1S9DA

Arf1[delta 1-17]-gdp-mg in complex with brefeldin a and a sec7 domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
161
structure length
155
Chain Sequence
MRILMVGLDAAGKTTILYKLKTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Snapshots of the Mechanism and Inhibition of a Guanine Nucleotide Exchange Factor
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein transport/exchange factor
molecule keywords ADP-Ribosylation Factor 1
total genus 54
structure length 155
sequence length 161
ec nomenclature
pdb deposition date 2004-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s9dA00
1H8EA 2XNDD 3KX2A 2WJVA 4D4LA 3FPAA 2RHMA 2ZIAA 4P4TA 1CF4A 1QHGA 3FFBA 2QU8A 4MGIR 4WXPA 5F9FA 4QM6A 2GF9A 2XNSA 2QE7D 4ZIRB 4CF7A 2J5XA 2JLSA 3BH0A 1GL7A 5DGXA 2XB4A 3JZMA 2QENA 4PAMA 2QSZA 5K8UA 1OFHA 5SZJA 4MYUA 2DFKB 1LS6A 3KKNA 4TYQA 5BN5A 1QHSA 1VMAA 2D4HA 4NZYA 1UKZA 2G83A 5KNBA 3TGPA 3CKLA 3IUYA 3B1YA 2ZAMA 1PLKA 3P4YA 5G3ZA 3VQTA 1YKSA 1S2MA 4KO8A 2CK3A 2BHRA 3RS0A 5FR1A 1AZSC 2IS1A 4S35A 2XGJA 1N25A 2JEOA 4XVRA 1HT2E 1XNJA 4GOJA 4M2LA 4FMBB 1T8UA 1TUEA 2Q9AA 4TLEA 2CCGA 3A4NA 4V0MA 1COWA 4E22A 3TUJC 1RRGA 2B21A 2GRJA 4BUJA 3T61A 2D7DA 1XD8A 2X8AA 2ZS7A 4QL3A 1R0ZA 1XD2B 5FH9A 2NPIA 4M1YA 4M9XA 5FOXA 2LKCA 1F2UB 1GRQA 2F43A 2NIPA 5DSZA 4D82A 3CH5A 4JMPA 4TQUS 1ZAKA 1Z0IA 4TL7A 1OIXA 5HKKD 2HLDD 1II9A 2VP0A 4IJMA 1G8FA 1OFUX 4N0EA 3CPEA 2BKUA 3EAQA 1SKYB 1P2TA 2QAJA 3GEHA 3LBNA 4Q1FA 4JLPA 2ZSBA 3ZH9B 1X8JA 2IYZA 3RRZA 2PEYA 5FUYA 3ZLJA 1D2MA 2H57A 4DCTA 2WSSD 5CJ2A 2GJSA 1G3UA 3WMGA 4A0GA 2CDNA 221PA 1KJZA 1TTTA 3LFUA 1XZQA 4IVPA 1ZD9A 3MSXA 1X8LA 1MRNA 1FW6A 3IQWA 4A1FA 3TRFA 2CNWA 3B9QA 3AVPA 1FOEB 2FOLA 5TMPA 2EFGA 2VP6A 4ZI2A 3BS4A 3VR3A 4B3FX 3AVXA 3OIWA 1RW4A 4U02A 2G0NA 3PR1A 4PO9A 3ZVRA 2A78A 4JZKA 2VTKA 5EUQB 2FGKA 4D6PA 3J81k 4TQAA 4PC2A 5LDDC 3C5HA 4YXWA 1IXZA 3X1YA 1IN7A 2XOKD 5DYGA 2CE2X 4P0TA 2OM2A 2H1LA 2P6NA 1E2FA 2JLRA 3U7EB 2GXQA 3KFVA 2QY9A 3C41J 1DOAA 3PUYA 5FL3A 4B2PA 1S8FA 2B8TA 3SFZA 3THWA 2OE2A 3SNHA 4MH0R 1H8HA 4TMTA 4GDFA 1DO2A 1GUAA 1OXTA 3TBKA 2NMVA 2W2XA 4ZCLA 1HV8A 2P0EA 1X3SA 4PAOA 3NDPA 4JLVA 5FOUA 4ACAA 2PT5A 5KTYA 1S1CA 3PEUA 2HJVA 1CR4A 2J45A 2EWVA 4YONB 4C0LA 3NVAA 4IXMA 3OEED 1FX0A 3PIRA 1SXJE 4QHTA 1KMQA 4NMMA 4MDFA 3KXIA 4JJZA 2FEOA 2XX3A 3SDZA 1RZ3A 5D3MA 3QPWA 4JSYA 1E2EA 4UJ3A 2ERYA 2D7CA 1E69A 4JL8A 4W9MC 1G5PA 4MUAA 2QN6A 1E9DA 1NN5A 2G1KA 2OLJA 2OEPA 1EWQA 5AK0A 2JCSA 4YMWA 1Z2AA 4I1VA 3LX5A 4Q19A 2D62A 3ZVLA 3ADDA 2PZGA 2AWOA 2XTMA 1UBGA 4JLJA 1K5DA 4IDQA 3IIJA 2HF8A 3PUVA 4TLDA 5TV2A 5C18A 4P4UA 3CW2A 4O0MA 4Q47A 3RHFA 3K9GA 1ZD1A 4TMXA 5F2EA 2BVNA 2ZRLA 4DLWA 1Y63A 5E7IA 2RCNA 3ASYA 2OZEA 4GT1A 1PLJA 5CB6A 2O8FA 4LJ8A 3B60A 4PZYA 1PV4A 1E2HA 4YDHB 4Z1MA 2BV3A 4B3CA 4GOXA 2J0UA 1G7SA 3TE6A 3KFXA 3EARA 5CM8B 5FPSA 4F4JA 2EW1A 3QF7A 1GSIA 2QMUA 3TR5A 2W2TA 1SVLA 3NHAA 1ZUIA 2QQEA 5AJVB 3LW8A 4X8HA 1QG4A 2KBFA 5B2ZA 2LWIA 1E79A 4RD3A 3WXMA 3M0EA 2V6IA 2JLZA 3ZVNA 4P32A 1L4YA 3WHLA 3L8YA 3U6BA 5DLQC 4UXJA 5CYOA 5C1BA 3BRWD 1TF5A 1K6MA 2B7BA 3CF2A 3A8TA 3LBIA 3MG9A 5FTKA 1MO6A 1N6KA 2YKGA 4URYR 3SS8A 2H92A 3UIEA 1EFTA 5C2JB 2CLCX 2C77A 4RD2A 3AVVA 1QHHB 3T1OA 1RPZA 1B23P 3A1WA 5KSOA 3R20A 1Z0AA 3KL4A 3BB4A 2H17A 3RWOA 4OBEA 4URXR 4R7ZA 4N3NA 2IYSA 2WKRA 3QBTA 2ATVA 5E3HA 2WWGA 1YQTA 1MABB 1VTKA 1OPXA 4JBXA 5DH9A 1F2TB 1P7CA 4DT1A 1Q1ZA 2B92A 2FSFA 2ZSAA 4B48A 1Z06A 2ZJ2A 3KB1A 4B32A 1ELOA 2QMEA 5JSZB 1KNXA 2ZJOA 4HB0A 3WP1B 5H8WA 2BCJQ 3K70B 2AWNA 3C8UA 1R0XA 4IOKA 4JL6A 2QMHA 4MKIA 1GTVA 5JSZA 3U7GA 4US2R 1G9XA 4PQYA 3TSZA 2YWHA 1WB9A 3WMFA 1U8YA 4CEIA 4MYHA 4A92A 5EJEA 1YR8A 1TEXA 3WYFA 1QRAA 2OFXA 3EG5A 4NHOA 2QM8A 2H7VA 4BQSA 1ZJ6A 1DG1G 2XTZA 2A5YB 4QNRA 2RB4A 5D3QA 1XXHB 5CJPA 2R6AA 3IIMA 4TWZA 4Q7JB 4BECA 1RYFA 1XXHA 5FPTA 2FPMA 1FUKA 1KO7A 3AF2A 4GNKA 1TEVA 4NPHA 5FTJA 4IVQA 1NVWQ 4KU4A 4TLCA 2JLWA 2WWYA 4PANA 4CEIB 2WJGA 3LH5A 3GLHB 4UNNA 4W7SA 4O2RA 1XPRA 1RVDA 1QHYA 5G40A 3FMIA 2VSOA 4OHXA 1OT3A 1QZXA 1Z8FA 1N5LA 1S9DA 3DKVA 1E2QA 4MGYR 4EPWA 4EUNA 2IBMA 4JLOA 4ZDKA 5LD2C 1IJFA 1SHZA 5FUXA 1XJCA 4LJ4A 1ZVQA 1YZNA 3IQXA 4ZIRA 2ZRIA 2IF0A 4HYYA 1ZMXA 2A30A 4KI0A 3SR0A 1VCOA 4LJ6A 4ZPXA 4EFMA 2RHDA 1NY5A 2OBLA 2ZJYA 1AZTA 4OQNA 2G77B 2GBLC 4E5UA 2KI5A 3U7HB 2WM9B 3NTUA 1AN0A 4CEJB 2ZU6A 4KFRA 2Q6TA 3CF6R 4Q18A 4KXFB 4V02A 1I4LD 2OV2A 3LX8A 1W4RA 3VKWA 4KSCA 4EPYA 3TAHA 5JLJA 2WHXA 4KYUA 2F1JA 2D2FA 3AVOA 4C7OA 4V0KA 1U8AA 4G3XA 1JAHA 2PLRA 2GA8A 4QOSA 1BIFA 4C3ZA 1RJ9A 4G5GA 2REOA 1LNZA 5KOYA 1NMXA 3QXXA 5LBIA 4AKGA 3EA5A 2AR7A 1W0JD 4RY2A 1G17A 4PPNA 4DLZA 1NJFA 3OZXA 4CW7A 2IX3A 3E70C 5D3MB 4WW0A 3IEUA 5DE3A 4CRWB 1I4DD 4QM7A 5JJIA 2PMKA 4DLVA 4OKSA 3DZ8A 1E1QA 4PXAA 2ORVA 2CLSA 3AV0B 3ZZTA 3VKHA 1X1RA 2ZRHA 3TKLA 3GFOA 4B2LA 5CDFA 4ON9A 3PENA 4C2UA 4QGGA 2RGNC 4RKEA 1MKYA 2PZEA 2HXYA 4NBSA 4PX9A 1TF7A 5FBQB 5DIFA 4DRZA 3CPHA 4TLBA 4L16A 2XTNA 2YC4C 4PFSA 1U98A 4IEIA 1G3MA 3C14C 4V0NA 1EFRA 4YMSA 1KI7A 3ETLA 4G0NA 1LB1B 2NQ2C 3LXRA 4TSFD 1FPMA 1JAIA 4KSBA 3ZGXA 2RAPA 2OSBA 1U81A 2AL7A 3SJZA 1WBDA 1IY1A 2QRZA 2ZQ5A 3EASA 1Q21A 2ZS9A 3DEFA 3VR5A 1E98A 1G3IA 2HLDA 4GSYA 4Y0VA 2AN9A 3A36A 1SVMA 1JR3D 5M04A 1PJRA 1RYHA 2JA1A 2ZJ5A 2ZJ8A 5EZ5A 4C4PA 5CIQA 4ZDIA 4DIEA 5L3QA 5G41A 4DDTA 2J9RA 1CJMA 1N3BA 4U5XA 1T4GA 1ZNYA 3U3OA 1OH8A 3X1XA 1CEEA 1EX7A 3I92A 3HU2A 2RGGA 1UDXA 2J41A 4BEBA 4URWR 4TTPA 3IKJA 1S3GA 3SFVA 2QNRA 2BJVA 4JYBA 4Q48A 1XD9A 2HYIC 2VP4A 4NCHA 1VG9B 1U90A 3F8TA 3PVSA 1HA3A 3KJEA 3KTAB 1GKUB 2ZTSA 4KFUA 4DUGA 1T91A 2ANCA 2WJJA 1P9WA 3RAPR 3VKGA 1OH5A 1HTWA 1EGAA 1BYIA 3SYNA 3CLVA 3VR2A 2FWRA 4KVAA 4WIAA 2PMDA 4HI0E 1Z6GA 1E94E 1SXJB 5IHPA 2VA8A 2FN4A 3E1SA 3T1VA 2GZAA 2J7PD 1OH6A 5B64A 1MABA 1AGRA 2QG6A 1J90A 3CUEF 1IY0A 1Q3TA 1P75A 121PA 1KSFX 3D6TB 4RVCA 3ZD6A 1F2UA 3QG5A 3ZZ0A 1KOFA 5F9HA 2YOGA 2AKAB 3LLUA 4FCVA 1T3SA 3W6PA 1S1MA 1T5IA 3K09C 4ARZA 3OHMA 5F3WB 4RJLA 2F43B 4NYMR 5J4KA 2E1RA 2VLIA 1KI8A 3R8CA 3KKMA 4NYJR 2ZI9A 3EC2A 2GESA 1RE0A 3A1UA 4MA4A 1V43A 2BC9A 5KSYA 2JLQA 2VRWA 2AK3A 2J59A 2IUSA 4WXRA 3PCRB 2CLDX 3LV8A 2OUKA 2QAGB 1Z47A 4HAXA 2WPDD 3RRNA 3TAUA 1GL9B 1OHHA 2WWWA 3PUXA 5JWOA 3AVYA 4GFDA 3FTQA 1F2TA 1Z08A 2B8WA 1T6NA 1WMSA 3W3AA 1IQPA 4DJTA 1CLUA 3FFAA 3Q85A 1K8RA 5TVKA 4LV6A 4MKFA 1Z83A 2B6HA 1OSNA 2IEYA 2RKOA 4QFMA 4AYTA 2JASA 5HPYB 3AVUA 1FMJA 3RS3A 2WMNB 3KQKA 2EFEB 5FOVA 5EZ6B 4Q1AA 4M1OA 1A7JA 4HUTA 4YXWD 1XWIA 1QHNA 2FX3A 3NEYA 2EFCB 5C4GB 1D9ZA 3B85A 4XWAA 3QKRB 3IIKA 3IO3A 4DXAA 1JXMA 2W00A 3LW7A 1UBFA 2DHRA 2YYZA 3C4JA 1AK2A 4HAZA 3E2IA 1IY2A 1NVVR 3WBJA 2F7SA 4Q4HB 4DHEA 1ZINA 4M9QA 5FBWB 1FL9A 1ODFA 3NDBB 1O87A 1W0JA 4Q4HA 5KHOC 4HUQA 4LV8B 4OQXA 1IXRC 3FVQA 1TX4B 4B43A 2GWHA 4DKXA 1EWRA 4EKDA 5G53C 2ZR0A 4P4SA 2OCYC 4BE7B 1LV7A 1XTJA 1RFLA 4OHWA 3T06B 4BLTA 1BYUA 1NVVQ 4JT4A 2PJZA 3OFNA 5JS8A 2FFAA 2CHQA 4J0QA 4PHGA 4ASUA 4RFSA 1U0LA 3B5JA 5BWMA 4ZCIA 3GLHE 1KI4A 3B1WA 2O8CA 1XTSA 2QQ0A 1UJ2A 4HZUB 2HEIA 5CITA 5J4LA 2I1QA 3U7FB 3EPHA 1E32A 4IOJA 5CK4A 2X2FA 2ZPTX 5EE5B 3H1TA 1R6BX 1COWD 4PC3A 4AURA 1FUUA 4TMVA 2FZ4A 1XXHE 5AUOB 1DAKA 1ONBA 4IW3B 4XSGA 3TNFA 3K8YA 3K0EA 4HUQB 3MWKA 3EIEA 4OQLA 3H0KA 2WWXA 1XF9A 3U60B 4MRNA 1FTNA 4AY2A 4BLPA 3FDIA 1ZM4A 3TQFA 3LLMA 5BN3A 5CIWA 3GLIA 4A8JC 4JBYA 2DWQA 2Q3HA 3X1DA 1E2DA 2QT1A 5KNDA 4XWOA 3QKRA 1AS3A 1NIJA 2FNAA 3FYHA 4DCUA 4TZ6A 1J8YF 1UEIA 5ANRB 1M2OB 3TJZA 4B75A 2FA9A 1OFIA 1DO0A 1GAJA 3LAWA 2EYQA 2VHJA 1W0KD 1M7GA 3B1XA 2LCFA 3QENA 4WVFA 5FTMA 2VBCA 3JVVA 1M74A 3RC3A 2IA5A 4B33A 4US0R 5KSZA 4KAXA 2FH5B 4QHSA 4IOMA 4LPKA 4E09A 1C1YA 2R65A 3V4RA 4JS0A 5B30A 4F4CA 4NYMQ 1CU1A 2UZ3A 5IDVA 4P3YA 5EXSA 1U94A 2CNWD 2KBEA 4AIIA 1J2JA 3AKCA 3FHOA 3MWJA 5FTNA 4LGMA 1XCMA 4B6FA 3EXAA 4EPXA 4Q1EA 1LTQA 2WWHA 4OHVA 5ELXA 1W48A 3FKQA 3CF0A 3RS7A 3WRYC 3VX4A 1G18A 2C96A 2CL7X 3LD9A 2GVDC 3HDTA 1SVKA 2QTFA 1Z6XA 4OK5A 3KTAA 3CIOA 4K81B 4URZR 2Z0MA 2A3RA 4JLAA 2QZ4A 3BH7A 3CX6A 3R7WB 5GVSA 1W49A 3SJBA 1YR6A 4LC1A 1KMHB 4LJYA 1N6HA 2ORWA 3K9HA 1DADA 4AD8A 1II0A 3CONA 3MRSA 3ADCA 4CT5A 1YU9A 2I4IA 1CP2A 4QBFA 3ZVMA 1EFHA 1KMHA 4GZLA 4V0ME 1G7TA 4MGKR 2G9NA 3O8CA 2YZ2A 1IJEA 2HV8A 4XTRA 2P6UA 3PEYA 3CRW1 4W5JA 2R9VA 1G4UR 4Z51A 1XBTA 3T15A 3UPUA 1G41A 2WIAA 2YHSA 5HZHA 2IYVA 4FMDB 1VIAA 5KPDA 1E0AA 1AS2A 4OK3A 1SVSA 3GEIA 4LBYA 3VR6A 2O52A 1SXJD 5AJYA 1TAGA 3SJCA 4DDWA 2OG2A 5BYKA 2IW3A 2ZI3A 4JKYA 1DG3A 1T0HB 3QPVA 4JLMA 3R9IA 2HDNB 2OXCA 3B1ZA 1YRBA 2FZLA 3EWAA 4UKDA 3PV0A 1BMFA 2ZVPX 2PX0A 2W6JA 4B44A 4D81A 1CXZA 3I3SR 4TLAA 1E1RD 2BMEA 2RGAA 1KK0A 1CJVC 2JJ1A 1BKDR 1KHTA 1F60A 3BWDD 4NTZA 4BEJA 1OXVA 1XB2A 1RC8A 5IF9A 2J0UB 5EP4A 2FU5C 2OAP1 2VEDA 2NTYC 2W6ID 3JZAA 4O2LA 5HZKA 3MAAC 4EQ6B 4FN5A 4NKRA 3UKDA 3I32A 1KO4A 3PFIA 1V5WA 1W5SA 3FKSA 3LWNA 3PUWA 1E1QD 4ITRC 1DEKA 2QROA 3EZ7A 4Q5IA 2F9MA 3QOFA 2AKYA 2N46A 3L0PA 4PHTA 1ZC4A 1OV4A 1U9IC 2F1IA 4R71A 1NIPA 4HAVA 1YVDA 3OIUA 1VDZA 5GJVC 3CNLA 1TU4A 1IM2A 3UG7A 3AQ4A 1JB1A 4Q4JA 2NO9A 4ABYA 1GNQA 4H1UA 1FNMA 2QEQA 1F5NA 2R44A 1E6CA 1E9AA 1KJYA 1YJ5A 3BK7A 3FMFA 4M4SA 4HB4A 3BBPA 2DCUA 4GMDA 4C9BA 3ADBA 2R6CA 3W8RA 3PEWA 5JS7A 1KO5A 1G21E 1O3YA 4KITB 5KUTA 3O8DA 2C98A 3E5HA 1VIYA 1JPJA 3I8XA 1W36C 1JECA 3IDQA 5KDDA 3HU1A 3U5ZB 1DELA 1KK1A 1R7RA 2DFTA 1CULC 1N6LA 1ANKA 2GJ8A 2VO1A 3WNDA 3SZRA 3OEEA 1L4UA 5HE9A 1TMKA 2YNMA 1HQCA 1E9BA 4HB3A 3GEEA 1W5TA 1WE2A 2VYFA 2WSSA 3DVLA 4B73A 4R2IA 4PO8A 4PSVA 5FBLB 4LJ5A 5A0FA 5JEEA 2KE5A 1JQLB 1KI2A 1WF3A 4R2HA 2YOHA 4EPVA 5IT5A 1U2RA 1AS0A 4K46A 4FMCB 1MR3F 4TZ0A 1ZUNB 4QJ4A 2EVWX 2FPKA 3T34A 3F3YA 4JVMA 3G0HA 1SZPA 1JI0A 5L3RA 2ONJA 1DS6A 4G5QA 1YHNA 2J0VA 3AF4A 3AKYA 1DAHA 1S0UA 2ODWA 3N2EA 1G3QA 3RSOA 1WA5A 2WVJA 2V4ZA 1XCPA 1A2KC 3VAAA 3KDSE 2G1JA 2OESA 3FMPB 4TQ9A 2VF8A 5E95A 3WHKA 4OJQA 3EPJA 2AHOA 4A8JA 2RMKA 2VP2A 4L9SA 3B7GA 1JJ7A 1TADA 1IN6A 2WWFA 3A1SA 3TSOA 4PR0A 4FIDA 4Q02A 1DAIA 521PA 2V7QA 4D2IA 1LY1A 4URUR 1QHXA 5KPJA 1OH7A 3THOA 3EW9A 4IDHA 3AF3A 1UFQA 3EA0A 5TB5A 1GFIA 1ZYUA 1VHTA 3QJYA 4NCIA 1P2VA 1GL6A 4M22A 1ZU4A 4NCJA 2ZEJA 1G20E 2XOKA 4POAA 4PQRA 2YVUA 1NVUQ 5KSPA 1GNRA 3A4LA 1TF2A 4LYHA 3ZDQA 3L0IB 1E9EA 2C99A 4KV9A 3SE0A 2Q3MA 3AUXA 3NBFA 3QKUA 3TH5A 3VX3A 5EP3A 4XD7D 5JI3E 1TL7C 4FMDF 4F4IA 3MMPA 4IDNA 4IOLA 1XD2A 2QM7A 4TT3A 5GJBA 2BBWA 3B78A 2ERXA 2JJ1D 1XDBA 4ARZB 4CYMA 1XRJA 2D74A 4JVLA 4AWXA 1ZP6A 4P31A 5KYKA 3K70C 1R8QA 4PHFA 4V0OA 4DIDA 4BGDA 5GADl 4WZ6A 3BFXA 2NPFA 1TPZA 3OE7D 1D6JA 1VKJA 1N6OA 3TMKA 4BZPA 3I72A 1A5TA 5P21A 1SXJA 3OAAA 4BFXA 1KYIA 1VG1A 4F93B 5KO2A 3FE2A 2J3EA 2ZUDA 2DFLA 2XZLA 1M34E 1K5GA 3SOPA 1GG2A 2DBYA 3AGPA 2NO1A 5K8LA 4KCGA 4A2QA 3L82B 4B2IA 4AKEA 2K5UA 4I81A 2WJIA 4LYJA 1XPUA 1WRBA 2R6FA 1YZLA 1KY2A 3TQCA 5E4FA 3RVBA 2PL3A 4RZXA 3SJAA 5C4MA 2V7QD 1FQJA 2A5FA 2C78A 4EJSA 2ZYWX 3QXHA 4KLZA 2WTUA 4GP7A 4LK2A 4BWYA 3QKSB 4FXPA 5BYJA 1Q44A 4V0LA 1ZBDA 2DPXA 5CK5A 1MO3A 2J7PA 4B3BA 3SQXA 5JHGB 4QHYA 1N6NA 1KZGB 2C2HA 3NBZC 2C8VA 3VTKA 1XP8A 4Z8XA 5DHAA 2ZSEA 5JRJA 2ZE6A 4TL6A 4RCYA 1MT0A 3LQQA 3M6AA 4US1R 3U2QA 2KB0A 2X2EA 3VNVA 3IPXA 3B1VA 4DLYA 4FINA 4L5BA 1OB5A 2BDTA 1CR2A 3U6KA 4M1SA 4K8OA 2BEKA 1KI1A 3RSLA 3ZD7A 4UQOA 3UMSA 4FWTA 4RCZA 1E96A 5AJWA 1G8HA 4HZIA 4RFSB 2MSCB 4B76A 4YMUA 3KQNA 1CJKC 1P2SA 5DI3A 1Z6AA 3MGCA 3G5UA 2OXRA 3MLEA 2O8FB 1NSFA 4HLUA 3BERA 4ZKDA 2W6JD 2C5LA 4DLXA 2QPOA 2O0JA 1M6NA 5EE9A 3GJ0A 3R9WA 4A0HA 4B3DA 2X1VA 1XMIA 5FPHA 4ZV4A 1W36D 1NNEA 4O3MA 1UF9A 3THWB 4HEJA 1FP7A 5FI0B 1Z07A 4TSFA 2WJHA 3BXZA 3KJHA 4QJ5A 1ZNXA 2V1UA 1N6RA 4ZO4A 1CR0A 2GXAA 2CHVA 2VHUA 2ZJZA 4LHXA 3K0CA 2CVHA 4QGHA 4YLGA 5KNCA 3AVTA 1E99A 4LHZA 1E4YA 2NOAA 1Q12A 2ZRAA 5E7JA 4A82A 4Q03A 4RD1A 1C4OA 4OI0A 2XZOA 3PUZA 2PEZA 2QGZA 5HE8A 4UNPA 1XMSA 5HCIA 4CEJA 1KO8A 4LHVA 4PPGA 4M1TA 1G16A 1UADA 3RS4A 5GJCA 4ZCMA 2F55A 3ZJYA 2REBA 2Z43A 1TQ2A 2BKEA 3I5YA 1GIAA 3A37A 1HE1C 4Q4AA 4PHHA 4RZ3A 4C0HA 6Q21A 3QVVA 3UANA 5B57C 2EYUA 1MO5A 3MCAA 2P5TB 3S1AB 3U3KA 1E9CA 4PZZA 1XCGB 1P3JA 2CXXA 4AC9A 2EU8A 4M1KA 3HWSA 1JALA 4HSEA 2JJ8A 3HP1A 1CJUC 1J8MF 1E9RA 2P6RA 3RRYA 2BIFA 2NZ8A 4QJ3A 3U4QB 4KJZA 4F92B 5J4YA 1CRQA 2JLVA 1DAEA 2IXFA 2V8OA 5JFGA 1W4AA 3N2IA 5HR5A 3OAAD 1MO4A 3X1WA 2GBLA 4A0FA 1W47A 5AWFC 2P2LA 1UKYA 3UK6A 1MRSA 3U3RA 3AF0A 5JHHB 1HUQA 3QBVA 4IDOA 3W5JA 1XTIA 3K0FB 1Z2CA 4Q7LA 3WNCA 3FMOB 3GLGE 3QKSA 4DSOA 3QE0A 1KI6B 2FG5A 4JYCA 4ACBA 2CCKA 1AM4D 1E1RA 4WBSA 4ZDWA 421PA 2BBTA 3DHWC 4A0RA 4LBWA 1HYQA 1P6XA 1G8GA 1M1YE 1HY3A 4HLUC 2IUUA 1N5KA 4LUCA 1TNDA 1AJEA 3EIHA 2WV9A 3NH9A 1XX6A 4XVUA 2J1LA 4JIMA 5B58C 3I1FA 2BBSA 4HLDA 1R2QA 2BMJA 2GDJA 1S3SA 4IKEA 2VSXA 1DTSA 2GCNA 5L3SA 1LW7A 1TU3A 2OT3B 3AP2A 3LA6A 2OHFA 2FE4A 4IHQA 3GQBA 4LC0A 4W5WA 4BZXA 1R5BA 3U44B 4KBGA 3QNUA 4GRAA 3UG6A 3BD9A 2ZRJA 2YC2C 2HJGA 1G4AE 2VH5R 1KZ7B 2IS6A 1G64A 1VCMA 2F9LA 1RRFA 1KSJA 2CMKA 3ZS9A 1GDDA 1P5ZB 1E2KA 1LVGA 3D31A 5LPNA 2HXSA 3Q5DA 3Q9LA 4D0NA 2PBRA 1EFCA 1EK0A 5AJXA 1XTRA 2W6IA 3DM9B 3MJRA 1FQKA 2KWIA 2OO7A 3QI2A 1D8TA 1KK2A 1W1WA 5JWRA 2GCPA 1JEEA 2JAQA 1VYUA 4DEYA 2CCJA 5F98A 3F0TA 3I61A 2WSMA 4NYIR 2XZPA 3T35A 2ZRKA 4KFSA 2IYTA 4S2EA 4TMWA 3ZIAD 3ASZA 3B9PA 5J40A 4UXHA 1JR6A 2WAYA 2BMDA 4KVGA 1KKMA 4NU0A 821PA 1W44A 4RZ2A 1PVOA 3AB3A 1CS4C 1RIFA 1IBRA 5E7MA 3GP8A 5JJLA 1SHKA 1G7RA 1Q1EA 1KAGA 4GOKA 5CLQA 3CNOA 5FR2A 4BLQA 3VMFA 2Q9CA 4IDPA 1P61B 1JEDA 1AGPA 3DOEA 1R8SA 1ZD8A 3DOFA 3ZQJA 4PAQA 1YZGA 4DWJA 2QP4A 3GJXC 4QBHA 3H2YA 1IOZA 2WJYA 2GILA 3OIYA 4PC1A 4RZUA 3UMRA 1WP9A 3GLFB 2HF9A 2C95A 4D80A 1T3HA 2Y8EA 3EC1A 5G3YA 1E3MA 1A2BA 5SZIA 2WOOA 1U0JA 1VG0B 3O8BA 4P33A 4LBZA 4F91B 2WZQA 2XJ4A 1P73A 2XXAA 1TUIA 1QF9A 2W58A 1S96A 4IRUB 1EFRD 1RJ9B 2CEAA 4Q1CA 3QF4A 3LXXA 4XWKA 1NP6A 2ZE8A 1LFDB 2YOFA 3CO5A 3RS5A 4FCTA 4CDGA 4C7OB 1AQUA 1HEIA 1W2GA 3A6PC 1G1MA 4PQFA 4G5RA 3B13B 2EWWA 4A9AA 4C0SA 3GLFA 1N5JA 1NMZA 1Z0KA 2GEUA 2O8BB 4UNQA 2ZITA 2ODNA 4ASUD 3LNCA 3U61B 4PZLA 2O8DB 3RDPA 3W6NA 3ZS8A 2L0XA 2Q21A 4G5OA 2ORIA 2ZRPA 1JPNA 1SQ5A 2WMOB 4ESHA 4LJ9A 4M9ZA 2OCAA 2FSIA 2JDIA 1SKQA 1ZUHA 4Q7KA 3GLGA 4M21A 1P60A 2D2EA 4AKHA 1XFAA 1W36B 1P2UA 2ZRGA 621PA 4GP6A 4A2PA 1Q57A 1OF1A 2MSDB 4IVRA 4KBFA 5EE0A 2FFQA 5EE3A 4E03A 1VYTA 1GKYA 2VIIA 3I4LA 5J4HA 5JI2E 1GVNB 1HH4A 4MKGA 4D0LB 4Q9HA 2IUTA 2QP9X 2ZRMA 1SVWA 1Z0FA 2LKDA 2ZI7A 3L0OA 2R8RA 1VCNA 2VF7A 3A4MA 1Z0DA 2OILA 1GZSA 4L9WA 2H8KA 3PITA 4NCNA 4HLQB 4PO1A 3U3MA 2UVQA 4WA7A 3GJ8A 1GILA 5DN6A 4DB2A 4HAYA 1Q1BA 2R6GA 4EPRA 1ZC3A 2ZRDA 4Q00A 3TVDA 3GLIE 1XMJA 2D3WA 2ZYUX 3A1TA 4OQFA 3WMEA 2AD1A 1F3OA 2A5GA 3K9NA 3DKPA 3IGFA 1OYWA 2BEJA 4RSGA 4TT3D 3QG1A 3QEOA 1SGWA 4XH9B 4AI6A 1J99A 2IYUA 4X8MA 4MRSA 2Z4RA 3TK1A 2MSEB 2RGEA 3QXCA 2QAGC 2W0MA 5K8TA 3Q7QA 3CB4A 2OCBA 1EXMA 4LHYA 4RD4A 4BFYA 1RKBA 3V4FA 4EIWA 2AX4A 3A58B 3K0AA 1NG9A 3QXJA 3EIQA 5EXPA 1JNYA 2ZE7A 4TYWA 1BO6A 4HDOB 3AVQA 1G291 3T12A 3BOSA 3MWLA 4D4JA 4A15A 3K0AB 3NC0C 2OBMA 1UPTA 2V54A 5EXXA 3C7KA 1Z0JA 4TN1A 4XVQA 3M4YA 4XSHA 1NI3A 5EP1A 2GK6A 2V1XA 2YJTD 4C0QC 4DUGD 3CR7A 4YMTA 3SBEA 3K53A 5BQ5A 2B7CA 2BM1A 3KKPA 4EDHA 1NF3A 3GFPA 1Z28A 1HT1E 4JL5A 2C9YA 3P32A 4A2WA 2FDCA 2PH1A 1KY3A 5BXQC 3GJ7A 1NL3A 3HYTA 1OFTA 1AIPA 2R62A 3CBQA 3N70A 1U8ZA 1OIWA 3P4XA 5FL7A 3RWMB 1XTKA 2ZYTX 3UWKA 4LV5B 1NBMD 4AK9A 1NBME 1E2JA 1H65A 1KGDA 4O25A 4I99A 2ZSDA 721PA 4QGAA 1NJGA 4CEHA 3CX7A 1NLFA 3GJ3A 1P62B 3JVUA 3RNLA 1R4AA 1WDTA 4HAUA 2GF0A 2QORA 2EFDB 5JWHA 1NSTA 5FBRB 2BCGY 4YC7A 4PPFA 1UBEA 3FOZA 2IXEA 5LB4A 4HDQB 4CIDA 1GM5A 3W9YA 2PCLA 1EFUA 4WZBE 3KZ1E 1II8B 1OXUA 5CLLA 2ZS8A 4KLNA 4DSNA 2VHQA 1S9HA 4D25A 1JQJC 4DB4A 3B8HA 3I73A 3D8BA 4LWZA 1JJVA 2OLKA 5GVRA 4UNSA 4Z54A 2ZRFA 2ZR7A 3ZZUA 4JJKA 2PJRA 5H70A 4Q66C 2ZVQX 3SU8A 2DWPA 4MITA 3BC1A 3WYGA 1NKSA 4QXAA 2REXB 2OCPA 3ND8A 4LI0A 4OI2A 4L4UA 2ZI6A 1W4BA 3AF1A 3L43A 5JZVA 3HPRA 2CL0X 4Q9KA 1R0WA 5L3VA 3KJGA 1Z6YA 3QKTA 4JVSB 5FUWA 1KO1A 5BW8A 2FGJA 4GPTA 3VFDA 1OLOA 3DM5A 3EZ2A 3T1TA 2ZSFA 1EX6A 1G8PA 1AKYA 3PG5A 3IPYA 1M7BA 4XOIA 4BASA 2F3RA 4R98A 1X86B 2WBLC 1JR3E 1NMYA 2GXSA 4LSGA 3SYKA 5JECA 5AUPB 1QBKC 2XAUA 2VHCA 1AQYA 3REFA 3T1QA 3V00A 2NO6A 5LD2B 1FFHA 1A82A 1VHLA 4GZMA 3K0SA 1W0KA 4QKQA 1II8A 3TUZC 2IWHA 1N0VC 2QRNA 2XJ9A 2RGNA 4YQFA 3DMDA 2QTVB 1Q22A 2J0QA 2YV5A 2BJWA 2VP9A 3EPKA 2OFWA 4D0GA 3IEVA 4Q1DA 4QG7A 4OI1A 1NN3A 2VPPA 4PTLA 1ZCBA 3H84A 3KQUA 2KJQA 4HLCA 4LYFA 4HDCA 3AGQA 3CRRA 1IHUA 5DHFA 3SI7A 4EPTA 3X1ZA 2RGXA 2ANBA 2I1VB 4RD6A 4DZZA 1BOFA 3EPLA 2XSZA 2JLXA 3VU9B 4EJSC 4RKFA 1Q1QA 1BS1A 2QGNA 2JGNA 3PEVA 5DYIA 1XEWY 2ZUCA 2GZHA 1XEFA 4I1OA 1DAMA 4OK6A 2GCOB 1G19A 5FOTA 5FPYA 4EQ6A 2FF7A 2DB3A 1NRJB 3IBYA 4Y0AA 5FI1B 1KI3A 4BLSA 3H86A 4RFVA 3QVUA 4FWIB 1XJQA 1KSHA 3IHLA 2ZE5A 1DAGA 1GKIA 2N42A 1OW3B 1ZM9A 3QXSA 4MUBA 3U44A 3OFND 3VR4A 1VG8A 1G6HA 3FWYA 4XIGS 4DEXA 4QRHA 4C0KA 3F5FA 2ZYVX 2P5SA 5DNYB 1RRCA 1NY6A 1SVIA 1E0JA 2IWRA 4EAQA 4LDJA 1R5OA 1W2HA 2CE7A 5J5CA 1AKEA 2ZXUA 3GLFE 4DSTA 3WBKA 3AEZA 1Z29A 4QC2A 2DYKA 1IN4A 1YZTA 2IHYA 1GRRA 3DL0A 3BJIC 3IHWA 1IN8A 1VCIA 3OF5A 4DSUA 3IBGA 5JEDA 2ZRNA 4LHWA 3HPQA 1GITA 5TARA 5AUNB 2V9PA 2CL6X 1L7VC 1CR1A 3K0FA 4II7A 4B71A 2OAQ1 3ND9A 4MRRA 1N6PA 4TMZA 4UJ5A 3WY9A 3NBXX 2R6DA 1NLZA 4AG5A 1I2DA 1KI6A 3R7WA 4JKIA 4BRUA 3ECCA 1VYVA 2IF2A 5DN6D 4CZ2A 2F3TA 2DFNA 2XSZD 4MRVA 2H5EA 3W3ZB 5EUMA 3RANA 1X1SA 1OHHD 4M1MA 5FFMA 2PX3A 4DDUA 1E2GA 3T5DA 1ESNA 2JJ2D 4B74A 1KDTA 1WXQA 3SN6A 5AR1A 1KNQA 2YINC 1UDWA 2W83A 4XJXA 4EFNA 5CM9C 4GI7A 4JSTA 1D9XA 4Q4AB 1UM8A 4JT2A 3W34A 4PC7A 1N0UA 2IXGA 4DLSA 4A8JB 2QTHA 5FOWA 2R2AA 3CWQA 3REGA 3Q5EA 3KQHA 1KDRA 2N1BA 2A2ZA 1JR3A 2FFBA 1WCV1 2VQSA 2ECKA 4B34A 3THYA 4EFLA 2QP3A 2ATXA 2IYXA 5HTKA 2IEZA 4A4DA 2O8BA 2WPDA 2W2VA 1DE0A 2NG1A 2DR3A 3SYLA 2YWFA 1DPFA 1M8PA 3ZIAA 4PSKA 2QPAA 2P67A 3L0SA 5AUQA 3SHWA 4C0AC 3GLIB 3R8FA 3PXGA 3EWSA 1MH1A 3BFKA 3AKEA 4Q4LA 2C9OA 3FHCB 3KUCA 2PCJA 2ZU0C 3NBYC 4X8LA 1AA9A 4TYYA 2JIZD 1QHIA 3UATA 2GHIA 3CR8A 3L2OB 4BFSA 4N0DA 2PZFA 1Z3IX 2O0KA 4XTCS 2H16A 3PJRA 3FKSD 3T5GA 4B3XA 1YZKA 4X8OA 2IL1A 2UKDA 1Z22A 2AD5A 4NH0A 3ICEA 3GPLA 1US8A 2Z83A 4DLUA 5CB8A 5L8VA 1ZW6A 1OB2A 3C5CA 1D2NA 2HCJB 4BFWA 3THXB 4LPSA 4P4SB 3UWOA 1UKVY 1US8B 1PUIA 4BFZA 1E2MA 2WICA 2FFHA 3CZPA 1KAOA 4URVR 1IONA 5A5GA 1FTSA 1OE0A 3DZDA 2I3BA 2J87A 2QT0A 3K9LA 3AVWA 3LVRE 1OJLA 1YR9A 3RLFA 2X77A 4Q21A 3SEAA 3SBDA 1OXSC 3LRPA 2Q3FA 1NKTA 1W46A 4WOPA 1E9FA 2RGBA 4D4MA 1LF0A 3W6OA 3LBHA 3RRMA 2GEVA 3MJHA 1FZQA 3WRXC 1T8TA 5KDOA 2CK3D 4H9GA 1Z6TA 2BMFA 3KB2A 3RABA 3AUYA 2EQBA 1R10A 3BAFA 1CBUA 5TY0A 1ZNWA 4BFUA 2QBYA 4MQBA 2C04A 3FHTA 2BOVA 3FB4A 2QA5A 5DI3B 1G7CA 1FP6A 3TR0A 1KSGA 3KJIA 5DI9A 1IN5A 4IEEA 4L8GA 1HURA 3P27A 2J7KA 2IC5A 2NO0A 1W7AA 1U0HC 3ZQ6A 1T0JB 4DVGA 4B47A 3GJ4A 2ZROA 4BZQA 3AH8A 1Q3HA 4QBIA 2FMXA 3NIBA 4C0BA 1FNNA 2CBZA 3LY5A 4OYHA 3EX7C 1WBBA 2DWOA 2GAOA 5FPKA 4M9SA 3AP3A 4Q9LA 4V03A 2V55B 4LZZA 2GZDA 3BH6A 4LX0A 3QPUA 5FUVA 3BE4A 5A4JA 1YZUA 2J0SA 1P72A 4MKHA 4L15A 2TMKA 2QAGA 5JRZA 3SQWA 2AFIE 2NGRA 5AJZA 2ZJAA 4ZI3A 4BPBA 1XEXA 5H1YA 3KKQA 4A6XA 2RGDA 2GJ9A 2P3SA 2HCBA 2IYQA 4A6PA 4NONA 1ZIPA 4KHZA 1QG2A 4N1AA 5EQTA 1DVRA 1GOTA 1QVAA 4D4KA 1PUJA 8OHMA 1Q0UA 4C2TA 3RYTC 1I4TD 5IK2A 1CJTC 1KI9A 4WZAE 4Q9IA 1QHHA 3ONWA 1E2PA 3ZYCA 1E2NA 1U99A 1B0UA 1LS1A 3K70D 1WQ1R 3VNUA 1EESA 3K0CC 5UKDA 3WYAA 5BN4A 1TQ4A 2QPTA 2VL7A 4OL0A 4R9UC 3X2SA 4E07A 1OXXK 1PLLA 4LYAA 2QI9C 1SULA 3O8RA 4MYCA 3HR7A 3OEHA 1CKEA 1ZNZA 1G6OA 4TL9A 2C9CA 1T5LA 2ODEA 1NLYA 1X6VA 2ZUBA 1PZNA 2QL6A 3K1JA 3LVQE 4G5SA 3QSYA 2QMOA 2Z5FA 3NG1A 2GK7A 4PC6A 3TLXA 3ICQB 4AG6A 2RGCA 2PT7A 1J70A 2FEMA 2GXUA 4ZKEA 1P9NA 3UXMA 1N5IA 2HYDA 2ZR9A 4LOAA 4BLOA 3BIFA 3SC3A 1M7HA 5IRCD 3QQ5A 2G0TA 4Q1BA 3CZQA 1H8ED 2XNDA 3P20A 4FD2A 2QBYB 4JLBA 3U3JA 2VP5A 1KJWA 4DCSA 4HB2A 1P4SA 2EFHB 1DBSA 2O5VA 3I8SA 3VU9A 1IAQA 4DCVA 4DDVA 5JBQA 3U4QA 3Q7PA 3W5IA 4M1WA 2FV8A 1N6IA 3B2EA 1R0YA 3CPJB 3CRVA 1A1VA 4GL2A 2FPLA 2W0SA 2CJWA 4IFEA 3GD7A 1OYYA 3WP0A 1XU4A 1GWNA 5J47A 4H1VA 4B3GA 2X19A 1CTQA 2IYWA 2KSQA 3C16C 3S1AA 1YZQA 1XMVA 2HUPA 2D06A 2QE7A 1Z63A 1ZU5A 2H18A 5FOSA 1X8KA 3OIVA 1DARA 4F7WA 3NC1C 2ZI4A 1S4QA 4FCWA 3QY0A 1TQ6A 4LY6A 4NDZA 3AKDA 2ZJBA 3CRMA 2DY1A 2GJAA 1E2LA 5EP2A 3KXLA 1NN0A 2WKPA 5CDFE 3THXA 2O8CB 3GMTA 3I5XA 3R9XA 1W4CA 5DISB 2WOJA 2O8EB 2HT1A 4Q9JA 5EE1A 1XTQA 1VPLA 1QDEA 2ZANA 5TDHA 1N2CE 4KFTA 2AK2A 4I1UA 1T3LA 1D2EA 3DMNA 1UKEA 1BMFD 1ESMA 1L8QA 2BBOA 3K09A 4M0LA 3L8ZA 4KYIB 2V3CC 2JLYA 5LB2A 2AFHE 4DLRA 5J4VA 4YDSA 2WKQA 4AYXA 2G6BA 1KTVA 3NEJA 1NVXQ 3UMFA 3VHLB 1ZM7A 1H8HD 3G82C 3TVTA 1FMLA 1KDOA 4LJAA 3Q3JB 4LJ7A 5HCNA 5C46F 1E79D 2ODBA 4LBVA 3LDAA 2G88A 3NHBA 4A36A 3MWYW 3TW8B 3TSWA 1DAFA 2UZIR 1GP2A 1NBMA 1Z5ZA 5K8IA 1T9HA 4OJKA 3Q8XB 4DCNA 1XZPA 3VR1A 3WNBA 1F48A 3Q72A 4OHZA 3TW4A 2E87A 1J7KA 2JDID 4NYIQ 2IS4A 5TXGA 1FX0B 1CRPA 4DC9A 3CWZA 4GMXA 4DLTA 4NYJQ 1BH2A 1XPOA 1G5RA 2A5JA 2J46A 2AXNA 2F1RA 4EJSB 3I62A 2WAXA 5JCPA 3KQLA 4HATA 2QUZA 4UNRA 5FBVB 2JIZA 3NKVA 4MRPA 4FW9A 4TMKA 4JLDA 3C15C 3HJNA 1YE8A 2GNOA 3IILA 2ZRBA 3NXSA 4QNMA 4PPQA 1ZCAA 4U7DA 4MYTA 1D5CA 3BFVA 1OKKA 1SKYE 4I4LA 2ONKA 3EZ6A 2IYLD 1JXOA 1LF5A 2NO7A 3FGNA 4G01B 2RH5A 3QIAA 1YR7A 1KKLA 2C03A 2IHBA 3BB3A 3P1JA 1MOZA 4QGFA 3W8NA 5JCZA 4CEHB 1Q20A 3CNNA 3GLHA 4Z1MD 3CM0A 2Z4SA 3KUDA 3NH6A 1L2TA 1ZM2A 1EG7A 3D3QA 4TTRA 3ADKA 1P9RA 4BFTA 4TYPA 1GNPA 2FJUA 2GKSA 1QVRA 3GJ5A 4NP6A 3AP1A 2P65A 2V6JA 3M1IA 3V9PA 4PSAA 1KDPA 2PLFA 4FI3C 4CT4B 3NWJA 1XJ0A 4Z8YA 3GFTA 5H68A 4ZDJA 4C30A 3MUFA 4DBLC 5SZKB 1ZRHA 3KXKA 2G3YA 1C9KA 2YWEA 3DPUA 4HAWA 2ZRCA 2Q9BA 1KK3A 1SXJC 3O47A 1E0KA 4RD0A 1NN1A 4ESVA 2ZAOA 3RC8A 5KDLA 4TYNA 4NCKA 1E2IA 5JJKA 1G8YA 1UEJA 4U00A 2FSGA 4CVNA 2YWGA 3D7MA 4IFBA 2A9KA 3KKOA 2ZI5A 2JLUA 1XEWX 5L3SB 4MDEA 1F6BA 4IXNA 3IO5A 4JLNA 3RS2A 2VSFA 4DT1B 2IT1A 1RRPA 3LQRA 2ZETA 5CYPA 4BRWA 2O0HA 3B82A 4FMCF 3EZFA 5IK2D 2GETA 1CIPA 5FTLA 4JVNA 4MGZR 3AM1A 4JBWA 4Q01A 1HQYE 3MD0A 4OQMA 2GCOA 2CVFA 3EZ9A 2BM0A 2Q0HA 4C0JA 4TL8A 1U9IA 5L3QB 1ETUA 3A1VA 2WIBA 1IXSB 3TUIC 5JMTA 2WWIA 2A7QA 2IYYA 1XEXB 4GBMA 2IYRA 4JLKA 2GAAA 2GVZC 1ZM3A 1R5NA 3CH4B 4ILEA 3TIFA 3H4MA 3QEJA 3HYRA 2MMGA 1NG1A 2AXPA 4W5HA 2NZJA 2F1HA 3GCGA 2VHTA 4OHYA 4QBGB 2XXAB 3GLGB 2XEXA 4NL4H 1UAAA 3DO6A 2GTPA 2JATA 2BWJA 4CGZA 1JBKA 4I1SA 4YMVA 1KIMA 2XB2A 1Y3AA 4HZUA 4D26A 2CHGA 5HKKA 1ZIOA 4OI4A 4ERNA 3OE7A 4UXIA 3DDCA 3W90A 4BFVA 4LRWA 3OESA 2F6RA 3N5CA 3SHFA 5KU1A 2ZREA 2FSHA 5DO9A 4BLRA 4AYWA 2O8EA 3HU3A 2O8DA 3LO5A 1SVOA 4F38A 4WAUA 1N0WA 2A5DA 2ASEA 3B6EA 2QSYA 1YRAA 3MFYA 5EXTA 1E0SA 3GJ6A 2GJKA 4AKIA 2MMCA 2OFOA 3BORA 4B6EA 2JJ2A 2GEDA 3OEHD 1E4VA 1G3RA 3P26A 1MV5A 4Q4JB 5SZHB 3BB1A 1HE8B 2HT6A 3CRQA 3QF4B 3VHXA 1GRNA 2E9SA 3HR8A 2OBNA 4G1UC 5GJWC 1OIVA 2IK8A 2CJWB 4Q7MB 4LCBA 2XITA 3CX8A 1VECA 1OKKD 3QUSA 2IS2A 3BGWA 2SHKA 1A4RA 4TTQA 4M8NE 3THYB 5FL7D 3PQCA 2ZM5A 4KODA 1G5TA 1TQDA 2Z6VA 4M53A 1I2MA 4NE2A 4B35A 1UBCA 1E9SA 4XD7A
chains in the Genus database with same CATH superfamily
1H8EA 2BSAA 3AR6A 1CF4A 2RARA 3GFFA 4QODA 1R4MB 3A6GA 4XPIB 3IEXA 1QGED 3ZXSA 4BNGA 1Z2DA 3QBDA 4MWZA 2GF9A 2FDCA 2NUAA 4PZDA 2J5XA 4DLKA 1GL7A 3QMPA 1L5KA 3ZI0A 1VBFA 3W6ZA 3OZIA 1YRWA 4QFDA 4ALMA 2IQIA 4CMEA 1IPFA 1IWPB 3I39X 1RIIA 4OCZA 1LS6A 1ND5A 2IEGA 1QHSA 5L7WA 1UKZA 4IPTA 3A4IA 3IKLA 5G3ZA 3VQTA 3T7IA 2FX2A 4KO8A 1UDAA 5TR9A 2V7GA 4OOEA 4IQ4A 5FR1A 3B3QA 4H59A 3JX9A 1V0JA 2FZVA 2WRZA 3BCUA 1SRQA 4FX5A 4Y9TA 4QTYA 1YFJA 3GEBA 4U0JA 4Z2YA 3EWIA 4P3NA 2VKQA 1XNJA 2IPOA 2WW8A 1U5CA 3A14A 3TS1A 4ZOBA 1T8UA 4P82A 2Q9AA 1FYFA 4TLEA 1KQOA 3CSDA 1COWA 1H5UA 1AX9A 4TM7A 4DWOA 4E22A 3T6KA 1RRGA 1PT7A 2B21A 1USKA 3AEKB 1HOXA 4RDIA 3T61A 3WLIA 3WLKX 4B7UA 4YREA 1R0ZA 1PR3A 4JOBA 2VJNA 1O96A 1S2DA 1A69A 2NPIA 4INPA 4M1YA 4WK0B 1I6KA 1QV9A 3ADPA 4HYTA 2ZWAA 1F2UB 2I8CA 4IIJA 4LRSB 2JHGA 3E9YA 4WTOA 4ZCPA 4CM3A 4JMPA 1Z0IA 4TL7A 3QWIA 3O38A 5HKKD 1WXXA 3BDIA 3DMYA 1OFUX 2IYNA 3LUDA 4IIVA 2N75A 4N0EA 3E5NA 3HZHA 7GPBA 2UUBB 1SKYB 2VWHA 1I30A 3TTWA 4EG3A 1P2TA 2DSNA 2P4HX 1HYEA 3A6EA 4HVTA 4G0VA 2O2YA 2YJNA 5DTEA 4QREA 5BSMA 5BN4B 3AYXB 3DCNA 3LYUA 3V7UA 2PEYA 5FUYA 4MO9A 4JI6B 2A1UA 2H57A 2IOYA 4NZOA 5I9MA 4A10A 1LBHA 4BY9E 4G0WA 2FXIA 1MPTA 4OQQA 2VPQA 5CJ2A 4YPOA 4Z7QB 2RI0A 4A0GA 1ZWLA 2W71A 1RRKA 1EKXA 5A4MS 1XZQA 2XQVA 1JWBB 3LDFA 1FDOA 3N3BC 4LFBB 1NNSA 1KZ1A 4AUMA 4RLFA 2CYBA 3G59A 1YCGA 4ENSA 4KAAA 1YJAA 4YP9A 5BNFA 3AVPA 1BX0A 3V4LA 3BS4A 5FHQA 4BQRA 4CQMD 4B3FX 4PIMA 1IEVA 1XTZA 4G24A 1RW4A 2CUZA 5DW0A 5E4TA 4U02A 4JI8B 1YK0A 3OT5A 3WL5A 3ZVRA 1P39A 2VTKA 1L5FA 3CUWA 4PC2A 2X9GA 1UXOA 1BFDA 2VYCA 2XT6A 3COSA 1EFPB 1EUDA 2JLCA 1WJGA 5KAPA 3X1YA 4AZ3A 1ZXLA 3EQ6A 2D1RA 4B3HA 2BFAA 4P0TA 4B3TB 2OM2A 3K9QO 1LLDA 2H1LA 5DNDA 1JDJA 3PKIA 4RMGA 1KEEB 1DOHA 3TTUA 5IZCC 5K6AC 5L4LA 2HQOA 2JLRA 4G2NA 3UPTA 3TXXA 5F78A 2Q62A 1UJ5A 4BU0A 1S6YA 1CF2O 2JL1A 2LXNA 1Q6ZA 4ZJYA 3SFZA 4WKNA 3VO1A 1ZCFA 2YVAA 4QWMA 5A0TA 3LXUX 4MH0R 1SFRA 3H99A 2YQ5A 4GDFA 1R9JA 1W0CA 2OTCA 4OLJA 5BMVF 4XJSA 4E4RA 1T35A 3OQ1A 1ZGHA 4ZCLA 1NOJA 4O4LF 1TW2A 4PAOA 3EG9B 3NDPA 4JLVA 5LOVF 2CSUA 5KTYA 4BGVA 3PEUA 4MCHA 1W1IA 4D8XA 4JVOA 4YUZA 4D0RA 4BP8A 1Q6YA 1U0NA 4C0LA 3TRJA 3C0KA 3NVAA 2UXCB 3KOMA 3QEMB 4HWTA 1EDDA 4PGHA 2K2QB 3H17A 1FUIA 1QB8A 3FNEA 3JARB 1MORA 1SD1A 2FOXA 1NXSA 2OQVA 4YCBA 1L5YA 1A9SA 3HJHA 4MA0A 4QHTA 4KXUA 4MDFA 3KXIA 4TOIA 3FUCA 1UQUA 4JLSA 4ND6A 4QQFA 5D3MA 5CVUA 1OLSB 2AUNA 2ZYDA 1Z75A 3HI4A 2PQ0A 3HY4A 1E9DA 1NGSA 1NOIA 2JFFA 1U8CB 2OEPA 4MINA 4QJBA 3ER8A 1FLNA 3RTEA 3H2BA 1Q7RA 3EF1A 1Z7YA 4D41A 5JCOC 2I1WA 2YXEA 2ZDHA 4IAOA 2B5OA 3KVRA 4PLZA 5T57A 4TVOA 5HKLA 1AMOA 1ISSA 3ADDA 2XGSA 1AN9A 2WSLA 4HV4A 1CZNA 1NJ1A 4L4ZA 3JU3A 1Y8RB 4IDQA 5KQPA 4FUTA 4LQCA 7ABPA 2HF8A 3KVYA 1J39A 1JBEA 5HIIA 4FYWA 2FHSA 3O2JA 4O0MA 4P4UA 1H1LA 1IDN1 1F17A 5DHPA 5E4YA 5LA6F 3RHFA 4ZI3A 5IDWA 4TMXA 3LHSA 3CX3A 1N5RA 2GKOA 5COAA 3AG6A 4DLWA 5C7OO 5E7IA 2AW3A 4L8LA 4TWJA 1T2AA 4GT1A 5TGTA 1NW4A 3ZWVA 3ZHUA 4ZP1A 3ZE1B 3B60A 1NVFA 3AJ8A 1L1QA 4BTEA 4Z1MA 3RSCA 1GV1A 4JJGA 2P77A 5K6RA 1XMQB 3EAFA 2OAEA 3FHJA 3I37X 5CM8B 3BSWA 4RK5A 3O1IC 1YL5A 5AHKA 5EI5A 1LI4A 5FPSA 3GA0A 3ZZ1A 1V8DA 4BNNA 3VUFA 1I8TA 1SC3A 3Q3IA 3O83A 4G65A 3NHAA 4IIXA 1UOPA 4MP3A 3O3MB 4X20B 3GGJA 5C8YB 1HDCA 3GG9A 4X6UA 4X8HA 1D0IA 3C3BA 3PNSA 3TMYA 4E7OA 1QG4A 2QN9A 4JKOA 5CB0A 3PNMA 1XTTA 2Y3IA 3O5AA 2FEXA 4A73A 4F8YA 5KX5A 1QUFA 3NWOA 3QH4A 4DSAA 1F14A 4A0SA 5F23A 5JZBA 4AB1A 4G4SP 4UXJA 2VJCA 3K1TA 2ONCA 5DXFA 5C1BA 3RRFA 1TF5A 2CKMA 1K6MA 1RQXA 1PP4A 3A8TA 5L53A 1CUJA 3EXIA 3MG9A 2PRSA 2I4TA 1SMKA 2GBPA 3SS8A 3DOIA 3AR8A 5JXWA 4CV0A 3EGWA 1EFTA 2R00C 1SC9A 2C77A 3NHRA 3VC1A 3T1OA 4U2CA 4ZXPA 1U2PA 2G8NA 3C3WA 3PPWA 4G85A 4IDEA 3LGSA 4WSOA 1R64A 2AZ4A 2C0QA 2Z1NA 3GF4A 4R1TA 3R20A 1Z0AA 4BX3A 1VL5A 1UMCB 1YQWA 3KXPA 4FGWA 4BP9A 3UUWA 4OBEA 4Q82A 3ZU6A 1F0PA 2J07A 2VSYA 2IYSA 2WKRA 3TTYA 4L0CA 4Y30A 3GN2A 1H0HA 3T8YA 5E3HA 5HZMA 3X1KA 5DH9A 4XIJA 1AB5A 4D4HA 4UPEA 1F4PA 1ZBQA 5DTQA 4RVGA 5G0UA 4WESA 4HB0A 2IV7A 1T2FA 1R0XA 1T2VA 3HLKA 5LZ7A 4IOKA 2QMHA 3OD5A 5KWJA 4US2R 1G9XA 2ZBPA 3OKCA 3TSZA 4F0JA 2YX1A 5FWDA 5GPBA 3E7PA 3ZCVA 2YWHA 2GEBA 2QQFA 3E61A 2A7XA 2PGXA 3WMFA 2F4NA 3JD0A 3PX3A 5EJEA 5AXBA 1TEXA 1WVGA 5EHZA 3ACDA 3AUKA 1QRAA 3WYFA 3EG5A 3ZWXA 2DHEA 3UK1A 4DA8A 2JFWA 2XTZA 3F71A 3HACA 1ISRA 4NY1A 3L18A 1DJQA 5AK4A 1PZEA 5D3QA 4XOUA 4EO7A 1M72A 4KUHA 3BMNA 1J2RA 2WPNA 3MLBA 3QVSA 4IGEA 1W25A 3VZSA 4EARA 1L5GB 1ZJWA 3O1LA 1FDWA 1Z37A 1LBIA 1KFEB 5BV8A 2IPXA 2Z5GA 1M6YA 1FFSA 2RHHA 3MPOA 2YIMA 3MWEA 5AKYA 3TR6A 1J0BA 2FPMA 3CEPB 1KO7A 2B61A 2V7PA 4AN4A 4COOA 5AFSA 1UXJA 4YFYA 5CLIA 1TEVA 3N58A 4CHGA 4Y67A 1WMAA 2AXEA 3JQGB 3PHCA 4UVGA 4KU4A 5FTJA 4EHLA 2JLWA 5AKIA 2QX4A 3LH5A 4JOSA 3GLHB 3RYFB 1K9SA 5L9AA 2P8SA 3EPPA 4ZZ2A 4DGSA 1XPRA 4PVDA 3FMIA 3QELA 4QO7A 3OQNA 4E2YA 1YDFA 1SPXA 4JP2A 4U9HS 4C6HA 4YRMA 1N2ZA 1OT3A 1QZXA 1Z8FA 1N5LA 2AJBA 1RFGE 1S9DA 3LP5A 4PFJA 2JCBA 1E2QA 4MGYR 4NCAA 4KTVE 5CA1B 2CHEA 4H0NA 1AOXA 2OHHA 4CMGA 2DEUA 1QXSA 3OY7A 2D59A 3QVOA 2PD3A 2X7JA 4JLOA 5LD2C 3TNJA 2HJ9A 2BMVA 4HVCA 1TXGA 4KC0A 4KGVA 3RVOA 3MJFA 4JBGA 4TRJA 4ZPXA 3D0OA 5BMOA 2OBLA 2JRLA 1LC0A 4BQNA 1WB6A 1A7UA 4BO4A 2WM9B 3H4VA 1XZHA 1AN0A 3NTUA 4H60A 2NP6A 2WWTA 1EVKA 4KXFB 4OFBA 4GVPA 3Q3EA 4V02A 4Y2UA 5IM5A 4YRLA 2OV2A 2WWVD 3RUCA 1DRKA 1LX6A 3CC8A 3VKWA 3AHFA 4KSCA 4EPYA 3ZK8A 3IPRA 1IJKA 1ORWA 2Z5LA 3I0MA 4IYRA 4E31A 2X5OA 3EXHB 4XIIA 1D1TA 3CLUC 1XMXA 2PLRA 2AZMA 3FRHA 1BIFA 2O5RA 3PTLA 1LNZA 2OMEA 3NYRA 2P11A 3QXXA 3IA2A 2UVDA 4G25A 1QVWA 1MB4A 2A8YA 3EA5A 2AR7A 2FUG1 2JAHA 2QZZA 3LC2O 3BE5A 1L4BA 1GFZA 4DLZA 1NJFA 4ENUA 3FKJA 1IRXA 2C82A 3LWBA 2X3UA 2KHZA 3IEUA 1L3CA 1QWOA 5DE3A 4H1HA 1I4DD 4CRWB 4MQ5A 2WYWA 4NPCA 1C29B 3HB5X 4ZZIA 4DL9A 1EJ0A 1XVVA 2CLSA 4V0QA 1M6HA 2NNLD 3PYXA 3FD8A 3TKLA 3H1BA 4QVGA 3VV3A 5CDFA 3ZHOA 1O5OA 1YZFA 3PENA 4OLAA 1Q92A 1E5QA 3AX6A 2CC2A 2PZEA 3SK0A 2W8BA 3QI7A 2WIDA 4LSWA 4E30A 1TFUA 1RYEA 4J75A 1YCHA 2HU2A 5FH9A 3QHQA 5IXYA 2QIPA 1YO6A 4RKRA 4L16A 1SUDA 4D3DA 3QBJA 3H5TA 4IEIA 3WKEA 3CUSA 3WLSA 2YYYA 3BCSA 4EJ6A 3F6SA 3K4PA 4V0NA 1EFRA 2N47A 3FYUA 5K3CA 4RK4A 1FS6A 3C5VA 1THMA 1LB1B 5K0JA 2Z8XA 1FPMA 4KSBA 3M3PA 2QR2A 2RAPA 4HG2A 3QVMA 5CT5A 3TFQA 1DNPA 3O8NA 4OHUA 2VKTA 5EWJB 1ONNA 1Q21A 2QZPA 2Q28A 2VNSA 3A3NA 3IV6A 4PXSA 5EPOA 2AN9A 3RYIB 1D1PA 1I10A 1DQNA 2EQAA 4HJXA 5M04A 1PJRA 1Y6ZA 1WLSA 4C4PA 3QU2A 5AO9A 1IMJA 1MAWA 3TDMA 4QYSA 3CMCO 3K1ZA 3QPCA 3CZ5A 4YUVA 4MLCA 4JFAA 3RT7A 4DLXA 5GIOE 1TQ8A 4F21A 3IAS1 4HDSA 5I5EA 2AI2A 3G88A 3UJ8A 4D3ZA 3EGDB 3RODA 4DOMA 1JZTA 1EX7A 3I92A 3SNKA 1WPGA 3DXFA 1YRHA 2J41A 4LWOA 4OSOA 4ZQIA 4R69A 5LYJB 5FOQA 5AVTA 3MC1A 4G37A 2OG1A 4JYBA 4Q48A 5D3ZA 3GBVA 1VG9B 3PVSA 4JA2A 4DPLA 3H83A 3KJEA 5WRFA 3U39A 4DUGA 5A1JA 1AGYA 3R3YA 3EDMA 1K9VF 4YJHA 1P9WA 4RW0A 5ADWA 2O06A 5DT9A 1FDTA 3RT1A 4H7DA 3FYCA 4I50B 3W04A 1OH5A 1EGAA 2Z1MA 1VE3A 2FWRA 3AB8A 3CLVA 3F7OA 2C00A 5TMDA 2XI4A 3RFCA 1Z6GA 5I4KA 1NR7A 4YHHB 1KJJA 1DEAA 2IOHA 4FYYA 3NOXA 2FN4A 3T1VA 2X7XA 1JEJA 5B64A 1QZTA 2IP2A 1UMBB 1AGRA 3JZFA 2WHPA 3Q9SA 1VOTA 4RVCA 1HDZA 2J6HA 3RVSA 3ZD6A 3UCFA 1FY2A 1KOFA 1ZIYA 1ODCA 2XE8A 3B8EA 4AN1A 2ADOA 2AKAB 3LXMA 2W48A 1ZOIA 5F2KA 3NBQA 3KU4A 5K5EA 1MQ8B 3B6ZA 3DJFA 3K09C 3R5XA 1KYVA 2I55A 2ZJ0A 4KIJA 2ZBQA 3OHMA 4KMOA 5J1TB 5D87A 1DBWA 3L4BA 1K2VN 4HWGA 4UCXA 4BU1A 3E1KA 3WNZA 5G0VA 3EC2A 4AZWA 5CDGA 2GESA 1BD4A 1R1DA 1RE0A 1PYDA 1XDGA 4MA4A 1F8YA 1V43A 1DMSA 2C9BA 2JLQA 1JU9A 1YS6A 4NJMA 2AK3A 4J3JA 2PVSA 2NU8A 5KI6A 4LMBA 2PKXA 2HPHA 3PVCA 1I1OA 3PCRB 4EEZA 4B85A 3LV8A 2OUKA 3O21A 1RT9A 3EXG2 3F67A 3RRNA 3QFHA 5KYNA 1FP4B 3NM5A 4ECEA 1EX1A 3HM9A 4CL0A 3JZDA 4GFDA 4E5SA 4MTLA 3K2QA 3U56A 2B8WA 1T6NA 4ZOLB 1K3FA 5B3LA 1IEWA 3T5TA 1CLUA 2WU0A 2P62A 2ZSHA 3LECA 3PPYA 4XPIA 5TVKA 1VBKA 4B7XA 5KMGB 1JEYA 3OHSX 1FCJA 1PFVA 1Z83A 3LK6A 4QFMA 3AVUA 4AYTA 1XVUA 1B6SA 1V5IA 3IIEA 3BJZA 3L7CA 4QQKA 4IDAA 1OAAA 5FOVA 4FQ7A 3ZE2B 3PPXA 1VGVA 5A05A 3DE0X 4AL4A 3GAZA 2PJDA 2QMYA 3IT3A 4HUTA 1JKMA 5A03A 2P5UA 3DEAA 3IE1A 1RSZA 3CPSA 2PYZA 1SCJA 2EFCB 4UBLA 4W8GA 5LNK1 3UWDA 3B85A 4BVLA 3IIKA 4DXAA 1Y42X 2BW0A 1LQ2A 2F8MA 2W00A 3LUGA 2D5CA 1UBFA 5ALDA 4B7CA 4CLDA 4F4DA 4Z7NB 1EK5A 4N49A 1IY2A 3SGLA 1N7HA 1PFWA 1X7XA 5FQNA 2F7SA 4Q4HB 1RCUA 4M9QA 3U4DA 1VL1A 1ODFA 2GHQA 4JZYA 4RORA 1V48A 2LCIA 1C1XB 3FNBA 4QPCA 3WGUA 1F8FA 4L3VA 3A6KA 4K6KA 4HUQA 1Z35A 3AR2A 5KHOC 1Y9EA 1HNXB 4LRXA 4I55F 2HM7A 4MPTA 1TX4B 3SR4A 1MB9A 2XECA 1GPMA 1KDYA 1EWRA 4EQZA 2ZR0A 4BTVA 4OEHA 1W6UA 2VZLA 1XTJA 4BE7B 1ZEJA 4EY7A 5EMNA 2RAVA 4DA9A 1NQ5A 2K4MA 5ALJA 1SXGA 1WNFA 2FFAA 4IDDA 3HUUA 3PKZA 3TYXA 2BH2A 4RFSA 1W5BA 2ECOA 3O0TA 5BWMA 1K7EB 1S8AA 5YASA 1KXJA 1N0HA 2HNBA 5JCJA 2Q5LA 4J6EA 4QYIA 2NSLA 3B1WA 3NIWA 3HXMA 2O8CA 2Z5VA 2MWMA 4EHJA 1SY7A 1DI0A 2GN6A 3K71B 2QTAA 3ZHVA 5J4LA 4LA4A 1DFHA 1NKVA 1VL0A 3P9IA 4IO0A 4E15A 3U7FB 4EI7A 3EPHA 2ZZMA 2QLTA 3THSA 3QMVA 2ZPTX 1MHTA 1R6BX 1COWD 4L78A 4TMVA 2I7DA 3GR6A 3ZNOA 3E03A 2X3YA 1ONBA 4JT9A 3CUTA 1V25A 4ZAWA 1JBQA 3RS8A 4AX4A 3K0EA 5G0SA 4F9EA 4HUQB 1WXDA 3MN1A 1GU0A 3DTVD 3EIEA 1W30A 1ZEMA 4YDQA 2WWXA 1RM3A 2ZJ7A 1ODLA 1XF9A 1WKCA 3BL8A 1T9ZA 3GEPA 3OTWA 4MRNA 3T41A 1AUVA 4W9NA 3H3JA 3QOYA 3FDIA 1KE2A 4YRDA 5KSWB 3BPSA 3DL2A 3GLIA 5JS1A 3DAGA 1APBA 2B1IA 2YVKA 4JBYA 1A8UA 2XWJI 3ZDXB 1E2DA 2YWRA 2EGUA 1E89A 3UEOA 4NZPA 3GJRA 1HC7A 2KM1A 2WD8A 5LQAA 1P0FA 1UEIA 3D6JA 1M2OB 3L6CA 3JYHA 2DG2A 3OJFA 2FA9A 1M10A 2OCLA 2P9YA 1KMMA 3QENA 2DCMA 2IHNA 1LVHA 2PA3A 3L7IA 4F3RA 4EM6A 1A5ZA 3Q2KA 3T3MB 1RMTA 3AY3A 4LZJA 4TRNA 3TJRA 4C22A 1U04A 3D4LA 1F8GA 1G8AA 1VSTA 3H9CA 4LPKA 4F9FA 5ARBA 5B30A 4F4CA 7MDHA 1Y9ZA 5LMNB 2KBEA 4ZC1A 3TDNA 1J2JA 4P3XA 2B30A 3FSGD 4DJJA 4X45A 5LZ9A 1VE9A 4B6FA 3EXAA 4EPXA 7ADHA 1B43A 5KNBD 2ONYA 1P1IA 1LTQA 4Q1EA 1I94B 1EM6A 1CERA 5ELXA 2HB6A 1W48A 2DM6A 3ZG6A 2XRYA 3RS7A 3WRYC 3EEYA 5JO9A 3WZMA 2CL7X 5DMHA 3ZXYA 5KEIA 1AU9A 5K0NA 2VWGA 5DM1A 4KQKA 2YUIA 1Z6XA 3OI7A 3KTAA 1EBUA 2R7AA 3CIOA 4K81B 3PJFA 4OK5A 4IBOA 4NNPA 1WPXA 1IQUA 4URZR 3ZCQA 3ZGZA 2AX3A 3CX6A 3DEHA 3JQGA 1YR6A 5BUQA 3H9UA 3LQYA 4WY2A 3QFRA 1KMHB 1GCIA 1YQXA 3IJEB 3N8KA 3Q8WA 4TTVA 5TVGA 4CKWB 4EX6A 1J42A 1II0A 1UFKA 1VJDA 3MRSA 4UHJA 5AICA 4XVCA 3CVWA 1BXGA 3ZVMA 2X6TA 4QBFA 1WV1A 1EFHA 1YCDA 4G4IA 3B38A 4P3KA 1FTWA 3OZGA 2N1MA 4GZLA 4RM3A 2YWJA 3SYRA 2RJNA 2OHXA 1M6WA 3O8CA 2YZ2A 3E3LA 1O8CA 3O8LA 3FR8A 3LHKA 4XD2A 4S1WA 1PJ3A 3T7RA 1X19A 3CRW1 3VOBA 5GTDA 1K97A 2SCUA 4EY3A 3GZNB 1ENZA 3IDZA 4LQ4A 4UCWA 1IZZA 1E0DA 1JPUA 5HZHA 2YHSA 2QOEA 2ZSIA 2CXTA 2IYVA 5KPDA 2OVFA 1E0AA 4IHKA 2XMDA 3RBAA 2PWBA 1SXJD 3BGDA 1CUYA 3G7SA 3R9IA 1DG3A 2ECQA 2A9RA 1L5LA 4ZVUA 4ND5A 2HDNB 2YXDA 3G0IA 4X1KB 5DF1A 1VFPA 4C04A 1PNVA 3PV0A 2PD6A 2ZVPX 4B44A 4UE6A 1ND6A 4V1CA 3JD1A 4TLAA 4U8HA 2DVMA 3H4IA 3WQQA 4Z4HA 2OXTA 3EK2A 4OAQA 3RIMA 3G2QA 1EP9A 4BEJA 3GGDA 2R87A 3LP8A 1OXVA 4IRXA 1JHAA 3ZEIA 3M6MD 5LXTA 2OAP1 4OJNA 3MCVA 2QIOA 1RI3A 1NQWA 2B5VA 3IQZA 2V5UA 1K2WA 1XZNA 2FG6C 3L07A 4MX8A 3D3NA 1SBHA 4FN5A 1OWMA 4NKRA 3PZRA 1PO7A 3PFIA 3SE7A 2UUAB 1W5SA 3L05A 3FKSA 1E1QD 4ITRC 3TOVA 1ATIA 4FDTA 3CVXA 3PGXA 3CVYA 4UASA 1T3TA 2BFDB 1OV4A 1F4LA 2JKYA 2MIIA 1EJ2A 2OZKA 2VQ3A 3F8SA 3AB7A 3VHXB 4ZYVA 3UMYA 2V7EA 3SVTA 1YVDA 3IQIX 3HJFA 3HUFA 1NWHA 3B1JA 1IM2A 4KP7A 3UG7A 3GW8A 4G36A 4Q4JA 3UNXA 4HNRA 5AVWA 3PWTA 1V16A 2EF0A 1GNQA 4H1UA 3GI1A 5B12A 4TSRA 1CUDA 1ZHHA 2Z1DA 5KYUA 4OGLA 2EJWA 2ZIWB 4RY9A 2Y05A 1HLPA 2W11A 1M1YB 2AI1A 4IMJB 2IP1A 2I34A 2E3JA 1XQ9A 3U49A 4OP1A 3ZJ5A 4IIHA 4OX9B 1G21E 2LNDA 2VZ8A 4XCQA 4B81A 4EI9A 1QCDA 1JEQA 1NW7A 1VIYA 5AK6A 3AJEA 3LIIA 3D7NA 1J20A 1DELA 3ZDAA 1EU1A 3KVOA 1GXSB 2RI6A 5EJAA 4DNOA 1HNZB 3IT0A 3BJEA 3QNMA 5FADA 3VTFA 3I9MA 1EFVB 3ZIDA 3BBLA 5U9CA 1MGPA 1BJTA 4KXMA 5K05A 2ZXEA 2HH9A 5HSGA 4B73A 1KGSA 3BAZA 2J9GA 5JEEA 1E6EA 3L7AA 5IT5A 3OTIA 1CHDA 4NFHA 1AS0A 5CA1A 4FMCB 1T8YA 3DDHA 3FOAA 1H9AA 2KLBA 1ZUNB 2EVWX 4BB6A 5BV2P 1YE5A 2QD3A 4JVMA 4AJ9A 2OK8A 2IW1A 1SZPA 4RAQA 4LE2A 5L3RA 3IVMA 5LC1A 4B8ZA 2J0VA 1B8PA 5LSAA 1T6YA 2O2JA 3ENNA 3FYUC 3I09A 5FP0A 1GQ2A 3U31A 3ZWKA 3CGGA 1WA5A 3RRXA 4MVJI 1QG6A 2V4ZA 2XIQA 4FKMA 5DRTA 3W8EA 5TT0A 4JROA 1JN0A 4OB7A 3E5MA 4Q9DA 4GX2A 2IYFA 1QK4A 1V1RA 2MYNA 3QU4A 4F4UA 3FMPB 5E95A 3OU2A 1PNTA 4OJQA 4X7RA 5ALQA 3DH0A 3KJZA 3QHPA 1GGMA 3PD0A 4KXQA 5A3SA 3AHCA 3R77A 4DNPA 1MEOA 4A7PA 4WUTA 1SHTX 2A0FA 1TADA 1IN6A 2WWFA 3MWDB 5DVZA 1EFKA 5EPEA 3QXGA 3P0EA 3PE3A 2FPRA 2J4FA 2J8ZA 2VDJA 2V7QA 3PNQA 1LY1A 1R9NA 4FIDA 2H3HA 4MUXA 4PRLA 1HYHA 3QVTA 2JBAA 4URUR 3U40A 3VYUB 1OH7A 4YH1A 3O9MA 2BKVA 1SEPA 4IWXA 1KH2A 5TB5A 4DBZA 2VJQA 4FE7A 1PJ4A 2J9ZB 2JGEA 1P2VA 5T3YA 4ZO7A 1WETA 2VUHB 5GZ6A 3E9MA 1G20E 3DMHA 2XOKA 3E9ZA 1F2VA 1UBRS 1D6NA 1XZDA 4K05A 3V3TA 5BSGA 3AI2A 1GNRA 3ENKA 3E3AA 1JHYA 4L5JA 5IC5A 5KSPA 3L0IB 2C2BA 1BG6A 2NO4A 1E9EA 2YTZA 4LNAA 4MJ3A 3WAGA 1OZFA 1UCFA 2Q3MA 1D1SA 2JCYA 3AUXA 1Z0SA 3F49S 3I6BA 3NX4A 3OTHA 5E2BA 3K5HA 4BEWA 1R37A 1JU3A 1CLEA 1H66A 1SKBA 1NDQA 4MV1A 2OXIA 1TL7C 4RGQA 3VH4A 5JI3E 3KS9A 1TLLA 1YNOA 1FS4A 4IOLA 1XD2A 4IIBA 2QUKA 2OECA 3OQIA 4YQZA 2BBWA 5FWAA 4ARZB 1XDBA 3TEJA 3ZYZA 1HMPA 1XRJA 4YR7A 2ABWA 2Y1XA 1ABFA 5KYKA 1B0ZA 1XL0A 3K70C 1TUBA 1Z5NA 2QUJA 1LK0A 4LVOA 5FBKA 2CWDA 3A9VA 4WZ6A 3BFXA 3GWZA 3P2KA 1WUIS 3IE2A 2FEWB 2E7ZA 1N6OA 4MVJG 5JAQA 4BZPA 4ENWA 2PNFA 2NYVA 3DUWA 4AMYA 1SXJA 4BFXA 3B6KA 1OVGA 1U3DA 1XMPA 2DJ5A 1KYIA 2ZSUA 3LUAA 4N7MA 5C37A 4F93B 5KO2A 2NVOA 1SB9A 3C1AA 1O5TA 4KQEA 2XZLA 1LLQA 3S1SA 1M34E 1RXWA 5IAEA 1V45E 4AF8A 2NO1A 4KYVA 3BF8A 1EE2A 2FPXA 2ZTVA 3L0CA 1FXWA 1ZN8A 2I5PO 2K5UA 4IS3A 4BE4A 1Z4KA 1E20A 4LYJA 4PQGA 4M7PA 2R6FA 5LUBA 3GH3A 1Z4IA 1A4XA 1JQAA 5EHNA 2EL7A 1Q0LA 3TQCA 3KV1A 3KQPA 3RVBA 3O8QA 2NZWA 4G8BA 3U4MA 5C4MA 3G3EA 1RC1A 1FQJA 4GXNA 4RJJA 4EJSA 4DGQA 4NATA 3QXHA 2PXHA 3BICA 3TIIA 3ZKWA 3UW1A 4BWYA 3EEOA 1KH1A 3R3JA 2WTUA 2FR1A 3AEKA 3T95A 1D6SA 1EGVB 2SKEA 5FWXA 4V0LA 4KR7A 2G7ZA 5DWQA 3FDFA 4KE8A 5CK5A 3U37A 3STHA 3AI1A 4YRPA 3RROA 2NM0A 2BSQA 1TCVA 2KYRA 3EEQA 1CUBA 1G8MA 3QFSA 5TSDA 2HQRA 4B3BA 3BL6A 2L18A 5FO1A 1ZVMA 1N6NA 2C2HA 3OCCA 3NBZC 4ME6A 4WL0A 1PV1A 3JQRA 4L74A 4QICA 4Z8XA 4D9IA 1EP1B 2PGAA 1F6WA 5DHAA 4B3IA 1BS2A 3W2TA 3DZFA 3BGSA 5I51A 1R6UA 1NQOA 2XVMA 2KB0A 4PFQA 1MJGM 2MYUA 3IPXA 4RHXA 1E2UA 5HK8A 1A8SA 1Z18A 2PH7A 2VHYA 1K75A 3E3NA 3R3HA 5AM5A 1KYZA 3WA6A 4BQPA 5IAOA 2V7XA 1GA1A 2XT0A 3ASUA 4M1SA 4TWAA 4UTXA 3VR6H 3U6KA 1JFTA 1HE3A 2BEKA 3RSLA 1Q0TA 4UQOA 1L7BA 3TLYA 3OKAA 3HBAA 2C9DA 3CEJA 3F9RA 3FMVA 1RJFA 4Q3DA 5F1OA 4TSKA 5IH3A 1V41E 3M49A 3ZY2A 2Q3DA 3Q9NA 3ZWDA 3M3HA 4FWTA 5AJWA 3L7NA 4DUZB 4U2EA 1UAYA 2CB9A 4BNFA 5DI3A 3UXEA 4EVRA 3MGCA 3G5UA 4HH0A 4CQLB 5KNDD 1PJSA 1YMVA 3L92A 4E6EA 4ZKDA 2FPGB 4XJVA 4KIGA 5L95A 3NBUA 1PDWA 1RXVA 1QTNA 1H1LB 5EFOA 4YGXB 3RUPA 4MWSA 3TOZA 3WMXA 4F8EA 1M6NA 2P4QA 1D0SA 5EE9A 1QRUA 2BGGA 1Y8RA 1H3FA 3N2ZB 4A0HA 3D6FA 4IWNA 2YDYA 1GY8A 3BEDA 4ZV4A 4WI1A 5F3RA 3F47A 1VFNA 1A3CA 3G49A 4LMAA 4I36A 4NMLA 3E22B 1AZWA 3O8OB 1ZNXA 3R23A 2VLBA 2OMKA 4PYKA 4DQUA 1N6RA 1MC1A 1P1JA 4ZO4A 1F12A 1P0CA 3REQB 3WA7A 3LT2A 2HU5A 4UM5A 3OFVA 1B8NA 1PW5A 2Y76A 3GUUA 2C42A 3K0CA 2CVHA 3AVTA 1E99A 4A82A 1E4YA 2HSWA 1Q12A 1U0FA 1ESEA 3N2YA 4FYIA 4W5TA 2ZSKA 3K94A 4OQDA 2ERCA 4GQBA 1YAJA 3M1YA 3VZDA 1PNRA 4OI0A 2HEGA 3PUZA 3TMAA 1U6KA 4GLOA 5LWHA 3B9BA 4OM7A 5HE8A 2E4VA 2V03A 2XHZA 4TVBA 3KLBA 4G07A 4UNPA 4Y6PA 4ZAGA 2JAXA 1G16A 2PFKA 5GJCA 1I7PA 3OEWA 4TVSA 3PL5A 2Z43A 1WVMA 4JXZA 1TQ2A 3DLBA 1K5HA 1V6AA 2PTHA 3TSYA 1OFUA 3I5YA 4JJ4A 4FDUA 4I8IA 5EJGA 1VPTA 1HE1C 4P35A 3QV2A 4M0UA 4Q4AA 1MX9A 1P6QA 3P0IA 1HM5A 1ZFNA 3QVVA 3N59A 3ECSA 2XVYA 1JIVA 3GIDA 3HXPA 1EK1A 4YMIA 3UANA 5KNLA 1QP8A 1WDKA 3S1AB 1W76A 5ESWA 3RAJA 3U3KA 3U13A 3ER6A 1E9CA 1Y0BA 2B0CA 3ZU4A 3AM4A 2QRVA 4OAPA 3I1IA 4G81A 3A0RB 4AC9A 3OHPA 3HWSA 2NU6A 2X41A 4HSEA 2VOJA 1DMRA 4KE6A 4MP6A 4TUYB 4XKJA 4ZD6A 2X5JO 3GPDG 3SR3A 2VRCA 5ICEA 1E9RA 3RRYA 3HB4X 5AI0A 1RE1A 2G67A 2ZT5A 4X93A 1Y1QA 4YJ3F 3CSSA 1MH9A 1W4AA 1E4OA 1D03A 1RLIA 2A6PA 2F00A 3N2IA 1ZXXA 1SHUX 3N7AA 4GL4A 3DVAA 4P54A 3ENQA 4R1MA 5AWFC 1EXNA 2P2LA 1UKYA 4LK3A 1TZ2A 4X9XA 2WKWA 1UK7A 3RM3A 4M7RA 4UVIA 5CR9A 3G9UA 1XDUA 3U3RA 1HUQA 4IDOA 4IIJB 4RSMA 3TOXA 1EFPA 1EUDB 1RXIA 4AS2A 3K0FB 4OHPA 4DLPA 1C8VB 3CF4G 3DNFA 5LJIA 1KIFA 5DSXA 3WNCA 5C52B 4QTXA 4N5IX 3HJUA 3PNVA 2J9XB 1GG5A 4ACBA 2CCKA 3AR5A 2E48A 4ZDWA 3I3OA 3L01A 2Y1CA 1MDBA 1BXGB 2FJ0A 2NVUA 2FN9A 2PKQO 2PX5A 2XCUA 3MINB 1HRDA 1HYQA 1XZMA 3DBRA 1WHSB 3FTPA 4OYRA 3KSMA 2D1QA 1M73E 3FXAA 2IUUA 4Y2QA 4X60A 1TNDA 1XU7A 1M34A 5IARA 5CDTA 4ZANA 5JSHA 2VDPB 1XX6A 5B1IA 4IRMA 5B58C 4IMIB 1HFEL 2BBSA 1R2QA 1SEVA 2Q8NA 2WUEA 3OE4A 4R16A 1AA6A 4ROTA 4ZQFA 3WL8A 3ERCA 3E81A 3Q6NA 4GP9A 1E7MA 4MVYA 1GVHA 3AP2A 4IHQA 5A4DA 4D3SA 2OXEA 1Q7CA 2VS1A 3BZBA 3TRDA 4BQEA 4E94A 1SKMA 1QYVA 1UZLA 3M1LA 1CQPA 2E82A 4KBGA 3RREA 1T9KA 3SZLA 3DC2A 1IPEA 3IUSA 3WAKA 5HX7A 1C3OB 1X42A 2ZRJA 3BD9A 3GL9A 4PRKA 1AUQA 4RVSA 4F2DA 2AMYA 2WNIA 3AESA 2HJGA 1CVIA 1G2OA 2PGNA 3OZWA 3OX2A 4UAGA 3MINA 3U7JA 4E2WA 1RRFA 3KUKA 2DXIA 2DTEA 1TVCA 4YVFA 4ZT4A 4RVOA 2CMDA 4MW0A 4TS9A 4TWRA 2Q29A 3G9XA 4XQGA 3ITNA 5JNSA 2P2YA 2P9EA 5DGHA 2GASA 4JNKA 3SXPA 4EA8A 4OLBA 1X9GA 2W6IA 3ACCA 3H5OA 3MSCA 4Q34A 1FQKA 3M4XA 3BCHA 4YUAA 1KZYC 4OA8A 2PUWA 1LQUA 2CD7A 4UZFA 3TTSA 1KK2A 1W1WA 5K3DA 1IMOA 4P5EA 2E4UA 3DPIA 5JWRA 2AOVA 5DPMA 4LYEA 1X7YA 2ESRA 3I61A 2CFTA 1YF3A 5JRDS 2NZVG 4NYIR 7AT1A 3SSAA 4RMJA 1XCJA 3CNQS 2A14A 4KFSA 1BHJA 1RJGA 3C3PA 1K06A 3RIEA 5JDIA 4GPD1 4KQHA 3ASZA 3B9PA 4JC5A 1JR6A 2HXGA 3GPIA 5A6SA 4NU0A 5KYXB 1PVOA 4YAFA 1JVSA 2OCGA 5IASA 4HAIA 4F12A 3KETA 2WVGA 3GP8A 4JK3A 1QUEA 1TCBA 1UL1X 3HLTA 4N5DA 2QR5A 2C4VA 1KAGA 1YZHA 2WD9A 2BDEA 3CNOA 3EAGA 4NLLA