1S9DA

Arf1[delta 1-17]-gdp-mg in complex with brefeldin a and a sec7 domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
161
structure length
155
Chain Sequence
b'MRILMVGLDAAGKTTILYKLKTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-Ribosylation Factor 1
publication title Structural Snapshots of the Mechanism and Inhibition of a Guanine Nucleotide Exchange Factor
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein transport/exchange factor
total genus 54
structure length 155
sequence length 161
ec nomenclature
pdb deposition date 2004-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s9dA00
1C1YA 3HDTA 3WNBA 2MMCA 4DC9A 3VR4A 1KAOA 3Q7PA 3AVQA 4B3BA 1MR3F 4N0DA 2IYQA 1E2HA 1IXZA 4IDQA 5DN6D 1XX6A 1SXJB 4DJTA 1KYIA 5A0FA 4EUNA 3KQNA 2ATVA 3IILA 4DDUA 2KI5A 1K5GA 3NC0C 4OJKA 1KSJA 4CT4B 1JI0A 4ZIRB 4HAZA 4CYMA 1KOFA 1L7VC 3I32A 1T5LA 4Q21A 3K1JA 1G19A 2C95A 4JKYA 2OESA 5KDOA 1GRNA 3GLHB 3JVVA 2ZRKA 3HU1A 1NN0A 1XJQA 2QSZA 2E1RA 2GZAA 2ZAOA 2XTZA 3KXLA 4LWZA 3W6OA 1AKEA 1D9XA 1F2UA 3SC3A 2VP6A 3QNUA 4JLOA 4LJ8A 1K8RA 2XTNA 4B3GA 1ZU4A 1TUEA 3AVVA 2VL7A 3P1JA 3HR8A 2Y8EA 3AKCA 2VYFA 4URUR 5CYPA 1GAJA 2UVQA 4C0LA 2XXAA 4JLAA 4KU4A 1OXVA 1IJEA 4XD7A 4BLPA 1KI3A 4Q00A 4HB4A 3LXXA 4HSEA 1ZAKA 3DL0A 4ZO4A 4URZR 4ESHA 4RZUA 4DDWA 4PC3A 5JSZB 3OIYA 4RD2A 1U81A 2ZVQX 3ZQJA 1OT3A 2IUUA 3CB4A 4AG5A 4GZLA 1KJWA 2BMFA 2QA5A 3SNHA 1RPZA 2CHGA 4LBZA 3NC1C 3EC1A 1R0ZA 4IFEA 3ZVMA 3CR8A 3L8YA 1P9RA 2VP0A 1LS1A 4KYIB 1MABA 5EP1A 2O8CA 5KO2A 3WRXC 4MDEA 1EX6A 3CRVA 3P4YA 2R9VA 2Z6VA 3LXRA 3CPHA 3AH8A 5DNYB 1P2VA 1N0WA 3AP2A 3QEJA 1F2TB 1K6MA 4RSGA 4CEJB 1P9NA 3FVQA 2QMUA 3LBNA 1NLYA 2BEJA 4Z1MD 1XMVA 3KB2A 1ZJ6A 4KLZA 1IAQA 1MO3A 3BE4A 1LFDB 2WVJA 3OESA 2ZRDA 5IHPA 2WKQA 3QQ5A 1L2TA 1UKZA 2C77A 1ZIOA 1E9EA 1N0UA 2P6UA 1DOAA 1NBMD 3LQQA 4RZ3A 2ZRNA 4GP6A 1KI7A 4L4UA 1NVUQ 2QM7A 1S9DA 1N0VC 3K9HA 3QE0A 2HF9A 1IN6A 2B21A 3THOA 5KSOA 1G5PA 3B5JA 5DHAA 1DAIA 3FTQA 1QHYA 1NL3A 3DZ8A 3I3SR 4LC1A 4MYTA 2FFAA 4OQLA 1KK2A 1W0JA 4FMCB 3X1WA 4I1SA 3TW8B 1T0HB 3O47A 4EIWA 2I1VB 2YC2C 4JLBA 1G7SA 1CIPA 1E9BA 2RAPA 3EZ9A 1G9XA 5KSPA 4ARZA 4HAXA 4RCZA 1UKVY 2NO6A 3KXKA 1QHIA 4C30A 3U3OA 5B58C 1MH1A 2J7PD 1QDEA 2RGEA 1FZQA 5JRJA 2AN9A 1XEXA 4L16A 1SVSA 1ZRHA 4JLPA 3LVRE 4HYYA 4TLCA 1NP6A 3CX6A 1QG4A 1GM5A 3LWNA 2A5GA 1YZUA 4FWIB 3LQRA 4OI1A 1A1VA 3WY9A 5JEEA 2V7QA 3ZVLA 1GILA 2KE5A 5B30A 2H17A 5EP4A 4C0QC 2IHYA 1E0KA 4TYYA 2P2LA 5D3MB 1UBCA 1U0JA 2DWOA 1XD2B 3CUEF 1E2DA 4MRPA 4AKHA 3QVVA 2R62A 1XXHA 1RJ9A 1W4BA 2PL3A 1T3LA 621PA 3GLGB 4CVNA 4A9AA 3RRNA 4DLRA 1IN4A 2QL6A 5EXXA 1CRQA 4EFMA 3OEHD 2QZ4A 5E3HA 4RZXA 1T3SA 2Z5FA 4NTZA 5TB5A 1T5IA 4V0OA 2J7KA 4B3DA 1KY3A 5EXSA 1KZGB 4LJ5A 1LVGA 3I5XA 4YONB 4JL8A 1G7CA 1KMHB 3ZS9A 5G3ZA 2WWWA 1BO6A 2WJHA 4AURA 4A2WA 821PA 3VHLB 4DT1A 2IS2A 4TQ9A 2Z0MA 3UMFA 2VSXA 5AWFC 3W34A 1TTTA 2NG1A 2IW3A 2J41A 4NH0A 3K09C 4URYR 4D80A 1HQCA 4TTQA 1SXJC 5AR1A 1IY0A 5FPKA 3B7GA 5DHFA 3AVPA 2RHMA 4PHGA 4US0R 5IDVA 2UZIR 2HCBA 3LD9A 4DUGD 2ZROA 4YMVA 4ITRC 3FYHA 2WIBA 2F7SA 3I73A 3REFA 3BD9A 2A3RA 4B75A 4NPHA 2R6CA 1XJ0A 1CF4A 1UKYA 3ICQB 3EIQA 1E9SA 4JVMA 2W6ID 1DG3A 3RC3A 4DCUA 1Q12A 2A2ZA 1M7HA 2ZI3A 5KYKA 3L82B 2D06A 3OHMA 4QJ5A 4Q4JB 1ZM7A 2JLSA 4JL5A 1EWRA 3VR1A 5FTJA 5H1YA 1P2UA 2J9RA 3RRMA 1HY3A 1E9CA 3GMTA 1C4OA 2FGJA 2MSCB 4OK5A 2YINC 2J59A 2CLCX 2QRNA 4DLXA 4U00A 2ZITA 2GXQA 4QBIA 1N5JA 2ZRCA 3U4QA 2C03A 4A6PA 3VR2A 1XP8A 2J0VA 2JJ2D 1Z0FA 2LWIA 3CNOA 1XF9A 3RS5A 3EZFA 5E4FA 1ZM4A 4H9GA 4WA7A 3THYB 3PEWA 1SVIA 3I72A 4QNMA 3BK7A 2PEZA 1U9IA 3WHKA 1RRPA 4AC9A 3HP1A 1P72A 2H16A 4W7SA 2DB3A 4A2PA 3AF3A 5L3RA 1VECA 1HEIA 1G16A 2P5SA 3GEHA 1VG1A 3AF4A 2QP3A 4F4JA 4W9MC 4FXPA 2VHCA 4V0ME 4B32A 4QJ3A 2P6RA 2GRJA 1DAEA 2GJKA 3VR6A 2CVHA 5L3QB 4Q4AB 3UXMA 1R5OA 1W0KD 4HLDA 1ZD9A 3THXA 3L0IB 4DLWA 2FFBA 1JR3A 3OAAD 4DKXA 4WIAA 2ZUBA 5SZIA 1OFIA 3D3QA 2EFEB 4B33A 1GKYA 1W44A 2QSYA 1P2SA 2O0KA 2JLRA 1AA9A 4A36A 2PLFA 2P5TB 5B64A 1DBSA 1VCMA 5TY0A 1U2RA 1JB1A 2QGNA 1DS6A 3L0SA 3OF5A 2ANBA 5AJZA 1M74A 4IFBA 1FX0B 1ZUHA 2BWJA 1CEEA 1SXJE 1WXQA 4ZCIA 2Z83A 2IF0A 2ZJ2A 2XX3A 3A1UA 3T06B 3PV0A 3QKRB 1J7KA 4KBGA 2W2XA 2ZI5A 4RKEA 1A2BA 2AWNA 4TL8A 3E70C 1WCV1 2BV3A 1KI1A 2JJ8A 2QENA 3GLHE 4LOAA 3X1DA 4BASA 5F9FA 2ZJAA 3QKSB 1G4UR 4P0TA 4EFLA 2OSBA 3LV8A 3EWAA 3KUDA 4EFNA 4DDVA 1P75A 2G3YA 3EZ6A 3K0CC 4CGZA 2XGJA 4DZZA 4G5GA 4QNRA 2CCGA 3IIMA 2G6BA 1GIAA 1NNEA 2ZXUA 1G64A 2PBRA 3NEYA 5FTMA 1AZSC 5FOSA 2CK3D 2WIAA 1XMSA 3SFVA 4B34A 1Z07A 3RS7A 2ZYTX 1VCNA 1EFRA 3B1ZA 1IOZA 1TADA 1NVXQ 3SQXA 1CTQA 4QRHA 1LTQA 3N2EA 3NWJA 3OE7D 3ONWA 2VHTA 3PUZA 4DLVA 2BJVA 1HURA 4LBYA 3SOPA 2Q9AA 4R7ZA 1CU1A 3GFPA 4WOPA 5KSYA 3V4RA 2GJ8A 4PPQA 2WJIA 4N1AA 4LJYA 1DO0A 3CIOA 4GRAA 4PPFA 1GWNA 4LK2A 4B76A 4AD8A 4MRNA 3VU9A 4MDFA 5LDDC 3RAPR 5G3YA 3Q7QA 2JLQA 1N6RA 3AQ4A 3O8DA 4Q1DA 4QL3A 1ODFA 1UBGA 1TEVA 4XWKA 2ZYVX 1HV8A 1KKMA 1VHLA 3WMEA 4HB3A 1SULA 2RGXA 4TYNA 3GLIB 2VEDA 1EFCA 2C96A 2N42A 3CNNA 4KBFA 5CDFE 1ZW6A 2BKUA 1HA3A 4KVGA 3PITA 3OEED 3VQTA 2E87A 4KJZA 3BH7A 3U3MA 5JI2E 1WQ1R 2PJZA 2QQ0A 4ZI2A 1HQYE 3MG9A 4Q9LA 2O8FA 4JBYA 4P4SA 4OL0A 2O8EB 4JLKA 2ZTSA 5DO9A 1PUJA 1G3RA 4Q4LA 1SHKA 3W3AA 5EXTA 1PUIA 4ASUA 3B82A 2Z4SA 3QENA 2NGRA 3DKPA 2A5DA 2FEOA 5GJBA 1T9HA 3A36A 4QBHA 2QY9A 2BC9A 2Q0HA 1W49A 3IQXA 1YKSA 1YR9A 1S3GA 1Z3IX 4DSTA 1W36B 3BIFA 3A1TA 3CLVA 1GTVA 5FI1B 3KFVA 4YMUA 3LFUA 4DHEA 4XVQA 1AS3A 4LRWA 3FOZA 3TR0A 4LCBA 1LF0A 2G0TA 1JNYA 3W9YA 4QHYA 3RANA 4KLNA 3PCRB 4DSOA 2VHQA 2JEOA 2PX0A 4IEEA 1E98A 3L8ZA 5BN4A 3U5ZB 3VNUA 3CONA 4UXJA 2H1LA 5DISB 1S0UA 1T4GA 4Y0AA 5KSZA 1RC8A 5E7IA 5JRZA 1NN3A 3K53A 1KO4A 3QI2A 3AP3A 5SZHB 3B78A 1O87A 1Q3HA 1XB2A 2YOFA 1GITA 2QQEA 2QMEA 3FFAA 4NCIA 2JLUA 3C5HA 4XOIA 1X1RA 3ASZA 4TYQA 2W2VA 3MFYA 4QXAA 1GUAA 1T91A 4LPSA 4PAMA 3KJEA 1JXMA 3T1OA 2W83A 1RE0A 2OLJA 2ZRHA 3TVDA 2WSMA 4E22A 4A1FA 2HT6A 4M1WA 4XVUA 2W6JA 3GLGE 4TQUS 4IHQA 4RCYA 2Q9CA 4B2LA 2HCJB 2XSZA 1G5TA 1RVDA 3PR1A 5A4JA 1YR7A 2ANCA 4OHVA 3QUSA 2WKRA 3HPRA 1FTSA 2AFHE 1S9HA 2VP9A 2JLZA 4F92B 4EQ6A 2XNDD 2C2HA 4OQNA 4OHYA 1QHSA 2J1LA 4PC6A 5ELXA 3AVUA 4HUQA 3EW9A 5CM8B 2AL7A 4D0NA 1SKYB 4LI0A 4Q1FA 1OIXA 1R0WA 3W5JA 3KQLA 5CM9C 3EPKA 3H84A 1H65A 3QBVA 1W4AA 4LHYA 1XPOA 1OH5A 2C9YA 2XXAB 1R10A 2BJWA 2KJQA 3P4XA 4JBWA 1US8A 4PZZA 1U99A 2J5XA 3WHLA 1P61B 1GL7A 4EPYA 2CLDX 4HAWA 5KHOC 2GAOA 2RGDA 1CR1A 4AIIA 3VTKA 4PZLA 4MYHA 3ZDQA 4BPBA 2EFHB 2WJVA 4HI0E 1VYVA 4P33A 4TMKA 1R8SA 1SGWA 2O8EA 2WWIA 5HKKD 4WVFA 1G5RA 5EUMA 3IPYA 4DLSA 3A6PC 1ZNZA 2C98A 1PJRA 1NY5A 4C4PA 3B60A 2NPIA 2IYWA 2WAYA 2O8CB 4E07A 3W6NA 3LA6A 1PLKA 2FF7A 1NJGA 2QG6A 5F2EA 2REBA 3AP1A 3QPUA 4HAVA 4IDOA 2DHRA 1WB9A 3OFNA 3ETLA 2F1HA 5JZVA 4MRRA 1Q1ZA 3TRFA 2J0UA 3KQKA 4Q1CA 2QRZA 4Q1AA 4TLAA 1YJ5A 3KKOA 1AKYA 2QPOA 2VPPA 2GCOA 4TN1A 3SE0A 3SS8A 1KI6A 2F9LA 1XWIA 1RRFA 2EWWA 2FSIA 2D2EA 2FNAA 2QTHA 4CEIB 4FMDB 4LPKA 4WXPA 5G40A 4Q5IA 1Z5ZA 1AJEA 1IJFA 5SZJA 1JQJC 3QPWA 5F3WB 2BOVA 3VR5A 2EVWX 3C14C 3C16C 4OI0A 3A4NA 3NBXX 3REGA 4L5BA 1XEWY 4I4LA 4PAOA 3NVAA 3A1WA 4UQOA 2CJWA 5AUPB 2GEVA 1IQPA 2ZREA 1FMJA 1SKQA 4XSHA 4WZ6A 3FB4A 4TTRA 1QHGA 2VF8A 3R8FA 4LHVA 5ANRB 2AK3A 1EFUA 4PHFA 3R7WA 4CZ2A 2QAJA 3T34A 1UFQA 3SR0A 1MRSA 2N1BA 2BM1A 3CZPA 3SYKA 3GQBA 4BZPA 1UJ2A 1KO7A 1N6IA 2VP4A 2BEKA 4D6PA 1UEIA 2QE7D 3MLEA 1AN0A 1NLFA 4TLEA 2G88A 1MO4A 2CXXA 2OBLA 3LY5A 2BCJQ 2Q21A 2HYIC 4UNSA 4MITA 3FDIA 4HATA 2IEYA 5HE8A 5EE0A 1YZQA 5K8TA 2AR7A 1FL9A 3F3YA 4KFRA 1XPRA 1W4RA 2GETA 1XD9A 1XXHB 3DZDA 1W36C 4IXMA 1ETUA 2VH5R 4BUJA 1GKIA 1TEXA 1VTKA 1CJTC 1Q3TA 4Z8YA 3GJ0A 4BEJA 4BGDA 3AVOA 1CLUA 2RB4A 1E1QA 1ZUIA 1M1YE 2ZE6A 2ONJA 2JGNA 1F5NA 3KKMA 3UIEA 1U90A 4HAUA 2WWGA 4TLDA 4XTRA 1FP6A 3FGNA 3LW8A 1QHNA 1II0A 3MAAC 4V0NA 1IN7A 1KDTA 1D2MA 2C78A 2IYLD 3R20A 3ZZUA 4B43A 4DT1B 1W36D 1HUQA 3MCAA 2ZRLA 2GBLA 1OSNA 2ODNA 2YC4C 5JCPA 2ZJOA 2CVFA 2H5EA 1M2OB 2VIIA 2FSGA 3QG1A 4KFSA 5AJYA 2B92A 2BM0A 4DEYA 4AKIA 3QF4B 1OXUA 1NVWQ 2RGNA 1R8QA 4G5RA 1DELA 4G3XA 1CR2A 3NBFA 3TAUA 4A0HA 4PANA 2ZANA 3RS3A 5DI9A 3I92A 1ZVQA 1JAHA 2OM2A 3PG5A 4LYJA 4ON9A 5CLQA 1MO6A 2OCAA 3KJIA 4ABYA 2FV8A 1J99A 5FBRB 1ANKA 3ASYA 3UG7A 4EKDA 2V3CC 3THWA 5IK2A 2VF7A 4PR0A 3HJNA 3GD7A 4PHHA 4KFUA 3GEIA 3CH4B 1NMZA 4M22A 2ZM5A 4BFSA 3KTAB 4GFDA 2BBWA 1H8EA 1HT2E 4A0FA 1CR4A 3RABA 2XZLA 3VKWA 2NZJA 1OFUX 3O8RA 2R6FA 3LO5A 1NIJA 1O3YA 1Q57A 4HZIA 1CP2A 2O0HA 3RRYA 3GLIE 4POAA 3W90A 4F38A 3K9GA 1XD8A 2XB4A 3BORA 4UNQA 1IM2A 1J90A 1XNJA 3CBQA 3B8HA 3VX3A 2JCSA 3U4QB 3GJ6A 3FE2A 3GJXC 2FA9A 3T12A 1G6OA 1DO2A 2GF0A 1R6BX 3AKYA 1TNDA 2HXSA 3IGFA 2XNSA 3T1QA 4WBSA 4JSYA 1VCOA 5C4GB 1KSHA 3NIBA 2J3EA 2V6IA 1ZU5A 2QAGA 3H86A 4H1VA 1U0HC 4O0MA 5K8UA 1TAGA 1WA5A 1LS6A 2CHVA 2V4ZA 4Q18A 3U7EB 2XOKA 2BDTA 4KO8A 1ZBDA 5BXQC 4C2UA 1MO5A 2ZR7A 3QVUA 1C9KA 4EPWA 4PQRA 2ECKA 2ZSBA 5K8IA 3PUVA 3W6PA 2OFWA 2ZEJA 4XD7D 4US1R 3VKHA 1YHNA 2VLIA 2ZRFA 3MUFA 3N70A 1NI3A 4M1OA 1FPMA 5L8VA 1P7CA 1S1CA 5HPYB 1Z63A 121PA 2DFKB 5AUNB 2G77B 2RGCA 3PJRA 1NJFA 4QGGA 5EE5B 1T0JB 2Q9BA 3GJ8A 3TUIC 3HYTA 4PFSA 5GVSA 1G3UA 5H68A 2A9KA 2A7QA 2F6RA 4NCJA 5J40A 3T15A 4URXR 1LNZA 3THXB 1WBBA 4MA4A 1Z0KA 2WOJA 2KB0A 4J0QA 4GDFA 1TF7A 4HZUB 4LDJA 1A7JA 2WSSA 4HAYA 2P6NA 2ZI4A 3SEAA 3Q9LA 2YYZA 2OEPA 3KX2A 3RDPA 1E4VA 2F43A 2JJ1D 2V9PA 4M8NE 3EX7C 1N6PA 2OE2A 5FOXA 4CEHA 5FL3A 3F5FA 5DIFA 3PUYA 3LBHA 4DCTA 4Y0VA 3K70B 3DOEA 3ZLJA 1FQKA 4D2IA 2EFCB 1VYUA 4A4DA 4QM6A 1ELOA 3CR7A 2QI9C 4OQFA 2YOGA 4FMCF 1G18A 3K0FA 4XIGS 4KITB 2ORIA 4LBVA 4BECA 3TSZA 1IN5A 2C8VA 1XRJA 4X8MA 2FX3A 4XWOA 2O8DB 4ZPXA 4K8OA 2I3BA 4R71A 1E4YA 5HCIA 4W5JA 3U7HB 1KK0A 3J81k 4C0BA 1AS0A 2AD5A 2GILA 4FINA 2VA8A 5CLLA 1E99A 1RRCA 1YR6A 4JYBA 2QPTA 4EDHA 3AB3A 1W0JD 4I1UA 2Q3FA 1SKYE 3LH5A 2WBLC 4HB0A 1HT1E 2ZJ8A 3EASA 4U02A 4BLOA 1FW6A 4B35A 3HU2A 5EP3A 1E1RA 5J5CA 4JJZA 2H92A 4DIEA 1G7TA 1G21E 3U2QA 1NSFA 4Z8XA 4WZBE 1DAMA 1KNQA 1R5NA 4JZKA 4NYIQ 1ZNWA 5HR5A 3EG5A 4IKEA 2X77A 4Q03A 1IONA 4OQMA 2QPAA 1QVRA 1EX7A 4JLVA 5L3SB 1NBME 2ZS7A 2V7QD 3FHTA 1OXTA 4BLQA 5JS8A 2B8WA 2ZR9A 3WYAA 1YZKA 3MJHA 4TLBA 2X2EA 1N5KA 221PA 3LLMA 3TGPA 5KDLA 1KTVA 3VU9B 1W5SA 3WYFA 1GL9B 2BIFA 3CPJB 3GJ7A 3A1SA 4DSUA 2ZU6A 2YWGA 2IEZA 2WWFA 4C0JA 2IS4A 5CJ2A 2EFGA 2KBEA 1EXMA 4PPGA 3D31A 2OAP1 2PZGA 3FHOA 2JDIA 3U3KA 4OI4A 3FMPB 1BMFA 5FR2A 3SFZA 1T8UA 1W5TA 2F3TA 4B47A 3KFXA 2QU8A 4KODA 4G0NA 2O8FB 2QN6A 3LRPA 4AYXA 2GEDA 4W5HA 1KNXA 4NCNA 1NKTA 2YVUA 1GRQA 1XZQA 5DI3A 2ZI6A 1P2TA 3E2IA 3K09A 4TSFA 1E69A 1NKSA 4MYCA 4XSGA 1SXJA 4XTCS 2GK7A 3H0KA 2YOHA 3VHXA 4FWTA 2JLVA 2AXPA 3N2IA 1U0LA 5D3QA 4S35A 4YQFA 4MUBA 1IY2A 1Q44A 3ADCA 2ZJZA 3I1FA 3IO5A 1M8PA 1RYHA 4JL6A 3A1VA 1NLZA 4NE2A 3GLHA 4DSNA 4C7OA 3LVQE 3KZ1E 2E9SA 3WMGA 4LJ9A 4AWXA 2J0SA 3MWLA 2NPFA 4M1TA 2WZQA 4NBSA 2V55B 3E5HA 1CJUC 1FNMA 4DEXA 4P3YA 2YWEA 1HH4A 4M1MA 3NDBB 1Y63A 3BH0A 3NH6A 3PIRA 5EE9A 4IVQA 2OFXA 4B2IA 3FMFA 4ZDWA 3NBYC 1Q1EA 1COWA 3TQFA 2AXNA 2I1QA 1ZCAA 3LNCA 4I1VA 4NYIR 3WNDA 3QXJA 1N6OA 2C99A 1E2IA 4TZ0A 3GLFB 2HV8A 4QFMA 3BGWA 2ZYWX 2O0JA 1G41A 5AUOB 1GFIA 3VNVA 4BZQA 1M6NA 5JSZA 4AYWA 3EWSA 3GP8A 1XXHE 4RFSA 3BOSA 2F1IA 1FFHA 3HPQA 1GP2A 4QBFA 4RZ2A 1ZNXA 4N0EA 3L2OB 4JT4A 1BOFA 1P62B 1OFTA 1P73A 2JLWA 2GCPA 1GNPA 1TPZA 4PXAA 1P3JA 4TMZA 1V43A 2DPXA 4LY6A 3TH5A 4P31A 1GZSA 2B7BA 2HEIA 4NONA 1QHHB 1N5IA 5FUYA 3CRW1 4G5OA 4D81A 2B8TA 1KDRA 1II8A 4RJLA 4UXIA 1E96A 3EIEA 1OB2A 1VCIA 4GOJA 4UKDA 4QOSA 1K5DA 4HUQB 5EE1A 1TQ4A 3ZS8A 3TE6A 1F2TA 3W5IA 3FKQA 4CEJA 1ZUNB 1WDTA 2VSFA 3QXCA 4XWAA 5CDFA 1J8MF 2KBFA 4Q9JA 4D0LB 5H8WA 4DDTA 3AVTA 4MGYR 3A58B 5IRCD 1ZD1A 3IO3A 4F91B 3U7GA 1FOEB 1U8AA 1DPFA 3ZZTA 3EZ2A 3K70C 3OIWA 4C2TA 2CL7X 1Z0DA 1RKBA 4GZMA 4MGZR 3T5DA 4MQBA 2VQSA 2ZSAA 1D6JA 3SYLA 4HUTA 5M04A 4IEIA 4R2IA 1YZLA 2VRWA 2ZI7A 3S1AA 4HLUC 5FUVA 1JR3D 2PZEA 3GJ3A 2R8RA 1OHHA 4IDHA 4LJ4A 1JBKA 3WXMA 2J45A 5JJKA 1Q1QA 3RRZA 1GRRA 1E79A 1S8FA 2ZSDA 5KPJA 3KDSE 4TYWA 2R6DA 1G3QA 2RGGA 2O8BB 3U3JA 3VMFA 1BKDR 1OLOA 2ZE7A 2HLDA 3B1YA 3LX8A 4BZXA 1GVNB 2VBCA 3K70D 3QXXA 3UKDA 2Q3MA 5KOYA 1MT0A 5FOWA 2GCOB 3K0CA 1QVAA 4QBGB 4A0GA 3O8BA 5BYKA 4GMXA 3SQWA 5CB6A 1FMLA 2K5UA 3U44B 4LJAA 3LAWA 4RKFA 2IUTA 1E2LA 1Z6AA 1ESNA 3RC8A 1ZC3A 2NO0A 1DAFA 2LKDA 5FR1A 2XEXA 1HYQA 5CK5A 1OYYA 2DBYA 2ZU0C 1XD2A 2YZ2A 5EQTA 4U5XA 1XTKA 2GESA 4PO8A 4DVGA 2IYYA 3B1WA 2CJWB 1NIPA 4FN5A 3K8YA 3GLGA 3ADKA 4TQAA 3AKEA 5C2JB 4FW9A 3K9NA 3Q5EA 2P67A 1CJKC 1P6XA 3CO5A 1OFHA 1EFHA 1EFRD 1E2FA 3R7WB 4MGKR 1AGPA 3QOFA 3LLUA 1Z6TA 1F6BA 3MSXA 1Z22A 3B1VA 4BFYA 1KMQA 1LY1A 2X8AA 1DTSA 3D8BA 1OH7A 3NEJA 2CEAA 3KJGA 4AI6A 4EJSA 1KMHA 3Q8XB 1U98A 2H18A 3SBEA 3P20A 4B3XA 3FKSA 5TARA 3M4YA 4OHXA 1JR3E 5EE3A 4OJQA 3QPVA 3RHFA 4EPVA 4F4IA 2EQBA 2OO7A 5FL7D 3SU8A 4LSGA 4MKHA 3UMRA 1GNQA 3IKJA 2J0QA 4WAUA 3L43A 1FTNA 4ZCLA 2WKPA 5FOVA 2HUPA 2WPDD 1AGRA 4A8JA 3RS0A 1YE8A 3K0AB 3CRRA 4TZ6A 1PV4A 3G82C 2NTYC 4LBWA 3Q5DA 4RD1A 3BFVA 4BFVA 4M2LA 2ORVA 3CRMA 1L4UA 4MUAA 5LB2A 4DWJA 1KI2A 1SVMA 4V03A 1MKYA 4QKQA 4Q47A 2FZ4A 5HCNA 1VKJA 4M9QA 3QSYA 3FHCB 4JYCA 4O25A 1GL6A 1UM8A 5CIWA 3B2EA 3BB3A 1NMYA 4ASUD 2C5LA 2OLKA 2H57A 4M0LA 2RGAA 3UANA 2B6HA 1PLJA 2GXUA 1RFLA 2F3RA 5H70A 2O5VA 4HEJA 3R9WA 1M7BA 4BFWA 4HLCA 2WM9B 3IPXA 5FI0B 2G83A 4PQYA 3AUYA 4PTLA 3PUWA 2Q6TA 1YZGA 1B23P 3GJ5A 2AFIE 4OKSA 4R9UC 2Z4RA 5EZ5A 3GEEA 2NZ8A 2AD1A 2WJJA 2X1VA 2ZRMA 4KXFB 1W46A 1YZNA 3DKVA 3EA0A 3BXZA 1SVKA 5G41A 4CT5A 2ZJ5A 1F2UB 2V1XA 2QUZA 3K0EA 3RWMB 3U61B 1OE0A 2OXRA 1LF5A 2CNWD 1D9ZA 1G6HA 2ZSEA 1Z83A 4Q19A 4M1YA 1J8YF 4G1UC 1XMJA 2IC5A 4Q01A 4KYUA 4O2RA 3JZAA 4LYAA 4RD0A 2B7CA 4YDSA 5JHGB 4GNKA 3ZZ0A 3AVWA 3QF7A 4BFUA 2W6JD 3C41J 4QGAA 4M21A 5FH9A 1S96A 4BFTA 4EPXA 4QGHA 4US2R 3G5UA 4Q9IA 5L3QA 2XSZD 4Q4AA 5A5GA 1OW3B 3OZXA 5BN3A 1H8HA 2QT0A 2SHKA 5DH9A 1YQTA 1VIAA 4D4JA 3Q3JB 3T5GA 4ZDJA 2QAGB 5DLQC 1MABB 3L0PA 1S2MA 3DPUA 1KSGA 1T3HA 4IDNA 2AKAB 4MRVA 4R98A 2XZOA 2BBOA 5L3VA 1AQYA 4Q7MB 3HR7A 3QKRA 4LUCA 4TT3A 4B48A 3AKDA 2OCYC 5JJIA 5FPSA 3B9QA 2YNMA 4DLUA 4QM7A 4DCNA 1VMAA 2EW1A 4M9SA 4C0KA 4QHTA 3QKSA 2ZRPA 3V00A 3RYTC 3LBIA 5DGXA 1F3OA 1W2GA 1AIPA 3I8XA 4A0RA 4UNRA 3RS2A 3BFKA 4X8LA 1JXOA 1OKKA 1SZPA 1ZM3A 3ZIAA 1Y3AA 1Q21A 3E1SA 4UXHA 5CJPA 4BRUA 3PEUA 3RS4A 2QNRA 2GDJA 2RKOA 1VG9B 1UADA 3BRWD 4KVAA 721PA 1FQJA 4G01B 4IVRA 2FSHA 4FMDF 3ZD6A 2CHQA 4IW3B 2HYDA 2WAXA 4ILEA 3GLFE 3OFND 4B3FX 3WBJA 4B71A 3RSLA 4HDOB 5UKDA 2YKGA 3IHWA 3GPLA 2IYUA 2KSQA 2DWPA 2HXYA 4LHWA 4D82A 4ARZB 1Z06A 5JLJA 2ZJBA 4KSCA 3TIFA 5J4YA 3VAAA 1QG2A 1XEXB 1YZTA 3NTUA 4O2LA 1E2NA 4UNPA 2WTUA 3QEOA 1PZNA 4YXWA 4GMDA 1E2QA 4HDQB 1IXRC 2JIZA 2ORWA 2EU8A 2GXSA 3C4JA 3MWJA 1W4CA 2FPMA 1UKEA 1XFAA 2L0XA 2X2FA 1EG7A 3WBKA 4BLTA 1NG1A 3ADBA 4TMVA 3PXGA 2BBTA 1XEFA 4W5WA 3PEVA 4WXRA 5FUWA 4GOKA 1HTWA 4B2PA 2O52A 3U60B 2XITA 4S2EA 2GNOA 2YV5A 5FBLB 1EESA 5AJWA 4NKRA 1KHTA 1P4SA 1X3SA 1PVOA 1QRAA 1D8TA 2LCFA 3ND8A 4PQFA 3H1TA 1RJ9B 1G4AE 1XBTA 1DEKA 4OHZA 1SVLA 2ZE8A 2OG2A 5HZHA 1HE1C 3TUZC 4ACAA 4YLGA 2AWOA 5LPNA 3A4LA 2F1RA 2WJGA 2IYTA 1JQLB 3B13B 3IQWA 4IOJA 4JLMA 3TMKA 2VHUA 2CMKA 5F9HA 1R4AA 3P26A 1YR8A 2OV2A 4B3CA 5IF9A 6Q21A 3X2SA 1XTIA 5TMPA 4PPNA 3W8RA 2G1KA 1G20E 2W0MA 2ZE5A 3UG6A 5DN6A 2IBMA 2W2TA 1TF2A 4ESVA 1GDDA 3SZRA 1OJLA 4FMBB 1VPLA 1XCGB 2A5JA 1W48A 4MKGA 4B73A 2JLYA 4KV9A 3IIJA 4O3MA 5AK0A 4ZCMA 1W2HA 3SN6A 1IN8A 1KKLA 1XMIA 2PCJA 5CB8A 5J4KA 3V4FA 3AVYA 4FD2A 2VP5A 4XJXA 3KUCA 3AVXA 4URWR 2IHBA 3BERA 3P32A 2CDNA 4E03A 1L8QA 1E2PA 1E1QD 1E9FA 2PJRA 1X8LA 2ERYA 5KUTA 2GJSA 4QC2A 4AYTA 5KU1A 4D26A 2ASEA 2QROA 3TLXA 4L15A 4PSKA 5DI3B 1KJZA 4NP6A 2NO9A 4OK3A 4UNNA 3U3RA 3HWSA 4GT1A 2PEYA 4JKIA 5BQ5A 1I2DA 1N25A 5K8LA 1OH8A 2IUSA 2FPLA 4AKEA 1N3BA 3FMIA 5JEDA 2XAUA 1IXSB 3KQUA 3F0TA 4PZYA 1WF3A 4C7OB 5FOTA 2CCKA 2ZI9A 1A4RA 1JAIA 4BFXA 2PMKA 5FBQB 5CIQA 3TAHA 2KWIA 3TJZA 1ZINA 3CF6R 3CZQA 4ACBA 1E9RA 4K46A 1Z28A 2FJUA 2R2AA 1S1MA 1Z6GA 2A5FA 4JLDA 4X8HA 3FWYA 2OHFA 4LC0A 5J4LA 3SDZA 2OXCA 5IK2D 1GG2A 3KL4A 4YMTA 1X6VA 1YVDA 2H7VA 1FUKA 4Q66C 4PX9A 1HE8B 2BMJA 1TX4B 1TUIA 2J87A 3TNFA 2FFHA 4Q7KA 4FIDA 1H8ED 2QAGC 1Z8FA 2GAAA 2C04A 2OCBA 2QBYA 1M34E 4Z1MA 5DYGA 3IHLA 1Q0UA 4RFSB 4IVPA 2BCGY 2IT1A 5JWHA 4A82A 2JASA 3B9PA 2IF2A 3I61A 3KKNA 8OHMA 1G8YA 1NBMA 2V54A 3EARA 2ZRAA 1E2GA 3FMOB 4GL2A 1E2EA 1G8HA 2QM8A 1I2MA 1II8B 2DWQA 1ZC4A 2GCNA 5BN5A 4A15A 4ZKEA 5HZKA 3PEYA 2F9MA 1Z29A 2D4HA 2JJ1A 4B6EA 4UJ3A 2V1UA 3D7MA 2QP9X 3CH5A 2XOKD 2PCLA 2NO7A 2UKDA 2HF8A 2GHIA 3CW2A 3RSOA 4BRWA 3UPUA 4YMSA 4G5SA 4B74A 2C9CA 1NVVQ 4I99A 5C4MA 4DLZA 2FDCA 1KO5A 1XTSA 1W47A 2J7PA 4TMTA 1XZPA 4OHWA 4D0GA 2PT5A 3F8TA 4NMMA 2FPKA 3K9LA 2A5YB 2FMXA 4X8OA 1D2EA 2DYKA 4B44A 4CEIA 3RNLA 3DVLA 3EA5A 4PO9A 3ND9A 5DYIA 4HDCA 3ZYCA 4QG7A 4Q7JB 1BH2A 3QKUA 3TR5A 2P3SA 1AK2A 1WMSA 3ECCA 5FOUA 4IOLA 4XH9B 2A30A 3SI7A 1WE2A 4DRZA 2FOLA 3S1AB 3QKTA 4P4UA 1RIFA 4R2HA 1T6NA 2ODEA 3ZGXA 3AGQA 2WSSD 1Z2CA 2CE2X 3MD0A 3P27A 4RD6A 2D74A 1G3IA 1IBRA 4M9XA 3NHBA 2P65A 2F55A 2OILA 4AG6A 2G0NA 1XTQA 2BKEA 2J46A 3DHWC 2QMOA 2ZRJA 3DM5A 2D2FA 4GI7A 1E2KA 3OEHA 1CULC 4FCTA 1CRPA 2YWHA 2OZEA 2OCPA 4LV8B 4I81A 3X1XA 3I4LA 2WHXA 2BBSA 3X1ZA 3DO6A 4KI0A 5C18A 3HU3A 3GFOA 1KGDA 1Q22A 1ZNYA 2ZR0A 3ADDA 1IHUA 3EZ7A 5F98A 5FTKA 2G9NA 1ONBA 3LW7A 3AUXA 4LYHA 4MRSA 1UBEA 3O8CA 2IA5A 2HJVA 2IXEA 2EWVA 1DAHA 3B1XA 3TK1A 5FFMA 1RW4A 4F7WA 2FZLA 3MJRA 3TSWA 4Q02A 2FG5A 1N6LA 3H2YA 3MGCA 4PC7A 2A78A 3IEVA 1CBUA 2GXAA 2W58A 5KNDA 4V0MA 2IS1A 4Q4HA 1E1RD 3TKLA 4TTPA 1R2QA 3EC2A 4C0AC 4NYMQ 1S4QA 3ZH9B 2IK8A 3GJ4A 1W7AA 3PUXA 4LZZA 4DCVA 1NVVR 1OYWA 2PMDA 4DUGA 3C7KA 1KJYA 1KO1A 4JMPA 2REXB 4KHZA 4EJSB 1OF1A 3ZJYA 1AM4D 4DIDA 5JECA 2VP2A 1XU4A 3TVTA 3C15C 4P4SB 4D25A 1AS2A 1FP7A 2NMVA 2W6IA 4F93B 5CITA 2PH1A 2HT1A 4TYPA 3CF2A 1CKEA 3RVBA 4CIDA 4FCVA 5FTNA 1EGAA 1XCMA 3U6KA 4DXAA 4NDZA 5EP2A 2IWRA 2GKSA 3PFIA 2OAQ1 2ZAMA 3QF4A 4ZIRA 1Z47A 4PO1A 1N2CE 1ZCBA 3SJBA 1X86B 4YDHB 4MH0R 4A8JB 4DB4A 1R0YA 4CF7A 4TL9A 2EYQA 3DMNA 4C9BA 1Z6XA 1SVWA 2JDID 1D2NA 1KZ7B 2NIPA 5DSZA 1KI4A 1DVRA 3AF0A 1JECA 4I1OA 2JJ2A 1NN5A 1QHXA 1BMFD 2ODWA 3BC1A 3MWKA 1DE0A 2ZYUX 2GJ9A 5JHHB 3QXHA 1KY2A 2D62A 1F60A 3BB4A 4IDPA 5AUQA 4MGIR 2QTFA 1BYIA 1G7RA 4PC1A 1FUUA 2WWHA 2NQ2C 3KTAA 5FBVB 5J4VA 2FGKA 3TQCA 2ZQ5A 1T8TA 4PAQA 4TSFD 2WMNB 5KNBA 4AKGA 4E5UA 1SXJD 2ZRIA 4Z51A 1DARA 2XJ4A 5LD2B 1VHTA 1U8ZA 4HB2A 2IYSA 3AF2A 3VFDA 1S3SA 421PA 4LV6A 5EXPA 4CDGA 3WRYC 1RYFA 2VSOA 1U9IC 4IRUB 4NHOA 2QMHA 4LJ6A 3IUYA 4M1SA 1LV7A 4LHZA 2ATXA 4NZYA 4HLQB 2GA8A 3AEZA 3D6TB 4Q1BA 5SZKB 5C1BA 1U94A 4TWZA 1W0KA 3RWOA 4WW0A 4K81B 5IT5A 1RZ3A 2V8OA 3OAAA 4LHXA 4C0HA 3SHFA 4NYMR 5EUQB 4ZV4A 2OFOA 1CXZA 1FNNA 1TQ6A 1U8YA 2GVDC 5FUXA 3SJZA 2P0EA 4EQ6B 5J4HA 5GVRA 1COWD 4Q9KA 4URVR 4MKFA 1NF3A 3ZD7A 2MSDB 3R9XA 2ZSFA 4G5QA 3TUJC 5EZ6B 5JFGA 4GBMA 2ZIAA 3KKQA 2OBNA 1VYTA 3WMFA 1TQ2A 1E2MA 3A37A 4P32A 1UEJA 1US8B 5C46F 4QGFA 3R8CA 4EPRA 1NRJB 1ZYUA 1E9AA 2Q3HA 1XTRA 1ZP6A 2ERXA 2IS6A 1LB1B 3GCGA 1YRAA 2REOA 2AKYA 2JA1A 3WYGA 2PLRA 3C5CA 1UDWA 3CX7A 2OUKA 2RHDA 4HZUA 4F4CA 3CM0A 4NCHA 4RD3A 2GZHA 3K0SA 4JVLA 3W8NA 5JS7A 5GADl 2IYZA 1N5LA 1E2JA 5TDHA 2AX4A 1UPTA 2RH5A 3UWOA 3MMPA 3NG1A 2QGZA 2CK3A 4L9SA 3BWDD 4GPTA 3I62A 4NYJQ 1MRNA 4KSBA 5KPDA 2X19A 1XJCA 3UMSA 1AZTA 4JS0A 1X8KA 4ZI3A 3JZMA 1JEDA 4JLNA 2J0UB 4L8GA 1RRGA 3VX4A 3OE7A 4HLUA 2BMDA 1KIMA 2WICA 4KFTA 2FWRA 3BH6A 1KI6B 2O8DA 1E3MA 4AK9A 4IOMA 4EPTA 2G1JA 2GVZC 2TMKA 3KQHA 3EPJA 2PX3A 4BLRA 2WWXA 2FU5C 1UBFA 5JJLA 3EAQA 2WWYA 1P60A 3DM9B 1KSFX 1OHHD 3B6EA 1CJMA 4KCGA 5D3MA 3WP1B 2MSEB 5GJVC 3EPLA 1E79D 5AJVB 4N3NA 1J2JA 3WP0A 4TL7A 2D3WA 1KDPA 4LX0A 2IYVA 2GEUA 4M9ZA 3N5CA 5JWRA 2HLDD 2W00A 3A8TA 1KK3A 4TMXA 3OEEA 4V0LA 2PZFA 4RD4A 1G8GA 2QTVB 1YRBA 3PENA 2BVNA 3DEFA 4OYHA 1E0SA 1E9DA 3R9IA 3EIHA 1W1WA 4DLTA 1SHZA 1ZM9A 2XTMA 3QJYA 5L3SA 2D7DA 4V02A 3KB1A 3IIKA 4M53A 5KTYA 2DY1A 4OI2A 2VO1A 2HJGA 1E32A 2CL0X 4PHTA 5FL7A 3M1IA 4RY2A 4EJSC 3A4MA 3T61A 1G8PA 1OXSC 4JSTA 1DAGA 2ONKA 3BBPA 4CRWB 3U7FB 4EAQA 1NMXA 4BEBA 4LJ7A 3NH9A 3NHAA 1DADA 2QORA 2GTPA 4JVNA 4RVCA 2WPDA 5CK4A 3ZQ6A 4B6FA 2QEQA 3VKGA 4Q7LA 4TMWA 5BW8A 3NBZC 5BWMA 1G1MA 2OT3B 2ZUCA 2FE4A 2BMEA 5B2ZA 3I5YA 3QG5A 2ZJYA 1G17A 5P21A 3EXAA 3I8SA 3Q85A 3T1VA 3SHWA 3BB1A 4NYJR 1CS4C 4YC7A 1VG8A 4A8JC 4UJ5A 1GOTA 2LKCA 3L0OA 5KNCA 2YHSA 3V9PA 1KI8A 1EFTA 1CJVC 2DCUA 2R6GA 3FKSD 4OBEA 4A6XA 1L4YA 4Q48A 5KDDA 2RCNA 3IBGA 4Q4JA 1TL7C 2AHOA 3M0EA 4DCSA 1KO8A 3PQCA 4LGMA 2ZS8A 1I4DD 1JJVA 5CYOA 4C0SA 2EFDB 3CNLA 1XPUA 4H1UA 2JATA 2N46A 4MYUA 3H4MA 5LD2C 4PSAA 521PA 4C3ZA 1XDBA 3B85A 2XJ9A 3QY0A 2R6AA 4IOKA 5JCZA 1XCPA 3CWQA 4Q9HA 3Q72A 3KJHA 1R5BA 2IXFA 2CCJA 4MKIA 4PSVA 2EYUA 5FPTA 3BFXA 5E7JA 4OK6A 3EPHA 1MOZA 1V5WA 1R7RA 2CE7A 1CR0A 1JALA 2XNDA 4JIMA 3SYNA 5JWOA 1NSTA 2CNWA 2F1JA 3UK6A 4BE7B 2ZPTX 3BAFA 3THYA 4DBLC 3GLFA 4JJKA 2GF9A 3CKLA 3NKVA 1JPNA 2DFNA 1TMKA 2VTKA 5FPHA 3THWB 3PVSA 2FH5B 5FTLA 2FEMA 3KXIA 1TU4A 2ZVPX 2WJYA 1QBKC 4M4SA 1G291 3U6BA 3CX8A 2I4IA 1TU3A 2QP4A 5TV2A 3DOFA 2ZS9A 4ZDKA 3LDAA 1GSIA 2DFLA 4A2QA 2GZDA 1D5CA 1OIVA 2GK6A 2V6JA 1E0JA 4QHSA 1QHHA 5E7MA 5JI3E 4NCKA 4L9WA 2VHJA 4D4MA 5HKKA 1XTJA 1E6CA 2GWHA 3BS4A 3T35A 2JAQA 4IJMA 5AJXA 1Z0JA 2R65A 3RLFA 1Z0AA 4BFZA 3T1TA 4NL4H 1ESMA 2RMKA 2YJTD 1A82A 2WV9A 4YMWA 1A2KC 3IBYA 3M6AA 3CRQA 3JVUA 4PC2A 4JT2A 3QXSA 2Z43A 3LX5A 2FN4A 5JBQA 4IXNA 2XB2A 4V0KA 3IEUA 4M1KA 4BQSA 3ICEA 1ZD8A 1EWQA 1WP9A 4XVRA 4NU0A 4D4LA 1Q1BA 1FX0A 4DB2A 1WBDA 4TL6A 3ZVRA 1X8JA 3GFTA 2QBYB 2IYXA 4E09A 4OQXA 5LB4A 3UWKA 1E94E 2JLXA 4WZAE 1JJ7A 5GJCA 1E0AA 1DG1G 5TVKA 1TQDA 4U7DA 4GP7A 1N6HA 5G53C 2AK2A 1JR6A 5GJWC 2W0SA 1P5ZB 4QJ4A 5FBWB 2CL6X 1H8HD 4FI3C 5BYJA 2ODBA 1TF5A 5FPYA 3BJIC 3G0HA 3AM1A 3QIAA 2MMGA 4CW7A 5J47A 1II9A 2WOOA 2D7CA 3MRSA 5DE3A 2IL1A 2OBMA 2O8BA 1X1SA 4LV5B 2XZPA 1ZM2A 5E95A 3VR3A 4A92A 1I4LD 1DAKA 2F43B 1N6NA 4JLJA 4BWYA 5JMTA 5HTKA 1ZIPA 4CEHB 1SVOA 3HYRA 3QBTA 1OIWA 4TT3D 1QF9A 4FCWA 4DLYA 1R0XA 1KDOA 4KAXA 3CF0A 3U44A 1N6KA 5EJEA 1EK0A 4LYFA 4AY2A 1OB5A 3CPEA 2YWFA 2WMOB 3KKPA 4RFVA 3TBKA 3C8UA 3K0FB 2QE7A 5TXGA 2ZUDA 1BIFA 3DDCA 1QZXA 5B57C 4JBXA 1BS1A 1JPJA 1OPXA 1OKKD 4ZKDA 3NXSA 1YU9A 3ZIAD 3AF1A 1VDZA 1J70A 3FFBA 3X1YA 3ZVNA 1NG9A 1Z2AA 1IY1A 2QT1A 2ZRGA 2NO1A 2ZRBA 3UATA 3IDQA 5LBIA 2R44A 3DMDA 1MV5A 3SJAA 3FPAA 1G3MA 1UAAA 1PLLA 3AGPA 1P9WA 3OIUA 3GLIA 2IWHA 1KK1A 1VIYA 1KAGA 3SJCA 1OV4A 2IXGA 1VG0B 1KI9A 4P4TA 4ZDIA 1Z0IA 3CWZA 3AV0B 2UZ3A 4YXWD 1B0UA 2HDNB 1Z08A 1G8FA 2JIZD 2CBZA 3MWYW 2GJAA 1NN1A 1GKUB 1F48A 2RGBA 1M7GA 3NDPA 3W3ZB 2DR3A 1SQ5A 5HE9A 1GNRA 1WRBA 2BHRA 1A5TA 3OIVA 1UDXA 2H8KA 1BYUA 4II7A 1Z6YA 3K0AA 4Q1EA 2IYRA 4JVSB 3TSOA 1OH6A 4Q4HB 1XEWX 4GSYA 4GOXA 2ZETA 4BLSA 2GBLC 2PT7A 4D4KA 1ZMXA 1Q20A 1JEEA 1AQUA 1NY6A 1LW7A 1UF9A 2CLSA 2C9OA 3TW4A 1I4TD 4Z54A 1OXXK 2DFTA 3WNCA 2NOAA 2IX3A 2FSFA 2FFQA 2RGNC 3SBDA 4ERNA
chains in the Genus database with same CATH superfamily
1C1YA 4DC9A 3VR4A 4EQZA 5EMLA 1K7CA 3Q7PA 4UAUA 4B3BA 4JR0A 1K2VN 3KSRA 5DTIA 5BSKA 2W8ZA 4GW3A 4AJOA 3WIDA 5K1ZA 2GK3A 4CL8A 4G4GA 1JSXA 4G25A 1GAWA 1QIEA 5B3JC 1IXZA 2FPIB 3AZQA 3T52A 4FYPA 1UC8A 2ZIGA 1B41A 1K5GA 4CT4B 3I0ZA 1JI0A 4HAZA 5K3FB 1UMCA 1Y6JA 1TGVA 3EG9A 1T5LA 2C9MA 2EP7A 3K1JA 4Q21A 4ER3A 3RC9A 4DCOA 4EHHA 4PLFA 3W9UA 2XIQA 5JC8A 2GAFA 4FR0A 2WWTA 3T9CA 3JVVA 1NN0A 2V7GA 3EIOA 4H4DA 4K0RA 4RTRA 3IT3A 2PO5A 4HDKB 1T9BA 3SHOA 5JC1A 1LVHA 1NZFA 4YREA 1EX1A 1R4MA 2E1RA 2IODA 4EW6A 2GPAA 2VOEA 4LWZA 1D9XA 3SC3A 5JANA 4C4AA 2JIOA 3TVYA 1XTVA 4UVDA 4HYTA 1TUEA 1J07A 2VL7A 2HA0A 5LIRA 2Y8EA 1ZI6A 5DGHA 3NVKI 2XD9A 5DTMA 3AR6A 1YI1A 5ALNA 2VYFA 4URUR 4COOA 4C6TB 1L7AA 4E5NA 4C0LA 2VZEA 4QDKA 2BLLA 2NN3C 2XXJA 4JLAA 1OXVA 1KI3A 3TFWA 4DQLA 1NI4B 4HB4A 4XEHA 3MT0A 4L2IA 1GZ5A 1IDN1 2PQ0A 2XDWA 4DDWA 3EEOA 4WFKA 4H60A 3I6ZA 2QL7A 4R8LA 2ZVQX 2R00A 2MYTA 1C9NA 1ENPA 3S3TA 1RJWA 3L5OA 1KJWA 4Z9BA 2BMFA 3I2GA 3N8NA 2PR7A 2XYHA 2HCRA 1KH1A 3DF7A 5IC4A 2JBAA 2ZIEA 1F8XA 4Y6LA 4CG3A 1T35A 2MJLA 3UAVA 3CR8A 3W3AH 1L6IA 4K9NA 3GLRA 1UDAA 4G0YA 4ENVA 3GPCA 1RWQA 4KYIB 1MABA 3ZQUA 2YMQA 5DEOA 1P74A 4ND1A 3UMJA 2GPBA 3WRXC 5B1EA 1EB8A 3LUCA 3CRVA 4HZGA 4OAOA 3P4YA 5DHTA 3LXRA 4XJSA 3A25A 1GNLA 4IS3A 4XXHA 1MA0A 3AH8A 3JSXA 1NQUA 4O08A 3AP2A 3TX6A 3PQFA 3MJ4A 4NRDA 4YAOA 4JOQA 3A6KA 3FWKA 1X42A 1NLYA 2BEWA 2GEKA 3BSWA 3OY2A 1XMVA 4FYXA 4KX5A 5B1DA 2Z3ZA 1ZJ6A 4OP2A 5T4BA 3NUQA 1MO3A 2A8YA 2XCQA 2WVJA 4XUCA 1KA9H 2OXEA 3O9ZA 3M1AA 5IHPA 2X76A 5TNXA 2V74B 4W1SA 4LW8A 5AHWA 4JT9A 1PFGA 1N2JA 2C54A 3GZ4A 1ZIOA 2XE8A 2PBLA 3SC4A 1N0UA 1RNLA 2FMUA 1DOAA 3DUWA 2C7PA 3Q2KA 2ZRNA 4FILA 3R5JA 2GZSA 4GP6A 4MI1A 2WFAA 5LUBA 1JXQA 1OCEA 1NM5C 2PSSA 3ESAA 3M49A 1IN6A 5ERGB 4GPAA 5KSOA 3DAGA 2OSVA 3B5JA 4F3KA 5A6SB 3AF6A 1DAIA 3CEMA 3DZ8A 4EFLA 4OQLA 4DA9A 2BGIA 3AU9A 3M3PA 1N77A 1MH9A 4MVCA 2D5IA 4EIWA 1DUIA 5F7XA 5B53A 3AJDA 2YC2C 3MRTA 4JLBA 1N2CA 3C3JA 4EVSA 1CIPA 4ZMSA 2HMVA 3T0FA 3L18A 4ARZA 4XKJA 4HAXA 4XQCA 2NO6A 3KXKA 4C30A 5B55A 2GAJA 2J7PD 5I7OA 4LYYA 3GOQA 2OZVA 3BRSA 5JRJA 3WSTA 2AN9A 1XEXA 1SBHA 3D3EA 2H8GA 1TUBB 3PZRA 4JLPA 4L16A 3RE1A 4DR3B 3L0YA 1U8UA 3F9IA 1M66A 3GQVA 3PQ8A 5KOJB 2G71A 3WG9A 4RJKA 1U4NA 3LWNA 2A5GA 2ZZMA 3SBOA 1OXMA 3LQRA 4CM6A 1M83A 4HNQA 2FMFA 1A1VA 2FKNA 4OLFA 4BMPB 1J7JA 4OM7A 4CQNA 1CY2A 4G5FA 3ZVLA 2BGRA 3CSDA 2VHYA 5CNJA 1K6EA 5B30A 2D1QA 2IZ5A 1XFDA 2G0AA 3EGDB 5EP4A 1E0KA 3MILA 5EKSA 1IHXA 3QXGA 4LCJA 1N2BA 1TO2E 5KTNA 4MMZB 1YQ9A 4AY5A 3IERA 4BNNA 4XYBA 1A4IA 4ND6A 4WLUA 1ATZA 2O3JA 3DCIA 1CVLA 1XXHA 1FDVA 1W4BA 2B98A 2HSWA 3JASA 1C0LA 5IC6A 3GLGB 2Y1EA 4QUGA 3BN3A 3RRNA 4P1ZA 5EYPA 1CRQA 1YVEI 1BMTA 2BFEB 4Q6BA 5K2MA 3UW3A 3KVNA 2OO5A 4OU4A 5AK3A 4OA8A 4C21A 3EGCA 2WA1A 1OBVA 4H7FA 1Z68A 3AILA 4NTZA 5LA6B 5TB5A 4V0OA 2J7KA 3EGVA 1KZGB 1ONOA 1HDEA 1VSBA 3U7IA 4BO7A 4OU5A 1RVV1 3F6EX 1IU9A 4I9NA 1AK1A 1WX1A 3QKIA 3I39X 3L4BC 4ZO8A 1G7CA 1MN6A 3BREA 1Y8RB 4TV9B 4PLPA 4D9HA 5ALVA 3ZE6A 3JZIA 4F86A 1EBUA 2VAVA 1H93A 2IQIA 4IHJF 1N3IA 5HOEA 2C07A 1EHYA 4UD6A 5IMBA 4KC0A 3TIGA 4AN1A 5ITZA 2RAVA 8GPBA 2QRKA 3Q7RA 3NBMA 3W34A 2BE7A 4WACA 4A26A 4LOHA 4RTOA 2IW3A 3L0CA 4URYR 3TLYA 1EJ0A 4QU5A 5HS4A 4MS1A 3I5UA 3UXYA 3P2MA 4TTVA 3G2IA 5AR1A 3X3HA 3AJRA 3B7GA 4WESB 1U3CA 4EVIA 3KSZO 3C3AA 3WK9A 4RMJA 5DHFA 2OGZA 3EPRA 4B5LA 4JN6B 3EGOA 4TXJA 1PJ4A 3MZ0A 4MVJD 5DW3A 2DH6A 2HCBA 3B89A 3COYA 2C2OA 3D2LA 1L5NA 4GQIA 3FYHA 5G0SA 3OQIA 5I9LA 4NS4A 2F7SA 4WCVA 13PKA 3BD9A 1KRHA 4I1RA 4B75A 5LM3A 1J1UA 1BN6A 2WK1A 3K4HA 4KPUB 4KN6A 1E9SA 1BNCA 3DTVB 4HUJA 3RC3A 2I2DA 3ITNA 3JWHA 3T9DA 2A2ZA 2I4LA 5AHRA 1M7HA 2R48A 5GGYA 2FQQA 4UM9B 3THYB 2NSHA 1ZOOA 1OTYA 2JLSA 4UCQA 4FGJA 5A5DA 1CHDA 2GBPA 3VR1A 3QMPA 3UV7A 5CFPA 4YAGA 1P2UA 2J9RA 2KPOA 4RK4A 2PD6A 2QN3A 1C4OA 5SY6A 4Y9RA 2B78A 2J59A 3VNQA 2QRNA 2I5PO 3COVA 3IUJA 4KSYA 3RFUA 1Q7CA 2OLEA 1VM6A 5J59A 3A1DA 4U00A 1VKNA 4WFJA 4DE5A 3TZEA 2YRFA 1N5JA 3P9ZA 5CT4A 3VR2A 4G0MA 3UJPA 3JYLA 1XP8A 2GM4A 1V71A 1SCQA 3M2PA 2LWIA 3FYUC 2NAFA 5E4FA 2C20A 3EXHC 4MICA 3PGKA 3V4LA 2RH4A 4JP3A 3M6IA 5D7BA 1SVIA 3DE6X 1Q0HA 1LD3A 1RRPA 1RCFA 4AC9A 5KNBD 3H04A 1FDUA 4W7SA 4WMLA 1MAUA 3V80A 5L3RA 4QECA 5IVKA 3PUHA 2PKCA 2FMHA 2YJ4A 4TTAA 1YIDA 4ZQGA 4ZI7F 1X14A 2Y9PB 1HZJA 3GEHA 3RYFB 3OJEA 4ZQFA 3DWGA 3Q3HA 4DG5A 3EVNA 1MTZA 2QLTA 2AYXA 4V0ME 4OB8A 3C2QA 3VM6A 2GRJA 4KEAA 2VDMB 2ZYAA 4OHBA 4EI2A 3KR9A 4J90A 3SQLA 3T7RA 5CT9A 3BE8A 3VR6A 2CVHA 3L8EA 2JVIA 4Q4AB 1UP4A 1ZD9A 3COSA 2HIHA 3CG4A 3THXA 2RGRA 1UKBA 2CXTA 3H87A 4M0KA 3OAAD 2GN2A 4EEKA 2PQ6A 5AVOA 1W44A 5C7OO 2HC9A 2WUWE 1H5NA 3IR6A 4NQRA 4A36A 2HQRA 1KEZA 1QO7A 3OLWA 3IDZA 1M1NA 3KQQA 3AFMA 4QPZA 2ANBA 4KE8A 1HLPA 4IFBA 3DBLA 2PRIA 4IYRA 5CGQB 1SNYA 5AJZA 4UUPA 4AJLA 5IJ0A 4B09A 1AUOA 4UBJA 5EJGA 3KCNA 4ZCIA 5F1KA 4LYEA 5KVSA 2XVYA 2IF0A 2ZJ2A 2XX3A 3ZCVA 4F2HA 3PV0A 2LDXA 1ZXBA 2R4TA 3QKRB 1J7KA 2F67A 5A7HA 3RHTA 1A2BA 2BD0A 3AI2A 3AO0B 3TLBA 1JT2A 3V8NA 2AW5A 1KBQA 3KZVA 1QIJA 4ML3A 5K0LA 2QENA 1RCTE 4GXNA 4DC0A 4BNZA 2I76A 4CKCA 4DAOA 5F9FA 2ZJAA 2FPUA 4NJEB 5ALYA 3OQJA 5ED0A 3QKSB 1G4UR 1JEYB 3NWEA 3LV8A 2VR1A 4DDVA 3O82A 4Z7JA 1LPNA 4OLBA 2J3QA 3GCDA 4Z7OB 2HK8A 1UOOA 4G5GA 2VDUE 5A03A 5EJ8A 2A0WA 2G5TA 2WM2A 1NNEA 4MUMA 2IPLA 5ELLA 4J16C 1B8PA 4QU8A 2E85A 4DGQA 2PBRA 3BMCB 5A3JA 3RHZA 4V2IA 3VDXA 2QMQA 2WIAA 2HHLA 5HF5A 4B34A 1MC5A 2WU4A 1Z07A 4ZVTA 1YASA 2H29A 3L1IA 3RS7A 5ECDA 4F45A 5MGBA 1EPUA 5CT8A 3QOXA 5KINB 1P0CA 3T1YB 4OBXA 2G5PA 4J0JA 1CTQA 1LTQA 3NWJA 3JVEA 4AUNA 2C5FA 1OBFO 1ONSA 3NTVA 3PUZA 1ZHOA 4HMOA 4R7ZA 2PKYX 1CU1A 3GFPA 2OWEA 4WOPA 4DLKA 3WXBA 1L6RA 1CQJB 1EDZA 1T9ZA 4N1AA 2WG1A 2WG0A 4WUVA 1DO0A 3ZBTA 4BP1A 2IZ6A 2ORYA 4EUFA 1FS4A 2BGLA 2CXRA 4GYJA 3HS3A 4PONA 2Q7DA 1GWNA 5JWOA 2X2PA 3WGJA 2W6PA 3N74A 4B76A 2W2NA 4AD8A 1PI3A 1LDMA 4B7ZA 4Y9DA 2XGGA 3EK2A 1TZCA 1L3IA 3E5RA 4NFHA 3Q7QA 5G0WA 2NV0A 5G3YA 3DAHA 2JLQA 1N6RA 3Q3GE 2OYRA 1JFVA 3UYLA 2F3SA 1QRUA 4AP6A 1C9EA 3TRJA 2CXSA 3CH7A 5AM5A 1XCJA 4XWKA 1HV8A 1KKMA 5FLEX 3H1AA 2Q3CA 4PQEA 4TYNA 2I3ZA 4E6PA 2HGZA 2WV7A 5DLDA 4LZNA 4KVGA 2R8PA 3PITA 3PU6A 3N2NA 2JGDB 4O3FA 3VYSB 3FOBA 1YMVA 4G0XA 4NV0A 5IU6A 1WQ1R 1HLFA 2PJZA 2QQ0A 4ZI2A 1BCSA 1XELA 3WLJA 4RZQA 4UDOA 5EXEA 3E1GA 4JBYA 2EZ4A 4YGYA 4NESA 3TD2A 2ZTSA 4G5XA 1UXHA 1LFAA 1EKXA 1UPAA 4OGWA 1SHKA 2YCLA 3W3AA 1GT91 1MB3A 4F3TA 2C2MA 1ZH4A 2ZTVA 1IVSA 4HBZA 2CV0A 2FEOA 1G98A 1T9HA 2ZT6A 3EVGA 1N9KA 4NK5A 1QH8B 3MSCA 1YKSA 3GGOA 5GZ3A 1W36B 1JZTA 4G26A 1C0KA 1ESCA 1GTVA 1PGOA 3HUDA 1KOLA 2J3DA 2QNIA 3V1LA 3LFUA 5LZ9A 3WGHA 3UV6A 3AV3A 4DHEA 3IPCA 1JFFA 3TR0A 3E22B 4O2AA 3I83A 1JNYA 4Z3OA 3JQGB 5CIYA 3CUKA 3PI7A 1W85B 3PCRB 1V39A 5D5HA 2VHQA 4DSOA 1I32A 2PX0A 4K9SA 2AT1A 3ESZA 3PEFA 3ZHOA 4PBTA 4TWIA 2B99A 2NU7A 4TGLA 3CONA 1DC7A 1S01A 1KYXA 1VB3A 4JUAA 1RWWA 3A26A 3UMCA 2BLNA 4BUCA 5KJ6A 1GAQA 4PXSA 1EHCA 2AEFA 3ESRA 1WEKA 1XB2A 3VYVA 3D02A 5IN4A 2QQEA 2QMEA 1GUZA 4NCIA 4X71A 3IULA 3MIZA 3T94A 1VE3A 4N5IX 2OKGA 2XF8A 1WCXA 3IDFA 4QXAA 4QATA 4HTFA 3RVRA 4LPSA 3IVMA 4PO3X 3QELB 3K6JA 2W83A 3E3OA 4L6AA 4V2UA 4EAAA 1A9PA 1O03A 1EFKA 3FZGA 3GFSA 3SM3A 4A1FA 1JLMA 3PNOA 3PP8A 5I8PA 1N0HA 3O4FA 3NS7A 4HNVA 3GLGE 4TKVB 2RFLA 3O2JA 3PFBA 5KC9A 2DUJA 2Q9CA 3URMA 4B2LA 5MN5A 3W0LB 1SIUA 5E9JA 2OR3A 5DHSA 1RVDA 3L6BA 4RA6A 1T2EA 3H0EA 2HOQA 4GBJA 1WV0A 5DBHX 3QUSA 1LPAB 1UQUA 1DLJA 2CYCA 2QE6A 1FTSA 1YVUA 4MTCA 4BKUA 5A2GA 3PB3A 4CR8A 1V7PC 2PUCA 4F92B 4HAIA 1CSEE 2XNDD 2C2HA 4YX9A 4YPOA 2IUEA 5AW0A 5K0FA 5ELXA 1EUYA 4OHYA 2GPSA 1Z88A 1YB2A 3TFOA 3OJOA 4TRJA 4I2VA 2NO4A 2BGTA 3IJRA 1SKYB 2C4KA 5LQCA 1OIXA 1CDZA 1L5GB 1Y0BA 4OMDA 2YIVX 4HWTA 4F5YA 5IAOA 4ETMA 3GXBA 1H65A 1N8KA 3CNQS 3EVBA 4O6VA 3GH1A 3ILVA 1O95C 2Y67A 4QGBA 4Y30A 4AM8A 5IDWA 2BJWA 3A04A 4JBWA 3ZUGA 1YO6A 2J5XA 2WAOA 3WBFA 1RYMA 1P61B 4EPYA 4CTMA 3C6ZA 1MBZA 5K8CA 3CZCA 1PUXA 1CR1A 4R16A 3NDRA 1VP9A 4MYHA 1J8FA 2AYZA 2EFHB 2QD4A 4F5WA 2YHIA 4TMKA 1R8SA 1SGWA 1KJIA 1FUEA 1QE5A 2IPMA 5BR8B 1MW8X 3LF1A 1G5RA 2VWGA 4TWAA 2GOYA 4L78A 3IPYA 2VDWA 4DLSA 5KCZA 2WNIA 3A6PC 2GUWA 3AETB 3C5VA 3BMOB 3B60A 4I8XA 1P18A 2IYWA 2WAYA 2H59A 1X19A 4HVTA 2P6MA 2Q46A 2O8CB 3BRWA 4H16A 5TGZA 3KVOA 2FF7A 2QG6A 4P93A 4DLAA 4WNAA 2YHBA 4IDOA 3TQHA 3UB4A 5C37A 1LW6E 3PRKE 3MJDA 1VZ2A 3FOFC 4U1RA 4X44A 1T2UA 3JQAD 1NUUA 1VL8A 1K4KA 4JITA 2J0UA 3ROMA 1UC9A 4FP9A 4RPGA 5CAEB 4Q1AA 3KKOA 1G6Q1 1T34A 2WWVD 1FRNA 3SE0A 2P75A 4Z4GA 2WHYA 1PJLA 5DBFA 1BWRA 3K4PA 1V6AA 3MQ2A 1TT5A 2FNAA 4PLHA 3B6JA 2VQDA 5JD5A 3B3GA 1P0MA 4LPKA 5DX1A 3PWKA 1DJQA 1MU0A 4MAMA 1WXGA 3IVAA 3MS4A 3NWOA 3ZHVA 2IW1A 1IWPB 3KJZA 3AXSA 4RESA 3JYNA 2ZYHA 3MLBA 5LQKA 4TS3A 4NG4A 4X6LA 4L72A 4HEQA 1OU4A 1U8XX 4WV3A 5JJCA 3QPAA 1NATA 2NT4A 3REGA 4NJMA 4BATA 3HCDA 4EY5A 2BW0A 1RM5A 4PAOA 3DL2A 4ZU6X 1ENYA 4OF4A 2GEVA 3TCKA 2YCBA 1B1CA 1FMJA 1SKQA 2PUWA 2Q1WA 2MSLA 4R2JA 4WZ6A 4F85A 2D1SA 2M6KA 2VF8A 3O4GA 3R5TA 4KV7A 1KAEA 1Y4AE 3UC5A 2G4VA 1IWOA 3R7WA 1BCRA 5IXYA 4CZ2A 1WJGA 2QAJA 2Y1FA 3JTEA 3T34A 1I1NA 4P7BA 4AXBA 3AW9A 4WK0B 3SYKA 4OSPA 4C04A 5FPQA 1KO7A 1GPDG 2ACWA 2VUTA 4D6PA 5ALJA 1LK5A 2C59A 4MQFB 1SA0A 3NONA 3THSA 5JPCA 1ZSNA 2B2NA 2OBLA 3T54A 1PF7E 2BCJQ 2C61A 4A1OA 3WL5A 4ZQCB 1P7PA 1ST2A 4UDXX 4BLUA 5KTPA 2VQ6A 1GEGA 4WNYA 2CNKA 4LOIA 4BO4A 1XPRA 4QOFA 3KQOA 1FYDA 3EZLA 3HO1A 1KZ4A 1NT2A 1W4RA 2HHCA 3BX1A 4EA7A 3ZJUA 4DA8A 5IT4A 3NRBA 3TQQA 4GE3A 2VH5R 5FV4A 3Q0IA 1IBSA 4LF9B 3K16A 3UT5A 3CEPB 3MCWA 1TEXA 2YYAA 2Y1DA 1W94A 3R75A 2Q3JA 5GQSA 3TSAA 1QIFA 5EQJB 3IOMA 4WFIA 4RF4A 2XXBA 4CM9A 4Z8YA 5JFOA 3EE6A 3GJ0A 4BEJA 2ZGVA 1R64A 1W52X 4C3OB 3UZUA 1EFPB 2ONJA 2QRMA 1XQYA 2B4YA 1SCDA 4YXFA 1F5NA 2M1ZA 2J67A 3UIEA 2BF4A 4XGIA 5AVZA 2WWGA 3FETA 4ZOLF 5CH3A 1RI1A 3HCPA 1FP6A 4BBAA 5T4EA 4C43A 4F1KA 3PXXA 5BSVA 3TRDA 4F9TA 4BEVA 4DT1B 2IYLD 3EXIB 4IXDA 2UZ4A 2QVXX 1U8EA 2E4ZA 2GBLA 2R5FA 3P0EA 3X2FA 5FWNA 2KLBA 5JNUA 4FZ3A 1WPRA 2H5EA 5ALKA 4DEYA 2B92A 1JQ5A 5LZ4A 2LR0A 2FW1A 5H82A 4WCFC 4X62B 3FOCA 1OXUA 1OZFA 2J33A 4NG5A 3SDSA 3SLRA 3K8QA 1O2DA 3K8ZA 3T5TA 3G89A 4G3XA 1TAQA 1C8VB 3DDOA 3NB0A 4PRLA 3T3OA 1ADCA 5DI9A 3I92A 1YQWA 3NORA 1JAHA 1YL6A 4NOMA 2EOAA 2CFTA 1QNLA 1U9ZA 1WSAA 1HPLA 1MO6A 1LV8A 2H4ZA 3HBJA 3NYIA 4XZ3A 4Y8VA 5CLQA 3D3WB 4ZMBA 1ANKA 1I4EB 1V3TA 2V3CC 3THWA 4R68A 4R0MA 1ADJA 2FX2A 1YGYA 1SUIA 2JGLA 4PR0A 3VR4D 3MERA 3HJNA 4MW9A 2IX9A 4G97A 5CX1A 3TOVA 1COZA 5K3OA 2BBWA 5ALUA 4YMGA 4FQ7A 4A0FA 5CG1A 1POWA 5JYCA 1ZX1A 2OCIA 1DJLA 3V9AA 1OFUX 3AEKA 2XMSA 3LO5A 4MINA 5A9RA 1JSRA 2A88A 5MHTA 4RC9A 5DWVA 2Q0QA 3GYGA 3HSKA 3KOYA 4GLFA 3RAGA 3W90A 4N40A 4F38A 1Y34E 1YJQA 3LUJA 1XD8A 4MR9B 1BU5A 2OK7A 4UHEA 1RI5A 1IM2A 1Z13A 2NQ8A 3ROTA 3B8HA 3FUVA 2IIVA 4DADA 1XLTA 4GICA 1QK5A 4I4TA 5A6VA 1YDFA 2HLNA 2EZTA 2HXSA 3T1QA 2QRGA 2XNSA 4WBSA 1K4MA 1IC6A 1S2IA 4U3JB 1FFYA 1J9GA 5C52B 3RKUA 1ZU5A 3H86A 3NOVA 4H1VA 4Z9YA 4GLBA 1WA5A 2R96A 1LS6A 3PXCX 1XKXA 5BXQC 5CLFA 1GSHA 4C2UA 1MO5A 3NRJA 4JI0B 4KWIA 3FTEA 2ZSBA 4G2NA 2V4MA 5K8IA 2GD1O 3GDGA 3BHNA 4FKZA 2PLWA 4US1R 5DM4A 1X80B 4P84A 5BR1A 1Z82A 1YHNA 2VLIA 3MUFA 1THZA 5TLSA 1NI3A 2RAFA 3GGSA 4M1OA 4C78A 5ELMA 1TM1E 2QLLA 4MCHA 1OV6A 4UE6A 1UBMS 3SFTA 3GUHA 1CNEA 3RGWS 3AQIA 2G77B 4M7PA 4B3HA 3D8TA 5AUNB 2XCLA 4QGGA 2WTAA 3F2VA 1T0JB 4IO1A 3KYCB 4PFSA 1G3UA 2VYCA 4I2NA 3MOSA 4QUKA 4F6RA 3KC2A 4CUZA 4NCJA 1H2FA 1LNZA 2QWXA 1OI4A 3T3HA 4P7FA 5JASA 4F12A 4HZUB 3CYFA 1UOEA 3TXYA 4HAYA 3WWYA 9ATCA 3HCRA 3SEAA 3Q9LA 1H4QA 4GVLA 4O2BB 4N54A 1A88A 4DMFA 1XN4A 3S8MA 4JP8A 2RHTA 4M8NE 2OCKA 2BMWA 1JSCA 4EKYA 1YRWA 5IH7A 1HNWB 1DHRA 2QRQA 4CEHA 3D2CA 4DDMA 2HR1A 1L5HB 2WUGA 4X1OA 1H05A 3LBHA 4KG7A 4B8WA 4G0QA 2ZWIA 3DQPA 1REQB 1Z35A 3CR7A 1JKJB 5A71A 5AW8A 2DSTA 5SICE 3TRIA 4NOKA 1DV2A 4HEA1 1LTHR 5KKAA 1IN5A 4P98A 2ZTHA 4UPEA 2C8VA 1DX9A 5HMLA 3RTAA 4FOPA 4KWTA 4EF5A 4S3MA 4AZ0B 2EV9A 3SSOA 4RMHA 2HWWA 2O8DB 4K8OA 4R71A 1W1UA 1EFAA 5T6MA 1AS0A 2HO5A 2AD5A 4E6EA 3COWA 3DB2A 3TG2A 2GBCA 2EJVA 1MAAA 5CLLA 3T9EA 1YR6A 4PG5A 3B38A 5J1SB 2GN1A 4I1UA 4KH0A 4OFZA 1SKYE 3C6MA 4D8TA 1HDRA 4R2LA 2D1YA 3D5QA 2HSDA 3DEJA 3N3BC 4HB0A 1T10A 3R3HA 4TV8A 3UT0A 4PYJA 4JQOA 5ALHA 2ISQA 3BF7A 4U02A 4Y7DA 3A9SA 1U9CA 4C14A 5HP4A 1R0RE 4JJZA 4KXWA 1JEOA 5E1MA 3FHLA 3M3HA 3OTQA 3F46A 4QPCA 4RPKA 3AY0A 4XGRA 5EKUA 1IZ7A 3DZJA 2OMEA 1PDOA 4D8VA 1Y9ZA 5FTWA 1P5RA 2PIAA 1VJDA 1N33B 3N0XA 5C9ZA 5HIAA 1H6CA 2PSJA 4DV4B 4JZKA 1NW5A 4Q3KA 4IIYA 3GPIA 3EG5A 1IONA 1QVRA 1EX7A 3F6CA 4UHFA 3I42A 5EUBA 5KWIA 2FR0A 4IWNA 2IIQA 1XXLA 4O4HF 1XTZA 5AXAA 5JS8A 4G5YA 2B8WA 3WYAA 3HLKA 1YZKA 2R66A 5D3ZA 1SBCA 2X2EA 1NXSA 221PA 1RQXA 3TGPA 5CFRA 1SB9A 3CS3A 3MUNA 3N5KA 1GL9B 2BIFA 4ZEMA 3S2IA 4RL4A 4DSUA 3LHSA 5TT0A 2O5RA 1YRYE 3FXAA 2YWGA 1DQRA 1D07A 2R4QA 3MN1A 1KDZA 5IVHA 1NTOA 1CZHA 5CJ2A 1QLHA 1CUAA 3WOVA 3NRCA 4MO9A 3O8OB 1P0FA 4TV9F 2KBEA 4C0XA 4Y1RA 4W1RA 1EXMA 1R74A 1M10A 2F9FA 4KDRA 4I50A 5FOQA 2ACKA 4QDXA 5HMMA 3U3KA 1Z8NA 3ZW7A 5K0CA 1P7VA 4PCVA 1U1GA 2DUWA 1J2RA 3L7AA 4RKRA 3TB6A 4G0NA 1NBAA 3RWBA 4BVJA 3HFSA 3ETJA 4V1CI 3LRPA 3LECA 1J25A 2P6OA 1D1TA 3HK2A 4NCNA 4NMLA 4MA0A 3REQA 3VR5H 4CMAA 1KL7A 2I6GA 1OVGA 1WMFA 2FW0A 2HJWA 4ALNA 4K9LA 1DEAA 3E2IA 1PE0A 3OFVA 4TSFA 1VKHA 4N01A 4A27A 1SXJA 1PFWA 3Q7IA 3E35A 1JPVA 5JSYA 3R8XA 2PS1A 2ZQYA 6NULA 2J9ZB 2JLVA 1L1RA 2B4RO 1U0LA 3GAFA 2B0JA 2ZJFA 1TMYA 3K1AB 4J1NA 4ZVQA 1C1DA 1ECFA 2QR3A 2PUDA 4JL6A 3C97A 4Q3DA 5K0TA 3GLHA 5AQ1A 3O7MA 4D57A 4G5HA 1W29A 3SQNA 4ZOAA 4NR0A 3PFFA 1GGHA 3SIPA 4AWXA 1SG9A 2V5VA 2QUJA 4JHXA 4V0QA 2OMKA 3HU5A 2WZBA 2WZQA 4HNSA 4M1TA 3WL7A 2ERCA 2ZIXB 4MKXA 4NBSA 1PFKA 4U4AA 5CT5A 1CJUC 2P41A 2ZR8A 3BJRA 3TZQA 3UUEA 2HH9A 4KLCA 1Z5UA 3K31A 2YN0A 3BH0A 3NH6A 4YDRA 3NDBB 4XARA 2OFXA 3FMFA 3L41A 1XHEA 3PFKA 5I01A 5TIIA 1TCVA 3ZHQA 1QYWA 1N6OA 1QOPB 2GYVA 2RHWA 4TZ0A 1P1HA 4QZVA 1MRZA 4QAJA 3G2HA 3ANMA 2ZYWX 2WQ6A 1TM5E 4C4TA 2NYAA 4BZQA 9LDBA 5JSZA 3C1UA 4QTYA 4E4RA 3KEGA 4EK9A 2IHTA 4QUJA 4RZ2A 3HPQA 2C9DA 3E3AA 1IK6A 1ZNXA 4GQBA 3QYPA 1MG5A 3P45A 5BQPA 3GUUA 5KOHA 1BOFA 2JLWA 1HT0A 2GCPA 1GNPA 4PXAA 1P3JA 1SHJA 5CNIA 3S0JA 3U31A 2O8NA 3G7UA 2HEIA 3PNLA 3QYAA 1P6UA 4WECA 1SUPA 4D1YA 2Q4DA 2B8TA 1ILWA 3VR2D 1KDRA 2KLHA 4D81A 1ULBA 1II8A 4WBXC 2ACEA 2XE7A 3GLKA 4J07A 3RJ5A 1OB2A 5JZ9A 1H3NA 1Z2OX 4R1SA 4ZK6A 5L4NA 5EZYB 1K5DA 1Y4ZA 4GH5A 2J5RA 4LOKA 1OC4A 1ZA2A 1F2TA 3N07A 4IQGA 2OG1A 3W5CA 4OBWA 1V7QA 4XWAA 3UPTA 2XQGA 4JOCA 3WAKA 1ORTA 1DHTA 5MN6A 3BRCA 3A58B 5DJ5A 1KMCA 5JCJD 1Y81A 2Y0PA 2IE8A 2CJPA 4F91B 1TKRA 2YDYA 4C4SA 1ORIA 1V1MB 3L9WA 3O8NA 1U8AA 4EO4A 1AZLA 4X41A 2EIXA 1RKBA 1RQGA 5HA5A 1LRLA 1UP7A 2VT3A 2B2CA 1M8GA 3GP5A 1H2BA 3GUZA 2JFGA 2DLDA 1M1XB 2VQSA 1D6JA 4WWHA 4YI5A 5FD8A 3VR6D 3UCEA 2ZI7A 3ZW9A 3S1AA 5F3DA 1CDDA 3H2ZA 4G24A 3R6WA 4IZ6A 1YS4A 3NHJA 4MLDA 1RXCA 3FCSB 5C1DA 4YACA 2OECA 2ZSIA 3GJ3A 3RVMA 4FFRA 4IDHA 1V4BA 3D2BA 1GRRA 3L4JA 1S8FA 2ZSDA 2EW8A 3WYNA 5JSUA 2IE0A 2XD4A 5DMXA 3G2LA 1GZ6A 5EI5A 3IA7A 1G3QA 2RGGA 2I4RA 3VMFA 1OLOA 3UN1A 1F4VA 4MJXA 1YS7A 1XTUA 2JC3A 1JPUA 2WF6A 5HDBB 1DCTA 2VUSA 3FVRA 4RTSA 2VNJA 4XB1A 2Q3MA 1B7GO 1MT0A 5CYGA 3K0CA 1QVAA 4KXUA 3VH3A 3I6IA 4QTXA 1G66A 3B53X 5F3RA 1Y1RA 3QWAA 5FQOA 3RTDA 2H48A 3CSUA 1RABA 3RC8A 1QOZA 1YAJA 1X7XB 2NO0A 1R00A 2F17A 4FX5A 2LKDA 4XQ0A 1Y9AA 4JR1A 4PQGA 5FR1A 4AJ2A 2XEXA 2V58A 3HJHA 1X74A 1FE8A 2XF2A 1XD2A 5JNTA 3HY3A 3A11A 3OCUA 4MQ5A 1XTKA 2KQUA 5TC4A 1QGUA 1VJTA 4CIAA 1AX9A 4J2OA 4HP8A 4LNUA 3B1WA 3ZCQA 3BZUA 3K8YA 4KNVA 2VRBA 3JU3A 4RAOA 5B6PA 5C2JB 3K9NA 4JWKA 3SICE 4BNGA 2A84A 4JKOA 4MUHA 3PGMA 2BZSA 5HDQA 1YS9A 3CO5A 1EFHA 3H6GA 4G9GA 4K3VA 5THKA 3S8EA 1PZMA 4CKWA 3ZGYA 5HKLA 1AB6A 3UFXA 1F6BA 4GOMD 3L7CA 1Z22A 4GR4A 2G4LA 2OA0A 4IHJA 4FQ8A 2C5EA 2X8AA 3D8BA 3EXFA 3SCZA 1PQWA 2CEAA 1L7QA 1OOEA 2BI4A 2AOVA 2VQ3A 2YBEA 3O26A 1JLHA 1MOPA 1KMHA 4G1EB 3N7TA 1CUSA 3UT6A 4TSRA 3T4UA 4JI3B 2HGSA 3FKSA 3M4YA 5I7WA 1TW2A 3D7KA 4I7EA 4MVJI 1J49A 4OHXA 1GFWA 3RHFA 4CMIA 4F4IA 5A4KA 2E5WA 1NJSA 3LP8A 3ZU4A 5FL7D 2OO7A 3N8HA 4HOYA 1G0OA 4MUXA 1K0UA 1GNQA 1H1LB 4RXMA 3IKJA 4CLXA 1D4ZA 1WUTA 1YFJA 2J0QA 2G5CA 1GQ2A 4KMSA 3U7JA 4ZCLA 2WKPA 4J0FA 3LC0A 5D84A 4RVHA 4EKGA 4DQVA 4LQCA 1XZFA 1RPJA 2A3NA 3WLTA 3VSAA 4ER6A 4E2YA 3CRRA 4RD1A 1DI0A 5DXAA 4MV6A 3ZXYA 4BFVA 4W5QA 4DWJA 3H65A 1BTOA 1L4UA 1PGNA 2ET6A 1Z6QA 3MNFA 4DRYA 2P77A 5B6JA 5IZCA 1MKYA 4QKQA 3G02A 2FZ4A 3BMQB 4GI1A 1Q7BA 3QH4A 4PZEA 1WBJB 2P3LA 2GA9A 5D87A 1WSWA 3OM1A 4O25A 1GL6A 5DT9A 2OL4A 2WYWA 3SC2A 3W3AD 2XQKA 4XUDA 4RPHA 3I9FA 3NFRA 1GA4A 3KJNA 3RVSA 3ZWAA 4M0LA 3GAAA 4R1NA 4K5QA 5B3LA 1XRRA 3HYLA 3L1KA 1RFLA 1JAXA 5H70A 1U28C 2NTVA 2VT2A 2O5VA 4HEJA 4E5MA 4JB0A 1M7BA 3QOYA 1QMGA 1EAYA 1Z4IA 2DFDA 2XWPA 5I8ZA 1LCIA 1VSTA 1YCFA 4L08A 4YAWA 3FYCA 1AK9A 3U4IA 1CX9B 3AUYA 3STXA 3DLCA 5ITVA 5DFAA 5BY2A 4REQB 3RD5A 1B23P 1EIZA 3GJ5A 4OKSA 4RNCA 3EZYA 3IE1A 4CI9A 3GEEA 4ZZ3A 3LWDA 5BSTA 3EMVA 2XT6A 3FPEA 5C8VA 3WGUA 5KZMB 2HWUA 1OXBB 4UPVA 2P90A 3NHZA 2HHJA 2OXFA 2FPPB 3JARB 3QUBA 4FNMA 1F20A 4MYDA 2QN1A 4Q39A 4C7JA 4ZI7A 4LVOA 1CUHA 2IEIA 2V1XA 3AX6A 2RBGA 4AUKA 3CZ5A 2OXRA 3JD3A 1TGYA 4ZVPA 5ADVA 4KPFC 2ZSEA 1KU6A 1QXSA 1J8YF 3UW1A 2SBTA 1LU9A 1XMJA 2IC5A 1A72A 5C5DA 3PEEA 4GE0A 5A9SA 2A1IA 5LDHA 1O8CA 3O75A 2XR1A 4BC0A 4BWVA 3U0VA 3WGIA 3OUUA 1E59A 3P9PA 3QVGB 1G5QA 4AF7A 1QGZA 3OQOA 2LUOA 3ABQB 4GNKA 2PD3A 2UVPA 4WDQA 5K3AA 5JHGB 3AVWA 4BFUA 2Q5LA 2VNKA 4UVHA 3VPFA 1V1JA 2J9FB 3SHTA 1HDYA 2HTFA 1K75A 3G5UA 4YRNA 1KYTA 3SXUA 4BKPA 4LDQA 3SJ7A 2V6GA 1OW3B 1GZUA 4P36A 4WH0A 1T1SA 2DFPA 1JQAA 3TJMA 3HGMA 2QT0A 3WKEA 2DKFA 4MWCA 1YA8A 5TMEA 3HV2A 4I5DA 3U4CA 2QJFA 2FMIA 3T5GA 1XKLA 5SYAA 2YXNA 1GL3A 1NJ2A 4XPIA 1NA5A 2PLNA 2F62A 3KO8A 3DPUA 1CCWA 1DKMA 2QL9A 2HRQA 1ZXLA 1C0PA 1CUJA 1THTA 4IDNA 4X3OA 2AKAB 1LX7A 4R98A 1Z38A 1S3IA 2XZOA 3D4LA