2WBLC

Three-dimensional structure of a binary rop-prone complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
175
structure length
167
Chain Sequence
b'RFIKCVTVGDGAVGKTCMLISYTGPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPGIPIVLVGTKLDLRDDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVALR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHO OF PLANTS GUANINE NUCLEOTIDE EXCHANGE FACTOR 8
publication title 3D Structure of a Binary Rop-Prone Complex: The Final Intermediate for a Complete Set of Molecular Snapshots of the Ropgef Reaction.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 56
structure length 167
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wblC00
4NYMR 5AJXA 4RSGA 1ZD9A 2FH5B 2UKDA 2HJGA 4URWR 5BN5A 2IA5A 1R5NA 2HJVA 2ONJA 4A82A 1JNYA 1E4VA 1OHHA 2RKOA 3KX2A 4PHHA 1NRJB 1GIAA 4JL8A 1QHIA 3T1OA 5AUPB 1P75A 2J87A 4DSOA 3FTQA 2E87A 5AJVB 3X1DA 2WJYA 2IS6A 3L8YA 1YE8A 1KYIA 4RFVA 4ARZA 2Q21A 1TUEA 4L15A 4GNKA 2O0KA 3SE0A 3BC1A 1H8ED 1Z0IA 3AP2A 3GLIA 3PEUA 5FUVA 3UK6A 2BM1A 1EXMA 1U0LA 2OG2A 3NEYA 2VL7A 2R6DA 3D31A 4GP7A 4A8JA 2FSHA 4FMDF 3PFIA 3WNBA 4BFSA 3I5XA 1ESMA 2GETA 3C14C 2YKGA 1SHKA 3FVQA 3TMKA 2XTZA 5FOSA 2QY9A 5FL7D 3JVVA 5D3QA 4R2IA 2WWIA 3VKWA 1HQYE 2NO9A 3T35A 3EC1A 1G3QA 3QXSA 4Q00A 2RHMA 4G5GA 3KTAA 4HAVA 1C1YA 5FTNA 1KTVA 2W00A 5CITA 4URVR 4JBYA 2JDIA 3IO5A 1NMZA 3MJHA 4E07A 5JWHA 5IRCD 2OZEA 1GKIA 2IYXA 4MKFA 2BV3A 3E1SA 3AV0B 2ZJZA 4PTLA 1GL6A 4UXHA 1M1YE 1Z0FA 4XWKA 2Q9BA 5JECA 3BIFA 3U44A 1S1MA 2DCUA 1RPZA 1KI3A 2YOGA 2ERYA 2J41A 4ASUA 4DDWA 2FDCA 1J7KA 3SJZA 3OEED 4LV6A 1WF3A 2O8EA 4NHOA 4TYWA 4KO8A 3VR6A 1XU4A 4JBXA 4JT4A 1SULA 2A5DA 4UNSA 5LB2A 2FX3A 1TU3A 2W6IA 1H8HA 1FZQA 1Q0UA 1J70A 2TMKA 2JLUA 2D62A 4YQFA 5EUMA 4PAQA 5BXQC 3PIRA 1OH8A 2ERXA 1U94A 2N42A 5K8TA 5A5GA 2WMOB 1KAOA 1S4QA 4QJ3A 2PX0A 3DHWC 3VKHA 3SC3A 4JSTA 2E9SA 1E32A 2WIAA 2X2FA 5AUOB 1OIVA 3LWNA 2BBOA 4NCKA 1KK0A 3PCRB 1EFTA 1ZBDA 2HV8A 4Q9IA 3GPLA 5HZKA 1W2GA 2VLIA 4HATA 3K0FA 1G5PA 1AKEA 3CLVA 3OF5A 5SZKB 2IWHA 1IXRC 1ZINA 2P6RA 1OJLA 2C98A 3A58B 4KODA 4M9ZA 4P4UA 2OT3B 4P32A 5CB8A 2ZJ2A 3THWB 3N2IA 3MAAC 2B7CA 3HPRA 5FFMA 4A15A 4KAXA 3NXSA 1N5KA 1PLLA 3A36A 1CBUA 1YZNA 3L8ZA 4GSYA 1EFRD 4HAXA 2GJ9A 2N1BA 4LYJA 5KU1A 1UDWA 3LY5A 3AF1A 4M4SA 2W83A 3ZZUA 2Q0HA 1FNMA 4D82A 1P9WA 2QNRA 4LWZA 2QPOA 2BC9A 4R9UC 4B44A 4DT1B 5LDDC 1AZSC 3P4YA 1KI8A 2GJKA 4JLBA 1P61B 2ECKA 1XTQA 2ZRFA 2NO0A 1ZNXA 5C1BA 3DMNA 1ANKA 4PC7A 3SI7A 2CNWD 3L43A 4MITA 4RD4A 1PZNA 2WJIA 3R9XA 2WICA 1JALA 1AQYA 5LB4A 1XCMA 2OLKA 5KNBA 5EZ5A 4AYWA 2OBMA 1GSIA 1OXVA 4BWYA 5FR1A 3KZ1E 2DBYA 5F2EA 2BMEA 5FL7A 2XSZA 1OIWA 3O8CA 1G3UA 1II8B 1G6HA 1FUKA 1KI7A 2XNSA 2GCOA 3P32A 4EJSB 1JB1A 1LF0A 4IVRA 4M8NE 3A1SA 4J0QA 4QHYA 1Z0KA 2HF8A 1KDOA 2FA9A 1T0JB 3P27A 5J40A 1ZAKA 2H1LA 1GVNB 4ZKEA 5BYKA 2ODBA 221PA 3HPQA 4NZYA 4Q21A 2QUZA 2VPPA 5FOUA 5FOWA 3GEHA 1UADA 3KXIA 5LD2C 3TUIC 1YZGA 2GK7A 1W4BA 2IXFA 3DM5A 1G8GA 3UPUA 4LV8B 4JLAA 4HZUB 3RSOA 4ACAA 2FPLA 4Q4AB 2IC5A 3UIEA 3A1TA 3I8XA 3U6BA 1ZUHA 1AJEA 4DCSA 2XB4A 4F4IA 1XDBA 1X8LA 3N5CA 3SBEA 1G4AE 3KKQA 5SZJA 1UKYA 5BN3A 1VG8A 4DJTA 2G9NA 1NP6A 3CKLA 5DNYB 1VG1A 2IT1A 3EPHA 1R7RA 3U3KA 1W0KD 3NDBB 1IN5A 2C9OA 1CR1A 1GUAA 2V8OA 3REGA 4B3CA 5DYGA 1IY0A 3KFVA 4LRWA 1NY6A 4OQMA 1UBEA 1SKYB 3D8BA 5E7MA 3ZIAD 1ZIPA 5G3ZA 1F6BA 2ZS8A 1B0UA 4UJ5A 3H1TA 1NBME 5BN4A 5BYJA 5SZIA 1FMJA 3QE0A 2ZITA 2QM7A 3KQNA 2O5VA 3LXXA 1W36B 1G3MA 4XD7D 1IN7A 3ASZA 1RRFA 1U90A 3X2SA 1OFIA 3LLMA 4PSKA 3AKCA 5CM8B 2XGJA 1P73A 1EWQA 5DIFA 3OIVA 3OEHD 3U3RA 4B6FA 2J7KA 1A7JA 5LPNA 2BOVA 4TMKA 4CW7A 1HE1C 2ZSDA 4KSCA 2QT1A 2W2XA 1VIYA 4JS0A 2QPAA 1CF4A 1TU4A 2DR3A 3AF0A 2FOLA 1M74A 2JLRA 4IOKA 1G20E 3CNNA 1OE0A 3IQXA 3QY0A 2Q6TA 4HAZA 4EPRA 3A4LA 4JMPA 4HLQB 1QRAA 1GG2A 2JGNA 4AC9A 5DH9A 2NOAA 2G77B 3I1FA 1N5JA 5F9HA 3QXCA 4LPSA 1KAGA 5KHOC 2QROA 4JKIA 1Q57A 4CEJA 3TQCA 2VHJA 3G5UA 4M9XA 1XJCA 3WY9A 4OQXA 3Q85A 2R44A 4ACBA 2RGAA 3K70C 2H57A 4GDFA 5H1YA 2I1QA 3D3QA 2ATVA 1NKTA 1M2OB 3BFKA 1Q22A 1PVOA 3THYB 3TNFA 4QXAA 3VTKA 4PZYA 2F43B 1IY1A 2GKSA 3GLGB 3W90A 2ZJOA 2GCPA 1GFIA 4PHFA 2WV9A 1IOZA 5DHAA 2PX3A 2QG6A 4DWJA 4L8GA 3K1JA 3GEIA 4JSYA 1JPNA 3F0TA 4WIAA 2R6AA 1S1CA 4DLXA 4EFMA 1VMAA 2GWHA 4Q5IA 1GWNA 2YWGA 3SYKA 4AG5A 4HLUC 3TK1A 4EPYA 1TEVA 1BH2A 1SKYE 4GZMA 1CR0A 4DC9A 1SVMA 2C77A 1U0JA 4C30A 1J8MF 1CRQA 1QZXA 1E1RD 2B8WA 1W5SA 2EQBA 4M9QA 1N0UA 5GVSA 5HKKD 1OH7A 1AA9A 3CNOA 4Q02A 2FU5C 3KJGA 4KFTA 5DHFA 4RD3A 4BGDA 1G6OA 1NVVR 3F3YA 1F2UA 3PV0A 3HR8A 1XEXA 4FCWA 1IHUA 2Z4SA 4WOPA 1KDRA 1DARA 3DPUA 3FYHA 2ZANA 4Q9JA 1JR6A 1ZMXA 2FPKA 4ZCIA 4KI0A 3CNLA 1KOFA 1D8TA 4P0TA 3QKRB 1D9ZA 4LDJA 3CX8A 4PC1A 3I5YA 1AZTA 1L7VC 2ZI5A 1NBMD 5AK0A 4C3ZA 4YDHB 3ZQ6A 3OAAA 3LLUA 1ZC3A 1ZM7A 3AEZA 3K9HA 1XEWY 4BZXA 2ZJAA 4OK5A 4EPTA 1XD2A 4BLOA 2AWNA 2ZUDA 4POAA 5JRJA 4PAMA 4Q9HA 1F2TB 521PA 2C03A 1UBCA 3W6PA 3BH0A 2QSZA 4B74A 4IEEA 1S0UA 1Z8FA 2F6RA 4TT3A 2RGBA 3QQ5A 4HYYA 4W5WA 1KSJA 3MJRA 1HEIA 2OSBA 2XEXA 4XD7A 1UBFA 1M7BA 2MMGA 4TTRA 4EQ6A 1G8FA 3T12A 4WW0A 2PT5A 3W6OA 3EASA 3PVSA 4M2LA 4TL9A 3U4QA 3U7GA 4BECA 4LJ6A 1Z6XA 2IYQA 1XCGB 3BOSA 3Q5DA 2VP2A 3AP1A 4QG7A 4MGZR 4NYIR 4B3DA 2BMDA 4DUGA 3TGPA 2GXSA 1JAHA 3K0AB 3THXB 2IYSA 4YMWA 3U7FB 2G3YA 3RRNA 4JYBA 3B5JA 3GLGE 2WAYA 3ZGXA 3FKQA 4HSEA 2WKPA 2HDNB 1MV5A 1E1QA 2CCJA 3ADKA 3T34A 1KO8A 5HR5A 1NVXQ 2V4ZA 4ZDJA 3BRWD 4AI6A 1Z63A 4AD8A 1LS1A 4IXNA 3KKOA 1Z6YA 1JR3A 4G3XA 5JJLA 1L2TA 4US2R 1PUJA 1JEDA 1IY2A 2AXPA 2GXQA 3B8HA 2FPMA 1Z2AA 5AJZA 1ZM3A 3LO5A 1JECA 2IF0A 4EDHA 1J8YF 1RJ9A 1E2PA 2CJWA 3CONA 4ZI3A 4Q4LA 3EZFA 3PXGA 3TBKA 2FG5A 2ZVQX 1EFUA 5L3SA 4TLBA 4CEIB 1OKKD 3LVQE 4HI0E 3QBTA 3WP0A 1E99A 2DFLA 2BBWA 2A30A 1N5LA 2H8KA 1FL9A 2PZEA 4KJZA 3RS0A 4IDOA 1KNQA 2RGEA 4IFEA 4HB3A 4KVAA 4LY6A 4MUAA 1FTSA 4TMWA 1P6XA 2PLFA 2UZIR 3SDZA 1XTSA 4B34A 2IS2A 2F1JA 4URYR 3BB1A 4IXMA 2GA8A 4NDZA 4QJ4A 3C16C 3K9LA 2IW3A 2G1JA 2H7VA 2JLYA 4A0GA 3GJ8A 5L3RA 2RGXA 5E7JA 1QVRA 3NBYC 4S2EA 3QKSA 1FP7A 3N2EA 4NU0A 2YOHA 5EXTA 1G5RA 2WHXA 2ZSAA 5DI9A 1W36D 2ZEJA 3NH6A 2CEAA 1NVVQ 4NBSA 1YZKA 1DAMA 2R65A 4YONB 2F55A 2NO1A 3KKNA 5TMPA 3ASYA 3H86A 4RCYA 4FMBB 4MRRA 2XAUA 1MO3A 2F3RA 1Q12A 5L3QA 4WVFA 4ESVA 4QBGB 3KUCA 1BKDR 1RRGA 2AWOA 1G3RA 3W34A 5G3YA 4HB0A 2RAPA 2XB2A 3LBNA 1VECA 4FMCB 4QL3A 1N6OA 4D26A 2ZAMA 2EU8A 2WWGA 3AF3A 3LBIA 4US1R 4AIIA 3ONWA 4Z51A 1GZSA 4M1KA 5EQTA 1JXOA 2WM9B 3UG7A 2VHQA 2REXB 4I81A 1DAIA 2GEVA 1ZUNB 4LJ5A 3RYTC 2ZRHA 3BXZA 1KY3A 3MMPA 2DFTA 2WSMA 5JWOA 2QORA 4KBGA 1E2LA 2C99A 3QG5A 1X3SA 2RGGA 4NYIQ 3RC3A 5IHPA 3RRYA 5C46F 1YR8A 1ZUIA 2WOJA 5DGXA 3EA5A 2OO7A 4HAYA 1JEEA 5A4JA 4JIMA 4M0LA 1T3SA 1F48A 2CHVA 2XTNA 2GJSA 2MSDB 2E1RA 1CJMA 1E2FA 1GNRA 3SQXA 4TSFD 2ZROA 3FMFA 5B64A 3CZPA 3QXXA 4U5XA 2P6NA 1M6NA 3CX6A 3PEYA 1XXHE 2ZS9A 3ZS9A 1XBTA 3UWOA 1E3MA 4N1AA 3PEWA 2O8FA 2XJ4A 2W0SA 3RHFA 2VTKA 3IO3A 2WJVA 4AURA 4C0QC 3WMGA 2XXAA 4XVQA 4A0RA 1E0JA 4IDHA 3VU9A 4UNRA 4BZQA 2NO6A 4P3YA 1Z0AA 4URUR 3Q3JB 5K8IA 3Q5EA 2O8BA 2O8DB 1E9FA 3U3OA 4C7OA 1KMQA 3BWDD 3ETLA 4EPWA 2QZ4A 4E03A 3DOFA 4XOIA 5FBRB 2QSYA 4IDPA 3VR3A 3GJ7A 4U00A 3OE7D 4HLUA 3L0PA 4DLTA 2ZJBA 4LPKA 4LHVA 3N70A 5EXPA 3K09C 5E4FA 2CE7A 1R6BX 2FSFA 5KDLA 4WA7A 3SFZA 3KQLA 3EXAA 1E9AA 5TB5A 1W5TA 3CR8A 3VR2A 3E2IA 3W3AA 2FV8A 2ZRKA 1XX6A 1WRBA 2VP5A 1AS2A 4D4KA 4Q1AA 1P2UA 3VR5A 3TUJC 1IM2A 3AQ4A 4Q4JA 3DL0A 1KI6B 3RDPA 1KJYA 1G3IA 2IF2A 1TF2A 2OCPA 2ZR7A 1YZQA 1XTRA 2PEZA 3P26A 5DO9A 4DSUA 3BGWA 2R62A 2XOKD 2VA8A 2OILA 5J4VA 4MKGA 2I1VB 4LJ9A 4Q7LA 4Q19A 1WQ1R 4V0MA 4II7A 2FFQA 3KDSE 4PO1A 5FTMA 3EX7C 4TMZA 1MRNA 4QNRA 1ELOA 1US8B 2QP9X 2ZRMA 3CWZA 5KSYA 3OFNA 3EZ6A 1ZU4A 3RS3A 1YJ5A 4MUBA 3C41J 3H2YA 1Z06A 1EFCA 4IOMA 5HZHA 2FN4A 2J0UA 5FBWB 3SFVA 5CB6A 3ZYCA 2HT6A 2V55B 2W2TA 3I32A 4TWZA 5HPYB 5D3MB 1UM8A 3ZVRA 4CEHA 3T06B 4GOXA 2ZJ5A 2VP4A 2CL0X 2CE2X 1II0A 1XMSA 3GJ0A 1S3GA 1UBGA 2W2VA 3EIQA 3QI2A 4V03A 5KSZA 2CLDX 2YWHA 3PEVA 4C0KA 3KQHA 3WYAA 2ONKA 1DG1G 2JLSA 3CX7A 1NIPA 1Z3IX 1B23P 4B6EA 2QP4A 3TW4A 4D6PA 2KWIA 2WSSD 4QGGA 1GRQA 5B2ZA 3WHLA 5JEEA 1DG3A 3KKPA 3C5HA 2PBRA 1VCOA 3SHFA 1CJKC 2A5YB 3FHOA 2QTHA 4JVLA 3K9GA 4RZ2A 2ZRJA 4L5BA 4E09A 1MO5A 4P4SB 1IQPA 4RFSA 5EE3A 3HU2A 1TAGA 1VHTA 1MABA 4UKDA 5JHHB 2V7QA 2AKYA 5EE0A 4HZIA 1TQ2A 4TTQA 2P65A 1Q1BA 3OIWA 4OI0A 4Q1CA 2VRWA 3PG5A 2B8TA 4KLZA 1MT0A 2RMKA 4GOJA 4TL8A 2V1UA 1K5GA 1W2HA 3SYLA 1E0AA 2GK6A 2OCYC 2G6BA 1W44A 2VEDA 3A4NA 1L4YA 1G64A 3B1XA 2QMEA 2QMHA 3CH5A 2QA5A 2CVFA 1SXJB 2JEOA 3I73A 1SVOA 4IKEA 1ZM9A 3QNUA 1W46A 2EFDB 4B73A 2IXEA 2ZJYA 3FHCB 5JS8A 2QBYB 1I2MA 3W8NA 1U0HC 1A2KC 4D25A 2REBA 3MWKA 1NIJA 2IYLD 3K8YA 1G5TA 2AFHE 2YWFA 5A0FA 4JVMA 4HB2A 5P21A 4AYXA 4DLUA 2ORWA 4TZ0A 4QM6A 1ZD8A 4PO9A 1HE8B 3TR0A 3U60B 5KSPA 4DCTA 4PR0A 2GCNA 3TSWA 4WXRA 2VSOA 4DEYA 4DXAA 1T5IA 2YINC 5IT5A 1EG7A 2XOKA 4NMMA 3DM9B 2P67A 2DFNA 4LJ8A 1GKYA 1GOTA 4PHTA 4DVGA 1T3HA 5JEDA 4A92A 3VR4A 1EX7A 621PA 1FOEB 4B76A 3GLHB 3NG1A 2ZETA 3QPVA 3RANA 1UEIA 2ZUBA 5FBLB 1YZLA 3H0KA 5FUWA 3T15A 2A5JA 3C8UA 2QAGC 4OQLA 4G01B 3AF2A 4I1SA 4FN5A 4WZBE 1G291 3PUVA 1XZPA 4HDQB 3UANA 4ILEA 2IK8A 3UMRA 1QHHB 3S1AA 2C04A 2WWXA 4JLDA 3UMFA 2ZU6A 4F4CA 4WBSA 3AF4A 5FPHA 5AJWA 5DE3A 3WP1B 1Z07A 3FE2A 3R20A 4ERNA 1ZU5A 2F9LA 3GJ3A 2AK2A 2Z83A 1UAAA 3NDPA 2PJRA 5KNDA 4Q1BA 3HWSA 1KO4A 3LQRA 2GZHA 2D06A 2V9PA 3P20A 1LVGA 2MSEB 2PCLA 3CO5A 2C78A 3MLEA 4MGKR 2HUPA 2J3EA 2J0VA 4K8OA 3U6KA 3HJNA 4CT4B 1FQJA 1E6CA 4JJKA 4LGMA 2CK3A 4MYCA 4MYUA 3NBZC 1BS1A 2FNAA 1KO7A 1SXJE 1U98A 2C8VA 5CDFA 4UJ3A 2ZU0C 1XXHA 3QXJA 2OCBA 2VHUA 1NN5A 2CCKA 2OFWA 4RZXA 2QI9C 5JJKA 1LW7A 4B2LA 4Q47A 3WRXC 2CMKA 5FI1B 2OE2A 1X6VA 1Q44A 2DY1A 3BFVA 5EE5B 1VIAA 4OBEA 5J4LA 3TR5A 4QM7A 4TYYA 3QIAA 4TL7A 3SNHA 1Q3HA 4B48A 5JWRA 4BLQA 3PUXA 2AD5A 2REOA 3W6NA 3SJBA 3K09A 1P4SA 4FMDB 4PXAA 1E0KA 2DB3A 1S9DA 3CF2A 4R7ZA 1R0YA 2ZRIA 5JI3E 1H8EA 4ZIRB 2ZR0A 4JJZA 4NPHA 5IK2D 5L3VA 1XPOA 2A7QA 4LYHA 3X1ZA 1AGRA 1P2TA 1G18A 3NH9A 1QVAA 5TVKA 4HUTA 3R9IA 1OIXA 3GLHE 1Z28A 3DEFA 4HAWA 1HT2E 2JLVA 4JLKA 1NNEA 2W0MA 2OAQ1 4HDCA 2P2LA 1DE0A 4JLMA 2ORVA 2WWYA 3X1YA 5JSZA 1R4AA 1MO6A 3QOFA 2GXUA 2NTYC 5DLQC 3KJIA 1E2EA 2Z43A 1M8PA 3B2EA 3IBGA 3KJHA 4V0NA 4F91B 2HT1A 1QHXA 1HY3A 3FMPB 4D0LB 2BIFA 4RCZA 3GJ6A 3KXLA 3AVYA 4TMVA 3LH5A 3CM0A 1ZC4A 1FQKA 2Z6VA 3UMSA 4IOJA 1AQUA 2X77A 4URZR 4KFSA 2B6HA 2EFHB 2ZI7A 4U02A 4BASA 3QPUA 2Q9AA 1YZTA 2WWWA 4KFUA 3U7EB 3KJEA 4GI7A 2AXNA 1XMVA 4PQFA 1BIFA 2NO7A 4TLDA 2Q3MA 3GFPA 1AKYA 4YXWD 1QHYA 1RRCA 2IYVA 3SOPA 2BVNA 5EZ6B 1I4LD 1UKZA 2OEPA 3B82A 2BEJA 4H1UA 4JYCA 5KO2A 2O8CA 3OEEA 5ELXA 5M04A 2QE7D 2OBNA 4TQ9A 4OYHA 2JJ2D 1NLYA 1FX0A 3VNUA 4DCUA 1NY5A 1TEXA 1Z22A 3M6AA 4GRAA 3B7GA 5EXXA 4DBLC 2ZSFA 1JI0A 3HU3A 2B7BA 2WKRA 1XJQA 5DI3B 3BORA 4QBHA 5FPSA 3WHKA 2Q9CA 2X19A 3U2QA 2KBEA 4H9GA 4MYHA 4LK2A 4DZZA 1RYHA 3C4JA 4MH0R 5CLQA 4Q4HB 5H68A 1P72A 1KMHA 2ZR9A 3CBQA 3NHBA 4ZO4A 3K0CC 4HAUA 1IXZA 4XWAA 3FMIA 3RNLA 2O0HA 4BFVA 2LWIA 1XNJA 1SXJD 4TYQA 1T9HA 3Q8XB 1NG1A 3QVUA 1OFTA 4KU4A 4LBZA 3TAHA 4B43A 2CL6X 4TLAA 3UXMA 3GJXC 3I62A 1FPMA 1AM4D 3WNCA 4US0R 2W6JD 2H16A 2DHRA 3SHWA 3RABA 4IDNA 4PANA 5DYIA 1IONA 4CF7A 3I4LA 4CZ2A 4RD1A 2Z0MA 2PL3A 5FPYA 1Q3TA 1T6NA 4KXFB 2J46A 1N6RA 3LX5A 1P7CA 1W0JD 4D2IA 4PC3A 2ORIA 1EFRA 2WJGA 2X2EA 2ZRPA 3FPAA 4ZDIA 2OBLA 2VP6A 5DSZA 4CDGA 1G19A 3Q72A 2ZTSA 3ICQB 4W5HA 4A2WA 4QHSA 1C4OA 1NLFA 3NBXX 4BFTA 1NG9A 5J5CA 2O0JA 4DEXA 2RHDA 1I4TD 1KI1A 1T3LA 1TF5A 4D0GA 3CRMA 5EP3A 1JQJC 4P4TA 3AH8A 3A4MA 4EJSC 2XNDD 5ANRB 2V6IA 5IK2A 1YR9A 2CNWA 2RGDA 4TYPA 1COWD 1GNQA 2HYIC 2H17A 3QG1A 2JIZD 2J45A 3J81k 3THOA 4ZCMA 1IJEA 1PLJA 2I3BA 1TADA 2Y8EA 4QGFA 4B3XA 3AVPA 3FOZA 3IPYA 4OI2A 1FMLA 1KSHA 4TZ6A 5KUTA 1YR7A 3TAUA 5KOYA 1U9IA 2C5LA 1Z29A 2VH5R 4CIDA 3GLFB 4ZPXA 3QF4A 3UG6A 2JLWA 3ND9A 4M21A 3SS8A 1G8PA 2J0QA 5TY0A 1HA3A 2QAGA 1WBBA 1GITA 4Q01A 4EFLA 5EUQB 1BYUA 5EP2A 1R8QA 3WNDA 2IWRA 4KFRA 5L8VA 3AGQA 1SVIA 4LOAA 2D3WA 1KJZA 2WPDD 1C9KA 3VFDA 1J90A 4Z1MD 5JMTA 4DLWA 2G0TA 4V0OA 1XRJA 4RD6A 3L0IB 4WAUA 2D2EA 4DDUA 5EE1A 2GILA 1N2CE 3PUZA 2OFXA 1H65A 5FOTA 1SZPA 3DKPA 1P2SA 5CIQA 2QGNA 4FI3C 2ODWA 4LHWA 2KB0A 4HUQB 2LKDA 1E2IA 3QEJA 4FINA 5HE9A 2NIPA 4L9WA 1E9DA 4TLCA 2JATA 1Q20A 2QGZA 2Z4RA 5TARA 5EP1A 3X1XA 5B58C 4DLSA 2F3TA 1W0KA 3RWOA 3VNVA 2P0EA 1W36C 4ITRC 1F60A 3WBJA 1CR4A 1P9RA 2K5UA 3CUEF 3RRMA 2FZLA 4NCJA 4X8MA 4FXPA 3CPJB 1A5TA 1OXUA 3ZIAA 1E79D 4F7WA 4XSGA 1P60A 1UKVY 1XEWX 4NYJQ 4W7SA 4DCNA 4K46A 4ARZB 3R8FA 1W4CA 3ZVNA 4Q7KA 2A5GA 2QN6A 3PUWA 2C9YA 3GLIB 1D6JA 3CRW1 2DYKA 3AVTA 4OJQA 4TL6A 1FUUA 3QUSA 5J4HA 4A8JB 5KNCA 3I92A 1BMFD 2ODNA 1TQ6A 1MRSA 4RZ3A 2A9KA 5LBIA 4EPVA 3UWKA 1R0WA 1P2VA 4KSBA 1NLZA 3OEHA 2F9MA 3SJCA 2YJTD 2H18A 2BM0A 1U81A 3A1UA 4XTCS 3GLFE 1XD9A 3KB1A 1KI9A 5DN6D 4JLVA 5CIWA 2ZI4A 4BEJA 2RH5A 5KDDA 3KTAB 2BKUA 1HH4A 2BJVA 2OFOA 4Q03A 4F93B 2QMUA 3O8RA 1CJVC 2KSQA 2ZREA 3MWYW 4FMCF 2ZIAA 1DO2A 3ADBA 4Z8XA 3ADCA 1GNPA 1G17A 3A6PC 721PA 5KSOA 4LHZA 3KUDA 3HYTA 3U44B 2P5SA 4A9AA 1KO5A 1T8TA 2O8EB 4FW9A 4L9SA 3DDCA 4R98A 2JJ1D 1P3JA 2YVUA 1N3BA 3LA6A 2RGCA 1HTWA 2R6FA 3RLFA 3ZVLA 3OESA 2A2ZA 3LAWA 4WZAE 4MKHA 1TUIA 4LBWA 4W5JA 2FEMA 5FPTA 2BDTA 1XB2A 4HDOB 4LYFA 1U8YA 1F3OA 4TMTA 1DAGA 2QQEA 1KKLA 5GJVC 1N0WA 2FFBA 3RS5A 2EFCB 1N6KA 4EKDA 2QEQA 5G40A 4O3MA 1G7SA 3R7WA 3THWA 4IEIA 3VHLB 1G9XA 2QTFA 4Y0AA 5HCIA 5KPJA 3K0FB 4PZZA 3K0CA 4B3BA 2FE4A 3AP3A 4X8OA 1E1RA 1GILA 4PSAA 4DSNA 4YLGA 1NL3A 3AGPA 2OLJA 4XH9B 5FOXA 5HKKA 1U2RA 3BFXA 2IYUA 1KJWA 4IOLA 1R2QA 1VCIA 3OIYA 2ZM5A 2QU8A 3FKSD 1Z0JA 1Z5ZA 3ZQJA 4DT1A 3CW2A 2VBCA 2CHQA 1N5IA 2FSIA 2P3SA 1VTKA 2X1VA 4D4LA 2V3CC 2D7CA 3SYNA 4M22A 2GAAA 4IRUB 3LDAA 1P62B 1YQTA 1NBMA 1E79A 4M1WA 5F98A 1AS0A 4Q7JB 4B32A 3DZDA 1MO4A 3AVWA 1G4UR 5KTYA 1AS3A 1KZ7B 2OUKA 4LI0A 1CRPA 1X1SA 2IUTA 2QP3A 1NJGA 4RJLA 1XJ0A 3T5DA 1VYUA 3CRQA 1II8A 4GBMA 4AY2A 4EJSA 1E2DA 2LKCA 4A6PA 4OK3A 4LYAA 3VX4A 3EZ2A 1ZM4A 3AKYA 3IBYA 1SQ5A 2WWFA 1MR3F 3H4MA 1LTQA 3FGNA 2GNOA 2PMKA 4G5SA 4MRSA 2AFIE 1BOFA 2GCOB 1DO0A 5DN6A 1EK0A 4LJYA 1W49A 1Z83A 1DBSA 2OM2A 4MDFA 4DHEA 5BQ5A 2FWRA 3I3SR 5C4GB 2QRNA 2HLDD 4JT2A 4BLTA 2VHTA 4GMDA 4Q66C 4DB4A 4IVQA 1E9CA 4DIEA 2VP0A 1AGPA 4HZUA 4Q4AA 4E22A 1S2MA 1CXZA 2BKEA 4OHVA 2HXSA 3RS4A 4AYTA 3B85A 1ZVQA 2VF7A 1J2JA 4AWXA 2PCJA 4NONA 4Q1FA 2AR7A 2IBMA 4ZCLA 1E94E 4AKIA 4DDTA 3SN6A 3REFA 1RFLA 2VF8A 4AKHA 4DSTA 1RKBA 1CTQA 4DCVA 3G82C 1GRNA 2JLQA 3ZZTA 4AK9A 3T5GA 3QXHA 1A1VA 1OXSC 4G0NA 1HT1E 3KB2A 2ZYTX 1F5NA 4M9SA 1OKKA 1WA5A 4BLPA 4AKGA 3B1YA 1TX4B 3BK7A 1KDPA 2F1HA 1OHHD 4JLNA 3CRRA 2J1LA 4KV9A 4QBIA 1R5OA 2EWVA 1JJVA 1N25A 2QENA 3K0EA 2GAOA 3GEEA 5FOVA 1Z47A 2CLCX 2ZRBA 3VQTA 1N6NA 2WJHA 5JS7A 3MCAA 5TXGA 2BBTA 4JLPA 2PT7A 1GL9B 2QTVB 2H92A 2R6GA 1N6PA 2OHFA 1D2NA 2BBSA 3Q9LA 2ZI6A 4BUJA 3FDIA 3HP1A 2QQ0A 4P31A 1KK1A 1KZGB 2GF9A 2JLZA 3RWMB 1TL7C 4IFBA 4ZI2A 2FZ4A 3L0SA 1UPTA 1HUQA 1VCMA 1WXQA 4OHZA 4XVRA 1EWRA 4MYTA 1NF3A 5G41A 1XCPA 4K81B 1SVWA 3LNCA 3MSXA 3QEOA 3BAFA 1PV4A 3GJ4A 2ZE7A 4I1UA 4C0BA 1RIFA 2PZGA 3PENA 4EAQA 3CH4B 3L0OA 2JJ8A 4JVNA 5C4MA 3X1WA 3LW8A 1CP2A 1Z6AA 4PFSA 4UNQA 1EFHA 4JL5A 2IYYA 4AG6A 2JDID 2PEYA 5FTLA 2R9VA 1QG4A 4GT1A 1XTKA 2ZRGA 2CL7X 1T91A 1QDEA 5FL3A 4DKXA 1IBRA 1NN0A 2ZRLA 3TH5A 3CR7A 2ZJ8A 4CVNA 1R0ZA 1OSNA 1Z08A 4CEJB 1XMJA 4I1VA 4Q48A 4NP6A 1O3YA 3THYA 1OB5A 2IS1A 2F43A 2W6ID 4C4PA 1H8HD 3GLGA 2IXGA 4OI1A 2YWEA 4BLSA 4JL6A 4JKYA 5E7IA 4TSFA 2XTMA 1M7GA 2X8AA 1KNXA 2AD1A 2ATXA 1NKSA 2MMCA 4M1MA 3SEAA 2NPIA 5BWMA 3AVUA 3U61B 1WBDA 2AKAB 2WWHA 3SR0A 1CIPA 1GM5A 3BH7A 2YOFA 4BPBA 3IQWA 1G7TA 1Q1ZA 4D4MA 1LFDB 4DLYA 4M1SA 3ZH9B 2WVJA 4N0EA 2GEDA 1HYQA 1E2QA 1X8KA 5KPDA 2GXAA 3B9PA 3NEJA 4F92B 2FMXA 2ZRAA 1Q21A 1XP8A 2RCNA 2NQ2C 1VHLA 1TTTA 2D2FA 4KHZA 4L16A 5CJ2A 3MWJA 3PR1A 4HB4A 2FSGA 3OE7A 4XIGS 1R10A 1Y63A 4LJAA 3TQFA 4BEBA 1I2DA 3B1WA 4PHGA 4B33A 4DIDA 1NJFA 3QKRA 2FGJA 1F2UB 3B60A 3RVBA 3B6EA 1XD8A 1XEXB 3D6TB 4U7DA 4ZDKA 1QHNA 4D0NA 3VKGA 1OW3B 1L8QA 1FW6A 4LSGA 3B1ZA 5B57C 1DELA 3KXKA 1F2TA 1XFAA 1G7CA 1VDZA 4OHXA 1ZW6A 4BFYA 1OYWA 2BCGY 3O47A 1WP9A 2WOOA 3PITA 1MH1A 3T1QA 1IN8A 3G0HA 2JA1A 4GFDA 1XD2B 1G16A 5IF9A 1DAFA 3BERA 5E3HA 1U9IC 2V54A 5AR1A 4OL0A 2J59A 3QKTA 1VG0B 1N6IA 5HE8A 3C15C 4HLDA 4A0HA 1YR6A 2XSZD 3M4YA 2FFAA 4EQ6B 4RY2A 2ZVPX 2EVWX 5FTKA 2Q3HA 2HXYA 2QRZA 2XX3A 1ZCAA 2ZSEA 3DMDA 3K0AA 4KITB 3U4QB 3TKLA 3THXA 3DKVA 1OT3A 4QRHA 3L2OB 4GPTA 1ZIOA 3I72A 4IJMA 4LHXA 1SVLA 1Y3AA 2ZYUX 4X8HA 1JXMA 1TMKA 6Q21A 1S3SA 3LVRE 2W58A 1DAEA 3EPJA 3E5HA 3LXRA 1LY1A 2EYUA 2WAXA 3JVUA 3AM1A 1A82A 1UFQA 2C9CA 4D81A 5GJCA 5GJBA 1E2KA 4HEJA 2NG1A 1W4RA 4H1VA 4NL4H 3L82B 1SVKA 4A6XA 1YVDA 2R2AA 3BE4A 4QC2A 3BB4A 2CXXA 2B92A 4B3FX 4C0JA 1RW4A 4BFWA 4LCBA 1NN3A 1ZNZA 1DOAA 4O2RA 5AJYA 2WSSA 3OIUA 4YMVA 3SBDA 2L0XA 2N46A 2G1KA 2QT0A 3CPEA 3B78A 4CEIA 2RGNC 2A3RA 3NTUA 1CR2A 1I4DD 5LD2B 3AUXA 4C0SA 1RJ9B 1SXJC 2CJWB 1X8JA 1KDTA 4G5QA 4RD2A 3VMFA 5KDOA 2CLSA 5CLLA 2QMOA 5L3SB 4LBYA 4EIWA 2IEZA 2H5EA 4S35A 4I4LA 4ESHA 1VPLA 4L4UA 4LJ7A 1Q1EA 3EWSA 3HDTA 3VU9B 1PJRA 3DOEA 3ZD7A 1HV8A 2BJWA 5TDHA 4BZPA 4RVCA 4XJXA 3W5JA 3FMOB 3R7WB 1W4AA 1W48A 2Q3FA 3BBPA 4Q7MB 4ON9A 2BCJQ 1ZM2A 2FEOA 2VSXA 3QBVA 1VKJA 3OHMA 3V4FA 4UQOA 4NYMQ 5FTJA 2XZLA 5CM9C 1ZNWA 3P1JA 3QKSB 1U8AA 5B30A 1RVDA 4YMUA 4RZUA 2IEYA 2VQSA 4YC7A 3RC8A 4XSHA 4CGZA 4BE7B 4KYIB 2WZQA 3NKVA 4WZ6A 3MG9A 3K53A 3ADDA 4IDQA 1XMIA 1G8HA 3FWYA 1WMSA 4TN1A 5JLJA 1YRBA 2ZUCA 2GBLC 3H84A 2A78A 4DLVA 1W7AA 4LC0A 5L3QB 1IJFA 1BO6A 3V00A 1WCV1 2FF7A 2ZI9A 3R8CA 4JLJA 1HURA 4LZZA 1Z6GA 1N6LA 1ZRHA 2DFKB 2EWWA 4B2IA 3SZRA 5H8WA 5AUNB 1KK2A 4D80A 4NKRA 3GD7A 3ZD6A 1TNDA 1OLOA 2WTUA 3QSYA 2A5FA 2YC2C 1S96A 3WYGA 5H70A 2D4HA 2PMDA 1KGDA 4OKSA 1OFHA 2FGKA 4KBFA 2WBLC 1DS6A 1XF9A 1JR3E 2ZI3A 4QBFA 5F3WB 2FFHA 2G0NA 3A8TA 1R8SA 3RAPR 4MGYR 2UZ3A 2NZ8A 2LCFA 3U7HB 4Z54A 5EJEA 5JHGB 2DPXA 4IHQA 3W5IA 3NVAA 3GCGA 2J0SA 4PAOA 4PX9A 3NBFA 4QHTA 1RZ3A 4I1OA 4M1OA 1OFUX 1E2GA 1Z6TA 2DWQA 3K70B 2XZOA 2IL1A 3M0EA 3NC0C 3TW8B 2O8FB 3TLXA 3LV8A 5AWFC 2O8DA 5BW8A 1JQLB 2PZFA 2UVQA 1XPRA 2XXAB 2YC4C 3SU8A 2KI5A 2O52A 2R8RA 1G8YA 3DVLA 4DLRA 1YKSA 3DZ8A 2O8BB 3IHLA 1W1WA 3U5ZB 1KSFX 3IHWA 3ICEA 4GP6A 1TQ4A 5SZHB 2JASA 4MRNA 4C7OB 2KBFA 1E2MA 1T5LA 4NYJR 2VIIA 5GVRA 3AVOA 1V5WA 8OHMA 821PA 3D7MA 3A1WA 5FBQB 2PJZA 3EIHA 4B71A 3TSZA 3EWAA 3LD9A 1KI6A 1E4YA 3AB3A 2IHYA 3V4RA 3Q7QA 1G41A 3EZ7A 3OAAD 2B21A 4KVGA 4PQRA 4LX0A 5CJPA 3GP8A 1K6MA 3ZVMA 4UNNA 4UXIA 4Q4JB 2GTPA 3LX8A 5K8UA 3RS2A 1OF1A 1HQCA 3TE6A 4TT3D 3P4XA 1US8A 2NZJA 1GTVA 4N0DA 2GZAA 5HTKA 1CULC 3TUZC 2GESA 1L4UA 4TMXA 1IXSB 3TJZA 421PA 2YHSA 3T1VA 1JBKA 2YZ2A 2G83A 3PJRA 3W8RA 3GMTA 4DUGD 2HCBA 2BMFA 3MRSA 3QF7A 1XTIA 5D3MA 2ODEA 5C18A 3WMFA 2MSCB 5FBVB 4R71A 2GJAA 5JRZA 4AKEA 2J0UB 3QKUA 3EAQA 4C0HA 1CU1A 5EP4A 1XEFA 2EW1A 2P6UA 3VAAA 3WXMA 1S9HA 4CEHB 1E1QD 2ANBA 1NN1A 4PO8A 3CRVA 3HYRA 4JBWA 1UJ2A 2IYZA 3CPHA 4M1TA 3KQKA 1E0SA 1DTSA 1ZD1A 1SKQA 3LQQA 3VX3A 3ECCA 1GKUB 1NI3A 1JR3D 1OB2A 1X86B 1Q1QA 4YXWA 4LJ4A 5CYPA 4A0FA 4URXR 1UDXA 2HF9A 4YDSA 4BLRA 3EPLA 4KYUA 3UKDA 5JCPA 2DWPA 3GFOA 4KLNA 4P4SA 2F1RA 4B35A 4A4DA 2QE7A 3FHTA 3WRYC 1VG9B 2JJ2A 2VHCA 4KCGA 4M1YA 3ZJYA 4X8LA 2V6JA 4MQBA 4N3NA 1T4GA 3ZS8A 4RFSB 1E2JA 2JCSA 1PUIA 3CZQA 1MABB 1G7RA 1NMXA 1UKEA 3IIJA 2C95A 1N6HA 1CLUA 2VO1A 1LB1B 2YYZA 1AN0A 1YZUA 3F8TA 1EX6A 4GOKA 4A2QA 2ZE6A 4Q1EA 3MGCA 1QF9A 1OH6A 3TRFA 1P9NA 2GEUA 2RGNA 2IYWA 1D5CA 1XZQA 2JLXA 4CRWB 1XPUA 1SXJA 1NSTA 4MRPA 2GVZC 2XJ9A 5TV2A 4PC6A 4GL2A 5JFGA 4C9BA 4BFXA 2CDNA 1FNNA 2GHIA 1D2EA 2W6JA 1OYYA 4G5OA 1OPXA 4OQFA 3EC2A 2QM8A 3B13B 2QBYA 3ZLJA 5JI2E 4ABYA 1QHGA 1JJ7A 3T1TA 4W9MC 2IS4A 1X1RA 1VYTA 3JZAA 4BRUA 1Z0DA 1W0JA 4MKIA 1QBKC 1CJUC 4ZV4A 1Z2CA 4V0ME 1VCNA 2OV2A 3GFTA 1M7HA 1KIMA 1KI4A 2WIBA 3GQBA 4CT5A 2QAJA 5KYKA 4F4JA 4TQUS 1CEEA 1GRRA 2V1XA 3MWLA 4LBVA 1RC8A 1DAHA 4BRWA 1UF9A 4C0AC 3ND8A 4YMSA 1ZJ6A 1TPZA 1YHNA 1FTNA 3O8BA 1ETUA 2XNDA 2WMNB 3LW7A 2R6CA 2GBLA 3IEUA 1RRPA 5IDVA 4A36A 3F5FA 1COWA 3GLHA 3M1IA 1E2NA 5DISB 3BD9A 1RYFA 2JIZA 4HLCA 4DRZA 1D9XA 3RSLA 4B3GA 4EPXA 4JLOA 4ZDWA 2HEIA 2ZQ5A 3LRPA 4QFMA 4XTRA 4QKQA 1QHHA 3B1VA 2IHBA 3JZMA 3TVTA 3TVDA 1IAQA 3BB3A 4FWIB 4NE2A 3TSOA 4PPQA 1BYIA 3K9NA 4QGAA 1SGWA 4LC1A 3WBKA 3C7KA 1CJTC 1KI2A 1NVWQ 3S1AB 1M34E 3KKMA 4FCVA 5FUYA 3LBHA 2BWJA 2P5TB 2JAQA 3K70D 2ZE5A 1E9SA 2D74A 3OZXA 1JAIA 1T8UA 4A2PA 2ZYVX 3CB4A 4B47A 3I61A 1U8ZA 3IPXA 1KKMA 3NWJA 4FIDA 4RD0A 1KO1A 4TQAA 5CYOA 3VHXA 3WYFA 3IILA 1LF5A 2WPDA 2GDJA 3QVVA 4NTZA 4B2PA 4V0KA 4Z1MA 3DO6A 4A1FA 5JJIA 1PLKA 1DADA 4IVPA 2VP9A 1IN4A 3AKEA 1KK3A 2GRJA 3WMEA 1OV4A 4PPNA 3SQWA 1MOZA 4GMXA 2ASEA 1E9BA 2KE5A 2OAP1 2NMVA 4R2HA 1ZCBA 1WB9A 4XWOA 4C2TA 3HR7A 3CWQA 1XXHB 1YRAA 2IYTA 3B9QA 4QJ5A 3GLIE 4QNMA 1LNZA 3PQCA 2NGRA 5G53C 4BFUA 1MKYA 2BHRA 1NMYA 1R5BA 4OHYA 5F9FA 5JZVA 2OCAA 4G1UC 4EFNA 3MFYA 4A8JC 3NC1C 4C0LA 3PUYA 2IYRA 1D2MA 5J4YA 3FB4A 3IIMA 4B75A 4Y0VA 2VYFA 4ZIRA 4I99A 3EZ9A 2DWOA 1E96A 1TF7A 3K0SA 2EYQA 4Q1DA 4FD2A 2ZXUA 2J7PD 1R0XA 4LHYA 2CHGA 1GDDA 4GZLA 3BS4A 1CKEA 1DEKA 1U99A 4BQSA 3IIKA 4UNPA 4DDVA 1E2HA 2FJUA 3OFND 1ODFA 3T61A 3A37A 4E5UA 1BMFA 4LUCA 4RKFA 2J9RA 3R9WA 1EGAA 1TQDA 5K8LA 1O87A 1WDTA 2EFGA 1A2BA 4QGHA 1KY2A 5GJWC 1K8RA 5JSZB 1EESA 3EPKA 2ZYWX 4OJKA 2CBZA 1AK2A 3IDQA 1ESNA 2OXCA 5FR2A 1QHSA 1GP2A 4TLEA 4YMTA 3EARA 3O8DA 1E69A 1JPJA 3CF6R 4TYNA 1J99A 2PLRA 1XWIA 4MRVA 2RB4A 2VSFA 3W3ZB 5J47A 1DVRA 1E9EA 4PQYA 2GVDC 2OESA 2GJ8A 1S8FA 3CF0A 4FCTA 3IKJA 4Q9KA 2Z5FA 1II9A 5DI3A 2O8CB 3FFAA 3ZDQA 2YV5A 2V7QD 1IN6A 1FX0B 2ZS7A 3IGFA 3HU1A 4Z8YA 5HCNA 5CDFE 2CVHA 2JJ1A 3KL4A 1T0HB 2BEKA 4Q4HA 2ZRDA 3SJAA 2OXRA 5GADl 5CK4A 5E95A 4V02A 2IUSA 3ZZ0A 1G21E 1FP6A 1W47A 5FUXA 4ZKDA 3Q7PA 1ZP6A 2GZDA 2XZPA 3QENA 5EXSA 4XVUA 1KMHB 2ZSBA 3U3JA 3GJ5A 1NVUQ 2XITA 1SHZA 5AUQA 4Q18A 5UKDA 1V43A 4P33A 4WXPA 1N0VC 1P5ZB 1KHTA 2ZRCA 4LV5B 2AX4A 5FI0B 2YNMA 4DB2A 1WE2A 5C2JB 4O25A 3TIFA 3VR1A 2IUUA 1VYVA 5CK5A 1ONBA 5JBQA 4PZLA 1NSFA 4MA4A 1OXXK 2ZPTX 3FKSA 3U3MA 2J5XA 4M53A 2WJJA 3LFUA 5JCZA 4DLZA 2BMJA 1G1MA 4OHWA 4NH0A 2KJQA 1ZYUA 4EUNA 2D7DA 3KQUA 2SHKA 2ZAOA 1KSGA 2GF0A 4NCIA 5FPKA 4Q9LA 2AK3A 3EW9A 3FFBA 1GAJA 2ANCA 4BFZA 3IEVA 1A4RA 1LV7A 3C5CA 3QJYA 2QL6A 1ZNYA 4NCNA 1K5DA 4OK6A 1FFHA 3MUFA 2J7PA 1CS4C 4PPGA 3BH6A 3UATA 4JZKA 2HCJB 4G5RA 4O2LA 2QPTA 3EIEA 3E70C 4RKEA 3AKDA 2IX3A 3MD0A 4UXJA 2HYDA 4TTPA 2AHOA 4MGIR 3W9YA 4F38A 4ASUD 3GLFA 1E9RA 2ZRNA 2WKQA 4OI4A 2G88A 5FH9A 121PA 3KFXA 2ZE8A 4C2UA 4FWTA 3QF4B 1DPFA 4OQNA 1DAKA 3BJIC 4PSVA 2NPFA 3AVXA 3AVQA 2C2HA 1OXTA 4MDEA 2HLDA 4O0MA 2QAGB 3IUYA 2C96A 1XTJA 3A1VA 4PPFA 3EG5A 1LS6A 1RE0A 1UEJA 2PH1A 4JVSB 3V9PA 2AN9A 3NHAA 3I8SA 4QOSA 1SVSA 2EFEB 1YU9A 3AUYA 2F1IA 2CK3D 4NCHA 4V0LA 4CYMA 2AL7A 1E98A 1QG2A 5J4KA 3EA0A 4D4JA 3RRZA 3RS7A 4PC2A 3AVVA 2CCGA 3QPWA 1GL7A 4HUQA 2I4IA 1AIPA 2F7SA 1OH5A 4IW3B 3NIBA 3CIOA 5EE9A
chains in the Genus database with same CATH superfamily
3R44A 5MGBA 3T8YA 3W3AH 2IA5A 1BN6A 2I6TA 3C70A 5FTWA 2ONJA 1JNYA 1P2BA 1L0BA 2RKOA 3KX2A 3R4VA 4PHHA 1JA0A 1FXSA 1OWPA 4G4SP 1GIAA 4JL8A 1QHIA 1AK1A 2J87A 2WJAA 3IAS6 3UMRA 1JT9A 4JYPA 3WK5A 2PT6A 3G89A 4MI9A 2WJYA 3A9VA 5FUBA 4LNAA 4N7BA 1ZVKA 3AZOA 3JD3A 4L15A 3MT7A 4GNKA 4MWDA 4NABA 1HKHA 3T1NA 1A5ZA 1MJHA 1NNLA 1Z45A 3N8IA 2WLTA 2L19A 3PEUA 3DL4A 1Z0ZA 2CZQA 4G84A 2BM1A 3PIDA 4WPGA 4J9VA 4P4LA 2QTNA 5ILGA 3VPFA 4EG6A 2QD5A 2H1SA 3NAZA 3D31A 4A8JA 2PUFA 3V1LA 3DWEX 4TUYA 2IXAA 1VMDA 4FMDF 3HABA 3PFIA 2E4YA 2IGBA 4RW0A 4P7BA 2B8NA 2YKGA 4AJNA 4ZHQF 1Y7IA 2JPDA 2XTZA 3FVQA 5FOSA 1YV9A 2P7HA 1ZHFA 2QY9A 5CB0A 4RMJA 1YDWA 1UL1X 5D3QA 4R2IA 3DNMA 3PD0A 1A4IA 2GZ1A 2WWIA 3D3WB 2Y1DA 5JQGB 3FCOA 3JQ9C 5LNK6 1ADJA 1J33A 4XLTA 3RB8A 3TOSA 5JO0A 3CT6A 3IR6A 5DNCA 2F67A 5LQUA 3EW7A 3DXFA 4I5FA 2GCEA 5ERGB 3N28A 2W00A 3K71B 3QP9A 3OPXA 2BR5A 3OKFA 5IKXA 1NQTA 4REQB 4J76A 3N2LA 5TJ9A 2AB0A 5L53A 2XRZA 3ACDA 1VLZA 1GKIA 1K9VF 2X14A 1MX3A 1XAIA 2HJSA 3FPGA 1U2SA 3IOEA 3M82A 4RXTA 4XWKA 4II3A 4RQTA 4FQ5A 5JECA 3ZNPA 1NUTA 1E66A 1I5RA 1MX1A 1ND6A 3ZK9A 3G2MA 3FDZB 1VPDA 4YRQA 3ZZNA 4DDWA 1HNWB 1ORRA 4KC0A 1J7KA 1TM4E 4TXJA 3SJZA 3OEED 2JBHA 1WF3A 3D6UA 4NHOA 5K4AA 1I7DA 4TYWA 4KO8A 4KRXA 1P0MA 2PTGA 1P0PA 4JT4A 3BSSA 4EKNB 1SULA 1W73A 2Q45A 2JNWA 2VAMA 3L1VA 1FY2A 2FX3A 3E1KA 3B5IA 4DUPA 1RHKA 1FZQA 5AVYA 5LMCA 3FYDA 2A84A 1CUFA 4PZ0A 4IHKA 2E6KA 4RHUA 1PNQA 3PIRA 4QBKA 1PK7A 4ZK2A 2O5RA 2EKQA 1RYMA 3TM4A 3BHJA 1JEQA 5A5GA 5K8TA 1HC7A 2QVCA 2Z2IA 3C1TA 2FW8A 2LE0A 3GRKA 5BSVA 1YB2A 2PX0A 3DHWC 3VKHA 4JSTA 1CETA 2X0IA 4QXMA 1UBRS 5LZ5A 2FHSA 3BWYA 1KYWA 1OIVA 3DBLA 3ZOZA 5AUOB 1KK0A 1MH9A 1ZBDA 3VJKA 1YBFA 1W2GA 4LQLA 1DFGA 2VLIA 4A8HA 2BLNA 2J9XB 3WLAA 1AKEA 3CLVA 3GXBA 3KOYA 3OF5A 5SZKB 1IXRC 1T5SA 1WV0A 1YCDA 1ZINA 3A58B 4KODA 2B30A 2I2BA 4M9ZA 4G25A 4P4UA 1XZCA 5GONB 1Y4AE 2ZJ2A 3GELA 1MQ8B 2VQ3A 4UHDA 5SV2A 4F5YA 4KAXA 3IVCA 4Y2PA 1Z12A 1EFRD 4HAXA 4LYJA 4AN4A 3L4JA 1GKKA 4QGSA 3H97A 1JE1A 3UJ7A 4E2YA 2W83A 1MX5A 1Z5WA 1VJ0A 2W6CX 1LTHR 4R01A 3ZZUA 2UXBB 4D82A 4PRYA 3R6TA 4X64B 2Z9DA 4ALNA 4LWZA 1DUIA 2QPOA 2BC9A 5IVPA 4ZT3A 2CT8A 3OQHA 3F49S 7YASA 3P4YA 1TIKA 4MKXA 1KI8A 3GPBA 2XF2A 4QXOA 4JLWA 2G71A 4QPDA 4G07A 5IW8A 4UE2A 2RAUA 3V55A 3WBFA 5TMBA 5C1BA 4R84A 3KR9A 1EZZA 2HPAA 2VXOA 2AJTA 3ANNA 3TO5A 2CNWD 3ZTTA 4YPOA 2EW2A 3HKEA 1YDEA 2R66A 1V71A 1T9GS 3OO0A 1GVHA 2WJIA 2XNHA 1C7FA 1TK2A 1T3TA 3ENZA 3LQ1A 2OLKA 5DCWA 5EZYF 2ILTA 3WOHA 3C2QA 4CJXA 2Y77A 2E3JA 2FZCA 3TS1A 2XB8A 2DBYA 1IN1A 1AKVA 1U28A 4K28A 1IVNA 1P6QA 2DHEA 1VRCA 1ZGHA 1SQGA 2I22A 2VF5X 3E0QA 3OCZA 3OT4A 5ENZA 3P32A 2GCOA 4AN0A 4EJSB 2VPXA 3RU9A 1QH9A 5DF1A 1FP4B 4IVRA 3A1SA 4A91A 3LLCA 2V7TA 1Z0KA 2YN4A 1DXYA 1G20B 2HF8A 1B16A 1M0SA 2X86A 4IICA 4MAAA 4DMCA 2Y67A 4B0OA 4BATA 2IIVA 4UAUA 3JAMA 2H1LA 2R1UA 3ZJUA 1CLEA 4MVWA 5TLSA 1CCWA 221PA 4ND8A 1FC0A 4PFJA 4ZANA 5FOUA 5JAUA 2H08A 4JT8A 3HY6A 3WI7A 3KXIA 4UUQA 5LD2C 3TUIC 1YZGA 4KXWA 2PSSA 3D4IA 1LXCA 1RLOA 3EIOA 4QU9A 4JLAA 1IM5A 3EGDA 3FIUA 2PL9A 1EBUA 2IC5A 1E8MA 1L5NA 3A1TA 3I8XA 3HLTA 7MHTA 5GM2A 3WS7A 3RAGA 1A88A 1XDBA 1CT9A 1QC5B 2JFQA 5GQSA 4YASA 3HC7A 1DIBA 1RMQA 3N5CA 4WECA 2PRZA 4WESA 2FXIA 1SU6A 4MI6A 1G4AE 4ZOLA 4ENSA 2OV1A 4B6JA 1KH3A 1NVTA 2CMDA 4O2AA 4DY6A 3ZW8A 1VG8A 1YRLA 4DJTA 1NP6A 2RBEA 5CVVA 2FLWA 4EY4A 4B17A 4KNWA 3RYIA 5DNYB 1VG1A 3DHEA 3JD1A 1Y3FE 1W0KD 1IN5A 2C9OA 3B6IA 3REGA 4B3CA 1GADO 1E4OA 2GNAA 2JD1A 2VRCD 1ORWA 1NT2A 3JQQA 4D8XA 5D6OA 3VMMA 5JARA 5T6MA 4KQFA 4YCLA 4UW9A 4JXJA 2YZMA 5E7MA 4PG7A 3Q8WA 2NNLD 5G3ZA 5IAOA 4J49A 1SBNE 3AETA 3R3JA 4YACA 4D44A 2PQMA 2ZS8A 4QASA 2HBYA 1JDUA 1KVSA 2DM6A 4N5DA 3WGTA 1NBME 2AJLI 5SZIA 2PD6A 1I2BA 1I1QB 2HOQA 1KAEA 1EVQA 1LWOA 1PTKA 2QM7A 3EG9A 3RUPA 3ZLBA 4ALIA 3KQNA 3D7LA 4PX2A 3K30A 5HRAA 2FK7A 4FFWA 3L07A 5BSWA 1JHDA 1GGJA 4NV0A 4XD7D 1IN7A 7GPBA 1X0XA 1GNTA 3W5UA 4YMHA 1OFIA 4PSKA 1ZZEA 1USVA 3PCXA 4CKCB 1P73A 1L5HB 3L7LA 4JI6B 4YT2A 2XGJA 1EXVA 1EWQA 3RKUA 2ZWOA 2XDQB 2EZTA 4QSMA 2BOVA 1XA0A 3EUWA 1HE1C 2PXAA 1JKJA 2ZSDA 4JS0A 4KSCA 4CW7A 3VYUB 1J6UA 2KLBA 3AF0A 3L18A 2FOLA 2JLRA 3H17A 4IOKA 3WO1A 2N75A 2PJDA 3CNNA 3NHFA 4HTFB 4P9NA 5T4EA 1H9CA 1GFSA 2JCGA 3GEMA 3LT5A 3ST7A 4DBZA 2XZTA 3A4LA 4GE3A 4JMPA 4HLQB 4ARAA 2VWGA 1Y98A 4M8SA 3LPCA 1XWFA 2Q27A 3AXSA 5G1OA 5HEKA 3HA2A 3MWFA 3D2AA 4HYQA 2GM4A 3VZRA 4KZPA 3AIIA 3CJTA 4XUGB 3LDHA 3TQCA 3G5UA 3WY9A 1MMFB 3H1EA 3GLVA 3Q85A 1VIVA 3A25A 3GCWA 2RGAA 4MWZA 4HQRA 2VUSA 2H57A 3HKDB 4RPHA 2I1QA 4YIKA 5DYWA 5FO1A 3AYZB 4HVAA 1ISSA 3BXPA 1T6ZA 1NKTA 5J2TB 1R6UA 1PR2A 2WVGA 3EXIA 1Q22A 4Q7QA 3KVRA 3THYB 2X22A 3SHQA 3L6RA 3H13A 1KJQA 2GKSA 4NX2A 3W90A 4KSYA 2GCPA 1GFIA 2C97A 3G17A 3QELB 5CD1A 3DFZA 2O5CA 4G5FA 3U9LA 2W2LA 1E3DA 4JNCA 2PYIA 4L8GA 1A50B 3F98A 1Q0QA 1JPNA 1SUBA 4O4IA 3I2JA 5EYPB 2R6AA 5FULA 5L3ZA 2PSEA 1RS0A 2GWHA 3FI9A 5CDYA 1F4VA 1TEVA 2FUG6 2RK4A 4ROTA 2HZ7A 4YMLA 4M7RA 3L41A 4BOYA 3KQTA 1PZEA 4JJGA 1FDTA 2AW5A 2DQ4A 3HFRA 1QZXA 2I76A 2B8WA 3F5SA 1W5SA 3BL8A 4TV9F 1EP2B 4IX1A 5HKKD 4HQ6A 2D6FA 3A3KA 3KEGA 5F1PA 5CFPA 4BGDA 5A6SA 5E38A 1CZOA 1Q1NA 3ZDEA 1X2EA 2X9GA 4FCWA 2Z4SA 3VZBA 4XGRA 3VI4B 3DPUA 1P5HA 5I8WA 5LWHA 2OMEA 1DX6A 5C8DA 4KI0A 3CNLA 2QVGA 4H1WA 3VV3A 2ZBPA 5I8PA 4IRMA 4LDJA 5B2FA 2XYRA 3I5YA 1L7VC 2VI5A 3PPVA 2ZI5A 3BSFA 3N8KA 3OX2A 4FHCA 4RMGA 3AEZA 4QBTA 1VL8A 2FPOA 3DH0A 3HCRA 1UXJA 2R8OA 4M8LA 4XB2A 1XD2A 2H29A 5JRJA 1XG5A 2OCXA 4POAA 4QD3A 5AW9A 4Q9HA 1F2TB 1J8VA 1UBCA 1FTGA 4JQYA 4BCBA 1QYCA 2XODA 4P58A 4KLCA 4GNRA 3K15A 3UFXB 4IX9A 4HYYA 1G6KA 1XALA 3TEJA 3MJRA 1Y6RA 1T4DA 2VS1A 4BZWA 3A6ZA 4YHHB 1LDMA 1XRQA 3JYNA 1K27A 4EQ6A 3MGKA 2WNSA 4H27A 2HMUA 4LECA 3T12A 4WW0A 3V8VA 2H2HA 1XNRB 3D3JA 3EASA 4M2LA 3U4QA 3MQ4A 1RZRA 4Y6RA 3AEQA 2AOTA 2VP2A 1SA0B 4JX8A 5T4FA 4NYIR 4DUGA 3WRWA 3TTWA 4NCXA 4D43A 3NP9A 4HFNA 4OYRA 4YT8A 3LM8A 3K0AB 3THXB 2VLBA 1JWAB 1HT0A 1XZJA 1NUAA 3NWOA 3OJFA 2MR6A 5K45A 3U7FB 1WKVA 3RRNA 3B5JA 2P9FA 1DNPA 2BTQB 3KYDB 2WAYA 4KOEC 3GLGE 3OM9A 4WLOA 3I9FA 5J1SB 3TW6A 5LFAA 1PR5A 1U5CA 1KERA 1TO1E 1KO8A 3IESA 4D79A 3D7NA 3G0BA 4HD8A 1NVXQ 3SEZA 2TMDA 2XB9A 1S2OA 4MUYA 4AD8A 1LS1A 1ZCFA 4R8RA 3RU7A 3I2HA 5KYGA 3CLUC 1Z6YA 3GPCA 4LGCA 3MXTA 5JJLA 2QQ5A 2DECA 1N1MA 2GPBA 3JQFC 3DD1A 3EDMA 4HNGA 2WSYB 2X0FA 2AXPA 2GXQA 1WTAA 4AZ0B 6YASA 1E6MA 3ZU4A 5JR3A 1OGIA 2HMYB 1HMPA 1J8YF 4D42A 2CJWA 4MVJH 4Q4LA 4JFRA 5CA1B 2FMHA 3K2QA 1GTG1 2I80A 3LVQE 4HI0E 3AESB 4Q4DA 4PG6A 3QYJA 5IN5A 3C3CA 1YB6A 4C29A 5JZMA 4RC9A 4MWTA 5JS2A 4DVJA 3KSUA 4MV3A 4IIXA 3C8MA 1ODJA 3AL0C 1Z0UA 4LY6A 4CIWA 1FTSA 3OIGA 1P6XA 4M6WA 1C41A 5EIWA 3ORQA 4C6TA 2YV4A 4WL0A 2F1JA 1EXDA 3ML1A 1U4NA 2VUUA 1XHEA 2IW3A 3EEBA 4OP2A 4R1PA 5KX5A 4ZOLF 2QMYA 3BQNB 3L7IA 1XF1A 3GJ8A 5G0WA 3UV3A 4E0BA 4K5QA 1C4WA 1JDBC 3G2KA 4GLJA 3F4BA 4B6SA 2GLXA 2JAWA 3NBYC 3UWDA 5EG5A 4DXHA 3QK7A 5F78A 2YOHA 5EXTA 1QB7A 5DI9A 5J2TF 5KQLA 1EM6A 3CE9A 3QGMA 5DW3A 2V6BA 1M2KA 4ZQIA 4COKA 5FUMA 4IV8A 1DAMA 4RH3A 4AUNA 2F55A 4AF7A 2HQBA 1AO3A 1GQQA 5TMPA 4X62B 3H86A 3EGXB 4MRRA 3RM3A 1RYEA 2YL2A 4EP1A 1MO3A 4YBZA 2OECA 5D86A 5L3QA 1HNXB 4ESVA 1F0PA 1MQ9A 1RRGA 2GYWA 1XZLA 2D5IA 1CVRA 2VDNB 2HEGA 4JEIA 4F06A 1WD7A 4HB0A 2RAPA 1VECA 2XUFA 4E46A 1N6OA 3HDYA 4FR2A 4D26A 1I9CA 2XA1A 1K2VN 3CIFA 1OROA 1HTTA 3NAGA 4NNJA 5CVEA 3DWFA 1XYYA 1QX4A 1YMUA 4G1BA 4UZEA 5JYDA 3L6OO 3IUMA 1JXOA 4RH0A 2EDAA 4UFOA 1MJGA 3ZHYA 2WM9B 2Z58A 2G9VA 1PJ8A 2VOJA 4LJ5A 4KUHA 2VDWA 3BXZA 1JG6A 4YRFA 5TMDA 4W5JA 1H3EA 2ONYA 1VIMA 3OLXA 3NORA 2H2FA 3F9IA 3NHRA 3WQQA 4UHHA 1OD6A 3IE1A 5IHPA 2ETXA 3RRYA 5C46F 1VKRA 2ECPA 2X6TA 3I8OA 2VK2A 4Y2RA 4Z0NA 3RTGA 2Z30A 2REQB 3WA6A 1F48A 2Y1WA 2ZDQA 2GJSA 1MXHA 4Q82A 1DTWA 5A5DA 1QYIA 3WMXA 2V03A 3ZWVA 5KSWB 4XYLA 4R2XA 2I6GA 2VNSA 3BDVA 3CZPA 5L7YA 2XLBA 1M6NA 2L18A 4LZOA 1VYHA 3IBFA 3PYMA 1VSVA 3ZS9A 1GCIA 4ID9A 2CDAA 3Q7RA 3SOZA 4C7MA 1I32A 4HVLA 2FYTA 2WJVA 5BSTA 2I1WA 1KH1A 3WGNA 3KV3O 5REQB 2I8LA 1UXIA 2NO6A 4P3YA 2ZSHA 1LCIA 1EHCA 3TQOA 4GLLA 1WD5A 4A16A 3CBGA 1E9FA 2O8DB 4C7OA 2Q29A 4YREA 3BWDD 5EMKA 1T1JA 3ETLA 3JQPA 5E6SB 4HEQA 9LDTA 2FX5A 1EUCA 1EFVB 3KVYA 2YV3A 1ZGZA 5FBRB 3HRIA 3JQAB 4D97A 1BXGB 3PNYA 3GGOA 3OE7D 1L8XA 4HLUA 3EOBI 4LPKA 4TKZA 3N70A 4H17A 3K09C 3LU1A 1D4FA 4WA7A 1VJGA 3F5QA 3W7BA 4CBVA 3CR8A 1RT9A 4EHAA 2ZP1A 3QLJA 3HZZA 2IODA 2ENWA 3W3AA 4E33A 4RANA 4YRKA 2AG6A 3BWVA 3A14A 3UFBA 3ULKA 5KU7A 4KTVE 4FR5A 1CZUA 1PJ2A 1U0TA 2D5CA 3HBMA 1HDGO 4TLLB 3TUJC 1KI6B 1X9HA 1X7ZB 1CB0A 2H5JA 3OCUA 4I5GA 1KJYA 3RDPA 5EJ7A 2OZLA 1TF2A 2QL5A 3JQEA 2C0PA 4ZT2A 4EVSA 4JV5B 2Z6QA 1XTRA 3P26A 3AL3A 1NC1A 3FTPA 3TLBA 2F4VB 3BTOA 1FZTA 3G1UA 3AUAA 4JELA 1MB9A 4KN6A 1AO0A 2VA8A 2CMHA 4BAUA 3VH2A 2OILA 3NQ41 4LJ9A 4CIVA 4Q19A 1ZMRA 2BGJA 2FFQA 3I9V6 2W4IA 3KDSE 2RHRA 2WD7B 2BGMA 1RXSA 3NPAA 1PFGA 4HS4A 1W8IA 4I4TB 1US8B 2QP9X 2V5AA 4NK5A 5FF9A 4MUJA 3HP4A 3DLPX 3DDNA 3OZWA 1KS2A 1V4VA 3R41A 4WBNA 2V7EA 2Y4OA 2FMFA 4CQNA 5BNIA 3WKDA 1V5IA 1ZI9A 4PEVA 2UXCB 3G1TA 5H3HA 2CDRA 4UFNA 4R8KA 4YN3A 4MUBA 1RZVA 2FN4A 2AXEA 3DFKA 3S68A 3JPYA 2EOAA 4NI5A 2W2TA 3I32A 1EJ2A 3OT5A 3K5IA 4KOAA 2AJ8A 4CMBA 3HBJA 4ML3A 4CEHA 1W1UA 3WGIA 1WR8A 3RFTA 2H54A 2JC3A 1TQ8A 5BSKA 5ALIA 4OGGA 2QTRA 3NC4A 4V03A 5CFMA 2YWHA 5KNDD 3WYAA 4OY3A 1WQ3A 1XTVA 1GT91 3CX7A 4FW8A 5KB3A 5I8ZA 5A4KA 1IXKA 2PQ0A 3P9IA 2PA3A 3EUAA 1GRQA 4QGGA 3OPVA 4YRSA 1DG3A 4J2OA 3FUUA 2OWDA 4DNFA 3C5HA 2M1ZA 4YJ2A 5DB4A 4D4IA 1CQIB 3DW1X 4JB0A 4MZXA 1CJKC 5HQ3A 4QU5A 3UAGA 3AUKA 2QRHA 4RZ2A 4E09A 1RM4A 4AJIA 4EY8A 2CHEA 1SOWA 4P4SB 4OGWA 3T4PA 4CM9A 1IQPA 1FRVA 3EQ6A 3FF1A 1YFZA 3KL2A 3OI7A 5EC8A 5EE3A 4MCIA 1SC6A 3IQZA 5E0KB 2AKYA 1MFPA 3L79A 1SEVA 1RYBA 2NU9A 1XV5A 3PNSA 5EXDA 2VRWA 3PG5A 2P9GA 3ZE0B 2B8TA 2HMVA 1ORTA 2RMKA 2V98A 1YIOA 3SYLA 1OZAA 2V1UA 5DLDA 2YMLA 3L8FA 1E0AA 3F6BX 3KKZA 3OCCA 4TTJA 2G6BA 2HRBA 3N53A 4P98A 2FP4B 3GL9A 3SP1A 5JZBA 4HNQA 5C32A 2W6OA 2QMHA 1NSYA 4OKIA 3HNPA 3O03A 1ESZA 1RXCA 4QICA 5TS2A 1LSJA 2X0JA 4LDQA 1XRNA 2FOXA 3GMSA 3KJQA 3I73A 3KZKA 2X8LA 4GPIB 2ZWPA 4OXIA 1ZM9A 1U0SY 1JDJA 1WXEA 2Z2ZA 1KXJA 3KC2A 4UAGA 4BDTA 4JU9A 4RTMA 4EO7A 4MQ5A 3FHCB 4F6LA 5JS8A 4MVCA 2QBYB 4UBIA 3D2BA 3U31A 1U0HC 3B6ZA 4D25A 3MWKA 1YNSA 1Y3IA 3K8YA 4JKOA 3FTFA 4C01A 2GK3A 2AFHE 4QEDA 4ZMRA 3HM9A 3H5RA 4Y8VA 4ZV9A 3IUSA 1NXSA 3AG6A 3PRKE 4HB2A 5P21A 3D6FA 5TE9A 1H6BA 2C94A 3FPEA 1ZD8A 3O2JA 4FZRA 3TOZA 1HE8B 1ECJA 4FBLA 3TRJA 4B7AA 3U60B 2ZJ0A 4XFKA 4PR0A 4BMOB 4ZC8A 3FETA 2GM9A 3AI2A 3PTLA 4NULA 4X9XA 4ZOBA 1JLKA 1N8NA 2WWRA 3B6MA 3G0GA 4M0KA 4N12A 2R4UA 4G0XA 4NRDA 2VSOA 3TSWA 4KW7A 1DO8A 1DZIA 4XWTA 5TGZA 3DOCA 4J90A 4DEYA 2HU7A 1T5IA 3PFGA 4E15A 1QFZA 4EG7A 4N6OA 2XOKA 1JR4A 4LYYA 1W29A 2J85A 1CERA 2P67A 2DFNA 1ACJA 4HWRA 3WL4A 1GOTA 3QQPA 5EFZA 4DVGA 4LNUB 5TQ2B 4A92A 1EU1A 1FP2A 3OJ0A 3MWDA 2VJMB 2MTBA 4IMPA 3GLHB 2JCYA 1UEIA 1EQAA 2JZCA 1JH9A 3DUFB 3C8UA 2QAGC 4G01B 2DXIA 1JAZA 1SELA 2P6PA 4I1SA 1YQEA 2FWJA 3PUVA 1XZPA 5DTMA 1PV1A 4HDQB 1JEOA 4IQ8A 5M34A 4WWHA 1IYZA 3Q41A 3ZGVA 5T8KC 5K6RA 3DULA 4JU8A 3WIVA 1ZHOA 2B1RA 3IQEA 5AJWA 5DE3A 2COEA 1H3FA 1OZHA 3FE2A 5EJFA 3ND6A 3R20A 4ERNA 2BLLA 5D7BA 1YR1A 4XQ9A 1Z13A 4CMIB 4U2BA 2Q28A 1AX9A 1SWWA 2WAMA 4CV0A 3PTAA 4LDZA 2IHVA 5EEHA 1P29A 3P20A 2V9PA 4MVJE 1QF6A 1LVGA 1YOBA 1Q1GA 2MSEB 2PCLA 3P97A 4GF5A 4NXNB 2XIQA 2O8VA 3KG2A 2QXUA 3DMGA 4DPKA 2HF2A 3U6KA 4AZ3B 3PDUA 4MVXA 4JJKA 4BCCA 3USCS 3L0DA 2BFNA 1D4AA 2O7RA 1BNCA 3GCXA 3JQAD 4MYUA 2UUCB 1KO7A 2IEBA 5TS3A 1ZJYA 1U98A 1DJMA 4JQOA 1XL1A 3PFNA 4QARA 2C8VA 3CW8X 2WIFA 3K9BA 4LDPA 4UJ3A 3NASA 2QMZA 3P0RA 2QY6A 2HBQA 3KT6A 3I52A 2VHUA 3CU5A 3Q11A 5DHPA 2EW8A 5BMOA 1KRXA 4E94A 3O3MB 1OA1A 3ZY2A 1VOTA 3NIGB 3NRBA 5JRDS 4B2LA 3WRXC 1E5LA 2R1VB 3ESRA 1ECBA 2ZT8A 1MX9A 4RTRA 4B31A 2XDAA 3ROQA 1SK9A 1H1DA 4OBEA 5K0LA 1FQOA 3ENNA 4HP8A 3SVLA 1XHLA 2OV4A 3K2BA 3SNHA 5HM6A 5LYJF 3VC1A 3EXFA 3EZNA 4JSRA 1CZNA 4BLQA 4Z2YA 3GT4A 2AD5A 2P8JA 2VDQB 3BHNA 4D3SA 5IT4A 3CVVA 5AI9A 2PPVA 1KVUA 5I6DA 1P4SA 4D9HA 2Q3EA 1HL3A 1HFJA 1JDPA 4Q16A 4XJVA 1PK8A 4FFSA 3QI7A 5JI3E 3BMOB 4ZIRB 3T6KA 2M6SA 3U80A 1WBJB 3P9NA 4OHRA 7ABPA 4H7PA 1C4KA 3X1ZA 3FHJA 1LWNA 3GP3A 3FGZA 4LVCA 4ZEMA 4AP5A 4ZYTA 3RUDA 1RHQA 2LVBA 4HAWA 2YRWA 3ROTA 1EJ0A 3FYCA 5L7TA 3WSVA 2B9VA 4IFTA 2ORVA 2WWYA 1EINA 1H0KA 3T3IA 1XNHA 2P5UA 1GGHA 2YY6A 4OLBA 1V1MA 1R4AA 3DE1X 1YB4A 2NTYC 4ZGBA 2LRHA 3HL4A 3KJIA 1M8PA 2QG4A 1QHXA 1QAOA 3I9JA 1R50A 4GKJB 1DG9A 1KQ3A 2H0QA 4RCZA 5KTSA 5TT0A 4BQPA 3GJ6A 3KXLA 3AVYA 4KPUA 3LH5A 1FQKA 1DOHA 1IHDA 1AQUA 1VLVA 4OOEA 5H9VA 2PAFA 3HGMA 3TTUA 2EFHB 2ZI7A 3P5BA 4N54A 4WBNF 1CUYA 2OD9A 1ODCA 3F6CA 3QPUA 3AI7A 2WWWA 1GEEA 2ZCVA 3K32A 4YRLA 2DAPA 3HB1A 1Y4ZA 1JHUA 2AXNA 2D59A 3A9WA 3OZUA 1BIFA 3ZCSA 3NVKI 2NO7A 4J8PA 3ZPXA 1KIAA 1RRCA 1OXBB 3SOPA 2WAAA 4V24A 5EWLA 2BEJA 4DG8A 5AM4A 4M37A 2IHKA 2BFOA 3LRTA 5E9QA 5KO2A 2NZVG 3OEEA 5ELXA 4D9IA 2QE7D 4XYBA 1V16A 4TQ9A 4LQCA 2WP0A 2ZZKA 1Z22A 3P9ZA 2PL1A 4EK9A 4YR9A 3B7GA 1JI0A 3IE0A 4MEAA 4B3JA 3W04A 1IWOA 5ITSA 4BL5A 1O94D 5AQEA 2P3OA 2P9CA 3BORA 5ALKA 1Y37A 3WV5A 5AVUA 1OILA 3WHKA 2B0CA 5H68A 4YP1A 1K5HA 1KMHA 3K0CC 1V7PC 2YWBA 4XWAA 5CT5A 4CLRA 3FMIA 4O59O 3QA9A 4N9QA 3ANTA 5E6UA 2ZBQA 4E70A 1XNJA 5ALMA 3G0CA 4F6RB 3Q8XB 3HVIA 3M33A 2H8GA 4JXKA 1OFTA 4KU4A 4LBZA 4NAVA 2CL6X 4D57A 3JW8A 1O6CA 3GUZA 4M99A 2I1LA 3I62A 1AM4D 1DBRA 1IUKA 2Z9CA 4US0R 5HIMA 4RKQA 2C5EA 3UHFA 3VKVA 3WNCA 3SHWA 5BSEA 5JADA 2WUGA 3KU1A 4LZNA 2BGUA 4KQIA 4E88A 1SN7A 3RBXA 4CZ2A 1ODIA 4DS3A 4HC4A 4IIDA 3Q87B 4EW2A 2XHEA 4UTRA 3SZGA 1W85A 2J46A 1P44A 3LX5A 1P7CA 4C14A 1YQ9A 4YCAA 3VU1A 3MPOA 4PC3A 1EFRA 2IIBA 4DCJA 3KYJB 1IE3A 2X2EA 2ZRPA 3FPAA 4CM4A 3EVBA 2OBLA 5KTMA 5BVGA 3IKTA 2ENUA 1G19A 3INTA 1CVIA 2P2NA 4BNJA 1LU9A 2ZTSA 3L9XA 3ICQB 5AK3A 3LUAA 5KTPA 1CY8A 3UYKA 1ZVJA 4AXBA 3NBXX 1Y9EA 4FEGA 4BFTA 4EZBA 3H9CA 1NG9A 1DV2A 4DEXA 1RWOA 2RHDA 6LDHA 2D1FA 5AIBA 2X6QA 4D98A 5HA5A 3CRMA 2YJ6A 4GM4A 2XNKA 3ZBQA 3HCOA 4IH1A 2ZTVA 4IDFA 1Y33E 5ANRB 3GVPA 1USGA 4ALJA 2CNWA 2BYTA 1PHPA 4BNMA 1ZMOA 2EFYA 1PE0A 3KE8A 1O54A 3S2GA 1F0NA 2HIHA 4JY7A 1Y9JA 4RTJA 3M1LA 1MGOA 4G41A 4RWEA 3K0HA 2MINB 2C59A 3C5VA 3FOZA 4JBGA 3C3XA 3QLUC 5JNSA 4H77A 5FWDA 2CSUA 3L7OA 4V1CI 5KUTA 1FNCA 2X9QA 3KZOA 1YR7A 4O2BA 2JIDA 4H6PA 1Y8RA 2IQ5A 3D3KA 3RPEA 3TLCA 1YU6A 3COZA 2VH5R 3G9TA 3IQFA 3ER9A 1R12A 1C3VA 2YDXA 3K5WA 1VP3A 3L0BA 3ND9A 4IDAA 2WM8A 1G8PA 2RG7A 1JSLA 3B2QA 4M21A 4MLPA 5TY0A 3SS8A 5IULC 4UATA 3ZHXA 3A26A 1O95C 2AT1A 1GITA 5DULA 3BJEA 4Q01A 4B4VA 5CX1A 2HPHA 1AF4A 4M98A 3Q9NA 3RAJA 2JEZA 1E0DA 1SVIA 1BD4A 3TE7A 3GRYA 3V8BA 4B80A 1KJZA 2WPDD 1OCEA 1QS0A 5CNKA 3EQ9A 4DF3A 4DQ0A 1YS4A 3C74A 1Y8QB 4Z1MD 1RQXA 1YRWA 2IVFA 2G0TA 3OQIA 3IV6A 4RHCA 4ZT5A 1XRJA 2JFHA 2PPLA 3L0IB 3M70A 2F1OA 3TR6A 2H2GA 5DLPA 1X14A 4PGMA 1XEAA 3RJMA 2PM8A 3BKXA 2GILA 1Z7GA 3T7SA 3PDWA 3PUZA 5CGZA 2OFXA 3RREA 4G09A 5I7RA 3LKVA 3BA6A 5HBRA 4EUKA 3OKAA 5B1YA 3I28A 3ME5A 1CZKA 4OHFA 1OU4A 2ZYHA 2QGNA 4I9NA 5JY6A 5KS2A 4LHWA 1A4UA 1XSEA 4HUQB 4JFAA 5KAMA 5AJTA 3GQVA 1E2IA 3QEJA 4DUZB 3D8HA 1E9DA 4MQFB 1EP1B 1W5BA 1KYYA 2QGZA 3BTSA 3CZRA 3HM2A 5AHRA 1OVGA 1TRKA 5TARA 1W0KA 3VNVA 1NR1A 4BB5A 1W30A 4UVHA 3WBJA 3WWZA 1I13A 4CF6A 1EE9A 1PHRA 3CUEF 3IA2A 4Z53A 4QEKA 1NV8A 4PLZA 4FJ1A 4NBNA 2ASVA 5D5PA 2MJLA 4MYDA 4ZJYA 1OXUA 3EIFA 2H9IA 4B85A 1J9GA 4F7WA 5IDYA 1NYLA 2BHLA 2XXJA 1P60A 1XEWX 3EGEA 3E7DA 1SXPA 4F3TA 3MVEA 4K46A 2WZCA 3LCUA 4OBXA 5C9ZA 2OQ2A 4Q7KA 4KAJA 3FFTA 3UMYA 3CNBA 5HVNA 1P1RA 3PUWA 1QU3A 3L3BA 3PC4A 1I6LA 3VO9A 1PS9A 3IYLW 2BI4A 2COKA 4BP8A 2WTNA 5FEMA 2O2CA 1XJWA 1Z82A 3BMXA 5ALWA 3I92A 4BB0A 1BMFD 2W7TA 3GDGA 3UAZA 3D3WA 1MRSA 4DYDA 2A9KA 3H65A 4TGLA 5JQGA 2QX6A 5JU6A 5KYXB 2MWMA 3U4IA 4KSBA 3UJ6A 5JD5A 5DMHA 2Z2YA 3GIDA 1X87A 3SJCA 1BDIA 3DVAB 1IU9A 2BM0A 1U81A 3L1IA 4C7JA 2KQUA 3A1UA 1PYDA 2I2XB 1XD9A 1N2JA 1QVZA 4ZREA 3WMRA 1EPUA 2MOKA 4AG3A 4L6CA 4REQA 3WQBA 2VATA 4MAMA 1K3TA 4J3NA 3KTAB 4GMGA 1FBTA 2VK4A 3IMKA 2Y76A 3OM8A 5IVHA 3LDGA 1HH4A 1QIHA 3WLHA 5IM4A 2BJVA 4XYGA 4F93B 4RDXA 4E51A 3HEBA 3V7NA 3MWYW 4K0KB 4Y1RB 3GFRA 4ZN6A 3K1AB 3FDZA 2BGLA 5MFPA 3ADCA 2EKPA 4HN9A 1YAJA 5LVAA 1NPDA 3N6VA 3SEQA 5K4HA 4Q3BA 3TOCA 4FE4A 5HIJA 4EENA 3HYTA 4HDRB 3PNKA 3DXXA 3ORYA 4GZ5A 4EO4A 3U44B 1GSOA 3AUJB 4A9AA 1RJDA 1CUZA 2ZB2A 2O1SA 1NE2A 2C7OA 4EMTA 2D3TA 3EXHC 2FEWB 3TPZA 5K6AA 1ZK3A 3HFSA 4R98A 3RLFA 2VA9A 4I3GA 1XMQB 5EKTA 3NWBA 3LAWA 1XC7A 4MKHA 1TUIA 2B20A 2VP3A 3C6MA 3IJPA 1K06A 1O58A 2VUHB 1XB2A 4HDOB 4P2BA 4WEOA 4YP6A 5FPTA 3H5AA 3U56A 5C7LO 3ZDAA 4TMTA 1ECGA 3E4DA 3DFIA 1BEZA 1RKVA 3LYUA 3V8RA 1N0WA 4AKSA 2FFBA 4CDNA 5IS2A 2QV7A 3BMQB 1GNVA 5GONA 4O3MA 1OREA 4F1JA 4DMGA 1TXGA 2VNIA 4IEIA 3E9NA 4LXHA 3VHLB 3ESBA 5JXGA 4M83A 4Y6SA 5IBQA 3J80A 1R8XA 4UM9D 1QIFA 4B3BA 3AP3A 1NASA 5G1NA 3UGTA 3P9QA 2OLJA 5HKKA 2GN2A 2GPTA 4LJSA 4HUJA 1L5RA 1KJWA 2CUKA 3OIYA 3KFLA 4J0CA 2ZM5A 2QU8A 4MDFA 1GARA 1VSTA 5ICFA 1XQ9A 3ORHA 2VBCA 3KJZA 2CHQA 3I04A 3KOZA 4MWEA 2FSIA 2P3SA 2X1VA 4RVOA 4RJIA 1S7GA 3CUUA 1I3LA 3HHEA 4BNVA 3E0XA 1P62B 4ARBA 2YFHA 3EUFA 2FI1A 2P69A 2GK4A 3W5DA 1E79A 2Z5LA 1OV6A 1P2FA 1EK6A 2JARA 4IDEA 1MQAA 4N6NA 3O92A 4D8TA 1HM5A 1Z5VA 2PGOA 4UAJA 1MO4A 1FVFA 3GNSA 4AY3A 5CCBA 5ALFA 4XAQA 4CWAA 4JIGA 3EHDA 1T13A 1KZ7B 2QRVB 2OUKA 1X1SA 1UINA 2FVXA 2IUTA 5I3ZA 4XJTA 4RJLA 3T5DA 3TFQA 3CRQA 2BKLA 4GBMA 2PVPA 3C7AA 3GAZA 4MLCA 5EHGA 3WTBA 4EJSA 1V9SA 3ONNA 4A6PA 4OK3A 1FP4A 4Q1VA 1KFEB 5GMOA 1QIJA 1G20A 3QVSA 1KQGA 1SQ5A 3QMWA 1SUPA 3FGNA 4G5SA 1Z4LA 2AFIE 3PEFA 3WOVA 3ZWWA 5I51A 5DN6A 1ZMTA 5C5EA 1M1XB 3ROFA 1Z83A 1XTZA 1E59A 2BDUA 2FWRA 5C4GB 3LWDA 2QRNA 2HLDD 3FOEC 3TINA 2G4CA 2OFPA 5K20A 1NOIA 4DB4A 1Y7TA 1LFAA 3D7RA 2RJNA 1E9CA 4I7EA 2J4DA 3DEJA 3KWLA 3HXLA