3GOQA

Crystal structure of the tyr13met variant of bacillus subtilis ferrochelatase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
307
structure length
307
Chain Sequence
RKKMGLLVMAMGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase
publication title Crystal structure of the Tyr13Met variant of Bacillus subtilis ferrochelatase
rcsb
source organism Bacillus subtilis
total genus 117
structure length 307
sequence length 307
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2009-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3goqA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3goqA02
2C8JA 2QD3A 1LD3A 2JH3A 2HRCA 4CCSA 1DOZA 3GOQA 1N0IA 2AC2A 2XWQA 2PNJA 1HRKA 2DJ5A 2QD4A 2HK6A 1C1HA 1L8XA 1C9EA 2XVYA 4KLCA 3HCNA 2Q2NA 3HCRA 2QD5A 4KLRA 3W1WA 2Q3JA 2XWPA 3HCPA 3AQIA 2XWSA 4F4DA 4KMMA 2H1WA 2XVXA 4MK4A 2H1VA 2QD1A 3M4ZA 2PO5A 3HCOA 4KLAA 1QGOA 1LBQA 3LYHA 1AK1A 2AC4A 2HREA 2XVZA 1TJNA 2PO7A 2Q2OA 2QD2A
chains in the Genus database with same CATH superfamily
4RY0A 2EJUA 4P7KA 3DLCA 2C5LA 1YZTA 3UHFA 3FAKA 4PLCA 2AFIE 3RRXA 3KUUA 5C52B 2WIDA 3O8QA 1HEUA 2J3EA 3G1TA 3H5AA 1PEKE 1FCJA 4ZMBA 2VUIB 2AEJA 4TTVA 1WU8A 2WV7A 2J5QA 2ZB7A 3B9BA 1KYWA 1XQ1A 2DFTA 5BPFA 1G59A 2OAEA 1JW9B 1S02A 4XGRA 3RKUA 3LBYA 3UANA 1F4VA 4B0PA 5CT9A 3BCHA 3SPXA 1PFVA 2BEVA 2W4IA 4KO1S 3OC6A 3UK0A 4C76A 5CEEA 1T4DA 1V4BA 2R8XA 2WA1A 3EMDA 1Z2OX 3HCDA 1G2OA 2BHRA 1MA0A 4HAYA 4NJEB 4QU5A 1H1LB 5AQ1A 1P91A 2EDCA 2I1LA 1OLXA 3OH8A 2OZVA 2UYOA 2W2LD 4JB3A 2IIVA 1CDDA 4PYMA 1P3JA 4QASA 4FNGA 1X1CA 4N40A 3K0EA 3INRA 2Z8XA 3HL4A 3T9CA 3EJ6A 1H3FA 1V1MB 2BGKA 3WNVA 2P9JA 4B3RB 1XMJA 2O8CA 2VJQA 1GL9B 1JWLA 1V11B 2Q45A 3DVSX 1RWBA 3IVMA 3WL3A 3HYLA 4LJ6A 1CUYA 4JDPA 1R5JA 3U80A 3QTLA 5THKA 4JD5A 4FJ2A 2WUDA 4AUKA 4ZVSA 3H5RA 4TMZA 2IYRA 5JHHB 2ZTUA 3NWBA 4J0CA 4XPIB 2I62A 4ECAA 5JCOC 5FA8A 2VA9A 1TAHA 1DFIA 2A1TR 2H9YA 2JANA 1MJFA 1T4CB 2VDRB 4HMOA 4UBLA 3PQ8A 4UNIA 4ZOCA 2JLVA 1Z15A 2FWRA 2OXRA 3H86A 1KHTA 1U5BB 4ND8B 5SICE 3LKDA 3ZR4B 1ZD3A 4CT5A 3HCFA 3IT0A 4YFYA 1UUFA 3N70A 4P2BA 1QIGA 2CK3A 1NQUA 1W2WB 2JH3A 4LZLA 2IU6A 4ZO6A 4YRPA 3RIHA 1XNGA 2ECOA 1DZ3A 2WJYA 5BSEA 4FFOA 2J31A 3LY5A 4FCVA 2XGSA 3BEOA 3CF4G 3HJUA 3N0TA 4FE7A 3F73A 1MABB 4S12A 1VGVA 2JLBA 4R8KA 2NZYA 1OPXA 2CHVA 1SKUA 1FC0A 3SQDA 4UU1A 1EM8A 1GRQA 5BP7A 1LRLA 1OGJA 1VLHA 1ORWA 1Z5NA 2W2LA 3JQFA 2R4TA 5KYYA 4AWXA 3F96A 4HVLA 3KBOA 5ITVA 4BATA 2HA3A 5IJAA 3S2FA 1GEEA 3I62A 4ITVA 5D8DA 2UZ0A 4Y8VA 1AURA 4KWEA 5BQFA 3IHWA 3ZI7A 1RVV1 2B0CA 4F86A 3NHUA 1SELA 4RPIA 3GT7A 1XMSA 4GM0A 1W6RA 3GG9A 4EMTA 4QLAA 1UKEA 3OCJA 1WQ3A 4LC1A 1W25A 3R3SA 3ZHQA 3P5SA 1OLUB 1Y8AA 2F43B 4CL2A 3D2AA 1NN5A 2QGFA 5BSFA 3KFLA 3NDIA 2CV2A 4RANA 1QH1A 4F97A 3PA8A 3T41A 1A5SB 1SXJB 2DFVA 2Q2NA 3AP3A 3KTOA 1GQSA 1BIFA 1YZYA 1KYQA 4NQZA 2BR5A 1BW9B 3FMFA 4QELA 3T94A 3PCXA 1LI4A 5ERXA 2G6BA 1YGPA 2REQA 2WNIA 3PBKA 4JCOA 2X9GA 4HFRA 2Q4OA 4BVBA 3ROFA 5A4AA 4KYIB 4ITUA 4TTTS 1UZAA 3THSA 1GYPA 1WTCA 3RTEA 5JZOA 1DC3A 4PQFA 3RYFA 1EVQA 2BZ0A 2H1OA 2H1HA 3GMSA 1X9GA 2AVNA 4TLLB 3ZOKA 1HA3A 4YACA 5LMZA 3OQMA 3DKVA 4UCXA 5C53B 1ODSA 4HB3A 4RXUA 1T35A 4DT1A 3FNGA 3ILYA 1XOIA 4CMCA 2CLHB 1C30B 1G5IA 3P9QA 3TW0A 1QYIA 4EMSA 3W8FA 3H2ZA 1Z68A 3VTZA 1ZJ4A 3PIIA 1OYOA 2OFPA 2GFHA 2O1EA 2QTFA 4GR5A 4XJTA 2CWWA 4H4CA 4DBLE 1EAYA 3TCNA 1RWWA 5F9MA 3OSZA 3VR5H 3WA6A 3M6MD 4HX5A 3N8DA 4B3MB 1PR2A 1TT5B 1CUVA 3PSHA 4G2TA 4DWWA 4EB8A 4CF6A 2QX9A 2C2HA 5HKLA 3PD0A 2J0VA 3VC1A 3Q98A 1OH8A 3DUWA 3OJ0A 3USZA 4CMJA 1TC2A 3L05A 3U7IA 2WA2A 1YONA 1P1FA 4B2IA 5A06A 8OHMA 5DM70 3ETCA 1UJ4A 4JL6A 1XMPA 1E3JA 1AY0A 1PQPA 4BRWA 3BFPA 4MWDA 3U7HB 1CR6A 1Y4AE 5BR4A 3KB8A 4Q9KA 2FZCA 2ZSAA 1KAMA 4YFVA 1ZOOA 3UENA 1CY4A 4GLLA 4IKEA 5IUJC 3KAJA 2WFLA 4F7DA 1K89A 2VSOA 2EERA 3C8UA 3RW9A 3PX7A 3OM1A 5SZJA 4JLPA 2C07A 4KOAA 4FI3F 3GQBA 1TTHA 1Q7GA 3KQKA 2QT1A 3I6YA 1YRLA 5T4BA 4YRZA 1RFLA 2PKQO 4KV7A 4WL0A 2CCGA 4PRYA 4TLDA 4BQPA 3HB9A 1HXHA 2X40A 3AV3A 5EE3A 3ZBTA 2I2CA 1KOGA 1E9CA 2P41A 1OX5A 4H0CA 1GTSA 3BTOA 1LD3A 1TQ2A 3L92A 2UZ1A 4LEIA 3M89A 2SKCA 2BGLA 1V8PA 1XJ5A 3HXOA 1P7CA 2IF0A 2J6HA 1DKMA 3GEHA 4X97A 1N34B 1Q0LA 1R5OA 3HKDA 1XPOA 2C42A 2F1HA 2F59A 2VJOA 3CCFA 2ZRLA 3GDFA 3LY8A 4TKMA 2XCTB 2TS1A 3UW3A 4BEVA 1WHTB 3G0BA 3JQ7A 5AVWA 3BWBA 4IUDS 3CCBA 4K9SA 4MI3A 2WE7A 3LUGA 2NPIA 2C0PA 4RK1A 1TU0A 1B3BA 1CB0A 2B94A 5B30A 4J49A 2X6TA 3KB1A 3SDSA 3B89A 3I37X 2CMKA 1ISRA 4PIMA 1EUDA 4NEQA 3K1YA 2HA5A 3S2SA 1CYEA 3HJGA 4Q4JA 2ZIAA 3F4KA 3I9LA 2NT4A 4MW2A 3BWMA 1D6JA 3IAUA 4MOWA 3TL6A 2CE2X 4C22A 4YJGA 3ID6C 1KC3A 1FYWA 3HDYA 4F38A 2QOEA 2ZAIA 4ZKDA 4IF4A 2VAXA 2ORVA 2BV3A 2FN8A 2Q07A 3RU7A 3LQYA 3EC1A 1RJFA 5J3JA 1WV1A 5DJ5A 2IXGA 3B1ZA 1CJMA 2XZOA 1AG9A 1IB0A 1S3IA 4IVQA 4K9KA 4ND6A 2A33A 4LC9A 4BUZA 1A9SA 1DQSA 3JSAA 4FYVA 1QMGA 1B76A 3P96A 3UFXB 5JHGB 2ZQZA 1S9DA 3PUKA 3G9ZA 3V7NA 3KUCA 1JIJA 3ZHOA 4XX1A 1NI3A 2PA0A 3DAPA 4LOAA 4NYJQ 4QRIA 2EBWA 3H75A 2B34A 1MXFA 1L5RA 1XQ6A 3IRVA 3LF1A 5K0EA 1LRJA 5BV7A 3WBFA 1E7WA 1XNHA 3EIHA 4IS2A 3BIFA 3H19A 1V6AA 4IHKA 5DP2A 2HQRA 1ONSA 3RASA 1K7YA 5CYOA 2C7VA 1GDDA 1AUQA 1L7VC 4FLMA 2WUVA 1TB4A 1P9WA 4CMEA 1TRKA 3I2FA 1PR4A 1AZLA 1M2VB 2FFBA 1A0OA 1PL8A 2PX3A 3C48A 3E3MA 3IA7A 3M1LA 5JBNA 2VP0A 4RADA 5BORA 3KCNA 3UB3A 1BX1A 5JZBA 1PQYA 1P74A 1KYXA 2ESRA 2B6HA 1GTMA 1M1YB 1QAQA 5KAPA 2JCXA 3W9SA 3WQRA 2C3PA 3I28A 2ECPA 3FOAA 4MVWA 3PGKA 2GESA 1OJ7A 3M4XA 4TWJA 3LLMA 2Q8PA 2Y1EA 1DEAA 3K1ZA 4ZARA 3THOA 5KQPA 3ABZA 1PV1A 2GZSA 1ZD1A 4O02B 2Z4RA 2OP1A 3EUFA 3W7BA 1NONA 4QIHA 3HO1A 4X60A 2OCDA 3MW8A 2W6QA 4ACBA 2CJFA 2PKXA 3MGCA 1E7RA 4KVGA 5DB4A 2VDQB 3OSUA 4NK4A 4Q3CA 4LECA 5I7UA 1T2AA 4H1UA 4QECA 1VJ5A 3QUSA 3QX8A 2HU5A 3IJ5A 4KRXA 1BDIA 1K7EB 1SKQA 3OZSA 3BWDD 4EKNB 3MWDB 4F3RA 5NULA 3VHLB 5HKBA 1M0TA 1SA0A 3QVUA 1FNCA 4L6IA 2ZI7A 1P45A 1NC3A 4TMKA 4TV8B 3CLKA 1SKBA 3DYVA 2QE7A 3GVHA 4MWBA 3NHBA 2O8EA 3MIZA 3ENNA 2IV3A 3OKFA 1C1DA 1YRAA 3WDLA 2VH2A 1TL7C 3HN2A 4YMSA 3SGLA 1KI8A 4P92A 4R1OA 3STTA 2V9PA 4EJFA 4ZMRA 1QO9A 4IDBA 4YJ3A 5B2EA 2O3RA 3O4FA 4Q4AA 3VVLA 3HCAA 1W88B 4S0XA 4XVCA 2IHBA 3OMLA 1Z28A 4F46A 3S4YA 1KA9H 3L6OO 2JCBA 3RABA 1LWOA 3WC4A 2RAUA 2CXHA 3RAJA 1LB1B 2C5EA 4K2HA 3VGPA 1YQ9A 2O8FB 2BW0A 2YDXA 2ZJ0A 2CL0X 4JI8B 3I45A 1JIQA 3NGMA 3MS7A 3BXFA 1MC4A 2V6JA 4DNOA 1TZJA 4ISBA 2J4CA 4RD4A 3RFCA 3PD1A 4I50F 4DVGA 4CIYA 3H1TA 4BN4A 2XRZA 2WF5A 2H06A 4EJ0A 2HJ9A 2R84A 1EWRA 3AINA 1PJAA 4TWBA 5I5EA 3V9AA 4URUR 5J2TB 3ANSA 4FYIA 3W2EA 4KXYA 3W8EA 4TUYF 4QSHA 3PJFA 1J5PA 4WMLA 5BNFA 4BQFA 1P7YA 2Q3LA 2QTHA 2R1VA 1VP3A 5FXMA 3TD6A 3B9QA 4IDHA 4AVYA 1I2ZA 3DD1A 4G5RA 4EJSB 2QX8A 1VCIA 2Y67A 1KDOA 1K5DA 4KLRA 5DNYB 4LJRA 2NPOA 1YB2A 5IKMA 1Z39A 3HEAA 2GM3A 2Q6IA 2HLHA 3GLHA 3QLVC 4KN5A 4ZO4A 1E4YA 5I9SA 4DWOA 2P67A 4ARVA 5IN4A 2DG2A 2GHRA 3DGEC 3AHGA 4FIZA 3USES 3GLHE 1SVKA 4KQFA 1EWKA 1GUYA 2IHZA 2PU5A 1CSEE 1XQ9A 3AFGA 4KW7A 4RDCA 3HLTA 2YIDA 4ZOQI 1SAYA 1Q0TA 1DIHA 4AL4A 1Z6AA 3TK1A 4QHYA 5IKXA 2A35A 1FUEA 2ZYTX 2P2CA 4PO8A 1OWMA 2XUIA 2RH5A 2PS1A 3D2LA 1BDJA 4AJIA 2ZB8A 3O3MB 4Q7QA 4S1VA 2G4CA 3TNLA 4DAOA 1RRKA 4EH1A 1D1PA 1A4UA 1ZMOA 4LYEA 4H31A 4YGXB 1QQ6A 5E3IA 2O07A 5J58A 2O0HA 4LHXA 1P0PA 3L9XA 3PNVA 4XAQA 3B1WA 4ESEA 4DLKA 5JALA 5KSZA 2WJ3A 1Z12A 1TE2A 4DIOA 2FKAA 3CH6A 4ABTA 4Q1CA 5A7HA 1N2EA 1JLLB 3CF6R 3QUTA 2W11A 4NCJA 5ADVA 1U7WA 4OA8A 4ADSG 1NN0A 5M2QA 2V74B 3W6UA 5JD5A 3DLHA 1B8PA 4L4UA 3GNQA 3NTVA 4R1TA 5DIFA 2OV1A 2X9NA 3KSMA 5TC4A 6REQB 3HYSA 4R8MA 4IUBS 2VRWA 3BJIC 3TIFA 1FQOA 3F98A 3G89A 1LW7A 1FQKA 3GUYA 4FQ7A 4L5YA 2C92A 2JJMA 2N1BA 3T7SA 1GYRA 1E58A 5FWAA 5EZYA 1RM0A 1WSWA 1TKRA 4MGZR 3NU1A 1EX9A 3ANMA 4TOIA 2GZAA 4MR9A 4P22A 3ICOA 4I1SA 1G5TA 4MEJA 5J9FA 2A0FA 4TSFA 4DA7A 5LYJA 3INYA 4HN9A 4C0LA 1JIVA 4ZQGA 1S0UA 5GOTA 1ZGGA 4MKIA 2CLIB 5JC1A 3OJCA 4RW0A 4UVDA 5EZ6B 4LBZA 4W5JA 5EJMA 2B5WA 4GPAA 3DKKA 5D3ZA 4AX8A 2NU6A 4Z86A 2ZIVB 2HNBA 2YH2A 3CF4A 5CDYA 4F60A 3VKHA 4PAGA 4B4WA 1K06A 5KTPA 1CEQA 1AB6A 2BCJQ 3C3JA 4A16A 5JBQA 2Q5EA 4RIGA 1WU7A 3ZGLA 4M98A 3QYPA 1A9QA 1N6LA 4L5BA 1E1RD 4IV0A 4ZALA 1ZK2A 3KSAC 1GSIA 2NM0A 4S3MA 4BFSA 1DSSG 2VP2A 2Q7XA 2YQZA 1E60A 2LE0A 4HX2A 2ZSHA 1Z0KA 2ECQA 2FZVA 1USGA 2HEGA 2W6PA 2NSLA 2ZRDA 2ZBEA 3I1JA 3LC0A 4ZGBA 2WZQA 5IKEA 1GTG1 3KTAB 3U3JA 1LXCA 1X2BA 3F9RA 4WPGA 1XPJA 2QX6A 2PT9A 1JIIA 4M54A 3TJRA 4RD3A 5JMOA 1XDUA 1UBSB 3OFJA 4HH1A 3NGLA 4KPGA 1U2DA 4KSBA 3K35A 4OHFA 3ZDEA 4BO4A 1U1DA 2WC1A 5L3SB 2H54A 1BU8A 1Y6FA 3HR8A 4NOMA 5CR9A 3GAZA 3IKTA 3DQZA 4R8RA 4FFWA 3S5JA 1NXWA 2YOGA 5HGJA 1PGJA 4CT4B 4XUDA 1WUYA 3V7UA 1ECFA 4X1KA 3I6MA 3P0HA 1C7FA 2BFAA 1H4TA 1UFOA 1AK9A 3DDUA 2ZUDA 1IULA 4KPFC 1REQB 1HLGA 2V59A 4CG1A 1DKLA 3FNBA 1JZTA 3TZ6A 3LQRA 2W2PA 4JC5A 4AW9A 5ICEA 4ZYTA 4JI2B 3MD0A 4DRZA 5EERA 3NORA 4FGLA 2ZSFA 1ISHA 5B1SA 4DLPA 1GIAA 3TTSA 1I94B 2QQEA 1ZWLA 3EEFA 1NW9B 3UH0A 2PSDA 4UHJA 3OQOA 1LV8A 1FLAA 2CEKA 1JQEA 1FS4A 1Z6PA 3H8SA 4K6GA 4XYGA 4XIIA 5TMEA 4WGGA 4MLCA 1JJ7A 1QOZA 1A8PA 1EFCA 2JRCA 5HBGA 3UCEA 4RVDA 2XA1A 4WUTA 3B6EA 2JGIA 3P9YA 1C4WA 1QLJA 1DEHA 4E21A 1QPBA 5K3EA 1SIBE 1MGOA 1WZIA 2DQSA 3L40A 3PKIA 4OXKA 3S28A 4BWGA 3O8NA 4J90A 2ZYVX 3FPFA 2G1JA 1O54A 4JX8A 3D3JA 4MKRA 3E8XA 1KBQA 1DQRA 2WWIA 3KXDA 3I0NA 2J45A 4ZPJA 3QVLA 1SC9A 5THQA 3KOXA 4RKYA 1PU2A 3TUJC 3W6PA 3WLAA 3SX4A 2LCIA 2MR5A 4DJTA 1ZCBA 2EFDB 5ALTA 5E6SA 4MGIR 4NMXB 3TB4A 5IKPA 2EQ5A 1B2LA 2X0FA 3MJ4A 1ZITA 2HWXA 3JQEA 4Q02A 3S2ZA 4TWIA 2HL6A 5LZ7A 1M67A 1U8AA 1PGPA 2C3OA 1X1BA 2QPLA 3H4VA 3PI6A 4JBWA 3GJTA 4A73A 4HDSA 5JPIA 3WGIA 1GPUA 4XWTA 2FFQA 3GZTB 1X86B 2PNFA 2QXYA 1USWA 5ALRA 4PC2A 1E9SA 1G2PA 2GD6A 4JIGA 4PXSA 5JYCA 2XHEA 5KYNA 1GVHA 2PZ8A 3VV2A 1CS0A 1ZJJA 2NYUA 2ZJZA 4JSTA 3STYA 4UCQA 2SHKA 4DMKA 1Y33E 5GV7A 1UPUA 2CBZA 4MYCA 3BXHA 4QQKA 4P5DA 2XODA 2OYSA 5H83A 1QYVA 2JCYA 2OAP1 1EFHA 5EEGA 1MORA 1RAFA 4XVRA 4P3YA 4OB6A 3PB3A 2RGGA 3A14A 3DKPA 1YRYE 2EKPA 4EM6A 4M3NA 3GFTA 1GKLA 1T3LA 4W99A 2PGDA 3E9DA 6GPBA 4BXOA 3RI3A 3H42B 4L6AA 1W9MA 3JV7A 4YRLA 5LQUA 3AUKA 3WNZA 4MQEB 3GCXA 3DTNA 2JLXA 4R3UC 1QVZA 5B7NA 2Z2IA 5EJ5A 4YDRA 3H97A 4NQRA 3PXGA 4FYKA 2IV2X 2WY2D 3GWGA 4PQEA 1XPUA 5IJWA 1R0KA 3PVSA 2NQTA 2QTNA 3FTQA 4M6WA 4B2LA 5CXUA 3F1LA 3R0IA 4WV3A 4U39A 5H81A 3WY9A 5KWVA 3R5FA 1KMCA 2YCLA 3OM0A 2B83A 3TQIA 3EAFA 3TF5A 2Z95A 4ZAZA 1VE6A 2WFAA 3HSSA 4JLKA 3I9KA 4QVGA 5DE3A 5JNTA 5G0WA 3DD5A 4BQQA 2UZAA 5FPSA 1GQQA 4ND1A 5F1YA 5LVAA 1C7JA 1II8A 1HQCA 2W93A 2WIKA 3FR7A 1U2PA 2IDZA 2Y1DA 5DHQA 2J7KA 2ZYWX 4RM2A 2WJGA 3PNLA 2VVTA 3P9IA 1ZJYA 4MINA 1CUXA 1YTLA 2ZSEA 3EGVA 4PINA 2FK8A 4Y2TA 3V8BA 1NATA 3WXMA 2IOFK 3UO8B 2FRDC 4QJ5A 3ICEA 3W2TA 5FDFA 3IBSA 3GFFA 5KX5B 4HJRA 2ZRAA 3OTWA 1UQRA 3KSDO 2OYCA 1KAOA 1C0KA 2JGEA 3N2KB 3N2LA 1E1CB 2WMDA 1QONA 4TYYA 4WA8A 4KGVA 5H3LA 3SKXA 3C3XA 3EGXA 3IS3A 1LK5A 2YW9A 3QX7A 3W9YA 1BS2A 1BHQ1 3IO5A 3IJPA 5MN4A 2GUWA 1O6BA 3LK7A 2E1PA 3QE2A 5EMHA 3NZEA 3HB0A 1OFTA 4FUQA 4RJIA 5K51A 5JARA 2FLVA 2GXUA 2PLNA 5IZCA 1JQDA 1K4KA 3B12A 5FULA 3KD2A 2FY8A 2Q4BA 3ZBUA 4NE9A 3P32A 5LZ9A 3V55A 5UKDA 3HXMA 2DULA 4I5EA 2XZTA 1PR9A 3JVIA 2IHVA 2O2EA 3KVOA 4YAUA 3NEAA 1SC6A 2G5GX 5KOHB 4FX2A 3R0ZA 2A92A 2NZVG 3JD0A 1GPAA 5ABPA 2NUTB 4I4LA 3IUPA 4PO1A 2FN4A 4QWWA 3ODPA 2FMTA 3DVAA 4FCWA 4K5QA 1RYNA 4GG1A 5JNSA 1RW4A 4A8JA 5GV8A 2XVMA 4OLAA 1XDGA 5DNVA 1KYVA 4GO1A 1EX7A 1SBCA 5FTWA 4V02A 5JEDA 5KDLA 2KE5A 4MP8A 2B30A 2RDMA 1IY0A 5EMKA 1KY4A 3CUEF 1C41A 4KHZA 3DJYA 3GFOA 4PSUA 5M3BA 2Q8QA 3TNDA 3ZWVA 4EHJA 2CF6A 1GCUA 4UTRA 3TMAA 4A36A 4F12A 1NBEA 5HKOA 1VL6A 2W2TA 3DE1X 3L8EA 1EX6A 4DIEA 2Q5JA 4R7ZA 4LCJA 1W94A 1AD2A 3K1AA 3JYNA 3Q41A 5BWCA 1KMHB 4BO0A 3BZBA 3SOPA 2X8WA 5HJEA 4BNFA 2YQ5A 3ZU2A 5JAHA 3BWCA 2AMJA 1QGDA 1Q1GA 2VCEA 3AXTA 3FKSD 4CQJA 2O3SA 2V6IA 2JFYA 3GFSA 3JVEA 3ECAA 4J4TA 1YCFA 4RPGA 5KMGB 1L5MA 4RVFA 4P4SA 1U5AA 5K3SA 1T25A 1IPHA 2HV9A 4V0NA 2L42A 3DBRA 1HL3A 1T9HA 1MNQA 1CFJA 4W8GA 3SZ3A 3P0RA 1P2DA 5KNBD 1OREA 2QTZA 4EF6A 4EO9A 3LZ6A 4CUKA 3O1HB 3QBVA 3F3KA 1XTVA 3H2GA 3FMGA 4YP1A 2H6EA 2AVDA 4GNKA 3GT3A 5FL7D 4IHJA 3VNSA 5CEJA 3EVAA 1QTQA 3VPSA 1YR1A 4QO7A 2CXXA 2GT1A 5L6MB 3QE9Y 3E81A 1KQPA 2PM8A 2YXLA 4OXXA 3ROMA 2REXB 4M83A 3IAS6 2GETA 4AZ0B 1WSBA 1CZLA 2FSIA 4XZ3A 3DYBA 3SF8A 1B42A 3DAFA 3L07A 5I4KA 4P4LA 1BGWA 1KPGA 2OLEA 2WSBA 1P2FA 2VSQA 1RZRA 4OSPA 4D4KA 1QC5A 3KT6A 4BEWA 5LOVF 1DUVG 2RBGA 3H11B 2BDEA 2P9ZA 3UHPA 4BLSA 2YBDA 3H2SA 4IIFA 1S6YA 1OAKA 3D3EA 4WFIA 1DXQA 2JCVA 2VDWB 4JB2A 2NUAB 1CE8B 2Y27A 2YV3A 1LZLA 3LVQE 4UCWA 3QWBA 4IDQA 3HJCA 4YJFA 4ZU1X 3QTBA 5GZ6A 4OHYA 5THXA 2H2FA 3AEQA 1HDIA 3ORQA 4EPVA 1GN8A 2B1JA 2C9MA 3PFGA 3PL5A 4U0JA 1WBDA 1TK2A 4R7TA 2QP9X 3GJZA 2XE8A 3ETGA 1ARZA 1J9GA 5EXDA 3QXXA 5K3AA 2DUNA 4PRZA 5LR6A 3RAPR 2ZAGA 1SUBA 4M87A 2FZLA 2GSWA 3ZNOA 1HV8A 1L6IA 221PA 1DGQA 3PNYA 1VFNA 3KVRA 3AUJB 4D3YA 3BQMB 3KLPX 1QIJA 3KQLA 1GG5A 4BFYA 3GF4A 4D0RA 3MS4A 4O4HB 2GEFA 3AILA 3A9UA 5CD9A 1AMUA 4OJKA 1AV6A 3DEKA 3HFJA 5BVHA 3TZCA 3WMEA 3MBKA 3OHSX 5H1YA 4G0NA 3W4IA 4FE4A 2XOEA 5JH7B 2XGGA 1V3UA 1R6BX 4WCVA 5ES3A 5KCZA 4JI4B 2QX7A 4KRYA 4YRJA 3AR2A 4BP1A 2C4WA 1RLOA 3A32A 4Q82A 5FORA 4TUYB 3ZOZA 3H16A 1Z7BA 2G9ZA 1NTRA 3C5EA 5TRTA 3TOCA 3VKUA 1ND6A 2WHXA 4KQWA 4XWYA 1H66A 4EUSA 3TRDA 4YLYA 4FOSA 1MHPA 4J76A 4E3ZA 4MIKA 2XE7A 2G4VA 2XUHA 4RZHA 1BJKA 3FZGA 2QLTA 3CNQS 1D9XA 1HLPA 3EQ7A 4RNDB 3T7JA 4ZI7B 5F9HA 3QEKA 4ZRMA 5IT9A 4E4RA 1QIMA 3T3MB 1GUAA 3IQXA 4RQBA 3IAAA 1XNQB 5LM3A 5GZ3A 3D0KA 2QQ5A 3C7CB 3G6KA 4PX5A 1AKNA 3LX5A 4QJBA 2HI0A 1BJTA 1YKFA 3HA2A 1H85A 2JGKA 2NYRA 2XSZD 3R3HA 4BQEA 4ER7A 3IR5A 4EYQA 1XRSB 1CUDA 1Z17A 2GF0A 4YO7A 3EDCA 1I6MA 1EZZA 3FHLA 3H13A 4D80A 4W63A 4AP9A 3G2QA 1RC8A 5JADA 1UBHS 3NLLA 1LUAA 4BX9A 5D84A 1JQJC 1OQAA 2CBGA 3QPWA 4X20A 5D6NA 1JTFA 2ACWA 3UJPA 3LBAA 2JAQA 3DM9B 1NXTA 2GHIA 5HM8A 1OUMA 3H1FA 2OHVA 4CNQA 2A0WA 1ZR4A 1I1HA 4HGOA 3C3YA 4EPWA 3SP1A 4V39A 3G2HA 6AT1A 1KVQA 5DLDA 3VPXA 1UMCA 2I4TA 1IHOA 3ZEAA 3JYOA 2O8NA 3KZOA 2B3DA 4K9QA 4MTLA 1ODJA 5CW1A 4EARA 1K08A 1G19A 1UBEA 2W2KB 3M5WA 4C3ZA 3BWYA 2YMLA 5JT1A 3DE0X 2QVCA 1F51E 4C14A 3B52X 4LY6A 4DTCA 1Y3AA 5HX7A 5A0VA 4F4JA 5TF4A 1CF9A 3AEKB 4A6DA 1C3JA 1HEYA 4HRYA 1AZSC 3OEED 4V0SA 2PGIA 3G8AA 4KXFB 2XDWA 3PFWO 4HDMA 2XSZA 5CFOA 1U2DC 5DNEA 2NZ2A 5HS4A 1IFXA 2FFHA 2H5IA 4D43A 2R6GA 4PR0A 4N1AA 4OFXA 1XZEA 2RAPA 1K88A 1MB0A 2TSYB 3HA3A 3B7GA 4Y1GA 1X1RA 4LI0A 4MQ4A 5LA6F 5IXJA 5J1SB 3JWHA 4TQAA 1CF2O 2O0LA 2X4IA 4WK2B 3FRIA 1X7XB 4ONEA 1WBBA 3K0AA 4IO1A 4RA9B 3RODA 3TGWA 1KFEB 4UQOA 3UICA 2O8DA 2HCBA 1R9NA 1FPMA 2PO5A 3G2OA 2PZGA 4ZVLA 2HIAA 1WL8A 3P8ZA 4RIHA 1UXOA 4BNIA 3DYIA 4ENSA 4ZI2A 1FU7A 3DULA 4M1WA 3AZPA 2C3YA 4MLDA 2GD0A 2I80A 4IIJA 4QNMA 1DQPA 3ZVNA 3U5TA 3P4UA 4LK3A 4FOLA 2DPYA 1R9JA 4GL4A 2G67A 2CNOA 4J91A 4KRGA 3GGGA 2NPFA 3FOWA 3A25A 2I6SA 3GZ4A 3Q3CA 4OSOA 3V7YA 4P3PA 4R40A 3DOOA 3M1AA 1PG5A 1XCPA 1F2TA 1XTUA 2K87A 1E63A 3PYMA 4QFMA 1SHJA 3OEEA 5F1PA 4IGEA 3N8KA 3IILA 3T5BA 5K8JB 4QOEA 1B16A 1E61A 2OCKA 3LA8A 3LNCA 3CRRA 5FBKA 5C0OE 3A1FA 3FSRA 4PVDA 1MH9A 3WWCA 1HDGO 2GN8A 2ERCA 4U02A 4DJDC 4DIBA 2QWXA 1KFJB 3HNPA 1QIHA 1R8QA 3FPSA 5AWFC 3COZA 4DLAA 2DQZA 4YMLA 1FIUA 4QDKA 4DAEA 4CEIA 1CBUA 3G8BA 1XF9A 5HE8A 4N41A 3SNHA 4YB8A 5AJTA 4N6NA 5CPFA 3S2IA 3I9NA 1PL0A 2APJA 3KT8A 1T1SA 1XTTA 3P7MA 4XB1A 2DFLA 1L4MA 4RKRA 3DLAA 4D56A 4QPJC 2AKEA 1KZ4A 1JV2B 1I14A 4IMIB 3TKLA 2FE4A 3U4DA 3EPKA 1P1IA 1GTZA 2RHOA 1TQ6A 2Q4RA 5KYGA 5LWHA 4WZ6A 1DIGA 3H2YA 4CETA 3EC7A 1ZD9A 2OORC 2ZWOA 3OJLA 3OPQA 4LBWA 4HN4B 1Y48E 1MAWA 1BYUA 1N5LA 1PJTA 3NVAA 3T6KA 3IDAA 2GNAA 4ZKEA 3F90A 3DE3X 2HBYA 2WJZB 3PQ6A 2C7BA 1XAHA 2EYQA 4JIMA 1Q84A 3E4DA 4D9HA 1W76A 5HZMA 2GN2A 1DAKA 4WKOA 1SZCA 1S4MA 4NPHA 4C3VA 1EK0A 1SIUA 4KH0A 3QIVA 2FPMA 2NUPB 2PAFA 4RMHA 5I4BA 5KAMA 2PL5A 2ILVA 3SFTA 1FY2A 2OKCA 4N39A 1Z4OA 2QTAA 2X0RA 1F3LA 2FWJA 3U16A 2FEXA 2ZRBA 3KWMA 1EVJA 2B20A 3KEFA 3MJRA 3Q3EA 4I8IA 3UMBA 5HIAA 1GKYA 3VPGA 5A1TA 4TQ9A 2YS7A 3MINA 5E4FA 1G6HA 1O9BA 4RHXA 3WWOA 4YT4A 4I46A 1VB5A 2OG2A 4D9CA 5B6IA 3VDMA 3H18A 3LKBA 1W5TA 3DTYA 3FWPA 1FYXA 1R0YA 4YRRA 5J43A 4DR5B 1SUCA 2W8BB 5CTJA 3VDXA 1U6KA 4BGIA 4BLUA 1ACMA 1U9ZA 4BQOA 1L7EA 3R6DA 3NIWA 5FLEX 2OXEA 1VG9B 2WWGA 1BE8A 1G8FA 2OCGA 1FEZA 3ACCA 2O52A 2JFVA 4Z9FA 4JMPA 4Y98A 4YP0A 3GRUA 3LCRA 6LDHA 4NBKA 5HOEA 1XVLA 2LPMA 3BHIA 3OIDA 1D5CA 1ZD4A 2QLFA 3ADDA 1W5FA 2GPWA 2KMLA 3T5GA 5K3BA 3ZHXA 1VQ1A 1IM2A 3JZFA 3ZE8A 3RHSA 2BEJA 2IFTA 1NPDA 3TIXB 3CHYA 3MGBA 2IEGA 4D9JA 1GU7A 3KVNA 3OY2A 5JAOA 1WSAA 3MBOA 1N77A 2XE6A 3EE6A 2QVGA 2WJAA 4FGWA 3RS3A 4LYFA 3WLNA 1M5TA 4WXRA 3GPLA 1MX1A 1R6TA 1I3LA 4GPZA 2A3RA 4P35A 1R2QA 2ZBDA 3O31A 4XUEA 4BMXA 2W6OA 1C4XA 1KO4A 2ZW9A 3DWIA 3PDIB 4D8WA 2VNHA 5K03A 1M54A 2C4VA 4MS3B 2IUEA 2VDMB 2HB6A 2CC2A 2ES4A 3KHTA 4X8LA 4D74A 3CRQA 1KZ9A 3V33A 2I9PA 1IVYA 4ZN6A 3H65A 4MPJA 4PYLA 3LFTA 5FUVA 4AKHA 3GGCA 1TW2A 2PXXA 2UVPB 2QVYX 3ABQB 5BR8B 3IQHX 3BB3A 2MINA 1H8ED 2RBEA 3MYRA 3WRXC 4I9UA 1WQ4A 1USUA 2IBMA 2Z9DA 5DH9A 5AW6A 2UYHA 4DDKA 3IXLA 3KS9A 4K9DA 3Q9LA 3X1XA 3J81k 4O2AF 4U63A 10MHA 2ZUSA 4JLDA 5L45A 4JJ7A 3H3FA 2FPRA 2IS2A 4YV2A 2WM2A 2D1TA 3LDUA 2Y2VA 3UHJA 1L4FA 3AM5A 4QBTA 4UMDA 4UMEA 1OA0A 5AOAA 3RJ5A 3SJBA 2H4YA 3ND7A 1QQ5A 2IL1A 2IHTA 5DXFA 2OQVA 3STUA 3ISJA 5IX8A 1GRNA 2FG5A 4EEKA 5IVDA 3NBXX 3JQGB 2O4UX 4JVNA 4HMPA 3SCZA 2GRUA 5E1MA 1U11A 1YJ8A 5FOUA 3WZMA 2GCNA 3VVBA 3SQWA 3COYA 5JATA 3UMMA 4GPD1 2J32A 4FIDA 4TS3A 4A0RA 1A7AA 2QQFA 3K6SA 3JASA 3M6XA 2ZTVA 3H5WA 3QU2A 4KZKA 4M76B 1EZ4A 2EGHA 2I3ZA 2VPIA 3FDJA 3FUTA 1IHXA 2QZ4A 1TZCA 4QNNA 4YI3A 1OR8A 3WLSA 2ATIA 5CT5A 4JHXA 3R7WB 2G1AA 3I76A 2J09A 4LDPA 5AKEA 1G60A 4A8PA 1MC5A 4RENA 4IIVA 4ENUA 2O5CA 2CHGA 3NCHA 3SE0A 1D2GA 3KUXA 3H0EA 1K6IA 3Q7IA 4P83A 3C14C 2W5UA 4ARUA 1QK5A 2HWUA 3B20A 1IEVA 3RM3A 2R1TA 3N28A 1RMYA 1TVKA 2GAFA 3L1UA 4M1QA 1QIFA 4LDJA 5F7ZA 1SB8A 5A7GA 1H8EA 4KU4A 4C03A 4DRYA 2VHXA 1Z6QA 1IQ0A 5IVKA 2QTWB 1Z5OA 5DM4A 3WJ2A 1D2AA 2DQYA 3ZCRA 4CTMA 1N75A 1JG7A 2C8VA 3EN0A 4I4CA 1DIAA 4L7VA 4FYHA 3WSVA 4F6LA 3AUSA 1EP3B 3U3MA 3HGQA 3NNNA 2B4RO 3TZQA 3WYCA 4CT0A 1P4GA 1PVDA 2VA8A 4OHCA 1ZESA 2GEDA 3C8ZA 2VNKA 1JI0A 3O83A 4GQAA 3RBVA 4FGJA 1NY6A 2DU8A 1M34A 3L7KA 2J48A 4NULA 2DWPA 4A9AA 3FTEA 2J8ZA 4B74A 1QX4A 3D0OA 3FPKA 3K9CA 1IOWA 4BEJA 3GARA 4JWKA 4LWQA 4Y1EA 1M34E 2FWBA 5AJYA 1FDIA 5IJ0B 2D6FA 4BLQA 2R00A 3E15A 1JLHA 2O0JA 3WV5A 1R27A 4BJHB 5CT8A 3EX7C 4LWPA 1O2DA 1V9LA 1ZEJA 3LUHA 4FBLA 5JO9A 4XWWA 1JH8A 3H04A 4AQDA 1ZSNA 2H1WA 1HDYA 3IESA 3QWFA 4FWIB 4MUFA 1A4IA 2F9LA 3K4QA 1S3GA 1M6YA 2CUNA 1EBBA 4OYHA 5CCXA 1S9HA 5A0TA 1TIKA 3LRTA 2GEVA 2ERYA 2VHJA 1DPFA 1C80A 1AKVA 1KRXA 3V8RA 1I80A 2HJGA 3K4PA 7YASA 5LOVB 2PPVA 1L7OA 4HO1X 4Q1FA 3F1KA 2QDKA 3KYBA 1RPTA 2HHLA 3ENKA 4L4XA 4JI6B 1J0EA 5AHRA 3T38A 3IQIX 2QMHA 3N7UA 5BV1A 5KOYA 2NU9B 4BMYA 2VJYA 2PKQP 1JL3A 4Z7OB 1YFZA 1WY7A 3TAUA 3HYTA 2P3SA 2JZOA 3KZMA 4ABYA 4B83A 1DRKA 5EP1A 4J1SA 2R4QA 1E98A 1X39A 1HYBA 4UBIA 1VYHA 4TTQA 4FYJA 1Z74A 3R5KA 4ZRDA 1GNQA 1L7BA 1NW6A 2Y4NA 4CPDA 4ETWA 4W9MC 4BFZA 1Z45A 3E9CA 4I9FA 1SU6A 3ASZA 1UXKA 4PLWA 4TXLA 3SJUA 1XDWA 2VP9A 4EJMA 1BCSA 4GEGA 4HRAA 4R05A 5A3QA 2I2DA 4PF1A 4OCZA 3THWB 5LQKA 4PO9A 4G5HA 1YBAA 3ZQ4A 5IJZA 3OPNA 1HNXB 3ELDA 1U2GA 3RVOA 1BVUA 4NENB 3RIGA 3SVTA 4JUCA 1DRVA 3H7AA 2PIAA 3NWEA 5K3OA 1XIVA 4G5SA 2OFOA 1KJ9A 4MUNA 2J33A 4K1XA 3U4AA 4EECA 4F5YA 4J16A 4YRNA 1WB4A 1IN4A 1KJIA 2V7QD 3UXHA 1YH3A 1HC7A 1T5HX 2P68A 2YFKA 2MYPA 1YDGA 2YMMA 1G20A 1G41A 3D81A 1O4WA 3ZHSA 4AX4A 3LIIA 1GU1A 2WE8A 3ANTA 3C4QA 4IAOA 3JALB 4YBRA 3RHFA 3U7QA 3WGYA 4ACAA 2DT8A 3TPFA 1G20E 1JEYA 2GM4A 3PXDA 1PJSA 1XUOA 5K0JA 1QK3A 1XA4A 1NN1A 3R5TA 4UREA 3V4VB 2G25A 2XB6A 1IJBA 2O05A 1IY1A 4NTZA 2H11A 3KU1A 4KXMA 4HLNA 3ESCA 4ARZA 1VSUA 3L8CA 1HT3A 4RSMA 2GPAA 3RFXA 1PFUA 2CY0A 3USCS 2GJ9A 1J09A 1ZKDA 3BBLA 1YD7A 2IZ5A 1TPYA 1ZRSA 3WL8A 3OVMA 1Y6ZA 2W6CX 3Q7QA 1C7QA 4UPDA 3SSOA 4CQNA 4TTJA 4K28A 3S0JA 4E1AA 1F3OA 2GI4A 3OF2A 1WCV1 2EKQA 3GJ6A 2BGMA 1JG2A 4ZVPA 3WQSB 3M6LA 3R8XA 1UEXC 4QYMA 1SNYA 1LDGA 1Z13A 1D2RA 1F8GA 2JI6A 3OOSA 3PV0A 2F17A 4WECA 4L9WA 2EGGA 621PA 4CCSA 3CMCO 5KYUA 2V7QA 1CJTC 5EMJA 1UEJA 4MI6A 3FYCA 4C7KA 2B78A 3A9SA 1VBKA 3KJZA 4QYWA 3LPCA 4FT4A 3KQMA 1IVNA 1PWXA 1DTSA 1HDCA 1QDLB 1VE5A 3PGMA 4D57A 4BTEA 4GPIB 5AW8A 5BMVA 2JD2A 1YBHA 5TGZA 8LDHA 2I3AA 3GFPA 2Y9PB 2XQVA 2B4QA 1XL0A 4I1OA 5BSHA 3HWSA 1Z4NA 4O2BF 4PXYA 4ARAA 5JAPA 4UQLA 1CVIA 4MS4B 2HZBA 3OFVA 5FOVA 5KJFA 1TXGA 2I7VA 3BDIA 3D6HA 1MU0A 2QG4A 3GMTA 2OXCA 2AH5A 3INGA 8ATCA 3Q3IA 3A2NA 1ISIA 5TVGA 4EB6B 1M2OA 4ZOAA 2I3GA 3UAWA 3PDJA 1QE0A 1Y7TA 2FYTA 4DG8A 2DJ5A 3E18A 5FYDA 2FSPA 1P18A 4A6PA 3B7WA 3HYCA 4HZUB 2R2AA 5EXPA 5COAA 4W6ZA 2DR3A 3A9WA 2JFPA 2G7ZA 5CFNA 2YHSA 1TMGE 3KZ1E 4HAUA 5I7OA 1CLEA 1AV7A 1FMTA 3AIKA 121PA 5L9AA 1K7FB 2GZHA 3KKEA 3NS7A 4ALKA 3FLBA 2Q2OA 2FB9A 3NETA 5CB6A 4B3FX 3RBXA 4OGLA 3WLJA 3A9TA 3VISA 3LOUA 2H3EA 2HUPA 3UWSA 1ND5A 1C2TA 2XRMA 4TTIA 2V9CA 3EH2A 1T1IA 4IJ5A 5AJUA 4LF5B 1NHGA 1F1JA 3HKEA 4OQZA 4D8XA 3LUPA 4Y1FA 1MGPA 2WVGA 1EEHA 1LNQA 3UMCA 3W2FA 2NP7A 2V98A 3EVNA 4L4ZA 2ZRHA 4H3VA 5FQNA 4CCWA 3JX9A 3K53A 1EFKA 1QDEA 5SY9A 3RVMA 4XX0B 3X1DA 2I2AA 4MW6A 2OXFA 3N5KA 3L0BA 2GDZA 2CLEB 4L3OA 3X1ZA 1BEZA 1TX4B 3EDQA 2G07A 1I1NA 1L5YA 1U3UA 1EFDN 2RHHA 3DVQX 4YCBA 5FH9A 3HL0A 1H9BA 1P3Y1 3Q6NA 3RRJA 3U6BA 3F4LA 3FRJA 4AP6A 1T8RA 2CDNA 1WZNA 2P9QA 4CCYB 1ESNA 3QKSA 1YL5A 1ZD2P 1VJ0A 2LCFA 3HPRA 4M1YA 4TWAA 3K0SA 4G67A 3C7DB 1G55A 4Q05A 5K4AA 5MFPA 1T5DX 1MPXA 4YI5A 5KREA 3HUEA 1J8QA 2P62A 3JYPA 4N3GA 2DY0A 5TR9A 2YFYA 1YJCA 4P7BA 3U1VA 5B3AA 1ZX1A 2CSXA 2YY7A 1U02A 2ZAYA 2ZRGA 5CMLA 1MB2A 3G17A 3JZAA 1G7SA 2HT6A 4HYEA 3AT1A 4HEA1 4BP9A 3VU0A 1XEWX 1YR9A 1ZRMA 4ZJPA 1KZ7B 4L1KA 5AM4A 5CFZA 2PE5A 2LIVA 1T0BA 2VQSA 5LN1A 5AP9A 2XT6A 2WJHA 1HFKA 3C3MA 3I5XA 2H7YA 3RGWS 4KTTE 3LV8A 3K0CA 3IEUA 1SD2A 2QL7A 5TPZD 5J5CA 3VU9A 3WGZA 3T9AA 4QJ4A 3AZQA 3RS8A 3UGQA 3GUUA 1N7GA 4HP8A 3NHKA 2RK3A 3FGZA 7REQB 3HRIA 1KDZA 3BCRA 4MSUA 2YZNA 4HRVA 1B3RA 3CUSA 4FFPA 3WYGA 2GH1A 1QRDA 3GJ8A 1XBTA 2WWWA 3OT1A 4CM4B 2F3QA 2GBPA 4MWZA 4O59O 1YA4A 2WMNB 3C45A 2VDVE 4NZOA 4OHRA 3WLHA 3OFSA 1G8KA 2C4KA 4N0EA 3U13A 4D41A 4QULA 4OOEA 1KPHA 1M6NA 4DG5A 4E51A 4F4HA 1QXSA 1IHUA 3ILSA 5BNIA 2HK7A 3TS1A 4HDRB 4RVNA 4RH0A 3OO1A 3SQNA 3ONWA 2IPXA 2BHSA 2JGDB 4CZ2A 2AX3A 2Q1TA 3ABSB 1F14A 3M33A 5B7PA 2GNPA 1NXPA 1TA9A 2ZUEA 2Q3BA 2W83A 1U98A 1UT6A 4LYDA 5EQTA 2QR2A 5BOVA 1A72A 3X0DA 5CD1A 2Q4DA 1U2ZA 4NJEA 2NG1A 3ZWQA 1EP9A 4AN1A 3LECA 4QYIB 2A1TS 4QBFA 3RTCA 1ODLA 4W5HA 1VXRA 4P3NA 3CQ9A 5FX2A 4L4YA 1WXGA 3WQQA 3N58A 3O4VA 2ORIA 4FDLA 2ENWA 1IOLA 1BAPA 1Z0FA 1T0JB 4XQ9A 1KWKA 3KLMX 1A1VA 1OFIA 1G0OA 1V11A 5L40A 4KPEC 1SUIA 4QUDA 4AZ3B 2H2WA 4IOJA 4YJDA 3KJGA 1QKKA 4ZC8A 1GTL1 3PT9A 4JKIA 2YX1A 5EYPB 2Z5LA 1M66A 3O21A 4BE4A 4IX9A 1KHHA 1XKLA 4P8RA 3ILVA 4P08A 4XPIA 3ZE7A 1NL3A 2QVLA 1J8YF 4L4RA 5IK2D 3UOGA 1T4CA 3PFIA 2XKAA 1V3TA 1HUQA 4CLXA 5HWSA 5JISA 3Q5EA 4MZXA 1U5BA 2VRCD 2NYAA 4ND8A 5D3QA 1DXYA 2YJ3A 4Z99A 4JLVA 3S5UA 4GXRA 2YIVX 4IIXA 1IBMB 2A9FA 3MZ0A 1OASA 1ELOA 1CRZA 3TQOA 4CV3A 2YZGA 1QP7A 4XR9A 1JMVA 1MABA 1PJ8A 1S8OA 1Z88A 3KOZA 4DRXB 4M21A 3M70A 3HZHA 3ASYA 2MSLA 3OLQA 3SHOA 5L95A 4O2AB 1WUIS 2JI8A 4KMSA 2IHNA 1S01A 1HFJA 1TJ4A 2E89A 2FEKA 4C0BA 4E07A 4FILA 3QVMA 3TM5A 1Z5UA 3BIXA 4RNCA 1PDWA 2PQ2A 1IEQA 1W85B 1IPEA 2ZIXB 4P5PA 4BFWA 1FE8A 3WKDA 1ORDA 2QL9A 1JXOA 4UFPA 3AQ4A 4MRAA 1H1TA 3J7TA 3D6FA 3MM4A 1XMIA 2JGMA 4MP3A 5JJBA 2DH6A 5C1OA 3IR7A 1ORRA 1OLUA 4K3VA 1KTVA 4YMWA 2F43A 4QDZA 1E0JA 3BWVA 3N0XA 3E53A 4XXHA 1AQYA 4LRWA 3T3EA 3LQFA 4GQBA 5K8TA 3TMKA 5IC4A 4NXNB 1YQXA 4GYWA 1F38A 1KJQA 1AKWA 1SXJA 3FFAA 1XZCA 3AUXA 4RAOA 2JIZD 1DBIA 3SOZA 5AI5A 2A9RA 4DIUA 4EFKA 3ZLVA 3QMMA 1KZHA 1UXIA 2I6XA 5LDDC 5KYWB 1SXJE 4ZTZB 1DCMA 1LLFA 2ZRJA 4E14A 1KORA 2O19A 3HADA 3MNFA 2PMBA 3BSFA 3LUFA 4PLPA 4QNRA 4TMXA 5AYVA 2ZATA 3GFVA 5K8IA 2XWBF 4GGMX 1LBQA 3ND8A 4IX1A 4XPZA 3TEMA 4D4IA 2VJMB 5BW4A 4KPYA 3FOCA 1ZH8A 2HUNA 4X0EA 1VSBA 1OI3A 3MJSA 4JC4A 4N48A 2WWYA 3TTXA 1MVNA 4PANA 3SXUB 4MP6A 5DM1A 5DLQC 2J6IA 1O0CA 4C7VA 1C30A 2NTJA 1M0WA 2VCYA 5HGXA 1NOJA 3WJ7A 1QCZA 1RXIA 1EUZA 1JEQB 3KOYA 3NV7A 4BLWA 2JG3A 3JVDA 4UHCA 2G36A 4D44A 1WLYA 5K0SA 2QSYA 4AWAA 2DFDA 3H9UA 4HKTA 5CX4A 2YOHA 1TT5A 3HCRA 4AICA 3V4RA 3HKCB 3VHXB 1T3SA 1CEXA 3QBJA 1TVEA 1FZTA 4PHHA 4D8UA 3RWOA 5F78A 1CQWA 5LYYA 1TCCA 4PYQA 3T1QA 5CM9C 5KU1A 1I13A 3BYZA 1I3KA 2BDUA 1WDTA 1NVWQ 1L5OA 1ULAA 1EHYA 2B9EA 3FPHA 4KWCA 5FPYA 3ZWBA 1TEVA 5EIBD 4MWEA 4C01A 1F4LA 4ZVTA 2EL9A 3C0KA 4ZEOA 1LDEA 1UFQA 1SQGA 1GAXA 4EVQA 1H94A 4C0WA 2QVZX 4NU5A 3WB2A 4GNRA 4UOZA 4GWKA 4EF4A 3ZV6A 2FQQA 1J1ZA 2OLKA 4JLNA 4YRFA 4D46A 5TB5A 3AKYA 2WUWE 2OXIA 4DXHA 1UDWA 1VLMA 1EVYA 3HM2A 1S7CA 1DO2A 2AB0A 3DMNA 4PPGA 5B3LA 2WICA 1MV8A 4B4UA 1KBZA 3OZUA 1XD9A 5F9FA 4FSXA 4BZXA 2EX1A 3OJEA 4M55A 5ADUS 2ON6A 4DDUA 1N5RA 2DHQA 1GKKA 1HLDA 2WABA 2AXEA 4E1VA 5CIYA 1KSHA 5ARDA 1RIIA 5GGYA 1JU3A 1FFXB 3F5DA 2W6MA 2MOKA 4AMVA 2F00A 1K8ZB 3HMKA 3ZHVA 1ODFA 1UZLA 2UUOA 2OWDA 4OHWA 1A97A 2JFQA 3FX2A 1WHTA 4QQFA 4JLUA 4BN0A 2JKVA 4HEHA 4JX9A 4TYPA 3L4JA 4MIEA 1JXMA 4JYCA 3PF9A 3WL4A 3W3AH 3W05A 3EA0A 5DTIA 5C3UA 4DILA 4JI0B 3FPBA 3K96A 3O84A 2CVHA 2F1IA 4US1R 3HDVA 1EGQA 4QODA 2KB0A 4UNQA 3H84A 3QV1A 2N75A 2ZBGA 4E3WA 3GELA 2J4DA 3AOEA 1WVIA 4UAUA 2QNBA 5YASA 4URXR 1XTRA 2BHLA 1QCDA 2BT4A 1QUFA 2YZMA 3P9RA 4JU8A 2YN4A 2QM7A 1XRLA 1H2AS 1L5VA 1T8UA 2JGJA 4FN4A 5AVUA 3BHNA 4TQUS 5I6DA 1QU2A 1O97D 5KNCD 2MJLA 2CNWD 3MGKA 4F71A 3PHJA 1XLUA 3KKNA 2Q28A 5LLSA 4TTAA 2JIQA 1U0FA 3NFYA 4RHCA 3QG1A 4PGGA 4WLNA 2X4LA 3BXEA 5CLLA 4YCJA 5FWYB 4U7DA 2SICE 3AKCA 3QYAA 4D25A 2ZT5A 4ENWA 4U7GA 2OL4A 3CO5A 4YJ2F 3M4JA 5JDCA 2B1IA 1FSPA 3UFXA 1X9IA 5ESDA 5FWXB 1KZYC 1VIVA 4TKUB 3SS9X 4YRMA 3OJFA 1AHHA 2JAWA 2PJZA 2XRFA 1J2RA 3RG8A 2XITA 1B0UA 2IHYA 3LFHA 5LLDA 1OF1A 3ZV7A 3GJ3A 3SAJA 3FPLA 2C96A 2PS0A 1X92A 4YY3B 3REQB 1U0NA 2ZJ1A 5A9TA 4CIWA 4DB2A 2BR4A 4WY5A 5F12A 1FRZA 3UZUA 4LAFA 2HDHA 4UUQA 2D59A 4X7PA 1HZZA 1J8DA 3FCOA 4DCPA 3LXMA 4MGYR 1BDMA 1VG1A 1LQ2A 4UZEA 4AKGA 1M2VA 3ROPA 1E2PA 1JJIA 4CN8A 3K5IA 2ZTLA 1OHHD 2BJWA 2KS6A 4Z9AA 1AKTA 5FWNA 3DZ8A 3RJ9A 1WM1A 3H83A 1M1YA 3JQQA 2CNWA 3GEBA 3ZGVA 5CT6A 4EEZA 1FJ2A 1YVEI 5EKDA 1GLVA 2RKWA 1JLKA 5IT4A 4Z4GA 1TMKA 5A7FA 1N4DA 1M1YE 4JNKA 2LWIA 4GDMA 4PZAA 5I5GA 5LMCA 4A1OA 1CY2A 4IH1A 5BV0A 1UJNA 3WNDA 2AK2A 2DLDA 3ICVA 3B3QA 2HBQA 4AJKA 2I4NA 4DMHA 4O2BB 1GZHB 2BMWA 2IYYA 4HUQB 1NE7A 4BKUA 3ELBA 3R2JA 3TVDA 4D45A 4TV8A 4IEFB 4UXIA 2V4ZA 4NV1A 1BRTA 4WXYB 1OA1A 1WCYA 3EVFA 4BEBA 2NADA 5HRAA 4CEJB 2QRPA 3R3YA 4D9NA 5K0NA 4ASUD 2JKYA 3PUYA 2VTBB 4KQHA 5TT1A 2CNBA 4Z9BA 4U7TB 3SC2B 3O4GA 5JCXA 2NQ2C 1MFPA 3BMCB 3U09A 1I3MA 4O1HA 1OHHA 2X0KA 4ERXA 3LX6A 4DA9A 3ZDBA 5F7XA 5IXYA 3PFFA 4HS9A 5U4XA 1W88A 3GBVA 1L4GA 3C5WP 4G97A 4E5YA 4G84A 4KNYA 2HV8A 3OF3A 2ZGVA 3DPSA 1JRLA 1P5JA 2QTTA 4FFRA 4ZODA 4JI5B 3RUIA 1N6OA 2ZQ5A 3WWYA 2NSDA 3ZE9A 2G7MC 4GKVA 4U7FA 3SHWA 3VR2A 2XKKA 2OESA 3OEWA 1NRWA 3FPGA 4IFEA 5IT0A 2O8FA 1FP7A 5BSGA 3SEQA 5HTOA 3ZNPA 1M7HA 2HA4A 1RYZA 3A1UA 1QHEA 2J6CA 2GN4A 1RBQA 2XVXA 4G0PA 1K0UA 4KQMA 4N4AA 1R9GA 3TLXA 4IMRA 2I33A 4EI8A 2GVNA 5FTLA 3D8BA 1ECJA 5J2TA 1JIKA 3OZDA 1TNDA 1FPQA 5DASA 1HK7A 3GJ5A 5HFJA 5CURA 1GVNB 4JWTA 1BQEA 1TUBA 1U0RA 2H29A 2AMVA 4DQDA 3COJA 4EJSA 1EM6A 5JJLA 3K8QA 4NWIA 2X42A 3P9ZA 2MWMA 5DO9A 3CUYA 1KAQA 2A9JA 1OD6A 3IAEA 1OILA 2XMZA 1NBOA 3OTQA 2HY7A 3K0BA 4LRTB 5H9VA 2VP5A 2QRNA 4ZEXA 4OJMX 1OFVA 5CAEB 4D2IA 4OBBA 4MZDA 1OB2A 1UT8A 2QPOA 4HJXA 4LXHA 1KIMA 1SBYA 3C1AA 3UJ6A 3TVYA 2O23A 5K5EA 2P90A 5DM2A 4FOPA 3H9JA 1I2DA 4HX9A 5FBLB 1Y80A 2AZDA 4QXPA 3AERB 3ZWKA 5C37A 4EX7A 1ECBA 1UC8A 4LE0A 3NDJA 3CE6A 1GZDA 3DE5X 4FDMA 1DTEA 1E9AA 3FOBA 4JGIA 2G9RA 3QHAA 3T5PA 2OECA 1B8OA 2HQOA 3AUUA 4UNNA 4IDCA 5HIMA 1WMAA 3ZC3A 1NYRA 4GC9A 4HPXB 5DF1A 3DHNA 5KJCA 1T6NA 3EXHB 4GSKA 3EOZA 3FDIA 1RPNA 3G85A 3KM0A 5MGNA 4LGVA 1FFEA 3PLRA 3GRPA 2D2FA 4GZ3A 4RY2A 2XJ9A 4OU5A 4TS1A 2C20A 1JLLA 4M1OA 3ROKA 2P5UA 4X44A 1PS8A 3R0XA 3GUZA 4S1WA 4X6XA 5AHOA 3S6JA 4F2WA 1ONBA 2O50A 1FFAA 4KBFA 4GDFA 4I55F 3WR5A 2ZZMA 4NBVA 1GGNA 1UPCA 1NUHA 3OICA 1ZUIA 3LFUA 4CYMA 1T29A 2EP5A 5JSFA 5JS6A 1NLMA 5D5QA 3ZZ1A 2GEBA 2QR3A 2VXBA 3UJAA 5BRJA 1O3YA 1Z2PX 4P84A 4DGQA 5J23A 3VZQA 3CW9A 2B25A 2E6UX 5DNWA 5LQRA 3K3PA 2IU3A 2B1GA 2JAOA 3QSGA 1JSXA 5FOWA 1X8KA 4AJJA 1M8PA 4EFDA 5EKTA 1J2TA 3FB4A 4TKZA 4DHWA 5AW4A 2CL6X 4B6EA 4WBSA 1YFJA 2G1KA 1BXGB 3GJ0A 4HDQB 1J0AA 2BEWB 2QLMA 3Q40A 3SI7A 1A2OA 4B82A 1Q0QA 5J5AA 3QPDA 3V4SA 4F2HA 5C5CA 5JQWA 2ZTMA 1GUBA 4MW9A 4EW3A 5KOIA 1X0XA 5GWXA 1PJ3A 2WD7B 3CZPA 4AZWA 1LF0A 1T9AA 3IIIA 4FW9A 1FA9A 4IDGA 5DIZA 4NSNA 4YUZA 2XBLA 2DT5A 4ZOEA 5AOCA 1JUDA 4BGEA 2BGIA 4RVGA 1SC4A 5CIWA 4M86A 4X3CA 3TKAA 3UJ8A 1KL7A 3WISA 4ZO7A 4YRAA 5C8ZA 4MV1A 5EZSA 1DIBA 1ES9A 2ZIGA 4WVFA 4OIFA 5BNWA 3KTAA 2ZRPA 2F3UA 2YWFA 3R74A 1QFYA 2JFNA 3E4CA 4MPTA 5CA0B 5DRYA 1KDTA 3OIUA 5G3ZA 2OZLA 3DMYA 4U8GA 3ZDCA 4BUJA 3G9QA 2ONZA 3L6CA 4EI9A 1W4ZA 1NLYA 2W2OA 1D6SA 3A9CA 4FHDA 5L3SA 2CBXA 5K0BA 4PXAA 1FRFS 1VRCA 3TLKA 2OB2A 3A3YA 3UV7A 2DPHA 3C1UA 1MO6A 1NULA 1U0SY 3HA5A 3UTCA 3F6RA 4AF6A 2QSZA 1T26A 2D00A 1W0KA 1NNEA 2GYWA 2QXTA 5F5LA 1H2EA 5C7OO 3QKTA 2NT3A 2FGJA 1R4AA 4HQ6A 1REQA 4JKYA 1JXQA 2V5AA 3H5IA 3ZY3A 2WKWA 1H2HA 4N3CA 1OXKB 1PQWA 3PUZA 3FCUB 1XYGA 4QYTA 1RQNA 5JV5A 3DAOA 1WY5A 5GY7A 4CMKA 4Q19A 2QKYA 1T8TA 2P9GA 3DQQA 3PPYA 2A84A 2FP3A 1XHEA 4GYYA 4WCFC 3T3HA 5F21A 1TTPB 3TQHA 1SEPA 3KHSA 4QU9A 4S04A 1QUEA 2R8RA 1Y7LA 3MJEA 1W87A 1QBGA 2ZU6A 3GVXA 1U3DA 2CLDX 4FINA 4J3FA 5FCDA 3RVKA 3QTTA 4AYXA 1N0UA 2AHRA 3G59A 3WYDA 1H0HA 2X0NA 1MT0A 1BC5A 2B4TO 4JROA 4JVMA 1VOTA 4RESA 1QB8A 1QV7A 4ESHA 1Z0JA 1CRPA 2ZQYA 2V96A 3K16A 1T6ZA 3NIGB 4LYAA 2R65A 4FJ1A 2L2QA 3OQ1A 1NQTA 1UWVA 3Q3VA 2ZPAA 4ZI5A 4EPTA 4H1WA 1UADA 1WZUA 2PSFA 5JWOA 5CVEA 1EA5A 3B5JA 4OM7A 4J9UE 3FSGD 5A04A 2AWNA 5IM4F 2P3OA 1R16A 3CW8X 2VPXA 3I2JA 4M8SA 4N5IX 5H4HA 2O2XA 3SKYA 3TBKA 4AJOA 3WWPA 4B4KA 4ENRA 4KMRA 4KYVA 3RUEA 2X9QA 3RRYA 2C9DA 1RD4A 3U7JA 3EISA 1V45E 2IEBA 3WYEA 3QMPA 3OKAA 2FPIB 4R54A 5FPTA 4ZEMA 3G8YA 4H1HA 2GHTA 2GSDA 3MB8A 3ETDA 4XWGA 1XR3A 3S7ZA 3HJHA 4D42A 4EA7A 2HWKA 3AV0B 3FXAA 3H3JA 5D2CA 3EZYA 4RZIA 1HT2E 3PGLA 1IZ0A 1DBPA 4L7QA 1V39A 1QB7A 2PCJA 2WFZA 5TDHA 1W1WA 4MULA 5ELLA 2ABWA 1H8HD 1T13A 3KTDA 3NVKI 2ET6A 3B7PA 4B7UA 2CLFB 2NP6A 2RE8A 3DGFC 4FKZA 4BIMA 3GG2A 1PLKA 2J3MA 2V7PA 4QXAA 1P9NA 4FYPA 1FFHA 1PZFA 2IDJA 4BX3A 2G1PA 3SHVA 3AGQA 4A0HA 4DR7B 4OH7A 2HRZA 1OXUA 3EMVA 3PPXA 1FOEB 4D5GA 4NCKA 1RT9A 4X84A 5AIAA 5KINB 2JGAA 1B8VA 4M36A 4U9IS 1TM1E 4LOHA 5KTTA 2Y66A 4QOSA 5HF8A 3HVKA 3RAEC 1IN5A 1DINA 1QP8A 5CYPA 2EZTA 4K88A 5LP6C 2GN9A 1ZL2A 3TIVA 3M4NA 4LHSA 2GCEA 2D0OB 1PWHA 3RFUA 5JYDA 2N0SA 3EDOA 1G6KA 2F8LA 3PZBA 4MQEA 4MYUA 4Q48A 1KZGB 5EUMA 4CQMD 5HKAA 4LV5B 3L2OB 2Q21A 4J3JA 3FR8A 4RHTA 4U6NA 2Y0EA 3CKMA 8MHTA 2HQ1A 3FNQA 3PICA 1JQAA 2JLZA 1DXHA 4R6WA 1MKYA 4W1RA 5I7WA 2J07A 4QEDA 4RIEA 3ZLBA 2JEYA 3SM9A 2QN2A 3V1NA 2VP6A 3OWXA 1KDVA 3OE1A 3M4YA 1CVRA 2EZ4A 1J2EA 3AYXB 2QRZA 3TLZA 4PZ0A 5DN9A 2FUNB 3RKSA 1Z0IA 4INAA 4LA4A 2EW1A 2ZLBA 5AI0A 1N5KA 4M8LA 3LBHA 1QIIA 2I71A 3BKXA 3PPVA 3SG0A 4QOIA 3SX0A 2KSQA 4LMBA 4IWYA 5EIBC 1Q2UA 4QJIA 3SYTA 4E08A 1NXQA 4EUKA 4REMA 4CF3A 5CH5A 1MOQA 3D5EA 5DBOA 3L3BA 3AOEC 4DIDA 1R7RA 2FVYA 1BN7A 4YXFA 1L3CA 4IXNA 5DYIA 4EY8A 5KX5A 4UBMA 1RPAA 3GYBA 4UJ5A 3QEMB 3QKUA 1QZTA 2GEUA 2X1LA 1JR3D 4NNOA 4C07A 5BOSA 1W8IA 4TL9A 4P7FA 3WFZA 4P7GA 3N2KA 1E1CA 4D8TA 4GI7A 2B5OA 1D4ZA 4ALIA 5CU7A 1Z35A 4MVJD 4LSZA 3RC9A 5IU6A 4MWTA 2X0JA 1J5XA 3G2MA 5GP1A 5JDCC 1J20A 1P2GA 5K0ZA 1DE0A 1H0RA 1VI5A 1YMQA 1QTIA 3QY9A 5EMNA 4ZQFA 2I7CA 1YDEA 4U2KA 1QV9A 4CM8B 3LVRE 2FZGA 2EV9A 1CK4A 1XU7A 3UOWA 4B6PA 1GUFA 2OAQ1 4Y67A 5A05A 4C78A 3RIXA 5ITSA 3EXEB 4HWOA 3I01M 1BEUB 3LT4A 3T1OA 4EKGA 1J5EB 3R7LA 5KOHA 1D2CA 4F9FA 4GZ5A 1BD4A 2O1XA 2NUTA 1ULBA 2OCLA 3NXKA 1HZZC 1YJ5A 4JT8A 3FNFA 3PDCA 3KYDB 3L4SO 1C1HA 4DJJA 1LPOA 2FGKA 3UG6A 3BTUA 3C24A 1DKNA 4ZZ1A 4EX6A 1YBMA 5CH8A 1E94E 1N0WA 1TO2E 1W19A 3PUHA 4YJ2B 4BV3A 3L5OA 1IZ9A 1T2NA 4QC2A 1JR3A 3UPUA 1O97C 2PLAA 2PZLA 3AB8A 4J7XA 2RGEA 4RV5A 4IJWA 3BCSA 1PFYA 4LOJA 2GZ1A 1W5SA 1Y63A 2C58A 2FKNA 2Q5QA 3BF7A 4HWRA 1UXJA 3I6IA 3UW1A 5F7JA 1JR3E 1N7JA 3E35A 3L77A 4Z8YA 2HA7A 3GLGB 3DDSA 4CMHA 2C5AA 2DMRA 3BRCA 1KMHA 1KEVA 4OJNA 1B43A 1QLHA 3IAXA 4EUNA 1R0XA 4QBGB 1MJGA 3H4IA 1EQAA 1UFKA 2XDAA 3N75A 4UAGA 3PFNA 1XAGA 1IY9A 1Z8FA 1B73A 2NO4A 1CD5A 1FVFA 1RLIA 1XWWA 4B8WA 2GA9A 5K45A 1N1DA 4Y2YA 3GRAA 1Z4LA 1Q1NA 2MTBA 3HUFA 2BMFA 3RF7A 5J47A 3QMWA 4G1FA 1V5GA 3V6MA 2D2XA 4G2NA 4WEQA 3K9GA 4BNNA 2F55A 1RKVA 4NMMA 2P0EA 3E5NA 2ZVDA 4YDHB 4EHFA 3MPOA 3NQ41 1H6CA 1LDNA 5JROA 1U28A 3P0IA 3UJ3X 1NSFA 4JBNA 4FS8A 4WA7A 2VOEA 1NXSA 3BIOA 3UT5B 1SBHA 1QRRA 2UDPA 5LIRA 4FFBA 4AZ0A 3DT6A 4AJ4A 2WRZA 5JXWA 1RI1A 4OJTA 4R3NA 4OFZA 4A10A 3Q12A 1GG2A 2PT6A 1QFZA 2PXAA 3JQRA 1YOBA 2PD4A 3LUAA 3R4VA 3FFBA 1KO5A 1XCGB 3H11A 3C8DA 2FEMA 1T5TA 1LPBB 4WOPA 5AH0A 3RIMA 2JCGA 1IWOA 1L4HA 1UBOS 2KJQA 3X1MA 1T4GA 2O2YA 2VDWA 2NUAA 3NAQA 5C9ZA 2WMYA 2W48A 1BX3A 1CE8A 3D1JA 3W2GA 1N32B 4TL7A 5TARA 1MAAA 4KV9A 5CRIA 2JFXA 2P0YA 1JFRA 1YE3A 3D8HA 4PG7A 3TGPA 2OCBA 3BJZA 3RQSA 4J0HA 5AK6A 5BYJA 3D8TA 4NRDA 1GM5A 1HT1E 4OI0A 2ENUA 4E2XA 1K63A 1RR6A 2RKBA 4K8OA 2KYRA 4JQYA 1N6KA 1ESDA 3KJEA 1GITA 1Y1LA 1A5AB 5CPBA 4DV5B 1U1GA 2TMYA 3AKZA 2CJXA 3TMYA 3GDHA 1ZIXA 4NOLA 1Y1TA 1KH1A 1UKZA 3EQ6A 1PV2A 3IDQA 3LWNA 3H6HA 2XE4A 4BAUA 3PFKA 1O95A 2C0QA 1KYYA 2BE7A 1L4BA 4KCGA 5GM1A 4B9AA 2D13A 2PLFA 4TROA 3PC6A 5FRDA 3C1OA 3T0IA 2H7XA 4OH1A 2AZ4A 4I50A 3UG7A 4TL8A 3UK6A 3K09A 4Q01A 2O5VA 5JH7A 2YHIB 3EOAI 3M82A 4UEWA 2Z2ZA 1DHRA 2X13A 1ZFNA 1UFVA 4N7MA 2XWQA 3TW6A 4E13A 4BDSA 4RTPA 4TUYA 4X91A 5EE0A 3EEYA 1Z7WA 1UZUA 1FJGB 4WJKB 3H87A 1M6EX 4TM7A 2G77B 5BUSA 3G5AA 3OD1A 4IJMA 4D97A 3OCWA 4MKXA 3RRMA 1JYEA 5A5VA 3HCPA 2YJZA 3NXSA 3Q72A 4DCNA 4RTMA 2HT1A 1USKA 1DJMA 2BEUB 1UBRS 2RJ3A 3K5PA 4L0DA 1CYDA 1H6BA 2OGUA 2WWXA 3FVTA 4PVCA 4B7XA 4ZI7A 1M9NA 4Z4FA 5HF9A 2F9MA 1R64A 3DBLB 2YWCA 3KKKA 4BGUA 3DHYA 3SYKA 4NYIR 1VYVA 3DFUA 1N2SA 1SBIA 3BXGA 1VLZA 4NCNA 1ZD8A 4FSHA 4WLFA 1E20A 3FBGA 3CXRA 2R8BA 3CRMA 2UUPA 4I3FA 1MX3A 1VPWA 1XLVA 3NYQA 4BX0A 3DDOA 1G8YA 1GNVA 1GV0A 2QUIA 3LWBA 4F9EA 1UJMA 3FTDA 3DW1X 4YCMA 3ZWWA 2I8CA 2ZSKA 4B3XA 5SZIA 3QF7A 3JQBA 1XMVA 1XCOA 4IOMA 2HJHA 3P97A 1OI4A 1B0PA 1XCLA 4NICA 1SQ0A 5COBA 1XEFA 4YNBA 5K3FB 1FU8A 4K6HA 2GWHA 1WOYA 1XZBA 3G2LA 2BM0A 4HSEA 4GMHA 3AR5A 3W2HA 5SY4A 2CZCA 1IN8A 2YWGA 3O47A 4I55B 1ETUA 1S8FA 2IY8A 2WDPA 2RB5A 1H42A 2QN8A 3GIWA 3IO3A 3O3OB 1PZGA 1K5HA 4GX2A 1SWWA 3HJTA 3DTVD 5BVGB 5K0CA 3AJEA 1UF9A 1UWKA 1U2RA 2W2KA 2FMFA 5FPHA 4CQLB 1ULTA 3M49A 1BVYF 4G1EB 4PGAA 5CBKA 2CVQA 4ZXFA 1KOJA 3RSZA 3IHTA 3AEKA 1QG4A 1YVRA 2V03A 3TQCA 4JJ6A 3U4HA 2HA6A 1OFGA 4GMGA 4V0OA 1YGYA 1EFRD 1T2FA 4JA0A 4JBHA 3MIIA 2AI3A 3WYNA 5LQCA 3GU3A 1BMDA 2OO5C 5KI6A 2I34A 3HCWA 1W30A 3TL2A 4JBIA 4RTLA 2WIGA 3SF0A 5F73A 3HYRA 1PJ4A 3AG6A 3HBFA 1M74A 2YV4A 2PVPA 4UHHA 3AHJA 3OP4A 2XTJA 2TMGA 5H16A 5FPKA 5DBHX 2WTMA 1I4TD 4Q3AA 1C29B 1X7XA 2QD4A 3HXPA 3GCDA 2QTLA 4RA9A 2ST1A 3SC4A 3N3BC 2TMDA 3WK6A 4E09A 5BW8A 4ZP1A 3LX8A 1YS4A 5A5EA 3FVVA 1JBKA 1YQUA 2RFLA 1GU0A 3IKJA 5K6AC 1P4HA 3A8TA 4PPFA 4KLAA 1XROA 4RFVA 3RWMB 4AZSA 3IGFA 5I7RA 2VNSA 3KG2A 1G3UA 2DTXA 3CCCA 4XR4A 1HKHA 2VK8A 1MEOA 1S3FA 3WB0A 1NVXQ 3K2BA 2DP4E 4ZJYA 2H1RA 4K1LA 4Z4HA 4YRCA 1XP5A 3LCUA 5EHZA 4JK3A 1TCAA 1BDBA 2GERA 1EFUA 3GH1A 3QYJA 3VC3A 1SKMA 5HFNA 5BSTA 2VCHA 1O94D 1VI2A 1HRKA 3KT3A 3FUCA 5H7XA 3U1TA 2WAXA 3VSCA 3AFOA 4U2GA 5IBQA 1VLJA 4RKQA 4KQGA 2WHEA 1A7UA 3I9MA 1GGEA 4GECA 4AJNA 4ZQCB 4J3NA 3QVOA 2B2NA 1WRBA 2VZ9A 2IXTA 3CNHA 1TIPA 3OOJA 3PJGA 5FYQA 1GGHA 3NAGA 4YC7A 3VSAA 2WF6A 3LP6A 3D02A 5DWDA 1Q91A 1U7PA 3OZCA 3ED1A 5BRNA 4Y2HA 1YAHA 3ELWA 4QGAA 2YCBA 5ESRA 4UPEA 4NVRA 3IXQA 4JH0A 4UASA 4HDNB 5DCWA 4CDNA 1ZUD1 4LGYA 1T0HB 1E4OA 3BTVA 4FMDF 1LTHR 4TM8A 4AULA 3ZHUA 1SUSA 5KVSA 4PX3A 1ZN8A 3QWIA 1LPAB 1Q1ZA 4EHLA 1OSNA 3FMOB 3LHFA 1YB1A 2XIQA 1YQDA 3GJQA 5E1OA 4L50A 5CBPA 1E2IA 3HCBA 3R6LA 3RHTA 3WDSA 3WP1B 2HBRA 1UJCA 1GSAA 1OC4A 3JVVA 1N5IA 3FPJA 5IW8A 2KI5A 3CZRA 4BB5A 4B40A 4CMAA 2WIJA 1G4UR 3C15C 3KXIA 3JVUA 1W29A 3RUHA 3JRWA 16PKA 3F49S 5KQGA 3AEXA 2EXXA 2R85A 1IZ8A 2AR9A 2ZUBA 1MTOA 3R0VA 5JAQA 5TNXA 4AZVA 5BUCA 3CZMA 1IU9A 1EVIA 1XQYA 2Y6UA 1MR3F 3NIFB 3F6PA 4C7MA 2DWQA 2V0CA 1ESZA 1KSJA 2HREA 1W73A 2NUPA 3EIXA 2JH9A 2BFMA 4M1KA 4WERA 3TD9A 4BE9A 4KK4A 1PNRA 2HSGA 1E18A 2ZIFA 4EYSA 3BC1A 1C8KA 1FX1A 4HDAA 4J75A 1X42A 1N2BA 2PX6A 2H17A 4GF5A 1M0SA 2X2OA 3OQHA 1R37A 3Q4GA 1WCWA 2QUZA 4G56A 2WG0A 1NXXA 1ZNWA 3G7UA 3IMFA 5TX7A 3RNOA 1L7QA 3H1AA 1CS4C 1GFWA 5E0OA 3W78A 4W5OA 3GPDG 5TE9A 2ZTSA 1ZRHA 2R96A 3EGOA 4BKRA 1AQIA 2FDCA 1DBVO 1VC2A 3LXUX 3SZUA 3VO9A 3WK7A 2Z3ZA 2W8BA 3M1YA 4Y6SA 1GT91 4RGQA 1SCQA 2A67A 3AHIA 3L4BA 3UJBA 1ENPA 3A3PA 3WJAA 5H5JA 3HE3A 2HLNA 4GXTA 4ENTA 4ZTUB 3DLPX 4JHLA 1SRRA 1YR2A 5BUZA 3PC8C 2H16A 1P6QA 2RHRA 1B6TA 4FI3C 2Q3EA 4BBZA 2K7ZA 2AW3A 4Y6QA 3BCUA 4Q15A 2PD3A 5CLIA 3DO6A 1EUYA 4RHYA 3P5BA 1GCGA 1MAUA 1ZOSA 2PSSA 1Z16A 3PYXA 3HDTA 5KDDA 3HVHA 4LBVA 5M5BA 1E2KA 5GPBA 2OV4A 4ZDWA 1K66A 1WWKA 2C1EA 1E66A 2XADA 3BSYA 3T5DA 2X2EA 1IM5A 3FHJA 4MQ6A 4O1MA 4CFZA 1RWNA 2VDNB 4JVLA 5TY0A 1UL1X 4C4SA 4EGSA 3QXGA 3OQJA 1JAZA 3BSSA 3ESRA 5EJ4A 1DARA 1SCBA 1E9BA 5DOVA 4RM3A 2ZM5A 1ZA1A 3OPXA 4G0QA 5CLQA 3W0LB 2X5KO 5JNWA 3H2BA 4DS3A 1XDSA 3G88A 2QD3A 3UTDA 1GPH1 3OWHA 4MS3A 1VL8A 6NULA 2FN9A 5A62A 2WIFA 3ME5A 5CB4F 4E2ZA 4L5JA 3CYFA 5EKUA 1JDJA 1S7GA 1JFFA 2Z56A 2UVPA 2AHOA 3VM6A 3ZY5A 3A4YA 5KYKA 1HYGA 3CUTA 3KXLA 3DCYA 2M6LA 1JF8A 3KLNA 2HOQA 3NMUF 5K0LA 4DSOA 1WXHA 2C98A 2I66A 2P2DA 3FE2A 4Q21A 4YV1A 2ZBVA 5KB3A 3SZLA 4H7KA 4TWRA 3SYRA 1C2YA 2QMEA 3Q5DA 4EYGA 1IAVA 2ZSJA 2X2PA 2FSSA 2VBCA 3QEOA 4B34A 4X62B 1BN6A 1EXMA 2V54A 1IRIA 1YBFA 4WLUA 2G5PA 2WF9A 4MHSA 3LGSA 4Z54A 5K2MA 2R44A 2A0KA 3KJNA 1LLQA 1NW3A 3IBTA 3PNQA 1OIXA 3W3AA 5EXEA 2D8AA 2XD4A 3NHWA 2J3HA 2PFSA 3QXSA 2V1UA 1QYRA 2R6DA 3C70A 3CM0A 3EVCA 4PYJA 3G2IA 1F2UB 1SG6A 1JALA 2AN9A 3A05A 4TVSA 4L9SA 3WIOA 1M1NB 3I4LA 3LJKA 5TSDA 4OQPA 3TG2A 4FZVA 1NW4A 5EFZA 5CH3A 4Q34A 3UATA 1RRCA 4KWIA 3IVGA 1DBRA 1KKMA 3JRXA 4F9GA 4J0DA 4IQGA 3GLFB 1EP1B 3CN7A 2CNDA 2FDXA 1KSGA 3DWEX 5EHGA 4FHFA 1ZM4A 4JVOA 5JXGA 1E32A 1YQTA 4ML3A 2VYVD 3EQ2A 5DM0A 2QRMA 3KFXA 1E1QD 2Y05A 1NE2A 4IH4A 3BL8A 4I9NA 4LOKA 4YHHB 3R6GA 2XZPA 1I5EA 4DM7A 5AOVA 4CEHB 4G0UA 4OHMA 3H9QA 2FFAA 4QXRA 5EXTA 1JJBA 4PC3A 1U28C 4ENQA 5ICFA 1E2JA 3LL4A 2G5CA 4G4GA 1VJDA 1G8MA 2G70A 3NWJA 1Z18A 4UZSA 4PN7A 2CFSA 3IIMA 1MQAA 2PRYA 1P17A 1THMA 2ZREA 3VZCA 3JQ9A 2ZUVA 4YALA 4F4DA 2C2YA 2OM2A 4HGYA 5EZQA 4GOOD 5L7YA 2ETXA 2K5UA 1NMYA 2NWQA 3KVVA 1E2EA 5ALGA 1GT6A 1BCRB 4P4TA 2I4IA 5IJ0A 1ESEA 1UBLS 4PEVA 4ZV7A 4FFMA 1L4YA 2Q1UA 1P81A 2Q29A 3GL9A 2VFAA 4FDAA 5IMSA 4I6GA 1DQNA 3SSNA 4U2FA 4M0EA 1YOVB 1KO8A 1TVMA 5KVQA 2PQ0A 3LH5A 4GPEA 4BV2A 4MRMB 2W7TA 1LBSA 2GASA 2LKCA 5B6PA 3GCZA 1SO8A 1TQHA 3HZOA 2I6UA 5JSHA 3OA2A 4HDKB 4ZK2A 2JJ1D 2QE6A 2VYVA 5KQRA 4HPWA 3KUDA 4IIDA 4Z4EA 3L0IB 1E1QA 1Z5PA 1V7PC 1C7RA 3SXJA 4EY4A 4ZZ2A 5U4QA 4DEYA 4OXQA 1RI4A 1T3ZA 1Z8DA 1EB9A 3BK2A 1R8SA 1IH8A 5ALWA 1W52X 1UKCA 1XDDA 2VZLA 3NP9A 3RU2A 5MN5A 2EW8A 1FP4B 5E38A 3U39A 2BGTA 4JYPA 4OL9A 3W7VA 2FX5A 1KF0A 3PJRA 1GL3A 2XVZA 2OUKA 2Y93A 3A37A 3AH8A 5EIWA 5LOVA 2QG6A 2IP4A 1EGMB 5EKXA 5GIOE 4ZCMA 1PVVA 4DC1A 3S8EA 1IB6A 3A6HA 3KAPA 1WNTA 4AROA 5I7VA 4X9XA 4RTKA 3L8DA 3BAFA 3IX7A 3QM1A 4KJZA 5K0GA 1XZ8A 1IVSA 1N5DA 3BGSA 1UC5B 2Q2VA 1T3HA 4G1UC 1QRSA 4FNAA 3EARA 3OUZA 3OQ6A 3IH5A 2RGRA 3AUAA 1ECGA 5TMBA 2GTHA 3W6OA 2IEZA 5A4FS 3HUTA 2PWPA 2P27A 1KGDA 4XH9B 4N8DA 5DX8A 2W71A 2W6IA 3U5ZB 2B21A 4MGEA 4CF5A 3G0DA 3QQ5A 1QK4A 1F0PA 3THWA 5ISMA 1DRJA 2KQUA 3D4BA 1N6IA 2JJ1A 2FI1A 1DZIA 2F9FA 4NENA 4YCLA 1U7OA 2K6GA 1VYTA 1CQZA 1YULA 4FLEA 4J2HA 3PC7A 3QY0A 3RYTC 4CM9D 1NBMD 4JJZA 2OSVA 3STXA 4LFCB 5ALPA 2IKSA 2W70A 2P11A 1CJVC 2I8AA 3QUQA 2FG6C 2ZUCA 4FTWA 1Y9AA 1SQFA 2BP7B 2VUUA 1ADBA 3AY7A 1KO7A 4JUBA 5C4IA 1RM5A 4HEA6 3PLAE 1J24A 1DBWA 2PL9A 4WOJA 3V46A 1GPWB 1P9RA 3QVXA 4QDOA 5E7QA 1NYTA 3E3LA 3MRXA 4LRSB 2IIPA 3JALA 3K1JA 4JBXA 5A02A 2F2TA 3CC8A 3DFIA 3BE6A 3R44A 2JI9A 5JO0A 3D7NA 2Q4TA 4R31A 3ZVKA 5TQVA 1TA0A 3JQBC 5CGZA 2OUIA 1Y7HA 5KSYA 2JH8A 4Z4IA 1Q6ZA 3LO5A 3AJRA 3AHCA 3LNTA 1E6KA 2V1XA 5AW3A 3OQVA 5TF0A 2ZU0C 2QMUA 3E7FA 5TXGA 3EJWA 1IONA 5D01A 3MGGA 3LT0A 2D4HA 3VYRB 2HK9A 4UE3S 1MZPA 1PVOA 5HK8A 1LJUA 1CNFA 2Q5CA