1R74A

Crystal structure of human glycine n-methyltransferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
275
Chain Sequence
YRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycine N-methyltransferases: a comparison of the crystal structures and kinetic properties of recombinant human, mouse and rat enzymes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Glycine N-methyltransferase
total genus 75
structure length 275
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1r74A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r74A02
4RTKA 2AVNA 1ORIA 2A14A 3G2OA 3NJRA 4GOLD 3EVBA 3OFKA 1B42A 5KVAA 3E8SA 3ER8A 3C0KA 2PSSA 3EMDA 5EMMA 1XCJA 4Y2HA 5CCXA 1YF3A 3EVCA 10MHA 3SR4A 5DM0A 4E70A 1VBFA 4KIFA 5DLYA 1SUIA 2Y1XA 5CCBA 2O57A 3QV2A 1G6Q1 2IH5A 2PT6A 1P91A 2I62A 2EG5A 1EQAA 3P9IA 1JQ3A 1HNNA 4DCGA 3HVKA 3OU7A 4PINA 4RTSA 3DXYA 5DSTA 3JWJA 1SKMA 1EJ6A 3RW9A 2V7EA 1EG2A 2EFJA 2QRVA 3P2IA 1QAOA 1RJDA 3B5IA 4UOEA 5EC8A 1G8AA 3A25A 5EOVA 3V8VA 2IH4A 4RV9A 2ZVJA 3G2MA 4PYLA 5DT2A 5K09A 1R18A 1YB2A 2NYUA 2IDKA 2I6GA 5CVJA 3G2PA 3SSOA 1Q0TA 5P8WA 2PWPA 3KR1A 1NBIA 1JSZA 2GS9A 4PYMA 5JUWA 3P9NA 3LKDA 1VL5A 3ORHA 3T7RA 2AOVA 3HP7A 3MB5A 4HH4A 3FUVA 1XXLA 3TOSA 5B1SA 4AUKA 3G2QA 3A26A 5HFJA 1AQIA 3KKZA 2JHAA 5EZQA 3E7PA 3FUUA 3KPJA 4MIKA 4QDKA 4MHTA 5HOQA 3ME5A 2VDVE 2FK8A 4ER3A 3P8ZA 5CVEA 4RTPA 2GAFA 1NW3A 3KR2A 1NW6A 2E5WA 1X1BA 4KWCA 4OBWA 3G5LA 5EG5A 5FTWA 3I5UA 5HILA 5LR6A 2HV9A 3K6RA 1YFLA 3OPNA 1EAMA 4EVIA 3GXOA 3H2BA 4KDRA 3FUXA 2OBFA 2AOUA 4R05A 4KVZA 2B3TA 3HEMA 1VLMA 2PY6A 3EEYA 2P41A 4PYNA 5T64A 3BKXA 1L1EA 1H1DA 4LG1A 3KQOA 5E1MA 5FA8A 3VYWA 1NV8A 2G1PA 3PFGA 5D1NA 2PX4A 5C9ZA 2ZWAA 1P39A 1UWVA 1Z3CA 3FTCA 3SXJA 2PX5A 4CKCA 3D2LA 2XVMA 2Z6UA 3C6KA 2ZZMA 3MERA 2ZULA 2H11A 3P9KA 4HSGA 3HVHA 5DX1A 4KDCA 3BGIA 4HC4A 2WA2A 5E2AA 3QOWA 4YV0A 5K0JA 1ZKDA 2ZIFA 3LGAA 5KS2A 3ERCA 2QE6A 3THRA 2AN5A 2NXJA 3O7WA 1D2HA 4Y30A 4BLWA 4QTUB 5LQNA 4C06A 2ONYA 3C3YA 3KPYA 4KW7A 4C04A 5LQAA 4XUCA 4OX9Y 2FPOA 1JQDA 2PXAA 2ZBPA 4GUAA 4MWZA 5T67A 4ER6A 3THSA 3IV6A 3Q7EA 4IWNA 3KU1A 5MHTA 2GLUA 2NXEA 4AZSA 4HRAA 2AN4A 3KQTA 5EHGA 1XJ5A 3LDFA 3X0DA 2O06A 4XCXA 3M33A 5F2KA 3S68A 9MHTA 5FHRA 1KIAA 4YMGA 5GIPE 3OCJA 3GRUA 1D2CA 5DRTA 4GEKA 2JHPA 5H02A 1BOOA 2XYVA 4FT4A 4YUZA 4DCMA 3M6XA 1YFJA 2NP6A 3LHDA 3UJ7A 3G7UA 2HR1A 4P7KA 2ERCA 4RVHA 3REOA 5BP7A 5FWAA 3QOXA 1O54A 1BC5A 4FGZA 2BR3A 3DH0A 5DRYA 4B17A 3BT7A 1NW8A 2CKDA 2WK1A 3HNRA 5EMKA 4ER0A 1D2GA 1I1NA 4X1OA 3UFBA 4YV2A 1NKVA 2OY0A 2C7PA 4EKGA 3NWEA 3PX3A 4P7JA 2OKCA 5DM1A 7MHTA 1YZHA 3TKAA 2VDWA 4GC5A 1RI1A 3O31A 3JWGA 3HVIA 4POOA 5E9QA 2YXDA 3HA7A 1ZQ9A 2PBFA 1QAQA 5CVVA 3MQ2A 5E2BA 3T7TA 4BP3A 2NP7A 3I53A 2P8JA 1N7JA 1N2XA 2IGTA 1XDSA 2NXCA 2YTZA 3AXSA 3BWYA 3MAGA 3PS9A 1KR5A 5DX0A 3TLJA 3FPEA 3C3PA 1PRYA 4LWPA 5FHQA 5BW4A 4GOMD 5EKXA 5EEHA 5G02A 3I9FA 4ATNA 3OZTA 5E1BA 3JWHA 3AJDA 3HCAA 5E1DA 4PYKA 4C08A 4FR0A 3M70A 3P9CA 2YVLA 4PCLA 1X19A 4FT2A 1IY9A 1VQ1A 2AOXA 2YR0A 1IM8A 3LDGA 4AZVA 4IKPA 2BR4A 4BP1A 2JH9A 3VC1A 1XDUA 3GNLA 5EPEA 3T0IA 2YUIA 5EMLA 3BKWA 3KQWA 3HA3A 2I7CA 3TM5A 1VPTA 1WS6A 3DP7A 4CXMA 1TPYA 5FADA 4DQ0A 3TR6A 3CJQA 4DF3A 1N7IA 2PGXA 5EQJB 1DL5A 1XDZA 1ZG3A 3UJBA 3KPUA 5M5BA 3UBTA 4ER7A 4GBED 1R74A 4M7RA 3NVKI 2O07A 4HG2A 4QQNA 3GRVA 3FTEA 2DPMA 2BM9A 2PX2A 3KQPA 1JG2A 1JR4A 3EPPA 4X61A 5DSXA 2P40A 3LCCA 5HIIA 5T6BA 3AXTA 3RODA 4M38A 4BLVA 2UYCA 1JG3A 3SSMA 2C7OA 2NXNA 4PIMA 5ERGB 4YUVA 3AWIA 3OZSA 4OA5A 3UJDA 2ONZA 1KHHA 1Y8CA 3FZGA 5EVJA 3UJCA 2C7RA 2ZFUA 1RJFA 3PT9A 1L3IA 4AZTA 2ZBQA 5EKUA 4V0QA 3KQMA 3PFHA 1O9GA 2OYRA 4R8SA 2IFTA 1WXWA 1TW2A 2VZ9A 2V74B 4RWZA 5DXJA 5FCDA 1MHTA 4A6DA 2QM3A 3UJ9A 1QAMA 3WSTA 5JR3A 4PYOA 1HMYA 2G72A 3IEIA 1YUBA 2FRXA 4Z2YA 2VP3A 4QVKA 5GP1A 2ESRA 4E31A 4PNEA 3HCBA 5LQCA 2YXLA 3UWPA 1R00A 3DXZA 3GRYA 4RVFA 3UA4A 2P1DA 1NW7A 3OE4A 3DUWA 2AS0A 2UYQA 3DLIA 3FUWA 5DTMA 5IKMA 1QZZA 4K6MA 2JJQA 2ZTHA 3EVFA 4CTKA 1Q0SA 3MCTA 4QPPA 5GINE 2IPXA 3A27A 1IXKA 3NVMB 3GRRA 4CKBA 3SM3A 1EJ0A 3DR5A 2Z6QA 1VP3A 1JQEA 3NW9A 5LQUA 1AQJA 1G60A 3ELDA 4RTLA 2IIPA 3KR9A 3CCFA 3FTDA 2PV0A 2ORED 3CBGA 4O29A 4PYQA 4RTQA 5HIKA 4WXHA 3LBFA 4IV8A 5EIFA 8MHTA 4DA4A 3B7PA 4E30A 4E2YA 2P7HA 3P71T 4PIPA 5K0BA 3SGLA 4AX8A 5DPMA 1L3CA 5E9WA 1DUSA 1DCTA 4L7VA 4EKIA 3KQYA 2AOWA 2ZIGA 3LL7A 2IP2A 1U2ZA 2HWKA 3TRKA 1V39A 3DMHA 4XUDA 4QVGA 4HGZA 4ZTBA 2OB2A 2ZWVA 4PWYA 3UJ6A 3OE5A 4ER5A 1ZGAA 1YZ3A 3BUSA 3G8AA 3R6TA 2K4MA 4HGYA 5K0CA 5LSAA 5GM1A 2YX1A 4C03A 4E32A 2O0LA 2EJUA 1XCLA 2ZBRA 2PKWA 2EX4A 4YUXA 5LQJA 5K05A 3PTAA 2XYQA 1XTPA 1P1CA 4GF5A 4OA8A 2UZ4A 1INLA 2VDUE 2OZVA 5C0OE 5K0GA 3L8DA 1X1CA 2IDJA 5FQOA 3EVDA 4RTOA 2P3OA 5FWDA 3UA3A 3ELWA 1FBNA 5HIMA 3UZUA 3GO4A 2I9KA 4R8RA 2LD4A 4RX1A 3HCEA 3F4KA 5E8RA 4F85A 1I9GA 4EMSA 4DM3A 3G5TA 4H0NA 1KPIA 3G8BA 4DKJA 3SX0A 3DTNA 5HIJA 3EGEA 4YMHA 5GIOE 1JG1A 2B2CA 4GQBA 1X1DA 2O05A 2YQZA 3A4TA 3FRHA 4FS8A 1NT2A 5U4XA 5GOZA 3SMQA 3R9XB 3FYCA 2VS1A 3FPFA 4RVGA 2PXCA 4X60A 5EHIA 3E23A 3BGDA 1FP1D 2GPYA 2HTEA 4P7FA 3SVZA 4C07A 3HM2A 2JG3A 3GIWA 3HVJA 1MJFA 4P7GA 3DULA 1FP2A 2PVCA 3K0BA 1T43A 3G88A 3EGVA 1UIRA 5CVUA 5EZSA 5GM2A 3KQVA 2H00A 3NWBA 4OQDA 2B78A 5EIWA 5DX8A 2AVDA 5EEGA 5K01A 3R24A 3MGGA 1RI2A 1KXZA 2R3SA 1BHJA 2JHCA 3P2EA 3R3HA 4HTFB 5GWXA 3BGVA 2OO3A 2OXTA 4MQ4A 2KW5A 4F84A 3PB3A 1RI3A 1SG9A 2PJDA 3B3JA 5DM4A 3P97A 5DWQA 3DOUA 4CWAA 3I58A 5E8JA 5ICGA 3KQQA 2Q41A 4M37A 2G71A 4KIGA 5KYGA 2P7IA 3BWCA 5FUBA 3FTFA 3O4FA 3B3FA 4LWOA 3ER9A 3HTXA 4R6WA 1XVAA 1VP9A 2H1RA 2PXXA 4QDJA 5FA5A 1F3LA 2XYRA 2GA9A 2AOTA 1KYZA 1SQGA 4HTFA 2P3LA 2PWYA 2B9EA 3GU3A 3DXXA 1WXXA 3VC2A 4WVLA 4PCAA 3VSEA 4CTJA 5F2NA 3FPGA 4GOOD 3UJAA 1ZHFA 2BH2A 3PLAE 3GDHA 4YUYA 2IBSA 1FPQA 1EIZA 3UJ8A 5LQRA 1M0EA 1KPGA 3TM4A 1JSXA 3NTVA 2XBMA 4X63A 4YV1A 3GRZA 1WY7A 5DXAA 4C05A 5DTRA 5HZMA 2CMHA 4G56A 4A6EA 3I64A 4V0RA 1BKYA 3CC8A 2R6ZA 2FYTA 2AOUB 3ELUA 2ZW9A 4FSDA 5D1HA 4FP9A 4E33A 3MCZA 2FCAA 3C6MA 2IH2A 5C1IA 5ICFA 4BY9E 2QY6A 4E2ZA 4DZRA 3ELYA 4EK9A 2G8NA 4BLUA 5CIYA 3TPZA 1F38A 3ANXA 5BXYA 4C4AA 2CL5A 1G55A 2FHPA 3KPVA 1I4WA 3EVGA 3BXOA 3OU6A 2QYOA 4PYIA 5HEKA 2Z6AA 3M6WA 3MTIA 1JTEA 1O9HA 1R6AA 4KRGA 3NMUF 5K03A 3HA5A 3DLCA 2CMGA 3DMFA 1ZGJA 2B25A 3KHKA 3OU2A 3A7EA 5K0LA 1RI5A 3CJRA 3IHTA 5IH3A 4OQEA 3LBYA 3V97A 2BZGA 2WA1A 3SSNA 3R0QA 1ORHA 2AR0A 4E2XA 1VE3A 1R8YA 4M36A 3PX2A 5K0FA 2ZLBA 2YXEA 4IV0A 1TW3A 2BM8A 1JG4A 3DMGA 4JXJA 5FULA 2XVAA 3AY0A 1KP9A 1NBHA 2C7QA 2BR5A 5F2OA 1NV9A 1X1AA 1SUSA 3NDIA 5DM2A 2ZSUA 2UYOA 4U7TB 3CGGA 2AN3A 5K0NA 3EVEA 4MTLA 4FSXA 3LCVB 3LCUA 4RSRA 1QANA 1R8XA 3RIEA 2GB4A 2N47A 2Y1WA 3MTEA 1P1BA 3OZRA 3KPWA 2F8LA 4R6XA 4E2WA 2IBTA 1AF7A 1L9KA 1UFKA 3ID6C 3TFWA 2P35A 5LQKA 5K8VA 1QYRA 2AZTA 4PYJA 3TMAA 3EGIA 5EGSA 3FYDA 1OR8A 1VIDA 3M4XA 2ZIEA 5K0EA 4PGHA 4QPNA 5EMJA 3HCDA 3CJTA 3FPHA 3P2KA 4GOND 2P3QA 5ICEA 1PJZA 1FJXA 2OPBA 3TKYA 4FZVA 3LDUA 3TQSA 4DMGA 3U81A 3NDJA 3LKZA 2UYHA 5ICCA 3FRIA 2GH1A 3MHTA 1M6YA 3EVAA 2EJTA 1RJGA 3KR0A 3LX6A 4QTTB 4U7PB 3GWZA 2ZCJA 2G70A 3KQSA 1G38A 1L3BA 1KPHA 3EMBA 4RYLA 2ADMA 2JH8A 2NNWB 4QQKA 4CKEA 4OBXA 3BZBA 3M6VA 3BWBA 1SQFA 5KQSA 2FK7A 5BW5A 1G8SA 3G89A 3HCFA 3FPJA 3T7SA 5DTQA 3HCCA 4YUWA 3EEOA 4NECA 5KQRA 4GC9A 1JTFA 1AV6A 3LSTA 3CKKA 2QRVB 3LPMA 4X41A 2OB1A 4EQZA 4RTJA 1KYWA 4LECA 5E9JA 5CD1A 4P58A 3JWIA 2HNKA 5FQNA 2PLWA 1RJEA 4ISCA 3EVZA 4PGGA 3GCZA 4RTNA 3CVOA 3E05A 1NW5A 3B89A 5CVDA 2PT9A 1WG8A 2DULA 3GGDA 1M6EX 2HMYB 3LECA 4RVDA 4RTRA 3BWMA 2PX8A 4RTMA 3PVCA 4PONA 2CWWA 3B3GA 5E1OA 4XUEA 3FUTA 4F86A 2ZZKA 1SVUA 2ZZNA 1WZNA 3OFJA 3A7DA 4AZWA 1RI4A 3GJYA 5CUQA 3M6UA 5CM2Z 2AOTB 3IYLW 1NE2A 3Q87B
chains in the Genus database with same CATH superfamily
1L6RA 1ORIA 3FLEA 5AM1A 2BI4A 2PH5A 3DNPA 4XYBA 3V7FA 2PTHA 4RKWA 2Z4TA 2YN0A 3OFKA 5H82A 3PV0A 5C8DA 5CB4F 5IN4A 2QMEA 2GKGA 4RNDB 5ALDA 4F11A 5BSWA 1R0SA 2ILTA 2JJ1D 2GN2A 2WV7A 5FWYA 3R6LA 5F3DA 3EJ6A 13PKA 1WXHA 1ODSA 4S1PA 5DM0A 4KIFA 2Y1XA 4TS1A 2O57A 3R7LA 4DLPA 2FDRA 1U1DA 3BMNA 2VP4A 3F8SA 4FFVA 3ZCSA 2I62A 5I7SA 1VJGA 2QLJA 3I9LA 5JFTA 1QKJA 2VYCA 3SC3A 5E3HA 4DCGA 2JAWA 1EUDB 1DC8A 3CN7A 3K9WA 5BV8A 1MZPA 4K0KB 3VO2A 3DVQX 4YIHA 4PG5A 2F59A 1NIJA 4KQCA 3MSXA 2KHZA 2VDPB 3HRKA 4UFOA 2XB6A 4K3UA 1TZ2A 3ROPA 1F1JA 3UOWA 1H5NA 3N2KB 2R00C 2R11A 1ZMXA 4RV9A 2OSVA 1GGVA 1MC4A 3GEIA 3W6UA 3ZYZA 1WCXA 1XD2A 1Z25A 2NYUA 3OX3A 3KEQA 3DL4A 3S5UA 1XPUA 1V95A 1NQWA 5C31A 3WDLA 3FYSA 4AUMA 3URKA 4C1BA 4BQPA 4Y98A 3KELA 4DILA 1LF0A 3WB1A 4DWWA 3ORHA 4FU0A 4L1KA 4OI4A 4OQYA 2CVHA 2NTVA 2XQKA 3C1AA 3FVWA 3QVVA 4FW8A 3VV2A 2PUCA 2B4QA 3A26A 4TYPA 1KRHA 3PF8A 1TAUA 2G63A 3DC2A 3MMPA 4UHJA 2DFTA 1WMBA 3G0OA 1XMXA 2DUMA 2EZ9A 4BBJA 3KSDO 5TGZA 1MQ8B 5AVKA 4ZA2A 2BM0A 5C80A 5HOQA 5HKBA 1SKYB 4RA9A 3D3WA 1R0WA 2YN4A 1VKNA 3UNXA 3UC9A 1XRSB 4JVMA 3HO8A 2FSFA 3DWFA 3BBLA 4WOCA 4C87A 4Y2RA 4NU0A 1PQPA 2CJXA 4O59O 5LBUA 1HDOA 3GJXC 2V8OA 3H2ZA 4KVZA 2GNAA 4ALMA 1KJJA 3FNEA 5J5AA 3NVAA 2OCIA 5EMNA 3WIVA 1OX4B 4ZU3A 1GG2A 3AX6A 3ED5A 5KNLA 3T7KA 3QVUA 3G82C 1EEHA 2PX4A 3G1TA 1UWVA 1XLTA 4YTEA 2MDTA 1EESA 1A9RA 5SZJA 1AKMA 4WUTA 2HDNB 3U3ZA 1CHNA 1HZZC 1M5TA 1YJAA 3BGIA 3IP6A 4HDNA 4WNAA 3W2FA 4C0AC 1GYQA 1G2IA 2OOSA 2ZIFA 1S2LA 2BYTA 3EWIA 4IEIA 3IEVA 1T6YA 4XTCS 5JSKA 3TEMA 2DPLA 2XTMA 1JHPA 1JL3A 2E6UX 1Y89A 1MORA 4E94A 2A88A 1X3SA 3P4YA 3PPVA 4JA2A 4CMIA 1R4AA 5DTJA 3WWPA 3K0SA 1ZJZA 2NUPA 1Z5WA 1GT91 2ATCA 1UKZA 4YYEA 4J1TA 1GGFA 4RCZA 2IUTA 1JAIA 3O3OB 4F06A 4U6QA 4BFLA 2V98A 1ZI8A 4EI9A 1HNZB 1U63A 5DRTA 5EUCA 1X94A 3LP8A 2YCBA 2G6BA 1HDXA 3ADOA 3N2EA 5KTRA 4HAOA 3MEQA 1BWQA 1FP6A 2R65A 3JS5A 2BFBB 4ZARA 3RR2A 2Z56A 4TTIA 1QH8A 4NAUA 4AG3A 2WWHA 3PEUA 2HR1A 4FYPA 1T13A 3EGOA 1QV7A 1QX3A 2BGNA 3Q1KA 1MIHA 3L9XA 4PC3A 4TSKA 1KU6A 1BC5A 1I5RA 3BT7A 4F8EA 1WP9A 4TRMA 3IVCA 3UF0A 3HZHA 5B57C 1R6UA 2OD7A 3D3KA 1EP3B 1VMEA 2ZOSA 3E9DA 3O0TA 1L5OA 1NW9B 1OIVA 3DO6A 4QUAA 4ZZ0A 1E1DA 1GCOA 1RT9A 3ASZA 4UUNA 2YWHA 5FL3A 2WJAA 5CIWA 1LNSA 2F43B 3HB7A 1RAEA 4K86A 4R1OA 3QPUA 1PEYA 3AC0A 2FRDA 3L0PA 2QYTA 4ZRNA 5E9QA 1NF3A 2HFKA 2NU6A 5HFAA 5F3WB 5BYBA 1C1HA 4DTCA 4JFRA 1NM5C 2I7DA 2QN3A 1BXRB 4P0QB 1BGVA 2FFRA 3FHJA 1FSGA 2W8BA 2XXJA 2BUAA 3OBIA 1TO6A 3RPEA 1L5MA 3U7FB 2GN0A 1RZRD 1PWZA 5I7FA 4P4GA 5IAJA 2HW8A 4PZYA 4I4IA 1A9YA 3WRVA 4BP8A 3U60B 5FWXB 1QOPB 1RYNA 1TQDA 2PLRA 2V7TA 3LUHA 4RVNA 4U8GA 4JLOA 4EYOA 3O74A 3T61A 1PJ4A 4V03A 3OIUA 2AK3A 4JA0A 2DPGA 4E0BA 2VR1A 3B78A 1P2TA 2X1HA 4OQLA 4OH7A 2E7ZA 2IX9A 5FORA 1HE4A 1TPYA 1U2PA 3AGQA 5LB4A 4BAGA 4DPKA 5BN5A 5EQJB 3UJBA 2RGYA 2ETXA 1Q7CA 3UBTA 3NVKI 1JWBB 4GLOA 5JPDA 3P0FA 4U9UA 4CLOA 4IOJA 2WIAA 3N8NA 4RJKA 4J03A 2UXBB 3L2OB 3PWSA 4QGBA 4FFBB 4Q9JA 5ENZA 4D4JA 5EJ6A 3A4IA 4JP5A 1NG9A 1ZM7A 2ZJOA 3LGSA 4PGFA 4JI5B 4YDQA 2BSQA 3TJRA 4TUYF 5ERGB 2FSSA 1CUEA 1ABEA 3OE7D 3EEBA 2ONZA 4DNPA 2OFWA 4ZJUA 1Z2OX 1E2HA 2ZSDA 1P44A 1TZBA 3EASA 5AVRA 4L78A 2H59A 2Z2XA 5JPCA 4RMGA 1P7CA 1PTKA 4QDTA 2F2TA 2FPRA 5F21A 1AZSC 2UU9B 3STYA 2PL1A 4DJDC 5G41A 1KEKA 4FDLA 3EIWA 3K2QA 1GSHA 3LLCA 1OA0A 2GOYA 3P9XA 4TPKA 3ZWDA 4DG8A 3OCUA 4BB0A 1QRTA 4K40A 2CXOA 1Z0JA 3ZHQA 5A3QA 2BCEA 1PUJA 4YRSA 2C5HA 1RABA 2G1UA 4IGKA 4OCZA 3RVOA 1ISSA 1KH2A 1BRTA 1VLZA 3VYSB 1F4LA 3LHSA 3PE6A 3IL2A 4BEBA 4Z7QB 2RGNA 1ZIDA 4CU2A 5DP2A 2DRIA 4RL6A 1P5RA 4ZTUB 1FNCA 2JKYA 1QZZA 1ULTA 2X23A 2ZANA 1DTWA 4FW9A 4Z9AA 1OH8A 1RTTA 1Y9JA 2G17A 1J1IA 4JNKA 3AKCA 1QH0A 2RH8A 1AXRA 2ZGVA 1CWUA 1K7CA 2PKCA 5BSRA 4JKOA 3FR7A 4D9FA 5EIBC 2D2XA 2ORIA 3DZJA 3FNHA 2VA9A 1Q12A 1TUBB 1WD5A 1YQTA 1AOXA 2ADFA 2EFDB 2HA2A 1PNOA 2RAUA 2RH4A 2YC2C 3E1KA 3FX2A 3L82B 3PQ7A 3IQIX 4Q3OA 2ZQYA 4Q4AA 1NN3A 1Z35A 4I4TB 4Y6LA 2JPDA 4MVJP 2CL0X 3UBMA 1H69A 5TMDA 1PWYE 1SM4A 3KVVA 4GYKA 3VTFA 3UB3A 1C1DB 1BAPA 2XUFA 2QYSA 3WISA 1T4CB 2QVBA 2R5FA 4XIIA 3IEMA 3DPIA 4OK3A 4G37A 2I6QA 3NUZA 3HDYA 3TTWA 3C3MA 1KA9H 5AQ1A 2J4DA 3B51X 1NVBA 4QVGA 4HGZA 3PR2B 2BN4A 2HM7A 4JVNA 3QHPA 4I1UA 3DKVA 2ZYIA 1W36C 4RCYA 1M74A 5JS2A 3IMFA 2CJWA 3VHRA 3RBXA 4DV2B 1OFUX 3EW9A 2VSXA 3G2HA 1TJ4A 2OCAA 1BX3A 3SF8A 4JMLA 4Y9DA 5BNZA 4P08A 4OGGA 1XRLA 4OA8A 4JI0B 4F1KA 1RWPA 1O6FA 2UZ4A 1NIPA 2C7QA 1PBTA 3L8DA 1PD1A 4KBFA 1II0A 5JZBA 3Q3HA 3S2IA 2P3OA 5FWDA 3STXA 4OPMA 4OFZA 3QMPA 2BFEB 3IJ5A 1Y9EA 2LD4A 5ADHA 3T3NA 3E4DA 3F4KA 2HNAA 3B5JA 5CLIA 4YDHB 3A8TA 5DYGA 4BNDB 3UATA 1HC7A 3P45A 4JI7B 1TGYA 4KPGA 3CEHA 3ILXA 3WLPA 1IHXA 3ZHRA 4FS8A 3T7DA 3UHJA 1UJBA 2PA3A 4YT4A 2OVFA 3RYFB 3TUIC 1E2FA 1U3VA 4BNHA 1SPBS 3V33A 5L45A 3VC7A 3FPBA 4X7BA 4PFQA 4COKA 3L40A 2Q1WA 3KAPA 3QH4A 2WILA 3L6DA 3D6UA 3WIEA 1HMPA 2AZDA 2JAUA 1ZH4A 3DDCA 4MV6A 1XNGA 4BASA 3CR8A 2C2GA 4UM8B 4DMFA 3VC3A 2FWIA 4I9UA 3K5WA 4J7UA 4NG5A 4MICA 2JHCA 3VH1A 5JXGA 5LOVF 4HTFB 1A2OA 1IK4A 2OO3A 3BGVA 5H0IA 2J30A 2NUBA 1FJGB 4PLCA 2O8BB 2GF0A 3JD1A 5D3ZA 1I5OA 4CLXA 4B1FA 2DTEA 4D96A 2R86A 3HUFA 4IS2A 4OEHA 1BQ4A 2C1XA 2I54A 2R60A 1CJMA 1CY7A 2J3DA 4QQRA 4HBZA 3CEAA 4YO8A 2GERA 5AT1A 4CWAA 5BSHA 2JFQA 2LVBA 2CV1A 1W85B 1XLWA 5JAOA 2X5JO 2ZT5A 4U7HA 3UQYS 3OTHA 3M7IA 2CLHB 1E6KA 2QX7A 3FWNA 2PRKA 1YKFA 4IMPA 4NCXA 4RIFA 5EP1A 3B3FA 3OH8A 5C8VA 3I61A 3COWA 1XVAA 4PF1A 1NPYA 4HDRB 2F8SA 1H23A 3HNPA 5B2FA 2M6SA 1KYZA 2GBLC 2YH2A 4HAXA 1U7HA 2PWYA 4CCSA 1Y8QB 5HDBB 4HI0E 3DXXA 4XE5A 1IG0A 2QIPA 4F71A 3NUGA 3OCYA 4Q1VA 1KFJB 4MUAA 3KKMA 4Q7QA 4AURA 1XRNA 2EJCA 4HS4A 5DT9A 4L9SA 4B3RB 1K6MA 5BWCA 3PITA 4FGJA 3KHTA 5EINA 1NX9A 4M54A 3L41A 1TT7A 2A0YA 1SQ6A 4A0SA 3QKIA 4C7JA 1QO0A 3KFLA 3W06A 2NO1A 4MVJH 3MJHA 3K6KA 1WCIB 1A9QA 2ID8A 2A9RA 4A6EA 2P5TB 3IOMA 1ZPDA 3IQWA 4G1EB 3OLQA 3BK7A 3E35A 5BVGB 1QP0A 5KWSA 1S9HA 1Y6ZA 1Z37A 3EVTA 5JCJA 2H1FA 2WYHA 3DBVO 3L92A 2ASVA 1I14A 3C87A 2ENWA 2R4UA 3DFZA 3N53A 3QWBA 1B43A 1A76A 4H4CA 4UBNA 3VHXA 4E5UA 1G55A 2C0CA 4E7PA 2M9MA 2PBLA 3K32A 3VTZA 3VNSA 4FFRA 4F3NA 3RROA 2OT3B 2HMUA 2I4TA 3PQ3A 4R7TA 5TGTA 3R7FA 5IZ4A 2OCYC 1XVIA 1ZW1A 3OT1A 5EPUA 1ZGCA 2QU8A 4ZAVA 4HMPA 1UADA 2B25A 3ZX5A 5JH7B 3ASUA 1E79D 4U7JA 1R12A 1V26A 3KDPA 2G82A 4A2WA 4E03A 3FMOB 1O08A 3MGAA 4FGWA 4NAVA 3V8EA 4FZRA 4KJXA 5IASA 4LK3A 3V3KA 5JBQA 1WB9A 2ZR9A 1EXVA 1XAGA 3QVXA 3W4KA 1RHKA 3D8BA 3LOQA 3OECA 3QWHA 1Y4DE 1Z74A 2WJHA 3E18A 4IZHA 1T8PA 1K8YB 1NYRA 2NGRA 3BXZA 4KQEA 1Q5PA 4L3OA 4OJYA 4DCOA 1SHZA 5FAKA 2FW8A 4EHIA 4ZYUA 5L3QA 3OTOB 1WUYA 1ZCFA 4UQOA 5AHRA 2NVBA 1PJRA 1M2FA 2J6CA 5DYIA 1OLSB 4JOCA 4MTLA 1U9JA 1QKIA 3Q85A 3A32A 5FLYA 3RS5A 1X2EA 4JLMA 1D09A 4TXNA 2VAXA 5G1OA 3TFWA 2IYZA 3CUVA 1OSNA 2HJGA 1QRDA 1KZ7B 3OHMA 3NRJA 2X0DA 3EZ7A 3CE9A 4EDHA 3ABOB 4XGKA 2ISSD 2GHTA 2WUEA 3EGIA 3I12A 5A4AA 5BQFA 2Q2WA 3IJPA 2I4MA 5B6IA 1XJ0A 2PQ2A 1DINA 2LUOA 2FXIA 5DF1A 1LLCA 1R0XA 3WAGA 2D7DA 4JWTA 1T2DA 2D5LA 4OTZA 5CVCA 4C4XA 3EMKA 4FEAA 3W5CA 4PXYA 3TQSA 4DMGA 4MGKR 3AL0C 2D59A 2PE5A 2XHEA 4TTJA 2PMBA 1RLUA 3IBTA 3LKZA 4L4YA 1DBWA 3TLZA 4RIEA 3BHIA 3EVAA 1EB9A 3B8EA 2RHCA 2JZNA 2JANA 3AVQA 4JUDX 1K8ZB 1Q17A 3PEFA 1Z2EA 4EHNA 2JLUA 1UC4B 3ROXA 1JKXA 2OQ2A 3S81A 3CH7A 4RYLA 3M8KA 2P78A 4CI9A 4F45A 4PLVA 4R69A 1G8SA 2CHGA 3E9CA 3FOZA 5LQSA 1UJCA 2PX3A 5FBKA 1PJBA 3U49A 2R6DA 5F9FA 1QUFA 4ZQGA 1I6KA 3SZRA 1LVHA 4P4TA 1CDOA 1EFRD 1LX6A 2CNBA 3I8OA 1BA3A 1OLUB 1VFPA 3VNUA 1GXSB 1JIIA 3ITKA 1RMQA 3TH5A 2QEQA 5CD1A 4I1PA 3WSVA 2C04A 5AXCA 1W0JA 3PJEA 4B45A 3C4VA 1ISJA 5AW7A 2Q6LA 3GJ7A 1M6EX 2G1KA 4N7JA 2AGVA 5HK9A 1KHTA 4RTRA 1MGOA 5F3RA 1I4EB 2WU4A 1AKRA 1XSEA 1PJ2A 3FUTA 1SD1A 2B36A 1VXOA 2FWAA 3V4PB 1X0VA 1KE2A 3FHOA 1CZLA 1FB5A 1DHTA 1PT9A 3HKDA 5TC4A 3PR3A 1P31A 1W5FA 3PXUA 4QRIA 1GTMA 3CPEA 3IEPA 3KJXA 3VR4H 5TARA 3V7NA 3WGGA 1RXVA 3O3NB 2XY4A 5JSQA 3KJFA 2X6QA 4E5DA 4Q02A 5KWEA 4G1VA 1G7SA 3ETJA 4Q93A 1QOZA 5F4BA 5HQJA 1LDMA 3BK2A 3EPHA 1ESNA 2JF0A 1HLGA 2VPWA 3CVJA 4L9AA 1OZFA 2Z08A 4CFYA 3AHCA 4F9EA 1Z4IA 1KTIA 2IH5A 2ARKA 3LH5A 1N0UA 1G6Q1 1ZWLA 1OAKA 3IBFA 3V4SA 1JG6A 4GI7A 3NB0A 3TSAA 1TX4B 2NUAB 1WD7A 3EG5A 2VHQA 2B1JA 2V7EA 1ZOSA 3JQ8B 2J6IA 4MVJE 2FA9A 4BZWA 2Z3VA 1IXZA 3B5IA 3L8MA 1E64A 4YAWA 5JCOA 3T9EA 3D8UA 3KB6A 2HMVA 1JIXA 2GSDA 3V8VA 1R9GA 1P2BA 4QWWA 5K09A 2ONCA 3VPBA 5BURA 2IDKA 3RRXA 1FU8A 3WZMA 4EG7A 2IEBA 4RA6B 4NOMA 4D56A 3KR1A 3IXMA 3P9NA 2RK6A 1E8NA 2AJLI 4E09A 1GPKA 4YN3A 4OUDB 2RGCA 4HH4A 3OSUA 3PP8A 4M1ZA 2RIPA 1VCIA 2GKSA 2YIVX 3K1AA 3TLKA 1M6WA 4D41A 3CPJB 2JIRA 1DAHA 3FUUA 3E3LA 1ZYUA 1U65A 2FK8A 1ITZA 2VOJA 4KZPA 1GG8A 1BOFA 1UXGA 5CX1A 2IP1A 1LS6A 2R79A 5IHPA 1XTSA 2FEKA 2R4TA 1M75A 4OQZA 1BHSA 4KE9A 4HUTA 2BM1A 3K6RA 5AUPB 3OPNA 5JD5A 1Q91A 4C22A 1ZITA 1VTKA 2BFBA 2DP4E 3KOWA 4M99A 3A1TA 3JQAB 3LT4A 2CE7A 4PCVA 2B3TA 4YMWA 2P6MA 4A8HA 4MWSA 4ARVA 4G1MB 1UMDA 3BJIC 4MKHA 3BD6A 4P84A 3ZPXA 3OPYA 3CF0A 3OZIA 5JNUA 4NQZA 2FZKA 5D8DA 3G2JA 3INRA 3D2AA 1OFGA 5THQA 1JE1A 1PKEA 2RJ3A 3CNBA 3F7OA 4OF4A 1IBMB 2WF7A 2N9UA 3MMNA 2QD3A 2R6GA 4NZZA 5ALMA 1NF9A 3TVTA 4B0OA 1NC3A 1JEOA 3C6KA 3T5GA 3P9KA 3S2UA 4MVJD 4C78A 1PQWA 4HC4A 1ODIA 2TRSB 5E2AA 3SN6A 3LGAA 1NZDA 3MYYA 2LW7A 3NIBA 1PL7A 3D64A 4JEHA 3S70A 2C0QA 5EYPA 4HMOA 1D2NA 2DBRA 2FMFA 2HGZA 3L7BA 2WZBA 1CQJA 4TN5A 4XWOA 1VIYA 2FB9A 2BTQB 4X7RA 2AD5A 3F9RA 3O1HB 4KDEA 4J3FA 1E3TA 1SPXA 2QRUA 3UXMA 3R6DA 4IF6A 4DLTA 1QGOA 3OT1B 4KWTA 1EMDA 2R6CA 1YBMA 2XQJA 4XOIA 1YGPA 1JHYA 1U2EA 2EW1A 2IZ6A 2KWIA 3JQRA 4GSKA 3VXKA 4ZZIA 1NI5A 2X2PA 3S68A 5BWBA 2PM8A 1I30A 1SVOA 2BGMA 2DE0X 4WKGA 1Q74A 3KOMA 1N2GA 4HYQA 1RWVA 3T35A 5CTJA 4B35A 4ZI2A 3IS3A 4QL3A 3JVVA 4CMKA 2NU6B 4EA7A 4FT4A 3IOBA 3ZZUA 1USIA 3HRHA 3RV4A 3L1JA 5EJ8A 2CK3A 1IBLB 3J80A 4LF7B 4QNRA 4QFCA 3DV0A 4BKUA 3EXG2 4G3XA 4Q1EA 3DHVA 1ZMRA 2NQTA 2O3SA 2Q9UA 3R09A 4YCCA 2Z4SA 2DJIA 3IOEA 2BBSA 1EUCB 2C95A 3G2IA 4GX1A 4N0PA 1N6HA 4TTQA 3DJFA 5WRFA 4CV3A 1A2KC 4DMMA 1OTYA 1DIGA 2YY6A 5HKKA 4FNOA 5GZ6A 3TQOA 2BDEA 5JG7A 1J33A 3IQXA 4F56A 4QGGA 3AI3A 2OZKA 5I9BA 2Y1KA 4S2UA 4PG8A 3FE2A 1TEXA 3HA7A 2P5SA 4LHEA 2IY7A 1MCZA 1DAIA 2Z30A 3DFUA 3IC5A 4MUBA 4P5EA 4V3CA 3RREA 3TQIA 4FFSA 4C6SA 4LRWA 4Z9YA 2BC9A 3M81A 3PS9A 5DX0A 2X0JA 2D1TA 5LPNA 1PNQA 3C3PA 3M6FA 4YRJA 2K7ZA 1BMDA 4NFLA 1KH1A 3WQRA 1U3DA 1E66A 1DO8A 3EY9A 4QOEA 4JHXA 5EWJB 4D3FA 4KZKA 1YR8A 3IKJA 5K8IA 1CCWA 2HYIC 4ETWA 3F90A 4XQ9A 4GMHA 2DUUA 1OOEA 1PYOA 2RGEA 4MQ5A 3UT6A 2I5PO 1KYQA 3MWFA 3OLYA 4IIGA 1M8GA 4JC0A 4BP1A 4EO4A 2C8LA 2JH9A 5KHAA 1CR2A 3DF9A 4ZQEA 4Z0PA 2J9RA 4YRDA 3TK1A 3EX7C 3JQEA 3HA3A 4HDNB 4S24A 1VPTA 2RAFA 2H0AA 3USES 5J2TB 4A2QA 3GLIA 4I6JA 3S7ZA 2PGXA 5CM8B 1Z2PX 1ZG3A 3ITEA 2Y93A 4DADA 4O4JA 1U94A 2JAXA 4G0OA 4RV4A 2EIXA 3OZGA 1CULC 2A57A 2DPMA 2YFKA 4JENA 3BAFA 3FTEA 1ZGHA 1VJTA 5T6BA 2P40A 4UHKA 1MABB 3I6ZA 4NG4A 1GKKA 1W88B 1L1FA 3GDFA 2F17A 2BE7A 3AWIA 2AX4A 4FLEA 5BMOA 4EGJA 5JZ9A 3VZBA 2WG1A 3D7NA 5D5QA 3KSAC 1KY2A 1J9ZA 3VNVA 1EK0A 3FFXA 1XG5A 1N5OX 4TUYA 1X92A 4U7WA 5JCOC 3A6JA 4UU0A 2IYAA 2H17A 2AWOA 3PEWA 4XJTA 3X44A 3D3JA 5CXXA 4X1IA 4D82A 3G8DA 1T26A 2GBFA 4O4LF 4U63A 5GP1A 1VG9B 2HAEA 5LZ8A 1MO6A 2RHJA 4G1UC 4EAAA 1JIQA 1I2DA 1P60A 4LZOA 2MYNA 4I7EA 3RAGA 2WJPA 3LZ6A 2C2OA 3NTRA 3VPFA 3FWYA 2A1IA 4PLFA 2JJQA 1U1CA 3A4VA 4BMPB 4DMUB 3KV3O 2VF8A 3DXFA 3MC1A 4QT4A 5I7WA 3IBGA 1AT1A 3A27A 2D6FA 1W85A 3JRNA 3S29A 1IMJA 1L4FA 2NXWA 2PR7A 3LYHA 3HO6A 3VM6A 1CR0A 4KOEC 2W9XA 3GI1A 2A33A 1M6VA 3GLRA 1YD7A 2A8YA 3HKEB 4MRMB 2WKQA 4UUPA 2OK7A 3SKVA 2QGFA 3QEJA 3HB5X 5EZ6B 4C3ZA 3CBGA 5JHGB 1ODTC 1ONOA 1UOOA 1IUNA 3MUEA 3SK0A 2GTIA 3V1MA 1JIVA 1EDDA 1YVRA 2QPOA 5K0ZA 2Z0MA 4GZ6A 3DKRA 1CX9B 4AXBA 1I94B 3K9HA 4MV8A 3RRJA 2E1RA 4XVCA 1DCTA 1CZRA 2PT5A 4RZUA 1X80A 2DCMA 5KOHB 4GZLA 1OKKD 3DYVA 1JAZA 1RJWA 3FUCA 5HZHA 2OCPA 5JC8A 5HA5A 5DEIA 4J0IA 1IQUA 2MR5A 2BKVA 2Z1NA 1P9RA 1QPZA 1GPLA 3OE7A 2YV4A 4BNJA 5KX5F 2W2QA 1ZGAA 4JSRA 4RS4A 4URHA 3TQRA 4M21A 4O4LB 2EKZA 2LCQA 3TLAA 2Z8ZA 4BNDA 1EZ4A 3ONWA 4QBTA 3U6KA 2WWTA 1JU3A 1ZUD1 3IXLA 3LWNA 4LVUA 4ESHA 2JD0A 2IWRA 2EXXA 1RWNA 3W5DA 2P5YA 3CSDA 3TAXA 5I7VA 3FXAA 2HU8A 5J23A 1JLLB 1UK7A 2QI9F 2JJMA 1FNMA 2JCYA 3GH1A 3IVRA 4K6HA 3WGNA 2GASA 5L7TA 1ELOA 1E7WA 2ZWIA 3G5TA 3Q7PA 4PQGA 4OAOA 1R0BA 4DV7B 2P2YA 2UYYA 5CDSA 2JGRA 1JG7A 2WRZA 4EZEA 1NT2A 1YZLA 5GOZA 4GVXA 1KDPA 3IUJA 1Z2CA 3N7UA 2WD8A 1GZHB 3D4NA 3G1UA 3MBKA 3PXXA 4ZVMA 4JB2A 3VBEA 3ZNPA 5JNRA 1S8OA 3SVZA 4LJLA 4TYQA 4UPDA 4BNIA 3HACA 3OICA 5EIAA 4LV5B 3HJBA 3I1JA 4MWTA 5CVUA 3MCUA 2ZJ3A 3GARA 5A2QA 2GM4A 4MWDA 1PKXA 1OZAA 4E6EA 4JEIA 2C88A 1F8XA 4KN8A 5CFQA 3ZD8A 2F3TA 4IM7A 2HV8A 3MWLA 5JS7A 4C89A 2A5YB 3DUFB 4P2GA 5L3SB 4MQ4A 1GTRA 3K8ZA 4F84A 3PHGA 3ANTA 4FFPA 3V8NA 1TUBA 2VTDA 4EY7A 1OV4A 1RCUA 3B1YA 3G6WA 4JZYA 1JHDA 3L7MA 4YP0A 2QLMA 4XTRA 1N1DA 1ULZA 2A78A 1YR9A 5ICGA 1JKMA 5A04A 2Q41A 2JK0A 1MX1A 2WDPA 2G71A 2I3ZA 4I9GA 2INGX 3WL4A 3MJVA 2J09A 1P72A 2GX6A 3ETEA 3KJNA 4ZALA 3TD2A 4YJ2A 3ER9A 4B4OA 4H15A 3IAFA 1RC8A 3RO7A 3UC5A 2EKQA 2XH8A 4AY3A 2OM6A 1W1UA 4LXGA 2WEKA 3U7QA 1GVNB 4CRWB 1OVGA 4AULA 3O8NA 5M3BA 3ZWVA 2DPYA 1SNYA 1QIFA 4O08A 3RYTC 1RSZA 4XFKA 4B3BA 4BQNA 1H4QA 1PJQA 4YRZA 2EW2A 4W5JA 1FU4A 2Q4EA 3RVPA 6Q21A 3BREA 4PO8A 1NONA 2UKDA 3W3ZB 3TIXB 4BRZA 3DCJA 5IAEA 4YUYA 3JARB 4UEJA 3BSYA 1KPGA 2H07A 3OO1A 2OXIA 3ADDA 1AU9A 2ZJAA 4YPVA 1WY7A 2A59A 4L0MA 4RELA 3SZOA 2XCOA 3B2EA 2R6ZA 1S3GA 2X8AA 3QUCA 4YRBA 5ALTA 3L4EA 1YRWA 3NP7A 2H9AA 4K46A 1NVUQ 1AUXA 1KXJA 1VHQA 2I3AA 3KCQA 4D8XA 3LC0A 4CQNA 2X19A 4IMIB 2WWYA 2EL7A 4OG2A 2OGZA 4EGAA 1P6QA 1UFRA 4INAA 3T6KA 2FPMA 1RKUA 4RY0A 3MTIA 4NARA 4MVJF 2L19A 1M3SA 2JBAB 3Q0TA 5JSUA 1V4VA 3UHOA 1NVXQ 2HWYA 5DH9A 4DAEA 1OFHA 4BO5A 3ICOA 2VBGA 2CVPA 5LU9A 3GVHA 3EJWA 2FV8A 3LBYA 1YR1A 4WKCA 5A3VA 1SBQA 3FWPA 4MS3A 1B2RA 4XD7A 3PGXA 4IR7A 2QRZA 3SYTA 5FBVB 5ALHA 4CL2A 5IK2D 3UGJA 4OLFA 3EYWA 4RIGA 1BD4A 4ZC1A 3A9VA 5TPZA 3W6PA 3MS4A 1E2KA 4AJHA 1JR6A 1DX4A 2WUDA 1CJTC 5BV1A 2QNIA 1O5TA 1RXYA 3IV9A 3L02A 4LC0A 4M53A 5DE3A 4QLAA 2VHYA 3WAJA 1LW6E 1OQAA 2J0EA 3IAXA 4EELA 3LA8A 5LA6B 5EKSA 1OX6A 1VLVA 1ODCA 3LY8A 5AI5A 4ECAA 4QRDA 2IBTA 2ZJZA 4AZ0B 5JTTA 3L0IB 2VO1A 5E0OA 3RJ9A 2PZGA 1EDOA 1MD9A 1PNTA 2H1VA 3I30X 5G4LA 1H1LA 4D6YA 5LIPA 3ZHBA 5LQKA 4DGSA 4FBLA 3OJCA 3EXHA 2JZCA 2P0YA 4QNMA 3NHPA 1MBZA 1W47A 4MGYR 3GC6A 3QEMA 4KV9A 3E9NA 4LCBA 1BXGA 4Y6QA 2W2TA 1UDAA 4ILEA 1GT6A 2BKEA 2EEPA 3C3WA 3CKLA 4GOJA 4W1PA 3CG4A 4JUIA 1FJXA 2XDQA 2FLKA 2G36A 3JZAA 3LRXA 3TLEA 5JNLA 2XKKA 1I6LA 3P26A 5K3CA 3U81A 1G291 3EQ7A 3VR1A 3ZTWA 2Z98A 2QQ0A 5K6TA 1G3IA 5DB4A 3T3DA 4JLUA 5KVCA 3V2IA 4G1BA 2ZCJA 1DXOA 3MJRA 4HX9A 3INYA 3T5DA 3KQSA 3T9AA 4LJ9A 3QENA 4BCBA 4FEYA 2CVFA 4AWXA 3BH7A 2AF3C 5TS3A 3C5VA 3IP8A 3EDYA 4LXUA 4RXTA 5JMOA 4OBXA 1G5FA 1I80A 1D0SA 2W6PA 3N5KA 4MUYA 3CVXA 4CMHA 4AXXA 4LHXA 3HCFA 2Z2JA 1N2BA 2YV1A 3E58A 4DSZA 3SLKA 3HK2A 2X0KA 3PF9A 2OO5A 3AETB 2MYUA 3KZMA 5G40A 1AV6A 1CUGA 1T5LA 4X41A 4Q9AA 2HCTA 2YRFA 3IAUA 4A8JC 1AGNA 1EM8A 4WK6A 3YASA 2AFHA 4Y18A 4MW9A 3BGWA 3Q0EA 4KN9S 5HSGA 2PLWA 1RADA 4Q00A 3FSGA 1LGYA 1UQUA 4DCTA 3H4TA 5HIAA 1YJ8A 2FGJA 3GGDA 4B3FX 4IDHA 4CKCB 1CP3A 1QFXA 1VMIA 2Q2NA 5IXSA 2RGDA 4ARUA 1G7RA 2QUHA 4J0JA 3WLSA 1H9CA 2F43A 3AI2A 1DO0A 4I4TF 1WZNA 2IHZA 2UUPA 2XNJA 1WMAA 3AR7A 3BZUA 3LY9A 3TD9A 4DHWA 4F1JA 4N7BA 3I2GA 1E6EA 2AF4C 3JQGA 4P93A 4TWBA 5CUQA 3M1LA 5K8TA 5CAEA 5AUOB 3COPA 4IIUA 5JXHA 4DIEA 2GA8A 4YJ2B 4TLEA 2CXHA 5KVAA 2NU9A 3DGEC 1V7PC 1S8AA 2QTMA 5HK8A 5CXUA 3C0KA 3KUUA 1XCJA 5ALKA 4EDFA 1XJCA 4GVPA 2OWEA 3KKLA 3CE6A 1RYZA 3HV0A 2K2WA 3K5IA 4XDYA 3PGMA 4X3CA 3FNFA 1P18A 2X9VA 2EG5A 4RENA 5A62A 2IXFA 1JQ3A 3ZCQA 1GGJA 1NXSA 4UCXA 4BRSA 2UZ0A 4KXNA 4LE0A 2IX3A 2HIGA 1K7XB 1OXBB 3KP1A 2POQX 2W8ZA 3LF2A 4FHZA 4KRYA 1WJGA 2EFJA 3B1WA 2ZYWX 2BAGA 2ZROA 3BB1A 1RJDA 1PG2A 4IUBS 5E3IA 3UOAB 1W581 2FETA 3ORYA 3CX8A 1RPTA 5HE8A 3M5WA 2GAOA 1CUSA 3FLAA 1E0KA 2QTTA 1EP1B 5IT5A 1C30B 4EYKA 5ULLA 2I6XA 4HRYA 5CVJA 3T8YA 1F0KA 1U9CA 1YO6A 4GM0A 2OENG 4ESVA 4MYUA 2PWPA 2A0UA 1K3UB 4NDZA 3CH6A 2GQ0A 5IAKA 3CIOA 1V47A 4MR7A 2ALJA 3RTDA 3P9SA 4PPFA 3I5YA 3THXB 1XXLA 1QRSA 3ZDCA 2IHBA 1BMQA 1U7PA 1KGSA 2JRLA 2VQ6A 2WHEA 3UKJA 4OB6A 2ZT7A 1RPAA 2OMKA 1AY0A 2MHCA 3ICWA 5A1TA 2WLSA 4OJKA 1JZQA 1TM1E 3ME5A 3N0WA 1Z8NA 1UPUA 3NBUA 4RTPA 4B73A 4G0XA 3LLUA 4MJLA 1E2UA 3WWCA 1JWLA 4FS3A 2E5WA 2YWRA 4KWCA 1X1SA 5TMEA 3HWSA 4D5EA 3UY4A 1C3OA 1G5HA 2JCSA 1UZNA 3ESZA 4YB8A 3CVUA 1A04A 1TA9A 1UBJS 1A72A 3A36A 3IURA 2QL5A 3R6GA 1P8AA 4EVIA 4YRFA 2NMVA 4H1VA 1D04A 3RS7A 2PY6A 1X6VA 2FSVA 3IVXA 4IIFA 4PYNA 4ERXA 2DWQA 3DE6X 1KP3A 1DRKA 4Y1GA 2IODA 1G8PA 3PFGA 3H1FA 5LQMA 5CDYA 1QBGA 1U5BA 4K9OA 2QZJA 3PZRA 1TM7E 3M3PA 5BR1A 4G2TA 2VJQA 2H11A 3DWGA 4MMYB 1QFSA 1RQNA 4N0MA 4IX1A 2COUA 3STTA 1ZGGA 2O6LA 1EGAA 1M34E 4ZDWA 1E9VA 2MYPA 1XZLA 1RJ9A 1EFTA 1YS7A 2JFBA 2VHXA 3OSZA 4WN3A 1BEUB 4ZT7A 2E0IA 3CRVA 1V1RB 1V9SA 3FSGD 3GRCA 4NQRA 4RVUA 1ILWA 1QNLA 4X3OA 4EF5A 2VT7A 2XKAA 4RETA 2CBXA 3KLMX 2EF1A 5MHTA 2UAGA 4JR1A 2NXEA 2C77A 1CR1A 3HS3A 2HPHA 1J2UA 2O06A 3AILA 1EKXA 2QN1A 4K9DA 1QE5A 2TMGA 2YOHA 1NKSA 3M4NA 3UMMA 1L7VC 2FAXA 4IILA 4RPLA 2AW3A 1MTOA 3EYAA 1KVRA 3DAFA 2VJPA 2QR5A 3BH6A 5JNSA 4RLFA 4BEVA 2XYVA 4P4LA 4DCMA 1FVOA 3EWSA 4FN5A 4YONB 1NRXA 2VPPA 4XD7D 2VWGA 3CLTD 2GRUA 1EK6A 2Y0BA 4N7MA 2Q6TA 3QOXA 1VLHA 1F8YA 2H4ZA 2BR3A 2WNIA 4C2BA 4CMEC 4TL8A 4YLYA 2CLDX 4CIWA 4R7ZA 1X7XB 4RHTA 4REMA 2NSHA 1TLLA 4F2GA 1DHRA 3E1SA 3SS9X 3NWEA 5IC4A 4BOYA 3KKQA 1BN7A 5COBA 2F9MA 3FB1A 1C0EA 4MYTA 2HJHA 3NC4A 5E2BA 2OGSA 4BQRA 4BP3A 3FF1A 2N75A 1N7JA 1N2XA 3OO0A 1IN5A 3A6HA 3FW1A 3T7CA 1WXQA 1BEZA 3UJPA 4DDUA 1X7WA 2K2QB 5LYJB 3QBJA 4LF4B 2X9LA 1DBIA 2O2XA 4BAUA 4JKYA 2EX0A 2XEXA 1THTA 2IEZA 1DG3A 2P62A 2W4QA 1UBMS 2WU1A 1ZGBA 4O4JB 2BGGA 4II3A 1JFFA 3SZLA 3W9BA 1KSJA 3BICA 1WUTA 3HN2A 3LZDA 5BQ3A 5KJ1A 5EPEA 2VDOB 2GD6A 5TPZD 2F9LA 5B3JC 4HK4A 2LCIA 3GGJA 5HZKA 1T6BY 3FGOA 2DXIA 3VX3A 4KMSA 1E98A 1VKZA 1MFZA 4F04A 4ZZ3A 4EWLA 4ER7A 4GBED 4D4IA 5DHFA 5EJ9A 2NV6A 3I92A 3ZJ5A 1K9VF 3HQ4O 2PHZA 4IBOA 4DE5A 5HUQA 1QIDA 3A9WA 1OZ0A 3OQMA 1PGQA 1PYDA 1JG3A 1V11B 2PIAA 2VF2A 3ISTA 4YT2A 5IJ9A 5AVYA 3D5QA 5JIBA 3UWOA 1ND6A 4GLLA 5EVJA 4EYEA 4LFAB 2HUPA 4QYSA 2ZUBA 4BVLA 3QLVC 2ZBQA 2NO6A 3VV3A 6YASA 1MO2A 4BU1A 3FY4A 3NHWA 3MFQA 3F67A 4PAWA 2JFYA 4HH3C 3ADCA 4QICA 4B3CA 1IJBA 5AI4A 3OA0A 4IDDA 3GD7A 3LYAA 3M9LA 1E3IA 5CDGA 3WSTA 4KCGA 1EFPB 2DBYA 2YIDA 2V6GA 5F77A 3O0DA 1S8NA 2CT8A 4MUHA 5LQCA 1TCVA 2H8GA 1XN1A 3HWRA 1MO5A 4JGGA 1HNWB 1Z75A 1QGED 3V3TA 1B15A 1IRXA 2IE0A 4PZPA 4B3TB 2LP4Y 1FMFA 2QZ4A 4EYGA 2LPMA 3WGIA 2GK4A 2GFIA 3EVFA 3K53A 4U3JA 2GLTA 3COSA 1H0HA 1N8KA 2DTDA 3GUYA 3TZCA 5KKNB 3NVMB 5ARBA 1LS1A 2FPGA 2JJ2A 3DMDA 1WX1A 2C1ZA 4BS9A 4BO0A 2O9JA 4M7WA 2X4DA 4PFSA 2EP7A 4MB2A 5IDYA 9ATCA 3ZS9A 1PZFA 3E53A 4GGPA 3VSCA 4N6GA 2GUWA 5IYZB 1RWQA 2ZRDA 3K05A 3KL2A 5FBRB 3RH0A 3ZZTA 5D87A 2WVAA 3A4YA 3ORFA 2PJZA 4CMCA 4EHFA 4M0UA 1CE8A 5F33A 1Z8DA 3TNFA 3U31A 1EVJA 5HVNA 4Q05A 1GGNA 4HLDA 4L7VA 3W3AH 4E5NA 3RAEC 4MYHA 5LXTF 1KVQA 2FF5A 3GLSA 1NG1A 5BUCA 5IM4F 2ZIGA 1Z4OA 1MO4A 1XCMA 2EGUA 1F17A 1H0SA 4TGLA 1H3FA 2H31A 4B6OA 4CKXA 1ULUA 4E22A 2OILA 4D3DA 1V1MA 5B6PA 4PR0A 2VWQA 5C81A 3AEZA 2IIVA 3DTVB 3PDIB 3MM4A 1SIOA 1HYEA 2AUNA 1VYTA 2WP8J 2AQ8A 2FWBA 3DE5X 1U7ZA 4FOOA 1XCOA 1OBFO 1E4OA 1Y34E 2IP4A 4GM4A 1N5KA 2I7TA 2H57A 1OLXB 2G83A 4IDGA 5E9AA 1ECJA 4QBFA 4LYJA 4EJ0A 5D3KA 4LOHA 4OKNA 3O4RA 1N7HA 1CG6A 1EJ2A 4F2WA 1ECCA 5K05A 3D9QX 1LSJA 1IIRA 3H9QA 4RSGA 4Q4DA 3C1UA 1FZQA 2OAP1 3ADBA 3B13B 2GRAA 3R5KA 3OM8A 5DKFA 5KVQA 1V5GA 2HLPA 3WP1B 4EKYA 1F8GA 2GXQA 4TXMA 3LUKA 3ROMA 4Q66C 2PKRA 3B9RA 4XWYA 3G8BA 4XGIA 5HUJA 1YAJA 1ZXXA 2YWFA 3L46A 4C0XA 6ABPA 5CFRA 3LX8A 4O4IB 3L4BA 3EBLA 2YQ4A 2JVIA 3AP1A 1LI7A 3ITDA 1JEAA 3MLEA 4P4UA 2X2FA 2ZDGA 4NWIA 5ED4A 4QVIA 2H6EA 3KFXA 2RHTA 4CODB 1XCBA 2JCXA 1S6YA 4O6VA 4JI8B 1KEWA 4Q6BA 4EECA 2EDCA 3KQUA 3GIWA 3ICPA 4C88A 1U0SY 2FMKA 1SWWA 1N9KA 3MF4A 4DW8A 3K0BA 5A9SB 2FZGA 1K6EA 3EGVA 1GILA 2G9RA 2OG2A 5FT9A 3GT3A 3VVMA 1AX9A 5DX8A 1DDOA 2QP3A 2ACKA 3R24A 5DU2A 4ZVTA 1PNRA 3D6HA 1LFAA 4K8RB 2YUTA 1M2VA 3WDMA 2CXNA 3TZBA 5BPHA 3NV9A 1KDVA 2WI8A 3V2UA 3ZQ4A 4TS9A 3EZXA 3RF7A 2O3QA 3EIQA 2Y9PB 1JA9A 5AHOA 3P97A 1O57A 1P8JA 4EJMA 3M5DA 4KIJA 1MV5A 5KREA 2Q3LA 4TVKA 5HQ3B 1A5ZA 1G6OA 1T3LA 3KNZA 3K2IA 4MHOA 4CKBB 2Z04A 3UK7A 3DB1A 1T10A 1YV9A 4P3XA 3RANA 1P19A 3BWCA 3D1LA 4KLRA 1J20A 1OC2A 2I1LA 3CNHA 2E82A 1GSAA 2FN9A 1NLMA 5H1YA 3AESA 3DE0X 4R0VA 4PW0A 4FUQA 2QPLA 1R1DA 1BKDR 4NYJQ 5JWOA 3ZIAD 5FOVA 1A8PA 4HXEB 3AHJA 3QUTA 4E2FA 3LFHA 2WSMA 4DLNA 4Q4HA 5AW6A 2GZDA 3VC2A 1XXHE 1U0BB 4OLAA 2RGUA 4MA5A 4FEEA 4NK4A 2O59A 1CUBA 4UUBA 1GDDA 3IUYA 1JF8A 3W1VA 2H63A 5BUQA 2MT9A 3WI7A 3CRQA 4IDEA 1PGPA 3D59A 4KFRA 3HU1A 1LBQA 5I9NA 2ENUA 4IIJA 2HU2A 4IH1A 3CC8A 4KSYA 5DYYA 2XUAA 2C84A 3GJ4A 4RABA 4E33A 1VJ0A 1K4YA 4IAOA 1XEFA 1OE0A 2XB8A 4PZEA 5B37A 1MJGM 1DCMA 1JWAB 5C1IA 4DN6A 5BSKA 3G9ZA 1MC1A 1B16A 2QTCA 1A8UA 4CM5A 5KDDA 1L7QA 2EFEB 4LCJA 2IC5A 4ZODA 1YR6A 3UUWA 2NLOA 1GPH1 1CK4A 4GS5A 3RIXA 4QLBA 1WP4A 3IR6A 4M87A 4JASB 4QXPA 3FB4A 1GKUB 4JV5B 2WW8A 4EFLA 1ZY2A 5HQTA 2XSZA 4J0EA 5IH3A 2XCRB 2ISCA 1VJRA 3L4SO 2QTBA 1X1RA 1OH6A 5EJ4A 4KR6A 1VE3A 2V3VA 2O3RA 2HSGA 4OXXA 2DFDA 1QO7A 4OQQA 3PIRA 2GD2A 3WFIA 1JG4A 1R3UA 1HWYA 1XZKA 1NBHA 1J2YA 1K7YA 2WQZA 2ZJ1A 4PZUA 4D4LA 2IF0A 2O8VA 1FXUA 2HF2A 1PR6A 3BRSA 1DAKA 3CH5A 3IO3A 3M34A 4NBWA 5YASA 4UNNA 2BEWB 2NO7A 3LP6A 4EUNA 3SXPA 2YYAA 3P9YA 2F3UA 2NO4A 1R8XA 3RIEA 4K6FA 1NC1A 2GB4A 2JGNA 4A16A 1KH3A 1GO2A 2JLWA 3MWKA 2CCGA 3RQSA 2QW1A 5C5CA 4Z4GA 3RVSA 2L42A 2QRHA 3I2IA 5BUZA 5KYNA 2ZTMA 5EGSA 1XWWA 3EQ2A 3IDSA 3IPYA 2CVQA 1LLDA 3FYDA 2HHLA 1VXRA 3ZW9A 1MXFA 3U3OA 4P4SA 1HDYA 1D8TA 4UC0A 1Q1GA 3K70C 2QX4A 4DV0B 4KQ9A 5LA6F 4B48A 4AQYB 4EG6A 3LLVA 4F9FA 1T35A 3WKCA 5HKKD 2H65A 4G9EA 3ZCRA 2GEKA 2HCBA 2XGOA 4EY3A 3Q9NA 2UYHA 1FVHA 3ON5A 3KXIA 4NH0A 1PSWA 1Q0UA 4EUEA 1FIUA 3FPAA 3MOSA 2Q1TA 4U7PB 1BDJA 4QTTB 5KKAA 3URMA 4LDQA 3V48A 1DAGA 3QU5A 3AUTA 4W9NC 2A5DA 4F12A 4UTPA 1KK0A 1P0CA 4ZT4A 4B46A 3SHQA 4RO0A 3U44A 2WMDA 4Y6OA 1R4NB 5K3FA 1XROA 3ZWWA 4D9CA 4DIUA 1QU2A 4O25A 4PBRA 4QQKA 1P62B 2WG0A 3WHLA 1J9GA 1F2VA 3BIXA 3CW2A 2PGNA 2X76A 3DEIA 5KQSA 5L6LB 1WY5A 1WZEA 1I3MA 4JYPA 3ZCXA 3R76A 5DTQA 5TIIA 1KJIA 5ALVA 4NECA 2GDJA 3X1JA 2A9OA 2AZ4A 3SZ3A 4BRWA 2B5OA 1EDZA 3VR6D 4NDAA 4WH0A 5EFOA 3WNDA 3K70B 1RKQA 1X1TA 4S3MA 4RF4A 1HQDA 4UNSA 2BFCA 1KYWA 5L51A 4MR8B 1WPXA 1S5PA 4IIJF 1GTL1 3WO1A 1HK7A 2QMOA 5AH0A 1CRPA 3GD5A 2ZRGA 3TMKA 5EXPA 4BRUA 1W1IA 3HR4A 3M9XA 2R6R1 2IUFA 2BPOA 3VR4A 4XQEA 2NADA 1U2GA 2ZZKA 1J8VA 3AHEA 3OFJA 4HAZA 5G1PA 4QQ8A 4RJJA 5FO0A 3RAJA 3RUDA 2GJ4A 4EKNB 4QG7A 3AR4A 1U9ZA 1NBEA 1YXMA 3SOPA 2DFKB 2BCGY 2YVKA 1E1KA 1SXIA 2A3NA 2Q07A 3KJGA 3MD9A 1KYYA 4H3KB 2IT1A 4PX9A 2VP2A 1L7XA 5AVJA 4D3SA 1SRRA 4L5CA 3RC2A 3QWIA 3DOOA 4MQFB 10MHA 2JFUA 3GPCA 4YR7A 3EH1A 5DLYA 2WSBA 4KPEC 2GN8A 2VZ8A 5HCNA 5J40A 3JRWA 4H6WA 4HX5A 3IUEA 1R64A 4N7RA 4WVFA 1HV8A 2I34A 3RVKA 4DNXA 5IS2A 2HSWA 3DKIA 3ILSA 4QSMA 3WDKA 3PFIA 1V3VA 2QRLA 2R1UA 3B1ZA 4NJOA 4TVOA 1U8UA 5I51A 2ACVA 1QAOA 1HO3A 5SYNA 1DWUA 3O7MA 1G8AA 3A25A 3DCNA 1FZTA 3UXEA 4JJ6A 5H8WA 4TQAA 3RVLA 3DSRA 2Q21A 1N2OA 5AW2A 2O52A 3G2MA 2IOFK 1XEXB 3P94A 4AKEA 2XBLA 2DHEA 3G2LA 5DASA 2JIZD 4DB4A 3A05A 2RJNA 3RHSA 2JLSA 4OYYA 2Y3IA 4KIWA 1GAJA 4BV9A 5JUWA 2QQEA 1T9CA 2Y8EA 3L4KA 5AWFC 3SKYA 3NGMA 2CHUA 1K7FB 5I6DA 4OAQA 5D5HA 3FUVA 3AZQA 1LVUA 2RKWA 4OK5A 4WKNA 4DJJA 4IZ6A 3F3KA 4MQEB 1D2MA 1O95C 1VECA 3PSAA 5C4GB 5U9CA 1QGDA 3H11A 4UFNA 3WK4A 3AEQA 3H5TA 3GY0A 1NN1A 3K0FB 4MIKA 5DULA 3NIFB 2CYCA 3WRXC 4D92A 1JFRA 4GPEA 1GHTA 1I0LA 1MGPA 1GGKA 1SHJA 2GAFA 2WIFA 4QXQA 4BNYA 1HFKA 1TU3A 1SBIA 1V2GA 1X39A 2FX2A 1DZIA 2IW1A 2WDZA 3ICCA 3N87A 3N2GA 2ODEA 2XF2A 4O2AA 4OMFG 2W5UA 3ZVRA 4Q4CA 4DUYB 3DFIA 2XQFA 4LV6A 5JFGA 3GPDG 3GXOA 2IZZA 2OBFA 3ZIDA 3ICEA 1JDBC 1ECLA 4C0HA 3HXMA 2ERYA 1C5KA 3BGOS 2HXGA 4ZEOA 3T7IA 4G84A 4XPIA 3Q3IA 4W5QA 3H6GA 4MCJA 3CA8A 4P83A 1J9EA 4P81A 3MSCA 1ZD3A 2PWZA 4IV5A 4YCMA 4KXWA 3S27A 1RBQA 5IU6A 2R8YA 5K8JB 5L3VA 2PGOA 5FLKA 5JO0A 3GIDA 3IPRA 4KC0A 5BMVA 2B99A 3L7OA 2QVZX 4II7A 1THMA 5KCZA 2Z09A 3ZU2A 5DHRA 5KQPA 2Y77A 3EDOA 4TLBA 2B6HA 1N4DA 2JFWA 5EESA 1R9JA 2QE6A 5CT9A 2NXJA 3HDJA 4GM1A 3GG2A 3CQ9A 1E6LA 4N5DA 2VYVD 3WLEA 3FOFC 3KPYA 4PPNA 3IBYA 3O84A 4ZQHA 5BT8A 2W6OA 2XTJA 4DDTA 4ZCTA 1NHWA 1L5VA 2GLUA 2OV3A 3KWLA 4MWBA 3V42A 2IZ5A 4CCWA 3EEIA 1DJPA 1GN9A 1YZTA 3LDFA 3PL5A 2I1VB 4Q7MB 4LRUA 3ZGXA 4DQVA 1DB3A 3CG0A 2VUHB 1Q7BA 4QPZA 1IHPA 5HRUA 1NPTO 2RG7A 3HDHA 1DKUA 2X58A 3SC2A 3RVQA 1O77A 3U39A 3DFMA 1FYFA 1HYBA 4ZAXA 5KI6A 4ZEVA 3W9SA 4QPJC 2QYHA 4NNJA 4YHBA 3COJA 4IRUB 2ONKA 4NNOA 4O2LA 4XB6B 5BNTA 3HI4A 3I45A 1N2EA 1SVNA 5DHUA 4R8VA 2AQKA 4O2RA 4LPKA 3N70A 1U02A 5F7ZA 4PLZA 1YIAA 1ZH6A 1AA9A 3HNRA 3R5XA 1XCPA 1PN3A 4TXHA 1WEKA 3DAOA 2WJYA 3ITNA 4X5OA 5TT1A 3A14A 3UV3A 3DTVD 2SECE 1SC4A 2C8KA 3F74A 5JS1A 3AUFA 2UUBB 3RS0A 4CMAA 4DXAA 3RFCA 4BC0A 3A2MA 4RLSA 3KUKA 2KQUA 3OQJA 3L6RA 1T34A 3CLRD 4FHGA 3VA7A 2YXDA 4JWKA 4XGRA 1UAGA 3ZN2A 1G42A 2OAGA 3VO9A 2DR2A 1O6CA 1ZCBA 2P8JA 5JCJD 2CNOA 4TS3A 5BOVA 2UYGA 5GV7A 2IF2A 1RD4A 3AFIA 1RQGA 3FPEA 1EHYA 5EZ5A 4XWAA 1FYDA 4G5FA 1BVRA 4IOLA 1Z6XA 1A96A 1MNQA 2NU8A 1PJSA 1YC2A 1YDGA 5AI6A 5A5VA 3KIPA 4G0VA 3M70A 3H4VA 2RGGA 2J41A 3JYOA 4MKRA 1Q7GA 5C53B 2AOXA 4NOKA 4C3OB 3ZHXA 2BI8A 1KZHA 3CVWA 5HP4A 3L93A 1XDUA 3GNLA 4ILKA 2H4WA 4CMJA 3O5AA 4U39A 1TJNA 1AXGA 3MOGA 4J9UE 3ZHVA 3TOCA 1IOWA 4EENA 1E1RA 4E1BA 5F7XA 5L4NA 4D9MA 3PJGA 1XTKA 2IYUA 3MTAA 2F4VB 1NZFA 4DF3A 3CZCA 5LWHA 1XTZA 2J9YB 4OBEA 3TAHA 3HEAA 3R41A 2V6IA 4RUKA 4B83A 4BQQA 1IUPA 2QE7A 2WTAA 1CVLA 3CUYA 1U7DA 1UEJA 3BDVA 3ZBTA 3L04A 5HIIA 2JC3A 2IS1A 1EAYA 5EY5B 2Q1UA 2PU5A 2WD7A 2DHRA 3UMVA 2GETA 1DXHA 2JVJA 4YUVA 1CLUA 2H4YA 3L7LA 3UJDA 2A6PA 3SLRA 2V6BA 4UPVA 1VYVA 3SYRA 1H9AA 1T8WA 2CLLB 2CXRA 1PU2A 3D4OA 5AQEA 3TLGA 1YVEI 2QOEA 3QKRA 4XDZA 4JJEA 5FIUA 5K3EA 1QG4A 2EARA 5ERYA 3WC4A 4OVKA 1MAHA 4I5DA 4KBGA 3V00A 1UCFA 5TX7A 1OWNA 2ZBEA 3T1VA 3NAZA 1ZUHA 4W1SA 5DTEA 2BJVA 5K0TA 2IUEA 4CG2A 5JXJA 1IL0A 2NTJA 1QO0D 3PA8A 4OQ4A 3NBYC 1W19A 4HWPA 1KJQA 1IG3A 1PI3A 2D1SA 3LO5A 2FR1A 3UQZA 2UDPA 3DT6A 2XA9A 1UBEA 3WMXA 4MTCA 4RJTA 3O8RA 1K06A 4I3HA 1YQXA 4J0FA 2I66A 3OE4A 5BQ5A 2G7ZA 2WYIA 1QIKA 5IKMA 5IUNC 2D54A 2I87A 2P90A 3PIIA 4GYWA 4CLEA 1QIMA 3NIDB 2QA5A 2IPXA 4KVFA 1T36B 4IO1A 3H5OA 1IEQA 1VC2A 4CKBA 1Q0QA 2WE7A 1QRRA 2Q0QA 3DR5A 1GUZA 3IDFA 3WGYA 4N01A 5AVVA 4I2NA 1IJEA 3BK1A 4V2UA 3ELDA 3WG9A 3L8HA 3WLLA 5FBLB 1RE1A 1U0OC 4LE1A 1DGQA 4I4CA 2BBOA 1TD1A 4ASUA 4QOFA 1E6WA 1GXSA 1CNFA 4Y1RB 4ZT5A 5EIFA 1Q0LA 2YBDA 3FDFA 4LIPD 5J4VA 1FSPA 2C99A 1OMOA 1XZIA 3NONA 4BE4A 5DFAA 2BH2A 2G07A 3U1TA 2F8TA 2PD6A 2M1ZA 4FCCA 1T0UA 3KQYA 4NYIQ 1KZ4A 4CM8B 4EUKA 3GJZA 1U04A 2OUKA 2RFLA 3DAPA 5EL0A 4XUDA 2FPPB 1XFAA 2JD1A 4KXQA 3SYLA 2OXCA 4GZ3A 5SY6A 3IULA 2AIRA 1KMMA 3G8AA 4XZ3A 4F4JA 3W78A 4PN7A 1W4CA 4HB3A 1HM5A 1W5SA 2IUUA 4OLJA 1XEAA 1T9DA 4ALJA 4BKMA 5IFKA 5LWQA 1TAGA 2IRWA 5ALXA 2CW5A 3ND8A 3F6YA 3PTAA 3SDSA 1GL3A 1BMFD 1CZKA 1G8JA 1UWCA 4Q9NA 4WDRA 4B8ZA 3L5OA 3IALA 3QEOA 4KNWA 2XUZA 4RA9B 2X8BA 3H0CA 3C6YA 4KO2S 2DMRA 1ETUA 3ELWA 2C2KA 3TAUA 2OESA 3ZWOA 2ECQA 4DM4A 1A71A 3E0QA 2FZLA 4V0NA 2XT6A 2BFDA 1I9GA 3QE0A 4J94A 1E1CB 4GOXA 5IXYA 4R5HA 3JALA 3VVCA 1DWOA 2IIBA 1ISGA 4QGSA 1PE0A 5GIOE 1TK3A 3OIDA 3KLPX 1R6VA 1T4MA 5FBHA 3RK0A 4L74A 2O05A 3FRHA 3DJYA 2IIQA 3C85A 3FYCA 1IYZA 3DBRA 3NTXA 4HTAA 5A6SA 2C1EA 2FKNA 4B09A 3E23A 1WU8A 1VG1A 2IEGA 1XD2B 2YDXA 4FJ1A 2ZBFA 4HRVA 4RK1A 3SMVA 3WYAA 3ZY6A 5IF9A 4CMIB 4EGQA 3N2KA 1T43A 1DEHA 1PZEA 1Y5MA 1XHEA 2FP3A 4FFWA 3WLQA 2H00A 2WJIA 2X14A 3P5BA 2ZBVA 3L06A 4NS1A 3R3HA 1CHDA 2R3SA 2WAAA 5JDIA 2GEUA 2VHZA 3IVGA 3TSYA 5I7UA 2KW5A 1GD1O 5KYXA 3H5AA 1RIIA 2X5KO 3R9XA 1ZUWA 4MS4B 1SUDA 1Y98A 5KSWB 1KDTA 1K5PA 2NAPA 4O2BB 1XNRB 4MSUA 1C41A 2O2GA 1SBHA 4EMBA 4YEDA 4DIMA 3ZLBA 4NP6A 4FOPA 3Q72A 1H2AS 2ZRAA 4L9RA 4X7PA 1TYBE 3CF6R 2FE1A 4HQNA 2VJKA 4RZHA 3SAJA 4C9BA 4LWOA 4F6RB 2EL9A 3HTXA 4R6WA 5AM5A 3SYMA 1X8LA 1X3LA 1PT6A 3LQYA 4JC5A 4TMXA 5F1PA 4IHAA 1GCGA 1SQGA 4Y1RA 2A2ZA 3JAMA 5BVGA 2O48X 2P3LA 2I55A 4ZV9A 1PVOA 1UUFA 1Z16A 3WV4A 1HDCA 5C5IA 3P2MA 1X14A 2AJ8A 5ELMA 2BZ0A 3M1AA 1OH5A 2HSDA 3PSHA 4B87A 1XRJA 3DEAA 1DBVO 1FPQA 1QCDA 5ITSA 1DPFA 3OP1A 1R27A 3K6SA 3HO1A 2KB0A 3U7JA 3W4IA 3CEPB 4DCNA 4M1OA 3D8TA 2I4LA 2XE4A 1N0IA 4UCWA 2CMHA 2P9GA 3GT4A 2LDBA 4QODA 3VR4D 4AIIA 3JQAA 3V46A 2RJOA 5LBIA 2PUHA 2FN7A 4UREA 2QNBA 5ALPA 2C4MA 3C6MA 1CSEE 5HMMA 1U98A 3R7SA 1DQZA 4HDRA 2KPOA 2P6NA 3HADA 4Q1FA 1ORTA 1PWXA 5GPBA 4BV3A 1E2MA 3MTBA 5I9IA 1AGYA 4OSOA 3PJRA 5TVGA 5DGXA 2XTZA 4LEIA 4BMNA 1PJCA 1PIWA 1FF9A 1C9DB 3E81A 4HHEA 4KRGA 3KL4A 1KOJA 3VDMA 2H7CA 3KWMA 3HL0A 4LGMA 2PFGA 1KY4A 4OYRA 1JYEA 5FYDA 3ZZNA 1B93A 4FIZA 4RGYA 3FETA 1TYEB 3HP4A 3G8YA 2GN6A 3H2IA 5H4HA 5HNKA 3TL3A 2XVYA 3WDSA 1BW9B 2WAMA 1V41E 1N6NA 4NK5A 4Q7EA 5LCXA 1O95D 3N8KA 1JKFA 3NALA 3RUHA 5E4TA 2HCFA 3EA4A 3PFFA 2CNDA 2XT0A 3U9TA 3ZOZA 5I7OA 1HE3A 2HREA 3LGXA 2FPIB 1FFXA 1OYVA 4IV0A 2HK7A 3RC1A 4JR0A 4A2PA 1I0ZA 3G7NA 4D9HA 1VSTA 4GZMA 2WSSD 1ZM9A 4C0WA 4HADA 3IDQA 9ABPA 1ZD8A 3KKEA 4H1TA 5EVCA 1X1AA 3PJFA 5HTKA 4RULA 4GPBA 1YZYA 4BZPA 5CEEA 1P4GA 1EB8A 2Z5FA 4RFSA 3DM5A 4M98A 4Y2SA 4A6PA 3MTEA 3OZRA 2OV4A 4C3VA 2OM2A 1TTQB 1B1AA 3DT8A 4II2A 4BMDA 4ERNA 2X0IA 1UC9A 1VSVA 3RVBA 5M04A 4YI3A 4D0NA 3QPCA 5D6OA 3WNQA 3CLSD 4EL5A 2W2KA 5CFOA 5BR7A 3GEDA 4ZJZA 4Q12A 1OI3A 3HKBA 4XLLA 2KE5A 1EK1A 1IBRA 1Y1PA 4NEGA 4M9QA 5L4SA 1AO0A 4KOAA 1C7IA 2CFSA 2WFAA 2IHJA 3E9RA 2GAJA 4N65A 4FZVA 4R84A 1TZMA 2OUIA 4FB5A 2H2WA 1ZCJA 3NDJA 1FQJA 5DNAA 1UP4A 3TNLA 1V48A 2GZ3A 3WQBA 1L5HA 4UAVA 5CG2A 2GM9A 1HXHA 3MAAC 2XMDA 3DCYA 5CBPB 3EXFA 4EI8A 5JCPA 4YJHB 5IHXA 1O03A 2PK3A 3L8EA 1KPHA 4QAJA 4MULA 1JUDA 4CV0A 2ADMA 5JNTA 1TJ5A 2CLMB 2H0QA 2OFXA 1F9EA 5BW5A 1H2EA 5LP1A 4RLQA 1FP7A 1OWLA 1W52X 3QW4B 4JUFA 2PGJA 2MU1A 3PC3A 2HRDA 2R0QC 1E99A 3WLKX 2ZWOA 3CKKA 1VG0B 2QRVB 3LPMA 1LV7A 4JIMA 2Y1EA 1Z2NX 5FOWA 2NPFA 2R48A 4D0GA 4YI5A 2O8CA 1YL5A 3EC2A 4XA8A 5DLPA 2EKDA 2MYTA 2YMLA 1TC1A 2P11A 1UBSB 4WCFB 3FROA 5CHYA 2WSSA 1OWOA 2C82A 4KK4A 5JANA 3HY4A 3FA2A 5FEUA 1QMGA 1YIDA 1J39A 3BB3A 4U7DA 4K6CA 3OZEA 2CWWA 4MV5A 3I23A 4NULA 4CM4A 4KFCA 2DFPA 1H9BA 2XQIA 3IUQA 3GJYA 4G36A 1B3RA 4Q4LA 1TF5A 2WF6A 3IAM1 3AUYA 2AR9A 3NYQA 1EBBA 3K0KA 4J90A 1OC4A 2JFFA 3R44A 4LYAA 3ZJ4A 4FHEA 1S4QA 3OQIB 2A14A 4XUGB 1KRWA 5CDFA 4EATA 2IGBA 3QA3E 1PGJA 2BGIA 5EP3A 2ATVA 2PZJA 2QENA 4H16A 2C07A 5EMMA 5CDFE 2NU8B 2OE2A 4ICIA 1Z06A 3KALA 1R3DA 1SH7A 2BBTA 3E3NA 1DUVG 1I2AA 1YC5A 1YRAA 2DR0A 1VCNA 2PT6A 3J7TA 1OV6A 5DYNA 4I19A 5DSZA 2Y4OA 1EXDA 1G66A 1FLAA 2PGIA 1BVHA 4LX8A 4R3WA 1IZ8A 2OCLA 5TF0A 2P2CA 1SKMA 2YWJA 3OQOA 3D7KA 3VQTA 4F5EA 2VNKA 3C4JA 1QF6A 3G0GA 1E1QD 5EOVA 3ZV6A 4PY2A 4MKZA 2H5EA 3AONB 4D8YA 3TXXA 3TDNA 1OTXA 2GZMA 4HDKB 1T15A 5AI8A 4H7PA 5SZHB 2WUGA 4CIDA 4EAQA 4PU0A 1ZU5A 4BFSA 4YMIA 2HIAA 2J5BA 2FHSA 1M34A 1ZOPA 4QAQA 1KI7A 4PYMA 3TLMA 5LD2C 3ABRB 5KNCH 2D13A 3VDRA 2MIIA 3FVQA 1JFTA 2FPUA 1CVRA 4PXSA 3K9CA 3KKPA 3TQTA 2DBZA 4XVUA 1AQIA 3IX7A 1XXHA 2I1WA 4HDSB 2GEFA 4KREA 1HE2A 2C4KA 4BQOA 1IC6A 1WO8A 2ZKLA 4Q7JB 1Y7TA 3TDMA 3WYNA 3EULA 4I9NA 3JVEA 1EFHA 2IZ7A 1VKJA 1XMPA 2IE8A 4YP7A 1IZYA 1XTRA 2DC1A 4UHBA 4QO8A 2Z1MA 3I1YA 3LVBA 4LXTA 4EPYA 4XM1A 1EAMA 5F9HA 2R84A 2W8BB 4I1RA 1KWKA 4KHPB 2AOUA 3G1WA 4JR2A 4CTOA 1AMNA 1M7HA 3RABA 1AS3A 1MH9A 2R6FA 1YZVA 3A6EA 1XZDA 2RI0A 3CNQS 4Z9BA 3PNSA 2XGSA 1KMHA 1OASA 2EC5A 2G1PA 4KUGA 5LA6A 1RTKA 1E4YA 2RGAA 3ZJUA 4Y6GB 2QXTA 4HH0A 4BN5A 1YR7A 4NRDA 2V7BA 2V9ZA 4KQFA 1PR4A 3D2LA 4FDUA 3GNTA 4I3FA 1Z28A 4CKCA 1YS1X 1JQBA 3CISA 4HSGA 4JC8A 4Y1EA 1FQWA 4L75A 1JQ5A 2JJ8A 2WHPB 2QN7A 3A58B 1P73A 3GH3A 3LXXA 1EHIA 2QQGA 3MAJA 3PR1A 4LMAA 3L8GA 5E38A 1UM9B 2O8DB 1ADGA 4J0QA 4MP3A 4Y30A 1JGTA 4QOHA 3CZQA 4HVAA 3VYUB 1N5IA 1IPEA 1RYHA 1Z82A 3AF1A 3I83A 4JXZA 4MWZA 2G1AA 4IIBA 4CF5A 1PL0A 1JR3D 1DQPA 1L1RA 2ZIXA 2Y1FA 3EGDB 3ENQA 4NV1A 4X94A 4AMUA 4QG3A 3GLIE 3A4LA 4HAYA 1T8UA 2EU8A 3GLGE 1BH6A 1SUPA 1USVA 3S2YA 2AD1A 4HT3B 4B4VA 1HURA 4WACA 4I08A 2IV2X 1X8XA 3OOEA 1DJMA 3X2FA 1CQXA 3D3EA 3MJEA 1FNNA 1H66A 3ZGVA 4HAVA 1SXJA 4GX2A 1PQYA 3A04A 2C2HA 3O93A 2ACEA 2FQXA 1GTZA 2J3EA 2V7QA 4RY2A 3C5HA 4L6CA 1RBZA 3RD5A 1JS1X 5MN6A 1IXYA 1D2RA 2FWJA 1CUCA 1GJRA 3I3OA 1EGQA 2OCDA 3NKLA 1NKVA 2YY7A 1Y1KE 3ROGA 4CM6A 2C00A 3SBDA 2VH2A 3IRUA 5F4ZA 4P7JA 2XPCA 5TQ0B 5KPJA 4MJ7A 4RKQA 1J24A 2EAUA 3Q9SA 3JQBC 1KR2A 2IV3A 1NAHA 5T7BA 3FNBA 2QTVB 1PO7A 2QLLA 4RHYA 3STHA 3EG9A 2X0FA 4EOGA 2YVAA 4MDHA 1HTTA 1CD5A 3MAGA 4B43A 3SI7A 1HQKA 1C3JA 3V8QA 1I01A 1W4RA