2OZVA

Crystal structure of a predicted o-methyltransferase, protein atu636 from agrobacterium tumefaciens.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
229
structure length
208
Chain Sequence
MDAMLLASLVADDRACRIADLGAGAGAAGMAVAARLEKAEVTLYERSQEMAEFARRSLELPDNAAFSARIEVLEADVTLRAKARVEAGLPDEHFHHVIMNPPYGLFEDWIRTASAIMVSGGQLSLISRPQSVAEIIAACGSRFGGLEITLIHPRPGEDAVRMLVTAIKGSRARLTFRAPLIMHETGSHAFTPFVDDLNNGRAAYARNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Atu0636
publication title The structure of a predicted O-methyltransferase, protein Atu636 from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transferase
total genus 59
structure length 208
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ozvA01
3SR4A 3P9NA 3EEYA 4EKGA 3H2BA 2DULA 5EGSA 3LKZA 1YZHA 3UWPA 3UJ7A 2ZCJA 2VP3A 3OZSA 1G38A 1OR8A 3GWZA 3JWJA 1WXWA 2ZIEA 5JUWA 2ONYA 4M36A 3TR6A 5GWXA 2PXCA 2ZWVA 5LQKA 2AOWA 2OBFA 5K0NA 3F4KA 5CVVA 2LD4A 2FK7A 1IXKA 3I53A 4RVFA 1WY7A 1RI1A 3SSNA 3UA4A 3LBFA 2Z6QA 4R05A 3BWBA 3TOSA 3B5IA 1VE3A 5CM2Z 5FA8A 3DTNA 4AZTA 2FRXA 4BY9E 3PT9A 1YFLA 3NW9A 4ISCA 3THSA 1HMYA 2EG5A 1KR5A 2Y1XA 2PXXA 3KHKA 5DPMA 2C7RA 5IKMA 3LDUA 1FP1D 1I9GA 4MIKA 5DRYA 4HC4A 2O07A 2B2CA 2ZIGA 2AOTB 3EPPA 5F2OA 4X63A 4R6XA 1MHTA 2EFJA 5CVEA 1JG1A 3GDHA 4BLUA 1D2CA 1ZQ9A 3ELUA 5EVJA 5CCBA 2IH4A 2ZZMA 2QM3A 3E7PA 2I62A 4EKIA 4AUKA 4P58A 3FUXA 1VP9A 3CBGA 1VL5A 4YUYA 1O54A 2PY6A 3KU1A 3EVFA 2P8JA 4RTMA 3HVJA 2GLUA 3FYCA 1QAMA 5HOQA 3FUWA 5LQUA 1FPQA 3ELDA 2H11A 2KW5A 3AY0A 3G8AA 3UJCA 1G8SA 4HG2A 3AJDA 3IV6A 2QRVA 1QAOA 2G71A 3TM4A 1EIZA 3KQPA 10MHA 5EC8A 4PYKA 1L9KA 1X19A 2ZZKA 1KPHA 3M6VA 3CVOA 2HNKA 5DTMA 5U4XA 5LQCA 4BLWA 4KVZA 4GOMD 5ICFA 2IBSA 3NWBA 5CVJA 5FHQA 3P2IA 1O9HA 1Y8CA 3KQQA 3FPHA 2IPXA 3A25A 4QQNA 3DR5A 5D1NA 3SVZA 5BP7A 5K0CA 5K0GA 7MHTA 5LQNA 1YF3A 2R6ZA 2VS1A 3ELWA 5G02A 1JSZA 2G70A 3CKKA 3P9IA 2A14A 5E8RA 4ER6A 1JG4A 1QANA 1BHJA 2NXNA 3A7DA 3ANXA 5FCDA 5E1DA 1ORHA 5DT2A 5K09A 2Z6UA 2JHAA 2BH2A 5E1BA 4PONA 3EVEA 2PXAA 1SQFA 3KQTA 3LDGA 2YR0A 3T7SA 3UJ8A 2JHPA 3DULA 2VZ9A 3AXTA 3OPNA 3FPJA 5HEKA 2G8NA 4X60A 1L1EA 2CMGA 5EOVA 4QDJA 3HM2A 3HVIA 3M6UA 5K01A 4LECA 3MAGA 4PGGA 5GINE 2IIPA 4GF5A 4HGZA 3NWEA 4Y30A 2PWYA 1N7JA 5E1OA 3FPFA 3R9XB 1KYZA 3DH0A 4HGYA 3AXSA 3BZBA 4GC9A 1UWVA 4PYJA 1V39A 3B7PA 4IWNA 2OKCA 2V74B 2P3OA 3K0BA 3NTVA 2P3QA 3PX2A 3LSTA 4E33A 1RI2A 4RVHA 2PWPA 4X1OA 5DM4A 5HFJA 5GIPE 3TQSA 5DX8A 4JXJA 1AQJA 2K4MA 2ZW9A 2G1PA 1KPIA 1R74A 4YV1A 4GOND 5EEHA 2JHCA 1AV6A 1XCLA 1VLMA 4DMGA 4X41A 3EGIA 1KIAA 3HVHA 1RI5A 2PBFA 1EJ6A 4PYIA 3GCZA 4H0NA 5E2BA 4OBWA 4OQEA 3DP7A 3T0IA 1X1CA 2P35A 2ZVJA 2PT9A 2H00A 3EVBA 1I4WA 1ZHFA 3HA3A 3BGVA 3IYLW 4ER5A 2EJUA 3PB3A 4RTQA 3FPGA 4FZVA 3KQSA 2ZWAA 1M6EX 3G2OA 3M6XA 4GEKA 1G60A 3GGDA 5ICCA 4YUVA 2QY6A 4RX1A 4AZSA 2O05A 3JWHA 2BR4A 4IV8A 2IBTA 2IH2A 3BUSA 3KPYA 5K03A 2AN4A 4O29A 3WSTA 3M33A 1IY9A 3REOA 5FULA 4BP1A 1AF7A 4OA8A 4BP3A 3X0DA 4E2YA 5LSAA 3NJRA 3M70A 3HA5A 2FPOA 2WA1A 2OB2A 5DTRA 1NW3A 1NW5A 4R8SA 5KVAA 4HRAA 4Z2YA 1BOOA 3FTDA 2ZFUA 2ZULA 2IDJA 3B3GA 4P7JA 5DTQA 5DM2A 5K0JA 3RW9A 2OO3A 3GRUA 2WK1A 3HCCA 1D2HA 1RI4A 4PYOA 3IEIA 5FUBA 5E8JA 3KR2A 3SMQA 4PIPA 5FTWA 5FWAA 3TKAA 3FTCA 4OX9Y 2IH5A 1P1CA 2JJQA 3CCFA 3FUUA 3JWIA 2CL5A 3PX3A 2EX4A 3GO4A 4C03A 5LQAA 5MHTA 2GH1A 3OFJA 3FTEA 3M4XA 5DXJA 3A27A 1SKMA 3FTFA 4YUXA 3KQVA 3HCBA 5T6BA 2UYQA 4C06A 3HEMA 2CWWA 3KQYA 4KDCA 4HSGA 3CGGA 3PFGA 4M37A 5EMMA 1D2GA 1IM8A 2V7EA 4PYNA 5CCXA 3GRVA 5KYGA 4EVIA 3GXOA 3TM5A 5C0OE 4G56A 4IV0A 4FSDA 5KQRA 4E30A 4V0QA 1M6YA 3FRHA 3EVDA 1SVUA 1RI3A 2XYQA 2C7QA 2NXCA 3E05A 4U7TB 4ER7A 1JQ3A 2PJDA 3GU3A 5F2KA 4PWYA 1VIDA 2H1RA 3OU6A 2UYCA 2C7OA 3NVKI 5EG5A 4FGZA 1WXXA 3GJYA 3UJ9A 3DLIA 3D2LA 3KPVA 4E31A 5ICEA 5E2AA 3V8VA 1ZG3A 3MGGA 4GQBA 1WZNA 3HCAA 1KHHA 2BM9A 1UIRA 2IDKA 1AQIA 2WA2A 3CJRA 3P9KA 3TPZA 3MHTA 3P2EA 4FSXA 3ORHA 1NT2A 3C6MA 4DCGA 2P41A 4Y2HA 4RTOA 3LBYA 4KWCA 4CKBA 4KRGA 2CKDA 3LL7A 2B9EA 1NBHA 2HMYB 1SG9A 2VDWA 1JG2A 1SQGA 5DLYA 3C0KA 5FADA 3G5TA 2BM8A 4QPPA 2NXEA 3MTEA 4RVDA 2I6GA 2UYOA 3Q87B 2ORED 2B25A 1SUIA 2PKWA 1N7IA 4CWAA 3UJ6A 1YB2A 5D1HA 1TPYA 2PLWA 2PX8A 3KR9A 2YVLA 3LCCA 1G6Q1 4FT4A 1FP2A 1H1DA 2HTEA 5HIIA 3RIEA 1NW6A 5LR6A 4MQ4A 5T64A 2AOUB 3G2MA 2FHPA 3DMHA 3G89A 5ICGA 4CXMA 1G8AA 1EAMA 2AN3A 2HWKA 2I7CA 2O06A 3KQMA 5EZQA 1YUBA 1XTPA 3FRIA 3U81A 2GAFA 1XCJA 3KKZA 1O9GA 2B3TA 3SSOA 4MHTA 4ER3A 2ZBQA 3DXXA 2GA9A 2XYVA 3BWCA 3EMBA 2OXTA 2VDVE 3TRKA 3UFBA 1JR4A 1Z3CA 3SGLA 5FWDA 3R3HA 3I9FA 3I64A 1F3LA 1NV9A 1P1BA 1L3IA 4OBXA 4POOA 4PGHA 5E9WA 4DF3A 4C4AA 9MHTA 5EIFA 1EG2A 3ELYA 1JG3A 2AVDA 4P7KA 2PT6A 3BKXA 4A6DA 5ERGB 5EMJA 3UA3A 5FA5A 5EMKA 3G2PA 5KS2A 3I58A 2AN5A 4QQKA 4RTJA 1RJDA 5LQJA 1XXLA 1YFJA 2FYTA 3PVCA 4C05A 4EQZA 1R8YA 5FQOA 2ESRA 4RTSA 5HZMA 1XDSA 3R0QA 4RTLA 1JTFA 2OPBA 4PINA 2B78A 1I1NA 2P1DA 2PX2A 3DMGA 5CVDA 3FYDA 3HNRA 2ZBPA 3NVMB 5EQJB 2Y1WA 4FS8A 4E2WA 2ZBRA 5FQNA 4CKEA 4XUEA 5E1MA 3LGAA 5DX1A 4PCLA 5K05A 3G2QA 5EPEA 3LCUA 3SM3A 1R18A 3P8ZA 1PRYA 4KW7A 4QDKA 4DQ0A 3TLJA 3NMUF 1R6AA 3PFHA 1KP9A 4PCAA 4DZRA 1EQAA 2ZIFA 2ZLBA 3CJTA 2XVAA 3LCVB 5GP1A 1YZ3A 5DSXA 4LWPA 4FT2A 5JR3A 2NNWB 2PX5A 4QTTB 5KQSA 5CUQA 1R8XA 3C6KA 3PLAE 3A7EA 1KXZA 4ZTBA 5K0FA 2O57A 3KQWA 4E70A 3R6TA 4ER0A 1BKYA 1NW7A 1WG8A 3EGEA 4AZWA 4EK9A 2YXEA 5K0BA 3EEOA 3QOXA 1BC5A 1Q0SA 3DXZA 3EVAA 3O31A 3OE4A 4KDRA 4BLVA 5HILA 4EMSA 1X1BA 3DXYA 5DRTA 3GRZA 3CJQA 2PGXA 1ZGJA 5HIJA 2IGTA 3RODA 3T7RA 4UOEA 3MCZA 3KPUA 3LX6A 2E5WA 4R8RA 5K0LA 3PTAA 3ME5A 4NECA 5LQRA 2AOXA 2AS0A 3TMAA 3S68A 4XCXA 3TFWA 3O4FA 2UYHA 4HH4A 1XVAA 2YTZA 2AOVA 5DM1A 3O7WA 1RJFA 3SSMA 4M7RA 4RTPA 3EVZA 1NBIA 2BZGA 2AOUA 2YQZA 1NE2A 1L3CA 4P7GA 1NKVA 5CVUA 1FJXA 4RTNA 4FP9A 2PX4A 3A4TA 3LKDA 3MQ2A 3VSEA 3FZGA 1B42A 3EVCA 3G5LA 3CC8A 5DXAA 3SXJA 5GM1A 5F2NA 5EIWA 5HIKA 1VQ1A 2IFTA 1U2ZA 4QPNA 4CTJA 4K6MA 2P40A 2Z6AA 4HTFA 4L7VA 4RTKA 3HTXA 1KPGA 1RJEA 2DPMA 2NXJA 3R24A 3JWGA 4PNEA 4GUAA 4YUZA 2QE6A 2PV0A 4V0RA 4YV2A 2XVMA 4RVGA 2OY0A 4C08A 5CD1A 1NV8A 2P7IA 5HIMA 2UZ4A 3KQOA 3K6RA 3MCTA 5M5BA 5BW4A 2N47A 5FHRA 3M6WA 5DWQA 2ZTHA 3EMDA 3NDJA 2C7PA 3EVGA 1L3BA 3OZTA 5K8VA 1X1AA 5IH3A 3FPEA 4YUWA 2OB1A 3AWIA 5CIYA 1ZKDA 4LWOA 1SUSA 2NP7A 4PYMA 3OU2A 5E9JA 1UFKA 1INLA 3HP7A 1JSXA 2QYOA 5EHIA 4C07A 2JH9A 3ER8A 1P39A 3LDFA 4KIGA 4PIMA 4DM3A 4F85A 2Q41A 3OU7A 4IKPA 5K0EA 5B1SA 2PVCA 1QAQA 1Q0TA 5EHGA 1PJZA 3V97A 3KPWA 3HCFA 3UZUA 4E32A 4QVGA 4XUCA 2CMHA 4DCMA 2VDUE 4X61A 1XDZA 1ZGAA 2ERCA 3GNLA 4U7PB 3KR0A 3PS9A 1G55A 2NYUA 2G72A 1JQEA 5P8WA 4YV0A 3VYWA 3ER9A 2HR1A 3OE5A 5GM2A 3E8SA 3FUTA 3A26A 4PYQA 5EKXA 3MB5A 2XBMA 1X1DA 3KR1A 2YUIA 4PYLA 4CTKA 1VPTA 2HV9A 1RJGA 2XYRA 3VC2A 3HCEA 5H02A 5EKUA 4HTFB 5E9QA 2NP6A 3OFKA 2JH8A 4F84A 5GIOE 2ADMA 4CKCA 1TW2A 4LG1A 2OZVA 1JQDA 3P2KA 4YMGA 2GB4A 4RTRA 1N2XA 3NDIA 4KIFA 3MERA 5GOZA 2YXLA 1F38A 8MHTA 3UJBA 3OCJA 4R6WA 3DLCA 3MTIA 3B3FA 2O0LA 5EMLA 4F86A 1P91A 2JG3A 4RWZA 4C04A 3P71T 3UJDA 2YX1A 4A6EA 4WXHA 4MTLA 5BXYA 1XDUA 2AR0A 3Q7EA 3EGVA 4E2XA 5DSTA 4RV9A 1NW8A 2YXDA 3TKYA 3C3PA 3HA7A 4GC5A 4GOLD 2ONZA 2OYRA 3KPJA 5BW5A 3LECA 4OQDA 5EEGA 1R00A 1FBNA 2R3SA 2ZZNA 4MWZA 2AVNA 3T7TA 3LPMA 2IP2A 3LHDA 3VC1A 3SX0A 3BWMA 1DUSA 4M38A 2P7HA 1VP3A 3B89A 3DOUA 3HVKA 2ZSUA 3OZRA 3GIWA 3UBTA 2GS9A 3E23A 4GBED 3ERCA 4ATNA 3QOWA 5C9ZA 2I9KA 2PSSA 4AX8A 1ORIA 2FCAA 2QRVB 3G8BA 4FR0A 1DL5A 2AZTA 3I5UA 4DKJA 3L8DA 1HNNA 2BR5A 4XUDA 4E2ZA 1KYWA 5C1IA 3QV2A 3ID6C 1VBFA 3BWYA 3BXOA 4RSRA 2AOTA 5EZSA 5T67A 3BGDA 4WVLA 3THRA 1XJ5A 1MJFA 3B3JA 3FUVA 4AZVA 4DA4A 4QTUB 1DCTA 3BT7A 3IHTA 3P97A 3BGIA 1M0EA 1T43A 2EJTA 3G7UA 4GOOD 4QVKA 5DM0A 2BR3A 3HCDA 3C3YA 4RYLA 5DX0A 3UJAA 4B17A 4YMHA 2P3LA 1JTEA 3P9CA 1QZZA 2F8LA 1EJ0A 1WS6A 3GRYA 4P7FA 2FK8A 3DMFA 1TW3A 3BKWA 3DUWA 4OA5A 1QYRA 3GRRA 3G88A 2GPYA
chains in the Genus database with same CATH superfamily
3PHGA 4DT1B 3L49A 3CRMA 4K9KA 1R4AA 2ZR7A 2I2XB 1EINA 3RV3A 3U1BA 2JCYA 4G5YA 4JUCA 1CIVA 3HUEA 1R5BA 2BONA 1U2SA 2ZIEA 4GZ3A 5KVSA 1CEQA 4QU9A 5AJHA 3QX3A 1I32A 4YA6A 3ZDDA 2QOEA 4O3MA 3PUYA 2GGSA 2GM4A 3F4KA 5EKTA 1ISSA 4QM7A 3HXQA 2IT1A 2Z8ZA 1KEZA 1QE0A 3I5MA 3IQWA 5JJCA 1ABFA 2Q3CA 2FF5A 1IVSA 1GGHA 1KETA 3O94A 5CM2Z 4D9NA 4B3CA 4CM3A 4JROA 4NZMA 4N8EA 4BEBA 5IM4F 4HDNB 1NJ6A 2FZCA 3ASZA 1MT0A 2R7NA 3F4BA 4R2IA 3CMCO 2WP0A 4M83A 5DF1A 1RZRD 2YV1A 1DAFA 3LXXA 1VDMA 3W4JA 2HYIC 3IRVA 4AMYA 1JNYA 4BZXA 3DPUA 3IR5A 4V3BA 2EZ4A 4YVFA 3WL3A 4D9GA 1R6VA 1QG0A 3HXLA 4N6NA 1QQTA 1RLJA 3SKXA 1C7ZA 3T9EA 1M8GA 3LY7A 4PQGA 3DB1A 3KZ1E 4ZOBA 1CKEA 2GTIA 3AFGA 3ABRB 3GD5A 1TQDA 3QXSA 4IIVA 4YCSA 5CBPB 4YIHA 4DJEC 2IC5A 2F55A 3W5UA 4MWCA 1Q20A 1Z6ZA 2C61A 1FS5A 2NO6A 2V3VA 3EASA 4MKHA 1M0SA 4XQCA 4YUYA 2A5FA 2PG3A 3QF4B 3C5VA 3JX9A 3H7IA 2FG5A 3KKOA 5BNZA 1PI3A 2CC2A 2FMHA 2JJMA 3C43A 3FYCA 2YYSA 1M54A 1QO7A 1PFUA 2XUZA 2RGXA 2WD9A 3GZNB 4LY6A 5J3JA 3WYFA 3T0FA 1Z6QA 2BFOA 3G5UA 5A1TA 5JHGB 1W88B 2GEKA 4WLVA 1I3KA 4LJKA 2W71A 1J5PA 3GUHA 4LGYA 1NXOA 1JQAA 4QUBA 3TM4A 4PSKA 2IS4A 3AVUA 4BCDA 1E2PA 2C9CA 3OM0A 3BIWA 4EIWA 3H9GA 4P83A 5D3QA 3MVEA 3FLBA 4UFPA 4AWAA 4BLWA 1MC8A 5LQCA 2XCSB 4NJEA 3ZWMA 5CVJA 1H1TA 1XA3A 1HR0B 4NMLA 1L5GB 3M1YA 1T0BA 5CA1A 3HP1A 3WYGA 2X2FA 4BO0A 1PV2A 4KZPA 3MWYW 4C7JA 2YW9A 2LDXA 1YF3A 1JG6A 2ES4A 1JSZA 2C96A 4EO9A 4I9NA 1I10A 2AFIA 3EZ7A 1NKSA 1UKZA 4RPHA 2QD2A 2V97A 1EK0A 4PIVA 2Q49A 4GLJA 4EEXA 2Q5IA 2NN3C 2Z6UA 2R5NA 1K7CA 3G9QA 3N59A 4Y8VA 4CMGA 4PONA 1E96A 4ZDIA 2BELA 4LF7B 5DEIA 3L5KA 3T7SA 5LMZA 3ZVMA 1BH2A 4S05A 4CMHA 4CKXA 4KNWA 3E8MA 4YT5A 1TAHA 2DTXA 3QK7A 4JUDX 4HXFB 2P4QA 3EMVA 4CLXA 1J0CA 1PFYA 2ZJOA 3QXGA 5BR1A 3ETNA 4B4DA 5K01A 2ID4A 2Q1WA 3BCHA 4KQCA 5BYAA 4PSDA 2IXAA 4PLTA 3VHXA 3OPMA 5LVAA 2J3EA 2C2BA 4BLQA 4F7WA 2ZBFA 1TDJA 4TMFA 2ZM6B 5F23A 3T3IA 2C5AA 1HETA 1WP4A 4PPFA 4X8HA 3ZX4A 3LLSA 3GQVA 1GGFA 3EZ6A 1L9XA 2P3OA 1PLKA 4FFRA 4M2LA 4QJ4A 1TF7A 5TXGA 3GUZA 1ZNZA 1QTQA 1GLVA 4V2UA 3L0BA 4I8XA 1UBHS 821PA 3A9VA 1BXGB 1DBVO 1AKEA 4DDVA 2ZJFA 2P2DA 2BI7A 3AEXA 3EY4A 5KJCA 3WTCA 2RGEA 1JU9A 2QXTA 4TQGA 1Z8NA 4BNTA 1KFEB 4DR1B 1QPBA 1IZ9A 1GPLA 4FONA 4C2TA 3G85A 1L4NA 3VRHA 1PKXA 3OUUA 4P4SA 1HYGA 2CMFA 2VHYA 5FLEX 3EARA 5FOTA 2VHEA 3ZE9A 2WHXA 2FJ0A 5IUJC 3ANSA 4DQUA 3KO8A 4EB8A 4BUZA 3MWLA 5CA1B 3LP6A 5JZSA 2XUFA 1QFZA 1ZHFA 2VHUA 3N2NA 1FMLA 4KN8A 4N0EA 3OY7A 5DHRA 5AW7A 1GTG1 2KI5A 1O95A 4LJ5A 2QZPA 2W42A 2C77A 2QJFA 4YRGA 1XWFA 1VCOA 3A0RB 3WNBA 3G49A 4BC0A 3ROFA 3REOA 3W1VA 1CW2B 1PT9A 1ORVA 2C9YA 1PTJA 3PF8A 5F52A 4IQGA 4WZBA 1ZGCA 4YACA 3SQDA 3SXUB 3T4UA 4QWMA 1YJQA 2FEMA 1BE6A 2HLNA 2ZWMA 4IWYA 2INGX 1ZNWA 4J4TA 4XEHA 5F9HA 4XKJA 1RQXA 5DTQA 5DM2A 1NVGA 5E2IA 1L5QA 4XVCA 2QTLA 1Z0UA 3VDXA 2MU1A 5B4VA 2EZ9A 4OLBA 4Y2YA 2GM9A 1SRRA 2RC5A 4TS4A 3I6YA 4OXXA 3UO8B 1MEJA 2EX4A 2GT1A 4JBGA 4BO7A 4MDHA 3ZHSA 4CF7A 3KD2A 1QRSA 4B2YA 4EPXA 4WZZA 3EHEA 2BL4A 2EYQA 1W4AA 1R4MA 2BLNA 2IOHA 2CJPA 2YJ3A 3VVCA 2I34A 2V7EA 4PPQA 1FUUA 2EW1A 4P4SB 3M5PA 4UMDA 4FB4A 4P9NA 5F5NA 1D6SA 3PXGA 2P4HX 1N1GA 1WSWA 3K9QO 4FPXA 4GGOA 4NFSA 1OXMA 1S2MA 2VZEA 1BNCA 1M6YA 3PVZA 5U1PA 1RI3A 3UQYS 1OVGA 1O6GA 2QL6A 3B6EA 4QEKA 1NNEA 2OCGA 3CLHA 3IC5A 2GZAA 4PWYA 4E1BA 5CLFA 5EG5A 1R6UA 3ZE6A 1OBCA 1ZMBA 1M72A 5BSHA 1AO0A 2EZ8A 4TTTS 1NWHA 4RNCA 1Y9ZA 1XUOA 1J7KA 2ZRDA 1Z5OA 1D6MA 1JDJA 1Y3BE 4PC6A 5A4KA 4OH7A 4C0JA 2AKAB 1KC3A 1TXGA 1AGNA 2NO0A 2P41A 5IWAB 2PT5A 1HE4A 3QYFA 4KEAA 5K7SA 1HYQA 5I3CA 3OOHA 5DLYA 3NC1C 2VXBA 4MR9A 3Q88A 3L1IA 1U4NA 2F3PA 2B36A 2K2QB 3AG5A 3ROGA 3JZAA 5FUYA 2VUIB 2NWQA 1TIBA 4OHMA 3ANNA 3NHSA 3OLVA 1I0LA 1O87A 1JBQA 2H1IA 5KOIA 3TD6A 4FLMA 1XKLA 1H1DA 1Q7BA 1GKLA 4RHYA 5HS4A 5JY1A 2G1JA 5J2UF 1M1YA 3KKPA 1L7RA 3T3EA 1G3RA 2AQIA 2G17A 2RBGA 4EUNA 1SRQA 4TZ0A 1T6BY 2ZUBA 4MQEA 3WB2A 2CKMA 1Q0UA 2JLCA 4BDTA 1R4MB 3IOEA 4FEYA 4WVFA 4PS1A 4DMRA 4Z8YA 1EK1A 1UZNA 1Z5GA 5AOBA 4ER3A 3B48A 3BX1A 2OXTA 3TRKA 1WB9A 3HBFA 1FSFA 1T9KA 1G3QA 4BQOA 4OQYA 3TE7A 3MCVA 4CF3A 3E7XA 4EF6A 2R25B 1K88A 2GBPA 4V1CA 4NCAA 2PT7A 2WDPA 2QX7A 3V55A 5A7FA 5CT5A 2ISSD 1LK5A 1ZRHA 4Q5IA 3TZKA 3D0QA 2V3WA 1FVFA 2OC4A 3IQHX 1XD2A 4CV2A 1NVBA 4JEMA 4UPEA 4U5XA 2FCRA 2X5OA 3WRVA 5BRAA 1AIPA 4M7OA 1VE1A 2I8LA 5FOSA 1FMFA 4RTJA 4WT7A 1MV8A 3F0TA 4II7A 3BWEA 3VHQA 2YFKA 1DUVG 2ZBGA 3WLIA 4DZTA 2OQIA 4J9VA 1VIAA 3R0QA 1IE3A 3RASA 5DIFA 1F20A 1UXGA 2PKEA 5J4YA 2XNCA 2P1DA 2IUTA 3CCBA 2ONKA 1H5UA 2VYFA 2XKKA 1CB0A 5E4TA 4PNHA 1S89A 2HA5A 4ARBA 4CZ2A 1LF5A 4MR9B 4Z7JA 4LRYA 4MUHA 2ZT6A 1FXWA 4CMJA 3P8ZA 3P2JA 4XX0B 4DWVA 2VYND 2FWNA 3H5AA 3W34A 2ZJ2A 4KQXA 4PX3A 3CJTA 3NHYA 4HQRA 5AXDA 2DJIA 5A4MS 4A3SA 2SBTA 3LGXA 4DMKA 5JATA 1U0HC 1YFZA 4AS1A 1ACMA 1P60A 4MUFA 4Q0MA 2PE5A 3KJHA 1C50A 1JB9A 1R8QA 4ENQA 1W4ZA 5JNRA 1GUAA 2VK8A 3GL9A 1BKYA 2WJGA 3BJIC 3CX8A 3EGEA 3GELA 2HC9A 2VJNA 3LUBA 1U2EA 1W75A 3OE4A 3KJXA 3WGZA 3K5IA 1R37A 3BF8A 3Q6MA 2Y9PB 3PEWA 2A0KA 3ETCA 2ZI9A 1ZK2A 4K3UA 1ZGJA 3NT2A 3OJXA 3TLMA 4V1CB 2XJ9A 1ILWA 2HLDA 4RFLA 4RZIA 5LIPA 2O7VA 2X8BA 2IEAA 3AUKA 3BCUA 3GGGA 4KQGA 3MINA 1L5RA 4WDQA 5DZSA 3CH4B 4ZANA 4HQ0A 3BL8A 4QM6A 4DNPA 2PLNA 1AZTA 3R6WA 5ALRA 4AMVA 5EMHA 3HXMA 3LRTA 4IFIA 2HDWA 3J80A 2VTDA 4IUDS 3QKWA 1I6MA 5SY4A 3OTIA 2R1VA 3PRHA 4RSMA 3ANLA 4X00A 3TQQA 1N33B 2YJNA 4PZLA 3QVSA 3W90A 1LJUA 1KMHA 3A4TA 3LTNC 3AY3A 1GM5A 1WZCA 1VRWA 1A96A 1XEFA 2X9LA 1I4DD 1RC0A 3EVCA 4GU5A 2YKGA 1VB5A 5CG1A 3WSWA 3IVGA 1FMTA 2IV7A 1K5GA 4TV9F 1F8GA 3T61A 4AMUA 3IKTA 3IODA 3OQIA 3HUTA 2YJ4A 3U3KA 4NOMA 3WLSA 1FTNA 3STVA 3EZLA 4DR4B 3OQ1A 2OV4A 4G89A 3QIVA 3C85A 4NBSA 3PE3A 1Z2DA 1NBEA 2HLDD 4KLNA 4Y3UA 2C0PA 2RHGB 1GG8A 1I3MA 3OAAA 2C7PA 1KJWA 1U8ZA 3LO5A 2MDTA 3QG5A 2VJAA 5EHQA 4JKYA 4XIGS 2CLFB 3PC8C 3H05A 2Q3BA 4EUHA 2P5YA 3WMEA 5JMPA 2AI3A 1Z7WA 3RD5A 1DIGA 3OBBA 3AUUA 1T8YA 5C8XA 4CF5A 3HP7A 4F92B 1E64A 4CIWA 3I62A 3TEFA 1EEXB 1Y63A 4FCCA 4XSHA 3W6UA 2QBYA 1SWVA 1ML3A 2BCJQ 1PYGA 2Y1CA 1LDEA 1XTUA 5LP1A 5E7MA 2GMWA 4EJFA 2AF3C 4HPJB 4LF8B 4XSVA 1J0EA 1E94E 2GK3A 3A6LA 2R1VB 3KPWA 1FXUA 4N01A 3VU9A 3ICVA 4ERNA 5EZYF 1DRWA 2IXGA 3DVLA 2V7UA 1II0A 1KMHB 2AFIE 1A4XA 3Q12A 4LJAA 3NB0A 2PUHA 4FGSA 3RTCA 1UM8A 3AB7A 4EX7A 1IN5A 1XRNA 2D74A 2VNAA 3C3XA 3OAAD 3D59A 4P4NA 1WSDA 4PYQA 1JDBB 3V7UA 3VC2A 5AW0A 4JJZA 3GVIA 2PHZA 1W5AA 3ETDA 5JBIA 2ZUCA 3VH4A 2FN3A 1QHGA 2V0CA 4RVSA 4Y1RA 2BKUA 3VOSA 4G81A 4R2XA 4L22A 3SYMA 1T6XA 3WJ1A 2ADMA 1G6OA 3CUYA 1W5FA 4GZ6A 3H4VA 2GZ1A 1W34A 2RBKA 5EMNA 1RPZA 4KIFA 2GSDA 1XZIA 5AKYA 2RAFA 1XZLA 3KSDO 1K4KA 3OZBA 4PNZA 1DIBA 3OCJA 1APBA 2EJVA 3C8UA 3KJQA 4F86A 1NLYA 2LPMA 3NWOA 4OHRA 1D9XA 1SOUA 5BXYA 3USES 1YRWA 1A0OA 5U4QA 3AEKA 1E1QD 3MWFA 4CM4A 4E0BA 3JRWA 1PDOA 5A3JA 1CR6A 1T0HB 1A8IA 1I30A 5H80A 4TWBA 5LOVF 4OI0A 3FNGA 1U3CA 2W2OA 3WP0A 3MT0A 5LM3A 3L92A 2HBRA 1QDLB 4M9QA 2AVNA 5FTKA 2Q3EA 4GM4A 4QXAA 2G0AA 4GVLA 2GD6A 4MB2A 4DA4A 3K8QA 3PQFA 2EZTA 1MAWA 3PDIA 5A3RA 2CNOA 2ZUEA 2P6MA 1QHHA 3JD3A 3VU9B 5BN4A 2OORC 2WWXA 3QOWA 4NV0A 3CUKA 3FCUB 2GARA 2RMKA 3BD7A 3D3WA 3E5NA 3E9YA 3G8BA 2MWMA 3IPAA 3FCYA 1P7ZA 4QRDA 1E3LA 2VP4A 1PP4A 3TNJA 5LKAA 2VK1A 5DN6A 2XF8A 3F8WA 3C3CA 1XRSB 3PCRB 4JVLA 3EXFA 1BEEA 1H9BA 2BN4A 3CINA 4MW2A 3THRA 4RORA 4PFQA 3AUSA 4DJFC 2PQ0A 5JWHA 3HJFA 3AFHA 4M54A 1ZVJA 1KI6A 5FB3A 5KHAA 3AKYA 3N0XA 4Y1RB 1ZMOA 1JIQA 2Y0CA 3ANYB 4GOOD 3L1UA 4J3NA 4WZBE 1T8RA 2KQUA 4ALIA 1EB9A 5LSAA 3NOXA 2QRMA 3D43A 4FNGA 1AQ6A 4HWRA 4JJGA 4W1RA 5AK0A 3OOJA 1DIHA 1SN7A 2H17A 3HMKA 4ZPXA 2CYCA 2JI8A 3WRXC 4Q7MB 3AEKB 1GPNA 3AKEA 4M0CA 4CM4B 5CM8B 1EGQA 3HV2A 5JCOA 1FSZA 3NXSA 4QASA 4YX9A 1C1XA 4NR0A 1ZNXA 3COYA 3U44B 2XA9A 4KO2S 4CFZA 4G97A 4K9PA 5C8YF 5GWXA 2H92A 3T15A 1TA0A 2J6IA 2O2HA 3R7NA 3SPXA 3SZGA 4ALNA 3CN7A 1IBRA 1IXKA 1R0SA 2CZQA 1OFUA 4L4RA 1XHFA 2O3SA 1ARZA 2QHXA 2NO7A 2VF2A 1C3OB 1EXMA 2NZ2A 3PFWO 4JC0A 2FXVA 2O5VA 1A2BA 3QEMA 4FMPA 4GS5A 2WNSA 5TR9A 2XHZA 5FOQA 3PDIB 4P82A 4TXHA 2BTQA 1DBWA 4ICIA 2P3SA 2XQFA 2YJTD 5BN4B 1CEYA 3NW9A 4M98A 1GTRA 1X2EA 4DG8A 2XCLA 3D3WB 9LDBA 5KJEA 3VHLB 4J4BA 1Z2AA 1CS0A 2IY7A 2NSLA 2RCYA 3IUYA 4FLFA 2ATEA 4PGMA 1GPH1 1R0ZA 1ULHA 5I9MA 3FR8A 3HNOA 3GLHA 3DOHA 4ITRC 4BV8A 4LMPA 3DFMA 4UAVA 1P75A 4JQOA 5D86A 1KI6B 3BXFA 5AT1A 5K8CA 2N42A 5FIUA 1GKIA 2EBFX 2QG9A 2HW8A 2ZS9A 2ZRFA 3B9BA 2E4VA 4MKGA 3U13A 4L16A 1FE8A 1QDEA 2PLAA 2M98A 3WQHA 4GYKA 4RWEA 4XCQA 1GPWB 3N2IA 4Y2XA 4G9EA 5IAAA 4AI6A 2XRYA 4CF6A 2ODBA 5J43A 4L76A 2HQOA 2RGBA 1UEJA 2CLIB 4QFCA 3O2QB 1OXKB 3QQ5A 4KOAA 3I9MA 1K8YB 4CCWA 1QAOA 1YCDA 3N07A 4D0SA 3OTGA 4X3OA 3ZNNA 4QIHA 2FSVC 1C1XB 2ZZKA 4YRSA 1M1YE 5BV8A 1N57A 4KTVE 1UKBA 5E6RA 5J47A 2IYWA 4MMXB 3WAGA 1OV4A 3RVBA 1B0PA 3OA2A 3FE2A 4RL4A 1LBQA 2IE0A 5F76A 2O2JA 3DZJA 2ENUA 3A25A 3KJFA 4AO8A 4XOUA 3WYEA 2GBIA 1TF5A 1Z33A 4JKIA 3ELWA 3FSGA 3QEMB 5HMMA 2GPBA 2FWAA 4I4TF 4RHCA 5ADHA 1K1EA 2BTQB 4ENSA 3P0EA 3QMMA 1PJCA 1GL3A 2IHKA 4DNXA 2X6QA 4BJ1A 4UW9A 5IS2A 2Z4RA 3EDOA 4O2LA 5E1BA 5LQRA 1I14A 4GGMX 2JBAA 3ZDCA 4RQAA 4OK6A 3M3DA 3Q85A 1S3GA 1CS0B 1SUPA 3KNZA 1EKXA 2VZ9A 4FWBA 2OBMA 3RS8A 3P45A 3VVMA 2CXUA 1JI0A 4UQPA 4OHBA 4QDJA 1GAXA 1LC3A 1MJHA 5JV5A 2PA3A 1GTJ1 3ONEA 2HCFA 3WIBA 1X3SA 3AUAA 1UJMA 2PWYA 1Z36A 3FFXA 1OIVA 3G82C 3KELA 4IFBA 4M8SA 1AN9A 1LU9A 2BFMA 1B8OA 2JLAA 4V39A 3OQVA 2J0EA 3C8ZA 2XVXA 2ZIXA 3HYNA 3Q9LA 1J5XA 4N65A 2QA5A 2JFVA 2SKDA 3HI6A 5HMLA 5INTA 1HTTA 1SOWA 1RKUA 2GYYA 2C54A 2Z2XA 2DMRA 3GMDA 4RS4A 5G0SA 1NOKA 1A2QA 5HFJA 3WKEA 3FSGD 3D8HA 2YNMA 4EYOA 4ZOCA 2J87A 3O90A 2ZW9A 2DFPA 3K73O 4MK4A 2DPLA 2HO4A 4CRWB 3K31A 4BGUA 1YKSA 3QENA 1Q0LA 4HQLA 2D59A 1YL7A 2JKYA 2Q5JA 1RBZA 5SYAA 2JIPA 4LGVA 3HMQA 5E6RB 1CQIB 3B78A 3CX3A 1Z6XA 2AFVA 3U7JA 3PRYA 4MV0A 4BLSA 3KQKA 2JEOA 1M1NB 2G0TA 1MUUA 3BBLA 2PBRA 2TMKA 2VA9A 3BC1A 4FKZA 1IZ7A 5TSDA 4EYKA 3CEAA 1MO5A 2O2EA 3ZV7A 2H7CA 1VPEA 2H5IA 1L5NA 1KY4A 2PUDA 1R8JA 3T4PA 4AY3A 2FUNB 1OUMA 1LQTA 2QN3A 3D5EA 1CDZA 2IEBA 4Y9UA 2ZCVA 4C0XA 1M8JA 3DE4X 3GGDA 5LZ8A 1ZC4A 1ZRMA 1RMQA 3UFXA 1IN4A 4WA7A 1W36D 3RUIA 2JBAB 4WESA 1V1JA 4DQKA 4AO6A 3L4JA 1B2RA 2W2VA 2AN4A 3R3UA 4ZK2A 2GXSA 3PXXA 2FPLA 3MMXA 4O4JA 2XAUA 2WMDA 4Q1AA 3F6EX 2C2WA 2YNMD 3Q3VA 3ZTWA 3A2LA 3FTPA 3V4RA 3NYQA 3LYLA 4UVGA 3DSRA 4P7JA 2ZULA 5AW2A 1JXMA 2EZUA 2ID7A 3NTUA 3L0CA 4QYXA 4CEHA 2WU3A 2GJKA 4PYOA 1XRPA 3GAAA 5E8JA 5DH9A 4XQEA 1W36B 1G2PA 1P1CA 1SB9A 3PX3A 4F4IA 3GO4A 3QLUC 1NI4A 3KZOA 3ET4A 4O4IA 4DM7A 4N6OA 4ZMBA 5JNUA 5CU7A 2PTHA 4IVRA 4BRSA 2CWWA 4YRKA 3VAYA 4V03A 3H2IA 4J2OA 2OCXA 2QAGA 2DJ5A 1NL3A 1NDUA 3C5WP 3QEJA 4MLZA 2WB2A 1YUNA 2A33A 2W6ZA 1F9EA 3QTTA 3UM9A 1SBYA 5DGDA 4ANFA 4KKVA 1S6YA 3QUAA 4F8EA 4ND6A 2PGIA 3BORA 2R7AA 2OSBA 3FRHA 3NHLA 3S8MA 2XYQA 4EVQA 5IMSA 2QKYA 3C7CB 1TGVA 5DMXA 2X8LA 4D3FA 2YBEA 1I2ZA 2X86A 1J21A 2QTGA 3DMPA 4HVLA 4KE6A 3AHDA 4ENVA 1HY3A 4JR2A 4NZZA 1CQPA 1ZG3A 3FLAA 4KO8A 5LZ9A 4BRWA 1JMVA 2AXPA 4RKFA 4O4JB 3IALA 4AG5A 4FFDA 1RRGA 4PZPA 4DLVA 2XE7A 4S1PA 1U3UA 3UCFA 4JBNA 4CMKA 1X15A 2IHVA 4EY7A 2ZT8A 1TFUA 1JJBA 2VT6A 1XU7A 4OY3A 5DVZA 2OQVA 3UANA 4D4IA 2FR8A 3A3OA 5EJMA 1LBSA 1Z0FA 2YXPX 3VNVA 3HI4A 2UYOA 4CEHB 2IHNA 3CTMA 1US8A 3HB4X 1WDWB 4WY8A 3PPYA 1N7IA 2FSUA 4H18A 2KX7A 2QY9A 2X3UA 2OGUA 1J33A 2PLWA 3VX3A 1NI4B 4O4IB 3AC0A 4BQQA 2AQ8A 2NAPA 1E3JA 1KC1A 1NSTA 2VSNA 2EQAA 4GE0A 2WEKA 4NDZA 2I7CA 2L82A 2EGUA 1KRWA 1N8TA 4OJMX 1S01A 3IVRA 1N1DA 2QAGB 2Z9CA 4WCVA 2PZLA 1PDWA 4H1HA 1GCGA 1RVDA 3BWCA 1BFDA 1NHGA 3NBUA 3QFFA 3F90A 3GLFE 3QVGA 1NYLA 4XJTA 4EI8A 1ZI8A 3QGMA 3WWZA 2CYBA 2GASA 4N47A 1BWQA 1HZJA 1P1BA 2ZYAA 4X85A 3W3ZB 3WHIA 3NIFB 4MPDA 1DINA 4QL3A 2UXBB 4ZQHA 4NBUA 3I72A 1DHTA 2F8SA 3M4YA 1GADO 3MIZA 4JT8A 5FI5A 4EGAA 1OH8A 3G9ZA 5L4LA 3NIBA 3L4EA 2WWTA 2VF7A 3CVYA 3I58A 4BXOA 1EZZA 2DFLA 3ECSA 2DWUA 3TJRA 5DOVA 2CHUA 4J7XA 1E3EA 1P9NA 4L3VA 4UTVA 1Y1QA 1FZQA 2C82A 1VL8A 4BNKA 3A1CA 4YREA 3C3JA 4IDBA 2BZSA 3CYFA 3AF5A 4GOXA 3LGSA 1IMJA 4IF4A 1BS9A 4XEUA 2ODQA 1T36A 4OP3A 3PLRA 3LGAA 4M0LA 4UM8B 4EQ6A 5A0TA 4RXMA 1W2GA 3T6KA 1U2TA 5EPEA 1US8B 3W04A 1FP6A 4DQ0A 2BMVA 4XYBA 3UXHA 3X43A 2LCFA 4BQFA 2H0RA 4M9SA 3IURA 4BEJA 2HWWA 1XMVA 3OC6A 1Q15A 1RZ3A 1XG5A 4JL8A 2MOKA 4DCUA 2FDCA 4KYUA 2AMLA 2WFLA 2NAFA 3AHCA 3FAZA 3EBPA 3G02A 4NS1A 4CHTA 2C58A 1I2MA 8ATCA 2MTBA 4JQYA 3VSCA 2R9VA 3ESZA 3S99A 4DANA 3MJTA 4LC0A 3G1UA 3EVAA 3DWFA 4PG6A 1M2NA 1ATIA 1BKSB 1EYZA 3CV3A 2EL7A 3QVGB 1JHYA 4ZCQA 3U4AA 4CCAA 3L46A 1I6KA 1R88A 1TTQB 4L0DA 4KCGA 1WMBA 1EUZA 3UJNA 3DL7A 2WT8A 3H1FA 4G0ZA 2I2DA 4G9GA 4D41A 3QIAA 5K0LA 3NT4A 2ZI3A 4UNRA 2HA7A 3JALB 1TIPA 4LRUA 1JR3E 5AK6A 3C5CA 2W37A 3TMAA 1EXDA 1RHUA 4XTRA 4YRJA 4DBLC 1H2ZA 2GYUA 5J23A 5D7NA 1XVAA 5J63A 1DQSA 1OX4B 2O7SA 3I6QA 1Z07A 1VL2A 1ZH8A 1NBIA 3ZIUA 2ZTSA 5H3LA 2I6SA 4DUGD 3KJGA 1XLWA 4HEHA 4N3NA 2I7DA 4B31A 1T3TA 2HIHA 5J2UA 4R0VA 3FMIA 2J0VA 1JKJA 2IZ1A 2X7HA 4KXFB 4ZHQF 1GRCA 4UJ5A 1H2XA 4MLCA 2ZRCA 3RVRA 16PKA 1ZD9A 3ZPXA 2VJYA 3O03A 4EQ6B 4G1BA 3QEKA 4MIOA 1KPGA 4DJTA 4UDYX 4TT8A 1YVRA 2R86A 4YJHA 4OXKA 3O8CA 3GLHE 1AB5A 3LY9A 4YUZA 2DT8A 2VNKA 2JLRA 5FP0A 4V0RA 1LLUA 4TZ6A 1RQLA 2FMXA 4YJ2A 1NV8A 1TUIA 1XB2A 4TWRA 4F9TA 1FMJA 3Q15C 3FOWA 4GI2A 2HIAA 4GP6A 2ZTHA 2Z5LA 3TCKA 2WFLB 5JJLA 1YIDA 2AEEA 2Z1DA 2OFFA 4IY1A 5KNDA 3ZU6A 2Q1YA 1JDVA 1P62B 4KK4A 3N05A 1ZIXA 3TWOA 4EY4A 4H27A 3B1XA 2HLPA 1R27A 1TJNA 2O2IA 2QX6A 3MS4A 3EEBA 4GZLA 5DMHA 3URMA 5CIYA 5KB3A 4DMLA 1XNQB 1UC8A 5FUWA 1LK7A 4BO9A 5FNZA 5JZ9A 5IDWA 4Z9BA 3TRDA 4DRYA 3OLQA 3AFOA 1BFUA 1BXZA 5K8TA 1EFUA 4RK1A 5ARDA 2WKRA 3GFTA 1QGAA 4UEOA 1HV8A 5DTRA 1Z0KA 1SCUA 3AJRA 4IDAA 5L4NA 4R2MA 1CDEA 1WUTA 4H35A 3NNDA 1ADJA 2V65A 5EHGA 5JXIA 1JIKA 1PJZA 1PR6A 1L4BA 2H1HA 3KK0A 2X8JA 1YRLA 1UDBA 4HF7A 3T5CA 3NYIA 3V8QA 4MKIA 1U3TA 2Q3FA 3O8BA 1Q0RA 3Q7IA 4R01A 3O4JA 2ZU6A 1QIEA 3LX5A 3DFIA 3UAVA 3TE6A 4A8HA 1H8EA 1TEHA 1ZK3A 3VJKA 3RS7A 5BR4A 3SC4A 1GNRA 4ENRA 2XBMA 5KNDD 5C4MA 3OCCA 4L5YA 4LF9B 2HV9A 1ZK0A 4OTZA 4LTDA 4YP9A 3CZ5A 3O1IC 5BPHA 2DKNA 1QYDA 1N5OX 3ZE2B 2B1GA 4PAQA 5K3CA 4YJHB 1ZNQO 4ZGWA 4V1CI 1JH8A 3DOFA 3OFKA 1FFCA 3WGUA 5I7SA 3NRCA 3DQZA 3L7JA 2QUHA 1DAMA 4YJ2B 4X3PA 2R2GA 3TSYA 1NUHA 1BXRA 2PGAA 2R6CA 3B3FA 2XMGA 1M6VA 1JZSA 3O3NB 1U02A 2E1PA 4V38A 2F8TA 3RTEA 2YWBA 5L51A 3PNQA 3ZLJA 2O3RA 3CGWA 1BGXT 1CYDA 1P0QA 4YJGA 2AW5A 3TKYA 2NZ8A 1BGVA 2VOJA 3OCWA 1U7WA 3DZBA 4DLUA 1DJQA 1FBNA 3QTBA 4KSBA 5K3DA 3UAXA 1LNQA 2DF8A 5AJTA 3INTA 2I3ZA 4OIMA 1SCUB 2H06A 1VP3A 4QDOA 4NBWA 4ZVVA 1LSOA 3UTCA 3C8HA 3FPCA 3L9WA 3ZXYA 2EYUA 2X8JB 4DUZB 3UXYA 1FLVA 5AXCA 4ZO6A 2QNIA 4EBBA 1DFHA 2BTEA 1XK6A 3RE1A 2HHJA 4RVUA 1A97A 4I14A 1DZIA 4RSRA 2XNDA 3KQNA 3CO5A 2HA0A 2HH9A 3G0CA 1GQYA 2RGNA 3C97A 4Y2RA 4DQVA 2B5WA 3WIVA 2V4UA 1EFPA 1OCEA 2ZTLA 4LQLA 3S2EA 3E82A 1FDWA 1M0EA 1C8BA 1GO2A 3HCDA 2IHUA 3UHAA 1C8LA 5CGZA 3RUHA 4E5DA 2RHWA 4QPJC 1S96A 4DR7B 1AXGA 3KG2A 2XZTA 4BP9A 2AJDA 3BIXA 3MD0A 3GRYA 3QMPA 4L5JA 4ZREA 3BKWA 3D4IA 4RZ3A 4NBVA 5K3FA 4H16A 1J2UA 1M6VB 1GEEA 1RWNA 1ZD2P 2EL9A 3QKRA 3V8RA 3ABQB 3R3WA 1QYWA 2VPZA 3RS0A 2V5UA 2Z5GA 4LYHA 3UJ7A 2WYWA 1Q1QA 4HWGA 4GUDA 5JUWA 3W9UA 4EG0A 4CGZA 5EA2A 5EZYA 2Q2NA 2WB4A 4NHOA 3IP1A 3EG5A 1DRKA 1FIUA 3UPUA 4I9GA 2ZK7A 1SD2A 1VLHA 2FK7A 2XNDD 1EVJA 1FNSA 4KLAA 2VP2A 4BU1A 4IHJF 2JLUA 3BCSA 5JO9A 4WXPA 3TOSA 3QPAA 4EL0A 4P84A 3O2NA 1MO3A 5EIBC 3BMOA 3IO3A 2Q6KA 3I2GA 1KOJA 4AZTA 4ILEA 2WWYA 3GUUA 2YXBA 3GPLA 5LMUB 3PT9A 2FW7A 2QN6A 3RH0A 4JI0B 3DCYA 2O2GA 3AERB 1VYHA 2C7RA 1R6TA 5ALEA 1G1MA 3LDUA 3AHJA 1MA0A 4B3BA 3K94A 1BE8A 4BWGA 3SHQA 3ZI0A 1VHDA 4JB8A 5HTKA 3RK1A 2B2CA 4PPNA 2VIIA 3PZBA 4C21A 1PNTA 2XB4A 3OZWA 4X63A 1CY8A 4JL5A 4AJLA 1ZQ9A 4Q7JB 3MN1A 4F2DA 3VSAA 2VT2A 2ZEJA 4BU0A 1N9ZA 5KWJA 2I62A 4P58A 4YK7A 1VP9A 2V58A 2VQDA 2CNLA 2ZP1A 3MT7A 2XTMA 4MA0A 4P33A 3TH5A 3WGMA 1C80A 2Q4OA 2PEYA 2I65A 2IUUA 3P0RA 1KK1A 4OU5A 4RSGA 4ZOLF 2AZDA 4LDAA 1O8CA 3IV7A 1XU4A 2WHYA 3DGEC 4KMSA 4KODA 2RJ3A 4M1YA 4CQLB 3U7GA 2WJVA 5K3FB 3M1IA 4FMBB 1S7GA 2N75A 3NNNA 3QKRB 3DBIA 1ADYA 1MO4A 3HJBA 3N2GA 5T4BA 2HMVA 4ND8A 4EGJA 2TYSB 4G4SO 1U1FA 4B3RB 2AKYA 2Q2VA 3DMYA 6Q21A 2KLHA 5CXUA 1I33A 4DEYA 4G5SA 1PNVA 1RKBA 2GBGA 4FYXA 4LXTA 1QLJA 1RHMA 3HR7A 1B6TA 1TLLA 4UXIA 4B0OA 5CX4A 1VL6A 1Q92A 3HGMA 4KRXA 1H42A 2X0KA 3LQKA 3TDMA 1M34E 2VSFA 3LQRA 3NHMA 1EVLA 2Q07A 4NH4A 4RHEA 1U7TA 2FSPA 5GPBA 2HD4A 2QP4A 3QYAA 3BMOB 2PIAA 3JWEA 4FE3A 1P44A 3H1EA 3CE6A 3N8DA 4LXYA 3NAMA 3PGXA 5IHPA 4KQHA 3W2HA 3W2FA 2DB3A 1V43A 3MMPA 3WDSA 1SCDA 4OCZA 3FVWA 3KQTA 5JH7A 5EXDA 1FNNA 1VPLA 4IJWA 5CB4F 1NOIA 5AK4A 1L7VC 3HKDA 3R9WA 1T2FA 1RYEA 2H51A 1G8JA 1SKBA 1OAAA 5EKDA 3L0OA 1JV2B 3PEVA 2CV1A 2EW8A 1W25A 1AZWA 2FRVA 4YAWA 1DC5A 3AIMA 3SR3A 5JS7A 2BDEA 2VJCA 2B35A 1R7RA 3LZDA 1EWKA 1OZGA 3ONFA 2AX4A 3SC6A 5H16A 3ZZMA 2H5LA 4IOMA 3VOBA 4ENTA 5KPJA 1YJBA 2IIBA 1BMFA 2SECE 3IELA 3MA0A 5B55A 5KYUB 4X66B 1P0PA 1CP3A 2HMWA 2WJWA 3AEQB 3N0TA 2FH5B 4FC7A 4MJ3A 1JXAA 1UWVA 3IOCA 1J0BA 4RKQA 2N46A 6AT1A 2D0DA 1F1JA 2E7ZA 3BSFA 2QVYX 2PWPA 3BZWA 1BHSA 2FEWB 3SZMA 1J97A 1XFDA 4PC3A 1M8PA 3BREA 4FFNA 2YWRA 4UHHA 2Q5EA 4QPDA 3MK31 4JB3A 4ND8B 2JAWA 5IBPA 1RW4A 4D6YA 4GOND 5CDFE 5K8LA 1QV9A 1AHNA 1UBLS 1GPBA 3LM8A 3EFOA 4A8JC 2XX3A 1EFAA 4XYEA 4BVHA 4HEQA 1KJNA 4DLBA 1NM5A 4UEJA 3AMVA 3ONDA 4OBWA 5AUNB 1MBZA 3ETGA 1SUAA 3HH8A 4YO8A 1XPRA 4AVYA 3EVBA 2FSFA 3ICQB 5H4HA 3LXUX 4DC9A 4ZEOA 4TQUS 3AT1A 1XAIA 2NMVA 2GXUA 2CD9A 4FEEA 5JQWA 1G60A 4LRQA 3B38A 3RSGA 4L9SA 1VC2A 1ZN7A 1EJ2A 2FEOA 2X1MA 3HXPA 3ZWAA 4YCJA 5AVQA 3QX8A 2IH2A 5JH7B 1H2WA 1OBOA 2FUKA 3DAPA 4QFMA 1SA0A 1MRNA 3D1LA 3L6DA 3UYLA 1G2IA 3CX4A 1K4YA 3HKDB 4PLWA 2F7SA 4ZO8A 5AVJA 3RT7A 3TTSA 2WE7A 2V7PA 4UE6A 1OPXA 3O21A 1UDRA 4E13A 1MORA 4E15A 1FA9A 3M4NA 1NW3A 5JSUA 4X62B 2MSCB 2KSQA 2ZFUA 1FQJA 1UPCA 4FZ3A 5K0JA 3TRJA 3P1JA 4R0MA 5JFGA 4DV5B 2I1WA 4MV7A 2G6BA 3OOYA 2XW6A 5FYQA 1U2PA 2F62A 3KXDA 4B6FA 2N1MA 1CVLA 3HGTA 3IMKA 3PENA 1IUPA 3KYCA 2FN4A 3FTEA 3VR1A 5DXJA 5BT9A 4ARZA 1SKMA 1UIMA 2J0QA 3PDJA 4IH4A 3B9RA 4C06A 5CEFA 5AKXA 1KEEA 2NOAA 2QPOA 4J0GA 2CXQA 5JAIA 1D2GA 2J7PA 4I19A 4TV8A 5G4KB 3BA6A 1YV9A 3EFOB 2PR7A 3MBOA 4WY2A 5CW1A 4CKEB 4YAGA 4Z4FA 5H68A 1GKUB 1PBNA 2ZSKA 2HT6A 4QODA 2O19A 1MQ8B 5KQRA 3P9RA 5A6VA 3EHDA 4FWTA 1FL9A 1NG1A 1C8KA 1SR8A 2BF4A 2G88A 4GAEA 5A3VA 3FZEA 1L4UA 3F5SA 5EE0A 2J5RA 4OLJA 3FHLA 3HO8A 5BQPA 5CP8A 1WRBA 2I7XA 3M34A 1Q1NA 3U3DA 2ZVPX 3DMNA 1KU6A 1N1MA 4JYCA 4CR6A 1ENYA 1IXSB 4K8OA 4DV6B 2WU1A 1JJFA 3QPUA 4XB2A 1SA0B 2WT4A 3FYHA 1XNRB 5AOAA 5JI3E 3IDQA 5KOJA 1WJGA 2BKXA 1K8XB 1ODKA 3LL4A 3RKSA 4DNQA 4FSXA 2QG6A 4I8DA 4ZMRA 1VLLA 2G9VA 3IIEA 3CZ9A 1J8YF 3IDSA 2AE2A 1Q6ZA 3QFTA 2F9LA 4P5DA 1I94B 2B9EA 1OI3A 1RXYA 2GAOA 2GCOA 3ZCPA 5CT6A 2CYAA 1FVOA 1RLOA 2NTVA 1SM4A 5TPWA 4WCFB 2YUTA 4DDKA 1KR2A 3OKPA 4BE7B 4HNSA 4YJDA 5IDVA 1TQ2A 1IAVA 1T4BA 1VSVA 2R1TA 2GLXA 4WK2B 1XCPA 4QELA 4IJ6A 3ZBQA 1I24A 5TY0A 1M2FA 3EVNA 3KYCB 4HYEA 1SOMA 2FMKA 4XXHA 3RIEA 1E2LA 2PTGA 5LYJA 4ARZB 2FHPA 2GBFA 3N5CA 1H2EA 4N0DA 4P3YA 2ZUDA 1KEEB 5CNKA 2JBWA 4YXFA 1O9GA 4C6TA 1L1RA 2ZI7A 1AKNA 4Z3OA 2ZUSA 4TV8B 2PRKA 4REMA 2B4YA 4BNJA 5CYPA 3TNLA 3D6UA 2ZSFA 4H4DA 1SBQA 3BA1A 4WBNB 1DKLA 1KAEA 4NIMA 1FDUA 5DV9A 2OAP1 1TKRA 1DC8A 1JIVA 1OYWA 2QENA 1CJBA 3LPCA 3OCVA 1DT5A 5E9WA 4L07A 3ZTTA 3O4HA 5FTMA 3ELYA 4E08A 3ESAA 4R2WA 4X1YA 4BMNA 2OBLA 2ZYVX 4QYWA 4M8LA 4Q18A 1LRLA 3HRHA 1QR2A 2YYZA 3CF4A 4J9UE 4OMCA 4DW8A 5TGZA 3HB0A 3H2KA 5KOJB 4Q4JA 1G9XA 4HN9A 4QJBA 1CUZA 1A8UA 2QL5A 3TEJA 4FS3A 4BC1A 2HF9A 1CWUA 3NVMB 1RHQA 2LVBA 1U3WA 2C97A 2LUOA 3A0UA 1SXJE 3KVNA 4MMZB 1D0VA 1TM5E 2GCOB 4TMYA 1GQFA 5IJ0A 3KT0A 4HQNA 2UZAA 5EJ4A 1GLNA 4ZCRA 4WZ6A 3U48A 4QU5A 4KW7A 1AKRA 4ZV9A 2HUPA 3QVWA 4UDNA 3TLJA 3VNAA 4JLSA 2R1TB 1EQAA 1UWLA 3I4FA 3UOWA 2B8NA 2FW6A 1EFKA 1GU7A 1CUIA 1HQCA 2XCQA 3L9XA 4E2FA 4YAKA 5EJ6A 3SBEA 4F06A 1MCZA 5MN6A 3L7CA 5SZJA 5ALQA 4JLOA 3MYYA 3G8CA 3QV1A 1KDRA 4ED9A 4X64B 3U60B 2Y1LA 3KQWA 1E62A 1WOYA 2QW8A 4AZWA 4B7CA 4C6TB 4QKQA 2DLCX 3QVXA 1PG0A 4P6VF 1X42A 4PQFA 1N6LA 5A62A 3IT1A 3D7RA 2VI5A 2P75A 1MEEA 3RM3A 1L7PA 3TW6A 1OFIA 2XMPA 3MYRA 5ALMA 1PR9A 5K6AC 3FY4A 3T1YB 3QW4B 3RQSA 1SC6A 3G5AA 3PCTA 1VBKA 4KR9A 2D00A 3TIVA 2VPPA 4NECA 3ORQA 3TINA 2WIAA 4NBRA 3VNSA 4EUKA 4F2PA 3KDAA 2VAWA 1KYXA 2Z3ZA 2JJYA 3HU1A 4ZVTA 4RD6A 5ALVA 3UWSA 1CF2O 4DC1A 2XOXA 4PXYA 3SR0A 2IDZA 5A5GA 3MJHA 2IIQA 3HZZA 1LDBA 4WWHA 3ZGOA 4O4HA 1GSAA 2V5AA 4Q4JB 3WJ2A 5KHOC 4RTNA 2A6PA 1K66A 2O6HA 4FZRA 1EWRA 1QIGA 2F4NA 2CE2X 2WG2A 2VJQA 2ZYUX 1P0FA 1ZM3A 3MJCA 1H5NA 4G24A 5DXAA 5HQ3A 4FK8A 3F9RA 3N2YA 4DCPA 1JBKA 1F3OA 5IJ0B 2ZRLA 5K20A 3E2MA 4K6MA 3U4QA 1JAZA 5JZVA 1DX6A 1P5JA 1JZTA 4IXMA 2PH3A 3WHKA 4B9EA 1YBFA 5LB4A 4J7UA 4HFRA 5DKFA 4O8ZA 3IE0A 4KX3A 421PA 3H3XA 1XOIA 3K1ZA 2H5JA 4HWTA 2FPMA 4KR3A 1LJ8A 2CUZA 3CHYA 1Z8HA 3NDJA 4KQFA 1BWRA 4B40A 5I4BA 3B6MA 4WKOA 5B37A 4BUJA 3T1TA 1YIOA 3CF2A 4IOKA 2GN2A 1G5QA 4EVSA 4L50A 2CBXA 2XE4A 6REQB 2MSEB 2GVZC 5LLSA 1I7DA 2O8DA 1J00A 1E5DA 3OHMA 1JI3A 4RPIA 5KSOA 1INLA 3QTLA 2P90A 3ITEA 4TTVA 1KI9A 4AUEA 1QO0D 1WPRA 4U0KA 3RYHA 4HDCA 3ZXIA 4AURA 4J29A 1RKQA 2QLTA 1XAJA 1H3NA 2OUIA 3BIOA 1ZC3A 3OJLA 2VF4X 4R2LA 2GX6A 4YALA 4AS3A 2Q6VA 2X5NA 3TQTA 1J24A 4PN3A 3RSOA 2ZXUA 3EIWA 3JQBC 1JA9A 4M0DA 4GP9A 5FAKA 1I2BA 1RNLA 4OXRA 1OHHA 3NO4A 1CUHA 5MFZA 1ODSA 2QTVA 4N0MA 4URYR 3W5SA 1U7XA 2FFHA 4O4HB 5HZKA 2IXDA 1M5UA 1Z4KA 2G72A 2O9JA 3OEHA 4YB8A 2KLBA 3DAFA 3O4RA 4N7RA 1GGJA 4PWZA 2P78A 5A7HA 1WXIA 1WUHS 1NN0A 2DQSA 2GZHA 4GXRA 3RABA 3T99A 3OIFA 7YASA 1N2CB 1S02A 2EX0A 3GRKA 3ZHVA 3U4QB 1O94C 1YWGO 3GFVA 1NYTA 1NASA 3AX6A 4K7JA 3PGKA 2W6QA 4EDFA 2X0DA 2C2GA 2JFNA 2ZR9A 3SZRA 2H8GA 2ZSHA 2IEDA 1C1HA 3FMOB 4JUFA 4BAUA 5J5AA 4BNDA 1SUCA 4MCJA 1Q7EA 4NYIR 1G0OA 2GEVA 4N54A 3J7TA 4B5KA 8ABPA 1IAQA 5D7BA 2VYQA 4YCLA 1YR8A 3GLIA 3LWBA 4X7RA 3WIEA 5F12A 4A6EA 2YX1A 3C45A 1JDSA 3LBNA 4YS6A 4D7AA 4DV4B 3L0ZA 1R2QA 4R1PA 2NV6A 2DLNA 3S2FA 1S2LA 3HA7A 4E7PA 2ZRBA 3R75A 3K09C 1TVKB 3RRZA 2O8DB 1K3TA 3NBMA 4GLLA 4B34A 2PBZA 2R2AA 4EATA 1SHLA 2CUKA 3OEHD 1QTRA 1YIAA 1DAHA 4C4RA 4AKSA 2ZZNA 3QFHA 1MMFB 1NBOA 4U9IS 3RT1A 3TAUA 3TCNA 4YYEA 3RYHB 1IATA 2FLKA 1J99A 2XMRA 2NM0A 3J81A 2YS6A 1A4RA 2ZSDA 4EFLA 1DUSA 1LW7A 2FPSA 3HVKA 1DWUA 2DBQA 1U9ZA 3KB1A 4L02A 4EO4A 2DZDA 1IYZA 4GLBA 4Z86A 4L5IA 1CY1A 2LBPA 3P27A 2XEXA 4HDAA 4UHDA 3C7DB 2EJWA 2JGLA 1RQGA 2YASA 1NXTA 2HGZA 3CG4A 4Q21A 3UYKA 2WTBA 1Z5WA 2PXHA 2ZAOA 1KAGA 3KJEA 3QV2A 5JW6A 5TARA 1N2ZA 4KUHA 5AHRA 4XDYA 5AVVA 2QWXA 3QBTA 5KWSA 3JYOA 5F64A 1L5ZA 2W6IA 2NZJA 2JD2A 4ND7A 4UE3S 3FVRA 4MGZR 4POAA 1U8CB 3S70A 4BGEA 2Q7OE 1GQQA 1T2EA 3B6JA 1R0YA 3CRNA 2QLLA 4B8WA 4L4UA 3GCDA 5FBHA 4KGDA 4B17A 3S7TA 1EGMB 4IM7A 4BNDB 1JTEA 5JTTA 2LGJA 4JHLA 4CUZA 1EWVA 1T9AA 5CH8A 3IEVA 2O5RA 1Q7CA 1N4AA 5EIXA 5G3YA 4IQ4A 1TIKA 2WYVA 4BMDA 3GLIB 1Z5ZA 3TOVA 3PGA1 2ORIA 1E89A 1ODJA 4L8YA 5H9WA 3CUSA 2VJDA 3HG7A 1ULZA 3MC1A 2HPVA 3EEYA 5EGSA 3W8EA 4KQ9A 1M3SA 1YRAA 2VK2A 3OJ0A 2BHRA 3OZSA 4O6VA 1Z7YA 4OAQA 1U0RA 1ZWKA 2DKFA 2B1RA 4FX5A 5CRIA 3T06B 3WGNA 6PFKA 3Q8LA 4JLAA 1BROA 4HVAA 1Z75A 2ID8A 1TMGE 3E84A 3I53A 4UOQA 4U39A 5M7EA 1DQPA 1ECLA 1RQPA 1BMDA 3WP1B 1PGQA 4HAZA 3N53A 3ZQJA 1PTKA 4LXGA 3JAMA 3HJHA 3IDAA 5CLIA 5BUCA 4Q15A 4OBEA 3T1OA 4HY3A 2IS6A 3LVRE 3FMVA 3PC8A 1II9A 3GD7A 1YFLA 2QAJA 1FS4A 4CLHA 2JFUA 2ECKA 4XFDA 3I32A 1FZTA 2ZAMA 1MDFA 4OI1A 2I55A 3NASA 1DX9A 5IF9A 3VO8A 4AW9A 1I9GA 3TLXA 1OBFO 4HHEA 1DFIA 3ZN2A 3U19A 1R64A 1WHTA 3DEFA 4Q1DA 4LJ8A 3ELBA 4INJA 1V95A 2B98A 3G8DA 2J59A 2MSWA 2RH9B 2XIJA 2ZAGA 1C4XA 3LLCA 3GDHA 4IDCA 4BLUA 1V4NA 4X65B 3ES9A 1KY5A 2J3MA 1QOZA 4FX2A 1HK7A 3H2GA 3IHKA 1TC2A 2YHIA 1JAYA 3KZXA 4BVJA 2IZOA 3INGA 4IXNA 1K6EA 3BZUA 3IT3A 3Q11A 1K9SA 4R2JA 5KO2A 5IBCA 4GYJA 1IG0A 2J9ZB 3HJCA 1L7EA 1PR2A 2PYIA 2QNBA 5CH3A 5HOQA 5J58A 5L3VA 1T9DA 4N5DA 3PQ3A 1ISRA 2A30A 2KW5A 1CJMA 5TQ0A 3ZCTA 2PNFA 2Z3WA 4QUKA 4RQUA 1AY0A 4QARA 5TDHA 4ZQBA 4BO1A 2XRFA 3QJGA 2JZCA 4MV9A 5KMGA 1MW8X 3OF2A 4MGIR 1W8DA 1NF3A 2CJXA 1YDMA 1PIWA 3C3KA 3DM5A 3FNEA 4IBOA 3DLAA 4OB8A 4G36A 5JANA 3E2IA 3IGFA 3MJ4A 1HDGO 3VH1A 3MOIA 2WWVD 1B1AA 4MB0A 3SVZA 2OZKA 2G1AA 2VRNA 3STUA 1JPNA 5BP7A 5HRCA 2O6LA 3IHWA 4Q66C 1QQAA 2AFHE 4CKWA 2JFFA 3HCOA 1NI5A 3O3OB 4YDQA 4FJ0A 1EI9A 1WMFA 1K08A 1Y1KE 1I4TD 1KDPA 2W6OA 1PD1A 3A31A 1V1RA 3FFWA 1CNMA 3HN6A 2LTAA 2NXNA 3LG2A 4WERA 4Y98A 1ORHA 4EKEA 5BWLA 4NV3A 3GP8A 2GTHA 2Y4OA 1OLOA 4CJXA 1JFLA 5BR8B 1IY0A 4FSHA 3X2EA 2QTTA 1KJQA 2YR0A 3KAJA 3SFVA 4FGWA 4BMPB 2HM7A 4OVKA 3GNQA 1WHTB 1KSHA 1SUWA 1OYYA 4A0SA 4D4KA 1JIIA 4R1OA 4Z4EA 1L5OA 1NRWA 2EHJA 1PF7E 2HSJA 2W98A 2W83A 3A4LA 4OQFA 1N4DA 4X60A 3KBOA 4DR5B 3OI7A 3USCS 3M6UA 1UMDA 4LECA 3D3EA 4RL6A 5EZ5A 2IIPA 2NSYA 3W3AH 1SOVA 5BSRA 4RNDB 2OORA 1QHXA 4RU1A 4ZRMA 3UN1A 3X1KA 3JQDA 3Q2IA 3ZD9A 3AXSA 1N9GA 1JIXA 1C9YA 1XZGA 3KKKA 1K8ZB 2V74B 4I50F 4UPDA 4EF4A 3HTXA 1Y98A 4BDSA 1EP2B 2AJ8A 4RVHA 3GBSA 5G41A 5H0IA 4LCJA 3KE8A 1FSSA 2E89A 3RHTA 3ZD7A 2YXNA 1DPFA 3C15C 3HR8A 3TQSA 1IZ0A 1TZBA 4E6PA 4G5GA 5DYIA 5CJJA 4JI2B 1CQZA 3IP8A 3N8GA 1DAPA 1NX6A 1SVSA 3NANA 1RCTE 1P5HA 2F8MA 4P53A 1HE5A 5FOXA 4R8MA 3TL3A 2X9NA 3WFJA 3B2NA 3TRFA 3PL5A 5FKJA 3ZE0B 3A6GA 1B74A 4BCCA 1OY1A 5L3RA 3KV1A 1BCSB 4CKWB 5EXTA 3BB4A 1X7HA 3RNLA 1PJRA 3WRXA 1MFZA 2FP4A 2QD4A 1V1RB 3VNBA 3BULA 4CV3A 4EA8A 3AVYA 5EIOA 2C04A 4YCBA 4KO1S 2BR4A 1J2EA 4V0NA 3HB7A 3INYA 1GUDA 1U9IC 2W90A 4RMIA 3SQWA 5BNFA 1RQ7A 2BEWB 4TTPA 5AK5A 5FUMA 3GY0A 3SHTA 5T4FA 4YIKA 4OA8A 4D26A 4P3PA 1AGPA 3DF7A 3NJRA 1K27A 4UARA 4F3RA 2DFNA 2Y0EA 2Z9BA 1UMDB 1VRCA 3RT9A 5BWNA 1XP5A 1P8JA 2IDJA 5D5HA 2OO3A 2EP7A 1DOZA 4IQ8A 3RVMA 5FUBA 3A4YA 4PSUA 4MB6A 1NOJA 2JIQA 1N9GB 3HRKA 1CQWA 1VLZA 4HLUC 1W85A 2J5KA 4RMHA 1J8VA 1PEYA 2C31A 7MDHA 5EINA 4D80A 2Z1NA 4L9WA 1BHQ1 3D54D 4UBKA 5DCYA 4XWWA 1G98A 1V16A 4YCNA 2MYUA 2JIZD 5KYNA 1GCOA 3GLSA 4NKRA 1F48A 5FTJA 1DG9A 1OXXK 3TSOA 2R97A 3MB8A 4IR7A 1ISMA 3PGLA 1FNCA 3LUCA 4D5EA 5JD4A 3X1ZA 1JB1A 2PZMA 2D7JA 4XLTA 1UEXC 2Z57A 2ZIWB 3BFXA 2PAAA 1YBHA 2F3TA 3DZ8A 3HJNA 3HA2A 3NIDB 1GYRA 4OQLA 4HNQA 2ZUWA 1JYSA 3OQHA 2YY7A 1TCAA 2X40A 2HPAA 2XRMA 5E3IA 2P4EA 4ER7A 1J9EA 1K7XB 5F2KA 1ZUHA 1NTRA 3CLKA 3OU6A 4RHFA 4UTZA 3TD9A 2QGZA 2Q46A 2FP4B 4CMCA 2G5PA 2BF7A 2NACA 1WXXA 1XRLA 1RE1A 4FJ1A 1KYQA 4Q03A 4YLEA 4W9MC 2FSVA 2H4WA 1MB2A 1SZCA 4G0XA 4RD0A 1H9AA 2BM9A 4RHXA 1EK2A 2X0IA 3D0OA 3KOMA 4HWSA 4IDGA 4KBYA 3TPZA 721PA 1C7FA 2WICA 2QUKA 2WIGA 3AOGA 5GJCA 2ZB7A 4ALLA 5KOYA 5KZMB 3C6MA 4Y1EA 5LPNA 4R83A 4CKBA 3A3NA 5CBKA 1H0SA 1NBHA 2ZJ3A 2VDWA 5DHAA 1UBJS 1SBTA 3MXTA 3D7LA 5IYZF 5T5QA 1JDPA 3BJRA 1W96A 4NXMB 5TGTA 3Q87B 3X1MA 3SC2A 4QAJA 5J1SB 1K86A 4LGCA 4QG7A 4KLRA 2VHTA 4LXUA 3QMVA 3LCCA 1ODCA 3MJSA 4F4CA 4RSHA 5HIIA 1YTUA 4ZT2A 4ZCLA 4Z4QA 3V3TA 4AY5A 4HX2A 3A1DA 1HOTA 3PC7A 4MAFA 2IQIA 1V16B 2YWFA 3GFRA 4PG7A 2J6CA 4CU2A 3FNBA 3QE2A 3N6VA 1EUCA 3C7AA 3HWWA 2XLBA 1A9YA 1XTPA 2HI0A 1YHZA 4MUJA 1PVDA 1XCJA 4L5AA 2IYOA 4Q47A 1AUPA 1LSUA 2N9UA 2DBVO 4TKZA 3VKVA 1EVIA 2GA9A 4C89A 1Z3CA 2OHVA 4BFYA 2ECPA 1PU2A 3R3HA 3I9FA 1Y7HA 3BHMA 2XDAA 3D1VA 1W8IA 1TEVA 2P5UA 4FR5A 2WZDA 3GVHA 3HEAA 1GZ7A 3OECA 4JLJA 4LYJA 3A70A 5EYPA 3A1UA 4IMJB 4DF3A 4ZI3A 4YNBA 1QOPB 2LWIA 3LUHA 4AF6A 1U8UA 1JG3A 3L7NA 4XDZA 1NLUA 3GYGA 3NM5A 5L7TA 5KS2A 1J25A 1V6AA 2W6NA 2HHHB 1YRHA 1MZPA 2BFNA 4E3ZA 2W58A 1IHPA 4G41A 4HB3A 1Z6PA 1CJUC 5FR2A 4LCBA 1RJDA 2B20A 2HV8A 5E6SB 3VR6H 2FYTA 3PVCA 1QV6A 1ZUD1 3LHIA 4XB1A 1WTAA 5MGNA 4RLFA 3R5SA 2QZJA 3OH8A 4RIHA 1E1MA 1UBSB 2PANA 4R2KA 3U1VA 3DKRA 1Z16A 3EEIA 1BAPA 2Z8YA 1S2DA 1TTPB 1QNFA 4U2CA 1WNTA 1RAEA 1JR2A 2XMSA 2R4TA 3G9UA 4GKKB 1V7CA 2VDWB 2DYKA 4E2WA 4FFWA 2HDNB 1ZCAA 1ZM7A 1HL3A 2ANBA 1QH9A 2DWOA 2VJKA 4M99A 3ZK8A 4FMDB 3LCUA 1R18A 1QP8A 3PWZA 4HGNA 1VJDA 3SC2B 1Q11A 3HXKA 2XQKA 2QM7A 2RHHA 3U26A 1SZJG 2JVKA 2QQEA 2QPTA 3JCZA 4YAEA 4PSAA 4E4YA 1H6CA 4KSYA 2ACEA 3LHKA 1XTBA 3EIOA 1EUCB 1JHDA 2J9XB 4Y6OA 2I6TA 4M9ZA 1M9NA 1EX1A 3HSSA 3HU3A 1Q0SA 4P36A 4LZPA 2NVOA 4JWTA 4XDHA 5I9SA 3RSCA 4IG9A 3U3ZA 2BPOA 1PGOA 1X1BA 1RRMA 4R9NA 4HUTA 3GRZA 4LHSA 2PZ8A 3W6NA 4FFBA 1OKKA 5REQA 2FUEA 3X2FA 1SD1A 2HXSA 3CNEA 3HEBA 3RIXA 1U63A 4WK4B 5JJIA 1T6YA 3QLUA 4DRXA 2ZRHA 3NDRA 4DA9A 4YAIA 3A3KA 1EFRD 3ESYA 3F6CA 5F78A 3QG1A 1KGDA 4E94A 1LI5A 4WA8A 4LF4B 5ER6A 1CB7A 3HPRA 3O4FA 1T24A 5BSVA 2QTHA 5C4IA 1L1QA 3AR3A 4J1SA 3O7WA 3VZQA 1O4VA 3SSMA 3QVJA 2AOUA 2IL1A 2A0UA 1NE2A 5BOVA 4B85A 3NTRA 4B2PA 2WRZA 3H9CA 3OTHA 1ZMRA 4YR9A 2V7GA 2YMLA 3G5LA 2ZWOA 1OXVA 1ZOIA 3B82A 3IVCA 3P0HA 1FLAA 1VA5A 5EIWA 2IFTA 2J30A 3UJHA 3USZA 4TL8A 1BJKA 1E9CA 4LHYA 3SF0A 2AHRA 1AUOA 1X7GA 2OZEA 2Z04A 1IJFA 2DPMA 3L0YA 4PNEA 4NARA 3AI2A 4OOFA 2HCRA 4WX2B 2H9IA 4IW3B 4UHEA 2WG0A 4Z49A 2Y05A 1Z4QA 4RVGA 2C3PA 2OY0A 1E9SA 3MJFA 1TD9A 3T35A 1JALA 3RKUA 3X1JA 2IYSA 4F5ZA 3VR3A 2FHSA 1MX5A 3EBLA 4LYFA 3ZDBA 1N5RA 3KTFA 2W11A 3CURA 4XUGB 2ISCA 4A16A 3I3SR 2GKSA 4LN1A 3OFVA 3H0EA 3PL1A 4WNIA 1EXNA 2Q9CA 4IFTA 2YV2A 1NNSA 1KJZA 4FFBB 5REQB 5IZ4A 1YZFA 3TECE 2P79A 3KVYA 3O4IA 5L4SA 2PMKA 5EHIA 2I54A 3N74A 4FE7A 4DRXB 2CDRA 1UDXA 4AQ7A 1OWOA 4HNTA 5AO9A 4R54A 4Z51A 2C78A 3T1VA 3EWAA 1DC6A 5IBRA 4NMMA 5DWDA 1QP0A 4PPGA 1QAQA 2FWJA 3HS3A 3KEOA 1SU4A 1SCAA 3CZPA 1BN7A 3GWGA 2O0HA 2A67A 1ABEA 2F1IA 4ZVKA 3CF0A 5CHEA 1EWQA 2B34A 3L0DA 2NYUA 3RLIA 4EUSA 2X9VA 3R0ZA 2OEPA 3RG2A 2HWXA 3VO2A 4GL2A 5KDLA 5CYGA 2CV0A 2TS1A 1VZ3A 2QJOA 3BGOS 4MV8A 1X1DA 2L18A 2CJYA 2G9NA 4AG3A 4D4GA 1E59A 1QHFA 4MINA 4R16A 3NP7A 1CRWG 2AK2A 3H3FA 3KJZA 3B2QA 2BWJA 3BAZA 4TMTA 2XRZA 3H83A 1X94A 2SCUA 3PNSA 3V4LA 4TVBA 1ZGGA 1W9MA 1JEYB 4YRIA 3ORSA 4G84A 4RTRA 1NMSA 1X38A 4FHGA 4UKDA 5IJ9B 2X8AA 4C1BA 4IGEA 2ETXA 3EAFA 4L0CA 4R6WA 1AK2A 4I1VA 3TZQA 4B7XA 5IDYA 1Z47A 3OT1B 1U11A 3I9NA 2GFQA 3I6ZA 5FORA 1T1SA 3RJTA 3WYNA 4BFZA 4XZ3A 4WXHA 1AA6A 1THMA 2DPHA 5CFPA 4CETA 3M4ZA 2Z1MA 4MZDA 3WS7A 1WMDA 1OIXA 1FFYA 3GT3A 3ZUGA 3WC4A 1XELA 3HYTA 4HBGA 4IHQA 4OQDA 4W8OA 4B6JA 1R00A 4Z5XA 1FUYB 3EFEA 2WJZB 3L77A 3PNBA 4QT0A 1YL6A 3T7JA 4MWZA 3TB4A 3AF3A 1BGWA 1RPTA 3KT8A 1DJLA 1P9OA 4ZVUA 4DDMA 3BWMA 2P7HA 2ZYHA 1UDAA 2J67A 3OZRA 2ZSUA 2X13A 2R68A 4G0MA 4WKNA 2PM8A 3BMCA 4LTMA 5A7GA 5NULA 4IMPA 2XDWA 2RB4A 3T52A 1ML4A 2VWHA 2VAXA 4RKYA 4R9RA 3F5DA 1DPGA 1BWSA 3W05A 4BLOA 2C4HA 2AOTA 1CUXA 1KOFA 2XADA 3H9QA 1G21E 5IAEA 3W78A 4A4DA 4U02A 1B7GO 4GX5A 4G4SP 2YH2A 2GEBA 2Z6VA 2ZJBA 3EH2A 3P9SA 3KWJA 2QE7A 2E55A 5DM0A 2SCUB 3D6HA 3GCXA 2WF8A 3CY6A 4UHKA 4ZO9A 4F4JA 1A7JA 3ZV6A 4YR7A 3QBEA 1NVDA 5E38A 5CFZA 4CIAA 4KXLA 5J4LA 1E20A 4IUBS 1RC1A 2JIMA 1XZHA 4XGQA 3WLNA 4INZA 2EV9A 1XV5A 4PLGA 4D9IA 2X7JA 4WQMA 5EWLA 1UPAA 3G88A 3C70A 2WPNA 2C4TA 2QW1A 2I8AA 1U4SA 2GA8A 4YRDA 1T8WA 1KJJA 1IRXA 4BN0A 5AVRA 3PKJA 4XI9A 3PXBA 5DNWA 4MTCA 4AP5A 1V6CA 2IX9A 3RROA 4LQCA 3UMJA 4PO1A 3VDRA 2PRIA 4OFZA 2VDJA 1NXVA 2WSYB 5BYJA 1WEHA 2HK7A 4PLFA 2BSXA 5DI3B 3KLNA 2QMYA 3IO5A 3WLOA 1JJIA 1I3CA 3GLTA 3NV9A 4RVFA 3ZH9B 1RI1A 4Q16A 3ZC3A 1V3VA 1B43A 1LC0A 3MQFA 3WZLA 3SS9X 4MA5A 1VI2A 3IKVA 1GAQA 1ZJ5A 3BMCB 2QE7D 4QUDA 2EBWA 1HMYA 1ZLXA 2REBA 2Y1XA 3IVAA 3KHKA 2OO5C 4MPJA 3RVLA 1GYPA 2HFKA 2C9DA 2F1JA 4D9MA 1F2DA 1QZ3A 4Q3DA 5HF8A 5KKCA 2AOTB 2AT1A 2B8TA 1Z13A 1F1BA 1DC4A 4QAQA 1TA9A 5CVEA 2IPAB 2VAMA 5EVJA 4RY0A 1LTHR 3WAKA 3AINA 4E12A 4U9HS 2J9FA 4LZLA 4OMFG 3OEWA 4PANA 4TZTA 4CIDA 4M1ZA 3A6HA 4FZJA 1ZJZA 4HNAA 3AI3A 3UC9A 5A6SB 5IASA 2IVZA 2VCHA 1OLUA 2GUGA 2Z2JA 1KKLA 4IIFA 2BI4A 4WFJA 3WL8A 4LXHA 3VC7A 1QAMA 3TSCA 4AG6A 1NGSA 4KXNA 3BE4A 1FPQA 1NE7A 2HA2A 4HK4A 5EWLB 5F1KA 1TCUA 4ZVSA 4E21A 1A1SA 4YRQA 2P9EA 3KQPA 4PHHA 5EC8A 5IKEA 3Q3EA 5HJ5A 1RC8A 4NYIQ 3NUGA 1AU9A 4MUKA 3TYXA 3GLUA 2JLQA 1H0HA 3EJWA 2J9GA 4UVDA 1N2GA 2XXAA 3CWZA 2CXOA 4NMXB 5BMVF 4QXPA 3QJ5A 4PGFA 5EHNA 2WF9A 1XZ8A 4KN5A 1AM4D 4UJ3A 2F00A 3BB3A 3FSJX 3V8NA 1QFJA 3WK8A 2G70A 3OWHA 3K9LA 4CN9A 1VRVA 2A14A 1T3ZA 2PKYX 1NPYA 2ZYSA 3L7LA 3MGAA 1EA7A 3IEPA 4J3JA 4P92A 4COOA 2E1RA 1XMXA 4LVUA 4R68A 4IH9A 3ZS8A 5CDGA 2JGNA 3A6KA 4PVDA 3L1KA 1HOXA 1YDEA 4EGSA 3VMFA 1H93A 1Z82A 3CA8A 5HSGA 3PPVA 1V11A 4PAOA 4JZKA 3K0CA 5HEKA 2IZ7A 4B6OA 4WDRA 3QEBZ 3N8HA 2XUAA 2IA5A 1PFQA 4N5MA 4MUNA 2OCYC 4HZUB 4DYDA 4FYIA 1U7OA 4PGGA 2J9FB 5DISB 2EJCA 3NWEA 3H04A 4UBIA 4LOIA 4A2CA 4GMDA 1USIA 4QDTA 4UHCA 1ID8A 5JNWA 1BRMA 3LTEA 1OLUB 1PK9A 2PUFA 2ZS7A 1E9EA 3IBFA 5ALGA 5EUCA 5B7NA 3FX2A 5LP6C 1DC7A 4IWNA 1VHLA 2PUWA 4O5OA 4U7WA 1FFXA 4WOKA 1GZSA 3IQXA 5DM4A 1B8VA 1YB1A 2P2YA 1LGYA 2ZRQA 3FTNA 1ECFA 1P80A 3CBQA 4FXPA 3MIIA 2CBGA 4ESEA 1IWBB 5BQXA 4E46A 4BFCA 5KAPA 3B53X 5B3JC 3HVHA 3T3HA 1XZPA 5I51A 2JEZA 5E2BA 4BAGA 4EBFA 4A10A 5ITZB 1KZYC 3T0IA 1ONOA 2A3NA 2O2CA 3UXEA 4REOA 4NPHA 5G0WA 2PGDA 2JZNA 1SIOA 4R40A 1ZUNA 4ZYYA 4MPPA 4JC5A 1PV1A 5EWJA 4PXAA 3CSDA 4P8RA 1JIUA 1RYMA 2EIXA 3KSRA 5ICCA 1W5BA 4F2GA 1L4YA 1HO3A 2VBIA 2RGGA 2WKPA 3ETJA 4JBLA 2IKSA 4GZMA 4OHUA 3ED1A 2O2ZA 4JSRA 4KKXB 2ARKA 1WXDA 1YZNA 2O7QA <