3GOQA

Crystal structure of the tyr13met variant of bacillus subtilis ferrochelatase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
307
structure length
307
Chain Sequence
RKKMGLLVMAMGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title Crystal structure of the Tyr13Met variant of Bacillus subtilis ferrochelatase
rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 117
structure length 307
sequence length 307
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2009-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3goqA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3goqA02
3HCPA 3W1WA 2QD5A 1AK1A 4KLCA 4MK4A 3HCNA 2QD4A 4F4DA 2AC4A 2PO5A 2H1VA 1N0IA 2Q2NA 2C8JA 1L8XA 2JH3A 4KLAA 1C9EA 2Q2OA 2AC2A 1LBQA 2QD1A 2XVYA 3HCRA 1DOZA 2XVZA 3M4ZA 3LYHA 2XWSA 4CCSA 2Q3JA 2QD3A 4KMMA 2XWPA 1LD3A 2XWQA 1TJNA 3GOQA 2DJ5A 3HCOA 3AQIA 4KLRA 1C1HA 2HREA 1HRKA 2HRCA 2H1WA 2QD2A 2HK6A 2PO7A 1QGOA 2XVXA 2PNJA
chains in the Genus database with same CATH superfamily
3HACA 5JD3A 1VZ2A 4MMXB 3CXUA 2GZ1A 3A3NA 3S8MA 4YPFA 2IHYA 2ZT7A 1MB0A 3KNZA 5JJLA 1F06A 1RWWA 1TYEB 2VJAA 5KEIA 1SXJB 2DWUA 2EX4A 4L9RA 1I32A 1S7CA 2G4VA 1LA2A 4MB2A 1T2AA 1YR1A 1JYSA 1FQJA 2RGYA 2ZXUA 3JPYA 1RHRA 3H7IA 4YJHA 3UUFA 4BKPA 4XM1A 4G0VA 1ZJ4A 5BNWA 3RAEC 2QX9A 2WVJA 4L15A 2ECFA 2EC5A 2PD4A 4IJVA 3IP7A 1UT5A 4KE6A 5A3SA 4M7OA 3SQOA 4YUXA 2KYRA 3CZ4A 1FTGA 2AK2A 1W9MA 1I3NA 3E9ZA 4K9SA 4NECA 4KHPB 2AUMA 3LBFA 3LY5A 1IM5A 4QD3A 3TE7A 3STTA 3FDXA 1U3WA 2VZEA 2WUWE 1W4RA 3HWX1 3K0AA 3O47A 4R81A 1K86A 3IVXA 1EX9A 1LBIA 4RGYA 5CX1A 5TT0A 3W9YA 3ZNPA 4EJSA 2W22A 3BL5A 2VTBB 4D3XA 1OE0A 2I22A 2XMGA 1L4HA 1Z8DA 2HHLA 1V1MB 1DZ3A 3L1KA 2XMZA 2FQWA 3R24A 3M6IA 4D74A 5EJ6A 2CUKA 1DJLA 1XCMA 1MJGM 1XOIA 1IWPB 2FWBA 2VAXA 2VT7A 5FQNA 3ISTA 2VSFA 1PQUA 2HPZA 1LQUA 4DT1B 1YE3A 1UJMA 3OZIA 1FLDA 3PUWA 4H60A 4XA8A 3VISA 4M0DA 1XEWY 3ZC3A 1QCZA 2VAVA 3PXEA 3OICA 3PEFA 3WIVA 1T8YA 3R5TA 3A3KA 4ZREA 4OHOA 5HKKA 1X42A 1F2TA 2AXNA 4JSTA 3W8FA 1ZONA 3EWAA 3PGKA 2C5LA 4LJ9A 3OWOA 1AY0A 1WQ3A 1G8GA 4F71A 4ZU6X 4EL0A 1UBEA 4R7TA 1UM9B 2QTAA 3CG4A 2Z0MA 2V6GA 3LT5A 3C4JA 2AFVA 4K46A 2OG2A 2VXBA 3WLSA 1DC8A 1F9AA 2ZZKA 3SR3A 1M73E 4DLWA 1QLWA 5F5NA 1XQ9A 4AQ7A 4NMLA 3E7WA 3O3NB 2IHVA 3N6XA 4KVAA 3NCHA 4AUEA 4D9FA 3IUYA 4RORA 2CLCX 3KFXA 4PGFA 3OC0A 3SFZA 3ZZ0A 2AKAB 5L3RA 3PQ7A 5LM3A 3MRXA 3BL6A 4CM4B 2XQFA 1TM3E 1W46A 1MIOB 2X19A 3CF4A 4Q00A 3VJLA 1FZTA 4I1UA 3RLFA 1KPHA 1JMKC 2NO4A 2ZI5A 4GMHA 3V34A 3UJ7A 1LPBB 3TZEA 4B4VA 5JAHA 1NE2A 5C7LO 3PHIA 4OIMA 1QBGA 2O3UA 3TAHA 1BZYA 2JLAA 1R66A 1ZBDA 2YZ2A 3PYMA 1EFHA 3FYUA 4XD7D 4YC7A 1K98A 1N5LA 2OEPA 3X43A 1BWRA 1W96A 2XZPA 1GZVA 2BGUA 3PQEA 1Z8NA 3VOTA 4LHWA 2A30A 3DEKA 2P2ZA 1LVGA 4A91A 4WESA 5ALNA 2Q4TA 3V3TA 2FWJA 1WCV1 2RCNA 1JKJB 5F9HA 3FGOA 4LZPA 5HP4A 4ZOAA 2C57A 1XK6A 2XNDD 4YDRA 4DA6A 1YJXA 1HE8B 3KU4A 3TXYA 4A5OA 5ALWA 4AS2A 1H5UA 5F2EA 3E3AA 2MSDB 4MVJM 2IVZA 2NO7A 1TIBA 3K92A 1TGYA 4AP5A 3H86A 1XZEA 2DFVA 3AF3A 4QYIB 1JG4A 2QUKA 4R1NA 5GONB 5TY0A 3GPCA 4URZR 3MJFA 2VYVA 3JYOA 2DYKA 3FMGA 3O8BA 3VU1A 5BSKA 4PG5A 4CCAA 4CMCA 5B4VA 3IKVA 1HBJA 1EHIA 3DW3X 4I8XA 1H6AA 1PR9A 2HV8A 1POWA 4NICA 2DG2A 3P7MA 2HQ1A 4H31A 4M37A 4CT4B 2AK3A 2EGUA 7REQB 3OMXA 2ZYTX 1T5HX 4YRNA 1E2FA 1JQAA 4KL8S 1H0KA 2ZLBA 3DD5A 3EXEA 1I2BA 3M8KA 1MH1A 1YV9A 4QUKA 3DR5A 4MA5A 4X8OA 2ZRBA 4YRMA 4HNUA 3TW0A 4RVHA 4BFYA 4NOMA 1I51A 3EVBA 5FLEX 2NXJA 1Y4DE 2PKQP 4R41A 4IDHA 3A05A 3WLHA 2BGJA 2ZIAA 3Q41A 4QNNA 4XAQA 3PX3A 3O8RA 2HI0A 2ZVDA 4LZWA 1KNXA 2XHZA 2C2MA 3HCRA 3COPA 3IURA 3RSOA 2ZATA 2K87A 3PF9A 5K03A 2Q6OA 4ODIA 1FPQA 4ZVPA 4KI0A 1JHMA 2WUGA 4Q3EA 5I3ZA 4FOPA 3LQ2A 3VDNB 3RYTC 1SUDA 1GZ4A 2EW1A 4EI9A 2J45A 5JJIA 4OM8A 3WGLA 4BTLA 1M5RA 1BEUB 2CZGA 2QAGB 4NFYA 1JZTA 2GOYA 3CLSC 1JHVA 3IOBA 3X1ZA 4YPOA 1E2QA 3GJYA 4G5OA 4KQ2A 1P7YA 1U04A 2FSSA 3DNPA 5H3HA 5DRTA 2QP9X 5BNFA 1W48A 5BN5A 1NPYA 3NHPA 2P75A 4OKSA 4HYQA 3MTQA 2OAP1 5DMXA 2GJ8A 1B41A 1M3SA 3VHRA 4OMFG 4X6LA 2OCLA 3LCRA 2OILA 4LHEA 5ICSA 2OFFA 3YASA 1RDFA 4C06A 4XWOA 3IP3A 4FM9A 1Z0DA 1RTKA 5CW1A 4ZKDA 2BKLA 4O33A 3MYRA 1VI2A 2WILA 1AZSC 3O6VA 2GHQA 1HTWA 5FL3A 5IG2A 1OXBB 3K9GA 3U3ZA 4CGZA 3LXRA 4KFSA 4HDAA 5ESWA 4RTMA 2LD4A 3CINA 1KMHB 3KLNA 4Q1EA 3SXUB 1UBLS 5CLLA 4K6KA 4YLEA 2VKTA 3ON5A 4PX9A 4CLOA 1KRHA 2Q3EA 4QUJA 4M49A 4LG1A 3WOHA 3M6XA 4OJTA 4EA7A 4HEQA 3AMVA 2XT0A 5FEMA 3JQDA 4DM7A 5AVTA 4G1UC 3RTGA 2O2JA 2C2YA 4G01B 5E1OA 3NOXA 4X6YA 3PF8A 3DG9A 1RBZA 4FGWA 3AIMA 2H7XA 1RM5A 5GGXA 3UMYA 2BIFA 2MJLA 1AM4D 3VNBA 3H84A 2VBGA 4H17A 1CY6A 4Z4FA 4EDHA 5LLDA 1E6EA 1EEHA 1SK8A 3Q9UA 1W8DA 4R31A 2VP4A 3ZZTA 3P96A 4ACAA 3MS4A 1Z6ZA 4KIUA 4PC1A 5ALGA 3R7SA 2WTNA 4EYSA 1M34E 3MJVA 1WHSB 5AQEA 4WA7A 4TYPA 4V0SA 5CURA 4DWJA 2Z43A 2IK8A 4Q39A 3QF4B 1Q19A 2PLAA 4B3CA 1L7QA 1X1AA 2BHRA 4BJ1A 1GEEA 5E9AA 1ZHFA 2MR6A 3EGXB 3HR8A 1VI6A 2XB8A 1Y8RB 4KQCA 1VPVA 2VJBA 3NBMA 3QG5A 3QMMA 3ZJ5A 2PANA 3K94A 2FUNB 2F8MA 3A6ZA 2HMAA 2YVUA 4UPDA 4BGIA 1QV7A 3RSFA 1E0JA 3UJ6A 4DZZA 3WK8A 4BX0A 3E15A 2WNSA 1XXHE 1HOTA 3ND5A 2ZXFA 3QPAA 4FKZA 4QECA 3Q11A 4XM2A 5HBRA 2O20A 3W5UA 4A16A 3PQ3A 4CUZA 1L9KA 1QYCA 1UEJA 1T91A 3QXHA 3KR9A 5JECA 2Q29A 2RAVA 4OK3A 2IBSA 1GG8A 5EMJA 5EYPB 1IXKA 2OQVA 1FXWA 5C31A 1Q7RA 4XUEA 3ANYB 5EQTA 5IX8A 3P9SA 1DX4A 4TKLA 2HT1A 3SZUA 3M4ZA 4J4HA 2NM0A 4BDSA 4DBVO 2P40A 2NVUA 2QTHA 3OQIB 5JC8A 1JBEA 1QHXA 3AJRA 2Q0SA 1A0OA 4QYSA 4DYHA 4OL0A 2ZR7A 4RXUA 5JNWA 1R88A 1W94A 1U8UA 3S44A 1U7ZA 4OQDA 1Z2AA 1TAHA 3F4LA 3IH5A 1FNMA 3QMVA 3NNDA 2P6RA 2QVYX 4M1MA 4BNUA 2H1OA 4J2TA 3MWDA 3CPJB 2ID4A 4N65A 2F3RA 2HRBA 4M21A 4UMEA 3HCFA 3IO5A 4KXWA 3VA7A 2YKGA 3IVAA 3X1XA 1IZ7A 5BOSB 2P2CA 1HDIA 1H4TA 1HXHA 1V8ZA 3H18A 4UD2A 1Z5ZA 2WHXA 2NV0A 4J2OA 1OIVA 3CFYA 3TOZA 3SC4A 4E5DA 1DNPA 4XDZA 5AKIA 2AJDA 3C41J 1PSZA 3ZDBA 1CUGA 2QY6A 1R37A 3F8WA 3WBKA 4LXXA 1G1AA 2JVIA 4C6TA 2QORA 2FPWA 3TPCA 3SQDA 4Y6PA 1YZUA 2ZTUA 4M8LA 1GDDA 3H9EO 3L0BA 3TIGA 1TQDA 2CLFB 4WCDA 3ZNQA 2B4RO 1IL0A 1QANA 1EWRA 1XAHA 3PICA 4GE0A 4LC0A 5IHPA 3L4KA 3V4RA 2VQ3A 3S8YA 3HCNA 2VHCA 1TUEA 1RC1A 2XIQA 4ZYWA 5DXAA 3I61A 5DWQA 4YHHB 2R1VA 4LBWA 2GCOB 4Q12A 3SYKA 1W25A 5IDXA 3OQNA 3DZJA 3LD9A 3JQBA 1YH3A 1KJ8A 3Q7EA 4HGRA 3QZUA 1FP7A 4LOLA 1C9YA 3BXOA 3BGSA 3CWZA 1BCSB 3DFIA 3QYJA 2DB3A 2MR5A 4URFA 1EI9A 4K2AA 2OVFA 4PZ0A 3UV3A 4CLRB 1J6UA 4YP9A 4ECAA 4W8GA 5ESXA 1G66A 1E6LA 1Z75A 4GZ3A 3IBSA 3JATB 3JQFA 3OWHA 2VQ6A 4G4IA 2I2AA 4WXMA 3WISA 4R0MA 4RA6A 3BK1A 2FW7A 2QROA 3MRSA 4RHEA 1T9BA 1URPA 3HFJA 3UXEA 4YT4A 4LJAA 4MRNA 5K6AC 5L4LA 3DZGA 3CB2A 3DONA 4U7PB 3T5CA 5FT9A 4BLVA 4ER6A 1U98A 2P77A 1O6ZA 3GT7A 1IEQA 1J5EB 1XO1A 2DC1A 4IKPA 2VHWA 2Z9DA 2OCPA 3EF3A 2OGSA 1TUBB 4URHA 2QTLA 2ZB7A 5J2TA 4GR9A 3OX1A 1BX3A 3GHYA 4GI7A 1GGHA 2CVOA 3BB1A 3NAGA 3PJRA 2DBRA 4E2XA 3CNLA 3VPXA 4JOBA 4PGMA 1YCHA 3Q1LA 4RPGA 4EG0A 3IPRA 4YJ3A 4RKFA 4NCIA 3RUAA 4IILA 3RUEA 3QHAA 4FFVA 1E69A 4YVFA 3VM6A 4ZEMA 3O4IA 1SVOA 2YS7A 1MRZA 4WIAA 4XCVA 4AF6A 2CLLB 5EIOA 1TQHA 2EXXA 4X71A 1Z63A 3IT2A 2N47A 4EGQA 1JH9A 3K70D 2YRWA 3FYSA 2QW8A 2QL7A 3LH5A 4A0HA 2DPMA 3K1YA 4UHBA 1MT3A 4C4AA 1XQVA 2W00A 3BMNB 3TIIA 2QBYA 1SZCA 1GPBA 1KU6A 3COWA 3PQ4A 2C3OA 4TOIA 1B0UA 4MPRA 3U3XA 1RQ2A 2YVKA 3KOUA 2QRMA 4MGZR 1GQQA 3UA4A 3AM4A 2FR8A 3LRPA 1PFUA 3PUIA 1NBAA 4RGVA 5FF9A 4EYKA 4GX0A 1W4ZA 3P0IA 2FEWB 2OO7A 3LF2A 1N2CE 3BWXA 3OT4A 3URKA 3T4EA 5C81A 3TECE 1ZW6A 5JYEA 3SIWA 1CUZA 2H63A 2FUG6 4RH1A 1HEUA 4KQ9A 1NBHA 2QGFA 3PI6A 5DBIA 4O4LF 3R7WB 2OC4A 2W2NA 1ZJJA 2AOVA 4ZI5A 5LQNA 3DBRA 1IMJA 2XNHA 1PL8A 1XD2B 3AUJB 2MINA 3ELUA 3W6NA 3MJCA 1CZHA 4V0MA 1U0TA 1CR4A 2W6ZA 3NT2A 4ZYXA 3BK2A 3WP1B 5I4IA 4TRJA 1QRAA 2ISSD 5AK6A 1M72A 3G7SA 4G5GA 3K9QO 4X1KA 3ZDYB 4MS1B 5A1TA 2WWTA 2Q6VA 4II3A 4MDYA 1Y6ZA 4DAEA 2Q46A 4FFNA 5DP2A 2IYOA 3KOOA 3WA7A 3SZGA 3N8KA 4RPLA 5FBHA 1ENPA 1Z16A 2FMXA 4BCBA 2FLVA 3DZBA 3GBPA 1Q20A 3A4YA 3WGTA 1NI3A 2WABA 3HY4A 1F0PA 1NL3A 2WSSA 1IPEA 4GOMD 3CH7A 2Z09A 3HDVA 4FC7A 5DGDA 4FDAA 3ZTWA 4QT4A 3UAXA 1UPCA 2ZAMA 4Y30A 4NXMB 1JB1A 1X0VA 3FR7A 3WDMA 1AF4A 1WZCA 2FFBA 1JN0A 2OT3B 1MP0A 4V39A 3PDHA 2R86A 3C6BA 5EP1A 3TNJA 4Z3OA 3JD3A 2FFQA 4GW3A 2PKCA 2WJ3A 4W1SA 4D25A 1SVWA 4HQRA 1MB2A 1P5RA 1UMDB 1U9CA 3DL7A 1ZESA 5CA0B 1CUFA 1LF5A 1Z73A 2AFRA 3HKBA 2I2BA 4CR6A 1RP1A 3ZGXA 1TCVA 1CYEA 1W59A 1Y6JA 2YFKA 4WCFA 4DIFA 3CNQS 3LXXA 1ZY2A 1NVEA 1QGAA 3ABZA 4WOBA 2W48A 2X8LA 4YIKA 3U9TA 3GLHA 3T94A 1GAQA 2WFLA 4ME6A 3BN3A 3KD2A 2HLNA 4D96A 3RRJA 4EG4A 3SC3A 2A88A 1I5OA 3MLBA 5K09A 3A0UA 4BBJA 5DYYA 4Q4AB 4EHLA 1ODLA 1OWPA 4TXJA 4OXIA 4QIHA 4RTSA 3H9JA 3IDZA 3WGOA 1QTNA 5KOJA 2G5GX 1UP4A 4EUFA 4O4IA 3UFXB 3W5JA 1I94B 4CUJA 1PGQA 4MPPA 2WA2A 1P3JA 3WLPA 5IK2D 3V1TC 3SVZA 2BSQA 4EAAA 1N6PA 4BLSA 5L8VA 1A69A 1EVQA 3PLAE 1JH8A 1ZGZA 4UW9A 3VU3A 2NSJA 4HAIA 3LY8A 1QIDA 1R8QA 1SC1A 3L04A 2ZAOA 1WPQA 4ZVLA 4G23A 1K7YA 2XV1A 1GGFA 1MAAA 3GV0A 4M87A 4PIPA 4Q15A 1RRFA 2DQKA 4G37A 4RH0A 5JQGA 3QEOA 3U4MA 5JNRA 4IRXA 4HQ0A 4D4GA 1OFVA 3N2GB 3VDXA 2HCTA 4YCBA 2FY8A 4H0CA 2NAFA 4ZAZA 1GFWA 3JASA 3SZ3A 4BNZA 2WU8A 2EZ8A 2COUA 4FN4A 1YA8A 2NTVA 5T3UA 2QVGA 3GEBA 3SJZA 1UXHA 4DQXA 2WYOA 2Y71A 1DC3A 4FYYA 3DEHA 3WGVA 1L5ZA 1IJBA 1NXVA 2H1LA 4UTPA 2VQSA 1PKXA 3G9XA 1CJMA 1HG0A 4MAFA 3VKUA 4RH3A 2NXNA 3LLCA 2QE6A 2QIPA 4N5IX 1H2FA 4I50B 2VPZA 3L6CA 1J9GA 2V03A 2AW3A 3NANA 4QTUB 5HSGA 3ELBA 4MUEA 4G4SO 4EYQA 3EIQA 1BKYA 4GLOA 1YOBA 2Z4SA 3AR9A 4Q1BA 1DXYA 3F97A 4FTWA 1BU8A 4QYXA 2XMDA 3AXTA 3Q15C 4RF4A 1AKNA 2GQ0A 5E7IA 4R2LA 2C61A 4LPSA 1RM4A 2FZ4A 1G3MA 4O2LA 1I01A 2VWGA 1DX6A 4Y98A 4YJFA 4CKXA 5EWMB 1Z2DA 5KSYA 4ZTUB 5LIRA 1L5FA 3OT1A 3IXMA 5EJ8A 2REXB 4BO6A 3FROA 3O1IC 3L06A 4X3OA 2G6BA 4YRAA 3MNFA 1M0EA 1TFUA 4DJ5X 5C18A 3VV2A 5K05A 2ORED 4TT3A 1TLLA 3S5UA 2EWVA 3C3JA 4CIAA 4I1PA 1Q7TA 1H4VB 5LD2B 4CMHA 1TEXA 5ALRA 2XCRB 2Q4EA 2JGNA 2VN8A 4HDMA 3KQHA 4MCHA 4UU0A 2PE5A 1WMAA 4RD6A 4LRUA 3GLRA 1VA4A 4DWOA 5D1NA 2PUFA 1PSDA 4MKHA 1QGZA 2GA8A 4TKMA 1DAPA 1WY7A 1V4VA 2X2OA 1VYTA 2PX8A 5EP2A 4PS0A 3DEYX 1KAEA 3RC2A 3GLIE 2OKGA 2IVFA 5AH0A 1IVSA 2VYCA 3CU5A 2ENWA 1Z4NA 1H8EA 4BFCA 2UUBB 5JT1A 1C1XB 1FMJA 1PGJA 1SXJD 3AI7A 1QFMA 3KKLA 3AEQB 3MLEA 4MIYA 4EI2A 4KN9S 1Y9JA 4PVDA 4J16C 3TS1A 3EG9B 3AZOA 4MGEA 2NPIA 1XL0A 1VMEA 2AKYA 5D1HA 5DT2A 5HIJA 3T06B 4A8TA 3KQNA 1AS0A 3RS9A 3U56A 1GSOA 3SM3A 5AKEA 2RG1A 2HA3A 4IV5A 2W0MA 1EM8A 4QDOA 1MGPA 1IY2A 2V7TA 3L1HA 4IDQA 3NW9A 4MIOA 4AG5A 4AMBA 1WBBA 2O8CB 4QGSA 5SYNA 2DCUA 3PQ6A 4EY8A 2H2WA 1QH0A 4EPTA 5TPZD 4DV2B 2SCUA 3RKUA 1C3LA 1K97A 1DT5A 3NTOA 4FYXA 1N3LA 4DR1B 5FPYA 4QICA 3LPAA 4UMVA 4W1QA 1Y1PA 4BFLA 4RCZA 1XNRB 3WBFA 4X7RA 2NPFA 1UDBA 4LRTB 5JAPA 1EM6A 1Q1ZA 1EQUA 3NX4A 1OI3A 1JR4A 1V5WA 4JJ6A 3HHEA 3KE8A 2VEDA 5IDWA 1Q3TA 1PL6A 3ZWQA 4PZLA 4CETA 2G6TA 1ZBQA 3CJTA 4K3UA 3W5VA 1NC1A 1ZKDA 5IM4F 3W2IA 2AJBA 4DAOA 1FEZA 4U00A 3GBVA 2GEFA 5KX5B 3AM1A 1OREA 4L74A 4NH0A 1N0UA 5JYBA 5AOBA 2H11A 1B8OA 2AG5A 5EESA 3RTCA 4BB5A 3R3JA 1NNLA 5BWOA 2L19A 3ZHQA 4FKBA 3LKBA 1UKEA 3HH8A 3KP1A 1KVTA 3MWKA 3N8IA 4Y2HA 3IODA 3QOXA 3HDHA 4ZXPA 2C3PA 4YYZA 2LKDA 5IJZA 4GBGA 2W2LA 3BXEA 5BSHA 4NHOA 1X1BA 2FYTA 3IUPA 3ZDRA 2JLYA 4UXIA 4QRHA 4HFJA 3WQSB 3TSYA 1LDGA 3IUMA 5K20A 1XZCA 1YTLA 2IXBA 4B4WA 3C43A 3IE0A 1AN0A 2PY6A 1P0MA 2IYUA 4BAGA 5EKXA 2CFCA 3TQRA 1TZCA 1VB3A 2VF8A 3LT1A 4CG0A 1ZCZA 2VTEA 4YYEA 5HR5A 5ITZA 4UC0A 1A9XA 4QM6A 3C6MA 1IHXA 2F67A 3BG5A 3R8CA 4IUDS 7YASA 4P86A 3LWNA 3KYIB 3Q6NA 3W04A 1VJ5A 4H4EA 4P4GA 5HHTA 3QE4A 4LQLA 3ZLUA 4DY6A 2FZVA 3DDHA 4LXQA 3ZW8A 1XMOB 2YMLA 3KT0A 5KHOC 2C9YA 1XELA 3BB4A 2NQTA 3VC2A 4UE3S 1Q11A 1X9IA 2P4HX 3UQYS 3QFSA 2XNCA 3NR2A 1BVYF 4AKEA 1KHTA 1WMDA 4EKIA 3BUSA 1NW7A 1EDEA 3HDQA 2B7CA 2IZ0A 1N78A 2YCLA 2PN1A 2OZLA 2XSZA 5I7OA 1U2EA 1PK9A 1V1JA 4IS3A 4UEOA 1BS1A 3ISVA 4N0PA 3IERA 3ZY5A 2FPKA 5CX4A 3TX2A 3CE9A 4LS3A 2AI2A 4BKOA 3VDMA 3GFGA 5FNVB 5IKXA 1DEAA 3PXCX 1J70A 1HKHA 3GJ6A 5IKOA 4Y0VA 4B8ZA 1N6LA 1JQKA 1P5JA 3CR8A 5LZ2A 2V65A 5C1BA 2YWHA 4JIGA 3SAJA 1JV2B 5B1EA 3AJ9A 3PT9A 2TMKA 1NYTA 5AW1A 1ZMBA 4TTIA 5HJ7A 1E66A 2FMKA 3ZGZA 3TNFA 5HDQA 5FPSA 2FF7A 4K6MA 4MYUA 3ABQB 2HF7A 4U7HA 1F6BA 2X7JA 5K51A 3GPLA 1L7PA 4JLAA 1D2EA 1VL8A 1EBUA 1RKQA 3DZCA 4J3FA 4X44A 5DW0A 2GK3A 2ET6A 5J4VA 5C7IO 5BNZA 1TX4B 5CH3A 3VR6A 2OV6A 2ZQZA 4CEIB 4UAVA 5JVDF 1YXMA 2UDPA 3DZKA 4XE5A 3G6KA 1F1JA 6PFKA 1UMBB 5AKLA 1J2UA 2BUBA 3HKCB 2ZDGA 4DMLA 4NCJA 2VHVA 3A06A 2GBFA 2OTCA 3L6DA 4B3TB 2NXEA 1AUXA 3JYHA 3UC5A 3B2NA 5HIIA 5KU7A 4JOSA 4OQZA 4JR2A 3LC7O 3UEOA 4ZCRA 4MHTA 3BAFA 2Q28A 3NATA 1F8FA 2BFDB 3ZDCA 1DKQA 4I19A 3T52A 2NV2B 1MOPA 3H4MA 5T6BA 3OTWA 3DW1X 4QDXA 1AO3A 1PUXA 1WKVA 4CIDA 2R8RA 1MVNA 3KEGA 2C78A 4OBBA 3E9QA 3N0RA 5E8RA 2C7RA 2WJPA 3BFJA 2IBMA 2JZOA 3C2QA 3PV0A 4U1RA 4ZI7F 1U2RA 4OHBA 1VG0B 4F8YA 3FTDA 2D4AA 3TDNA 3ZG6A 1U7XA 4U7DA 4NEGA 1R9NA 1UPUA 3LUHA 4DZTA 5D5PA 3ONWA 3GEMA 1R5BA 2I1VB 1VP9A 3OZ7A 3O95A 1LQTA 2GS9A 3U3JA 2IGTA 4AICA 5BNIA 1EFKA 4IQ0A 4P54A 2VXOA 5T67A 1A8SA 1DTWA 3ILYA 1K5PA 3ETNA 2IEBA 2VHXA 3F5FA 1YOVA 3LDGA 5KPDA 1FDRA 1XCOA 4ND2A 1P4HA 3F96A 1VXOA 3NDRA 3TBKA 5JSUA 3OUUA 3SYMA 2H92A 2PX4A 3WLAA 3O4RA 4EY3A 2GAOA 4B8WA 3AEKA 4PINA 4YUYA 5A0FA 4NC9A 1RNLA 3HL0A 2RDMA 3VSDA 4OFZA 4FOTA 3PCTA 3UGKA 1N2IA 1PR2A 1ZRSA 3ZCTA 5KOIA 2E1PA 3VKFA 3UIEA 2HXGA 1TCCA 5FL7D 2H48A 4D4JA 5LR6A 2L69A 4G0PA 3E2IA 1E2EA 5FBKA 4AFNA 3NALA 3QLTA 4MUFA 2VJDA 1CCWA 3DMNA 3RANA 4A4DA 2V59A 1GA1A 4YALA 3LK7A 5IDVA 2OO5C 1M2KA 1M2NA 4IMPA 3U5ZB 2QL5A 4BUZA 1LI4A 1BWQA 4JH0A 1W4LA 4UZSA 5AICA 2CFIA 3L6OO 1CRLA 1EPUA 1PJAA 2H1VA 4I5DA 5EUMA 3ZS9A 1PGOA 2DPGA 4MB0A 4WY5A 1O4VA 2VHEA 4R2HA 4XGQA 2C0PA 5BR4A 2ZRNA 4DJJA 1XTRA 5JDCA 4NOJA 2Q7OE 1OLUA 4WLFA 5E1BA 3JTEA 4Z1OA 1D1QA 3C5EA 1R50A 2AR7A 2JFZA 5BYKA 1K8YB 1L7BA 3UG7A 3UH0A 3ZD6A 3LZDA 3F7MA 3KL2A 4IS2A 1I5RA 1V2GA 3B70A 4FEYA 4FYMA 4JVLA 3UJBA 3ESXA 5AJWA 1QFZA 5EMKA 5CA1F 1KE2A 2WUDA 3N9IA 2V7WA 3D0OA 3KJEA 4HUJA 3WIBA 5DNYB 2C7QA 4EBFA 2A5FA 4J0QA 1GPLA 1YVRA 2CLEB 2DY1A 1M0SA 4ZEOA 3ZIDA 1X8XA 4Z4GA 3I9FA 4BZXA 1NY6A 4Y0AA 4RKEA 1W581 5CVVA 2WHPB 2H0RA 2VA9A 3RYFA 3MD0A 1AKEA 1Q0SA 3HEAA 5EMNA 2ZBQA 4HAZA 1E2GA 3CEHA 2OD9A 3K9LA 3HO8A 3L7NA 3LECA 1IU9A 1REQA 2Z4RA 3H1GA 4AUNA 2OCBA 4EPXA 4US2R 4GR4A 4L76A 1C0KA 4XWTA 5ULLA 3PENA 4TYNA 3H7AA 4XIIA 1P75A 2A33A 4D9NA 2J0EA 4FMCB 5DYTA 5LP6A 3JYLA 4KLRA 4RQBA 5DM4A 1XZIA 3STXA 4PAGA 2BCEA 3KK0A 4YJHB 8ABPA 1EBBA 4AIIA 1UEXC 2G82A 2GT1A 4K26A 3WK4A 1EB8A 4OSOA 5JZBA 4C3VA 1OXVA 2VP3A 2X0RA 1CS4C 3DHEA 3AW9A 3UCXA 1YHNA 1NZFA 1ZNQO 3Q6IA 4PANA 3WL6A 3W2FA 4DEVA 4DPKA 4E5MA 2YDYA 2EGGA 1KQNA 4EJFA 4FGJA 5K6TA 1AVTA 1US8A 4TTVA 1J1ZA 4J91A 3FYTA 3K0AB 3TE6A 2B8TA 4OB6A 5CX1B 3BEOA 1MDFA 1KH2A 3RVQA 1V47A 4EJSB 3VC3A 4PNHA 3TL6A 1KYIA 2J67A 2FKAA 2MMGA 1DJPA 1B1CA 2AHRA 1CG6A 2UYQA 3AUKA 3SOZA 1FCJA 3AB3A 2IS1A 4ZZ1A 2J9GA 4IZ6A 3K2IA 4TL9A 3JQGA 2WMYA 4XQCA 1RAAA 3PRKE 3LO8A 5AK4A 1EEXB 5BWBA 1ZXLA 2OK8A 4MNTA 4JLMA 2ERCA 3L93A 4TWRA 2ETXA 2X2PA 2O5RA 4A3SA 5AKJA 2R85A 1YJBA 1IY0A 3I2FA 2YVLA 4UFNA 3CN9A 1S2DA 4YDSA 3VX4A 4AJ4A 4ZPXA 2VYFA 1E9VA 2G63A 1JE1A 1RZVA 2NZJA 3SKYA 4I1OA 5K45A 5IBPA 3RBAA 4BPRA 1GFIA 1WB5A 4C0KA 3OFKA 2PHZA 1RYFA 2JIBA 4KK4A 3H8WA 4IAOA 3EWIA 4EMUA 2LKCA 2DRIA 3TR0A 1IQUA 2B0JA 1RI3A 3IOEA 2CLIB 2PX0A 5LQRA 3AIIA 2I7VA 3K73O 3UPUA 1IN7A 1UWKA 2F62A 3B20A 1ENOA 3CPEA 3SIRA 4YXWD 1ISSA 4UDNA 5FI5A 4L4ZA 2NTEA 3N5KA 4HWGA 3PG5A 2OENG 2VHQA 5EUQB 4EO4A 2QJFA 1WHTB 4JU9A 4L28A 1X9HA 5LQDA 1HDGO 3BTOA 1ZK2A 5CT9A 5GJCA 4BB0A 3VMFA 4PCLA 5J2UF 1ADJA 3CX3A 4EKDA 1II8A 2A3NA 4TZKA 2HWYA 3K16A 2O3SA 1XU7A 2IP4A 4MKRA 4BWGA 2Y76A 3KZOA 7MHTA 3KQVA 1UWLA 4XX0A 3FYUB 1IBSA 4K9RA 1A95A 1XU9A 1YE8A 4R83A 4DCSA 2RK4A 4O6VA 1W4BA 4C0BA 4H1UA 4TV9A 1Z5OA 2FZCA 1HPLA 4RKWA 2BFPA 5FI3A 3UMMA 3THOA 3WV5A 3A4LA 1ISGA 1RTTA 4WESB 2IYSA 4BY9E 1XJ5A 2YJGA 2CLOB 1KQPA 3RK1A 3D8HA 4BC1A 1M8GA 3ZE0B 5KOYA 3M6FA 4OX9B 1QFXA 2NIPA 4OU4A 5FFMA 1OFIA 3U62A 2D1FA 5T5QA 2NW6A 3IT3A 1JDJA 2L2QA 4GIBA 4J16A 4PPQA 4Y6SA 4B6OA 4P2GA 2IZ1A 4XFKA 2XRFA 3FDZB 5LYJA 1S2OA 4ARVA 4E5SA 1U80A 3LBIA 4IIYA 4ZRNA 4AO8A 1CT9A 4AXXA 2JI4A 4E7PA 5G4LA 3S2UA 1NR1A 3DKRA 3TLZA 3TRFA 1Z25A 2J9YB 2NQ2C 4PGAA 3OEED 4BLRA 1E3WA 2PUJA 2C5HA 2Z2KA 3I5UA 2NUPA 5B55A 4R9NA 3JQCA 2UZIR 1XCJA 3ENZA 4JJ4A 5FLKA 4BO0A 2W6JA 3EB9A 3V4VB 1UAAA 3UUGA 4Y2SA 3TLMA 1IHDA 2CCJA 3CVOA 3A04A 1N2XA 4GLBA 2AV6A 4KZKA 5TT1A 3Q40A 3EXEB 1Y4SA 3PPWA 5DW3A 4IVNA 2XGOA 5AQ1A 3OPNA 1RCTE 2I67A 1XKLA 4X97A 4KODA 4C89A 9MHTA 3FIUA 1TD9A 2OFOA 1N7JA 1ZM2A 2B1RA 2M6LA 3WQRA 4J75A 4F9TA 5CYGA 1YRWA 4C2TA 1GUBA 1KP2A 1CUBA 2IUSA 4PN7A 3FZYA 4H7DA 1OZAA 1DB3A 3HBMA 2WF5A 1GL7A 3ZHSA 1OWLA 1SWWA 2HH9A 3GJXC 3INTA 3PEVA 1V9CA 3STHA 4OYYA 5ECDA 3ZDFA 2JW5A 4AAYA 4NFLA 4PZCA 1Z6GA 3BDAA 4F7DA 3S81A 5KNLA 3A6HA 2HRRA 2PMBA 4HRAA 2P1DA 4S0XA 3SY8A 1J2RA 3EPHA 2W2KA 2DH5A 3DA8A 5JI3E 1E96A 3HKEA 4NNJA 3AKZA 4NE2A 2Y1DA 5FYDA 2XQIA 5K0FA 4J2HA 3ICEA 3ZX4A 4HUQA 4AK9A 1NMXA 3PNKA 1A5AB 3NUZA 1KI2A 2BM8A 2Z8YM 4FFRA 5IVPA 3E9EA 1XE3A 1HFKA 3O8QA 4FZ3A 4X3PA 1WMBA 4W99A 3GVXA 4LWZA 1VBNA 2EHDA 1Y3DE 3JZIA 3HJGA 3WLIA 3DOIA 3D8TA 1M74A 3F7TA 1A76A 1N6HA 2BFFA 3O3MB 4P4LA 1DIHA 1P0IA 3OD5A 4JI5B 3RS0A 1J0AA 2XB6A 3ROFA 1C1DA 2ZQYA 3EQ8A 4WDRA 2NG1A 3GVHA 3WRXC 3KZCA 2G9VA 1S4MA 2GCPA 4IIXA 1F3OA 1LNSA 3NJ4A 2W11A 3T3MB 3AR6A 3UJHA 2BT4A 3QNWA 4BQEA 3PFKA 4M98A 1V41E 4IBOA 3U3DA 2YHSA 1I4TD 2O5VA 2B5VA 3FRJA 2A5JA 3PBKA 5DRYA 5GV8A 3M6VA 5KTSA 1C3XA 1E2KA 2AI3A 2AC2A 5PNTA 2J48A 4FI3F 4J0KA 3ZKWA 3I8OA 4CLOB 4H6XA 4CQJA 3WJ7A 3VPGA 2QY9A 1YR7A 2EBUA 1E9SA 1G4UR 1Q3KA 3OX3A 4AF8A 2O4UX 1U6IA 3AG5A 3VDRA 4NXNB 4XZ3A 1N33B 3FBWA 4TTSA 4CEJA 1GHTA 1VE5A 5E2IA 1W73A 2IZ5A 2Y3IA 3EJ6A 2NO9A 4KQIA 3FSJX 2C3MA 4FX2A 2EARA 2A0KA 1WF6A 4U8GA 2GA9A 1YJ5A 3PUHA 2W2MA 4R8LA 4WT7A 3MAJA 3VBCA 4BE9A 3PE6A 4FNMA 5DISB 5I48A 4TM7A 2GN0A 3O0DA 1QO0D 2TMGA 4YAGA 3E18A 2EKDA 2DKOA 5DMHA 1ZH0A 1JKXA 1JEOA 1YUBA 4OOFA 1U2GC 4XDGA 5CMLA 1RJWA 1IUOA 3K9FC 3ZHOA 2XNKA 2R6ZA 1NX6A 2NT4A 3JQRA 4LTDA 4P7FA 4D2IA 1Q3HA 3JQAB 3RB8A 4ABTA 2JGIA 4FFBA 3T3DA 4MPDA 1ZRNA 1L7EA 1UZUA 3GFQA 5EJ4A 5AKHA 3PPIA 3BWDD 3E9DA 4LMBA 1DBIA 1JFLA 2WAXA 1WE2A 3AYZB 4RFVA 4WEOA 5CHYA 3IIEA 4DCPA 3BE5A 2I3DA 3WJ2A 4B6PA 8GPBA 2WAYA 2F1OA 4OHMA 3J7AC 3OM0A 3PR2B 4YCCA 2B4KA 3AUTA 3CYFA 2RHWA 3IQEA 4IXTA 4RZXA 5C5IA 1JALA 2QZSA 2ZGVA 3A3YA 1TZBA 3AVUA 1BHQ1 5HOQA 3MWLA 2QD4A 3KETA 3N05A 4URVR 4HNSA 4KRFA 2BFBB 2QOEA 1WDWB 3S5JA 2O8EB 3E7DA 3BE4A 6AT1A 2GPNA 3R6DA 4YAWA 4M0KA 3PKIA 1DCKA 3ZWCA 3U4QA 1LC3A 3NVDA 1NMYA 1KYWA 2IDKA 4LYAA 3C3WA 5CJPA 3UUWA 1PDOA 5FLYA 5JEDA 1G5IA 2AOTB 1EX1A 1WEKA 4E15A 5L9AA 1EK0A 4I4LA 3EULA 1J7JA 1X8LA 2B83A 2ZYUX 3LVFO 1DWOA 5AW7A 4XRRA 2WW8A 2JIMA 3AFNA 2NVUB 5A9SA 1CPYA 1N92A 2BF4A 5KYXB 4FIZA 2GK6A 1H9CA 5ALLA 2WVAA 2H7YA 3M6LA 2Y1GA 3OLCX 1KDRA 3NC4A 1J8MF 4R4JA 5AMXA 1QTRA 2EKLA 2HADA 3M89A 3SPXA 2PUDA 4KDEA 1O6GA 4JB2A 3PI7A 1GCUA 1VSTA 3DQPA 5B1SA 3ODPA 3EVAA 2NVOA 1D2RA 3DP9A 1V8FA 3MTJA 4GPIB 4TS3A 4A1OA 3MWDB 4MYCA 4EG8A 3KUCA 1SD1A 1Q83A 4BNDA 5FFFA 2CVFA 5DU2A 2A9JA 2MMCA 5JADA 2O0MA 1A5TA 4YAEA 1D09A 4O2AF 4QQNA 2XEDA 3IRUA 4GLLA 2RK3A 1OXTA 2YC4C 4MR7A 2D00A 1FVOA 4CKBA 4ZHQF 3UWOA 3EA5A 5DLDA 1W5SA 3RBZA 3GCWA 1RRKA 3MCWA 3PDUA 3D54D 4XLZA 5ENVA 2J1LA 3DAYA 4C5AA 4P7JA 4DWWA 4PYLA 4BX8A 3SEZA 4H16A 4IQGA 3TF5A 1K7FB 2NZVG 2EGHA 1GKKA 4PLTA 3O7MA 3KQPA 5LA6F 5BNTA 3LYUA 5IMBA 3FHLA 1HFWA 1XMSA 2G9UA 1CUVA 1YAHA 1KKLA 4N0QA 2QUJA 5THQA 2NADA 2BFOA 1UM8A 3D2CA 4OQEA 1DFHA 3WXMA 1KEWA 3RD5A 2R1VB 4L1KA 4WV3A 2Q6IA 3LIIA 3QU9A 2DT5A 2B7BA 4B48A 4N03A 5IZ4A 2XCIA 1ZDMA 2V74B 4K6CA 7AT1A 4B2YA 3OHSX 4PXYA 2ZP1A 3IUNA 4AT1A 4HTAA 3M4NA 5C53B 1QKIA 1X2EA 1EMDA 1KAQA 4B3SB 1FFHA 3ZKAA 5AXDA 3ABSB 3LHSA 1ZM3A 4EW6A 1JIUA 3KQYA 3KUDA 4C4RA 5TGTA 1XHEA 1Y1TA 2WT8A 2JJ2D 3C3XA 3TW6A 1W2GA 4DPLA 4MYDA 1RYYA 2HMWA 4FOOA 4RW0A 3S2ZA 4H1WA 4CU5A 1W93A 2H2IA 5LMCA 2NVWA 3P45A 3D4IA 3ANLA 3B8HA 3LXMA 1KOLA 1FFXB 4WZ6A 3RDPA 3SMQA 3GRCA 4PONA 2Z57A 4BMVA 4QGGA 4EARA 1Y33E 3C85A 4DR4B 1J0CA 4V0OA 1SOMA 2JH9A 4KQGA 1H22A 1YSCA 1SB8A 4POOA 2R1TB 4BMSA 1CE8A 2XH8A 5J2TB 5E6UB 4TKVA 2FG7C 4J8PA 2QTGA 2ONKA 3IUQA 3QOWA 4I3FA 1F2DA 1QIHA 2FP4A 2Y1WA 4QYMA 4AS3A 3MBIA 4LFBB 3FUWA 3VNQA 2X0NA 2FOIA 3GL9A 3AFOA 4YJ3B 3RUHA 1HA3A 4CTMA 4QG3A 3VUFA 5BR1A 1M8PA 4Q03A 5BMVF 3OJXA 2RHMA 4AN1A 4FE3A 2FEKA 3IUEA 1B76A 4JUDX 4M0UA 1WM1A 2H5IA 3CF0A 5BYBA 3O8LA 5C1IA 4NU6A 2C9OA 1M2JA 1KVRA 2HIGA 3JD0A 2D7CA 4Z6KA 1BOOA 1NQWA 1ZUD1 4OI2A 3TZBA 1NI4A 2B9EA 3OOEA 4BMXA 4E5VA 2LNDA 4XPZA 2QBYB 5KTKA 1XX6A 1VIYA 4Q9JA 3HBAA 3NHYA 1KC1A 1S2NA 3S99A 1CNEA 3I37X 4B6FA 1Y9EA 1XLTC 2O7VA 2QZZA 3CEMA 4HLDA 5BVHA 4RYDA 4HDNA 3UJCA 3OQOA 1AG9A 1RJ9A 5CIQA 3LG2A 9ATCA 2I6UA 4IIJB 1OYOA 1X92A 2QN6A 3HZZA 3MCUA 4BV8A 2C7GA 3FMFA 3DMGA 1BD3A 3IUJA 4IZHA 4RTNA 2EFJA 1ZWLA 2AWOA 3FWZA 4FI3C 1CQXA 4ER3A 4JVOA 1MO5A 4F0JA 2VQFB 1J0DA 1GL6A 3QYFA 5GGYA 2BV3A 3GYGA 5DCWA 4DC9A 3P20A 2D2XA 2CLKB 1UC4B 4GR5A 1R15A 4EFMA 1RFLA 4W7HA 3Q2KA 4AP6A 2YV4A 3DBRB 2QRGA 3KD3A 4HQ6A 2H4ZA 2MINB 3GDWA 3GP5A 1LRKA 3MWGA 3DVAA 5F76A 5L3SB 4AD8A 1FMCA 2FFHA 2MSEB 1CUYA 4X1KB 3UJ8A 4H18A 4TQGA 3NMUF 4HKTA 3WO1A 3GD7A 5DYIA 2ZJ5A 2UZ0A 4DLPA 3CQ9A 4QM7A 5LYYA 3QF7A 4NESA 1XD9A 1KO5A 2QGZA 3Q9NA 1YB6A 4RDIA 5JD6A 2CL7X 4JDUA 2GJAA 2AMYA 2WUVA 2F9FA 3OPQA 2EFCB 4P53A 4Y6LA 3ZEAA 3TM4A 2ZSKA 3AL3A 2QAIA 2Q9CA 1P31A 5G2OA 2B69A 4D4IA 1BMFD 1IN8A 5EJAA 4DQUA 4Q4CA 1RWPA 5DXFA 4EHHA 4EGSA 1HE1C 4C5BA 4OQNA 1ZU5A 3M1AA 2VPTA 4RPJA 4FJ1A 4V0QA 1AGXA 4MVYA 2KMLA 3UXHA 3CLVA 3HKBB 2VH5R 4X85A 1WLYA 3NHWA 3RKRA 1O8BA 3GP3A 3G2IA 3I4LA 1SQ6A 4GMGA 1PBNA 2C29D 2QSYA 3CNHA 5ALIA 3THXA 1U3UA 1IXZA 1CLUA 2AX4A 3OZAA 3ZK7A 3I72A 1E2BA 3BCRA 2BP7B 3MS2A 2FDCA 3W5AA 2QI9F 3RODA 1V48A 1I7LA 1T2UA 4NK4A 1CQIA 4ZQFA 4CKCA 3U09A 3AVVA 4NZ9A 3RNOA 1MO3A 3R7NA 5KYYA 3H97A 4XWGA 2OOSA 1B43A 1IXYA 3KV1A 5KOJB 1A9ZA 1GKLA 2X6TA 2X14A 4ZI7A 5DBGA 3Q8LA 2OXEA 3II6X 2IQIA 4PE5B 1J49A 2GEJA 4FHDA 5FPTA 5T3YA 4W1RA 3J81k 4L5YA 2BKUA 1XK7A 4Y2XA 4TZ6A 1Z74A 3ZOZA 2NMVA 5K8CA 5LQAA 5MF6A 3GFOA 2B8NA 1FS6A 4JDPA 5JQGB 3IAXA 1PJSA 4F72A 4WK2B 5SICE 2VDVE 1NVWQ 4LQCA 3ZU6A 1RMTA 4CMKA 2G06A 1FDVA 1NWCA 3K4HA 3IEUA 1KEVA 4I36A 4MARA 2GPJA 3G3EA 4PFQA 3A32A 2QN2A 3JASB 4M1KA 5DYNA 3EUEA 1RI4A 3D3EA 1WL8A 1XN1A 3PWTA 2R4TA 3THWA 3NGLA 4JA2A 2CDCA 5B2EA 1U0NA 1Y9AA 2WKWA 1TCUA 2V54A 1RLJA 2D1QA 3G2NA 2RHTA 3AERA 2JGLA 3LCUA 3T5MA 4ENUA 3E61A 1PT9A 4KACA 5T7BA 2OBLA 4HS9A 5EIBC 1PX2A 1LEHA 3FYDA 3CLUC 4QSMA 3VPBA 4XOIA 5I9IA 1H05A 1R1DA 4EZBA 1GTG1 5TF4A 3WGJA 1G18A 2D0OB 1BD4A 3SC2B 1XDBA 2GI4A 1OGIA 3ROMA 3V2HA 3V4OA 5CNMA 2PRZA 1CVLA 1KY2A 1T2NA 3LIPA 4C4TA 3CUVA 4LSGA 1C2TA 4AY3A 1ND5A 5JIBA 3C3CA 5K3OA 2HBRA 2YW2A 5AWFC 2C4HA 3JXEA 4FDLA 2ZDQA 3NHMA 4M9ZA 5K1ZA 4YJFB 1WDTA 1DRWA 1IJKA 2DSTA 4UARA 3OT1B 3B2EA 3F6PA 3L8GA 4LHYA 3WZMA 3KWMA 5AW4A 2JBAA 4KO3S 4Z7QB 4PF1A 4V0RA 1N8SA 2OB1A 1PR3A 3W3ZB 3OLXA 3C3EA 1GITA 1LH0A 1E18A 2REBA 2R7LA 2WV9A 3LUFA 1D6SA 4EKNB 4I81A 3O5AA 2WR8A 1GT91 2R1UA 3SEFA 4GE3A 4BFUA 5DN6D 1HMPA 1OJ7A 2AG6A 2GXUA 4TSFA 1QAQA 2IEDA 1HDEA 2HK8A 4HEA1 4P4SA 3HCEA 3CRZA 1ICEA 4E22A 3OQJA 5BQ3A 4LF8B 2FN4A 3DKPA 5H8WA 1E64A 1Y5NA 2R6R1 1YNSA 1OASA 4J90A 1UXJA 5F4BA 2C1ZA 4WVLA 3ZBTA 7GPBA 3LRTA 3C6XA 1E3TA 3H4IA 5TS2A 5I47A 3QV1A 2B8JA 5DDIP 4L5JA 5SV2A 1QWOA 1OCEA 2WSLA 2WI8A 4ASUA 4IKEA 3K5PA 4YJ2F 4TMFA 2CDNA 3DOUA 4BQRA 2M6SA 5A2GA 4H77A 1YMUA 4AKHA 5ANRB 3AZPA 1KI9A 3ZTTA 3TTWA 2HMYB 1GRVA 4JQZA 4QQ8A 2XE8A 1FVXA 2FZGA 2ZUUA 1K08A 1O6CA 4Z2AA 4KR3A 4OHVA 5IFLA 1TRHA 3KKMA 3KVVA 3UH1A 4LZNA 5CDHA 2RGEA 2BELA 4M4SA 5KYTA 3EZYA 4PZZA 1RXWA 2VT3A 3AYXB 1EM8B 4F06A 2IH4A 4X95A 1U2GA 2X3YA 1XHFA 3P0RA 3C3YA 2IIPA 4F6LA 2IS2A 3VNAA 2XMRA 3KYBA 3IHKA 1U0EA 5CVJA 4RGQA 1JBQA 2HYDA 1EDDA 2SCUB 5A5EA 2FH5B 4V3CA 4FT4A 2OWEA 1EUDA 2WWIA 4PZAA 2GKSA 3LP5A 3WRYC 5DNUA 4KV7A 5C1PA 3AGQA 1R3UA 5EJFA 2FCRA 3ZGVA 1LBHA 3NRJA 2AJTA 3P1JA 5LOVA 2WICA 4IX1A 3E70C 4WJZA 2ILTA 1Q50A 1X7WB 1PGNA 1X7XA 3OI7A 4MKZA 3X1DA 3WYAA 5JSFA 4KR6A 2YJTD 2CLSA 2J59A 1ND6A 3BMCA 2R65A 4P32A 3CG0A 3IE2A 4GBMA 3I6ZA 4RM2A 1U63A 1QIMA 4IWNA 4JCOA 3KT6A 4TZ0A 3PVZA 3A2MA 5EXPA 3T0IA 4ENSA 2GZHA 3ESDA 1V6CA 2OMKA 1JMVA 3BIOA 3HM2A 4TXLA 5HKKD 2X22A 4QXPA 1BVRA 3RC8A 1Y63A 5AHKA 1O97C 1NN3A 3RM3A 1SRQA 2R1ZA 2HEIA 3A1EA 3O03A 4BX3A 5IZCC 1P9RA 1J1IA 4C04A 1Q22A 2AG8A 2CFRA 4L73A 1WSAA 4EJ2A 1M7HA 3QGMA 1N2HA 4ND8A 3H3XA 3GRRA 5HOEA 3KL4A 2ASVA 5M2QA 4I66A 4YV7A 1G8PA 5D84A 3V46A 4QELA 1JEYA 2JH3A 3JVVA 3CCBA 3TYXA 3BBLA 1NOKA 2NSHA 1P1RA 3ACBA 3TDMA 1HDZA 3DCNA 3QA9A 3I8SA 4HB2A 2GEKA 2J31A 3LBNA 3HB0A 5B30A 1QORA 2RKWA 3AWDA 4JGBA 5J2UA 3NIDB 2KJQA 1YDGA 3BTSA 1XZHA 5ITZB 1BIFA 1AQUA 1I2MA 1Y8AA 4OHRA 2XTMA 2Z1NA 3TRIA 1NVVR 1OLXA 3G5TA 3ME5A 3WNBA 5L45A 3RVSA 2OGUA 3PIDA 3RF6A 5G0TA 3FAKA 2G71A 1IE3A 1FFSA 3NOQA 4GAEA 4IXNA 4MRSA 4GM1A 3TFQA 5JASA 4DA9A 1D8AA 5B58C 3SD7A 1ECCA 3AY7A 3CLTD 1Q0TA 3HCCA 3SDSA 2VNHA 1JA9A 3F9CA 1SIWA 4E32A 1QFYA 1XTZA 3O26A 2OV1A 5BT8A 2QI9C 2V3VA 2IU4A 1P18A 4LOJA 3ICOA 4Q1AA 4BMYA 3ROZA 2FDXA 3PQDA 1S2LA 2QD3A 1QG2A 4I9FA 5AXAA 3CBQA 5EKTA 4ZMSA 4LQ4A 3C4VA 4B5LA 4P3PA 4DSOA 3CSSA 2R6DA 1K8ZB 3HJAA 2OZLB 3OH8A 3HABA 2J3LA 3F2IA 2X8WA 4KWEA 3SZOA 5A3JA 3WG9A 4FSXA 3OPYA 1P81A 4DW8A 1E58A 3ZW7A 4IDPA 1RRVA 1P7VA 2Z04A 2ZULA 1N9GA 4LWPA 2QE7A 3RJ5A 3B6KA 1JQEA 2IRWA 2VYVD 3DCYA 1JFVA 4C0HA 1VL6A 3JCZA 1GNTA 1VKZA 2DUNA 3GEHA 3O90A 4DV0B 3MGGA 1PFYA 4MQBA 1AQNA 3EX7C 3MG9A 3DMDA 3PK0A 3X1YA 1DELA 4TMTA 5G41A 2CJWA 1KJYA 5DBHX 1C4WA 1UL1X 1IQ0A 1Z7BA 3F6BX 4OI4A 1MJFA 4TMVA 2NTJA 5AJZA 1CEYA 5D7BA 1O08A 4WLEA 2C5AA 1SVMA 3W1VA 2R5WA 3OJWA 4TTTS 4RTJA 3LAWA 1II0A 1VJ0A 2P2LA 4K9NA 5BQXA 3T1HB 3TVDA 1P4JA 4K3VA 1QIJA 1FDWA 3QELA 3QLJA 2BGTA 3TW4A 1L9XA 3C98A 3S2FA 3ZLVA 4FEEA 1BDIA 1DX9A 1RQLA 3AF2A 2PKQO 2F1JA 4BAUA 5A5FA 2QD1A 3AJEA 2BF7A 2QZPA 4CM7A 1RVDA 2ZSJA 4BZWA 5KJ6A 4AF7A 2FSVA 4RD4A 3G7UA 1W85B 2HHAA 5IMSA 4AX8A 2C42A 4N54A 4X41A 1UBRS 2LTAA 4LMPA 2A9PA 4RVCA 3ZU5A 3KPUA 3I12A 1OXXK 4QXQA 3ZWAA 1RE0A 3EC7A 1XTQA 1DJMA 1L4LA 2PWYA 3GT3A 3HMQA 4G67A 2D2EA 2CDAA 3G2PA 3H1AA 3LLUA 3RC1A 3T4PA 4U2CA 4P8RA 2DULA 4D4HA 2XVXA 2ZR0A 3HXKA 4KSYA 3GJSA 1DAHA 1UBFA 5COQA 1O58A 3ZWVA 2IOHA 4RENA 2XTJA 3NI2A 1XMIA 1FYEA 1QPBA 2JHAA 1QO7A 5MFPA 5K8IA 1XLTA 1CY4A 1U8FO 2XYQA 4TTPA 4FW8A 3PCRB 2XRZA 1OTHA 3RF7A 2I3ZA 3JVEA 4KW7A 3AKDA 4TWZA 3G88A 1UC8A 2C5GA 2PWZA 2OBMA 4KREA 1BE6A 1QM5A 1MW8X 3MM4A 2WAMA 2PU7A 1TL7C 3BPSA 3GOHA 5K3EA 1Q15A 1GNPA 2QHXA 3DCIA 1NT2A 3FZNA 2WM8A 3AEKB 1OSNA 1R4AA 4QARA 3ABRB 4QLAA 3V8BA 1GTMA 1NN5A 1PR0A 1S8NA 1N2JA 4MULA 2D5IA 3RUIA 4WI1A 4CDRA 5HK9A 3F3YA 1PV2A 4LJSA 3FTEA 4AY2A 1TNDA 1KO7A 2R7MA 1QB7A 3AU9A 1JTEA 4LJ4A 5LKAA 2BJHA 3NPAA 3L02A 2MTBA 1L3BA 2K2QB 2XY4A 2BHLA 1V25A 2WWRA 1XVUA 1BQ4A 4AZ0A 2FPOA 4MH0R 4U5XA 3G17A 5UKDA 5C7YA 1CZLA 3NTUA 3LYAA 1XQYA 1V8DA 3C15C 2WYHA 1NNEA 1Z4KA 2ZJ7A 3HEMA 4D0NA 2VDPB 4RTPA 10MHA 2C4NA 2OHGA 4M0CA 1Q21A 1OLUB 1PK8A 4R1MA 3RYIA 1TXGA 1A9YA 1R3DA 1WNFA 4LWQA 4ARAA 4CF4A 4EYOA 3A1NA 2DXIA 2Q3FA 4ZANA 3ZXIA 2EZ9A 1XFDA 1LPMA 1YU9A 2P4QA 4RVGA 4DTIA 2O8FB 4X64B 1DAOA 2P90A 2W6OA 3H1BA 4QHTA 2A9QA 3AB8A 3OOYA 3OU6A 2CFSA 4WMLA 4ZQCB 1DLIA 2GFQA 3IPAA 3NETA 3TFOA 5JW6A 3HJUA 3T1VA 1A8UA 1MA0A 4NABA 1OBVA 1Q5PA 1RT9A 1ZM7A 1AV7A 1RAGA 3G5UA 1GAWA 2WJZB 4MTLA 3GUHA 2Q7DA 4DE5A 4GI2A 3C70A 3QE0A 4JY7A 4S0ZA 1NW5A 5ALZA 3RRNA 3VYTB 4GM0A 3RSZA 3RYFB 2PSDA 3HWSA 3L7YA 1NMQA 1SXJE 1PR1A 4MJXA 3KLPX 3MT0A 3ZU2A 5JXWA 2HIMA 4IR7A 4HAOA 4IMIB 4ZVRA 1V26A 1SOUA 5LQUA 3L7JA 4KNVA 3GVIA 1YE5A 3L0SA 2X0KA 1X8KA 4MW1A 5CTAA 1LI7A 3TN7A 2H65A 3DXFA 4PYOA 1GRCA 5GJVC 4FB4A 3KVNA 2OO3A 3TPZA 1JRLA 2CZQA 1SQSA 4A03A 3BCSA 3GMTA 1L5SA 2X3UA 3OQVA 5ILGA 3RQIA 3WYNA 5B7GA 2A92A 2BTQA 3FUTA 4HP8A 4LSWA 1ZJYA 3LUBA 3RIGA 4CIWA 5KI6A 3SEQA 4UBKA 2W8ZA 4PQGA 4N0MA 1R6DA 4TXNA 5JRJA 5F1YA 5AJUA 3RRBA 5KO2A 1TKRA 2PWBA 4M83A 2A6PA 4M60A 1KA9H 3BRQA 1CU1A 4HDSA 4B6SA 5LN1A 3DXYA 3E1KA 2YR0A 3NS7A 4KX3A 5DO9A 1MC4A 2JATA 2DEUA 1X6VA 2YWRA 2XMCA 5JZMA 2PJZA 3CVJA 1BRMA 3NHSA 2I65A 1E3MA 3EXFA 1PVVA 2X9VA 1SC6A 4YY3B 5ALTA 1JKIA 1ZFNA 3CX6A 4KO2S 4DS3A 1ML4A 3B1ZA 3TI7A 4BQPA 2Z6VA 5KUTA 4CT5A 4DQDA 2OVBA 2IEZA 4N3CA 5ELMA 2ZPUA 5G0UA 3TMYA 4EB8A 3HR4A 2OPBA 5ED4A 1E0SA 4F85A 4OFXA 2FVXA 4ZHQA 2JGKA 1KC3A 3JQGB 4C7BA 1E77A 3O9ZA 5GJBA 1W6UA 3QPUA 5AHXA 4GYWA 2J3JA 1UPTA 3GGGA 3MA0A 3R41A 4H3KB 4AJKA 4ZCSA 2LDXA 5B6JA 1EGMB 1UMCA 2D8AA 1TQ4A 2OHVA 2ZIFA 3AL2A 3GLVA 1J21A 1LJLA 5JAMA 4XFJA 5TDHA 4XPIA 3WLQA 3ZHYA 1B0PA 4JQYA 2LVBA 3PPYA 4UAUA 5LA6A 1KK0A 2A78A 2FUCA 2EOAA 4BGVA 1FU4A 1JECA 3IOMA 1VBFA 1D4ZA 3CBGA 4ZVUA 3UT5B 1QR6A 4F93B 5FFNA 1U3VA 4YMIA 3QKRB 5I7SA 1N8KA 3E0XA 1G3RA 3PQ8A 2IW3A 1T13A 1PNTA 4N0EA 4HAWA 3BXXA 3L77A 1E1QA 3Q98A 2P6NA 2VF4X 1GQOA 3BL8A 4R7ZA 4EL5A 5CCXA 4EAQA 2QZ9A 2PSEA 2FE1A 2OK7A 2WNHA 3PXGA 1P17A 3OCZA 4M9RA 4C43A 1EWYA 1E6MA 1GQ2A 4HAXA 4OXRA 5F77A 4TZTA 3GA0A 1Y98A 4DCOA 5FD8A 5F33A 5GY7A 5ALXA 5TMEA 1TKCA 3R76A 1RMQA 3FOWA 3H5IA 3HUEA 4XJSA 1A4XA 1V2HE 4Q3CA 5A7HA 4FGLA 1ECLA 1U2DC 4EQZA 1T8TA 2AI1A 1QGOA 5IAKA 1DRUA 4XX0B 4GHWA 2QYOA 3LP8A 3MS7A 2F1KA 2VTVA 5ALYA 1L7AA 5E1MA 2NN3C 3ELDA 2FEAA 2OCDA 4C0AC 4DRYA 3HP1A 4IINA 3IQIX 3CRQA 5DLYA 3EDQA 1MW9X 2D5AA 3B9QA 1KS9A 5M5BA 1E7MA 2DQYA 3PUJA 1B8UA 2QKYA 2IEGA 1JR3A 3N3AC 4ZCMA 2WU3A 3HI4A 4N8EA 2JNWA 1YWGO 1EH5A 1M8KA 2BH9A 1NR5A 1AXEA 3IR7A 1QAOA 3A1CA 1CQPA 1AKYA 1U8YA 1VIDA 3JVIA 2PG3A 3KVOA 3N58A 4EMTA 2V0GA 1Z36A 4OQPA 5LYJB 1PJQA 2GKGA 2I6FA 3ZWWA 1AUVA 2QS9A 3B6EA 3TLJA 3Q7RA 5CDSA 3P94A 1OBFO 3I39X 5J3JA 3EMBA 2Z5GA 1T3HA 3A4TA 2AN5A 3T35A 2CWWA 5JSQA 4ARIA 3T7IA 1FDUA 1UBTS 1T9ZA 3PX2A 1MENA 5AYVA 4EUEA 4MRMA 3U48A 1E3WB 1ZO8A 1GNQA 4OMDA 5TXGA 2IYFA 2OFXA 2YIDA 5KTMA 4QOSA 3EGDA 3HVKA 1JHOA 3P2OA 4DSTA 3VO2A 3WRYA 3GAAA 1IZZA 2E85A 1RRMA 1S6YA 4GQAA 2H51A 2V4MA 2N75A 2YIJA 1PK7A 3QVGA 4HWSA 4K9PA 3IAAA 4PQYA 4QNRA 4RSHA 3R6LA 3UKOA 3QTBA 3LZ6A 2FRXA 3WMWA 3FPAA 1QRSA 1LLCA 4YLGA 1FLAA 1K6XA 4QVKA 1K2WA 2OBBA 4N7BA 2X4IA 4F2PA 1AO0A 3FWYA 2ZRGA 1R4MA 4OLBA 1G60A 3PUXA 3ZWOA 5DEOA 2DR0A 1VLJA 4L8WB 4M8SA 1CJBA 1ZNYA 2WHYA 2YXEA 1GP2A 2AC7A 3HA5A 3QPCA 3ZQ6A 1EE1A 4ER0A 2WBLC 3NASA 5B12A 5AI5A 3RYCA 4DV4B 2MYNA 4GXNA 2CY0A 3LCJA 2LRHA 5JMTA 2MDTA 2TSYB 5BV7A 1GSAA 3DZIA 1GARA 4WFIA 3GLTA 4EITA 5IZCA 2W2KB 1NRWA 4PAMA 1YL5A 5ALOA 5JFOA 1KQOA 1DO2A 2L0XA 1XALA 1G5FA 1Q7CA 3NBYC 2V0CA 2ODWA 3OKCA 4Z3DA 1U7PA 5EFOA 4WQMA 4DA8A 2G9NA 4AKIA 1GUFA 2AJ8A 3PC8A 3R3XA 3GJZA 3TSWA 1T26A 2DERA 3EXG2 4TTRA 1GYQA 1IHPA 2WLSA 4G3XA 3FPHA 3R4VA 4PO8A 2GPBA 2WSSD 4YMWA 4JBHA 2CNBA 1NDUA 2JLUA 2G0AA 4TL6A 2QV0A 2JBWA 2JK0A 3TFWA 3N8GA 4WKBA 4BJ3A 3WQQA 4UFPA 4U5QA 5ALUA 2FW0A 2JAOA 5AVYA 1C1DB 4ZYZA 4CM1A 5GIPE 1GRQA 1WDLA 2EWMA 2G09A 3NM5A 4KWTA 4PV7A 3D7LA 1V0JA 4UAJA 3QUBA 4FR5A 4K40A 5CTJA 3KHSA 1NXOA 3WK5A 5JY1A 1MAUA 3ESCA 3HXPA 4FP9A 3MTIA 4R8SA 4QJBA 1ZD8A 4KDCA 4P83A 3L9WA 1JDSA 2OA0A 1DE0A 1OH7A 4M54A 4MPTA 4QHYA 3BA6A 1KI1A 2RHHA 1QF7A 2VZLA 1Q77A 2HM7A 3D6NB 4KEAA 1DIBA 5CLHA 4AZWA 3HO1A 5CIWA 3ZKWB 2GZ2A 3VNVA 1W19A 1YKSA 1VL5A 1MABA 2GNOA 1QS0A 3D0KA 2J85A 1ZINA 2HQRA 3G23A 1JDTA 1TTQB 1PEKE 4NPAA 4CEJB 2B6NA 2RC6A 3PNOA 1E9FA 3NU1A 4U7FA 4XXHA 1YQUA 4LECA 2ZZNA 4P08A 3OLWA 5SY4A 2QT9A 1B8VA 1I10A 2KM1A 1G8AA 1VB5A 2WUFA 4IHJF 4LYDA 2P30A 1U2ZA 4M9UA 4YJGA 3W2TA 3ZV3A 1EUQA 1JEEA 4NQRA 1CRWG 2Z3VA 1CP2A 1PTJA 2FAXA 3DOEA 1SELA 2I55A 2PSHA 5IT4A 3OLVA 1JSRA 1HM5A 1AZLA 1Z4OA 5JANA 1FNSA 1BMQA 4CDGA 4HWTA 1C0PA 4IH4A 1SRRA 3KEMA 4AB1A 3GJ7A 2BFEA 1AB5A 3I9JA 4IG4A 1G3UA 3PWKA 1NVAA 2MHCA 4RMHA 3MEQA 3LJKA 3V8EA 4BQNA 3H3FA 4JX8A 3SX4A 5BW4A 1NATA 1KO1A 2YHBA 1TEHA 2IOFA 3E8SA 3G9TA 3GGCA 4UUNA 1CTQA 4OLHA 5JRZA 4Q4HA 4AJJA 2PUAA 3FOBA 1R6AA 4CCYA 2M1XA 4BFXA 4EKEA 2CNWA 3IHWA 3T1TA 3FF4A 2AYYA 3HM9A 3ZVMA 4XX1A 1M2GA 3N2EA 4L95C 2GO1A 5J4LA 3TIXB 4UEJA 1NLUA 2FEPA 3K35A 4ETMA 1HNNA 2CFOA 4LGCA 3PNYA 3ZTYA 1AA6A 3G5AA 3A7EA 4Z0NA 4H3VA 2HQOA 4PBRA 3TXAA 4C7OA 4LI0A 4AECA 4DRXB 1KL7A 2OGTA 5L3ZA 2G72A 2PSJA 3TD2A 4LE0A 4NYMQ 3HB7A 2O1XA 3JV7A 4RK5A 3P9ZA 4KB5A 5EZYA 3GAMA 4ZVQA 2RAUA 1U0OC 1CSEE 4FCTA 4LUCA 3WNCA 4DCTA 1KK2A 4ROSA 1WRBA 4B79A 3C74A 3A10A 1DV2A 3D1LA 5DHTA 4BRZA 2PBRA 2DTDA 3U4QB 2WIAA 4EHAA 2VDRB 5F1PA 1J22A 2HMTA 5MN5A 2W6PA 1FS5A 1PDVA 4ER5A 1XKXA 3JZFA 3SXPA 2VG8A 3CLSD 1TYAE 4GPZA 4KDRA 1E7SA 4D5GA 2NXWA 2R5FA 1WPRA 1O2DA 2DFDA 2QYHA 4MICA 2WNIA 4WK4B 4ZJYA 5A9SB 5FR1A 5FLXA 4G0XA 1J23A 3ZGYA 5BSEA 4UDOA 2J5XA 3X0DA 1E7QA 4KXVA 1SY7A 2ZANA 3H2BA 4TT3D 5F73A 3CH4B 2MT9A 4CI0B 3DT8A 4DEXA 2Q6LA 3NJ8A 4UUBA 1J09A 5CK4A 1J00A 2X1MA 1OZGA 1XAGA 2BW0A 1ISRA 3LUGA 1EVZA 4I9HA 4PHTA 4X5OA 4R7GA 3USZA 4D6PA 4E7OA 2Y1FA 5IDQA 2C8VA 2PT6A 3L8YA 3LDAA 3PYXA 2QR2A 5SZKB 3LRXA 1N4AA 3WMFA 2C77A 3BXGA 2AX3A 3ELYA 2Z5FA 3E7PA 4OQFA 2LPMA 2DKNA 5FOWA 3WWZA 2J5RA 4CEHB 2WKPA 1XPUA 3GLFE 1A9RA 3FCUB 4MR7B 3VOBA 2KW5A 2OZVA 1PV1A 1BE1A 1V6SA 1BKDR 1ZMXA 3CUTA 4HNTA 1Y1SA 1E5QA 2A35A 2RBGA 3QFHA 5EWLA 4DSZA 1H8ED 1KRXA 5F7OA 4G6ZA 5COAA 1N2OA 3WICA 5BUQA 4NE9A 4TLAA 1ZOLA 4TLLB 5IJXA 3DBIA 4N1AA 1S8AA 2HREA 2SHKA 3K1JA 3OIDA 3PUKA 4TGLA 4U2FA 3TB4A 2QDKA 3HG7A 3K96A 1ZC4A 3OPYI 3ZYZA 4F4CA 4RMNA 5JZVA 2PFGA 1IIRA 4C08A 1UDXA 1ZEMA 1ZYUA 4O5AA 3TTYA 1QOQB 2E7ZA 2NVBA 1XZBA 3F98A 3QENA 4HATA 3STVA 3U4AA 4D43A 2UVDA 1I3KA 3W5IA 4AUMA 5L51A 4LMRA 4UTZA 2V98A 1CQZA 1SUEA 5AR1A 3KEQA 1H2WA 1V8OA 4RK1A 3U19A 1QU2A 3S27A 4Z9FA 1YB7A 2QX4A 4ZOEA 3TLGA 1BE0A 2HDNB 2MIIA 4N0DA 2DCMA 4GG1A 3KR2A 3CCCA 1VHQA 2WFZA 3N2YA 3DFMA 3JRWA 3DOCA 2IX3A 4C4XA 2DSNA 2E4YA 4TLMB 2PIAA 1WUHS 1VE3A 1M10A 3BKXA 1VE1A 3QG1A 4HEHA 4UBIA 3DM5A 4MS3A 5BN1A 4MQ5A 3BIJA 4PGHA 4ZT3A 3NHUA 4LHZA 4QFBA 1N5DA 4E11A 3MWJA 3PDIB 4NP6A 4PPYA 1P29A 2XEXA 1CJUC 4R98A 3HWRA 3F71A 4PFKA 4FFLA 3AUUA 1PFGA 1XB2A 2HSJA 4NENA 5IAAA 4O1IA 1MXHA 2FP4B 1JAZA 3WK7A 2EKBA 3B1WA 1VRCA 3UV7A 3BA1A 3UYLA 1OGJA 4GWGA 1XRNA 4BVGA 2WMDA 5HKOA 1ZQ1A 3D3JA 4OP3A 1WCYA 1ZGBA 3C8UA 4Y3UA 2W2LD 2YBDA 4ADSG 5A4MS 3R5XA 2H1CA 3QEAZ 2PMWB 3GA5A 1N2GA 5HRAA 1O95C 2PMCA 3VJRA 2FSFA 3FSEA 4IDFA 4ETIA 1SN7A 4E12A 2PZFA 2IL1A 1AHIA 3B3GA 3CW9A 4CU2A 1B3RA 3KKQA 1HEYA 2ONYA 1KBZA 2Y92A 3P8ZA 2FGKA 4UCWA 5KPJA 1P2SA 5FWXB 5BUZA 3IE1A 3G7NA 1CDZA 1L4NA 3LY7A 1XQWA 4H7EA 3ISJA 3VO9A 1FSPA 3U80A 3ZWMA 1ISFA 3MN1A 4JVSB 4O8CA 4RY9A 5BVHB 4KTVE 3CNOA 1RFGE 1ARZA 3DF9A 3QLUC 3W2GA 3G82C 4HDNB 3HGTA 2WY2D 2RH5A 1G7CA 2ZWVA 3JQ9C 4JMPA 5A1JA 5KYKA 1D6MA 1GY8A 1F7VA 3OM9A 2GEUA 3V9AA 2VJMA 3DE4X 1KDOA 4B7UA 2ZTMA 1SBTA 1T6BY 6NULA 2VHYA 4ZPJA 1U0LA 1YB2A 1YUNA 3A2LA 3VI3B 3OURA 1JIJA 1RHJA 1QPGA 5D2CA 4AO7A 1R9JA 1FK8A 4PLYA 2KI5A 3RS2A 1VPTA 2JCSA 3BE8A 3ORQA 4MV5A 1U3CA 1NUQA 3P19A 4EFDA 5KQRA 5LLTA 221PA 2FZKA 4KUHA 3B6IA 3P0JA 3VX3A 3DVAB 3CLRC 2XSZD 3BS4A 3QU2A 3SYTA 1XL1A 4N5DA 1HTTA 4NATA 1KIMA 4C4OA 4KTTE 4ZT2A 5AW2A 1X13A 1J0BA 4YQEA 4F1WA 1QSGA 2Q1TA 3VVCA 4NMXB 4MVJE 1ANKA 4RGBA 5CLQA 4DV6B 3FOFC 1R12A 3SQWA 1N7HA 1T6YA 1RRPA 5I7WA 1OYVA 2G1JA 3VC1A 1V1RA 3LKZA 4DADA 1UIRA 2ZWOA 4DIKA 2RHCA 3LT0A 5AI8A 3T3HA 5LWHA 4YRCA 1A3CA 4RJKA 2J08A 3OHPA 3MPOA 4KKVA 1SZJG 1WMEA 4S1TA 4PC3A 3CLKA 3P9RA 4R1LA 2V45A 1UQUA 3H6HA 2IYZA 2P91A 4CTJA 4UFOA 5H80A 1JI0A 4DLSA 4HFMA 1OV6A 5CB8A 2ZU0C 1JDBC 1VLHA 1CUEA 4HTFB 4OXXA 3DBHA 1U2DA 3JALA 1VPWA 3VR6D 3OE5A 3R3YA 3W0LB 1WCIA 2O2IA 2X1VA 1QLHA 2P6PA 5CBKA 4X20B 3FI9A 4LVUA 1OAOC 3ZDQA 5K0SA 3TVYA 5EA2A 4D99A 4ILEA 4D9BA 1CY8A 5IH7A 4JYZA 3FPCA 4ZT6A 2QNRA 4RESA 1E3EA 2EJUA 3HXQA 4ZQHA 3THXB 4JLOA 3WTCA 4DJTA 2FUEA 1WQ1R 1T0HB 3L0PA 1KI6A 5C5CA 5IBCA 3KSMA 2I6SA 3SLGA 4RVNA 2VP0A 3B82A 4HGQA 2OUIA 3QJYA 2CXXA 2PGNA 3MJDA 1PWEA 4HOYA 1LDYA 5EQDA 4CLHA 3VSCA 5IYZA 1IM2A 4PHGA 2ST1A 2QEQA 4HNRA 4XQ9A 4DDUA 4ZI7B 4F5DA 2HPVA 4P34A 4OLJA 4BVBA 1GA6A 1H6BA 2F3SA 3PNBA 1XA4A 1QJ4A 1ZLXA 2H7CA 3OQPA 3ORRA 3K8YA 2PZBA 3O75A 1NJ8A 5A6SA 4Q4LA 1T5TA 2ZUVA 3RH0A 3T99A 5IXJA 4YAOA 2YASA 4FDUA 1T3LA 2AZTA 3OUZA 2Y0CA 2SKDA 4GZ6A 1ECBA 4L4RA 4PX5A 1O94A 1MG0A 2HNBA 2PL3A 4G25A 4G63A 3W79A 3WMGA 4E5KA 3THWB 4HQLA 3HA2A 3ZH2A 3EA0A 1YZQA 1Z45A 2A9KA 2I2XB 3QIAA 3AERB 1Z0KA 3D6MA 3HGQA 3TQIA 1FYDA 5IULC 3GR6A 3P2EA 1JDNA 4YP6A 1QVVA 4P31A 4E2WA 5H70A 2ZT8A 2OMEA 4EG3A 2G0NA 3GX1A 2IGBA 4I5IA 1WTAA 3UY4A 4QGHA 4OJMX 1EK1A 1K7XB 1LI5A 5THKA 2RHOA 3B5JA 2OYRA 2OAQ1 1DUVG 4KJZA 5EIAA 2JVKA 2O2YA 4JN6B 2HBZA 4M0PA 5F12A 2G1PA 3EGOA 1U8TA 4LFAB 3RS8A 5D01A 3TRKA 4EY6A 4GM4A 1TO2E 3FTQA 3O4HA 1Y82A 4HRXA 4R16A 3EWSA 3RSQA 4HL6A 4R3UC 3T8YA 2XQVA 3NC1C 1E5XA 3CF4G 4D9HA 5KMGB 3RFTA 4B3XA 3ED5A 3QXSA 3EW9A 4FW9A 4FS3A 2AIRA 4B81A 2GZAA 3VYSB 4AMZA 3ESQA 4C87A 1TM7E 2QVXX 3SE0A 3PL5A 1R0YA 2BMWA 4DCJA 2CNNA 5CGZA 1SC3A 4E6PA 5CA1B 1G20A 3DT6A 2JHPA 4TMYA 2QJRA 1G9XA 1EHYA 2PZKA 1V3QE 1UAYA 3COYA 2VQDA 4MKIA 3HWWA 3NHBA 4M7WA 4P4SB 1ZJ6A 4FEGA 4Q7JB 3F6SA 1MJNA 3U40A 2RHJA 3VH1A 5B7PA 2R6AA 1T8RA 3GEIA 1G42A 3EZ9A 3PC7A 4HYTA 1JIQA 2P9YA 3RVLA 2R96A 4DUZB 3O2NA 3TNYA 5EE9A 2TYSB 5IC4A 5EMLA 3WL5A 1WW2A 2F4NA 3NKFA 3TNLA 3L4JA 1DFGA 2EL7A 4LGYA 4CNQA 1XAJA 2WJJA 4RE6A 2O8DA 2GEVA 3MYYA 3STWA 3VYVA 2ZR9A 4MQLA 3M4YA 1RVV1 4LY6A 5KCMA 1Y34E 4IYRA 4FCWA 4AMGA 4CGYA 2QRVA 1XMXA 1Z6PA 3TCKA 1QV6A 4FUTA 3ECSA 1NASA 4RKQA 3OY7A 1B73A 3L1VA 3O1LA 4QDZA 3DWFA 4L9WA 1EE2A 1BXKA 1O4WA 4WAUA 4K9QA 5EHXA 3NTVA 5B2FA 4AU1A 1B6RA 1ZK1A 3NKVA 4GMXA 5ALDA 4DMFA 4I4TF 4U2DA 3Q3IA 1Z26A 1VHDA 2IELA 4TLDA 1SBQA 4XYBA 2A5YB 4PSAA 1EUDB 2NTNA 2C1XA 1Q2UA 2XRMA 1MQ9A 4G0OA 4I9GA 4OHFA 1GN8A 3HVJA 3GLQA 3LHIA 3OY2A 5DM0A 4JL8A 1PEDA 4DM4A 5HRCA 4D0SA 3LC1O 3P26A 4F6RA 1GNLA 4HZIA 2OYSA 4M1OA 4URWR 1KIFA 4GKVA 4NYIQ 1PP4A 4E1VA 1RWKA 2W6IA 2DHRA 3QJ5A 4EATA 4URXR 1MB4A 3BMCB 5AKGA 4C0QC 2YHIA 3GNSA 3HEBA 1HSZA 2HMUA 4LI3X 4LYHA 1NU8A 4PRZA 4X45A 5DIFA 4AN0A 4KO8A 1RYNA 1W6RA 2VDWB 3CT4A 3EWNA 1ZRHA 4HD8A 5IUJC 2OXCA 1DQYA 2XUFA 1PNVA 1MX1A 3FD8A 2D5CA 1R0LA 2V5VA 2WD7A 4UBJA 3RARA 2YS6A 4PPFA 1S3GA 4X0EA 3F6EX 3AINA 1TTTA 3MCVA 2OHXA 3V4PB 5KJCA 1JEAA 1YBVA 5CH8A 3E0QA 3GJ5A 1PYGA 2FPUA 2I4RA 1DC5A 2PKWA 2QM0A 4CDNA 4ND8B 3QX8A 2HV9A 3DE7X 3X3HA 4IRMA 4B3BA 1CHDA 1WVGA 1JQ5A 1SVKA 4Q9HA 1L4GA 1EZ4A 2IF2A 2GETA 1DAMA 2HUNA 1RLMA 5EKDA 4G0UA 2Q7XA 5CNKA 2RG7A 1K2VN 5J2UB 1AU9A 4EI7A 2Q2VA 4UCXA 2EZUA 4NIMA 1B3BA 3FMOB 4E08A 2CL0X 3UHAA 3PEYA 4ES6A 1OLXB 1JE0A 3R7BA 4MW0A 2GDJA 1YS1X 1R00A 2A4KA 3F1LA 3MJSA 2Z1DA 1ZPDA 4C21A 3GRYA 3DE0X 1GUZA 1XVLA 3U6BA 2ZIWB 1SR8A 4PYQA 1X1EA 1L8AA 2B94A 3GXBA 2IYAA 3JVUA 4UQOA 3HJNA 2F8TA 1SUPA 3ESZA 3M1LA 1NXTA 4JUBA 1F4LA 1PJ3A 3AF1A 3TQSA 4BLOA 1T8UA 1YKGA 4BVEA 4YRIA 1VM6A 1N0VC 1SCJA 2L18A 4PRLA 1AJEA 2ZCJA 1BVHA 3JZMA 1PWYE 4EFKA 1T0BA 2Q45A 4ACBA 2VTBA 4NCNA 1PEAA 3R5SA 1SURA 5J63A 3WLTA 1GGKA 1KEEB 3EIOA 2OXIA 1V1MA 1XZPA 4LV6A 3NH6A 4K88A 4M1ZA 3HDYA 3VO8A 5AUQA 1GIAA 5ALJA 4E70A 3P2IA 5A62A 4P84A 4Z8YA 1LDMA 5DGHA 2ZSFA 3CZMA 3DE5X 3B2QA 2XUKA 5FHQA 1YQXA 4XR9A 5IXSA 1UXOA 1SEPA 5EINA 1ENZA 1FDIA 1USIA 2WOJA 3O92A 2AEEA 1QRDA 4HVAA 1ZUHA 3AVPA 1N9GB 4PM4A 4RABA 4CQNA 1ZUNA 3Q0EA 2Z3ZA 4ZJZA 2FETA 4QBIA 5FOTA 4JBYA 4ZOLF 4XSHA 1N3YA 1UEIA 1FP4A 1W2HA 2DF8A 1MQ8B 2Q0HA 2Q1UA 4WSOA 4EVQA 1GAEO 2H9YA 1UM9A 2W6JD 2XE4A 4XJXA 1JJVA 4B45A 3AESA 4RL6A 1UKAA 1ACMA 3K9BA 1G5HA 4U02A 5BPFA 1RRCA 4NRDA 3WVNA 4W7IA 1YL6A 4QPJC 1R8XA 2CJWB 2BMEA 3BFVA 4J0DA 4HSEA 3VR5A 4NEQA 2EL9A 3AFGA 2IYVA 4LNUA 3T1YB 3WI7A 3NBZC 1G8YA 1R0SA 1KERA 2A67A 2YMPA 1DLJA 2ID9A 2IZOA 3A37A 3LQ1A 3HPRA 5JRDS 1D0SA 2YNMC 3TMKA 5IN5A 2D1RA 3FNQA 5HJEA 1U99A 1FTSA 5CB6A 1NXSA 1PWXA 2Z56A 4QUEA 3M3DA 4Q24A 3QELB 4NVRA 4YACA 4OJNA 4DIUA 3GO4A 5CDTA 1R0RE 4G4GA 4E33A 1LX6A 5H4GA 4NBWA 4G0QA 5ICEA 4EFLA 4J4TA 4DNQA 3NTQA 4MWOA 1DP4A 3R23A 1MORA 3CMMA 3Q8XB 2AFHE 3L6EA 3A14A 4JNCA 3WYBA 1O95A 1P72A 3L7BA 5DI3A 5IJWA 4UHHA 3I3OA 3VR4A 5K0TA 1F2UA 5BO5A 2QX7A 1IM8A 2XGGA 3IHLA 5JFTA 1Y5LA 1JKJA 4L8GA 5LLSA 3HU2A 2O48X 2FX5A 1GDTA 1NMEA 3QUQA 2H5EA 2NZWA 3GN1A 4C20A 3IMFA 1CY0A 1FA9A 3NTXA 2G08A 1DADA 4L27A 3RROA 2CE2X 2HLPA 4MWBA 3ZV5A 5KTNA 2WINI 2XBMA 3QLUA 2NSDA 5JMWA 3E8MA 4D9KA 3PHCA 2AMVA 4OGLA 2I2DA 1D4AA 4F8EA 1G0NA 3JQ9A 3ASYA 6LDHA 4L9AA 1CUXA 3UENA 4LSZA 3Q87B 3FCYA 4UEKA 5FO0A 3TLKA 3ZQKA 4ABYA 4E5UA 5JAIA 1U4NA 1KQ3A 1HGXA 3B7WA 3DMTA 4QOFA 5K9ZA 1TJ4A 1VTKA 1X3LA 2O7QA 2IHTA 2ROQA 2ZWAA 5EE1A 1QTQA 3GZ4A 1AKWA 3N3BC 1OBOA 3LUCA 3H16A 1STOA 3PFFA 5CT8A 4YRTA 4OMUA 3VAAA 1ODJA 1KVUA 4RPKA 3BHNA 4CMJA 4MWZA 1SOVA 1GCAA 3R9KA 3NB0A 1HOXA 1MPXA 3D8UA 1QE3A 1L7XA 4XJTA 5H3LA 3ZOKA