3GOQA

Crystal structure of the tyr13met variant of bacillus subtilis ferrochelatase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
307
structure length
307
Chain Sequence
b'RKKMGLLVMAMGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title Crystal structure of the Tyr13Met variant of Bacillus subtilis ferrochelatase
rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 117
structure length 307
sequence length 307
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2009-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3goqA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3goqA02
2XWPA 2Q2NA 2Q3JA 4KLRA 1QGOA 2PO5A 2C8JA 3LYHA 2H1VA 1C1HA 1L8XA 2PNJA 2JH3A 2PO7A 1AK1A 1C9EA 1N0IA 1HRKA 2XWQA 4KLAA 2XVYA 3AQIA 2HRCA 1LBQA 3HCNA 2QD1A 3HCPA 1LD3A 4KLCA 2QD5A 3HCOA 2QD3A 2Q2OA 3HCRA 1TJNA 2AC2A 1DOZA 2HREA 2XVXA 4KMMA 2DJ5A 3M4ZA 4MK4A 2QD2A 2QD4A 3GOQA 2H1WA 3W1WA 4CCSA 2HK6A 4F4DA 2XWSA 2AC4A 2XVZA
chains in the Genus database with same CATH superfamily
3N2GB 2K5UA 1DX4A 4H0CA 3CC8A 2Q27A 3FHOA 2H51A 3PYLA 3M1AA 4DNFA 2J9FB 1KNXA 4QICA 1C0IA 5EJ2A 2VF7A 4M0DA 1LX7A 5E6RB 2ZIXB 3RVBA 1ONBA 2FFRA 3EIHA 1MQSA 2WT9A 3L8HA 1L8AA 3LQ1A 5JY1A 4CLOB 1KH3A 4WW0A 1G5TA 2AJDA 3HCWA 1ZYUA 4GZMA 1SEVA 2IOFA 1TM3E 1SRRA 4P32A 3HH8A 1A2QA 3PUIA 3GR6A 3MCUA 4NCJA 4JQSA 4DSNA 2FFBA 4JI7B 1VL6A 5AVKA 4WFQA 1HQYE 1WU7A 1K4MA 2QP9X 4M22A 3WIVA 2DUWA 4HBGA 5JS7A 2C31A 4FGZA 1HM5A 5KO2A 3O3MB 4GM0A 5A1JA 1MR3F 1GTG1 1HE2A 1YRBA 5TPZD 4LOAA 3PX7A 3RQIA 3WI7A 4JBWA 4GX1A 4OREX 1WBDA 3MHTA 2OTCA 3BHNA 2Q9BA 3A14A 3T9EA 1IJEA 1T8UA 1VE6A 3CZ9A 4ZQIA 1ORHA 2QTTA 2WOJA 2Y0CA 4K1LA 3HJBA 3PRHA 5FTWA 3C41J 3RIYA 1N1DA 5AH0A 5HGXA 4YY3B 4LTNA 4C4AA 5K0JA 5BYJA 1UM9A 4MROA 1JWLA 1E32A 4HEA6 4V38A 2JCSA 3QKSB 4PYIA 3L7YA 4OUDB 4U0KA 5TV2A 3NFRA 2NZWA 3U7RA 4RD6A 4D8YA 3T4EA 4MX8A 2FGJA 4ECAA 4Y6PA 3GPCA 3I2KA 2FN4A 2XA1A 2ZP1A 4I5IA 3ZD9A 4DGSA 5ICSA 3CRZA 5L40A 4MUGA 3UJ9A 1RAEA 4H7KA 4CM4A 1ODCA 1VLVA 3F4KA 3AR6A 4IGFA 3FSRA 1NDQA 1C1HA 2R68A 3K2IA 2BR5A 3FZQA 4GLOA 4JLWA 5EHIA 4D9GA 2FN9A 1B14A 4PNEA 2FFJA 5IDXA 2VP3A 4LS3A 2J31A 4OBXA 4GVPA 5ERXA 2CCJA 1WW3A 4QQFA 3WAKA 1TEHA 4JZKA 2HSWA 1T6YA 2C4HA 3T7IA 4ECEA 1SVMA 1M72A 3DYVA 4YAEA 3IUMA 5FAXA 1IHUA 3L77A 4FGWA 4MMXB 5FJJA 5A4AA 4G26A 4EA7A 4C2BA 1F8YA 4QUBA 4TM7A 1F7UA 2Q3CA 4RWEA 5ITZA 5F64A 1KF0A 3JARB 4L6AA 4CMEC 2JATA 1K6XA 4CYMA 4PCAA 4F8EA 5B3KA 1VP3A 1T0HB 5ALIA 3OQNA 1JQEA 2CUNA 3L1UA 5DX0A 4U39A 3BXXA 1JG2A 3K8ZA 4B8YA 4ZVKA 1BD4A 3F5QA 2YOHA 4OQFA 2JPDA 3I45A 4TUYB 3WIBA 5A6SA 2EJUA 2ZSBA 2WVGA 4ID3A 1TFUA 3LM8A 4OB8A 3NAMA 3ANYB 4HDRB 4CQMD 4Z7OB 1QVZA 1B8NA 1DHTA 3HZOA 4V3CA 3TQIA 5DN6D 1EXDA 2WMOB 3I37X 1W9HA 4G5OA 5ECYA 4D3XA 3FPCA 5KJ1A 1A1VA 1W88A 2OCAA 1QP0A 5FV7A 4F72A 5EJ8A 3AH8A 3BEDA 1Z2PX 4GI3A 2DCMA 3F6SA 4NNOA 1YA8A 3EXAA 1PG0A 4IXMA 4U02A 4JIMA 3BRWD 4GDMA 1VLLA 1SZDA 1JLLA 5K0LA 4B4OA 3M6VA 1I7QB 5T7BA 3UOWA 2EHJA 2IXEA 4K88A 4HUJA 1OYWA 4O1MA 2P0YA 4I3FA 1QHNA 2QSYA 5ECWA 1NUPA 1UINA 1NJ5A 1LW6E 1AQYA 1YMQA 2JGKA 1W44A 5HW0A 3O0TA 4CEJA 5JDCC 4AY2A 1DQRA 1L0BA 3L7LA 1P2FA 2XMRA 1TE2A 4PG5A 1OXKB 4FMCF 3ZYCA 4UQOA 4OSEA 2XDQB 3HV0A 4DARA 2ZTSA 3O8OB 4GPTA 4GR5A 4ND6A 2EDCA 3QVOA 1SK9A 5EZYF 2TMDA 5GGYA 3V1YA 4J90A 4QYIB 4WCDA 1KTIA 1SG0A 2CL0X 4LWOA 1A98A 5T41A 3H8WA 1W4LA 3RFTA 4D4GA 2UZ0A 4F9FA 4U5XA 1U3TA 2XT9A 5IVHA 3KJEA 1WWKA 5DRYA 4GOMD 1YMVA 1Z5GA 4OXRA 3KLNA 3SKYA 3UV6A 3ELDA 2I7DA 4LDJA 2XCQA 4US0R 5HX7A 2YYZA 3NP7A 4DIFA 5I45A 3BXGA 5FPQA 4WACA 1YDGA 2GX6A 3BD9A 4OO3A 1KAHA 2PYIA 1NE7A 3KYJB 3DE7X 1VMDA 3DL7A 2XMQA 1V8OA 5K3FB 2HPZA 2KLHA 4J07A 3AI2A 1ZVKA 4NYJQ 1JG6A 3I9KA 3WNZA 2XXAB 1XLWA 4Z2YA 1K5DA 1QLWA 2OGZA 5K0FA 2ZM5A 4GE0A 5H9VA 4RIEA 4CR6A 4BVHA 3HHEA 1TCAA 3K8YA 5DTIA 4C78A 3J7AC 1ZZGA 3PICA 2B83A 4FPXA 4I50A 4ZVMA 3SJBA 5JE8A 3TMKA 1VKRA 4AUNA 3NOOA 4B6QA 2XUJA 4WZBE 3HQ4O 1Z2DA 2I55A 3JCZA 4P80A 1OJ7A 4EG0A 4CXMA 3ICWA 3NASA 4Y9TA 3RG8A 4B3HA 1G64A 3BQNB 4H7DA 4OHWA 1XYVA 2V7WA 3F7NA 5E2IA 3VAZA 2HREA 5B1HA 1L5RA 4DCTA 1QYXA 2D0IA 5FXMA 4C22A 3T7RA 2GKGA 5EMKA 2FSVA 3ESQA 1MEJA 3RYIB 2O1XA 3E0XA 3QPVA 4MV1A 3K35A 4LJAA 3WLTA 3CSUA 4BV9A 5C4MA 1CEXA 5L95A 2IC5A 1CB7A 5EGSA 2ZIVB 2A3NA 4D4JA 1MO3A 2CK3D 2RHCA 2WF7A 1KMCA 4IKOA 1RCTE 2GD1O 2XOEA 3IMKA 3A25A 1E5TA 4QDKA 4UUQA 5BR7A 2VDWB 4U7WA 2IH5A 3GN2A 3FIJA 3GCZA 4D80A 4KI0A 1PGNA 4TKUA 5C1OA 3KZXA 3A1UA 3ZW9A 3PQCA 4JLUA 3AB8A 3F74A 1Z5VA 2DPMA 1JJAA 1UQUA 2Q4TA 2R1VA 1ZNZA 1A9PA 1BHO1 1EP3B 1NIJA 4JNCA 4WGFA 2A67A 4XX0B 3T3EA 3TRKA 6CHYA 1IEXA 3INYA 1GPKA 3L8ZA 4HBZA 3PXBA 3KXIA 2BYTA 5AUQA 3ND6A 1DCMA 1XQ1A 2FLVA 1R6VA 1RYHA 3BQ9A 3DE0X 1DJLA 2GERA 2NUTA 3ZOKA 3TMYA 4GOND 2F8SA 3QLUC 4M7WA 2Z83A 1G20B 3MMSA 3KJZA 3U5TA 4W6QA 3D3KA 3ZGLA 4CM9D 1S0UA 5J63A 1R0WA 3O4VA 2FSUA 4HDMA 1SZPA 4JDUA 3EH2A 1ID1A 1HH4A 1PDVA 2ZDHA 5DK4A 3GLHB 1W2GA 2ZR0A 2IWHA 1RLTA 3WB1A 4RA9A 3KKEA 2WHRA 5ALOA 4PHCA 2G5CA 3PPWA 2PEZA 4YFVA 4BU1A 1XHEA 2GKOA 4L75A 1U0JA 4P7GA 5CNIA 1J49A 2PQ2A 4CUKA 4EPXA 3CIOA 2NLOA 5KNBH 2G09A 1RM4A 9MHTA 4U1RA 4PYRA 1EFPB 1X74A 3EXG1 3F4BA 3RK4A 3FB4A 4G8BA 5BOSA 2GZSA 4QODA 4EDHA 4GG1A 1BU5A 2OHFA 3AG6A 5SV2A 4D8VA 2PFSA 3ZZNA 5KX5B 1KFJB 2ISSD 3H0EA 1ADCA 5HF8A 5A05A 1UC9A 3EC1A 4K86A 1QIKA 3KLPX 3F71A 5K6AA 1NR1A 3NVMB 2XZLA 5IXSA 5IUNC 3ZOZA 3EBOA 3EZLA 3LCCA 4FE4A 3S4YA 1GNQA 4TXNA 3BH6A 4LRUA 1QKJA 3WLKX 1YO6A 1DE0A 4KIUA 3ZVKA 4DSZA 5JVDA 1PR0A 1E0KA 3HGMA 1SXGA 2RK6A 4MW6A 5TGTA 2WWFA 1HFEL 2GHTA 3K73O 1JAHA 2PLRA 3BHMA 3H4TA 4RSMA 1OLXB 4UUPA 4CIDA 2ANCA 4HADA 1RQNA 2QZPA 3ED1A 4BQFA 3IMGA 4P93A 4GPZA 1FSSA 1OV4A 2A9OA 1PFVA 5SZKB 3V2HA 3IQZA 2OM2A 3IT2A 1M10A 3FDZA 4BMPB 1X80B 4RPJA 1ZIXA 3L0ZA 2BBSA 4PAOA 5KJFA 5AUOB 1KXJA 3DXFA 5DN9A 1DKMA 4AM8A 1OFTA 3TL3A 5HKAA 5K4GA 4KLRA 5A4DA 2PKRA 2WU4A 3A7DA 3CKYA 2BKAA 3HY4A 3QKRB 2R4TA 2AF4C 2V8OA 4BQIA 2XSZD 1UP6A 4H17A 5J5VA 3QF7A 5A0TA 2BIFA 1HSZA 4YJGA 1ZD8A 3TIFA 4R7ZA 4RVNA 4TTIA 3BWEA 1M54A 1WRBA 1JHRA 4II7A 4TTAA 4X45A 1FUUA 1JR2A 1Y8CA 4B8WA 5KOHB 1L1FA 3WAGA 1ILEA 1J4AA 2ADMA 4S0ZA 2X8WA 2NVBA 3T1OA 2QT1A 3OCWA 2YMLA 3W3AA 4EITA 4D0GA 2E1RA 3OIUA 3UH0A 3A9UA 2O8DB 1MV8A 1SBQA 4OM8A 4M38A 1WNTA 3JWEA 5ECDA 5KTOA 1GDHA 1PJBA 2UZ1A 3E2PA 3Q10A 5K0TA 2Q5JA 1I2AA 2YHAA 3WK6A 4D8WA 2AQHA 3QVTA 2ZI6A 3L79A 1I14A 4W5QA 3KDAA 4PLWA 2R86A 4ZANA 5LXTB 4N41A 2IKSA 2WUWE 1IATA 1JFRA 3RIMA 4P4NA 3U4GA 4ATNA 3AFNA 2G1PA 1IVYA 1S96A 1C7ZA 3I0MA 1H66A 1KY5A 3L6BA 3JTEA 4OXNA 3ZWNA 3KZCA 4JKYA 3T95A 3X1XA 1KI1A 4IEEA 5ITSA 3QBDA 3ZHRA 3A2LA 5DGCA 3RS3A 5LNK1 1ISGA 2JGDB 3ROMA 4U00A 1QV6A 3KL2A 3ZCQA 4EFDA 3MGAA 4ALNA 4ZZ2A 3F97A 1AUVA 1F48A 2LXNA 3I9NA 4HTFA 3RFUA 4TV9A 1EDZA 2O7QA 1PJ2A 1XQXA 3RBZA 3ZWOA 4F3CA 3HBLA 1GCUA 2OXRA 3E6AA 2XUFA 1II8B 2HC9A 5FA8A 1BHSA 1XTBA 5HZMA 3TZHA 4YCMA 2DOKA 4ZMBA 4Z4GA 2VF2A 4BNDA 1QYRA 2DQSA 5DLYA 3IPXA 3ECSA 1D1PA 2G08A 4PTZA 1H85A 1N2HA 2AI3A 5AO9A 5ESWA 5FOVA 4B80A 1MH9A 3TLAA 1VOTA 2XKJE 4MV0A 2M9MA 5BP7A 1ZP6A 2QN6A 1TKBA 1FLNA 1NL3A 1MPTA 2G1AA 4FT2A 1BIFA 1ZWLA 5FFNA 5HFAA 1XZQA 1QCZA 4YYEA 1RYNA 1G4UR 3R24A 2OEPA 4L5BA 4KE9A 4PBTA 1KDVA 5E7QA 3V2GA 4QG3A 5JSZA 5EPUA 5TQ0A 4ESOA 4MR9B 3O82A 4CGYA 3L1HA 1GILA 3PC8C 2Q3FA 4MEBA 2WF6A 4YP5A 3T7SA 4Q1FA 4E4RA 4YUVA 2D2VA 1KAQA 4IWNA 2ZJFA 1CP2A 3OO1A 4IGKA 4FYKA 3SKVA 1RAIA 4K6FA 3V7WA 5BW4A 5HQ3B 2VH1A 2XKAA 4FFWA 3OIDA 2QEQA 2R47A 3MAAC 4XOIA 4BXOA 4GHWA 1WXHA 2Q0XA 1K1EA 3W5SA 4DLWA 3ACDA 4OP2A 1QH1B 1ZY2A 3LQFA 1USKA 4KBFA 1QHSA 4V0ME 1Z26A 1FDTA 5FPTA 2GBLC 2YCBA 1SD5A 4X97A 5B2ZA 1Z08A 4ZMSA 5JEDA 4LWPA 3N8NA 1S6YA 1R66A 4UM5A 4EGJA 1TD1A 1ZK1A 2VT2A 1QR6A 3FMOB 3WQSB 1G9XA 3JQFA 4N48A 3UW3A 4B6JA 3AR5A 2VSXA 2RFLA 4K9QA 1O96A 3C8ZA 2Q3JA 4GKKB 4LF5B 2EKPA 3O83A 4EELA 4TTJA 1R5JA 2HKIA 4HWSA 4KDCA 4KGZA 2GK3A 3SC4A 5CXXA 5L9AA 3RS4A 1WUJS 2ZJ8A 1KVRA 5CM2Z 2V3CC 3BDVA 2AA3A 4PIPA 1IQPA 2JF0A 1R0RE 1D4FA 3FCCA 3GLVA 4QDJA 4Q9DA 3U26A 1XQWA 1AKNA 3R6GA 3AOGA 2UZIR 5ITVA 1NPDA 1SKQA 4J76A 1Z73A 2A94A 3FKJA 4NU5A 3I39X 4MAMA 5JD6A 3A3PA 1A2KC 4X6LA 2R1TB 1BYUA 1V1JA 4IDOA 5FNVB 4MJ7A 3IR7A 3RQSA 3VDXA 3RT1A 3WYGA 3L04A 1XEXA 2YWBA 1DVRA 2XUKA 3GXOA 2Q0QA 1JHZA 4PO8A 1HPLA 2FN3A 1SCJA 1IN8A 1JTEA 3H2YA 5FI1B 3EBPA 3UWSA 5JZVA 3I9V1 1E1RD 1Y82A 1ZK0A 1YIAA 2GPTA 4TT3A 1B26A 1GZVA 2B0CA 3GH1A 3I12A 1G7SA 1QX4A 3PF9A 2KPOA 4TQUS 2Q2QA 2H7YA 4RENA 4RJKA 5TJHA 2O07A 3HYNA 3AJ8A 4YRIA 5DTRA 3OQ1A 5DBIA 3S5JA 1FQWA 2X9VA 2VNKA 2ZSDA 3GJRA 1XD8A 4YDHB 3AXSA 3EZ9A 1K7XB 1LDMA 1O08A 3ETGA 1I3NA 2YY7A 1QFSA 1JIIA 1B0PA 4RMIA 4IVQA 3VTFA 3CLRC 1EH5A 2O2ZA 4BNFA 1ZINA 2OCXA 2WUVA 1JLHA 1KGDA 1SG6A 2ZITA 3GP5A 3GUVA 3H8JA 1V4NA 1NBME 3P52A 3RANA 4D0NA 5B55A 1I5RA 4DQ0A 3IIMA 5FV4A 2QMQA 4PLPA 4QU0A 3JALA 5FUWA 4HUTA 3G2OA 1NN1A 2D1RA 4E5VA 2SHKA 3G2JA 3MMXA 2G0NA 3FVVA 4JB8A 3ESDA 4XQGA 3ER9A 4IJQA 1F6WA 2PWBA 3WGNA 4IMPA 4DJDC 1H4SA 1XJCA 2CDBA 3IPRA 1JMYA 2A59A 4QNNA 1V6CA 2CHEA 1E2JA 1R3DA 2FGKA 3KQYA 3PXCX 3KXDA 3DV0A 2JHAA 3O3NB 2C3OA 4HFJA 1O6CA 3O8NA 2QNBA 4YQEA 5U4XA 4ZI2A 4EPYA 3IAM6 1M6YA 1QE0A 2GEJA 2I5PO 4FC7A 4LBWA 4RU1A 2EZ8A 1ZM7A 1Z2AA 5D84A 4BB9A 1I3LA 4H6PA 2BE7A 4BUZA 3EWSA 4KQKA 3U7GA 2P3LA 2VBIA 2ZSIA 3ZJTA 1NRWA 3X1ZA 4CRWB 3A6DA 1A5TA 1N5IA 4QGSA 2K4MA 2G8LA 1Z6TA 2G9NA 1YC5A 1YZLA 1RYZA 1VG1A 1A4UA 4DLKA 5IZCC 4RTSA 2WTXA 1V1MB 3OMXA 2REXB 1TZBA 3ONEA 1E4EB 3WBBA 2FQXA 3CA8A 2IHUA 1CY0A 2X6QA 4R2IA 4BLPA 3CXRA 4WKBA 4R1QA 1H5QA 4ZYYA 4WKCA 1VGRA 3EHDA 5DCYA 1JUDA 1E2UA 4JL8A 3DBOB 4HB2A 4MQEA 1BTOA 3VO1A 2PUDA 1WPXA 1AKRA 3QG5A 1RLMA 5KBYA 2DRIA 1E1CB 2GZHA 4QASA 2X5OA 2KI5A 1UMDB 3UPDA 2J3QA 3L92A 1ML3A 2FNAA 4DSUA 3HKCA 2BP7A 3JQAB 4V1CA 1COWD 3ZDCA 2OBNA 3RUIA 3AP3A 4ZYTA 1TUEA 1IPEA 1KMHA 1EJ6A 1SCKA 2A0XA 3UFXA 2IHNA 2NMVA 1NRIA 4HAOA 3PXGA 3T3DA 2R9VA 3USZA 4PVCA 3W3AD 1Y8ZA 3M1YA 4WXMA 3O47A 1QS0B 2IDKA 1YCDA 4N3NA 4YI3A 4LOLA 4AJ9A 2ZZMA 4JK3A 4NRDA 4O8ZA 4ZCLA 5BVHB 3UBTA 3PUXA 1ZN7A 5C0OE 3RWOA 2QU8A 1M34B 4JEIA 2GNOA 4UZSA 4Y0VA 1XZLA 3VU3A 4ZV4A 1NBMD 1GEEA 4HLCA 3DEZA 5T8KC 4DAEA 5HFJA 1O5OA 3SYNA 4DLZA 1IVSA 1Z88A 1DZ3A 2W6ZA 3HUUA 3OZDA 1KEPA 4UHDA 3ORFA 4JL5A 4D8TA 5JV5A 3UKJA 1Y1LA 1KSHA 1ZVMA 2DFVA 3SY8A 5ALUA 4K9PA 4D6YA 2WYOA 1GGHA 4UEKA 1JDNA 1M1XB 1HDCA 5AHRA 5AW3A 4FWTA 3MJSA 1KTVA 2YY5A 4HAVA 3CPJB 4ZAGA 4LY0A 1M2GA 1GGJA 2J5KA 1RQGA 1WSAA 3K0FB 1SWVA 2NPOA 1WHTB 3HI4A 5NLLA 3QE2A 2PX3A 3GGGA 3O0DA 2Y1FA 3FRHA 3MPUA 5JFGA 3LQRA 2PR2A 1GKUB 1U9JA 3GLKA 4WD3A 1GV1A 5JDIA 2H9AA 4HVAA 3DDSA 1BXRA 3EMDA 3QELB 4TV8A 1ANKA 2PX4A 4V2UA 5EZYA 3TZ6A 3V7YA 1JL3A 4PSCA 2XGJA 2EP8A 2JD2A 4I19A 1SHKA 3F6BX 1Z9BA 3H04A 4OXQA 4EUFA 3P9NA 3LW8A 3O92A 4GQAA 4AZTA 4F2PA 3ZNNA 3P0EA 2Y0DA 3WLFA 4B34A 2E4AA 3EIUA 1KU0A 5AVTA 1PFGA 4R4JA 3RRBA 1TIKA 2HYDA 1HMYA 2AQIA 2PS1A 1C0PA 2ZS8A 5CGZA 4QXRA 1QZ3A 2QMUA 3SNKA 3T7EA 5COBA 5DWDA 4UNPA 4MITA 5K0BA 4EF6A 1TAUA 3X2EA 2H1IA 3OHSX 3GLGA 3HSKA 4GF5A 1SBNE 1Q11A 4IYJA 1D2EA 1IUOA 2ZJAA 4B7UA 1U9IA 3L0DA 3N8KA 1A2OA 2RI6A 4IM7A 1NQXA 4IUBS 1FRVA 2QG9A 2HJVA 5FHRA 1CUZA 2XNJA 2F59A 1AK2A 3Q7IA 3VMMA 1A96A 1JBKA 1W34A 2O57A 3SNHA 1NBHA 2XF2A 3PQFA 3L6RA 1RQLA 5GM1A 2DH6A 5CP8A 3SE7A 5ED0A 4ARCA 1EFDN 1O1YA 1D7AA 4TPKA 4QT4A 3D6HA 4EY4A 5LQRA 3ZXSA 4H16A 1IRIA 2CWDA 3RD5A 3GFBA 3MZ0A 1DEOA 1J8FA 3P2YA 3T8YA 5C52B 2X5XA 1FIUA 5JQGB 4OHVA 4NQZA 3Q87B 4D56A 5ILOA 3BUSA 1CIJA 4ZGWA 4WHMA 2AW5A 4S1PA 4TWRA 1DV1A 2I3BA 4KO1S 2W22A 1WB6A 4BNLA 1WZCA 4KJZA 1P74A 3KR1A 3SZOA 2AOUA 3DV2A 2F90A 1CDEA 2VJOA 2NOAA 3WKEA 3AINA 2VSOA 3AKDA 4B40A 2DECA 3KLBA 2CJXA 3RYCB 1T2FA 1H6CA 3PTLA 1P6UA 1F06A 2J67A 3DWGA 4JR0A 3WL7A 1ZA1A 1TJYA 1Y9AA 1WMAA 4PYKA 3KQMA 4QDTA 2Y92A 4YJ3B 1SUDA 4N0QA 1DPFA 1C7RA 2IIPA 1JTFA 2VQDA 2CW5A 4G01B 2QU7A 4JB0A 2XA9A 4R0NA 3VYUB 2QR3A 4K7JA 3H7IA 3IEUA 4F1KA 5TPWA 3TQTA 3TZEA 3WQHA 3D2CA 2ZAMA 3K09A 1P19A 2J7PA 1TM4E 2EHDA 2PYZA 3IIJA 4LSGA 1TLFA 4P9NA 3OZIA 3D4NA 2F9LA 2XHZA 2CLCX 4GYKA 4GAEA 4OLHA 4BWVA 3X43A 2FA9A 1B41A 3UWOA 1BWQA 3ZU5A 4TKVA 1HURA 4HDSA 4C14A 3TI9A 3NBZC 2BHNA 4IICA 5HIMA 3ZDAA 1GADO 3ZDQA 5FBVB 4I1UA 3SBEA 4EO7A 1NMZA 2GK6A 4WFIA 4DYVA 1PVOA 4IO1A 1XZGA 3UJPA 2BW0A 3F8WA 4A6DA 2PKXA 1M5RA 4JH0A 2C82A 2OUKA 3EMBA 3EXHA 2HXYA 4JITA 5JZMA 5AOAA 3LTEA 1IZ0A 4XPZA 3WBFA 1EE2A 1ETHA 1EWTA 2EGGA 3O6VA 1A9ZA 3PFKA 4URFA 2BEJA 3ACBA 3SMVA 4C6TB 2IYEA 2WFMA 1XYYA 1LBEA 4HPWA 3R3WA 1SXPA 3MWDB 2OD7A 2PZFA 3E4DA 4KUHA 4F2WA 4F04A 5JYDA 2ZRGA 5EIOA 2QLTA 2CVZA 3STHA 1YFJA 1FPQA 5AP9A 2ZIGA 1G38A 1VL5A 1GYPA 2LRHA 4Q1DA 5J2TF 2ZRBA 2WD7A 1J7KA 3JQ9C 3VO8A 1HZZA 3ZVNA 2YFHA 5JFOA 2I87A 1MO6A 1SM4A 4L28A 3H5TA 1P1IA 3THOA 2BZ0A 2UYHA 4YJHA 4EVQA 1NJ2A 3TXXA 3IVXA 4FFVA 4R7TA 1E0DA 3OQIB 3CF4A 3HK2A 2W4QA 1Q1QA 1Z6ZA 5A0VA 4FBMA 4LEIA 4YS6A 3ZQ6A 3RAPR 3WXBA 4O4IB 2E37A 2I9PA 3FWNA 1Z0FA 5L4NA 5J47A 2C5SA 3E05A 3PP8A 4GMFA 4LGVA 3GZ4A 3LPDA 3OP1A 5KJEA 3KSMA 1M1YA 1TYAE 1UK8A 3CCBA 3LPLA 5E0OA 4DCPA 3WNDA 2PUFA 2NAPA 4M36A 2FMKA 1X39A 3WICA 3BK1A 4RZUA 1S5PA 2NU9A 5IWCA 1SCNE 2H1VA 1M83A 2V7BA 4FUTA 1X7YA 3VVLA 4EGSA 5FP0A 4HCJA 4AYTA 1LY1A 1O97D 3PQ6A 2YWJA 4EZBA 4ENVA 3II6X 4Q1EA 4ISCA 1MA0A 1HORA 1XXHB 1S3GA 1KPGA 2BFBB 3SXUB 3T1YB 4S05A 1O77A 1PEKE 2C2GA 2CBZA 2IYYA 3QTTA 3KDPA 1E0AA 2MT9A 4FMBB 3JWGA 3H2HA 4PZZA 3M83A 3I83A 3Q0TA 3D7MA 4AW9A 1O6ZA 4A8JB 2AMYA 3F98A 2AX3A 3DEYX 1E1DA 5K0NA 4R8LA 1WPGA 4LE0A 3OLQA 3REOA 1Y4DE 3AUSA 4OMDA 2ZRCA 3TW8A 2IEDA 3WGHA 4TQAA 3NWPA 3ZE7A 2FEXA 1JJBA 4HP8A 2FPPA 1SHTX 3IXLA 2IOYA 3R4VA 1KI8A 2OZLA 2PFGA 2XXJA 5COQA 5AJXA 3SM9A 4BECA 4YXWD 4JXXA 3TUZC 4BX8A 1W5SA 2V58A 1ECPA 1Y80A 3EDOA 4GI7A 4LMBA 4CIXA 2HO5A 1MAWA 5FLEX 1KY4A 4RZHA 3VAYA 4DT1A 4ZAFA 4WY2A 2QAGB 2BM0A 1WVIA 4I5DA 2E0IA 4ZT7A 2IYQA 1QCDA 3EVTA 1A9SA 2CZGA 3RTEA 4AMUA 3FAZA 3U1VA 2DETA 3RRXA 3PKZA 2ZI4A 2J4CA 3K0CA 3LQKA 5CJ2A 1R8YA 1P5ZB 1DKRA 3DFMA 2DWQA 1HI9A 2IYAA 3LWZA 4FQ8A 4I4IA 4D5GA 4D41A 2GN6A 4Q39A 1I94B 2OV2A 3T15A 4YK7A 3VU0A 4AWBA 3VR4A 2WLSA 1DKLA 1KVSA 1ESZA 4RE5A 4B6SA 3BM5A 3ETNA 1OZFA 3LY9A 5JJLA 4TVKA 1BSVA 4G0YA 2BHSA 2IYZA 3EC7A 1J8YF 2LCQA 1S2GA 3VH4A 3TLZA 3SQOA 2NP7A 2XGSA 3IAS1 4RHYA 2FWRA 1E2BA 1H9BA 2NZYA 3A2MA 4PS0A 2G76A 3JAKB 5DSZA 3O31A 1RQ7A 1XF9A 4URWR 1P72A 1PL0A 1XHLA 3AF1A 4JZYA 4GDFA 1KI9A 1PZFA 3FPSA 3M6AA 4RTMA 1RPJA 2QK4A 1IQ0A 1V1RA 1VHDA 1YULA 5K3SA 3VNQA 3CPHA 4Z9AA 3WSTA 3IL2A 2WHQA 3IEXA 4N0DA 1CZOA 5DP1A 4XB1A 5KYXB 3GP8A 3JSXA 4J6FA 2C58A 3IIIA 4MA5A 3FBWA 3O2QB 3FOAA 1BMQA 1G9TA 1TYZA 1TQ8A 3DTVD 3PC6A 4B3BA 2BEUB 2WSLA 4G36A 3SM3A 1RTTA 2OHOA 1Y9JA 2JGEA 4NBKA 1AN0A 1ZR4A 5DYIA 4GPAA 1F2DA 3N87A 3MF4A 4PLZA 1D2HA 4BMSA 3ESYA 4K26A 1VJTA 4WXHA 4ESVA 2W43A 4PAGA 3ODPA 4KH0A 2GJ9A 2K2WA 4QNMA 1SOVA 1SMKA 4ML3A 1LRLA 4NH0A 5C4GB 2FG6C 4OK5A 4PIMA 1NZFA 4LZJA 2J3MA 5JSFA 4XQ9A 2W7TA 2R7LA 5JXHA 3FY4A 2OB1A 2P6PA 2VA9A 2Y1KA 3LP5A 3OZCA 1PHPA 2P9ZA 4LJLA 1ZDMA 4RHXA 1U28C 3JYHA 3RHSA 1JDVA 4JI6B 3W8NA 4DQLA 4URVR 5C8YB 1SCQA 2F17A 1PV4A 1SUSA 2ENWA 5DM1A 4PINA 5A3SA 1KQPA 1FJXA 4P4SA 4EY8A 3SX2A 4ER7A 4TKMA 1EG2A 4LVOA 1N2CB 1NP7A 3OFNA 3PHBE 1ECJA 2WSYB 3EGXB 4CEIA 3CJRA 4OX9B 3GAMA 1Q0PA 4RPHA 4OHZA 1CUAA 1E66A 5D3ZA 5F5LA 3TW4A 1DRVA 1U4SA 3BT7A 3P0RA 3E9ZA 4P34A 4WE3A 3ASZA 4TMKA 1LSJA 3PQ8A 4LJ7A 4BPRA 4K6OA 3UQYS 1DLJA 2QJFA 4FLMA 4YMWA 1ZHOA 4CKWA 3ZR4B 3FJOA 2RGWA 4HAZA 3BDAA 4ZCTA 2FFQA 4HRVA 2HZBA 5B53A 3FRIA 4OAPA 1RACA 4INZA 3HCFA 3URMA 2B5OA 4JB2A 2C2OA 2XLBA 4QO8A 1T35A 4QOEA 5FUVA 2D1SA 1C3XA 4BNVA 3AF2A 4LI3X 1LBSA 2I91A 1Q1AA 3T3MB 2C77A 2GCOB 3NPAA 4LJYA 2G1UA 5AJZA 3UOGA 1QF9A 3L2OB 4KDEA 2JLZA 4E07A 5LQUA 1G21E 5U1PA 3UAWA 4N9WA 3KSAC 1ZUIA 2X0NA 3LY8A 4YJKA 2XMZA 1SUBA 4ZHSA 3L7JA 3THWA 3TTYA 2WVAA 5T57A 3ZHVA 2D8AA 5ELLA 3I3SR 4X66B 5T4BA 1VECA 4K9KA 1OLSA 3QYFA 3KYCA 1AK9A 2EAUA 1YCFA 4CMJA 5I9BA 3LUHA 4MV7A 1ZGZA 3FHLA 3R76A 1EK2A 3B1YA 1RXCA 3F8TA 3D3QA 1W36B 1BJTA 3GYBA 1YB6A 4KNYA 4UTPA 4UD6A 4Q9JA 1F1BA 2ZATA 3GPDG 1ZCZA 4WIAA 3OQVA 2IF2A 4Y67A 2DC1A 5KI6A 2LBPA 2P62A 1L1QA 1TUBA 4FCVA 5DI3B 3IYLW 5IM4F 1U7UA 2O2SA 1GU7A 1Z7YA 3NR2A 1JFFB 4H9GA 5AESA 2P8SA 3ZCTA 5JFTA 1YJBA 4LX8A 4RD3A 3UK0A 2XBUA 3VKWA 3C6QA 2Y4NA 3V4SA 4HEHA 3M9LA 1L5QA 2JZNA 3H18A 2BFCA 5EYPA 3SR3A 3W7AA 3MJFA 4UBMA 5G0TA 2X4IA 1SU4A 3H5VA 2A0YA 2GBCA 4RHFA 4YAFA 1E2LA 2WHPA 1E8NA 2OHIA 2G25A 1K7FB 2I6FA 2BHRA 3NAZA 3ZIUA 4IQFA 1ZGJA 3B3AA 3RVJA 1DAIA 4AYXA 2JLXA 3OJCA 2CXPA 2XUIA 3VPGA 4C2AA 2J6CA 1QTQA 4TSKA 3SEQA 4F6RB 1MIOA 4BNYA 1NX6A 1CUDA 2G70A 1FSFA 3ICQB 2ZR7A 3PNYA 5FNZA 4LXIA 2YJTD 1WEKA 4F85A 2EIHA 3SR0A 4NCIA 4G37A 4EJSA 4L5AA 4EMSA 4JVMA 1JAIA 4R0MA 2R11A 2ZKIA 1Z0DA 1UMKA 1V16B 4ENPA 1ZVQA 1KYZA 3C3PA 1ENYA 4FDTA 1G6OA 2QRHA 1CBUA 4UNNA 1PQPA 4ME6A 1E3MA 2Q2WA 2GD6A 3ZHBA 2BEVA 2V6JA 5EJ6A 1UT5A 4FYPA 2OP0A 2PZ8A 3DTNA 5LLDA 1DIRA 3CG4A 2RBGA 1YMUA 2C7GA 3G02A 4OSOA 5IC4A 3HDVA 3IO5A 4NF2A 4NYMR 1GG2A 3N8HA 4EPTA 1P2BA 1ULSA 2HJRA 4PFKA 1RWMA 2DHQA 3DKIA 5DX8A 1J0EA 4K2HA 3NRJA 3EBLA 4HXFB 3O1LA 5F98A 1XZDA 1TO1E 5E9JA 4I3HA 1T5IA 2WYHA 1P77A 4PAWA 3ZHQA 3CLHA 1NU8A 1P7VA 1EBUA 4Q3NA 1P6XA 2WB4A 1QONA 4HQLA 4Q6WA 4D9EA 3CVWA 3A37A 3ETJA 4QOGA 1YI8A 5EJ7A 2H7XA 3D1LA 4WL0A 1EGMB 4C89A 4QXPA 5K7SA 1XVTA 2DKFA 3MJEA 3HP4A 4LHEA 3QHPA 2E1PA 4F45A 2GM4A 2P1DA 4FR0A 3AUKA 3P5SA 4KHZA 5DI9A 5LN1A 3K9LA 3WYDA 1B76A 2CV2A 3HFSA 5TS2A 4LNUB 3SICE 2JBAA 3QE0A 3TG2A 3C1AA 2IU0A 1UZMA 4LDQA 2QM7A 5F9HA 3PJEA 1ETUA 1SUWA 2VHWA 1JA0A 2F9MA 3D02A 4OPMA 4DANA 2HAEA 2JK1A 1QUEA 3IQWA 4YRNA 4PLCA 2CNBA 3M81A 3GZNB 1E2IA 4ENQA 3QKUA 1JXAA 1D3AA 4GRDA 3VTAA 3HSSA 5A4FS 1P1JA 2VTKA 3P20A 2PT9A 3KOUA 1H8HD 3BXFA 4DILA 4OFXA 1CR4A 2A0KA 1UOQA 13PKA 2QVZX 3B1JA 1ZONA 1JKMA 1Z39A 5D3KA 1D2NA 3O2NA 3QKTA 1YZTA 3TZKA 1DC3A 3EFOA 4RK6A 4S1VA 2V3WA 3UAGA 3E18A 3MELA 5K9ZA 1Y1SA 4U7JA 3GOHA 4JP1A 2P6OA 4A3SA 4PANA 3C8DA 1KK1A 1KP2A 4D79A 1OYYA 4NMWA 5B1IA 1LDGA 1QRTA 1RXEA 2WJZB 5B6PA 3INGA 3U3KA 2FPXA 2C1EA 5BV0A 1TC2A 1BC5A 2HTEA 4Y1GA 2QN3A 3INTA 5KAPA 1IBKB 3HKEB 4JOCA 3BQMB 2I7CA 4RLFA 5A5VA 2Z6UA 1BJKA 4TMTA 5E38A 5DNCA 1OTHA 1R6DA 3ON5A 4EDFA 1DTWB 4JGIA 4YASA 4BRSA 3HDHA 4WDQA 4COKA 5AJYA 4EA6A 1BDBA 1SOWA 4E5NA 5AW0A 3I4LA 4P53A 5LSAA 2B8WA 1YONA 2HQSA 3TBFA 4PQEA 2OXFA 3STUA 1II9A 2HV8A 5CAEB 2XADA 1T2CA 1ZD1A 4LRXA 1TAGA 2HI0A 4NQRA 2I3AA 5CVEA 5B4TA 2YHBA 1WF6A 4QAJA 5JWHA 3HGQA 2DMRA 4G5GA 2HY7A 2YNMA 2AZ4A 2IXDA 2DE0X 2H4FA 1ZM4A 1PGJA 3WMFA 2XTJA 4N5IX 4WSOA 2QP4A 4G5SA 2I3DA 3L84A 1VHJA 2HGSA 5K6RA 3WGUA 3TPFA 2OBXA 4IOLA 1O95C 1E63A 2XE8A 3ZK7A 1I7DA 4J0QA 3EASA 5BURA 3I58A 1R0LA 2NVUA 3G2MA 1D0IA 1MU0A 3AFMA 3F96A 1IVNA 3VNUA 3REGA 1C81A 1IY1A 1LC0A 4ZHQB 4OYHA 3SIXA 1YQXA 4N9QA 4REQB 1HFKA 3THXB 5ENVA 1HA3A 5BMVB 1A9RA 1PJCA 2NM0A 4IW3B 4D96A 1G7TA 3FTQA 2ECFA 1DKPA 4RGYA 1LDEA 2PRSA 4MPTA 3P0IA 3IFSA 2ZANA 1C8LA 3B7WA 1UBNA 4L2IB 4O25A 5M2QA 4RF4A 1TADA 3C7KA 4EECA 4CIVA 5EMHA 1ESMA 3WGMA 5E1OA 1NHGA 3PGJA 1AM4D 3EQZA 2QAJA 1J5XA 1J6UA 1K66A 4AMGA 3A6ZA 3VH3A 4BMCA 3A3NA 4HYTA 3LYHA 1U5BB 1GU1A 2GTHA 3GH3A 4IIHA 4NENB 3VU8A 3DM9B 3WYBA 2WF8A 1HK7A 4EQZA 3STVA 3FMIA 2FZCA 3HJTA 4CCYA 3I53A 1LXCA 4AO6A 2Z6QA 2BPOA 3B1WA 4O4JB 5DB4A 3R75A 2ZT8A 2IYSA 1UZUA 4MWTA 1A4IA 1KI6B 2FPKA 3K2BA 4G9BA 3DGFC 4OTZA 4X8OA 1G5PA 1U5AA 5THQA 2P90A 1QPZA 3IPYA 5C34B 2IHBA 2ODAA 8ATCA 1NF3A 3H5LA 5E3IA 5K8JB 5IS2A 5AM2A 1O9HA 2P0AA 3H4VA 1HOXA 3IBSA 4TMFA 2WJJA 5ALTA 3UUFA 4IOKA 4Q4AB 1J0BA 1P61B 5DM70 5DCWA 4JBXA 1TF5A 3PHJA 2BH9A 3IODA 1OBOA 2Q1SA 2WU0A 3EWNA 4YQFA 1I36A 4XEUA 5FWXA 1Z35A 1EU1A 5J2TA 3DLIA 3HBJA 4DBLC 1DDGA 1C3OA 1V48A 3ENVA 4WNAB 5DBHX 3O75A 5KTYA 3BS4A 1RM0A 3FVQA 5JXIA 1FMFA 1O5TA 5BN5B 1RDFA 1GGNA 3AFOA 1NJSA 2J08A 3OOYA 4KV7A 4D6PA 3BE4A 1BQ3A 4LX0A 2A8YA 3E70C 5LBTA 3VX4A 5BSKA 4HF7A 3IMEA 1DJQA 3LUFA 4JVOA 5DXFA 1D9XA 5MGNA 3WRVA 5AI5A 3DAYA 2JFGA 2VYND 2VTVA 5KOJA 3EX7C 1THZA 1BVYF 1HDZA 4B87A 1DBPA 1IAQA 1WZIA 3KQQA 4J0KA 3G9UA 4P4TA 5JRZA 2I2XB 3GEBA 1DXHA 3MA0A 3S2IA 3KWLA 2QR5A 3B6MA 3TRDA 3WG9A 4B71A 4EHBA 1KI4A 2O3SA 1YVRA 2GEKA 3U6KA 3MWJA 4GYWA 1W5BA 5C1DA 4X41A 5JMWA 1E2HA 5BNFA 5JH7B 1VGVA 1UZLA 3NATA 5CFPA 3OKFA 2EJVA 4XAQA 4DZTA 2A7XA 1VPDA 3DPSA 4RZQA 3UJBA 2A4MA 2PX0A 2WFLB 3FH0A 1HEIA 3IHLA 4JLDA 1SD2A 2H5EA 4MIOA 3VZPA 3PD1A 1DAKA 3I8XA 4QQKA 5EHQA 5JECA 1XDUA 2XTZA 1PGPA 1NX9A 4MI3A 1LSOA 1QIDA 4DNPA 1CR2A 2XWPA 4DEYA 1JZQA 5JISA 5KIAA 3OURA 2QPOA 4NZZA 5JJIA 4I55B 4JJZA 3KWFA 4JEMA 4OQLA 5L7YA 2A9FA 1ODSA 3NNSA 2MJLA 1UPAA 2QPLA 4IR7A 4EHJA 1ZXLA 4BN5A 1ONPA 1N9ZA 2YICA 4QBGB 9ABPA 5JCJA 1Z29A 1RZRA 3GGPA 3BZBA 2Q5FA 3OH8A 1XZAA 2PBRA 3L8MA 1E3JA 3LUPA 1HLPA 1FW8A 2FFHA 2NUBA 3MT7A 4IS2A 4UTXA 3R41A 4IJVA 5A71A 3ZBTA 3E8SA 3QX9A 1T91A 2PD6A 5B7GA 3ZGVA 5HVNA 1MQAA 4FSHA 2IZ6A 4M9SA 2XMGA 3U37A 4B44A 1KBQA 4L6IA 3R5JA 4QFMA 3QV2A 2HDHA 4PICA 3AU8A 4P98A 5DO9A 5A4JA 1CY6A 1R0CA 2E5WA 2ESRA 2FRDC 2UV8A 3ISTA 4LV8B 4YCAA 2N1MA 2OCGA 3CW9A 1Y7TA 4LTDA 1DWUA 4G0ZA 4U9HS 4KO4S 2HU8A 2ZAIA 3P32A 3IUQA 4R1LA 2DF8A 4CQJA 3V4LA 1C7EA 4GNKA 4J0HA 4ALLA 1A9OA 1M3SA 5EA2A 1DKNA 1Q12A 3C3JA 1FRFS 4RIFA 4WBNB 3F6PA 3G59A 2Q1XA 3H2JA 4DBZA 1DO2A 4N65A 4NU0A 2CHQA 2EV9A 5IJ0A 3K53A 4GRAA 4JJKA 3RABA 2JCGA 5B2EA 5REQB 4X1YB 1F5NA 1TEVA 2ASVA 2D1FA 3DG9A 4PXYA 4R9UC 3WMEA 3PQEA 3SFVA 3IJRA 3T4PA 1O0CA 3VZQA 5BPFA 2ZJ1A 3HDYA 3KB1A 4JLMA 4L57A 4LXQA 4IHJB 2ASEA 3RBXA 5C32A 1C9JA 1Y34E 2J9FA 2G3YA 2NXCA 2PRIA 4W5HA 1YOVA 1V7PC 1JZTA 4YGYA 2AE2A 1GUBA 3NEYA 4CLOA 3KK0A 5TEWA 1WCXA 4PNHA 1U2DA 2AYZA 2EBFX 4E2YA 1EUDB 1ONNA 1K6EA 3PDWA 2I54A 3SZRA 1BVHA 1DG1G 3Q3JB 4YX9A 3BHJA 1E92A 2JFBA 1ZH0A 1Q3HA 1G3RA 4GX5A 2NO1A 3KQVA 4WECA 1PLKA 3IE2A 3QPCA 2XUGA 2PGXA 1NVVQ 3D7LA 4R3WA 5ILGA 4BGIA 2GJ4A 1JN0A 2PGOA 1ONOA 3H99A 3WR5A 4IDFA 2X41A 2I65A 3I9LA 4LPKA 1YB2A 1HDRA 1XJQA 3BMOA 1IXSB 1YUBA 3BE6A 2QTVB 1CE8A 1QAMA 1V95A 5DNAA 4MW2A 5BRNA 2VRWA 3H5WA 4EGQA 1IZ8A 4LSZA 5FIUA 5J5CA 1E3WA 1EB8A 3AEYA 4PAMA 3UYLA 4TKLA 1N9KA 3RIXA 1C7FA 1VPEA 2PKYX 2OO3A 3AGQA 3EXFB 3TIGA 1I0LA 3LPMA 1EHIA 1NVBA 2Q7OE 4QHYA 4WJKB 4C5CA 2J09A 1M0EA 1JH8A 1HFWA 3EVGA 4INOA 1RTKA 2BN4A 2P9EA 2QAGC 2ZI9A 5KNDH 2PL5A 2EIXA 2BZSA 1QDLB 2W5UA 3QPUA 5KSPA 1RPZA 1U0FA 5H0IA 3F6CA 4Y9DA 1KEUA 4EUNA 2BR3A 4ZJUA 3Q0IA 3NXSA 4GPBA 4J7AA 2Q41A 3G2PA 1HT1E 1X8JA 2VDKB 3C97A 3IV9A 4M1YA 4U6QA 4DY4A 4NATA 4YDSA 3P2MA 3PE4A 1MBZA 2YJ4A 3OHMA 1Z47A 3PGA1 3R4CA 4CCAA 1CT9A 2FUNB 2VK4A 4AJLA 4EZEA 5K3OA 3U81A 1JAXA 1G7RA 5CIWA 1J2TA 3IT3A 3W8DA 2ADFA 1OQAA 3VHQA 4Q4CA 4LJ4A 3OM1A 1Z0JA 2AIRA 1NKVA 3NYIA 1MB3A 4FGSA 1EDDA 1F0YA 5LC1A 5K03A 1XU9A 2X1LA 2A30A 3MJRA 3SHFA 3RIHA 1UKYA 3MRTA 2XE7A 4IV5A 4I81A 4OFBA 3NTXA 1JIKA 2F00A 5CX1B 1N7GA 4OH7A 1C8KA 1CR1A 3T0GA 2AZTA 5ETJA 2DQZA 4XYLA 2IBMA 3H9CA 5FPKA 5LQJA 2OT3B 2EQAA 2TSYB 3L0IB 1E2DA 3OUZA 4KV9A 4YP0A 5FQOA 4EFNA 1VE5A 2AEEA 3P19A 1NULA 3G2LA 4J0JA 4HDQB 3K0EA 2I7TA 5IM4A 2R00A 1EG7A 3DZ8A 2P75A 4X6UA 2W6NA 3FNHA 3QPDA 2IRWA 5HF9A 3BFVA 2FZ5A 3CX7A 3OFJA 4H18A 1RMTA 4R8VA 1XP5A 4D9CA 4BO9A 4UVDA 4WN9A 1AB6A 3MUEA 2IHZA 4YA6A 5H68A 3O9MA 1H2WA 1D8AA 2EATA 1UL1X 4F9EA 4HH4A 2P7HA 1E3EA 3EDMA 4HMQA 4PG7A 3TSOA 4NFLA 4BLTA 3LCRA 2OMEA 5JAOA 1JX6A 2O5CA 2CMGA 1VPTA 1E9AA 1NXWA 5KMGB 2YWEA 1LDYA 2VUHB 1QANA 3WK4A 4K6CA 1OAKA 2O20A 2V9CA 4JSTA 4TTTS 2QAIA 2YFYA 5AHXA 4BYGA 4TZ0A 4X54A 2AEJA 3SLGA 4JV5B 5LDHA 1DADA 3SS8A 5LM3A 3QF4B 4YCSA 3DNMA 4TL7A 2V6MA 4NJMB 2I67A 3ZCSA 2QT0A 3SGLA 3CMCO 4MWZA 4UHJA 3KOYA 5JAIA 2HT1A 3O8OA 1CYDA 4PYLA 3K70B 3FMPB 2WG2A 1MGOA 3JQQA 2J5XA 1ZESA 3SEZA 1AHNA 1J42A 1Z5OA 2HEIA 2HSJA 3D4LA 3EUAA 5JYCA 1ECGA 1FP6A 1Y0BA 3DBLB 4MS1A 4Y2QA 1CULC 2SBTA 3E7XA 2WW8A 1L5YA 2NO4A 2QF7A 4I6EA 4ZA2A 3H4IA 3QU9A 2O23A 1DOAA 3TGWA 2Z4TA 3H9QA 3C43A 1U2SA 4N6GA 5K4HA 1AKTA 3QIAA 3EDRA 3AL3A 2QMZA 3S68A 3GCWA 1R5NA 4NARA 3TOSA 3GLFA 2XYRA 3AHFA 1YI0A 2XXBA 4ZEXA 1X1SA 1TK2A 1T6BY 2GJSA 3DE3X 3Q6IA 4DSTA 1RHQA 4L4UA 1RYDA 1S3SA 5AK4A 4CUZA 1MF7A 4LNHA 1X92A 3KXLA 2Z9DA 3BTSA 1WMSA 3V8VA 5L3QB 1G8JA 4Q9IA 2Q2NA 3DDWA 1JEQB 4B8ZA 2WU8A 4RTPA 4Q9AA 3UATA 4HZUA 3SJCA 4IDQA 1GCOA 1WUIS 4W8HA 1F3OA 1XLUA 5TMDA 3TVYA 4NBUA 3OPMA 4BL5A 4MP3A 4UULA 3K0KA 1U0TA 3Q41A 1BXGB 4U4AA 3CCCA 2VZ8A 4GGOA 1LJ8A 3U4CA 1I2BA 2OILA 1N0WA 4LHZA 3AT1A 4MGKR 5EEGA 3WWYA 4JENA 5CLIA 2YFQA 5JNWA 1BGXT 3DMGA 3RSSA 2CHGA 2IP1A 3L02A 2PSEA 1S2IA 4JSRA 1S8NA 1VIYA 4LYHA 4PC1A 5FO0A 3FCUB 4RZ2A 4BX3A 3ONVA 1YQTA 2ETXA 5DISB 3CN7A 5D6OA 3RYHB 3KOOA 3L7BA 1OFIA 1ODIA 3AFGA 3DKRA 5ERYA 1UAAA 2JFWA 5JS2A 3NH9A 2V0GA 2W8BB 1X9HA 1BRTA 2KYRA 2PANA 2VDWA 3TS1A 5BSEA 2ZYTX 4LJ6A 1PZEA 3RHFA 5HMLA 5BR8B 3KR2A 4YUWA 4E33A 2C7BA 1FA9A 1X19A 1Y1RA 2HV9A 2NSHA 3HWSA 5B58C 4C06A 3F47A 3NYRA 3DL0A 4MZXA 3AKYA 2ZIUB 4MQ5A 5HNKA 3AF6A 5AVZA 1Z36A 3VJRA 4QJIA 4EHDA 4GNRA 3IURA 5HUJA 1Z17A 2QY9A 2F8TA 2HCFA 3LH5A 1M5UA 1NJFA 1NR5A 1XAJA 2EKZA 3D6AA 3DGEC 3NTVA 4MR8B 4ZAZA 2NPFA 1JEJA 3W9UA 4AS3A 5B12A 1EMDA 2BJWA 4M1QA 4DUYB 2RAPA 3HUTA 1ONSA 5HIIA 3NHSA 2PS0A 4LZAA 3IJEB 3ZH2A 4HLNA 3GG2A 3GL9A 2HMTA 3L1JA 4M0KA 3AM4A 4MJ3A 5THKA 4YAIA 1YL5A 3A1EA 5LNK6 1W6RA 4R16A 2QSJA 2Y2VA 3LCMA 5DULA 2FK7A 2JHPA 3OX3A 4M9ZA 5TGDA 4AZWA 2D0DA 2Q8PA 2NTNA 3GUHA 1UC4B 5LP6B 5JZ9A 4YUZA 1DX9A 2SECE 4RVGA 1SKYE 2VJKA 1FU8A 1PR3A 1A77A 4BC0A 3RTDA 2ZTVA 5FORA 4N4AA 3VBCA 3NB0A 2VNIA 3JZFA 3WGTA 2P2GA 2YV3A 4QGFA 3QEMA 3I4FA 6GPBA 4D9JA 2V7QD 1E2QA 1U0LA 1T3TA 5LLSA 1PWYE 4WZAB 3UAZA 4BCBA 5CB8A 1HKUA 3BBLA 3E9CA 1FDIA 3G13A 4PR3A 4UJ5A 2VJQA 3UT6A 4EG1A 4NS1A 2VJBA 1LSSA 2A2ZA 3N0VA 5HRCA 2WEKA 4WESA 4MLPA 3U7QB 1OWNA 2X40A 4JUAA 4B2PA 2VT6A 2D74A 2CEKA 4F4UA 1YNSA 1CF2O 3Q3GE 3R5XA 2RGGA 1J5PA 3NVDA 4K9SA 2REOA 4Q3KA 1CX9B 4ZPXA 3IEMA 4KN5A 1D2CA 2CLFB 4IDPA 4S12A 2JK0A 3TD9A 2O54A 3ZK9A 4WJZA 2J3KA 4KQHA 4UARA 1XDBA 4PGFA 5IJXA 2W90A 4NJEB 4YUYA 3RUAA 4DJTA 3KV1A 5FLYA 1MEOA 1Z12A 2Q2VA 4LI0A 1BX3A 1N5OX 3UZUA 3V9AA 4D44A 4ZYUA 2DAPA 1JLRA 3IULA 5IK2A 4MRRA 5LZ2A 4MGYR 4HXEB 4K9LA 5EP2A 1OH8A 3HB0A 1RPNA 1THTA 1OLUB 1UOOA 3BGSA 3FDIA 2XNKA 1WD7A 3D2AA 3V97A 4FLFA 1RE1A 1YJCA 4D9BA 5IXJA 1I6WA 2WUEA 3RW9A 2PRJA 1C80A 5EZQA 2CDNA 2PHZA 5E2BA 4KZPA 1RFGE 1TMKA 1VDMA 2FWBA 5IDYA 3W5AA 5DZSA 3M6IA 3MK31 4HQOA 4MCHA 5SY9A 5T3YA 3WZ2A 2HA4A 4S1TA 5B30A 2PXAA 2XEDA 4HZIA 3ZXYA 3Q7RA 1GZ6A 5JBNA 4TMWA 4BGUA 4YQZA 1RU3A 1QB7A 2ZT5A 4IJ6A 1W93A 2C2KA 2FSFA 3AHGA 1E7MA 5CMLA 3EARA 3OOHA 3D2LA 2ZBFA 1FQJA 3GJ8A 3IC5A 4RS3A 3E9MA 3HCDA 5KNCH 3Q5EA 3CF0A 4PZAA 4URHA 3EOBI 1ZU4A 3SR4A 5I4BA 1ICIA 2WTAA 5AW6A 2C2ZA 4KWTA 3N05A 2FN7A 3IOEA 4PY2A 4G8JA 1J24A 5SZHB 2BC9A 3TCXB 1L4UA 3OMLA 3P71T 4LDRA 1T10A 2G7MC 3PVSA 3M6FA 3ABQB 4ZN6A 4L9AA 1Y3BE 4HNTA 4BLWA 1B43A 4LYEA 1M0TA 1OVGA 3FRJA 4C4ZA 4BUJA 2VS1A 2EEPA 3K30A 3OY2A 3GA7A 1TU4A 2W6CX 4UDYX 1UMCA 1XZKA 4AJHA 1R6AA 4BE7B 5KHLB 2QN2A 4WK2B 1TM5E 3RKSA 1W1UA 1A50B 1TD9A 3R6DA 3AOEA 1F51E 1NMEA 2YFKA 3GMDA 1QIIA 1EE9A 1AXGA 1U2QA 5FD8A 2CB9A 4PN3A 2FMTA 2IPNA 3NPMA 3GJXC 2ARKA 1BMFA 1SUAA 3AWIA 3DE2X 3E8XA 3W5HA 4DABA 3CT4A 1CK4A 3K92A 3EXEA 1GGKA 1Z6GA 4CTOA 2QIOA 3PRYA 2ZM6B 1XZNA 1EWRA 3GBVA 1DIAA 3VX3A 2R97A 1GVNB 3O8DA 4MUKA 2ZVJA 1YZGA 3ZY6A 4DDHA 3L06A 3DMTA 4J9VA 1UXHA 2ID9A 3FTPA 2PT6A 3K5PA 1Q84A 5IWAB 3IVRA 4MLCA 1GG9A 2IL1A 1TRKA 2OFWA 2SKEA 3M4ZA 3ABOB 4HWTA 4DPMA 5C1BA 3GWGA 1Y33E 7ADHA 4R8SA 4DM3A 4KP7A 2RAVA 3BXZA 5J2UF 4PXAA 1GSHA 1Y3AA 4IX1A 2AR9A 1NLFA 2NUPB 4TWIA 2B21A 3RPEA 5ADHA 1Y3IA 3I9OA 4DEXA 2GPWA 3LL7A 3O26A 2HNBA 1QJCA 2OQ2A 2Q46A 4QHSA 5EZ5A 2FXIA 3K6JA 2J6HA 3GJ4A 1E77A 3I3OA 3LDFA 4MVJH 4Z8YA 5AKLA 5CFRA 2BGRA 4GD3Q 2ZVPX 4CGZA 2MSDB 2RK4A 4CMIB 1YB4A 2JDID 3X1YA 8OHMA 3WQBA 2OORC 1ZLXA 1X7GA 3CLUC 1J25A 5KYGA 1IULA 3AILA 1BN6A 1TVMA 3T1QA 1LKZA 1BNCA 4GMGA 4H3HB 2IK8A 1CVIA 5M29A 2QJWA 2OGWA 2OOKA 4NMHA 4NOMA 1EFCA 1JTVA 1NW5A 1YNOA 2PH3A 2Z5VA 5GJWC 5ALVA 3RLIA 1U81A 1LGYA 3DMNA 2GF2A 3O73A 4IH4A 4Q7QA 5DW0A 4QXOA 1ABEA 4KOAA 4OATA 5IVIA 2AD1A 4XGIA 1GDDA 3VHXB 4ENRA 1AUOA 4RABA 1XEWY 1GZHB 1ZGHA 1P4HA 2D0OB 3CLTD 4JI3B 1UK6A 5BNWA 1GRRA 4YRZA 3GU3A 4DLUA 2BF7A 2DHRA 1E1NA 1K4YA 1V7QA 3NZEA 3HBMA 1GCGA 4HAIA 4OHCA 1I4EB 1QTNA 2H0QA 2VH2A 3D3WA 3ROQA 4R84A 2VUIB 4FKZA 4P5DA 2ZYGA 4MIKA 2A9PA 4B4DA 1EXNA 1FF9A 4YAOA 5NULA 4ACBA 4O4HB 2XRMA 3HM9A 1VXRA 1DP4A 2O2GA 2Z2XA 3AEQB 3PKJA 3RRYA 3AK4A 3CH6A 3LAWA 3AHCA 1AXRA 1FTSA 1P33A 1E1QA 1Y6JA 4YEDA 4LIPD 3N70A 3R7FA 1SXIA 4AJOA 4EUKA 3AUAA 3G7SA 3QXGA 4BQQA 3MOIA 3QITA 1OA0A 5F2NA 4BNZA 1R18A 4BP8A 1ZN2A 2EX4A 1VIVA 1SO8A 1HMPA 2CLDX 3PNPA 4RX1A 2I4IA 1T5SA 5AM0A 1EFHA 2HBYA 3VSAA 1G291 3FA2A 2YZKA 4LF9B 2CXHA 4KU4A 2IOHA 1P29A 2DQKA 2QD3A 5FPHA 3D59A 3QWIA 4PQFA 1F8GA 1CRZA 3O8CA 5EQTA 1MRNA 1FTGA 5CVVA 1QX3A 3H97A 3TWOA 3CGGA 2YWFA 2POQX 2DR3A 3OOWA 3TOZA 2IYVA 2VQEB 3AHIA 2QXUA 3O7MA 5LZ8A 3QEBZ 4BX2A 2R6JA 4PCVA 5C5DA 1G0OA 3T1HB 3K0AB 4J9UE 5C80A 3I30X 2LGJA 3L4JA 4UBLA 5JAMA 1KKUA 2H7VA 4RO0A 3WB9A 4EY7A 1AG9A 4FFLA 5FCDA 1K68A 2FEMA 4O2BF 1VPWA 4KHPB 2XMSA 1U1CA 1LNZA 2AK3A 3PIRA 4HLUA 3NCTA 4DCCA 2HMSA 5FDFA 5JANA 4WOCA 2E85A 2K2QB 4H6VA 4F8JA 3W5CA 2CHUA 3UCFA 2BHTA 3COZA 3VGPA 1TF7A 3DFFA 2ATEA 1AS3A 4OAOA 4OLJA 5HDQA 4EY3A 2ZYUX 4C1BA 1EGAA 3F3YA 4CFYA 2Z2JA 4PCLA 2PT5A 1W94A 4GGPA 4E14A 1INLA 5ITWA 1DINA 1FS4A 3NUGA 4FWIB 2XOKA 4I0WB 3IA2A 4MS4B 4PGGA 2UUBB 5A3VA 3BD7A 1M1NA 1JPNA 3QLVA 8ADHA 3AF0A 4L07A 4A2QA 3JQBC 2Z4RA 1V1MA 2OCIA 3PWKA 3NHZA 1XCLA 4F8YA 1DAEA 3FNEA 1IMJA 3THSA 1JI3A 1IXRC 3C3MA 1MV5A 3NX4A 4OIMA 4ZQHA 4EBFA 2EBUA 1DCFA 3JVVA 2X42A 1QHYA 3OFSA 1FE8A 2B7CA 3N3BC 5CLJA 5IK2D 2B20A 2OV4A 3OLXA 1P81A 1JJIA 1E1CA 3EY9A 2B3DA 5JSYA 4B4UA 1C4OA 4MDHA 5B1EA 4O2AF 4F5ZA 1J22A 5DHSA 3LW7A 4B76A 1DQPA 2PZMA 4F3TA 4XDZA 2E4WA 4RMHA 4IDCA 2Z08A 4HH1A 3ACCA 3JPYA 1EPUA 3COPA 5B7QA 3TTWA 3UQZA 2PMFA 1EXWA 2FG7C 4JLKA 3RSOA 4MR7B 1LPAB 5EJMA 2J3EA 2O7VA 1J2RA 5E9QA 3IPLA 1VIMA 3TLBA 4AZ0A 3TJMA 1I7NA 2JAWA 2XVYA 2HMVA 3GEEA 1SQ0A 4JLSA 4OHKA 3SIWA 1SVIA 4C0BA 2VBGA 2OKCA 1NF2A 2Q2OA 1QS0A 4XTRA 3R7DA 5AK3A 3R8CA 3ZWMA 1ULHA 1VE9A 4OI2A 5HSGA 1ZHFA 1N1EA 2C8LA 3LXMA 3VPSA 4IRXA 2EXXA 4YPOA 3WRXC 4EIWA 6Q21A 4GSKA 3ETEA 3W9BA 2I8LA 3CUWA 1EUQA 4TLBA 2BEWB 1V9SA 4MJLA 1QPBA 4DKJA 3FPJA 3VSEA 3AUTA 1MB4A 3I0NA 2Q9AA 4JBHA 4NV3A 3AHHA 2PJZA 1IBLB 3B70A 4F6CA 1I2DA 4FIZA 1O58A 4RA6B 5T4HA 3VU9B 5CH3A 2Q1UA 2FWJA 4TLEA 4FONA 4YRLA 1KYQA 1LPNA 2C88A 2VPYA 4PG6A 1EFKA 2JH8A 4HI0E 2BMFA 5DYWA 1FQOA 3K0FA 3JATA 2A35A 4MW7A 2DWUA 2OK8A 3K6KA 4QSMA 2X86A 1AKMA 1DL5A 2B4RO 4YWJA 5K0CA 1ZAKA 1C7JA 5IVPA 4MKFA 4WPGA 3D6TB 1M2OB 3WDLA 4BIIA 5BPHA 4M0UA 2J33A 4F71A 4HWGA 1BG6A 4BAGA 1PT9A 4V39A 4A27A 2PM8A 3ZXUB 2JIQA 1JEEA 4BWYA 1AV6A 3QFCA 5HJ7A 1BMFD 5LD2B 4ZI7F 4TSFD 1NP6A 1WDWB 3RNLA 2H2GA 3CW2A 3I01A 3OLWA 4NFHA 3UT5B 3UXHA 1XFAA 3M9XA 2QM0A 4MUFA 1GHTA 2O8BB 2FP4A 6NULA 3G5UA 4NYIQ 1W5FA 2H6EA 2JLBA 5JPIA 1K2VN 4JC4A 5GV7A 4EF4A 1UP4A 4YV0A 2WM8A 3HR7A 4BO2A 3CE6A 4ALIA 1ACLA 4KVZA 4Z4FA 3FSGD 2Q3HA 1E8DA 1E79D 1WTCA 1QFZA 2AUTA 2IYFA 4B31A 1R0SA 1Q44A 2GTIA 2VYFA 1GPDG 2ID7A 4I1RA 5G41A 4Q4DA 2LCFA 2YZNA 5LP6C 4Q1CA 4DLYA 3BRCA 1IBMB 1OI2A 1QJ4A 1XO1A 2AN3A 2GCEA 3W6NA 4OVKA 2GZMA 1IPFA 2Z8XA 3HRIA 3WYFA 1N3BA 3LSYA 2QUBA 4UFPA 4WVLA 1GFIA 2VF4X 3Q3HA 1QIGA 1R9NA 1G2QA 5EEHA 3SK0A 1TYDE 2IIVA 3IXQA 3U3RA 1E99A 4W5OA 3LWNA 4BQNA 4TXJA 1KEEB 3ZV5A 2QXTA 4GUDA 2VXOA 3Q72A 3WK9A 2CLOB 2RGBA 3DLTA 3X0DA 2X9QA 5DGHA 2LVBA 1JHDA 2QRVA 1DWQA 4TROA 3QMVA 3C3CA 1ZW1A 2RG1A 3WL4A 3LE8A 4ARVA 2D4AA 5KHOC 4RXUA 1RVDA 1X9IA 3LLSA 2JJ1A 1IK6A 2IUSA 4UMEA 5JQGA 4P58A 3U44A 4ED9A 1IU9A 4RXMA 7MHTA 1R8QA 4RJIA 1JEAA 4WH0A 5AVJA 4GX2A 1BA2A 3IQEA 2EYQA 3QE4A 4MO9A 4ND5A 3ZGYA 1EWKA 4QFBA 1GZ4A 3FZNA 2E87A 1O0BA 4ZK6A 4FCTA 1GYQA 4RAOA 5JAQA 2C4UA 2DHEA 3DT6A 2R62A 1J70A 4MWGA 3BB1A 5J43A 3UANA 1SXJE 3RYCA 4S24A 2JGMA 2QGNA 3R09A 1G4HA 1UM9B 4XWGA 2B4TO 2A58A 1KI7A 2R96A 1WXIA 2Q28A 4FHDA 4TXMA 2P9YA 1Y37A 1OZAA 2QRPA 3IILA 4WMLA 5HPYB 3S8YA 1DEAA 3AUXA 5ECGC 3M6XA 1AH2A 2Z57A 1JLSA 4P82A 4GC9A 4E1VA 1EFRD 1PJRA 2ZWOA 4C04A 1RWQA 3JYNA 4XPIB 3G9ZA 5AQ1A 2H0RA 1P0CA 2C03A 4MH0R 4D46A 4CM6A 5JJ5A 3DJYA 5DNUA 2PX8A 4MEJA 2O14A 1G6Q1 4H3VA 5J4KA 3E3AA 4P36A 3K70C 4GKJB 3NGLA 5BSRA 3RSLA 5CJJA 4L4RA 1FFAA 3FWYA 3SDSA 3TSCA 4DG8A 3LRPA 5EFZA 3M4NA 2PZAA 3SBOA 3AKEA 5B58T 2BT4A 5ITZB 2VUUA 4KRGA 1JKJA 1LW7A 4O33A 1S2NA 1U8AA 1NZDA 1O94C 2NGRA 3CW8X 4J4HA 2C95A 1UXKA 4DY6A 3PZRA 1CY4A 4OHOA 3BL8A 3VDNB 4ZU1X 3HKBB 2J41A 2XYVA 4HYQA 3ROZA 3S55A 1RKBA 2C04A 3IAS6 3FFTA 1YR3A 4NPHA 4W5RA 5FFFA 5A6SB 3LJKA 4W5NA 3V1UA 1HGXA 3CINA 3SYRA 5F77A 4D4IA 1KZ7B 3P9CA 1WIWA 5KKAA 4FI3F 2IP2A 1FL9A 4IWXA 5JCOC 4YNBA 4AZSA 2IYOA 4G0XA 3C6BA 5EPOA 1W88B 4ZRNA 4UOZA 2ES4A 3M33A 3E81A 3CRW1 2AHOA 2ZSHA 5K8LA 1K0UA 3AR7A 4QTTB 1B8VA 1NYQA 3TPCA 4Q21A 1JLLB 3KU4A 4FMPA 1ND6A 1QH8A 2C4VA 4HHEA 1QHIA 1Z45A 1JA1A 3IT0A 3W2TA 3CPEA 2HFKA 4B09A 1WKBA 3OBBA 4JC0A 1I7SB 1KFCB 3VR3D 1IC6A 4JR2A 2YZ2A 1Z28A 3PEYA 4KNWA 1XDSA 3T3HA 1D6SA 1TT7A 3ITNA 4O4LA 3PHGA 3COYA 1U4OA 4CEJB 3WFJA 3VRHA 5KSWB 3EUFA 3OESA 2YOGA 2WZQA 4CHGA 5CFMA 4O0MA 4OQMA 3FGZA 1Q3TA 4BFCA 5C18A 1OH5A 2O8CA 4LWQA 4C3OB 4DSAA 4ZTZB 3I2GA 3D0OA 3UHJA 1PL8A 4GWLA 2GARA 2V97A 4PCUA 4A8JA 4B3CA 1GARA 2Q5HA 3I01M 1ISSA 1PV1A 3BIXA 2HFJA 3OPVA 3RAEC 5E95A 3CZ5A 3G5LA 3SHWA 2ZJ2A 4BNWA 1YGYA 5I9IA 3L4BA 4LXXA 1NSFA 2MR6A 2KWIA 1G18A 3G8AA 2QVCA 5A7GA 4PTLA 2WILA 1JB1A 3K5HA 3V4FA 1KYXA 1ZH8A 1XNHA 2C5HA 3CHYA 1R7RA 1BW9A 1M8GA 3D5QA 4GL4A 1XQYA 2XB4A 4S35A 1ENPA 3L8DA 4QBKA 5KZMB 2M32A 8LDHA 2RHBA 3K4HA 1K06A 4F9TA 2QMYA 1ISHA 1M6HA 1PWEA 4RK4A 5F2EA 5DOZA 2HWWA 4KIGA 3TKAA 5CH5A 2C9DA 3QTBA 3W79A 1PJQA 2UXCB 1I3MA 3ELUA 4X8LA 1XZJA 3T6KA 2VL7A 2CLEB 3IALA 2BFMA 3GXBA 3C8MA 4X8MA 5BN4A 4JC8A 2NQ2C 4AXBA 3D31A 2HD4A 3KUCA 4I50B 1E9RA 5DYYA 3GT4A 1YQGA 3B1ZA 3FMVA 1BU8A 2NXEA 3N6VA 4IJMA 1G59A 3NEPX 1DEHA 3EGIA 3N9IA 2PSFA 2X5NA 4IUDS 4J94A 3X3HA 2HA0A 2COEA 1YC2A 4MHSA 2I4RA 3MS7A 2XWQA 5KVVA 3PNMA 4UEWA 1OD6A 2WJPA 1KO8A 3GN1A 4NBVA 3OSZA 4G41A 4MW0A 4HNRA 5IG2A 5CD9A 2F3QA 1TJPB 3FFBA 3JD3A 3ML1A 3NG1A 4P1ZA 5LZ5A 2F1KA 2ZI7A 4JEHA 4TTPA 1N2GA 4C4SA 3ZE0B 2Z5LA 1H4TA 2P77A 3UB2A 4E1AA 1KEVA 4EGAA 3L7IA 3B82A 1I1HA 1UANA 1NFQA 2XUOA 4YACA 5F52A 4QXAA 4EW3A 3I5XA 1SXQA 1TK3A 3P7MA 2FZGA 2ZSKA 2P6UA 3PR2B 4TKUB 1L4YA 2DSNA 1TYBE 2W6JD 3NKVA 5F12A 5BQFA 3PEWA 2R0QC 3T3OA 2R1VB 2B8TA 5ICEA 2IY9A 4A92A 1SBTA 5TMPA 3S6JA 1NNUA 4KJXA 2ECPA 3U4QA 2V6BA 3O2JA 1GOTA 1PSDA 3Q85A 3S99A 1DEKA 2FZVA 1BHQ1 4HGQA 3EE6A 4B43A 3WSWA 3REFA 4F96A 3EZYA 4L0MA 4N01A 2NUTB 2FEOA 1O9BA 2R2GA 1KMMA 3TFWA 1D1QA 2ZREA 3EFBA 2P69A 4HO1X 1H2BA 3PQ4A 2CMFA 1MH1A 5G4KB 2C07A 1EVZA 1IN4A 2WTBA 2FOIA 2H11A 3HO6A 3AI1A 3KDSE 4DPLA 5ICFA 1QAQA 4HDMB 3OA0A 2DR0A 2RGRA 5C8YA 3ID6C 1J8VA 4UJ3A 3IVMA 1EA7A 3E5MA 5LR6A 3AXTA 2QE7A 2R48A 3OU2A 4RA9B 4X64B 2NYRA 1F4VA 1Z4KA 3HBFA 4OSPA 4RHCA 4TS4A 5IAKA 2HXGA 3KM0A 2GBIA 3VA7A 1OC4A 4JT2A 3EQ2A 1SVSA 3OICA 3EGXA 1PW7A 2PMEA 1WU8A 2RGXA 1GLNA 3A7EA 5EMMA 1ESNA 2YY6A 1DCKA 2JJ1D 2VR1A 3C3KA 4L3WA 5BYAA 4KFTA 2E7ZA 2YUIA 2W71A 3BMXA 3OE7D 3R6TA 4J2TA 2B4QA 4B73A 3TLMA 4Z1OA 2EDAA 2EX0A 1YK0A 1NXPA 2IV7A 1PSZA 2Y1WA 1Z4PX 2VRCA 3KVVA 3KFLA 2YVKA 2O3UA 4OMUA 2C54A 1PU2A 4HX9A 3K8QA 2MYNA 4UUAA 4ENWA 3DF7A 1KJYA 5JVDB 4ZVQA 1Q21A 1ZRHA 3R3UA 4BJ5A 2BLLA 3PL1A 4G25A 4TS9A 2EOAA 2GCOA 2OSVA 4Q9NA 4ILEA 2GXSA 1W8IA 5YASA 2PXXA 4QPJC 4I1VA 4IXTA 5K3AA 2IHTA 2WIAA 4TQ9A 3FVWA 1SZJG 2UAGA 4MTCA 5IU6A 4QGGA 2W6ID 1J1IA 1E9DA 1FX1A 2BHLA 2HOQA 2HWUA 2NUAA 3FDZB 3QJ5A 1JEDA 3FI0A 1AV7A 4NU8X 4OQZA 4PWYA 4MUHA 2XECA 5C4IA 2H4JA 3WX0A 4UPVA 1UJMA 4DCSA 1U1FA 4NDAA 1PS0A 3UMGA 2RKBA 4E46A 4CCWA 1J5EB 2EP5A 1CJCA 1QG0A 2GPJA 3KYBA 4JBNA 4RVUA 2COUA 1WUHS 2XMDA 2Q0SA 4E5YA 5AVXA 4EJ0A 2WIBA 5I7FA 4BFVA 2IOFK 1LQ2A 1QK3A 1T1JA 3ONFA 4YJGB 1GRVA 4KBYA 3WY9A 3QGMA 3AR4A 1BFUA 2OL4A 1P9OA 3DMYA 3LS2A 4KO2S 4RS4A 3DZBA 1TL7C 3TZBA 2PA3A 2GO7A 1OF1A 1P7YA 4A0RA 4DCVA 2BGMA 3NV9A 1Z16A 4NONA 3AESA 2QUHA 4Q7MB 1KJQA 1XPJA 2QZ9A 1LB1B 2HJHA 1VJ1A 4PG4A 5I4IA 4NE7A 1PJTA 5KNLA 4DIKA 1H8EA 1L4BA 1LI5A 3B6EA 4CF5A 2C7PA 5D01A 1UDWA 4ITUA 4NFSA 1LVHA 3O93A 2HADA 5ISMA 4YPFA 4ZOCA 2YVAA 1DUVG 2W0SA 4RY0A 1UCFA 5EWMB 4F4IA 4OMFG 3G82C 3U62A 1ZW6A 5IULC 1A4RA 2OB2A 1CU1A 2A5FA 3G17A 2OY0A 3CV3A 4KTVE 3DFZA 1UDRA 2QGFA 1YL7A 3SSOA 3CKKA 4D9NA 2DU8A 3QP9A 4L4SA 3JQGA 3OZRA 2GS9A 1HR0B 4XA8A 3NJRA 2YBDA 1E9VA 1LBQA 1PZHA 2H1CA 4DR6B 5AJHA 2W83A 9LDTA 4M87A 1RBQA 1Z7WA 3CLSC 4F5YA 1STOA 1TDJA 4TV9B 5LYJF 2CUZA 1MMFB 1TIBA 4K0KB 5JTTA 2DUNA 4OEHA 1KS2A 1NQAO 1LUAA 4KIWA 2VNAA 4XJVA 4D9KA 4LOIA 3SQXA 2H5IA 4RUKA 4RULA 4O2AA 4BNDB 3H3FA 2E82A 2GZRA 3G2QA 1USIA 4I8IA 4DM7A 4MI1A 4J1TC 5AKJA 4XVUA 5H83A 3DSRA 2VSYA 3EVZA 4R6XA 2PRKA 1QSGA 4QUKA 1V96A 4LF8B 1G8PA 2MSLA 1V45E 1A8QA 4RADA 4UM9D 5A2QA 4CQLA 4I66A 2AF3C 4MV3A 4S3MA 5E9AA 4NEHB 4EUSA 1ADJA 2AFIA 1TU3A 1Y5MA 3VR5H 5B6JA 4XWKA 5JSKA 3HSYA 5TQ0B 5I51A 3TSZA 5JSZB 4H27A 2GCIA 3Q7PA 3HJFA 5KVCA 3RK1A 4IF4A 1PI3A 3TKLA 1YS7A 3AY0A 4C5AA 5DU2A 2RIPA 1UH5A 2H1WA 2OBFA 3WGLA 4QD3A 5L6MB 4KVGA 4FFDA 2VPTA 3ZI7A 3VZBA 3C6YA 1Z4NA 4H4DA 4KMSA 3BKWA 4XUGB 3MCAA 2C9YA 3P9XA 3ZDXB 3ZWDA 4DE5A 2YHUA 3C39A 4BXOB 3V00A 1ZD3A 5DNEA 1XT6A 5I4CA 4X9XA 1D1TA 1RADA 1XQ9A 4K2AA 4QG7A 2VP4A 3C5VA 4E0BA 1FP4A 4MVXA 4DLBA 1IIRA 4FFRA 3THYA 3PV0A 2WKSA 4ITVA 3WGKA 3TL6A 4H6WA 2D59A 3ESRA 5H59A 3ZE8A 5IKPA 2RE8A 3S2GA 4ZEVA 4P0PB 2Y4OA 4MICA 1Z75A 5D85A 2F4VB 1LLDA 1UBFA 2VG8A 3PUHA 4KXYA 3OCJA 4RMNA 1O96B 1F20A 4JLPA 4NZPA 2A3RA 4ZI7A 1W87A 4JOSA 4S1NA 3X1KA 3ZQJA 3DCNA 4R01A 1HTTA 3MERA 2D5BA 4EWLA 3RS7A 1D04A 1TKAA 2LIVA 4EYSA 3EB9A 4Z1MD 3UKDA 2V1UA 3IEIA 2J32A 2DKNA 2R7NA 2I6SA 1QV9A 5EINA 3CGWA 4BE9A 4TX1A 1XPRA 2XQVA 2ZJYA 1DO8A 1FUYB 2ATXA 1FXWF 4QIHA 5JNUA 4LXGA 5GJCA 2GLXA 4U63A 2LUOA 2RI0A 3S1AA 1XEXB 1L4NA 3G0HA 4M99A 3VBEA 1RHKA 1Y8RA 2D06A 2JI4A 3EEYA 1DBQA 4ESEA 1VJ5A 3WGJA 4MYDA 2R4UA 5ALFA 1CYEA 3PT9A 5GQSA 4BBPA 1ZSNA 1RRCA 5LLTA 2GXQA 3ROTA 4BJ1A 3D6NB 3TO5A 3IAFA 3B52X 3U61B 1ZQ9A 2Y1DA 1P0IA 3DD1A 2V5AA 5WRFA 4DR1B 4H3SA 1PS9A 1XDGA 3KVRA 4CG1A 2R1ZA 3KEOA 4IKEA 5TE9A 2GAIA 2FR8C 3E58A 4J7CA 4ZOAA 4AKIA 1IDOA 3HVIA 3BCRA 5HCIA 4KACA 5TQJA 4ER0A 1YA6A 1LRKA 1VZ3A 2GFIA 4IINA 1ST3A 3QUAA 1Y5RA 2PMKA 3CJTA 4UNSA 3V4OA 3NHUA 4CZ2A 1FFHA 2P9CA 4H60A 4JX9A 6REQB 1F4PA 1OASA 1JHQA 2JFPA 3IS3A 2FPGB 5U9CA 2CJWA 3I2HA 1JFSA 3NT4A 4FN5A 3JALB 2H31A 4DA7A 1WP4A 4KG7A 1QO9A 1U3VA 2JA2A 1Y6RA 1F0NA 4P3NA 1LK0A 1J2UA 2MU1A 4FYMA 1R0BA 4WY8A 2N3ZA 1T3ZA 4E32A 2VH5R 2PMCA 1T5TA 2QV7A 3ONNA 4NE9A 2VA8A 1L5KA 5AXAA 4AKSA 3PFWO 1ZR2A 5TVKA 2OESA 2HGZA 5BWLA 1SU8A 4BQSA 1HE1C 4GR4A 3UTCA 5JWOA 3T9FA 4WFJA 4ZT5A 3ENKA 3LV8A 4PXSA 3RYTC 3QUCA 1YZKA 1XVUA 1IY9A 2BMDA 3E3MA 4X1KA 5JXJA 4X94A 2VRCD 2CGEA 1CJMA 3OE4A 4X63A 5KJCA 1Q1GA 1X9GA 1RIFA 4LYFA 1VLQA 2CEAA 4L2IA 5F9FA 2XJ9A 2GKSA 4OHYA 1NNLA 4LZZA 1SVKA 1XZCA 3AC0A 5IDVA 2I4MA 5GJBA 4TXHA 4L8FA 4IGAA 2Q4BA 2GBFA 4C03A 2FE1A 3V8PA 1VE1A 3IVAA 4AMZA 4C0JA 1W59A 2QLJA 1R00A 2WY2D 1TFRA 3NBFA 2QX4A 5KSOA 3HE3A 1YJAA 3EVEA 5G1PA 2J87A 3B3JA 3G8CA 2G5PA 1T0IA 3T5GA 5IANA 2P9HA 3B48A 5LIRA 3AVWA 2YV5A 4AROA 2QUKA 3GGDA 4FN4A 3GLIA 1W1WA 2VDRB 3FYUC 4MQEB 5I6DA 2JA1A 1R9GA 1U31A 1A9YA 2CL5A 4LE1A 4EFKA 4TZ6A 2JVIA 1N5KA 2BFNA 1SVUA 2CJYA 2M6SA 4FHFA 5DTJA 3SLRA 2ZBGA 1C3VA 2AX4A 2YV1A 3GG9A 4ZT4A 3IO3A 3EGEA 3C7CB 1CUIA 2NYVA 4QDOA 1UDCA 3UTDA 3V33A 2I71A 3KHKA 1D6NA 1T2VA 1E5QA 1XTSA 3A9VA 4R05A 5HG0A 2P9FA 3DAPA 1T9HA 2BP7B 3NBUA 1NW7A 4V1CB 1AMOA 5GVRA 3OPYI 5A4KA 2GOYA 3OU6A 2ZUTA 4ZCRA 3ZPXA 2DXIA 1DXQA 3I2IA 2PA0A 4I14A 3UFXB 2OFFA 4RZSA 1V5GA 1R8JA 3CB2A 3LL4A 1PWXA 4P22A 5AW5A 4CDNA 3K0SA 4GP9A 4P7BA 5AVYA 4LA4A 4UTZA 1AIPA 1SEPA 3TLEA 2IUYA 2VHVA 2P67A 1BDMA 1VIAA 3VKHA 4KKVA 3PEFA 1KQGA 2BMVA 3GVIA 5BV2P 4XM1A 2OD9A 4RHEA 4B4WA 4FNMA 1DG9A 4KFSA 1K5GA 3GPLA 4UNIA 3CU5A 1NBIA 2GZ2A 1JF8A 3QUTA 3W34A 2I6QA 2VI5A 1PT6A 2WKRA 2J9RA 3F3KA 2BFPA 4JD5A 5L6LB 3EMVA 3RFVA 5B57C 3OIVA 1SHJA 1YF3A 1CRQA 3DVLA 1YSCA 4JAVC 2DT8A 4HY3A 4PO9A 2GT1A 2O0MA 4PPGA 2WJ3A 4QEZA 4D57A 5KNBD 1VSUA 1MAAA 2IEIA 3HJHA 1GGMA 1V8BA 1XRSB 2WAYA 3EG9A 1PT8A 5UKDA 2WYVA 1FSZA 4G4GA 2W70A 1CY1A 3BWYA 4N6OA 5TSDA 3F6EX 2PV7A 4PPQA 1NUUA 4RKRA 2C1XA 3HLKA 2IYWA 1S1CA 1ZOLA 2QTMA 3M3PA 3RRMA 5HHTA 2BFAA 2P1RA 4CJXA 3DHWC 4EKNB 2FK8A 3H75A 4FMCB 3GJ5A 4BNXA 4RPIA 3B53X 1QO7A 2H1LA 3PRKE 3KB6A 3T7TA 1BXRB 4OB7A 2LWIA 5EZYB 4TV8B 2UVPB 4ZAVA 3WE7A 5K20A 3LFTA 2HA7A 5I4KA 3DFKA 1F3LA 4ICIA 4ENTA 1RLJA 2IUTA 2NU7B 1P2VA 3PNOA 3L18A 1WCWA 1CNFA 2BF4A 3H19A 2PQ6A 3I09A 1MD9A 2BE9A 4FGUA 4G1BA 4GH5A 1PEAA 3K4PA 5CYFA 5DKFA 3WNBA 4ZDIA 5AW7A 3TKYA