2WJ3A

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
TDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
molecule tags Oxidoreductase
molecule keywords 1-H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
total genus 104
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2009-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 2wj3A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wj3A01
1P0PA 4L3WA 3W06A 1YAHA 2XUKA 5BOVA 5ALFA 1QTIA 4FBLA 5AI9A 3VJLA 2DHDA 4KR0A 2WUDA 2JGKA 4FDMA 4GECA 3QMWA 2BJHA 4OCZA 1DTEA 2O2IA 2YASA 1XRNA 3GZJA 4HXEB 2XUFA 1GQRA 4J0JA 1CUDA 4J0GA 4QDTA 1EINA 1FFDA 5HFNA 3G7NA 1HLGA 3H17A 4U2DA 2WHRA 5AKEA 4EBBA 3I6YA 2QUBA 1DX6A 3B12A 1CUAA 4X90A 4EY4A 1L7QA 3QPCA 4K6HA 1ZD4A 1N5RA 4EUSA 4X95A 2OPHA 2AXEA 4V2IA 1SCKA 3KXPA 5ALQA 5DNVA 4GHWA 1C4XA 1K6EA 4JUIA 1XZBA 1R88A 3WL5A 3O95A 3WL8A 1OXMA 1VZ2A 4C87A 1XRRA 2G4LA 1WPXA 3CN9A 5CT5A 3G9UA 3ZLVA 3O9MA 4BAUA 2EDCA 1AKNA 4C4XA 4MWTA 4G8CA 2OAEA 1QIEA 1QIDA 2GBGA 3B3QA 4G8BA 5DNWA 4UBLA 4E11A 4ZRDA 2FJ0A 3WA7A 4AO8A 1TCBA 5C8XA 1JMYA 2PVSA 5AM4A 1TIBA 4G4IA 5DYWA 5EIAA 3C5WP 1JMKC 2RGUA 2OXEA 4AB1A 2WIFA 3OC0A 4LXIA 3DS8A 4C89A 2XMDA 5JAUA 2V98A 5EHZA 1T4MA 5JAPA 5CT8A 5K3AA 3X3HA 1PFQA 4FLMA 2VF2A 4AO7A 4MYSA 4M0MA 1VE7A 3BF7A 3SK0A 5A62A 3EIOA 4AXBA 2ROQA 3EBLA 1MX5A 4J03A 3NUZA 5IVHA 5HKAA 5CH8A 3SC2A 4LXHA 1QTRA 4U2EA 4QWMA 3I6MA 1TCAA 2JEYA 1FSSA 3STWA 5AICA 3F67A 2ZYSA 3DKRA 4CG1A 3AUKA 2C58A 2CUTA 1D07A 3C45A 2J3DA 4FWBA 1CVLA 3FYUA 1IUOA 4B0PA 3FAKA 3H2GA 1AGYA 4BE4A 4XVCA 3G02A 5AH0A 4BBZA 3GFFA 3STUA 6YASA 4H0CA 2C5GA 1X2EA 5LZ7A 1XRQA 3STTA 1NU6A 4ITVA 3WWPA 5IVIA 1P0QA 2UZ0A 3H04A 3I2FA 5YASA 1YR2A 3GUUA 3W9BA 1KU6A 3HC7A 5ALIA 5DYTA 5EHNA 1N5MA 3BIWA 3TEJA 2OGSA 5JAHA 4BRZA 4DNOA 1UOPA 2P8SA 1MO2A 5K5EA 2HRRA 4OU4A 3LP5A 2WG0A 3T4UA 4N8EA 3H0CA 5EI5A 2VJDA 2HU5A 2XUOA 3H18A 2PSJA 2C5FA 3WYDA 4NVRA 5IVKA 5C8ZA 2ZSIA 3E0XA 5AK3A 1BS9A 2XUAA 5AI0A 4EHBA 3I1IA 1A7UA 5AK5A 1H2WA 3ZWQA 3WA6A 1A8QA 1UZAA 4MJ3A 4UFPA 2QXTA 1QE3A 1AZWA 2HL6A 4CG2A 1BU8A 3H2HA 4RPCA 5HF9A 1MTZA 4QDUA 3TRDA 3STVA 3M3DA 1L7RA 2R11A 1CIJA 2C0QA 1EK1A 4N8DA 3DYIA 5FDFA 1QFMA 5IH7A 5DYYA 1LZLA 4X92A 4MYDA 3S8YA 4L9AA 4BTLA 1IUPA 5FUMA 3IUQA 2XUHA 1F8UA 4X93A 1XQYA 3QZUA 3W05A 3G0CA 3CXUA 4IH1A 3BJMA 3E3AA 1QJ4A 3FSGA 3QMMA 1CRLA 2H9YA 2X8BA 4Y2PA 4HTAA 1J1IA 2CB9A 3ZV7A 3O4GA 2ZYRA 1DQZA 5LP1A 3PUIA 5A6VA 4DM7A 5K3EA 3RK4A 4DMFA 2VTVA 2XLCA 4Y7DA 3F98A 1DT3A 3I2GA 2RI6A 5JADA 1NX9A 2WFZA 3EQ9A 1MPXA 2PSFA 4FBMA 1QLWA 1XZHA 2J4FA 1LZKA 1EDDA 3WJ1A 3H2IA 3WL6A 4IQ4A 4AQDA 1MAAA 3MUNA 4Y2TA 4A23A 3KDAA 4Y2JA 2XB6A 2HFJA 1XZFA 2OCIA 1EHYA 1Q0ZA 1X70A 3BE8A 4FTWA 3I2HA 3VJMA 1Z68A 5KREA 4BE9A 5CBKA 1BE0A 4KE8A 2JIDA 4GDMA 4CI9A 1UK6A 4LXGA 3LS2A 1A8SA 3AILA 1CQZA 4OSEA 1SFRA 2W22A 1YSCA 2B61A 4L0CA 4TPKA 3CCCA 5AIBA 3FYTA 5AKYA 3KSRA 1WHTA 5SYMA 1QZ3A 5C81A 4C6HA 1WCYA 1BEEA 4KRXA 1LPBB 2J3QA 3G8YA 3H1BA 4QDOA 2J4CA 4ARAA 1JFRA 5AKIA 1GPNA 1CR6A 1ETHA 5I7UA 1F6WA 2XMZA 4H35A 5ALUA 1K8QA 3IBTA 4U2BA 5LKRA 1ODSA 3IURA 5ALLA 2JGFA 2Q0XA 4B85A 5ALPA 4ZXFA 4C01A 3WWDA 2Z5GA 4G8DA 3WJ2A 2CEKA 3C6YA 1CUUA 4OD0A 1O6FA 4BYMA 5EFZA 2GBIA 3STXA 3QBJA 4WJLA 4FKBA 4B81A 5ALKA 3PDCA 2G5PA 3FVRA 5FLKA 4EY7A 4QDZA 3I1YA 5AK6A 4D9JA 3BDIA 4X91A 5EIHA 2HDWA 3KWJA 3AZOA 3C6ZA 2XE4A 3D3NA 5CT6A 4BAZA 1GQSA 1ZI8A 2HA6A 3HI4A 3W04A 4P08A 1N1MA 1XLVA 5A71A 4ROTA 2BUCA 5FPQA 5FV4A 2XLBA 3IULA 1XZJA 5I9IA 5AI5A 3G0DA 4YASA 4PV7A 3I2KA 2VJBA 1UK8A 2DQZA 2YH2A 2X76A 4BVKA 2RHTA 2VT6A 4PQEA 4IH4A 5ALRA 4HXGA 2XQJA 3OOSA 2ONCA 3BL8A 5JALA 1MN6A 1ACLA 5EHXA 2QS9A 2QMQA 5FKJA 4Y2VA 4Y2SA 2VEOA 4F60A 3AJAA 5JAOA 3WIBA 2XMRA 1YAJA 4OPMA 2BFNA 1UOQA 3WKCA 3DOHA 4S0XA 4UUQA 5F4ZA 4KAJA 4H77A 3EF3A 3WL7A 2OCGA 1WB4A 3DYVA 3ICWA 4Y2XA 4J0DA 3D2BA 4BDTA 4H7HA 2BGRA 2OGTA 1TKRA 1EDBA 2FX5A 4FHZA 4X3CA 2VJAA 5KBYA 3H19A 5AKZA 3N0TA 1USWA 4IH9A 1DWPA 4U2FA 2WG1A 3FSGD 3M81A 3PFBA 4DSZA 2XUIA 4QZVA 2XMCA 5LYYA 1BEZA 1CUCA 3V48A 2OGZA 3FLBA 2XUDA 3C6XA 1MT3A 3CCBA 4K5QA 5K3DA 1EVQA 1ODCA 2HA2A 1CFJA 2WJ3A 1QO9A 4YX9A 1CUIA 3VVMA 4FNGA 1DWQA 1TQHA 5ALWA 1DQYA 5I8PA 1F0NA 5DWDA 4HS9A 5D3KA 2Z8ZA 3F8SA 1CEXA 1FFBA 4Q05A 3OG9A 5HFAA 4LYEA 2VAVA 3AIOA 4X94A 3HZOA 4AN0A 1YA8A 5AI8A 4J7AA 2JEZA 1E66A 2ACEA 4X00A 4NS4A 3DCNA 2O7VA 3GELA 3DL4A 4BC1A 1ZOIA 5J3JA 4XIIA 2PU7A 4AZ3A 3O4HA 5CH5A 2GZSA 4KE6A 1ZGCA 3V1NA 4ZGBA 2Z3WA 3CN7A 3D59A 3YASA 4N8SA 2JGEA 3RARA 2PUHA 1XRLA 3QPDA 4RGYA 5AKJA 4GEGA 1VLQA 3IB3A 4A5SA 2G63A 2I78A 4B0OA 4BCBA 2AJCA 3R40A 2XMQA 2DFPA 1FFCA 2XQGA 3JW8A 4MQMA 3U1TA 3ESCA 1OCEA 4GLBA 1TRHA 2WM2A 2WKWA 1AQLA 4AO6A 1ZIYA 5LIPA 1AMNA 1G4HA 1GKLA 1OILA 2O7RA 3IIIA 2ES4A 2Y6VA 4HRXA 3RM3A 3FYUB 4OU5A 3BDVA 4JYMA 2HU8A 4W1PA 2JGJA 1CUBA 1XKLA 4CCYB 1ORWA 5DTJA 1X2BA 2D5LA 4O08A 4P93A 3ILSA 4ZV7A 1R9MA 2Z8XA 2Y2VA 1SCIA 5HF6A 1SC9A 5FRDA 3RLIA 3AZQA 4FLFA 2XMBA 5KWIA 4FFWA 3UMJA 4Q3LA 5ALOA 2VSQA 3K2IA 1Y37A 5LZ2A 1S8OA 2JF0A 4MXDA 1XRMA 2JGLA 1HQDA 2WLSA 2WILA 3EQ8A 4B9EA 2WIJA 1JJBA 4DTCA 1YB7A 3D2AA 4YK7A 1XQVA 2QRUA 2X5XA 3ICVA 1KEZA 3SX4A 2QUAA 3VKFA 1XLUA 1CUEA 5EIEA 4XJVA 3EQ7A 2WIGA 3DEAA 3D7RA 7YASA 3HEAA 1N8SA 3D0KA 5BWCA 2YYSA 1ORVA 1WB5A 2ZJ6A 2XUJA 3F9CA 2FJPA 5CRIA 3DLTA 3HJUA 1IVYA 3FYUC 1MU0A 1QIIA 1W4LA 5HQ3B 4UHHA 3ED1A 3GA7A 5A7FA 3C6BA 3DOIA 5K3BA 2WSLA 3WMRA 5JZSA 4ZV9A 1G42A 1QO7A 3M83A 1RP1A 2C0PA 2IITA 1XZAA 4XX1A 1E5TA 5EHQA 1VOTA 4UHBA 5HK8A 2PSEA 2QT9A 1CV2A 3TJMA 1MX9A 4DNPA 2VA9A 3WK8A 5AP9A 2ACKA 3KWFA 1VKHA 2WIDA 3WWCA 2AJ8A 2V97A 5D3ZA 5CXXA 1BCRA 2QOEA 4LIPD 4KACA 3K9BA 4BB0A 5JATA 3OPMA 4JYPA 2HRQA 2XI4A 3DNMA 5CT4A 5HF8A 3R3UA 3DJYA 4W1SA 2HA7A 5LZ8A 5ALYA 1UFOA 4GBGA 4UHEA 1E8NA 4Q1VA 3ESAA 2PUJA 4J0KA 4JH0A 2PM8A 1J06A 1GPKA 1LBTA 4X71A 3A6ZA 4M0FA 1EH5A 3G9TA 5AKLA 3V1MA 5AOAA 5JZBA 4KYVA 2VT7A 5E4YA 5ALJA 1AUOA 1MNAA 2BUAA 1IUNA 3O4IA 1C7JA 3BIXA 1QOZA 3MVEA 4HXFB 4H7EA 2BAGA 4G9GA 5FXMA 4GW3A 1EXWA 5C7YA 5AIAA 2HA0A 2OQIA 5T4HA 4UPDA 1GT6A 5CMLA 3STYA 4EY5A 2FUKA 1XRPA 3G0BA 4QEKA 4RNCA 4BVLA 3I28A 1K63A 3HYSA 2EEPA 2QVBA 1UOOA 2AJBA 2OG1A 4WFJA 2PSHA 3O9VA 3PF9A 4QDXA 1AURA 5CXUA 4AZ0A 1RWQA 4DGQA 3WYNA 2OQVA 1E8DA 5LZ9A 3R41A 2DQYA 2XUQA 3C8DA 2PPLA 4KEAA 1ZI9A 2RAUA 3WZMA 1QIJA 1JT2A 2BKLA 3FLEA 2WTNA 4ZI5A 5JD6A 5AKHA 2PSDA 4KE9A 5HF5A 2WFLA 2IX9A 3VJKA 5KWJA 2W6CX 5T4EA 3G9ZA 2WFLB 2H7YA 2H1IA 4TGLA 5K3FA 4PW0A 3P2MA 5T4FA 1VJ5A 3S2ZA 1ACJA 3VVLA 1XZCA 3PF8A 4B84A 4PSCA 2WU3A 3DDUA 1PJAA 3V1KA 4LKOA 2XUPA 2JGMA 2ZYHA 1ZICA 4MEAA 1E3QA 4WY8A 1LPSA 5AHXA 4N5IX 4RE6A 2GBCA 4HAIA 3U0VA 2WUFA 4UBOA 5DLPA 5JIBA 5ALNA 4E15A 4U2CA 2Y1KA 4PNZA 1TCCA 1EVEA 1I6WA 3FNBA 5A2GA 3N2ZB 2XMSA 3G0GA 4UBKA 5FP0A 2CJPA 1DX4A 4PF1A 4X7BA 1LPMA 2DCMA 5CW2A 5AJHA 1BN7A 2WQZA 5D6OA 4FFVA 4J0IA 4FLEA 2BCEA 1H22A 5LKAA 3B5EA 3A70A 1ZD3A 3G9XA 1W76A 1BN6A 1ODTC 1XROA 1XZDA 1QGED 3WK9A 3R3WA 1NU8A 5DNUA 4Y2RA 4Q3OA 1LPAB 4JNCA 1GZ7A 1H2XA 3IA2A 1WM1A 5JD5A 5ALEA 1HKHA 1XZKA 1YS2X 2V9ZA 4BRSA 1P0IA 2HIHA 2HA5A 5H3HA 4OB8A 5CT9A 3V1LA 1L7AA 3WK6A 4DIUA 1B6GA 3QPAA 3WKBA 4AMZA 3R3YA 2ZVDA 4BCDA 4Z49A 4P92A 3RKSA 4WDRA 1DT5A 4AN1A 4RE5A 4BDSA 4EA6A 1XKTA 5ALXA 2CZQA 3O4JA 1QIFA 1WB6A 5AI6A 4FMPA 1VE6A 4BZZA 1A8UA 1LPPA 1VXRA 1ZD5A 3OURA 3ANSA 1JU4A 1BRTA 1TAHA 4OYYA 5LZ4A 3BWXA 4BZWA 3BF8A 5FPPA 2IIVA 4F21A 3FLAA 1VZ3A 1QONA 2DHEA 5LZ5A 5HQ3A 5IKXA 1ISPA 1U4NA 4H7KA 1DINA 2PKYX 1THGA 3C70A 4E14A 3IVMA 1KU0A 2VJCA 3BXPA 3HXKA 5ALDA 2WTMA 1Q83A 3VISA 1XLWA 2QZPA 4BC0A 1LPOA 2Y6UA 4F0JA 1HPLA 5ALTA 4Y9SA 4PSUA 3HRHA 5JZ9A 1YS1X 2GYVA 4ARBA 4EY8A 2WFMA 1JJFA 1CUSA 2JGIA 4H18A 1RYYA 4JEIA 1R50A 1XQWA 2QJWA 1R3DA 2OAGA 4X6XA 4CCYA 1TK3A 2O2HA 2XQKA 5HZGA 5ALSA 4DSAA 4QWWA 4X85A 5E4JA 1XZEA 4G4GA 3KD2A 2RIPA 3QMVA 3HSSA 1YCDA 1T2NA 1CUGA 4BCCA 1W1IA 2VAXA 1G66A 1XFDA 4HZGA 4DMCA 4UFNA 4INZA 3DKKA 5DJ5A 4DNQA 3MUOA 3R0VA 4Q34A 4C4YA 4K2AA 2WHQA 5A7GA 3FCXA 2HFKA 4CIBA 1DWOA 1F0PA 3WZLA 3T52A 2YXPX 3UUFA 3PE6A 1EDEA 3WIOA 1MAHA 3LCRA 2Y2UA 4Y2UA 3A2LA 1VXOA 3IDAA 5JASA 2C4HA 5K3CA 3AIMA 3LLCA 5HK9A 2DR0A 5SYNA 4WDQA 3IUNA 4CFSA 3D5EA 1IMJA 2XMGA 3VXKA 5ALVA 4XWGA 3L1JA 5AM3A 1ZIXA 5T4BA 2H7XA 5ALMA 3WKDA 3Q8WA 1M33A 2WJ6A 3I2IA 2ZJFA 1CUJA 3PICA 4MEBA 5A7HA 4A16A 4Y2YA 2WU4A 4BVJA 2C7BA 5LLSA 2Z3ZA 4MWSA 2VQ6A 4IHAA 4WCVA 1R4ZA 4OB7A 2K2QB 4G5XA 3HACA 5CTAA 3ZLUA 4B7ZA 3WKEA 5ALHA 1DU4A 4DMKA 1R1DA 4DMHA 4UBMA 3R3VA 1CUXA 2B20A 4I4CA 2WUEA 1YB6A 4WFIA 1FJ2A 2RONA 5AOBA 4UBNA 4Y2QA 3D2CA 4C88A 3WWEA 4ZWNA 4C4ZA 4IO0A 2OCKA 4QNNA 1EB8A 1B41A 3H2KA 4UHCA 2WG2A 3FVTA 1XZLA 1SOMA 1UKAA 3DQZA 4U2GA 2XT0A 2QXUA 2PU5A 1YASA 3QITA 3BJRA 4KE7A 1CLEA 4UFOA 5AKGA 4EY6A 5ISMA 2GYWA 4L72A 4F5ZA 2LIPA 3I6ZA 2QM0A 5JANA 1LPNA 1MJ5A 4W1RA 1WHSA 1ZD2P 1EI9A 1JU3A 4QLAA 3L1HA 1EB9A 2WUGA 3H1AA 1PV1A 4H7IA 1QIMA 1WPRA 3KOOA 2RHWA 4J3JA 1Q84A 1ZJ4A 3UUEA 5JYCA 1Y7IA 1R9NA 2OCLA 4KAFA 1J2EA 4FNMA 4FOLA 3IUMA 4K6GA 2ZJ7A 3C5VA 3DL7A 4NZZA 2GZRA 4ZREA 3G0IA 2WJ4A 1U2EA 3HLKA 3W2TA 2AJDA 2V96A 3IUJA 2GBFA 1IZ7A 1C7IA 4HVTA 2QTBA 1THTA 1CQWA 1JI3A 1MX1A 4DYHA 1GPLA 3GROA 5ALGA 5JD4A 3NGMA 1UXOA 3OM8A 3V9AA 3AFIA 4X6YA 1LBSA 4M0EA 1VA5A 3AZPA 3D4LA 3C8HA 4E46A 2ZSHA 1WOMA 2WHPB 4EB0A 4Q82A 4WFKA 4UBIA 4OUKX 2D0DA 1XZIA 3H2JA 4H7JA 3Q0TA 1EK2A 1W75A 2H7CA 4QE3A 5AOCA 2PX6A 1FFAA 1CUWA 1XQXA 3AIKA 2DHCA 3WWOA 3SWWA 5HCUA 4Q3KA 1E8MA 3WK5A 1UK7A 3NOXA 3AINA 4QA9A 1GGVA 2G5TA 3F97A 5C8VA 4EZIA 5BV7A 3PUHA 2QKYA 2ECFA 3ESDA 3QH4A 1XZMA 2B9VA 5HKBA 2EDAA 3QVMA 4HRYA 2I03A 1QIKA 5AM0A 4CCWA 2I3ZA 1Y7HA 4KJXA 5FOQA 1YA4A 1SCQA 3JWEA 1GXSA 3M82A 1ZJ5A 3F96A 3ESBA 4BATA 2ORYA 4K6KA 3WQHA 1QFSA 4UHFA 4B83A 1IZ8A 2HADA 3I2JA 4P9NA 3FBWA 3ZPXA 1MNQA 3FCYA 4OYLA 1UK9A 3FWHA 4UHDA 2HU7A 4H7DA 4CIAA 5AO9A 1LLFA 4B6GA 1QIHA 3GBSA 5DTIA 5JARA 3WLAA 4X6UA 4BAGA 2OLEA 1BCSA 3A2NA 2BGNA 2R8BA 4H7FA 4B82A 3W9UA 2XQIA 1UKBA 1H2YA 5BWBA 4YPVA 1G5FA 4B9AA 5E2IA 4CG3A 4LYDA 5AM1A 2B4KA 1Q0RA 5EGNA 1BROA 1UKCA 4X97A 2HA3A 4I19A 5CH3A 2ZYIA 5ALZA 3LIIA 4KRYA 3R3XA 4TVKA 2AJLI 3L1IA 1H23A 3QM1A 2VATA 4GWLA 4BP8A 1VA4A 1GKKA 2QJRA 2CBGA 2E3JA 2BUBA 2HHAA 3NWOA 1UWCA 4GI1A 1HL7A 2DSNA 2JBWA 1JKMA 1J07A 5AM5A 3C87A 3FOBA 2PBLA 3K6KA 4QLOA 1LNSA 1CUVA 4ETWA 4J0HA 3ZLTA 2O2GA 5CURA 4GXNA 1FFEA 1JJIA 4DNFA 3PFCA 3O0DA 1E89A 3TGLA 4B80A 2CMFA 5AKKA 4AMYA 4NMWA 1U65A 4BP9A 2WHPA 2XQFA 1CUZA 5K3FB 2QR5A 2GYUA 3WK7A 3LIPA 1P0MA 3E4DA 3C43A 1CUFA 1HBJA 1LGYA 1AX9A 2HM7A 1U8EA 3HABA 4DLNA 4BTVA 2I3DA 3ZI7A 4W1QA 1CUHA 1HDEA 4PO3X 3VDXA 3OTQA 1CPYA 2CKMA 1K5PA 3WKAA 4I3FA 3ANTA 4G4JA 4W9RA 1CUYA 5E4TA 1EA5A 4J0CA 1QIGA 5ESRA 3WK4A 4N5HX 3A2MA 4UBJA 3DD5A 4LHEA 1XZGA 3E1GA 5AK4A 2XDWA 1W6RA 1K4YA 3QYJA 4KAAA 5D7BA 4OB6A 1ZGBA 2HA4A 4WY5A 4G1FA 5AM2A 3MGAA 1UT6A 1ZI6A 4PSDA 1H2ZA 3PI6A 1AC5A 2PL5A 2WIKA 5AI4A 4G9EA 4MQLA 4AX4A 1A88A 3JYHA 3WI7A 4W63A 1W52X 1EX9A 1O6GA 2XUGA 2NW6A 3R3ZA 5AKXA 5IVDA
chains in the Genus database with same CATH superfamily
1WLYA 4AG3A 3AF6A 1P0PA 2CSXA 3T61A 5J2TF 1V95A 4BFXA 1QM5A 3JQ6A 4WI1A 2EF1A 5LCXA 4EI2A 3IAM6 2JIZD 1C1YA 4EO7A 2W4IA 4WLUA 5ALFA 4DWJA 4TWAA 1M1UA 1JBQA 1U2DA 1XG5A 4FBLA 3IQHX 1PR2A 3IP1A 3OQHA 3OZEA 2QE6A 4NHOA 1PN3A 2AA3A 4MWGA 4ZQIA 5FI0B 1SVMA 2O2EA 1IZZA 4J4TA 3RSOA 3UJDA 4AWAA 4PTYA 5L3VA 3M5PA 4RPGA 1WSBA 4GG1A 2HAEA 1FMTA 2DT8A 2PQ0A 1OMOA 3R5TA 3ZYZA 1C3OB 2RSLA 4HVAA 5KYNA 1SELA 2HDOA 3R0XA 2V4ZA 2QTMA 3IT2A 1QOPB 3K0FB 4FKZA 4KMRA 4BNXA 3B6EA 4J0JA 4K9OA 5JH7B 2C2ZA 3P97A 4OP1A 2JK1A 3VC7A 1CUDA 4X7RA 3WOHA 4EH1A 3AHHA 5ENZA 5HFNA 1OAOC 2MSKA 3G7NA 4NFYA 2LTAA 4U2DA 1ZH2A 2BMAA 3OQ1A 2PEYA 3C8UA 4JEMA 1L9XA 2WHRA 2GEFA 5DLQC 4MAMA 3FGOA 1LD3A 3W2HA 2CXNA 1CDEA 2GWRA 1KAMA 3LLUA 3W9SA 4EBBA 5B6JA 1NI4B 1SOWA 3NIBA 4XGNA 1MD9A 3MEQA 2AQ8A 1M1YE 1CUAA 3B12A 3HMQA 5EC8A 3IUPA 5IJ0A 4N12A 5IK2D 3WSTA 1GLGA 2O1EA 3OQBA 4FC7A 4PZ0A 5LQAA 2VF4X 2RGNC 4BMXA 1Z33A 4MGZR 4K6HA 5EMJA 3LCUA 4C21A 3JYPA 2JJ1A 1NYTA 1N5RA 2SCUA 3FPGA 3TFQA 4CF6A 1K4MA 3FPHA 3GGJA 3QLUC 2OPHA 1EM6A 1ESNA 3TKAA 1HA3A 3Q40A 4TLBA 1VL6A 2R8EA 4JKIA 1MFPA 3UH1A 1X80A 1MDBA 2I99A 3GT4A 4IS3A 4L85A 4GHWA 4MYRA 4F2WA 2WJYA 3DE4X 2QE7D 3H2YA 5T41A 1QP4A 2VBCA 1R88A 3B6JA 3WL8A 1FFXB 3BRQA 1DHTA 1GFWA 2Q3FA 3X1KA 1UM8A 2PKXA 2ZB2A 4YP0A 1L3CA 1GKUB 2ZVJA 1I1NA 3BE4A 4AU1A 2G4LA 3BXZA 3GMTA 5GADl 3RYTC 4BJ6A 4FMDF 1XR3A 4DRZA 2OT3B 3O9MA 1Z7BA 4CEIB 2VCHA 1ABEA 1JLRA 3NEAA 2FWMX 3AEXA 3SF8A 1TZBA 4J91A 3TVTA 1OYOA 1AG9A 1ZA1A 2AEEA 2WD7B 3BD6A 5HCIA 4G8CA 1E0AA 2OAEA 4MRNA 4WFQA 1I10A 4CKYA 2WKQA 1BO6A 1Q0SA 1Y0BA 4KXNA 2Z04A 4KXXA 1QBKC 1OWLA 1NJ2A 2XD4A 2GJKA 5DNWA 2QGNA 2W58A 5FLEX 4ZRDA 2D4AA 4JJEA 1TJ3A 2BCJQ 1K92A 1NW4A 4E11A 4JXXA 2P9GA 4HN2A 4OM8A 3WGJA 1TCBA 1E1CB 2C84A 1UDAA 1TU0A 2P68A 2CFCA 1BDBA 3C3EA 3NYWA 4P7BA 4G4IA 4KDRA 3AR4A 3U9LA 3EJ6A 3L8CA 5KDDA 3EW9A 2QAGB 2RGUA 4FDUA 4H4DA 1GCGA 2PGDA 3ZHUA 1LWNA 2XCSB 2C7PA 5TF0A 4MW0A 5A4IS 1FCJA 1V3TA 5DGHA 2NTNA 3BGIA 3KR1A 4DG9A 2VNHA 3H83A 4Q9NA 2C3MA 4EZBA 2WIFA 2WT4A 4HAUA 3HR7A 3UGQA 5A4KA 3PQ3A 2DR2A 5FTKA 1E2QA 1JLHA 1Z4QA 3BQ9A 4ZKEA 3ACCA 5JAUA 2VK1A 1JYEA 2V98A 4ZOAA 2C57A 2PD4A 4AYWA 5EHZA 1RMQA 3IDZA 4LDRA 2FQYA 1JHDA 5JAPA 3I30X 5K3AA 3X3HA 3LUPA 2P6NA 3BQNB 4O2BF 1G9TA 2WJAA 4BMSA 1DCKA 4R9SA 3BF7A 1HE5A 2JD1A 1I4EB 4QYIB 1P7VA 4Q1BA 2J7PA 2PJZA 4AVYA 2ROQA 3LOUA 5JMTA 4XM2A 4Z3OA 2P9BA 1SXJD 3W5DA 4G37A 3DAOA 1H4TA 4LG1A 3KM0A 3NBFA 3DDCA 4PEVA 3L7IA 1FX1A 1NX6A 1UBJS 2CXPA 4O1MA 5ECGC 3SDSA 4BRZA 3CLSC 2UYOA 1Z25A 3M4JA 1LW6E 1VL1A 3LBNA 4G84A 3WGNA 5BWMA 5LP6F 1PTKA 2AVDA 3AJDA 2G82A 2FPKA 4LXHA 4PYMA 4REQB 1VBMA 2NZ8A 1S4MA 2CLEB 1T3LA 4HGOA 4ER0A 2F4NA 5KZMB 3DO6A 5BYJA 4QWMA 1A27A 4LJAA 4LS3A 3KT8A 3PPWA 4XPIB 1II9A 4KIJA 3EXAA 4GRIA 1J0DA 2FDRA 1RQ2A 2YXDA 3CGGA 1VLJA 1LV7A 1HNWB 1YJ5A 1H0HA 2RKWA 3DKRA 1ELOA 3R7BA 4E7PA 3OM1A 1DAKA 3AW8A 1X1EA 3D3JA 4U7WA 2E4XA 2ECOA 3HPRA 3OZBA 1EG7A 5FBQB 1IG3A 4XGRA 2F43A 3IBCA 2OQ2A 2J3DA 4FWBA 5G1PA 3WLLA 4JI8B 3ZV5A 4BNNA 3OEEA 4MPTA 2DKOA 4MQEB 3UXHA 1HDXA 1G7CA 2EFYA 3H86A 3AOEA 4I6GA 4OGGA 3EBPA 4QOFA 9ABPA 4HAVA 2PUDA 4B0PA 2FPRA 1BKYA 2HV9A 2P9CA 1U2PA 1SB8A 3FVVA 1L5OA 3THXB 1I4TD 1JAIA 1PQUA 4YRFA 1G8KA 1DELA 3AKEA 4PGFA 2YZKA 5KUTA 5BVGA 4AKSA 4WZ6A 1CYDA 1IULA 1U0LA 2CEAA 2FY8A 2PGJA 4LHSA 4MTCA 4DSOA 1JHRA 2AE2A 3H5LA 1C4OA 1E1LA 5GGXA 4DYDA 6YASA 1V5EA 1ZUNA 2A86A 2D7JA 1LK0A 4IG4A 2C5GA 1LQUA 2RHJA 4OIFA 5JQWA 1XVVA 4JUFA 4G5HA 3EIEA 3OF2A 3HE3A 1JJVA 4U7JA 4BO6A 5EAIA 2PYIA 1TFUA 2BSQA 3OAAA 1M83A 4M88A 2FMTA 3BTSA 2J09A 2NUPB 3F6YA 3H04A 1UJ6A 3WLTA 5EZ6B 4K6OA 1H42A 3A32A 3ZTYA 2I8AA 2BKEA 2XBMA 1A9RA 1MO4A 2R62A 3AJ9A 2DY0A 4YYZA 2VHCA 1KU6A 2PT6A 3Q98A 5TJHA 1G8GA 4FJ0A 2MTBA 3LWNA 3WDKA 1DC4A 4RWEA 4RTRA 2YWBA 4RELA 4AC9A 5ALIA 5EHNA 3HFRA 2I2DA 1KVRA 3FAZA 3OT4A 5G40A 3CTMA 2AR9A 2P8SA 4DNOA 4ENVA 2VEDA 3H9UA 1DTSA 1K8ZB 3LSTA 4QPZA 3UA4A 4EF6A 3HWWA 2HRRA 3O3CA 4OU4A 1NI4A 3H4VA 3LP5A 4GR4A 2UYCA 2OXTA 3T4UA 4FW8A 3CLUD 4UE2A 4EY3A 2O3RA 4CHGA 1G6Q1 2OPBA 3INGA 4YDQA 2W00A 3JAKB 2X0JA 3KWLA 4YJ2A 2C5FA 3T7JA 3WYDA 2BM1A 4RD2A 2PANA 3WMWA 5LYJB 1Z4JA 2JK0A 4JQOA 5C8ZA 2ZSIA 1ISIA 3Q3JB 4G0OA 4YXWA 4J7CA 4PVCA 4HATA 3GFPA 2ZJAA 4IZHA 4MV4A 1EXMA 4KFUA 1FNBA 4I55A 4AN4A 3IMEA 3HG7A 5JWOA 1YZGA 3A11A 4FD2A 2IVFA 3G49A 4WGGA 5GWXA 2IEBA 2QN8A 3HV2A 4R1QA 4JJZA 3I1IA 2YUTA 4JEHA 2EHJA 4QL3A 2LBPA 1A7UA 3BH0A 4GOMD 4NCJA 5AK5A 4CMCA 4GUDA 4F8JA 2IUFA 4GNRA 2BEVB 3RRBA 1L5SA 5IT9A 1CFZA 1GGEA 1WEKA 4ARSA 3HO1A 2B34A 2H54A 3PUVA 4HL6A 4HRVA 5HILA 2DH5A 2QXTA 4ENPA 1QE3A 2LKDA 2KHZA 5CEEA 1U5BB 4RD1A 4GDFA 2C2MA 3RUIA 5DGDA 1S4QA 3HV0A 3KKOA 1CS4C 4RPCA 4YBZA 2JLCA 3CS3A 3DBHB 1FSFA 2OD9A 3M6WA 1Y48E 3KQQA 4KLZA 4W7SA 4UUNA 4WZAB 4CN9A 7ADHA 4GM1A 3V46A 1DDIA 4F3CA 2RHHA 1WZEA 3C16C 1L7RA 3GCGA 3WGZA 1CIJA 2WVGA 3C0KA 4AZSA 4BMYA 1UPBA 4NWIA 3KZMA 3PA6A 3DYIA 3HXPA 2GVZC 1ZHFA 3OEHD 3OSZA 2OL4A 4M9SA 4RPLA 2WTAA 4ZVMA 1G5PA 2OYSA 5D6NA 3VZRA 5IH7A 2QK4A 3VM6A 2W42A 3L4EA 5CJ2A 2EQAA 2ZT8A 4GQAA 2G4VA 4BO7A 5LQKA 2YVKA 3U4CA 1O97D 2EW8A 4NAVA 2QMYA 4NE7A 4YMIA 3ESZA 4IUCS 5EA2A 4R0MA 4K8OA 4QJ4A 4OQZA 1HYGA 2BZSA 4U7HA 4KOAA 1ACMA 1M2FA 5BOSB 2HNBA 3IUQA 3IYLW 3NU1A 3TW6A 1P7CA 3GZNB 2RJOA 1NLFA 4MUNA 1XQYA 3I92A 5EKSA 5FBLB 3ZGXA 3W05A 3FHCB 1YWGO 3D9QX 4IH1A 1QCYA 1AE1A 1WEHA 3L07A 3HSYA 4IIYA 4QPDA 5IZCA 1CRLA 4HDOB 1N7HA 4L57A 2JFUA 4Z9BA 1CW2B 5DBIA 5CB0A 3MHTA 2E5FA 2NYAA 1XYGA 1NT4A 2OFWA 3PPXA 4OK3A 1Y98A 1WCIA 3C3JA 3OZCA 2AG0A 2ATIA 4HTAA 3ISJA 3BSYA 4Y2PA 4EAQA 2C04A 2CLHB 1Z17A 3TW0A 3O4GA 1S2LA 1D0VA 5EESA 3WLNA 3SHOA 5LP1A 3O93A 3PUIA 3CEPB 4YECA 3OMXA 4E22A 3ETDA 5A6VA 4OHWA 1QVWA 5KJCA 4B4WA 2YXLA 2EU8A 2YIMA 3VBEA 1D09A 4YRNA 5IT5A 5JQGA 1W47A 1ZU4A 2CK3A 2VUUA 4YPOA 4MKHA 4OXRA 3I2GA 4MRAA 4CLRB 1DAMA 4YRTA 2RGCA 1F0KA 4EYOA 1RJDA 1NC1A 1E9DA 1R0YA 2FK7A 2I1LA 5ESDA 1EVJA 2WFZA 2I0FA 3EQ9A 4CXMA 2GPSA 2PSFA 5KKNB 3HXMA 2ZI3A 2A5LA 3O4VA 2QRLA 3L8FA 3N87A 2VVTA 1EDDA 3WYGA 2WABA 4MR9A 3H2IA 4H1VA 4XRRA 1KI2A 1MAAA 3WADA 4ID9A 3ENNA 4IKOA 3AW9A 3IAHA 3IKVA 4A0HA 2B4YA 5TQ2B 3BULA 3ROPA 2Q5JA 4CFZA 4Y2JA 2GHTA 2XB6A 1WUJS 3NTQA 5FBVB 9LDBA 3AM3A 4UDYX 1GQYA 2GDZA 2CHUA 3PCTA 2W6MA 4PC7A 3X1WA 3BE8A 4PC6A 1WBDA 4B8YA 3I45A 4YCCA 3UYLA 1Y6FA 5K6AA 4NESA 1DLIA 3UT6A 2WZBA 1DI0A 3ROGA 2BW0A 2OWDA 4MAFA 1EM8A 2KJQA 3P1JA 2VYVA 3VJMA 1Z68A 4XGKA 4WJKB 1CRPA 4BE9A 5CBKA 1R64A 4JXZA 5L8VA 2VO1A 2W2KB 1U0BB 4J0EA 1Q0UA 5C7LO 1JECA 1SUAA 5G41A 4ZOLA 4GPEA 3D4PA 3I5UA 1QP0A 1RLTA 1CTQA 2CXXA 3V8VA 4B3HA 4ZPXA 5G0SA 2AXQA 5CDUA 4D0NA 3W78A 4DABA 4F3RA 1FVOA 1FW8A 4RDHA 3AILA 4G0XA 1Y33E 2J3JA 3S28A 1SFRA 4C7OA 8GPBA 3FFBA 1Z5WA 1EEXB 2NO5A 1VKJA 1VLMA 5L3QA 1U8UA 1CJCA 1NQUA 2GJ9A 1NGSA 3PD0A 2PUFA 2XBLA 4C6TA 1SIUA 1VSQA 1WXXA 3CIFA 5FOTA 3CLRD 3QWIA 2GK4A 5HG0A 5BSRA 2ZSUA 2EJWA 2G67A 1XZPA 2XHZA 4L0CA 3JPWA 3RJTA 4O2RA 1Z26A 2W7TA 4NFHA 1ZVMA 3F1KA 2ZS9A 2PRYA 5EXPA 3HKEB 4J0FA 4AQ7A 1XTQA 3HWRA 4R3NA 1E58A 3L0IB 1RZVA 4S0ZA 1QZ3A 1DFGA 3MJHA 4Z9FA 1N33B 5LYJA 4C6HA 4BPBA 3LT2A 1IPEA 5G0VA 1NXOA 3TQTA 1LPBB 3S0JA 1BSVA 4JI0B 4I81A 5A3SA 3ZDAA 2V6BA 4OQQA 3MWDA 2BEUA 1O6BA 3COWA 3UWMA 3DOFA 3I4FA 1GPNA 4K3UA 5I7OA 4GGPA 1Z38A 5I7UA 1WDLA 2JGAA 3PQ5A 3MJTA 1THZA 2C98A 1OH8A 4L16A 3MCZA 4J6FA 4U2BA 1UMCA 2A92A 1E2DA 4RVHA 3LLVA 3FMIA 4J1TA 4RK1A 3ZU3A 3DNPA 1RHKA 1XNGA 2JGFA 3AG6A 1UBRS 2Q0XA 4IG9A 3QEAZ 1KSGA 2HCFA 4EI9A 4MARA 1KMHB 1P2VA 2C78A 1NUUA 2PJDA 2Z5GA 3LWZA 1KXJA 4G8DA 4OGKA 2IYQA 3LC0A 4P84A 5EP1A 3N6XA 3C6YA 1CUUA 2AH5A 3A27A 4ZANA 4OO3A 2BV3A 1VE5A 5IC5A 2GD6A 3EGDA 3DA8A 1FNCA 4EG5A 3L6UA 4E33A 1FW6A 3ZGVA 1TK9A 2V0GA 3FI0A 2GTPA 4GI7A 2M2IA 2CE7A 2A0XA 4KQ2A 1W35A 4F9EA 4UM9D 3HJRA 1V1RA 4FE7A 4AF6A 4M38A 3GRFA 1N0IA 2GN4A 5DM2A 4P54A 3F3KA 5EXEA 3STXA 5CB4B 1AF4A 4HLUC 4P7JA 4MO2A 3WNQA 3ORSA 4YPFA 5IJWA 2IP1A 3X0DA 4RH1A 1NP7A 2G5PA 2ILTA 2VP5A 3CBQA 2YJTD 3R6DA 5FLKA 3RFXA 1FFGA 1W19A 3NNNA 4J49A 4EY7A 4GPTA 3MMNA 4LOHA 1M0WA 2EZ9A 2JJ8A 4QDZA 4RFVA 3HXQA 3FTNA 4MKRA 4CJXA 1J9ZA 2J32A 4P33A 3I83A 3ASVA 4OLAA 4Z0HO 4F92B 5AK6A 2EKDA 2ZXEA 2RCYA 1Y4DE 3RSZA 3EVCA 4MH0R 2JI8A 1DMSA 4X91A 5EIHA 1KWKA 1A7JA 3K72B 4TWRA 1QU2A 1JG1A 3PT9A 3ZK9A 1EFAA 5EUQB 2F55A 4UM5A 3T15A 3MW8A 3RHZA 3BMNA 1D4AA 4EYEA 1QHHB 1RAIA 1MOZA 3JARB 3IEPA 1TEVA 3KUDA 1KVQA 1YXMA 1HEYA 2GEKA 1RTKA 1F2UB 2I8LA 4HWKA 4MCIA 4ML3A 2NO0A 5CT6A 4LCEA 2N75A 1E0JA 3AESB 3DWFA 4XDHA 3WDLA 5D00A 2O8FA 1ZI8A 4Q4DA 2TECE 1RI3A 3COSA 3KJZA 3KC2A 4DAOA 2O07A 2BBTA 4EGAA 1VRCA 2CY0A 4P3OA 2YZNA 4XIGS 1XLVA 2HK8A 2BUCA 1NV8A 4JC4A 5FPQA 1Y5MA 4BGVA 5FV4A 3AVYA 5CJJA 2XLBA 2QN6A 2J5KA 3PC3A 3ZXIA 5B7QA 1GGNA 1II8B 4PXYA 2UXDB 5JS8A 3UAOA 3L0OA 4XWYA 2HGZA 2A9OA 3T1HB 5DCUA 4HNHA 3S2EA 4D43A 5AI5A 1CJMA 1NLZA 1PLLA 3GEDA 4W8OA 2YNMC 3TL3A 3QXXA 2NXNA 1DWUA 3IBFA 4RTLA 2ZDHA 3IMGA 3MCUA 1ORIA 3A9WA 2ZAMA 3WBFA 1Q77A 2OCDA 3V7FA 1LW7A 3QU4A 4TOIA 2I80A 1BHSA 3INRA 2JFHA 2FR0A 3CRW1 4MPPA 3RU3A 3ZQJA 5BUZA 2JLXA 2IUTA 1U02A 3K4PA 4YAEA 4WKOA 2XDQA 1GM5A 4PQEA 1IBLB 1Z15A 2O3QA 5BV8A 2ZBVA 3JVVA 1WVGA 3QGMA 5JNWA 2ONCA 1QMPA 1U7XA 2Z2ZA 4DF3A 2REBA 4WCFB 4ZRMA 1PL0A 1A9OA 5FEUA 4X66B 3IMFA 5G4KB 5AW5A 4XJSA 3OX3A 1FTSA 2BTQA 2ZB4A 4IQFA 4KO8A 5JSQA 3QVGA 4JJIA 4ZC8A 4F3KA 4MDEA 1VFPA 3NOOA 1RMYA 2BE7A 1ACLA 3SDZA 3ZWDA 3O91A 4ZZ1A 1T29A 1T1SA 2P5SA 3T5PA 1KDTA 4G89A 2JGNA 5I51A 5TLSA 1XMSA 2QVZX 2LPMA 4G09A 3L9WA 1AKMA 1EQAA 4K26A 1VL5A 4BUJA 2VYFA 1J22A 3EG9A 3IXLA 4Y2SA 2MINA 2VEOA 4LTDA 4BFLA 4PX2A 3BRWD 1RCUA 5IMSA 4J94A 3HDJA 5U1PA 1JGTA 1P62B 4M9XA 5AXAA 1L5WA 1Y42X 2P35A 3Q3GE 1JFFA 4IX9A 5BT8A 3GG9A 4R2XA 3SM9A 4CIVA 5GZ6A 1Z6QA 5KQGA 4IGAA 2YICA 3QSYA 2D2IA 1DJOA 4CQMB 1YACA 2G08A 2WV9A 1PFKA 5B58C 3AETB 3DOHA 1ULTA 4HDCA 3SPXA 3X1ZA 4BMCA 2UYGA 2ID8A 2ODBA 4B44A 4JXJA 4CF4A 2BDTA 2C2XA 4E1VA 2EFJA 4P80A 4I4NA 5EJ8A 4G0MA 4O4IA 3NDJA 4TQGA 5COQA 3KHUA 2OCPA 1KK2A 4RPHA 2A67A 3DYVA 1CDOA 2EJUA 4J2TA 3L84A 4UNPA 3KZ1E 1FU4A 4OJKA 3SOPA 4KR3A 4PVDA 2ZAGA 4YRQA 4PCLA 4AL4A 2FK8A 1TVKB 3D2BA 3KE8A 3LVRE 5JAHA 1PGJA 2MSLA 1SBZA 2UYYA 2J07A 4H7HA 2OZLA 1UBSB 2BGRA 3GQBB 4RBNA 4Q39A 5LLDA 3HK2A 3LZ6A 3IODA 1ZZEA 4MR8A 2GOYA 1EDBA 3BIOA 4KTVE 4FS3A 2DPLA 2FX5A 2BH9A 1PP4A 4ZHSA 4FHZA 5IP5A 2YYYA 4GU5A 4ON9A 4MW2A 1YZVA 2O1XA 3ETEA 2BFCB 5LMNB 4HDNB 5KBYA 1TLFA 3PXBA 3TL2A 4AXXA 4BYGA 2HXYA 5EWJA 1RCTE 3O8DA 1A2OA 2EBWA 2PCLA 1YOVB 1AS3A 2ZPAA 2JAOA 4A3SA 5J43A 3WAJA 3SXUB 5K8UA 1L9KA 1Z62A 3WLJA 4FCVA 3AGQA 4EA9A 2O57A 3PFKA 4KOEC 1KRWA 2ZR8A 3R5HA 4G6ZA 2WG1A 2QNIA 3B6MA 3FSGD 1GPUA 3LM8A 5CK4A 2FUEA 3GT3A 5FUBA 3QEBZ 3UKDA 3L6BA 1ENPA 4GKAA 4Y1RB 1VYHA 4ND3A 2ZE7A 2X4GA 4WCFC 5EP4A 4QZVA 2OVFA 1K5HA 2R2GA 1T3ZA 4FN4A 2XMCA 1BEZA 5U4QA 1SWVA 2RIRA 4PLPA 1M3SA 1M66A 2G0TA 4QQ8A 3WRYC 4RTPA 3EGDB 2ZVQX 1GA1A 9ATCA 4D3ZA 4ES6A 2E89A 3FWYA 4P81A 5HPYB 1J2TA 1UAYA 4BZXA 1K89A 2Q50A 2HA2A 2V3CC 4RMIA 3HA7A 3CNOA 1JE1A 1QO9A 2OO7A 4R9VA 2PZKA 2QYTA 1CUIA 1ZITA 1JDZA 3OBIA 3ZGYA 3W3ZB 3VR0A 3WZ2A 2ZRKA 3HUDA 1XQ1A 4DDWA 1W5SA 5TQ0B 5HGJA 4YP7A 2P77A 3VVMA 4FNGA 3DAGA 3VYUB 4IMIB 4OMDA 4FZ5A 4QLBA 5AVQA 5JDIC 2PGIA 3CX7A 5DWDA 2XNDA 5LDHA 1AUQA 2CJYA 3K5HA 2J9ZB 3IEKA 5AVOA 4JI1B 4Z4CA 3FZEA 2AKEA 1M1NB 1A5TA 5FL3A 1J2UA 3N8HA 2Z8ZA 2C2GA 1S2IA 1CEXA 2F43B 4I08A 1AKEA 2DR3A 2ZZKA 2DHQA 2AFIA 3HXOA 2P90A 3CR7A 2CXSA 2X0FA 2DPHA 1Y6RA 2YIVX 1BHO1 4LYFA 5DN6D 1J9GA 1M2GA 1NSTA 3ISVA 3VUFA 2R1UA 1KJYA 3DD1A 4LYEA 3UZUA 3LKDA 4X94A 4DG8A 3EOZA 3X2FA 4TYWA 4A5OA 1YA8A 4JT8A 4J7AA 5JMWA 1E66A 1RC8A 1NMZA 5B6PA 4GSYA 4MV5A 2HY7A 4X00A 5I5GA 3NASA 4NS4A 1KI6A 3BFJA 2VWHA 1GJRA 2G17A 2YFYA 1XNRB 3R23A 2H2GA 3CBGA 2AJTA 2ZTUA 3PQDA 2R6CA 1JDVA 2O7VA 1KVSA 1V26A 1NBIA 2O6HA 3EMDA 3L6RA 4BVFA 3QEMB 2VT2A 2X8WA 2QRZA 3DE1X 2E7ZA 2ZZMA 3O4HA 5D5QA 3SQOA 1JHAA 4DR1B 3S1AA 2G9NA 1E62A 3KBOA 2BL4A 2IYUA 1ZGCA 5DP2A 1KBOA 1TM5E 2IYYA 4LJRA 3VPCA 2HBYA 2WTXA 1QWSA 2GN9A 2QI9F 5CNMA 4TLLB 4AZ3B 1G8HA 1QZUA 5BSTA 5FWYB 3D59A 4GMHA 4ZOQI 3NAMA 4II3A 4L5YA 4Y1FA 3RARA 1DLJA 3L79A 4UTOA 2EKZA 3K71B 2IEYA 1U4OA 4DLVA 2CVQA 1H4VB 3L7KA 4ZDJA 5BPFA 1VLQA 1Z6GA 2NXEA 1SBTA 1SG9A 1BXKA 5CFOA 2PHZA 2F3SA 1U1GA 2X9VA 4HB0A 3TNJA 3HJCA 2ZPUA 3LUKA 4DXDA 2G63A 4G25A 1D9ZA 3F2VA 3JVEA 3WLHA 4U00A 1EEHA 2AJCA 1ULZA 5AW0A 3R40A 1RMTA 1WU7A 1EFLA 4Y9DA 1FFCA 1C3XA 2WF9A 4MK4A 3JW8A 3SDBA 4OHVA 2QV0A 1TO2E 1X77A 2Q6TA 1HM5A 1E3SA 3CR3C 2Z4SA 4DANA 3IDQA 3ODPA 3B9RA 3JQBA 1I1QB 2FSPA 1TRHA 2DC1A 2WAOA 3O1IC 4AWBA 1BX3A 3C3CA 3VO8A 1JA0A 2VZ8A 5T8KC 3LQ4A 3VI4B 4E4TA 4WASA 2W6IA 1Q1BA 1Y8AA 4LGYA 5A5GA 1SU4A 1AMNA 1JHMA 1PD0A 1RRCA 2RDMA 1G4HA 3KB8A 3V7NA 1C80A 1T91A 3AF4A 3B5JA 3VSAA 4CODB 5J4HA 4U6QA 1XZQA 2R00C 1OILA 1WTAA 1WRBA 2FZCA 4IILA 1KR5A 2O7RA 2C2WA 3ONEA 4REOA 3T7CA 1GVHA 1K8RA 4NCBA 3RNOA 1DXHA 1U1EA 3SJ7A 4NS1A 5AWFC 1AGNA 5B64A 2PXCA 4G97A 4HRXA 4HO1X 3P4YA 3UFXA 4DLYA 3FYUB 2G76A 2ZRCA 4I2VA 2AW3A 4FYYA 4PN7A 5CG2A 4GZ3A 2GCIA 1WCXA 5DTQA 2ZSKA 2HU8A 1IOVA 1RPNA 2QMHA 4WK0B 4F93B 2JGJA 1CUBA 1XKLA 4MVCA 4CCYB 5DTJA 4W9NC 1YL5A 1TUIA 4O08A 5JAZA 4QDKA 1Q1EA 3ILSA 4ZZIA 3T94A 3DONA 3VC3A 1NW8A 3ZY3A 3PWKA 3ZZNA 4B7UA 1T6ZA 1H9CA 1GL9B 1SHKA 2Z8XA 4MHOA 2GN1A 1ZN8A 2CHVA 4QPNA 4DUZB 5AW4A 3R0QA 2AFIE 2Q5HA 3IA7A 4GR9A 5JOQA 1W36B 4IGKA 1A2KC 3RLIA 5HXAA 1LF5A 2WYWA 5IN4A 4L07A 3LCJA 2QW8A 1G59A 5LXTF 1L8LA 3L3BA 3UMJA 3ZOKA 1MKYA 1X1TA 1U31A 1YI8A 4AMUA 5ALOA 3CH6A 3D8NA 2L2QA 3T1QA 3PUWA 3NTRA 3TIIA 1W8IA 4KNYA 1S8OA 1ZH6A 1UXHA 5EFOA 4V1CB 1SCAA 3TOVA 4MXDA 2RHDA 2QQ5A 4R41A 1GGMA 2FLVA 1EFCA 1AU9A 5CTJA 4YGXB 4GMKA 1WAMA 3RJ5A 4Q1FA 4Z7QB 2CCKA 1J2YA 2I33A 1MEJA 3CNBA 3GAZA 1A5ZA 4C3ZA 4WESB 4XEUA 2XHEA 5JU6A 1FSGA 3H75A 3O92A 3MJSA 1MXHA 2HPZA 3DZFA 3LT5A 2ZIGA 5ECWA 3MM4A 2WIJA 3DBHA 5AW9A 1UPTA 2A30A 1EDZA 5MN5A 1VCOA 1BJKA 3NDRA 4PGGA 5IYZB 4E07A 1OFUX 3KV3O 5F7XA 4D99A 4EFLA 4J6EA 5B57C 5CLIA 2CV0A 1WP9A 1KFKB 3VKFA 2HBQA 4MRRA 4UULA 1IHXA 3ORYA 1CUEA 4F5WA 5JAIA 1U6KA 4OXIA 2P5UA 2PRKA 1IQRA 4RGQA 7YASA 2JZNA 2J31A 4AF8A 4M9RA 3D0KA 3IR5A 4LAFA 1OE0A 1J8VA 1U28A 4PHGA 1XWWA 2GH1A 4ZCTA 5AVXA 2XUJA 4TLMB 2IY8A 5CRIA 5IJ9A 2G5GX 3H11A 3JASA 3RGGA 3ZHVA 2VUHB 3L7CA 4B2YA 2HJGA 5C0OE 1MU0A 2CL6X 5AFSA 4UAVA 2QSZA 2VQ3A 3KZXA 1X6VA 4IDOA 1BGWA 3ZU4A 4TM8A 3G2QA 4DWVA 3BE5A 1UC9A 2Z6VA 4LI0A 3C6KA 3I76A 3AK4A 2GKOA 2M9MA 3BWBA 3L7AA 4I5FA 4ARVA 4HSGA 5LMZA 3EXFB 3ADDA 4RKQA 5TVGA 3FIJA 4LSMA 4BNZA 5C1OA 5JZSA 5LQRA 2PGNA 4BXOB 1QKIA 3PJEA 3QKRA 4DA0A 3IELA 3ZD6A 1T2FA 2C8JA 3NUGA 2X8JA 4A9AA 3RAEC 2JATA 3OQIA 4YWJA 4JI3B 2ZWAA 2OFPA 4F04A 2C0CA 1TNDA 3QPVA 4EVIA 5B36A 2UUBB 1P7YA 2DWCA 2P2CA 3CNLA 1O5TA 2V4UA 4UHBA 2VOEA 1QOQB 1RAGA 3L41A 4MGHA 5HK8A 1VJGA 1NG1A 2YMQA 2HPHA 4AJNA 4F9FA 1I2AA 1CV2A 1Y3HA 2WF8A 3QTTA 1G19A 4C78A 3TJMA 1KQ3A 1EFKA 1GU0A 4IDPA 3OM9A 4RZQA 5EVCA 1W0KA 2W2KA 3VKVA 3S3TA 3VU8A 1P17A 5BSHA 1JU9A 3L0SA 4ZAGA 2YWRA 2BI8A 2IXTA 3PGLA 5E8JA 1R4MB 1UPAA 3PLNA 4DMMA 1KY3A 3KD3A 7REQA 4B32A 2Z95A 3OPXA 2CKDA 3MD0A 1FJXA 2IF0A 1IN1A 2PXXA 4TSFA 1KQFA 1K6IA 3QWHA 3HBJA 3JQ8B 4XJXA 4XWOA 4KQGA 4QVKA 1LI4A 3FH0A 4EMTA 1NW6A 4UCQA 5KDLA 4KACA 3MCTA 5J1SB 1J21A 3PWSA 3D6HA 1IBCA 4JVNA 3SAJA 5JATA 3R76A 1H3EA 4LF8B 4R1MA 1Q6ZA 1E6EA 2Q8NA 3EVBA 4I14A 1RXSA 1I4LD 3P2YA 3OPYB 3KPUA 3ND5A 1B74A 1DEHA 1JT9A 1DC7A 4JX8A 3D1JA 5HF8A 1MO6A 2ZRMA 3QNUA 1Z4NA 2DPGA 3R3UA 2QL7A 2WI8A 3KVRA 3CM0A 3U40A 5C52B 1PR4A 1MR3F 4W1SA 1O54A 1OB5A 4OY3A 2D2FA 2ZQZA 1Z88A 2NADA 3IMCA 4Q1VA 5BUSA 1ECPA 1E2EA 1PFVA 1RAAA 4G5SA 3BFPA 2ENWA 1ANKA 1ESEA 2YMPA 2QRNA 3KL2A 4ZQGA 4ASUA 4AY2A 1RIFA 4FFNA 4YROA 4GPD1 2PKCA 2QRKA 3R7WB 1IY9A 3BRSA 3ZWKA 4M1TA 4DV0B 4JH0A 3UKOA 4D3DA 4EW6A 2J5BA 2NMVA 5I9TA 1Z5UA 3FGPA 5E0KB 1J06A 2E4UA 2D0PB 1IZ9A 2WTBA 4P4LA 3SJZA 3BXFA 3Q11A 3ZW9A 1UJBA 4GLLA 3M3PA 3A6ZA 1D1QA 1XP8A 1R8XA 4OFXA 4CDGA 4Z2AA 2D6FA 4MS4A 2X14A 1U98A 3RUCA 3VKUA 1JKXA 2ZBRA 5AW2A 1HSOA 5HKAA 4TL6A 1XHLA 3V1MA 2VJNA 4DXAA 5JZBA 3F0TA 1F3LA 1LV8A 2AS0A 2Y76A 2DMRA 2NO4A 4BV2A 3MERA 4JP8A 4WV3A 1VKRA 1MAWA 5A0VA 2IS6A 4DLPA 1UMBA 1E63A 1FDVA 1S2MA 3DE3X 3RUPA 3GNTA 5KTNA 1T4CA 3DAPA 2JLVA 1I6KA 4LF5B 3QE0A 3O4IA 4RD3A 1VGVA 4ZVTA 1FP4A 2P79A 1HQKA 4GX5A 5DN6A 3I8XA 2QAGC 4GX0A 4A4DA 5C5IA 4WLNA 3STHA 2A1UB 2Q0HA 1L1EA 3L5KA 4G9GA 3TQHA 2HLDA 4P5PA 3TUIC 3VUEA 2Q3BA 1EXWA 2PUCA 2XCOA 5DU2A 2HA0A 1KEVA 2Y1WA 4FDVA 1NJ5A 1U0HC 2QVXX 3N2KB 1I33A 4HUJA 4KPUA 3T54A 3WO1A 1JN0A 2GAJA 2QVYX 1PEYA 4XDZA 2FUKA 1LDNA 2W2PA 5D01A 1OREA 1S2DA 2Q27A 1W581 2AF3C 1AHIA 3RRYA 4BVLA 3OX2A 4ESOA 4CL0A 2GCOA 4DMGA 4R68A 4B31A 4GYWA 1K63A 4L8YA 5EP2A 4CR8A 2CK3D 5TY0A 1K0UA 1ISHA 2O7SA 1NURA 1FPMA 1XLTA 2KBFA 2RHOA 3CPSA 3GEMA 5DDIP 1V9LA 1C1XB 1VL8A 2CJXA 1FU8A 2PZLA 2VKTA 2EEPA 3A6FA 4RVFA 5JJBA 4L6CA 1QMGA 4PLFA 5LUAA 1TTTA 4V2UA 2VPTA 4UJ5A 3RFFA 3GHYA 3OIUA 2AJBA 3K0CA 3Q1KA 1UP7A 2OG1A 3CH7A 4WFJA 3QTBA 5JVDB 3C97A 2AZTA 1E2LA 1Y8RA 2R1VB 2IYTA 3GZTB 3O9VA 4RANA 5GONB 2Q3MA 5IAKA 4PM4A 2XCQA 1V6CA 5JSHA 1MB0A 1D6JA 4DCOA 1ECJA 3U7QA 3DMGA 1G8JA 3PIIA 3HS3A 1E1MA 1RWVA 2GRAA 2GZMA 4MVJA 1I2BA 2IHNA 1F2TB 3GJ8A 3ETCA 1PL8A 4AP9A 2PQ2A 1QR6A 1KWGA 2OQVA 5FB3A 4X62B 1DJPA 1FLVA 3E9DA 2FOXA 3A3OA 1HGXA 1IBRA 1T4GA 4RVCA 4MROA 1UFRA 1QFYA 3HTXA 3BWVA 1M8PA 1RZUA 4FCCA 4ERNA 1CU1A 1Y34E 1GTJ1 1DQRA 2FHPA 2MYTA 1AKUA 3K0BA 4FUTA 4KO3S 1DCFA 4OMFG 2HSZA 4P0TA 5EXDA 4DIOA 3GMDA 3M70A 4N6NA 4TRJA 5I7SA 1QIJA 2KM1A 2X3FA 1JT2A 3NEYA 5L4SA 3QPBA 1GZ5A 3HGMA 3ZBQA 1GNVA 2Q29A 3FLEA 1XN1A 3TI7A 3EXFA 4ZI5A 3ZHQA 1NW5A 4FMCF 4C05A 5HJ5A 1DEAA 5H4HA 5JS6A 3I53A 2JFNA 3ZCRA 1V4BA 2XDQB 3S8EA 2XB9A 1Z4PX 1SXJC 3QELB 3FNHA 1OYYA 3HUFA 4YJ3F 4TRRA 4ZIRB 2RBGA 1Z83A 4XYEA 1PZFA 1Y9DA 1QZZA 2W6CX 4IDEA 2EV9A 3OQPA 2FRDA 2WK1A 3DDWA 5DNYB 1QHSA 1XL1A 2EW2A 2BPOA 2H7YA 4O8ZA 1NAHA 4X44A 4X7MA 3DJFA 3D5QA 2GPTA 5GQSA 2P6MA 1VHJA 4YCSA 1EFTA 4AY5A 4G0QA 1M6WA 1UKEA 3E1SA 4QHTA 3UOGA 2XITA 3G5UA 3OF3A 3ZDXB 1MBZA 2G5CA 1EWTA 1JPJA 1ACJA 2ZIVB 5BSMA 3S55A 5HR5A 3VVLA 2ZUEA 2P2SA 4R40A 4B84A 3LI2A 3GJYA 4HWOA 4ZEMA 3CB2A 4RHCA 4ACAA 3QHPA 4JI4B 1IC6A 5JXHA 1GN9A 1HDYA 4CDNA 4NYIR 2H1WA 1HK7A 2XUPA 2FQ1A 1YCFA 2LV8A 1DV1A 2GBLA 2GI4A 3L40A 3T9AA 1YQ9A 1E3QA 2HEIA 4KH0A 1IXSB 4WY8A 1JLLB 2IYEA 2XW6A 3PL5A 1AKWA 4UAJA 3E2IA 3LQFA 1LQ2A 2GBCA 2QTHA 2A58A 3KKZA 1L6IA 1XX6A 5REQA 4BB6A 1VCHA 2PL3A 2A4MA 5JCOC 3G7SA 3Q9LA 1G20B 6ADHA 5JY1A 4MP3A 4UNQA 1NJ6A 5F21A 5G4KA 4UVGA 1UBHS 3KFXA 5ALNA 2QVCA 4OK5A 1U7TA 2HMYB 4U2CA 5GJVC 4I8IA 5TC4A 2BZGA 3GRYA 1CS0B 1EK5A 1U0NA 2DKNA 4B46A 4F4UA 5KOHB 4FCTA 1UZLA 3ICPA 4IIJB 5ICGA 3U48A 1WUYA 3BD7A 5A2GA 5JSZA 4R98A 1P8AA 3TLJA 3GLFB 3PC7A 4MR8B 5FP0A 1QK5A 2CJPA 5JFOA 3QIVA 1W0CA 4DBLE 1JXAA 1DG9A 5AVRA 2DCMA 5HDBB 1YKSA 4IDDA 2ZI7A 5CW2A 2HQOA 3G2OA 5AJHA 4FR0A 5KTTA 2VIIA 5D6OA 4X1IA 3SLRA 2WM9B 2W6QA 4FFVA 4XUEA 5KC8A 4Q15A 2QQGA 1U99A 2MSEB 2WM3A 4ZEXA 3T5GA 3AP3A 3EPRA 4QO8A 3BQMB 5DP1A 4L2IB 4O3FA 3V7WA 2EKPA 3ED5A 3JQPA 3IIJA 5AHKA 5EHIA 2UU9B 4YAUA 2V5UA 3AETA 3OCZA 3A70A 3KHTA 2Z1NA 3DE7X 3BYZA 1L5ZA 3TLMA 3BMCA 1ZD3A 1DV2A 3G9XA 1U6IA 4BFCA 3A6PC 3ON5A 4MQ4A 3SZOA 4L1KA 3D1VA 1XZDA 1QGED 3R9XB 2WYOA 4UVEA 4CUZA 2BHLA 4BJ3A 4D57A 3ROMA 5FT9A 2RHGB 1GZ7A 2KSQA 3I37X 4KWEA 3VO2A 5DNCA 1RZRA 3ZX4A 3IA2A 1VECA 2GMWA 2KI5A 4MQFA 3WGIA 3RAPR 1XZKA 2V9ZA 4BRSA 3P45A 5E3JA 4LNAA 5D1NA 3U3RA 3LP8A 4KPYA 1NJGA 1G3MA 1T6YA 1SC1A 3QK7A 2COUA 1I7NA 1LTQA 4C7MA 2GETA 3M6MD 3TN7A 4XLTA 1YR6A 2PS9A 2BGJA 3I01M 4DCMA 4PIPA 4YS6A 3V8PA 3E9YA 5EZQA 3RVKA 1NKTA 2ZVDA 3NTXA 4MNTA 2IW1A 1U7HA 1NQOA 1I5EA 1PZNA 1Q1NA 2GLTA 2K6GA 3CUKA 2VAPA 3NKFA 3RKSA 2C59A 2FVXA 2OCXA 4WDRA 1R37A 4PAWA 2QTNA 3OCUA 2LWIA 4MLPA 4R69A 4BDSA 1C1XA 3C41J 4DIEA 1N3YA 1E5XA 2AFHE 1CCDA 5KYYB 4L9SA 4QM7A 2G72A 4LTNA 4DCSA 5CVDA 4GPAA 2QLFA 1S7CA 4Z8XA 5DYNA 4WVFA 2GA9A 4LRYA 2VPWA 1GCUA 2CZQA 2Q2OA 3V2UA 3OWHA 3BGOS 1FLDA 1MGPA 3MT0A 2V03A 2PZJA 3HNPA 3TEMA 1WB6A 3PXUA 2C83A 2DX7A 3ENQA 5A9RA 2ZS7A 4QBKA 1XTUA 4LOLA 3A6HA 4KL8S 4BZZA 5AVWA 1A8UA 4HFRA 1CQIA 5J2UF 1KYXA 3EFEA 4CM4A 4E21A 4DV4B 1C0PA 2GFHA 3F7NA 3W0LB 3SZ3A 3QF4A 1JU4A 3WYFA 5J58A 1MB3A 1F6DA 3OF5A 4ESVA 3U6KA 3UJ9A 3AYZB 4H31A 3NGLA 3DTTA 3ENZA 2WMNB 3IMKA 1W93A 4A03A 5C80A 4RIGA 3BWXA 5LZ4A 4ARIA 1ICIA 1T8PA 2ETVA 1L8XA 1XMQB 4TMTA 2O8VA 4BZWA 4PZCA 3KTDA 4GVXA 4WK6A 4MJXA 3BF8A 2HRZA 3O2QB 2IIVA 4Q16A 3NQ41 4M0DA 1VPWA 1BA3A 2B83A 3R3SA 1VE1A 4EJ0A 3FLAA 4TWIA 4UTXA 1TA9A 1XTJA 4PYJA 2FUG6 3MK31 3DEHA 1FC0A 1I3KA 1NR1A 2Y8EA 6REQA 3BVPA 5LZ5A 5HQ3A 5DTEA 4TWZA 5IWCA 3E9EA 3CVXA 2PGLA 1Z3CA 3BMQA 3OTHA 2XGOA 3KR0A 4R2MA 5BN5B 3T0IA 4CZ2A 5HRUA 3DPSA 3EUWA 2C54A 1NJ1A 2OP0A 4Q0MA 4DJJA 1NTOA 2OHIA 3ZNOA 5FA5A 4MGYR 3ZIAD 3RSQA 4JV5B 1ZD1A 2OR3A 3NGXA 3J81k 1QHNA 4UNIA 3OCWA 3L8GA 1TYCA 2PD3A 4TYPA 5DBOA 1BAPA 5ALDA 5I7EA 2TMKA 2Q9AA 3LOQA 4QGAA 4E13A 1MQSA 1V1MA 3RRZA 3D0RA 4URUR 5AD1A 1DCMA 3UYKA 2IELA 3GN2A 1RHQA 3PQ6A 2NXJA 5ALTA 4XJTA 4RNDB 3N86A 1KJ8A 2CLLB 1Z6XA 1KP2A 2QN2A 2VK2A 3DB2A 1D4ZA 2DLDA 3FVWA 3GT0A 3UKJA 5H9WA 2WAMA 3GEPA 2YNMD 4GICA 1QVAA 4OFWA 1WXQA 4HHEA 4TN5A 3DZ8A 4FQ8A 2QYOA 2YCBA 4Q66C 2IU0A 2QRQA 4GXRA 3M6LA 2AOWA 5DBHX 5I45A 4DCPA 2QA5A 3TIFA 3ANNA 1RDFA 1KDZA 4YV2A 1ZMXA 3BWYA 3I64A 2FGKA 1GITA 4H18A 3SHTA 2XECA 1R50A 5FBWB 2LCQA 2EFHB 3OSUA 1ISGA 1OJLA 4NK4A 2OAGA 3BSSA 3JAWA 2VTDA 3AR9A 3PZRA 4YCBA 2N46A 5ALSA 3AWDA 1SA0A 2HLPA 4MUEA 4QWWA 1PJQA 3EUFA 1SIBE 3QKWA 1YBMA 2YJZA 3I58A 3NR2A 3LPLA 3DZBA 3FR7A 3MJDA 3M5CA 1XZEA 2JJYA 3DH0A 4G4GA 4KWIA 4JBLA 2JLAA 4O5OA 3A6DA 3REFA 2NVWA 3ER8A 3V4OA 3K16A 3SR3A 1VPEA 1RWXA 1XP5A 4IQGA 5B37A 1HX7A 1J90A 1W1IA 2H1HA 1XFDA 2KQUA 3BFKA 4DMCA 1M2VA 1GQ2A 4UFNA 1MOQA 3DKKA 2R25B 5DJ5A 4DNQA 2I76A 3NC0C 1Z5GA 4LCJA 4YJGB 3JTMA 2X42A 5A7GA 1QS0A 1HTBA 4NENA 3U17A 1S2OA 4R7GA 3ZXSA 2CXOA 4QUEA 2JLUA 2DM6A 1Y4SA 4FIZA 5DWQA 4H3HB 4PX9A 3PA8A 4HAXA 4PX3A 3JQGB 4ZVSA 4BMOB 3GYGA 4RTMA 3LPMA 5FQNA 5A6SB 3MLEA 3EA4A 4F6RA 1QCCA 2GQ0A 4EDHA 3IPAA 3NM5A 2OTCA 1RPJA 1RWOA 2QX8A 3KLMX 3PBKA 3C1UA 1RWMA 2FN4A 1YFKA 3IOCA 4N0QA 4QBHA 1ZWLA 2B0CA 3EVFA 4A8JB 1V47A 1PJ4A 3QV1A 1T1RA 3SQXA 4P2GA 5JASA 5JY6A 5FTNA 4CFYA 1J49A 2B6HA 2R6FA 4F11A 3FPLA 2QT0A 2D5CA 4MCAA 2HJWA 3EXEB 2JJ1D 3E48A 5E7IA 1T2DA 3EZGA 5FWNA 1TEZA 3WDMA 1EBUA 3EVTA 5JCOA 5HK9A 2RHLA 2DR0A 1E99A 1V96A 4NBRA 1GAJA 2QRVB 4OQPA 1O58A 5F33A 4YRPA 1BX1A 1Q3HA 3VR6A 3RYHB 3TTUA 4DUGD 1OGIA 4WE3A 3UCFA 4LJYA 3TB6A 2AK3A 2AZ4A 5FPKA 4Q3NA 1TMOA 4X7PA 1AZSC 4JSTA 3CUYA 2YN4A 1JLMA 2EOAA 2B5VA 2AX4A 2I54A 1GPAA 3SP1A 2NUPA 1Q7GA 2QWXA 3ORQA 1B15A 3HKDA 3K70B 1IK6A 1JUDA 3L1UA 3S70A 1ZIXA 2P3LA 2G1AA 4GMFA 3VO9A 2H7XA 2WNHA 3E8XA 4XH9B 2I29A 3EFOA 3C7DB 1AQUA 2XEDA 4FW9A 3ZY4A 4Z4EA 4AUMA 2OBMA 2WJ6A 1E9EA 3DYBA 3G2JA 3KX2A 4RD6A 5H3CA 4A2PA 3BMOB 3NI2A 4GSLA 2VYVD 2ZJFA 1U8YA 3ZVLA 3CH4B 4OLFA 3TMKA 2IX3A 1DO2A 4N3NA 3V8BA 4BNVA 3JQRA 3D6TB 3KVVA 1UANA 3W8DA 4BNGA 4X20A 4DJFC 4PFSA 2Z3ZA 1AQJA 4Y30A 2FFHA 2EAUA 4ZEWA 4AZ0B 3GRPA 1WKBA 1FDIA 4L76A 1R4ZA 1NXSA 1WD7A 4OB7A 4ND8A 1K2VN 1R8QA 4PZAA 4Y1GA 4BEWA 4HNRA 3OQNA 4ZI3A 1L5HA 4JYBA 4BNWA 2PUWA 2I67A 1Z75A 4KZPA 4B7ZA 3WKEA 5ALHA 1TO6A 1XTVA 2GD2A 3E3OA 1YVDA 3UY4A 3V34A 1I4DD 2XVXA 4LXUA 5L7WA 4P35A 3U56A 1AK1A 3K94A 4M55A 4YMVA 4DC1A 3ILVA 3IV6A 3RLFA 2WJIA 4UBMA 3SFVA 5HOQA 1ZNYA 1KZGB 5EYPB 4WMLA 2I6UA 1CUXA 2B20A 2FPUA 3VHLB 2WUEA 2P9HA 2D59A 2X8JB 4GFDA 1W9HA 2Y05A 4WFIA 5BMOA 3HCOA 3TTVA 1WKCA 3O9ZA 3J7AC 1R7RA 4FUQA 1CLUA 4PGHA 2GXSA 2E4ZA 1RNLA 8ADHA 4JJFA 3LO5A 1C41A 3WGMA 2C5AA 1QX4A 2BFBA 1QG0A 3DCJA 3K05A 3ONDA 4YHHB 2NSHA 2CVOA 1HDZA 4XIFA 2VDWB 4ILEA 1ULSA 5FBZA 1AKYA 1JRLA 2A9PA 2BSXA 2R5FA 3VZSA 3T3MB 2OCKA 4AJJA 4KQIA 4GM4A 2XE6A 1RE1A 3ICQB 4QNNA 1EB8A 3EE6A 2DZDA 3H2KA 3OPQA 3N2GB 1YE5A 3U7JA 4E5NA 5IX8A 1KXZA 2OM2A 2VJOA 3E5NA 4EO9A 3PXXA 5EQJB 3WE7A 1TOAA 4E3ZA 1ISFA 1DBPA 1SOMA 2J9XB 3GGDA 1WUTA 4OX9Y 1DJQA 1UKAA 5CA0B 2VJQA 2Z83A 3EVNA 5DO9A 2XT0A 5FFFA 4BJ5A 3T3NA 3H8SA 3JV7A 3PNVA 1AGRA 3L93A 3PQ8A 5E6SA 2PZGA 2QHXA 2GPWA 3C6QA 3WYBA 4AJKA 4DEVA 3UC9A 3MCWA 1SR8A 3ASUA 2AFHA 3UJ3X 1G3IA 4EMUA 4RK6A 1WZ2A 1KDPA 4BO0A 2WAXA 3PR3A 3WQRA 3RC3A 3KB2A 2GZDA 5BXQC 3DWGA 3I9JA 2BM9A 3KJEA 10MHA 2ONZA 1E3EA 3AEYA 2JJ2A 1GIAA 4C0XA 2COEA 5IS2A 5HMLA 5A5EA 4KE7A 3FOWA 1CLEA 2C2YA 1MQAA 2QTFA 3C6MA 3I8OA 4UFOA 5IAJA 4PGMA 2EXXA 1IHOA 3W4IA 4HVLA 2XYPA 4D8TA 3HBFA 1FVFA 1SB9A 2B1QA 4L72A 1YNOA 4L4XA 1DP4A 2GM9A 5BN4A 3V4LA 3ZKWA 3LGSA 4L22A 1CVRA 3ABZA 4TS9A 4WIAA 3VPHA 2JBHA 1LJ8A 1O94A 3GCDA 9MHTA 2FPOA 1UBNA 1O96A 3AJRA 4RDIA 1WHSA 4M7PA 1WHTB 1EI9A 3FW1A 1VKZA 2LRHA 3SFTA 1JU3A 4NU5A 4YAKA 3TZHA 1FP1D 3VSDA 4C9BA 3H1AA 1QUEA 3P71T 3R5XA 1PV1A 1FYVA 5J5VA 1PJBA 1WPRA 3CRVA 2RHWA 3DZJA 4CTJA 5L40A 2Z30A 1JIXA 3ZZ1A 1XTKA 2P4QA 2NV0A 2UYQA 4HLUA 2XWJI 4PSVA 4AX8A 1L7NA 3EMKA 4GVLA 1J2EA 4OSOA 4MQEA 4FNMA 1PBTA 2CW5A 5H80A 5C2JB 1QVZA 3PHHA 4JBXA 1REQA 2EVWX 1JB9A 3IUMA 3M6IA 3ND8A 1I3NA 4M1KA 2GEVA 2WHXA 1Z6PA 3GJ3A 4CWAA 1TYZA 2AFVA 3R3HA 1JW9B 5EKUA 3UG6A 3DL7A 3JRWA 2XB2A 4DCVA 4DCJA 2R1VA 5GONA 3W4KA 1Z7EA 2QTCA 3WRYA 4BV8A 1RQPA 3VU3A 2QV7A 1ULUA 2Y92A 4H0NA 2CUNA 2V96A 5B3JA 1PR3A 3IUJA 1LJUA 2BFDB 6AT1A 2AXNA 2DULA 4M54A 4I9HA 5CW1A 5HZHA 1C7IA 1ZM4A 2QF7A 4FVTA 4HVTA 3T7RA 2A88A 3PX2A 4PLZA 5ECYA 3RTBA 3ZCPA 1EM8B 5BORA 4R8KA 4YRMA 1JDBB 5GJWC 4BGDA 4WOKA 1AO3A 4GE3A 1MX1A 2WSSA 3PJFA 3NT4A 3S8MA 1GD1O 2GXAA 3V9AA 1I2CA 1M72A 2FHSA 4L5BA 4DUYB 2WF7A 3T3EA 3O6VA 2O8BB 1VSUA 1LBSA 1DAEA 3L4BC 5ILGA 4M0EA 1JWAB 1VA5A 3E03A 3PKJA 3D4LA 4OBWA 4EARA 4DMLA 2AG1A 4EL5A 1WOMA 4GYKA 3GLGB 5K0JA 3HYRA 1K6JA 4BO4A 2ZWIA 1DNPA 2EZ8A 2ID9A 5BWLA 1JDBC 2J7PD 2QE7A 4OHMA 4CMEC 1UMDB 4A91A 2QD2A 3OICA 5FPYA 1PEDA 4IIVA 2PRJA 4AJLA 3RVBA 3TF5A 1MHPA 2WWWA 1ADGA 3H65A 4U0JA 4ZCRA 3MOGA 5FAKA 1H2EA 3LQ2A 3IE1A 3KALA 2DHCA 3SOZA 3SWWA 5HCUA 1Z2AA 1JTEA 5DF1A 3CINA 1E8MA 3OZTA 3DMNA 3QKSB 4CQJA 3B2QA 2Q41A 3GLHB 1XAIA 2VSOA 3EZ2A 4M0CA 5ELLA 1TK2A 2B4AA 5F7ZA 3TSWA 1BTOA 1GN8A 2H00A 3PD7A 5C8VA 3BM5A 1JJAA 1YQDA 3K2EA 4ND8B 4LE0A 4F46A 5EEGA 1KO4A 1FJHA 2XAAA 1JG6A 4HAYA 5DXFA 2HH9A 2PGOA 4R8SA 1YTUA 1ZP6A 2QENA 1D2RA 2VNSA 1V8FA 3M9LA 3NFRA 3P8ZA 2JCXA 1SG6A 3CEHA 2VWQA 1PJZA 1DL5A 5HKBA 2NVOA 5I4BA 3URMA 4NICA 4HRYA 1VG1A 2I03A 3HA5A 5DHAA 4G36A 5GONF 4FMDB 2ERYA 1CE8B 3TCNA 4KJXA 4IO1A 3UB4A 3Q3EA 3PPVA 4MLZA 3SIXA 1I2ZA 3LRXA 3ND9A 1FYEA 1YR9A 3CO0S 3P9IA 4BQRA 2IYOA 3E6AA 3KSZO 4CMIB 4EGFA 2QGFA 4GM0A 4YLYA 1NAIA 2YMLA 3ESBA 3I42A 1YS9A 2R6JA 3ESQA 3VYWA 1AXRA 3AEKB 2H16A 2D7DA 4PE5B 2QVLA 5JEEA 1E1RD 1K66A 1QFSA 5I48A 1QE0A 2P2YA 4LMRA 3ONNA 3UW3A 2HN9A 3PQEA 1Y4UA 2DUMA 3I62A 3CJTA 3OJFA 4I1YA 3RBVA 1EX1A 1T43A 4OI0A 4UOZA 4P9NA 3FBWA 4RC9A 3ZPXA 3K5WA 4A36A 3EBOA 1MNQA 3LHIA 3OT1B 3PEVA 3BK2A 2AI1A 1IN5A 1X0VA 2NU8B 4UHDA 4XEHA 4N7JA 2ZBQA 2HU7A 4FJ1A 2GAFA 3SBEA 2LP4Y 4RY2A 4CIAA 4LTMA 4I8DA 5BNIA 1QIHA 3RVMA 3LC2O 3T95A 1M6VB 1BKDR 3B6KA 1GV1A 4PR0A 4OMUA 2QLMA 3WYEA 4GAEA 1ESZA 3V8QA 2IUYA 4BKQA 1KMQA 3S5JA 4AJPA 3BXHA 1MZPA 5F98A 5EJ7A 5DTIA 1IATA 4OI2A 1T13A 3RYIB 3WLKX 1HE4A 2A4KA 3HFGA 8MHTA 5B3LA 4EHKA 2HEGA 3MQFA 1VP3A 1Q15A 4JBGA 1BCSA 2M6KA 4Y0NA 4HYQA 5M04A 1JFVA 2BGNA 2R8BA 4ACBA 3DO8A 4B82A 2XJ9A 1COZA 1QHHA 1YONA 1SIWA 4L4RA 1OXSC 2VHQA 3RHSA 4ZGGA 2A2ZA 4QJBA 1Y9AA 4ABYA 4F4DA 1EIZA 3IO3A 5HM8A 3NALA 1E2HA 4HLQB 4PO1A 1BGXT 4TXJA 3H05A 3V33A 4A2CA 4A0FA 1FEZA 4GS5A 4BWVA 5I8ZA 5CVJA 4A10A 2CCJA 3QJ5A 4LMAA 2EERA 4J1SA 4BNJA 5KIAA 1JG2A 2X5OA 3ONVA 4C4RA 1PI3A 1BKSB 1SRRA 3EGIA 4HEA1 5CD9A 4AWXA 5EGNA 3E2PA 2BP7B 4JBWA 5CVUA 1BROA 5ICEA 4DWWA 1V6AA 3K8YA 4F6CA 4CMJA 3L8YA 1Z5ZA 2HCRA 5K8LA 4IF6A 1KPIA 1G4AE 4V0RA 3W2GA 5JHGB 3E7PA 1JQDA 1HRKA 1AXGA 2HRBA 2O3SA 3LPAA 1EFHA 2B4QA 2ZYIA 3AF1A 1C30B 3I72A 5CH3A 2Q7OE 3DV0B 1K27A 4QD3A 3ZE9A 3C7KA 5C32A 1NONA 2Y4OA 5ED4A 3THSA 4EI7A 5LR6A 4TVKA 3F4KA 2AJLI 2JH8A 3CZ4A 3CY6A 4L8GA 1YRWA 4WKCA 5AUPB 5B3KA 1VTKA 2PLFA 2BFOA 3A1SA 4KWHA 3EH1A 2O4UX 1GT91 2HYIC 5LOVA 3IS3A 4GWLA 3UWOA 3DTVD 3FDZB 3H8VA 1MT0A 4FJ2A 1ZXLA 3VAZA 4ZTZB 2A3NA 1GKKA 3SG0A 2CBGA 4CKZA 3TAHA 2E3JA 3WO0A 2BUBA 2HHAA 3EZNA 3FFWA 5IK2A 4B8ZA 1GG2A 1RRKA 4GI1A 4GKBA 3O26A 4ZRNA 3MBOA 1IXZA 1JKMA 1X7WB 2X6QA 3PPYA 3U7FB 1N34B 1SGWA 2IS4A 4Z7NB 4JD5A 3FTEA 2PBLA 3UHOA 4E03A 4QLOA 4D2IA 4ETWA 4YWHA 1NBME 2OC4A 3UMGA 2O2GA 3FA2A 4UDNA 3VZCA 1OTYA 4NDAA 3ETHA 4NPAA 3WISA 1XZ8A 3TGLA 2OFXA 5CG1A 5LXTB 4MP8A 4JFAA 4NMWA 2G8NA 3LG2A 4UQOA 4YEDA 3GFGA 1ECBA 2C96A 4NMXB 5G1OA 1QH0A 2HLDD 1KQNA 3MFYA 2QLLA 3AIIA 3Q2KA 3S7ZA 2R6AA 3FRHA 4OK6A 4PYLA 4CVNA 5GINE 1VE3A 2VSXA 1C4WA 2QSJA 4NK5A 3UJPA 2XA2A 5KNDD 3WK7A 1P0MA 1QHYA 3DZDA 2JRCA 4DLAA 5BURA 3ZVMA 3THXA 5DH9A 3W5UA 1IFXA 3CRQA 3DGFC 1AX9A 4KI7A 5DI3B 4TL7A 3DZKA 4NU6A 3TOCA 4RFLA 1HDEA 4PO3X 4BQEA 1AT1A 1CQIB 1V4NA 2FI1A 4ROSA 3VDXA 5EQTA 4RKWA 1CPYA 3A1TA 2CKMA 2I6GA 2CLOB 4N5NA 1WDMA 3VR1A 2JVKA 4DA6A 2XTJA 1GU7A 3WKAA 1IAQA 2X2PA 2PWPA 4BJ1A 2GFIA 2O20A 1O77A 2ZKLA 1V3VA 3HPQA 3OVMA 4RFSB 1M1YA 4IDNA 4LRXA 2J0UA 5IW8A 4BLQA 3CT4A 3OM0A 5CITA 2ATEA 4MKZA 4O2AA 1YGYA 4RK7A 4KX5A 5H82A 4YR9A 4ZQBA 4AQYB 2DWPA 1N32B 3C8MA 4IP0A 5TS2A 1XCBA 3DD5A 4PLGA 4UBJA 3C4VA 1C0IA 5A0FA 1PLKA 1V39A 1D2MA 2AMLA 2Z4TA 2VQSA 3IQFA 2XXBA 1UKZA 1DJMA 1NR7A 4HB2A 1MC5A 1ZVJA 4UU7A 5EN4A 1J20A 4BGUA 2RHBA 4NCNA 1O9HA 3H6GA 3JQAD 3QYJA 4M99A 4LSZA 4P36A 3O8OB 3TTTA 1SOVA 4OB6A 5MFZA 3DKVA 3AVTA 3T3GA 4WY5A 1A77A 3QFTA 1U8AA 5DYIA 4D9CA