2WJ3A

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
b'TDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
molecule tags Oxidoreductase
source organism Arthrobacter nitroguajacolicus
publication title Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
pubmed doi rcsb
total genus 104
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2009-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 2wj3A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wj3A01
1JU3A 1CUCA 3R3VA 3C6ZA 1MX5A 1ZD5A 4MXDA 5CBKA 1CUDA 4Y2UA 4WDRA 1JJFA 3B5EA 2JBWA 1E8NA 2BAGA 1IMJA 3D3NA 2WM2A 5FRDA 2XQJA 3IUQA 4F5ZA 2CZQA 3I1YA 1R50A 3GROA 3WYNA 1FSSA 4LYEA 5E4YA 4IH9A 2BGNA 1IUOA 2WQZA 1UK6A 5DYTA 1YAJA 4FHZA 1W6RA 4M0EA 3CCCA 3PI6A 1G5FA 4X92A 4BC0A 4IQ4A 4DNQA 2VT6A 5DNUA 4BTVA 2HHAA 3KOOA 5I9IA 4DNFA 5D3KA 3G0GA 3QZUA 1P0MA 1CUXA 2G5TA 1EDBA 5KBYA 1GZ7A 2Z3ZA 3LIPA 5T4FA 3BXPA 2PU7A 2VEOA 1XRQA 4B85A 1QTRA 1A8SA 5FUMA 4G4IA 1FFBA 4HRXA 2CBGA 2VT7A 3DKRA 4MEBA 2Z8XA 5EHNA 1H2YA 1Q0RA 5C7YA 7YASA 5AIBA 1F0NA 1DQZA 5JAPA 4GDMA 4X90A 4C89A 4K2AA 3EQ9A 4PO3X 2R8BA 2XUJA 4E15A 2CMFA 2GZSA 4QDXA 4G8CA 1QIMA 5HK8A 3QH4A 4X71A 1KEZA 2OG1A 2PVSA 3QBJA 4HAIA 2FJPA 4AZ3A 3WIOA 3ESDA 3EIOA 5CH3A 3PE6A 1MTZA 4X7BA 5DLPA 1ZJ5A 3OPMA 1VZ2A 2VSQA 3HXKA 3QVMA 1EXWA 1EK1A 2C4HA 4L9AA 4XX1A 3WK6A 3R3ZA 1YSCA 5D3ZA 5FPPA 4KEAA 3W04A 2XQFA 4KAAA 3IIIA 4BE9A 4C4YA 4ZGBA 4N5HX 1DT5A 2O7VA 4OPMA 1W52X 2BGRA 4EY6A 2W22A 2PL5A 3IUMA 1LLFA 4QWWA 4E46A 4DNPA 2HA6A 5JAUA 2I03A 4G8DA 4J7AA 1JJBA 3PUHA 1YAHA 1AKNA 1ZGCA 1CEXA 2PU5A 4HRYA 3AILA 2E3JA 3G0IA 1TIBA 4UFNA 5AKLA 1E89A 2HA2A 3C70A 4IH4A 1AMNA 1CUAA 1HPLA 1THTA 5JARA 5EFZA 3DDUA 1XQXA 3AUKA 4PNZA 2W6CX 5AKJA 4J0KA 2XUHA 4H0CA 3F98A 4BCCA 3VISA 3HI4A 1AUOA 4QDTA 5E4JA 4CG2A 4GBGA 4NVRA 1T2NA 5FPQA 1WHSA 4J0CA 1GPKA 3I2GA 3DEAA 3VVMA 1ZGBA 4XIIA 5ALXA 3U0VA 2ORYA 1DU4A 2Y2VA 3OG9A 2O7RA 1TK3A 1W1IA 1PV1A 3STWA 1Z68A 5AKEA 3HYSA 3K6KA 4AX4A 3T4UA 1MT3A 1AC5A 1JMYA 1GQSA 3WL6A 1W76A 2PSFA 3Q0TA 3AIMA 1R4ZA 2WIFA 2ZJ6A 2WIDA 4TPKA 2H9YA 1ZI6A 4B80A 1THGA 1F8UA 3UUFA 5ALHA 4LYDA 3M83A 3FBWA 4QDUA 5ALWA 3STXA 5LKAA 4AO8A 1ETHA 2AJBA 2D0DA 4XWGA 1K8QA 1L7AA 2WUFA 1J07A 3AJAA 4MWSA 3DCNA 4W1RA 3FYTA 4ZI5A 4U2EA 4MQLA 5LYYA 2WG0A 1XQYA 2ZJ7A 1YS2X 1EHYA 3H1BA 3VJLA 3I2HA 4W1SA 2JEYA 2RIPA 5EHQA 5ALEA 4C88A 1U65A 3BWXA 4UPDA 1LPAB 4P93A 3S2ZA 1SCQA 2R11A 2QJWA 3G0CA 1VE6A 3G0DA 2PKYX 1ORWA 4IH1A 3X3HA 1XZDA 5FKJA 1BEZA 2OAEA 2XMCA 2QT9A 3H2IA 3SC2A 2OLEA 5HQ3A 5HQ3B 5DWDA 1QIHA 3DKKA 4I4CA 4BRZA 1MNAA 1FJ2A 5CW2A 3CCBA 4B9EA 1FFDA 5T4EA 2EDAA 4AZ0A 1ISPA 4XJVA 1UOOA 4BZZA 5AKHA 4LXHA 4GWLA 4H7FA 1SCIA 3KD2A 3AZPA 3BIWA 3L1HA 1CUYA 5ISMA 1QTIA 1XRLA 2H7YA 2XUAA 3LIIA 4BAUA 2VF2A 4GW3A 1XRPA 5CRIA 4GEGA 4J0JA 4B0OA 4Q05A 2OCGA 5ALSA 3STUA 2DFPA 3HZOA 4ZV7A 1AGYA 1XZKA 4OB7A 3BJRA 1H23A 2XE4A 4UBMA 3L1JA 1X2EA 3F9CA 4H18A 4CG3A 4UBIA 1CUGA 3QMVA 2H1IA 5ALMA 2YASA 1UZAA 2ZYIA 1ODTC 2QOEA 4FWBA 4JYMA 4Y2SA 1KU0A 1ZICA 5AK4A 3I1IA 4FFVA 1N1MA 4F0JA 3AFIA 2V9ZA 2J3QA 5ALKA 4AMZA 4DMKA 3ZPXA 2VATA 4KE9A 1M33A 3C8DA 2I3ZA 2UZ0A 1D07A 5FXMA 2XUPA 1PFQA 4N8DA 1USWA 3FLBA 4UBNA 2XI4A 3K2IA 3TGLA 3WZMA 1R9NA 1HDEA 2OQVA 5JZ9A 1X2BA 1LZLA 4QE3A 2FX5A 5K3CA 4RGYA 1BN6A 3V48A 5HZGA 3R0VA 1NU8A 4ZWNA 1SC9A 4I19A 3G9UA 1DWOA 3GFFA 3RK4A 3O95A 3RLIA 5C8ZA 2IIVA 4FNGA 5K3AA 3HLKA 2IITA 1CUSA 4UBLA 1GPLA 5AKXA 3M3DA 4Y7DA 1MNQA 1VE7A 4JNCA 4X3CA 2VJAA 4YK7A 2QUAA 5FDFA 3H17A 2G63A 1I6WA 1BEEA 1QFMA 4C87A 1G42A 1LPMA 4DM7A 4H77A 4WJLA 4HZGA 1WOMA 2XLBA 1EH5A 2OAGA 2PSDA 4U2DA 3C6XA 2X76A 2WHQA 3N2ZB 2WIKA 1SFRA 4GI1A 4J0IA 3WK9A 4P08A 3H2HA 1Y7IA 4EY8A 3MGAA 2O2HA 5FOQA 1JI3A 3IA2A 4UHBA 1ZD3A 1MAAA 3WWEA 3DD5A 4B83A 2JGMA 5SYNA 2WHPA 5LLSA 3WI7A 1FFAA 4C4ZA 2WSLA 4A23A 5JYCA 1TKRA 5AKZA 4KRXA 5JASA 3H0CA 4X97A 3HABA 2C0QA 3ANSA 5LZ4A 3ILSA 1CUBA 3KWJA 3KDAA 4K6GA 3DJYA 5AM2A 3WYDA 1XLWA 4WCVA 4H7EA 3BJMA 3FLAA 3M82A 3C5WP 2RONA 1XRNA 1H2XA 3WZLA 5C8XA 2BCEA 1RP1A 3K9BA 1YB7A 4HTAA 1WCYA 4Q82A 5AI0A 1Q84A 3U1TA 4GHWA 3HJUA 1TRHA 4Q3KA 4Z49A 3AIOA 3O4HA 1XZAA 3P2MA 2B61A 1CIJA 3GA7A 2AXEA 4Q3LA 4FBMA 3DQZA 5ALQA 3I2IA 1N5MA 4X93A 2P8SA 1QIFA 1ODCA 1B41A 1BRTA 2QMQA 5AK6A 2C5FA 3FWHA 3Q8WA 5AI8A 2HFKA 2XQKA 5ALFA 4C4XA 4EBBA 3C45A 3WIBA 1CLEA 4IHAA 2QS9A 1YCDA 2VAVA 4UUQA 5ALIA 5JD6A 1ZOIA 4EY5A 1R1DA 4WFIA 1ZD4A 1P0IA 4ETWA 5C81A 1QE3A 1EVEA 1KU6A 3AZOA 2EEPA 1XROA 4PW0A 4CCWA 4EY4A 4KJXA 2JGJA 4BDTA 4BVJA 1XZLA 4QNNA 4B6GA 1Y37A 2OCKA 3ZLUA 3C6YA 3O9MA 2WU4A 2VTVA 2JGKA 2B4KA 3ANTA 4MJ3A 1R88A 4CI9A 2C5GA 2XT0A 3A2NA 2XQIA 1UXOA 1EI9A 5EIEA 4UBOA 1ZI9A 4EB0A 5HKBA 1U8EA 2BJHA 4UBKA 4NZZA 4EY7A 1BCSA 4BCBA 1RYYA 4OD0A 3C6BA 4K6HA 2HA3A 2PM8A 1OXMA 3GUUA 5AK3A 5LZ7A 5FP0A 5HF6A 5CT8A 3W9BA 1IVYA 1FFEA 5ALTA 5AOBA 5FLKA 3DS8A 1EINA 4OU5A 1YR2A 4UHEA 1QOZA 1AQLA 1DX6A 1LPNA 2DHCA 5H3HA 3I2JA 5JALA 2QKYA 4RNCA 4OCZA 2XUOA 1RWQA 3PFBA 2Z8ZA 1FFCA 2Y2UA 2WUDA 1Q0ZA 5BWBA 2XUQA 1CUFA 4UHDA 2WG1A 3IULA 3AINA 4PV7A 3ED1A 4B9AA 3QITA 4KYVA 4RPCA 1ODSA 2DHEA 4BVKA 1ACJA 1L7QA 4J0HA 3STYA 1XRRA 3DL4A 3R41A 2D5LA 5AOAA 3LP5A 5EI5A 1VZ3A 1ZIXA 5CXUA 3KXPA 4MYSA 2WHRA 5HFNA 1DX4A 3F67A 4FLFA 2XMDA 3WWDA 5AH0A 1YA4A 1W75A 2WFMA 5J3JA 5DNVA 4UHHA 5C8VA 3V1LA 6YASA 2RHTA 1UOQA 2B9VA 2I3DA 2WUGA 2QJRA 2WJ6A 5DYWA 5JAOA 4QEKA 1IZ8A 3NOXA 4A16A 1O6GA 1QO9A 3A70A 3AZQA 4HXFB 2QXTA 3W05A 1LPOA 2OGTA 3BDVA 3ZV7A 1ZJ4A 1MAHA 3WKEA 5A7GA 1GKKA 1T4MA 3C8HA 5IVKA 2QTBA 1C4XA 5ALNA 2V96A 4H7JA 4KAJA 5KWIA 3I6ZA 3OTQA 3I6YA 5ALGA 3EBLA 4BYMA 4CG1A 4A5SA 1UOPA 4GLBA 3H2JA 2WG2A 3JWEA 2JGIA 2C7BA 4FLEA 2DQYA 1EDEA 4DYHA 5A71A 3FSGD 1TCBA 4AO7A 1XZEA 2HA7A 1O6FA 1LBTA 3WK4A 4E14A 2DCMA 5HCUA 5DTIA 1QLWA 1QIIA 1ZI8A 4WFJA 1LZKA 2AJ8A 4HS9A 2ZSIA 1JT2A 2PSJA 2CEKA 3IDAA 2XMSA 3DOHA 4J03A 1N5RA 1ZIYA 4KE8A 4J3JA 5LP1A 1H22A 4AQDA 1HKHA 1G66A 3WK7A 4YASA 4PSUA 4FMPA 2PSHA 3D2BA 1UFOA 1AZWA 2BUAA 2PBLA 1AX9A 2CB9A 2JGEA 3LLCA 3BE8A 1XLVA 2JIDA 3E4DA 2ECFA 3FOBA 4Y2TA 5HK9A 3BL8A 4DIUA 3QMMA 3WA6A 1QIKA 2HA5A 1UT6A 4Y2QA 3JW8A 4J0GA 2WUEA 4FFWA 1VLQA 1B6GA 3NWOA 5JANA 2WJ3A 5IKXA 4BAGA 3FYUA 2O2GA 5AKKA 2RGUA 3W06A 3T52A 4W1QA 1WB5A 5CURA 2HA4A 1L7RA 1J2EA 4Y2RA 1YB6A 4BB0A 3FAKA 3R3XA 4BDSA 1R3DA 5T4BA 5AM0A 4ARBA 5DJ5A 4F21A 3KSRA 5ALLA 4LHEA 1JKMA 4DGQA 1CUUA 4DMCA 2V98A 3H18A 4OUKX 1WPRA 4G8BA 5ALZA 4B0PA 2J3DA 4M0MA 2HRRA 1BU8A 1DWPA 5AOCA 1XZMA 3A2MA 3L1IA 4FOLA 2WHPB 5A7FA 5ALDA 2QZPA 2ACKA 1WB6A 2AJLI 4CFSA 4KACA 1CUZA 4J0DA 3WKBA 5BWCA 2ZVDA 5IVIA 2VJCA 4INZA 3TEJA 3DNMA 1ORVA 2WTMA 3H04A 5AO9A 5HF8A 3VVLA 1C7JA 1K4YA 4BCDA 1XZHA 5ALYA 3H19A 4D9JA 5KWJA 1HLGA 2PX6A 5CH8A 2GZRA 3DOIA 3FSGA 1N8SA 1UK7A 4Y2JA 4L3WA 3D4LA 2G4LA 1IZ7A 3AIKA 3VKFA 3WWCA 3ZLTA 4P9NA 3WL8A 4RE5A 4FNMA 3WMRA 5JIBA 3CXUA 1XQVA 4EZIA 2DHDA 2X5XA 4TGLA 2JEZA 1CVLA 4FDMA 5AIAA 5ALUA 1VA5A 3ESAA 4ITVA 4X95A 5K3BA 4CIBA 4W63A 1WB4A 4QDZA 1HQDA 5LZ9A 2WFZA 2QUBA 1LPPA 1K63A 4L0CA 1CQWA 4EUSA 1X70A 5KREA 1MU0A 3C5VA 1XZJA 3BDIA 3RARA 4AXBA 4IO0A 3KWFA 3WK5A 2H7CA 1CQZA 1K5PA 3F96A 1IUPA 1EB9A 3A6ZA 4N8SA 4MQMA 3PICA 5F4ZA 3WKAA 3E3AA 2AJCA 2B20A 2FUKA 1SOMA 3DYVA 2XUDA 4U2BA 1CPYA 5JD4A 3YASA 2LIPA 3ESCA 4JEIA 1E8MA 4WY8A 2VA9A 4MWTA 4Q1VA 2RHWA 3I6MA 2HA0A 4C6HA 3SK0A 5BV7A 2DQZA 5A62A 1U2EA 2WFLB 4OYLA 3V1MA 3H1AA 4BAZA 1MJ5A 1QJ4A 4CCYA 4S0XA 4UHFA 1H2ZA 4U2GA 5LZ2A 2XUGA 1WPXA 4ZXFA 5LZ5A 4N8EA 3I2KA 2Y1KA 5AM3A 2RAUA 2OCLA 3DLTA 1E3QA 3CN9A 2XUFA 4Y9SA 1EX9A 4UFPA 4MEAA 4UHCA 3MVEA 5T4HA 1VXOA 3QM1A 5CT6A 5CT5A 1MN6A 3WWPA 1TAHA 1CUJA 1E66A 2WILA 4N5IX 1HL7A 5IH7A 4O08A 3GZJA 5CT4A 3C43A 4MYDA 2QM0A 1BS9A 4DMFA 1EK2A 2WIJA 5ALVA 2WJ4A 2GBIA 4KE6A 1SCKA 3UUEA 2HU5A 1VJ5A 3G7NA 3QPAA 3R3WA 4QWMA 2NW6A 4AN1A 1GGVA 5I7UA 5ESRA 1EB8A 1TCCA 3G8YA 1JJIA 3ZLVA 2EDCA 4DSAA 5AI6A 1G4HA 1GT6A 4QLOA 3GBSA 2GBFA 4L72A 2IX9A 4YX9A 3SX4A 2RI6A 1J1IA 1UK8A 2XDWA 1BROA 3ZI7A 4AB1A 3FVTA 2GBCA 5K5EA 3MUOA 3WKCA 3BIXA 2AJDA 1JMKC 4AMYA 4ARAA 3OURA 1BN7A 4X94A 1UKAA 2VJBA 4JYPA 2Q0XA 2HL6A 1E5TA 5JZBA 1XKTA 2WIGA 3IURA 1K6EA 1EA5A 4CIAA 4FLMA 1UWCA 5AM1A 1GKLA 5HF5A 2ACEA 4H35A 4EHBA 1UKCA 5DTJA 1XKLA 5BOVA 1F0PA 4G4JA 3ZWQA 3O4GA 3R3UA 1XZFA 5CT9A 3C87A 1XZIA 4QA9A 4WFKA 4Y2VA 2XQGA 5D7BA 4HXGA 3BF7A 4DNOA 2WFLA 4NMWA 1CRLA 4QDOA 2XMGA 4TVKA 3F97A 3QMWA 3D5EA 5CTAA 1MX9A 3G9ZA 3WJ1A 3PFCA 5AI4A 1QGED 4M0FA 2DR0A 3R40A 4B7ZA 1XLUA 1Q83A 4DSZA 1DT3A 2C0PA 4G1FA 2ONCA 1QONA 1TCAA 5I8PA 1GQRA 2J4CA 2HU8A 1XFDA 2VQ6A 1CFJA 2XUIA 2BKLA 2QXUA 4X91A 2I78A 1WHTA 4U2FA 2BFNA 3NGMA 4F60A 3N0TA 3JYHA 4DLNA 5HKAA 1WM1A 3WA7A 3VJKA 5IVDA 5LKRA 3V9AA 4YPVA 4OU4A 2ZYHA 4GECA 3D2CA 5JADA 3ESBA 4PQEA 2O2IA 1AURA 5EIAA 2WKWA 3WL7A 4XVCA 2FJ0A 3W2TA 1HBJA 2XUKA 4OYYA 3G0BA 1A7UA 3TJMA 4DTCA 5DYYA 1QO7A 1QFSA 2PSEA 5K3FA 3H2GA 5ALJA 1TQHA 4UFOA 5D6OA 4BRSA 2OXEA 1QIDA 4AO6A 3HEAA 1CR6A 3G02A 2PUHA 3PF9A 1CUHA 3R3YA 4ZV9A 4BE4A 3VXKA 5A7HA 1F6WA 1MPXA 2GYWA 1CUIA 3FYUB 3O0DA 4UBJA 4KRYA 3FYUC 3FVRA 3IUJA 2HIHA 4FKBA 4P92A 2JGFA 1NX9A 1LPBB 4Q3OA 1LBSA 4FTWA 5EGNA 1UKBA 2HADA 2JGLA 1BE0A 1OILA 1XZGA 2ES4A 3IUNA 2K2QB 2JF0A 3OOSA 2OPHA 5JZSA 5JD5A 1BCRA 1DINA 1EVQA 4G5XA 3WKDA 4B81A 1Y7HA 3LCRA 1XZCA 2HDWA 2J4FA 4U2CA 5K3DA 2H7XA 3SWWA 1ACLA 4H7KA 4AN0A 1DTEA 4OB8A 1PJAA 4BBZA 3W9UA 4LKOA 2ROQA 3BF8A 3EQ8A 4H7DA 1JU4A 2V97A 5DNWA 2HU7A 3MUNA 5AKGA 1IUNA 4OB6A 4X85A 4BC1A 3RM3A 1VA4A 5AP9A 4KE7A 4HVTA 3DL7A 3IBTA 5AKIA 5AI5A 1GXSA 2Z3WA 4Y2XA 4LXIA 2GYVA 3PUIA 3E0XA 4X6UA 1VOTA 5SYMA 2XB6A 2ZSHA 1XZBA 3ICVA 3WK8A 3HRHA 4B82A 5K3EA 2OGZA 1MO2A 1QIGA 5AKYA 5A2GA 2G5PA 1DQYA 3FCYA 3EF3A 2Y6VA 3QYJA 3STTA 1XQWA 1P0PA 3WQHA 2VAXA 2PPLA 5EHZA 1A8UA 5EIHA 3I2FA 4NS4A 4KR0A 1ZD2P 3WL5A 5E2IA 2HRQA 2WTNA 5CH5A 3B3QA 3I28A 5AM5A 2WU3A 4KAFA 2CJPA 3PDCA 4BP9A 1YA8A 3WLAA 2ZJFA 2Z5GA 1EDDA 3WJ2A 5AICA 1MX1A 4BP8A 4H7IA 1CUWA 2XMZA 3O9VA 4CCYB 5LZ8A 3CN7A 2PUJA 5A6VA 2BUBA 3STVA 5HFAA 3F8SA 1YASA 2OQIA 3IVMA 3M81A 4OSEA 2DSNA 2HFJA 1QIJA 1LNSA 4JUIA 1R9MA 4Y2YA 1UK9A 4Y2PA 4B84A 1JFRA 4K6KA 4ZRDA 2XMBA 1CUVA 4K5QA 3D59A 3FNBA 5ALPA 2HM7A 3QPCA 4FBLA 3O4IA 4GXNA 3PF8A 2GBGA 3G9TA 2YYSA 1QIEA 5EHXA 4ROTA 5ALOA 2BUCA 5AHXA 1C7IA 2ZYSA 4C01A 3A2LA 4X6XA 1CV2A 3FLEA 2CKMA 3VJMA 3DYIA 5CMLA 2ZYRA 2WLSA 4ZREA 3FCXA 4QZVA 4LXGA 3OM8A 1E8DA 3GELA 1GPNA 4G9EA 3OC0A 3D0KA 3RKSA 5CXXA 1CUEA 4PSDA 5AK5A 1H2WA 4G4GA 1NU6A 3V1KA 2Y6UA 1XRMA 4HXEB 3TRDA 3D2AA 2OCIA 1LPSA 3S8YA 3B12A 4WY5A 3VDXA 4E11A 3HSSA 4JH0A 4RE6A 5HF9A 4I3FA 2VJDA 1QZ3A 3H2KA 2QVBA 2XMRA 3WWOA 5LIPA 3QPDA 4V2IA 4BATA 1YS1X 2C58A 1W4LA 2GYUA 4W1PA 4X6YA 5E4TA 3G9XA 2XMQA 5YASA 3V1NA 2XLCA 1LGYA 5ALRA 4DMHA 4BZWA 5JAHA 3ICWA 4WDQA 5AJHA 4BTLA 3HC7A 1VKHA 4BVLA 5AI9A 5AM4A 3IB3A 4X00A 3E1GA 1A8QA 4LIPD 2OGSA 3NUZA 1DWQA 1VXRA 1U4NA 3D7RA 4QLAA 3UMJA 3HACA 3EQ7A 3LS2A 2CUTA 4PSCA 5FV4A 5JATA 1P0QA 4H7HA 1J06A 1S8OA 2QRUA 2YH2A 1OCEA 5K3FB 1A88A 2QR5A 4G9GA 4EA6A 4Q34A 2X8BA 4W9RA 4PF1A 3O4JA 2YXPX 5IVHA
chains in the Genus database with same CATH superfamily
4K9QA 4WKCA 5HFJA 1RQGA 1WMFA 4R51A 1Y34E 3K73O 4NG5A 4RQTA 3T94A 1HZJA 1MX5A 3N5CA 2AD1A 3ROTA 2AE1A 1ZD5A 1UCFA 2F8LA 5JQWA 2FSHA 4QD3A 3O1IC 4ZZIA 3B38A 1SC4A 3ORFA 5DPMA 4F86A 4Y2UA 4ICIA 3W4KA 2VJOA 3W6PA 4YRJA 1SHZA 1IN8A 1Z8NA 4LDJA 3QEAZ 3B9QA 1II8A 1Z4NA 3G0HA 1MOQA 2EU8A 3E1KA 1ABBA 3KKOA 2JBWA 4HX5A 4UJ3A 1AUPA 2XNKA 4BFXA 4EABA 2V5AA 2VP4A 3N53A 2J45A 1GUFA 2HEIA 5FRDA 3GPBA 4DLZA 4F5ZA 3I1YA 2N0SA 4CHGA 1ZR4A 1R50A 2ZYDA 1DAIA 3IP1A 1M6YA 4G0UA 4WVLA 3WLNA 2B1QA 3AESB 1FSSA 2OB2A 4AJ4A 3U4QB 4ZEMA 2EP8A 5E4YA 1J39A 1SOAA 1XDBA 2X0DA 3MINA 1NN3A 1PVOA 1I1NA 1YAJA 2HKIA 3OZFA 1WDLA 4D99A 3KQKA 3NJ4A 1EBBA 1DV2A 3CCCA 3OE7A 1KFJB 1MUUA 4PAGA 2GYYA 1IG0A 1BAPA 1KKUA 4LE2A 3OFND 1D2MA 1SXGA 1IXKA 2CXQA 2Y76A 3F6BX 1AKVA 1T1RA 4YJ3A 2Z9DA 4OHZA 2FTKE 1U0RA 5HM8A 4GRIA 2QLTA 2QVGA 4TXHA 1KOFA 1LDEA 2FMTA 5TVGA 4DCPA 3KOOA 1YQUA 3QW4B 1RM5A 4N6GA 3E4CA 3G2HA 4OXIA 5HG0A 4UCXA 1IQ0A 4O8CA 5B7NA 3LK6A 1E62A 3BIOA 3TD6A 1V3VA 4AJIA 5KOYA 5TSDA 1HZZA 5D3KA 3TFWA 1Z74A 3EC7A 3FNGA 2ZJ0A 3N70A 1E1CA 4WEQA 5BW5A 3K8YA 3CVWA 5AW9A 3HBAA 1AKTA 3MERA 5CA0B 2G5TA 2TS1A 2QTWB 2W2LA 2ZJBA 3H86A 5AYVA 1TU0A 2Z3ZA 3OF2A 2ZUUA 3K8QA 3MMXA 4RTMA 1GQ2A 2CFRA 1E2PA 5F3DA 1A9RA 2ZZKA 1XJ0A 1NP6A 2J7PA 5F77A 1PVVA 1U7OA 1P81A 2BKAA 1KYTA 3Q5DA 4IHJF 4IDDA 3WOVA 3GG2A 1IYZA 1FFBA 4E94A 1V6SA 2CBGA 1LRLA 1YR6A 3V33A 1PGOA 1AMOA 2GPNA 5DXJA 5TMBA 2POCA 1XK7A 2J0QA 4WOPA 3KOUA 1BXRB 1TF2A 3OESA 3BCRA 3OJCA 1O96B 4FC6A 5JAPA 5ABPA 1PN3A 2DKOA 3HKEB 4GDMA 4BN0A 5K0JA 2POQX 2R8BA 4RHEA 2M6LA 2Z5VA 4IVQA 1BTOA 4E15A 2BEUB 4ZOBA 1ZC3A 5JQGA 3AR3A 5MN6A 2WZQA 2XECA 3RT9A 3F7OA 1V16B 3DZFA 2P2DA 3EIEA 4EPRA 3GJ4A 3V46A 5U1PA 2HW8A 4YAKA 5IT4A 3QH4A 4N6NA 1Z6GA 4R0VA 1KP9A 3C3YA 3QBJA 5D01A 4X66B 2O8EA 2CHVA 4QRDA 4XQEA 3H5RA 1A5SB 4FGJA 2BKUA 3SHQA 1MZVA 1BDMA 1RM3A 3D8TA 3HBNA 4FZJA 1EFKA 1N0HA 5DNAA 3R5SA 2XDQB 4CPDA 4E6EA 5CFQA 5EXXA 5CH3A 2VNHA 1J0XO 1OQAA 1MTZA 1H8EA 4Q18A 1WLSA 1HE2A 1LRKA 4Y1FA 1K0FA 1H2HA 3NRCA 1N32B 1SHTX 4NPCA 4BZQA 1SVIA 2R1TB 5DLPA 1ZJ5A 2C9OA 2GPSA 2P1ZA 3QF4B 3OM1A 1E6MA 5DM2A 5JMOA 2ZXUA 4L2IA 3THXA 1Z88A 1ESDA 4URYR 1EK1A 2JCGA 3BFPA 1QRRA 4BMOB 3FNIA 2ID8A 3VR3A 4DWJA 4Z3KA 2C4HA 2ISQA 3EW9A 4L9AA 1UAYA 4S1PA 3SFTA 2VDNB 3AR2A 4EF6A 5M29A 3T1TA 1JDPA 2GB4A 2P9ZA 2R2AA 3R3ZA 2HPZA 5JCJA 1YSCA 3MRXA 5JO9A 3QKIA 4KEAA 3TQOA 1CD5A 1GOTA 1M2JA 1NX6A 2H1HA 3ZHOA 2JFQA 4N0QA 4RPJA 6NULA 2FP3A 4MV0A 3OCVA 2C99A 1L5HB 1X13A 1Z5PA 3PZBA 4CF5A 1IE3A 4A15A 1Z2DA 1ORIA 2W11A 4QQ8A 3OT5A 4L15A 4F85A 1IVNA 1DTWA 1H2AS 1BFDA 1DG1G 4PRZA 4R5MA 2WV7A 3EPRA 3NBZC 3EISA 3FCEA 1E7MA 4RAOA 2P65A 1TZBA 4OPMA 2TMGA 3QV1A 1CE8A 1XZNA 2PL5A 3QWHA 4KR3A 1HE8B 4L8WB 1LLFA 2PH7A 2A0FA 3ET4A 4QWWA 1WXWA 1D2AA 3A4MA 3ZD6A 3QXHA 4HH1A 2CNWD 1C0IA 4MR8A 2OBMA 4CV2A 4QBIA 4O4HA 3NH9A 2OL4A 5HRAA 2VWPA 9GPBA 4X1IB 2YTZA 4MUNA 5DBEX 3KU1A 3NDBB 2XA9A 2FI1A 2GK6A 4Y0VA 2R62A 1FNBA 3DTVA 1AK9A 4UNQA 5CNMA 1NW4A 1CEXA 1KR5A 2ZCVA 4HRYA 1I2ZA 4DXDA 3KHKA 2O7SA 3HWX1 5CCEA 1TEXA 1U1FA 5AKLA 1E89A 2HA2A 3C70A 3TUIC 3ZY3A 2WF9A 4ZIRB 4ZOQI 3ABZA 3GMTA 1GP2A 2MSEB 4URWR 3OJOA 2FPXA 1AMNA 2XA1A 1QHNA 1UIMA 4XWTA 3OM0A 1U0OC 3QY0A 5BURA 5EFZA 5JARA 3SZGA 3WRWA 1I3MA 1Q1BA 3SIWA 3LLMA 2FW9A 4W6ZA 3Q3CA 2AXQA 1NF8A 3CFYA 4RCYA 5ADHA 1PJTA 1GL6A 2CCJA 4H0CA 1G5RA 2VK8A 5CJJA 5CLJA 1W36B 3F98A 4BNZA 4ZAFA 3HI4A 3TQHA 4JK3A 2GCPA 3KHUA 2XCUA 3FTFA 4CG2A 3PQFA 4LCBA 4W9NA 4G1CA 1T2NA 4CUZA 1GPKA 5FPQA 2OG2A 5BYKA 4XPZA 5JS6A 4HB2A 1ZGBA 2R6AA 1RP7A 3ASZA 1ZK1A 4LRYA 4RDCA 4V0ME 2XD4A 4XIIA 5BSRA 5B2EA 2IU0A 4A2QA 4R7TA 2ORYA 4AJHA 2EIHA 2VH1A 1MQ8B 2Y2VA 3OG9A 4TS9A 5TARA 1E6LA 5J5CA 2Y1FA 4LRWA 4BNXA 3CVYA 2ZIAA 4K87A 5IJAA 1XTTA 3BRQA 4QNRA 2V03A 3HDHA 5CYFA 4U7DA 3DKPA 5FTKA 1RC1A 4BYGA 1Z68A 4IGEA 1S01A 4D0LB 2Q2OA 3AUAA 2JFBA 2ZRKA 2GKGA 2CSXA 2K7ZA 1GRNA 1REQB 2NZXA 4ZMBA 5U9CA 1QC5B 3K6KA 3QRWA 2IODA 2HSWA 2BGMA 3IRUA 4KKXB 3DE6X 2P11A 4DJDC 1AC5A 3DBLA 5FTNA 3GLGE 3V8NA 1USGA 1Z63A 1JMYA 1RRCA 3AR6A 4XTCS 2D1SA 4Y98A 4RTNA 2JCSA 2UUOA 2Y8EA 2R68A 3L5KA 4CU5A 3D3EA 2ZI3A 2FGJA 4ZODA 2GEBA 3TLMA 1R4ZA 4HYTA 4EUFA 1B8PA 2VOJA 3PC2A 2PGDA 2YYZA 4CLEA 3W2EA 1OFUX 3LF1A 4NH0A 3F6EX 1NQOA 3L7KA 3RI3A 5BPHA 5HMLA 5M7EA 1PFVA 3W5UA 4RKFA 2IELA 5JEEA 2C9YA 3C48A 5LNK6 1ZI6A 3MOGA 1RXWA 3QVKA 4M76B 1F8UA 5ALHA 1RFLA 1DAPA 1M6VA 1FBNA 2MJLA 2Q4EA 2V4UA 2QBYB 4LF4B 2IY7A 5JJBA 3M83A 3A2KA 3JZIA 1CSEE 5EP3A 1SPBS 2R25B 5HNKA 2UV8A 3O2QB 3S2GA 4FQ8A 4A5OA 5L3QB 2CLOB 4IMRA 3TOVA 3MSCA 2OOKA 4EUEA 3STXA 5KOHA 4O2AB 3QKWA 1T9ZA 5LKAA 3BMCA 2D0DA 2AJBA 1Y3CE 4O2BB 4XWGA 1L5NA 1MDFA 2FSPA 1K8QA 1LDYA 4L0DA 4BO2A 1L7AA 3AG6A 5KC9A 1W94A 1FFHA 1H8HA 4PYJA 3SQLA 2V6BA 3CJRA 3HCWA 1HFKA 1JWAB 1RBMA 4H16A 1J0EA 1I4WA 4K6MA 4UCFA 4W1RA 4QBTA 3FYTA 4ZZ1A 3UPTA 3OQBA 2WMYA 4LZLA 3L0OA 2WFAA 4U2EA 4ZI5A 4BEBA 2Q8QA 1VGQA 5H3LA 3F3SA 2HXYA 3IQWA 1OLOA 2WG0A 4DG8A 4ZK6A 2R8EA 4JXXA 4QAJA 5DVZA 4CDRA 3L3BA 2MSWA 1YS2X 4XLTA 1OWMA 4HTFB 2EARA 4TM8A 3UEOA 1FTYA 1M2OA 4OXQA 4P3XA 2BR3A 4YTEA 2RIPA 3RVKA 4RVUA 4QPNA 4UM7A 2FQQA 3ZDAA 2IS1A 3FYCA 3NWPA 3INTA 1C4WA 1WKVA 3LX8A 4RWZA 4N0EA 2C7RA 2R6DA 2ICAA 3LGSA 3EX7C 2IP4A 4TKUB 4N3GA 3G0CA 2FPKA 3SLGA 1L5LA 4ETNA 1QPZA 1GPBA 1AKQA 4OEHA 3E3NA 3JAKA 1JYFA 1GNRA 1ZL2A 3HPRA 4FFDA 3WYGA 1XZDA 4Z0HO 5D84A 5IJZA 2IIPA 3HA5A 2GWRA 5DLQC 3UV6A 2QSYA 2CLIB 2WOJA 4IIFA 3DTTA 5M34A 3HL0A 4JI8B 3H8SA 1ST2A 3O1JC 2FPOA 3OZGA 4FYJA 1FZTA 2W48A 3JYLA 2G7MC 3TTVA 2QT9A 2VJLA 3A26A 1PZXA 4FN5A 4TLDA 1Q15A 2JGDB 3BB3A 4K26A 2Z43A 3TR6A 4D97A 4TWAA 4R71A 4PR3A 1YS7A 2VZLA 3AEKB 4MCAA 2CXSA 5HQ3A 3ROQA 2Q21A 2D2XA 3IHKA 3NVMB 3GPIA 3U7IA 5IT9A 1JV2B 2V6GA 1UUFA 2IV3A 3OZTA 1S3SA 1CRZA 3Q7QA 1JPUA 4V39A 5GTDA 1NYQA 1WS6A 5CW2A 3I8XA 2E49A 4LXXA 3CCBA 5K0EA 3V1YA 4J6EA 4AYTA 2A9PA 2A5JA 1R18A 6AT1A 4EH1A 2EDAA 2Q1YA 2Q62A 2VTBA 1Y4AE 2IHBA 4OHKA 2G5GX 4QX6A 4AZ3B 5CB4A 1NUSA 4RBNA 4XJVA 1I51A 1UOOA 4KQ2A 3WB2A 1L5SA 3KSMA 4GWLA 421PA 5GJBA 4IICA 3BB4A 4IGFA 4MX8A 3UFBA 5JAZA 1CRQA 2GKOA 4KV9A 2GETA 4D4MA 4QUHA 2ZUCA 2ANCA 3KD2A 2H4XA 3D1VA 3NONA 1JA0A 2VDLB 3BXHA 3EVBA 4J6FA 1IDN1 4FOSA 2BISA 4G0NA 4JP2A 4KUGA 2F8TA 3WGGA 3AQ4A 1QTQA 4RQBA 5JAIA 2AB0A 2H92A 4CN9A 5ISMA 3EEYA 3N2LA 3CSUA 1OIWA 3WMWA 2XUAA 4CF3A 2FFJA 1CR0A 4PYLA 4ABYA 4GW3A 5TMPA 4JCOA 2XRZA 5K0CA 5CRIA 3DE3X 3OQOA 1C9DB 1ZOPA 3B53X 4B0OA 3OPYI 1YFLA 3UJHA 3VV3A 2OCGA 4ES6A 1S9HA 1NRIA 4J4HA 2VWHA 3STUA 2HJ9A 1O57A 4DRXB 1PZNA 1XZKA 3IO5A 1YA6A 1HK7A 5AK0A 1U2ZA 2XE8A 4OB7A 1SA0B 4EARA 1YZKA 4TS4A 2E1RA 3BAZA 3PJRA 2QTNA 2EGHA 2RIRA 2Q1WA 3LL7A 2AW5A 2WZDA 1XMPA 2C83A 1A69A 3R5JA 4WZZA 4A2WA 5C5EA 1P4HA 3AXSA 2OFWA 3Q7PA 1BGVA 1P17A 3RJMA 4INAA 4F1WA 2P3QA 2WC1A 1J90A 1EFVA 4V1CA 1VMIA 1F2UB 2ECKA 3R77A 4M6WB 1ORHA 1GKYA 4WZBE 1QJCA 2H1IA 1NV9A 4BLQA 3GEPA 4MGEA 3N76A 3SYMA 3U4QA 1UZAA 2CLMB 1RWOA 2G09A 3LXUX 5ENZA 1JHYA 2BFFB 3QWAA 1M7GA 2G06A 2VPPA 2JFYA 2P7IA 1TFRA 4JIGA 1WMEA 3AUFA 1OE0A 3CLSC 4FNOA 4Y2SA 1LLUA 3AOEA 2YRXA 4L7QA 4TV9F 1QYCA 2J07A 1K75A 3COZA 4GOXA 2LV8A 4M1OA 4O1HA 5LOVF 2HV8A 3P9RA 1N2CE 1U3VA 1N9KA 1WTCA 3LPNA 3KDSE 4LYGA 4QU8A 3V2GA 5REQB 4DIBA 2BEWB 2V9ZA 1PTJC 3C3KA 4EHAA 2J3QA 3QE3A 4FYXA 2P6UA 1UADA 2JLXA 2J0UB 3LKBA 2J0UA 4FXOA 4A0GA 2P6RA 1Y5LA 1D8AA 2Y27A 2BEUA 5CFRA 1XPOA 5EY5B 4RV4A 4C0JA 4XEHA 3KAQA 1A7AA 1PL0A 1U02A 4XDHA 1JXMA 4OGLA 5LMZA 2DAPA 2X9VA 5C4GB 2ZSKA 3CEHA 3O7WA 3SQNA 1NQXA 1ZWKA 3KXLA 4JGBA 4P32A 3FLMA 3QW2A 4K6FA 2KWIA 4R9RA 2QRVB 3CPHA 5TV2A 4B8ZA 5A9SA 4YONB 2HDNB 1AA9A 1QR6A 1T2UA 4BTEA 3K2IA 1QSGA 5ECGC 1MB3A 3TZQA 3EXEA 2BFPA 1U9IA 1K08A 3ZBPA 5LYJF 1R0BA 2AOTA 4QUBA 3OJLA 2OQVA 4JLUA 2VUSA 1X94A 4R41A 5BWNA 2JBAA 3RVSA 3FFAA 2D4HA 2BRUC 2OZLB 3GRZA 2I67A 5KAMA 2ZANA 1A8HA 3PPVA 5CB6A 4OHFA 2OYRA 2YV2A 1G21B 3H16A 2I2BA 1QHEA 4HG2A 2B37A 5EMNA 1WE2A 3MS2A 5JC8A 5HZGA 3PQ8A 1SC9A 3UAVA 3L8DA 1E1CB 5CK5A 3SMVA 2HIGA 4H0FA 4PS1A 2Z5LA 1R74A 2X3UA 3SDSA 4DCJA 1XYYA 2FDRA 3U3RA 3WHIA 1GO2A 3GFFA 1JW9B 3RK4A 5JCOA 5CAEA 4P84A 4OHUA 3IC5A 1T1JA 4IDFA 1C8BA 1OA1A 3G5AA 1XGKA 2X7JA 3ND5A 2REXB 4G89A 2Q2NA 4KIJA 4XDZA 4YUYA 3IQDB 1OFTA 4JP5A 2Z58A 3K1ZA 2F1JA 2ODPA 1U4OA 1XF9A 1UMCB 1IK4A 5IC5A 3CGGA 4I3HA 1SKUA 3R0XA 4BQRA 2QQFA 3DC7A 1GTMA 1V6AA 1VE7A 3O92A 1GRRA 4JNCA 4QUJA 4QYSA 1T5BA 3A1NA 3O4VA 2X86A 4NENB 5EJ9A 4WLVA 3JD3A 1KI8A 3GFPA 1RYZA 5CDFA 5K20A 5FDFA 2O3RA 2Z2JA 3H17A 3KSDO 2HJVA 5KMGA 1TAUA 1OX5A 4B3JA 5AWFC 4UMVA 3GLHB 1LLQA 4CM9D 2R6HA 4BMVA 1L5QA 2KBFA 3UAWA 1G42A 5EJEA 5JQGB 4KVZA 4DM7A 1GAQA 5DNEA 1FTWA 2NU7A 1Z82A 3FZEA 3PYMA 1QRDA 2OAGA 2ZYUX 2MSLA 4KMSA 4IDBA 3NIDB 2ZM6B 4Z1MA 4BGVA 4HNUA 1KJ9A 4Q4JA 1I0ZA 2WHQA 3LD9A 4Q4HB 4DW8A 3V4RA 2WIKA 3S55A 1TUBA 2I33A 1MXHA 2RKOA 2DWPA 1R0WA 3G8AA 2ZI7A 4J0IA 1WSBA 3B1ZA 5HJ5A 3JATB 4GM0A 1UPXA 4D02A 3H2HA 3OE1A 1UQTA 3EMVA 3KQUA 1RKXA 1PG5A 1WCIB 3AB8A 1V9SA 1WXFA 2CMKA 3IQXA 3MGAA 4H6WA 2VHZA 5CA1F 1AXGA 1MEEA 4EB6B 5GIPE 3OLCX 4ZQIA 2IOHA 3KTDA 3MMZA 3C7DB 1UZUA 1JIUA 1V8ZA 2DBYA 4XDGA 1MRSA 2EKPA 2DUNA 3IA2A 3NGXA 4V2UA 1RHKA 1KP2A 2I7DA 1FBTA 1HMYA 1ONBA 4UHBA 1QS0A 2IHKA 4MUAA 2JEOA 2L2QA 4EI8A 4ZGGA 1MAAA 3P2KA 4YRPA 2ZVPX 1HFEL 4U7PB 2NIPA 2QORA 3DLPX 4MV5A 3OWOA 4OP2A 5ELMA 5IZCA 4CLDA 3H2ZA 1VECA 5JSQA 5CDHA 4TKUA 4ZCMA 1XCMA 1ZA1A 4PC7A 2YXEA 3RFVA 1OLUB 5KHOC 2C31A 1TKAA 3FF4A 4KN9S 5FFMA 1VCNA 3V6LA 1OBCA 1NNUA 4YRLA 1F2VA 1YZFA 1P4GA 4HBZA 3Q6NA 5E9QA 4BLRA 5JASA 4D0GA 1T2AA 3HDYA 3CE6A 1FJXA 5G3ZA 2X7HA 2YWDA 3KYJB 5DIFA 4ITRC 4OA5A 2I8CA 4LE1A 1Z7BA 5JYEA 3ANSA 4OXRA 3C3XA 1V3UA 1YK1A 3ZKWB 2ATCA 1C1YA 2AR9A 3LA6A 1QGAA 4HDOB 5JRJA 1QB7A 3KWJA 9ATCA 3GCDA 3V1UA 2FFBA 2OBXA 2Y05A 3H0KA 5LOVB 9LDTA 3GW8A 4WXRA 1XLWA 3LUCA 1F14A 2WR8A 1RMQA 3AHGA 4V24A 4WCVA 4XUCA 1KO1A 4H7EA 3BJMA 4BBPA 1OFIA 3W1VA 3FLAA 2JAXA 2YS6A 4LYJA 1QFJA 4C20A 1P5RA 2Q3MA 5ADWA 2VZ0A 2RONA 1XWIA 2PZJA 4KB5A 5F76A 3BGVA 3WGHA 4ZIRA 2FGKA 2YIVX 3WZLA 2D6FA 3BE6A 4RIIA 3D2LA 1UJCA 1VJ0A 4E4TA 1KAMA 3WZ2A 1YB7A 5F33A 1W9HA 3MW8A 4LGYA 4XGIA 2I6UA 1WCYA 1G2QA 1O4WA 3DLAA 5TPWA 4XVRA 4BGIA 3P2EA 5CDYA 1NIJA 2GASA 2KLBA 1YNSA 1GGEA 1EG7A 1R6XA 2FZ4A 4IX9A 3BICA 4MS4B 4D3YA 1B1CA 2RKBA 4JC0A 1DXOA 1KGDA 2GVNA 4OBEA 4ZI7B 5LQRA 1AA6A 4Q7QA 1KIFA 2QRPA 1YRLA 2FNAA 1EFUA 1KO4A 1IBCA 3DZKA 5JZOA 4Q3KA 1H0KA 2QVCA 4Z49A 1I4DD 2Q2VA 2V54A 3JQAB 4TUYA 3LOUA 3LV8A 5LB2A 3FPSA 3LWZA 4XA8A 4K3VA 1TJ4A 3ADDA 2FCRA 3JPWA 1G55A 1CIJA 1PEKE 3K9GA 4H1VA 4O4LA 3CJQA 3LP8A 3B1VA 3EXAA 4S35A 4OJNA 5D85A 1IY9A 4PG7A 4Q3AA 4C2BA 2QD2A 3OQ1A 3GBVA 1GU7A 2YUIA 4FBMA 4P3PA 3ZJYA 1EWKA 1D0SA 1NY5A 2J3MA 2P8SA 3TNDA 3PXBA 2GJ8A 4FEGA 2QMEA 4FYHA 1H42A 3QLVC 1FNCA 2GILA 5IS2A 1E98A 3RYHB 2VAMA 4PFQA 3ESRA 3PUKA 3WGIA 1RWMA 3FCUB 4LOIA 4CFZA 1HEIA 1C14A 2H59A 1OH6A 3B20A 1TJYA 2CLFB 1I80A 1Y1RA 2C5FA 2QYOA 4MAFA 4CXMA 1EFVB 2X1HA 3OCYA 2ZR0A 4RV9A 1SWVA 1SXJB 3RHFA 2CHQA 2CVFA 3FA2A 5ALFA 1AKEA 1IWBB 3MFQA 5HBRA 2BFCB 3C45A 3TMYA 3UA3A 3WIBA 1QCCA 1CLEA 1J2YA 2F67A 1SN7A 1L8QA 3CPJB 4PLGA 3RHTA 1W0KD 3U0BA 4UUQA 2HDOA 4YAJA 5JD6A 4R01A 1DZ3A 4NF2A 2JFPA 3ZEIA 3CO0S 3EF1A 4EY5A 1KDVA 3TPFA 3DVLA 1NP3A 4OQYA 4YJ3B 1EHIA 4GAEA 5ESDA 3TRHA 3VQTA 3CH5A 1R37A 1CNMA 2GRAA 4G5HA 1UXIA 4US2R 3L04A 1UDRA 1WD5A 1SGWA 4REQA 1GVNB 4TTIA 1BYUA 3FD8A 1V9LA 3PNLA 4KKVA 1EVEA 1PDOA 4BXOB 3AZOA 4JV5B 1CQIA 1XROA 3BULA 4M0PA 2F64A 2PGIA 2R86A 1E79D 1DIAA 2VHVA 5KOJB 1RJ9A 3EGIA 1AQIA 1R0LA 2W6PA 1TTHA 2YN2A 4US0R 3V97A 2ZCUA 5LA6A 2GH1A 4KJXA 4MVJM 4MWCA 1DTSA 3N8HA 4Q16A 4WECA 5H81A 5FTLA 4FM9A 4MH0R 3F47A 2Q8PA 3D7NA 3BKWA 4BDTA 4N7MA 3UENA 5KKNB 5BSVA 1F8YA 2VKTA 2ZTHA 3D4BA 4B6GA 1IBMB 1EGQA 3P9ZA 5CB4B 3ONDA 4XJTA 4L3OA 3WLHA 5FUWA 2WU4A 3ZLUA 4DUGA 3P19A 2ZT7A 1E1DA 3ANTA 1R88A 2Y3IA 1EWVA 3OZ7A 1MA3A 4BO5A 2BGTA 4DPKA 2V3CC 2C5GA 4Q7KA 3R76A 3KHTA 4ZVKA 2G9VA 4GC5A 1VCHA 2AEEA 2XQIA 1ZVKA 1ATIA 1U0LA 5BN3A 1CQIB 2NPOA 2OA0A 4GYWA 4BGUA 3EGWA 2RBGA 2HB6A 1P6QA 4NSNA 3VZBA 4YALA 1T3SA 1U28A 3VZRA 2OHVA 4MEJA 3SYLA 1U7ZA 3DBLB 3GCGA 2VUIB 4DUPA 4BEWA 2PKQO 1WBBA 1RC0A 1PJ4A 5I45A 1Z5ZA 1SZCA 1O6BA 3VZPA 3SGLA 3CKLA 3VDQA 5ICGA 3BYZA 3D0OA 2XYVA 5LWHA 2A5GA 2VHJA 3U7HB 4FS8A 2DVMA 4A9AA 3EPHA 4AP9A 5I7SA 2GAIA 1GUYA 3DDNA 4UATA 4EATA 1O0CA 3IAEA 4D7AA 2F6RA 1BXGB 4IG9A 1OBHA 4JBWA 1UXGA 3AYXB 3ZLJA 5CDTA 2W2KB 2QR2A 4MVJA 4LZPA 1BW9A 4C0LA 1HTTA 1WF6A 3KL2A 5HF6A 3SYTA 3JU3A 3NM6B 4TVBA 2EKQA 2XODA 3GG9A 1FFEA 1C0KA 1T1EA 5CW1A 2TECE 2ZKIA 1AGNA 5AOBA 3DBVO 3K1AA 4KUEA 3C7CB 3IO3A 2ONKA 2F48A 4EG3A 4OU5A 4M2LA 4QNMA 2QM8A 1T0HB 1U5BA 1UEIA 5K0FA 1FC0A 4BVBA 1R4MA 3L7YA 3WIVA 3L9WA 3MINB 4BOYA 1I0IA 1LQ2A 3V80A 2A0UA 3BCSA 1TMGE 3OI7A 3SQMA 1HNXB 3TE7A 4O2AF 1XPUA 2O3TA 2UVDA 4R1NA 1LPNA 1IJEA 1DBVO 1P4AA 1BIFA 1US8A 1AVTA 1H3NA 2HBZA 1E6CA 1VDMA 2I66A 4P53A 1ZUNA 4JBXA 4MB0A 3ZCPA 1MJGM 2RH4A 5M5BA 4RNCA 1QFXA 1J6UA 4NESA 1ORTA 3CWZA 4BE7B 2EQBA 2I2AA 1XCLA 1SXQA 3PFBA 1EZ4A 1VI5A 2D0IA 2Z8ZA 1I10A 1QH8A 2R47A 3LWNA 4Z9XA 4KHZA 1BE6A 1O94D 1YZUA 2VO1A 4M36A 1CJKC 1L7BA 2XOKA 2QV7A 2IDMA 2ZRDA 4JR0A 1VI6A 2OBLA 1Q0ZA 3UXYA 1EGMB 4ZI7A 1WKCA 3DPSA 3ISTA 3L6EA 3EY4A 1PZFA 3IUSA 2H1CA 4DS3A 2O57A 4FFOA 3ER6A 3RV3A 1R0YA 1WMAA 1E0JA 4PV7A 1T9GR 3B9BA 3G8DA 3NKFA 1DLJA 4NH4A 1UMKA 1T26A 2ZXEA 5FO0A 3QITA 4ND2A 2RAPA 3X1MA 1IM8A 3FZQA 1GKUB 3HCAA 4BVHA 2GR9A 2X3YA 4FB5A 3I30X 4E6PA 2QT0A 5AW6A 1ODSA 5FBVB 2IPXA 4LFCB 2UZAA 2DHEA 4I2NA 3DPUA 1PK7A 1E1RD 1YCHA 3CEPB 3Q9SA 4AULA 4BVKA 3OZBA 1QV7A 3STYA 3OM9A 1RCUA 1PIWA 2NTVA 3CNEA 3GGDA 4TYQA 2IZ0A 4XWAA 1MA0A 2VT3A 3ENNA 1QF6A 1L4LA 5AOAA 4UUPA 3LP5A 1NC3A 3IT1A 1GILA 3HVJA 4WOCA 2EKBA 2R751 4JHLA 2CHGA 2FFRA 3P0EA 5CTJA 5DHSA 5CXUA 3PSAA 5JRZA 1DX4A 1GLVA 1NBEA 3MCVA 3IP3A 1DRVA 1GEEA 3HDTA 3MD0A 1ELOA 6ADHA 1XDZA 3U7JA 1DBRA 2J3EA 2OCPA 2Z8YA 1E69A 1RI5A 1QORA 2AI1A 3A6EA 3RVQA 4TRJA 2WFMA 4F04A 1A4XA 1SNYA 3QPUA 3KQLA 2AOVA 4ZDKA 5A4IS 3ZDBA 2NNWB 1J0AA 1E4EA 2RHTA 1AQNA 3PFKA 2B9VA 3ZJTA 3WADA 4CLXA 2WD8A 3D8BA 4LNHA 1BS1A 4QRIA 4Z7OB 3LBNA 1KTIA 1GAJA 2PUBA 4A16A 5BUSA 1L7VC 1QHIA 4EWLA 5ITZA 1BDBA 1VB3A 2P91A 1BDJA 1O6GA 2GESA 1QO9A 3HR8A 4TVOA 4XX0B 1SBZA 4BZPA 3T3NA 3EE6A 1K06A 3CR7A 3HWWA 2FSSA 1FUIA 1BXZA 2LRHA 4QPPA 1U0HC 1ABEA 1TPZA 1TVMA 1TUGA 1O2DA 2PCJA 2WF7A 2QXTA 3W05A 2HO5A 4HNVA 4RESA 3WFZA 1JAIA 3TF5A 2NZUG 2ONZA 4K9MA 4N0DA 1UBKS 4ZFNA 4CMEC 4HGPA 1MAHA 5GM2A 3UBTA 1YRHA 1GEGA 1U8CB 5F21A 4EI7A 1JR6A 2HLPA 1I3OA 2R48A 1FRQA 4RCZA 1RYNA 4GMDA 1SRQA 3EIQA 5JQGF 3PQEA 3NHBA 1NKTA 3K6RA 4Q4HA 3M34A 3NHSA 4NI5A 5J40A 3NDRA 5C3MA 5DOVA 5KWIA 2OVFA 3W2HA 2V3WA 1U7TA 1J5XA 4GPD1 4JLVA 4Z4IA 2E37A 3OQHA 1SBHA 1L4YA 4QVGA 4CJXA 1EVIA 2V0GA 2UXDB 3L6UA 4JJFA 5BN3B 1MB9A 1NYLA 1N92A 2W8ZA 2ZI4A 3O1LA 4U5XA 3UKDA 1LXCA 2Q4OA 1IQUA 4GLBA 3H2JA 3GCXA 4IIVA 3KQVA 4BNIA 4CKBA 4KW7A 1LJUA 2JGIA 1IXZA 1R8YA 1T3ZA 2C7BA 4RJJA 4UJ5A 2CV0A 4FLEA 5D1NA 4XJSA 4L5CA 2F3TA 3TCNA 3IQZA 2QQ5A 2CNOA 1PJLA 3E9NA 3R7NA 1R2QA 1F4PA 3L7BA 3MS7A 4RKWA 2RHOA 3D8RA 5EHGA 5ERYA 3WJ7A 1TCBA 2V74B 5IWCA 2HY7A 3K32A 4KX5A 1N3YA 2QNRA 2FMIA 3P9IA 2OFFA 3RAEC 3GAMA 3B9PA 4PQRA 4K3UA 5FEMA 4INPA 4JI7B 2IOQA 4XD7A 5BQOA 2HA7A 1TD1A 1O6FA 3G79A 3TQSA 3JQEA 4WEOA 4CQNA 1NT2A 2I2XB 2IDZA 4KWTA 1CNFA 5DTMA 5DTIA 3M6FA 5TY0A 2FW7A 4WX2B 1N9ZA 3Q6MA 4HGOA 3EARA 4MVYA 5KTRA 1U98A 2XWPA 2D2FA 5CIWA 4CQLA 4QPDA 5E95A 1Q7RA 3GFVA 3UJCA 3CH4B 2HAEA 4XCQA 4ZI2A 2CEKA 2NGRA 1LSUA 2NSHA 2NZYA 5A4MS 2E5WA 3RAFC 1G59A 3ZVKA 1HDZA 4J03A 2H5LA 1ESMA 1XAHA 3IV9A 5BV1A 4BB6A 4CZ2A 4ENRA 4Q0MA 3OTIA 2HH9A 4RJKA 2WM9B 4FYPA 2NSYA 1JN0A 1MO4A 2CDAA 3PITA 4G2NA 4HZUA 3AJDA 3E18A 4C0XA 2IYRA 1G66A 2G36A 4GE3A 4YASA 1KDTA 2JDIA 3QLJA 1AJEA 4PSUA 2DUUA 3NCTA 2PSHA 3IFSA 5EQDA 1DXQA 3D2BA 4KWEA 5FPTA 4I1OA 4MO2A 2BUAA 2VWQA 5EJ5A 5G1OA 1UPCA 3PDUA 1KH2A 4BX3A 1AX9A 2B5WA 2CB9A 2JGEA 3GVHA 2GARA 4TXLA 1V25A 3TW4A 1KOGA 4FYWA 2PKCA 1WQ3A 4JJ7A 2GERA 3LPCA 2AK3A 2VI5A 3GUZA 3IIMA 1V8BA 2HRBA 2P4SA 4IKEA 3GD7A 3OHMA 1N6KA 3BZBA 4WL0A 3UT0A 1X92A 4FDUA 1JTVA 1M76A 4HYEA 4A2CA 5HILA 4F1JA 5EVCA 3ZWKA 1CS0A 1YWGO 5KNDA 1Y8ZA 1WVMA 3M6MD 3B8HA 1I2MA 1EHCA 4YAOA 1KMQA 1SCUB 1BWSA 3K31A 3OFSA 2GAOA 4BV2A 2Z9CA 3O3MB 5G02A 2X19A 1QIKA 4X1IA 1AO3A 4OVKA 2PL1A 3AESA 1MHTA 3PGA1 1NW8A 2E85A 2EZTA 2W6ID 4P7GA 4KI0A 3UAXA 3NBAA 3QG5A 4NBWA 4ZCSA 1ZM3A 1F3LA 4NECA 1QGZA 2H1SA 1ZMRA 5BQPA 2FDCA 2UUPA 2CDBA 1N2EA 4MOWA 1VLQA 1TC1A 2BM1A 1B6GA 4I4TB 4O2RA 3UCEA 2WJ3A 1QG4A 1ZAKA 4G5RA 5DDIP 4GR9A 3ICOA 2GFIA 4R05A 5E6RA 2YJTD 5IKXA 3A28A 1C7EA 1OGJA 4NG4A 4Q3EA 3FYUA 2PGLA 3CJTA 2RGUA 1QWOA 4NE7A 1SHUX 2DF8A 3BGWA 3NRBA 2QP9X 1TEHA 4WK4B 5JDCA 3GWZA 2G82A 1ZUHA 3KS9A 3P8ZA 3NBXX 3DP7A 5K8CA 3IEPA 5CURA 4GQAA 1M6VB 1XEFA 3S2SA 5F64A 4QU5A 1J8MF 4Y2RA 2X0NA 3AHEA 4NK5A 4D25A 2QLNA 3FAKA 1CETA 3B8EA 3R3XA 1V47A 1R3DA 1Z2NX 4Y6RA 3LT5A 2V9CA 4CE6A 2VXOA 4LHXA 5B55A 5DJ5A 2PJRA 1P1RA 1GRCA 4PYQA 3BWVA 3K5IA 1FRFS 1N9GA 3TW8A 3KSRA 2H8GA 3QK7A 3WMFA 4GMHA 2XCOA 3RG8A 5KYKA 3CRRA 4RAQA 2FLVA 2CUZA 6LDHA 2DHQA 3A10A 1CUUA 2C07A 3BE5A 1V3QE 3GL9A 1N2SA 4E1AA 2PT9A 1ZN7A 4JGGA 3WGVA 4DLSA 3PJEA 4CEIB 1YQDA 1TEZA 1FIUA 4K0KB 2OK7A 1QP7A 4B0PA 3WRYC 5KX5B 1SU7A 1GNQA 1GA4A 1YE3A 1O96A 3H6KA 2RH8A 5JAMA 1G5QA 1VTKA 3LSTA 4W5NA 3K16A 3OLZA 2BMFA 2VF5X 3A2MA 3BJZA 1UEXC 4EI9A 3L1IA 1LX6A 4R98A 3E53A 3NC4A 2NZJA 1FCJA 4B6FA 3H9JA 4P4TA 3TZCA 3GJ0A 3AY0A 5ALDA 1G7SA 3ZQ4A 1EXVA 1XJCA 4QREA 2ACKA 5K0ZA 3JAMA 1DOHA 2AJLI 2JFHA 2BW0A 1FRZA 5IC6A 3H7IA 4YJHA 4B4DA 5ETJA 3OZCA 1N5OX 5A3JA 1I3KA 2O3JA 2ZVDA 2UUBB 1LFAA 1KH1A 2QW1A 2NO9A 5IVIA 1AN9A 2VNSA 4LV6A 4NDZA 2WU8A 3MWJA 4HWGA 4BNNA 3MCAA 4RPKA 4EO4A 3T41A 1ORVA 3WLRA 4RVNA 5E1MA 4ZVSA 3RH0A 5DCUA 1PGJA 2OGUA 3SVTA 2HNBA 3K0FA 4WLUA 3C3JA 1A9PA 3BAFA 4HAZA 3RYIA 3FUVA 5C2JB 2PD6A 4FOTA 4YMTA 1Z3IX 1W5TA 2FB9A 4BCDA 1NT4A 2F59A 3LDHA 5A4KA 3N8GA 1PFWA 4ZALA 1FXWA 4LDRA 3WGMA 3H19A 1WXIA 1PS0A 5HE8A 5KWJA 5MFZA 2DJ5A 1E9VA 2Y77A 5EZYA 1HLGA 4CIDA 3Q72A 4KFRA 1OH7A 3S68A 2PX6A 4B6QA 1O9HA 2FKAA 3HA7A 4ND5A 1M6EX 3JX9A 3DLIA 5EUMA 5FAXA 2FUG1 3REGA 4FX5A 1AY0A 5GONA 4ITUA 3JZMA 4LJLA 3FSGA 3OT4A 1Z7WA 3JTEA 4Q4JB 4C5BA 5EYPB 4CEJB 4Y2JA 3KJIA 4GP9A 4L3WA 4C03A 4CM9A 4H4CA 1J24A 3R0ZA 2G4LA 1IZ7A 4V0MA 5DFAA 1TA0A 4ZCIA 2IEIA 3GQBA 4NHOA 1WKBA 3B7PA 4FNMA 3R7BA 3WMRA 5JIBA 3MJFA 2PHZA 1G1MA 1FP2A 1DC7A 1PZHA 2I2DA 1OR8A 4I1VA 4L5AA 4WY2A 4EHKA 4Y67A 1G9TA 2X5XA 3C85A 2AR7A 4R9NA 3ND9A 4MO9A 4RHYA 4TGLA 1KFCB 2QX8A 2R6FA 2XQVA 3B6EA 2NUBA 3A1EA 4AX8A 5C4MA 4XSHA 4QPZA 3HCEA 1Q6YA 5ALUA 1Z8DA 4HAOA 1L5WA 4XYMA 3ESAA 4X95A 4RACA 2QXYA 1P75A 4CIBA 3B78A 4R6XA 1SAYA 1FVFA 3F2IA 4UTOA 1CZRA 3T8YA 3Q5GA 3R3JA 4FZRA 3MTAA 3ZIAD 4DYDA 1E3SA 2XWSA 5JNTA 1E5XA 4OX9Y 3FOCA 2NU6B 3Q8XB 1CY2A 1P18A 4TN5A 3FUTA 2ZWMA 4MICA 3JQRA 5HM6A 5DHRA 4D9EA 1WSDA 1R0SA 1II0A 1YULA 3R24A 4MI3A 4FOOA 3MWDA 2YNMC 5AOVA 3H42B 1K5HA 1XHEA 2Z95A 3ESYA 3GFBA 3NHZA 3VDMA 2J7KA 1KVSA 1M8KA 2PX4A 5I9MA 4JXZA 1L7NA 1I01A 1V5GA 4NBKA 3ZWXA 3Q87B 4F2GA 1MU0A 3PHBE 5KREA 1Y6FA 3D31A 3OZIA 5B1DA 4YFVA 5F35A 3WK5A 1KDRA 1E64A 1SBNE 3FUUA 6REQB 3VFDA 3O75A 3OZRA 3TXAA 2H7CA 8OHMA 3AJRA 2J0SA 1NL3A 1M72A 3QU2A 4LDNA 4PS0A 1EB9A 3EXFA 2W0MA 3QX7A 1PJBA 4M1EA 1DEAA 1T3LA 1X0VA 3RGGA 3Q7SA 4N8SA 1E1QA 3NASA 2PZFA 4KDRA 5BW6B 1E1QD 4YREA 3C5HA 3DZHA 4LRUA 1CJVC 4N3AA 5AFSA 2AJCA 4LRXA 1RPJA 5I5GA 2AFIE 3KT6A 4WLEA 1LUAA 2XUDA 3PIDA 2E55A 1GVHA 2X41A 5JD4A 3L06A 4JI3B 3UB4A 1QHFA 3YASA 1WETA 1IJBA 1DDIA 1L8AA 2LIPA 2QUZA 3ESCA 2W00A 3LLUA 4MUGA 3LT1A 2VA9A 4MWTA 4Q1VA 4RFSA 3I6MA 5FD8A 4L75A 2ZATA 2HA0A 3N2NA 4RZUA 3NV9A 1KK3A 5CFPA 4LZZA 4RD4A 3RS7A 2NADA 5BV7A 1Q22A 1P61B 1RJWA 2ZIXB 1NXQA 2XDQA 4UEQA 4URHA 5G4KB 2DQZA 1DTWB 3HN2A 3IHWA 4CBVA 4ZYTA 3KOMA 3LXRA 2EBUA 2GT1A 2IHVA 1AHPA 3RQIA 1O94A 2JATA 3MGCA 4ZICA 5A62A 3FMOB 2ZIEA 3WMXA 3T5MA 1EFDN 1GHTA 2VP5A 3TKAA 4AW9A 5HVNA 5BO5A 3ISVA 2DOKA 1YJ5A 4PZ0A 3HJCA 4WCFC 4BAZA 1K1EA 3BWCA 2YICA 3BL5A 3N1UA 1ITZA 1QJ4A 4TKMA 5ES4B 1JB9A 1F4LA 1ID8A 1VL8A 2YDXA 2P9GA 4IUDS 3H9QA 4F5DA 5LXTA 3E0QA 1WPXA 1GDDA 2YXNA 4H1HA 4ZXFA 4CHTA 5AESA 4I0WB 1C41A 4N8EA 2WAOA 4KQKA 2JGRA 3PXUA 5LDHA 1FTNA 2CY0A 4PGGA 1KTVA 1RZRA 3U48A 4LQCA 2Q3EA 1KVTA 2NZVG 3HLYA 5CYGA 621PA 3ECCA 1PR1A 2EEZA 1A3CA 2B8EA 2RC6A 4RGBA 2EJCA 4Y9SA 2WU0A 3V42A 2DUMA 2R2GA 5I3ZA 3K70D 4UDYX 4MUKA 3X1WA 1EX9A 3T3OA 1Z6QA 4MEAA 4UFPA 4C7MA 4D82A 1JR2A 1NXSA 3EBPA 4ON9A 4JI1B 1CZNA 2BFDA 2VCYA 2VDQB 3BWMA 3I72A 3DEJA 1VXOA 3LQ4A 4O4JF 1FFYA 1G0NA 2AMYA 2QY9A 2FPLA 2NUTA 2JLYA 1QU2A 3JQPA 1BX3A 3EGXB 4AZWA 3WWPA 3I5MA 1PQYA 3RU9A 1K6JA 4NMXB 4Q9NA 1DMSA 1ZIOA 5KVAA 1CUJA 1E66A 2WILA 1SWWA 4J3NA 3FJ1A 2P77A 1OXVA 2RGWA 4N5IX 1HL7A 4LAFA 1SBQA 1FVOA 2K4MA 1RI2A 2ZWIA 4B3DA 3CZRA 3OLYA 1FXUA 3S5JA 1BQ4A 5BVHA 1GUBA 2YY7A 2VDUE 3LO8A 2HD4A 2NUPA 1IEXA 5LCXA 5SY9A 2IYPA 7ABPA 1OXUA 3OEYA 4CT4B 2WA2A 1R8JA 3SN6A 2XGJA 1K8RA 3ZK7A 4TKVA 3THRA 2QM0A 3LHIA 2UTGA 1BS9A 3V4SA 3QU5A 2WB2A 3RRMA 1DEKA 1UBHS 2WIJA 2JPDA 3MT7A 1Z8HA 4IINA 5J4LA 3GLFA 1XKXA 4O63O 1QE5A 1RVDA 3JQFC 1J33A 2ILVA 2HU5A 3G7NA 3TI9A 4KFCA 2Q41A 3UK1A 3R7WB 3ND8A 1MVLA 3ANMA 3C3WA 4JJ6A 2IYXA 3N2GB 4ALIA 2HHCA 1EB8A 3HVHA 3TD2A 4PRLA 5JXIA 5AHWA 3ROMA 3DTVB 2P5YA 5AI6A 3ODGA 1DJLA 3PDIA 2C2MA 4QLOA 2GBFA 1YJBA 5FH9A 1RI3A 2JLRA 1GAWA 3FWYA 3W2FA 2A14A 3W1WA 2P41A 4P38A 3KPWA 5BT8A 1X1DA 5JTUA 1ULSA 4QM6A 3E9YA 3UHFA 3IMFA 3EZNA 1XEXB 1RKUA 4BO1A 3LCVB 4RZXA 1VE1A 2H57A 3I76A 4NBVA 2NWQA 3JARA 4YYZA 1KI9A 5B36A 1NBMD 4XTRA 4C05A 3ZI7A 2A9VA 1YL5A 2PSSA 1Y3FE 5ECDA 1CK4A 2IXGA 3BMQB 2EG9A 2OV6A 2QROA 1LX7A 4AB1A 5JEDA 1ZIDA 3PL1A 3AUJB 1LWOA 3CUYA 1IN4A 3BIXA 3MN1A 3E8XA 4JC8A 5HUQA 2AJDA 1Z5OA 3M0EA 4F9GA 2I71A 2JAWA 5DCLA 1FW8A 3BZUA 4JI5B 4AG5A 1XD2B 3ETEA 4M0DA 3AMVA 4N65A 3RUEA 3OCUA 4GMKA 5K8VA 5CLHA 3H7AA 5BWLA 2A58A 4BGDA 4YAEA 1OFUA 1BN7A 4X94A 1Z12A 3LUFA 1OYVA 3UOWA 4NAUA 3ZU3A 4WA8A 2IBMA 4KVAA 3A58B 2Q0XA 5BMVF 1L9XA 3R2JA 2WSBA 3CO5A 4KBGA 2CDRA 3CRZA 1KE1A 4H27A 1DFIA 3IYLW 3PUWA 1WQ1R 1RXUA 1XELA 3L8MA 4B8WA 4BVEA 3PA8A 1CBUA 3KYBA 2CK3D 5SY4A 2MYTA 1EVZA 2DY1A 3EEBA 4EHBA 4YI3A 5DULA 2AG6A 5BOVA 4M88A 1F0PA 3E7XA 3A0UA 2IDKA 2O8FA 5EE5B 3ZWQA 3F7MA 1QNFA 3LUGA 3ILVA 4D44A 3ZCVA 2JZNA 2EW1A 3FR8A 3R3UA 4BN5A 3PXEA 4OG2A 1QBGA 5CT9A 3C87A 4UMFA 1DMRA 5A02A 1R0CA 1XZIA 2VK2A 1SUCA 3JASA 3O4FA 4MVJP 1LEHA 4M3NA 4JLKA 4OF4A 1JIJA 4QA9A 2AYXA 2PWAA 4IQ8A 3R5XA 4WXEA 4EMBA 3C4JA 2DE0X 4L16A 4WESB 1OASA 1NG9A 3EZYA 2WKPA 3ANYB 1K88A 4XFKA 3NRJA 5J5AA 5I9NA 4TVKA 3FKQA 3RS9A 2ZBPA 1T1IA 3N0RA 2J09A 3R6GA 2AUNA 3M3PA 2O5VA 2H00A 1N0WA 3GWGA 2YL2A 2FFHA 4MHSA 2QBYA 2OY0A 3LZ6A 3QXXA 3G9ZA 4UREA 3GLFE 1OI2A 4AVYA 3PFCA 1NI4A 5AI4A 1BMDA 3RBVA 2X5KO 1EU1A 1W30A 4XUDA 5KCZA 2ZZNA 2C2GA 3NVDA 3ZZ0A 4JLWA 1WULS 2Y1CA 1T0PA 2VBCA 2JDID 4D8TA 2VWGA 3IBYA 1LDMA 2VJQA 1N6RA 4B7ZA 2OK8A 3AKCA 1IUKA 3HZHA 2FXIA 4TUYF 1XLUA 4PSAA 4ER0A 3ZZNA 1DT3A 4I9UA 1EYZA 1HC7A 4QOGA 2IZ7A 2A0XA 1TA4A 3PEUA 3IQGX 5JOQA 1JU9A 3QUTA 1PT7A 2VK4A 2ONCA 1QONA 1KAHA 1TCAA 2PJDA 1W49A 4TQGA 5AMXA 5EWLA 1X7ZA 5FI5A 3W8DA 4A8JB 4QDJA 3LECA 2GLTA 3U4DA 1FDWA 2HU8A 4OIMA 2EAUA 3AHDA 4DSNA 3EPJA 1CFJA 2WWRA 3IAXA 4YV1A 5HXAA 1Y3AA 4UU8A 3IPXA 4JHXA 3N05A 4ZT6A 3L49A 2NU9B 3AR4A 3LHFA 3WSTA 3NGMA 4AC9A 1EVYA 2A3RA 4GRDA 4IR7A 4S2EA 5KVCA 4I4NA 5LC1A 3DBHA 2R44A 5A1JA 3TFOA 5C5IA 2EHDA 5CPFA 4M21A 2K6GA 3SU8A 4ML3A 1S89A 3IKVA 4EBFA 2EFEB 4X54A 4YEDA 3U3MA 3CIOA 1T2FA 1UQUA 4BWFB 4LRQA 4DIOA 2VLIA 2X1VA 4GKKB 4IRMA 4MRMA 3D2CA 4A8JA 1G60A 1Z0ZA 2ZQYA 5BN5B 3ESBA 3OBIA 2O2IA 1AURA 2ZBFA 1PQPA 4FJ1A 2LDXA 1M75A 1BC5A 4YV0A 2XBMA 4NJMA 2PD3A 4CEIA 1HL3A 1HBJA 1DKMA 4NYJR 4ZQBA 2WQ6A 4D3DA 1ECPA 3KO8A 4DIEA 1XNJA 2PJZA 2XDYA 2ZSUA 2XCIA 4DTCA 3NOOA 1QFSA 2ZRAA 1GCOA 4DILA 1E9CA 2OHXA 2P6OA 2QAJA 4RZSA 1UFQA 1E77A 5FT9A 5K3FA 3U80A 3B1YA 3W5HA 2NN3C 1DFHA 3H2GA 4RTSA 1ZC4A 2ORIA 1TQHA 2B1GA 3GZ4A 3K4QA 5ALJA 4S04A 2OXEA 4L9SA 4WBSA 2XW6A 4FHEA 4L85A 4L8YA 3BWDD 4PHGA 4L51A 4TN1A 4J07A 2VNIA 3LPMA 2W71A 4MV8A 3CZPA 2PUHA 3DMFA 1O6ZA 2A3NA 3PF9A 2ZBQA 1M1YA 1USVA 3ROZA 3UH0A 4A1FA 3R3YA 5DYIA 5KTYA 1R5JA 3C3EA 3FMFA 1UPBA 3I04M 1W2GA 2GN0A 2QD4A 5DTRA 1QVRA 1RQRA 3IVGA 4EB3A 2Q99A 1VPDA 1RAGA 1QLHA 2EERA 3G2PA 3H1TA 3LW8A 4XSGA 4LX8A 4Z7NB 2FG5A 4Y0NA 4LCJA 3AWIA 1MPXA 2F9LA 2G0NA 3NTLA 4DMLA 2IXDA 1EESA 3HWSA 3ASUA 4WGFA 3AKEA 3B70A 3QEOA 1VLHA 3W3AD 2OKCA 4KRYA 3RW9A 2R1TA 2YWJA 2PT6A 4FPXA 4DDHA 3LYHA 2DH6A 4NLLA 1YBMA 1I5EA 5IKMA 3PLAE 4V0OA 4B7CA 2B69A 4UD2A 4FKBA 4XQ9A 4JL6A 3E35A 4E5MA 2B6HA 1DRKA 2GZ2A 4EFLA 5CP8A 1NASA 1NX9A 1JBKA 5DBIA 2Q3FA 1RI4A 1BZYA 4ZU1X 4FYMA 1V0JA 4EKYA 3J7AC 4N6OA 3I62A 1TW2A 2Z56A 1G20A 2ZYVX 1FX0B 2HK9A 1DKNA 2B1JA 3FDZB 1JWLA 2C7GA 1SXHA 5CA0F 3H5LA 2AMLA 3K1JA 4LJKA 4XGKA 3M5WA 4YBZA 2A30A 3I92A 4OHBA 4YO7A 2R0QC 5F1KA 2GM4A 4GOKA 2JF0A 1X1QA 2AH5A 1Y5NA 2ZPTX 2CK3A 3ZHZA 2YKGA 5KX5A 3OOSA 2OPHA 1KO8A 4OQXA 2HF9A 2PNJA 1A96A 1Z8FA 1UMCA 4Y30A 4ZO8A 3DEZA 2GO1A 2M32A 3B52X 4HPXB 3D3KA 4G5XA 2VJNA 3WKDA 5DNCA 4DY4A 4MVJF 4EYKA 4YCNA 4AUKA 5DN9A 3GN2A 1GD1O 5DWVA 5JZVA 4PGMA 3LCRA 1GPJA 1I9GA 4ZKDA 4NCAA 1CJBA 2ZOSA 4QAQA 3ZNPA 1PX0A 1T13A 5LQCA 1PJSA 3O3NB 4OXXA 3IHTA 2XPCA 3HADA 2C00A 2H7XA 5CAEB 3SWWA 3VYRB 4H7KA 2HCRA 4AN0A 1DTEA 4W99A 2ZKLA 4ZDJA 1QQAA 3NP9A 2QRHA 2X9LA 4J1QA 4UEOA 4W9MC 4LGCA 5AJVB 4LNUA 3S2YA 1Y9EA 1I7LA 1T36A 2VF7A 2Z4SA 1T8RA 3W9UA 4LKOA 2ROQA 2VDRB 3BF8A 4OGFA 4DJAA 3LCJA 4JLDA 3IP5A 3L6BA 2FOXA 4FT4A 5K01A 2YXLA 5BN4B 3DFUA 2HU7A 4J49A 1M1XB 4TWRA 3MUNA 4ZO7A 1ESNA 4IL5A 1Z28A 4R2MA 3A4IA 5IDQA 3ZHRA 1JAXA 4KR9A 4MIOA 4P83A 2ZDHA 4OB6A 3SY8A 4A92A 4BC1A 4RELA 2HLNA 4CYMA 4GOJA 4YRQA 3RC7A 4AICA 1ZKMA 1AH2A 1N25A 1N6PA 2O8CA 4X6LA 2P4UA 3CLVA 2IWHA 2GPJA 2PMWB 2B4YA 2Y68A 4Q1BA 1O4VA 1TM2A 2ZJZA 5KNLA 4YCBA 4BU0A 3KAJA 3E0XA 3P0FA 4EL0A 2ZUDA 1I1QB 2XB6A 1T1GA 4LRTB 4M54A 3T0GA 1MVOA 3I6IA 3P20A 4PZEA 4CEJA 2IH4A 4JS0A 2HNKA 1MO2A 1QIGA 3ZWWA 1W0CA 1X1RA 4RADA 2AK2A 5AKYA 3S4YA 2QD1A 2ISCA 4BQSA 2LGJA 1K8YB 3TWOA 1NDHA 1ZCFA 3B3GA 4HDKB 3G7UA 3GQBB 3A1WA 5AVXA 3JQGB 5KIAA 3PNMA 3SR4A 4CNQA 1WCIA 1X86B 2Y6VA 2H4YA 1RJGA 2EL9A 3EF3A 4ONEA 1XQWA 2D4AA 4ZXPA 3WX0A 4F12A 3DMDA 5B53A 3WQHA 1QPGA 1SVOA 2BCJQ 2G9ZA 2Y0DA 1WLYA 4RY9A 3EGXA 3IJEB 4K8RB 2F17A 1MIOB 1Q7BA 3O3OB 4PBSA 1L5KA 3DXYA 1DAEA 1TT5B 2O2ZA 2ZTUA 4IFIA 3RWMB 4NS4A 3DVAA 3UAGA 3ZV6A 1TK9A 4W5QA 2XF8A 4J7XA 1A9XA 1C9YA 3WSVA 4CM4B 1BXKA 1YJXA 3KEQA 4KXNA 4NV3A 1SM4A 3B3QA 5IYZF 1DDGA 6GPBA 3L01A 4GZLA 4KSYA 1WZIA 3OT1A 3IIEA 3KLPX 3RSHA 3ZE1B 5ICSA 5AM5A 1JLKA 1O58A 1Z2CA 2IWRA 1Q0TA 2WU3A 2QENA 1F5SA 4WOKA 3EZFA 2IHZA 2A8YA 2CXHA 2C59A 4K6CA 3NORA 1W1WA 3KLBA 3PDCA 4AN4A 1Q16A 3E23A 1BEUB 5F23A 3INNA 4GDFA 2ZJFA 1FYEA 1JKIA 2D74A 1G8SA 1IQRA 1CY8A 4ND8A 1E1MA 1O8CA 5LP6C 4BP8A 1DUVG 4OJKA 1C3OA 1OYOA 1NATA 2G9RA 4HDMA 4MKIA 1SIOA 1Z35A 3HYRA 4X3PA 1MO3A 1YVDA 2J87A 2PUJA 3GLGB 5A6VA 5IH7A 4ACBA 2BUBA 1Z4PX 4WE3A 4KFSA 4GNRA 1UTRA 3OAAA 1RAFA 4WKNA 4D26A 2ZBGA 1GKIA 2PRJA 2R5FA 4DXAA 1XNRB 2OO5C 1DFGA 2HK7A 2NXEA 1ULHA 3DMYA 4MLZA 4AIRA 1F38A 3ZCTA 2GTIA 3WS7A 5J2TF 3EA0A 4FE3A 2P27A 1QQ6A 3VTAA 3HNRA 1AB5A 3M81A 4DKXA 5BNWA 4RPHA 1W36D 4WN9A 4AKTA 3BTUA 1L7PA 4IGAA 1NMQA 2GCGA 3AYZB 4NONA 4Y2YA 4M37A 1PYDA 1UK9A 3HH8A 3WICA 3UOGA 4BNYA 1I7PA 2W0SA 4W7IA 4FFLA 1RQNA 4B84A 4B3CA 4K6KA 3ICPA 3TQCA 4KRGA 5GJWC 2B92A 3PXGA 1E0KA 5BPFA 1M1NA 4QICA 4DDTA 3VKHA 3KFXA 4H4EA 2CLDX 4QGAA 2BZ0A 2D0PB 3B6KA 3D59A 1E9FA 2QZ9A 4E5KA 1GGMA 7REQB 5HGXA 2ODEA 2Z9BA 5ALPA 3WMEA 3WRYA 4LI3X 1C7FA 1E2GA 2CZCA 3NB0A 4LVCA 3KE8A 3VPXA 3FPGA 4GXNA 4BMSA 4BHTA 5L3QA 4KUHA 2FH5B 5THKA 4EVIA 1EVLA 1XTIA 4TKZA 1QIEA 2AGVA 1BHQ1 1I33A 2ZAOA 2EJWA 5F7XA 5KPDA 4PZZA 2BUCA 1MRZA 3NQ41 3EIFA 3SE0A 2GDZA 2ID9A 3LFHA 4AS3A 1NUQA 2BHLA 5HUJA 3A2LA 3DF9A 4PYMA 4TS3A 3VYUB 4X6XA 1J23A 4B2IA 4BEJA 1G8JA 2DQKA 4KHPB 1B1AA 1A9QA 3L8ZA 2V0NA 3SBXA 4PLHA 3VJMA 3ZHSA 3DYIA 5KC8A 2ZYRA 5GAJA 1QVVA 2AXPA 5JLJA 3FCXA 2IV7A 1MGOA 1YK0A 4Q1CA 4M1ZA 4JI4B 2P2LA 4OQDA 3RTBA 4L22A 3RIEA 4QZVA 4KO8A 3F5MA 3AU9A 3OM8A 4JLJA 4TLEA 2IH2A 2JZOA 3MUEA 3GIWA 3GELA 3N74A 4G9EA 1DC4A 2XR1A 4XIYA 4DFDA 4QJ4A 3RKSA 1J7JA 3MWDB 1PJCA 4FX2A 1B14A 4OBWA 3CV3A 3IPRA 3JV7A 5CXXA 1E3MA 1D6SA 4EK9A 3RFUA 4GX2A 4G4GA 1U5BB 1LWNA 1NBAA 1NU6A 3UXHA 2IYUA 3GEDA 1A8PA 2AQKA 4E5SA 4W6QA 2NU8B 4V3CA 3GT3A 3VPHA 4ATNA 2H0AA 2RCNA 2ZB4A 3VKVA 1DOZA 3TCXB 1KZ4A 1KJ8A 2OECA 2WK1A 4EFMA 1FFXB 1LCIA 3F9RA 4LZJA 3ZHVA 3IE2A 1Z06A 3QEMB 2DQSA 3A6DA 3VDXA 4CMIB 2BMDA 3ZHQA 1AQJA 1VHQA 4E11A 3LQ2A 1OX4B 3TBKA 3AG5A 4ZC8A 4JBIA 1QP0A 3BQMB 2HHJA 1C8VB 4XFDA 5EWMA 4M1QA 4X20A 1M2GA 3DAOA 3GPDG 2B78A 3PEVA 3EHEA 4J3FA 1YIAA 3BERA 1KMNA 1NM5C 2VJDA 1QZ3A 2NZ8A 1ATZA 3HXTA 1RWVA 4Z4EA 3BKXA 3K9NA 5KTNA 3VZDA 4F9TA 3AW8A 5LIPA 1KK2A 1ML3A 2X8LA 3BSFA 1JEEA 1CQXA 1X74A 3RSSA 4J2HA 1TECE 1TVKB 2Y4OA 3BK2A 3LTEA 4CL8A 2IW3A 2C58A 1W4LA 2JFFA 5CG2A 5BXQC 3I34X 4ALJA 2C61A 1DG3A 1NVFA 2ZT5A 4QXQA 5CA1A 5LNK1 3FN4A 1FQJA 1LVHA 4LJ5A 2IOFA 4RH0A 5BN5A 2XMQA 3GGGA 5K0LA 5YASA 3ZU5A 5ALRA 1PTJA 3W6NA 3X0DA 1B3BA 3HV0A 2P5SA 5FPHA 4BZWA 1WWKA 1FRVA 1SUWA 2HJRA 3IDOA 3QJGA 3WO1A 3K53A 3HC7A 2AEFA 2DWQA 1W5AA 4PYKA 2YINC 1P9LA 3CVJA 4P80A 1ZEMA 3QVUA 2Z6QA 2JD0A 5CPBA 2JC3A 1DEXA 1FYDA 2WNIA 4QBKA 4WT7A 3NM4A 1W5SA 3X1ZA 1LK5A 4KR6A 4X00A 3TX6A 1A8QA 3PL5A 3G2MA 3NHAA 1V2HE 2OGSA 2QNBA 4LIPD 5DBGA 4CMKA 3DHNA 4FDLA 3P9SA 2R87A 1RWBA