1S9DA

Arf1[delta 1-17]-gdp-mg in complex with brefeldin a and a sec7 domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
161
structure length
155
Chain Sequence
MRILMVGLDAAGKTTILYKLKTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-Ribosylation Factor 1
publication title Structural Snapshots of the Mechanism and Inhibition of a Guanine Nucleotide Exchange Factor
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein transport/exchange factor
total genus 54
structure length 155
sequence length 161
ec nomenclature
pdb deposition date 2004-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s9dA00
1NP6A 4FI3C 5CLLA 4A82A 2QAJA 3ZIAD 4ZIRA 2ZANA 1KZ7B 3EIQA 1E0AA 1K5GA 1OH5A 1N6PA 1UBEA 2IA5A 3PEYA 3KQUA 3DL0A 2KBFA 4JVMA 3PUWA 1UEJA 5SZJA 4BEJA 4II7A 2XGJA 1QHHB 1UKYA 4H9GA 1OPXA 4PHHA 1HA3A 4DXAA 1G64A 2RGNC 5JS8A 3HYTA 3OE7A 2W2VA 4MGIR 3UMFA 1JXMA 1OKKA 1P4SA 4TLBA 1WCV1 4C0BA 3K70D 3A1SA 4OI2A 4F38A 3LFUA 1Z63A 1UBFA 3VR3A 4WAUA 4M1MA 3AVXA 4HB4A 5DE3A 3QF4B 1QG2A 3NBZC 3HDTA 3VHXA 5L3QA 1MRNA 4NH0A 5EP3A 2P0EA 1OSNA 5TB5A 3W34A 1DEKA 1E96A 5CITA 1R2QA 1W44A 1GDDA 1LFDB 1H8EA 4NCIA 5KO2A 3I92A 3GLGA 3UPUA 2ZJYA 1JNYA 3J81k 4QM7A 4OQLA 2V1UA 1Q20A 4HAXA 4DCTA 1KI6B 2O8DB 4DVGA 3PEUA 1XJ0A 1II8A 5FTKA 1KI3A 4QBGB 4QC2A 4EPYA 1LW7A 3D8BA 1GTVA 5EUMA 3RHFA 3TE6A 2H92A 4CVNA 1FNMA 3TVTA 3BFVA 3U61B 1G8FA 1GKYA 1P9RA 4BLQA 2UZ3A 4FWIB 4EKDA 1GG2A 4JLNA 1E2DA 4BFWA 3KL4A 5K8TA 1GOTA 2XTMA 3CNLA 5FBQB 1KY2A 4OQNA 4B43A 4OQFA 2VPPA 2OUKA 3GJ8A 1X6VA 3Q85A 1FTSA 4DEXA 1Z8FA 4LHXA 1LNZA 1DOAA 2WWGA 3K09C 3VX3A 3PEVA 1YZLA 1GILA 3CZQA 3KJGA 4K8OA 3B7GA 4YXWD 4PO8A 1OW3B 2Q3MA 1YE8A 2GNOA 1PJRA 2DY1A 4DLTA 2W0MA 3I8SA 4W5JA 5B57C 2X1VA 2RAPA 4F4JA 3ZVNA 1NG1A 1G3MA 2Q3HA 2K5UA 2Q21A 4H1VA 1ZM7A 1CJVC 3CH4B 4WIAA 4I1UA 4OL0A 1WMSA 4OK3A 4LWZA 1A1VA 4Q02A 2W0SA 1XZQA 2CL7X 3RS4A 1RYHA 4V0LA 3EG5A 4AKGA 2QNRA 1N5KA 2BM1A 1UKZA 1TF2A 1AN0A 2QMOA 2MMGA 2WJJA 5FTJA 2PZGA 4FCTA 3SDZA 3SS8A 1KDTA 1G18A 1OFUX 3ZGXA 3BRWD 1DAHA 1CKEA 1NVXQ 2QMHA 4LJ7A 3BIFA 5EXSA 2ANCA 2JJ2A 3VR6A 4M2LA 3QPVA 4C0QC 1QHYA 1CBUA 1YR7A 1XMJA 2J46A 1XPOA 4KITB 2XZLA 3ZJYA 1SVKA 2IYWA 5LB2A 4RD6A 3T15A 1MV5A 1NL3A 1N6RA 4JJZA 4M53A 3TGPA 3U44A 3M0EA 3ADKA 4CEJA 1GNQA 2ZYWX 4M1KA 2I3BA 1R10A 5GVRA 1H65A 2GVZC 1YJ5A 5EUQB 3RABA 1IY2A 2ECKA 3ECCA 1Z0KA 1E2JA 2XOKD 2ZAOA 4GOJA 1XWIA 1OXUA 2ZRDA 2CDNA 3AVQA 3I73A 1U94A 2EFCB 3ZH9B 4DCNA 2NO9A 2VA8A 1WF3A 1KOFA 1UPTA 1U0JA 1XMSA 1C1YA 1XMIA 1YVDA 3CX6A 4IFBA 3KZ1E 1VHTA 3QKRB 3AGPA 4TT3A 2BCJQ 4AYTA 4Q9HA 1FMLA 5DI3B 5EJEA 4AY2A 4JLVA 3VMFA 1G16A 3K1JA 2J0UB 1BIFA 2G1JA 3DM5A 1S0UA 4ZIRB 2R44A 1A7JA 4D25A 2ZRAA 1QDEA 1WP9A 3ZS9A 2FZ4A 3RNLA 3HR7A 1HTWA 3OEED 3EIHA 4OHXA 1RRPA 3PCRB 1CJMA 2QSZA 4P32A 3ZVMA 3BERA 4GRAA 4OHVA 3RC3A 1CS4C 2NG1A 3L0PA 1KNQA 3FVQA 3LA6A 2O8BA 4D4JA 3CRQA 3MGCA 1N6HA 2QM8A 1G291 2PEYA 3QKTA 1R0XA 3T34A 1XX6A 3LVQE 4L16A 1I4LD 5CM9C 3VFDA 4EDHA 2R6FA 1TAGA 3GQBA 1CJUC 5L3QB 2OHFA 4A2PA 1QBKC 3HU3A 3A36A 3Q9LA 4RZXA 2GBLA 4BRWA 2AL7A 1E9BA 1DO2A 2AD1A 1SZPA 4B32A 1E9DA 3EPKA 3EZ9A 4PXAA 3W6PA 4Z8XA 2IWHA 1M7GA 1CJKC 4RZUA 3LBNA 4QG7A 2W2XA 4HAVA 4JLDA 1CF4A 2IT1A 4HAZA 4IVQA 1II8B 3GJ6A 1DAIA 2IYTA 2QTHA 1E9FA 1F48A 2O8EA 4MRVA 1AKEA 1BMFA 2XXAA 1Z6YA 1WRBA 4TMXA 2XB4A 3OIUA 1H8HA 3S1AA 1J7KA 4NZYA 3B1WA 4E09A 5J5CA 4KO8A 1HURA 2ATVA 2VHQA 4NYIR 4ZPXA 5DNYB 2CMKA 1E0JA 3HP1A 4LSGA 4P4UA 2ZE5A 5JWOA 2DBYA 1Q12A 4TL8A 2Z43A 1P2TA 4B47A 2GXAA 3RC8A 5FOXA 3K53A 2HUPA 2BIFA 4A1FA 1OLOA 4D82A 1W1WA 4FMDF 4CZ2A 1N0UA 2AFHE 1U0LA 1QHSA 3C5HA 4HDCA 1NBME 1N5JA 1Z3IX 4TTPA 4A0FA 3P4XA 2FNAA 2PMKA 3DM9B 5AJVB 5FL7A 1LY1A 1R5OA 2FV8A 5JRZA 5CYOA 4AKEA 1G6HA 1FP7A 1ZCAA 2JLQA 2VHTA 3GJXC 1WE2A 3LNCA 3KQNA 2HEIA 4JLJA 4KXFB 1OJLA 1YR6A 2ZYTX 3KUCA 2ZRFA 2DFNA 3LRPA 1UM8A 3F5FA 3GFPA 5KOYA 5DYIA 3VU9A 4Q1FA 2PT7A 2RGAA 5JBQA 1JR3E 4BE7B 1EX7A 4PAMA 3PIRA 1R7RA 4X8OA 4EPVA 3IQWA 1X8JA 3TAUA 3AEZA 2WPDA 2ZXUA 2FDCA 2QRNA 1I4DD 1WXQA 1SXJB 2CK3A 1KAOA 3CM0A 3EXAA 1NVWQ 3I5XA 3UG6A 4QOSA 1N6KA 3FKSA 5FBVB 5E7JA 3BAFA 3U7EB 2OBLA 2FN4A 5FH9A 2QP9X 3PUZA 4Q1DA 3V4RA 3AVPA 3SFZA 1OYWA 4IOKA 2ZR7A 2ZTSA 4NKRA 2PJRA 2GBLC 4MGKR 2BM0A 3OIVA 1E79D 4QJ5A 2WWHA 4D4KA 1ZC4A 3U44B 1ZIOA 5KSOA 4QFMA 1UF9A 2C03A 3NDBB 2HCJB 3NXSA 5AUOB 4CEJB 1UADA 3VR4A 3LWNA 2HXYA 1OIVA 2KJQA 1K8RA 3LX8A 2VP9A 1ZJ6A 2BKEA 4IRUB 2BC9A 1ZP6A 2IEYA 2DHRA 1E2NA 1VG1A 2PEZA 3AV0B 3LBHA 1U8YA 1T3HA 1Z6XA 2QZ4A 1R8SA 5JLJA 1E99A 3T1QA 4CEHA 5KSZA 4B3DA 3A4NA 2WMNB 3AUYA 1A4RA 3EAQA 2R8RA 3T1TA 1G19A 3EW9A 5CB8A 2JDIA 3B1YA 3CBQA 4QKQA 3FYHA 4XVQA 2PMDA 1GNPA 4ACAA 1G3QA 4ZDKA 1FZQA 3NEYA 4LJ9A 5BYKA 5HE8A 2REXB 2ZU0C 5J4YA 3DMDA 4BZPA 5L3VA 2VYFA 2IHYA 2UVQA 1Z2AA 2CCGA 3N70A 1KMQA 1AQYA 5AUNB 4RFVA 3IKJA 1W49A 2IYUA 1DAKA 4LV8B 1MO5A 4FCVA 1W4BA 3A8TA 3ZYCA 1KK2A 2WZQA 3PG5A 4X8HA 5FTNA 5A0FA 2FG5A 1RJ9B 2IYRA 4G5SA 1IN7A 5EP2A 5GJBA 2O8BB 4D4MA 4DRZA 1TUEA 3U7HB 4AD8A 1JQJC 4Q9IA 3ZZUA 4Q00A 1LF0A 4Q7KA 1W0KA 4TQUS 3T1OA 2QTFA 1Q1ZA 2CNWA 1T91A 2XSZD 3WXMA 4HAWA 1Q22A 5KYKA 3K0FA 5IT5A 4LZZA 5B58C 3W5JA 1IJEA 4MKIA 3TUIC 2ZYVX 2V3CC 1E2KA 1YZQA 4MQBA 2W83A 5EE9A 3W8RA 2P65A 3AVWA 4JLBA 4LJYA 2A2ZA 5FOTA 5JHHB 1KTVA 1Z07A 2H17A 2NO0A 5A5GA 4KU4A 4LBVA 5UKDA 1FTNA 1R5NA 2E87A 1HE1C 2G77B 2BEKA 3CIOA 1VG8A 2G83A 4IKEA 5FOWA 5IDVA 5AWFC 1E9RA 1W5SA 3QF7A 4RD1A 1CR1A 4TMZA 4TQAA 2QE7A 1XMVA 2O8EB 2XAUA 4PQRA 2WAYA 3EX7C 2XXAB 5JJKA 1R8QA 2JLVA 3C5CA 221PA 4DLUA 1NN3A 2CHGA 3WBKA 2C95A 1ESNA 1P5ZB 1SKQA 5FOUA 4LBYA 4Q18A 1VIAA 1G3UA 3S1AB 4OQMA 2CLSA 2CHVA 2NTYC 4UNPA 4PC7A 3B1VA 1G5PA 1E94E 2IWRA 3RRYA 3X2SA 1E9EA 1RVDA 3KJIA 2ZSFA 5DI9A 4GP6A 1NN1A 3BWDD 1E79A 4V02A 1E9CA 2QU8A 4UXJA 1DVRA 1RKBA 2DWOA 4HLUA 3ZDQA 2QPTA 4YONB 2R6DA 2NZJA 4QBIA 5JJLA 3ZD6A 2YWHA 1NIPA 3SJCA 1E1QD 1MO6A 1N3BA 4JLOA 1EFRA 2PZFA 4A9AA 2ZRPA 2KI5A 3ADBA 4GMXA 3V9PA 1PLJA 2WSSA 4UJ5A 1OFHA 4DSOA 1CLUA 1TUIA 1ZNYA 4MRRA 1V5WA 4B35A 1KO5A 1QHHA 1CU1A 3GEHA 1BO6A 2WJGA 2ZI3A 2WJYA 4B34A 3I3SR 1VCNA 4G5RA 3VU9B 4FD2A 1ZRHA 5HKKD 2ORIA 4JJKA 3Q7PA 2XZPA 4DUGD 2GK6A 2F7SA 4AWXA 5KNDA 5B2ZA 4Y0VA 2ZE8A 4MA4A 4LPKA 4R2HA 4YDSA 3KDSE 2IS4A 2CE2X 1FFHA 4DCSA 5BN5A 3TMKA 3I62A 4LJ6A 1VCOA 1S3SA 2GTPA 3MWLA 4Q66C 1V43A 5KSPA 3VKHA 4JSTA 1UKVY 1RRCA 3B6EA 3LH5A 1NBMA 4JLAA 1AZTA 2HYDA 4URXR 1SVSA 5F2EA 5BYJA 2W6ID 3OFND 1NLZA 1E9AA 2OLKA 2OSBA 2N46A 4HDQB 2OCPA 2O8DA 3C41J 4JZKA 4JBYA 1E2FA 1DAGA 4QHTA 1T4GA 4KBFA 3W6OA 4L15A 4LRWA 1G5TA 4Q7JB 3ADCA 3BOSA 3VKGA 2ZETA 4M9XA 3H86A 4P0TA 2ZSAA 1TX4B 4I1VA 1X86B 2QP3A 4CEHB 3QY0A 1JR3A 1II9A 1GFIA 1DG1G 3NIBA 1HQYE 3DKVA 2G1KA 5E4FA 2A5YB 3AF2A 1SXJE 2HYIC 1L4UA 3ASYA 3OE7D 3OF5A 3TVDA 1AS3A 1P3JA 4PC3A 4ERNA 1NG9A 1XEXA 3CB4A 1YRAA 4M1SA 4P4TA 1OKKD 5EE1A 4QJ3A 4DLZA 2WWXA 3B82A 4NONA 2BEJA 2DYKA 1II0A 4HLUC 3RANA 3V00A 2RHMA 1S8FA 4NYIQ 1OXSC 1T8UA 3MJRA 3RS3A 2OESA 1FOEB 4EJSA 4LHYA 1VHLA 2V55B 5EXTA 3KQLA 1ANKA 2J87A 1W36C 1KI1A 2QL6A 1LF5A 3DKPA 4G0NA 1Z0IA 3QUSA 1H8ED 4IOJA 2JLZA 4XTRA 2F6RA 2W2TA 4Q4JA 1P2UA 5CJ2A 1DBSA 2MSCB 3K0FB 4R98A 2VRWA 3EZ7A 3TUJC 3K0CA 3BH0A 2ZIAA 3PUXA 1XDBA 3QOFA 4URUR 2Z0MA 4XWOA 3ICEA 1GRQA 1FL9A 4TYNA 4JKIA 2NZ8A 3E2IA 3MRSA 4V0KA 4DHEA 2C04A 4BFTA 4LJ4A 1PZNA 2DR3A 5C4MA 3NDPA 2BJVA 2GJSA 4D2IA 2HCBA 2DFLA 2W6JA 2FSFA 3WRXC 3X1WA 3SJZA 5J4HA 3R20A 3TR0A 4Q9LA 3R9IA 4Y0AA 4IDNA 2C96A 2Z6VA 4A6XA 4BQSA 2O8CB 2DWPA 4V0ME 3U3OA 1GVNB 3QSYA 2IW3A 4QJ4A 4PQFA 4R71A 5G41A 2E9SA 3TSWA 4A0RA 5CK4A 1XZPA 2QQ0A 4TTRA 4C9BA 4AI6A 2ZQ5A 3D6TB 3SFVA 1N6LA 1RE0A 3REFA 5CIQA 5SZHB 3LQQA 4TLEA 1XFAA 4XD7A 2JLUA 4KVGA 4OK6A 3U3MA 1S9HA 2WKQA 1KO8A 1N6OA 2WWYA 2ORVA 5GJVC 4GBMA 1TQ4A 3CO5A 2J59A 5DI3A 1X8KA 3B78A 5C18A 3U60B 2GESA 4KVAA 2J0UA 4DIEA 1S96A 3AF0A 1DPFA 2OG2A 2X2EA 2YC4C 3P20A 1Q3TA 5DO9A 4MYTA 1Q21A 3WMGA 3SHWA 2A7QA 2VBCA 2A5DA 2ERYA 2O52A 5BW8A 4MH0R 4V0NA 3TJZA 5LPNA 1ZU5A 3G0HA 1R5BA 5EXXA 4F4IA 3EPHA 3FMIA 4PO9A 1LS6A 3KFXA 4IXNA 4LBWA 2JJ2D 5SZIA 2VP0A 821PA 2FX3A 2GJAA 2VSOA 4C0HA 4EJSC 4DSNA 3SOPA 2CLCX 2ZEJA 4CT5A 5KSYA 1DADA 2J9RA 5DYGA 2H18A 4PTLA 1OYYA 1R4AA 4NYJR 2ZI4A 4MGYR 3AP3A 5FTMA 4JL6A 5JEEA 1KI7A 1CTQA 4LBZA 4PZYA 3K0CC 1P75A 3KXIA 1J70A 1E2EA 1Q1EA 2UZIR 1SVWA 3DEFA 2DPXA 3X1YA 1GWNA 1F2TA 4YLGA 1JXOA 5HR5A 3SBDA 1Q1QA 4M1WA 2D7DA 4AIIA 3U6KA 3EA5A 1GL9B 3QIAA 4CRWB 1Z6GA 1NKTA 2AD5A 5D3QA 1IHUA 2JIZA 2YJTD 4TT3D 2EWVA 4O2RA 3VTKA 3IGFA 2PZEA 5FR1A 1U90A 3O8DA 1A82A 3LW7A 4D26A 2CCJA 3BS4A 2ZJZA 2WKRA 4S2EA 2XEXA 2ZI6A 1P62B 2IXFA 3LW8A 4LUCA 4BLSA 2ZS9A 4Z51A 2FF7A 3THOA 3MCAA 3P26A 5DHFA 4DSTA 4E03A 5F9FA 4ZCMA 4DDTA 2OXCA 3IBYA 1RW4A 3AB3A 1XEXB 2VHCA 1IONA 1RYFA 1SHZA 2HV8A 2NQ2C 1JAIA 1AKYA 3UWOA 4PANA 2J5XA 1HUQA 2ZRHA 3DHWC 1TQ2A 4KFTA 3U6BA 2P5TB 1NSFA 3ZQ6A 2VP4A 3U7FB 2F3TA 3CPEA 5M04A 2EFEB 3IIJA 1NVUQ 4EJSB 4BPBA 1RIFA 1NRJB 1Z2CA 2QMEA 4BRUA 1XCPA 1ZM9A 4UXIA 5FBRB 2FSGA 2I1QA 3MWYW 4ZDWA 3BBPA 3C4JA 1OFTA 1D5CA 5EP4A 3B9QA 4Q4JB 2XTZA 4Q9KA 1P6XA 1YZUA 1S4QA 2HF9A 4YMVA 2ZRJA 4CGZA 4FMBB 5JCZA 2J7KA 5HZHA 4US0R 5JSZA 4QGAA 1JR6A 4KJZA 2QG6A 1YHNA 1OB5A 2X2FA 1E4VA 2V7QA 5FI1B 1ZUNB 2A30A 2O8FA 3U3RA 1BMFD 2EVWX 2NO1A 3FFBA 1R6BX 3MUFA 5IK2A 4HEJA 1SXJA 4E22A 4DDUA 3QXJA 2UKDA 4B6FA 1G4AE 3QXHA 2N1BA 1NI3A 1W4RA 1VDZA 2ZJ2A 3OHMA 1H8HD 1US8A 1M34E 4D80A 4DB2A 4QBFA 3QKUA 1MKYA 2XJ9A 4L4UA 4E07A 3R9XA 2JLRA 4ZKDA 721PA 5HZKA 1D6JA 3A6PC 2SHKA 2G0NA 2C98A 5DLQC 1SVOA 1XTKA 1PLLA 2D2FA 2AK3A 1XP8A 4B3XA 4DSUA 3W3AA 2DFTA 3B13B 1S3GA 1YZNA 4GNKA 4EFMA 4GFDA 4LJ8A 1D9XA 1EXMA 2EU8A 2D62A 2ONKA 2JJ8A 1L7VC 4OJQA 3VNVA 3EPJA 4KLNA 1OIXA 4QL3A 1P9NA 3AQ4A 2ZRGA 1COWA 5FL7D 4BZXA 2HT6A 5JI2E 5IF9A 2XB2A 3UWKA 4RKFA 1XEWY 1HT2E 3BC1A 2RGCA 2FFQA 5G3YA 1VTKA 2GAAA 4HB0A 4AURA 4BLOA 4CYMA 4DLXA 1BKDR 2RGBA 2A78A 2ATXA 4BUJA 3FHCB 4QM6A 2QM7A 2C9CA 4B3GA 4HZUA 1U8AA 4YMTA 3FTQA 4WBSA 1ZD1A 4TSFA 3EZFA 3FE2A 2MSDB 1P2SA 3H84A 1G41A 2D4HA 3AF1A 3DPUA 4M1TA 1AQUA 2WTUA 1N5LA 1Q44A 2LCFA 1E6CA 2ORWA 1DAEA 5GVSA 2OXRA 1T3LA 5KNBA 1GRNA 3WBJA 1G20E 1NY6A 2IYSA 2WPDD 1U99A 1DE0A 1N0VC 2GHIA 2CK3D 2I1VB 1UJ2A 1LS1A 1W4CA 4KLZA 4M21A 2EQBA 3FKSD 4IHQA 3LLMA 1TU4A 4FMCF 4MKHA 3UG7A 4V0MA 1RJ9A 2FWRA 1XJQA 1GNRA 3WYAA 4ARZA 2BBOA 3LXRA 5G40A 3ZD7A 3LY5A 3SC3A 1Z5ZA 2OFXA 1X1SA 4MYCA 1TNDA 2OBMA 4LYAA 2R65A 2WWWA 2AXPA 1ZINA 1F2UA 4MITA 1E2HA 3VR1A 4XVUA 4BLTA 2AFIE 3ZZ0A 1TADA 4EPXA 2WIBA 4JKYA 5E7MA 3OIYA 5K8LA 5LBIA 1IN5A 5E7IA 6Q21A 3T1VA 4OHWA 4KV9A 4B48A 1F2TB 4DBLC 1K5DA 2R2AA 2Q0HA 2D3WA 2J45A 3PFIA 3TNFA 1HT1E 2P3SA 1SXJC 2G88A 2EYQA 1UBCA 3UMSA 2GJKA 5TV2A 3I1FA 3IIMA 2JDID 4PPFA 4RZ2A 5FOVA 1MO4A 3CX8A 1VECA 3AF3A 4F91B 4GZMA 3B1ZA 1ZM4A 3L0SA 1T9HA 2R62A 3WNCA 4KSCA 4CF7A 2IYXA 5KUTA 2ZS7A 5J4LA 3AF4A 2A5GA 2NPFA 3SBEA 2GKSA 5FI0B 4C7OA 5EP1A 5GJCA 2ASEA 4BLPA 2QORA 2YOHA 2R6AA 4AG6A 1AGPA 4Q4HB 2ZVQX 5C4GB 4KFSA 3D7MA 3WHLA 1F5NA 5EE0A 4LJAA 1BS1A 1U0HC 4PHTA 5FUVA 1J8YF 2FGJA 5EE3A 1W0KD 3THXA 2OCYC 2CNWD 5JCPA 1QRAA 3RSLA 2D7CA 2PX0A 3BORA 3AH8A 2HLDA 2IHBA 4C0AC 1EK0A 4XIGS 1F60A 4MDEA 4OKSA 3KKQA 3O8RA 2Q3FA 3REGA 3PQCA 1VG0B 2V6JA 3VR2A 5FUWA 4E5UA 3SYKA 5HPYB 1E0SA 3TSOA 2DCUA 3GJ4A 3OESA 3OZXA 4UNRA 2QAGA 3M4YA 3ZVLA 3L82B 3T5GA 2AXNA 3C16C 4B6EA 1DELA 4NHOA 2CJWB 4A92A 5JSZB 4MGZR 3HPRA 3H0KA 3QPWA 2QE7D 2O8FB 2QI9C 1G8PA 2ZAMA 4PSVA 1Z47A 1G7RA 1ZVQA 3RRNA 4AKHA 5EXPA 4KODA 2PCLA 2VP5A 1US8B 2VLIA 2Q9CA 1ZNZA 5C46F 1BOFA 2WKPA 3BK7A 3ZS8A 4CW7A 1L2TA 4XVRA 1JB1A 4PQYA 1GUAA 1F6BA 1JEEA 1NLFA 2Z5FA 1J8MF 2CCKA 1VG9B 3EZ2A 2IYZA 1HV8A 3BE4A 4NP6A 4NYJQ 2YOGA 3CX7A 2VHJA 1ZUHA 4D6PA 4RZ3A 3X1ZA 5LDDC 3NG1A 3P27A 1W5TA 2P2LA 3HPQA 2D74A 3RS2A 1EFRD 5EZ5A 3LO5A 3HU2A 3EARA 3L0OA 4FMDB 3F0TA 4ZV4A 1KGDA 2BVNA 1OIWA 3WP1B 2GXUA 2WSSD 3NBFA 5AJWA 3TQCA 5KHOC 2X77A 2AWOA 2FPKA 4FN5A 1Z0FA 3BB3A 3CZPA 1NVVR 1FQKA 2HF8A 2IF0A 4O2LA 3IO5A 2FU5C 4TL7A 1N25A 4AYXA 2VH5R 4HZUB 2BJWA 1KYIA 3K9NA 3UXMA 4LHVA 3DZDA 1M8PA 2QMUA 2WAXA 1XD9A 3CF0A 4LHZA 3CR7A 3CUEF 2QGZA 3RS0A 3WMEA 1T0JB 4ACBA 2VSFA 1XTIA 1KJYA 2FZLA 4AK9A 1JEDA 1R0ZA 1CRQA 1XB2A 2Z83A 1CR0A 1FX0B 2QP4A 3IILA 3EPLA 4PSKA 3GFOA 2IS1A 1JBKA 1ZBDA 2ZRKA 3QXXA 4BFZA 1G8YA 3PUVA 3QBVA 3THYA 1M1YE 4TZ0A 1P60A 4G5OA 4NCNA 2GCOA 4ARZB 3CPHA 1MH1A 2C77A 1TL7C 3DO6A 1NBMD 2HT1A 4W9MC 1LVGA 1E2IA 4O3MA 1TF7A 4NCHA 2BMDA 4XJXA 3RYTC 4A6PA 4TZ6A 1F2UB 3JZMA 3B1XA 3P4YA 3KQKA 2VQSA 3MG9A 1CR2A 2EYUA 4ASUA 2EFHB 4HYYA 1P7CA 1DTSA 4TMTA 3TAHA 1LTQA 2FJUA 4IW3B 1TEXA 4ZI3A 5L3SA 4RSGA 3U7GA 2I4IA 1GKUB 1KMHA 1W46A 4YMWA 1KJWA 3GLFE 1GSIA 4C3ZA 4IXMA 4XTCS 1WDTA 3TSZA 1NKSA 1XBTA 5FL3A 4IOLA 3CRW1 2F3RA 5AUQA 4DLVA 5C2JB 1IY1A 1I2DA 1JR3D 1MO3A 1VPLA 3MLEA 3RS5A 3WY9A 5CB6A 3K9LA 4TMWA 3L0IB 2GEUA 2ZE7A 5FBLB 3NBYC 1E9SA 4M9QA 2IK8A 3CF2A 1ZNWA 2O8CA 5FPHA 2QSYA 2Q9BA 2WM9B 1OH8A 4YMUA 1BYIA 4GPTA 3FFAA 4YC7A 1IQPA 2ZPTX 3QI2A 1PLKA 4C7OB 3N2EA 1ZCBA 1BH2A 3FMPB 2ZRMA 3PITA 3MMPA 4PHGA 1N6IA 4DLSA 2P5SA 3THWA 8OHMA 2R6CA 4JT4A 1TQDA 4OQXA 1JPJA 1KO7A 4G01B 4PSAA 1QZXA 2ZR9A 2DWQA 4W5WA 2IS2A 4DT1A 1OXVA 2KBEA 3GLIE 3THXB 1NJGA 4V0OA 3FMOB 3JVUA 2WOOA 1G9XA 4X8MA 3CRRA 1NIJA 2V1XA 2EFGA 2CXXA 2IYQA 1U2RA 2L0XA 4LC1A 3QXCA 3UIEA 3NKVA 4MRSA 4L5BA 3BXZA 4HLCA 2FFBA 2CVFA 2OO7A 4N1AA 4BZQA 5JECA 4OJKA 2BV3A 4LV5B 2QAGB 3BJIC 4TL9A 4WOPA 4RY2A 2D2EA 2CHQA 3X1XA 3TW4A 1Z83A 4A4DA 1OXXK 3ONWA 5JEDA 2GK7A 2W6JD 5FPKA 5K8UA 2ZE6A 5FPTA 2F9MA 2QT0A 1DARA 5CLQA 4HSEA 4M8NE 2XJ4A 3K9GA 4ZO4A 1XTRA 2BCGY 1XEFA 1D8TA 3T12A 4A0HA 3BFKA 5FR2A 1IBRA 1UBGA 3R7WB 3KTAB 1EFHA 2FEOA 4PZZA 1ZNXA 2IXEA 2J1LA 2B6HA 5HTKA 2IEZA 3KQHA 5B64A 3G82C 2GVDC 2B92A 5LD2C 1FPMA 4JMPA 2QRZA 3ZQJA 2OEPA 1IM2A 1E1RA 4GT1A 3ND9A 4ILEA 3FGNA 3K0AA 4XD7D 3GJ3A 3PXGA 1G17A 3Q5EA 5H1YA 4QGHA 4A8JA 2GXSA 3GEEA 1ELOA 2ZRCA 4D0GA 5FTLA 5F3WB 2OBNA 4B33A 2IL1A 3SI7A 5FPSA 2HJVA 4PC2A 2QA5A 2JASA 2J0VA 2IBMA 3SR0A 2GJ8A 1U98A 3BD9A 4B76A 2NIPA 1UAAA 1XPUA 1ODFA 2QTVB 3ZVRA 4M1YA 1KHTA 4QGGA 3ICQB 3KXLA 2FSHA 2WOJA 1C4OA 4P33A 1RFLA 3CWQA 1Z22A 2O0KA 3HU1A 4EUNA 4C30A 1FMJA 3LAWA 1GRRA 2FFHA 4HLQB 3A1VA 1SKYE 4U7DA 1YU9A 4MUAA 4N0DA 4QRHA 3G5UA 2ZYUX 2NGRA 3WNBA 5DN6A 2F1RA 4B2LA 2QROA 4EPWA 2FA9A 1IXSB 2VEDA 3THYB 1UDWA 2AKAB 2C5LA 2W58A 1Z06A 2ZI5A 3KKOA 4OK5A 1VCIA 2GCOB 3I61A 1EWQA 1SVIA 1OE0A 5CYPA 4X8LA 3U5ZB 1EGAA 1YRBA 1JECA 1FUUA 3I8XA 3PV0A 5LB4A 2OE2A 4U02A 4RD3A 1YKSA 5CM8B 5E95A 2GA8A 1E2GA 2FGKA 4Q4AA 3BGWA 4BWYA 2HJGA 2JIZD 2OZEA 2ZRBA 1E98A 2A3RA 1S1CA 2H7VA 2REBA 3IIKA 3K0EA 4ZCLA 3QNUA 3GP8A 4GDFA 4AKIA 4TQ9A 2P6RA 2IF2A 5LD2B 2YWEA 4B44A 3NTUA 3PENA 5L3SB 3AVYA 2XNDA 4DLRA 2OM2A 1NMYA 4PHFA 1KMHB 5KDDA 1GM5A 1XD2A 4F93B 5HE9A 1LV7A 2EW1A 2J41A 2IUTA 4B73A 1XD8A 2BMJA 3CNOA 3OEHA 3Q8XB 1XEWX 2WV9A 3FHTA 1KSGA 1OHHA 1FP6A 4FXPA 4LJ5A 3AGQA 2ZJAA 3QG1A 2GAOA 1AGRA 3K9HA 1I4TD 4Z1MA 4JYCA 5FOSA 1NNEA 3VHLB 1KK3A 3LD9A 1W48A 1DAMA 2G6BA 2OT3B 2BBWA 5G3ZA 2ZU6A 3O8BA 2IS6A 3GMTA 1O3YA 2IXGA 4BGDA 3FDIA 4TTQA 2RGDA 3MSXA 4DCVA 3GPLA 5P21A 4NPHA 3TW8B 3SQWA 1SULA 1M2OB 4RD4A 4B74A 4XWAA 4H1UA 1E2LA 1YZTA 4HATA 1OH7A 3THWB 4TYPA 4URVR 5L8VA 2RGXA 3FOZA 1E0KA 2X8AA 4UJ3A 1AIPA 2O5VA 4IVRA 2NOAA 2ZSBA 4Z8YA 3W5IA 4DCUA 1WBBA 4PAOA 1FQJA 4TYYA 2YKGA 4DT1B 3CR8A 5BN4A 3IQXA 2V54A 1W2HA 2W00A 2WHXA 4ZI2A 2EWWA 4I1OA 2REOA 3PEWA 3R8CA 1UEIA 3MAAC 3R8FA 1PV4A 4I1SA 3GLFA 4HI0E 4CEIA 1RZ3A 3O8CA 3VQTA 4TYWA 2V7QD 4L8GA 4JYBA 2YVUA 3RRZA 3WHKA 1NVVQ 1RRFA 2ERXA 2C99A 2GILA 2VF7A 5IK2D 1IN8A 1SXJD 2BMFA 3V4FA 3IPYA 2JA1A 2VHUA 2WMOB 2V6IA 4BFYA 2OCAA 4I81A 4Q9JA 4QHSA 5IHPA 1UKEA 4LCBA 4ZCIA 2O0HA 3TRFA 1IOZA 4JSYA 4KBGA 2XNSA 2RGEA 1KNXA 2Q6TA 4KAXA 4M1OA 4PX9A 3C8UA 1XCMA 4BASA 5J47A 4KHZA 3A58B 3LXXA 1U81A 4K81B 2OILA 1KDPA 3EZ6A 2ZI9A 4DB4A 4DC9A 5J4KA 4Q1CA 4ZDIA 5BXQC 2ZITA 4IEIA 1N6NA 1VYVA 4GI7A 2AR7A 4HLDA 3NC0C 4PO1A 3JZAA 3SYNA 5BQ5A 1XJCA 1COWD 1M7HA 1VKJA 4EPRA 3U3JA 3TR5A 4I4LA 4DJTA 4AC9A 3GLIA 1X1RA 3EIEA 3OAAA 4UXHA 3RAPR 4CDGA 3DZ8A 4B3FX 4YQFA 1VYUA 1E4YA 1SHKA 1ZUIA 2CVHA 3LDAA 4G1UC 1KKMA 1TPZA 4FW9A 3K0AB 4KSBA 4IDQA 3AVOA 1EG7A 4MYUA 3B5JA 3X1DA 1KSJA 4A8JB 2H16A 4TSFD 3U4QB 2GZHA 3TUZC 1P73A 5TVKA 5KPDA 2PLFA 4Q1EA 1Z28A 1KO4A 2ZRNA 4GZLA 4WXPA 4LHWA 4Q48A 1FNNA 1KDRA 5EQTA 4RFSB 3VX4A 3H4MA 5CIWA 1CXZA 3TBKA 2VP6A 1MABA 4N0EA 1KI2A 3F8TA 3NHBA 1YZKA 3A1WA 1OXTA 3MWJA 3AKDA 4Q4HA 2F9LA 1KO1A 2GCNA 5JJIA 1W2GA 5DSZA 2CLDX 1ZM3A 1ZMXA 2J0QA 1TTTA 2BKUA 3LBIA 1XCGB 4UNSA 2FPMA 2V8OA 3EA0A 5TARA 1XNJA 1DG3A 2YV5A 5BWMA 2F1JA 2ZS8A 2HDNB 1NLYA 1YZGA 3JVVA 4M4SA 3DOFA 5FUYA 4B2PA 2OCBA 3LQRA 2ZJ8A 1G1MA 4A2QA 2PLRA 1G7CA 5AJYA 4NBSA 2JLWA 4A15A 1Y63A 1Z29A 1JI0A 1CR4A 3QEJA 2C78A 1JPNA 2VL7A 2JGNA 2FOLA 4LOAA 1AS2A 4KFRA 2ZUCA 4KI0A 4Q4AB 1Q57A 1R0YA 4J0QA 1W0JA 2CJWA 2D06A 3IBGA 2JJ1A 1E3MA 4LK2A 5TY0A 1KY3A 5L3RA 1D9ZA 4C2UA 1QVAA 3I4LA 2B7BA 3WMFA 4LDJA 4ZDJA 1XD2B 3D31A 2YYZA 1UDXA 4JVSB 1G8GA 2XTNA 1A5TA 1KZGB 1KKLA 2OLJA 2J7PA 2ZROA 5FPYA 1Z08A 4AG5A 4G5GA 1P2VA 3BFXA 4GP7A 1CEEA 3ZIAA 3CKLA 3RS7A 2RHDA 4OI4A 1G21E 3K8YA 3T35A 1PUIA 1Z6AA 2ZSDA 4HUQA 1IAQA 1NMXA 1ETUA 5FUXA 1T3SA 3Q72A 1UFQA 3UMRA 3QVVA 4M9SA 3W3ZB 3DMNA 3SJAA 2HLDD 5KPJA 2YOFA 1ESMA 2ANBA 4Q47A 3SNHA 2JATA 1YR9A 2ZUDA 4C0KA 4DEYA 4I99A 1E2PA 5K8IA 2PT5A 2OFWA 3T5DA 4ESVA 1VMAA 4DLYA 1OF1A 4US1R 4HUTA 621PA 1XXHE 4Z54A 4L9SA 5F98A 3GLHB 4FINA 1OB2A 1G8HA 3RLFA 3AVVA 4UKDA 1GITA 4TMVA 4URZR 3GJ0A 3GLFB 4CEIB 4ABYA 1OFIA 1S2MA 1RC8A 3FHOA 2X19A 2XITA 2CL0X 2B8WA 2HXSA 2MSEB 4TLAA 1AA9A 1ZU4A 3LV8A 1FX0A 5A4JA 4P4SB 3H1TA 2YHSA 5JWHA 5CK5A 3W8NA 1A2KC 1DAFA 1E69A 4A2WA 3GCGA 1GAJA 1XTQA 4BEBA 2QT1A 1NSTA 3C15C 4U5XA 2WBLC 3SHFA 3KJEA 3QVUA 3A37A 3WP0A 2C2HA 4GMDA 4LYJA 1MOZA 1T5IA 1QG4A 4JLMA 4JT2A 4BFUA 2FMXA 3AUXA 1ONBA 5JWRA 4G3XA 2F55A 4KYIB 1OV4A 1EFUA 2CEAA 2WIAA 1KI4A 3IUYA 4PPNA 5JS7A 1Z0DA 4EPTA 3GEIA 4D81A 1E32A 2YC2C 3DVLA 4C4PA 3EWSA 3TKLA 4EFNA 2RMKA 4NU0A 3WRYC 4NTZA 3AP2A 2GF9A 3GLIB 2BDTA 4KYUA 2C9OA 2B7CA 3CNNA 4NL4H 4QHYA 1CULC 1ZD9A 2G9NA 4DWJA 2OAQ1 1FUKA 2J3EA 3KFVA 4OI0A 4YXWA 5JMTA 1R0WA 1X3SA 2BMEA 4PZLA 5H70A 3MFYA 3WYGA 5H68A 4UNQA 1F3OA 2VIIA 1KJZA 4MDFA 4O0MA 1SQ5A 1IN4A 1MABB 3LVRE 3B9PA 3Q7QA 4NMMA 2ZVPX 4RD0A 3GLGB 4HAYA 4F7WA 3L8YA 3RVBA 4B71A 2ONJA 3BH6A 3DOEA 3UK6A 3WNDA 3QJYA 3WYFA 1U8ZA 2ZRIA 4URYR 4C0LA 2OFOA 3CH5A 4NCKA 2AWNA 4FWTA 1CIPA 2WJIA 2JLSA 3I72A 1PUJA 5KU1A 2GXQA 1KDOA 2FE4A 2XX3A 3NH9A 4FMCB 1W36B 3CRMA 3UANA 3K70C 2ZJ5A 2AKYA 1IJFA 1ZW6A 4Q7LA 3FPAA 3RWMB 1T8TA 3NC1C 1RRGA 4IDHA 1KSFX 1ZM2A 4Q1BA 1KK1A 4ASUD 5BN3A 1P61B 2ODNA 3EC1A 1D2EA 4LGMA 2C9YA 2PL3A 4DKXA 1FW6A 1EWRA 1JAHA 2QENA 3GJ7A 1NF3A 2VSXA 3A4MA 4HB3A 1SVMA 3IDQA 5JI3E 1EFCA 2JAQA 1MR3F 1N0WA 2IYVA 5TMPA 1J90A 2GEDA 4WVFA 2H1LA 3I5YA 4IFEA 4OBEA 1QVRA 1NN5A 3MWKA 5DHAA 5H8WA 3FMFA 2V4ZA 2NO6A 2XOKA 3KJHA 2ZR0A 3SN6A 4S35A 3B2EA 3KKPA 2CBZA 5HCIA 3PVSA 4C0JA 3R7WA 3IEVA 3KTAA 2H8KA 4MKGA 1JJ7A 2G3YA 2WWFA 4PPGA 5TXGA 4F92B 4BFXA 3SE0A 4QGFA 4L9WA 1XRJA 1TMKA 2IYLD 2IUUA 4CIDA 3Q5DA 1SKYB 3EASA 3M6AA 4B2IA 2C8VA 2GRJA 3OEEA 4XOIA 4HUQB 5FBWB 1KIMA 4YMSA 3ADDA 3QENA 1MRSA 1NJFA 3GFTA 4QBHA 3AVUA 1G3RA 1HEIA 1KAGA 4NYMR 5ELXA 3ZLJA 2OAP1 1A2BA 2F1HA 3NH6A 1L4YA 2A9KA 2WJVA 4NDZA 2BBTA 2GETA 1VCMA 3O47A 4MRPA 2TMKA 4TN1A 3QBTA 2R6GA 2ZUBA 2N42A 3Q3JB 3K70B 2DB3A 1VYTA 2JLYA 4A0GA 3HYRA 5EZ6B 2GEVA 2GZAA 1QHGA 4WZBE 5DISB 1ZC3A 1W47A 4JS0A 1HY3A 3GD7A 2XZOA 2Z4SA 4US2R 2F1IA 5DH9A 3A4LA 3VKWA 3W6NA 1CJTC 2F43A 5CJPA 2ZM5A 3FWYA 3CONA 3QKSA 1YR8A 1XF9A 4WZAE 4Q03A 4C2TA 3LLUA 1DO0A 4B3CA 4LYHA 4TMKA 2ZREA 4PC1A 4ZKEA 1G6OA 2RCNA 4G5QA 4MYHA 4ON9A 1MT0A 4Q4LA 4XSHA 3B8HA 3CWZA 4TLCA 5C1BA 4M22A 4POAA 4EQ6A 1E2MA 1S1MA 2MMCA 3RSOA 1OH6A 1WB9A 4WXRA 3C7KA 1GL6A 2CL6X 5F9HA 4BFSA 1E1RD 4RCYA 4WA7A 2QAGC 1NY5A 1KI8A 1XTSA 2VTKA 3L8ZA 1U9IA 4BFVA 5JHGB 1ZD8A 1G5RA 4K46A 2FEMA 3SEAA 3UKDA 3HWSA 3R9WA 4W5HA 2PJZA 4IDPA 1L8QA 4RKEA 3GLHE 1IN6A 1J99A 3QG5A 4DLWA 2KWIA 2AN9A 1VIYA 2BBSA 4V03A 1XXHA 1I2MA 4NCJA 4C0SA 4GSYA 2GDJA 4QNRA 3M1IA 3QEOA 1DS6A 5CDFE 2ODWA 4TWZA 1KSHA 2KB0A 1EX6A 2FSIA 3A1TA 3KXKA 3CLVA 1N2CE 3H2YA 2VF8A 3L2OB 4LI0A 2JLXA 3TLXA 3MD0A 3KKNA 2JEOA 4D0NA 2EFDB 3T06B 4UNNA 3BH7A 3EWAA 2IYYA 1N5IA 4MKFA 4WZ6A 4FIDA 4Q19A 1X8LA 2QPAA 3A1UA 4DZZA 2ZI7A 1YQTA 1T5LA 3CF6R 3AKCA 1TU3A 3U3KA 1BYUA 1AZSC 5DN6D 2H5EA 3QPUA 2V9PA 3VNUA 1JJVA 3AP1A 3SU8A 3W9YA 2QBYA 4KCGA 2WWIA 1XPRA 2LWIA 5E3HA 2GZDA 2RB4A 4HDOB 2ODBA 4GL2A 4JL8A 3IHLA 4M0LA 2QUZA 2J0SA 2IC5A 2A5JA 4RCZA 3IEUA 5D3MA 3TH5A 2VP2A 4Q7MB 2GCPA 4Q21A 2WVJA 2PX3A 2P67A 1JALA 2NO7A 1QHNA 3BB1A 3N2IA 3NBXX 4HB2A 2QEQA 4IEEA 3RDPA 1CRPA 2QPOA 2VO1A 4BLRA 4QXAA 1GKIA 1AS0A 1GP2A 5J4VA 2XNDD 3PUYA 4JL5A 1M74A 5GJWC 4N3NA 3VR5A 2PCJA 5KDOA 3AKYA 3RRMA 2IX3A 2YWGA 1AJEA 3UATA 1KI9A 3I32A 1G3IA 5AJXA 4D4LA 4HZIA 4Q01A 3AVTA 1Q1BA 1Y3AA 3OEHD 3HJNA 3SJBA 2AK2A 3IO3A 1P72A 2NMVA 1OHHD 3GLGE 3KB2A 4R2IA 3ZZTA 1HQCA 4FCWA 4HAUA 2ZJBA 4B3BA 4Z1MD 2JCSA 3C14C 3AM1A 4EAQA 1NN0A 3TK1A 2RGGA 5B30A 5KDLA 2GJ9A 1M7BA 3FKQA 3KB1A 2WSMA 4PC6A 2RH5A 5JZVA 4EFLA 5G53C 2YINC 2QQEA 4DDWA 3OIWA 1TQ6A 2Y8EA 4Q1AA 3SZRA 1U9IC 2BHRA 3CPJB 3PR1A 2LKDA 3PJRA 4EIWA 4DIDA 4TLDA 3W90A 4ITRC 1OT3A 4PR0A 4OI1A 4DDVA 4OYHA 5DGXA 4PPQA 2DFKB 2GF0A 1EFTA 3T61A 4ESHA 1T6NA 3U4QA 3QF4A 3NHAA 2R9VA 4IVPA 5AUPB 3IHWA 4CT4B 3K0SA 4MUBA 2PH1A 5SZKB 1B0UA 1CP2A 4LYFA 1IXZA 4RFSA 1XTJA 4JBWA 1HH4A 3E70C 3ASZA 3NVAA 1C9KA 1K6MA 1LB1B 2ZSEA 2XSZA 4JLKA 3NEJA 4RJLA 1W7AA 1S9DA 1AK2A 2OV2A 3EC2A 5EE5B 1Q0UA 1KI6A 2QGNA 3HR8A 4P31A 4YDHB 3RWOA 2E1RA 1GIAA 3ND8A 4PAQA 4JLPA 5AR1A 2F43B 2RKOA 3E5HA 421PA 3KUDA 2LKCA 3QKSB 1T0HB 1QHIA 1ZAKA 1Q3HA 3B60A 5ANRB 4XH9B 5JFGA 1SGWA 2O0JA 4JBXA 2KE5A 1G4UR 4LC0A 3LX5A 4Q5IA 1SVLA 3P1JA 3QQ5A 121PA 5AJZA 4B75A 2CE7A 5J40A 4RD2A 2IUSA 3DDCA 2G0TA 3BB4A 1P9WA 4EQ6B 3OAAD 1B23P 4LY6A 4UQOA 3AKEA 3QXSA 1G7TA 1E2QA 2YWFA 4NE2A 4IDOA 4R9UC 4A36A 4URWR 3CW2A 5HCNA 1J2JA 4LV6A 3TQFA 3FB4A 2RGNA 2B21A 3L43A 1D2MA 1QF9A 4IOMA 5AK0A 2YZ2A 1QHXA 2YNMA 3F3YA 4GOKA 2KSQA 4JIMA 1XXHB 1WBDA 3NWJA 2BOVA 3CRVA 2FH5B 4TYQA 5KNCA 2QN6A 2PBRA 4PFSA 2GWHA 2Z4RA 2AX4A 5TDHA 1E1QA 521PA 5IRCD 1O87A 3SQXA 4JVNA 2WICA 3QE0A 1TF5A 1XU4A 5KTYA 1ZIPA 2QY9A 2ZJOA 3IPXA 4JVLA 5JRJA 1TEVA 3ETLA 4OHYA 1Z6TA 4W7SA 1G7SA 4AYWA 3GJ5A 1W36D 1NMZA 3SYLA 1WQ1R 4WW0A 1D2NA 4OHZA 4LPSA 1GL7A 2P6NA 1HYQA 4R7ZA 2NPIA 5HKKA 1AM4D 1W4AA 2P6UA 4XSGA 4A8JC 4MRNA 2QBYB 4F4CA 4D0LB 4DUGA 1Z0AA 2ODEA 1KK0A 1HE8B 3D3QA 4LX0A 4TL6A 1M6NA 4NYMQ 3P32A 3GLHA 2Q9AA 4XWKA 5D3MB 2FPLA 3B85A 3TIFA 4M9ZA 3U2QA 2FFAA 4O25A 1W0JD 4P3YA 4GOXA 1EESA 1Z0JA 5GADl 2B8TA 2JJ1D 5CDFA 3KX2A 1ZYUA 5FFMA 3KKMA 3N5CA 1PVOA 1IXRC 2H57A 3VAAA 1IY0A 4P4SA 4BECA 3MJHA 4QNMA 2W6IA 1GZSA 1JQLB 3K09A 3OFNA 2AHOA 4KFUA 5DIFA 4IJMA 3QKRA 1RPZA 2J7PD 1WA5A 2BWJA 2A5FA 2ZRLA 4U00A 4RVCA 2WJHA 3E1SA
chains in the Genus database with same CATH superfamily
5DFAA 2ZZKA 4YCMA 2CHFA 2NU7A 1CUIA 4ZMBA 4LKRA 3LK6A 2SICE 1KZ7B 4KIFA 2WZDA 3PEYA 1Y1TA 1E3DA 4JVMA 4HNHA 4RA6A 2A67A 4HX5A 4OSOA 1TT7A 4P4NA 1UEJA 4YTEA 3TSAA 3VR4H 1UKYA 2C4MA 3QX8A 2GN4A 4WWHA 1RWXA 4MGEA 1GCAA 1XN1A 5BWBA 4PHHA 1YS7A 3UK1A 1NUSA 3VZRA 5KYVA 4IXDA 4KTVE 1UQUA 5AXAA 3A9TA 4GI3A 4RTPA 1UZNA 3BXFA 4TLBA 3DJYA 4LECA 4C0BA 3K70D 4CMBA 5J5VA 1CHDA 3AOEC 1QHEA 1Z5PA 4TV9B 4WAUA 3IA7A 1SXHA 3G0GA 3L0DA 4BNNA 2VDJA 5DE3A 1A98A 1PJ4A 5K0GA 3MCWA 3NBZC 4I5FA 4CNBA 3VHXA 3FSEA 3NFRA 1VGVA 4NH0A 5EP3A 5A1TA 1OSNA 1S6YA 1R9MA 2AR9A 4ITVA 5JXWA 5CITA 1P1BA 1YMQA 3ZWAA 2BGJA 3IUSA 1LFDB 4LHEA 2I80A 1A2OA 2OCXA 2ZOSA 5KO2A 2E6KA 4M3NA 4JKOA 3GLGA 3V1NA 1EGMB 2H0RA 1TW3A 1JNYA 3J81k 4GLJA 3L7AA 5DZSA 1AXEA 5ALDA 3W6ZA 3PQ7A 4E6EA 2FYTA 1MEOA 2D5LA 4HVTA 3HVUA 1XJ0A 1O94D 1II8A 4Y1FA 3H04A 5IMSA 4QBGB 1LWOA 1EVQA 4QC2A 4EPYA 5NLLA 3TNYA 4RX1A 1N1DA 3OTIA 5BURA 1GTVA 1GGJA 4RO0A 1P81A 2Y1OA 1E6KA 3W0LB 5C7OO 2EIXA 1WUIS 3E9YA 1YV9A 5L4SA 3GLKA 5CCXA 3S55A 3UVEA 3MWEA 4AY3A 1G8FA 3O9MA 4OJMX 5EHQA 3V6LA 2VDRB 3L0BA 2IKQA 3P9KA 2Z3ZA 3SK0A 4WGFA 1R0KA 4XDZA 4JROA 4Y1EA 3I9V1 1S4MA 3UCXA 3ZLTA 2PUVA 2X22A 4AY5A 1E2DA 4TS9A 2OV4A 3V8PA 4BFWA 3KL4A 4CTNA 1GOTA 4TVKA 1K0FA 3DZJA 3E35A 3JTMA 5F78A 3BD8A 1A0OA 2ZSUA 4P5EA 4AP6A 2W42A 4M89A 1UJ5A 5DEOA 1C80A 3Q85A 4DEXA 1NFRA 1NTRA 4MUXA 3QUCA 3HY4A 1GPUA 4MB6A 3PEVA 3B7GA 1HC7A 1XP5A 2NAFA 2Q3MA 3HDJA 1Y1QA 2DY1A 3ONVA 1U8EA 4DLTA 2W0MA 4W5JA 1TLTA 1ACJA 3OZAA 3C3JA 3SMVA 1NG1A 4CBVA 4Z0TA 2VVTA 4GOOD 2Q27A 5B6IA 1ESDA 4D9NA 2BKLA 1CJVC 4OL0A 1WMSA 4YCAA 1TFRA 2QT9A 3DWFA 3PQ6A 3P94A 4E6PA 4ROSA 2R79A 2CL7X 4LRTB 1WU8A 5ECWA 4E88A 2YIVX 3QU5A 3EG5A 1L7OA 4AKGA 4GMGA 2WM3A 1JI3A 2YMPA 2HA6A 3FWNA 4PZEA 1UK6A 2MMGA 1T36B 5DHTA 5FTJA 1GG5A 5ENVA 3SDZA 2DZDA 4M37A 1KDTA 5CM2Z 1SPBS 2QU7A 1N2XA 2QMHA 1RWWA 2HSWA 3O2QB 1QQ7A 4U9HS 2OGWA 2R5FA 3OTQA 3RAGA 4MWDA 5DWQA 4NXMB 4M2LA 2JFVA 1QHYA 1CBUA 2G7MC 2J46A 1DHRA 2QLBA 2PRJA 5IDQA 3VOAA 3ONNA 3ZJYA 3OPYI 2YVKA 2SNIE 3H1AA 4J1TA 1EK2A 1X92A 2GPBA 4LRUA 4RD6A 4M53A 1NL3A 3U4AA 4JJZA 4ZYXA 4FYWA 4JC8A 2PBZA 4Z0HO 3A10A 4ZI7A 4OAQA 1WG8A 4XCXA 5EJGA 1GNQA 2ZYWX 2PJUA 3I9OA 2DULA 3V42A 4QQ8A 2PUCA 2KMLA 5BV8A 1CUZA 2Q4EA 5GVRA 2PTHA 4J0JA 3ECCA 1QUEA 1Z0KA 2RGRA 2ZAOA 1Y9ZA 4KXVA 1FXUA 4GXQA 4GZ6A 3RUPA 4FX2A 1INLA 5JXGA 5DNAA 3I73A 2H9YA 2HSDA 2PD3A 2NO9A 1GCOA 1TYCA 2V3WA 3N39C 1JZQA 3CX6A 1UPTA 4IFBA 3UJPA 1RNLA 4Q3EA 1XZ8A 3ESRA 1J0CA 3AGPA 4CMHA 3H1GA 4F4UA 1P1FA 1OI4A 2VUIB 2J5RA 2Q62A 4YRQA 2E4XA 5DNVA 1IHXA 3I6BA 4DMCA 2G1JA 4WKPA 4ZIRB 2XQIA 4IRXA 4WNAB 1F1JA 1E7YA 2YV3A 1PX0A 3ML1A 4FDUA 3OEED 3PGKA 5ERXA 5AICA 3RNLA 1RRPA 2FEAA 1CJMA 1TPYA 3LUKA 4Q3NA 1OBVA 4MYSA 4TKUA 1K9SA 3ZVMA 3ZDAA 5LN1A 3IVCA 3HVIA 3NJ4A 5KOHB 3K6KA 3L0PA 4IIGA 4NOMA 2QX8A 5JARA 2ECPA 3U4MA 1U2QA 4RBNA 4DC0A 4F5DA 5IZCC 4Z4FA 2H9AA 1I8TA 2I65A 2A0XA 4JT8A 4D4JA 2REQB 4BNVA 3UGJA 1GFSA 3T34A 2ERCA 1XX6A 1UOQA 4YAUA 4BNWA 1I4LD 2TYSB 1T5BA 4E2FA 3VKUA 4EDHA 3ZDDA 4OU4A 1UMBA 4UCXA 1TAGA 4L4XA 2B78A 3GGOA 3FLEA 3UXYA 3ZCTA 1FUYB 5L3QB 2GO7A 2OHFA 1C3OA 4PCVA 4UU1A 3BEDA 4J7XA 1QBKC 5EA2A 3KO8A 1OT5A 1HLPA 4RZXA 3LKBA 2AQHA 1Z4KA 4UBNA 3WKDA 1SZPA 2H6EA 3BMNB 1E9DA 1JQEA 4PO9A 5L3ZA 1F0KA 4D7AA 1UT5A 3D3WB 1PZXA 7YASA 3EPKA 1ILWA 4FVTA 3UH0A 1M7GA 1N9GB 5ARCA 1U8FO 2CVOA 3LBNA 3FWHA 5HDBB 3AHGA 4HAVA 8ATCA 1OBHA 3K32A 1GQQA 2IT1A 3JZIA 3RM3A 3N0RA 5INTA 3N58A 3QOYA 3QX3A 2WSYB 3EZLA 1DAIA 2ZZNA 1WV0A 3FLAA 3HVHA 3ZCUA 4UMFA 2O8EA 1SC9A 4X62B 5PNTA 3G5MA 4JR1A 3VNAA 5JYEA 5MN6A 3U9LA 4G1VA 4HR7A 1LPBB 2ZB2A 1BHJA 1UPFA 3LUFA 1IZ8A 3W5HA 2J5BA 3HH8A 3S1AA 1J7KA 1FJ2A 2PO7A 1AG9A 3E7PA 3I05A 3LQFA 2E55A 4U6SA 4EY5A 3B1WA 3R7SA 5ALQA 1P6QA 2ATVA 2VHQA 4FTWA 5T67A 4NZPA 1U11A 3HP1A 5LQJA 3F6BX 4IINA 4P4UA 5AJHA 1QK5A 2ZE5A 4TL8A 2Z43A 4A1FA 1Y9JA 3GY0A 5LXTF 2E37A 1FP2A 3MSCA 1K7FB 1RAEA 4CMAA 2QOEA 2VJBA 1H0HA 3C5HA 1QE0A 2HIGA 3EEFA 3BMCB 4MW9A 1Z3IX 1WZEA 4OLHA 4LZJA 4S0XA 4I2VA 3V3TA 1OZ0A 2FNAA 3DM9B 5DSXA 2CB9A 3UB2A 3A2KA 4OHFA 1YWGO 5FL7A 5J2TF 1DRKA 3H19A 3OPNA 1X3LA 4CODB 1U02A 2GHQA 4WN3A 3VBEA 3EXFB 2JLQA 4UHBA 2XCTB 1HGXA 1ULAA 2GUGA 2HEIA 2VNAA 4NS1A 4ZQIA 1ID1A 4JLJA 5KTOA 5EHGA 3RS9A 4AXXA 1LLQA 5EMHA 2X8JA 2DFNA 3LRPA 4ER0A 2WZBA 3CE6A 2C7RA 1J0XO 4KE7A 4Q1FA 1WO8A 2VT6A 3CRNA 5JFOA 3B89A 4WLVA 4BFLA 4OHKA 5JAQA 3THRA 5JBQA 2OGUA 2XE8A 3RTGA 5AW6A 3CXUA 5A2GA 1EX7A 4PAMA 4DTIA 1R7RA 4IQ0A 2XE4A 4X8OA 4E7OA 4R1MA 4ZAXA 4EPVA 2MDTA 2MOKA 1FPQA 2WPDA 1U1CA 4JASB 3A9VA 2ZXUA 1XE3A 3CM0A 2Q29A 3EXAA 4IO0A 3WYDA 1EBFA 5B3LA 2BW0A 4Y9SA 4DR1B 2I3ZA 2J9FA 3ANXA 3CJQA 2OXIA 2OBLA 1NVMB 3U7EB 3AHCA 4HGPA 5FH9A 3ZW7A 2R48A 3MTAA 4QBKA 4H1WA 3JARB 4QFBA 1D4FA 1A9QA 2HA5A 3SFZA 1LXCA 5KYUB 5CBPA 2ZR7A 3U17A 3BN3A 1JHYA 3CE9A 4P7BA 1UP6A 1ZESA 1U4OA 1PF7E 4JEUA 4UM8B 1U9JA 2Y3IA 3EHDA 2FMKA 3HMQA 1ZIOA 2ZBFA 3R6TA 4RMNA 4D4KA 4J0GA 4OBWA 4GX1A 4KJXA 4QFMA 4LN1A 4FLFA 5FULA 2XMSA 3MA0A 4RMGA 2PUDA 4BMVA 3QA9A 1OIVA 3ZE2B 4N7RA 1DKUA 3O2JA 4IIHA 1CUHA 1XYYA 2V59A 4JI4B 2BKEA 3BA6A 1FSSA 2BC9A 4L73A 1QR2A 4XUDA 3HXKA 5DB4A 2ZBDA 5A62A 3COJA 3LBHA 2OC4A 1MHPA 1LV8A 3TEFA 1VPEA 3GFVA 4BLVA 3A3YA 3DCNA 3OJWA 3K35A 4NS4A 4RJIA 4B3DA 3DTNA 2WMNB 4X44A 4FGSA 3DZBA 2R8RA 3OD5A 3T1TA 4HXFB 1IM8A 3BXXA 4HS4A 1U04A 3I5MA 5CAEB 1PKEA 1IHYA 4D45A 2BD0A 3EGEA 4W1RA 3GW8A 5U4QA 2B7LA 1G3QA 1P44A 3NEYA 3FNFA 2PQMA 4LJ9A 4J9UE 3H6GA 2EBFX 4BZPA 5L3VA 5IUNC 1H69A 1NR1A 3MMZA 4HZGA 4PX3A 4Q82A 1RM3A 1YBAA 2BKAA 2G40A 2UVQA 3PZBA 4I4CA 4R40A 4WECA 1W49A 1X7GA 4F1JA 4UUAA 4CMEC 2R7AA 1MO5A 3N1UA 1W4BA 3A8TA 2GLUA 3GL9A 4FC7A 1E5XA 5K20A 4KREA 2O07A 1B3BA 3CUVA 5JVDF 1E1LA 2FN7A 2IYRA 4WFKA 3OU7A 1HFKA 2JFOA 4M0PA 1GPMA 2P4EA 2ZPAA 5EP2A 5JV5A 1QYCA 3BJEA 3G85A 1SBIA 4S2UA 4DRZA 3RJ9A 1TUEA 4WBNA 1JQJC 3ZZUA 4UDYX 1W0KA 2QTFA 4MEAA 2CNWA 2HRRA 5FNVB 1LNSA 4XXHA 1DHTA 3ED1A 3N6VA 4G89A 4LZZA 3FYTA 3CGGA 1IJEA 2P9JA 1QP8A 2Z5LA 3HBAA 4MKIA 4MUMA 4J6FA 1CVRA 1JKJA 4PG6A 4ZCPA 3TNLA 4Z49A 5JBIA 2ZZMA 2YXNA 4W8GA 3AI7A 4YJ3F 3W8RA 1PKXA 2PTGA 5COQA 1A8SA 3W5CA 4EG5A 1DWOA 2WUFA 3QI7A 4LJYA 1J8QA 5U4XA 3RC7A 3GZNA 5IYZA 3UEOA 1AC5A 3C3PA 3Q7RA 1T25A 1GLVA 1J5XA 3VI4B 1R9JA 2YIJA 1R5NA 4L74A 3ZI7A 3JD3A 3CIOA 4H6WA 1VG8A 3I01M 5FOWA 4YRAA 5IDVA 1PW5A 3TPCA 1QK3A 2QIPA 2VJCA 4BO7A 5IASA 1V71A 3BQMB 2YZMA 2NZUG 1KYXA 4TKVA 4D74A 2CLOB 3EX7C 3ETGA 2XXAB 1PS8A 3U1BA 1R8QA 2ONYA 3BPSA 3C5CA 3UJDA 1MXHA 1NN3A 2GCIA 3WBKA 1UUFA 4N03A 1MQAA 1P5ZB 1QKKA 3QEMB 1DBWA 2POCA 5FOUA 5I4BA 1EKXA 4XR4A 3LIIA 4EATA 2WDPA 2CHVA 4UNPA 2ECOA 3L7JA 4CG1A 2QN8A 5GINE 3PVCA 1JU9A 5DI9A 1NN1A 3FIUA 3MJFA 1E79A 2B4AA 2DPMA 2PJDA 3DTVB 2QU8A 3R3WA 4V02A 4WRRA 4C4XA 5HNKA 4XB6B 4DA4A 2MWMA 3ZDQA 3HCCA 4JI1B 2QYHA 2OOKA 5CH8A 2WRZA 3VGPA 4O4LA 1DWQA 1Z39A 3D4BA 4PSDA 4YMIA 5HK8A 2YWHA 3RUCA 1PZGA 1V5EA 1S2OA 3GFSA 4JLOA 3AR6A 1M2EA 3SIPA 3WGNA 3TF5A 2A88A 1G2IA 2GBIA 2AFVA 2KI5A 1YDEA 1V3QE 2M1ZA 4GMXA 3VNQA 1YE5A 2OORC 2CLIB 3EZXA 3PYMA 4EH1A 5HRUA 3M6MD 4G1FA 4RJKA 3WWCA 1ZNYA 4RSMA 2O2ZA 4TUYF 3A4TA 1U0OC 1XZBA 4D3SA 3QVSA 3FPJA 2CD7A 4V24A 4DXDA 2WJYA 2GM5A 2PU5A 3GEDA 4G37A 4G5RA 3G0IA 2AG0A 1JMVA 2ORIA 2XZPA 2EIHA 4ZMRA 2HWWA 1Y3DE 4J3FA 1I3OA 5B5SA 2O9JA 3DBIA 4JXZA 4NBLA 3F78A 4KQJA 2IZ5A 4MV3A 3CLTC 4RJJA 4YYZA 4Y0VA 1R0RE 3NNSA 2CLHB 3U7QB 3UAVA 2OAEA 4O8CA 4EI7A 2P9FA 5IJ9B 3GN2A 3KDSE 2CE2X 4EEKA 5F1PA 3TTXA 3T0GA 2QIOA 2Z2ZA 3F46A 2GTPA 3MWLA 2CDBA 4Q66C 5KJCA 1UKVY 2AFHA 5KNBH 1G5QA 4D97A 3VC2A 3LH5A 4OFXA 2AT1A 2G9VA 1Z0ZA 2PG3A 2HYDA 1XTBA 2W6ID 4RU1A 2O2JA 5KCZA 1JL3A 2O5EA 3MK31 4O3FA 2W2NA 3LOQA 3ELYA 1OZHA 1DAGA 4QHTA 1BWQA 3K0HA 5EGSA 5LYYA 4F6CA 2J6BA 2X76A 3ADCA 1ENPA 1VBFA 2IIQA 1PGJA 1ZGHA 4U7PB 4P0TA 3LXMA 4YFYA 4V1CB 1NMQA 1H2BA 2ZSAA 4N39A 4PYQA 4I1VA 5REQA 4G0VA 3ZDBA 1X86B 4ZI5A 2V45A 2WYUA 2QP3A 1RPNA 4Q6WA 1ZBQA 1DXYA 4CEHB 2PYIA 1C50A 5B1DA 3PJEA 4PVCA 1L5SA 1UL1X 2G1KA 2PWBA 2A5YB 3EAFA 3PK0A 1A8QA 1L4UA 5B58T 1Y8QB 1MJGM 2FZVA 4TUYB 4EF4A 1TDJA 3SIRA 3V55A 1Z8DA 4P4TA 2UUCB 4Y30A 2QAIA 1J8VA 1OVGA 1R0BA 2Z8YM 4NONA 5DULA 5ERYA 2JJMA 2HGSA 2GBGA 3EGCA 3DZGA 1II0A 3RJZA 2QL9A 3OLWA 3OU6A 4NYIQ 1T8UA 4JYAB 4HK4A 4AZ3A 4LFAB 5A0TA 3MJRA 1C3EA 1RMTA 2CUTA 2YVLA 3OURA 3RS3A 4I50A 4PR3A 3SYMA 1FRFS 2J87A 1GG9A 4A8HA 3E4CA 4AX8A 1U28A 4EKNB 3R5XA 3L7CA 4OB6A 4IDDA 4ZU1X 1QTNA 3TZHA 5AM2A 2P9ZA 4FHDA 1F51E 3TFWA 1FDUA 4FJ0A 4LY0A 4XTRA 1BKSB 4QM6A 3EAGA 4Q4JA 1DBSA 2O2XA 4MR8A 2J9XB 4QLOA 3UMJA 3JQFC 1X1EA 2VRWA 3EZ7A 5CA0A 5DTIA 2ZIAA 1QNLA 4KQ6A 4R8KA 4MPTA 4R2LA 1K3UB 4D9HA 1YS2X 3TLJA 4MVJI 5EINA 3GRZA 1FL9A 3VV3A 1RI3A 4HSGA 3TIGA 1M75A 5DX0A 2EJUA 1E3WA 3A9SA 3FG9A 2QTTA 4Y1RB 4IGEA 4MR9B 2L2QA 5CW2A 4V0KA 1GCGA 2G8LA 2H65A 5FBHA 4TTSA 1EDEA 2I33A 4BFTA 2WJAA 5IM4A 3GUHA 3ZY3A 5C4MA 3VYUB 5AHRA 1NX6A 2WIJA 1TK2A 3NDPA 3TD6A 3WB1A 2BJVA 4D2IA 4EO9A 1YJBA 4FR5A 1JWLA 4AS3A 4DREA 3DVQX 2RD2A 2R1VA 2FSFA 4GF5A 4ZRMA 3WRXC 1SNYA 4V3CA 1G20B 2EBWA 2OCDA 2XR1A 1SEVA 2VTDA 3OJEA 3IXLA 4FJ1A 4IDNA 1JHRA 1CQJA 2QL5A 4XAQA 5KWEA 1PP4A 3QMVA 2VUTA 4TXNA 1JKIA 1GVNB 4WCFB 3VMMA 3OEYA 4ERXA 2IW3A 3O38A 4PQFA 4DADA 2E9SA 3BJMA 3U4IA 1ZH0A 3TSWA 2I6TA 2WE7A 3DULA 2GN9A 3KZXA 3PR2B 3QH4A 5CK4A 2XQGA 4H6PA 4C9BA 4N5IX 4AI6A 1XZAA 2AUNA 2X9VA 3ROEA 4MV0A 4CLXA 2C7QA 1H42A 1IBCA 3SQLA 2IVFA 2AE1A 2UDPA 3NUQA 4PY2A 3SYTA 4OLFA 1T2FA 2AH5A 3AJEA 4WLOA 4IHAA 2VHVA 2XA9A 4R8SA 1USGA 1LK7A 3LQQA 2Q5OA 2XCRB 1GZ7A 1XFAA 2HBRA 3P2EA 4XD7A 4F5WA 2TMGA 1S9HA 2WKQA 1KO8A 2IFTA 1GL3A 1TQ4A 1ZI9A 1QGUB 2P6OA 3C87A 1ZQ1A 3PXBA 4QGSA 1JE1A 1R4NA 4AJOA 4HX9A 1ZCJA 1JEYA 1J2UA 2J0UA 2PXAA 2YASA 1U8TA 1QO0D 1RMQA 4L7QA 1QGAA 3FAZA 3EVCA 4AUMA 1GG8A 1XLUA 1Z34A 4OU5A 1QBGA 4Q3KA 2AC4A 1S8AA 5K6AC 3GP5A 5BW8A 3R74A 2AZXA 3MTQA 3WDMA 1TVKA 2ZJ6A 4N49A 3G0HA 2X0IA 3UHJA 3TNDA 5LL6P 3EPHA 1P7WA 5CDYA 3KFXA 4OB8A 5SZIA 3S6JA 3VR6D 3MPOA 3PUHA 4EJSC 1OWNA 3KRTA 3WBBA 3U13A 1B6GA 5IAKA 3R6GA 4AMUA 4BVEA 4PONA 4B31A 3ZJVA 2PKWA 4IM7A 1A95A 3K0KA 1EPUA 1Z75A 3EWIA 2XUHA 3IESA 4BV3A 1RWVA 4PTLA 4K0RA 5AFSA 5GIOE 1BD3A 4PG4A 1DMSA 3L4EA 5FTMA 4JL6A 2V7BA 4A3SA 1L3BA 1AKQA 4LBZA 2O2EA 5BN5B 3RV4A 1ADBA 1YDFA 4PZYA 4BNUA 4BU1A 3G7SA 3H3XA 3VU3A 1SVWA 2IXBA 2AX3A 2DPXA 3DEFA 4E51A 1HMPA 2XUKA 4JNKA 4PZAA 4YLGA 3SQNA 1JXOA 4QYTA 3E2MA 3WYNA 4AECA 4HQOA 5BUSA 4ZZ2A 1KQFA 1RHQA 1ZRSA 1QE5A 1NKTA 2AD5A 1G0OA 4UDNA 3EEQA 2YJTD 2UZ0A 3JQ8A 5D3QA 5FF9A 4C7JA 1BCSB 4NCXA 2EWVA 2I7CA 3G7NA 3B12A 4O2RA 2Q2QA 1MX1A 4QFCA 3IGFA 2PZEA 3JU3A 3LKZA 1M0WA 5JATA 4WJLA 3HN7A 2G9ZA 4L5YA 4YGXB 4YAIA 4ZHSA 4UOZA 1MC4A 2FEWB 3EVDA 2OBXA 4CM9D 3KFLA 4AO8A 5A2QA 2PZBA 3DYIA 1U7ZA 2ZI6A 1QXSA 1VE1A 3HBJA 4JI0B 4H3HB 1HLDA 2FRVA 1ONSA 2BFCB 2WUDA 3KYCA 1FK8A 2VZ9A 2XB8A 1BXRA 3LW8A 1Z5UA 3OSUA 4LUCA 4BLSA 4RTSA 1K89A 2O0MA 1AB5A 2ZS9A 3C3DA 4FIZA 4CV1A 2FF7A 2EBUA 3F5MA 5BSVA 3N7AA 5TNXA 4EJFA 3EYWA 3WSWA 4ZCMA 4DDTA 4CIBA 2Q5QA 3DDNA 1JFTA 1TO1E 4EJMA 1XEXB 4YAGA 1IONA 1JT9A 4JBGA 1QGYA 1JAIA 2ZUWA 1T6ZA 1T9GR 2X41A 3UWOA 3VSEA 1HUQA 3QPCA 3Q3IA 3EE6A 4K9QA 1T9ZA 2OOSA 1SC6A 1JLSA 4ND5A 3AHHA 5D84A 3EVZA 3R3SA 4PX2A 3ZLBA 3E3MA 2O1WA 5M04A 4X3OA 3EIWA 1IVSA 3FN4A 4BPBA 4DA9A 5I4CA 2QMEA 1ML3A 5DBGA 1XCPA 5FBRB 1RHRA 4D4HA 1SIUA 2FSGA 2I1QA 1QYWA 2BFEB 3QVKA 2DRIA 4M8KA 4N7JA 1V9SA 4ETMA 2YHIB 3DEJA 1HNXB 2IH4A 5E9AA 3FNHA 3VOBA 1KEEA 4F46A 1OFTA 2O19A 2WT4A 4EEZA 4W1PA 2I71A 2XTZA 1DUVG 4Q9KA 3QBDA 1OAOC 1PQ4A 2B99A 4RLQA 4Q12A 4A27A 4J6EA 4ZT7A 5JCZA 1P9LA 3GGCA 2VZLA 7MHTA 2X42A 2C00A 2YQ5A 3GFQA 4US0R 5HZHA 2K2QB 1JR6A 3ELBA 2X2FA 5FI1B 4AM8A 1ZUNB 2A30A 1JDTA 3P2YA 2EVWX 1UZUA 3OY2A 1Z12A 5KB3A 2R1TB 1W93A 2QLMA 3DEKA 4DIKA 4DDUA 1QP7A 1TIKA 4NAHA 1G4AE 3QXHA 2N1BA 2ZJ2A 4D80A 4DB2A 4PYLA 4C1NA 2J6HA 1YUNA 4E07A 3I42A 5BR8B 2JLRA 721PA 5HZKA 2HHLA 3IDSA 4MTLA 1Q0PA 1PJ8A 2VJNA 2SHKA 4D0RA 5KVCA 5JD5A 3A6PC 3HS3A 1YB2A 1XCJA 2LW7A 5DLQC 5TRTA 4RAQA 1AKMA 4LW8A 2EW2A 3DTVD 4MV6A 5KX5A 3RGGA 1WW8A 3W3AA 1E61A 5DLEA 5JH7B 1UDBA 3R5KA 2I54A 3JX9A 4EFMA 4Q7QA 4UHDA 2I1WA 4CR8A 2ZB4A 1EXMA 1F7UA 2NXJA 2ONKA 2JJ8A 1DTWB 4OJQA 5DM2A 3TLZA 3T4EA 4QL3A 1KZYC 3O4RA 1R8JA 4ZXFA 4LS3A 3LHKA 1Z45A 4CLDA 1FMFA 5CLGA 1JJBA 2ZYSA 4GOLD 3UWKA 1XEWY 1HT2E 3DS8A 1YQDA 4LA4A 4Z0NA 3BULA 5G3YA 4HB0A 5C3MA 2VKTA 5DHSA 1Y80A 4QXQA 4CYMA 4DLXA 5HKAA 1BKDR 2ZYRA 1XMPA 2W2LA 4FU0A 4L6AA 3FKJA 1U2SA 3DA8A 3DXZA 1EI9A 4O4HB 3DZKA 3I83A 3PXCX 4OAPA 4B3GA 3DMGA 1U8AA 4YMTA 1JIVA 2IIPA 4XZ3A 2CXOA 1J6UA 2FEKA 1CF2O 4N12A 4QQNA 4MV7A 2SCUB 1P2SA 4B45A 3DLIA 1WXIA 4M1TA 4I9HA 3LL4A 5AKIA 1AQUA 4EGQA 3C8HA 1R00A 4LZAA 1R18A 2I4LA 2P30A 1YMVA 3RAJA 2OXRA 2A9VA 3WIBA 1G20E 4FB5A 3EEOA 1N0VC 1R6DA 2GHIA 3AUUA 1FFYA 5G1OA 1JTVA 1OFGA 3MAGA 3CLKA 1FNDA 1Z5NA 1W96A 5JWRA 3LLMA 4FMCF 3A0RB 4NPAA 4LF6B 4K5QA 2H08A 3WVNA 1RJ9A 1XWFA 1XJQA 4P54A 2BBOA 1SB9A 4OY3A 3ZD7A 4E70A 1Z5ZA 4HQ6A 1X1SA 3VM6A 1TNDA 3DFZA 4BX0A 1DZ3A 2R11A 2WWWA 3MGBA 5JE8A 3IOEA 5B1HA 3QLJA 3OWXA 1LZLA 5KHAA 1F2UA 1E2HA 1QS0B 3C5VA 3HNOA 4FOPA 4N0PA 3RK0A 4RVSA 2AFIE 3ZZ0A 4RJTA 3VR4D 4EPXA 3TGWA 4EP1A 4JKYA 4DDHA 3OIYA 1VA4A 1BROA 3DWIA 1OBCA 1CERA 4O2BA 1PDWA 4CF3A 5CDUA 2ES4A 4G85A 4CKCB 5J2TA 4QU8A 4JC5A 4OXQA 4FHFA 1CUAA 3PPVA 2I6FA 1KE1A 2UZAA 5M29A 2H48A 2J45A 4ARUA 4FQ7A 2R8XA 3A27A 2EDAA 1KIFA 3EUAA 4XYBA 4JI3B 3D6FA 2V0GA 1KQNA 3I1FA 3G7UA 4RZ2A 4PPFA 5T3UA 1WPGA 3ZE9A 4UULA 4F2GA 2ZPUA 5LQRA 3DONA 1UFOA 5KWJA 1Y1LA 1DPGA 1ZM4A 1EUCA 3OUUA 3HB0A 3PB3A 5DM1A 4BHTA 1T9HA 3IKLA 1G42A 4YIKA 3M7IA 4KSCA 3GLQA 2ZAGA 3ZKWB 5J4LA 4EJ6A 1E3IA 2WQZA 3WBFA 5FAKA 1V5FA 1OAAA 4BO5A 1T24A 3EBLA 5EP1A 5K2OA 4FB4A 4H1HA 4BLPA 4YX9A 3F47A 4AG6A 1BX0A 1AGPA 2NUTB 2QYOA 3K31A 3J7TA 4CM4B 3L7MA 1PJAA 2HRDA 1LK0A 2JEYA 1JZSA 2V0CA 3AX6A 3I58A 5EE0A 3WHLA 2Q3LA 2Z2YA 3QMWA 4QYIB 3K15A 5EE3A 3IODA 1GZ5A 2OMEA 3V4SA 1SCUB 2GLXA 3HADA 3THXA 1BNCA 4H18A 3RSLA 3U9TA 3T5AA 4ARAA 2EXXA 3O73A 2WD8A 4K9SA 1A4XA 3AH8A 2OBYA 3PHCA 3WKAA 5CT9A 1EK0A 4XIGS 1L1RA 1F60A 3MS7A 4OKSA 3O8RA 2OKGA 5E1DA 3TQRA 3ZU3A 1AMOA 3R7AA 1VG0B 2V6JA 3UUWA 4BDTA 2VRCA 3BREA 5KYXA 3VR2A 3HKBA 4E5UA 3SYKA 4FFDA 5HW0A 4BFCA 2H2WA 4MVWA 5EJ2A 3LY9A 4PNZA 1SKBA 5B4VA 5CXQA 4DR5B 4RTJA 3ZVLA 2LCIA 4URFA 5LXTB 4WX2B 3N6XA 3KWLA 3LF1A 3DP9A 3B38A 3JYHA 3P45A 4ES6A 2OHXA 1G66A 3BE5A 4JJ6A 4DIFA 3NI2A 4UCWA 5EIWA 3BDIA 4CUZA 3H0KA 5BMVA 2CHUA 3PXAA 5L7WA 3ZHCA 2X1MA 2PUHA 3OCZA 4YV7A 1QCDA 2UXDB 1Z47A 3QU7A 4JQOA 3BGVA 5ALXA 2C83A 5FYDA 5J1SB 4AKHA 4KODA 2PZ8A 2VP5A 3OTHA 4L2IA 4D79A 1LLUA 1USWA 3IHTA 3ZS8A 4MMYB 4YFVA 1QDUA 2OO5C 3NDIA 3QFTA 4UW9A 1Q83A 4AULA 3ABZA 5EIXA 4XVRA 4R6XA 2IGTA 2PX2A 1F6BA 3EIXA 4EHBA 2RE8A 1NLFA 1Z4LA 1HDCA 3E22A 3W78A 3D8TA 1VG9B 1T4MA 1M0TA 2V65A 3UHOA 3IUQA 3LIPA 2IZ0A 2XDAA 4BOYA 5H5JA 2O8BB 3LX4A 4NP6A 1LC3A 1PZHA 1SZCA 4FS8A 4MQUA 1QTQA 3NP9A 4WNCA 5ALOA 4JQSA 2VJMA 4DV7B 3DT8A 2I22A 4CLRA 3H3FA 3P27A 1W5TA 1AQ6A 4IGKA 1EFRD 4X20B 3RS2A 5TQ0B 4DG5A 1BDHA 1E1CA 1KC1A 1O95C 3EARA 3L0OA 2YXPX 2XY4A 4DGQA 4ETIA 1OFUA 3FM9A 3WGYA 2EGGA 1OIWA 3D2BA 4UVEA 1W25A 5AJWA 3HCWA 1IBKB 3C3YA 3VUFA 1UDRA 3PX2A 1SCNE 4MIKA 3CZPA 2H1FA 1NVVR 1FQKA 2Q5IA 2WNIA 3GDFA 4O2LA 3SE7A 4MIOA 4ZU3A 1ZS9A 5C1OA 5TPWA 1N25A 2YW2A 4AYXA 1FIUA 2VH5R 5HOEA 3UXMA 5BRAA 2UAGA 3DZDA 2Y9PB 1M8PA 4KPYA 2QMUA 1GTL1 2QY6A 2R4UA 1BJKA 1T1IA 3CR7A 2AZTA 2QGZA 5CPFA 1A9TA 3RS0A 1IFXA 1Z6PA 2RI1A 4X6YA 1JILA 4DLLA 1E62A 1O9BA 5KNDD 1A4UA 5BV1A 2O8VA 4WOBA 4DJFC 5B3KA 1XTVA 3G6WA 3S3TA 3VH3A 3FYUB 1Y3IA 1U5BB 2E3JA 2H51A 2NYUA 3GJTA 1G8YA 3KBOA 1YIOA 4P58A 4X84A 3THYA 4C78A 5AXDA 5EIBD 2GA9A 2DJIA 1WZUA 2Q99A 4RVHA 1RS0A 1HFWA 1TL7C 3GBSA 1NBMD 1DX6A 1ZGGA 4JBLA 4QU0A 4RA9B 4TPKA 1TF7A 5BT8A 1G6KA 2FVYA 4P0QB 3TLCA 4XJXA 3WTBA 2FQ1A 1S7GA 3ITDA 3T99A 3JZMA 2HW8A 2R00C 3ZX4A 1J56A 3BICA 5AI5A 5F1YA 2H85A 2LD4A 2W8ZA 4R1TA 2PX4A 2P78A 3K3PA 4BIMA 3KT8A 5EQJB 5F7JA 2JFHA 4HYYA 1P7CA 4TMTA 3ZNOA 4IJUA 1TEXA 2BISA 4EB6A 3MWFA 1E6MA 1Y81A 1WHSB 5J5AA 3ILHA 3MMXA 4P6VF 2YZNA 2G09A 1L5KA 3GLFE 4IXMA 3PJFA 1KDZA 3KAPA 3SJ7A 3I2HA 4DLVA 4Y6RA 1IY1A 1I2DA 2COUA 3L0CA 1FC0A 1RBZA 1VPLA 2QRMA 3G8CA 2CMFA 3IBTA 2JF0A 1VJCA 4TMWA 1OZFA 4UD6A 3OQOA 2CMDA 4G0OA 4ZVOA 4HH0A 2GFQA 1W9MA 1CY2A 3AJ8A 1EHIA 1BMQA 1PG2A 3EDQA 4FFVA 2QSYA 5FPHA 1L7DA 4H4EA 3ZNPA 1I3CA 3P0JA 1KEWA 3SQDA 4C04A 3LUGA 1V4BA 4E32A 1UKAA 4YC7A 3H6KA 4C7OB 4ENWA 1RLOA 1UBHS 5L6MB 3I23A 3NM5A 1KOJA 3MJTA 4PVDA 5CLHA 4ALLA 1Y9DA 4HQ0A 4B82A 5CB4A 2JVJA 1V6CA 2XYVA 3H18A 2IXTA 4P2GA 4Q9DA 1C7QA 3TQIA 2P62A 5H16A 8OHMA 4JT4A 4F9EA 4ZTZB 2Y99A 1E1DA 1TQDA 1GRCA 2I87A 4A8TA 4PSAA 3EVTA 2DWQA 2ZBGA 1YL5A 4R1QA 2KBEA 2XAAA 4V0OA 2HNBA 3R41A 3FMOB 3RBZA 5T4HA 2MINB 5BQ3A 5AJUA 4JX9A 4TQGA 4K8RB 3ZBPA 1O5OA 1NW5A 5A3QA 4UD2A 1UBKS 4DFDA 2UYQA 3JQ9C 1U2RA 5ABPA 3WIVA 1M54A 2RHRA 3QXCA 4RYDA 3UIEA 5BNIA 2OGSA 5TMBA 2R84A 3EGXB 4BQIA 4WUVA 2CVFA 2OO7A 4G1BA 4N1AA 1XNHA 4YB8A 3NHWA 2BV3A 4RQAA 4G25A 4BCCA 4EHIA 4H16A 1P80A 4TL9A 1I7NA 2B9EA 1LDBA 4CMCA 4Y6SA 3BWYA 5LQUA 4C08A 5ICFA 1Z83A 3WJ1A 4A4DA 3GU3A 3ONWA 4M46A 5K8UA 2ZIWB 2O1XA 5IF3A 1OASA 2Y1GA 3IAM6 1NUHA 3NASA 3NRBA 1XVVA 4ZAWA 2NUBA 1DOZA 4M7PA 1S2GA 2XJ4A 1QH9A 3OP1A 5A0VA 3V1UA 2NLOA 3RB8A 4E4TA 1O57A 2Y93A 4UU8A 1FJHA 4ZO4A 4BMOB 1TCBA 1QIGA 1D8TA 2HHJA 4HN9A 5KJ6A 1CUJA 4ZCSA 3BFKA 2QTZA 3IE0A 1UBGA 5FR2A 3TSYA 3G3EA 1ZK3A 5BUQA 3FTEA 1OFVA 2FPSA 5D87A 1K5PA 2HA7A 1BU8A 3ISTA 1ENZA 1T15A 3ET4A 3GFRA 2GVDC 3B7PA 2X5KO 2KS6A 2QTMA 3EXG2 4ZO9A 3TX6A 3O6VA 4JMPA 2G4CA 5EG5A 2OEPA 2X7XA 4ZEOA 2XWBF 5HRAA 3PGXA 3EXIA 4G86A 4C01A 2OYRA 4YP7A 2MJLA 2MT9A 2BHTA 2H4XA 2VF2A 2VEOA 1L7EA 4ETNA 4GM4A 1K2WA 3ULKA 2K2WA 3CYFA 4LDNA 1YNSA 3BYZA 2GXSA 3HB1A 2HI0A 3A4VA 2VPQA 5DTMA 5HJEA 5FTLA 1JKFA 1JDUA 2OBNA 2ZBVA 2CNDA 1JIUA 2J4DA 4KV7A 4MRMB <