3TN7A

Crystal structure of short-chain alcohol dehydrogenase from hyperthermophilic archaeon thermococcus sibiricus complexed with 5-hydroxy-nadp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
234
structure length
234
Chain Sequence
MKVAVITGASRGIGEAIARALARDGYALALGARSVDRLEKIAHELMQEQGVEVFYHHLDVSKAESVEEFSKKVLERFGDVDVVVANAGLGYFKRLEELSEEEFHEMIEVNLLGVWRTLKAFLDSLKRTGGLALVTTSDVSARLIPYGGGYVSTKWAARALVRTFQIENPDVRFFELRPGAVDTYFGGSKPGKPKEKGYLKPDEIAEAVRCLLKLPKDVRVEELMLRSVYQRPEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Short-chain alcohol dehydrogenase
publication title Structural insight into the molecular basis of polyextremophilicity of short-chain alcohol dehydrogenase from the hyperthermophilic archaeon Thermococcus sibiricus.
pubmed doi rcsb
source organism Thermococcus sibiricus
total genus 92
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tn7A00
4M49A 1ARZA 2PH3A 1E1MA 3SBOA 3GMDA 3UFXA 4J9UE 1TB4A 5AOVA 3RUHA 1NR1A 4EJMA 1JWAB 1BW9A 5IN4A 1FJHA 1YDEA 3K2BA 3LSYA 3VH1A 2C5AA 3NUGA 2EP7A 1RYEA 3GA0A 2EHDA 1O95A 1YONA 1PJSA 2B4QA 3OIGA 2PD6A 3PLNA 4IS2A 4L73A 1LDGA 3CUKA 1H93A 4TMFA 2JFFA 1YQGA 2QYSA 1E3JA 1DAPA 1BW9B 4DA9A 1P44A 3FTPA 4XRRA 1OBFO 3M6IA 3DAFA 4CV3A 2H1SA 5LDGA 3DBRA 1DIRA 3CH6A 1U3VA 4HKTA 3RU7A 3SJ7A 1HZJA 1RM0A 3PI7A 4NH4A 2G0TA 2JFHA 3HJAA 1NFRA 4R16A 3H6KA 4JBGA 1U4OA 1XSEA 2EGHA 2NTJA 3ZZNA 4YQZA 3ZU2A 3DBRB 2OBNA 2HMUA 1HE2A 4PGFA 4RZIA 1TVEA 1ZK0A 5EPOA 4BUCA 1DC3A 1AN9A 2HRZA 2AE2A 1CIVA 3IP1A 4N18A 1EEHA 4YWJA 2Y1CA 5TGDA 4GGOA 4AJOA 1YBAA 1SOVA 1C14A 1ULUA 2ILTA 1E6WA 3HG7A 3D5TA 3OP4A 4IDAA 4JQCA 4XQ9A 3TSCA 4AJHA 1C1DA 1JVSA 1P33A 5I8WA 3DQPA 3H5NA 4IINA 4WUVA 5A9TA 3W4IA 3KBOA 5IJZA 4UUPA 3QWHA 3JYNA 5U9CA 2NNLD 1WP4A 5JBIA 3TFQA 2BD0A 3NTOA 2JL1A 1EUDA 2I3GA 4EDFA 5A02A 3NAQA 4CV1A 3IKTA 1I10A 2DBZA 3N58A 4EEXA 2BFOA 1PJ4A 3H8VA 5T67A 5IFLA 2EF1A 1FDTA 4Z9XA 3INTA 4ZN6A 2VZ8A 1ID1A 1ISFA 2Y99A 3GMSA 1PS8A 1NQTA 1OC4A 4YXFA 3U3XA 4GBJA 4NFYA 1LC3A 1PZEA 3RBXA 2NV6A 4D46A 1WMAA 3IIEA 4INAA 2VHZA 5I7EA 1KY4A 3ENKA 5C3MA 5ILOA 2CFCA 5TC4A 4NBWA 1R16A 3ZV6A 1YXMA 2X8LA 4GWGA 3W1VA 5JNLA 1ENZA 5FI3A 2BI7A 3NJ4A 1DRUA 4XQGA 4E5MA 1ENOA 3Q9NA 4K6CA 3FD8A 4RGBA 1PJTA 3VVCA 1I32A 1RM5A 2BHLA 4PLZA 4EUEA 1I01A 1GUFA 1NASA 4FN4A 5COBA 3V8BA 2X22A 1EUCA 2I67A 5A5FA 1B7GO 2OUIA 2H63A 4ZRMA 3HFGA 3ZU3A 3K92A 3WGIA 1BRMA 3GUYA 1GD1O 1PGJA 1WZIA 4GVXA 3BIOA 2F1KA 3PXXA 3A28A 2AEFA 4CM6A 2O3RA 1Z7BA 1E7QA 1XQ6A 3KZVA 3G1UA 5F5NA 4OOEA 2O50A 4DLLA 2D8AA 3RFVA 3H3JA 2I5PO 4W99A 2EERA 3ZHYA 3VPHA 3MJTA 5GZ1A 5JE8A 1L7EA 1GQ2A 3E9QA 4PLYA 5B4TA 5K9ZA 1ZCJA 2Y1OA 2YQ4A 3P19A 4PVCA 3FSRA 3PPIA 3AUAA 2VQ3A 5GZ3A 4IQGA 2VYND 3GVHA 2DAPA 4GX2A 4MVJF 5L3ZA 1H0KA 4O1MA 4ALNA 5JAIA 1A71A 3RJ9A 5DOZA 4Z6KA 4AJLA 4QSMA 2EJWA 5ER6A 1YL7A 2IEBA 3E5RA 3JQFC 5ITWA 2HCTA 4WASA 4GAEA 3VZPA 5JYEA 3E03A 4HX5A 4WCFC 3F4BA 4JROA 3PQFA 2ZB4A 5ENVA 2YDXA 2FMUA 3GAZA 3QP9A 2IDZA 3QRWA 3V1UA 3MJVA 3TOXA 4D42A 4HFNA 1Y8RB 4ZVVA 4RVSA 1UXKA 1U5AA 3ZWMA 1M66A 3JYPA 5CHEA 1U7HA 4OQZA 3TOZA 2QQ5A 4BHTA 1LRLA 2FR8A 4BV8A 2C54A 4A27A 4DC1A 2ZTVA 1V8BA 1J4AA 3SX2A 3K9QO 4LISA 1HLDA 4DQXA 5TSDA 3CXRA 5B1YA 4IS3A 1T4DA 3Q6IA 1MC4A 1O89A 2GPTA 2R00C 1PL8A 3WFJA 4AJPA 5DNAA 2IZZA 3UXYA 1HYEA 4IMPA 4CMCA 3ZV4A 3NX4A 1YS4A 3GDOA 3Q11A 1U3UA 2NVWA 1X0XA 3LC7O 1SBYA 2ZTMA 3WX0A 3OICA 5ER9A 1VE9A 4XA8A 2ZYGA 4IIVA 4WLVA 4C7JA 3INGA 3PFWO 3I4CA 1XA0A 2AMFA 3WGOA 4J1NA 1EVZA 3H4VA 3KM0A 1A9ZA 4RPKA 1Y9AA 3OQ1A 1MV8A 4E2YA 2DTDA 4R3WA 5DCYA 3AI1A 3RWBA 3DB2A 1EDOA 1ADBA 1BXKA 4N7RA 2DUWA 4Z0TA 2AQKA 4EJ0A 3B70A 3B1FA 2YZ7A 3OEYA 5JCJA 4MDHA 1SEPA 1LX6A 2DC1A 4W9NA 2XXBA 1ZO8A 3KV3O 1Q0HA 3KETA 4U7WA 4BKPA 1X13A 4AVYA 4W82A 4DGSA 2E82A 5KWEA 2WE7A 1KY5A 1SCUA 3W4KA 3L6DA 4LMPA 4LVUA 1QYXA 3BMQA 3QWBA 4YJHA 1U28A 4FJ2A 3NTQA 2Z5LA 3LC1O 3IMFA 3T7CA 1H94A 2O3JA 1V9LA 1SPXA 4E30A 2X0RA 4JIGA 1J5PA 1IOLA 4E32A 1X7GA 4OQYA 1KOLA 4IGEA 1B8VA 1QORA 4BNIA 1P77A 4YJHB 1ORRA 3AI2A 3ROQA 3BMOA 4ROSA 2JHGA 1O6ZA 5DOVA 3JQFA 4R69A 3WICA 4ALLA 3S2IA 3TZHA 3R1IA 3I9JA 4Z9YA 2OFPA 3TZCA 2CSUA 2ZB3A 1MB4A 4A0SA 1TA4A 2GSDA 2PTGA 2VT2A 3DTYA 3RKUA 3ZCXA 1DAOA 3FBTA 2EXXA 1UXHA 3HWRA 4K26A 5G2OA 4RF2A 5THQA 5TT1A 1R4MA 3I6IA 1EK5A 2Q1TA 1P1JA 2FR1A 1CWUA 1FDUA 1UUFA 4J49A 4QO8A 3S2GA 4JX8A 3PP8A 2C20A 2C82A 4PZDA 2YDYA 3ZGYA 2Q45A 3QE3A 4NK4A 2QZ9A 2R00A 4ZQEA 3FNFA 5I7FA 3AM3A 5EERA 3ZWAA 3W4JA 4NQZA 2Q3EA 2V7PA 4R51A 1GR0A 5B4UA 4CLOA 1LRKA 3AK4A 3DXFA 4J1SA 3LVFO 1VL8A 4FOOA 3PJFA 4XJSA 3U9LA 1T2FA 2BFMA 4XZ3A 3AM5A 2EV9A 1E3WA 2D2IA 4CJXA 4NPCA 1LQUA 5G4LA 4M8SA 1B8UA 2C2YA 2VOJA 2RBEA 1N8KA 5F5LA 4O6VA 4Y6RA 4WEOA 5JAQA 3B20A 4IM7A 3UW3A 5JAMA 1NHGA 3JQ7A 1A4UA 4U0JA 4J16A 4GSKA 4K9DA 2Q46A 8ADHA 4K1LA 3CE6A 1E3WB 2J5KA 1QR6A 2AW5A 4Y6PA 4JN6B 4PLCA 4X54A 1XKQA 4FC6A 3ROKA 4YT8A 2PGJA 4RVHA 2C29D 4WGGA 3CINA 1GPDG 1SB9A 4KUGA 4OKNA 2VNAA 3QLJA 4WE3A 5G0VA 3VTZA 3PJDA 4YT4A 1DXYA 5JMPA 2UUPA 2O48X 3FRJA 1EVIA 4HWKA 2TMGA 4J7XA 3WIEA 3GVCA 4HUJA 2JAHA 3ZHXA 4CM3A 2X9VA 5JY1A 4I5FA 1SZJG 2IRWA 4NFHA 3TDKA 1E7MA 3HQ4O 3PDJA 3GFBA 4B79A 2P4HX 1AUPA 2B35A 3K2EA 2C7VA 3I52A 2NU9A 4ZICA 3GVXA 1T2DA 1YQDA 3RI3A 5CAEA 5L51A 1GZ6A 4E2XA 2HJRA 3OQBA 3V1YA 3R3JA 3VZQA 1WDKA 1N9GA 5AXBA 3IDSA 3AOGA 5JY6A 2J5RA 3KOUA 1MP0A 2AEJA 2AEMA 2CF6A 3ONFA 5GMOA 1DJNA 3TFOA 1DFHA 1I24A 5CEEA 3ZWOA 4XJTA 4HXYA 5IF3A 1ZKMA 2IYOA 2O2YA 1YQXA 3I83A 4TSKA 4QQRA 3ITDA 1Y7TA 4BNYA 1N9GB 2PZKA 4XR4A 3UH1A 4MVJH 4EITA 5JCJD 5KVCA 3RCBA 3LC2O 3QVTA 1A27A 3L6EA 2VN8A 1H6CA 1ZK2A 1Y5MA 1P9LA 2HKIA 5BSEA 3GY0A 2E37A 1H6BA 2O3SA 1VJ0A 4KDEA 1O5IA 3ZHBA 3WGHA 4E0BA 4AICA 4DVJA 2VZ9A 2DM6A 4UREA 1M67A 3PGXA 5GY7A 2V65A 2HDHA 3WG9A 3KXDA 2Y67A 2Q99A 3TZQA 4D3SA 1EK6A 2WMDA 4U6SA 4WECA 1R6DA 4P4LA 4XYEA 3PHIA 1QG6A 1LC0A 4GX5A 3ST7A 4R3NA 1WMBA 4GX1A 1UZMA 2HUNA 3ONDA 4LRSB 4Y8VA 3QV1A 5CFZA 5BNTA 3TQHA 4OYRA 3DTTA 1GEGA 2PGDA 1XHLA 4RF4A 2GERA 5I9MA 1PTJA 4MJLA 1PGNA 4L4RA 1A5ZA 1ZVMA 2O23A 2VWPA 1VKOA 1NR7A 2C0CA 4L4XA 3DFUA 5TNXA 9LDTA 3WOHA 3Q2IA 1KEPA 4EJ6A 2Q4BA 3HB4X 3KEQA 5C7LO 4RF3A 2EKLA 1J6UA 1YVEI 1KVSA 2DBRA 1Y8QA 4B3HA 4P8RA 1I33A 1YB1A 1SO8A 1R15A 3PYXA 1QYCA 1VI2A 5BR7A 4LSMA 3PEFA 1HF3A 3H9JA 1ZSVA 1QRRA 5G0WA 1SAYA 2QG4A 3G0OA 4PRLA 4OSPA 2HO5A 1PJ2A 3ZV5A 1W4ZA 4P4GA 3K8ZA 2YFQA 4FD3A 4YT2A 2Y68A 1NQAO 1E1LA 2JCXA 1VRWA 3HDJA 3QWFA 1H9AA 2GLXA 3WIDA 1T25A 1Y8QB 2ZCUA 2HK7A 4YCAA 4WJZA 2BGLA 4PG4A 1E1NA 3PK0A 2EKQA 4OKIA 4IZHA 1QV7A 4XRGA 1EE9A 3ANLA 2Y05A 4PCVA 1HDCA 4FBGA 4BIIA 3NJ8A 4Q39A 2YHIB 3WGTA 3I4FA 1E77A 5F3RA 1D1TA 1SEVA 4RPGA 3ZWWA 4IDBA 3UUWA 3DZJA 1E7RA 1D7OA 1MX3A 4R1UA 3GF4A 4N5LA 3PIDA 3ZU5A 3A1NA 3VKVA 5A4DA 2AHRA 4R41A 1DIAA 5IZCC 3VPFA 1GYQA 1R66A 2C2XA 1R37A 3BTUA 4IXTA 2NVBA 4CPDA 1ZUD1 1ZMOA 1R4NA 3K31A 4Q3EA 1QYVA 1M6WA 4IJVA 4ZD6A 3I3OA 1U5CA 4XGKA 2GN4A 4CV0A 2FR0A 4BNVA 2QYTA 4U6QA 4NK5A 1AGNA 3DEYX 2B36A 2B0JA 2VOEA 3BAZA 3GGGA 3MJEA 2VWQA 3NGLA 4RORA 2FY8A 1GPJA 4GQAA 4XYBA 5TJ9A 4BQRA 3PVZA 2D5AA 3KSUA 4FS3A 4YACA 3KYBA 1C0IA 4JNKA 4XCVA 4HNHA 3PFFA 1FK8A 1LDNA 3JQEA 4ND5A 1NXQA 2JD2A 4PG7A 1XEAA 4DUPA 4IJWA 4MVJG 4GWKA 1QLHA 2IEDA 2YV2A 1E3LA 2RIRA 2PZMA 4NU6A 3DHYA 3PWZA 1B8PA 5ITVA 2EKPA 1Z74A 3NYWA 4UULA 2HJSA 1G0OA 3E18A 2DBVO 3WJ7A 1C0KA 2VUTA 5BSFA 4IQ8A 4A10A 3ADPA 2PV7A 3F5QA 4PVDA 4N54A 1XU7A 5A3JA 3E9NA 1BVRA 4U0KA 4QTZA 2G5CA 4PN3A 1AHIA 1IB6A 3S1LA 5L9AA 1E7YA 1DB3A 4DBZA 1I3NA 1CRWG 1PEDA 1VSUA 1ULSA 4RDHA 3W6UA 1I5RA 4J91A 3RASA 3I9OA 1PL6A 5TIIA 3FWNA 1PJ3A 2ZB7A 3F1LA 3ZNPA 4EUHA 1IL0A 1PL7A 2PKQO 2WD7A 2VHVA 3GVPA 5EMHA 5JC1A 3RUFA 1Q2XA 2I76A 4ND2A 3VPSA 1LJ8A 4DTIA 1Q7BA 5JAZA 4BO4A 2YJZA 4CM5A 4F45A 4LCJA 3N7UA 3NTRA 4CMGA 2G1UA 4UVEA 1G0NA 2QRJA 1LLUA 2NU7A 1TI7A 3BMCA 1RM4A 1M2WA 2E4AA 2E6UX 2VYNA 3GG9A 4MOWA 1I8TA 1P1IA 1HDYA 4MVJI 3WB9A 2X5OA 2FRDA 2Q1WA 1WPQA 2HMSA 1JA9A 5MGBA 1IHXA 3VDQA 4YYZA 1PWZA 3QVSA 2JKVA 3V2HA 4AJEA 4DPMA 3ETEA 3C7CB 4MP8A 4RQTA 4J1QA 4H15A 2JFGA 3BMCB 4TZTA 2B69A 5DT9A 3UF0A 1I2BA 2AQ8A 1DHRA 1H2BA 4CLXA 3OJLA 4QFCA 4ZA2A 3INRA 4BVAA 1DEHA 4CLRA 5KVQA 5IZCA 5U1PA 1WW8A 1KERA 4B4UA 4UVDA 2E48A 1MG0A 5IDYA 2IZ1A 1PS9A 1EBFA 1P1RA 2ZQYA 1K6XA 5TF4A 1XIVA 1I36A 1EZ4A 1T2AA 4ZQFA 1A72A 3KLMX 3NT5A 2OMEA 4NBUA 4QX6A 4XDYA 3QA9A 2A35A 1UXGA 4ZQHA 4MKXA 4KTVE 3UHAA 1B15A 4XYGA 5L45A 1YL5A 4OM8A 2GASA 3I23A 1OFGA 4U8GA 2NM0A 1IULA 4FFMA 2XAAA 1HXHA 1I2ZA 4D3FA 4GH5A 3M2TA 3AFNA 3JQGA 4D79A 4BNWA 2A94A 3BXXA 2RHCA 1KC3A 3W8FA 3ORFA 4HFMA 4B3IA 2O3UA 3D3EA 4JCOA 3V5NA 4OMUA 3GQVA 4PLHA 2BELA 1EQUA 2WM3A 3T4XA 4LN1A 1PZFA 3TRIA 3OIDA 3JQGB 2PK3A 3HUDA 4ZGWA 1CERA 3PYLA 3G79A 5JYDA 3IKVA 1B2LA 4XKJA 5LCXA 3S8MA 3GDFA 4Z0PA 2VCYA 4EEZA 1XYGA 1C1DB 2I3AA 4FFRA 5L53A 4EI2A 4GSLA 5L7YA 1HYGA 1E6UA 1HLPA 4DIOA 3V1TC 5HBRA 3ZH2A 3K73O 1DRWA 3UGKA 2QRLA 3K5PA 4R1SA 1DC6A 2AQIA 3KYDA 4J43A 4MP6A 1YGYA 5H82A 4TRMA 1LSSA 4PLFA 2POQX 4IDFA 4QO7A 5JO0A 4OH1A 1GQYA 4O5OA 1CQIA 4RPHA 2VUSA 1UP6A 1MLDA 1NM5A 4UAGA 1X0VA 1UAYA 1V0JA 2OZPA 2J3KA 4JP3A 3KYDB 3L4BC 4J4TA 2ET6A 3CIFA 5A04A 1ZW1A 5BSGA 4QEDA 1GL3A 1HKUA 3TZKA 4A7PA 4JGBA 2DLDA 2Z1NA 4AJ2A 3SC6A 3GR6A 5BQFA 4ZQBA 5FEUA 4B4VA 2CDBA 3FWZA 3RIHA 1GAEO 4UEKA 5CDSA 3OM9A 2UAGA 3OEWA 3PJEA 3HDYA 1W73A 3IC5A 1DPGA 3JQ9C 4NJOA 4YPOA 4NFSA 2UV8A 1HL3A 3KHUA 3MOIA 1BDMA 5GZ6A 4JLWA 4UVHA 2Y1DA 3EW7A 1HYHA 3NKLA 1PGQA 2VRBA 3LU1A 3DBVO 2C7GA 3P2YA 2D0IA 1I0ZA 1GCOA 3JV7A 1A7KA 1LLCA 2NTNA 4LVCA 3ROPA 5JFOA 2I99A 1U8FO 1DHTA 2H6EA 4DMLA 1B3RA 4A03A 1UP4A 2AXQA 4KWHA 4FFLA 2NLOA 4YDRA 3EZYA 5A06A 3Q1LA 1ISJA 4QT0A 2G17A 3D64A 3GPIA 4B7UA 3MCVA 1HTBA 3EGOA 5KKCA 2DTXA 3WGZA 4YT5A 2Y1EA 5K0ZA 3T4EA 4GLLA 3QVOA 4HBGA 4GKBA 2GO1A 1K3TA 4YRAA 3ZWPA 3JD2A 1J49A 5JMWA 4LW8A 2W2LA 4ALJA 1GADO 4R9SA 4AJJA 2OGUA 4BGEA 3JQ6A 3ZV3A 4PG8A 1CETA 3CMCO 2EW8A 4Z3KA 2NWQA 2BH9A 5TQVA 1ONOA 4XGIA 4ND1A 3BTVA 1S7CA 4P38A 1D1SA 2VHXA 3L0DA 2FN7A 4G5HA 5KVVA 1H2HA 1V3VA 2GRAA 4R1TA 1XQ1A 3COSA 3W8EA 3IL2A 2XF8A 4ZHSA 2VWHA 4DPKA 3U5TA 1Q7GA 4XQEA 1PQPA 3FPCA 3C1OA 5TJHA 1VJ1A 1F12A 3RVDA 4Q3BA 1LDEA 1K89A 4AJIA 1Z75A 4DLAA 4A73A 1R12A 4KWIA 3LLVA 1U4SA 3O9ZA 4IXWA 4CMAA 1FDWA 3FR7A 2BKAA 1QSGA 2OOSA 4KZPA 2HRBA 2Q49A 3DHNA 1PZHA 4OXYA 2GR9A 3NRCA 3ZWBA 2C59A 1K5HA 2HU2A 4JK3A 3L4BA 1JDJA 2OXIA 1EQ2A 2ZK7A 1UZLA 2P9CA 3W6ZA 4FFPA 4E3ZA 3RUAA 2BF7A 3DOCA 4XR9A 3VKUA 5JDIC 2BFAA 4CM1A 1EVJA 1ZEJA 3GEDA 4G81A 4CMBA 1LNQA 1LEHA 1ISHA 4YAEA 2X23A 2P5YA 4CL3A 4UUOA 1PQUA 1UDCA 5T8KC 2UYYA 4BNTA 4BOYA 5HS4A 1MC5A 1N2SA 1J0XO 3WTBA 3FBGA 2GZ1A 3PZBA 4RJTA 4YJGA 3VAZA 3ZWVA 5CPBA 5I8ZA 5IDWA 2CNBA 1NYTA 3P2OA 4NZ9A 2OBYA 2W8ZA 4MVJE 1RWBA 2HK9A 4P22A 4IPTA 4NI5A 1PGOA 4G2NA 2UDPA 3B6ZA 4D0RA 4OAQA 4XWYA 3VVBA 5CP8A 4Q3NA 5H81A 4DRYA 3UCFA 3GAFA 4H3VA 4J0FA 3JYLA 3EVTA 2X0IA 1PR3A 4E4YA 5DULA 4BMNA 2DTEA 3AI3A 2X9NA 3GUCA 3UVEA 5BSHA 3PGJA 2EEZA 2AG8A 2O3TA 4Y67A 1QLJA 1ZK1A 4NU5A 4QUKA 3ROMA 3BMQB 5AQ1A 2GN6A 1T1RA 1GDHA 5L95A 2HMWA 2DBQA 4WKGA 4B7XA 4XIYA 2CMDA 4CMJA 1T24A 1HE3A 1EFKA 1XGKA 3EY4A 4OIMA 1F8FA 3U4HA 4D45A 2NUAA 1ENYA 4WCFA 1ZSYA 5G4KA 1LXCA 2OORA 3TZ6A 4HFRA 4TKMA 4BKRA 5CDUA 3TNLA 3WWYA 2DPHA 1Z45A 2NSDA 5CDTA 3SVTA 3V2GA 4J7UA 4AJ4A 1QYDA 3BMOB 1CQJA 5CEJA 4I5DA 2RH8A 4B8WA 4YQYA 3GNTA 1ZXBA 5CG2A 4RPJA 4WCFB 5KKAA 2QHXA 1LDMA 4J7CA 3JYOA 3MWEB 2R2GA 4MP3A 4KQXA 5JLAA 1NAIA 3I9KA 1R4MB 5TS3A 3ZW8A 3WDSA 1BXZA 3WGGA 3DBHA 2NU8A 1ZMTA 5L7TA 1XR3A 3WXBA 5AXAA 5ENDA 4QFDA 2PZJA 1XU9A 5THKA 1GEEA 9LDBA 1SC6A 4M55A 1MXHA 1ISMA 2D59A 5JDCC 3Q0EA 1U8XX 1N92A 1PR9A 1VL6A 1LI4A 2V6BA 3DBHB 5DBIA 1HDZA 4ZJUA 3WQRA 4N5MA 1KS9A 2CY0A 1OMOA 3HN7A 4CLOB 4FFOA 5JDIA 2Y93A 3GN2A 3L9WA 4KTTE 2I66A 2W2LD 2WEKA 5DBGA 1YBMA 2WYVA 2QX7A 5CDGA 3JD4A 2DU8A 2E49A 5T8KA 3DMYA 3QW2A 4ALIA 4YRDA 3FHLA 4L9RA 3H9QA 4IMRA 1KVUA 1WXDA 2WSBA 3JQ7B 3LQFA 4JBIA 1YRLA 4RDIA 2JD0A 4UEOA 3VH3A 2YV1A 4M1QA 2GZ3A 2Y66A 1K2WA 1YKFA 2X7HA 3L4SO 3OJOA 1Y5RA 3UCEA 4R01A 4BGUA 1I3MA 3HFSA 4BB5A 1ZZEA 1PJQA 3F4LA 3WYEA 1Q7CA 3BTOA 2GGSA 4YJFA 3W8DA 4L4SA 3PQEA 1X14A 4CM4A 3WQQA 5B12A 2V6FA 1WNTA 2VYVA 1GUYA 4KDFA 4A2CA 3BHJA 1PWXA 1X7DA 1ADFA 4RVUA 1U3WA 3VZRA 4YJFB 4DYDA 2QIOA 3RJ5A 4ITUA 4WLOA 3ADOA 1ISIA 2B37A 4CM4B 1F06A 1RM3A 2FPGA 2ZATA 4J6FA 4I08A 5DN9A 3LYLA 3M1LA 4BNGA 3KTDA 1IYZA 4F3YA 4TRRA 1DC4A 1LUAA 4BO5A 4WK6A 3PRJA 3I5MA 2VUUA 2GN9A 5T57A 1B0AA 3NT2A 3HZZA 4C4OA 3RUIA 1Q1NA 4FJ0A 3X2FA 1UDAA 1LLQA 3L77A 3Q3CA 1A4IA 3R0IA 3K96A 3H2SA 3G1TA 2PKRA 3F46A 3QQPA 2ZYAA 4BNLA 4EUFA 5KJ6A 1SB8A 3MTGA 4LGVA 2XPCA 4II3A 3JQAA 3KB6A 3HE3A 1ZJYA 4E5NA 3WS7A 1GQQA 3KEOA 1N1GA 1VPDA 1JKFA 3IOYA 2HSDA 4XX0A 2PKQP 4MPDA 1WAMA 3PYMA 4CM9A 4XB2A 1KEWA 5JDCA 4AFNA 1IUKA 3JD3A 4BS9A 4BO9A 1YWGO 5TLSA 1Z7EA 2ZIZA 3FF4A 3C24A 4CR6A 1X7HA 5EQFA 4D3DA 2F00A 4XGNA 3NDIA 1BG6A 3IUPA 2PNFA 1DIHA 2HAEA 1TT5A 3DZGA 3VOSA 4CODB 3GN1A 3GT0A 4J4HA 1XCBA 1ZSNA 3GVIA 1LSUA 2FPIA 1IZ0A 1I3KA 3KSDO 4NBRA 4OO3A 4CR7A 3IS3A 1BDBA 4RLSA 1PJCA 1F8GA 4D44A 1F14A 1ZBQA 1X15A 3PTZA 2W2KA 2NVUA 1B26A 4KUEA 1NTOA 2WE8A 4TVOA 1TT5B 4M86A 4YEDA 3NV9A 3AJRA 4J0EA 3AW9A 3H7AA 1NP3A 4BB6A 4IDEA 3ETGA 2QRKA 2B5WA 2ZQZA 3FN4A 3D5QA 1NBOA 3LT0A 4E5YA 3U49A 1AXEA 3AY6A 5JSFA 3AY3A 4II2A 2CF5A 2O7SA 2TMDA 1FDSA 2PA3A 1Z82A 1C1XA 4BO2A 1U7TA 3E82A 1VC2A 1MG5A 2WTBA 2NQ8A 2YQ5A 3EHEA 4W6ZA 5KCZA 1TXGA 5KJCA 5F1PA 3PWKA 2PR2A 1UAGA 4MIEA 3F5SA 2IE0A 3RROA 4BL5A 4BQPA 4TZKA 3EMKA 3ZNNA 5G0SA 3TPCA 1C1XB 2X86A 3DBLA 2GUGA 2GCGA 5LC1A 2X5JO 1GV1A 1PJLA 2XOXA 3Q9UA 4A5OA 1U9JA 4DQVA 5JS6A 2WYUA 2RCYA 1JWBB 2I65A 1DC5A 3X2EA 4RO0A 4CQLA 4FOSA 2B5VA 3DAPA 1HE5A 1P1KA 3EDMA 3L9XA 2J5QA 1YE3A 1P74A 3JQBC 2Z95A 3E1KA 2W4QA 4RVFA 4WLNA 1EFLA 3ZU4A 2HMVA 1RKXA 3WBFA 1L1FA 2ZYDA 4CQLB 4FB5A 3DOJA 1ZXLA 3O38A 4GPD1 4WPGA 5J23A 3U4DA 1R4NB 3DZHA 3GH3A 1SNYA 1YOVA 2B4TO 3ONEA 2Q1UA 4J3FA 1KEVA 4PLWA 2X6TA 3I9NA 1WDLA 2YV3A 5COAA 1LU9A 1JW9B 1NHWA 2PGLA 3BHIA 5T64A 3G17A 5FYDA 4BNJA 1IPFA 1RJWA 4QXMA 2VYVD 4L76A 4P4NA 4Q3CA 4UVGA 2Y1FA 1IPEA 2PFGA 4IDDA 3KLPX 2LDBA 2QZZA 5C5IA 4CM8B 1YOVB 4CR8A 3ZNQA 1YH3A 1UJMA 2VHWA 3KYCA 5DCUA 3LF2A 3ZW9A 5F1KA 2XXJA 3WNQA 4ND4A 3GEGA 4GI2A 2EJVA 2J3JA 3IUSA 5C37A 3QY9A 1O94A 2R6JA 4WCDA 4I9NA 4BKUA 4J2HA 1C0LA 4CUZA 4H7PA 1MXFA 4J2OA 4DBVO 4HV4A 1PGPA 4NIMA 4B4WA 1V3UA 1E1KA 3C8MA 2CD9A 5DZSA 3GHYA 1E3IA 2X0JA 2C07A 3I9LA 5F1OA 4A26A 2NADA 4WOKA 4URFA 2YHUA 3STHA 3OA2A 2HLPA 2X9GA 3VH2A 4B4OA 5HM8A 4BGVA 4J9VA 4YTEA 1BWSA 5C7OO 2JAPA 2VT3A 1UZNA 5AXCA 3GRPA 3C3XA 5BNIA 3DAGA 3AUSA 4E5KA 1CDOA 2WDZA 1JU9A 4I5EA 4XIJA 3HSKA 3DZKA 1JQBA 4PG6A 3JQAD 2VNSA 3H5AA 4PZEA 5K6AC 2WD7B 3A06A 3MOGA 1KBZA 1PSDA 2DVMA 3DZFA 3GFGA 4NBTA 4TWRA 4CM9D 3E5MA 1PU2A 4MKZA 2NTVA 1V35A 1GV0A 4BNXA 3R6DA 1A7AA 2RAFA 2BGMA 1HWYA 1R0LA 4BMSA 3F47A 4WLFA 1P31A 5EESA 4ILKA 6LDHA 1JAYA 1M75A 3WLFA 4R54A 4CM7A 3H9UA 3S2FA 5EN4A 1ONPA 3ULKA 1XELA 2O4UX 3NDJA 1LDYA 4JJIA 3ANNA 4CUKA 4MVJP 1AHHA 2FZEA 4FC7A 4CL8A 1KIFA 4J90A 4EBFA 1EMDA 3RKRA 2LDXA 3DC2A 4MVJA 4BNNA 1A9YA 4DQUA 5I7VA 3DONA 7MDHA 1O8CA 4AJKA 4BKQA 1HRDA 1XLTA 2O7QA 4OL9A 3UICA 3C1AA 1B16A 1BMDA 2BI8A 3TWOA 4CLRB 3WMXA 3ZWYA 5IN5A 1DIGA 1DSSG 3GGOA 1ZK3A 5A03A 1DOHA 1FDVA 1W6UA 1QYWA 1NX6A 1W8DA 5IAAA 4BO6A 1K6IA 1ZJZA 1BHSA 3E48A 3LZ6A 1MUUA 3V2UA 2YUTA 3ZHZA 4B3JA 2WD8A 3AFMA 5KTKA 2FOIA 4PZCA 4CM8A 2CDAA 5G0TA 4WEQA 1KC1A 2CUKA 4MO2A 3AWDA 4YB8A 4ZU3A 3KVOA 2WJPA 1NPYA 1QXSA 3G3EA 2EGGA 2Q2VA 1U3TA 2GZ2A 4YAIA 4Z9FA 2CZCA 1G6KA 1ML3A 4HP8A 4EW6A 1AXGA 2B83A 3DWFA 2YY7A 4TVBA 5ICMA 4CQMD 4E5PA 1NPTO 2YYYA 3ICPA 2GD1O 2X58A 5DDIP 5C7IO 1C3VA 4RPLA 2Y0CA 4GX0A 1ZNQO 1DBVO 4GMGA 5AVOA 5L4LA 3OJFA 2HK8A 5HWSA 3E8XA 3T7EA 1OOEA 3EVNA 1MA0A 5CG1A 1FMCA 4E31A 3GZ4A 4K6FA 1GCUA 2FP4A 4CUJA 5A05A 1ZFNA 3IJPA 3QWIA 4DWVA 1T26A 1WVGA 1JN0A 5B4VA 4BNUA 5K6AA 4NR0A 3RC7A 1CYDA 3MZ0A 4WLEA 2H9IA 2D5CA 5CDYA 1NNUA 5A9SA 4EZBA 1NVGA 3PHGA 2DQ4A 3D0OA 1NFFA 5L40A 6ADHA 4F6LA 2OL4A 5A3VA 1PIWA 1HZZA 1SMKA 4JXKA 2G82A 2P9EA 3OMLA 4Y6SA 3GPDG 3A14A 1B14A 3MJCA 2A92A 5A9SB 1ADGA 4LK3A 3UKOA 1Q0LA 3ASUA 3DL2A 3GC6A 3JD1A 5KOIA 4L0QA 1YO6A 4YVFA 3QVWA 3ASVA 3D7LA 3DO5A 1YJQA 4IBOA 3QJ5A 2O4CA 1LSOA 4Z0HO 3WTCA 3ICCA 3LT2A 1DDOA 1T2EA 3H65A 4FFNA 4PFJA 4B8ZA 3EC7A 1UDBA 2AE1A 1N7GA 1T2CA 2Q4EA 3MJSA 4FPXA 3PHJA 4BMVA 4YAKA 4E33A 1GY8A 2Q50A 5FI5A 4ZQGA 2Q2WA 3AU8A 2DPGA 3NGXA 4BO8A 3H9EO 3WYCA 5JO9A 4E21A 4ESOA 3UN1A 3U4CA 2FWMX 4UUNA 4W9NC 4AJNA 1UH5A 2J3IA 1EUZA 1N5DA 3EYWA 3RUEA 2PZLA 1FXSA 3IP3A 1JAXA 1QP8A 2PWZA 4RF5A 1R0SA 3WMWA 5JPIA 5JXWA 1DRVA 3CPSA 1HSOA 4XDZA 2GN8A 2IYPA 4FGSA 1IE3A 1H5QA 2PH5A 1EBUA 2P5UA 3GDGA 4O0LA 3VPGA 2QW8A 1DLIA 4I5GA 4CLDA 4DC0A 4WNIA 1KVRA 3DOOA 3N74A 4AJ1A 3PQDA 3RU9A 1R0KA 1N7HA 2DFDA 1VJTA 3L07A 2ZCVA 4E2WA 2PY6A 3F9IA 4GL4A 3D3WA 1BSVA 2O3QA 2AG5A 2WWRA 3GG2A 5TX7A 1M76A 3JD0A 3B1JA 4ALMA 3BMNA 3DZIA 1Y8RA 2SCUA 3RD5A 4TROA 2GF2A 4MVJD 4U5QA 1E7SA 4R68A 4L74A 3E6AA 3O8QA 4CLHA 2P4QA 5KJFA 3RC2A 3NDRA 3HDQA 1HDGO 2BGKA 1K6JA 2Y1GA 4XEHA 2D3TA 1GYPA 4N5NA 4EGFA 5HTOA 3D3WB 3HDHA 4CMEC 5IG2A 3ABIA 5CEFA 1ZEMA 2D4AA 4CMKA 4Q3AA 3BMNB 2A4KA 3O8QB 4WOJA 4JJFA 3OFSA 4PIVA 4HADA 1MFZA 1D3AA 4UUMA 1IHYA 1ADCA 1WDMA 4O63O 1NFQA 3F6YA 1ZIDA 4ID9A 1UR5A 3R3SA 3VPXA 3HN2A 3BZUA 4YBZA 3ZI0A 2P2SA 1PS0A 1XWFA 3BA1A 3FNGA 1JTVA 4BGIA 2DFVA 5T6BA 2DUUA 4RL6A 4BO7A 5KJ1A 1BVUA 7ADHA 1DIBA 2ZTUA 3JQ9A 1VKNA 4B7CA 3MJ4A 5A5EA 1GZ4A 1QKIA 2P9GA 3M1AA 1YB4A 4PLTA 2VZ0A 3JYQA 2P68A 2ZTLA 3FNHA 4E13A 2EG9A 3H5RA 1PJBA 4R1NA 2FSVA 5AYVA 4J1TA 4I8XA 3UAGA 4HFJA 2VRCA 4G65A 1TEHA 3OA0A 1WWKA 4ZRNA 4DIFA 1GTMA 3JTMA 1D4FA 3L6OO 4OJNA 4M89A 4I1IA 3DFZA 4XD2A 5HA5A 1MGOA 1BTOA 2EIHA 4YJGB 4D7AA 2JHFA 1HE4A 5H83A 5I7SA 1OZAA 3IAHA 3FPLA 3AUTA 3CZMA 3LK7A 4LRTB 5L4SA 2X4GA 1L7DA 1E3SA 3GOHA 5FFFA 2YW9A 3FCOA 1VL0A 3TL3A 1V6AA 3NT4A 1LSJA 4DXHA 3ANMA 2J6IA 3EK2A 4ALKA 3GRKA 3GHHA 5KNLA 4FJ1A 1E7WA 3BYZA 2CVQA 3I9MA 4K28A 1NWCA 3S2EA 3Q2KA 3WSWA 4MKRA 1KEUA 2H5LA 4RCVA 3DHEA 1H6AA 3PDUA 4IGFA 3WJAA 3WYBA 5ICSA 1P1FA 1NVMB 3LT4A 5ADHA 3EAGA 3LT1A 1KVQA 1HETA 4PRKA 5DP2A 3OETA 3K30A 4PLGA 5LDHA 4KUHA 3SC4A 1LDBA 3OH8A 2JJYA 5G4KB 1GU7A 3IJRA 4D41A 3S55A 3KUXA 5TT0A 3QVXA 4H16A 4CMEA 3KO8A 4DLBA 3ZDFA 1RPNA 4MVJM 3RUDA 4OHUA 1I3LA 4F6CA 3WSVA 5JC8A 5KVSA 3DDNA 2Y0DA 1F17A 3GK3A 3O03A 4YA6A 3O4RA 5HRUA 2X5KO 3RBZA 1VLLA 2CVOA 4NDNE 4IJUA 1KETA 1HDRA 1LA2A 1ISGA 3GEMA 2FZWA 4FQ8A 3D4PA 3IQDB 2HMTA 2Z1MA 2VTEA 1XDWA 3AOEC 1F0YA 4IZIA 5DBFA 4XB1A 2PLAA 1P45A 3WWZA 3RQSA 3ENNA 4GLOA 2IZ0A 5BNFA 1O9BA 1P3DA 1PZGA 3VHRA 3ZWNA 2VWGA 1EDZA 3TJRA 1AE1A 1Z73A 3SJUA 2G76A 1GZ3A 4XQCA 2AQHA 5BT9A 3RSHA 1W0CA 1VSVA 3U09A 1DLJA 1LQTA 4BNFA 1S6YA 4NMHA 3RFTA 1HDXA 4BNMA 4KQWA 2GDZA 3WGYA 2O2SA 1CF2O 2ZJ0A 3SEFA 1DO8A 5EJ2A 3CEAA 1QV6A 3ZWXA 1FF9A 1Y6JA 3GNSA 5FF9A 4JBHA 5G0UA 3CSDA 4FCCA 4IDCA 1T1SA 1K0UA 2RH4A 2V6MA 1WLYA 3KRTA 3G49A 3RC1A 3CTMA 1B3BA 3JQ8A 2CVZA 1TT7A 2C5EA 1P0FA 1KVTA 1D8AA 1BXGA 4E6PA 1IY8A 2HQ1A 4GGPA 1CEQA 1P0CA 2Q1SA 1JLLA 1NVTA 1NWHA 5L7WA 3LDHA 3P7MA 4R4JA 1YB5A 5IDQA 2WYWA 4OOFA 5L4NA 3AM4A 4PLPA 4UVIA 4BKOA 4BNZA 3VDRA 2B4RO 2FHSA 3TF5A 3JQ8B 4TRNA 1SOWA 4E2ZA 3C1TA 3ZN2A 1HEUA 1BXGB 2IXBA 5B37A 3AY7A 4FSHA 4JJGA 4TRJA 5A9RA 3I1JA 3M2PA 1BGVA 1JKJA 4RVDA 3H3FA 3SLKA 4S3MA 3E9MA 4DL9A 3D4OA 4NHEA 1OC2A 2I9PA 4W7IA 2VRCD 5T5QA 3EZLA 5I9LA 5EL0A 1YJ8A 2JCVA 3RFXA 3OECA 1LTHR 2NU6A 5EIOA 4MIOA 4OSOA 4KP7A 4R5HA 1TLTA 4HY3A 4Y98A 4ND3A 3PWSA 3RBVA 1X1TA 2Y0EA 3F1KA 1U2GA 3LLSA 1LRJA 3WQSB 4CV2A 2EP5A 3GNQA 2A9FA 1E5QA 4AG3A 3VH4A 2DT5A 4RV9A 4PG5A 5F21A 1H9BA 4WLUA 3JQAB 4LMRA 2OO5A 4GKVA 3VZSA 4D43A 1M6HA 5EQDA 3AOEA 3DMTC 1P1HA 2ZB8A 1KYQA 1UXIA 4QECA 3ZNOA 1NPDA 4GMFA 4IDGA 3GLQA 4I9HA 3OHSX 2W90A 3FI9A 3NEPX 3OSUA 1OAAA 3PZRA 2ZKLA 3QIVA 2BLLA 3CKYA 3OJ0A 4EYEA 1NQOA 3DR3A 5MDHA 3ETDA 4MIYA 2AA3A 1PX0A 3CMMA 1ENPA 5DCWA 3VTFA 5ES3A 3P5SA 3WBBA 2OHXA 2VHYA 1E3EA 3SLGA 1E0DA 4RLHA 5JCXA 4IIUA 2OP0A 1V3TA 3H9GA 4R9RA 5ILGA 2FPPA 3MWDB 3OBBA 3HADA 3JQDA 4BNHA 4HNGA 2DKNA 2W2KB 4FIZA 2RHRA 1XG5A 4IY1A 1I2CA 1Z6ZA 5DP1A 5U4QA 2NVUB 5IXYA 3ZWCA 1T4BA 3C85A 4R5MA 4J4BA 4D0SA 5JW6A 4PLVA 4Y9DA 4DPLA 4NNJA 4JP2A 4XYMA 4BO1A 4YAJA 1GUZA 2PD3A 3H2ZA 2JD1A 4WNCA 3D4NA 1H6DA 3UOGA 4AL4A 3ON5A 3HB5X 1YDWA 5KIAA 3FNEA 2D1YA 3A4VA 1WZEA 4ONEA 3PLRA 1ZK4A 1HT0A 3JQCA 1YBVA 4DREA 3GZNA 4CQMA 1EVYA 2YHIA 3PHHA 4RZHA 2X1HA 3O26A 3WR5A 4YR9A 5IZ4A 2GYYA 3RC9A 1EE2A 4L75A 1G1AA 3C7AA 1C0PA 4Q3DA 2ZJ1A 1OI7A 3WFIA 2BRUA 2NACA 1Y81A 2UUOA 1VM6A 3VC7A 3DBLB 4TKLA 2X0NA 1CJCA 1RYDA 4M87A 1JVBA 3FTNA 3GZNB 4CQMB 2W98A 1YL6A 3ITKA 2J8ZA 8LDHA 1QMGA 1U1IA 1JKIA 4YAGA 3F3SA 5CPFA 2EWMA 3MEQA 5FWNA 1ZH8A 2NQTA 4DMMA 2EW2A 1Q0QA 3OQ6A 1E92A 4IQ0A 3B1KA 1GYRA 3EUWA 3SXPA 3I6QA 4YJDA 1ONNA 4CLEA 4F46A 4KMSA 4I9UA 1MFPA 2VTDA 4OGWA 4M54A 1O0SA 4YRBA 3HHPA 3LF1A 2GNAA 4Z3DA 4BO0A 4MINA 2Q2QA 1HDOA 3OIFA 1GFSA 4CMIA 4GVLA 4FW8A 4S1VA 3DMTA 4CMHA 3AU9A 4UEJA 1NQ5A 3HNPA 4RQUA 3AUUA 4XYLA 2P91A 1UP7A 4NG5A 2BFPA 3BTSA 3MTJA 3JCZA 5COQA 3UCXA 4RVGA 5TRTA 4O59O 5I9NA 4CMIB 3TL2A 1UXJA 4W4TA 4FR5A 3KYCB 4KOAA 1I30A 4W7HA 3WLEA 1HSZA 4BO3A 3U4IA 3PHLA 3RUCA 4LSWA 2CDCA 4L8VA 4DYVA 1IZ9A 2JCYA 4OXKA 3TN7A 2OP1A 3D1LA 5KJEA 4IUYA 5IDXA 3GGPA 4NJMA 2IXAA 4LCEA 2YFHA 4IJKA 4E12A 1E5LA 1Y9EA 4FDAA 1PQWA 3OJEA 4TQGA 4BV9A 2V6GA 4C7KA 4BNKA 2FSSA 1Y1PA 5IXSA 5AXDA 3KSZO 1DFIA 3RAJA 3QWAA 2J3HA 1DFGA 3U62A 5HS6A 1LLDA 3DZBA 2IODA 4NJMB 2PD4A 3JSAA 1NAHA 3PJGA 4FGWA 1LBEA 3K6JA 5A1TA 3PIIA 4Q9NA 1X1EA 2I6TA 3WGQA 4DIBA 3OF2A 2UVDA 5DF1A 5EINA 3BHMA 1E6EA 3C7DB 3U0BA 3QHAA 3A9WA 1U2DA 1N1EA 4OXNA 3QSGA 3CZRA 2BMAA 3WNVA 3FR8A 4NBVA 1DJQA 3JQBA
chains in the Genus database with same CATH superfamily
4KN6A 1SUAA 2JJ1D 1ARZA 2QLNA 4M49A 3W5VA 3SIWA 2AOUB 4ZO9A 1L7PA 4HEQA 2QRGA 3VNRA 1JWAB 2MYPA 1DEOA 1BW9A 1CX9B 1R18A 1VE6A 2VBCA 4MYSA 3VH1A 2HDOA 5LNK1 4FD2A 2EP7A 1CLUA 1RYEA 3CPHA 1YQQA 2EHDA 3GA0A 3LW8A 3W3ZB 1Q21A 3LFHA 2F62A 4N01A 5EE3A 4IS2A 1G20B 2PD6A 3C1UA 1KBOA 5HP4A 5IEJA 1RWPA 1Z0UA 1PG5A 2XHEA 4BQFA 1NG9A 4J2TA 1DAPA 1DPFA 4DA9A 3BRWD 3T1TA 2BEWB 1ICEA 5DLYA 1YZFA 4DIKA 3M6IA 1VLJA 3DAFA 3Q3GE 2VPTA 5I9TA 2HA0A 1II8A 2JFUA 5LDGA 3X1WA 3DBRA 1DIRA 3HRKA 5ITSA 1T4MA 3P2JA 1XD8A 2WMOB 4MYCA 2XYQA 3RU7A 4CIVA 1W5FA 1HZJA 2OY0A 5HUQA 1HRKA 2GWHA 2HDNB 3QXSA 3DE0X 4U5XA 2JFHA 1NY6A 2PGAA 2YNMC 4HDMB 3LL4A 2I2DA 3HJAA 3I37X 4P98A 3U3ZA 4FNMA 4BGDA 1N36B 3P4YA 5AUQA 3TNJA 3OQHA 3W78A 3LCRA 1IBSA 2OCXA 1B74A 4CM8B 5BSKA 2OBNA 2HMUA 4M9SA 5AUOB 4JI5B 1TVEA 4CRWB 2UXCB 4BUCA 3LHSA 4BJ5A 3TQOA 7GPBA 3EGXA 5F5XA 2Z08A 3EHDA 1DEXA 3QV2A 4MWBA 1YBAA 1ULUA 2PX4A 3F67A 1E6WA 1XWIA 4IDAA 4WERA 3A1WA 1PRYA 1C1DA 2H4WA 3CFYA 3RYCB 2FI1A 3SZOA 2LV8A 5AVSA 4P0PB 2NMVA 1E58A 5IJZA 3OX4A 4MUMA 3QF4A 4RD6A 5KTTA 5U9CA 3FUVA 5H3CA 2NNLD 1TZBA 4TYWA 5AR1A 5DHAA 4LHYA 3NTOA 2JL1A 5UKDA 4QIHA 1GRVA 4M7WA 1JQKA 2BM9A 4CV1A 4X1YB 4EDFA 2DBZA 4D26A 4G0MA 4LJ9A 4HAWA 4N6NA 4FNOA 4CEHB 3H8VA 5T67A 4N9QA 1NXVA 3FB1A 3CKMA 3OM1A 5JR3A 2NP6A 1H22A 3LQ1A 1R10A 1QANA 2G3YA 2R8RA 1Z6PA 3AF1A 2CJWB 4Y0AA 5K03A 2B21A 4DB2A 1ISFA 3EIOA 2Y99A 3ZDXB 1PS8A 5EZSA 2AN4A 2IU6A 3AIIA 4TYYA 1B23P 3ZIAA 3EH1A 1GO2A 3OQOA 4DR4B 3KNZA 2I7XA 1L7OA 3TOCA 1AUVA 3IE2A 2X1LA 4HNAB 2NV6A 4WJKB 1T5HX 1WMAA 4IILA 4D46A 2RHHA 3NBYC 5I7EA 3NYIA 1KY4A 2BWJA 4ADSG 3EDCA 2HV8A 1T4GA 4NBWA 2PNJA 2CL0X 1YXMA 5JNLA 1ENZA 1N2EA 2PLFA 1ZGHA 4AMGA 3ZZUA 3LTNC 1QCCA 3FKSA 3WRWA 5K8TA 2GEVA 4D0LB 3TG2A 3KOWA 3ZHRA 5EIAA 3I4LA 4E5MA 1ENOA 2QQGA 4K6CA 5K8JB 1PJTA 1PDWA 4TTPA 3TCXB 4PC1A 3NUZA 3KOOA 3AQIA 3HWX1 2PFSA 3OESA 3ENVA 4PHHA 2ZBRA 4YRFA 4QT4A 1NASA 3R5JA 3QXGA 4Y2UA 5COBA 2QT1A 3DGEC 5EQJB 1T9GS 2C2OA 4DZZA 3OOWA 1XZKA 1KARA 3ZU3A 4J0HA 2PAFA 2EWVA 5EI5A 2PLRA 3BQ9A 4DBLC 1WU7A 4IJ6A 2IBTA 3AINA 3PFKA 1CY2A 3A2LA 6PFKA 2AEFA 2JANA 3RIEA 1B00A 5JUWA 1CEYA 1Z7BA 1XQ6A 3TVYA 2BSQA 2O50A 2AR9A 2I33A 3H3JA 2FJ0A 2I5PO 4NH0A 4W99A 2EERA 2JGLA 1SVOA 3P0EA 1FSZA 2B6NA 4ZALA 1PT8A 1XDGA 2O2GA 4RFLA 5THQA 1GQ2A 2YWXA 3E9QA 5CUQA 2XCRB 5D1NA 4PLYA 1QRTA 1QHNA 1H1LB 1M8FA 2I1VB 1YC5A 2YQ4A 3OCWA 1EP3B 4KXMA 4Q1FA 5CH3A 2M6LA 3IEVA 4EVIA 4D8UA 4O5AA 4ZCPA 4BLPA 3WK7A 1W36C 5JFTA 3F6RA 3LKDA 4LNAA 3PPXA 4MV3A 5BWMA 3GVHA 4GX2A 4MVJF 4PY2A 5L3ZA 2WLSA 3AEUB 2A5GA 3KS9A 4HDOB 4ARUA 4MZDA 2AFIA 3RJ9A 4R05A 3C87A 2EJWA 3LPMA 2XA1A 4LDJA 1YL7A 2W0MA 2IEBA 4AUMA 5HR5A 1VP3A 2BTEA 3N8DA 4JLOA 2WAYA 4WASA 4GAEA 2YWEA 5IT9A 3STVA 5I7UA 1IM2A 2H1WA 5JYEA 2E4VA 5A5GA 3CLUC 4JROA 4AP9A 1IG3A 2BM0A 1QVWA 3F8WA 3QRWA 1A96A 1DKNA 2AUMA 5LZ5A 4IRMA 3AL3A 3RPEA 2BFCA 4D42A 4KKVA 4ZVVA 4RVSA 1UXKA 1ZP6A 2IU0A 5KQPA 5LJLA 4HN4B 1X7WA 1M0TA 1O95D 1XDZA 2BTQA 4OQZA 4UHJA 1S2OA 4YCDA 4M1KA 3CZ9A 2EOAA 2FR8A 5ALRA 3FDFA 5T4EA 1A7UA 1KO1A 3HXQA 1BN7A 1J4AA 2II6A 2VRWA 2GHIA 2ALJA 4MKGA 4H17A 1C80A 1NSFA 2ESRA 3QIAA 1D2AA 2ZE8A 1JE0A 2OFOA 3CXRA 1VQ1A 3IO3A 2I7TA 2ZBQA 1T4DA 4UM9D 1MC4A 3MAGA 3M4JA 3UT5B 3WP1B 2GPTA 1M0WA 3GLUA 1AQLA 1JSRA 4G97A 4EEKA 3ZE1B 2CNNA 4IMPA 4KWEA 1JIJA 3W9UA 1JIUA 5F23A 1UM9A 3CG0A 2OXCA 2BFNA 2FFJA 2QTVA 3BVPA 2NVWA 3Q11A 2QRMA 1X0XA 2DT8A 2H7YA 3HJCA 1SBYA 3LC7O 3ME5A 2H7VA 4OV6B 5CH5A 3WX0A 2FF7A 1OB5A 3W9YA 5ER9A 3KQYA 5J40A 1S3SA 4LBWA 2LZ0A 1J1UA 4WLVA 2OBLA 3IXQA 2WU0A 4FHFA 2EFCB 3DHVA 2V3VA 5AM5A 2EEPA 1A9ZA 1FNDA 3TD2A 4MH0R 4RPKA 3LVQE 4X20A 1YR8A 2DTDA 2FMHA 4R3WA 4YECA 1XPUA 1OBOA 3GFPA 2PGNA 1EDOA 4ABYA 4DDHA 3G85A 1BXKA 3LLMA 1O6GA 2ST1A 4CG1A 1RRMA 3HFJA 4Z0TA 1V95A 4OHKA 1SD1A 2QI9C 1Z25A 2VQSA 3AR4A 3P9YA 4EJ0A 4GOKA 2VXOA 4L3WA 4B7ZA 3ILXA 2J32A 1IIBA 1AMUA 4R8SA 2FPWA 5EYPB 2NO0A 1THZA 2H11A 3I32A 3PD7A 3W5JA 4ZK2A 5DRYA 1ZO8A 3B60A 3NFYA 4FTWA 4C6TA 2WZQA 3GLKA 1QK3A 2QK4A 2MTBA 2IS4A 1BMFD 4AVYA 3X1MA 9GPBA 1G4UR 4IG9A 3EG9B 5ECWA 1LVGA 4B7AA 4KMMA 4ZDIA 5AVUA 3LPCA 2FPKA 1E4YA 3C3PA 4AF7A 1RAGA 5JCZA 3QTTA 3B5IA 4K0RA 5GONA 4DLVA 3DDSA 3RWMB 1KA9H 1ESCA 3SQNA 2D5IA 4HYTA 4IIBA 2Z5LA 2ZKIA 3OE4A 1JFRA 1D2CA 2HZBA 2WSYB 2O3JA 1V9LA 2OV3A 3BICA 5D2CA 2H2WA 2WP0A 2X0RA 4JIGA 4DILA 4E32A 2DKOA 1X42A 2JH8A 2BV3A 4QHTA 1KOLA 2NAPA 2C8VA 1B8VA 1R0XA 1Z6YA 3H3XA 5BRAA 1QORA 5CDFE 1P77A 5B58T 4B6OA 1LBTA 3AYXB 5LQSA 3ROQA 3F90A 5JXGA 1CUBA 2CLFB 4ROSA 1EH5A 4Q4JB 4CBVA 3LY9A 4R69A 5F52A 3S2IA 3TZHA 4HH0A 4F0JA 1H2AS 4Z9YA 3VJMA 3HLKA 4NECA 3ZD9A 2XRZA 5LKAA 4PZAA 5GTDA 3FKQA 1K4YA 2GCOB 2QS9A 3MUEA 4R98A 4XVRA 1ECJA 2ZJ2A 1M2OB 4O4LB 4ZT2A 1FSPA 1RSZA 2R8ZA 1AM4D 1IHDA 4K26A 4RIHA 2VH1A 2WUVA 3CLTD 3I6IA 1RHMA 3ESBA 4RMHA 1SHJA 1RWVA 2DY0A 2Q1TA 1FDUA 4JU9A 5AK6A 2YJTD 1JFLA 4AMVA 4P7JA 3RS5A 1KS2A 3PP8A 3A6EA 1JSCA 1XZNA 2E4YA 4BBZA 3D8RA 2OM2A 4UBLA 4CKBA 2C82A 1B0UA 2PYZA 3QBEA 5ALFA 1K2VN 5F33A 4CIDA 3CKLA 2X0DA 2GZMA 2ZQ5A 4QC2A 2QW0X 2GKSA 4NK4A 2X1VA 4RS4A 2QTZA 5EMLA 3ZHCA 4QLBA 1JWLA 3M9LA 4TL9A 1SZDA 1GZVA 1RWXA 5L3SA 4XDHA 1N33B 5I7FA 4RK7A 2ENUA 2A1TR 2C4TA 4NQZA 5JZSA 1XRSB 2ONYA 4QPNA 1Y1TA 3IILA 3AK4A 4Q7MB 5GWXA 4J1SA 3ZZTA 4CLOA 2IX9A 4KVZA 2UXBB 4D56A 2WILA 3AKCA 3WLAA 1EXMA 1CUHA 2VATA 4OQQA 3PLAE 3C3DA 1G17A 3O6VA 4EKNB 2W9XA 2VQEB 2QVXX 3HB0A 1E3WA 2D2IA 1PT9A 1GNLA 2XCSB 3OOHA 4M8SA 3TTWA 3NIDB 3UG7A 3G8CA 2PEYA 4DA4A 3OU2A 4JT8A 5I4IA 2PPLA 2ZT6A 3AEZA 4IM7A 3VO2A 4RANA 4YRQA 2XT6A 4NCKA 1GL6A 4U0JA 2YX1A 2MSLA 3V7UA 3ACCA 3SHWA 4KR0A 4I9FA 1L6RA 3CE6A 2HZ7A 1CC1S 3IT0A 2AW5A 2WA2A 2FG7C 5FV4A 4JN6B 4X54A 1MVOA 4O0MA 5CX1A 4PX5A 3ROKA 4H7EA 4ZRDA 1GPLA 2PGJA 3UAVA 1ORHA 1IB0A 2OV6A 3PSAA 3QLJA 1FOEB 3CUWA 5CB6A 4DCCA 3PF8A 3D5EA 2CK3D 3MCZA 3PJDA 4BBJA 2FKAA 3A2MA 4HGZA 2UUPA 1KAEA 4FFWA 2GK6A 4M9RA 2PT5A 1Z4OA 3DS8A 4KNWA 1IN4A 4Q1CA 3FJYA 3HCFA 4EG0A 5HIAA 5JCOC 1K7YA 1L2TA 4MR9A 4ARZB 3GVCA 4QYIB 3D81A 3ZUGA 4HUJA 4P86A 1G3MA 3ZHXA 4E11A 1ZJJA 1SZJG 1X9IA 4NFHA 3TDKA 5ISMA 3HQ4O 3ZDRA 1FP7A 3KJZA 2FYTA 5H4HA 4BFUA 4UNSA 2C7VA 3I52A 2NU9A 4MS1B 4J0DA 1VBNA 1YNSA 4ZKDA 4HQOA 4M8KA 3GVXA 5ITZA 2JLUA 5CAEA 3RI3A 1GZ6A 2E4UA 2HJRA 2JGJA 3GCGA 3GRRA 3OQBA 4PCUA 5C34B 3HKDA 1WDKA 1KJNA 1N9GA 1QO7A 5AXBA 5PGMA 3VZQA 4F9FA 2J9RA 2WNSA 5LZ2A 4R8MA 4RWEA 3EBOA 4MHOA 1MP0A 4FFBA 3O4FA 2D1FA 4D9NA 3A3PA 4BFCA 4FFSA 1QH8A 4AWXA 5CEEA 3ZWOA 2WZBA 2NUTA 2XZDA 4C20A 3GEPA 4R1LA 2GS9A 2H48A 2IYOA 1ZOLA 3NORA 4DMKA 1FS6A 1JKJB 3DEJA 1Y7TA 3ITDA 4TXNA 2NZUG 3EEQA 3HJRA 4XR4A 1A9TA 3BULA 4DW8A 5FEMA 2FV8A 5NLLA 1A27A 4OSEA 1QHHA 2VN8A 4AZ0B 3H11A 2R5WA 2ZI3A 4P7GA 4MTCA 4ER6A 4LOHA 5JOQA 1QC5A 3IAM1 3M4YA 1YCFA 3K9HA 4PW0A 4EQ6B 3DO6A 1OROA 2E37A 5DMXA 4GM4A 1VSBA 4Y7CA 1EX1A 3C3AA 1ZNXA 2AJLI 2XMZA 3PEEA 3V6MA 3ZHBA 3WGHA 3FPSA 1W5BA 4PWZA 3RRNA 4QU9A 3E81A 5H7XA 2F3TA 4G5SA 5GY7A 1FTYA 1PLLA 1PYDA 4U2GA 2IBSA 1MQ8B 2GBFA 3EAFA 3ED5A 1SWWA 3U2QA 3LNCA 3KJFA 1KO7A 2CXRA 2Y67A 5J43A 3L7YA 2G28A 4G8BA 4U6SA 4O4LF 2ZUWA 4WECA 4BATA 4P4LA 4EMBA 3PHIA 1XQVA 3P0RA 5LWHA 1NQUA 2A5DA 3HTXA 4QBKA 1IEWA 3E15A 4LHZA 1XVUA 2HNKA 4R3NA 5IUJC 3CNBA 4GX1A 4TKUB 1T36A 1XCMA 2HUNA 2IUFA 2W48A 4L5JA 2ACEA 2DFNA 2CVHA 4LTNA 1DAMA 2OXEA 1P19A 4R6WA 4RADA 4MS3A 1GTJ1 3ZE2B 4GI7A 3FJOA 6REQB 2PGDA 2OO7A 4GZ5A 2CJFA 4KVFA 3KKPA 4MJLA 4KKXB 5CB4B 2PX8A 3GQBA 1ZVMA 2RHJA 4DRXB 2I4NA 4G86A 1E2DA 2GEKA 3RSSA 1KEPA 3PI6A 1JXOA 5AK0A 3AJEA 3LPDA 4RE6A 5C7LO 1E1CB 2EKLA 1J6UA 1EFRA 4BCDA 1ECCA 2ODTX 1YVEI 4C0HA 5FX2A 3N05A 2QDKA 2PGOA 1EB9A 1X7XA 1YVUA 2B7BA 2NZJA 3BGOS 3NEAA 1SO8A 4U9HS 3UJ9A 1QYCA 1VI2A 1XOIA 2AD5A 1QTQA 3PEFA 3GJTA 1HF3A 1DKQA 1ZSVA 5J9FA 3VC1A 4IYJA 2Q7XA 4PRLA 5TR9A 4JASB 1JEAA 4MYTA 1PJ2A 2D4HA 4ZMRA 4JX9A 1NQAO 2J41A 3MWKA 3RVPA 4L15A 4UPDA 4H4CA 1E1LA 5HOEA 2XMCA 3WIDA 2I54A 5LYYA 2ZCUA 3E2IA 2C7RA 4C4YA 3T7RA 2V4ZA 3WGUA 3PC6A 3TLZA 5EP2A 1N0VC 3J80A 4UPVA 3Q5EA 3UXEA 1EE9A 5ALDA 5A7FA 3NP7A 3LO5A 2VPXA 4FOTA 2ARKA 1IUNA 4TTRA 1T2NA 4WD3A 4RPGA 1S4QA 1ZGGA 2FG5A 3DZJA 2GWRA 3LO8A 1MRZA 2B25A 4N5LA 1G98A 3PIDA 4LXGA 5DFAA 1YRAA 4KLNA 5E9AA 4HYQA 4M1ZA 5CNJA 3VKVA 5A4DA 2AHRA 5KVAA 2VAPA 3HCEA 4R41A 1Q16A 3A4IA 5LNK6 2LVBA 2IEIA 2C2XA 4IXTA 5J1SB 1RVV1 4K6OA 5E0OA 2HIAA 5LMCA 3DQZA 1R4NA 4N5DA 4Q3EA 1OLUB 1U0TA 1U5CA 1MU0A 1NONA 1Y6RA 4MEJA 3HUTA 3O4IA 1L8LA 3D3NA 4BNVA 3L0ZA 4BX2A 5B3AA 4U6QA 2FXIA 2I55A 2FVXA 4JLSA 4NK5A 3DEYX 1TAQA 4C6HA 2B0JA 3GGGA 2J1LA 4OFBA 4PC3A 4GMHA 1G9SA 2HO4A 3DVRX 3PL5A 5FUBA 1UWVA 1YVDA 1V1RA 3AUJB 4UASA 3D8UA 3F6CA 1T13A 3J7TA 3LUJA 3ZE9A 1E4EB 4X6LA 4ND5A 2KJQA 4Y2JA 2H16A 1RZ3A 1SM4A 2JD2A 3AMVA 2ZRKA 3KAKA 4JSYA 4KWTA 3QMMA 5P8WA 2SBTA 3LX6A 3KQNA 3KZOA 1XYVA 2PZMA 1P5FA 2D1TA 4RAQA 5F9MA 5ITVA 4HEJA 1B8PA 1FU7A 4UULA 1FQOA 5BSRA 3E18A 1C0KA 4LIPD 3FIUA 1LNZA 3M5PA 2AFRA 3NWJA 1MO3A 2PV7A 3JTEA 4LYHA 3UMBA 4A10A 1A5SB 1KHHA 5D84A 2EC5A 1QRSA 1XU7A 3B5EA 3VI4B 1CQWA 1NRWA 1VI6A 3KSMA 5DM1A 5A3JA 4Q9IA 3K35A 2J67A 4K9PA 3WHIA 1T4CB 2GM9A 4QBIA 3GLHB 2VBGA 1E7YA 3DWIA 1QO9A 1SBIA 2FLWA 2WW8A 1I3NA 5DWDA 1CHDA 1H5NA 1PEDA 3TRJA 3TXAA 1N6LA 1UBNA 1GSHA 3KKKA 4M9ZA 4H1WA 1I5RA 4AS2A 5DN6D 2AXPA 6NULA 3RASA 4F92B 2H7XA 4U7JA 1Z18A 2V54A 2DUMA 5JWRA 3ZNPA 5DXJA 4R1OA 1SXJA 1XJQA 1WPRA 2PKQO 1R1DA 4E5SA 4WDQA 1BX1A 1VMEA 1D8TA 3EDRA 2BBWA 1Q2XA 1F8YA 2WVAA 2BYTA 1KSHA 7ABPA 2B2CA 2BMJA 1LJ8A 2QRVB 4JEUA 3R24A 3LW7A 4H3HB 2CVPA 5CHYA 1ABEA 1WXXA 4TXHA 4F3RA 4ZEVA 5JAZA 1Y8ZA 2WHQA 5KNCA 4F45A 3MWLA 1VLZA 1JDPA 2G1UA 2I6XA 1CD5A 1G0NA 2JH3A 4UVEA 1LLUA 2X3FA 3F8TA 3BMCA 3JXEA 1RM4A 1M2WA 1VB5A 1M8JA 4A82A 2A6PA 3P9IA 3HYLA 1HDYA 2X5OA 2FMFA 1Z0SA 3IMGA 4KQKA 1ZD2P 3DDHA 1UMKA 1HURA 2FRDA 3KJIA 3V7FA 2XKJE 1NM5C 2QSJA 3CRRA 5I4BA 2O5CA 4P34A 1G5PA 2RG1A 2A67A 5LVAA 3N2GB 3ABQB 4C4XA 1IXKA 2VDWB 5KQSA 2N3ZA 3ZX5A 3Q3IA 3CR8A 1LS6A 1OWOA 1NNLA 2FSGA 1BOFA 2OZKA 4QTTB 5E6SB 2YJ6A 4MA4A 1FFCA 3I34X 2NU7B 4H15A 1YR6A 3SE7A 5DT9A 4AQDA 2UYCA 1I2BA 2QLFA 4BWGA 4MK4A 2B7CA 5HRCA 1H2BA 2WYHA 3O91A 3OZUA 5BOSA 1KTVA 2MSWA 4BVAA 1X70A 3LVBA 1NBME 1EESA 3CCCA 4IV0A 3ZGVA 5KVQA 4D96A 5IZCA 3D31A 3O7WA 4GI5A 1WW8A 3REQA 3ZWDA 4UVDA 5IYZA 3AL0C 1U2EA 2PS3A 4CTOA 1PFVA 3AF0A 1MG0A 1X9GA 2FUNB 1GA6A 4BY9E 7MHTA 2FE4A 2NO4A 1Z4MA 3Q15C 4R1MA 1Z2OX 2ZQYA 1XHEA 1M2JA 3FZQA 4MXDA 1WZ2A 4UC0A 2HPVA 1A72A 4KQFA 3B8HA 3IEKA 3L1IA 4ZVLA 3KHSA 1G8SA 2A35A 2Y1WA 4ZV4A 4KJZA 3ZJVA 2XBMA 2WOOA 2OE2A 2I7CA 3O47A 3UHAA 4TYPA 5K0SA 4OHXA 2GN1A 1YJAA 2GASA 3I23A 3LCMA 1C30B 3F9RA 3F78A 1U7ZA 1IULA 2HQOA 2NM0A 3H86A 3NEYA 4J07A 4QJ4A 3OD5A 5CGZA 4GH5A 4JI1B 4JITA 1XCGB 2KYRA 4IRUB 4Q24A 3JQGA 3TZEA 4D79A 4BNWA 3R40A 4M60A 5BR4A 2PM8A 4IHKA 4N82A 1O08A 4IVRA 3OEEA 2C61A 4HFMA 3F7NA 1TKRA 2O3UA 2PYIA 1RC8A 3V5NA 4HLUA 3ER6A 3GQVA 2C78A 3BCUA 1OJ7A 4LRUA 3Q9SA 1VJRA 4QLOA 2AF4C 2GK4A 3T4XA 4LFBB 5AOCA 3VO1A 1C50A 3GMIA 1AJEA 2YN4A 3HCOA 2PK3A 2R4UA 3OD1A 4EW1A 3PYLA 1TECE 4YYEA 2PVSA 4X1IB 2VP5A 3IKVA 4XKJA 5A4JA 1LV7A 1BJTA 1JQEA 5H80A 1CUYA 3S8MA 1YFKA 3O90A 2GCNA 4Z0PA 3U7IA 4IZ6A 3QUTA 4Q1DA 2IWHA 5LQNA 1G8PA 2ZZKA 3LUPA 4PFKA 5DHPA 1QKKA 2JARA 3T7DA 2HPZA 4Y2SA 3DV0B 1GU0A 5L7YA 3BH7A 3HGMA 4S35A 1IJFA 1FPMA 3AVOA 3HC7A 3QX8A 4L0DA 1M1NB 4CETA 4Y2PA 4GRDA 3O21A 3ORRA 4HXEB 5HBRA 3FWPA 5I7HA 1E1DA 3UGKA 3SYMA 1NE2A 3GL9A 2WC1A 3DNFA 4R1SA 3ZHSA 1DC6A 2BFEA 1GILA 1A1VA 4LZWA 3HB7A 1YGYA 1OH8A 1EHIA 1A50B 2ZUEA 1E3DA 1G8YA 2N0SA 1P6QA 4OM7A 2Z2XA 1XZQA 1L4BA 2D62A 2ZP1A 3B36A 4PLFA 3ETHA 3WL4A 5JO0A 1IXYA 2B9EA 4B6GA 3UJPA 3K20A 2XYHA 4IFTA 2OAQ1 4JC0A 1MLDA 1RXCA 3CT4A 4DQDA 3ZD6A 1UAYA 1KU6A 2OKGA 1SVLA 2OZPA 5HFJA 3CIFA 3IDQA 2ZAMA 4Y1RA 2I03A 1HV8A 2RHWA 2ZS8A 3K0CA 1WEKA 3OLWA 2QBYA 3TZKA 4G9EA 2WT8A 4BFZA 2APJA 2NV2B 4ZQBA 5AQEA 5FEUA 4GLBA 3WADA 3T6KA 3QVLA 3GGCA 2HHHB 2CDBA 1WMEA 4UEKA 1E4VA 2HLNA 4D9GA 1VKZA 5EZYB 1N3LA 1DPGA 3MWJA 4FHEA 3B51X 3RTBA 4YPOA 1KMHB 2PL9A 1O94D 3L6CA 5IKPA 1VLQA 4AS3A 3AHIA 1I5EA 1P3Y1 1ZUWA 3KHUA 1Y5NA 4BLQA 4BEWA 4MW9A 4UDOA 1TMGE 5TXGA 5GZ6A 4XASA 4D6YA 4HZIA 4EHKA 3KZ1E 4L3OA 4E4TA 4YASA 1EI9A 3Q98A 3KQHA 2AGVA 1EGHA 5CGQB 2W6QA 3FKJA 4KGVA 2Y1DA 4W1SA 3RVJA 1QOQB 4EARA 5EWMB 5GJBA 3C5WP 5B2ZA 1Y6GA 1PGQA 4EYQA 4EYOA 1I1QB 2D0IA 1XFAA 4RHCA 1GCOA 1UT6A 3EN0A 4UKDA 4LVCA 5JFOA 3WMFA 2JHPA 5JI3E 1IDOA 1MEJA 4UNNA 1C4OA 2YNMA 1U8FO 1DHTA 3ZH9B 3N75A 1TM7E 4YMVA 1B3RA 4ZZ1A 2IHTA 4A03A 4C6RA 5K0JA 2RGCA 3S5JA 4FFLA 1BFUA 3EZYA 3V8VA 1D1QA 3JZIA 1RWKA 1MC8A 3KB2A 5A3RA 4MPTA 3GPIA 3SKXA 3ZXXA 4P3PA 2VRNA 1UINA 1WD7A 3HZRA 4LBVA 2Y1EA 2DB3A 3MQFA 3T4EA 4C0AC 4EFDA 3MBKA 4HBGA 4GKBA 1ZA2A 3WIUA 3WJ2A 4M88A 1Z5OA 4DXAA 3O9VA 1AMOA 3TCNA 4M6WA 4QXPA 2A59A 4G36A 2ODEA 3NRBA 4RIIA 4X97A 5BORA 5H9WA 1IAQA 5E8JA 4BC0A 1TJ4A 1DG3A 1UC5B 2AR0A 3TNDA 4AJJA 4PCAA 2XZTA 5SZIA 3ZV3A 4PG8A 1RQRA 1CDDA 3LV8A 1Z0ZA 2OORC 3GEHA 3PR3A 4NZNA 5TQ0A 3AT1A 3OEHA 4LKOA 2BH9A 1ZIYA 3VKWA 2BUAA 4FBLA 1YQEA 4I46A 4ND1A 3RBAA 2OHFA 3HPRA 3INYA 4LJKA 4X8OA 3MN1A 1S7CA 4P38A 3L0DA 4G5HA 5HHTA 2IVZA 3UK6A 3W79A 1NNSA 4TL7A 1Z5ZA 2EDAA 1TQDA 3OM8A 3H42B 4MB2A 3BXHA 1CY8A 3FPHA 3FMIA 3M6AA 1USGA 4GF5A 3IL2A 4DPKA 2P2GA 3K1TA 5EAIA 5C80A 3U5TA 3VPBA 4ZGBA 5IT0A 2JIZA 4H4DA 2PSJA 5TJHA 4TMZA 2C5GA 1ZHHA 3DXXA 1QDLB 1C2YA 1UODA 4MW2A 2A0KA 2WOJA 1K89A 4M7OA 1WCIA 5JZBA 2Z2KA 5BNWA 3W5BA 4JI4B 4WH0A 3Q41A 1VHTA 1YRWA 4IXWA 3UUGA 4OJTA 1FDWA 3O1JC 5AW9A 3QEKA 1OH5A 1LK5A 1QPZA 1JQ5A 1UAAA 2IF2A 5JJCA 4KZPA 3EGVA 3KAPA 4V0ME 1XEWY 1FS5A 5KHOC 1AMNA 3ZWBA 2KM1A 3NRCA 2HU2A 4JK3A 4MQMA 2HCJB 1L3IA 4IWYA 1JDJA 3C5EA 3OPYI 4RD2A 4A0GA 1UZLA 3W6ZA 3RUAA 4FYMA 3DOCA 4WOPA 1K3FA 3VKUA 1TK3A 3ONVA 1S2MA 1EVJA 1O97D 1OTHA 2NO9A 3GEDA 4G81A 1DL5A 3L8ZA 4JR0A 4CMBA 4ZOLB 4MV1A 2H17A 3UJHA 3WZLA 4EVRA 4BZWA 2XT0A 1JAHA 3DCIA 3COVA 1SQ5A 2I29A 1RWNA 3ELDA 4CL3A 4DNPA 1X92A 1PQUA 5T8KC 4QFMA 4BNTA 2HJWA 4ZVSA 5HS4A 3DZCA 4G84A 1EK0A 2IOFA 1GGMA 1L1EA 4PFQA 5DLPA 4BZQA 2ZSKA 1TYEB 1NKVA 4TV8B 1QUFA 3NBKA 1UC9A 2CUZA 1F9EA 4NZ9A 2OBYA 1XRNA 1T0UA 2HK9A 1ZRMA 4P22A 2L69A 3B89A 1PGOA 5I9BA 1BGXT 2VT6A 3C0KA 3M34A 3HACA 5HX7A 2CXTA 2WWYA 4G2NA 3LDAA 2UUAB 3F6EX 3KJGA 3NBXX 4OAQA 5B57C 3Q7PA 3TLJA 1LPBB 1CIJA 3CONA 4WBXC 4YDSA 3GAFA 2B1IA 1WEHA 4H3VA 3B6EA 5JRJA 1V37A 4HYYA 2WHXA 4P7BA 5ELMA 3T9AA 5BR1A 3DPIA 1SBHA 4BMNA 4Z8YA 2JGRA 1KFCB 4GHWA 4MO9A 3PC8C 2IYXA 2Q0XA 2BMWA 3KBBA 4L6CA 4UU0A 1L5KA 4AZSA 3FUTA 2AG8A 5EZYF 1QLJA 4RTMA 1ZK1A 5K0TA 3MB8A 3TSWA 1JFVA 3NBZC 4QUKA 3BMQB 1E2EA 3ANTA 3MINA 2GN6A 3GO4A 1T1RA 2G25A 2FFAA 4MW1A 5AQ1A 5JS8A 5DBHX 2DBQA 2FU5C 3VPAA 5EY5B 4U2KA 1BFKA 2CMDA 3R0VA 1QS0B 1T24A 2VYFA 4CMJA 2MT9A 1VG1A 3H2KA 1DKRA 1EFKA 1MRSA 1XGKA 3EY4A 1F8FA 1RNLA 2IVFA 2K4MA 3QFCA 1I7SB 1N78A 1ZSYA 2DG2A 4CKEA 1Z5VA 1AB5A 3FMGA 3MJRA 4TKMA 5DX1A 5DIZA 3FPGA 3WWYA 4K8OA 2DPHA 2NAFA 3C6QA 1Z45A 2CL5A 1MJHA 2FQYA 3V2GA 5CDTA 2DHEA 1MTOA 4C0QC 4A0RA 1H8ED 3MA0A 4NABA 3ZGOA 3O8NA 5BN4A 1IG0A 1QBGA 4O4JB 1A9XB 2RH8A 4OLBA 4OK5A 5DKFA 4B2PA 5TS2A 1IDN1 2N46A 2DYKA 3RU3A 4RPJA 4EABA 4KYIB 4R1QA 2AI2A 2R2GA 1SXGA 2Q4RA 1GG2A 2V8BA 4M0FA 2ZSBA 5E6UA 1NAIA 3KOYA 5K3BA 4BTEA 4GKJB 1SQGA 1R4MB 3UAZA 2VSYA 5TS3A 1JHPA 5EUBA 1Y9ZA 4EPRA 4W5HA 1IN6A 2H7CA 3MBOA 3IAM6 1P6UA 1F4PA 1ZKDA 4FE3A 4FMCB 1FTSA 5L7TA 3JQRA 2DETA 1OGJA 2VAWA 5THKA 1XU9A 5EXSA 5LB4A 3OZ7A 2R5FA 3ILHA 2ONZA 4EFLA 3CF2A 5EFZA 3IUBA 3EXIA 5BVHB 4AW9A 1TC1A 4PNHA 1G5RA 4XDGA 5AJWA 1MW8X 1X7YA 4HOYA 1ML4A 2M98A 1U8XX 5KOJA 2V5AA 1PR9A 1GUDA 1QHGA 3NW9A 2VDOB 1LI4A 4I2VA 1HDZA 2NU8B 1GNSA 3B9RA 3HP7A 4IH9A 3VRHA 5JZOA 4AMBA 1RPAA 3DAHA 4TM8A 3A10A 5AH0A 5FA5A 3CUYA 4FFOA 4K9RA 4F1KA 1V7ZA 3DFMA 3GN2A 4KTTE 1DV2A 3M5CA 2W2LD 1U0NA 3G8YA 4JOBA 1IVNA 1PBNA 1WUYA 2ZWOA 1NULA 4A6XA 4EPXA 5KMGA 1Z4KA 2W2MA 2ZSAA 4CN8A 3GLRA 4MI1A 1UOOA 3JD4A 2DU8A 1K1EA 1G7TA 1NBAA 3E0QA 3ODGA 4FYVA 4L7QA 4NKRA 4KVGA 4URUR 1LK7A 3OQIB 4G37A 1WNFA 2WINI 4BZXA 4UBOA 3ESCA 3R0QA 3JQ7B 2WSBA 1AKNA 3VH3A 3MCWA 2Z6VA 1AF7A 3NV7A 4M1QA 4K1XA 3L4JA 1XK6A 4S1OA 4KQ6A 1TL7C 3L4SO 2X7HA 4DQLA 5I3ZA 3UCEA 4R01A 4IXNA 4KLRA 2ZETA 2HQSA 2X9LA 3HFSA 3QI7A 1PJQA 3FTDA 1BD4A 3TRKA 3EAQA 3OZBA 3TSYA 3N0WA 3VSDA 3BTOA 5LLSA 2AV6A 4M0PA 1HT1E 1AVTA 1L8AA 1P2FA 4O3MA 4PO3X 3IDZA 1B42A 1X8LA 1YB7A 4QYTA 3ZCRA 3T5DA 5DX0A 4DG8A 1JG6A 5B12A 1WNTA 4YLEA 3AFIA 1GUYA 5AVQA 1F2UB 3B3FA 1NRXA 1PWEA 3AQ4A 4KDFA 4XCXA 5IBPA 3IE1A 2IUUA 2XTAA 4H7HA 1NZFA 4AX8A 3WKDA 2ERYA 3MMPA 1OF1A 3W3AA 5LZ4A 4KW7A 1L5VA 4B3TB 3DR5A 4C4ZA 3VPCA 2QAIA 3IQEA 4ITUA 3DE5X 2B37A 1DTWB 4RTJA 4HTFA 3V8NA 1T3GA 1TMKA 2XIJA 1UZUA 2Y92A 2XNDD 1NNI1 5TVKA 2O2JA 4BNGA 3AKZA 3KTDA 1DV1A 4TRRA 3G2NA 4XOUA 1CRZA 1LUAA 4BO5A 3OF5A 3SIPA 3O94A 5GAJA 1QYRA 1VHWA 2GN9A 2QRUA 1DQSA 1B0AA 1TW2A 2C98A 2R79A 4G4JA 2HNAA 1Q1NA 2C8LA 3N87A 3T9CA 1BNCA 1S2GA 2W00A 3L77A 1W6RA 1A4IA 4O33A 3TLMA 3F6PA 1JDUA 2SKDA 4ITRC 3K96A 1SC4A 3G1TA 1KJQA 4I81A 5MGNA 3F46A 4KSBA 4EUFA 1O6CA 1D0SA 3PFGA 2HU8A 2WQZA 1QFXA 4HO1X 1G21A 5IK2D 3I61A 1GGKA 5DI3A 3PEVA 4IR7A 2OHIA 3QUSA 1ZJYA 3C4VA 1GT6A 2QY9A 4LJ8A 1GQQA 2BHNA 5M2QA 1CRPA 1VPDA 2PANA 4R2KA 3H1TA 1XHFA 3IOYA 1Y3CE 2HSDA 3EWIA 2ZJ4A 2HLDA 3PFCA 4MPDA 5DW3A 3W8RA 1JQDA 4GYJA 4RENA 1WAMA 2X19A 5EG5A 2WHRA 4MWEA 5E4JA 4CM9A 2WJ6A 1KEWA 3BWDD 3B6MA 4HNUA 2P2YA 2B82A 2GBPA 4DLYA 1Y7LA 2Y27A 4L95C 3TIFA 4BS9A 1E0SA 1M6VB 1YZGA 1L5OA 1FRZA 1QZUA 2Q0HA 5FBWB 4O4JF 1XN4A 2YZMA 2XDAA 3QX3A 3REGA 4IEIA 4CCYA 3E22B 4PZZA 2HAEA 2JFQA 4BRWA 1CDZA 3DH0A 1A98A 4E1VA 5EXEA 4NCIA 1JDVA 1QJCA 3GT0A 4GLJA 1ZSNA 5EEHA 3ANYB 1V71A 2A78A 2JI6A 1JHVA 2NYRA 1QCZA 2PWAA 2Q9AA 2YN0A 1PJCA 1E1QD 1F8GA 1F14A 1ZBQA 5LXTB 1X15A 3FZEA 4P82A 1JBEA 1B26A 4PBRA 5CA1B 3LG2A 2FFRA 5J2UF 4OP1A 2J3QA 3GDWA 5FBRB 2X0EA 2HV9A 1FTNA 3AJRA 4D8XA 3AW9A 4HWGA 3QE9Y 3UJDA 1ZI9A 2GHTA 2P1ZA 4K6GA 2ZIXB 421PA 2I1QA 2O0KA 3VYTB 1CUWA 2QRKA 5CFRA 4Z2YA 1P4SA 1UEJA 3D5QA 3L5KA 5E6RA 3SAJA 4E94A 1TIKA 4Y9RA 5JWHA 4MRSA 4Q01A 2BKLA 1TTPB 1V4VA 3AY3A 4II2A 2O7SA 1AV7A 3G1WA 1HM5A 4DYHA 2I78A 2DUJA 2J0UA 1ODLA 4LYYA 4I5GA 4V0OA 1U7TA 5TV2A 1VC2A 4D9MA 5BYKA 3OC6A 3L7CA 4AS1A 1VA4A 2O7NA 4YI3A 1M2HA 3CX6A 2UYQA 3QZUA 4KAAA 4N3GA 5B36A 1JMKC 2B3DA 3HCWA 1P5JA 1ECLA 3RROA 5JS7A 3BL5A 4BQPA 2IE0A 1HEIA 5KYXB 3EMKA 3L8DA 3THWB 1VPTA 2IU3A 3WHPA 4PYLA 3B6IA 3H5OA 3K5HA 4QDZA 3R7BA 2XOXA 5JS6A 5FA6A 2WYUA 3KXPA 5THXA 3TLYA 2RCYA 3LUKA 1CIPA 1IBKB 2I65A 2PCJA 1DC5A 4RO0A 1ZIOA 4ETWA 1HE5A 1P1KA 5FH9A 1O03A 3FAKA 2J5QA 4DV3B 4RYLA 3LA6A 2ZT5A 2Z95A 3IIJA 3E1KA 4GPIB 4OU5A 1K5GA 1W25A 3EY9A 1G2OA 2IYZA 2PLWA 4Q03A 4KI0A 3CEPB 2Z9CA 3ICOA 3ZU4A 1N6RA 2Z9DA 1CLEA 3AB3A 5TARA 3WBFA 2AYZA 1L1FA 1XEXA 1YS9A 1WW3A 3T7IA 3CV3A 2ZJAA 3A27A 3O38A 2R97A 4K05A 4WPGA 5ALSA 5J23A 1V8OA 2QTHA 3GROA 2YKGA 3GH3A 1FVXA 1ABFA 1SNYA 2P8JA 2WG2A 3ONEA 1NI5A 4NBLA 1AZSC 2JGNA 2XOKA 2FQ1A 2JLQA 2C5FA 4JDUA 2G7MC 1QM5A 4ARVA 2AB0A 5DHUA 3VBCA 1NHWA 1Z2NX 4HDSB 5CA0B 3BHIA 3IUQA 2VKTA 2C99A 1VCIA 4PIPA 4R2LA 1RJWA 2QD4A 2VYVD 5LUAA 1KK2A 4UTPA 4W5WA 3DEZA 3U7EB 3BE8A 4AZ3B 2BSXA 2QZZA 3LT5A 2P9BA 3ZNQA 2VHWA 5SZJA 1PT5A 3CISA 1MIOA 2OBMA 4EATA 4ND4A 5AI0A 5C37A 2J3JA 3IUSA 3FOFC 4WMLA 2ZROA 3GJ8A 1VIMA 3KFVA 1E62A 4CIYA 1HX7A 3TQFA