1S9DA

Arf1[delta 1-17]-gdp-mg in complex with brefeldin a and a sec7 domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
161
structure length
155
Chain Sequence
MRILMVGLDAAGKTTILYKLKTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Snapshots of the Mechanism and Inhibition of a Guanine Nucleotide Exchange Factor
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein transport/exchange factor
molecule keywords ADP-Ribosylation Factor 1
total genus 54
structure length 155
sequence length 161
ec nomenclature
pdb deposition date 2004-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s9dA00
1GL6A 1JXMA 2GJAA 4JYBA 1J99A 1I4DD 4E5UA 3UIEA 4R2HA 2C5LA 4ESHA 1LV7A 721PA 3DDCA 3HU3A 4XWKA 2P5SA 3TVTA 3OEEA 1GKUB 1G7TA 3R9XA 1UPTA 4BECA 1NMZA 5JRZA 2CJWB 2VP5A 4IFEA 2XSZD 4FI3C 4IEEA 4LWZA 2WPDD 3FHCB 3FKSA 3A8TA 1EWRA 1KOFA 4HLUC 3K9GA 4TQAA 2WJHA 1QG4A 2ZE8A 3QIAA 1QHSA 3WMEA 2PEZA 1E98A 1CJVC 4MGYR 2LKCA 2CVHA 1IONA 1TUEA 3T12A 5FPYA 3TBKA 5E7MA 1RC8A 3ICQB 1Y3AA 4UNNA 4JLKA 2B92A 1M1YE 1N6OA 1U0HC 1P2UA 1ODFA 2AWOA 2OFWA 4RVCA 3S1AB 3NH9A 1N6IA 1D9ZA 3K0CA 4DVGA 4G5SA 1CJTC 3FPAA 4TYNA 1CBUA 4TZ6A 4PXAA 5B30A 2A5YB 1CR0A 2QE7A 3ZVLA 2B7CA 3GMTA 2QY9A 3C4JA 3I4LA 4M1TA 4A8JA 4Q21A 2WKQA 4MRVA 4D2IA 3QKSA 3QKRA 1J70A 5DI9A 5E95A 3DM5A 4DBLC 4XSGA 2V4ZA 1X8LA 2GEDA 1KMQA 1E2QA 2AKAB 2PJRA 4UXJA 1OJLA 4EPTA 1F6BA 2ZITA 1ZM9A 3Q7PA 4ZIRA 4ZO4A 2G1KA 2WWYA 3UATA 1YVDA 3THYB 3KQHA 5JHGB 3VFDA 3O8CA 3QJYA 1FP6A 2VP2A 4K81B 1BIFA 1Z29A 2K5UA 5B57C 4LYHA 3LX5A 1DAKA 4A15A 2ANBA 1E9RA 3GFPA 3GLIE 4PO1A 1J8YF 4G1UC 1U99A 4DCNA 1TL7C 1QHHA 1W36D 1U0LA 2QM8A 4HB3A 4RZ3A 2IUUA 1G6OA 4HDCA 5K8TA 2ZI5A 1P72A 2QL6A 3CX7A 3MWLA 2HCBA 4LYFA 3NIBA 3HPRA 1KJYA 1R0YA 2O8DA 2GETA 1ZUIA 3RRZA 2Q3HA 1XEFA 3AUXA 3BWDD 4LSGA 1G291 4QBHA 5AK0A 4KFUA 4GP6A 3VNVA 2ZI9A 3RRYA 5HZHA 3GJ0A 2P0EA 1XZQA 2IXGA 6Q21A 5KUTA 3DKVA 2YKGA 1UAAA 3U61B 4KLZA 4LHVA 3SU8A 1YR7A 4TMTA 1MV5A 4LI0A 1NN3A 1SVMA 1FUUA 1IN8A 1ZINA 2NO9A 2UZIR 2X77A 4JLJA 2WOJA 4PZYA 2A5DA 1KMHB 4MUBA 4W5JA 5J5CA 3ZZ0A 4QM6A 2HJVA 2W6IA 1SXJC 2ZJZA 1CR1A 2HYDA 4TTRA 5KSYA 2JLWA 3FTQA 2PCLA 4MGIR 4C0BA 1U8YA 1XF9A 3IBYA 3PIRA 4NU0A 5HR5A 4HUQA 3CW2A 4JMPA 1LF0A 4LJYA 4HUTA 3WNCA 4JLNA 2HF8A 2QM7A 5EZ6B 3GQBA 3JZMA 2EFDB 4BQSA 1JJ7A 1NN1A 1EESA 4QJ3A 5JECA 4M8NE 2GAOA 3BBPA 2YNMA 3NEYA 3A1WA 5TXGA 3B82A 1U9IC 1Z0IA 4A2QA 2Y8EA 1FQJA 3FMFA 4LPKA 3UG6A 2ZE7A 4M9QA 3ZGXA 3ETLA 1FPMA 3TMKA 2QPTA 2V8OA 3B60A 5TARA 1KO5A 1WBDA 2I1VB 3REFA 3OIYA 1E9FA 1KJZA 2IYZA 3R8FA 2X1VA 3T15A 4AD8A 4BZPA 4MKHA 5JEDA 1W4AA 3RNLA 1XMVA 4L16A 5KPDA 3U4QA 3VX4A 1II9A 3VKGA 2F3TA 4JVNA 2FPMA 1KGDA 3QVVA 3ZZTA 2PZFA 1ZIPA 2B8WA 2PEYA 3B13B 3ONWA 1P73A 3AGQA 3NBZC 1W2GA 2ZRGA 2IS1A 1KI2A 4NH0A 3I5YA 3N2EA 4DT1A 3T06B 3LBIA 4MRNA 4B6EA 3LVQE 1S9DA 3ZH9B 3QQ5A 1JEEA 1CP2A 2HF9A 1DOAA 4MGKR 1MR3F 3WNDA 2REBA 2OLKA 3P27A 1IM2A 1EX6A 2J7PA 2CE2X 4RCYA 4ZV4A 3R7WA 2ASEA 3FMPB 3BIFA 4JBYA 3Q8XB 1Z6YA 3K0AB 2ZUCA 3NBYC 3ADCA 1I2MA 2J7KA 3I8XA 4YLGA 4CZ2A 1XJ0A 3X2SA 5D3MA 4TYQA 5FFMA 1M7BA 3K70D 1IN7A 2QSZA 2JLXA 3GEEA 2ZUDA 4LRWA 4P3YA 3UKDA 1TF7A 4TL9A 4FINA 1LB1B 5SZHB 3K9LA 2QRNA 3VHXA 2OE2A 3GD7A 4LYJA 2IYLD 3SQWA 4PC6A 3P20A 1G4AE 5GJVC 1UDXA 1W0KD 4P4TA 1DPFA 1XD2B 2X2FA 4CT5A 4Q9LA 1KNQA 2WM9B 5TMPA 2ZRKA 4TT3D 1H8ED 2ZI3A 4Q03A 2VF8A 2O8EB 1RJ9A 1EWQA 4MKFA 5IDVA 4AKEA 4EQ6B 1CF4A 1FNMA 2GJSA 1Q3HA 4US0R 4QJ5A 3RS2A 4M1OA 1JBKA 1TU3A 4ASUA 1FX0B 1E2MA 421PA 3KJGA 3X1WA 1UKVY 1IHUA 3MWJA 1DVRA 4DSTA 3MGCA 1JR3A 5CDFE 2Z4SA 4TMXA 1EFRD 4Q4AB 2XXAA 2CEAA 4TLAA 4HAZA 4LYAA 4QRHA 4C2UA 1TEXA 3ZIAD 1A5TA 4UQOA 1JPJA 4FCWA 4DZZA 1U8AA 1IXZA 1KSFX 2OCYC 1A2BA 1XBTA 2F1IA 3RABA 5K8LA 2PZGA 1EXMA 3KTAA 4XJXA 1G8FA 4A2PA 2Z4RA 4JSTA 2QRZA 2BJWA 2IHYA 4GT1A 4JT4A 5CB8A 3SDZA 1Z47A 1JAIA 3KQNA 2IF2A 4NDZA 3VR1A 1EX7A 1MABB 4QNRA 5SZJA 1IXRC 1S96A 4OL0A 3ICEA 4Q66C 4LUCA 1ZP6A 4I1VA 4B33A 3P26A 1YR6A 3B85A 4DB4A 1MO6A 1N5LA 3W6NA 4Z54A 4RZUA 1KDPA 5DSZA 1L4UA 5FTMA 2ATXA 2VPPA 5FTNA 1XTSA 3UMSA 3X1XA 4DRZA 3J81k 3CR8A 1P6XA 3WYGA 4EFMA 1Z5ZA 2ZI7A 1E2GA 2IK8A 3GJ6A 2R8RA 4AKIA 5KDDA 1QRAA 1JEDA 2OXCA 3K0FA 3FDIA 3LBNA 4WOPA 3DHWC 5EZ5A 3U6BA 3V00A 1Q21A 4Q19A 3TIFA 2EWVA 4GZMA 3SBEA 4KITB 4M0LA 4ITRC 1NG1A 2MSEB 4M53A 1DAEA 2C03A 3PUWA 1Z2CA 3EZ9A 4PO9A 3TK1A 3ZVNA 1ZU5A 3TW4A 5JZVA 4B34A 4RFSB 1E4YA 1E94E 3D8BA 3SZRA 4B35A 1BMFD 2FSFA 2XEXA 3ASZA 5CITA 3RC8A 3OE7A 1VCIA 1VCOA 1VHTA 5LB2A 4M1SA 3WP1B 2XAUA 4GFDA 3PFIA 2R6AA 5LB4A 1XXHA 2HT1A 4BGDA 2X2EA 1OFUX 5CYOA 4XVRA 4N0EA 2CBZA 1Z08A 1OH8A 4Z1MD 3K1JA 3AVOA 3GEHA 1G16A 1CTQA 3CRW1 2ZSEA 4FCVA 4PSKA 3Q72A 2BKEA 2JA1A 1CULC 1ZC4A 1U9IA 2DHRA 4RZXA 3ZVMA 2OUKA 1B23P 5CK4A 1DO0A 1L8QA 5G53C 3KX2A 1CLUA 3TGPA 2Q3MA 3A1TA 1H65A 2KE5A 4U7DA 3TR0A 3CM0A 4FW9A 2OT3B 2FJUA 1J90A 2O0KA 3PVSA 5C4MA 1DARA 4Q4LA 1KO4A 2C95A 3RS4A 4HB2A 5JJKA 4M1WA 4GPTA 3A1VA 3KQLA 1TQ4A 4LZZA 5FUWA 2JLUA 1DADA 4ZPXA 2WBLC 3EC1A 4OQNA 1WE2A 2GHIA 5H1YA 2F6RA 5FPKA 5G3ZA 1IBRA 4YMVA 5IK2D 3BRWD 4LDJA 2P5TB 2JJ1A 1GZSA 1IY1A 3MRSA 5FBVB 1Z8FA 2G77B 4DLYA 4GMDA 2MMGA 4JLDA 4NONA 4IDPA 3WNBA 4F7WA 3CNOA 2BJVA 1VG0B 5F3WB 4FCTA 2CCKA 4B2PA 5JEEA 2IEZA 1E9SA 3A1UA 5UKDA 5AUOB 2DFKB 3N5CA 1VIYA 2SHKA 1AN0A 4PFSA 2GXUA 4PC7A 1UFQA 1YZUA 2GRJA 1FOEB 4I4LA 5FOXA 5E4FA 1YE8A 1N6PA 1KO8A 1TMKA 2BBSA 1NVWQ 2G6BA 4R9UC 4RD6A 4ILEA 2PLFA 3U44B 3QY0A 1P61B 3QUSA 4URWR 2XITA 1F2TB 2VSFA 3KKNA 4F4JA 2XSZA 2DB3A 1EFUA 3PUZA 1HQCA 3GJ7A 5JS7A 1E2IA 1W2HA 1P2TA 3DZDA 1KI1A 1GDDA 2ZU6A 4YC7A 5EXSA 1LVGA 2O5VA 2KI5A 3GFTA 2DWQA 3CWQA 3EW9A 3NDBB 4BWYA 1Z0KA 2HUPA 4OKSA 4XSHA 4M1YA 3KJHA 1XCGB 2ZJ2A 2R62A 4TYYA 5DI3A 3EWSA 1Z0AA 2VP9A 4KCGA 2EQBA 4Q9IA 2ZRBA 3FHTA 2ORVA 2DBYA 2YOFA 5FBQB 5HCIA 2G3YA 3ADBA 4TMZA 1JAHA 2VQSA 4WVFA 4MQBA 1ETUA 3KZ1E 4PHTA 3CO5A 2GJ9A 5JWRA 1KI9A 1JI0A 2IHBA 1VYUA 1CRQA 4MYTA 5FPHA 3AP3A 4PPFA 4G3XA 2WV9A 2IUTA 1ZU4A 4YONB 3GLFE 5KDOA 1GRQA 3TJZA 3L0PA 3VQTA 4Q4JA 2ZREA 2CE7A 3B1XA 3T61A 4LJ4A 1UJ2A 5B58C 1HA3A 2OXRA 1J8MF 1OFHA 3ZD7A 3RS5A 1SVLA 3OESA 1G20E 4LJ6A 4GOKA 3E5HA 1N0WA 4KFRA 3LQRA 1SVWA 2REXB 2EFEB 3TW8B 3DM9B 4BLOA 3AH8A 1ZNZA 3C8UA 3ECCA 4Q02A 2IL1A 1VKJA 2QENA 1Q1ZA 4PO8A 2VH5R 3TSZA 1NN5A 1W4BA 3C16C 4FXPA 4C0QC 1E2HA 5FTLA 3TLXA 3C7KA 4D6PA 1US8A 1VYVA 3A4NA 4D0LB 2QPAA 1LFDB 3A36A 1M7GA 3CH5A 1YZLA 5IRCD 3P4XA 1TEVA 4XH9B 2YWGA 4XVQA 3BERA 4D0GA 2WAXA 3AF3A 2VBCA 4BZXA 5F2EA 3ZZUA 4DSUA 5KSPA 1N6NA 3C15C 3H4MA 1PUIA 3REGA 4EQ6A 4KYIB 1GRRA 2O8EA 5BQ5A 4C30A 1AGPA 1ZYUA 1N2CE 3QKSB 2ZRJA 3DL0A 2QG6A 2WWWA 1OH7A 2H5EA 2XTZA 3T1TA 2PX3A 3W5IA 4RKFA 821PA 4ZI2A 1OT3A 3EWAA 2ZSFA 1G1MA 4MYUA 2ZJBA 4URYR 1Y63A 1P9NA 4OI0A 3QEOA 4R7ZA 2ZRDA 2FOLA 3OEHA 3AKCA 4JL6A 4C0JA 4TMVA 3QBVA 2Q6TA 1OIXA 4NYJR 5DIFA 1QVRA 1UKEA 4KXFB 5D3MB 1GNQA 2OESA 3L8YA 1CIPA 1A82A 3AUYA 1G3IA 2OBMA 4OJQA 4QHSA 4F38A 2EFGA 2ZYUX 2C99A 1G7RA 4EPVA 1G4UR 1KK1A 2FPLA 4IW3B 3B2EA 2J0VA 3NC0C 2V9PA 2FFQA 1N5KA 3IHWA 2GCNA 1F2UA 1VG8A 3GP8A 3PQCA 3KDSE 2AK3A 3PITA 4JYCA 4HAWA 1R8QA 4GSYA 1YZTA 5H8WA 3SJCA 1CRPA 2IYUA 4B71A 3D6TB 2EFHB 1N25A 1P60A 5SZKB 4XVUA 3UWKA 3EZ7A 5J4KA 1OFIA 1AM4D 4QGHA 1XJCA 3GFOA 3VAAA 2J5XA 2QBYB 3OEED 2JLYA 4QC2A 1FZQA 1OYWA 4GDFA 4BLRA 1GOTA 2PMKA 1ZW6A 4G5GA 1TADA 1OFTA 3T1VA 3VTKA 4RKEA 3GLGA 2RGDA 3C5CA 2FFHA 2RKOA 1VDZA 2WJGA 3LW8A 3LAWA 3EPKA 5GADl 4LHWA 1XTIA 3AKYA 4XD7A 2ZJ5A 3MD0A 4IJMA 1X8JA 1AQYA 2NZJA 2QQEA 1GRNA 3GLIA 2RGEA 2V7QA 4HZUA 4LPSA 2FN4A 1NLYA 2VHTA 5FUXA 3B1ZA 3WBKA 1RYFA 3IQWA 4DIDA 2FSGA 4G5QA 4MH0R 4TZ0A 1O3YA 4BLQA 3A37A 1ZJ6A 2PBRA 2ZPTX 2OFOA 4NL4H 2NOAA 2WSSD 4F4CA 3U3KA 1KAOA 2ZRMA 2F1JA 3KXKA 1KMHA 4OJKA 1RRFA 4HZUB 4QFMA 3X1YA 2DPXA 4AG5A 1CJMA 1S2MA 1XTJA 1YHNA 2D06A 3L43A 2CHQA 1MT0A 4FIDA 4ARZA 3F3YA 4CDGA 4S2EA 1XD8A 1XMIA 4MYCA 1HY3A 2KJQA 4S35A 1K5DA 1E2PA 1UKZA 3D3QA 1F60A 4IXMA 3TQCA 2BMJA 2JGNA 4TLEA 1E0SA 3FYHA 1E69A 1G3RA 5EE0A 2WSSA 3I1FA 1ZCAA 4JLPA 4B3CA 4B76A 2XTNA 2YOHA 2VHQA 2IYYA 3U7GA 1KDTA 4OQLA 4ZCIA 1E2KA 3NBXX 3AVWA 2RHDA 2BWJA 3ADDA 2O8DB 2P3SA 3W9YA 2XZPA 5FOTA 2J0UA 1VYTA 3IIJA 2XNDA 3U3RA 5K8UA 3KB2A 1Q22A 2J0UB 4RSGA 2FE4A 2GILA 1M74A 2WJVA 2HEIA 5L3QB 1RYHA 1DE0A 4OYHA 4HLUA 1XP8A 4D4KA 1TTTA 1UEJA 5GJCA 3W5JA 1F2UB 1XEXB 1XWIA 2Q9BA 1Z22A 2GZDA 1RZ3A 4B43A 1E4VA 4BRWA 4K8OA 1GSIA 4CEIA 1U8ZA 2BIFA 5JSZB 1E79D 3F8TA 1ZD9A 4TYWA 2AWNA 5E7IA 5KHOC 1GWNA 2TMKA 4KSCA 3TUZC 1T3SA 4I99A 2O0JA 5HCNA 5JJLA 5F9HA 3LWNA 5FL3A 3PEYA 4LCBA 1SXJD 3BOSA 3X1ZA 1FFHA 2GEVA 4C0KA 1EFCA 3QENA 3TR5A 2ZE6A 3CH4B 4N3NA 3SFVA 3WHLA 1CS4C 3LFUA 3MUFA 1V5WA 1Z6XA 2NPIA 2F55A 5GJBA 3KJEA 2ZYTX 5TV2A 3L0SA 1IY2A 3HR8A 3RAPR 2A30A 4E03A 2BCJQ 1Z6AA 1AQUA 3KUCA 4DC9A 3MLEA 3HR7A 1AA9A 5BN4A 5CJPA 2GWHA 1T9HA 2QT1A 3Q85A 3AKEA 4GP7A 5HTKA 4ZDIA 4IDNA 2IYQA 3W8RA 2FSIA 1XXHE 4PHHA 2IYVA 3MMPA 3DOFA 4E22A 2F43B 2JDID 2VP6A 4EFNA 1XXHB 2AFIE 1T6NA 4LOAA 3W34A 5GVRA 4RD3A 1US8B 1XU4A 1COWD 1ZCBA 3IKJA 2ZRCA 3PUVA 4MGZR 4PANA 2VHUA 4XIGS 3KKQA 3EIQA 4KI0A 1DEKA 4HATA 4H1UA 2BCGY 3M4YA 3CUEF 5G3YA 3K9NA 4OQXA 4F93B 4DLRA 1FMJA 1KI4A 2QA5A 1OV4A 3IIMA 2GDJA 2QGNA 4U5XA 5KOYA 4A1FA 3MWKA 1QBKC 2PL3A 5B2ZA 3HJNA 2CLCX 4Q4HB 2ZETA 5LDDC 3NH6A 2A7QA 4OHZA 4NCNA 4L15A 1E2JA 3FOZA 3UMRA 1YR9A 1N0VC 3WY9A 2AN9A 4M9ZA 4RD2A 3KQKA 1WB9A 1AKEA 4RZ2A 4PAQA 1QG2A 1DBSA 2WKPA 2QORA 4YMUA 4QG7A 5GJWC 3H84A 3SN6A 2F9LA 4HLDA 4TSFD 3EPHA 4JS0A 4OQMA 2OILA 2ZU0C 1G18A 2OBLA 2DFNA 3UMFA 1E6CA 3HU2A 4V0ME 4JLBA 5D3QA 4UJ3A 2ZANA 1DAGA 2AD1A 3KTAB 5FR1A 4DB2A 2JJ2A 3NVAA 1YU9A 2BOVA 3I73A 4PAOA 3NWJA 4QNMA 2H8KA 1XX6A 3CPJB 2Z43A 5GVSA 5FTKA 3HYTA 1T8UA 2GCOA 2D7CA 1Z0JA 5KTYA 4US2R 3BH0A 4QHYA 3H2YA 3VR4A 1C1YA 2D2EA 5KPJA 4EIWA 3CF0A 5EE5B 1G8GA 3AEZA 1OB2A 2NIPA 2MSDB 3GJ4A 2YWEA 5FPTA 3U44A 1NVXQ 3CNNA 2QAJA 3IBGA 2ANCA 5CYPA 2W58A 2DWPA 3B78A 3ZS8A 4Q1DA 4EPRA 2A5FA 3VKWA 1AS0A 1KHTA 2ZRAA 3NDPA 3SYKA 3B1VA 1Q1EA 1FTNA 2AHOA 3RRMA 4DLTA 4EUNA 1N6KA 4P0TA 1W47A 5DE3A 2OLJA 5DISB 2CLDX 1XJQA 3UXMA 3NEJA 1QHYA 4MRSA 1UBEA 4R71A 4A36A 4II7A 2W2TA 3PENA 1QHXA 3BE4A 2FU5C 3T1QA 4C0SA 2B6HA 4DDUA 1CKEA 1OXVA 4YDSA 1GNRA 2NO6A 2WWHA 4PPQA 3OIVA 3ZDQA 1EFHA 4G5RA 4V0OA 4N0DA 5LD2B 2BM1A 3FWYA 2D4HA 4M21A 4Q7LA 1XTRA 4CEHB 1D2EA 1N5IA 4ARZB 1GVNB 2XJ4A 3SJBA 5JWHA 3AKDA 4ABYA 3UG7A 1IAQA 4Q9JA 1U98A 4FMCB 1RW4A 2JJ2D 5C46F 1G8PA 3CR7A 2QSYA 4URXR 1F3OA 1YRBA 2ATVA 4LGMA 3KB1A 1P9RA 4KV9A 3SOPA 2IA5A 3B9QA 4ACBA 1W4CA 4L5BA 2OBNA 3CX6A 1Z28A 3CONA 1IN4A 3EPJA 3PUYA 2P6UA 1R0ZA 2GVDC 5AJYA 2IWRA 1ZUNB 3AVTA 4M9XA 3TSWA 3MG9A 1XPRA 4MDFA 4ZCMA 1E2DA 521PA 3RRNA 1P4SA 2BBTA 1VECA 5AJWA 3RSLA 1II8A 2FH5B 1GAJA 4IRUB 3ZVRA 3OFNA 1R8SA 4W7SA 1Q20A 1ZMXA 1G7CA 1KSHA 5C4GB 2FWRA 3W3ZB 2ORIA 1II8B 4HZIA 1GITA 1QHIA 4K46A 4LBVA 1S1MA 4H9GA 3AF4A 1J7KA 2Q9AA 1JPNA 1GTVA 3I8SA 4ZCLA 2I3BA 4HAUA 2P6NA 4OHVA 1PLLA 4TYPA 5AUPB 3F0TA 5CJ2A 4Q7MB 4JZKA 4UNPA 2P65A 4OI2A 2A78A 3Q7QA 2GXAA 3THXA 3EAQA 2ODBA 3Q9LA 4UXIA 2RGAA 2C9CA 2IYWA 2R9VA 3UWOA 5E3HA 2GBLC 2QP3A 1HEIA 3NTUA 2N1BA 4C7OB 1I4TD 2DWOA 1QHNA 3RS3A 2BV3A 2OAQ1 5A0FA 4D26A 3B1YA 3TKLA 2N42A 2XOKD 3QSYA 3MFYA 3VHLB 1X3SA 2JLZA 3K9HA 2WJIA 1QHGA 2WWFA 1SXJE 1BYIA 4C0LA 1HURA 1PUJA 1SXJB 1ZBDA 3K70B 4NZYA 5FOSA 1NBMA 2J45A 1NL3A 3CRMA 3OZXA 3K09C 3FFAA 3SHWA 1X1RA 1L7VC 1P7CA 4BLSA 4OHXA 5JCZA 3EASA 4E09A 1SVKA 1OKKD 3QI2A 2YOGA 5JFGA 1MABA 1WXQA 3SNHA 1Q44A 4CT4B 2C96A 1OXUA 3EARA 1GM5A 2BEKA 1UDWA 2ZM5A 1OHHD 1Q3TA 2W83A 1LS1A 5IF9A 5DHAA 3EZ2A 1G8HA 1OSNA 1XZPA 5KDLA 2ODWA 3A4MA 4KO8A 3IO5A 2RMKA 4EJSC 1TQ6A 2KWIA 2R6FA 2IEYA 4D80A 2O8BA 2FFBA 2VF7A 2YWHA 1NIJA 3BD9A 3OAAA 3JVVA 4CW7A 4PC3A 2OCPA 4Z8XA 2YC4C 1AGRA 4PSAA 4BFZA 4KYUA 4IVRA 5CM8B 4EPWA 4ESVA 1YZQA 1G8YA 1MO5A 1XTQA 2WKRA 4Q4AA 2XXAB 1XDBA 4GOXA 3AVYA 3I92A 2AXPA 4JLAA 4PAMA 1I4LD 1PJRA 4QBGB 2C77A 3B8HA 2OEPA 4Q48A 4HSEA 3NBFA 2QTHA 4Q7JB 2HDNB 4DDTA 1W0KA 3WHKA 4D4JA 4BE7B 4ZDKA 3VR2A 3QXHA 1ELOA 4UXHA 2D3WA 4ZKEA 3LW7A 4ZDWA 1JB1A 2ERYA 2R6CA 3SE0A 1RJ9B 1NF3A 1DAIA 1E2LA 1NY5A 3GJ8A 1IQPA 4Q9HA 2XZLA 2GCPA 4M4SA 2V1XA 4A8JB 4TLCA 3I5XA 1QZXA 4U02A 121PA 1KKMA 4N1AA 2X19A 2FZ4A 3Q5DA 3P32A 4DLVA 1E3MA 3VNUA 3NXSA 3PEWA 4TMKA 1G41A 4UNQA 1XEWX 1AZTA 4NP6A 5FI1B 1H8HD 2C04A 4DSOA 4EPYA 3AVXA 3L82B 3CWZA 4B2LA 2IYTA 3QNUA 4KFSA 4QXAA 1TPZA 2W6JD 3AB3A 5E7JA 1WQ1R 4Q5IA 2J46A 3WYFA 5DN6D 2KB0A 1GKYA 2CLSA 1P5ZB 4P33A 2W00A 3K8YA 5DH9A 3U2QA 1SKQA 2ZRLA 4CRWB 1G19A 4LC0A 2YC2C 4F92B 2XNSA 4GMXA 2PX0A 3WBJA 2NZ8A 1RFLA 2H92A 2WJYA 3BJIC 4MKGA 2VP0A 5L3RA 2JLVA 4YMSA 4NKRA 4RY2A 1S9HA 4NCHA 4C3ZA 1DG1G 1XCPA 4KU4A 3FKSD 2RH5A 3W90A 2QROA 4A0HA 1MRNA 2GESA 1OIVA 1R2QA 1ZD8A 4NTZA 2EW1A 3QG5A 3KUDA 3RDPA 4Q18A 1E0JA 1LF5A 2ZJ8A 2O0HA 2HT6A 4LJ5A 4B2IA 3FHOA 2ONKA 4JVMA 4LJAA 2BBWA 2ZS9A 1YZKA 5FBLB 1T91A 3QPWA 4C4PA 4G0NA 3SYLA 1K8RA 4AYWA 4QKQA 3EPLA 3FGNA 1WRBA 3GLFB 4O25A 1H8EA 1U94A 4MYHA 3TE6A 2WPDA 3OIUA 1GILA 2G9NA 1FMLA 4JKIA 2NTYC 1F2TA 4WW0A 3RVBA 3G82C 4IXNA 5JI3E 3E2IA 2IXFA 1U90A 1GP2A 2PCJA 5HKKA 2HYIC 3IHLA 3AF1A 2NQ2C 5EUQB 1A2KC 2GXSA 3LLMA 4MUAA 3PEUA 5EP2A 5FL7D 4QBIA 1MRSA 5KYKA 4FMDB 3G5UA 1IJEA 2X8AA 2ZAOA 1TQDA 1X86B 2KBFA 4B44A 2ZS7A 4V0NA 2XJ9A 3QPUA 3DZ8A 4BFVA 4AI6A 4KSBA 4P4SB 1A7JA 3MJHA 1W46A 3I32A 1PZNA 1OYYA 2ZJYA 1PV4A 1NI3A 2OG2A 1CU1A 1G7SA 1EFRA 4R2IA 1MOZA 1SHKA 4OK6A 1E2FA 1OE0A 3JVUA 1F48A 2O8FB 3THOA 4HDOB 4A0RA 3LXRA 5F9FA 4TL6A 4DLSA 1ESNA 3MWYW 1OB5A 1KK0A 3CZPA 4FMBB 4IOLA 3ZS9A 2V6IA 3SI7A 1ZM3A 2WZQA 1TUIA 2BM0A 3D31A 1KY3A 1E1QD 3EG5A 2CK3D 3QXCA 3U4QB 3CPHA 4PTLA 3D7MA 4PPNA 1J2JA 4B3FX 2WJJA 1OLOA 3E1SA 3MCAA 3DVLA 2I1QA 2ZS8A 3A58B 2O8CA 3QEJA 1YKSA 3B1WA 3A1SA 5BYJA 1D2NA 5FPSA 4RCZA 2P2LA 2RGBA 2G0TA 4POAA 3QKTA 2GZHA 1YZGA 2IT1A 5TY0A 4BEBA 2IF0A 3U3OA 3THYA 3WXMA 1DS6A 2QI9C 3MAAC 1YZNA 3X1DA 4DEYA 2PMDA 2KSQA 3U7EB 4ZIRB 2A2ZA 5FL7A 3RWOA 2GCOB 1LNZA 2BHRA 3U7HB 1G6HA 2C9OA 4QJ4A 3IGFA 1RE0A 4JL8A 1OPXA 4HUQB 3C41J 3QKRB 2WVJA 5BWMA 3AGPA 5CLLA 2ZTSA 1SQ5A 4TQUS 1AS2A 2Q0HA 2FV8A 4FD2A 1P62B 1OKKA 1Z63A 1W5SA 3U6KA 1Z6TA 2CK3A 1FQKA 1DO2A 2YHSA 2V1UA 1QDEA 2QUZA 2HLDA 5CM9C 1VMAA 4LX0A 3K0FB 4KLNA 1NKSA 1HE1C 2V55B 5JJIA 1E2NA 3S1AA 4QOSA 2RGNC 3QE0A 1VIAA 1KO7A 2IYSA 2A5JA 3CF2A 5KU1A 3QPVA 1G5RA 5L8VA 1BMFA 4DIEA 1JR3D 2IBMA 4RD0A 4I1UA 4Q1CA 1W7AA 1L2TA 4Q9KA 5IK2A 2W0MA 1E96A 1GL7A 3SC3A 3B9PA 1XB2A 4BFYA 3ZD6A 2DR3A 1CJUC 1TQ2A 3KXLA 1SHZA 1QVAA 1TF2A 4ACAA 1T5LA 3EC2A 3VR3A 4M2LA 1BH2A 5P21A 1NNEA 4YMTA 1D6JA 5EXTA 3N2IA 3QXXA 3RANA 4TTQA 4Y0VA 4E07A 3G0HA 1N3BA 2UVQA 4A6XA 2G0NA 4NYJQ 1E9EA 5TDHA 5C18A 4ZDJA 4ZKDA 1ZRHA 4DSNA 3WMGA 2ZE5A 2E1RA 3WP0A 1NRJB 2GK7A 2OHFA 3K0CC 3KFVA 3R8CA 4V03A 1G17A 4IDHA 2GTPA 5G40A 4DDVA 4C9BA 3ZLJA 3PR1A 1OHHA 3AV0B 4JJKA 5KO2A 4TTPA 1XEWY 5C1BA 2FSHA 1ZNXA 3AP2A 3BH6A 4MA4A 1Z0DA 2F43A 1FL9A 5EUMA 1ZUHA 2L0XA 2UZ3A 1S1CA 4AKGA 3H86A 4PPGA 3IO3A 4WA7A 4TQ9A 2QGZA 3HYRA 3T5DA 2LKDA 3LH5A 5L3SB 5CK5A 1KI8A 3B6EA 3P4YA 4Q7KA 3A6PC 2XNDD 5CIWA 1G3UA 1KI3A 2UKDA 2AL7A 3LA6A 1XD2A 2JJ8A 4NCJA 4AYXA 1OH5A 2D7DA 4US1R 4NYMR 3TUJC 1C9KA 221PA 4BFSA 1W4RA 4V02A 1ZNWA 3IQXA 3MJRA 1JQLB 4LJ8A 4NYIQ 3NHAA 1SULA 1WP9A 1XCMA 2C78A 1TAGA 4D81A 1T4GA 2NGRA 1NLZA 1KK3A 2E87A 4NCIA 3SJAA 5KNBA 3CBQA 1E1QA 1YRAA 4BUJA 3BS4A 3WMFA 1P9WA 1Z06A 1KI6A 1W1WA 3BXZA 4JLVA 4PSVA 1AJEA 2EYUA 2FZLA 4B6FA 2IS6A 4B32A 3R7WB 4G5OA 2YVUA 3HP1A 3O8DA 2RGNA 4X8OA 4A0FA 4QGAA 4GI7A 3TAUA 4NYMQ 4O3MA 3OEHD 1JQJC 1ZVQA 2DY1A 1Q57A 1GNPA 1HT2E 1ZD1A 2GVZC 3BFVA 3IPXA 4PC2A 1JECA 1KSGA 1R7RA 1XEXA 1GUAA 4OBEA 4Q01A 4Q00A 4W5WA 1RVDA 3FMOB 4I1SA 1WBBA 3OFND 4KAXA 4M22A 4DT1B 3CRRA 2VSOA 2VL7A 4KVGA 2CMKA 1IN6A 1AS3A 1S3SA 4BLTA 2EU8A 5J4YA 5EQTA 2QNRA 2DYKA 4XTCS 5FTJA 3B7GA 1P2SA 3O8BA 4QM7A 4IDOA 1EGAA 4AYTA 1YQTA 5M04A 2CVFA 1D8TA 2C8VA 1NP6A 2J9RA 4GZLA 4Q1BA 4V0MA 3GPLA 5FBRB 4Q1FA 3SFZA 1SZPA 4CVNA 1GG2A 2CCJA 4I81A 3RYTC 4TLDA 4NMMA 3K53A 1L4YA 1JJVA 2A5GA 1UKYA 1NMXA 2FGJA 4IOKA 2ZXUA 1KKLA 2FEMA 1PLJA 4PQYA 2VSXA 1E32A 3LQQA 1NJFA 3HWSA 1LTQA 1VTKA 1OIWA 4QHTA 3ZYCA 4HLQB 1AKYA 2H57A 2BKUA 3ASYA 1X1SA 2VHJA 3V4FA 5EP1A 3VR5A 1NBMD 4RFVA 1IJFA 5KSOA 3JZAA 1IOZA 1R6BX 1Q1QA 2ODNA 2XB4A 1SGWA 1FTSA 4OK3A 3AQ4A 3TUIC 1ONBA 2GF9A 2J3EA 1M7HA 4LK2A 1TNDA 4LY6A 2VA8A 2GA8A 1KY2A 1W48A 2WHXA 1R4AA 3VKHA 2ZROA 5FOWA 2NO7A 1G21E 1KI7A 3KKPA 3PV0A 4DCSA 3QKUA 2RB4A 5EXXA 4GL2A 2QZ4A 3I3SR 3M6AA 4CEJA 2QQ0A 4JSYA 2CHVA 4OHYA 2H16A 5J47A 3SQXA 2NMVA 4BZQA 8OHMA 4DLWA 2Q9CA 3I62A 5FUYA 1TX4B 1T3HA 2OCBA 5FI0B 3ZQJA 1AK2A 1N5JA 1Q0UA 3LX8A 2V6JA 1IXSB 2BBOA 3SHFA 3Q3JB 2QE7D 3V9PA 2D62A 1N6HA 4X8HA 5HE9A 2QBYA 4KJZA 1MO4A 2JLRA 1Z83A 5HKKD 1SKYE 4MRRA 4I1OA 4AURA 3H1TA 2ODEA 1VCNA 3Q5EA 3LXXA 5G41A 4TN1A 3AM1A 3DO6A 1S3GA 4PR0A 2QP4A 1G3MA 1HH4A 2E9SA 3BFKA 4LC1A 4DDWA 1K5GA 3QXJA 1QF9A 2C98A 4BFTA 2Z6VA 3IDQA 4Z51A 1KIMA 1U81A 5IHPA 1T8TA 4YQFA 4TMWA 1ZM2A 1CXZA 3FKQA 3GLFA 3HDTA 2MSCB 2PZEA 1II0A 2DFLA 2WIAA 3T5GA 4LJ9A 5KSZA 2PH1A 1G9XA 2EYQA 4W9MC 1VHLA 1E1RD 3PJRA 3M1IA 3P1JA 2FFAA 4LV6A 2KBEA 1W44A 5LPNA 2QMOA 3VR6A 2R44A 4OK5A 4JLOA 2J41A 4UJ5A 3THWB 1LS6A 2QPOA 3PG5A 1PVOA 2Z5FA 2YV5A 3KFXA 2J59A 2ZRNA 3TNFA 3OE7D 3DPUA 2YINC 2IX3A 2OAP1 4B3BA 3SJZA 1WMSA 4GRAA 1XFAA 3RS0A 2Q3FA 3VMFA 2XTMA 2OFXA 4NHOA 2FDCA 2IS4A 4JJZA 1T0JB 3SR0A 3TH5A 5EJEA 4D25A 5F98A 1E9BA 2HV8A 2QAGA 3AVUA 2BMEA 2W6JA 1NVVR 4L4UA 1KSJA 4B74A 2DCUA 4KBFA 1BOFA 3KL4A 4AIIA 1BO6A 3OF5A 2ZEJA 5J40A 1SVIA 1ZIOA 2NPFA 5DLQC 5FH9A 2P67A 3B5JA 1MKYA 4B48A 1RRCA 2ZIAA 2QMHA 5BW8A 1R5NA 3OAAD 1P2VA 4IVPA 2FPKA 3QBTA 3I61A 1DAHA 1NMYA 5AUQA 5C2JB 1G64A 1A4RA 1FW6A 1T0HB 4EJSB 4JVLA 4DJTA 1KZ7B 2CNWA 2VTKA 3IEUA 1E9CA 4MRPA 4WXPA 3EA0A 5EP3A 3U3JA 4XTRA 2CCGA 2QEQA 5J4VA 4Q1EA 2LCFA 4QL3A 1P3JA 2IW3A 2VLIA 3BAFA 1D2MA 4LBWA 2GXQA 5CIQA 2BMFA 3I72A 1COWA 1SVOA 4ASUD 4YXWA 2ZRFA 1OF1A 2D74A 5AWFC 5FOVA 5H70A 3CB4A 2RCNA 2R6DA 2W2VA 3ND9A 2VYFA 3FVQA 3CRQA 2B7BA 2BEJA 2R65A 1E9AA 3R9IA 4CYMA 1EFTA 4Q4JB 1B0UA 4OI1A 2A3RA 1A1VA 1R5OA 3LRPA 3EIEA 4PHFA 4WXRA 2H18A 1XMSA 2QAGB 5JHHB 1VCMA 4DCUA 2ZR0A 2ZQ5A 1MO3A 2NO1A 1CR4A 1R0XA 5J4HA 4TWZA 4KVAA 3BH7A 4XWOA 2O8CB 1V43A 1CJKC 2O8BB 4WZ6A 1N6RA 4XWAA 5EP4A 3T35A 1BKDR 2IUSA 3FB4A 2VHCA 1KYIA 2H17A 5FR2A 1DELA 1XPUA 2C9YA 3GJ3A 4D4LA 3EXAA 5DI3B 4A82A 3EX7C 2GK6A 4YXWD 3EZ6A 3GCGA 3W8NA 3LY5A 3SBDA 2PT7A 1E9DA 2IWHA 3C5HA 1R10A 1VPLA 1OXXK 5CLQA 4FN5A 3LVRE 5TB5A 2ORWA 5BN3A 2P6RA 3KXIA 3TAHA 3A4LA 1SKYB 2A9KA 1KZGB 2WIBA 4NPHA 4PQFA 4A4DA 2XZOA 1SXJA 1Q12A 4PQRA 4WBSA 1HT1E 2O8FA 4AKHA 4PZLA 2JLQA 2QAGC 4GBMA 2YWFA 4B3XA 2WICA 1OW3B 4URUR 3IEVA 1OXTA 2OM2A 1JR6A 1X6VA 3LV8A 1ZM7A 3PCRB 5LBIA 2NG1A 3ZQ6A 4HEJA 4ON9A 3TRFA 3TQFA 4C0HA 4EAQA 2G88A 2WSMA 4EDHA 4CGZA 1ESMA 5HE8A 1OH6A 3VU9A 1P75A 2V7QD 5B64A 3NKVA 1G5TA 1EK0A 1HV8A 2RAPA 4HB0A 4LHZA 5DNYB 3PEVA 4ERNA 3QF4A 2W6ID 1PLKA 4JVSB 2F1HA 3ZIAA 3GLHB 1E1RA 1TU4A 2J0SA 2GAAA 1S4QA 4H1VA 3QF4B 5EXPA 1FNNA 4DLZA 2AKYA 2I4IA 3GJ5A 4DXAA 2IXEA 4KODA 3CKLA 4Z1MA 2QMEA 4B3GA 5FOUA 5AJZA 3CNLA 5HZKA 1JXOA 2AR7A 2IYXA 3DEFA 3EZFA 3K0AA 2W0SA 2ZAMA 2B21A 5ELXA 1KDOA 2ECKA 1UEIA 3NG1A 5EE3A 4IVQA 4CEJB 1IN5A 2G1JA 5BYKA 1G5PA 2VRWA 4AY2A 2ONJA 5JCPA 2W2XA 4MITA 2AX4A 1RPZA 2WWXA 4ZI3A 1DG3A 3SEAA 2N46A 4HI0E 2GF0A 3CX8A 2WAYA 2OO7A 4D82A 1XMJA 1KK2A 2CL6X 2IYRA 1WF3A 2F3RA 2GKSA 1S0UA 3QG1A 4LJ7A 4HYYA 5DYIA 2ZR9A 4FWIB 3VX3A 1GKIA 1H8HA 1NLFA 2AK2A 2XB2A 1TF5A 1LW7A 2H7VA 4IFBA 1W0JA 4L8GA 4TT3A 4IOMA 1F5NA 2G83A 1T3LA 3DOEA 2JCSA 2OCAA 1Z2AA 2QU8A 4UNSA 4XD7D 4HAYA 4AG6A 4D0NA 2ZRIA 2GZAA 2AFHE 1FUKA 1UBGA 4WIAA 1NVUQ 1GFIA 4HAVA 5DN6A 4CEHA 1JR3E 5CDFA 1RIFA 4OI4A 3MSXA 2D2FA 4LV5B 1K6MA 5DHFA 5HPYB 3EIHA 4MDEA 1UBCA 1ZAKA 1VG1A 2GBLA 5ANRB 1W36B 4DLXA 5IT5A 2AXNA 5SZIA 3QF7A 3SS8A 4IOJA 3BK7A 2ZI4A 4NYIR 1N6LA 2V54A 1NN0A 3L0OA 4L9SA 1R0WA 5FBWB 3WYAA 3CIOA 1S8FA 1NKTA 4HB4A 2GNOA 1NSFA 1XRJA 4DKXA 1Z07A 3F5FA 1XNJA 3GLHA 4RFSA 1M2OB 5DYGA 1G3QA 2HXYA 2R2AA 3LO5A 2ZSAA 2B8TA 4KBGA 4NCKA 4J0QA 1YR8A 2GEUA 3BFXA 4WZAE 4EKDA 2C2HA 1EG7A 1W0JD 1ZM4A 4GNKA 2R6GA 3IIKA 3CRVA 3LD9A 2JIZA 2JLSA 4EJSA 4JKYA 3IUYA 2VP4A 4Q1AA 1HQYE 4CIDA 1UBFA 2VO1A 3NHBA 3AP1A 3OIWA 1BS1A 1KI6B 2RGXA 2VEDA 4G01B 4IHQA 4LV8B 4URVR 3DMNA 3BC1A 1M6NA 3RS7A 1GIAA 2OZEA 3PUXA 3R9WA 1KDRA 4UKDA 3T34A 1U0JA 4GOJA 2H1LA 2GJKA 4B75A 621PA 4O2LA 4X8LA 3W6OA 3FE2A 4DHEA 3ADKA 4A2WA 4FMCF 1UM8A 4WAUA 3BGWA 3LBHA 4Z8YA 2ZSBA 2FNAA 4A0GA 2ZVQX 5JRJA 3RWMB 2NO0A 4IEIA 3V4RA 1JNYA 4CF7A 1QHHB 2JIZD 1AZSC 3THWA 1T5IA 4BFUA 4B73A 1DTSA 4QGGA 4BRUA 1BYUA 4RD1A 5JMTA 2DFTA 2WTUA 4A9AA 2HJGA 3L0IB 2J7PD 3AF0A 2FX3A 1FP7A 2PLRA 2EWWA 2FG5A 3U5ZB 3L2OB 3OHMA 1D5CA 1FX0A 1Z0FA 3DMDA 4TSFA 4DWJA 2QTFA 1Z3IX 3O8RA 3IPYA 1JALA 4Q4HA 4V0LA 3L8ZA 2XGJA 3BB4A 4C2TA 3K0EA 4YDHB 1M8PA 2ZUBA 4PC1A 2CL7X 5EE9A 4A92A 5A5GA 4LBYA 1SVSA 4P32A 4EFLA 4BEJA 3LLUA 4P31A 1KTVA 2HCJB 3UK6A 4BPBA 3QXSA 4WZBE 2WMNB 3LNCA 4C7OA 4TL7A 1W36C 3GEIA 5TVKA 4URZR 1W5TA 1HE8B 3THXB 4LBZA 4X8MA 3W6PA 4P4UA 2RHMA 2Q21A 2FF7A 1ZC3A 3GLHE 1KJWA 1Z6GA 2QP9X 3UPUA 1XPOA 1RRPA 4BFXA 5DGXA 2PJZA 5AR1A 4HAXA 3DKPA 5AUNB 2CNWD 4RJLA 5CB6A 2ZJAA 3QVUA 1NG9A 1HTWA 3CZQA 3PXGA 4B47A 4DEXA 4L9WA 3RLFA 3KQUA 4MKIA 2BVNA 4A8JC 5JLJA 3GJXC 1XTKA 1OXSC 1KAGA 4PZZA 2QT0A 3AF2A 2ZJOA 3H0KA 2CJWA 3RHFA 3AVVA 4JBXA 5KNCA 1YJ5A 2ZRPA 2HLDD 1WCV1 2ZYWX 5JWOA 4DUGD 1E99A 1RKBA 2WWGA 3C14C 4BASA 2IS2A 4NE2A 3UANA 4NBSA 1W49A 2J1LA 2REOA 3BB3A 3U7FB 2J0QA 2CHGA 4O0MA 4EPXA 1NVVQ 4UNRA 3KJIA 3K09A 1CEEA 4TL8A 4W5HA 4FMDF 2ZYVX 1M34E 4B3DA 5JSZA 2FMXA 3AVPA 4CEIB 2LWIA 4F4IA 3M0EA 4AK9A 1GL9B 2ZVPX 4QGFA 2BC9A 1KNXA 2JAQA 1VG9B 3IILA 2EVWX 4DLUA 2ZR7A 4JIMA 4DCVA 2QN6A 2Z0MA 1NY6A 4M1MA 3ZJYA 4DCTA 2BDTA 1E0KA 4FWTA 5BXQC 5L3QA 4OQFA 5K8IA 1E79A 1KO1A 4PHGA 1DAFA 4PX9A 1X8KA 2QTVB 1HYQA 5JS8A 3QOFA 1UADA 1CR2A 1WA5A 3HU1A 4AC9A 2WMOB 1AIPA 4JT2A 3BB1A 3KKMA 2OV2A 2XX3A 1RRGA 3BORA 1R5BA 3VU9B 5J4LA 1I2DA 2JDIA 3W3AA 4KHZA 3T1OA 5LD2C 4F91B 4JBWA 3TSOA 2YJTD 1Q1BA 5L3VA 3K0SA 5AJVB 3KKOA 4LHXA 4LHYA 4A6PA 2ERXA 4V0KA 1N0UA 3WRXC 1NJGA 2O52A 1E0AA 2RGCA 2JATA 1O87A 2F1RA 4P4SA 5A4JA 3ND8A 3E70C 4JLMA 2CL0X 3CPEA 3O47A 4BLPA 3K70C 2IC5A 3N70A 2BMDA 2FEOA 4IDQA 1MH1A 1ZNYA 5DO9A 3WRYC 4DUGA 2GJ8A 2QMUA 2WWIA 3NC1C 5JI2E 5KNDA 2YZ2A 2Z83A 2WOOA 2ZRHA 2EFCB 2FGKA 1DAMA 3FFBA 1U2RA 4HLCA 2F7SA 4M1KA 3RSOA 1C4OA 4QBFA 2PT5A 2JASA 4KFTA 2F9MA 2CDNA 1NSTA 2YYZA 2XOKA 1NIPA 2JJ1D 2ZSDA 3GLIB 2JEOA 4IKEA 1IY0A 5JBQA 3RC3A 4O2RA 4Q47A 5FUVA 1HUQA 3CF6R 1WDTA 2CXXA 4HDQB 5H68A 5L3SA 4JL5A 1LY1A 4M9SA 3GLGE 4BFWA 4D4MA 2HXSA 4YMWA 4OHWA 3FMIA 5AJXA 5BN5A 1E2EA 2FA9A 3HPQA 3GLGB 3CLVA 3SYNA 3AVQA 2V3CC 1NBME 1D9XA 2OSBA 3LDAA 3TVDA 4AWXA 4C0AC 3R20A 4RD4A 4U00A 2AD5A 2MMCA 2VIIA 3EA5A 3U60B 1ANKA 1XD9A 4TLBA 4Y0AA 3U3MA 2ZI6A 4R98A 5EE1A 1UF9A 2J87A 4XOIA 2RGGA
chains in the Genus database with same CATH superfamily
4B9AA 1GL6A 1TTPB 3N6RA 4AG3A 3EFHA 4WCFB 5TVGA 5ADWA 1LPBB 4EL5A 1SJ9A 4MQLA 1XZGA 2J6BA 3B9BA 1RLJA 2I9PA 4QA9A 1TK3A 3WGHA 1GQYA 4ESHA 3DDCA 3HU3A 2Q62A 3TVTA 5DGDA 3WADA 3IMFA 1G7TA 3M2PA 3W9BA 2PUVA 4JU8A 1ZSNA 1D07A 3MK31 2CDCA 4QXPA 1T9GR 2MOKA 2WNHA 3CUWA 4IFEA 2QUHA 2XSZD 4REQB 4IEEA 1G21B 1X3LA 2JJYA 3A6GA 4ZI5A 4BE4A 3PFHA 3DVAB 1G59A 3FY4A 4TQAA 3UEOA 1TTQB 1WAMA 4DMHA 1GDHA 1XZNA 2A6PA 2R5WA 3ZHZA 4RKYA 1CJVC 4TGLA 3KJXA 3QWBA 4MGYR 1L7BA 4XE5A 3UCXA 5FPYA 3S8YA 3KJFA 5DTEA 5E7MA 4NBNA 1IQUA 1P4GA 1V4NA 4R3WA 5K03A 2YCBA 4IIXA 1N6OA 2RI6A 3N8HA 3P9SA 1BCSA 3GFSA 3U62A 1U02A 4XUGB 5GM2A 3P0JA 3S1AB 1W88A 3SX2A 3WWCA 4G0VA 3MFQA 3U0VA 3UQYS 5I7UA 3L8EA 4CWAA 1D9ZA 3GN2A 4DVGA 4BFLA 2D59A 1CBUA 1PT8A 2M9MA 4PXAA 1ORTA 4ZVKA 3RUFA 5AM1A 4YCNA 4A03A 5AOCA 1IB0A 4PTZA 3NJRA 4KQWA 3AQIA 3QIVA 5AXBA 2B7CA 1ECCA 3GMTA 5CYFA 2PGIA 3RVOA 5ALLA 5KYYB 3CVUA 4Q21A 1XVVA 2MINB 1JHPA 1E7MA 3LT5A 4RVDA 1J70A 3LLVA 5DI9A 1VKOA 1MH9A 2PKYX 3IT3A 4EJFA 2IHZA 2WG1A 1KMQA 2AKAB 2FQXA 3QJGA 1ZH0A 4JH0A 4N54A 4UXJA 4Y1RB 1MC4A 1F6BA 2ZITA 2R5FA 3KQQA 1PJTA 2Z5VA 3CVVA 3X1KA 3JXEA 5AH0A 3DKKA 2WT8A 1EG2A 1PFYA 3GUCA 3GZTB 4H15A 4IIVA 4DPMA 3TRHA 1TLLA 3UAGA 4X85A 4ER5A 1LX6A 1OTYA 3IVCA 5IAEA 4F6RB 3KQHA 1YH3A 4O6VA 5TGDA 3O8CA 2VP2A 1UZUA 2ZTUA 4K81B 3SOZA 1BG6A 4CMEC 5B57C 1IUOA 2K2QB 2WM2A 4LYHA 1YGYA 2N9UA 4G6ZA 3GFPA 3WRXA 2YMMA 4WJKB 1SQ6A 2J8ZA 3K2BA 1NJ6A 3VDRA 3GLIE 5JD3A 5CVCA 4G1UC 2H1IA 1QHHA 1TW2A 3TXAA 4MWEA 3TLAA 1U0LA 2QM8A 4HB3A 4GAEA 1NFFA 2QMZA 1DTWA 3TW8A 2IYEA 2YZKA 2FCRA 1UXGA 3QOWA 5K8TA 1W36D 3IIEA 4E1AA 1GJRA 3HG7A 2C7GA 1KMCA 4CMEA 5KQSA 4BKQA 3CX7A 4CTMA 2K7ZA 4N8SA 2J9FA 3NIBA 3MCVA 3ZCQA 1KRXA 2AX3A 1FP1D 2KYRA 2OCDA 3RODA 2C1EA 4Z4QA 1GQOA 5IMSA 1ZUIA 2VKQA 3JALB 3GV0A 2NXWA 4DBZA 3BSWA 4Z4IA 1M2HA 2V7BA 2IXAA 4D43A 3TZCA 1OPRA 5C4IA 3LZDA 4GP6A 5KNLA 1Z5NA 3ZWQA 1GLNA 1FVHA 1NP7A 1GADO 1JLLA 3IHKA 3QVKA 4ZRDA 2JI6A 2P0EA 1OLXA 1W1UA 3E2MA 1U7TA 2IXGA 3FF1A 3STYA 3VRHA 2SKCA 1Q1GA 3UA4A 5ESRA 4FFLA 2O3QA 3BXFA 4RXUA 4KPFC 1V95A 3IR5A 4KLZA 1AHHA 3T5MA 3WK7A 1PWEA 1YR7A 5FAKA 1IBSA 4LI0A 5FEUA 1SVMA 2X77A 2VDLB 4JLJA 2I6GA 4N39A 2WOJA 4AIRA 2A5DA 4BWGA 1QH0A 4OJTA 1F8UA 5AVZA 4DY6A 2VS1A 3K96A 3CS3A 1NUUA 3HY6A 1CR1A 4AWAA 3HWX1 1B8UA 3FTQA 4MWSA 2PCLA 5K0ZA 4MB0A 1U8YA 3K0HA 2R6JA 4O2AA 1M2OA 3HI6A 1L5NA 5K0GA 5DHQA 4JMPA 2CMFA 5DBGA 1ZA1A 1K6JA 1L5WA 4LMRA 1KDZA 3AHJA 4HUTA 2LBPA 3FW1A 1D2GA 2QM7A 4IIJF 1BU5A 1JAZA 4DFDA 5H4GA 1HNWB 3FOFC 2EFDB 2WUGA 4AX4A 1NN1A 2A7XA 1EESA 3LUFA 1HETA 1PR2A 3EAFA 4C6RA 1EFLA 2GASA 1HDXA 3DFMA 4R84A 4CLEA 3VI3B 2P4SA 4A2QA 3ZJ4A 2FEXA 1MJGM 2R47A 2JH3A 2JVKA 1FQJA 3QWFA 4MW6A 4YAEA 5JS6A 2ZE7A 3E7DA 1MC8A 1SC1A 1U3DA 3AILA 3ETLA 4ARUA 5A06A 1FPMA 2O1EA 5CAEB 5BVHA 1W25A 1MPTA 2Q1YA 3LUDA 1UMBB 4Q82A 1KO5A 4LXHA 4KAAA 1WBDA 2QRVA 2R87A 3L3BA 3OIYA 3PQ7A 3R41A 1KJZA 1CJSA 4B46A 4HDKB 4BZPA 4MKHA 2ESRA 2IXBA 4GMGA 2ZJ6A 2VDPB 3C74A 2AZTA 4ICIA 5IABA 3KSUA 3QOYA 1SOUA 1Y3FE 3D8TA 5D8DA 4ALJA 2FUG1 1N5MA 1Y34E 3ZIDA 4F56A 1CNEA 4ETMA 3H0CA 1I51A 4JVNA 2FPMA 2JKYA 3VR6H 4LJLA 3EQ7A 3QVVA 3ZZTA 2GZ1A 1ZIPA 2B8WA 4DUZB 4HDMA 3U9TA 1FRVA 2IS1A 2DFPA 2PX5A 3AEUA 2E4UA 2XZDA 2OXTA 4PLHA 3I5YA 4KR9A 3T06B 4EUSA 4MV7A 4IGFA 2UZ1B 5ICGA 1S9DA 5G0UA 2M1ZA 4E3ZA 2AF3C 1JYEA 3U19A 3II6X 2HF9A 5AKHA 3ZGYA 2CXNA 4RCYA 1IM2A 1FRZA 1R12A 2MYNA 1C30A 3L7IA 4F3YA 5JH7A 1C3OB 2ASEA 2PWAA 3ND5A 1Z6YA 4RHFA 1A2QA 1XRMA 1YRHA 3NBYC 3K6SA 1KJ9A 2J7KA 3SP1A 1Z8NA 3L1JA 4CZ2A 3FNFA 1FIUA 4PYLA 4WK2B 2EJTA 3FIJA 4P9NA 3LUGA 3PQ6A 4LRWA 3UJHA 1SHTX 4KRYA 1X19A 4TL9A 1UR5A 3L1IA 3BVPA 3E61A 3WJ7A 1WEKA 5CDGA 1SFRA 5CH5A 3VHXA 1FXUA 3GD7A 1I1QB 5JUWA 1URPA 1YE5A 4L7QA 4OQ4A 1MHPA 4G5FA 5MGBA 1B8PA 3AJ9A 1OXBB 1P31A 1HM5A 1W0KD 4ISBA 1WOMA 1Z56C 1XVIA 4P4TA 4V3CA 1EHYA 1TCBA 1YBMA 1HE3A 2PGDA 2AI1A 3OPMA 2BGLA 2FPIB 2X2FA 2VBFA 2MSKA 1KNQA 3UFBA 5KYWB 3TBHA 2IPXA 2UVPA 4Q03A 3BTSA 1RJ9A 4MUEA 1GQFA 1NU6A 2OKCA 2X9NA 3FRHA 1SEPA 2FB9A 4EQ6B 1FNMA 2GAFA 4H6WA 5HF9A 1Q3HA 4JENA 4RIHA 2HSDA 5FLKA 3LUAA 1AQJA 5AHRA 2FW8A 3QSGA 4B3JA 4ASUA 2WNIA 5EN4A 3ORFA 1QANA 2QTRA 2XWBF 2B61A 421PA 4D8VA 4GGPA 3PWZA 1CZKA 3GL9A 4MW1A 1EFRD 4Q4AB 3ZBPA 1FQWA 1T6XA 4FEYA 4TLAA 4QRHA 1F0KA 2XCUA 3U7JA 1A5TA 3PNQA 1ODJA 2H2FA 1KSFX 1VE3A 2NUPA 2WTXA 3AM5A 1U04A 4FJ2A 3E9EA 2R1VA 4B4UA 3CSSA 3D5TA 2J33A 3DZGA 3E9ZA 1XAJA 4GEKA 4A2PA 4JSTA 3EWNA 3SQLA 2IHYA 5CB8A 3AG6A 1KZ6A 3TCKA 1ISSA 3M34A 3KQOA 2HMTA 1FW8A 2VWQA 1ISJA 3KQNA 3H65A 2IF2A 3OZTA 4NDZA 3OZGA 3VR1A 4CL2A 1I2AA 4FQ8A 3KSAC 1Q77A 4TRJA 5SZJA 1F7VA 1CHNA 1SBHA 3LY8A 4P3PA 1JIJA 4LUCA 4HNTA 3OQIA 1P1CA 1ZP6A 2DPYA 1KVTA 2JFGA 2WFMA 4UUBA 1IB6A 3QX7A 3P26A 1T6YA 1YR6A 1E3WA 4GI1A 4ZT7A 4B33A 3NS7A 4ZYLA 1N5LA 4DB4A 1P0QA 3GN1A 4NS4A 4RZUA 1FDRA 1KDPA 5DSZA 2WHPA 1RPTA 3IEIA 4WRRA 4L5CA 3H3FA 3PC3A 5FTMA 3UMSA 2WTNA 3X1XA 4DRZA 1M1NB 3WYGA 1P6XA 4B6RA 4EFMA 1Z5ZA 4DLWA 2QN9A 2R8RA 1DLJA 2DGDA 4AKIA 3WAJA 3V2UA 3R24A 4N6NA 3EBLA 3IP5A 1H23A 5EIBD 1IEVA 4JP5A 4WOPA 4QLAA 3U6BA 5IUNC 2IIQA 5DBEX 3MQFA 1Q19A 5F5LA 4FKMA 1NWHA 5J63A 3KAPA 1VXOA 1EP2B 3AI1A 4PYNA 4M0LA 3D4IA 4ITRC 4C7KA 1SOAA 1M8JA 3NAZA 3PUWA 3EZ9A 3KVOA 2JAPA 4W6QA 3FWPA 3JQCA 3MTJA 2B3DA 3P9ZA 3T4PA 2PYIA 3FCAA 1M8GA 1HG0A 1HSZA 1LK5A 1JIVA 3D8BA 4RS3A 1JHMA 2VHXA 1PSWA 1BX0A 1FFSA 1DTEA 2C0PA 3EEFA 1EGHA 2F67A 2NWQA 3DV9A 4XIFA 3KXPA 3WP1B 2QM3A 2IY8A 2OGTA 4BMYA 1TZJA 2R6AA 1I7LA 3U4IA 2HT1A 3DE1X 3JWHA 1U2DC 2QTMA 2YZNA 4PFQA 5FAXA 3ZJ5A 2DY0A 1T4DA 2GNPA 3TNDA 5KYGA 3FWHA 3ZD9A 1WSBA 1BHO1 3AVOA 3GEHA 5SY9A 4YT4A 1G16A 1GZUA 1CTQA 1PEKE 3CRW1 4JEHA 1E6KA 4R2WA 4WA8A 3DMTA 3BJZA 3IXLA 3ZPXA 1QIJA 2JA1A 4UU1A 5FBZA 4UHDA 2FPIA 3A3YA 3UV6A 1PGNA 1U9IA 3C87A 4RZXA 3TM5A 2OUKA 1SBTA 3RPEA 1L8QA 4ALMA 1SPBS 1U0RA 3N07A 1ZUNA 2Y1XA 2E49A 1O97D 2RJOA 3DMGA 5IASA 2EG9A 2P7IA 3CM0A 2FRXA 1C0EA 3PF8A 2FJUA 1N2SA 1U1GA 5BYBA 1DARA 2ZT7A 4MDHA 4MIKA 4TT8A 5J23A 5EYPB 2DX7A 4EO7A 4I46A 2I91A 1QFJA 1TQ4A 1X92A 4I8XA 4XGNA 4A27A 3CBGA 1RM5A 1X1BA 1L3BA 2C5GA 5GTDA 2XEDA 4GQAA 3S40A 2ZULA 3T38A 3Q7RA 3F4LA 1VA4A 1CEXA 1WE2A 1Y8QB 4OYLA 2RK3A 1RXWA 4KAFA 2L69A 1ZN7A 1MQ8B 1BN6A 4L4SA 4LDJA 2JJ1A 1QJ4A 3I2IA 3FCXA 4DHWA 4JMLA 2VUTA 2G77B 1YDGA 1TKRA 3MIIA 4DIKA 3LBYA 5JQGB 2PLWA 4NQRA 1FB5A 1FU7A 1M0WA 3FWNA 3GRAA 4G24A 1KYWA 5GIPE 2W6CX 1Z38A 3ORRA 2MMGA 5EYPA 1DZIA 1O95D 3OTWA 1DHRA 4H6PA 1VG0B 1U0OC 1RI1A 5F12A 3UMVA 4ME6A 3LUBA 4P2GA 5JEEA 4MW0A 5IAOA 2GN1A 2IEZA 3A1UA 1DIGA 1EINA 4M9CA 4PLVA 2Q7OE 4EYOA 1DLIA 5LQSA 4PFSA 9LDTA 2GBFA 1F4LA 2PLNA 5CLHA 1UFOA 5JQWA 2NN3C 4BVGA 3C7DB 2AN5A 2CLIB 2G5PA 1CY8A 1Z2NX 2DTDA 3BCSA 1FOEB 5E1OA 1RR6A 4D92A 1JKJA 4EYQA 2BBSA 4RD6A 1NWCA 4MJ7A 4R9UC 1LZLA 3GOQA 3ZHYA 1CQPA 3ZHOA 4LN1A 2I3DA 4YJFA 4BNTA 2FEAA 4FP9A 4E2XA 1CDEA 1SIWA 1F2TB 2WM8A 2XITA 3IAS6 3P2OA 3QLEA 4GX0A 1VJDA 3U9SA 3WKAA 4AJOA 4D02A 4DMCA 4F4JA 2XSZA 1C0IA 4Z7JA 1VL5A 4X1KA 2HZ7A 2PGNA 4EBFA 3DEIA 4ENPA 2IQ5A 4YC7A 5D51S 1LVGA 4R16A 3TL6A 4BQIA 2KI5A 3OCWA 5TGZA 4QU0A 3EW9A 3N28A 3HTXA 3U1BA 2XD9A 4HEHA 4PRLA 3CVXA 5COQA 2FN3A 3AESA 3WK4A 2FRDC 1BDIA 3L6UA 5DI3A 4JI5B 4TYYA 5IC5A 1YDMA 5KVQA 5HIAA 1Z0AA 3TB6A 2CW5A 2VP9A 2EQBA 3O4RA 1P4RA 1QGDA 5LLTA 1J0BA 1SC6A 3B3AA 5DGHA 5ICMA 4HGRA 5FBQB 5H3CA 5EG5A 2LP4Y 5K6RA 3ADBA 3AU9A 3RS4A 1T3TA 2P3OA 3OM8A 3STTA 4BO8A 4FYYA 4MQEA 4M7WA 3UVEA 1TJYA 3UPDA 3VZQA 1LBEA 4PHTA 1AMOA 1KPIA 3H9QA 3AU8A 1K7EB 5F33A 5AT1A 3CUVA 1VKRA 1V5FA 2WSIA 1VYUA 2M6LA 1D6SA 1T35A 3VDNB 4EJ6A 4RA6B 5KDOA 1GRQA 2V8BA 1WY5A 1KQGA 1CNFA 3BM5A 3EIFA 3L0PA 1T4MA 3NHUA 4G4JA 2PWBA 1U2PA 4O2BB 3VPCA 2QVXX 2BFNA 3HV0A 3OFSA 4AKSA 3VTFA 4WKNA 5B58C 3UKOA 1HA3A 2OXRA 1LJ8A 3ZD7A 3RS5A 2C31A 1O0BA 4IIUA 4B7XA 2JARA 4ENWA 4Y2GA 1SVWA 1Z17A 1GSOA 2DBRA 2W2OA 1ABFA 5FRDA 4PNEA 2YQ4A 5JVDA 3DM9B 1EYZA 3I2HA 1ZNZA 3C8UA 4H3HB 3HBLA 3MCUA 4ZODA 2QENA 1USKA 3PXEA 4WCVA 1Q1ZA 4PO8A 1BXKA 1AUOA 2HWUA 3HJAA 4MI6A 3TSZA 1KEZA 4FXPA 4MMYB 5DRTA 7REQB 3AHHA 3DEYX 1GNSA 3IP9A 2XUJA 4WXYB 4OQDA 3TLJA 4FC6A 2ALJA 1C4WA 3GGCA 4D0LB 5C7OO 2QPAA 5FBKA 5T3YA 3CH5A 3R9KA 1M7GA 1NYTA 1AC5A 3EQ2A 5HUJA 4JC0A 3VOSA 1TEVA 2YWRA 1QGUB 3TXYA 2ZUEA 2IP2A 3GJSA 1KETA 1R0CA 3ILXA 2C29D 4BZXA 2VBCA 3A9VA 4DSUA 2E0IA 2V58A 1N6NA 3H4MA 5KSPA 4EQ6A 3TLCA 1V47A 3NTOA 1A8IA 2YW2A 1DQZA 2YXNA 3MLAA 1MC5A 2VLBA 1OBVA 1X7DA 1ZYUA 2QTNA 2KLHA 1JZQA 3FI9A 3QKSB 5EHZA 1PW7A 2HO5A 3Q7IA 4ND8A 4QQ8A 4F85A 1XF1A 1MV8A 4D6YA 5B58T 1OT3A 1W0CA 3DO5A 3K4QA 4MYUA 5DNWA 3G9QA 3KLBA 1CF9A 1P9NA 2GZMA 1P6QA 1EHIA 1EXWA 1R9NA 2EZ8A 1U8FO 1VMEA 2ZRDA 3QEOA 1EGQA 4OSOA 1LPNA 4DLNA 3RIXA 3K73O 3NLLA 3QBVA 3H2HA 4B0PA 3GZJA 1FSPA 4NYJR 1RYEA 3KQMA 4ZTZB 4K1XA 3RFCA 4BWFB 3ANLA 4KXFB 4B83A 2Y1FA 2OESA 4B45A 3V3KA 4V38A 4C6TB 1VLLA 4M88A 1G3IA 4OJQA 4F38A 3DMYA 1AY0A 3RB8A 2ZYUX 4IPTA 3CLRD 3HDHA 3A26A 3I0MA 1D4AA 2HHAA 4DA8A 2ODAA 5TMEA 3NATA 5CLFA 3MPOA 2V9PA 2O59A 2NX2A 3V7WA 5LQAA 3WLIA 3Q7TA 1Z4IA 3MTAA 2W2MA 4BNDA 1N5KA 1QQTA 1W6UA 3GC6A 3ZCXA 3U49A 3ZVRA 5L40A 2Z1MA 2XCIA 4FDTA 5ERGB 3ON5A 3UK1A 1WV0A 2PD4A 3RKUA 3R3XA 4PGAA 4EEXA 3PITA 2BKLA 3PQFA 3W2GA 3HM2A 1VSVA 1XDGA 1YNSA 3HB9A 3MGBA 1V2GA 4ZV7A 1YZTA 2EG5A 3KKEA 1GT6A 3V8PA 3ENKA 3SAJA 4HEA1 2AA3A 3Q9SA 1M2VB 3TCNA 3OMXA 4XVUA 1G2QA 2QXYA 3EZ7A 3NT2A 1V26A 3BRQA 3NHZA 4BX9A 2ZVDA 3O2JA 4WJLA 5F73A 3VAAA 3CCBA 1AKVA 4TZKA 3OUUA 3K92A 4A8TA 3H7IA 5EQDA 3DTNA 1EM6A 2XQFA 4BLRA 4U2GA 5K0FA 4B80A 4RH3A 4ZEOA 2JK1A 4G5GA 3ITEA 1TADA 2I03A 4ZOCA 5IKEA 2AQKA 3VVMA 4WKGA 1UMDB 3C5CA 3BD7A 4Q4DA 3V8EA 5BVHB 4QD3A 3AIOA 3LAWA 2N47A 1DQYA 4YRKA 4LY3A 4UVHA 5K45A 3MD0A 1DJMA 1UFVA 5KOIA 4IJMA 1G2PA 5AJUA 4DQKA 4YRSA 2NZJA 1YCFA 2R2GA 4NX2A 3AL3A 4H7FA 3GLIA 4LPSA 2V7QA 3I0ZA 1SR8A 3OCJA 2YYAA 4D8XA 3DF7A 2VHTA 1TC1A 1YI8A 3NBAA 4L0QA 2B5OA 3K9CA 1NW9B 4DIDA 3G2PA 1YC2A 3PSHA 4MH0R 3M83A 5JPIA 1PD0A 2YYYA 3F6EX 2EATA 2W7TA 3L8CA 4RLFA 3EAGA 3LPAA 1QO9A 4QFCA 2XUDA 1K7YA 2NOAA 1STOA 1FBTA 1L5YA 1SUPA 1W9MA 5ALFA 1MVLA 3KXKA 4TV9F 4I50A 2WVGA 2VJBA 4IYRA 2GX6A 5A62A 1DKPA 3PFBA 3X1YA 3L7BA 2GKOA 4BNUA 4TPKA 1SB8A 3W7BA 1XTJA 1YHNA 3N2LA 4LOIA 1U3CA 4MW4A 2QX7A 1G5FA 5AW5A 3VU8A 1V41E 1VIDA 2D06A 4OHOA 2XCTB 2NP7A 3KOZA 1NXPA 4CDGA 5K8JB 4S2EA 3A04A 4TSRA 4RU1A 4F04A 4ZEWA 4XRRA 1OZ0A 1P7PA 2J5RA 1E2PA 3D3QA 3TQCA 2FWIA 3ETGA 5A9TA 1N2BA 2LXNA 3JQAB 4EG3A 1DQPA 2BFDA 4TLEA 5FNVA 4YMVA 1BNCA 1QG6A 2WSSA 4JLPA 1J6UA 4KR2A 4Q3DA 3U7GA 2FW6A 1XKXA 3AT1A 4LRXA 4OQLA 3NBXX 2RSLA 3QNMA 4EOGA 3TIXB 3SZGA 1T5SA 1YO6A 3S99A 4AMUA 5AVWA 2JCVA 5K8UA 2YV2A 1J2YA 2WHYA 2J0UB 3CUTA 2EZ9A 4LQCA 4BNGA 5JY6A 4EY8A 2X1MA 3GEMA 2GILA 2ZCJA 2IGBA 2HEIA 2QNBA 1U2GC 2H1HA 5BPHA 4F6LA 4Q3EA 4N03A 3ESAA 1TYAE 4X90A 4D4KA 1JDTA 2VNIA 2PAAA 1O08A 1WM1A 2A94A 4E08A 3QUAA 1F2UB 1XEXB 1RZ3A 5I5EA 1KBZA 4BRWA 4QQKA 2DULA 4KKVA 5EWJB 3D0OA 4WVLA 4CEIA 1U8ZA 2BIFA 1TI7A 2C5EA 3IVXA 4MUKA 1KQ3A 4TYWA 4JJ6A 5E7IA 1QRUA 3MT0A 4X60A 1T3SA 3OZDA 4V0QA 1UWCA 5HCNA 3LX4A 3U40A 4OUDB 3H2SA 2CVQA 2V5UA 2VRBA 5FL3A 3O92A 1PGOA 4W5QA 3RHSA 2GEVA 5BOVA 1EFCA 3U81A 5A3RA 1I0ZA 4XWWA 4NMLA 1Q5PA 3T9BA 3WQBA 1T2VA 3P0RA 4BRSA 4Y2VA 2HUNA 3ROPA 1Z6XA 1N2OA 2NPIA 4I1IA 1QQAA 2YWBA 2PL1A 2GAJA 1E20A 1IY2A 2QL5A 2ZYTX 2XUGA 3DTVD 1AGYA 3L0SA 1C7IA 4NE9A 2ISQA 3FRIA 2Y9PB 4O4IF 5LC1A 4C7VA 5CYGA 5CFQA 4B8YA 1AQUA 5K51A 4DC9A 3MLEA 4Y9DA 1ACJA 4HMQA 3OPVA 3S8EA 2WD7A 5E6RB 1I1NA 3WLNA 2F8MA 4EW2A 2GWRA 4M54A 2EWMA 1C4KA 1NBEA 3AFMA 1K75A 3WRVA 5FA5A 2RKBA 5HTKA 4GP7A 3MD9A 4PBRA 4ZDIA 1OA1A 4DMRA 4COOA 2IYQA 5GGYA 2IYVA 2V6FA 3JAKB 4LZJA 3FUVA 4RHEA 5F2KA 1DCTA 2F43B 3W3AD 5C8YB 3PNMA 4M89A 3V9AA 1TD1A 1QCYA 2HBQA 1LLCA 3KNZA 1T6NA 4IAOA 2R84A 4RD3A 1XU4A 1ZCBA 3IKJA 5A5DA 3PGMA 5K6AC 2QRPA 4PANA 1P81A 2VHUA 4E4YA 2HL6A 1JEAA 3A2NA 2WIFA 3JRWA 4XIGS 3HZRA 3KKQA 2NACA 4HATA 4H1UA 4ZAVA 3M4YA 3LCCA 4UATA 4QTZA 3DYVA 5IDYA 3MRXA 2AUNA 5FFFA 1FMJA 4DLRA 1N78A 2O5EA 2AYYA 4AJNA 3GAFA 2Q5LA 2Q1SA 2GDJA 1N5OX 3G1TA 1QHFA 4U5XA 4B6GA 1BCRA 5JS2A 1QBKC 1MEJA 2A0YA 2PL3A 2RAUA 4U9IS 5B2ZA 3VR0A 2G72A 4Q4HB 2AN1A 2PH5A 3VC3A 3IUMA 3NH6A 1QVVA 1I6KA 1APBA 4FGLA 5DW3A 2RB5A 4G8JA 2NYVA 3K7EA 3V2IA 1E2JA 4JI8B 4H7DA 3HE3A 3UMRA 3UXYA 4QYMA 5CVVA 2VJMB 3AYZB 1X38A 4EG7A 4WZAB 2WQ6A 1WB9A 2INGX 1AKEA 1X2EA 3KO8A 4PAQA 4RLQA 1O1YA 3JQ6A 2B37A 1DBSA 1Y1SA 1RWPA 2FWJA 2QORA 3RQSA 3SR3A 4YMUA 2Q2VA 4FT4A 5A6VA 3T9AA 1THTA 3SN6A 4R6WA 1RYZA 3DO8A 2H0RA 3IBCA 4GGOA 1MUUA 2QI9F 5JXJA 2UUPA 2ZQYA 3L77A 2ZU0C 1WTAA 4HDAA 1AKNA 3UMFA 2PMCA 5IEBA 2AC4A 1P1HA 3DNPA 3DXZA 4UJ3A 5D3QA 5DGTA 3KEFA 3KTAB 5FR1A 5KKCA 3C7AA 3EFEA 4NAVA 3NVAA 3H17A 1GTZA 4ZHQB 2BOVA 4PAOA 4K9KA 1GPWB 1EFKA 3Q6NA 5KKNB 2M6SA 2XCRB 4CR7A 1B7GO 1NI4B 1UC8A 5I7EA 3NVDA 2X15A 4BVEA 1T8UA 1UCFA 5KTYA 3DAFA 4US2R 1GN9A 4JQYA 3JQAD 1XHEA 3BH0A 1ZIDA 4AZ3A 5CBKA 3H2YA 3NKFA 2NU7B 4B9EA 1C1YA 2D2EA 2RAVA 4PQGA 2FPGB 5EE5B 4RA9A 4LRUA 5AJHA 2PRYA 2W2KA 3QV2A 1OJ7A 1U8CB 3K31A 1SQFA 1JMKC 3OLCX 1HQKA 4RABA 4RW0A 5LZ2A 4LF8B 2ANCA 1MA3A 3IAM6 1YBAA 1DKRA 1RLMA 2W6ZA 1EBBA 3FROA 2V45A 1I94B 1AS0A 3PRKE 1KHTA 2HU2A 2YFKA 2YH2A 2ZRAA 3NDPA 5ALUA 3SYKA 1HPLA 2OZPA 3K1ZA 4EY5A 3KLPX 2HO4A 1QX4A 3SPXA 3JTMA 1N6KA 4E5DA 3RFFA 3ZX5A 2IYNA 1Z0ZA 3QLVA 1YUBA 5DE3A 2CLDX 1XJQA 3OETA 3FCCA 1QHYA 3G5TA 3V8BA 4R71A 4RDIA 4A36A 2FSSA 4AJ1A 1V4BA 3LUHA 5HILA 3ZKAA 4DDUA 3EVZA 3Q8KA 2WJAA 1H94A 3HV2A 4NULA 4I4TF 3KEGA 4IHJB 4V24A 2C83A 5LQNA 5LYYA 1AUPA 1EFHA 4V0OA 1N2IA 4MQ6A 5CB4A 2Z08A 5LD2B 4V1CI 1UBMS 4IIEA 3VZSA 4Q7LA 4QWMA 4YHBA 3UT0A 1QMGA 1T8SA 2WF5A 1BH6A 3B7PA 2J9ZB 3OCCA 4YCJA 4FMCB 5F21A 2FPWA 4G1CA 2I9KA 1G8PA 1ZL0A 2P3LA 3CR7A 1LDBA 4A8HA 1F3OA 2BFEA 4LGMA 5TRTA 3V1YA 4KV9A 4BX2A 1OAOA 3EBPA 4JJIA 4TXHA 1Y3IA 4L5BA 1U1DA 3CX6A 1Z28A 3CONA 1PEAA 2C3OA 2JFQA 3I34X 3EPJA 3JVDA 2GHRA 1W73A 1XQWA 1L1FA 5BRNA 5BWOA 2P6UA 4CQNA 1CQJA 3AESB 3IVRA 2VTBA 4RVNA 3WLSA 2ZBEA 3NKLA 1PI3A 3PTZA 1DB3A 3WIEA 4A10A 4MVJA 1LPMA 2HA5A 2MR5A 2XDQA 1AO3A 4E15A 3L8HA 4EGAA 521PA 1P4SA 5ENDA 3F5QA 4DIFA 4OH7A 3UAWA 4NFLA 5DSXA 5HW0A 5AJWA 3RSLA 3I01A 1I01A 4IRUB 4IQ8A 1QV6A 4DPKA 2C4TA 4UCQA 3QKIA 3YASA 4Z0PA 5FUMA 2FP4B 1Z16A 3W3ZB 2ORIA 3O94A 3ZDBA 3F46A 4KACA 1WF6A 4K46A 1BQ4A 1JHDA 1S1MA 2AOVA 1AF4A 1J7KA 1X7YA 2Q6LA 4Z3DA 5BQ3A 2AKEA 1JPNA 3IAS1 4LXIA 4LK3A 1UL1X 4PEVA 5B1HA 3PQ2A 3DF9A 5CJ2A 4Q7MB 2V3WA 4UNPA 2P65A 2HDHA 3Q7QA 4C2AA 2GXAA 1L4BA 3OZEA 3EFBA 2VDMB 3DZKA 4ER7A 2Q5JA 4F2PA 1E0DA 3WGTA 4FR2A 4YROA 3NTUA 1T26A 4C7OB 3A6KA 4B81A 3A6JA 1I3KA 4CM7A 1HBJA 4G0QA 3RS3A 2BV3A 4JP1A 5A0FA 3B1YA 4BRZA 3HJHA 3TKLA 1C9YA 3H5RA 1CY0A 1VPVA 1NJ1A 4FHFA 2QVLA 3IE0A 1HE5A 1X3SA 4W82A 1N2EA 2BMWA 2JAUA 3DMTC 3IALA 2NU6A 4OQEA 4JWTA 1KPHA 1O03A 2DKFA 5F64A 3WIBA 3X1JA 4BBPA 4C0LA 4YAGA 2ZDQA 3QTBA 3HACA 3U48A 1ZBDA 3AW9A 4OMDA 2GCEA 3K70B 2WE8A 4CUKA 5EJ7A 2YQ5A 3SDBA 1ZG3A 1NQOA 3CRMA 2IOYA 3OQHA 3SHWA 3FFWA 3WKCA 3RFXA 4BLSA 4OHXA 4ZT3A 1GFZA 2EEPA 5AHKA 5JCZA 1O6CA 5FX2A 1ML4A 1QKIA 1N8NA 4ZVLA 2ZJFA 1R66A 4CQLA 5LMCA 3JCZA 3ED5A 1I6WA 3DB2A 3GROA 4IF4A 1IVNA 1QGOA 3AUJB 4R8LA 3WLQA 5DHAA 3EZ2A 2A1TR 4BU1A 3KYDA 1C1DB 4BVLA 1FP4B 3GK3A 1XZPA 3C7CB 1CJCA 2PNFA 1LPSA 2QX6A 2SNIE 4X7MA 4D80A 2O8BA 1PT7A 3VPGA 1NIJA 3BD9A 4LCEA 5CTAA 3JVVA 5JY1A 4F71A 4CW7A 3HNOA 1GGJA 2JFOA 5KJ1A 4PSAA 3ZV4A 3ESQA 4EPWA 3E3NA 4ESVA 1U6KA 2JFXA 4GC5A 1GGMA 4UQLA 2B8JA 3IA2A 1XTQA 4BMDA 2XXAB 1XDBA 2QGFA 1ZZGA 1TUBA 5U4QA 1X9GA 3DGEC 1DXQA 2C77A 2J32A 1GTJ1 2OEPA 1QIEA 4ZRMA 5AM2A 4HSEA 1OR8A 1ICIA 1O8CA 2DHCA 2YZGA 3DCIA 3K2QA 3NBFA 3OJ0A 5D7NA 2ZM6B 1ONSA 1JQ5A 3DDZX 3HK2A 2MSWA 3VNAA 3QYAA 3NWEA 1ELOA 2YWCA 4TUYA 2CZQA 1Y80A 1CS0B 2R6CA 1RJ9B 4AS3A 3ZI0A 3HCCA 4R7TA 4WZBB 1W4LA 3KLNA 4GP9A 4L3OA 3VPXA 4E12A 4M4SA 3A0UA 4DIBA 2VF5X 4NFYA 4X00A 4TLCA 4A8JB 4BKRA 5E0KB 4FFBA 3I5XA 2OAEA 3SDSA 1PJZA 1SUBA 3DXFA 121PA 2XGSA 2X19A 3GVHA 4N1AA 1G0NA 2HIHA 3LO8A 2BUAA 4R2LA 1E77A 1FP4A 5A2QA 3PDWA 1G41A 2C7OA 5J2TB 4QTXA 2JHAA 4NP6A 5FI1B 2JFFA 1UMKA 1ZD2P 4DSOA 2BFCB 4OP3A 3NIFB 4HTFA 1TYZA 5JD4A 4QXAA 2XE8A 2AW3A 4K40A 5AVJA 3OT1A 2FWMX 3W05A 3DDUA 3PEEA 3IPAA 4K1LA 5JS8A 2KB0A 1GKYA 1WUYA 2ACKA 3CVJA 3KD2A 2XUFA 4P33A 5GONF 1H9CA 4TXJA 1USGA 1K3FA 1ZL2A 1PR5A 4HWRA 3PRJA 2AG5A 4QT4A 4F92B 1C80A 1QAQA 1H2XA 1Y5MA 2XNSA 4Y2QA 3KVRA 2V7EA 3BJIC 2WA2A 5JSHA 3S44A 4UMDA 4YMSA 4NKRA 4DE5A 1J2RA 4OIMA 4YCCA 1GTSA 2X1LA 3D6UA 3RHTA 1RLTA 4S1WA 2FVYA 5AW8A 3AM3A 1IHDA 1MRNA 4L8VA 3V8RA 4JP3A 3KUDA 3RDPA 4R8SA 1DQSA 3VSAA 1JH8A 3AIKA 2X41A 1LF5A 2ZJ8A 3B5IA 3TX6A 4LJ5A 3BQNB 5IC6A 2PY6A 3HEAA 3TECE 1CFZA 2H2WA 1KR2A 4LGYA 3TEMA 3VV3A 5HHTA 3AR2A 4C1BA 2XZTA 5I45A 4N41A 4C4PA 2GZ3A 1K8RA 3L1HA 6ABPA 4Y2JA 1XKQA 3NRBA 4CM9A 5JD6A 3DQZA 1T36A 3FXAA 2H1SA 4X1KB 4CLRA 4K87A 5FF9A 3OM9A 3UF0A 4N76A 2DZDA 1GILA 3SICE 1DFIA 1OBOA 1GFWA 1Z6ZA 3QQPA 4WKCA 1VI2A 3ETNA 4MLCA 5BWCA 4YLEA 2C1ZA 4YP5A 3RVBA 4CG3A 1OV6A 4IXNA 2I67A 2NV6A 4OJMX 3ZGZA 2Y1EA 2IXFA 4YRNA 4UDXX 1U90A 2PCJA 5CCEA 4YALA 1TU0A 5TQ2B 3DMFA 1MDFA 3R3JA 3LVFO 4Z9XA 3GAZA 3H18A 3UYKA 5H9WA 5HTOA 4O2BF 1A2KC 1RRVA 2OG1A 3DCYA 5E8RA 2PS3A 3PEUA 4O4LF 1S01A 2QJWA 3H97A 4FGSA 3LQYA 1ODSA 4AUNA 2QIPA 4B44A 3ER8A 1USVA 4DLBA 3HCDA 3NB0A 4JI0B 1G63A 2B35A 1QE0A 2H06A 4AI6A 1H3EA 2ATEA 2JIBA 4HUJA 4LYYA 4MARA 2JG3A 3MJHA 1W46A 4KIWA 3VNSA 2BHSA 1PZNA 1OYYA 3L1KA 4HWTA 2OMEA 1PV4A 3TE7A 1GYPA 3ZWVA 2X4GA 1CU1A 5DM0A 4CKWB 1I0IA 4PQEA 4AF7A 4MV0A 2WJWA 2AIRA 2J3KA 5ILOA 3O7WA 3E23A 4OK6A 3VPFA 3KR1A 2UUCB 2OL4A 3FIUA 5EJ6A 2FPPB 3DE7X 4HDOB 5HDQA 3CLTD 3THOA 5B55A 3ICPA 2QTZA 3LRXA 1WCWA 4X1IA 3LXRA 2ZYSA 1QKKA 4TWAA 4DA9A 2FJ0A 2Z8YM 1T25A 2HV9A 5F7XA 4KR3A 3M1LA 2UDPA 4FMBB 4UEOA 3HA5A 3UGQA 1UBRS 1Z5GA 5L3ZA 3J80A 1ZM3A 4JJAA 2WZQA 2O5RA 5E6UB 1QTIA 2Q99A 3GDOA 1N34B 3LWBA