1R74A

Crystal structure of human glycine n-methyltransferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
275
Chain Sequence
YRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycine N-methyltransferase
publication title Glycine N-methyltransferases: a comparison of the crystal structures and kinetic properties of recombinant human, mouse and rat enzymes.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 275
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1r74A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r74A02
5CVVA 4IWNA 3A26A 4OBXA 3UA3A 1NV8A 3SMQA 5JUWA 4X61A 5KS2A 2BM8A 3FUUA 5EIFA 2Z6UA 1L9KA 3G5TA 2AOWA 1X19A 3G8BA 3THRA 4A6EA 5E9QA 5K0BA 2WA2A 5E8RA 4RTQA 4HH4A 5JR3A 5KVAA 4RTKA 9MHTA 5HOQA 3ELYA 2AOUA 1RJGA 1O9HA 5T64A 1RI1A 5GIOE 1YUBA 3GCZA 3KPJA 2ONZA 2PXCA 3EVCA 4HSGA 3AXTA 4P7KA 4C08A 1X1BA 3P8ZA 4E32A 3BWCA 4RTLA 3GJYA 1NW6A 3QOXA 3NWBA 4ATNA 1NW8A 5EKXA 4PYJA 1WY7A 3EVFA 2NXCA 3TR6A 5HIIA 4KWCA 2AOUB 1YZ3A 3G2MA 3PFGA 4PGGA 4GOLD 1VBFA 5DRTA 3GRYA 5EHIA 7MHTA 4GC5A 2AVNA 1FP1D 4GUAA 1IY9A 1P1CA 1NV9A 2VDWA 3WSTA 1ZHFA 1ORHA 2FRXA 1H1DA 1JR4A 2BZGA 2P1DA 2YXLA 2CL5A 3FTDA 2PX2A 3ANXA 3G5LA 3NDJA 1TW2A 4QTUB 2OXTA 2NP7A 5IKMA 2ZIGA 5FQOA 5EMLA 2UZ4A 3DXYA 1DUSA 1YFLA 4YUVA 4RX1A 1P39A 3NWEA 3PS9A 4PIPA 3KR1A 3HCEA 3P9KA 4EQZA 2GPYA 1G8SA 3P2KA 5K0EA 5LQRA 2B9EA 2C7OA 1INLA 1XCJA 3HVJA 4RTNA 2NP6A 3GDHA 2NXJA 5P8WA 2EJTA 4M7RA 1BHJA 3EVGA 1X1DA 3KQQA 1VP3A 3Q87B 5E1BA 3I5UA 3T7TA 1G8AA 1NBHA 4EMSA 5HILA 2G1PA 4HTFA 3HVKA 3OFJA 2AN3A 3HVIA 4GOMD 3E23A 4PCLA 4U7PB 2ORED 3M33A 4DM3A 3SSNA 4CKEA 2PSSA 4AZVA 2GAFA 5LQAA 5FA5A 1KHHA 1DCTA 5C9ZA 5KQRA 5E2AA 3FTEA 2XBMA 2O0LA 1AQIA 2A14A 3K0BA 4M38A 5DXJA 1TW3A 3BKXA 4BP3A 4BLWA 3UWPA 2FHPA 4HTFB 5DM1A 4AZTA 4YV2A 4RVHA 3UZUA 2XYRA 3A27A 2H1RA 2NNWB 2ZBRA 1KP9A 3R3HA 3DUWA 3BWYA 4RTJA 1FJXA 3M4XA 3IYLW 3P71T 2JH9A 5EIWA 4BLVA 3JWJA 2BM9A 3KQOA 3A25A 3B89A 2IDJA 2E5WA 2FCAA 2ZZKA 1I4WA 2P8JA 5FHRA 1R74A 3FRHA 4C03A 2OKCA 4V0RA 5K0FA 1NE2A 1NT2A 2YTZA 3SX0A 3ER9A 4L7VA 5EEHA 4MQ4A 5EPEA 2YQZA 2AOTA 3FPHA 5K0GA 2V74B 1SVUA 1XDSA 2P7HA 3PX2A 2QYOA 3R24A 2B2CA 3EMBA 5DTMA 3LDUA 3NTVA 2HNKA 4FZVA 1XDZA 5EEGA 3KR9A 4QDKA 5BP7A 3VSEA 1L3IA 4RYLA 3B3JA 2AOTB 2C7RA 2BR3A 1XXLA 1SQGA 3FPEA 3OE5A 3OFKA 3KPVA 3OZRA 5EKUA 4DZRA 3BKWA 1D2CA 3OZTA 2AVDA 2ZLBA 5DT2A 3UA4A 3MTEA 4H0NA 4V0QA 4YMHA 4QTTB 2CKDA 4KW7A 3HCBA 4RVGA 1VL5A 3ELDA 3KR2A 5EC8A 2HMYB 2PVCA 3ELUA 5D1HA 1M6YA 2GLUA 3FUWA 3FUXA 2ZZMA 1F3LA 3PX3A 2OBFA 3U81A 1QAQA 4FP9A 4FSXA 4P7FA 4XUCA 4RTOA 2ZBPA 2XYVA 4OA8A 1KR5A 1EQAA 3O4FA 3I58A 3IHTA 2O07A 5DWQA 1RI4A 1DL5A 2Y1WA 3NW9A 4E2YA 5K8VA 5CCBA 1Q0TA 3AXSA 4R6XA 4AUKA 3RIEA 4HG2A 2G71A 3BGIA 2I7CA 4F85A 2IPXA 4WXHA 2YUIA 1JQ3A 2I6GA 4QQKA 3E05A 3LBFA 2G8NA 2P3OA 2PKWA 1MHTA 1G60A 1RI5A 3BWBA 5FWDA 3SGLA 1EAMA 3UJAA 4EKGA 1B42A 2I62A 3B3FA 3EGIA 3LBYA 5F2KA 3PFHA 5BW4A 5LSAA 3LDGA 1ZG3A 1XTPA 2AN4A 2PLWA 3TM4A 3BT7A 1R18A 3I64A 1UIRA 2HTEA 3EPPA 3LPMA 3MCTA 4PONA 2EJUA 3HM2A 3CKKA 3IV6A 3GIWA 5B1SA 5T6BA 2KW5A 3SSOA 4DF3A 1NW3A 2VP3A 4KIFA 1VIDA 2BR5A 2DULA 1JSXA 4PGHA 4CTJA 2WA1A 4C07A 5MHTA 4JXJA 3REOA 1EJ6A 3MCZA 2HV9A 4QPPA 4E2WA 1P91A 1QZZA 3FUVA 3HCAA 3UJ8A 4DMGA 3NJRA 5DM2A 5F2OA 2IBSA 2PT6A 3C6KA 3I53A 3LGAA 4CTKA 3HA3A 2H11A 1UWVA 2PBFA 3TQSA 1KPGA 2B3TA 2ZWVA 2P40A 3M6VA 5U4XA 4HC4A 2PXAA 4GOND 1V39A 3OZSA 1YFJA 2C7QA 3GXOA 4RVFA 1O9GA 4CXMA 2FPOA 5EGSA 1KYZA 1JQDA 3G2QA 4R8SA 5FTWA 3G2OA 2Q41A 2ZFUA 1KXZA 3HVHA 3KQMA 5LQNA 2PXXA 1AF7A 2QM3A 2ZZNA 3CVOA 1I9GA 1KIAA 3HCDA 1BC5A 4R8RA 3FPJA 1EJ0A 2IH5A 2LD4A 4HGYA 1U2ZA 2HWKA 5EVJA 4C05A 3KQPA 3BGDA 5T67A 3LCCA 2Y1XA 2P3LA 4YV1A 4ER7A 3LCVB 1G55A 2AZTA 3CJQA 5CM2Z 3NVKI 3GU3A 4IKPA 3LKDA 1EG2A 1VP9A 1FP2A 5GOZA 5LR6A 4QDJA 3G7UA 5DLYA 3X0DA 1M6EX 3GNLA 3OU6A 5C1IA 2BR4A 2GS9A 1KPHA 3MGGA 1UFKA 3B5IA 4QQNA 1F38A 1SUSA 3B3GA 5CVUA 3P9NA 3HCFA 1XJ5A 3KKZA 5HFJA 3HA5A 5DSXA 3T7RA 3UJDA 4GF5A 2G72A 4FT2A 2O57A 2ZBQA 3R9XB 1WS6A 1L3CA 2YXDA 3EEYA 3BUSA 5ICCA 3MERA 3P97A 2ZIEA 2IIPA 2P41A 1YB2A 3HCCA 3SSMA 1KYWA 4Y30A 3GGDA 1HNNA 1R8YA 3TFWA 3K6RA 3P9IA 3AJDA 1QANA 4RVDA 3OCJA 2OO3A 3ELWA 4BP1A 3M6UA 3MB5A 1AV6A 5E1DA 3TPZA 4P58A 2IGTA 3DH0A 3L8DA 3A7DA 5H02A 2IH2A 3JWHA 1XVAA 2IH4A 2IDKA 1RJDA 4P7JA 2XVAA 4PIMA 5HIKA 3HEMA 5KQSA 3KQYA 3H2BA 4PNEA 3C3PA 2NXEA 3LX6A 2ESRA 1SG9A 2YR0A 2BH2A 1NBIA 2N47A 4BLUA 3DMHA 1L1EA 3CC8A 3HA7A 4RWZA 2NYUA 5LQUA 3C0KA 3UJ9A 5DX0A 4XCXA 3PTAA 5EQJB 1MJFA 1VE3A 5EHGA 5HIJA 1Q0SA 4U7TB 1JG3A 3AY0A 3JWGA 2UYQA 3OPNA 3UBTA 4C06A 3LL7A 2FK7A 2PGXA 3E7PA 4LWOA 5LQCA 4RTMA 1Y8CA 4GBED 1I1NA 1WXWA 3NDIA 3R0QA 3S68A 3CJTA 2UYOA 2WK1A 1KPIA 2ZSUA 3DXZA 5GM1A 2XVMA 2ZULA 3LECA 1WG8A 3TOSA 4E31A 4PYIA 2Z6AA 3EVEA 3TM5A 3TKAA 1RI2A 2R3SA 5E9WA 2JG3A 2PWPA 4PYNA 3SR4A 1NKVA 3FUTA 4NECA 3SXJA 1QAMA 4C04A 3R6TA 10MHA 3DR5A 5DRYA 4KDRA 4AZWA 4EK9A 3MTIA 1RJFA 2FK8A 3LCUA 1JSZA 4K6MA 5ERGB 5ICGA 3DXXA 4M36A 3AWIA 5K09A 1EIZA 4OX9Y 3A4TA 3BXOA 1X1AA 3FTFA 5BW5A 5DM0A 3KQWA 3TMAA 4EKIA 3MHTA 3VC1A 2P7IA 3TKYA 5CD1A 3EGVA 1ZGJA 3FPFA 3SVZA 2VDVE 4FGZA 4FSDA 5GINE 4X63A 5DSTA 2QY6A 2YXEA 2OB2A 3PB3A 4ISCA 4ER5A 2IFTA 5EZSA 2AOVA 3FRIA 3HNRA 1HMYA 2NXNA 2K4MA 2YX1A 5CIYA 1IXKA 4GQBA 4RTSA 8MHTA 3P2IA 3EVDA 3BGVA 2PY6A 3Q7EA 5FUBA 1R00A 2PX8A 4C4AA 2YVLA 4KIGA 5DXAA 5GWXA 3F4KA 3RODA 3EVAA 4CKBA 5K05A 5K01A 2ZVJA 5K03A 3DMFA 1SKMA 5EMKA 5DX1A 2IP2A 2AS0A 5EZQA 4LECA 3LSTA 5D1NA 4YUYA 4ER0A 1NW7A 1ZGAA 4B17A 5DTRA 3EMDA 2VDUE 2AOXA 5K0CA 5K0LA 5ICEA 2P3QA 3V8VA 2ADMA 3C6MA 4MTLA 2R6ZA 3GO4A 4DKJA 1L3BA 2GA9A 1G6Q1 1JTEA 4WVLA 5CVEA 1ZKDA 5DM4A 5EMJA 4OQEA 4YUXA 3D2LA 1PRYA 3LKZA 3OU7A 5HZMA 4AZSA 1QYRA 3FYDA 3EVZA 4HGZA 4MHTA 1JQEA 3DMGA 4RTPA 2JJQA 3ID6C 3MQ2A 1T43A 1TPYA 3TRKA 4RTRA 3M6WA 1WZNA 1N2XA 4IV8A 3DOUA 5FHQA 3NMUF 3EVBA 2PV0A 1RJEA 2ZTHA 4GEKA 4CWAA 4OQDA 2FYTA 2GH1A 1JG1A 3UJCA 1JTFA 3G88A 3ME5A 4PYMA 1JG4A 5CUQA 5HIMA 2PJDA 3DTNA 4PWYA 4X60A 1ZQ9A 3G2PA 3TLJA 3UJBA 4BY9E 3KQTA 5LQKA 2EFJA 4PYQA 4A6DA 4KVZA 2DPMA 3EGEA 3JWIA 3ORHA 1D2GA 4RSRA 3SM3A 3UJ6A 1R8XA 4EVIA 4UOEA 4LG1A 4KRGA 3PVCA 2JH8A 3NVMB 1VQ1A 5K0JA 2ZCJA 4POOA 2ZW9A 3P9CA 4XUDA 2F8LA 4XUEA 5FQNA 3DLIA 3B7PA 3PT9A 4DCMA 4E33A 5CVJA 1FPQA 4AX8A 1WXXA 2JHCA 4M37A 5FCDA 2QE6A 2PWYA 3HP7A 4PYKA 4QVGA 4FR0A 3DULA 5G02A 5GP1A 1IM8A 1BKYA 2ERCA 3GRZA 2CWWA 4GOOD 5E9JA 4E30A 2ZWAA 2AN5A 5M5BA 3CGGA 3RW9A 3MAGA 1AQJA 2IBTA 1RI3A 2OZVA 3GRRA 1JG2A 2OYRA 5DPMA 1P1BA 1YF3A 4LWPA 1QAOA 2OPBA 4MWZA 3EEOA 4OBWA 2B25A 2OY0A 4MIKA 2AR0A 3CCFA 1X1CA 2C7PA 4PYLA 1G38A 5KYGA 4E2ZA 4R05A 2CMHA 5E1OA 3VYWA 1VLMA 4IV0A 4G56A 3LDFA 4GC9A 4X41A 4Y2HA 2UYCA 4FS8A 2XYQA 3M6XA 3FPGA 5EOVA 1D2HA 5DX8A 5ICFA 2HR1A 1O54A 3DLCA 5HEKA 4P7GA 1YZHA 4DA4A 4PINA 5E8JA 3QV2A 5IH3A 3FTCA 3G89A 3QOWA 3ER8A 1VPTA 3GRVA 5E2BA 3O7WA 1XDUA 2O05A 2VS1A 3CJRA 5E1MA 1BOOA 2I9KA 3HTXA 1N7JA 1SQFA 3FZGA 3OE4A 4F84A 5GIPE 3KPWA 2PT9A 3BWMA 3FYCA 3T0IA 5DTQA 3IEIA 1OR8A 2EX4A 5FWAA 2OB1A 2GB4A 5CVDA 1SUIA 1R6AA 2CMGA 5FADA 5CCXA 4R6WA 3I9FA 4QPNA 4YV0A 5FA8A 3GRUA 2PX4A 4YUWA 1XCLA 3PLAE 5BXYA 3C3YA 3A7EA 3KR0A 4RV9A 4E2XA 4YMGA 2ONYA 3CBGA 2VZ9A 3LHDA 4O29A 2JHAA 2G70A 3KQSA 3V97A 5LQJA 3E8SA 5FULA 3VC2A 5F2NA 2Z6QA 4QVKA 4PCAA 4YUZA 4ER3A 3KQVA 2JHPA 3UJ7A 3G8AA 2O06A 3O31A 4X1OA 3M70A 4ZTBA 5GM2A 1Z3CA 2PX5A 3BZBA 5EG5A 2P35A 3DP7A 3GWZA 4PYOA 4FT4A 2ZIFA 4E70A 2EG5A 3KPUA 2QRVA 3UFBA 1PJZA 3ERCA 1ORIA 3KPYA 2B78A 3OU2A 3P2EA 5K0NA 4ER6A 4F86A 1M0EA 4OA5A 3KU1A 5EMMA 3KHKA 2V7EA 4KDCA 1NW5A 4HRAA 1FBNA 5C0OE 3THSA 2H00A 1N7IA 4Z2YA 3T7SA 4CKCA 4DQ0A 4DCGA 2UYHA 2QRVB
chains in the Genus database with same CATH superfamily
2UUOA 1WF3A 1GPMA 3LT1A 2JLZA 4RH3A 1TA4A 5KS2A 4ITVA 2H5EA 3LNCA 2QN2A 1SUFA 1SN7A 2Q3JA 4KP7A 3ASUA 4OJQA 5ALXA 1L9KA 1GQSA 1RJ9B 1WULS 2ILTA 3RB8A 4KPEC 1X19A 1PGOA 4J2HA 4WZAE 3N75A 1I01A 1WZ2A 2PV7A 3TNDA 3TYXA 3PQ6A 1X1RA 3ZWPA 5KVAA 2FE1A 2PS0A 2V0NA 1HRDA 3PQ3A 4BQRA 3L8CA 1K6IA 5EQDA 2QUAA 2ZJZA 1Y4AE 1O0SA 4LY9A 5FOTA 1BDMA 4BFYA 4BO8A 1W93A 3DFZA 4IEIA 5DIZA 5FOSA 1MCZA 1NKTA 3I2JA 3W77A 3EVFA 3UUEA 1P75A 2C2XA 2X5KO 2COEA 3V3KA 1ZXLA 3GRYA 2AVNA 4H0CA 3VSBA 1D1PA 4CPDA 3GHHA 2ZT6A 1LDBA 1QE3A 1HOTA 4IMPA 4RC9A 3CWCA 2WYIA 3H8SA 1ZSYA 3F1LA 4PINA 1UT5A 3CLUC 4YP1A 1F8FA 2W0SA 2NP7A 2C9DA 1GPJA 2JI9A 5IK2D 5CB4A 4PLGA 5FQOA 4ZI5A 3LFTA 4DR6B 1P39A 3BHJA 3Q5GA 3U9LA 2EP5A 4CJXA 3TUIC 3LVQE 3SZRA 4EQZA 4CTMA 4Z0HO 4Q34A 4LZJA 1NM5A 2B9EA 3LYHA 5DCYA 5H3LA 3RUPA 1OPRA 2AG6A 3DVSX 5KNBD 1BJTA 4UNQA 5CB4B 4F3KA 2QRNA 5IT9A 3AF6A 3IAS1 2NMVA 3SLRA 1PDWA 5FB3A 2AN3A 3ONNA 4NEHB 1ZK0A 4HPWA 4URHA 2DBYA 4L5CA 1ZVKA 3KHSA 5DXFA 1QKIA 3GQBA 4NYIR 3BEOA 1ZH2A 3OTGA 1MT3A 5E2AA 1LF0A 2YFQA 1UCFA 3QE4A 5JPDA 5KNBA 5B55A 2IY9A 1XXHB 2FRDC 3H7IA 4OL0A 4EI7A 1GAQA 1Z5GA 3A9VA 4MQFA 3OY7A 4QREA 1VHTA 4X3PA 4EUHA 3GQBB 3B1VA 3MLEA 2ZJOA 2JFOA 4UAUA 1F1BA 4XSGA 3WWDA 5KU1A 2DY0A 1PO7A 4L5BA 2RC5A 4YA6A 3OKAA 4EY3A 1Y3FE 2VSFA 1CV2A 3A2LA 2JAPA 2R7LA 2VNIA 2YWFA 3S1AA 3T8YA 4LGVA 2OZLA 4HLCA 3W5UA 3NVKI 4MQFB 4GMGA 3HR4A 2QAGC 4I2NA 4F5DA 5JQWA 3C3EA 3Q9SA 4RPLA 4B3FX 3TGLA 2AOTA 4YALA 5K0GA 2V74B 4TT8A 4I55F 1KK3A 1R0XA 2B2CA 2HA6A 2YWXA 1NQWA 3LDUA 3S1AB 4MUAA 5CCEA 1DFHA 4WD3A 1A0OA 4UHDA 3CLSD 3GFPA 2IZ7A 3H5AA 2I3ZA 3DEJA 4L3VA 4RNCA 3C6BA 1C81A 1PT5A 1K7EB 2AOTB 1DDGA 4LRTB 3T9BA 2WHQA 3TGPA 4ONEA 3RFCA 3L1VA 1N5MA 5FFNA 1I36A 3LXXA 3B6JA 4I3GA 4NIMA 2R48A 1NW9B 1QK4A 1Q7GA 1VXRA 2VDRB 3Q7PA 4EW2A 3BF8A 4IH1A 4BMCA 3VXKA 3OZCA 4Z2AA 5EE5B 1T2NA 3AERA 1HNZB 3DZHA 2JIDA 1TVMA 3DEHA 3GQVA 3MM4A 1VI6A 3CA8A 1XAJA 1NKSA 3H5TA 1YDEA 1COZA 4JLJA 4EO9A 2ZBPA 5EJEA 2CL7X 2CLHB 3O4FA 4FFSA 1OIWA 3P0JA 3IHTA 5K8VA 1YJBA 1IOLA 3VTFA 4TYPA 5ILOA 2AT1A 4POAA 5IM4F 4IX9A 4HG2A 1G5IA 1AQUA 4NOJA 1H66A 2WJZB 3ORFA 1DQYA 4I5IA 4BNVA 1CLEA 5E6SA 2BEUA 2J9XB 1DHTA 1MKYA 5AK6A 2CWDA 3URMA 2Y67A 5LSAA 1KZ9A 1O03A 2IEZA 5BN3A 4LZPA 1NMQA 5FBRB 3T52A 4YYZA 3IQZA 4M0KA 1LPOA 2J9GA 2AHOA 3L0YA 4PPFA 5EIAA 2E87A 3RVKA 3FHTA 1MXFA 2QLNA 3KALA 2A9RA 2QVBA 4OBBA 5DE3A 3A28A 5JH7A 3I2YX 3W9SA 1DAKA 3DCYA 1EZ1A 3I92A 2R7MA 5DYWA 1XC7A 2CUKA 2VP3A 3L6CA 1TO2E 4NHEA 3DZBA 5BN3B 1WIWA 5ADHA 5H5JA 1XIVA 2OHGA 3GA5A 2GR9A 1M73E 1CQXA 3ZDAA 1RWXA 5JD3A 4B3XA 1P91A 1RFGE 1MEJA 5JH7B 1W44A 5DYYA 5AM4A 2ANCA 1X1QA 1RJWA 1VKHA 2AYZA 2CZGA 2VJPA 2UV8A 2IYOA 3SZOA 3IVAA 3M81A 2Y4OA 4RO0A 3HDJA 4WNAB 4BZQA 2IV3A 3F2VA 2CXRA 4KMOA 4YRAA 2CDCA 3ASZA 3WLRA 3ICCA 2PN1A 2D5CA 3GLHA 2HEGA 1FXSA 2DHEA 1V6CA 3HUEA 3O8OA 4D2IA 4BEWA 2P67A 3LP8A 2ZZNA 2ZETA 2R7NA 2GXQA 5BQ3A 2C92A 5AVYA 4PZZA 4GMHA 3IH5A 3IBGA 3K9CA 4MARA 1A9QA 2B8JA 4HGYA 3KQPA 4JUAA 4DSZA 1SXPA 2P9YA 3S1LA 2KE5A 2Y1XA 1X8KA 3A6JA 3O8OB 3SBXA 3FF4A 2DR2A 1SM4A 3FA2A 3NBFA 3WK6A 4Z9BA 4G0PA 2Y1KA 5GOZA 1QGED 3L6UA 2P62A 3CF0A 4NAVA 4Z99A 5DLYA 5IYZF 3RM3A 3GNLA 4ZCLA 3WLHA 2J67A 3MELA 3FWPA 3VHLB 2BR4A 1LPBB 2QNRA 1T8RA 2ZATA 4UVIA 1H6AA 1KYIA 2G36A 1XJ5A 3HA5A 4UZSA 5DSXA 1XMOB 1J22A 1ZM4A 1T4CA 3C8DA 1HR0B 3AWDA 4JR1A 1SKUA 3R9XB 5G41A 5TPZA 5DHPA 1OT5A 1ETHA 3ZKWA 2H65A 5IJ9A 1I14A 1B6GA 4KB5A 1J1UA 4X6YA 3BBLA 5SV2A 1W94A 2ZROA 1ECBA 4LJYA 1O5IA 1U04A 4S1VA 1NI3A 3ZKWB 4U7DA 1KVTA 3FCXA 3WP1B 4D6PA 4YAUA 5IJ9B 2QU8A 2BGRA 2D74A 2JIOA 3CEHA 3GUUA 3NDRA 3NI2A 4P5EA 1I3CA 1RT9A 4H7PA 5C3UA 4TSKA 1O6GA 2YINC 2GUWA 1VIVA 3LHSA 4AL4A 3GC6A 1T9KA 3UHOA 2L18A 3P19A 2QXUA 1TF7A 2JGNA 1VCNA 1YNOA 3E82A 5DHAA 1QX4A 3K0HA 3DC7A 1THTA 1UBMS 4JZYA 4NJOA 3V8RA 5LYJF 4JC5A 1E4OA 1QRDA 1PKXA 1CE8A 2VP5A 3CVJA 4XA8A 4YCNA 5A4MS 1AJEA 3AOEA 2NSJA 1NXWA 1UDBA 5D01A 1T34A 3AVQA 2VF2A 4K1XA 4R1PA 5FAKA 3WLJA 1U8FO 2AW3A 3IESA 5F21A 4C3UA 1K27A 1B0PA 1NMZA 1QVAA 2ZUUA 1T5OA 2ZXFA 3KJXA 1R0KA 5KTRA 1GGFA 2V9ZA 1CUIA 2NUPA 4E1VA 2CB0A 4RETA 2FAXA 1CE8B 3LV8A 4GSLA 1IQUA 5CFZA 2FKNA 3DXZA 3ODGA 5ALZA 1ESDA 4FGLA 1H4VB 1HEYA 3LC1O 3N8NA 3U44B 3D7LA 4E31A 1E1DA 3WAJA 2WSMA 3CLTD 1L4BA 1XHLA 1XVLA 1P18A 4MZXA 1QPBA 1RI2A 2W4MA 3S2FA 2WJYA 1DWPA 2FUG1 1RYFA 3A31A 2JIZD 3SQLA 2NUPB 5CLIA 4B32A 3RIGA 2PK3A 3ZDRA 2APJA 3VV2A 3IAM1 1JSZA 721PA 2LCQA 1W9HA 1K7XB 1GNQA 1X77A 4C6RA 3THXA 1AF4A 3ZDFA 3PIIA 1V45E 1X9IA 4XLLA 1AA9A 4JH0A 2YWRA 4LHYA 5ECWA 1CUSA 4BCBA 5BW5A 3KB8A 3FTFA 4JA2A 3DOIA 4CKXA 5KKCA 4KO4S 3CNOA 3DZDA 5T4BA 2R25B 4QIHA 2C59A 2RH4A 3SVZA 4PSDA 2VDVE 3PSAA 3ZNPA 5HS6A 4M0MA 3X1XA 4QSMA 5DSTA 2RAFA 3ZVLA 2WFLA 4GMXA 3CKMA 4YCDA 5LZ7A 3AILA 4CV0A 2AOVA 1N1DA 1ESCA 1D1QA 2RKBA 3CR3C 1DEXA 3HDGA 2D00A 2YX1A 3PEWA 1TLFA 4JVSB 1RLTA 1SH7A 3QLTA 5FBHA 3L4BC 3EH2A 8MHTA 1LK0A 3FNHA 3CE6A 4IUYA 4OM8A 1DO2A 4DDKA 3A0UA 3HZZA 1FXWF 5JRJA 2WFLB 3BFVA 3ONFA 4CKZA 3SQNA 1Y7IA 2YQ5A 1L5MA 1GPWB 5AI5A 2QTRA 3G0OA 4YC7A 2AS0A 4P84A 5AIAA 5EZQA 5FEUA 2V6IA 5DHSA 4U6NA 4GL4A 1IY2A 2CCKA 4KSYA 1OFUX 4GXTA 4G5FA 3E9MA 1TEXA 1QBKC 1W46A 1YDFA 3A04A 3F7NA 1KEEB 1DO8A 5C3MA 4G89A 2GEUA 4N3AA 4OQEA 3L41A 2X7HA 3GLGA 4JD5A 3LAWA 5CJ2A 3FYDA 3RASA 1UAAA 3TKLA 1VJ5A 3KJFA 1HSOA 1QB8A 2FMXA 4JL8A 3PNQA 1KI1A 5AM0A 3TUZC 3R5XA 1CUFA 1C1HA 1OGJA 2MT9A 4JA0A 5JSYA 3GEEA 3OWOA 3T3GA 3F5QA 1GQYA 1IBLB 3GLGB 5H8WA 2EF0A 4YRJA 4ISBA 1W52X 1N7GA 3FUCA 5DZSA 4CV1A 4F12A 4HRVA 4RHTA 3KUCA 1USGA 4GI2A 3WQSB 3ZTTA 4DVGA 2FPLA 5KYGA 1IVSA 3NLLA 4WBNF 2AN1A 4BY9E 5SZHB 1SA0A 1E7RA 1NLYA 3K4PA 3LI2A 3PLRA 3RHTA 4PYQA 4UPVA 5BR1A 3JQDA 5KSPA 1LK5A 4O1MA 4YLYA 4UD6A 1FFGA 2HHAA 1E94E 1XJ0A 1Z28A 3I2HA 3UJ6A 2B21A 2V7TA 4J0HA 3CEPB 1W87A 1WMFA 3QFSA 4NVRA 1G3UA 3EWIA 1SA0B 1WB5A 5JYBA 1UBFA 2F1HA 3E27A 3R0ZA 5DV9A 5FWXB 1PR0A 5KYYA 3JD2A 2XV1A 3H42B 4LDRA 5FQNA 3BXEA 5H81A 5K6AC 3TNJA 2HBYA 1WXGA 2BKXA 3LDAA 4QUKA 3ZCPA 1OMOA 2B82A 2OXRA 3C41J 3K35A 4M46A 2UZIR 1T9CA 3SEQA 2FWRA 4ZODA 2J08A 2QE6A 2RJ3A 3KJQA 2HPAA 3MWYW 2G7ZA 3UMYA 4S0ZA 3EQ2A 4GSKA 5KYYB 3IDZA 5AKYA 1MLDA 5JO9A 2F1OA 3CE9A 2QTTA 3VKUA 4AICA 1NUQA 3MJFA 4DSTA 1AQJA 1SD5A 4U6QA 1IL0A 1FMTA 5MN4A 1QAOA 4MQEA 4D4JA 1Y6QA 4I4IA 3ZXYA 4UFNA 1EHCA 3ADKA 4WUVA 1JHPA 1T1RA 5G1PA 1USUA 3OKCA 3QU5A 3JYLA 3PWSA 2OM6A 2QDKA 3V4SA 4Z51A 5FPKA 3JVEA 2WOOA 3K0FA 1XCOA 1XN4A 1DXQA 1NOJA 1BTOA 4DOMA 3WRXC 4WJLA 3R8FA 3DO6A 3E7DA 4MQEB 1U9ZA 1JVBA 5HZHA 2V1UA 1UFVA 5FBWB 2R6HA 1OTXA 2VRCD 2BAGA 3MQFA 4S0XA 3L43A 5I9NA 4KUHA 1S9DA 2V0CA 4XSHA 3K0FB 1N3LA 4Y6SA 3J7AC 1VL2A 4IGFA 2GN1A 4IDHA 1I2ZA 4NCIA 4UFOA 2BM1A 1X2BA 3IHKA 3OE4A 1E66A 2GEDA 2C95A 2C8JA 3O3OB 1YB1A 3PNOA 1SFRA 4XM2A 4HNUA 1L5YA 5FWAA 4JEUA 2FKAA 3HJBA 2GB4A 5I4BA 2B1GA 3LW7A 5K2OA 5CCXA 4G5XA 4R6WA 1A8SA 2E1RA 2WEKA 1RKVA 1PVDA 4NYJQ 2EXXA 3QYJA 1XCLA 1PJ2A 2I55A 3VOBA 2XT6A 3FPKA 4UTXA 5CYGA 2ONYA 5A3QA 2W6ID 2DU8A 2PIDA 1SXJE 2IYWA 4KKVA 3ELBA 1U0RA 1YXMA 1HDOA 4MWEA 2CEAA 4F7WA 5BN5A 4Q7EA 2R8ZA 3G8AA 3TTSA 1IH8A 2FEPA 4TV8A 3EGOA 4ZTBA 1RACA 3BZBA 5CB0A 3ANMA 3ND8A 4Z54A 1P2FA 3GJSA 4ND8A 3QFCA 4MVYA 5IF3A 2FZCA 4LXUA 3GD7A 3SBOA 1T35A 3STVA 2I7TA 1YK0A 2W6IA 4H59A 4J4HA 3VTKA 3AUFA 2B78A 4QGAA 5K0NA 4CF7A 1U3CA 3G9QA 1BG6A 3KU1A 1ZI9A 1H2WA 4TV8B 4XQGA 3MIZA 3U7FB 2E6KA 3UJNA 4IP0A 5BVGB 4FYVA 3QXSA 1RVDA 4ND8B 3EX7C 1TA0A 1H5UA 1OGYA 2GHIA 5IJ0A 2Z95A 4H16A 5K6TA 2BEKA 4HAOA 5A71A 1WPGA 3A26A 1N34B 1EX1A 2AEFA 5JFOA 1LQTA 1N92A 1G1MA 1ZOLA 4DDUA 1Y5LA 5FA6A 4K0RA 5UKDA 3H2KA 1CJTC 4FCVA 4M0FA 3AF5A 5LU8A 3HN7A 3E7XA 5EYPA 3KYCA 4DLRA 1RXCA 5MN5A 2YRXA 5IJ0B 4MDEA 1GLVA 4LZZA 4B3SB 3D6TB 4RA9A 5C31A 4RTLA 2C2KA 4RL6A 4XB1A 1C7RA 1XQ6A 5F76A 2O2YA 3GDOA 4N3GA 4MKZA 1MC8A 3QY9A 3QWHA 5EYPB 2XBUA 3KYCB 4OL9A 1EWRA 4B4OA 3I05A 2JZOA 3VYTB 2IPOA 2JHGA 4MWBA 5PNTA 3ZV6A 4EW6A 1G8GA 3COJA 4CMIA 2EC5A 5TR9A 2CLCX 4GC5A 3RTGA 2P69A 3W4JA 1R15A 3K8OE 4GR5A 2NZWA 1T3ZA 1YRQA 1HQDA 4Y2JA 3DL4A 2BZGA 3A4LA 3E9CA 1Z5NA 4Q3AA 2FDXA 2VIIA 3AP2A 3PCRB 2C5GA 3EOBI 3IOYA 4JP5A 3LXRA 5FBQB 2N46A 4C1BA 2JAHA 2XOEA 2MR6A 3N58A 4CMIB 4DTCA 1IWBB 4XPIA 1XPUA 2H0RA 2VF7A 1D07A 2Q45A 3OC0A 3P2KA 3PKIA 4HPXB 4J03A 4YS6A 3K16A 4D1YA 1INLA 2WINI 3A3KA 3HCRA 3GDHA 1QHYA 4WSOA 3TR5A 1EGMB 2YV3A 4QULA 4Z6KA 2ZYRA 4MYRA 3IAFA 3HY4A 2BHNA 4FYIA 1ATIA 3DMRA 3JZMA 3PHLA 4XPIB 4BNMA 3HCWA 1LPSA 3TOCA 4BNWA 5AVQA 4GH5A 2OXIA 3VDMA 1E3EA 4TKMA 1G59A 2JJ8A 2JW5A 2Y9MB 4BN4A 1QVWA 2O3SA 4BRZA 2O48X 2XRYA 1PJBA 1GSHA 1IY8A 2C78A 1Y80A 4PZ9A 4DLAA 3KCQA 3LC2O 1G66A 4EKYA 1AXGA 2OQRA 1FDOA 1V8PA 2FUKA 3N8HA 4O4HF 2BZ0A 4ICIA 1FJXA 1EH5A 4MGHA 4YR9A 1T2FA 3P71T 1FCJA 1UBJS 3FPBA 4MW9A 1DBWA 3DAHA 4L50A 1GPKA 3TTVA 1GWNA 1IJFA 1M10A 1JEYA 3B5EA 2I8AA 2A1IA 2E5WA 2K87A 3B20A 3GA0A 5K0FA 1NSYA 2OKCA 4DDTA 2Y6VA 4IGKA 3I2GA 4YQYA 2I6FA 4R71A 1O96A 3M6AA 1MIHA 5DW0A 2ETVA 3P96A 3PQCA 1SVUA 3LYUA 4BNHA 3DCIA 4N0PA 5U9CA 1JEYB 1VYTA 4CT0A 2F1IA 4MULA 2FSSA 4IZHA 1XDZA 4QDKA 1OTYA 2P3SA 4URWR 2QZZA 1A98A 3IPCA 2PJUA 3LO5A 3D0QA 1EFUA 2JIMA 2DHDA 5LDGA 3S27A 3W1EA 3ZDBA 2WG2A 2UYGA 4MB0A 1DKUA 1PFUA 5JO0A 5ALJA 5DLDA 4G26A 5ALPA 1N2CE 3WDLA 1ADBA 4NDAA 3MTEA 3PQ4A 4V0QA 4RCZA 3MTDA 1EKXA 3GJRA 4UBLA 3RC7A 4A27A 5FX2A 3KQKA 2EFHB 2ISSD 4D9KA 4UBNA 3UAOA 1UBRS 3FIUA 1FZQA 4JK3A 3Q2IA 5IAJA 3GPCA 4HY3A 1TB4A 3PENA 2NOAA 3ZV3A 4CBVA 4FXPA 5CMLA 3U6BA 1R3DA 3PFFA 2X6TA 4BP9A 1OXSC 3TLAA 5JJKA 2G0NA 3KKEA 4OQNA 3BF7A 3PCTA 4EEXA 2KS6A 1KORA 3GFVA 2FG6C 4AUKA 4ZYLA 2NQ8A 1LPNA 2FRVA 4RK6A 1JQ3A 4MW6A 3DKVA 4LE0A 5HGJA 2R2GA 3LT0A 3CVUA 4CQNA 1PJCA 1Z5OA 1A9XB 3TQQA 4JCCA 4BFTA 1H5QA 2JK0A 1W36D 1XZ8A 5LA6F 2HRDA 2I99A 3GYBA 4GR9A 3LSYA 4XYEA 1GCOA 1YMUA 4JI2B 1D9XA 4G0VA 1NQUA 2OO5A 3L7LA 1L1RA 2NXWA 4MROA 3IV6A 3JQ8A 2JRLA 5B1SA 3HJCA 3DDHA 3OLYA 3LY5A 4Q0MA 3SS7X 3G0HA 1YAJA 1YZKA 2NV6A 2RMKA 3HLYA 4HDMA 1C0KA 3EASA 3OESA 4KIFA 2VAWA 4MV6A 1UXJA 2IPAB 2XCIA 3AESB 4YDHB 1NPTO 3KBOA 4RY2A 2OMKA 2MSDB 4EZIA 1EJ6A 3MCZA 1FU7A 2C3OA 2LDXA 3CH4B 4IXTA 4N5DA 2ZJ5A 4RDHA 4HUTA 2OGZA 1EAYA 2JGMA 1VLLA 4UE2A 2H1VA 4UJ3A 5AK5A 3EZGA 3SX2A 2MSWA 4HDMB 2HMAA 3LGAA 1MXHA 1PYGA 1B6TA 1W36B 1KJ8A 1ANKA 4HYTA 2H2DA 4V0SA 3TIFA 3TQSA 4US1R 1QC5A 2CSUA 2P40A 1YFZA 2VSOA 4M22A 1SKYB 4E5NA 5FTLA 1T0UA 5ALWA 1PD0A 1NUHA 1NVXQ 3GVIA 2BZSA 3SXPA 2G5PA 4XEHA 1JQDA 4A1OA 1LC0A 1M0WA 1NURA 1G8MA 3VSDA 3HVHA 4H3SA 4O3FA 3WADA 3OLQA 1KAOA 4INZA 4J76A 4TTTS 3HCDA 1PSDA 3OZBA 2C1EA 1PV1A 2E9SA 2X4GA 1OILA 1HV8A 2AUMA 2WILA 2EIHA 3AFMA 3KJHA 4C01A 3FYTA 5ISMA 2L19A 2WM9B 2YVKA 2Z5LA 3L0CA 4JJ7A 4MUNA 2R7AA 2ZSIA 3J81A 1RXIA 1WY5A 5DGDA 4RGQA 4IIUA 5AQ1A 4B2YA 1Z2AA 4RZSA 3JQGA 3U13A 4MUFA 4NXNB 2HWWA 3IAXA 1HO3A 2EZ9A 3KVNA 3SJBA 1IEWA 2F43A 2V59A 3MGGA 1LTKA 2F64A 2HJ9A 4HX9A 4D8UA 1EDZA 4C5CA 4OLBA 4CEJB 2QG6A 2H92A 1PWXA 2I4RA 1KYYA 2DT5A 3L04A 1NQ5A 3L6DA 4A5OA 3JQGB 2WJ3A 1VG1A 4CT4B 3O2SB 4J0IA 2DKFA 3H9QA 1NXQA 4A0SA 5ICCA 2YN4A 2F43B 3QW2A 4KQ6A 2BDEA 3GZ4A 3CZ9A 3C8MA 1ULSA 2Z4TA 3TX6A 3VZBA 1H4TA 3W34A 5D5HA 4NQRA 1KHTA 1U8XX 1IN7A 3TVYA 3VZSA 5F1OA 4BVKA 4RKWA 1X9HA 1LNQA 2DF8A 2OQ2A 3ZD9A 1Y7LA 2MR5A 2ID4A 3R5JA 4IIBA 1X6VA 1E2QA 2PNFA 5KQGA 1DIOB 2VHUA 4ZZIA 2V7WA 3L7CA 5GVSA 4FZRA 5KQMA 5CFPA 2VF4X 1VE5A 1AKYA 2IH2A 1TIKA 1B14A 5HIKA 1WV0A 2OHOA 4IVNA 1DKRA 1QRAA 3OOSA 4F96A 1PD1A 1J99A 1MO3A 3PEEA 5KQSA 1G63A 2GKSA 1TZMA 3V3TA 5CFRA 3T9EA 1Z73A 2YV4A 2ZQ5A 3CKYA 3R1IA 4BLUA 3TL2A 3QUAA 1UT8A 3PXEA 3IHLA 5KTSA 3BHIA 3Q10A 2NYUA 2ZCUA 4J1TC 4PO8A 4QGGA 4F56A 1NATA 1V5FA 2YNMA 3DAOA 4O4JF 1CRWG 5LMNB 2F67A 5FUMA 1ZK2A 4GL2A 2Y9PB 4WADA 1E2MA 3V1TC 4NOKA 4LWOA 4BEJA 3OQNA 3L7IA 2OOSA 1ZIOA 2GK6A 3N3BC 4GE0A 5BQOA 1T8UA 3GL9A 3RRXA 2QRLA 3S68A 5EIBD 4RQUA 1W0CA 3FYHA 1MVLA 1D1TA 2X8BA 1Y5RA 1JNXX 4YO7A 2MHCA 4MUHA 1QIMA 3W06A 4QEDA 4ZK6A 4B81A 1H9AA 4PYNA 3RRBA 1BH6A 4L6CA 3OSZA 4GWLA 2BIFA 4QPDA 3LOUA 1RYDA 2C8KA 1TI7A 2CVFA 4PC3A 1OH6A 2FK8A 3GJQA 4K6MA 3H9UA 3H0EA 1ZM7A 4OHOA 1D5WA 2JGRA 2P68A 5K09A 2I0FA 3O2QB 4OX9Y 3LBNA 4M49A 3S5JA 3BFKA 3BXOA 1V25A 4Q9DA 4DLVA 2C54A 5NULA 1NC1A 1GA4A 1TC2A 4MVJA 3KDPA 2WJVA 2VHZA 3CW9A 3OF2A 1J97A 4RGBA 4EKIA 1BMFA 2W6OA 3GT7A 3L6OO 2WU8A 4Q1DA 4MKGA 4N5LA 3NOXA 5DGHA 1PHPA 5HG0A 3A1CA 4UTOA 3DM9B 4G63A 2BSXA 4H31A 2XRZA 2WIDA 3LYAA 5IC4A 2C9BA 4Q00A 2JVJA 5IXYA 4XYBA 5L8VA 3PC2A 2NXNA 1NSTA 3IAUA 2Q27A 3PGXA 5CIYA 1BQ3A 2AXEA 2B69A 1SBNE 2H1WA 2NSLA 4YMUA 2UXDB 5FUBA 4OQQA 1Z2EA 3W6ZA 2OV1A 1YQTA 1JBEA 2VT3A 2J6CA 2GJKA 3RSQA 3HB1A 5TX7A 1VB5A 2ZVJA 4HQOA 4N01A 5DX1A 5EMKA 4LRXA 4DCOA 4QYTA 1GKUB 4DW8A 2RHOA 5D1NA 5AR1A 4E7PA 2L17A 4URYR 1GQ2A 4QODA 4HLDA 4N18A 5A7FA 3EG9A 2W11A 3ZY3A 5BMOA 1T4BA 1SOMA 1Y6RA 3DW3X 1ZM2A 4FD2A 4PR0A 3UG7A 5C8ZA 7GPBA 1CFJA 3O8LA 4ERNA 4U2GA 5DF1A 4L1KA 2GN6A 2AKYA 3JS5A 1GAWA 4FLMA 1JEEA 1EXVA 1IEXA 1HTBA 2DLNA 3MUOA 5EZ5A 4LWZA 3EG9B 1P9OA 2QT1A 2W2LD 5AM1A 4P80A 3AR7A 4AZSA 2QY9A 2FN4A 2Y2UA 2IS4A 1CZOA 1LLFA 1WTCA 1SUCA 2V6BA 3BB3A 3ITDA 3L7NA 3JD3A 3PJGA 4AN0A 2EFCB 2H6EA 3OZDA 3OTOB 4AUNA 3GFGA 4OH1A 4I2VA 1VL0A 1VTKA 1XRQA 3R7NA 2HIMA 4YBZA 4QGBA 4BVGA 4KLZA 2PGIA 2W2LA 5HKAA 5KIAA 1RYZA 4F2PA 3C1AA 1YDMA 1Z25A 2WICA 4YH1A 1VPWA 3CR7A 3NKVA 3HC7A 1YQEA 3UJBA 1GL7A 4YQFA 3AIIA 3ICVA 5CIQA 4Z1OA 4IMRA 2JGEA 4H7KA 4X61A 1SUAA 1CNMA 1P61B 5C8YB 2IU4A 1ML4A 1L5QA 3RKSA 3ZUPA 4XE5A 1GDDA 4C4SA 1XWWA 5JSQA 4P82A 1C8BA 4QASA 5IWAB 1KBZA 3FNEA 4PR3A 1ZNXA 5K0JA 2Q8QA 1QHIA 5BMVA 1NMYA 1XK6A 4J43A 4K3UA 2BHTA 1HI9A 3GBPA 3VNBA 4U1RA 4XB6B 2WJJA 1Q19A 3OWXA 1IK4A 1WXXA 2X1MA 4G4SP 4JVLA 4M37A 4KXVA 3WLQA 2C4KA 2NO4A 2ODNA 3D8BA 1PNTA 4IICA 2H07A 2HNBA 3G8YA 4J3NA 3ZCUA 5AW9A 4WY5A 3AHIA 4K6KA 3DAPA 1K4KA 3M0EA 4ZRMA 2DQZA 4CQMA 5BMVB 4EHKA 1JKIA 4HL6A 2GHRA 2R6CA 3D4NA 3GEPA 2IBTA 2I91A 1S7GA 2WTMA 1H2HA 4GS5A 4LDQA 4XX1A 3TD2A 1XZEA 3CLVA 4DMUB 2FCRA 3IDQA 4YAJA 2XE4A 1JF8A 3B78A 4HNAA 1UXHA 1U8AA 4BU0A 1II9A 2IUUA 3PNSA 3AU8A 1V8BA 1JAZA 4LJ7A 3WG9A 1JP7A 4CQMB 4RZ3A 5L53A 1NA5A 4MUEA 2CYBA 1W4RA 2XE8A 5TNXA 4IDPA 4IV0A 1UODA 1Q14A 4OYHA 4Y2HA 3U7EB 2XYQA 4HLUC 2HPVA 1UBHS 4ZHQF 3HFRA 3S6JA 3ZHZA 2O1XA 1U2DA 3PZBA 4HNAB 2R66A 2O8EA 3GARA 1PGPA 2SICE 3LLVA 3M5DA 4JI3B 2XF8A 2ST1A 1I6LA 1DJOA 3GH3A 2C58A 3S44A 1NNI1 2X0JA 3ND6A 4OREX 4R0VA 4QSHA 1IN4A 1M9NA 4Q21A 3CN7A 1KQ3A 5KKAA 1L4MA 2WRZA 2UZ1A 3T0IA 4ESEA 4TXLA 2FUNB 1EZ4A 3GOQA 2GM4A 5KHAA 4OLAA 3T3IA 2I7DA 2I2WA 2P5YA 3QITA 3W5IA 4W7HA 1YQDA 2BCJQ 1YS9A 4YMGA 3P0FA 1TADA 4O29A 1JFRA 1WOYA 4KPUA 5A4IS 3KUKA 5LKAA 2UZ1B 4F8EA 1RXYA 4M1ZA 3IQWA 3TCKA 4FR2A 4F91B 1JJBA 2OTCA 3CF2A 2GWHA 1G20A 3DV0A 1Z56C 3UJ7A 5HTKA 4MRRA 3VPDA 4N7BA 2AUTA 4L5YA 1E63A 2P35A 4FT4A 2VLBA 3PI7A 2C8LA 4JLNA 4KPUB 3F6YA 1M2EA 4R1OA 4WK0B 4NNPA 4I5GA 1PJZA 4FE4A 1QQAA 4NOMA 1ORIA 1LLDA 3DV0B 1SQSA 1V16B 1G20B 3HJAA 3KPYA 1OX5A 1PNVA 2WUGA 2Y92A 1XLTC 3L9WA 2OECA 1FOEB 3PC4A 4BQSA 4H7EA 2CLFB 3NORA 1A7UA 4OFBA 3LQRA 1FS5A 5IAEA 1TJPB 4G37A 3WO0A 5AJUA 3KQUA 5KJ1A 3E9YA 1PIWA 4NU8X 1XKLA 4OIFA 4KMMA 4DCGA 3EBLA 1AGNA 3LWNA 4JLMA 4YPVA 4RVNA 5CVVA 1PQWA 3QNUA 4RY9A 3IVGA 4OBXA 1ECJA 3VGJA 3F1KA 1N6KA 2RHDA 5BWLA 2XBLA 2WVGA 4IDEA 2C97A 3KYIB 2ZG6A 1DEAA 1ZOSA 4QU0A 3RTAA 4C4PA 1T5DX 2VYCA 2WTAA 1TU0A 4NE9A 4Z4HA 1Y8QA 1XMIA 1Y1SA 1JSRA 3M6LA 4QBGB 4UOQA 1ES9A 2OAP1 4HH4A 3EEIA 4YJFA 3STXA 1JHXA 3UMBA 4CMBA 1C2TA 1RJGA 4FGKA 1XRSB 4GRIA 4BMYA 1K2VN 2RHWA 4E4YA 3IUYA 4OQYA 4HFRA 2OHIA 4M0PA 5I3ZA 3G79A 3NH6A 4M7PA 1W85A 3HL0A 4WZBE 5K8JB 1QH1A 4WK6A 4D0RA 4WLVA 1A97A 3HWRA 1AURA 3CZ5A 1Y8QB 4RDIA 2FY8A 3MUFA 4YJFB 1DAPA 2CNKA 3N28A 5FNVF 5F4BA 3G17A 4BNUA 1LWNA 1O7JA 2FW7A 3F49S 2E3JA 1MOZA 3QBVA 3GEGA 3IUEA 2OBNA 2OGWA 4QM6A 3QLUC 1T1GA 1H1DA 1C7QA 4NJMA 1Q17A 4YRKA 3B53X 5KWIA 4WNYA 3IDFA 4WT7A 2X1HA 1XA0A 1JE1A 2VHTA 4MO9A 3ZCSA 2ACEA 2FGKA 3NIBA 4UTNA 2XUKA 3BE6A 2W2NA 2XYHA 3FLMA 1PS0A 2WJAA 3IOEA 2QVLA 4K26A 1TO1E 2AI3A 5I45A 4UHHA 3TOZA 3G7NA 3EVGA 2WFZA 4U7JA 2A92A 3T7TA 2LTAA 3D64A 3R23A 4E5VA 2QJOA 3ORRA 4BAGA 4HTFA 3HVKA 2G1PA 5ETJA 2ZRHA 1AKVA 1QTIA 3B1YA 4GOJA 5DLQC 1ZS9A 3I73A 3PIRA 4Q6WA 3H9JA 4LTMA 2LE0A 3PUJA 3U7HB 3QTBA 3AJRA 3WY9A 1TEVA 1E3TA 3RVDA 2WZQA 5F3RA 3SIWA 1FRFS 3T9CA 1AQIA 1X87A 2A14A 4ITRC 5H4GA 1ZNQO 4GX2A 3RS0A 4DJEC 3H1PA 3ODPA 1EVYA 2ACKA 4HTFB 3RCBA 1QBGA 4DR3B 1OTHA 4Q93A 2I3DA 4KNWA 5DYTA 5MDHA 5HKOA 2X13A 1N77A 4IF4A 3FDIA 2XYGA 1ZLYA 4JLAA 4K9NA 4YTEA 3VH2A 1ULTA 4OGKA 3ZQKA 2WUEA 3REQB 1ZK1A 3USCS 5I7HA 1I4WA 4NBVA 1H0SA 1S2IA 3Q40A 4JB2A 5JCOA 4RAQA 1C9DB 1XE3A 3OLXA 1IULA 1CCWA 1ULBA 4GMDA 2YQZA 1ADGA 3V4LA 1U6KA 3HU3A 3PGKA 3U4IA 1EP2B 2ZS7A 2AN9A 4GI3A 2X2FA 4WH0A 4A2QA 4CLHA 4V24A 3Q8LA 4AY6A 3I62A 4F6LA 4B3TB 4BEBA 4C21A 3E9EA 2Y1DA 3QE0A 3SKVA 1WF6A 2HSJA 3D1JA 2Y0EA 4MWCA 4RDXA 4JXZA 2GNAA 1XBTA 5BP7A 4K9SA 1L3IA 2HJHA 3VPXA 1EVLA 4NMMA 5JQGF 2GA8A 3B3JA 3DZJA 1E9BA 3PQ5A 2XODA 3S55A 4L74A 3X1DA 5JPCA 2PKRA 2A59A 1W5AA 1Y7HA 3ZE6A 2X0IA 2QM7A 2ZRQA 2CLKB 5AK0A 1CZKA 3UA4A 3BJIC 3ZCVA 1MC4A 1WU8A 4BO2A 1B76A 1J2EA 3CS3A 1E4EB 2BVNA 4B80A 3EEBA 3QU7A 1B2LA 5JYCA 5D6OA 1AGYA 3QPVA 5D1HA 5LUAA 1A69A 1SBHA 1HL7A 2ZQYA 1KFKB 3PSHA 4KYIB 4LQLA 3PJRA 3EY9A 3FUXA 3U81A 2YZKA 1C0IA 3BD9A 3EDCA 2WSIA 4OQ4A 4CN9A 1FS4A 3PFCA 4QTYA 4MV5A 4OA8A 3UICA 5DM60 5IXSA 3B48A 1KARA 5FWNA 1R0SA 2G4VA 2VZEA 4E7OA 1G5FA 1OAAA 3TSAA 1RLUA 3BE5A 1ODSA 2BISA 2V54A 1Y6FA 2PQMA 1E92A 4D92A 1I1QB 2BMWA 3LBFA 4JLPA 4X7BA 3FWHA 1SIUA 3ZZTA 1G60A 3OIUA 4F2GA 3W5JA 3OX4A 1WKBA 3NO4A 3SGLA 1KI2A 1QIDA 2HRQA 4WY2A 1VJCA 2PYIA 2II6A 2PH1A 3WIOA 1FMJA 1L6IA 1ZA2A 4BAZA 3GPBA 5ALOA 5EQFA 3D6NB 1HOXA 3DO8A 4IHJB 4KSCA 1MB9A 4ZVSA 4B0PA 2GEKA 1LDYA 3QKWA 4BE7B 1JAIA 1YJAA 3MF4A 1HE3A 4WI1A 1ZL2A 3I9V6 4LRSB 2HN9A 4U2DA 3G5UA 4HYYA 1HDGO 1VG8A 3CZAA 4U3JA 3SHOA 1U02A 5KTPA 3UCEA 5JNWA 5K4HA 4EUFA 2CKMA 2GD6A 1DRUA 2VA8A 4IJVA 3RBXA 1Z29A 3EAQA 1CETA 1KU6A 5FYDA 1H05A 4IQ4A 3NJRA 4TXHA 3SKXA 1YULA 4U3JB 3JQ9A 3F6CA 1V9CA 2FJ0A 5AVSA 1KPGA 5EXXA 1I6KA 1Z4OA 4GRDA 3L3BA 3H4MA 1MO4A 3A9WA 3FR7A 2M6RA 3KSDO 4L8WB 4ARIA 4HLQB 3DDUA 4OK5A 4Y6OA 5BUCA 5K45A 2XMZA 3IP5A 3ZHVA 2OG2A 3O4HA 1WUIS 4B3MB 5I7OA 2AMYA 1SC4A 2DPLA 2JAXA 3BB1A 3OZEA 3ZCXA 2YOFA 2V98A 3GDFA 4PVCA 4FYXA 1NWHA 5F9HA 4F6RA 3R3VA 4FWBA 5BSKA 1ENOA 3OTHA 4E5KA 2LD4A 4TRRA 3BGSA 3OTIA 1ZJ4A 3MS2A 3BGDA 3QXHA 1QQTA 5I9MA 4UE6A 3ZJTA 4RUKA 1JT9A 3TBKA 4YK7A 2NZYA 1NAIA 1M1NA 3PDJA 4F6RB 1BAPA 2MIIA 1ZGGA 1SRQA 1XP8A 3Q3EA 1KYVA 1JDTA 1OYYA 1TC1A 3G7UA 4LIPD 4C7XA 3SFZA 1LBTA 2JAQA 4FYJA 4Q4DA 1Z39A 3CV3A 1KS2A 4DLUA 2PWZA 4DLYA 2XXAA 1FQOA 4P36A 1FSZA 1XMVA 1SKAA 3IERA 1M1NB 4JWKA 1D7AA 3FPAA 3R0JA 5B53A 2BI8A 1K63A 1F0NA 1EFRD 2DQYA 4ZQFA 1XZNA 4WJKB 3ZU5A 1WUHS 4H1TA 2I6TA 5IP5A 2XXAB 3CUTA 3EK2A 2G8LA 3WE7A 4A8JB 4Z7QB 1RBZA 2IZOA 4URZR 5L3SA 3UOWA 2VDKB 4AKSA 3R7LA 1G4HA 2L0XA 1OFUA 3A4MA 1R0WA 3N2LA 3HACA 1EFRA 4RVDA 3MRTA 4JJEA 4V0ME 3REFA 3ZJ5A 4GLOA 4IRXA 2Q29A 1JILA 3DH0A 1IZYA 3BE8A 5L3SB 3IIIA 1KBOA 2O0KA 3C3AA 5A6VA 4F4IA 1O8BA 2VK8A 2YJ5A 2HB6A 3GJXC 1J49A 4WDQA 1Z17A 2Q99A 3DE4X 3Q9LA 3ROTA 4DWOA 4OYYA 2G07A 2VJKA 4K86A 1I2CA 2A5YB 1PR3A 1JIQA 9LDBA 1EWQA 1E2JA 2PMKA 3ZBUA 1VE3A 4CMHA 1NBWB 2VZ0A 3IUMA 5IKEA 3EYAA 4YJHA 3V4ZA 1R0YA 3JWGA 3Q2OA 5CDFA 3U4DA 3QJYA 3VI4B 2CDNA 3GJ5A 1W47A 3H4TA 2F8SA 1C7FA 1C9EA 3WJAA 3H3XA 1YU6A 4WE3A 2IX3A 3ZE2B 2GFIA 3KXKA 3EC1A 1IVYA 1MF7A 1CZRA 1KPIA 3C8ZA 2ZUSA 2NZVG 4YJHB 2A9JA 3WLMA 1XCPA 4Q4HA 3HO8A 1ZGHA 1PEDA 2YVQA 3PQ8A 2KMLA 1TAGA 3HO6A 4FFRA 3TM5A 3BXFA 4CMCA 10MHA 1ZJJA 1OFGA 1FBTA 4NS4A 4MRVA 4D8YA 2A4MA 1JFSA 4EYOA 1GRVA 1F5NA 4NS1A 4XR4A 3Q6IA 4Q4HB 1JDVA 2ZRJA 3DDCA 3C45A 4GPD1 2OO7A 2H0QA 3ENVA 4IDOA 4N65A 1A88A 2JGFA 4YREA 5KX5F 1JXAA 2KBEA 2DRIA 2VUHB 3OECA 1NJFA 5I3CA 4RA6A 1ZD2P 2A88A 4BGUA 4B6JA 5LN1A 1U2PA 1PT6A 1JU4A 2NM0A 2D0IA 2V03A 1LTHR 5JXHA 3NHYA 3W6OA 4EG4A 2R84A 1T2DA 4GQIA 6PFKA 5K51A 2E89A 1LRKA 3E48A 1M3SA 4INOA 1KVUA 2FPXA 4RA6B 1L5KA 2QPLA 1NIPA 5AKJA 4KR3A 5JARA 3M7IA 4R1NA 1E69A 3KWMA 2AB0A 3SZ3A 4ENRA 1VMIA 3MB8A 1Z9BA 3WJ7A 1FA9A 1SKMA 5JLJA 3FZNA 1E6KA 4OFXA 5BQ5A 1U28A 3STTA 1S8AA 4Z5XA 2AOXA 4FUQA 2GD0A 4F93B 2PUCA 2ADMA 2H4ZA 1BD3A 3RAEC 4A7PA 2X1VA 2ZS8A 3WMGA 4NZZA 3IP6A 4WN9A 1L3BA 4WVLA 2GRAA 1QLHA 3LBIA 4H3VA 2Q5FA 1LZKA 3M4JA 3IPYA 2RE8A 2IU3A 1IATA 2Q7OE 2XZLA 3AK4A 2EW8A 1DAEA 4QDOA 1PRYA 5JXGA 3KEGA 1GU7A 5TB5A 5LCXA 1XU4A 1W4LA 1WCYA 1ISSA 2WAOA 3G49A 4BO4A 4PBSA 3QVMA 4HGZA 4PQFA 3SZGA 5C8VA 2VRWA 4IQFA 3PX7A 4MHTA 4D42A 2P2CA 3E4CA 3KLMX 4WW0A 4O6VA 4B84A 1XTSA 2Z3VA 4EZBA 4YT8A 3TRKA 1LI7A 4RTRA 4EFLA 4TL6A 5IFKA 1CZHA 1BVRA 1W76A 3AJ8A 1P80A 3WGTA 3WTCA 2Y0CA 4NXMB 3ECCA 1Z62A 4IPTA 5BWMA 1X38A 1UBTS 3H84A 3SCZA 2Q28A 3JZDA 3IMEA 1E0JA 2VDJA 1LBSA 1R1DA 2RKOA 3QEKA 1AS0A 3DTYA 3O0TA 4O2AA 5DYNA 4B4WA 3FH0A 1K86A 2AZ4A 3VO2A 3IMGA 3DYIA 3V00A 4CIDA 3OJXA 4IFIA 5CXQA 1CNFA 4RK7A 3RF6A 4B82A 4J7XA 1BU8A 2CT8A 3WGOA 2CLMB 5KOHA 2IYYA 4K6CA 2YC4C 1FX0A 1F06A 1NVTA 1ZI8A 2GVDC 4ENPA 3GT0A 2IYZA 3EUWA 1TMOA 3LA6A 3NHRA 4O2AB 4L16A 4EGAA 2HCFA 1XQXA 3NUZA 4XVUA 1CF9A 4H17A 1QHSA 3U7GA 2VJNA 1ND6A 4KQXA 1L4HA 2F8LA 1J25A 1ID1A 2O6HA 3H1EA 3PHJA 1I7SB 3IOBA 4MQUA 4ZMSA 5KOHB 2PH7A 2J6IA 4E33A 2EGHA 3EQ9A 4OHWA 1TAUA 4JITA 3T7AA 3JYPA 1X74A 2HIGA 2QN7A 2WTNA 5AUQA 2R6R1 2E5LB 5E0KB 3SN6A 2B8TA 4D82A 4ETWA 5BR8B 2H9IA 3RYHA 3UHJA 4Y6RA 1TTHA 5CLJA 1KEWA 1SBCA 2X1LA 1L9XA 4HGOA 3VNAA 2RGBA 3DMDA 1KEUA 4F97A 3FG9A 2F2TA 3WFJA 4D4LA 4UATA 1JIIA 4EEKA 2QX7A 2VP9A 1BYUA 2H2WA 3RYHB 1N2GA 1X1CA 1ZYUA 2CLDX 2G25A 2XH8A 3CCFA 4G85A 4LC0A 2R2AA 1JLLA 3WHIA 4W9NC 2YIVX 1IVNA 5B7QA 5KNDA 2EKBA 2W43A 2OOKA 4HDOB 4B74A 4OMCA 4JQZA 1MNAA 3R3ZA 4ZVVA 1EUDA 1WB4A 5HXAA 4DB2A 5DP1A 1VFPA 4YIHA 1KZ4A 1U5CA 1GNRA 2WW8A 1OXVA 4KR9A 1JLLB 1BGXT 1E7YA 2ZR0A 3AFOA 3EXFA 5TDHA 3SIRA 4P4NA 3ZW9A 1N7JA 1VSBA 2HK6A 1M2NA 1I33A 4BB9A 1EUDB 4XFJA 1XXHE 3DZ8A 4BGDA 4GP6A 2GOYA 5BNTA 2ZVPX 5IVDA 1HX7A 3BXXA 3VR4D 5LZ4A 3EXFB 2H2IA 5TQVA 3VC3A 1S2OA 2HHCA 2GXUA 3MT9A 3GD5A 2HA0A 3OQVA 1XNHA 5D5PA 4G97A 1U3FA 2WF5A 3HDYA 5MN6A 4C76A 1X92A 2O19A 2BT4A 1YQWA 1TK9A 5F2NA 3RO7A 3UWDA 1V7QA 2A7XA 3BOSA 1S02A 2W6ZA 2WC1A 4PCAA 4WASA 4HCJA 3T1OA 3WGVA 1QGYA 5IN5A 2XDQA 3R3YA 1SCDA 3E9ZA 3OG9A 1E6LA 3UUGA 1OROA 4DYHA 4NI5A 2HA5A 3RG8A 3AKYA 4B6OA 1UADA 3FI9A 3LPLA 4OHXA 2AMLA 1SG0A 2OBMA 1M6VA 3A6EA 3CZPA 8ABPA 4NPCA 2V7EA 4F7DA 2XDQB 1FMLA 1LUAA 1CDEA 4NV3A 1FDIA 5LBTA 2JGAA 1JDBB 3LX4A 5LNK6 1S2DA 3I09A 1GTSA 1H8EA 3V1YA 4MYDA 3QVUA 4UTPA 3K32A 2VJMA 1L4KA 3ER6A 4W7SA 1I2MA 3CZMA 1M6VB 3H04A 4L78A 5FIUA 5SZJA 3W78A 3EYWA 3FCCA 1VZ2A 3L07A 1P4SA 2PPVA 3CEAA 4QJ5A 3VKFA 3T94A 1Q1QA 5HK9A 3P9PA 1X39A 4KODA 2DFLA 4XGKA 3CR8A 2VBFA 1MEOA 3WWCA 4QUDA 4EYEA 5H0IA 2VJMB 3I23A 2D5BA 1NDQA 3RSHA 3G9UA 1CPYA 3QYPA 1DAMA 1EU1A 3MK31 1D0IA 3HZRA 4KAAA 4EJSC 3O8QA 4DANA 2BONA 2ZRNA 2ZJBA 1E1CA 3BERA 5KREA 1D2RA 2XTAA 5EQTA 2YY6A 1KI4A 3WFIA 3G59A 5AW2A 5BR7A 1QH9A 2ZU6A 2OD9A 1ELOA 2NGRA 1UBUS 2NXCA 3O74A 1G9XA 3PXCX 4WIAA 5B58T 4UUBA 2VQEB 5K2MA 2GVNA 3GJTA 3O8QB 2ZTUA 4GUAA 2OZEA 1C3VA 4XQ0A 1HLFA 1K5HA 2CJYA 2YY7A 3AB3A 3HN2A 4RLHA 1E1CB 1O3YA 2J5XA 1Z83A 1V2GA 1KOLA 1GOTA 3JQFA 1GGMA 1QOQB 2WJIA 3OIFA 1DUSA 1ZH4A 5A2GA 2F3SA 5EUMA 3NWEA 4P92A 5J40A 3ZJVA 1C7IA 3ZQ4A 5G1NA 3UVEA 3MJVA 2KYRA 2HPHA 3GGSA 2NP6A 3KE8A 4RHYA 1N8SA 1DINA 2XNJA 2O7VA 4JJ4A 5COBA 3SZLA 3I5YA 3WWOA 3D6FA 4UXIA 5CNJA 4W5OA 4TN5A 5AVVA 4ZAFA 2RB5A 1W88A 5KJCA 1TVCA 3FHJA 4IVQA 5KWSA 1G8HA 1KZ6A 4AN4A 4JYAB 4B48A 3DHWC 4RABA 1P3JA 1HYGA 4DM3A 1YCFA 4CKEA 3FR8A 2Y05A 2YHAA 9ATCA 2XCQA 5LQAA 1UOEA 3FWNA 1A5BB 1UR5A 2YKGA 3FTEA 1E79D 3S0JA 5I4IA 3TSWA 4KXQA 2EEZA 1AHIA 2NTVA 4O2LA 2CMFA 4PHHA 4Q24A 1W88B 4BOYA 1AGXA 4YV2A 5BOSA 4BYMA 4QYXA 3ZW7A 2FPRA 2EKPA 1V5GA 2I6QA 4DAEA 4H77A 4CU5A 4CKEB 1P7YA 3JQBA 1CR6A 4AVYA 4DJTA 4NNJA 2WFAA 4WCFC 4K9QA 2DP4E 2EKQA 1UPXA 3O8BA 3LVBA 4UMFA 4BLVA 4MV3A 1CKEA 3KQOA 1E79A 5BOSB 3PXBA 3UOGA 3IT2A 2GN4A 2FWMX 1PZEA 1P33A 1SVKA 5FHRA 1GPAA 3P0IA 5B58C 2QX6A 4NR0A 3A3NA 4DSUA 2NZ2A 2RGRA 1YB7A 4ENQA 4Z86A 1ZW6A 1DKNA 1GT91 2AG1A 5J23A 2D2IA 1E2GA 3FPHA 2VAXA 3N8GA 4DREA 1U0BB 1XZGA 4FTWA 1EDDA 4RFLA 2DG2A 5F7XA 3NTVA 5IDQA 1N6LA 1C30B 1ZGCA 2P9GA 4KQ2A 1CIJA 1XF1A 2OCXA 2GFQA 2BEWB 3H1FA 1Z2PX 4BE9A 2QTFA 2E4XA 2GKGA 1DKOA 1V11A 1N6IA 2ZAOA 4JI1B 1K4YA 1QO7A 1XXLA 2JZCA 2A1TS 2PDAA 3AEZA 3HPQA 3MA0A 1JKMA 3OFKA 1V3UA 1XG5A 2QJFA 3VR6D 4CIYA 4KAXA 4J0KA 4ZU3A 1YHNA 3DNMA 1VZ3A 2E82A 3O1LA 1J33A 2O59A 1NJ8A 3QBDA 3W8NA 3VHXB 1L7VC 1GGHA 1RW4A 2D5AA 3AW8A 4KW7A 2O5CA 2DUNA 5JD4A 4BL5A 1P4JA 4XWTA 1OFHA 1M6YA 2B35A 3RARA 4CLOA 5CFMA 4Q16A 3OM1A 2FF5A 3RROA 3QPWA 2ZZMA 2GXSA 4MUIA 3VR6A 4AW9A 3K9NA 2YFYA 4TQGA 2NSYA 4KO8A 5EP4A 1H4QA 2D54A 3KIPA 4AI6A 3AYXB 4R3NA 1KR5A 3VR0A 3TUJC 2EW1A 4XEUA 1C80A 4A10A 4N82A 5CCBA 4KGDA 4QXAA 2GCIA 2IZZA 2V96A 4CLOB 16PKA 3IULA 1YDGA 3TRDA 1YCHA 3PI6A 4WA7A 1T1JA 4NCNA 4DJJA 2G9ZA 3EGWA 1MT0A 4N49A 1GDTA 3FJOA 1G5PA 2I62A 1XNGA 2C83A 2JIRA 2VH1A 3PWZA 4TMWA 2DPHA 4AG6A 5C32A 1N2EA 4NRDA 3N0TA 5ICMA 4HI0E 4JBIA 4UEKA 3BFXA 2NUTA 4HVLA 3CLSC 3I64A 2ZUTA 4PONA 2ZJ8A 4GI1A 3W7VA 2W42A 2XVYA 5J5VA 4D3ZA 2RAPA 1SHLA 2X14A 1IMOA 4YAWA 3WNQA 4KACA 1B1AA 1CJBA 2WA1A 2NUTB 4ID3A 3FOAA 3T1TA 3W8DA 5C4IA 2ZEJA 4N0QA 3ILVA 4OMFG 5CPBA 3H1AA 1ABFA 5G4LA 3GJ6A 4E09A 2H4FA 1QF9A 3ESQA 3HGQA 4AWXA 4HGNA 4IIFA 4UU7A 2GX6A 4X9XA 3I0ZA 1AM4D 4ZCPA 1NQTA 3O5AA 2C2OA 4H7DA 3I04M 2R4TA 3T1YB 2GD1O 4HXYA 4Q19A 3WQHA 2ZR9A 1PJ3A 2PFGA 4C1NA 4CM8A 2X9LA 3ETGA 3COVA 4ZCIA 1UMKA 2W90A 1GNTA 1IQRA 3NBUA 2IXGA 1AF7A 3H86A 3MJSA 4KXYA 4ND7A 4UNIA 5ES3A 3S4YA 4KO2S 1HTWA 1R5JA 1UBNA 1Z6ZA 2O5VA 3OQ6A 4NK4A 3BH0A 5BVHB 3ILXA 2H2HA 5CX1A 2F62A 4YRPA 2DGDA 5TXGA 2I66A 1USWA 4LX8A 4GKKB 2PRYA 3VU3A 4ZTUB 4D25A 3GU3A 4IKPA 3HDQA 3WIEA 4EPYA 2VWGA 3CPJB 4PQYA 3TLXA 2XKAA 5CX1B 5F5NA 5K8CA 1L4GA 2A9VA 2VXYA 2WG1A 2FPPA 4O4LA 3DMPA 5C1IA 1USKA 2B7BA 1KPHA 3QP9A 4JQSA 5GONA 3TCNA 3WAKA 3R9WA 1KERA 1YRWA 3VPAA 1YI1A 4PLVA 3P9NA 4WNIA 3C7CB 3IXLA 1V71A 3NM5A 1JXOA 3BQNB 2FPPB 4O4LB 2WNIA 3KUXA 5IBPA 3V9PA 2VTBA 4N8DA 5GONB 4GT1A 5BV8A 1DQZA 2G5GX 3GYGA 1YJQA 4MS1A 5HNKA 2ZIEA 3DO5A 3BMXA 3HCCA 1ONBA 2JBAA 4Y30A 1GQRA 4M9UA 4OHVA 5HDQA 4A1FA 3TN7A 1HNNA 3D8RA 3C98A 4CR6A 3P5BA 1R8YA 1XEFA 3NTRA 4FKMA 3AEUA 3W6UA 2VTBB 2NVWA 2R47A 3ELWA 4JI5B 2PZAA 3V8BA 1W4AA 4MS1B 4BVHA 1EVZA 3E18A 2XQFA 3VNUA 4J1SA 2JBAB 1SHKA 3A7DA 4EPWA 1M1YA 5ADVA 1XVAA 3CIFA 2YN0A 3F4LA 1W5EA 3UC5A 3AEUB 1LD3A 1XV5A 2Q9UA 4QXRA 1RXVA 2H4WA 2OFWA 1L4EA 2CFTA 3ZJ4A 1AN9A 4F71A 4GDMA 4DA8A 4JSRA 5DN9A 2A1TR 1XCBA 2LZ0A 4KBGA 1L1EA 5JASA 5LVAA 4J6EA 3PTAA 1E1YA 3C5HA 3FDZA 4H4DA 4N5IX 5EKSA 2ZT7A 1JECA 3IAEA 1XYYA 2VPTA 1G41A 3AY0A 5EJFA 2HT6A 3BC1A 3OPNA 3EDQA 4LF7B 1SVSA 4KU4A 2BGTA 2Q3BA 2RH9B 2XI4A 4IAOA 1ENYA 1S3IA 2IP1A 2JKZA 1T8SA 1BU5A 3FDZB 3L8EA 3FI0A 3G23A 3HDVA 1TKBA 5B6JA 4N12A 2PKQO 5THQA 2YDYA 4DAOA 1I1HA 5IPFA 1KTIA 2QV7A 2Z6AA 3HU1A 3AZOA 2QTVA 2IKQA 1W0JD 1TYEB 3OIDA 2ZYIA 4OI1A 3QEMA 3W7AA 5FV7A 4A0RA 3SXJA 3FGPA 2DUJA 2C3MA 4Y18A 3R6TA 1USIA 4U7FA 2ZJFA 4LGCA 3DZIA 4P53A 4PU0A 5ERGB 2HMUA 2I67A 3LWBA 4KQGA 1UFOA 1WO8A 5ARCA 3IJ5A 2EFGA 3AWIA 3NBAA 2R00C 3UMRA 1UK7A 3QEMB 5HW0A 2CXHA 4L9RA 2WHPB 4QAQA 1PQ4A 1ZC4A 4RPKA 1JV2B 5DI3A 3TMYA 5DM0A 4DQUA 1Q20A 5LJLA 4BVAA 4L0DA 3B9QA 3X2SA 4C88A 3IUQA 3QEOA 3FD8A 1XRMA 1Z0AA 1ORWA 1R5OA 2QQEA 2ZE6A 3EOZA 4KQFA 1I2AA 1A5ZA 2PD3A 2WM8A 4XGNA 3C97A 1V8ZA 1KOJA 1Z12A 5FUXA 4G8JA 5DI3B 3FRIA 4BJ3A 3UK6A 1V1MA 3GN2A 4Z0NA 3TW8A 1AMUA 3W2FA 4RTSA 3O6VA 3VVLA 2PX6A 4J75A 1YIDA 1PWYE 1OQAA 1YOBA 3O4GA 1WUTA 3G2NA 3RHSA 1S4QA 3FHOA 1YVPA 1V1MB 1A2KC 3DFKA 3I8SA 3TW8B 3OZWA 5H7XA 4WOKA 2J0VA 1NW7A 4PAGA 2JGIA 1IU9A 3PWKA 3RBAA 1PFWA 2PPLA 4QO8A 4N6OA 5FBLB 2XNCA 3GLTA 1GFWA 4X71A 1FW6A 1ZGZA 1YVEI 3PNPA 1JHOA 3RF7A 3FE2A 4JROA 3DLHA 3MD0A 1F7UA 3QE2A 3AETB 2DBVO 5A9TA 4ALLA 3PBKA 4HFMA 5L7WA 1GPNA 1VIMA 4RK4A 3MILA 4MI1A 3EIOA 2ZJ7A 1F0YA 2PZGA 2EL7A 4MAFA 3T1NA 1QFYA 3DQPA 3O75A 1ZICA 4D9MA 4DCVA 3M1AA 5AW5A 2CL0X 4AXXA 1BA3A 3EVZA 3IQGX 4EATA 1R50A 2V7BA 4YN3A 5M2QA 4YEDA 1CUAA 1EHYA 4MVCA 3CZCA 4Y3UA 2LV8A 3ZWMA 1G6OA 1YZGA 5P21A 2RONA 3DLTA 5CA0F 2IUFA 3FCAA 2BMAA 3UWKA 2VTVA 5EVCA 1TD1A 1W4CA 4ZZ2A 3MPUA 2FRDA 4ABTA 1E9RA 4MVJG 3HSSA 4BZXA 5FI0B 3EF0A 3MPOA 4HB0A 4X90A 3CH5A 5EXDA 2P30A 4GZ5A 1I30A 3OZIA 4O0LA 4ENSA 2IHTA 1QQ7A 4C6HA 3VKHA 2PUVA 1NGSA 1U2QA 2GNOA 1Z7BA 4LBZA 5KTOA 2WT4A 3A58B 3QF7A 4EVIA 2QAGA 5EINA 4WECA 3KWJA 3G85A 3KM0A 4PAMA 1P8AA 1SU6A 1J5XA 2BUCA 2H8GA 4Q4AA 2EJCA 3U4CA 3WRVA 5IH7A 1SULA 1CP2A 1RVV1 2G0TA 2IXBA 1VJRA 3GRKA 3TTXA 1NMEA 1O95C 3MYRA 4C2TA 1QF6A 1EESA 4HGQA 1N32B 1WCIB 2PSEA 2QAGB 3VO8A 5BV1A 2A0XA 2ZIUB 3U80A 3RS7A 4OH7A 3ET4A 2W93A 3SF8A 4A2CA 4B9AA 5BUQA 1SVWA 2F1KA 2RHRA 3DULA 3DBLB 3QI7A 4HR7A 4Q4AB 2OBLA 4UVDA 2DM6A 2HXYA 2C5BA 1K0UA 2I76A 3FF1A 4D9JA 3X1WA 2I4LA 2H7VA 3G5AA 3N86A 3SAJA 2AX3A 2PU5A 4M0EA 3AJEA 1J7KA 2FH5B 2OZVA 3OHPA 5KVSA 4M8NE 5J2TB 4OBWA 3GEBA 3SF8B 3D3KA 1ISPA 4KLAA 3B1JA 4ZOLF 3GMDA 3RFVA 1JPVA 1IM2A 1DIHA 5GZ6A 4BVEA 1LZLA 2AEJA 4QPJC 4C0AC 3MWKA 3OF3A 3IEKA 4RVOA 2PUHA 1YA6A 2P4UA 4W9MC 4AC9A 1P5HA 5EP2A 2BELA 2ICAA 1DE0A 3OZVA 5C5EA 3KNZA 1XZMA 1W75A 1E5LA 3UYLA 4JELA 2ZYHA 4Q3KA 5T57A 5CVCA 2GSDA 5LP6C 1GUDA 4P93A 4F38A 1KC3A 4KXWA 2WYOA 1XU7A 5D85A 3PKJA 4ZAGA 5EIXA 2QQ5A 5B1YA 2DLCX 3KPWA 4QG7A 4YP5A 4IJWA 1IHYA 4R7GA 4Y2GA 3F73A 1WUJS 4NCHA 2J3HA 2CMGA 1HE5A 4I1RA 2EZTA 1QR6A 3EF3A 5EUCA 4YUWA 1U80A 4ZQBA 3PLAE 4FQ7A 2IL1A 1L4UA 1Y6GA 2VZ9A 2DJIA 3HCNA 3LHDA 2VSYA 4XTRA 2XVZA 5ILQA 1VJGA 1Z5VA 4C7VA 4QVKA 5HIAA 3AIKA 5I7WA 5KHLB 2RHJA 4F9EA 4RW0A 2A9PA 3BCSA 1Z4MA 1XELA 2PZLA 2Z09A 2X8AA 3HJHA 4ZARA 5FPYA 5AVUA 1VMKA 2NUAB 3EWAA 4FWTA 1NULA 4RWEA 2ZIFA 3LPCA 2VDPB 4DCPA 1L5VA 3MJRA 3WB1A 2VYND 3FSGD 4X7PA 1B7GO 4LAFA 2XGOA 3QKRA 5G2OA 1SVOA 2WTBA 1Y8ZA 4OA5A 3TI9A 1NZFA 3KVYA 1FBNA 1IHOA 2YV1A 4KH0A 5CA1A 1N7IA 4Z2YA 3AR2A 3FVRA 3LUHA 4E5SA 4R0NA 3RRZA 4XJTA 1CSEE 1IPEA 1XEWX 2X0NA 1E98A 1BDIA 4HWSA 2MYTA 4B9EA 3QKRB 1JJFA 2VYNA 3DG9A 1DBQA 3FSGA 4FI3F 5CLQA 3KKLA 2BBSA 2Z1DA 1UFRA 4B73A 2BM8A 2XCLA 5HMLA 3FUUA 3JZAA 1HEIA 4KR6A 2Z6UA 4N7RA 4AK9A 2C77A 4D0SA 3HH8A 2K2QB 3OCWA 3H87A 4XQ9A 5C4MA 5E6UA 5CA1B 4ALIA 1A4RA 1XLUA 2P4EA 2QW1A 4TMZA 9MHTA 1E5VA 2FEMA 2MWMA 2IOHA 2X5OA 4BKRA 4BXOB 2AJTA 4K9OA 4G1CA 1ZL0A 5I7UA 2KB0A 5D7BA 3I1JA 4O33A 5JDIC 3N9IA 2GHTA 1FVXA 2QYTA 1NW6A 1RWVA 2Y76A 1RRFA 5E6UB 2C98A 3SLKA 1U7DA 5EKXA 2I87A 1JHUA 2DQ4A 2G08A 1QORA 3TR6A 2ZRPA 2M2IA 3O83A 2N75A 4YV0A 2J0QA 1MFZA 4B40A 4OHFA 3GLRA 4J16C 4BO0A 1UJBA 2F9FA 1WMEA 2R79A 3FY4A 1QFMA 3RGWS 5HPYB 3JQRA 1Y9ZA 3E5RA 1AHHA 1JN0A 1NXOA 5EZYF 2FRXA 3OD5A 1ZCZA 1OXMA 2JFVA 1N5IA 4F4JA 3D7SA 4DJAA 1I0LA 5JD5A 2MINA 4RX1A 5IJAA 4A8TA 4MYCA 2WWVD 4D79A 3P9KA 2GPYA 4ID9A 5H3CA 5HBRA 2LIVA 4FYHA 3ABIA 2GHQA 3HVJA 1DOZA 5CIWA 3LPAA 1Y4SA 4AO8A 4S04A 1U90A 3MCAA 3C3DA 2P9EA 3F9IA 3V34A 4ZEVA 2R68A 4D8WA 1OIVA 2MINB 4MV9A 4NX2A 5F9FA 2PRIA 2OA0A 1P4GA 3C16C 3OFND 4U7PB 4UHKA 3SSNA 1GZ6A 3PVZA 3QVVA 4KQIA 1E9CA 2CNBA 1KHHA 1W25A 1W6UA 4YGYA 1LBQA 1OE0A 3UH1A 2WAXA 1T3GA 2WIJA 3BK1A 3H7AA 2HX1A 2YVAA 1N0HA 4FHFA 4GP9A 4LV8B 1E1LA 4U0KA 4WFQA 1QCCA 3UWPA 4M53A 2Q62A 3CWQA 1I6WA 1M34E 1Y3IA 3UHAA 2HI0A 1WCXA 3AUTA 3BWYA 3DUWA 4FEYA 2QN9A 4RZQA 1UKCA 1BE8A 1PR4A 3DEFA 4W8HA 2BGGA 1HQCA 2WB2A 1RPTA 5FAXA 1GFZA 2KJQA 5L4NA 2PX0A 3BDVA 2PSFA 4KVGA 1XZQA 3ROFA 2JA2A 1NTRA 3R3WA 4M89A 4ZT4A 4UUPA 1GA6A 1YIAA 4E12A 4B6GA 4FNGA 2Z4RA 1UZMA 4IGAA 4EGJA 5IHPA 3EMBA 5DTMA 3WGJA 3GBSA 4UXJA 1Z6TA 1A9TA 3B70A 3PD1A 1A76A 5C4GB 2PTHA 2FQWA 2FSGA 3ISJA 5AFSA 4BNZA 1QQBA 3BQMB 1XL1A 1QV9A 1DLJA 1W8DA 1XDWA 4JU8A 3QXJA 5A3VA 3B13B 4NBNA 4ZEXA 4RADA 1RZ3A 1FRVA 1E7WA 1JG7A 4QOIA 4M7OA 1KY4A 2MYUA 2A1UB 4G65A 1IPHA 2N1BA 5AH0A 3AEXA 1TQ2A 3IDAA 1E1QD 3ZVMA 1C4OA 4ZI2A 4JXKA 2FN3A 2CKDA 2Z2XA 2C3PA 4H15A 1EGVB 2PRKA 2FR0A 3KTDA 5I9TA 4RPCA 1WW3A 2HMYB 3MTBA 2ZYUX 3U3DA 5B2EA 3B6EA 4YJ3A 2YYYA 1K68A 5BYAA 5JAOA 2CMKA 1NVMB 2QRHA 1KEKA 1XMXA 2Z2JA 1QX3A 3GFRA 1FLDA 4GM1A 4FSXA 5CURA 5DTEA 1E1QA 3D8TA 3L4BA 4ZCMA 4NH4A 1ECCA 4KFTA 2HZ7A 1D1SA 5HMMA 5JI3E 1A8UA 1IHPA 1NP7A 1Z6AA 3D5TA 3QMMA 3S8YA 1JEQA 2VQ6A 2C0CA 3G9TA 4YJ3B 4URXR 1IC6A 2I4NA 4Q03A 3F9CA 4QA9A 5DYGA 4WXHA 4PSVA 2I6GA 4MUYA 2IEAA 1S2NA 2IIBA 3JASA 5SYNA 3VDQA 2C7VA 1P7VA 3UJAA 4V1CI 4N0DA 2Q2VA 1J8YF 1HBJA 5BW4A 2HADA 5LMZA 3LDGA 3RYCA 3BT7A 2V5UA 3ITNA 4L9AA 4QJBA 3HKCA 1F9AA 2QZJA 2Y2VA 3K2EA 2CHVA 5G4KA 1BDJA 1WVGA 4FNAA 1N36B 3CKKA 2O8BA 1OA0A 3JASB 1EK0A 2LBPA 4YMSA 2DXIA 1FMFA 5KSWB 2AR7A 5EUQB 2C20A 3NBZC 4DLKA 3RYCB 4TYWA 3V4PB 2OLKA 2YV5A 2IYLD 2C4WA 3HKCB 3JXEA 5EJGA 1U9YA 2XT0A 2I8CA 3OEHD 1Z2CA 3O93A 4DA0A 4ZYWA 1BQEA 2XUGA 2J33A 4NBSA 3JPWA 3EIUA 3FUVA 3UJ8A 1M6NA 3CISA 1N2SA