2MYPA

An arsenate reductase in the phosphate binding state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
MKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Hybrid Mechanism for the Synechocystis Arsenate Reductase Revealed by Structural Snapshots during Arsenate Reduction.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Oxidoreductase
molecule keywords Glutaredoxin arsenate reductase
total genus 47
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mypA00
1KRWA 4F12A 2E4UA 2IPAB 4B09A 1NXPA 3N0RA 4XASA 3RQIA 3KLNA 4YV7A 2LBPA 3CU5A 3E3MA 2PE5A 3H6HA 2WJWA 2PUAA 2DRIA 1JL3A 2PAFA 1BAPA 1D1QA 3MM4A 2IPMA 4JB2A 1SRRA 4RS3A 5PNTA 3CRNA 4O1IA 3CG0A 4QICA 4Z4GA 3OLWA 1JYEA 3CNBA 4S05A 3EQZA 4G0PA 3N53A 4F3TA 2FKAA 1S8NA 1D5WA 1BA2A 4Z4CA 3OM0A 3QLVA 5JS1A 2ZAYA 4MS1B 1M5UA 2RJNA 3OO1A 5DTEA 6CHYA 2LP4Y 3LUGA 3DLBA 5GOTA 2HJ9A 5CNJA 4RY8A 5BRAA 1QQAA 4YLEA 3T6KA 4EY3A 4E7PA 2VUIB 3N0XA 4XARA 1DP4A 4RU1A 5HM6A 1ZGZA 2GI4A 3M9WA 4MLCA 3HO1A 2PUEA 1YMVA 2FQWA 5JS2A 1YK1A 2L19A 2MSLA 2QVCA 2YHAA 1JFSA 1W25A 2P4UA 1MAVA 1DBWA 3HDVA 2FLKA 5JNRA 2MYTA 1U8TA 4HNRA 4Z0NA 1K66A 1BDHA 3CLKA 3H75A 3HVRA 3N0WA 2XDYA 4RKRA 1R8JA 1DRKA 2QSJA 2P9HA 4NICA 5T7BA 1GUBA 1DJMA 1UDRA 1GLGA 1NXWA 1ISSA 1LBHA 5BQ3A 1P8AA 4KV7A 4RWEA 4MRMB 2LUOA 2FEWB 4LE2A 4XFKA 3EULA 2JVKA 3H5WA 2RDMA 1QO0A 4W5RA 4OG2A 3B2NA 2J48A 4F11A 3IDOA 5EWJB 4WUTA 2PUBA 2RJOA 5D2CA 1XHFA 3F6PA 4L85A 1D1PA 4RK4A 2ID7A 4ZJPA 1Z12A 3KLOA 3KG2A 3M6MD 4KQ9A 5DGCA 4YGXB 3H5IA 3I42A 1ZHHA 4KMRA 3HXMA 1FFSA 3FGZA 1XHEA 3RH0A 2I6FA 3EJWA 3FFWA 3HJFA 3FFXA 3MA0A 4EYOA 1USKA 3C3MA 1RPJA 3IP7A 2R25B 3H5LA 1D2AA 5CHYA 3QELA 4RXUA 3QLUA 1P6UA 2JBAB 2B4AA 1TLFA 2MYNA 4G0OA 5HSGA 3D02A 5F64A 4KZKA 1QMPA 2NZVG 1E2BA 1NTRA 4RDCA 1LBIA 1ZH4A 2GBPA 2H3HA 1P2FA 2FMIA 2L17A 3GBPA 1F4VA 3C3KA 3QLTA 2HQRA 1E6MA 4GPAA 3RVRA 5KQGA 1YS6A 4KRFA 4FE4A 5KI6A 1QP4A 3QK7A 4KREA 1Z2EA 3P9YA 2R4QA 4M88A 3OM1A 3CZ5A 4LZLA 1DG9A 1EFAA 4ZMSA 1M5TA 1MB3A 1SD5A 1ZH2A 1APBA 2ID9A 1ABFA 1JFVA 1E6LA 4Z4EA 3C3WA 4MAAA 1NXXA 4Z4IA 4MGEA 2QVGA 3FMVA 3T38A 4KK3A 3H6GA 1T34A 8ABPA 1Z26A 4N41A 2QXYA 5JNSA 4O1HA 4G97A 1EWVA 1D4ZA 2FN8A 4Q6WA 1FFWA 3A3KA 1OXBB 2MSWA 4QYWA 1JF8A 1PHRA 3O2SB 3KKEA 1EHCA 3SNKA 5FWYA 2FVYA 4W5QA 4IMIB 1DC7A 1M2EA 3KCNA 3M9XA 1CYEA 3DBIA 5TQ0B 3K9CA 4MQFA 3OQMA 4EVSA 3H5OA 4F8JA 1EWTA 3T95A 2PUGA 3VNBA 3K4HA 3GBVA 3O21A 4RK0A 4NV3A 4XAQA 3SY8A 4YR7A 4KVFA 3MQ4A 3QEKA 4D6YA 5JNUA 1H9CA 3QX9A 1VLZA 1GCAA 2A9QA 7ABPA 2AYXA 3I5AA 1YVUA 4MS4A 5ED4A 3RVQA 1XWWA 3JPYA 4JP1A 2PUCA 4OLAA 3UK0A 1JX6A 2CWDA 9ABPA 1L5YA 2WB4A 1P6QA 3OLXA 4H60A 4LDZA 4E7OA 4FB4A 4MR8A 1SXHA 4TMYA 5BRJA 2QV0A 3HDGA 3Q7RA 1ZN2A 4HYEA 1MVOA 1DRJA 4S04A 1TJYA 1ZAYA 4G86A 1Z16A 2FQYA 3FDFA 2PL9A 1KRXA 1DCFA 4Y9TA 3KTOA 3O75A 1ZITA 2FW0A 1USGA 1NY5A 1J56A 3C6QA 2IPLA 1YIOA 3KYIB 3A0RB 2E4YA 4IILA 3TB6A 4N0QA 2H0AA 4H3HB 5KC9A 4MR9B 5IUJC 2MSKA 3JPWA 2IDMA 4Z9AA 5DKFA 1U2QA 4MPTA 1Z17A 3MF4A 3IP9A 2FTKE 4XLTA 4MR7A 4EGSA 1TM2A 1Z18A 1ZDMA 4W5TA 2GX6A 1JDPA 2JVJA 3GV0A 3I45A 2FN9A 2L18A 3LUDA 4RK5A 5DLEA 5EWMA 4ETMA 1AB6A 3H1EA 3LMKA 3A0UA 5KQPA 2VUHB 3Q7TA 1Z2DA 3IPCA 1A2OA 3D8UA 4P98A 2E4ZA 1IIBA 4RK1A 1FSPA 4RK6A 2LIVA 4PZ0A 4MR9A 3H5VA 4XXHA 3KJXA 3CG4A 3QEMA 2GWRA 4WXEA 5HQJA 4OTZA 1JHZA 1ZGGA 2ZWMA 2TMYA 3RVJA 4YRZA 1QPZA 3BRSA 3HEBA 4MQEA 1A0OA 4RY0A 3GT7A 2HQOA 2WRZA 2CHFA 4PICA 2M98A 5TQJA 1AB5A 1PEYA 2V0NA 5IX8A 1SXIA 1Y1LA 3OQOA 1QP0A 1OXKB 3TD9A 3R0JA 3NHMA 1U2PA 4PYRA 3CTPA 1YK0A 4Z9BA 1URPA 1A04A 1LJLA 2IYNA 3EQ2A 4WZZA 3ROFA 2NT4A 1NXTA 1SXGA 1L5ZA 3IPAA 4JASB 2YHBA 3QELB 1C0EA 3DLHA 4IGAA 4D74A 3O1HB 4UHJA 3LKBA 5FBHA 3G85A 1BVHA 3EGCA 3BBLA 3FFTA 1KGSA 1VKRA 4LDAA 4KFCA 5IEJA 3LFTA 1RXEA 1TMYA 4TLLB 1CHNA 2A9RA 3O1IC 3OMWA 5TPZA 4JOQA 1BDJA 3NBMA 5EWLB 3RVNA 3JS5A 3UUGA 2OQRA 3TX6A 3GL9A 2W42A 3HUUA 2FXIA 3LUHA 2JK1A 5FWXA 5JNTA 4PEVA 4YS6A 3RVPA 4OBBA 3BRQA 3MMNA 4JB0A 4FE7A 1LK0A 1ISRA 2O20A 5I4CA 1QO0D 1NXOA 1DBQA 3DGFC 4P1ZA 1LJUA 4HNSA 1QKKA 1DC8A 2HQBA 2L2QA 2PLNA 2R48A 5CNIA 3ILYA 5E3JA 3CZCA 3KSMA 1EAYA 5FWYB 2MYPA 4IRXA 4Q6BA 4WXMA 2FLWA 5FWXB 1WETA 5GQSA 1ZY2A 5ABPA 3F73A 4O5AA 5FBKA 3CHYA 4Z4FA 3HM9A 1EWKA 4RXTA 2LPMA 1NXVA 5JNWA 2PUDA 3JY6A 4RV5A 4TN5A 5DCLA 2JBAA 6ABPA 4WWHA 4IMJB 4MR7B 5TQ0A 5TPWB 1RZRA 3OQNA 4MQFB 3OLVA 3BREA 4OLBA 1E6KA 3DGEC 3BILA 2BGGA 1YTUA 3KYJB 1ZESA 5TQ2A 4MQEB 3IP6A 4CBVA 1JH9A 3SAJA 5B3JC 2FEKA 3GWGA 3L6UA 3KS9A 1M2FA 3HK2A 1K68A 3Q41A 3JVIA 3EDCA 4QYMA 5TE9A 1F51E 4EYQA 1DBPA 3GA5A 1JFTA 3O2JA 4G0YA 3C97A 3DZDA 5T3YA 1Z13A 4JAVC 3H1GA 2N9UA 4Q7EA 3G1WA 4KQCA 4RXMA 5TQ2B 2IKSA 1I3CA 4MLDA 3RVSA 4G0ZA 3LUAA 1VRVA 4Z99A 2WMYA 5HKOA 4DN6A 2M1ZA 3LUJA 2JVIA 5TPZD 2QR3A 3F7NA 3LOPA 3UKJA 4EYGA 4EVQA 3OLZA 2FMKA 2F8SA 1JBEA 4DADA 2FEPA 4LRQA 4NQRA 3VNAA 2PJUA 4F06A 2Q5CA 4UHKA 4LX8A 4MS3B 2FMHA 2QU7A 3W9SA 1GCGA 4ETIA 2CD7A 2X7XA 4N76A 4KPYA 2IOYA 1USIA 3IP5A 1JDNA 4L4UA 2RGYA 4PE5B 5C5CA 4MS4B 1NXSA 3LUKA 4JA2A 2HSGA 3Q15C 3TMYA 3OO0A 4N0PA 4MS1A 1ABEA 2QW1A 1ZVVA 1GUDA 3OMXA 1YS7A 3L49A 2JCGA 4QPJC 1Z15A 5IC5A 2KYRA 3TO5A 3MYYA 2WWVD 3QEMB 4OATA 2PKXA 4ZMRA 3I09A 2WY2D 3T8YA 1QP7A 4LE1A 4MRMA 2HPHA 4N47A 2NZUG 4G0QA 3EAFA 1KMIY 2PL1A 3NHZA 4MR8B 3LUFA 3CS3A 3Q7SA 4H3KB 2NUBA 3QX8A 5EWJA 1NATA 3GYBA 3RVKA 2FQXA 3CFYA 3GRCA 3ROTA 3O2QB 2VYCA 4Z4HA 2QZJA 4KNYA 2WJAA 3OLYA 1PNTA 3N8IA 5B3JA 2FSPA 4ZPJA 4DQDA 2OENG 3Q9SA 1YMUA 3QLUC 2NT3A 3E61A 1RXIA 4RK7A 1JWLA 5CNMA 2E4WA 3LUCA 4EUKA 3HV2A 3NNDA 2A9OA 3F6CA 5KQLA 4TLMB 5EWLA 3NNSA 5CNKA 3CKMA 1DCKA 1QQBA 3HUTA 3RVMA 3RVLA 3O1JC 5C5EA 2IPNA 3H5TA 3O74A 3SG0A 1RNLA 4RY9A 1MB0A 4EVRA 5IUNC 4YCSA 5JNVA 1JLKA 1RZRD 5EWMB 4NCAA 1CEYA 4KK4A 1W9HA 3EODA 4N03A 4YWHA 4G0XA 2FMFA 2JRLA 1QNLA 5KWSA 1FQWA 2B1JA 4RZSA 1DZ3A 4RKQA 2E4VA 2MYUA 5IUKC 4ZYLA 2VK2A 4LE0A 4ML3A 4MS3A 1FFGA 3HS3A 4RSMA 3N75A 3JVDA 5KQMA 3HZHA 3HCWA 3KHTA 2F8TA 2R47A 5BR1A 2PUFA 3NNNA 1U04A 1Z25A 4IF4A 4WT7A 5IEBA 1HEYA 3ILHA 4NCBA 1DCMA 4YP9A 3LKVA 2JB9A 5IBQA 4W5OA 4D6XA 3MIZA 3S99A 3LTEA 5KC8A 4MYRA 5TPWA 1TVMA 1VPWA 3H1FA 1JYFA 1PNRA 1MIHA 1C4WA 3SM9A 1BDIA 3HSYA 3N6VA 3QLVC 4HNQA 5IULC 3A10A 1U0SY 4ETNA 4GNRA 2GKGA 3SQNA 3URMA 3JTEA 1PEAA 2AYZA 2A9PA 4G0MA 1B00A 2PMCA 4YO7A 2E4XA 1PUXA 4EYKA 2CHEA 4W5NA 3RVOA
chains in the Genus database with same CATH superfamily
2P6NA 3C3EA 2C9ZA 2C97A 1M34E 3DCNA 1FE8A 5CLGA 3VAAA 4LYGA 1BU5A 2ZSIA 3AERA 4CGZA 2CHGA 1WPRA 1NKVA 3PUWA 3LO8A 2PUAA 1TE2A 3V8MA 2D0DA 4QE3A 4D9FA 2F59A 1PL7A 4XQEA 4QC2A 1Y8RB 1C3VA 1QH8A 3WFIA 4J43A 4BUJA 1MENA 1HDZA 4DB2A 1NW4A 2XZTA 2XMPA 1SRRA 1TI7A 3U7GA 1C7JA 1VSTA 5DXFA 1R1DA 1QYVA 2IXAA 5F7JA 4YMTA 5A0FA 1OBVA 5C8YF 3GFRA 2H06A 3WIUA 4N18A 3JRWA 5CFMA 4MW2A 3ZU5A 4E03A 5GZ3A 3NTQA 1V8DA 4AMZA 3P9SA 4CLRA 1BA2A 4L50A 2FPPA 3PR2B 4X61A 3BTUA 3W0LB 4D1YA 4E51A 1M1ZA 3MTJA 5DX8A 4P3YA 5EJFA 1OREA 4ACBA 4CYMA 3I0NA 3TJMA 5LYJB 1XXHB 1C30A 2WT8A 3LUGA 1XQ1A 3OIUA 1ZMTA 4PCAA 2Q99A 3OZBA 4PHCA 4YLEA 4ZT3A 4CTMA 3ABSB 4ER0A 3N0XA 3LPDA 4ZVMA 2W48A 1TYEB 4LA4A 1ISFA 1PJBA 1PTJA 3GQBB 3HN6A 4C30A 1NW5A 1I32A 3RI3A 1YMVA 2FQWA 1YR7A 4DQLA 2Y1XA 1A7JA 1Q77A 1CKEA 1HEIA 4W5JA 1G1MA 1MAVA 1QMGA 3GP5A 4BMYA 2YTZA 3EIQA 2VQ6A 1ZZEA 4LC0A 1CVIA 2YXPX 2HK7A 1L7QA 2PH3A 4L6AA 4YAOA 3I34X 4JWKA 3W6UA 4MW7A 5CEFA 3LYAA 2NU6B 2X4IA 1X70A 2R62A 3AF2A 5G3YA 1R0KA 2J3QA 1OB5A 1KEPA 2WTAA 1ODJA 1RVV1 5AOBA 2AKAB 5JQGB 2I87A 4LOJA 4D0GA 5G1OA 3CWQA 5B58C 2QRKA 1PF7E 3HADA 3DL0A 3ZDYB 3E3AA 1LTKA 2LUOA 2C0CA 3V9AA 2G06A 2EX4A 4Y6PA 2O0MA 4F60A 4TSFA 1TVKB 2CL0X 3MWJA 2IYQA 3LT5A 3I30X 4UBNA 4DGQA 4FB5A 3STUA 5FPTA 5AESA 3IO3A 1ADCA 4WUTA 2D1TA 5F5LA 3TB4A 4BPRA 4FYPA 3DM5A 1PNOA 4V0ME 5COBA 5DEIA 4D26A 3KOUA 4KXQA 4DUZB 4DJJA 1QHEA 4E5SA 2I03A 2RKWA 1VJGA 3QXJA 5JG7A 5BN4B 4EHAA 4HAWA 2I6FA 2OFPA 3MMPA 4MRNA 1R9JA 3FFWA 2HK8A 2AD1A 3N7TA 3TYXA 1TNDA 4AZ3B 4IDHA 2PLAA 1BMDA 5FR1A 5L4NA 3OICA 3J81k 1ZIXA 3BK7A 2NACA 1FEZA 1USWA 4GYYA 1DIOB 4FSHA 1ENOA 2GEFA 1E6CA 4HQKA 4XIIA 5JVDF 2P1ZA 1QLHA 2ZYTX 3L77A 2IYWA 5IKPA 2X42A 3LA8A 4LSMA 4UNRA 4QTZA 1JDJA 1XMJA 2C2KA 4ZHSA 2YL2A 3AQ4A 1I10A 3TUZC 3DNFA 4IXTA 4NNPA 4B8WA 4CMCA 3M6VA 4O6VA 1PJAA 2FMIA 3PNYA 2EG5A 4C06A 3AF0A 3DTVD 4O2AF 3T1TA 4KRFA 3PNBA 5KTRA 3MFQA 3TTSA 5AW6A 5JBQA 3K2EA 3P5BA 4PXAA 2ZI6A 4MAFA 5EUCA 3ADCA 5J5AA 1G60A 1XRRA 4M36A 4NYMQ 4PS0A 2WF8A 5BN5A 1AV6A 4PSCA 1E2IA 2J5KA 2NYRA 1R6DA 3IEVA 4D9NA 1TB4A 5D3MB 3V8BA 4J1TA 2AN1A 1Z2OX 1E6LA 4GAEA 4BUCA 4Z4EA 1TDJA 4AUKA 1YA6A 1SG9A 1SB9A 2RC6A 4MYHA 5DW0A 4K9LA 5EIBD 4PZYA 4TOIA 4V3CA 2ODBA 3H6GA 2QTCA 3FKJA 2CVPA 1NUAA 2WTNA 4KAXA 4DY6A 1NASA 2SCUB 1VJTA 3D2BA 1XTTA 2VKQA 1TLTA 3GMIA 1HI9A 2H2GA 1FRFS 2ZUTA 2XE7A 2DJIA 3DULA 3L18A 1PFKA 4EAQA 5FWYA 4IMIB 3H16A 2KM1A 1GUYA 2HYDA 1JEAA 4OHVA 2W11A 3HB1A 4PZPA 4F8YA 3ORHA 4F8JA 3BAFA 3BMNA 3JATA 3R3SA 5FOXA 4EKEA 4ALMA 1E92A 2FWJA 3PYLA 1MBZA 1N5MA 2LKDA 2ZI5A 4CNQA 1WMSA 4DKJA 1H9CA 3FYUA 1BOFA 3H04A 1EVKA 4D0NA 5SZIA 4XB2A 5HFJA 2IE0A 2NTNA 1NUQA 4I0WB 4BB5A 3PRJA 3WP1B 3BH6A 3LIPA 2QVXX 4JLBA 3UZUA 4UUPA 3K8YA 1P6QA 3LDHA 4LYJA 4UFPA 4MW9A 2AF3C 4NAUA 4X6LA 2PRZA 4KXXA 2V8BA 1XAGA 4TMYA 4C3VA 2JFXA 3H1TA 1KEEA 4R9UC 5KSZA 3ZQJA 3N59A 2ZDHA 4GH5A 4GKVA 4RF4A 4V0QA 5LQCA 5DH9A 3IQXA 4NH4A 5CFNA 1NG9A 5CH3A 1A69A 1TCCA 1A9XB 3PZRA 2Y66A 3LX6A 1A82A 4M0KA 1HRKA 2YJGA 1MFPA 2AQKA 1K6JA 1G5TA 2H4HA 2X5OA 4UFOA 1I2BA 1J56A 3DVRX 1U1GA 4LYDA 4MIEA 5KREA 2JLUA 1R50A 2WWWA 2XIQA 3RPEA 4YDHB 1MB2A 2H0AA 1BGWA 3FUVA 5ALFA 1QYRA 3GNTA 1Y1PA 2PIDA 1U3FA 5G0UA 3UH1A 7GPBA 2D7JA 1E94E 2OILA 1F5SA 2J9ZB 1XF9A 2Q2VA 2YASA 4KI0A 2QTBA 2YRFA 3BQ9A 4KO1S 5CDHA 1Y9ZA 4NESA 3U16A 1GYPA 2WP0A 1JAZA 2P6UA 2IBTA 4OQZA 5DLEA 3NTXA 4EMTA 3OE4A 4R8SA 3HY4A 3JD1A 4M1SA 4ZCPA 3ZCSA 4KWHA 5KQPA 3Q7TA 1E58A 3K30A 2A4MA 2AJLI 3C1TA 3BJZA 2XRFA 2H59A 3JZIA 3R09A 8LDHA 1SKBA 4H7FA 4EAAA 1NVVR 1XLWA 2BYTA 2YY5A 5H70A 3ONDA 3N8DA 3WBJA 1X92A 2H92A 4NMXB 4EY5A 2B4RO 3QEMA 2HCRA 3DJYA 3UGQA 4MV7A 2FNAA 2XNCA 3KUKA 5C34B 3UQYS 3A3YA 3CH5A 3SSNA 1Q15A 3ZJ5A 3MAAC 3C98A 1KWKA 4DMUB 4EUEA 5TQJA 3GRKA 4NCIA 5IX8A 2V6BA 1KDOA 2H7XA 1FDWA 2VDPB 3CLTC 3HCEA 4MI3A 5ECYA 4P3PA 4PYRA 5AVVA 4CDGA 2JAOA 4J3FA 3REOA 4BIIA 4KQKA 4BUZA 4ZI3A 4X7MA 1NUUA 4UDYX 5L6MB 5JTTA 2Q3CA 3SDZA 4V1CB 4NYMR 5IKMA 1V41E 2OUIA 3NAGA 4BYMA 3EGDB 1ICIA 4BLVA 4V0OA 1BH6A 3S2GA 1IBKB 4JCOA 4HSGA 1PBNA 5AIAA 3T4PA 1IONA 1ZXXA 1Q7TA 3DLTA 3KB2A 4EW6A 2H08A 5DSTA 1L0BA 4UHJA 3QJ5A 5EXPA 1IJBA 5KTOA 5EE1A 1BVHA 3HB9A 4Y7CA 1QGED 5IEJA 5FAXA 3LCUA 4HADA 1KO8A 1ZUIA 5HG0A 2XADA 4EJMA 1X7GA 2X9GA 1TEXA 3H4VA 1BDJA 3VTFA 1JR2A 1PV4A 2GAJA 5CG2A 2IY9A 3BSSA 2YJ3A 1T9DA 4JDPA 3BWVA 2OP1A 1AKNA 1I33A 2WTEA 1K63A 3UV7A 1O5IA 3VKVA 3HUUA 4UM7A 1OIXA 3CQ9A 3GNLA 4Y2HA 2NUTA 4O2BF 3W2IA 3NVKI 3RANA 3E9YA 2VI5A 4B7AA 2H2AA 1FIUA 5ALTA 3I9FA 3FSGD 1L5QA 3H2HA 3D2CA 5AJYA 3RU3A 1NXOA 5F12A 3IURA 4JVOA 1C7RA 1CU1A 4BNYA 4CKEB 2BFDA 2REQB 3RK0A 1LJUA 3L05A 1RHJA 1Q11A 2HDHA 2MSDB 3FNRA 4C5BA 5HUHA 3ZHCA 4YHBA 3RUDA 2C2ZA 1EBFA 2YVQA 3BK1A 3K0AB 5AM4A 4JI1B 4F9FA 3GLIB 2BTEA 3NUGA 1F8FA 3ZDFA 1ULUA 5EMMA 3KR0A 1EH5A 4UEJA 4U00A 1A9QA 3FOAA 4I99A 5DE3A 1E4VA 3W5DA 4O5AA 1VBNA 1SZCA 3D64A 1YIAA 4AJNA 4C07A 1NVGA 1QGZA 1UAYA 3CH4B 2IS1A 2ZYVX 1OZFA 3HPRA 1E3WA 3LCJA 5H7XA 4TS4A 3ZWCA 2XVXA 1PZHA 4JJ4A 1XU9A 3WRXA 3A1TA 3HI4A 3F5MA 1SU8A 4HVAA 5FBZA 1V1RB 3LLMA 5LUAA 3ZD9A 1IXKA 2ABWA 1F8GA 3DGEC 2JAPA 3LSYA 2BGGA 3KYJB 1RFLA 2DY1A 2HDOA 3GZTB 2A5FA 2B4KA 3LG2A 3OCCA 5HOEA 3TW4A 1Q50A 4Q7KA 1XN1A 5J47A 3M5DA 3FZYA 4LDNA 2I8CA 1OAOA 3H5RA 4P3OA 3TSZA 4GP7A 4NC9A 5L3VA 5KTTA 1NYLA 3WLQA 5CA0B 5K3BA 2YXNA 1GZHB 4MZXA 1E62A 2QUKA 2ZJ5A 3OOSA 2WI8A 4H1UA 3ZCPA 3HEMA 5JI2E 3MJEA 1UMCB 2WHYA 1MQAA 3TK1A 2ZAGA 4D3FA 1FLDA 2IKSA 2JCYA 4A82A 1UPBA 5KYTA 4DR1B 3BMQB 1I9CA 1TX4B 2EG9A 4GQAA 5CX4A 2ADFA 4YCDA 1Q0PA 2AG5A 3USCS 3G6KA 3STHA 1VHLA 5FNZA 3S2UA 4TUYA 2ZRIA 1N2GA 2ON6A 3CYFA 2EW2A 3ETCA 3NALA 1KYWA 1KSHA 1M1YA 2G1AA 3KKMA 1TYBE 2YVUA 1GFIA 2QD1A 2ZSEA 3EE6A 5D3ZA 5AXBA 4EB0A 4YLGA 1SFRA 2IPOA 2OOSA 3VJLA 1NVVQ 2G1UA 3I58A 1EU1A 3M2TA 3DV9A 3MAGA 5EG5A 1XOIA 2ZJ0A 3CUWA 4P4GA 4L75A 4B3JA 5BSKA 5DBIA 2I2AA 4CCAA 5BMVB 1W48A 3U17A 2HSGA 5JH7B 1EGVB 4JJFA 1FNCA 1U2ZA 3AR6A 3ENVA 1WMFA 3JASB 1MXFA 1W73A 1G8FA 2JCGA 2JLSA 1HDCA 3ESAA 1YCFA 3FTQA 1AF4A 3GDHA 3D6NB 3ZDZB 1O0BA 3LDUA 1IYZA 3WYCA 8ATCA 5G0WA 2AZDA 3R3HA 5GMOA 3FDXA 2CE7A 2IYUA 4ZMRA 2CDAA 5EJ5A 4NU5A 2IH5A 1NT2A 3V42A 4JI3B 5HJ5A 3B3JA 1AQ6A 1QZUA 4RKFA 1WZCA 3PUVA 1GNPA 4IHJB 3RS8A 2CZGA 3DOOA 3GLIE 3C4JA 1BD3A 5SZKB 5HJ7A 4YMIA 5F73A 3RFXA 1NVMB 2JC3A 3R7WB 5ENDA 3Q7SA 2W0SA 1PRYA 5CB4A 3A1WA 4ZEOA 5JWHA 2ALJA 4TRJA 1B76A 2FQXA 2W4IA 2BFCA 3W6ZA 2HPZA 1H1LA 2HLHA 1G55A 2WJAA 4MWZA 4NU6A 4EZEA 3CNLA 2C3PA 2NT3A 3I6QA 3B82A 3UMGA 4RK7A 2C4MA 1GQQA 2PH1A 3ENWA 2C04A 1T9BA 2NUAA 2MWMA 2PH5A 1ULBA 5DGIA 1ODIA 3ZZMA 5KQRA 3MS2A 5AI0A 1JLMA 1NPYA 4TVKA 1V5WA 5KQLA 1TO1E 2FX5A 2OGSA 3BB1A 1FNBA 3CIFA 3EQ6A 3FGOA 4WBXC 4Y6LA 5MN4A 3D0QA 1J7KA 4PGFA 3RVMA 1CVLA 2BHRA 1EUDA 2O1WA 2EQBA 3C8MA 1WQ3A 3KCQA 4N8SA 5TEWA 3TAHA 2GXAA 4GBJA 1KJ8A 3QU2A 1H2WA 1YF3A 3G9TA 1MB0A 4IKOA 5F4ZA 5IUNC 1V2GA 4RYLA 3HWWA 3RDPA 4TV9A 5K8UA 3WFJA 5BSTA 4UTNA 3RKRA 1NMXA 1BSVA 4CDNA 1N9GA 3ET5A 5GZ1A 1P2UA 2BZSA 3BFKA 4M3NA 4P4SA 2D3TA 3V6MA 1DZ3A 5HKLA 2VBCA 1GQFA 2YFHA 3FXAA 4RIHA 1RZUA 2C8JA 1K4KA 1HLDA 3PI7A 4XQCA 4Y18A 1OFTA 1W59A 1SIWA 2QP3A 5ALIA 4KWIA 5BN5B 2ILTA 2PMEA 4CKCA 4YT4A 3C4VA 3GT0A 1QIHA 2W4MA 1KDRA 4CLHA 4B81A 1GUAA 2HSZA 2PGNA 4EFDA 4C3ZA 3CUYA 2JB9A 3RU2A 4M8KA 1D6MA 1X1AA 2PSFA 1MORA 1T2NA 3MIZA 3R74A 4EBFA 1U7OA 4MYRA 2UUAB 1EFVB 2OORA 2VIIA 3AU8A 4GZ3A 2IU0A 5JFTA 1QU2A 3N6VA 5BSFA 1KYIA 4A8JC 1QTIA 5EQDA 1T25A 1ZK2A 3E5RA 3MGBA 3WDLA 5B7PA 1AC5A 1B8PA 2DWUA 3CINA 4QQFA 4D41A 3HKDB 4XWWA 4FOTA 1QVWA 4YMHA 3UMBA 3UPDA 4TKLA 2CJPA 3ESYA 1ZUNB 3T9CA 2KMLA 3TPCA 4AECA 5GVRA 1FFAA 4MHTA 1OLSB 1RKUA 3GJ4A 4TPKA 1MP0A 4CG0A 1U4NA 1JJVA 1ZH6A 1XXHE 1DINA 1R4MB 2CXTA 3F3MA 4JENA 4JX8A 4M6WB 3QUTA 2HA6A 2LV8A 2G70A 2E87A 5EJAA 2XD4A 1L7EA 3HDYA 4H3VA 5JJBA 3QHPA 4H16A 1GZVA 3B2EA 5KNLA 3TTYA 1VCMA 3EVNA 3HGQA 1NFQA 2NXJA 3LQ1A 4HWOA 3CW2A 4TTQA 2LNDA 5PNTA 4H17A 1QH1A 1Z8HA 2ZR7A 3PC7A 4O1IA 2PX2A 4PPQA 5D84A 2YIVX 3EXHA 5FWDA 3ROXA 4R4JA 3A6EA 4PZAA 3SSAA 2AR9A 2X1VA 2FKAA 4YV2A 5B2EA 1UF9A 1W5AA 3AP2A 1RTTA 4ER3A 1FMLA 3L82B 4NOJA 4PXSA 2C7BA 3E7WA 2ZJ6A 3EZ6A 3O0DA 5I8WA 5KSWB 4P9NA 3NOQA 1C9EA 2I4NA 1EP3B 1PSZA 3E53A 1O7JA 1CSEE 3IMKA 1YZQA 5KCMA 4ZO8A 3U9SA 1KJZA 1D0VA 1XD2B 2ZS7A 3LLUA 1CE8B 4PX3A 5DTEA 3V1KA 4PR3A 2PBRA 3HJGA 4FEGA 5J5CA 2AXQA 1L8AA 1TUGA 2VRCA 3NH6A 4JUBA 1W0KA 3FWZA 5B1DA 4MKZA 3WLTA 1ZJ4A 3KBBA 2P30A 2V7GA 3I72A 4V03A 1DAOA 4QDJA 2QN3A 2PUEA 3E1GA 5DMXA 1T8PA 2L19A 4L0CA 4QWMA 3DKKA 3OFNA 3TJZA 2D5LA 4LF4B 4BO5A 4X3OA 4GPZA 2SKDA 4R41A 4DR6B 4HNRA 4C0HA 2REBA 1SBYA 2EFCB 2VF8A 4WZBA 2I3BA 3N0VA 3OCYA 5IVIA 1BQ4A 3N0WA 2VUTA 3RASA 5JTUA 4EFNA 5B4UA 1FB5A 1J24A 2QL6A 1NZFA 2CXXA 1DJMA 2NLOA 2QTVA 4L4ZA 5JV5A 1ISSA 1EDEA 2NV2B 3R6DA 4Q19A 2ZQ5A 1CS4C 1NDUA 1ONNA 1NW3A 4LE2A 4R69A 3H5WA 4YRAA 3NV9A 3T3HA 2Q46A 1E2GA 1PZEA 2PZJA 3S2EA 1HH4A 3OA0A 4G5HA 4YFYA 3TQSA 1KQGA 5ALVA 5BORA 1W2WB 3D6VA 3GLRA 1FPQA 4NEQA 1C29B 1F2TB 4TZTA 4L85A 1UXJA 2GZDA 4RF3A 1WEKA 4KQ9A 4A6DA 3S44A 4IX9A 4U2FA 3FOCA 3ROQA 4KMRA 4LQLA 1L4GA 3L7CA 1BXZA 1H8EA 1XJWA 2WC1A 2UYOA 1LUAA 3DAOA 3RH0A 1HOTA 2GCOB 2C2GA 2FZ4A 1G7RA 3EY9A 3A14A 3HJFA 2P7IA 1THGA 1XK6A 3TFWA 3KK0A 3SC2A 3Q6NA 2R6GA 4B7UA 2QW8A 4F2DA 3UKDA 1TZCA 3WGMA 3J80A 1YRQA 2G5CA 4MOWA 1N0UA 3ZBUA 2JAWA 2P62A 2PKEA 4HGPA 3FM9A 1SUSA 3WO1A 2IHJA 2PCLA 1IH8A 3NTLA 3QVSA 3GCXA 4L28A 3KJIA 4ZVSA 2FPGA 3H4TA 1JB9A 3TAXA 4EEXA 1TO6A 3MCZA 2YIJA 3SBDA 5HSGA 4BKQA 3G2PA 4OI0A 2AFIB 1C3LA 1KNXA 3HZZA 1P0MA 3F78A 3O4HA 4JJAA 2WT4A 4NU8X 1N6KA 2GBPA 1B74A 2J0UA 4B76A 1F4VA 2WVAA 4BNNA 5I6DA 1ZRSA 2X4DA 3NFYA 5TT1A 2ASVA 3ISJA 2I1WA 1KKLA 5A3QA 3ZWYA 2CUZA 4MA4A 4BPBA 3ETDA 4JC4A 3LU1A 1NWCA 2R4QA 1RAFA 3L7BA 5K8VA 1RQRA 1E8NA 3P9KA 3QV2A 1ZI8A 1PDVA 2CNLA 2JNWA 3R6LA 3E2IA 2O8FB 1SEPA 3KZNA 4QPPA 5AKXA 1MQ8B 1I30A 2NO5A 4HLCA 5H3HA 5LQJA 4NS1A 5MGBA 1L1EA 1O57A 4EG0A 1LI5A 2XE6A 1MOPA 4JWTA 5BO5A 1JJ7A 1L4KA 2LXNA 4XM1A 2HA5A 3GJYA 3PHCA 1GZ3A 4FDVA 5EMLA 1BGXT 1U5BA 4F84A 4M1KA 3C39A 2XNSA 1D2MA 4GXTA 3F7MA 1H2FA 3HDJA 2PMWB 2JI6A 4KQMA 3O2SB 1C8KA 2VTBA 2ZZNA 1E2KA 3FFAA 4AJ1A 5CBPA 1JHMA 1GNQA 2DHQA 3G1TA 1N33B 1JG3A 1GPAA 1MC1A 3AVWA 5JAQA 1XZMA 2WU1A 2JGRA 4P84A 4UBOA 3LF2A 2XTJA 3G2KA 1MNAA 2EQ5A 3HB4X 2R66A 1AKEA 4KDFA 4PQEA 4DAEA 1LPPA 2WU8A 3B51X 1AUVA 3QUQA 4DMHA 1VHDA 2R87A 3EWNA 3MILA 3SMQA 3C74A 4LW8A 2OO3A 1H5UA 5GINE 3B6MA 2GQ0A 3CUKA 1CYDA 1U3CA 2W37A 1BX3A 1FVOA 3D54D 2ZS9A 2QM3A 2C5HA 3LPMA 1VL6A 3AJAA 1SXHA 3WB0A 4FFLA 5L53A 1AMNA 2OTCA 4DB4A 2LZ0A 3VR5D 1JDTA 1TQHA 3FUCA 4N8DA 3SSOA 1IB6A 1OPXA 1WHTA 1Z16A 2VXCA 1QZXA 1DCFA 4UUMA 2WWTA 4ZDIA 1EX1A 2PJRA 3UB3A 4DEYA 1USGA 3BMQA 2G9RA 4GICA 1E5TA 4WVLA 3ICQB 1G6KA 1XCGB 2UZIR 4G5GA 1V71A 1Q92A 4WBSA 3BZUA 3WGYA 1NR7A 1O9HA 1DUSA 3CURA 5DRYA 3TB6A 5THQA 4AM8A 1VE7A 5LQAA 3PHLA 1GNLA 1K0UA 4HUQA 1QVRA 3VYUB 2OG1A 5LBTA 3MBOA 4HVTA 1SVSA 1A5SB 1UH5A 3JD3A 2PGLA 2WR8A 2H31A 3CX8A 1PTKA 3ECSA 4FJ2A 3L2OB 4OIMA 4QOGA 3K1AB 4C29A 1I2CA 5DWVA 3MCTA 1H22A 5EWMA 3BBPA 2B8JA 1NOIA 2G07A 2QPAA 3ANSA 2O2ZA 3AFIA 5AI4A 4RGQA 4BX2A 4CN8A 8MHTA 3IUMA 3VTZA 3H84A 3VSBA 2VAVA 3EW9A 3NHAA 1N5IA 4JK3A 1SQ6A 2PXXA 3D0RA 4H6PA 4TM8A 1ONSA 1V43A 4WOJA 2ZIGA 2VP5A 3NDJA 1TKCA 1G20A 2IZ1A 1QC5A 1PVVA 1Y7HA 2DPGA 1QH8B 2J9FA 1JHZA 1QCYA 4AQDA 1BE0A 2MIIA 3TFQA 2GKOA 5C32A 2Q6OA 4WY8A 4OCZA 3HEBA 4KTTE 4HV4A 1SWWA 3RARA 1X8XA 3JWJA 4KGZA 2WRZA 1Z38A 4L4YA 2M98A 1U4SA 3IJ5A 1JIXA 4OK3A 1QU3A 3K3PA 2A9JA 1NI4B 5F78A 3NEPX 2HQ1A 4G1FA 4NMHA 2PX6A 1KO1A 1VLLA 4LV6A 3K35A 3QG5A 1ZVMA 4PBSA 1H9AA 3HN7A 4XM2A 4LBVA 4URHA 1GRNA 3DL4A 1MJNA 2HREA 3CVOA 2I2FA 1IIRA 1A04A 1C3OB 1G5RA 1NM5C 2H8GA 2R6DA 3KL2A 3OZXA 1EE1A 5AQEA 2EFHB 3SFTA 3EH2A 1Q84A 2GDJA 5HWSA 2Z1MA 3FLEA 1RADA 4ZI7B 3DTTA 1NAIA 5I01A 2SKCA 5JQGF 2X4GA 4TS1A 5THKA 1ZH8A 1TMYA 4XCXA 3O1IC 2PKQO 4HRXA 2D5AA 3PQFA 1NPTO 1LRLA 4OJQA 5D3QA 4ZT7A 3DL7A 4IIYA 3UUEA 2O8DA 1AKRA 3D6TB 1R00A 3P5SA 3U62A 3ZBPA 1E4OA 3KJQA 4MX8A 5I9TA 2QPTA 2QLFA 3DE3X 3H8VA 4KSCA 4U3JB 1DQNA 4QJIA 3FB4A 1VA4A 4QKQA 3S7TA 5I51A 4OBBA 1VIVA 2ZJ3A 3JWHA 5DHUA 3UAWA 3ASVA 3ZVNA 1EFLA 2O20A 5AUQA 4JYPA 5DW3A 3IAM6 2AK2A 3PXXA 3X1DA 4PZUA 3D3WB 4MW6A 5IM4F 5L6LB 5H4GA 2WSBA 2ORYA 2NPIA 3WK7A 2P78A 1HEUA 2VPTA 3PUZA 4HNSA 2VXBA 2WYVA 3GJRA 5CT6A 3SP1A 2JJ1A 3WO0A 2PLNA 1JR3E 4QHTA 1ODTC 1LBEA 1HORA 4OX9B 3ILYA 2FZ5A 1AGRA 1ZICA 4CTJA 4O3MA 3HYRA 2XUJA 3ZIAA 2RKOA 3K9WA 3UV6A 3AETB 2C2BA 1DEXA 2BE7A 3M1AA 2G1PA 1MPXA 3AEQA 5AJTA 3V46A 2WTMA 4BNWA 4G2TA 2D0PB 2X8JB 3KU1A 3MK31 4UM9D 3WYGA 1UJ6A 4U7GA 1HYHA 5LUBA 2XA9A 1CULC 3JYOA 1M6WA 2F9MA 2PUDA 4YB8A 3QV1A 4FBGA 1PJQA 4KBGA 5JRZA 3FYTA 2BR4A 4A10A 3BE6A 4CFZA 4LAFA 4PS1A 3SDBA 2XE8A 1FZQA 2H0QA 5DI3A 4BO4A 1M6HA 3VZRA 5AD1A 4BNDA 3DXFA 3H9JA 5GP1A 2QMEA 3BILA 3U4MA 2ZYUX 1KEWA 3DPUA 4P35A 4EKDA 1NYTA 4MVJP 2VP3A 3V1MA 3UT0A 1O97C 5JS6A 2YZKA 4L5JA 4X0EA 3QYPA 3D6MA 1KDZA 3Q41A 4Q39A 1HX7A 2P4SA 2F48A 4FDUA 4YRJA 4ZODA 2JL1A 4CKYA 2JI7A 2NVWA 3M1LA 3KAPA 1VJ5A 2IV7A 2QJFA 3GYGA 4QU9A 4E6PA 2Z4SA 4FOSA 1OLOA 3GUZA 4D9IA 4C08A 1IY2A 3IVGA 4Y1EA 1QIDA 4DSOA 3VKHA 1DAKA 3NHFA 3UGJA 3WL3A 2D62A 4O2RA 5KDOA 4RCVA 3LAWA 4K1XA 4MTLA 3ZW7A 1FRQA 1Z6YA 3QFSA 2GZAA 2CCGA 3SZRA 2XXAB 4AUNA 1FQOA 2J33A 2SCUA 2UVQA 3L7NA 5GM2A 3UCXA 5JMOA 4Z4QA 1NVEA 4G1EB 3N05A 4ODIA 3WV4A 2V6IA 4QXPA 1GCGA 2BEVA 2W71A 3ZCTA 2X7XA 3PWTA 1WQ1R 1Z6ZA 1MO3A 1BHO1 2VDOB 3DAFA 4CT4B 2G80A 2OESA 1C41A 3PF8A 2JFYA 5CJPA 3E1KA 4WVFA 3MMSA 5B5SA 3GLGE 1UBRS 4WA7A 4LF9B 1R15A 3HY3A 1NIPA 4J2TA 5F23A 5F9MA 2XTMA 2G72A 1PKXA 5IC5A 1IDOA 4MV8A 1P18A 1P2TA 2B92A 4FIDA 3TO5A 4AMBA 4YJ2F 5DM60 5CAEA 2XNDD 4LKRA 4PV7A 1H1DA 2ZE6A 1LPBB 1VCOA 2A14A 3C1AA 3NBZC 4PCVA 5JJ5A 4RTJA 5J2UF 3TVDA 2VTDA 2QY6A 2OBNA 3DVAA 1PSWA 3HNOA 1OC4A 3P2EA 3SJCA 2VYVD 2XBMA 5ECDA 3DL2A 2ONKA 4AJPA 2OM6A 2XF2A 3B38A 4BFVA 1HDIA 4WLUA 2ZGVA 3HBNA 4RD0A 4EA9A 3FZNA 4EEZA 1OB2A 1DBVO 5EUMA 4TWAA 1WUKS 3TEFA 3RVKA 5TNXA 3CFYA 3O2QB 5E3HA 5KTNA 3H1BA 4MGZR 4JI7B 5FO0A 3N2GA 3PCRB 1CQIA 1TADA 2JLQA 1UDXA 3VSCA 2XMQA 1AQYA 4KUEA 2Y8EA 4ITRC 2FHPA 2ZPUA 3UXYA 4ERNA 1SUWA 2FEXA 3CVJA 2V58A 1SHLA 4FIZA 1MO2A 4ARZB 5I9IA 2YVAA 3GAAA 4MQBA 3JQAA 4QFCA 3MT7A 5F1PA 3HGMA 1YCGA 3BCSA 5L3QB 1DGQA 3SBOA 3C5HA 1A9YA 4PG4A 3KNZA 2IOFA 3K32A 4ABYA 2Q49A 4EMUA 3KSAC 3GJQA 3KUCA 4WUVA 4C43A 1KI8A 2ZUEA 2GJ8A 5NLLA 2I7TA 4YCSA 5F3DA 2QAGB 1NW9B 2XCIA 4YMWA 4GZMA 1OX4A 2FUG1 3U1TA 1GL9B 2I3AA 1TZMA 2IZOA 1Y6GA 3GAMA 2OCXA 1ZNZA 5H9VA 4KUHA 4MNTA 2PKQP 2PL5A 4JI6B 4A6EA 5B6PA 1PX2A 2X2EA 3CUSA 4IJUA 3F90A 1VLMA 1H9BA 1UXHA 1NA5A 4Y2JA 5F2NA 5JAPA 5LXTB 3IKMB 2UYHA 3O8BA 4A1FA 2O59A 5D7BA 2OHIA 3N75A 3FAZA 2DR0A 1YR3A 1KYXA 1J1ZA 1G9SA 4ZO7A 5SY6A 3ROZA 3TZKA 2FPIB 2PEYA 2VRBA 2QIPA 1UBMS 1YOBA 221PA 5BWLA 4PLPA 2C5LA 3VR0A 3HL0A 2Y1GA 1S8OA 3CNOA 4KMSA 4KIFA 4OHUA 2ID8A 2X0IA 3U49A 5AVOA 3LTEA 3C2QA 4JT8A 2C29D 4G0NA 3IPRA 2NVUA 1V35A 1U5BB 2OCAA 3N7UA 4I1IA 3GJ7A 1WSDA 3B5EA 3DPSA 3OKPA 3PNQA 2J9RA 3COPA 4C04A 1YQUA 4RD3A 1TJ4A 2FPWA 1CUEA 1B00A 2NYAA 1GV1A 4YO7A 3V97A 4IG4A 4FHZA 2VZLA 5GWXA 2OMKA 1KRWA 5BV2P 3CA8A 1FUYB 4G84A 1ZN7A 4RV4A 1FJ2A 4W9NC 2HO5A 3COSA 3C8HA 4KACA 2Y99A 4ZTBA 5A9RA 7REQB 1W5EA 2F1HA 3QENA 4RORA 2I4RA 4GOND 1KY4A 3R44A 4RA6A 4DVGA 4AC9A 5G53C 1AUXA 2RGNC 4Z6KA 4J7UA 4YMLA 3D7RA 5LNK1 4YP1A 4NARA 1IZ9A 2AMYA 3ETEA 5DJ5A 3ZVRA 2ZBDA 1T3GA 2B4TO 2P2DA 1XZ8A 3LF1A 3OEHA 1CRLA 2DTXA 2PR7A 2R6AA 2XTZA 2YWJA 3AV0B 1ZKMA 3CF2A 4M7RA 3PNKA 2HGZA 1H42A 2CKMA 3QXGA 3ZY2A 2Z6UA 4YMGA 2ZIEA 2WMNB 2ORVA 2PV7A 3NWOA 1L5KA 2H52A 4ZA2A 4JJ7A 1TEZA 3ZGXA 2FR8A 1XZLA 4PLHA 2C3UA 2GPSA 4QO8A 3JQBA 3PC8A 4BP8A 3PIIA 2PA3A 1TUBB 2HJ9A 2JI9A 3M6UA 3MMXA 4CNBA 3DEAA 3TRFA 3SKYA 1RQLA 4PINA 5DTQA 4YI3A 1NR5A 6GPBA 2QZ4A 2G0TA 4DIKA 3KHKA 1HGXA 2OQIA 1A4IA 1RI4A 3P9IA 2C7GA 5F1YA 4EKNB 4NPCA 4TV8A 4YAUA 3DEKA 3KXPA 4LJ6A 2YHAA 5EHIA 4MWBA 4BV2A 5ARBA 4MDYA 4X6UA 4WHMA 4QLBA 1DBWA 4ENUA 3VVCA 1U8TA 4Q9AA 1YB4A 3ZQKA 2R11A 4CIAA 1AF7A 1CQJB 1ZM3A 3KKLA 5DEOA 2ZI9A 3IEXA 1HYEA 1YDGA 1CR6A 3NC4A 3A9RA 4UHBA 5HMMA 4L8YA 4HGNA 5D86A 5AI6A 2LCQA 4ITVA 1BO6A 1OX6A 2WJGA 3ZY5A 4CMEA 3WBBA 3IMGA 1P8AA 1EIZA 3ZUGA 3KETA 3QVGB 2DHRA 1VB3A 2OKGA 2R8PA 3NHWA 4OH1A 2W43A 3TRDA 1RWQA 2Q4TA 3BS4A 3SC6A 3NWJA 2Z2YA 5LWHA 2XZDA 3I3SR 1N0WA 1CD5A 1DDOA 4OA8A 5KVCA 5GJBA 3T0IA 1DQZA 1RM3A 4Q02A 2GD0A 4XWYA 3OIDA 1COZA 2BISA 3T3DA 4D43A 721PA 3S1AB 3QRWA 1H4TA 3ESDA 4IV5A 2FPKA 1M1YB 3TKLA 1IHOA 1MC5A 3QKSA 4JLMA 1N6LA 1QJCA 2MSEB 3ONNA 4U4AA 4V0MA 2J67A 1L4YA 3ZY4A 4F6RA 1TTQB 3CW8X 3OWOA 3RYTC 1G5PA 5LA6B 3K09C 3RUHA 1FNSA 4EYOA 2ECKA 4BV9A 1GNSA 1HMYA 3JQGB 3L1JA 2ZUCA 4RGYA 5B4TA 2AKYA 5FRDA 1KI2A 2WABA 1CIJA 3F6BX 4Y6QA 2GWHA 4BEWA 1V5IA 1HYGA 3JQFA 1G6Q1 4IMRA 3IR7A 1ILEA 3K8ZA 3HACA 1A1SA 4G0OA 4WCDA 3OTQA 1FYFA 3T9FA 4YMUA 1U7PA 3W3AA 2FZGA 1IN6A 3A9WA 2ODTX 3CZAA 3M2PA 1P73A 5GM1A 4I3HA 3MLBA 3OPNA 1T1JA 4ZVLA 3GZNB 4OB6A 3WOVA 4B4KA 3R9XA 1TKRA 2YCBA 3FRIA 3NCTA 3RVRA 4S3MA 4WOCA 4LOHA 2QMOA 5D1HA 1IHUA 1JSCA 1J2YA 2JA1A 5G0SA 4IJMA 1NQTA 1X7ZB 4CKEA 4F5ZA 4EHDA 1MOZA 1ML4A 2VRNA 1IQRA 1Q7CA 5AM1A 5JMTA 1BE8A 2QNBA 4NE9A 4ZMSA 1QRAA 3VNUA 5AR1A 1M5TA 1WVMA 1BN7A 1ZH2A 3IC5A 5KWIA 1APBA 2B8TA 3ZK9A 1ND5A 2JIMA 1N3BA 3MJRA 2H4YA 4RVFA 3W79A 2A0FA 1LPMA 1P74A 2NU8A 2IPXA 3RS7A 2IHBA 3WRXC 1CG6A 1KERA 1VDZA 2EJBA 3HRHA 1Y3HA 1MA0A 4M1EA 1KK1A 2P2YA 5BOVA 4TT3A 3RRMA 4ER6A 1GZUA 4GLBA 5AKJA 2FN8A 5LMUB 1T6ZA 1YDMA 2MHCA 3A3KA 3IVXA 3P2JA 3QXCA 3VSDA 3M5PA 1JF8A 3KJEA 3N0TA 1NMQA 4EHLA 4I6EA 2X7JA 1FSFA 1Z0UA 2AN9A 2P91A 1MA3A 5FYQA 4EVSA 3O8NA 4B9EA 1FFYA 4QASA 4M2LA 3RHTA 5IJWA 3SY8A 1V1JA 1QIMA 1L5RA 1V7ZA 1VJCA 2EZTA 4MWTA 3EGXB 4QTUB 1HKHA 4XIJA 3UJPA 1GCAA 2A9QA 3OCUA 5LQMA 1JMYA 1REQA 1ZLYA 3L0DA 1YVUA 3P2OA 2XE4A 3SICE 3SLRA 3L8YA 1Z6AA 1AVTA 1NULA 4JKOA 4TYQA 5I7UA 2PU5A 4HGOA 3MRVA 1DG1G 1HDOA 3D8RA 1ECPA 2ZUUA 4C6TB 1V9LA 1MEJA 5TX7A 2V74B 3PWZA 3DAGA 3BJMA 4KR7A 1HXHA 1KR2A 5FQNA 3DP9A 3H86A 3JSXA 3OLQA 3C3YA 5AW5A 3ZGNA 1UPTA 4TTAA 5AICA 3JV7A 1FOEB 2AWNA 4OQ4A 3EXIA 4OGWA 1E1KA 3E9CA 3N2KB 3FDFA 4G89A 1WUTA 4L08A 1EXVA 4Y9TA 3V8VA 1EFAA 4P3XA 5IN5A 3QX3A 1VKJA 1GKKA 3GLGA 2J3JA 4KTVE 4XB6B 2XKAA 3OCWA 3KYIB 4EFLA 1GWNA 1QYDA 2QTNA 3SZ3A 3DVQX 2HBZA 3AFGA 3ENKA 4NP6A 5LD2C 5E7QA 3PQ8A 4YP6A 2YQZA 1F2UB 3VDXA 4UNNA 2GCNA 4II2A 4P8RA 1HE1C 1ONOA 5LZ5A 3FBGA 4B3BA 4Y2RA 3DYVA 4A1OA 1Z18A 2P1RA 4W5TA 1BC5A 2A2ZA 3X0DA 1T3LA 3R2JA 3VH4A 2FN9A 1CB0A 4HQNA 1PNVA 3H1EA 4JNKA 1PX0A 4KPGA 3A0UA 4LRSB 4CM9D 4PC3A 5CCXA 4YCLA 4FGSA 1MD9A 1XTJA 3OTWA 1EJ6A 4NCXA 4OYRA 5DHSA 1CEQA 1NBIA 4WLVA 4BMDA 1V7PC 4IIDA 5K2MA 4J90A 2RGWA 1J09A 2VDKB 4C2BA 4XXHA 4D8TA 1ZNWA 2ISQA 2PZKA 3CLSD 1IATA 3DCIA 4A16A 1OBCA 3O9MA 1B73A 4LCBA 4UXHA 4CQMD 2TMYA 2B8EA 1IEVA 3X1KA 5BSEA 3WIEA 1K0FA 4MQEA 4CHGA 1A0OA 1NONA 4Q3LA 4XPIB 4JODA 1P2VA 5C37A 2GBCA 1U1FA 1K88A 4BLRA 4L3WA 4MUHA 1Q1NA 4JGBA 1RP7A 2A33A 3NHMA 4BDSA 4YT2A 4YXWD 2V4MA 4ESVA 4A3SA 3K0FA 1YUMA 3OUTA 2J3MA 2VWQA 3OT5A 4PZ9A 3EFEA 5IJAA 4RTOA 3CLTD 1NP6A 4YJ3B 5AVQA 2B30A 4RTPA 3RBXA 3WX0A 1X87A 1YJCA 2YV5A 3W5UA 4C78A 2OLKA 3NMUF 2ZAOA 1TK9A 2ZUDA 2NUAB 3PD7A 3IPLA 4Q82A 1TQ8A 2YFYA 1HNXB 3B3QA 3GN1A 1AZLA 4IGAA 3AW9A 4QDOA 4UUBA 3VKFA 4AROA 3TZEA 1GOTA 3QUAA 1I3LA 2JASA 2OBYA 4TLLB 1U0BB 3RK1A 1JLLB 5TGZA 1VOTA 1LFAA 1SGWA 3HR7A 2VQDA 1XNGA 3FVVA 4GEKA 1DIAA 4N5IX 1XPRA 1JW9B 4RQBA 2X1HA 1KQOA 4M38A 5HBRA 4A0HA 4CQMB 3IV6A 1U0NA 4YS6A 3I01A 4DBVO 5MFZA 4TGLA 5JAZA 5FORA 2C4VA 3TNJA 4G85A 1PAUA 1WUIS 2I2WA 3UVEA 2GB4A 3CO5A 2XGSA 2YYSA 4HDRA 4UDOA 5K3OA 2AMLA 5LKAA 3OZ7A 5BPFA 3A4LA 1EM8B 1QKKA 3TBKA 1I2DA 2VAXA 4G4SO 2FUG6 3GHHA 3NVDA 4OGKA 3ZV4A 2CXOA 5U4QA 3LXRA 2K4MA 3KYCB 2QUHA 4GU5A 5CNIA 3BD9A 1NDHA 3BQMB 5DM2A 7YASA 5LQNA 2BF7A 2ENUA 5F5XA 3LFUA 4IX1A 5FWXB 2J85A 1ZY2A 3GCDA 4Z4FA 2GSWA 4QGBA 3VV2A 1Y80A 3E5NA 3FTFA 1NXVA 1VG1A 2ZAMA 5L7TA 4G5SA 3IB3A 3PUHA 5B55A 1DT3A 3PEFA 1SR8A 1N3IA 3ZXUB 1E7YA 1ECLA 3FNQA 4OQMA 5JW6A 2E48A 4YWJA 2BSXA 4QXQA 4JBXA 4DIUA 2PFSA 4QTYA 4KDRA 4K2HA 4ZVUA 3BF8A 3QE9Y 3MPOA 4YRTA 4AIIA 4FFWA 5JDCC 2WUWE 1TXGA 4HK4A 1YJXA 4ROTA 2GETA 2VZEA 3M3HA 4J7XA 4ZRNA 3T15A 1ZYUA 1OLSA 1Z5GA 3AWDA 4JP2A 3BXZA 5DLYA 4ZWNA 3TTUA 4JEUA 4LXYA 3A4IA 3EVGA 4HEHA 2FB9A 1UMBB 5SZHB 1QLWA 5L8VA 1KAHA 3C43A 5B3KA 1NSYA 2IUSA 1PG0A 4QARA 2CMFA 1C1DB 3AXTA 2H57A 2JDID 3FYCA 5ELLA 2DQKA 2PVSA 4DR7B 4ZO6A 5T3YA 5HKKD 1C1YA 3ZDDA 5DTRA 1B8UA 5M5BA 1GQSA 3IL2A 1OXTA 2FWAA 3FRJA 4KIGA 3SOZA 4KRGA 4O4LF 2AN3A 4Y2UA 5FXMA 2VA8A 3I1JA 1VKOA 1XZHA 1YVRA 3ITNA 1OSNA 3WLHA 4AAYA 1X1QA 1F06A 3U61B 5LP6F 4AQ7A 1QJ4A 1KOLA 2JARA 4U9HS 1CJKC 3JASA 3AJEA 3L1UA 3OHMA 3F7NA 5TS3A 4DTCA 2O8CA 4UUQA 1CS0B 3G9QA 3HVIA 4BCBA 4U7TB 2QSYA 3AOEA 3RC9A 4H59A 4DDHA 1PGPA 2Z5FA 5J5VA 1CJCA 1K7CA 1XMIA 2XVMA 2A92A 1WHSA 2OV2A 3Q3GE 3O4IA 4BCDA 5I47A 4GO1A 2DSNA 4YIKA 3OKAA 1O9GA 5EFOA 4KBFA 3WLFA 3A9TA 5EJ4A 3CLHA 1E9CA 4MS1A 4AT1A 4R31A 1TW2A 3BH7A 1G5QA 3SR3A 1N2IA 1FS5A 1R0YA 4AVYA 3DUFB 2W2VA 2JBHA 2IYYA 3TL6A 1F6DA 4JCCA 1D07A 1OWPA 2PRSA 1XP5A 1DOAA 3OIGA 1E60A 4FOPA 3JQ8A 4DWOA 1X9GA 4AICA 1UBSB 2A7XA 2BJWA 3PTZA 1LF5A 4OLFA 4PTLA 3R3XA 4AG6A 1Z0KA 4IXWA 4CDMA 4D4LA 1Q83A 3L8DA 5FWAA 4ZZ2A 1Z07A 4DCSA 4MHSA 1N1EA 3N70A 3A6FA 3OTIA 1JRLA 1GTJ1 2G0NA 1G0OA 1A2BA 4TT3D 5DP2A 1GAJA 1Z5OA 2J3HA 2EYUA 2QNIA 5HDBB 4TMVA 2NZUG 3FJYA 5CDGA 4EF6A 2XCSB 2JLYA 2WHPA 3DH0A 1NBOA 2XYRA 3RYHA 2AI1A 5ULLA 1L4EA 1X80A 3CS3A 3TRHA 2D8AA 2OB1A 4Z4HA 2W6ID 3IIJA 5EEGA 1K6IA 4F3NA 3N28A 2OXIA 4TRNA 4XIYA 3TECE 4UC0A 4R7ZA 4LK2A 2ZSAA 2JI8A 3W5JA 2QYTA 4HZUA 2C82A 4C4YA 1QOQB 4JFRA 2HWUA 4LGCA 1CP2A 1YRHA 1MTZA 2O06A 2VH2A 3JRNA 3QOXA 3K20A 3BEDA 3MUEA 5AK5A 4UTXA 5DZSA 1J99A 3KJHA 5EWLA 2WIKA 3JQGA 3V7FA 5BWMA 4BB9A 4YDQA 3TLJA 2FPLA 5NULA 4FC6A 3O74A 4HQ6A 2YWXA 4CKBB 3EX7C 1UBGA 2XCTB 1XVTA 4GSKA 2BSQA 2IF0A 4RY9A 3OWHA 1YZGA 2JFWA 1GR0A 2ZI7A 4KXVA 4ARIA 1TC2A 4U8GA 1FMJA 2XAUA 1PLLA 3DEIA 4N03A 1I2AA 1ETUA 2YXEA 5HCIA 3ZHQA 3DMNA 3KYDB 4QPNA 4XX0B 2X9VA 3O91A 3WNCA 1PFVA 1Y7LA 2W2MA 4N54A 3GDFA 5BNFA 3MWLA 2ZRGA 1Z4IA 2I6SA 1MAWA 1OXMA 5DBOA 2FR1A 3ORFA 4FONA 2BVNA 4C0SA 1UXOA 3B7PA 4DMKA 2GFHA 2JFUA 3DLPX 3GVPA 5ECWA 5IG2A 1KVTA 3ZKWA 4A0FA 2Q3JA 2PK3A 5BYJA 4DMFA 2UVPB 3HFSA 2ZVDA 2PSDA 3RU9A 1NLZA 3OQIA 4GX0A 4WKGA 2Q8QA 4S0XA 4WACA 1N7GA 2QD5A 2I62A 3VX3A 4DG9A 1JEDA 3TTTA 1JG2A 3S99A 5LQUA 3Q1KA 5KC8A 2PRKA 3OQJA 3QNMA 3NKVA 4RLFA 1E2JA 2QE6A 3IE1A 1IULA 1U31A 2GTHA 2YZ2A 4HWRA 1QDLB 1ZD8A 2ZR9A 2GKGA 5CLIA 4GL4A 3LWZA 4KYVA 1B6GA 5CA0F 3UUWA 4BO0A 5C35A 3VR1A 2EFDB 4E3WA 5HQ3B 2JG3A 3OM9A 2RAVA 4KO8A 1QH1B 4ZT4A 1M7HA 5GONF 4IVNA 1YAHA 2PNJA 3AHFA 1GUFA 4JL5A 4LJ5A 3WWOA 1JJBA 4HP8A 1B1CA 3SQDA 3FHCB 1FDVA 3IXLA 4D8UA 3D4PA 1N5DA 2VATA 4UHCA 3FZGA 3QWFA 3IQZA 3P9CA 4M9QA 4TKMA 4WASA 3VOAA 3GRVA 1NNI1 3TLEA 3GGCA 2B6NA 3P4UA 3R5SA 1YC2A 1S2OA 5TMDA 3DW1X 2HRDA 3EEIA 2R65A 2A88A 4CMGA 4JN6B 5H9WA 2RFLA 4E12A 5KINB 3MJTA 3OLWA 4HYQA 4PFQA 3TDNA 4DF3A 4WZBE 1E79A 2FSUA 5BW6B 2BWJA 1GG5A 4NMWA 2HMTA 4HDKA 5ISMA 1DIGA 4UNPA 1I6WA 2W6IA 3IOYA 1L7OA 4IDOA 1UJNA 3QPVA 1CDEA 1UWLA 3PNMA 4L6IA 4ND4A 4X8OA 4H4CA 5CW1A 1HT0A 2BSAA 1KQPA 3PQ5A 2C59A 2F1KA 1KH1A 2GASA 1MO6A 3U44B 2EJUA 1MB9A 3T6KA 3I04M 4BDTA 1PV2A 5EE5B 4DV3B 5KYUA 2XUPA 4MLCA 2Q9CA 4WY5A 5SYAA 4DQUA 1KEUA 3EEYA 4Q4HB 4PN3A 3HXQA 2FW9A 3GVIA 4Q9NA 2GBFA 2BJVA 4EL0A 3P20A 3QOWA 1YJ5A 2HT1A 2GPJA 1M5RA 1R6BX 3QBEA 2EOAA 2HU7A 3C1UA 4MPDA 1XZKA 4XUDA 1V95A 1FP4B 1M1YE 4M1YA 4RJJA 1P1RA 2ZRCA 4P86A 5KU7A 1UXGA 1YE5A 5I3ZA 5B53A 2I91A 4I8XA 1J2TA 1KYQA 2EDCA 1PL6A 2DBQA 4H7KA 2O8BB 4D5GA 2D06A 4QVKA 1IZ7A 2BFBB 3ZV6A 2WD9A 1Z5WA 4A6XA 2FMTA 2R8XA 5CB8A 1HURA 1YRYE 3N2EA 3FROA 3HJUA 4XD7A 5CUQA 1E3EA 3NTRA 3TG8A 2VJNA 1BFDA 1A95A 1NJFA 5K4AA 3RJ9A 2PGIA 4F92B 2P9QA 3BD6A 1J9GA 1NI4A 3EYWA 5JZVA 1QE0A 1GPLA 3VVLA 2GS9A 2PUBA 2RJOA 2AFHA 4BKMA 1VMEA 2AG8A 3E05A 3FG9A 4LY0A 5JMPA 4ZHQA 4HHEA 1LTHR 1U0FA 4YGXB 5DNDA 4E4YA 1X94A 4MPRA 3VR4A 4WKPA 2XSZD 2V7VA 3KTFA 4I3FA 4UM8B 4ZK2A 4ADSG 4B74A 4I5DA 1NE2A 4CM6A 1CR4A 3C5CA 3ANXA 4LRUA 4Q16A 4N7JA 1B2LA 1VIAA 5EZYB 5DN6D 121PA 4TS9A 1H2XA 4MPJA 4B4OA 5JXGA 5EXTA 1S9DA 4LXTA 1COWA 1D8TA 2Q3EA 1DJQA 3AP3A 3HE3A 3K9HA 3L0ZA 3NUQA 4RCZA 3BWYA 4BO2A 4FFRA 4BCCA 3C41J 3TLAA 2JDIA 4R1QA 4DMLA 5KAPA 2QRQA 1XRLA 1MH1A 4LJKA 5DSXA 5DT9A 3S5UA 3WLSA 1BMQA 3QU4A 3WAJA 2BM1A 3P45A 1I6MA 4WNCA 4QXRA 1OF1A 3PICA 1FVXA 2E7ZA 3KQVA 4JQZA 2PR2A 2B20A 1Y3FE 2FFBA 2YWCA 2HR1A 1Q7GA 5AQ1A 1RVDA 2ANCA 3NHLA 1F1JA 3G59A 3HC7A 4IDGA 3D3WA 1SQGA 3B9BA 2P27A 2KBEA 2WM2A 1U2RA 3HKCA 4H7DA 4D25A 2XYVA 2Q1XA 3HI6A 3L1VA 4TLDA 1BJKA 1MAAA 4TTSA 2ECFA 4YX9A 3OCZA 3CWCA 2O2DA 4LHVA 5B36A 3R3VA 4F2WA 1JFVA 1C1XA 1HBJA 2GYYA 3HCRA 2KW5A 4IGIA 2HBQA 4TYPA 4LWOA 2QVGA 4MGEA 4P4NA 1B8NA 1DPGA 4KAJA 3GIWA 4P0TA 1SC1A 4RESA 3EG5A 1RYDA 2QGFA 5KHAA 4E5UA 3HN2A 1PYDA 5EUBA 4AP5A 4O1HA 2V7EA 1E9EA 2Y1WA 1M66A 1XD8A 2UYGA 1WSAA 1Z35A 3FVTA 1CPYA 1TIBA 5D7NA 4F3KA 2QLBA 5ADVA 1CF4A 2PTGA 4KN8A 1K7FB 3OPMA 4JU9A 3VA7A 2G8LA 3CX7A 1E2QA 1YI1A 4PAMA 2IHUA 2X86A 3E5MA 2E49A 2WZBA 3DBIA 4KWEA 5ESRA 3GRAA 2OYSA 3MCWA 4ZAZA 1U3WA 1O03A 4UVDA 1N75A 3QEJA 2I2XB 4I8DA 2C9CA 3NXSA 4ZEWA 5IRCD 2KI5A 1LZKA 1PWYE 1JIUA 3EH1A 4U2CA 1A9XA 1JNXX 3SZOA 1YKSA 3IA7A 5AHOA 5E9JA 2AEMA 4X1YA 3CVXA 1UFOA 4QFBA 4CTOA 4BEBA 1ABBA 5JZMA 4R1TA 4MVJD 2CWDA 3P2MA 3ANYB 9ABPA 2HJSA 1UMBA 1TK3A 2W2QA 2IIQA 5DGDA 4H60A 2QQEA 5EP4A 3R8CA 2XUKA 2R1VB 4DLTA 4E7OA 1E1NA 3R0XA 4YJGA 4A0QA 1DCTA 1W4ZA 2HNBA 4Z8YA 5DLPA 1JKFA 4Z8XA 3U39A 3B85A 4S1NA 3GAZA 2ZJBA 4L6CA 2BC9A 3FLMA 4G86A 1N5RA 3WLOA 2VFAA 1KRXA 4NZMA 1L8QA 3DWIA 2BMWA 3WG9A 3UENA 2W93A 4KX3A 1OR8A 2FPMA 5AKZA 1XKLA 3AFMA 3WB1A 4B9AA 4MQ6A 1NTOA 1F12A 4X20B 1DEKA 2O8CB 1AZWA 1C9YA 2YJ4A 1C3EA 3KVYA 1NJ8A 3PNLA 3NHBA 2MSKA 3JPWA 3QE2A 4XQGA 3ODPA 3N07A 1UK7A 1K8RA 1I1OA 1YB7A 3ZHRA 3JAWA 3MF4A 4MVJI 1A9SA 1EFHA 4HJRA 4INAA 1XLTC 3SFZA 4AJOA 4RMNA 3R9WA 3MRXA 2O57A 1G38A 1NVFA 4F0JA 4KYIB 3SMVA 3D3EA 4CMIB 3H0KA 3D8UA 3LGXA 2O2IA 1DFIA 3CY6A 3CZ9A 3H9GA 3OJFA 3BULA 5KS2A 4N82A 5FPSA 4OXRA 5FBLB 5CDSA 4DSUA 2W2NA 3H5VA 1DAPA 3CG4A 3WK5A 4OHZA 2XWJI 3AM3A 5T4EA 3HR4A 4ISCA 2XGGA 2HUNA 2V7QA 4BFCA 1P4JA 3O82A 3WWPA 1JSXA 4L7QA 1EFDN 4GRIA 1YZNA 4WZAE 2AZXA 2P65A 3VTAA 2JGAA 1EX9A 5JYCA 3K6SB 3NXKA 3TM5A 5DHTA 2CMDA 1WB9A 3ILVA 4N12A 5BN3A 4JIMA 3R0JA 1BWSA 4I9GA 3CTPA 4YRGA 5J2TB 4I55B 2X2PA 1WXFA 1U7ZA 2C98A 1UODA 2BZ1A 2HLDA 3OE1A 3PEYA 1L5ZA 2NYVA 3S0JA 1L4MA 1T1SA 1W5SA 1SKYB 3FTCA 3NHUA 3QELB 1VJ0A 1N25A 3B48A 3P71T 2EZUA 3DT8A 3G85A 3JYHA 4YCJA 2IS6A 4OP3A 5IT9A 1UMKA 5FLKA 1YB5A 3FLBA 1WSBA 4L78A 1N2CA 3EVTA 4B32A 3Q3JB 5I7HA 1U8ZA 2RHHA 5KBYA 1Z56C 2A0UA 1VYTA 2EZ8A 4FFOA 4A5SA 5EWLB 4A4DA 2NMVA 2VNJA 4GLOA 1C5KA 3NHYA 5K45A 1CV2A 1FW8A 2W42A 2GBLC 3JWGA 2FXIA 3Q5EA 1LKZA 1XDGA 5ECGC 3C6KA 4YASA 2V7TA 4PX5A 1NMYA 2QL7A 3ZQUA 5I48A 1WMEA 3LQKA 1EUYA 3BRQA 3U4QA 3MMNA 4JC8A 2C2HA 4WN9A 3R0IA 2RGXA 3IUEA 1XQXA 1GAWA 3F3KA 2V5UA 3LNCA 2VP0A 4LISA 2BR5A 2BGIA 2GCEA 1BMFD 5B2FA 2L2QA 4HEQA 3ZI7A 2ZT8A 1GPWB 4XDZA 2OHVA 1ONBA 1T4BA 1W36D 1CFJA 1ECJA 3KKZA 4OBXA 2REXB 1QAOA 4QSMA 5K99A 2ZRLA 1K97A 1FTGA 3FKSA 3TVTA 2OCLA 2H2HA 4PFJA 5A5FA 4Q6BA 4WXMA 1FYVA 4U6SA 2QENA 3VYSB 1O58A 1F8UA 1THMA 1TJ3A 3PNSA 3T54A 2Y0PA 4HTAA 2HHHB 5L7WA 1FBTA 4MICA 4ZREA 1KJWA 1PZGA 4RV5A 2C2XA 4LTNA 5FHQA 1SZJG 5DCLA 2G88A 1LPNA 1EUQA 1JH8A 1GAXA 2WU3A 5FLXA 1KI9A 2XJ9A 4KXLA 3BUSA 3PC2A 3AVVA 3QU5A 3RLIA 4BNXA 2CFTA 2FETA 2P0EA 2Q9BA 1FS6A 1E3JA 2WFMA 4J76A 2QRZA 4EG5A 3I23A 3BXGA 1TM5E 2P75A 3GRYA 2PUHA 4J9UE 4YAJA 3SZGA 1XFAA 5CRIA 4V1CA 4GPBA 1SQSA 5KEIA 5C4GB 3GRFA 3G82C 1LPSA 5D5QA 1L2TA 2Z9DA 1PT8A 1R9NA 1J2JA 2BI8A 3U7QA 3WL5A 1BOOA 3GDGA 4G0YA 2XNJA 5HGXA 2GZRA 1V8FA 4R98A 2GFIA 1ZRHA 3QM1A 4HTFA 1QO9A 5CJ2A 1WX1A 5HOQA 1D4AA 2BBWA 1KU6A 2Q4BA 3AEYA 3LW7A 3MWFA 3QPCA 1I3CA 1CIVA 3E1SA 1Z47A 3A37A 3PQEA 5JDCA 3OEEA 3DS8A 1GDDA 4BNFA 1I7QB 2ZG6A 3VPDA 2VTEA 3BRCA 3RG2A 3UJBA 4B6RA 2ZB2A 4ZZIA 2Z2JA 3QPWA 2YWHA 1J70A 1UL1X 1OCEA 3PPWA 1K5GA 4DR5B 2JGMA 5GAJA 5J59A 3TBFA 1MKYA 1MT3A 1G9XA 3DM9B 3I9JA 3HO1A 1JG7A 3GEGA 5C8YB 1ELOA 1YASA 1TF5A 4KHPB 3UHAA 2FZCA 1YU6A 2P9ZA 2IOYA 2V0CA 2CV2A 4MCJA 3A26A 3CSDA 4PF1A 1JKIA 3NDBB 2FEMA 5IM4A 4CLXA 2MCFA 3SNHA 2BP7A 2ZDGA 4MYUA 4RZ2A 4RYDA 3OZWA 2BRUA 4CU5A 3BGIA 3UAYA 3VI3B 4CL8A 3Q98A 3WWDA 5EXEA 5TDHA 2I9KA 2R1TA 2ZRAA 2XW6A 3DFKA 3FOEC 3E9ZA 1DXOA 3I2HA 4HQRA 4Z2AA 3RADC 3A9CA 2NTYC 1P1FA 3KQLA 2F4VB 3KU4A 3L04A 1W44A 1XJQA 4CM3A 3T8YA 5J2UA 4U9IS 1DV2A 1EE9A 1L4HA 2NNLD 4RD1A 1PBTA 4WK0B 3GUVA 5A2QA 1HR0B 2FFQA 4CODB 5G1PA 3W8EA 3QVGA 3HWX1 2BFBA 4A26A 1M6NA 3EAFA 4FYVA 5A4KA 1LLQA 1JA9A 1W1WA 1GUZA 1CVRA 4JC0A 4NCKA 5KTKA 5IVKA 3CNNA 4L0QA 2GUWA 2Y27A 5C4MA 1HY3A 5LD2B 4V3BA 2VF5X 1HDYA 2VSOA 2BOVA 4PWYA 4BLWA 1TU0A 1DTWA 1UEIA 4TTVA 5JY1A 1P45A 1Q1BA 3E61A 1IPEA 2GEDA 3EGOA 5T3UA 1IPFA 3K9BA 4IDEA 1VXOA 1QBGA 1I7DA 5I7SA 3BD8A 4W63A 5FL7A 2ZTSA 5KYNA 2C07A 4MRRA 4GYJA 3I52A 4FOLA 2P6OA 1EEXB 4JLUA 1N0HA 3PB3A 2YH2A 2VK1A 1FDTA 4R1PA 1RHQA 5C8ZA 3NGMA 1KPIA 4Y6OA 2IEBA 4UD2A 2XZLA 3H5TA 2VLBA 2V3WA 1ZK4A 2VYND 2AF4C 2A1UA 1G6OA 4Y1RA 1PUIA 5E4YA 1G2OA 3UK7A 1RXYA 2WAOA 1NVBA 2R85A 4CG2A 5JNVA 2Y1LA 5EIOA 1TKAA 4X65B 3VHXA 3S1LA 3DHNA 3ZHBA 2JHGA 3CX3A 4W7IA 4YWHA 3OWXA 3NT4A 4QULA 3NANA 1RLIA 1E3QA 4M8IA 3V8NA 3A36A 3A31A 3EA4A 3U48A 1QAMA 2XXAA 3LL4A 3IBSA 2L82A 4S12A 4HQOA 4KE8A 2WUVA 4JLDA 4OA5A 1VMDA 1VDMA 3HZRA 4RKQA 2YKGA 1EBUA 3FMOB 3SIXA 2B7LA 4A9AA 1RU3A 2Z9BA 1R4NA 4G26A 4MI1A 4BVFA 5KMGA 1Y6RA 1K7EB 3WYDA 2ZRMA 1YH3A 1I7LA 3ORYA 1LDGA 5EMHA 4RQUA 1RYHA 4PZCA 3LVQE 3G9XA 5MN5A 1DX4A 1JHYA 3NATA 3LKVA 5E1OA 3MJSA 4UBJA 4W9MC 4R83A 1C0IA 3U40A 4FYYA 4X6YA 3C3BA 4EUSA 3G2MA 4I1YA 1GCIA 4LG1A 4W6ZA 2NSYA 2FXVA 2IFTA 3ICOA 1CJUC 1E5QA 3NASA 3PIDA 2POQX 4DLZA 5H02A 5DLQC 4O4IA 1J8YF 2VKTA 1Y4SA 4LJ7A 1KORA 1O0SA 1PI3A 3SEQA 3UXHA 1YJQA 2NUPB 3WL4A 4D79A 4ZYUA 2E21A 5KPDA 2ZITA 4C7OA 2RAFA 1UKZA 4IDFA 2PUJA 2VEDA 4UUOA 2CFOA 2BGRA 1ID1A 1LD3A 1DC5A 1ZUD1 2E4UA 3PD0A 4B09A 2DR2A 4AJEA 3R5XA 4DUGD 1E0SA 4N5MA 3SCZA 3OX2A 1Y5LA 1Y9JA 3ZTWA 1O4VA 2WJWA 1UPAA 3AVOA 1CUFA 1I4OA 2CCJA 4Q9JA 2WHXA 4DLWA 5IFLA 1E2UA 3T41A 4J3NA 5EJMA 1SG6A 3P9QA 2WIFA 3C14C 4ZCTA 2O6HA 2X0KA 3IMFA 4G4SP 4B5KA 3U5TA 3Q6MA 4H7EA 3ABZA 5L4LA 1XQVA 1YDFA 2YHIB 1FX0A 4PQRA 2MJLA 3KXIA 4X1KA 5DWQA 2M2IA 1DPFA 4RTLA 3ADDA 5A04A 3ZDBA 2QMUA 3IOCA 3IJPA 1HFKA 4Q1AA 5FJIA 2GM3A 1W9MA 3AUJB 1PWXA 4WOPA 1SK9A 2C94A 4MDHA 1FYXA 4BNHA 2JLZA 2JLXA 3M5WA 4FWIB 4EHBA 2FDXA 3Q72A 4I4LA 1HDEA 5DNVA 7ADHA 1A4XA 3T52A 5LYJF 3ZOZA 3EDYA 1EM6A 3UB2A 2X0RA 4AULA 4JBYA 4DNFA 1K3TA 1Q3HA 3TIFA 3VU0A 4UJ3A 1Z83A 3O4RA 4F3CA 4A27A 2XCOA 1XRPA 4NWIA 2ROQA 3GDWA 1SO8A 1E32A 4E2WA 5AI8A 3AM1A 2I6UA 2RBEA 1ZGZA 4H6WA 4NFYA 5E7JA 2FK8A 5ERXA 2A5LA 5AVSA 5JD6A 3KXLA 1SUDA 3UMJA 1KJNA 1Q16A 3W7AA 2XYPA 4Z3KA 4LHEA 2RBGA 3E3NA 2X76A 3NB0A 4X54A 4J7AA 5L95A 2VJAA 3CKLA 1ORTA 2DM6A 2P6MA 3HDTA 3BN3A 2OKCA 3M4YA 5BRNA 3CLKA 4EY7A 4OQQA 3HVRA 1I80A 1E96A 2C5AA 1T9HA 2KX7A 1RM5A 1ZEJA 3GUYA 3W5VA 3VZSA 2QQ0A 2WLTA 3MTQA 2RKBA 4B71A 2A30A 4J03A 2QL9A 1C1DA 3O03A 1EK5A 4FT4A 1PL0A 3R7FA 1TMKA 2JGIA 2D1RA 4HAVA 4Y9RA 4F6RB 5BSRA 3AILA 2BEWA 3UJHA 2I4OA 2VPQA 4R84A 4EWLA 5I9SA 5ILQA 4HAXA 4CV3A 4P2BA 3HB7A 4ND7A 4HNGA 1I0ZA 3K0FB 4XDGA 3M6MD 2M6LA 3RVBA 1ZNQO 2EX1A 1UJCA 1KSGA 2EX0A 3EMKA 2VVTA 4YJ3A 4F21A 2JAUA 3GVCA 3OPYI 2DFPA 5K6TA 1ZK0A 1XVIA 2ZYIA 4WW0A 2M6KA 1P7CA 1O5OA 4ZCSA 1UWKA 4DT1A 4RDHA 4YCCA 1PW7A 3C3MA 3GEHA 4IEEA 2MSNA 3H5LA 2P9CA 1D2AA 4HH4A 4WH0A 1B0AA 1Z45A 3QELA 2YHUA 3QLUA 2CNWD 1P0QA 4GP6A 4QDXA 2HKIA 2JBAB 2QKYA 5KB3A 2IXBA 2P2CA 4G8CA 4D9EA 5JZSA 5ICSA 2MYNA 3C3JA 1SXPA 5KOHA 1W0JA 3ANTA 4M9RA 5EZQA 3FGNA 1YVPA 3L9XA 3E27A 4KXMA 1TJPB 4IAOA 3W1WA 3ZGLA 5IVHA 1B14A 4G63A 5LZ4A 3KEFA 1ZIPA 4R5HA 3UY4A 4YDSA 3RU7A 2Z3ZA 5JCJD 1W94A 3TZ6A 3OHSX 2J45A 5HCNA 5KOIA 1RRGA 4HDRB 4KNVA 1KPHA 3A1CA 4N7BA 4COOA 2C5BA 3B12A 1T1RA 3KC2A 1ZXBA 1OVGA 4H15A 4LI3X 2JBWA 1B1AA 3K5HA 3JQ6A 1YNSA 3QVWA 3S7ZA 1KOJA 1RLMA 5BSWA 3MWKA 3LRXA 4JBLA 2ID9A 4YDRA 3L0CA 4HKTA 4IWNA 4DOMA 4C2UA 4HG2A 3KEQA 3CRQA 1SUFA 3I76A 4YJFA 1SUBA 4TV8B 2G0AA 5EJIA 3MINA 3UOWA 3CH7A 2JEOA 4Y2YA 4C0KA 1TT5A 3MERA 4I08A 4ND6A 4QBGB 3OPVA 4RCYA 2YFKA 4CXMA 5A4JA 4O4IF 4Q6WA 2PN1A 2X19A 1JEYA 1XCMA 2HRZA 4P38A 1ORIA 5FHRA 1RRKA 5HGJA 4AS1A 2Z08A 2RB5A 4JOSA 4C89A 2Q5QA 3T3MB 1GKUB 3MB5A 4MWCA 1DC7A 2CMGA 4BBAA 2FP4A 1P0IA 1RABA 1ZBQA 1V3TA 1YZLA 3QZUA 4RVUA 2C00A 3LC1O 2QU8A 1O8BA 3N7AA 3QG1A 4EJ2A 4BFUA 1NYRA 5EC8A 4MV4A 3UMCA 4YR7A 4JI8B 2RSLA 1E2LA 5G4KA 4ZVKA 3TNYA 4E2FA 4TTJA 3PX7A 2ZW9A 3QU7A 4X93A 7ABPA 1E2MA 5IN4A 4MS4A 2FMUA 1PR1A 1BHQ1 3RVQA 3ST7A 4WKBA 3L0YA 3QE0A 4UQLA 1NRJB 1CY2A 1II8B 5EL0A 1RHMA 3AGPA 3HKEB 5GY7A 4L73A 1L5HA 2GCPA 3OLXA 3USZA 4B6QA 1QE3A 1RYBA 1U1EA 3B52X 5BRJA 1R0LA 4AS3A 1W75A 3TI7A 3RSHA 3WHPA 5LYJA 4JXXA 3B1XA 2A59A 3BQNB 3COYA 5FOWA 1FLVA 2X3UA 3JU3A 4WKOA 1GZDA 5ESWA 3TI9A 1IJKA 3IELA 3O75A 1ZI9A 3EEQA 2VSQA 1IU9A 1DIHA 1NUTA 1EB8A 1V3UA 3LPCA 4CKCB 1L8LA 2FJ0A 3TAUA 1UJMA 2M32A 3DMTC 3OP1A 3UG7A 3FIUA 3MTIA 1IAQA 3KZMA 4N0QA 5JD3A 3VU3A 3L5OA 3AI3A 3LY8A 3RC3A 4DANA 3E84A 2QUJA 2HC9A 4NU0A 4WZAB 3FKSD 5U9CA 3H8WA 1UDAA 2A58A 2OXRA 2O8FA 1PSDA 4NATA 2R44A 1R5BA 4YLYA 1WCXA 4RVDA 5ALNA 4QUDA 1EE2A 3FVRA 4ZDJA 3WIOA 5KYYA 5FPQA 2I65A 4EFMA 4JH0A 3CUTA 3EIUA 4PO3X 4DM3A 5AW3A 4F5WA 1M0SA 2WF5A 2XGJA 4EB8A 1CUIA 4FWTA 1D5CA 3IPCA 1A2OA 2DECA 1CRWG 2B9VA 4MZDA 4D0LB 2HBRA 4MXDA 4EPVA 4OQLA 3SYRA 3GVXA 1CP3A 1PE0A 3P96A 3R3UA 4GLLA 4LDRA 2NVOA 3IV9A 1QB8A 4NE7A 2BD0A 3CBQA 4Q48A 4E30A 1I1QB 4ZRDA 1P3Y1 3ASZA 2BAGA 1W4CA 2BR3A 5DN6A 2KQUA 2GA8A 2RH5A 3BIWA 4KVAA 3V6LA 1N2XA 4Q3CA 1WPQA 4MVCA 3E0QA 1KZGB 3TF5A 4TMKA 1PQWA 2JGFA 2H9IA 2XPCA 1LJLA 2IYNA 2VHUA 3IMCA 4R68A 5J4YA 1NXTA 3GN2A 2XUQA 3HP1A 5AW9A 2Q5LA 3H2GA 4HZUB 2YHBA 1SH7A 2HCJB 2YUIA 3CRW1 3DZCA 5CIQA 4ESEA 3KSDO 5CEEA 3U44A 2GN4A 1PD1A 2EBHX 1EESA 5H59A 4QQ8A 4QYTA 1Y63A 4OL0A 2Z2KA 2WFZA 3FA2A 1L7NA 3K1JA 3FHOA 3W9UA 2SECE 1N9ZA