2MYPA

An arsenate reductase in the phosphate binding state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
MKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Hybrid Mechanism for the Synechocystis Arsenate Reductase Revealed by Structural Snapshots during Arsenate Reduction.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Oxidoreductase
molecule keywords Glutaredoxin arsenate reductase
total genus 47
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mypA00
1PEAA 3RVSA 1XWWA 5ED4A 2YHAA 4MAAA 1DJMA 5GQSA 1QQBA 3T6KA 2ID9A 4ZMRA 2E4VA 3KJXA 4N03A 1GUDA 3RVJA 1SXIA 3IP7A 5CHYA 3IP9A 2IDMA 4PEVA 4EYGA 4LE1A 4RK5A 3CHYA 1XHEA 2FQWA 2FVYA 4HYEA 2RJOA 4QYWA 4EVQA 9ABPA 1Z25A 1QO0D 4XARA 3FFWA 3OO0A 2FKAA 4PICA 3NNDA 4G0XA 2IYNA 3T95A 1EWVA 3H1FA 3GBPA 2ZAYA 2QVCA 5FBKA 4S04A 1TM2A 3OO1A 1TJYA 3BRQA 3BREA 3I42A 3HS3A 1HEYA 1BDJA 1C4WA 2J48A 1LJLA 5CNJA 1Z16A 1F4VA 2M98A 3B2NA 3C97A 3TX6A 3EQ2A 2R25B 1VKRA 1MIHA 2FMFA 1P8AA 2IOYA 4RK1A 3HO1A 4JASB 5IEBA 4MR8A 4YLEA 3A3KA 4RSMA 1F51E 3ROTA 2CD7A 1JFTA 1YMUA 4RV5A 1SD5A 3CS3A 2HPHA 4HNSA 2FW0A 3IPCA 4KPYA 1USKA 2R48A 4OLBA 2FQXA 2MSKA 3O1HB 4YV7A 2Q5CA 2CHEA 1ZAYA 4OLAA 2BGGA 1NXSA 2ZWMA 1Z13A 3K4HA 2FMHA 2MSLA 1QP7A 1C0EA 1DRJA 3FFXA 4YCSA 4LRQA 3URMA 1APBA 3QX8A 4KMRA 1EWKA 1QNLA 1U2QA 3RVQA 1NXVA 3NNSA 3CG4A 3Q7RA 1BAPA 3H5VA 1BDHA 3LTEA 4RKRA 2E4YA 4ETNA 1MB0A 2E4UA 5BRAA 3E3MA 3JY6A 3A10A 4LDZA 4Z9BA 1YTUA 3KCNA 3MA0A 3A0RB 1NTRA 4F3TA 1A04A 3NHMA 1ZH2A 5HSGA 4QPJC 4MR9A 4D6YA 1JDPA 4MS4A 1FFGA 1K68A 2E4WA 1ISSA 1CYEA 4MS3A 1UDRA 2A9QA 2M1ZA 4KZKA 5TQ0B 3O75A 1DCMA 2V0NA 3ROFA 1D5WA 1WETA 2FN8A 4YRZA 1A2OA 1OXBB 2TMYA 2WJWA 3HSYA 3ILHA 4RXTA 1CHNA 4B09A 4QICA 2PJUA 3MQ4A 4IMJB 3CRNA 3Q9SA 3HCWA 2QU7A 1FQWA 2GWRA 3L6UA 3IDOA 1IIBA 2QW1A 5C5EA 4YS6A 2MSWA 4GNRA 2MYPA 3RH0A 7ABPA 3RVNA 3H5LA 4JA2A 1Z26A 4G86A 3HM9A 2GI4A 5TE9A 4FE4A 1U8TA 1GLGA 2L17A 4NCAA 4UHKA 3MYYA 3UUGA 3SQNA 4RWEA 3QEMA 5B3JC 3D8UA 1E6MA 1QP0A 2MYUA 5EWJB 3KLOA 3QLTA 4TMYA 2PKXA 3HXMA 1QQAA 1YIOA 2WJAA 4S05A 3QEKA 1JFSA 3O2SB 4MS1A 4EVRA 2HSGA 3OMWA 2JBAB 3W9SA 2FLKA 2QZJA 1DC8A 1KMIY 3MMNA 5TPWA 1E2BA 1Z12A 2P4UA 4W5OA 5BRJA 4P1ZA 5I4CA 1DBWA 3LFTA 2PUFA 5TQ2B 4WUTA 1TVMA 3H75A 3EODA 1B00A 3HJFA 4L4UA 3A0UA 1YK0A 2JB9A 1JHZA 2FEPA 4MQEA 1EWTA 1CEYA 1S8NA 3K9CA 1GUBA 2GBPA 4NICA 4RK6A 3NHZA 4RXMA 1R8JA 3Q41A 3CZ5A 3RQIA 1D1QA 1M2EA 3KS9A 4MYRA 5IX8A 4G0QA 3HV2A 5HM6A 1KRWA 5TQ0A 1ZGZA 2R47A 2YHBA 4KVFA 4RY8A 1SRRA 1YVUA 2RGYA 4GPAA 4KREA 4D6XA 2PL1A 2OQRA 3CNBA 3GRCA 3N75A 4G97A 1JX6A 2B4AA 5IBQA 4PZ0A 1M2FA 2WRZA 3UKJA 3N6VA 1GCGA 4MLDA 4XASA 4WXMA 3QEMB 4F12A 3LUHA 1Z17A 1EFAA 3C3MA 3EQZA 1FSPA 1LBIA 4XAQA 1NXXA 4MGEA 5PNTA 3D02A 2FEWB 1KGSA 1USIA 1NATA 5KWSA 3KHTA 4G0MA 4O5AA 3DGEC 3LKVA 2F8SA 1DG9A 1RXEA 2FTKE 2LIVA 3CZCA 3OLVA 3QLVA 3N8IA 4MS3B 1OXKB 2PUDA 1JWLA 4MS4B 3LUAA 4RDCA 5C5CA 4FE7A 3VNBA 4JAVC 2PUAA 2A9RA 1U2PA 2JRLA 3G1WA 2WMYA 2QR3A 3CG0A 1JF8A 2JK1A 2KYRA 4L85A 5FWYB 5IUNC 1Z2EA 1RPJA 4MQFA 1I3CA 3N53A 3UK0A 3C3KA 2ID7A 2AYZA 5B3JA 4Z4GA 4JB0A 3G85A 3H6HA 1YMVA 3H1GA 2B1JA 1E6LA 1USGA 3N0WA 5TPWB 1PUXA 3NBMA 1PHRA 3EAFA 4TN5A 3Q7TA 1DBQA 1MAVA 3OLXA 4W5QA 4RY0A 4ZJPA 1SXHA 2PAFA 3HUTA 2MYNA 3RVKA 3R0JA 5HQJA 4Q6BA 4Z4IA 2LPMA 2JVKA 4KV7A 3EJWA 3GL9A 2HJ9A 4XFKA 3GT7A 1BA2A 4H60A 1VPWA 2X7XA 1TMYA 2JCGA 5DLEA 2AYXA 3MIZA 1ZY2A 3O1JC 3QELA 4Z4HA 2VYCA 4EUKA 3FFTA 4LZLA 4MR8B 4XXHA 5TQJA 3TD9A 1ABFA 2JBAA 4WWHA 4DQDA 4E7OA 4MQFB 4H3HB 1U04A 3QX9A 1JDNA 1ZITA 2NT4A 2R4QA 3SAJA 4ETMA 4O1HA 1K66A 2GX6A 1D2AA 1TLFA 2F8TA 3EULA 5EWLB 3CFYA 1ABEA 5BQ3A 4N0QA 5T7BA 3I45A 4RU1A 4IF4A 4MRMA 5JNWA 4CBVA 3RVOA 1M5UA 4XLTA 4KFCA 1EAYA 1PEYA 1T34A 2HQBA 3CU5A 3IP6A 3L49A 3LKBA 3QELB 5CNKA 5DCLA 1NXTA 3JTEA 4HNQA 2P9HA 4N47A 2PUCA 1BDIA 2PE5A 3IP5A 4EYQA 3TB6A 3VNAA 2W42A 1LK0A 1QP4A 3M9XA 1NXOA 4NCBA 1ZH4A 1YS6A 1RZRD 2E4XA 3CLKA 2IPLA 2FXIA 1PNRA 1EHCA 3E61A 4F06A 2NZVG 3BILA 3QLVC 2HQOA 4YGXB 4N41A 4WT7A 1D1PA 2QXYA 4WXEA 3O1IC 2QVGA 4Z4FA 3H6GA 4MR7A 1LBHA 4EY3A 3O74A 3HVRA 4F11A 3T38A 4MLCA 1KRXA 4OATA 3MM4A 4LE0A 1W9HA 4WZZA 3EGCA 5EWLA 5IULC 4IILA 1FFSA 3DZDA 5EWJA 5EWMA 3DLBA 5DGCA 3HDVA 3KYJB 5IC5A 2H0AA 1RXIA 3LMKA 5JNSA 1GCAA 4G0OA 1AB5A 2VK2A 3GWGA 2A9OA 4IGAA 4JOQA 4YR7A 2QSJA 8ABPA 1JH9A 5TQ2A 1P2FA 3N0RA 2FQYA 1MVOA 3FDFA 2IPAB 4DADA 2IKSA 1ZGGA 5F64A 5FWXA 3KG2A 5FBHA 3EDCA 3F73A 4EGSA 4DN6A 1URPA 5IUKC 4MS1B 4IRXA 3M6MD 2NUBA 2L2QA 5CNMA 4YO7A 4YWHA 1JYEA 3DBIA 3KKEA 4UHJA 3SM9A 4N76A 3OQMA 3JPWA 3RVMA 2L19A 4JP1A 3DLHA 1JL3A 2NT3A 2IPNA 4EYKA 5KC9A 3GV0A 5JNRA 5DKFA 5ABPA 1NXWA 2FN9A 3LUJA 2WY2D 3JVIA 4FB4A 1JFVA 3I5AA 2IPMA 4Z9AA 3SNKA 3T8YA 4MR9B 2JVIA 3CTPA 1P6QA 2LUOA 4KQCA 1P6UA 1QKKA 4RK0A 5TPZA 3SG0A 5JS1A 1YS7A 1DCKA 3ILYA 3LUGA 3F6CA 4RZSA 4YP9A 4RXUA 3OQNA 1L5ZA 3H5IA 1DZ3A 2PUEA 1DCFA 2CWDA 3GYBA 4W5RA 3QK7A 4TLMB 4P98A 4EVSA 3N0XA 3H5OA 1NXPA 4EYOA 5KQMA 1DRKA 2MYTA 2LP4Y 3OMXA 4H3KB 3RVRA 2NZUG 4QYMA 3HEBA 3SY8A 3LUCA 3Q15C 1H9CA 1Z18A 5FWYA 2FMKA 1BVHA 2L18A 5GOTA 4Z4EA 1VLZA 4D74A 4PE5B 2CHFA 1JBEA 2WB4A 2O20A 4ML3A 2JVJA 3LUKA 3GA5A 1E6KA 4JB2A 5KQGA 3CKMA 2RJNA 3LOPA 4KNYA 3MF4A 4MRMB 5JNVA 3KTOA 3RVPA 2XDYA 4G0YA 3O2QB 5T3YA 4W5TA 1Y1LA 1ZHHA 3F7NA 4PYRA 3OLWA 3OLYA 2A9PA 1JLKA 3KSMA 3FGZA 4ZYLA 2FEKA 2FLWA 4OTZA 1ZESA 4NV3A 5KC8A 3IPAA 4O1IA 3F6PA 1ZVVA 3OQOA 3H5WA 1JYFA 1ZDMA 3DGFC 4Y9TA 2QV0A 4RK7A 1RZRA 3OM0A 3O2JA 1PNTA 2H3HA 3TO5A 3OLZA 4Z4CA 4Z99A 1DC7A 4Q6WA 4RY9A 5JNTA 4RK4A 4F8JA 1J56A 4KQ9A 4TLLB 2RDMA 3QLUA 3O21A 3TMYA 2PLNA 3NNNA 5HKOA 1YK1A 3H1EA 4KK4A 3C6QA 2OENG 3P9YA 1L5YA 4NQRA 4E7PA 2HQRA 4LE2A 5D2CA 4G0PA 3QLUC 4IMIB 1Z2DA 3BRSA 1DP4A 4RKQA 5IEJA 3JVDA 1Z15A 4M88A 3C3WA 3JPYA 2LBPA 4LX8A 4OG2A 2I6FA 1D4ZA 1ZN2A 5IUJC 4ZMSA 3FMVA 3I09A 4ETIA 3HZHA 3M9WA 1QPZA 1QMPA 1U0SY 1ISRA 2GKGA 5TPZD 2E4ZA 1VRVA 4OBBA 4RS3A 2FMIA 5KQLA 5CNIA 1DBPA 5FWXB 4MR7B 1SXGA 4Q7EA 4KRFA 4N0PA 5JNUA 2VUIB 4W5NA 1AB6A 3HUUA 3LUDA 4ZPJA 1XHFA 4Z0NA 3BBLA 5JS2A 3KYIB 4LDAA 3HK2A 1MB3A 2PL9A 4HNRA 3Q7SA 5EWMB 5BR1A 2FSPA 1M5TA 2DRIA 4KK3A 3OM1A 3HDGA 2WWVD 2VUHB 4G0ZA 5KI6A 4MQEB 5E3JA 2PUBA 5KQPA 2PMCA 3JS5A 3H5TA 1RNLA 1W25A 2PUGA 1NY5A 3S99A 6ABPA 1A0OA 5DTEA 2N9UA 3RVLA 6CHYA 3KLNA 4MPTA 1FFWA 1QO0A 3LUFA 1LJUA 3GBVA
chains in the Genus database with same CATH superfamily
2YV5A 5C8YA 2C07A 3EF3A 3ES9A 5H81A 3PUJA 2H5LA 4G4JA 1M75A 4FQ5A 3L8EA 5H3LA 1OXXK 5FNVF 3K32A 2HO5A 5ISMA 3MLEA 3MTEA 4BZQA 4DR6B 2Q3EA 4M8SA 3OTWA 1KA9H 5JLAA 3QPBA 2OHIA 2QX6A 1ZD9A 3FPFA 2ZE5A 4JNCA 2ZI7A 5DBEX 2IHBA 5ETJA 2ZYHA 2A0UA 5IJXA 5KBYA 1RM4A 1F2DA 1RYYA 4FWIB 2BZSA 5A0FA 5BUCA 3FFWA 1RE1A 4P53A 3VPAA 1T6ZA 2XH8A 1GITA 2IYNA 2Z8YA 3VZRA 3T95A 1AQLA 1N2OA 2OWDA 1UJ5A 4CMGA 4ZD6A 4AZVA 1KRHA 2C8VA 2H2DA 3FSGD 3O8CA 4EY6A 4HPJB 5F9MA 3RPEA 2IYSA 3HUFA 4G5QA 4EFDA 3GEEA 1R74A 1WBJB 3IKMB 3IUEA 4WZAA 3B2NA 3A27A 3BD9A 2B9VA 1AZLA 1LTKA 4MV5A 3LQYA 4B6EA 5IJ0B 3GYGA 3L0CA 4PLHA 1C7QA 3EVDA 4KXWA 5LSAA 3AKZA 4C2TA 2IU3A 5FRDA 4JASB 5BOVA 1XK7A 1QG0A 2JIOA 1U0LA 2HLDA 2WICA 4CCSA 1TYAE 3KZ1E 3DMPA 4UCXA 3A2KA 3GFSA 4RMNA 3R9XA 2XA9A 2OSBA 2PGIA 4OL0A 3TQFA 1JB9A 4LDJA 4DC0A 4YNBA 1G3QA 4I1UA 1U7DA 1FDTA 2QBYB 3O9ZA 1U2ZA 3ZU2A 4E2XA 3WB2A 3AR7A 2VPTA 3HDQA 1MC4A 3LA8A 1JKXA 1P17A 4BMXA 2OCBA 1MO4A 3FPSA 3BJIC 1DQSA 2AUTA 2V59A 2V58A 2J46A 3I2FA 4H15A 1VLMA 4HY3A 4TMFA 4ZQEA 1Z13A 2O2IA 2P65A 2ZSKA 4FFNA 3U3ZA 4DPMA 1QGYA 4NXNB 3BXPA 4LRQA 3URMA 1M8FA 1WF6A 1E69A 4OFXA 2FR0A 2D4HA 3QE2A 3NIDB 3EB9A 6REQA 4BVAA 5H4GA 4TL9A 1V7PC 4C29A 2GHIA 2DKFA 3RTAA 2ZYTX 4KPUA 5HJ7A 5CG2A 4ZZ2A 3EIHA 3L46A 3G02A 3IEIA 4RKRA 1D09A 3T94A 4BB5A 1DTEA 3CIOA 1MGPA 3K0EA 4QTXA 1M67A 4RHFA 4YN3A 1A9RA 4CGZA 5C8ZA 4IS2A 3E22A 5TDHA 3EF1A 1Y8RB 4A0HA 5DEOA 5J4KA 3WO0A 2ZUUA 4IXTA 3E4DA 5LD2B 1H9BA 3AB8A 4C05A 4MR9A 1YR6A 2FP4B 3FIJA 2G9ZA 1ZONA 5F2NA 1Q44A 2W2PA 4JL8A 1V1MA 1AXRA 3IIMA 3OPYA 5TQ0B 1DCMA 1PKXA 4YDQA 1H0SA 2O1XA 2RD2A 1QF7A 4K0RA 1XU4A 1EDBA 2HPZA 3C7AA 4BN5A 2IXDA 1C3EA 1A2OA 2VSQA 3V32A 2B1RA 3T7DA 3GLKA 4B09A 3IEUA 1FS6A 3C16C 3MQ4A 3T4EA 5IW8A 3FIUA 2Q29A 1W47A 3L8HA 2V9ZA 2WC1A 3U62A 1JA1A 4NULA 3EMVA 4I5IA 4AZ0B 1M3SA 2F4VB 4GSLA 3UW1A 3AXSA 2AH5A 3C1UA 1DXHA 3FAZA 3ZLTA 1B0PA 3D6VA 1H2ZA 4NAUA 4AFNA 5IZ4A 1ZJWA 4Z2AA 2Q7DA 1GOTA 4IO1A 4O4IB 3ZWPA 4C7JA 2ZXEA 2P41A 5I4BA 2NTJA 4DR5B 3CWCA 2G0NA 3QBEA 1SR8A 3QENA 3BH0A 5EPEA 4UFPA 2PJRA 3AKDA 5BQPA 1LX6A 3HCCA 4ZOQI 3FTQA 4NJOA 3BCUA 5L4NA 2JHFA 5GZ3A 1CETA 3BYZA 1FXSA 1R6DA 4E5SA 1VLJA 2HV8A 1VYVA 2XJ4A 3DTVD 1QFJA 3GCGA 1MCZA 4L27A 4REQB 3SC2B 3VBCA 4ZYXA 4H18A 1RC8A 2WJAA 1ECPA 3SN6A 1ECJA 2NYRA 2GYVA 3BMCB 3D0RA 5ALSA 4C88A 2UZ1A 2PSSA 3Q11A 3PT9A 3QKRB 3VR2D 3V2IA 4QVIA 5HF5A 3H7IA 4HDMB 1WETA 4EEZA 5DSXA 4EUHA 3PDJA 5CVVA 3CX4A 1HK7A 3KVVA 5CA1A 4F3YA 5LQNA 2IYLD 2GBLC 3V8NA 1Y8ZA 4EQ6A 3EUEA 1GSAA 3L18A 3UFBA 1WG8A 1XTJA 3IBYA 2OFFA 3SZ3A 4IMPA 1FSSA 2RH9B 2OECA 3OLCX 5ALGA 3F2VA 3RARA 1NQWA 2NU9B 1ADYA 1TX4B 1DRVA 1XZLA 4G9GA 2A78A 4L7VA 4B81A 1CS0A 1E20A 1DWOA 2HHLA 4X1IB 4JHLA 3RI3A 4NYJR 1KK1A 3JALA 4YT2A 4X61A 4D0GA 3U56A 1UKZA 4UM7A 1S2OA 3RQIA 2XKKA 3R76A 2CSUA 3CGGA 1W36D 2ECFA 2AE1A 4JR2A 2XTAA 1ZQ9A 3A6DA 4QJ4A 3M3DA 3DNPA 3ZPXA 1Z74A 3ESCA 1W1IA 4IIBA 4QAQA 1GVHA 4CMIB 1NQVA 2J9GA 2NXWA 1TTQB 3MRXA 3TJMA 1W5SA 1CWUA 1CZOA 1QE5A 3G8CA 1TKCA 4PPFA 4UEQA 4CG2A 5KNBH 1GFIA 3G9TA 1STOA 4O4HB 5A71A 1EFAA 3C3PA 1CUAA 1KKMA 3FZYA 2AFVA 5JD5A 1H8HD 4XAQA 3KEOA 3O4FA 1R64A 2WM2A 4G0MA 1PCXA 4O5AA 4KI0A 2F8SA 3GRPA 2BGRA 5DSTA 2B5WA 1P0MA 3NBYC 4F4DA 1NF9A 1PWEA 3KOWA 4U3JB 4OI0A 2Y1KA 3UKOA 4N3CA 2I03A 3GDHA 4UREA 2RAVA 1C3OB 4A16A 4D0SA 1ESMA 3E22B 5E7MA 3SYLA 4GKAA 1KJ8A 3HCOA 4WBNA 3WFZA 4DDWA 1YNSA 2QN1A 4Q4AA 4XGRA 3IHTA 4Z5XA 1T8UA 1SU8A 1U9IA 2O5RA 3A6GA 4D0NA 4MKIA 1O89A 3HE3A 3UG7A 1U7PA 4ESOA 4NXMB 4PSVA 4J0GA 3PF9A 3D8NA 5F5NA 4NWIA 3KQYA 3SS7X 5MHTA 2NIPA 5AJYA 4XJTA 3R7WB 2J6BA 3W9UA 4JLWA 2BKLA 3CXUA 2G08A 4D26A 4EB6B 1JS1X 3OCWA 1KE2A 1HWYA 4RY0A 3VHQA 2C96A 1L7RA 5KSZA 3UTCA 3IPXA 2WSMA 2NZ8A 1SCKA 4UDXX 1GRVA 4GMGA 3A1NA 3I58A 3W6PA 2VHYA 3ABRB 4C0QC 1H9AA 4DA4A 2YOHA 3FPAA 3ZWKA 5AHOA 1F2TB 1HDEA 2FPLA 2IHKA 3DR3A 3DFFA 3G79A 1XVLA 1JKJA 3OZEA 3REQB 1HFKA 1ZY2A 2M6SA 3WGUA 2QAIA 3GLFE 2VJLA 2WDPA 4IIGA 4W99A 1Y9EA 2CDRA 2VYCA 4NDZA 5LQMA 5F76A 4CDRA 4JQYA 3TD9A 3DCNA 5G1NA 3KUCA 4BTEA 3ZOZA 2V6IA 2YVLA 2O48X 3C2QA 4E7OA 2Q41A 2VNSA 3BL6A 1FLDA 1XZDA 1TFUA 2PNFA 2RKWA 2XHZA 4U7PB 2I2AA 2BTQB 3O3NB 1ORWA 5KS2A 3FNEA 3MT0A 4DSAA 1Z36A 3LBHA 4EFNA 2G82A 4X1KB 2HQ1A 4DIFA 1RPTA 5FA6A 3I45A 1RT9A 2LCQA 1G5TA 2GN9A 3JQ7A 1S7GA 4IGKA 2GZMA 4NYMQ 1DKRA 3ESXA 3IP6A 3LC7O 3TRIA 3RF7A 1LPPA 1W85B 3HJTA 1NXTA 1U2SA 4E31A 1VG0B 2GGSA 3WYAA 3BL5A 4RSRA 1S9HA 3FRIA 2ZAGA 1BKYA 2Q0QA 1FLAA 1DBIA 2C20A 4FI3F 2HF8A 2HPVA 4KQWA 3D2CA 4UUQA 3WV5A 4AMZA 4F3RA 4LF7B 2VF8A 4DJFC 3CLKA 3NOVA 1PQYA 3O4JA 4UM9D 4L0QA 1EHCA 1VIMA 1ORVA 1Q74A 2ZUWA 3QLVC 4MVJE 5G1OA 1YQQA 1WUHS 4PFQA 4WT7A 3U48A 4ENQA 2XB2A 1L4BA 2DT5A 3O1IC 1YRWA 2O2DA 4V0LA 2WPDD 5B1YA 2QTGA 4AS2A 4DV3B 4ZYVA 1CEQA 5ARDA 1IPEA 5FBWB 1U0OC 4LJ9A 1ANKA 4IIFA 5FTKA 3VX3A 2X8AA 1N6LA 4L4RA 3EGCA 4CTNA 2JD0A 4L0MA 3NWJA 4ZT5A 4CLOB 1PVVA 3LRPA 1YUBA 4R84A 3UXYA 1FUUA 5KIAA 4DLYA 1XGKA 3A4VA 4NENA 3O90A 3T3EA 5IC5A 4X62B 2VHQA 5JNSA 2R1TA 4YREA 3ROKA 3NI2A 1FNCA 1PW5A 3RS4A 1CSEE 4LW8A 3OT1A 3PNYA 1T3LA 1UOQA 1TADA 1SXJA 4BNKA 1XXHE 1FU7A 1IONA 4CODB 4IX9A 3JWJA 2XQKA 1C3LA 3UXMA 4C2BA 4TMWA 4EJSA 3QXSA 1C7RA 1NOIA 2Q5LA 4F45A 3O73A 1MDBA 1K9SA 1J6UA 4DV6B 4RE6A 4PXYA 1ZBQA 3OH8A 1EFKA 1JYEA 4YWHA 3UAXA 3T1TA 2H4FA 3WGZA 4EHIA 3QXXA 4MHTA 5DK6A 1OSNA 5EINA 5AWFC 2GETA 4OB6A 5JTTA 5BV0A 1OWMA 3I83A 4V0QA 5JNRA 1EGQA 1J8MF 3GFVA 4CVNA 4FR2A 4EW6A 5AUPB 2MU1A 5FI5A 3FHCB 2VK1A 4FYKA 1O1YA 1B6TA 2Q8NA 3AEUB 4ME6A 3SQWA 2VR1A 5IVHA 3N8GA 1VKNA 3EQ8A 1H1DA 3N8HA 3O8DA 4UD2A 3L6CA 1ZRSA 2BGWA 5CLJA 4MJXA 4QUKA 1QBGA 3OQPA 2XWJI 3TEFA 1OYOA 2IHZA 3LC2O 3P20A 4L5BA 3AVUA 1SUEA 1WMSA 2FSSA 4Z1MA 1MP0A 4BCBA 2ANCA 5ICEA 3MINA 4K9OA 1V1JA 2FZ5A 4KVAA 5JDCC 2LP4Y 4RDXA 3FGNA 1G20A 1F0KA 4P7FA 4NH4A 1KMQA 4IY1A 4I3HA 4BC0A 4NG5A 3W5SA 5JIBA 3DOCA 4GRDA 4H0NA 4RNDB 3RUHA 1D4AA 3K1YA 4YUXA 1C0IA 2G5GX 3U39A 2ZANA 3PGLA 3VV3A 4MK4A 2FYTA 4ML3A 2I99A 1QF6A 4TT8A 3I5UA 2HLDD 1LZKA 2II6A 5FYDA 5BQ5A 2PD6A 4QGSA 5BW4A 4FD3A 1JA0A 3LUKA 3TIVA 2CLSA 4MB6A 1PAUA 3LLSA 3LPNA 1OI4A 2VTBB 3PEUA 1KZ1A 3QMVA 3ZWXA 3AT1A 1YRAA 1IL0A 5JECA 3DJFA 5IKXA 4GXRA 3AI3A 3AZPA 2XRMA 3CEMA 1HDCA 4ZO8A 4BO2A 4W5TA 1V6SA 3DDCA 5H9VA 4M86A 1KI3A 4I3FA 4EFMA 5JQGB 2ZI3A 3DG9A 1TEHA 3L8MA 4R1NA 3CW8X 2XW6A 1E3SA 2JJ1A 3L8FA 4RC9A 4YV2A 4KXXA 4D1YA 4YXWD 3RG2A 5CA1B 3UF0A 1W4CA 4URFA 1F48A 5JT1A 1VZ3A 1TYBE 3NUQA 1RAAA 3DLAA 1DQZA 4ETWA 2FPKA 4OMUA 2J67A 3ZDEA 2Q5IA 4RY9A 4XE5A 1C1DB 4X20A 2VPIA 3SLRA 3RUPA 2CLCX 3TCNA 2XYRA 4DQVA 1P1IA 2HSWA 1R10A 1W8DA 2LGJA 3KPYA 3WIVA 3IUJA 4ZCIA 3BWMA 3MK31 1DLJA 5TF0A 4JXZA 3P5BA 3FF4A 1MT0A 3GZNB 1NVEA 4K9NA 1P7WA 3UT5B 2AR7A 1H8ED 2J6IA 1NVVR 2YJNA 3IERA 4I08A 1GU7A 1TF5A 1L3BA 4PHGA 5GVSA 2W6QA 3N5CA 5DLYA 9GPBA 1IHPA 1DDIA 1NX6A 1GSOA 4B4UA 1C50A 4HLUC 1CD5A 2ROQA 1Y4SA 3MCTA 2VO1A 5AKHA 1NE2A 4I8XA 4I5GA 3ANNA 4ZCTA 2AFHE 3VGPA 5KHLB 5DI9A 1NWHA 2ON6A 1P2GA 5CVJA 4UEKA 4X3CA 4P7KA 1HTTA 1MT3A 3ELUA 3GEHA 3PHCA 1MB4A 4WXYB 4HX9A 2CNOA 1P5RA 2PYZA 4WCFC 5CNIA 3B6MA 2CMGA 1F2VA 2RSLA 4IUYA 3PR3A 4P92A 4BNVA 4N6GA 4PTZA 3QIVA 1T0HB 2ZZNA 4JLPA 3TLZA 1XHFA 3HJCA 4XIFA 5B1IA 4CL8A 4F4HA 5IDQA 1KQNA 1UFKA 2P0YA 3DDSA 2FP4A 5LB2A 2H3EA 3B9BA 2WD7A 3UOWA 3UWSA 1ZOIA 1W48A 1Y1RA 2QM3A 2HIAA 5HPYB 5JWRA 1U28C 1MO3A 1T9CA 2ZSBA 4KO4S 1W87A 4DMCA 3ZCTA 1NJ6A 2PSFA 2MCFA 5DLPA 3HKEB 1ES9A 5KI6A 1OA1A 1TCCA 2I1WA 2ZU6A 1T1SA 4NE2A 5AIBA 3TZBA 2O5CA 4QXRA 4OSOA 2C99A 5JARA 3PCTA 6ABPA 2J3IA 2ORWA 1UMCB 2Y1LA 4YRLA 4QBIA 2HU8A 4CTKA 5EE3A 3BORA 1YMQA 1QO0A 5EIOA 3BIFA 3FPCA 4Z53A 2BPOA 4U6NA 4ZT6A 3TW0A 4P34A 1ULAA 4KL8S 2E89A 1QIMA 4TWZA 4X1YA 3GT0A 2HJRA 2DULA 4XYBA 5ERGB 3LWNA 3TRJA 3WLTA 4DFDA 2QI9C 4KVZA 1TIBA 1CHDA 1WXDA 4IVQA 5EIFA 3KQNA 2R6CA 1QORA 1I14A 1L7NA 1OT5A 3ECAA 1T1IA 4DLPA 2X5JO 5I9LA 1XEWX 1E8MA 1HETA 4E30A 3PC4A 1G2PA 1EWYA 1KY3A 2O6LA 5K3BA 4URXR 4F6RB 4BPBA 3TGPA 4BV2A 3TZ6A 2JIZA 2GK7A 3K9QO 4L5AA 2YC2C 2GPJA 4RJIA 4XARA 2PLFA 4AF7A 4AUKA 3GBSA 4HTFB 4KQJA 3ZI7A 2PA0A 5HE9A 3PGA1 1JA9A 4EB0A 3BBPA 3C4QA 4HDRA 4KN8A 4DNQA 4DSTA 4QUBA 5ER6A 1OWLA 2AK3A 3T52A 3BHIA 3DMFA 1A27A 5C5DA 1Y80A 1A9QA 3ZTWA 4PBTA 1YB5A 2FHSA 3GLSA 5EIXA 4G1UC 1ZGJA 4J75A 1R6XA 3BE4A 4RHXA 3ZKWA 1NOKA 2DPXA 3UH1A 1ZI6A 4HF7A 2B34A 4DCNA 1J7JA 1F51E 3VNRA 3G6KA 3AV0B 3NHYA 2A67A 5IH3A 1JIKA 2WKSA 3CS3A 1TM3E 2FEMA 3W1VA 3T7SA 4YUVA 3IAAA 3P0JA 3A31A 3INRA 1F5NA 4CM8B 4WE3A 2OQ2A 4JROA 1XQWA 5KYNA 4G37A 1FB5A 4KMSA 4RD3A 4B4OA 3F8WA 1QK4A 3HJAA 3N2GB 1GTVA 3O1HB 4LFCB 1N9GB 1KEWA 3A4IA 1FJHA 2GF0A 2EKPA 3INYA 1QP7A 4CT5A 4M1ZA 5KJ1A 4C7OA 4OJMX 5EIHA 1Q77A 1KQFA 3DBRB 3PHGA 3FSGA 3P9KA 3COJA 1I33A 4RVHA 1EWKA 4A0SA 3FGPA 1L3CA 3N86A 3L8CA 1U28A 2R5FA 1ODFA 3H1TA 3NNSA 2W83A 4IZ6A 4DARA 4IQ8A 4QE3A 2ZSDA 1YZHA 4KE6A 1JHRA 4B2YA 1Q1QA 3I4FA 2ZDHA 4AKSA 1YCFA 1KNQA 3EHDA 4MVYA 1UZLA 1PFKA 4LHWA 3EVEA 5FB3A 4UQLA 1N6HA 2DY0A 3HQ4O 3I9FA 2J9YB 3HVKA 1VIDA 1M2KA 2COKA 3A0RB 5GZ6A 4MW1A 3KQLA 1QR6A 2OPBA 4ENTA 2QLFA 2N1MA 4RZ3A 1COWA 3IP3A 1AOXA 2EJCA 5ADUS 4RFSB 3KO8A 4L5IA 2H1RA 2YASA 2FMUA 1J21A 3O75A 5M04A 3CW9A 3ROFA 4PHHA 4K9MA 1ODKA 1QNFA 4MI6A 4PWYA 3UAVA 4B47A 5ADHA 5BV7A 2HWWA 1RI2A 3I0MA 5E0KB 3M3HA 2OG2A 2ZYIA 3HSYA 4KWEA 2QMQA 2B35A 3A4MA 4UUOA 1LV7A 3AEXA 4UVEA 1ZH0A 5AW9A 8ADHA 1LBSA 1H0KA 3AUJB 4LWOA 5A5EA 4CLDA 3L4JA 5JZOA 3U1TA 2BKUA 1BDMA 2XXBA 4H27A 4MVJA 1FQWA 2FETA 1N25A 2I66A 1PN3A 1KVRA 1U2DC 2ZE7A 4LPSA 1ZXLA 4Y0AA 4D4MA 4EBFA 1F6WA 4DUZB 4M9SA 1LRJA 4BFXA 4XJXA 3AFMA 5EHXA 4JWTA 1JEDA 1YZLA 2QAGB 4FGKA 2QD4A 2VNKA 1FXUA 3QHQA 2W70A 1C41A 4J1NA 3JQQA 1WP4A 1RWXA 2L17A 4K2HA 2QJOA 1DGQA 2DECA 2OMKA 4MHOA 4Z7JA 3MYYA 4M83A 3OTGA 1XROA 1G8MA 4TVKA 4MVJD 5UKDA 5B3JC 4ICIA 3EOAI 3EZ6A 4WERA 3WNDA 2PD3A 4HAVA 2DGDA 4B9AA 5EJ7A 2HLHA 1OQAA 2BCGY 1DPGA 3VNSA 1O8BA 1Q17A 5CT6A 2JBAB 5ALRA 1E9BA 2G0TA 1GL7A 2LDBA 4DVGA 4F72A 3E9ZA 2IE8A 3KAQA 4P1ZA 1E3DA 2OYRA 2OAEA 4DCTA 3KJEA 4CM7A 1CR2A 3OC6A 2QN2A 4GM1A 4U2FA 1Y4UA 5ESWA 1E3MA 5K20A 2H4JA 1B00A 4TSKA 2Q4OA 5ITZA 5C1PA 1N1GA 3SU8A 3L02A 4EOGA 2ZJOA 4CETA 2VZEA 3G2QA 4GMFA 3TOXA 1EUDA 1S8NA 1YWGO 2WE7A 1ESCA 4K28A 3UGQA 1UR5A 3GLFB 1WOMA 1T1EA 2F9MA 2I9PA 5TX7A 5FFFA 1FZTA 1PZEA 1RQ7A 3VR0A 1L4UA 3R0IA 1E3JA 1U31A 4UBLA 3ISVA 4OHOA 4YFVA 1XMPA 4NZMA 1OGIA 2BD0A 1N9ZA 4YEDA 2GRUA 2Y0CA 4L3VA 2HA4A 1JHPA 3G0HA 2WM3A 2EZ8A 4FJ0A 4X8MA 4P35A 4Z4QA 3N70A 3SYMA 5FV7A 5FBVB 4B2LA 4B74A 5F98A 1OLXA 1LC0A 1EG7A 1TVCA 3QEMB 3LUHA 1QFXA 1AA9A 3NHJA 2YINC 3DVRX 3GRUA 4YRCA 3TQTA 1M66A 1DX9A 4MGEA 4ZOLB 4RTQA 1Z6ZA 4P0TA 2Q3JA 4RIGA 4A91A 4ZAFA 1FNDA 3IP1A 4F4CA 3AX6A 3CZ9A 4W9NC 5AW8A 1FSGA 5AQ1A 1TAHA 1SKBA 3ICPA 2HNBA 3DBHB 1GGHA 1U9IC 2J87A 2X15A 1CIVA 3B3AA 3OZVA 5ALNA 1ILEA 3CPHA 3GJXC 3UYKA 1RBZA 1G8PA 1T5BA 5FF9A 5L4LA 4EB6A 4P3OA 3TR0A 3JQGA 2YHIA 1V1RA 4YUAA 2QHXA 2Y0PA 4MQFA 3RU3A 3V3KA 3ZQ6A 4NG4A 1J4AA 3TIIA 4PC6A 1XL1A 1U9CA 3LGSA 5IYZB 3ONEA 2CLLB 5AJWA 2GPYA 1XL0A 4GNKA 2O8EB 3FDXA 3GJRA 2IBMA 3NBMA 1DIRA 3OSZA 2C9OA 4RZXA 1YGYA 3EX7C 1OX5A 1E0KA 3NX4A 1B6SA 4M55A 1IHUA 4BFUA 1JLLA 3TEJA 3QX7A 4J91A 4TSRA 4F9GA 2X19A 5HQJA 5COQA 1LC3A 1RP1A 1RZ3A 2LR0A 3ISJA 3SCZA 1SBTA 4YRSA 3QOYA 5AR1A 5BORA 2VHJA 2NPFA 2C7RA 3IEVA 1X94A 3IVRA 3PXBA 3QELA 4WXPA 2FEAA 2OB1A 2XWBF 4RD1A 3N5KA 5FOUA 5A03A 3ZCQA 1QH0A 3HI4A 2Q9UA 3NZEA 4RHYA 4NOMA 4AURA 2VOEA 1A9XA 8GPBA 1TVEA 2NO5A 2NT4A 4IHJA 2FUNB 2RBKA 1GTMA 3FW1A 5KAMA 1KDYA 1BW9B 4MP6A 2ZIVB 1X3LA 3MCWA 2PKYX 3BDAA 1UJCA 4HDNB 1ZD4A 1H93A 1K27A 1M2OB 3VC1A 2O7VA 1BRTA 2VOJA 4X1YB 4TTSA 13PKA 1LVGA 4ISBA 4K9LA 4Q7JB 5KTNA 4ERXA 1M5UA 4KFCA 1H6DA 2DH5A 2QM0A 2Z4TA 2GBFA 4H4DA 3LYHA 3SLGA 3IV6A 1E8NA 3MBKA 5D86A 3WDMA 1SCIA 2V7EA 1NF3A 2Q5HA 1L7PA 3FCEA 1ZG3A 1JDBC 2CVPA 4DLAA 4A1OA 1UFOA 2O50A 1CRQA 2P9BA 4X00A 4H6VA 3SYKA 3KD3A 1LRLA 3BDVA 2R65A 3L7LA 3MMXA 1EVEA 1WB6A 2AQKA 4QXPA 4W9NA 2BW0A 3CEHA 5CFZA 4NCNA 4EHFA 4GOXA 4TS9A 1WEKA 3QP9A 3UB4A 4FYXA 4WVFA 1RHKA 4Z4FA 2PZGA 4MR7A 2GNOA 2I6TA 3TDKA 4DC9A 4OHWA 1NWCA 1UEIA 1R8QA 1XJWA 2JRCA 2QMEA 4KAXA 1B74A 1GR1A 2X0IA 4PGMA 3RUDA 1PGQA 5AH0A 5IT9A 2X42A 3IKLA 1JQEA 4IEIA 2VHXA 3E18A 3OCYA 4AP9A 1RJDA 2OCYC 4L2IB 1E0SA 5LP6B 4X8OA 1OX4A 1P5ZB 4X41A 2VWHA 1Q5PA 3BXXA 3VFDA 2ZUFA 5AYVA 2CE7A 1VGQA 1C9EA 2QN3A 3K70B 3GJTA 4JP8A 4NBLA 4E07A 5C51B 4MKFA 4G01B 1I3NA 3E4CA 2X2EA 3EWSA 3V8PA 3GZNA 5IP5A 1NRXA 1ND6A 1WXQA 3B3FA 3QU9A 1HFEL 4WHMA 3WISA 5IPFA 5E9JA 3KTDA 4NBVA 3N6XA 1OFGA 1UM9A 2IQIA 4IRXA 3K0FB 1VHTA 4U5XA 5CNMA 4YO7A 5A06A 2EU8A 4NQZA 1XYGA 1O87A 3LCVB 5ANRB 1OBVA 1BN7A 1Z7BA 2ODQA 1L5HB 1MH1A 1WMAA 5L3RA 4ZZ3A 3N87A 2YICA 1ZEMA 4FFWA 4U0JA 3EPHA 2H7CA 2JLQA 3IMEA 5JY6A 3VPGA 2ADFA 3GQVA 4EPVA 3NM4A 3WQHA 4CEJB 3C0KA 2WVJA 1CYDA 5BVHB 1KHHA 4MVXA 4DZRA 4MXDA 4IEEA 3GCZA 1OAOC 4PSCA 2OBXA 5C4MA 4M53A 2CVQA 2H2AA 2JH3A 3PA6A 4DIEA 3LP5A 2FPGA 5L4SA 3WYGA 3ILYA 1RYMA 4X54A 2AXEA 4DDHA 1NBAA 3IVCA 4PWZA 3Q6IA 4CLXA 2G1KA 1U7WA 4G5SA 4I50B 4O4LB 3U4DA 4EA8A 1IHOA 3GRVA 1M2VA 1P0FA 1E4EB 5LC1A 2WLTA 4MAFA 2RH8A 2XYQA 4IWYA 1YRBA 1Q0UA 3RHZA 3FX2A 1BOFA 2Q4EA 1H2XA 3G2HA 3FB1A 2IEDA 4ZVRA 4I9UA 1J2RA 3KWMA 2JBHA 3KSZO 2CJWB 1KE1A 2LNDA 2QP4A 4B76A 1A8QA 1Z18A 1WDTA 3K9BA 3L2OB 3WI7A 1GFSA 1YZQA 2B82A 2C7BA 2QYTA 1HLPA 2EOAA 2WSIA 3L0PA 4KQ2A 4LSMA 3VJMA 4J1QA 1K6JA 5LBUA 1SURA 2M9MA 3CUSA 3DMTC 2WYOA 4OMDA 2AG0A 3JXEA 1SCQA 1UZUA 5TT0A 2YBDA 1EDEA 1C1HA 1ULUA 1KEKA 2PT7A 3FCOA 4DKXA 1HMPA 2DAPA 4P7JA 4AMGA 4JJKA 5AI5A 2NQ2C 1W1UA 1XEWY 3DE1X 3ZQJA 2A5YB 3R20A 1QV7A 2G63A 2BMJA 3NUZA 1LFDB 4MRMB 1MUUA 4TTQA 4WKBA 2Q62A 3RVPA 3TUZC 1MZPA 2FVXA 4OXKA 2GTHA 5AKJA 1E4OA 3STHA 1RD4A 4Y9RA 5BUSA 5C32A 3WS7A 1GGKA 2F3PA 1T43A 1ZHHA 3COZA 5TQVA 1YQEA 4YYZA 1U5BB 4CPDA 3DM5A 4URVR 3ELDA 4TTPA 5DX0A 2HU7A 1QHSA 1Z83A 3GD7A 3IPAA 4OH7A 1C8LA 2B2XA 4BFLA 5IK2D 4WCFB 1HOTA 2FU5C 1YDHA 2VWQA 4X6YA 4F2HA 3HYNA 1VFNA 2FPSA 3AMVA 4DR3B 1NNEA 4J0HA 4QXOA 5D5HA 3H11A 2OAGA 1G16A 3P71T 1W581 3LG2A 4U0KA 1YR8A 5AK6A 4B4DA 3B6JA 1EP9A 3C45A 4JS0A 4MP3A 4Q0MA 4TMVA 4QIHA 3H04A 4NZOA 2EARA 1FRZA 3AEQB 4JEIA 4RIFA 3UB3A 4CQMB 3OZGA 4QU9A 4PSDA 4JYZA 2V97A 5IJZA 1CY1A 1KI7A 4B8YA 4RF5A 3KTAB 1GDTA 3NWOA 5KWIA 3UFXA 1D4OA 3F96A 3VZCA 4GM0A 3ZE0B 4P84A 5JQWA 1V47A 5HBGA 1SXJE 3W6ZA 1RYZA 3JPYA 3QFHA 3IAM6 1TUEA 2I6FA 2XCIA 5A6VA 2JAXA 3I2IA 4QG3A 4FS8A 4GUDA 4I4IA 3CX3A 2GPAA 5BSKA 2OHVA 1QQ7A 1JB1A 3EGDB 3RIXA 4HQNA 2CL0X 3PDIB 4IV8A 5KTMA 4K3UA 2A9JA 1L3IA 5JCOA 4A23A 3I52A 1QDLB 4HWPA 4MUXA 3SZMA 2C5AA 2ZUTA 1ZU5A 1OI3A 3W90A 1XQ6A 4E51A 2HLNA 1HR0B 4R1TA 3PJRA 3ITKA 1OWOA 3LCMA 1S2MA 3HRKA 2QXTA 2UKDA 2ZR8A 4NIMA 3TSAA 1WV1A 2XBLA 5JDCA 3S7TA 1HO3A 1II8B 1XWFA 1UAYA 2OE2A 2ZBRA 4HWOA 4MPPA 5E3JA 4YCLA 4DV0B 4YRQA 4QO8A 2C4TA 3OZWA 5ICFA 1RNLA 4QPCA 2QVYX 1UAGA 3QW4B 2P2LA 4UAGA 5D6OA 4B2IA 4DCCA 5LLTA 3K9NA 4MP8A 4CXMA 1LWNA 2F3SA 1DTWA 3EA0A 3LCCA 3MCUA 2R66A 1KZHA 5EQTA 4RMHA 1JSXA 2BEVB 3F90A 4Z8YA 1E2EA 1R4AA 2R7MA 2WYHA 2YXEA 1IY1A 1DJMA 4M46A 2MTBA 4EF5A 2H08A 3P5SA 4PAOA 3NFYA 4R3UC 4DMMA 5IAKA 3B3GA 4DLZA 4F7WA 3OQVA 4N03A 3OECA 2IBSA 1VPTA 3C74A 1YKSA 2WNSA 3BB3A 3IP7A 3IP9A 3NR2A 1S8OA 2VK8A 4HL6A 4HPXB 1VYHA 4RK5A 2AJCA 3GU3A 1MPXA 4YRBA 3SFZA 2EKQA 2FZLA 3O6VA 3BFPA 5A3VA 3RG8A 1T15A 1CX9B 4AO7A 3IOEA 1XMXA 3ACBA 3ZWMA 4NMLA 3CUEF 3EF0A 4FFLA 4HB2A 4L74A 4JJ8A 1RYNA 1IRXA 2DHCA 2WIGA 2W5UA 4M7PA 3ROQA 2H18A 3L82B 1YE5A 4JLUA 1Q0ZA 5FBKA 4CIBA 4FR5A 1JEJA 1QU3A 1I5OA 2G28A 3NV7A 4UDNA 1D2NA 3FUXA 2BFWA 2IIBA 4UU0A 3TRHA 3B38A 1ML4A 1XF9A 4HDQB 5IT4A 1PQPA 1NP3A 3PJFA 2QAJA 3K1AB 1NVAA 1CZNA 1NMQA 1YQXA 2C82A 3AUAA 3ZCPA 4EGFA 2O8DB 1ZM7A 5EJMA 2R25B 3TX2A 1VIAA 1AZWA 3IDAA 3AFIA 3B78A 2Q07A 2IOYA 4RK1A 5DM60 1QZZA 3I76A 4IVPA 4OHVA 3SHQA 4MV6A 3ZJVA 4C1NA 3GELA 1GYPA 2W6IA 3KDAA 4XUEA 4DMUB 3C3YA 4M99A 5IC4A 4N5MA 2HU5A 1LK5A 1T5HX 4WBSA 1UC5B 1FFHA 3JAMA 2XVZA 1OAKA 3D5QA 1W2WB 5EJ8A 2MSKA 3L7OA 1BGVA 4D43A 3ITEA 2Q5CA 3SI7A 2DB3A 1V6AA 2ZWMA 4G85A 4IAOA 1TD1A 5BUQA 4XB2A 1M73E 3C43A 3D6TB 4R2MA 5BMVA 5EHZA 4G0WA 3PNOA 5F33A 1P2VA 1ADBA 2R1VB 4GZ3A 2G9VA 2QKYA 5AM2A 2O2HA 2XUHA 4DMKA 1N4DA 1P9RA 1VE1A 2X7JA 1LKZA 4NK4A 3AR2A 2C1EA 2NUPB 2D3TA 4LZJA 5IBCA 3IO3A 2GM9A 2AF4C 4GVLA 2PX4A 2EV9A 4WESB 5EC8A 4KXLA 4HYTA 3IT2A 1DC5A 4L2IA 3R7AA 1QIDA 4BRWA 1VXOA 3AF4A 4YQEA 3WGYA 4CV2A 4YCNA 4CL0A 3RBVA 3UMSA 5KNLA 4KOEC 3CR8A 1P2SA 5GADl 1BQ3A 4EZIA 2X4IA 2YZKA 5EXXA 3DPUA 2P4EA 4KZKA 2BFMA 1RM0A 3E8XA 1ZYUA 5KAPA 4P4TA 1WUKS 2C95A 4JBIA 4WRRA 4OGLA 2WHPB 3O3CA 4MUKA 4GOLD 4Q3AA 1FDOA 2UYOA 5KU1A 5FHQA 3FTNA 3C6XA 4PG7A 3GVIA 4C7BA 1NMXA 5HKAA 3U4QA 3IXMA 5LFAA 4D8VA 2CLKB 4EHHA 5J1TB 2AXQA 3KHSA 5B1EA 1X19A 3DAOA 3EZ7A 1TCBA 3R7DA 1IN1A 3EXIA 3LL7A 4FTWA 4ZV7A 1XN1A 4GPTA 1R8XA 1GCUA 2FFRA 5L9AA 2FN4A 1OTYA 3ABQB 3PDCA 1NW4A 1E7YA 5D3MA 5K03A 5DV9A 3MWJA 3Q4GA 2DVMA 4KR6A 1U7HA 5L3SA 1WS6A 3D4IA 5C46F 2IZZA 1Z26A 1KP2A 2H00A 3WFJA 1QG4A 2FW6A 4F5DA 2JJYA 3DB2A 3VKGA 1B1AA 2REXB 3BJMA 2VDNB 2D0DA 2VUTA 3EQ9A 3M6FA 3M9LA 4UUAA 4XW2A 2BBOA 4Y7DA 4RCYA 5EKXA 5EE5B 4B43A 5IUJC 4EAQA 3HXMA 5EI5A 5F3DA 1OZAA 5FKJA 4FBLA 2Z9BA 4IHJF 3OMWA 4Z2YA 2VF5X 1QX4A 1JFFA 2FLKA 2FPXA 2N46A 2OTCA 2QZJA 4MHSA 3EGEA 1F0YA 2R6AA 1B0ZA 3CY6A 1M34B 3NAMA 5TPWA 5IXJA 3GJQA 1DBWA 4K6KA 3W2FA 2C00A 3WX0A 1SUCA 2YYZA 1GEEA 1U7ZA 4NH0A 4YDRA 3W7AA 1V3TA 1YRQA 1MABB 4F2GA 2UV8A 4R7GA 2JGDB 2GZAA 4MIOA 4QDOA 1QMGA 5AW6A 1N2CE 2JHAA 2B7CA 2JJ1D 3ONVA 2DPMA 1TEXA 3HR8A 1P1CA 1LI5A 3AEQA 3RFUA 1W36C 1ZOPA 3ZIUA 2V3CC 4BO6A 4QM6A 1CPYA 1WHTB 3CZ5A 2X9VA 1KKLA 5M2QA 4DE5A 2H65A 4MDYA 1M2EA 4NJEA 1N6OA 3OVMA 1Z2OX 1PL6A 3H2BA 3JD2A 5GVRA 1C80A 2VH1A 2XUJA 1KJIA 4RY8A 2R6GA 1QIGA 1SQ0A 1VCHA 2BLLA 1C8BA 3H97A 1BRMA 1MO5A 3AVVA 1NA5A 1VB3A 1JX6A 4FONA 4YMVA 4QXQA 4M1QA 1JEYA 3ZDAA 5C9ZA 1GQSA 1C7ZA 3ZDDA 1MAWA 2BMWA 2I6XA 3BEOA 3MQ2A 4HO1X 2D1TA 2RHOA 5JNLA 4C06A 1M0TA 4GS5A 4LSGA 1V3UA 2VPXA 4D9MA 1NM5C 1SVNA 1WPXA 2GYUA 2Y71A 4LSWA 3SDBA 4KO8A 1DBSA 1USIA 1EGVB 4XM0A 3L7CA 4CQMD 1I3MA 5KWSA 4HDCA 1EDDA 4JYCA 4KQ6A 3IT3A 3OZSA 4AJIA 2DUWA 4GPBA 2QM7A 2LZ0A 1TJ4A 2B4KA 3OLVA 4KDCA 2WTEA 4NESA 1N2JA 3OE7A 3HXKA 3N8IA 1NT4A 3QFTA 2AMYA 4NARA 4Y7CA 2H29A 3JV7A 1H94A 2HEIA 4RQAA 5AW7A 1EXDA 5DGIA 5BSMA 4K03A 2QDKA 3U7JA 3DTTA 4CMBA 4ARCA 5IJ0A 2JRLA 2HWXA 4FC6A 2Q9CA 3L7DA 2VJOA 4D4IA 1UP4A 1K06A 5I9SA 5HUQA 4IOKA 1WU8A 3PSHA 3X2FA 2DPYA 1NBOA 4J49A 2CXPA 3SE0A 5TJ9A 2ZIAA 4B40A 2Q2QA 3W78A 5L95A 2IYVA 2C3UA 2OMEA 3LQFA 3WZ2A 1S0UA 4G23A 4PFSA 3GAMA 3H9QA 4NLLA 4QGAA 4S0ZA 3EARA 5KNDD 3O8QB 1HI9A 2FF5A 2FDRA 2WF9A 4QL3A 1P73A 3HUTA 2ZIZA 4OUDA 3WYCA 2QTHA 1QYIA 1TGVA 2D0IA 2C8LA 2X5OA 2XUIA 3RIMA 3KQTA 5JATA 4Z4IA 3CRMA 2LPMA 5AK5A 5D5PA 4FGJA 3I6MA 2EWWA 2P1DA 4JA0A 4JMLA 4QHYA 3EN0A 4FOOA 3F2IA 2PV7A 1E9AA 1TMYA 1YD7A 2C4KA 2BRUC 1CUIA 1IATA 1UKCA 3KAJA 2F1HA 4GPEA 3MTIA 4S1VA 3WNBA 1VE7A 4E13A 1SPXA 1UBOS 3BQ9A 5J40A 1XD2A 2IEBA 4WWHA 1BXRB 2BGKA 5F2KA 3QX9A 3X3HA 4AZ3B 4MV3A 4R9RA 1XZQA 2AN9A 1UM9B 3VR6D 4O1HA 2VAMA 3NAZA 4DA7A 1QLJA 1QOZA 3COWA 4K9SA 1NRWA 1NURA 1H8HA 4URHA 1PGJA 3E3NA 3FR7A 4HH0A 1OKKA 2MSDB 3G7NA 4N0QA 4HB4A 1GTSA 3VO8A 1T8TA 2YJGA 4AQYB 1YHYA 1NBHA 4U2DA 2OHFA 2ZUVA 1IY2A 1JAXA 4KQMA 2BHNA 4RA9B 1DE0A 4YRDA 1UADA 2BFBB 2OWEA 2XOXA 3HYLA 4WY8A 5CNKA 3RHFA 2GN6A 1U80A 4Q9AA 1U5AA 1ISPA 4D9GA 1BDIA 1XDSA 3EG9B 2ZCVA 5FR2A 3AVYA 2Y77A 1JHAA 3IIKA 5A9TA 2RMKA 3HY6A 1QXSA 4ARSA 5ALJA 1TT5B 5DYYA 2FDXA 2W98A 2XITA 3IC5A 4AMVA 2BHLA 2E4XA 2R8OA 4R81A 4OHXA 5CXUA 4EHBA 3HO8A 4WN9A 3F5QA 3C41J 1BNCA 2R00C 3AOGA 4DT1B 5CFNA 5L6LB 2PGNA 3TCKA 2F3TA 5ESRA 5BSWA 1T2UA 1O95D 1JDZA 1RQXA 4TRJA 1G6OA 4U9UA 3HVRA 4CW7A 1NBIA 3T38A 4BVGA 2PM8A 4JLJA 5EYPA 2F4NA 4WZZA 3T9AA 3OE7D 1K0UA 4FYIA 4M0MA 4REQA 3RE1A 2HZBA 3ZHCA 5TMPA 1YRLA 3E7WA 3M8KA 4F84A 1KWGA 2OGWA 2OO5C 1G20E 3MLBA 4H0FA 1B23P 2ANBA 2QE6A 2PMEA 1KAQA 1UXOA 4EENA 4Q21A 5KYKA 4PX9A 1LBTA 4FNGA 2ZB3A 1WSDA 3HL4A 3ZBQA 2A59A 1N6RA 3JQ7B 8ABPA 3L7NA 4CKCB 1ZHOA 1J90A 4JGGA 5H80A 3OF2A 3RSOA 4ZVQA 1P2UA 2BFPA 3R7LA 1EIZA 2R8PA 2WZDA 3DFMA 3RC2A 1MOQA 3HYRA 4PRYA 3RT7A 1OMOA 1XXHB 3H4IA 3T06B 3KXDA 4JC4A 4MS1B 3CSSA 4PFKA 4KDEA 3GEBA 4WDRA 3V4FA 3FTPA 3TMKA 2L2QA 2K2WA 4B33A 5A9RA 1NVUQ 5CCBA 3ZVNA 2G72A 2PMWB 4FQ7A 4GR4A 4JBXA 1W29A 3AF5A 4AK9A 4FGLA 4BX0A 4YP5A 1IBCA 4JP1A 4PQYA 2WV7A 1UT6A 3N05A 4LRYA 4YXWA 3A3OA 3GV0A 4XWKA 1O94D 3Q0TA 1R12A 5E7IA 4ALIA 4F97A 3MJSA 1UWLA 3CO5A 2G76A 3H8JA 3FNRA 3NATA 4LIPD 5E6RB 1MGOA 2J6CA 3JQCA 5KX5A 1NUTA 4Z9AA 3NXKA 4FYHA 1G42A 1R5NA 1TEVA 4MR9B 5BRNA 2C88A 1L9KA 4GQAA 1P6QA 3CBGA 2F6RA 1P6UA 3DUFB 3REFA 1TTPB 3SEQA 4J9VA 5I3CA 1DC6A 3JZDA 1G21B 1K97A 1H66A 3EOZA 3P0HA 4I8DA 2YRFA 4PAGA 2I2BA 3HJHA 3W3ZB 4DTIA 2HNAA 4Z0PA 3MGCA 4KE7A 3T3HA 4YJ2A 3WIUA 3F7OA 4KB5A 4D5EA 5MFPA 1YO6A 4ZQHA 2GCOA 1G3IA 4NYMR 1CNMA 3U44B 4HDKA 5HK8A 3FWHA 3Q5GA 2H0RA 1PD0A 1Q22A 2Q2NA 4F9TA 1X92A 4OI1A 5DTMA 2JD2A 3DOEA 2QUKA 3HEBA 4MMYB 1YGPA 2OL4A 4LGYA 3RFFA 1BEZA 1QC5A 1EX1A 3AI2A 3S2ZA 3GP8A 1AG9A 2XODA 2CUZA 1C9JA 3IDFA 4ZXFA 1BGWA 1X87A 2WAAA 1C3OA 4PE5B 3U4AA 1JQBA 3H05A 1E2IA 1J0DA 1FC0A 2H9YA 4UPEA 1Q2XA 2SCUB 3NIGB 3TH5A 1O94C 3U7EB 4F5ZA 2IU4A 2BGLA 2JVJA 3GZJA 3UCXA 4HN9A 3IODA 3GA5A 1OHHD 5CB6A 2C84A 1VHWA 2OCXA 3ZYCA 4ER6A 3E9QA 3DC7A 1G18A 5ARCA 4EB3A 4FDMA 1XZMA 3TSWA 3D7LA 4GMKA 1PFVA 4H7IA 1QRDA 3ONFA 3GW8A 5C4GB 2WNIA 2Q1UA 4ZOCA 4AL4A 1N1DA 3HL0A 2FEKA 3MWLA 5BNZA 3K2IA 4A5OA 3PITA 1CP2A 4FHEA 5REQB 1JHMA 2PKRA 3QKWA 2VSYA 1VLHA 5DULA 3VU0A 1Z4JA 4ZDJA 1E3QA 1HE5A 4Y6LA 1K9VF 1CB0A 3H0EA 3FAKA 4UBNA 1WDLA 4FDLA 4OOEA 4GX5A 3IUBA 1C3JA 3GJ0A 1BYUA 2PFSA 3KOUA 2Z2IA 4CG1A 1JIXA 4LI3X 3QLUA 4ITUA 1NBME 1NLMA 2QJRA 5EJAA 5HKOA 5L3VA 3TK1A 1YFKA 2BGJA 4QXMA 5JVDF 1G55A 3FMFA 2ACEA 4GQBA 3KETA 1L5YA 2YN0A 5FOTA 2HDOA 4YRPA 2VDMB 3W2HA 3NKLA 2X9QA 3THWA 4MVJI 1Y6QA 1I13A 3EBPA 4Q9KA 4DBLC 1R5OA 4CIWA 3Q8XB 4LX8A 1E59A 1XSEA 1FLVA 1MENA 2A3NA 3VH4A 3ICCA 4CM5A 4NC9A 2IQ5A 4YJ3F 3TL3A 1FJXA 3V8BA 2I54A 5ITVA 1SGWA 1QRUA 5K2MA 2WOOA 4OV6B 1RHUA 2H8KA 3RU9A 4Q37A 2FPMA 2DT8A 5JBQA 5LIRA 3EWNA 3PB3A 3HCBA 2HK9A 4QNMA 3PXXA 1OIXA 2KX7A 4M0CA 1NF2A 3GN2A 1NZJA 5CCXA 4GOOD 2YVQA 3CWZA 3HJRA 4JHXA 1AF7A 1DADA 4YJHA 3KKQA 2R00A 1DTWB 3ZXSA 2VP0A 3FCSB 2IDJA 3ZGYA 1VKOA 1B3BA 2FSPA 1T3GA 4KV9A 1PWYE 1U6KA 5B4UA 5IN5A 3ICOA 5JRDS 5KQPA 4K46A 1IBKB 2CHQA 4J16A 2GEVA 1XLTA 1YL7A 4JJIA 4MCAA 2H54A 5CTAA 1ODIA 3S2SA 3V34A 2PUGA 2P2DA 3AL2A 4EUNA 4UTZA 6CHYA 4UBMA 4FNOA 1FFWA 2ZRHA 4KXVA 3FD8A 3MRSA 3RASA 2H1SA 1I4EB 3DBVO 3G5MA 2X8JA 1CUJA 1MBZA 2LD4A 2ATCA 2I7CA 1IG3A 1SOMA 3BB4A 4C20A 3ET4A 4D98A 4ZICA 2WJVA 3ESAA 4LAFA 3MC1A 1P4RA 1J23A 1SWWA 4KH1A 1X1QA 5DNYB 3T9FA 4I4TF 1Y3FE 1M1UA 2A9VA 5AUQA 3FOWA 3BXFA 1Z4KA 1CUHA 3SGLA 2Y27A 3WKCA 5CIWA 1EWVA 1EA7A 1MR3F 2E85A 4FHZA 4GE0A 4KFUA 3S2FA 3C5EA 4D92A 5B2EA 1TB4A 4MUAA 2O8VA 3EAGA 1MN6A 1NW8A 3NBAA 4RABA 3ZXUB 3JQAD 3MTQA 3VDMA 3LXMA 2YW2A 1CXZA 3QVJA 3L7IA 4E15A 4O4HF 1N2BA 2FWNA 2Y1XA 3A1TA 3K8ZA 3KJHA 5CITA 5JWHA 4UFNA 3G2IA 4MKXA 4AX4A 4KMRA 2W2OA 2QM8A 4MV1A 1E89A 4D3ZA 5D84A 4ENUA 4RF3A 3QPUA 4F8EA 5A5VA 4BNZA 5DHUA 1T24A 5IEBA 2OORC 2WJ3A 4HQ6A 4EGCB 4QWMA 4EL0A 2JGFA 3IUYA 3EHEA 3FLBA 4QPNA 3QOXA 3VTAA 3O95A 2OC9A 2YOGA 3HVJA 4Q12A 3O92A 4HNSA 5DLQC 4HQRA 3V1KA 1PFWA 4K1XA 2VT2A 4IJVA 4B3MB 3AR5A 1LDGA 2VBFA 4OLBA 2VYVD 4EA7A 2EX1A 3P96A 1YA6A 3EVAA 1N5OX 3JQRA 4WK4B 3I9NA 4JIGA 4MQ4A 4U6SA 2K2QB 3TGWA 2YY5A 2W58A 3FZEA 3SR4A 1U7UA 1ZCAA 2AC7A 2PZEA 1OLOA 1IY9A 3C6KA 4LMBA 3ETHA 2GKOA 4M1SA 1MLDA 2BKAA 4AZ3A 4CIYA 4BCDA 3F6EX 3IQWA 4Q4DA 5FUBA 4ABYA 2ZU0C 3R3UA 3RIGA 4CM1A 1MF7A 4ENPA 5FORA 3JYOA 1MOPA 2ZSAA 4KR9A 4BNTA 4RTRA 1MAAA 1N2IA 1RWBA 4M0PA 5BRAA 5AVTA 1L6RA 3VR5A 2WF7A 3SSAA 1IOVA 2ZT7A 4JU8A 4JLMA 4BZZA 3O38A 3A1DA 4KYVA 3PVZA 2G36A 2IODA 3N6RA 1TUIA 3QKSB 1Z0UA 3C6BA 4EG3A 4QPJC 2NVUA 5AJUA 1HNXB 2AEJA 1FUEA 3G1UA 3MPOA 4WLNA 3PTLA 1PFGA 1T4DA 2FX3A 3MZ0A 2E9SA 4ALMA 3FOBA 1S8AA 2LV8A 2OBBA 5AW5A 4KXYA 1WUJS 3AU8A 2H31A 1JEAA 2RGGA 3LQKA 4K88A 3D8BA 1SQSA 1VPDA 3FPEA 3LKZA 4IW3B 5FCDA 1BH2A 1MJGM 3F3SA 5T4FA 1EP2B 1GPMA 4PM4A 4R7TA 5B6JA 1HG0A 1SIUA 2QUZA 3MWEA 4PLYA 5KYYA 1HT0A 1XVTA 1OLXB 1H0HA 1PS0A 2DBYA 3UG6A 1JQ3A 3HCWA 1YOVB 5LQKA 2WKQA 2P2SA 1VMDA 2W9XA 4Q1FA 5JPDA 4GX2A 5FAKA 1GGEA 3PPYA 3Q7PA 2D13A 3NBQA 4OKIA 2QW1A 5DYGA 1OFIA 1RWPA 3INGA 3ZHOA 3UMYA 2FMTA 4WACA 4YS6A 2BZ0A 3EVBA 2MYPA 2BDEA 2ATXA 3ZHZA 2H1VA 1X1BA 4R8RA 1DKNA 3F9CA 4MMZB 3A32A 2O8NA 5FPPA 3I1FA 3O0TA 2JFQA 1H85A 3IPLA 3L0YA 1WBDA 5HF6A 1RWMA 4C0HA 3WWYA 3RROA 1T5OA 3V97A 1CQJA 2NZYA 4YT4A 3ESYA 2KLHA 5B55A 2P8SA 1U8CB 1UP6A 3SQNA 3TLMA 1G8HA 4E3WA 5KNCD 1YF3A 3D8UA 1U3GA 4BAGA 1DC3A 4C5AA 1VE5A 3A9UA 2ZRQA 3LLUA 1ZAKA 1PWZA 3PUHA 3NT2A 1NX9A 3QEKA 4P58A 1RWWA 4Q3DA 4TGLA 2YWDA 3PENA 3H83A 3WGQA 3ETNA 2NO4A 4MUGA 3LDHA 1YA4A 1X86B 3PKJA 4ZAWA 4TYYA 2TMKA 1PL7A 4I3GA 4RTNA 3HKDB 5ESXA 4TUYA 3RB8A 5CGQB 4QAJA 5BSTA 4WUTA 2QW0X 4A6EA 4CTOA 1ENPA 2UVDA 3GGOA 3MHTA 3HJFA 1QB8A 2C31A 4BLTA 1KAMA 3B1WA 1X9GA 3A0UA 5DM1A 5CDFA 5KCZA 3F5MA 5M34A 1PDOA 1XMOB 2HK8A 1AQNA 2VAWA 4G5YA 3D7MA 3FVTA 3BK7A 4HN4B 2IHTA 3NHZA 1AK1A 3HCFA 3Q41A 1TMGE 4KR3A 4MJ3A 4MYRA 2CL6X 3CLRC 1OGYA 2X0DA 5JJBA 4I5DA 3OWOA 1X80A 3VRHA 3VR4A 2PGJA 1V0JA 1WMFA 1JRLA 4Q03A 1YVEI 4ZU6X 1I32A 1YVUA 4GPAA 4KLAA 2IYAA 2BMFA 4H9GA 2HW8A 1LDYA 1JP7A 5IBPA 1WDWB 4D56A 1RACA 2P2GA 2YIJA 2QRVB 3GRCA 3PCRB 3FDIA 3DV0B 1OWNA 1Q0QA 2ZPUA 4WXMA 4QLBA 3TN7A 3E0XA 3WGNA 1Z17A 4US2R 1XKLA 1ZOOA 1Y6GA 3PTAA 1E64A 2VYFA 4HDSB 4K6GA 3L0DA 4CR8A 3P4YA 1E5VA 4PZYA 2R6FA 2JKZA 2X86A 3L01A 2CLMB 4G4SO 5JEDA 1P9NA 2CCGA 4LC1A 2BUCA 4AG5A 2ST1A 1NG9A 1KEPA 2GVDC 3TBKA 3VU1A 2Y66A 1Z5NA 2ZJYA 2X9LA 3SF0A 3VNBA 1U6IA 1KZ4A 2IYXA 2VJMA 3BWEA 5JXWA 1U2PA 4C43A 3HB7A 4TROA 3LBAA 4YJGB 2IXFA 4L22A 2CVFA 4YAWA 3DZJA 3ZE9A 3HB4X 5HGXA 2VL7A 5KREA 1GL9B 1TJ5A 1WXWA 3G68A 1WL8A 3JR7A 1P2BA 4TS1A 1YKFA 4EPYA 1G9SA 3T5BA 5AVYA 1A8IA 4M1WA 4F4FA 3ZU4A 1QUEA 1U99A 1N1MA 3BRWD 3N0WA 3TTSA 2O2CA 2W0SA 4G5XA 3MAGA 4TN5A 1J2JA 3WP0A 1Q84A 2IYWA 3Q6MA 4L95C 1KMHA 4F5WA 2ZAMA 4BBJA 2VEDA 3AHFA 4IHJB 5IFKA 3A7EA 3C48A 5J43A 2B99A 3ZD7A 3UXHA 5KYYB 4RPIA 4PX2A 5KTRA 4LNUB 1KORA 3HB0A 4ENSA 4GU5A 3ZIAD 2NVOA 2A0KA 5EVJA 1YZUA 2ZSEA 3AESA 3LQ1A 5AI4A 3VSCA 2VAVA 1EVZA 5DLEA 1J33A 2QD5A 4DLRA 4U7JA 3RYHB 5G3ZA 2D5AA 3NALA 5B5SA 2AW3A 1JJBA 3P4UA 3THRA 3TRKA 3R75A 1XZNA 2J3KA 2DU8A 3WK9A 4ZZIA 3QKUA 1R6VA 2ZZMA 4MQFB 4FMPA 3VI4B 1U04A 5LN1A 3C3CA 1N8SA 2R4QA 1MG5A 4X20B 2GX6A 1SY7A 2UVQA 4BQIA 4YT8A 2HKIA 4OQPA 5LZ8A 2L69A 2TS1A 1KIFA 4ZYZA 5JCJD 1XZGA 1SUSA 3CRQA 4J43A 4OXQA 4KE9A 5GGYA 3SQOA 1VLLA 2Q1TA 5KEIA 4WCVA 1IFXA 3I6BA 4MYHA 5J2UF 1G2OA 1OD6A 1UZAA 1NBWB 2FW7A 2VQDA 1U65A 3A2MA 4I4NA 3WG9A 2IUTA 1M2NA 3OBIA 4GM4A 4UD6A 4N8EA 2JIQA 3COYA 3QWHA 4Q19A 5GJVC 3REOA 4JD5A 3T1QA 3AUFA 4XR9A 1U98A 4GG1A 2VYNA 2QU8A 4ACBA 3DW1X 1Z6QA 1LJ8A 3FNBA 4LUCA 3CSDA 3E8MA 3AB3A 3H18A 5D3ZA 2N0SA 4BWFB 4WJZA 1VG1A 1ZX1A 4CHTA 1WA5A 4MVCA 1IH8A 4L8GA 4Q24A 2CNDA 1WBBA 1U1IA 2CGEA 1EQAA 3U9LA 3O8OB 2G80A 2HA6A 5NLLA 5C18A 3AF2A 1HTWA 4BYGA 1YA8A 2JAUA 3G7SA 5E6SB 3B1KA 4RLHA 3RWBA 4J7AA 4CR7A 3THWB 1Y4AE 3SXUB 7AT1A 3TG8A 1HE3A 3QKSA 1MPTA 1EGHA 2P7HA 4CQLB 1VIVA 1GFWA 3ZU6A 4BBZA 3I1JA 3BSYA 1EX9A 1L5LA 3JU3A 2ZTMA 3KYJB 3WBKA 3OFKA 1L5KA 5C8VA 4RX1A 1QVRA 5JROA 4J1TC 1GU1A 4MPRA 3IBTA 1TQHA 4QEZA 4Y2VA 4YCJA 4YR7A 1IOWA 2EX0A 2YWXA 4O4IF 4DB2A 4Q1CA 4O29A 1WVIA 1UXGA 2FQYA 3SX2A 4RPLA 3DLTA 1Y81A 1ZGCA 3NUGA 4E46A 1HX7A 4DL9A 3CLSD 2EHJA 3R8XA 3PGXA 4HX2A 1WZCA 1PSWA 1FXWF 1SVKA 2PZ8A 2W2VA 2PBLA 3LC1O 1URPA 4LOLA 4PXSA 2E1PA 4AJ1A 1DKUA 1CS4C 1NI4B 5JC8A 2ZB8A 3R3XA 3ICWA 4EL5A 1GP2A 4GLLA 3IA2A 5BWLA 1TM1E 2PRZA 3CLUD 4LCBA 1W2GA 4UATA 4J6FA 3WHIA 2IPOA 3RVMA 3G0DA 1UBHS 3PUZA 3R9IA 3PUYA 2V7TA 4C6SA 1H2WA 3EIQA 2ZS7A 4XYLA 5IWAB 4QUGA 1JHYA 3AM3A 4ZTBA 4D9FA 1R5BA 5A4DA 3ZGNA 1Z63A 2BRUA 1J0AA 4FMCF 4F2DA 2YY6A 2ZYWX 3F5DA 3RC1A 2IRWA 2ONKA 4IIJA 4XVQA 4BP1A 4CT4B 4Y6OA 5C7LO 1FZQA 5TS3A 2QN6A 4Q16A 1IK4A 4TZ0A 4R9VA 5I3ZA 4W5WA 5IMBA 5KYXB 3FPJA 4EI8A 5G1PA 1IXSB 3ICVA 2W4QA 2H1LA 2W2LA 2AHRA 1V2GA 3JQ8B 3QY0A 4RXUA 2UUAB 3DFKA 3U26A 1GEGA 1KR5A 1XA4A 1WW3A 1XKTA 1DOZA 2O3SA 2ERXA 3A2NA 3BS4A 5EE0A 2GR9A 1I0IA 5EJ5A 3HKDA 4BFWA 4A8JA 3LXUX 2EHDA 3N1UA 2C1ZA 3N0XA 1NXPA 4EYOA 1SB9A 2X40A 3R44A 1S2IA 1TK9A 1N0VC 2G8LA 3D8HA 1MW9X 3LK7A 4P33A 3P0IA 3ZE1B 3LE8A 3Q0EA 1H9CA 4PAWA 3GR6A 3RTCA 5K99A 5E4TA 1BVHA 2O6HA 4ZVOA 4Z4EA 2Z1NA 4HZUB 3Q1KA 2Q8QA 2JCYA 2YJZA 3NJ4A 4P81A 4KDRA 3KQVA 3VHXA 4MUJA 2AOTB 3LQRA 4L6IA 4JBHA 1I3LA 4Z1MD 5LP6F 1MHTA 3GCXA 4LJ4A 5L3SB 3H4TA 2WZBA 4JB2A 3R0XA 4D9BA 3C6MA 3QE9Y 5A7GA 4D3FA 4MICA 1KXZA 2APJA 2R62A 1P77A 2WU3A 1CNEA 1X1SA 3KRTA 4BHTA 2ZB4A 1ZK1A 1ZVMA 4DMFA 4IXNA 3UJ3X 3KSMA 4PNZA 2AFRA 1ZL2A 2HJVA 1ZESA 3BWVA 1G5RA 1T0PA 4I50F 2XIQA 3PE6A 4IKEA 1CQXA 4I6GA 4CWAA 4ZHQA 4AF6A 3ENQA 4M4SA 2YIDA 3HZZA 4X6UA 3U7QB 4BMZA 5HK9A 5IZCC 5M5BA 5IKOA 4WI1A 2GCIA 9LDTA 4RADA 1FNSA 3B5JA 3DVQX 3OHPA 4XDGA 3TIFA 5EEGA 1IWOA 4HGOA 1ZI8A 1ZD1A 4Z9YA 1HZJA 3Q2IA 4P2BA 4F8JA 1J56A 3TMYA 2RDMA 1RDFA 4QODA 3T3OA 5J63A 1K6XA 5AO9A 4EW2A 3ACDA 4KQFA 3R5JA 1AGNA 4FD2A 1OASA 4D8WA 4OCZA 3SR3A 4WZBE 1AH2A 2RG7A 5KWEA 2J5QA 5E1DA 4JQZA 4LE2A 3NM6B 5D2CA 2H9AA 4NFLA 3ZW9A 1IRIA 2PQMA 2JGLA 2XBUA 4Q9LA 5I5GA 2PKQP 1UWKA 3CX8A 3PD0A 4I9NA 2GHTA 4BZXA 5F4ZA 3FMGA 3BJRA 3KQWA 2HXGA 3IVGA 1KJ9A 2VIIA 1I30A 3ER6A 4R51A 1IC6A 3F0TA 5DWQA 4CM9A 1K3FA 4I5EA 3WBBA 4B3XA 3WNQA 1N2ZA 1ZFNA 4FM9A 1GWNA 2PKWA 4BVLA 2ZWPA 1O08A 2FPWA 2OCDA 3KHUA 3L7AA 3I09A 1II8A 2YYYA 4Q93A 3COVA 3M9WA 4EPTA 4UHHA 4CUZA 3LXXA 4JJZA 4AKTA 1WIWA 1MFPA 1X1AA 2R79A 3GQBB 3RODA 2E2WA 2P78A 4MOWA 1U1GA 1KYQA 5FWXB 4RCVA 4EJ0A 2H52A 1Y1PA 3D1LA 1SQ5A 4MMXB 3EXHB 3WYDA 2ZQ5A 2IEZA 3GUCA 5JZSA 2QBYA 4ZPJA 1KH1A 1LLFA 1L1EA 4JOBA 1I51A 3DEIA 2CDNA 2SKEA 2HV9A 2EJVA 3LBIA 4WASA 3UHJA 1XJCA 1JFLA 1CR6A 5EWMB 2FI1A 1Q1NA 2JKYA 5DGDA 2QN8A 3TZHA 4DA9A 4BASA 1PL8A 3KZOA 3WYBA 2IGBA 1JBKA 5H83A 3LT0A 4JP5A 4F56A 2DXIA 3E9CA 5HQ3B 1Q0HA 3PEYA 1KK2A 1SBNE 1AKTA 1GAJA 1DV2A 2NU6A 3DCYA 3NHRA 1U02A 1U0FA 3KU4A 1T5SA 4RA6A 2VT6A 2WLSA 1QOQB 1NVKA 2X1VA 3Q12A 4LQDA 2ATIA 3TLGA 4BX8A 1UBUS 5THKA 1P4JA 2F3RA 1RAEA 5KOJB 1XWWA 4JBLA 3CTMA 4J1TA 1ZLYA 3QVWA 3M83A 2XDQA 1N0WA 1RZUA 1W4BA 2J0UB 1NJ2A 3EYAA 4M8LA 5FPSA 4C5CA 4DLNA 2EQAA 5EJ9A 1QQBA 3SHFA 5CB4F 4WADA 1X6VA 1WM1A 5CHYA 4LE1A 2VPPA 3HGMA 3S8EA 5LMNB 1M8JA 2B4RO 2FJPA 5EZQA 3BDIA 4V1CI 3HVUA 2ZJ0A 3TKAA 2PDAA 1CQJB 1QO0D 3BSWA 4ZGBA 3JATA 3OO0A 5AXBA 3ABIA 2EJWA 5LQAA 3FJYA 5DNCA 2YWHA 3MUFA 4NZPA 2ILVA 2PX6A 3SSMA 3UATA 2X6RA 1YFJA 2QVCA 2DOKA 3IAFA 4H6PA 3OO1A 3ZZUA 3G9QA 2P3OA 1G66A 3O8BA 2AJ8A 3LHKA 3IEXA 4J29A 4ER5A 1LJLA 2ILTA 4FHDA 5H59A 1NLFA 2X1LA 4COOA 4MGZR 2GZHA 3DBHA 4NV1A 3QJGA 3MFQA 4O59O 3UY4A 2C97A 3ROTA 4BNLA 2CD7A 1WKCA 2O57A 2C54A 5SZJA 2XOEA 1VSBA 3LT1A 1TE2A 4M0UA 3V8MA 2BFBA 5DP1A 1NMSA 3UT0A 4GOKA 2VRWA 4D7AA 3DVAA 2I34A 4ISCA 3SC2A 4HVCA 2FQXA 5K2OA 4PQFA 4QARA 3VDXA 1P31A 4RJTA 3QVVA 1WZNA 1F9EA 4C4SA 1E9VA 2GBGA 3L3BA 3DCIA 4LRSB 1P7ZA 2XKBA 5EAIA 1IZ0A 3BXGA 2PZMA 3GPDG 1IEVA 3O8NA 4M87A 4MEAA 3OZDA 4C0BA 2X77A 5CJJA 1CUCA 3RKRA 5DM70 2DQKA 4OAQA 2Z4RA 4UBIA 4JFAA 4C01A 1T4CA 2O23A 2W37A 4UEJA 1Y7IA 2HHHB 4AIRA 1QGDA 1XZ8A 3P32A 1BDHA 5LZ2A 4INOA 1JSZA 4J3NA 1UFVA 4B8ZA 1F6DA 2N42A 3NXSA 3P19A 5FXMA 4UNPA 4BLPA 1FOEB 4E2YA 4ID9A 1YU6A 3G0IA 3KCNA 1XTZA 3GMTA 3NIFB 2BP7B 1PS9A 1ZSYA 4LJ6A 1W52X 4G8DA 5C7YA 4W7SA 4K3VA 1VP3A 4YI3A 2HA5A 1OBCA 1VKHA 4NBWA 5BWBA 2OGTA 3W8EA 3N74A 2HRRA 3KR0A 3X1DA 2XPCA 4N4AA 4BN0A 1HURA 3BRWA 4B0PA 1UJ6A 4E08A 1Q7GA 4X3PA 3NBZC 4HRXA 3WDKA 1D5CA 2TMYA 4WX2B 2V03A 4MTCA 5HW0A 3QKRA 4FEAA 2AGVA 1NNUA 2FR8A 4IMJB 3CLUC 2ECOA 1E6EA 3F6BX 4QTUB 3ROEA 4HNUA 3UJPA 3OJLA 5JANA 5KYGA 3TSCA 5I7VA 4LI0A 2ZBGA 1IIRA 3TIGA 3GLGE 4FSHA 2BY4A 1NMEA 1NYQA 3A9SA 3SXUA 3I3OA 1UM8A 4RUKA 2QP9X 1EJ6A 3GRRA 2GD6A 1X8KA 4GVPA 2WVAA 4OU5A 5EQDA 4LRTB 5BN5B 5J58A 1ZNZA 1UKEA 5GOZA 1H2AS 2V6JA 4DXAA 2QOEA 1GQFA 3HM9A 4OHKA 2Q5JA 2HI0A 3HKBA 1Y42X 1YT5A 3LYLA 4AI6A 3FUVA 2FR1A 3WL6A 4C03A 4F0JA 4ZDKA 2ZTSA 1OVMA 3HJUA 1JUDA 2Y8EA 4L07A 3LTNC 2X6QA 1JIIA 3NRBA 3PQ8A 1JFSA 2QMOA 3FROA 2BMAA 2ZAOA 3PNKA 5A9SA 2O8BA 5K05A 1FDUA 4RQBA 2QTBA 2XBMA 4N0EA 1EVJA 1KMIY 1UWCA 1PNQA 2YXNA 3OSUA 3T7KA 1DO0A 1SKUA 2F90A 4HDKB 4AJJA 4DV2B 3KX2A 3HKCB 1SXJB 5A4MS 3BIWA 1PGPA 2JI9A 3HR4A 4PAQA 3A3NA 1GR0A 2WK1A 1QHEA 2WQ6A 1I1HA 3A1VA 3R09A 1W0KA 4FYMA 1I3OA 2PKEA 2OLJA 1XCMA 3S55A 3PPVA 1EWTA 4MRVA 3Q2KA 4K9QA 2OV6A 2CWWA 1Q6YA 3UPDA 2JJ8A 3AUKA 4RKWA 3WMGA 4BIMA 1W35A 3HB5X 4M37A 1R8JA 1T0IA 4C3ZA 3OX1A 3P2JA 2H1IA 4BBAA 2W00A 4CMAA 4DDMA 1ADGA 5JJ5A 1YFLA 3MB5A 4YQYA 3G2LA 2PGOA 3AESB 5KDDA 2D54A 4IKPA 2XUZA 3F3YA 2BZGA 3BMQA 3LSYA 3U1VA 4B6RA 1B6GA 1KDTA 3HSKA 3GY0A 2BFCB 2QS9A 3EIOA 3SJCA 3UANA 1QCDA 1I7SB 2WILA 4ZDIA 1R00A 1D2GA 4S1OA 1S8FA 4YPFA 3OFNA 4OB7A 2SNIE 3NDRA 1JDJA 6LDHA 2VUSA 3JQDA 4MLDA 2C8KA 4FUQA 1ULTA 2BBWA 2CB0A 2VPYA 4CEIB 4M22A 2ZJZA 3OQIA 4RD0A 3TW8B 2X14A 2WSYB 5JMTA 3LPMA 1UWVA 2BFNA 3BMQB 2C4WA 3V8QA 2FN7A 4WA7A 4FZ3A 3AW8A 5A3JA 3DGEC 2HF2A 2PS1A 3KQOA 1KK3A 3EAQA 1X7ZB 3L06A 4TLCA 3JALB 3OT5A 3WJ1A 3QLVA 4ZVSA 3OQ6A 4CQMA 3T9BA 1XRLA 1YBHA 5CFOA 4OX9B 5T4EA 1WSAA 3K4PA 3K6RA 5AKYA 2EFGA 3RF6A 2ZRJA 4EY4A 3U60B 4AROA 3Q88A 3K0HA 1BEUB 2WMYA 3T54A 4ZMBA 1JF8A 5J4YA 4DR4B 4D9JA 4O3MA 1VE6A 2I6UA 3QJYA 1K7XB 4JC5A 2KM1A 1ZZGA 4ZXPA 4HT3B 3K30A 5AKGA 4NU5A 4YV0A 4UPDA 4MYDA 4WECA 5CBPA 1HRKA 5SYMA 1SVSA 3S1AB 1P91A 1BCSA 1VJ0A 1E1CB 4DIBA 1SVLA 4GX1A 1M10A 1RAGA 3VOBA 4ER3A 1R16A 2WAXA 3OLXA 3FLMA 1B14A 1BWQA 4JELA 3TD2A 1FP4B 2CFTA 4BLQA 2PAFA 3EASA 3FUUA 3WLFA 3ND7A 4P38A 3ZCXA 1FYDA 2VC2B 2EKDA 1VCNA 4JOCA 4QBKA 4NL4H 4R9UC 3ZXXA 4EG1A 1T5IA 4M1TA 3E2IA 4G1CA 4FILA 1IB6A 3EIWA 4EJSC 1VPWA 4ZIRA 1PIWA 2X7XA 1IYZA 4BX9A 5JH7F 1WNTA 1G6HA 1N32B 1IM8A 4DLSA 3U4MA 2RI1A 3E8SA 5LDHA 1Z28A 1WB5A 3DDWA 3FUTA 3PXDA 1H0RA 1U3FA 1G2IA 4LZLA 4Q15A 3TNYA 4ZCRA 5F9HA 4UKDA 4PPNA 2PTGA 1JDNA 1EK5A 1Y6RA 2OM6A 2Z9DA 2CW5A 4OQXA 3WZMA 3ZGLA 4N7BA