1VBFA

Crystal structure of protein l-isoaspartate o-methyltransferase homologue from sulfolobus tokodaii
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
224
structure length
224
Chain Sequence
ASEKEEILRKIKTQELAEAFNKVDRSLFLPENLKDYAYAHTHEALPILPGINTTALNLGIFMLDELDLHKGQKVLEIGTGIGYYTALIAEIVDKVVSVEINEKMYNYASKLLSYYNNIKLILGDGTLGYEEEKPYDRVVVWATAPTLLCKPYEQLKEGGIMILPIGVGRVQKLYKVIKKGNSPSLENLGEVMFGRIGGLYGFYDDYDDIEFRVNKLERQIKSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How Oligomerization Contributes to the Thermostability of an Archaeon Protein: PROTEIN L-ISOASPARTYL-O-METHYLTRANSFERASE FROM SULFOLOBUS TOKODAII
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
molecule keywords 231aa long hypothetical protein-L-isoaspartate O-methyltrans
total genus 59
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2004-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vbfA00
1R00A 3HVKA 3O7WA 4FT2A 2OPBA 4PYNA 5FQNA 2H11A 2PLWA 4E2WA 3HM2A 5H02A 3ID6C 4WXHA 2NXJA 5M5BA 3KQSA 5HZMA 5HILA 4WVLA 2P1DA 3THSA 4RV9A 1L3BA 3AJDA 5EMKA 3KPVA 3SXJA 1VLMA 2IIPA 5FHQA 3EEYA 3B89A 4QDJA 1QAQA 2PY6A 5DRYA 1Y8CA 4YV2A 1FBNA 3A4TA 4IV0A 5EMJA 4E2XA 3KR0A 1N7JA 2GPYA 5BXYA 2JH9A 1YZHA 1JSXA 1XDZA 2QM3A 5E9QA 2O57A 3C6KA 3EVFA 4EKGA 4EVIA 2NXEA 3G2QA 2CKDA 5ICGA 3DTNA 3SVZA 1R8YA 5ICFA 1U2ZA 1IM8A 3ANXA 3KKZA 3O31A 3PT9A 1VIDA 3M6VA 3HNRA 2GS9A 3KQPA 2ZULA 3SSOA 2IDJA 3BKWA 1P39A 2QRVA 1SUSA 3A26A 3FUUA 3HA3A 2ZCJA 4OBXA 5IKMA 1AF7A 3C0KA 3PTAA 4ER6A 2IFTA 2PX2A 1JG4A 2R3SA 3CCFA 1N7IA 2XYVA 3KPYA 4YUZA 2BM8A 2ESRA 2YXLA 3TOSA 4PIMA 1N2XA 3T7TA 3E7PA 2O0LA 1XJ5A 2ZIFA 3C3YA 3HA7A 5FCDA 2WA2A 4KRGA 3U81A 3KQQA 2IBTA 1AV6A 4XUCA 3M6UA 4OX9Y 2EG5A 3CVOA 1RJGA 4YMGA 5GWXA 5LQNA 3BZBA 3C3PA 4RTNA 3MCZA 3CBGA 1HNNA 2C7QA 3REOA 3BWYA 1BOOA 1D2GA 3BUSA 2H00A 4CKEA 3ER8A 1KPIA 2QYOA 5EQJB 2CL5A 2QE6A 3SX0A 1SG9A 2AOWA 5CVUA 1RJEA 1YF3A 3EVBA 3Q7EA 2G72A 2NXCA 5DTQA 4CTJA 1O54A 3UJDA 4E2YA 4GOMD 1YZ3A 4GUAA 5LQRA 3LSTA 3BT7A 3NW9A 2UYHA 3KHKA 3NTVA 2PXAA 4PGGA 2B78A 4RX1A 5FQOA 1BHJA 3UJCA 3ERCA 4ER5A 5E9WA 2PXCA 3A27A 2JHCA 3HCFA 3I58A 3OU7A 4RTOA 4F86A 3EGVA 3ORHA 3OE5A 3LCCA 3ER9A 4RYLA 3VSEA 2PX4A 3EGEA 2IH5A 2I62A 1P1BA 3EVZA 5DX8A 3PS9A 3QOWA 1XCLA 2ZBRA 2ADMA 1X1BA 3FTDA 5DWQA 1I9GA 2OB1A 5FWAA 3B5IA 5IH3A 2AOTB 3EPPA 3OFJA 4R8RA 3TR6A 3A7EA 4U7TB 2I6GA 4RTRA 1BKYA 5E8RA 4HG2A 3IV6A 1R18A 3P9NA 4BLUA 4EQZA 2G1PA 2XYQA 1MJFA 1ZGJA 3BWCA 3M33A 5DX0A 4L7VA 2C7OA 5D1NA 4CKCA 3GGDA 4H0NA 4B17A 1NW7A 3KQMA 3V8VA 5DSTA 5DPMA 3FPJA 2GB4A 3BXOA 5ICCA 1SKMA 1PJZA 1I4WA 2R6ZA 1XDSA 4FS8A 4IV8A 4OBWA 5EMMA 1VBFA 4A6DA 5E1BA 3DLCA 3WSTA 2QY6A 3LECA 3THRA 5DM0A 5C1IA 1QYRA 5HEKA 3G8AA 1TW2A 1FP2A 1DUSA 3GRZA 3G2MA 1M0EA 2ZLBA 2OO3A 3K6RA 4M36A 3P2KA 3HCAA 3CGGA 3ELWA 2NP6A 4ISCA 3UJ6A 2EX4A 5KYGA 3OU2A 1L1EA 2NXNA 4QPNA 5EPEA 4MWZA 4DZRA 4E33A 5BP7A 1SQFA 1NE2A 2PT6A 5GOZA 1RJFA 4E2ZA 2KW5A 1P1CA 3CJTA 3FPEA 1D2CA 1AQIA 1JG3A 1SQGA 1TPYA 4YUVA 4HTFB 3LHDA 2DULA 1XCJA 3UWPA 2HMYB 3ELYA 3MQ2A 2EJUA 3MTEA 3R24A 4ATNA 5GM1A 4C03A 2ZW9A 1EG2A 3BGDA 5HFJA 3TQSA 2IBSA 3GNLA 3DP7A 3UFBA 3MAGA 4BLVA 2HNKA 2FRXA 3HTXA 4Y30A 4JXJA 3TKAA 3FTFA 4ER7A 3LDFA 3LX6A 2AVNA 5E9JA 4QDKA 5HOQA 5CIYA 4XUDA 1KIAA 3P9CA 4RTKA 2I9KA 4LECA 3UA3A 2FCAA 5BW5A 1KYWA 3JWJA 5B1SA 4MHTA 4BLWA 4PWYA 5EGSA 5E8JA 4C05A 4HH4A 2P35A 1OR8A 2OB2A 5DM2A 2OXTA 1NV8A 4PYOA 4PCLA 3KPUA 4PIPA 1KPHA 4X61A 1XTPA 2ZVJA 4R8SA 4RVFA 5JR3A 4PINA 2G71A 1EJ0A 1NW8A 5GINE 5D1HA 3LDGA 2ZBPA 3GDHA 3Q87B 2YUIA 4U7PB 4X63A 4OQEA 4KIGA 4RTMA 2PX5A 5JUWA 2P8JA 4YUYA 1KXZA 4RSRA 2WK1A 1KP9A 5C0OE 3FTEA 2YQZA 2FK7A 1RI5A 4LG1A 1EJ6A 4FT4A 5K05A 1G6Q1 3P9KA 2ZTHA 5KQRA 2PSSA 4PGHA 3CKKA 2VDUE 3D2LA 2WA1A 2B2CA 2E5WA 1M6EX 1I1NA 2EJTA 4PYMA 1EAMA 3DMGA 3TFWA 3G89A 4OQDA 5FUBA 1VE3A 1UWVA 2UYOA 3G8BA 3PB3A 3KQVA 4RTLA 3GU3A 3GO4A 2QRVB 4QVGA 1KR5A 3UJBA 2B25A 2P3OA 3DH0A 3DMHA 2IGTA 4IWNA 5CCXA 1B42A 3P8ZA 5K0EA 2Y1XA 3G7UA 4GEKA 2CWWA 2AOTA 2CMHA 2Y1WA 3EVCA 2B3TA 3EGIA 4M38A 4F84A 3DMFA 4HGYA 3E23A 2P7IA 4P7KA 5EC8A 1QAMA 3DXZA 3M70A 1JQ3A 1WY7A 5EHIA 3LPMA 5HIIA 1HMYA 4BP1A 3KPJA 4O29A 3UJ7A 3V97A 4EKIA 4RTJA 3AXTA 3UJAA 3MB5A 5DLYA 3DXYA 5EEHA 1QAOA 3C6MA 5FADA 1KYZA 3TLJA 3R6TA 3GWZA 5EMLA 4P7FA 3JWHA 3QV2A 4ZTBA 2JH8A 2ORED 2YX1A 4MTLA 4P7JA 4YUXA 2ZSUA 2LD4A 3H2BA 5U4XA 3IEIA 4X1OA 4LWPA 1R6AA 3R3HA 2FK8A 4DM3A 3PLAE 1VL5A 4FSXA 4FZVA 5F2KA 3HCDA 4A6EA 2HWKA 2FYTA 3BGIA 2PV0A 5DXJA 5KS2A 5CD1A 1RI2A 5CCBA 2PX8A 4GQBA 2O07A 3EEOA 1YFLA 2IH4A 2PWYA 3OU6A 4GC5A 3M4XA 4FGZA 3VYWA 1NW5A 3BGVA 3A7DA 3FYCA 3HEMA 3FUWA 5DRTA 5LQJA 1G38A 1VQ1A 2PXXA 1JTEA 3DOUA 3NVMB 3P2IA 4P7GA 4QQNA 5K0CA 3EMBA 2AOUB 3ME5A 3FUVA 5E1DA 4HC4A 2AN3A 2BM9A 4E70A 4GC9A 3SSNA 3FZGA 3HCCA 5HIMA 1SUIA 4C06A 5CM2Z 1VPTA 1EIZA 2IDKA 2ZFUA 4FSDA 2O06A 3VC1A 5E2BA 2CMGA 3FTCA 2ZBQA 5K0JA 5K0BA 4MQ4A 2YXDA 1PRYA 2AVDA 5ERGB 3NWEA 1JG1A 1NW6A 3EMDA 3FYDA 4V0RA 5EVJA 3BWMA 3F4KA 4AZSA 3LBYA 3FUXA 3MCTA 1V39A 4K6MA 3OFKA 3KQTA 3R9XB 2GA9A 4C08A 4C4AA 4PYJA 1JQEA 3HCBA 3LL7A 1XVAA 4M7RA 3I53A 4KDRA 1WXWA 4RTSA 3RIEA 4HRAA 5EEGA 1YFJA 1FPQA 5K0LA 3TKYA 5K0FA 3GRYA 1RJDA 5EKUA 4POOA 2UYCA 3G2OA 2XYRA 1SVUA 1JTFA 5E1MA 4UOEA 5ICEA 4MIKA 4PYLA 5K0GA 2IH2A 1QANA 4DA4A 2ZIEA 4Y2HA 2VDWA 2Z6AA 3E8SA 2NYUA 2VZ9A 3CC8A 4R6WA 1IXKA 3EVAA 3GXOA 3FRHA 10MHA 3IYLW 1X1DA 4DMGA 2OKCA 1INLA 2EFJA 3UJ8A 2BR3A 4QVKA 4YUWA 5GIPE 2ZZKA 3EVDA 3AWIA 3PFHA 4CWAA 3B3GA 5EG5A 2GH1A 2VS1A 2VP3A 2AOVA 4RVDA 1F3LA 1NKVA 4AZTA 1ZGAA 3GRUA 4KWCA 3DR5A 2UZ4A 1T43A 4RTPA 4DF3A 2F8LA 2V74B 3NJRA 3S68A 2XVAA 4DQ0A 1JQDA 3ELDA 5T6BA 2BH2A 3TM4A 5DM4A 3G2PA 3KR2A 1H1DA 4RWZA 2OBFA 3MGGA 5FHRA 3HA5A 3GJYA 3CJQA 2H1RA 3MTIA 4AX8A 3HP7A 4YV1A 1IY9A 5KQSA 4DKJA 1G60A 3SMQA 2BR4A 2YR0A 5LQKA 1YUBA 1R74A 3GIWA 3TM5A 4KIFA 5FTWA 5DM1A 4XUEA 4CKBA 2ONYA 3LCUA 4QTTB 3B7PA 3AY0A 3FPGA 5FWDA 3NMUF 4NECA 1G8SA 5E2AA 3LKDA 5LQUA 5G02A 2HV9A 5K0NA 2VDVE 3I64A 3I9FA 3TMAA 5EZQA 5GIOE 1X1AA 5LQCA 3K0BA 5F2OA 3IHTA 1X1CA 2UYQA 3GRRA 3VC2A 4AZWA 2JHPA 5CUQA 1UIRA 1WXXA 4PYIA 2ONZA 3CJRA 3HVIA 3KR1A 5EIWA 1EQAA 5EZSA 2N47A 1TW3A 4QPPA 3AXSA 2PGXA 4V0QA 4DCMA 4YV0A 3OPNA 5CVVA 3DXXA 3KR9A 3R0QA 3LDUA 3G5TA 3NDIA 1ZQ9A 4PYQA 1JSZA 1FP1D 2IPXA 5HIJA 1L3IA 3HVHA 4RVHA 2AOXA 4LWOA 3GCZA 5LQAA 3FRIA 1G55A 4BY9E 1NBIA 1L9KA 2IP2A 3UA4A 4RVGA 1M6YA 4R05A 5CVJA 2HR1A 3I5UA 1RI1A 4GBED 3JWIA 3NWBA 2GAFA 3DUWA 1D2HA 1WZNA 2I7CA 3PX2A 1BC5A 2JJQA 3T7RA 2O05A 4X41A 1JR4A 2AS0A 4FR0A 2ERCA 5DTRA 1VP9A 3QOXA 1NW3A 1L3CA 2AOUA 3OZTA 1KHHA 3LBFA 5K03A 3UBTA 2Z6UA 1Q0SA 3KU1A 5P8WA 4PONA 5EIFA 4PNEA 3RW9A 3BWBA 1KPGA 1RI4A 2AN4A 4RTQA 4E31A 1Z3CA 1AQJA 4QTUB 4HSGA 4R6XA 5DXAA 2YTZA 5EHGA 3PX3A 4EK9A 2FHPA 3DULA 3JWGA 4P58A 1P91A 1QZZA 2ZIGA 4C04A 3EVGA 5K09A 5C9ZA 4GOND 9MHTA 4OA5A 2DPMA 2OYRA 2XBMA 1XXLA 2C7PA 2PWPA 5FA5A 3FPFA 3KQOA 4FP9A 1ORIA 3RODA 4CXMA 4OA8A 5KVAA 5T64A 1RI3A 2G70A 4F85A 1O9GA 3B3JA 3T0IA 2NP7A 2ZWVA 2JHAA 3ELUA 1YB2A 3FUTA 3O4FA 3UZUA 4CTKA 3MHTA 3X0DA 1FJXA 3KQWA 1XDUA 3G88A 2PKWA 3KPWA 4C07A 4ER0A 2P41A 7MHTA 2P3QA 5EOVA 5F2NA 2AZTA 2ZZMA 1X19A 2AR0A 3T7SA 8MHTA 3PFGA 1NV9A 2PBFA 1Q0TA 4E32A 2FPOA 4X60A 5CVDA 3HCEA 2Q41A 3LGAA 2A14A 2C7RA 2Z6QA 1WS6A 1ZG3A 3TPZA 4PCAA 3A25A 3LKZA 4AZVA 3L8DA 2PVCA 1G8AA 4HGZA 4YMHA 5BW4A 1F38A 2V7EA 5GM2A 1NBHA 3OZSA 3GRVA 3LCVB 1ORHA 2G8NA 2PJDA 3SSMA 2OY0A 3MERA 1NT2A 2BR5A 4KVZA 4EMSA 5FULA 3P9IA 4M37A 5DX1A 3FPHA 4QQKA 2YXEA 3OZRA 3PVCA 2ZWAA 5T67A 4GOOD 1MHTA 1R8XA 1WG8A 4PYKA 1ZHFA 4KDCA 3SR4A 4XCXA 3SGLA 2HTEA 1VP3A 3OE4A 3TRKA 3EVEA 4AUKA 5LR6A 1UFKA 2YVLA 5E1OA 5FA8A 1JG2A 5GP1A 4HTFA 3B3FA 3KQYA 2P7HA 3P97A 4GF5A 3P71T 2OZVA 1DL5A 2K4MA 3DLIA 1O9HA 5DSXA 5LSAA 5MHTA 3G5LA 3NDJA 2ZZNA 1ZKDA 3BKXA 5CVEA 3OCJA 4ER3A 5DT2A 3HVJA 4G56A 3UJ9A 3M6WA 5K01A 3NVKI 2NNWB 3M6XA 2P3LA 4E30A 3P2EA 5HIKA 4KW7A 2PT9A 5K8VA 1DCTA 2AN5A 2P40A 2JG3A 2BZGA 4IKPA 5DTMA 2B9EA 4BP3A 3E05A 2XVMA 4GOLD 2GLUA 5EKXA 3SM3A 4DCGA 4Z2YA
chains in the Genus database with same CATH superfamily
1G9TA 1JDUA 2OPBA 4X3PA 3U1TA 3ZE0B 3NV9A 4BBPA 5JSZB 5F35A 3HV2A 4HP8A 2F4VB 1WJGA 3RROA 4HJRA 1C41A 3V8NA 2UXBB 5KNBH 4KFSA 1WABA 1NNLA 3IOEA 1VJGA 2FPIB 1R0ZA 4QGBA 1BAPA 2DSNA 1D4ZA 2IVZA 1U4OA 4ZO6A 5EMKA 5AT1A 1WQ3A 3SN6A 1NIJA 3A6FA 1NVUQ 3DDSA 5AKJA 3K2EA 3WGHA 4QEKA 4ZQGA 2CWDA 4HDRA 4QDJA 4DXDA 3GPDG 4URHA 1E6KA 3D7KA 5IAGA 1ZW1A 5LD2C 1X77A 1N7JA 2K7ZA 1JQKA 1VYTA 2RH8A 5JCZA 4I55A 4YRFA 1Z9BA 4KR3A 4DR5B 1JIJA 3MM4A 3S6JA 1TKBA 1E9DA 2JFHA 1IN5A 3B2EA 4KIWA 4QXMA 4UHFA 3MG9A 4FD3A 1FK8A 3ANXA 4LGYA 2QJTA 1MC5A 2DWCA 2BAGA 1VG8A 3R0IA 4L5BA 4UAUA 2ZULA 1TTPB 3DW1X 1Y6FA 1CRZA 3HA3A 4JLVA 1XWIA 3AQ4A 1EXMA 4BCCA 5BSGA 1RQGA 2QN8A 3HCOA 2LCIA 2XRYA 4C7OB 1E0DA 2W6JD 4Y9UA 3WFIA 1N4DA 1E77A 1T8PA 2JNWA 4NXMB 3LW7A 4KPUA 4CL0A 2WTEA 3LDAA 3OZIA 4WA7A 5FCDA 1UMCB 1CWUA 3R8XA 2GXUA 2HQSA 4FYWA 4JK3A 2R62A 1HDEA 1E4YA 2YWRA 1PUIA 4UU1A 4YPVA 4LF6B 4OX9Y 2PKCA 4WK0B 4LOLA 4Y2PA 3PF9A 4DV2B 3CINA 1WBDA 2NSDA 4I5GA 1R12A 3REQB 2F7SA 3CBGA 2JGLA 4O1HA 3LTEA 2AEEA 3BQNB 1OH5A 1VJCA 3HO8A 3OESA 2JVJA 3L7KA 3F5MA 1FDRA 2B35A 1RAAA 4M1KA 4ND4A 5KX5B 3DTVB 4GOMD 4EFLA 4DA7A 3P26A 2ERXA 2Q6LA 4TXHA 1AUVA 2OBNA 1PGOA 3ENQA 5H81A 3SK0A 1OAKA 1N2OA 1VPWA 5FQOA 4IDHA 1OA1A 2EGGA 4M76B 2WSMA 3A9CA 3CR7A 2LR0A 2I4IA 4PEVA 3OU7A 2WAAA 5C46F 1WDKA 4B31A 5BNTA 1YE5A 4G24A 4EZBA 2RGGA 4JLNA 2F00A 5K1ZA 3ZZNA 5L6LB 3BQ9A 4EHKA 3T52A 3OE7D 3T3MB 1F4PA 4B6JA 3RJ5A 4KR2A 3EVZA 1BA3A 1KEUA 2RIPA 4I5IA 3I34X 1J1IA 3VPBA 1ISFA 3GRPA 2NQ8A 2NWQA 3EA4A 4ND2A 4QUGA 5D3MB 1UQTA 4KQHA 3TLCA 5CT6A 4TYPA 3GC6A 2JIPA 1YRWA 4XWTA 2QXUA 2FPUA 3D1LA 3K8YA 1IEXA 4KJXA 5FTNA 3P9NA 2G1PA 1M5UA 3PHJA 3BL6A 5DX0A 5H9VA 2PANA 1PL0A 2XX3A 3I2GA 3ETHA 3D2BA 5EQFA 2G80A 1AQUA 3E22A 3CPSA 1NW7A 4OSEA 2XHEA 3MZ0A 1U1FA 4MUEA 3DA8A 3R0JA 4WL0A 2SCUA 1E7WA 4R8MA 3VAAA 4Y6QA 3T12A 3N05A 1NP3A 1NR5A 4A8HA 1I4WA 4NLLA 2HB6A 4DUGA 4AVYA 2XMPA 1NVWQ 2XYPA 2BFBB 5EI5A 5B7PA 3LECA 1Y4AE 4BMVA 2V7VA 4ZVLA 5A7GA 3ZIDA 4BVLA 4C0SA 1TVKB 5K2MA 4RMJA 5EP3A 2YASA 4Q1DA 3UH1A 1AS3A 2I8AA 3TI7A 3FI9A 5FB3A 5L4NA 4BFYA 1Y6GA 2OLJA 3EYWA 3AF0A 1PE0A 4L5YA 2H1FA 1SQFA 1ZIPA 3DE5X 4EY5A 4KI7A 1QE3A 5EE3A 1P1CA 4K9NA 3EIWA 3GZJA 1HT2E 1TPYA 1UJ4A 2G83A 3VR5H 2WJPA 1JQLB 3LHDA 3QNWA 2V6JA 3TUZC 4V0ME 2MHCA 4BPRA 2P6UA 1PYDA 2P5YA 1ADYA 4C03A 2W6NA 1LB1B 3EAGA 2NACA 3H1AA 5IC6A 4MWGA 3TI9A 3VQTA 3L7CA 1CCWA 1E18A 1IN7A 1ZNQO 3PUHA 5AM0A 2VCYA 2ZJFA 4QNRA 2J33A 2QRPA 4N49A 1VLHA 3CUKA 1Y7HA 3DVAB 5T4BA 3W78A 3P27A 3DEJA 3ABSB 1SRQA 2GRUA 2JLQA 3EDMA 4G0OA 4G07A 5DBIA 4YDRA 4EGQA 1T8RA 2ZBEA 4CTMA 1GEGA 1XZGA 5EGSA 3T5TA 1YQ9A 2FPGA 3LPCA 3GR6A 4OYRA 1U8UA 4RJIA 5KSZA 3CEHA 3EC1A 4D6PA 1DQZA 2WVJA 1HO3A 3D7NA 2UXDB 1U8XX 5IRCD 3UUWA 5FA6A 3RG8A 3RSCA 5A6SA 1KVSA 4MCIA 1HZZC 3D3WA 2RHBA 3GRFA 3IEUA 5B6JA 3DZHA 4FN4A 2PUFA 2AKEA 4FCVA 3VHXA 1XYGA 3E9NA 1W52X 3QI7A 5J2UF 4NULA 3EVTA 4BAZA 2VL7A 5JUWA 4JKIA 3G6KA 3MRXA 2NX2A 3AM4A 3A8TA 2YJNA 4MUGA 1EJ6A 2P67A 1F48A 4GM1A 4M54A 2NT3A 4ME6A 4NH4A 3GLSA 1A96A 1K3UB 2MOKA 1T8TA 3CPEA 2Q5IA 4IS3A 1VPLA 1U1EA 2BZ1A 2GLTA 3NBYC 4YWJA 5EJ7A 4MKHA 4E5VA 1D6MA 2BJVA 1VE3A 2Z8YM 3WMXA 3VHQA 1PHPA 2G3YA 3FE2A 2IEDA 2CSUA 3GIDA 2I8CA 1UDBA 4HWTA 2ZUCA 3UJBA 2P3OA 3UC9A 3HNPA 3PWZA 2A84A 1B42A 2ADOA 1J1ZA 1PL6A 2Z9CA 4E4YA 5IKOA 3VR0A 4LYGA 2CWWA 3QK7A 4Y0AA 3UFXA 1E1QD 1JLMA 4M38A 1EB8A 3ZVMA 4AP5A 3UUGA 1EH5A 1UJ2A 2Y9MB 3IXMA 2F59A 3DXZA 4JLBA 5HIIA 4BFTA 2W6ZA 3U09A 3UJHA 1SVNA 1YDGA 4KQKA 4BKRA 3UJAA 4MS4A 2E55A 4AJKA 2P9HA 5C1BA 4CEIB 3UK2A 4BKUA 1A7UA 1UPXA 3GLHB 3D6HA 1YS9A 4IMJB 1ADCA 4JA0A 4F3NA 4EY6A 3LIIA 2OORA 4P7FA 1DJQA 1XVVA 2I66A 1R8SA 1RU3A 2PUVA 2VRNA 2DLCX 4D02A 2IHTA 1V5IA 3W77A 2G28A 1RWNA 3RTBA 2LWIA 3B9RA 1OU4A 1RHKA 1UK6A 2ZWIA 1K4KA 5U4XA 1Z8NA 2OLKA 2QX7A 3PQCA 1R6AA 4WQMA 3RRZA 3WIBA 4FZVA 2XTMA 2PWAA 1Q0RA 2QN6A 2AR9A 4ND5A 3PCXA 2VQ6A 3BGIA 2F3UA 3ZZ0A 2P30A 2VUUA 2DG2A 2ZU6A 3EGXB 4Q1VA 5SYAA 5HQ3A 5CCBA 1CS0B 1OY1A 3T0GA 1XEFA 1NJ1A 3CNLA 3S2EA 4MUHA 1J9EA 3VYWA 1NW5A 2IKSA 4WZAB 5B3KA 4BX3A 2WW8A 3CVUA 4MMZB 3S0JA 4EM6A 1O03A 4HT3B 2VXOA 3OHSX 5A2GA 2CNWD 1G1AA 4K8RB 4C4AA 4C78A 4D57A 4UDXX 1LTQA 1DG9A 4IKEA 4UFNA 1TYZA 1YE8A 2IOFA 2Z98A 1PF7E 1CULC 2IDKA 3F2IA 1CZLA 3ANMA 3VC1A 4QXPA 5DCUA 3NXSA 3QUSA 4ETMA 1O0CA 5K0JA 3BH7A 1D2MA 2RFLA 1YZNA 1JEQB 4MZDA 4NATA 2D2FA 2Y68A 4DRYA 4PX2A 3TZBA 2X42A 2BHLA 1D1TA 1CQXA 1E6UA 1E9CA 3W6UA 1YNSA 3JAMA 4KG7A 4HNQA 1JQEA 4PCVA 4WBNF 1E2LA 1I0ZA 1DOHA 2XZPA 3IFSA 3R7BA 3TKYA 5I8WA 1UFVA 3F9RA 2ZQZA 3H5LA 2PVPA 4NCHA 3SF8A 4AXBA 5AVUA 1QRUA 1LK5A 2WJ6A 3E48A 4QJ4A 4C5AA 2IY8A 1AM4D 2M1XA 4EUEA 1HKUA 4MW4A 4PYLA 1NUTA 1V5FA 5K45A 4DPKA 3HLYA 4QECA 3Q5DA 3NIFB 4Q3EA 3W5DA 3VH2A 1M2NA 2ERYA 1QR6A 3GFQA 1Y1PA 4R4JA 5EJAA 5BV2P 2H9IA 3OZCA 4XXHA 5DBEX 4NDZA 3INGA 4NIMA 4TTPA 3K8OE 3HK2A 1T0HB 3PUXA 3BJRA 1A4UA 1T8YA 3EWNA 4MDEA 2X9QA 5LWQA 1EM8A 3I32A 1H05A 1WXQA 4KWCA 4WT7A 4F3KA 4QTYA 2H2GA 4RTPA 1BU8A 2Z57A 4LJLA 3TPFA 4FI3F 4EJ2A 3VYTB 5DM4A 1G6OA 2ZCVA 3KR2A 4RSMA 1PZGA 4A0RA 5JALA 2A9KA 5KWIA 3I2JA 3VOAA 3M6AA 2BGRA 1ABEA 2PR7A 2WSYB 5BW6B 3FTNA 1DKNA 3SMQA 1NVAA 1ESDA 3GIWA 3MWDB 1S2GA 3QFCA 1NVTA 3R1IA 4B80A 4RH0A 4R1UA 4CKBA 1IQRA 1JKIA 3FOWA 2IYPA 5FOVA 1F14A 1M67A 3JQ7B 4TZTA 1CEXA 1WIWA 3R7AA 2PS0A 5G0SA 1SRRA 4AD8A 3CVWA 1K8XB 3CN7A 1NR7A 2W7TA 4CM5A 3P0HA 2DE0X 4IIFA 1U1GA 1Y5RA 3QH4A 4TV9B 4BNFA 3KYCB 4YECA 5J2TB 3D0RA 4X84A 5JU6A 3G2HA 1LSOA 3QLJA 1S3FA 2CKMA 4ARCA 3OJ0A 3JAKB 2I9PA 2Y99A 4GL2A 4L4RA 1AKNA 4IJUA 1T8SA 3GRRA 2NTEA 1ZH6A 4IXMA 4BMYA 3EXIA 2ZRCA 2QW1A 4I19A 5K99A 2ONZA 1F8FA 1YT5A 4JD5A 1FVXA 2WKWA 3I5YA 1YS7A 4UM9D 3G8CA 1HNWB 7AT1A 1GPDG 3KSZO 4XRRA 3NDIA 2IEZA 2GETA 1IY1A 2C9CA 3LOUA 1U0RA 2WNIA 4JQOA 5H1YA 3PNKA 3T95A 4C4RA 4CMEC 4LWOA 1X8JA 4TRJA 4NZNA 5FPPA 5LQAA 4HXGA 3RFCA 2XY4A 1UK7A 4RVGA 3VSCA 1DBQA 1RI1A 2P79A 4FFNA 3O9ZA 4NENB 4ZI5A 1MORA 4CUKA 4D3XA 3LZDA 2F9FA 1JBEA 1WZNA 1X9IA 4GI1A 2HLDA 4Q12A 2JJQA 4Y2QA 4CKWB 3O4IA 4TMTA 2PUDA 2P9TA 1XE3A 2JI7A 5BRAA 3I4CA 1RZVA 2GEUA 2ZB2A 3M6MD 4ZU6X 3U0VA 1FSFA 5P8WA 3SICE 3DDUA 3BWBA 1HRDA 2WYWA 4DJEC 1XA4A 3ICCA 4RTQA 2GBLC 1F7UA 1WB9A 4HOYA 2Q4BA 6ADHA 1XMOB 3NQ41 2DOKA 1H0KA 4GLJA 5JD5A 1O7JA 2OYSA 4P58A 4BTEA 4XFDA 1ZA2A 4ABYA 4QXOA 4H3HB 4LNUA 4PLWA 4FQ5A 2QMHA 2OYRA 1OJ7A 4BMXA 2I3AA 4JU9A 4GVLA 4OKNA 4LK2A 2XZLA 4JIMA 1JV2B 1SC3A 1CY0A 1UBJS 3B3JA 4BNHA 2OR3A 1E6WA 3RU7A 3WLOA 4DLTA 3O4FA 3EDYA 3UZUA 5IBQA 1XZJA 3SJUA 3GJ8A 4CCAA 3V1MA 1NIPA 2L69A 4V1CA 1XD9A 2QTHA 1TZMA 3OTOB 2PUTA 1R9MA 2P41A 1MN6A 3I01A 2C4UA 4FYMA 2JGNA 4KR9A 4BKQA 1Z2DA 2MYTA 1M0SA 5IDXA 4P5EA 1PQWA 3B1ZA 1Q1GA 3T4UA 2WLTA 3TIVA 4E32A 4FZ3A 4QYXA 3ZY4A 2GYYA 1DX4A 3WKAA 2FZKA 2NADA 3LGAA 4Q48A 3AJ9A 3ZUPA 3TQCA 1K27A 1JYFA 3Q41A 4MEBA 3UPDA 2C7RA 5EL0A 1E3QA 4ODIA 1AQ6A 2AW5A 4GYKA 3C3JA 4EA9A 5A03A 1F38A 2IOYA 1J97A 1XDBA 3DCYA 3IP3A 3R8CA 5CB8A 4O4JA 1KMQA 1KYQA 3W9BA 2OG1A 5TNXA 2XBUA 1E2NA 1KYTA 5F7ZA 1DADA 1Y1RA 3P9YA 1RZRA 2QW8A 1Z18A 2C4WA 5D6OA 2BGMA 1W46A 5G0UA 1URPA 3R44A 4PN7A 3LQKA 2R9VA 3L1JA 4N5LA 3FHJA 4G0ZA 2HTEA 3UCEA 1I7LA 1JF8A 1PQPA 2UUAB 3IPXA 4I6JA 3ESRA 1T2DA 3HM9A 1DRJA 4XVQA 2AC4A 4TX1A 2CDBA 2AG8A 3FFAA 1VMDA 2O50A 1DAOA 4IIJA 2X3YA 3PE4A 3I42A 5SYMA 4JODA 4JEHA 1H66A 3WB1A 3BKXA 3LBHA 1FYXA 4NC9A 3FI0A 5KJ1A 4WCFC 3W2IA 1EFRA 1P80A 4U2DA 4X3OA 4KQIA 3I6ZA 2EQBA 5E6RA 7ADHA 4G56A 5AR1A 2VWQA 4KIUA 4TVKA 4F6RB 4NBLA 2Z43A 3I09A 4D1YA 2P0YA 1YBVA 3CNBA 4MMYB 2DLDA 4IKPA 1X7HA 2P91A 1KARA 1JEAA 3NTXA 3C8MA 1U99A 1W6RA 4GOLD 4Q66C 1QZXA 1DVRA 1YA8A 2NSHA 1WRBA 2J46A 4XPIB 5MN5A 5CGZA 1MFZA 1A8SA 1E5XA 2FF5A 1W9MA 2ZR8A 4LGMA 4U1RA 3HJGA 1LLUA 3DYVA 1J1UA 2G9NA 1EX1A 3BC1A 1OKKD 3G85A 3HLTA 5B58C 4DC9A 3H7IA 1TUBA 1WNTA 1Z5NA 3L04A 4OQPA 2IITA 2XTJA 4FYPA 4CKBB 4F8JA 4HLUC 4FUQA 1QYIA 2O2ZA 6Q21A 3ENVA 4JLPA 2PH1A 1UBSB 5DNWA 4G0UA 5JVDA 1C4OA 1XCPA 3L01A 4KO1S 5KSOA 2V3WA 3LQ1A 1VIDA 2ZJBA 4RD6A 3N0VA 4PCUA 4ZT3A 3UKDA 3D8BA 1T36B 1BWRA 3KQLA 4C30A 3M4ZA 1N2EA 5FXMA 5JH7B 4C7VA 2WUGA 4ALKA 1PWEA 3E81A 2OAGA 3PTAA 1WPQA 4AL4A 1E2FA 2EX0A 2R3SA 1MPXA 3P9XA 1V6CA 4HDCA 3VU9A 5KC9A 1MRZA 3TOSA 1N2XA 3NBFA 2I2XB 4O2RA 3NT2A 2DWUA 2Q1XA 1JR6A 2FJPA 3DEKA 2DR3A 4Q3OA 5KDOA 2C9ZA 4O5AA 3OIUA 1QQ6A 5AM4A 5IT5A 2W6JA 4M1EA 1TB4A 4IDQA 4J3NA 5ESWA 3GJ0A 4B43A 2DR2A 2POQX 4MI9A 5ADWA 1TD1A 3GLHE 4TYYA 4DW8A 3GGCA 4WIAA 4WKCA 3WGIA 1C29B 2IYWA 1FFEA 3F67A 4H7HA 4OMUA 2VJPA 3R40A 2Y1GA 1WNFA 4V38A 5TX7A 3M6LA 2A0YA 2I4NA 1CNEA 1GNPA 4PE5B 3J81k 3CB4A 4P84A 2HA6A 3L7BA 5JC8A 5KI6A 4Z9XA 1H5QA 2BSQA 3NP9A 2DLNA 2C5SA 4R3WA 3JQ8A 4NCNA 4X1KB 2VHEA 3G1TA 3KHKA 4P35A 1UADA 1V96A 4KOAA 1XCGB 2FPIA 1RACA 4WZBA 1PGJA 1VL6A 2AHOA 5BMVF 1TEVA 1QFJA 4A03A 3WNCA 4RTOA 2FPWA 4BB6A 3T6KA 2HHJA 4H60A 2J7PD 4PPFA 3QX9A 3ER9A 4QASA 4BN4A 3RYHB 1H2HA 5T3YA 2PGIA 1WDLA 4RK6A 3TLZA 4I55B 3I2HA 3I28A 4OGKA 6REQB 1F2TA 2HK9A 3ZHZA 3ZGOA 4JX8A 4N5DA 4B4KA 2H0RA 2IEBA 1JIKA 3KXLA 4JDUA 5LP6C 3U39A 2Q5HA 3B9PA 4MPPA 2XGJA 2AOTB 5IJ0A 1RKUA 3DOIA 3EFEA 5ILOA 4M8SA 5I6DA 3ILVA 3QEAZ 2ZAYA 1V16B 3NUQA 2ZJ3A 1IZ8A 1FRZA 1WQ1R 1YR9A 2UVDA 1N1DA 2E1RA 5DBGA 1OLOA 2G76A 3M1YA 2HBYA 1XRNA 3S2UA 1JPNA 1XFAA 2C3PA 2K7FA 4F21A 4C87A 3ACDA 1U8YA 3HYCA 5BPHA 2H08A 4QUJA 2WD8A 3D1VA 1SXJB 3LX4A 1G8FA 4QQFA 4AW9A 2HRQA 1PJZA 3O1LA 1EMDA 1K5PA 2HQBA 3PIRA 4E1BA 1G16A 4KMOA 4GX1A 4RPHA 1YB6A 2Q4OA 2O2SA 2C5FA 1ISJA 1LPBB 4G5RA 4HKTA 5IWCA 2QR3A 4FHFA 1GA1A 3J80A 5CDTA 4Z1MA 3JY6A 4L3OA 4QOEA 1D8AA 5BWOA 3N2GB 4EGJA 3GDOA 3JRWA 5T4HA 1XJCA 4LFCB 4MUFA 3G2MA 3GNQA 4ZZ1A 1GG5A 1R5BA 3MAJA 3HCAA 3LHFA 3ELWA 4BGVA 5ITZA 3LP5A 4QPNA 4TSFA 4P38A 5EPEA 4E5PA 2I3GA 1SKYE 1RLMA 2RH5A 1V37A 4Q01A 1RJFA 3DBRA 2CLMB 1ZN7A 4UHHA 5KVVA 1AQIA 4OCZA 1JG3A 4QZVA 3VJRA 4A8JA 3CF6R 2DULA 2SKDA 3ZCRA 1EDOA 1P2GA 4M55A 4QG7A 4DNXA 4LF9B 4Y2XA 1I2BA 3R24A 4KSYA 5BT9A 4ATNA 3L06A 5JS2A 1Z22A 3C15C 1UKAA 5EWLB 4ZVMA 1R0SA 3MAGA 3NBXX 3RQIA 2FRXA 5B7GA 4JXJA 1XU9A 1GTL1 1T0JB 2D2IA 1QHXA 2XJ4A 3PQEA 1B2LA 4O4LB 3FOBA 5CA0A 1N34B 1A69A 2XOXA 3Q0IA 4KCGA 2HEIA 4DANA 2I9KA 5LC1A 3RIXA 4YIHA 1PL8A 2BPOA 1JLRA 1WO8A 4RKWA 3JWJA 3QY9A 3WLNA 1P1RA 2BFPA 1FFXB 2O0HA 3S8YA 2OD9A 3PUJA 2NZWA 2P35A 1OR8A 1LQ2A 1W1UA 1G21A 1HUQA 2NUAA 1GCIA 4K81B 4WWHA 3TB6A 3V4OA 4OHWA 3PHHA 4BQFA 1J8DA 1NW8A 2AKAB 2H17A 3SSAA 1O5IA 3L8EA 3LDGA 5H59A 1NMXA 2RK3A 5HUHA 2YUIA 2AFIE 2B8TA 3NX4A 3SY8A 3EVNA 4PNHA 4Q4LA 5I9TA 2A9OA 2P8JA 4XJTA 4QE3A 3CISA 2YQZA 2C5BA 3AZPA 1JIVA 1LI5A 2C2ZA 5KO2A 1X9HA 3WSWA 1PWZA 1VKOA 4MW0A 1CR2A 1W2WB 1N33B 2Q4DA 1ESCA 2GF9A 3QVGA 3AF6A 2WA1A 4KV7A 4TKZA 4RPIA 4AN1A 5DBFA 5CB0A 3G89A 4N82A 5FUBA 1FLAA 1X87A 3PYLA 3WG9A 3AHCA 1XD2A 4MV6A 4P33A 1DJLA 4GX5A 3BJEA 2B25A 2GGSA 1ISRA 4ZPJA 1JKXA 5L45A 4F7DA 2F8MA 3VR4A 3DMFA 2JGDA 4HVTA 5U9CA 2CNLA 4IG9A 2GX6A 4ZQHA 3OH8A 2KSQA 2PMWB 2EZ4A 4O08A 2D6FA 2OCPA 4H18A 1NNI1 3R76A 2KLBA 2IU6A 5E3HA 4F1WA 4GYWA 3VR3A 4O2AB 3SXUB 3TW8A 3RSSA 1C3EA 4B48A 4KREA 2BBWA 4K9PA 4N39A 2DWPA 1LW7A 5JFTA 4LNHA 4EKEA 2TMGA 4I4NA 3I3OA 4OJKA 4YROA 1IEWA 4WESA 4A10A 4X1OA 4MQFA 4LWPA 1HE8B 3E3AA 3O8QA 2R7KA 1QHSA 3OD1A 3SNHA 4BEVA 4DMKA 1AZWA 1VL5A 2PBLA 4FS3A 2RJOA 1W1WA 4M0EA 2I6UA 4AYTA 4LSGA 1FFAA 2YICA 3IAM1 3ORSA 3ZWVA 2D1QA 3GZ4A 4CTOA 1O6FA 2C0QA 3PK0A 4C6HA 2O07A 4LDAA 4HATA 3T3NA 4IIXA 2OOSA 1FDOA 4ZV7A 4B7XA 4OD0A 1EUCA 2JAXA 3HEMA 2NYRA 3HZOA 4KXNA 2BT4A 3AOEC 2EKLA 4BNKA 1VRWA 3LGXA 4NOMA 3RYHA 2IA5A 3KTAA 1O95A 2KB0A 2OBLA 2WABA 1KR2A 4LI3X 5EJEA 1QGAA 1Z6XA 4OAQA 2ACEA 5HIMA 3RYFA 4C06A 4LF8B 2ZJ2A 1DIBA 4ZCIA 5HGXA 3WO1A 4XAQA 2Q2QA 5E3IA 1RMQA 2CLHB 2JI8A 2UUPA 1KAHA 3OEEA 4F7WA 1XA0A 4ZK2A 2AVDA 4LDNA 5KNLA 5A3QA 2PQ0A 3U2QA 5KNDH 1J21A 2RKOA 3DLHA 2GPWA 3GT7A 3KQTA 5DGIA 121PA 1MT3A 3IAFA 5D8DA 4I99A 1QP0A 3WMGA 2HEGA 1RM3A 4ASUA 5FUYA 1Y7IA 5CXXA 1HE1C 1KC1A 1GADO 4KR0A 1L4FA 2ZG6A 3SCZA 1VRCA 2P9ZA 2FEOA 1K86A 4CFZA 3L4JA 1SVUA 1YS2X 4Z4QA 5K0GA 5AJHA 3EH2A 4MIOA 3OUUA 1G291 1YQEA 5GMOA 2G9RA 1DJOA 1EBUA 1F12A 4LJAA 3PP8A 1NVBA 1N4AA 3IS3A 2PFKA 621PA 3T99A 5LZ4A 2VF8A 2O2JA 1HTBA 4DMGA 2D1YA 4OOEA 4YUWA 1MFPA 1RC1A 3OZWA 4G4GA 3QXXA 4L85A 1EGMB 1HDYA 4ZEWA 3HY6A 4XGKA 2GH1A 5SY9A 1QK5A 1KI6B 5COQA 3NORA 2BCEA 3UW3A 1DEAA 1T34A 5AQEA 5LBTA 4W5JA 3QLUA 3V1YA 5I9NA 1W0KA 1AH2A 2HTFA 4ILEA 4WNYA 3OMWA 1GGVA 1II9A 2PZAA 2G9ZA 1I1OA 3EF0A 2G5TA 3QU7A 3QW2A 2BH2A 2FFJA 3O84A 2WJZB 4GH5A 2FEAA 4D3SA 4JOQA 3U3DA 4N3NA 3S2GA 2EZ8A 4ZHQB 3HP7A 5JAUA 3L41A 1KGDA 4KBFA 5IKPA 4YACA 3ZWOA 5KU7A 3I1IA 5ARCA 1YZUA 2RI0A 5DM1A 4C20A 2G63A 2V5UA 1C7ZA 2BDUA 2BJHA 3ZX4A 4YAJA 4FE7A 3TZ6A 4QULA 3FFXA 3FR7A 4NXNB 2CJPA 4JI3B 1M73E 1QYCA 2WHQA 2GN0A 5JO9A 2ZSKA 4UBLA 2NTJA 2RGCA 3TTYA 5HJ7A 1WDWB 2JGRA 2KJQA 2QTRA 1C7RA 4RA9A 1Q6YA 4JI1B 4C43A 2GWHA 3X43A 2X1MA 1N2CA 3P96A 2FCRA 4NABA 5EZQA 2R1TA 5FWYB 3BGSA 4BB5A 1DG3A 4EBFA 1J22A 2ZSEA 4QFMA 2VPQA 3EH1A 4IP0A 4PZLA 1JDSA 3VC2A 3KNZA 4MLCA 4B76A 4EMUA 2IS4A 4HL6A 1WXXA 5GADl 1VFPA 1C7EA 3I6BA 4K9SA 3MJCA 3ZWAA 2WYHA 4AKEA 1TCVA 3AETB 1JHAA 2J0SA 2WPDD 4AJLA 4N0DA 2DT8A 4YRIA 2CEKA 1CRWG 1T4GA 2XQVA 3AEQA 3KR9A 1EVJA 4UULA 5MFPA 4FNAA 5FI0B 2PS3A 1S1CA 1ZXXA 4JVOA 3S40A 5JY6A 3NKVA 3D8TA 1FP1D 1KKUA 4FMCB 4LC9A 3WWOA 2CB9A 4KXYA 1DZIA 4MIEA 3GAZA 1TM5E 1G55A 1NBIA 3KEMA 1OZ0A 3TXYA 4C0QC 3WLRA 4DZZA 3VKHA 4P92A 5FBHA 3C3EA 2AZ4A 3EOBI 4X71A 5BN3B 1I7NA 3T7RA 3UJNA 1I36A 3N07A 2ERCA 4F9EA 3TL3A 221PA 2C31A 3OLVA 3ZDZB 5K03A 1IXRC 1QOQB 4RPKA 4EABA 4LHYA 2XKJE 1KPGA 4G4IA 2RHRA 4RU1A 4XDHA 4DDMA 5FBVB 4BJ1A 4CDGA 4HV4A 1QBKC 2YMPA 3JS5A 4F3CA 4L74A 3PX3A 4EK9A 1AA9A 1X9GA 3EJ6A 4L0MA 1KFKB 4HAUA 1KC3A 2O8VA 3H2SA 4RS4A 4CCYA 4OIFA 5ALFA 2I2DA 4HZUB 2C5EA 3H0CA 1KVUA 2OV8A 5B58T 3SVTA 3WWEA 3G2IA 4QKQA 4S0XA 3C4VA 4KXMA 4R31A 1ZJ5A 2CXHA 3O8QB 1WD7A 3A9UA 3MT7A 4OHBA 5AVWA 4OU4A 1ST3A 5CLLA 1H9AA 1USVA 2WJHA 1FJXA 4OAPA 3HRHA 1L6IA 1XDUA 4RACA 3WZLA 2ANBA 1ND5A 1RWOA 3IAXA 3ZOZA 3IJRA 4DIKA 4GNKA 3LUAA 1ONPA 3C6XA 5AVXA 3HN6A 3T7SA 2IUUA 1NV9A 3TJZA 3AF2A 1GPJA 1I2AA 4RZQA 2J45A 5J4HA 1JXQA 3BMCA 2C3UA 5KJFA 2MINB 4QRHA 5BVGA 5KSWB 1UKVY 1Y80A 2P2DA 1DHRA 3A25A 4FONA 1P75A 3RFTA 5IK2D 4DNPA 1PZEA 1QR2A 2R47A 5F3RA 1SHKA 2ZI7A 3E35A 1NBHA 5GM2A 3TL6A 3L8CA 4EYGA 2FEWB 1WP9A 3C7CB 4NBUA 4O2BA 3CRVA 5JXGA 5AUQA 1GPYA 5B37A 3RYTC 2QN3A 2FEPA 3QBDA 1WG8A 1FFCA 3D3KA 5F1OA 3VPHA 2N46A 3KZNA 4XCXA 5CJPA 4KAAA 4ZAVA 1YB5A 2GSDA 1V95A 4OKSA 4ARBA 4TZ0A 3A1NA 1QUEA 5K3AA 1VJ5A 2B1RA 2PRYA 3PDUA 3PUYA 5DGXA 3IAHA 3K1YA 3KOMA 2W22A 1V0JA 3X1KA 1O9HA 3BIXA 1L7RA 2Z5LA 5ALSA 2OHXA 2YS7A 4J7UA 3CO0S 4YO7A 1X7ZB 3DOEA 4ZZ3A 2GD2A 3TLYA 1CK4A 5FPQA 1KZ1A 4H9GA 1H2ZA 4L2IB 3R7DA 2BY4A 3N2YA 3IAM6 1IUPA 1KJYA 4UUMA 2YQ4A 3ML1A 1IQPA 5TSDA 2BEKA 4ACBA 3R9WA 1W35A 1FFBA 2H1VA 4KC0A 1DQRA 1CR4A 2IZ0A 3D2AA 5E95A 3B60A 5L8VA 2IELA 4DIEA 4Y6SA 2NMVA 2WMOB 3TNDA 2SHKA 2PLRA 2NVWA 1TM1E 3V46A 4AP9A 5B1IA 3AI2A 2G9VA 3QI2A 4II7A 3UMJA 2QGNA 2YV5A 4PFQA 3C16C 4WXRA 2Q28A 4AROA 1KRWA 1NFFA 5HILA 1YQWA 3OOJA 1LNSA 1C14A 2GZDA 5EJ2A 4N65A 2FR1A 1AV7A 1EBFA 1NLYA 3PJEA 3UHFA 4B74A 4HUQA 2UZ1A 1DXYA 2CY0A 2W43A 1TTQB 2PD4A 3KCQA 2V6FA 1XOIA 4RL4A 5DT9A 3LPDA 4UJ3A 3R5FA 4LCBA 1V8OA 1H3NA 3CLSC 4DNQA 5JNWA 2P68A 5ILGA 2XV1A 2P1RA 5TDHA 2JH9A 4YP6A 1QPGA 3A1UA 2FDCA 5DLQC 1T9GR 1W34A 1XA3A 1Y8RB 3PIDA 1XVLA 2LIVA 2YH2A 4PBTA 4ZQIA 4Q0MA 4ZVTA 3CNQS 2A58A 2WIDA 1FFDA 2C4HA 3OA0A 3F74A 1VZ3A 2PIDA 5EN4A 1WUIS 3V4RA 5DMXA 2B4RO 2GDZA 3HZRA 4IYRA 3WYCA 3NHRA 3V4LA 5IVKA 2FY8A 1NXSA 3LQQA 1V1RB 5LWHA 1QORA 2G77B 4BQIA 1OXVA 3AIKA 1CBUA 4ZA2A 1XELA 1YIOA 2R2AA 1J5PA 1ZLXA 1DXOA 1KP2A 4XB6B 1T4CA 2FWRA 1K9SA 5F1YA 2HCRA 1RLUA 3WTBA 4O1IA 1SBNE 4E5SA 3STYA 1UMKA 4WKPA 1JR3E 2WLSA 3B1JA 2QX6A 2Y0BA 4PSDA 3WHLA 4K3UA 2ZXUA 5A3SA 2KBEA 2EX1A 2HQOA 1EVZA 1AK9A 5KJ6A 3W06A 5AOAA 1NC3A 4CG3A 1UKZA 1YS1X 3ZJVA 4UASA 3FSRA 1D2GA 2H00A 4IZOA 1SIUA 1Z5WA 1TQ4A 3NO4A 3S29A 1SIOA 2I0FA 4B6FA 1DQNA 3OLWA 3U31A 1KVRA 1QV6A 1CERA 1RAGA 4P4LA 5D3MA 2JAPA 5HPYB 4YYEA 2YFYA 3LSTA 1XIVA 1QC5A 2OWDA 4ROTA 4I3FA 4L7QA 4QO7A 2ZUEA 2OD2A 1QHHA 2PXAA 2DERA 2HSJA 2J9RA 1DWQA 5EUQB 1GKKA 2Y2VA 3H3FA 4TV9A 1P1FA 3RVMA 4ESEA 3T9BA 3C1UA 5JYDA 1UEXC 2B94A 4CIXA 1E5DA 3DG9A 1U0BB 4LYAA 4B8ZA 3G2NA 2LPMA 4BLPA 4RM2A 3JSXA 3E22B 3ZTWA 4AY6A 4TYWA 1ATIA 2ZE6A 2I99A 4CW7A 4XX0B 1EE2A 4ZQEA 4CCYB 3RJMA 2O3TA 4RM3A 3UXHA 1L6RA 4RVNA 1NURA 4CQJA 4CIYA 5FTKA 2AJ8A 4XVUA 1NJ8A 1TYBE 4RY2A 3PRHA 3T1TA 2DT5A 1G4AE 4TKVB 1YGYA 3OJWA 1GTRA 1KRXA 2EOAA 3PPXA 1D2AA 1S02A 4ND1A 5KVSA 1EAYA 2GYWA 1E69A 2B6NA 4HYEA 3DMDA 4I2VA 1PJAA 4NMWA 4ZHSA 3X1WA 4NE7A 4R8VA 4R2HA 4L15A 4CKCA 4MVJP 2BGGA 3ANYB 3F1LA 5DSTA 2WNSA 4ZCPA 3MF4A 4M9RA 3R7LA 2GB4A 2OFFA 4MP3A 3FM9A 1OA0A 1PSZA 4GI5A 3N53A 4HRXA 2YKGA 4BVKA 3NJ8A 1H4SA 3IPYA 3E7FA 2GPJA 3VZRA 2AI2A 5LNK6 2QY6A 3LUKA 2BEWA 2GD6A 2MSEB 4M0UA 4XYBA 1XZIA 3TAHA 5EE0A 1YQXA 3FMPB 4QWWA 3RF7A 2HMWA 1XVIA 1K6JA 4FHGA 1KNXA 2VP2A 1GAWA 3GOHA 3R74A 4EHIA 4XCQA 2VHJA 4Q00A 4R1OA 1GNTA 5D5PA 1NP7A 4EJSA 1R4ZA 2CYBA 4JJEA 1XHFA 2BDEA 5IBRA 3LRXA 3U16A 4DZRA 3MINB 2IHJA 1I2MA 5LYJF 3VC7A 3L07A 1TT5A 3E18A 1UPBA 4OHUA 5JDCA 3PEYA 3I04A 4B3GA 3HKEA 2ZSBA 1M75A 2H6EA 2R66A 1PR1A 3A28A 1OF1A 4KVAA 2X2FA 4MPDA 1U65A 2PK3A 4FYKA 3LYUA 1LPNA 3KIPA 5GAJA 1WSAA 4CFYA 2IS2A 1A97A 1Y98A 1JHXA 1V3QE 2ZWMA 5IJAA 2XSZD 2FXIA 4ZYTA 2P75A 4RABA 3DE7X 3K0KA 4NYIQ 3WFJA 4D8TA 1Y8QB 2JPDA 4C0JA 3I9LA 1F6WA 1MAVA 2JFOA 4QDKA 3ISVA 5E7JA 3TD6A 3V1NA 5EJ5A 1FS6A 2NTYC 2SNIE 3A3KA 3IBTA 4D0LB 5LXTB 1UBFA 3S81A 4UMVA 1QDLB 3OFNA 5GZ3A 1Z63A 1D1SA 3H18A 4PN3A 4O8ZA 3V9PA 1P81A 2XMCA 5CH3A 2ODWA 4GGMX 5G4KB 2IOFK 2YOGA 2FN3A 2PMDA 4JOCA 4Q4DA 3OD5A 1ZMOA 1KPHA 2HLHA 1LRJA 4WKNA 1ODFA 3CH5A 4LDZA 4M9UA 2VAMA 4FK8A 2RGUA 4GKBA 4ON9A 1YHNA 5JMPA 2IZ6A 4J7AA 5CJ2A 4GNRA 5KUTA 4P4SA 2NG1A 3EXHC 1VI5A 4RGYA 2O52A 2WQ6A 2WK1A 1DC6A 1XCOA 4QNMA 2EP7A 3RFFA 1I7QB 4A36A 1NY6A 2H59A 5JAZA 2QTVA 3EBPA 1T3HA 1Z47A 2GN4A 3IALA 4P53A 1A95A 2ZSFA 4BO3A 1PFUA 2E5WA 1QVRA 2QN7A 3NIGB 1EAMA 3NONA 4TM8A 4WY2A 1BDBA 1NATA 3D9QX 4UBOA 1BEEA 3F7OA 3LQFA 5CYOA 5BUZA 5KWJA 3GP8A 4ZC1A 2P9QA 1V2HE 3WNQA 4U7JA 5KNBD 1L5SA 2JLXA 4IWNA 3DBRB 2ZRIA 2DRIA 2Y1XA 3W8FA 4EX6A 2B3TA 5JPCA 1RHUA 2DBRA 1JIQA 2R4UA 3GQVA 3NTOA 2YC4C 4ZDWA 4DCNA 1K98A 1WY7A 2C5AA 1UK8A 4A2PA 4G8BA 3KPJA 1M7GA 1PW5A 1MJNA 2R6FA 4R2WA 2WSIA 5AVQA 2OGWA 3FLAA 3B1KA 3TZEA 4RAQA 3M1LA 1IH8A 1U0FA 2BMJA 3H6KA 3UTCA 2VH5R 1QJ4A 4MWEA 4TTIA 4IRMA 3SNKA 3KYIB 1ISPA 1A1SA 2CBZA 1VSVA 2ORED 1NZDA 2AGVA 3UB4A 4TLEA 3CKYA 4LTDA 1ZWLA 4AJEA 1PG0A 3AF4A 4JNCA 5H3LA 2PS9A 3GUHA 1FFXA 2BGKA 4DUGD 4W63A 1UDAA 2O0KA 1TA0A 1N3IA 1CJBA 2RGNC 2JZNA 1G21B 3O4JA 4GP9A 2NUAB 5K7SA 1T26A 1IVNA 3ASYA 4Q7JB 5ISMA 1YFLA 1VG9B 1Q1NA 3IESA 2JHFA 3LUGA 4EPRA 5KBYA 2IZOA 3A7DA 5DW3A 4RLFA 3AUAA 4LJ9A 1U7XA 1UMDB 3CCBA 4S3MA 3PUVA 1EEHA 1RCUA 1LSUA 4IOLA 4XJXA 1SNYA 3B8HA 2BHNA 1EX7A 2YMLA 3L4BC 5D3ZA 2O19A 1QIGA 1M10A 2AN3A 2VNIA 4E70A 2JRLA 1EVYA 4IFTA 2Y1KA 4MDFA 2P6MA 1P61B 2IYUA 1JA0A 5EKDA 2I2FA 4KVGA 3CIOA 3IQDB 1T2CA 3H1BA 2NAFA 4GVPA 5HA5A 4Y6OA 5DYYA 2GAIA 4LDRA 1WVGA 3ZD7A 3BFPA 3F4KA 1RYHA 4M9QA 3FUXA 4MV0A 5E4TA 2C0PA 3EXHB 1K8YB 4C08A 5I4CA 2C2OA 1K7EB 3IPCA 1NLZA 3ZGXA 1S2OA 4AO8A 3HCBA 4TVSA 1NUHA 4V03A 1Q91A 1WXWA 2XA1A 4S1PA 3RIEA 4BO4A 3BMNB 3R3SA 5K0LA 2O2XA 1SC6A 4YP9A 1DX6A 5K0FA 4P1ZA 5KPDA 3IB3A 5F12A 2NGRA 4Q9KA 2Q6KA 2GZHA 4Y9RA 1GZ4A 1CQIA 2FJ0A 3BMQB 3P45A 1HG0A 3RT9A 4C4PA 3EZ7A 4KGXA 1T9CA 4MLPA 1FLDA 3B20A 3EZ9A 2GCIA 4P54A 4BX0A 4MYSA 3HXTA 3O2NA 4YT2A 3ZV6A 1GNVA 2JGAA 4HMOA 3P52A 3QWBA 2FSFA 4MYTA 2FSGA 3PFHA 1I9CA 3HV0A 5FPHA 4R7GA 1I5EA 4ZVRA 5IXYA 2LCQA 3VO2A 1E2MA 1GQFA 2AOVA 1KTVA 3BTUA 4A73A 4AKSA 4E03A 4YMIA 2XDYA 3UMMA 1ODTC 3VYVA 4J1TA 3ICEA 1SCUB 1ZJ4A 2J48A 2PBZA 2TMDA 3ELDA 3QYJA 4ZT7A 3RV4A 3WA6A 3CZRA 4ZRMA 2AFIA 2YJ3A 4UCQA 3RADC 2REXB 2R6AA 2B4KA 3D6AA 1V16A 3KVRA 4PXAA 3OZAA 1RFGE 3G82C 5JSUA 2P2ZA 3LL4A 3QVLA 4B7AA 1Q1QA 4G8DA 3K32A 4DLPA 2QB5A 1K2WA 2VJMB 3UUEA 5A1JA 3U56A 4MQBA 4TWJA 2EKQA 3A05A 3HR8A 4N1AA 4JXXA 3MMXA 1XTSA 4EHNA 1Q84A 3AY0A 2IQ5A 2NV0A 2VNSA 3HH8A 4KWHA 4PQYA 2OTCA 2ZUFA 1C1YA 2RGEA 1NONA 4HPJB 1E3MA 3NNSA 2XWSA 1IAVA 1WCIA 4HX5A 2HWXA 3FPKA 5MN6A 3TMAA 1XLUA 1N6PA 3INTA 2Q3BA 2H1OA 1Z68A 2E4XA 1FTSA 1PJ8A 4E5NA 3WB0A 3B8EA 2WF9A 1STOA 1PGNA 1T24A 2HREA 1GZSA 3GLVA 3GLQA 3AK4A 3IHTA 4RLSA 4NBWA 1VBNA 2H63A 4D0GA 3RAFC 3C3KA 1XAGA 3FWPA 4QVIA 1NM5A 5ELXA 4F04A 1WUJS 3CJRA 5ESXA 2CFIA 4AJOA 3DEAA 3P4YA 1EQAA 1WF3A 5JTTA 2CHGA 2QRQA 2CB0A 3EXFB 3HADA 3E1SA 3KT6A 4JBGA 4JSTA 2QVLA 4N9WA 2EDCA 5CVVA 3O1IC 4DCCA 6ABPA 4FGSA 3HA2A 1PNQA 2W2KA 5DBHX 3WLMA 3I2YX 1F51E 1AGNA 3A1WA 4TRMA 3ZHRA 1JSZA 1ORWA 5BUSA 4X8OA 4S12A 1OMOA 2NM0A 3BHIA 1TYAE 4WXEA 3EAFA 4Z0TA 3TD2A 1K4MA 3ZPXA 1KYVA 2OESA 4NFSA 2KI5A 1PDVA 2JANA 4G4JA 4GBED 1QP7A 3UYKA 1JVNA 5PGMA 3K09A 1K1EA 2CHFA 3CUEF 1JR4A 3SLRA 4HQOA 4Q21A 3IHLA 2Q5EA 1M6HA 3RS7A 4M9CA 2R5NA 3ADOA 4I1PA 2EARA 4L95C 2C98A 3E7DA 4YJ2F 2Q3EA 1UC5B 2PZKA 1OTYA 5T57A 1GU1A 2CL7X 2DCMA 3WV5A 4P6VF 4B6RA 4ZHQA 5CEEA 4GZLA 3RC2A 5D51S 5FR2A 3KOZA 3NAZA 2OCDA 4K46A 4H7EA 2C2WA 4QDOA 4C04A 2GEBA 4IOMA 2A92A 1RXYA 5C9ZA 721PA 1TMYA 5BQXA 5LMZA 4QHYA 3LY5A 1QE0A 1XXLA 3RG2A 4KGZA 5KWSA 3AW8A 1M8JA 3SR0A 1ORIA 1XDWA 2NPFA 1HDXA 4IDOA 2JK0A 3I61A 4XD7A 1T13A 9LDBA 1RNLA 1U0SY 3L40A 2OP1A 5B4TA 1PR5A 4A23A 5INTA 2QAGB 1MOQA 4OYYA 2H0QA 4A0GA 4OQMA 5JFGA 4YEDA 3E15A 4QBFA 4J3FA 4XI9A 3ZHTA 7MHTA 3RT7A 2ZZMA 1ABFA 1UP4A 3AW9A 2R8XA 5KOJB 3EJWA 4NNOA 3QFRA 3UJ3X 1J49A 4JJ4A 5IDWA 3NEJA 2BKVA 5DV9A 1AUQA 1FL9A 1RRPA 1KZ6A 2BEJA 3AETA 3KSAC 3AO0B 3AVQA 4E4TA 4OVKA 3ODGA 1OYVA 2I7XA 2Z5FA 3IUPA 2HRZA 5JOQA 1T1EA 4PPGA 1O3YA 3F96A 3GRVA 3ECCA 5EJ8A 4KVZA 4W8GA 1AK1A 3KL4A 4S05A 3M3HA 1QG2A 2XMBA 4RVSA 2VRCD 3UW1A 4YRNA 4ZDIA 1OOEA 1R6BX 1YRYE 3QG1A 1ZJ6A 3V55A 3VI3B 1LVUA 4KDCA 1ZNXA 1W85B 2OV4A 2X0NA 4JLWA 4H7PA 3P0FA 2IXAA 3M3PA 4D9GA 5AHOA 5IZ4A 4ZRDA 4BCBA 1X80B 3RU2A 2E21A 3AUXA 1ODIA 4Q3BA 4RYDA 1P17A 4U2KA 5JIBA 2CVPA 1KIMA 2ZJ0A 2CNBA 1AURA 1VPVA 1J6UA 4OHPA 2QRJA 2JDID 3LX5A 1RTKA 2V7UA 3KAQA 4TUYA 4ER3A 1C0LA 5ALGA 3M6WA 2Q6TA 2WG0A 3KQUA 3GFPA 2FMXA 4KRFA 3LC0A 4TGLA 3LVQE 1ECLA 5I7AA 3A2MA 3D2CA 4BDSA 2UDPA 1UCFA 3O93A 2VR1A 1H2YA 3FIJA 3OIFA 3FVWA 4JY7A 1LPMA 4GXNA 1CP3A 4MVYA 2NUTA 3TTUA 3PU6A 1P9NA 1L5FA 3RIYA 2JL1A 4OGGA 4DMUB 4UM9B 3DYIA 1QWOA 3WK8A 2Z1DA 1VB3A 4JJKA 1ZESA 4WVLA 1DSSG 2YDXA 4OJTA 1AG9A 1E3LA 2B36A 1QTRA 3F4LA 4HDMA 4Z7NB 5ALOA 3VSDA 5JH7A 1P2SA 4RFLA 3VISA 1LCIA 2Z6VA 4WOJA 4LHXA 2RHTA 3VNUA 4EEZA 2PY6A 1TPZA 2VJMA 1Q14A 5ULLA 4YV2A 2C3MA 5EMJA 7YASA 1CUIA 2GPYA 2V7PA 4RKEA 4L3WA 1IATA 4FXPA 2H3EA 4L8YA 5E9QA 4D56A 3EVFA 1G20A 3CW2A 1RPZA 1BD3A 3AY3A 5D5HA 3P0JA 1JJVA 5ICGA 1QWSA 3SVZA 2CXQA 3TO5A 1T9BA 5JXHA 1EFUA 1ZXBA 4LQLA 4M0DA 4M8IA 3T94A 2JLBA 4R83A 5HRCA 2BELA 2EJCA 2H2DA 4PLZA 3C8HA 3SSOA 3WL5A 4P4UA 1JE0A 3A26A 2BEVA 1ISSA 1T15A 2ECOA 2YWXA 4K6GA 4N5NA 2JARA 1GILA 3HUEA 3OJLA 1FFHA 3IILA 4MCJA 4UPDA 1SD5A 1H1TA 5LOVB 1G21E 1XFDA 2PX2A 5JI3E 2XYVA 3SR3A 3QEJA 4QDXA 2RI6A 4Y2TA 1XC7A 4GPIB 1ZKMA 3KVNA 4YAFA 4AJ2A 3H8WA 4WVFA 3T7TA 3HA7A 3F2VA 3HJRA 4KR6A 3M8KA 3WLQA 4BQOA 4BV8A 1H4TA 3JAWB 4TWRA 2WBLC 4Y3UA 2EG5A 5L3SB 1SCJA 1L4UA 3VKUA 3OWXA 4CR7A 4YMGA 1MH9A 2J3HA 4G36A 3BZBA 1LRKA 3VDRA 1RWVA 1FDSA 5AVTA 1MIOB 2GI4A 1A82A 4GPTA 1CTQA 1YBHA 4F38A 2NO1A 4HO1X 4QQ8A 2CLEB 3IQWA 2AWNA 3FUCA 2RIRA 5LDHA 5BW8A 3L0SA 3A10A 4DY6A 1FDIA 1AQLA 2ZS8A 3L4EA 4P0TA 4NX2A 1A77A 5DTQA 5EPUA 1C9YA 3BSSA 4CHGA 1PVOA 3SHQA 2RGRA 4XSHA 2UYHA 1E89A 4ZDJA 1Y4ZA 3VXKA 4MKXA 2Y27A 2FZCA 4MS1B 4P82A 4Q24A 4RKRA 4KOEC 5B7NA 1QSGA 3VPXA 2NOAA 2JIMA 3KJXA 2VOEA 3LLCA 4TV8B 4ZOEA 3ZR4B 4OQ4A 2N75A 1IWBB 1ZI6A 2HU2A 1TT7A 4F5WA 3LCCA 1SH7A 2C04A 5A4KA 2XTZA 1SM4A 3EGEA 2CVZA 1FSGA 2NO6A 5T3UA 1RTTA 1R88A 1N9GA 1RYEA 4L9AA 3AKYA 5G0VA 1XCLA 1U4SA 5DWQA 4E21A 2I6SA 3RH0A 3NHLA 1J42A 1TAHA 2QQ5A 2XUAA 3EPPA 5DOVA 3EMKA 4IH1A 1U5CA 3L0YA 3LKBA 2JZCA 4NV3A 2VC2B 3L77A 3M1AA 1KZ7B 5I7UA 2XUIA 4Z3KA 3L2OB 4FYHA 4BGIA 5B12A 5BT8A 1I0IA 5CD9A 5K8CA 2PUBA 2YNMC 3T5MA 3FNBA 2PX6A 3WL3A 1ZNWA 1GGJA 2WKPA 1LJUA 1TO6A 3RWOA 4IV8A 4ZTUB 1G4HA 5F3WB 5LB4A 1D2RA 1YB1A 2F3QA 1DKMA 2PDAA 3WSTA 3K0CC 2C1ZA 2FKNA 3WLHA 3WMFA 2DJ5A 5C1IA 1U7TA 2FFHA 1N57A 1LQTA 2H54A 2D5CA 1UBOS 3CLSD 4ARIA 4UUAA 2OUKA 1F4VA 1VE7A 3K6RA 2GT1A 3BPSA 5TB5A 1WR8A 4D79A 5TC4A 5AI6A 2Q2VA 3CB2A 3UJ6A 5B57C 2F9LA 2WV9A 4C3UA 1XALA 3IPRA 3NPAA 1EKXA 2VBCA 4KWIA 5EKSA 2P77A 4X8LA 4QYIA 3U5ZB 1Z13A 3CEAA 1L4GA 3OETA 3N0WA 4LZPA 4R81A 4GE0A 2EC5A 1JR2A 2MT9A 3E9RA 3VSBA 2GBFA 1HDZA 2QTAA 3G3EA 4YDHB 1K5HA 1W0JA 4OXQA 4JGIA 3QEBZ 1LPAB 1KI3A 1N2SA 1N1EA 5HFJA 3WMWA 1EQUA 1YASA 2QTTA 4EHHA 4XARA 2BZSA 3GA7A 1CFJA 1J33A 5DASA 2LW7A 3PRYA 4BXOA 2X3UA 3ZIAA 2ZRFA 4W5HA 5DNVA 3BCRA 5A6SB 4EMTA 3ESYA 2R86A 1TC1A 2FTKE 2IYLD 4J76A 3WGVA 3PSHA 4M8NE 5ALNA 5U1PA 4BWYA 5B36A 3TCKA 2DQKA 1VMKA 2AVNA 2BV3A 2VSXA 1G8GA 3X1MA 1P9OA 4BU0A 3MTDA 3ZS9A 4N8SA 3PHLA 1KSFX 5BWBA 5FEUA 1S1MA 5I4KA 2DKFA 4JKYA 1R4MB 4FOSA 1MU0A 4E6EA 2BKEA 2IHVA 4H08A 4IJMA 4FVTA 4EHBA 1HL3A 3TIFA 4RY8A 4JL8A 1HT1E 1HV8A 1XNJA 3HPRA 2RGYA 5EWMA 3T1YB 4WZBE 2Y9PB 2ZRHA 3ZOKA 5JDIC 1PSDA 4QAQA 3K4QA 1GGFA 1N6OA 3TAXA 4RVFA 1B3BA 4E94A 4BGDA 4EW1A 2H4WA 1KO7A 2V7QD 3QGMA 2QLMA 1EM8B 4WXYB 4O02B 1IU9A 3VYSB 1NUSA 4AJNA 3HDJA 4K03A 3H3JA 4M89A 5IAKA 2D0OB 1QIMA 1SCKA 3TVDA 4D3YA 5HDQA 4RSRA 5C8DA 1E92A 5DYNA 5FWNA 2BCJQ 1KO8A 3MIIA 3SS9X 3SU8A 2FUNB 4AG5A 4C3ZA 4AF7A 2PSSA 4KQEA 3HVUA 5JSKA 1Q1AA 2CD9A 3E3MA 1KQGA 3SJAA 2VYNA 4Q4HA 1D1PA 3W5VA 4IZIA 3ABIA 3N59A 3QYPA 2ZKLA 1C1DA 3RKRA 5HZGA 3GO4A 4OFBA 3OIGA 1TT5B 4N0PA 2ZKIA 1B7GO 1WZUA 3DMHA 3I1FA 3KG2A 4B3JA 5BV1A 4F2GA 2FI1A 4XA8A 2C1XA 4YK7A 4CV1A 2FETA 4OFZA 1Z75A 3CWZA 2IW3A 1LDBA 1ZIYA 2G17A 2Y77A 4EECA 4B6GA 4NYJQ 3P94A 3OY7A 3DV2A 3V97A 3WGKA 3AXTA 1R6DA 2ZROA 5CB4F 4BMOB 1SUEA 4LQCA 5HF8A 1V9SA 3LWBA 3GAFA 1GT6A 3F46A 2HH9A 5FADA 2JVKA 4ZD6A 2XIJA 5BYKA 5AXCA 5IUKC 1LDMA 4WLOA 2JH8A 4FEYA 1C9NA 1LPOA 3ICOA 3KLMX 4N76A 3KTAB 4YA6A 3R3HA 1E2QA 2IOHA 4WFIA 1DC8A 4B2LA 5HSGA 3THXA 1OAOC 4V0MA 3KJHA 3KXDA 1ODJA 5ECWA 5KPJA 3TN7A 3TRHA 2JLWA 3KB1A 4X7PA 5G4KA 5LVAA 4XLTA 1R5JA 4BNGA 1E5LA 2BFAA 2PX8A 3GWGA 1ZJZA 3BE6A 3TINA 4P8RA 4RHCA 4RKQA 1IJKA 1ML3A 3AZQA 5CH8A 3UOAB 4N12A 1YZTA 3UXEA 4AZ3B 3DP9A 3ZJ4A 3N0RA 4IO0A 4QQNA 4A0SA 4IVPA 5CB4B 3BRWD 1Y89A 2QLJA 1Q17A 2AQKA 3BB4A 3SZMA 5UKDA 1DFIA 4DG8A 3HN7A 1TCAA 3WLJA 4HEQA 5CA1F 3IRVA 3PTZA 4NU8X 2FW0A 4R01A 5I51A 2JLZA 4WNIA 2BEUB 1IBRA 1EE9A 3MBKA 1JZTA 4PLGA 3BEOA 3TBKA 1B16A 1CC1S 2GN1A 3EMDA 5CAEA 4EPWA 3AIIA 5FWXB 1NYRA 2R6CA 3WKCA 3BWMA 1R5OA 4K6MA 4NKRA 4CM8B 2N9UA 1W36B 2PL1A 1SD2A 4ZI2A 1VRVA 1FIUA 1M8KA 4U39A 1JUDA 1BS9A 3QHPA 3R5KA 1J56A 1NF2A 3K5IA 1X0XA 4QYMA 1TM3E 3F1KA 2ZT7A 2OHHA 1ATZA 4D4LA 2C8VA 3F7NA 1NN3A 4DBLE 2ZTLA 1AVTA 1I14A 2WV7A 1PNOA 3I0ZA 4LZNA 2IH2A 1M0WA 3WLLA 5EE1A 2AFRA 3JD2A 3RGWS 1H2EA 5K4AA 1LJ8A 1Z0UA 2WUFA 5IK2A 1LJLA 1LBSA 3PDCA 1DS6A 1LF0A 1JU9A 1P9WA 2OKCA 3QXSA 1XAJA 4YASA 1M66A 2RGDA 1L5LA 3IQEA 4OXYA 3C5EA 3W8EA 2Z0MA 3GJRA 3KJEA 1M76A 1KOLA 2VYCA 3HKCA 5BVGB 4X45A 3Q7SA 4I8DA 4CM3A 3KLOA 4B5KA 2LP4Y 4H1UA 4FDUA 4ZYLA 2R6R1 3F6YA 3I9MA 1FQWA 4YJHA 3C74A 2OK7A 3ZJ5A 5LLDA 2BGTA 3H16A 4DQ0A 3DOCA 2JKZA 3E27A 4N5IX 3IDAA 4KWTA 3LWZA 3I6IA 3ZTYA 3K30A 2GF0A 3OZEA 5DCLA 3S99A 4QT4A 1QP4A 3ZCUA 5KQSA 5AK5A 5NULA 1QH0A 1VHDA 3T3HA 3TW4A 4DIOA 4EPXA 4KIFA 2C29D 4S1NA 1RQ2A 2V55B 4RD2A 3ZE6A 1K88A 1HYHA 1YI1A 3B7PA 2JK1A 2H18A 2QMUA 3EB9A 3M4YA 4HSEA 4LOJA 5DZSA 4HTAA 4JZYA 5DJ5A 5A7FA 3VH3A 5KEIA 4DSAA 1WW8A 1HTTA 4LOAA 4D6YA 1P3DA 4M0KA 1QG4A 3QMMA 5G02A 3UWOA 2E87A 2P6NA 3BCHA 3I64A 1B26A 1CDDA 1A8HA 3I9FA 2OBXA 3O4RA 4GXQA 4HGRA 4RZHA 5BURA 1RD4A 5ENVA 4KQ1A 5GIOE 2WWYA 4G5QA 1V5GA 3WB2A 5IT0A 4X6LA 5M3BA 1GTMA 4LNAA 1JEDA 4ZI7F 5CIWA 1JHPA 1NXVA 2HOQA 2JHPA 3U7HB 4Z3OA 1J2UA 3AUYA 4NPCA 4CLOA 2HJHA 2D59A 2HLPA 2MMCA 2ZRMA 4QICA 4PV7A 5A05A 2W70A 4RMGA 3ZVLA 4DBLC 3BICA 3IV9A 4QOJA 3PEVA 2VQDA 4R1QA 1EDZA 3LF1A 2WD9A 6YASA 2J6IA 3TDMA 4KEAA 4XLZA 5KYXB 3GCZA 3MYRA 3HABA 2H4FA 1RXSA 1F5SA 2ZIWB 1OBFO 4D97A 1KGSA 1L1RA 2IP2A 3K9QO 3T1VA 4R05A 4BO0A 3OLYA 4PAMA 3JZMA 3JWIA 4FOOA 1QTNA 4AAYA 2JFGA 1H8EA 4HZUA 4WZAE 4KLNA 1SCAA 2BTOA 1VPDA 1Y3BE 1XQ6A 1FP4A 4JT8A 3HSYA 1ZO8A 1EWRA 1EFHA 1C4KA 1DFHA 2GZAA 4K1XA 1NW3A 1R4AA 1E9VA 4EF5A 3PE6A 1AZSC 2Z6UA 3WYGA 2ROQA 3RW9A 1AO3A 2Q7XA 1E6LA 2XUFA 3W1WA 3TDKA 4IUYA 5CBKA 3ZWCA 1HH4A 5SY4A 1A8PA 1J23A 1QHYA 2NSYA 3U7EB 1GRNA 4X20B 5IT4A 1SHTX 3IPLA 4J94A 4TV8F 1F8YA 1P91A 3RK1A 3VDQA 4PPQA 5E7MA 4PPNA 4ECAA 1UFQA 1BIFA 3Q8XB 4R2IA 4Y2UA 3D7RA 5FA5A 1GKIA 4FGLA 3E9DA 3IV7A 3RODA 4CI9A 4AN4A 4E1AA 4CXMA 1WCIB 3RSHA 2R8EA 4ETNA 1QLWA 3C3MA 1U5AA 4KXXA 3FMGA 3Q72A 1Z83A 4BMPB 5TQ2A 3Q9UA 4M7PA 4CUZA 2CXUA 3G49A 5EFOA 3RSLA 1TL7C 1U31A 2VT6A 3OUTA 2AZTA 1NQTA 3WS7A 2MTBA 1H2WA 4QU0A 2V6GA 4C21A 2CHUA 2VAWA 1KJQA 4P3XA 3ORRA 4FWIB 4M1YA 1BDMA 4DLNA 4YMUA 2PJUA 4OHVA 5TV2A 5BSTA 4WXMA 5C53B 1PFKA 1UC4B 4YJ2A 3JQFC 1A9TA 3UGJA 2VTBB 2UYYA 1N6RA 2PVCA 2DX7A 2VNKA 1F4LA 3IERA 3JX9A 4U7FA 4AZVA 1VCOA 3AEKA 4GMHA 3B6EA 4LK3A 3O4GA 3VR3D 4JJGA 4DLAA 2A35A 3RFUA 3PZRA 3IUQA 4KBGA 4KXWA 1SXPA 3UANA 1QGED 2GF2A 4P5PA 2OZEA 3OZRA 4PTYA 3TZCA 3RVKA 5FWXA 3V8MA 1PI3A 5KC8A 3GZNB 4PYKA 5DB4A 4IJWA 3GJ3A 1RXWA 4IFBA 1S2MA 3SGLA 3DAFA 2D0PB 4Y6LA 3MT9A 3TZKA 4LGVA 1WKCA 1XQWA 2WDPA 4HDOB 3TGLA 2B0JA 3B3FA 2OCYC 3WNBA 2MSDB 2MSNA 2OZLA 1R0BA 4AZ0A 4UE3S 3ZY2A 5TMPA 1ONBA 3OZGA 3HJFA 5HQ3B 1KAMA 2NVBA 4KE7A 1ZIOA 4R8LA 5AXBA 2A59A 4ERNA 3ZK8A 1M1UA 4BFVA 5CVEA 4DV6B 2J9XB 5J2UB 1JKJB 2B7CA 2CDCA 3COPA 4IWXA 3VR4H 1GTJ1 1DHTA 4WZAA 4I2NA 2CYCA 3EIUA 1H8HD 5K01A 2CLOB 1EGAA 5LZ7A 5CG1A 1RZRD 3B7GA 1G5PA 3A4NA 2HYDA 4LYFA 3TLBA 3K20A 5ADUS 1PZFA 2BFNA 4I81A 5KNDD 3QMPA 3IVRA 3KP1A 4AKHA 3FCXA 4JMPA 3FETA 1XTQA 3F6RA 1V35A 2CUKA 1X94A 3O8LA 4XDZA 5AW9A 1Q50A 4EA8A 4E2WA 3EFBA 3AHIA 2PH3A 1LGYA 2D1TA 3H1FA 5GOTA 4WBXC 3UV6A 4H7JA 2J7PA 3N6XA 4EVSA 1QIJA 3H13A 4KKVA 4W4TA 1I6MA 5F33A 1F0YA 2W58A 3B13B 4ZCQA 5TR9A 3WZMA 2EJVA 2I6FA 5KKCA 1R8JA 4F11A 3AKCA 5FHQA 3OCXA 1ZQ1A 3CSDA 1Q92A 4C7MA 5IYZA 4UE6A 1FRNA 1D0SA 2VHYA 1D2NA 1LFDB 4BNTA 5TIIA 2WZBA 5BXYA 5I7EA 5DLDA 4MI1A 2UUCB 2O1EA 3VMMA 4WCVA 4CMIA 5BYAA 5A5GA 1KTIA 3BMNA 3NASA 4B87A 1UDRA 2PGJA 2CKDA 3ESAA 3H42B 1P8JA 1S9DA 1US8A 3KKZA 4GSKA 1K8RA 1ZOIA 4ANFA 3FCEA 4NPAA 4U2BA 2BD0A 3IRUA 3MCVA 5EFZA 3AG6A 3ACBA 4YXWA 2WI8A 3KZXA 2IE0A 4FU0A 3VHRA 3LUFA 4RJTA 2GQ0A 3I0NA 2ZI4A 4LY0A 3ZJYA 1YDHA 2WHPB 1QZ3A 1ZUHA 2ZIZA 5AKGA 4YH1A 1ORRA 1M74A 3JZAA 3S8EA 2BM8A 5IN5A 1W5FA 2FMUA 2QSJA 4RMNA 1M2JA 1E9RA 5J9FA 5CHEA 2OXIA 4E11A 1JEYA 1AA6A 4TRRA 3GG9A 1TADA 3JATA 4RHFA 2Y1DA 3ONDA 3M6UA 3N8IA 1L0BA 4KQWA 3TLAA 3ZEIA 2FSUA 2QLNA 3CVOA 4P81A 3DKPA 2HGZA 3MBIA 5DIFA 4AC9A 2ADFA 2EF0A 4OLHA 1GPUA 1BH2A 3DE0X 3KLNA 1XG5A 4ITVA 3SC4A 5TGZA 5KMGB 3RFXA 2VBGA 4IW3B 4EELA 3ER8A 2NUPB 4P80A 3VNRA 3ZCPA 1CVIA 3EQ6A 2QRZA 3HB4X 5BN4A 5ADHA 6REQA 3HKDA 3AUJB 1UANA 2BSXA 4BECA 4HR7A 4DGQA 1PN3A 5JNLA 2VG8A 3OCCA 5IMSA 1DBWA 2A9RA 1TU3A 2QZZA 2DH5A 3LT2A 2JBAB 1SOUA 3EQ9A 3WRVA 4B7CA 5IF9A 2V7TA 1GDHA 4TSRA 1H6BA 1Z25A 3LXRA 2HJWA 3NHYA 2NV2B 2EBFX 4IIHA 5IC4A 2OECA 2Q46A 2VJNA 1VIYA 4MEJA 1ONSA 4U2CA 3ORHA 1OWOA 3JQAA 3HCNA 3WADA 3BTVA 3WIEA 3AFGA 2R4QA 3P9SA 3NAGA 3EWAA 3KQKA 1JHOA 1OH7A 3EQZA 4E5MA 5C4MA 1CYEA 3OC0A 4HN4B 5FWAA 5DNYB 3VO9A 5CTJA 8OHMA 2H5LA 4R8RA 2BEWB 4YAKA 3B1XA 3WDKA 2C0CA 4PZYA 1VKNA 1X7WB 4MH0R 5BR4A 5FX2A 1ODLA 1HK7A 3CLUD 2H51A 5IZCA 1ZJJA 2NU9A 2QN1A 4YJKA 1SXHA 1MJFA 5FF9A 4V2UA 1L5HA 2C7OA 1WE2A 4D9IA 5JNVA 2HK6A 3TIGA 4AURA 3S2IA 1G42A 3CNEA 4MQFB 3QEOA 1Z2NX 1M34A 4DPLA 2F62A 4MV3A 5KNCD 2C7GA 1CJSA 3L9XA 4M98A 5IFKA 5FNVF 2JEZA 4EGAA 5AIBA 1T4DA 2W2PA 3LNTA 1Y9EA 4QGSA 5JSZA 1M1YA 5AIAA 5JARA 4LMPA 3K2IA 2CGEA 5DM0A 3KEFA 4A26A 4YMTA 4HNRA 3ETJA 4PRYA 3DTVD 3EFOA 1Q0TA 4U7GA 3BOSA 3OPQA 2XB2A 1CUCA 4ZIRA 2WNHA 1FVHA 2EERA 5FUQA 2A5GA 2EGUA 4Z7JA 2D1RA 2IYTA 1I2ZA 4QFBA 2LDBA 3O82A 1NE2A 1T1RA 4PAOA 2JFZA 4LXIA 1B1CA 3LVRE 3K73O 4UNIA 2IUEA 5ALUA 2ZSJA 1JALA 4NHOA 4IHKA 1JAXA 4GMXA 2UKDA 3BGDA 4CGYA 1A9ZA 1JRLA 4UDOA 1BN6A 1PYGA 1P7VA 1CY6A 1A5TA 2AMLA 2YJGA 1SZDA 3AT1A 3L18A 3OTIA 4FBMA 4GR4A 5D01A 3OQMA 5JD4A 3DHEA 1U94A 3TKAA 3LDFA 1I4LD 4O4IB 4XQCA 2ZI6A 1XZEA 3A0UA 2P4UA 1J70A 1U6KA 3CLRD 3MUFA 1W0KD 1UDWA 2X4GA 3B36A 4NS4A 2AX4A 4Y2JA 2IX9A 3CX6A 5BWNA 3ITKA 4Q9LA 2O20A 3WHPA 1VBMA 2A0KA 2AJLI 3BE8A 5ED0A 4JS0A 3TQHA 4JENA 2IYAA 4HI0E 3BFXA 4UNPA 1ZZGA 4B0OA 4F93B 1YBFA 1BFDA 3STHA 1USIA 1KSHA 1WBJB 1U9IC 2OB2A 1ZJWA 3N28A 4G37A 4M88A 3V4PB 1WW3A 3IHWA 2X2EA 4DRXB 3MJVA 3NGXA 1XQYA 1BXRA 2ZJ1A 3GDHA 3NALA 3Q87B 4JITA 5AKZA 1UBCA 4LX8A 1K9VF 1YZGA