2WBLC

Three-dimensional structure of a binary rop-prone complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
175
structure length
167
Chain Sequence
RFIKCVTVGDGAVGKTCMLISYTGPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPGIPIVLVGTKLDLRDDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords RHO OF PLANTS GUANINE NUCLEOTIDE EXCHANGE FACTOR 8
publication title 3D Structure of a Binary Rop-Prone Complex: The Final Intermediate for a Complete Set of Molecular Snapshots of the Ropgef Reaction.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 56
structure length 167
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wblC00
3QBVA 2UKDA 3KQLA 4OK3A 3CWZA 4QBHA 5EE1A 1UEIA 3K9LA 2Z43A 4MRNA 1KO4A 1OHHD 1SVWA 2VP2A 3BWDD 2P6NA 3K9GA 2XGJA 3KKQA 3RYTC 2YNMA 1DAIA 4Z51A 1W46A 3VR3A 2OBNA 1DS6A 4EAQA 2LCFA 1ZC3A 2J7PA 4OQNA 2EFEB 3CONA 3DZ8A 3FMFA 3SBDA 5CIQA 4A6XA 4I1VA 3RS2A 2GCPA 2ONJA 4RD2A 4MGYR 2V3CC 2CVFA 2VSOA 2YZ2A 4G5SA 1A7JA 1T5IA 2DWQA 5BYKA 2WAYA 3VKWA 1K8RA 1IN7A 1ANKA 4GOKA 4D0NA 2CNWD 3O8BA 4FD2A 2FF7A 1OXSC 4K8OA 5DE3A 1DO0A 1A4RA 4RFVA 4AG5A 3SHFA 3F0TA 4FIDA 2X77A 3TW4A 4HLUA 1OSNA 4NCJA 1S96A 4A8JC 1KO7A 4HAXA 3C5CA 4DLVA 1Q3HA 4G5RA 3FKSD 3PUZA 1KAGA 1S4QA 2YHSA 4JKIA 4OQFA 1E0JA 5JZVA 4ZCIA 5CDFA 2IEZA 1WBDA 2D2FA 4Q66C 4F4IA 3CNLA 1LS6A 1XF9A 4QC2A 2W6IA 4EPYA 2F55A 3CF2A 1LB1B 4MKGA 1SULA 1S0UA 4KFRA 3GD7A 4QBFA 5L3QA 2O8DA 3OIWA 3L0OA 3PUWA 2VO1A 2RHDA 3KKMA 1ZW6A 1CJUC 2FZLA 4F4CA 4Q1FA 4BGDA 3MWJA 4B6FA 4KSBA 3GFOA 4P4TA 1E3MA 3TIFA 2ZROA 2AL7A 1HE8B 3HR7A 4JVMA 1COWA 3QQ5A 5B64A 1NSTA 2GHIA 1OJLA 4GOJA 3BIFA 4O2LA 3DKVA 2FU5C 2Q21A 3TQFA 2IWHA 2QP4A 2QPOA 4US1R 1XTRA 2QT1A 1FX0B 4OYHA 2YWFA 2G88A 4PC3A 3TRFA 1CULC 1XMSA 5CK4A 3EA0A 4PPFA 3KTAB 4TZ0A 2AXPA 2ZRJA 3T1QA 2ZRPA 1GNPA 1EG7A 3A4NA 3K0FA 3TMKA 3GLHE 1FPMA 3V4RA 4LBVA 2V6JA 3B6EA 4TLDA 4OHVA 5CK5A 1W0JA 1SZPA 1J7KA 4UJ5A 1E9BA 1AZSC 2C9CA 3K09A 3Q5EA 3K53A 3AF1A 2IWRA 1J8MF 1RYHA 4G5GA 2ECKA 2J7PD 1XEWY 4QBIA 4CZ2A 2VYFA 1S2MA 2QROA 2WWHA 5SZHB 4OHWA 4ASUA 2FGKA 1W5TA 4ZCLA 1HEIA 1W4AA 2ZR0A 2BIFA 3QXSA 3T1OA 4D82A 2DR3A 1GM5A 1N5IA 3GLHB 4MGZR 4NYMR 4ZKDA 2WWWA 4HYYA 1NVUQ 4RFSB 3LD9A 4DRZA 2XB2A 1N6KA 1IBRA 3FHTA 1NRJB 2PMDA 1RJ9B 3W90A 2WV9A 4DEXA 1GL7A 2A7QA 4NYIR 5TMPA 3BK7A 4KLZA 2ZI5A 2VHTA 1Z3IX 3GLFA 2VEDA 2ZSAA 3W9YA 2WJHA 1GSIA 1A2BA 2GXQA 2OILA 3IPYA 3MGCA 3VMFA 5DGXA 2OG2A 1XZPA 4AIIA 4ESVA 1Z8FA 3HWSA 4LJ5A 1ZNXA 3W6PA 2OT3B 4D4JA 2N1BA 2W6ID 2QAJA 121PA 3RS4A 2HF8A 5KYKA 1KKMA 5KTYA 3F3YA 3CZPA 1G16A 2ZYUX 1UBGA 5E7JA 2R44A 2A5YB 4D4LA 3FKQA 2C9YA 4JL5A 4URWR 4QXAA 3I61A 2ZJYA 2ZRKA 3GCGA 3MUFA 2H16A 4W5WA 2OFWA 2NZ8A 3LX8A 4LUCA 3DZDA 3U3MA 1OH7A 4MKIA 4DB2A 1NIPA 2ODWA 1GDDA 4OQLA 3DDCA 1BO6A 3FB4A 3ZVLA 2E87A 4UJ3A 1GILA 1COWD 4I81A 2BBTA 2AFHE 4LBZA 4GP7A 2GBLA 4GPTA 1JQLB 5IDVA 1G4AE 1PUJA 3LLUA 3O8RA 1ZP6A 4IKEA 1NJGA 1FP7A 2DB3A 3L82B 2BVNA 2ZYWX 3VR6A 2OBMA 4G01B 5FOWA 4ZDJA 5CITA 3EPHA 1FMJA 1RRPA 3LXXA 4IVRA 2PZFA 3GJ0A 2AR7A 1OXTA 2ZE6A 4UXIA 4AYWA 1G1MA 2W2TA 3B1WA 3CRQA 3VTKA 4DCUA 2QSZA 2RGNC 2QRZA 5J4KA 1KTVA 4TL6A 4MRPA 1AN0A 2NQ2C 3K0EA 5L3VA 3NVAA 2NG1A 2HEIA 2AK3A 2V7QA 2Q9CA 2WMNB 5CLLA 1HQCA 3BH0A 4D0GA 1TNDA 1LF5A 2JATA 3DMNA 5EQTA 1RRGA 4IOKA 4MYTA 2PCJA 1WE2A 1XXHA 4HDOB 4LV5B 4DT1B 3W3AA 1F48A 5KPDA 4OHYA 3TSZA 1JEEA 1U0LA 2RCNA 1Y63A 4I99A 1QVAA 5HE9A 2C2HA 1SVMA 3I1FA 3LLMA 1ZUNB 4QHSA 2ZJAA 1EXMA 4PC6A 3TUIC 4WXPA 4MYUA 2ZQ5A 2QMEA 1F2UA 3TKLA 1Z0DA 5AR1A 1Z0IA 3S1AA 3TVDA 4A9AA 4BLQA 3D8BA 1NF3A 3MJRA 5H8WA 1UEJA 2C96A 2MSDB 4TSFA 4RZUA 1SXJB 1C1YA 5F2EA 4FINA 2F1JA 4RZ2A 2C95A 2QUZA 3U4QA 2J0UB 1E0SA 1OXVA 2AK2A 3L43A 5FFMA 2FDCA 5EXXA 2H17A 1G8GA 2GKSA 1ZM9A 2WBLC 3PFIA 1XPOA 2ZJ8A 1UJ2A 1KNQA 1Z0JA 2IS1A 1T5LA 2O8EA 2OO7A 4LYJA 4A4DA 1F2TA 2CJWB 5HCNA 2D62A 4M9XA 2CLCX 5A4JA 2AX4A 3FMOB 5SZKB 4Q19A 3SOPA 1OE0A 1N6NA 3FMIA 3PEWA 1E2IA 1GRNA 4TYYA 3T1TA 2OM2A 4P4SA 4DUGA 1U0HC 3TK1A 2OAQ1 4TQUS 2V1XA 2ZREA 4AD8A 1OIVA 1U98A 1Q1ZA 3G0HA 1ODFA 2BWJA 4JLOA 1NLZA 3H2YA 1OXUA 3NG1A 1XD2A 1II8B 4QG7A 1NSFA 4X8HA 3THXA 2DHRA 4NCKA 5FOXA 1JJ7A 2D2EA 2H5EA 2Q6TA 1KDPA 5JHHB 4LHWA 3E70C 4P32A 5AK0A 1RRFA 1SKQA 2QNRA 5EXSA 4W5HA 4G0NA 1HH4A 1CP2A 1JBKA 3BD9A 3H86A 4PAOA 3AKCA 3W34A 4DZZA 5KNBA 3NEJA 4KODA 3WYAA 4QKQA 1G9XA 1CXZA 5CYPA 3FFAA 4B3BA 1HYQA 2V7QD 2YVUA 3PVSA 2XEXA 3H1TA 4F92B 3K0CA 1SXJC 4B3CA 2ZI9A 2P65A 3P26A 1D2NA 2O0HA 3QKRB 2BEKA 2QN6A 1KZ7B 2XXAA 3AUYA 5DI9A 4R9UC 4B2LA 1Z06A 1S8FA 4II7A 4LHVA 3UMFA 2JEOA 2GJ8A 4LJ8A 1EK0A 2HCJB 2MMCA 4W7SA 4IOLA 1AA9A 2IXGA 3FHOA 1XD8A 2ZRIA 4UQOA 1AQUA 3DM5A 3L0IB 2FMXA 5HKKD 4Q02A 2N42A 1YR7A 3SE0A 4NHOA 1E9CA 2FNAA 2R6GA 1DELA 4TSFD 5AJYA 2OUKA 3NC1C 4BWYA 4FW9A 1PLJA 4OK6A 1AS3A 5DI3A 1KSJA 3CR8A 3RWOA 4TMZA 3TR5A 2D7DA 3IEUA 3QKTA 2J41A 2PH1A 1FTSA 5GVRA 3PXGA 4DEYA 2JLQA 2FFHA 3M1IA 1KDTA 3SZRA 2WKQA 1E2NA 4BFUA 1YKSA 3ASZA 2ZRCA 3BORA 4E07A 2H7VA 1ZU4A 4NP6A 3VNUA 2EFGA 2Z4RA 5FUXA 2O8CA 1XU4A 1KJZA 4HAWA 3E2IA 4A0GA 1DAEA 2KWIA 1G64A 3QEJA 5EZ6B 4BLSA 2ZU0C 4KFSA 5KNDA 5C1BA 1VDZA 3R9XA 3H4MA 4IEEA 5GJBA 1KMHB 3QF4B 4DUGD 4O3MA 2G6BA 2JJ8A 3NDBB 2PMKA 3OIVA 3CIOA 4Q4JB 4WW0A 2A30A 4NYMQ 1RVDA 2GEDA 1W7AA 4LZZA 2IYTA 3CLVA 3A37A 3VU9A 4Y0AA 5J4LA 2RGXA 2FH5B 1VCNA 4HAYA 1Z63A 3EC2A 3ETLA 2BV3A 5E95A 2WAXA 3I62A 4NYIQ 4XIGS 3CB4A 2JLVA 4A0FA 4BQSA 1G5RA 3PEVA 3OFND 5FBVB 4G5QA 3SN6A 5JHGB 2PLFA 3J81k 3TW8B 4D6PA 1TF2A 2XTMA 3JZMA 4M1WA 4B3DA 2AKYA 2KE5A 4XWKA 2VBCA 3CPHA 1W4RA 5DSZA 2CL0X 4G3XA 1IN6A 1NKSA 1IJFA 4NH0A 4R7ZA 3TNFA 1YE8A 5KDDA 1AZTA 1Q57A 4Q1EA 2ERYA 4GRAA 4XD7A 1W36C 4QJ4A 4BLOA 5D3MB 1CRPA 3OE7A 2KBFA 2NTYC 1RKBA 1KI8A 1I4DD 3TAUA 3K70B 2ZJOA 1F60A 1P2UA 1PJRA 2AN9A 4MGIR 2O0JA 3EA5A 3EZ6A 5JWHA 4BECA 4IXMA 1E1QA 2C04A 1FP6A 1KJWA 5HR5A 2G3YA 3WYGA 5C4MA 2WHXA 1EFRD 2K5UA 2F6RA 3I32A 1KNXA 2N46A 2WJVA 4TL8A 4C0QC 2ZXUA 5FTNA 4HB4A 2CL7X 3QE0A 1ZIPA 1Z6AA 1ZYUA 4DLSA 1NIJA 3I4LA 4DC9A 4NBSA 1NVVQ 2KSQA 4CT5A 4F38A 4AWXA 2E9SA 3U7HB 4HSEA 3X2SA 1G21E 2P0EA 4QGAA 3WMEA 2OV2A 3QIAA 2FFQA 4MQBA 1Z0AA 2I4IA 4PPQA 1MO6A 4CEHB 5TV2A 821PA 1TADA 2GAOA 1ZNYA 2HT6A 3U3JA 4RKFA 4UNQA 4S2EA 4IDNA 2LKCA 4C0SA 2CHVA 2R6CA 2ZRDA 4DCNA 2QM7A 3GEHA 3FOZA 2AD5A 1GL9B 2JLYA 3GP8A 1P2SA 1F6BA 1CEEA 1KAOA 3T06B 2PJRA 4JLJA 2VP9A 4XVQA 521PA 4C7OB 2GVDC 2PX0A 1U8AA 2ZSBA 3HU2A 4M1KA 2QENA 4TMKA 2O8BB 5EP1A 1HUQA 1T3LA 3MMPA 1KSGA 1GP2A 3U7GA 1OKKA 2YYZA 4YDSA 3TBKA 3GPLA 1P9WA 1LV7A 5CM9C 2RHMA 4JL8A 2W2VA 1KMQA 1AM4D 4JLMA 4PAMA 4EPRA 1FUUA 1VECA 4D4KA 2RGGA 3U61B 4C30A 2WMOB 4L5BA 4ZCMA 3RC3A 1CJVC 2ZRNA 5G40A 3NKVA 2FV8A 1KI6B 2HLDA 1XEFA 4V0MA 2R62A 3BFXA 3RNLA 1NP6A 4A2WA 4YXWA 4IJMA 2NO0A 2GF9A 4ARZA 1EWRA 1XJQA 4MH0R 5B58C 1CBUA 3QKSB 5CLQA 4A6PA 4XVRA 5DH9A 2P67A 4BRUA 4EJSB 1G3QA 3D31A 4DKXA 4U02A 4XD7D 1UDWA 2VLIA 2FZ4A 1XBTA 3GJ3A 3OE7D 4HUTA 2ZS8A 3BH6A 3RANA 3KJEA 4R2HA 3P32A 1DG3A 1P7CA 1WXQA 2J3EA 3P4YA 2C98A 5HE8A 1E1QD 1WMSA 4IOJA 1EFHA 2QQ0A 4LYAA 4LY6A 2GAAA 4US2R 1X1RA 2ZETA 4YDHB 3WYFA 5L3RA 4MITA 1JB1A 2IK8A 3B2EA 1DE0A 3A8TA 2VSFA 4QNMA 1ZRHA 4CEIA 1U2RA 1JECA 1MH1A 2GNOA 3LY5A 2WKRA 1XJCA 1YQTA 3KQNA 4D25A 5JSZB 2F7SA 4HAZA 2WSMA 1U0JA 1BOFA 4C0KA 4G1UC 5TDHA 2O8FA 2WWFA 1ZCBA 2IXFA 3W3ZB 3IUYA 2BM1A 4JJKA 3THYA 4PZZA 3TH5A 1HQYE 1DTSA 3ZDQA 4BFXA 1E98A 4JBWA 4M1OA 3SU8A 3H0KA 2C9OA 3AVQA 3NHAA 1IONA 4RSGA 4L9WA 5GJCA 4FWIB 3SR0A 1E2EA 4PSKA 1FFHA 3I5XA 3B8HA 1GRQA 4C0JA 3ZVNA 4RD3A 2SHKA 3DO6A 4HAVA 1JR3A 1LY1A 3LVQE 3KFXA 1NY6A 1QHXA 2GEVA 2XX3A 5HZHA 1OKKD 2ZI4A 3QPVA 1U9IC 3VR1A 1T8TA 1VG0B 4YMWA 2QA5A 4EJSC 4U5XA 3AKYA 4B34A 5KPJA 3PG5A 3KKPA 1VHTA 2ATXA 5SZIA 3B82A 3ONWA 1FUKA 1IN8A 2Z83A 3X1YA 5FBWB 4A8JB 4URYR 5UKDA 1GZSA 3B60A 2AXNA 2D06A 2HLDD 1TEVA 1XCGB 5CJ2A 1DBSA 3JVUA 3AF3A 1E2DA 2EWWA 1UKEA 1G3UA 1II0A 1KHTA 3QXXA 5CIWA 4YXWD 2FPKA 1E79A 3L0PA 1TTTA 3EPKA 4DCVA 4R2IA 4Q4HB 3U6KA 2PT7A 2XNDA 2Y8EA 4OL0A 4Q1DA 4TMWA 2HT1A 4FMDB 2TMKA 4B76A 2J9RA 4J0QA 2QL6A 4TZ6A 5CDFE 3TAHA 3NXSA 2IYRA 3GFTA 3QBTA 2Q3HA 4WBSA 3JVVA 4OK5A 4TMVA 4AYTA 4ZIRB 1X8LA 1E2HA 2Q9BA 3FWYA 2BJWA 2W58A 3OEHA 3E5HA 5IHPA 3VX4A 4JVNA 3RRNA 3O8CA 3PENA 1P3JA 4M53A 1GAJA 2W6JA 2JGNA 1ONBA 4LHYA 3TJZA 2OSBA 1WCV1 3SJZA 2P6RA 2R6FA 1A2KC 2J0QA 3SHWA 4M4SA 4EDHA 5JFGA 1YZGA 3WY9A 4DCTA 1ZIOA 3KB1A 2XTZA 1MABB 1ZAKA 3ICQB 2E1RA 1MO4A 3AGPA 4PSAA 1PUIA 2Z6VA 3T15A 1J99A 1E96A 3TGPA 3IEVA 2O8DB 4JLPA 1Y3AA 4DVGA 1OXXK 3R7WA 5KSZA 4PHFA 5L8VA 4Q01A 3IQWA 3TUZC 5KSYA 1NG9A 4DLRA 3KJHA 2QPTA 2HXYA 5G41A 1Z83A 3GJXC 1G8YA 2JLZA 2WOJA 3GJ7A 4B3XA 1EWQA 3M0EA 3R9WA 4NTZA 2EWVA 4ERNA 1R8QA 1N6RA 2EYQA 1W48A 5EE0A 1GFIA 3A1WA 4BRWA 5FL7A 1IAQA 2A9KA 3LV8A 1U90A 1E6CA 3LH5A 4HI0E 1M2OB 4LHZA 4P0TA 1UF9A 1F5NA 1N6HA 2YC4C 2YJTD 4Z1MA 1ZM7A 2OXRA 4EQ6B 621PA 3A4MA 3UPUA 1VIYA 3HYRA 1IN4A 2F9MA 1QDEA 4GBMA 4L8GA 4Q7LA 2B6HA 2R6AA 2Z0MA 1MKYA 1YHNA 5D3QA 5EP3A 3KX2A 2ZRMA 3LW7A 3KFVA 3K0FB 1D5CA 3H84A 4ZDKA 3IIMA 1L4UA 1Z6GA 3AF2A 1KSFX 1Z6TA 2GF0A 3ADKA 4E03A 3AP3A 4B6EA 6Q21A 5B30A 3EIQA 3GJ5A 4HLUC 4IOMA 2QY9A 4M22A 4QFMA 4A0RA 2IYYA 4B48A 3GLFE 4HB2A 3Q7QA 3MWKA 2P6UA 1G8HA 2IF2A 2IBMA 2WPDA 2XNDD 1RZ3A 3ND8A 5ANRB 5AJWA 1AS2A 5FI1B 2YWEA 3EG5A 1Z08A 4YONB 2GESA 2FFBA 5FL3A 2Q3MA 4D4MA 5JI2E 3QG1A 1Q0UA 4HLCA 1LNZA 3VAAA 1YR8A 2EFCB 4A15A 4RD1A 3FTQA 1G4UR 4PO1A 2IYLD 1Q3TA 3OEHD 1HT1E 5FTMA 5FI0B 4B71A 1VKJA 1WF3A 4US0R 2W6JD 4NKRA 3THWB 2NPIA 2MSCB 2D3WA 4M1MA 4FMCF 3BFVA 4GFDA 4FCVA 2VF8A 1RFLA 1TQ2A 1VTKA 4M21A 4NONA 2GETA 2GJKA 1JAHA 4HZUB 8OHMA 2CXXA 1OPXA 721PA 3U2QA 3AEZA 3ZVMA 3AKEA 4A82A 2QGNA 4TT3A 2HF9A 4Q1BA 5JBQA 4PXAA 5BQ5A 1NJFA 4M9SA 4QGHA 4ILEA 4ITRC 4Q7MB 4DB4A 1ZD1A 4Z54A 1VCOA 1VYTA 4B2PA 1IY2A 1AGPA 3L8ZA 2ZJZA 1JPJA 4WZBE 2NPFA 3WHLA 3P1JA 2VP4A 4JBXA 2EQBA 2KBEA 2JJ1A 1NNEA 4M1SA 1IXZA 4PZLA 1Q1BA 3KTAA 3R8FA 2IYXA 1E69A 4HB3A 2IA5A 1D6JA 5EUQB 3SEAA 3KQKA 1PLKA 2AFIE 5G53C 3ZD7A 2PZEA 5FL7D 1TAGA 2F43B 1QHHB 1Z0KA 3K09C 2JDIA 4N0DA 4Z1MD 1ZC4A 1P9RA 1D9ZA 1X1SA 1DAKA 2D74A 1HT2E 1XXHE 2O0KA 4V0LA 1P75A 1R7RA 3UK6A 4DJTA 3LWNA 3SYKA 5BN3A 1S3SA 4OBEA 1R10A 3M6AA 4PPGA 3WP0A 1HE1C 2KJQA 3MCAA 3QEOA 3VKHA 5J47A 1R5BA 2OFXA 3DL0A 3HYTA 1E4VA 2RGEA 4FMBB 4Y0VA 5JJIA 1KK3A 2VL7A 3SJBA 4B3GA 1ZJ6A 5BWMA 3M4YA 2AWOA 5J40A 2BKEA 4DHEA 1KYIA 1YZLA 2FN4A 2H18A 4RFSA 4F93B 1PVOA 2XSZA 2FSIA 2WJJA 5KOYA 1NVVR 4GZMA 1RJ9A 4OHXA 3BB4A 1A5TA 2WPDD 3WRYC 1YZNA 2GXUA 4UXHA 4XJXA 4E22A 2F9LA 3AVVA 1XMJA 4EFNA 4QRHA 1OIWA 2VHJA 3R9IA 1KSHA 3AKDA 1OW3B 4A0HA 1SGWA 4IVQA 1NG1A 1KI4A 3IKJA 4M8NE 3U60B 5F9FA 3MAAC 5IT5A 2CCGA 2CDNA 3KQHA 1NMXA 1DOAA 1AS0A 2WWYA 4B35A 1T4GA 3EX7C 2EU8A 1E2GA 1W0JD 4Q4AB 1MRSA 1S9HA 3EWSA 1X3SA 5F98A 2FSGA 5DIFA 2QBYB 1ZM4A 3SFVA 2V6IA 3ZJYA 2KB0A 1J70A 4F7WA 1W1WA 2WJIA 4JIMA 5FUWA 4ASUD 1H8HA 1U8ZA 2QP3A 1M8PA 1E9DA 2WOOA 2GCOB 1UM8A 5FTLA 5J4YA 4A1FA 3NH9A 1I2DA 2OXCA 4BFWA 4JSTA 4EPTA 3U3RA 1LVGA 2ZSFA 5CYOA 4BFZA 4TT3D 3K0SA 4Q7JB 1E32A 1WQ1R 3FE2A 2WSSA 1EFTA 4RVCA 1RW4A 3CRW1 3DOEA 1I4TD 2WWIA 3VKGA 4RY2A 2QPAA 1UAAA 3NH6A 4QHYA 5L3SB 4JYCA 4LC1A 2CCJA 3B1ZA 1JEDA 1FTNA 1W0KA 4LYFA 4P4SB 1TF5A 2F1IA 2G77B 5TVKA 2ZITA 4F4JA 2J46A 2BMFA 1X8JA 1UPTA 4K46A 3MD0A 4OHZA 4U7DA 4V02A 1A82A 3QY0A 4QGFA 2B8WA 2VQSA 2YV5A 4MGKR 1GOTA 5IF9A 4PTLA 5G3YA 2REOA 3U3OA 4B33A 4Q9KA 1K6MA 1XCMA 3AF4A 3PEUA 4MKFA 4HLQB 4ACAA 1VPLA 3CPEA 1NBME 1T8UA 2QMOA 1CR0A 3I92A 4PANA 1D8TA 3UG7A 4DT1A 2FWRA 3IBYA 2ZAOA 4Q1AA 2OEPA 4PFSA 1G6OA 2IS4A 2ZM5A 3BXZA 2RB4A 5CJPA 1ESMA 2ZS7A 5KSOA 2EW1A 3HJNA 2I1QA 3KUCA 4B75A 2ZI6A 4E09A 3B9PA 5F9HA 1UFQA 3HP1A 4UNPA 2V9PA 1KI2A 2EVWX 4ACBA 1N6OA 3MLEA 3UXMA 3A1SA 3VR4A 3KQUA 3F8TA 2NGRA 1SXJA 4PX9A 1IY0A 4BE7B 2HXSA 2ZR9A 1FOEB 1R0ZA 2IHBA 2V8OA 3RSLA 1VIAA 2J0UA 3BJIC 5TY0A 1OYYA 4TN1A 4DLYA 5KHOC 4HUQB 1JALA 1P60A 3VR2A 2A5FA 4B3FX 4PPNA 1RC8A 4CGZA 3NWJA 1E2QA 3Q3JB 3PUYA 4AKEA 2ERXA 1QZXA 2CJWA 3KJGA 1M34E 2A3RA 1FNNA 4EKDA 1LF0A 4BUJA 2IYWA 1H8HD 4N1AA 2CL6X 1YU9A 2EYUA 1M1YE 3ZZ0A 3UG6A 4WAUA 3QVVA 3GEIA 2BEJA 2GK7A 3ADCA 1V5WA 2PLRA 2WSSD 2L0XA 4YMUA 1TEXA 1T9HA 5EXTA 4DIDA 4OI1A 3CO5A 4QJ3A 4P31A 5JCZA 4OKSA 2MSEB 5EP4A 4B47A 3A1VA 3D6TB 1W36B 1G6HA 1II8A 4BASA 4DLZA 3RS5A 1M7BA 4LDJA 5JRJA 1KK0A 1BYIA 4IXNA 1XWIA 4GMXA 1D2MA 4P33A 2F3RA 3MJHA 1HV8A 2GA8A 1EX6A 1OF1A 4PHGA 1ZCAA 1I4LD 1E0KA 2ZRLA 5H68A 2C03A 4TQAA 4KBGA 1ZNZA 4WZ6A 2YOFA 3EARA 2R65A 3FPAA 3K0CC 3QXJA 5AUQA 2A5DA 3HU3A 5E7IA 4Q7KA 2C99A 1DAGA 4Q18A 3O8DA 4TLAA 5AJZA 4LHXA 1ZNWA 3NBYC 4DSTA 1KI3A 3QKRA 1E2JA 4TYPA 5FPHA 1EFCA 3C5HA 4POAA 4H1UA 1QBKC 1P73A 3BERA 5EE9A 2NIPA 1E0AA 4WVFA 1MO3A 1TU3A 4Q9LA 221PA 1LW7A 4HAUA 4IVPA 421PA 3B85A 1BYUA 2G0TA 3QI2A 3R8CA 2XOKA 2DWOA 2WIAA 3OZXA 5EJEA 2IUTA 3Q85A 2PX3A 3FHCB 2GXAA 2NO1A 4NMMA 4Q48A 1VYVA 1JQJC 2RGBA 1A1VA 3VHLB 4Q21A 4GP6A 2QI9C 3FGNA 2HJGA 5JI3E 3RS3A 3ZQJA 4C2TA 3ADDA 1SXJD 2CBZA 4URVR 2ZE8A 3DVLA 3EC1A 3C7KA 4UNRA 3W6OA 3V00A 1ZM2A 3U5ZB 2B7BA 3GJ6A 1AQYA 1ZUHA 3PQCA 1GG2A 3VR5A 4EPWA 1I2MA 3KL4A 1D9XA 1CR2A 4QGGA 4Z8XA 4URUR 3TR0A 3I3SR 1K5GA 1OB2A 5BXQC 3RC8A 4C9BA 4MUAA 3ZYCA 1CKEA 1VMAA 2HUPA 2PT5A 3A58B 5DHAA 2DFNA 3VFDA 3C41J 4KO8A 3EW9A 3KKNA 2J59A 2UZIR 3PR1A 1N0VC 3RVBA 3GLIE 4TMXA 4RCZA 1M6NA 1JAIA 1OT3A 1XTJA 2ZUCA 1C4OA 4KAXA 2H8KA 1UDXA 3QSYA 2QZ4A 1VCMA 2WJYA 4O2RA 1G5PA 2QRNA 2H92A 4WXRA 3EZ7A 1KMHA 3QF4A 2C8VA 2VHQA 4LCBA 4CEJB 4Q4JA 4XSGA 4Z8YA 3C16C 2JAQA 3BE4A 5AJXA 4URXR 1WRBA 2CE7A 1QVRA 1US8B 3ZS9A 5LD2B 1KDRA 1CIPA 3N70A 3LFUA 4L15A 2BKUA 1JPNA 2BMEA 3SJAA 3GLGE 3GQBA 2J5XA 1GTVA 2VHUA 3B1YA 4LWZA 1SVIA 4PSVA 3GLIB 4FMDF 4JYBA 3UWKA 3IO3A 4AY2A 4NE2A 2YINC 1G7RA 2XITA 5KDOA 2ZJ2A 3A4LA 4HZIA 1NY5A 3WNCA 2JLUA 3IIJA 1YZUA 3LNCA 1N2CE 1QG4A 2J87A 2JJ2A 4TTPA 4KLNA 3KKOA 4KYUA 5D3MA 4D0LB 1O87A 2GVZC 3B5JA 3EASA 4RD4A 3LA6A 4IRUB 4C0LA 1YR9A 3Q8XB 1AKYA 2ZSEA 2GZDA 1MV5A 2DWPA 3PUVA 1OV4A 4O25A 4A36A 1TQ4A 2D4HA 4JT4A 4KU4A 1P72A 3ZIAA 3GEEA 4PO9A 3GLGB 4AURA 1E2KA 3EZ2A 5EZ5A 4MDEA 3TLXA 1IXSB 3CUEF 4D2IA 1N5KA 1PV4A 4EIWA 3ZZUA 4BFVA 4R71A 1SHZA 1YRAA 1CRQA 5DHFA 2XOKD 1FL9A 4R98A 4AKGA 4FXPA 3B1VA 3WNBA 4OI4A 4ZI2A 1U81A 1AGRA 3OIUA 2A2ZA 2VF7A 4TTRA 5A5GA 2OCYC 2IYQA 3LX5A 3ASYA 4NCNA 4GNKA 4UKDA 4FI3C 1EESA 4KVAA 3KXKA 4QOSA 2QAGB 3CX8A 4CEHA 2JASA 3BRWD 5KNCA 4MKHA 4JLVA 1N5JA 5FOSA 2OESA 3CNOA 4EPXA 1CF4A 4PQYA 3UWOA 1N3BA 2CK3A 2ZI3A 3ICEA 1R5NA 4LBYA 2PBRA 4DSNA 5LD2C 2WWGA 2HYDA 4JT2A 3V4FA 1NLFA 3PUXA 3UIEA 5E3HA 2CMKA 5FBQB 1X6VA 2O8BA 1ZU5A 1L4YA 3E1SA 3EZFA 4DDTA 3WBKA 3ECCA 4KITB 4IHQA 3U44B 2DYKA 2Q3FA 3PIRA 2IUUA 4M9ZA 1VCIA 4ESHA 1TX4B 1K5DA 2PL3A 1UBFA 2AHOA 3B78A 3C15C 1R5OA 2IT1A 4RKEA 5FBLB 3L8YA 4NCHA 1GIAA 3HPQA 1KI6A 4TTQA 4CT4B 1AK2A 4V03A 4UNNA 1OFIA 1WA5A 1JR6A 3DMDA 5DN6A 1E2PA 3GJ4A 4BFTA 3BOSA 4W9MC 1SQ5A 3QKSA 1U9IA 3N5CA 4PAQA 1OFUX 1LFDB 4EJSA 1CR4A 2OHFA 2X8AA 1D2EA 1BH2A 3REGA 5BW8A 3SNHA 5E7MA 1VG9B 2ODBA 2ZRAA 3CRVA 2R9VA 2CNWA 3K70D 5JLJA 1EFUA 2A5GA 2FSFA 1G41A 1UKVY 2QAGC 3VNVA 3TSWA 1M74A 1O3YA 5GJVC 1OH5A 2QGZA 3FVQA 1X86B 3EZ9A 2FJUA 1B23P 2B7CA 1E1RA 3K0AB 4JVLA 2GCNA 1XEXB 4DLUA 5JRZA 2ZJBA 2QTVB 5CM8B 4B32A 2PEZA 4JVSB 2UVQA 4V0OA 3LO5A 2W83A 4IFBA 5JSZA 4LJ7A 2WIBA 4EFLA 1W4CA 1VYUA 2ZVQX 1IY1A 1X8KA 2XZOA 3L2OB 3I73A 2RGAA 1R0WA 2DFKB 4ABYA 1J2JA 4LV6A 1SVKA 2WVJA 1JXOA 2IL1A 4UXJA 1KK2A 1JXMA 1TPZA 3AVOA 1DVRA 2XZLA 1SKYE 1YZKA 3T61A 4KCGA 2CK3D 2OLKA 3UATA 2ANBA 3BB1A 3NBXX 4PHHA 2ZRGA 3X1XA 4W5JA 5IRCD 1R4AA 4QNRA 4XSHA 4ZDWA 3LRPA 1Q44A 4LK2A 3KZ1E 3P27A 5BN4A 1T3HA 2G9NA 3CM0A 2F3TA 2F1HA 4OQMA 3SYLA 1Z2AA 4IDQA 4DDUA 5J4VA 3EIEA 3ZD6A 1ETUA 5KO2A 1CR1A 1J8YF 4NPHA 5P21A 2R6DA 2GJAA 4TL9A 3EAQA 1NMYA 4A8JA 1SKYB 1XB2A 3SC3A 1IM2A 3I8SA 4LV8B 1CJKC 2ZR7A 1E9EA 1KKLA 3IDQA 2G1JA 3SI7A 4JBYA 4XWOA 4BZQA 1WB9A 1R2QA 3SFZA 1E9RA 1HTWA 5L3QB 1GUAA 1M7GA 5DN6D 4Q5IA 1DPFA 1XP8A 1KZGB 1XD9A 1UADA 4Q4HA 2J7KA 3QUSA 4WOPA 4RZ3A 3SBEA 3LBHA 5J5CA 3AM1A 3QG5A 4DSOA 4N0EA 4FWTA 1W5SA 2OAP1 4BLPA 2JLSA 1KIMA 2VH5R 1S3GA 1S1CA 2ZPTX 4QHTA 1PZNA 4ZIRA 1W4BA 4BFSA 1JR3D 4ZO4A 2GXSA 4PR0A 4HLDA 1L2TA 4KV9A 4XTCS 3EWAA 5JEDA 1TU4A 1WDTA 2OCBA 1RE0A 3I72A 3GJ8A 2PZGA 1E1RD 4PC1A 3X1WA 2H1LA 1YJ5A 3ZLJA 3RS0A 1U94A 1J90A 2BJVA 2RH5A 2ZUDA 2RMKA 2HCBA 4YLGA 3X1DA 4BEBA 1MABA 2VP6A 5HPYB 2IW3A 1N6IA 1E79D 3OAAA 4TL7A 2YC2C 3QPUA 4TYNA 1BIFA 3PITA 4JMPA 1Z6YA 4LSGA 3W5JA 1NVXQ 4DLTA 4CVNA 4TWZA 1U8YA 2IS2A 3X1ZA 2XAUA 4NL4H 5DYGA 1Q21A 1Z47A 1Z5ZA 4KI0A 4NYJQ 3REFA 3SJCA 2HYIC 2XB4A 3RRMA 2BCJQ 3D7MA 1YVDA 3RRZA 5JS8A 2CHGA 3WXMA 1P4SA 4EQ6A 2JA1A 3QF7A 3ZQ6A 5LPNA 1OFHA 2ZE7A 3MSXA 4PC7A 5LB4A 1P2TA 1FW6A 3DHWC 5EP2A 3B13B 3DOFA 1MR3F 3GLFB 2OCPA 5FOUA 2C77A 2LWIA 4RZXA 4ZI3A 1Q12A 2RGDA 4ON9A 4Q47A 4BEJA 2FPLA 3P4XA 1IOZA 3SYNA 3FFBA 2WKPA 3O47A 5K8LA 3CKLA 1SVSA 4XH9B 5C4GB 1XEWX 3K8YA 3AVTA 1VG8A 4ZDIA 4L4UA 1JI0A 2X2EA 1DAMA 1GNQA 1FX0A 2ZE5A 3MG9A 3BBPA 3RAPR 1QF9A 3QXHA 1CS4C 2ONKA 3RDPA 5FPSA 1JJVA 1II9A 3ZH9B 2QM8A 1KOFA 2F1RA 5DO9A 3UMRA 1ZINA 2IHYA 1CLUA 1SVOA 3CH5A 3Q5DA 3G82C 3JZAA 3N2EA 4TYQA 4D81A 4PQRA 3IHLA 1XZQA 4JLBA 3CRMA 4A92A 2IEYA 5FPTA 3UMSA 3V9PA 3HPRA 1G7CA 4D26A 2A5JA 3BS4A 1DEKA 1G8FA 3IGFA 2QTFA 3C4JA 4GDFA 1OH8A 4JLKA 1G17A 1QHYA 5G3ZA 2WM9B 2WTUA 5DYIA 3THWA 2GJSA 2QMUA 3KDSE 5DNYB 4H1VA 4IFEA 1GRRA 2GRJA 4JLAA 1IQPA 1NN0A 2G0NA 4DXAA 2CEAA 2GJ9A 3BFKA 4NDZA 4HZUA 2JLXA 2OZEA 2AD1A 3QPWA 1N25A 2QSYA 4I1OA 3CWQA 3GLHA 4TMTA 2RGNA 3TE6A 1E2LA 4U00A 2CCKA 1MOZA 4DLWA 3OAAD 1F3OA 1SHKA 3B7GA 4LYHA 4PC2A 4Q1CA 4V0NA 1XXHB 3CNNA 4XWAA 3WNDA 4RCYA 3LQRA 3PJRA 4XTRA 2IYZA 4DDWA 2IXEA 3ZZTA 4L9SA 3QOFA 1KO5A 2FA9A 4JLNA 2YWGA 2G1KA 2DPXA 2F43A 1QHHA 1F2UB 3CRRA 1QHIA 4LBWA 3BH7A 3MWLA 2ZUBA 2P2LA 3S1AB 1HY3A 1NMZA 5DLQC 4NCIA 1QHGA 1QHNA 2FFAA 1GKYA 1IHUA 4KFTA 2XNSA 2DBYA 4ZV4A 3U4QB 1XX6A 4C2UA 4GL2A 1TUEA 1OFTA 2P3SA 2V1UA 1GWNA 2ORIA 4GZLA 2B8TA 1T0JB 4LX0A 4OI2A 4QBGB 4JJZA 4LPSA 2GBLC 4TYWA 1EX7A 2ZJ5A 4ZKEA 2J1LA 3FDIA 2FOLA 2O52A 4OQXA 4B74A 1V43A 1R8SA 3C14C 2O8EB 2QE7A 4LOAA 4EFMA 4AKHA 2GDJA 1F2TB 1SXJE 4QM7A 2RKOA 1XPRA 1DAFA 3DEFA 2OLJA 2PCLA 3OIYA 2IX3A 3CF6R 1H65A 2I1VB 4MUBA 2W0SA 2JJ1D 2HJVA 3CW2A 2GEUA 1OYWA 3TQCA 1WP9A 3BB3A 2C5LA 1G5TA 4GMDA 1E4YA 5K8IA 2QU8A 3ADBA 2NOAA 3VX3A 1ZBDA 2JDID 2VSXA 3BAFA 1KGDA 1Z28A 1UKZA 1XD2B 3A1UA 5HKKA 2DCUA 3THXB 1Z07A 1R0XA 1OIXA 4Q4AA 4WA7A 5LB2A 4X8OA 1P62B 3CR7A 3IIKA 4MYCA 1CU1A 2GZHA 5FH9A 5JCPA 4DDVA 2QBYA 4PZYA 5SZJA 1EGAA 1G7TA 5JECA 1QRAA 4JS0A 3AVPA 3GFPA 3UKDA 4KYIB 4DCSA 2GCOA 1T3SA 2CLSA 4FCWA 1UBEA 4I4LA 4B73A 4AC9A 4BLTA 1NVWQ 4M1TA 5LBIA 2ATVA 1M7HA 3WBJA 3CX6A 1GNRA 2XSZD 3T34A 1L8QA 3ZVRA 2NO7A 4V0KA 3B1XA 2XXAB 2GILA 5L3SA 2NO6A 3AV0B 4PQFA 4WIAA 1ELOA 4X8MA 3U3KA 3CPJB 3LVRE 1OLOA 1R0YA 3LXRA 4HB0A 4JL6A 4M9QA 3FMPB 4FMCB 1G3IA 2NO9A 1W47A 4EPVA 1FZQA 5JWRA 3WMGA 5JMTA 4LJ4A 3QXCA 3THOA 3T5DA 5EE5B 1G19A 2NMVA 1AJEA 1W49A 1ZD8A 2ORVA 4M0LA 3AVXA 5FPYA 3SDZA 2JLWA 2BBOA 2JIZA 3AF0A 1NL3A 2B92A 4B2IA 1HURA 2ZSDA 1TQDA 3OFNA 4C3ZA 3FYHA 1GITA 3Q72A 3SQWA 2P5SA 4DIEA 3K9NA 4IW3B 2GK6A 2ZAMA 3KXIA 5DI3B 2ASEA 3MRSA 2V54A 5JWOA 2EFHB 2VTKA 1VG1A 3T5GA 1GKIA 5FR2A 4C4PA 1ZVQA 3HDTA 1DO2A 5BYJA 4D80A 1IN5A 4RJLA 1XJ0A 2NZJA 3WMFA 3CX7A 2QE7D 4G5OA 4I1UA 4BZPA 2O8CB 1P61B 2BOVA 4DBLC 5C18A 3I8XA 4N3NA 1RRCA 4LRWA 4QM6A 2R8RA 4MRRA 2QMHA 2IYVA 4HEJA 2XZPA 4YMVA 3IBGA 4IDHA 1EFRA 1W0KD 5DISB 2X19A 1N0WA 1TF7A 2ZRHA 1NBMA 2QG6A 3LDAA 3LQQA 2H57A 3L0SA 3SQXA 3CZQA 4YQFA 3KXLA 2FPMA 3VU9B 2W00A 2FEMA 4KBFA 1IJEA 4TLBA 5FTJA 4HUQA 1Z22A 2CVHA 4GOXA 2YOGA 3BC1A 3P20A 4NU0A 1KY2A 3R20A 4O0MA 1N5LA 5B2ZA 4IEIA 2Q9AA 1RIFA 3TVTA 3ZGXA 2XTNA 1E94E 5K8UA 3Q9LA 5JJLA 1C9KA 2GZAA 2BCGY 3GMTA 2OBLA 4A2QA 4BPBA 2ZYVX 4HATA 2BBSA 5EE3A 3F5FA 5H70A 1JNYA 2ZVPX 4Q03A 1XNJA 1NI3A 3LBIA 1NN3A 2J0VA 3RRYA 3BGWA 2QTHA 4LI0A 5K8TA 1N0UA 1XMVA 5B57C 3U6BA 2V4ZA 4MDFA 4LJAA 4KJZA 2AWNA 4B44A 2VPPA 1GVNB 5KSPA 3HR8A 4DWJA 1KO1A 5IK2A 4DLXA 4TLCA 2ZIAA 3OF5A 2IF0A 3W5IA 1OH6A 1B0UA 3QKUA 3PV0A 1T91A 3NHBA 1E99A 1FMLA 1S1MA 1E2MA 2FSHA 3RS7A 4LGMA 3PCRB 3IILA 1YR6A 2UZ3A 3A6PC 4PO8A 1XTQA 3AP1A 1TMKA 2JIZD 3AVYA 3UANA 2VP5A 3SS8A 1KY3A 1ZM3A 4CW7A 5M04A 2CE2X 4M2LA 1XDBA 2YWHA 1NN5A 3DM9B 4H9GA 2VIIA 2REBA 2FGJA 1UBCA 4HDCA 1WBBA 2J45A 5C2JB 1XRJA 1S9DA 1IXRC 2MMGA 1G291 5ELXA 5CB6A 3K9HA 1N6LA 1T6NA 2X1VA 3ND9A 3KUDA 2VRWA 1P9NA 5H1YA 1GL6A 2ZEJA 2OCAA 4V0ME 2WWXA 3G5UA 5AUNB 4YMSA 4C0HA 1FNMA 1NLYA 3LW8A 3TSOA 5FOTA 3K1JA 5FBRB 3A36A 1H8EA 4PHTA 4UNSA 1Z29A 5TB5A 1CJMA 1LS1A 2J0SA 2RGCA 2EFDB 2BHRA 5FOVA 3NDPA 3W6NA 1ZD9A 3TUJC 3LAWA 2QEQA 1KK1A 2HV8A 4KXFB 1UKYA 2QP9X 1NBMD 1P5ZB 5TARA 3MWYW 2Q0HA 1G3MA 3AQ4A 5KUTA 4MYHA 4Q00A 1DADA 1VHLA 1P2VA 4KHZA 4CIDA 4IDOA 3NEYA 2REXB 2B21A 5BN5A 3CF0A 1RYFA 3WP1B 4YMTA 3PEYA 4JSYA 1BS1A 3CBQA 4NYJR 1T0HB 1XTKA 1W2GA 4AI6A 5C46F 1W2HA 4ARZB 2CLDX 2DFLA 4M1YA 1DG1G 4TLEA 3RHFA 1U99A 2X2FA 3U7EB 1XFAA 5HCIA 4KFUA 1L7VC 3T12A 3VQTA 4CEJA 2PEYA 1XTSA 2ZU6A 3OEEA 2ZS9A 4MRVA 4OJQA 4X8LA 5A0FA 2W2XA 4XVUA 1FQKA 4L16A 5IK2D 1XCPA 3VHXA 1US8A 1W36D 2JCSA 1GKUB 1R6BX 1G20E 2BDTA 2AKAB 4QJ5A 1QG2A 2Z5FA 3EXAA 3IQXA 1E9SA 4RD6A 2XJ4A 2XJ9A 5AWFC 4EUNA 2FG5A 2V55B 3GLIA 4KSCA 4IDPA 2GTPA 1CTQA 4YC7A 2IYSA 1NN1A 2FX3A 1BMFA 4CEIB 1BKDR 4Q9IA 1KI1A 5FR1A 5GJWC 3K70C 1DARA 2QT0A 5F3WB 2BMDA 5J4HA 2G83A 2FE4A 2ZRBA 2ORWA 1JR3E 3IO5A 4TQ9A 4CF7A 4NZYA 2YOHA 3AP2A 2IYUA 3AB3A 4WZAE 3EPLA 4C7OA 3OESA 2IS6A 4C0BA 3I5YA 2O8FB 5KU1A 1MRNA 1CJTC 3THYB 2LKDA 3HU1A 1TQ6A 2GWHA 4CDGA 1MT0A 1Z2CA 1N6PA 1Z6XA 1Q20A 1XTIA 1YZQA 3GLGA 3AUXA 2DFTA 3NBZC 1FQJA 5GADl 4ZPXA 2OFOA 1TUIA 1P6XA 3AH8A 1G18A 1TL7C 3NBFA 4KVGA 2OE2A 3ZS8A 4AKIA 5CB8A 4S35A 2IUSA 1H8ED 2HDNB 4RD0A 5AUOB 1OHHA 1AKEA 4BZXA 3AVUA 4LJ9A 1OB5A 5E4FA 3A1TA 4JLDA 4I1SA 3T1VA 4AYXA 5FPKA 3QJYA 2ZTSA 1Z0FA 2BMJA 2QAGA 5KDLA 3RLFA 4BLRA 2A78A 1YZTA 5JS7A 4HDQB 2VA8A 1MO5A 5JJKA 2QORA 4GT1A 4P3YA 2YKGA 4AG6A 1Q22A 2W0MA 4DSUA 3IHWA 4P4UA 3QENA 2JJ2D 2ZANA 4FCTA 1Q1EA 2BC9A 2Z4SA 4LJYA 4LC0A 1E9AA 3EPJA 4FN5A 4OJKA 4Q9JA 4CRWB 3KJIA 5FUVA 3ZIAD 3B9QA 4CYMA 1KO8A 3W8NA 4E5UA 3MFYA 3CH4B 5HZKA 3U44A 4A2PA 2ODEA 1KI7A 4K81B 2ZYTX 3T35A 1HA3A 3DKPA 2P5TB 5EUMA 3W8RA 1E9FA 3FKSA 3OEED 3AVWA 4URZR 4Q4LA 2WZQA 4JKYA 4XOIA 2C78A 2ANCA 1DAHA 4F91B 3U7FB 2WICA 2PJZA 1G7SA 4OI0A 3WRXC 1KI9A 3QNUA 2WJGA 1QHSA 3DPUA 3KB2A 4MA4A 4QL3A 2RAPA 5AUPB 3RSOA 4B43A 2ODNA 1PLLA 2VHCA 2CHQA 4JZKA 3EIHA 1G3RA 4AK9A 4BFYA 1ZUIA 4Q9HA 5HTKA 1NKTA 1BMFD 5FUYA 3D3QA 1RPZA 2BBWA 3WHKA 5JEEA 2O5VA 3RWMB 4LJ6A 3IPXA 2DY1A 1Q1QA 5LDDC 3NTUA 3NIBA 5TXGA 2VP0A 2FEOA 3N2IA 4GSYA 2IC5A 2ZRFA 2R2AA 5AJVB 3AGQA 1LTQA 2KI5A 3NC0C 3Q7PA 1G8PA 1SVLA 2BM0A 3R7WB 1ESNA 3RABA 3C8UA 2D7CA 1KJYA 4MRSA 5EXPA 1ZMXA 1E2FA 1XMIA 1W44A 2I3BA 2ZI7A 3QVUA 4GI7A 1AIPA 1KDOA 2QQEA 5FTKA 5GVSA 3K0AA 1XPUA 2JLRA 3LBNA 3OHMA 4C0AC 1XEXA 1YRBA 4LPKA
chains in the Genus database with same CATH superfamily
4J1TC 1GUBA 4JUBA 3WNQA 2I2XB 4K0RA 4OQDA 2Z43A 3KYDA 4MPJA 2XRYA 1OHHD 5D86A 2VP2A 4A91A 2Q5CA 3ZC3A 3IT3A 3MCUA 2BH2A 3KKQA 3HJTA 3RYTC 1W46A 5DEOA 1X7HA 5K51A 3VR3A 4J4TA 3I83A 1ZC3A 4OQNA 5B3KA 3G49A 1Y33E 4K6KA 5ILOA 3FMFA 1I14A 1WDLA 2FZVA 3CG0A 3SBDA 3QU9A 4I1VA 4B7AA 4H1TA 1L4BA 5IDYA 4RD2A 1YRYE 2H51A 3MERA 2BDEA 5JISA 2IIBA 1B2LA 2DWQA 4U9HS 3LDGA 1E0DA 4EJMA 5BYKA 3VKWA 1K8RA 2IXAA 1IN7A 3P9YA 4M1QA 1CQZA 3O8BA 2WF8A 2UV8A 4OG2A 5EZYA 4CLEA 4G25A 1H6CA 2H4HA 3BIXA 4WK2B 3WQHA 1A4RA 3IBCA 4NENB 5BVHA 5SY4A 1NRWA 3LE8A 4MR8A 5TMEA 2ZYRA 3F0TA 4PM4A 1V8OA 2I3DA 1XPUA 1KRWA 3KETA 2JK0A 4F9GA 4F1JA 2CYAA 4F97A 3OQVA 4HAXA 4WKGA 5JD6A 1DX9A 4R68A 3LOPA 3MBOA 3O8NA 1T2FA 3CQ9A 1AVTA 4ZQGA 1FJHA 1SC6A 1OMOA 1DHRA 4K2HA 1MOSA 1GQFA 2G9UA 2WYUA 2YHSA 3EVAA 4JKIA 4U7WA 4XKJA 3BZBA 4AZSA 1E0JA 4X6UA 2R84A 1WBJB 3PDIB 4C5AA 1NJSA 4TKVA 2AV6A 4ZCIA 1WBDA 1NWCA 4ZAZA 2A0YA 4QC2A 2W6IA 1CDOA 3ED1A 3I0ZA 4OYYA 1Z56C 2XNCA 1SULA 1U0NA 1S0UA 2AN3A 4KFRA 5L3QA 4BP9A 3L0OA 2YVKA 3IAAA 2RHDA 4MHOA 3WVNA 1GPMA 3KKMA 4E14A 4EVQA 1Q19A 1W85A 3F6YA 4W8HA 4LF6B 1UFKA 4TVOA 1J9ZA 4W82A 3GW8A 3MWJA 4P93A 4UCWA 5HEKA 3W8EA 4BGDA 5JYBA 3LECA 4E5MA 4KSBA 1AHIA 2A7XA 5A4DA 3FPBA 1E3MA 1B0AA 1NP7A 1YQWA 3RSGA 3D8NA 1X92A 1J2TA 1JT2A 1RLJA 1Y80A 1BMDA 4B17A 2PZKA 4ER7A 2ZROA 3HCDA 4MZXA 5HNKA 3HR7A 3O1LA 1FPQA 1OJLA 1VHWA 3BIFA 4GOJA 4B4WA 2FU5C 1P77A 3TQFA 3AHFA 2IWHA 1K89A 2P2GA 5CDGA 4F2HA 5HYVA 4WKNA 4PGHA 2GAJA 3HXMA 2JGJA 2I8CA 3DAYA 3DO5A 4G84A 2UYHA 3BHIA 4OYHA 1FX0B 2Z8YM 4LHEA 5D8DA 4XDGA 3GVHA 2WMDA 5IG2A 2X8JA 3EA0A 1ISHA 1NI5A 2HA2A 1PZEA 3ENKA 4B81A 4TZ0A 4BX0A 4Y2TA 3DV2A 1GNPA 5HF9A 3A4NA 1J1ZA 4AJPA 5B5SA 1DFHA 2DLDA 3P9ZA 4GXTA 4HWTA 1FPMA 2FE1A 2JFXA 2J3MA 1LPAB 2FYTA 2V6JA 1I5OA 2GHTA 2XWPA 3GNTA 2XMQA 4D0RA 4W5OA 1KFEB 5CHYA 4TLDA 3VNSA 4AJEA 1YDWA 2J6HA 4DG8A 4IMRA 2B8NA 2PYIA 3JAKA 4UJ5A 2C9CA 2CNKA 1BROA 1CYDA 3VR3D 1I32A 5HJ2A 4G5GA 5BN3B 2ECKA 1EVZA 1TVEA 2QS9A 1J2RA 2G80A 5AK4A 4LF8B 3QBEA 1S2MA 3WFJA 2WWHA 3O2QB 4OHWA 4AJ9A 4UDYX 1R0CA 3VSBA 3L8FA 5LOVB 5KU7A 1HBJA 1HEIA 1W4AA 1DQSA 4O4IB 1VKZA 1D4OA 2JNWA 4QOHA 5CH3A 5DRTA 2Y0BA 3CX4A 4TUYB 2N3ZA 4YJHA 2QJRA 3A4VA 3WWYA 5JXHA 1MBZA 3JQAA 1HEYA 1GM5A 4AJJA 3GLHB 2ZOSA 3UENA 2O54A 3GAMA 4ZKDA 3BIWA 4HNHA 2AMYA 4HYYA 3IIIA 4KLRA 4QUBA 5EC8A 4G8DA 1HM5A 1UFRA 3E8SA 4JWTA 1KQPA 4OIFA 2PMDA 1RJ9B 1O5TA 1T9GR 2QRMA 3W90A 4C76A 4F4UA 4NCAA 1GL7A 3DLPX 4ZMSA 3ET5A 2ZI5A 3O26A 3KJXA 2VHTA 1K08A 1Z3IX 1K3UB 1VA5A 1V8ZA 2IU6A 1J2EA 3B70A 1PS0A 3K4PA 4ILKA 5DCYA 3WYBA 2QVGA 4YPVA 1KXJA 1SURA 4W6QA 1W8IA 4AIIA 4ESVA 1XDZA 2H63A 3HWSA 4G0QA 3ZV5A 2GNAA 4D4JA 2N1BA 2W6ID 1AZWA 3VZBA 121PA 5BWNA 5KYKA 5KTYA 1KKMA 3QHQA 1R27A 2PX4A 2VWQA 3GRYA 3NASA 4FFVA 3U9SA 1FJXA 3OT1B 1FXSA 5E7JA 5H4HA 1T8SA 1XDUA 4D4LA 4IDAA 3TFQA 2IY9A 4ZRNA 3FKQA 5IC4A 3GL9A 4QXAA 5B3JA 2PMEA 4QPCA 3RTBA 1BTOA 2ZJYA 3GCGA 1WXDA 3E5MA 3TQHA 4DTIA 2NZ8A 1U2DC 4LUCA 3DZDA 3DTTA 4X44A 4G5FA 3RBVA 4OQLA 1QLWA 4LNUA 5A9TA 1RWNA 3ZVLA 2BI8A 2NT3A 4L5IA 5KYUB 3AF6A 1Y6ZA 4JGGA 3ND6A 4I81A 4F2WA 3QEMA 2FPGB 3RU9A 3A9UA 4CETA 5A0TA 1ZP6A 3IUSA 4IKEA 2IYPA 2QU7A 3OF3A 1Z62A 3ZQKA 5JROA 4EOGA 3CLHA 3WKAA 3DH0A 1K06A 2BVNA 4J9UE 1V1RB 2OBMA 5IZCA 4ZDJA 5TE9A 4DA9A 4PLCA 1J1IA 4QXRA 1A9YA 3L6BA 5DM70 2PZFA 3PDUA 4KIJA 1JTEA 4Z0TA 1C1DA 1KJIA 3PUJA 3PXDA 4CLDA 3CRQA 5A5EA 4AQ7A 1PEKE 4NZ9A 4O2AF 1QIKA 1L7XA 3PE4A 4JOCA 3AJRA 6LDHA 2NG1A 1OX5A 4PZUA 5AK5A 5FKJA 3C6MA 1EP3B 2V7QA 3MB5A 2AFHB 4YRZA 2C9BA 2XCLA 2Q7DA 1NC3A 2A5LA 2H6EA 1HZZA 1TEHA 1U3UA 1VZ2A 1ACLA 4CDMA 3IQGX 3UQYS 5CFQA 1O8CA 1RRGA 2QW0X 4HDOB 5FWXA 1XXHA 2Q6VA 4RF3A 2F1OA 3HXLA 1YQEA 3W3AA 4DT1B 3NTRA 5KPDA 3N2KB 3CKYA 1JEEA 3COJA 2UUOA 4I99A 4CFYA 2A1UA 3FVWA 3L6OO 2DG2A 4H0FA 3JQAD 1EJ0A 3K7EA 5THQA 2ZJAA 3OUUA 4ZPJA 5FNVA 3TUIC 1BQ3A 4YUXA 4N7MA 4MQ5A 4FBMA 1ZEJA 3KU1A 3TKLA 4Z86A 5DWQA 4LDNA 5KB3A 2B4RO 2G9ZA 4AROA 4AUEA 1Z0IA 2GVNA 2QD4A 2R85A 4I6JA 4CIVA 2X22A 3E15A 2WZCA 3PI6A 4DOMA 2GPNA 3KBOA 1FFWA 5F2EA 4FINA 2F1JA 2D59A 4KREA 1BQEA 2WNIA 1V1MB 4NE7A 4WQMA 2AK2A 1QGDA 2QPLA 3ODGA 3CJQA 3OCJA 3U4QA 4MO2A 2FDCA 1RJWA 2QVXX 2JIQA 4S0ZA 4EG5A 4HWGA 1G8GA 2FWJA 1TAHA 5CX1A 2WBLC 3R6GA 4BP1A 4OXIA 1QAOA 3PFIA 2C9MA 5B3LA 1JZQA 2FI1A 3KPUA 1N77A 4AMUA 4MP3A 2IS1A 2J6BA 1O54A 1T5LA 1QK4A 1W94A 4IIEA 3RYIB 1TQHA 4ETMA 5C5DA 1C7ZA 1N32B 4JOBA 4YWHA 1E6WA 2G5CA 4BC1A 3A6FA 3H8SA 2FZCA 2AC7A 2XMBA 1HDRA 4OAPA 2A86A 2OG1A 3G5AA 4MB2A 4YJ3B 3FMIA 4BGEA 4J29A 1QAQA 4DR3B 4FDVA 3PEWA 1JXQA 2XGGA 4BO2A 4NI5A 1N9GB 1XE3A 4P4SA 3TI7A 4DUGA 5FWYA 2V1XA 1EWQA 4AD8A 4LFAB 1U98A 3RIEA 2BMVA 1M6EX 3KOXA 4HQLA 3GLSA 1MH9A 4YDRA 1EBFA 4JLOA 1NLZA 3H2YA 1OXUA 4W6ZA 1TKBA 2DU8A 1NSFA 1G4HA 2JFNA 4X8HA 1XI2A 1C80A 2FMIA 2H5EA 2ECFA 1WO8A 2XB8A 4PIPA 2W9XA 1VLZA 2PSHA 1KMIY 4OU5A 3PT9A 3R7NA 1I30A 2GN0A 3TCXB 5H3HA 2QNRA 3G02A 4MULA 1JHMA 3R0ZA 1PSDA 2BM9A 4LVOA 4EKNB 4BWGA 1HH4A 1QG0A 4HH3C 1L1FA 3H86A 4UVIA 3W34A 4DZZA 1OGIA 3LK7A 2PXXA 3BXEA 4HDMA 2JGLA 2CNLA 4KODA 1XZIA 4FQ8A 5BXYA 3S2FA 5ADUS 3L4JA 2A9RA 2D5BA 2PH7A 2J5QA 4K86A 4I5DA 1Y1SA 2FPSA 4JU8A 4B3BA 1HYQA 2V7QD 2YVUA 3PVSA 2BUCA 4AQDA 4X61A 2XEXA 3H1TA 3O2NA 3DZHA 1FMTA 3P26A 3QKRB 3U80A 2BEKA 2HF2A 5H81A 3RTCA 3VU3A 2GN6A 4QICA 3WQQA 1DFGA 1OLXB 4O4JF 1GEGA 2G6TA 1GEEA 1UIMA 3O94A 3OD5A 4TWIA 1Z06A 3QBDA 5EY5B 3W3AD 1WMBA 1KMCA 2C82A 1EK0A 4MWGA 4AT1A 1Y5IA 2CN1A 2VI5A 3H75A 2XBLA 3H5AA 5L4NA 1NMQA 4CM8B 2ZRIA 1YL6A 1ENYA 1AQUA 4Q24A 2FMXA 3G5MA 1BJKA 1UT5A 2N42A 1T2DA 4E3ZA 3SE0A 4KPUB 1JDPA 1E9CA 3BCHA 2DFVA 2FNAA 1SFRA 3LSYA 4YJKA 3RSSA 3VRHA 1DELA 2FOIA 4FW8A 4F7DA 4BWYA 2CUZA 3PJFA 4OK6A 3ETCA 2WMYA 5DI3A 3CR8A 1LDBA 4AZ3B 1ODSA 3IEUA 1ULBA 4QECA 1RXWA 1QSGA 2PRZA 1ND5A 4ZV7A 3USES 5LP6B 1FTSA 2M1ZA 1LJ8A 3GGPA 1BX0A 1JKXA 3M1IA 4Y2PA 3IT2A 2Z5VA 1UP4A 1X7YA 4MMXB 1ODKA 1YR2A 6ABPA 2E55A 2ATIA 4OXQA 2J67A 4LXUA 2F9FA 5K0FA 1ZU4A 4BO6A 3BJZA 4OH1A 4ZAVA 3VNUA 1PJQA 2EFGA 3KDPA 1PYOA 2R8YA 4ND3A 3MOGA 4U2BA 1LBIA 4O5AA 2DY0A 4B4DA 2QJOA 4BLSA 3JVEA 3JARA 3ANMA 5CUQA 1U31A 1VJGA 4KFSA 3S1SA 1T8PA 2I6GA 4YCJA 3R9XA 5BMVA 4HXFB 1T35A 4LVNA 4QO7A 4CKZA 2HMSA 5GJBA 1HDCA 1KMHB 2I2AA 3UGKA 2G6BA 2H1RA 2JJ8A 2Y1KA 4DUGD 2A94A 1M34A 2HZBA 4WW0A 3ZG6A 2A30A 3NDBB 2GEDA 1XK7A 3M70A 4LFCB 3V7FA 4PAWA 4YAFA 1W7AA 2IYTA 3CLVA 3A37A 3EHEA 2DQYA 2RGXA 4R69A 3SM3A 1M1YA 2TMDA 4GC5A 3EC2A 2Q27A 5JAUA 1CUGA 1Z63A 1AV6A 4ZO8A 5MGBA 3CB4A 2EKDA 3HR4A 1G5RA 3F3KA 3ZUGA 3HLYA 1B0ZA 2WIKA 3AFGA 4NABA 5FBVB 3SN6A 4FZ5A 2G04A 5JHGB 5INTA 1ORWA 1XZEA 3J81k 1X2EA 1V48A 3AJ8A 5AHXA 2XTMA 4M1WA 5LWQA 1R6XA 3KJNA 4PEVA 4D8WA 1RQXA 1XLWA 5JNUA 1EFPA 1UOQA 1W4RA 1BCSA 1NR1A 3SYTA 4MV3A 2CL0X 4G3XA 5KWJA 1ZLXA 1IN6A 5AI0A 4GX2A 3D8SA 1Q57A 3SR4A 1ACMA 4B2YA 4GRAA 4JH0A 4QJ4A 1SUBA 5F12A 3HY3A 3NBMA 2NTYC 3C3JA 4DIFA 1I4DD 1G9SA 3DLAA 5AKKA 3MTDA 2ZJOA 1PJCA 1D4FA 2HU5A 3FPHA 2YBDA 2E4UA 3EA5A 3EZ6A 1K0FA 2BD0A 1VL0A 1F14A 1FP6A 2H9YA 4XX0A 4YQZA 4FEEA 2XBMA 1MX9A 1T5DX 1EDBA 5JQGF 3STWA 1GDTA 1OGJA 1KNXA 2N46A 3LKZA 5DV9A 4HDRB 2PU7A 2WJVA 1F06A 3OJCA 4UBKA 4R3NA 3WIOA 2CL7X 1PFWA 1Z6AA 3KWJA 4CLOB 3OTOB 2Y93A 1SCNE 2IOFK 5TQ2A 4ALNA 5FDFA 4CT5A 3DCJA 5DCUA 3BKWA 4AWXA 2E9SA 3AJ9A 4HSEA 4XI9A 1JQBA 1G21E 1Y1TA 4QGAA 3A1EA 1PGOA 2XYHA 5LQUA 2KW5A 2DBZA 2Z2IA 3KHUA 1J24A 1L9XA 3NEAA 4PPQA 1Z37A 3V8RA 3ZE0B 3K9QO 3LWDA 4TV8B 4Z2AA 5FRDA 1KQNA 5BWCA 4CEHB 1ZCZA 3A2MA 3AKZA 4EUHA 4F71A 2C4VA 1TADA 2GAOA 2NNLD 3S70A 3TSYA 3O83A 2FN8A 4GZ6A 4U39A 4RKFA 1FP2A 1PG5A 1ZSNA 1ISIA 2CXUA 2PVCA 2R4QA 3OF2A 4IDNA 3ZCVA 4C0SA 2H59A 2CHVA 3A28A 2CFCA 5IUJC 1UBJS 1JGTA 2ZRDA 2PSFA 3OM9A 3WYEA 2AD5A 5IFKA 3NWOA 2OCIA 3QE9Y 4OCZA 2BPOA 4IRMA 1CY8A 1P2SA 4NS1A 4W63A 1IK6A 1KAOA 1TCCA 1MV8A 4OLAA 4DIMA 4O33A 3RIMA 4YP7A 2BKLA 4LDPA 4NU5A 4MV1A 4BV8A 4X45A 3AEKB 4G4JA 3MMPA 4LQLA 5HF5A 2BFDA 3R5SA 3A9CA 1OKKA 3JQFA 4C22A 4ZCQA 3TBKA 1P9WA 5CM9C 2XUHA 2DOKA 3GNQA 3WS7A 3FY4A 4F46A 4HJRA 4KQ9A 2MU1A 1FFXB 1ORHA 5JYDA 4D4KA 3RT1A 3HFSA 4B0OA 2VUUA 1K97A 4C30A 4ZHQF 2ACVA 1R18A 2FPIB 2FV8A 3OQPA 3ZHYA 2A33A 5AFSA 1KI6B 2ZXEA 3WK8A 1XEFA 5CXXA 5KYWA 2GLUA 1Y5MA 3DL7A 3WV5A 4EYOA 2WHPB 3ZNOA 3LC2O 5CMLA 4D8YA 4D3DA 5IXYA 3K30A 4RF5A 1I7LA 4IJMA 2F2TA 1IH8A 1IAVA 1Y4DE 2HK9A 3I09A 1UK6A 5TR9A 4MUMA 1DKMA 1GT6A 4EJ0A 1IRIA 2UVDA 1XJQA 1XA0A 5B3AA 3WYNA 2GM5A 1C1HA 2GYVA 2I4TA 2IDJA 4I50F 4LSWA 4RL4A 4XVRA 5DH9A 5H0IA 2Q2OA 3K31A 4HGQA 4EJSB 3GYGA 3PYLA 1E7YA 4ZVQA 3UQZA 1TM2A 3RUDA 1UDWA 1FYXA 3RYHB 1YUBA 1VMDA 2QOEA 3HFRA 2ZS8A 3H5VA 4PICA 1PWEA 4XZ3A 3H9JA 1LRLA 3I58A 2Q5LA 1JQEA 1P45A 3MXOA 2RE8A 2XT0A 3I6YA 4ZU6X 3U81A 5HE8A 4BN5A 2B0JA 2A4MA 4RXTA 3WLAA 1WMSA 2HMYB 4IOJA 4RXUA 5CDHA 1EFHA 4LYAA 4WZAB 4C4AA 4US2R 2PG3A 2IBTA 3EGDA 2P77A 2Q7XA 4ZTZB 4DQVA 3V8MA 1OI7A 1QFZA 5L3RA 1EYZA 4FSHA 3V80A 3CLKA 4K9LA 1IIBA 5KKAA 4KW7A 3JS5A 4D9FA 4RVUA 2QNIA 2VSFA 2O9JA 3JTMA 2Q5JA 3WGKA 1JECA 4GXQA 1QE3A 4ALIA 3E2PA 3NHJA 1MH1A 2GNOA 3EXIA 5E6UB 3KQNA 1S02A 3WIUA 7YASA 4MUJA 2F7SA 5GPBA 1ECBA 1WVIA 3EQ6A 4D9GA 1CJBA 1BOFA 4C0KA 4FYJA 1L1EA 2WWFA 1I2ZA 2A0KA 2JD2A 3Q12A 2BM1A 3A2LA 4JJKA 3S8MA 3KZKA 1HQYE 1E98A 1GRCA 5L4LA 3DAHA 1JDUA 2JW5A 2DX7A 1LSJA 1GR1A 2HJRA 4M1OA 3ZU4A 1FP4A 2C9OA 4J0HA 3ESXA 3ILSA 3IT1A 3VU1A 2QF7A 4ZYUA 1P7VA 1WQ4A 1K6XA 4NQRA 4RSGA 2Q4TA 5HM6A 4FWIB 4WBXC 4IVNA 5FUVA 1YMUA 4CM9D 4UMVA 1LI4A 3NNDA 4LZJA 4AMGA 1CK4A 2G72A 1IULA 3ANTA 4RD3A 1SOAA 3H2SA 3C8HA 2P0YA 5BN4B 1LY1A 1Q0LA 1D7OA 3COWA 4HTFB 3TSAA 3IUJA 2BFFB 1RWVA 2GEVA 2XX3A 1QNFA 4WSOA 5LDGA 2WHEA 1EDEA 1OKKD 4GU5A 2QSJA 5H02A 4EJSC 4U5XA 3KKPA 3DV0B 5KTRA 4ZD6A 4DIUA 4N47A 3E18A 1AF7A 5FBWB 1QHEA 3QFSA 4LYEA 1RTKA 3JAWB 3SNKA 5KYXB 2FRVA 2Q0XA 3R7BA 3B60A 3HA2A 2NAFA 3L1KA 3LRXA 2BFNA 2D06A 2VS1A 1QCZA 2QMYA 2EWWA 1UKEA 2IYFA 2VA9A 4KEAA 2HQBA 1DHTA 2WF7A 3C3EA 4JC8A 3O90A 4FS8A 3TQRA 3WJAA 3A11A 5HFAA 1E79A 3UPTA 5DBHX 4DCVA 1V7PC 3OX1A 3QU2A 4R2IA 4X71A 1UDAA 2E1PA 1CW2B 3CLSD 4FC7A 1LPSA 4OL0A 5TMDA 5ISMA 2VPWA 5F1PA 2TMKA 1SCUA 2OZLB 2XCQA 5CTAA 3C2QA 1S4MA 4KN6A 1ZEMA 2Z56A 4J0QA 3UGTA 3VPXA 1WEKA 4AB1A 4AN0A 3DEIA 1HEUA 1TCAA 1W5BA 1QM5A 2IYEA 3G1WA 1IBMB 3D4OA 4G97A 1BHO1 1QHFA 1NX9A 3UCXA 1X8LA 1HDYA 1AKRA 4W8GA 1XGKA 1ESZA 1RM4A 2O2YA 2W58A 3LQ2A 3MYYA 4K9KA 1N5RA 4RLFA 1F51E 4K9QA 2OXTA 4A1OA 5IHPA 2D3TA 4GOOD 3MZ0A 1K75A 4FFMA 4JVNA 4X1IA 3O8CA 1EDOA 3V2GA 1P3JA 3NDRA 3OKPA 1RZRA 5K3BA 4R5HA 4LCJA 3LHDA 5DP2A 4DR2B 3O3MB 1WMDA 3EGCA 3H6HA 5L9AA 1C7FA 1NM5A 1P39A 3D4BA 2P6RA 3MMSA 3RYCB 1SHTX 1PWHA 1OLSB 1KZYC 4M4SA 5JNTA 1HNZB 4OUDA 3UV3A 5K6RA 5LYYA 4E2YA 2LE0A 2P62A 3OJLA 5A5FA 1CDDA 1ZCFA 4LOHA 2QVLA 1V9LA 3RUEA 2Z6VA 1KFCB 2O8DB 3NU1A 3R3UA 1TTHA 1Y3AA 2Y77A 5DM2A 2CV0A 4I1RA 5L8VA 4YRCA 1E7WA 3H2GA 3U31A 3TUZC 2XEDA 2Z2JA 5G41A 3QVJA 3ETGA 5C51B 4ZVTA 4I14A 3HUFA 3EXEB 2D13A 2XF2A 3OLYA 4OLJA 3M0EA 1F38A 1RRKA 4LGCA 4NTZA 4U6SA 4B3XA 1TT5B 2WDZA 4BCBA 3ZZNA 2EYQA 2RK6A 1JRLA 3E0XA 3RYFA 4Z1OA 5EHNA 4QXPA 4G0WA 4BRWA 4YT4A 1IAQA 1WPQA 2WUEA 2FUCA 1U90A 5DWDA 1C3OA 1I51A 1M2OB 2QG4A 4P0TA 3UHPA 1GRVA 4WLEA 5CCEA 3C98A 2WZDA 2OHXA 2O7RA 3DF7A 1KEZA 4GMGA 2C61A 3TEMA 4EQ6B 4RY0A 5EQFA 3OLWA 4AX4A 4EMUA 1CHNA 4D4IA 1L3BA 3M3PA 4GBMA 4L8GA 2R6AA 3WTCA 2Z0MA 3ITEA 4NEHB 4AY4A 1YHNA 5D3QA 5EP3A 4JVOA 2RGWA 4UULA 4Z9YA 2ZQZA 4RHYA 1JDJA 1FFAA 3K0FB 4CPDA 3AG5A 2QX8A 4HFNA 2WU4A 3EG9A 3HACA 1ZH2A 4KRFA 2Z9DA 1KYYA 5I8WA 4GPD1 3C3CA 1PQ4A 3I4CA 1DWQA 1Z34A 1J1UA 4JP3A 5C80A 2QY9A 4A0RA 4YRTA 5EWJB 1DIGA 3H18A 1QQ6A 4EGCB 2AOTB 3FF4A 3WLOA 3GHHA 3TAXA 4RJTA 4BNNA 1WDWB 1Q50A 2J4CA 1F6WA 3GHYA 4BO8A 4DQKA 3ND8A 1RZ3A 3ZZMA 5K45A 3G5TA 4N8EA 2Q1SA 4E12A 3NTQA 3LKVA 3WI7A 1F1BA 3DQPA 5T7BA 5HIMA 4ECAA 1RMTA 3I01A 5K7SA 2GESA 4C0LA 2PUAA 5D5QA 5EIAA 1ICIA 2CZGA 2FFBA 2Q3MA 1ES9A 4LF4B 2LVBA 1ZSVA 3VAAA 1HSOA 1PKXA 4A15A 2EF0A 3PE6A 2K6GA 3F71A 3WBBA 3PGXA 4LXIA 2O1SA 1F4LA 3C5EA 5FI0B 1NXPA 4C7XA 2GZRA 2YUTA 3NNSA 1RZRD 3THWB 3LHFA 3M33A 2R6HA 2NM0A 4G8BA 4GZ5A 5ALZA 4FMCF 3BFVA 3S81A 4RE5A 4EHDA 1O03A 2JAXA 4O1HA 1VTKA 3L6CA 1GT91 4M21A 1PR4A 1YZHA 3I05A 3TNYA 5TPZD 2V03A 5FBHA 9ABPA 1B42A 2G09A 2NUBA 1IG3A 3U2QA 4RA6B 4A82A 1V4VA 2XI4A 1WXIA 1XVLA 1KR5A 4Q1BA 4TT3A 1MC8A 3HXKA 1UBSB 1SWWA 3QHAA 2BEWB 2VHXA 2PUFA 2EZTA 3DA8A 3OEYA 4BBAA 4DB4A 1Z8HA 4B3SB 1USKA 4RK5A 1AGPA 3L8ZA 4WZBE 1JPJA 3Q3IA 2OQRA 4YP9A 3WZLA 2ZZNA 2VP4A 1YS1X 4JBXA 2ZB4A 2EQBA 1K7XB 2KBEA 5E3IA 4YR7A 1NNEA 1IXZA 3LCJA 3PFGA 3UCFA 3UJPA 2IYXA 2R47A 1JV2B 3F3MA 1VIMA 3NJRA 5IH3A 3KSDO 5H4GA 4P0PB 1ML3A 5G53C 2YIDA 1M75A 2PZEA 1V6AA 2CW5A 2QN2A 4ROSA 3FLMA 3I04M 2Z2ZA 3N6RA 1Z0KA 1NMEA 2JDIA 4N0DA 1UZLA 4ZYXA 2X9NA 1ZGJA 4GVXA 3GFVA 3PJGA 1Y9DA 3DEJA 3L8GA 4M37A 1TMOA 4ED9A 4UUAA 1EFDN 4DNFA 2ZJ6A 3BFPA 2Z08A 1CUDA 2LDXA 4K28A 3UK6A 4RTQA 1GA4A 3SYKA 3EDRA 5B1SA 4WPGA 4F4FA 4OBEA 2V7BA 3GZNB 3KG2A 1R10A 3E7PA 3QWBA 5EGSA 5DNWA 1EA5A 1W1UA 3PDHA 4PPGA 4Y2VA 3WP0A 2YY6A 3C6XA 3MCAA 3QEOA 1JILA 4YROA 1R5BA 3DL0A 4LECA 4OGLA 2JH8A 1OXMA 1Z38A 2YZGA 3RJMA 2VL7A 5ADWA 1ZJ6A 5BWMA 1NI4A 3AL0C 3JPYA 4PWYA 2H2FA 1CZNA 3EDYA 3I6MA 3OFVA 1QTQA 4BMVA 5J2UA 2C2WA 1YZLA 2H18A 2HPAA 1PVOA 5F33A 2B1GA 4PTZA 1WCWA 2XSZA 5AI6A 3W2EA 5FI5A 3TOXA 4CM6A 4GZMA 3CLRC 3WRYC 1L4EA 2GXUA 4MW2A 4XJXA 1X1TA 2PO7A 2RBGA 2YH2A 1XMJA 2H54A 4EFNA 3AVVA 2VPTA 1B76A 8ATCA 1YBVA 3DHYA 3R9IA 3SGLA 1AUOA 3R0IA 4X65B 1OW3B 4K0KB 1EIWA 5JMOA 4K5QA 4P34A 4KQKA 2CXSA 1KI4A 4PZPA 1TO6A 3AY6A 3GJSA 2XHZA 2CCGA 3D43A 2CDNA 2A35A 4JN6B 4Q3CA 5D3ZA 5G4KB 3ZY4A 1GLNA 1OBCA 1GTJ1 4KZKA 2G1PA 1T4GA 5AW8A 3M1AA 3PZBA 4BRZA 5IH7A 2NSJA 3UBMA 3LMKA 5IZ4A 3SE7A 4PGFA 4AN1A 2IXTA 4W1RA 3NX4A 5DSXA 2P3QA 1E1YA 1KXZA 2YWJA 5JDCC 3SFVA 4RANA 5CEEA 3ZJYA 4YO8A 5IAEA 4UNIA 3S7ZA 4EHLA 4F7WA 2WJIA 4FYHA 1LUAA 4ASUD 1H8HA 1U8ZA 1UBMS 4MWSA 1E9DA 4AY6A 2GARA 1C9JA 2Z2XA 3NH9A 3MQ4A 4P3NA 3L05A 4KDFA 2VOEA 4JSTA 4MVJA 4N6OA 1Y34E 4ZVNA 3HA3A 4JYZA 3G5LA 2HRQA 3H6GA 5CYOA 4BFZA 3PFKA 4TT3D 1WQ1R 3GC6A 5C8YF 4QEDA 1ZGCA 5K2OA 1EFTA 2EOAA 4RVCA 3DOEA 4FM9A 4RY2A 2QPAA 5BQOA 1P1KA 2LP4Y 1CNFA 5C3UA 4BATA 1TZJA 3E3AA 5C35A 5AVTA 5L3SB 5IM4F 3QWAA 4FU0A 1GQOA 1WB6A 3B1ZA 3CEPB 5A5VA 1JEDA 4MCIA 3MWFA 4LYFA 5CNMA 2G77B 3UK0A 1QVVA 4DABA 4Z7QB 2ZITA 4F4JA 1DJQA 2BMFA 3T7TA 2K4MA 1DC3A 3OI7A 1UPTA 4B6GA 5CYFA 1QH0A 5ICCA 3MD0A 4OHZA 1V39A 4DA7A 2PKWA 1WW2A 5BV7A 2B8WA 3C3AA 4Q1VA 4D9NA 1GOTA 1QFSA 4DW8A 2PGDA 4Y2RA 2EBWA 4Y1RA 3AUFA 3DUFA 2XOXA 4EZIA 3E9QA 4IUYA 2SECE 1GAXA 3UZUA 2QMOA 5KNLA 3CIFA 1QG6A 3BL5A 2WAMA 3P9IA 3UG7A 1D8TA 1BKSB 1U2GA 1AKUA 2ZAOA 1Z2DA 4Q1AA 4JR0A 1KPGA 2W5UA 3EQZA 1KZ9A 1W29A 1JQ3A 3BXZA 2IS4A 2RB4A 4Y6LA 5IKMA 1ESMA 2WKSA 4YREA 2ZS7A 1PT6A 2FSVC 1K8ZB 2O1WA 1CD5A 1W88B 3AEUB 3G0OA 3HJGA 3PRHA 4EHKA 2G9RA 2W43A 3B9PA 3T5AA 4L8LA 1O89A 2HJWA 1PZHA 3HCFA 4MWZA 5TQ0A 3RUFA 1KI2A 1Z5UA 3R3WA 2JZOA 5ALEA 1RTTA 1SBQA 1F7VA 1E8DA 1PNRA 4RTPA 1C7JA 1JMYA 3UH0A 2V9ZA 3B3AA 3F8TA 3NT2A 3PPWA 3L5KA 5L4SA 2NGRA 4PX9A 1IY0A 4BE7B 1ENOA 2ZR9A 1FOEB 4A8HA 1VIAA 4CFSA 1B6RA 4HQRA 3T4UA 1QFMA 3NM5A 3ESZA 1NFFA 2ATEA 3BJIC 3G0DA 4OHBA 2COUA 4A0QA 4F6RB 1NMSA 4TN1A 4DLYA 5KHOC 2CLOB 4HUQB 3S7TA 3RIYA 3MTJA 2GPYA 1F0NA 2PX5A 2RBKA 3LM8A 3A27A 4FHZA 2GWRA 4XFJA 4ER6A 4CGZA 3NWJA 5DX8A 3KSRA 5DT9A 4G0OA 4YAJA 5H9VA 4HRVA 4YS6A 2CJWA 4V24A 4M0DA 2AGVA 3KPVA 4UE6A 1QYVA 3QU4A 4YH1A 4B82A 3U56A 4RF2A 2PKXA 1H8HD 2ZCUA 3BTVA 4HGYA 4AKSA 2OBBA 1CE8B 1YNSA 3G2QA 3N3AC 4LY0A 2CL6X 3HXQA 2R7NA 4MVJD 3ZZ0A 5BWOA 4NMWA 1DB3A 3DE2X 5A2GA 1TJYA 1U4NA 1KJJA 3GEIA 3CW8X 3ZNQA 1T0BA 4IH1A 1JG1A 2DKOA 3W5VA 3QFTA 1TEXA 1T9HA 2OD2A 2A6PA 4L28A 3K96A 4DIDA 4P31A 3EGVA 4OKSA 3A3PA 2CXQA 3D3JA 1Z2OX 2C0PA 3E23A 4WE3A 5FO0A 2V5VA 4C4YA 3FOEC 1W36B 2RHWA 5K3CA 1NBOA 1M7BA 1THGA 3E35A 2X86A 3OBIA 4UCFA 4EB8A 1XWIA 4GMXA 1YOVB 2W37A 1Q0RA 1N8KA 1UANA 3MJHA 3PP8A 3WLRA 1OF1A 1JBEA 3U4MA 2WJPA 4NVRA 4XLZA 4RTMA 1B6TA 3AFOA 2REQB 1BJTA 3R9KA 5ALPA 1B41A 4KBGA 3ZGLA 4WZ6A 3HY4A 5EKDA 5K8VA 3FPAA 2D1QA 5AUQA 1J5XA 4HJXA 5C8ZA 2C9DA 4ZVOA 5ES4B 3JXEA 3JQ7B 3WRVA 1JFLA 2C99A 1JLKA 4F84A 3ZY2A 5GONA 1IZ0A 4TLAA 4MVJI 3EBLA 1M2GA 3NBYC 2BUAA 2F3UA 5ARCA 2H9AA 3OM0A 4I5IA 1YQGA 3CE9A 3QVTA 1EB8A 2ZULA 5KEIA 2QYSA 4RMHA 1QBKC 3WE7A 3G6KA 3K2QA 5EE9A 3VDXA 2OGWA 1MO3A 1TU3A 1JFRA 4HAUA 1LW7A 2BP7B 4GPBA 1L4HA 4IVPA 2PRJA 3B85A 3H2ZA 2G0TA 1A4IA 3A4YA 1LX7A 4MMZB 5FF9A 1U04A 4IJVA 5AXDA 4GR5A 3DFUA 2EX4A 3FHCB 3ZKWB 2R68A 1GV1A 1DJOA 4Q48A 2PT6A 3BE8A 1F17A 2C4KA 4XGKA 2A59A 3VPDA 3ADDA 1P1BA 3DOIA 5F73A 3DVRX 3DVLA 4EY7A 3C7KA 1PQYA 3B7PA 4QFBA 5EIBD 4UNRA 3V00A 2P2DA 1XWFA 4QOGA 2FW9A 3EWIA 3ZNNA 1GG2A 4BBJA 4EPWA 4Z8XA 1CR2A 4QGGA 3ZWVA 4URUR 2I6UA 4C9BA 3TDNA 4ZCTA 4HF7A 4DA0A 1CKEA 3RC8A 1VMAA 4B7UA 2CNBA 3HY6A 3OWOA 1WSAA 5DHAA 2Z95A 1HGXA 2JIOA 3C41J 4KN9S 2GD6A 5BN5B 3K6SB 1X38A 1PR9A 2J59A 2L42A 3A14A 1YI0A 3GFSA 3LY7A 3PR1A 5M5BA 1CF2O 5KJEA 4BMZA 4ARCA 3ZEIA 3RVBA 2XCIA 3KQMA 1C4OA 4ZVRA 3KEQA 3E7XA 3AOEC 5FWAA 3CV3A 2NVUB 1BD4A 4P4NA 2ZTMA 3ONEA 1VCMA 1SZCA 3IEKA 4O2RA 4F12A 3OU6A 2ESRA 2J5BA 3C48A 3EZ7A 1DIOB 1UK9A 5MFZA 1TIPA 5BVGB 4E13A 2XUKA 5ALIA 4KVFA 1V2GA 3C16C 4D8VA 2QKYA 3BE4A 1IVNA 3RAFC 1QCYA 1W34A 4J0IA 5DJ5A 1BXZA 1W5EA 3H9UA 3GRVA 3BDAA 3PI7A 3JQQA 1CIPA 4MPPA 4REMA 4AJ2A 5LD2B 3ZCTA 1A97A 1JPNA 1OFUA 1YHZA 2XQJA 1IZ9A 3SJAA 3TW8A 3W0LB 3GQBA 2J5XA 2BGRA 3GLIB 3B1YA 2CJPA 1J8QA 1ZRNA 4U63A 3EYAA 1M6VA 3UWKA 2BFWA 2FWAA 1I3MA 5BSMA 3F96A 4QUAA 2YINC 5KDOA 1MG0A 1JVSA 4G9GA 1E7SA 4HZIA 3SC6A 3WNCA 3JYPA 3LNCA 2GD1O 5H3CA 4Y6RA 3EXHB 3NI2A 5G0TA 1ZI8A 3MJFA 3UGJA 3B5JA 3C6ZA 1LI5A 4G37A 2WAOA 4QAJA 2W2NA 2ZSEA 2GZDA 4WCDA 2LZ0A 5HIJA 1T3ZA 2A14A 4KU4A 2AR0A 3DP9A 3IVCA 4E5KA 4R1MA 1OLUB 4EEXA 1GAEO