2MYPA

An arsenate reductase in the phosphate binding state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
MKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin arsenate reductase
publication title A Hybrid Mechanism for the Synechocystis Arsenate Reductase Revealed by Structural Snapshots during Arsenate Reduction.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 47
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mypA00
2A9OA 4PYRA 3I5AA 4OLBA 4O1IA 3IP9A 3DZDA 1DBWA 1U8TA 4KQ9A 4MR7A 1PHRA 4RKQA 5EWMA 2FEKA 2PKXA 3HK2A 3EQZA 5GQSA 3OLXA 4Z4IA 4YGXB 1ZH4A 1NXVA 4RK1A 5T3YA 3EQ2A 2WY2D 1VKRA 3F6CA 4ZMSA 2NUBA 1ZH2A 3RVLA 2P9HA 1EWKA 1E6MA 3N0WA 3TO5A 1NXOA 5IUJC 3QEMB 4F8JA 2L17A 3HSYA 1ZDMA 2E4XA 3M9XA 3I42A 3LFTA 1JYFA 1BDIA 4WUTA 2B4AA 1L5YA 2FN9A 3GV0A 3LUFA 5TPZD 2CHFA 5EWLA 1RZRD 1DBQA 2JVIA 4ZJPA 4G0OA 2PUAA 3OLZA 1S8NA 2WMYA 3MIZA 3OLVA 3OQMA 3CHYA 1PEYA 3H1FA 1CHNA 1SXGA 2HQBA 3C6QA 3LUDA 1BDHA 4RZSA 3GBVA 1CEYA 1TM2A 1YIOA 1ZGGA 3SM9A 3QLTA 3R0JA 2VUHB 5IEJA 1PNTA 1M5UA 2X7XA 4RU1A 2FN8A 4O5AA 3L49A 4RDCA 5I4CA 9ABPA 1GUBA 3KSMA 4XXHA 1PNRA 2JVJA 1MB3A 4YLEA 1ISSA 2HQRA 3FFXA 4JB2A 4RK7A 4QPJC 4QYMA 1Z2DA 3CU5A 2OQRA 4KQCA 4LE1A 5JS1A 3MF4A 2JB9A 4MS1B 5FWYB 2IOYA 3TMYA 5KI6A 2PUDA 1NXPA 5GOTA 3LOPA 1J56A 1FFWA 2V0NA 4Q7EA 4HNRA 3T38A 1USGA 2RJOA 2FTKE 1JL3A 2FQWA 3RVMA 4MS4B 3E3MA 3D02A 3IPCA 1NY5A 1OXKB 1TJYA 3LUKA 3OLYA 4MRMB 4LZLA 1R8JA 2MYUA 2E4YA 4YCSA 3G1WA 4IMIB 4MS3B 4GPAA 3JVIA 3HUUA 2XDYA 3HUTA 3T8YA 5DCLA 3NHZA 3KTOA 4TMYA 5EWJB 1YMVA 4IF4A 5KQPA 3KYIB 4MAAA 3BBLA 4WZZA 4WXEA 5IUKC 4FE7A 3JY6A 2ID9A 3LUGA 5TE9A 2PE5A 1H9CA 2WB4A 1Z18A 3DBIA 2A9RA 3O2JA 4YP9A 2IPAB 3C3WA 2LBPA 5JNSA 3MYYA 5JNWA 1EWTA 4L4UA 2CD7A 2CWDA 4YWHA 3TD9A 3HXMA 2LUOA 4JASB 3IPAA 1JWLA 1U0SY 4XAQA 4KMRA 4ZPJA 3CZCA 5C5EA 4MQFB 2HJ9A 2F8SA 1GCAA 4EYOA 1D1PA 2QR3A 2JRLA 3NBMA 3Q7SA 4W5QA 3A3KA 3LMKA 1ZITA 1F4VA 2IPNA 2QSJA 1DC7A 4MR8A 2FLWA 1Z16A 3GT7A 1D5WA 5HM6A 3CRNA 5IC5A 5KC8A 2PUCA 4N47A 3ROFA 1ZGZA 3GBPA 5TPWB 1DCKA 2R47A 2MYPA 2JVKA 3B2NA 5C5CA 2J48A 4B09A 3RH0A 5JNRA 3OMWA 1D2AA 1EFAA 3CKMA 4EY3A 1JBEA 2GWRA 4OATA 2BGGA 5TQ2B 3L6UA 4G0XA 4PEVA 4TLLB 2GI4A 3MM4A 3QEMA 1MIHA 4YO7A 3OMXA 1RXEA 3HDVA 1IIBA 2FMKA 3HEBA 3QLVC 2FW0A 1U2QA 1JF8A 4L85A 2FMHA 1Z2EA 4YR7A 4NICA 1UDRA 4RK0A 4DADA 1YVUA 1FFSA 3HZHA 3MA0A 5TQ0B 4F12A 2M98A 3JPYA 2VYCA 1I3CA 1ZAYA 3HCWA 4UHKA 3HJFA 1M2EA 4LDAA 1JFTA 2JBAB 3BREA 5CHYA 5CNIA 4XFKA 1QPZA 4O1HA 1SXHA 4DQDA 2LPMA 2M1ZA 2VUIB 1F51E 2RGYA 1M5TA 4YS6A 4FE4A 1VPWA 5HSGA 4W5OA 1VRVA 3N75A 3VNBA 1JFSA 2RDMA 1L5ZA 3DGEC 3C97A 4G0ZA 4MS1A 5FWYA 5HQJA 4LE2A 4JB0A 2ZAYA 1D4ZA 8ABPA 4IILA 1DP4A 4RSMA 3SQNA 1Z12A 1W25A 2B1JA 2FMIA 1QO0D 3M6MD 3Q41A 4H60A 4QYWA 3UKJA 4MS4A 3Q7RA 4MQEB 3RQIA 1JH9A 3NHMA 3RVOA 2YHBA 3M9WA 4FB4A 5FBHA 4MRMA 4OG2A 5JNUA 5B3JC 4KREA 1MB0A 4MS3A 2O20A 4MLCA 4MR9B 1BDJA 1MVOA 2MSKA 6ABPA 2FVYA 3HM9A 2W42A 3GRCA 3DLBA 5EWJA 1EWVA 1C4WA 1USKA 1YK1A 1P8AA 1JHZA 3N0RA 3QLUC 4G86A 3LUHA 5BRJA 1ABEA 4RWEA 1APBA 4N41A 3KJXA 1PEAA 3JVDA 3H1EA 5IEBA 1LBIA 2MYNA 1NXTA 5IUNC 4W5NA 1CYEA 4F3TA 2FQYA 1GUDA 1A2OA 2VK2A 1ZHHA 3QELB 3SG0A 1C0EA 4KVFA 1YMUA 1LJUA 3EJWA 3OQOA 3H75A 3Q15C 2FSPA 4N0PA 1VLZA 1Z17A 3QK7A 4QICA 3O74A 5KQLA 4WT7A 3CFYA 3HS3A 5BR1A 2HQOA 3CZ5A 3JS5A 1QMPA 3O2SB 4JP1A 2DRIA 3HDGA 4H3HB 1BA2A 3QEKA 5CNKA 1ABFA 5ED4A 4MPTA 5F64A 4ETIA 5FWXB 3O2QB 3LUAA 4HYEA 3KKEA 4MQFA 1Z26A 3TB6A 3EAFA 5FBKA 1BAPA 2NT3A 2LIVA 4UHJA 4N03A 3G85A 3N0XA 1Z15A 4ETNA 3I09A 2FLKA 3KLOA 4ML3A 1QP0A 2Q5CA 3H5VA 2AYZA 4NQRA 3S99A 4JOQA 1NTRA 3KG2A 1DG9A 1XHFA 3LTEA 4RY9A 3NNSA 2KYRA 3BRQA 1JFVA 4TN5A 3GA5A 5TPWA 3T95A 1KMIY 2LP4Y 2HSGA 2R25B 4MLDA 5KQGA 3F6PA 4M88A 2A9QA 1EHCA 1QQBA 2H0AA 1ISRA 1E2BA 2PAFA 5TQ2A 3RVQA 4KRFA 1NATA 3CG0A 5JS2A 4IRXA 3EODA 5ABPA 2NT4A 2QW1A 3OO0A 3HVRA 1TLFA 3KLNA 4RY0A 5KC9A 4PE5B 3QLVA 2R48A 1EAYA 3KHTA 1YS6A 3O75A 6CHYA 3CG4A 2YHAA 4KV7A 3UK0A 1AB5A 4GNRA 2ZWMA 3SAJA 4EVRA 4RS3A 2OENG 3CLKA 3FGZA 3RVSA 1KRXA 2JK1A 1QP7A 4CBVA 2F8TA 1DRKA 3CS3A 2FKAA 3LKBA 5TQ0A 3FDFA 5DKFA 4EYQA 1JDNA 4IMJB 4YRZA 4RXUA 2L2QA 5BRAA 2IPLA 1PUXA 2JBAA 3ILHA 1SXIA 5DTEA 3GYBA 1ZVVA 3CNBA 2WJAA 4D74A 2NZVG 2E4VA 3K9CA 1URPA 2GBPA 1QO0A 2QVCA 5TQJA 2GKGA 5KQMA 4YV7A 3BILA 4RKRA 3DGFC 3OO1A 4Q6WA 1WETA 2PUFA 3MMNA 2TMYA 5D2CA 4W5TA 3OQNA 3O1IC 4XLTA 2E4WA 4MGEA 4IGAA 5IBQA 1DRJA 2QZJA 3I45A 1P2FA 5IX8A 3N53A 4XASA 4WWHA 1P6UA 1HEYA 4Z4HA 3H5WA 3DLHA 1U2PA 3K4HA 3F7NA 3KS9A 3LUJA 3OM0A 3UUGA 2WJWA 3RVNA 3RVRA 4MQEA 3C3KA 3T6KA 5JNTA 1P6QA 3SNKA 3URMA 3H5LA 1JDPA 5B3JA 4Z0NA 4ETMA 3C3MA 3GWGA 3H5OA 5HKOA 1A04A 1NXXA 3QX9A 4XARA 3BRSA 4Z99A 2QVGA 2A9PA 4MR9A 4RXMA 4D6XA 4NCAA 3IP7A 5PNTA 4RY8A 3QLUA 1Y1LA 4G0QA 4Q6BA 3TX6A 1QNLA 1KRWA 1ZN2A 4G0YA 3Q7TA 5E3JA 5JNVA 4MR7B 3W9SA 1USIA 5EWMB 5CNJA 1K66A 2ID7A 2L18A 4EVQA 2PLNA 4OBBA 4MR8B 3HV2A 3QELA 1OXBB 4EYGA 2MYTA 2R4QA 2QXYA 1A0OA 1GLGA 2P4UA 1LBHA 1NXWA 4EYKA 2FMFA 2N9UA 1ZESA 2RJNA 5DGCA 4P1ZA 3NNNA 2E4ZA 3P9YA 3EDCA 1LJLA 3A10A 4RXTA 1TMYA 2QV0A 3LKVA 4OLAA 5KWSA 5FWXA 4F11A 3FMVA 4D6YA 3O1HB 3EGCA 4KK3A 4Z9BA 1E6KA 4PZ0A 4Y9TA 5EWLB 3O21A 2WRZA 4W5RA 1QKKA 3CTPA 3OLWA 4EGSA 1MAVA 2GX6A 4LDZA 4E7PA 1YTUA 3N8IA 1W9HA 2IPMA 4RK6A 1AB6A 3N6VA 3QX8A 4KFCA 3KYJB 1QP4A 1U04A 3RVJA 3F73A 1Z13A 4HNQA 1NXSA 2H3HA 4EUKA 1JYEA 4RV5A 3H5TA 4F06A 4NCBA 2FEPA 1SRRA 2QU7A 3D8UA 4ZYLA 3HO1A 4N0QA 1SD5A 1D1QA 4G0MA 5CNMA 1QQAA 4KNYA 4KZKA 1Z25A 4RK4A 4KPYA 5DLEA 4S05A 2E4UA 1FQWA 3ROTA 1B00A 1DJMA 3A0UA 2I6FA 4Z4GA 1E6LA 2FQXA 4PICA 1DZ3A 2IYNA 1RXIA 1FSPA 1DC8A 3Q9SA 4E7OA 3VNAA 3RVPA 3SY8A 1XWWA 3JPWA 2CHEA 4JAVC 3A0RB 4Z4EA 4LE0A 3KCNA 1XHEA 2MSWA 4LX8A 1YK0A 2AYXA 2PL9A 2FEWB 3RVKA 4DN6A 2PMCA 2PUEA 3OM1A 1BVHA 3EULA 3H6HA 3ILYA 4S04A 4HNSA 4Z9AA 3FFWA 2PL1A 4Z4CA 7ABPA 1ZY2A 2HPHA 3H5IA 3IP5A 2IDMA 4G97A 4Z4FA 4LRQA 3H1GA 3O1JC 1K68A 1DCMA 4H3KB 1JX6A 3H6GA 3FFTA 4P98A 4NV3A 2MSLA 4N76A 3IDOA 1TVMA 1JLKA 4EVSA 3IP6A 2IKSA 1RNLA 3MQ4A 4ZMRA 4TLMB 3JTEA 2PUGA 5IULC 2FXIA 1FFGA 1DCFA 3GL9A 5TPZA 1T34A 4MYRA 1GCGA 5T7BA 1KGSA 1RZRA 2NZUG 3LUCA 1DBPA 1M2FA 4G0PA 1RPJA 4WXMA 2L19A 4KK4A 1YS7A 4JA2A 5BQ3A 4OTZA 4RK5A 2PUBA 2WWVD 3E61A 2PJUA 2JCGA 1LK0A 3NNDA
chains in the Genus database with same CATH superfamily
1GAXA 1YCFA 2IY8A 1TUBB 2Z5LA 1ZKDA 4RKQA 4YMUA 2PQMA 1LW7A 2WSSA 1WBJB 1M8FA 1NBMD 1G6KA 1I51A 1UAYA 3AG5A 5DXAA 1XZJA 1G5HA 1FSGA 2BEVA 4ENRA 3FXAA 5F2OA 2A9FA 4IDHA 4HX5A 3B1XA 1MO2A 2BKUA 1WZ2A 4OQMA 1LFAA 4IDGA 5EESA 1NDUA 2QJOA 4KWTA 5DSXA 1P29A 3G0BA 2PX2A 1QX4A 1NBOA 2B4AA 3LWDA 2A0UA 2QQ5A 1HLFA 3VTAA 2PFGA 2VWPA 1FB5A 3K31A 2XMDA 2DC1A 5CLGA 3TKAA 3ZWMA 3QVJA 4O4JA 2C8LA 3C6QA 2KHZA 1RPAA 4D1YA 3VZSA 5KJ6A 1HT0A 3Q2OA 4GPD1 2PR2A 3STWA 3VFDA 3HB0A 1JLHA 5EQJB 4Z4QA 4EITA 1WZIA 1THMA 1T24A 1XRSB 2HHCA 3E9MA 3PC2A 3GA0A 3TZ6A 4CMGA 4CL2A 3KJIA 4O5AA 4P4SA 4LDNA 4AUNA 4HDKA 1JKMA 4OAPA 3LQYA 3G79A 3K5IA 2V4UA 4PVDA 4KQ1A 3S6JA 2XT9A 3T54A 3LECA 4JB2A 3RIMA 2VQFB 1SOMA 4RK7A 2E21A 3VJRA 2OQIA 1FVFA 1O7JA 5T8KC 1XXHB 1KDTA 3L02A 2R1VB 4EG1A 2XITA 5A4JA 2W0SA 4QLAA 2IOYA 1NKSA 1UZLA 3I9MA 4KXYA 4N6NA 1TX4B 1ZBDA 1UXKA 2NO7A 2RJOA 4JJ6A 3T15A 1QAQA 1EFUA 5F78A 2H2DA 2Z0MA 4PLWA 3RVMA 3SD7A 4EKGA 3CF2A 4JHLA 5HOQA 2G9ZA 1ORWA 1GVHA 1SAYA 3NRBA 1Z22A 1G3QA 3QVGB 4DBLE 4EHNA 5IK2A 1YFJA 2UVDA 1O8CA 1PCXA 1WCYA 4EB0A 1BROA 4GDMA 1GTRA 5B4TA 1OX4A 2Z1NA 4WKCA 4LZLA 3H11B 4UXJA 1IPHA 1ZUD1 2XKJE 4XIIA 3X1XA 1Q50A 2D54A 3OCVA 4YR9A 2H5IA 2K87A 1PJQA 3PDWA 5FOSA 3JD2A 2XDYA 3HUTA 2AVNA 1GRVA 4JI6B 5D3KA 3UB2A 3I01A 2VJAA 4Z49A 1GGFA 1JIJA 2RKWA 4XGKA 3ASZA 2EKZA 3TCNA 3MILA 1RRPA 4QO7A 1EUQA 1QYIA 3BBLA 5AKKA 3T5AA 1GQFA 5LMNB 3TFQA 1MXFA 2K2WA 3MELA 3ZCXA 4WFKA 4F4HA 2PE5A 1A2BA 2GYWA 4C14A 4ZK6A 1OB2A 4LF4B 1U2EA 1ATZA 3HB7A 5HF8A 1ZO8A 1YR9A 2NU7B 3DVAB 2ZGVA 3X1JA 1P1HA 1WMDA 2R2GA 3O4FA 3THRA 4BZPA 2C2WA 4H27A 3R7LA 3ZWKA 2A1TR 1KIAA 2YWRA 4CKCA 3HXMA 4C4TA 3TD9A 2R5NA 1XAIA 2AMVA 3N8NA 4K9KA 1TO1E 3UXHA 1C9JA 4XWGA 3OEHD 2JGFA 4JOBA 2I6GA 2C9CA 1ZW1A 5BMVB 5JALA 3TTWA 3DE2X 4MQFB 2P1RA 1LH0A 2WIJA 2F8SA 1W73A 3CE9A 3PSAA 4ESEA 1N2CA 1BGVA 3BMCB 3THYA 2BN4A 4CU5A 3UMYA 2DBVO 4YXWD 1WNFA 5E2AA 1EUCB 1UK8A 3KBBA 4HK4A 2Q0HA 3G9UA 1NVEA 2BZSA 2PD6A 4RDHA 4L0DA 2IP2A 5T4FA 3QPUA 4A8JA 3F0TA 1BXGB 3E0XA 2AFVA 3IPXA 1TT7A 3RIYA 2OD2A 4RIIA 2ZS9A 1H2FA 1RPNA 2IPXA 3RF7A 4FS8A 4RNCA 3CLVA 2CNBA 1W59A 3CEMA 1AUOA 2R47A 4QJBA 3W77A 4FIZA 421PA 3BXFA 3ZJTA 1H8ED 2JARA 3OMWA 3DC2A 5JROA 1K92A 3RO7A 2DFPA 5C8ZA 4G25A 4PEVA 2A84A 5L8VA 3KNZA 1GPH1 5GTDA 1JHAA 2I9PA 4UU0A 3UV3A 1VGQA 3QSYA 4Q3AA 3BUSA 4M46A 4IO0A 5FBVB 1LLCA 1TK9A 5JSKA 1Y37A 1E98A 1CG6A 4OJYA 3VVCA 1DBIA 1QUFA 1CEEA 4QYIA 2C0QA 4AMBA 1NJ1A 3QPWA 1QQTA 1UDRA 2SKDA 2YHSA 4B6SA 3KSDO 2WWHA 1JR2A 3V7YA 3DSRA 4CF5A 3CN7A 2GCNA 1O5OA 1VHLA 3CUSA 3EIFA 2Q3DA 1H69A 1YJBA 4BNWA 2AK2A 3ESDA 3LPCA 1Z33A 3QE4A 5K0LA 3DMPA 1TZKA 4Z3DA 5EMNA 2JD2A 4J0JA 4JI1B 5FOXA 4PSAA 3NFYA 5EYPA 3ZHBA 1DGQA 1D6MA 3E53A 4H6VA 2C96A 5E7IA 2HIAA 1H5NA 2Z3ZA 3OIFA 1XWFA 3LDFA 2VUIB 1F51E 4DXHA 2BAGA 3GF4A 5P8WA 4KXMA 4QGSA 2ZT5A 4GU5A 5J3JA 3WWCA 1L8QA 4K0KB 5CX1B 1U2GA 3FETA 2P6NA 4EJ0A 4M89A 2OVBA 3OJOA 3P2MA 3ENVA 2OZLA 4W8GA 1Z5PA 1U9IA 8ABPA 3UM9A 4WY8A 4PXAA 4IHQA 1NR1A 5AI6A 3V48A 2JNWA 1WUKS 4BNUA 2Z8ZA 4TRNA 5IH7A 3C8HA 2O07A 4O2BF 2A94A 3FPAA 4OMUA 4CCSA 4NESA 4DMUB 2DLCX 5EE5B 2OE2A 4MS3A 3AETB 1K5GA 2H1SA 2V7QA 2XTJA 3HXTA 3O4JA 5DXJA 3AM5A 4P6VF 5JG7A 2Q3EA 1I6LA 2NZYA 5JAIA 2G5GX 3JD0A 3DE7X 3S2FA 3VKWA 4JYMA 4B6GA 5CVEA 2XCTB 2PGLA 4HR7A 5FI1B 3KFXA 1F1JA 3LQRA 4WOJA 5IEBA 4IJ6A 4B2PA 5CFOA 1YS4A 4G5HA 4NJEB 2IW1A 1VDMA 4GC5A 4M8IA 2O23A 4B8WA 4BFCA 4EEXA 4CQLA 1EX6A 1ZHHA 1Q12A 4D41A 3ADCA 1C0EA 3U5TA 1UZUA 1EPUA 1N0UA 3QVLA 4QXOA 3IERA 5EMHA 3ZCVA 2FPPA 4MPPA 3H0KA 3RSQA 2WT9A 5L6MB 5MN4A 2WJGA 1ST3A 3JS5A 1XLUA 4FZJA 3HDGA 4XSVA 1RMTA 1ZJ6A 4EUFA 3Q7QA 3H8JA 5MGBA 1P4RA 3HFGA 3KYBA 2DUJA 1R0YA 3MPOA 4Y9RA 5ALLA 1M1NA 3P9KA 4ND4A 4ZTBA 3DF9A 3AR3A 4CQMA 5BV0A 4UDYX 3V8NA 1IK4A 4D4IA 4DDUA 3JD3A 3PNBA 4OFZA 3WBBA 4PZZA 3NWEA 3ZKAA 1KVRA 4WXPA 5EZ6B 2ZS7A 2NNLD 2BKEA 4K3VA 3PJEA 3VYTB 1Q2UA 2WQ6A 3V7NA 4CDNA 1QO9A 4X62B 3NKLA 4ML3A 4HB2A 1H0KA 1BHSA 2ATVA 1FFEA 1ZISA 2PT7A 4Q3EA 4B43A 4EKIA 2AZXA 4HDRA 2O8BB 1WLSA 4W4TA 2A58A 1UJCA 1FYDA 1SCBA 3WWEA 4TUYA 1TA0A 4RAQA 5IT0A 3W2FA 4LJ8A 5CFLA 2WHRA 1JJFA 3QKRB 2BD0A 1GARA 3PIIA 2HD4A 1QGDA 2JGRA 1ISRA 2W6IA 3CJTA 4HFNA 4QOGA 2C0CA 2O2CA 5TQ2A 3WYAA 1E2BA 3R1IA 4K28A 1WUYA 5BQOA 3UK1A 3ZZ0A 4OGGA 1GN8A 1XTKA 3G49A 1RWXA 4RD0A 5KOJB 2C07A 2Q99A 3B2EA 3FTPA 5I9MA 4M8LA 5JOQA 3EIHA 3KHTA 4M36A 3ZWOA 2YRWA 3LPNA 3RIHA 3V33A 4OMFG 4PX5A 2WB2A 5LLSA 4G4IA 1P2BA 3AB7A 5BSGA 2HZ7A 2PPLA 3COSA 4LOIA 3GGDA 3Q9UA 2P75A 4IFBA 1GYPA 5LNK6 1X1CA 1PR6A 3PI7A 2E3JA 4C4RA 4X6LA 1N5OX 1GSIA 1H85A 2VNSA 1BFDA 1T0PA 1NMSA 2QRHA 3NPAA 4J2OA 3RC1A 1YB7A 3E5RA 2D1YA 3W78A 2XCRB 3ECCA 3I4FA 3MGAA 3HHPA 3RAPR 1MAWA 2QAGA 4K8RB 1A9XA 2IQIA 2JBAA 4WK0B 4AVYA 2ZSBA 5CDFA 1LS1A 1QH8A 3H4VA 4M9RA 2PZFA 5CJJA 2BGWA 1E2MA 2F1IA 1P0QA 2E4VA 1U4SA 3ADKA 1KR2A 2IWRA 2OPHA 3Q11A 4YAUA 3T1TA 1XQ6A 1T6ZA 2R1ZA 1JEYB 1M2OA 4UDOA 4CLRA 4B4DA 1Z6AA 3IHWA 3LA6A 1A9RA 5LA6B 3ROGA 1S4MA 1N78A 4WLEA 5CFMA 3PEFA 2IYQA 5KVAA 3F1LA 2JI8A 3N2GA 1W47A 3FZGA 3AUKA 2IGTA 1KY3A 3PDIA 3GCWA 1AUQA 3AP1A 3F7NA 3GUYA 3UCXA 3SYLA 3K6SA 2XR1A 1NOIA 2WJWA 3RLFA 2BCJQ 5K6AA 1F60A 2XUFA 3E9ZA 4DV7B 4XYMA 1L7XA 4D81A 4II7A 2GJKA 3LA8A 1ZP6A 2VJDA 1H2AS 2JD0A 4WEQA 3V8PA 3AVQA 3ADDA 4XARA 3ONDA 2V8BA 1RJGA 2Q8QA 3D8RA 2QJWA 4E88A 3L4KA 4XA8A 4QVGA 3B6MA 2LCIA 1HL3A 3FKSA 1ZVJA 3K0FA 1KI9A 1Q19A 1K3FA 4G8JA 4NCHA 5A62A 5BVHA 2ORVA 4MQMA 2WHYA 4C5AA 4BBPA 5F51A 4NIMA 5BORA 3A6LA 4C03A 1NY6A 2Z8XA 3K09A 4Y2XA 5ALEA 2ZUFA 3NONA 3DKKA 1FMTA 4E12A 2WTUA 5C1PA 3ZE7A 2AMFA 4MV6A 3KAPA 4HHEA 4KMSA 3JQBA 3MN1A 3GLIB 4R1QA 1RLJA 2E4ZA 1M2VB 1VE3A 1W88B 1H2YA 3RHTA 2A86A 3D43A 1WIWA 4I8XA 1YAHA 3VPCA 3ETCA 4KUEA 1UKCA 4ZN6A 2CVFA 4ND8A 1HMYA 2BL4A 4OQQA 1GPMA 4OSEA 2ZWPA 3T61A 4QULA 1IATA 4X5OA 1XJ5A 1IH8A 1KFKB 1MQAA 3O3OB 4HL6A 4TN1A 2PD3A 5DN6A 4ZVLA 3SHVA 1ESZA 3BHIA 3RS4A 4UOQA 1P61B 3ET4A 5BWOA 4X54A 1R0KA 3GBSA 2A9KA 4EGFA 4Q37A 3BXPA 3REOA 1SHJA 3S7TA 4D0SA 3SI7A 1KIMA 2Z4SA 4JVNA 3ZD7A 5EXDA 5BYBA 1KOFA 3CEAA 1UKAA 4QJIA 1SVKA 3MJEA 1Y7TA 4G67A 4ZHQA 1L5WA 4KQXA 2OK8A 4EQZA 2ZXEA 3NTVA 4HNQA 1DTSA 4YUXA 2PSFA 1R3UA 2DFKB 1IY1A 4A5SA 2P0EA 4P83A 3B1KA 2Y1GA 2VOEA 2OP1A 5BV2P 2QTVB 1D1QA 5JJBA 1M74A 3PVSA 1E2QA 3ELBA 4WFQA 4BO8A 1JZTA 2XE6A 2Y92A 3H2BA 3ROTA 4RPHA 4EIWA 3E7PA 4KXQA 3RAFC 4D3FA 1LV7A 2VP5A 4C3ZA 4L6CA 1KY5A 3A6FA 1W1WA 5KWJA 4EKEA 1KDPA 3USZA 5C4MA 5L4SA 3SS8A 3WKCA 3EF1A 1H23A 4EY7A 3WB9A 1NONA 4OYRA 2Y4OA 3UHJA 3SFVA 1F38A 4K9OA 1ZC4A 3E84A 1PFUA 3ADPA 3ORYA 4KLAA 4YHHB 3G02A 3RVPA 3TF5A 3EPLA 1MW9X 3PRHA 2P5TB 4GKJB 3UMSA 3QYFA 5IAKA 4E03A 4K9PA 2FFRA 5HPYB 1VI5A 2G76A 2VP3A 4FEGA 3GOQA 4BGIA 3K5PA 1S3GA 4N5IX 5J2UF 1KK1A 1NQWA 3JQ7A 1LRLA 3PQ5A 1RT9A 3OM1A 1ZOLA 1JI3A 2H1VA 4Z9AA 3RROA 1YQDA 3PPIA 4PHFA 2HPHA 3UGQA 3R8XA 3V8QA 2UYCA 3NDPA 3TTTA 5A3QA 2UYQA 3KQHA 1NBMA 4CTMA 2OESA 4L73A 3ZY6A 4TTVA 2KJQA 1V39A 3IPLA 4EEKA 2XUKA 2RB5A 2PMEA 2Q5LA 3CRMA 4P4NA 4XWWA 1AXGA 4UMVA 2G71A 4P98A 2XT0A 2FF7A 4RPGA 3GCDA 3D4OA 1ZIXA 4B75A 4B1FA 1S6YA 1KFEB 1OZAA 3TAUA 1WBBA 5LVAA 3SBOA 2FWMX 1RM3A 1E3IA 2AQ8A 3IVXA 2QLMA 5KJEA 4AY3A 5G53C 1FNCA 1G3UA 1RJ9A 2J3IA 2EBUA 4RQTA 1WU7A 3LLSA 3OIYA 1G8GA 4OIFA 2P35A 4RV9A 2POQX 2BY4A 2R5WA 1QS0B 5FWDA 3MWLA 3LUCA 4LDPA 1RPJA 5C1IA 1BE0A 4RO0A 3G5LA 3UK2A 3TD6A 2P67A 4EG4A 4K40A 4MUHA 4AJLA 1H6BA 1VMEA 2DUNA 3IKMB 5KCMA 1RI1A 4I55B 4HEA1 4D4MA 1JG7A 5EKTA 4HEHA 3V42A 4HF7A 1E4VA 3FOEC 3CRW1 3L0PA 4ZVKA 2YJZA 3IP9A 3W4JA 4GOLD 1F3OA 2BI4A 1OB5A 4I4TA 1JHOA 4D3YA 4Q21A 3S8EA 1N2IA 4JR0A 3RHFA 4I4IA 3PENA 2G5PA 3FZQA 3BIXA 4JROA 4WAUA 4WBNF 2ZM6B 3I5MA 3OD1A 1U8XX 1VKRA 3ISTA 2Y6VA 4OUDA 5IJ9A 2RBEA 5JZBA 1E6UA 1X39A 4G07A 4MVCA 4ZCSA 5LKRA 2HU7A 4HQNA 1SVLA 2JEOA 2X9QA 3PX2A 1FNBA 4GBJA 3W9UA 5EJEA 4WBXC 3I2JA 3IMEA 1NJGA 1DNPA 1KZ4A 4F8JA 3PHCA 4NARA 1GNQA 3K0KA 1XGKA 1P9WA 2Q9BA 4PNZA 4YC7A 3T35A 4AJOA 4FM9A 2HWYA 4PLFA 5G41A 3NLLA 4Q3KA 2FN9A 3GV0A 1GR1A 4MQ6A 4QQFA 1S7CA 3W5IA 1G98A 2AC7A 2YYAA 2IYEA 2VDJA 3DB2A 4FE3A 3ZQKA 2R8YA 3EUWA 3REFA 1EJBA 3E0QA 5KAMA 4UE6A 4DJEC 2ZI6A 3TQQA 4Y7DA 2BHSA 3MWEA 1TVCA 3ORHA 2R62A 3LY7A 5KTTA 3MS2A 3GYGA 3WICA 4OPMA 2VK1A 2EBHX 2XRYA 1L6IA 3TXXA 4I50A 4Q4JA 5CR9A 4R9NA 4OI0A 1EX9A 3B5EA 1KY2A 4OVKA 4P4TA 1ESMA 3MTBA 1XQVA 2PCJA 4GKAA 4LXYA 4J1TC 3KYCB 1P60A 1V2HE 3W5AA 5H80A 4OHRA 4GXNA 3PHLA 3D1VA 2G1PA 1YNOA 1QK4A 1Y6RA 3UJPA 2QWXA 4J94A 5A05A 4O2BB 5L51A 5DM70 4LV8B 1ZJWA 3AEUA 4L9WA 3UJ8A 4KAFA 1SXJC 5CT6A 1DC5A 2AEJA 1FRQA 2J3QA 2XODA 4GW3A 4QRDA 1P1KA 3IQWA 2G08A 3JQ8A 3ORFA 3UPDA 3H86A 5LMZA 1G4UR 3O8CA 1C2YA 5GP1A 1BYUA 1YZNA 4LHYA 3V8EA 2OD9A 2DTEA 4CM4A 5BYKA 1Z0UA 1ABBA 2FZWA 4FGJA 4MYDA 3UOGA 3IEPA 2RGNA 2MCFA 4RTNA 3ULKA 4B9EA 4F5YA 3DYBA 1J90A 2HQ1A 2NQ8A 3R77A 3HLKA 4REQA 2PLAA 1HSZA 1ZUNB 3VZBA 1THGA 1UKZA 4KR2A 3AVYA 4YAGA 4YXWA 3V2GA 3EEBA 4R01A 5HGXA 1DAGA 2HCFA 2RAPA 1N1DA 1HA3A 3KTOA 4X0EA 3VR5H 1Y5MA 2IJGX 2CLKB 2R7LA 3CMMA 2XB6A 4G8BA 3IT3A 1V26A 4IINA 5DM1A 2OP0A 3TW6A 3EG5A 2BFBA 2ZXUA 1DJLA 3AVTA 4BKMA 1HDOA 4RHYA 2F9LA 5AK4A 3AYXB 1PJCA 5KNDD 5G1OA 1H8EA 3A05A 4DR2B 2R00C 1M0WA 3RC3A 3L1UA 4GYYA 3NS7A 4MW0A 1K5DA 3PU6A 4V03A 1Q3HA 3K8YA 3OU6A 2LBPA 3NHFA 2AOXA 1SD2A 3OP4A 4GX5A 3PFGA 4DIDA 1DO8A 1B8VA 2R8EA 3ZV3A 2VJNA 1YR8A 3HCDA 4KQJA 2LUOA 1V0JA 3U3DA 4GQAA 1SBCA 3PQ4A 3DNMA 1JWLA 1U28A 4IHAA 4S0XA 2ZE8A 1YZYA 2QK4A 3BHJA 3IE0A 3K8OE 3R6GA 2ZRBA 3FVVA 5HTKA 2PV0A 2OAP1 2IEIA 2FSUA 4U3JA 1TA9A 5KEIA 2VDNB 2JAOA 2DMRA 2YW2A 1HBJA 3FMIA 4CODB 1T43A 3UAZA 2CJXA 1T91A 5EJMA 4JC4A 3GT7A 3WQSB 4CTOA 2ZSHA 3SVLA 3NGXA 4IM7A 5DNUA 5IC5A 5JDCC 4YUWA 5E8JA 5EXEA 3WNBA 3EVTA 4A03A 3AINA 3DZCA 4EI7A 2ZREA 1E7WA 4GEKA 3AHGA 3MIIA 4MV3A 5HGJA 4MGKR 3T4PA 4C6RA 3TLGA 2MINA 3KVOA 4FMCF 3AHDA 2QUIA 1RYFA 4ZCQA 5JEEA 1KEKA 5EIBC 1C7ZA 1KYTA 2D2VA 2QZSA 4JJZA 1VYVA 4AS3A 5F98A 4CMIA 4BZZA 4A1OA 1Z3CA 1GD1O 1E3EA 4FNAA 4PSUA 3U9SA 3F7OA 3WHKA 4XW2A 2CYBA 1CR4A 1EVKA 2HL6A 1SUBA 2A2ZA 4UAVA 3EXEB 4BB9A 3S4YA 5EXTA 4QYSA 3MTIA 4DYHA 3OTWA 1DAMA 5D51S 5DP1A 1FFSA 1MD9A 2R66A 5A4AA 3E15A 1JR3A 4YJFB 3M9LA 4EX7A 5JXWA 1TJ3A 1GZ5A 1UC4B 3JPYA 3VKVA 3LH5A 1N57A 1M2EA 4Z2AA 2YCBA 2VXOA 1FS4A 1KP3A 3M1AA 5FUYA 1M76A 3TSAA 3CXRA 1EGVB 3TLMA 4BAZA 4LSZA 4JXXA 3A3NA 5C4IA 3PGLA 2C9BA 4FHGA 4KDCA 1ONSA 3NP9A 1RYBA 4DUPA 2DHCA 3FJYA 2BEUA 4L7QA 5DJ5A 2JFFA 5DTMA 3N6RA 4ENVA 3BH7A 1F8YA 2GEKA 3EXHC 1JMKC 3MBOA 2CYCA 2B98A 3O4VA 4U8HA 1Z29A 1C14A 3UMGA 3GP3A 3OZWA 4FYYA 3FYUB 3KSBC 4H60A 2B69A 3RQIA 2IDJA 2Q2OA 1YRBA 1NUPA 4MRVA 4YO8A 5FBHA 4P7FA 3SEFA 4BPBA 5FOQA 1EM8B 3Q40A 4P22A 1QH0A 1JVNA 1Z6TA 3TLYA 1UBSB 5LU9A 3EOAI 1KSJA 1BDJA 2XTZA 1CIJA 1MVOA 2FVYA 2NO5A 3G5UA 4K1XA 3T9DA 3IVMA 2X0KA 3C7CB 3LXRA 1ENPA 4DTCA 3I4LA 4EG5A 3AV0B 3RR2A 1B93A 1YE3A 1JWAB 3FG9A 3JATA 4MO9A 1X1AA 1O57A 2WIKA 3PNQA 4G2NA 5ALNA 1TMGE 3B2QA 3HXQA 5ECDA 4MI9A 1N75A 4QC2A 4XKJA 4QDJA 3WKDA 3ZCRA 5IW8A 1UPTA 1UODA 1KBOA 2AA3A 2R96A 1C9KA 3CJRA 4FEAA 5CPBA 5IKXA 3F6SA 2QE7D 4IV8A 2X6QA 3ESAA 5B3LA 9GPBA 1SQ6A 1VBKA 5D00A 1NF8A 4UPEA 2WU1A 1FOEB 3NP7A 1BA2A 2H9YA 2A67A 1H2XA 1JEQA 2V9ZA 2WVGA 3LCVB 4G2TA 1KZ9A 1VP3A 3W5UA 5HK9A 2WU8A 4V0LA 4ZAXA 1L5RA 3IIMA 1L4GA 5JC1A 1GPLA 1ENOA 1JU4A 1UBLS 1Z26A 1Z74A 4IX9A 1P18A 3PICA 3HCFA 2BZGA 1PJRA 2N1BA 3HE3A 5EY5B 4WVLA 5FP0A 5HX7A 4W8OA 1QTQA 3EVBA 2KM1A 1U3GA 2H4FA 4N8EA 4XYGA 4OXRA 3YASA 1FJHA 5JAPA 1JT2A 1RHUA 2GCGA 3IMKA 3UB3A 3WYBA 4C22A 1VP9A 2RGRA 3T9FA 5KKNB 3FSRA 3V6LA 4CR6A 1DDGA 1KH2A 1XNJA 2VG8A 1EMDA 1MB9A 3GXBA 1KDRA 4OK5A 4LRYA 4ZQCB 3ZK7A 4PX2A 4AP6A 4CZ2A 5JCZA 1JPUA 1MO4A 1Q7TA 2J67A 3PUVA 3BGSA 2GPAA 2WHQA 1YZLA 4WZAB 3T95A 3LT1A 1TU4A 3MAGA 1W46A 3VC1A 2DEUA 1V2GA 4OV6B 5DCWA 4RFLA 5E4TA 5K2MA 5FNVA 2ZB4A 3Q3HA 4MGIR 4D9CA 2UYOA 3G7UA 4KRFA 4PR0A 1LDYA 2X3YA 1QIFA 4HRYA 4I7EA 5I7WA 1BWSA 5DTRA 1Q1GA 2FZ5A 4CHGA 1X3SA 3RDPA 3SJ7A 4CM9D 2AFIE 5IHPA 3WYGA 3H2KA 1CIPA 2CFCA 4LRWA 3REGA 4YV0A 1YU6A 1NVKA 2VNJA 4PFQA 4KMOA 1JEOA 4XTCS 4W1RA 2C4TA 4O6VA 2ZM5A 1HZZC 2O0LA 1B41A 2ODEA 2JDIA 4RS3A 1KYVA 4MJ7A 1OVGA 3EGEA 3UAGA 3LC7O 1AA6A 2EYUA 3QXHA 3LZCA 1JDJA 1F6DA 1I6MA 2C4NA 5IAGA 3U56A 2Z2JA 3PQ7A 1LX6A 1E1DA 1Z4OA 1ZU5A 2V1XA 5CVCA 4ZOEA 2BC9A 3GLIE 2CXXA 1EFTA 1WF3A 3W8EA 1MGPA 1LRJA 4FN4A 4YT2A 2A5FA 2Y1XA 1DAKA 4D7AA 1ZRHA 1E61A 1LPBB 1QDEA 3M1YA 4GMKA 1HH4A 3GNSA 2GN8A 2E89A 1U8ZA 3PL1A 3I4CA 4WADA 4IJVA 2K7ZA 3T1OA 1OPXA 1SVSA 3MMNA 2H11A 4WCFC 5D2CA 4GL2A 3AWIA 5FOUA 4E21A 1GTJ1 3ODGA 1H94A 4RJIA 7MDHA 3D0KA 4R81A 4RJKA 1IB6A 3TTSA 2C5HA 2WD7B 3DLHA 3DBRA 2O0MA 3K4HA 1A4XA 1RKVA 1RSZA 3LU1A 3SC2A 2RGEA 3AF2A 5FBQB 2CXNA 2PZMA 4EBBA 4P0QB 3PT9A 3VU3A 4AO8A 4RTLA 1Q22A 2Y9PB 3RVRA 1J0BA 3PXGA 4BCCA 1J2EA 4DMHA 2PLWA 3NHYA 1W35A 3E6AA 4KVZA 1ZGBA 4NYJQ 4NZNA 1OAOA 1M1YA 4I1VA 4RL4A 4LRTB 1A04A 1G1MA 3BF7A 3LXMA 4NF2A 4S3MA 3BRSA 1IMOA 1B15A 1XE3A 2ATIA 1I5EA 4Z99A 3WAKA 1BQ4A 2DY0A 3D5EA 5CBKA 2VTEA 1S3FA 3AG6A 3DBHA 4PFSA 2ZUUA 4A0QA 2FP4B 1GTVA 1X8JA 1TVEA 4P58A 1QCYA 1Y1LA 3KT3A 1QNLA 5C4GB 1A82A 2YV4A 3QNWA 4BO0A 3W9SA 2DUMA 1S2MA 4COKA 3Q88A 3A1UA 4L3VA 5CNJA 3SQMA 1KO1A 4XGIA 4EVQA 1A71A 2WQ7A 4ZCIA 3BHMA 4RDIA 3UICA 1XVVA 1FF9A 2C4WA 3KCQA 1OXBB 4LNUA 4N9WA 4YT5A 5C7OO 4KGZA 1OUMA 2GEVA 4WJZA 3E1SA 2ESRA 3BTSA 2HWXA 5DBOA 3RYFA 2WKQA 2PA0A 3QXJA 1T4CB 2FK8A 1CQIA 1WP9A 2GPYA 1GPWB 2QJRA 1LJLA 3A8TA 3B3AA 3N7AA 3R3UA 1KS9A 3A10A 4M38A 5COQA 2VT3A 2JBWA 4JLSA 2PSHA 9MHTA 3EMDA 4X90A 4F11A 5CT5A 5BT8A 2REQA 2Q2QA 1WCWA 1BDMA 1RRMA 4O2AF 3OZ7A 1Y4UA 1Y1KE 3TZBA 1WOYA 3HRIA 5EIAA 1Z39A 4A4DA 4B4WA 1HE2A 1AGXA 1MAVA 1XN1A 1QGOA 4TKVB 1WEHA 2VCHA 3Q5DA 3AVVA 3CO5A 2YWEA 1ZYUA 3AUFA 3RGGA 5B30A 2CDRA 2YKGA 4A5OA 1GG5A 4MVWA 3AHIA 4LXIA 1X7DA 2NVWA 2FEMA 2GK7A 4KIJA 1NNI1 1GAQA 1N6HA 4D8WA 4JI2B 3U39A 1CUIA 3AF0A 3TDMA 4BJ3A 2AEEA 3B7GA 4MP8A 1NXSA 4TMKA 3L6RA 2GDJA 1WXHA 4DCOA 5BSFA 1FIUA 2FUCA 1WDKA 1UT8A 4XR9A 4C0XA 3HO1A 2I6UA 4B6FA 3CLTD 4KQ2A 3F9CA 4LJAA 4LXTA 3A26A 5A4IS 3P0JA 5CVTA 1DHTA 1B00A 4O02B 1EP2B 3C3CA 1JHQA 1CJCA 4PICA 3IAEA 3PD0A 3EDYA 5IN4A 1GYRA 3UY4A 4QNRA 1UMKA 2EW2A 4BNVA 4XVHA 1X1BA 1YSCA 4B8YA 1P74A 2W2OA 4TXLA 4PX3A 4IPTA 4PLZA 3WNVA 1SHUX 5J43A 2F43A 3VV2A 3I6BA 2GZ3A 3FTNA 4JAVC 3HPQA 1ZZGA 5LDGA 1AK2A 1R18A 4GE3A 3LX6A 4Y6OA 5JWOA 3H2ZA 4HAYA 1AA9A 1KJZA 2ZI3A 3MRVA 5KNCD 2AKEA 1M33A 5FCDA 4BFXA 3VVLA 4IRUB 1DAHA 3ILYA 2GXQA 1WXDA 2BOVA 3PYXA 4DCNA 2C4KA 1CNMA 1Q21A 2WQZA 4D4JA 4Z54A 1M2JA 1WKBA 2W2LD 2ZSKA 3BDVA 1PQPA 3KB6A 4PWYA 4Z4FA 2AJCA 2DJIA 3BTVA 3DCNA 1X0VA 1UFQA 1GZDA 5HIMA 4D79A 1J7JA 1E9RA 4CLDA 2ZJ1A 2VYFA 5BUQA 4FKZA 5E8RA 1P77A 1ZSNA 3TRJA 2J5BA 1W4LA 1AK1A 4HVTA 3MB8A 5A3VA 3C1OA 4LOJA 1L2TA 1HOXA 2EEPA 1SG0A 5CD9A 3GXOA 1RW4A 2UZAA 2FWIA 1T2EA 4JU9A 3SXUA 1BCSB 3QFSA 3S2UA 4A73A 1JV2B 4XB6B 3BFKA 4YV2A 4HXGA 3OTQA 5JIBA 1EBUA 1RWKA 4YACA 2A57A 1YO6A 4MUEA 2IVFA 3VR4H 4B8ZA 5KBYA 1XD2B 5C1OA 4M1MA 3ZKWA 1D04A 2NP7A 3N7UA 521PA 5AT1A 2JCGA 5EE0A 5CH5A 3IIIA 4GSLA 5TS2A 1O8BA 4FMCB 4S2UA 1KMMA 4D26A 1DBWA 4J3FA 1Y4AE 2H9IA 1PX0A 1UEXC 3EVAA 4DPMA 4A15A 1MC1A 1MJGA 1U2DC 3ZQ4A 4A0HA 5LBUA 3S1AB 1Y3HA 1XDSA 1VBNA 1YDGA 4O4HA 1KJ9A 1L4FA 4RK1A 3VC7A 1BKDR 1PT7A 1XDGA 3IILA 4JLJA 5HJEA 3O26A 1E9AA 4ZMSA 1Y34E 3WLFA 3IL2A 3RVLA 2GZ1A 3DKIA 4W7HA 4LBYA 1EZZA 2Q3CA 4OHWA 2GK3A 4E3WA 4AY2A 2ZVDA 2DULA 2UKDA 4L8FA 5H82A 3UWKA 5ECWA 3ZW9A 3QJGA 3WE7A 3R5SA 4R2HA 5LD2C 2HDHA 2BV3A 2GJ8A 3W06A 1CQXA 1G8JA 4YAOA 1BDIA 3ROQA 3K6JA 3FYSA 5A3JA 1GZUA 4KODA 3CX4A 3RT9A 3UV6A 1QGED 2HYDA 2XXJA 4FI3C 3MIZA 1Y8RB 5IKPA 5D7NA 1TC1A 3K70C 2NGRA 2CNOA 2HU8A 3W3AH 2WA1A 1EXWA 1IBLB 1JG2A 1K7CA 5LQNA 2FZGA 3DTYA 4ZVNA 4BZQA 1GEGA 2VUHB 2C8KA 3AIOA 2BFPA 3QGMA 1GV0A 3LIPA 4U7JA 4ZT3A 1IHYA 3FNGA 4GVPA 4CKBA 3E9RA 5EHQA 1NHGA 2WKSA 1T1SA 2JCBA 5SV2A 3TEFA 2ZBEA 3Q7EA 2EF0A 2XIJA 4RFVA 4B82A 1LCIA 1MB3A 1MQ9A 1Q7CA 2CMKA 3NW9A 4OIMA 4OQYA 3UB4A 1L5HA 4R5HA 4C5CA 4DQKA 2FZKA 3LYLA 2WOJA 3COVA 2OORA 4YROA 4DAEA 1UFKA 5KX5B 3EYAA 2Y1EA 3VDXA 2HA6A 5BOSB 4QU8A 1KYQA 3T9BA 1A1VA 2BFEB 5FFMA 4NX2A 1JXOA 1VL6A 2ETVA 5A7GA 3SYKA 1J70A 1KI6B 1RYMA 4I9GA 3AYZB 4MDYA 4G5QA 1FUUA 1EDEA 1QHHB 2Q9AA 3GVPA 2VRWA 1GKIA 3WWYA 2EHDA 4ENPA 5KJCA 1HL7A 2H4WA 3TOCA 3BXGA 1HYHA 4BGEA 4AP5A 4HNUA 1CUEA 1D2MA 1US8B 1XELA 3M33A 1XEAA 4AT1A 4W9NA 4X1KA 3IE2A 3O91A 3SMVA 4BMYA 4BQEA 4E94A 5B58C 3Q8KA 1X80B 3LL4A 3QFFA 5LYJF 3WK6A 4C9BA 4QGFA 4EFMA 1T4DA 3DBLA 1UPCA 3T4UA 4FP9A 5DCLA 3NHZA 4AULA 2BFFB 3EXAA 4R7GA 3RBZA 1VG8A 1DKUA 1UPFA 4QRIA 4WZZA 4MIEA 1BGXT 1OBFO 2C4HA 3JY6A 2VWHA 4FE7A 4JELA 1DX9A 2NIPA 3B9QA 1NJSA 3N86A 1C50A 1WB5A 4OQFA 3U1BA 1H9CA 3UWOA 4BVKA 1WP4A 1RKUA 2PG3A 3OIVA 2LRHA 1NLUA 2XWPA 2J0UA 4ZIRB 3JWHA 4ZQBA 3FWYA 1Z62A 2JHGA 2AW3A 1UM9B 1KKUA 2J3JA 1JEEA 2W8BB 4ETWA 5EERA 1FMJA 1QG2A 2X8BA 4O08A 4L72A 4ENUA 5TGTA 1VSVA 2WNSA 2CD7A 1N3IA 3KJGA 3PEUA 3NATA 3SFTA 3KSUA 4F3CA 1T1EA 4PLYA 3ICPA 4M0PA 2Z83A 4CG3A 1KU0A 1RLUA 2JJMA 4H1VA 1G0OA 4CIWA 5G0SA 3V1TC 4M37A 4BN0A 3N3AC 2QDKA 3PR2B 1H2EA 4BKUA 1X1EA 3RSLA 4DWJA 3VPHA 5K2OA 2QR3A 3B8EA 3CX8A 3SU8A 1LC0A 2VK8A 3KVYA 2BSXA 4CMAA 4F2DA 5F3RA 3UUEA 2OG1A 5CM2Z 3P9SA 1OU0A 5BOVA 1VM6A 1O94C 4MR8A 4B84A 1YS9A 4P81A 2Q6LA 3E3LA 4UEOA 5BSRA 2O7SA 4WEOA 4D57A 1WKCA 3CNLA 3TNLA 3ROFA 3M6FA 3HKEB 2R8ZA 3NBQA 1E8MA 3U49A 1SUIA 1UPUA 1JA9A 1XRQA 3AR8A 1W1UA 4OP3A 1OZ0A 1NRWA 1TJPB 2X3UA 2X8LA 1KF0A 1T1JA 4K05A 4KR0A 1X8LA 2JJQA 3GQVA 2GWRA 3G0CA 4NE7A 1M7HA 2VBGA 5K3AA 3ZW7A 4DKXA 1TO2E 3VAAA 3GJQA 3JR7A 1J1IA 3QEMA 1Z4JA 4FYVA 1SG6A 2BMJA 1BDHA 2WWGA 1IIBA 2DFNA 3PGVA 2PL3A 4TKUA 3TLAA 4B9AA 3WB1A 4LCJA 1XU7A 4M87A 1U2QA 1JF8A 1O6BA 3BCRA 3MCZA 5AM0A 3WRXA 1DRVA 4CKZA 3B6IA 3IPRA 3LRTA 5FI3A 1YVPA 5E7JA 4NICA 3AERB 4BQFA 4DSUA 3FUTA 1DIOB 1CZUA 3PNLA 4FQ8A 2QTHA 1PTJC 2GN0A 1GPNA 3C45A 2YWDA 3EDRA 2LKDA 2ZAIA 3JWGA 4NLLA 5TQ0B 4B3XA 2JHCA 1SCUA 2WINI 2OO3A 5I01A 1MW8X 4XFJA 4R8VA 4ZCLA 1JFTA 5A0VA 1RZUA 5B1DA 5BSTA 3DZJA 1BOFA 2CSUA 2H2FA 4WIAA 3LY5A 3K7EA 1M5TA 2H1IA 3QBDA 4FTWA 5DCUA 5TF4A 3WL8A 1E7YA 5CYPA 1V8PA 2GCPA 3R5XA 4F6LA 5HJ5A 1BMDA 3QMPA 5DHFA 4FHFA 4MYSA 3ROZA 2Q1XA 2IYFA 1E99A 1VZ2A 2VQSA 4Z9FA 3WGLA 3FTFA 4PGGA 2QE7A 4K6CA 2PO5A 3OH8A 3AUAA 5DYTA 4C4SA 2PGAA 1M6HA 3AP3A 1KSGA 5CH8A 1S8FA 1L5LA 2QRVB 5CLJA 1BMFD 2OLJA 5FLYA 4K87A 3QFHA 3STHA 1CWUA 2J5QA 1Z0FA 3BT7A 2XOKD 5DYWA 1B8NA 4K88A 4TX1A 1E2DA 1MIOB 1OXXK 1RWPA 4B7CA 3COZA 2PZGA 3DG9A 3ND5A 3NAMA 3PE6A 4FSDA 4OG2A 4P3XA 1W29A 1II8A 2F67A 3IR5A 4WZAE 4YAEA 2KB0A 5EJIA 4L9AA 4KXWA 4F8EA 4RL6A 3VI3B 3NIWA 2AKAB 4KRGA 1B23P 2XUJA 1KP2A 1N6NA 5JAUA 3Q2IA 3UHOA 3SX0A 1OLUB 5G0TA 2DY1A 5JAHA 1DIBA 2JFBA 2D2EA 1XRRA 3CRZA 1FP2A 3IEKA 3IS3A 3LUHA 4U4AA 4ZTUB 1DZIA 1E2EA 4LS3A 3UT5B 1E9CA 1WEKA 1OXVA 4JUCA 4ZRDA 3PNMA 1D8AA 1GA1A 4RF3A 4EDFA 3P2EA 5LB4A 1R0BA 1K06A 1OW3B 3EA5A 1R5JA 2BISA 4F1KA 3P9CA 4RTRA 4OFWA 4V0RA 1KDVA 2VDQB 3SLGA 1UMCA 4O2AB 4WASA 3QK7A 1V1RB 1YCHA 2HA2A 4LJSA 3WIEA 5KQLA 1X1SA 4BP9A 2ZCVA 5CA1F 1P2UA 4CM9A 4DSZA 4Z53A 1RWBA 2ORED 1KORA 3LF1A 3A1CA 1ZRMA 5IC4A 2VIIA 3GLGE 2CYAA 2NSHA 1IBMB 1XZPA 2PBFA 2VWGA 5K0CA 5GM1A 2IYPA 1MU0A 2HA3A 5HEKA 2CLDX 4DF3A 2QM8A 3ESXA 1HDXA 4OYLA 1XWIA 2ACVA 3DE5X 2YZNA 4B3JA 1C7FA 1Z68A 4QZVA 3MVEA 1LW6E 1NJ6A 2XRMA 2EFYA 2WJYA 3F7MA 3WNCA 2HHHB 3HBAA 4OD0A 3AFMA 4PLCA 4CG0A 3B89A 5JYDA 3KB2A 2DQ4A 3EWSA 3ZXSA 3DT9A 4H9GA 2O2IA 1DG9A 1X8KA 1ZCAA 3JTMA 1DL5A 1MABA 1T4MA 3IOYA 3NH6A 2D0OB 2IEBA 5L4NA 5NULA 2VJMA 1TQ2A 1FYWA 1BVUA 4NVRA 4RELA 4UMDA 4K9LA 5DIZA 3IUPA 1H3EA 2XV1A 2Z08A 2CSXA 1NJFA 3DE6X 3WMEA 4F1WA 5JYCA 1HE5A 3EODA 1NOJA 2JJ8A 3GZJA 1VLLA 4MULA 1JMYA 4MKFA 1Q0LA 1JAHA 1OWLA 1EAYA 4QPCA 1YS6A 1W9MA 1L1FA 1MT3A 2G1AA 4ER6A 2YHAA 1QZTA 4HWKA 4PC7A 3SAJA 2HMTA 3WWOA 1SCIA 4YVFA 1ODSA 4AF7A 3T3GA 3FGZA 1HRKA 4F5DA 2ANBA 1BE8A 1PDOA 2P9EA 3V8RA 1L5FA 2DQSA 4OQ4A 4YH1A 1UPAA 4A7PA 2H3EA 4ZOBA 1V5WA 3QPVA 1XYGA 1XK7A 1ECGA 3W2EA 4AG5A 3GT3A 4U1RA 3GHYA 3ZXUB 2BHNA 3N28A 3DF7A 4U8GA 3UFBA 1XG5A 3ZTTA 4KE9A 3AM4A 1M2WA 3H8WA 4TV9F 1RZ3A 2B99A 1MOZA 4R0MA 1GGEA 1JKIA 1U02A 2J4DA 1K4YA 1BHJA 3OQNA 1MTZA 5C32A 1GUZA 3QWFA 3H3JA 5DF1A 1DRJA 1KYXA 4FFRA 1I36A 3DR3A 2F90A 3SBEA 5IX8A 1PL8A 1H4TA 3IUQA 1HEYA 1OASA 3IOEA 5F1OA 1DEKA 5ED0A 4UUBA 3VNQA 5JH7F 1E9DA 2CHGA 1IONA 2SBTA 4C7MA 5H8WA 1FLDA 3B1FA 3CW9A 5G4LA 4CGYA 4R2MA 3KKZA 2H1OA 4PTYA 3I9LA 3KFLA 3RSSA 4IJQA 4Q7LA 3PJGA 5BURA 3Q3GE 3H5LA 3QOYA 5EJ4A 2O2EA 1Y8QB 3C3MA 3EZ2A 4MROA 4YN3A 1VSQA 1GPDG 1NXXA 4KRXA 2VVTA 4WDRA 5FA6A 3PEYA 1U8CB 3L7MA 2A9PA 3ORQA 2Z58A 3LS2A 4MV7A 3SC6A 4DM7A 4HLUC 1XZAA 4NG4A 3V9AA 5K0TA 1YZ3A 2D1FA 2VH5R 2JI7A 1OHHD 4PCAA 3NOOA 4TLCA 5LD2B 4AWAA 4PXYA 3LKZA 1IUNA 1I1NA 1K27A 1YVRA 3I6MA 4R1PA 4CL0A 2CXQA 4W8HA 1JZQA 2ERYA 3M5DA 4WHMA 3TEMA 2VWQA 4S1NA 10MHA 3O94A 3RJ9A 2HW8A 1DT3A 3OECA 1FP4B 3KQSA 4XD2A 2PQ0A 4QX6A 3KEFA 1GP2A 1MJFA 1M34B 3FDJA 2BCEA 4PZLA 5FPYA 3GFSA 3AOEA 5DGIA 3RQSA 4GQIA 2PUWA 2Z9DA 3N07A 3ES9A 3EDCA 4YJGA 1Y7PA 4AQYB 4R2WA 4G85A 1E18A 2ET6A 4PHTA 1FNNA 4QJ4A 4RA9B 3VR0A 1TB4A 4FSHA 4KZPA 2RJ3A 2CJFA 4BVGA 3FPJA 1J09A 2PMWB 4EHFA 5FWXA 4DMKA 3QA9A 3FMVA 2JKYA 2PFSA 4BE9A 4EHAA 3W8DA 1XPOA 2Y1OA 1WR8A 3OZSA 2ZJAA 4ROSA 1KPGA 1SC9A 2ZTSA 1CJTC 3CZ9A 3GDOA 1R7RA 3RYHB 4BKPA 1G5FA 3CTPA 1R2QA 3LXXA 1ISJA 2W2TA 5L3ZA 3I39X 2YH2A 4Q12A 2FSVA 5COAA 1RFGE 4DPLA 4K2HA 4FIDA 1AB6A 5KNCA 3VM6A 2Z2ZA 4ZI7F 1JHVA 1P91A 3CZAA 3WC4A 3BFPA 5IDVA 1UT6A 1U0HC 3TLZA 3PPVA 1UJNA 2CLSA 4M0UA 1G7CA 1P75A 3BXZA 1RYYA 3MQ2A 2W2LA 1K8XB 1JYEA 3X1DA 1FC0A 3R75A 1VLMA 3HSSA 4FGSA 4ZYLA 5LC1A 1RXSA 3AZOA 3WX0A 1DINA 4N01A 4BTLA 4RABA 4D2IA 1TTQB 3O6VA 3M3DA 4RK4A 1E79D 4W7IA 2OVFA 4JIMA 4LX0A 1YJXA 3OZFA 2VTBB 4Z4GA 2REBA 2ZT6A 2GBCA 3G0IA 5I48A 5KAPA 3R4VA 5ALZA 3SFZA 2R3SA 4IGKA 4BO1A 1KMHA 1UCFA 1I30A 3BJZA 3MJ4A 2VA9A 4C20A 5LYJB 5BNZA 4HX9A 2C7GA 1P2DA 2NXEA 3H19A 3SBDA 1FMLA 3D8HA 1JSXA 1FCJA 1O2DA 3ESRA 2DWQA 4FCWA 4MYTA 4Z86A 1DMSA 4UZEA 2R2AA 3A0RB 3AFNA 1KPHA 4QU9A 2HWKA 1WDLA 4P5PA 4MVJM 1SWWA 3AHHA 3S8MA 2EGHA 5EIWA 1J5PA 3T0IA 3CCFA 1R6DA 3IDFA 3JQGB 4XCXA 5EN4A 3EY9A 2O14A 1T29A 4HB0A 4L74A 3G0DA 3Q3VA 3RASA 4JBHA 5H9VA 3VQTA 7ABPA 1V8ZA 5FPQA 4LHSA 5K8CA 2AXEA 1ULSA 3QPBA 3H1GA 3T1NA 4CT0A 1JB1A 4F72A 2O8EA 1NLZA 4Q93A 5LBTA 3F49S 4HO1X 2QMEA 3RU2A 1PG2A 1AKEA 1CUJA 1FNSA 1RMQA 2CNLA 2HK8A 4HQKA 4U6QA 4X61A 3GY0A 1SUFA 1XEXB 4E33A 2A1UA 3TRDA 3JTEA 2VTKA 1MO3A 4LBZA 4Z1MD 3L7YA 2YINC 3SDBA 2QHXA 5EKUA 1YZTA 2ILVA 2PX4A 1H1LB 2W8ZA 3NOVA 1GCGA 4V0ME 4N3NA 3DR5A 1AKVA 1TT5A 2P9BA 5AOVA 4N5DA 1OQAA 1WMSA 4LOKA 3T0GA 3CQ9A 1RYDA 5BV8A 2XCSB 2CLMB 3QXGA 2WWVD 1NW7A 3MT7A 4WVFA 5KTKA 3Q8LA 3AJRA 4OH7A 3UJ6A 1CEYA 1NW4A 1BCRA 2WYIA 4ZOLA 3KL4A 3RODA 2GUGA 1HDZA 2QORA 5FD8A 4KDRA 1XCBA 2NLOA 2D1RA 2Q7XA 3BSFA 3BMQA 3LPLA 2P4EA 2OXCA 5CA0B 3HZOA 3PNYA 1JGTA 1DADA 2DQKA 2QMQA 3T9CA 1T9KA 3DDZX 2G63A 2R6R1 4JLKA 4EA7A 3RUEA 1IWBB 4MEJA 2XMPA 2ZIFA 3IV9A 1STOA 2G1KA 2QBYA 3OE7D 1AQJA 5AM2A 3CC8A 3LY9A 4XWOA 3WLIA 4B47A 3GROA 4LGMA 3VAZA 4BKOA 4IHJB 2D2IA 4NE2A 6AT1A 1D0VA 3ZDFA 3EXIA 1Q57A 3RUDA 4ZVPA 3PFBA 5IDYA 3DP9A 4MK4A 2PUAA 4KAXA 2WMYA 1UBEA 1GVNB 3QQ5A 3Q7PA 4EW6A 1ZGHA 4GS5A 4CM3A 5K5EA 3GJRA 2GEDA 3Q6MA 2R8OA 4WA8A 2OFXA 1Y33E 2WZDA 3C3AA 3SM9A 3UJBA 3WYDA 3CA8A 4KKVA 4EO9A 3AW8A 3BE5A 4FS3A 5K3SA 4ES6A 3VA7A 5AKIA 2Y2UA 3P0RA 5BWBA 4FQ5A 4JV5B 4DWOA 3VOTA 4RF2A 1CUUA 2JVJA 1PJZA 3QP9A 3W9YA 3FM9A 1UDWA 2Q2VA 1W36B 1MV5A 3TR5A 3D3NA 3FWPA 1QF9A 4LZJA 5HXAA 5KNBH 2FFHA 3WSWA 3STXA 3WS7A 2WIGA 4KPGA 1HEUA 2IHUA 2JB9A 1LGYA 3DLAA 2JLCA 3LCUA 3OJCA 1KR5A 1JSZA 3K94A 1NXPA 4OHOA 1NN1A 1LVGA 1J56A 3OX4A 4Z51A 5KIAA 4JZYA 1GKYA 1USGA 3NHLA 5IYZF 4G89A 3ABIA 1G20A 1T3SA 3A27A 3QU4A 4QXMA 5FADA 4YUVA 1VMAA 4D9EA 1AS2A 1T0HB 2OM2A 3TJZA 4U39A 4QNMA 1E5QA 3G0HA 2I76A 2YYSA 3ZVNA 1A8UA 1HG0A 1JR4A 4QM7A 4QUGA 1XDZA 3NANA 2J08A 4FXOA 5LMCA 1E3JA 1Z2NX 4N6GA 1JDBB 1UMDA 3O82A 2GESA 3WDSA 4DABA 4DMLA 5KZMB 4RPJA 1NR5A 5ES4B 4G37A 1QK5A 5DNYB 2DR0A 5L7WA 2J9FB 2P1ZA 3C3DA 4GI1A 3SF8B 4Y2RA 4RIEA 2PBZA 1U8FO 5AWFC 5CA1B 2D3TA 4P80A 2CLCX 3RS5A 1PW5A 2OHFA 1GNRA 2WB4A 4CR8A 1LK7A 3LTNC 1E0JA 1FZQA 2NUTA 1FFDA 3SSNA 2JJ1A 4R54A 3UNXA 4ER7A 4C4XA 4HVLA 1GR0A 2FR8A 1V8FA 1VPLA 3HFSA 3MYYA 4N5MA 3R8CA 2J9YB 3RTGA 1IM8A 1SUPA 4RZXA 5TMEA 4RTJA 2ISSD 3K5WA 2FV8A 2SCUB 3ESCA 3B48A 4LNAA 5AVVA 4D25A 4ZP1A 1FFBA 2C2MA 4O2LA 4XAQA 4TQUS 1FSSA 1U5BB 4FINA 2EKLA 2GAIA 2NZ8A 2P2DA 3EF3A 2W2KA 5CDTA 5KU7A 4JJ8A 2JK0A 3OI7A 1N32B 2WV7A 1Z5OA 3GPIA 2H5JA 1QVZA 5KSOA 2GWHA 3S44A 1SMKA 3TXAA 1SU8A 1V16B 3AHEA 4DIEA 1Z0IA 1IQ0A 1K5PA 3A7DA 2Z95A 4NPCA 2GD1O 5DW3A 2GN4A 4JBNA 4QG7A 3N2KA 5SZIA 4LXXA 3FMPB 3IAFA 2JATA 3GZ4A 4TLDA 5A9TA 1IXZA 2LDXA 3CKMA 4IVRA 4G5YA 1W4AA 1C9NA 3L7JA 1T9DA 1UDAA 2XZTA 1WXQA 4F1JA 1LTQA 8LDHA 4TWZA 3LYAA 3COJA 3ZWYA 1GYQA 1Q1BA 3KVVA 4BHTA 1SOWA 2CLIB 3D5QA 3HVKA 2DVMA 3P97A 4FX5A 4LHZA 2EF1A 3VPSA 5JR3A 4JBYA 1BMFA 3Q1KA 1ICIA 2GO7A 2X13A 1T9AA 2XOKA 3GLKA 1FYXA 1KI2A 3TNFA 5JD3A 3FUVA 1J06A 2G0AA 4UM5A 4IFEA 3S0JA 3WKAA 4CJXA 3VYUB 2ZYAA 2EQ5A 2GKSA 4ABYA 1FLAA 4YYZA 2QXTA 4AMZA 5LKAA 2UXBB 4R6XA 5FORA 3HN2A 5ULLA 2CDBA 4M6WA 3T99A 4LRUA 3UK6A 1AS0A 5BUZA 2JIOA 1TF2A 3G59A 1R3DA 2YXNA 4R40A 1T4BA 4P32A 4WJKB 2A35A 5ERGB 2Y67A 3MERA 4FE4A 5JH7B 3D4BA 4K5QA 1Q84A 3MGGA 1VPWA 3VOBA 4CKWB 3L6BA 3HL0A 4DVGA 2RDMA 1T8WA 1L5ZA 1V6CA 2OLEA 3P0FA 4G0ZA 2CXPA 4F7DA 1JHUA 1K4KA 4F6CA 2H54A 1FQOA 2QD4A 1O4WA 1QV7A 2IS4A 3A2NA 1RS0A 1ZU4A 3CLRC 4FQ7A 1PT8A 2BJVA 2H2HA 5TF0A 4ZVVA 4DR5B 3D31A 5BO5A 5C8VA 5BR7A 3DV2A 3PBKA 1MQ8B 5AK0A 3Q7RA 4AKGA 1F06A 3J81k 2Z8YM 3P7MA 2DE0X 5K3FB 5JY1A 3ONEA 3AL3A 4J1QA 1FTNA 3E8SA 4WCDA 5JQGA 1OH7A 3TJRA 4I2NA 4BZWA 3Q6IA 1OYWA 5D5HA 3SQXA 2B3TA 3O8LA 5JVDF 2XBMA 4R7TA 1I32A 4M7WA 2AOUB 1G3MA 2D7DA 5DXFA 6ABPA 4L0CA 3WXMA 5TEWA 1NI4B 2W42A 3QLUC 4KU4A 1E3DA 1APBA 2DR2A 1WZCA 1MTOA 1OXTA 2O05A 3C2QA 5ALHA 5HF5A 1UK9A 3JVDA 2VZ8A 3ND9A 1E1CA 2VZ9A 3AR9A 3ROXA 4DJFC 1DKPA 4RE5A 5JASA 4ZQIA 5EPEA 2OFPA 2NPOA 3U40A 1A2OA 3WWDA 4BMSA 4I1IA 3BXOA 2HY7A 3CH7A 3WADA 2V4MA 1SXPA 2IXGA 2N47A 4N0PA 2DUWA 4Z0TA 4RESA 4LZZA 4EJSA 3OBIA 1AOXA 1C3JA 1GZVA 2AUNA 3C8UA 4IKEA 4WT7A 4DREA 2R6AA 1QIMA 3TTUA 1PVOA 1CRWG 4G1FA 5BYJA 5DCYA 2UZ0A 3WIUA 1ID1A 2QUZA 3JRXA 3D7MA 3PS9A 1VKOA 2NQTA 3GFVA 1BN6A 2HWWA 4QDXA 5ESDA 4DZZA 4EECA 4HYEA 1FP7A 2A3NA 1EP1B 4RW0A 2K2QB 5HF9A 4US2R 3A1EA 4GOXA 4JB3A 2AN5A 4JKIA 3UVEA 4F85A 5JV5A 1MHPA 5JO9A 5DPMA 3LXUX 2IHBA 3JQ9C 1JILA 5DOZA 1DWUA 2XUAA 3BRWD 4BUCA 4QARA 4OA8A 3BC1A 2QD3A 2UVPB 3NT2A 4G41A 3I05A 1EVQA 1EZ1A 1NTRA 1NUSA 4QFBA 3QI2A 4XWKA 3LBNA 3ZHSA 3GA5A 3E1KA 3FF4A 2W58A 2HSGA 4B3DA 3IXLA 2E5WA 2QA5A 3L0SA 4HLQB 1LTHR 1N92A 2H59A 2Z2KA 3GT0A 3C3PA 4ASUD 1ZOOA 3DVRX 3C3EA 3JQ6A 3CVXA 2I80A 3PP8A 1W0KD 1J0DA 1ZPDA 3RIXA 3L8HA 1G38A 3M6AA 4TYPA 4ZRNA 4UNRA 5CFNA 4JI8B 2VZEA 3DXZA 3TJMA 5BUCA 4TZKA 1XI2A 4AZ0A 2DPLA 5CCEA 1U5AA 1MQSA 2RCYA 3HNOA 4L3WA 1SHLA 1TZJA 4ZA2A 2IYWA 1QP7A 1DRKA 5GIPE 2I2CA 3FYCA 1NG1A 4FW8A 1PS8A 4P33A 1JDNA 1T6YA 4YRZA 2ZE5A 3HBJA 2Y0PA 4GPEA 1GG9A 1OHHA 3LDHA 1NBEA 4X41A 1TIPA 1U2RA 3H16A 1R10A 1AY0A 1WCIB 2ONKA 2C5GA 5GGYA 2GKGA 4J16A 2ZWOA 2ONYA 4WNAB 5K6TA 4TMVA 4UD2A 3WGGA 1A8SA 1K8ZB 4X1IB 2A4MA 3WHIA 4IXWA 1PKEA 3AXSA 4BVEA 3R3JA 4KPEC 1CUXA 1HYEA 1MEJA 1M6NA 3MT9A 4X84A 2IX3A 2PUFA 2OCLA 4ESOA 5DMXA 1AKWA 2VYQA 4QDZA 3TRKA 2UZ3A 3BJIC 1P1FA 2G1UA 1EFVB 2VPTA 4WK2B 2FHPA 4BLRA 1G63A 4BXOB 2AFHB 2QTZA 3IODA 4HX2A 5JSYA 5ICSA 3OM0A 4XDGA 5ITSA 5K0SA 5LQCA 4G1BA 2O3SA 4TV8B 2HI0A 1GUYA 1AHHA 4UNPA 3R8FA 3ZOZA 1XVUA 1LQTA 5EE9A 2DTDA 1KY4A 2BCGY 4CG2A 1F20A 2OSBA 3UT0A 2OHGA 4JYBA 1RFLA 2XAAA 1WTCA 4U6SA 4ISCA 2RSLA 3K8ZA 1O6GA 4L9RA 5B3JA 5KPJA 1M0EA 5EIEA 3MRXA 3NHJA 4BLTA 3HMKA 4HMQA 1LX7A 4PR3A 4ZOAA 5HRCA 2QLLA 4M2LA 1CE8A 1ZRNA 3LT2A 3ZWCA 1L3CA 1XTRA 1DMRA 1XP8A 1PUIA 1NNUA 4L8LA 3B3JA 2WHXA 3UH1A 2X8AA 2X15A 4RHXA 1WOMA 3PKZA 2OUIA 1DG3A 3QVGA 3UT6A 3OSUA 2H57A 4R8SA 1IRIA 5HKLA 4AU1A 4JNKA 1BC5A 2H7CA 1HURA 5DN9A 2ZQ5A 2IXFA 3PX3A 3UV7A 4EYGA 5KTRA 3UMMA 5GGXA 1XKQA 1VGVA 4EJ6A 1NW5A 4A8PA 2JA1A 4C05A 3JALA 4BS9A 1E79A 2DBYA 3B9BA 4C6TB 1UBRS 4KGXA 3PLAE 4QQRA 1C0LA 4RXTA 2JD1A 1RQGA 2X77A 4DJAA 3M6UA 5L3SB 2QV0A 2DB3A 5IZCC 2AOWA 2HB6A 3FSJX 1XZNA 4RLFA 5FUWA 5K3DA 3DV0B 4YCCA 2YHIA 1XROA 2BF4A 1MKYA 2R6GA 3O8RA 1VLHA 3EDMA 4KLZA 5H59A 1IJKA 4NCJA 1KEPA 1E1MA 3E9NA 4Y67A 5CYGA 1U2TA 3GFQA 1QKKA 4DV2B 2B37A 4AYWA 3DD5A 3WMRA 1O97C 1I4EB 1OIVA 3U4HA 4D3ZA 1VPVA 4S24A 3WGOA 4DBVO 4ZJUA 1KAQA 5B7NA 3E9EA 3J80A 5I3ZA 4LG1A 2Y1DA 3OQHA 4ZI5A 3RD5A 3EMKA 1YR7A 3VKFA 3PEVA 1S5PA 2F9FA 1D2CA 2A0KA 2B30A 4Y1RB 2JEYA 1Y5IA 2P3OA 3O3CA 4G36A 1Z2PX 2EU8A 3OQIA 4KO2S 2HCJB 2L82A 4RULA 1R0WA 4I3HA 3OJXA 5E9WA 2XKBA 4BOYA 1AKUA 1QGUB 2O0HA 4C1NA 3CRQA 4HJXA 3EVEA 3MTAA 1FQWA 1XLTA 1ZX1A 4PHCA 3ZE6A 1UQRA 1XD8A 4MVJD 3J81A 5JFGA 3HKDA 3TD2A 4BNDB 1U63A 4BVLA 5JZOA 1TPYA 4Z1MA 2A1IA 1L7OA 5AVYA 2N46A 2AE2A 3G2PA 2E6KA 4MPDA 1CQJB 2CD9A 2OG2A 5CU7A 4E7OA 4H7FA 3AH8A 1UK7A 5EUBA 4XPZA 1AD2A 3DAYA 1WHTB 1T2UA 3H2GA 3SY8A 3UMCA 3AGPA 3L0DA 5JXGA 5LJLA 3EPJA 4XUGB 4ZI2A 1LLDA 2V9PA 3L41A 3CW8X 2JFWA 4E6PA 1V3VA 4D3DA 2B2XA 1JIKA 2G82A 1A4IA 2W6PA 3KXLA 3PF8A 4LX8A 4P7BA 1J2RA 2YJ3A 3SC4A 1J24A 2VDUE 3D59A 4RFSA 2HCRA 3WJ2A 3H6HA 5IS2A 2PUJA 2OOSA 2J32A 1Q2XA 3N2YA 2NXNA 5EAIA 5BV7A 4FD2A 1OH6A 4UHEA 1HLGA 5FL7A 3JQPA 4DZTA 2PS1A 3INTA 1F12A 2WTXA 1YIDA 3WNZA 4IIYA 2IYVA 1JX6A 2QN3A 2FN7A 1RXYA 1T8TA 4DSOA 4KQIA 4UMEA 1JALA 2EJBA 3IP6A 3OE7A 4HVAA 2VPWA 3H4MA 2D06A 5BW5A 5C53B 3BICA 1DTWA 1KVTA 2EV9A 2RHHA 1T9HA 2YNMC 2EAUA 1XX6A 3KOWA 3NBXX 4GT1A 3GL9A 2AN4A 4GPBA 5LSAA 4TZ0A 1MRSA 5EFOA 1KYIA 2PN1A 5EJ8A 2AG8A 3AHJA 1IU9A 3QQPA 4LAFA 5AD1A 4IFIA 1M2FA 4UULA 3VYSB 5C52B 1C8BA 2L19A 1JAZA 3MRTA 5ETJA 3TRFA 1OFTA 4J0GA 1PYOA 4J76A 1OLSA 1V41E 2PBLA 3KQMA 1Y9EA 3OT1A 4Q15A 4UZSA 3PHHA 1IQUA 1WUIS 1QAOA 2I4NA 1UP7A 4R1LA 5D3ZA 2RG7A 5CG1A 5ICMA 3KSAC 4MR7A 1HNWB 4CCYB 2OHJA 5FLKA 5LXTF 4NBWA 5H4GA 3ETDA 3RRZA 3TGLA 3GJ3A 3ZXYA 1VA4A 1XRNA 3R20A 3BDIA 4YGXB 2IP4A 4FOLA 1LBTA 4BCBA 1OT3A 2JGDA 2AR0A 2FCAA 4N7RA 2YFYA 3M3PA 1CUBA 3LRPA 1FW6A 3A4TA 3GPCA 3FFAA 4E2XA 3COWA 4HGQA 5I7HA 2ZRLA 1SBTA 4NQZA 1GQOA 3NTLA 3FTEA 5D1NA 1RBYA 5F7ZA 3RANA 1COZA 1FS6A 3Q6NA 1Z63A 2AN1A 3E81A 1TIBA 4F5ZA 5KKAA 2OWEA 2PUGA 3ZX5A 2MSDB 2X0RA 2R6HA 1OJLA 2GARA 1VYHA 4ALJA 4B81A 2ODTX 2PV7A 2QZ9A 2ZIEA 3IOCA 1AKQA 3NTQA 2Z3VA 1HC7A 2O1WA 1C9DB 2DPGA 3LUDA 4P4GA 2EIXA 5C34B 5CIWA 1FRVA 3GK3A 2E5LB 3TIXB 2P2NA 2WAMA 5EE1A 2YJGA 4BMVA 1VZ3A 2XNSA 4X8HA 2UZIR 1GRQA 3UW3A 2EOAA 4RDCA 1T2NA 2PGIA 2FRVA 3DMGA 3LUPA 1QIJA 1GTMA 3OZTA 4QDUA 3SKXA 4UOEA 9ABPA 5LQMA 5IM4F 3N5KA 4OU4A 2G28A 2OB1A 2ZYRA 1HF3A 1M8JA 3R6WA 2RE8A 3HWWA 1DBVO 3L07A 3AUYA 1E66A 1M72A 2GZDA 5A6VA 2O1SA 1TE2A 2X19A 2C29D 1P7WA 3MJDA 3DDSA 1JHYA 3KPYA 1LRKA 1A9TA 2XW6A 4GOKA 1EB9A 4ALNA 2G7MC 5LQRA 2O3QA 3G89A 4YCJA 1EYZA 2JCVA 3DZ8A 2EJTA 1A5TA 2FTKE 2WE8A 3E3AA 4P5EA 5JVDB 2FQWA 4XQ0A 5EKSA 4LWQA 1OT5A 4LEIA 3RVQA 3OHSX 2GRUA 2JIDA 1UEIA 1QCCA 2MMCA 1QKJA 3ESBA 3SXPA 4CWAA 2QRKA 2XA1A 4QBKA 5B2EA 3VV3A 4HDOB 1NY5A 3JQRA 5BXQC 2RC6A 3JYNA 4IMIB 2X41A 3ZQ6A 4PO1A 1IXRC 3BORA 2OMKA 2GLTA 4N48A 2ZRKA 2VF5X 1VLJA 3HP4A 1XV5A 4J6EA 1F0NA 5REQA 3C3XA 5AKEA 1PSZA 5U4QA 4DIOA 1YMVA 4IF4A 5EZYA 4G6ZA 2PT6A 2G9VA 4ND1A 3TL6A 1U8UA 4UKDA 3TZQA 4EUNA 1H66A 4WXEA 5B4VA 1QHNA 4ZEWA 3U1VA 2QLTA 3UZUA 4EZBA 1VHWA 4GLFA 2YIVX 4NENB 2ID9A 3QXXA 5J5VA 1R4MA 2WF9A 2VF8A 3QPCA 4UHBA 1SA0B 4E08A 3T94A 3JASB 1RKXA 1KO5A 1P5HA 3DXYA 3CLUC 4M9XA 4FFNA 4YRQA 3VR6H 3U61B 3S1LA 1KQOA 2ZSFA 5H70A 3GUHA 4EHJA 1SCJA 4OCZA 4LWOA 4K9DA 1GRCA 1CERA 1BXZA 2B6NA 4CIDA 3THXB 2REOA 3F2IA 3UJ3X 3P27A 1EWRA 2X4DA 4I9UA 4U2GA 3O9VA 2O8FB 2XRFA 3O95A 4JASB 1IQPA 2Q1WA 1XKLA 4KMMA 5LA6A 1NBHA 3KQOA 3H05A 4I9NA 1OILA 4DT1B 4W1QA 4PZAA 5F9HA 1X7XB 2B2NA 2I4RA 3AJDA 1A4UA 1QB7A 1QG6A 4LTMA 1ILEA 3AEZA 4BDTA 4EMSA 5I7EA 1HE3A 5AJUA 3MCVA 3KDAA 4EJ2A 3U4CA 3U19A 2PWBA 3NKVA 1O0CA 3FOWA 3WAJA 2IPNA 1E94E 1F5NA 1XD9A 1HDGO 5BWNA 4LRSB 2ARKA 3AT1A 4G56A 4DNXA 2J3DA 1GZ6A 3ASUA 2I55A 1A7UA 2BGRA 2PUCA 3I73A 2QLNA 5AJZA 4E07A 3B5IA 3E9DA 3HC7A 4Y6QA 4BYGA 2PDAA 2V8OA 1KE2A 5AVQA 2AEMA 2AFIA 5AICA 1C7JA 2DZDA 2JIRA 3I3SR 3DXFA 4TT8A 3AIMA 2Q62A 4U2CA 3DTVB 4UW9A 4DR1B 5ELLA 4DRZA 2ECOA 2TRSB 3I23A 3RVDA 5HM8A 4N5LA 2OCXA 4HOYA 3V1KA 4DLXA 4F56A 5AM4A 5F3WB 4PQRA 4R71A 2OM6A 4U6NA 2P9TA 2ZSUA 2DTXA 1K1EA 2ZJZA 1ZXLA 2B8NA 5HIIA 4IEEA 1N9GB 2NZJA 3EQ6A 3VDQA 1V11A 2BHTA 2AJTA 1H22A 4QUKA 2H85A 2OHXA 2ZATA 3LLVA 3BWMA 3PFFA 4JUIA 3SLRA 4G4SO 1R00A 4JJIA 3G9TA 5JJKA 1OFUX 4FJ0A 2A14A 5BN3A 1KSHA 1XMQB 1GL9B 2GD6A 3HGQA 1W88A 3ANTA 2H31A 4GR4A 4J2HA 4WNYA 4I3FA 4NFLA 1WNTA 1CY8A 2RHMA 4O1HA 4DG9A 1SXHA 2NV6A 1JLRA 2LPMA 2F3PA 2I7TA 4Q1FA 4RENA 2QJFA 2VAPA 3VVMA 4GNKA 4IF6A 1XNGA 4W5OA 4UM7A 4F5EA 5T8KA 3A1SA 2RKOA 3X1YA 3GJZA 2CLHB 2QM0A 3KJNA 3U26A 1PGOA 2ZJ5A 4G4JA 3RC2A 4JI3B 4AN0A 2RGAA 5E1BA 2IOHA 2RHCA 3QIVA 3QFTA 4LE2A 1TQDA 4TTRA 5HWSA 4E5DA 2I33A 1SNYA 4TLEA 1K86A 4LCBA 3UMBA 3EEFA 4RVNA 1AF7A 2QD1A 4FFVA 4RD3A 3OSZA 3DYVA 5E9JA 4V24A 4ARZA 3CPSA 2NTEA 3M6MD 1XU9A 1IJFA 4Q4HB 4ARSA 4FYJA 4M9UA 4MS4A 4MQEB 4HDMB 4AIIA 5JDIC 3K1YA 4HWGA 3RVOA 1F8GA 5H02A 1G59A 1BTOA 5ECGC 4MRMA 1AQYA 5HKKD 4UNSA 1B1AA 1TW3A 2OUKA 4H3SA 2O20A 2Q4DA 4MUBA 4WZBE 3LOQA 4A10A 4MR9B 2HEGA 1Q0UA 2MSKA 2WTBA 2ZRAA 3BRWA 2XVMA 2UAGA 2G8NA 2XJ9A 3H42B 4U5QA 2P9ZA 1J4AA 2KI5A 1R15A 5EWJA 4LOHA 4EO4A 1GXSB 1JIVA 2XB2A 3HCCA 5BY2A 4BQOA 2ZSJA 5KYNA 3GJYA 1TEXA 3JVEA 1SKQA 3NH9A 3NXKA 3CPJB 2A30A 4FOOA 4RX1A 5IAEA 1EUDB 2FRXA 4LJLA 4YK7A 4IIJA 1L7MA 4M22A 1FUKA 2N3ZA 1L7RA 2V98A 1LPOA 4QOHA 1H2WA 3UFXA 5DM60 4ASUA 3A4LA 1W75A 3GJ7A 4P31A 4BJ6A 4X92A 1SXJD 1WB6A 2XXBA 4BLPA 4TL8A 1GCIA 1RAAA 1C4XA 4QWMA 1NPTO 5G1PA 2PY6A 3RUHA 1U7ZA 3HRKA 3PD7A 1NDHA 1DV1A 3GVIA 2XXAB 2AC4A 4JU8A 4ACAA 4HH0A 2BTQA 1R4NB 3AONB 4B73A 3GLFA 4UTXA 4NAVA 4DY4A 5LZ4A 1KO7A 1NQUA 2WF5A 2NYAA 3HJAA 4HBZA 1VKHA 4JBLA 2W5UA 2WSBA 4I99A 1IG0A 2FFJA 5EP1A 5IF9A 2AVDA 4ROTA 1D7AA 4UHJA 2HDNB 4YP1A 1B74A 2I8LA 1AGYA 2G3YA 3C5VA