1S9DA

Arf1[delta 1-17]-gdp-mg in complex with brefeldin a and a sec7 domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
161
structure length
155
Chain Sequence
MRILMVGLDAAGKTTILYKLKTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/exchange factor
molecule keywords ADP-Ribosylation Factor 1
publication title Structural Snapshots of the Mechanism and Inhibition of a Guanine Nucleotide Exchange Factor
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 155
sequence length 161
ec nomenclature
pdb deposition date 2004-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s9dA00
4GT1A 4ZV4A 1XD2A 3BERA 5J4VA 1OYWA 3QY0A 5AUOB 5JWHA 2QMHA 1E1RD 2WWGA 2P6RA 2NZJA 3LLMA 2FSGA 3OF5A 1IXRC 4JKYA 5JHGB 3U7EB 4Q4JA 1N6OA 1CTQA 4QGAA 2JLZA 3RSLA 4ZDKA 2HLDA 4URXR 2ZRBA 5L3VA 1IN4A 2WPDA 1X3SA 1KO1A 4HZUB 1W0KA 2GJAA 4IOJA 1U8YA 2OFOA 3P26A 2E9SA 2Q21A 5JS7A 3IGFA 8OHMA 3QUSA 2MMGA 3MD0A 2ZM5A 1Q21A 3CH5A 2PZEA 4BWYA 5FBQB 1XXHA 1XJCA 4BPBA 3C7KA 4Q00A 1A1VA 1TNDA 3CR8A 1PV4A 2A5GA 1Z07A 4B73A 3DZDA 3PUWA 4LPKA 2ZRPA 2FU5C 4GI7A 2ZSFA 4B75A 1VKJA 3BS4A 1E32A 2FSHA 1SHKA 1MRSA 3MSXA 1FP6A 4YMSA 4XVRA 3SHFA 3TQFA 3PUYA 3C4JA 2N1BA 2HDNB 1NIJA 4M53A 4A0HA 1IQPA 1XRJA 2EYQA 3BXZA 5FOWA 2P5TB 4M8NE 1R8SA 2J0UA 4QGGA 1TU3A 3MUFA 2VYFA 3SC3A 5F9HA 5JSZB 4G5OA 1XZPA 2GVZC 4KV9A 1JBKA 4WW0A 2ZUBA 2ZR7A 1OIVA 4MRVA 1SXJD 4GZLA 2ZRMA 3KKQA 2J3EA 3IO3A 4K81B 1KO8A 4B3CA 4HATA 4BZXA 3LDAA 1UEJA 1N6PA 1W46A 3QF4B 5J5CA 1PLJA 4Q1FA 1RZ3A 2G83A 4FW9A 5DIFA 3WBJA 2R62A 3K70C 3CF2A 4BFSA 1LFDB 1ZMXA 3SZRA 1G291 2VH5R 1N5LA 4YDHB 5SZIA 1KZGB 2Z6VA 4C0LA 2OBNA 2BIFA 2J41A 2VTKA 2BDTA 3WNBA 2O8EB 2ATVA 1QHHB 2FGJA 5CLQA 4OHVA 2ZJZA 5D3MA 4IVRA 2PZGA 3S1AA 2WOOA 3CRMA 4RY2A 4TQUS 1FTSA 1I2MA 3EPJA 2IA5A 1GNQA 1HTWA 4FCTA 3KQKA 2VIIA 4ZPXA 1XCPA 4FINA 1O3YA 2QAGA 1E9DA 2QZ4A 3QKRA 4IW3B 4KJZA 5FL3A 3TIFA 5CM8B 3OEED 1KIMA 4KFRA 1M34E 2XB4A 1L2TA 3TLXA 1E2NA 4OQMA 3BAFA 4OK3A 4ESVA 4Z1MD 3ZGXA 1G3QA 3K0FA 2XZPA 3TUJC 3IBGA 5BN4A 2MSCB 3ADKA 2GJ9A 4D6PA 1GTVA 5CK4A 1OFTA 4MGZR 1Z63A 3QPUA 4GDFA 4LHWA 3U7GA 3AB3A 2ZRIA 3VHLB 1N6KA 4OYHA 5KU1A 4DLUA 2BBOA 2EW1A 3RRZA 5DI3B 4NP6A 5E7IA 1WMSA 1T5LA 1DARA 2TMKA 621PA 3BE4A 1BKDR 1Z08A 2C77A 4DT1B 3OAAD 5FUXA 4JS0A 4V0ME 4LUCA 2GXUA 3NBXX 2XGJA 1WA5A 2WWHA 4PQFA 5AR1A 3CF6R 1CXZA 4RFVA 1CR0A 3X1YA 4PZYA 2DWQA 2J9RA 2RMKA 1YR6A 2IYWA 2D06A 1AQYA 4XSGA 4BLOA 4DDWA 2JGNA 5GADl 4US0R 5LD2C 4MA4A 4Q1CA 1XMSA 1G5PA 3NDBB 3AF1A 1U90A 2QTFA 4PX9A 3LVRE 2YC2C 1XMJA 1NSFA 1VIAA 5IT5A 4II7A 3X1WA 1OB2A 1R10A 2ERXA 1YZQA 2EWWA 5EE3A 4CEHB 1AIPA 1GFIA 4ZKDA 1GP2A 3OEHA 5C4MA 1E9BA 2FFAA 1W2HA 2HJVA 2RGGA 5JS8A 1U81A 2DB3A 1TQ2A 2DFNA 3NTUA 4J0QA 1TX4B 3LRPA 1F2TA 5JHHB 1S2MA 2ZI9A 4PAMA 3QXSA 4TMTA 1AJEA 2JJ2D 1VYTA 2XITA 1VTKA 3OZXA 3W8RA 2ZR9A 1OLOA 4IOKA 4XSHA 3G5UA 1ZAKA 5DI9A 2NO1A 2O5VA 2Z43A 2ZI4A 5EE0A 4BFVA 2V9PA 1N6IA 1X6VA 2K5UA 2GF9A 3OIVA 4RFSB 4LYFA 4UNPA 1NVXQ 3RWMB 2FG5A 1T3HA 2CE2X 1NJGA 4M9XA 1JR3E 4TQAA 5E95A 2J59A 2QGZA 3VR5A 2ZJ5A 1SVWA 4TLEA 4A0FA 4EPYA 1RJ9A 1Y63A 2J1LA 2J0SA 4TL9A 2P5SA 2PH1A 1UADA 3SBDA 2DCUA 2IYRA 4FCVA 2GCPA 4RD6A 3TW4A 3AF4A 1XWIA 3VMFA 4BGDA 1E2EA 3X2SA 2AD5A 3FOZA 1KSGA 4D26A 4AG6A 2ZYWX 1TF7A 4DIEA 1OT3A 1FP7A 4DLRA 1FMLA 1UDWA 2Y8EA 3Q7QA 2GAAA 3U7FB 3L8ZA 2D7DA 1HUQA 4GOXA 4JT4A 3U5ZB 4FMBB 4TYNA 4DUGA 3GLIE 2OLJA 4ZDJA 3KZ1E 2GZHA 3CF0A 1EG7A 1KDTA 1W48A 4X8HA 1E2KA 2C2HA 2JAQA 4JYBA 3KUCA 3UG6A 5JEEA 2KSQA 3HPRA 2KB0A 1ZU5A 1I4DD 4GRAA 5JCPA 4ARZA 121PA 3CLVA 2A78A 2VO1A 3B6EA 2RHMA 4TLCA 1CKEA 3HR7A 4EAQA 2F55A 1D9XA 4KAXA 4JLMA 1E9EA 3VU9A 3BFVA 3N2EA 1TMKA 4OK5A 4D81A 3NDPA 2GILA 1X8KA 3H4MA 1E9CA 2ZJOA 3LLUA 4CEJB 1KK0A 3K0CC 3P27A 3W5IA 4UJ3A 1TAGA 2ZE7A 2O8CB 2W6IA 2AWOA 1ESNA 1SQ5A 3CRQA 3T12A 4CZ2A 3T5DA 1VHLA 4LJ6A 2REBA 1FQKA 4IDQA 4IDNA 2R6DA 3KKNA 5EZ6B 2WAXA 3GFOA 2ZS7A 3GLGB 1OB5A 1G5TA 1IN6A 1YZKA 4YONB 2P0EA 1Z28A 3THWA 1NLFA 4M4SA 1ZUIA 3ZZUA 3TSOA 1AGPA 2ZJAA 3ZVMA 3AUXA 3W6PA 3DOEA 2CJWB 3HDTA 4WBSA 3EX7C 1G8YA 2CCGA 2XX3A 1KY3A 1NIPA 2QP9X 5EE1A 1MO4A 2OT3B 2F6RA 4YC7A 4UJ5A 5AJXA 3GMTA 3DKVA 3D7MA 1NN3A 1P9NA 3E70C 4M1SA 1G8FA 4X8OA 5HE9A 4Q1AA 3U3RA 4MUAA 2CL7X 3F0TA 1VCNA 4NONA 1WE2A 3QQ5A 4PPQA 4NYJQ 1S96A 1KI9A 2X2FA 2B92A 1OXSC 3MJHA 3D31A 2GCOB 2B8WA 2GF0A 3KJIA 1FX0B 4KFUA 3K9LA 1CF4A 4UKDA 1W36B 2G0TA 1LY1A 2GA8A 4B3XA 1Z83A 2ZRKA 5FBLB 3REFA 4EPTA 2Z5FA 1F6BA 2V55B 1Q1EA 4B2LA 2WTUA 4HUTA 2ZTSA 1JB1A 3OE7D 4LSGA 5FPYA 4PXAA 1NLYA 4YMWA 1OHHD 1K8RA 1F60A 2FN4A 1SKYB 3SOPA 1OXXK 5J4KA 3K70B 4LHYA 4DLVA 3HPQA 1H8EA 1ZD9A 2WV9A 2WOJA 2OXCA 1LW7A 1TADA 3JZMA 3X1ZA 2GJKA 1KSFX 2QQ0A 4RD2A 4V0OA 4B43A 4KITB 5EP3A 2XB2A 1LTQA 1Z6GA 4NCNA 3ZJYA 2HXYA 2HT6A 1X86B 3K9NA 1W49A 3SHWA 1XDBA 3ZVLA 3SYNA 3NHBA 3T5GA 4RD1A 4C0HA 4JLAA 3QNUA 1ZUHA 4DCTA 1R0XA 4JIMA 2FWRA 2HLDD 2KWIA 2WPDD 1ZC3A 4QM6A 3GLHB 1DAMA 3U7HB 1N5KA 1W0KD 2PMKA 4V03A 4Z1MA 3NEJA 5F98A 4HZIA 4TLBA 4YMTA 1DOAA 2ONJA 3QG1A 4WIAA 1SXJC 3PXGA 5JCZA 3WHKA 4D80A 4BEJA 3FE2A 5ANRB 2OCBA 5KPJA 4UNNA 4BE7B 3AVVA 1KJWA 1YU9A 3QBTA 5IRCD 3CX6A 3IDQA 2H8KA 2D62A 2GEDA 5J40A 3AVWA 3KJEA 3PR1A 3GLFB 4Q47A 2AK2A 4A2PA 4NCHA 2J5XA 5FTJA 5SZJA 2YOGA 2X19A 3ZVRA 1ZCAA 2W58A 3K9HA 1OH8A 1Z22A 3KX2A 3ZD7A 1QRAA 4AKGA 3GJ3A 1LB1B 4LBYA 5E4FA 3KTAA 1U94A 3CNLA 3RS5A 3BJIC 4FWTA 1P73A 3ICEA 3KXLA 2FSFA 4E07A 4P3YA 1J99A 4PC7A 3MFYA 2BM1A 1ZM7A 1V43A 1YQTA 3TUZC 2L0XA 4QJ3A 5LD2B 2QY9A 3R8CA 3Q3JB 2CEAA 4ZCIA 4B2IA 2ZS9A 4C3ZA 1Y3AA 3JVVA 3TSZA 2DYKA 2YJTD 1S1CA 5K8IA 3JVUA 4RZ2A 4Q5IA 4P33A 3FHCB 1ZINA 2HJGA 2H18A 1ZNZA 2ZRCA 1TU4A 3U3MA 1CR4A 3F8TA 1R8QA 4Z8YA 3GJ6A 4D25A 1G16A 2WSSA 4RKEA 4FIDA 2QRNA 3TBKA 3AKYA 1QBKC 2AX4A 2P6UA 3DO6A 2V7QA 2VP5A 3AEZA 4URZR 4M9QA 2ZQ5A 2AXNA 2Q9CA 1D6JA 1VYVA 4MYHA 1Z0AA 2NO0A 4C7OB 1ESMA 2F43B 2JLYA 4P4TA 1HE8B 4DLYA 1Q0UA 1XF9A 3L0OA 2ZU0C 2QN6A 3ZD6A 2H7VA 4PSKA 5BYKA 5B58C 2G88A 3I61A 1GZSA 4MQBA 1Z8FA 2HYIC 4CEIB 1GAJA 1KDRA 3FGNA 1PUJA 3Q5DA 1G19A 2QMOA 2O0KA 4QRHA 2XSZA 3KDSE 3QE0A 2UZ3A 1ZUNB 4XJXA 2IS2A 2HCBA 1RIFA 2D7CA 1ZW6A 4RVCA 4LJAA 4OQFA 2FPMA 2ZJBA 4IXNA 4JLPA 4DLTA 3NBFA 3LQRA 4LJ7A 3MJRA 3T1VA 1AA9A 2VP2A 5KNCA 5JI3E 5JZVA 1W7AA 2QBYB 1HEIA 3ASZA 4BFYA 1NI3A 2PBRA 2LCFA 2C98A 3WP1B 1T8TA 2ZYUX 1H8HD 4MH0R 1E3MA 3IQWA 1GL9B 1CJKC 4XIGS 4C9BA 3ND9A 2WKQA 1XBTA 3I8XA 2WWFA 1M7GA 4KFTA 4S35A 1GL7A 3B9QA 1EWQA 2O8FB 4NTZA 5FH9A 4C2UA 1F2TB 1UKVY 4G01B 3ND8A 2NPIA 4ASUA 2XXAA 4DLXA 3C5CA 3GJ8A 3LXRA 4XH9B 1KSHA 4DB4A 2RKOA 3PEUA 4W7SA 3E5HA 2P6NA 5GJBA 5JJIA 4KVAA 3EPLA 1EFUA 2OSBA 3CBQA 3SU8A 3CNOA 4DCSA 1G6HA 4PPNA 3P4XA 3U3JA 5EXPA 3R7WB 2F1RA 1D8TA 2GEVA 2VF8A 2PT7A 3DPUA 4HAUA 3OEHD 4QBHA 1IAQA 1IM2A 1N0UA 1R5BA 2R9VA 2IXFA 3WHLA 3EXAA 3N70A 1T91A 1SZPA 2GVDC 2BJVA 2BC9A 4LYHA 1DE0A 3BRWD 2FZ4A 2YV5A 1FPMA 3EC2A 5FOSA 3IKJA 2J0VA 2FF7A 2HYDA 1RJ9B 3AP2A 1U9IC 4EFLA 1ZM4A 3NC1C 4FN5A 1Q1ZA 1I4LD 1NMZA 5E3HA 4OHZA 1SVKA 2FOLA 1KNXA 4IVQA 4PHHA 5EQTA 1P75A 1ZNXA 3BB3A 5AWFC 3RS3A 2R6AA 4IJMA 1HQCA 2PT5A 5FBRB 1M1YE 1AKEA 4NHOA 3WP0A 2EFGA 1KGDA 4LYAA 2ONKA 1NLZA 1QZXA 2Z0MA 1YZLA 2ODBA 4OI1A 2ZI3A 1ZU4A 2P2LA 1KTVA 1SVIA 2WJJA 3VR6A 4B76A 4DWJA 5KO2A 5IHPA 1NP6A 1N3BA 4NYIR 4LBZA 1E2GA 1R0WA 1VCIA 2JASA 3KKPA 4Z51A 5G3ZA 2YHSA 1U0LA 3CZPA 2ODWA 3I4LA 2VHCA 4KCGA 3W8NA 2R6FA 1ZD1A 1OH7A 2HEIA 3L2OB 4V0NA 1Z29A 4XVQA 4ZCLA 4U00A 3FMOB 4JLVA 4LRWA 1GDDA 4Q4HA 4A4DA 2NQ2C 1KI3A 4DCNA 1UKYA 3LNCA 5EE9A 4M1YA 1KO4A 2VSFA 3W34A 4GP7A 1OXVA 4QXAA 3A1VA 1ZM2A 2QI9C 5B2ZA 3AM1A 4LBVA 1RRGA 2E1RA 4M9ZA 3VR1A 1JALA 3IIMA 2RGCA 4HLUC 4HUQB 4I4LA 3OFNA 3G0HA 4DSNA 3IIKA 2XEXA 4HB3A 3OIYA 3BWDD 4D4KA 4DUGD 1OYYA 1SVLA 1ZP6A 1Z6YA 4A82A 1D2MA 1XJQA 2SHKA 2IT1A 4DXAA 2F1IA 4PPGA 1EX6A 1OJLA 1XEXB 3A4NA 4TTPA 1QHYA 4HAZA 4A6PA 2QE7A 4EQ6A 1ZYUA 3AVYA 1E69A 2KE5A 4YXWA 5E7JA 3PQCA 2Z4RA 1E2FA 2FX3A 3TQCA 5BWMA 3VKGA 5TVKA 2CVHA 4OQXA 3W5JA 1MABA 1U2RA 4OKSA 4R2HA 1ZM9A 4TTQA 3THYA 2CNWA 1JJVA 2OG2A 3ETLA 2W6ID 4M2LA 2IYVA 4B47A 4R9UC 4ZIRB 4I1VA 4LOAA 1KK3A 2BHRA 2ZITA 4D0NA 2YC4C 1CLUA 2DFTA 2ZJYA 4HI0E 1GWNA 4GFDA 4NYIQ 2GWHA 1NN5A 4TQ9A 5CDFE 3AVUA 2GZDA 3EWSA 1II8B 1SXJB 5JEDA 3D6TB 3VQTA 2JATA 3PUVA 3B1ZA 3Q5EA 3I62A 1ZIOA 2C9CA 5JLJA 2ZRNA 1XMIA 2JDIA 1UDXA 4AD8A 1E2LA 3CR7A 1HT1E 1S4QA 3EAQA 1FQJA 4KLNA 3AVXA 2Q9BA 1P2SA 4PC6A 4V0MA 1WBDA 2WWXA 2C04A 3DKPA 3HR8A 1YZGA 2IWHA 1ZNYA 5HTKA 2IXGA 4A0GA 4DLSA 1A5TA 3BBPA 4BLTA 4TMVA 1X1SA 4C0KA 1FUUA 5HKKA 2QNRA 4GNKA 3ZS9A 2VP9A 2WAYA 4B3FX 1MR3F 1GOTA 3NC0C 3GJ0A 1W36C 1NY6A 4AYTA 2N46A 2YZ2A 2WICA 1Q22A 3KQHA 2FGKA 4XTCS 5L3QB 1BOFA 1Z6TA 1XD8A 2BMEA 4A36A 2J0QA 5EXSA 2XTZA 3Q85A 4LY6A 3M1IA 3SQWA 3C5HA 1Q20A 1E9RA 4UXJA 2ORVA 1FFHA 4QM7A 1Z0IA 3KKOA 2ZVQX 2GJ8A 3OIUA 2PZFA 3GLGE 2V1XA 3GP8A 4A2WA 1U0JA 4ZDIA 1H8ED 1N2CE 3MWLA 4GL2A 4HDQB 1VMAA 3HU1A 1G8HA 3IPXA 1G4UR 1UKEA 4W5HA 4RD4A 3B8HA 1NVVQ 1VECA 4RKFA 3Q8XB 3GQBA 4CDGA 1FNMA 3GD7A 2MMCA 1S3SA 5JRZA 3QKSA 2ZRGA 4HDCA 4ITRC 3QG5A 3ZZTA 4DDTA 1XTSA 4HAVA 3P1JA 4US2R 2G77B 2BM0A 2C78A 1L4YA 3MWYW 3QENA 2BV3A 1HURA 4JYCA 2FFHA 5D3QA 3R9XA 1BMFA 3P32A 1YR9A 1NJFA 2ERYA 1WXQA 5DN6A 4RJLA 3U2QA 3O8CA 4BZPA 2V3CC 1JR3A 4Q4AA 1HT2E 4LC1A 1J70A 5H68A 2CCJA 5L8VA 3KXIA 1NKTA 1G8GA 5CLLA 3SBEA 2R44A 3VR3A 4DEYA 3W9YA 4WXRA 4N0EA 1KMHA 5KNBA 1KDOA 3L43A 4MKIA 4WOPA 1RRCA 5JWOA 1JXOA 2OCPA 5JWRA 2IS6A 3VR2A 1P2VA 3RS2A 4B3BA 5J4HA 221PA 4KYUA 4OHYA 2KJQA 4LX0A 2ZSEA 4NL4H 1SKYE 1H8HA 2JLQA 4WZ6A 3EZ7A 3ECCA 4CF7A 5IK2A 2XJ4A 1J7KA 2PX3A 2W2TA 3P4YA 1U98A 4Q9JA 2IYTA 2F9LA 3DDCA 4QJ5A 3QXHA 1NVUQ 1NL3A 2ZUDA 4JVNA 4TTRA 1ZJ6A 2QGNA 3DMNA 2QAGC 1E4YA 1E94E 3VX4A 5BN3A 1C1YA 1GSIA 2FE4A 3H0KA 4BASA 1M8PA 1MO6A 4D2IA 1JEEA 4LGMA 3FPAA 3NXSA 1F3OA 4G5QA 1CU1A 2NO9A 3NBZC 1NBME 2PX0A 3PJRA 4P4SA 1NG9A 1E79A 1N0VC 3GLHE 3CPJB 2WKPA 1DADA 2OILA 4C0BA 3U4QB 4PQRA 5C2JB 1EGAA 4JLKA 5ELXA 3W3AA 2QG6A 5AJVB 2EQBA 4PO9A 1F5NA 1VG8A 2GTPA 4ERNA 1JPNA 4QC2A 2ZYVX 2Z4SA 3TVDA 4BRUA 5L3SA 1GITA 3V4FA 1R5OA 4WZAE 1PLLA 1DTSA 4Q7MB 4PO1A 3SQXA 4Q21A 3FHTA 4MYCA 4GPTA 1G20E 2Q0HA 1YZNA 2WSSD 3NH6A 4QKQA 1GRNA 1QHNA 4CIDA 1XEWY 1CR1A 2OESA 4TMXA 1KO7A 2JLRA 4LJ9A 1TTTA 1A7JA 1Q1QA 2CHQA 4RCZA 1JNYA 2QPTA 4LV8B 3SJBA 3REGA 3UMRA 4B74A 5C46F 3GLFE 1E2JA 1T9HA 2OBMA 2NMVA 1Z0KA 3W90A 1E9FA 5FOUA 4QBFA 2RAPA 2V7QD 5FTNA 4MKGA 4BFUA 1RE0A 1W1WA 1SVMA 4O25A 1EFCA 1XP8A 3CRVA 4BRWA 4Q9IA 2IF0A 4EKDA 2GETA 3QKTA 2PJRA 4F4CA 4JKIA 3HU3A 3TW8B 1N6LA 1WB9A 1US8A 1VG9B 3EA0A 5KPDA 1DEKA 1W4CA 2QL6A 5DSZA 4B6FA 1AZSC 1P9WA 2RHDA 2XSZD 2XZLA 1KI1A 1ANKA 2QEQA 4JLDA 2C96A 3SYLA 2B7CA 3PCRB 1GUAA 1CULC 3RRYA 2WWIA 4BFZA 3IPYA 1KNQA 1G3UA 3ZS8A 3Q9LA 5DGXA 2ZRHA 3D8BA 2AHOA 3HU2A 4PPFA 3KB2A 4US1R 1VIYA 1ZVQA 3HYTA 1AS0A 2VLIA 3WY9A 2AKYA 4CT4B 1PVOA 2F9MA 4FMDF 3U44A 1JI0A 1Z5ZA 1F2UA 2ODEA 4QBIA 5LB2A 3SS8A 3WMEA 5KTYA 4NYJR 4URVR 4Q4LA 1G41A 4QHSA 1WDTA 4C0SA 4PO8A 421PA 4ASUD 4ACAA 1JJ7A 1GG2A 5CB6A 4LHXA 4FMCF 1DAFA 1ZD8A 2IUUA 3K09C 2IYLD 4G1UC 4TYWA 1II0A 1R0YA 2ZREA 3C14C 1OE0A 3T34A 1OXTA 1BYIA 1S8FA 2PJZA 2ZSDA 2IK8A 4Z8XA 1V5WA 1DAIA 4L15A 2RGNA 3DZ8A 3ZDQA 4L9SA 2VHQA 2R65A 3MRSA 5EP4A 3UMFA 1QG2A 4GMXA 1Z0DA 2OUKA 2ZAOA 2W0SA 1FUKA 1RRPA 2HXSA 4RSGA 1X8LA 1XB2A 1CR2A 1UPTA 1YR8A 1DELA 2V4ZA 3FHOA 4LK2A 4PFSA 3CNNA 3QKUA 4DIDA 4C2TA 1KKLA 4G5GA 3JZAA 1EX7A 2O8DB 4FCWA 5KDOA 3I73A 3QJYA 5M04A 1PLKA 4FWIB 3I72A 2G9NA 3DOFA 3IEVA 2ZXUA 2F1HA 1N6NA 4AKIA 3FKSD 4A8JB 4L4UA 2RGXA 5BN5A 3P20A 1COWA 1PJRA 4DLWA 2REOA 2B21A 4PZLA 4JL8A 4V0LA 1DAKA 4H9GA 1CS4C 2D2FA 1G64A 2XNSA 4L16A 2D2EA 5C4GB 1JPJA 3C41J 1KHTA 1UBEA 1YKSA 2H57A 4LJYA 3NWJA 1ONBA 1XD2B 1OW3B 1E2HA 2XOKA 4A9AA 1AGRA 1XMVA 4EPWA 2BBTA 5GVRA 3UANA 2QSYA 2OAP1 1TUIA 1CP2A 5FBWB 4M22A 5FPSA 3UK6A 4V02A 2R8RA 1XTRA 2RH5A 4U02A 4DEXA 1IXSB 3LD9A 3NHAA 4HB0A 1OSNA 1E4VA 2CHGA 4LBWA 3VNVA 4Q4JB 2FH5B 4PAQA 2G3YA 1JR6A 4FI3C 3QBVA 4HZUA 4MUBA 5EXXA 3NG1A 4ZCMA 1A82A 2ZROA 3RS7A 2WHXA 1EXMA 3OFND 4LV5B 2V54A 2YWGA 3T1QA 3QEJA 1M2OB 1CJUC 4PTLA 3NIBA 3UG7A 2QT0A 4LYJA 2BWJA 1RFLA 2CL6X 3DM5A 1E2DA 1DPFA 5AJWA 1JECA 4D82A 1XXHB 5G40A 1SGWA 2YWFA 2QE7D 4JVMA 1G6OA 1N0WA 5SZHB 3EZ6A 4RD0A 4YXWD 2QU8A 2ZANA 2ZE5A 2VHUA 3AKCA 2IX3A 2JJ1A 2ZRJA 5K8LA 4PR0A 2OCAA 4TL8A 4Q9KA 4IEIA 3BK7A 4PZZA 4P4UA 4EFNA 2IEYA 2IUSA 2BCGY 2IYYA 1DBSA 2A2ZA 2CNWD 4BECA 4DSUA 4HDOB 4QG7A 4JZKA 2PCLA 4OJKA 1KY2A 1H65A 4FMDB 3RVBA 1T4GA 2DY1A 2J45A 3A36A 1L4UA 1LVGA 4JLOA 3RSOA 5H1YA 5JSZA 2OLKA 3ADBA 2J0UB 4UXHA 4F4JA 2GBLC 4H1VA 3DM9B 4OL0A 1CBUA 2X8AA 4IOMA 1G7CA 4BEBA 2NZ8A 4JLNA 2ZU6A 3CX8A 1S9DA 3VHXA 3QF4A 2JIZA 2C03A 3FFAA 4IOLA 2ZJ2A 3IUYA 4EJSA 5A5GA 3PG5A 5JJKA 1U99A 4DSTA 1EFTA 2JDID 3A6PC 3LBHA 5HZHA 1P72A 1BO6A 1RKBA 3BORA 4D0GA 3ASYA 4QOSA 3RNLA 2ZEJA 4EPXA 3A4LA 2P65A 4RCYA 5DO9A 2ZPTX 5DHFA 4Q9LA 2O8EA 1QHHA 4XWAA 4A92A 2OAQ1 4PSAA 2VA8A 4Q1BA 3AKDA 3A37A 3PITA 5HCNA 2YOFA 1GVNB 5HKKD 5D3MB 4M9SA 4Q01A 3S1AB 4NCJA 2I4IA 1QHXA 2G6BA 2NO7A 1Q57A 3SE0A 4F92B 4AIIA 1S3GA 3B1VA 3NBYC 4O3MA 2A9KA 2NTYC 2QAGB 5AJZA 1MO3A 1KDPA 3EIEA 3QKRB 4BFXA 2H17A 2OZEA 1CEEA 1K5GA 1ZRHA 2Q6TA 5E7MA 5DYGA 4BUJA 1E2PA 2ZR0A 1FW6A 1R7RA 4ZO4A 1RYHA 1DAGA 3T1OA 3FDIA 2D74A 3UPUA 1R5NA 3KQLA 2DWPA 4G5SA 1IONA 1II9A 4DSOA 1G21E 3K0FB 1VHTA 2QORA 2BEJA 4M1TA 4NU0A 3SYKA 1SXJE 1EESA 3TH5A 5DI3A 5H8WA 3TJZA 4NPHA 2FV8A 2HCJB 4TSFA 1GM5A 4NMMA 1KK2A 3N2IA 1P4SA 2V6JA 2WJVA 4G3XA 5H70A 1UM8A 2BMDA 3K0SA 4KO8A 3I3SR 1D2EA 2A7QA 1K6MA 2BVNA 3SN6A 3I1FA 1IOZA 2FA9A 2OEPA 4KXFB 1NKSA 1DG3A 1T5IA 4ABYA 2BEKA 2B8TA 4KI0A 4HAXA 1AM4D 1BS1A 1ZM3A 3SJZA 1P62B 4DHEA 2KBEA 2JJ8A 3ZLJA 1T0HB 2GAOA 3QXJA 1I4TD 4PANA 4GZMA 4BLQA 3PV0A 2QP4A 4Q48A 5CYPA 4YMVA 3QI2A 1EFHA 3B5JA 3LH5A 3KL4A 3DVLA 2ZRDA 1Z6XA 3ADCA 1YJ5A 3IEUA 4DVGA 1BMFD 4W9MC 3W3ZB 2ODNA 3BB1A 5DN6D 1XPOA 2GZAA 2BOVA 2PLRA 3RDPA 3WNCA 1JR3D 3GLIB 2VQSA 1O87A 4MYTA 1XPRA 1KKMA 4NH0A 1FZQA 3SR0A 2DWOA 2H16A 1Z3IX 3E2IA 2GXSA 2VEDA 3BH6A 3NKVA 4M1KA 4G0NA 5FI0B 4CEHA 4DC9A 2Q3FA 2VPPA 4AWXA 1E99A 3SEAA 2CLDX 1IN5A 1XNJA 2ZETA 1T3LA 2WJGA 2H1LA 1XTJA 2YWEA 5A4JA 4BLRA 5L3SB 2AXPA 2WWYA 2NGRA 4A2QA 5IK2D 3B1XA 1IJFA 2VHJA 2PL3A 1Z2AA 1L8QA 1IN7A 4XWKA 5KSOA 4Y0VA 3CX7A 3KFXA 2OM2A 3KQUA 1G1MA 3TUIC 1G7TA 4A0RA 2AN9A 2W83A 4OHWA 4RZXA 1KJYA 4BFTA 5F9FA 1UFQA 3EIHA 4DZZA 2WMOB 3H1TA 1E79D 3B1YA 3B78A 4KYIB 1Z2CA 2IWRA 3VAAA 1J8YF 3G82C 4N0DA 4RFSA 1LS6A 2REXB 3AVTA 3EZ9A 1WP9A 4UNRA 1YRBA 2W00A 1E2QA 4OHXA 4XWOA 3RRMA 4XD7D 4DKXA 3EG5A 1TL7C 4FD2A 1E0AA 2AFHE 3QF7A 2IYSA 2C5LA 2RGAA 2ZI7A 3LVQE 1QHIA 2QTHA 5JI2E 4NDZA 4D4MA 1MV5A 4JBXA 4KVGA 2F1JA 3IBYA 4AKHA 3FB4A 5TMPA 2DR3A 5F3WB 3FYHA 2ZI5A 2I3BA 2QPOA 2IBMA 4A6XA 1T0JB 2LKCA 1G7RA 1ZBDA 5CDFA 4I99A 3GPLA 1EFRA 1GRQA 2IYZA 4HAWA 2AK3A 4MITA 3NH9A 5FOVA 3FKSA 1UF9A 3PEWA 1X8JA 1TQ4A 2OO7A 1T3SA 1R6BX 2AL7A 2YKGA 1D9ZA 2VSXA 2AKAB 3WRYC 5HR5A 4P0TA 1T6NA 1DO0A 1PZNA 3IQXA 3CIOA 4ILEA 5KHOC 3HP1A 1F2UB 1EK0A 2RB4A 1MRNA 1U8ZA 4AYWA 1VYUA 4Q66C 2ECKA 1NF3A 1W0JA 1BYUA 4IXMA 4M0LA 3PFIA 4D4LA 5C18A 4TMZA 1IHUA 3WMGA 4WZBE 4MKFA 4ARZB 3BD9A 2WSMA 3KQNA 3RANA 2RGBA 1OPXA 3K8YA 4QNRA 5FUYA 3VU9B 1NY5A 2QAJA 1MT0A 1NMYA 1TF2A 2FZLA 4CEJA 4CRWB 4XTRA 3L0PA 4U5XA 1TEXA 1IY2A 2O8CA 3PUZA 2QP3A 2ZJ8A 4PSVA 4URUR 5GVSA 1JQJC 4TZ0A 1XJ0A 2IHYA 2J7PA 1A2KC 4BLSA 3LQQA 5FFMA 2ZI6A 3KKMA 4EFMA 3B9PA 1HY3A 3EA5A 4E03A 3GLGA 2JLUA 2QUZA 2QMEA 3BB4A 4AG5A 3DMDA 4KODA 1Q3TA 1VCMA 3AV0B 1W4BA 3GEHA 1LV7A 1KOFA 3THWB 2W2VA 1Q3HA 2IHBA 2CJWA 1KI4A 1QG4A 3CPEA 1RW4A 2KBFA 4LZZA 4L9WA 3KXKA 2DFLA 3V9PA 2I1VB 4OBEA 1BIFA 5CB8A 4Y0AA 3LBIA 2WKRA 4F93B 1L7VC 4OI4A 5K8UA 3QEOA 2BKUA 1KI8A 2V1UA 4JSTA 1AKYA 2FFQA 1NVVR 1UEIA 2A5DA 2WZQA 2CVFA 2D4HA 2VF7A 1AN0A 4BLPA 4Q7JB 4DBLC 2FDCA 3LW8A 1WQ1R 2GEUA 4OQLA 5CK5A 4NCKA 1NSTA 4PC3A 4JJKA 4A8JC 2GCOA 2QMUA 4QJ4A 3ZH9B 1FX0A 4IFBA 3LV8A 3I32A 1RRFA 2IF2A 2GRJA 2NOAA 1W44A 1DVRA 5CJ2A 3J81k 4XVUA 3TAUA 5J4YA 1COWD 5DYIA 1LS1A 3U6BA 1MH1A 2ZAMA 3L82B 5TB5A 3RABA 3HYRA 3N5CA 1NVWQ 4M1OA 2VP6A 5JMTA 4URYR 1M74A 2R6CA 3MAAC 4UXIA 2EU8A 4YDSA 521PA 4DDVA 4F91B 2B7BA 3CWZA 2GESA 1RC8A 3R9WA 3ZIAA 2UVQA 2XOKD 4A1FA 2WJYA 2EFEB 4TLDA 1W5SA 4IEEA 4TT3A 2EWVA 2MSEB 4B2PA 4CGZA 3EC1A 3PENA 3VKHA 4CVNA 4TL6A 1OIWA 3RAPR 4GBMA 5FTKA 1E9SA 3V4RA 1X1RA 3GEIA 4L8GA 3O8DA 4DLZA 2VL7A 1NBMA 4LJ8A 3GLHA 4LV6A 3R9IA 3TKLA 4LI0A 2YOHA 2R6GA 1EWRA 2F3RA 1JQLB 3LO5A 5EJEA 2GKSA 3TK1A 4N3NA 3GFTA 4WAUA 1RVDA 5LDDC 4G5RA 1Z47A 4NYMQ 4DDUA 4BFWA 4MYUA 1LF0A 1QVRA 2IC5A 5EUQB 2RGEA 3A8TA 1Z6AA 2FMXA 4KU4A 2H5EA 3SDZA 2PCJA 3TE6A 3QVUA 3RYTC 3ICQB 2E87A 3T15A 4TMKA 3MWKA 4NZYA 1N5IA 3I92A 2I1QA 2F7SA 2D3WA 4ON9A 3O8BA 4EJSB 4PHFA 4OK6A 3RLFA 4QGHA 2QRZA 3UMSA 3GLFA 4OJQA 2PLFA 2JJ1D 2QPAA 3K0AA 5GJWC 1LNZA 3TAHA 4HSEA 1VDZA 3AH8A 2O0HA 4Q7LA 4OI0A 1E6CA 2OCYC 1FL9A 3R8FA 1CJTC 4KSCA 2BKEA 4JJZA 1WBBA 1VG1A 1P3JA 1E2MA 2CXXA 3I5YA 2W0MA 5G41A 4LDJA 1U0HC 6Q21A 4IRUB 4KHZA 5JRJA 3KTAB 4CT5A 1C4OA 1N5JA 5CIQA 1CRQA 1XFAA 1W4AA 1OKKD 2OV2A 2WMNB 4GSYA 2YVUA 3LW7A 1YR7A 4DJTA 4QHTA 1A2BA 1HA3A 1MO5A 3AF0A 2XNDD 2JIZD 5EUMA 4BZQA 4JL6A 3GFPA 1VG0B 4R2IA 4QHYA 5TY0A 5B30A 4NKRA 5CIWA 2QTVB 1GRRA 1KJZA 2C8VA 2N42A 2OHFA 4Q1DA 2DFKB 1P5ZB 2G0NA 5TXGA 3SFZA 5FPHA 1AZTA 3RWOA 2QM8A 3TGPA 3TR0A 4QBGB 4QL3A 3T1TA 3U3OA 4KBGA 4TMWA 5CJPA 2IW3A 1XXHE 5FR2A 4EPRA 3BC1A 2HT1A 2P67A 4PQYA 3PIRA 2WM9B 3AVQA 1KO5A 4QGFA 3KB1A 3THXA 2ZYTX 4JT2A 4C7OA 3M4YA 5DE3A 4AI6A 2F43A 2UKDA 4HB2A 1OH5A 3B13B 5FPTA 5KDDA 4QFMA 2Z83A 3WYAA 1KI2A 4D4JA 3F5FA 1E1QD 4LC0A 3BIFA 4C4PA 5GJCA 4KFSA 1P7CA 4CEIA 1AS2A 5TDHA 4C0AC 4XD7A 1B0UA 3UWKA 5FOXA 1NG1A 1GNPA 1QHGA 2BJWA 1IXZA 2W2XA 3K9GA 5FPKA 2J87A 1MKYA 2AFIE 3B1WA 2GHIA 1WF3A 2VHTA 3A1SA 3T06B 3VKWA 4Q7KA 1DS6A 1KI7A 4DCVA 2EVWX 2ORWA 3CH4B 3TRFA 4TSFD 4HYYA 2LWIA 1PUIA 3AKEA 3GCGA 2FEOA 4PC2A 2OFXA 4F38A 3HJNA 2QBYA 2JA1A 4B33A 4IFEA 4LPSA 5IF9A 5JBQA 3QSYA 3CRW1 3CPHA 3B60A 2A5JA 2EYUA 2IYQA 2XZOA 5AUNB 5FL7A 1KMQA 1SHZA 1R2QA 3A58B 3GJXC 3L0SA 3RS0A 3ZQJA 4ZDWA 2O8FA 3VTKA 1XX6A 5JECA 4AURA 3FMFA 2MSDB 1NNEA 1QHSA 3GJ5A 1W4RA 4JLBA 2O8BA 1XCGB 3FMPB 2XXAB 1OFIA 4M1MA 5K8TA 3R20A 2Q3HA 2FEMA 2ORIA 3WNDA 2ASEA 2W6JA 3HWSA 3K09A 2X2EA 3QOFA 5KSPA 4IHQA 3MLEA 1XEWX 3LBNA 1YE8A 4KLZA 4V0KA 5SZKB 3R7WA 5DNYB 1BH2A 1AS3A 4MKHA 1J8MF 3PEVA 4I1UA 2RGDA 5TV2A 1YRAA 3CONA 3QVVA 4OI2A 1IJEA 3WBKA 1WCV1 3K0CA 2EFDB 2CK3A 2IUTA 1M6NA 1P61B 3EARA 5DHAA 1HV8A 1S0UA 3EIQA 2YWHA 4L5BA 4NE2A 2WJIA 4B32A 4MRRA 3SFVA 4GOKA 3TMKA 1UJ2A 2LKDA 1KI6A 4B71A 4MRPA 4ESHA 2ZRFA 3CUEF 1IBRA 2DHRA 3EW9A 1OF1A 4HLQB 4P31A 2R2AA 5DLQC 5LPNA 5BQ5A 5BYJA 1P9RA 1Q1BA 4HLCA 3M0EA 4O2LA 1YHNA 5CYOA 1VPLA 2UZIR 5FTMA 4AC9A 1G5RA 1FMJA 1NMXA 4MDFA 5FUWA 5J4LA 3AF3A 3K1JA 1E1RA 1ZNWA 2QA5A 4LJ4A 2QSZA 1XTKA 2Q9AA 4LHZA 4WXPA 4AKEA 4PHGA 5FOTA 4GOJA 1TEVA 4NCIA 2AD1A 2OFWA 2IYXA 4Q4HB 1E0SA 2CDNA 1KAOA 1EFRD 4DB2A 3QIAA 2X77A 3PUXA 2EFHB 1SVSA 3NEYA 2BCJQ 4HUQA 3BGWA 1UBFA 2OBLA 4BQSA 3E1SA 2GNOA 4B6EA 1IY0A 4B35A 4E22A 1ELOA 2VSOA 3VX3A 3VR4A 5B57C 1E0JA 3W6NA 5G53C 4IKEA 4EDHA 5FTLA 3CWQA 3KJHA 3RS4A 3CM0A 1D2NA 5CITA 1XEXA 1W0JD 4RZUA 2V8OA 1XZQA 3QXCA 1ZC4A 3RRNA 3X1DA 1VCOA 3TR5A 2ZRLA 4JBWA 4W5JA 4LJ5A 1YZUA 4O2RA 2CBZA 1NN0A 2RGNC 5DH9A 4EQ6B 3OHMA 1E0KA 2YNMA 2CE7A 2QT1A 2X1VA 3AUYA 2WIAA 3ZZ0A 3ADDA 2IS1A 1C9KA 1P6XA 2ZSAA 2JLWA 3GJ4A 5EP2A 4DRZA 1IN8A 1Q12A 4HAYA 1MABB 4JMPA 2PMDA 2O52A 3EWAA 3UKDA 3THYB 4KSBA 5JJLA 2FPLA 4ZIRA 1ETUA 2J7PD 1U8AA 1TQDA 1P2UA 3AQ4A 4RD3A 2DPXA 4AYXA 1G9XA 3MCAA 4F4IA 2QENA 1II8A 1SXJA 5EZ5A 1E2IA 3FTQA 2GBLA 3U6KA 2J46A 3OESA 2V6IA 3NVAA 4Q9HA 1CJVC 1DAHA 1XTIA 4TN1A 4UQOA 3U60B 4KBFA 3ZQ6A 3O8RA 3GJ7A 2JLVA 1FTNA 2C95A 2XTMA 3CRRA 2OXRA 3SI7A 2CCKA 5HCIA 2GXQA 2RCNA 2NPFA 3THOA 2H92A 3IHLA 1XEFA 3DL0A 3BOSA 3Q7PA 1S1MA 4Q1EA 4RZ3A 2ZSBA 3Q72A 1DG1G 1Q44A 1ZIPA 1XCMA 4Q19A 4ZI3A 3L0IB 5L3RA 3BFXA 3LY5A 3WYFA 2VRWA 4LHVA 4Q03A 4WA7A 2IS4A 2OE2A 4C0QC 4XOIA 1OKKA 5UKDA 5JFGA 2PEYA 5LB4A 3AGQA 4FMCB 3AGPA 5L3QA 4ACBA 2CL0X 1IY1A 5KSYA 3OEEA 4JVSB 3UWOA 1W36D 2XNDA 4JL5A 2G1JA 4HEJA 4MRNA 3U3KA 4LWZA 1G3RA 5GJVC 1CRPA 3AP1A 3W6OA 4H1UA 5FBVB 5EE5B 2BMJA 4GP6A 4YQFA 3SJCA 3K70D 1NN1A 4TYYA 3RC3A 1M7HA 4FXPA 4AK9A 5HPYB 4MGKR 1N25A 2ZE6A 1A4RA 2B6HA 2BBWA 3QPWA 2FPKA 5KDLA 4Z54A 3ZIAD 5EP1A 2WJHA 1QF9A 1KZ7B 5F2EA 1DAEA 3EPHA 4TT3D 3CW2A 2JEOA 4X8LA 1TQ6A 1B23P 1GL6A 4W5WA 3FMIA 1N6HA 3K0EA 2GXAA 3AF2A 2C9YA 4PAOA 2A30A 5C1BA 4I1SA 5KUTA 3OAAA 5HZKA 3K0AB 1NRJB 3AP3A 1NBMD 1OFHA 1TF5A 3QKSB 1OH6A 3K53A 1MOZA 1QVAA 5CM9C 1JXMA 1G3IA 4QNMA 1GKIA 4EIWA 2QQEA 1E1QA 3F3YA 4POAA 1E96A 4ZKEA 3B2EA 4PHTA 1ODFA 4TL7A 3WRXC 1XD9A 2HF9A 4EPVA 1G18A 3H2YA 2WWWA 4UNQA 3LWNA 3OIWA 2GCNA 3H86A 3LX5A 3CB4A 3ZVNA 4Q4AB 4CW7A 2IXEA 2WIBA 1T8UA 2IYUA 4HLDA 3CZQA 4EJSC 1AK2A 5LBIA 3B7GA 2ZRAA 3TNFA 3IO5A 5BXQC 1UAAA 4R7ZA 721PA 1GKYA 1Z0JA 4MDEA 2VP0A 3LXXA 4IVPA 4Q18A 1E98A 1KMHB 2A3RA 2ATXA 2FFBA 2HV8A 4LCBA 1OIXA 5AK0A 4DT1A 1RYFA 3LA6A 3AVOA 3TSWA 3DEFA 3RHFA 1G17A 4NBSA 1G7SA 1JAIA 2F3TA 2WBLC 1GNRA 3LAWA 4JSYA 3VFDA 5EXTA 2HUPA 5P21A 2ZIAA 2AR7A 2BMFA 5KNDA 2CLCX 1G8PA 1J2JA 1UKZA 2DBYA 4PC1A 1YVDA 2PEZA 4TZ6A 4R71A 4DCUA 2A5YB 1J90A 3GEEA 1K5DA 2JJ2A 1G4AE 3CO5A 3FFBA 3IILA 4K46A 3MWJA 3V00A 4AY2A 2YYZA 3THXB 4K8OA 2NO6A 3SNHA 2GK6A 3I8SA 5KOYA 3U4QA 4B34A 4P4SB 4B44A 2ZUCA 1UBGA 2P3SA 3KFVA 1LF5A 2A5FA 5IDVA 3AVPA 1ZCBA 1JEDA 2ZE8A 2C99A 2GDJA 1R0ZA 1WRBA 3LFUA 2VBCA 1D5CA 4TYQA 2Q3MA 1P60A 2ZVPX 4TLAA 3T61A 1I2DA 2ZS8A 1GILA 1FOEB 3KUDA 3M6AA 2JLXA 1F48A 4MGYR 1KK1A 2QROA 4IDPA 1E9AA 1U9IA 3VNUA 3I5XA 2O0JA 1CJMA 4UNSA 3TVTA 2ANCA 3QXXA 3IHWA 4JVLA 2GK7A 3FVQA 3UIEA 3T35A 821PA 2WVJA 5FI1B 2BBSA 3EASA 2JLSA 4O0MA 2JCSA 3FWYA 4P32A 5AJYA 1TPZA 1US8B 3UXMA 1KYIA 5B64A 5AUPB 4TYPA 5FR1A 5KSZA 1GIAA 4MGIR 3WMFA 5G3YA 5AUQA 2O8BB 3L8YA 1R4AA 4WVFA 1SKQA 5J47A 2QM7A 4B3GA 2EFCB 4B3DA 2IL1A 2IEZA 3MMPA 2NIPA 1TUEA 1HQYE 1M7BA 2HF8A 3BH7A 3H84A 5KYKA 1W2GA 4F7WA 5BW8A 1P2TA 3X1XA 4IDHA 3O47A 3BFKA 1XU4A 2J7KA 3A1UA 2FNAA 5FL7D 3EZFA 4ZI2A 1W5TA 2ANBA 3CKLA 3UATA 2CHVA 4X8MA 3DHWC 4HLUA 5DISB 4C30A 1W47A 3U44B 3BH0A 1OV4A 3C8UA 1FNNA 4I1OA 4YMUA 1OFUX 3PEYA 4YLGA 4EUNA 3GLIA 4A15A 1Z0FA 4S2EA 3WXMA 1AQUA 2KI5A 4IDOA 3A4MA 4B48A 1HH4A 4R98A 1KI6B 2W6JD 2C9OA 3QPVA 2VP4A 4JLJA 5FUVA 4U7DA 3D3QA 1KSJA 1QDEA 2NG1A 4URWR 2CLSA 1Z06A 1S9HA 1OXUA 3B85A 3B82A 4HB4A 4D0LB 3LX8A 1CIPA 4JBYA 1HE1C 2AWNA 4MRSA 3KJGA 4N1AA 1JAHA 3RC8A 1XTQA 2CMKA 5HE8A 4CYMA 3A1WA 2CK3D 4M1WA 4TWZA 1G3MA 1SVOA 2XJ9A 3ZYCA 3U61B 2O8DA 3A1TA 3MGCA 4I81A 3MG9A 2FJUA 4OQNA 4C0JA 4E5UA 2XAUA 3C15C 3PVSA 4GMDA 3SJAA 2G1KA 2FSIA 1YZTA 3C16C 1XPUA 1GKUB 4Q02A 4A8JA 4E09A 5TARA 3IIJA 5A0FA 1HYQA 3WYGA 1DO2A 2GJSA 1RPZA 4M21A 1SULA 3EPKA 1N6RA 3OE7A 2YINC 3ONWA 4NYMR 3EZ2A 1OHHA 3FKQA 1UBCA 2XTNA 1KAGA
chains in the Genus database with same CATH superfamily
1I32A 2EQAA 3I1JA 4GKBA 4GT1A 4NMHA 3BERA 4BNHA 5LQSA 3SSAA 2HA7A 1PGJA 2MSKA 2PXHA 3P0JA 3S0JA 2P6RA 4RVNA 4BCDA 3EXHA 2FSGA 1BQEA 1CVLA 5FAXA 1I01A 3RFXA 5J2TB 1CK4A 4JKYA 3SQNA 3U7EB 3UJDA 3NO4A 4LOIA 1N6OA 1P2FA 3FHJA 1RM4A 1SZDA 4L75A 4DQDA 4RHFA 2HLDA 1BXZA 2ISSD 2F3UA 3EFOA 5L3VA 3Q88A 1X3SA 1CZLA 2YXBA 1JEYA 3DP7A 2JK1A 1XQ1A 4CMAA 4QDUA 3CTMA 4CR8A 1XT6A 1K7YA 2NSYA 2PJUA 2VCHA 2AB0A 2E9SA 4X61A 2Q27A 1AO0A 2FEXA 5A2GA 4FIZA 3OETA 3QUSA 3RFFA 8OHMA 3UN1A 3HCAA 4ITVA 4OA8A 2P9GA 2B9EA 2AJLI 3CH5A 2ST1A 2ZBGA 4DR2B 2JI4A 4E4TA 1J2YA 1BXRA 3ETNA 4Q00A 1Q11A 5AK5A 3ZZNA 4R1OA 3SKVA 4D8XA 3CR8A 1H0SA 1WTAA 3AUKA 1W96A 5LWHA 1QOZA 2FW0A 2FU5C 3DXFA 1U2TA 2ZSFA 4GI7A 5EHIA 3M9WA 1QHEA 2J31A 2X15A 2G9UA 4IGEA 4J4BA 3BRQA 4OJYA 3ROKA 1M6EX 3WK9A 3PUYA 1TQHA 4Y1FA 1W8IA 2QJFA 4TYMA 1NIJA 1WCXA 4DMFA 4XVCA 1BHJA 4UDXX 4DDKA 2R1TA 3L40A 2EYQA 2R87A 4HGRA 4ZV7A 2XYPA 4PIMA 4Q3BA 3MT8A 4QT4A 3N7UA 2P5TB 2J0UA 2C5AA 3HEMA 2BI4A 1LZLA 3MUFA 2GUWA 3KC2A 5IM5A 1XZPA 4DBLE 4TV8A 4FFSA 1EB8A 5DX0A 3V34A 1JWBB 1PJCA 1FB5A 3BZWA 3P5BA 2UAGA 2AVDA 4O2BB 5I9LA 2JKVA 3LDAA 4CV2A 3DWIA 4KTVE 5J5CA 1PLJA 4LXHA 5FNVA 2PA3A 1W5AA 4MA5A 4ZXFA 3WMWA 2FSPA 1QO0A 2WUGA 4IF4A 3WBJA 4DRXA 2DEUA 4N01A 1LFDB 1F38A 1LDMA 2CHUA 1TCVA 1JX6A 3K4PA 3V8EA 1PYGA 1IQRA 3D9QX 3R7FA 3L8FA 3TWOA 3Q3GE 1TD9A 4GQIA 4Q7EA 2OBNA 4WNAA 4MV9A 3SEQA 2BIFA 4C0LA 3WNBA 5J1SB 2O8EB 3OMWA 2ATVA 4O29A 4J2TA 1LXCA 1B2RA 2FGJA 2QRVB 3DBHB 4UCWA 4P7GA 3L8HA 4MB0A 4DA0A 3AU8A 3OPYA 4D4GA 3KJXA 1Y7TA 2P2DA 1RBMA 1Z7YA 3CRMA 1GU7A 5JVDA 3EPJA 5CFNA 1O95C 3D8UA 3LPMA 4FCTA 3BUSA 4ZPXA 2JAPA 1XCPA 4FINA 1O3YA 1X13A 1IHXA 2QAGA 3F8WA 5G0VA 1E5QA 2C42A 3KOZA 5CM8B 4ER0A 1Q50A 2DPHA 4TWJA 3FFWA 4MP8A 5GGYA 4BS9A 1L2TA 3QIVA 1DWOA 4E15A 2NU6A 2I80A 3VBEA 1ZMTA 3T5PA 2IH2A 4N49A 2XKBA 4OQMA 4FYXA 3N8GA 3WA6A 4CCAA 4DDMA 3GDWA 2FMUA 3EYAA 5BN4A 3MS7A 2DBZA 2MSCB 5HXAA 1V8FA 5CH5A 3ADKA 5CLFA 4D6PA 3G5LA 2P9JA 3QPUA 1XO1A 3OKCA 1QO7A 1WB4A 1ZEMA 2JFNA 2ZRIA 3SC2B 4OYHA 3SX4A 1JEJA 1LVHA 2AFHB 3VHLB 4IIUA 2BJHA 3M4ZA 1DEAA 2CLFB 1U1FA 1RQNA 1D4AA 5DI3B 3RRZA 3C24A 4NP6A 3U81A 4IFIA 5E7IA 4N8EA 2CWDA 2YQZA 3ENNA 3VH3A 4OLHA 4BL5A 1DHTA 3QNMA 2WHPB 4TWAA 1SN7A 1BKDR 2UYQA 3D0KA 4OL9A 2X5JO 1LRKA 1U2QA 1L5LA 5ALLA 3ZX5A 1BDBA 3JR7A 3X44A 4V0ME 4LUCA 2XNCA 2XGJA 5FA5A 3L7CA 3HEAA 1ISFA 1F6DA 1M1YB 2AX3A 2ZXFA 1CPYA 3MUNA 3CF6R 4K1LA 4NENB 1CR0A 1SM4A 3KAQA 4ZOLF 5K0TA 1EG2A 4WXYB 4MPDA 1UFRA 5T64A 4AXXA 2DWQA 3AW9A 4WV3A 2J9RA 4HKTA 4V38A 1R4MB 1T1IA 2YHAA 4ZRDA 2B30A 2W2NA 3FYCA 3H5AA 5DBOA 6CHYA 2JGNA 1YB2A 3E23A 4FZJA 2J9ZB 4MA4A 3G6KA 4GKJB 2H1CA 1CETA 2Y27A 3AF1A 5TJ9A 3ETDA 2WHRA 4KOEC 3SC6A 3WKAA 1SBIA 2HSDA 4LTDA 4UASA 2Q0QA 1QQTA 1T9AA 3GFGA 5LVAA 1WUJS 2H7XA 1WDKA 5D3KA 4H0NA 1SPBS 4KW7A 3Q7EA 1R10A 4P35A 1SC9A 3D3NA 3QKIA 4FNAA 1AIPA 2W2KB 3OZUA 1GFIA 4ZKDA 3SAJA 1GP2A 1GZ6A 1JP7A 1KAMA 4GI1A 1Z3CA 5AYVA 4E2ZA 5C4MA 2JI8A 2WTXA 2FFAA 5H9WA 1DT3A 3REQA 2H3EA 2RGGA 2WKWA 3PDHA 1U81A 2XMDA 3M9XA 3SD7A 4BGIA 3FYSA 3LGAA 3AERA 2EWMA 4CLXA 1AUVA 1DPGA 4J0QA 1TX4B 3RJ9A 1F51E 1R88A 1F2TA 1DX4A 1FK8A 1MVLA 1HDZA 1Z35A 5A9TA 5B1SA 1CD5A 1H9AA 4FKBA 5B2FA 5IASA 3K1AA 1MU0A 3QBEA 2BSXA 2C7RA 4EARA 3FI0A 2XITA 1VTKA 1NUUA 1ULBA 2X40A 2ZR9A 3W8RA 3I3OA 4XSHA 3Q10A 1AF7A 1S2OA 1LC3A 2YYAA 1J24A 4DR4B 2Z43A 2ZI4A 5DBHX 3BDVA 5KB3A 4RHTA 1WAMA 1X6VA 2GHRA 2ONYA 3RAJA 3OLCX 4RY9A 2AQIA 1RZRD 4ZYTA 4RM2A 5CLGA 1XTZA 5CFLA 2X3FA 2DGDA 1DRKA 4EF5A 1VHDA 3FCCA 2BD0A 3DZBA 3LVBA 1T3HA 2CE2X 3FBWA 2Q1XA 4XVHA 1E0DA 1TVMA 2OQVA 1X74A 2LNDA 1TJNA 2A67A 3PXDA 1SVWA 1T0UA 1H22A 4O4HF 4TLEA 5JZOA 1P4GA 1YGPA 4TL9A 2ZWOA 3ZDDA 2PUTA 2EKLA 2PH1A 3AB8A 2RBGA 4RPHA 1L3CA 1KETA 2IYRA 3KLBA 4XGNA 2PY6A 1AV6A 3AF4A 1Q7EA 1XWIA 2A0FA 3VI4B 3ZGYA 3NP7A 1UMDA 2FZWA 1E2EA 2FRDC 1UT8A 2AD5A 1V35A 4ZTZB 4MUMA 1FP7A 1T3TA 1FNDA 1QG6A 2NXJA 3BGSA 3H9UA 1JDSA 2PMBA 2X1LA 2GAAA 2Y8EA 3Q7QA 4GSLA 3UPDA 5KTOA 1NBEA 2EJUA 1KQ3A 3OCYA 5LBUA 3VSEA 2D7DA 4A0SA 5JJBA 4GOXA 4EHJA 3GLQA 2DJIA 1UFKA 3MERA 5EINA 1CSEE 3ZI0A 4D57A 1T36A 1WCIB 3K2EA 1K7SN 2OLJA 4WKGA 5EXDA 4M46A 3GLIE 2DSTA 3NCHA 1EG7A 1FMCA 1T5DX 3GAAA 1RXWA 1Q0SA 3KUCA 4JYBA 1MB0A 4X0EA 3HPRA 4OTZA 4GI2A 4BMSA 1V16A 1Q0RA 4GRAA 4ARZA 1M1NA 1C9MA 1U3UA 4V3BA 1GTZA 4BO9A 3NDRA 1WXGA 1ZN8A 3D6FA 1TTHA 2FMFA 4UDOA 1E9EA 2ORED 4K8RB 3P9KA 5KJ1A 3HACA 2OHVA 3AOEA 5ESRA 1GPMA 3BL5A 3MCTA 3N59A 2GILA 3H4MA 1RC0A 1ADBA 4LDAA 1ZD2P 1E9CA 2QU7A 2HI0A 2VUHB 3D5EA 4LOJA 3EX7C 1QP4A 2JIBA 1LLCA 4MVJP 4UJ3A 2XCQA 1SQ6A 1Z62A 5BY2A 3BQMB 3N07A 2W6IA 2ZATA 3D8HA 1HDXA 4M0KA 2ZB3A 3BD7A 3C3PA 1AKVA 3CRQA 3S2FA 3T12A 5KWSA 3D6HA 5EMLA 4MTCA 1PR1A 1RQRA 3U16A 4BAZA 2IEBA 2IEAA 2I6TA 5DWVA 2A88A 4BNYA 4EVQA 2VFAA 3B52X 1L5HB 1UCFA 2ZS7A 1HE3A 3SXPA 3ABIA 4MW7A 4FLEA 1G5TA 1IN6A 4JNCA 3PXCX 3E9YA 1N8SA 2B4KA 4YONB 4IIXA 3G0OA 2P0EA 3G1WA 3QXGA 1V8OA 4DLBA 4ZYZA 1NLFA 2WG1A 1ZUIA 3BD6A 3M6VA 4M4SA 3ZZUA 3TZHA 1ULAA 3AYZB 4IPTA 3ROFA 4DYHA 4TKZA 4CQNA 4XX1A 4U7TB 1KYQA 5ALPA 1MDFA 3DOEA 2F8SA 2I3ZA 3KZOA 4K9NA 4WBSA 5DF1A 3SY8A 4A73A 5JDCA 2B4AA 4KMRA 1KY4A 1JQEA 2ZK7A 3T99A 5KKAA 3LXUX 4EY3A 1K3UB 3G0GA 3VR5H 4ZCRA 1MO4A 4JI3B 5ARCA 8LDHA 4A6EA 2WU0A 1VE6A 4XQGA 1ZQ9A 3I39X 4NK4A 2ZB8A 1W76A 4CWAA 1GPH1 1Z0ZA 4M1SA 4L51A 1G8FA 2HNBA 2OCIA 1ENYA 3EC7A 3HVHA 3KQOA 4ZTBA 2GM4A 2CL7X 1VCNA 1L5ZA 4FFMA 1WE2A 4M60A 1H2RS 4PPQA 2HU8A 2X2FA 3F98A 4F1JA 3JYOA 4ENRA 5BWBA 3ESYA 2B8WA 4JHXA 1CUZA 2R60A 1QOPB 2YXDA 4INPA 5U4XA 3ZOKA 4KNWA 4C4XA 2A4MA 4UKDA 2CUTA 4W8GA 1W36B 1QFYA 3NVMB 4HQRA 1WXHA 4L85A 1FBTA 4IMPA 1WUHS 2GA8A 4REMA 4B3XA 4PTZA 5F7XA 3V7UA 1F6BA 3LX4A 2PL1A 5ALHA 5H16A 4QAJA 2YBEA 4PXAA 4PLVA 1MW9X 1B16A 3MEQA 3GFQA 1J5XA 5JDIA 2FN4A 4FZVA 4DLVA 1P1RA 1H8EA 1XYYA 1BX1A 3X1ZA 3PZBA 1O9GA 1WUYA 2GJKA 3JD2A 4B43A 2QQ0A 2QHXA 3KOUA 5H81A 5EKXA 4KITB 2C97A 2DKFA 4X95A 1CUYA 3VTFA 1Z6GA 2IXBA 4DY6A 2P2ZA 1QK4A 1OMOA 1W49A 3K9NA 3VDNB 3SYNA 3NHBA 4D9HA 4RD1A 1NU6A 3H5IA 4JLAA 4NFSA 1AMOA 1FJGB 2DRIA 1CQIB 1GFSA 1KYTA 2H5LA 1NE7A 1ZUWA 2OV4A 2VXCA 3IJ5A 3P2KA 4XLTA 4JDPA 2HLDD 3K9BA 4CQMA 4DMRA 1VLJA 3OJCA 3JALB 3KUUA 3TLMA 1VJGA 1NYRA 3NWBA 1N5KA 4W8HA 3ECSA 2IIPA 5B1YA 1R0LA 2FUG6 1TCUA 4Z1MA 1JZQA 2E5FA 3NEJA 4QUAA 1QU2A 4NBRA 4MQMA 2AG5A 5A1JA 2XUDA 4H18A 2WIFA 1SXJC 3OQHA 3AWDA 4Q18A 1QFXA 4REQA 1IIBA 5AVZA 4L9RA 5AM2A 2OCBA 4YCMA 3X3HA 5IN5A 4GAEA 1G20B 2AFIB 4KIWA 1QDLB 4D02A 3AVVA 3LCJA 3HP7A 3KXDA 1GQSA 2PX6A 1YMUA 4ZMBA 2CB9A 3LL7A 1ZSNA 2FWJA 4OEHA 5C31A 4BQNA 5J40A 4HDKA 1MGPA 2NQTA 5JXGA 3PR1A 1ZVKA 4F6RA 3AEKA 2XW6A 3I12A 1TI7A 2ZIXA 4FKZA 3GLFB 1W29A 3SF8B 4ZQHA 3UH0A 1KS2A 5CVVA 5FTJA 2IZ7A 3DVAB 3OA0A 4YRNA 1WVGA 1RWXA 3ZVRA 1ZCAA 1QTRA 3UJ3X 5FEUA 1OH8A 3GUHA 3OUTA 2PL9A 1QRAA 5F51A 3GJ3A 3OBBA 1LB1B 1XC7A 1DTWB 3OQ1A 1GPKA 2A1UA 4MWSA 3AG6A 4BE9A 3WV4A 3ANYB 4XX0A 1U94A 3CNLA 1EM6A 3D4PA 3BJIC 3UMGA 2DUNA 3FPHA 2EKBA 3KXLA 3TLYA 3UXEA 3DVRX 2OLEA 4OUDA 2AEEA 3SVZA 4PC7A 3MBIA 1JPUA 4NV1A 2BM1A 1OPRA 2WJZB 3GG9A 3Q2IA 3Q4GA 3ZY4A 2ZSUA 1Y8RA 2IY9A 1N8TA 3BCHA 2QY9A 4U7JA 2CEAA 4S1WA 4ZCIA 4BQIA 2ZS9A 4S1NA 1I14A 4QUBA 2OK8A 1Y3AA 2Z8XA 3JVVA 4RWEA 2JAHA 3TSZA 2G9VA 5HJ5A 4FLMA 4JY7A 2XMBA 5JAMA 1GZ4A 3JYPA 3HMKA 1QO0D 4LY0A 3ROEA 5KEIA 2PZBA 2H18A 1FXSA 3ICCA 1TU4A 1S02A 3QHQA 3LFTA 3U3MA 4GC9A 2BGWA 4Z8YA 2DLNA 4Z3OA 3BF7A 5AOCA 2JI9A 2PXXA 2VJYA 3AC0A 4FIDA 3W1EA 1FLDA 2QXUA 4IHKA 3W9BA 4PYIA 3IEIA 2JD2A 2EBUA 2FP4B 2DU8A 4P54A 4TPKA 3C1OA 5HDQA 1QBKC 3QW4B 1SC4A 4YRRA 1Y7LA 5AM0A 3ZWMA 4RX1A 2QSJA 1L4LA 1TLTA 3G88A 2JFWA 5I9MA 4R8SA 1R16A 1QWOA 4TKVB 4ZTUB 3TTUA 5CDGA 2LBPA 3W77A 4AJJA 3AEZA 3VZRA 5KX5A 2ZQ5A 4MYHA 4ND6A 1Z0AA 2NO0A 3PQ4A 1ESMA 3GW8A 5ARDA 1Y1SA 2HIMA 5EJGA 1VPEA 4DLYA 5GIOE 2BTEA 1J25A 1Q0UA 4D6YA 4E32A 4F04A 2F4NA 3DUFA 3YASA 4E5YA 2QN6A 1U7PA 3T9DA 3JXEA 3TR6A 5BYKA 2B4TO 2FJPA 3IRUA 4MI1A 4MJLA 4YBRA 4BP9A 2Y4NA 2V96A 2BN4A 1C0PA 1VMIA 1KDRA 3IOEA 5HDBB 3JVIA 1G19A 4RXTA 5JALA 4QRHA 1SKBA 3KDSE 3QE0A 4MVJA 3RUEA 1HNXB 5DSTA 4L1KA 2CJYA 3R76A 4YECA 3OZCA 2IS2A 4FOLA 2N9UA 2XAAA 3OKPA 4R2WA 3EVZA 1CHNA 1RIFA 4N03A 1KF0A 2PBLA 1I2AA 2FCAA 1R6VA 3FRHA 3OHPA 2Q5CA 4FYIA 4L50A 4DLTA 1F8FA 4JLPA 2R6ZA 1P1KA 3ZX4A 2G5PA 4U7PB 5KNCA 1TVEA 2VP2A 3MCZA 1FTWA 5HIJA 2R5WA 5AKKA 1JSLA 4BFYA 1NPYA 2FKNA 2PBRA 3ORFA 5FFFA 5BQXA 3NOQA 2PKEA 1H8HD 3HXLA 5FADA 5CT4A 5JYCA 3G7NA 4C9BA 3RVSA 4QOIA 2VJQA 3ND9A 2BE7A 1Y1LA 2YV3A 1QGOA 1XBTA 3FRIA 3KR9A 3L0DA 3OD5A 3RTAA 3T3EA 4S35A 3S55A 4MHTA 2P5YA 3K6SA 4O4JA 3VOBA 3J81A 3HB5X 3ZQKA 4NTZA 2NVOA 3RS9A 4G01B 3ND8A 5LXTF 4ASUA 2FUCA 4X00A 2IDKA 4IJKA 3PX2A 4DLXA 5JD4A 1P0CA 4DBZA 4JYPA 2D5LA 4DQKA 1ZQ1A 4PG4A 2QVZX 3WDLA 1F2DA 1EFLA 1KSHA 1P6UA 2C1EA 2RKOA 2FQXA 4W7SA 4N3GA 5GJBA 1EK1A 1N2EA 2H4JA 1Z33A 1ZD5A 2VNJA 3A6DA 1D2GA 3VI3B 5IT0A 3CBQA 3BWYA 3SU8A 2ZBUA 1AUOA 4IY1A 1G6HA 2Y05A 3A26A 1TFRA 4S2UA 13PKA 3WLMA 3U3JA 5IF3A 3HKBA 1FS5A 4HX2A 1JR4A 3R7WB 3CEMA 3DPUA 3ZI4A 5IT4A 1VDMA 1E5XA 4YHHB 1IM2A 3KLNA 5C3MA 2X6TA 2VPXA 2IXFA 2DUMA 3WB9A 1GPLA 3ZY2A 1JHXA 4OUKX 5CG2A 4OP2A 3WYCA 4V1CI 1YMQA 2BC9A 4XFKA 2NU8A 3U9LA 4QTYA 3BRWD 3KT8A 2B34A 2FZ4A 4P6VF 4D1YA 3EC2A 5SICE 3UEOA 1F7VA 4IRMA 2NT3A 2ZYHA 5IJ9B 5AM3A 1ZM4A 1JIXA 3QVKA 3F4LA 1I4LD 1NMZA 3LFHA 4HDNB 5E3HA 4DMMA 4X62B 4IVQA 5EQTA 1P75A 1ZNXA 3IDZA 3NANA 1F0PA 1PYOA 3QYJA 2RJNA 3RS3A 3ZHSA 1QXSA 4E6EA 2R6AA 4UU8A 2M6RA 3VZSA 4JQSA 2F59A 3P9NA 4ALMA 1M1YE 2FLKA 3WP0A 5IAGA 3STXA 2WA1A 3DFIA 1WDWB 3ZBPA 2ONKA 1NLZA 1QZXA 4F7DA 3DPIA 2BFBA 3OZTA 2H51A 3TD9A 3H83A 4OI1A 4Y8VA 2OD7A 3H97A 1GQQA 4JOQA 4PG7A 1ZU4A 5TT0A 1V7QA 5E7QA 4YRAA 1KTVA 2WJJA 3VR6A 3D8SA 5KO2A 1E1KA 4W6QA 5IHPA 1C7EA 3G1TA 4NYIR 3AUUA 1MC5A 1R18A 4LBZA 4ISCA 5CB0A 1XLTA 1DC3A 3PGVA 2JEYA 2MYUA 4MLDA 2EARA 4UPDA 5D6NA 1TW2A 5G3ZA 1E7SA 3CZPA 2ODWA 4PZUA 4KCGA 3MTEA 4YMIA 1E1NA 1L9KA 3C70A 3LXMA 3DW3X 1JH8A 4NZNA 3MHPA 2HA3A 3L2OB 4V0NA 5EEGA 3DGEC 4U00A 3FMOB 5FKJA 1JH9A 4G63A 3PQEA 4Q4HA 4CTOA 3FZNA 5EHZA 1EGHA 1V9LA 3LNCA 2F1OA 1HLGA 5E0OA 1KO4A 2QJOA 1ORRA 3BKWA 3A1VA 4OFXA 2XE6A 2QI9C 1T6XA 3NIWA 1D1TA 1T9GS 2H31A 2E1RA 1MUUA 1KQNA 4E88A 3IIMA 2RGCA 3L3BA 4ZZ2A 5LOVF 2PGNA 1J4AA 2VOJA 1WO8A 4DSNA 3IIKA 3IP8A 4FC6A 3NASA 5CXXA 4DCJA 4GBGA 5E4JA 1OYYA 2ZSHA 3L5KA 5A5DA 1ZP6A 1YOVA 2V74B 4H4CA 1D2MA 4AS3A 5CIYA 4DSZA 5JAOA 2SHKA 4B3RB 1XNHA 4UVEA 3UGKA 3HKEB 4J90A 4PPGA 5FQNA 2A14A 5JG7A 2EFJA 5ALDA 5DNVA 1KE2A 4A6PA 4BNUA 1IZ9A 1JFFB 1MFPA 4ZC1A 4CF5A 8ATCA 1BDJA 1JKJB 1EJ2A 1XZDA 3S3TA 3BDIA 3PQCA 2FK8A 1JLRA 4PICA 3TQCA 3EVTA 1M8KA 3WJ7A 2ZTVA 3K5IA 4KTTE 3RUHA 2B98A 2GN8A 1M34A 4JEUA 4OKSA 1ZM9A 3ET4A 1FY2A 1TXGA 4JJFA 2OG2A 4KG7A 5DCUA 5F3RA 3UB2A 3THYA 1FFXA 3P2JA 2W6ID 4QJIA 4KQEA 1SUSA 4M2LA 2IYVA 3B6ZA 3AL3A 5H83A 5TMEA 4GO1A 2EGUA 3D54D 3LNTA 5CA0A 2Z9DA 3L6OO 3EN0A 2I54A 1T8RA 2W90A 2Q0XA 2ZJYA 3N2NA 3OFJA 3R1IA 4HI0E 1NQXA 4D3FA 1I2CA 1G21B 1GWNA 3DZKA 4PYLA 1EJBA 1S01A 5JD6A 1II8B 3FIUA 4GOMD 1CB7A 2JIRA 2X8JA 3D6TB 4MUEA 2YW2A 3I62A 4PRKA 1VHQA 4AWBA 4FQ5A 5EJ8A 2OTCA 5JLJA 1JIJA 1IRXA 2JDIA 4AD8A 1E2LA 1YL6A 2QZJA 5C35A 2QPLA 1HT1E 3IAXA 3JQ8A 3EAQA 1FQJA 1T10A 2CMFA 2EXXA 2XOXA 4ZMSA 3W7AA 1ORVA 4R3NA 3FD8A 1P2SA 2GYWA 4R8VA 3ROTA 3TXXA 5B3JC 3KHUA 1WBDA 2QOEA 1MZPA 3DKPA 3G2NA 2V65A 4F97A 2DPLA 2E21A 1EA5A 4KUGA 3R40A 2ZPUA 2IXGA 2WT8A 3Q7TA 3H1EA 5HTKA 4R84A 1G55A 2VJBA 1KE1A 4DLSA 4P2GA 4TMVA 1QIJA 2BZSA 4IIFA 3I04A 4IJVA 2OHHA 3UQYS 3DEIA 2JJYA 2IU4A 2DJ5A 2EQ5A 4S24A 3ZLTA 3A10A 2AF4C 3INYA 3NC0C 5C1PA 1L7RA 2N46A 1I1QB 3N6VA 5C8YF 5L3QB 1Z6TA 2WF8A 4ZO6A 5LP6C 1XD8A 4A36A 2JGFA 3NNSA 5JTUA 4TKLA 3DBOB 1E59A 4V3CA 1D6MA 1N7JA 2O1XA 4QECA 3UWMA 3GWGA 3C3BA 1THTA 4CKZA 3C5HA 4HOYA 3WGIA 3OFSA 2EX4A 3D4LA 2GKGA 2P4UA 5FBHA 1QH8B 2G25A 2H5JA 1FFHA 4QM7A 1Z0IA 2VTVA 4QDKA 2PZFA 3N2GB 1WZCA 2FXVA 2V1XA 2DQYA 3BSWA 1HETA 3GP8A 1E8DA 3U7IA 3WWEA 2G5TA 4DILA 1HTTA 1U0JA 2HH9A 3J7AC 1LWNA 4ZDIA 1H8ED 1UWVA 2YX1A 1Z74A 3FBTA 2JCXA 4YCSA 1CQJB 3ACCA 3HU1A 3ZDYB 1HX7A 1G8HA 3LUCA 4PO3X 4P80A 2HJSA 2FSSA 1NVVQ 2LGJA 1T43A 2PX8A 5PGMA 2BE9A 3GQBA 4BUCA 3EFEA 5MFZA 2WTEA 1X94A 1U02A 1BROA 1OWPA 1EVJA 4HDCA 4NHEA 2XPCA 5DGCA 2G63A 4TROA 4DDTA 3K8OE 5D1HA 4HAVA 3P1JA 4CQMD 5BR4A 1NVEA 2C78A 1YHZA 1IULA 2FVYA 3FH0A 2HRBA 4B31A 5GTDA 2ATCA 3Q6NA 1TVCA 1UXHA 2D0IA 3KHKA 1QJCA 1GGMA 1TGYA 4WY2A 4AMYA 3O8OB 2ERYA 4YAJA 1WXQA 2QVCA 3PPWA 4ZVMA 4RJLA 3U2QA 3ABQB 3GT4A 1SBQA 1JJBA 1JR3A 1Y8CA 1HDOA 2QQGA 3CISA 4Q4AA 3S7ZA 4CM5A 1GZ3A 4FILA 5L8VA 1N1DA 1TIBA 2H07A 3G8DA 3SC4A 4WHMA 1O9HA 1XUOA 3C6BA 1YJAA 1LQTA 1FFCA 1HZZC 4XFJA 5BNFA 3P0RA 4CV3A 1D4ZA 2QLTA 4MKIA 4KO3S 2QYOA 3RWBA 3RV3A 4CG1A 2WU1A 3QOWA 5JWOA 3E4CA 1JXOA 3BRCA 3LUFA 4DG9A 2JH3A 3VR2A 4B3BA 221PA 3EVCA 3NHKA 4U0JA 2ZSIA 1ST3A 1JJIA 2JLQA 4OHFA 1VL5A 3WTCA 1JG6A 4CF7A 1KPHA 3R5TA 4RJJA 4L9AA 2XJ4A 5JC1A 3P4YA 1OZ0A 4YP6A 2CLIB 2H11A 3K92A 4ND8B 4CPDA 2HR1A 1M76A 1T0BA 1CF4A 5JXHA 1X7HA 1C3OB 1JFVA 3IHTA 4IDFA 2QTZA 4JVNA 1E6EA 1NL3A 2IFTA 2XLBA 3EXG2 2BFAA 1ZJ6A 2QGNA 5K99A 2HPAA 4KX3A 5DWQA 5BN3A 3OU7A 1C1YA 1GSIA 3H0KA 3TN7A 4D2IA 5AQ1A 4BWVA 1DBQA 4LDQA 3QYAA 1NBME 1L8XA 4P4SA 1EX9A 5DOZA 1H4QA 4KI7A 4DMLA 2OILA 3I0ZA 4PQRA 4C7BA 2C4HA 3ZHBA 2CNDA 2EQBA 2AE1A 1V96A 3DSRA 1KEZA 4OGFA 2ZJ0A 4F56A 4L5AA 4L78A 3SQXA 3T38A 3BMOB 4WZAE 4ADSG 1B76A 5B55A 4PO1A 4Q21A 3EJWA 3FHTA 4GPTA 3ROMA 1G20E 3L7JA 2PRIA 3C3JA 3WLKX 2P9QA 3NH6A 9ABPA 1J1UA 3L49A 2OA0A 1FFYA 4P86A 1GRNA 4QKQA 1SIOA 3U4HA 1BA2A 1CR1A 1M5TA 4D45A 1C7FA 3LRTA 4BNLA 5L40A 3DVQX 1DEHA 1HBJA 1ZJ4A 4MLZA 1N4DA 4RCZA 4EFKA 3UBTA 3GLFE 4KN6A 1CFZA 3QBJA 3V8RA 4DYDA 3TLGA 5C46F 5HMMA 1T9HA 1P4AA 1Z0KA 3CXRA 4CIVA 1NRXA 1E9FA 2PS9A 4QBFA 5FOUA 4EG3A 5FTNA 3PD0A 4MKGA 3EXEA 5LIRA 2R8ZA 3L7MA 2I2BA 2ODQA 4O25A 4OOEA 3CRVA 1CUVA 4Q9IA 3SICE 4OQZA 2Q4EA 4EKDA 1WB5A 3WYDA 2Y6VA 3FN4A 3LUBA 3QKTA 3U7QA 4AULA 4E3ZA 4G0QA 5IU6A 1XV5A 3ICPA 1WB9A 4B6GA 4RMIA 2Q2QA 3EA0A 1U8UA 4B4DA 2Q5IA 3C97A 3VH2A 5CCDA 3C6YA 1TCBA 3D43A 1XQ6A 5ICEA 4MVJD 1TPYA 1C7RA 3FM9A 1ANKA 2B4QA 2EV9A 2QEQA 5JPIA 2RI6A 3PA8A 3A06A 2I33A 2NV6A 5E1OA 3HJUA 3KOYA 3PCRB 1CULC 2NV0A 5F7ZA 4C78A 4EGSA 1T6BY 3FKJA 4UHEA 2EW8A 4LF9B 2WYIA 3DAYA 2WIKA 1JRLA 1EB9A 4G85A 3O73A 3O84A 4GEKA 4PYJA 1Z15A 4EW1A 5BMVA 3E3AA 5KNCD 1DG9A 1GEEA 3D8BA 4RIGA 2AHOA 5DYWA 1QRUA 1K97A 2UYGA 1VIYA 2Z5VA 1P7WA 4LOHA 5DTJA 3UC9A 1EAYA 3QGMA 1AS0A 3IBFA 2VLIA 3MS2A 2XGMA 1XP5A 3OH8A 3BIXA 3ESXA 1NMQA 3KZVA 5A7GA 3M2TA 4FMDF 3I45A 3V55A 1VJRA 4X7RA 3WMEA 4F5DA 1RLUA 4F60A 2I91A 3O4JA 5FP0A 4ASUD 421PA 3IR5A 1A9SA 1JJ7A 3CO0S 5CB6A 2QR5A 3O92A 4FMCF 4UVHA 4RTSA 3K09C 4G1UC 1OLXA 4UCXA 3G2MA 3HWRA 1II0A 2PS1A 2V0NA 1BSVA 2ZREA 3AFGA 3AYXB 4FHZA 4L0CA 4MUXA 3PX7A 1OXTA 1NGSA 3W3AH 1UOPA 5DZSA 4FB5A 4WWHA 1Y7IA 3DZ8A 1F6WA 1FFGA 4LA4A 4FK8A 1U8XX 1Y1KE 1PJLA 2O2XA 2ZW9A 4IIJB 2IHKA 4L9SA 2I6SA 1IIRA 1KRHA 3GA0A 2RH9B 5EP4A 3HUUA 4IG4A 1BW9A 2QD1A 1V1JA 4E5SA 1YASA 1Z0DA 3FCAA 3PQ6A 2C9MA 2PKRA 1VKZA 4OU4A 5HILA 1HE4A 2GM3A 1X8LA 3FHOA 4AF8A 2ZBVA 1RPAA 3F7OA 5HBGA 2VP3A 5K0GA 1EX7A 1RAEA 4DTCA 4M54A 1VKOA 4YGYA 3PDUA 1MJHA 3F6BX 3MBOA 4FWIB 2Q1TA 2G9NA 4UOZA 2QTRA 2ZXUA 4KFCA 4OBBA 3ZDEA 4YJHA 3QEMB 1R8JA 1PJRA 1T5SA 3A6HA 3DMGA 4PZLA 1X7XB 4IX9A 4YP0A 3VR6D 3IQGX 3N75A 1EDOA 4OYYA 1U7WA 4V0LA 5CTAA 1DAKA 3SSNA 2RD2A 1XAGA 1K7XB 4AJNA 1PSWA 4MS4A 2D2FA 1IBCA 2YIMA 4M9RA 3MT0A 3HVRA 3M6LA 2D2EA 2WJPA 1YCDA 4QLAA 2AG6A 1JSCA 1GNSA 1TA0A 2VJPA 1KHTA 1YKSA 4J7AA 4ZEOA 3V7YA 3CNBA 3A7DA 3NWJA 4U9HS 5KYYA 1N32B 2VH1A 3E27A 2XOKA 4NJEA 3W4JA 1ZRNA 4LGVA 1XMVA 1ZXXA 2JKZA 2MDTA 4ZT5A 4EG0A 4BN4A 5D85A 2OAP1 4A6DA 4MYRA 1NT4A 3EDOA 1UBNA 3VJKA 3OO1A 4FFBA 4B4UA 5KOIA 2H59A 5KZMB 2VWHA 1C7IA 4HB0A 2AH5A 1P45A 3AR8A 5B7GA 2Q3JA 2RHWA 3VDRA 1W19A 3TQTA 1SR8A 1YUMA 2JGRA 1Y1TA 3QBVA 1HPLA 5EXXA 3C1AA 2YY5A 3EFOB 3G9UA 1JEYB 1W1UA 3RS7A 1BE8A 2CL5A 3BGOS 3W1WA 1NF9A 3WGLA 2YWGA 1AUPA 4CU2A 4PTLA 3DFUA 5HIMA 1Z2PX 4RNDB 3UG7A 4JKOA 4ZGBA 4RV5A 1ONNA 2BWJA 1ZJJA 2ZBEA 3BULA 3MXOA 3PDWA 2P4HX 4L8FA 1E2DA 3HB7A 1TYEB 3L1JA 4RQAA 1JB9A 2BDEA 5L7WA 1GO2A 1B26A 3DS8A 2YRFA 5C32A 1TZBA 2IOYA 5DU2A 1ILWA 1BXRB 1JYSA 2C5SA 3EZ6A 4RD0A 4EBFA 2DQKA 3C48A 2JJ1A 3V3KA 2Z2XA 3WISA 4F2HA 4TL8A 3O2JA 2OGTA 4D8WA 3WZMA 5JC8A 5F3DA 4H35A 1K6IA 1XA4A 3HM2A 5JMPA 4ESOA 3E58A 4RQBA 1LPNA 1TA9A 3AJ8A 1Q6YA 1T8SA 1FQOA 1KY2A 4OQDA 5KHAA 5F21A 2CUKA 4FMDB 5F1OA 3RVBA 2DY1A 7YASA 3WL7A 1GPAA 2PQMA 3GMDA 4OSEA 4RC9A 2AOTA 1SOVA 2J0UB 3IUBA 4K9SA 2GBLC 4OL0A 1W30A 4Q3CA 4IOMA 3ADBA 4RGBA 2G17A 1HDRA 4M76B 1G7CA 3HFSA 3FDJA 4TV8B 1YS2X 2I87A 1IZ7A 2MSWA 3HFGA 4MJ3A 1E7WA 1WLYA 1D2RA 4BV2A 3HGMA 1D2HA 1RJWA 4IOLA 3I6YA 3N58A 2JDID 3A6PC 2J3HA 3FNRA 2RHGB 5HZHA 4L72A 4G97A 2LV8A 4KDCA 5FNVB 3BORA 3ASYA 1EWKA 2FEKA 4DRXB 1W4ZA 4QU8A 3RFVA 1I0LA 4E7OA 4RCYA 2QG4A 1U2GA 5DHFA 1C9JA 1I0IA 2GYUA 1Z5WA 4C7VA 3CE9A 4WNAB 1A7AA 2MOKA 2OAQ1 1TO2E 4Q1BA 1B0PA 2W71A 1C8LA 4LS3A 2A84A 3EH2A 5HF9A 4YRSA 2YOFA 1GVNB 3DTTA 4W82A 3OPYB 4L27A 4M9SA 4PW0A 4Q01A 1WXFA 2G6BA 3RIGA 1O0BA 1QPZA 4DC0A 5JVDB 3E7DA 4MQEB 4L3VA 3H5LA 2H1IA 3B1VA 5AHXA 2DP4E 4ENVA 1XZGA 3BMCA 3HV2A 5L9AA 2QAGB 3A3OA 1MO3A 3NIDB 4LF7B 5DTQA 3JD1A 3HBLA 2H17A 4I55F 1DV1A 2OZEA 2IEIA 3A1DA 3E22A 5LDGA 4DVJA 3MB5A 5E7MA 4E4YA 4RV9A 5DYGA 3F7TA 3H1FA 1FW6A 4ZO4A 1ENZA 3EQ8A 2PH5A 2NU6B 3ZGVA 3OJWA 1YI8A 2ZUSA 2W6ZA 2FX2A 1R5NA 3KQLA 3ZNQA 4JMLA 4QDOA 3A27A 1IQ0A 3IPCA 2PLAA 1G21E 5HCUA 2LTAA 4MQ5A 5BN4B 2VQEB 2WJAA 3IVGA 3CF4A 3C5VA 1PJAA 3TH5A 3MYYA 2Q1SA 4E1VA 2HCJB 5IULC 3DLTA 1K4MA 5IPFA 1KK2A 2V6JA 3JWGA 4KO8A 5THQA 2A7QA 1K6MA 3CJTA 2V58A 4RMHA 3FSJX 2OEPA 2H1WA 2NAPA 5IDQA 2HO4A 4QA9A 1DG3A 1TTPB 2BEKA 4G8JA 2OV8A 4K86A 5H4HA 3SJZA 1WNTA 1XQWA 2IDJA 1MJFA 1T0HB 4BLQA 4PANA 1D2CA