1R74A

Crystal structure of human glycine n-methyltransferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
275
Chain Sequence
YRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine N-methyltransferase
publication title Glycine N-methyltransferases: a comparison of the crystal structures and kinetic properties of recombinant human, mouse and rat enzymes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 275
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1r74A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r74A02
2GPYA 2AS0A 2E5WA 3C0KA 5FUBA 5ICFA 5LQUA 1Q0TA 3BT7A 2GLUA 1YZ3A 1RI2A 3P9NA 4HSGA 2I6GA 1DL5A 3LPMA 5CVVA 2XVAA 3GRUA 3LCUA 3FZGA 1F38A 5HFJA 4QVGA 3B89A 3PFHA 1I9GA 2AN3A 1SQGA 2IGTA 4X41A 3FPEA 2EX4A 3R0QA 1BOOA 3VC1A 1WS6A 3KQSA 4DM3A 3EVFA 4IWNA 3KR1A 3PVCA 4YUVA 2HTEA 4V0QA 3B5IA 5K01A 2EFJA 4Y30A 3TLJA 1T43A 5ERGB 3TOSA 2CL5A 2XBMA 3CC8A 2JHAA 2YXEA 3AY0A 3CGGA 3LCCA 4ATNA 4PYNA 3B3FA 3QOXA 5HIMA 1IXKA 3X0DA 3FPHA 1EJ0A 4PIPA 4RYLA 2XYQA 2OB1A 2B25A 3ELUA 3P2KA 3SSMA 3DH0A 1L3CA 3G7UA 1X1BA 2CMHA 2I9KA 1NT2A 2BM8A 1G38A 1G8AA 3LGAA 4F85A 3EEOA 4YV0A 2P40A 3FPFA 3EGIA 3TKYA 1WXWA 3HVJA 2VZ9A 3RODA 2OBFA 3GRRA 2I7CA 5CVEA 5LSAA 5GIOE 1NE2A 1JQDA 1ZGJA 4EKGA 3E7PA 4QTTB 2BZGA 4ER7A 3MHTA 2PKWA 5ICEA 1VP9A 4MQ4A 3G5TA 3KQYA 5DLYA 3GNLA 3OFKA 4ER0A 2Z6UA 4GQBA 2B78A 2B9EA 1KYZA 4C06A 3UJAA 2ZWVA 4CKBA 2XVMA 4QDKA 1R18A 2Q41A 1AQJA 4EQZA 2UZ4A 2QRVB 1NW6A 5K0NA 4C04A 3FPGA 3EMBA 5T6BA 1PJZA 1ZGAA 2HNKA 3HA7A 3P8ZA 3QOWA 5FCDA 4RX1A 1JSZA 5HEKA 1G55A 3RIEA 4P7JA 3SR4A 4FGZA 2ZLBA 1XVAA 5CCBA 3NMUF 3G2OA 3PB3A 3UJCA 3K6RA 4DQ0A 3SX0A 1L9KA 2VP3A 3MCZA 3NWBA 5FWDA 3M6XA 4BP3A 3SVZA 1VIDA 2QE6A 5E9WA 2PT9A 3M4XA 2QRVA 3M6VA 1VQ1A 2PXAA 2A14A 3NVMB 5DSTA 5EIFA 4DMGA 4E33A 2JHPA 3JWGA 3ERCA 3PX3A 1V39A 2G71A 5EC8A 1JG2A 1HNNA 3FUWA 5EVJA 2JH9A 1G6Q1 1KR5A 3T0IA 5FHRA 5DRTA 1ORHA 4B17A 2YVLA 3Q87B 3FRIA 3R3HA 5HILA 4E2XA 4YUXA 3HCAA 4GF5A 2PX4A 2I62A 1FBNA 3U81A 3D2LA 3GRYA 1BHJA 3B3GA 3KQQA 3A7DA 2ZBQA 3B3JA 3PFGA 1UFKA 3DLIA 2NYUA 3HP7A 1I1NA 4KIGA 2HV9A 4RVHA 3DR5A 4QQNA 3DMGA 2EJTA 2PWPA 4QTUB 4RTRA 2G72A 3HCCA 4P58A 4EKIA 5K0GA 4PYMA 2IIPA 2JHCA 2OZVA 4ISCA 4PGHA 5FADA 2O0LA 2NP7A 5LQRA 3EVAA 2ZWAA 1YUBA 3P71T 4Z2YA 5GIPE 4FZVA 2CMGA 3HA5A 3V97A 4U7PB 3HVIA 3NW9A 2Z6QA 3EMDA 4P7KA 2IH4A 4F86A 1KPHA 3UZUA 3G88A 5EHIA 2ZFUA 2P8JA 4HGYA 2C7QA 3VYWA 5BP7A 4GOOD 4OA8A 4YUWA 1RJFA 4CTJA 3BWYA 1QANA 2AOTA 3TRKA 4AZTA 2PX5A 3HM2A 4C07A 1VL5A 4R6WA 3P97A 3KU1A 3DLCA 1VE3A 3S68A 4PYOA 3TPZA 3Q7EA 5E9QA 2P7HA 1NBHA 4PCAA 4PYKA 4HRAA 1R74A 4PNEA 3DP7A 3IYLW 3OU6A 4RTJA 4WXHA 1L1EA 2YQZA 2FRXA 3BWCA 3KR0A 3DULA 3DXZA 3LDFA 3LX6A 1BC5A 3EVGA 2ZULA 3OZTA 1NBIA 1L3IA 1NW3A 1QZZA 5CVJA 2HR1A 2JJQA 4GUAA 3HCEA 4R8SA 2BR3A 4ER3A 3B7PA 5E1MA 3DXYA 5GINE 2NNWB 5EIWA 5BW4A 1Z3CA 4DCMA 2P3OA 4ZTBA 2ONYA 4BLUA 1KP9A 2G8NA 1D2GA 4YV2A 1NW8A 2AOXA 3UJ7A 1JSXA 3KR2A 3P9IA 2BM9A 3AXSA 4AX8A 4DZRA 3HA3A 1AV6A 4DCGA 2R3SA 2ZTHA 1B42A 2ERCA 3BWMA 3I5UA 3UA4A 2OY0A 2XYRA 2Y1XA 2AOUB 3A25A 3FPJA 1BKYA 3LECA 1RJDA 2AN5A 3NDJA 1ORIA 1VBFA 5GP1A 3OU7A 2ZCJA 2BR4A 3HNRA 4KRGA 4GC5A 1ZG3A 5EMMA 4FT4A 3SSOA 4ER5A 2PXCA 3HCBA 2ESRA 5E2AA 2V7EA 2AOVA 3GCZA 2VDUE 3GXOA 4OQEA 4Y2HA 1KXZA 1AQIA 4X1OA 5DTQA 5EEGA 5EKXA 2BR5A 2DULA 3TR6A 4PIMA 3SGLA 5K0FA 2BH2A 2XYVA 2ZIFA 1D2HA 3IV6A 2AVDA 5JR3A 1NKVA 2AOUA 4CKCA 1RI4A 5H02A 5E1BA 4CTKA 2PY6A 2YTZA 4DKJA 4PINA 4LWOA 1PRYA 5DSXA 3T7TA 4NECA 1KHHA 1MHTA 1RI3A 1XDZA 3LCVB 3H2BA 3ER9A 5HZMA 3R9XB 4KW7A 2F8LA 3OE4A 2IBSA 1SQFA 3HCFA 2PBFA 3UJ8A 2B3TA 4HG2A 3BKWA 2PSSA 5DM0A 5ICCA 2AVNA 5JUWA 3OZSA 2IH5A 2WK1A 4QQKA 2G1PA 3DUWA 1P91A 1UWVA 1KPIA 2ADMA 3EGEA 3BGIA 3THSA 1O9HA 3EPPA 2ZZKA 5F2KA 4C03A 3UJBA 3MB5A 4O29A 2FK7A 4RWZA 3KPUA 5DX0A 3C6KA 1SUSA 1UIRA 3OFJA 4RVDA 3CJRA 5DX8A 3ELDA 3NJRA 3FYDA 3A7EA 5K8VA 2HMYB 3PT9A 4PYIA 3P2EA 1H1DA 1MJFA 2HWKA 4OA5A 2Z6AA 1QYRA 4LWPA 4BY9E 3JWJA 4M38A 5EGSA 1WG8A 5C0OE 5K0EA 3LL7A 4X60A 5DWQA 2FK8A 2C7OA 3HCDA 5HIKA 2JH8A 1O54A 4RTPA 2KW5A 2V74B 4KVZA 3M6WA 3P2IA 5FULA 1JTEA 3ANXA 5U4XA 5FTWA 2P3QA 2PWYA 5LQKA 5KYGA 5E8RA 3A4TA 3A26A 1TW3A 4GEKA 5KS2A 5HIIA 2IBTA 3KQTA 1KIAA 5E9JA 2R6ZA 5C9ZA 1ZQ9A 1M6YA 5GOZA 2OKCA 3ORHA 1G8SA 5ICGA 5D1NA 3FUUA 4GOMD 2YR0A 4R6XA 5DTRA 1M6EX 4GBED 1JG1A 8MHTA 4POOA 7MHTA 4XCXA 1L3BA 3K0BA 3EEYA 4UOEA 3NVKI 5P8WA 1NW5A 5LQNA 2IDJA 5LQJA 2EG5A 2C7RA 1N7JA 2QY6A 4HH4A 5BXYA 3BUSA 2YXLA 2ZVJA 5KQSA 3AWIA 1R6AA 2AOTB 4IV8A 5FQNA 3DMFA 4BP1A 1EG2A 5CCXA 3L8DA 5EMLA 1P1CA 2UYHA 1YFLA 2G70A 1NW7A 3TKAA 3WSTA 5MHTA 5M5BA 3QV2A 1WXXA 5K0CA 1VPTA 1FJXA 1XDSA 5DXJA 3MTIA 1RJEA 1SG9A 2FCAA 3ELYA 2OYRA 1HMYA 2IDKA 4GOND 4KIFA 1TW2A 4M7RA 5DM2A 5DM4A 2PJDA 3KQMA 3IEIA 3KPJA 1M0EA 2UYCA 4YMGA 1IM8A 5F2OA 2B2CA 4QPPA 2P35A 3GRZA 4OBXA 2FYTA 5FQOA 5LR6A 2JG3A 4C08A 1KYWA 4OX9Y 1RI1A 3BXOA 3NTVA 3BZBA 3O7WA 4PONA 3GRVA 4WVLA 5E1DA 3EVCA 3VSEA 4C05A 1NV9A 3LBYA 4XUDA 3GWZA 4QVKA 4M36A 4BLVA 2PX8A 4RTSA 4MHTA 2UYQA 4X61A 2GA9A 3FUXA 3TQSA 3BGVA 5BW5A 3SMQA 4FR0A 5DRYA 5E2BA 1I4WA 3R24A 1EIZA 3E05A 3MCTA 2AZTA 4HTFB 3LBFA 4G56A 4AUKA 3KR9A 1JQEA 3LSTA 2NXCA 4LECA 2GB4A 2VS1A 5LQCA 1VP3A 2ONZA 2YXDA 4E30A 2Y1WA 1TPYA 4P7FA 1X19A 2YUIA 4DF3A 4IKPA 3ELWA 2AN4A 2OO3A 5D1HA 4YMHA 3I9FA 3HTXA 3F4KA 3LDGA 3UA3A 3GDHA 2PT6A 5EQJB 3REOA 3LKDA 3EVDA 1DCTA 3T7RA 3THRA 3PLAE 3DTNA 4HTFA 3BWBA 2GAFA 4EVIA 2NXNA 4F84A 3OE5A 4FS8A 3IHTA 1KPGA 3UFBA 3DMHA 3FTCA 3CCFA 3TFWA 4HGZA 1P39A 4RTQA 2GH1A 3FRHA 2O57A 3G89A 5EMJA 4KDCA 2PX2A 2P41A 3BGDA 5DPMA 1U2ZA 5EZQA 2PLWA 4E32A 5GWXA 2QM3A 3T7SA 2GS9A 2N47A 4C4AA 2O05A 1XDUA 4CWAA 2C7PA 5C1IA 3VC2A 4AZSA 5DXAA 3HEMA 3ME5A 4YV1A 3DXXA 3M70A 4E2WA 4E70A 4ER6A 4KDRA 2PV0A 4RTKA 3A27A 2H00A 3FUTA 2OXTA 3OPNA 4FSDA 5F2NA 3NDIA 5HOQA 4CXMA 4YUYA 1ZKDA 3C3PA 1D2CA 3SSNA 4E2YA 3OCJA 5EEHA 5K0BA 3KPYA 2P7IA 4L7VA 3HVKA 4FSXA 2DPMA 2IP2A 2ZIGA 5G02A 2AOWA 2OPBA 5T67A 3AXTA 4JXJA 3FTDA 3KQVA 3UJ9A 4RV9A 1R8XA 1IY9A 1G60A 3G2PA 2CWWA 1P1BA 10MHA 4OBWA 2IH2A 3LDUA 3G5LA 3LKZA 5K0LA 1EQAA 5B1SA 1Q0SA 1R00A 5E8JA 2ZZNA 3AJDA 1XJ5A 4FT2A 5DX1A 1YB2A 2NP6A 3O4FA 3R6TA 4U7TB 2NXJA 3SM3A 4RTNA 3KHKA 3SXJA 1QAMA 2ZBPA 1NV8A 4A6EA 4E31A 3KQOA 3TMAA 4KWCA 5K0JA 2ZW9A 3C3YA 5EG5A 4A6DA 4OQDA 2ORED 3KPWA 1AF7A 3ER8A 2FPOA 3GIWA 1X1AA 1INLA 4PYLA 2PVCA 2H11A 3UJ6A 1QAQA 2CKDA 2VDWA 3KKZA 1YZHA 4R05A 1JTFA 5K09A 5K03A 4AZVA 2LD4A 3MAGA 5HIJA 3UBTA 3OU2A 1N7IA 1SVUA 5FWAA 2YX1A 5FA5A 5LQAA 2PXXA 1RI5A 3E23A 3G8BA 2QYOA 3G8AA 5CUQA 2EJUA 3HVHA 4MTLA 4RVFA 1FP2A 1XCLA 3JWHA 3RW9A 3EVZA 1XCJA 5DM1A 3GGDA 5T64A 4MIKA 9MHTA 4BLWA 1XXLA 1SUIA 5CM2Z 4PCLA 4FP9A 4QDJA 3PX2A 2IFTA 3DOUA 4RVGA 3FTEA 3E8SA 1WZNA 3FTFA 2AR0A 3I58A 1JR4A 2IPXA 2VDVE 4V0RA 3G2QA 4K6MA 1R8YA 3UJDA 5EOVA 3FUVA 2H1RA 2WA1A 3M6UA 3P9KA 5EMKA 3GJYA 1X1DA 1DUSA 2WA2A 4GC9A 3FYCA 5DTMA 5EHGA 4RTMA 2O06A 2ZBRA 4HC4A 4M37A 3PTAA 3C6MA 3GO4A 5KQRA 3O31A 4XUCA 1OR8A 1N2XA 2P3LA 3BKXA 5CVUA 3CVOA 5GM2A 3PS9A 3KQWA 1RJGA 3MERA 3JWIA 1F3LA 2ZIEA 5CD1A 5DT2A 2PGXA 3UWPA 3MQ2A 5GM1A 3KQPA 3ID6C 3LHDA 4EMSA 1JG3A 4PWYA 1YF3A 4RSRA 4PYQA 3CBGA 3I64A 5IH3A 4DA4A 3EVEA 1VLMA 5FHQA 1JG4A 3CJTA 4H0NA 3TM5A 4CKEA 4E2ZA 1FPQA 1XTPA 3P9CA 5EPEA 5IKMA 2NXEA 4RTOA 1EAMA 2ZSUA 5K05A 3EGVA 4PGGA 2FHPA 5EKUA 4YUZA 1QAOA 4IV0A 3G2MA 4GOLD 5KVAA 1SKMA 1X1CA 1Y8CA 2K4MA 5CVDA 1ZHFA 5EZSA 1WY7A 2O07A 3KPVA 2P1DA 4MWZA 1EJ6A 3V8VA 3GU3A 3TM4A 5CIYA 4LG1A 3M33A 4X63A 4RTLA 3CKKA 3NWEA 4R8RA 4EK9A 3I53A 5FA8A 3MGGA 4XUEA 3EVBA 1YFJA 1FP1D 3OZRA 3CJQA 1O9GA 2ZZMA 3MTEA 2OB2A 4AZWA 1JQ3A 4QPNA 4PYJA 2UYOA 5E1OA 4P7GA
chains in the Genus database with same CATH superfamily
1ATZA 1J25A 1WDMA 2E5WA 2PKQP 5I9BA 4EABA 2JFPA 4WSOA 3I8XA 4L7QA 3AUSA 5HCNA 3NM5A 3QX3A 1K8RA 2X1HA 2OZPA 3DTVD 1E3MA 4YRIA 4YWJA 5JTUA 2Y67A 2RHTA 3QFTA 4JQYA 3NWJA 3CEMA 3PFHA 1UXKA 5C31A 3NRBA 3T1QA 2EX4A 4YP5A 3QYPA 3TFOA 1AKWA 3D4LA 1FX0B 1IN7A 1AKYA 3EYWA 1JHOA 4GI5A 4YUVA 3VDRA 1ZINA 2OCAA 1E6EA 1GCUA 3VR5H 3FHLA 2CLSA 2SCUA 5DWDA 3EZFA 3JQ9A 1RYZA 2CL5A 4UPEA 5IF3A 1KI6B 4UCWA 3Q8XB 4PZCA 3W3AD 2WFMA 2WTNA 3ZXYA 4W5TA 1IVNA 5L40A 3S1AA 3CO0S 3F6EX 1H6DA 1JF8A 5GADl 4KGZA 5BW6B 2HJ9A 2IIQA 2UUPA 4Q4HB 2VXBA 2EDAA 2VNIA 1E7SA 2VKQA 2Q4TA 3O1JC 3DF7A 1X1BA 3A1VA 4O1HA 5IT0A 1VLQA 2ZJ4A 4IEFB 3ZDDA 1SC3A 1U4NA 2BEUB 2C8VA 1UBNA 1PHRA 4C6SA 2RI1A 3RVPA 4BOYA 3GRRA 3U09A 1DKMA 1P5JA 4JVMA 1KO1A 5B2ZA 4IIGA 4XVHA 4BFVA 5I7HA 1DBRA 3C3CA 1F6BA 2ZWIA 3G9UA 1R9NA 2AB0A 2OZLB 1OLSA 1AF4A 1ESNA 1P1IA 3CXUA 4XX0A 1VGRA 3TZKA 1FFEA 1CS0A 1BMTA 1SC4A 2I87A 4N3AA 4EYSA 1R18A 5BN5B 4XFKA 1NP3A 4F4FA 2NZWA 2A7XA 4M6WA 1YS1X 3KEFA 5TB5A 5CB4A 1JSZA 4INZA 2X0DA 3V1NA 4RUKA 4WOBA 4DDHA 3M9XA 4B9EA 2AMYA 3G2HA 1B2RA 4LF9B 3UJCA 1THTA 4MMZB 4Z4EA 2VP3A 1P45A 1UIMA 5CG1A 3VBCA 5JJBA 5HSGA 2PT9A 4PNHA 4UXIA 3KB2A 4PLHA 4IDDA 4P08A 4CIBA 1AGYA 5A62A 1PS9A 1K5GA 3A4NA 4BMCA 3VJRA 3UCFA 5EC8A 3R4VA 1JG2A 3KB8A 2B37A 2QUAA 1G1AA 4NZYA 2GZAA 3KQKA 4IUYA 4B87A 4W82A 1Z25A 1ZM2A 4RXTA 1QHSA 3QKRB 1EE9A 4ZYZA 4KO4S 4C2AA 4YUXA 3HCAA 4JLWA 5LU9A 2FG6C 3AP3A 3C48A 3QUTA 4FVTA 4IDQA 3KLBA 4X3PA 3IOBA 1DHTA 2OMEA 2GPTA 3RRMA 2ZVQX 4L8VA 4TKUA 3H6HA 4UDYX 5D5PA 3KJIA 4C2BA 1USWA 4OQNA 4QTUB 3EZ7A 2YH2A 4TM8A 2P8SA 4RTRA 4H18A 1RHRA 1FYFA 1T29A 2Q5FA 1QB8A 1CUCA 5AKZA 2IXAA 3HDTA 2ZWAA 1GPWB 1SK8A 4OAPA 4AT1A 4LMRA 2FXIA 4EA7A 3HBMA 3WK6A 2RE8A 4PR0A 3J81k 2IH4A 4U1RA 2WNSA 1C3LA 2AFIA 1Y9JA 2DHDA 2QMHA 5AJVB 1F2VA 4HGYA 4LHVA 5BNZA 1AURA 1QJCA 1S01A 4RABA 1JHYA 1E2QA 2NAFA 4Q16A 2QTZA 5AVWA 1OT3A 2ZUBA 4GP9A 1IXYA 4R6WA 3AINA 3VXKA 4IYJA 1P80A 1EDOA 4P3OA 5F7ZA 4DLZA 1FTGA 2FWRA 5ILQA 3ZJTA 4MUGA 4IHQA 4JEMA 4CDNA 3IQZA 1E61A 5I7OA 1BU8A 7REQA 4LWPA 4JLMA 2I2CA 1QZZA 1L3IA 5CVJA 2HR1A 2WKRA 4HLUC 1XSEA 1ZL0A 3HCEA 4YJGA 1RM3A 1QF7A 2FZKA 4OCZA 2CDAA 1A7JA 5ELLA 1PLJA 2VH5R 1NC1A 2L69A 3AOEA 4W1SA 1G291 4H4DA 1QIDA 2GD2A 2O7RA 1IIBA 2MYUA 2QRHA 1IPEA 3ZWOA 4DCMA 3U9TA 3B7WA 1N5OX 4C0AC 3DFKA 2Q5JA 3A0RB 4HNTA 5D3ZA 3VPAA 4D7AA 4TYNA 1NLFA 2Y76A 4JELA 2ZXUA 4ZQEA 1GZ6A 4ZAZA 3M83A 1QIMA 1SZJG 1T35A 4Q3EA 4RFSA 4F8EA 3UHJA 4ZDKA 3EULA 1U1DA 1X74A 5KTTA 4AYXA 2QG4A 1D9ZA 5G0VA 4J1SA 3CUKA 2GJ8A 2WQ6A 1GTZA 3OU7A 3U7RA 1C9MA 1WNTA 2TYSB 3FTNA 1B26A 5BQ5A 4LRSB 4R1QA 1UUFA 2PXCA 2PIDA 3WC4A 4MVJI 1T6YA 1L7NA 2QN8A 1RE0A 5D00A 4GWGA 3BD8A 3T7DA 4O02B 3FWHA 1NOKA 1I2AA 4AN1A 4H6PA 1CDEA 3MWYW 4AUEA 5C53B 1JDUA 2QGNA 1NONA 1WSDA 2G9VA 3OQIB 3AUAA 3T7IA 4OUDA 3DEHA 1X0XA 1KHHA 1YL7A 3BTSA 2E6UX 4Q3NA 3QWHA 4AU1A 1FUUA 3ER9A 1KEVA 4RHTA 4C0WA 1W581 3L49A 2ZATA 5IXSA 2LTAA 3EDRA 2UUOA 3UJ8A 3A9SA 3EZYA 3SPXA 4LFBB 4B40A 1ADCA 5BWBA 2C4UA 3D8TA 3O8DA 3GJXC 5BV1A 4CG0A 3W05A 3G0CA 3LLSA 1KPIA 4FW8A 2ADMA 3JPWA 1TD1A 3AUYA 4GLFA 1G8KA 4GXQA 3SC4A 1PGPA 1J2JA 4Z3DA 4NAVA 4AF7A 4MDHA 4EY8A 1YI8A 2NSJA 5EJFA 3KYJB 2HMTA 4L9SA 3VHXB 1LC3A 1RRGA 3T3HA 5EUCA 1A82A 1JEYA 3ELDA 4WDRA 5T8KA 1V1RB 4CCYB 4YNBA 4RLHA 5K8VA 2XGSA 1ANKA 4QUGA 3VGPA 4C3VA 3TCNA 4ZJPA 3SM9A 1SIWA 3RAPR 3X1DA 4M38A 1F12A 2IEAA 2XIJA 3I9OA 1U6JA 1MXFA 4BQEA 3JARB 2I80A 3HCDA 3GUUA 1N5KA 2CLLB 4NTZA 2A67A 3ZNOA 2P2YA 3M6WA 3P2IA 1ST2A 1JTEA 1JYEA 1QBGA 4IXDA 4R8KA 2GSWA 2OA0A 2AD5A 2PSFA 5BR4A 5A0TA 4K87A 2FSUA 2HSWA 1Y81A 3VU8A 1I30A 3RC8A 3HYLA 1W1UA 2PUBA 2VH1A 3K1AA 5E9JA 1Z5PA 1ECJA 1ZEJA 5GOZA 2J9XB 3EIFA 4FIZA 4NOLA 3AERA 3AVOA 2JGLA 2X86A 3HR4A 1PT5A 2EBFX 2Z58A 3HHPA 4CM4A 4XCXA 3A36A 1T5SA 2AK2A 2PUJA 3I73A 4J0JA 3DC2A 4JHLA 1VMIA 2WFAA 1LVHA 4PPFA 3VFDA 4EB0A 1FUKA 3I6BA 3AU9A 4L8YA 5ELXA 1YRWA 2JHGA 2XUDA 2ZRIA 4JASB 2XECA 4DUPA 2YWFA 4L28A 3PJRA 3DE3X 2OQ2A 2X1VA 4JC4A 2WNHA 1Y80A 3COZA 4ENVA 2XCLA 4JP5A 2IHUA 4IJQA 1G20A 5JADA 2JRLA 2Z8XA 3AZPA 4RZUA 4XYMA 4OHZA 4HQOA 5M5BA 1KORA 1UDRA 3CN7A 2QW8A 3K72B 5IG2A 4ZI7B 2QLTA 4XDZA 2VAXA 2NOAA 1VL2A 2B9VA 2H57A 1FMCA 2CHGA 2CNWD 2FUG6 3NBYC 3PQCA 4X7RA 3W6PA 4BCBA 4O4LA 4WADA 3CH4B 2VA9A 1N33B 4OOFA 2QTFA 3IDFA 2FYTA 4UFOA 3DLHA 2JG3A 1O97C 1Y1RA 3IT3A 3VSEA 4BGVA 4F06A 3LQ1A 4QELA 1CUXA 1RPAA 3LBYA 4LVCA 4Q19A 3R0ZA 2BBSA 4TSRA 3F73A 1IVSA 1E0SA 4IFTA 1I3KA 4BO2A 4R9RA 3K20A 3MTBA 4B3JA 1YR7A 4D3DA 2GMWA 3BAFA 4WUTA 1IWOA 3H0EA 4PIVA 2Z04A 2YN2A 3HVRA 4Q48A 3K0FA 2J6CA 1X1TA 5HFNA 1EIZA 1D1TA 2DBYA 2AZTA 3BL5A 3ABQB 3D6TB 2D5BA 3IDOA 4LX0A 4BLTA 2ANBA 4O8CA 1EWRA 3I9MA 4PVDA 1VP3A 3M6LA 1VLLA 2CYBA 2YS6A 3MRSA 2Z3ZA 2BM1A 4PHCA 1ZESA 4QX6A 2RHDA 1WF3A 3E15A 4XIIA 2XYGA 3I2JA 1H6AA 2EC5A 1FFYA 1VKJA 1PCXA 1KO7A 2D5LA 1A3CA 2IXDA 3IUYA 3LDGA 3ICCA 3BFVA 4JU8A 5AKEA 5E3IA 5EQJB 1QKJA 4EITA 1J5PA 4ZT4A 3PITA 4WD3A 1MO2A 3PGKA 3L1KA 4TX1A 2IHKA 3FMVA 1WVGA 1P6QA 2R8BA 1LWNA 3ICQB 2IEIA 3IE2A 1VIYA 2IY8A 4XIFA 1U4SA 3SU8A 4DREA 3CZQA 3R2JA 3IB3A 4JT8A 3TFWA 1Y3CE 3G85A 5B2FA 4RTQA 2VJDA 2C83A 4KR7A 3ON5A 4QLAA 2XAUA 3E27A 2QVXX 1N2OA 2QY9A 2X2OA 3P2YA 5HF5A 5JT1A 3H2KA 3NPAA 3RSFA 3FJ1A 1DV2A 3NNDA 5JXGA 3UGTA 3GVPA 2XZTA 5EJ5A 2N47A 3PRJA 3OCCA 1OJLA 3VHQA 5KTYA 2G80A 4DR4B 5I8WA 5B1HA 1L5FA 1QHHB 1CWUA 2HJGA 3EGDB 3MXOA 4RF4A 1KE1A 4CT0A 4DUGA 1R0XA 3HBNA 4RGQA 4IO0A 3WIOA 1PWEA 4V0MA 4PQGA 5CH5A 4E07A 2JS7A 4LZNA 4L0DA 2BONA 1MQAA 5DNVA 5BR7A 4GLOA 3E70C 3NHAA 2XY4A 4NABA 4OI4A 2AZMA 5JMOA 3UANA 3VAYA 2H2WA 4YUYA 4YV7A 5K0GA 1MRSA 3TQFA 4Q9AA 2FFBA 1QE0A 1QONA 2A3RA 3RSZA 5K0BA 4ZCQA 2P9ZA 3AW9A 2DPMA 2ZIGA 3L7YA 3HRKA 2GK7A 5IZCA 1UZAA 1JALA 2IHJA 3FTDA 1BTOA 3KQVA 3ABSB 3PRYA 4Q66C 3W7VA 3HK2A 4MA0A 3EQ7A 1V9LA 4E5DA 1YIAA 4RFLA 4Q1EA 5A5GA 5EQTA 2HWXA 5BMOA 1D04A 4GI7A 2A5GA 3CSDA 1JHVA 2PMWB 2ZR0A 5E6SB 1UC5B 5KNDD 4MDFA 3LQ4A 4FGJA 5B7NA 3FFTA 3ENZA 4KFTA 4RLSA 3NOQA 3VV2A 4K6CA 4FCWA 5J43A 3V1TC 4UBLA 5EJ2A 1DZ3A 2IE8A 4X9XA 4Y3UA 2XUIA 3CX8A 1QZ3A 4UBMA 3F47A 4J7AA 4BZXA 2PJUA 2BF4A 5IUNC 1XI2A 3HQ4O 3S99A 4WXYB 1SQ0A 3CM0A 4JJAA 5DBEX 1U99A 2OFXA 3NHYA 1KDTA 1VJ5A 1Y3HA 3H3FA 4UHHA 5JLAA 3KV3O 5JFOA 2KYRA 5MN4A 1UBGA 1Y6RA 1WV0A 5ICSA 2H1FA 3E3LA 2Z5FA 4CR7A 2W2MA 3UBTA 1SVUA 2ZI4A 3TLZA 4R3WA 1D1PA 3JAMA 3H9UA 2ZU0C 6REQB 1Q84A 4HDRA 5IDWA 1WV1A 4MWTA 4B3CA 3C8ZA 3LUKA 1V5WA 5CNIA 4HWRA 2QM8A 3VGJA 2CXXA 2PT7A 3EJ6A 1SUBA 4WNAB 1L5HB 5TMEA 5AI9A 5JRDS 4PM4A 1I24A 4XX1A 2O8FB 4GYKA 2W2OA 1T3HA 5KNBA 3OF5A 2HJHA 4TLLB 3FFBA 2IPXA 2ZDHA 3O21A 5GONA 3W90A 4X44A 3VVCA 1GP2A 4NZNA 3KUCA 4RPGA 3I62A 2QDXA 3L8GA 3S40A 1Q1QA 5KCZA 2JGEA 5G2OA 2MJLA 3PUVA 1D8TA 3FYUA 5LBTA 2FUG1 1PVDA 2D8AA 1ARZA 2Q0SA 3RQIA 5FDFA 3AMVA 1ZMOA 5H70A 1PJ2A 1O0CA 4ZVSA 4G65A 4BV2A 1RCTE 2H9IA 2BMFA 3C41J 3IERA 2J08A 4TQ9A 5K7SA 1U9YA 3TX6A 1N77A 2QQEA 2WSYB 1HZZA 2EWVA 2JFYA 2LDXA 3CR3C 4HBZA 5BYBA 4L3WA 4H0FA 3Q3VA 4REQB 1W35A 3CJTA 1CG6A 1YS2X 5HJ2A 3RH0A 4ZEVA 3GW8A 5CT8A 4CMEA 2ZSUA 3NORA 1PWZA 4H6VA 2WFLA 4K9SA 3LPDA 4LISA 3LUPA 3ROTA 2B1IA 4ND4A 1Z5GA 2P5UA 4MCAA 2VNSA 1PF7E 2ZTSA 2YOGA 5AW9A 4FFOA 1E63A 1OGIA 2MT9A 4BVGA 4QDUA 4BJ5A 2GJAA 4XLLA 2O07A 4CVNA 5EWJB 3Q8MA 2VYVA 4MVJG 2I78A 1YDFA 2NQ8A 4RORA 1E6LA 4Y0AA 3ZI4A 4AECA 1BEUB 3MJHA 1G0NA 1Y42X 4Z5XA 5MDHA 5LQSA 1QIJA 1T2FA 4WZBA 3LQQA 3DQQA 4YEDA 1T5LA 1ZVMA 2G36A 4P4SA 4IR7A 4JEUA 3RS2A 3V8BA 5HJ5A 1MP0A 2Z9CA 3QIVA 1LDBA 1I6LA 3SLRA 3M0EA 3RC2A 1U9ZA 1XJ0A 3LVBA 4ZO9A 3G8CA 4ZI7F 4EEKA 1V3TA 4OGFA 4TKZA 1ZC4A 5EGNA 2GZ2A 1GGEA 4PSUA 1MB4A 5EKDA 1JR3D 1Q0TA 2H5EA 4CODB 1YZ3A 4YAOA 3C7CB 2C1XA 4FYWA 1THGA 1DL5A 4PLYA 2OUKA 1F2TB 4C7XA 5KUTA 4ZT7A 3K1ZA 1B3RA 1F38A 3K7EA 5JY6A 4R2IA 1TKRA 1Z22A 3FIUA 1DKQA 1QH8A 3L6BA 2YVAA 5C7YA 1QYIA 5FTLA 5KHAA 3K70D 2HT1A 4F4UA 5JOQA 1QX3A 3JQQA 4ASUD 4EX7A 4H7HA 1L7EA 3W7AA 1D2EA 3GP3A 4A6PA 3LPNA 1SZDA 2VWQA 4RA6B 4OMDA 1T8SA 1H2ZA 4GMHA 3RSLA 1HFEL 1TTHA 2EWMA 3TOSA 4EL5A 5HWSA 1CE8B 3BORA 3DMNA 2VHZA 1SCUA 4QE3A 2AMJA 2YXEA 2D0IA 2GEVA 3AEKB 2X6TA 3FDFA 1AGPA 1G2OA 4UARA 2XRYA 1M74A 1I3MA 2EQAA 2E0IA 2QQGA 3DNPA 2HK8A 1C3OA 2QD1A 3PXXA 1NMEA 3EMKA 4J3JA 5K8UA 4G0OA 5JNVA 2HF2A 4QGBA 2X0IA 4ZVMA 1OVGA 1QVRA 2ZIZA 3HGTA 5JWOA 3JASA 4DBVO 1GV0A 1SCJA 2JFBA 1NVGA 4OHVA 4K9KA 4KE8A 4QGHA 1ZHHA 5A7HA 1T9HA 1IHDA 2L2QA 1U80A 1WXWA 3N53A 1A04A 3VUFA 3RODA 2VPYA 2GBGA 4KMSA 4Q9NA 1LGYA 3W0LB 3UN1A 3UMCA 3FFXA 3MELA 2JK0A 2W2PA 4W5JA 2Q6KA 3HJRA 3OFKA 4LW8A 4BAZA 1JPJA 1TKCA 3BXFA 1GTVA 1VXOA 4LXHA 4UCXA 3WMGA 4TXMA 1AA9A 2NVUA 1WB4A 3GNSA 2ATXA 5A4KA 1ZUIA 2WMNB 5H5JA 2IV7A 1PJCA 5T3YA 5CXQA 5KMGA 1N36B 1HL3A 2H08A 1HOXA 1W47A 2FN8A 1UMKA 4XPZA 2ZRDA 2Y2UA 1XVAA 3SBOA 3AJRA 2EHJA 2PX6A 3Q41A 3VVBA 3OT5A 3L0IB 2P0AA 4YRZA 3A06A 3LQ2A 4Q3CA 1UJMA 2XWSA 4L75A 1ADYA 1BS9A 1CQPA 2RFLA 4ND3A 3BILA 3SC2B 4EHBA 3AV3A 2J4FA 5DGHA 3MW8A 4W1PA 5EERA 3KKKA 5TMPA 3WP0A 4DAOA 1IUNA 1R4AA 3B7GA 1Q77A 2DH6A 3TTTA 3PEWA 2HGZA 2IS4A 4BX3A 1AK1A 3OM0A 4H08A 1KY2A 1WL8A 3FUWA 1N8KA 4B47A 5LPNA 2WTBA 1KEZA 1BWRA 1G6Q1 1Q3TA 1YU9A 1E5DA 1WXQA 1UOEA 4JFRA 4N7MA 4YXFA 4BKMA 3L79A 4E2XA 2O2IA 4O2AA 4EG8A 2I62A 3AKYA 4BWVA 2J09A 3N9IA 4OHPA 3EHEA 3B3JA 5FTNA 2RHBA 2VBCA 1KMNA 1MC8A 4E7OA 2DMRA 3DR5A 1WY5A 2J0QA 1CQIA 3IP1A 4IZOA 1YC2A 3IJEB 1ISSA 4TUYA 2FW1A 3I39X 3HCCA 1W85A 2FY8A 4CHTA 4Y6OA 4Z4CA 5JJ5A 1IJEA 1OPXA 2IIPA 1DAPA 3A6DA 3KAKA 4I3GA 4M9CA 4S1WA 4CMIA 3A1SA 4GLLA 5B3AA 2IS6A 2DH5A 1GG5A 4DLXA 1X1SA 1YKGA 2QI9C 4FZVA 5CA0A 4BKUA 4E03A 3KE8A 3L7NA 3F3YA 4U7PB 4LRUA 2ETXA 2OGUA 3QK7A 1E1QA 1A72A 2I1WA 3V48A 1PX2A 4YXWD 5C8YB 3GB9A 3W1EA 1QANA 4D0LB 1E2FA 5JZMA 2WT8A 1KSGA 1AHHA 4YCAA 2P6MA 4DLUA 3UAOA 3U4MA 2DTEA 1Q11A 3A4VA 2F1HA 5ELMA 4X20A 4QEDA 3B8EA 1QJ4A 1OHHA 1XEAA 1WEHA 1YJ5A 3KAQA 2BDEA 2R48A 4BNHA 4CETA 1SUDA 4WUVA 1K4KA 3RNOA 3TEFA 1TNDA 3KLOA 4C3OB 1AZSC 3I61A 1OXTA 2G5TA 3S0JA 4DMKA 1JHXA 3Q9LA 1NW3A 1ZA1A 1F0YA 1NQXA 3S44A 1R6XA 3V7FA 5B3JC 2HB6A 5KVSA 5T4FA 1GAXA 4OAOA 2GPAA 2FEXA 1L5GB 1EK2A 1OIVA 4KXXA 1LSUA 5E1MA 3KM0A 3OQ1A 2JFWA 5KHLB 4ARVA 4E5UA 2CXOA 1G4AE 2BEJA 5E4YA 5CT9A 1TZJA 2FFRA 3HU5A 3AEXA 4Q3KA 4WBSA 1OPRA 5DGIA 2O5CA 3NGMA 2ZT8A 1EFTA 3O1IC 4Q01A 3S2FA 3UF0A 1D2AA 3U0BA 4AL4A 4TMFA 2AJDA 1UEIA 1KO5A 4B33A 3GCGA 4IVQA 2JDID 2YJGA 3TSZA 1QGYA 4D0RA 5DNCA 2ATCA 2ERCA 3R0JA 1BFDA 5YASA 2Y1XA 3K5IA 4DR5B 1ZONA 1RXWA 3JU3A 1G66A 2QGFA 3OHPA 4R31A 2X5OA 3QE0A 2BE7A 3W8EA 9GPBA 5DLPA 4GC5A 1JYFA 3RVMA 1PLKA 1CIPA 2GCNA 1A0OA 2J3LA 3O8OA 3OPYB 1OA1A 1F14A 4M98A 4ZYTA 4TMTA 4Y2HA 1TK9A 4WZAE 1MIHA 4MZDA 4RD3A 3WWOA 1XG5A 3DDHA 3NHPA 4JLUA 3KHUA 4XQEA 5FFNA 1TAHA 3RKRA 3UT5B 3MB8A 1I5EA 3DMTA 2C3UA 4JP1A 4YFVA 3F8TA 5E1BA 5E7JA 2JASA 2ZJ6A 4YTEA 2V1XA 1XOIA 4QODA 4AJEA 2E4VA 4ZODA 3NI2A 3RU9A 1CR0A 1XDZA 1Z12A 3C7AA 1EUYA 3H2BA 1U31A 5JC1A 1MB0A 4JYMA 3L8HA 3TNDA 1T8WA 1SBZA 1ZD8A 2FE1A 2OBLA 4RENA 2DFTA 2IBSA 5F9MA 4KH1A 4QUKA 2PZ8A 3CRZA 3PUYA 4WY2A 1KI4A 2PZMA 4YJDA 5BRAA 3PD7A 2AVNA 2ST1A 1WRBA 2WT4A 4IG4A 4QQKA 2G9NA 4XAQA 2ACEA 1P91A 1NY5A 3K4PA 5AM4A 3EGEA 2ZZKA 5JNUA 4LVNA 4IRXA 3OEWA 3MB5A 1QDEA 3UIEA 3RVDA 4MJ3A 1KI9A 4X97A 4ENQA 2I9PA 2J6HA 4O29A 3KPUA 5BYAA 1SY7A 1TL7C 2BW0A 3CJRA 2M9MA 3SLGA 4I4NA 5CYGA 4JXXA 1XYVA 1LRJA 4N9WA 3FJOA 4I9FA 2Q1UA 2HWKA 3LCJA 5A0FA 2Z6AA 4KWHA 4IVPA 2VFAA 1OLUA 2INGX 2OE2A 4ON9A 3U4HA 2QX9A 3J7TA 4WH0A 2ZUFA 3VR4H 1GJRA 2ZP1A 4XRRA 4XTRA 3AK4A 3A4LA 1E3LA 3NOVA 1FMFA 1ZAYA 4I50A 1VJ1A 3K9FC 3DHEA 3TLKA 3EZXA 2YKGA 2JFOA 2Y1KA 4M1EA 1F2DA 3ED5A 5IKEA 1LQTA 3LWBA 4DCCA 1R16A 1T36B 4ZVVA 2R1VB 5EJEA 1JT9A 2XDQA 2Y3IA 2Z2ZA 4PLZA 3ZNNA 3LDHA 4GOMD 2VUUA 1PZGA 2YR0A 1MJNA 3IE1A 1JWLA 1BRMA 1WMFA 2DVMA 1U3WA 2ACKA 2IC5A 1TLLA 3NASA 3IVGA 4QA9A 3OOSA 3WHIA 3LLUA 1X80B 2ZBUA 1QFYA 3CNQS 3PWZA 4B3SB 3EK2A 4LTMA 1RMTA 3RTBA 2I8AA 2WAXA 5ER9A 3ZK7A 1NXTA 1E1CB 1LTKA 5KQSA 1N6NA 2A35A 4MR7B 1OVMA 4Z0HO 2RSLA 1QLWA 2ZKLA 5COQA 721PA 1N5MA 3WZLA 2YMLA 3U9LA 2X8LA 2G70A 4P81A 4LF6B 1DDIA 3EAQA 1IQRA 3TKAA 3TLGB 4TMZA 1OKKD 1UFQA 5KPJA 3LQYA 3NAGA 1E7RA 3NLLA 6NULA 1P19A 3NIDB 4HDSA 3X44A 3WMWA 4C7BA 7REQB 4P82A 4LI3X 4LF8B 3VPGA 4K9MA 4KIFA 1U8AA 1OC2A 3P0EA 3GD7A 4NE7A 3B1ZA 2KS6A 2JGIA 3L0DA 5G4LA 3SHWA 3UV6A 1AHPA 1E2PA 1E1KA 4HH1A 1LJLA 3MINB 1BHO1 3NXSA 4WVLA 1U0JA 3GOQA 2ZE5A 3CISA 2W8BA 1UFRA 3RAEC 4L4ZA 2ZOSA 2W5UA 2IYTA 1FXSA 2NUPB 3HFGA 4CM8A 3IPAA 3TZEA 1OF1A 3HA2A 1ISFA 2XUPA 2ZJ5A 1RHJA 3KZKA 1X9HA 5AI0A 5E2BA 4V39A 3VH4A 4P3NA 2HRRA 5HM6A 4FZJA 2XV1A 2QTCA 3O5AA 1E18A 1PYDA 1RJ9B 5CLLA 4YAIA 2R4TA 1NWCA 2CW5A 3KR9A 2YS7A 2NXCA 2PN1A 4KN8A 4OQMA 5L3SB 2NMVA 2OV2A 1SULA 4GD3Q 2Y68A 1ZN7A 3C5CA 4BN5A 5GVSA 3PHGA 4YRTA 3VU1A 1O89A 3EARA 4G9GA 4I3HA 4OHUA 2P6OA 3HXQA 1F8GA 1U7DA 2O9JA 3CTPA 3IQEA 3F4KA 2PD6A 5C7OO 1URPA 3LPCA 1H0KA 1PEYA 1GDHA 3A14A 3FJYA 3LC7O 3PJFA 4MIYA 3FPAA 4MPRA 4QWMA 1G8FA 1QF9A 3E8MA 2JLAA 1KE2A 4TQGA 3ZDBA 3VZQA 3OE5A 2O54A 2XUOA 3ONEA 3VH2A 4G0NA 2H4JA 3G3EA 4RLQA 1PTKA 2X2EA 2GJ9A 4IIYA 3WDLA 3ZE0B 3JALA 3ZNQA 2WU0A 4D4JA 2GH1A 1W96A 4NF2A 4O59O 1HG1A 4AJ4A 1GPH1 1XMXA 1Q20A 5C8YF 5JNSA 4KDCA 3BGDA 3I9NA 3DDUA 1L0BA 4IH9A 3WIVA 2FMXA 5HK9A 1B6TA 3CZ9A 1SHZA 2EARA 2OCPA 4II2A 5A3SA 3WO1A 1P9WA 2C7PA 3PQ4A 1USKA 1K1EA 5A04A 3L01A 4FWBA 5J2UA 2EIXA 3PNYA 1MOQA 2ZQZA 3WJ1A 1CQWA 1U0SY 4CW7A 2QD2A 3IKLA 1OC4A 1VA4A 3JSAA 3LSYA 3I9V6 4AI6A 1DBQA 4XI9A 1Z56C 1A97A 3KUUA 2Z5LA 4NBRA 3HV0A 3L77A 2PV0A 5B6JA 5CFPA 1ZOOA 3FLBA 1SNYA 2WJ6A 3HKBB 3RJ9A 2WIJA 1C30B 2WPDD 1DC5A 1KRHA 3AUJB 5JATA 2DQKA 3I28A 5JCJA 1DU4A 4ZOQI 2VKTA 5D3KA 1V6AA 2XRZA 1LTQA 2GAIA 4PSCA 1Z0AA 1R4MA 3VZSA 4L6IA 1J2RA 1NVWQ 4I4LA 3WGNA 5CJPA 4ZDJA 2EFDB 2X6QA 5EP3A 5B1SA 1LRKA 1Q2XA 3AB7A 4EVSA 5IH7A 5DLQC 2FPRA 1Y1PA 2Y9PB 4JYPA 2P77A 4QGGA 4EB6B 1C9EA 2P91A 3WBFA 3GT0A 2P9FA 3QTTA 1A4RA 5IBQA 2K7ZA 1E2IA 4RKFA 1CDDA 3FGPA 2ZI7A 3T99A 3TLEA 3VVMA 4M86A 2HSZA 3KU4A 2GNAA 1F60A 2QBYA 5G3ZA 1IDN1 2OZKA 3L18A 4P5PA 2H18A 1CY2A 1DB3A 2C98A 4C30A 1GXSA 1JIJA 2JAXA 3OBBA 4Y2RA 1MENA 3K0AB 2IK8A 5AUQA 3VI3B 2YJ3A 4CMAA 4BZWA 5BSKA 2CL0X 2ZSEA 3CYFA 2NXWA 4N4AA 4QTXA 3L4KA 3PWTA 3WKCA 5JS6A 1RQPA 3E23A 2RJNA 3W34A 4B7UA 1DXYA 4D42A 5B3LA 3TXXA 4NCJA 4YACA 3ASUA 2WHPB 5G0TA 5JYEA 5B12A 4Y6LA 1WABA 4XB2A 1QR2A 2ZRLA 2VPPA 1DT5A 1CX9B 2R6JA 4QDTA 4J76A 4LYDA 1FYDA 3VYRB 4U7HA 1EP9A 2GD1O 2WHEA 2ZANA 3NU1A 4LGMA 4TWJA 4C4TA 2QN1A 4DY4A 4FYVA 2W0SA 4QNMA 4RLFA 3MS7A 1VPLA 1SUFA 4F5YA 4BO3A 4IDFA 4RCZA 3QLEA 4GRIA 4MRPA 5E4FA 5EE0A 3T3EA 4DGQA 5KSPA 4L6CA 4B6JA 1TRHA 3UMJA 4MVJD 5JAIA 5KOJA 2UU9B 5KOIA 4J0DA 5JPCA 5TQ0B 2OCKA 2GTPA 1HEUA 2PH1A 2VA8A 1BW9B 1EA5A 2I3ZA 3EOBI 4IIJA 3SVTA 1E96A 4LQDA 3VKVA 4BKPA 3KQWA 3PPVA 1O57A 1I1OA 4R1LA 3PA6A 2JFNA 3NDPA 2ZYRA 3T6KA 5B64A 2AI3A 2MR6A 5I9NA 1CVRA 1CUHA 3AL2A 4Q4CA 4DCVA 3JATB 1NQAO 3EF1A 4HF7A 4D3SA 4GMGA 2R7LA 1R4NB 2D59A 2JRCA 2DPYA 2V45A 4KVGA 4F6RA 2UUBB 3V42A 1T9CA 2JFVA 2J5BA 4DMCA 3RR2A 1KYTA 1ESZA 3M5WA 4D43A 1FCJA 4JUDX 3IV7A 5A9SA 1NF2A 4ZCIA 5GVRA 2YWRA 1AGXA 3I2HA 3PP8A 2QRQA 4K9OA 4X90A 5AKLA 3A9TA 4UTPA 2VRNA 2ZR8A 4KPUB 1UDAA 2WTEA 3PFIA 4M9SA 4Y9DA 5EWLA 3UAGA 3YASA 1DEHA 3RWBA 1EH5A 4PGFA 1Z7BA 3FH0A 3HZZA 3OE7A 5BN4B 1XLTC 3WGIA 1NMZA 1GG8A 2YNMA 1E4EB 4XB6B 2CEAA 4ZVRA 1SB9A 1JHZA 4IFBA 4Q21A 3W4JA 1SU4A 2XEXA 1CUWA 2VF2A 4EPTA 5JSZA 3L8ZA 1N2JA 3BH6A 1UFVA 4IVRA 1ZFNA 2J0EA 1KRWA 3AL0C 3CZRA 3WIUA 4CQLB 3CT6A 5FBHA 5HFAA 3HWRA 1EVZA 2UZIR 3TZQA 2C4KA 2FPGB 5FWXB 1Q14A 3GVIA 1NNUA 1A4XA 1W4AA 2ZIXA 3PUHA 4AZ3B 2B4AA 1HI9A 3QLVA 1Z34A 2GXSA 3EG9B 4NOJA 3RYFA 4A7PA 2WJHA 2EGUA 3KEGA 3GRUA 1R8QA 3NEPX 2NW6A 5ALJA 4A91A 4EHHA 2FQYA 1I9GA 2O59A 1SQGA 3I6QA 3I9V1 1ONBA 4J1NA 3VC1A 1ZD5A 3QJ5A 5J5CA 1G7CA 1OZHA 3WOHA 2BFAA 3FF4A 3PVCA 1A76A 1BFKA 2CVHA 3EQ8A 1FTNA 5KVVA 3ESCA 4R4JA 3KNZA 4ATNA 1LF5A 4GMXA 1FYEA 4EHFA 3W5JA 3EQZA 1FDSA 3U17A 2V3WA 1NXVA 3MQ4A 4PLVA 1P0IA 2IVFA 3TGWA 3O3OB 4PIPA 5FPPA 2ISQA 1ZH4A 1DUVG 4WK0B 4G8BA 4G0VA 1RLOA 2CVPA 2XUAA 4BJ6A 1RLMA 1TCUA 1NJGA 3EEOA 1KI1A 5JCOC 3WWDA 5JO0A 1AZWA 1TM1E 3JQFC 1Y4DE 4OUKX 3PYLA 1J2UA 3CWCA 4MHSA 5CHYA 2XUHA 5ENZA 3ZKWB 1V5IA 2V7UA 2A4MA 3E7PA 1A9YA 4E4YA 3MHTA 1H23A 3RKSA 1CEYA 1IRIA 3G5TA 3IOEA 2G07A 1AIPA 1QKIA 2F1JA 3TLMA 4F91B 3GCDA 1E0JA 3WO0A 3EOAI 2PUCA 1II8A 3EG5A 4UAUA 1T10A 3B6JA 1Z37A 5ARCA 4N5DA 4N5HX 3GA7A 5K0TA 3KWLA 4C04A 2QZPA 4L5JA 3VMMA 1XTIA 5JMPA 5KREA 4OQLA 1ZGAA 3G0IA 2XVYA 3TNYA 4B7ZA 2OC4A 3V1YA 5DU2A 4BGEA 1TIBA 1S1CA 1B3BA 3N58A 3G2OA 3G2LA 2GN1A 3K1JA 2XTMA 4C0QC 3K6KA 2VT6A 5DBFA 4BP3A 4CM9D 1YFZA 1U3CA 3NX4A 4KUHA 2F67A 4YJKA 3M4XA 1SD5A 1VQ1A 1XVTA 2PS3A 2HHCA 2Z09A 2HUPA 3BD7A 3G5AA 3VZRA 2G4LA 4A03A 2HZBA 3PX3A 2G71A 4C78A 3EAFA 4NBLA 1LFAA 4TVOA 5JO9A 1OFUA 1PFKA 1P2FA 4TV9B 2CL7X 5TXGA 2RGNA 2XUKA 1D0IA 1ZH8A 2X4GA 3EEQA 1Z8DA 4US1R 2OAGA 1KMHA 2EJCA 2NTJA 4OJQA 2IUYA 4M0KA 5K3OA 4L95C 5FOQA 4RF2A 5SYNA 5KJFA 1NG9A 1N7GA 2GCEA 4HNVA 1OCEA 4I9UA 3A7DA 4NS1A 3G17A 3P9XA 1UFKA 4A4DA 3DLIA 4M22A 4RVHA 1RRPA 3GRKA 3H9CA 4I55B 1DAIA 3M6FA 4M0FA 3ZG6A 3BRWD 2HRDA 3RDPA 2CUTA 3M4ZA 4GKAA 4HRYA 1PE0A 3F0TA 4L6AA 1VE1A 4ISBA 2OGSA 2E37A 4P32A 3OIDA 4RIIA 4OQPA 3SEAA 4JP2A 3BZUA 2BEWB 3A3KA 3DE6X 4GI1A 1JP7A 2J3QA 3AILA 3K16A 2FSVC 4YROA 1XTZA 5JSFA 4DMHA 1LK7A 1SKUA 3GMTA 4BIIA 5H3HA 1Y3FE 4WINA 4P7KA 1BCRA 3C2QA 3CB2A 1CUFA 2UVDA 3I34X 4BS9A 3A70A 3JQAB 4JLSA 1UL1X 4C7VA 1U94A 2DE0X 1L4NA 3ONFA 1M2FA 1LQ2A 4MGZR 4O2BB 1KWGA 4HYQA 4QU5A 2PS9A 5EA2A 3EOZA 3ZHUA 1S02A 2IZ6A 2ZYHA 4LDJA 3N70A 2BSAA 4ZAGA 1EZ4A 1DPFA 3P9YA 2PD3A 5C4MA 5K6AA 2O48X 1AUPA 1Q15A 2ZYAA 2PNJA 4BRZA 2YQZA 2FRXA 1I51A 1ST3A 1QLHA 2XCUA 4UTXA 3TTWA 2CV0A 1REQA 1NBIA 1YE8A 3Q1LA 1V2HE 3QNMA 4QHTA 3D8BA 2BR3A 5COAA 4BV8A 1EFLA 4LMPA 3TXAA 3CPSA 3FHJA 3AR3A 5SY9A 2RHJA 5HKKD 1R9JA 1TFUA 4GZ5A 4N7JA 4HQLA 4MUBA 5TGTA 4OSEA 4N1AA 3TVDA 4R9SA 2HV8A 1D2GA 4YJHA 4H6WA 4PLPA 3LPLA 4AS1A 3GEHA 1U7OA 1U0RA 2BKXA 3MT9A 2D3TA 2IF2A 2W6PA 3KR2A 1GDDA 3ZVKA 3GEDA 4LQCA 1Z68A 2OXEA 3CH7A 3HA3A 1XL0A 3NHJA 4DC0A 2GKSA 4XQ0A 3I5UA 2A9RA 3KJNA 5HKAA 5EP4A 4X8LA 4B0PA 3TK1A 1BKYA 2R7MA 1RJDA 1YL5A 1W75A 2JJMA 2LIVA 3GG9A 3E03A 1ODIA 1VE5A 3HNRA 4TS9A 2V55B 1KF0A 2BHLA 2VF7A 3JAKA 3LOUA 3WOVA 4ER5A 2QZ4A 4XW2A 3EXEA 4P4TA 5EAIA 2EP7A 4PHTA 4DG5A 2VDUE 2E5FA 5CURA 4B74A 3UTDA 1YGYA 3JZFA 3N0TA 3R6GA 3E82A 4PRZA 3TR6A 3U6BA 2Z1NA 4R51A 5DB4A 1V11B 4NYJR 4LE0A 1M1YA 3AESB 1CB0A 2Q1WA 4UNRA 1S96A 4AY2A 3LC1O 3DZ8A 4JJEA 4OP2A 2PY6A 3E35A 4LFCB 4DKJA 4YJ3A 5DSXA 5E7QA 4DCPA 1SBNE 4F5EA 1H6CA 4JJGA 1MHTA 5FBQB 4DS3A 4O5AA 4DLWA 1TEXA 1E79D 2H65A 3T9EA 2DERA 1ZI9A 3BMNB 2OQIA 1ABBA 2R8RA 3PQ8A 1SQFA 1L7OA 1P4AA 1V5GA 2OL4A 1AKTA 2CEKA 3KYDB 4ZOLB 1MEJA 1ZKMA 4HG2A 5ICCA 1BVHA 1O7JA 4C4YA 1ESCA 4Q9LA 1Q91A 1VKRA 4KXFB 3DOEA 2JJYA 3QQPA 4BQNA 2X23A 4C87A 2JAOA 3F6PA 1NFFA 1YMQA 2VNKA 4FOPA 4UKDA 2FK7A 3T1OA 3TR0A 5DGTA 5ALEA 3VI4B 3STTA 3C6KA 3GZNB 4JGGA 1U6IA 1UIRA 2I3DA 2V6BA 3EY4A 4K6FA 3RTEA 2CN1A 2XUQA 3HYRA 4RF5A 2Y0BA 4ZO7A 4MARA 2HU7A 3RHSA 2G09A 4HB4A 4KREA 3RSQA 2E21A 3JWJA 1WCYA 2VHVA 3LRPA 1CEQA 2GN9A 4AP6A 2NUAA 3Q0IA 2C00A 4J0KA 4FHCA 3MBOA 4KNVA 4QUEA 1L1FA 4EARA 1DBSA 3JD0A 4KSBA 2NUBA 2JH8A 1IHYA 3L7JA 4PFSA 3I04A 5HIKA 3QA9A 5L51A 2DWOA 3QZUA 4UXJA 1RADA 1LPSA 4FYYA 4LJ6A 1XO1A 1EQ2A 4BWGA 2WZQA 3DAHA 2Y6VA 4EELA 2IBTA 2OBYA 3FVQA 1A69A 1E7YA 1RCUA 1W4BA 3ASZA 3DOJA 4CM3A 1M6YA 2V9CA 4PN7A 3OZXA 2QYTA 3RADC 4KTVE 2ONCA 1XWIA 3D7MA 4K05A 4TUYB 3K6SB 1W85B 3SC3A 4NP6A 4YMVA 3LFHA 5HXAA 3QEAZ 2FAXA 4CMIB 4NE2A 1M6EX 3RUEA 3S7TA 3PC3A 4CL8A 4CLDA 4KH0A 1W2WB 2PS1A 4UAGA 4Y6QA 4EHKA 1K63A 3IP7A 5CLQA 3KHSA 2HHAA 3LW7A 4W5OA 4NYJQ 2QRZA 1PL7A 1KDPA 3PEUA 4O63O 4FLEA 3UYLA 1FQOA 3PPXA 4GDFA 4RK7A 3EIQA 4N3BA 4BBPA 1E77A 3K31A 3Q9SA 3PEEA 5KYTA 2EFHB 4WN9A 4M99A 1H2WA 1E9RA 3SFZA 1ZVVA 1P1CA 2UYHA 1PQYA 1XNJA 1RQRA 1E89A 1WHSA 3D1JA 3LJKA 3PGLA 3UMRA 2ZJ0A 2BFFA 5MHTA 2Q07A 5GJWC 3QUCA 4ECAA 2HHHB 3GCXA 4RH3A 4KPGA 4J3NA 1OGYA 2BI4A 3P2OA 1HMYA 1M1XB 2QYSA 3QF7A 3MUFA 1UBHS 1BE8A 3KPJA 1JBQA 3DV0A 3GFRA 3KYBA 3UKJA 2V3CC 4EHLA 3B2NA 3L0BA 4BMXA 4QPPA 2P35A 2LPMA 2HLNA 1IG3A 4U2BA 3NTVA 5BPFA 3A04A 3WAGA 1KFBB 4WLEA 3NBMA 4EW2A 4B6FA 4LY3A 4WKCA 3RASA 3OF3A 3PICA 4BNKA 1NLUA 1NDHA 3BTVA 3OEYA 2I4NA 3E7WA 4EWLA 1UT6A 1HV8A 2GA9A 5AW5A 3I01A 4TV9F 1SAYA 3M3DA 1ZX1A 2BJVA 4QYSA 3SYRA 1PL8A 3GJRA 2IYXA 1GZVA 2YFKA 1U8FO 4G3XA 3ZNPA 1W36C 1C8KA 4FHEA 3N2GB 5DI3B 4GSLA 4LECA 1NT4A 4I1YA 4MV9A 2W70A 1TIKA 3RYCA 4I55F 3MWJA 1OWLA 2V6MA 4YONB 1RAIA 3JR3A 2A1UA 1PZMA 2BGNA 2HZ7A 4EI7A 3CF4G 1E2JA 1W5TA 3P0IA 1C9DB 1KDZA 4DARA 5CG2A 2IZ0A 3OZDA 4M0UA 4FKMA 3V55A 4F84A 1PX0A 1EX7A 2QI9F 3WB2A 1MC5A 3H8VA 4YAGA 1WETA 1PS8A 3SF8A 3FTCA 3FCUB 1UMCA 4IHJA 5HQ3B 1E64A 1QMPA 4HNGA 1KNXA 6ADHA 1XT6A 4NH0A 1KAHA 1KK0A 2E4XA 2H2GA 3NIGB 4O2BF 3I37X 3PUWA 4DPKA 4YCJA 3QG5A 2HSEA 3B51X 2PUGA 4AY3A 1YJBA 1PQ4A 2AK3A 2O05A 2AR7A 4G6ZA 4LN1A 4WRRA 4WBNA 1GG2A 4ARBA 2X22A 4L22A 4BMOB 1XWWA 1Q6ZA 2FWJA 1KS2A 4PQEA 3EH2A 4K9NA 3WYGA 4AQYB 2Q4RA 1XKXA 4AWXA 1MQ8B 2V98A 3V6LA 2V7XA 3DXXA 3P2JA 4DGSA 2R00A 3QVMA 4Y2QA 4EFNA 4D02A 3LM8A 1N0VC 3KJQA 1FYVA 1GZDA 4WK2B 3DTYA 4GG1A 4OK6A 5F1YA 2AXPA 5AM3A 2ZBGA 4RVUA 4N12A 2OPHA 1Z18A 1ZKDA 2K2WA 1Q7GA 8AT1A 3ACDA 3LOPA 1E58A 4U9IS 1SN7A 5LN1A 3MD9A 1F4PA 1YI0A 2Z3VA 1N6OA 3U13A 3AXTA 4QOIA 1ETHA 4LJ7A 2JLWA 1K3FA 4ZPJA 4HYYA 1P1BA 1WPGA 3BXEA 1YOVA 3OBIA 1Q3HA 3ZVRA 3V8EA 2HFKA 1MXHA 4D56A 1E8DA 5KDLA 5TGDA 2C04A 2ZSBA 4LHSA 1SC9A 4G5YA 1ULAA 1ZJ4A 1XK6A 3IC5A 1NQVA 4ZZIA 2NXJA 5L9AA 3USES 4DVJA 1GU1A 1XUOA 2RHCA 4S04A 1UOOA 2M2IA 2H1VA 4GXRA 4KYTA 5EY5B 1XCGB 1M76A 1T8RA 1SCIA 3LK6A 5FR1A 1JHDA 3D3WB 2ZIVB 3T7CA 1A5SB 1CY4A 2Y0CA 4CKYA 4L02A 3MM4A 5KAMA 1QGED 4MUXA 1X1AA 3TDMA 3SQLA 4XWTA 1QAQA 4FEEA 1JTFA 1FE8A 1VHLA 1SVIA 1U8UA 1XTVA 3H6GA 3PHJA 1T2AA 2XZDA 4QUJA 3TEMA 1HETA 3L0PA 4I1SA 4ID3A 1SUCA 2B6NA 2P4HX 1SBYA 1GFWA 1ZCZA 4TWRA 3NPMA 4ZOLF 2EW1A 4DRXA 3T9BA 5F98A 3D9QX 2H54A 2J67A 3L7OA 3GLFE 4HX5A 3QVXA 5IAOA 2H1LA 4P5EA 4RAQA 4JLDA 4QU8A 3B8HA 4GRAA 4FFRA 2ZSDA 2OMKA 1GTG1 1F2UA 1WZNA 4MUAA 5JWHA 4M55A 4FLFA 3ZQ4A 2FOIA 3GLIE 2PUAA 4J0IA 3KCNA 4CQMA 3OLZA 1AGNA 2Z2IA 4AZWA 3OETA 3N1UA 2WA2A 5CT4A 3ZQKA 1GL9B 4CKEB 2HQ1A 2ZB8A 4V02A 2PKCA 1FXWA 4DV3B 1OILA 3WYBA 5KZMB 4QBGB 4JROA 4QJ5A 4OFBA 4PQFA 3DHNA 4ZD6A 2C97A 2FW8A 1YNSA 3HJCA 4OU4A 5AKYA 5FEMA 5I45A 2JBAA 4D3YA 1VSTA 3EZ2A 2VATA 3UWSA 1XMVA 3GBPA 4OG2A 4BO5A 4RPJA 3SBDA 1GGKA 3X1ZA 5IT4A 1GVNB 3AETA 1P7YA 1Q0HA 1Y3DE 3CF2A 4G86A 4JDPA 4TUYF 5ECWA 1PJTA 5HUJA 1T8YA 3OOEA 3UG7A 3KALA 4WXPA 1QO7A 3LTNC 3FHOA 5EKUA 2FMKA 3H5LA 5LUAA 2J9FB 1TEHA 3OCUA 4PTZA 3RRBA 4YY3B 1NXXA 4CIYA 2GPWA 4R5MA 1OIXA 2XAAA 4R2HA 2J6IA 2OV4A 2EAUA 4KN6A 2GEUA 3LZ6A 3OCZA 2WJWA 3S5JA 4XJTA 1ILEA 1SU8A 3GVCA 4WGFA 3HRHA 3HY3A 3AX6A 1HFKA 3U9SA 3FCOA 4ZEWA 5IN5A 1RZ3A 4WZZA 3C8UA 4WOCA 2GN6A 4BMDA 4GE3A 1L4BA 1P0FA 4ZTUB 3FYHA 2R25B 2OCLA 1LTHR 1NLZA 2OQVA 4EEXA 2VVTA 1USIA 2Y05A 4JVOA 3SS7X 2CMFA 1QG2A 5SYAA 1CUDA 3IUSA 3OTWA 1XRRA 2ZI3A 2HA6A 1UJ6A 2COUA 1UH5A 1MLDA 1EDDA 3PE6A 1MIOB 3DD5A 3FZGA 3REQA 1TK3A 3MUOA 3QMMA 1QK5A 4J4BA 1Q0RA 3ZBPA 5T57A 1KDOA 1HE4A 1W5EA 3D6FA 4NULA 5JVDA 1W59A 4MS1A 3LD9A 3NDRA 5G53C 4DLSA 4UHKA 2CDCA 3KR1A 4D9IA 4UNPA 2TRSB 4P4LA 1CQJB 5K01A 5B7QA 1UBTS 4HPXB 1NPDA 3TLJA 1JTVA 1XP5A 2FSGA 3EWNA 2XBMA 3SKYA 3ZWBA 2P27A 2FU5C 5EHXA 3AY0A 3D54D 3KOYA 3NTQA 4CMGA 4BV3A 5ALSA 3PE4A 2AV6A 4NJOA 4FCTA 3AVUA 2Q7XA 3IMGA 4DA9A 3F9CA 1LLDA 3OVMA 4M8KA 4Z3OA 3PD0A 2OO5C 2IDZA 3W5DA 3B6KA 1W30A 1X15A 3OZWA 2J3JA 1CF2O 4PAQA 1J8MF 4WCFA 3QSGA 3PGXA 1B8PA 4PYRA 3V7WA 3NJ4A 4G36A 1S8OA 1U7HA 2W00A 1PR6A 1UZMA 3HMKA 2OBFA 4HDKB 1TCAA 3SZUA 1NE2A 1JQDA 1ZGJA 4G1UC 5CXXA 2RH9B 2YN0A 3FZYA 2P1RA 1PNOA 3DT9A 1YE3A 3FOCA 3KT8A 3EDOA 3O1HB 1VP9A 1QDUA 5ALNA 3K4QA 4ZVPA 3PQ7A 1J22A 5IK2A 1BWPA 1NVBA 1PQUA 3CA8A 1FSSA 3ND7A 1KS9A 3UXEA 1N3BA 2O2CA 4BFLA 4OXRA 1AQJA 4BUJA 2FZ5A 4IIHA 1E1RD 2H5IA 1E7WA 2GD6A 4CIWA 3A3OA 1Q1EA 3AZOA 3BC1A 3QOWA 2QAGA 4IP0A 4K9QA 3TL2A 3BIXA 3FE2A 3UXMA 3U61B 2QRUA 2N1MA 4E12A 2CV2A 2BCGY 4LKRA 4GS5A 3BJZA 1SC1A 2DFKB 2GM5A 2DHRA 3Q4GA 1RRFA 3LA8A 2QPOA 1FVXA 2ID4A 3CLTC 2XNCA 3JQDA 1YQEA 1KAMA 1NR5A 3NWBA 1DADA 1N78A 2R1UA 3VPDA 3HBLA 5HRCA 2XMPA 2XXJA 5A5DA 4E33A 3ERCA 3HMQA 4W1RA 4NFLA 1HNNA 2F3PA 2VHQA 3WNDA 1N5JA 1T1IA 2GHQA 1HL7A 2P9BA 4DNOA 3KL4A 2YZGA 1EGHA 4JP3A 3QXSA 2JLVA 2IPMA 2LUOA 2FPLA 3CT4A 5HX7A 3ND5A 4ZMSA 1F48A 5LBIA 4HQNA 1V9CA 1JV2B 1UKAA 2GKOA 2AL7A 2HHJA 1LBEA 5D8DA 3NO4A 2GXAA 2E2WA 3WBBA 3PXUA 2JZCA 3S2GA 3UOWA 2EZUA 3RO7A 3BB1A 1KZ4A 3SYKA 4GX2A 4HDNB 5ITWA 3AHJA 3TCXB 3VDNB 4AAYA 2EJTA 3FSRA 2PWPA 1BGVA 2NSYA 4PO9A 2DXIA 1V5FA 4OV6B 1XX6A 4QYMA 2JHCA 1BKSB 1SVMA 4MWBA 4IHKA 4DEVA 4DB2A 4M1QA 2WD8A 5F5LA 2C1ZA 1SRRA 1GPBA 3NALA 1QIHA 3E84A 4QG7A 1RYEA 3GH1A 1ID1A 2C4HA 3ZLBA 1DIBA 3DVSX 2PANA 4XEUA 2AMVA 1ICIA 2KQUA 2WD7A 5EINA 3RUFA 4DA0A 1JHPA 1YR9A 1PYOA 2YUTA 2C7QA 3BWYA 3KJEA 3RUPA 1W4RA 4QUHA 1TZCA 3RE1A 4BJ3A 1PT6A 2GBLC 2GJKA 1Z36A 2IHBA 3JZDA 4MI1A 4N0MA 4RVOA 3RSHA 1NF8A 3VDMA 2G9ZA 3P4YA 3TPZA 3SR0A 1ULHA 3Q7EA 3VAZA 1Y82A 2WB4A 3GV0A 4IIEA 3REGA 1I1HA 3AEQA 4E94A 1TDJA 1R66A 1ZD3A 2O19A 2YFYA 1N6LA 3EA0A 4I1RA 2QX6A 1NUQA 4BNGA 2HPZA 2CXUA 3JD1A 5ESDA 1M1UA 2XMGA 2ECOA 3MZ0A 4BKQA 2NNWB 5MFPA 3ZLVA 4B3BA 1J2YA 1VB5A 4HD8A 4L72A 2D4AA 2G8NA 2XCQA 1NW8A 3CMCO 3KLNA 3W5CA 3P2MA 1U1IA 4JZKA 3ND9A 2OLKA 2PH5A 2ZETA 4HN2A 3M1LA 5TF4A 2BVNA 1XC7A 2WAMA 4OYLA 1GGHA 1BYIA 3F9RA 4C2UA 2B98A 2HQOA 3W79A 3OE1A 1NQWA 4M60A 5CHEA 1Q0PA 2BEVB 3VR3A 2FMTA 5AKHA 2C4TA 5E0KB 4EHJA 2GNPA 3KVYA 2P9CA 2N0SA 2BMEA 4R40A 1GR1A 1ZN8A 1HFJA 1LUAA 1ULUA 2ZPAA 2PIAA 3GA5A 3MWLA 1XFDA 4YS6A 1PKXA 4ALIA 3L4JA 2FZ4A 5ALVA 2QDKA 2W93A 3GGJA 2GVZC 3DDWA 3HU2A 3ITKA 3K9LA 3FHTA 2QVZX 3I83A 5HYVA 3ZVLA 4QICA 4RK1A 4B6OA 2XYVA 2CV1A 5KWEA 1WJGA 1YDHA 3F7TA 2PJZA 1TX4B 5FPTA 1TD9A 4AN0A 1Q2UA 1I6KA 2ON6A 5E7IA 4MW1A 1V8DA 4PTLA 5AYVA 5H3LA 7ABPA 3DBOB 4JVSB 1XZFA 2BGKA 2CZQA 3GJ6A 4FFBB 1CYDA 5HZMA 5FPQA 4AIRA 5FUWA 3OQBA 4LWQA 2J0VA 1WOYA 1BXRA 3BKWA 2QN6A 3V4VB 1UFOA 4YHHB 1JXAA 5TMDA 1HQYE 1GU0A 4D3ZA 3Q7IA 1BYUA 1B0PA 3ESAA 3DUWA 3JTEA 5E6UB 3RRJA 2YW2A 3RYIB 1R0RE 3R23A 3RHTA 2Q5OA 3EGXA 4H3VA 4ILKA 4MW9A 3V3KA 4DM4A 1P44A 1ZIXA 4JUFA 4X3OA 4ZT2A 3UCEA 2R85A 4NJMB 1DMRA 3SY8A 4JSTA 3MG9A 5ICMA 1YVDA 3GP5A 4MVXA 3GROA 2HMYB 3ZE2B 2RCNA 1ZY2A 4OMFG 1MJFA 2B8NA 1QO0A 4OA5A 1UZLA 3ZWAA 1NJSA 3IIJA 1XEFA 3JY6A 4YGYA 2PBLA 4DV6B 5DWQA 5DKFA 4LBVA 2GZMA 1NDQA 4HAYA 2C7OA 2GUGA 2YIVX 1YZFA 1WWKA 2O7SA 1MORA 3A1FA 5KYGA 5ARDA 1HQDA 1P7PA 3DBRA 4Y0NA 4DFDA 1H3NA 1M7HA 1ZM4A 4ZREA 1RM0A 2H0AA 5DFAA 1MB2A 1C3VA 2GZHA 3KSRA 1VCHA 5M3BA 1QR6A 3M1AA 1EVEA 5KEIA 3M6IA 2RHGB 1NBEA 1X6VA 2R1TB 3OWXA 1AS2A 2FUEA 4ZKEA 4N48A 3WYEA 1NPYA 5FLEX 1C41A 2G4CA 3IUJA 3HEBA 1BCRB 2Z1MA 1JHRA 3K1TA 4MCJA 3KVNA 3IILA 4DQLA 3IL2A 4F60A 5JQGA 3V3TA 3BUSA 1CUBA 2AWNA 2QQ0A 1TUIA 2D1FA 1Y9DA 2ENWA 5ALZA 5AW0A 2IW3A 3DD1A 4Y6SA 1U11A 1I4TD 3LYLA 3TDNA 3PCXA 1VYHA 2NSLA 4ZDWA 5BV8A 3KT0A 3RSCA 4S24A 1YRBA 3PR1A 1U8YA 2CLOB 3D8RA 1XN1A 4U6SA 1M2HA 2QV0A 5JASA 2AN9A 4NCIA 4QU9A 1Z82A 5DXJA 4L76A 3ZS9A 2FPPA 4EKDA 4E11A 3AM4A 1W94A 5TR9A 3ZU2A 2JLUA 4IGFA 1XNHA 3LT2A 1EB9A 2OR3A 2VZ8A 2HNAA 2X7HA 2DQ4A 2IYVA 4IDOA 1BCSA 3PGA1 3O7WA 4PONA 3VOSA 3GRVA 4HGQA 3AUKA 4GZMA 4C05A 1Z2CA 1U63A 4HUQA 3ITEA 1SBIA 3NGLA 1P2TA 4A0QA 3S1LA 5LWQA 2PRKA 4ZYXA 1SBQA 3FI9A 1ZJJA 2OFWA 4TYYA 2C5FA 4O0LA 1E2GA 4CR6A 1UK8A 2IEZA 3AC0A 1DC3A 1OU0A 3KQHA 4XGNA 1Z75A 4M9RA 5DRYA 2ERYA 2IHYA 4G0YA 1E2LA 1PG0A 3T5GA 2H31A 3O2NA 2CLFB 3MS2A 2ZPUA 1W36B 1JQEA 2V0CA 3F96A 2BGRA 1V3QE 1PGOA 2YJ6A 4GL4A 3H17A 4NK4A 4DF3A 4NVRA 2FE4A 1XJCA 1YBFA 3LBAA 4HZGA 3W8NA 1LS6A 2AW3A 2GBPA 5B3JA 1KGDA 2ZM5A 1HLPA 1G0OA 3OP4A 1LH0A 5ALPA 2AHRA 1XMOB 1J21A 2QQFA 4CF3A 3DBVO 4BNXA 1OTHA 2P4UA 2XCRB 1GL6A 4C7OB 3SR3A 4KR6A 2QXUA 1PL0A 4NH4A 1JU3A 1FSFA 4I14A 4JEIA 2BZ0A 2BFOA 3KTFA 1J97A 4KQEA 3FFWA 3FRHA 3RF6A 1QRAA 1DWPA 9LDTA 2PX2A 3AI2A 5I7WA 3FR8A 2PU7A 2VTDA 1KQOA 4TTVA 3NP9A 4OM7A 1GPUA 2VBIA 3EXHC 4JYAB 1AJEA 4JV5B 1IHPA 3CB4A 3RBZA 1E99A 4C4AA 1RHUA 1PBTA 3OQOA 1K5HA 4IJKA 5C1IA 1ISIA 3QUBA 1JKIA 1U2EA 1FNDA 3UHAA 5KWIA 2BFCB 1R0BA 3ZDFA 4B45A 1YZKA 4P33A 2IOYA 5IULC 1CQZA 1CUAA 1P81A 1NHGA 4M53A 1GLNA 3IKTA 3QPUA 2HT6A 3LC2O 5BOSA 1ZITA 1XDDA 2EF0A 3ETDA 3FNRA 3QLTA 1UJ5A 1Y33E 3NNSA 3SI7A 4CG2A 2HLHA 2CXRA 3A27A 3FUTA 3M6AA 1CJKC 1GV1A 4FSDA 2E4ZA 5C4GB 2GK4A 3M1IA 3USZA 1I4DD 1IAVA 5F2NA 4DXDA 4HLCA 1VIMA 3C74A 1WQ4A 3MFYA 2QMEA 4IINA 2ZIWB 4FGKA 1NJ5A 1R8XA 1PFWA 5DYTA 3G2PA 1N9GA 1DCFA 1VDZA 3IUPA 4MS3A 2ZYIA 5AJWA 1N9KA 4O8ZA 3FX2A 3DW1X 4W5QA 4L2IA 3Q8KA 1MKYA 1YAJA 4WZAB 2ZZNA 5AKJA 3BH0A 3MILA 5BWCA 4QT0A 2YJ5A 1C7IA 4ALNA 5C81A 3R7LA 2E7ZA 5FNZA 5KJ6A 1D07A 1HR0B 2XWPA 4FBLA 3CRMA 2VAMA 1LPPA 3DWIA 4V2IA 4KGVA 4Z1MA 1N5DA 4FMCB 4YRPA 3O4IA 1D4AA 2IXEA 3EZ6A 4KVAA 3VR6D 1H9BA 3AM5A 3ZI7A 3L04A 4KIWA 4KOAA 1YZHA 4MAAA 3LQKA 3G2IA 5EFOA 3PRHA 1YKFA 4MK4A 2JKYA 3SX2A 4ENTA 4MICA 4P9NA 5IAJA 5JCPA 3G8BA 4HAVA 4NS4A 1TF5A 1VA5A 2GCOA 4U0KA 4A16A 4A6XA 4A23A 3RW9A 3FTPA 4GYWA 1N3LA 4O3FA 5J59A 2PGOA 1T9AA 1XCJA 1GAQA 2A0KA 2JPDA 2JIDA 2I3GA 2Q1YA 3G0BA 2A0UA 4NOKA 2ZTLA 4B4KA 9MHTA 3WYNA 5CIQA 2VUSA 3TKLA 4WE3A 2QEQA 1KQGA 4QDJA 2XMQA 1RLIA 2B0CA 3FTFA 3VUEA 1CP3A 4C4PA 4NBUA 3GJZA 2FWAA 2FEWB 2XE7A 2H4YA 4KJZA 4ARUA 3G1WA 1FS4A 1P73A 3PXDA 4RHFA 1JLLB 3KO8A 1WZ2A 3DB2A 1HQCA 2CLKB 2I7XA 4OHFA 1T1JA 3PDIA 5BVGA 5J23A 3MUEA 3DEFA 1UXIA 3OWOA 2BP7A 3JQBC 2DT8A 3AHGA 5TS3A 4H77A 2ZUTA 1O94A 1XALA 4H7FA 3PNBA 1N75A 3UJPA 5H4HA 1Z2EA 2PGXA 2O8NA 3C3KA 3ID6C 1Y5LA 1Z7YA 5EFZA 5LJIA 1X7ZA 3SD7A 4DR2B 2W6JA 3O8QB 2W90A 3RYCB 3ONVA 1SUAA 4H0NA 1CK4A 5I7FA 5U1PA 1J24A 3TQOA 1FPQA 2PK3A 2D74A 3NEJA 2P9GA 3U49A 1UMBA 1NMSA 1YXMA 2FWNA 2O3JA 3A3YA 3FNHA 1TEVA 3L3BA 4OQZA 5A9RA 1WB9A 1Q7TA 1EE2A 1C0IA 3O1LA 4CG1A 3I3OA 1YHZA 3LUHA 2L19A 1SXQA 1ZIPA 2P5YA 3E61A 1M2WA 3AFMA 3DGEC 4R68A 3T7EA 1JEJA 2WUFA 4HNQA 4RMGA 4XGKA 4W8GA 1QTQA 1HF3A 4REOA 1CY7A 4OHRA 3ZDXB 5JLJA 2AJ8A 3M33A 1I2MA 1RBZA 3MIIA 1Y7PA 3DWFA 3PDJA 5ECDA 3RIMA 4MDEA 2H92A 3L46A 4XM1A 5BSEA 1GN8A 2NN3C 4GX1A 4V24A 4CEIB 5EPOA 3G79A 2WBLC 4QUDA 4EFKA 1MUUA 1K2WA 3OZRA 5SV2A 2HI0A 1AHNA 3TSCA 2X9GA 3DMPA 3Q3HA 2QXTA 5JWRA 3S29A 3HWSA 1PWHA 2G0NA 4ZT3A 4TL8A 4DLTA 1FNMA 1Q50A 3LA6A 4QGSA 3GLIA 3PNPA 4WHMA 2J45A 2PE5A 1M8GA 1NRWA 1LC0A 3U44A 1K8YB 4CMJA 3OUTA 3OZCA 3IBTA 4YMIA 1XF9A 2HPHA 3DFZA 3WYFA 4D0GA 4OJMX 1N2SA 5LA6B 1DTWA 3AVQA 3MWEB 4MKFA 1GQYA 2IGTA 1OTXA 4LOIA 4IY1A 4UTOA 5K3FB 1OASA 4D26A 3N86A 2OESA 4BJHB 3FTQA 2BWJA 2IZ1A 3W3AH 2PH7A 1JKJB 1U7UA 3SQDA 3NGXA 4W6ZA 1RT9A 1R6VA 2G1JA 3ZE7A 1YI1A 4AQ7A 2OEPA 4PCUA 4WL0A 1WCXA 1QDLB 4J4TA 4CIDA 4E3ZA 5HZGA 1S2OA 3T5DA 1JJAA 4J1TC 3AJAA 2OB1A 1JWBB 4CDRA 5LOVA 2VTKA 5I7UA 3DLPX 3EC7A 4QOEA 4D57A 3H9JA 3W4IA 2C03A 3PXEA 4EUNA 3KQUA 1YFKA 3QKSB 2I9KA 2JLBA 4IFIA 4J2TA 4PZUA 4UDXX 3OX2A 3M7IA 1SKYB 3DF9A 3WA6A 1DJQA 3HVJA 1Z0UA 1RJWA 1RVDA 4H9GA 5IM4F 3TSWA 4P0PB 4MQ4A 2ZUUA 2J0UB 2Q5HA 1QHXA 4TKVB 1EP1B 4TMWA 5CNMA 4GBGA 2RH5A 2ZWVA 2WUWE 4WZ6A 1UJ2A 2WYUA 5AWFC 1K8XB 2BM0A 4A1FA 4WK6A 4D4KA 4F5WA 4ETMA 1C0KA 2FR8C 4DLKA 2KB0A 1J9GA 1RR6A 2RKOA 3T5TA 3ZY4A 4I8XA 3N5KA 4XWYA 1DEAA 3HG7A 2UVQA 3MOGA 3WIDA 1GZHB 3TIVA 4FGZA 2ZYWX 1QG0A 3HLYA 2FWPA 4H1UA 3C6BA 2X9NA 3LUJA 4KQ6A 4KBFA 4AURA 2V6JA 3HJNA 3K6RA 1PL6A 1JEQB 1V0JA 2GXUA 3ANNA 3MCZA 4G4JA 1G21E 2PLNA 4KXLA 1BMQA 2EJWA 5LLSA 4KLNA 4RA9A 4A2QA 4DR1B 2QRVA 1OAOC 3IMCA 1QPZA 2X76A 5IEJA 1OI4A 2MSCB 2ZROA 4ZO6A 3F5MA 5CXSA 2I8CA 1DC6A 3K15A 3PQ6A 3QKWA 3UK1A 1FNBA 1LV7A 3OCYA 4PRLA 5DLEA 4BNLA 5DM70 5K3CA 3D4IA 3EMVA 3GEPA 5DGXA 4S0ZA 4C0HA 4NE9A 2WUEA 1T1SA 3IP8A 3ZGLA 5AVYA 1UKVY 2EFGA 1FMTA 1G18A 2PQMA 4PPGA 1NTOA 3GYGA 3U3ZA 1CLUA 2FKAA 2CD9A 3AR7A 4BMNA 1EIWA 4HH0A 1Z6ZA 1MFPA 3ZXIA 5JYBA 4E5MA 2XXBA 3B1YA 4FWIB 3C6YA 1W49A 4BATA 2X0KA 2NAPA 3H1BA 1R5NA 4P92A 4EFMA 4EKIA 4FMCF 1Y8QB 2FOXA 2H1OA 5AQ1A 5LMNB 1SB8A 3RRXA 1HKUA 1NN5A 1C1DA 2RJ3A 1QGOA 2XMBA 3NHWA 2EKDA 4I9HA 4J7CA 2HWWA 3HU1A 5FLXA 1KMMA 3TIIA 1UADA 2Z6QA 3CNLA 4RKYA 5DO9A 4DDKA 2RGRA 2Z4SA 1KQFA 4ZYYA 2JBHA 4PGMA 5LDDC 1RWWA 4HSEA 2CVZA 3MTGA 4HXGA 4D9JA 1GGMA 1E69A 1X8LA 3TZBA 2UZ1A 4K88A 1VJGA 4PZZA 1LWOA 3L06A 3PQEA 3WLFA 3OH8A 3OQNA 3H16A 2X9VA 3DOCA 4PC2A 5BN4A 1EVIA 1AT1A 2DUJA 2XTAA 2ROQA 4HRAA 4PNEA 1A2BA 1U9IC 5L7WA 4NESA 5F4ZA 3O4GA 3IIIA 5DYIA 1WHTA 1Y3IA 3WL7A 2FP3A 2C3PA 3SQOA 4PZAA 1CETA 2JJQA 3A6ZA 3EDMA 3EC1A 3C6ZA 1ZYUA 4B8ZA 3U26A 4TT3A 2EJVA 2H85A 3GUYA 4KSCA 2UYYA 4KACA 3VU9A 1Z3CA 3WRXC 4OXQA 3UGJA 3D59A 4ZTBA 1RW4A 1CP2A 3MSCA 1MCZA 3D6UA 4UUPA 4CEJA 1JAXA 2E48A 1E6MA 1VL6A 2C0CA 2B8EA 5LYJA 5KTPA 4B7XA 3NYWA 3O8BA 2BM9A 5AJZA