2OZVA

Crystal structure of a predicted o-methyltransferase, protein atu636 from agrobacterium tumefaciens.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
229
structure length
208
Chain Sequence
MDAMLLASLVADDRACRIADLGAGAGAAGMAVAARLEKAEVTLYERSQEMAEFARRSLELPDNAAFSARIEVLEADVTLRAKARVEAGLPDEHFHHVIMNPPYGLFEDWIRTASAIMVSGGQLSLISRPQSVAEIIAACGSRFGGLEITLIHPRPGEDAVRMLVTAIKGSRARLTFRAPLIMHETGSHAFTPFVDDLNNGRAAYARNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a predicted O-methyltransferase, protein Atu636 from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transferase
molecule keywords Hypothetical protein Atu0636
total genus 59
structure length 208
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ozvA01
5DRTA 2B78A 2BR3A 3DTNA 5E1DA 2PXAA 1B42A 3FUXA 3Q87B 2P3OA 2NXCA 3G2QA 3T7RA 5GWXA 4YUZA 4V0RA 1P91A 2NP6A 2CMGA 1NV8A 5DX0A 4E2WA 1ZG3A 5EHIA 5EEHA 2OY0A 3UJDA 2QRVA 3ELWA 2OB2A 4GC9A 3THSA 4ER3A 1RI4A 3BWYA 3BGVA 5ERGB 3VSEA 3B5IA 3EVZA 1X1AA 3Q7EA 1XXLA 1XTPA 5FUBA 4FT4A 3EVCA 5K0GA 1MHTA 1X1DA 2BM9A 3KR1A 1OR8A 2IFTA 1ZGJA 4BP3A 4YV2A 1XJ5A 4QVGA 3RODA 5DLYA 1NT2A 3FTEA 1NV9A 1HNNA 3LECA 3P2KA 3EVFA 4FS8A 7MHTA 5E9JA 1FJXA 2G1PA 5DT2A 1DL5A 3E7PA 5FQNA 2XBMA 1I1NA 4OX9Y 4PNEA 3B3JA 5GM2A 4ER0A 1F3LA 1D2CA 4NECA 5EG5A 4E30A 3FTFA 5EIFA 3BWCA 2B25A 2FK8A 2OBFA 3G5TA 3KQWA 4ZTBA 2NXJA 1VP9A 4R6WA 4C03A 1NW8A 2PX4A 3FPHA 4LWPA 4KIGA 3HEMA 2Y1XA 2EJTA 3QOXA 1Q0TA 4JXJA 2P7IA 5HIKA 4PONA 3M6VA 1INLA 2YX1A 1VE3A 5FADA 3SM3A 4GOOD 5C1IA 4YUYA 4FGZA 4QPPA 5G02A 3LX6A 4DMGA 2WA1A 3ELDA 2CL5A 1R6AA 1NKVA 2H00A 1JQDA 3T7SA 2Y1WA 3UJ6A 3FRHA 2AOVA 5P8WA 1ORIA 4A6EA 4RTPA 5E8JA 2IH2A 4KWCA 3P8ZA 2YUIA 1G6Q1 2HWKA 3B89A 4OQDA 5K0EA 1G55A 5DM4A 4BP1A 2VDVE 4PYNA 2ZVJA 2ESRA 4CKBA 2A14A 5JR3A 4ISCA 2UYOA 4CTJA 5LQKA 3FUUA 3HCCA 1QAOA 3ANXA 3I58A 1SQGA 3SX0A 4RTNA 5HEKA 5IH3A 1G8AA 2QE6A 3KR9A 2DPMA 3OE5A 4C04A 3BZBA 3P2IA 4MTLA 3UA4A 2AN3A 2KW5A 2ADMA 2WA2A 1YUBA 2ZSUA 5E9QA 4AX8A 1FP1D 2YQZA 3FPEA 3IEIA 2BR4A 3HCFA 4P58A 2C7RA 4X60A 3TFWA 3EMBA 3EVDA 3NJRA 1WG8A 2GLUA 3G2MA 4AZTA 2OB1A 4EQZA 2O0LA 4UOEA 3HA3A 3TKYA 5EC8A 2XVAA 4EMSA 2IGTA 3G2PA 5HFJA 3I9FA 3PT9A 3NDIA 3UWPA 2XYQA 3P9CA 4XUEA 3TPZA 1KPGA 2YXLA 1JQ3A 3DMFA 5E2BA 2PKWA 4EVIA 1RI5A 5EMMA 4RTLA 2WK1A 1KP9A 3ME5A 5CVEA 5FCDA 1JR4A 3LCUA 2GB4A 1JSZA 4X41A 3G2OA 5KQSA 4QDJA 1VP3A 5K0BA 2ZWAA 4GOLD 1RJEA 3P9IA 2O05A 4DCGA 2G70A 4CKCA 4F85A 2PXXA 3DOUA 1YZHA 1RJFA 1SG9A 3GU3A 3UJBA 4DA4A 2O07A 4GOND 4RX1A 5K0FA 3BGDA 1ZGAA 1AQIA 3DXZA 5F2OA 3X0DA 3JWHA 3SXJA 4QQKA 4OBWA 3O4FA 2P7HA 2IP2A 3FPFA 2O06A 5GOZA 4DKJA 3E05A 4HGYA 2IBSA 1M6YA 2P3QA 1R8XA 4PYIA 4PIPA 5DPMA 4ER5A 3FUWA 1RI1A 2Q41A 1FBNA 5D1HA 4POOA 4YUXA 3MCTA 3HA5A 3PFHA 2IDKA 3TQSA 4P7FA 5KYGA 2P3LA 3LBFA 4YV1A 3MHTA 3NWEA 4GF5A 3MB5A 3B3GA 5FTWA 4R05A 5BXYA 2GPYA 5FWAA 1JSXA 3DH0A 3RIEA 4RTSA 3CJTA 3GGDA 3A25A 4QQNA 2CWWA 5K0CA 1AV6A 8MHTA 2YR0A 5EPEA 1AQJA 2Z6QA 3HP7A 2I7CA 4KIFA 2NNWB 3KQOA 5GP1A 1KYWA 2ZFUA 2H1RA 3OU2A 2AN4A 2ZBRA 3L8DA 4PYKA 4EK9A 2NYUA 5FHRA 1JQEA 5DM0A 1XDSA 3EVGA 2PY6A 4E2ZA 1NE2A 5CVDA 2IDJA 4RVGA 10MHA 3OFJA 3H2BA 5T67A 4E31A 2OXTA 3K0BA 2BM8A 3KQSA 4OBXA 4IWNA 4PYMA 3CCFA 1KYZA 4M7RA 5LQCA 4C08A 3B7PA 3MQ2A 5KVAA 3PVCA 2JHPA 3GWZA 4PYJA 3NDJA 1YF3A 2F8LA 5DXJA 1EG2A 2AVNA 5E1BA 2ORED 2K4MA 1EJ0A 1R18A 1JG3A 1P1BA 1O9GA 1VL5A 4QPNA 3AJDA 3SVZA 1O9HA 3P71T 1M6EX 2V7EA 4LWOA 4PCAA 5CCBA 4RTKA 2IH5A 2R3SA 3TKAA 3G89A 3LKDA 3ELYA 5HOQA 5EKUA 3EGEA 3EPPA 4PGHA 3CGGA 5EZQA 2Z6AA 5CD1A 3DLCA 4P7KA 1WS6A 3BUSA 1HMYA 2ERCA 2ZZKA 2ZLBA 4RTQA 4CTKA 3KQQA 2P41A 1DUSA 3LSTA 3GO4A 4RVDA 2JHCA 1YB2A 5HILA 4V0QA 5CCXA 1RJGA 2EFJA 3HVKA 4DM3A 4X61A 3LL7A 3HCEA 5CIYA 4RVHA 2VDWA 2PX2A 3BKXA 1XCJA 4E2XA 4AZVA 2IH4A 3GRVA 3PLAE 3E23A 1QZZA 1ORHA 3ID6C 3KQTA 4R8RA 1L1EA 3HVIA 4F84A 3VYWA 2AN5A 5FA8A 1WZNA 1YFLA 2ZWVA 3F4KA 5BW4A 5IKMA 3P9KA 5DTRA 4RVFA 5K09A 2VS1A 1BC5A 4KRGA 2PXCA 3T7TA 5EVJA 3UA3A 3DLIA 4EKIA 5JUWA 3EEOA 3MTIA 4Z2YA 3FTCA 3GCZA 1SQFA 3KPWA 3HVJA 3GXOA 3NW9A 2EJUA 2UYCA 1PJZA 3REOA 3I64A 5EEGA 2GH1A 3G8AA 1I4WA 1JG2A 3FZGA 4F86A 1D2GA 3UJ7A 3HA7A 3KKZA 5C0OE 3KQYA 1BHJA 4MHTA 2FPOA 5FULA 2ZBPA 3DR5A 1JG4A 2EX4A 4ER7A 3FRIA 2G8NA 5LQRA 3PX2A 4FSDA 5DX1A 2PT9A 5HIMA 3BXOA 4RWZA 3CBGA 1VLMA 3PS9A 3A27A 5T64A 1JTFA 4AZWA 2IIPA 3G7UA 3LGAA 5EOVA 3NTVA 5HIJA 3UBTA 2OO3A 1WXWA 2ZIGA 3MCZA 3NVKI 5K03A 3OPNA 2E5WA 1P39A 3ER8A 2FHPA 3C3PA 3PX3A 2ZW9A 5DTMA 2AR0A 3CC8A 3KPJA 3MERA 3OZSA 4YUWA 4RTOA 1U2ZA 1KHHA 2HMYB 3LDFA 3DULA 4FZVA 5ICGA 4HTFA 4PYQA 5K0LA 1QANA 3KQMA 3UFBA 2PWYA 4L7VA 3CJRA 4U7TB 3ERCA 1RJDA 3G8BA 2EG5A 3GIWA 4IKPA 2O57A 2PX5A 4O29A 4RV9A 2P8JA 1XVAA 4MWZA 4PIMA 5E8RA 4HGZA 1DCTA 3WSTA 1KXZA 2ZBQA 1D2HA 4YMGA 2AOUB 2OZVA 4QDKA 1XDUA 4RYLA 3G88A 3HM2A 5EGSA 4GC5A 5C9ZA 1R8YA 5LSAA 3C3YA 3GRRA 1NW3A 5GINE 5CVJA 4B17A 4FT2A 1G38A 5DWQA 1H1DA 3JWIA 3BGIA 2YTZA 3TM5A 4PINA 5ICCA 1X19A 3NMUF 9MHTA 5D1NA 2AZTA 2PSSA 1QYRA 4OA5A 5E1OA 3SSOA 5GIPE 3I53A 4K6MA 4RSRA 3PTAA 3VC1A 5CVUA 1FPQA 1NBIA 1MJFA 1XDZA 2GAFA 2OKCA 1NBHA 3P97A 3FUTA 3VC2A 1KPHA 1V39A 3CKKA 4FSXA 2PV0A 2GA9A 1FP2A 4GQBA 3P9NA 4C06A 3HCDA 5K0JA 2VDUE 1TW2A 1UWVA 2HNKA 3OU6A 1TW3A 3BKWA 4MQ4A 4DQ0A 3CVOA 2P1DA 4A6DA 4E32A 3ER9A 5EHGA 4QTTB 5FQOA 5DSTA 4RTMA 2UZ4A 3EVEA 3TMAA 1NW5A 4RTRA 4WVLA 4CWAA 3PFGA 2PJDA 3M6XA 4HTFB 1EJ6A 3LCCA 1ZQ9A 3EEYA 1X1BA 4R6XA 5LQJA 5GIOE 3DUWA 5E2AA 2IPXA 3EGIA 2ZCJA 5F2NA 2C7PA 5LQNA 1XCLA 4OA8A 1SUIA 1I9GA 3LDGA 1RI2A 4KDRA 2AS0A 2JH8A 5HIIA 3JWJA 2DULA 4ER6A 2N47A 5DX8A 3RW9A 2C7OA 2FCAA 4CXMA 2XVMA 3FPJA 3OFKA 3HTXA 4FP9A 2FK7A 4BLWA 3BT7A 1F38A 2NXNA 5H02A 2JHAA 4MIKA 4YV0A 3MGGA 3UZUA 5CVVA 3KQVA 3R3HA 3S68A 3U81A 3AWIA 5ICEA 3SMQA 1N7JA 4YUVA 2CKDA 3KPUA 2G72A 3D2LA 2ZZNA 3OCJA 3I5UA 2AVDA 4AUKA 1KR5A 2NP7A 4HSGA 2BH2A 3R9XB 3GRUA 3E8SA 3NWBA 3TLJA 4GUAA 2CMHA 1ZHFA 2ONZA 5FHQA 2G71A 3IV6A 1SUSA 1RI3A 5ICFA 1UIRA 3IHTA 3KPYA 3GJYA 2IBTA 3M33A 4HG2A 4DZRA 1IM8A 2I6GA 1VBFA 5LR6A 5EMJA 4Y2HA 1NW6A 2YXEA 3SR4A 2HR1A 3A26A 3ORHA 1O54A 3DXXA 2AOTA 3GDHA 4PCLA 2ZTHA 5M5BA 5F2KA 1IXKA 3K6RA 1N7IA 4H0NA 1JG1A 4IV8A 5B1SA 1P1CA 2JJQA 5EMKA 2ZIEA 3GRZA 5U4XA 2UYHA 2XYRA 3LKZA 3A7EA 3EGVA 3OU7A 3UJ8A 1G60A 2GS9A 1AF7A 1SVUA 5CUQA 2FYTA 3T0IA 3TRKA 3UJ9A 1KPIA 4IV0A 3V8VA 2QYOA 3JWGA 3M4XA 5KS2A 3LDUA 4RTJA 3FYDA 3KPVA 2P40A 3UJCA 1VQ1A 4HH4A 1BOOA 2PT6A 3BWMA 5DTQA 2YVLA 5GM1A 1X1CA 5EIWA 2NXEA 2PVCA 2PBFA 3GRYA 1Q0SA 2ONYA 3LHDA 3NVMB 3R6TA 4LG1A 5T6BA 4C07A 2OYRA 2UYQA 3MAGA 2AOWA 4P7GA 4Y30A 3A7DA 4HRAA 5BW5A 4PGGA 4FR0A 4E2YA 3DXYA 4BLUA 3SSMA 4G56A 3DMGA 3B3FA 3R24A 2LD4A 3OZTA 3EVAA 2B3TA 1QAMA 3QV2A 4KW7A 4QTUB 1VIDA 4X1OA 1R74A 5K8VA 1R00A 3OE4A 2YXDA 3ELUA 1SKMA 3KU1A 3HCAA 4PWYA 3GNLA 3LCVB 4WXHA 1L9KA 1L3IA 5EMLA 1M0EA 4ATNA 2I9KA 3TOSA 2P35A 1L3CA 4EKGA 5LQUA 3KR0A 3LPMA 1T43A 5E1MA 4OQEA 5DRYA 1EAMA 2AOUA 5K0NA 4U7PB 2QY6A 2ZULA 3BWBA 2B2CA 3FYCA 4M37A 3OZRA 2PX8A 4GBED 1PRYA 4KDCA 5E9WA 2FRXA 4AZSA 2AOTB 1L3BA 5FWDA 5EZSA 3HVHA 4PYLA 1G8SA 2Z6UA 5DSXA 1BKYA 1NW7A 1KIAA 5HZMA 3TM4A 3P2EA 2VZ9A 2QRVB 4BY9E 3M6UA 1VPTA 2PWPA 2BZGA 4M36A 2PGXA 4YMHA 1Y8CA 5CM2Z 3G5LA 1ZKDA 2JH9A 4GEKA 5LQAA 3EMDA 1TPYA 3CJQA 3EVBA 3KHKA 5DM1A 4X63A 3FTDA 2I62A 4BLVA 4C4AA 1UFKA 2JG3A 4E33A 1N2XA 3FPGA 3MTEA 1EQAA 4DF3A 1IY9A 3HCBA 1WY7A 4KVZA 4C05A 3AXTA 3AXSA 5EKXA 5KQRA 3M6WA 3AY0A 5FA5A 3HNRA 3A4TA 3SGLA 2HTEA 3C0KA 4CKEA 3DP7A 5EQJB 3C6MA 1YFJA 3TR6A 2BR5A 4E70A 4P7JA 2R6ZA 4GOMD 5MHTA 5K05A 2B9EA 5DM2A 2V74B 3LBYA 3PB3A 3V97A 3QOWA 5K01A 4M38A 1QAQA 4R8SA 3FUVA 2XYVA 2OPBA 2HV9A 4DCMA 3UJAA 4XUCA 2QM3A 3KQPA 5BP7A 4XUDA 1JTEA 3C6KA 4HC4A 4PYOA 3THRA 3IYLW 2AOXA 2H11A 4LECA 3O7WA 1YZ3A 4QVKA 5DXAA 2PLWA 2C7QA 3DMHA 3O31A 2ZIFA 2ZZMA 3M70A 3KR2A 1WXXA 1EIZA 2VP3A 3SSNA 1Z3CA 4XCXA 3R0QA
chains in the Genus database with same CATH superfamily
4TTPA 5C8VA 3P1JA 4G09A 4AZ0B 3NYRA 4INOA 2NVBA 3FUXA 3T7RA 2NXCA 1NTOA 1Y3FE 1P91A 3QU2A 2QU8A 4IS2A 4PLFA 2BFFB 4K81B 1WV1A 1P2DA 4MJ7A 1DOHA 2O59A 4MAMA 2QD4A 4WNYA 5CPBA 4D8YA 2DPXA 2F64A 3QFSA 5FBLB 4DGSA 1RI4A 3WL7A 4ZQHA 1TA4A 3B5IA 5E9AA 3Q9SA 2FGJA 3AZOA 2DERA 2BKVA 2P4UA 4IFIA 4YPVA 3IXLA 5DMHA 1QPGA 1YHNA 4KIWA 3R5HA 2IV7A 3U4DA 5BMVB 1ONNA 4DA7A 4Z9BA 3EPKA 1X3SA 1JHZA 3JQFC 4JBNA 3GI1A 4BGUA 2DMRA 1NASA 3IQHX 3RSHA 1UC4B 3WYBA 2OOSA 1RYZA 1U9CA 2J33A 5SICE 2EW2A 4XCQA 1HH4A 1U8CB 1IHUA 2HNBA 2OC9A 2QYHA 3CVJA 1IDOA 4XSGA 2EYUA 4AULA 5C18A 1O95C 3R5KA 1EXDA 4O33A 1DKPA 4Q1FA 3ER6A 4OM8A 3RARA 4LJRA 4KCGA 4C03A 3TH5A 3ICPA 4F7WA 1C3JA 4FHCA 3O9VA 3DE5X 1JF8A 1OBFO 1WDTA 3JVIA 2QPLA 1OILA 5A5EA 4JWTA 4KRYA 4P3NA 4B2YA 1U2EA 4JBXA 2VDLB 1Z4NA 2ATVA 3QKTA 2FW9A 1RKUA 3HB9A 4UQLA 3ECSA 3NOVA 2H5LA 5CHEA 1SUDA 3NRCA 2FUNB 3RTCA 2AFHA 3LX6A 3ZV5A 2WWWA 1R5BA 4DCJA 2XMDA 5CFQA 1JKFA 1JWBB 3MJSA 5G4KA 3IUNA 3EXEB 1EWKA 2AOVA 2RGAA 9LDBA 3AEUB 4JLAA 3D9QX 1E7MA 3VU0A 3AUYA 5JE8A 4AICA 4BP1A 2ZUFA 1M73E 4EUFA 2OCDA 3RFFA 2CCJA 4EF5A 1Z06A 2Q46A 2WHPA 3AWDA 3K73O 3R4CA 4FMDF 2OSBA 1ULBA 3UV3A 3V7NA 1Z0FA 1G291 3M8KA 2H7XA 2PMWB 3PC8C 1OXTA 4Q4HA 3G13A 1EZ4A 5ALRA 3V4LA 4IDAA 3R6WA 3TR5A 1RLMA 2JLVA 2XMSA 5IH3A 2V6IA 1Y6RA 4Y1RB 5ALZA 3NEYA 2HWXA 3FNRA 2VBIA 4MUHA 2C29D 3F5DA 5C53B 1K6JA 3D4OA 3LLUA 3KQNA 5JSZB 1FP1D 4EGQA 1JDSA 3G0GA 3QXHA 4ZU6X 2IEDA 4WZZA 5JD5A 1TVCA 4QGAA 1NNEA 3LT1A 3CN7A 4P9NA 3NTRA 1RU3A 1MOSA 5EC8A 2ODQA 2M6RA 1OUMA 2W2KA 5IT4A 4DKXA 5LPNA 1SCNE 4EGCB 3IPCA 3RJZA 4GIBA 2WZBA 3STVA 3U61B 3CLUC 1P7WA 3B6ZA 5ARDA 1RYHA 3LQ2A 4C5AA 1RC1A 2H9YA 4CLHA 1JR4A 2D3TA 2H0AA 4DYHA 2BDEA 7MDHA 1QLJA 1DNPA 2GRUA 1UC5B 2HA0A 3G0CA 5L3VA 1RQLA 1XLTC 4JJ4A 5E95A 5JOQA 1UKCA 1Z8HA 4DXAA 2R6AA 2WSMA 1M76A 6ABPA 3PIRA 4P93A 5IAKA 2X58A 3E84A 3N8GA 5JAQA 2DXIA 1PX0A 4GAEA 4DLBA 1M1ZA 2XQKA 1JVBA 2GZDA 2I2XB 3GMDA 4PQYA 3KEOA 4ZTZB 2YJ5A 3DDOA 3GLKA 4PYIA 1SBNE 2JLQA 4ER5A 3PEWA 2JJMA 3ETGA 4QU8A 2Q41A 4UTXA 4DWJA 3FCOA 3C3AA 3RREA 1GHTA 3TQSA 3ZLJA 1IUPA 2W2MA 1A4RA 4LQLA 3UAWA 3S1LA 3SD7A 3VTKA 3RBVA 1DRVA 3AR9A 3O8OB 2VDRB 1EK2A 3OT5A 4L0DA 4L9SA 4BO4A 2C7GA 1QRAA 5I3CA 4PGFA 2XHEA 3GDFA 1FTGA 1YU6A 2FUKA 3ONDA 4ONEA 3BMCA 1IHYA 2VA9A 3RUDA 1QCDA 3UB3A 6REQB 4AZWA 1DBVO 1FU4A 2TMDA 5LJIA 1T9GS 4X8HA 1RZVA 4NFLA 4PZCA 1AU9A 4B7UA 2VP4A 4JNKA 2XH8A 1JSRA 4E2ZA 2VHZA 4K9DA 4NEGA 3RD5A 3RGWS 2HO4A 2HRBA 3HO1A 3NKFA 2XJ9A 1M34B 2TECE 1ZSNA 3SFTA 1G2OA 1OTXA 2EKQA 2ZBEA 4OBXA 4UTRA 1TZMA 2QUAA 2VOEA 2VPYA 1OQAA 4M0DA 2O50A 4NQZA 4JJZA 3TSCA 2ZAMA 1N5OX 4R2KA 1LI4A 1KDTA 2OGSA 4KQHA 4R7GA 2PUBA 4NENA 1AO3A 3QVTA 2WT9A 1ZOOA 2BUAA 2ORED 3AEKB 3BSYA 4MIOA 3UHJA 3ROEA 3AF0A 1CK4A 5JC1A 5G0SA 3T0GA 4ZDWA 1LQ2A 2EW8A 5DYTA 2H17A 1JPUA 3RS3A 1KEZA 4JXKA 3AFHA 2C2OA 2QLJA 3G89A 4RK0A 4RELA 3UFXB 1IYZA 3F7MA 3HB7A 5EKUA 3O8CA 1AGYA 1KP3A 3L79A 3EGEA 3BD6A 1ZGBA 4PZ9A 2WIKA 3CG4A 4JOBA 4LN1A 2HMTA 1GV0A 1ODJA 4OJNA 2ZTSA 3RRJA 1HETA 3BICA 4ENPA 2R68A 4LHWA 4WJKB 4D3FA 1PQPA 3B70A 1RS0A 3T1VA 3QF4A 2ZYIA 2DKNA 1LKZA 2EWVA 3IHLA 4LFBB 3OJFA 2ZRNA 2PQ2A 1MB9A 3RVNA 2VDOB 1L7RA 4V0QA 3OHPA 4BV9A 3SE7A 1ELOA 2ODWA 5JJKA 2IPLA 1S3SA 2Y9MB 2ZYTX 3BKXA 4PO9A 5TMEA 4X71A 2VTBA 2R00A 3PC4A 1WPXA 2BMFA 2OM2A 4QL3A 1THGA 4LVUA 4WKGA 3PGMA 2CXSA 3B2NA 1B7GO 4Y0VA 3ELBA 4MI1A 1VBKA 1ZNXA 3KAPA 1A0OA 1NI4B 1Y4UA 2BZSA 3IEPA 4UEJA 3T99A 1ADBA 2Y0PA 2VBCA 1BX3A 3FMVA 3I01A 1XZCA 4YAEA 1SK9A 4F4UA 4RKFA 2YWDA 2H1SA 1RHJA 3T9EA 2PL5A 4RBNA 3ZYZA 1GNVA 5KYWB 1MABA 4PSDA 4EKIA 2NADA 2HNAA 4OJQA 3T6KA 2IYSA 4DR1B 3S8EA 1QTQA 2VI5A 1JILA 3WIOA 4RK6A 3GXOA 2D3WA 2C9BA 4E6EA 4HN9A 5EVCA 4RHCA 2ZYWX 1VLQA 2H3HA 2ZJBA 1YDGA 3D6TB 3E9YA 2BGUA 4IDEA 5K8CA 1XT6A 1Q7CA 1E79A 1WD5A 2HRDA 3KQYA 4TT8A 4O4IA 3OX1A 3OEEA 3NC0C 4Q9AA 5TJ9A 4HX2A 3Q9UA 1RAIA 3PYMA 3DB1A 3WRWA 4LAFA 1WZEA 4HB3A 4OB7A 1XDBA 1O8BA 1BE0A 5DBEX 4Z0PA 4G3XA 1G4HA 1PW5A 4XE5A 1AMNA 5EINA 1KQOA 5K03A 1DI0A 2DR0A 4UQOA 5B4VA 4GPZA 3RUPA 4I55A 3DOHA 1VGQA 3HCPA 3TDKA 1V16B 1Y81A 3L6RA 3OZBA 4ZT2A 4NATA 2D13A 3JQGB 2WFAA 4Z2AA 2PWYA 1U0HC 5ALJA 5B64A 3T9BA 1DMRA 4LI0A 4RV9A 2O57A 3MUFA 4R1SA 1PL7A 4RKEA 1BEEA 4XPZA 3WX0A 4MWZA 5JYEA 1OX4A 4LJ9A 4Z99A 3JSAA 3U9TA 3ZQ4A 4QDKA 1KEPA 3Q7RA 3QZUA 4YDRA 3FLMA 2VWGA 3V4SA 4KN6A 2H0RA 2HLPA 5J5CA 1DLIA 1TVKA 1JEDA 2JFZA 1SHTX 1ZA2A 2JIMA 2GSWA 3DO5A 3IQFA 1IBRA 1KC1A 1U8TA 4QSMA 1XGKA 2GXUA 5B7QA 4RE5A 1OV4A 5D5QA 3X1XA 2P3SA 3FPKA 4L5IA 4BRUA 4D0SA 4C3VA 4EUKA 3G9XA 2SKCA 4HNQA 5B55A 5BSEA 1G5TA 1WVGA 1V39A 4FOSA 4ZV9A 2OZPA 1PSWA 1TADA 3LUHA 1Q95A 3V4PB 4J1TC 3L7OA 4U2KA 3N2LA 1X1SA 1T0BA 4JCCA 1A9XA 4J1SA 3GJQA 2YN0A 3U7EB 3HMKA 3JAKA 4RETA 1M2KA 1OLOA 1L5QA 5EERA 5F33A 4R1UA 1EFVB 1T34A 3O7MA 3PJRA 1DKNA 1E2EA 1YBAA 1JAZA 1DIGA 4Y2SA 5K2OA 2X2OA 3HB1A 1XD2B 3C45A 1J8VA 5IK2A 4YCAA 3JQPA 1XU9A 4UREA 1V25A 1HTWA 1MJHA 1RM4A 4HMOA 3M3DA 1KOGA 4ER6A 1BXGA 4B4WA 2HGSA 2XUPA 3ABOB 1VLHA 4GI5A 4Y1EA 3VO9A 4W5NA 2ZT8A 3IP6A 4H4CA 4IQFA 1FTWA 4EEKA 3IAEA 4IJUA 4OIFA 4PE5B 4XVQA 4AT1A 1XDGA 2R8OA 3MWLA 3T1QA 1R12A 5REQA 3LGSA 3VHRA 2H4XA 3RVLA 4HDNA 2GBLC 2HB6A 3TVTA 2W2PA 1V1RA 3ZHZA 4UPVA 3U81A 5JALA 4O3MA 1CCWA 1JMYA 1VHWA 3B51X 3JS5A 3IC5A 3KWMA 2H31A 3H1FA 4DCSA 2H0QA 4HX9A 1M1YE 2CUKA 1QDLB 3I3OA 4RPGA 4W5WA 2QSYA 2I03A 3UHAA 4AUMA 2VDKB 3GMTA 2R62A 3OM9A 4PX9A 3WIBA 3BD8A 3UAOA 4CUZA 4F4FA 4W6QA 3SQMA 1UZAA 1MB0A 3IHTA 5LP6C 2RGWA 2BGRA 2ZVPX 5I9SA 2GCEA 1JHUA 3I45A 4PO8A 3L05A 5KHAA 3ZWAA 1OBOA 2JPDA 1MBZA 13PKA 1QYCA 3DZ8A 3LJKA 5FBHA 3UMBA 3JD1A 2AC2A 1OAAA 5A7HA 2H07A 4CG3A 2HK7A 2WIAA 5CJPA 1XPOA 2P1ZA 4KO1S 3OBBA 3WLPA 5DYWA 4OY3A 4UNRA 1TNDA 3IERA 4OU4A 4ZP1A 1IUNA 2IZZA 4JQOA 3KUXA 3NWJA 4NYMR 3SBDA 1B0UA 4DPKA 4F3TA 3T0IA 1DAHA 4E33A 1LBSA 1V6AA 2QRUA 4BFTA 1UMDA 5ELXA 2Z58A 1H05A 2OMKA 3K1YA 1QGDA 1IEWA 4MGHA 4RMGA 3BULA 1DELA 1XA4A 5T6MA 2OUKA 1EHYA 5HKBA 1NMXA 1O0SA 5CPFA 5LJLA 2OBYA 1GA6A 4XSHA 2FP4A 1TX4B 4ZT7A 3A7DA 4HRAA 5AVSA 2O8CA 4HUQA 2J9RA 2ZB3A 3TQRA 4G56A 3B3FA 3SC6A 1LLUA 4IVPA 2NT3A 1NSYA 3EW9A 4FFMA 4YJ2A 5LM3A 2Q49A 4U9HS 4UBNA 1OZFA 2RHHA 3EWSA 2WWRA 2PTHA 4PFQA 2AKEA 3SQXA 5DE3A 4R68A 4KR6A 3RTEA 4IXDA 1R00A 1YOBA 4FINA 2GBGA 4KH0A 4NQRA 3ELUA 4TVOA 3KU1A 4IDBA 3S5UA 2FR1A 4PAGA 3BL5A 4G65A 3QE0A 1L3IA 3R77A 1GGKA 4YPFA 4BAZA 2P6PA 1DQSA 2BEVB 2EKLA 1G4UR 1YZKA 3LUGA 5E4YA 4UM8B 2WD7B 4J2HA 5LDHA 4MR9B 3AR7A 4OQEA 4EW1A 1HV8A 3N58A 1MAUA 4JU8A 1ZRNA 4N48A 3KQUA 4CM3A 4Q3KA 3GCWA 3H9GA 4UHFA 3R3ZA 4EWLA 4GBED 1KZYC 5KDDA 2ZRPA 3IO3A 5FO0A 3PC6A 4G0VA 4JLWA 3SDBA 3D4LA 1GA1A 2CJWA 2WT4A 4KZPA 4MQBA 4PS1A 1CUWA 4GOXA 4J0GA 5LN1A 3EZFA 3DV0A 1A4XA 1AGNA 2QR2A 3G9TA 1PUJA 3HRHA 1YWGO 4R9RA 4X7RA 5E6RB 5K99A 2ZUTA 4G5GA 4NNPA 4G4SP 5L9AA 4MDYA 3TI9A 3ILHA 2PVSA 5F64A 4ZIRB 2OO5C 2JAQA 3HS3A 3O3MB 4HL6A 4XVCA 1N2ZA 2AHRA 2P9TA 4NXMB 3GBVA 2B34A 5L8VA 1Y89A 2ZWPA 1CFZA 2EWMA 2XA1A 3RKSA 3SYTA 2GFQA 4ID9A 1HURA 1YQ9A 4KVZA 4EJSB 5EJ8A 4BLOA 3M1LA 4JQYA 1Q7BA 3HNRA 1L7AA 2ZCVA 4F3RA 5DGHA 4N6GA 1J2UA 3DP7A 3Q0IA 2YIDA 4LRYA 4P3YA 4DCCA 2V3WA 1YB4A 1XHLA 1R37A 1T0IA 4CF4A 3D3WB 4LGVA 1JECA 4ARZB 3F7TA 2QTRA 1F1BA 4K26A 1P2TA 1ND6A 3D1LA 2AUNA 1HR0B 3M89A 3RB8A 1QFMA 3DBRB 4M1QA 4XARA 4P0PB 2R5WA 3A1TA 1FVFA 2WSBA 4EPVA 5IJZA 1XPRA 1ETUA 5PNTA 4DQUA 2M9MA 4CQMB 4MV9A 3L6DA 3VPGA 4NBRA 3KALA 3U16A 1ENPA 4NOJA 2HEGA 4WN3A 2PD3A 4XLTA 1SK8A 3IMFA 4BNYA 1NJ1A 4DJJA 5TC4A 5BWLA 4EFDA 3DMHA 3NNNA 4G2TA 1UJ2A 3TBFA 4BCCA 3GBPA 1M2HA 1ZH8A 2IW1A 1Z3CA 1GGHA 1UBMS 1GVHA 3A1SA 2O3SA 3A9WA 3FJYA 1Z4KA 1N2SA 3L7NA 1OE0A 1LRLA 1Q21A 3S1SA 2Q4DA 1LBHA 2JIBA 3HUTA 4MRVA 4BYGA 3HHPA 4KPUA 1J7JA 3WLIA 4L2IA 2C20A 3DVRX 5C7LO 3E7DA 5TMDA 1L7BA 1SCIA 2OB2A 2VT3A 2XRYA 3OIUA 3VOSA 2DFKB 1CEYA 4QARA 4EG5A 2F3QA 1JU3A 3S2YA 3T1YB 2ILTA 3CTMA 1K27A 4JA2A 1CD5A 1XTPA 1Z7EA 3EVCA 1T3HA 1KSHA 3LTEA 1NX6A 2R60A 3AIOA 3IOYA 1IFXA 4FCTA 4MW6A 1ZGJA 3MRVA 1XJ5A 2WYWA 1A7AA 3EFOA 3ZD9A 3H5NA 3RODA 3SC2B 3WV5A 3ZK7A 4A6XA 3WLAA 2QX7A 2OCPA 2A0FA 4JUFA 4CGZA 4V3CA 3FTEA 4CM8A 3RS8A 1PLLA 2GD0A 2JKZA 2Y0BA 3WLLA 1OWOA 2IV2X 5KOHA 4EG6A 5H3HA 3SICE 1AKRA 1DL5A 5HS6A 5I51A 3NHYA 4K6CA 3TOCA 1QZUA 3AF5A 4UD2A 4EPYA 3ZHSA 1Z08A 1LDEA 5KHOC 3OF3A 2HPZA 4JLNA 1SCUB 3AESA 5TGTA 4EX7A 5C37A 4IO0A 4FOPA 2MSWA 1IATA 2W6MA 2I29A 4RDIA 4KXXA 3VI4B 2QI9C 4LTDA 1QVWA 4HF7A 4TVKA 3ZBQA 4DIKA 1EWTA 4EB0A 3T5DA 1A97A 4OYYA 1SVOA 5KIAA 4Q37A 3NCTA 5CCDA 4F2WA 2ODPA 3GHYA 1OIXA 3GMSA 3H8VA 1V6CA 1W4RA 2WA1A 1IMJA 1R6AA 3ELDA 4G5FA 4GMKA 1NY5A 4HAWA 2X3YA 3T7SA 3HNPA 4UOQA 4EFMA 1G3UA 3IEMA 1IWBB 3D3EA 3GZJA 4Z3DA 1ARZA 3KOUA 5CX1A 4BMPB 1VGVA 3IE1A 2IH2A 3HFJA 3PHHA 4X1YA 3WRYC 4IV5A 3ZXSA 1B41A 4CEJA 4P98A 2Q7DA 4BO9A 2QX6A 1FK8A 1NUSA 4JIGA 2IUTA 1UBGA 4BGDA 4NTZA 1RWMA 3H5LA 3DUFA 3IRVA 4ISCA 1MA3A 1SGWA 3C98A 5DOVA 1IBLB 1SUFA 4KR9A 2BYTA 5JC8A 3L0IB 2QE6A 4Q4JA 5B58C 2W2LA 1ZONA 1EE1A 4ZAFA 1MJGM 2RH4A 2RIRA 1Q84A 2ORYA 3FIUA 2UZIR 2ZSUA 3O8LA 4G8CA 4PWZA 2Z3ZA 3MNFA 4ZVRA 1LRKA 4BE7B 1DZ3A 4REQA 1EVLA 2QN2A 3Q3IA 4OHKA 5DK4A 1CUFA 4AZTA 2OAP1 4ZKEA 1IWOA 2L19A 4MW9A 4N82A 4FTWA 3HA3A 5LU8A 3IILA 2JBWA 3DMRA 3PT9A 3OEYA 3D3NA 4DIDA 2O6LA 3OF5A 2ZXFA 2D06A 3RC8A 2BJHA 3T5PA 2ZR8A 2H18A 2YHUA 2IEZA 4RSMA 1IM2A 3CZ9A 2FW8A 2RHWA 3IS3A 4BBZA 1M2VB 1P1KA 2VH2A 3BMOA 2P6NA 4HWPA 4NL4H 5F3WB 2IU4A 3HN7A 2HRQA 2W93A 4YP1A 1IXSB 4CKCA 4JITA 3KKMA 3KZVA 3PA6A 3T1HB 3LK6A 2M1ZA 3DE3X 2Z5GA 1GEGA 4Y18A 3NRJA 4XAQA 1Q0RA 3FDZA 1R5OA 1NULA 3EPLA 3ITNA 1A8HA 4DWVA 4TMYA 3FPFA 1QG4A 2CNNA 2IP2A 4POAA 2ISSD 3I2KA 1QRDA 4ZREA 2IPMA 4RHYA 1JUDA 2WY2D 2ZRBA 4ZO8A 4UVGA 5K3FB 3JWPA 3RIYA 3LWDA 5BNZA 4WNAA 4WACA 3SYNA 4PR3A 3NPMA 4IGEA 2HA5A 1NDUA 3O9MA 2OVFA 1Q6ZA 1CUEA 2FPRA 4PICA 3WLMA 3FCUB 4GF5A 4MKXA 4R8LA 4XB2A 2ACWA 5LXTA 2XTAA 4Q1DA 4B80A 2JBHA 1Z4IA 3OQNA 3LP5A 2NSDA 4TKMA 2ZRCA 4E5MA 1ESDA 2C8LA 1AK1A 3L5OA 4BC1A 1N0IA 1YV9A 1T1RA 2OTCA 1XN1A 4LGYA 4PPGA 3UWKA 4C7OA 1G8KA 2WWIA 1XDSA 2ZBFA 1NE2A 1TKRA 3PLNA 2KBEA 4JFAA 2C5FA 2G1AA 3UYLA 3W4KA 1DCMA 2AIRA 1GNQA 2BM8A 3OEHD 3P4UA 3KQSA 5ALXA 3RUEA 4LF5B 3ZQUA 3OT1B 4E4YA 3CIFA 1C1HA 2NV2B 3MUEA 2HRCA 4K6GA 5HFAA 1W52X 2ZAOA 3MLAA 1KGSA 3VR6H 1FJHA 5LLSA 1ZUWA 2B4AA 3JRXA 4HPXB 3B1YA 2XZPA 3HP4A 1W48A 3X1YA 1Z56C 2LPMA 1HFJA 3BQNB 1VL5A 4L28A 1KARA 4MPJA 5DGIA 1OCEA 2ZYGA 2WDZA 1VE9A 3IP5A 1CVLA 3TKAA 3FHTA 2ZUVA 3L8HA 1X7WB 3E7FA 1IDN1 2YJ6A 1W73A 4HAXA 5KTMA 4KYVA 3AQIA 1Q15A 2R8EA 5FI3A 1TD9A 1MPXA 2DSNA 1KEEA 2NVWA 3H42B 4IH9A 2OCIA 1YZFA 1G8JA 3C4JA 3DM5A 4FFNA 3NC4A 4RTQA 2P41A 4DMKA 1QIEA 1SVSA 4QOSA 4G5OA 2GZMA 3ANTA 1EQ2A 2VJQA 4IQ0A 5J5VA 5CCXA 3HVKA 1XA3A 4DM3A 3QU4A 3GP8A 3DAYA 4L4XA 4UBMA 3OAAA 5ENDA 5K3FA 2HT6A 1GPAA 4P38A 3RSOA 3F4LA 3DE4X 1XCJA 4JI7B 1MU0A 1VZ2A 2GX6A 4W5JA 4FFRA 3T5TA 3TG8A 1II9A 3WQHA 5EXPA 2CJFA 2UUBB 2AX4A 1Y6ZA 1OYVA 4MVJG 4KQJA 4OXRA 4C0HA 4RD3A 3KEMA 3BB3A 3PPWA 2GK4A 4F84A 3AF2A 2AXQA 3F5QA 2XCTB 2GCPA 3VJLA 1S2NA 3NHKA 1G21E 1Q1NA 1S5PA 1HWYA 2O2DA 2W7TA 1O87A 2XCUA 3FWZA 1A71A 1FQJA 2ASVA 1KZHA 3V5NA 1XDDA 5JT1A 4X8MA 2GDZA 4HPWA 1M34A 1PL8A 1VXOA 4RZQA 2G08A 2KMLA 3ZDDA 3LT4A 2CMDA 3TWOA 3UUGA 3UG7A 4IP0A 3UJHA 4O0MA 1N3YA 4OSEA 3PUIA 2JJYA 3INTA 2XJ4A 4JP5A 1UJCA 2ZIWB 3VVBA 3KSBC 4PM4A 1Z17A 1CZHA 5KTSA 1L7NA 1PJCA 4JBHA 2NG1A 4KBYA 3GFSA 1Z15A 4KQIA 2ZIVB 2LP4Y 2BKUA 2RHDA 2JIZD 4J6FA 4WDQA 4XD2A 5HIMA 3VGJA 2G6TA 5LZ4A 1QIJA 5T64A 2BFDB 1Y1RA 3QXJA 2OHOA 4TKVA 1W7AA 4PW0A 3HGMA 1UPCA 3CURA 1UAYA 1SU6A 5HIJA 5D6NA 3V8NA 4N03A 3MILA 2YIJA 3OPNA 2CHVA 3AOGA 3KDPA 3QNUA 4D1YA 2FHPA 3V55A 4QAJA 2OXCA 2R4TA 2P1RA 2YWXA 4OQNA 3OZSA 3ZDZB 4TTSA 4YUWA 5LZ2A 3U3KA 4E5KA 1E9RA 4US2R 3PXGA 1PT7A 3MLBA 1DAPA 3QUAA 1ZY2A 2VTBB 3LC1O 3J81A 4NHEA 4F2PA 1CLUA 1H8EA 3E0XA 4B87A 1U04A 2GEKA 4ROSA 4BNJA 2YV3A 3IEKA 3LCRA 4GLBA 3OBIA 1ZVMA 4P92A 4YEDA 3A4LA 1P19A 3LMKA 1QWSA 1V3VA 2PX0A 1UBSB 2XKBA 4KXLA 4D42A 3PICA 5LP6B 3KELA 2CLHB 3FD8A 1EU1A 3OSZA 3IP1A 4IFBA 1I6MA 4M89A 3UMFA 1JDUA 3GLFA 3TM5A 4ZHSA 4RZ3A 1OWMA 4RXTA 4MQEA 1XZDA 1Z4OA 2HEIA 3NASA 1QRSA 3UHOA 4IRMA 4OA5A 2FDCA 4HAZA 2LDBA 1CRLA 2YHIA 3I53A 3R3SA 4JH0A 4PTYA 5IH7A 3L7JA 2G9NA 3QFRA 2Q62A 2H92A 1AQNA 5CBKA 1KKUA 4GI3A 3D64A 3DAHA 1MG5A 2J85A 2OAGA 2VDUE 1WPQA 3TXAA 4IJ6A 3A1VA 1BVYF 1UMBB 3TLCA 5KTTA 1A9YA 4DMRA 1QH0A 4XDHA 1BAPA 1KMMA 1YB6A 4MQ4A 3W8EA 1UEXC 2A94A 3LW8A 4OAOA 5HX7A 1OGYA 2XT0A 2J7PD 1AB5A 4O2RA 4N54A 1ZQ9A 4MYTA 4LDQA 2IPXA 4ZO7A 3KQLA 1AC5A 1XROA 2A0WA 3EFBA 5A0TA 4ZI2A 3CZQA 3FCSB 2FMIA 1TEZA 4N7MA 1KVRA 2JLSA 3S7TA 2FX3A 1YQEA 2R1VA 4EL0A 2FX5A 3VGPA 4DUGD 1VKRA 1EXVA 3GAFA 1PU2A 1TE2A 3QXCA 4FCVA 3V7YA 4ZYWA 5JG7A 2XVMA 4QXQA 3H1AA 2HFKA 4ZCQA 3AHJA 5EKSA 1W4BA 1XXHA 2HFJA 3K94A 3WNQA 2IS2A 5AT1A 2H29A 3NHRA 1EVYA 1TRHA 4FWIB 1SKQA 1PSDA 1WZIA 1XRPA 3O82A 3E3MA 5K3BA 1M1NA 1VECA 3K9NA 3L7CA 5FFMA 3YASA 2ZETA 1R4MA 2OA0A 4X90A 2A5YB 1RZ3A 1HUQA 1QHSA 2KJQA 1G9XA 1M5UA 2I4NA 1NJSA 3EDRA 1RQRA 5JFTA 1GRRA 3EUEA 1JPVA 1XEWX 3JQFA 3R0JA 3D31A 3FCYA 2X23A 1NJ8A 2GBIA 1SVLA 4R1NA 3IBFA 1ZH6A 3SR4A 1BGXT 2O2ZA 2X0NA 3ORQA 2JGDA 2A7QA 3UK6A 2AOTA 5D85A 2FWRA 3DYIA 5F2KA 2X8JB 1LLCA 5JAIA 3A6ZA 4MICA 1R6TA 1V5FA 1Z0IA 3V4RA 5JWHA 4Q05A 1X7XA 2C0CA 5TXGA 4D8XA 3X1KA 5IDYA 1RHMA 2Q3JA 1NPTO 2I6QA 3IA7A 4M8LA 1LK5A 2Q2WA 1TPZA 4TXNA 3I9NA 1S6YA 1F5NA 3L6EA 4P4TA 4RQTA 4IV0A 3NX4A 2JKVA 4CHTA 3KAJA 5JASA 2QA5A 2XWBF 3UJCA 3ZWOA 3FNFA 4HH4A 2PV7A 4IDCA 4L0MA 4MVJP 4BVHA 5JAZA 4WCFA 4ETNA 1Q0SA 2IIVA 3D0OA 4WFKA 4XGIA 2HJGA 4V0SA 1M7BA 3IJEB 4F71A 3PVSA 5AOCA 5I9MA 1Y33E 4FFBA 3JYHA 1FLAA 4HGNA 3DMGA 4LDAA 3RE1A 2LD4A 1U0RA 2Q1WA 2RHCA 3AP1A 3ANYB 3C5WP 4ZVTA 5BORA 2GQ0A 3DPIA 1L8OA 2C4UA 3WGJA 4GDMA 3THYB 4F3CA 4CNQA 1SKMA 3TZ6A 1PFKA 1E5LA 1T5HX 1J22A 3C7TA 4LBYA 5B1HA 1FUUA 2I9KA 3U0BA 1EESA 1BS9A 1RKXA 4TXJA 3AEUA 1HSZA 4TQ9A 3PGA1 3SIPA 2WJYA 2WDPA 4A36A 2QY6A 4FHGA 5AJXA 3T3OA 3G3EA 5BR1A 1QH8A 1DQPA 4KHZA 5KOJA 1AMUA 3A11A 2Q3DA 3WL3A 3W9YA 4DIOA 3LUCA 3ZCSA 2PRKA 4JQCA 5E0KB 4WZAB 4GBJA 3AVUA 1G8FA 3K9FC 3IOBA 1GPKA 4TQAA 3VZBA 5LXTF 2P62A 1QRTA 3C7DB 3CF4A 1L8AA 2ZSIA 3INRA 5AH0A 1QGED 1YK1A 3V46A 5CXUA 4J1NA 3U3DA 1GZ4A 3INYA 5C46F 2GVZC 3K4HA 4LX8A 3CJQA 3EVBA 4QDZA 4MMXB 3PUHA 3LVFO 1A88A 4CT5A 5ALLA 5D01A 2PVPA 3DR3A 3KUKA 4MUAA 3D5EA 1N9ZA 3DAGA 3E9NA 3SX4A 2ZBUA 3FJ1A 3DLPX 2DQSA 1THMA 3E5MA 3BEDA 3SQLA 5FA5A 2WMYA 4TXMA 3TAUA 1R7RA 3NBYC 5FF9A 5AW0A 5JFGA 2YFQA 2O8CB 5T4BA 1JLMA 1FYWA 2W6ZA 1Z8NA 3H9EO 2Y76A 4E70A 3SR3A 3KHTA 4WLNA 4RIIA 5DM2A 4YJ2B 3AHHA 2V6JA 3TAXA 4P53A 1CR4A 2OHXA 1L6RA 4JKOA 1E9DA 1I4TD 2OZKA 2OT3B 1H0HA 2WZCA 3TRDA 1BHO1 2OR3A 4QPJC 3IUPA 4XUCA 1DTWB 1YR8A 3T5BA 2XECA 3DMTA 1ZD2P 4U0KA 3DFFA 4G4JA 4PYOA 1GPYA 1KJZA 1D7AA 1ZM7A 2FX2A 3H75A 2H11A 2Y93A 3N8NA 4HAUA 4NSNA 1JFRA 3ZGYA 5JCXA 1ICIA 1N2GA 3THWB 3KXDA 3NC1C 1W9MA 1Y1SA 3LIPA 1AKQA 1NI3A 1VG9B 3BXGA 3DC2A 1IB0A 1T36B 2NUBA 1TK2A 2HBRA 2PLAA 2W6ID 3EQ6A 2H9IA 5AJUA 3WYFA 5L53A 1SNYA 1ODCA 3N70A 3RYCA 3EH2A 3RNOA 2V5VA 1UODA 3R9IA 1NV8A 3MS7A 2V6GA 3LQ4A 2ZR7A 3QMPA 1SN7A 5CVCA 2GN8A 4ER3A 1EWVA 2G88A 3BH6A 2VZ8A 4K9MA 5AVKA 4Z4CA 4YT8A 3NT4A 2DEUA 4CEHA 1CUGA 3C85A 1F2UA 2G0NA 1WX1A 2FFAA 3I34X 4FW9A 4QYIB 4D3YA 5JCPA 5KWVA 5HQJA 3CKLA 2QVCA 4RKYA 1EP2B 3TGWA 2NO0A 3LECA 1LZLA 3ENKA 1IE3A 4DB4A 4WXYB 1HRKA 2PZGA 1USGA 4ZO4A 2WUWE 2FSHA 4MCIA 2WJGA 1ZN7A 4HYYA 4NCXA 2NU7B 2D5AA 4HNAB 4KQKA 4B6SA 4OYHA 1Z0DA 3B3JA 3EBOA 4P4LA 4ZOLB 5BUSA 1GTZA 3FTFA 5BN3A 4NCKA 4Y6SA 3VJKA 4XVUA 5C4IA 2MSDB 3BWCA 3KRTA 3SY8A 5BR8B 2EKBA 3K1AA 5JS7A 3N0XA 4NV0A 3V2GA 4HAOA 4MW4A 2EZ8A 4OQPA 4TV9B 2TRSB 5DNUA 2PJZA 1SZPA 1OWPA 1U7WA 2BJWA 2Z5LA 3DCJA 4LXXA 4YRFA 5C1IA 4YRNA 2O52A 1KY5A 2QD5A 3KTAA 2DH5A 1DIAA 1GPJA 1UADA 1P18A 2FR8C 3QF4B 3PX7A 5C4MA 3F1LA 2CSXA 1LJLA 4JC5A 4E6PA 4GHWA 4UU8A 2NU6B 5FFNA 3REQA 1ORIA 1VBNA 3OIWA 1P6QA 2BP7A 3GQBB 3B89A 3TUIC 2EKDA 5BWCA 5JAUA 5K0EA 4HBZA 5MFPA 1V26A 3D1JA 2CLSA 3H11A 3CMCO 3KSDO 1VL2A 2AMFA 1VDMA 1HFEL 2GWHA 4HDQB 3CX3A 4EJFA 1OLXA 4MS1B 2WMOB 2CZCA 4YP6A 1GIAA 3I58A 5FLKA 4EZIA 5KQPA 1OZHA 3U5ZB 3K05A 8LDHA 2V7TA 4KRFA 1P2SA 3KR9A 5FUYA 2E4XA 3CZPA 4GE0A 5AXAA 1O0CA 3V4OA 5AKXA 3FXAA 1F60A 2P9CA 1KGDA 2I6XA 4JVNA 2WF6A 1KA9H 1VE6A 3RV3A 3U3XA 2ZU0C 5J2UF 2GBLA 1LS6A 3G2MA 1EWYA 2AI1A 2B4RO 1XZMA 1A3CA 5DLEA 3ZQKA 1WMEA 3WNZA 2X76A 4U1RA 3T3NA 1H69A 2GEJA 4PC6A 2YICA 3PCXA 5I3ZA 1OXMA 3B2QA 2F3RA 4W6ZA 3G1UA 3QY0A 1NVBA 1YJAA 2A78A 2PS9A 4GE3A 4R1QA 3WB9A 3U1BA 1ORVA 2QEQA 4UAUA 2IUSA 4NBNA 5K8LA 3E3OA 3S2UA 2GJKA 2VNSA 4D0GA 1HY3A 1WDMA 1DX6A 2XXJA 2JF0A 4K6OA 3KK0A 2CEKA 3J80A 2W70A 4BX3A 2RGXA 3A4YA 4BFYA 1ILWA 2QAGC 3E7XA 2XUJA 2OMEA 3NU1A 4D6XA 2HYIC 1RJFA 1ZRSA 1S7CA 2W58A 3R3VA 1IQUA 4GH5A 3RVJA 3JQ9C 3BGDA 5HUHA 5K0FA 3FFXA 3DXZA 2VSQA 1OH5A 4XTCS 1EX1A 4J91A 3ZHRA 1U0GA 2AMYA 1CNFA 4PGAA 5CB4A 2X3UA 4ARIA 2BN4A 3AVOA 3V32A 1SXJA 2F1HA 1H5UA 3RK0A 1R8XA 3NAGA 5B1YA 2ZRIA 1NVMB 4IUYA 1J21A 3BRWA 4L6CA 4MXDA 1ZJYA 4RA6A 5HE9A 2RK3A 4TTAA 4LC0A 2AG8A 1NNSA 3FCCA 3AU9A 3VSAA 4BN0A 4CMJA 1FVHA 2BFNA 4R1OA 4XRRA 1VLVA 3GPBA 3B3GA 1NVAA 2HCJB 3CF4G 2IY8A 4I4TA 3RIEA 5JSHA 5IKXA 3LA8A 1YCHA 5JXHA 3IXMA 3L0YA 2GETA 2NTYC 2B7BA 3KSRA 4LOLA 4QODA 4EFKA 1W30A 5A4IS 2XRMA 3SVTA 4XQEA 1O08A 1JN0A 3ETCA 1T2NA 2I1WA 1YQWA 3OU2A 4NJMA 2GCGA 3PDJA 3RS0A 3H8SA 2NYUA 3PNYA 5F73A 4F6RB 1T5OA 1VIVA 2ECPA 4NDAA 3HKEA 1EXMA 2R7LA 2EHDA 2SKEA 3FOAA 3GFBA 1ORTA 2OPHA 1QH9A 1L5LA 3PXEA 1Y1QA 4BVGA 1IOZA 4PYMA 5JAPA 4IWNA 1OBHA 4JJIA 4AZ3B 1H1LA 1YNOA 1ZSVA 1UDAA 2VDJA 3NWOA 5I7OA 1M2VA 1X38A 3GJ0A 4HGOA 3WYCA 2EBWA 2QTHA 2OORA 4AJEA 3WOHA 4CM4B 2C61A 3TQIA 1P1BA 3EEOA 1Z7YA 1L7QA 2RI0A 1O9HA 2OV6A 4BZPA 4M53A 5CCBA 4RANA 1YA4A 4MMZB 3HYLA 4LXHA 2QDKA 3VNQA 3Q9NA 1RDFA 4J29A 4ZRNA 3SDSA 1JEEA 1YKFA 4BGIA 4LVCA 4EPWA 1T24A 3CGGA 1JP7A 1X8LA 1GKLA 4F3NA 1ZJ5A 4LC1A 1G5HA 1U4OA 1WXGA 4YXWA 4UOZA 2D54A 1HMYA 1HE4A 2PJUA 4O4HF 1UZLA 4A2WA 2WM9B 1C0KA 2G07A 3DNMA 3O4HA 1CJUC 1IVSA 4HD8A 4HZUA 4II7A 4Q19A 3AR2A 2E4AA 5HMMA 1UXOA 2Z57A 3LL7A 5CLHA 2G9RA 2WILA 1BJKA 4DCUA 2PX2A 2V0NA 3OCUA 5LDGA 3R40A 1M2WA 5ALVA 1V45E 1WXDA 3DPSA 5DI3A 3SKYA 1OXXK 5TIIA 2IH4A 4Q4HB 2Y1LA 3PLAE 1R8QA 1V37A 3HR4A 5C1OA 2PD6A 1FFHA 4MRSA 4ZYTA 2QTWB 3HVIA 2IU6A 3A3YA 3RQSA 1E3MA 4BEWA 4ZAYA 2FN4A 2HRRA 2EKPA 2F9MA 4LOKA 1RBQA 1OLSA 2V9ZA 2XBUA 2OBBA 4RVFA 4Y2XA 1JBQA 1UKVY 1VBMA 4GKKB 4FGUA 4YAJA 1DJPA 3UA3A 1ZI8A 2ZTLA 4DJEC 2D1TA 2HO5A 4IUCS 1E4EB 2IT1A 3LHFA 3P9ZA 1F51E 3HVJA 5K4GA 1NF3A 4GPEA 1P4RA 2AC4A 4L1KA 4O08A 2OV2A 1DRWA 2JEZA 1S4MA 4RZUA 5HJ5A 2I9PA 1U0OC 2ODBA 1D2GA 5FI0B 1L5OA 3M34A 4MYUA 4V02A 1JLLA 2QTTA 1N1DA 3DVAB 4PNPA 4Z0TA 5T4HA 3EXHB 2OV1A 4C7KA 5BN4A 1SKYE 3DDNA 1SKYB 1H85A 2HI0A 3IOCA 4Q9KA 3O8BA 5I9IA 2KSQA 3IB6A 1T9AA 2ZOSA 3H2HA 4OH7A 5D5HA 4ZHQF 5CDSA 3QEBZ 1P39A 3UGQA 3ZDRA 2QP9X 4UHBA 3TPFA 2UAGA 2AR0A 1TCAA 3GA7A 1EEXB 1O0BA 1SOUA 4CM9D 1PK9A 4HTFA 1W0JA 3BD9A 2RKBA 4PYQA 5F1YA 3SHWA 1ABBA 3G7SA 1NXSA 1IN6A 3HL4A 3KD2A 3PPXA 4E4TA 7YASA 2QW0X 1UMCB 4L50A 2ZRAA 4GGPA 4YUAA 1JALA 4LHVA 1QP4A 5IKEA 4YJDA 1NF9A 2BH9A 1T2AA 4KQ6A 3GRPA 4X6YA 3SHTA 1R8YA 1U4SA 2PKEA 1UQUA 3O8RA 4NABA 4YJHA 5DYYA 3U1TA 1XUOA 2PZLA 3JWIA 2W22A 5FWXB 1BFKA 1H2FA 3PL5A 1NN5A 3DV0B 2C2KA 3VPFA 5D87A 1B93A 2ACVA 4RK5A 1C8KA 1PYDA 3A1WA 5COBA 2J32A 1PCXA 2P69A 5HXAA 1RPAA 1IQ0A 2O4CA 2BCGY 2YJTD 3K8QA 1UWKA 3BERA 4QBKA 4CKWA 2RJ3A 1S02A 1UPAA 1E6UA 3LD9A 3QLEA 3LZ6A 1BXRA 3MGBA 3CRW1 4NZMA 4U7GA 1I5OA 2IYUA 2LW7A 4A0QA 2JA1A 4WEOA 1LDYA 2KPOA 2VJPA 4PG6A 4TV8B 4YJ3B 2M6LA 4RH3A 4W9RA 4BMXA 2RB4A 2XDQB 4O3FA 3UHFA 3KFXA 1I01A 4O2BA 1PEDA 1JX6A 3VV3A 1FIUA 1LH0A 3T95A 2J5XA 2PJDA 1RFLA 4NDNE 2BFDA 2HW8A 3E9RA 1UPXA 2WTEA 3C41J 4JLJA 5DGCA 4W8HA 5E3HA 4PN7A 2AMLA 4ARZA 2CN1A 3K2IA 3IUMA 1O94D 3R7BA 3ECCA 4B74A 4ERXA 3DBRA 1A9TA 1OGJA 2QXTA 3R41A 4C7JA 5T3UA 3RW9A 2PKRA 1ZZEA 3EFEA 3MMXA 5BW8A 1GPMA 2PFGA 4H27A 3I6YA 1A5AB 1I13A 2AZDA 1A04A 4I5DA 4F9GA 1M0SA 2D0OB 2YCLA 3BIWA 2AZMA 3NLLA 4A82A 5LP1A 2CCKA 5FORA 5FBZA 4EY8A 3T34A 4IGIA 4YO8A 3GRKA 3SMQA 1E3JA 3MWDA 2R44A 2I7DA 3B6KA 3COWA 1MAWA 4M9ZA 3GZNB 4ND7A 3TRFA 4WBNA 1GA4A 3R7FA 1GTSA 2EJVA 3NKLA 2ON6A 2QMHA 3T1TA 3V6MA 1W8DA 2ONZA 5B36A 2XE6A 4HRYA 4Z7QB 1NW9B 1UXHA 2JFUA 3PHGA 4BO6A 4DLTA 3O1HB 2XRZA 2QBYA 1NUPA 3B6EA 4UDNA 5FOQA 2I6GA 4M99A 5EE0A 3KOWA 4Y6QA 1DKUA 2PTGA 2YXEA 4OD0A 5EUCA 4BZQA 2AC7A 2CVQA 3EAFA 4AYXA 5DHAA 3Q8KA 1Q50A 2NZWA 3T7DA 1ODSA 1JHAA 1T35A 3FYHA 4W8GA 3DWEX 1FP4B 1NVWQ 3UYKA 3Q3VA 5FLXA 3D6HA 1H1TA 1FRNA 2VJBA 3GF4A 4QXOA 1GCGA 2YMPA 3H4IA 4W82A 1UFQA 1D04A 3SKVA 4D9GA 4HCJA 1L8LA 5DP2A 4XM1A 2PFKA 3EC1A 2EGGA 3AL2A 3IE2A 2FW1A 2YWGA 1DQYA 3FYDA 2JLUA 4FLMA 2JARA 4YQZA 1GR1A 4ZU3A 5LU9A 5JO9A 1GTRA 1UQRA 2PT6A 4Z1MD 3WFZA 3F6RA 1L7MA 2F1KA 4E5NA 4GMDA 1FTYA 1E2HA 2RKOA 2OQ2A 4C22A 5JRZA 1Z4JA 1Z75A 1F6DA 4L15A 3BL6A 2H3EA 4XYBA 4PLWA 4AJNA 2NPFA 1NQAO 3ND6A 5AWFC 4NC9A 1DBRA 1RQGA 3HY6A 4TT3D 3WO0A 1Y9DA 3KKNA 1C3VA 1QAMA 4EEZA 2J87A 1LPNA 3ND5A 4JJEA 1XCPA 4I55B 2GAIA 3UM9A 3VNUA 1PJ3A 4YB8A 3AERA 5FYDA 1V16A 2QIPA 2VYQA 3O9ZA 5E2IA 4EZEA 4HQKA 2PZJA 2MSCB 4KIUA 4RDHA 4BASA 2B0CA 1E61A 3IAS6 4EHJA 4MVJI 5DB4A 3LPMA 1MJNA 4URXR 5KKAA 1UEJA 1JA1A 1T25A 1AZTA 4OL9A 5EYPA 2Q1XA 1O6ZA 2C5SA 3E58A 1TFUA 3EC7A 3GAZA 3LBIA 3QEMA 4MV4A 2RAFA 3LC0A 3SR0A 2W90A 4IOMA 3W6ZA 3R6LA 3SKXA 2VLBA 3U37A 3HDJA 4DJDC 4PLYA 3DUFB 3V1TC 3DKIA 1DADA 5EZSA 2VYNA 3DO8A 4X97A 1T9GR 1XEXB 2WIJA 1O95D 4RVUA 2SBTA 1U1EA 1IOVA 3COYA 4GPBA 5FNVA 2AG0A 3TXYA 4MDFA 2Q07A 4EBFA 1E3EA 2RHOA 4L4YA 1DC6A 4WNCA 2PLRA 5AKEA 3AF4A 3ZDYB 3D2AA 4K88A 1Y8CA 1EWRA 4DG5A 1NG9A 3I52A 1Q0QA 1XZJA 3W4IA 2QK4A 5KYXB 1AXGA 4IVQA 3FTDA 1LTHR 5TMBA 2JG3A 1KL7A 3WQSB 1N2XA 3BWDD 2Q8NA 1E2JA 3JVEA 2F9FA 4KAAA 3ZWQA 3HCBA 1E20A 2VL7A 3L1IA 1EE9A 4BQEA 4H35A 4B82A 3AXTA 5BV8A 4QDXA 1J24A 5C2JB 1D07A 4KGVA 3WWCA 4DT1A 5CXQA 4XEHA 3PQ5A 3V8QA 2VK1A 4BX9A 1XU7A 4C0QC 1GZ3A 2PIAA 3DXFA 3WLQA 3ZK8A 3SCZA 2OENG 4R2HA 3ZV7A 3NB0A 2B9EA 1JLKA 1YBMA 3WXBA 5LMNB 1KVTA 3E22A 3U4QA 5A4MS 3R0IA 3AUKA 3KETA 1NBEA 3CCCA 3ZWDA 2VT2A 4RE6A 4DCVA 4DCMA 4HV4A 2K7FA 2CD9A 1Y8RB 3AZQA 2Z04A 4JL8A 4WVFA 4YROA 1ZP6A 5C1DA 1RIFA 4EVQA 3A9RA 1N92A 4KWEA 4QICA 2Q9BA 2AE1A 1KI4A 3O7WA 4UEOA 4BQNA 1PZMA 2BBTA 4FE4A 4C3OB 1FYXA 1TK9A 4IEIA 1GKYA 2JD0A 4PTLA 2ZS9A 3H2JA 2AQHA 2AFHB 2Y0CA 1EGQA 1GUFA 3LIIA 1C4KA 5LA6A 5HR5A 4JOQA 2WE8A 2BR3A 4WW0A 1JAIA 2FWMX 5KOJB 4M46A 4C3UA 3WL5A 2O48X 4H4EA 4GZLA 1LPBB 1FFDA 1VJCA 1C14A 3F1KA 2ZI9A 1H6BA 4FQ5A 4I4TF 4KOEC 4DLPA 1CDZA 5KBYA 5ITZB 3TEJA 4PLHA 3PXUA 4IDGA 4RMIA 1QU2A 4EITA 2XZTA 1CEQA 4MIYA 4NONA 5ENZA 3K2QA 3ORFA 1A7JA 1CWUA 3L4BA 3ZWVA 3L8EA 3THXA 1NXOA 5CR9A 2G0AA 2GR9A 4L9AA 3NALA 3PQ3A 3IPXA 3O93A 2CNKA 3SEAA 3W5DA 2I80A 4QVGA 4YP0A 2BMVA 1XTQA 1OFGA 3GHHA 2EG9A 1FSFA 3II6X 3P2KA 4TT3A 3JW8A 2BFMA 3A4IA 4HRXA 3IR7A 2I8CA 3OIGA 3ZE6A 2A3NA 2WF5A 4L95C 2BC9A 1O4VA 1ZMRA 5FEUA 4YJGB 3ESQA 2X41A 4NDZA 3USCS 1GPUA 2Z43A 4EI7A 3V1LA 2N46A 1BZYA 3U31A 2BF7A 3C3JA 5EIFA 4CFYA 1WTAA 1U9IA 1Z5NA 2ZITA 3G5TA 4FGKA 4LF7B 2NZVG 1FZTA 1UCFA 1P5FA 2BONA 4Z8YA 3H2GA 2Z3VA 4KIGA 4KO8A 4DWOA 3QPWA 4M6WA 3I6ZA 4UDOA 2HU5A 2I3GA 3ORRA 4FZRA 4HFNA 1H8HA 2OZEA 2P77A 2F67A 1TEHA 3AHEA 2BMEA 1TB4A 5CA1F 5HIAA 2B20A 1DQRA 2NPOA 4TV9F 4XWGA 3PUYA 1YZNA 3L9WA 4M1YA 2ZJ0A 3JZIA 4YQEA 3ADPA 3GCDA 3OQIB 3GT7A 1HSOA 4QUHA 4F3KA 2RSLA 3E70C 3NHPA 2PRZA 3K70B 4OP2A 4BQPA 1JV2B 4B7AA 4DREA 1FDRA 4N8SA 4OVKA 3DBLB 2YQ4A 3RKUA 4LHYA 1M74A 4ZI7F 4FXPA 1D0IA 4IDPA 4MR9A 4U6QA 5IC6A 4BO0A 1R16A 3LX4A 4NK5A 3TCNA 2VYVD 3IX7A 2C83A 4AMUA 3ZCTA 4ZK2A 1UWLA 5IK2D 5KO2A 4IWXA 4WHMA 2V7GA 1EPUA 3G2LA 4CMCA 2C8JA 3O8OA 4YMIA 3O2JA 4DYDA 1IXYA 1XJCA 2OVBA 1RPNA 3AR6A 3UB2A 1DJNA 1PD0A 3WISA 2J4CA 4G0UA 3SYMA 3EPJA 2R4UA 4MNTA 5AW4A 2UXBB 1ENOA 3LU1A 5FOSA 2I8AA 4YO7A 3L6BA 4QXMA 1HC7A 2AZ4A 3AHIA 1PDOA 4LE1A 4F2DA 3R7DA 4ZQFA 5J43A 4B6RA 1T8YA 3X2FA 2ADFA 4MJLA 3AJEA 1YAJA 4Q39A 3M4ZA 4OHMA 4DLKA 2ZE6A 1JFSA 3OEWA 5DVZA 3OQ6A 1CBUA 3LQQA 2RGCA 3MM4A 4UPDA 2HLNA 4RF3A 1D6MA 4LWQA 4KE7A 4DLYA 3T38A 1SMKA 4X41A 3PQDA 1U63A 2V96A 3LKBA 3D2CA 3PEYA 1MMFB 5B53A 5K0BA 3I5YA 3HXTA 1MAAA 2CZQA 5D7NA 5IZ4A 2FMXA 3B6MA 2ST1A 3KTFA 3THYA 4KK3A 1QYWA 4N6OA 2IA5A 3TZEA 4EBBA 2J3JA 2VZEA 4TOIA 721PA 1Z4QA 1ORDA 1PLKA 3I6BA 2DUWA 4LGCA 1H3EA 5I9LA 2OESA 4QT4A 5BPHA 3KAKA 4Y9SA 4ZWNA 3F73A 2P7HA 3OUZA 2C2GA 2PQ6A 3E05A 4RDCA 4XIFA 4BN4A 2VNAA 4COKA 3PEFA 1QLHA 4OXYA 3PDWA 5DBFA 4TZKA 3ADBA 1EIWA 1ZKMA 1AKVA 1WW3A 4AY2A 3EULA 3B13B 3MYRA 5HCIA 5G40A 3L4JA 4PC2A 1M6NA 4C5CA 3HYSA 2IRWA 2ECKA 2QXYA 3A9SA 4IKEA 3P45A 4XGQA 4YYZA 3OMLA 2XOXA 3K0CC 1M2FA 3OIYA 1SBTA 1PR6A 4TGLA 3GLFB 4RM3A 1B74A 4Q4AA 3W7AA 4H0CA 1UDXA 3I9LA 4RJJA 2I7CA 3LOQA 4YV7A 1USVA 2SCUA 3EIUA 5IDWA 5LZ5A 4DDHA 1AGPA 3N53A 4KZKA 5FHRA 2AGVA 3IDFA 4I6JA 2G4LA 2WYHA 5AMXA 3RT1A 3U2QA 1TMOA 4DCNA 3HUUA 4UULA 2ZM6B 1N75A 1WVMA 1A4IA 4P35A 4U2GA 4WXMA 5C7IO 1XMOB 4KGDA 2PSHA 2ZJ6A 2J5BA 4DR7B 3K0BA 3AG5A 1ZESA 2CB9A 3KLNA 3Q0EA 1TJ3A 3UK2A 1WEHA 2FZ4A 4FMCF 4WOKA 4NJEA 5TQJA 2XAUA 3B7PA 1PJ8A 1HE2A 3IHWA 4Z0NA 1KF0A 3V33A 2C8VA 2C58A 2C3UA 3I37X 3ML1A 3GOQA 4KUHA 3SXPA 3UT6A 2CE7A 3UPDA 2LKDA 1F7VA 1RXUA 3EF1A 2AVNA 4WKPA 1EJ0A 1ZIPA 3VYSB 2B1JA 3AJDA 2ZAGA 3OLCX 2VPQA 3FF1A 1EVKA 1G6HA 3PZRA 3V1MA 4E7OA 5HOEA 5KX5B 3ZGLA 5BXQC 4IGKA 5G1OA 3GROA 4E14A 5CB4B 5J1SB 1KYIA 3G82C 2H2DA 1KIFA 2IKSA 5CD1A 2RGRA 4CQNA 2X9GA 4UARA 1N25A 1WS6A 3LVQE 4K0RA 3TOVA 4YC7A 4Z4GA 4YIHA 3HLYA 3F71A 4EW2A 2QUJA 3DKPA 1FZQA 1VPLA 1XR3A 2RHMA 1H6DA 3LS2A 3OX3A 4NMXB 4C2BA 4OHYA 2CYAA 1E7YA 1K7SN 4MHSA 1YKSA 4BO1A 4P0QB 1ISGA 4S1OA 4CLOB 5KSOA 4KDFA 3MOIA 4G67A 4XDGA 3GCXA 3ANSA 4I1SA 3AUAA 2J09A 4I4TB 4WEQA 3W1EA 2DWPA 3NZEA 4E21A 4EYQA 4QIHA 3TF5A 5IM5A 1QZZA 1U9JA 4KFSA 1ZI9A 5E6UA 3KOZA 3PJGA 5FXMA 5CK4A 2D6FA 1ORHA 4NYJR 5CDTA 4NNOA 3TMKA 4NOMA 1E62A 5CW2A 1RP1A 1UT8A 2Q9CA 2OXEA 2WM3A 2Z2YA 4UUMA 3RYIB 1FNNA 3FB4A 3P9KA 3ONFA 4I4IA 3OUUA 1ZDMA 2A1TR 4TTVA 2GN0A 3WNBA 2P68A 3R6DA 4HMPA 1RHKA 2EDAA 3IAUA 3MTIA 4R3WA 5EJ2A 5HG0A 2GCOB 3FZEA 2ZSHA 3FTCA 4Q93A 1SQFA 4LJLA 4MOWA 2CBXA 3BYZA 3CEMA 4M7WA 4OG2A 4XYLA 3F4BA 2G40A 2WSYB 5KVCA 5LYJB 2ZM5A 1ZK3A 3D7NA 3CW9A 4R1PA 1DBSA 3D8SA 3OY7A 2HZBA 1SCJA 2FEXA 4L8YA 4RPKA 4UU0A 5BO5A 3GA5A 1P4JA 1J49A 1I2CA 2QSZA 1XHEA 4JELA 4C7VA 3C16C 1YQDA 3EXAA 4D8UA 3OQPA 2Y68A 2CFSA 2FMFA 3B5EA 3DCNA 1OREA 4GZMA 5TQ2B 3X44A 4REOA 4DC9A 1SIWA 1IQRA 1VXRA 3PQ2A 1KVSA 3H5RA 3ONEA 3IAFA 1QOPB 1N5DA 2HA2A 3AR8A 3C6YA 4HHEA 4PSKA 4RL6A 3SF8A 4AQDA 4LV8B 4XWTA 3O73A 3ESBA 1XD2A 1E4OA 3TPCA 4RPLA 4C2AA 3DM9B 3WWOA 1N5LA 4FFLA 4J7CA 2I3ZA 2XXAB 1O6GA 4AF8A 1C1YA 5BQ5A 1HK7A 1M1XB 2EEPA 4Q3BA 1U90A 2J3KA 3LW7A 4RV5A 1ODIA 3IKTA 2HMYB 4WUTA 2WE7A 2LUOA 5DHFA 4P31A 1DKQA 4QGSA 3J81k 4H3SA 1NJFA 2M6SA 1RJDA 5CHYA 5C8XA 2QT0A 4L3VA 5I9NA 3OP1A 3JQAB 4B6OA 1YE5A 4QGBA 3WLFA 3WSTA 4TVSA 1DCTA 2FUCA 3GVHA 1JI3A 2A92A 4P33A 5BRAA 1OI7A 3PI6A 3MIIA 1ZXXA 4ZV4A 1XDUA 4YCJA 3VH3A 5EGSA 1QH8B 2Q5EA 3PQCA 1N8TA 3VR4H 3MTJA 1DPFA 2YHBA 2K2QB 5DEOA 5DM60 1KHTA 3KUUA 1Z63A 1QQAA 3DTVB 5JBIA 2WVGA 4I2NA 2IEYA 3SSOA 3PFCA 2I8LA 4TWZA 4JMLA 3SZOA 3GT3A 1XAHA 2Y2UA 3VR6D 3FOCA 3P97A 1W29A 1LV7A 2C4MA 4MV3A 2R8BA 3U80A 2JFPA 3UGTA 2DJIA 2CF6A 4BQRA 3H5VA 3WDMA 3TTUA 4D5EA 3KWLA 4ON9A 2GTPA 2HLDA 5BSGA 1BQ4A 3SF8B 6PFKA 5IVPA 1THZA 3L43A 1TW3A 1JEAA 3VDMA 1R0BA 1VLJA 2W4IA 3ZIDA 3I9MA 2F8MA 2XOKA 5AKIA 4QUGA 5AVYA 1S3IA 1VHQA 4RY2A 3PCRB 3BE5A 4MPTA 5HZGA 1SCAA 3EX7C 1TRKA 1EUQA 2WQ6A 2FFQA 2AI2A 3DYBA 2YDYA 2ZEJA 1XCLA 3NUZA 3QX3A 1SB9A 1SUIA 3Q88A 4K46A 3WLKX 3ANLA 1SVKA 1Z0AA 4ZICA 5ISMA 3G17A 5FNVF 3F7NA 4BBJA 1TEXA 1LUAA 1XF1A 1V5WA 4P4NA 5CYOA 5DX8A 1ULAA 5GQSA 2YN2A 3HTXA 4LEIA 4Q7EA 4X8OA 2XMZA 4OHVA 3V48A 4B6FA 2ZRFA 3K5WA 4C89A 2QG6A 4ZQBA 5L3ZA 2JHAA 4HEA1 3AJ9A 4AF7A 4J03A 4AL4A 3CYFA 3FSJX 3AI7A 3GA0A 3NPAA 3QX8A 4LOHA 4G26A 3WNCA 4CGYA 5B4UA 1N7JA 4A8JB 2GHIA 2R48A 2CKDA 4Q12A 1E5VA 3ROFA 4IJWA 2B99A 4AUKA 1L1FA 1CE8B 2VF5X 2BH2A 1W0KD 4QU9A 1EMDA 2FE1A 1RPTA 2ODAA 1G8HA 2WD7A 3OQVA 4FXOA 4YJHB 4WFIA 4JVMA 4U63A 2E37A 4E0BA 1T8WA 4UUNA 2YY6A 2QGZA 3WGKA 2QT9A 5LNK6 4CKXA 1G20B 2FA9A 5C51B 5LMCA 2R7KA 3I92A 4URFA 1JFFA 2XUQA 2G4CA 1O54A 3DXXA 3GLRA 4PCLA 1YI8A 4EG0A 1OMOA 1UJMA 3ITEA 1DBWA 1MVNA 1EVZA 4CKWB 1W36D 3E1GA 3SP1A 2CNWD 1Z36A 1E3SA 2Y1GA 3MT9A 3U7GA 3JZAA 3BIOA 1HL3A 5E6RA 3AJAA 3ONNA 3Q15C 5IZCC 1QZTA 1SVUA 2Q6OA 1O9BA 2IYYA 4HQ6A 1KE1A 3D3JA 4UM9D 5KS2A 4YHHB 2L17A 1OZAA 5DNEA 3KM0A 1SHZA 3FY4A 1WOYA 3HBNA 1KFCB 3EBPA 3VNBA 4HQOA 1N2IA 1G38A 3HN6A 2D4HA 5T6BA 5TVKA 2C57A 2PRJA 3R6TA 2FWAA 1YMVA 4YMLA 2OYRA 5LMZA 2UYQA 1IZZA 2ZYAA 1T5SA 3KJGA 3KFLA 2Z2IA 2MYUA 2MIIA 5CDUA 3H9UA 1SKBA 3FTNA 3D3WA 3UT0A 2POQX 4ZFNA 1ADYA 3LVBA 3OZTA 5AKYA 5BSTA 1WABA 1JIIA 3KE9A 4ZVOA 1KZGB 5JPDA 1QGYA 4JSTA 4FZJA 4KXYA 4CR8A 2NOAA 1E9VA 1T10A 3QMWA 4QTUB 1BMTA 2ECFA 1TCUA 1D9XA 3E1KA 1BVUA 3GJRA 3IALA 3OE4A 3A04A 3KTAB 3KVYA 3ZE2B 2NQ2C 4RJIA 1X94A 3LRTA 3MWDB 5FBQB 4DABA 1XP5A 4E5PA 2QAGB 1U7HA 3IJRA 3J7TA 4JI5B 4YLYA 2OHGA 3EEIA 5HUQA 1VHTA 1EI9A 1TM3E 3P9PA 1HT3A 3ZWYA 4B76A 4FWBA 1DAIA 2NUAA 3AUUA 3HFSA 4CTMA 1R8SA 1G8GA 3M81A 2B2CA 1P2UA 4S1WA 3ILSA 3OLQA 4XX0A 4HEHA 3WP1B 4Y6RA 1PNRA 4DSNA 1GNPA 3ABZA 4J9VA 2FSVA 4XXHA 2WU4A 4H31A 4BO8A 4D98A 4DPLA 5HZMA 4LE0A 1YJ5A 3IFSA 2DQKA 1D4FA 2Z1DA 2Y1CA 4M36A 4RQUA 4B3JA 4YRSA 5KWEA 1WF3A 4BU1A 2G5PA 2ETXA 2PX3A 4H18A 4UQPA 3QPUA 1C3OA 4O2LA 5L7TA 2GA8A 3VR3D 3QWAA 5EJ4A 3G8DA 1UFKA 2R8ZA 1TLLA 4HQRA 2N75A 3FPGA 2OHJA 2ZSBA 1C7IA 3MJTA 4MWBA 4TYPA 4RIHA 3M9WA 3SC2A 1P5JA 4AJJA 3QF7A 4MGYR 3MRSA 4E5DA 4JLOA 5KQRA 1YZQA 3H99A 1L7DA 2VPPA 3RRXA 4DV4B 2DR3A 3OH8A 5CB4F 1E3WA 1SOWA 2HZ7A 5FV7A 3QFFA 4ZZ2A 3QGMA 3KXIA 5SZJA 4B0OA 4YAIA 2I2BA 3BILA 4TN5A 2CFTA 3SE0A 3U40A 4PF1A 3O75A 1KJ8A 4I4LA 5BMVA 2V74B 3OTIA 5DFAA 5K01A 2P9GA 3C3BA 1KQNA 1EE2A 4CLXA 3E35A 3IDOA 1KY3A 4DR6B 1DS6A 5AOVA 1J2YA 3BE4A 4YMVA 4R54A 1WMFA 1V1MB 3H04A 2QM3A 4B1FA 2NGRA 4PBRA 1QGOA 1GQQA 3LX5A 5KEIA 1CUDA 1NVFA 2LCFA 5TS2A 4WA8A 2PMEA 1B8NA 3TDMA 1S1MA 4CIXA 5KCMA 1GRVA 3RVBA 5DXAA 5DNAA 1JZTA 3OCWA 1XL0A 3GRAA 3O31A 2R6JA 4MWOA 5J5AA 3A6PC 3V8BA 3G85A 2JGNA 4YJ2F 1OIWA 4GKVA 5JJ5A 1OJ7A 1F06A 1Y9AA 3SSNA 2CLCX 4KFTA 1TIBA 3DHWC 3HWWA 3WLSA 4U2EA 1UC9A 3B36A 4M88A 4FDUA 1BVRA 4P08A 3G2QA 3E0QA 1RYNA 4ZVSA 5IVKA 3HDTA 2PH5A 3GR6A 1ZG3A 2OY0A 1IY1A 3WYDA 1PWXA 1S8NA 1Z25A 1VKOA 4ALNA 1FS5A 4ECAA 1Q1GA 2JGDB 3SEQA 3TNFA 4P5DA 5JCZA 2I2DA 2X8JA 4B6EA 2XUAA 1PUIA 1CQJB 1GT6A 5EKTA 1TYEB 4OL0A 3TTXA 3HXMA 1JQJC 1MP0A 3PUVA 4K87A 1IMOA 2OGTA 3F6PA 3ILVA 2Q5OA 3KT8A 1TTTA 1OT3A 3B38A 2CBGA 1NXWA 1EUCA 1WUIS 4HEQA 3ZCXA 4NBWA 4BFWA 3B85A 1J2EA 2P9BA 2QSUA 4G0ZA 5IT5A 4J0HA 1RBZA 1SUPA 3T35A 1PZHA 5EGNA 2BCJQ 1ZMOA 3K0CA 4D0NA 4L8VA 1ZISA 2H48A 1R8JA 1L4HA 3ABSB 5COQA 5DH9A 4Y0AA 1A82A 3EXG1 3QWFA 4PNEA 4BN5A 3SQWA 2OILA 3KHSA 1KYQA 1E9CA 1PR3A 1ADGA 4K9SA 2BVNA 4JI1B 1P72A 1UKEA 2CK3A 4GP7A 3HPQA 4Y9DA 5CT8A 3H7AA 2OBFA 4Y6GB 2G8LA 5DLQC 5DTEA 3I5XA 1KYYA 3OTWA 2XMRA 2UUPA 1JLSA 5FOVA 3TW8B 1XZBA 1EH5A 3HJRA 2GAOA 1BIFA 3QOXA 1Q0TA 1U8AA 4HGRA 1L4NA 5G0WA 1HLPA 3M6VA 4DBLC 1IEQA 4X3PA 1SQSA 3NBKA 3UV6A 2E4WA 1UDRA 4FYKA 4N7RA 2P75A 3EY4A 3JV7A 4C4OA 3V4ZA 2H1FA 3A6GA 1S7GA 4NARA 1HT2E 3U7IA 4CPDA 2H00A 1HDRA 2Y1WA 4AK9A 3GLIA 5LOVB 3GLGE 1MJGA 3OQJA 3RUHA 4CLRB 4HZUB 5EQDA 3W5SA 4ODIA 4M1KA 4KXMA 2EFCB 2YY5A 1XK6A 1VPDA 2GYVA 4QEZA 4QHYA 3W5AA 5JAMA 2JCGA 2ZE8A 1T8UA 3OZDA 1LLQA 1PSZA 5H0IA 2A14A 2P5UA 3F8TA 3IQWA 2I4LA 2ORVA 3QJGA 4KKXB 4X9XA 1JHMA 2JIOA 2FMHA 2REXB 2XB6A 1MTOA 4UNQA 4R0VA 3DKVA 3DHVA 3U9LA 1DRUA 4IIFA 5A0VA 4RHUA 1LB1B 1KS9A 1MO4A 4L6AA 1ZHHA 4J07A 2AN3A 3UMSA 2G7MC 1E1KA 1H4TA 3H84A 4MPDA 2WV7A 1AS0A 1CQIA 2E3JA 2EXXA 2HCRA 2PS1A 2YVKA 3GX1A 3MCUA 5CLQA 4DMHA 1XZ8A 2FEPA 2GLUA 4UOEA 5MF6A 5ELMA 4JT2A 4JYAB 4LMPA 1XQ6A 3CO0S 3UWPA 1R0KA 4IIUA 5BQOA 4HKTA 4PPQA 4ZCTA 1O03A 1Z22A 2Y71A 4ZXFA 4TRRA 5A7GA 3FM9A 3E82A 3VYVA 2FN7A 6REQA 2WU8A 5TDHA 2QJTA 3B1WA 4Y2RA 3NHJA 1W44A 1I6WA 2IZ5A 5EJFA 2OYSA 7AT1A 2ZI4A 3ND9A 2XCQA 1ZC4A 5JXIA 4KFUA 2JAXA 3SF0A 2X6TA 3GN1A 5LMUB 1J0CA 3KJIA 4QFBA 4YVFA 4LNHA 2A1UA 1LY1A 2RAUA 5J47A 3SQDA 2BZ1A 3HV0A 4Q9DA 2HCTA 2JFBA 4BC0A 5EWMA 5EP1A 1D0SA 4HYEA 3ODPA 4OBWA 4ZEOA 2IZ7A 3DSRA 4U2DA 3VRHA 1IQPA 3ZW9A 4DOMA 4U6NA 1L7XA 4NENB 4U00A 3CNLA 2IVFA 3L8YA 3NGXA 4DN6A 2HADA 4PHTA 3ADDA 4LSMA 3ETEA 3DT9A 3N7UA 3RVQA 2JVKA 3D54D 1C0PA 1KKLA 3CRZA 3JASB 1NE7A 4G0WA 1KTVA 1XBTA 3ZW7A 1U7TA 1UMKA 1WUKS 1U5AA 1UOQA 1CQWA 3PL1A 2QRZA 4FC6A 4J0CA 4JK3A 2GKGA 3N86A 5G3YA 2YMQA 4ND2A 5F1OA 3CJTA 3GGDA 1WP4A 1BX1A 1F8YA 2RHJA 3WGUA 4F0JA 5J40A 3A4NA 1NN3A 2YWJA 3Q1KA 3V2UA 1N78A 4OQYA 2ZR0A 1I3MA 1B8OA 4KIFA 1WSBA 3WMXA 4ALMA 4EJMA 5T4EA 1P8AA 4PAQA 4NF2A 5DNDA 3CWZA 1K2WA 1U2PA 3VQTA