2WBLC

Three-dimensional structure of a binary rop-prone complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
175
structure length
167
Chain Sequence
RFIKCVTVGDGAVGKTCMLISYTGPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPGIPIVLVGTKLDLRDDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D Structure of a Binary Rop-Prone Complex: The Final Intermediate for a Complete Set of Molecular Snapshots of the Ropgef Reaction.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
molecule keywords RHO OF PLANTS GUANINE NUCLEOTIDE EXCHANGE FACTOR 8
total genus 56
structure length 167
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wblC00
4EIWA 4C30A 4TT3D 3QJYA 2OBNA 2WJVA 1SKYE 5IK2A 5SZIA 1NVWQ 4D4LA 3QUSA 2QZ4A 1ZCAA 2GNOA 4Q4LA 4TLDA 3J81k 1FTNA 1KKMA 4B6FA 1G8YA 2GJKA 2WWIA 3DM9B 3OIVA 1KMHA 4JYBA 4TYWA 4LJ7A 1UEJA 4AG6A 2QAGB 2ZJ5A 3IPXA 3QF4A 3VHXA 1G5PA 2RCNA 2VPPA 3GEHA 1WBDA 4O25A 1XWIA 5F9FA 1EX7A 2WWFA 3MD0A 1G4UR 4QBFA 4M1WA 2E9SA 1L2TA 1EX6A 1Z29A 2ODEA 2GDJA 2C95A 4BLTA 4LPSA 1JNYA 1TL7C 1TQ2A 2EWVA 4L5BA 4YDSA 4A0GA 2LKDA 1GNRA 2VTKA 2IW3A 1Z6YA 4ZPXA 4UNSA 1VG1A 1S1CA 3ZVRA 1KJWA 4GOKA 4P33A 3MWYW 3EIHA 1KMHB 2PEYA 2QP9X 4ARZB 2A78A 2D7DA 3RYTC 2ZIAA 4NCKA 2WHXA 2A5JA 2BCGY 3BAFA 3CBQA 3P1JA 5DHAA 2VP2A 2VHJA 3DM5A 4BWYA 3MG9A 4Z51A 5SZJA 1KZ7B 3GLHB 4BFWA 4PAMA 5FPKA 2FZ4A 4MYCA 4A8JA 3EIEA 3AVYA 2CHVA 4HZIA 1GILA 1Z6XA 1D9ZA 3NBXX 1QBKC 4WIAA 5JS7A 1X8KA 2C78A 2KB0A 1XPRA 1CRPA 1RRGA 1S2MA 4HDQB 1JXOA 4JLVA 2QPAA 1JJVA 1KO5A 1XEWX 4LY6A 4B3BA 2ZUBA 3NH6A 4KSBA 4Q9IA 1T3HA 1LF0A 2ZE6A 3ZLJA 1T3LA 2W2VA 3VNVA 1L7VC 1OW3B 2JLXA 2WKQA 1KHTA 1KZGB 1XDBA 3AUYA 1OSNA 2J0SA 2WBLC 3CW2A 3I4LA 4P4SA 5DE3A 1TU3A 3GEIA 4Q01A 3RDPA 1VIAA 2WTUA 4QOSA 1RFLA 1KY3A 2W58A 4NHOA 5DNYB 4JLBA 3B5JA 4CYMA 3IEVA 2Q6TA 2ZE8A 4LJ8A 3IILA 1E2PA 4D4MA 2DR3A 3KX2A 2QSZA 1TQ4A 3NXSA 4GMXA 1W36B 2JLZA 4R2HA 4Q1AA 4DCUA 2ZS7A 2PLRA 1YZQA 1Y63A 3KKOA 5HE8A 2KI5A 2VSOA 5TV2A 4RZ3A 1N6IA 2G0TA 5L3VA 1G1MA 1UFQA 4JYCA 3NEJA 1NN0A 3EIQA 4PAOA 2GXQA 3ASZA 2ZSFA 4NE2A 3TLXA 5E3HA 3K70D 5FTMA 1UPTA 5BN3A 1MT0A 4HSEA 4TYPA 1QRAA 1M2OB 3T5DA 5BXQC 4RD6A 2PBRA 1AZTA 3FB4A 4TTRA 1G3UA 4Q4HB 3UMRA 3BB4A 1IN4A 4N3NA 5JRJA 3D31A 4PX9A 1UKVY 3AVWA 1M7GA 5B30A 3M4YA 4TL6A 1KK3A 3PFIA 2J7PD 3D7MA 3OEEA 4D26A 4HLUC 4OQMA 4XWKA 3ONWA 1P4SA 1W2GA 3AVXA 1ZYUA 1OB2A 3W5JA 2LKCA 4EPWA 4CRWB 3AKCA 4KFRA 2CK3A 1OHHA 1OF1A 1OKKA 1NN3A 2ERXA 3BIFA 3BOSA 1RW4A 1GITA 1P62B 2WWGA 5JCPA 2ZE7A 5KSPA 3BFVA 5KSZA 5UKDA 1TU4A 2F1RA 2IEZA 2BMEA 3CWZA 4H9GA 4RZXA 1TMKA 2FFHA 1XPUA 2YHSA 3A6PC 3T1TA 1KAOA 4HZUB 3TUZC 3PEUA 1F60A 1CR1A 2ERYA 4N0DA 4P4SB 1ZCBA 2GETA 3W6NA 2D2EA 2CE7A 4FMDB 1HEIA 3Q5EA 5FOVA 4EPRA 3EC1A 2OBLA 1YRBA 5EE3A 4NBSA 5H70A 3MLEA 5EE9A 1PUJA 2IYXA 4TSFD 3GLIB 1DELA 4FCWA 1P2TA 1FP7A 4AKEA 3FYHA 3B2EA 3JVUA 2GJ9A 3EZ6A 3KKNA 5DN6A 3VR2A 3LQRA 1N3BA 1RYFA 1H65A 2VHQA 2IYZA 1E9EA 2H18A 3BWDD 4R71A 3REFA 2QGNA 2RGBA 3TJZA 2PT5A 2R6GA 3GMTA 4I1VA 1YZGA 3D8BA 3NBFA 2QE7D 2OESA 1D2NA 2V1UA 1OH8A 4KFUA 3W3AA 3PXGA 2AN9A 2VO1A 1E9RA 1TPZA 2ZJOA 1KI1A 4OI2A 2QN6A 3Q9LA 3VMFA 4YXWD 2XZOA 2BWJA 3DKPA 3IBYA 2AFHE 4HAUA 1JQJC 3K70C 1XXHB 1Q3TA 2BEJA 2QORA 3THXA 2AKAB 1KTVA 2O8EA 4V03A 3L0OA 5DGXA 1G3RA 2ZSAA 3CX8A 4JJKA 2ZQ5A 3RSLA 2HT1A 4AY2A 1VG9B 3PIRA 3K0AB 4NYJR 4HEJA 4HLUA 3NG1A 2O52A 3FDIA 4L8GA 2ZRPA 1J70A 3BGWA 4KV9A 4LYHA 3KXKA 1ZRHA 1G3MA 1XXHA 2L0XA 3NDPA 2HJGA 3T1VA 2C77A 1P2SA 1W36C 1R5OA 1IXZA 3FFAA 2B92A 3KL4A 4TN1A 4DUGD 2P6UA 4DIDA 3WYFA 2NO6A 4PPQA 4FMCB 3FMFA 1PVOA 2RGNA 1Z0KA 2WM9B 2QAGA 3QF4B 1JALA 2WJGA 3C41J 1Z07A 1E9CA 1KIMA 1XEFA 3L0IB 3LX8A 6Q21A 3G0HA 1SGWA 4TYNA 1WXQA 1YHNA 2V55B 4B34A 2XOKA 1U8AA 5DH9A 4AWXA 2HT6A 4PSKA 3SJCA 4F92B 1XFAA 2OCBA 3PUVA 5ANRB 3X2SA 3QI2A 1GNQA 4A9AA 3CONA 3FHOA 4K46A 4RY2A 1T0JB 5AR1A 1MO3A 3PG5A 1EFUA 1HT1E 3AKEA 2RMKA 5GVSA 4GT1A 1AS2A 3GJ7A 3FKSA 3IHWA 2WOJA 4LHXA 5FR1A 4JLMA 5FUXA 4KLNA 2OSBA 1AS3A 2NPIA 4W5JA 2CHQA 2MSEB 1HUQA 3TR5A 2EFCB 2CEAA 5CYOA 1KO1A 1VCNA 4EAQA 4Z8YA 4Q4AB 4QHTA 1GZSA 3DZDA 1U81A 4XVRA 1G8PA 1AZSC 1EFHA 4LX0A 1E98A 2Z4SA 1Q12A 1XEWY 4U7DA 4EPYA 4MRSA 4LCBA 2ATVA 1G7SA 2OCYC 5CM8B 4IRUB 3E1SA 1KSFX 3E5HA 1NP6A 1ZC4A 2OAP1 1ETUA 4BE7B 1SXJD 3BS4A 2HF9A 1E2FA 1H8HA 3CNNA 1GM5A 4H1UA 4MRVA 1PLKA 1XJCA 3BBPA 5B58C 4JKYA 1QHGA 4PHGA 1IY2A 2ZRLA 1VCIA 2FPLA 2KJQA 2P3SA 2W6JA 3U3RA 3DOEA 1XEXB 5E95A 1P9WA 3RWOA 1PV4A 1N6LA 3K0FA 3ZJYA 3BH0A 3RABA 3TNFA 4Q19A 2GVZC 1GKIA 3B8HA 3QNUA 2GXAA 4F91B 1W4RA 2ZITA 2C04A 3UPUA 3SBDA 1MO6A 3AVQA 4C0HA 1OHHD 4LOAA 4Q5IA 3B1WA 4X8MA 2YWGA 3CWQA 4IDHA 3SU8A 1DO2A 1G17A 2PZGA 2YNMA 2G9NA 4DLVA 2KE5A 1GKUB 3QXSA 4GPTA 2DPXA 3IGFA 5L8VA 1T3SA 3HU1A 2IS6A 3X1WA 3RRMA 1OB5A 1Q1QA 2HCJB 3MSXA 1HYQA 4B35A 4YMUA 2WIAA 3AV0B 5FOSA 1JR3E 4CZ2A 3IO3A 1Z0IA 2B8TA 2ZRFA 4M8NE 2A5DA 5GJBA 4W5HA 4NCJA 3L43A 2I1QA 5FBQB 4JS0A 2C03A 3B1XA 3DDCA 3EPHA 3DVLA 1C1YA 3RLFA 1G3QA 4K81B 1XTKA 2J46A 4ZV4A 5EUQB 2ZJYA 3OFND 3ND8A 2V1XA 3U3MA 1M1YE 2C9CA 4PSVA 4OHWA 4V0OA 1WA5A 4DCVA 4TMWA 4O3MA 4IOLA 2GCOA 4M9ZA 3VFDA 2PMDA 3G82C 2XSZA 5CYPA 1IAQA 4MUBA 4BQSA 1E3MA 3TUJC 1A2BA 3CF2A 4TL8A 2DB3A 2ZS9A 2LCFA 4WZ6A 3W8NA 1G64A 3CF6R 2WOOA 4US0R 3Q7QA 3HYRA 1XNJA 5JJIA 2B7CA 1GOTA 4DWJA 5KO2A 1EXMA 1PJRA 4DLUA 5HKKA 5FTKA 2CMKA 5FUVA 4BFYA 5KNBA 2MSCB 5FBRB 4TQUS 5TVKA 3M1IA 1Z63A 3VKWA 4TTPA 1OXVA 5E7IA 1A7JA 3QOFA 4HAXA 4AD8A 4D0NA 3SJZA 2GBLA 2G1JA 4FN5A 2WKRA 5SZHB 5CB6A 2Z83A 3A4MA 2J7PA 3MFYA 1XCPA 1E94E 3BB3A 4JLAA 3MRSA 4P3YA 3CM0A 2QRNA 4QXAA 4MKGA 3DHWC 4Y0VA 2VIIA 1VG8A 2BKEA 2VP6A 3NC0C 3K0EA 1S1MA 3ZDQA 1GL7A 2N42A 4Z54A 4HB3A 2GAOA 2XTNA 2OAQ1 4ILEA 4PAQA 3PVSA 4DLYA 4PQFA 3KFXA 4RD3A 2CLCX 4TT3A 3QKRA 2XSZD 1GSIA 2HUPA 3IHLA 2NO9A 4PC1A 2IUUA 1XZQA 2YWFA 1JR6A 2WMOB 1GDDA 4YMWA 3PEWA 5KTYA 3MJRA 4UNPA 2JDID 4FWIB 4WVFA 4GZMA 4ACAA 4QHSA 2D7CA 1XTIA 2PZEA 4JLDA 4MRRA 1DARA 1JI0A 4GRAA 4Q47A 1W48A 1KO4A 2X77A 2ZE5A 1YR7A 2FNAA 4BECA 4PC2A 2VSXA 3FGNA 2QY9A 3MCAA 1RIFA 4ZIRB 3M0EA 1GIAA 2QMUA 3AVOA 2IF0A 3PUYA 5J40A 2WWYA 1UM8A 4OJQA 1JJ7A 1OV4A 4HZUA 1CLUA 4DLXA 2B6HA 1FZQA 4ZDKA 2HYIC 4MDEA 2FGKA 2HLDD 4TLEA 5EZ5A 1GUAA 1SVIA 2GZAA 1EFRD 2JATA 4R98A 5CB8A 3NH9A 1XU4A 5CLQA 2IYUA 1KAGA 3IDQA 5A4JA 4PZLA 5AJVB 1FX0A 2NO7A 5E4FA 2DHRA 3AH8A 2PX0A 3OESA 1E1QA 3OIWA 4RZUA 1GL9B 1YE8A 1CXZA 1AGRA 3A1SA 1FQKA 5AJWA 1CS4C 3F8TA 3R9XA 2PCJA 4LSGA 2OZEA 3EA0A 3MWJA 4PTLA 3E70C 4KVAA 3CRRA 4U5XA 4KVGA 2EFGA 3QY0A 2QAGC 1P72A 4BLSA 3KJHA 5CDFA 1UKZA 4GOJA 3REGA 1Z08A 2CCGA 4BLOA 4DDUA 4TMVA 2CXXA 4ZCMA 1T0HB 3ZYCA 4OBEA 4F93B 4RKFA 4B3CA 5KUTA 1GRQA 1EG7A 1KYIA 1NN5A 4XWOA 2ZI3A 3DMDA 4NCHA 4DUGA 2J3EA 4MGKR 2BIFA 1RKBA 1XTJA 1O87A 3KB2A 3RWMB 3IUYA 4Q02A 5KU1A 2WWWA 3EA5A 2CCKA 2ZROA 4OK6A 3LXRA 3F5FA 3PCRB 2P2LA 3I62A 2ZRDA 2ZUCA 1FPMA 3I1FA 8OHMA 3CRW1 5HE9A 2J59A 2VH5R 2H7VA 1QF9A 2F43B 3TVTA 1T9HA 2IXGA 2A9KA 4WBSA 5FI1B 3SYLA 1D2MA 2IYRA 2GZHA 5HPYB 2QBYA 3GD7A 2IF2A 2ZR0A 1G4AE 4JJZA 1HH4A 1AKEA 3OAAA 1ZUNB 5TB5A 4D81A 3UATA 2V7QD 2ZAMA 3IEUA 1KSGA 1DPFA 4B47A 4DLZA 4S2EA 5JHHB 1EWRA 2JIZA 3B78A 1D2EA 4P4TA 4EDHA 3WHKA 2QT0A 4A4DA 2VA8A 2ZYUX 2W6ID 2H17A 3NBYC 4CEIB 3SHWA 4C4PA 1DTSA 4G5GA 1IN8A 1N6PA 2ZVQX 4CEJB 4LHVA 3EZ9A 4BZPA 1BYUA 4UXJA 5BYKA 3C5HA 4UJ5A 3MUFA 2ZI6A 2CL7X 3N2EA 3GPLA 4BFXA 4DSUA 4LBZA 4QBIA 2A2ZA 4PO8A 3PITA 4PHTA 2JJ2A 3EARA 2JLVA 4IXMA 2FV8A 4DBLC 4POAA 5L3QB 3QVVA 4OJKA 1OIXA 3DL0A 2IWRA 2H16A 4B3DA 5KHOC 4EPVA 4MH0R 5GJVC 5HZKA 2JJ1D 1SXJE 1NY5A 4WXPA 4XTRA 4MYUA 3CZQA 2QT1A 5GVRA 3IIJA 3X1XA 4TLBA 5C1BA 3EPKA 3OFNA 4NH0A 5K8IA 1BMFA 4HB2A 5DI3A 2R44A 2NQ2C 5HR5A 3X1ZA 2C8VA 3GLHE 1ZAKA 2V54A 2FGJA 4Q4AA 1RZ3A 4JVSB 4M1MA 5GADl 5C18A 3ZGXA 3EPLA 1G8GA 2QP4A 4CEJA 4M9SA 2ONJA 1KO7A 1QVRA 2OXCA 3FTQA 3CRVA 3LW8A 5G3ZA 2IS1A 3AEZA 3A1VA 5J47A 1CJTC 2FSGA 1MRNA 1OXUA 2FU5C 2CJWA 3AVUA 2HF8A 3IO5A 3LVQE 2RGAA 2ZRKA 4WA7A 2AKYA 4ZI2A 3GFOA 5AUPB 3SFZA 1DO0A 3ADDA 2XB2A 5FPSA 1TADA 4PQYA 2J87A 3P26A 4LJ6A 4FXPA 5H8WA 1US8A 1G16A 3SYNA 4AC9A 4URZR 2DYKA 4LBWA 1UDXA 3KUCA 4RFVA 2XGJA 2I1VB 4NDZA 4ERNA 1ONBA 4PZYA 3LLUA 4XOIA 1NVUQ 3DZ8A 4DZZA 2GBLC 1XF9A 3OIUA 2CK3D 3AKDA 4BRUA 1LF5A 1X6VA 2GAAA 3QENA 4YQFA 5JI3E 1RJ9A 4US1R 2WWHA 2V3CC 4E22A 3AGQA 1PZNA 3B13B 3EASA 4PC7A 4RKEA 2JLYA 5AJXA 1H8HD 3RAPR 4IDOA 1HURA 5DIFA 4BRWA 3ADBA 2TMKA 2J0QA 5KNDA 4BASA 3UG6A 2IYYA 1JEDA 1UDWA 4H1VA 4JLOA 4W5WA 2BCJQ 2GK7A 4NU0A 4JLKA 1WF3A 5LPNA 4HUQB 5EP3A 3NBZC 2QNRA 3UWOA 2A30A 1SULA 1VMAA 1GRNA 1XMVA 2CVFA 4O0MA 4XVUA 4D4JA 1E69A 2VF8A 3OEHD 4G3XA 4UJ3A 3SQXA 4KHZA 4NL4H 1EFCA 3VKGA 1XBTA 2OUKA 2ZR7A 5LD2B 1W49A 3KKPA 3KFVA 1KI6A 2QRZA 4LC0A 3SJAA 4URWR 4NP6A 3KZ1E 3B1YA 2C9YA 4J0QA 1ZNYA 2XNSA 3ZVNA 1R5NA 3TR0A 2BBSA 4HAWA 1T5IA 4TWZA 4DCTA 5FPTA 3U5ZB 3N5CA 1P5ZB 5AUNB 4YMTA 5JHGB 2FX3A 3AB3A 3VHLB 1F3OA 4AKHA 4ZKDA 1IN5A 1Z0DA 2QEQA 3KB1A 3L0PA 5EE1A 2IWHA 1II8A 3H1TA 3PUZA 5TMPA 3U7HB 1LS1A 5JSZB 4Q00A 4PANA 4RCYA 5EXPA 4RD4A 4ARZA 2V8OA 2ZJAA 5E7MA 2YOFA 1HT2E 3CR7A 1N0UA 2D06A 4DVGA 5EJEA 4RJLA 2E87A 4CF7A 1E9SA 5EE5B 2ZYTX 1OFTA 2JGNA 3FWYA 3A1WA 2VP0A 4AI6A 1UADA 5LB2A 1LB1B 1W1WA 4QJ3A 2R9VA 1ZINA 3GJ6A 3VR5A 2BMJA 5AJZA 4NCIA 3I73A 2AD1A 4C2UA 5FFMA 2QTFA 1DBSA 1TF5A 3QG5A 2Z6VA 4M1KA 1EESA 3DKVA 3RRYA 4US2R 2BEKA 3ZVLA 1GAJA 1Q1ZA 2WAXA 5FL7D 1FOEB 3EWAA 4ZDJA 2YJTD 4PPNA 1GFIA 3I61A 3C4JA 2WMNB 2YVUA 1TQDA 2OE2A 5FOTA 3VR6A 3U7FB 2ODBA 3U60B 4KYUA 4M9QA 2G88A 2JLRA 2ZTSA 2FFBA 2VEDA 4Q9KA 4B3FX 4IVQA 3DPUA 2WICA 3CRMA 3QXHA 2JA1A 4PC3A 1DAEA 3WP0A 1JBKA 4C3ZA 3NVAA 3QXJA 1GWNA 1VHTA 3A58B 1M74A 4UXHA 1BYIA 2F3TA 3H4MA 4AYTA 5JWRA 1X8LA 4LJ4A 1DAMA 4NTZA 1CBUA 3R7WB 2IC5A 5B64A 4M0LA 1CIPA 3KDSE 3SZRA 3FMIA 1Z0FA 4Q9LA 3QG1A 1YRAA 2FN4A 1A82A 1HE1C 1TX4B 3B85A 4ZI3A 3U6KA 2EFHB 3TRFA 4C0LA 2ZS8A 1KDOA 5IK2D 4BUJA 4M1YA 1M7HA 3N2IA 2FDCA 3CX6A 2NOAA 3WMFA 1CRQA 2XAUA 3RRZA 3BERA 4Q1BA 2XXAB 1LV7A 1DVRA 1LY1A 721PA 1ZM4A 3AUXA 1FMJA 3W5IA 2FF7A 2REOA 2X2FA 1ZM3A 3TGPA 4UNQA 1OIVA 1X1SA 3PEVA 1SXJB 4F38A 3ETLA 3HPQA 4GL2A 1F5NA 2CLDX 2OILA 3MMPA 2QMEA 1OIWA 4LV6A 4Q9HA 5EP4A 4HAYA 3Q7PA 3SE0A 1QHNA 1CJKC 1M7BA 1W0KA 1I2DA 2X1VA 2NTYC 4MKFA 3QKRB 4TSFA 4LI0A 2W2TA 2VQSA 4G0NA 2ZYVX 1IOZA 4P31A 3U3OA 2K5UA 1PLLA 1AS0A 3BFXA 1SZPA 1WE2A 2GKSA 3GJXC 2UKDA 4OHXA 4OQXA 5JSZA 3EC2A 4CT5A 3LBIA 2A5GA 2ASEA 3PQCA 2OG2A 2XTMA 4OI4A 4ABYA 4YONB 1KGDA 5CDFE 3HU2A 1E32A 4BLQA 4IDNA 3ADKA 4Z1MA 1ELOA 2ZJ8A 3EZFA 3KTAB 3LV8A 3PUWA 5M04A 2P6NA 4B2PA 1ZD1A 5A5GA 2BVNA 3QQ5A 4JLPA 2OV2A 4URXR 1QVAA 1FW6A 3BH6A 1XXHE 1ANKA 1OYWA 1NNEA 4Q48A 4PO1A 2D3WA 4GP7A 3HWSA 2J1LA 1EWQA 4GNKA 3ASYA 1NJFA 3AVPA 3QEJA 5IDVA 3TW8B 1LVGA 2AFIE 1M34E 4OK3A 4URUR 1IONA 4M2LA 1VTKA 3AKYA 2Q0HA 3CH4B 4LJ9A 3N70A 4JMPA 1G5TA 2NO1A 4KFTA 1WMSA 3BORA 5H68A 5F9HA 1G7CA 3RVBA 2OEPA 4NYIQ 5HKKD 3VTKA 2G77B 1E2LA 3LD9A 4M1OA 3FPAA 5DYGA 5JMTA 3AP3A 2UZ3A 1TAGA 3EAQA 4PR0A 5J4HA 4GI7A 1WQ1R 2VSFA 3CX7A 2F6RA 4RFSA 1MABB 4AKGA 1G9XA 2YWHA 2RGDA 2WPDD 4UKDA 5IRCD 3ZS8A 5J4KA 1QHIA 1P60A 2QM7A 3BFKA 3K0AA 1XMIA 3B6EA 3QEOA 4QNRA 3HR8A 1GRRA 1CF4A 4TTQA 3LW7A 4EJSB 2WJYA 5AK0A 4BFUA 5IT5A 3DOFA 2FFAA 2XNDA 4JVMA 3GLIA 3GLFE 3W8RA 2MMGA 5FBWB 3FVQA 1E2KA 4B75A 3GCGA 5FBVB 1OH7A 2AWNA 3AP2A 3GJ0A 4C0SA 4LDJA 4DB4A 4EJSC 4GOXA 3U4QA 3X1DA 1MR3F 1W2HA 2DFLA 1OFIA 4D0GA 3U3KA 2EYQA 2HCBA 1QZXA 4HI0E 3CB4A 4QG7A 4XIGS 3LQQA 1T91A 2AWOA 2NGRA 4JL5A 4ZDWA 3U6BA 3K0CA 2AR7A 2JDIA 2PJRA 1S0UA 3Q72A 4LV5B 4E03A 1NMXA 2R65A 2IXFA 1G5RA 3L8YA 4RCZA 1QHHB 2KBFA 4KSCA 5KDOA 3Q85A 3QPUA 1ZUIA 3F0TA 4Q4JA 2R6CA 2UVQA 3T61A 3HU3A 1OH6A 3U44A 3TQFA 1MO4A 3K70B 1NVXQ 3CR8A 4D82A 1AIPA 1NIPA 1S3SA 1UAAA 4HAZA 2RGCA 3QPVA 4FMCF 5FBLB 4EPXA 1VECA 2JAQA 1GVNB 5FOWA 1BMFD 2QP3A 3H84A 3TIFA 3EG5A 4QGGA 3LO5A 4Q7MB 4B76A 4RVCA 1T8UA 3RRNA 1MRSA 2WJJA 4P4UA 3H2YA 1QHHA 4MDFA 3IKJA 4N0EA 2Q3MA 3AM1A 2A3RA 2OLKA 1Q0UA 1KDPA 1KJZA 4AK9A 1N5KA 3NKVA 2OFOA 1IBRA 1KOFA 4LGMA 4MITA 1UJ2A 1BIFA 4IW3B 1AQYA 2QM8A 2WV9A 1JR3A 1LS6A 4Q1CA 3QBVA 4C0QC 2P65A 2GK6A 1W0JA 2OT3B 2YYZA 4JVNA 2FA9A 5B57C 4BZXA 1YJ5A 1UEIA 4U02A 4WXRA 3AQ4A 2JEOA 3JVVA 2OM2A 1TNDA 3CPJB 4KJZA 4MQBA 4TZ6A 2DWQA 3CF0A 4GDFA 1Z0AA 2ZRMA 3VX3A 4NYMR 4C7OA 2GESA 4BZQA 4PO9A 1NKSA 2FSFA 1XPOA 2WSSD 3L8ZA 4O2RA 1O3YA 2CNWA 3WBJA 4IHQA 4X8LA 3LX5A 2PL3A 4JBYA 3GLHA 4XWAA 4AG5A 5HCNA 2V9PA 3KJEA 5L3RA 3W34A 4TZ0A 1YZKA 4HB0A 4S35A 5TARA 4ACBA 1HA3A 4LHYA 2GVDC 2JASA 1F48A 4FMDF 1ZW6A 3LFUA 3RS3A 4BFVA 1E4YA 1X8JA 4OQLA 4OI0A 1VYTA 2ZR9A 1WDTA 4MYHA 5KDDA 1GKYA 1VG0B 2C96A 1L8QA 3V00A 1XJ0A 1A1VA 3WNDA 2DFKB 3SC3A 3CUEF 3EZ7A 4A92A 1Z6AA 3CO5A 3BH7A 2ZI4A 5TDHA 4B32A 1UBCA 1CU1A 4XJXA 1NSFA 3CIOA 3NWJA 1OT3A 4D6PA 3LA6A 3LXXA 2REBA 4BEJA 4I81A 3RS7A 2Z4RA 2WKPA 3X1YA 1P9RA 2OXRA 3VR3A 5BW8A 5ELXA 2VP5A 4CW7A 4IOKA 2ZXUA 3QSYA 1U8YA 2IT1A 4LHWA 4AKIA 1FTSA 3EX7C 3TMKA 1VCMA 3O8DA 1W5SA 1XZPA 1VKJA 3UMFA 2ZVPX 4BFSA 1NG9A 1G18A 3BC1A 3TSWA 2Y8EA 1COWA 4JT2A 5LDDC 2W6JD 5LD2C 1XCMA 4HDOB 4JZKA 5GJWC 2GHIA 4EQ6B 1ZD9A 2DY1A 3AF1A 5EE0A 2BM1A 4ON9A 2FZLA 2RGEA 4DCNA 4TMZA 4IFEA 4YMSA 4JSYA 4LYAA 1SVMA 5AWFC 2JCSA 4DKXA 3VQTA 4V02A 5BYJA 4LUCA 4JL8A 1E2EA 3P4YA 3RS5A 1OH5A 1UKYA 1P61B 3RC8A 1KNXA 3T35A 4PC6A 3NHAA 3WMGA 3ZH9B 3ZD7A 1Z83A 3OE7A 1Q21A 2X19A 4DC9A 3R7WA 4OL0A 3PJRA 1E0KA 4TYQA 1XX6A 4II7A 2ORWA 1YVDA 2QTVB 1G291 1XD8A 2XOKD 1S9HA 5CIQA 1S9DA 1ZNZA 4JSTA 1W5TA 4G1UC 5KPDA 1EFRA 3RS2A 2NMVA 1N5JA 4DHEA 3GJ5A 3GP8A 4PXAA 1NBMD 2ZAOA 2BC9A 2WJHA 1Z6TA 1FMLA 2CE2X 4IDPA 3EXAA 2R6AA 4BPBA 2BKUA 1E2NA 4FW9A 1DAGA 3FE2A 4IVRA 4LYJA 3A37A 1ZMXA 3B1ZA 2G3YA 1G8HA 4RZ2A 421PA 3I32A 1YKSA 4KU4A 4GBMA 5G3YA 1KK1A 1ZM2A 3TSZA 3QKSB 3VU9A 1U0HC 3WRYC 2IS4A 2REXB 1E79D 3CNOA 1OPXA 2F1JA 4O2LA 3SDZA 1LTQA 3A1TA 4Q21A 5DO9A 1Z22A 4N1AA 1W4BA 1S8FA 1RRFA 2PLFA 4Q4HA 4LRWA 2IBMA 4F4JA 2VF7A 1VDZA 3KKMA 3OHMA 4HB4A 5HZHA 2BHRA 1PLJA 4HLDA 2R62A 4KODA 1MV5A 4DDWA 5E7JA 2IXEA 1TEXA 2NO0A 3T15A 1G20E 4ZCIA 3W3ZB 4Q66C 4TL9A 1UBGA 4NMMA 4KITB 3QIAA 5LBIA 1NLYA 1X1RA 1AGPA 1KI7A 4MRNA 2BBTA 1XTSA 5CJ2A 3GLFB 1ZC3A 1CJVC 4FCVA 2NG1A 3DMNA 4MGYR 4EFNA 1T6NA 4ZO4A 1OKKD 1ZM7A 2GJAA 3BB1A 3MWLA 2ZM5A 4Q1FA 4FI3C 3V4FA 5DN6D 1J8YF 2H8KA 1SVSA 4A2PA 5FPHA 1E1QD 1SVKA 2G1KA 5P21A 2QA5A 2CVHA 4QM6A 2EVWX 2CBZA 3WMEA 3NTUA 3NIBA 4PPGA 4B71A 3D6TB 2FOLA 4LYFA 3UIEA 1S96A 1VHLA 3ICEA 3K53A 1F2UA 1FUKA 1T8TA 1NLFA 1IJFA 2IHYA 4IVPA 1QDEA 1ZIOA 5L3SA 4D2IA 3KQLA 2W2XA 2VL7A 2QE7A 2WIBA 4B44A 3I5YA 5KSYA 4L15A 5BN5A 1S3GA 2F55A 2GEUA 3P32A 5FR2A 1FQJA 2JLQA 1R0WA 4G01B 4I1OA 3GFPA 4DSOA 3P20A 1JPNA 1R0ZA 1RYHA 1KK0A 4A0FA 1Q3HA 3EZ2A 4QJ4A 2QAJA 2EFEB 1I4LD 5KOYA 3NHBA 1LFDB 4BLPA 3Q3JB 4OHVA 1P2VA 4Q7JB 3HP1A 5D3QA 2CNWD 1WBBA 2WWXA 1DAFA 3K9NA 4B2LA 4A36A 2NIPA 5TXGA 1N6HA 1U8ZA 3C5CA 4C7OB 1NRJB 4CIDA 3OEHA 2VLIA 5K8TA 3GFTA 4Q18A 3TKLA 3I5XA 1U90A 3NDBB 2N46A 1E0SA 1G19A 1K6MA 2QU8A 3ADCA 3GJ8A 1ESNA 3FFBA 2FPKA 3UKDA 1US8B 4WW0A 5DYIA 5FOUA 3I8XA 3Q8XB 1W47A 1OJLA 2QPOA 2DCUA 4XH9B 3W9YA 2WJIA 4DLSA 3MJHA 3EWSA 1KNQA 4NCNA 3SFVA 4BEBA 3OEED 5C2JB 3BE4A 1IHUA 2ZU0C 4PQRA 1XB2A 5J4LA 4HLCA 4DEXA 2FH5B 3G5UA 1H8ED 1R5BA 3TQCA 3SS8A 1K5DA 2O8EB 121PA 1E2GA 1J2JA 5JBQA 3PR1A 1NBME 2HDNB 1IN6A 4YC7A 1M8PA 1BO6A 5AUOB 3GLGE 2IHBA 2OFXA 4E09A 2C5LA 2WVJA 3GLFA 2H5EA 3KQNA 4LBYA 1E2HA 3RHFA 2O8CA 1GTVA 4OHYA 4RD1A 5B2ZA 4DRZA 2VRWA 5JECA 5F98A 2GRJA 4WOPA 4D0LB 1XJQA 4LJYA 1HQCA 1XTRA 1KI3A 2N1BA 1JQLB 2H57A 1W36D 3TVDA 3BXZA 1K8RA 2C9OA 1XD9A 3K1JA 4PZZA 3GLGA 1KDRA 2ZANA 1DEKA 2PT7A 4NYIR 5FTJA 3H86A 4IKEA 3F3YA 3QF7A 2D2FA 2HXSA 4C0KA 2C98A 2RB4A 4B3XA 1ZIPA 1YZTA 5JCZA 4EJSA 4UXIA 1NI3A 3SHFA 4P0TA 1A2KC 5AUQA 5LB4A 3WY9A 3SQWA 1F2TB 3JZAA 1D8TA 2XNDD 2F43A 4W7SA 2G6BA 3A36A 5SZKB 3KQHA 3LY5A 3OF5A 4D25A 1II8B 2QMOA 4A6PA 1AK2A 3K0CC 2GXSA 3B82A 4IEIA 4L9WA 2W6IA 1J8MF 4F4IA 4L16A 1Q1EA 1KY2A 2PX3A 2X2EA 3K9GA 2BBWA 4U00A 3E2IA 4TLCA 4DLRA 1NSTA 4V0ME 2RGXA 4EQ6A 2ANCA 1NN1A 1UF9A 1XD2B 1U94A 2IS2A 1E2IA 1X86B 1GG2A 2ATXA 2O0JA 3K8YA 4XSGA 1Z6GA 1Z28A 2PJZA 3FHCB 4MRPA 3R20A 3ZVMA 1E9AA 3A1UA 1DG1G 2P0EA 1KI8A 4LHZA 2DFTA 1IXSB 3TH5A 3CPHA 2CL0X 2ORIA 2GF0A 2BM0A 2EQBA 1D5CA 4JLNA 3AF3A 2ZETA 4QGFA 2BJVA 2O8BB 1D6JA 1W44A 5JEEA 1G7TA 5F2EA 2GXUA 2B8WA 2QGZA 2HYDA 2ANBA 2ZRGA 1HTWA 1AKYA 1V5WA 1CEEA 1TEVA 2QBYB 521PA 4LZZA 1TQ6A 1QHSA 4KLZA 3U4QB 3AGPA 1R8SA 1D9XA 2GEVA 2XEXA 4Z1MD 4B73A 3B1VA 1RRCA 2F1HA 3AF0A 4K8OA 2H1LA 1R0XA 2IUSA 3K0SA 5C4MA 3R9WA 1ZU4A 4MKIA 3CZPA 3TSOA 4Q7LA 5FL3A 1N0WA 3UXMA 4EUNA 5FL7A 1W4CA 3TBKA 4A6XA 3T34A 1TF7A 4DT1A 2ZU6A 4EKDA 4BGDA 1MH1A 1Z8FA 3PUXA 3C16C 4IOJA 2O8BA 1CULC 1E6CA 4FD2A 3TUIC 1IXRC 2P5SA 5C4GB 3S1AA 4UNNA 1JAHA 2YOHA 3THYA 2OLJA 1VYUA 2QI9C 1Z06A 3U3JA 4KI0A 1EGAA 3KTAA 4DT1B 2ZPTX 5J4VA 4KAXA 2FWRA 4MKHA 4V0KA 1NLZA 1P3JA 2RAPA 1YU9A 1V43A 4PFSA 3MGCA 4QRHA 2HLDA 5JLJA 2ZUDA 3A4LA 2E1RA 4KBGA 2W00A 1G8FA 3SI7A 5JJKA 1U2RA 4W9MC 2QMHA 2F3RA 4HATA 1SVOA 3RNLA 3R8FA 2BOVA 5EXTA 1G7RA 1HV8A 2QENA 4DIEA 5DI3B 2EW1A 2DWPA 1KJYA 2XITA 3QXXA 1IN7A 2QROA 1OYYA 1GL6A 4PPFA 2MSDB 2XZPA 4B74A 1R2QA 1ODFA 1KI9A 4KCGA 4NKRA 5HTKA 3HJNA 3KJGA 4X8HA 1P2UA 2J0UB 1N6RA 1OXTA 2B7BA 1XTQA 1NVVR 5L3QA 1NMZA 1DAHA 4DJTA 1NF3A 4KFSA 3ZIAA 4V0LA 3B9QA 1N6NA 2NPFA 1U9IA 1YR6A 2G83A 2ZRIA 3CPEA 1Z47A 3T06B 4OYHA 1B23P 3U44B 1YZNA 4QJ5A 1UKEA 4ZDIA 3KQUA 1SKYB 2GCPA 2ZI5A 3LBNA 2OHFA 4LWZA 3WP1B 2QSYA 3Q5DA 3CKLA 1YR8A 2BBOA 2CHGA 4IFBA 5FUWA 1R0YA 2ODWA 2R6DA 2YC2C 4IJMA 621PA 4L4UA 1A4RA 4AIIA 2ZJBA 1GNPA 4V0NA 2RH5A 4HYYA 3S1AB 1E9DA 4BFTA 3UK6A 1ZNXA 3QPWA 2F7SA 1R7RA 2IYSA 3VR1A 2ZSDA 4Q7KA 5FOXA 1Z3IX 4D80A 4A8JB 1OXXK 3FKQA 2JLWA 1Z2CA 3KQKA 3K9HA 5BN4A 1Q44A 4B6EA 5L3SB 1NKTA 1Z0JA 2EFDB 5CK5A 1AN0A 3A4NA 3DO6A 1R8QA 1FL9A 3IIKA 1SHZA 2Q3FA 3GLGB 3KUDA 2BJWA 1H8EA 1ZUHA 2ZRJA 3VX4A 3HYTA 2XZLA 4HLQB 5EXXA 4BFZA 2JJ8A 4C2TA 3VNUA 2QG6A 1FP6A 2AD5A 3NC1C 4B43A 2BMFA 1DAIA 1DS6A 5J4YA 2ZRHA 2IUTA 3WRXC 3GQBA 5J5CA 4IDQA 5DHFA 2Q21A 3WBKA 1CR0A 1J90A 2V6JA 2QQEA 3L82B 1E9BA 3B9PA 1P73A 2C2HA 1F2UB 4DLWA 5G53C 5JWHA 1W0JD 2ZSEA 5KPJA 4A2QA 2VHCA 1AJEA 4G5RA 1LNZA 2A7QA 3SBEA 4NPHA 2RHMA 5KNCA 1E0AA 5JJLA 2BDTA 4M22A 4LV8B 4B3GA 1XD2A 3CNLA 4OQNA 2R2AA 4C9BA 3JZMA 1RJ9B 4HUQA 3ZQJA 2ODNA 1JB1A 1VIYA 2P6RA 1JXMA 3O8BA 5GJCA 3WYGA 2ZRAA 3LAWA 4Q9JA 5BWMA 2Z0MA 4M4SA 2AL7A 3TAUA 5D3MB 3CRQA 4GZLA 2AXPA 5EP1A 4URVR 2YOGA 1QG4A 1YR9A 1NIJA 2CDNA 2G0NA 3DEFA 4MGIR 3I3SR 2Q9CA 4G5OA 4LC1A 1K5GA 3TAHA 2P67A 4CVNA 1SVWA 2V4ZA 2J5XA 2DWOA 4QBHA 1N2CE 1I4TD 5EUMA 3TK1A 1N25A 4C0BA 4ZIRA 1RC8A 1SKQA 1E2MA 1MO5A 2F9MA 4D4KA 2YC4C 5JEDA 2EU8A 2FEMA 2GF9A 4I1SA 4RSGA 2UZIR 3O8RA 5JZVA 5CITA 3THOA 3CLVA 3AVTA 3LH5A 3BD9A 3ZQ6A 1KO8A 2PEZA 2DBYA 1HQYE 3KXIA 4JVLA 5JWOA 2XXAA 2IL1A 3C15C 5K8UA 4HAVA 3I72A 4KO8A 2GEDA 3BK7A 1XEXA 5G41A 4CGZA 3THWB 2FEOA 3H0KA 2IX3A 3C14C 5F3WB 1ZVQA 2ZRBA 4ASUA 1SQ5A 4F7WA 2IK8A 5C46F 3ZIAD 4OQFA 4WAUA 4DLTA 2AX4A 4A0HA 3AVVA 4LBVA 2Z5FA 4QM7A 1BS1A 1U98A 1E1RA 1ZD8A 2FPMA 4C0AC 1OFUX 4IOMA 1P9NA 4IEEA 4E5UA 3VU9B 1U0LA 1W0KD 3EW9A 4QBGB 3IQWA 2Q9BA 2XTZA 1OLOA 4KBFA 3PV0A 1BOFA 5A0FA 1YZLA 4P32A 2AK2A 4Q1EA 2W0MA 3RS0A 3TW4A 2AXNA 4PHFA 4QNMA 3GJ4A 4YDHB 1QHXA 4DDVA 1KI6B 1DE0A 1YZUA 2XB4A 1AA9A 3OZXA 4GFDA 4I99A 3FHTA 4Q4JB 3K0FB 4M21A 1RE0A 1NG1A 3TE6A 1ZP6A 2BV3A 2R8RA 5CM9C 1R6BX 4MA4A 3LLMA 3LBHA 4OI1A 2LWIA 3THYB 3VAAA 1E96A 2ZRCA 2GZDA 1II9A 2J0UA 1Q22A 4QFMA 2KSQA 3WHLA 4EFMA 1CJUC 1KMQA 2NZ8A 3OE7D 2HXYA 4KYIB 1E2DA 3AF4A 4Q03A 4CEIA 4JKIA 1S4QA 3FMPB 2QQ0A 4GSYA 4URYR 4FWTA 1WRBA 3AF2A 5CLLA 5FUYA 3R9IA 3OAAD 1RRPA 1CJMA 1HE8B 1Z2AA 2WAYA 3T5GA 3EPJA 1JPJA 1A5TA 4TL7A 2EWWA 3I92A 3SOPA 1COWD 1N6OA 2PMKA 1UBFA 4XTCS 1GP2A 1NJGA 5D3MA 3VR4A 4JLJA 2P5TB 4LK2A 1T5LA 4AURA 2YINC 1LW7A 4TMKA 5FI0B 5JS8A 1JR3D 2GA8A 2IYVA 2IYLD 4DSNA 1C9KA 1X3SA 1G21E 2CL6X 2ZJ2A 4XSHA 2O8DB 2D4HA 2CJWB 1TUEA 3ND9A 4QKQA 5FH9A 4TQ9A 4HDCA 2H92A 2V7QA 2RKOA 4FIDA 5K8LA 4TMXA 1RPZA 5G40A 3KJIA 3ZZTA 1SVLA 3IBGA 2VP4A 4FCTA 821PA 1MABA 1XCGB 5HCIA 5JI2E 1TF2A 1WP9A 2KBEA 1CR2A 1II0A 1U9IC 3FOZA 1IJEA 1VPLA 2V6IA 4OK5A 3BRWD 1XMJA 4I1UA 4G5QA 4F4CA 1FNMA 1R10A 1E0JA 1SHKA 4WZBE 3PEYA 1P6XA 4TLAA 1M6NA 1MKYA 3U2QA 4DSTA 2J45A 2QUZA 4JL6A 4QL3A 4MGZR 3CH5A 4NYJQ 4Y0AA 1DG3A 3PENA 4V0MA 1E99A 1NMYA 1BKDR 2IA5A 2OCAA 2O5VA 1PUIA 1FX0B 1SXJC 2ZYWX 2O8DA 3L0SA 2FMXA 4LJ5A 3A8TA 1F2TA 1TTTA 3C8UA 1I2MA 3GEEA 4Q1DA 3QE0A 4GP6A 3THXB 2C99A 4PHHA 3HPRA 4UQOA 1ZM9A 4YXWA 1E9FA 3RSOA 4ASUD 4YMVA 2YZ2A 3O47A 1ZNWA 5BQ5A 5IHPA 2YV5A 1N5LA 3LRPA 4G5SA 1MOZA 2X8AA 2I3BA 3K9LA 5IF9A 1KSJA 1G6HA 1HY3A 4B2IA 3U61B 2MMCA 3T1QA 2HV8A 4JIMA 1Q57A 4TMTA 4X8OA 2FSIA 5AJYA 1N6KA 3THWA 1QHYA 2ONKA 2DFNA 2WSMA 1EK0A 3RC3A 2WSSA 1WCV1 2JLSA 4ITRC 3KXLA 4L9SA 1I4DD 2XJ9A 4QHYA 1G3IA 1ZBDA 4A1FA 1CKEA 4MUAA 1W4AA 3HDTA 1IQPA 2VHTA 1XRJA 2Q9AA 1JECA 1CTQA 1N5IA 4R7ZA 1Y3AA 3T12A 2CCJA 1E4VA 3QXCA 5KYKA 1CP2A 3V4RA 1FNNA 3B7GA 2O8CB 5FTNA 2A5YB 4QGHA 3GLIE 3P4XA 1IM2A 3LWNA 1T4GA 1L4UA 4R9UC 5FPYA 4QC2A 2ZI9A 4OHZA 4CDGA 4Z8XA 1VYVA 1OE0A 3QKTA 4JT4A 3VKHA 2R6FA 2IYTA 2VP9A 4NONA 3SEAA 1FFHA 3NEYA 5EZ6B 4DCSA 2D74A 1P7CA 1AM4D 3IPYA 3KKQA 4LPKA 3ZZ0A 2JIZD 4M9XA 1E2JA 2F1IA 1QG2A 4OKSA 1OFHA 2XX3A 3W6OA 2W83A 4DEYA 3W6PA 2J41A 1KKLA 5EP2A 3I8SA 1OXSC 4ESVA 3B60A 4WZAE 1C4OA 5EQTA 1ZJ6A 4A2WA 4MYTA 3OIYA 1KDTA 2J9RA 3UG7A 2AK3A 2ZREA 2FSHA 4ZKEA 4B48A 3WNBA 2GWHA 3P27A 4TQAA 3LVRE 4A8JC 1J7KA 1Q1BA 2OFWA 2PCLA 3FMOB 4BLRA 2QPTA 2GILA 2I4IA 2XJ4A 4XD7D 1RVDA 3UWKA 4RFSB 4DXAA 3U7EB 4FMBB 2GTPA 3LNCA 2W0SA 3SNHA 2D62A 1VCOA 2F9LA 4EFLA 3T1OA 1N0VC 2OO7A 3UANA 5CJPA 2FJUA 2ORVA 5JFGA 3W90A 2NZJA 2ZI7A 4PSAA 2QL6A 4RD2A 5CK4A 1NL3A 1YQTA 2BMDA 5CIWA 2SHKA 4HUTA 3SR0A 4LJAA 3SN6A 2GJ8A 2ZSBA 3K09C 3RANA 4AYXA 2PZFA 5H1YA 2YKGA 3O8CA 1W7AA 2O0HA 3BJIC 4KXFB 1FUUA 2EYUA 2YWEA 1KK2A 4A82A 1W46A 2JJ1A 4A15A 4CEHB 5DISB 4RD0A 1E79A 2WPDA 4DB2A 1G6OA 1KSHA 1DAKA 2PH1A 1UBEA 4EPTA 2OBMA 3QVUA 1L4YA 4FINA 4C0JA 3ICQB 1EFTA 4JBXA 1CR4A 1XP8A 1U99A 3SYKA 2VHUA 3HR7A 1E1RD 2RGGA 2ZRNA 3MWKA 4IXNA 4JBWA 3WXMA 3QBTA 1F6BA 2VBCA 4R2IA 1R4AA 2GCNA 3V9PA 1KI4A 1XMSA 1NBMA 4QGAA 1ZU5A 221PA 1B0UA 5KDLA 2WZQA 3UMSA 2CLSA 4M1SA 2VYFA 4XVQA 1IY1A 2GJSA 3FKSD 1Q20A 2HJVA 2ECKA 4I4LA 2IYWA 2KWIA 1SXJA 3L2OB 1DOAA 4ZCLA 4CEHA 4CT4B 2J7KA 1E2QA 2FG5A 1TUIA 2QTHA 3LDAA 3SJBA 4DDTA 4M1TA 2O8FB 1DADA 4E07A 3WYAA 2JJ2D 3R8CA 4A0RA 3AP1A 2OCPA 1NVVQ 1Z5ZA 4B33A 1KI2A 1NY6A 3ECCA 1IY0A 5EXSA 3WNCA 3QKSA 3ZZUA 3ZD6A 2Q3HA 3M6AA 2HEIA 3RS4A 2J0VA 5TY0A 3D3QA 2Z43A 1J99A 2IYQA 4M53A 2O8FA 5JRZA 4ESHA 2RHDA 4TYYA 1JEEA 2A5FA 1G41A 3K09A 1WB9A 3U7GA 5FTLA 2JLUA 5DSZA 2GCOB 2B21A 3IQXA 4UNRA 3C7KA 2IEYA 4GMDA 4NZYA 5DI9A 3IIMA 4NYMQ 2O0KA 5KSOA 2ZEJA 1AQUA 1JAIA 1ESMA 4YLGA 1P75A 3GJ3A 2AHOA 4XD7A 1U0JA 3MAAC 3ZS9A 2FE4A 2RGNC 3QKUA 5DLQC 4AYWA 2ZJZA 2FFQA 1BH2A
chains in the Genus database with same CATH superfamily
3WB9A 4BAZA 1H6CA 5CTJA 4C30A 4EIWA 2WJVA 1SKYE 5ABPA 5SZIA 2ZKIA 2GNOA 2NP7A 4MJ3A 3PWTA 4WH0A 3OIVA 5LCXA 1YBAA 2QXYA 1NNI1 3HRKA 4YAJA 5A9SA 1NE2A 1VOTA 1XRNA 2MSLA 4QYWA 2B2XA 2Y1LA 9LDTA 3D2CA 2ZTHA 2EW2A 1ID8A 3IPXA 3BMOB 1HDCA 3K4QA 2RCNA 1GPKA 2JBHA 1B00A 1ZD3A 5FA6A 4YRPA 4BVJA 5F9FA 1E7RA 3VUEA 1CVLA 1LDEA 2ODEA 2HBQA 4GLJA 5HF5A 2C95A 2PNJA 1JNYA 1R4NA 4L5BA 4A0GA 3HHEA 4QYTA 2LKDA 4LE2A 4ZT7A 2FQWA 3HN7A 5KKAA 1SKAA 2V59A 3EIHA 4U7HA 4EGSA 1KMHB 2WMYA 4J6FA 1LI4A 2A78A 3L1IA 3PT9A 2ZIAA 3RYTC 3WQBA 2WHXA 4N76A 1X1CA 4P08A 4CIYA 1GG8A 5DHAA 5G0TA 1T15A 2FW8A 3DM5A 3GRVA 3OPMA 4IDFA 4P58A 4DQLA 4NLLA 1KZ7B 2C54A 5SZJA 4Y9RA 3EJ6A 4BFWA 3PC7A 4PAMA 4Q37A 1DUVG 3Q7RA 1V6CA 4MYCA 5ALPA 4KIJA 4BBJA 2X4IA 1NW9B 1A9ZA 2XYRA 4GXNA 2PSSA 2HM7A 4OGGA 2CV2A 1PYDA 5JT1A 1D9ZA 3TO5A 4PXYA 4QECA 3DBRB 2P4EA 5EAIA 3BVPA 1DXHA 1WHTA 2GLUA 3IUMA 4KI7A 4BN4A 3RTAA 4DCPA 4UOQA 1RRGA 4TWRA 1S2MA 2C92A 1JXOA 2ZTMA 3AEYA 4I0WB 2PBLA 1JJVA 3A6FA 4TS1A 5AI0A 4BNDB 4FB5A 1KO5A 4J0HA 3WGTA 3GNSA 4MR7B 4NR0A 3E53A 4WY8A 5TQVA 3E7DA 5I7EA 2QN2A 1CRPA 3H1GA 3NH6A 4D9KA 5KTSA 1Q15A 4Z53A 4KDEA 2RHGB 4EA9A 2W2VA 1BKSB 3PGJA 4IIUA 4PIVA 4BXOA 4HGOA 1WLSA 2PDAA 3G9TA 3QV2A 1BXGA 1KHTA 4QTUB 3X44A 1YF3A 3F4BA 1MPXA 4DNFA 2DHCA 1ACLA 1M1UA 2WBLC 3CW2A 5DE3A 4M7WA 3A2LA 1K66A 4NHOA 4I66A 5DNYB 4AX8A 2O3TA 3S2UA 4DIUA 4ZEVA 2AQHA 4Y8VA 1Z5NA 3B5JA 4P4NA 5ALVA 4LJ8A 3OT1B 5IABA 1PFWA 1I5OA 2QSZA 1KOGA 3FA2A 4GMXA 1W36B 4LCEA 2JLZA 1Z2DA 4PFQA 3O75A 3WLLA 1M0EA 4OB7A 2PRKA 2QN1A 4CLDA 1T36B 4RHUA 5K1ZA 1N8TA 2JFYA 3L7IA 4XVHA 3NEJA 3UC5A 1MOQA 5LL6P 1NWHA 5COBA 1MA0A 1P9OA 4L3OA 4UZFA 3K70D 5FTMA 5CFMA 2TMGA 2I76A 4NDAA 1CHNA 4IDEA 1M2OB 3JWGA 4F72A 1NYTA 4B45A 2GBFA 3UWSA 4HX5A 4PLWA 5A0TA 3FB4A 3UMRA 2L18A 4NOJA 2O54A 3I58A 1PV1A 1PZMA 4KLRA 5JRJA 3TE7A 3O8QB 2C57A 2GWRA 3AVWA 3BULA 2SCUA 3R6GA 4OAOA 2BH9A 2E37A 4TL6A 3RU2A 3G9ZA 5B7GA 3KZCA 3OEEA 4URFA 3A0RB 2ZSHA 4HLUC 4XWKA 5A4IS 3ONWA 1P4SA 1EM8B 1W2GA 5EVCA 2OCGA 4HQNA 3W5JA 1OB2A 2XYHA 3PLRA 3BMQB 1C7IA 2GZRA 3AKCA 3W79A 1COZA 1C41A 4M0KA 3WAKA 4H4EA 4KW7A 3QFHA 1OKKA 5FO1A 5HDQA 1ZUNA 2CWWA 2H1RA 1P4JA 5GONA 3M6FA 3WRWA 2ZE7A 3GWGA 1ADBA 2JF0A 2VF4X 2WZCA 3UAWA 4PG8A 2XQFA 5GWXA 1N9ZA 1M2KA 3UPDA 2C3UA 4H9GA 1VJGA 4LDNA 1FDRA 4BIMA 2OGZA 4DCMA 3JWEA 2CHFA 1F60A 4O02B 2W6CX 1DIAA 2XUJA 2GETA 4QDXA 1RLTA 3U1TA 1VJ5A 2D2EA 2CE7A 1HEIA 3TBHA 5FBZA 1UOPA 3ZH2A 2VPTA 1PUJA 3OC0A 3GLIB 3RJMA 1DELA 4FSXA 5C31A 4BQQA 4JI2B 1VIDA 4Z0PA 2PQ2A 2F8TA 2JL1A 3L07A 1M2JA 3B2EA 4RLSA 2OTCA 4QULA 7GPBA 5LQDA 2R7KA 1ND5A 4BZZA 5DN6A 3ZJ5A 1RYFA 4JEMA 3BWDD 3V7NA 1WXEA 2PGDA 2QGNA 3BWCA 1GZ6A 3PHHA 5CB4A 1WUYA 4JSRA 1CY0A 1LDYA 2RGBA 3TJZA 4C6TA 1GSOA 1JUDA 3RQSA 2P5UA 4DVJA 1U6JA 3OBIA 4F3RA 3DMGA 3SVLA 1D2NA 1OH8A 4OHBA 2XA2A 2HN9A 3PXGA 4YHHB 4DNXA 1E9RA 2B78A 3A4TA 1UP6A 2RH4A 3FPEA 3Q9LA 4YXWD 2AOUB 2BWJA 3DKPA 4N8DA 1FYVA 4JQYA 1OXKB 4OMUA 1XXHB 1TO6A 1R0RE 1YJXA 2EHJA 4RMJA 2VC2B 4URHA 5AFSA 2BEJA 5HJ7A 1T9AA 3MXTA 1LQUA 2AKAB 4HFJA 4IJ6A 5IKMA 3THXA 2RKBA 2GPBA 1I6WA 2DUNA 2ZSAA 4Y30A 3TB6A 4KMRA 1U1FA 1YMUA 2QN9A 3FDXA 3PIRA 1IG3A 4BLUA 3NG1A 3N1UA 3JQ6A 3PC2A 4IRXA 5IFKA 4LYHA 1EP3B 3QW2A 1XXHA 4L08A 3RK4A 4LRYA 3T1VA 1T9KA 1USUA 2QVLA 3H1AA 5LU8A 5DCUA 2P6UA 1YOBA 2NO6A 3IERA 4OIFA 3IDZA 3FMFA 5TEWA 4O63O 1PVOA 5ELMA 1QH1B 2B2CA 1JALA 1T8PA 1P7WA 2I66A 2N9UA 2D00A 3M33A 4XQ0A 2Z2XA 3ADPA 3VZSA 4AZTA 1T35A 2YRXA 1KIMA 4G8BA 1QIEA 3B38A 3LX8A 2XY4A 4MVWA 1E4OA 1SGWA 1I1QB 3FUWA 1FU4A 4ND5A 3G13A 4U2BA 3THRA 4B34A 4CM3A 4BB6A 3CNBA 4F92B 4PSKA 3UJHA 3FIUA 1FNSA 1ZZEA 3IHKA 5ANRB 2BGWA 2I2FA 1WPGA 2ETXA 1BCRA 1EP9A 1T0JB 1ZD4A 3CONA 1MO3A 2BKVA 2H4HA 3FHOA 4K46A 1LJLA 1EFUA 2F9FA 4AF7A 4ROTA 4DDHA 1OWLA 2APJA 1A88A 1AS2A 1KEEA 4LTMA 3VR4H 2ZG6A 2BM9A 5T41A 4GE3A 3TOXA 3FKSA 2PUJA 4ZPJA 1WXIA 4XA8A 4D45A 4EVIA 4KK3A 2OSBA 3A4VA 5CRIA 1W1UA 2CHQA 2MSEB 1YS1X 3DDSA 4XCVA 1DC6A 4B40A 3ZGYA 2VK4A 1LTHR 2O3JA 3G0GA 4GSKA 4EAQA 5AT1A 3UMYA 3R2JA 4Q4AB 1WKVA 1IZ7A 3PPVA 4GL4A 3ZE6A 1JMKC 5KX5B 4NU5A 4QHTA 3IV6A 1DL5A 2PFSA 4LWOA 4YYZA 3FJOA 1T6XA 1FFAA 4XVRA 2O50A 5AW7A 4U7DA 4LX0A 1BWQA 1E98A 1N4AA 1Q12A 2GSDA 4NAHA 4A3SA 2ZIWB 1RABA 4P4LA 3GW8A 1D6NA 5FP0A 3PU6A 4ZC8A 3NW9A 4QU8A 5BR1A 4ZYUA 3UW1A 1QZ3A 5IS2A 2GN0A 3AI2A 4HBZA 1PR9A 3O1HB 1WXWA 1UANA 3KTFA 1KSFX 3E5HA 1NP6A 2OAP1 4BE7B 3EXFB 3IYLW 2OV8A 2PH7A 1E2FA 4UTZA 1SQGA 2O1WA 4FOPA 4PW0A 4MRVA 2HSGA 4JN6B 1TZBA 5JVDA 1VSUA 4L2IA 4QBKA 1KFKB 2QVCA 2FRDC 3RFFA 1F1BA 2VYVD 3V80A 3IP7A 5EMHA 1VCIA 1I1HA 2A0WA 4QTXA 1JEQA 3H9GA 4AMGA 4D6YA 5AKHA 1QRUA 3NT5A 3NVDA 3RWOA 4K9DA 2W6PA 4EAAA 1TM7E 1UODA 2YRWA 4D5EA 3DWIA 4Q39A 1G8JA 1L7QA 3GGPA 3WL3A 1E1DA 1GKIA 3M49A 5KVVA 4JOQA 4LSZA 4PGAA 1KXJA 1HKUA 4TV8F 1EWKA 3UPUA 4J3FA 3KO8A 1XZFA 4PZUA 5EIOA 4LOAA 1OJ7A 1WY5A 2X8JB 4Q5IA 1O6FA 3B1WA 4JD5A 5AW1A 1T3GA 3KQVA 2QX4A 4MYDA 3ZHSA 3DB2A 3F47A 3HS3A 4TTSA 4X9XA 3GP3A 4BO2A 2P8JA 1J09A 2WILA 3M1LA 4IIJB 4DLVA 3Q3GE 1GKUB 4GPTA 5L8VA 4XYLA 4EB3A 4QVIA 1P39A 4HDKB 1G0NA 1M1YA 1NC1A 1QIMA 1BEEA 3QELB 4L74A 4ZQBA 3WGNA 2YHIB 3E61A 3RRMA 4QYXA 1KAEA 3QQPA 1M1ZA 4UDXX 5HRUA 2DPGA 3MSXA 3D5TA 2WIAA 5ICFA 3AV0B 4X00A 5AVXA 1WNTA 3B53X 4A03A 2PZMA 3LJKA 3UGKA 3P9SA 1JWLA 2ODQA 3W9BA 1ISSA 1CYEA 4QXRA 3BGSA 1OASA 2KLHA 5HDBB 1HDZA 3EPHA 4LYGA 1XTKA 1RCTE 2JVIA 5DM70 1GQ2A 2PVPA 2HGZA 3F7NA 1L4KA 4ZV4A 1PGPA 3OFND 4BP1A 4WOCA 2WQ6A 2V1XA 1K7SN 4L6AA 1VE7A 1M1YE 2YIVX 4PSVA 4LF5B 4H7EA 2TMYA 2RHJA 1PKXA 2DGDA 5C81A 2P7HA 3GA7A 4DCVA 2GCOA 3DKRA 3PDHA 2PS0A 2JGEA 1EI9A 3NKFA 4MUBA 1H22A 1E3MA 1A2BA 1BQ3A 1QMPA 4J49A 3ROXA 4H77A 2WUVA 5HFAA 2WOOA 2MYNA 4WLUA 3HYRA 2X0DA 1F2DA 1OBHA 1PYGA 1XNJA 2GD0A 2G1AA 3ESZA 5HA5A 5CG2A 5CG1A 1JL3A 4IAOA 3AM4A 3LX4A 1Z7YA 1GT91 2ECPA 3AHGA 1J0AA 1W85B 1CNEA 2ORYA 5D86A 5FUVA 5KNBA 2P9FA 5FBRB 1V35A 5CR9A 5TVKA 5A5DA 1ZA1A 4FXOA 1QS0A 3EH2A 4TTPA 2Q1SA 4L8WB 1VSVA 4HAXA 3WWZA 1ULBA 1O6ZA 3D8UA 1GTZA 1TYEB 4FN5A 5SZHB 4LOLA 2HU8A 1GPUA 2DVMA 3IAAA 4L4SA 5CB6A 3K32A 5AXCA 3A4MA 4YR7A 3MFYA 3LMKA 1DI0A 1LWNA 3BB3A 4I6JA 3GUYA 3FMGA 3JAWA 4P3YA 2QRNA 2WR8A 3R76A 2VKTA 3L1VA 2QXTA 1K08A 2BE7A 4JC4A 4W1SA 2R8ZA 3BXPA 5DSXA 3RTEA 2VIIA 3VNSA 1VFNA 2Q3DA 1CRLA 2VP6A 3NC0C 5G1OA 2IPXA 3K0EA 4P38A 3ZDQA 5D87A 5JXJA 4YPOA 3IUNA 3O0DA 3SZUA 4CMBA 4HB3A 3C6BA 3MS4A 2XTNA 3WKCA 3GGOA 1UEXC 4FE7A 1PFVA 5F7JA 1EUYA 2N47A 3N7UA 4DLYA 1T4MA 1TEZA 3JQ8B 2C20A 2A0YA 1GSIA 2ON6A 1PS0A 4QO8A 4CKWA 1DC5A 1KEZA 1XZQA 2G4LA 2WFLB 2YWFA 4MTCA 5LWQA 3ZZNA 1KP3A 4P98A 5KTYA 4B3MB 1XMXA 1XVTA 4GZMA 2EDCA 3BXGA 1MW8X 4DBVO 1YJBA 1UJMA 3HR4A 1DARA 1PZFA 4MRRA 1WSWA 3JQGA 1TM1E 3EVBA 2ZBDA 1EGQA 1KO4A 1FP4B 1NYQA 1SC9A 4QASA 1YR7A 1ZGGA 2GCIA 2VAMA 4COOA 4PC2A 2VSXA 1TDJA 4QOGA 4RVGA 2G17A 3MCAA 1RIFA 4NAUA 3C39A 2VPQA 3V1LA 1T8YA 2IF0A 2XUQA 3A9SA 4E7PA 5L4NA 2WWYA 1T25A 1TMGE 3K9WA 2B6HA 1AGXA 3LPLA 3PFFA 2HYIC 4EQZA 1Q2UA 1G66A 3LKVA 5EZ5A 2FWMX 5BUSA 3CLTD 3G6KA 1B8OA 1XU4A 5CLQA 3HADA 2OSVA 2H08A 5AVRA 2NUTB 1KAGA 1G2OA 2C88A 3KWMA 4HL6A 3R0JA 4EI2A 4PZLA 4OFZA 2GM4A 1DNPA 3IAM6 1HT0A 1RXVA 4OKIA 3CPSA 3OESA 1ML3A 1QK3A 1QIHA 4DARA 3IH5A 3R23A 5AVUA 2PGLA 2E18A 3A1SA 1A04A 1Q95A 1CS4C 1EFPA 2PCJA 1OA1A 4TKVA 4YJ3F 1K0UA 4FBMA 1F0KA 4XLZA 3CRRA 3CZMA 3WBBA 4DR5B 3KLBA 3H7IA 1QO7A 5HKLA 5EL0A 4U1RA 5LNK6 3H8JA 1EQ2A 4KWCA 4EW2A 2CYAA 2PU7A 4EFDA 2RIRA 2GM5A 5JVDF 4FFSA 5JPCA 1Z08A 5JZMA 3DF9A 4XEHA 1I7QB 4DDUA 1E1YA 1RR6A 3ZYCA 1U2TA 1ZIDA 4F60A 4F93B 5IAGA 4QUJA 1GQYA 1YIOA 1GRQA 3X3HA 1EG7A 4CNQA 4Z6KA 1DQNA 1L4BA 2VUUA 2X0JA 1A96A 3KJZA 2NVBA 4XWOA 4ZTZB 1U0FA 4HN4B 5JAOA 1DEAA 1RWOA 3JQAA 4NCHA 3DJYA 4DUGA 1RADA 3JD3A 4IO0A 4ZVLA 1XTJA 1O87A 5E9JA 4JLUA 3BIXA 3REQA 1DCTA 4ALKA 1QHFA 4NBLA 5C37A 1ISRA 3S7ZA 4ZFNA 4R1PA 3RRBA 1NVGA 4EF4A 1ZQ1A 1FU7A 3AFIA 1GADO 2P2LA 3PUKA 2Y1WA 4MUXA 1FS4A 3SHVA 5BSTA 3DLCA 4F8EA 1BE1A 3WLSA 5JH7B 4QOJA 1A8IA 1IZYA 3TPCA 2EF0A 1FPMA 3DPIA 3I1FA 1R0CA 5DNCA 2Q41A 3X2EA 4WBXC 4CQMD 1IHPA 2BW0A 2F43B 3BF8A 3G2QA 1GXSB 3LVBA 3Q41A 2OKCA 3M6WA 4KTTE 3WG9A 3B6JA 2NV0A 1GRCA 2XDQB 3BRWA 1MB3A 4WBSA 3NWOA 2R1TB 3CN7A 3NTVA 4C7JA 2R8PA 3NHSA 3TOSA 3UJAA 2IYRA 3WYEA 4ATNA 3P2YA 3AZOA 5ICEA 1JR2A 1U3GA 5HPYB 4YP0A 5K0TA 1I01A 1O57A 2TMDA 3ICOA 1HLDA 4U2GA 2R47A 1AB6A 1YQUA 1ZUNB 4P22A 5GOZA 3TNLA 3WQRA 2V7QD 2BFOA 1PR1A 1RHRA 2HHCA 3G8AA 1DPFA 2X4LA 1WSAA 3AIOA 4S2EA 1XL1A 4O1IA 1JG2A 1EWRA 2JIZA 2FZKA 1DO8A 3MXOA 3B78A 2YXDA 3DLAA 1I2ZA 4ZYZA 1Z0UA 3KYCA 3WHKA 1LX6A 1FDSA 1POWA 2V4UA 1JQEA 3JYPA 2FSVC 2H17A 4CEIB 1LUAA 1DTSA 4NX2A 2ZVQX 1N6PA 2H2HA 3C6XA 4LHVA 4WESA 4B6SA 4PZDA 2G9UA 1YKGA 3ISTA 5ALSA 1QAMA 1QGAA 4BZPA 2Z2JA 5H4HA 1Y5RA 2C5HA 3C5HA 3D8RA 4UJ5A 4WX2B 1PTJC 2F1KA 3OCJA 2CL7X 1NA5A 1EXWA 4GLFA 4AMVA 5MFZA 2WYOA 5IDYA 4LBZA 3PITA 1F5SA 2MWMA 1RCUA 1TW2A 4Z2YA 4IXMA 2JLVA 1KR2A 3WK6A 4POAA 4M9RA 4XLLA 1XZEA 2EXXA 1U80A 4G8CA 3UMCA 4UAGA 5IJZA 1QANA 1NT2A 4R41A 4EPVA 2NYVA 4MH0R 2GAJA 4U2CA 4DTCA 1M34A 4U0KA 3R5JA 4WHMA 1NY5A 1BEZA 4X1OA 4HJRA 3IIJA 4B81A 2YR0A 2JFNA 4CEHA 5K8IA 3JAKA 3NIWA 2GN1A 1FTQA 4GPD1 1A9TA 4CMJA 5CH8A 2O2IA 1SHUX 5JTUA 4DLKA 4PY2A 2C8VA 1GGFA 4B7AA 1QBGA 4F2GA 2O8NA 2BFEB 1ZAKA 2XKKA 1IUKA 3UJNA 1PR4A 5CDSA 4KXUA 1RZ3A 2O3UA 1YZFA 2SICE 2V74B 5HIMA 1TPYA 4LXHA 4AUMA 1JQKA 3EPLA 2QIPA 2QP4A 4CEJA 4RPJA 4DG8A 3L6DA 3MMNA 4IIXA 1BKYA 3LW8A 1UR5A 1CUDA 2PYZA 4BDSA 3ER6A 3KOZA 1Y81A 5C8YA 2FSGA 1ULSA 1Y5NA 3OPYI 4FZ5A 1RBZA 3PCTA 4CMAA 4DR7B 4ES6A 2RGAA 4WA7A 3DP7A 3H2BA 2C5GA 4IYJA 4ZI2A 3GFOA 1F9AA 3AR3A 3AR5A 1MOSA 2TSYB 3I42A 4TGLA 4NJMB 4F3KA 5IDXA 3D7SA 4WKBA 2XB2A 4HUJA 4MW7A 4NOLA 4HR7A 2OCDA 4J16C 4UPDA 3U4QA 4HDSB 4MIOA 3TM5A 2QM3A 1US8A 1G16A 2HF2A 3RSSA 3SYNA 4N8EA 4URZR 3U4IA 5E1OA 3VNRA 1L3BA 3Q8WA 4K9NA 4F06A 3RTBA 1D4AA 4L5JA 2JJMA 1UDXA 5K09A 2XGJA 2I1VB 2LRHA 4NDZA 5DM0A 4KAJA 1ONBA 5A5FA 4RH0A 3OUZA 3DZ8A 1RM0A 4M0UA 4FTWA 4LYYA 5REQB 1FYFA 4MEJA 4U7GA 2OQ2A 3JALA 3OWOA 1MZVA 2BP7B 3K5WA 1X6VA 2GAAA 1SUAA 3O9VA 4GGOA 5JI3E 4IRMA 4US1R 5EIXA 3KKKA 2V3CC 4E22A 2YZKA 2XGOA 3ST7A 1IRIA 4PGMA 4INOA 1ULUA 4BVGA 3KR9A 5AK6A 4BRWA 4DAEA 3JQ9A 1EK6A 1YUNA 2FMTA 2TMKA 3KDPA 1CEQA 1DIHA 4RBNA 3NTXA 1H5NA 4CQNA 5CCDA 2IYYA 2EF1A 1U7TA 1UDWA 3H04A 3MCVA 5IVIA 4NU0A 4JLKA 3I9LA 5DNUA 3HTXA 3OPYA 1ENPA 3S68A 3BD6A 5LPNA 1GZDA 5HFJA 4CTOA 1WDKA 2QNRA 3D5EA 3L02A 1VMAA 1GRNA 2GQ0A 4O0MA 3AUAA 4D4JA 5EEGA 1UOOA 4HGRA 3GELA 3WYBA 1FFGA 1P1HA 3HKDB 3PJGA 1Z7EA 1SNYA 5LLSA 1U3VA 3TQQA 1SQ0A 4MW4A 3VKGA 3B52X 4YY3B 1P31A 2ZR7A 3PDCA 2AZMA 3KKPA 3H5IA 3TRIA 4ZMSA 2D54A 1O97D 5JYBA 1ODLA 3E3LA 3SJAA 4M0FA 3AESA 2QB5A 5DGCA 4IMIB 5MDHA 4J0QA 1ZNYA 2PPVA 3ZVNA 3TR0A 4HAWA 4TWAA 4B3JA 4ZO9A 5FPTA 4DCTA 3WVNA 3N5CA 4U39A 2IXAA 4W7IA 3IEMA 3OZAA 3DBIA 4JGGA 4ZKDA 2QEQA 4TTAA 5LQCA 4WKNA 3OBBA 5BSMA 3LHIA 2WLTA 5EE1A 2CXNA 4NE9A 4ZOLB 3IXMA 4RU1A 4R2KA 1L5FA 1NQVA 3JQBA 4MO2A 1KETA 2V8OA 4KRXA 5J3JA 4LVNA 5E2IA 1UAYA 2DAPA 1EK1A 2ZJAA 3FDZA 3OZ7A 2CY0A 3Q3IA 4MO9A 4U9HS 4AJ1A 1OWMA 3RYIB 3ZIUA 3TMAA 4RTMA 1E9SA 3E81A 3P9ZA 1SY7A 2ZYTX 5A7GA 5LBTA 1WD7A 3RS9A 3A1WA 3L1HA 3AHHA 3HKCA 1J8VA 3FJYA 4EYOA 2E89A 1W1WA 1DT5A 3QP9A 1NBOA 1YCFA 2R9VA 1ZINA 5AJZA 3M3PA 5TRTA 3W3AH 5FOQA 1F1JA 3ZWXA 2WFAA 1DRVA 1DBSA 4OLJA 4OAPA 4F8JA 2EJTA 2QTAA 2Z6VA 4IQFA 4BX9A 3GPBA 4CKXA 3ZCQA 1XNQB 3TINA 3W5IA 1EESA 3TOVA 1YIDA 2VAPA 2QX6A 3EQZA 3QWBA 4FZ3A 2CVOA 2F3UA 4N12A 3RJ5A 4RQBA 1Q1ZA 3JASA 3M1YA 5HZGA 4FFVA 1MB2A 3FF4A 2ZGVA 3NJRA 4O2BA 4PPNA 2HHLA 1EFDN 3C4JA 2B30A 4JA2A 4D44A 1RWBA 2DOKA 2OE2A 5FOTA 1KYYA 2QTBA 1OR8A 3JR3A 1MTZA 2ODTX 3OCXA 4M9QA 5E6SB 1Q0QA 2I54A 2X7XA 3ZU4A 3HHPA 2IH2A 1YI8A 3ZWCA 3RUIA 4LF8B 1J5XA 1RYBA 1JKJA 3P0HA 2RFLA 3QXHA 1DAEA 1M0TA 1JBKA 2OV3A 3D1JA 3FZNA 2IRWA 3GQBB 3NVAA 3B9BA 1YC2A 3R3JA 4H3KB 1SPBS 4QYMA 4MX8A 1L7OA 2AR9A 4EYSA 1GFSA 2R60A 4UXHA 4YB8A 5CT6A 4LXIA 3SPXA 3W78A 4AYTA 1E1KA 4CUZA 1ZRSA 4LQLA 4DDMA 1ZDMA 5DBGA 1DAMA 4RTKA 1P2FA 3NPMA 5E4TA 4YP6A 4FEYA 2O2XA 4QYSA 3DTVD 1OCEA 3NJ4A 5I8ZA 4FWBA 1CDZA 1PQ4A 1Z12A 3PUJA 2GD1O 1FIUA 1PKEA 2WJZB 2B4QA 2JD0A 1A82A 1HE1C 4G9EA 4OQDA 3TF5A 1KGSA 1QYXA 3B85A 4YPFA 3W4JA 3ZKWB 4E5YA 1AA6A 3BMNA 3TRFA 4KJXA 5IK2D 4DPLA 2GKGA 4BUJA 3I05A 1PZHA 2A4KA 2GZ2A 4B79A 1CRQA 4EMUA 1P5JA 4P5EA 2BGLA 5FUQA 721PA 4JYPA 1Q7RA 4WZAB 3FHLA 2P41A 1WZNA 3D2LA 1JMYA 1LK5A 5KJ1A 2REOA 3NALA 3QOXA 4NXNB 5TGZA 1J2UA 3CINA 3FYTA 1X1SA 3W7VA 2FN9A 3DXXA 2B4AA 2PO5A 3ETLA 4KP7A 1M2VA 3TSAA 1F5NA 1MAAA 4IWNA 2OILA 3LYLA 4NG4A 3RBZA 4Q0MA 3SE0A 1LNQA 1M7BA 5DPMA 1A69A 1BU5A 2VOJA 2WG2A 4Y6LA 2RD2A 2NTYC 3HA7A 1FFEA 1FMTA 3JQ8A 3OEYA 4K9KA 2GCEA 2VRCD 2VJQA 3KE9A 4C6HA 4EH1A 2Y0EA 3R7BA 4P31A 1PIWA 4G1MB 4AY6A 2K5UA 1G21B 3BFXA 5FQNA 1YBMA 1L3CA 1Y7PA 1RKVA 3OJEA 1WCXA 1PTJA 4MB6A 2GKSA 1RU3A 5FPQA 3SYMA 2VDVE 2GA9A 3HI4A 4CIWA 2GK3A 3QVOA 3FPGA 2DJIA 4G26A 1MG5A 2ASEA 4ZICA 2CXHA 1QLHA 1E32A 2B61A 4Y1GA 3PK0A 4OOFA 4Z1MA 2E4XA 3G79A 1N33B 1I3OA 1PNQA 5A6VA 5DLDA 3EZFA 1UUFA 3RARA 3ZK7A 5B3AA 4BTEA 3R7NA 1ZD1A 5A5GA 3QQ5A 3VZRA 5BQXA 4BNFA 1DBPA 3BH6A 3MGAA 1OYWA 1NNEA 1AG9A 3O2SB 2ENWA 4IZHA 1ABEA 3LZCA 5E0KB 5I7OA 1NJFA 3TIIA 2IY7A 4QA9A 4BNXA 2A1UA 1H6AA 3NBMA 3WOHA 3V33A 4XDHA 1K8QA 3AKYA 4RHCA 3CH4B 4KFTA 4Q1VA 1OBOA 3DOJA 5F9HA 4J76A 4C1NA 1V96A 5FFNA 5HKKD 3HK2A 5BUCA 2Q1YA 1JP7A 1ORRA 3LE8A 1JIKA 2ZPUA 4LF6B 3L8CA 3BHNA 4PR0A 2HCTA 3EAQA 3KLNA 3MPUA 4GI7A 1SKMA 4LDZA 3CX7A 3FNBA 1CETA 1N2XA 4RFSA 4DG9A 5J2TA 2QSJA 1G8SA 3E9CA 4TWJA 3DE7X 4XUCA 4BNMA 5BOSA 2OO5C 3FG9A 3HSKA 1B4DA 2YJZA 4L07A 3AR4A 5IRCD 4MLDA 4YJ3B 5J4KA 1KVUA 2VNAA 1UPCA 4DMHA 3LWBA 3RBVA 2CV0A 4F71A 5L6MB 3DNPA 2FETA 1GRRA 1RIIA 4CMIA 3PNQA 1E3DA 4WMLA 3EXHC 3AB7A 4TTQA 3T3OA 3IJPA 3HUFA 4FYHA 2BE9A 3OZVA 3A9WA 8ABPA 2QYOA 1N0HA 1LBHA 1Q17A 1CK4A 3HYSA 4IMPA 5EY5B 3LZ6A 1DIBA 1O96A 1CUJA 4K8RB 4QARA 5LYYA 4AJPA 4UFPA 5KC8A 2AVNA 4KWHA 2PL1A 2MMGA 3I9V6 3MUOA 1WPQA 4GLBA 1NR7A 4B7ZA 4WK4B 2VNSA 3GCGA 3ZPXA 4KXVA 4UHJA 4LF4B 4DE5A 2JFUA 1OH7A 1DKPA 2E3JA 2WD7B 2DKFA 2BFBB 3AFOA 3GDGA 3HP4A 4ZT6A 5CMLA 2LVBA 4LDJA 5EJFA 3TVYA 2I3GA 1IDOA 3PICA 3WO1A 1MR3F 3X1DA 3GDHA 4RAOA 4JUCA 4E14A 3L7DA 5C8YB 4CMIB 4HRXA 1ISFA 4HI0E 3CB4A 2QY6A 4QG7A 3ZTYA 2GBCA 4L76A 1U7UA 2VUHB 3KT3A 2IQ5A 1P44A 2AR7A 1AV7A 3ZWAA 1KYTA 5LYJF 1M2VB 4MYSA 2JDIA 2H4FA 5BQPA 3Q72A 4ENTA 1NMXA 4Q6BA 1C3JA 1NUTA 2IXFA 3B3JA 1G5RA 4KN8A 4CIXA 3IT2A 4GKVA 4B6OA 1EVIA 2OVFA 3I2IA 1D2GA 3A9UA 1QHHB 4UC0A 1WPXA 4NC9A 3AM3A 4KSCA 1T8RA 3QX3A 1L5HB 1QGUB 4GC9A 4PRLA 3IULA 3AEKA 3SFTA 3V1TC 1QG6A 4KGDA 1Z4OA 3PFHA 4MVJE 3KZKA 5DEIA 4CODB 1FFBA 2CB9A 5KOJA 2VDJA 3BBLA 2F48A 4U7JA 3T61A 3CZAA 4AULA 2HA5A 4BC1A 3TQFA 1MO4A 4CM4B 1OH6A 3VPGA 4D82A 3O4JA 3R6DA 4R8MA 1S3SA 5E9QA 5IUKC 3QPVA 5L4SA 1RM5A 2GPNA 2QR5A 2R84A 4MV9A 3VPAA 1OA0A 3P9RA 4R1QA 1JEOA 1GVNB 1TT5B 2QP3A 3V4VB 3H65A 1OLSA 4YRTA 2R97A 4DMMA 1DDGA 2YUTA 4KN6A 2WI8A 1SB8A 2I6GA 3C3BA 2WJJA 4HKTA 4HNQA 4LXXA 4TWIA 1QHHA 4QPZA 4FZJA 4B3HA 4ARIA 1EP2B 5A3JA 1M83A 4BRZA 3BEOA 3NZEA 2A3RA 4OUDA 3AM1A 1KDPA 3LYHA 2WT8A 1R0BA 4UBNA 5MHTA 1UAGA 1DAOA 4LGMA 1RS0A 2WKWA 4J1SA 4MITA 4QEDA 4IW3B 3ET4A 4ZYVA 3AF6A 1MXHA 2QM8A 2ODAA 3HFGA 2VBFA 3U4AA 1QNLA 3F96A 4X84A 2XGSA 2H4XA 2YY6A 2X41A 5DLYA 1RI3A 4JX9A 3PYMA 1MJ5A 1RDFA 3A1DA 1DQYA 1JHYA 4WXRA 4BGVA 3EC7A 3AQ4A 2JEOA 3EULA 2B82A 4FYMA 4KQEA 2AOTB 3S1LA 1T5OA 2Z9DA 1TNDA 2P7IA 4BNKA 2RHTA 1OLXB 4YMGA 3CF0A 4RQUA 1MIOB 1K7CA 1Z5WA 2P3OA 3LBAA 1XZCA 4IILA 4MXDA 1T43A 4MW6A 5FWYB 3VX3A 5A2GA 4DV5B 2H00A 3L8ZA 2YY5A 4O2RA 4XGIA 4DANA 3HJHA 1IZZA 1UCFA 2PL3A 2ZPAA 1C30B 4YCMA 1RP7A 3BZBA 3TW8A 3ZBQA 4DOMA 3O3CA 4AG5A 5HCNA 3KJEA 3MW8A 1E6UA 2FX5A 4ZT2A 3A11A 2P4QA 3D8SA 3W34A 4M46A 1U2QA 4G1CA 4HB0A 4U2FA 5F5LA 1HA3A 4ACBA 3Q9SA 4IIYA 4DA6A 1UBMS 5KX5A 2G36A 1ONSA 4F45A 1QAQA 3GAZA 4LZWA 1L7EA 4F84A 3S40A 5JSZB 4FR5A 3WXMA 1MEEA 2WYHA 3MQ2A 3LZDA 3WB0A 5BWCA 3PDJA 4ZI7F 5KDDA 1GKYA 1SAYA 1HNWB 4C7KA 3GVPA 2ONZA 3SIXA 1KZ1A 2VVTA 4PLPA 3WNDA 1T1SA 2ID8A 3N2LA 4OU4A 3CUEF 4PGFA 4M98A 1LLDA 3FLEA 2CLKB 2X9QA 2HMVA 1UBCA 4HDRB 4ZEWA 1PDOA 3CIOA 3NWJA 2BFAA 1OT3A 3C7TA 3LUFA 1JDBB 4LW8A 4YJ2F 1B41A 2OOSA 4KIUA 5FFFA 1P1FA 4E5PA 2BN4A 2WKPA 1BWPA 1GN8A 2VYND 1EH5A 2BGUA 1KE2A 5BW8A 5ELXA 3DEHA 2IT1A 3FF1A 3BAZA 1BX1A 4AKIA 3RRXA 2V9CA 4DNPA 4FFBA 1ECJA 1VCMA 3RUHA 1W5SA 1TZMA 1ECLA 1XZPA 3IBCA 3RC7A 1VL5A 4ILKA 1J49A 1VKJA 2ZVPX 2DY0A 3CCFA 1G18A 3M6MD 3S2EA 3SSOA 2HFJA 2ZIUB 4J0JA 2AJDA 1XCMA 5GJWC 10MHA 4IUYA 3I9MA 4R8LA 1P74A 1NV8A 2DY1A 4GZ6A 2BM1A 1OVGA 3A14A 4OREX 4CQMA 4JCCA 3G1TA 4PYNA 4JSYA 5AWFC 3L5OA 2RJNA 4V02A 1HM5A 1F6DA 1MENA 4M49A 3KJFA 4Y9DA 5ADWA 4LXUA 4TV9A 4JBNA 5E4YA 2OZPA 5K0NA 3UK7A 1SH7A 2IHNA 4QLBA 3RC8A 4Y2VA 3I1JA 3KSUA 2BLLA 1ADFA 3ZH9B 4N41A 3FROA 2YV1A 4XB6B 3TZKA 1JMVA 1FTWA 2ZT5A 3EQ2A 3ITKA 3Q2KA 4UATA 5DASA 4JI7B 2J9XB 3TIGA 2ZUWA 4DC9A 1X7WB 4OL0A 4PU0A 3SHTA 2B8JA 1X87A 5D01A 5ICGA 2XOKD 1V1RA 3IUEA 3IOEA 2D2XA 4RZUA 3FPLA 3TLGA 1Z0ZA 3AU9A 3RS2A 1N5JA 3J80A 1MQAA 4Q4DA 1U3TA 1TFRA 4K2HA 1TLFA 2ZBRA 4PXAA 1Z38A 3C3YA 3GH3A 4ZJPA 2DFDA 1NUAA 2WJHA 3NHJA 1STOA 1FMLA 1W9HA 4OEHA 1SUSA 2BKUA 2FPPA 3DWEX 3RUFA 4K03A 1EJ6A 1ZMXA 1XLWA 2M98A 3AUJB 1X42A 3I2JA 1G8HA 2CF6A 2YIDA 4RZ2A 1YKSA 3G17A 5IN5A 3EGEA 3IALA 3ZKAA 1KK1A 4GEKA 4HQ0A 2OORA 1IYZA 1H6DA 3F8WA 4MW0A 3WRYC 2IS4A 3CUWA 3FUVA 2IYEA 4O08A 1OPXA 2BGGA 3KELA 3DVSX 3A1TA 1Z22A 5IH7A 4N1AA 1S8FA 2PZBA 3CHYA 3MJFA 1RJDA 4J1TC 1MH9A 4OCZA 1SVUA 1SOWA 2VF7A 3DAOA 5HZHA 4HLDA 1PLJA 4IH4A 2AF4C 1C9YA 3R0ZA 1JLKA 3V55A 1EGHA 3ZWPA 3V5NA 2NO0A 4LJLA 1QTNA 1Z4LA 1TZCA 1UBGA 2B5WA 2VXOA 4GX1A 4MUKA 1REQA 5LBIA 3TLAA 2R25B 4F5WA 5L51A 1KI7A 4R5HA 3P0JA 2O19A 1FVHA 4UBMA 4AB1A