2WBLC

Three-dimensional structure of a binary rop-prone complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
175
structure length
167
Chain Sequence
RFIKCVTVGDGAVGKTCMLISYTGPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPGIPIVLVGTKLDLRDDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHO OF PLANTS GUANINE NUCLEOTIDE EXCHANGE FACTOR 8
publication title 3D Structure of a Binary Rop-Prone Complex: The Final Intermediate for a Complete Set of Molecular Snapshots of the Ropgef Reaction.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 56
structure length 167
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wblC00
2QP9X 1E0KA 4CEIA 4KYIB 4MQBA 621PA 2J0QA 3GJ4A 4XTRA 3PUVA 4MGZR 1KSHA 4TYYA 1YZUA 3KZ1E 3QVVA 3WBKA 3VX4A 4UNPA 3RC3A 4M9ZA 2CE2X 4GT1A 3AH8A 3KXKA 1Z8FA 4PZZA 5EJEA 1YRAA 4FINA 1NLFA 1R8SA 1XTSA 5FI0B 2WWHA 3MWLA 4WXPA 1IXRC 5CK4A 2GAAA 1E9DA 1KHTA 1KJWA 2KJQA 3MG9A 4I4LA 4M1YA 2IUTA 4P0TA 4LJ5A 3ZD6A 3P26A 4C0LA 4LHWA 1I2DA 1LNZA 1OFTA 3B7GA 3FVQA 3IEUA 2ORIA 4V0NA 4LV6A 4V0ME 1PJRA 1KO4A 1D6JA 4JLNA 4II7A 2JATA 3PQCA 4AG5A 1W5TA 3REFA 5ELXA 2VP2A 1Z6GA 2AK2A 3CZPA 4RVCA 2OO7A 1K8RA 1TUIA 2XTMA 2YV5A 1KGDA 2GVZC 3TQCA 1NMZA 5EUMA 4DT1A 1L7VC 4G5OA 4LJAA 4WZ6A 4EFLA 1EFCA 1KDTA 2HCBA 3O8BA 1P2VA 4GRAA 1Z83A 4XTCS 1ZD8A 4Z8XA 5FBQB 3VKWA 1PZNA 2FH5B 2VYFA 4IKEA 2GJAA 4NYMQ 4M1OA 4PSKA 3PITA 3AF4A 2FFAA 3QPVA 3QI2A 4IVRA 721PA 1HYQA 3K0FB 5TY0A 1ESMA 1QG4A 2P65A 5LB4A 2VO1A 5DNYB 1D2NA 3PUWA 2CCKA 5L3QB 5BWMA 4RSGA 1TPZA 4QM7A 2YOHA 4LX0A 1RRCA 1AQUA 4QHTA 3ECCA 4WBSA 1G9XA 3DPUA 1NG1A 1LF0A 1JAHA 1IJFA 3LO5A 1OT3A 1SXJA 3TK1A 2P0EA 4HEJA 3ZLJA 1T3LA 2P6UA 1XD2B 2BMDA 1Q21A 2ZVQX 3U6BA 1J8YF 4EPRA 1XD2A 4NCIA 2E9SA 2CBZA 1Z28A 4IFEA 4C0AC 3U7HB 2OG2A 3CR7A 4EPWA 3UG6A 3NBXX 1NNEA 1TMKA 3QOFA 3A4MA 3TGPA 3OAAA 1D9XA 1O3YA 4XVRA 1SVMA 2XNDA 3AP1A 3TE6A 2ZI7A 2J0UB 2PL3A 4OKSA 3DKVA 3SE0A 5KNDA 4TSFA 1E9EA 3A6PC 5B57C 4JYBA 3KFVA 1G6OA 1FL9A 1IJEA 1D2EA 4MRPA 1RFLA 3NEJA 5FL7D 2ERYA 3R8CA 4Q4AA 1Q22A 3K9LA 1GNPA 1RIFA 1K5DA 1XJQA 4P33A 3B9PA 3VNUA 3TSWA 2WKRA 1IAQA 1P9WA 3PCRB 4LV5B 5G53C 5KSOA 2DFLA 4IDOA 1GVNB 2OE2A 4AKIA 2OUKA 4RCYA 2CEAA 3SFVA 3EC1A 4XSHA 4B48A 2J7PD 3K9HA 4CYMA 4PAOA 1DAKA 3NHAA 4JL5A 4OYHA 5B64A 1S9DA 2ANCA 5J5CA 1FP6A 1Q1EA 3RVBA 1WXQA 4URWR 1TQ2A 3C5HA 3SDZA 1N6LA 5JWOA 2GXSA 2JA1A 3ZQJA 5FPSA 4TT3D 2QT1A 3OIUA 5KTYA 1N6OA 1DOAA 2QAJA 3Q7PA 5BYKA 4UQOA 4TZ6A 1G4UR 1XJCA 4PPFA 1Z22A 2VRWA 4YXWA 2R6AA 5KNBA 1ZUIA 3HP1A 4V0MA 1KK0A 4ZV4A 4Q4HB 2F55A 1XCPA 3ZIAD 4BLPA 2R8RA 2MMGA 4HUQB 2W00A 2PZFA 4JLMA 1XTKA 1OFIA 2H92A 3BFXA 2YC2C 1DAEA 1E0SA 2VSXA 1EX6A 3NIBA 4YMSA 2C9OA 2ZJBA 4KU4A 2ZRFA 4PR0A 3QEOA 5B58C 2FPLA 4LYHA 2WJHA 1LV7A 4RZUA 2I4IA 4IOJA 3GJXC 5D3QA 4NHOA 1M7HA 4DUGA 2GESA 3KTAB 2XJ4A 2IYQA 2ZPTX 2OBMA 4JSTA 2LWIA 4Q7LA 4B33A 1JAIA 3W90A 2HXYA 5FTJA 4M21A 1X8JA 1YZLA 3UPUA 1E0AA 2UZIR 3EG5A 5EP3A 2RGDA 4PPGA 3A1VA 3C8UA 2Z0MA 3WMEA 2XTNA 3RDPA 3QXJA 4JVMA 4AKHA 1VYUA 4JZKA 2KSQA 3ZJYA 2OHFA 2QMOA 3L0PA 4N0EA 1XMSA 4TTPA 1QDEA 3U3RA 4NU0A 4LBVA 2X2EA 3U5ZB 3GJ6A 1CTQA 1J99A 1Z06A 2RCNA 3JZAA 5EP1A 1L2TA 2ZSDA 2NO6A 3CRVA 3I1FA 4DLRA 1F2UA 1II0A 5JCZA 4PXAA 3ADCA 5E3HA 2REOA 4BLSA 4NDZA 4ZDWA 3UWKA 1KO7A 2ZIAA 1AGPA 3V4RA 2J5XA 1YHNA 3OE7A 4HLQB 2P67A 1XCMA 1EXMA 1E0JA 5JHHB 3IO5A 1UM8A 3TH5A 4ZCIA 5H1YA 2PT7A 2R9VA 1PLKA 1PLJA 3MAAC 4PFSA 1VCOA 4TMKA 1MR3F 4FI3C 4PO1A 5KDOA 2ERXA 1QRAA 5C2JB 1NLZA 4NYIQ 1RRFA 4Q48A 5FR1A 1FQKA 4IDHA 4IOKA 4OHVA 4PC6A 4QBGB 3UXMA 1XTIA 2IYVA 3LBHA 1FQJA 2VF8A 1X1SA 1GAJA 3FKSD 3OZXA 4X8MA 5EXSA 4J0QA 3VNVA 1PUJA 4UJ3A 3K0SA 3TUZC 1R6BX 4NKRA 2GJ8A 2ZRNA 1P9RA 1PUIA 2VHQA 5DE3A 4DVGA 2CL6X 2HF8A 2EYUA 1HTWA 4Q4JA 2ZUCA 3KQLA 521PA 2NTYC 2UKDA 2H16A 2D7CA 4LK2A 3U3OA 3GD7A 4JLOA 4FMDF 2J0VA 1XNJA 4URUR 4X8OA 1X1RA 4WIAA 1IN6A 1W36D 4F93B 1NSTA 3ETLA 4ZIRB 1YR7A 1DEKA 1N2CE 1ZNYA 4W9MC 2W6ID 5DIFA 1NY5A 4B2LA 5LPNA 1E79A 4Q4LA 1E3MA 1S0UA 1NN3A 1TU4A 2BJVA 3VU9B 1Z2CA 4P31A 3WYGA 1KI7A 1AS3A 1BIFA 2PMDA 3AVTA 3VU9A 1GOTA 2FF7A 4B75A 4KO8A 1U94A 4A2PA 1GNRA 4DEXA 3HDTA 4YMVA 3D6TB 4LYAA 1DPFA 2CNWD 2FSIA 4S2EA 3AVUA 3U4QB 2F1RA 4XOIA 4LGMA 3TUJC 5LD2C 4QJ5A 5KSYA 5IRCD 2AXNA 4TWZA 2QMHA 4LDJA 3A8TA 1GRRA 3GLGE 1JALA 1E9CA 4F4CA 3SFZA 2ZI3A 2EWVA 5E7IA 1FP7A 2D7DA 3L0SA 3U7EB 1KO8A 3ZVNA 1OIVA 1KI3A 3MD0A 3DM5A 3KKNA 1G20E 1N5JA 4JKIA 4TQAA 2ZYVX 2Z5FA 3SS8A 1TNDA 3HYRA 1FNMA 3KJGA 3UMSA 3VR5A 3B5JA 3O47A 4UJ5A 3WBJA 1W5SA 1N0WA 3C7KA 4BFWA 4TYQA 4G0NA 4QXAA 4F4JA 3H0KA 5AR1A 2ZRBA 1C1YA 2FPKA 4M1KA 1MO5A 1MV5A 5AUNB 1CF4A 3LRPA 1RRGA 3GJ5A 5JI3E 3QG5A 2OCAA 1CULC 4RD6A 4FCTA 3EPJA 4DZZA 2V7QD 2RH5A 4JVSB 2G6BA 3T61A 1Z29A 2OESA 3RAPR 4M2LA 5LDDC 3DEFA 4MRSA 2ZUBA 2FEOA 3DL0A 5TB5A 2QSYA 3K0AA 5J47A 1KNQA 4UKDA 1NVVR 3GJ8A 3EARA 3R9WA 5JBQA 3AF2A 4GZMA 1JXMA 1KY3A 1QVAA 1T8UA 2VSOA 1A82A 2R6CA 3LLUA 2VP9A 1JR6A 3HU2A 3QF4A 3BERA 2IYXA 1U2RA 2WJGA 1NF3A 1W4CA 2O8CB 2B8WA 5CK5A 3L43A 3OFND 2ZRCA 1F5NA 2CXXA 3AKYA 4ERNA 4RFVA 1DG3A 5E7MA 1S4QA 3NBZC 4ZKDA 1XRJA 3I61A 4ESHA 5FBLB 2J45A 2WIBA 2WWFA 1OV4A 2IYZA 5EXPA 3OIVA 3RRZA 2ONJA 2YJTD 4KSCA 3QKSA 2CL0X 2G88A 1VDZA 4HLUC 5JS8A 3SEAA 3IPYA 2RGXA 3IEVA 3UANA 3PEWA 3C14C 2BBOA 2PJRA 3THXB 1IN4A 3H86A 5EE1A 4TYNA 1WF3A 3ZQ6A 3AUYA 4NCJA 3LNCA 1KYIA 3O8CA 3GLHB 3SZRA 4TTRA 4EJSB 1OIWA 1S9HA 2YWGA 4JSYA 3JZMA 2QQ0A 2D74A 1BS1A 2BDTA 2JLRA 4H1UA 4JLPA 1W4RA 1G3UA 4EKDA 221PA 2O8DA 4IEIA 4IDQA 3R9IA 5AJWA 2QENA 1S1MA 1OYYA 3TAHA 2QI9C 3B85A 1X3SA 2CJWB 1KK3A 2KE5A 1DELA 4AKEA 5EP2A 1KO5A 1IXZA 2V6JA 3G0HA 1XXHB 1S3SA 1KO1A 3RLFA 4MKHA 1KDRA 4XWOA 4KITB 1U0LA 4A2WA 2C78A 2RGNC 1KK1A 3BBPA 1GKUB 3MWYW 4E07A 5KNCA 3GLGA 4UNSA 1IY1A 5FL7A 3CWZA 2C9CA 2F6RA 4Q03A 4UXJA 3LXRA 1W44A 4JLJA 2A30A 2PH1A 5AWFC 1LY1A 4TMZA 2IYRA 1YR6A 1ZJ6A 3UATA 1QG2A 1LTQA 3HJNA 4TQ9A 3VKHA 1E94E 4PPQA 1II8A 2FFHA 1VECA 1JPNA 5TV2A 4IXNA 2A5GA 4LC1A 3BH7A 4OL0A 1ZYUA 2J7PA 1G4AE 4E09A 2F43B 3R8FA 2QTHA 3PJRA 3I72A 4GPTA 3CB4A 4MKFA 4O0MA 4EQ6B 3C15C 3CUEF 4TN1A 3MFYA 3P20A 4LBWA 2P6RA 2QAGB 4A8JC 4TT3A 4DIDA 1L8QA 3WYAA 5GVSA 5KSZA 1KSJA 421PA 5BYJA 1US8A 1N6IA 1P72A 2F3TA 2N42A 2YWFA 2ZJ8A 3TW4A 2ZSEA 1MRSA 5FBRB 2VF7A 2GA8A 4MITA 1E2NA 1FMLA 4OHWA 3VTKA 4HZIA 1N5LA 1X8LA 1G8HA 3U6KA 2OT3B 2G9NA 1OHHD 3IUYA 3F5FA 1F60A 4JMPA 1E9SA 5KPJA 4HAZA 1MH1A 4TLAA 1N6KA 4KFRA 4AK9A 4P4TA 3FMIA 4QBIA 2MSEB 4PC2A 1UEJA 1R0YA 5GJCA 2GWHA 3AGPA 2W58A 5IDVA 4HAUA 1E6CA 4ACBA 3NDBB 4Q66C 1DS6A 1ZAKA 2ZVPX 3BH0A 4XWKA 1FNNA 2VHJA 3PUYA 4NH0A 5CM8B 2B7CA 2H8KA 5EXTA 3AVXA 2A3RA 2QY9A 4K46A 4TLDA 5SZIA 3IILA 4OQLA 1GTVA 4E03A 5FTLA 1KI2A 1ESNA 5HKKD 1TL7C 4A6XA 2GBLC 1DE0A 1FX0A 5G40A 1ZBDA 8OHMA 5DLQC 2XAUA 1TEXA 2JAQA 3I62A 4KBGA 2EFGA 1G291 2ZYTX 1NIPA 4Q1FA 5CJPA 5K8TA 3ICQB 5FOTA 1QHNA 4LHXA 3W6NA 5F9FA 1TQDA 1XMIA 2ONKA 2AN9A 3R7WA 4RCZA 4U7DA 1HH4A 5E7JA 3TVTA 4BUJA 2IT1A 4JJKA 5TARA 3W8NA 1TTTA 5JWRA 3D8BA 1GFIA 4CEHB 1NI3A 4GOKA 4HZUA 2ZEJA 1ZM2A 4LBZA 2EW1A 1E2KA 2ZRIA 1RYFA 3DMDA 2O8BB 2RGBA 1WP9A 3AF0A 1P75A 1Z07A 2OBNA 1UBFA 4MYHA 4A0RA 2O8BA 4PHFA 2OLKA 3ADKA 4D4MA 2WJVA 3P27A 2PCJA 4M0LA 4PQRA 4RZ2A 3B9QA 4A82A 4C2TA 1KAGA 3T34A 5J40A 2GCNA 1E2PA 1P2UA 1CJTC 4QHYA 5DYGA 2YWEA 1Z6TA 821PA 4C0HA 4LHYA 3V4FA 3GJ0A 3AVQA 1OF1A 3Q5DA 4B3BA 4DDWA 5FUVA 4LHZA 1KSGA 1O87A 3EIEA 1E2FA 1G7SA 1I4LD 4DCVA 5K8LA 2IYYA 1KJZA 4ZCLA 2IC5A 5CM9C 1KKMA 1AKEA 2G3YA 2GF9A 3WNBA 3W3ZB 4GZLA 2AK3A 2NQ2C 1ODFA 3MSXA 2LKDA 3GJ7A 1LW7A 2WV9A 2QTVB 1WBBA 5JRZA 4TL6A 1GL9B 2NOAA 4FCWA 1CKEA 3RNLA 1GZSA 4BECA 4V02A 3RANA 4BFTA 1ZIPA 4QJ4A 4R2IA 1T3HA 2XXAB 1Z47A 1XEWY 2B8TA 1H8HA 2ATVA 1G8GA 2MMCA 3TW8B 2IXGA 3I5XA 4Q02A 2YOFA 5F2EA 2R65A 3L82B 1C4OA 1T6NA 1LFDB 1QHHB 4DC9A 4DIEA 1SVWA 4URXR 3D7MA 2OEPA 2CDNA 2DY1A 1QHHA 2I1VB 3BC1A 2GAOA 1UJ2A 2W6IA 4IVPA 4G3XA 3QIAA 4XVUA 1E2QA 4P4SB 3P4YA 4H1VA 1JR3D 2CLSA 2Z43A 2N46A 2XITA 5EE9A 4R2HA 5DN6D 4KI0A 3SBDA 3TJZA 2EFHB 3BORA 3CONA 2V3CC 4BZQA 2CNWA 3EPHA 1A7JA 1XPRA 1NKTA 1G7CA 2GDJA 3U2QA 3UKDA 1XMJA 1RJ9B 2FZLA 4CT4B 1RW4A 2W83A 3UIEA 2G83A 2D2EA 4XIGS 2WJIA 1OE0A 1KI4A 3W6OA 2BC9A 1OJLA 5G3YA 5H68A 3X1ZA 1P61B 2JJ8A 5FL3A 2HLDD 2A5FA 2BM0A 2KB0A 3CNNA 4AURA 2ORVA 5G41A 2LKCA 3CWQA 2ZE8A 4Z54A 1IN5A 4BPBA 4BFXA 3CF6R 4AIIA 2GCOB 1DAHA 2V9PA 1QF9A 1ETUA 2H18A 3CKLA 1QHGA 1YZGA 3U3MA 4QC2A 4MGKR 1P2SA 4P4UA 1XMVA 5A4JA 4D80A 3ZH9B 3Q3JB 3VFDA 4D4JA 1P73A 1E9BA 4BLOA 3L0IB 4Q1AA 2R6GA 4CZ2A 3PV0A 3IGFA 3EZ2A 2QSZA 3GLIB 1XF9A 3PFIA 2V7QA 2FN4A 2J59A 1G16A 2QORA 3AB3A 2A5DA 2BWJA 2X19A 4DDTA 4ON9A 4DLSA 2VTKA 1SZPA 1XEXB 4XD7D 2Q3FA 1E1RD 1G6HA 2CMKA 1GKIA 3LFUA 1E32A 1VG9B 3T12A 1R4AA 1DVRA 2YOGA 3QXSA 1YR8A 2IA5A 1SXJC 4DLWA 1I4DD 1YJ5A 4BQSA 1NVUQ 3IHLA 2OFWA 4C4PA 4RFSB 3WHKA 1ZW6A 3CH4B 3WNDA 2ZAMA 4R7ZA 1MO4A 4GOXA 3I8SA 3THWB 3NBYC 1YZKA 4QM6A 3K0FA 3THWA 5H8WA 5JSZB 3S1AB 3BWDD 1SGWA 3RS7A 3H84A 2C77A 4EFMA 2C98A 5L3QA 2XSZD 4LUCA 4GI7A 2HT1A 5GJWC 2G1JA 4B43A 2BBSA 1DADA 3TSZA 3VMFA 3QF7A 3CF2A 2OAQ1 5BN4A 3MJRA 3WHLA 1M8PA 3TNFA 1GRQA 2QPOA 3QKRB 2FA9A 3FOZA 3IDQA 1NY6A 4F38A 3RC8A 4R98A 1GDDA 1GP2A 1Z5ZA 1NSFA 5BXQC 3TR5A 3QBTA 4URVR 1Z08A 3CRW1 2QP3A 4CGZA 4OHYA 2A2ZA 4HDCA 4UNQA 2OV2A 4RY2A 1BO6A 2WWGA 1E2DA 1DAFA 2ODWA 1JNYA 4BFUA 2IF0A 5KOYA 2D62A 2ZTSA 2R2AA 1BH2A 3EZFA 3IO3A 3SJAA 2ODBA 2J0UA 4CRWB 1CR0A 2BCGY 3A36A 5IK2D 3REGA 1DG1G 4MGYR 1OLOA 3ZZ0A 1X86B 4RZ3A 1U98A 2QEQA 1KZ7B 2WKPA 3IKJA 3N70A 2GKSA 2IXFA 3O8DA 5JMTA 1EFHA 2EWWA 3E70C 1VCMA 2JJ2D 4ZI2A 2BM1A 2HXSA 1A5TA 3FMPB 2NIPA 2CHQA 1R2QA 2DHRA 2ZYWX 2RHMA 3N2EA 4X8LA 2FSFA 2B7BA 4MUAA 1E9AA 2WHXA 4A0FA 4A0HA 3WYFA 4FMBB 5AJZA 4ZDIA 1OXXK 1RYHA 2GVDC 1JPJA 1KMHB 1U8ZA 1UBCA 3C41J 4Q01A 4Q1CA 2PT5A 4PAQA 2NMVA 1R5OA 4Q47A 1M1YE 2QT0A 3LVQE 3TAUA 1A2KC 3CZQA 1MKYA 3RWOA 2ZU0C 4LJ7A 4Y0AA 4JKYA 1ZNZA 1ZP6A 4UXHA 3CR8A 4Q18A 1XB2A 3VR3A 2OFOA 4IDPA 3MUFA 3VKGA 1W0JD 4PC7A 2OILA 5FI1B 3CF0A 1R0WA 1U0JA 3RSLA 4DJTA 1KI6B 1IQPA 2GHIA 5C4GB 3I4LA 3A37A 4Q4HA 2WVJA 3T1TA 2XGJA 4KFTA 1Q0UA 3EIQA 2QM8A 4HUQA 3RHFA 3TIFA 2DB3A 3KB2A 4LPSA 1SVLA 2ZSBA 3CX6A 4GMDA 1ZD1A 1EFRD 2FOLA 2IX3A 4RD1A 4TZ0A 3ZD7A 1OXVA 4M1WA 4DLUA 1R0XA 4BEJA 2CK3D 1XBTA 4DSOA 2AL7A 4BASA 1OHHA 2IYUA 4ACAA 2PCLA 3NC1C 1TQ6A 4FXPA 4E5UA 1II9A 4OI1A 1VCNA 1JR3E 3AVPA 3KTAA 2V6IA 4BRWA 5IF9A 1WRBA 3MCAA 4PZYA 3KKPA 3EZ9A 4NYMR 1Q20A 1P4SA 2J9RA 1T0HB 4KFSA 4C9BA 1KNXA 4P32A 2FNAA 2KWIA 1KK2A 1KKLA 2ZRGA 1NL3A 3GLFB 1KI8A 3BB3A 4YMTA 1W0KA 1BMFD 4TL8A 3K0EA 3GLFA 1TUEA 1N0VC 2QN6A 3T1VA 2MSDB 4LHVA 1AKYA 3ZS8A 1ELOA 5CLLA 1M74A 4C3ZA 1R7RA 4LOAA 5JJKA 1P60A 2QL6A 4OQXA 5HKKA 4FN5A 3PIRA 1EX7A 1E4VA 1GUAA 1M34E 2H1LA 2BEKA 1MRNA 1Q1BA 1UKVY 4QKQA 4BGDA 5TVKA 5HZHA 4JIMA 1SVSA 2Q3HA 2UZ3A 3MWJA 4MA4A 3WRYC 3BJIC 2AFHE 2JDID 3NDPA 2V1UA 3H4MA 2ZI6A 4GFDA 4NONA 1IN8A 3RS5A 5M04A 3K70C 1OB5A 4MKIA 3CRQA 1J2JA 2ZRHA 2DWQA 1YU9A 2C5LA 2QBYB 2AD5A 4DKXA 4HAYA 5IT5A 1VIAA 2A7QA 4DLTA 1E2JA 1NN5A 2R6FA 3NH6A 5LB2A 1W48A 2ZJZA 2KBFA 2WOOA 3PG5A 1OH8A 1QVRA 5C18A 3AUXA 5FOUA 3KJHA 4PANA 2DPXA 1J90A 3CO5A 3I92A 4OHXA 1GNQA 4ZKEA 4HATA 1RRPA 1N0UA 4B3GA 4PHGA 1AGRA 4NBSA 5E95A 2DFKB 2FPMA 4JL8A 4BEBA 2IHYA 4EUNA 4QNMA 3SI7A 3SYNA 1WB9A 1C9KA 1D8TA 2GILA 4W5HA 4B73A 4OI4A 1E2GA 5UKDA 3X1DA 3GFOA 3LD9A 2J46A 1GWNA 4BFSA 4DLZA 1G3MA 3KXIA 4ZI3A 5TXGA 4LJ9A 2D4HA 2C96A 2D06A 3W34A 3LAWA 1EGAA 2VP5A 3GLHE 4ZIRA 4W5WA 3PEUA 2IEYA 3WP0A 4US0R 1CP2A 1TX4B 3CPJB 5CB8A 2ZXUA 1AK2A 1Z6AA 1HUQA 1BKDR 4C30A 3GFTA 1NLYA 5CB6A 4DWJA 2REXB 4RD4A 3BH6A 2F7SA 3TLXA 3HWSA 2OAP1 3L0OA 4IRUB 3K0CA 1E96A 1R5NA 1XXHE 4G5RA 1CLUA 2VA8A 1IXSB 3U4QA 1Z3IX 4AYWA 4L4UA 5CLQA 3G5UA 1KJYA 4JLDA 1JR3A 4MYTA 3VR1A 4CW7A 5DN6A 1RE0A 1NKSA 3NHBA 2GJSA 4PZLA 4Q9LA 1R10A 1XWIA 4BZPA 1XJ0A 3B1YA 2WJYA 4YONB 1XCGB 4RD3A 4O2RA 1ZNWA 3ZS9A 5DO9A 3THYB 3QUSA 2FG5A 3EPKA 3FFBA 4LC0A 1VCIA 2VH5R 3QEJA 4D4KA 1VTKA 2AKYA 1S96A 2DFNA 3VX3A 4EPXA 2HYDA 2OXRA 3PUXA 4LZZA 2VSFA 4WXRA 2ZROA 1Q57A 1XPUA 1WDTA 2G0NA 2HLDA 4N3NA 2IBMA 2O0HA 2V8OA 4I1OA 4MYUA 3OIYA 1XEWX 3EIHA 4O25A 4Q1EA 1J8MF 4B6FA 3E5HA 2Y8EA 2CCGA 1N6NA 4NYJQ 3T1OA 1Z0FA 4CF7A 2X1VA 1G18A 1VPLA 2JLXA 3ZDQA 4U5XA 4M53A 4N1AA 1HT2E 3FMFA 4DDUA 1DAMA 1UAAA 2FU5C 3AP2A 3M4YA 5LD2B 4D6PA 3OEED 1K5GA 3QPUA 4AWXA 5AUPB 4BFYA 2JJ1D 4BLQA 1SVIA 3RS4A 2PX3A 3EWAA 3A1TA 2Z83A 1OH5A 2O8EB 1P9NA 3EZ6A 2H57A 3HR7A 2V54A 1MABB 1N6HA 1E1RA 4M1SA 2O8EA 3PXGA 4LY6A 1G3IA 1G21E 2ODEA 4JBYA 2O8FB 1XP8A 1CIPA 4CVNA 2W0MA 4L15A 3BXZA 1A4RA 4IEEA 5A0FA 2PJZA 3Q8XB 2O8CA 1CR1A 4F92B 4R9UC 2IF2A 5FUXA 4NYIR 4C0QC 4YMUA 3CLVA 1YR9A 4QGAA 2CLDX 2ODNA 2VP0A 4A92A 1DBSA 4LYJA 2E1RA 1W1WA 1KIMA 3D3QA 5FTKA 1AM4D 4Q7KA 1N3BA 1JJ7A 2IS4A 5P21A 3DZ8A 1WQ1R 3I3SR 5KDLA 4NL4H 2XSZA 1TQ4A 2XZLA 4Q9HA 3RS3A 1A1VA 4KODA 2ZJYA 1FTNA 3THXA 4B71A 1JQLB 5K8IA 3B82A 3GLHA 4OK6A 3T5DA 3GQBA 4EJSA 1TF2A 5J4LA 5JEEA 4C7OB 1EK0A 3DKPA 4NTZA 1SXJD 3T35A 3OESA 1YRBA 2ECKA 4MDFA 3I5YA 2GXUA 2IS1A 1ZUHA 2CJWA 4E22A 1XX6A 5HE8A 2FV8A 4G5GA 5AJXA 5K8UA 1XD8A 1ZUNB 3A1SA 4DDVA 1V5WA 1ZU4A 3CRRA 5A5GA 4A2QA 5KUTA 1S8FA 1XXHA 5DHAA 2OLJA 3KKQA 5FFMA 5IK2A 4ASUD 3OAAD 1Z0KA 1UKYA 3F0TA 2EU8A 3ASYA 4RD0A 4CDGA 1FTSA 2IYLD 3LV8A 1E99A 4FMCB 1FUKA 5BW8A 1I4TD 4I81A 4A6PA 2ZRLA 5TDHA 1P6XA 2IK8A 4MH0R 1MT0A 1G5TA 1YZTA 2IYTA 2QROA 3EWSA 3HR8A 3W8RA 3KXLA 4DXAA 1OB2A 2RB4A 2ZI9A 4GDFA 1X8KA 1K6MA 2FSGA 4O3MA 3IBYA 2PMKA 3DMNA 4D26A 2HEIA 5HE9A 2VIIA 4Z1MD 5C4MA 1P5ZB 2YC4C 1IONA 4MUBA 1TF5A 1WMSA 1T4GA 2F43A 3QXXA 1L4YA 2RGGA 4L9SA 4EQ6A 4P3YA 1WE2A 1Z0DA 4M22A 1BYIA 3MMPA 4NCKA 4ZPXA 1FZQA 1QHYA 2GZHA 1G17A 3T5GA 2QAGA 4RJLA 5FUWA 4G01B 1Z0IA 5FBVB 1XPOA 4AI6A 1CR2A 1ZINA 2XOKD 1HQYE 4S35A 4GSYA 4TMWA 2AWOA 3MGCA 4HLDA 1FMJA 3AVVA 1SKYB 3A1UA 4ARZB 4OI0A 1F6BA 5DI3B 2IS2A 3ZIAA 3GEIA 3BRWD 1E9RA 2YHSA 4B3CA 2RKOA 2GEDA 2BMJA 3NG1A 4G5SA 2AX4A 2OSBA 1E98A 2ZETA 1IBRA 1XDBA 2RGCA 1AS0A 3BD9A 4AYTA 4PSAA 2FFBA 4U02A 5JJLA 1G7RA 3ICEA 2V4ZA 5D3MB 1U8AA 2RAPA 3ZZUA 1JECA 3LWNA 1U0HC 3HU3A 4OK5A 1BYUA 2CK3A 4L16A 1IHUA 2WMOB 2O52A 4ZCMA 2J3EA 4I1UA 1DTSA 4KCGA 4Q9JA 1GSIA 2ZS7A 3DOFA 3HU1A 2BKUA 121PA 1G1MA 3H1TA 3NH9A 3BAFA 3QKTA 1EFUA 3RS2A 4LJYA 4OBEA 2WPDD 3GEEA 4AG6A 1JJVA 2G77B 3QXHA 1EFTA 4C0JA 3I32A 4GP7A 4F7WA 3P4XA 1IY2A 2KBEA 4XJXA 5AUOB 2G1KA 4AD8A 3U44B 5F98A 3T15A 1ZRHA 3ZVMA 1HURA 1UBGA 4DLXA 1BMFA 5JRJA 2GCPA 3RSOA 3LLMA 4UNNA 3R20A 1OXTA 4K8OA 2YKGA 4TMVA 3ADDA 3BB4A 3U61B 2FJUA 2PZGA 4JS0A 3K9NA 1MO6A 2HDNB 4CEHA 4M4SA 4LV8B 1J70A 1IY0A 2PEZA 2VBCA 3C4JA 4KLZA 4GBMA 1LVGA 1KDPA 2PZEA 5KU1A 4Z8YA 3GLIE 2WWWA 3Q85A 4LCBA 3EX7C 1JXOA 2BCJQ 3SJZA 3KUCA 2O0JA 4OQFA 1XZPA 2WSMA 4RZXA 2P3SA 4JJZA 3B1WA 3Q7QA 3W6PA 5BN5A 3KQHA 2QQEA 3KUDA 4I1SA 1YQTA 2JLYA 1T0JB 1OH7A 5JHGB 3PEVA 3QG1A 3OE7D 4MDEA 2JLQA 2WBLC 4URZR 1E1QD 1AN0A 1WCV1 3ND8A 1A2BA 3TUIC 4AKGA 2C95A 4XH9B 2OCYC 2GZAA 3Q9LA 1G41A 1R0ZA 1W36C 2WTUA 3EASA 4W5JA 1SKQA 2OCPA 3ND9A 4TLBA 4ESVA 1AA9A 3FKSA 3SQWA 2DWPA 2EFCB 3KJEA 4C0KA 3U60B 2YWHA 2WIAA 2QE7D 1RKBA 1SULA 5EQTA 3B1XA 4L5BA 3NC0C 2OBLA 3I8XA 3SQXA 2XJ9A 2ZRDA 5KSPA 4US1R 1QHIA 3LH5A 2W6JD 4Q9KA 2XXAA 3WMFA 4QGFA 1UKZA 1UF9A 2GZDA 1OH6A 2PBRA 2K5UA 1W4AA 1MOZA 3AF1A 5IHPA 3LDAA 1GM5A 1XFAA 3KDSE 1SVOA 5L3RA 3FTQA 4Q21A 4D0GA 1KTVA 2JEOA 1Z6YA 1YVDA 1LS1A 3BOSA 2CL7X 1ZCAA 4BFZA 4B34A 1FPMA 4EFNA 3CPHA 1Y3AA 1PVOA 2CVHA 2RHDA 4V0LA 1XTRA 2HCJB 4HDQB 3N5CA 4P4SA 3Q5EA 1KI9A 4A1FA 2N1BA 3KQNA 3BB1A 2XB2A 5B30A 1G5PA 3CNOA 1ZNXA 3CM0A 3ONWA 4FD2A 5GVRA 3QQ5A 2Z6VA 2ZSAA 4ABYA 1NN1A 4LYFA 2J7KA 3FGNA 3PR1A 1RJ9A 3NXSA 5KYKA 1XTQA 1NN0A 4PQYA 4GNKA 4A9AA 3EZ7A 2BOVA 4FWIB 2RGEA 5AUQA 2GEVA 3FPAA 3CBQA 5GJBA 3KB1A 5LBIA 3UG7A 3UMFA 2GF0A 3VR2A 1UFQA 2ZJOA 3HPQA 4TLCA 2BMFA 1HE8B 2RGAA 2RMKA 1OYWA 2NG1A 4CEJB 1FUUA 1N5KA 2ZJ2A 2GCOA 1NBMD 4CEIB 1M7BA 4HAVA 4WZAE 2AFIE 2X2FA 4JT2A 1E9FA 2O5VA 2BKEA 4TTQA 4M1MA 2NO9A 4B44A 4Q9IA 4KBFA 1D9ZA 3AKDA 3FHCB 3GLIA 1P7CA 1QBKC 3KKMA 2W2XA 4TL9A 1HEIA 3JVVA 4WZBE 3W5JA 5BQ5A 3RRYA 4BLRA 1XEXA 5FTNA 4AY2A 3OEEA 1TU3A 2VHUA 2G0TA 1E2HA 2MSCB 3Q72A 4R71A 2JJ1A 3KQKA 5JFGA 3CH5A 2FWRA 4MYCA 4OQNA 2HUPA 3E1SA 1BOFA 1Z0AA 2IYSA 5AJVB 1ZD9A 4RFSA 3A4LA 1IM2A 4CIDA 5SZHB 3DM9B 4DT1B 3ZYCA 3IBGA 1NIJA 3OFNA 5JSZA 1IN7A 4QNRA 1COWD 1P62B 1VYVA 2WSSD 5FR2A 1ZC4A 3S1AA 2CCJA 4JLAA 2XZPA 4A4DA 2AXPA 2YZ2A 4DLVA 3CPEA 1OFHA 2J87A 3OEHD 3GLFE 4AC9A 1Z0JA 2NO7A 1CXZA 1XEFA 4G5QA 5ANRB 2VP6A 2QZ4A 3B13B 1AS2A 1KY2A 4DCTA 5C1BA 4A15A 2R6DA 3BE4A 2HYIC 4FIDA 4PSVA 4TL7A 2A5YB 3B1VA 3LY5A 3PUZA 3QKRA 2BIFA 4NP6A 3LW7A 2ZSFA 3WMGA 1GL6A 1FW6A 3M1IA 4D4LA 3P1JA 3VR4A 4HDOB 5KDDA 3DDCA 1NRJB 1E2EA 1CS4C 4KFUA 5EZ6B 3SC3A 3X1WA 1SXJB 4NE2A 3LX5A 4MRVA 3TQFA 4M9XA 2FFQA 2F9LA 1N25A 3AGQA 4JBWA 4L9WA 2DCUA 1KI1A 3W5IA 1M7GA 3ZVRA 2GXAA 2ZYUX 4KJZA 3RABA 3TRFA 2Q9AA 3KKOA 4LJ8A 4TQUS 5E4FA 4D82A 4ZO4A 4DSTA 1DO2A 4KLNA 4EDHA 1U99A 4Q1DA 4QRHA 4U00A 3VQTA 2Q9BA 4B2PA 1GILA 5CIWA 5FH9A 5KPDA 3TBKA 4ASUA 2BEJA 5FTMA 2IUUA 2GTPA 2ZR9A 4JT4A 4UNRA 2AHOA 1F3OA 5FBWB 2NPIA 3GP8A 3UWOA 4FW9A 5DYIA 3QSYA 1KMHA 3WXMA 3FHOA 4WA7A 3FMOB 4Q4AB 4HI0E 2BMEA 1UPTA 3THOA 1AZTA 3MLEA 1KMQA 1XTJA 4GMXA 2BBWA 4C2UA 3GFPA 5L8VA 3HPRA 1H8ED 5H70A 2QGNA 4Z1MA 4PAMA 4TLEA 2I1QA 1S3GA 2ZANA 3CIOA 2J41A 4QL3A 2QMEA 1ZM7A 3L2OB 1RZ3A 1JEDA 1OFUX 1UDWA 3K1JA 3AP3A 4GP6A 3FYHA 5BN3A 1KI6A 5HPYB 2VLIA 1GRNA 4DEYA 4XVQA 1N5IA 4JLVA 2JIZD 2XOKA 4DB2A 2C9YA 4IW3B 2A78A 1T3SA 2WAXA 1W2HA 2J1LA 2ZE7A 3EXAA 1U8YA 3OF5A 1NMXA 3BFVA 4LJ4A 1G8PA 4B3XA 3RYTC 4JLBA 4OI2A 4DBLC 1B23P 1T91A 4WW0A 3B6EA 5CYPA 4K81B 2GRJA 4POAA 4BE7B 2NO0A 1CEEA 5JS7A 4DSUA 1PLLA 4KHZA 3U3JA 2AKAB 4MRNA 2SHKA 3U7FB 3CW2A 3GEHA 2QRNA 1TF7A 2CHGA 4Q7JB 2GEUA 2WPDA 3IIJA 4A36A 1W2GA 3W9YA 2REBA 1W47A 5AK0A 1TEVA 4FWTA 1E2IA 1Q12A 2ZRJA 4LRWA 2F1JA 3QBVA 3FB4A 3D31A 1KDOA 5JEDA 4EPYA 2YVUA 4RD2A 1T5LA 4B6EA 2QUZA 1YE8A 1KZGB 3EA5A 4B2IA 4HAXA 2JLSA 5TMPA 1QHXA 4YDSA 4HB4A 1NBME 1D2MA 1OSNA 3X2SA 3CX8A 3C16C 3IQXA 3LQRA 2NZ8A 3AVOA 4HLCA 2QM7A 4Y0VA 2PEYA 4KV9A 3WNCA 3SNHA 3A4NA 4YLGA 2QRZA 1F2UB 4D2IA 3B78A 1NP6A 3AKEA 2QBYA 2XX3A 2X77A 3VHXA 2XB4A 5EE5B 4US2R 5DHFA 2P6NA 1D5CA 1UEIA 2ZRKA 4QBFA 3VHLB 5DH9A 3QXCA 3F3YA 4HB3A 1NVVQ 2GK6A 4BRUA 2BVNA 3QY0A 1CR4A 1M2OB 5EP4A 4L8GA 3RS0A 1ZMXA 2CHVA 2FX3A 4EPVA 2IL1A 1VG8A 2ZE5A 4HB0A 4GL2A 5JJIA 3UMRA 3ZZTA 1E1QA 4LBYA 4JVLA 2P5TB 1E69A 5HCIA 5KO2A 3QENA 3QPWA 2HV8A 2PLFA 3FE2A 4KYUA 1J7KA 2J0SA 2R44A 2HJGA 2VQSA 3PEYA 5L3SB 1YZQA 4I99A 3O8RA 5L3SA 2Q9CA 4W7SA 4PHHA 1DAIA 2QE7A 2VHCA 1OKKD 2X8AA 3IQWA 3K0CC 2IYWA 1DO0A 4LJ6A 3K70B 4D0LB 2EYQA 1HT1E 5DI9A 1CJKC 2ZRMA 4KSBA 1XZQA 5G3ZA 3AQ4A 3NKVA 1Q1QA 4ITRC 4DLYA 1E4YA 2W6JA 2F3RA 2WMNB 2VL7A 4Q4JB 1E2LA 5CDFE 4B76A 1VHLA 5F3WB 1U9IC 4HAWA 2VP4A 4V03A 4Q1BA 2ZQ5A 1Z63A 5FOSA 1G8FA 3JVUA 1H8HD 3HYTA 3KL4A 3CX7A 3B2EA 1B0UA 1GL7A 2QPAA 3NEYA 5JZVA 2OZEA 4QHSA 2WOJA 1ZU5A 3GPLA 3L8ZA 4ZDKA 3ZGXA 2XZOA 1T8TA 4IHQA 2OM2A 2ANBA 1ZIOA 2VHTA 2QG6A 2WM9B 1T5IA 3AF3A 1OXUA 2WWIA 2XNSA 3QE0A 4NCNA 4OHZA 1VG1A 4FMCF 1ANKA 1OW3B 1U9IA 3QNUA 4PQFA 4QG7A 4UXIA 2R62A 1AZSC 1XU4A 3LBNA 4NPHA 6Q21A 2HF9A 2C99A 1VMAA 3TVDA 1L4UA 1WBDA 5FPKA 3THYA 2WWYA 4DCNA 1W49A 5HTKA 1EESA 2C2HA 1P2TA 2ORWA 2GJ9A 3NVAA 2ZRAA 1FOEB 5F9HA 1SHKA 2ATXA 1Q44A 4NZYA 1DARA 2GJKA 4DHEA 2IXEA 4GOJA 3RRMA 1G64A 3X1XA 4JYCA 1S2MA 3AKCA 1ZM3A 1RVDA 3B8HA 2A9KA 2DR3A 4B3DA 2CVFA 1NBMA 2ZS9A 4HSEA 4BLTA 2LCFA 3FDIA 1U90A 4OJQA 3NBFA 1YKSA 4MGIR 4QJ3A 2OXCA 4OQMA 2D3WA 4NCHA 3V9PA 1CBUA 2DYKA 2B6HA 4M9SA 4B32A 4I1VA 2ZI5A 1SKYE 2DFTA 3SBEA 2WAYA 1G7TA 1VIYA 3K09C 1IOZA 2Q6TA 5FPHA 1NJFA 3GMTA 4XD7A 1JBKA 1UBEA 5JLJA 4Q19A 5AJYA 1NG9A 3EC2A 1G5RA 2JASA 1MABA 5DGXA 2HJVA 3M6AA 2ZI4A 1NVXQ 1Q3TA 2O8FA 1LB1B 3K0AB 1Y63A 4EJSC 3DHWC 4OJKA 2ZM5A 1FFHA 2W0SA 3ZVLA 1GIAA 2WKQA 4M9QA 3FHTA 1ZM9A 5JWHA 2VEDA 3H2YA 3CRMA 3K09A 4WVFA 1OPXA 1CJUC 3QF4B 3FKQA 2FSHA 3SYLA 2QTFA 1COWA 1RC8A 2WSSA 2OFXA 2QNRA 4Z51A 3OEHA 4YDHB 1AIPA 3K53A 3LVRE 4IDNA 2GXQA 1OXSC 3TR0A 3AVWA 4MKGA 4IXMA 3RRNA 4PPNA 1HE1C 2EFEB 1KOFA 2ZUDA 1Z6XA 1AQYA 3QKSB 5CDFA 3UK6A 5KHOC 2TMKA 4IJMA 1UADA 2FGJA 2XTZA 3A1WA 4IOLA 5EE0A 4C7OA 4XSGA 3OIWA 4FMDB 3DO6A 1XD9A 3N2IA 4YC7A 5GJVC 2IHBA 3BS4A 2NPFA 5EE3A 4IOMA 5L3VA 2Z4RA 4IFBA 2Q0HA 4QOSA 1EG7A 4N0DA 3A58B 3KFXA 1CRPA 1F48A 2XNDD 4TYWA 1KAOA 2HT6A 3AV0B 3U3KA 3EA0A 4C0SA 1G8YA 2O8DB 3DZDA 3MJHA 4LSGA 4WAUA 2Q3MA 3KJIA 3CNLA 4F4IA 4TSFD 3LQQA 4AYXA 5HZKA 4CT5A 2E87A 2JJ2A 2FGKA 4HYYA 2QAGC 2QPTA 4Q7MB 2JLZA 1Q3HA 4LI0A 1QHSA 1HV8A 1G3RA 3LBIA 2WJJA 4HLUA 1JB1A 4BFVA 1QZXA 2FE4A 4TYPA 3WP1B 1HY3A 2IUSA 3LW8A 3VR6A 4FCVA 4ZDJA 4NMMA 3DVLA 2JLUA 4EAQA 3B60A 5JCPA 3GLGB 2BBTA 1WA5A 1RPZA 1PV4A 3IIMA 2FMXA 3AM1A 1JEEA 3K8YA 4EIWA 2AD1A 1CU1A 3OHMA 2NGRA 1H8EA 3QJYA 4EPTA 3KX2A 1II8B 1TAGA 3TKLA 4PTLA 2ZS8A 3M0EA 1W0JA 2AWNA 3P32A 5CITA 2BV3A 3IHWA 5C46F 2AR7A 4D25A 3EW9A 1R5BA 2D2FA 2EQBA 2JGNA 2DBYA 2VPPA 4ARZA 1ZCBA 4NYJR 5DI3A 5FPTA 2RGNA 1GKYA 4D0NA 2JIZA 2H17A 3F8TA 4RKFA 4BWYA 4YXWD 4RKEA 2V1XA 2B92A 3PVSA 2JCSA 2WWXA 5DISB 1H65A 1EFRA 1JQJC 2ASEA 3T06B 2ZJAA 1US8B 2YNMA 3TMKA 5FOVA 2ZR0A 3BFKA 3L8YA 1SHZA 5D3MA 4D81A 3NTUA 5CJ2A 5JI2E 1VKJA 5CYOA 4PC3A 5B2ZA 4DRZA 2WICA 2H5EA 4OK3A 4V0KA 3LA6A 4TMXA 3TSOA 2P5SA 4LPKA 1V43A 1G19A 3SJCA 3V00A 2ZRPA 4Q00A 3BGWA 3SHFA 1SQ5A 5DSZA 3LXXA 3GJ3A 2PX0A 4DUGD 4A8JB 4WOPA 4V0OA 4A8JA 2IW3A 5HCNA 5FUYA 1AJEA 3U44A 2WZQA 4KVAA 2IWRA 4DSNA 2FDCA 1M6NA 1ZM4A 4F91B 2EVWX 4B74A 2ZITA 3U7GA 3EAQA 1W0KD 1JI0A 3QVUA 2F1HA 2XEXA 2BHRA 5J4HA 2KI5A 3E2IA 3ASZA 3NWJA 2F1IA 1HQCA 1S1CA 5CIQA 3SU8A 2YYZA 1FX0B 4MRRA 2F9MA 1W46A 2P2LA 3T1QA 2GNOA 4B3FX 2JDIA 5JECA 4DB4A 3C5CA 4YMWA 1KSFX 3R9XA 1SVKA 2EFDB 4M8NE 1E2MA 2CLCX 5EUQB 4QBHA 4PHTA 1OIXA 3R7WB 1UDXA 4BZXA 2I3BA 3G82C 5J4KA 3SOPA 2GETA 1NMYA 1G3QA 2C04A 2ZJ5A 3W3AA 5GADl 4HZUB 1VYTA 2UVQA 1TADA 2V55B 4JLKA 1NJGA 2DWOA 2PLRA 3GCGA 4JL6A 3FFAA 4PO9A 4O2LA 4X8HA 2C8VA 2ZREA 1T9HA 4G1UC 1ZC3A 1HA3A 2GBLA 1P3JA 4QGHA 1EWQA 2C03A 1NVWQ 2ZAOA 4TMTA 1LF5A 1Q1ZA 2YINC 2O0KA 2NO1A 3MRSA 4B47A 4YQFA 2Z4SA 2BJWA 1ZVQA 2QU8A 2ZR7A 3WRXC 2NZJA 4HUTA 3K70D 3RWMB 2A5JA 3J81k 2JLWA 1CJMA 4Q5IA 5FPYA 2L0XA 1UKEA 3QKUA 4DCUA 1MO3A 2IWHA 1OKKA 2IS6A 1Z2AA 1U81A 2ZU6A 4ILEA 5FOWA 4B35A 4QGGA 1F2TB 4M1TA 4PO8A 4A0GA 1VHTA 3WY9A 1F2TA 1GG2A 3BK7A 1W4BA 3X1YA 5J4VA 1X6VA 3AEZA 4IVQA 3SHWA 1DAGA 3SYKA 3DOEA 5HR5A 4DCSA 3B1ZA 3FWYA 1EWRA 1SXJE 1I2MA 3SN6A 2FEMA 2OCBA 4JVNA 2Q21A 1N6RA 5EXXA 4LWZA 3SR0A 3PENA 2QMUA 3VAAA 1R8QA 2QGZA 1E79D 3BIFA 2QA5A 4HB2A 5FOXA 2B21A 4C0BA 4XWAA 1W36B 3ADBA 2GK7A 3IPXA 2H7VA 1N6PA 2QP4A 3EPLA 2IEZA 3KQUA 4JBXA 1CRQA 4KVGA 1W7AA 1LS6A 2ZE6A 5EZ5A 2W2VA 2FZ4A 3K9GA 4KXFB 4URYR 5SZJA 3AVYA 1CJVC 1YZNA 4QFMA 4PX9A 3SJBA 3I73A 1VG0B 4KAXA 2JLVA 3IIKA 1ONBA 2CE7A 2W2TA 5SZKB 1GITA 3MWKA 4H9GA 4CEJA 4PC1A 5J4YA 3LX8A
chains in the Genus database with same CATH superfamily
2E5WA 1EDEA 3C3MA 4ZVQA 3ANMA 2GT1A 4KYIB 3GJ4A 1MHTA 1SURA 3VTZA 4CM8B 3KZ1E 2YMLA 3AM3A 1PTJC 4NARA 1DO8A 5I9MA 3RC3A 4CI0B 4F5ZA 2NUTB 4BBAA 1KVQA 5EFOA 4MVWA 4BJ3A 1FW8A 3HL4A 4EUSA 3KC2A 3RSZA 4A1OA 4GXNA 4LE2A 3H16A 4I5GA 5SY6A 2I3GA 3DL7A 1NLFA 3E2MA 3C3DA 3W4KA 4BV8A 4JWKA 2ZUWA 3EQ2A 5FI0B 5HOEA 3OZAA 4U2CA 3LL4A 3OZDA 1ZQ1A 1TUGA 2BKXA 4M1YA 1E9DA 2BEVB 3MG9A 2IUTA 4KQJA 3CB2A 4C0LA 4CL3A 1DFIA 1I2DA 3IEIA 5LKAA 3OQVA 3GT4A 2NXWA 1SCQA 4UDXX 1D6JA 4QYIA 4JLNA 1F4PA 3PQCA 1FSPA 1P6QA 4AG5A 3REFA 1E2BA 1Z6GA 3CZPA 1RWWA 3BTOA 1PT6A 3BWYA 3NOVA 4DG5A 4CKEA 1K8RA 2XTMA 2YV5A 4KQMA 4XIFA 3TQCA 4IQ8A 5EUMA 4EFLA 2GO7A 4G5OA 4O4LB 4X5OA 1JHUA 1KDTA 2HCBA 2OHHA 3O8BA 4ZVLA 5FHRA 1V6CA 4BATA 1JEYA 4IKEA 2X0NA 4M1OA 1OX4B 4XUDA 5FWNA 1RIIA 2F4NA 2MT9A 3QMVA 3C4QA 3N87A 3D3EA 4QTZA 2HGZA 3ABZA 3H2GA 4HQ0A 3QHPA 2PSFA 3K0FB 4FDLA 2Y93A 5FWYA 3I2GA 4NBVA 3CLUD 2VO1A 5CB0A 3RRFA 3PUWA 2UYGA 3C97A 3OPYI 3BCSA 5BWMA 5CFNA 4PTZA 1GD1O 1TPZA 2ICAA 2HO4A 3JVEA 4GOOD 4IH9A 4RSGA 4LX0A 3L4KA 4QHTA 2N3ZA 1ULZA 3ECCA 4WBSA 3DPUA 5AJTA 1WXDA 1CY2A 1U65A 2HSDA 1KU6A 3DLHA 1FX1A 2IODA 3OIDA 3D6NB 4Q0MA 1GQRA 1G4HA 1WDWB 2HZBA 4Y2YA 4C01A 1O95C 4OHRA 3COYA 3PHIA 4N0MA 4E15A 4EUEA 2RI1A 2BEWA 5BSWA 5I9BA 1XD2B 3KT3A 1Q21A 3I12A 4GG1A 5A4AA 9ABPA 2GLXA 2Z4TA 4KXMA 4QATA 3AHDA 1ZKMA 4IJQA 2OG2A 3CR7A 4FOSA 3UG6A 2JS7A 5IM4F 1NNEA 5JDIA 1TRHA 3A4MA 3NDRA 2C2MA 4P4NA 3OAAA 4XVRA 1YMQA 1L3BA 1GV0A 1Y6GA 1JXQA 2ZI7A 1JFFA 2J0UB 2C94A 3PICA 3DBLB 4MUYA 3GVCA 3JARA 2D7JA 3V7YA 5H83A 3AUFA 4DR7B 4JYBA 2GDZA 1E92A 2D2XA 3WK6A 1DAPA 4R69A 3NAZA 2ERYA 3I6BA 1RT9A 4CMJA 1SOWA 3BTUA 3UMYA 4HN4B 4G89A 4ABTA 2YRXA 4G1VA 3FDZA 4EA8A 1O1YA 1DQZA 3PC3A 3KP1A 4LV5B 4LZAA 1E5VA 5E6SA 4C20A 2HJRA 1ZJJA 3LUHA 4L2IB 2D6FA 3EJWA 4CMCA 5K99A 4U2GA 1QV9A 5B4UA 1E3WA 1MFZA 1I7PA 2VTEA 3L04A 4M38A 4NNPA 2XLCA 4B48A 2J7PD 3TTUA 4PAOA 3NHAA 4OYHA 5FV4A 4IHJF 1L9KA 2BEUB 1FP6A 3BX1A 4QYTA 5G0UA 3TTTA 5M2QA 2OXEA 2I1LA 4NPCA 1TQ2A 4DVJA 4ERXA 4FYPA 1P19A 4C78A 4ZYTA 4GM0A 4TT3D 2QT1A 3B52X 3T5MA 4PRYA 4OHPA 1SC9A 2WQ6A 4PE5B 3FOWA 1Z4IA 5BYKA 4UQOA 4PPFA 4YJGA 1Z22A 2H59A 3IUSA 1XO1A 3LQ1A 3EJ6A 1ZUIA 3DWIA 2OY0A 3HP1A 3KDPA 5K3OA 4TKZA 4ZV4A 3HJUA 2F55A 1XCPA 3HEMA 2J3KA 4KGVA 4HUQB 4LJSA 4YCBA 5DBOA 1Z5UA 1E60A 1Q0ZA 1GEGA 3K1YA 1NNI1 4QVGA 1E1YA 2C58A 2ZBVA 4WK4B 2VSXA 3GDOA 2ZZNA 4YMSA 2JGMA 4D4GA 5KYVA 2PMEA 5ERGB 1Q0PA 3EOAI 3U3ZA 5B58C 4MYRA 4XGIA 4FQ7A 1X42A 3DVAA 1E4EA 1IUKA 3D4IA 1EAMA 4I3FA 1G60A 2HK8A 3CFYA 3DSRA 3NEPX 2HU7A 4IOJA 4LOKA 5F9MA 2HHLA 1U0FA 2HAEA 5JS1A 3JQBC 4IMPA 5D3QA 4DYVA 4NHOA 4IHKA 3CVXA 1NVEA 2VTBB 1TEZA 4M99A 2AH5A 3KTAB 2XJ4A 3EFEA 1ND5A 2OBMA 1PNTA 2IDKA 1SC4A 3Q0EA 4JSTA 1MRZA 1QM5A 4HDRB 4W7IA 5EYPA 1NP3A 3W90A 2ZLBA 3I45A 1MG0A 5TR9A 4M21A 4F5YA 1YZLA 3EG5A 4ER0A 2J6BA 3RAGA 3C6BA 5I7EA 5JCOC 4XQ9A 1E3LA 4IDEA 5BSUA 1S2OA 3GRYA 3RU2A 4AKHA 1N36B 1RADA 1TPYA 3H75A 3FYTA 3UHJA 1BQEA 1B93A 3K8ZA 4TTPA 4UPDA 1P5HA 2FRVA 4HNQA 4LBVA 3WLNA 1C3OA 2CEKA 3M89A 3O31A 1N33B 3DO8A 1L7QA 2RCNA 4YTEA 4INZA 2PSEA 3JZAA 3VC3A 1L2TA 3RVRA 3OICA 1GLGA 1P5RA 3CRVA 4DLRA 4PXAA 4GI3A 5IM4A 4XYBA 1NU6A 3E3OA 3MTDA 3TLJA 1BVUA 4QYXA 1JR4A 2OBFA 4JCOA 3UC5A 2ONYA 1KO7A 3U9TA 3OF3A 2A0YA 5HDQA 3V4RA 4RHCA 3GARA 1YHNA 1M2OA 3OE7A 2Q5FA 2P67A 3V80A 4CQJA 4EX7A 1RI4A 4JNCA 3RT7A 8ATCA 4P86A 1YCFA 4CJXA 4YCSA 3PT9A 3IO5A 1UM8A 5ARBA 4ZCIA 1FXSA 1HDXA 1PLKA 1AHHA 4GX0A 1UBSB 3LE8A 4C88A 5C9ZA 4PZ9A 5BSMA 1T9AA 3HY3A 1MR3F 4C4AA 1XP5A 2ERXA 1QRAA 2I7CA 4NS1A 5C2JB 2XRYA 1NLZA 2OHXA 5D5HA 4Q48A 5FR1A 4IOKA 3AO0B 4IDHA 4PC6A 4QBGB 3H7AA 4JC4A 2GPBA 3CNEA 4RTPA 3GBPA 1L7RA 1MJFA 3LVBA 3FKSD 2V59A 5BWCA 5E4YA 2ZBEA 2VRNA 4JBHA 4MAFA 3N74A 1BTOA 1Y4AE 4BV3A 3EF3A 5EXDA 4IHJA 1ZEJA 4YRNA 3VNVA 1PUJA 4KWHA 1SK9A 3AYZB 2MDTA 5AVWA 1PYOA 2ZRNA 4Y2UA 1KPHA 4HQFA 4I66A 4JB3A 3WLOA 4BZWA 1E1DA 5DE3A 4IIHA 1CY4A 2I7VA 4RQBA 4DVGA 3KQPA 4ND4A 2YXPX 1HTWA 4Q4JA 4HQLA 4MQ5A 3ELBA 3GFRA 4UVEA 3MGBA 4GZ6A 5DCUA 2D7CA 3A27A 3WYNA 1YOVA 4JLOA 1VL6A 4FGUA 4YPVA 4ZOBA 3QVMA 2ZP1A 3S81A 1W36D 4F93B 5JZOA 4B3RB 2FK7A 3EFOB 1DEKA 1CB7A 1ZNYA 2W6ID 2WT9A 5DIFA 5LYYA 4WLUA 5DGDA 4ZYUA 1MC1A 1E79A 2BM9A 3DLAA 3G2QA 1NN3A 3D3JA 2BJVA 4BKMA 3VU9B 2Q2NA 3WYGA 2NACA 1V1JA 4QWMA 3NHMA 1HYHA 2X5XA 4JH0A 4B75A 1PBTA 3HUDA 4KO8A 3PHBE 1QV6A 4FXOA 4OMUA 3N0VA 2WD9A 2Y0PA 4HDMB 4QUEA 2NNWB 1RKUA 4F6RB 2PGXA 3VJMA 3AVUA 1O5OA 1KMCA 3HBNA 3OD5A 3QWAA 4TOIA 4XOIA 4F5DA 4ITVA 4LGMA 3TUJC 3ANYB 1LW6E 2QZSA 3GV0A 3R1IA 4TWZA 2WM8A 4F4CA 2ZI3A 3O75A 1FP7A 4PLYA 4BDTA 1J0AA 1KO8A 2MINA 2PYZA 1OIVA 3NP7A 5JNVA 5IH7A 3A32A 3DM5A 3DP7A 4JKIA 5I4BA 2CBXA 2ZYVX 4DS3A 1PVVA 3G5MA 3SS8A 4X9XA 1FNMA 2JVIA 1XRPA 1CB0A 1O6GA 3B5JA 4FP9A 3UMSA 3ZXSA 1W5SA 1CJCA 4JODA 3ETNA 5B6IA 4PAWA 4G0NA 3FYDA 4C43A 1WP4A 5AR1A 4F2DA 1XRSB 4RWEA 2FPKA 5EIFA 3ER6A 5ICCA 2JAPA 1B3BA 3UWSA 5HNKA 1MO5A 1MV5A 1M66A 3HXMA 5AUNB 2ZIUB 5G4KB 3HM9A 1ICIA 1MD9A 3HB4X 3TNDA 2UUCB 1FP4B 1RRGA 1ZZGA 3JZIA 1TLLA 1ISGA 3N2ZB 5JI3E 1MGPA 4PXSA 5GZ6A 3VR4H 4CNBA 5ALLA 1T9DA 4BLUA 4OXRA 4JVSB 2GKGA 4G1CA 4M2LA 2Z8ZA 4HGZA 4G25A 5I7SA 2FQWA 4IP0A 3E53A 3WXBA 4CKYA 3L6EA 2FN8A 2XCOA 2JBHA 4K88A 3DL0A 1DEAA 3PFGA 1HKHA 3K0AA 1OI3A 3E3LA 5TB5A 5CEFA 3UJCA 2J3IA 4UKDA 2C4HA 1NVVR 5EY5B 5KVSA 2BUAA 4MJLA 3WFIA 1KBQA 4FMPA 4WEQA 1XYYA 1FNDA 2WNHA 2YIJA 2BN4A 2VSOA 4KN8A 3WGYA 3E58A 5B1SA 2Q4DA 4HDNA 1KORA 1TO2E 5ADVA 4Q9DA 1DSSG 1WVGA 4WX2B 1R6VA 2PWPA 2VSYA 3UWMA 4DMRA 2C3UA 2JFPA 1SZCA 4PTYA 5ECGC 4I3HA 4KN6A 3UH0A 2K87A 4L74A 4KMMA 3AKYA 3RRJA 4RFVA 2W2KB 3I9V1 4G0ZA 1S4QA 3NBZC 3ZNQA 3I61A 3ZWYA 2J45A 4Z7OB 2QJWA 2IY8A 2Z3VA 2VUTA 1Z0SA 4KMOA 1A5AB 4HQOA 3MILA 2CL0X 5JS8A 5F7ZA 2RGXA 2E4VA 3MUOA 1SBIA 3PEWA 3S40A 2BBOA 2NU6B 3IEPA 3THXB 3BKXA 5K9ZA 1SAYA 1WF3A 2ZVDA 4WK2B 5F64A 5HWSA 3LNCA 3ZY4A 1L5YA 3O8CA 4Z0TA 2N0SA 3GLHB 4D57A 5A6SA 1OIWA 1S9HA 1THMA 3KYDB 3JZMA 1FLAA 3M4ZA 2D74A 1BS1A 1TYCA 1E63A 1WAMA 1I36A 1YZYA 2D0PB 2JLRA 1W4RA 5JCJD 3T1YB 1JU3A 4UUPA 3USZA 4HY3A 3RU9A 2NVUB 2XMDA 2C4NA 1S1MA 2WAOA 3EXHA 3PWKA 2QI9C 5IYZF 3NHKA 4AF8A 1N5MA 4Y0NA 2IGBA 4MVXA 2KE5A 1DIRA 3DBIA 1NLMA 1K7FB 3TLGA 1Q0HA 3VHQA 1KO5A 1Q7CA 1MX5A 3GB9A 2CVOA 2V6JA 3PDIB 5FB3A 2W2OA 1XXHB 3C6QA 4S1NA 3ZGNA 2Y99A 3PDUA 4BVKA 1BNCA 1KO1A 4FQ5A 4MI6A 4BGVA 2DPMA 3V33A 3X1JA 1KDRA 1HTTA 4XWOA 2Z2IA 2C29D 3CG0A 4JGGA 4BNMA 5BSHA 3BBPA 2AMLA 3MWYW 5KNCA 2ZTVA 3S55A 1JG6A 3DWFA 3L5OA 1CCWA 2F6RA 2JVJA 3CCCA 3MRVA 3SMVA 2BLNA 3LXRA 4S1WA 5FHQA 2O59A 1A5BB 2X3FA 3FZEA 3WLHA 1C50A 1G20A 2YNMC 1I13A 3QU9A 3SKVA 2PUBA 1ADBA 2VYVA 4UTPA 3TWOA 1T0PA 1UQUA 3WISA 4GPBA 5AIBA 2WD8A 1IDOA 2H1RA 3GRVA 4WWHA 1LTQA 3ZCPA 1SUDA 2XB6A 3OPQA 2AEFA 4KYVA 1JPNA 4XWTA 1V9CA 2B35A 1WIWA 3BXPA 3TTWA 4CM9A 1SIUA 4IXNA 4FYKA 2Q49A 3BH7A 5B1EA 1AA6A 1OLSA 1WHTB 4IGEA 3UTCA 3PNSA 3R8FA 3DE7X 2YWCA 3WGJA 2RJNA 4QO7A 3PJRA 4Q6BA 4DLBA 5KWEA 3E7DA 4G1EB 1W5EA 2AN5A 4W63A 3MFYA 1F51E 5EVJA 2F64A 2QAGB 4A8JC 1Y8RB 4DJ5X 1XZJA 1L8QA 5GVSA 5F3RA 4HXYA 3RBAA 5KSZA 2NWQA 1KSJA 1Y7HA 2YZ7A 1ZJYA 4JY7A 5BYJA 3IUBA 1P72A 4C4ZA 2P6RA 4GXQA 4FJ1A 2B4YA 4HNGA 4HWPA 2ZSEA 1SBZA 2EKPA 3CCBA 3RTAA 1E2NA 4OHWA 5CPFA 3B7WA 1J21A 4D9CA 1G8HA 1FE8A 3DEZA 1ZGGA 3G89A 5FWAA 4IIDA 2G9NA 2VJYA 1EB8A 1I3KA 3W04A 3IUYA 3FWPA 1G38A 1RLJA 3V1UA 2H7XA 3EHDA 3HRIA 4Q3NA 1N6KA 4TLAA 3PQ8A 2IEDA 5LA6F 1UWKA 4AK9A 3D0KA 4F11A 4UHBA 5CDGA 4ZJZA 4IMJB 4Z53A 2H3HA 1AZLA 1R0YA 3VMMA 4BJ1A 2PSDA 2WYIA 4J0EA 1R8YA 4DE5A 4HAUA 2P7IA 2Q6VA 1HDEA 1E6CA 4J0FA 3CUSA 1NP7A 1ZAKA 2Q5HA 4Z1OA 5I7WA 1QIHA 1OGYA 1FNNA 4NH0A 1JQDA 1T29A 2GERA 4UOEA 2YJZA 2OD9A 2P9HA 1TYEB 1EM8A 1IC6A 4OFBA 5BR1A 3AL0C 1OWMA 2WHPB 1X2BA 5SZIA 1F6DA 4OQLA 2WG0A 4J2TA 4FOOA 1CQJA 2GBLC 4AUKA 1M2KA 9ATCA 1VA5A 3A3OA 1BH6A 4KBGA 4YWJA 1G291 4Q1FA 3T4PA 4M54A 5FOTA 1QHNA 4LHXA 5BR8B 4RVOA 1MB0A 2JW5A 2P9FA 2QDXA 4YH1A 2H1HA 1QCYA 1R0KA 4U7DA 1HH4A 3TVTA 1CUHA 3PC4A 5J2TB 5TARA 1T2VA 4YRGA 2I0FA 3OJOA 1TTTA 5IYZA 5JWRA 4JIGA 4KSYA 4GOKA 2F3UA 2ZEJA 1QIGA 1ZM2A 2J30A 2NSHA 1HT0A 1F2DA 1E2KA 3WK7A 1FLDA 3AI7A 2ZIFA 3AF0A 4MB0A 3NEAA 2GH1A 3GXOA 4OBXA 5FAKA 1S8AA 1VE3A 4MYHA 2ETVA 2O8BA 4I6JA 3MJTA 4GRIA 1VL0A 1WZNA 2QTGA 2PCJA 3G2PA 4M0LA 4PQRA 1YR1A 3VTAA 3WLKX 4DBZA 4C2TA 3T34A 4GECA 3A0UA 2GCNA 3DL4A 2Z09A 1P2UA 3HC7A 4KQ9A 1A27A 4O02B 1X39A 4MIOA 5FLEX 3HM2A 4OHOA 1Z6TA 1UC9A 1MX1A 1X9GA 3A14A 3CE9A 3GUUA 4LHYA 4O4LF 5DYNA 3GJ0A 3TQIA 1OF1A 2XUOA 4B3BA 4YI3A 4YRTA 5FUVA 1T8YA 1M2FA 4DM3A 1ZESA 3ZWKA 2C3OA 1Z75A 1I4LD 4TVBA 4LF4B 1YACA 3MYRA 3WGNA 5KNDD 1KJZA 5CM9C 4DZTA 3AW9A 2G3YA 4GPEA 4JVOA 4LOJA 3WNBA 3W3ZB 4W8OA 2NT3A 1PEYA 3H2HA 2VTDA 2XYHA 3Q11A 4CIVA 2RHCA 2P9QA 1FS6A 3R7BA 1TD9A 3JALA 1GL9B 3VNAA 4OXYA 5AK3A 4FCWA 4BECA 2O05A 4GC5A 5AI0A 1XI2A 3V48A 2FLKA 3VSAA 5B4TA 2POQX 1THTA 4HQ6A 1DBIA 2FZCA 3C3AA 4N3BA 4EHDA 1T3HA 4B6OA 3FCYA 2XXAB 4GDMA 1G8GA 2PJDA 1BFKA 2QTWB 3DB2A 3OLZA 3QVGA 3WGGA 1ZMOA 4CXMA 3A3YA 1KFKB 5F2EA 5FQNA 4QG3A 2OEPA 1P4HA 1MJHA 1TTPB 1FSSA 1QIIA 3BC1A 4BXOA 1UJ2A 1AQIA 1RRMA 3LL7A 4UDNA 2W4MA 1XRLA 3ZHRA 4U0KA 2YYYA 2HBQA 5AVOA 5LA6A 4F84A 4RDCA 1NI4B 4P2BA 4AQDA 1SIWA 4GU5A 1PP4A 2O1XA 1Z5GA 2XITA 3AFHA 4R2HA 6REQA 5JQGB 5DN6D 4MV8A 4KI0A 3D81A 3NT4A 4GPAA 1SEVA 2PUVA 5JALA 1UC4B 2JZCA 3EPHA 3M6LA 1C41A 3P2IA 4HUJA 1G7CA 2D1RA 2VZLA 5KAMA 3UKDA 1UKCA 1XMJA 3AEXA 1U3CA 2FZLA 3W6UA 2W83A 2G8LA 4L0MA 3UIEA 2G83A 3HCEA 4XIGS 3ZNPA 2QRKA 1OE0A 5L7WA 2OBBA 3IQZA 3GT3A 4CM8A 3W6OA 1RXVA 1PWZA 3P52A 5H68A 4B4VA 3AK4A 2FHSA 2DTXA 2NUTA 2JJ8A 1ZD2P 5FL3A 4QLBA 2HLDD 1QMPA 5ALQA 1XELA 4Z54A 1TC2A 1IU9A 3CWQA 1EHYA 5F4BA 4BMXA 2BZGA 2AG8A 5KCZA 2XNKA 1M5TA 4NK5A 1DAHA 3CKLA 4UHCA 3U26A 3EB9A 3VZBA 3CWCA 4EY7A 4IAOA 1JS1X 5DBHX 1P2SA 5SYNA 4HWKA 1NV8A 5T57A 3ZH9B 4S1VA 3IUMA 3M9LA 3RVJA 2DY0A 3V32A 1E9BA 1L5WA 2BEVA 4MI9A 3A6GA 3KKKA 1PG0A 4Q1AA 4CZ2A 2R6GA 1W96A 2XOEA 3FPCA 3IGFA 1HLFA 3ZWMA 3RQIA 2BF4A 2D8AA 5KOIA 1NQUA 3PFIA 4CG2A 1NZDA 2V7QA 3C0KA 1G9TA 1BDBA 2QORA 2Y1CA 1X2EA 1UK7A 2BWJA 3GDHA 1XHLA 3GJZA 3ND7A 3PXEA 4MCAA 3T7JA 2EQ5A 1W34A 4H1WA 3GGOA 4H7EA 1XEXB 4XD7D 3L46A 1E1RD 5JO9A 5AJUA 1XGKA 2W98A 1E32A 2G06A 4O4LA 3JD2A 2YOGA 1PWYE 1ZN9A 4X1IB 3NXKA 3OLXA 3IDAA 5ER9A 1LBIA 4IM7A 2Q0QA 2YH2A 2F17A 4DLWA 5LQJA 4BQSA 1JVSA 4RFSB 2IUFA 3RUAA 1JNXX 1OX4A 1Q16A 1Z39A 3CH4B 3I23A 2ZAMA 5BSTA 2WWVD 4EY3A 1OXBB 4GOXA 1E6EA 2Y6UA 3AYXB 3I8SA 3LY8A 4MKZA 4PX2A 1YZKA 3D2CA 4NBKA 4RHEA 5LQMA 3K0FA 4JV5B 5TIIA 1OT5A 5JDIC 1NXXA 1PL6A 1PZEA 2FXIA 1L3CA 1QHFA 3PYXA 2J3JA 2O3JA 3UAVA 2Q41A 2JFZA 3IBFA 2XSZD 4I0WB 3ZWCA 1XDWA 4MB2A 5GJWC 3X1MA 4B43A 4F4FA 2XKAA 4LRXA 3HU5A 3QF7A 1DL5A 5I5EA 4NBWA 4V24A 5GTDA 2OAQ1 3MQ2A 1EYZA 4DBLE 3KJZA 2BY4A 4OA5A 1GRQA 2QPOA 3QKRB 1M6EX 2FA9A 2X0KA 3BMQB 3FOZA 1NY6A 1E5QA 3FTEA 1XT6A 4F38A 4R3NA 1GP2A 1SA0B 3I9LA 4R0VA 4B7XA 1DJOA 4URVR 3MWGA 2JNWA 5AHKA 4CGZA 4OHYA 1FUEA 1OREA 2A2ZA 5BURA 4U7JA 4RY2A 1D0IA 1WX1A 3FZYA 1BO6A 1LK5A 2WWGA 4HFNA 4LOHA 3L8DA 4BFUA 3WDMA 2IF0A 2VBFA 1WKBA 2D62A 2R2AA 3IO3A 3SJAA 2J0UA 4ZTUB 3P9XA 4ZRMA 3DBLA 2CYAA 1X86B 4R01A 2BHTA 2QEQA 1C7EA 2X6QA 1KZ7B 2WKPA 5AMXA 1RLOA 3KOOA 2BDUA 1EA5A 3O8DA 1KU0A 2J9ZB 5JMTA 5K8JB 3FOFC 1VCMA 2DBRA 3MK31 4DGSA 4ZI2A 1LRKA 4KPYA 2IH5A 1PKXA 4ISCA 4TKLA 1R2QA 2JFHA 4KV7A 4RDXA 3QVKA 1K8QA 4M98A 1O0CA 3PB3A 2FSFA 4TKVB 4MUAA 1A72A 1LSSA 1BHJA 5AJZA 5IARA 3ICOA 1ZD4A 5JSUA 2QAIA 1UBCA 3IVXA 5FCDA 4ZCQA 5ISMA 1X70A 5HS6A 4RH0A 4BMPB 5ITSA 4Q47A 1M1YE 2QT0A 3LVQE 1YS9A 4IV0A 2BEUA 3TAUA 3VVLA 4EK9A 1A2KC 3I1JA 2QWXA 3CEHA 4EECA 1M10A 1JDTA 4JQSA 4L5JA 3WWCA 3T1HB 1ENZA 3MJCA 5LMNB 3EXIB 4R1PA 1B73A 1S3IA 1VLLA 3IOCA 3CR8A 1PR3A 1R9JA 2G9ZA 1H69A 3VR3A 1V1RB 1Z16A 3T7CA 3DCYA 5FI1B 4DJTA 5ESXA 5BN3B 5EKTA 4PG8A 3WVNA 2ZJ6A 3UJ6A 2IOHA 2OXFA 4JUBA 2GHIA 1T34A 1XZCA 3FFTA 4JYMA 4PS1A 3WIDA 1EXVA 1K63A 3A37A 1UQTA 1JDJA 2WVJA 1RZRD 4KFTA 2QLNA 2XGJA 4HS9A 4JP1A 4HUQA 2DB3A 5C51B 2ZBDA 3TSYA 5JT1A 1SVLA 2ZSBA 3CX6A 4GMDA 1QOPB 1U5BB 1EFRD 1T35A 3B9RA 2VN8A 2J5BA 2OZLB 3QEKA 4GM4A 4LYYA 2XA9A 4ROSA 3SOZA 1VB5A 2APJA 1FYXA 3VUFA 1CYDA 4TZ0A 4WFQA 5F21A 1L1RA 3QE2A 4MW4A 2H2AA 2B5VA 3GPCA 4DSOA 3DH0A 2AL7A 3G8DA 4BASA 2ATEA 2HM7A 1X1BA 2QTMA 4WKPA 5I8ZA 1MPTA 3QWFA 5ED4A 4E5UA 3HUEA 1U1FA 4O5AA 2XD4A 4WOJA 1II9A 1XR3A 2QIPA 4OI1A 2VTBA 2PS3A 3JPWA 3G9UA 2FZWA 4OIMA 2FSSA 3KTAA 3JAMA 1T9GR 2FUEA 2R47A 2PUAA 1WRBA 3A25A 2O2JA 2EEZA 1F2VA 3QPDA 2Y0BA 1ZJWA 4CM3A 2IIPA 4HDRA 4B0OA 4M55A 1T5OA 1Q20A 1T0HB 3QV1A 4C9BA 5BQXA 1IJKA 2FNAA 5CXXA 3WI7A 2PGIA 3AI1A 3WKDA 2HBZA 5T6BA 1CNMA 1NL3A 1KI8A 2D0OB 1TEHA 2GUGA 2IX9A 3CMMA 3WZ2A 4ENPA 3K0EA 1WKCA 1TUEA 2I29A 2PLAA 4ME6A 4N8SA 4LHVA 1AKYA 1C9DB 1JZSA 1ZZEA 2JARA 4EBBA 4B3HA 1M1NA 1M74A 2BFOA 1R7RA 5CLLA 4ANFA 3LWBA 3L49A 3NBKA 3BFJA 1C9MA 1E4VA 3WNQA 3S5UA 4AROA 1T25A 3ZWOA 1M34E 4LQ4A 5LQDA 2VAMA 2H1LA 4FGJA 1XKTA 1MRNA 2ZRQA 4CLHA 1UKVY 2NXCA 2WNIA 1T0IA 3L3BA 4JIMA 1SVSA 4N5HX 5DPMA 4BGDA 3PQ3A 1I7QB 2O5CA 1QVWA 2XCLA 3UJNA 2X0IA 4QXPA 3A9UA 4YRJA 3SVZA 2V4UA 5B3KA 5M04A 1W29A 2ZI6A 1Y1LA 4BGIA 4GEKA 4B17A 2AYYA 1H4VB 3DNPA 3WWZA 1R4MB 3N0RA 3L0BA 1ZIXA 4FDTA 1UH5A 4LSZA 2AD5A 2V3VA 4J49A 4YMGA 3VHXB 2PRIA 4RPIA 3MC1A 1CUAA 1S02A 1HR0B 3S2EA 3IVRA 1CQWA 1GGJA 3K96A 3MJEA 3ZE7A 2VPWA 2WOOA 5ALIA 2GYUA 2P2ZA 2FR8A 1QVRA 4JJGA 2VDJA 3VH4A 1WOMA 1Y4ZA 5CP8A 2QW8A 5JPIA 2DPXA 2QPLA 3A11A 4OHXA 2UVDA 4FHGA 4PGMA 1N0UA 2FAXA 1W76A 3GCWA 1YZ3A 2WD7B 4NBSA 1GU1A 2DFKB 2FPMA 4RLQA 4E94A 3NPMA 1M0EA 3GRFA 3IIIA 4JL8A 4F9GA 2HRCA 2IHYA 5KQLA 3T5AA 2O4UX 1WF6A 2O5RA 4WH0A 3GFVA 4YMHA 2EL9A 3OTWA 3CX4A 1D8TA 3DEIA 3SR4A 5KQSA 2G82A 1GPUA 2R8OA 1E2GA 3N5KA 4L0CA 4M6WA 4Y9RA 3GFOA 3SAJA 3ZDXB 5CB4F 4BFSA 4DLZA 1G3MA 1I0LA 2E6KA 2HO5A 3KXIA 5K45A 1RWKA 1XRQA 4M89A 2D06A 1QQ7A 3LGAA 3JAWB 5BNTA 1KVTA 4L57A 5AOBA 6AT1A 2VP5A 4YALA 3FBGA 2OV3A 3ADOA 3TL6A 4LFAB 1OR8A 2V3CC 3EFOA 4IJ6A 3STXA 5E2BA 2QVGA 4US0R 2EOAA 1CP2A 1TX4B 3UM9A 1DEHA 1FVXA 3LIIA 4UUQA 3DF7A 1QCDA 2FYTA 2I34A 2B4QA 5TSDA 1N1EA 3M6WA 1K7YA 3GFTA 3UQYS 1Y5RA 4BB9A 1OFGA 3TLAA 3RASA 1O97D 1RC0A 1DRKA 3R7DA 4HDMA 3K0CA 4HVLA 1R5NA 4F6RA 3IA2A 2I6XA 3AOGA 3BWMA 5IKOA 4LY9A 1WDMA 3RRXA 4AYWA 5ALTA 1PWEA 1D4FA 1PCXA 1QKJA 1RE0A 4PM4A 4Q9LA 5HTOA 3R7FA 1R10A 2I6UA 1BE8A 2WJYA 5K0LA 1FYWA 2MWMA 5JFTA 3W2HA 1LPAB 4O2RA 3U9LA 1JDPA 1I10A 3ZS9A 4DTCA 3THYB 3QUSA 2FG5A 1SWWA 3FFBA 2O3UA 4Y2TA 3ZWWA 4RHXA 3FVTA 3HFGA 1DRVA 2DFNA 1JIJA 2WPNA 3PL1A 8LDHA 4EZBA 1DBRA 1JDVA 4WXRA 1M34B 4K5QA 4KUEA 2QL5A 1Q6ZA 1Q57A 2Y1OA 2G0NA 4NG4A 1FFYA 2V8OA 3OIYA 1JSCA 4IYJA 4NS4A 4O25A 4D1YA 1FP4A 5C1IA 1D1SA 4B6FA 3AW8A 4EVQA 5K20A 5K0ZA 2CCGA 3UO8B 4MHTA 1JPUA 1FRVA 5DXAA 1PJ2A 4MEBA 3VH1A 2X1VA 4C4YA 4I50B 4AJ2A 4JU9A 4DA9A 4U5XA 4NC9A 2JLXA 1AK1A 4N1AA 1I2CA 1HT2E 3FMFA 4DDUA 3EBLA 1JA1A 1OBHA 2G9QA 2V0GA 2I22A 5HIAA 2B99A 5EMMA 5AW2A 3D02A 3WJ1A 1FDTA 1DWUA 2INGX 2PM8A 3EVCA 1SO8A 3AJDA 2JJ1D 3RS4A 2AG1A 1N7GA 2JGAA 3V1YA 1Z15A 1MF7A 3ROTA 3VO1A 3WLJA 4HWTA 3MPOA 1Q15A 1V8BA 4BB6A 2BI4A 4AZVA 2H1OA 4DCGA 4PNHA 3FOCA 2OKCA 4TKUB 2ZQYA 4RMIA 4Y8VA 5BSEA 4S05A 3N8DA 2JHAA 4ARIA 3QXGA 2ODEA 1N7JA 1ZBQA 3RKRA 4C6TB 1GTSA 2O8FB 1NHWA 3LQKA 1CSEE 3NB0A 4IEEA 1T24A 1IUNA 1T8SA 3DZKA 3Q8XB 1CR1A 4YAFA 4F06A 4QBTA 1F1BA 4REOA 1FYFA 4GXRA 5KVCA 5IVKA 5DB4A 1H5UA 3CVVA 1YR9A 2W2KA 1J2EA 2X4LA 1MTOA 3EXHC 4O4HB 2VP0A 2NU8B 3K2QA 1TXGA 2QRUA 2VOEA 3RSQA 2IYPA 2P75A 1GDHA 2RK4A 1AM4D 3RJMA 3AHIA 4D92A 1U80A 3NYQA 3ISVA 4YACA 3OZBA 2CUTA 3I3SR 3UVEA 5CB4A 2PY6A 2WVAA 2R7AA 1H2EA 1NW3A 3FZQA 3WLIA 2DHDA 2ZJYA 1D2HA 1E5TA 1FTNA 1TKAA 1X13A 2FRDA 2RHBA 2O1SA 2NU6A 3CA8A 3EH1A 4RKQA 1CFZA 3THXA 1L4MA 2B1QA 4EATA 2XHZA 3B82A 3GLHA 4B0PA 4K3UA 1UWCA 3GQBA 1TF2A 1VJRA 4C7OB 3KYDA 5IFLA 1U0OC 5IEBA 3IR5A 1RPAA 4NTZA 3ZZMA 3T35A 2OC4A 4BLWA 2NVUA 5J2TF 2ECKA 2JFXA 3COZA 3ZWBA 1UUFA 3ELYA 3EEBA 1P45A 3QIVA 1CVRA 1XX6A 4QUKA 4N41A 1WABA 5K8UA 3I9NA 3A1SA 4JB8A 2B5OA 4A16A 1V5WA 3PDIA 3BG5A 5KUTA 1ZR2A 5CLIA 4INPA 4CM5A 1A69A 1S8FA 1LH0A 1XXHA 4JOSA 4F4HA 2O6HA 3OEYA 1H2WA 3A6ZA 5FFMA 3OAAD 5IK2A 3ABSB 1TW3A 4ZVNA 4BLVA 1GO2A 2NXNA 3ASYA 5CHYA 5HKBA 4J0DA 2HWYA 1R6XA 1YUBA 4HT3B 1XAGA 4FMCB 1LQ2A 2FWNA 1L3IA 1I4TD 3GG2A 3QFTA 5IKXA 1UZNA 2QUIA 1RJGA 4Q3LA 2BRUA 1O5IA 3QLVA 1KWKA 2Q2VA 5J3JA 4ECEA 5HF9A 4CM7A 2EZ8A 1X8KA 1K6MA 3L92A 4O3MA 3UK0A 3IBYA 1N8KA 3DMNA 4EBFA 3IL2A 1COZA 2VXOA 3PXXA 2RBKA 1XMPA 2HREA 4Z1MD 3SYRA 3HLYA 1WXHA 1IONA 3ERCA 2VR1A 4HNHA 3K0BA 3RYHB 2NP6A 4P22A 1TF5A 2ZVJA 1AQLA 2CD9A 1T4GA 1JH9A 1NV9A 3TR6A 1FU7A 5I3CA 4OFZA 3L7MA 4M22A 1BYIA 1MG5A 2XBUA 4B87A 1FZQA 1BMDA 3GUVA 4YRFA 2Q5JA 2QAGA 4RJLA 1XLUA 1Y8RA 1I4EB 2KX7A 2QJOA 3HNPA 1CR2A 4Z6KA 5FBVB 4R1NA 4GSYA 1YFKA 1L8AA 1XZNA 2YWBA 1IVYA 2QX4A 3PC2A 2Z6QA 1XJWA 4DQUA 1ULUA 3A1UA 1SG9A 3C3BA 5DI3B 2Z9DA 4ARZB 2G5PA 4MQMA 3JQ7B 4BB5A 1BQ4A 1GARA 3DBOB 3OSZA 1R8XA 2EP8A 2ZETA 2RGCA 4P5EA 1BVRA 1RNLA 3TZKA 4OJTA 5K4GA 3HCAA 4I9HA 5CH5A 1G7RA 1PD0A 5K51A 1VPVA 5D3MB 1U8AA 2BTOA 2PKEA 2RAPA 4OK5A 3HU3A 4PNZA 3K15A 3HMKA 2CDCA 4L16A 5D5QA 1IHUA 4HNVA 2C20A 2O52A 2WMOB 3BD6A 4XVHA 4ZCMA 3DDOA 5JQGF 2J3EA 1Y34E 3G0DA 1IHDA 2ZFUA 2R7MA 2ZTUA 4MMZB 5EWLB 1DKUA 2ZS7A 4IQFA 2BKUA 3H1TA 5I4IA 3BAFA 4LEIA 1JF8A 4B9AA 1O96B 2JRLA 4X64B 1E2UA 1TJ4A 4FHFA 1JJVA 4UW9A 1HDRA 3DE0X 1SCJA 4YBRA 1KY5A 3I32A 2WHPA 4D9JA 1IY2A 2FZGA 2PGAA 3ZWPA 1FYEA 3G02A 5AUOB 4R0NA 1NW6A 3L7LA 2AHRA 2XDWA 4RGQA 3OBBA 4R3WA 1OMOA 4DANA 2GEKA 3LLMA 3PNQA 4UNNA 3IP6A 2I8LA 3Q15C 4GI2A 2QQGA 1AHPA 4D9IA 5A1TA 1B7GO 1ONSA 2W5UA 2H31A 3BB4A 3N53A 5LQCA 3U61B 1BKSB 2PZGA 1XFDA 3DNFA 3K9NA 2BHLA 2J5QA 5CVUA 5AM3A 2V58A 5J2TA 3FY4A 1ZX1A 3AY6A 4LV8B 1KERA 1J70A 4KLZA 1XZFA 3UN1A 1UT5A 3HBMA