2WJ3A

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
TDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
molecule tags Oxidoreductase
molecule keywords 1-H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
total genus 104
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2009-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 2wj3A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wj3A01
2BUAA 3U0VA 4DYHA 3A70A 4BDTA 3BE8A 2WUEA 2V97A 3AJAA 3DDUA 3ICVA 5ALFA 2XUHA 1HL7A 1CQWA 4LYDA 5JARA 1IZ7A 4KE8A 4E14A 5JANA 2HRRA 3HI4A 5DTJA 4DGQA 1E66A 2CJPA 4EBBA 5EGNA 1XZFA 1XROA 1BEZA 2YH2A 4J3JA 4KR0A 3WQHA 2CEKA 4BE4A 1G5FA 5SYNA 4G4GA 1WB4A 2DSNA 1UKCA 1LPBB 4K6GA 4HVTA 3M81A 1YB7A 4LKOA 1W76A 5AKHA 5AK5A 1GPKA 2XMSA 5AIBA 1WB6A 3FLBA 4ZXFA 5JAPA 4RNCA 4Y2QA 4QA9A 4CFSA 1BCSA 3DS8A 5ALGA 4CCWA 4D9JA 1P0PA 3EBLA 2OAEA 5HF6A 1UWCA 4O08A 3G9TA 3QITA 5LYYA 4Y2JA 3BF8A 4BCBA 1MO2A 2ZJ7A 3H1AA 3DJYA 4B7ZA 2J4FA 4X94A 3H2GA 1DU4A 4TVKA 5ALQA 1W4LA 2Y2UA 1B6GA 4N8EA 4KACA 1BN6A 2O2HA 4YK7A 5AKKA 2XMQA 1XLUA 3L1IA 5AM5A 4U2FA 1A88A 1ORWA 1ZD5A 2XQJA 4ETWA 1F6WA 2ES4A 3RKSA 4KYVA 1ZD4A 4HTAA 2VTVA 4AMYA 4P08A 4FKBA 4U2BA 1MU0A 1Y7HA 1W1IA 4KRXA 4EA6A 1DWPA 4QLOA 5AM4A 4FFWA 1CUYA 3T4UA 2ZJFA 3IB3A 3I2JA 1N5RA 1EI9A 1YS2X 1UK7A 1E89A 3G02A 1MTZA 3O9MA 4G5XA 1XLWA 1E3QA 4H7DA 3STXA 1T4MA 5H3HA 4QZVA 1GKKA 4H77A 5FV4A 1ZD2P 1HLGA 1I6WA 3H17A 1UK8A 4GHWA 4DMHA 4J0KA 4FLMA 1R50A 2ECFA 3V48A 1ISPA 1CUEA 5AH0A 2QJRA 1ETHA 4UBMA 3PUIA 3D2CA 1H2YA 2HDWA 2V96A 1SOMA 3WMRA 3AIOA 1SFRA 2PVSA 5DNWA 2PSEA 4X92A 3VJMA 1YB6A 5AM2A 3GZJA 2XI4A 5AK6A 4MXDA 5DWDA 2BGRA 4ARAA 4BRSA 2QKYA 5I7UA 1CIJA 4Y2PA 1BU8A 3WKAA 4ZRDA 3AINA 1T2NA 4IH1A 5DTIA 2GYWA 5ALEA 2I3DA 1JI3A 4BCCA 3STWA 5A71A 5AKIA 1XZCA 3SWWA 4FMPA 4JH0A 2HFKA 4HAIA 5EHZA 1AMNA 3PUHA 1TQHA 4WDRA 1XZMA 4HRXA 3DEAA 4GXNA 5T4EA 3ZLVA 1FFCA 4DNQA 3H2JA 1ACJA 5A7HA 4FDMA 1YASA 4FNGA 3PF9A 1Y7IA 1XZLA 4BZWA 2WTMA 4CCYB 4H7FA 5LLSA 1DX4A 1MN6A 4PV7A 4KE7A 1CUBA 1CUGA 3RLIA 1EDDA 4IQ4A 3K2IA 1WCYA 1DINA 1QIEA 1QONA 4B9AA 4FWBA 2DHEA 4X6XA 4ZV9A 4GEGA 2C58A 1MX9A 2HM7A 4H7IA 3D3NA 4DNFA 1WHTA 5DYWA 3IURA 1UK9A 3R3UA 4HZGA 3WIOA 2WSLA 3NOXA 5ALDA 4ZI5A 4OUKX 4U2CA 4ZGBA 2ZYRA 1NU6A 3QH4A 4X00A 1R9MA 1THGA 2X5XA 2Q0XA 1WB5A 5AJHA 3FBWA 3KDAA 1FFEA 4WFKA 2JGEA 3WK9A 1EK1A 5IH7A 4WCVA 3E4DA 3FYUA 3C6ZA 3C8HA 5A6VA 1EA5A 3W06A 3IULA 5IVKA 2Y6UA 4EY5A 2XLCA 1NU8A 3FSGD 5FP0A 3H0CA 1JJIA 2O2IA 5AOAA 5FLKA 3HZOA 5AI4A 2VF2A 5AIAA 1XZIA 1LPOA 4B80A 2HHAA 5AKZA 3WIBA 4PQEA 3ZLTA 4BBZA 1RP1A 4QDTA 4LHEA 5LZ8A 3WK8A 5DYTA 4N5HX 1EVQA 3OG9A 4BVJA 3FYTA 4C6HA 1PFQA 5HQ3A 1MX5A 5K3DA 1GQSA 2ONCA 2Z8ZA 5ALJA 1UOOA 2HADA 3GA7A 2CKMA 3ED1A 3MUOA 2HIHA 5ALWA 3JW8A 2JGFA 3O4IA 3V9AA 1FFAA 4INZA 3V1MA 2RI6A 3IUMA 4U2DA 4L72A 5LZ4A 3N0TA 1K8QA 1MPXA 3WK5A 4TPKA 2ZYHA 2QMQA 5LZ9A 2WFLA 1QIGA 5ALSA 3NWOA 4Y2XA 3F96A 4UBKA 1CUSA 3KOOA 1WOMA 4NMWA 1L7QA 2UZ0A 1DWQA 5AKJA 3VDXA 3WWDA 2ORYA 5JZSA 4GBGA 1VOTA 3D0KA 4QDOA 2AXEA 4UBIA 2YASA 3ESBA 2PUHA 4UHCA 1XZBA 1AC5A 4LXHA 3VJKA 1CV2A 2I03A 1QFMA 1QIJA 4GLBA 4GDMA 5HK8A 4G4JA 4J0GA 4JUIA 4BZZA 2PSFA 2WUFA 3WL8A 1AKNA 4Q05A 4Q1VA 2R8BA 2XUGA 1LBSA 2CB9A 3HJUA 5HFNA 4LXGA 1TIBA 3ESCA 1IUNA 2VT6A 3BL8A 4I4CA 4OYLA 3BDVA 5EI5A 4OSEA 4KE9A 5JD5A 3FAKA 1G4HA 4GWLA 4UFNA 3F8SA 1YA4A 1XKTA 1CLEA 1XZGA 3F98A 2C0QA 1CFJA 1W6RA 1Q83A 1H2ZA 3S8YA 1HBJA 3FOBA 1MNAA 3D7RA 4GI1A 2H9YA 3GROA 2WUGA 1CUVA 3YASA 2DFPA 4YPVA 5AHXA 2XMBA 3I6YA 3C6XA 2AJBA 4K6KA 5EIEA 2GBCA 4UFPA 4X71A 1TRHA 1KEZA 5F4ZA 3WYNA 3HABA 4ARBA 4HXEB 5K3AA 3KWJA 2OQIA 5JYCA 5D7BA 2WHQA 4QE3A 2QJWA 4C01A 1M33A 1CR6A 3NUZA 2VAXA 2OG1A 2PM8A 4BP9A 3EQ7A 3DNMA 4EY6A 2ZYIA 5SYMA 2WILA 1XRQA 3VISA 4OU5A 4QNNA 1GKLA 2C5GA 5HQ3B 3DYIA 4FHZA 4BE9A 1GZ7A 3N2ZB 4MYSA 1DX6A 1JT2A 3IUJA 3WI7A 1P0IA 2IX9A 4U2GA 5AI6A 5JADA 3E3AA 2LIPA 4QEKA 4N8SA 5FKJA 1FJ2A 2AJ8A 1UOQA 1QIDA 3C45A 4BAZA 1VJ5A 5K3CA 1F0PA 1UKAA 2WM2A 2WFLB 3ANSA 1E5TA 1JKMA 2QZPA 1GQRA 1CRLA 3ZWQA 2XUPA 5AKGA 1XQYA 2QT9A 5LIPA 3MGAA 3EQ9A 4C88A 1BCRA 2BKLA 2WG0A 4ZWNA 4BRZA 3ILSA 2QOEA 5CT8A 4IH4A 2XB6A 1QIKA 4CCYA 2P8SA 4X91A 4Y9SA 2VATA 1IUPA 5T4FA 3R41A 3QBJA 4QDUA 3FVTA 4YASA 4LIPD 4B6GA 1TCBA 4Y2TA 1U65A 3DCNA 3GUUA 5E4JA 2FX5A 1C4XA 3MVEA 5CXXA 2G4LA 5KREA 4CIBA 4MYDA 2WFZA 4AMZA 5HF8A 5DYYA 5K5EA 4F5ZA 4X7BA 1YS1X 2V98A 2RGUA 2JEZA 5C8ZA 5ALHA 1MAAA 3IIIA 3PDCA 4HXFB 5CT4A 5CMLA 3A2MA 4AN1A 3OURA 3HXKA 2JBWA 3QYJA 1EB8A 1XKLA 1TK3A 3W9BA 3R3YA 3G8YA 2X76A 1A8QA 4AO7A 1JJFA 3A2NA 1DQZA 4I3FA 3DOHA 3QM1A 1SCQA 1CUIA 3WYDA 5DJ5A 5AICA 2XUAA 4G9EA 1UZAA 2HFJA 3AILA 1E8MA 2Y1KA 1EDEA 4BVLA 4OB8A 3R3WA 5K3FA 3H2KA 5I8PA 4IHAA 4C4XA 3CN7A 4MJ3A 3EF3A 3GFFA 2BFNA 3VJLA 4X93A 5AO9A 3BIXA 2IITA 4G4IA 3D59A 7YASA 4W1QA 1QTIA 2QRUA 1XZEA 3O4HA 1U2EA 4Q3KA 2QS9A 3R0VA 1Q84A 3AIMA 1QJ4A 1CUWA 3L1HA 2CZQA 3STUA 4W9RA 2DHDA 4B82A 1N1MA 4H18A 1MT3A 5JZBA 2O2GA 2H7CA 1JJBA 3C43A 3AIKA 3X3HA 3IUQA 1XZDA 4X95A 1QOZA 5JZ9A 1UKBA 1TCAA 2H7XA 1H2XA 2WJ4A 4EUSA 3P2MA 3WWCA 2DHCA 1XZAA 2QXTA 3HYSA 2C5FA 4KE6A 4J0CA 2V9ZA 3O4GA 2OGSA 2AJCA 5ALMA 4PW0A 4DMKA 3WKDA 5IVIA 1XQWA 3FLEA 4BTLA 5AM1A 3O9VA 2G63A 1EB9A 2HRQA 5FRDA 1QLWA 1THTA 2VJAA 1GT6A 1LPNA 2B4KA 1QIMA 1LGYA 2WIJA 4FLFA 3PE6A 3A2LA 5CH3A 4BYMA 1D07A 1USWA 2I78A 3G9XA 3IBTA 1G66A 3OC0A 3CXUA 4W1PA 3DD5A 2JGIA 4WFJA 4Y2RA 1P0MA 3O4JA 1YAHA 1DQYA 1C7IA 3PFCA 1TAHA 3LLCA 3WL6A 2VQ6A 1A8UA 3M3DA 3E0XA 4F60A 1XLVA 4DSZA 3EQ8A 1QTRA 2AJDA 4UBNA 2WJ3A 2HA5A 4RPCA 1Q0RA 1VE7A 3HRHA 3ZI7A 2Z3WA 5IVDA 2JGMA 4EHBA 1ODSA 5ALPA 1ORVA 4M0EA 5FPPA 4S0XA 5EHQA 1Q0ZA 1UK6A 1FFBA 3W9UA 5FXMA 2ZYSA 1HPLA 1CUAA 3A6ZA 5DNUA 5BOVA 3FYUB 1YA8A 4BTVA 4X90A 4EB0A 2JIDA 3WL5A 5ESRA 4XIIA 1AZWA 4B0PA 4AZ0A 1VKHA 3B5EA 4B0OA 4UFOA 3G0DA 2W6CX 3QPCA 4OD0A 3IDAA 2QXUA 2BJHA 2PKYX 2XUFA 1EVEA 3STTA 1LPSA 2QUAA 4MQLA 1S8OA 3D4LA 2JEYA 1H2WA 3FWHA 4Y2YA 1ZD3A 1OILA 1X70A 4XWGA 3JYHA 1LBTA 1CUDA 5CH8A 4M0FA 4A5SA 3LIPA 4BC0A 2OXEA 3DKKA 4DM7A 3LCRA 3OTQA 4G8DA 1VZ3A 2VSQA 1J2EA 1OCEA 5AKXA 4QDZA 4U2EA 4LXIA 4L9AA 3PF8A 3I6MA 2OQVA 3GELA 5AI8A 5JALA 3TEJA 4N8DA 4WY8A 4Y2SA 2Y6VA 1VXRA 1SC9A 1MJ5A 1WPRA 4G9GA 2ZSHA 4UPDA 3FLAA 5AKEA 2GZRA 1CUCA 4LYEA 5CW2A 1JFRA 5CXUA 1A8SA 1EHYA 1XQVA 3OPMA 5ALRA 4B81A 3B12A 1R88A 3W2TA 2BUCA 3M82A 1F0NA 2I3ZA 2ZSIA 4UHEA 4OU4A 5JIBA 1JMYA 4H35A 2QTBA 5DNVA 5LZ5A 1DT3A 4J0IA 4UUQA 2PBLA 4H7KA 2JF0A 4DNOA 3AUKA 1QGED 5K3FB 3WZLA 4EY7A 2VEOA 1BN7A 1L7RA 3STVA 5D6OA 4HXGA 3RARA 1O6FA 5AI0A 2WIDA 4KAJA 1QIFA 4UHHA 2EDAA 1ODTC 4X6UA 4JYPA 3LP5A 1NX9A 1CUZA 4MEAA 2QUBA 3WZMA 2HA4A 4BVKA 3PFBA 1HKHA 1LPAB 3CCCA 1K5PA 1K6EA 2HU7A 2J3QA 3AFIA 1ZICA 4E11A 4WY5A 2VT7A 5FOQA 2XUDA 1GPLA 4KRYA 4L3WA 3G9UA 2WHRA 5ALVA 3RK4A 3K6KA 4BAUA 4FTWA 1LLFA 4DMCA 4E15A 2HU8A 2J4CA 2JGKA 2RAUA 3G9ZA 3KD2A 1IVYA 3OM8A 3SC2A 2B9VA 2VJCA 4P92A 4OPMA 4XX1A 2QR5A 3G0CA 4W1RA 3I6ZA 4P9NA 1VXOA 4H7EA 3I28A 1E8NA 5AI9A 1H23A 2K2QB 1F8UA 4KEAA 4X6YA 2WIFA 2NW6A 5AKYA 4JNCA 3C87A 4A23A 4ROTA 2EDCA 2ZVDA 4PO3X 2PX6A 3F9CA 2BCEA 2Z3ZA 5BV7A 5A7GA 1XZKA 1C7JA 4AX4A 1P0QA 1XQXA 4Q34A 1UFOA 2WU4A 2WU3A 5AI5A 4CIAA 3NGMA 3WWOA 3KWFA 3FSGA 5LP1A 1N5MA 4QDXA 3UMJA 1L7AA 3STYA 3FVRA 2WIGA 5HKAA 2PSHA 1HQDA 4AZ3A 2PUJA 4DSAA 2OAGA 2DR0A 1O6GA 5ALTA 2WIKA 4FNMA 3C6BA 4W63A 3AZQA 3WK7A 1ZIYA 3F67A 1YSCA 2XMRA 3HLKA 1ZGCA 2WG1A 5ALIA 5C7YA 4L0CA 1EH5A 3O0DA 4H0CA 4EY8A 5IKXA 5AM3A 5J3JA 4FFVA 2VAVA 4ITVA 1ZI9A 1GGVA 2XT0A 4Q3OA 5EIAA 4CG2A 3GBSA 5IVHA 2OGTA 5FDFA 4ZV7A 3HSSA 4Q82A 2XE4A 3PI6A 4W1SA 2WUDA 1QFSA 1LZLA 3W04A 1VZ2A 3I2GA 2C4HA 4A16A 3FNBA 3R40A 5JAOA 4C89A 2OCGA 3H04A 3C8DA 2X8BA 4MWTA 2VJBA 4HRYA 4BC1A 3WKEA 4K5QA 3FCXA 1MAHA 3BDIA 2CMFA 3H1BA 4F0JA 1CUFA 3I1IA 5HF9A 1R1DA 1ZI8A 2C0PA 2HA2A 2JGJA 3TGLA 4XVCA 4KJXA 2ACEA 1DWOA 4I19A 1KU0A 5A2GA 4NZZA 1MX1A 3WKCA 2GBGA 5ALKA 1FFDA 2WLSA 4PSDA 4QWMA 2OLEA 1QE3A 2XQIA 3FCYA 1J1IA 4B84A 2XQFA 3WJ2A 5JD6A 1KU6A 4DNPA 2PPLA 1AURA 1TKRA 1QIHA 1CUJA 4B85A 2G5TA 2DCMA 2G5PA 3DYVA 2PL5A 4N5IX 1IZ8A 4J03A 2QVBA 1XRMA 3ZPXA 3UUEA 4FBLA 1CUUA 2PSDA 3WWEA 3ESAA 4MWSA 5K3BA 3DOIA 2GBIA 2HA3A 2JGLA 2GYVA 4OB7A 1RYYA 5I9IA 1R9NA 3OOSA 4DLNA 4XJVA 3TJMA 5LZ2A 5EIHA 2CUTA 2E3JA 2FJPA 1J06A 1ZI6A 5LKRA 3BJMA 4H7JA 3R3VA 4TGLA 5HF5A 3DQZA 1CQZA 3CN9A 4C4ZA 5C8VA 1AUOA 1ODCA 4FOLA 2RONA 4PSCA 2J3DA 4OCZA 1XZHA 1VA5A 3TRDA 1AQLA 1UT6A 2ROQA 5YASA 4AB1A 2BUBA 3Q0TA 1B41A 4AQDA 5JD4A 3H18A 1EDBA 2RHTA 5ALOA 3QPAA 3BF7A 1JMKC 3ZV7A 4DIUA 2OCKA 1WPXA 2DQZA 1EINA 2BAGA 4AO8A 5K3EA 5E2IA 5AOCA 3I2FA 3DKRA 3D5EA 3I1YA 2PU5A 1Y37A 5CURA 4J0JA 3DL7A 1IMJA 2IIVA 4IO0A 5HZGA 1CVLA 4JEIA 3U1TA 1BROA 2BGNA 4OB6A 2Y2VA 2GYUA 5CT9A 2WKWA 3DLTA 3C6YA 5T4HA 1YR2A 3C5VA 1QO9A 3LIIA 4K6HA 3JWEA 3G7NA 2PU7A 4G8CA 1BS9A 1XZJA 1Z68A 2VJDA 2WJ6A 4BDSA 3WL7A 1BRTA 5LKAA 1JU3A 4BB0A 2HA0A 5E4TA 3QMWA 2EEPA 3ESDA 5T4BA 1ZJ4A 1OXMA 4UBJA 3G0GA 2QM0A 2YYSA 1W75A 2O7VA 3HC7A 3H2HA 3VVMA 4BP8A 3PICA 4E46A 3C5WP 2GBFA 4RE5A 3ZLUA 3G0BA 1X2BA 2XUKA 1RWQA 1XRPA 1CEXA 1QIIA 5AOBA 4KAFA 5CH5A 5HCUA 3V1LA 1U8EA 2O7RA 1FSSA 1DTEA 4F21A 4DMFA 3IUNA 3QPDA 2WHPB 1BEEA 4V2IA 2Z5GA 4PF1A 1G42A 4Q3LA 1IUOA 2R11A 4GECA 3L1JA 5BWCA 5FUMA 5C81A 4WFIA 4UHDA 1ZJ5A 4CI9A 4G1FA 2XMGA 3H19A 2XQGA 2WFMA 1ZIXA 4X3CA 5KWJA 4Y2VA 4M0MA 5CT6A 3WK6A 4PSUA 1UXOA 5A62A 1LZKA 1K4YA 2HA7A 4B83A 5ALNA 2C7BA 3D2AA 1YCDA 3O95A 4UBOA 4YX9A 4GW3A 1EX9A 4P93A 5D3KA 3WWPA 5BWBA 2XUOA 3QZUA 3S2ZA 4C4YA 1SCKA 3M83A 3WA6A 2XUQA 4HS9A 4RE6A 3WA7A 4X85A 4KAAA 4JYMA 1QO7A 1J07A 1LPPA 3RM3A 2XMZA 2OCIA 2XMDA 5CT5A 1XRLA 1QZ3A 1VLQA 5AK3A 2XQKA 4Z49A 5EHXA 4X97A 5JATA 4UHFA 1WHSA 2HU5A 2XLBA 3D2BA 3CCBA 3HEAA 3I2HA 1H22A 4FLEA 2W22A 2AJLI 3FYUC 1SCIA 3I2KA 4OYYA 3UUFA 1AX9A 1CUXA 4BATA 5C8XA 3MUNA 5ISMA 4QWWA 2VA9A 3KSRA 5AP9A 1EK2A 1GXSA 1E8DA 1K63A 3R3ZA 4B9EA 4MQMA 4PNZA 1XRRA 2XMCA 5FPQA 4Y7DA 3SK0A 4EZIA 5EFZA 1YAJA 3IVMA 1U4NA 4AO6A 3VXKA 6YASA 2H1IA 3KXPA 1PJAA 1VA4A 2GZSA 4MEBA 2OGZA 3R3XA 3AZPA 5CRIA 1VE6A 3I2IA 1GPNA 1PV1A 1ZGBA 3W05A 4UBLA 1N8SA 4Y2UA 3LS2A 5D3ZA 3QMVA 4J0DA 5CTAA 2XUJA 3ICWA 1JU4A 4K2AA 3VKFA 2D0DA 2FUKA 5EHNA 5AKLA 3H2IA 5JAUA 5ALZA 1CPYA 1WM1A 4AXBA 1AGYA 3EIOA 3K9BA 3WJ1A 5CBKA 4ZREA 4EY4A 3E1GA 4BAGA 5AK4A 2PSJA 3ANTA 2Z8XA 2XUIA 1R3DA 4H7HA 3WKBA 1A7UA 1ZOIA 3WK4A 2WQZA 5ALLA 3B3QA 1LPMA 5AM0A 5HKBA 4FBMA 1CUHA 2D5LA 4BCDA 2OCLA 5KWIA 2WTNA 2RIPA 1DT5A 1X2EA 3HACA 1R4ZA 2XDWA 4DTCA 1BE0A 5JASA 1ACLA 2CBGA 5HK9A 3QMMA 3Q8WA 4NVRA 4C87A 3BIWA 1UOPA 3BJRA 3F97A 5A7FA 3VVLA 5KBYA 2OPHA 3BWXA 3BXPA 2H7YA 4J0HA 5LZ7A 3WLAA 1TCCA 5ALXA 1W52X 3AZOA 4NS4A 4WJLA 1XRNA 5DLPA 3SX4A 3DL4A 4CG1A 5ALUA 3V1NA 4UHBA 3T52A 1LNSA 2RHWA 2WG2A 5JAHA 4WDQA 4J7AA 2DQYA 2B20A 3C70A 1MNQA 2YXPX 3IA2A 4G8BA 4IH9A 5HFAA 2WHPA 3G0IA 2B61A 2FJ0A 2HA6A 2HL6A 4RGYA 4QLAA 3V1KA 3QVMA 5E4YA 4CG3A 1XFDA 2ACKA 1EXWA 1HDEA 5ALYA 4AN0A 2ZJ6A
chains in the Genus database with same CATH superfamily
4MVJH 1UQRA 1FVXA 2O8CA 4P7KA 2G7MC 1DI0A 1ECBA 3KJGA 1ZH4A 2OFPA 2VWPA 5JECA 4G25A 2BUAA 5EMNA 5ULLA 3ROFA 4CNQA 4PN3A 3HP7A 3NDJA 1PIWA 2ZXEA 3OKAA 5CLHA 3U0VA 5CB6A 3A70A 3EPHA 1U3GA 2Q41A 4B71A 1WF3A 5FBQB 4M1MA 2JD2A 3MWKA 4MVJF 2WUEA 2WA1A 4QVGA 4V24A 1HT3A 1QRAA 1QYIA 4M1OA 3SOPA 2BHRA 1OA1A 1PJZA 4JUBA 3OIVA 3PTLA 3ZUGA 2O2CA 2QE6A 3WB9A 4CL2A 1S1MA 1CQWA 4K6MA 4TYWA 2HJRA 1COZA 2A33A 1HZZA 1YQTA 3JQ9C 4I4NA 4X24A 1I4WA 2PX8A 2V6MA 3RF6A 3TIFA 4D46A 4NEQA 4F5EA 2DXIA 1PR3A 2WWWA 4MICA 3PNBA 5JAQA 3KXDA 3MWLA 2CJPA 4YDSA 2FSVC 2V4ZA 1Z8DA 2IKQA 2LV8A 3WBBA 2BMAA 2PJRA 1RPTA 1YRBA 1XZFA 1XROA 4YFVA 4CLRA 1Q44A 1V3TA 3EEIA 3QTBA 3P0FA 1DPFA 2P67A 3MELA 2XGOA 4LDRA 4ZEWA 3WYAA 1D09A 4PR0A 1C3LA 1JDZA 2QMEA 5GOZA 1G5FA 3OQNA 4PANA 5SYNA 1U1EA 3ASYA 3H8WA 2I55A 4MV6A 1UKCA 3GX1A 2CFTA 2C5HA 4RJJA 3ZCXA 4US0R 4D4GA 2ZCJA 4UEJA 4BE7B 2CXUA 2IF0A 1KSGA 4HAZA 3ROEA 1D0SA 2ZRAA 4MTCA 4DOMA 2UZ4A 1S2IA 4XUDA 1PD1A 5AKHA 3VZBA 3AXSA 2B8NA 3TL2A 3ORYA 1NZDA 4IIEA 3EAFA 4N0QA 3FLBA 4XQCA 4RWEA 4RVUA 3U7QB 5HS4A 4RNCA 5JAPA 4QXPA 1C4OA 4CFSA 2ZTLA 1YQEA 4RMIA 4M1TA 1DKUA 5ALGA 5H3CA 3CUYA 5GGXA 2OAEA 4XQGA 4G67A 4QATA 1NUAA 4MRMB 3WMXA 5CA1B 1DRJA 4G86A 5C0OE 1J0EA 1P6XA 1Y4ZA 2VWGA 3BF8A 3NJRA 4FS8A 3HXMA 3AWDA 3B5IA 4X61A 1XCBA 4Y6PA 3SF8A 4YUAA 2II6A 3NC0C 3QLVA 2BC9A 1GY8A 1T0PA 3E9CA 3UW3A 4D3XA 4BO3A 3ZS8A 4MV4A 5BMOA 1NW7A 3H1AA 1UUFA 2JVKA 1TJ4A 3GLQA 3JRWA 3N28A 4F3YA 1JSCA 2NACA 1Q1NA 3ENKA 3NASA 1OZHA 3K0EA 4QHYA 1VDZA 4HYTA 4NH0A 521PA 1L4LA 1E64A 2ZB3A 4RFSA 1JXAA 3ZWWA 1NNSA 3C4VA 3I12A 2PT6A 1P8JA 5F9HA 1RCFA 1KZ6A 4XPZA 4BU0A 4M9ZA 4N8EA 4BN0A 1RJEA 2HQRA 1Y9ZA 2Y0DA 5C34B 4B4KA 5LBTA 2CVOA 2OLKA 1L4GA 1BN6A 1KBOA 4KACA 1GZVA 5KJCA 1HQKA 4OF4A 1KKUA 2Y1GA 1NMZA 5DGXA 3Q3JB 1RRMA 3FZNA 5HOQA 1Z4IA 3HG7A 2OC4A 3FSJX 2EG5A 5AM5A 3GYGA 4MROA 2CCJA 1OLXA 1SD1A 3BORA 3NTVA 1ZD5A 1ORWA 3EY4A 4EI7A 1L4NA 3QHAA 1F6WA 2QD3A 1GNQA 3SSOA 4KYVA 3A8TA 2HUPA 3V97A 3HQ4O 5E9QA 3VMFA 4CM9A 2B4AA 2VYVD 5BPFA 1F6BA 4CG0A 4AMYA 3CRZA 3WXMA 3ACCA 1XN1A 1UP6A 3W1VA 6AT1A 3OEWA 4EZEA 1MU0A 1VL2A 1Y7LA 1JKIA 1W1IA 1ZN7A 4KFUA 4ZCLA 4EA6A 1AU9A 1XNRB 3R9XB 4ITUA 1OV6A 3N39C 4EHIA 2F1HA 3AFGA 3BULA 3GJ7A 2I6TA 3W2EA 4BJHB 5IAAA 4DR6B 2DFKB 2HBRA 1YI8A 3C2QA 2X0DA 4EG1A 2ZJ5A 4FFWA 3R6TA 2C54A 2YRFA 121PA 4L07A 4JLSA 4N6NA 1NYRA 2I1WA 2XNCA 5CFRA 2CF5A 3I2JA 2AOUA 1CXZA 1UIRA 1NUUA 3O7MA 1EI9A 3WNBA 4LJ4A 1QBGA 3WLTA 3BPSA 4BRUA 1UK7A 3GK3A 4FDTA 4QNMA 4A7PA 4CETA 2VNSA 3I0ZA 4WBNA 5K7SA 1E3QA 3TZLA 3ZE7A 3L07A 4C43A 3S5UA 4I9UA 2GPSA 2ZS9A 5H3HA 4ZYTA 4YRLA 1F14A 4BECA 3C39A 1EA7A 3JQBC 5LBUA 3T7EA 1Z6TA 5A0FA 1ZD2P 1GEGA 3A3YA 4BZXA 4QZVA 1ZNQO 1TK2A 1I6WA 1QQ7A 2J85A 2OZVA 1EHCA 1R6BX 4DMHA 3F5MA 5BUCA 2BGIA 1B26A 3KLNA 4J0KA 4N3CA 5EJMA 1QPZA 4TTIA 4Y8VA 1R50A 4YT5A 4MYUA 4J2HA 3CF0A 4WIAA 3V48A 1ISPA 1CUEA 5E3HA 1RVDA 3P7MA 3O90A 3ZU2A 4YWJA 2CFSA 2QRLA 4PYNA 2GPAA 5C3UA 1RQGA 4UBMA 2F8SA 4FDVA 4H4EA 1PK8A 3DE5X 1F8FA 3RBZA 1A27A 3D2CA 1RFLA 2V96A 4IXTA 3NYRA 4OYHA 5DX0A 1PS0A 3ELDA 3GLFB 5HKOA 3WMRA 3FBTA 2IS6A 3K09A 1WUHS 3I0NA 4RL6A 5DNWA 1O6CA 4X92A 3VJMA 4ECEA 4GOKA 1FYWA 3M9LA 5DNDA 5EJ4A 1IXKA 1Z9BA 5CM2Z 3PGJA 5JFOA 3WLQA 2FKAA 3I42A 2HSWA 4JB0A 2A9QA 3DA8A 3K9LA 3KSDO 4IG4A 3MZ0A 4BLQA 2XI4A 3UJPA 4MXDA 1H94A 1T9KA 3O1LA 2BGRA 4YTEA 3UAGA 3MAGA 5BQPA 2GF9A 4YT2A 5CA0B 1M72A 2ID7A 2OBYA 1S2MA 1KFKB 3HM2A 4HUQA 2CBZA 3DAFA 1CIJA 2Q3MA 3KQPA 5DTQA 4BGUA 2YBDA 4IIUA 4QO8A 4P3NA 3D6MA 4C0JA 4HN9A 5DTIA 3O4VA 3GRRA 4R54A 3ZW7A 1UDXA 3PPIA 4RTKA 5ALEA 2CZGA 1JIJA 1P77A 1F8YA 1AKVA 3I92A 2PH7A 3N7AA 4QOGA 3STWA 1K2WA 2W98A 2EATA 4LA4A 4ESOA 2D6FA 4YB8A 4CUZA 2B7CA 3LY5A 4GM0A 4M21A 2V7PA 4QOIA 1C41A 1QGYA 4A27A 4GQAA 5FORA 4NXNB 5F3DA 4WJZA 3KSBC 3UHFA 4RH1A 4WN3A 3HFSA 2DYKA 3R7LA 4FMPA 2ZKLA 2C7GA 1DIRA 4YXWD 1JBQA 1P4JA 4K1XA 5AVYA 2VPYA 3JQ7B 5EHZA 4OGFA 1XAIA 2C94A 3T7IA 3VVCA 5ITZA 4I4LA 4P7JA 1G5TA 5TQ0A 1FYDA 1PR2A 4JJ4A 4MJLA 1FP4B 1YDFA 2ZJ8A 2XXAA 1QDUA 4KIFA 3NMUF 4G5FA 4RTQA 4DC1A 3DAGA 4BX8A 3ZD6A 3IESA 5IYZA 2GTIA 5L3SB 2JCSA 2GZDA 4CMKA 1M8KA 1TK9A 3BFVA 3UT6A 4EX6A 3MJTA 2VP3A 2FP4A 4IOJA 4PRZA 5GY7A 2AK3A 1J24A 3P27A 3EH2A 1I1HA 3SE7A 3OCUA 3OCWA 1E5XA 1SXJB 1C14A 1LSOA 5T4EA 3T34A 2QJFA 3ZLVA 4DA7A 5G4KA 4E3ZA 5K0TA 1SIBE 2X6RA 4DLVA 1KFEB 5A7HA 1F4VA 2OKCA 1YASA 5H83A 3V00A 4C06A 1M34A 3TW4A 4UVIA 3BSWA 3PF9A 1YHZA 3FDIA 1EM8B 1XZLA 4BGEA 2RIRA 4Y3UA 1ZESA 1L1QA 4B76A 4ASUA 1JEAA 1BVRA 2CT8A 1K97A 1XHLA 4JL6A 3MTBA 4H7FA 1VPEA 4DABA 1ZRHA 1PNTA 1YIAA 4JASB 1PG0A 2ZRFA 4S1PA 2PUGA 3UUWA 3F7TA 5I9TA 2HNBA 3OFNA 4JIMA 1SVWA 4TZKA 2NX2A 1DC4A 4JENA 4Z4HA 1R0YA 4C76A 3ANYB 1CUBA 4UKDA 2AC2A 4O4JA 4E03A 4IQ4A 1LD3A 2IELA 4TS9A 3TH5A 1W0JD 4CODB 3A36A 2QUJA 4Y9RA 5KQSA 4RD3A 3CX7A 1PTJA 3IP8A 1QONA 4R8KA 4MGIR 5FTKA 1W59A 3V4SA 2JFZA 3E3NA 1QZXA 4B9AA 4CUKA 3PEYA 3DV2A 4JYBA 1VJTA 4TVSA 4W8HA 2QNRA 3EULA 3WTBA 2H1WA 4IDAA 1NPTO 2C58A 1MX9A 1X8LA 2P1DA 3TLEA 3V6LA 2HM7A 3VTZA 1ENZA 4DY6A 1OAAA 1TVMA 5KQGA 2NADA 2IPNA 1DV1A 2QTWB 3GLGE 3ZKWA 1O5IA 3U31A 1H2RS 4GVXA 1OXBB 4J6FA 1Z13A 4FFDA 3Q6NA 3T5DA 3TLXA 4JLJA 1JGTA 3IJRA 3R3UA 1UT8A 4G0OA 3O0TA 4E32A 5BV1A 2Z2XA 4KO4S 5DU2A 3G1UA 4OXIA 1UC8A 3PUVA 4ZI5A 1ICEA 2BVNA 2R85A 2BF7A 1FVHA 3EASA 3FXAA 3U3XA 4INJA 1NQAO 2OT3B 4D8VA 1OSNA 1R9MA 2XIQA 3CLTD 4WERA 4NOLA 4QUEA 4QYXA 1K7SN 2HX1A 1WZCA 4WI1A 1WQ3A 5EYPB 5EE1A 2OXRA 3KHTA 2JAXA 4HNSA 1Z45A 1KQPA 3OZDA 3ZC3A 2ZM5A 3UCEA 4JXJA 5H3LA 4RVGA 1R12A 2HPHA 2JGEA 4NMHA 3P2JA 1M6EX 3B53X 1GITA 1V2GA 3E5RA 4IGKA 4EP1A 1L7BA 1WV1A 4WCVA 1GPDG 4FEEA 4A15A 4MK4A 3C8HA 4JT9A 3JASA 3TAHA 4JBNA 1N6LA 4X3PA 2BEUA 4B5LA 2QL9A 1U0RA 1E2LA 3KUXA 2Y6UA 3BWEA 3UA4A 1RHMA 4FEGA 3MTEA 1DOAA 1ECLA 5HJEA 4HH0A 1RWXA 3HJBA 4O63O 3ZIAA 4G0WA 2EGUA 1SOWA 4RV4A 5J5VA 3F2IA 4IICA 4WH0A 2R7NA 1P1CA 1PI3A 5WRFA 3WGLA 2O2IA 4KPUA 2UDPA 3DC2A 4IJQA 5AI4A 4IJKA 5I7SA 2Z3VA 1AHIA 1LPOA 5IWAB 3SI7A 3WL3A 5BMVF 1BX1A 1I01A 2H31A 1B2LA 1RJ9B 2HHAA 2L0XA 2QE7A 1E2KA 3HO8A 3HCEA 1BMTA 2PUWA 1N8NA 1R27A 3PHHA 1NP7A 4YLYA 2J31A 4WESA 4RWZA 2XW6A 3F74A 3IQIX 4LYFA 3AB3A 4LHEA 1LDNA 2Y1WA 3SIPA 3SJBA 1PNQA 4PX5A 1MD9A 4GIBA 4NQRA 4J9UE 5DSZA 3OG9A 4C0LA 3DZKA 2Q3JA 1RC8A 4XXHA 3K9NA 5HQ3A 1O9GA 3UNXA 3BWDD 3GLTA 1UOOA 2QXYA 4Q9LA 4F86A 3CVXA 3C16C 4JJZA 1Z15A 1SBYA 2A0KA 2XGGA 2XJ4A 4LI3X 3A1TA 4M46A 4TTRA 3MOSA 4DN6A 2CHEA 2BD0A 4ZQGA 1NF3A 2AG8A 2R0QC 4FGKA 3EVFA 4IVRA 3O4IA 1FFAA 2B8EA 4INZA 1M67A 4LY3A 5G41A 3V1MA 1ZPDA 3WV4A 2JDIA 5C35A 1ZH6A 3H5VA 4Q03A 5FQNA 2H2DA 4KUHA 4DLYA 5HIMA 5JS2A 5LZ4A 4PTZA 1KEEB 2Z8YA 3AHHA 4QGGA 1H9CA 1OLXB 1DAGA 2GAIA 2P11A 1MPXA 2VSYA 1X8KA 4LQCA 1M2VB 1YRLA 2HTEA 4NYJR 3MBOA 5G0TA 1LBQA 3OJEA 4MQ6A 4ED9A 2WFLA 3WAKA 1QIGA 5BQ3A 5ALSA 1LLDA 5FO0A 3BWVA 1OXTA 1CHDA 2N1MA 3HFRA 1IB0A 4M1SA 2WZCA 1NUQA 5C1DA 2C8JA 3PRKE 4OIMA 1QDLB 1CUSA 1T13A 5F35A 4RIGA 3RU2A 3KOOA 3FYHA 1P80A 4LUCA 5FBKA 4JYAB 1CY0A 1RJGA 1TA4A 1WOMA 2WK1A 3OJWA 3VZPA 1EFHA 4EJ2A 3EYAA 3NGXA 2QTMA 1PYGA 4JYCA 1ND5A 1FQJA 1V35A 2GRUA 4M9QA 1NXOA 2ZIUB 1E7SA 3B78A 1VFNA 2JFBA 3GCDA 4I50B 4CCSA 4WA7A 2HGZA 3ZHBA 1X77A 1MVNA 2Q50A 1X92A 1Q21A 4DCUA 4ZDIA 1VOTA 3HBFA 1JR4A 4QDOA 1DHRA 3DGFC 2VP6A 4LJLA 3TDKA 2A5FA 3ZXXA 1FYEA 2GLXA 4TRRA 5BSTA 1IBLB 3OH8A 2IYAA 2Q9AA 3LJKA 3W2IA 1AY0A 3AKEA 3V4OA 3MQ4A 4DAOA 3LYAA 3PFHA 4GKJB 4JITA 1PVVA 1U0GA 4JI6B 1OFVA 3FZGA 3KKLA 3HPRA 4PYQA 4CGYA 4EQ6A 4H6WA 4JLMA 4MYTA 2BFOA 5AW9A 4BLWA 2PLFA 1O4VA 4BNDA 3G2MA 1LW6E 5DP2A 2RHCA 4GLBA 3OD5A 5PNTA 2PT9A 3AKCA 1KI7A 1P1BA 3AL2A 3C3BA 3NHSA 3II6X 3PHIA 5HK8A 3VC3A 3VU3A 2I3BA 3GRAA 1E2GA 5J2TF 2BEKA 1I8TA 4RJKA 4ZALA 2Z6AA 1YFJA 3RKUA 2PSFA 3LVBA 3T7DA 2WUFA 4FB5A 2CXPA 4B3IA 1JTFA 4Q4JB 3FTQA 4Q05A 1FLNA 1UJ5A 1C7RA 3AEQA 3QBVA 4P4LA 1LBSA 1L9KA 2CB9A 1L6IA 5HFNA 2Z9DA 4CT4B 3I64A 3R0IA 1RRFA 1EE1A 1Y3BE 3DO8A 2QZ9A 3PDIB 2I8LA 4Z9YA 5H8WA 3WG9A 4ZVOA 3ZV5A 4U7JA 2XF8A 5ARCA 4XD7A 3G85A 5MGBA 1UR5A 3HNPA 1P18A 4OHVA 4YLGA 4BMCA 5C5CA 2WPNA 3NTLA 1P2GA 1BCSB 3ZU4A 1C8LA 2J5KA 3L8ZA 4M98A 3HN6A 1OROA 2UZ3A 4YAEA 5I7RA 4K81B 3DUWA 5JD5A 2EFCB 2J5QA 2I4IA 4NWIA 1GD1O 3PUZA 4FR5A 1PR9A 3DMDA 4LOJA 4A8HA 5J4VA 3FVQA 4UFNA 1DQRA 5JQGF 3GAMA 3OEHD 4GWGA 4AWXA 1WDKA 1XALA 1DQPA 4L0MA 1ONPA 2J0QA 2H1RA 2EJVA 2YFQA 4ER3A 4O0MA 3EAGA 3U7JA 4HNTA 3QXXA 4J2OA 3RBAA 2C0QA 2PQ6A 1IU9A 1CFJA 3Q4GA 5JNVA 5FUYA 1GNLA 1Z37A 2OA0A 2AG1A 4FKZA 4MUYA 2OB1A 1VSQA 5A02A 5I7OA 2E6KA 3S8YA 4IX9A 4UU0A 1E7QA 1X7WB 3U9TA 5KINB 3PITA 5DHTA 1FS4A 5ES4B 1HBJA 1Q22A 3IJPA 5DGCA 1I94B 3D7RA 5BV8A 5I3ZA 4YMWA 5HJ7A 1BFUA 3NBMA 2RK6A 2PH1A 1WCXA 1RXSA 1QH8A 3D7MA 1L5OA 1WO8A 4LMAA 4M0KA 4TWIA 1GILA 1U1IA 5B7GA 4TWJA 3T9FA 3UB2A 4JP8A 3L49A 1LCIA 4YRQA 1GR1A 3UWOA 4YPVA 4DV3B 1Z4KA 2ZYUX 3UGJA 2FN8A 5EWMA 1G41A 3HH8A 4K6KA 3V8QA 3EEYA 4KLCA 4C3UA 1EWVA 3DZ8A 5DNAA 4EG7A 2BGKA 3HGMA 4JGIA 4TUYB 1VSTA 1TRHA 2FVYA 3UPTA 1WF6A 2IOYA 4TKUA 3FPEA 3SF0A 4YT8A 1R8SA 2O0JA 1QK4A 3CY6A 3H8JA 3DD1A 5T8KA 5C1OA 1I2BA 2PANA 3HABA 3TRIA 1Q14A 2DFTA 3HYNA 3L7NA 3VPDA 3OQJA 4DWWA 4ZDKA 3RIEA 5CG2A 5JISA 1IATA 3L9XA 3F4LA 1WPQA 4RSRA 4BN5A 1YJBA 3PE3A 3WRXA 1HGXA 4AD8A 1QKIA 2B2NA 1J0XO 1OGIA 3QGMA 4G5OA 1Q1ZA 3AP3A 2CVFA 3L1VA 4JJKA 2OG1A 2X4LA 1MMFB 2PZ8A 4NPHA 2R00C 4LX8A 1XWIA 1TIKA 3DWIA 1NJFA 2Y66A 3F6BX 2IU3A 2SCUB 2YRXA 3DEIA 3FYDA 1SQ6A 3HA7A 2QG6A 3JQRA 4U7PB 2B4YA 4ZEVA 2WILA 3EPLA 1MO4A 3CS3A 3RC1A 2OXIA 2UYGA 2W6QA 2D0IA 3EZ9A 3O9ZA 3U40A 1VHJA 1KK0A 2D62A 2V0CA 4NDZA 4TWZA 5EHIA 4E2XA 2G0AA 2P9CA 1QGDA 2EJTA 1XCOA 3RSCA 3T5PA 2QLMA 1RM3A 4L8GA 2G7ZA 2I99A 2SECE 4KR6A 2ECQA 1K7YA 4MYSA 5COAA 2Y05A 3QVWA 1KXJA 2H7VA 1ZM3A 1FX0A 4RULA 1ZHFA 2IX9A 4U2GA 2V7UA 5JADA 4QUKA 2FDXA 2QT1A 3JQQA 2RMKA 4GOXA 4EHNA 4JOSA 4ZYYA 2HIAA 2M6RA 2VPTA 1Q1BA 4QEKA 5LP6A 3K32A 3P9YA 2EFJA 3M5PA 3IMFA 1H8ED 4B6SA 2ZXFA 1IY8A 1FJ2A 3OMLA 3IUSA 3C1UA 3PR3A 4F84A 4J1NA 3U5TA 1X1TA 3IO3A 1HYGA 2RE8A 3CUKA 3BL5A 5TQJA 4F38A 1BZYA 1K4MA 4R9SA 1E5TA 2OHIA 3D6NB 1IN1A 1M2WA 3SSNA 1SQ0A 5GZ1A 1CRLA 3R44A 4KITB 1A77A 3S28A 4BBAA 4V1CA 2XUPA 4DMUB 1QYWA 1XQYA 2Y8EA 3OICA 4D74A 2CFRA 2H0RA 5LIPA 3ZLJA 3E5NA 2XVZA 3EQ9A 4UJ3A 4EJ0A 1Z73A 2WYVA 2BKLA 2WG0A 1RYFA 3OFVA 4GQIA 1KYYA 3EVNA 4NARA 1G5HA 1U6IA 1URPA 2O23A 4MVJP 4U9UA 5K45A 4HUJA 5KC8A 2IPMA 4IH4A 3GRYA 4J4BA 5AJZA 3AEKA 5FBWB 5BRAA 2D5IA 4PLTA 4R7ZA 5A9TA 3P32A 4QEZA 3O2SB 4DHWA 2W2LD 5NULA 2F64A 2YZGA 3WLEA 3R5JA 1P2TA 1LI7A 4JEHA 2ZR0A 4J49A 2VATA 3BRSA 3KOMA 4XWKA 3R41A 1Y6RA 3TPZA 1SUEA 2I6QA 2YWHA 4TS3A 3IKVA 4OHZA 3VTAA 1WXWA 2H18A 3R24A 1NVKA 3L7AA 2AOTA 1XA0A 5JBQA 5IM4F 4LIPD 1SVOA 4LOKA 2DPXA 3OQ1A 3USCS 5AXAA 3HCFA 1KZGB 5F7ZA 4D3ZA 5MDHA 3EY9A 2V59A 2BFBB 1H65A 4KYIB 4Y2TA 3FYCA 4LJRA 3A6GA 5DEOA 3OC6A 1H1TA 2IHYA 2OTCA 5E4JA 4BQOA 3NVDA 1ZR2A 3OOYA 2GN4A 3R7FA 2XADA 1RQLA 2OM6A 2WU0A 3M7IA 2JAWA 2VNJA 3Q7PA 5JYDA 1H1LA 1N5LA 1KHHA 4LJ8A 3DMRA 4EWLA 1HC7A 2G4LA 2C84A 2VZ0A 4DIFA 1VDMA 2W90A 3A1DA 5B3JC 5KREA 9ABPA 2MMGA 3IALA 1JFTA 4CIBA 4CEHA 4BMNA 4D8YA 5KQRA 1UPAA 2WFZA 3FETA 3HR7A 2QAGA 2R9VA 4DVJA 3F5QA 4XYLA 2WQ7A 1OW3B 1K3FA 3CF2A 2N75A 1BFDA 3R74A 3RS3A 2OV6A 1R6AA 4KW7A 1E3TA 1HYBA 4Q7JB 3QELB 1E1NA 1O96B 1JS1X 4DEXA 1GYRA 5KDDA 1K9SA 2XXJA 1YS7A 1D2CA 1KO1A 5HX7A 4DG5A 1U1GA 3PSAA 3L4KA 5K20A 2G1PA 2IUFA 2D7CA 3DE2X 4U5XA 3WGQA 5KTMA 1QFXA 1V5EA 1DKQA 3DAHA 2BJVA 1K7FB 1AMUA 4NBSA 1HI9A 1K8RA 3QYFA 4RELA 4YH1A 3TECE 1PQPA 1XTJA 1QKJA 3LTNC 3OPXA 3O8OA 1JHMA 1T9DA 2C5EA 1FNDA 3GJ0A 3PGVA 2GCEA 1ZH0A 2WVAA 4PZPA 5CMLA 4B7CA 3AETB 4B4WA 4KNYA 1W96A 4RIFA 4RD2A 4M0CA 4YV2A 3DP7A 2H3EA 3HXKA 1IBMB 4X7RA 2KBEA 1XKLA 5TT0A 4BMXA 1FMTA 3N0WA 1TK3A 2NSDA 2CV0A 2VAPA 4J9VA 2EYQA 1SXIA 4L8WB 3PA6A 2P78A 5BSFA 1GHTA 2A9OA 4OHMA 5JSUA 1L3BA 1JPVA 3UBMA 4D97A 3MW8A 2VJNA 3A2NA 1X8JA 5TF0A 2WAXA 1XTIA 3M1IA 1SD2A 2DY1A 3QM1A 3R20A 4QREA 2GKGA 1C8KA 4MVJA 1Y4DE 1DAHA 1H8EA 5HCIA 4EVRA 3IODA 2PG3A 3ZQJA 1CCWA 3UWKA 4ZDJA 1QHXA 5F1PA 5IVPA 3REOA 1QGOA 5C5DA 1XV5A 3FW1A 3AILA 2Q49A 4EGFA 4B7XA 1DEXA 1XELA 3D0RA 5TEVA 3L01A 2IHZA 1GNTA 5AJYA 1E1RD 3QF4A 4GSLA 4UUNA 4F9EA 2AN4A 1X1BA 4EF5A 5CJPA 5A04A 2X9VA 2AG5A 2QVCA 4EHHA 1Y1KE 4BVLA 2WYWA 5BOSB 5K0EA 4JV5B 4MH0R 2ZR9A 5K3FA 1G2QA 2ISCA 5LBIA 2FX3A 3DDHA 3H1FA 3H2KA 4U6SA 1GA1A 5EJAA 2NAPA 3D6TB 1F8XA 3PQ8A 1GGKA 1RWKA 3G2HA 5A6SA 1CZUA 1IXZA 2A84A 3JVUA 1Z4LA 2HCBA 2O2EA 5LDGA 4MLZA 4MJ3A 3AHCA 4NBRA 3EF3A 3FUXA 3GFFA 4OGGA 4PZ9A 4EHAA 1JEOA 4TWAA 1Z5UA 3PKJA 5EE0A 1QPGA 1IPFA 2B25A 3DFMA 4P84A 4EOGA 1BKSB 4M54A 4G4IA 4LXTA 5A3JA 4QGFA 4KIJA 2WU1A 3D59A 3TAXA 5K6TA 1JZSA 2XB4A 5SZJA 4A2CA 5BY2A 1T5DX 2W2LA 2FUNB 4W1QA 4H1UA 2QRUA 2JARA 3O4HA 3RS8A 1J23A 1YVRA 4C7OB 4Q3KA 4ZRMA 2WKPA 2JASA 3QFCA 2QS9A 3B60A 5JQGA 3I9OA 2DWPA 3SM3A 4B35A 3L1HA 4ZK2A 2IEIA 1E1RA 3THWA 2GSWA 1DAKA 3S1AB 2UYHA 1PWHA 1W93A 3UXMA 2V8OA 4AECA 5A5EA 4YP1A 1KJQA 3KO8A 4EGAA 4O4LB 4RVDA 1VMDA 3TOVA 1OAOC 4EFDA 2OY0A 3PWKA 5DBFA 3P71T 3ZKWB 5JZBA 3I5YA 4KTVE 4U0KA 1I2DA 3MAJA 1G8GA 1M74A 2H7CA 3NIWA 3NR2A 3QEOA 1JJBA 4N5DA 3F3KA 2WWGA 3TFWA 3X3HA 2P8JA 1B16A 4OHYA 2DHRA 3PNOA 4OXXA 1E3SA 1JR2A 2W6ID 3BFXA 1J8DA 2R86A 2VDMB 1EBFA 2WMNB 4TKUB 4KVGA 3R7NA 3EG5A 5KSZA 1FIUA 1MAVA 4NULA 3N8KA 3T1VA 1AXGA 1K6MA 1W88B 4BO8A 4ZVRA 1H2XA 1V5GA 1Q0PA 1GAEO 2WJ4A 2YOGA 1TA0A 1W2WB 2HLPA 3HU3A 4IJ6A 3ZIAD 1N6KA 2W2NA 1OZFA 5AR1A 3WWCA 2AQIA 4PGGA 4EEKA 1FFGA 1BMDA 1MG5A 3GQVA 3HUTA 3LGXA 2RHRA 2Y77A 4AJ4A 4KE6A 4AKSA 2HB6A 4JR1A 2BCJQ 3W2HA 3WAJA 3M33A 4Y98A 2W4QA 4PW0A 3LG2A 3CVVA 1DBPA 4MPDA 5DHUA 5TEWA 2DQSA 2YHAA 3D7SA 3WKDA 2YNMC 5J4LA 1RZRA 4KMSA 2WKRA 4QYSA 3KC2A 4Y1RB 4L3VA 1QYCA 3FLEA 1F2UB 4BTLA 5AM1A 2XEDA 5B12A 2KHZA 1LXCA 4I50A 4LI0A 1DV2A 4I2VA 4PR3A 2FFAA 5GTDA 1BKYA 4BY9E 4GG1A 1QLWA 1SBNE 4OQ4A 5DTRA 4WLFA 3IIKA 4KV9A 1KP3A 2VTEA 4J94A 4DAEA 1B0AA 1A5SB 4TTPA 4P58A 2JGDA 1LGYA 3GCGA 1DQNA 3L1UA 2RKBA 3OLYA 2FPMA 1VL5A 2WT4A 4DIBA 3IFSA 4C6TB 5A4FS 9LDBA 3PE6A 1MT0A 3D02A 4GMKA 4PWZA 1TA9A 1XU4A 2C2XA 2ESRA 3L0CA 4NTZA 4XTCS 2G80A 5KYWA 1L7EA 3PX7A 1NLFA 2Z5LA 1A97A 1NLZA 1USWA 2I78A 1P31A 2ZSBA 3A31A 3EFEA 3IPCA 4MYCA 1FDUA 2R8RA 3K0CA 2OGWA 1TUBA 3OOJA 4CR7A 1E0AA 1NF2A 3SMVA 1M1NA 1P0MA 3LPDA 2IV3A 4KO2S 3LYHA 1SKAA 4OI4A 4G2TA 4Y18A 2Z1MA 3O4JA 3PDIA 1XDGA 3PFCA 2X19A 3UQZA 4FOTA 4ZAWA 1T6YA 5AHRA 4Q00A 1A7KA 2EU8A 3LLCA 1JJAA 5A03A 2VQ6A 4RJIA 1ZSVA 1M1YA 5EPUA 3ER9A 1A8UA 4KZKA 5J5AA 1Y8AA 2NZUG 2ZT6A 3LCUA 4FHDA 1IEQA 5KAMA 4F60A 1NE7A 1F7UA 1X7ZA 3V4RA 1XLVA 2QTAA 3AOEA 3Q7TA 1QTRA 1GKUB 1Y81A 3DBLB 1NI4B 5KSWB 2FK8A 3EB9A 1I5EA 4QC2A 4BKMA 2WJ3A 2PXXA 1ZA1A 3AJEA 3QWFA 5K0LA 1Q0RA 1G8SA 4GOLD 3BE6A 4MMXB 4AJPA 4BNVA 3PB3A 2JGMA 4I55F 4IZ6A 1JHXA 4MVYA 4WLOA 2ZWAA 3CZ4A 1ODSA 5GWXA 5B1DA 4JJ8A 2HAEA 1K8ZB 3K4HA 2ZI4A 3HCPA 1XF1A 1NMQA 3MWEA 4RGQA 4S0XA 5EHQA 4R2IA 3KWLA 2P30A 4JC5A 4ME6A 1T0JB 1P2DA 1XEAA 2GNAA 1VMKA 3RUHA 3VZCA 5BSGA 3QYAA 3PYMA 4Y1GA 1IEVA 4KPUB 2PZAA 4DM3A 2P4EA 1GDTA 4GL2A 1SQ5A 3QA9A 2V4UA 5FXMA 1DEOA 3A32A 2CNBA 4KQHA 1PRYA 4J0FA 4KQCA 4MWZA 1XKXA 5HZKA 3Q9SA 1VIAA 4YIKA 3I1JA 4Q01A 2V8BA 4ZAFA 4OVKA 1FZQA 1P6UA 3ZU3A 3ZS9A 4O5OA 1MDFA 1ZUHA 3A6ZA 1WE2A 4HQRA 4AQYB 1DAPA 1D1QA 1UEJA 8ABPA 2H3HA 1MC8A 2MSCB 3OFKA 4KFSA 5LQRA 2OD2A 4D99A 1XWFA 3EVGA 4PWYA 4EB0A 2XZOA 2O59A 2JIDA 3NKVA 2BELA 1NVUQ 3DB1A 3OHSX 4YRPA 3IMEA 5ESRA 2WV9A 3DMPA 4TXNA 2R8YA 2JFNA 4A0FA 4B0PA 2A6PA 4HWPA 5L3VA 4AJEA 2COEA 2XT6A 2J59A 4MPRA 3P4YA 4R8VA 1PGPA 1FNCA 2Z2YA 2ZWMA 4YUVA 1YHNA 3W5VA 2FQ1A 4UOEA 2CXXA 5CDFE 2PUAA 3G0DA 3K1TA 2Z1NA 2G06A 2GBPA 3K6JA 3C3XA 2ZT8A 1VBNA 3ROQA 3IQZA 4IUDS 3O7WA 3VPHA 4WZ6A 2XUFA 2XSZD 3BOSA 1NR7A 2OHGA 4YRDA 3U7FB 2X9LA 2QV0A 4J16C 3STTA 1N78A 4EW3A 3UEOA 3UYLA 3UH1A 4MUJA 1D0VA 4U1RA 4F4CA 3B9PA 3CLRD 2OHFA 1I3LA 3TGPA 1ULBA 3D4LA 3KEQA 5KKNB 2NMVA 1QCZA 1JT9A 2PMWB 3E2PA 4XD7D 2JEYA 1H2WA 3E8XA 5DSXA 2FWAA 4EGSA 3CZQA 3ONDA 3FWHA 3H4TA 4K6CA 1A2BA 1OYYA 1X70A 4BVHA 2GN6A 4PO8A 4QFMA 1HE2A 4QUAA 3MRTA 3KDPA 1K88A 3S1LA 1YZHA 3KX2A 3GEMA 3PHBE 1T34A 2FEMA 3LIPA 4POAA 1V5IA 4OXRA 3UV3A 1Z36A 5I4KA 2WZBA 1PJBA 3VDQA 5FBLB 1CHNA 2PL1A 3LCRA 3QHPA 4P38A 3W3ZB 2WM3A 4CKCA 3JPYA 4FIZA 4HDNB 4B73A 4ZZIA 1DSSG 4FZJA 4QG7A 1TO2E 1TTTA 1U04A 3BQMB 4QHSA 2OLJA 4Y6GB 5C7OO 3Q0EA 1EFTA 4U2EA 2VF7A 4NKRA 4IUYA 4JDUA 1HLFA 3JXEA 2KSQA 4RO0A 3WHLA 3SKVA 2AF3C 4YRRA 3GFSA 1P9OA 3RVRA 3HEMA 3JVIA 1C4KA 1AUXA 1S89A 3C5HA 4S2UA 1YV9A 5AI8A 4ARVA 1CY6A 2QN8A 2VZLA 1WLYA 2FRDC 1ZXXA 3TEJA 4IIFA 2VXOA 1C0IA 4N8DA 4F96A 1S3FA 2GUWA 4IIYA 2XXBA 1SC9A 3QF7A 3W5DA 4E51A 1AQ6A 3RJ9A 2ZSHA 3OLZA 3ZD8A 1M1XB 2C3PA 3H5RA 3EZXA 2OZEA 4Q4DA 4V38A 3FD8A 3ZE0B 4S05A 4FJ2A 1C7ZA 1JFRA 1EBBA 3AUYA 1XPRA 3KALA 3N2GA 4A10A 1WMEA 3GFGA 5ALRA 5DTMA 3VGJA 1JMVA 3B12A 4OJYA 1VJCA 4O4JF 2A94A 2H8GA 3FHJA 4QQFA 3W2TA 4NENA 1VLMA 2FEAA 2OD9A 2R7KA 4FZVA 5CGZA 3VH3A 4B17A 3PNMA 1UJ4A 1XMJA 4RYLA 1JIUA 4GF5A 4K28A 2CN1A 3SJZA 4M8KA 2CFIA 4EDHA 5LYJF 4CLXA 4JI2B 1WUTA 1C7FA 4HEA6 4WBXC 1YO6A 1TRKA 2OM2A 1KJZA 1Y1TA 3DMFA 3U7EB 1P62B 3D6HA 1KAGA 2ADMA 4ZMRA 1K86A 2XX3A 2RSLA 1SKUA 1Y3AA 1JMYA 1QQAA 2I62A 1BGXT 2IEBA 2G0TA 3VKWA 4B4UA 2R751 1AKYA 1NBOA 1IBKB 2IHVA 221PA 3CH5A 3M6XA 3U3OA 4RTPA 4YNBA 2QRQA 4J0IA 4KPFC 2FGJA 2VHTA 4TUYA 5JU6A 3DXZA 2HREA 4FW9A 4BYGA 3K4QA 5F23A 2ZQZA 2ZT7A 2JF0A 2VDQB 2C03A 2TYSB 3HKBA 3C3CA 3DTYA 4PLWA 2BTQA 4G84A 3U4DA 2O8DA 3GJ6A 3CRW1 4RVHA 2CF6A 2GOYA 1JR6A 1WMAA 3C14C 2ZUFA 2V3CC 5K3FB 1F20A 2GAFA 3I73A 1QG4A 1BXGB 1TU0A 4GU5A 1KXZA 5BSWA 1BN7A 1KYXA 4Q9IA 4WUTA 1Y3FE 1QRRA 5ER6A 3LUKA 4HXGA 3P45A 3HY3A 3IAFA 4IQFA 4BFYA 4Z6KA 1PR6A 4LJSA 4M55A 4HYYA 4IVNA 4EJMA 1QIFA 4WFQA 1IOVA 2YYAA 1TJ5A 5A4MS 3KQSA 3N7UA 4CDRA 4A0SA 4WGFA 1ODTC 2LKCA 4RZIA 3EOBI 4PLYA 3HCOA 1II8B 3DMTA 4PVCA 4O02B 3ZV4A 1NX9A 1CUZA 4MEAA 5FOWA 5JS8A 2QUBA 3C98A 3KVYA 3MBIA 4Q3BA 4MW9A 2DFNA 2FHPA 2HA4A 5AW4A 4RL4A 2J07A 3PFBA 3TBFA 1LPAB 2W2TA 4KFRA 1K5PA 1K6EA 4RQBA 5JAZA 3KLBA 1EIWA 1LH0A 4WY5A 3CZMA 3UKDA 3UWPA 3AR2A 4RTOA 1CIPA 1OX6A 1YQQA 2VUIB 1PEYA 2QTRA 2XUDA 3CX6A 4TROA 3TW8A 1IY2A 4KRYA 5FAKA 3T3NA 1KMNA 4L3WA 2YJ3A 4EQZA 4TRNA 1X7ZB 5I4IA 2NIPA 2OESA 4IFTA 3TCKA 3O8OB 3CE6A 2PUEA 3NHFA 2V7VA 4BV3A 2H59A 5KWVA 2RD2A 1KMCA 1YZFA 3OJCA 1YB2A 2ZU0C 1C1YA 3FF4A 4J4TA 3VR6A 2IODA 3RK4A 4MA0A 4O29A 3K6KA 4FTWA 1KQFA 1Z5NA 2CMDA 4KX3A 3TEFA 3UZUA 1O87A 4E15A 2BKUA 3CUSA 1CQPA 1RCTE 2RAUA 3HPQA 2DQ4A 3KJQA 3NHAA 1JLRA 3CRNA 1UMCA 1PG2A 2W70A 2F59A 4JOBA 4CMEC 4P92A 4BUCA 3GJ5A 4CN9A 1U8FO 4DUPA 4Z1OA 1SC6A 3G6KA 2C78A 2A0WA 4GD3Q 3G0CA 4DG9A 1ZOLA 1R8JA 3GCWA 2COKA 3I6ZA 1SO8A 4LBZA 3NBUA 1US8A 2ORVA 3EIUA 1L7NA 4E5YA 4AAYA 2VJLA 3I28A 4PLZA 3H83A 3HL4A 5AI9A 5EZYB 1WNTA 1YACA 4HEQA 3X1MA 1F8UA 2JA2A 3N7TA 4EYGA 3PJEA 4AZ3B 4KEAA 1KYVA 3SBXA 5BT9A 1XMQB 4ZT3A 1KH3A 2NW6A 2CNWA 1AKUA 4WKPA 1CZLA 4G26A 4AZ0B 1L7DA 2BV3A 3ZI4A 5THXA 4AC9A 5M34A 4P22A 1CERA 3FM9A 2OO5A 1HF3A 3QWAA 1K4KA 1SIUA 4NLLA 2ZKIA 2ZVDA 2IVFA 4R2XA 3CWCA 5F7OA 1W36D 3F9CA 2XR1A 3QHQA 2BCEA 3GJSA 5FWYB 3T38A 1UH5A 3NC4A 1XDDA 1G8PA 3LUBA 3O2QB 4LWOA 3QV1A 1H0SA 1Z5ZA 3ETEA 4PC7A 1T29A 1J8FA 5A7GA 1XZKA 4PE5B 4Q21A 1C7JA 1SVKA 1EWKA 2N1BA 3PUYA 4AX4A 4OXQA 2P6MA 4NOKA 3SAJA 1G64A 1VL6A 4HNAB 3PFWO 4Q34A 1UFOA 3S1AA 4P3YA 1P5HA 2WU3A 2R79A 3GG2A 2WVGA 3O4FA 3NOVA 3VDRA 3MIIA 5BN5A 4CIAA 3ZDBA 1NYQA 1VYHA 1GQOA 3NGMA 1AS2A 4NHEA 2FQQA 4ENQA 2AC4A 3KWFA 1F9EA 4JBLA 3CMCO 5H02A 1VPLA 3BMOA 1U98A 4Y6QA 3VU9B 5E7MA 4DG8A 3SQOA 3NZEA 5AHOA 1WTCA 2OXFA 4BEVA 1KQGA 3MGKA 4JJ6A 5IK2D 2I2CA 4OH7A 5TT1A 3DT6A 2QE7D 5K1ZA 2X9NA 1E3IA 1HQDA 2Q5QA 5L6LB 4Z9BA 3NWJA 5IC4A 1YQDA 1GPYA 3CG4A 1ODIA 1X9IA 1YGPA 1SUPA 4PHCA 3SYKA 3H0KA 5KS2A 5G1NA 1H9AA 2A58A 4JLBA 2OAGA 5HVNA 1B15A 3LYUA 5J4KA 4JBXA 4NAHA 2PLNA 4IM7A 4DB4A 1G5IA 1XTKA 2EKLA 3P4UA 2WIKA 4DE5A 1VLZA 4CKWA 3KETA 4E08A 3WK7A 5EJEA 1ZIYA 2G08A 1FMJA 1RYBA 2XMRA 1ZGCA 3HLKA 1G1AA 2Z08A 5HR5A 1ZSNA 1A1SA 1SBHA 3QELA 4XCVA 5HBGA 2WG1A 3B6MA 2RGCA 1DDOA 4XWOA 4E3WA 2YRWA 3BYZA 3MD9A 1OBOA 3NHJA 5J1TB 1GNVA 2XH8A 4B09A 5LYJA 4CDGA 5LLTA 4HDOB 5EUQB 2C4VA 1T2AA 1WMFA 3E27A 1IFXA 3N8IA 4H60A 4PPGA 2IYWA 3UMYA 1SQSA 5IKXA 1M66A 4OMFG 4ZCRA 4QTZA 1NAHA 2YWDA 2MYTA 4GWKA 1CRQA 1ZWLA 2HLHA 1U9IA 3D7NA 4V0OA 1ESDA 3LX6A 5T4HA 2H4HA 1Y9JA 3L79A 5FTLA 3WTCA 4KB5A 1NWCA 2XT0A 4NE7A 4NFHA 1WXGA 1NUHA 2I29A 1L4YA 1W4BA 1VI6A 1FSGA 4X20B 4MUAA 3R09A 4YRSA 3EVAA 5EIAA 4CG2A 1EG2A 1Y0BA 5SZHB 1PR1A 2C07A 3PNSA 5C37A 3S99A 4BQIA 1WKCA 4GI2A 2GZMA 5HE9A 1S6YA 3OKPA 3W8RA 2QX8A 2OGTA 3RWMB 1JPJA 1HDGO 2HZBA 1RKVA 4HZIA 3Q2KA 2FZLA 2IP1A 2PZJA 2XE4A 5BW4A 1R8QA 3TQFA 5ILOA 2J3KA 5KUTA 5LMUB 2WUDA 3FZQA 4LZZA 1RYEA 4MVJI 1RXUA 1V8ZA 2PWBA 1NNI1 2OHVA 1LZLA 4NMLA 3WR5A 1OB2A 4P81A 1E2MA 1L7MA 2GA9A 2JLBA 3U4HA 3DDZX 3I2GA 4XTRA 5A3SA 4EB3A 1CYEA 4R69A 4F2HA 1PDWA 3ILYA 1RYNA 5JAOA 4F3RA 4JSYA 3DM9B 1WZNA 1V1RB 2AUNA 5DHQA 4NZYA 2A8YA 1J00A 1DBQA 1XHFA 1G21E 2QVLA 2OCDA 5CNJA 3JSXA 5E1OA 3AI3A 2VSFA 3D0OA 4L7QA 5DYNA 1ZJ6A 3RSSA 4QXQA 2PMKA 4BC1A 2NU6A 3WKEA 3K9HA 1YQUA 1TT5A 4BEBA 2IUUA 3LC0A 2DPGA 3LQ4A 4NX2A 5E9AA 3DMYA 1CUFA 2TRSB 3U7GA 1ZCZA 1SU7A 3L8DA 3FWYA 5EE9A 5EVCA 2E4WA 1U99A 4CCAA 2YWXA 4K9PA 2D1FA 5HF9A 3OU2A 5LVAA 2WJZB 4TS1A 1IZ0A 5J5CA 4XKJA 5REQA 1K8YB 4B3RB 1SD5A 4UHKA 2JGJA 5J58A 2R6CA 3V32A 1ZYUA 2HRZA 4BQEA 4IXNA 5ARBA 2ACEA 3H9BA 4EAAA 1ZHHA 1OYVA 1QCYA 3B1VA 1Y8RB 1E99A 4I19A 4MB6A 3MSCA 3FSEA 3LV8A 4BMSA 5LXTF 2QMYA 3SLKA 5ALKA 4LG1A 1FFDA 1MEEA 3LWBA 2N9UA 4TQGA 3ZVLA 3EPPA 4FYYA 1VHLA 1V43A 4I4IA 3ZNQA 4F92B 4OJNA 3QE4A 4W5TA 3TSZA 1W49A 2WLSA 3HKDA 3ABZA 1PJ4A 3GARA 2Z9CA 1EVIA 1QE3A 4QWMA 3VR4D 2YWCA 3ESZA 3F6EX 4CQMA 4ETNA 5I9LA 1J1IA 5FBVB 3WNDA 2FMFA 3RS2A 2IS2A 1UAGA 3WJ2A 2XHZA 2Y71A 2I4LA 3ZHQA 4HR7A 1AF4A 1A8HA 2ZRHA 1U02A 4ECAA 3ETGA 4DNPA 3HBLA 1VLVA 3A4IA 5HP4A 1AURA 1NR5A 3VZSA 1G8AA 4FJ0A 1W44A 3R5FA 4B6JA 4COOA 2J32A 1JEDA 5TGTA 4PFJA 3A6EA 5LP6F 2G5PA 5H70A 1IL0A 5KTYA 1L5MA 3MJHA 5KMGB 3B6JA 3FZEA 5I7AA 1T5HX 1HA3A 2V55B 3L7YA 2Y0PA 3LXRA 4OIFA 3TLBA 2F3PA 4GDFA 1IC6A 2CL6X 1X94A 3MMNA 3J80A 1ECCA 4NECA 2GK7A 2JGDB 5LU9A 1QLJA 4D41A 4EFKA 3WGNA 1GN8A 5DXFA 5JJ5A 4O8ZA 1U2QA 4V1CB 3EZLA 3JQFA 3DW3X 1UFQA 2W2OA 4LTMA 1IJKA 1MJGA 1WA5A 3DOIA 2GBIA 2HA3A 4DMRA 1E9VA 1FW8A 2JGLA 5DN9A 4DB2A 4ZPJA 2GYVA 2P65A 1WIWA 4DQLA 3D4BA 5I9IA 5JZMA 1RZUA 3GEDA 2FPUA 5MN4A 3F1KA 3TJMA 5EIHA 1T4BA 1CS0B 2CUTA 4Z4EA 2E3JA 1PNVA 2CVPA 1J06A 3HKEB 4KXVA 3SHOA 4QD3A 3BJMA 5LKRA 3R3VA 4MCHA 4Y9UA 5C2JB 4EPRA 3O75A 2GPYA 5IZCA 4CM3A 1YC2A 4P82A 3ZWKA 1WQ1R 3OLWA 1CQZA 3KE9A 3QKRB 5IZ4A 4K0KB 2EF0A 3MTAA 2FZ5A 3P5SA 4KFTA 4CF7A 4C4ZA 2QL5A 1PSZA 4EMBA 2X40A 3OE7D 1XNQB 5DP1A 5C51B 2B4RO 1JU9A 1OWMA 3GUZA 3KYIB 4DMGA 1A72A 3PLAE 2RONA 4PX2A 3X2FA 1PK9A 4OCZA 3L9WA 3ADOA 2FMIA 1XZHA 3M3HA 1EDZA 3VR5D 1X7YB 1Y3CE 3EC2A 5IEBA 2BFDA 3V7YA 1JDPA 3ZJTA 5H80A 1UT6A 2G25A 3LLVA 2ROQA 1PT8A 4G5RA 4HDRA 2K4MA 3ICQB 1EJBA 3KE8A 4ZCSA 4B3SB 1I0LA 5AVJA 2VHWA 1GUAA 3K6SB 2P6UA 4X45A 3QKUA 4ZO7A 4X64B 4TLMB 3V8NA 3O1IC 4MR8B 3W1WA 3CVOA 4BNWA 4RXTA 1CQJB 1JRLA 2UAGA 1Z5WA 4OBWA 5ALOA 3SXJA 3U44B 1QK3A 4PFKA 3WYEA 4RD0A 1CF4A 2HMUA 3IEVA 3G5UA 1PFUA 3I4LA 3OWXA 4Q4AA 3LZ6A 3NIDB 2E87A 3QENA 4B8WA 3VR4H 2L19A 5JAMA 4JAVC 3IR7A 4QPDA 1PJSA 3U9LA 2SKEA 1HFKA 1MVLA 1QORA 1EFKA 2BFFA 2OCKA 4UJ5A 5BQ5A 4UU7A 2Q1XA 2P5TB 2DQZA 1N1GA 2HWWA 2X9GA 4J16A 4A03A 2PAFA 4XCXA 4Y1EA 1SBZA 4C2BA 4EPTA 4I55B 5KO2A 3PHJA 5K8LA 2IKSA 4HMOA 4U6QA 2ODAA 4WE3A 1AV7A 3RVSA 2X58A 2RC5A 3I2FA 3Q87B 4M1EA 3ZBTA 3KPYA 1DC7A 1SY7A 3A9UA 2I6UA 3CLUD 5HPYB 1Y37A 2P6NA 4HPWA 4GYKA 3NCHA 4J0JA 2BEVB 3L8HA 3DL7A 3VR4A 3IE0A 5BMVB 2EBHX 2RH9B 3PQFA 3U60B 3OZXA 1H2BA 3F3SA 1I30A 3KXLA 1TYAE 2XCIA 3O31A 3O92A 4BS9A 3R7SA 1U7HA 3EMVA 4O4HB 3K0KA 1CVLA 1BFKA 1V4NA 2W6NA 3LT1A 1JJVA 4W7IA 4Z51A 1ZR4A 3O8LA 4BO2A 2C2YA 2J7PA 1XTRA 1QAOA 4FGWA 4AMVA 2GYUA 4K9KA 1J33A 4UZEA 3RJMA 4PZEA 2PGDA 3UICA 7ADHA 3PQ4A 2O6LA 2ID4A 2C7RA 1VRVA 2RBGA 3D5QA 3V2UA 2BBSA 4TMZA 5L51A 3EFOB 5FWDA 2C04A 3M5DA 3ZU5A 3COWA 3L0IB 1I7LA 3AVTA 4I5GA 3A6JA 1QO9A 3OZTA 4UM9B 1GTMA 4GL4A 2PZKA 1LTHR 3DBLA 2QN3A 3KZVA 4XLLA 3Q6IA 4XPIB 3CF4G 4PAOA 4DCOA 3JWEA 4OX9B 2PU7A 3DKVA 1IM2A 2R6ZA 2C4NA 3DCJA 3EGXA 1U90A 4UHJA 5G02A 3K71B 2VTBA 4OAQA 5BXYA 2KQUA 5JS7A 2WJ6A 1ISRA 1QXSA 4E5DA 4BDSA 1F2VA 1GOTA 5JAIA 4H6VA 5IFKA 3B89A 1JU3A 2QTLA 1FLVA 1YE8A 2QVZX 1UZMA 1QK5A 2ZB2A 3KIPA 4MULA 2HA0A 2X4IA 4C5CA 2GEDA 1RC1A 2DLCX 5T4BA 3IIEA 1RI4A 2CVZA 5DYGA 3RJ5A 1Y7TA 1QFYA 4TZ6A 3U3JA 2PR7A 4KBFA 3U09A 1B00A 2BOVA 1R5JA 1QG0A 3EGIA 2YQZA 1FYFA 2QM0A 2YYSA 4JWTA 1W75A 2D3TA 2HJ9A 3NHZA 3WYBA 3SC2B 3FTFA 3ZD9A 1EX7A 4BP8A 1V1MA 2Q3FA 3VJRA 4WXEA 1WG8A 3C5WP 2GBFA 1AF7A 4RE5A 4K86A 1KYWA 4ALJA 4R1MA 2H17A 1T91A 2Q5EA 3NVMB 2D0PB 4XFKA 4DBZA 3UBTA 2BE9A 4EG0A 1RWQA 1QVAA 3QVOA 3VVBA 1CEXA 1QIIA 2C3UA 2ZRPA 4JI7B 4YAKA 1W5SA 1UFVA 3K0CC 4KAFA 3LI2A 4XWTA 1D2MA 5CH5A 5HCUA 3RQIA 1I4EB 2ZSKA 1PR5A 2EBWA 3PT5A 3WMEA 2VUSA 5AHKA 1OU4A 3JS5A 5DPMA 1CY4A 1U0OC 1P1FA 4RIIA 2GD0A 3RFCA 1U8EA 4Q1BA 3CA8A 2I80A 4NL4H 5LPNA 1AIPA 3AEXA 3FJ1A 5H5JA 4F21A 1AQNA 2O8EA 1NV8A 5IW8A 3QKWA 1RI5A 4LV8B 1TD9A 2KMLA 2NVUA 4EW1A 2Z6QA 3TTYA 5DASA 3ZY2A 5JBNA 1Y34E 3HWSA 5CFPA 1NM5C 5JYEA 1FJGB 3ODGA 1GRCA 5FOQA 2QW8A 2DUNA 5C4IA 2LBPA 1QNFA 2GI4A 2PMDA 5DB4A 1UBEA 3RASA 4EMSA 5FTMA 2Q4EA 1YZLA 5TMEA 3TB6A 4GP6A 4V2IA 4IQ0A 1E4OA 4FCWA 3FX2A 3TKLA 4C3OB 3LA8A 1M8JA 1PJQA 4Z1MD 3CVWA 5A0TA 2OORC 3AERB 2ZPTX 3DM5A 4TL8A 4AZWA 4S1WA 1CU1A 1DJNA 4FP9A 4AJJA 2P1ZA 4KG7A 4FYMA 4S24A 3CRVA 2W6IA 4HFRA 1P7WA 4D44A 2D4AA 5FT9A 4XGQA 1T1SA 1N5DA 2D06A 4GMDA 1YUMA 5HGJA 1W36C 2ZYGA 3L4BA 2ZE7A 2XKBA 2ENUA 4CYMA 1VHQA 3WSVA 3W3AA 4CLOB 1VYTA 4XSVA 5C81A 1OFUA 3VYRB 1I80A 5EKSA 1WY7A 5CM8B 3P9SA 1Q16A 1VKJA 4IL5A 1ZJ5A 1A95A 1GRQA 1W30A 1ZVKA 4FFSA 2XQGA 3A4YA 3FTNA 1M2OB 1IY9A 1DFIA 1L5HA 3ROZA 2QLBA 2I1VB 1ZK4A 2NTJA 4G4SO 4Y2VA 3B36A 4D96A 3IILA 4X62B 1E0KA 1GPUA 3SZMA 1HRDA 4M0MA 3FH0A 2JBAB 2O0MA 3U4QB 1ABBA 2AN5A 1UXOA 1R64A 2Y68A 3W3AH 1BRMA 2QRKA 3D3KA 4ZV4A 1VC2A 3CR3C 3KWMA 1K4YA 1WD7A 3IOEA 1CBUA 1YDHA 2SBTA 3UOWA 5CFNA 5J23A 2B7LA 4ZANA 2CNLA 2HA7A 1DARA 1BMQA 5E3IA 2K7ZA 2V58A 3WFIA 5AQ1A 3S5JA 1MC4A 3C48A 3DYBA 5ALNA 2C7BA 4RHFA 5KOHA 1YCDA 1J1UA 1HG1A 3CKMA 2A67A 2WJIA 3O95A 2ECOA 1KC3A 3VI4B 1T6XA 4OH1A 1SUSA 4QXMA 4UBOA 3QG5A 1DOZA 1EX9A 1M1ZA 4XLTA 5D3KA 5EJIA 3GCZA 4PG5A 2HRBA 1VSBA 2EAUA 5BWBA 4LBWA 5BT8A 3ELBA 1PDOA 3EDRA 5KNDD 3GFQA 3L0YA 3P9XA 3UGQA 1NPDA 1PFKA 1EKXA 5U1PA 5FOSA 1F5SA 4XB1A 2XUQA 3FNIA 2J8ZA 2OQRA 2G76A 1KA9H 5F76A 5DV9A 4D9NA 1VECA 2B5WA 1E1YA 1TC2A 3QEKA 3UGKA 1K5GA 1U0BB 5LR6A 1QO7A 4YJ2A 1DO2A 2IBTA 1T2UA 2ANCA 2QUHA 3IVAA 1GCGA 1A9XA 1KEWA 1FTYA 1LPPA 2ODQA 3EGWA 5FL3A 1GPMA 1N9ZA 1WY5A 2G67A 2UVPB 2XMZA 5BSKA 4AG3A 2XMDA 2FAXA 1QZ3A 2J0UB 4BKRA 1QOQB 2ZI6A 1ENYA 1WRBA 1X9GA 3JX9A 1PWYE 3NRJA 4PC6A 4TKZA 4GKKB 2UXCB 1Z34A 2P40A 3ELYA 4MP8A 1Z4QA 4LPSA 5D1HA 5EHXA 3EXEA 2YICA 2NSLA 3IVXA 2WQ6A 4X60A 4X97A 5F2OA 5DRTA 3QWHA 4MAMA 4ZN6A 1QF9A 1WHSA 3W6PA 2XLBA 4EA7A 2FUEA 2VH1A 3D2BA 1YHYA 4YRMA 5CB4A 2NUTA 2EP7A 3AW8A 3COZA 3LWZA 4QGBA 3REQB 3VR2A 3ZZUA 4BP1A 1FU4A 5MF6A 2AJLI 5IKPA 3IH5A 4CI0B 2QRMA 3OLQA 1NI5A 2QX6A 1CJSA 1DRVA 4C4RA 3PEWA 3UUFA 4C14A 1QAQA 3UJDA 4D4KA 2W48A 2GDZA 4RK0A 3RT7A 3F7MA 3IKTA 3AYZB 2P9ZA 1EXVA 2GXUA 1UBHS 5ISMA 3ROGA 5FFMA 2OVBA 1TTPB 1S7GA 4HQ6A 3UTCA 3WGZA 4IHJF 4IRXA 5C7LO 1GXSA 2L18A 1E8DA 1ORRA 3R3ZA 3O3NB 4BZPA 5CBPA 2NWQA 4HUQB 1QX4A 4B9EA 2O57A 1FDRA 3B7PA 4G1VA 4UNIA 2FUG6 6GPBA 3AR5A 2J7PD 2PKQO 2P77A 1HDOA 3RU9A 1YULA 1Y8QB 4OFZA 1WEKA 2EQ5A 2OD7A 1TYZA 3MCWA 2BLLA 5F9MA 3UXEA 2BGTA 3IVMA 3QEMA 5DXJA 1XYYA 3PI7A 4RD4A 3X43A 4QVIA 3BCSA 4EMUA 1ANKA 2H1IA 3OF2A 3LQYA 1TOAA 4CKCB 1JKJA 1NY6A 2I1QA 2YY6A 2C5BA 1FDIA 4AIIA 3R0ZA 4MEBA 4G3XA 1YR8A 4RIEA 3SGLA 5K4GA 3A06A 2Q62A 4KQEA 1ZCJA 1U7WA 4JEUA 3H05A 2V3WA 1ESMA 5B36A 3DV0B 3U37A 2WNHA 1EE9A 1UEIA 5FUQA 1PV1A 3BFJA 3BXZA 5CVDA 4ERXA 2WJGA 1WULS 1T0IA 1I1OA 1O8CA 3KM0A 1SUIA 4GOJA 3QMVA 2B9EA 4MIYA 3AVYA 3G2IA 1ZM2A 4W7SA 3AVWA 4ZMBA 3EDCA 2NUPA 2AZDA 3DZIA 2FUKA 3ZWPA 5AKLA 5BW5A 4K7JA 2WKSA 2JL1A 1YKFA 3P94A 4ILKA 1KS2A 1QVVA 2X3UA 1EFUA 3KVOA 4GC5A 4PYLA 1F17A 1OKKD 5JAUA 1COWD 3EGOA 1ABEA 1IWOA 5U9CA 3OEYA 3T9BA 5JNUA 4QARA 3UY4A 1AGYA 1CEQA 2QL7A 3A9WA 3IBSA 4H7PA 3WJ1A 2Q6LA 3K2EA 1T25A 2BLNA 1A50B 4ZRNA 3EGCA 3MLBA 3RTGA 1DJLA 5CFLA 2NAFA 3MS4A 3ANTA 1RYDA 5ERGB 5TVGA 2VDRB 2YINC 2QK4A 2XUIA 1R3DA 3KB8A 4I08A 5IBPA 4DLTA 1A69A 3SC6A 2A2ZA 3QKTA 3GI1A 1ZOIA 3NYQA 3ONVA 4R8RA 3WK4A 3RRNA 4OATA 3B3QA 5LJLA 3R8FA 3FPCA 3DZGA 2X41A 3VPGA 3FFBA 5AM0A 3DB2A 1A9PA 2OO3A 5DHRA 1XJ0A 4UOZA 4KIWA 2VL7A 1W48A 5I5GA 3ZOZA 1CLUA 4XWAA 5JS1A 4X7MA 1JVSA 1G291 1XP8A 3N6XA 2D5LA 3D6AA 1EGMB 1QVRA 3E9DA 3PDHA 4R31A 3TNDA 3K8OE 3ADBA 4UNPA 1XMIA 1XXHA 4HB4A 3EGEA 4NG4A 5KWIA 1RXWA 4B2PA 1PT6A 3PENA 1DT5A 3EDYA 1BDMA 3T1OA 3D4OA 2O3TA 1BE0A 5ELXA 2Z57A 2HBQA 3ECSA 4FI3C 2Q3CA 1ZKDA 3BL6A 5HK9A 2RGNA 2IOHA 2JFXA 5K0GA 2ID9A 5BSUA 4Q1FA 3GJ4A 3VQTA 4XYEA 1CZOA 3OTGA 4HX5A 4QRDA 1G38A 5CTJA 1DFHA 3BJRA 4DILA 4WA8A 4MA4A 1OPRA 1Z8HA 4GM1A 5C8ZA 3HM9A 1JDNA 1T24A 4A1FA 3VYUB 4B75A 3AVVA 1M7GA 4Z4CA 1EIZA 5KBYA 4LJ5A 1GN9A 2VI5A 4F93B 2BFCA 4L51A 4PNPA 2GH1A 1TL7C 2H7YA 4QOJA 5JV5A 1FSFA 3O1HB 3RVMA 1ISSA 1NUTA 2PS3A 2QPLA 4RY2A 5LZ7A 5K09A 3DAYA 2HT6A 2C99A 4R1LA 1OV4A