1R74A

Crystal structure of human glycine n-methyltransferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
275
Chain Sequence
b'YRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine N-methyltransferase
publication title Glycine N-methyltransferases: a comparison of the crystal structures and kinetic properties of recombinant human, mouse and rat enzymes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 275
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1r74A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r74A02
5EZQA 3LECA 5LQAA 3A25A 3CJTA 2CWWA 2IBSA 4FT2A 5IKMA 3GDHA 5EZSA 2ZZMA 2FK7A 2ORED 3EGIA 4QPPA 3UJ7A 5IH3A 4DA4A 2IP2A 1QANA 2PSSA 3I53A 4GBED 5CVDA 3UFBA 4WVLA 5ICEA 1U2ZA 3GO4A 4QVGA 1NKVA 2ZZNA 4EK9A 1JQEA 3DXZA 3HCBA 1IM8A 4MTLA 1YF3A 1SG9A 1XDSA 2XYVA 3M4XA 3M70A 2WA1A 3SR4A 3UJ8A 5E9WA 5FCDA 5LQNA 1X1BA 2DPMA 3E23A 4PGHA 5HZMA 1D2CA 1AF7A 4LECA 1FPQA 2IH4A 4Y30A 3HVJA 5ICCA 3NDJA 4KDCA 4RWZA 4RV9A 4F84A 1TW3A 4E2ZA 3CVOA 3ER8A 2Z6QA 3NW9A 1UIRA 4QPNA 5GM1A 4AX8A 2V7EA 3HCFA 3PX3A 3FPGA 2ZBRA 3U81A 4YUZA 5EKUA 3V97A 5LQUA 3B5IA 3C6KA 5HIMA 1FJXA 4YMHA 4CKBA 3O4FA 4YV0A 5EMKA 2YXLA 3EMDA 3HEMA 1INLA 1KPIA 3KQTA 2ESRA 2GH1A 1QAMA 4PCLA 1ORHA 4EKGA 1RJEA 3KPYA 2O0LA 3G2QA 4ATNA 4PYMA 4YUWA 3EVEA 3MCTA 5M5BA 3DOUA 3OCJA 1R18A 1G38A 4GUAA 1XTPA 4RTMA 3C3YA 3BWMA 4RTQA 3B3GA 1V39A 4BY9E 4HRAA 3V8VA 2F8LA 4PYNA 3NWBA 2CMHA 4LWOA 4PGGA 5JUWA 5CM2Z 2JG3A 1XVAA 1JSZA 2JHPA 4E33A 3G8BA 2NXEA 2N47A 3GRZA 3OE5A 2C7QA 2NP7A 2P40A 1SKMA 5EMLA 4X41A 3TM5A 4YUYA 3MQ2A 1AQJA 3NVMB 4QQNA 5E2AA 1QAQA 4MIKA 5KVAA 3HCDA 5JR3A 3FTFA 1KPGA 3FTDA 1P1BA 3DUWA 1WG8A 3RIEA 1NBIA 5CVVA 4IV0A 1EQAA 3BGVA 4GOMD 5EG5A 1FBNA 1YZ3A 2OB1A 4U7PB 5FA5A 3LBFA 2HNKA 3PFGA 4R6XA 1XXLA 3VC1A 4C05A 5DM0A 3TKYA 1P91A 3JWHA 4M38A 4IWNA 1X1DA 5GWXA 3THSA 4RTNA 3EPPA 1VE3A 2ZBPA 3OFKA 4DF3A 1VLMA 3GGDA 4PYKA 4E30A 2P8JA 4PNEA 1KXZA 2B9EA 4DCMA 3P97A 4ISCA 1BC5A 2QE6A 4KDRA 2ONZA 3T7TA 1M6EX 1NW3A 2PWYA 3CCFA 2BM8A 4FSXA 1SUIA 2BH2A 4FR0A 1RJGA 2FK8A 2PX8A 4JXJA 4AUKA 4BP1A 4BP3A 3REOA 4RTPA 3LGAA 3NWEA 3P9NA 1R74A 3BGIA 4HGZA 5EPEA 5C9ZA 4KRGA 5DX0A 5EVJA 5E8RA 2QRVA 2YTZA 2PBFA 3JWGA 4PYOA 4Y2HA 3NMUF 1EJ0A 1RI4A 3K0BA 1B42A 1NW5A 5HIJA 3BUSA 4RTRA 2PXAA 3O7WA 4RVHA 3PTAA 5FADA 1TW2A 1F3LA 4RTKA 5EOVA 2FYTA 5C0OE 5D1NA 4GF5A 3FTCA 4QQKA 3TLJA 2AOUA 3GIWA 5EGSA 3ID6C 3SM3A 5DX1A 1X19A 2AOXA 4RTOA 2BR5A 2PT9A 3HCCA 3A27A 3I5UA 5DM1A 5G02A 4M37A 2VDUE 2KW5A 2GPYA 5CVUA 4AZWA 4RTJA 5CVJA 2PGXA 3IYLW 2AR0A 3TQSA 3OE4A 2ONYA 2YX1A 5K8VA 2ADMA 4QVKA 4RTSA 3ERCA 1NV8A 3C6MA 3P8ZA 3KPJA 1G8SA 3O31A 4HC4A 2P7HA 3EVDA 1KR5A 2P3QA 2GAFA 2IGTA 4GOND 2OXTA 4AZSA 1UFKA 1X1CA 1OR8A 2OB2A 4EKIA 3TMAA 4V0RA 5DPMA 1I1NA 5K0JA 4RSRA 2A14A 3KPWA 4FP9A 3UJCA 3FPJA 3DP7A 1IY9A 3QOWA 1KIAA 1XCLA 1O9HA 3MCZA 4E70A 5F2KA 5BW5A 3KQMA 4X1OA 2OZVA 2YUIA 1HMYA 1ZGJA 4M7RA 1X1AA 2VS1A 4RTLA 5DTRA 4DQ0A 1L3IA 3I58A 4IKPA 3FRHA 3NVKI 1RJDA 3SVZA 5EHGA 3MB5A 9MHTA 2C7OA 2IPXA 4FSDA 3G2OA 5DXAA 1WXXA 3ER9A 4ER7A 1YFJA 2EFJA 5K0BA 2GS9A 1JQDA 3P9KA 1EIZA 3P9CA 4OBWA 2YVLA 2PXXA 3OU7A 3QOXA 3QV2A 2OO3A 3VSEA 2B25A 2HWKA 3HNRA 4GEKA 5B1SA 4C08A 3EGEA 5K0CA 3FUXA 3JWJA 2AN5A 2NYUA 5EEHA 3E8SA 1JG3A 3EEOA 4LG1A 3HCAA 3KPUA 2EJTA 3PX2A 3B3JA 3G88A 3FUVA 3UA3A 1JG1A 3DTNA 4MQ4A 3AY0A 4X61A 5FA8A 3CKKA 5DSXA 2PY6A 2VDVE 4CWAA 1M6YA 3E7PA 1QYRA 4O29A 7MHTA 5DTQA 2PWPA 2JHAA 3S68A 2Q41A 2ZFUA 2H1RA 1AQIA 2O05A 3ELDA 3BZBA 4PCAA 3HTXA 3HM2A 2C7PA 4YUVA 4P7KA 1WXWA 5FUBA 3KU1A 3ELUA 4HTFA 2FCAA 2AZTA 2ZIEA 1SQGA 4KIGA 5DRTA 3SMQA 4GC9A 3LKZA 3PLAE 2OYRA 2OKCA 2R3SA 3OU6A 4RVGA 5DM4A 2AN3A 1NW6A 1RI1A 2PT6A 2Y1XA 4PIMA 4ER6A 4YUXA 5T6BA 3GRVA 4V0QA 1DL5A 3HCEA 4XCXA 2BZGA 1DUSA 4FT4A 1VIDA 3OZTA 1AV6A 4P7FA 1JR4A 2PKWA 3FPEA 2B2CA 3FPFA 3C3PA 2IDKA 3LL7A 1JG4A 1SQFA 3E05A 3LHDA 3LBYA 5CD1A 5EQJB 2NXJA 5K03A 5LQCA 1L1EA 2ZW9A 3BKXA 2O07A 3GNLA 5HILA 1D2HA 5KYGA 5E1MA 3EVAA 4RYLA 2XBMA 4AZVA 4GC5A 3RW9A 2P35A 1JTEA 4CTKA 3B3FA 5E2BA 5KQSA 2UYHA 4QTTB 3P71T 1R8XA 4HSGA 2QM3A 3HA7A 1BKYA 3LDFA 1G55A 2XVAA 2YQZA 3KR1A 5E1BA 2C7RA 1NBHA 2EX4A 3D2LA 5DRYA 1O54A 2ZIGA 5DLYA 2ERCA 1N2XA 2H11A 4BLUA 1Y8CA 1L3CA 5T64A 3R0QA 4Z2YA 3VC2A 3FTEA 3UA4A 1PJZA 2P3LA 4HG2A 4IV8A 4DM3A 3P2EA 4E2YA 2UYCA 3DXXA 1L9KA 2B3TA 2ZSUA 3BWCA 3G7UA 3UJ9A 4NECA 1VP3A 3F4KA 3GU3A 3M6VA 4QDJA 2PX2A 4F85A 5HEKA 3X0DA 4XUEA 1D2GA 5EKXA 5F2OA 4X60A 4CKEA 3MGGA 2HV9A 1IXKA 1KYWA 5GIPE 2AVDA 3CJRA 1N7IA 3KQPA 3LKDA 5E1DA 4E31A 2XYQA 5DX8A 4E32A 5K0GA 3ELWA 3CJQA 3FYCA 5FQOA 3WSTA 2Z6AA 5K0EA 2IDJA 1XCJA 3PFHA 3A26A 5C1IA 3T0IA 2AOTB 4K6MA 5LR6A 5LSAA 4PYLA 2QYOA 5DT2A 2PVCA 3DLCA 1L3BA 4YV1A 1H1DA 2OPBA 2HTEA 2WK1A 1VBFA 1WS6A 4MWZA 3BT7A 3Q87B 3DLIA 4OX9Y 3BXOA 5CCBA 1DCTA 5EEGA 2LD4A 5GIOE 2YXDA 3GRUA 4FS8A 2PX5A 3JWIA 3A7EA 3CC8A 5E9QA 3GRRA 4KWCA 5ERGB 1M0EA 3NTVA 1XDUA 2G71A 2P3OA 2PJDA 3DMHA 3KQVA 4R6WA 5K05A 2G1PA 3G5TA 2VZ9A 3EGVA 2EJUA 4QTUB 3P9IA 3LPMA 3Q7EA 5HIKA 4P7GA 1YFLA 4L7VA 3MAGA 5E1OA 1MHTA 2IIPA 4EVIA 1G6Q1 2R6ZA 3DXYA 3KR0A 4LWPA 1MJFA 1WY7A 1HNNA 2FHPA 3DH0A 3R3HA 4G56A 8MHTA 1ORIA 1N7JA 1QAOA 3OU2A 3PB3A 4ZTBA 2YXEA 3T7SA 3EVZA 5K0LA 3LCUA 3PT9A 5E9JA 3SXJA 1KYZA 1UWVA 3CGGA 3KPVA 5DXJA 3KQSA 3DMGA 2PXCA 4OQDA 3TOSA 2GB4A 2XVMA 5DM2A 4C06A 3HP7A 3VYWA 5EMMA 3ELYA 5CUQA 5FWAA 3SSMA 2UYQA 5HOQA 1BOOA 1O9GA 2FRXA 3MTIA 1NW7A 4PYJA 4KIFA 1YZHA 1YUBA 5GINE 1Z3CA 5DWQA 5H02A 4BLWA 4P7JA 4YV2A 1JSXA 5P8WA 3AXTA 2PX4A 5GOZA 2I7CA 3UJ6A 4PIPA 1SVUA 2AOVA 2G72A 4CTJA 2YR0A 5EC8A 5K09A 2UYOA 4M36A 4EQZA 1P39A 1T43A 2XYRA 3HVKA 1VQ1A 2NNWB 2I9KA 1RJFA 2HMYB 2NXCA 3I64A 5FQNA 2IH5A 2AVNA 4DMGA 1XDZA 3KQQA 3A4TA 3M6XA 4A6EA 4MHTA 2K4MA 4GOOD 3BWYA 3SX0A 2O06A 1F38A 4OQEA 1TPYA 4C04A 4POOA 2P41A 3MTEA 4PYQA 1NE2A 3A7DA 1RI5A 5ICFA 2ZWVA 1FP1D 3EMBA 4E2WA 1Q0TA 4ER3A 4GQBA 5GM2A 3TPZA 3L8DA 3SGLA 2P7IA 3G2PA 3H2BA 5LQRA 3NJRA 4XUCA 1KHHA 3KQOA 2AS0A 4RVDA 1JTFA 5BW4A 2NXNA 2ZLBA 3LSTA 3LCCA 2JJQA 4CXMA 3GCZA 3TFWA 4FZVA 5LQJA 5EIFA 1SUSA 5FHQA 3M33A 3TRKA 5LQKA 4DKJA 3EVBA 1Q0SA 2V74B 1JG2A 1KP9A 2CL5A 4B17A 3BGDA 1I9GA 2QRVB 1NT2A 1VPTA 4H0NA 3LX6A 1G8AA 5DTMA 4RVFA 5GP1A 5EHIA 3LCVB 3SSNA 1XJ5A 5KQRA 2IBTA 2E5WA 3FUWA 3UWPA 2BR3A 4DZRA 3HVIA 1JQ3A 1KPHA 4BLVA 2ZIFA 3G89A 4CKCA 5MHTA 5K0FA 1ZHFA 2AOUB 3KR9A 4HGYA 3MHTA 2GLUA 3UBTA 3KHKA 2FPOA 4F86A 2BM9A 4YMGA 3LDGA 3EEYA 3OZRA 3PVCA 4P58A 5FHRA 3CBGA 5CIYA 1G60A 1QZZA 1ZQ9A 1FP2A 2DULA 1EJ6A 2GA9A 2ZWAA 3FYDA 3FZGA 1ZG3A 3PS9A 1YB2A 4PYIA 4U7TB 5EMJA 5HFJA 3RODA 4FGZA 4C03A 5T67A 4PINA 1ZKDA 2H00A 3GWZA 2OY0A 3R9XB 2CMGA 3HA5A 4ER5A 2JH9A 3FPHA 4R05A 2JHCA 4KVZA 3GXOA 1EG2A 2UZ4A 2CKDA 3UJBA 3TM4A 5BP7A 2QY6A 5U4XA 1NW8A 1R6AA 3MERA 3HVHA 4QDKA 3FUUA 4R8RA 2WA2A 4OA5A 5D1HA 5FULA 1P1CA 3G8AA 2JH8A 5EIWA 4A6DA 2B78A 4DCGA 2IH2A 3GRYA 3IV6A 2Y1WA 4XUDA 3AXSA 5F2NA 4RX1A 3K6RA 1RI2A 3EVCA 2PV0A 2EG5A 3KKZA 1I4WA 3AWIA 2HR1A 4X63A 2Z6UA 2G8NA 1R8YA 3DR5A 3UJDA 5KS2A 3I9FA 3FUTA 2I6GA 3OZSA 3P2KA 1R00A 4GOLD 3UJAA 3AJDA 2ZULA 3ME5A 2AN4A 2IFTA 3DULA 3EVGA 4HH4A 5CVEA 3R6TA 5DSTA 4OBXA 4EMSA 2ZBQA 5ICGA 10MHA 2ZCJA 3EVFA 5K01A 3TR6A 3C0KA 2ZZKA 3G5LA 3IHTA 3KQYA 3BKWA 1EAMA 3B89A 3HA3A 3IEIA 2O57A 4R8SA 2BR4A 4AZTA 2ZVJA 1BHJA 5CCXA 4OA8A 1ZGAA 1VL5A 2VP3A 3ANXA 5FWDA 3T7RA 3G2MA 3TKAA 4KW7A 3OPNA 3BWBA 4ER0A 1WZNA 3M6UA 3M6WA 3P2IA 4PONA 5K0NA 3OFJA 3SSOA 3UZUA 4E2XA 3B7PA 1PRYA 2I62A 2PLWA 2AOWA 3ORHA 3R24A 4UOEA 5BXYA 2NP6A 3LDUA 2AOTA 2G70A 4HTFB 4C07A 2OBFA 1RI3A 2VDWA 5FTWA 3KQWA 2ZTHA 5HIIA 4WXHA 3DMFA 3THRA 2P1DA 3KR2A 3GJYA 5E8JA 3NDIA 4PWYA 1VP9A 1NV9A 3FRIA 4C4AA
chains in the Genus database with same CATH superfamily
1X7XA 3K8ZA 3CJTA 1PFQA 2JI7A 1E7RA 1JQBA 3KLNA 4YXWD 2EKDA 3O4GA 3TR5A 3PDJA 1FNDA 1DP4A 3CZ9A 3NHYA 4EW2A 1ZINA 4IJUA 3HKCA 4MRSA 1DBWA 4JN6B 1N6OA 1N2CA 4Q9JA 3KHSA 1XDSA 5BOSA 5JC8A 3KKLA 1D04A 1RCFA 3SR4A 3I5YA 1XMOB 2PTHA 5ETJA 5I5EA 1RMQA 4L16A 2GRJA 2C9ZA 2W8BB 2ZJ4A 5JW6A 1AKUA 5CX4A 4KHPB 1RPJA 4AM8A 4DT1B 5AJUA 3OZAA 1GLNA 3W2GA 2R1VB 3OBIA 2G06A 2GILA 3I9MA 1L4MA 1XQ9A 4J0EA 3C5WP 3OQHA 3H1FA 4Z4HA 3ZHVA 1U2DC 4GGOA 2NSLA 1C8KA 2XDYA 3O4FA 3PE4A 2GBFA 2YXLA 4YFYA 3Q3JB 1LQ2A 3KTDA 2GH1A 3X1MA 5C51B 4Q19A 4OXIA 4Q3BA 2PX3A 4EGAA 4RE5A 4MB2A 3BGOS 4JI8B 2OV8A 2WT8A 1E64A 2VPXA 1R4ZA 6AT1A 2BTQB 2AJCA 3EVEA 1TT5A 5FBQB 5BXQC 1GTG1 4HNAB 4KAFA 3V55A 5CR9A 3D4PA 2XRYA 4L8YA 3S2IA 3M83A 3ND8A 3DKPA 2NTJA 1PDOA 2R8ZA 5L8VA 2PGJA 3TL2A 2CMHA 2FZVA 2MCFA 3ZWNA 3H9CA 4ZV7A 1ZGGA 4EFKA 5JUWA 3MUEA 4OKIA 1ZOPA 5I7AA 2J6HA 3U3KA 1R0SA 3QLJA 1YDMA 3IMFA 4QQNA 2I33A 4Y2QA 4JI5B 1F5SA 4IP0A 4MVWA 3LPCA 1NUUA 5KYVA 5DFAA 4R1PA 3WLIA 1QP8A 4MKXA 2X0EA 2WVAA 3H1BA 3DPIA 4RTSA 3K9BA 3ESDA 3QUQA 5BWOA 1LSUA 5FOTA 5JI2E 1GDHA 2PUCA 5AVXA 3M3PA 1AH2A 5ALPA 1YMUA 1ZNZA 1V9SA 2Z9CA 1XZKA 3REQA 4H15A 3E9QA 3F3MA 2P1RA 3N7UA 4ENQA 3L8YA 4RTNA 1MO2A 3CUWA 1U9ZA 1ANKA 2ZBPA 2HXGA 3M2PA 3OWHA 3P32A 4NICA 4XIGS 1CIPA 3R4VA 2O2GA 2GXQA 4J7AA 4TZ6A 2IT1A 2IE0A 3WC4A 1FSGA 3KJHA 4Q12A 4DLAA 1Z33A 4KSCA 2ZYIA 1FXUA 3IEPA 4ZVQA 4ESOA 4HGQA 2H54A 3QUBA 1T9BA 1AB6A 1FRNA 2QN1A 3GG9A 4PZLA 5TRTA 3JAMA 3KEOA 1QC5B 2OV6A 2PX8A 3AY6A 3DBVO 4IGAA 4WWHA 1NVAA 4BDSA 3I6MA 2VP4A 1M2JA 3ZK8A 2VBFA 1A7UA 3QUTA 1Y3FE 1TF7A 3KJZA 5FWYB 2NNLD 3N53A 3OZEA 3TL6A 4DSAA 3ADDA 4O4IA 3SF8A 5AM0A 5HIJA 5AHWA 4AS1A 4RTRA 1O03A 1KVQA 1WHSB 5HW0A 4IMIB 1PR5A 2I9KA 3CLVA 2DWQA 1NZDA 1TFUA 1YONA 3FTCA 3ZS8A 1UXKA 4B4WA 2E21A 2Y2UA 6REQA 3GP8A 3EFHA 1DAPA 4R7TA 2A33A 2LGJA 4D43A 2CW5A 3IVGA 3AF6A 1GCUA 2OHGA 1C7QA 3O4VA 5DIZA 3SZOA 5EXEA 3ILVA 1X92A 3RKRA 3U6BA 1XHEA 2AR0A 3PLRA 3VYRB 1BG6A 3TE6A 5EJ2A 3IIKA 2QVBA 4QEKA 5FNZA 3LW8A 3UANA 1ZD9A 4LS3A 1ONBA 1V4BA 2VOJA 3S40A 1I5OA 1DIHA 2AI3A 2OB2A 4LRXA 1DBPA 4YJHA 1SD5A 1LF5A 2VXCA 3NHLA 1PJ3A 2I54A 3KPWA 4HGOA 3DEAA 1G21A 2JAPA 1CZOA 2IOFA 1G20B 2FVXA 3DDUA 3IQDB 4QATA 4WINA 4W6ZA 3SCZA 2Q6IA 2CUKA 2FPSA 2OENG 4RIEA 3WK7A 4RBNA 4GDFA 2CFSA 3E2PA 3K0AB 4JLVA 4KIUA 4JNKA 1ZGJA 3EW9A 3N0WA 1EK1A 1VSTA 4F4FA 1NN1A 3NBYC 2AZMA 4BX0A 4IHJB 3HP4A 3UMBA 4F1KA 3EXEA 3EBOA 2J33A 1BXKA 5CCEA 3G3EA 3SVZA 5CW1A 2YICA 1DAFA 4HAWA 1MEOA 2AN9A 2VLIA 5EGNA 1IBLB 1KMHA 9MHTA 5DXAA 2FEMA 5IVDA 2HSDA 2XUDA 3GQBA 4GFDA 2HRQA 2CHUA 1GZ3A 1KJZA 1D03A 3B2EA 4PZDA 3OJXA 1NMQA 4GEKA 1N2ZA 2CV2A 2VYNA 1T4DA 3EGEA 4RABA 2Q62A 1USVA 1WX1A 3OX4A 3VOTA 3E8SA 2HIHA 2B8JA 2Z5GA 5FBLB 3TS1A 2AFIB 3HUEA 3L40A 2QT9A 2GESA 1QK5A 1SPXA 1ZVQA 4RZSA 3F5DA 1UDAA 4YLEA 1MB0A 3P1JA 4RKYA 5AYVA 3KB8A 1AMOA 3AVUA 2PT7A 3KRTA 2IS1A 4M7OA 4TLAA 2FQQA 5FTJA 2FOLA 2FFHA 2DFPA 1D1SA 2ACWA 3BREA 1HYQA 3OESA 1Z16A 3R0VA 1NJSA 4DBZA 1YAJA 4YX9A 4OK5A 4OFWA 2WNSA 4OAOA 3C45A 2GJ4A 2AN3A 2WHEA 3AF0A 2WAAA 2X3UA 4GYWA 2ZANA 3E8XA 2W2TA 1YWGO 2W0MA 1BKSB 3FDIA 1EVJA 1XU4A 3W8FA 4WLNA 1VIDA 3RU7A 4I4TB 1CY7A 3OX3A 4DMLA 5AVWA 3DZGA 4QX6A 1I0ZA 1GAJA 3MWDB 3PKZA 1IVYA 5F9MA 4EMBA 5KYYB 1FMJA 1SC1A 3WSWA 3VJMA 1Q0ZA 3NAMA 1R6BX 5LQCA 1APBA 3K9LA 4N6NA 1UZNA 3IQIX 2XRFA 4O2AB 5DGDA 3WY9A 4A2PA 4EHLA 1WUKS 5DCLA 1OZHA 3O73A 4RYLA 2Q49A 3EZFA 2WG1A 3QBDA 5CYFA 4BO5A 3VA7A 1JTEA 3GR6A 3O3CA 4Q16A 3S2UA 3LS2A 4LRTB 1JPUA 3P71T 1GILA 1TU4A 4TSRA 4CVNA 3DHVA 3CEMA 1ISRA 4M0PA 4D79A 6CHYA 4IQ4A 1WMFA 1X0XA 3QRWA 2R44A 5DWVA 5KBYA 2ECPA 1NLYA 1KIMA 1RZUA 4HYQA 4QOGA 4M22A 4KO1S 1E1CA 2EKQA 5CH5A 5UKDA 4DLWA 5CDTA 4Z2YA 2HEIA 1TMOA 3JWEA 4YTEA 1G1AA 3BCSA 3PSHA 4DM3A 1T2EA 5TQ0B 3AEUB 5CM9C 1Q0PA 3AF5A 3E1GA 2QMUA 2J9YB 4O59O 2E87A 3KXLA 4JJ6A 1VP3A 2AJLI 4GXRA 3RLIA 1XNRB 3TXXA 4QDJA 4Q21A 4PAWA 2Q2VA 3DE5X 1B4DA 1JPNA 1ENZA 2WLSA 4LHZA 4XUEA 3SXUA 3TB4A 1IXKA 1HZJA 4JS0A 1XD2B 1X70A 5F7XA 4S05A 3WHKA 3RTCA 5AQ1A 2C83A 1FSFA 1NA5A 1PVDA 1WU7A 2VP5A 1PL8A 4H08A 4UJ5A 1QRDA 4XIIA 3JQ7A 2FR1A 3ONVA 5A0VA 3KVVA 4H7KA 2PBZA 5D01A 4K6MA 2GLXA 1E1RD 2R5NA 2GCIA 1N34B 2DFTA 3GGGA 2DHQA 1C14A 1XZFA 3ICVA 2BMAA 3NTLA 1XMVA 3NTXA 1MB4A 2GGSA 3JASB 5CXSA 4DM7A 4AVYA 1IU9A 1HDYA 3TQCA 4KQ6A 5GIOE 1XJQA 2VSOA 2H29A 1ZSYA 3TQTA 4Z49A 3KLPX 3NG1A 4FI3C 4CG3A 4N5LA 4L3WA 1NI5A 4KLAA 1J0CA 5F78A 5KKCA 1LS1A 3V9AA 5I5GA 4D9EA 1SOAA 2HMWA 3W6UA 4QTUB 5FBZA 1EJBA 4ARVA 3KYIB 3ZCSA 4BB5A 3GL9A 4D9BA 3BX1A 1F0NA 2FB9A 3A4NA 5ENZA 5F2EA 4C0AC 4F4CA 1KY4A 3UQYS 2JVJA 2W71A 5C5DA 3JX9A 5D3QA 4JBGA 2XXJA 3RGWS 4UKDA 4G85A 4QRDA 4PS0A 5AOAA 8MHTA 4M2LA 1ORIA 3I5XA 1N7JA 3DNMA 4MUKA 2Q1YA 1S8AA 3H5AA 4FTWA 3LCMA 4REOA 4YVFA 4PBSA 1SPBS 1YB1A 2YXEA 4ZTBA 1BQ4A 4DCVA 5D3KA 3ZGXA 3WSVA 1GZVA 3SXJA 4EW1A 1ABBA 3EMKA 2DBYA 1IAQA 4OGFA 3KTAB 3C14C 2BFDB 4F9GA 4BFCA 2HLHA 3P9RA 4XGIA 2OCPA 4B8ZA 4DCJA 3PV0A 2P78A 4C0SA 2PVSA 2FPKA 2Q4TA 1GCOA 1DC5A 1Z6GA 1Z3CA 3KXPA 4MYCA 1JIKA 3N59A 2D5AA 3AETA 4YV2A 9ABPA 4NQZA 1Q5PA 3JQ9A 1HKHA 4N0PA 3KEFA 2DF8A 2A9VA 5CDUA 3AINA 4CCWA 2RH5A 1Z6QA 3I5AA 5HX7A 3T61A 5JZBA 3NDPA 4PC6A 3R9WA 1ODKA 3B1WA 1P75A 2X14A 3G5UA 3Q1LA 4MNTA 1E9DA 5EWJB 5F21A 1SHKA 3B5EA 5EXXA 2DOKA 3FNGA 5C46F 1F5NA 1SOUA 1HEUA 5JRZA 4J2OA 2QD2A 1DELA 3Q5DA 3DDNA 2HQBA 3SEAA 4ZI3A 3OIFA 1ZRHA 1M5UA 2J87A 2IPLA 2RHWA 2VHWA 4MMZB 3CB2A 1F38A 4L4RA 2P4SA 4DJDC 3TLZA 3SM9A 1KI4A 2OT3B 4TTSA 2IUEA 4X64B 4PZYA 4UATA 2XNHA 1YDWA 2DFDA 4OI0A 1GFIA 1JL3A 2ZRIA 1WXFA 3MSCA 2ZUCA 3HR8A 2P2ZA 1UJ4A 5GM2A 3G2PA 3GPLA 1JJIA 5BSTA 1ZA2A 4AP9A 1E0SA 4BV2A 5KB3A 4Z3KA 1TGVA 1TC2A 4NCXA 2H1LA 2Z8YM 2ZLBA 1ZRNA 2IQIA 2PDAA 2C3MA 3A6FA 1C9NA 3ZDXB 4DQUA 1SM4A 4CMEA 2I3GA 2XX3A 2QIOA 3VZPA 3DE2X 3WL3A 4BEBA 1SUSA 5TF4A 3CZMA 2D7JA 3RT1A 4URZR 3V2UA 2Q5FA 2FUKA 4HLCA 2HSGA 5AJWA 4AN1A 4ZANA 1SCAA 2V74B 3JD1A 2J4DA 1REQB 3ZOZA 5EJ6A 4FXPA 3AEQA 2RHRA 1I9GA 2RFLA 3FTNA 3NWJA 4P4TA 4QL3A 4K6GA 2ODNA 4S1PA 2BJHA 2QT0A 5I9NA 3RLFA 4JYMA 3QQPA 1OZ0A 2IBTA 1R37A 2V9CA 2ACKA 2B1QA 3HKDA 1DZIA 1WSBA 4INOA 1A77A 2X6TA 4BVLA 1YI1A 3U7GA 3KYDB 3QFHA 4Q1DA 3DV0A 3L8HA 2BBWA 3F1LA 1ZHFA 3QLVA 3KR9A 5FR1A 5LLTA 3C1TA 4L8FA 1TKRA 3SEFA 5KX5A 5JZOA 3AP3A 1M1YE 2IHVA 4PR3A 5B4UA 1ZZGA 3O82A 3NBXX 4RJLA 3SSAA 1BXRB 1DIRA 3O4JA 1A5ZA 3OQBA 1XVLA 4LMRA 3DBLB 3V4FA 5EQTA 1TK2A 1RYFA 3HA5A 4JI0B 1QGED 2VCHA 2DUWA 3LQ4A 4ZOLA 3CUTA 5IKXA 3I52A 5L3QB 3EXIB 3O1IC 1XDBA 3HXKA 3UUFA 2DH5A 3MVEA 5C4MA 1LX7A 1W25A 3SZRA 1OYYA 1DMSA 1P1CA 4Q3KA 4UNQA 3Q1KA 3QBVA 4ZO4A 3W79A 2PO5A 5EJGA 4DANA 4XUDA 2PH5A 2QLLA 3L4BA 5EUCA 2AZDA 3CQ9A 5F2NA 1QU2A 1FUIA 4AJHA 3ON5A 4G07A 3A70A 3FPLA 3R5FA 1C41A 5IJ9A 4P82A 1T8YA 4RNDB 1PDVA 5TV2A 5JS2A 4OHVA 2UVPA 3D3WA 1GT91 3B9BA 4AMUA 4UUNA 5B30A 3AM3A 5CLGA 4TRJA 4X20B 1XTVA 3HB4X 3K9CA 5DSTA 2WZQA 3RYFA 2GMWA 4EMSA 1QO7A 2W0SA 3M4NA 1IBKB 4CG1A 4PM4A 1VGVA 2WFLA 2XDQB 3GC6A 5IKOA 2UXCB 2GZ3A 4MV4A 1YQDA 2O7QA 3G5LA 1NBWB 3IHTA 3LVFO 5DWDA 3WGZA 4A7PA 1EAMA 5CHYA 2EU8A 2ZKIA 2IYSA 9ATCA 3SE7A 2OCXA 1K08A 3CVWA 4OYHA 4JWKA 1VL5A 4OHOA 1LB1B 4Z1MA 3L6BA 1RYZA 4GM1A 5D3MA 3JWPA 3O4RA 1W49A 5FXMA 4GSLA 1G63A 1JAZA 3PENA 2IITA 1JE1A 1OI7A 4QASA 3RG2A 3UZUA 3NV9A 4BMPB 5KVQA 1X13A 2CFOA 3ADPA 3AF3A 4R2IA 5K8CA 3ZDYB 1NDQA 1Z0DA 5AVSA 1RI3A 2XMSA 3EZ2A 4DARA 3D8NA 5LIRA 5HJEA 3BWVA 3AVTA 5EN4A 3RHSA 1F9AA 2MSEB 5JDIA 5BSVA 3VBCA 3K9GA 5EZQA 2FWAA 1OE0A 1ISIA 2XF2A 3VPCA 4BFZA 5L53A 3D5EA 1N2JA 1U3TA 3WB2A 5FORA 4NONA 1B2RA 1OH7A 2IUFA 4YLYA 4BY9E 4DR7B 2O23A 1KERA 1PWHA 1PZXA 3H05A 4NBSA 5FLKA 4BX9A 1HYEA 3A1UA 5IANA 2ZKLA 3HCBA 2VTEA 3PUJA 4UFPA 2V6IA 2YXNA 3E4CA 3T5DA 3M70A 3H17A 4AUNA 5JADA 1OLUB 4U0KA 2NT4A 4DJEC 1UAAA 1NXOA 1SC6A 4RZ2A 4E3ZA 1U9IA 2R00A 3U39A 1BA3A 4BZPA 2QJTA 4FC6A 4E51A 2OKGA 3JD2A 3PE6A 4FX2A 3DM5A 1B15A 4YMVA 5EESA 3HSKA 2ZTLA 4XPZA 2J85A 5BNWA 1LZKA 2J6CA 4KDCA 4JJAA 2JKZA 4RV9A 3HCRA 5EKDA 3TLBA 1G8PA 1MORA 5HOEA 4R9UC 3L6CA 5LQUA 2Q3HA 1Z8FA 4BQRA 2PIDA 3C7AA 3PQEA 3QE3A 3GJ0A 4EPRA 1YRAA 4OIFA 5C1BA 4JBHA 3W90A 1Y8AA 3GP3A 3NGLA 4KPUB 4ZCTA 4J3NA 2Z2JA 3JVVA 3H16A 1ONPA 3IB6A 4N9QA 3ZHTA 3L1HA 2NSJA 2YWXA 2IXDA 4X3CA 5C7YA 1KU6A 1T9GS 1TCAA 1TM2A 2X7JA 4NABA 3MEQA 4M60A 3I1YA 4RK1A 4YUWA 3RKSA 4W99A 1PJLA 1G5HA 2VQ6A 4QBFA 3U62A 1GU0A 1HFWA 3NAGA 1QG6A 4ECAA 2IZ7A 2EW2A 3DHYA 1QF9A 3QVGB 4FSHA 4HAXA 4W8GA 5KJEA 1FVOA 3USES 4OQXA 3G7SA 2XA1A 4A6XA 3U44A 4E5PA 2C7BA 4F71A 3E9DA 4MS4A 3JQ9C 1XXHB 1VLVA 2FSSA 3R5TA 2X9LA 5BVHB 2VHCA 2PMBA 3VI3B 4D9NA 2P40A 4LUCA 4F4HA 2FQYA 3U40A 1AQJA 4NHOA 1V11A 3H1AA 3DQQA 1CJKC 3RSOA 5F73A 3HDHA 3W3AD 3G49A 4OAPA 2QP3A 5CVVA 3U4DA 1MDFA 3FOBA 3BK2A 4DKJA 1G19A 4EGCB 2W2QA 1XXLA 1P73A 4B7ZA 4F6CA 3VZDA 2IU4A 4FNOA 3OLQA 1TYAE 4DWOA 4FGSA 4YRNA 2R5WA 2DB3A 2PWBA 3LQRA 2RI6A 5JJKA 1NNUA 1G8HA 1V0JA 1VLMA 2VDLB 4GMKA 3R09A 3ZW7A 4C29A 4DCMA 2D0PB 4PNEA 4YMLA 4LJ9A 3K70C 1VHJA 4IW3B 3R6DA 3HFRA 1J2JA 1N6HA 4H7JA 1XZPA 3RYHA 3PC3A 2I6QA 4FIZA 1MV5A 4UHJA 2VPZA 3RYIA 5LKRA 4KXXA 3V7FA 4EPVA 1CQJB 1OGJA 4NG5A 2EHJA 1T3LA 2H08A 2JIZA 3HU1A 3R2JA 2RGRA 5F9HA 3QELA 4BMOB 2W2XA 3ROTA 2NZ2A 3JQAA 1R4NA 1C7IA 2XDWA 3CRQA 4ZAWA 4RESA 4CMEC 5EY5B 2SHKA 2UYGA 1DJQA 3G2LA 3OETA 4OHXA 5EPEA 5C9ZA 4OYYA 3S8MA 1RR6A 2NAPA 4ZXPA 2WWGA 4ND4A 4MR7A 1K86A 4PSUA 2B4YA 3NMUF 3MD0A 2DHDA 5ECWA 3OFSA 1XZ8A 3QFSA 1I1OA 4RPIA 2LZ0A 3WNZA 5KNCD 1AD2A 1VZ3A 4E12A 3OEYA 5LYYA 2G9NA 4BV9A 2D2IA 2CUNA 2XQVA 5T4FA 4FQ8A 1DVRA 1EE9A 2WE7A 3QIAA 1FIUA 1V1JA 3GVXA 3CF2A 3SM3A 4CM4B 3KDPA 5REQB 5A1JA 1X19A 4U6SA 1V45E 1YOVB 4ZDWA 2ZIXB 3NAQA 3QLVC 2BY4A 5DM1A 5AVKA 3DLTA 1W5EA 2QU7A 2TRSB 1RD4A 3IQZA 5ALGA 3MGCA 5JQGB 3U9LA 4DHWA 1SUEA 1HT2E 2CXSA 2Q8QA 4IHJF 5IAAA 5K8VA 1FFXB 3CX6A 3IBYA 1WMDA 3WR5A 3VHXA 5GJWC 4IR7A 5CFPA 3R8FA 5ALLA 3AM1A 2CNDA 2PH3A 3DWIA 5FPTA 2JFXA 3HFJA 4FP9A 4IIVA 2WAOA 3QX8A 4D9FA 3ZCRA 2W2OA 4CF7A 3FMIA 1DINA 1Z26A 1DBIA 4CL8A 4NXMB 1TX4B 2GTIA 4QSHA 2B8EA 3IAS6 1YR2A 2PH7A 1H22A 1WCXA 3BF7A 3Q7PA 3IT2A 4FS3A 3H1TA 3JYQA 5A5EA 4FZ3A 2MSCB 1S2GA 1ZD5A 2J5XA 3MN1A 1JHQA 1P4RA 4RD6A 4RF3A 1G41A 4CEHB 4K28A 3TJMA 2X0FA 4RQUA 4MGKR 1RLOA 2GS9A 2HDOA 3OQIA 5L7WA 5FR2A 4TM8A 4RMIA 4R9NA 2CB0A 3DDHA 3QOXA 2GCNA 1H2RS 4N82A 5B1DA 5ARDA 5BSWA 4IJMA 5H4GA 4UHCA 3FG9A 1R0WA 2GJKA 3Q0IA 3OZCA 1L5YA 2GN6A 2VOEA 3B5JA 2AQIA 4W9NA 4X95A 3R7DA 3WLFA 1JG3A 1I94B 3FXAA 4RGBA 2EJTA 4QXRA 5HQ3B 4JUCA 5I9TA 1U5CA 2HWWA 2WYIA 3BA6A 3QNMA 2PY6A 4DILA 1EFRA 1N2IA 2OD7A 5JSYA 4FEAA 2EWMA 1RADA 1IHPA 2XB4A 4CWAA 4BXOA 1ZRSA 3PFCA 1MBZA 2WJIA 3FH0A 1A72A 1XIVA 2QYSA 3LXXA 4TXNA 4XI9A 1JGTA 2CVZA 1DRJA 2XT9A 3D3KA 4PC7A 4CDRA 4CM9A 2HK7A 4PZPA 2FY8A 3LO8A 4IDNA 5FLYA 3U2QA 1J25A 1N33B 2OYRA 4XYLA 1NI4B 4O2AF 2GZ2A 4QPJC 4PIMA 3VNAA 3IMKA 4UAVA 3A9WA 4NBKA 1MPXA 3E61A 2J0UA 3P0HA 4F6RB 2NSYA 2NX2A 2ZSHA 3JALA 5T6BA 4PPGA 4BUCA 1RKUA 4GPTA 3KD2A 4L8LA 1FFCA 2OC4A 2VBCA 5JDIC 5LJLA 4ZQIA 4BNDB 3I4LA 3H6HA 1WWKA 4Q9NA 4A23A 4AJJA 2AX3A 1TIKA 3CXRA 4EI9A 3L1UA 4BJ6A 4G24A 1Z2EA 3M8KA 4JLMA 5ECYA 4ZRNA 1I7SB 3DEZA 3LHDA 4FUTA 1AN9A 1LV8A 1SKQA 1WE2A 1PTJA 3CFYA 5EKTA 4ZVTA 3UUWA 4WA7A 5F7OA 1CRPA 1KORA 2FSVA 1E9EA 1W4BA 3NHMA 4RGVA 4BRZA 1L4KA 3EVAA 2J3KA 4G0XA 2AEMA 3THYA 3EXHB 1VPWA 4NXNB 2XBMA 1U9IC 1N9GA 2BZ0A 2R00C 3PNLA 4UUQA 4R8LA 4QJ3A 3L7JA 2LKCA 1E4VA 3O75A 3U37A 5KC8A 3BSWA 3M3HA 1LW6E 3LUDA 5E1BA 1MAAA 3I5MA 1YJCA 1B2LA 2OHVA 4N5NA 3DSRA 2QN8A 1CRZA 1U4SA 4JEUA 4KDEA 4HEA1 3AZPA 4P80A 3Q12A 2BGLA 3R0QA 4KODA 5J4HA 1RQRA 4EYSA 3NFRA 4XOIA 3IE0A 3PUIA 5FBKA 3SEZA 2G1KA 5DISB 2RBGA 3G7UA 3OX1A 2OCKA 3TBHA 3VGPA 2I8LA 1AKVA 1VKOA 3WA6A 4WKNA 2A92A 1J0BA 4G6ZA 2HUNA 1SOMA 3MRTA 4OMCA 3SBEA 2JGMA 2VJAA 3PXBA 4AF6A 4CKEA 1DAKA 2O3UA 4Z7JA 2WTUA 1QUEA 4QLAA 4YRRA 3LWBA 3FBWA 3DEKA 3CCCA 1E2EA 4WDRA 4G5OA 4WLUA 1UEXC 3WGHA 3JYOA 3Q15C 3FYCA 2BFBA 3VR5A 3W8DA 3OBBA 1O4WA 2NU6A 1TM7E 2DETA 3EN0A 1X2EA 2ZI9A 2A3RA 5DT2A 2W6CX 2XEXA 3AUFA 3AGPA 2WKQA 2GHTA 4L9RA 3CPSA 2WK1A 2J3MA 3MJ4A 4NE2A 2ZI7A 3BXOA 4BLQA 2IA5A 3A7EA 2GCEA 3NB0A 3GJ7A 3AEKA 2YC2C 5BV0A 3G0CA 1X7DA 4B48A 2P68A 3RASA 1CHDA 5AKJA 2XXBA 3ZQ6A 2R68A 4HPWA 2FMXA 1Z37A 1SHTX 2FW6A 2EJUA 5EMHA 2JFGA 4ZV9A 3MOIA 3SZGA 1NDHA 1LW7A 3N87A 5TMBA 2CN1A 1OBVA 4EHJA 1D9ZA 1XZLA 3DA8A 4M0CA 4FGJA 3AKCA 2ID8A 4MPPA 1G6Q1 3ZUPA 2QN7A 2K7ZA 3V42A 5F12A 3ZTTA 1ADCA 5GJBA 2OESA 3PA8A 1OWNA 4E1AA 2Q45A 4PC3A 1TL7C 1YRLA 3RG8A 1ISHA 5E9JA 3O1LA 3RJ9A 3BXZA 3P0RA 2XUAA 2P9JA 5ER6A 1K8RA 1GGJA 5EKSA 2RBEA 3CT4A 1L5SA 1VLZA 1VJ0A 4H1HA 3NHFA 3TI7A 1RT9A 3MD9A 4FFNA 5DM2A 3LTEA 1Q44A 4LJ6A 2GHRA 1GO2A 4F91B 1CF9A 5EE5B 4ZVKA 5HOQA 3G7NA 3NP9A 4IV5A 3JAKA 3KZXA 3WQQA 1JEAA 2OMKA 1XYVA 1ZM2A 4GKAA 1PEAA 1JSXA 3OY7A 5JJ5A 3FFWA 3I0NA 2B35A 5GOZA 1DX9A 5KI6A 4BMYA 4P9NA 1VPDA 2R1UA 2Z5FA 3QEMB 2EFYA 2EYUA 3E18A 3TRHA 1NZFA 4NJEB 5EC8A 4H7DA 4BMVA 2Z8XA 2AXPA 3GZ4A 3AVPA 5IVPA 2B7LA 2JIQA 3NETA 2PCJA 3ITKA 1TRKA 1Q1NA 1WB6A 1E0JA 1G2QA 3AIIA 3BGWA 4NBVA 5FUQA 3AZOA 5A6VA 3GJ4A 4B85A 3DC7A 3QUSA 4I5FA 1B6TA 1C1DB 5ALRA 1YZGA 4D9KA 3C74A 4C6HA 4DMGA 4EG6A 4PCUA 5C37A 1KBZA 1RPZA 1XDZA 2COUA 1DEXA 1MG5A 3Q2IA 3UBMA 3WYFA 5CURA 2JF0A 2HIGA 4ZOEA 5B58C 1IHOA 1JR3D 4CV0A 2P41A 5I4CA 2IUYA 3OD5A 3NHAA 3K31A 2XUQA 3BL8A 5ICFA 3ZZ1A 1MA3A 2AZ4A 2UUPA 4OP3A 3ABZA 3KOMA 4D46A 2LW7A 3ZDFA 4CT4B 1U6IA 1BX3A 2GN8A 3FSJX 2EEZA 4L9SA 1ECGA 1PWYE 5KREA 5D6OA 1GG9A 3V8VA 5HSGA 1ZA1A 3KQOA 2I6SA 2ID7A 3R3VA 4KNYA 1JR2A 1HLGA 1RAHA 1WZEA 2RB5A 4J7CA 1J2RA 1M2WA 3GMIA 1AQYA 4UAUA 5L3SA 2BM0A 4LJSA 3N1UA 3NJ8A 4W9NC 2QDKA 3L1IA 4X1IA 3N07A 5J4KA 1JKJA 4JC4A 3U7RA 1Z4PX 2JHGA 1VOTA 3TMYA 4EKYA 2ASEA 3EVBA 3KM0A 2ZWMA 2AQ8A 4M9QA 4NS4A 3WJ2A 5K3BA 4ZCRA 1WKBA 2YOHA 2ZJ2A 5KKAA 3ESXA 3LQKA 1H6AA 4RVFA 3FRJA 1I7PA 3N0VA 4NBLA 1MTOA 4MYUA 3EA0A 4CTNA 2JFHA 1NN0A 3VAAA 5C32A 4G41A 5K0FA 5TPWA 4D0NA 2AOUB 3L9XA 4G67A 3T99A 1C9MA 2WZBA 5TJHA 4D8YA 4XSVA 1KI6B 3I2JA 3PVCA 4P58A 4I5EA 1ZQ9A 4EWLA 3STYA 1XVUA 4YMWA 1ZG3A 3KD3A 4MUGA 4ZYWA 3ENKA 4MA5A 1DDIA 1TGYA 3F0TA 8OHMA 4LJ8A 1JVSA 1QQ5A 2VN8A 1B8PA 1T6XA 2VUSA 1C3JA 4V0ME 3DVAA 2B99A 4AZ0B 4DC9A 1HKUA 1Y6FA 1KTIA 4BGEA 2HA4A 3SIRA 3TZKA 1DAIA 1EG2A 3H83A 4EHBA 1ZO8A 2IYTA 4AUEA 4AMVA 1R0LA 4EJ0A 3HMQA 4UHDA 4NHEA 3G2KA 5TPZD 2YXBA 4OA5A 1BVYF 3G8AA 3PG5A 4N47A 1P6QA 2FSVC 1WKCA 3G85A 2WNHA 2JKVA 3PSAA 1UMCA 1C7RA 5JTUA 1GZ7A 4RPHA 2IEAA 4E13A 4HQNA 6NULA 4FCVA 5CM8B 3I9NA 3DR5A 3V8BA 3NALA 3IVMA 3RFXA 4GOLD 3CCBA 3ME5A 3HKCB 3CT6A 4LQLA 1E2BA 1N2CB 2XIQA 4XA8A 5GINE 3BIFA 3CZ4A 3EUAA 5BOSB 4OBXA 1J5XA 1Y4DE 1UJCA 3GLTA 4Q03A 5DHRA 1SC9A 4EY7A 1KZ6A 4IZIA 4XEHA 4C87A 4KITB 3I3OA 2Z09A 4Y0NA 1ZJ6A 2DHRA 3UO8B 3FNQA 4HZUA 4BKPA 2SCUA 3B89A 2PMDA 2QW1A 4CCYA 1CDOA 2WU1A 3CR7A 2EJCA 5ECGC 4AZTA 2YIJA 2R8RA 4U7GA 4DNOA 1AHNA 1HTBA 4GKBA 4K8RB 2ONKA 1RW4A 3MCVA 4I7EA 4JR2A 3DQZA 3PYXA 1LRJA 2CD9A 4UNIA 1Q50A 2ZYVX 4MDHA 4OXXA 4ER0A 1WBBA 3IIMA 2GRUA 2F1JA 2CXXA 2AOWA 2QZZA 1N0IA 3CTMA 4GPAA 4O4HB 3ZDZB 2VHUA 5A6SA 1ZIXA 3LDUA 5KNBD 2Q28A 3N2KA 1GDDA 2PSFA 4NY1A 3U4IA 1E3IA 2G5PA 3ZN2A 1J8YF 3EIEA 3KQWA 4WXHA 1TVKA 4PSAA 5KCMA 2ILTA 3C3DA 2OO5A 2VDOB 2RHJA 1KJJA 1TT5B 1FTGA 1EZ4A 1VP9A 1VLQA 3QJYA 4PSVA 4PZEA 3FRIA 3FMOB 4TUYA 5A03A 4QUBA 2A58A 2FFAA 1WVGA 2PU7A 3GDHA 5EP3A 5G4KB 4AJIA 1AMNA 1U3CA 2PSSA 3IUQA 3WLRA 2FSHA 4CIAA 4IUBS 1XL1A 2JLRA 2YYZA 4EK9A 1Q3HA 4U3JA 2ZT8A 4US2R 2V5AA 2OQ2A 3UJ3X 5JCJD 5E4TA 3DPSA 1SG6A 3WB0A 2IY7A 3I6YA 2R48A 4PZ0A 4RD0A 3WMXA 3OI7A 5K3DA 3DHNA 2PR7A 4NZ9A 2J48A 4Y30A 4QDTA 1BW9A 5BR7A 1TW3A 4EUSA 4EW6A 4QEDA 3IELA 4O2BA 2CUTA 1FTSA 3FD8A 5FD8A 1GAXA 2E7ZA 2VF2A 3COJA 1EBUA 2JIZD 1TA9A 2XVXA 4X90A 4XTCS 3ZCVA 1KPIA 4LQ4A 4XDYA 3UXMA 3UHOA 3TRJA 1BHO1 4G0NA 1YQTA 4NMLA 3UOGA 4MLCA 4QPDA 4PYMA 4LDRA 2WIAA 3HSYA 1UMBA 2TSYB 3OCZA 2DLCX 3IFSA 2HDHA 4R1LA 1G38A 4TTPA 3CWZA 3OIGA 1S01A 1LDYA 4LTMA 2QUIA 2VT6A 4C76A 1PQUA 2Y77A 1FF9A 4QUJA 3VOAA 3FOFC 5EFZA 3K1TA 2BKEA 3EG5A 5TQVA 5SZKB 4MINA 3SF8B 4FXOA 1OJLA 2EV9A 4EP1A 1PJBA 1NOIA 2JCGA 3AERA 1D2AA 3NVMB 1U5AA 3QKRA 1QAQA 4OPMA 3WL7A 1X1SA 3V1YA 1A95A 3FTDA 1GKYA 1DAGA 4E5MA 4QOSA 5IFLA 1JXMA 4PXYA 5EG5A 3H86A 1KL7A 1XKQA 3AESA 5E6UB 3LRXA 3OJEA 2HAEA 3TKYA 3H3JA 3CA8A 3JQDA 3Q0TA 4FN5A 5DI9A 1KAEA 3SJAA 3UKOA 3W77A 2TS1A 3PEFA 1T5HX 1Z2NX 2HMUA 2JFBA 3J80A 3DAFA 4ZGBA 1NAIA 3OFKA 3WX0A 2Y0PA 4ZEMA 2WWXA 3GN2A 1KXZA 1XTUA 2AMJA 2C5SA 2J9FA 3IA2A 4BRSA 4RJTA 3EB9A 3REGA 2BSQA 2PS9A 2HJSA 1P33A 2RDMA 4YJHB 4YRJA 3T06B 3GT7A 5SZIA 3IHLA 4UDOA 3IJRA 1NW3A 3EPRA 1SELA 1G21B 1MX5A 4KYVA 3RIHA 5IYZA 1RRMA 2IVFA 1EBFA 1FLNA 2BFEA 3N0TA 2O2SA 3QGMA 1RJGA 4MUHA 2EJBA 3BWEA 1JJ7A 5E95A 5FFFA 2COKA 2WKSA 2AZXA 4CKWA 3GJ8A 3GGCA 1G8KA 1I7NA 3C8DA 3PUZA 1E5LA 2Z2IA 1JDTA 5AJVB 5ELMA 4GUDA 4KAXA 2CYCA 4K9MA 2PBFA 4JOBA 2PGAA 5EJ7A 1AQNA 1A9XA 1TO2E 1KMHB 4U7DA 2PEZA 3QBJA 3TR0A 3NOOA 4IUDS 1E9CA 4LHWA 2ZYUX 1JDBC 2FJ0A 3EWIA 4C01A 4CIVA 2GSWA 3PEUA 3ISTA 4TZTA 2V1UA 1GKLA 4RD2A 3TTVA 4CMIA 3GIWA 1VHWA 1EFRD 3KCNA 3ID6C 4GI5A 1WQ4A 2FW7A 3M2TA 4HDNB 3ZHBA 3W8NA 4YCLA 2UZAA 2ODAA 4U2GA 4BB6A 2QUZA 3I1JA 4RGYA 1P7VA 4D4GA 5CA0B 4BKRA 5LN1A 4IDCA 4CM9D 1U3WA 5DGXA 4B73A 3AF2A 2YRXA 5HE9A 2PO7A 1GCIA 2BDUA 1G8SA 1TJNA 1GEGA 3K2IA 1EK0A 4MUYA 4QO7A 4C30A 1ZK4A 5IKMA 4ABTA 1PGJA 2A4MA 2C61A 1M0SA 1OR8A 1SHLA 4MCIA 3UPTA 4XVRA 1T5TA 1JQKA 4BWVA 1TA4A 5LYJA 5K0JA 1UOQA 1L7VC 2IXAA 1OX4B 1SU7A 4G1UC 5HZKA 3QOWA 2OZLA 5CNMA 3WWDA 4OSEA 5A7GA 3FPAA 3MMXA 3LWDA 2XMPA 2OZVA 2VTKA 2ZUWA 3OFNA 4JAVC 4Z0HO 4NAUA 4M7RA 4YRLA 3F47A 4ZVVA 3CX8A 3D7NA 2P69A 3WIBA 4QLOA 4IVNA 4BNJA 3FRHA 4O5AA 1P72A 4W4TA 5LOVB 4NBWA 2FWRA 4KN9S 2HCRA 4TVSA 4FSDA 5C8DA 3IAHA 3UPDA 1WULS 4DRYA 3T3NA 4MW0A 5K0BA 4OQQA 2P5TB 1UZLA 3Q4GA 4F9FA 3LMKA 3H9UA 3NM5A 3ZLVA 3BZUA 3PUKA 3VDNB 4AF8A 4FFPA 5B1SA 1JI0A 1E69A 1JIJA 4YY3B 3IAXA 5HUJA 2WPNA 2NYUA 3N5CA 1E7QA 1M67A 4LC1A 3G9QA 4DIFA 3DE1X 3ZWAA 3VO1A 1O0SA 5FYQA 2AYXA 2QZJA 1O94D 4HLUA 1GA4A 2OCYC 3SAJA 4AJ9A 2XCUA 7MHTA 2JB9A 3SVLA 1E5VA 4F5WA 4Z53A 1E3TA 3CEJA 3BZBA 4UMVA 3T7KA 1NVUQ 1E1CB 1WXWA 1BMQA 2VK2A 1TM4E 3M1YA 1GFSA 2GDZA 2H5LA 5AJXA 5A7FA 3ZGYA 4X8LA 5CD9A 1S4QA 3PHHA 1X39A 4GC9A 1H5UA 5KQGA 4LCBA 1Q1AA 1O57A 2RI1A 2Y1XA 1HTWA 3D3NA 5CBPA 3CRMA 2IWRA 3BTOA 2ODBA 3CZCA 3VR5D 2OO5C 2DZDA 3GOQA 3M6FA 2R6HA 1CIVA 2Q7DA 4KR6A 3OCUA 4B76A 5BNZA 3IDQA 5FT9A 3WV5A 4YT2A 3MTAA 4WKBA 3E22A 2HI0A 4RVUA 3ACBA 5JY1A 1RBMA 2E4VA 1Z2PX 4Q3OA 4CMCA 4D4JA 2ZJ0A 3ENZA 3DJFA 1RXIA 3KHTA 3PUYA 1UZAA 2HKIA 3P9ZA 3NZEA 4EJSB 5B6IA 1O1YA 2I55A 4ZVLA 2FPRA 3GFOA 3FM9A 3BILA 4RPCA 4BECA 2UXDB 2OGZA 1Y4SA 3QFFA 2WILA 4OGLA 3E2IA 2WIJA 3E3OA 3BORA 1U2QA 4BBZA 4CTKA 2Q1WA 4RM3A 3CW9A 2UYHA 1USWA 3CLKA 1M1YA 4PX9A 4RLFA 2IF2A 3LD9A 3NM4A 3QYPA 1QP4A 3SLKA 4QICA 4XWAA 3ZJVA 1BKYA 1TYDE 2NTNA 3MJDA 1T1GA 5AQEA 5BVGB 2ZAYA 5I9BA 5DRYA 3FJYA 4PO8A 3STUA 2X42A 1N2XA 3KOWA 3ZJUA 3W8RA 4R0VA 2X2FA 4BLUA 4D0LB 2HEGA 2EBUA 1Z06A 3HCWA 5B12A 4C3VA 1M7HA 4DMUB 4YAIA 1XRJA 1MZPA 2OWDA 3VHLB 2XI4A 3NAZA 3KWFA 4YNBA 4D0RA 2BGWA 1MW9X 4QNMA 1IQUA 3EEBA 3EXG1 1TEHA 4WCDA 2D5CA 1XWFA 1KGDA 1D09A 4K6HA 2PX2A 3IRUA 1BVRA 2Q0XA 3L1KA 3X0DA 2C54A 1D2GA 3L0CA 3AR5A 5M29A 3SLGA 4H1WA 3B6IA 3IESA 4Y2JA 1YU9A 1KYWA 2RKBA 2ZAGA 3EA4A 4NFYA 4I14A 5GIPE 1P3DA 4CL2A 4AL4A 1GZ4A 2IOFK 3ELWA 1GZ5A 1JJVA 1T8PA 3LOUA 1JV2B 1FUYB 2HPZA 3Q5EA 1YK1A 2BI4A 1XCJA 3K8OE 3MQFA 2CXUA 4PYLA 4UU7A 4KR9A 5ADVA 1OU4A 2NM0A 3V1MA 1XZEA 3CXUA 3I23A 4ACAA 2WJ3A 4CLEA 3GLIB 2XZLA 4J75A 3GCXA 2FUEA 4R98A 5JXHA 3DE0X 3K5HA 3U3MA 3K6JA 4UUMA 4U6QA 4NX2A 5IVHA 1PR2A 1J56A 1EQ2A 1EVEA 2NO9A 3GFTA 4NARA 3L7BA 1LQTA 5THQA 3KQKA 1XA0A 2ZIVB 3A1EA 3UXEA 4NV0A 2Z2KA 2J4CA 3A3PA 3KC2A 1XRLA 3ICEA 1YZVA 4JI3B 1GQSA 1FQOA 2ZVDA 1ULTA 2Q9CA 3GMSA 2OP1A 3HG7A 1DDGA 3I04A 4PZCA 3SBDA 3EGVA 3O8LA 1R5NA 4TN5A 3RIYA 4QJ5A 3SYKA 1XI2A 3SHOA 4MIEA 1I6WA 1OXTA 2PLNA 5LZ9A 1R12A 1NJ2A 3CNBA 1MHTA 4GRIA 2C2ZA 1V71A 4JSTA 1J49A 3DXYA 3GUCA 4DUGA 1RU3A 2F3PA 2F1RA 2OV3A 3LT5A 4LWPA 4V0LA 5AXCA 3DH0A 3JAWA 4WBNB 5DGTA 1UBSB 1JEQA 521PA 2FQXA 1XZBA 2MINA 2Q5IA 3LFUA 4YJ3F 4D8UA 4DNQA 3PA6A 3FF4A 1U8XX 3GCGA 4B81A 2G0NA 3HM9A 4TKMA 3K70B 1Y8ZA 1KYZA 1JDPA 3CLSC 1ZY2A 4BNWA 4DIMA 3QF7A 4MR9A 4TTVA 4OQDA 1RVDA 4XYBA 4U2BA 3THWA 3FCSB 1D7OA 8LDHA 4PLVA 2CNWD 4MLPA 4MI1A 5F3DA 3BRCA 3EDQA 3MTIA 4TKZA 3U7EB 3WNDA 1YUBA 4W5NA 1W76A 5A3VA 2A1UA 4G23A 3RV4A 1UQUA 2I5PO 2PX4A 1L5HB 2W83A 5CXXA 5BY2A 2F6RA 5KOHA 1IXRC 5IVKA 3ZV6A 4M0LA 1JKIA 1G9SA 4G4JA 4NPHA 3AEQB 4B09A 4JI7B 1HX7A 2FFBA 5K09A 1TECE 3AJ8A 4JLNA 1PGOA 4B2PA 3TCXB 2V0NA 1BMFA 1GZSA 4M36A 3KJFA 5EP4A 1EFVA 1ZMTA 4C2UA 3L07A 4L4XA 1WLSA 4PQYA 3V80A 3VYVA 1CQXA 1NVXQ 2FN7A 1A8QA 1T36A 4GYJA 4H2DA 3DV0B 4Y6QA 4F97A 4K9DA 3H8VA 2RJNA 2QHXA 5HWSA 2GZRA 4BWGA 4A6EA 4MHTA 2CZQA 1EFCA 1Y7PA 3JD3A 1W36B 3TQIA 3D4OA 2V65A 2LBPA 4BZXA 1NE2A 5GMOA 1S8FA 1RM5A 1XMJA 3B2NA 4MW4A 5D5PA 2IZ0A 4F4DA 4TMTA 1JLLB 4GQBA 1T1IA 4PZUA 4K6CA 4YGXB 1EFPA 3ZQ4A 1WB4A 4LDPA 5P21A 1UINA 2QG9A 4QELA 4ZOLB 2DQYA 2Q4RA 1DFIA 4K8OA 3ROEA 1M6VA 2V7WA 4RVDA 4Y0VA 3PFNA 4DNXA 3BBLA 5DNAA 1E62A 5BR8B 4HAIA 4HWOA 2BLLA 1K63A 4AWXA 3SF0A 4E5KA 5SY9A 3G17A 1U3UA 4P86A 3SLRA 3LHKA 2LDBA 1C9DB 1N6KA 2WQ6A 4HQ0A 3G0DA 3ZV4A 3FY4A 1VFPA 3K3PA 3ZZTA 5IBCA 1C4WA 1UMDA 3DF9A 1ULAA 2H1IA 3AV3A 1OGIA 3LCJA 4V0SA 2H07A 5T5QA 5JNUA 4ARCA 1B8OA 1Z35A 3LXUX 4HLUC 2OK8A 2QRMA 1YIAA 2UVPB 3GUHA 1CUVA 1KETA 1TB4A 4MW5A 5CGQB 2BMEA 3UN1A 2RB4A 2XAAA 3RYFB 5IFKA 1W34A 4XGRA 4A9AA 1THGA 3KYBA 1EDOA 4DR2B 4LFBB 2QQGA 2WVJA 2WFLB 4Q4HA 3RK0A 4A8PA 1GLGA 4BOYA 4D42A 4B3SB 2XMDA 3RVJA 2DULA 4UCXA 1OI2A 1N2EA 1XTRA 3KE9A 4R0MA 2ZCVA 4MGHA 5C4IA 2RI0A 3WOHA 3ROKA 4GGPA 1L1FA 5JCXA 2GUGA 4YIKA 1XT6A 4G5GA 2IHUA 3JYNA 3OTIA 1MQ8B 2HF7A 1ZKDA 5L3RA 2LPMA 2D1YA 1MO4A 2YZ2A 3ANYB 4HQLA 4W8OA 4YT5A 4NPAA 4AY2A 1CRWG 1YUNA 1T0HB 4DIOA 3CEPB 4JLUA 4KXYA 3TVTA 1B74A 4C3UA 4JI4B 1CZUA 1I33A 4RZHA 4UREA 5FJIA 4RXUA 2QUJA 4I9FA 4TM7A 4COOA 1SUCA 3U4CA 3DLHA 1F7UA 5FI0B 3MMPA 1XYGA 3TLKA 5KWEA 1LDBA 5BWNA 4KQKA 3WICA 3ZY6A 721PA 5J4YA 4BBAA 3GLKA 4M9ZA 3WLSA 1LK7A 4WN9A 3UJDA 1T2NA 3P20A 4OFBA 4FBLA 1C0PA 1XAHA 3F7OA 1UXGA 3LBIA 4MH0R 3OZSA 3SJUA 3WYNA 4ZCMA 2LV8A 1Z5UA 1JLRA 1KRHA 4TVKA 5CVEA 5IWAB 1M1NA 5DJ5A 4RK4A 2X4LA 3FB1A 4CCSA 4LRWA 4HATA 2R85A 1ZH4A 1R4AA 3KFLA 5KPDA 2B1JA 3I9V6 3HA3A 3I30X 2QLTA 3IEIA 4TYYA 3G1UA 4CM7A 3RSGA 2GEFA 4H3KB 4EW3A 1ZUNB 2P4QA 3KEQA 3QPBA 4S1VA 3WLKX 4V24A 1T9AA 3VKGA 4IXDA 4OP1A 3BXFA 4Z51A 2IHKA 1WZNA 5KNDH 2YHBA 5F52A 1PE0A 3JSAA 2VHYA 5KSYA 2H8GA 3UK6A 5KYXA 2WUVA 2EAUA 1RLJA 1XU7A 4HTFB 1JVBA 1L7XA 1KKMA 2OBFA 2OUKA 1ZWKA 1AB5A 1X7ZA 2YWRA 3I8XA 3Q3IA 3VM6A 3ZV3A 2Z5VA 2P1DA 4HVLA 3KR2A 3GJYA 3ET4A 1MIOA 3EMDA 2NU7A 1V43A 2MSNA 4L5JA 2D8MA 3IIIA 1JHDA 1OAKA 1MNAA 2EBHX 2FK7A 2GWHA 2TYSB 3PWZA 4FI3F 3UJ7A 1F0KA 1RC0A 2JARA 5HZGA 2ZSEA 2WWWA 1PQ4A 3FYUA 4MS4B 3EGXB 4LX8A 3S5JA 4EEZA 2Z30A 1E3MA 1HXHA 5AVOA 4G8DA 4Q3CA 1SCUA 1FU7A 2NQ8A 2FWBA 4IWYA 4J3JA 4PLFA 4V38A 1W73A 3WDMA 3G8CA 4FB5A 5BYAA 5B57C 1V11B 1N3LA 2KWIA 3BL6A 1NFQA 4NZZA 2YOFA 4TTAA 1K9SA 2F1IA 2J9XB 2EQBA 2WMNB 3G0IA 1WEKA 3LX4A 3PXXA 3ZDCA 1T25A 3NDJA 4FQ5A 4CM1A 3T4UA 5BN1A 3ER8A 3CVOA 2OHFA 2Z6QA 1NL3A 3L2OB 3N7AA 2HQSA 2V7EA 5FI3A 4A3SA 5B64A 3FPGA 5FDFA 3EHEA 4DG5A 1Q57A 4JLDA 1KYQA 4ZCLA 4FDUA 3DL2A 3RIXA 1JU4A 4B7CA 2H31A 1OXBB 4MQLA 5EJ4A 3RU9A 4WFKA 5JZVA 3EOZA 1FSZA 3I72A 4XCVA 1ECLA 3HRIA 4LY3A 2QI9C 4O4IF 4P5DA 1M0WA 1RKQA 3H42B 1XOIA 5F1KA 5K3FB 4E15A 3CLSD 5D00A 3WGLA 1SUWA 4L6AA 1FNBA 3UT0A 4AS2A 3ZJ4A 2X6RA 4XDHA 1N2BA 3S7TA 2XGGA 3U7IA 4Q7QA 4ZIRB 5JAMA 3ZKWA 1VJCA 3JQAB 4X7PA 1R4NB 4RTQA 1CLUA 5AH0A 2R6CA 3JU3A 2AQKA 2NVUA 3H3XA 1SAYA 4MQ5A 4NTZA 3KIPA 4PYNA 2WUFA 3WYBA 2VWQA 1CD5A 4D9HA 1J8VA 3G8BA 3KQNA 1R0CA 1E3WA 1OASA 1O6ZA 1Q95A 2QRNA 3C97A 4G2NA 4IS2A 4K03A 5EMLA 2VZLA 1YRBA 4BNGA 4CMHA 4XWKA 3MQ2A 4A15A 1TCVA 4B31A 3GFPA 1ZCFA 1F8YA 3NWOA 2WSMA 5HMMA 1KEEB 2OCIA 3DOOA 2P11A 1JRLA 3IVAA 3ABOB 3UB4A 3AR2A 1F48A 4R6XA 4ZVNA 4BQPA 4XVCA 2EWVA 3P9XA 3DZJA 2QEQA 4PBTA 2R66A 4YGYA 1OX5A 2QNIA 3LO5A 3IEMA 4R2MA 5AICA 1X6VA 4OHUA 4PLHA 2B9EA 2CLEB 3VHXB 1W93A 4KK4A 3AILA 1II9A 3NHJA 1TKAA 2XOEA 4YUAA 1NSTA 5K51A 3GUZA 1CE8A 4F4JA 4FSXA 1ZBDA 2FK8A 5DGHA 2IP1A 2I78A 4FCWA 5DGIA 3REOA 3ZWOA 4BQEA 2VT3A 1WZ2A 3W3AH 3QNWA 1PSDA 3NPAA 1AC5A 4INJA 4JROA 3L0SA 4RSGA 1DZ3A 3K94A 3D4NA 3VR4D 3N9IA 4ASUD 2BE7A 4ENRA 1IZZA 5BN3A 1H4QA 5BV2P 1IWBB 4FE3A 4WKCA 1KZ9A 1P4GA 2DMRA 3CMCO 4IMPA 2W2LA 4QBIA 5F3RA 2XW6A 4MB0A 3T3HA 3KQLA 1XMIA 1QZTA 1SUBA 6LDHA 3Q72A 2B34A 5C0OE 3HO1A 5D1NA 4ZCPA 3WGVA 2IP4A 2I7DA 4NL4H 1KO1A 1TUBA 2BJVA 1N5LA 2H4ZA 4L50A 5EE0A 3SJBA 5GONA 2B8TA 1Q6ZA 1U11A 2XMRA 3NUGA 2BR5A 2GSDA 5AJYA 2PL1A 3A27A 2PGIA 1TJPB 1NULA 4G5FA 2G7ZA 4CQJA 5EIHA 5DEOA 3PQ2A 3PE3A 2BHLA 4LOKA 3QU4A 1V47A 1WXIA 1ZSVA 2R47A 4EY8A 4TWZA 1G7CA 1SA0B 2WQZA 4G8CA 3HV2A 2NGRA 3CZAA 3LH5A 4G25A 2YY7A 4I55B 3AFHA 5BYJA 1YQ9A 1E77A 1Z56C 4RSRA 3KVOA 1CEXA 1PFUA 1ZOSA 5E4JA 3OT4A 1E9RA 2QUBA 3RC1A 4DR5B 1TQDA 1YVUA 3QXHA 1B26A 1QTNA 2HY7A 2QYTA 4PPQA 5CTAA 4LRQA 4I9HA 4PRLA 1T8TA 2GN0A 1W4RA 2XUOA 3L5OA 4PG4A 5BW5A 3SR0A 5LKAA 2IPMA 1Y89A 2J0UB 1H1TA 4ZAFA 2A5GA 4UBJA 3EH2A 4D8TA 5KSZA 2LCQA 2MSKA 1OSNA 3JRWA 3QU5A 3VZQA 4R71A 4TXHA 4YCSA 2BGKA 4DTIA 3DE3X 2G8LA 2X1VA 3V6MA 3HB9A 5LMCA 3WWOA 3FDJA 5FO0A 5LB2A 3U7JA 2A0YA 2NOAA 2JGFA 3IA7A 4DAEA 1V7PC 3P0FA 1P5HA 2V7UA 3MNFA 4EI2A 3IERA 2WR8A 5E6SA 3THYB 3PXCX 4WEOA 4OX9B 1N9GB 2PR2A 1V3UA 3OO1A 4H31A 3QYJA 3W4KA 3ZWDA 2ES4A 4NH0A 1EX6A 4L0DA 1IH8A 1C3VA 2PYIA 2XE7A 4YASA 5DSXA 3VJKA 1VPLA 4TLMB 4BNYA 4BQFA 4Q3AA 3NV7A 1WVMA 5JVDB 5JS7A 3LQFA 3QE0A 4UTNA 4CM3A 5KYUA 4TLCA 4MV9A 5CG1A 3I61A 1GTL1 2O05A 1Z5PA 1SH7A 4RWEA 2HD4A 4IOKA 4M1ZA 4N8EA 1MDBA 5J9FA 1OT5A 4IZOA 1E2MA 3E0XA 2O8BB 5DRTA 2V6GA 2FPPB 4NS1A 3W5HA 2OKCA 5DM4A 3E5NA 3OQJA 4GHWA 4H35A 4DVJA 1MOPA 1NJ8A 2B94A 2A9RA 5EZYB 3AVVA 2RAUA 3L0IB 1DUSA 1ODJA 4N4AA 3BS4A 4J6EA 4S35A 4CKEB 3O92A 3QU9A 2JAWA 3VO9A 2LIVA 5AM1A 4GZ5A 1NNI1 3EZNA 4LEIA 4WLFA 4D98A 3NKVA 1UK8A 3FYUC 4WK2B 2JAOA 3GRFA 3QXXA 3VH1A 1DJOA 2YCLA 5PNTA 3AWDA 4J1NA 2ZXEA 1KDVA 2BEVA 2UUOA 1PYDA 3M1IA 4K9PA 1G1MA 5E3HA 5EJFA 1PJRA 4CQMB 1DB3A 1VKJA 2Q3EA 3K15A 1VSQA 1U7UA 1XGKA 3SI7A 3FWZA 4MW7A 4JT4A 3LP5A 5CB4B 1ZAYA 5DBGA 4C7KA 1N3IA 1NASA 3K72B 4J29A 1JQJC 4JLSA 4NR0A 4WH0A 5AK5A 1HQKA 2VPQA 1T4CA 2ROQA 5IBPA 3W4JA 1NBHA 4LDQA 3HN6A 1NT4A 2D1FA 4UEOA 4V0MA 3ZIDA 4GZMA 2ZRCA 3T52A 1A1SA 4XX1A 2QN2A 2JGEA 1MRNA 1P9WA 4OXYA 1CNFA 1OI4A 1ZCJA 1R0BA 1SCDA 1SBHA 1WXHA 2UYCA 1M34E 2Q8NA 5EP1A 4BO8A 3EXG2 4CIXA 1KEPA 1CJCA 4B7XA 1ENPA 3GU3A 2H4WA 5H80A 4J03A 5A0FA 2R8EA 4KQHA 1A7JA 1JWLA 1DT3A 2HN9A 1C4XA 3FMVA 1MJHA 3EQ6A 4UOZA 2AFHB 2D1TA 3T94A 3HDQA 4IHKA 1N7IA 3SICE 3W5VA 5DX8A 1TK3A 3ZV7A 1OXVA 3OEHA 2CJYA 2PK3A 1GSIA 2FSPA 2REQA 4UMDA 1A4XA 5DO9A 3VTKA 4B3HA 3L9WA 4BNFA 3I2KA 4HHEA 2CXTA 1WIWA 4HDCA 4CMGA 2IDJA 2WJPA 1D3AA 4KXNA 2JJ8A 1P9RA 1Y5IA 1C30B 2J67A 3LAWA 3PKJA 1VBFA 1ZLXA 4TKLA 2LVBA 3NHSA 4AQ7A 5CCBA 1E3SA 1WDKA 3AI2A 4XD7D 3DTYA 2YXDA 3MWEA 5CEJA 4BPRA 3KJEA 1Z07A 1CVLA 3MMNA 2ANBA 4G8BA 3GRRA 4WACA 2BTEA 2Z2YA 3H0KA 3LQYA 1VMEA 2ID4A 4KN6A 3D64A 1OX6A 3KQVA 4M46A 1O0CA 3PLNA 2XKAA 4CT5A 1FDIA 1XEAA 1VIYA 1Y1LA 3D59A 3QI2A 3GA0A 4M6WA 5HIAA 4PN3A 3V4RA 2GM3A 2X0DA 4E5SA 3D6JA 5A1TA 5HIKA 1G98A 2D1RA 5BSMA 2GO1A 1THZA 4Q4LA 2GCPA 4J1SA 2QMEA 3F73A 3GLHE 1E5DA 1O95A 1HNNA 2WD7A 4OGWA 1IG3A 3R6LA 4Q0MA 4X6UA 1HGXA 1ZC3A 1HL7A 4E3WA 2XQGA 4CHTA 5ALOA 1GVHA 1TI7A 3NFYA 3TQHA 2WYVA 1VIMA 5JT1A 4EFLA 1SU6A 2PKCA 2QQ0A 1JEOA 3B38A 1VDMA 1P81A 5IUKC 3IR6A 1HQCA 1FL9A 1W47A 2BISA 4RFVA 4ONEA 4BE9A 1RLMA 2PXCA 4YCJA 1G7TA 1WO8A 1ADJA 2Z6AA 3FSEA 1YFKA 1I4DD 1YJ8A 2ZEJA 4ZU1X 4RS3A 5CFLA 1O97C 4KQMA 3FHOA 1R0ZA 4A91A 1XQWA 2P2CA 2XVZA 4DA0A 2CV0A 1J1UA 3L8MA 2Q3LA 3QKWA 1OJ7A 4YXFA 5LDDC 1UR5A 2DU8A 4KXMA 1E3JA 2GBLA 2OZPA 4X1IB 3PC2A 4EO7A 5P8WA 1BE8A 3UT5B 5KX5F 1QMGA 4WX2B 3A2KA 1SVUA 3RTAA 1T3TA 4JL8A 2QTAA 1VMIA 2YR0A 2HT6A 4BS9A 4EENA 1WA5A 3PHIA 1P1IA 5KTKA 4AFNA 2CCGA 2FHSA 3LPLA 4RMHA 4DMRA 1MOQA 1EA5A 4CRWB 2CLIB 2WVHA 1N0HA 4ZOLF 3ROMA 1VGQA 1H2YA 2IH5A 3A6ZA 1U80A 2AVNA 2H0QA 2HDWA 2OCGA 2VA8A 1KY2A 2Y71A 4BVEA 4G0WA 2DC1A 1YZNA 3FOEC 1UT6A 1U8CB 1D2EA 4UEJA 2I65A 2IWHA 4K0KB 5ALEA 1MP0A 2AYYA 1V1MA 2ZWVA 4OB7A 4P93A 2NYAA 1IRXA 2JLVA 3IJPA 3JVUA 4CHGA 4LZAA 1AOXA 1UBRS 1YE8A 1JXQA 5H68A 2PPVA 4A27A 1X42A 1Z7GA 1PU2A 3H2BA 4I6GA 3OFVA 2BGNA 4JBXA 5E0KB 3NDBB 3LLMA 3HJCA 3BMCA 1XLWA 2NXNA 3O8QA 4YAJA 4BNKA 3OPQA 2YZMA 3HEBA 4FR2A 4EI8A 5ITZA 3OLXA 2GD2A 2DKFA 2ZIWB 4MQUA 4FZVA 2Y0DA 1JDJA 4QDZA 3RS5A 3RU2A 1U28C 1UMCB 3BTSA 3L6DA 2GO7A 3M5PA 4HGNA 5DNUA 2WKPA 3A11A 2QGNA 2Y66A 4QRHA 2VDQB 4CU2A 3GJ3A 1TPZA 2WBLC 4AMBA 3KSAC 1KEKA 5DHFA 2H52A 4KZKA 3IDZA 1Z5ZA 1XJ5A 1CS0A 3PZRA 1ZESA 3AM4A 2E5WA 5FKJA 5I9LA 3U5TA 4PWZA 4F3YA 5LMZA 3OCYA 1QIJA 3AUJB 3GGSA 4BLVA 4DLKA 2F1KA 1JA9A 3LDHA 2EIXA 3FOAA 1V5GA 3CNNA 5HKOA 1U8UA 1QHHA 3F67A 3UBTA 4AYXA 3L93A 2EF0A 2QLBA 3EVNA 4HZUB 1Y1RA 4B3JA 2XQIA 1H3NA 3OURA 3PUXA 1AHIA 4PYIA 4D44A 1PGQA 4QKQA 3CLRC 3KFXA 4DG8A 1EVIA 4IDOA 1RAFA 1J90A 3LY9A 4DA9A 3QXSA 4XYGA 1ECBA 2Y1EA 3EFOA 4IIGA 3FVQA 4MUBA 4KOEC 1OTHA 1M2KA 3H8SA 2CL0X 4YRPA 3GDFA 3ZG6A 3MTJA 4FKBA 3NQ41 3N2KB 3UJ9A 5CAEA 2WA2A 1FUEA 1KF0A 2EKBA 4DCGA 3K0FA 3QOYA 4IMJB 2B78A 1NUAA 5GV8A 1QE0A 2UU9B 2FW9A 3AXSA 1FYVA 4LJAA 5DNVA 1Q1EA 1Z2CA 4FDTA 2AC2A 2DECA 4K81B 3T15A 5LU8A 2QTZA 3MUFA 4FE7A 1TZCA 2EG5A 2OBYA 2OFWA 1MUUA 3FIJA 3MQ4A 2MMGA 4Q01A 2IS2A 4V03A 1DTWA 4K2AA 3HACA 2YWEA 5C5IA 3PRKE 1Z6ZA 2JGIA 4KR0A 1ULUA 3SJCA 3S1AA 2HJWA 3KX2A 3WJAA 1NQUA 10MHA 3JW8A 4Q02A 4Q9KA 4NU0A 4JOCA 5IAKA 4F5EA 2YWHA 5L6LB 3ZS9A 5CDSA 1JWAB 4CPDA 2QU8A 4LWQA 5C2JB 2I66A 3TFOA 1RMTA 2ZDGA 1L7RA 2UVDA 1W2WB 1FOEB 3NEJA 2X2EA 4FFVA 3ZU3A 4B7UA 1C81A 2ZVJA 4N7JA 4RH0A 3RRXA 5AW1A 4O2BB 1AKMA 5JRDS 1YNSA 3D8BA 3VR0A 3RQIA 4HDRB 2XRZA 1GQQA 3EBPA 3GWGA 3WHIA 1DBSA 4BO3A 3WK6A 4KV9A 5FI1B 1TA0A 1ULSA 2W6IA 4D9IA 3LC2O 3TLYA 4NYIQ 5K2OA 2C20A 4Q4JA 3V8QA 2NP6A 2AOTA 1SUFA 4B4VA 3O95A 3O8BA 4FYYA 1QCZA 4L3OA 2P9ZA 3DMFA 3N0RA 1G5QA 1RHQA 1L9XA 4MGEA 4OG2A 5LP1A 3GJSA 2Q1TA 3KEGA 1UMBB 7GPBA 4RSMA 1PBTA 4N39A 3PZBA 4FDAA 4LVNA 3D5TA 3C2QA 3A25A 4F06A 4OAQA 2FOIA 1PVOA 5EZSA 4FYKA 4Z4CA 3GEHA 4ND8B 2ZCUA 1FNNA 1M8JA 3D8HA 3A6PC 1E32A 3AW9A 2ZM6B 2V9PA 3OT1B 1F4VA 1QYCA 4H6XA 1NG1A 5ICEA 4S04A 1MABA 3IT1A 1M66A 2QAJA 2OLEA 1U04A 4X3OA 3BSSA 5CTJA 5HG0A 5L3ZA 3TZLA 1YF3A 3IIJA 5JNSA 3BDIA 4WNAA 4IG4A 2XCTB 1N2OA 5IJ0A 5E4FA 1VJ5A 1X77A 3SQWA 3LLSA 2RHTA 3ABIA 4JQCA 1XPUA 3GYBA 3ECCA 4BJ5A 5LIPA 3AW8A 1JNXX 4IJVA 2AUNA 2P2GA 3ZWPA 4E2ZA 2IIVA 2X41A 3OZGA 5ALIA 4MVCA 5ALWA 2JLZA 2O8DA 1XFAA 1W88B 4CLDA 1WSWA 1O95C 4XJTA 1ATZA 1NUHA 3ETJA 3QMVA 4YUZA 5JZMA 5IT9A 4BVBA 2OGSA 3WXMA 1I3OA 2OORA 2HO5A 5HIMA 1QQTA 3O26A 1C50A 1IATA 5C1PA 4TKVB 1QGDA 2J9FB 1KIFA 3K4QA 4M49A 3QH4A 3BEDA 3CIOA 1ZVJA 3KQTA 4WCFA 3URMA 1AZTA 4BO6A 2RG1A 5ELLA 2HXSA 4OXKA 4PVCA 2BFEB 1BDMA 3P0EA 5DT9A 3A14A 3F8SA 4FOSA 3I73A 4CKWB 1QWOA 2AKAB 2PRIA 3B3GA 2WJ4A 3DCNA 3Q3GE 3K6SB 4WJLA 4TYQA 1OYWA 1YBMA 2GBLC 4EM6A 3RYCB 4FMCB 4RFSB 1JHMA 2C4MA 2X0IA 2Z43A 4KX3A 4Q5IA 2J7PD 2JHPA 5KTTA 2NXEA 1K8QA 3NKFA 4TT8A 5F1YA 3RCBA 2Q8PA 3I42A 3ZDDA 1C9KA 3SOPA 5FAKA 4F2WA 2V0GA 4NZOA 1H2AS 1M2VA 4MIKA 4RACA 2IQ5A 1CW2B 3MWYW 2XE6A 1U8FO 2DJIA 5FOWA 2AYZA 4CMIB 4ZJYA 2IXGA 3O47A 1QKKA 4F3CA 3H7IA 5KTRA 3E9NA 2HA2A 3ST7A 1KBOA 1PIWA 3L0DA 3E5RA 5COBA 3OY2A 1Y6QA 3BIWA 4JP1A 4CNBA 4XWOA 4RYDA 1NF8A 2EERA 4AQDA 2MJLA 3G0BA 3R0IA 3ROGA 2DERA 3RVQA 4Y6PA 2FRDA 5A05A 3LUGA 1CUHA 2BP7A 4JBWA 5I7OA 3QY0A 2QE6A 5LWQA 4PPYA 1C8VB 4Z1OA 1Y5NA 2FEPA 3UAWA 5LYJB 1ZR4A 3W1WA 2BHSA 3SC2A 3HCOA 1FVXA 2QVLA 3JQQA 1Z12A 4B82A 2G1UA 2HMSA 1MCZA 1TZ2A 2J30A 2XY4A 3DMDA 2H2AA 1LU9A 4KAJA 4OQLA 1NX6A 4NEHB 3TWOA 5ES4B 1R74A 2HA6A 1JHVA 1QHNA 2RSLA 2IZ6A 3F46A 3K1ZA 3UMSA 3W5IA 2QRVA 3FBGA 4DLNA 2EW8A 2GJAA 2ZS8A 5I3ZA 4YK7A 4P53A 2DCUA 4GYYA 2ZBDA 5EUQB 3PDUA 4DRXA 5LQDA 3WLNA 4LI3X 3F9RA 5B1IA 2FP4A 2J7KA 3ZBTA 3RAGA 4MEAA 3TB6A 1IN5A 3CV3A 3D4IA 1AS2A 3CW2A 1QYDA 3I5UA 4JX8A 5E9AA 3RUIA 2J0QA 2C00A 1M1ZA 3H4VA 3CSUA 3LM8A 3Q9NA 3ZDRA 5HFNA 3KZKA 2GEKA 3LPAA 3ZEAA 3CINA 2QN3A 3WMFA 5IJAA 4JSYA 1OKKA 1X1RA 3CZRA 4J4BA 3O31A 2KB0A 1FJ2A 2XBLA 4PLWA 3R8XA 3RFTA 1KR5A 5FOXA 4URWR 4IH1A 3AHJA 4HB0A 1I2MA 4V0NA 3U3JA 4MV0A 1QQ6A 1O08A 4WVFA 2D59A 5J47A 2H51A 4PFKA 3K1JA 4OJNA 1A8UA 1LK5A 1R64A 4UD2A 1RLTA 3UFXA 2XEDA 3NASA 1FX1A 1FY2A 2BFNA 1SIWA 2J3QA 1HETA 4YQFA 3T1TA 1FC0A 1HMYA 3D5QA 1X1AA 1C1XA 1PI3A 1GHTA 1J20A 4W9MC 4YC7A 4I6EA 3RC2A 4QFMA 4IKPA 4ODIA 1GPMA 2X5JO 4K6FA 4BV3A 1D6MA 4ZEOA 3E22B 4QYSA 4OLJA 2IPXA 1QV9A 4ZDJA 4L9WA 3QX7A 2FN3A 2VJOA 3MWGA 4K05A 1W36D