1S9DA

Arf1[delta 1-17]-gdp-mg in complex with brefeldin a and a sec7 domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
161
structure length
155
Chain Sequence
b'MRILMVGLDAAGKTTILYKLKTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-Ribosylation Factor 1
publication title Structural Snapshots of the Mechanism and Inhibition of a Guanine Nucleotide Exchange Factor
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein transport/exchange factor
total genus 54
structure length 155
sequence length 161
ec nomenclature
pdb deposition date 2004-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s9dA00
4K46A 4V03A 2VEDA 5HE8A 3REFA 3L8YA 5CM8B 2HJGA 2QAGC 3NH6A 4I81A 5KPJA 2EFEB 3EAQA 1SKYB 4URUR 5CK4A 2ZANA 3B78A 4A8JB 2R6CA 5EE1A 4EFNA 1UBFA 5HZKA 1A5TA 1XCMA 5FPSA 1TEXA 1PUJA 3MCAA 1U99A 4CEJB 1PJRA 4LHYA 3GMTA 1JALA 1SKYE 4GOXA 4D4MA 3CNNA 1UKYA 3KXIA 4LGMA 1E2IA 1Z6XA 2ODNA 4R98A 3P4YA 2O5VA 2BMFA 3LXXA 3SZRA 3MJHA 3A1UA 3OESA 3D31A 4NONA 5DSZA 3TSOA 5BN4A 4ZPXA 1EFRD 3BE4A 3OIYA 4MUBA 3UWKA 2ZRCA 1KI3A 4P31A 1Z8FA 2CNWA 4C9BA 1MRNA 1ZINA 5L3VA 3K8YA 4I99A 5CJ2A 2OBLA 4D80A 4PHTA 4M1MA 1FW6A 4MYCA 1Q1BA 2ONKA 3BJIC 2F9LA 3C4JA 4LYJA 2QQEA 4MYUA 3SI7A 3GEEA 4U5XA 4L15A 1IN6A 2OBMA 4LHWA 2GZAA 3QKSA 3FHTA 2PJZA 1RJ9A 2MSDB 4JS0A 3OF5A 1E2FA 4JKIA 4OHXA 1JQLB 3KKMA 1CJKC 2WKPA 3EZFA 1BYIA 2V55B 3CF2A 4I1OA 4NYIR 3W3AA 2D06A 1Z08A 2RMKA 3T12A 2FOLA 3KTAA 1T5LA 3KJIA 4NP6A 4RD4A 4ZDKA 5JEDA 2WPDA 4KV9A 3L0SA 2HLDA 3EW9A 4TTPA 2BMJA 2ZJZA 2JLYA 1SVWA 1Z83A 1II8A 3BAFA 1NVUQ 3HR8A 4B71A 1VHTA 2K5UA 2BBTA 3OHMA 5BYKA 3L82B 3SE0A 2Z4SA 3KXKA 2OFXA 4JT2A 5EUQB 4ZDIA 4PO1A 2CCJA 1ZM9A 2HYDA 3TW4A 4TSFD 2BM1A 1HV8A 5KU1A 3AEZA 2FFAA 4QHSA 4C0HA 3Q7QA 3CRVA 3KJEA 2PCLA 2H57A 1LFDB 4HAWA 3AVWA 1PLKA 4B48A 3K53A 5FUYA 5AUOB 1W44A 1M7GA 3E70C 1Z0FA 4OHWA 1S8FA 2XSZD 2BKUA 1JXMA 2C8VA 1BYUA 3QPWA 5KSYA 2JLXA 1P3JA 1G6HA 5KO2A 4D4JA 3TMKA 2NPFA 1GWNA 1RRFA 1W7AA 2W0MA 4Z8YA 2V4ZA 4IEIA 3KFXA 1ZM3A 5KDLA 1E2HA 4JLJA 4FN5A 4U7DA 5EE9A 3DM9B 4RFSB 2CJWA 1C1YA 4JZKA 4CZ2A 1J99A 1OFHA 2G77B 2ZJ5A 2OBNA 4LHXA 4WA7A 4RJLA 3AUYA 4GZMA 1AM4D 3CPHA 4D6PA 1TTTA 1NN0A 4KAXA 2XJ9A 5IT5A 4PX9A 4LI0A 4LYHA 4QKQA 2JJ8A 1OFUX 5FL7D 3VTKA 3VR3A 4WZAE 3OIWA 3S1AA 4UXHA 1U2RA 3MWLA 1NVWQ 2R6AA 4GNKA 3WMFA 3SC3A 4Q4JA 4BEBA 2QBYB 3CR7A 1G64A 2DCUA 2D62A 2IHYA 2QENA 3FFAA 2WZQA 5CLQA 5B2ZA 4WIAA 1FQKA 4BZQA 4LJ9A 3QKRA 1G291 3TE6A 3IGFA 3U7GA 2ZI9A 2A2ZA 3ZD7A 2GZDA 4HB2A 3OAAA 1S9HA 3T35A 3QG5A 1OXUA 1ZW6A 3AP2A 3MFYA 2GK6A 2WVJA 1IN8A 2QMUA 1UDXA 2ZSEA 1BO6A 2HEIA 3DZDA 1NBMD 1G8FA 4HAVA 1LW7A 1JEEA 1MR3F 4FCVA 2D3WA 4AK9A 1WBBA 3N2IA 2Q3FA 5TVKA 2J59A 1Q3HA 4A6XA 2ZJYA 1NVXQ 3RS0A 5K8IA 3T1OA 1WF3A 3K9NA 2WOJA 2QPTA 4CGZA 1DVRA 1XD2A 2DFNA 3ZGXA 1DAGA 1WP9A 2Z5FA 1UBCA 1R0YA 1R6BX 2W2TA 3EZ7A 2V9PA 5FFMA 4DVGA 5L8VA 1R2QA 2YWHA 1LS1A 2CVHA 1L7VC 4N1AA 4FD2A 1KDPA 4IVQA 4N3NA 2W6JD 3IO3A 4QJ4A 1GKUB 3IPXA 3C16C 4Q9JA 3C41J 5AJWA 3BB1A 1QG2A 1VG9B 1Z47A 2F1HA 4KSBA 5GVRA 1KO5A 2WJJA 4NDZA 3GLFB 1UM8A 1E6CA 5F9HA 1E96A 1OPXA 3IIJA 4AKEA 3FPAA 4L5BA 1E9RA 1M1YE 2FZ4A 3GJ7A 4FMCF 1GNRA 2ZSAA 3M6AA 3NHAA 1Z0AA 3NC0C 1QDEA 4RCYA 2DWQA 1U0LA 3TK1A 4E03A 4PZLA 3GLFE 4QGAA 2HXSA 1GUAA 3RVBA 4ZCLA 5SZIA 1AZTA 1IBRA 4C0QC 1US8B 1VIYA 4C0LA 4I1SA 1N6PA 2B6HA 1KI6A 1UEIA 3K0CA 1OXVA 1XTRA 2EFDB 4BFTA 5F3WB 1XJCA 1OF1A 1YR6A 3MRSA 4HATA 4E09A 3SNHA 2I1QA 1ZD1A 3K0EA 3WNDA 5J4HA 3FKSA 4RCZA 4CT5A 2JEOA 2ZPTX 2OM2A 1FMLA 1XEFA 2XITA 2KWIA 1JB1A 3R9IA 4L16A 4W5JA 5BYJA 1PZNA 4MKHA 3W9YA 3QSYA 2WTUA 4OK5A 3GLIE 1IONA 1M7HA 1YU9A 1IN7A 3TH5A 1GSIA 1XD8A 1ZIPA 2AR7A 4FMDB 2GXAA 1RW4A 4GL2A 2QPOA 3FGNA 3H2YA 1FTNA 3KL4A 4KYUA 1BMFD 1TF5A 3LBHA 1XJ0A 5GJCA 2GETA 1IXZA 1JNYA 1Z0KA 3I61A 3AP3A 4A2QA 5AUPB 2V8OA 2G6BA 4Q48A 3VX4A 5D3QA 2C96A 4ZI3A 3FVQA 3LLUA 4P4UA 5ANRB 5C46F 2O8EB 4NU0A 3SHWA 2A7QA 3E2IA 4IFBA 3KUCA 3N70A 1HA3A 5EE3A 2C77A 2YWGA 4Q02A 4YMWA 3RS3A 4V0ME 2DWOA 3RC8A 4PPGA 2N42A 4NL4H 1UADA 4DIEA 1KI7A 1F2TA 1W4BA 1Z0DA 2JATA 3UMRA 1FX0A 5GVSA 1QHSA 1NRJB 4NTZA 5JWRA 5KNCA 5L3SA 1FUUA 4WZBE 1NLFA 3GJXC 2QRNA 1IJEA 1JBKA 1KO1A 4L4UA 2HF8A 4LJ5A 4Z8XA 1RYFA 1A2KC 3NIBA 4M9XA 3SYNA 1KJZA 5SZJA 2FV8A 1XEXB 4XH9B 4ZKEA 1N3BA 4F38A 1G4AE 1OKKD 4EJSB 3QVUA 4TLAA 4UNNA 2OSBA 4XVUA 3JZMA 2AX4A 3DKVA 5LB2A 3TVDA 1YJ5A 4YDSA 1YZGA 4DDUA 2WV9A 5H70A 2WICA 3GJ3A 3UMSA 2PLRA 4B2PA 3U44B 121PA 1GRRA 3NBZC 2DB3A 1OB5A 4G01B 4RZ3A 4ZCMA 1HE1C 1W4CA 4O0MA 3SU8A 4B74A 5BW8A 4AYTA 3Q7PA 4QNMA 4B47A 4TSFA 3TQCA 4Q01A 3K09C 3AVTA 1E79D 1W0JD 3L0PA 2VP6A 1CJVC 1OV4A 3B1XA 4I4LA 4MQBA 4A2PA 4EQ6B 3NWJA 3HU3A 2XSZA 2OCBA 2XB4A 2A5YB 1CJTC 3RRNA 5KYKA 1NVVR 3QKUA 4BZXA 1TNDA 1N6HA 3BBPA 3DL0A 2B92A 4J0QA 1G5RA 1UFQA 4DLWA 5DIFA 3R7WA 3M4YA 3MJRA 3E5HA 3KXLA 4KFTA 1V5WA 3WNCA 1U8ZA 4Q1AA 4Q47A 1Z06A 3HU1A 1T0JB 4DLSA 2GCOB 2PJRA 1AJEA 3IDQA 1J8YF 1Q1EA 1P61B 3PUYA 3AM1A 1XWIA 3AH8A 4AC9A 3UK6A 3A1WA 2ZYTX 3AGQA 4JLBA 5EP4A 5FL7A 4YXWD 1KK2A 4BFYA 1NF3A 2VBCA 3QXSA 2MMGA 2ODWA 2ZRDA 4HAUA 2HV8A 1E0SA 3BS4A 1CRPA 1CLUA 2G0NA 1W36B 3CUEF 1WCV1 4KFRA 3U7HB 5CK5A 3W8NA 4CEIA 2IS4A 4BFXA 1IN5A 1FPMA 3OEHD 1IJFA 2EYQA 1TPZA 1LS6A 3BXZA 3GJ5A 3U3RA 4F92B 1KI4A 3W34A 5FOXA 4TWZA 1KMHB 4B75A 1NBMA 1ZRHA 2JJ2D 2UVQA 4IEEA 1CXZA 1HY3A 2J7PA 1GL6A 3I62A 2BBSA 3QXJA 3W5JA 1KZGB 2HDNB 4K8OA 5JRZA 5CDFE 4HSEA 1CTQA 1D2NA 1FUKA 1E2MA 3FB4A 3TQFA 2O8DB 1TMKA 1MH1A 4FINA 5F2EA 5K8TA 1VG0B 1YQTA 2OE2A 4JYBA 2IYWA 2J0UA 4TTRA 4NKRA 4PSKA 2P3SA 5FOWA 2W6JA 2FE4A 3H84A 1XEXA 2IUTA 1N0UA 2R6GA 3LY5A 4BLRA 1KYIA 4EJSA 5FOUA 4ZIRB 1D9ZA 1P5ZB 2QN6A 3PENA 4PC7A 3X1DA 3HR7A 2Z0MA 2REXB 4G5RA 4I1UA 2HXYA 4B2IA 4P33A 5KPDA 2IS6A 5FBVB 1YVDA 2QE7D 1X8LA 3T06B 5C4GB 1AGPA 1D2MA 3B1YA 3QIAA 3T34A 4F91B 4A92A 2RGDA 4Q00A 3P1JA 3KKQA 4C0KA 2QGZA 3AVYA 2GDJA 2G83A 2JLQA 2F43B 2RH5A 1R5NA 3U3OA 2ZJ8A 2VPPA 2QMEA 2HLDD 5AJYA 2XZPA 2Q9AA 1Z6YA 3SQXA 2JJ1D 5DNYB 3VR1A 1I4LD 1ZMXA 3NBYC 4A9AA 1W5TA 4ON9A 4LK2A 4OJQA 1N6RA 1Z0JA 4TMXA 1D8TA 1NP6A 2IK8A 4AURA 2ORIA 2ZR7A 3PEYA 5SZHB 1OXTA 4KFSA 3AKYA 2X8AA 2J1LA 1CU1A 2ZYWX 3ASZA 4KCGA 3WMEA 2BVNA 4C7OB 4OK6A 4LV8B 1OFTA 4JT4A 6Q21A 1ZM7A 3U6BA 4BFWA 3ICQB 1IY0A 3NHBA 5LB4A 4DT1B 3B1VA 4OI0A 1BMFA 1EX7A 4RZXA 4EFLA 3CKLA 2QI9C 1DE0A 3SEAA 3ONWA 4GMDA 2AFIE 5JSZA 1W48A 3RS5A 4FMDF 5DHFA 1M7BA 2GILA 2WJVA 2ZAMA 4DUGD 4BRWA 5JMTA 4NCNA 4AIIA 3HPQA 2VHCA 3BH7A 2JA1A 3K0FA 1U94A 1WE2A 4GBMA 4LSGA 4ZV4A 2ASEA 3NTUA 1G1MA 1XXHA 1KY2A 1KAOA 4GOJA 4W5WA 3W6PA 3R9XA 1XMJA 3MLEA 5B58C 2B8TA 3EZ6A 3BERA 3IIKA 4OI1A 1UF9A 3LRPA 2PEYA 3CF6R 4PHGA 5JBQA 4YQFA 2ZSFA 5FOVA 2Q3HA 3JVUA 3AKCA 5G41A 1KI1A 4R9UC 3X1YA 1XNJA 4XJXA 1XCGB 1ZUHA 4LC1A 1OIWA 1E2KA 4A15A 2IUUA 1P9NA 3BK7A 3W90A 3CF0A 5H8WA 1OKKA 3CH5A 3LNCA 3K1JA 4NH0A 3LXRA 3B7GA 2WWWA 4DZZA 1CULC 2JLUA 5J4KA 1EGAA 1KOFA 1LTQA 1SHZA 3IQWA 3NKVA 4DCTA 2F1IA 4H9GA 1K8RA 3W5IA 3QKSB 1SVIA 4QM7A 4CVNA 1RJ9B 2O0HA 1QF9A 3GJ6A 1C9KA 2ZRBA 4CDGA 1G8GA 2Z83A 4IVPA 2RGCA 1BOFA 4Q03A 4KI0A 2KJQA 1I2DA 4EJSC 2A78A 3KTAB 5C1BA 3LX8A 3SYLA 1QHIA 1XDBA 2YV5A 3IPYA 4GOKA 3EPLA 3PXGA 3ZQJA 3ZD6A 1XTIA 2FN4A 4QHTA 3LAWA 1E79A 4WW0A 3TBKA 4MRNA 1II8B 2VF8A 2HCJB 4KXFB 3ADCA 1AKEA 1O3YA 1QZXA 4BZPA 2D7DA 421PA 4PR0A 1VCNA 1DO0A 4MRSA 1ZU5A 3T61A 1E9AA 4RY2A 3I3SR 2JGNA 4YMVA 1SVSA 2DY1A 2FX3A 2JIZD 3QBTA 3SJBA 3CWQA 2WWYA 1GTVA 4D0LB 2V3CC 2PMDA 1OXSC 3KKNA 3QKTA 1DAIA 1NY6A 4K81B 1MV5A 2OILA 2H17A 1NJFA 1KI9A 4HAZA 2ZVPX 4NYMQ 1VYVA 5E7MA 3FOZA 2GF0A 2C9YA 2I1VB 2VYFA 5CLLA 3IUYA 2VHJA 4AD8A 1R7RA 1XB2A 3AF2A 2YOGA 3P27A 4EIWA 4ZDJA 3HP1A 4XWAA 4TL8A 4GDFA 2GXQA 3TKLA 1E94E 2V7QD 4M1WA 1GITA 1KGDA 5DYGA 2YC4C 3H0KA 1OH7A 2NO1A 4NMMA 5KUTA 1CIPA 1U0JA 2WHXA 2ECKA 4F93B 3KKPA 1P75A 2YWFA 2H8KA 1FZQA 3G82C 2CJWB 4B44A 4AYWA 2W6ID 3OEHA 5GJWC 1UAAA 2ZQ5A 3AKEA 3HWSA 3EPHA 1ZBDA 2A9KA 1EFHA 4D25A 1G7TA 4IOLA 2OAP1 1P62B 3PV0A 2ZR9A 2KI5A 3QPUA 2JJ2A 1T0HB 2ZRHA 3S1AB 3ADBA 3VX3A 1RIFA 3O47A 4Q4JB 1Q12A 3T15A 3IEUA 1E99A 2G3YA 2QEQA 2WM9B 1E98A 3AVOA 4BRUA 1W36C 1JEDA 1X1SA 3QKRB 4ZKDA 4RD0A 1P9WA 4C0SA 1Q22A 3U6KA 1TU3A 1DBSA 4NPHA 2QP9X 2EFGA 4C2UA 2FA9A 4BGDA 4LJ6A 2HCBA 2P65A 2ZU0C 2IYVA 2B7BA 5FPKA 1ZNWA 3QJYA 1Q0UA 3LX5A 3LBIA 3LH5A 3VR2A 1AKYA 1RZ3A 3IKJA 3EC2A 2R6DA 4RKFA 3CB4A 1Z28A 4FI3C 3MSXA 3I5XA 1U98A 5FUXA 1XD2B 2A3RA 4XSHA 4MDFA 1QHGA 3LV8A 1IM2A 2OHFA 2QE7A 1II9A 5FUVA 1XPRA 2J41A 1T91A 2EVWX 3MUFA 5EZ5A 4DSNA 4PPFA 2QROA 4LJ7A 5JJIA 3PUWA 2PCJA 4A6PA 4A2WA 1N5KA 2ZXUA 4JJKA 4TMWA 5HCIA 2C9CA 2NZ8A 3THXA 4P4SA 5DGXA 3WYGA 2XX3A 4F4JA 2O8FA 3W8RA 3GP8A 4WVFA 3VKWA 3FHOA 3C5CA 1KJYA 5KSPA 1E2GA 4ARZA 3SS8A 3V4RA 2FSFA 1DAFA 2ZR0A 1RRPA 2C2HA 3MAAC 3UIEA 5E7IA 4TN1A 2JJ1A 2QQ0A 4PHHA 2KE5A 1W2GA 2FDCA 2XTNA 4DB2A 4AKIA 2QG6A 4B6EA 3GQBA 1CR2A 2WJHA 3QXHA 1IY1A 4R2HA 4MYHA 3RAPR 3RNLA 1U0HC 4TZ6A 2QL6A 1E0JA 1TEVA 3R20A 5AWFC 3TW8B 1SXJD 2ZRLA 4ZCIA 4FIDA 5JFGA 4L9WA 1ONBA 5A5GA 4BECA 1I4DD 5JRJA 1KI6B 2FNAA 3LQRA 4DSUA 2GESA 1KK0A 5FOSA 5FPHA 2H18A 4PAOA 3I8XA 2HT1A 2DHRA 2QAJA 1YHNA 4DUGA 1P9RA 2NG1A 3BWDD 3VR4A 1Z6AA 1T3LA 4TYYA 2VTKA 4B3BA 3TNFA 5KNDA 2WWHA 1GOTA 1JR3D 3B60A 5P21A 2ONJA 2GEDA 3MMPA 2KBFA 5EP3A 2AKYA 5DLQC 3BIFA 4UXIA 2WWFA 2LCFA 1XJQA 4A82A 4OQXA 1U9IA 4V0KA 4IKEA 4URZR 3L8ZA 4B32A 4UXJA 3AUXA 3GLHA 2JLSA 5G40A 3UMFA 3ZYCA 3CZPA 2DFTA 1OYWA 5AJXA 4US1R 1D6JA 2WWGA 3VNVA 1Z3IX 2IA5A 4O2RA 4OHVA 1WMSA 2ATVA 3ADDA 1T3SA 5HE9A 1DS6A 1WRBA 3M0EA 4UJ3A 2REBA 2ZSDA 2WKQA 1R10A 1U8YA 1E0AA 5FTMA 3QF7A 1DPFA 1IY2A 2EWVA 3PQCA 4PQYA 5JJLA 4V0OA 1F2TB 2L0XA 2XNDD 5DHAA 1G7RA 2IYSA 1FX0B 1M2OB 3DMDA 4ERNA 4B3CA 2BV3A 5L3SB 3U60B 3CRMA 3GPLA 1NJGA 2RKOA 2C78A 2G88A 3AP1A 1MT0A 4DDVA 1SVMA 5CYPA 2ZROA 4G0NA 2J7PD 4NYJR 4Q1DA 3X1XA 1KI8A 2PBRA 2GNOA 4MH0R 1KHTA 2IS1A 1SKQA 2IYLD 1Z2AA 3TLXA 4B73A 2MMCA 4BFUA 4GFDA 2KB0A 3WMGA 3CH4B 1RE0A 1D9XA 2I3BA 4HUQB 4DEYA 3M1IA 2RGEA 2DR3A 2Z43A 4D0NA 3ADKA 4LJ8A 3O8RA 1RRCA 2H92A 3Q9LA 1DADA 2ZRJA 3K70D 1TU4A 2J0SA 4BWYA 1KY3A 2PZEA 1A82A 4FXPA 2BWJA 5TXGA 1E2DA 3U7FB 3FDIA 1UBGA 2BM0A 3B1ZA 4M8NE 4NCJA 1JXOA 4R71A 2JLZA 1NKTA 1KDRA 3I5YA 1X6VA 2JIZA 3I8SA 4OYHA 1GG2A 1RC8A 3P32A 2WJIA 2ZJ2A 4AKGA 1RYHA 2FZLA 2QTHA 3K9LA 5EXSA 1N6OA 3IHLA 4TT3D 3NVAA 2XOKD 1OE0A 1Q3TA 4NYJQ 2UKDA 4UNPA 3DEFA 4DCSA 1S9DA 2VA8A 3AVPA 2FSGA 5DO9A 2JDIA 3PUZA 1G3MA 1W49A 2ZUCA 2V7QA 1H65A 4KSCA 1XPOA 1XTQA 1FP7A 3PITA 3WP0A 4DWJA 1DAKA 4PHFA 2B8WA 2ZETA 3LW7A 4IHQA 1TF7A 4DCUA 3U5ZB 3R7WB 3PCRB 2OESA 1WBDA 3K9HA 4B34A 2IXFA 4OHYA 221PA 2KBEA 3CRQA 4PPQA 4PFSA 2W6IA 4FCWA 4OL0A 3RRZA 3F3YA 4Q5IA 1Z5ZA 4Q1BA 4Q7LA 1XMIA 1FOEB 1WA5A 1AZSC 1KTVA 2XJ4A 1G9XA 1SHKA 1IHUA 3LWNA 1AGRA 1KO4A 3CNLA 4Q9LA 3THWB 3E1SA 3IBYA 3RABA 1U9IC 3B2EA 3I73A 4S35A 4DBLC 4CEIB 2IYZA 2ERXA 3DKPA 4IDHA 3V9PA 3MWKA 1SZPA 2ZITA 1XTKA 5DI3A 4Q9IA 1TX4B 2AHOA 2WSSD 4MGYR 4RZUA 1F6BA 1VMAA 3AB3A 4G3XA 3I4LA 1G7CA 4P32A 1KI2A 1R0ZA 2IX3A 4QBFA 4RD2A 3LQQA 4KU4A 1OSNA 1KO7A 2ZJAA 1S96A 1TAGA 4AG6A 2JAQA 2MSEB 5FL3A 2ZRNA 1N6NA 3BD9A 4DCVA 4IJMA 4DLXA 3A1VA 3ZZTA 3TVTA 5DYIA 3QY0A 1ZJ6A 2IF0A 1G6OA 3GJ8A 2ZM5A 4QGGA 4EPTA 1NBME 3GFTA 4TLCA 4TMVA 4LHVA 5FTKA 1TF2A 3LDAA 4Q7MB 2EFCB 2RGNA 2P6UA 2YYZA 4PQFA 5FTJA 2IF2A 2TMKA 2NO0A 2G9NA 1GILA 2V1UA 2JASA 3VKGA 2R62A 2J0UB 1I2MA 4PZZA 2FSIA 1VCMA 3WHKA 3X1ZA 3N2EA 3CBQA 2OFOA 2P5TB 3U3KA 3TGPA 3SJCA 4WBSA 4Q7KA 1VCOA 4DCNA 2WOOA 2FMXA 3GCGA 3EPJA 1G8HA 1G4UR 3ZVRA 4HLQB 4W7SA 4M21A 2XZLA 1YR9A 5HKKD 3RSLA 1GNQA 1PLJA 2ATXA 1OIVA 2WJYA 4FCTA 1KIMA 3A1SA 4HUQA 4JLKA 2ZVQX 4XOIA 3CW2A 4Y0AA 4FW9A 1TQDA 3QEOA 1P7CA 2WAYA 3FMOB 4TYQA 5KHOC 2E1RA 4W5HA 4JVLA 5KSOA 1CJMA 1P2TA 4OJKA 3VU9A 4D26A 5EP2A 4O25A 2QMHA 2ZEJA 4MYTA 1SXJA 1NMZA 3SHFA 5H1YA 1DEKA 2HT6A 4JMPA 5CB6A 5HZHA 4I1VA 5GJVC 1GNPA 3Q8XB 1Y3AA 3A37A 1P60A 4N0DA 1MO5A 2CXXA 4QXAA 4V0LA 3VR6A 4EUNA 5AK0A 2FF7A 1I4TD 3R9WA 2WIBA 2QM7A 4A36A 1Z2CA 2GVZC 3W6OA 4ACBA 1GRQA 2RGXA 5CB8A 1VTKA 4Z51A 2WJGA 1SVKA 1CP2A 1ZUIA 2N1BA 4LY6A 2H5EA 3B85A 1JR3A 4ZDWA 4H1VA 4CT4B 1YZUA 1E2NA 1JPJA 2OCPA 3B9PA 1EFUA 3K0CC 4DLRA 2OXRA 3HJNA 4ABYA 1KKMA 2EWWA 4EPVA 1V43A 3GFOA 4LBZA 4D81A 3IIMA 3K0AA 4BLTA 5JSZB 4PC1A 1E2LA 4M9SA 3KJGA 1D2EA 4QJ3A 3CLVA 1F5NA 3FE2A 3QQ5A 4DRZA 5J4LA 1XRJA 1TQ6A 3K0FB 1G5PA 1P72A 1X8KA 1XP8A 1XXHB 3ZS8A 5JHHB 2PT5A 1TL7C 3THWA 4O2LA 5EQTA 4Q19A 4LOAA 4BFSA 3TAUA 4NBSA 4GT1A 2YOFA 3NEJA 1RRGA 5EP1A 2OAQ1 2W2VA 4KITB 5SZKB 3GLIA 2EU8A 2XNDA 3MD0A 4M2LA 4EPYA 2BC9A 5JWOA 2H7VA 2YWEA 3U4QA 1XXHE 2FEOA 1VPLA 5A4JA 1G5TA 4M9ZA 1IXRC 2FU5C 2UZIR 2VL7A 4OQLA 2VP4A 2ZE5A 3OFND 5FBWB 3VMFA 3QXXA 5KOYA 1CBUA 4DDTA 2J45A 2IC5A 3BGWA 4XTRA 3L2OB 2RHDA 1P6XA 4AG5A 4DJTA 3QNUA 2O8CB 1XX6A 2V1XA 1E9FA 2R8RA 2C04A 4R2IA 2X2FA 2D7CA 2JLWA 2RGNC 5TV2A 3WNBA 5E4FA 2OT3B 3A6PC 3P20A 2IWRA 2BDTA 4QG7A 4ESHA 2DFKB 1W4RA 1GFIA 2QTVB 2VSXA 3A58B 1QBKC 3A4MA 3EARA 1G3RA 2GZHA 1Q20A 1OIXA 3ZVNA 3B6EA 3QVVA 3ZZUA 4IDNA 2BJWA 4CF7A 3VR5A 2ZUBA 4NZYA 2N46A 4TT3A 4CIDA 2XOKA 3DHWC 4PXAA 5G3YA 3SN6A 4HI0E 4X8MA 4NCHA 1F3OA 1R0XA 4OQMA 2BJVA 3F5FA 4ESVA 3Q5EA 2ERYA 4JLMA 1F48A 5FR1A 1ANKA 1UEJA 4G1UC 5CIQA 1SXJC 2A30A 4OQNA 2QU8A 5K8LA 3U7EB 1YRBA 4X8LA 4DLVA 2F7SA 4Q21A 2H16A 2W2XA 3OZXA 3VNUA 2G1JA 5EUMA 1ZD9A 3W3ZB 2QPAA 2YINC 4YDHB 5BN3A 5KDOA 3QEJA 2O8BA 1B0UA 4EPRA 2LWIA 3NXSA 2E87A 2IYXA 3KQLA 3WY9A 1KMQA 5J5CA 5J4VA 1U81A 4G5SA 3GLGA 3OIUA 1JI0A 2JLRA 2Q21A 2A5GA 1IN4A 1G3UA 2Q3MA 2AKAB 2ZAOA 2QT0A 4OI4A 1QHNA 1G21E 5JI2E 2ZRKA 3KKOA 2ZS8A 3AVUA 2Z4RA 2FSHA 4IXNA 3Q3JB 2ZE7A 3PG5A 2OO7A 1R5OA 4RZ2A 1Z22A 2ZREA 1YR8A 4D82A 3V4FA 3IHWA 4HLDA 2WSSA 5JLJA 1Q21A 4RKEA 1EWQA 3UWOA 4RD6A 4M9QA 5EE0A 2P0EA 1G3IA 2C03A 1TQ4A 5BXQC 1SULA 4PC6A 2GK7A 2IXEA 2GAOA 2P5SA 2ZJOA 4PPNA 4EPWA 5KNBA 1G19A 1B23P 821PA 1GM5A 5EXXA 5FPTA 2UZ3A 2EQBA 4KLZA 3BRWD 4WXPA 3WYFA 4URVR 2QT1A 2ZI3A 3OIVA 3ZDQA 4HYYA 2OG2A 4BLOA 1KJWA 2CL6X 2QY9A 3AVQA 2XZOA 3CRRA 2QAGA 4G5OA 5JCPA 1RVDA 2C99A 4PTLA 3WRYC 1GIAA 2QP3A 3PVSA 1JJ7A 3LVRE 3QF4A 4TQAA 4B76A 4V0NA 5JCZA 1OJLA 1OH6A 1XZPA 4E22A 5F9FA 2IT1A 4HDOB 3JVVA 2O8CA 3LLMA 1ODFA 4HAYA 4LDJA 3EPKA 5HKKA 3RWMB 2MSCB 1QG4A 3IQXA 1NLZA 4TMTA 1DOAA 3AF3A 5JS7A 4EDHA 4GMXA 5DISB 2BEJA 3QG1A 3AVVA 4MKFA 1NG1A 3BH0A 2J3EA 1U8AA 3D7MA 3GJ0A 4RD3A 4A0RA 4A0GA 1WDTA 4NYMR 3U2QA 3KQKA 4H1UA 3THXB 4P4SB 2O8FB 2IBMA 2G1KA 1UKVY 2AD5A 1GP2A 1E9CA 2WMOB 3HDTA 4TMKA 4E5UA 3VHXA 2FGKA 1CKEA 2GF9A 4ARZB 5LBIA 2Q9BA 1EWRA 2ZIAA 1NLYA 4AWXA 4XWOA 2I4IA 2IYRA 1OW3B 2C9OA 1X86B 3V00A 3QENA 1EK0A 1DTSA 4CYMA 1EFTA 3DDCA 4JLNA 2IYTA 1CEEA 2CE2X 4QBHA 4C0AC 5E7JA 1DELA 2VF7A 1E9EA 3WBKA 4RD1A 2YC2C 4IVRA 4XSGA 1BS1A 4QGHA 2P6RA 1HQYE 1ZU4A 3BC1A 3GD7A 4LYFA 4A0FA 3LW8A 1W0KD 4PAQA 3LO5A 1GRNA 1MKYA 4NE2A 3ZVLA 2GAAA 5FR2A 4YLGA 4RVCA 2JDID 3I32A 1P2SA 1MO3A 2O0KA 4MRRA 2AN9A 4M53A 1Z63A 4MRPA 3GFPA 3PFIA 1N2CE 2E9SA 1WQ1R 3WP1B 4FMCB 2OV2A 3UKDA 2R2AA 3KDSE 1S2MA 3DOFA 4TMZA 3AF4A 1SGWA 1HH4A 1ZAKA 1NSTA 3K9GA 1E2EA 1NMYA 5EJEA 3THOA 3NC1C 3L0IB 3TRFA 2Q9CA 4DSOA 3GLHB 1P4SA 3UPUA 3KJHA 2X19A 4G5QA 4HZIA 4HUTA 1M6NA 2CK3D 3DM5A 1R5BA 4UNQA 2J9RA 1KSFX 3OFNA 5DI9A 1P2UA 4Q9HA 3QE0A 2VRWA 2GJAA 5GJBA 2P2LA 5JZVA 4OI2A 3GLHE 2NIPA 2A5FA 4LV5B 3R8FA 3A1TA 2FPMA 2XTZA 4LCBA 1ZNZA 2GKSA 3MGCA 3RHFA 1XPUA 3EZ9A 2HJVA 3KZ1E 2O0JA 4AY2A 4XD7D 5JECA 5BQ5A 1NKSA 2LKDA 2BBOA 4LHZA 3DVLA 2Q0HA 4L9SA 1N0VC 1LF0A 2YZ2A 4MKGA 4MDEA 2CL0X 4JBWA 1JR6A 5LDDC 1GAJA 5B30A 4HZUB 1BKDR 1A7JA 3AF1A 5G53C 4WXRA 4IDOA 5AUNB 2EW1A 3QI2A 2CHGA 3SQWA 1H8HD 4BEJA 1QHHA 2WBLC 1ETUA 2FFQA 3MG9A 4PC3A 5C18A 2GTPA 4KODA 4IFEA 1ESNA 1PVOA 1KK3A 1T6NA 2VP9A 3U3MA 5HR5A 2VSFA 1AA9A 2V6JA 3DO6A 1HURA 1GKYA 4URXR 2WSMA 3H1TA 2NTYC 2WKRA 4JLPA 3ZS9A 1CR4A 1PUIA 1U90A 4US0R 4B33A 4RFVA 2JLVA 2J7KA 2REOA 1COWD 3SJAA 1A4RA 3B1WA 1QHXA 2ZRGA 1E9BA 3C7KA 3N5CA 1YZLA 5JI3E 4IDPA 4MRVA 1ZD8A 4QJ5A 2W58A 1XBTA 1ZIOA 4GP6A 3RRYA 3RYTC 1KAGA 2CCKA 3TR5A 4ASUD 3SDZA 1RKBA 3QPVA 3H86A 5E3HA 4FWTA 2VP2A 2QMOA 4TLDA 3EG5A 2XXAA 2OCYC 2CL7X 3AVXA 4M0LA 721PA 1IAQA 2CHQA 1YZQA 2VQSA 1OYYA 4HLCA 1XZQA 3B5JA 2PEZA 1D5CA 3H4MA 1W4AA 2CHVA 5HTKA 1E2JA 4LPSA 1L2TA 1OH5A 1S4QA 4JL5A 4JJZA 1N6KA 4RSGA 1DO2A 4Q9KA 5IRCD 2XGJA 3A36A 1NN1A 4JIMA 1IOZA 3TJZA 1MABA 2IUSA 4CEHA 2DBYA 1OHHD 1XFAA 2J46A 3IEVA 2ODEA 5J4YA 1S3GA 8OHMA 4TLBA 2RB4A 1E0KA 2IYYA 2GXUA 1F2UA 1Q44A 2YVUA 2C98A 1GL9B 3HYRA 3SBEA 3THYA 1T5IA 1T4GA 4Q7JB 1J7KA 1YR7A 4Q1FA 3O8BA 2GVDC 3ZIAD 2GJSA 4F4IA 4M1TA 4E07A 2ZE8A 4Q4HA 4KFUA 4WOPA 5FI0B 1KKLA 4DDWA 4NYIQ 4QNRA 1TUIA 2HF9A 1JPNA 4JVSB 4C0BA 5K8UA 3CX8A 5AJZA 4AYXA 4D0GA 4IXMA 1HE8B 2GHIA 4L8GA 5D3MB 5DI3B 3Q5DA 2BEKA 3ZJYA 2HUPA 5IHPA 4LBWA 1YZKA 4UNRA 2IL1A 2BIFA 3RRMA 1NIJA 3R8CA 5A0FA 2H1LA 1O87A 1XTSA 3D3QA 1YE8A 5IDVA 1VECA 5HCNA 2ZRAA 5KTYA 4LUCA 4LJ4A 4Q4AB 3KQNA 2CLDX 2FPLA 2R6FA 2PL3A 1KK1A 5E95A 2D2EA 1N5JA 1P73A 2ZRFA 1JAIA 1N6LA 2QNRA 5M04A 2J0QA 2Y8EA 1T9HA 2QM8A 2BMEA 1Q1ZA 2XNSA 3IILA 4HZUA 2FG5A 4P3YA 3TSWA 1E2QA 4A8JA 4Z54A 2PX0A 4F7WA 1OH8A 3C8UA 3UG7A 4YMSA 2VP5A 2XB2A 3T5GA 2VHQA 4V02A 4CEJA 2R65A 3TUZC 4KVAA 3FHCB 5FUWA 3RDPA 3T5DA 1NNEA 4BFZA 1ZUNB 1KO8A 4B3XA 1OFIA 4TL6A 1JJVA 4URYR 2ZJBA 2XEXA 2RHMA 3NG1A 3W6NA 3B9QA 3CRW1 1KDOA 3KB2A 4DB4A 3BFVA 2GCNA 2C95A 1N5IA 2GCPA 3T1TA 4P4TA 3X2SA 5L3QB 4DKXA 1MOZA 4Z1MD 2P67A 3VU9B 1BH2A 3CM0A 1ZYUA 2PX3A 3P26A 4HEJA 1GVNB 3LA6A 1SXJB 1CJUC 3CONA 4YC7A 3RC3A 4AKHA 2D74A 2QTFA 2AK2A 1EFCA 1DG1G 1E4YA 2QGNA 3KB1A 3TUJC 4B6FA 4JLDA 2VSOA 1SQ5A 1UPTA 3AF0A 4C3ZA 4DLZA 1XEWX 5B57C 3DPUA 1E1RD 3TUIC 5CM9C 2W0SA 1A1VA 5JWHA 5EZ6B 1NY5A 1SXJE 1W0KA 3FMPB 2NO6A 1CR1A 4QGFA 2LKCA 4TYPA 2OLJA 1S3SA 1N0WA 1YZTA 4LRWA 1E3MA 3VQTA 1N25A 3D6TB 1P2VA 2G0TA 5DE3A 3ZVMA 1QRAA 3OE7A 3CWZA 3EIQA 4C0JA 4POAA 4FWIB 1E4VA 4M22A 2OUKA 2WWIA 4ZO4A 1G7SA 1TUEA 5F98A 1E1QD 3K09A 3TR0A 3K0AB 2HYIC 1JR3E 2V54A 4KBGA 3IBGA 1KNQA 2DYKA 1QVRA 1VDZA 2AWOA 2CK3A 2ZTSA 1M74A 3JZAA 5J40A 5LD2B 1EX6A 5TY0A 1W2HA 5AJVB 4UKDA 1TQ2A 2ORWA 2XAUA 1R8QA 3PEWA 2CLSA 1GDDA 5TMPA 4WZ6A 3KFVA 1T8UA 1NL3A 1G8PA 4XD7A 2BHRA 3NDBB 3GLIB 2SHKA 1LY1A 2ZRIA 4M1SA 3WXMA 1N6IA 3SOPA 3U4QB 4TLEA 4IOKA 1EG7A 2EFHB 1FQJA 1J8MF 3AV0B 4OQFA 5D3MA 4B3FX 3NBFA 2VP0A 4GP7A 2B7CA 3UANA 2FFBA 4HDQB 3NH9A 4JLOA 3REGA 4DC9A 2IS2A 3IO5A 4FMBB 2ZU6A 3AKDA 1Z6TA 2IYQA 1H8HA 4Q4AA 1A2BA 4URWR 4B3GA 1HT2E 1W1WA 2GBLA 3HPRA 4TQUS 2GWHA 4RFSA 1W47A 1FFHA 4TZ0A 1E9DA 2D4HA 4JVMA 1XCPA 1ZC4A 1Z29A 3WRXC 1E9SA 5IK2D 2QRZA 2RGBA 5CJPA 1PV4A 2F1RA 4ACAA 2A5DA 2FH5B 3CPJB 3DZ8A 1E2PA 5KSZA 1EFRA 4A8JC 3K70B 1M34E 1COWA 3ND8A 3NEYA 4OK3A 1Z0IA 2QBYA 4ILEA 1SVLA 1YZNA 1UKZA 1VG8A 2B21A 4WAUA 3WHLA 4A4DA 1FP6A 2WIAA 1W36D 1AQYA 1Z07A 1HUQA 2BMDA 5CYOA 1R4AA 521PA 3J81k 3C5HA 1JQJC 3F0TA 2Q6TA 4ASUA 3B82A 5DN6D 3O8CA 4MGZR 3OEED 3TIFA 2BCJQ 1NG9A 3GEIA 3B13B 4GZLA 4F4CA 2C5LA 2RGAA 4JSYA 2YHSA 4TYNA 1AIPA 5UKDA 5L3QA 1YKSA 3LFUA 4JBYA 2VLIA 4M4SA 1NIPA 2R44A 3I1FA 3BFXA 4JLVA 1KSJA 5FPYA 2ZI4A 4BASA 3RLFA 3KQHA 2GEUA 4X8OA 1MO4A 3ZH9B 5FOTA 4D2IA 2VIIA 3VAAA 4B35A 1L8QA 4EFMA 1XU4A 1K5DA 1OHHA 3EIHA 2IEZA 5C4MA 3PUVA 2ODBA 2O8BB 5FBRB 1ZNYA 3PEUA 4KHZA 2GJ9A 2ZS9A 3DMNA 2ZI7A 1AS2A 2BOVA 3A8TA 1AQUA 4PO9A 4NHOA 3GLGB 3SR0A 5L3RA 2CLCX 3LD9A 4LYAA 2ORVA 4IOMA 3MWJA 2X77A 1XD9A 2J5XA 4N0EA 3SJZA 4BLQA 2OLKA 4JVNA 3GLFA 3ZIAA 4BLPA 2YNMA 3AGPA 5FTLA 4HLUA 3ZLJA 3GLGE 4B3DA 2FPKA 1AS0A 1RFLA 1UKEA 3ICEA 4GSYA 4MUAA 4CRWB 3DOEA 1GZSA 2ZUDA 1R0WA 1ZCBA 3D8BA 3ETLA 1ESMA 4KLNA 4QM6A 1H8ED 5TARA 5GADl 2ZRMA 3RS7A 1FL9A 1LB1B 5BWMA 1US8A 4R7ZA 1VYTA 4OKSA 1K6MA 4KJZA 1UJ2A 1R8SA 1G41A 2ANBA 3P4XA 4TYWA 2GJ8A 4JLAA 5G3ZA 3FTQA 2EYUA 5IF9A 2YKGA 1XF9A 1SVOA 3BB4A 3ECCA 1Z6GA 4KBFA 1X1RA 4M1OA 4DEXA 1CR0A 5JEEA 5JJKA 4XVRA 3C14C 3CR8A 4Q1EA 1OB2A 3LVQE 3Q72A 2QAGB 2ANCA 4D4KA 2X1VA 4YONB 4II7A 1PLLA 4TL7A 3U61B 4MGIR 1GL7A 3BH6A 4LBVA 5JHGB 3QF4B 3KQUA 2BKEA 5AUQA 2YOHA 3CZQA 2GBLC 1HT1E 3I72A 4MKIA 1LV7A 1LNZA 3UG6A 2F6RA 4QOSA 1NMXA 2A5JA 3I92A 1IXSB 1ZCAA 1DG3A 1S1CA 3GJ4A 5FBQB 1NVVQ 4IOJA 2F9MA 2ZRPA 4V0MA 4UQOA 4A0HA 2AXPA 3EASA 3BOSA 2FFHA 4EAQA 2O8EA 4XWKA 3F8TA 3UXMA 3RS4A 3ZQ6A 4Q18A 4Z1MA 2AWNA 4BPBA 3U3JA 1E32A 2ZI6A 2QUZA 3B8HA 4QHYA 1L4UA 3NBXX 3SFZA 4OBEA 4PSAA 1WXQA 5CITA 2O52A 2OFWA 4JL6A 4MGKR 1L4YA 4A1FA 2ZS7A 4C2TA 4G5GA 4C4PA 4TTQA 4GI7A 5EXTA 1E1RA 1KNXA 1S1MA 2GEVA 3QOFA 2ZSBA 5FI1B 2PZGA 4C30A 1DARA 2DPXA 4BUJA 1Q57A 2XTMA 4BQSA 5ELXA 1TADA 2CNWD 1HYQA 3RS2A 4PZYA 4JYCA 1KSGA 2CMKA 2CE7A 4W9MC 4MITA 3EWAA 2F55A 1XTJA 4LZZA 3VFDA 1XMSA 2IW3A 2IEYA 3K0SA 1YRAA 2IWHA 3SYKA 2NGRA 1JAHA 1E1QA 1VKJA 1QVAA 2RAPA 1CS4C 2AFHE 4LJYA 4X8HA 621PA 1CRQA 2NOAA 1OT3A 2QZ4A 3A4LA 2QSYA 3U44A 5CIWA 2OCAA 2WMNB 1T8TA 1ZM4A 2PH1A 1XMVA 3CO5A 3EC1A 4KO8A 3EZ2A 1ELOA 1C4OA 2JCSA 3BFKA 1AS3A 4QFMA 2QORA 2F3RA 1IQPA 4GPTA 4US2R 4IRUB 1NI3A 2VO1A 2WPDD 3BB3A 3CIOA 3PIRA 4KYIB 1MO6A 3L43A 2KSQA 3ND9A 4HLUC 1NSFA 3HYTA 4TQ9A 4LX0A 1EESA 2OZEA 1ZP6A 2FWRA 3EWSA 4LV6A 4EQ6A 5LD2C 5EE5B 5TDHA 1VG1A 2ZYUX 3RANA 1WB9A 4GRAA 2VHTA 4DXAA 4M1YA 3G5UA 1ZM2A 4O3MA 2FJUA 2OEPA 3PEVA 1FNMA 3EX7C 3FMFA 1E69A 4CW7A 3VKHA 2PZFA 3CPEA 2FGJA 4HDCA 4NCKA 4OHZA 1QHYA 1G16A 3QUSA 3T1VA 2NMVA 1N5LA 1W46A 3O8DA 1G8YA 1OLOA 1G18A 4PAMA 4Q66C 3FYHA 3FWYA 1RPZA 2GCOA 2NZJA 3QXCA 4DHEA 4UJ5A 5IK2A 3ZZ0A 1FNNA 4HB3A 3CX7A 1OXXK 4LPKA 2QSZA 3QBVA 4IW3B 1VHLA 4U00A 5C2JB 1ZC3A 1JECA 1II0A 2NPIA 3A4NA 3Q85A 1LVGA 1DAHA 1X3SA 4Y0VA 5EXPA 3TSZA 3AQ4A 1AK2A 4YMTA 1QHHB 3NDPA 2GA8A 1G20E 3WBJA 4ZI2A 1UDWA 1MRSA 3ASYA 3EA0A 3PUXA 3VHLB 1ZNXA 1HEIA 5DN6A 1J90A 2W83A 1LF5A 3OEEA 2IYUA 2OXCA 3WYAA 1Q1QA 4HB0A 4B43A 3K70C 4IDQA 1AN0A 1KSHA 5CDFA 4D4LA 1KMHA 4PC2A 2NQ2C 4QBIA 2PMKA 4XIGS 2AL7A 5KDDA 4DIDA 4PQRA 2NO7A 1KDTA 3UATA 4QBGB 3X1WA 2J0VA 2CVFA 2IXGA 5J47A 4AI6A 1J2JA 3SBDA 2AK3A 2F3TA 2GXSA 2RGGA 1DAEA 3FMIA 3OAAD 3RWOA 1VCIA 4JSTA 4LWZA 2O8DA 1KZ7B 2WAXA 2QA5A 2XXAB 4B2LA 2AD1A 5AR1A 2J87A 4KVGA 3HU2A 1ZVQA 2V6IA 4PANA 1NN3A 5HPYB 4DLYA 4LBYA 5FTNA 1G17A 3C15C 2QP4A 2W00A 2YJTD 1M8PA 2D2FA 3PJRA 2ZYVX 4ZIRA 2IHBA 1GKIA 2NO9A 3EIEA 3PR1A 4QL3A 4MA4A 3TAHA 5FH9A 4HB4A 4QRHA 2CEAA 2X2EA 2DFLA 1MABB 1VYUA 5LPNA 3CX6A 1W0JA 4YMUA 4CEHB 1W5SA 3T1QA 2F1JA 5B64A 2ZI5A 2PLFA 4PO8A 1F60A 2CBZA 3L0OA 4LJAA 4U02A 4M1KA 1H8EA 4HAXA 4Q1CA 1VIAA 4XVQA 1F2UB 4XTCS 2F43A 1BIFA 3EXAA 4P0TA 2RCNA 4TL9A 3OE7D 5JS8A 3THYB 2CDNA 4JKYA 4LC0A 2AXNA 1HQCA 2BBWA 4BFVA 4DLUA 1UBEA 1EXMA 1CF4A 1HTWA 1FMJA 4Q4HB 4BE7B 5H68A 1NN5A 4QC2A 5DH9A 3LBNA 5BN5A 1FTSA 2VH5R 2DWPA 2R9VA 4JBXA 4JL8A 3RSOA 2P6NA 4DSTA 4PSVA 1XEWY 1Y63A 2BCGY 1DAMA 3KX2A 5TB5A 2GRJA 1T3HA 3GEHA 3MWYW 4C7OA 4Q4LA 5FBLB 2VHUA 4YXWA 3BORA 4BLSA 4ITRC 2WWXA 1G3QA 2Z6VA 1S0UA 4EPXA 4EKDA 3G0HA 4NCIA 4UNSA 4DLTA 1J70A 2CCGA 4DT1A 2PT7A 1X8JA 2GJKA 3FKQA 2ZE6A 3FFBA 3KUDA 3EA5A 2FEMA 3SFVA 3CNOA 1K5GA 4S2EA 3FKSD
chains in the Genus database with same CATH superfamily
2P11A 1D7AA 2VEDA 2XLCA 4RIEA 5FYDA 3L8YA 1R37A 4FYWA 5KTSA 3NH6A 2YS7A 2OYRA 4DSAA 1XV5A 1E6LA 5JNVA 3F8SA 1DEAA 1XAJA 3LSYA 1A5TA 2DHEA 3QWFA 1TEXA 1SUWA 2I0FA 2PQMA 2HV9A 1D1PA 2Q5LA 3ZTWA 1PJRA 4LYYA 3ITEA 1NR1A 2QE6A 3TG8A 4CEJB 4DV3B 4GOXA 1YK0A 5BSRA 2CJYA 2R6ZA 1X1TA 2WB2A 3FNIA 3L1VA 1QVVA 2WB4A 3PDUA 3FCUB 1Z6XA 3DEZA 1YCHA 4MGEA 1ORRA 2O5VA 2BMFA 3TDNA 3UENA 4NJMA 3EGXA 3LXXA 3T4XA 3MJHA 3A1UA 3RIXA 3L8DA 3KYDA 3ZV5A 3HZHA 5BN4A 1TRKA 1FLAA 3CEHA 4JROA 1ZR4A 2B4AA 3OIYA 2BH9A 3F74A 4PIMA 3L05A 3PQ2A 4P31A 4DJJA 4UTRA 2JPDA 1CY8A 1XZFA 2WU1A 4GM4A 1MRNA 4LQDA 4C9BA 3EHEA 1Y1QA 4F3NA 1I5OA 3K8YA 4D1YA 1ORHA 2ZBRA 1SZCA 2OBLA 3LRTA 3OM1A 4D80A 1FW6A 4S2UA 1RQ7A 3KM0A 3MRVA 2B5OA 4OX9B 1LDYA 4BRSA 3MUEA 3C4JA 4RF5A 5CW2A 1NQXA 3GEEA 5KS2A 1P2FA 4U5XA 3H83A 4L15A 1PF7E 1IN6A 1RJWA 2OBMA 3QKSA 2ODQA 1N2JA 1PI3A 3G8YA 1OOEA 3HYLA 4JS0A 3MQ4A 1DDGA 4QARA 4OHXA 4ZAYA 2WKPA 3EZFA 4QD3A 4BJ1A 2O8NA 3PQEA 2FWJA 2D06A 2VHVA 1YC2A 1V1RB 3WLJA 2RMKA 4FCVA 4GS5A 3T12A 1QCDA 2FOLA 2O0LA 1UFOA 3KTAA 1AN9A 4Z99A 3FA2A 1N0IA 3FCSB 2KQUA 2WDZA 2AZXA 4WCVA 2ZWVA 3L0SA 3L7AA 3Q0EA 2UZ4A 3EMBA 4CQMA 1R0CA 4G8CA 1N5RA 5SY4A 5HJ5A 1KWKA 2GLUA 4E3WA 3RB8A 4FNMA 1AX9A 4AS1A 1QRDA 1NVUQ 3R74A 1Q6YA 2HSJA 3LBAA 1H2YA 3HLKA 3W9UA 2AC2A 2R0QC 1YVUA 3CLRC 3R6WA 1GHTA 1VHTA 4LI3X 1CEYA 2BBTA 3KV3O 2QY6A 3QEMB 5EZYA 3FRIA 1T2VA 3FYUC 5ADHA 4TV8B 2I03A 4FE4A 1CUDA 2HGSA 3C3PA 1R3UA 4YI5A 1W2WB 2Z4SA 3Q7RA 5DBEX 1QP7A 4JT2A 2G9ZA 3WQBA 3ZI4A 3EUEA 4JX9A 1Y1RA 3I76A 1I30A 4PLZA 2W8BB 1K6IA 2PLAA 3UAVA 3H1FA 4UQLA 2R6JA 3DW1X 2WYUA 1BEUB 1HRKA 1HV8A 1FY2A 2B20A 2FOXA 2ZJ7A 3BM5A 3A9RA 3IQZA 4FFMA 4RSMA 5IT9A 2QTBA 5EWLA 4TVOA 3KJEA 3K0BA 1XVAA 2H57A 3B53X 1LFDB 4M0DA 1JXQA 4QUIA 1O4VA 3AVWA 1Z7BA 3LS2A 4G8DA 2V97A 4WKNA 4DIKA 4LZAA 3ZV7A 3GAFA 1N34B 3QM1A 1FF9A 1A8HA 1QUEA 2GHRA 2EL9A 4OKSA 2Q7DA 5DBFA 3ZZ1A 3CVVA 1P3JA 4MW9A 3C5VA 3CXUA 3DTTA 5FLEX 2B2XA 3D8SA 3DDZX 5AYVA 4CT0A 4D4JA 4DVJA 5KO2A 1RRFA 2W0MA 2DQZA 2X14A 2I6FA 3U1VA 4Z8YA 1HG0A 1CQJB 4EI9A 4EA8A 5KDLA 1E2HA 4WNAB 2NZVG 4NX2A 5KKNB 4U7DA 2DKNA 3AU9A 2VT3A 3DM9B 5HK9A 1J99A 3AJDA 2H1IA 4LHXA 3L4BA 2ASVA 2PGIA 4GZMA 1AM4D 1NN0A 2CHFA 1YZHA 5EWJA 2XJ9A 3CUYA 5DBGA 1NMEA 4PE5B 4UW9A 4F4HA 5JNUA 3LI2A 2O06A 1T8SA 1OFUX 5FL7D 3VTKA 3VR3A 4WZAE 1Z39A 3MB8A 4UXHA 3S1AA 3MGKA 3BJMA 4Q4JA 1FC0A 1U3TA 1SHJA 1M76A 3M70A 1QVWA 1G64A 3FFAA 2D62A 4HNRA 3A04A 3ETJA 4PEVA 2YHUA 5CLQA 4WIAA 1FQKA 4AN1A 3U81A 4LJ9A 1H4SA 1ZIXA 5JMWA 4O4JF 3TE6A 3DLPX 3U7GA 2A2ZA 3N3AC 2AVDA 2C7VA 3WTCA 5DM0A 4JZYA 1FNCA 4JV5B 2BFDB 1HETA 3AP2A 1Q0RA 3H7AA 1KEKA 3S81A 2QMUA 3OA0A 1X39A 1QO0A 1RQGA 3B3GA 4JLWA 2ZSEA 1C7IA 3EMVA 1BO6A 2ACWA 2HEIA 3HJAA 5DKFA 1NBMD 1QQ7A 1VBMA 4PYKA 1XGKA 3IP8A 1T5HX 2D3WA 4HQOA 4Q3EA 1SD1A 1YACA 4YV7A 3HADA 5BYAA 1MX9A 2DHCA 3P0IA 3JSXA 3TNYA 1IXYA 4D3ZA 3O03A 1Q3HA 4NXNB 5TPZD 3U16A 2DPMA 2ZJYA 2DMRA 3I2YX 3RS0A 3T1OA 3ZDZB 5HRUA 2H4ZA 3K9NA 2WVHA 4I4IA 3VKFA 6REQA 2NSYA 4CR7A 2QUAA 1TJ3A 4IYRA 2PS1A 2QVXX 2R87A 1IATA 1VSBA 4QUBA 3EZ7A 1H1LA 3EXG2 3HLTA 3AT1A 3DO8A 4IJUA 1R2QA 5AM2A 2QM0A 5LJIA 4RULA 2YWHA 3RAFC 4MQEA 1EFVA 4N1AA 1KDPA 2O7VA 3BKXA 4IVQA 2OGWA 1YB7A 2W6JD 1GLGA 4YJ2A 5DK6A 5TGZA 2GBIA 4H0CA 5KAPA 4C43A 1ZOPA 3HE3A 3I5AA 4IEFB 1TMYA 2F1HA 4LYEA 4NFHA 5CEFA 2WJJA 3IUBA 4PX5A 2Y27A 1MOQA 1E96A 3NETA 1TEZA 1Y4SA 3HDHA 2ZJFA 1E9RA 1BQ3A 4KTVE 1A8QA 1L4NA 1ULHA 2EG5A 1V9SA 2FZ4A 4O1HA 1X7WB 4GXRA 4C29A 2Q1SA 4CF7A 1RKUA 1O95A 1QDEA 1K0UA 1WD7A 2DWQA 3L92A 4BMXA 4ETNA 1X7ZA 3C8DA 1P1JA 2YWRA 3QU9A 4YMLA 1ESZA 3T3IA 1UM9A 1SBIA 3BXXA 4PG4A 3TW8A 4C0QC 4D02A 3FVTA 2W6OA 1Z5WA 3UW1A 2YV2A 5JS1A 5KU7A 1PZHA 3BMXA 1ESCA 2B6HA 5FA5A 5JISA 3LIIA 5IW8A 1KI6A 1U0FA 1UEIA 1OXVA 1J06A 2A9VA 2BFMA 3HGMA 3MGBA 4OSOA 4QOFA 2IPMA 1SA0B 3DBLB 4E09A 1LU9A 3ME5A 4XJVA 2W9XA 4YJ3B 5I47A 5JAQA 1XKXA 2MR6A 3OWXA 5J4HA 2BKAA 2CGEA 5BY2A 2ZPTX 3BTVA 2OM2A 1FMLA 3WWEA 2KWIA 3MA0A 4N76A 1QV7A 4L0QA 2WYOA 2NU9B 4A26A 1VLQA 2FPPA 3FXAA 3RHZA 4EOGA 3QSYA 5EQDA 4HXGA 4OK5A 4JJ6A 5LXTA 1IONA 1LBQA 1U7WA 2I2CA 3A6KA 3CZ4A 1IN7A 5KHAA 4GXQA 3GGGA 4IVNA 5JS2A 5IABA 1XD8A 1K9VF 1RYBA 1QYVA 1Z4PX 2NX2A 2AR7A 5G1PA 1ZAYA 1Q50A 1SC9A 2GK4A 4FMDB 4HGZA 4LW8A 4B7ZA 4GMFA 4CIAA 2QPOA 1VFPA 3H2YA 4DR4B 1FTNA 5JXHA 1M2KA 4PBTA 2VPQA 4LRUA 2QTCA 3KOYA 1XZGA 2IZOA 3IKTA 3V46A 4ECAA 1LW6E 1WB5A 2F8LA 2GETA 2I4LA 2X2PA 3LLVA 4HMQA 3KOZA 2QU7A 4RKRA 4YROA 4A2QA 3NHPA 4MO2A 2UXCB 5AUPB 1BXKA 3IEMA 1P0IA 3VX4A 2KS6A 5D3QA 2C96A 4ZI3A 3JSAA 3FVQA 3LLUA 2O5CA 1MFPA 4HYEA 4F3RA 1NBAA 5KCZA 1T1GA 3SHWA 1ZOOA 2BTQA 3E8SA 5JADA 4MVJG 5AJUA 2FPWA 5EE3A 1HA3A 4A6DA 3SZ3A 4GSLA 4DA7A 4V0ME 3RC8A 1IC6A 3ZXXA 5JAOA 1F5SA 3ENWA 3L6OO 4DIEA 4NL4H 1UADA 5K45A 1JLLB 4E5DA 1E6WA 4CLRB 4QDXA 4YFVA 3ET5A 1GPDG 2D5AA 3T5PA 5I3ZA 4YIHA 1QHSA 1A95A 1UWVA 1QK5A 3I37X 5C37A 4ZEOA 5D6NA 3EVZA 4K9OA 3GJXC 3EEOA 3K9QO 3WQRA 1XG5A 1HKUA 1JQ5A 1IJEA 3QSGA 4NBRA 3ZW8A 1TEHA 2HF8A 4HEA1 4GKJB 1HWYA 2AZDA 4QNNA 3SYNA 2YUIA 1KJZA 3GJTA 1XDSA 4DV2B 4OAOA 4ZKEA 3WGUA 4RYDA 3R0JA 1GA6A 2AG5A 3QVUA 2HZ7A 3KEOA 2JFNA 3BTOA 4EKGA 3A6EA 4O1MA 4CMJA 4D3YA 5LB2A 1OAAA 2H4HA 4YDSA 4V38A 1J2YA 5I9MA 1JAXA 1FTYA 1MJGM 3CJRA 2WV9A 2JVJA 5I7EA 4FS8A 3VC7A 6NULA 1QQ6A 4ENTA 3D7NA 3F6RA 3LSTA 2Z6AA 1PK8A 2HBRA 1BXZA 2F8SA 3A1NA 1EP2B 1GRRA 1DXHA 2ZSUA 4XR4A 4EX7A 4OJNA 2R86A 3BMCA 4KLCA 4ZCMA 1JQDA 2O2XA 5ALXA 1W4CA 2Q5HA 3D59A 3FCXA 1MC8A 2WT4A 4ZRMA 1CUJA 4MWTA 3ZCRA 5ALVA 3OE1A 1RLUA 2REQB 3EXEA 2OV1A 3Q7PA 4B47A 2Q6IA 3RVRA 3TQCA 3K09C 1KZHA 1FXUA 4CV1A 2OLEA 3E7WA 3DF7A 1E79D 4OFZA 3UJPA 1GRCA 1NNUA 3FAZA 1C2TA 2GA9A 3AL3A 1SCQA 5DCLA 4J1TA 4MQBA 1ENOA 1TCUA 4A2PA 2F59A 1R6AA 3H97A 3H99A 2XSZA 4HWKA 2HBZA 2FW6A 5EFOA 3I2FA 3AERB 2EBUA 3SYRA 4BO1A 2P9JA 4PGMA 1TNDA 2XXJA 2A94A 3BBPA 5LQJA 1USUA 4PAGA 4OXKA 1JILA 3OIGA 2FZCA 3IALA 3Q87B 5DIFA 4DOMA 3ZDFA 3ESYA 4YV2A 2XCOA 2LIVA 5JMPA 3IQHX 5HOEA 1KAMA 1XK6A 3HU1A 5DV9A 5DM70 5CFPA 5AP9A 4DLSA 4BJ3A 4PY2A 2PR7A 3V7UA 1J8YF 2Y77A 1Q1EA 1P61B 3DL4A 3GDWA 5CGZA 2R79A 4MW7A 1QGAA 1BMTA 2EP8A 4QXRA 1M0WA 3AH8A 4MW5A 4AC9A 3ICOA 5JQGF 2JW5A 1QIFA 3AIIA 4HFNA 1VOTA 4QBTA 2YY7A 5EP4A 1YS7A 4PTYA 4A03A 4BC1A 2AEEA 4BFYA 5K99A 2M98A 5C32A 2WY2D 2MMGA 3I3OA 10MHA 3FGOA 1N5MA 3NRCA 4F9FA 2AZMA 4HAUA 5F1YA 2P2ZA 1SQGA 3ND5A 3HN2A 3PGXA 4WINA 4F1JA 1TT5B 2ABWA 3HDVA 1CRPA 1CLUA 4XQEA 5T5QA 1W36B 4E1VA 4ISBA 1GFSA 4DUYB 3ZJUA 2PUDA 3HTXA 1ZL2A 4BFXA 4YCCA 4OOEA 1IJFA 2EYQA 3BXZA 1LS6A 3W6UA 2MINB 3SP1A 5KX5F 4F92B 3C5WP 3MW8A 1ZSVA 2SCUB 1QGOA 1KI4A 2VP3A 3W34A 4F1KA 4JJ4A 3ZW7A 3MTQA 3TQSA 4Q24A 5ILGA 1FXSA 4AN0A 2UVQA 2JJ2D 3Q9SA 1PWZA 2GTIA 2MJLA 3OZEA 5TMEA 3RE1A 4EY5A 2YN0A 1OU0A 1GL6A 3HCRA 4ZI7A 2OC9A 5F7JA 1GZUA 2BBSA 1RYDA 3BDAA 3OM8A 5DNEA 1TZBA 2NUTA 4CV0A 1RI2A 5KWVA 4YRRA 4HSEA 1CTQA 3E1GA 3QXGA 4OIFA 3EVTA 3OJFA 4ES6A 1XU9A 3FB4A 2JHPA 4MUMA 1L4HA 3PQFA 4F3TA 1H6AA 1AQNA 5EHIA 2ECQA 3JQAB 4FINA 1UP7A 2X7XA 5HXAA 3TLGA 3RAJA 3IXMA 4NKRA 1THMA 4GE3A 1XZMA 2FE4A 3ROPA 1TZJA 2OUIA 3EWIA 5IMSA 4JCOA 4KRXA 2IUTA 1N0UA 4WLNA 1OLUA 3HKCB 1KYIA 4EJSA 3ZI0A 4TTTS 2PH5A 1Z45A 4ZIRB 1D9ZA 1JMYA 1K7SN 1QWSA 4MVJP 3SQOA 3PICA 2JCBA 3CS3A 3DWEX 4YDRA 5HKOA 5ITSA 3UYKA 1U04A 1WKVA 2QYSA 1H3NA 2Z0MA 5ARDA 2WNHA 3KQSA 5DDIP 3ER6A 5KPDA 2IS6A 1FPQA 5FFNA 1L5FA 1ODLA 1X70A 3ZKWB 5IZCA 4OQQA 5C4GB 1QK4A 3UOAB 2JKZA 3S2ZA 3T34A 3QIAA 3B1YA 4LN1A 2VI5A 4BV9A 1DTEA 1V2HE 2C5HA 1UK6A 1VI6A 3IP9A 1NBHA 2IPXA 1WCIB 1W96A 1AXEA 3KKQA 4R2LA 2QGZA 5DNVA 3RTBA 1YDFA 2BI7A 2GDJA 3AVYA 1T6BY 1P0QA 1R5NA 3WLIA 2I3AA 3U3OA 2ZTLA 4IGFA 2XRFA 3IRVA 2QMEA 5D5PA 1SIWA 3THSA 5BSTA 2WG0A 4HQ6A 1KKUA 3O2JA 2Q9AA 3RODA 3T5BA 3C6KA 5ADUS 1H6BA 2JGJA 2JJ1D 4KK3A 5KZMB 1E5TA 2Z6QA 3RRBA 3O93A 3PEYA 1F6DA 2IK8A 1NP6A 2OGSA 3IOCA 4ZWNA 5H59A 2VHEA 4ZMBA 2Z2JA 1X38A 3WMEA 3ILHA 1V8PA 3M4XA 4OK6A 1OWLA 1DU4A 1JU4A 4BAZA 1A04A 2CB0A 2GB4A 2W43A 3O2SB 5AM1A 2FPRA 4CU2A 4NNOA 3MHPA 3D4NA 1KORA 3EF1A 4EFKA 2CUTA 3DTNA 3ICQB 4UBOA 3MOGA 4PQGA 3ZQ4A 2N1MA 3NQ41 1EX7A 3CURA 4RZXA 2JKVA 1PNQA 1T0PA 1FRNA 1THGA 3B7PA 2YWBA 4OJMX 3D2CA 3CTMA 3BL6A 4GMDA 5GGXA 4JI2B 1W48A 3RS5A 2X1HA 1YFKA 5DHFA 3STWA 1M7BA 2WJVA 2D2XA 3C7AA 4J7XA 1ONSA 4NCNA 4AIIA 3HPQA 4R8VA 3BH7A 2MDTA 4IIFA 1KDZA 3H8SA 1WE2A 3NGLA 4LSGA 5FNVA 1HPLA 4X91A 1ADYA 3FNQA 4GOJA 4W5WA 2O3SA 4LA4A 1S2DA 4NQZA 1QHFA 3PHJA 4XQ0A 5B58C 2DOKA 4WH0A 4RA9A 3EZ6A 4OI1A 5TQ2A 3ROGA 3CNQS 5IASA 1FNBA 4P4GA 3FLEA 2XMZA 1C8LA 2G9QA 4PHGA 2HC9A 3FRHA 1KA9H 2OHIA 3D4OA 3JVUA 3OIDA 3EGXB 2OVFA 1N57A 1SVNA 4NJMB 3PXXA 3GJYA 4IXDA 3TZEA 1NYTA 4PAWA 5DFAA 5BO5A 3UXHA 4ND4A 3CJTA 3G9TA 4MR7A 5CHYA 5DW0A 4XLTA 1ZUHA 2D5IA 4ZYVA 1E2KA 4NULA 2O5EA 1JLSA 2OP0A 2IUUA 5KHLB 1Z2PX 1H69A 3UB4A 4NH0A 3LNCA 3DTVA 3K1JA 2OGUA 3A3PA 3NB0A 4P3NA 4DZZA 4QWMA 4HOYA 1EGAA 4V3BA 4QU9A 1LTQA 1YB5A 2JHAA 3AESA 2OA0A 1FJGB 1ODIA 1B3RA 4DRYA 1UC9A 1KYVA 1VE3A 1B15A 2F1IA 3G2JA 4PCAA 2O14A 2X5NA 4BWGA 2D5BA 5J58A 5HS6A 3QKSB 2DTDA 1X9IA 2WM8A 4UPDA 5F35A 4MB2A 4UASA 1T1JA 1JIQA 5ELLA 4AECA 3GJ6A 4UULA 1SQ0A 3SQDA 1EINA 1SN7A 4CDGA 4M36A 1X80A 4IVPA 3TLAA 4MR8A 1XAIA 4X94A 1I2DA 3KTAB 1M1XB 4FK8A 8GPBA 3K5HA 1UWLA 3DAGA 3LM8A 5JNTA 1XTIA 1F8GA 3DR3A 2FN4A 3LUAA 4RK7A 3EEIA 4L8LA 3RS9A 4CQMB 3CUUA 2PUCA 2IZZA 3TBKA 1UPXA 1IULA 4KXFB 1H2WA 2Q3DA 1O3YA 1X1BA 4BZPA 1WHSA 1S2NA 4Z9AA 1ZVKA 2VTEA 4DLBA 1VCNA 1F2DA 4CF3A 1EK5A 3IT1A 3MC1A 5FBHA 3ETNA 2JGNA 3ZD8A 4E5YA 1SVSA 5HFJA 2DY1A 2FX3A 2FN9A 1RHKA 1HSOA 4OATA 5T8KC 3WNZA 2HKIA 2WEKA 1DDIA 3AB8A 3A3YA 5TMDA 7MDHA 1P29A 2R7AA 3INTA 3WAKA 1CDEA 3KKNA 3MWFA 1BH6A 2IV2X 3UBTA 1MV5A 1QZ3A 3VTFA 3AM4A 3ENNA 2BPOA 2ZVPX 1Q17A 4J1QA 4NYMQ 5HA5A 5E7MA 5KVAA 1XUOA 1JHDA 4ZI5A 4Z3OA 3EQZA 2GF0A 4RH1A 2C9YA 5EWLB 4KAJA 4OBXA 4XM1A 1JJIA 2XNJA 1R7RA 1M10A 2QJWA 2YOGA 3AF2A 4EIWA 3WLQA 3EHDA 2RHHA 1CY4A 3U3ZA 3HDQA 4AM8A 4COKA 3P5SA 4GDFA 2J3MA 5ED0A 3HNRA 4AN4A 3AQIA 3PEEA 4K6HA 4UFOA 1GITA 1KGDA 1UQRA 1WABA 5DYGA 4KPGA 2YC4C 3PLRA 3H0KA 1ODTC 5LOVF 1Q1GA 2NO1A 1Z3CA 4EF6A 1FQWA 5AM3A 1GUBA 4ZQCB 1CNFA 5P8WA 3TZBA 1AURA 2H8KA 2P91A 3MK31 4RTRA 4BXOA 2W6ID 1C1DA 2CF6A 3SX4A 3TM5A 1H0RA 3LP6A 1IOVA 4LGVA 3ZWCA 5EWJB 2QTLA 1G7TA 2VYCA 2ZFUA 1XJ5A 1P62B 5C80A 3UJ7A 1R1DA 2KI5A 3QPUA 4UBNA 1SOVA 1E62A 3S1AB 3VX3A 4RHCA 4OQPA 3IP3A 3T15A 4Q4JB 1Q12A 2GM3A 4BRUA 3NX4A 4PYJA 1Y9JA 4ZKDA 2IE8A 2FW8A 4WCFC 1EBUA 2M6RA 4BO5A 4ZHQA 3WKCA 3U6KA 1TU3A 1DBSA 3GEBA 3M2TA 3N39C 4CG0A 2K7FA 4L75A 1PIWA 4CL8A 4D97A 4TXNA 3AR7A 1IPHA 5THQA 1KXZA 4MK4A 1AMNA 3DLTA 4JYZA 2RK6A 2HJHA 4UVDA 4ZYYA 1FU7A 2X58A 1SZJG 5AOVA 1N9GB 2JKYA 4NS1A 4BGUA 2B7BA 5FPKA 3LDFA 1YQXA 3JD3A 3LX5A 4PN3A 2C7PA 2VAWA 4B8WA 4WK6A 2JGEA 3MTJA 4XE5A 4YRNA 3WDLA 3LECA 1JIUA 1PT6A 3B1FA 3OY2A 4UTPA 3UJNA 3MSXA 4MLPA 1U98A 6REQB 5JSYA 3AFNA 4MDFA 3BXFA 4R9RA 2QE7A 3VAYA 3LPMA 2PKXA 1ZO8A 2PSFA 4ITUA 5FWYB 1T91A 3L7JA 3TPCA 1H1LB 1W1UA 5EZ5A 5EIBD 3KZNA 4YPVA 2JFBA 5FXMA 3W5JA 4DSNA 5JJIA 4MB6A 3EEFA 4RVOA 1C8VB 4QODA 3KCNA 8LDHA 1HEUA 1QGDA 2JFYA 1ZJJA 2PCJA 3PUWA 4WOKA 1YRYE 5ERGB 3INRA 3UQZA 4A6PA 4A2WA 3TW6A 5BWOA 2NZ8A 2EKLA 4CLHA 3THXA 1TFUA 1UCFA 1BJRE 1Y34E 2CMFA 2H5LA 4KWCA 4RAQA 3SBOA 3W8RA 2QUHA 1USIA 3WYGA 3GP8A 3VKWA 1ST3A 2BUAA 4OBBA 3A0RB 4XGIA 1ULSA 2BFOA 1KYXA 2R6HA 3KU1A 4XGKA 3V2HA 2ZR0A 1RRPA 3C2QA 3C8HA 1MJGA 3HFGA 2D00A 5E7IA 3W1VA 4CTKA 1DUIA 3CXRA 3H5WA 2FDCA 4DB2A 4AKIA 2QG6A 4L50A 3TLKA 4IO0A 4B6EA 1CR2A 3F47A 4G4IA 4RJTA 5LR6A 2WJHA 2XWSA 1CUVA 1CZUA 4MYHA 1VI5A 1X7ZB 3GN2A 4E46A 3RNLA 2QL6A 1TEVA 3ML1A 1UM9B 4HNQA 4HVAA 1LBHA 4UMVA 4WLUA 3FNHA 3OX2A 4WNCA 1SXJD 3TW8B 3KLMX 4ZCIA 4MDHA 6CHYA 5A5GA 3WIVA 1DJMA 1I4DD 2JZCA 3E9CA 1KI6B 5JRJA 1UBSB 1YQQA 2PRZA 4I50A 2VHXA 3M4ZA 3P0RA 3LQRA 4G86A 4PLGA 3ZE8A 1KK0A 5KQLA 5FOSA 2JD2A 3M5CA 2FZVA 4S24A 4CGYA 4W5OA 5DTIA 3DYIA 4HWOA 5ECYA 1NDHA 1QIDA 3AY3A 3I53A 3I8XA 4ENRA 1ZR2A 2M6SA 2DHRA 1EJBA 2CMHA 5EUBA 3TIXB 1DIBA 5C53B 4RY0A 3MPUA 1SHLA 1T3LA 1S2OA 4QEKA 4ZVVA 1LD3A 3P94A 4B3BA 1TKCA 3EVCA 2WWHA 4TUYF 3PNOA 3LXMA 1U5BA 5LXTB 1JR3D 5P21A 4AG3A 3PDIA 3IA7A 4JGBA 4LF5B 1QG6A 1JPUA 4ETMA 3OPYA 4BNXA 4DIOA 1TYBE 4XIYA 1U9IA 1WQ4A 1EDBA 1LXCA 1Y9DA 2JGDA 3L8ZA 3OJEA 4URZR 4V0KA 3FN4A 3NPMA 4B32A 2UVPA 1V0JA 3ELYA 3TLMA 3UMFA 2W5UA 1KERA 3CZPA 2DKOA 5EYPA 5TSDA 3ZYCA 3CE9A 3CR3C 2X7JA 1TLFA 4NG5A 3M0EA 3UUEA 2BTQB 3WFIA 3OP4A 2Z3ZA 3PRHA 2JFVA 1DIRA 1OA1A 1QJ4A 2GD6A 1T5TA 3O31A 5CCBA 3WJAA 1R10A 4QTTB 1UFVA 1QKJA 4PGGA 4BNMA 3NDRA 2B30A 5EJ4A 3FSGA 1FUEA 1MAWA 4PQYA 1BEZA 1NW5A 1B41A 4RIHA 2XNDD 1ZVMA 1ETHA 4FEEA 4OUDA 3HZRA 2ZYIA 3KQWA 1BGWA 5FAXA 3O7WA 4UU8A 2VRCD 1C30A 3AG6A 1VHQA 4RJ2A 3NT4A 2VEOA 3WBFA 3ZLBA 4CMCA 5C8DA 4JDUA 3CRMA 3GPLA 2C7QA 1NJGA 2NTJA 4BB9A 4RHYA 2G88A 5EFZA 4KLAA 1HFWA 1BU8A 4QOHA 1YU6A 2YFQA 5LZ4A 4P3XA 2A35A 2ZROA 4GD3Q 1CHNA 4UBLA 5CYPA 3K6SA 4MDEA 4UUAA 2BKLA 1ODJA 3M9WA 3JVDA 3WYAA 1CZLA 4XDGA 5FBKA 2VWQA 4Q15A 2PSHA 1Y98A 2DGDA 1RE0A 3C45A 3GQVA 4RK5A 1E1KA 4YCJA 1C3JA 4BWVA 2VK1A 1ZX1A 1L5MA 3ADKA 4LJ8A 1RRCA 2V0CA 3L6CA 2PUWA 3Q9LA 2ZRJA 4TWRA 4X65B 1SKMA 2HW8A 3K70D 3GPBA 1A5SB 3PHHA 3T3EA 4FXPA 2PZEA 3I9OA 2BWJA 3DF9A 3IT0A 4IFIA 5TXGA 3FOWA 5IDQA 3FDIA 3U7FB 1UDBA 2AB0A 3B1ZA 3H1GA 1P45A 5M3BA 4F9GA 1NR7A 3BRQA 1QGED 1RS0A 1S6YA 4I5DA 3I5YA 1HC7A 3D2LA 3IR7A 5F51A 5IXJA 1PQ4A 3AK4A 3Q12A 2AS0A 2FZLA 3A6FA 3IHLA 3LYLA 4TT3D 3NVAA 1SIBE 4WI1A 4NYJQ 3W79A 1Z8HA 4U2EA 4CCWA 3FAKA 3I6IA 3ZWPA 3L6UA 2DHQA 2PZMA 4E2WA 4EG1A 5HBRA 1S9DA 2O20A 2VA8A 1X7DA 3AVPA 2PNFA 4GLLA 2JDIA 3PUZA 1KJ9A 4QOEA 5DO9A 2NSHA 1QDUA 3ZHXA 2FUNB 3TB4A 5K03A 4UE6A 4X71A 2V7QA 4ROTA 3G0OA 3IIIA 3U4CA 1XPOA 3PITA 3WP0A 4FNOA 1DFHA 1R6UA 4DWJA 2AMJA 4QFCA 1DBWA 3G9QA 2XUOA 1BFKA 3U5ZB 4MJ7A 2PS9A 2IH5A 4OIMA 2ZYHA 3ZDDA 3EF3A 2O07A 2QN9A 3KJXA 4AJLA 1RAAA 4L3VA 4PPQA 4XVCA 2IQ5A 4JUDX 4I1YA 2IYOA 1IWBB 4OL0A 4UE3S 4X6UA 3LXUX 2CLHB 1EXNA 1PJZA 4LE0A 4YP5A 3NC4A 3FNFA 1RACA 1XZ8A 2HY7A 4NQRA 4Z3KA 1GYRA 1WV1A 4ESOA 3FOAA 4OM8A 4IJ6A 4DIUA 4QFDA 3H1PA 1HYHA 4Z0TA 2O0MA 5IX8A 1AGRA 1NI5A 3I28A 5A4FS 1U3WA 3QNMA 1G2PA 2B0CA 5CLIA 3VTZA 4XOUA 4UDNA 2H4JA 1O9HA 5K4HA 3KHSA 1VMDA 4GPD1 1GN9A 4OCZA 3OPYI 1JVBA 3BPSA 3KUKA 3Q3CA 3UT5A 3YASA 2P2SA 1PHRA 2G09A 3DKPA 4IDHA 4AF6A 5IDXA 4P7KA 1TX4B 2AHOA 2GD1O 5E6SA 4MGYR 1F6BA 5JNWA 4HDMA 2NV2B 1G7CA 1O5IA 3FLMA 4GSKA 4LECA 4P32A 5IM5A 4BTVA 4RTMA 1XDUA 1OSNA 4YEDA 4XRGA 1WUIS 3W5SA 2BDUA 2FHSA 1OR8A 1HMPA 1N6NA 3HH8A 3DDWA 4N6GA 3TVTA 3QY0A 4QU5A 2IF0A 2NUTB 2PRJA 5JQGA 4RGBA 1VPVA 4WZAA 1KEPA 3EOAI 4EPTA 2Y0EA 3HCEA 1VLZA 5EI5A 3LDAA 2GN1A 1J2EA 2GWRA 4ML3A 2PHZA 4YMGA 1RYEA 2NM0A 4CMAA 4FFRA 4GOLD 4PQFA 4QEDA 5FTJA 5AVXA 3AY0A 1P6QA 2RC5A 1I2MA 3TLGB 1T1EA 5FI3A 4TT8A 4RWZA 1S7CA 3N2EA 1YONA 3HYNA 3SJCA 4LDRA 2Q0SA 3TGPA 1B6SA 1OLUB 2IOQA 1FLDA 4C1BA 2FMXA 2Q1XA 5KX5A 3GCGA 5DRTA 1XRRA 1NGSA 4HLQB 4RMJA 3ZVRA 3T7IA 4GW3A 2XZLA 3PI7A 5HKKD 1PLJA 1ZUNA 2ATXA 4I0WB 1OIVA 3OQMA 1WCXA 1PYOA 4HUQA 1Q11A 1N5DA 1POWA 3D4LA 1NNLA 4JLKA 1IB0A 1ULTA 4K9NA 4XOIA 3RRMA 1PP4A 2PMBA 1V6SA 3KR1A 1R5JA 3QLUA 1TQDA 2GZRA 4KN9S 2Z04A 4LQ4A 4DADA 1P7CA 1EWVA 3R3XA 5KHOC 2E1RA 1QYIA 4L5YA 1N9ZA 5A3QA 4OH7A 4QYMA 3GC6A 1Z16A 1P2TA 3B36A 5J2TA 1DV2A 3VU9A 5AHRA 2GN8A 3IP7A 2ZEJA 1JSCA 3MNFA 4MYTA 1NMZA 5H1YA 2HJRA 2VHWA 4FEYA 3Q8MA 2HT6A 4JMPA 1SVUA 3HWX1 3QU2A 3UXEA 2QXYA 2BGUA 1UQTA 1GNPA 1B1AA 1Y6QA 1BE0A 2NNWB 3O3MB 3Q8XB 4QXAA 4V0LA 5EIFA 3VR6A 3W4KA 3O1HB 4BO8A 2FF7A 1CW2B 1ZL0A 1WQ3A 4KDFA 3CMMA 4LTNA 4D9FA 4DNQA 1AO0A 1PJAA 2GVZC 1VGRA 3CISA 4CKBA 1D6MA 2CC2A 2RAVA 5FCDA 1XE3A 2NQTA 2ILTA 4IINA 4TGLA 1A71A 3ETHA 4Z51A 4X6XA 1CFJA 3B85A 2JH8A 3TFOA 3LKZA 1RQXA 1TW2A 1AMUA 1E2NA 2OCPA 1J0BA 1BGXT 1R4NB 2AEFA 5I4BA 2OXRA 4CMBA 1V43A 1ZWKA 4WRRA 3OTWA 1BOOA 3K0AA 1A0OA 1YZFA 2DKFA 5A9SA 4BLTA 3P9SA 1OU4A 2FPOA 2PV0A 3KJGA 3LGXA 4YAJA 4RAOA 1EPUA 1T15A 3CLVA 4ZK6A 1P4HA 3O82A 5CYFA 1XRJA 4K6FA 3CB2A 1TQ6A 1NXVA 3PF8A 4LMRA 3TSAA 1QR6A 5FNVB 1X8KA 3VUEA 4MLCA 1XP8A 1YF3A 3PSAA 1TL7C 1PX0A 2RI1A 2AOWA 3UAGA 5EQTA 4Q19A 4FS3A 5GZ3A 3HXOA 4RA9B 3GLKA 1VL2A 3CY6A 4F6CA 1RRGA 2I4MA 4EY7A 5TQ2B 3IVAA 2JCYA 2PLNA 3SZGA 3C1TA 4M2LA 4X9XA 2AG0A 1W25A 2H7VA 3DFKA 1UDRA 1XXHE 2FEOA 4UMFA 3VBEA 3GVPA 4BKPA 4DCOA 4DNOA 3FW1A 3RPEA 4HSGA 1IXRC 2B98A 2VL7A 2E2WA 4PX2A 1FUIA 4YAOA 3GNTA 2PUVA 3F6BX 5F1KA 3W2EA 3E8MA 3OCYA 5TE9A 1Y7HA 1HNNA 5KOYA 4DDTA 4AF8A 3L1UA 3B7WA 3E15A 3BGWA 2JBHA 4BBPA 1UPUA 4R01A 5B55A 3LMKA 3WQQA 2H7YA 4F2WA 2H9IA 1I10A 3KE9A 1W6UA 1L1RA 3DTVB 3HV0A 1FVHA 3QNUA 1R6TA 2B61A 1XX6A 1SJ9A 4U0JA 4U7WA 5KQMA 1LSSA 3AESB 1JLKA 1NVMB 2YYYA 3VOAA 2JEYA 5MF6A 2OVBA 2DLNA 2I6UA 5HF8A 3UK7A 4TPKA 1WSDA 4XXHA 5TV2A 3SC2B 3AIKA 5EIBC 4KR6A 3G79A 1TIKA 4X45A 2PL9A 3PQ8A 1AK1A 3LNTA 4O2BF 1HZZA 4IH4A 4QG7A 2PRKA 4GQIA 3UWMA 5E2IA 1GFIA 1I6KA 4J75A 3WLHA 2IIBA 4MR8B 3FOFC 1GGKA 4FM9A 3TS1A 3UJBA 3KVYA 3N2GA 4ZO9A 1G3RA 2GZHA 3AO0B 3ESAA 3L1JA 1FU8A 4LYDA 1TCVA 1VA5A 4DJEC 1GARA 3QVVA 1OVGA 1B0PA 4FSHA 2KX7A 3VR5A 2ZUBA 4ND2A 5BR4A 1FP2A 3RADC 2WDPA 3D64A 2ES4A 2CDCA 2AE2A 4X8MA 4UTOA 1DHTA 3GJSA 4G0VA 2F00A 2IYNA 1R0XA 4HXFB 4OQMA 1NWHA 4LQLA 1WHSB 2EKZA 5CT6A 5FHQA 2QB5A 2GNPA 3Q5EA 4JLMA 3ZD9A 1JQBA 1U7PA 4IR7A 4G8BA 2Z57A 3SSOA 4G1UC 4KXXA 5CIQA 3NYIA 1T5SA 1SXJC 3GFQA 1WO8A 3B5EA 5LKAA 3FBWA 3NONA 3U7EB 2P9YA 1OFGA 3FCOA 4G67A 4MQ5A 4U9HS 5IAGA 4I5IA 4QT4A 4IHJF 5HKAA 5I6DA 2LP4Y 4RTJA 2ZULA 3CSDA 2H16A 2W2XA 2GT1A 3JY6A 3OZXA 3VNUA 4FDAA 3ZGVA 2GERA 2EJCA 3DMPA 1XQYA 3DBHA 1ZD9A 5TS3A 4I8IA 3MS4A 5AESA 3AOEC 3MCWA 2P9QA 1TA0A 3FM9A 5KDOA 2O8BA 1DRVA 1AXGA 4MUFA 3T94A 1Z7YA 2ADOA 1SUDA 2E87A 4QSHA 3WY9A 1KMQA 2AJ8A 3W2IA 5A2QA 1QOPB 1KVTA 1U81A 1D6SA 1RNLA 1V6AA 2MOKA 2YY6A 3BWVA 2PGJA 4FLMA 2VJKA 4JB8A 5AXAA 2I1LA 3QE9Y 2VRNA