1VBFA

Crystal structure of protein l-isoaspartate o-methyltransferase homologue from sulfolobus tokodaii
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
224
structure length
224
Chain Sequence
ASEKEEILRKIKTQELAEAFNKVDRSLFLPENLKDYAYAHTHEALPILPGINTTALNLGIFMLDELDLHKGQKVLEIGTGIGYYTALIAEIVDKVVSVEINEKMYNYASKLLSYYNNIKLILGDGTLGYEEEKPYDRVVVWATAPTLLCKPYEQLKEGGIMILPIGVGRVQKLYKVIKKGNSPSLENLGEVMFGRIGGLYGFYDDYDDIEFRVNKLERQIKSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 231aa long hypothetical protein-L-isoaspartate O-methyltrans
publication title How Oligomerization Contributes to the Thermostability of an Archaeon Protein: PROTEIN L-ISOASPARTYL-O-METHYLTRANSFERASE FROM SULFOLOBUS TOKODAII
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 59
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2004-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vbfA00
5KQRA 3TR6A 1NW3A 1P91A 3KQPA 4G56A 5CCXA 1QAOA 3B89A 4PYIA 1ORHA 4E2XA 1M0EA 1D2HA 2G72A 2P3OA 4EKIA 2Z6QA 2PVCA 5FA5A 4PINA 3FPJA 5K0EA 5DX8A 3B5IA 3TPZA 1NBHA 4A6EA 4OQDA 4IWNA 5E2BA 1XDUA 9MHTA 4C07A 4F84A 2UYCA 4RTLA 3PFGA 4KW7A 2B2CA 1VIDA 3C3YA 5IH3A 2ONYA 3KQTA 3SR4A 1NKVA 4E30A 2PT6A 3FRHA 3SX0A 1YFJA 3BWBA 5GIPE 1N7JA 2QE6A 3PS9A 3A26A 5CVJA 3FTFA 2FK7A 2QYOA 3ANXA 2WA2A 4M38A 3UBTA 5LQRA 2XYVA 3O31A 1TW3A 2FRXA 3GRYA 3MQ2A 1FP2A 3CJQA 4DCMA 3L8DA 2FYTA 1EG2A 1ZGAA 1RJGA 4C06A 1NT2A 3BT7A 2P40A 1L3BA 1ORIA 4R6WA 4RVGA 4RTNA 2FHPA 3UFBA 5CVEA 3M6XA 3WSTA 5HOQA 5EPEA 5ICEA 3B3FA 4JXJA 1XCJA 1F38A 2BR3A 2BM8A 1R6AA 4CKCA 4Z2YA 5GIOE 2IP2A 3ORHA 4F85A 5ERGB 2YVLA 5E1MA 3PB3A 3RODA 4YUXA 3P97A 3G2QA 1EJ6A 5FULA 1ZG3A 2NXCA 3I5UA 3G8AA 4X61A 4EVIA 5K01A 5HEKA 5LQNA 1BC5A 2VDUE 1WXWA 1O9HA 3EVAA 2ZBQA 3A7DA 4GQBA 4KIGA 4LWOA 4HSGA 4KVZA 4OA5A 3SSOA 3AJDA 3HCEA 1F3LA 2B3TA 2PXAA 1VP3A 5T6BA 3SMQA 3NVMB 1G8SA 4ZTBA 5F2KA 3TMAA 4RTQA 2PSSA 5DXJA 2ZWAA 3KU1A 3NWBA 4QQKA 1RJEA 3EVEA 4GOMD 1NE2A 1ZKDA 2I7CA 3MERA 4U7PB 3SGLA 3IYLW 3G89A 4P58A 1G60A 2GS9A 5BW5A 2HR1A 1AV6A 5FWAA 2CWWA 4ER5A 4RWZA 5EMKA 4IV8A 2OB1A 5EHGA 3JWHA 2VS1A 4WVLA 3TOSA 3FZGA 1I4WA 2JHAA 4FSXA 4PYQA 2JHPA 2ZZMA 4RTSA 1NW5A 4PGGA 3KPUA 5FTWA 3HP7A 3QOXA 2F8LA 3R6TA 2YXDA 4FT2A 4DQ0A 4PYNA 3ELDA 5EEHA 1KR5A 2R3SA 5DPMA 5KQSA 2NYUA 5K0JA 2EJTA 2UYQA 4PIPA 3TM4A 2FCAA 1L3CA 3RW9A 5F2NA 3DXYA 3T7TA 2PXXA 3LHDA 3NDJA 3UWPA 3PLAE 3HCCA 4PCLA 2AR0A 4CTJA 5GINE 2EFJA 3R3HA 4OQEA 4GUAA 3GJYA 1WZNA 3K0BA 5CVUA 4V0RA 3TRKA 1KPGA 4X41A 4PCAA 4PYMA 4C05A 4QPPA 3HVKA 2NXNA 3BGVA 3FPGA 3FUWA 4RTMA 4QTTB 4PGHA 1R8XA 3LSTA 2DPMA 2PX4A 1R18A 2C7PA 2O05A 4O29A 3CBGA 2VP3A 3G2MA 4RTKA 3I58A 1YZ3A 4X1OA 2PLWA 3M70A 4P7FA 5C1IA 2IDJA 1D2CA 1JSZA 1R00A 2O57A 5D1NA 4OBWA 5FUBA 2IH2A 2XYRA 2PX8A 3DMGA 4GOOD 3ERCA 3KQVA 5DWQA 2HTEA 3A7EA 3KHKA 3LGAA 5E8JA 4YV2A 5P8WA 3EVFA 2R6ZA 4QDKA 2E5WA 4YV0A 3C0KA 2BR4A 4IV0A 3DTNA 5DTRA 3B3GA 3ELWA 4MIKA 3LL7A 3HCBA 4KRGA 3EGEA 2ZVJA 3UZUA 4CKBA 4GF5A 1RI4A 2OPBA 5HFJA 3OPNA 1Y8CA 3DP7A 4R6XA 3KQMA 5EVJA 4E32A 3KR9A 5LQAA 1FP1D 1NW6A 3UJ7A 5LQJA 3G2PA 1G55A 3TKAA 5JR3A 2B25A 4MHTA 8MHTA 4PYLA 3EVDA 4DCGA 2FK8A 1VLMA 1QYRA 3EGVA 1P39A 3G5LA 1MJFA 1QZZA 3CKKA 4NECA 3LDFA 5F2OA 2ADMA 1U2ZA 4WXHA 3G5TA 4FP9A 3EVZA 1IXKA 3TFWA 5DLYA 3M4XA 5ICCA 2ZSUA 3UJAA 5LQKA 3KPYA 2N47A 3P9KA 1P1CA 3DXXA 2CMGA 3ER8A 4M7RA 5DT2A 4XUCA 4HGZA 3UJ6A 1SKMA 1G6Q1 2PXCA 1Z3CA 1MHTA 2HV9A 4EKGA 2OXTA 4FZVA 1NW7A 1KP9A 2GPYA 4ER6A 4XCXA 5EIFA 3Q7EA 2JH9A 3NW9A 5CVDA 4C08A 1UWVA 3KQSA 5EEGA 4C03A 3FUUA 3EEYA 5DTMA 5EMMA 1ZGJA 5EOVA 5LR6A 5EC8A 5HIMA 4HGYA 3TM5A 2GH1A 3LCCA 2EX4A 1BOOA 4RTRA 3KKZA 2UYHA 1BHJA 3GIWA 2P7HA 5K05A 2BH2A 3R9XB 3E8SA 1IM8A 5MHTA 5M5BA 2OO3A 3OU6A 2CMHA 3P9CA 2YXLA 5FCDA 5GOZA 2NNWB 5C0OE 4CWAA 1IY9A 1JTFA 2K4MA 1SUSA 3LPMA 2ZTHA 5DM1A 5E9WA 1BKYA 3BWCA 3UA4A 2IBTA 3HVHA 2I9KA 4HG2A 5GM2A 1WS6A 3SSMA 4E2WA 4E70A 4PYJA 5C9ZA 3LCUA 3PX3A 2C7QA 2AVDA 5LQCA 1SQGA 1YZHA 1RJDA 3FTDA 4V0QA 2IIPA 1L9KA 5EG5A 4YMHA 3R0QA 2EJUA 5BW4A 2IH4A 3LX6A 1JG1A 2XBMA 3CVOA 5K0FA 3HCDA 3THRA 2FPOA 5EKUA 1Q0SA 3FUTA 3THSA 3I53A 2ZCJA 4OX9Y 2PWPA 2OY0A 3T7SA 3NMUF 2AVNA 5DM0A 3B3JA 3GNLA 5FWDA 5CD1A 3ELYA 5FQNA 1M6EX 4H0NA 5FHQA 4AX8A 2O06A 2EG5A 1X1CA 2JH8A 3JWIA 3O7WA 2Q41A 1JG3A 2AOTB 2QRVA 3U81A 5K0BA 2G1PA 2XVAA 3V8VA 4BLWA 3EMDA 5E9QA 4FSDA 4FGZA 3HTXA 3EGIA 1YFLA 3HVIA 5KYGA 3OU7A 1NBIA 3M6WA 3T7RA 3HA3A 3KPJA 3E05A 3A27A 3OCJA 5DSXA 1H1DA 1XVAA 2PT9A 2P1DA 3EVBA 1AF7A 2ZBRA 3CC8A 3FPEA 3I64A 5U4XA 2HNKA 3TQSA 4DF3A 3GCZA 4CTKA 3ER9A 5HIJA 3MHTA 4HH4A 1FPQA 1G8AA 2G70A 2ONZA 5EZQA 4GC5A 2Y1XA 3D2LA 5EQJB 1KXZA 2H11A 3FUVA 3UJCA 2IH5A 4RVHA 3HCAA 2AOUB 3REOA 4UOEA 1X1DA 4A6DA 4HRAA 2V74B 3MCZA 5FHRA 4XUDA 3DUWA 3LECA 5HIKA 1JR4A 2VDWA 2JJQA 3EVCA 3K6RA 3CJTA 4FT4A 5ICGA 3GGDA 5E1BA 3EVGA 1O54A 4AUKA 2HWKA 1XDSA 3M6VA 3BUSA 1SUIA 1L3IA 4OA8A 4C4AA 2UYOA 3DOUA 2IDKA 1D2GA 3KQYA 4RVFA 3C6KA 5E1OA 4AZVA 5JUWA 3HA5A 3H2BA 3A4TA 1G38A 3EPPA 2NXJA 3FYCA 3KR0A 3FTEA 2H1RA 1SVUA 2ZLBA 3GWZA 3LKZA 3OZTA 1ZHFA 5EHIA 4M36A 2PX5A 3GRVA 2C7RA 4GEKA 2ZWVA 3MCTA 4QVGA 3AY0A 5BXYA 4YUZA 1KHHA 1PRYA 2B9EA 4B17A 4DZRA 4RSRA 3P2KA 3BKWA 2PKWA 5CCBA 2ZIGA 2PV0A 4QVKA 2IPXA 4QDJA 4HTFB 4E2YA 3PTAA 4KDCA 3Q87B 2OKCA 4M37A 4MQ4A 1Q0TA 3OU2A 2IFTA 3GXOA 4BLVA 1EQAA 4RV9A 2B78A 5E8RA 1AQIA 2LD4A 3G8BA 1VQ1A 4X63A 4R8RA 2Y1WA 5E9JA 3KQQA 4RTJA 5GP1A 1XTPA 1SG9A 4PWYA 2KW5A 3VC2A 2NP7A 3QV2A 2BR5A 4POOA 1RI5A 3FPHA 4YMGA 2WA1A 3KQWA 2Z6AA 1YF3A 1X19A 2YR0A 3HVJA 4GOLD 4KWCA 4MWZA 4BP1A 3HCFA 4Y2HA 1QAMA 2XVMA 4QPNA 1JQ3A 2VZ9A 3OE5A 4QTUB 4AZSA 5DXAA 4ER3A 5LQUA 1B42A 3MAGA 1HMYA 1I9GA 2AOXA 5EMJA 1AQJA 2P41A 5HZMA 2YUIA 4QQNA 2OB2A 5FA8A 2QY6A 5H02A 2ESRA 4HC4A 2G8NA 4EK9A 5K8VA 1EJ0A 2AOWA 5EMLA 3AWIA 3BGIA 3GRRA 5HILA 4F86A 4FS8A 2QM3A 3GDHA 3LBFA 4OBXA 1JQDA 1X1BA 2JHCA 3ID6C 3F4KA 5K0GA 2ZIEA 2UZ4A 2NP6A 3G2OA 2OBFA 1WY7A 3CGGA 10MHA 2OZVA 2WK1A 4ATNA 2P35A 3AXTA 2P3QA 1SQFA 4DKJA 1VPTA 1P1BA 4DM3A 2YTZA 3DR5A 2IBSA 3ME5A 5T67A 4AZWA 4E2ZA 2ERCA 5EZSA 1X1AA 3DMHA 5DTQA 3UJBA 4ER0A 1T43A 1QAQA 3VSEA 3T0IA 2ORED 4K6MA 1EIZA 5FQOA 4CKEA 1L1EA 3BZBA 1TPYA 3LKDA 1JG2A 5DSTA 5KVAA 4YUWA 4MTLA 5DRTA 3NDIA 2YX1A 2XYQA 4FR0A 2AZTA 1KIAA 2CL5A 1YUBA 3PT9A 2ZZNA 2ZULA 4P7JA 2QRVB 5EKXA 4KDRA 2PJDA 3GRUA 3KPWA 2AN4A 2PX2A 3PFHA 5E2AA 4GC9A 3UJ8A 2AOVA 2G71A 1FBNA 4PYOA 4BY9E 2I6GA 3IV6A 4P7KA 3IEIA 2PBFA 2A14A 2BM9A 3SSNA 1DCTA 3G7UA 5HIIA 1VL5A 3P71T 3LBYA 4BLUA 2GAFA 3FRIA 3G88A 5DX0A 3HA7A 4LECA 1R8YA 5CM2Z 3C3PA 3DMFA 3FPFA 3S68A 5KS2A 4Y30A 3KR2A 2PWYA 3P2IA 3HNRA 1NV8A 1KYWA 1TW2A 5E1DA 5K09A 4AZTA 3HM2A 2CKDA 3TKYA 5DRYA 2O07A 3UJDA 5LSAA 4DMGA 4YUYA 2YXEA 1WG8A 4PONA 1V39A 1DUSA 2GLUA 3UJ9A 4EMSA 3EEOA 1RJFA 2V7EA 3JWGA 2GA9A 1XJ5A 2P8JA 3BGDA 4RTOA 3IHTA 3NVKI 4E31A 3BWMA 3HEMA 5CUQA 2NXEA 1YB2A 4X60A 5GM1A 3CJRA 3SVZA 3RIEA 4LG1A 4RYLA 5CVVA 3SM3A 4R05A 5ICFA 1UIRA 2O0LA 3DULA 1JQEA 4DA4A 1HNNA 1JSXA 3MTEA 5K0CA 5IKMA 3DH0A 5D1HA 3LCVB 2AOTA 4RVDA 3UA3A 1XXLA 3BXOA 3OFKA 2IGTA 3AXSA 1M6YA 3B7PA 3I9FA 2DULA 3KR1A 3OZSA 3GU3A 2H00A 1XCLA 1XDZA 5BP7A 2P3LA 5B1SA 1N2XA 1EAMA 4YUVA 4LWPA 2GB4A 3KPVA 2ZW9A 4U7TB 3GRZA 2ZBPA 4P7GA 1KPIA 3LDUA 7MHTA 2AS0A 4BP3A 4E33A 1RI1A 3TLJA 1KYZA 3EMBA 1FJXA 1R74A 4R8SA 2Z6UA 1RI2A 5EIWA 3SXJA 2OYRA 3P9IA 5K03A 4RX1A 4XUEA 4C04A 3PVCA 3V97A 1NW8A 1OR8A 3DLCA 2HMYB 3JWJA 2AOUA 4ER7A 3NJRA 3OE4A 2ZZKA 3ELUA 4PIMA 3LDGA 3OFJA 3KQOA 1JTEA 2ZIFA 1PJZA 2ZFUA 3M6UA 3NTVA 4GBED 4IKPA 3A25A 5DM4A 5EGSA 3GO4A 1QANA 5FADA 3M33A 3FTCA 1KPHA 1JG4A 1I1NA 2AN3A 4GOND 3DLIA 1RI3A 3MB5A 3QOWA 3E23A 3MTIA 3R24A 4PYKA 1INLA 3E7PA 3BWYA 2PGXA 5DM2A 5K0NA 3VC1A 5K0LA 3MGGA 1DL5A 2JG3A 2C7OA 5CIYA 1VBFA 3P8ZA 4RTPA 5DX1A 5GWXA 2VDVE 3PX2A 3C6MA 2AN5A 1NV9A 3O4FA 3P2EA 3OZRA 1UFKA 4CXMA 4YV1A 4EQZA 4PNEA 2BZGA 1WXXA 2YQZA 3DXZA 1N7IA 1O9GA 1VP9A 3BKXA 2PY6A 4KIFA 4HTFA 3VYWA 2P7IA 3NWEA 2I62A 3P9NA 4ISCA 1ZQ9A 3X0DA 4L7VA 1VE3A 3FYDA 5T64A 5G02A 3CCFA 3FUXA
chains in the Genus database with same CATH superfamily
2CV1A 5JECA 1NW3A 4QEKA 4G65A 4IMPA 1RFLA 3I73A 1TFRA 2HREA 2OUKA 3QI7A 5F7JA 3ZS9A 5I7HA 1P7VA 3A14A 1RIIA 2I6XA 2Z5GA 3GN2A 1VE5A 4CW7A 4PINA 1IL0A 2Q5OA 4QECA 1CT9A 1CFJA 2MOKA 3TFOA 2BLLA 4J1TC 3TRFA 2MJLA 1P72A 3GF4A 2B98A 2LZ0A 2R66A 3ISJA 3L84A 3MT7A 1X0VA 4OI4A 1RMQA 1S2DA 4V1CA 1S3IA 1TA9A 2NADA 3A2MA 3N2LA 1NMZA 4L5AA 1W93A 4UAJA 3PIDA 3TOZA 3PUIA 1WTAA 5CVJA 3JQRA 4I1UA 3T99A 1SWWA 1C1XA 4HDRB 3OJFA 3U6KA 2FW1A 4LOJA 3T5BA 1EFPB 1J56A 4D8WA 3L8DA 3ETCA 5JS2A 1EG2A 5CCEA 5EJAA 3JARB 3EDCA 2J0SA 4JLOA 4I9FA 2PEYA 5G0SA 4XDYA 1KIFA 4D3XA 5AIBA 2F3PA 5T4BA 1UT5A 4UQPA 4S3MA 2Q62A 5AO9A 3T4XA 2W7TA 4NMHA 3FKSD 5JNVA 1NAHA 2GKSA 4Y9RA 5CT6A 1QGYA 2WDZA 3V8QA 1E3JA 4BC0A 5DULA 4UHBA 2A86A 1Z5GA 1X3SA 3B7WA 4HAZA 1W4AA 4OHPA 2HJVA 4UU7A 2J3IA 4UBKA 5JISA 4KIGA 4DCMA 3RTCA 3KLMX 2IA5A 2FN4A 5AKLA 4PX2A 1V11A 1PP4A 4H6PA 3Q8KA 2VSOA 1Q91A 1IK6A 3ESDA 3FHOA 1JIUA 1Y6FA 3K31A 3AF3A 3NHBA 4HDSB 1FMTA 1GJRA 3C7KA 3NWBA 3G5UA 3JVVA 4QQKA 3U0BA 2X5NA 3UQZA 4CKWB 1QQAA 4F72A 4ID9A 1KBZA 1T0IA 2FUG1 2WVHA 3IYLW 3RFFA 1GSIA 3B13B 3X2SA 4KXVA 1T4DA 1FDWA 3AKDA 4PC1A 5ADVA 2P0AA 3L01A 2DFPA 1CRWG 1CS0A 2OVFA 1JSRA 1XR3A 3CNNA 3EGDB 3L5KA 4M1QA 2JFPA 4WVLA 4C9BA 1NVAA 1GUBA 1FTYA 2P4UA 4PG4A 7MDHA 1NW5A 3O1HB 1LXCA 1X39A 1XIVA 2QAGC 4EHJA 3PCXA 4N40A 4ZT7A 1QVAA 3CB2A 3GDWA 3CRW1 1Z2CA 2NYUA 3QM1A 4MR7A 1O0CA 4PS1A 4DDMA 1MO6A 1SN7A 1SBYA 2QPTA 5K51A 3UWPA 2P4SA 2FZ5A 3JTEA 4L95C 1JDTA 2YZ2A 3VOTA 2CFSA 2NU6B 2H1WA 1JSLA 3CZRA 3EEQA 4LGYA 2BFAA 5FYQA 3PX7A 2W2NA 1CUFA 1NXTA 1RWKA 1TEXA 4PCAA 5EZYB 3DM5A 4D8YA 3NYQA 2UUAB 3GB9A 2LXNA 2OCKA 1ABBA 4R0NA 1RADA 1RFGE 3C24A 4DDWA 2TRSB 2WWXA 3S2YA 1G5RA 1OF1A 2Q1TA 5TE9A 4U2BA 2D0DA 3N1UA 4IZOA 3ADOA 4NU6A 5IDQA 4XARA 1A88A 1FYVA 3JCZA 5TV2A 2Z5LA 3FD8A 3O4JA 5J3JA 1H23A 1LCIA 4MDYA 4PQGA 2C7PA 3C3EA 3ZZNA 8LDHA 2XGSA 3KSMA 1KDZA 1E3LA 3L1UA 4INZA 5K0ZA 3SYKA 4TSKA 2J32A 4RKRA 4A9AA 5COQA 1ZXBA 2G7MC 1GNSA 5KNBA 2IH2A 1R8QA 5L7TA 3ACDA 3UMVA 5EXDA 5DSZA 4DVJA 3I1IA 1DJQA 2BFBA 2GO7A 2KB0A 2IHVA 3IXMA 3LGAA 5AESA 4PPYA 4FW8A 1MX1A 1NWHA 1TQHA 1Y1QA 2FOLA 3WYFA 1B8VA 3TNFA 2ID8A 1TEVA 4IF4A 3KYCA 2XCRB 1RE0A 2AHOA 2FPIB 3AM4A 3EGEA 3T1OA 3G8DA 4UM9B 2DT5A 4UKDA 1P80A 2REQA 1J9ZA 1RQRA 2B36A 5G1NA 2IC5A 2PQ6A 3AINA 1OZGA 3ZR4B 2SNIE 2ZM5A 1RHJA 1ZUIA 2GBCA 4JP3A 5KC9A 2GJKA 3QFCA 5JR3A 2X6TA 2IEDA 3CKLA 3EVDA 3GEHA 2C4NA 5K4AA 3K4HA 2ZVPX 5KHAA 5HF6A 4N41A 1UJ6A 3LDFA 4IZHA 4M49A 1EFCA 3CT4A 1N5KA 3G5TA 5ESRA 1E5DA 1KXJA 4MRVA 5ICCA 4RJTA 2BSXA 5CFRA 4KE6A 2E49A 3O2QB 4BWGA 2WT9A 4MULA 4RGQA 2DKNA 4MVYA 1YS4A 2HQ1A 2IVZA 2W5UA 3D8NA 2EHJA 1SXIA 1U99A 4W63A 4BC1A 4DUGD 4F06A 1OUMA 5ED4A 4X3OA 2JIPA 3E81A 4TZ6A 1ISFA 5K0TA 1OPXA 4N9WA 4DVGA 5E6SA 1H4SA 4YC7A 1KH3A 5K6RA 4WECA 5IW8A 4C08A 1KP2A 3ICOA 2V5VA 1OVMA 1SULA 3O1IC 2XIQA 2JFYA 5EWJB 2OAQ1 1E1CA 1Y1LA 3DFKA 3HCWA 2A6PA 3HGMA 2O8NA 4QUGA 2Y66A 4WOCA 2VAXA 1N9GB 3O2JA 2CXSA 2MSEB 4JBYA 2Q6KA 1OYYA 3KEFA 5HZKA 3A1UA 3U1VA 2CHFA 2YH2A 1E62A 2ABWA 3COWA 2Y1KA 3L1KA 3KD3A 3ZCVA 5COBA 3I5XA 4G37A 1NBMA 5CB0A 1N2JA 3ZCPA 3O26A 4XVHA 4CWAA 2OM2A 3TFQA 3Q5EA 2HBRA 1JXQA 2PCLA 1H22A 2WE8A 1SZPA 1VB5A 4YI5A 3X1YA 2ZJYA 5ALJA 6ABPA 1HC7A 2BDEA 4II3A 5KX5A 3AUFA 4Z0PA 4G9BA 1QHXA 1UKAA 3OD5A 1Q84A 2AJTA 3CH4B 3PX3A 2BYTA 2FPGA 5E9AA 1ADCA 4V0QA 2YY5A 1P8JA 3ASZA 4EJMA 4LJLA 4LXUA 2QRHA 2PSDA 4TL6A 1U9YA 4BB9A 1HTWA 2Y68A 1G5QA 3JZAA 1ISGA 1NUTA 3G6WA 3AVUA 2VP6A 4XGRA 2CLOB 2P6OA 1NRXA 3KZMA 3P1JA 1ENOA 2P2YA 3ZV7A 3DHEA 2FWMX 2NVBA 4D3YA 4XX0B 2XB2A 3PICA 1E2GA 4M0PA 1X1CA 5D01A 3WWDA 4E1BA 4G0WA 2AOTB 2PKQO 1AZLA 3EBPA 3UTDA 1ZJ4A 3FFAA 1U90A 2LW7A 3D7SA 3MYRA 3PYLA 5KTTA 4DV1B 4TM7A 1Y9EA 1NQWA 2PTGA 4MARA 3WDLA 2D0OB 2GF9A 2M6KA 3H5VA 2NQTA 1NMQA 1RAFA 1UAAA 3KPJA 3HYCA 4LGMA 3SEQA 4A2QA 3AR8A 1KOGA 3RRNA 1IY0A 3L07A 4OSPA 3CC8A 4P8RA 3C3BA 3QEOA 4ZCIA 5FBVB 1U80A 1W75A 1TYZA 2YJ3A 4O4HF 4WXPA 4EKEA 2WWIA 1N2CA 1N77A 2WUVA 1OX5A 1UK7A 3FETA 4L8GA 4MUNA 5KSPA 4GC5A 1RWVA 3JASA 2H11A 2HN9A 3THXB 1XOIA 4OXXA 4BEVA 2DUWA 2HK8A 2G9QA 2X41A 3QVSA 3GNTA 4M53A 3VPHA 2V74B 1A4RA 2HF9A 4FYHA 3JQBC 1N5DA 3QJGA 1SVIA 4YCAA 3SI7A 3TZLA 3UEOA 5ICGA 1SY7A 1ZS9A 3CEJA 5TPWA 1MOSA 3GHYA 1K6XA 1L4YA 4BMSA 1USIA 1FL9A 2DLNA 3P27A 4ZI7A 4M9QA 3VR0A 2TMGA 4V0KA 4A8HA 4B82A 5K45A 3HA5A 3B48A 4DWWA 2JIMA 1ZOSA 1MDFA 4G0ZA 2D5CA 3TLZA 4QJ3A 2DCMA 2NYRA 2CEKA 1GG9A 1N5RA 3GWZA 4YRLA 1X1SA 4QREA 4WACA 3LUJA 1BA3A 3AMVA 2PUBA 3P4YA 2IPMA 3C8ZA 2W6IA 4JMLA 4IJKA 4TUYB 5TJHA 1Z6XA 1KRXA 2ECFA 4X1YB 4TLCA 2ODBA 3K16A 5CDFA 3PTAA 2BE9A 4F5ZA 3MT8A 3Q87B 4GXRA 3IDSA 4BLVA 5A1TA 2PZMA 4RV9A 2BTEA 1SXJA 2VR1A 2CFRA 4KLAA 5DO9A 5E6UA 4BNKA 1T4GA 1TT5B 2VCYA 2ZAYA 4QGFA 5KOJB 2F00A 5FI5A 5CAEA 2AYZA 4G1VA 2H08A 2WM9B 4F46A 2BJWA 3FZNA 3JYOA 1E98A 2KW5A 3D2BA 4BBAA 2X0EA 2QZPA 1ZSVA 2HW8A 1TM5E 5D3KA 5SYMA 4D98A 3Q1KA 4YJHA 3LP8A 1N1GA 2VA8A 2IQ5A 2ETXA 3MJ4A 2BHNA 5D51S 4LGCA 2AH5A 3MQ4A 3H5RA 4YEDA 3ZGXA 4AJ4A 1GTSA 1LLUA 3P9ZA 2XMSA 4AO7A 1J8FA 3AZOA 1AKYA 1E2QA 3FOWA 4WOPA 4C78A 1E3DA 3U4HA 4D42A 1M8PA 3W34A 3IJ5A 3N7UA 1PX2A 4B47A 2HL6A 1Z0IA 4Q9NA 1TADA 4I1RA 2QTNA 4B3BA 4L28A 4IHQA 1KA9H 4O2RA 4XOIA 5SV2A 4F6RA 3N07A 1Y7PA 2BEWA 5KHLB 4BL5A 2JHCA 4DG8A 3LLMA 2VZLA 4KGDA 1RZRA 4TS4A 2C5GA 4P3OA 4B84A 4WNCA 2PH7A 1C1HA 1ECPA 1KKLA 2FR8A 4FZ5A 3U80A 1BYUA 1NI4B 4RSMA 1E2JA 3GAAA 1X7GA 4XWYA 3ZHRA 4IF6A 4G85A 2O0JA 2RMKA 1F0YA 4JL8A 3RVNA 4AZWA 3VOAA 1A9PA 3U4QA 1SFRA 4ER0A 2D8MA 4GMHA 4ND8A 3T0IA 5JOQA 4HEA6 4M98A 1NW4A 1F0NA 1KQ3A 3OPYB 1EP1B 5FQOA 5G3ZA 4CKEA 1YZVA 3I09A 3ZE0B 3VH2A 1JHOA 4IINA 4IO1A 1H8ED 3RS8A 4PX5A 1H0KA 1DVRA 1E32A 4FDMA 2YN0A 1JIXA 3UMCA 2IYEA 2N0SA 1NVKA 5IVIA 3I0NA 1ESNA 1GLGA 1FEZA 1NNI1 2PX2A 5E2AA 4F71A 1LI7A 1MUUA 4W9NC 2AOVA 2FQWA 4HDRA 4BU0A 4H27A 4TKVB 3ABIA 2XNDD 3UANA 3FNEA 4Q05A 4D92A 5K3EA 3GLIE 1GD1O 1NVGA 4YREA 5LA6B 4QTYA 3LBYA 4YQYA 5CDUA 3OJLA 1AMUA 3X1MA 5PNTA 1Y6GA 2JVIA 1QCZA 2GYUA 1MEOA 3N2EA 3C3PA 4IFTA 3TW6A 4EG4A 4ZOLF 4ZVLA 4DQVA 4WCFA 3TIIA 1LTHR 5F1KA 5HK9A 3QXSA 4PF1A 4L3OA 3E48A 1CPYA 5FTJA 1IHDA 1CZRA 4ZJUA 2EARA 3TKYA 5JSHA 3QX7A 4AQDA 4G24A 5CHYA 4NAHA 3TQRA 3E27A 5TF0A 4BNTA 4ZARA 4CLRA 4W5WA 5CBKA 3WZ2A 1SIUA 4YJDA 3RTAA 5EIEA 1E9DA 1IEQA 4E0BA 3ZNOA 3QPVA 2Q27A 2ZRAA 3KJXA 1PDVA 3A05A 1M5UA 3ZWOA 2GCIA 3NEPX 1DX6A 4FB5A 5DTEA 3GRKA 4IYRA 2WJHA 3S2FA 3HJCA 1GL3A 2ZT6A 1A50B 3CRRA 3EG5A 3GJZA 4Q3LA 4IOJA 1HFKA 3AEKA 5FPSA 5JNTA 3HU3A 2IPNA 1EWTA 2JFQA 3D54D 3MOGA 3N75A 2JZOA 4FMCB 2VN8A 3DH0A 5ALLA 4C0XA 4CM9A 2QTGA 8ADHA 1R5BA 2GZDA 5IKMA 5HP4A 1FLAA 1M6YA 4MUIA 5LQSA 3DE7X 1THZA 5TGZA 3HWX1 5F7OA 4RK7A 1ZVKA 4JB8A 3RV3A 1K68A 1VIAA 4FN4A 4NE2A 4YUVA 3MBIA 2CMKA 3SQNA 1E4EB 1EZ1A 2GB4A 3IQWA 4H15A 1E0DA 2O2CA 2OHOA 2YRXA 4HD8A 3JRNA 5HCIA 3BFVA 1SCDA 2R1TA 4X00A 1V8OA 3ZE6A 1PYDA 1U31A 3F46A 2FN7A 2DBVO 4E09A 3OSUA 1E2IA 3R0IA 1A5TA 1RYHA 3ZQUA 4Q3AA 3GQBB 1BXRB 1YHZA 3QELB 4CLEA 2P6RA 4EJFA 3VYTB 4Z4FA 2AOUA 3TLBA 5EZYA 2ZJ4A 3B6IA 1F2DA 3KCQA 2VLBA 1JTEA 4YAIA 3RF7A 1P7WA 2GYWA 2YMLA 3UKOA 4D96A 1HR0B 1NQXA 3AX6A 4PG7A 3DT6A 1E6CA 4D5EA 5AW0A 4QYIB 1M0TA 4GXTA 4Q7EA 4PYKA 4ETMA 3AVQA 2X23A 4R2LA 4P4SA 4EEZA 3UTCA 3HJUA 2D7DA 1U3WA 1OFHA 2W2OA 4ZIRA 1B14A 2A1TS 4YRSA 1ZGHA 5HQ3A 1VBFA 1T8SA 1OROA 1OH5A 1EUDA 1WAMA 4Z9YA 4GGMX 2Q4DA 1AKNA 1UJ5A 2Y71A 3EIUA 3H87A 4GGOA 4EFMA 3NTRA 4LRTB 3OZRA 2XMDA 2IYZA 4L0MA 3PF8A 1DRJA 1ESCA 1O9GA 1XELA 3HKDB 1YB4A 3KTFA 4LSZA 3OQHA 1AB5A 3NIGB 1D9XA 3E58A 4FMBB 2DERA 3BRWD 5B4VA 1V5IA 5IBCA 2JC3A 4JVOA 4XTRA 3CCFA 3WGYA 2FY8A 1WDMA 1P91A 4FKMA 1MVOA 1K0FA 2XUFA 3M0EA 3R23A 3B89A 4R84A 1ORHA 1ENPA 4QBKA 5JI3E 5T4EA 4EKIA 1JPJA 1PGQA 2I03A 3QOFA 4Q6BA 3ZY2A 2Q5QA 3V7FA 2F6RA 2C4VA 3QGMA 1DQZA 5E2BA 1XDUA 1GGMA 1R0XA 3L7MA 3QQPA 4KRXA 5AKHA 4EG0A 1G3QA 3BIXA 4JBLA 4KW7A 4ND4A 2FF7A 2WSSA 1W7AA 5LZ2A 4YAEA 2CDRA 1ZU4A 2X1MA 1IOVA 1QDEA 2QSYA 3BVPA 3T5GA 3RAEC 1AIPA 1Z8DA 3IBYA 4BMNA 1GUAA 1OHHA 4XLLA 4EVSA 3DMRA 3EXFB 3HR7A 4I5EA 3N6RA 3P5BA 3UGQA 3H5LA 4YCSA 3GLKA 4LMBA 1NNEA 4QUJA 1XAJA 4OLAA 4H16A 3RAGA 2G0AA 4S1NA 3HL4A 3SOZA 4C6RA 1SA0A 5CTJA 4FNGA 2C77A 1HYQA 1XQ9A 5FOXA 1CVIA 3BE4A 1H42A 1Z15A 1NONA 2J9GA 1IBLB 1DLIA 1A1VA 2PFKA 3I34X 3O92A 4JLBA 3SZOA 4EVIA 1ZL2A 4JJ6A 3R9KA 5LWQA 1YQWA 3IDOA 3ZZ1A 2VDUE 4Q4AB 3A6PC 3A7DA 1LVGA 2YWFA 1NBOA 3I3SR 4RVCA 4EQ6A 3WFJA 4NBUA 1Y4AE 2GCOB 2PGIA 3ZN2A 1VP3A 4J0HA 5ANRB 1E5VA 4B4KA 2R7LA 4PCVA 3WL3A 5DXJA 2GDZA 4MV8A 1WW8A 4JLWA 3WJ7A 3MAJA 3DE6X 4FMDB 3PC7A 3TTXA 4DCCA 3WV4A 3GJTA 3AJ9A 3VX3A 4M1YA 4O1MA 2C82A 1UFRA 1EH5A 5JFGA 2JBAA 3RHTA 4INOA 4CR6A 1V3TA 5EE5B 3H2IA 1GEEA 3M5CA 4RPGA 4TOIA 1DKPA 3FZGA 4FZJA 5CJPA 2ZUWA 4QOFA 2XDAA 3BULA 5DI3A 1DO8A 3QOXA 4QM6A 1PG0A 4IYJA 1UFOA 2C57A 4WLEA 4FDTA 5KNDH 4DPLA 2ES4A 3HB7A 5KQSA 1OXXK 1NJ6A 1XCPA 2OD9A 3UVEA 3ZOKA 3ZLVA 4PIPA 1P9OA 2R6CA 4NWIA 2E82A 1E6WA 3NHUA 1SZJG 5D7BA 3WAJA 1VL6A 1TPZA 4Q3EA 1FYEA 3W2EA 2P30A 4IMRA 1KS2A 4MVJI 1T5DX 1ZVMA 5AVSA 3MVEA 3O6VA 4JXKA 1BSVA 2G76A 4HEQA 5JYBA 5H1YA 4BO3A 3K05A 4L9WA 4CL2A 3AGPA 3CG0A 3EZ6A 3GR6A 4H7KA 4B45A 5KQPA 3N05A 4QUIA 1FNNA 2NXNA 1OTYA 1C3OA 2Z3ZA 3KCNA 1YI0A 5BT9A 3UGKA 4AAYA 1QP0A 1I51A 1S02A 2RK3A 4HS9A 2NV6A 5EERA 4F9GA 1YNOA 4P9NA 3IP1A 3LWZA 2WNIA 3MWLA 4WVFA 3CBGA 1KGDA 3X44A 1BKSB 4Y9TA 1N36B 3W6NA 1N8TA 3WLHA 2EL7A 3ZLUA 1YZ3A 3QMVA 1GA6A 2AC7A 1LC0A 1JHMA 4JOQA 5TY0A 4MKHA 4DW8A 4F7WA 4ZK2A 5HF5A 1NBAA 3NIBA 2E4UA 3I83A 4ZDJA 1Y3DE 2ZZMA 3DVAB 4TMYA 4M46A 1K8XB 5GPBA 2FUNB 5KTOA 4LQCA 1PJTA 4GP7A 3A3PA 1IEXA 3L7YA 2XIJA 2IIVA 2IEAA 2AR9A 3HKBA 2G9ZA 1J33A 1G1MA 1EVJA 3E3LA 4KSCA 4L78A 4KXFB 5KDOA 1NQAO 2I1VB 4KRGA 1H65A 3OLQA 3FM9A 1M3SA 1RI4A 3LUPA 3TLMA 4NZMA 1CQJB 3IBSA 1KEVA 4B2IA 1U8ZA 3FDFA 5DLDA 4EABA 1TA0A 1VECA 3WP1B 5E4JA 1EFRD 4MHTA 2H4YA 1Q2XA 5AKXA 4BNHA 4CVNA 4YJ3B 1QGAA 2C2OA 5LQNA 1U3FA 3FYUB 2H3EA 2E4XA 5CX1A 3U1BA 3JZFA 2P2CA 3IKLA 4G4SP 1XB2A 1XWWA 4HAWA 3S1AA 4EY7A 1WMEA 2ZU0C 1T0PA 4QT0A 3SQWA 2Y1LA 1M2VA 2N75A 4KV7A 1V8ZA 3V48A 4JZKA 2XUKA 4L4UA 4NCHA 3PFCA 4E46A 3W8NA 4EP1A 1K98A 2I1LA 4P3KA 2OXIA 5CB4A 5J2UA 2PSJA 1BMFD 1UXJA 2CE2X 4IH9A 4BO4A 1KP9A 1QIIA 1P74A 2GMWA 4JIMA 2PT5A 1KJQA 2YN4A 4Q7QA 4JEIA 2DSNA 1EFDN 1YMUA 4HUJA 5JBIA 3BWXA 4D4HA 5F9MA 3ITNA 3TM5A 2IZ7A 4AJ2A 3OCUA 2Z58A 1SOWA 2IUTA 2QHXA 1I36A 3EZYA 4HADA 4IO0A 4J2HA 4LJAA 1CR6A 4ARZA 4ZU6X 3WLMA 2WKWA 3M49A 2PMDA 1DIGA 1T2FA 4JZYA 4MKGA 3GT4A 1R0WA 3K9HA 1N1MA 4MRRA 4O4HA 1YC2A 3BTUA 3N6XA 4LIPD 5JWRA 4K81B 5E9WA 3F5QA 1OBHA 1E4VA 1U6JA 3I4CA 5I7SA 4DR4B 1WS6A 3K5IA 4PQRA 4BRSA 1E94E 1VA5A 3OZIA 3TL2A 4EGSA 4F4FA 5CLHA 2C7QA 1E79A 5DVZA 4F4HA 3D4NA 3ZIAA 3AI1A 3PEYA 3KXIA 4HLUC 3DDHA 3RIXA 2QVXX 1Z4IA 4IMJB 4OTZA 1Z63A 3BIJA 2YDYA 3E18A 3UAWA 2FPPB 2BH9A 3EXEB 2VHVA 3FNRA 4DLXA 2WUDA 1SXGA 2FLWA 3NMUF 1HYEA 4MPRA 1TM2A 1CULC 4UCFA 3MA0A 4B81A 3ZQ6A 3I62A 3RVPA 1IRXA 4RZ3A 1M6EX 1W85A 1IDN1 5FUQA 2ZBEA 4AU1A 1HLGA 1BWQA 3EWIA 3A70A 1N2CE 1KEUA 5KSZA 3D8RA 3CVWA 2UVPA 5LXTA 2MINB 4I6EA 3TR5A 4OB8A 4TXNA 4L6CA 1MX9A 4INAA 1EVLA 1VPEA 2JFNA 4QHTA 2WR8A 3SBOA 3S2SA 1YQ9A 4AJHA 3IESA 4ZYLA 3HPQA 3C4VA 1ZUWA 3W5BA 4LWZA 3DT9A 3ER9A 2NZWA 1DEAA 3TQHA 1IM2A 1U2DC 1ABFA 1IEWA 2GBIA 4O5AA 5D5HA 1U1EA 5EJ9A 1D1QA 1G8AA 3EQ6A 3WL8A 4BRWA 3A2KA 4F93B 2IOFA 1AVTA 1U7OA 1FMCA 1OBOA 1S2MA 1C8KA 3LUCA 3GRPA 4YRGA 3ZEAA 3UAOA 1SNYA 3ZWXA 4FOPA 2OHVA 3A36A 2VDWA 3A3NA 2JJQA 3AEYA 2CJWB 4O4IB 1P9WA 3BCUA 3RYHB 1Z56C 1NG9A 3OC6A 2BHSA 1JI3A 1KVRA 5MN4A 1KI7A 3BUSA 4QJBA 5BNWA 4I4IA 4ZJZA 2JLWA 3DOUA 2VJCA 3ONWA 4UNNA 3C3KA 1GL7A 1C9DB 1PNOA 4EOGA 1QE5A 4JP2A 5TQ2B 1A9XB 3P9SA 1EE1A 1L5WA 3B8EA 4KOEC 3UG7A 4B2YA 5I51A 2WTBA 3FWPA 4BKRA 4ZZ1A 3AU8A 3W2FA 1A5ZA 2PJZA 1SVUA 4XVQA 4BFXA 4XWOA 5JDCA 2Z08A 4M36A 3V46A 4MHSA 2QVBA 2PL9A 4EX7A 5I7VA 5H3CA 3QX3A 4HZUA 5TSDA 2BMEA 3L8CA 2PD6A 2X0JA 5DBOA 3ST7A 1XZGA 1ADGA 2X0RA 1LWNA 4GMGA 2VHXA 4NPAA 3UAGA 4LFAB 5BN5B 2FEPA 2VATA 1ZEJA 4Z8XA 2VHZA 5M04A 4FGUA 2H7XA 3BPSA 3WDSA 2L69A 3LGXA 1WSAA 3ILVA 3SD7A 3DGFC 5A62A 3P96A 5HG0A 2ZJ0A 4OSOA 3A3KA 4JSRA 4QSHA 2JLCA 3VNBA 3QV2A 2BR5A 4XJSA 4POOA 1PD1A 2OQIA 1XMXA 4XVRA 5FOSA 1Z06A 1Z4NA 3TW8B 3ZU2A 2GEKA 4E22A 1PLLA 2B6NA 2Z6AA 5ETJA 3VHRA 2R6JA 4JWKA 3L6EA 4IKEA 5JANA 2NU8B 2EQBA 1C9NA 3NKVA 2WSLA 3C98A 4ENVA 1U3VA 3OESA 3RVLA 1HMYA 4QYIA 3L7BA 1JG7A 1ZX1A 2CXPA 1C4KA 4UCQA 1RKBA 4IQ8A 3UATA 2WYOA 4DQXA 2PUHA 4OSEA 1OT3A 4LY0A 2XQIA 1L7AA 3NH6A 4JJAA 4LPSA 5FA8A 1SCUB 3KSBC 1PJ2A 1U5AA 3K92A 1EVIA 1EEHA 3GAZA 5ENDA 2WHXA 4JQSA 4QHYA 3AWIA 4PPNA 3GRRA 4KQ9A 4ZALA 4ZO8A 5IZCC 3AFHA 3O73A 4QG7A 1NVMB 2F3TA 2X3UA 3AI7A 1CUGA 1W49A 1RJWA 3AK4A 3F4KA 3LNCA 2C9OA 4TTAA 4WLUA 4ZOLA 1W29A 2Z1NA 2ZREA 1ODFA 1SIWA 4GBJA 4XOUA 4XQ0A 5AW5A 1WXQA 3WB1A 3IERA 4B48A 3LNTA 5HJ2A 4E4TA 3G9QA 4UM7A 1BFDA 4ZD6A 1JEJA 1U0OC 3EODA 1VMEA 1C3LA 2XLBA 3W4IA 1CYDA 1L1QA 5IABA 3N74A 4DA0A 2WTUA 1CHNA 1EIZA 3PI7A 4MKFA 5LYYA 3WGHA 3SY8A 1NVWQ 4FFRA 1TEZA 5IS2A 1PWYE 4CEJB 2VK1A 1J20A 4ED9A 2P2SA 2O8CB 3W78A 5KNCA 2BMWA 4ZOEA 4EEKA 5C80A 5ILOA 1LV8A 1CCWA 1ZW6A 2ECPA 2YRWA 3ESRA 4LNUA 4HGRA 2Z9CA 4UFPA 1QYIA 4EY5A 2G4CA 3EIHA 4L07A 4X8LA 5HYVA 3WQQA 1QGED 5L3ZA 2VUIB 1OBVA 1SXHA 5GONB 4NOMA 3R7FA 1YRHA 2A5FA 1U3GA 4G67A 4IH4A 1JJVA 1YWGO 5WRFA 4JN6B 1UJBA 3G88A 1JLMA 2TSYB 3HPRA 3KP1A 1W1IA 3S68A 3CEAA 3QEMA 5ADHA 3WYAA 3DEKA 3IAHA 4A4DA 1E3WB 3AUJB 3MEQA 2VJYA 4QUKA 5DRYA 3VDMA 1JZTA 1HX7A 1E20A 4H2DA 2L0XA 4X8OA 3L05A 3OE7D 4CCSA 1U0EA 5F5XA 3WNZA 5HR5A 1Z7BA 2ACKA 3P52A 4R01A 5CT8A 1WVIA 1CUXA 2HJ9A 1T0HB 5JYCA 1XYGA 2WM2A 3BGDA 3K9CA 5ALZA 4ACAA 1JDUA 4DL9A 4RTOA 3BWMA 3HEMA 1YONA 2AUMA 3RG2A 4X60A 2MCFA 2QTFA 3C97A 2QJTA 3H5AA 3GT7A 2KX7A 4Z54A 1JKFA 2XUHA 1I2ZA 4HN2A 4H31A 4JJEA 1R27A 1UXHA 1VCOA 2CLHB 3OMXA 1PZFA 1EXWA 1WOYA 2I29A 2OR3A 5JO9A 5C5EA 5MGBA 4BMYA 2BUBA 1II0A 2FPSA 3OKFA 2ZIXB 2QYHA 4W4TA 4F5DA 3EG9B 3KWLA 4MK4A 3HRIA 1CRLA 3OZSA 5H3LA 3QVMA 1C80A 4LAFA 5BP7A 4UE2A 3DZJA 4B6GA 3O0DA 4QEDA 4OXNA 5AWFC 1YCFA 3MELA 3WB0A 3GRZA 2ZQ5A 1XFAA 1V6CA 3QW2A 2WOJA 4IVPA 3QTBA 2B8WA 4OOEA 3RJTA 1GRVA 5NULA 1IJBA 1RMYA 1XV5A 4HBZA 4PX3A 1BCRA 3CUTA 3HO6A 3IKJA 1ZZGA 1JIIA 5L3QA 4F3TA 3VKVA 3WRWA 4GL4A 1O96A 1FTQA 2GYYA 2W2LA 1MA0A 1BHQ1 4FM9A 4R1LA 1PUIA 5JD6A 5AM2A 4A36A 3R3JA 1QZUA 3LDGA 2XUPA 3USCS 2H4HA 1MJGM 1PJZA 1LGYA 2CVZA 3GWGA 1B0UA 3OZCA 2WSBA 1VLQA 1NU6A 2CMDA 3PIIA 4TV9B 1PWHA 4N0QA 4X1IA 4DPKA 5LIPA 1E5TA 5JS1A 3KTAA 3QVVA 3Q5DA 3CV3A 3AVTA 4PSUA 1G20B 2XZTA 5DM2A 3PLNA 4NBNA 4P5EA 4DJDC 3GN1A 4Y1RB 1E9FA 1VRVA 2XEDA 4PSVA 4LRUA 2W6ZA 1I1OA 1E1DA 2J0QA 1EI9A 1LI5A 1PFQA 3A0RB 2YBDA 2WYIA 3BGSA 3UMSA 3DVAA 1NV9A 3MGKA 4LPKA 2VF4X 2Y05A 3N2GA 3PE3A 4GR4A 4JQOA 5GZ1A 4GZMA 1TVMA 4U8GA 1RP7A 4R9UC 2XCTB 4R2XA 2Q9BA 4DQDA 1AKTA 4XFDA 1Q0RA 5H7XA 2XMPA 1LBEA 1L8LA 2KM1A 3I5YA 1UBHS 2F67A 3D4OA 1QSGA 1H2RS 3UN1A 3KB1A 4Q9AA 1UINA 1A98A 1NKSA 1T4BA 1JKIA 2DF8A 5F21A 4UUAA 4F7DA 2E9SA 4FC6A 2IZ1A 3E2IA 4O4LF 3TLAA 1CF4A 4FOSA 3W5CA 1G17A 1QLJA 2OZKA 3HHPA 4WXEA 2ZIVB 2AKYA 1GAWA 4K9NA 4MYDA 5JSZB 4NOKA 3ETJA 3PQDA 1ZN8A 3QE2A 4OQNA 3FRHA 2Z1DA 3BN3A 4QUAA 5DNVA 3U7IA 2QZZA 2VHYA 2FFBA 2BF4A 2GCGA 4E08A 5MFPA 5ADWA 3HY4A 3D0RA 2HZBA 4M38A 2IEYA 5LQRA 2XYVA 4ZZ2A 3RU3A 2FE1A 3HB9A 1PLKA 4UU8A 4X93A 3WMFA 5AT1A 4PNZA 1R3DA 4UEWA 3HU2A 1FTNA 2QN1A 3CZ9A 3M6XA 4GM4A 5EPEA 5KB3A 3FI9A 3MWEB 3OZEA 1HKHA 4BFSA 1CB7A 3GRFA 5BWMA 5J4YA 1ZI9A 3MHPA 3Q3VA 1IVSA 2KYRA 1TCCA 4BV8A 2BMJA 3PB3A 4NFYA 1HDXA 5C32A 2GUGA 3L79A 3R4CA 4EGCB 4H35A 3I5UA 5CG2A 1H6CA 1J2JA 2KSQA 2YVUA 3EF1A 4QWWA 3C5EA 5DOVA 1UBJS 2ZBQA 2XQJA 4LJ9A 4ZV9A 4KVZA 1NG1A 3AVPA 1R6BX 1RRKA 3AHJA 1Z16A 3QPAA 1GXSA 4PIVA 2A33A 1XUOA 3Q3IA 4ZMBA 4RTQA 1RPZA 1DAIA 1O94C 1NDUA 4U7HA 2ZWAA 2WIJA 4BNDB 2WV7A 1HK7A 1T1SA 1YZKA 4W99A 2DTEA 3S6JA 3VUFA 5LZ4A 3UOAB 3U17A 5KPJA 1XFDA 3IVMA 5EXPA 1EWQA 1NE2A 1R12A 1PZGA 1Q3TA 2V6FA 2ZOSA 4KO2S 2HR1A 3ZNQA 4K46A 3PPYA 2CFOA 1XD2A 3MRVA 4RY2A 2POQX 4FGWA 5LP6B 4G6ZA 2FPPA 4G84A 2BFWA 5THKA 2VS1A 1OU0A 2BMAA 4ZAZA 3B6MA 3ZU4A 4WDRA 1G5PA 1T5LA 2VUSA 4B79A 1DEXA 1G5FA 3B70A 4OJQA 1Z12A 5JXIA 2YXDA 1NMSA 1ILEA 3H5OA 4G8JA 3E9EA 2R3SA 4R5HA 5I9TA 3NHKA 2E5LB 3VH3A 1B6TA 5LBUA 2Q46A 5TR9A 4ACBA 3ZWKA 5K0JA 3HB4X 2O9JA 4CCYB 5I9BA 3DXYA 3OIGA 5TT0A 4IIHA 3VYUB 5C7IO 3NDJA 3VKFA 2PNFA 5LQMA 3HCCA 1ZWKA 2CDNA 4FGLA 1YQTA 1V1RA 1AT1A 2ARKA 3I01M 3HO8A 4U5XA 3AL2A 4D9KA 1J2YA 1KK0A 4DM4A 4DB2A 5DWVA 4Q15A 2WPDA 1YZFA 2O5EA 3IJPA 5LZ9A 5HJ5A 4IIFA 1US8A 2F4NA 1G16A 2C3OA 3F1LA 4CF7A 1W2HA 2FXIA 2Q3CA 1YGYA 3HJBA 5BSMA 1FFGA 4D3SA 2X5KO 6PFKA 1K86A 3L7LA 6AT1A 2C2ZA 1NLZA 4U63A 1JR3D 2XAAA 1IG0A 3GVHA 3PDIB 3PWTA 1NL3A 1CE8B 1PT8A 2OORC 2FEMA 1Z0FA 2VP3A 3PTZA 5FPHA 1F9EA 2CJWA 2GCPA 3AWDA 3PQCA 2ISCA 2W6QA 4I2NA 2PLWA 4MJXA 1GM5A 4X7RA 3TLGB 1KFEB 2WU3A 4FS3A 1PR6A 5FUBA 2FR1A 4BQIA 1KAEA 3KAJA 1N0VC 1TUEA 1QG6A 2XYRA 4M8LA 1XDDA 2BGJA 2QL5A 1C0KA 2V7GA 5IAEA 1L5HB 1Y7LA 5TQ2A 1NSTA 2XZOA 2UUPA 1Y7HA 4K6KA 1B7GO 2JW5A 1XNGA 3EVFA 2R6ZA 3MUOA 3PEUA 5P8WA 2AZMA 2WVJA 2DVMA 1ZJWA 1MAVA 1RU3A 1ZXLA 2BR4A 1ISIA 3DTNA 3JQQA 3K1AA 3O83A 1Q7BA 3AM5A 4O4JA 1CKEA 4TWJA 3ORYA 4GHWA 3P2MA 2JGKA 4E32A 3QRWA 3DMTC 3M4ZA 1B00A 3B9QA 2CNOA 3PWZA 3V80A 3JQ6A 4MEBA 1G55A 3RGGA 1OWLA 3TKAA 4RM3A 3AKCA 1L5KA 2CXXA 1JXMA 2FI1A 4RHCA 4JBHA 4P0TA 2O4CA 2X22A 1VMDA 3NUGA 3WGLA 2LDXA 2ZQZA 3GV0A 1J7KA 3DBVO 3DQQA 1ZIPA 3HWWA 4HB2A 3IO3A 3E7XA 3KFLA 2GJSA 3MWDA 1XRJA 3OEHA 1UUFA 1U04A 4U3JB 4ARAA 3BS4A 3WS7A 2I4RA 2Y0PA 1TAUA 3KPYA 2OCBA 4H1WA 3WZLA 4YRQA 1ADYA 1P1CA 3DXXA 3RS9A 3S0JA 4D74A 4EZBA 3CZAA 4RS4A 1JEAA 1GDTA 4RELA 2GTHA 3B8HA 2P69A 2EFEB 4MS3B 3AGQA 4Z7JA 5H16A 7ABPA 3ZJVA 4J2TA 4QELA 4MR8A 5EIFA 3Q7EA 3WO1A 1O87A 2C5HA 1AQNA 4RJKA 1GKIA 3P0RA 2I6TA 4RM2A 3KC2A 4X3PA 2FOIA 3TVDA 4Q6WA 4W1PA 2EDAA 3JQ9A 5DNEA 4A27A 3CWCA 4NRDA 4Y9UA 4ZCTA 2Q4EA 121PA 4PGMA 5M5BA 2PDAA 1MXHA 2RE8A 3E9NA 2NNWB 4P2BA 3MLEA 3DUFA 4HWKA 3UENA 2CVPA 2QN9A 3X3HA 4ERXA 3CU5A 1UWCA 3LPMA 3NRBA 5J1TB 3BWCA 4FFNA 4KWEA 3IH5A 1ZJZA 3QVGB 4G26A 4JFAA 1TM1E 2WJGA 1DBQA 1N9ZA 3ZXSA 2H85A 4YMWA 2YXPX 2AVDA 2IVFA 3C5CA 4NTZA 2A0XA 3MT9A 4FHDA 2B4AA 1IHOA 1BO6A 4JL5A 3VR6H 3A6DA 1WDLA 3JQFA 5BW4A 3FHTA 3IIKA 8ATCA 4YRBA 3M5DA 1OAOC 3PJFA 5K0FA 3FUTA 3P0IA 4RLHA 5DYGA 1THTA 4I55A 5F5LA 3I53A 4EL0A 2OY0A 3AJAA 3GLTA 4Y0AA 4AP6A 4AUEA 2HSGA 5KMGA 1N0IA 1DX9A 4MPDA 2AVNA 1BU5A 3RNLA 4Q34A 4AZ3B 1MJNA 2PZFA 3R5HA 1QO7A 5HDQA 1EYZA 4H0NA 3ADCA 5C4GB 2O06A 3RUEA 1A76A 2B4QA 4BFVA 2FGKA 3GCDA 2XMGA 4MI6A 3OZFA 2XVAA 2OESA 4LISA 3V8VA 2NTNA 5L3SB 1SXPA 4X62B 1FTWA 5JZ9A 1PJBA 1KI4A 2C7VA 2YOFA 3M6WA 3R76A 2D1FA 2PU5A 2P90A 1G5HA 2GEBA 3OCJA 3NEYA 4O8ZA 2CD7A 2GM9A 4C30A 1WHSB 1JAZA 4EA9A 3EDRA 3QPWA 4OXRA 4TQ9A 1XVUA 1GQSA 1ESZA 1KEEA 4QFCA 1RRFA 2RAPA 3VAYA 1XJ0A 2V03A 4YCLA 3PC4A 4R40A 5IHPA 4A91A 3U4MA 4MUJA 3GPCA 4RJ2A 1RYZA 3G9XA 4BIIA 3WGVA 5BSWA 1P2FA 3O90A 2L82A 2XXBA 4PX9A 1FBTA 1JU4A 3EUEA 3N39C 4WKOA 1NP3A 3LYLA 4JJ7A 3RBZA 4DV2B 1X1DA 1E99A 1KJZA 1VOTA 1GFIA 1QVWA 3MUFA 5H4HA 4DLPA 5JVDB 1Z5WA 1P62B 4KIJA 4R83A 2V4UA 4BE7B 1JEQA 2LPMA 2X7JA 5ITZB 3UAYA 1AUPA 2G9RA 3DL2A 4WA8A 1DLJA 3X1KA 1I3NA 1NVXQ 4BYGA 4G1CA 3RVKA 2HO5A 1VG1A 2F48A 3HEAA 4QZVA 4GI5A 3TB4A 4NKRA 1M2NA 1Q1EA 1ICIA 3IT3A 4L76A 3UG6A 2RHGB 4IDHA 3HNOA 4HJXA 4KWTA 2H1RA 5CU7A 4N7RA 2QMOA 2HMVA 4KFRA 4WQMA 4QVIA 2QGNA 3EIWA 4DPMA 1G8MA 3GRVA 4GEKA 1J00A 2VAMA 4MWOA 2QPLA 2OAP1 4DE5A 3PWKA 1S5PA 4YIKA 5BSGA 1S2OA 1OI3A 3DVSX 3LX4A 1U3TA 3F0TA 4QJIA 2RB4A 5TS2A 3W2IA 5GZ3A 3SX2A 1FYDA 3DLTA 2IP4A 4TV8B 3VR4A 4H6VA 3W04A 2B78A 2LIVA 1ECFA 5FKJA 4I1VA 5LZ8A 4BIMA 5CA1A 3ICEA 4TWZA 1E9AA 4MJLA 3TSWA 3JQDA 3OIVA 4R8RA 2VQ3A 3SJAA 1I2AA 3EOAI 2PUDA 3S27A 5C51B 4PWYA 1Q19A 2QTLA 4Q5IA 4P0PB 3AU9A 1AA6A 1EE2A 3QJ5A 3HSKA 2LKDA 4OI1A 2F3QA 3UAZA 2A1TR 2AG0A 2C0CA 4Z9AA 4P3PA 3AEQA 4Q47A 1FS5A 4XIYA 5JSKA 1ZQ1A 4DFDA 2GNOA 4ZEVA 3KZOA 3VO9A 5CX4A 2B4KA 8OHMA 2WFAA 4WI1A 1G20A 4D9MA 3Q7SA 2B30A 2C4HA 2OILA 3OCYA 2QBYB 1VJDA 1ZN9A 2B21A 3MINB 1U2PA 4UVDA 2VDKB 1W4ZA 2AOWA 5HILA 3BGIA 4WA7A 1VLVA 1Z2NX 1KZHA 3ZU6A 1V4NA 4BVGA 2NP6A 2QX6A 3QBDA 4BMOB 2IU4A 4XWGA 3GYBA 2X8BA 3HFJA 5CNKA 5LN1A 4KP7A 3PQ7A 4QBTA 2WK1A 2GSDA 2Z4SA 4GU5A 4LOHA 4U00A 4B09A 3QWIA 2VYNA 3O8NA 1TU4A 1IHXA 2O1XA 5A9SA 1W0JD 3E3AA 2HJRA 2VQDA 3A4LA 2QEQA 3H83A 3P0HA 4UE6A 4JCCA 2ZR9A 4JVNA 1EX9A 2HGZA 3RK4A 3I12A 3USES 3ZTWA 5D5PA 4BCBA 3AFOA 3ZD7A 1BX0A 2AI1A 3ED5A 2I9PA 5LBTA 3UUFA 3GX1A 1SUEA 2GX6A 1USUA 3EXIB 4ITVA 4PO9A 1M1NA 1M2GA 1BD4A 3K15A 1KFJB 1WWKA 1UXGA 3OOSA 4G1FA 2MYUA 3TCKA 1ULSA 1NVVR 4P34A 2YJGA 5TARA 1IY2A 4O8CA 3W5IA 4DTIA 5ELXA 5ALKA 1E1QD 2CJPA 3M4NA 3SZRA 4TS1A 2AN4A 5DNDA 3LX8A 5F33A 1Q17A 5EZ6B 4X66B 1M6NA 4D02A 5AKGA 4EJSC 3MUEA 1UPAA 1VLLA 3I42A 1XEAA 3EIEA 1G18A 5JATA 3FCSB 5CLLA 1P9RA 3X43A 4KXQA 4IXMA 4LJRA 2WVAA 2R8EA 1E7QA 1FP7A 3H2YA 3EGOA 3IRVA 3O8DA 1GAQA 2I66A 3PU6A 2PWYA 4HDMB 1GKKA 4HX9A 4L0CA 5G0VA 1ZR2A 1EVZA 1WM1A 3NEAA 2ZGVA 2I8LA 2QRLA 5TMEA 3SS9X 4IDEA 4E5SA 1V48A 3HNPA 1SC6A 4NYIR 1MC8A 1LFAA 2BGLA 1XZPA 3REQB 3V32A 5IFLA 2F64A 1G66A 2F8MA 3OFVA 4WY2A 3DBLA 4MQFA 2IYSA 5TEVA 5FO0A 5H3HA 3WLJA 1JLLB 1W1UA 5EZ5A 4E31A 2HXGA 4BJ5A 4ME6A 1XLTA 4FWIB 2ACVA 3PRHA 4F8EA 5L7YA 1DEHA 2E0IA 1XEFA 3QEBZ 2RBGA 4IOLA 3TPCA 5BRAA 3H6HA 3OBIA 1YVPA 4X45A 1R0SA 1Z0JA 2TMDA 2AV6A 5DYYA 2YVKA 2QQFA 2OMEA 2V7XA 1OXTA 4ROTA 5B3JA 1AHPA 2IYPA 3L49A 5A9RA 4DEVA 2X2PA 4LV8B 5FL7A 3KR1A 3N7TA 1XCLA 4NBLA 2IEZA 1K7SN 1E2UA 2C58A 1EAMA 1NF3A 2Y0DA 4FOTA 1JKMA 4J9VA 5DE3A 1E4OA 1OY1A 1UKZA 5AOAA 3HJAA 3EWAA 3JQ8A 2B1GA 3AETA 1M67A 1U9ZA 1Z39A 3I1YA 3LDUA 2EGUA 2XXAA 3OEYA 1GGKA 5I8WA 3TLJA 3LHFA 5EIWA 3D4BA 1Y6ZA 4BVKA 2VTVA 1KQOA 3D5QA 3ZU3A 5TF4A 4BP8A 4YP9A 1AK1A 2QROA 1LF0A 2JI4A 1MQAA 2VYFA 3IAS6 3OFJA 5TNXA 1ZONA 4NCJA 4DRXA 1S8OA 1LNZA 4UOQA 2G77B 2X2FA 5DM4A 1PTJA 3WL4A 4DQKA 4D6XA 1CUJA 5AI4A 2JLBA 4Q4JA 5JD5A 1GPH1 4RCVA 3DLIA 2FMHA 2RH8A 3JW8A 3UB2A 1DTWA 4MV4A 4CG0A 1INLA 2ADOA 2ZYGA 4XR9A 5I6DA 2PGXA 5C37A 5K0LA 3NCHA 4O3MA 2BKVA 1FP4A 3MFQA 3C7DB 3KX2A 5G4KB 4UXIA 2WM3A 5A02A 3IIEA 1QG4A 4FIZA 4HR7A 1FQJA 3OUUA 4HDKA 1UMDA 2AN5A 2EKLA 3GW8A 4CXMA 4IG9A 3FWZA 1KVUA 1IZ7A 1ID8A 3NWPA 1NLUA 3TJRA 3QW4B 4QUDA 4CYMA 4ISCA 4RQTA 1XD9A 1SQ5A 3OPQA 3P9NA 3K0AA 4R1OA 1UJCA 4K2AA 3S5UA 3ZCSA 1BMQA 2JATA 3M1AA 3R3WA 2R7KA 2PIDA 2W2PA 1CZOA 1JLKA 1PR3A 3H17A 1Y8ZA 1XPOA 3G23A 4MEJA 4F2DA 5D3ZA 5FLXA 3PXBA 3PHJA 1XAIA 2G72A 2GESA 2P8SA 1SBNE 5IJAA 3B5IA 1AGXA 3FF4A 4JC5A 4MR9B 1P0MA 1XN4A 2R6R1 4IWNA 4OQDA 2R1VA 3NTXA 1M74A 4YBRA 5AICA 4KMOA 5FCDA 4CF5A 3PPVA 2ZRQA 1K7YA 1KI2A 2C7BA 2UVDA 4ZT5A 2D13A 3T1HB 1HI9A 4FFDA 4HAYA 3FMVA 4G01B 4RJLA 1L5FA 3ESQA 2HK6A 3SBDA 3WLOA 2XPCA 5BWLA 2OZLB 4HFMA 1IN4A 1KI3A 4JSTA 4L8WB 4OHBA 1J22A 2QYOA 3MILA 2A30A 2H1OA 1GTL1 4WLVA 4DZZA 4L5BA 2R47A 4WZZA 5JXJA 1AGPA 5CJJA 1HMPA 3UPUA 4BBZA 1UZAA 3D6VA 3VNVA 1Q7GA 2VG8A 3ZEIA 1CBUA 4DA8A 3G1WA 1CRZA 3OLWA 3HKEA 4FFVA 2P40A 2IEGA 1TUGA 2NLOA 3MSXA 1VKZA 4XLTA 4EY6A 4RTNA 4Y67A 3SMVA 4CMBA 4L0DA 4IV5A 1OW3B 3FH0A 4Q1BA 3GJQA 5AKYA 3T4UA 4CKCA 2RB5A 1IQ0A 3A6LA 2DETA 3AUUA 3TSCA 4LBZA 2P4QA 1QYCA 4R8KA 3L18A 1KQPA 3GFQA 1COWD 2HQSA 4S1OA 5AHXA 3QKRB 4B8WA 2Q3FA 3QMMA 4M9XA 3LF2A 1E63A 2NZJA 4MO2A 4WZ6A 5FTKA 4OQXA 3ZHBA 3UWSA 3UUWA 3QJYA 1OXSC 1DKMA 4EB8A 4GQBA 2AWNA 2DM6A 2F3UA 3I45A 4HSGA 5AM0A 1CNEA 1WUIS 3OP1A 3T5PA 3GBSA 5DLQC 2BPOA 1YJCA 1FLDA 3AC0A 4CZ2A 1ECJA 1MD9A 1YZQA 2G67A 2IUEA 5F2KA 3FUCA 3T5TA 3QVGA 5JT1A 4C89A 1BZYA 1SVWA 1UOPA 2WIDA 4RA9A 3WSVA 4RF4A 2MMCA 1NKTA 4RW0A 3PJRA 3E53A 5A2QA 4ND5A 3IOBA 2IXGA 2RCYA 3P2JA 4J0GA 2EG9A 4H59A 4A1OA 4DA6A 4P0QB 1HL7A 1XVTA 2TS1A 2X9VA 3LPNA 4MUXA 2ACEA 2NYVA 4I4CA 3VBEA 2PLRA 4GRAA 1XG5A 1SBIA 1T6XA 4DGSA 1XVLA 1WNTA 2PFSA 3EDYA 3FIJA 2G08A 1LQUA 3KPUA 4Q1AA 2F8LA 4EHIA 1HE1C 2QL6A 1A77A 1H8HA 4KC0A 4M0LA 1AQUA 1XD8A 2QA5A 2P65A 3IOCA 2YJ5A 2UZ0A 3DFIA 4HEHA 2PA3A 3NR2A 4HDNA 4RXUA 4C1NA 4LC0A 2FMIA 4O33A 3TQIA 1HEUA 4A8JA 3IXLA 1Z82A 3S2UA 3PLAE 1DCMA 1D9ZA 1XLVA 1A4UA 1WDWB 2XUGA 1CY1A 1Z07A 3FWYA 4JR0A 4KQXA 3RUCA 3GJYA 3ZKAA 1ZJJA 3QFFA 3VYSB 5K4HA 3GP8A 2QN2A 4WBXC 3VR5A 1J97A 1REQB 2IYRA 3UHPA 1RM0A 1KS9A 3LQYA 4L4RA 3KOUA 4WEQA 3S1SA 1ACJA 4B3HA 2D59A 3ROGA 1XZAA 1FS4A 4FOLA 4AM8A 2E6UX 4URXR 4LF9B 2FX3A 2WNHA 1KRHA 4F3CA 1SKBA 3LPDA 4ZQBA 4CKYA 1IZ9A 1JQLB 4C22A 4E4RA 3OQVA 3K8QA 1DBVO 3FF1A 3E5HA 4GNRA 5ALUA 3EMVA 4ZO9A 3MS2A 4CG3A 5CBPA 3K94A 3NU1A 5EE9A 4E5PA 4H6XA 2ZR7A 1P61B 2W4QA 4UTPA 5IYZF 1RLJA 1FU4A 1HQKA 1NR5A 3P2YA 1KI8A 4G23A 1BMDA 1FXSA 5JMPA 1QH0A 2HPAA 2Z9DA 3UXHA 1IN6A 4DCSA 3D6FA 1ZA1A 4DLVA 1GNQA 3FOBA 3RUIA 3A7EA 4R31A 1OLOA 4L15A 5CDSA 2BZ1A 1W94A 4MLZA 4KV9A 3EIQA 2XE4A 2CK3D 2PZKA 4NCNA 3ROPA 3ICQB 3DBRB 3EA5A 3Q8XB 1BDBA 4IRMA 4W8GA 1C7RA 3UUGA 1KDYA 3JYQA 2GRJA 1L7MA 4YASA 5DCWA 1FTSA 3FPAA 4WX2B 3A6FA 3UJ7A 4CL0A 3WK7A 1XTRA 3IV9A 4N8DA 5FDFA 4J0KA 1E1KA 2W98A 1ISSA 3PK0A 2YIDA 13PKA 4DRYA 1HNWB 4QXOA 4H7DA 4GX5A 2QAGA 3LMKA 2HLHA 2IX9A 2WQ7A 3OHSX 1JHAA 4FPXA 5DLYA 2QUZA 2AEFA 3U3JA 5C1PA 2ZSUA 3IILA 2V4MA 3S2EA 2QRGA 3UJAA 5FH9A 3IGFA 4KE9A 4XWKA 1JH9A 2PSFA 5IAAA 4BNMA 1OJ7A 1WCYA 2CMGA 1KFCB 1QHIA 2B8JA 3E9RA 1AKQA 4ZVTA 3CUSA 2IKQA 3R9IA 1UPFA 3CE9A 1CEQA 4MVJA 2ACWA 4PC6A 5BN4B 2EL9A 5EXTA 3LXUX 4JXXA 2FKNA 1E7WA 3EWNA 1H66A 5LB2A 5ALWA 3A1EA 1WHTA 1YI1A 2VQSA 1P5HA 1P77A 2PGOA 2X76A 3D9QX 3NOXA 3OAAD 3PQ3A 4G0OA 4D43A 2H1LA 1T1JA 4B6RA 5A4IS 3OO0A 2IK8A 5EY5B 4P82A 3WDKA 2PUGA 3HJRA 2J09A 2QI9F 2ZYVX 1H6DA 3H5NA 4KMSA 4OGKA 2P2NA 1CQPA 2CW5A 1IM8A 5CM9C 3KZ1E 5JNRA 3PENA 3GBPA 3O9VA 3G2NA 4LC1A 2NNLD 1S7CA 1SR8A 1G6KA 2PLNA 4R9SA 2VYVD 3K32A 3ITEA 3TQFA 3W7AA 3WYCA 3LW7A 4UCXA 5H68A 4XZ3A 1TQ6A 5C7OO 4E70A 4ROSA 3H19A 3VPFA 5T41A 4Y2UA 3DTVD 4RCYA 1T6BY 3C8DA 4GO1A 3CX7A 3NJ4A 3WQSB 1YJ8A 1MH1A 4Y7DA 1XHEA 3C3MA 5IPFA 2DBZA 5LJIA 2EKPA 1PW7A 1QCDA 3M8KA 1Q0SA 2RG7A 5EKUA 2PUVA 3IT0A 1BHSA 3TB6A 1H69A 1E7YA 1IB0A 3B82A 3PJGA 4TKMA 1X13A 2DLDA 3VI4B 4WN9B 1EHYA 4ZICA 2Q4TA 3EXIA 3KT3A 3CF0A 3GNLA 5F1YA 1FVHA 1EBUA 4OFBA 1L5OA 4LJ5A 4YCJA 3L4KA 4C87A 2NSJA 1J99A 2JDIA 3ENVA 3L0CA 3U81A 2P9JA 1QIMA 2X0NA 4K87A 2ATCA 2JPDA 2F1RA 2D0IA 4BLWA 1L5NA 5KJ6A 5JYDA 1CNMA 3HTXA 2Y4OA 4TMXA 5BSRA 2HSZA 4Y2GA 5KJEA 3OECA 4BX2A 2WSYB 3PHHA 4GRIA 4M0MA 1JHYA 2B4YA 2H2DA 4Q7MB 2R8YA 2AQHA 1LPAB 2VJLA 3DCIA 3HSYA 4UU0A 4CM4B 3KSUA 1Q7TA 1L9XA 1YSCA 1MO3A 3A9VA 4ISBA 1P1HA 1BE6A 2M2IA 1WU8A 1P2UA 2VAVA 1OLXB 2JFWA 3F96A 3H9JA 3NT2A 4QPZA 4TXJA 2P62A 1QWOA 3PNQA 4IIBA 3PF9A 1FW6A 2BISA 1T1GA 4BVLA 5BVHA 1DBRA 1P19A 4UOEA 1JFSA 2CUTA 2OVBA 2YWEA 3D4PA 1PR0A 4MW9A 4DMFA 2HDNB 3U7HB 1QHYA 2WJJA 3ZG6A 3GJ6A 1TQ4A 3EVCA 4NYMR 4QXAA 3QKUA 3EVGA 2ROQA 4WNIA 1MG0A 3IAAA 2VTBB 4OXQA 4G4GA 3H0KA 4TL9A 2JFOA 4JX9A 2PSHA 2UYOA 4F8JA 4H7HA 1Y3FE 2G7ZA 4JHLA 1QV6A 3OTIA 3T3EA 3C1UA 2R60A 2QS9A 3AY6A 1Y3CE 2I3DA 1EZZA 4JI2B 3A4TA 4HLCA 1O4WA 4AN0A 4KWHA 2BFEB 4FWBA 4XUGB 2LCIA 3IUNA 3TVYA 3ZD8A 1SQ6A 5E0KB 2KBFA 1FUEA 1TUBB 1USGA 4QOJA 2GGSA 3RAPR 5B3LA 3NG1A 3L4JA 1QPZA 2F2TA 5HJEA 3QVKA 3R9WA 1L5SA 4YUZA 4H3HB 3IEXA 4AL4A 4DDKA 2R48A 1NN1A 1C30B 2XUAA 2FPLA 1K4YA 2ZB2A 2GT1A 2WG2A 4HTFB 1VZ2A 4YRMA 9LDTA 3SJCA 2A35A 4W6ZA 4PC7A 3HFRA 4BKUA 4OOFA 5E6RB 1ODIA 2JGFA 4PO1A 3H11B 2PD3A 3G8BA 2RKWA 1B3RA 1T9KA 1NLYA 4ZA2A 1CZLA 5SZJA 1KMHB 5C5CA 3EK2A 2ZRHA 3VC2A 1A27A 3NV9A 2WAMA 4UBLA 4EPYA 4F21A 1G20E 3H7AA 1ZINA 4ZODA 3NBYC 2IELA 2WA1A 2BFOA 4ZOQI 4Z1OA 2C5SA 1ORTA 5JS8A 4LZAA 4Z2AA 1BRMA 3L02A 2VZ9A 3GYGA 4RIFA 2VPTA 1A2KC 2D06A 3KOWA 1ZH0A 2W2QA 3F2IA 3V1MA 4J4BA 5FO1A 2IHYA 2ZRDA 4MRMB 1ZVJA 2YMMA 4RPCA 2C2BA 1IN8A 1Z2AA 1F8YA 3IP7A 3Q5GA 3CVJA 4J0DA 4QQNA 3TMYA 4BB0A 3Q7TA 2ZROA 2ZYTX 3RARA 5K8VA 4KPUB 5G4KA 4F38A 4KDEA 1MVLA 4K28A 3ADDA 2WSMA 1CB0A 1HE5A 2Y27A 2GO1A 3BHIA 3IB6A 1IXZA 1NLMA 4G1MB 2ZR8A 4KACA 4P86A 3LXRA 3C7TA 3SE0A 3DMPA 2FWIA 2I4NA 4F3NA 2SICE 3GLVA 5BOSB 2H06A 4FYXA 1NSYA 3G2OA 3K5WA 3ZVKA 3PGMA 3F7MA 4NATA 1EE9A 2JJ1D 5DIFA 5AYVA 2A3NA 1QHHA 2B94A 2P35A 5F3RA 1VPTA 1UBTS 2QRPA 1YJ5A 2BGNA 4OHFA 3TLXA 3ZDZB 1DEKA 4QA9A 4B71A 4WUVA 2PO5A 5EZSA 3ZH9B 4HVCA 1NM5A 2Q28A 1X1AA 5YASA 4TWIA 2HLDD 4OUDA 5C81A 4TXMA 1U7PA 2JLQA 3RVOA 3VZPA 1KMMA 4L8YA 3CBQA 4BWVA 1Q20A 3KWFA 1P2VA 1TZ2A 2QVZX 4EGFA 4EYOA 1ULHA 2QVLA 1TPYA 3QZUA 5EAIA 3WC4A 3C14C 2ZQYA 5DRTA 5KWJA 1RYNA 4HHEA 1XAGA 3EJWA 4JI8B 5AI6A 2EP5A 2AZTA 4JMPA 4UC0A 2Z2XA 2EX1A 3G2HA 1IYZA 3LY8A 4Y2JA 3E9YA 3FMFA 3IELA 3GRUA 1K27A 1JXAA 1NIJA 3ADBA 3ZVNA 4JYAB 3IE0A 1DC4A 3EXAA 4MVCA 5FORA 3R7WB 5JQGF 3GGSA 1RCUA 3HR4A 3U6BA 2IZ5A 3WMWA 1JT2A 2CNBA 3FKQA 3LT2A 4L75A 4WKCA 1CZHA 2PBFA 3LUFA 1KE2A 4KR2A 1D2NA 2FEOA 3QWBA 4Q00A 1GSAA 1HT1E 3PXDA 2C97A 2WAXA 1S8AA 4NEHB 4UJ3A 4QOHA 4YRTA 1AN9A 3OT1A 4LKRA 1C3JA 3FRIA 1A2BA 2PO7A 1G2QA 4YRKA 2O4UX 3DMFA 4EMTA 1D2RA 1ESMA 2VHUA 4RVNA 3G3EA 4FZ3A 4I66A 3R8FA 1E3QA 5JSQA 4CQLA 2RGXA 3VH4A 1VL8A 3IAS1 2FTKE 1JXOA 1Z74A 1IOWA 4UHFA 4DTCA 3CPJB 1MFZA 1PSZA 1U4SA 1Y82A 1YZNA 3F2VA 3IQHX 5TQJA 3CQ9A 4OLHA 3F5DA 4Y6RA 1JTVA 4U6QA 3ZS8A 1SKQA 3SIXA 4LXGA 4PZCA 3FMPB 2GPSA 2OV1A 3O4HA 2DECA 3LYAA 1D5CA 2BI7A 3ITDA 4JLKA 1RWMA 3K0HA 2CHQA 4P4UA 3IQDB 4I0WB 4XGQA 1EA5A 3T9BA 1JAYA 3V6MA 1EDBA 1WZUA 4RXTA 5GJCA 4DV3B 2OHIA 3QVXA 4A10A 1UEIA 5ALIA 4XAQA 3GT0A 3KJGA 3SXUB 4H0FA 5JEEA 2C3PA 2IGTA 1QP7A 4MLCA 4RIEA 4NYJR 1ZO8A 3K8OE 1WIWA 4Q93A 3TO5A 5I7UA 3WGZA 2VQEB 1DC5A 1ZD2P 3UIEA 1MIOB 2X3YA 2YJTD 3R2JA 3KQLA 3WLIA 2WD9A 2XVYA 2ZBPA 1NVTA 3F5MA 4E4YA 1GNRA 4MEAA 1T15A 3NIFB 2PGJA 4FCWA 3QPUA 2G1JA 3M9WA 1Z08A 4LW8A 4ZHQF 1H6AA 1J4AA 1N6HA 4NARA 4K9PA 4JWTA 1LBQA 1LPNA 2YINC 1VDMA 3I6ZA 3CRNA 3N0RA 3CNBA 1G5IA 2C9CA 1IJKA 3DOIA 3LQ4A 1MO5A 3AR9A 2YFKA 2DFNA 1X80A 2ZZKA 2X1VA 2ETVA 1U7WA 1WV1A 1FP6A 3ELUA 3LBAA 3NTVA 2I33A 3N7AA 4IKPA 3VHXA 3ZGYA 3TRHA 4LF6B 2SKCA 2BGTA 3I9KA 1A5BB 1O0SA 4AMBA 2JCXA 2FF5A 2R7AA 3LP6A 4K6GA 4LJ8A 4S24A 4MUAA 4LYEA 4TYNA 3LZCA 3M7IA 1M8FA 4QPCA 1SC1A 3C39A 1RC0A 1ZD4A 3PRYA 5FBRB 5IC6A 4ALMA 4AJ9A 3CRZA 4OYHA 1DQRA 4AP5A 2DR2A 2ZVQX 2CKMA 3ZGZA 4YXWA 1HNZB 2XUOA 1BJRE 1J6UA 2G06A 3P2EA 3P19A 2XQFA 5AVKA 2GN8A 1VIVA 4B7AA 3PFNA 3DXZA 1KEPA 3LKBA 1U2SA 2REBA 2CXUA 1YDFA 3LOQA 2P9EA 2ZSIA 3QF7A 3R5XA 4QQRA 1CX9B 5JDIA 3ITKA 4C4RA 1XE3A 1Z6GA 2ZUVA 3EUAA 2V6IA 4QICA 4RHYA 2PBZA 3JWEA 4X1KB 3K6SA 1PG5A 4A2WA 4YRZA 4NBRA 3MG9A 4JJZA 5AJHA 4MS4A 1E1NA 2QG9A 4F12A 4ZAVA 5B1IA 5BR4A 1OBCA 4BQRA 4AJEA 1U9IA 4Z7NB 3OIYA 5LLSA 1UEJA 3CN7A 3PEVA 4YAKA 4Z53A 1P4SA 1WUHS 3IPRA 3QV1A 4ZEWA 3SR4A 4Z9BA 1NY6A 5KQLA 4YCBA 4G5FA 2HDOA 1EXMA 4DIMA 1E59A 1IXRC 2DHRA 1PS9A 1YDHA 1QF9A 2HPHA 3I2JA 4NP6A 5LKRA 3UBTA 4K40A 3VVLA 5HUJA 4MOWA 2FRXA 3ENKA 4DSAA 6YASA 1Y89A 1GPJA 3HVUA 2GZMA 4E1AA 4W1QA 4UOZA 4QGGA 1H2AS 4ZYUA 3O4GA 1D2MA 3FMOB 4EVQA 5BW8A 3QKSA 2AD1A 3V9PA 2YIMA 2NPFA 1B8UA 2I2CA 3B1KA 5HXAA 2ZBDA 2CLIB 4CQMA 1R6AA 1KDRA 2VPPA 2OV2A 3KEMA 3U3RA 2YWGA 4YPOA 4ZK6A 1HXHA 2ZRIA 1SEPA 4I5GA 1RZ3A 2GK4A 3IUQA 2FWJA 3QHPA 1MT3A 2J3JA 2R62A 3ESCA 1FRZA 3L6BA 1EJ6A 2IHKA 2IYXA 2ZJAA 3C6QA 5A4JA 5FUVA 3FDIA 3SDZA 4FDUA 4KE7A 1X3LA 1GKYA 3QVWA 5U9CA 2PS0A 3EPHA 4EAQA 5AHKA 5C5DA 3AJDA 2IOQA 2E37A 2CYBA 4C0WA 4DNXA 1I5RA 4HQRA 4G9EA 3UC9A 4ZYWA 2ODNA 3PFIA 3LO5A 5TT1A 3GK3A 1P3Y1 4C43A 2I67A 4GPD1 4Y2SA 3SFTA 4DHWA 5FBWB 2VLIA 3KFXA 3MTQA 1SXJC 4X54A 5EGNA 4YO8A 1FRQA 2IV3A 4PPFA 3EXHB 1QGUB 1YL7A 3ABSB 3SFVA 1N3YA 2CJXA 2P9GA 3KJZA 4H7FA 4KXLA 4B76A 4DLKA 2FZLA 2GM4A 3TAHA 4C4ZA 1H3NA 1F4VA 1YBVA 3Q1LA 521PA 4FSXA 2IOHA 4EG7A 2HJHA 3JQPA 5JD4A 4QO8A 4LDZA 4KQWA 2QY9A 5A4AA 3KBOA 1GT91 3ELDA 4J0IA 1KR5A 4UNIA 4YCDA 3TW4A 1B74A 1T9ZA 4FN5A 3BZUA 2WF6A 2HOQA 2QD4A 3W8FA 2VC2B 2CXQA 2OTCA 4ZAFA 3WYDA 4BFWA 5F2NA 4DV4B 3NBXX 1ES9A 4IL5A 4EO4A 3AZPA 4AMVA 4DB4A 2QRJA 4GUAA 4B3TB 2O6HA 4IG4A 3TRKA 4AZ0B 3K0KA 1UM9B 2H4FA 2Q1WA 3CIFA 1HQCA 3FZQA 3MFYA 4X41A 1II8B 4KN8A 5KVVA 4YHBA 3BD8A 1W0KD 1MF7A 1Z83A 2R84A 3U31A 1FFEA 3ABOB 3PCRB 1YBHA 3KVRA 4QOIA 1A4IA 4RTMA 1VYUA 2ZJ5A 4JDUA 1RAAA 1TZJA 4N7MA 4NXNB 2FR8C 4CDNA 2H54A 1AGRA 2IL1A 2JKVA 4OL9A 1OXVA 3UKJA 1T8TA 2VF5X 3BH0A 4QU5A 5IULC 1EXDA 3P45A 2C9MA 5LDGA 1QFMA 3R7AA 1GCGA 2BGMA 4P7FA 4WZBA 1HPLA 2P78A 1JWBB 3MOIA 3V7YA 4PLZA 3T9AA 5BY2A 2H16A 3C7CB 1LDEA 1QWSA 3DB1A 4OK5A 1NYLA 5BYBA 3FHJA 3ZQJA 2BOVA 1ZL0A 3I28A 4PXAA 4EMBA 2PMCA 1P5JA 5IJ9A 4OXKA 1QKKA 2J9FB 4OHOA 1Y9JA 1ISPA 1U7HA 3DZKA 4MIEA 1HGXA 2NTYC 4KK3A 4B5LA 3KM0A 3EN0A 5DDIP 4MV3A 3MJDA 2QVCA 4J49A 1JPNA 5DEIA 3KQKA 1TUBA 2YRFA 4TN1A 5FXMA 2JGIA 5A7HA 3F9IA 4CUJA 2AEJA 1YRBA 3OPNA 4B74A 1RPAA 3OFSA 4E03A 3JX9A 1ZY2A 3IVCA 2JAWA 1EJ2A 1XTUA 3ZCTA 3C3XA 1IQUA 4FFLA 4ZP1A 1N7HA 2YWBA 2PZLA 2ZCUA 1KEWA 1Y8QA 1QYRA 4XDGA 1DV2A 3ENNA 4UNPA 2VEDA 3AQIA 3F8SA 4QULA 2XDYA 4WPGA 2GZ2A 3TX6A 5KTYA 1ECBA 3OTHA 3S2IA 4EA8A 4R68A 3ZD9A 3GFGA 4WCFC 1C41A 2Y1CA