2GESA 5IC5A 4F04A 3LV8A 3VZSA 2Y99A 4J0HA 1GM5A 3H87A 4HQNA 1L4MA 5M3BA 3EWAA 2I8LA 5CRIA 1FNNA 5F3DA 2O8DB 2Q8QA 2MINB 1SB9A 2ZJBA 2ZBEA 5HUHA 4Z54A 5FADA 4YT8A 3M34A 1UZAA 3ONDA 4V0ME 3TAUA 1DLIA 4F4JA 1NYQA 1P4AA 3CKKA 3FSJX 1YD7A 2DC1A 3FYUB 5F33A 1J99A 4HDRA 4XSVA 3W79A 1Q0RA 5JNLA 2XNJA 4KP7A 4QPCA 3AQIA 2D7CA 4C4TA 5AVZA 1ZJYA 1Q7TA 2CNWA 2IU6A 3GXOA 1PR4A 3BMNA 1TKAA 1Z22A 2FJPA 1KETA 5NULA 4N76A 1J1IA 2E82A 1PJLA 1U3WA 1CRQA 2BHTA 3CKMA 3DT6A 4I6EA 4PZYA 3ZV4A 5B58C 3DFMA 5KS2A 5FD8A 2PSFA 2XECA 1L8OA 1U2EA 5LDHA 5FORA 1JG1A 1EIZA 5ALTA 4EAAA 2BKEA 2P1ZA 1LS1A 2VP4A 3T7CA 1WW3A 5TDHA 3VDNB 2OKCA 1IUOA 3KPVA 3K5PA 4Y1FA 4BTLA 4IH1A 1OIWA 5EXEA 5B7PA 3CVVA 3I4CA 2YICA 1SCUB 1YA8A 1TC1A 3AKZA 1XPJA 2B5VA 4N39A 3BBPA 3KR1A 1MX5A 1HQYE 4A82A 4JYAB 1ZDMA 2GVNA 3U6KA 2CFSA 2EAUA 2G5GX 2V4UA 3CPEA 1B73A 4NV3A 2MINA 2P4SA 3AV3A 3U31A 5JRZA 5KB3A 5DTJA 2O8DA 2Q28A 1PJ8A 2R8EA 1KOLA 1QRAA 3LOPA 3DQQA 4XPIB 3RWOA 2WOOA 3S2EA 5IDYA 1QYVA 3FYUA 2WKSA 5FBKA 4CXMA 3LXRA 4CLOB 2SKEA 1GLVA 4LXIA 3I2KA 2YH2A 2G0TA 4RTLA 4PQEA 1CF4A 1Y7LA 4Q7MB 1XCJA 2H0QA 1CNFA 1UQUA 1I6KA 5GGYA 4J0QA 1E58A 1RXYA 3EK2A 4LY9A 1IOVA 5DHQA 5DV9A 4C2AA 5IUJC 3HP4A 5EFZA 3WKBA 1HETA 2JRCA 4PU0A 3WRWA 1D1TA 2WTUA 2G1JA 2WMYA 5G02A 3VR6A 1CC1S 1XG5A 5KSYA 3U44A 3DBOB 5AOAA 1ID8A 4Q02A 4JJ4A 4YGYA 5FBRB 4B75A 1SCUA 1Z2PX 3EXAA 3MUFA 1AQYA 5CDUA 1JIUA 2HL6A 1M6NA 1KFBB 4JITA 3WGHA 1C1YA 2JBWA 3K4QA 4K9NA 3V8BA 3L0CA 2PFSA 2OORA 4QELA 4CMGA 2JC3A 5KINB 2EOAA 2HN9A 1M2WA 1UJ5A 3IAHA 3D2AA 3H9UA 4HPXB 2CMKA 1SVKA 3BM5A 3DT9A 2DY0A 1VL6A 1R2QA 4UAJA 2I6QA 1Z0AA 2WE7A 1I1NA 5FRDA 4DA0A 1O0BA 2VDPB 1L7EA 4XOUA 1K6MA 4G5SA 5J4YA 2PL9A 3ZHVA 1JHPA 1CEQA 2ZRHA 4RF5A 2VJCA 4XPIA 1DAFA 1JB9A 3E2MA 3DM5A 4U7PB 2A9JA 3IMKA 1S1CA 3ZD8A 4CLOA 3D5EA 1N36B 1PK7A 2H5LA 3X2EA 1RRMA 2XHZA 1PSWA 1OB5A 1ZNWA 3H13A 3RVPA 3F7MA 2JFPA 3MD9A 1OIVA 4IIJB 2CL5A 1OH8A 2QJFA 1WUKS 1PQUA 2C5EA 1QK5A 2RGUA 3KUDA 3L1KA 4PAOA 3TOSA 5BR7A 5JCOC 3MQ2A 4GYJA 4GUAA 2QD3A 2XLCA 5DBEX 1Y81A 3BIXA 4MHSA 2X86A 3W78A 4FK8A 3BRQA 3PCTA 1E6EA 2VDRB 5E0OA 4CM9A 4B74A 3AVVA 3N2KB 1J2UA 1LLDA 5FCDA 4FYHA 2YJ5A 4DMLA 4ENSA 2PJRA 1M83A 1MAAA 1ZIPA 5U4XA 3UMFA 2JAOA 5AJYA 5DZSA 3HVJA 5TQ2B 4NJMB 4I4TF 5GZ3A 4GECA 3AFGA 2PVPA 4EJ2A 3MAAC 4ZZ0A 2HGSA 2LCFA 2QMZA 4LRXA 1RXVA 3WKAA 3QYJA 3UXHA 1GGJA 4TTQA 3RRXA 1T6XA 2ATEA 2JFWA 3M5WA 4YNBA 4YYEA 421PA 1V3QE 3QF4A 4XWOA 2Q62A 2EATA 3UHFA 2B8WA 3FPAA 4UTOA 2F64A 3QSYA 3NDJA 1V1MB 4F9EA 1GGFA 3KD2A 2P6OA 4MZXA 1J9GA 1IHDA 3OLXA 4G41A 4IIJA 4YCAA 2I3GA 3ZOKA 5JDCA 5IEJA 2FU5C 4MVJP 4BKOA 2QM0A 2GN6A 2PZFA 1AXEA 5BMOA 4YCNA 1AUOA 2XGSA 5TX7A 1UJCA 4K05A 3TNJA 3KLBA 1BMQA 3D81A 4HG2A 2PR2A 4RXTA 3VHXB 4S1OA 3U4IA 3AEUB 2Z1MA 1J90A 2QSUA 3O92A 4Z7JA 4GLJA 3UWPA 2FG6C 3KAQA 1DCFA 3N2KA 2H29A 1VMIA 1Z07A 3AM3A 1JHUA 4XTCS 2ZM6B 1TVMA 4AQDA 5C46F 2W2PA 3AX6A 1LX7A 1KIAA 1E4VA 5TQ2A 1Z0DA 2NAPA 2QX7A 2I6XA 3ROXA 4E08A 4NJMA 3I2IA 4ID9A 3UH1A 1FFXB 3KVYA 4HFNA 5HHTA 1XA3A 3GVHA 2H7YA 3FUCA 4FONA 3J7AC 4RF2A 2I34A 4OJTA 3HUFA 4QZVA 2AD1A 3QVTA 4O59O 1SBQA 1YMVA 3D2CA 4L75A 4UBLA 5DCLA 2Z98A 2JGLA 1X70A 3JQFC 4DUGD 1MW8X 2Q3FA 3OCJA 2JA2A 1XVAA 2FMIA 2ZSBA 3OE1A 4HAOA 4NR0A 1HZZA 4D0SA 2FHSA 4LAFA 3STVA 1V1MA 3C24A 1A69A 4GR9A 4CBVA 3UPUA 2R9VA 1EIWA 4WLVA 1C81A 3KBOA 1ULAA 5AOBA 5JALA 4AO7A 2Z30A 2RH8A 4MQUA 2ZUEA 1DUSA 1Z4OA 3FD8A 1XELA 1NYLA 2H48A 4MP6A 2IPNA 2JLQA 3MT0A 4ZVMA 1E3QA 2F00A 2X1MA 2FDXA 3JZIA 2IYFA 5FUXA 3CR8A 1GTL1 2WIJA 2AZMA 3WRYA 4L22A 3VHXA 1KYQA 1MJNA 2FSFA 2PRIA 3AEUA 1UWCA 3I04M 4A2WA 1TB4A 1JLRA 1JJIA 4F11A 4NS4A 4DSAA 3J81k 2C5HA 1WPGA 1A5ZA 1TTPB 4O1IA 2QQ5A 3G2QA 3OE5A 4LF4B 2HU5A 3FM9A 4J29A 4BP3A 1EU1A 2MSEB 4N9WA 1SKAA 2ILTA 3HR7A 1V25A 2PN1A 1BCRB 1FFXA 4Y9UA 2FRDA 2NTJA 2CLFB 3C45A 1ETHA 4BLSA 3I39X 3T4EA 4X64B 1FSPA 1DIRA 1I32A 1Y6JA 4FHFA 1UIMA 4L9RA 1D5CA 3DOCA 3ZDZB 1JW9B 4E94A 3E9CA 2RGNC 4LYJA 4Z1MD 3EOAI 3LBYA 3VZPA 3B8HA 4WESB 2J3EA 2XTJA 4RVDA 3U3DA 2JLYA 1JAZA 4PF1A 4HDOB 4CT0A 4D80A 4G65A 5L3RA 1L9KA 1OHHA 2GD2A 5AHKA 2WV7A 3RHTA 3FJ1A 1CNMA 3NX4A 1M3SA 4JK3A 3P2MA 1S7GA 3TB4A 2PXCA 4J1TA 1XCOA 1HYGA 5JQGA 3MELA 5KTRA 5AKYA 1E3TA 1EP2B 1G2QA 1WW2A 2I4IA 2YV4A 4P3YA 3VO1A 3MCWA 5MF6A 1WZUA 3R40A 1M72A 3FMOB 2ZUBA 3PEYA 1KP9A 3HXKA 1LRLA 1EWTA 1SCJA 3PHHA 2OQVA 2RBKA 1K3FA 4D92A 1JKIA 1RWNA 2IUSA 2RHDA 4HGYA 5EE0A 2ODWA 2BJHA 1BW9B 4P33A 3MXOA 1CZHA 1LJUA 5DGHA 4ZVVA 3VPHA 4YMWA 1BCRA 3LI2A 3VXKA 3ZY3A 2CV1A 3TK1A 4IR7A 2CEAA 1U7XA 3EXG1 4CL8A 4BO7A 3DB1A 3LPMA 3D7RA 4RGVA 4NCBA 2V55B 1IM8A 2BZ1A 1ZW6A 1XTIA 3I5YA 3RBZA 2A9QA 3NC0C 4QU8A 1JYEA 1DRKA 4B9AA 4QGGA 1NI5A 4LXGA 2VJDA 4PEVA 2Q3DA 4RY9A 3T0FA 5IZCC 2EW1A 2Y8EA 2BOVA 1E1RA 1WTAA 3MSCA 4WESA 3S3TA 4Y2GA 4RFVA 1N5MA 4QYMA 1UXKA 4M0CA 2E1RA 4EUNA 4P4GA 5H7XA 1FQJA 1ZW1A 2EP7A 4UHFA 3H4VA 3CNNA 5IM4F 3PD1A 2LUOA 4HRYA 2P78A 3RASA 4ALJA 3EZ7A 5I7EA 3LGXA 1YCFA 1MT3A 2GAAA 2PD4A 3D8RA 3L8YA 3TE7A 5K0BA 5KDDA 1W7AA 2BEVB 3BWEA 4OH1A 4NU6A 5KYXB 1RJGA 3OSUA 1SCKA 2YZKA 3C5HA 2EFDB 4MV5A 3ROGA 2X1VA 1CR4A 4B34A 5J4KA 1IK4A 5I8PA 1G6OA 3GEPA 3AB3A 2I3ZA 4P7FA 5DHAA 3OM9A 3QV2A 1JRLA 5BYBA 3SBDA 3FX2A 2PMFA 3OTGA 2ID8A 2JJMA 4J2HA 5DJ5A 2WJZB 1G4UR 2FSHA 1BW9A 1IBSA 1MU0A 5CIWA 5EP4A 2WD8A 3RU9A 4BC0A 4F1KA 3JWEA 3GN1A 2PA0A 1M1YE 1UEXC 2JKZA 1W48A 2H54A 2Q5LA 2QUJA 3ZXUB 2CNWD 5EE9A 2B5OA 2Z4RA 4GI1A 4HEQA 4JOSA 3ZU2A 4DN6A 4DLZA 2RK3A 1CW2B 3EF0A 3H0EA 4Y6SA 1FPQA 2H59A 5BY2A 1JAYA 2ANBA 1IEXA 4KQ9A 2HY7A 1G8KA 1M2GA 3KQWA 5AM0A 4M9ZA 1TA0A 2BKAA 3EMDA 4F3YA 3SJAA 3OO1A 4ID3A 4QAJA 4NKRA 2FW8A 4O8ZA 5A04A 2QPAA 4KO2S 1AKMA 1WUYA 4EHDA 5EJMA 1WVIA 2CCKA 1NWHA 3EGWA 4X95A 1APBA 4HDQB 5IULC 4C7OB 4V0SA 4OQFA 2GF2A 2BEVA 5KYXA 2IH2A 2FWPA 4CM3A 1Q74A 4XASA 3RODA 4YN3A 4DLKA 2P6UA 2PKQO 2I9KA 4RPGA 5CM8B 3A9SA 4D9HA 1S4MA 3HADA 4G5RA 2FRVA 3GDOA 3EARA 4OQ4A 3I58A 4E22A 3UMRA 1QDLB 4TVOA 3QJGA 3ZHYA 1K2VN 1UP6A 1QRSA 3NHZA 4JYMA 1FP6A 1Z33A 5GONB 4A26A 5C51B 2B35A 1ST2A 5TGTA 4QDXA 3DZJA 5JCXA 1P3Y1 2DG2A 3WRVA 1WULS 5IVHA 4WMLA 1QHSA 1KAHA 2IXFA 2KE5A 1ILWA 1AD2A 4GG1A 3IIEA 4EJ6A 1YR1A 1SVOA 4Z4IA 2W83A 3LM8A 5AO9A 4D9EA 1JZSA 2AR7A 3PTLA 1ZRNA 4X71A 5MN4A 1XRRA 1AKRA 4MYHA 1KO8A 2Y0BA 3VR6D 1EK6A 1SIWA 2WSSA 4NYIQ 4WZZA 3O3MB 1PLJA 4L72A 4MINA 3GYBA 5KKCA 4PZCA 1ZZGA 1V16B 3PQ3A 3QA9A 4R2KA 5D5HA 3EPPA 3RRFA 3ZHQA 4MDFA 4R8MA 1FFBA 1MXHA 3BULA 1J56A 3BDVA 5EEGA 3B2QA 3UVEA 1FUEA 4Q05A 1L4YA 4JI1B 4BO3A 2WG1A 4NOMA 4C7OA 3NWJA 4BGDA 1JSLA 2NUTB 2HTFA 3DC7A 2XVAA 5H68A 2ZRMA 1A27A 1VSUA 4KBGA 1ONOA 3R76A 4O2LA 3LQQA 4FFDA 2H7CA 3PC8C 1T5OA 4FYYA 4JGIA 4XXHA 1BU5A 1Z8DA 4KRGA 5D3MB 3F2VA 3AP1A 2CNNA 2EP8A 1E0AA 2LCQA 1MFZA 4N0QA 5GONA 3KLOA 1L8LA 1L5MA 5GOZA 1ND6A 4EAQA 1F3OA 2Y1KA 4JBLA 1NVFA 3Q7IA 5MFZA 4L4UA 1YZVA 3W5BA 1LVHA 3GRYA 5CP8A 4C30A 3DAFA 4NU5A 5A4JA 4YDHB 1USUA 2FEMA 2OXEA 3N8IA 1W5EA 5B53A 1UM9B 5EHQA 3X1KA 1LW7A 1E4EB 1AZSC 2LNDA 4B4WA 4H4DA 1SK8A 2XQGA 4NF2A 2XRZA 5EXDA 4B6PA 4GHWA 5FPHA 3DBVO 1YAJA 5HQTA 1SRRA 1G55A 5LDGA 1LVGA 5KVVA 1FYEA 5DULA 3P2JA 1V16A 5BWCA 2XOEA 3W1EA 1TU0A 4WK4B 4ZYUA 4CM9D 4EFNA 2FSPA 5IAOA 1L6IA 3RQSA 1GCOA 1U02A 4WA8A 5H83A 1EK5A 3D3KA 3TB6A 3ZQJA 4FQ5A 3TG2A 2OENG 2NUTA 1OILA 5BORA 4JBXA 3C3PA 3SQMA 1GEEA 2O3RA 5D00A 1JWLA 2JFZA 3VSAA 3KELA 4KC0A 1HYBA 4WKBA 2QV7A 4DA7A 4NCHA 4Q3DA 2H4JA 1G2OA 4NE9A 4AP5A 2ACEA 3EEYA 3TDNA 3PLRA 1LI7A 5M2QA 1GA4A 5D3MA 1U28C 5IU6A 1K6XA 2QAIA 3DOOA 3TKYA 5CA0B 3LO5A 3OFKA 5ALJA 3UAOA 3AFMA 4ND2A 2G04A 3KTDA 5FYQA 4AY3A 3AI2A 3AMVA 4GSKA 3EVAA 2OHVA 3OZCA 2PKYX 2E5WA 5CLLA 1SD1A 1I30A 1BGXT 2JA1A 4LI0A 1JHVA 1KDYA 1TKBA 2FVYA 4NNPA 1ZVQA 1I4TD 5KOIA 3QUQA 1ODJA 1UM9A 1E4EA 2OTCA 1K98A 3I52A 4BMYA 1BQ3A 1UBMS 3LLVA 3FCOA 1JYFA 3BF8A 3PYMA 3PKJA 1XN1A 5PGMA 1WEHA 3OQPA 3GUVA 3PXCX 4N3AA 4U7GA 1L7OA 4PYJA 5LP6C 2ZQ5A 3G8BA 4RQBA 5A2QA 1VMDA 2Q3CA 1KEZA 1AOXA 3NIDB 4IGKA 4JXKA 2Y2UA 3SQWA 1YTUA 1Y48E 3I09A 5C80A 5FLEX 1Q7GA 3K96A 3BGVA 3KHTA 4OFWA 2JB9A 4BDTA 1UC5B 2V7VA 1M1XB 5JAQA 1C4XA 1EWKA 3RRMA 3WGVA 2IL1A 2X2EA 1USVA 4WTOA 5TF0A 1T26A 3KQVA 4CUZA 4W9RA 1NSTA 1CP3A 2IOFK 3B7GA 2Q49A 3ZZ1A 4AULA 5KWSA 1R5NA 3VGJA 2F17A 3LL7A 4BKUA 3CE9A 2ISCA 1M2KA 2HRZA 1F14A 5BW6B 1P1IA 2AN9A 5CHYA 4C03A 4OQZA 4KOEC 4DLNA 4GGPA 5EQDA 4WV3A 2FOLA 5CA0A 4QICA 1PBNA 3VVLA 3A10A 3RS2A 1M2HA 2FFHA 4J9VA 1SK9A 1E3MA 4DY6A 3OUZA 5KOHB 5AI9A 4ENUA 2QPOA 2MWMA 2WZBA 4OHXA 2O6HA 3RUAA 3L05A 1F20A 2AKAB 1VG8A 4WNIA 5JVDB 2PY6A 1P9RA 4BZWA 3IKTA 2YINC 2R8PA 4LDAA 1XWWA 2CL7X 1G3IA 4MPTA 4PIMA 5EHGA 3U49A 4HWPA 3ZCUA 1P2VA 4OB7A 3ONNA 2WJ6A 3LA6A 4YRIA 4QQRA 5DNWA 3VX4A 1E9VA 2IITA 3PXBA 2XB9A 5ILQA 3SK0A 1XT6A 4S35A 4QJ3A 2Q6KA 4YWHA 4I14A 2I78A 4LK2A 1FYFA 5ARCA 3FSEA 1U2GA 3ULKA 3OAAA 1GARA 1L7XA 1R0WA 2AV6A 3WR5A 4C2UA 1TLTA 3IYLW 4O1HA 3ETDA 1LB1B 3C3KA 3W6OA 1Q1BA 3W5CA 3UQZA 1ECPA 3CG4A 2VSOA 4O33A 1N25A 4HWRA 4H9GA 3ZQ4A 4CPDA 3QBVA 4WINA 2B82A 5A5FA 3EY4A 4OBXA 4QJBA 1SUBA 2NXCA 4XLTA 2HR1A 4TZTA 4D4JA 1GPYA 4YXWA 4JJ6A 4Q7LA 4X7MA 1UOPA 3RKSA 3TI9A 1QOZA 2DBVO 3DCJA 1W76A 4NL4H 1ACMA 1EK2A 3GLKA 4HD8A 1BC5A 4K6MA 3RFXA 1IYZA 3V00A 1Q1AA 3R23A 1WD7A 4G5XA 5KOHA 4RS4A 5BNIA 2GMWA 1ZX1A 2RKBA 1BHSA 3DW1X 2P3SA 4FLMA 4GBMA 3SQLA 2BVNA 1VG0B 2P40A 3V8MA 5BN3A 4V1CI 3JVIA 1GDDA 2BN4A 4Q18A 3L4BA 3K31A 5JVDA 3UN1A 3EXEB 1OHHD 2HJ9A 1N5LA 2CHVA 2P11A 2IZ7A 2W6OA 2ZPTX 4JLOA 4MROA 5CT4A 1PR0A 4QPJC 3BCHA 4LZOA 3IBTA 4EYEA 2IPAB 4AURA 4L02A 1GAEO 1F3LA 1B8VA 3BK2A 3QX7A 5LR6A 4GPAA 2ON6A 4XDGA 2Z2KA 1LFAA 5BQPA 3S40A 1Z6PA 4DRXB 3PFGA 1ZISA 4EENA 5L3ZA 3KVVA 3IT2A 4MQFB 3UUWA 3EFOB 2I6GA 5DNEA 3SSOA 3SZOA 4KREA 3BEDA 1R74A 3BWDD 1XKTA 3F46A 1DAGA 1EGHA 1KARA 2CNBA 3ZTWA 4DV3B 3LC0A 4L0QA 5CLFA 3UMBA 1BVUA 2JGNA 1UFVA 2B8NA 4K1LA 2GD1O 2M6RA 3QU5A 4AKSA 4WNYA 5I7UA 5T8KA 1CDDA 3GT0A 2XR1A 3L6DA 4KGXA 3OUUA 4OOEA 2DMRA 2WD9A 4PW0A 1VLMA 5FFNA 5G1PA 3ZY5A 2EERA 4BLRA 1A7UA 1JJBA 4DMRA 3GA0A 1W4AA 1SCQA 2J5RA 3C5WP 2QL7A 1NNUA 3F6CA 4AJ1A 4YP9A 1YDEA 1CR6A 1LDMA 5KVSA 2ODPA 5EJ4A 1W2GA 4P7JA 1E1RD 2H5IA 3K0HA 4B3XA 1E2EA 4ZYTA 2IHJA 4DILA 1RHKA 2BL4A 3EXEA 2VP3A 4KMMA 4HH4A 1VHQA 5EMJA 5GVRA 4DCVA 3VYRB 5AVXA 3I2GA 2BMJA 4EI2A 3NV9A 2BUCA 4S1WA 3RU7A 2OD2A 1A7KA 2A0YA 4G81A 2XBUA 3GMDA 2ECKA 3ETHA 1MIOB 1OCEA 3NM4A 4QASA 5EJEA 2P4QA 1Q19A 4UNRA 5HM6A 2R1ZA 3EEOA 2ORED 1N33B 3OCXA 1RZRD 1T5TA 2F48A 5BQXA 1I2MA 3AVYA 4E3ZA 4COKA 4M8SA 5GMOA 2D3TA 2J6CA 4MQFA 3KVOA 3TECE 1CR1A 2I99A 1FU8A 3HB7A 1SQ5A 4ZQGA 4ARBA 4F06A 1RJFA 4EI7A 1PJRA 3I6IA 1W5SA 1YJAA 1XZQA 4FCWA 1E3JA 4JMLA 4Q3BA 5AW4A 1NIPA 2MSNA 3W8DA 1TXGA 1CUCA 4TYYA 1Z5NA 3U7RA 5BVGB 3QYAA 4PE5B 5DIZA 2DFLA 4JA0A 5AKIA 9ATCA 2FQXA 3DP7A 3U13A 3GFTA 2PPLA 4KPEC 2JD2A 4MYUA 4TQAA 2AYZA 2GO1A 1Z4KA 3EBPA 2EYUA 3HB4X 4ALIA 1WMFA 4Q4LA 2G9NA 1K4YA 1M8JA 1POXA 3WL5A 3HJFA 4D3DA 2R11A 1YDGA 5EJIA 1RZUA 4MRNA 3OU2A 5HCNA 4ZP1A 3C3AA 3OZWA 2F1RA 2G8LA 2O1EA 1OU4A 2H2IA 2H1LA 5CDYA 5CEJA 3TRDA 1N5RA 4G01B 4EUSA 2XYQA 2VUUA 2V6MA 4JJFA 1D4ZA 3AIKA 4YT5A 5FWAA 4KXVA 1N5DA 2R2GA 4MLPA 4MI1A 2NSJA 4U2KA 1LLUA 4YLGA 2Z2ZA 4K8OA 2NZVG 2JKVA 2P6MA 4HK4A 4R3NA 1MIOA 3CUWA 3EHDA 3IQHX 2ZSKA 4RZSA 2X77A 5DHRA 4ZVNA 3OTQA 5IJWA 3BSSA 3NHPA 3Q87B 3O75A 1CULC 2MYUA 1JDBC 1ZPDA 2BHSA 5FBQB 4YP1A 3A1TA 4QDUA 3VO8A 3ZBTA 4DDWA 3DMDA 2VK4A 1Q1ZA 4R5HA 3ORQA 4EFKA 2GZ1A 3FOCA 1GQ2A 1WPXA 4AKTA 1CPYA 2WA1A 2VT6A 4G8BA 3M4YA 1HDXA 1CETA 5BVGA 4CMKA 4V3CA 3A9CA 3F5DA 4M9RA 1C9KA 1WETA 2QJTA 5KYYB 1B0AA 2QZ4A 4UUNA 1MDFA 1HQDA 4LOJA 2QGZA 1LF5A 1CS0B 2ZDHA 5CM2Z 5HOEA 2GCOB 1F2DA 1OA1A 5C0OE 1QK4A 1VE7A 5MN5A 1U2DC 2DJ5A 3WRYC 2YVAA 1NFRA 2WSSD 1PFKA 3QVKA 2WR8A 3DDCA 3OEEA 4HWSA 5DGIA 1FQOA 3U5ZB 2Q4TA 1NR7A 3ZBUA 1DNPA 4AY2A 4F3TA 3QW2A 4RDCA 5FI3A 2VJQA 2IEYA 4V3BA 1QCZA 4LZJA 3KQYA 1FRFS 1AXGA 4QE3A 3RSZA 5A3SA 2HSJA 3QHQA 1BN7A 3KOZA 4QPPA 3GG9A 1G3MA 2P5SA 3A1SA 4IMJB 4JP1A 2C2GA 4QXAA 1XMSA 5IS2A 4GXRA 4XGRA 4LCJA 5ICMA 1E3SA 5T6MA 4S12A 2MYPA 4W1SA 3T7JA 4DIKA 3N2NA 5EMMA 1A3CA 1L4HA 4TYWA 1IM5A 3WAJA 5AK5A 4IH4A 4Z0NA 4HXYA 2TECE 2HWKA 2ECQA 2RGBA 3CMCO 3UEOA 2FMHA 1X77A 3ZDEA 3A2LA 5GGXA 1EXWA 3USCS 4ZAWA 3DNPA 3OIFA 4EECA 4A6EA 3ANYB 5WRFA 2CXRA 5KYYA 2WT8A 3TMKA 4IV5A 1OAAA 2VJNA 4MQ4A 3E4CA 3SBXA 1CS0A 4L6CA 4R1OA 2GN9A 3KZ1E 3SY8A 2GCOA 3IMGA 2OZPA 3LDFA 4L07A 3ILYA 3ZJYA 1PWZA 1P9OA 2I22A 2HLNA 2I03A 4HAIA 5DGTA 1HYEA 4TXMA 2SKDA 1NURA 2VKTA 2FZLA 2NVUB 3DTTA 5I48A 5EUQB 4FYPA 1EUDB 3PQ2A 3R7LA 3TSCA 4FGLA 3E9YA 5GINE 4I1RA 4LVNA 4MUKA 2OAGA 1VSTA 4F5ZA 5JSFA 3O8DA 3AY0A 5LD2B 4MDHA 1E96A 5LZ7A 5LQAA 1WCV1 1POWA 5JY6A 4IOJA 3V2IA 4BJ1A 2LDXA 2PKCA 2O7RA 3MMPA 1T9BA 1GFIA 3IUEA 1RYYA 4RD2A 3RSCA 4WPGA 3D4BA 1UP7A 5BNZA 2NIPA 5JJ5A 2QXTA 4NNOA 2PT7A 4M6WB 1UBLS 4J1SA 1C3LA 3QFHA 1DC6A 1ENYA 2B4AA 4IIFA 5AM4A 1P1RA 3UKDA 3HRIA 4D8VA 5BYJA 3LT0A 1PWXA 3EA5A 1Z5ZA 4QFDA 4ZT2A 4ZI7F 2O2IA 3NU1A 3EXFB 3P27A 5CBPB 5GJBA 1E1DA 3QOXA 2CLCX 1Y5NA 2OD7A 4IQFA 4YEDA 2WM2A 2DLNA 4KYIB 3PFHA 2EDAA 4HNVA 2CT8A 2J67A 3ZU3A 1ZIXA 2H51A 2GF9A 4H3KB 4HAXA 4DVGA 2IEDA 1DBIA 1U2TA 5F5LA 1D0IA 5LU9A 1ORWA 3P0HA 2YUIA 1RJ9B 2ZJ2A 1QDEA 4NATA 3GXBA 3P0RA 1BKDR 2NVUA 3T6KA 4HEA1 4DJAA 3TL2A 1EUDA 4DR1B 2AFHE 5E95A 3EOBI 1HE2A 4IQ8A 1MC4A 2JLRA 2DFTA 4RJ2A 2NO0A 5FOSA 1Y3CE 2P79A 2CUTA 4FMDB 5T64A 2IPOA 1VL0A 2DFKB 3EPJA 3U4QB 2XB8A 1OX4B 4PBRA 5DKFA 3GBVA 1LJ8A 5EY5B 4HQRA 5EJ9A 5CEFA 1TADA 4FYMA 2IY9A 2L2QA 3KU4A 1DJLA 2E4UA 4P92A 3PXXA 2GCPA 2VAPA 4E1BA 2Q50A 2QX8A 4L8GA 5GJCA 3A3YA 2J7PA 4GYYA 2GZHA 4M6WA 3OPVA 3U4CA 2CE7A 4LG1A 5BMVB 2AHRA 2XVYA 4XM2A 2K2QB 1H2FA 1QO0A 1U8UA 3IDFA 4NH0A 1A5SB 3FOAA 2ZJ3A 1WABA 4NNJA 2CXNA 1NQXA 2IYRA 4QNMA 4RY8A 4BX8A 1IUPA 5KNDH 4BNKA 3EXFA 1XLWA 4CG3A 4LRYA 5CBPA 3BORA 1ATZA 2WDZA 3FI0A 5GONF 1OB2A 4TTIA 4WCFB 3B6IA 3VU8A 1PO7A 3A36A 2CFRA 3GEDA 4RGBA 4DSOA 1LPSA 1Z7GA 2CD7A 2Z9CA 1LC3A 1GRNA 4K28A 3RHZA 4JVNA 4ZCSA 1CKEA 3UJNA 1X1DA 1RJ9A 4H7JA 4MW6A 1UP4A 3VR5A 2H07A 4MRRA 3D0QA 4QBKA 5I8ZA 5BT9A 4OJNA 2OBLA 3HNRA 2VDOB 2PCJA 3QLJA 2DY1A 3DC2A 3OAAD 4G1CA 2NU9B 2K4MA 1TCUA 4UAGA 5GV8A 4DG9A 2GN1A 3FRJA 1X3LA 3MBKA 1PTJC 5D1HA 5E1OA 3SLKA 2WPNA 1QIDA 2JIQA 3U81A 3UTDA 4AJOA 4EJ0A 1YHNA 3NUZA 4HV4A 1OX4A 2L0XA 3U4QA 4OAQA 3O7MA 5ARDA 1QP4A 3Q8LA 1SXPA 1H5NA 2WKPA 3TIXB 3T4PA 4DDHA 2I33A 1I1OA 3SC3A 4KITB 2AOUB 4HLCA 4YXWD 5JISA 3WQSB 3QENA 4OB6A 4TWRA 5EOVA 3TYXA 2Q6LA 4KTTE 3OM0A 2G88A 4L8FA 2W70A 2IYSA 5BMVA 2ZUUA 2ACKA 2CV0A 5EL0A 2UZ0A 4R2IA 1U0SY 1VLZA 3TKAA 1CEYA 2VXCA 1JQLB 5HK8A 1VL2A 4D9FA 4G9GA 1DAKA 2DBZA 1QTNA 2G1KA 2HA4A 2KX7A 2VYCA 4YXFA 3ZVNA 3PRJA 1PL0A 3U4HA 3AC0A 3I64A 3L7NA 1XRJA 1Z82A 1D8TA 2BFAA 1LY1A 4WCFA 2SNIE 1ZC4A 2UZAA 2Z2YA 5KYWA 3IT3A 5DU2A 2BMFA 1R0YA 2VO1A 13PKA 3FMFA 1E60A 2A1UB 2IPMA 4L6IA 1XN4A 2CYBA 3WYDA 1B1CA 3L1VA 1S89A 2Q27A 2ZIXB 1N3LA 1FP7A 1HI9A 2W93A 3A4TA 4PGHA 1UK9A 1DC4A 3R5JA 3B9PA 1QCYA 2NU9A 4LXUA 3QBJA 3J81A 4TYNA 4X62B 4MH0R 1YL5A 2LCIA 3LWDA 4ZZ3A 5HBGA 4F9FA 1YONA 1MR3F 3SJUA 2P2GA 2F7SA 4RV9A 1Z0JA 1Y5LA 2BGMA 2Q3HA 3DT8A 3Q6IA 4RTRA 2AOUA 3OCZA 3TL6A 1N2CE 3HYCA 4A6XA 1CZUA 1Q77A 2IZ6A 4LZWA 1U1EA 2COUA 2HA2A 1O58A 3PKZA 3MQ4A 4WK0B 3K0CA 4ZGWA 3L7DA 3A6FA 1CUYA 4A03A 2BONA 1UC8A 4HB0A 3KSZO 4ML3A 4IEFB 4PFJA 4AW9A 1BCSB 5KU7A 2I67A 1GGNA 3DYVA 2A86A 1JMVA 1UL1X 3Q15C 2FY8A 4QBFA 5CA0F 5CFMA 3KYDB 3MCZA 2WWYA 1Z8FA 3PT5A 4XDZA 3F97A 1S5PA 1I6WA 3R0QA 4KXMA 4F0JA 3QIVA 3QGMA 3KT3A 1TYCA 4PNEA 2GFQA 2HGZA 1AK9A 1CY7A 1ZINA 4TS1A 2AWOA 2A1UA 2APJA 2FPUA 3OX4A 3GRUA 2IX3A 2WJHA 2QT9A 1RRGA 2ZIXA 1GCIA 3TOXA 2XQKA 4OQXA 2QGFA 4F8EA 2I2AA 1CZRA 4ZPXA 2R751 2QTNA 2W2QA 1XX6A 3GJZA 4ZCPA 4OXNA 4PPQA 4WBNA 5CVCA 1AKUA 1E8DA 2ATXA 3PTZA 4GM4A 4R1MA 2QEQA 2F8LA 1VLHA 1E2BA 1CLEA 2HJHA 1ZH0A 2PJUA 2ZJ7A 4V0RA 1JQJC 1XP5A 2JAQA 3HRKA 4MUBA 1IJEA 3AF0A 4IIYA 2ZXFA 1WLYA 2XF8A 2BSXA 3CUTA 5DXJA 3TN7A 5CBKA 1K97A 3RKUA 3MJ4A 2BTQB 2PLRA 4ND7A 4P5EA 1T2CA 1KQNA 5ICGA 5KNBH 1O0CA 1D7OA 5CUQA 3OECA 2BEKA 5EPOA 3ER9A 2PL1A 3E05A 1GAXA 2B21A 3O4GA 1BCSA 4L4ZA 2O48X 4NOKA 1UUFA 2X9GA 3ZD9A 4YP7A 3I5AA 4IPTA 1UKCA 3AG6A 3TO5A 4RW0A 1NM5A 4YPOA 5FAKA 4GP7A 4QWWA 3ZVLA 4QUHA 3KYDA 1G5TA 5EPUA 5GY7A 5JAHA 1N2OA 2HBQA 1QTQA 4BEWA 2JHFA 1O5OA 4GMGA 3TPCA 4UTVA 3T9FA 4ZYXA 2BV3A 1Q1EA 1R00A 2FQQA 3BC1A 1L5LA 4FZJA 3CRW1 1XTUA 4BJ3A 4RMNA 4PS1A 1BA2A 3B3QA 3CZPA 3F3YA 3L07A 1WDMA 4S1VA 5AKXA 2BR5A 1K9SA 1QQAA 1Y9JA 2P0YA 1CRWG 5FWNA 2XZOA 4C22A 3GQBB 1T9DA 4H59A 4QA9A 1NXSA 1JQ3A 2H6EA 3KXKA 2P8JA 3ZKWB 4B8YA 2CVQA 4ZEWA 5MDHA 4UDOA 4OMDA 4FFRA 2DPGA 1T8UA 1PG5A 1GKUB 5EYPB 1QOQB 4YUWA 1R37A 2IBTA 4UBNA 1YFLA 4HLUC 1IBRA 2FPPB 3FSGA 4L27A 5FOXA 1YASA 4G4JA 2FLVA 1B74A 2BTQA 2A33A 1RQGA 1TO6A 2XITA 4B3CA 1AMOA 3KU1A 3PJGA 4BFTA 3ERCA 4JU8A 1ORIA 2JHCA 3RYCB 3HLTA 5L8VA 2PVCA 4O8CA 4Q93A 3B1VA 3HKBB 4N8DA 1DJQA 3BICA 1P73A 1YO6A 2LDBA 2RK6A 3OEED 1U65A 4KXUA 2QN9A 4L08A 1XC7A 5DXFA 3I6BA 3FCXA 4P0TA 4UNPA 1U2GC 4R41A 4KFTA 3MTDA 1GL7A 1P9WA 3AUJB 1PQYA 5C32A 3K0FB 1P0IA 4K6GA 4BQEA 4GR4A 4QODA 4D96A 1NC1A 1VE3A 3COJA 4YUVA 4DBVO 1J8QA 3SGLA 3TQOA 1JJVA 4ZMSA 4FLFA 2PT9A 2P5YA 2ZIWB 5HIIA 4MV3A 1KTVA 3GQBA 4YJFB 2E4ZA 1QGED 3PF9A 1QMGA 3ZKWA 5JBIA 9LDBA 2WK1A 4PC2A 1R5JA 3ANXA 4BBZA 4CM5A 3AONB 3C3XA 2RAVA 3DEFA 1ABBA 1RDFA 4KV7A 1YBFA 1XRSB 5EYPA 5U4QA 3OCYA 1C4OA 1BDHA 2MT9A 5T3YA 4AN4A 3IJ5A 1LBHA 1RXEA 2FPPA 4CF3A 4KN6A 3JZFA 3FPGA 3PICA 2HWWA 2AFIE 1DELA 5LZ4A 6ADHA 3TVDA 3PDUA 3IUPA 1PAUA 4EW6A 3O4JA 4NAUA 3GBPA 4XR4A 4KPUB 3RYCA 3IFSA 5L40A 5HM8A 3DDSA 2R6R1 3HKBA 3QP9A 2XNDA 1DO2A 1VG1A 3JWIA 4LXXA 3SEFA 5K4HA 3SG0A 2VF2A 2GYWA 1IY2A 1QGAA 2A94A 2P9YA 4IDDA 3V8EA 4IVPA 5LYYA 1RWBA 3K2IA 2JFOA 5DLPA 1IN8A 2Y27A 3L8CA 5K0TA 1VP3A 2ILVA 3K0EA 4IFIA 4YHBA 3MN1A 3C6YA 3K0FA 5TT0A 4AG5A 4MDEA 5CH8A 1P4HA 1A7AA 2PKWA 1JFLA