2MYPA

An arsenate reductase in the phosphate binding state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
b'MKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin arsenate reductase
publication title A Hybrid Mechanism for the Synechocystis Arsenate Reductase Revealed by Structural Snapshots during Arsenate Reduction.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Oxidoreductase
total genus 47
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mypA00
2JB9A 3OO1A 4IGAA 8ABPA 2FMHA 3O1JC 4MAAA 1BDHA 4RY8A 1D4ZA 3O2QB 4D6YA 4YR7A 3O21A 4TMYA 4UHKA 5IEBA 4KNYA 1DCKA 3SM9A 1QQBA 2HQOA 2V0NA 4N47A 3LTEA 4EYOA 1P8AA 4EYKA 4PICA 1YS7A 3RVKA 3IDOA 1NATA 1DRKA 4G0YA 2PJUA 1R8JA 3O74A 3O75A 2JRLA 1MVOA 4M88A 2I6FA 3KJXA 3H5IA 3CZ5A 3QEMA 4KPYA 5TQ0B 1YK1A 2AYXA 2FLWA 1LBIA 3FFXA 1Y1LA 1A0OA 2PKXA 4LE1A 4W5NA 1TJYA 1J56A 3OMWA 2VYCA 1Z13A 1JDNA 3H5LA 4MR7A 4QYWA 3QK7A 4D6XA 1APBA 3FFTA 4MR8A 2FMFA 5JNUA 4LRQA 4Z4EA 1Z17A 4LZLA 3GT7A 1FSPA 1IIBA 3O1HB 4HNRA 1EHCA 3KYJB 1TLFA 3JVIA 2PAFA 3Q9SA 1XHEA 4O5AA 2LBPA 3IPCA 2FQXA 2IOYA 4RXTA 1Z15A 4HYEA 2M98A 3A10A 4YLEA 4XASA 2FKAA 4Z9AA 5IULC 2WRZA 4LDZA 3VNBA 4YCSA 4Z4IA 3A0RB 1JDPA 5HSGA 3BBLA 2FTKE 4PEVA 2FXIA 4MGEA 4MQEB 1URPA 2MYNA 1U2QA 4W5OA 1L5YA 3EGCA 3FMVA 2WY2D 3TD9A 3HXMA 3DLHA 1NY5A 3H5TA 1ZH4A 3LFTA 4P1ZA 1RZRA 2KYRA 3OM0A 4WXEA 1GUBA 5HM6A 2L18A 5EWMB 1ISRA 3GL9A 3RVLA 4ETIA 4F11A 3KS9A 4TLLB 3SNKA 1HEYA 2FSPA 5JNSA 2PLNA 1BAPA 3OLWA 4N03A 1WETA 4NCAA 1DG9A 5CNKA 3GYBA 4RK0A 4RXUA 2LP4Y 1KMIY 3LUHA 5JNVA 1LK0A 2VUHB 4D74A 2B1JA 2QU7A 1PNTA 3JPYA 2PUGA 4Z0NA 3QELA 1VKRA 4WT7A 4EVRA 2CD7A 1NTRA 2FVYA 3EQZA 2P9HA 1EWKA 2NZVG 1CHNA 5GQSA 1LBHA 2FMIA 4KFCA 5IUJC 1USKA 2IKSA 1EWVA 3URMA 2PUAA 3HK2A 3I45A 1RZRD 3N0RA 3OLYA 3Q41A 3MM4A 3TB6A 5TE9A 1W25A 1BDJA 3T38A 5EWLB 5IUKC 4FB4A 3LUDA 1E6MA 3C97A 4G86A 5TQ2A 4XXHA 3KG2A 9ABPA 2PUCA 2OENG 1YVUA 3G85A 4Q7EA 4EYQA 3P9YA 5B3JA 2R47A 2IDMA 1TM2A 1Z26A 2TMYA 1PEYA 3H5OA 3N6VA 1U8TA 1KRXA 1ZGGA 1DCMA 1C0EA 3K9CA 2PMCA 3LKVA 4MRMB 4CBVA 4PE5B 3M9WA 4JP1A 2QZJA 2E4UA 2PUEA 1F51E 3GBVA 1L5ZA 1OXKB 5D2CA 3RH0A 3B2NA 1KGSA 3NNDA 4DADA 4Z4HA 4KK3A 1ZESA 1TVMA 5TQJA 1Z16A 2IYNA 2MSWA 3CTPA 5FWYA 3O2SB 2NT4A 1FQWA 4JA2A 4ZYLA 4B09A 1YTUA 3EQ2A 3RVQA 3F7NA 3IPAA 4IF4A 3R0JA 4EGSA 3UUGA 3QLVA 1Z2EA 4MS3A 1DBQA 2LUOA 1EWTA 3KLOA 3CFYA 4MLDA 4RK5A 5T3YA 3MMNA 5C5EA 2PUFA 1M2EA 3RQIA 2LPMA 4N0PA 2A9PA 3Q15C 1K66A 3SG0A 3KCNA 2JBAB 2LIVA 5FBKA 1NXSA 5BRJA 4MS4A 2ID9A 1SRRA 1JYEA 3H1EA 2E4XA 4NV3A 2PL1A 1A04A 2A9QA 5KI6A 5BRAA 5CNIA 4OATA 2WWVD 1GCGA 1YMUA 2XDYA 1AB6A 3LUJA 4Q6WA 5EWJB 5DLEA 1DZ3A 1DCFA 1QP7A 3DGEC 1M5UA 1M2FA 4W5TA 3IP7A 2PE5A 2ZWMA 2NZUG 2WJAA 2PUDA 5B3JC 3EODA 1SXIA 1MB3A 3OLZA 4OLAA 1JHZA 4KK4A 3KYIB 2E4VA 4G97A 5I4CA 2GWRA 2A9RA 3C6QA 3GA5A 3IP6A 5IBQA 5FWXA 2L19A 2MYTA 3H75A 1ZAYA 4F06A 4MLCA 4GPAA 1ISSA 3NHZA 2L2QA 2HSGA 3QX8A 2E4ZA 1JBEA 5TPWA 4ZMSA 1YS6A 3MQ4A 3RVOA 2MYPA 4OTZA 2QW1A 2L17A 2ZAYA 3H1GA 4KVFA 1XWWA 4MR9A 4JB2A 2P4UA 4RZSA 3S99A 3F73A 3JS5A 3OMXA 3HVRA 2RJOA 2JVJA 4JOQA 1ZITA 3M6MD 2WMYA 3CHYA 4H60A 1S8NA 3OLVA 3T8YA 1DJMA 2QXYA 3KSMA 3I5AA 2FEWB 5TQ0A 3QLTA 1QKKA 1SXHA 3HZHA 4H3KB 6ABPA 1QMPA 3ILYA 5F64A 5KC8A 4H3HB 3SAJA 3F6PA 1CEYA 2VUIB 1JL3A 1RXIA 4HNQA 2FEKA 3QLUA 4RXMA 4QYMA 3TX6A 5KC9A 1PUXA 1GUDA 1QO0A 4O1IA 3L49A 2DRIA 1GCAA 5HQJA 4TN5A 2JCGA 5KQGA 1YIOA 5JNTA 3HJFA 2WJWA 5CNMA 1MB0A 4G0QA 2NT3A 3ROTA 1VPWA 3E61A 4RU1A 3T6KA 3N0WA 4O1HA 4Y9TA 4MS1B 3ILHA 3RVMA 5ABPA 1P6UA 4ZPJA 4GNRA 2Q5CA 3DZDA 1ZN2A 2FQWA 2YHBA 4IMJB 4L85A 2M1ZA 2B4AA 4OLBA 5T7BA 1NXTA 3BRSA 3H5WA 3HCWA 4KV7A 5DCLA 3GRCA 3HDVA 2NUBA 2J48A 2R4QA 4KQCA 4YP9A 4LX8A 4KMRA 3RVPA 4KREA 4MQEA 1VLZA 3C3MA 4FE4A 2GX6A 4RK4A 2CHEA 1P6QA 3IP5A 3RVJA 4F3TA 1QNLA 3H1FA 1FFGA 1FFWA 2HJ9A 3N75A 1E6KA 3GBPA 4Z4GA 3HS3A 3CS3A 3HSYA 3LKBA 1QO0D 3KLNA 1I3CA 1BVHA 1SXGA 4XARA 1ZGZA 4W5QA 3OO0A 5EWMA 5IX8A 3DGFC 1D1QA 2N9UA 1ABEA 3KHTA 2R25B 3MF4A 4QICA 1Z12A 4YRZA 3FGZA 2CWDA 5C5CA 4MQFA 4RY0A 3HV2A 3JPWA 2AYZA 2MYUA 4PZ0A 3QEMB 4IMIB 4RS3A 3GWGA 2FLKA 5E3JA 1DC7A 4MYRA 3F6CA 3MA0A 4Z4FA 1U0SY 3L6UA 3BRQA 1DBPA 1FFSA 2A9OA 2ID7A 3QLUC 4JASB 3NNSA 3KTOA 4ZJPA 2QSJA 4MR7B 1YK0A 5CNJA 5KQPA 4WXMA 1LJUA 4HNSA 4MR8B 3HO1A 1EAYA 3LUFA 4RDCA 2PUBA 4NICA 5IC5A 3HM9A 3JTEA 5EWLA 5FBHA 1D2AA 3HUTA 4G0PA 5FWXB 3UKJA 1OXBB 3CZCA 2RJNA 3O2JA 1USIA 3Q7SA 5JS2A 1USGA 4XLTA 5IEJA 1NXOA 4F12A 2E4WA 5TPWB 3BILA 1NXVA 4N41A 2F8SA 1NXPA 3QEKA 4MRMA 1DC8A 4G0ZA 1BDIA 1KRWA 3N8IA 7ABPA 2FN8A 1VRVA 3SY8A 2BGGA 3GV0A 3JVDA 3NNNA 4MR9B 3OQMA 2RGYA 2GI4A 2MSKA 1W9HA 1B00A 2IPMA 4RK7A 1T34A 1M5TA 4TLMB 5JNWA 1ZVVA 5DKFA 4JB0A 1ZDMA 2IPLA 5KQMA 4DQDA 2CHFA 5IUNC 2JVKA 1E2BA 3O1IC 4S04A 5DGCA 1PNRA 2HQRA 4G0MA 3DLBA 4YWHA 3N53A 2O20A 4ETMA 1JWLA 4Z4CA 4RK6A 1JH9A 3EDCA 2QVGA 4LE0A 1P2FA 3FDFA 3KKEA 2RDMA 4DN6A 4NQRA 6CHYA 3D8UA 2JBAA 3HUUA 3H6HA 4E7OA 3RVNA 4LE2A 1D5WA 5GOTA 2QR3A 4RWEA 3QLVC 3TMYA 3H5VA 4ETNA 4YO7A 3QELB 1AB5A 4N0QA 1UDRA 1XHFA 4KZKA 3CRNA 3OQOA 2F8TA 4F8JA 1U2PA 3CU5A 5JS1A 5EWJA 2PL9A 1QP4A 2MSLA 1K68A 3CNBA 4ML3A 3CKMA 3OQNA 1Z2DA 2FQYA 5TQ2B 3NBMA 4WUTA 4EYGA 2VK2A 1E6LA 3EULA 4P98A 3JY6A 4FE7A 2JK1A 1H9CA 2IPAB 3RVSA 4MPTA 5PNTA 1JFSA 4RSMA 1JLKA 4WZZA 3LUGA 3CG0A 2X7XA 4RY9A 5KWSA 3HEBA 3MYYA 4OBBA 4Z99A 1RPJA 2QVCA 5KQLA 1CYEA 1ABFA 3BREA 3C3WA 3VNAA 2HPHA 4NCBA 2FW0A 1GLGA 1F4VA 4G0XA 4Q6BA 4S05A 4MQFB 3I09A 1MIHA 3CG4A 3DBIA 2H0AA 5FWYB 1JF8A 3LUCA 4IILA 4LDAA 5ED4A 1ZH2A 3MIZA 1Z25A 4YV7A 2W42A 1QP0A 1QPZA 4N76A 5BR1A 1SD5A 4XAQA 2OQRA 4MS3B 4XFKA 3C3KA 3T95A 1DBWA 5DTEA 1PEAA 5TPZA 1JX6A 1ZY2A 3EAFA 3HDGA 4YS6A 3CLKA 4UHJA 3NHMA 1NXXA 4WWHA 3A3KA 3I42A 1DP4A 4MS4B 2GKGA 2JVIA 1DRJA 4IRXA 5CHYA 3SQNA 4YGXB 1C4WA 3OM1A 1ZHHA 4EVQA 1QQAA 3LMKA 2H3HA 3IP9A 3K4HA 4RV5A 3FFWA 1Z18A 5JNRA 3E3MA 1MAVA 4EUKA 2FN9A 1U04A 3LOPA 1RNLA 1RXEA 3QX9A 3LUKA 4Z9BA 3TO5A 4KRFA 1JFTA 3H6GA 4MS1A 5BQ3A 4ZMRA 4JAVC 3N0XA 4RK1A 4EY3A 2R48A 4QPJC 5HKOA 1D1PA 2YHAA 1TMYA 2HQBA 1LJLA 1A2OA 3Q7RA 3UK0A 4E7PA 1JFVA 2E4YA 3G1WA 4KQ9A 5TPZD 3W9SA 2FMKA 3M9XA 3RVRA 4RKRA 3D02A 2QV0A 3A0UA 4PYRA 2WB4A 3EJWA 3LUAA 4G0OA 4RKQA 3OLXA 1BA2A 1JYFA 2IPNA 1PHRA 4EVSA 4W5RA 3ROFA 4OG2A 1EFAA 2GBPA 4L4UA 3Q7TA 1NXWA 2FEPA 1YMVA
chains in the Genus database with same CATH superfamily
1H22A 4BO5A 5AWFC 2I6UA 4UFOA 4XQ0A 3SK0A 4MICA 4YN3A 2NTVA 5CFOA 4LPSA 4NRDA 4C9BA 3QX3A 2JS7A 5DNUA 3INNA 3IOMA 1RAEA 2Q8NA 3JQGA 1YDHA 2QUBA 2Y9MB 1QH1B 1TRHA 4UHKA 4BXOB 1I7LA 1P1CA 3G8CA 4G4GA 1SVUA 4N47A 4DOMA 2Q1XA 4YJDA 2YFKA 3AQ4A 3EPKA 4GG1A 2IHTA 4TT3D 1U94A 3ZWPA 1VKJA 5LXTA 4D4GA 5DWQA 4FUTA 4KIFA 4X1IB 2VNKA 4X6YA 4L1KA 3SM3A 5CB6A 3MCVA 1VHLA 1T2VA 4DV4B 4GOLD 1PFWA 3KKQA 4MW7A 4DM3A 4U5XA 3RVBA 2P6NA 1C8BA 1P9NA 1YK1A 2AF4C 1WSDA 4MVJE 4DXHA 2XRZA 3T9CA 2ZVJA 5ETJA 4Q1VA 3QMWA 2OV4A 2WYUA 5EE5B 5SZKB 2PZGA 3SLRA 1J09A 4JN6B 2AYYA 1N6HA 1UPAA 3LY7A 2J0SA 3LWBA 1T0JB 5FWDA 1FRNA 2VHYA 4LMPA 4NCJA 1GGNA 2IY7A 3D9QX 1WPGA 2GZ3A 1GTL1 2WKSA 2XTZA 1VYTA 1SZPA 2X5OA 3NHSA 1YJCA 2DWUA 4PZLA 3NP7A 4WJZA 3KQKA 1WWKA 4QO7A 4BE7B 5LNK1 1NVXQ 3BD9A 1L5LA 2QN3A 4YYZA 3WKEA 4BZXA 2FQ1A 1EHCA 5JAMA 1QAOA 4QFCA 2X1HA 1ZNXA 4C87A 2H8KA 3D6JA 2F3SA 4CCWA 4A0FA 3R9XB 4YRRA 1FPMA 2YOFA 4UVGA 3ZXXA 5KDOA 1XVIA 4Z8YA 5DXFA 3FRHA 3ZTWA 4E1AA 1AHPA 4L9AA 3WL8A 3F5DA 4O4HA 5B58C 1VDZA 2CJXA 3DP7A 3F7TA 3BZWA 1NKSA 3QJ5A 4O4LA 3UJDA 1FXWF 4YCSA 3UA3A 4QUHA 2PSHA 3GUZA 4HDMB 5JD3A 1PFQA 2BEWB 5K8TA 2AOXA 6PFKA 5ALRA 1X1CA 1CZLA 2E18A 4MJ3A 3SWWA 4HXEB 2VHVA 5LQKA 1L8QA 2JJYA 5F3WB 4HXYA 3OM0A 3R2JA 4H7DA 2A6PA 4WXEA 5CUQA 4RHCA 2ECKA 4EYSA 1OYVA 2OB1A 3LBNA 1GZ6A 1BYUA 4QDUA 5EWMB 3ER8A 5EESA 1E18A 1QH9A 2BM9A 4B0OA 2FSPA 3JQBA 5JNSA 1W0KA 3SJAA 1MZPA 1Z56C 3VDNB 2GN2A 3VU1A 1T8SA 2P0AA 2R6HA 3N2IA 4HWRA 2EFHB 1LNZA 4W7HA 3Q8KA 5CG2A 1D4FA 1IEXA 4RMIA 3VO1A 2WWYA 4AXBA 2HEGA 4WNAB 1FYXA 3GPBA 1FMLA 3DZKA 3WKCA 3KQTA 4O0LA 3WMGA 5FRDA 3EQZA 2ZSJA 4ZO7A 1A96A 1YBMA 1RPZA 3T7DA 1LBHA 3A2NA 4Q1AA 3L7CA 2RGNC 1L8OA 3IJEB 4YECA 4HDSB 2B8WA 2BI8A 5FUBA 1LLFA 1XKXA 2B5OA 1YH3A 3URMA 2OL4A 3HK2A 1XMVA 2DHQA 1LDEA 2DKFA 2ZROA 4BLPA 5BW4A 3RS4A 4Y7DA 4NCKA 5DOZA 1IK4A 4RTPA 1JHPA 1KP3A 3I30X 4DEXA 4EEZA 1Y8QA 1YT5A 2VHJA 2P0EA 3UT0A 3P9YA 1FTWA 4L15A 1KZ9A 1AD2A 1TTHA 1YWGO 3EG9B 1C3VA 4D98A 1S3GA 1IC6A 2GRUA 3A28A 1R2QA 2I22A 5BPHA 3WGYA 5HWSA 4L5BA 1BTOA 2FR8A 3C45A 4YBRA 1PDOA 1GEGA 5JISA 5KWJA 1Y89A 1Z2OX 1ZD3A 2GWHA 5K3AA 1MCZA 3ZBPA 1NQTA 2I3DA 2QVYX 1KEPA 2ZUTA 3TL2A 4EP1A 2FPPA 3ON5A 4HH3C 2XTAA 3LPMA 1IQUA 1BQ3A 1GKLA 1UMBB 3WGIA 4CR8A 2MSWA 3MTAA 3QG5A 4XDZA 3D8BA 3KTFA 3OE5A 3OTIA 4ADSG 3WYNA 1S2IA 2IYSA 4EGSA 2QZSA 3QNMA 4YH1A 2ZYGA 3G0IA 1GGFA 4HZUB 1CUDA 2WPDD 3IE0A 3MJRA 4Q7JB 4ZODA 4HGYA 1GL9B 4RK5A 4DLTA 4FE3A 3AM5A 3NLLA 1W88A 4B81A 3FJYA 1DEHA 4PLCA 4R5HA 2AXQA 4KXXA 2VDJA 3GGSA 5JAOA 1DQRA 1VLLA 3GEIA 5KKAA 3UF0A 3QKIA 1Z33A 2C77A 2HO5A 4I55A 4DPKA 3LLUA 5IVIA 1UP7A 2PGIA 3LPDA 3FTCA 1QMGA 3U39A 2Y6VA 5K6TA 1CEEA 3D7NA 4RVCA 4C30A 4UDYX 5E7MA 4ZI2A 3U7IA 4OHPA 4NV3A 5EZ6B 2WHXA 3CLUC 4MKFA 2JLXA 1JB9A 2OHIA 1F6BA 4F9TA 1OAOC 1EKXA 1HXHA 4RKWA 4TTVA 3T0IA 4JVMA 2OCDA 4Q6WA 3L0ZA 1V2GA 4LF7B 2JI8A 3P9RA 2HXSA 1RM4A 3QFTA 4JLAA 1THGA 3I04A 3B1WA 3ZE9A 3UH0A 2DVMA 2QM0A 4YJ2F 3AJEA 2QJTA 4ISBA 4LHVA 3GDFA 4XQCA 1WMFA 2RC6A 3ZN2A 3Q5DA 3ZDEA 5DSXA 3FB1A 2YV2A 4L0CA 4EBBA 4OFWA 1JHZA 4FP9A 4KK4A 5EJGA 1YE3A 3WJ1A 1AXEA 5DTQA 3I5YA 5I4CA 2BBSA 1WXDA 3BRCA 3HDHA 1HTWA 3W4IA 3LY5A 2XRFA 5IAGA 3UMGA 5JFOA 3W05A 1G20E 4HUQB 1X42A 1CIJA 5TARA 2CFSA 4YA6A 1DCTA 3RWOA 1S8FA 4RWZA 1L9KA 5LYJB 2OHHA 2YJ5A 2DWCA 5LC1A 3JQFA 2YMMA 1TIKA 3QX8A 4H16A 3IBFA 3L9XA 3G8DA 2VVTA 3FETA 1PLKA 1SA0B 4MW6A 1H94A 1QR6A 4J29A 3GJ3A 1V3UA 4FMCB 2REQB 4I2NA 1XWFA 5FPSA 2CNKA 1JIUA 2GRJA 3PJGA 5BSMA 4DJEC 1H4QA 3D4OA 1KJ9A 2I4TA 4JT8A 1CC1S 3V7FA 2ZJYA 2D1TA 4I46A 3AR7A 4IR7A 1Y1QA 5G2OA 5EE9A 2C5SA 4M0UA 3H8JA 5KX5B 2QSYA 3GRUA 4PZ9A 3HHPA 1N9GB 2I2FA 3CX8A 3NBUA 3IB6A 3R6DA 3VPFA 2EKBA 3LT5A 5IXYA 10MHA 3NWOA 2B99A 1KA9H 4X9XA 2ZTLA 3KKZA 3L07A 5CURA 2H2GA 3DE5X 2ADMA 4JMLA 5C8YA 2NM0A 5DW0A 1J5XA 3UJCA 4A16A 3WV5A 3ZWCA 3KL2A 4ITVA 3VR0A 2JFVA 4TRRA 4UPVA 1JIVA 3W3AH 5JDIA 1ISIA 3CUKA 1LFDB 3BA6A 4ZQEA 4WBNF 2XWQA 1S5PA 4PV7A 3VXKA 4MEAA 3IR6A 5CFPA 2DC1A 2RBGA 3R9WA 4XJSA 3SVTA 2YIDA 5AD1A 3V9PA 2M6RA 1IK6A 3IBTA 1GUZA 4Q0MA 4R69A 4URFA 1N57A 5LQUA 4M49A 3IAS6 5IMSA 2XCIA 2H08A 2DYKA 3SJZA 4L85A 3RC8A 1V16A 3FMIA 2HCTA 4MQUA 1UWKA 2R79A 2GEDA 3FTFA 13PKA 4EEKA 4MK4A 3SQXA 1SVWA 3AM3A 2HV9A 1GNSA 3M34A 4MVJM 1FP4A 3AUFA 3SC3A 3VNSA 1HDRA 4N48A 2W2VA 3GROA 3QU7A 2AMLA 2Z5FA 3BWVA 1QCYA 4PO9A 3GRPA 3ZZ1A 1GRRA 3FOEC 4MITA 2YJ6A 2GJAA 2AUMA 1D3AA 1CBUA 3UJ6A 1X2EA 1E9CA 1Y48E 3EWNA 2PZMA 4MGHA 2GHIA 2VCHA 3D64A 3KLNA 3Q85A 3SYNA 1A8QA 3DNFA 1EIWA 2XYGA 4I3HA 1Z38A 2EJVA 3D3JA 4JT2A 2O2IA 2XODA 1U2GC 2NXCA 4JOCA 3K09C 3HKDB 3RRMA 3WGHA 1EQAA 3BSYA 2DGDA 2XIJA 5CLFA 3G13A 3HJAA 3FR8A 5FI5A 1X7XA 5IDVA 2QAIA 4IW3B 2QTCA 4EUFA 2QLNA 3VHRA 3EMVA 2Q2VA 4GX5A 1UDAA 4EG0A 3DLAA 4TZ0A 1JJAA 1G5HA 1W4CA 4JLWA 4PGFA 4TTJA 3LQKA 4NG4A 1O4WA 1X7WB 2JI4A 2OO7A 3ESXA 5CD1A 4DGQA 1V9SA 3T4UA 3BQ9A 2FWRA 3PFKA 1P5HA 3DZGA 1P0MA 3GO4A 3GLHB 1YR1A 3MA0A 2YDYA 1C1YA 4P6VF 1KFEB 1E0DA 2JCSA 2RIPA 3OJLA 3QA9A 4NJOA 3QPVA 1ULTA 2I80A 2ID7A 1IM8A 3RSQA 1NZFA 1QOPB 1OD6A 3TMAA 4ZJZA 4BVEA 1ZICA 4ENSA 2H31A 3KOWA 3FHOA 1EGVB 1L6IA 4M9RA 2X5KO 2AG0A 3TTSA 4BRSA 1ZM2A 1ZMOA 2PS1A 3HPQA 4I1SA 3HJBA 3Q1KA 3REQA 4UCXA 4AWBA 4AMBA 4BS9A 1V5WA 3FOAA 3V55A 4NJMB 2VDMB 3T3NA 1UK8A 2GA8A 2YOGA 1GR0A 3H2HA 3EXFA 1TT7A 2C99A 2XUIA 2FEMA 1YU9A 2A88A 2G67A 2QX8A 3HB5X 2VDKB 5AI0A 2HYIC 3N2LA 4ERNA 2MTBA 2D7DA 1AN9A 3NT2A 1V43A 1OFUX 4NZ9A 4F1WA 1KFBB 3GOQA 3UO8B 5L4SA 4ND1A 7ABPA 5JAQA 1E94E 3PQ6A 2ORED 3VBEA 3NWEA 3BAFA 2I34A 4M99A 4ZAZA 1UOOA 4YUYA 4RO0A 3K9GA 2DMRA 2Z30A 3QVGB 3SS7X 1B00A 2IPMA 5JLJA 1U3UA 2W8BB 3E70C 5K8CA 5LLTA 4WE3A 3JVVA 1C0PA 5DN6A 2RCYA 3DKIA 3WG9A 4DQDA 3GZ4A 4IVQA 3AUTA 3D2AA 4BLRA 3ONVA 3H2KA 2O20A 2IW3A 4JYAB 3PX2A 3DQZA 4TLDA 5D87A 2W6MA 4GWLA 1CNEA 3OT1B 4MEJA 4O4IA 4BCBA 1ACLA 4UTZA 1M7BA 4RZIA 4A3SA 1C50A 1TFUA 4D7AA 3KV3O 4DN6A 3UB3A 4TLCA 2E49A 3F98A 1SFRA 4XR9A 1ND5A 3UCXA 4ENPA 1M0SA 4W8OA 2X9GA 4JI8B 4HNUA 4XPZA 3PPIA 3F7OA 1J2RA 9LDBA 1GUFA 4ETNA 3BMXA 3DJYA 2FCAA 4OQMA 1PL7A 3KUCA 2QRKA 1OB5A 1PDVA 3BJIC 3I58A 2J9GA 2GDJA 3I05A 3TQRA 2I2DA 4P53A 3TD6A 3N6XA 1GQ2A 3AY0A 1GFSA 1PSWA 2PL9A 1EXVA 2IHZA 4FOOA 3ZWDA 4K2HA 3OTWA 4DNPA 3FOCA 2AWNA 5JJBA 4RVSA 3ZU2A 2PO5A 4M2LA 2IUTA 4H1TA 5FFNA 4XA8A 1LX7A 2WEKA 5IH3A 1F0NA 1E1MA 1RLMA 1U6IA 1X77A 2PU7A 4LWOA 4MRRA 3LK7A 3RVSA 4HF7A 4JQYA 4MPTA 1U1GA 3AGQA 4Y2SA 1L1FA 3D4BA 5LOVF 2AQIA 4JXZA 2X7XA 4C7BA 1N6PA 1SR8A 2VRBA 5ALPA 4DRXB 1B6SA 3I2JA 2WF8A 2X9LA 3EIQA 4JDUA 1XU4A 5HHTA 4ZCIA 4YJGA 5H1YA 3G8AA 2HPHA 3DLCA 3IERA 2PXAA 3OKPA 2Z1NA 4R1TA 3DDUA 1W36C 1FP7A 2PDAA 1J8DA 1MGOA 5IK2D 2BM0A 3L79A 1K7YA 4C4RA 4IHJB 1JVSA 3CPJB 5ALVA 1R0WA 4UQOA 3B6IA 2TRSB 2HLNA 1BHSA 1WEHA 1Z5WA 4HGRA 1TTPB 3F2VA 4KI7A 5T4EA 4CKBB 1Y7TA 1RTKA 1L5OA 4MKZA 1FFXB 2YN4A 2NYAA 2P79A 1BX3A 2OYRA 4TUYA 3AERA 3BGVA 3UVEA 5FJIA 1W29A 3LHSA 2O2ZA 4PG8A 4AMZA 3O0TA 4INJA 2DH5A 5KYKA 1BJKA 3BD8A 4YRJA 2QS9A 5KYUA 3C15C 1G7SA 1QIMA 5A5EA 3A9WA 3IHKA 5FEMA 1S4MA 1G60A 2F62A 2G5PA 1IATA 4QLAA 2ZBFA 4I9GA 1PJ2A 1FMFA 5CHYA 2A4MA 4Q1EA 5HF6A 4QASA 3S2YA 1FYEA 2WILA 4KDRA 4P4SA 4KEAA 1J1IA 2PGAA 4U1RA 2HXGA 1MT0A 4G4JA 4BO8A 3N58A 4Y1FA 1MAVA 2H4JA 1J0DA 2P9GA 5IM4F 4G8BA 4XUGB 3U5ZB 4FEEA 4UMEA 4X7RA 1LDBA 3CCBA 4PZPA 4RLHA 3RC9A 4D4HA 1DINA 1MDFA 1VP9A 1V4BA 3D0RA 2B1QA 2BEJA 2W98A 1E4YA 3E3AA 5K4GA 2PXXA 3F3MA 5JXJA 4Y67A 3I1YA 1X70A 3TTTA 2XZLA 4F92B 5EHXA 3QKSB 5K05A 2WR8A 3G1WA 4JBNA 1BYIA 4KQJA 3ZV5A 3ZYCA 1J00A 1A2KC 2QMUA 4FMDB 1N0WA 3DCYA 3V46A 2HA7A 3E9DA 4CJXA 3QI2A 3VBCA 2QRQA 1HKUA 1PR5A 2VT6A 2AV6A 3E22A 4MWTA 3II6X 2WICA 4V38A 2BEKA 3GP3A 2R44A 1H0KA 2AI2A 4KQXA 4MDHA 5I4IA 4URWR 4RABA 5LZ2A 3ZW7A 1LPMA 1IHYA 2VRCD 5CFLA 4XM1A 2CZGA 4JEHA 4ZCLA 1W87A 4M1YA 4XIIA 1N4AA 2OC9A 4PLZA 2G1JA 3V4ZA 4RY8A 3T4XA 1K8QA 4RPIA 5BW8A 5AICA 4FM9A 2IYQA 5AKIA 3MGGA 4YR7A 2HRRA 4JI4B 4HDQB 2OAGA 2VZEA 3FYCA 4O2AB 4JZKA 1K08A 4BKUA 4X8OA 4YUXA 4AWAA 4MP3A 3MD0A 5CPBA 2MMCA 4V3BA 4RLSA 3SKVA 4LYEA 5JMWA 4J1SA 2ETXA 1GDHA 2FMXA 3LU1A 4AO7A 4B6QA 3GGOA 4PYKA 3O75A 4Q3NA 3NTOA 4HRXA 2C5FA 3MSCA 1BC5A 3I62A 1NU8A 2WIKA 4NBVA 4DV5B 3JYQA 3GG9A 1O87A 2Y1EA 2FLWA 3EIWA 3TIVA 2EGHA 3O6VA 4LE1A 5FQNA 2YWHA 1RXCA 1TZCA 4PZZA 1ZOLA 4FNMA 1B6TA 3ASUA 4QYIA 5LZ9A 2OA0A 5TDHA 4IIHA 3IUEA 2O07A 3MEQA 4R16A 5LJIA 4M7RA 4LAFA 3V1YA 3O1HB 3I34X 5SYMA 1Z5PA 3VR4H 5BWLA 1MV8A 4R3WA 3KYJB 3JVIA 2PAFA 5G1NA 2AUTA 4FMBB 4M1KA 3G5UA 5A4JA 2VHXA 4IUCS 1JIIA 2JBHA 2J9FA 1TCBA 1E1KA 1TCCA 2M98A 3JWIA 3MMZA 4MQBA 2CCGA 3E2IA 4ANFA 1X19A 4ZEWA 5I7RA 4YGYA 3OZWA 3TFQA 4C0QC 5DE3A 2RG7A 1G20A 1JWAB 3HJTA 4LZOA 4J2TA 4U4AA 1ZUIA 4LWZA 4D9HA 1SUIA 4Q24A 1A4XA 2XZDA 4N9QA 5EJ2A 1AH2A 3EEBA 4XWKA 3OH8A 1W85A 4E2FA 4MV4A 3W3AA 4P3PA 2WY2D 1TXGA 5E6UB 2IQIA 3U16A 1Z5UA 4DYVA 4XCQA 1LDNA 2FOLA 2V65A 2C00A 1GNLA 4J6FA 5J5AA 5DRTA 1VMAA 5EJ4A 1QRRA 3LGXA 3EE6A 4H7KA 4GPIB 5F7XA 3KS9A 3RKRA 3KT3A 4WN9A 2XXJA 1HEYA 3G5TA 3OOSA 1F06A 1CE8B 1D7OA 3S8EA 1T9KA 3F5FA 3L1KA 3Q4GA 2AFHB 4RXUA 3P19A 3GD5A 2ZRGA 1TM3E 4ZOBA 1K5GA 1Q1EA 2F1JA 1CT9A 3WYCA 1PHPA 2KPOA 1DI0A 2IX9A 4JP2A 2HSDA 3FA2A 5E7JA 3AUKA 2E5WA 5DV9A 1H2WA 2R1VB 5ENVA 5CEJA 1DHRA 3LGSA 4TV8A 3Q9UA 4JYBA 4V39A 4BP9A 3WLSA 4W9NC 3L7BA 4Q01A 1YJQA 1EK6A 1U7WA 1W34A 2JLAA 3GH1A 1IN4A 3IIEA 3FOZA 1GYPA 1KKMA 3FIUA 4Y2UA 5JS6A 2IA5A 4RDIA 1W25A 1BDJA 3HH8A 1I4LD 3BMOA 4XXHA 4X20B 2OENG 1HLFA 4CKZA 3R5JA 2GSDA 5GGXA 4LVUA 1XZ8A 5L6LB 4JNKA 2ATEA 1JHQA 4XB1A 1GSAA 4BEJA 4MUFA 3AVVA 4F3YA 3K9CA 3ESRA 1P5FA 3MLEA 4DNFA 1XQYA 2Y66A 3HBAA 4N8DA 4HKTA 1BOOA 1OR8A 2NYVA 3UGQA 2ZI6A 4EB3A 1B8UA 3ZIUA 1KVUA 1PNQA 4QBKA 1B8NA 1NY6A 5IT5A 1Z0AA 2G9VA 4U7PB 3SI7A 4HDKA 2QY6A 5HR5A 2Z1MA 3GLTA 1QQ6A 1EFDN 2FMUA 1OLUA 3KDSE 3Q3HA 3EBPA 4JA2A 4AY2A 3KT8A 4NDNE 1VG8A 1E1RD 4QA9A 1R0LA 2G09A 4NS4A 5LU8A 1PJRA 1AQJA 2BOVA 3CJRA 1VGRA 2EERA 5I9SA 2QM3A 3HYCA 3I5XA 3Q3GE 4PZYA 5BSFA 5BSGA 5JSHA 1JU3A 2WWXA 3N2YA 4N6NA 4W6QA 4KQEA 1I2MA 2EFYA 3ZZ0A 3KCNA 2LIVA 2FGJA 2Q5FA 4OCZA 4WXPA 2HCRA 3ZGYA 3EB9A 1JJFA 2QN8A 3HO8A 4B4OA 1QKJA 4PYNA 3E7PA 4FGSA 4CEHA 4KHPB 1NDHA 5GP1A 1X9HA 4BFSA 4BMSA 3ZTYA 5JAHA 4MI9A 2EL7A 4P7BA 4LK3A 4D4LA 2W9XA 3B2QA 3ELDA 3TDMA 1YUBA 1ZP6A 3DO6A 4ND2A 1R9MA 2F4NA 3L6DA 2B7CA 1YONA 4IJKA 3SZ3A 3W7AA 3AL0C 4IGFA 5EZYB 1W6RA 1G42A 4A6EA 3FGOA 4PC2A 4F2GA 5ENZA 5H9WA 3OA2A 3T1TA 1XK6A 3K96A 4OAOA 5D7NA 2IBTA 1DCFA 3NTQA 8OHMA 2PRSA 1B0AA 1SCNE 4R51A 1VM6A 1I7NA 1OA1A 3IP7A 4LS3A 5FNVB 3C7CB 1HDYA 2PE5A 2HSJA 4ZQGA 4YAJA 2BGUA 3EODA 1MB3A 4PO3X 3QVLA 3VKGA 4JNCA 1I80A 3QWIA 4RIGA 4JIMA 1QQ5A 1Z28A 5HS4A 4Q4AA 1EM8A 1X6VA 3TTYA 3GLGB 2RONA 1T5OA 3BH6A 1B73A 3CKKA 3GD7A 1FX0B 4R0NA 4TGLA 5FTMA 3PQ3A 2D2FA 1MABA 5DBGA 1ILEA 4CM4B 2GBLA 1H65A 2IP4A 3ROKA 5IPFA 3SQMA 1B7GO 2CVFA 2DFVA 3N8NA 3QENA 1NP7A 5BORA 2FU5C 5BNIA 4L0QA 5F73A 2OWEA 2QG4A 1B16A 1XIVA 2FFJA 1K06A 1NC3A 4XIFA 4DV2B 2G08A 1OWNA 2H7CA 4WZ6A 3PC4A 3LBHA 4G5FA 5KOIA 1Q0RA 5CLHA 3Q8XB 1P4AA 4Y3UA 3WRWA 3ZDBA 2XUGA 1NX6A 1XC7A 1ZITA 3CHYA 2BMEA 2KLBA 2X6RA 4UDNA 3KXLA 4QM7A 4IOLA 4TRNA 2ODPA 1DC3A 1E1DA 1VBMA 3K0AA 2PR2A 3WBBA 1LBSA 3EVDA 5CIQA 3UXMA 1YB1A 2HWYA 2FDRA 3CRMA 4OIMA 1KJJA 3TLXA 4II2A 1CZOA 2FLVA 1FLAA 2UZ3A 1PR4A 3DV0A 3FWNA 3I6ZA 1RPAA 3NOQA 4FGLA 5E6RA 1T2NA 2GM3A 3BXPA 4BO9A 5LM3A 2VUIB 3UHPA 4CFZA 2JKYA 5CFZA 4Q1DA 4OL0A 1GUDA 3VR3D 2BV3A 3LDHA 4CUJA 3WB0A 1E5XA 2IP1A 3KOUA 2WTUA 2Q2NA 4JLMA 1F2TA 4OI0A 4R5MA 1WHSB 2H3EA 3SFTA 2XMZA 3JSXA 3ZDXB 2ZK7A 3RYHA 1C9KA 1AA9A 1N0VC 4OYHA 5AVUA 3O9ZA 4F6LA 5D5QA 2X40A 1MH9A 5MN5A 1USWA 2FPRA 4E0BA 2IYOA 5DFAA 3RFXA 1MKYA 3P97A 3ORFA 1Z63A 2CEKA 4GNRA 3U81A 2Y1OA 4UBJA 4HH1A 2M1ZA 4MIOA 2FN7A 3BRSA 4B0PA 4I9FA 2YBEA 4E94A 1U7OA 1KWKA 1N2CB 3SC2B 4LSZA 1E8DA 2AD5A 3JSAA 2NU8B 4CF4A 2ENUA 4CTMA 4R0MA 5EIEA 4NIMA 2IF2A 4MQEA 3RVJA 2V1UA 4F3TA 4CM7A 3ZW9A 1ISPA 1EA5A 4Q03A 3RNLA 1FUKA 5IBCA 4L9SA 1YZNA 3ENZA 1QIEA 3O31A 3HSYA 1QV6A 2WSBA 1U3TA 4P54A 2P65A 4XQEA 3FM9A 1XF9A 1UOEA 4IX1A 4O2BB 2ZRHA 2XUAA 3DTTA 4S1NA 4F9EA 3IALA 1V7CA 2QUKA 4YCNA 5FV4A 3DL4A 1SKAA 3QFSA 4YMSA 5EYPA 3CVWA 2BTQA 3WMXA 2UU9B 3TSOA 4KFRA 2ATIA 3HKEA 3RIGA 3TG8A 1LLUA 1YJ5A 4DDVA 2PGXA 1OOEA 1SCIA 1V8PA 2JFUA 2X4LA 1GQYA 4RACA 1M7GA 4Q4LA 2R1TB 2MT9A 4RD4A 2E1RA 4YMHA 2VHWA 3I52A 1OKKA 1WUKS 2XE7A 2J3DA 2JJ1D 3QBTA 5LUAA 4UBOA 1P4GA 1YE5A 3THOA 4AQ7A 5F4BA 3NORA 3WIVA 5F23A 5K6RA 1WSWA 4OQFA 3KTOA 1PZNA 4IDPA 2V7QA 3E5RA 1ZK2A 1TZKA 1U5BB 4JMPA 3TW8A 5EA2A 2J9YB 4JBYA 3DM9B 5J43A 1MHPA 2VUTA 3P9SA 4C6TB 2UAGA 1OTXA 4X84A 3HL0A 5L8VA 3U49A 1HL7A 3CLHA 1QGYA 1NPYA 3JAWA 2EWMA 5GIPE 1C1DA 3HY6A 4G0PA 1K6EA 2PZ8A 3O26A 2WG1A 2WUWE 3O0DA 4GI5A 3QLEA 1NXOA 4MMYB 4DV3B 2DG2A 2VNAA 4OQDA 4EVIA 4ED9A 1E32A 4G65A 2ZIEA 4PRLA 1A4UA 1PEDA 1NYTA 4Y2RA 2YR0A 3KYBA 3VZCA 3U44B 2WWHA 4QDXA 4WERA 2XD4A 1O4VA 3IQXA 4X5OA 2ZDQA 5H16A 1NMSA 1TMOA 3ZIAA 1QWSA 2VJQA 1W5FA 3EYAA 4LJRA 2P4EA 4RK7A 1WCIA 4XWGA 4E13A 3A6GA 1GNRA 5DKFA 3VR4A 3UJNA 1J0XO 4N6GA 2JLSA 3RV3A 3PXDA 1A9SA 2IZ0A 3R3VA 2W2TA 3CINA 5CB4B 2I67A 2VXYA 3UNXA 1TQDA 3THYB 4PPNA 1JU9A 1M2KA 3AFNA 5AYVA 5ICMA 1TA0A 1T4DA 4MI6A 1LF0A 2FEXA 1IPFA 1Y1RA 3WKAA 4CKCB 5KOHA 1MXFA 3HDJA 5ALNA 5C4MA 3VX3A 3LI2A 2JBAA 2WF6A 4EA7A 1Z9BA 1C3LA 1JIJA 4MVJF 4NSNA 3IQGX 1C7IA 1GZVA 4NK5A 1Y37A 1YAJA 4BAGA 1UM9B 1QH0A 2QEQA 3NKFA 3UMJA 1JHOA 2JIBA 4Q21A 4CETA 2H5EA 2C88A 1ST3A 2RHMA 5JVDB 4BQRA 4EJSB 1DJQA 3EZ7A 1R0XA 3OF2A 3MB8A 4HXFB 1P2VA 3B6EA 1WG8A 2BR3A 4JI5B 2ZUSA 4B79A 3NJRA 1SBCA 1ZN9A 3ORQA 3AOGA 1QVRA 5JROA 1H6BA 1Q16A 4DUYB 2VO1A 2NOAA 3NBFA 1FDIA 1Z2DA 2BIFA 1XRPA 2ZE8A 3FKSA 4L0DA 4CM8B 1IY8A 1V1MB 3DR3A 1WKCA 3IAXA 5K3OA 1P2GA 3A1TA 3T34A 1M5RA 4AZ0B 5HMLA 2V7PA 3H9UA 4MI1A 4RSMA 4DG9A 1DAPA 3OZCA 3ZLVA 2Q0XA 3WL7A 4DQVA 3EEQA 2P6PA 5KWSA 2AFIB 4I36A 3HEBA 4I8XA 3AKYA 4DAOA 1NT4A 2P41A 2UZ1A 4C7VA 4UXJA 1RWBA 4W1RA 4BYMA 4IQ8A 3MQ2A 2XBLA 3E0XA 1FE8A 1GLGA 1XTUA 2FDCA 4YR9A 2PPVA 4YRMA 1OX4A 1H6DA 5CDFE 3TXAA 4PHGA 4Q6BA 4OI1A 4CPDA 3ZLUA 4D9BA 2UKDA 1SKYE 2GZHA 2PYZA 2XGSA 1ENZA 1EIZA 4NEQA 3WGKA 4OQ4A 4EELA 1D4OA 2VSYA 4M46A 1UQUA 1F2VA 4G9EA 2DKNA 4PQFA 1E1NA 1R4AA 1S2NA 1NAHA 3NC0C 3PDHA 5TPZA 2ZDHA 2QAGB 1UZAA 4YS6A 4RTLA 2HFKA 1N2XA 4S1WA 1PFVA 1SXJD 1RCTE 3W5JA 4LEIA 1R5BA 1MG5A 3UYKA 3AK4A 2XMDA 1O95A 4OMUA 4OGGA 2XNJA 4ZDJA 4F21A 2JVIA 5CVDA 1E69A 5LPNA 1K3FA 3CIOA 4LYJA 1I4DD 1ZK0A 4YGXB 4MMXB 4DMCA 3VVLA 5JBQA 3CCCA 3FWHA 4EVQA 3FVQA 1U0RA 3LC7O 3LVRE 1JKXA 3RLFA 1K0FA 4G89A 4HI0E 4DV7B 1VL1A 4I08A 3WA7A 3DZHA 1HLDA 4L5CA 4EW6A 5JY6A 5D3KA 1DAEA 3GJ5A 2Q6VA 3JXEA 2ODAA 3WO1A 1L7RA 4IIBA 3KE9A 3GNTA 3QBDA 3T9AA 1E8MA 4TT3A 1NG9A 1WB4A 1CR0A 4QPJC 3D4PA 1Q83A 2QBYA 3V6MA 5K0TA 1EUYA 5MFZA 1OILA 1RC8A 2G88A 4KQ9A 2FXVA 2P62A 4J0JA 3FPCA 4Z2YA 3VV3A 3SBDA 3GWZA 1M83A 4K1XA 3N2EA 1PHRA 4F4CA 2XCTB 4HATA 3EEIA 3PFGA 2GD6A 3QMVA 3CXRA 8ABPA 4JSRA 5DI3A 3L6CA 3KAKA 1VLMA 2M2IA 4LTMA 3EC1A 3V2UA 4QTUB 2CLLB 3I12A 1UAAA 4IIJB 2H07A 2VTDA 3AHFA 3AVOA 4HB3A 4M1OA 4B7CA 3ZE0B 4UREA 1OXVA 4OQZA 2G25A 5DBIA 3EPHA 2O8CA 4WRRA 5ICGA 4EYOA 4E08A 1WCYA 3P27A 4JT9A 5HIIA 1B3RA 1YB5A 2QGFA 3IQEA 3I3SR 5FUMA 4JU9A 4PYLA 3QV2A 2W4MA 3WBFA 3MILA 3RJTA 5A5FA 4B45A 1A8UA 1YR3A 2X2EA 3AHGA 3CZ5A 4N7MA 3AI3A 3P2EA 4HWKA 3D7LA 2ZXUA 1T43A 2JA1A 1Q21A 2DTEA 2FZ4A 4NPAA 5H0IA 1UKCA 4W5NA 4RVFA 3Q88A 3QBJA 1F9AA 1U28A 2BHRA 4DG8A 1FDWA 5K0GA 3EOAI 5KSWB 3ZEAA 1SMKA 1JEOA 2HADA 4QYWA 4B3IA 4CHTA 1MRSA 1U1IA 2Z58A 3GARA 3O90A 4MR8A 3VPBA 3BT7A 4FGZA 4RAQA 4G4SP 3L8DA 1SBQA 3EAQA 2D62A 4O4JA 5KVAA 1C81A 1BEEA 1JA9A 1NVEA 2QMOA 3GOHA 3HADA 4URZR 5UKDA 1Z4IA 4DG5A 4OXYA 4HNRA 2A2ZA 3QVWA 5C0OE 2C7PA 2YWDA 4IDEA 4H17A 1Z75A 2YY6A 3AP1A 2FQXA 3JALB 4LJ4A 3EUAA 4CUZA 3CR3C 1BZYA 3LZ6A 1X38A 3EIEA 3VJMA 4K6GA 4XIJA 5HKAA 4LDZA 3U4DA 5JWHA 1FNBA 2FA9A 5F2KA 2FX2A 4HRYA 5HNKA 3NVMB 4QUDA 3ZXYA 2JHAA 1D4AA 5DRYA 4X62B 2VWPA 2ISCA 3CRRA 1A4IA 2D00A 4FD2A 4I4TA 5CA0F 4CFSA 1D07A 1Z83A 1DT3A 2I4LA 2WM9B 3G0BA 5AXBA 1XYVA 3NTUA 2FY8A 3BSFA 5KREA 2B9EA 4IIVA 3MUEA 3RYIA 4UFNA 2BF4A 1IZZA 1Y3FE 1FDVA 1JTEA 1RRPA 2I62A 2XVZA 5J2UB 2QUZA 4JYMA 3D3WB 4RZQA 1GO2A 2DPHA 1G66A 4PPQA 1GITA 1J1ZA 4JB8A 1Y1SA 4G1VA 4WD3A 3L05A 1ST2A 4WOJA 2QX6A 2P8SA 1Q6YA 4RGBA 3UPDA 1JEAA 3OIWA 3NFYA 3LUHA 4JK3A 6YASA 5CLIA 1W44A 1WB5A 3EDOA 4W82A 2WSLA 4QDOA 3NHUA 4PYMA 1EDEA 4AZ3B 2B98A 1Y42X 5LP1A 3BSSA 3EOBI 4PX2A 4XVRA 2Z95A 4ZT3A 4G81A 3Q7EA 3PQ2A 3CM0A 3BRWD 4IPTA 4QJ4A 4HUTA 2LDXA 1ZI6A 1D9XA 2VTBA 4HHEA 2OCGA 4XWWA 1JQKA 4AY4A 3D3KA 1XPOA 4PCVA 4H4CA 4JUFA 3K9LA 1U0FA 2FP4A 2QNIA 3FBGA 5TE9A 2WPDA 3QE2A 5C18A 3JRXA 9ABPA 1WCWA 2DECA 3KG2A 1W75A 2HR1A 1O97C 1KU6A 1WD5A 4AO6A 4RULA 1GFWA 3E9QA 4IJUA 2BUAA 3AR4A 4A4DA 1VL6A 3DEZA 1POWA 2Q1UA 1KEWA 3DOJA 4F56A 2BMFA 4D82A 1X15A 2IEIA 2ZJBA 4EHAA 4GKVA 4Q4JA 1NQXA 4AMUA 4O5OA 2G1PA 1QHFA 3MS7A 3PR3A 1BS1A 1OV6A 1P0PA 4C78A 5KHOC 1XN4A 3SICE 3HA5A 4YI5A 5DLPA 1T8TA 1VB3A 1KO1A 3PITA 1QP8A 1QTQA 2ROQA 3KETA 2YNMD 1WS6A 5GJBA 5IFKA 2OORA 4PC3A 4FINA 4GOXA 1GCIA 5TQJA 1YOVB 1M8GA 4DLRA 5AW8A 3G0HA 2ONJA 3ZGOA 1ZKMA 1WOYA 2WKRA 1C3OB 1OXTA 1Y5MA 1CDZA 3EQ7A 3IPAA 4D56A 1MA3A 1W6UA 5A04A 3UUGA 4AG5A 4H2DA 4JV5B 2E6KA 3PFBA 3AUXA 3H9CA 1DFGA 2R2GA 1EWTA 2Q2QA 4P38A 5FO0A 3DFZA 1E64A 5C5EA 1EWQA 2GBCA 3PNBA 4M22A 1Q2UA 5EMKA 1SELA 4UCQA 3ZKAA 5K3FA 1K66A 3IV6A 3QXXA 4INPA 2AQHA 2EJUA 1I4OA 2GYWA 1PNOA 2H0RA 5KTTA 4M4SA 3GR6A 3IHTA 3HI6A 3IHWA 2Y92A 4IWYA 2GEVA 3A37A 3OC6A 4N0DA 4ZVRA 3SSAA 2WIJA 3EG5A 2X4DA 2E4XA 2PGLA 2P9FA 4GC9A 4CZ2A 4YRLA 1P33A 3I2YX 2QQFA 2VDVE 1FUUA 2ASEA 4RIFA 4GRIA 4G67A 1TZ2A 2D13A 4IWNA 1HETA 4ND3A 2FPMA 4C3VA 3V4RA 5EIXA 1NASA 2DH6A 3KAQA 3OQMA 1Z4QA 4B31A 5L3QA 3THXB 3P4XA 1EE2A 1LSOA 4LJ5A 5NULA 2X9NA 2DFDA 4B71A 3QTTA 3V8BA 2E4VA 1J2YA 2IHKA 2JJQA 2NO7A 3GGDA 1GTMA 4AN4A 4AUMA 1CB7A 1IMJA 5G3ZA 5BUCA 3IP6A 3GRKA 5EVCA 2PA0A 3CZRA 2E55A 1COWD 1FS6A 2ZJ3A 3EK2A 3OEED 2JZCA 4FBMA 4D57A 2VJMA 1UDBA 5K4HA 5I7OA 3AHCA 3L02A 2I0FA 3TGWA 2PYIA 1FF9A 4BFUA 1MFZA 4WX2B 3PKZA 1U7XA 1JBEA 1OT3A 2DU8A 2FW7A 1FK8A 4BB9A 3RHFA 3O93A 1KMQA 4JIGA 4Q00A 5EMLA 1OV4A 1RRCA 3CKYA 5TGTA 3R7SA 1QH1A 4OTZA 4BXOA 3IAEA 2Z43A 4KLZA 3GNQA 1R8XA 3GA7A 1TAUA 4JB2A 2FG7C 2W2PA 7AT1A 1GM5A 1TU3A 2RJOA 3FPGA 3L8EA 4HFNA 5I8PA 1T8RA 2QGNA 4H60A 3AF5A 2H4ZA 2GJ9A 4K6OA 5JALA 3PDIB 4X1IA 2QXYA 1JRLA 2J7KA 5KCZA 4KXLA 3WZMA 1PX0A 1AK1A 4ZXFA 3WV4A 1HZJA 1HYEA 1EVKA 1BWRA 1MIOB 2GVDC 3ILYA 4ZT7A 5BSTA 4B3MB 5F64A 3BIJA 1XVAA 2DCUA 5DNAA 3BGSA 4JUAA 4W8HA 4PNHA 3PDWA 4AZWA 1PUXA 3F96A 4DE5A 3GHHA 3ELWA 3H87A 3QBEA 3ORRA 5J1TB 2JCGA 4C0XA 3HJFA 2MINB 2Q07A 2F9MA 2CYBA 3B70A 3K1YA 4TS1A 1MC1A 5TGZA 1QYRA 2NT3A 3CV3A 4CIAA 1FFBA 3GFRA 4K46A 4GQAA 2VXCA 3VHXB 3N0WA 2GNPA 3BFJA 3AILA 2DPLA 3P0EA 5HQ3B 1O6CA 1UMDB 4FFDA 4U2KA 3E7FA 5KOYA 4QEDA 3O7MA 1Z68A 5K2OA 5B30A 5K0FA 1R8QA 2NN3C 1ZC3A 5AOCA 1WDMA 4O0MA 2QRMA 4KV7A 4XYLA 4B43A 3HCPA 1XTBA 3WL4A 4NCHA 2M32A 1DQNA 4Y18A 1P1KA 3Q87B 1FQKA 1LXCA 2J48A 3A9RA 5K3CA 1V71A 3OECA 4YP9A 1T26A 3SE7A 3R3UA 1NT2A 2BUBA 2X23A 5HCUA 3R9IA 1Z8DA 3LA8A 4HDMA 1ZNWA 5B2EA 4CGZA 1E3DA 2BEWA 4GR5A 3VPXA 1P6QA 2HUNA 5IF9A 4AJKA 3DMGA 3JQFC 1PP4A 2DOKA 3DKPA 4DABA 2VHZA 2HJ9A 3C16C 4R9NA 5TVGA 1BEZA 1NNUA 2PTHA 3IDQA 1LTHR 2O9JA 4XLLA 2FKNA 2JAWA 1OQAA 5EG5A 1XJ5A 3ZVNA 1BVHA 3HRKA 2REOA 3O1LA 1H2ZA 3OO0A 3QKRA 5EWMA 4ZEXA 2GD0A 4PLYA 2R5NA 4NYIR 1SJ9A 2GT1A 1T25A 1ZEJA 4M8KA 2XKJE 3KHTA 4HMPA 4Q7KA 1VE7A 3A25A 2PYDA 4RL4A 3K3PA 5IVPA 1YUNA 2J3EA 4HRAA 4N3BA 5DN9A 1GZSA 3ED5A 3JVUA 4B87A 1I9GA 2R1UA 3AL2A 5ERYA 2JFZA 3UJHA 2YC2C 3OPNA 3STTA 2I6TA 1CWUA 1RLIA 3U7QA 1FIUA 3CYFA 4KN6A 2H54A 3OE7A 1CJUC 1WUTA 2HTFA 4WNAA 1XCLA 3QEMB 2W7TA 4LY6A 4L8GA 1A27A 4M38A 1SQ5A 5LQNA 1M1YE 3BL6A 4G5YA 1DNPA 4PNZA 4V03A 4A2WA 1XCMA 3FF1A 4NE2A 4GRAA 1VBNA 5LP6C 4OJMX 4HTAA 2ZE7A 1EFPB 3DMRA 1CDEA 3KQQA 5JDIC 1T9AA 4HDSA 1VLJA 2WKQA 3GEGA 4FTWA 1T6YA 3R20A 2IXDA 3D7KA 5IAEA 3LPNA 3LS2A 2PUBA 3PDJA 3B7PA 1P29A 3G6KA 3M2TA 4LUCA 5CFNA 1J7KA 4KLAA 4D9GA 1U9IA 3CR8A 2VTVA 1AHNA 2AHRA 2OGTA 5DLYA 1YQGA 2IYFA 1XJ0A 3U4AA 2C2XA 3L8FA 4EQ6A 1E2LA 2OFWA 3DWIA 1HORA 2J0QA 4YUAA 2ISQA 3EIHA 1QIGA 5JS2A 3V4VB 2LKCA 3RVRA 5BV1A 3R5SA 3OZVA 3O8OB 1JFFB 4DIBA 1K3UB 1FNCA 1DZIA 2F90A 4MNTA 5IKMA 5AESA 3W5CA 1BDIA 4TZ6A 2O59A 1V8OA 5DLDA 2W6QA 1G8MA 4XWTA 5DH9A 5DNDA 3SYRA 7MHTA 1KSFX 1ZEMA 3UGTA 4M98A 3T5GA 1ZJ6A 4AECA 1KI4A 3KWFA 3ZU6A 1JALA 1Z6ZA 1CJKC 3MWYW 2Q5QA 1UINA 4J0HA 4N5MA 4Q9KA 4D46A 4DV1B 2NXWA 1ZVVA 3PQ5A 2R6DA 3WRVA 1ORIA 3GXOA 1W4RA 4MJXA 2GTPA 4PFQA 5KOJA 2AS0A 2YRWA 4FT4A 4JD5A 2C7GA 2EZTA 4K26A 3MRTA 5I8ZA 4HZUA 4D0NA 1KSHA 3FVTA 3D8NA 4QUKA 4IS3A 4RORA 1K4MA 1OCEA 4D8WA 3QYPA 2QM7A 3LUPA 5AJUA 3GMTA 3OZ7A 1NI4A 2A58A 4HVTA 2QE6A 3LC2O 3DMHA 3WP0A 2QZPA 2BL4A 1K9SA 5EN4A 3JRNA 3TOSA 2YY7A 4BZZA 5AW7A 3OJWA 3GEPA 3HU5A 2YHUA 2QX9A 1GADO 1XMXA 2D1YA 3NVKI 3HWRA 4FIDA 4L9RA 4R8KA 3V1UA 1JR3E 3N7TA 4N0QA 1A2BA 3ZDDA 4EJ2A 1RKVA 2G6BA 2XKKA 1YMQA 5IK2A 2HK6A 3VISA 2NACA 2F8TA 3IP8A 1U2PA 4F8JA 2I99A 1I4WA 3WI7A 1Z6GA 1RWNA 2FOXA 3LT4A 1XTSA 5EIWA 3EIXA 3ANNA 3FVVA 4U2EA 2Q99A 3W9YA 1K68A 1B3BA 1LBQA 4E5SA 3IC5A 4WOBA 4FR0A 4WKCA 1BVYF 1Z4NA 1H8ED 3B3AA 3BF8A 1N5IA 2Q49A 4R2LA 4UOEA 2XWJI 5M3BA 5EJ7A 1KIAA 3QXHA 1KI6B 4OQPA 3MYYA 4HUQA 4F4IA 4F96A 4Z99A 1RPJA 3CNQS 1NUPA 1UXGA 5FHQA 5LYJA 5HJ7A 5JZSA 1DX6A 2PWAA 3IIIA 1MJHA 4IGEA 1NF9A 2ESRA 2FSFA 3L1HA 4BIIA 2FWAA 2A0YA 4DCOA 2C59A 3KBBA 2CV0A 5EHNA 1SA0A 2SCUB 4KVAA 2I6SA 2N3ZA 4IVPA 2ZUEA 1MIHA 3CG4A 1WB9A 3MNFA 3GLIE 3KR9A 3JARB 4MW1A 3WLQA 4DLVA 4UARA 3L3BA 4YYEA 2W42A 1QPZA 6AT1A 1SD5A 5JJLA 5I4BA 2HMAA 1QVZA 2XUQA 2XZPA 5DTEA 4BDTA 3MCWA 3EAFA 2FPKA 1N9GA 4BV9A 1YHYA 1RKXA 2ZI7A 1QHYA 4WY5A 1Q44A 3WTBA 3AP2A 4WINA 3WS7A 4OVKA 5JTUA 4MDFA 1RJFA 1EEHA 3QITA 1KDVA 4D97A 3CEHA 4NYJR 4LFCB 2OY0A 3C3EA 5LQSA 3DBOB 4JZYA 1B6RA 3LT2A 3TE7A 1J0AA 2NUTB 3PBKA 1UBGA 2VRCA 4HX5A 2O3QA 3Q3EA 2MR6A 5CVCA 4B2LA 1FXSA 3HBMA 3RK1A 2GFIA 1YDWA 5A1JA 3KD3A 1EG2A 4GX1A 5HFJA 4ZOLB 2QQ5A 3BMCA 3PX3A 3HWSA 4PCAA 1GZ3A 3BYZA 1H9BA 2DCMA 1RXEA 2YC4C 3TO5A 3V4LA 1SVMA 3FWKA 2B92A 2J9ZB 1HYGA 2RI6A 3WADA 2R7LA 4ZMRA 5BT9A 4C76A 1CEXA 2P3OA 3RNOA 1GRVA 1TMYA 1XQ9A 1LJLA 3DAGA 2G5TA 4UUAA 5AI4A 4HAWA 5IAKA 3FNRA 1Y1TA 2FWNA 1ZM3A 4KFTA 2ANBA 3K20A 2TMGA 1KF0A 1YB4A 4IIYA 1W36B 4NU0A 3CLUD 3ZWYA 4U63A 3L4BA 3UMCA 4XSGA 4PLTA 1XP5A 2PZKA 2BI7A 5ENDA 3JQAB 5KVQA 3V32A 4DA9A 1QWOA 1NOKA 1P6XA 4EPWA 1ELOA 2XE8A 4NE9A 1EXNA 1NXWA 2Z08A 5LA6F 4AY6A 3H7IA 4D81A 2XLBA 2WF7A 1SKMA 1I7DA 4KAFA 2FFAA 2ZR9A 3EQ6A 1CUSA 3ZQ4A 3OY2A 1XDWA 2ZBGA 4J16C 3FPHA 1XD8A 3S2FA 1S3SA 4E5KA 1KAQA 1LLCA 5J2TF 2IH4A 3HKDA 1XP8A 1PAUA 1DOZA 3KWJA 5SZJA 3EPLA 2AC7A 4G63A 2BSAA 3INGA 1UR5A 5DYYA 5B12A 3UBTA 1EGHA 3ER9A 5ED0A 3SEQA 3UWSA 2GZ2A 1H66A 4UXIA 4M1SA 2F4VB 3BJZA 4M88A 4Q37A 2WSYB 2I6FA 2I9KA 2MDTA 3AFOA 4G23A 1ZGHA 1DS6A 3GFTA 4KWTA 3K1JA 4NV1A 5BNWA 4F72A 1T91A 2BFAA 3FFXA 2A9VA 2BHLA 4P4TA 3EVTA 4QJ5A 1XLUA 4TMFA 3PFWO 1PR6A 4AB1A 4AS2A 4ZIRA 3K0SA 2GXUA 3LCVB 3FNGA 2G6TA 4CR6A 3ZD7A 4NG5A 4C21A 2IYUA 2N46A 2VP9A 3HN6A 3E0QA 2UYCA 4Z49A 1Z0SA 2P40A 3COVA 3DMFA 4YUZA 4D4JA 4E2WA 4KWIA 4MZDA 1RHJA 4BKQA 4JUCA 3DXZA 4MTCA 4UVHA 4E31A 1LSJA 1T5BA 2VBCA 2X8JB 4I4NA 5AUPB 1E3SA 1KXJA 2WK1A 3C3PA 4GE3A 4HAYA 4NJMA 4XWYA 4BUZA 1XHEA 3NHFA 4FOLA 1CS0B 1A5ZA 3SHTA 5C8VA 4H6VA 2V7WA 2GYUA 3A10A 3KLMX 2FF7A 1SXJE 2C7OA 4UASA 3DAFA 2H4FA 3UT6A 1PR9A 1GU7A 5LSAA 2XWBF 1HRKA 4R8VA 1C1XB 2DPMA 4ZCPA 2OXIA 2BE9A 1P7VA 1PVDA 3AMVA 1URPA 3NBAA 2EJBA 3NHAA 3QVGA 4ODIA 3THSA 2E82A 4ER5A 2P6RA 2IZ7A 1WDKA 2OUKA 2WV7A 3U3DA 4QQ8A 2A1TR 4IDCA 3AIOA 3ZCSA 4AXXA 4QG7A 2WVJA 5AI5A 3MOIA 1N2JA 3GYGA 5E7QA 2O7RA 4E12A 1D2RA 4Z7OB 3OJCA 3RVLA 2CNDA 1CZHA 3GXBA 2R6FA 4N5HX 4TLLB 1G3RA 2P78A 2AZMA 2IYRA 3OT1A 1XZNA 3IUBA 1U5CA 2F1KA 2AVDA 3TZBA 3E58A 4II3A 2CMKA 3SQDA 3VAYA 4BP1A 2IYEA 4M9QA 2FWIA 4LHYA 1KMIY 3W1EA 1DDGA 4Y2YA 3VSDA 2QG6A 3HP4A 1WPXA 2NAPA 3BXGA 3OUUA 5GJCA 1I6MA 2OHJA 3EBLA 3S3TA 4KPFC 3DDWA 2V96A 3TLBA 4LSMA 5KKCA 1WJGA 4MYHA 5LCXA 4RJJA 2NZVG 4WMLA 1WV1A 5HMMA 4YXWD 2CNWD 1SIUA 4N1AA 3ZQJA 2NVUB 2FMIA 3GJSA 1R4MB 2FX3A 3IAHA 4OL9A 2IKSA 4ZHSA 3T0GA 3A6FA 3I6IA 5E0KB 3S8YA 3AF0A 2RHCA 1U1CA 2DR3A 3W1WA 3G88A 1I2AA 1H8HD 2PZEA 3AF2A 3OJOA 4JVLA 5T8KC 3WL6A 1GGJA 1OB2A 3DB1A 3IUMA 3DTVB 3OETA 2O8EB 1KERA 2CXHA 3DH0A 5EQJB 5JH7B 2B1GA 4LYDA 4BO1A 2HNKA 3ECAA 4HP8A 2R8YA 2XXBA 3CUTA 3GT3A 3RRYA 5JIBA 3PWZA 5IZCA 3W6UA 1CULC 1X8XA 3LV8A 3NHLA 2CYAA 5KQRA 5H83A 1C0EA 3RW9A 5EGNA 4Y2QA 2VZ8A 1SNYA 1Y7IA 3LKVA 2CMFA 3WISA 4A6DA 4IH9A 2BR4A 2H2WA 4WXHA 1XZJA 4UNSA 1NSTA 1X1EA 2Q5JA 4ZAYA 3NMUF 4HXGA 3SZUA 3CKLA 2EP7A 5CDSA 3EXG2 1BMDA 3P2IA 1EEXB 3T7RA 3T7IA 2ZJ5A 4AKEA 2FW6A 4PVCA 5AJVB 4HWGA 3H11B 2O06A 4QC2A 2V3WA 3O2SB 4QPPA 3U61B 2EFJA 2RGRA 3NW9A 2PH5A 1TNDA 1NKTA 2NZXA 3C3DA 3R0JA 1Z4LA 1FFXA 5BRNA 1YUMA 3QEAZ 2EQBA 4H9GA 1V3VA 3GZTB 5EEGA 1ULZA 4S1PA 4B3RB 2HGSA 3A27A 4F6RB 3H4IA 4HK4A 4JJ8A 4MSUA 3DKKA 3JQ8B 4G2TA 3TVYA 1G4AE 1U99A 3PXGA 1M1YA 3BICA 3A3NA 1RHMA 1UPTA 2Q4DA 2UZ0A 1XQ1A 2C4NA 3C3AA 1SRRA 4IP0A 4XIYA 3IOYA 4LDNA 3RHTA 1FQJA 2ZB2A 3RUDA 2WG2A 5EKTA 4KXVA 1ID1A 4F8YA 3OVMA 4PS1A 4R41A 2JIZD 5T64A 1KO7A 3U6BA 3C6ZA 3BXXA 2OXEA 1N5MA 1KI2A 2ZIAA 1GCGA 1KMHB 3RTGA 2OO5C 3LCJA 2X1MA 2O1XA 5B4TA 2ZSKA 2BPOA 3MPUA 2ODNA 1IAVA 2G9ZA 1C9NA 2Q9BA 4JYCA 1OWMA 2PFSA 3TX2A 4MCHA 1QANA 2GK6A 1EI9A 2IDZA 1H4SA 3ESQA 3RV4A 4MW0A 2R62A 3PGMA 3SC6A 5K4AA 2W2LD 4HDRB 2QRHA 1CRQA 3QKSA 1HE4A 4IGIA 1UT6A 3LGAA 4YCBA 1OAKA 3H0CA 2ICAA 1XELA 4I8DA 1Q14A 2A9RA 3ZS9A 5K1ZA 3IT1A 2YZNA 4PAWA 1UZMA 2WT9A 3F5SA 2MR5A 3N8GA 2EKZA 4JH0A 1W5SA 1N5JA 3UHFA 1DOHA 1SKUA 1OBOA 3KTDA 3PJFA 5JSUA 5D6OA 3VR3A 1G9XA 1E2EA 3CZAA 2QJRA 2W6OA 1UZUA 4RJKA 4D0RA 5E9WA 1EM6A 4MP6A 4D42A 3U7FB 1X3SA 1VJ5A 3UC5A 1GILA 3EZ9A 2Z5LA 4QOSA 1S9DA 2W6ID 1E5LA 2DHEA 3KVVA 4O2AA 4TSFD 4BC1A 3IAUA 2IOHA 4KBGA 3RTEA 4YPVA 3MJCA 1NNSA 2WMYA 1J20A 2ZSIA 4NF2A 5LLDA 2A4KA 2Q5OA 3KC2A 3O5AA 4LQLA 4EY7A 2ORYA 2WA2A 1DV1A 4DJ5X 4ROSA 1W36D 3NOOA 3F6SA 1K7EB 5A5DA 4CVNA 2OBYA 2YQZA 1K1EA 2XVYA 4JYZA 1RIFA 1JR3A 4I6GA 5K0NA 4AP5A 4CQMB 2GN1A 4NC9A 1UBNA 1K63A 1QR2A 4MLPA 4BZQA 1JL3A 2WJIA 3LDFA 3GJ7A 3DBLB 4PFJA 1S2OA 1JDVA 4LJSA 5BXYA 1TUGA 3SZGA 3TZLA 5C7IO 3BB3A 3OCVA 3K6SB 5DM60 1ISJA 1A8SA 3G49A 4R4JA 3QSGA 2IU0A 4EH1A 3QE9Y 1P18A 2IEZA 2ORIA 4RLFA 3R5HA 3B53X 2HJSA 4AJ1A 1XDGA 2H1LA 3TW6A 1YQUA 1JT9A 3HVHA 4BMNA 3HJRA 1IVYA 1GA1A 1QDUA 2O8BB 2H4WA 3KUXA 5AVOA 2FZVA 4GD3Q 4HWPA 3I01M 2OMKA 4XSVA 2JJ1A 4BLUA 1IG0A 4LYYA 4ZVSA 1I32A 1IMOA 5ALLA 2HKIA 1GPDG 5E2AA 5DB4A 4UUBA 4OKNA 1WV0A 1C9JA 1C9EA 1KYZA 1VIDA 2FCRA 1XOIA 4UJ5A 1RCFA 4FS8A 4GSLA 4EAQA 1X7HA 1E9BA 4IXMA 5C3MA 4P3YA 3LHIA 2HHCA 1H1TA 3GLIA 4EJFA 3WGNA 1NQ5A 1OX5A 2RGDA 4DAEA 1Q11A 2AIRA 3KVYA 2CDCA 7ADHA 3TG2A 4RGQA 1TQ4A 1YA6A 5K03A 1ABEA 4B3SB 1RXWA 1ZVKA 2NXJA 3NGMA 1CY6A 2A86A 3PUKA 4JY7A 2PMWB 5CW2A 2G77B 4REQA 1DDOA 2X19A 4CTJA 5BN1A 1PR3A 2QA5A 3EGIA 3FGZA 2LE0A 4K9PA 4KOAA 4KW7A 4V02A 1X74A 4QOFA 3S2ZA 1U8EA 1W5BA 2IW1A 1IZ7A 3HV2A 3TBFA 1T4BA 5JD6A 5AM1A 4GI3A 4RS3A 2GDZA 2J4DA 2GCNA 2P75A 2ZRBA 3ZLTA 1XVTA 2II6A 2ADOA 4CM1A 3L6UA 2R1VA 3VZQA 1XLTC 5FBVB 2WTXA 3UUFA 4J0CA 1EZ1A 1UFRA 2AX4A 3DMTA 3EMDA 3L84A 3N76A 4IKEA 3VYTB 5AP9A 5B57C 1OXUA 3O8QB 3F2IA 2P2SA 4YFVA 2JI9A 1LPBB 3G23A 4INOA 1T4MA 3MT8A 3PCXA 4NICA 5AHOA 3TZ6A 5B6JA 1BXGB 5FPKA 1K4YA 3CN9A 1IVSA 4XVQA 2CJYA 4X20A 1LCIA 4EK9A 3SFVA 3CMMA 1PKXA 2YS6A 2GM5A 2V55B 5IHPA 1H2AS 2YL2A 4DARA 2VDOB 4OHMA 4MYSA 3EVGA 3F49S 5A05A 3W6ZA 3WIEA 4C6HA 2X58A 3BILA 2Q1WA 4DCCA 4N41A 4G0ZA 1MPXA 1SUPA 2Z3ZA 3BB4A 1NVKA 4ZT4A 1SN7A 4XJVA 1J9ZA 5F76A 1AKWA 1WCV1 1UXOA 2TECE 4DT1B 4ZK6A 3ND6A 2VCYA 1E0SA 2MSKA 2OM2A 4QU8A 3S70A 2BGWA 1YRHA 1ECCA 3K8YA 2R0QC 3M5CA 2WM3A 3TPFA 1AO0A 2YXNA 1V45E 1CVLA 3E1SA 4JBXA 4ZAFA 2A3RA 1B0ZA 1I3KA 1KH1A 4JGBA 4S1VA 4UNIA 3VVBA 5IUNC 1WTCA 3BWBA 3C85A 4G0MA 1KK3A 3EQ9A 2P5TB 2QTMA 3K8QA 4M87A 1LV7A 1QXSA 2G4CA 3A9SA 3KSZO 3SYLA 2RB4A 4AFNA 3F4LA 1RHRA 1XQ6A 4TSRA 1JEQB 1LJ8A 4NQRA 2EKQA 2PZLA 5BN5A 6CHYA 3WLPA 2ZRDA 3B82A 4E7OA 2XR1A 3C6KA 4WBNB 4AUEA 3NONA 2BFPA 2NU6B 3DTYA 2GNAA 1WP4A 3I2FA 3TMYA 3X2SA 2BI4A 2PRKA 2O0MA 1UF9A 2DEUA 1KZ4A 2B1IA 2ZQYA 2J09A 4OA5A 2NTYC 3GRYA 4DEVA 1C4KA 3GAMA 5AI9A 1HMYA 1JSXA 3AFMA 4HBZA 1BFDA 1L1QA 3RU7A 1UWVA 4XTCS 2X6TA 1GARA 5HKLA 2WPNA 1SVNA 5DX0A 3CRVA 1J22A 4P2BA 3TAXA 3OZAA 1O8BA 2E9SA 3EAGA 2EF1A 4HX2A 2DWPA 1ZK4A 1X92A 2UVPB 5FNVA 3CRZA 3ES9A 2Q5LA 1PT9A 2WG0A 1E6LA 4MPDA 3W90A 3E03A 3LXRA 1LTQA 1P74A 5F9FA 2JH3A 1ODSA 1ARZA 2H2DA 1SXJA 2JK0A 1DTWB 2QJFA 2VOJA 2YICA 3KU1A 3KZKA 4TS9A 1UBEA 1E7QA 2JFBA 4TRMA 3F8SA 3KQUA 5DK6A 4RY9A 5FEUA 3PDCA 5K01A 3GLGA 3AOEC 5ITVA 1RS0A 4CMHA 3I9FA 2QI9C 4OBBA 1WMDA 4UCWA 3C6MA 3T7CA 2O3UA 4CM4A 1X8KA 3FAZA 4R3UC 2SKCA 4TL8A 4URUR 2C31A 1KZHA 4AW9A 1BHJA 2FI1A 2D4AA 4KGXA 2IXFA 3V1LA 5HRCA 4M1WA 1RRKA 4KRGA 1IUOA 1IM5A 1MZVA 2D1FA 5K5EA 2Q6TA 3DD1A 3PEFA 3DBIA 1O94D 2CGEA 5CYFA 4YV7A 4N76A 3DV2A 2GEFA 3FLBA 1ZUWA 4XFKA 1CCWA 4GLJA 4KDFA 4QQKA 4RX1A 2OM6A 2ZREA 1JPJA 3BA1A 3I53A 3EPJA 4DJAA 4NR0A 4QHSA 3ZX4A 4IQ4A 2QR2A 3RIMA 2XNDD 4IOKA 4NFHA 5ALXA 4G85A 4ZVTA 2G07A 3TQOA 3CF6R 3M9LA 3QFHA 4MS4B 4MIKA 4X93A 3WGQA 4KQHA 1H3EA 1AHHA 4BNXA 1YRQA 4TMVA 1PK9A 4JLKA 5HJ2A 1G291 2ZG6A 3E7DA 3WGGA 1VZ2A 3OCUA 5JZ9A 5I9IA 1QQAA 2JC3A 2YINC 5G53C 4MWSA 4V0LA 5BYKA 3D0OA 5DF1A 1WHSA 1JLLB 4PAOA 1F48A 3DVSX 4XYMA 3ZLBA 2O5RA 1E61A 1K8YB 5DTMA 5GVRA 5A1TA 1UC9A 5JEDA 4UAVA 4WIAA 5EP3A 1PQUA 1I9CA 1M8KA 1P1RA 2VG8A 1BE0A 3GI1A 4LZJA 4BNYA 1V8DA 1A69A 5ALQA 3Q7RA 3AM4A 3G2PA 4I1IA 4JQCA 4ZAVA 2E4YA 5AOAA 1BJTA 4LXYA 5JSFA 1KKLA 4ZKEA 3THWB 1Z6XA 4M1TA 1N2CA 2KB0A 3AXTA 3EJWA 4QBTA 2CNOA 2NU8A 2J5QA 3SC2A 4WNYA 3OLXA 2Q6LA 1BA2A 1SZJG 1H3FA 2KI5A 2TMDA 5TJHA 2VQFB 2YMPA 2JF0A 3JQ7B 3E82A 4F3KA 4CQMD 5ALWA 3ADBA 4ZO6A 4WASA 4S24A 5JJCA 1PU2A 1F2UB 3BQMB 3G79A 3LA6A 3RBAA 4LJ9A 4KPUB 2FPXA 2WSMA 3G2OA 4AF7A 4LF4B 4F9GA 3AGPA 3AHDA 3RS2A 4O2BA 1SC6A 1Y7LA 2C0QA 1EFRD 1NFRA 2P68A 3OF3A 4D6YA 4RETA 3EY4A 1JQEA 1M2WA 1DCKA 3ED1A 3F74A 3ND8A 6Q21A 2V0NA 1B26A 2SBTA 1M34E 4WLVA 3OX3A 3LDGA 2IELA 4NZNA 1LQTA 2JKZA 2C96A 2PJUA 1DX4A 3CUWA 3G02A 2R1TA 2R00A 4D02A 3H2YA 3H16A 1VI2A 2J8ZA 5HDBB 4FW9A 4EB6B 4L78A 3L7YA 4RVUA 1ZD5A 2ZIGA 3RRBA 2P8JA 3I9V6 5C5DA 2ZRPA 1XPRA 1TJYA 2P2NA 1Z7WA 3BGIA 4X61A 5I47A 2D06A 4UEJA 4MUMA 2ZM5A 3PYXA 3QEJA 4BE9A 1B8PA 1SWVA 2V3VA 4PGMA 2A35A 2Y68A 1G5FA 2G70A 5JQGF 1R6BX 4GMDA 4RA9A 4DR5B 4AYTA 3PPXA 4EPYA 1OZFA 3DPIA 4PWZA 4K0KB 1HG1A 1SVKA 3JV7A 4LRQA 5ESDA 2FW8A 1H6CA 2F3PA 1XZQA 1RP1A 4K40A 4M9UA 4C6TA 1NLUA 1JEEA 2OV1A 3OX4A 2VXOA 2ZETA 4X24A 2P3LA 4HVLA 4I5DA 4CMJA 1GTVA 1PO7A 1WABA 5EHIA 4G1MB 4AF8A 2IBSA 5AJTA 2GH1A 2YFQA 1VP3A 4O59O 4M6WA 3CWQA 3LP6A 5K45A 1UEJA 1NGSA 3DXXA 4KO3S 5T4BA 4BJ1A 4DIMA 3U44A 4Z4IA 3LCUA 2GHQA 3FTEA 1KYIA 2EZUA 4ND5A 1MOSA 1WE2A 2YDXA 3HPRA 4BBJA 1G5QA 3BRWA 4C20A 4YRKA 4ZZ2A 3IMCA 1WHTB 2O6HA 4KVGA 4BPRA 3UV7A 3EGCA 4OUKX 2DE0X 3HXMA 1XWIA 1E3MA 4BJ6A 2B82A 2PIAA 3AZPA 4P1ZA 1IOWA 3OICA 2R85A 4C88A 5CB4A 5EZQA 1HLGA 2OGWA 1IIRA 3SNKA 4ZZ1A 2ZJ4A 4J2HA 3PIIA 2I2CA 4QO8A 2QW0X 2W2OA 3MFQA 1G8JA 3CZQA 1FC0A 1KZ1A 2VATA 3K05A 3LOQA 1Z08A 2IFTA 2P67A 2C0CA 4N03A 1V1RB 1AUXA 4CLRB 4BNDB 2UV8A 1CETA 1JQLB 4CWAA 4DHEA 2PH3A 1GFIA 2X22A 1V7ZA 3NH6A 4K28A 3A6EA 1JKJA 3FJOA 3VYRB 1PNTA 1R66A 3EFEA 2P6OA 3IVXA 4NNPA 4N3CA 1XZFA 4XGKA 5HBGA 5A0FA 3AF4A 5B2FA 2JLYA 3TI9A 3WB1A 1U28C 5JVDA 3B52X 4EJSA 1X80B 2EZ9A 3OZIA 1Y98A 2Q7XA 2ETVA 4YP1A 2AFRA 1JA0A 1S3IA 2YVKA 5IVDA 2K2WA 3ANSA 1L7XA 3G8BA 1XRLA 3IO3A 2ZYDA 3SJUA 5HQTA 2ZSEA 3I0ZA 2HBQA 3KJEA 1QVVA 1RI3A 4KTVE 2GO1A 3HVKA 2DY1A 5C1IA 3U09A 3IEMA 1GVHA 1O5TA 2OQ2A 2PCJA 3KZXA 3FVRA 3R0QA 2W0SA 1NXQA 3IFSA 3LDAA 3ZNPA 3HHEA 2FF5A 4CM8A 3LUDA 5CXUA 3E4CA 3IKVA 3NIDB 2PD6A 5CBPB 2I76A 5GOZA 3TR5A 4Q3DA 1V1MA 3ETCA 3IPRA 1TM2A 2RHBA 5BR8B 3PC7A 1QZTA 4WA7A 1NJ1A 1KRXA 2F3RA 3ZZNA 1XPJA 2RK6A 2C2ZA 2ZR8A 2GPYA 2REBA 3EN0A 1DCMA 2MOKA 2AFIA 1K6XA 2C4KA 2CVQA 2YTZA 4KWHA 2R6ZA 2R751 3KOXA 4R1MA 4DMGA 5BMVF 1TQ6A 1NHWA 2HL6A 2TS1A 1N7HA 4ID9A 1NDQA 4IJ5A 4KB5A 1L5ZA 3S28A 4KQ6A 1J5PA 2Z2XA 1NYQA 3OFVA 4KTTE 3NUQA 2HTEA 1YZUA 2QNBA 3D4LA 3I73A 1QPGA 4NDAA 5T5QA 3R0XA 5LXTB 4WLOA 5K8LA 3AIMA 2IPOA 1XKTA 2I2XB 3MRSA 4XM0A 3EQ2A 1OE0A 1D6NA 2ZIWB 1JJ7A 2V45A 1ZD2P 2FN4A 2IUSA 2MHCA 3FUTA 3PFFA 4J3FA 1FNMA 3M7IA 1IDOA 1TJNA 5I7HA 4CM9D 4WCFC 4QNRA 4C0BA 3GFVA 2AE2A 4QL3A 1SUEA 2XYVA 3RQIA 4RW0A 3AIKA 1RQ2A 4JLDA 2YV1A 3I23A 4KGZA 4L9WA 5CH3A 4U9IS 4BAZA 5JHGB 5CW1A 1K7SN 4BJ5A 1X9GA 5KINB 3ICEA 4KI0A 1COWA 3OEEA 4ZT2A 3RS3A 2AHOA 3H9EO 2QXTA 4XW2A 4OQYA 5IS2A 3IEPA 1W2WB 2N1BA 1RRVA 1EA7A 2DTDA 2DLNA 4P7JA 4PLWA 5F1OA 4TLBA 4BQOA 4DPMA 3NAGA 1YCDA 3KYCB 4LI0A 3WA6A 2ZB4A 4KH1A 1TF7A 2JHGA 2R9VA 3IUYA 4WDRA 1GCUA 2GRAA 2HA4A 2D0IA 2WLSA 4V0RA 5J4YA 2VTBB 4DC1A 3IT3A 4V2UA 2E3JA 2NV6A 3STUA 2QN7A 4O4HB 4H77A 4CM5A 3OLCX 1M2FA 2D7CA 2BFCB 3UYLA 3BF7A 4GYYA 2X7JA 2ZWMA 4HAVA 4CLXA 4EA8A 1I3LA 1YFLA 2REXB 5TB5A 5TX7A 3KT0A 4G5QA 4OLAA 4X63A 2FPSA 3BWMA 3BJMA 4D3YA 2HHLA 2VN8A 5K7SA 2O2GA 1NVGA 2PZJA 4C3ZA 3ECSA 5F4ZA 4YFYA 4LG1A 2HQSA 1CJMA 3F1LA 4OYRA 1SGWA 2K6GA 1RWOA 3ROQA 3KO8A 4MCIA 1ZRMA 2EKDA 3LXXA 5LFAA 2OFXA 1H4VB 4BV2A 3E1KA 2H9YA 2F43B 1NVVQ 2AC2A 2B5VA 3DO5A 2C9BA 2YWXA 3OPQA 3PQ7A 4I19A 2QMZA 1KSJA 3GGJA 5DU2A 1E2IA 4DR3B 4RY2A 3TI7A 1RXSA 1AXRA 2G76A 2YH2A 1LZLA 2R86A 3FYDA 4BC0A 3HBJA 1SU4A 2A92A 3LL4A 4MR9A 4QDTA 1ZNQO 4RZSA 1QVWA 4Y2VA 3QH4A 1DB3A 4O25A 1F1BA 2IUYA 4X8HA 3NPAA 4RD3A 2WWTA 1B15A 2BMJA 4ES6A 3PLNA 4BMYA 5EAIA 4NCXA 4LF9B 2AZTA 2QYTA 4OY3A 1Z7BA 1YQQA 1RLJA 4EY6A 2B25A 1KJZA 4UU1A 3HZHA 3G2LA 1P1JA 1CK4A 4WTOA 3TNJA 3AI1A 4JS0A 3BHJA 5KC8A 3MD9A 3OOHA 1Y8QB 2WNIA 3GCGA 3Q2IA 2KX7A 1ORWA 4AY3A 2XMGA 1CRWG 4BRZA 4G5GA 1T5LA 2P1DA 2I8CA 3QWAA 5CNMA 1MB0A 3IQZA 1P2BA 3MMSA 4G0QA 1YQTA 4IJWA 2ZUBA 5ESRA 4BTVA 3T6KA 4ZVNA 2ACEA 4J91A 1UJNA 3DZJA 3GMDA 5CFMA 1IJBA 4MKGA 1DJOA 3JALA 2IGBA 5AK4A 2G4VA 4LOHA 3FXAA 4AG6A 1C7FA 1NBAA 2FPPB