3TN7A

Crystal structure of short-chain alcohol dehydrogenase from hyperthermophilic archaeon thermococcus sibiricus complexed with 5-hydroxy-nadp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
234
structure length
234
Chain Sequence
b'MKVAVITGASRGIGEAIARALARDGYALALGARSVDRLEKIAHELMQEQGVEVFYHHLDVSKAESVEEFSKKVLERFGDVDVVVANAGLGYFKRLEELSEEEFHEMIEVNLLGVWRTLKAFLDSLKRTGGLALVTTSDVSARLIPYGGGYVSTKWAARALVRTFQIENPDVRFFELRPGAVDTYFGGSKPGKPKEKGYLKPDEIAEAVRCLLKLPKDVRVEELMLRSVYQRPEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain alcohol dehydrogenase
molecule tags Oxidoreductase
source organism Thermococcus sibiricus
publication title Structural insight into the molecular basis of polyextremophilicity of short-chain alcohol dehydrogenase from the hyperthermophilic archaeon Thermococcus sibiricus.
pubmed doi rcsb
total genus 92
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tn7A00
3FTPA 5KVSA 5DCYA 1DO8A 4TROA 1TLTA 2QG4A 5BNIA 3LZ6A 3KYDB 4FOOA 2DC1A 5KJ1A 1DBVO 3JCZA 4CM6A 1UP4A 5DDIP 3DZBA 3F4LA 3V2GA 4FPXA 1MC5A 2BMAA 3PEFA 2GN6A 1NNUA 5IDQA 4CLRA 3MJ4A 4PG5A 1IL0A 1P1IA 3INGA 5L53A 5GMOA 2JCVA 1HTBA 4YAEA 2Q2QA 2C59A 1CRWG 4DQVA 4DVJA 1WLYA 4E2YA 4HNGA 3LT0A 3S55A 2HLPA 3JSAA 1F8GA 3DL2A 2GUGA 4R5MA 3GNSA 3INTA 1BXGB 4TVBA 4FGSA 3RQSA 4QUKA 3OFSA 2Q1TA 4U6SA 3LLSA 2JD1A 3OJFA 4BO3A 4E5MA 3ZCXA 2A92A 1C0KA 1H9AA 5TQVA 1QORA 2Y93A 3RAJA 2NADA 3MWEB 4PLVA 2Q3EA 3GHYA 3NAQA 4XGKA 2GD1O 3JYNA 5JLAA 3VPXA 5G0SA 2HUNA 4ALMA 4RCVA 1T24A 4RVHA 3LU1A 3CSDA 4HY3A 3N74A 2V6GA 3RSHA 1YJQA 3ANNA 3NDRA 2H6EA 4J90A 1IY8A 1R12A 1NASA 3EW7A 1LDGA 1R4NA 1TT5A 2QYSA 4PVCA 4DRYA 2XAAA 4AJ1A 3DBLA 2XPCA 4EEXA 3M1LA 4CV1A 4PZDA 2WD8A 5K9ZA 4OJNA 3HZZA 5JAIA 5L7WA 2NU6A 4HADA 4HXYA 1P33A 3K5PA 4IMPA 1PS8A 5COBA 4DPLA 3HWRA 1LX6A 3IP1A 5COAA 4QEDA 5L4LA 4QSMA 2Q46A 4F45A 2DTEA 1BXZA 3JQ9A 4BO1A 4D42A 4IZHA 1T2DA 3A28A 5JDCC 3FPLA 3GMSA 5HS6A 3MTGA 3PYMA 4OSOA 5C7IO 2VWGA 5FI3A 2GN8A 4D0RA 1NBOA 4INAA 4ESOA 3DBVO 4IGEA 5IZ4A 1JVSA 2X9GA 5JDIC 1YOVB 4J43A 3TL3A 4TRNA 3TQHA 3NTQA 1D7OA 5DOVA 5L51A 2QQ5A 2HMWA 2RHRA 4X54A 1GL3A 4R01A 4XYEA 2FP4A 3M6IA 1PGQA 3FSRA 3HJAA 4WEQA 5JC1A 2VHWA 1ZJZA 2JFGA 5G0UA 2H9IA 4F46A 1IHXA 2NACA 4BMVA 2UVDA 3GUCA 4CUJA 5ER9A 2NU9A 2YHIB 3S1LA 2QHXA 4KOAA 1EE9A 2XOXA 2ZYDA 3EYWA 5A04A 1Q0QA 5COQA 4YRAA 3WLEA 4ITUA 3DOJA 3H3JA 2YHIA 1ID1A 3FNHA 3VPGA 1T25A 1EK6A 1PEDA 5T8KC 3VZPA 4CQMB 3GQVA 4RDIA 1ZSNA 2X8LA 1A27A 3AOEA 1G6KA 3GEGA 1LLDA 4FGWA 5JAQA 5CDSA 1HDGO 3BXXA 2GGSA 3GVHA 4AICA 4CLOB 2VZ0A 3KSUA 4DC1A 1JLLA 2VOEA 3AUSA 4AJHA 2PK3A 1KETA 4ILKA 5EERA 1I24A 3AWDA 4PZEA 4WLEA 5IDYA 3K9QO 1E3EA 1PJ3A 5F5LA 4R9RA 3OM9A 4DUPA 1KVTA 4XDZA 4WCFA 2EKQA 2I76A 3ONEA 4EI2A 3OQ1A 4R3WA 3L6OO 4A2CA 3TFQA 4LK3A 3V5NA 4TZKA 5KWEA 1MB4A 3RUIA 1VJ0A 4ZQFA 3P19A 4AJEA 1FDSA 5AXBA 1DPGA 4DQXA 4IBOA 4HV4A 4RJTA 2GNAA 1CIVA 4NFYA 4BNJA 1J0XO 4J1QA 1JU9A 4ZQGA 5CEFA 3A06A 3HB4X 3I9NA 4CJXA 4W9NA 3BMCA 4OXKA 1UDBA 1ENOA 4OSPA 5LC1A 3DOOA 4CLHA 5K6AC 1E6WA 1HDCA 1U3TA 4GMFA 4R1UA 3GN1A 4L73A 1U5CA 5DNAA 2JCYA 4ALLA 1SOWA 2IYPA 5A9RA 2BGMA 1XQ6A 1NPTO 1DAOA 3G17A 1P3DA 4L74A 5JSFA 3V1TC 2RH4A 1P1FA 4CV0A 2E37A 4E31A 3NGXA 4RQUA 2FPGA 1PJQA 3ZU2A 3RFTA 3V1YA 2Y99A 2VYNA 3QVTA 4IIUA 3D64A 3PGJA 2CDAA 3ICPA 3ZU3A 3UOGA 2Q1SA 5J23A 2GYYA 3C1AA 1DRWA 1TI7A 4GLOA 1GYRA 2VNSA 4Z9FA 1U9JA 3KVOA 3RC9A 3UKOA 3GY0A 3HE3A 4NH4A 3SX2A 4B4OA 2VTEA 3AOGA 3FD8A 3WYEA 4JIGA 1A9ZA 1V3UA 1HYEA 1EBFA 3PHIA 4Y6RA 5A9SB 1UH5A 3DAGA 5IFLA 5BSHA 2EF1A 4D7AA 3WNVA 1VJTA 3U4CA 2G76A 4BKOA 1WMBA 5L95A 1QXSA 4BNHA 4Y9DA 3BMNA 5GZ6A 1B14A 2C7GA 3HADA 4EEZA 4MP6A 3E03A 4NK4A 1MG0A 1AHHA 2G82A 3I9MA 5G4KA 1ZH8A 1IOLA 4UUNA 1E5LA 5CEJA 3GFGA 5DOZA 4IDFA 1LA2A 4BKRA 1GV1A 1RWBA 1YQXA 1K0UA 1VC2A 2EG9A 4YBZA 4HBGA 1DFHA 3I1JA 3MOIA 4M86A 2PY6A 4IDEA 3OMLA 4AJNA 1MLDA 2OBYA 2UUOA 1ORRA 2O3JA 3GZ4A 3RUAA 3C1TA 1SOVA 1P0CA 3P2YA 1PJSA 3WDSA 2E49A 3L6DA 3GHHA 1DC6A 4CV3A 4J2OA 5AYVA 2V65A 4UREA 2AQKA 1A7KA 1GDHA 2Z1MA 1VPDA 1LNQA 3F3SA 2P9CA 4UUMA 3U09A 1I2BA 4JQCA 2ZCVA 1E77A 3ZWOA 3U0BA 3ZH2A 3RC1A 3WGYA 3X2FA 3ZWMA 4Y8VA 2EEZA 4E5KA 3KEOA 4LCEA 1CETA 1PWXA 4OQYA 3QVXA 1T2AA 2PFGA 3GH3A 1YDWA 1UZNA 4FC6A 4BGEA 4PG8A 4WLUA 2IODA 3GPIA 1DIRA 3WGHA 4ND2A 2X86A 4J4TA 2C0CA 3QVSA 4IUYA 4Z6KA 4W7IA 5GY7A 5HWSA 5KKCA 3PIDA 1ZUD1 1X15A 2FMUA 3JQDA 1QYDA 4BKPA 5U4QA 4JJFA 3BHIA 3IIEA 4XA8A 4AJLA 1WAMA 2O3TA 2C2XA 3I6QA 3MWDB 5TRTA 1ISGA 3R1IA 5F21A 2X5JO 1BDBA 1YGYA 4YT8A 5IN4A 4LVUA 1S6YA 2IYOA 3PPIA 4FQ8A 4WPGA 4IJVA 4NBVA 1EMDA 2X23A 2NQTA 5THQA 1QV6A 4CMEC 4CM4A 1RM0A 4K6FA 3PJFA 2OZPA 4MINA 2Z1NA 2FSSA 3ORFA 2D5AA 1ENPA 1P1HA 5IDXA 1E6UA 1X7GA 4E3ZA 3GLQA 1ISMA 1YH3A 2HDHA 3MTJA 1PSDA 4J2HA 4OKNA 4Q3AA 2OFPA 1MFPA 4GL4A 4YJFA 4EYEA 2EP5A 3RJ5A 1I01A 1I8TA 2BH9A 3BTSA 2BGLA 4WGGA 1UAYA 5B4TA 5ENDA 3QVWA 4UVEA 1UJMA 1E7RA 4QQRA 3FBGA 3NV9A 3CINA 4JGBA 1XGKA 4S3MA 4GX2A 2NVBA 4GKVA 1RM5A 2VRCA 3GFBA 3WFIA 2DPGA 4XWYA 4B79A 1ZKMA 3PI7A 1H2BA 1I32A 2FRDA 1KEUA 4UVHA 3JQAB 2F1KA 1PR3A 2FZWA 1GAEO 3EAGA 3ASVA 1WZIA 3JQGB 2EJVA 4ND3A 2C20A 4DIBA 4E5YA 3PHLA 2GR9A 2PKRA 1ENZA 2QW8A 2A9FA 1HYGA 1NR7A 1PR9A 3KYDA 4IINA 4WCDA 2SCUA 4IIVA 2WM3A 3BMOB 1JAYA 3HN2A 3S2EA 4CMIA 3F1LA 4CL3A 2DBQA 4AL4A 2WJPA 4NBTA 3HUDA 3L0DA 2I5PO 3DXFA 2OXIA 1UXJA 3OJEA 2EW2A 4P22A 1KVRA 3M1AA 1W6UA 3DHEA 3HFGA 1OC2A 2QRJA 3NUGA 2HU2A 3OQ6A 2PZJA 4U7WA 4Y98A 3ANMA 3DMYA 1GCUA 4MO2A 5GZ3A 4ZJUA 4ZD6A 2C5AA 4LMRA 2AEJA 1XIVA 1XYGA 3DMTA 4A0SA 4J1SA 1D8AA 1E6EA 2YDXA 3KSDO 5TJHA 1T2EA 4GX5A 2OOSA 3A14A 5BT9A 5A5EA 3ZNPA 1I3LA 1SMKA 1WDLA 2VZ8A 4TRMA 1HSOA 1PGOA 3KO8A 4N5NA 2YHUA 1J49A 1PTJA 1E0DA 3AW9A 4OXYA 1LDBA 1VJ1A 3V2HA 1CQIA 2JAHA 2WE7A 3L77A 3PFFA 5TT0A 5IAAA 1R4MA 3L4BC 4PVDA 3QRWA 3BMNB 5KNLA 4WE3A 4I9NA 4LISA 4I8XA 1JDJA 3I83A 4BV9A 5B1YA 3PTZA 1NVGA 4MIYA 1HE2A 2EKLA 1H94A 1ADGA 2EXXA 4XCVA 4YAJA 1B2LA 4BQRA 1B26A 4U5QA 2W98A 2IZZA 4HFNA 3IUPA 4Y6PA 2X1HA 2X9VA 4Z3DA 1M2WA 5AOVA 3Q6IA 1B0AA 3K31A 5A1TA 5DZSA 3JD3A 1YBMA 4AJOA 1OAAA 4PG4A 2GRAA 4XYGA 4GH5A 1DFGA 2J3HA 2EGHA 1P9LA 4YJGA 4TKLA 3EY4A 3AM4A 4YVFA 3TPCA 2B4RO 2BGKA 4CM7A 4L8VA 4NJMA 4Z9XA 1A71A 3ZV6A 5JY6A 3BHJA 2AG5A 3GDGA 3FNEA 3HDQA 3RD5A 5FYDA 3VKVA 2DFVA 4G2NA 1NM5A 2J8ZA 4FD3A 2VUTA 4QFCA 2I67A 3C7AA 3WBBA 1B16A 3HNPA 2JD0A 3WB9A 4L4SA 4KTVE 2BFMA 1ONPA 3D3WB 3PJDA 3Q9NA 4TZTA 5T64A 3I3OA 1ENYA 2W2LA 3UCXA 3QV1A 3PP8A 4GMGA 1AXGA 5FI5A 3WGQA 1NP3A 1HYHA 3PDUA 4CMKA 2P2SA 4BVAA 3HN7A 5DP2A 1IZ0A 1IE3A 1Z6ZA 3GC6A 4GQAA 3WQSB 3CPSA 3I6IA 4BB6A 2NSDA 3E18A 3WWZA 1HDZA 4JBIA 5ES3A 1G1AA 1PZHA 3TSCA 1KY4A 1LDYA 3JYLA 3H5AA 2NVWA 4MVJF 2I6TA 1AE1A 1GUZA 4L9RA 3P7MA 4AG3A 1UR5A 2J3JA 2C7VA 1T26A 1NHGA 3GVXA 1Y6JA 4RVDA 4O59O 1NWHA 2Y1DA 4A10A 2BFAA 4JBGA 1IPFA 1GADO 4BNKA 4F6CA 2VTDA 4LCJA 4E5PA 4U0JA 2W2KB 4WLFA 3JYQA 2JAPA 2B5VA 1YBVA 5MGBA 4FCCA 3DBHB 3VH2A 3E6AA 4J4BA 1JKIA 1DDOA 2IZ0A 4A03A 3BHMA 1PJCA 3OJ0A 1A9YA 5C7LO 2HAEA 3EVNA 3C24A 4AVYA 2VUSA 4OO3A 3C7DB 3Q2IA 1SPXA 5BSFA 4ALKA 1WVGA 3FTNA 5JYEA 3WS7A 3S2FA 1OMOA 4ZGWA 3OJLA 3JD2A 4TVOA 3NKLA 3CEAA 5I7SA 1IYZA 3LLVA 2Q45A 2OORA 4DREA 1R37A 2RH8A 2Q2WA 1LUAA 3ETDA 1YO6A 4AJ4A 1KS9A 1F8FA 1NQTA 4ZHSA 1E3SA 4YT2A 4IDBA 1E1MA 3DBRB 1I2ZA 4RGBA 4XZ3A 4Z0HO 4UVIA 2O4CA 3P2OA 4KUEA 4M8SA 1DRUA 4FFPA 4FFLA 5EL0A 3VTFA 4WLVA 2Q1UA 4R16A 1ISIA 2WD7A 2W2LD 1SB9A 4J16A 2W2KA 5JAZA 1J6UA 3ZHXA 3DC2A 1LC3A 4BGVA 4HWKA 1GZ6A 2EW8A 3PWZA 3PHJA 1V8BA 5ITWA 2J6IA 4RL6A 2TMDA 5LCXA 3K92A 5ILOA 1CYDA 5CP8A 3WG9A 2W4QA 4HFJA 4C7KA 1XELA 3ITKA 3DHNA 5H81A 4XGNA 1L7DA 4WOJA 4CMJA 4PG7A 3E5MA 4JNKA 5A3JA 3AY7A 4H16A 4R4JA 3ZW9A 3HDYA 2JFFA 1VLLA 3WMXA 5U1PA 3NJ4A 2DVMA 4XYLA 3PYXA 3DZJA 1PJBA 4J49A 5FF9A 5KOIA 3JTMA 4EZBA 4IPTA 3Q3CA 3OIDA 5FFFA 4IM7A 3LT2A 5HA5A 2IXBA 3K73O 2WTBA 5L4NA 3E1KA 3JQBA 1BXKA 3H9EO 2NTJA 4II2A 3UH1A 4CV2A 4WJZA 2ZB4A 1H6BA 1OBFO 3DDNA 4CMCA 1KC3A 1P0FA 4XJTA 3WX0A 3PZRA 1KBZA 1D3AA 2WSBA 3G0OA 4MKZA 4RF4A 4Z0PA 1E3IA 3TRIA 4CPDA 1V3TA 4ID9A 3KOUA 1TB4A 3AK4A 2AEFA 4J1NA 3WJ7A 3VVBA 2OP0A 3GAZA 1WP4A 3ZWBA 4DMLA 1CEQA 2O2YA 3C8MA 3JQFA 4H3VA 3F47A 2NU8A 2HMTA 5I9MA 4MVJG 3QLJA 2WMDA 1E3LA 2CDCA 3PFWO 4XRGA 4BO0A 5JY1A 4GX0A 2EV9A 3LC1O 1PS0A 4JLWA 3ZWXA 2DT5A 3L07A 4YDRA 1LDMA 4DXHA 3GZNA 3B70A 2AQIA 4CLEA 3H5NA 3MJSA 4TRJA 3GVCA 1WWKA 3K96A 3FI9A 3O03A 1TXGA 4BOYA 5I8ZA 2E6UX 3JQ7B 4TSKA 3U4HA 4CMEA 1EQ2A 5K0ZA 1ONOA 1HXHA 2RCYA 3MJTA 4XQGA 4RQTA 1JA9A 5U9CA 3IAHA 4KQXA 1BW9A 4GVXA 4NFSA 4BNXA 3RBXA 3D3WA 5JMPA 3DZFA 3GUYA 1XDWA 3DZHA 3JQ9C 1M67A 2X0IA 3RKUA 4MVJH 4FFOA 2DBZA 3ASUA 4HFMA 3UGKA 5CDUA 4PLTA 4XQCA 1DHTA 3OA2A 1LJ8A 1MXHA 4RDHA 1C1XB 5T8KA 4MVJA 4NG5A 1U3UA 2BLLA 4IXWA 3PGXA 4ZICA 5A5FA 1ZZEA 1R66A 3I9OA 1XHLA 4FIZA 4OQZA 4EUHA 2EKPA 2DLDA 2HJRA 4ND5A 4KMSA 1ZMTA 1BDMA 5JBIA 5EMHA 1B3RA 5TT1A 3DZIA 5IDWA 1ZEMA 2QZZA 4JK3A 1MV8A 3IKTA 1HE4A 4FSHA 3GNQA 3GDOA 1VSVA 1IZ9A 4MPDA 4WKGA 3WLFA 5JCXA 4W82A 1UXGA 3DOCA 3OEWA 4U0KA 1GQQA 4FJ2A 5BSGA 3VZRA 2NQ8A 2BF7A 2PR2A 1P45A 2O50A 7MDHA 4ROSA 4D46A 2DKNA 2G5CA 2NVUA 1WDKA 3ZNQA 1RYDA 3A4VA 4UEKA 4B7CA 5A9SA 2HJSA 3KUXA 4ND1A 5JO0A 3LC7O 4BO7A 1LEHA 1Q2XA 3VAZA 3ZHZA 4BO2A 3GRKA 4YRDA 2IE0A 1ZFNA 3WTBA 3EUWA 3OIGA 2GO1A 1VL6A 5EINA 2B0JA 4EW6A 2WWRA 1EEHA 1HWYA 1Y8RA 2CSUA 2D59A 4P8RA 4YACA 4F6LA 1LLUA 4C7JA 5I7VA 2X22A 2QX7A 2AEMA 4IJKA 3W6UA 1DB3A 4XR4A 1W73A 2VHYA 4D3FA 4E32A 1PQWA 1WXDA 4PN3A 5A4DA 4RPHA 2FPIA 1X7DA 2AG8A 2HRBA 1C0PA 4R1NA 1MGOA 2P4QA 4BNFA 1DJQA 3DAPA 5A9TA 5CG2A 1LDEA 3JQAD 4HKTA 4Q3NA 3ANLA 1G0OA 4PFJA 1DIHA 4QFDA 2AW5A 3QQPA 5I9LA 2EHDA 1MFZA 3T4EA 2PD3A 3KHUA 3WJAA 2P4HX 4J7CA 4NJMB 1HT0A 3VZQA 2BKAA 4R54A 2IEDA 1E7QA 1IUKA 1K6XA 2GF2A 5HRUA 5I7EA 3FWNA 1VKOA 3B1JA 3CH6A 4XB2A 3FBTA 4AJPA 1K3TA 4U6QA 1RYEA 4PLPA 5KVVA 3NDIA 2HK7A 1FDVA 2AMFA 4QT0A 1X13A 1ZK2A 4H7PA 1Z7EA 4YPOA 1ADCA 4KZPA 5EQFA 3M2PA 1OI7A 4EUEA 1LDNA 2JJYA 3G79A 3H2SA 2Q4EA 3KEQA 4A5OA 2Y0CA 3OEYA 1GPJA 3GMDA 1Q0LA 3ZU4A 2V7PA 3U4IA 3GN2A 3AOEC 1XLTA 1LRKA 1E7WA 3NGLA 1QLJA 1Y8QB 4TMFA 1F14A 2PV7A 1BVUA 2I9PA 2X4GA 3HB5X 4WEOA 2Y1CA 4OOFA 2R6JA 3ZHBA 1IB6A 2YW9A 1YBAA 2VHVA 3QSGA 3PDJA 4E0BA 2FOIA 5BQFA 4OIMA 5JW6A 1ADFA 3UAGA 3VPSA 2WYVA 4FFRA 4OH1A 3LSYA 1I0ZA 5HTOA 4NQZA 3WTCA 4FBGA 5IN5A 3WR5A 1BSVA 5AVOA 5CG1A 4KUGA 1CDOA 3JD1A 3JQ8B 2AQ8A 1PGNA 3LVFO 3MCVA 4W6ZA 1LRJA 4AJJA 2AXQA 3RUCA 1WPQA 5LDHA 3VDRA 2VUUA 1E3WB 4GLLA 3T4XA 4WLNA 4K9DA 3AJRA 3E9MA 4YAGA 3E9QA 1HDYA 3GGGA 2J5RA 3UHAA 1BMDA 3SEFA 4N18A 2JL1A 3QP9A 4E30A 2HCTA 2YZ7A 1WZEA 1A7AA 3E8XA 1LQUA 2GLXA 1PZFA 1LBEA 4O63O 4CODB 2H5LA 5A06A 4Q39A 4ZQBA 2D8AA 1MG5A 1CJCA 1QYWA 4GVLA 3RROA 3IDSA 3WGOA 2DBVO 4XYBA 5TSDA 4B4UA 3BA1A 3SBOA 3KYBA 4RPLA 4G81A 1DIBA 1P77A 1GFSA 2WD7B 4CLXA 3DZKA 2Q2VA 2CZCA 6ADHA 1BWSA 3H9JA 4RZHA 5EQDA 1KEWA 2QRLA 1YB1A 2Y0EA 1LC0A 3ZV3A 4PZCA 1I30A 1PX0A 1YB4A 4RVGA 4DLBA 3I4CA 4HUJA 3LDHA 2PZLA 2I65A 4IJWA 5JS6A 3WMWA 5KJFA 1FXSA 3ZW8A 2IZ1A 3WNQA 2ZTUA 4IY1A 2C07A 2X7HA 3AY6A 3ZU5A 1FK8A 3PIIA 4CM8A 1YXMA 1N8KA 2C54A 5EESA 1B8PA 3O26A 4CMAA 1U5AA 2B4TO 3RU7A 1HZZA 4JN6B 4OHUA 3QHAA 4R5HA 3ZN2A 2P91A 1VKNA 3VH1A 5B4VA 1HKUA 1ZK4A 1DC5A 5I9NA 4OL9A 2V6BA 5B37A 3GRPA 3ZI0A 4IQGA 2H63A 1R6DA 3JYPA 4MKXA 3ETEA 1NTOA 3I9KA 3I23A 4R69A 4D3SA 3OJOA 3ZHYA 4N5MA 2B4QA 5DF1A 5GZ1A 4PG6A 3WSWA 5F3RA 3ZZNA 3DHYA 1GCOA 5H83A 4BIIA 3UICA 2VYVD 2X0NA 1ZMOA 4YT4A 2ZTVA 4IGFA 4Q9NA 1SBYA 2HRZA 4OAQA 1PL7A 3GPDG 4EDFA 3RJ9A 2VWPA 1UDAA 3C85A 1Z82A 3ROQA 5DBGA 5A03A 3C7CB 3MOGA 3IUSA 1GUYA 4J7XA 4O6VA 4HX5A 1T2FA 4UEOA 1LXCA 4S1VA 1DHRA 1P1JA 3DFUA 5F1KA 4UEJA 1L1FA 1A4UA 1HL3A 1NVMB 1R4NB 2CUKA 1L7EA 1F17A 1DC4A 3E48A 1KY5A 5JNLA 1PGJA 4CQLB 2Y1GA 1PIWA 1Q7BA 1PJ2A 5KCZA 1LSUA 5C7OO 1RM3A 3FCOA 3H9UA 1E3WA 4IDDA 4ALIA 4WNIA 3JV7A 1PL8A 1O8CA 4A73A 5HBRA 5G4LA 5CDYA 3L9WA 1O89A 4J9VA 2P9EA 1PGPA 1R0LA 3R0IA 2GN4A 3QY9A 3ZWCA 4ND4A 4Z3KA 1U28A 2IDZA 4UVGA 2RHCA 1YKFA 2J5KA 1O0SA 1C1DA 1RJWA 4NU6A 4ONEA 3VHRA 1XWFA 4DMMA 1UXIA 1E7YA 1YONA 1EUDA 4RF2A 2DM6A 4DIOA 3JQ7A 2YJZA 1B8UA 2DFDA 3RKRA 2FR8A 3GGOA 4AJ2A 5IF3A 1CF2O 1DRVA 2OUIA 4GX1A 2J3IA 2V6FA 5G0TA 1ZK0A 3LF2A 3PQFA 1GYPA 1UDCA 3VC7A 4NDNE 1K89A 3UFXA 2VNAA 4BO4A 3BTVA 1XU7A 5A02A 4P4GA 3V1UA 1BG6A 5C5IA 1JKJA 4UUOA 1GQYA 3JQAA 1ONNA 3U62A 4CMBA 1GYQA 3JQFC 3VH4A 3WSVA 4DC0A 1GTMA 5HS4A 4RO0A 4JP2A 3DTTA 5JO9A 3L4SO 4DYVA 2EWMA 4OKIA 1M6HA 1V3VA 3GT0A 1OFGA 3H2ZA 3TZKA 1I2CA 5B12A 1ZVMA 4JP3A 1LSSA 3ENKA 1NQAO 1RKXA 5CFZA 1G0NA 1ZK3A 3ZWVA 1ZBQA 2GCGA 2AE1A 2GPTA 3SJUA 1E3JA 1I36A 2DQ4A 1J5PA 1A5ZA 3PHGA 5JMWA 3ROPA 2PZMA 1C3VA 4GSKA 1U2DA 3AFMA 3PQDA 1R16A 3HFSA 1O9BA 3HDJA 5DCWA 1K2WA 1HDOA 2AA3A 1YOVA 3RI3A 4GSLA 1PJLA 3C1OA 4WUVA 2OGUA 3PLNA 5EN4A 1Z45A 2A94A 1QR6A 1Q7CA 2DTDA 1YL7A 4YJDA 2UAGA 1FDTA 5TF4A 1I3KA 1Y8RB 2O3SA 4RF3A 4DA9A 4MOWA 4N5LA 3SC6A 3UF0A 1SEPA 2Q1WA 4J3FA 2HMUA 4RPGA 1U3VA 2D3TA 4II3A 2JCXA 3WIEA 4L75A 4I5FA 1MXFA 4KDFA 1XR3A 3IS3A 3OECA 4E2WA 3IKVA 1LU9A 4IXTA 5T67A 2FY8A 4GGOA 3GA0A 3Q2KA 1OOEA 1U7TA 4NU5A 4DLAA 1DAPA 3JQBC 3RFVA 4WOKA 2NVUB 3NT5A 3I9JA 4ALJA 1DJNA 1KOLA 3STHA 4PLHA 3PWKA 5DBIA 9LDBA 2NNLD 3JD0A 3KBOA 3DBRA 4DPKA 5T5QA 3KXDA 2R00A 2W8ZA 4K28A 5BR7A 3TF5A 3WQRA 4G65A 4I9UA 3L4BA 4O1MA 3TL2A 4LSWA 2BFOA 2O3QA 1E7SA 4DYDA 3DEYX 4NJOA 1WNTA 1PQPA 4J91A 4QX6A 4L4XA 1R15A 4BB5A 4MP8A 4I5DA 3R6DA 5THKA 4A27A 3NYWA 4BNIA 1CWUA 2B69A 1N2SA 1GV0A 1PJTA 1HLPA 1N1EA 1T2CA 2GZ1A 3CKYA 3WYBA 4GWGA 3KYCA 2JD2A 3OP4A 1NFFA 4DGSA 3FWZA 4Q3CA 3O8QB 4M49A 4OXNA 4CQLA 1NAIA 4XD2A 1LSOA 1YWGO 1VSUA 2Y0DA 2FWMX 2YUTA 2F00A 5KJCA 3QW2A 3OHSX 1HF3A 2PZKA 1LI4A 3PWSA 4R1SA 4JX8A 4F3YA 4MIEA 2DTXA 1XCBA 5H82A 7ADHA 4R68A 3TFOA 4TWRA 2HKIA 4WCFB 4XB1A 1E7MA 1WMAA 2PH5A 3QWIA 5I7FA 5IJZA 5L7TA 3QWFA 3PVZA 1LRLA 2QYTA 1NPYA 4B7XA 2PA3A 3FR8A 3GG9A 4EGFA 3D5QA 1XKQA 1KVQA 3ROKA 3F5SA 3D4NA 2VHZA 3F46A 3TZQA 4FDAA 4YT5A 2CF6A 4GWKA 2PNFA 3H65A 2D1YA 3PJEA 1M6WA 5L9AA 1UZLA 1QYXA 4UUPA 1PZGA 3K6JA 3ZWPA 2ET6A 2FN7A 3VH3A 2XXJA 3H3FA 2PKQO 3FRJA 3OBBA 2IRWA 3R3JA 4DWVA 2E48A 1GPDG 2FSVA 1PJ4A 2YV1A 3ENNA 4L0QA 2P68A 3TOXA 3U49A 3SVTA 1HSZA 1JTVA 5L3ZA 2X9NA 2Z95A 1UP7A 3MZ0A 4GGPA 2Y66A 4FJ1A 4XEHA 1NHWA 3U4DA 5CAEA 2CVZA 1SC6A 2I66A 4RV9A 4BNGA 2PWZA 3LQFA 1U4SA 4FN4A 1KYQA 3ETGA 2Q49A 5CHEA 3AU8A 3TDKA 1IULA 1U1IA 4CL8A 1M75A 1XSEA 1AN9A 1NAHA 2B35A 1YB5A 2XXBA 1S7CA 3PK0A 2PGDA 4CUZA 5CEEA 1FJHA 4XIYA 3V8BA 3BTOA 4CM8B 5FWNA 2O7SA 3N58A 1N9GB 3AFNA 3I52A 3WWYA 2IXAA 2VT2A 3IQDB 2EGGA 2JHFA 3FN4A 1H6AA 3D3EA 1GU7A 5L7YA 1NQOA 1JWBB 4GPD1 5JXWA 4H15A 1NVTA 3F4BA 3GG2A 2C82A 1ZIDA 3QA9A 4IJUA 5F5NA 4PRLA 3ABIA 2BI8A 4BNVA 3TJRA 2CDBA 1T4BA 2PGLA 3AI2A 4J9UE 4BMSA 4PLYA 1AHIA 2VRCD 4DLLA 3NTRA 1X1TA 1R0KA 1I3MA 3DQPA 3RIHA 1QKIA 2YYYA 3DBLB 4CQMD 1Q1NA 2Y68A 1H93A 1QYVA 1YVEI 2ZYAA 4JJGA 4NBWA 4YQZA 3F6YA 2NTVA 4TKMA 1HLDA 3CZMA 4MP3A 1WDMA 1R4MB 1ZW1A 4B8ZA 4PLGA 4BNNA 1TT5B 3RUDA 3G3EA 3WFJA 5BSEA 5JAMA 5TLSA 2OBNA 4DQUA 1SNYA 4CUKA 1HEUA 3P5SA 3CXRA 5JYDA 4BQPA 3CZRA 1ZEJA 5EJ2A 5A05A 4XR9A 4MVJD 2HK9A 1Y81A 3EZYA 1D1TA 2JHGA 3FNGA 1K6JA 1KVSA 1ISFA 2W90A 1X7HA 2GERA 4WECA 3G1UA 2ZCUA 4NR0A 5DT9A 2CF5A 3WXBA 1H2HA 1KIFA 3F9IA 1BRMA 1QP8A 3HDHA 3WBFA 1GZ4A 3GVPA 4JBHA 3AY3A 3PYLA 4Q3BA 2ZIZA 4CLDA 4YA6A 2B37A 3EDMA 1OC4A 4P4LA 4YJGB 5G4KB 3W6ZA 4AJKA 5C37A 4R1TA 1H6DA 4OGWA 3T7EA 4BMNA 4IDAA 5ICMA 1ZCJA 4P38A 4Z9YA 2Y1EA 3ZWWA 3B1FA 4WLOA 5DP1A 5KJEA 4CR8A 5CPFA 4BNYA 3SC4A 3CMMA 3E82A 2Y1FA 4KWIA 1BGVA 4Y6SA 1Y8QA 1N7HA 3CMCO 3QIVA 3UCEA 4LN1A 3U5TA 3D5TA 3CE6A 1YS4A 1QLHA 2YV3A 3FF4A 2BELA 5K6AA 1GZ3A 2LDXA 4EUFA 1JN0A 3O8QA 3DMTC 2O4UX 1JAXA 3AUTA 4CLOA 3PJGA 5MDHA 1JVBA 2WE8A 3DONA 2ZQYA 1B3BA 2DUWA 3ZNOA 2C29D 3KYCB 1KEVA 4D3DA 2J5QA 5DN9A 4BS9A 4BUCA 2DAPA 1RM4A 1E1NA 5F1OA 1ISJA 4MIOA 2GZ3A 4RORA 4PGFA 4FS3A 3AI1A 4WASA 2VWQA 2PH3A 4WCFC 5G2OA 3COSA 3W8FA 3UUWA 4MVJP 4LMPA 2YQ4A 1PQUA 3HQ4O 4HFRA 3GEDA 1DLJA 5KVCA 1SO8A 3H8VA 1HE3A 4HNHA 1BVRA 1YL5A 3EGOA 3DWFA 4XJSA 4XQ9A 1I5RA 4CM4B 3GDFA 2XF8A 3KSZO 3OICA 4DL9A 3DR3A 3KTDA 4E12A 1JWAB 1ZSVA 4KDEA 3RUEA 1GEEA 2HO5A 1PU2A 2J3KA 5ENVA 4KUHA 3ONFA 3G49A 3M2TA 1BXGA 3RCBA 1LQTA 4FC7A 2YY7A 3ADOA 4IDCA 4YJHB 1EE2A 4YQYA 1BHSA 2EIHA 4K1LA 4ZVVA 1P31A 2VRBA 1Q7GA 3B20A 3AU9A 1ZXLA 1NFQA 1W8DA 3IJPA 4XDYA 4CLRB 2YFHA 8ADHA 3ZWNA 3PZBA 4YB8A 3LT1A 3KV3O 1FDUA 5KIAA 2FZEA 4NI5A 1X0XA 2VHXA 3BTUA 4KWHA 5KTKA 3H4VA 4B4VA 1A72A 3VKUA 1Z75A 4BKUA 2ILTA 6LDHA 4B7UA 1JQBA 2PD4A 3AUUA 4M54A 4BNLA 1NR1A 3IP3A 2ZQZA 4J6FA 4FOSA 3F1KA 1SZJG 1V0JA 2D0IA 4YCAA 3CUKA 4D44A 4M89A 2JFHA 3ITDA 4J0EA 3D4PA 4IQ0A 1LSJA 5ADHA 4OMUA 4R9SA 4CM9A 2ZATA 4NHEA 4YAIA 4J1TA 1H9BA 4FFMA 3MJCA 4NBRA 4QO7A 3BMQB 4URFA 2AQHA 2R2GA 5BNFA 3RUHA 3OIFA 3S2GA 3A1NA 3QE3A 4LRSB 1HDXA 1U8FO 4D41A 3WGIA 1MA0A 4AFNA 2PGJA 1J4AA 2I3AA 2Z5LA 1GUFA 1VE9A 3NEPX 5TS3A 3W4KA 5C3MA 4LGVA 4E6PA 1W0CA 4RF5A 2ZKLA 4ZU3A 3RC2A 2A35A 4W99A 3AM5A 4IS3A 4BNWA 1GY8A 4M1QA 4MVJI 4GAEA 3TN7A 4BV8A 4C4OA 1V35A 2X6TA 4YR9A 1V6AA 3KLMX 5ILGA 2YDYA 3DAFA 3QWBA 5T57A 3AUAA 1AUPA 3TWOA 1IPEA 5IG2A 4WNCA 4I5EA 5HM8A 1Z73A 2Y1OA 4E2ZA 4W9NC 2JKVA 2UYYA 4PRKA 3Q1LA 5CDGA 3UXYA 3KRTA 2YFQA 2OO5A 3Q9UA 3ZWYA 5ITVA 5JFOA 1E5QA 5EPOA 4GI2A 2D4AA 3VPFA 4YTEA 3O4RA 4YEDA 2FHSA 4UULA 2E4AA 3OH8A 3VZSA 3FHLA 3GZNB 1ULSA 2I99A 1R0SA 1B7GO 1VRWA 3DTYA 3L6EA 1Y9EA 2G0TA 4EBFA 1EQUA 1HRDA 4CM1A 3GOHA 1YRLA 4O0LA 2E82A 4G5HA 2Q99A 4FR5A 3LT4A 3QVOA 3ON5A 4ZRNA 1HDRA 2P9GA 1ADBA 2X58A 1I3NA 1UXHA 1Y7TA 1ML3A 2O48X 4YWJA 2B36A 3BZUA 1UUFA 1SCUA 2RIRA 3F5QA 3BAZA 3WGZA 3C3XA 2VWHA 3NT2A 5JCJA 4BO6A 3SJ7A 4K6CA 2NWQA 3X2EA 2UDPA 2G17A 2GZ2A 2B5WA 2ZK7A 4L4RA 1B8VA 1YQGA 2GSDA 4HP8A 4PLZA 5CDTA 1DOHA 1MC4A 1U8XX 1LTHR 1VL8A 4CR6A 2D5CA 3E9NA 1YQDA 4OM8A 3KETA 5JPIA 1N92A 2HK8A 3IL2A 4B3HA 1DIGA 4R51A 4LRTB 4KQWA 1NPDA 1KVUA 2Y67A 5AXDA 2EERA 3K2BA 4PIVA 2GASA 4Z0TA 3SLGA 1OZAA 3EK2A 1QYCA 4ZRMA 1P1RA 4BKQA 1LLQA 5IZCC 3D1LA 4ALNA 2D2IA 1E1KA 1XU9A 2HMSA 5I8WA 4KP7A 1O6ZA 3OSUA 4L76A 1F12A 1O95A 2ZB7A 5L4SA 1YDEA 5KVQA 4CM9D 1E92A 1DIAA 1SEVA 2G1UA 4ZA2A 3KLPX 1ZJYA 2UUPA 4K26A 3G1TA 2OHXA 2OL4A 1ZO8A 3IJRA 3I4FA 4UAGA 3GAFA 4I5GA 2ZYGA 3A9WA 3O38A 2AE2A 3MEQA 1B15A 3Q0EA 1EVYA 2ZB3A 3UCFA 3UW3A 3OQBA 3FNFA 4BL5A 4YXFA 4YJFB 4BO9A 4J0FA 3UVEA 3GR6A 3B1KA 4GBJA 4RVFA 4NBUA 2HMVA 3IC5A 3N7UA 1XEAA 3MJEA 3WGTA 4FW8A 4DBVO 2X0RA 1C1XA 5JC8A 1DLIA 1P74A 3IOYA 1TEHA 1EDZA 4B8WA 1D1SA 4LVCA 1ULUA 2FPPA 4A26A 1F0YA 5JDIA 2B83A 1U3WA 4JCOA 3OA0A 1O94A 2AHRA 3FPCA 3DBHA 4E13A 2R00C 4M87A 4M55A 4EITA 1KEPA 1AXEA 1NXQA 1I10A 3RUFA 3JD4A 4D43A 4E2XA 1M76A 2NLOA 3JYOA 1HETA 1N5DA 3BMOA 4CMIB 3MJVA 1FDWA 3GGPA 5ER6A 3HG7A 4E21A 2HSDA 2CNBA 4JJIA 1PWZA 5DCUA 2NUAA 5CPBA 4AJIA 3W8EA 3OF2A 1X14A 4WK6A 2ZJ0A 1N1GA 4U8GA 2EP7A 4BNTA 1W4ZA 2C2YA 1RPNA 3ULKA 5AQ1A 3EVTA 2DU8A 2TMGA 1ZNQO 4RPKA 4R3NA 3W4IA 4DPMA 4FJ0A 4GKBA 4E33A 8LDHA 4ZQHA 1P1KA 3JQ6A 3KB6A 4YRBA 1LLCA 4JXKA 1YJ8A 3WOHA 1D4FA 2VCYA 2CY0A 4B4WA 3ZWAA 4TQGA 3NJ8A 2PKQP 4MVJE 3INRA 3PXXA 3RC7A 3ZGYA 4OOEA 5ICSA 3S2IA 1C0IA 1ZXBA 5JCJD 3AM3A 2CFCA 4CM3A 4XKJA 1SAYA 1EUCA 3EMKA 3GK3A 3PHHA 3CTMA 4TRRA 4IS2A 3I5MA 5F1PA 1ZK1A 5JE8A 3HSKA 4QXMA 3O9ZA 3RFXA 3NDJA 5IXSA 1K6IA 1QV7A 1O5IA 2V6MA 2C5EA 4DBZA 2GDZA 3HHPA 3SXPA 2DBRA 2O23A 1N7GA 3GNTA 2FR0A 4N7RA 5L40A 2NV6A 3R3SA 3VDQA 3JQCA 5G0WA 3KM0A 2BFPA 1CERA 2OMEA 3LF1A 4MJLA 4QECA 5TJ9A 5A3VA 2O7QA 3TOZA 4EJMA 4BNMA 3WQQA 2P5UA 4MVJM 3EC7A 1NX6A 3BIOA 2POQX 1NFRA 3DO5A 3VTZA 4CMGA 4BGUA 4RLHA 4E4YA 2HQ1A 4FB5A 4ZN6A 4YJHA 2DPHA 9LDTA 2FR1A 2WDZA 5DBFA 4DIFA 1UAGA 5FEUA 3VPHA 3FR7A 1H5QA 1AGNA 2VN8A 4I1IA 4A7PA 3AI3A 5B4UA 1Z74A 1T1SA 3H5RA 5KJ6A 1QRRA 3W1VA 1JKFA 1C1DB 3SLKA 3ZDFA 3ZV4A 1V9LA 3WGGA 1N9GA 2VOJA 1NQ5A 3L9XA 4XRRA 3DB2A 4W7HA 5AXCA 3B6ZA 1E1LA 3LC2O 1I33A 3PQEA 3WIDA 1K5HA 4XQEA 1DEHA 3ST7A 2ZTLA 3PLRA 4B3IA 4CQMA 1HZJA 1MP0A 2BD0A 1XG5A 1A4IA 2X0JA 3ICCA 2ZJ1A 1DC3A 3H9QA 3JQ8A 3UN1A 4CM5A 1EZ4A 4J4HA 4D0SA 3LK7A 1ISHA 4IDGA 2RBEA 2Y05A 1XA0A 1FF9A 3QJ5A 4YYZA 3RWBA 3QWHA 4BNZA 1WW8A 3WICA 3VVCA 2BI7A 2PD6A 2YV2A 2ZTMA 3QWAA 3BMCB 4NNJA 3K30A 5TNXA 5TX7A 1VI2A 4XIJA 4NMHA 1BW9B 2A4KA 2WEKA 2CVQA 3H6KA 3EZLA 2QIOA 1Y5MA 1Y9AA 2X5KO 2YQ5A 1DSSG 1NYTA 4FFNA 4OYRA 1XQ1A 1EUZA 3NRCA 1C14A 3IMFA 3JQGA 3LYLA 3ONDA 2EJWA 3E5RA 1IHYA 3DFZA 2NM0A 2WYUA 1SB8A 3K8ZA 2CVOA 5G0VA 1GD1O 5TC4A 3T7CA 2VYND 1EDOA 4NFHA 2O3RA 1C0LA 1MX3A 2BHLA 1TVEA 4NZ9A 5JDCA 4O5OA 3TZHA 1TT7A 2CD9A 3D0OA 1X0VA 5T6BA 3ADPA 4E5NA 5IXYA 3GF4A 4Q3EA 5LDGA 4BO8A 2QZ9A 2PLAA 3NTOA 1P44A 3U3XA 3NT4A 3DZGA 1Y5RA 3H9GA 4XX0A 3JQEA 4IQ8A 1VL0A 2OP1A 2CMDA 1NWCA 1T4DA 4LSMA 4RVSA 5EIOA 1GQ2A 1KC1A 3U9LA 3BMQA 3D4OA 3V2UA 4BHTA 1MUUA 4Y67A 1H6CA 2LDBA 2QRKA 5DULA 2RAFA 2O2SA 4LW8A 1PL6A 2VQ3A 1PS9A 1F06A 1KERA 1U4OA 4EJ0A 1EBUA 3TZCA 4XGIA 3TZ6A 2GN9A 2DUUA 1FMCA 4KTTE 1UP6A 3GVIA 2WYWA 4I08A 4CMHA 4IMRA 5L45A 3OETA 3W8DA 3GEMA 4N54A 4XYMA 3NX4A 3S8MA 4Q3DA 4JROA 2VZ9A 1DXYA 1EVZA 2H1SA 2VT3A 1EFKA 2ZB8A 1GEGA 1X1EA 2O3UA 3TNLA 1DFIA 5BNTA 3K2EA 2X5OA 2VYVA 1Z7BA 4UVDA 4CR7A 4ZQEA 1U7HA 1M66A 4QO8A 4MDHA 4I9HA 3ZV5A 2P5YA 1BTOA 4D79A 1QMGA 4PCVA 2PTGA 2UV8A 3W4JA 4PLCA 3H7AA 3ZNNA 4J7UA 3CIFA 4PLWA 4RZIA 1ZSYA 5TGDA 5TIIA 3WYCA 4PLFA 3RBVA 1YL6A 2BRUA 1JW9B 1H0KA 4W4TA 3RU9A 1U2GA 4YAKA 5IZCA 1QG6A 4MKRA 2IEBA 4RVUA 3RVDA 2I3GA 1TA4A 3RASA 1Y1PA 3Q11A 1EVIA 4NK5A 3VOSA 3RBZA 1CQJA 2Q4BA 3PRJA 4NIMA 1YE3A 3BYZA 4QTZA 4R41A 3ROMA 4DTIA 4BGIA 5KKAA 4B3JA 1EVJA 2Q50A 4BNUA 4NPCA 4BO5A 1T1RA 1UXKA 2NU7A 4RLSA 4EJ6A 1VM6A 1HE5A 1PZEA 1EK5A 4RPJA 2NTNA 1ARZA 1GR0A 1EFLA 4P4NA 1Q0HA 3KZVA 1UZMA 3I9LA 3EHEA 4D45A 5AXAA 3D7LA 4IZIA 1QSGA
chains in the Genus database with same CATH superfamily
3OLXA 3H11A 2NO1A 3FTPA 1NN0A 3P52A 3EBPA 5EMNA 1DO8A 521PA 5HJ2A 5BNIA 2J48A 3BWDD 2V54A 3CX7A 2G7ZA 1F1BA 2ZWMA 2QMHA 1CZNA 3TE6A 4G6ZA 2J3MA 4D9MA 4TXJA 2Z9DA 4OQEA 1D9XA 3NH9A 4ZAZA 1S2LA 4JUAA 3DZBA 2WHEA 1QKKA 1R1DA 2JH3A 4C7OB 1FMFA 1MC5A 4B6GA 2J7PA 4QGBA 5AVWA 1NLYA 3FYUC 4PG5A 4OXQA 4EAAA 5C8YB 4CNQA 1JPVA 1XL1A 3LUHA 2P1DA 3RVJA 1Z4LA 2CJYA 5EIFA 3INGA 3ZDXB 2GWHA 3VBCA 1HTBA 3Q7PA 3N8NA 3DBIA 2Q2QA 4D4JA 4MWOA 1Z3IX 3B8HA 4JELA 3E3MA 3K9WA 1TAGA 2HLPA 4X7BA 1Y63A 3DL2A 1ZRNA 2GUGA 2IW1A 4FNOA 2P3SA 5BSRA 3GNSA 2JEZA 3TXAA 2FRVA 1YZ3A 4FGSA 4Z7JA 1GAJA 3OFSA 5D6NA 3LLSA 3OJFA 3RV3A 5FV4A 1KFCB 3CLRC 3O3NB 4Y2GA 4PPYA 2BE7A 3E5HA 3HB7A 5TVKA 1SBQA 3GHYA 3LNTA 2KSQA 1CS4C 3NAQA 5FXMA 1A0OA 4MKFA 2UU9B 2HUNA 2V58A 1B8OA 5AI6A 5K0EA 4DNXA 1T24A 5CLFA 3D43A 2P2NA 1IEVA 4RVHA 2YY5A 1DBIA 2VUIB 2VDJA 1IOZA 4NXNB 3N74A 4B17A 2V7TA 3ANNA 4J90A 1U0EA 4HNAB 2CLIB 1EFDN 3AEUB 1JZSA 2YOGA 4ARAA 3HTXA 4RBNA 2H18A 1EESA 1PSZA 1QGDA 4PW0A 4PX5A 4DRYA 1FFXA 2QMZA 4IIEA 3E15A 5HXAA 3RFFA 4U3JB 1VE5A 4OKSA 3CVYA 3I5UA 4EEXA 1YR2A 3SYRA 4CV1A 1PDOA 1JLKA 1ZESA 2WD8A 4PZDA 4RTJA 5KHOC 5L7WA 2B8JA 2NU6A 3J7TA 2BT4A 1YBHA 2PQMA 5CX1A 1QZZA 3HGQA 4E15A 1GU1A 1LPSA 1PS8A 3GJ5A 5COBA 3TLYA 3IOEA 4WOBA 2V3WA 4ZC8A 1G18A 2ROQA 5CT9A 2LKDA 4EY3A 5HRCA 3FI0A 3OX3A 4J0IA 3JQ9A 4D42A 4MAAA 4EL5A 1EEXB 1T9ZA 3B48A 1M74A 3HXPA 3KFLA 1Q1QA 1UFKA 1WB9A 1L4EA 3M5PA 2X2PA 3BWCA 3L92A 4J07A 1AZLA 3PYMA 4OSOA 3DGEC 2QMYA 4BC1A 3M4JA 2Q2OA 4HEQA 2VQFB 1TQ8A 4GR9A 4LZAA 3DULA 3Q10A 3DBVO 4HYTA 4QUGA 1JVSA 4Q9LA 1UKYA 1YOVB 4D98A 5EJ7A 4X41A 2G88A 8ATCA 4KOEC 3OJXA 2Q9CA 2OHVA 4L7VA 5L51A 4KXVA 3U3KA 2H48A 5I9TA 3P0EA 2QRZA 2VF4X 2BR5A 2E5WA 3EWSA 4LRYA 3SBDA 2IYUA 3Q40A 2FP4A 3GZJA 3PS9A 2ZB2A 4Y2VA 3HJAA 5E3JA 5FPTA 1QP0A 1SCIA 2BCEA 2JFGA 1AUOA 2I6GA 2REQB 2ZT7A 3H2HA 3HACA 4I55B 2VXOA 4X8MA 4YV2A 1KPGA 2NACA 5HMMA 3W5DA 1TQ6A 2JIQA 4LXQA 4LYYA 5ER9A 2IOFK 4HZIA 3Q7RA 4H35A 3S1LA 2QY9A 1VMEA 4C7XA 4MYTA 2I7VA 5A04A 1C5KA 1GTRA 2HF8A 4XX1A 4F2PA 3DOJA 3MOSA 2YHIA 4Y1EA 4LF8B 1ID1A 3VPGA 3AI7A 2ZAOA 1G3QA 2FP3A 4H3KB 4ZO4A 4O2AB 3GPCA 2DSTA 4XASA 2L19A 2JLXA 2X8LA 2XMBA 1GPNA 3E58A 3L49A 1ONSA 2A0KA 2VJQA 5CW1A 2BUAA 2QM8A 5KUTA 2JK1A 1PWYE 3DD5A 1BHQ1 1OROA 5FJIA 4CLOB 2FX3A 5JJKA 3IAM1 3VYVA 3R0ZA 4KH1A 4HVLA 1YB7A 4ILKA 1HQCA 3PEWA 1I24A 4YGYA 5JD5A 3K0EA 3OBIA 3VSDA 3PUHA 4ACBA 2PS9A 3PENA 1E3EA 1ST3A 1QIMA 4ZDIA 4TYQA 2SCUB 1EB8A 1IQ0A 3CRRA 5GM1A 2XECA 5FX2A 4AD8A 4DUPA 3EF3A 2GN1A 3QUQA 1KYXA 4UNQA 4ZVLA 4B3BA 3ONEA 1TUBB 1IOWA 4DSZA 1NJSA 2YWCA 2C4TA 3TFQA 3CF6R 1RZRA 4M0MA 4TZKA 2Q8PA 1I7PA 2ISCA 3RUIA 1DPGA 2EX1A 1YMVA 3FMVA 2GNAA 1CVIA 2PSFA 2ID4A 3TH5A 1XB2A 2VBGA 2F3PA 4HG2A 1J0XO 4YCJA 1F0NA 4J1QA 4BNJA 1ZJWA 1XTPA 3A06A 3Q6NA 4NAHA 1ZI9A 2OBFA 5CEFA 4W9NA 2RGRA 2ECQA 2WJ4A 6CHYA 3DW1X 1GPMA 4JJEA 1BRTA 3G8CA 3GN1A 5FA5A 1U5CA 1Z5UA 3FDZB 1NBHA 1O6BA 1JLRA 3N3BC 1SOWA 2IYPA 5JPDA 4YROA 1E9SA 2B4YA 3KJZA 5IKMA 1NPTO 1XLTC 4NABA 2BEKA 1P3DA 3EFHA 1OX4A 3KQPA 4IDHA 6PFKA 4N47A 3VFDA 1P1FA 4F4UA 5LQUA 4HLQB 3UXEA 3SSAA 3NGXA 3EQ7A 3S4YA 3V1YA 3MERA 2VYNA 3E2PA 2X2FA 4NE7A 3D64A 4IOKA 3R20A 1HTWA 1YR3A 4U02A 3LCRA 3CZQA 4QGGA 2XLBA 3UOGA 1N5MA 5LWQA 4RD3A 5DSTA 2D5BA 1MTOA 2XUHA 1CB0A 5AW7A 1DRWA 2X40A 3PNLA 5H3HA 2J41A 1GYRA 2F43B 3O2SB 4GLOA 4B3FX 3HVIA 5KO2A 3O90A 4AI6A 3BXZA 4H7HA 1H8ED 3KVOA 4F2GA 1PFGA 3TNFA 4N6OA 4QIHA 4BJ6A 4ZV4A 5I5EA 4B4OA 2VTEA 3DMHA 4YC7A 3WYEA 5DMHA 1IQPA 2I4LA 5AK6A 1A9ZA 3ABQB 4N3AA 5LYJF 3DAGA 1JB1A 1SCQA 2WP0A 3NHWA 3EZ9A 4BKOA 5L95A 2VPZA 1QXSA 5DI3B 3CU5A 3EXEB 4BJ5A 1FQKA 3AERB 5KREA 5JJ5A 4ISCA 4PGMA 1B14A 2WIKA 2WUEA 2OBLA 3LG2A 3HADA 1ZM4A 4EEZA 3M6WA 2UUBB 4JR1A 1CFJA 3UANA 2G82A 4W8OA 5CUQA 1IZYA 3LPMA 5G4KA 1J39A 2IPMA 1XT6A 4GPZA 4REQB 5C1OA 3F7OA 5IYZF 2C5SA 3NBAA 4C4TA 1XZLA 5DOZA 1FFXB 2RMKA 4IDFA 4MQ4A 3NETA 4BKRA 2GI4A 1L6IA 1VC2A 2KE5A 4DC0A 3G9ZA 4QLAA 1DFHA 2UYQA 2GB4A 4IIJA 4AP9A 4EUKA 1WHTA 1T0JB 2FZLA 2VJNA 1VE6A 4F60A 4GDMA 4EO9A 5AKGA 3W04A 3OIWA 1NQXA 1P0CA 4F3CA 2HI0A 1XN4A 2IF0A 3C4VA 3KUKA 5EE1A 1NRXA 4AO8A 3GD5A 3ZK9A 4WNYA 1BMTA 1QB8A 5KTRA 5AYVA 1PSWA 2AQKA 1A7KA 4DUZB 1JHQA 5FLKA 2WM9B 5CURA 3QHQA 3BWXA 2YXPX 5IEBA 3F3SA 1VCIA 3L0SA 1NULA 4HGYA 3K9HA 4GZMA 2W6OA 4LG1A 3WYGA 4V0LA 1ETUA 1I2BA 2IV3A 4F4DA 4YO8A 4DR2B 1Q84A 1VECA 3RC1A 1XFDA 2XV1A 4FXPA 2A5FA 5HEKA 3ZWMA 3R6GA 4UMEA 4S2EA 3QKIA 1F60A 2QWXA 4INJA 2GK7A 5G1PA 4XWGA 1X1CA 3KEOA 4LCEA 1NBIA 1CETA 1PR4A 1PWXA 3Q5DA 1EIZA 3QVXA 4HH3C 1YSCA 3WMFA 3GH3A 3B7WA 2PPVA 4H0CA 1F9AA 1Q7RA 1RFGE 3HHEA 3QNWA 4HDCA 4LDPA 4ZIRA 1FUIA 3SMQA 2YKGA 4J16C 1YVDA 5EJ9A 4EUSA 1T9GS 2X86A 3NANA 4J4TA 4RMHA 3RSCA 4Z6KA 3CH7A 4F5ZA 1T36A 1ZUD1 4JL8A 2HHCA 2HMAA 4FYJA 3JQDA 3PGVA 3IIEA 1G7RA 1E79A 1G42A 1H8EA 1J8VA 1WAMA 3U7GA 3W3ZB 3I6QA 1KMQA 4HNSA 1ISGA 5TRTA 3TQRA 3ONWA 1BDBA 1J5EB 2PIDA 4YT8A 4EKGA 1KI6A 2NZVG 3EZ7A 4IG4A 4EH1A 3RT9A 1WY5A 2FNAA 3LFTA 4HDSB 4X84A 1ZA2A 2XNHA 4WPGA 4P7KA 5AOCA 5JZMA 1O4VA 1T35A 1CSEE 4WOPA 3NC1C 4P5EA 5THQA 2R1TB 4OMDA 2W42A 3GARA 1SVMA 2R1VA 2WVGA 4JI0B 1JKXA 5THXA 1RM0A 1IK4A 3S0JA 2ADFA 2OZPA 5JXGA 2P9HA 5F77A 3ORFA 1TTTA 1MR3F 1WPRA 3QTLA 1I3OA 4KG7A 1QQ7A 1SQGA 2JATA 4O4JF 3L0PA 3I58A 2VDWB 1N2HA 3PE4A 2ZU0C 5KYWA 1R0YA 2BFDB 4OKNA 4HNVA 2QTVB 5LD2B 1L7QA 2WAAA 3MWEA 2EP5A 3SSMA 1SHLA 2WRZA 1X2EA 1I01A 4RXUA 4CEHA 3O4HA 1KAMA 1ZIXA 4AZ0B 3RRZA 2HCJB 3TAXA 1T4GA 3LUKA 4BGDA 2OECA 1Z37A 1A4RA 3NV9A 4XWOA 3SZRA 4YUAA 4JGBA 4EQ6B 1XGKA 5K8UA 3ISVA 2NVBA 4LDQA 1QBKC 3GCGA 3PGMA 4PZAA 4RJJA 1YR8A 4F6RB 5C34B 3GFBA 5FLEX 3F90A 2HDWA 2POCA 1GGVA 3C7KA 4UBJA 2IUTA 3FVQA 2FRDA 4CF6A 1KEUA 4NPHA 3GP3A 2FZWA 2LV8A 1GAEO 1E2HA 2XUAA 1GOTA 2YWJA 3Q3HA 1KZ4A 2C20A 5I8PA 2P0AA 4HVTA 4ESHA 2CJPA 1JIQA 1ENZA 1UPCA 2EKZA 1DEXA 1SU8A 1NR7A 2QW8A 2DPLA 4WCDA 2SCUA 4TQAA 2WM3A 3BMOB 5F73A 3K3PA 2XE4A 1M5TA 3F1LA 1F48A 2DBQA 2GFQA 1Z0ZA 4AROA 1VA5A 2XYPA 2ZIVB 1F51E 3IIIA 3KL4A 1KDOA 2IYFA 4NBTA 1VIAA 2CB0A 3L0DA 1UEXC 4GZ3A 5ETJA 5BWNA 2YVLA 4P22A 3WIOA 1KVRA 2V4MA 1TAUA 2IHJA 3OO0A 3DHEA 4L8WB 4MR8A 3C8UA 3A25A 2HU2A 1R6AA 4H7DA 3PVCA 1AHNA 1M1YE 1RXUA 3OQ6A 5H70A 2IS4A 3L7AA 2PZJA 2F1HA 2GJ8A 5TV2A 1GZSA 2J32A 1GCUA 3DMYA 2FRDC 4ZJUA 4EYSA 2C5AA 4QJ3A 1XYGA 2HBYA 4A0SA 1D8AA 3DOEA 4QBHA 4C89A 3EX7C 4IUBS 4B4KA 1RRMA 4TPKA 3R75A 1ZP6A 2AUTA 2CDRA 1TM3E 1H65A 4YV7A 3Q8XB 5D01A 5DYIA 3ZNPA 1BGWA 1I3LA 2YNMC 1WDLA 3M33A 1HK7A 4YFYA 3I6YA 4N5NA 5DHPA 5I7OA 1PTJA 1E0DA 5HCUA 2YVUA 3UG6A 1ECJA 3K2QA 3Q9LA 4OHRA 1NVKA 1UKZA 3R9KA 2C7PA 2CBZA 1UMDB 2G1JA 2JIBA 2LGJA 5TT0A 3RYIA 3TGLA 1HLFA 4BFLA 2VJYA 4PVDA 3EQ2A 4Q1BA 3STWA 3LA6A 3QRWA 5ALNA 1D6MA 2WA2A 4YJ3A 4LISA 3I30X 2PZEA 4H31A 4ML3A 4GKJB 1JDJA 4PQGA 4BV9A 4DZTA 3ZEAA 3H5IA 1DQSA 5H16A 4I1VA 4MIYA 1HE2A 5LQJA 3P0FA 1QKJA 2CNNA 2EXXA 4HXGA 1LK7A 1VP3A 2MSWA 4U5QA 1VPWA 4L4ZA 1PNOA 5K3CA 5HOQA 1IN1A 4EKYA 3FWPA 2QLTA 3HL0A 3QEMA 4Z3DA 1AK2A 1KEEB 2P9FA 4V0MA 5D51S 1ZMBA 2BHSA 3Q6IA 4BLTA 4S04A 3GRZA 3L4JA 4YJ2B 1G7SA 5A1TA 1UEIA 4O29A 4AJOA 4EG5A 1T8YA 1QFXA 2QPLA 2X4IA 3CHYA 4PAGA 3CW9A 1XRSB 4YDSA 3NPAA 1BX0A 2ORIA 5AVQA 3THYB 3WLKX 1DFGA 1O6FA 2O14A 1CUYA 4CDMA 1N2OA 3HA5A 2QGZA 3VAAA 3WADA 1BIFA 4YJGA 2O0LA 3EY4A 3DBOB 3EDOA 3PPVA 4P3PA 4PX2A 2NVOA 2V45A 4ZTBA 2B4RO 4OI0A 2BGKA 2O06A 3I92A 4CM7A 4L8VA 5KX5F 4NJMA 1AS2A 4C7BA 5HGJA 5JTTA 4A82A 4LJ9A 5JY6A 5EP1A 3GDGA 5JCOC 1U9CA 3HDQA 4ZV9A 5HE8A 3A70A 5EZQA 4GMHA 4CIYA 3GYGA 1PVVA 3S8YA 1GA4A 2IHUA 3X3HA 1XZKA 4MMZB 3V8MA 3O8BA 1RDFA 2JD0A 1F5SA 1KMNA 4E4RA 1E89A 4IVPA 4Z49A 4KTVE 2Z8XA 1UT5A 3AIOA 4XM0A 2PRZA 4TZTA 1ODTC 5T64A 4D3ZA 1L7XA 1ENYA 1VYUA 2FEPA 2P67A 1EFVA 2PLFA 3LRPA 4IEIA 3PP8A 3ZZMA 4GMGA 1AXGA 1U2PA 4HGQA 3WGQA 2DT8A 2P2SA 1HE1C 2AVNA 2XKJE 3HN7A 1FFSA 3DL4A 1V37A 3I6MA 4P36A 4DSUA 3REGA 2XZDA 1MVOA 1IE3A 2JGNA 1N2CA 5EHQA 4ADSG 5DSXA 4GQAA 1WXFA 1XZHA 2OBMA 3CPSA 4HQ0A 4IX1A 5IW8A 2HRCA 2NSDA 4BB6A 4BLRA 4DMLA 2I8AA 3A0UA 5F7ZA 2AHOA 3CF4G 1K08A 3DXYA 3LFHA 4OFWA 1AKVA 4NMXB 4EW1A 4BVHA 2XCRB 1I0IA 2ZRLA 3AV0B 1KY4A 2PWBA 2FW9A 3C6XA 3U6BA 1DC7A 1Q7TA 1W0JA 3H5AA 4DARA 4LKRA 4QBKA 1T8UA 2H0RA 2DR3A 2GBGA 1GUZA 2ODWA 2Q5IA 2XADA 3OFND 3P7MA 1G2QA 1MNQA 3HN6A 5MN6A 5B7GA 1GPUA 2F3UA 5H3CA 1T26A 4PONA 4GD3Q 3WLNA 4DV4B 3HR8A 4JJ8A 2GOYA 3GVXA 2PNJA 1SKYE 3DEJA 3TRDA 3ZE7A 4ATNA 1NWHA 4X6LA 5ES4B 3ZDDA 1FOEB 4QPPA 1JS1X 4Q82A 3VMFA 2R6GA 5JIBA 3KZKA 3IQGX 1RR6A 4XPZA 5ALLA 4U0JA 1N0HA 4YONB 3E23A 4HT3B 3LBHA 1NQWA 4ISBA 4E11A 3DZDA 5DLYA 1N9ZA 5LA6B 2Q6IA 3E6AA 2FYTA 2NT4A 1N5RA 2JA2A 3AEUA 3NASA 2PX0A 1PJCA 2D7DA 1AV6A 5IH3A 1U2QA 1L4HA 3D6UA 3SS7X 4WZBE 3C24A 3ZIAA 3KEGA 1CIJA 2NUTA 2D1FA 5JO0A 3W06A 3AVTA 3VZCA 1ZUNA 1GR1A 3HH8A 1JWLA 3M70A 4TVKA 5K0BA 2GBPA 2P5SA 3NKLA 3LOQA 3R7AA 3SF8A 4X1OA 1W5EA 4C0SA 3RSOA 3OFNA 3LLVA 4QOJA 5GONB 1MPXA 2Q45A 2PS0A 3EDRA 3LKZA 4I3HA 3L8HA 2AMYA 1HYBA 2PCJA 2PRIA 3BWYA 3H5VA 1QLWA 2PO5A 4HGZA 1LUAA 1OLSA 2JIMA 1BKSB 2OPBA 1QFJA 3A2LA 2Q7OE 5A4AA 2RHBA 2NUTB 1F8FA 2QA5A 2Y77A 1JR3E 3HM2A 3C8HA 4EMTA 4RYLA 2HRRA 5L3SB 1E1MA 4XZ3A 1ORWA 3I6ZA 5DHQA 4Z0HO 2ANCA 2I3ZA 3V4ZA 4M8SA 3AL3A 4LXGA 1DRUA 3BIFA 3OQIB 4X1YB 4Z7NB 4FFPA 3INNA 4EHHA 4P08A 2J4DA 2IU6A 3HKBA 3M9WA 4R16A 5TPZD 5JAZA 4J16A 5H02A 1PAUA 2W2KA 3KNZA 3L7OA 3ZQUA 1LC3A 4BGVA 5DWVA 4HWKA 1JXOA 5FOTA 4HB4A 3LCCA 2WU8A 3B8EA 5JJBA 2JASA 3VBEA 4RL6A 2NSLA 1E2GA 4W1RA 2ZSAA 3K92A 5IC6A 3L7YA 2W6JD 1ZI8A 2C7OA 3WG9A 3H1BA 4MDFA 4LRXA 1XZ8A 4LYJA 2WJ3A 1EFRA 5KSPA 3DHNA 4XGNA 4BRUA 5JBNA 5KQSA 1B0ZA 1SRRA 1T29A 1TO1E 1CJVC 3BD9A 3PXAA 3E5MA 1E5XA 4IKOA 5FOSA 2PSDA 4RK5A 5HKLA 2NU8B 1Z5OA 4CWAA 4NPAA 5GAJA 1FVOA 1NT4A 1T91A 4NENB 5H9VA 3IOBA 1QYRA 3ZW9A 4DOMA 3QVLA 1I1QB 2JFFA 1JEOA 3LY7A 1PFYA 3BQMB 3BE4A 3NJ4A 2DVMA 4EZIA 1Z4NA 5TR9A 7AT1A 4L5IA 5IX8A 3CZCA 1R6UA 2EIXA 1J7KA 1UMDA 2ZKIA 4O2AA 4ZQIA 3AVWA 1F6DA 3ZHQA 1X74A 4D1YA 4CDGA 3TEMA 1NW7A 2H1RA 2RB5A 2C04A 4J49A 5FF9A 4DRXA 1JI3A 4LI3X 3Q3CA 3SLRA 5KOJA 4EYKA 1QGUA 3BH7A 4DWJA 1CQIB 4EFLA 4IM7A 4D9NA 1QHNA 1LW6E 2IXBA 4HDNA 2IJGX 2OXEA 1AZSC 2HNKA 4YJKA 1BXKA 4ZT5A 3UQZA 2NTJA 3K1JA 4II2A 3ZDEA 1WZUA 5SYMA 1OBFO 4XJTA 2V9ZA 2ZU6A 3CUSA 2WSBA 4RF4A 3EAFA 3KKZA 5AHRA 3TRIA 2IX3A 2RIPA 4YH1A 2Y2UA 4I50A 3G2LA 1ANKA 4LIPD 2AOWA 2AEFA 2W00A 3H5WA 4J1NA 4MQFB 3WJ7A 4IRUB 3AHJA 3A4TA 3R4VA 3FJ1A 3IP7A 3NOOA 4PFKA 2F9LA 3RHSA 4QM6A 3OESA 1A5AB 1P73A 4OLFA 2HXYA 4MEBA 4ND8A 2J6HA 3QLJA 2WMDA 2CDCA 3CZAA 4MVJG 4DDTA 1B23P 1CLUA 3LC1O 5DYYA 3V1LA 2FUNB 1OU4A 3QMWA 2Y1KA 4MRNA 1XYYA 3OE4A 4JLWA 4P4SB 5A6VA 5I7UA 2DT5A 5AH0A 4DXHA 1FFWA 4HXFB 2YICA 1VPEA 1ULBA 2QN9A 3ESAA 3KEMA 4YRJA 1DZ3A 4OM7A 1U2DC 2JLRA 3MJSA 5JTUA 3CRQA 1G38A 5J2UF 2JJMA 1UBEA 3KQNA 2OV1A 3FI9A 4UFNA 3O03A 3TRHA 5L3QB 5IJ0B 3GRRA 3ZV7A 5I8ZA 4BOYA 1FFEA 2ERXA 4CMEA 3EFEA 4X92A 3GGCA 1ONOA 4TT3D 1HXHA 4KPGA 5MGNA 2B0CA 1T9AA 1PT6A 1HL7A 1JA9A 1KNXA 3F9CA 4RZUA 2PSEA 3T35A 3DTNA 3N8GA 4K6GA 2IHBA 3JZDA 3I64A 2ZUWA 3D3WA 4E14A 1HNXB 3FPEA 3GUYA 2NSHA 5DFAA 1SQ6A 2W2QA 1Z36A 5BSKA 1EA7A 2IBMA 3U4GA 2X0IA 4MVJH 5EWMA 1W93A 5HGXA 1HR0B 4AQDA 5JFTA 5KC8A 2HU8A 4Z4FA 4IF4A 1CJUC 4CIBA 3ET4A 1SH7A 4LV8B 4MJXA 3C16C 3K05A 4PLTA 4DJ5X 4F2WA 4V1CI 1AQNA 3TG8A 1JIIA 1MXHA 4RDHA 3W2TA 4ZAVA 5T8KA 5PGMA 2KLBA 1H23A 3F6EX 4DEXA 3C45A 1IB0A 1Z6XA 1ZDMA 2H3HA 4UHBA 4WZBA 4ZICA 5F64A 2JIOA 3L8DA 3QXGA 1R66A 1XX6A 4F5DA 1ZGJA 2HJRA 4M46A 4UAVA 3TSAA 3KKMA 3ANYB 1ZMTA 1B3RA 3KXPA 1HZZC 1IPHA 4MR8B 3FZYA 1L1EA 2FJPA 4TL6A 1U04A 4JK3A 1HTTA 1MV8A 3KQKA 1OJLA 4MPDA 5CT8A 1ZPDA 3UPUA 3QUCA 5IYZA 1YA6A 2XUQA 1UXGA 4Q6BA 3WHLA 5AKXA 2PR2A 1COZA 1E0AA 2QVLA 4OBXA 3RTGA 7MDHA 4ZVQA 2P77A 3THRA 2NVUA 4ZVNA 3VNAA 1K63A 1RYDA 3A4VA 1HOTA 2ETVA 4QEZA 3J80A 4HVAA 8ABPA 2JAQA 1GKKA 2X4LA 1F8XA 2JEYA 2FOLA 3ECCA 3W5JA 4BO7A 3QVUA 4Z2AA 3AHDA 3ZVNA 3T0IA 3HCOA 1RXIA 3DLCA 1E61A 2IXDA 2R6HA 2AG6A 2YMLA 3HDVA 3NR2A 1L5QA 4JJKA 4WNAB 5DGXA 3ROGA 3ZHOA 4EIWA 2ZRIA 4YRDA 3OJWA 1GN8A 1Q3TA 3W6NA 3EUWA 3GZTB 2GO1A 2LNDA 4NDAA 2GCNA 4WA8A 2YJ4A 5CJ2A 3AEKA 1T5HX 1H2WA 2FPWA 1ILWA 2WWRA 4X3CA 2D59A 1Z5WA 2E4ZA 4F6LA 1I6WA 2PWPA 4R6WA 4C0WA 5I7VA 2QX7A 1A95A 1XZJA 4MRMB 2R6R1 3BWMA 3WXMA 5CDFE 4F5EA 2NZXA 1TEZA 5EZSA 4EJSB 4PN3A 2GO7A 2XT0A 5IM4A 2G04A 4BLUA 4D99A 4R1NA 2IBSA 1MGOA 3P4UA 1T10A 2WSSA 4BWYA 1P7VA 4F93B 3HA2A 4BNFA 5CG2A 1KY3A 1N6IA 1T9DA 2R4TA 2FEWB 3R5TA 1Q11A 1ZC4A 4HKTA 3JTEA 1Y9DA 3OEHD 2AW5A 1SUDA 3QQPA 2GXAA 4R7TA 3BGDA 3OX1A 3T4EA 5E4YA 2OPHA 2VF5X 5HR5A 2AJBA 2GVNA 2P4HX 2X9QA 3NP9A 4J7CA 4NJMB 3ET5A 4U2KA 4AG6A 4R05A 1FUUA 1L3CA 2Z0MA 3PDCA 4JL6A 4TSFA 2QU8A 1P2SA 3C5WP 5I7EA 2HHLA 3PB3A 1ESDA 1YMUA 1D9ZA 3I42A 1QHSA 3QFFA 1L7RA 4FDUA 3TL6A 2YOHA 4MULA 5GJWC 3BDAA 2W2PA 5AI0A 3EYAA 2NZYA 2XOKA 1X13A 2GPSA 1IXRC 1ZK2A 4MRAA 1NZFA 4G1CA 4PZ9A 1ADCA 3MMPA 1KSFX 4MGHA 3RSSA 3PCXA 4YPOA 1A4XA 4TMTA 3SYKA 1LDNA 3NBKA 2KBEA 3G79A 3LQ2A 3H2SA 4A5OA 4KQ1A 1GPJA 3GMDA 1Q0LA 2IYVA 1UKVY 1JSZA 2V7PA 1RRCA 4CT4B 5F23A 1QHHB 1XLTA 3IKMB 1HI9A 4F9TA 4KXFB 4DZZA 4ZIRB 2XA1A 1FU4A 3ETNA 4HAXA 2I3DA 1RNLA 1RHUA 2DHEA 2HB6A 2I9PA 2O7NA 4ZOLA 5DE3A 5EZYF 3AIMA 3PHCA 1T43A 2QV0A 3AH8A 1KKMA 2YW9A 3N7AA 5BQPA 3T12A 2J87A 2VHVA 3DHVA 4HSEA 4R98A 4DG9A 2FOIA 2JC3A 4OIMA 4WZAE 5JG7A 1UBLS 2C88A 4PGGA 3UAGA 3VPSA 1NDQA 4DJEC 1AUVA 1ZD1A 4OH1A 1SKYB 1I0ZA 3NIDB 4NQZA 3UH0A 4NYMQ 2G70A 3WGMA 1BSVA 1S4MA 1TUGA 2PSHA 2R86A 3W6PA 2DPYA 2QAGA 4KUGA 2HPZA 1DADA 4KPUA 3THSA 4DF3A 1W4LA 2AXPA 2VJBA 3U19A 1PG0A 3PQ4A 3MCVA 1AQ6A 2EP8A 2R1VB 4JYPA 4NBNA 4ZT2A 5GGXA 5KAPA 4MW6A 4DYHA 2CXUA 3ZOKA 4URYR 3VDRA 2VUUA 4WY2A 5I9IA 2HCRA 2I2WA 2DG2A 2NZ2A 4X6XA 4EGCB 1FJXA 1R27A 2MR6A 4CHGA 2ZR0A 1JR4A 1P7ZA 1N9KA 1ZM9A 1BMDA 2J5RA 4QDTA 5E9AA 2YCLA 2Z8YA 3PSHA 3TX6A 4KHPB 3ZCVA 2YZ7A 1WZEA 2YWGA 2O1EA 3E8XA 3L5KA 1HNZB 2GZSA 1LBEA 2IU4A 3IT3A 3QVMA 4I1OA 1XVTA 4EW2A 3MGGA 1W59A 3SM3A 4G8JA 1HC7A 1B1AA 1PUIA 2OZEA 2ZJ2A 4D0GA 3RROA 1E59A 1A04A 1XNJA 1IVNA 5CITA 5AW8A 3WGOA 2PVPA 2C2GA 4RVCA 1U2ZA 2G40A 1I4WA 5DPMA 2Q07A 4W1SA 2XW6A 4G0XA 2CJXA 4LF4B 1QH1A 1XTBA 3Q8MA 1GFSA 2WD7B 5LNK1 4CLXA 4CEHB 2IH4A 3WE7A 1E20A 2QRLA 1RXSA 1Z6AA 2Y0EA 3RIEA 3SJAA 3Q41A 4QULA 1AG9A 3ZV3A 4JI4B 4GLBA 3ZXYA 4DCJA 1WM1A 4FMPA 4PM4A 3AZPA 1K8RA 4BWVA 3I4CA 3LDHA 5F51A 4AM8A 3BN3A 2WUDA 1A9QA 1OXVA 1XUOA 4PGHA 4UBMA 5EKDA 3V34A 2IS2A 2J0UA 3JPWA 5FEMA 1T13A 2Q2NA 4DAOA 1PYDA 2OHFA 4MW5A 3NBZC 1PR6A 3NATA 3ZU5A 1Z0IA 2EJUA 2VHJA 4BBAA 3L7LA 4XARA 1LV7A 4YMHA 2GX6A 4G41A 5EESA 3K4HA 1N2GA 4MB6A 1B8PA 3OOSA 2SKEA 3OZCA 3A6ZA 3U3DA 3SE0A 4Q9IA 4OHUA 3QHAA 1I7SB 1GU0A 5GVRA 1VKNA 2ZR8A 3A7DA 5AVXA 3LVQE 4OI4A 1G1MA 3KXKA 1OX4B 2HLHA 2YHBA 3KAKA 5I9NA 2NOAA 4OATA 4Y9TA 4CFSA 1RTKA 2R8RA 2Q21A 3UMJA 3RPEA 4X65B 1PBNA 3M6VA 1Q0ZA 3JU3A 1CP2A 1SM4A 2WWGA 1NTOA 3I9KA 4R69A 3DJFA 1G5RA 2Z4SA 3SOPA 1PLLA 2C4KA 3VR6A 4EPRA 1R10A 4ENVA 3EVBA 5HE9A 3UUEA 1QBGA 3QI2A 2AN9A 1CB7A 3WSWA 2C9OA 2PZGA 4C0XA 5IT5A 1XTKA 3DHYA 1XWIA 1GCOA 2GRUA 4BRWA 2W5UA 3DP7A 4BIIA 4TLCA 3G2QA 3TEJA 4IGKA 3MJHA 5BN3A 1VE7A 2ESRA 2QENA 2KPOA 3EQ9A 4OAQA 3FSJX 3EIOA 4GOMD 5CA1F 2ZRCA 3GPDG 1VRCA 3NHKA 5IJ9B 4C0HA 2VWPA 3F3YA 4NKRA 1P5HA 2A14A 1UDAA 1Z88A 2VYQA 4JR2A 3COPA 3TTXA 2B6NA 1X1RA 3MOGA 3Q3IA 4J0GA 5EJ4A 1TJ3A 4HX5A 4JVNA 5LYJA 4GKAA 1DWPA 4PZLA 1YZVA 4PR3A 4PYJA 1NQVA 1OI4A 1ZKDA 2AI3A 1TUIA 3DWGA 3U1VA 1SVNA 4MW1A 4YRFA 3RS3A 4S1VA 1ZI6A 1DHRA 1OZ0A 3EBLA 3HY6A 5F1KA 5LB2A 2YVQA 3VDXA 2V7VA 3M3HA 3IXQA 2MSDB 5FTKA 1NVMB 1QO0A 3K4QA 1F17A 2JFNA 3AEYA 1TC2A 4G8CA 2WIFA 4HEHA 4HMOA 5ECDA 1GUBA 3D81A 4EK9A 5JNLA 1TJ4A 3QTBA 4FINA 5LC1A 1Z8HA 4BPRA 5KPDA 1Z9BA 4AN4A 1LSUA 3MT8A 4FMDF 3L7IA 4EP1A 1K5GA 3A6GA 3KAQA 3OCUA 4EWLA 1TM7E 3H9UA 1E3WA 4IDDA 4ALIA 4WNIA 4CTKA 1O8CA 2QE7A 3H9CA 2JBHA 4F9GA 1YF3A 3FDXA 1TU0A 1AGRA 4J9VA 3A2KA 1R0LA 2CJWB 2E89A 1CUWA 1D1QA 2GK3A 4ZC1A 3QY9A 4QHTA 3OT1B 5TQJA 1B4DA 2GPJA 1R0ZA 1L0BA 2R751 3HNOA 4RKYA 3ZWCA 1Y4DE 3FSGA 4ZJZA 5DW0A 2G9QA 2IU0A 4KI0A 4BXOB 4UVGA 2QZ4A 2J5KA 1O0SA 3AF4A 3DQQA 5EJIA 1RJWA 4NU6A 4KMOA 1KYIA 1MPTA 1X1QA 3DL7A 3ESQA 4B9AA 4DMMA 2WJZB 4QLBA 4ZOAA 3QJGA 3N0VA 1H1LB 3QLEA 1MEOA 2DM6A 4E88A 2IEIA 3AQIA 3G8BA 4LE2A 3LH5A 5B2ZA 3OQMA 2DFDA 2G7MC 4CG1A 2FR8A 5EAIA 4FEEA 4IVRA 2OUIA 1XCMA 3Q8KA 1O94D 2XYHA 4HPWA 4YRSA 4KODA 1DU4A 2R6FA 4AZTA 1ZK0A 3PQFA 3RVKA 2H1CA 1TMGE 1UDCA 2P8SA 5B3JA 4AS2A 2JFUA 4LWOA 2VNAA 3UFXA 2B7BA 1EM6A 1UJCA 1XU7A 3F7TA 1Z4JA 4LV5B 4PRZA 3WWOA 5G41A 2E0IA 5LMCA 4D6PA 1QCDA 2FZVA 5C8DA 4ID3A 1TAHA 1ZH0A 1ULTA 1JKJA 3QKTA 2Q29A 1GQYA 3JQAA 4N6GA 4RKEA 5C5IA 5TMPA 4U2DA 1IY2A 4CMBA 2YUIA 4AQ7A 2VFAA 2PBZA 4H1UA 4DY6A 1GFWA 5CRIA 4UOQA 3DTTA 3NM6B 3X1YA 3AEQA 1DKUA 3WLLA 4FM9A 2ZSFA 4DYVA 5LP1A 1UWCA 2FUG6 4M1TA 4OXIA 2IPAB 3VPBA 3DAYA 1M6HA 3QKRB 1AOXA 5SY4A 3ZVLA 1V3VA 1MJ5A 2B78A 4JH0A 2CNLA 3AF1A 2I8CA 5MFPA 2AFRA 2CK3D 1NVVQ 2I34A 3QPUA 3X43A 2GK6A 4M1SA 1ZVMA 3R3VA 4F9FA 3EA5A 1TMYA 1RKXA 4BU0A 3DZ8A 4GF5A 3TB4A 3L01A 4PN7A 2QPTA 4S35A 4K0KB 5AHXA 1NRJB 2XB9A 3GRAA 4WV3A 3STYA 3ZWVA 2MCFA 5BUZA 3CN7A 1ZBQA 1EDDA 1YQQA 2JFXA 3VR5A 2GCGA 4HZGA 4YRCA 2FKAA 2MSLA 1XQYA 1N5JA 1K7FB 2RHJA 4LJ8A 5B5SA 1A77A 1E3JA 1I36A 2DQ4A 3PHGA 4M9XA 1DAEA 3FCUB 4IJMA 2XA2A 3KZXA 3QKSA 5A7GA 1AZTA 1U2DA 2KB0A 2I87A 4WBSA 3WA6A 2ZSUA 2DFNA 4MUHA 4A0HA 2AXEA 5JCZA 4O4JA 3L7MA 1NVAA 1C41A 2WJ6A 1FFYA 1NIJA 3HFSA 3E22B 2G80A 4GECA 3DKIA 5DCWA 3UNXA 3KKQA 4RL4A 1NC3A 2AA3A 3H97A 1YOVA 3RI3A 3AR2A 4WUVA 4Q7EA 3EIXA 5C1BA 3GWZA 4QOFA 4M8NE 4A8JA 1QR6A 1JIVA 2UAGA 1FDTA 3ZS8A 5TF4A 3OIUA 1I3KA 2O3SA 4RZQA 5EWJB 4G0VA 5JASA 5GONF 1SEPA 2Q1WA 3FCEA 4J3FA 3WK7A 3VR4A 1WXIA 2KI5A 2V1UA 3UOAB 4II3A 2JCXA 3ZXUB 4P3NA 1V11A 1X7ZA 4GOND 4I5FA 4L8LA 5IWCA 4O3MA 1I94B 3KCNA 1U63A 3FPKA 5DISB 1QF9A 3IS3A 4TYMA 1RI1A 1S9DA 4E2WA 3IKVA 4XIIA 2R1UA 2FFHA 2MYNA 3UJ8A 3VR4H 3T5AA 2FY8A 4N12A 3GA0A 1SBNE 2FWPA 1P8JA 4JKIA 1OOEA 1U7TA 4AMYA 1GLVA 2PXHA 1T8TA 3RK4A 4UUQA 1XZDA 4G4GA 2CHUA 2GF0A 1MF7A 3KG2A 1ECLA 1EWRA 5DBIA 2NV0A 1RRFA 4OK6A 1ZICA 3IV9A 1XDUA 5SZIA 1TMOA 4AURA 2V4ZA 1CQXA 3ROXA 3ORRA 4FFSA 3DBRA 2RGNA 3Q7QA 4DCGA 3ED1A 1GKUB 1UK7A 4MI3A 2ZJ6A 3CNBA 5CNMA 2Y1XA 3AHIA 3FETA 2BHNA 5DGCA 4NZOA 3TF5A 4DNOA 5K4AA 1AY0A 2FWNA 3WQRA 1KOGA 4O1MA 2OCKA 4I9UA 3DS8A 3I2HA 3ZBQA 4B75A 2H07A 2JBAA 3EGXB 3QE0A 3ZY4A 4A3SA 3TG2A 2FWAA 4DYDA 1Q12A 4NJOA 1L4MA 1JPNA 1Z0SA 5EE3A 1Y1TA 3W77A 3QW4B 1KRXA 2YBEA 3MC1A 1CCWA 3DCYA 3EULA 3ZK7A 4MP8A 2BFEB 2W7TA 4I5DA 1GTL1 1PJTA 4N03A 1N1EA 1BX1A 2GZ1A 2VH1A 4RJKA 1EI9A 2WV7A 3GMTA 4GWGA 5G40A 4RX1A 3WYBA 6YASA 3DDWA 1P9NA 2JD2A 2F1IA 2PMWB 3FWZA 4Z51A 3TK1A 4Q3CA 1MW8X 4RTLA 1D6JA 4ODIA 3MGKA 2ZS8A 1NI4B 2FEOA 5KBYA 2Y0DA 2MSKA 1HF3A 1Z06A 1B2RA 2PZKA 2R5FA 1O77A 3EVAA 5CM8B 1TQDA 4G89A 4DADA 4R6XA 3EXHA 3HABA 4FI3C 1AH2A 2DTXA 1XCBA 4H1HA 4LDNA 4C0LA 3G5LA 1GFZA 1NUQA 2HKIA 3K0BA 1E7MA 3OZTA 4XB1A 2P7HA 3CKKA 3WRWA 3FLBA 4ARVA 1C30A 4EG0A 1NPYA 2AOTA 4B7XA 2PA3A 1CQWA 1G41A 5JNTA 2VK1A 4EGFA 3D5QA 4AX4A 1XKQA 3IDOA 1KVQA 5JZBA 3U17A 2HSZA 2YMMA 1L5YA 4G5YA 2WAMA 4PSDA 4FYVA 4JDPA 5ECGC 1W5AA 4YO7A 3T7DA 2QOEA 4O8ZA 3FCAA 5JD6A 1U02A 2EDAA 4PX9A 2QJOA 2B20A 5KQRA 1IBRA 3DPIA 1E94E 4OLBA 3GRFA 1KORA