2WBLC

Three-dimensional structure of a binary rop-prone complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
175
structure length
167
Chain Sequence
RFIKCVTVGDGAVGKTCMLISYTGPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPGIPIVLVGTKLDLRDDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHO OF PLANTS GUANINE NUCLEOTIDE EXCHANGE FACTOR 8
publication title 3D Structure of a Binary Rop-Prone Complex: The Final Intermediate for a Complete Set of Molecular Snapshots of the Ropgef Reaction.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 56
structure length 167
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wblC00
5HE9A 4JL8A 1TEVA 4IHQA 2A78A 2ODBA 4JIMA 5JEDA 1J7KA 2WSMA 3EZ7A 2DHRA 4DB4A 4GP6A 2ZETA 3KJGA 5CM9C 1JALA 1QG4A 4RY2A 1NKTA 2AN9A 3CKLA 1K8RA 2D2EA 3V4RA 3TAUA 1ZNWA 1O87A 2NO6A 3AGPA 5FI1B 2F3TA 2QPOA 2ZYVX 3OFND 3HPQA 2BC9A 1HT1E 5J4LA 3QQ5A 2NQ2C 2QM8A 4HLQB 2CK3D 2GJAA 1MRNA 2K5UA 3GFOA 4TMWA 5GJWC 1LF0A 3CUEF 4LHZA 4MYUA 2PCLA 1N5JA 2FV8A 2J7PA 1TAGA 1F2TB 2IEYA 2C78A 3OEHD 2ZAMA 2BDTA 1TX4B 5EE3A 1G18A 3S1AB 5CYOA 1XMIA 2ZI9A 1KTVA 2IYQA 3EIEA 4HYYA 1N6NA 4O2LA 4QBFA 2ZYUX 4BUJA 4BFSA 4MH0R 3OESA 1U98A 4CVNA 1G8GA 3MRSA 4KYUA 1G17A 1LFDB 4M9XA 3BWDD 3UIEA 1YE8A 3PEVA 4EJSA 3SQWA 2OXRA 3B9PA 2MSEB 2P5TB 2XB4A 3F8TA 4HUQA 3MFYA 2O8EB 3TBKA 4B47A 2H57A 2VQSA 2ZI7A 2OT3B 4JLBA 3GLFB 3GLFE 4QXAA 5CITA 1US8B 1N6OA 5CLLA 4A0FA 3H1TA 4NCIA 3AQ4A 4JL6A 2C9CA 4HAZA 3CPHA 1Q1ZA 1BMFD 4PC3A 4Q1CA 2KBFA 2ODNA 3REGA 2MMGA 1MO6A 2FJUA 4TL6A 3QKSB 3RS3A 3OEEA 5FOVA 2ZTSA 2QY9A 2GCOA 2JLXA 4CW7A 4QBGB 4DCNA 1IJEA 4LOAA 1U9IC 2CL7X 1CTQA 5CK4A 5IF9A 4Q4JB 3IO5A 4PO8A 4DLSA 4KODA 3TW4A 2V7QA 3SZRA 4LK2A 3QG5A 2IHYA 3U3JA 3K0FA 2AKAB 4MRVA 3QSYA 3GEEA 1W4AA 3NTUA 4MKIA 4WZBE 2PEZA 3VQTA 2ZS9A 5DHFA 3NH9A 3JVUA 1GITA 1XD2A 4M0LA 4NU0A 1R0XA 2H5EA 3IHWA 5FPSA 4OHWA 1IAQA 3VMFA 2GHIA 1VKJA 1M8PA 2V55B 3QPWA 4Z1MA 4CT5A 2V3CC 1VCNA 1H8EA 3P26A 1QVRA 1L8QA 1RW4A 1RJ9A 1JB1A 5KNBA 1OFTA 1L7VC 3W6PA 4O3MA 1XX6A 1N5LA 5FR1A 5JS8A 4BLRA 3EPLA 1LNZA 1RYHA 2QROA 1KI6B 1P75A 1NBMA 2NO0A 3LRPA 2JIZD 1KMQA 1JPJA 1CJMA 3AKDA 2HXSA 3H86A 2EYQA 4YQFA 4JL5A 2DFKB 2NO1A 4QGAA 2F3RA 5DE3A 1UAAA 2ANCA 5H1YA 4BFYA 2OILA 3UANA 1OFHA 3OF5A 1I4LD 2XGJA 3UG6A 1D9XA 1ONBA 1UM8A 3AF2A 1SHKA 1XBTA 2NO9A 2BCGY 2J45A 4Q02A 4TZ0A 2O8FA 2AX4A 4NYMR 1NN0A 1P3JA 2XJ4A 4A82A 2OBLA 3QXHA 4I1OA 121PA 2ZJBA 1ZM2A 4HLDA 2G1JA 2X1VA 1TQDA 3BRWD 4Q03A 5GVRA 2QSYA 2Z4SA 2GJ9A 5FUWA 3GJ0A 1P2UA 2JLRA 4V0NA 4DEYA 1T3LA 1ZUIA 3GJ4A 4TLCA 4A6XA 1TUEA 2OLKA 4F4JA 3R9WA 2W6ID 1GSIA 2A5FA 5E3HA 3ZQJA 2QE7A 1X1SA 2NMVA 1XTQA 1LV7A 1MOZA 2XX3A 2SHKA 3FPAA 1IJFA 2QMEA 5EE0A 3NDBB 1JNYA 2JDIA 4QGGA 4M1SA 1N6RA 1T8UA 2WSSA 3TUIC 4D4KA 2PZGA 3B1YA 4II7A 1JXOA 5KO2A 3SJCA 3BB3A 2YC2C 1OH7A 2FFQA 3CWQA 4WAUA 3WP0A 2JA1A 4QOSA 1GRQA 4U5XA 1WF3A 4KI0A 3SJBA 1YZTA 2AD1A 1KK2A 1N6PA 1P2SA 1P62B 2J3EA 2PZFA 4FINA 1FW6A 3NHAA 2ZI3A 1EFTA 4FXPA 3DKPA 4ESHA 4XWOA 1E2GA 5F3WB 1VCOA 3CBQA 3P20A 1FP6A 3BOSA 2X2EA 3QF4A 4D2IA 4B35A 3CNNA 3CONA 3NG1A 1A5TA 5JRJA 3FKQA 5AUOB 3K0SA 2GBLC 3P27A 1OJLA 4A4DA 3K0CA 3CRRA 1X6VA 4MDEA 4IVRA 4KV9A 4O2RA 1X1RA 3MSXA 1VG1A 4OJQA 4EDHA 2Z5FA 4Z8YA 1XD9A 3THXA 3OHMA 1E79A 1U0HC 3D31A 5LD2C 1U90A 2WJIA 4GI7A 3BB1A 2C96A 4Q9IA 5KSPA 1SKQA 1KK1A 4OI1A 1D2NA 3RC3A 4XJXA 2L0XA 1P73A 2IYWA 1W36C 3HP1A 2ERYA 3LY5A 4XTCS 3A1UA 1FMLA 5J4YA 3RABA 1E9SA 2GA8A 3D3QA 2ZSFA 1KO1A 1KK0A 4QJ5A 1R2QA 1Z0JA 1FL9A 2Z4RA 3D6TB 4AD8A 4PSKA 4P3YA 5AWFC 4TYNA 2ZEJA 3PEWA 4HDOB 2O0KA 1BYUA 1XTIA 3NBXX 4JLDA 4Q18A 3SNHA 3TSWA 3ZZUA 4Q21A 2QMOA 2Q3HA 2YVUA 2QORA 3GEHA 4EPVA 3BH7A 2QN6A 4LHVA 2ZU6A 2E1RA 2QTFA 3UG7A 1XXHA 1ZD1A 1GFIA 3LBHA 4KLNA 1HT2E 4R98A 4V03A 4J0QA 1LTQA 1F2UA 1HY3A 4CT4B 2Z43A 3U44A 4C7OB 5IT5A 1YZGA 4HLCA 2GILA 5DH9A 4M1KA 4RD2A 3K0AB 1X8JA 1PLJA 4NKRA 1XZQA 2H18A 4FMCB 4HLUC 4ZDWA 1T4GA 3OFNA 5J5CA 5CDFA 1HURA 1PV4A 4B3CA 3V9PA 4ZCMA 1SVWA 2QA5A 3QBVA 1W4RA 1U99A 2CBZA 2CLCX 1TU4A 2CK3A 3VR3A 3WY9A 5FPYA 1KI2A 2ZJOA 4TTPA 3EPJA 5F9FA 3C5HA 4B48A 4I1UA 4IFEA 3NWJA 4HATA 2WOOA 2YWHA 1A82A 3J81k 5LBIA 3OEHA 2O8DA 3L0PA 1A4RA 1T8TA 3IBGA 5IDVA 1DAFA 4OK5A 1W48A 1CRQA 1XB2A 2QM7A 3LVQE 3K53A 1ELOA 4V0ME 4DXAA 1R4AA 1OH5A 3SOPA 3W3AA 3ZIAD 2KB0A 3RVBA 1WQ1R 1CJVC 4KFUA 1XEWX 4PR0A 4DCUA 3B1WA 3VNUA 3ECCA 3I5YA 1KK3A 2NIPA 1OB2A 1LVGA 4ZPXA 4OBEA 5JCZA 4UXIA 1E1QA 4OQNA 4LC0A 5HR5A 3TRFA 3K1JA 2GXAA 3TNFA 3EA5A 2KBEA 2BMJA 4KLZA 1IQPA 1E9BA 4CGZA 3B6EA 3LQQA 5KOYA 4A8JA 2GETA 4KYIB 2IC5A 4DHEA 4NDZA 2GXUA 2QAGA 3A58B 4D6PA 1N6HA 2Z0MA 2ZRAA 3D8BA 3MJRA 1L4UA 4Q4HB 3ZS9A 1RRCA 4S2EA 1EWQA 1RVDA 4TL8A 3I73A 3ZZ0A 2BCJQ 1EK0A 4I1VA 2G88A 2HCJB 3PENA 5K8LA 5G40A 2FFAA 2FX3A 2ZQ5A 5DNYB 4A0GA 3HU3A 1Q21A 5JHHB 2OBMA 1G6OA 3L82B 4PAMA 2HT1A 2CMKA 2WOJA 3C41J 4LYHA 1QBKC 3HU1A 3NC1C 3A36A 1GNQA 3UMRA 4F91B 1RRFA 4TLEA 5F98A 3TQFA 3QXJA 4DLUA 2ZR9A 2FGJA 1KSGA 3GJ8A 4FCWA 4PQFA 2J7PD 2YWFA 4PFSA 1SULA 1JR3D 1FZQA 4FN5A 5E7MA 1T3HA 3T61A 1FPMA 3P4XA 4UNQA 3A4LA 2ZS7A 5C18A 3AV0B 3SBDA 1VCMA 5H70A 1MH1A 3K9GA 4OI2A 3CNLA 1TQ4A 2WICA 1KI8A 2H92A 1XTSA 4GSYA 1BS1A 1S8FA 1WBBA 3BFXA 4NYMQ 1NI3A 1I4TD 3UKDA 4C2UA 2V1XA 1ZCBA 2HEIA 1KSFX 4M4SA 521PA 1W7AA 2ZXUA 1IOZA 1KSJA 4BWYA 4DLXA 1RKBA 2FGKA 4LV5B 3B8HA 1N2CE 2WWIA 1CR2A 4XOIA 2KSQA 4DBLC 3C7KA 1QHIA 3T06B 1IXSB 2FH5B 2WBLC 4IDQA 3D7MA 4Q7JB 5AJZA 4BGDA 4QL3A 1KI3A 3K9NA 3DO6A 4GFDA 3O8CA 2F7SA 1DS6A 2ZR7A 1U8AA 2W6IA 1G4AE 3GJXC 1W4BA 1ZNXA 4XVRA 4ZO4A 2ORVA 4JVMA 2EVWX 3SU8A 3EG5A 3DKVA 3OEED 3BAFA 4GMDA 4LY6A 2I4IA 3WNCA 2ERXA 5D3QA 1BO6A 2BM0A 3MWKA 1YZNA 1JPNA 3IEVA 5EP1A 1VG9B 4YMTA 1G5TA 5JSZB 1G3QA 1KNQA 4AKGA 3WYGA 1Z0DA 2ZJ2A 5JZVA 2YV5A 1C1YA 3W3ZB 1E3MA 4IFBA 3PEYA 3TVDA 3O47A 1GWNA 2OAP1 3RSOA 5CB6A 2VHTA 2R65A 4GL2A 3L43A 3F0TA 1XEXB 2FPMA 2N46A 4POAA 4WA7A 3ZDQA 4GNKA 4AYTA 4GDFA 1HTWA 4ZKEA 3RAPR 2GEDA 1DPFA 1G1MA 3NC0C 5EP4A 4Q9KA 4PQRA 4NTZA 1S0UA 3IDQA 1L2TA 1SXJD 2I3BA 3CF2A 2MMCA 5M04A 3ADDA 3T35A 4EJSC 721PA 1FP7A 3U5ZB 3K9LA 4MITA 3NBYC 1Z8FA 1NMZA 3B78A 1OKKD 3UPUA 3V00A 2RH5A 1KMHA 3BJIC 4NE2A 3KUDA 5G3YA 4BFZA 5SZHB 2EFHB 3B13B 1NJFA 4TQAA 4CEJA 3LV8A 1IHUA 3UK6A 2GZHA 4Q1AA 3OIYA 2CNWA 1IBRA 1GTVA 1KDPA 3Q5DA 5LPNA 3Q85A 2JATA 2HCBA 3OE7A 3KKPA 2FN4A 4JLPA 2ZITA 4DC9A 1GILA 4AYXA 1AK2A 2ZR0A 3CZPA 2OO7A 2WAYA 3SBEA 2IUSA 3JVVA 1GL6A 4L16A 1DELA 2J59A 3LX5A 4DKXA 2UVQA 3N2IA 5BW8A 2J46A 2J87A 4FI3C 2D62A 4RVCA 3TJZA 1WXQA 1A7JA 3PXGA 3SN6A 2ZJ8A 2ZRJA 4C0LA 821PA 3X1ZA 2JDID 5JI2E 2YWEA 2GESA 1SZPA 3QE0A 4NYJR 5DSZA 2D3WA 3THYB 2FF7A 2Q6TA 2V54A 1RE0A 2OM2A 5LD2B 2H1LA 3C15C 4M21A 5BQ5A 4EQ6A 2O8CA 4HZUA 1BYIA 2RGNA 1RYFA 2JLZA 1RRPA 1FX0B 1KI9A 2PT7A 3GLHB 3GLHE 4G0NA 4DDVA 2V1UA 1KDOA 2ZS8A 2IS1A 1ZNYA 5L3VA 3RS2A 4DIEA 2J0QA 1W36B 4BFUA 4B3GA 2V8OA 2GF9A 2A2ZA 4LV6A 4O0MA 5DIFA 3TQCA 4B73A 5KDDA 4R2IA 2WWHA 4B2PA 1FNNA 3BK7A 3U60B 5K8TA 5H8WA 1XDBA 1WCV1 4TYQA 1PUIA 4NH0A 3AVTA 2IYRA 5TARA 2ONKA 2GDJA 2XNSA 4DSUA 2NG1A 2F1RA 1DAKA 2XTNA 3IIKA 1KI1A 1WBDA 1BKDR 4AG5A 4EPXA 1ZAKA 4C0KA 3GJ7A 2XTMA 2CXXA 1ESNA 4G5OA 1Z0FA 4RFSA 3AVUA 1JXMA 1P60A 4ACAA 5JJIA 3NKVA 4DCTA 2O5VA 4EAQA 1E79D 5EXXA 1AGPA 2J0UA 1OF1A 1ESMA 1N6LA 3PITA 4B43A 4KO8A 4CEIB 4MRSA 2BJWA 3CR7A 1NP6A 2OESA 2QGZA 3DEFA 1YR6A 4UNRA 4A1FA 1Q1BA 1NKSA 2VHUA 1UFQA 2BHRA 5L3QB 4KSCA 1HQYE 3AF0A 4E5UA 2BM1A 4TYPA 2HF8A 1Q20A 5BN3A 1KO8A 1Z07A 1R8QA 1WDTA 3OZXA 4IDPA 4NYIQ 4JVLA 1KOFA 1Z0IA 1SVIA 3H4MA 4OYHA 5AJVB 5J4HA 1VECA 4WW0A 1M7GA 1R5OA 1GNPA 2ZRKA 3MMPA 5FBVB 3BIFA 4FMBB 2IYXA 4PXAA 3WHKA 1GUAA 4LCBA 5F2EA 3GLFA 1CJKC 1XTJA 1US8A 1U0JA 2EFCB 4EUNA 3U7EB 2CJWB 1IN6A 3WP1B 2AKYA 4M1YA 5L3RA 2OFOA 1GIAA 3SFVA 3CRMA 1E2LA 2H17A 1UKVY 3WYFA 3GLIB 2C04A 3GLIE 2YOGA 3CF0A 2ZJZA 4HB4A 3RS4A 3VKGA 2OAQ1 2AK2A 3FE2A 4LSGA 2ZRLA 5C1BA 4WBSA 4RCYA 3I61A 1PVOA 4YXWA 2P65A 3QY0A 2XZLA 1TL7C 1NVWQ 4DLRA 5IRCD 2GCNA 3K0CC 3ZYCA 4BLTA 2JASA 4KITB 2GXQA 1T0HB 4WVFA 2GXSA 1UBFA 3KKNA 3L0IB 3G0HA 1E9AA 1ZD9A 3KXLA 4N1AA 4MKFA 4E07A 1DAHA 4JYBA 2EW1A 5HTKA 4OL0A 2YYZA 1JJ7A 3RHFA 4TMTA 3MCAA 3K9HA 1IXRC 4IXMA 4WOPA 4NCJA 3VU9A 2ZE6A 4A0HA 5C2JB 1TADA 1W2GA 3V4FA 4LYJA 1JR3A 2YHSA 5EP3A 2CL6X 1OXXK 3MD0A 1S9DA 4IEEA 4TMKA 2Q9AA 5ANRB 2NPFA 1GAJA 1E0JA 2EFEB 5FBWB 4ZI2A 3UATA 3QEJA 2PT5A 5CM8B 5CK5A 4LYFA 3QPUA 5EE5B 4ZDIA 1MABB 2JEOA 1YVDA 2ZJAA 4AYWA 5BYKA 2YC4C 3LX8A 3ZVMA 3KZ1E 2C98A 4KFSA 2YKGA 2YOFA 5K8UA 4QHTA 1A2BA 3THOA 1E1QD 3Q5EA 3WYAA 2A5GA 2OHFA 2VYFA 1S4QA 1IY1A 1ZM9A 1X86B 4XD7D 1FTNA 3SJZA 1AN0A 2JJ1D 1E99A 3QUSA 4OQFA 2QBYA 4ZIRB 2IHBA 5GJCA 4A36A 1G41A 4OQMA 2CHQA 4HAWA 3AP1A 4A6PA 2RHDA 4Q5IA 2C9OA 1U94A 3R9IA 5JBQA 3SYNA 2VO1A 3LBIA 3SDZA 1NIJA 1UEJA 4RCZA 2YZ2A 3P32A 2FSIA 1G7SA 1KAOA 1U8ZA 1XFAA 4C30A 3SYLA 2ZRPA 3FMIA 4ARZA 5LB4A 5KNDA 1R0ZA 2FNAA 1P9WA 2FWRA 4V0LA 5EUMA 2DBYA 4B3FX 3VX3A 3ADBA 2GVDC 1QRAA 2F43A 3FTQA 5FTJA 3Q3JB 1CS4C 3GQBA 3VR6A 2DY1A 2WJGA 3T5DA 1X3SA 1II8B 1ODFA 4DLZA 3U4QB 1E2PA 4F4CA 1I4DD 3HYTA 2ZUCA 2QG6A 5FTLA 1E2FA 4FCVA 3BFKA 1LF5A 1S3GA 1HUQA 5EJEA 2UKDA 5SZJA 2YWGA 2AXNA 3KKMA 5EUQB 1SXJA 4PPQA 3AVYA 2BV3A 1A2KC 5KDOA 5BN5A 1ZBDA 1SVMA 3KB1A 2BVNA 1Q12A 1CKEA 4FMCF 4NMMA 1OKKA 1UBEA 4LUCA 5FR2A 1J99A 4IOJA 4EPWA 4FW9A 4TZ6A 3QXCA 5CJ2A 2PJRA 2V6JA 3TVTA 4JYCA 1E2QA 1Z08A 1AA9A 3LW7A 4A8JC 4TYWA 1S3SA 1U0LA 3CPJB 5C4GB 3GEIA 2QAGC 1CIPA 4YMSA 3ZQ6A 2W2TA 4MDFA 3R8FA 4MGYR 2A5DA 5KSYA 4AC9A 1SVLA 3DVLA 1E9CA 3FHCB 1P7CA 2ODWA 1E2DA 1Q0UA 1VYTA 4XVQA 1Z47A 2ZRBA 5KDLA 4CEHA 2F6RA 3LBNA 4H1UA 4I81A 4OI0A 3L0OA 4B3BA 4EJSB 4XSGA 5BYJA 1BH2A 3R20A 4W9MC 4NYJQ 3I62A 4F93B 4HUQB 4HZIA 3T5GA 2FDCA 5IK2A 3EW9A 2VEDA 1JAHA 3DDCA 5GJBA 4NZYA 3B1VA 1KYIA 1TQ2A 2WTUA 2PX3A 3IIMA 2ZVPX 1XMSA 3CIOA 2RGAA 1YU9A 3RLFA 1W1WA 2ZI5A 1YKSA 2C9YA 4ASUA 3G82C 2NOAA 3CB4A 1DTSA 3UMSA 1KGDA 4MYHA 4B74A 4BLOA 2OZEA 3K70D 2A3RA 1CBUA 1CJTC 1Z22A 3HPRA 4M53A 3FGNA 5FTNA 3EWSA 4L5BA 3FMOB 2XZOA 1IY2A 4TT3D 1KO5A 2JLQA 2AFIE 4F92B 5TDHA 2DWPA 2ZRNA 3GFPA 2HJGA 4PSAA 2O8BA 4IEIA 4PZZA 3IO3A 4HAXA 1JECA 5A5GA 2IXFA 2JLVA 4KSBA 3UMFA 3F3YA 1QVAA 2OE2A 1E69A 4FIDA 3K0FB 3CX8A 2QSZA 3EXAA 4O25A 5EXTA 4Q1FA 2JCSA 2VHQA 2GNOA 2B21A 3AKEA 1P9NA 2OCBA 3QENA 4B33A 4PC6A 4QG7A 4BRUA 4BE7B 2X77A 5D3MB 1JR6A 1RJ9B 4MUAA 3U7HB 2YNMA 1ETUA 5B2ZA 2WWGA 3KQHA 4URXR 3LW8A 4G5RA 2QU8A 4CZ2A 2BBTA 3CRW1 2CNWD 1GRRA 3QKRA 4V0MA 1HH4A 3OE7D 2DFNA 3ICQB 2GRJA 5TMPA 1XNJA 4HAYA 1UEIA 1IONA 4W7SA 3RDPA 3U3OA 4BASA 2WKQA 5EXPA 2VP0A 4TMZA 1SKYB 1SKYE 2OG2A 4WZAE 2WHXA 4Q9JA 5KNCA 5JRZA 2QGNA 2ZI4A 3PEUA 4BLPA 1GKUB 4CRWB 2O8FB 2NZ8A 2HYDA 4BLSA 3SS8A 3Q9LA 2G0NA 4IDNA 4PQYA 4QRHA 5TY0A 1YHNA 3H0KA 5L3SA 5HKKA 1E2JA 3OIVA 5JJKA 3M4YA 3K8YA 2VP4A 2RGDA 4GT1A 1QZXA 4RFVA 1QHSA 2P0EA 3C8UA 3PCRB 1IY0A 4X8MA 1HQCA 3AGQA 1H8HA 1DO0A 2J9RA 4DDUA 2O0HA 3LLUA 1TQ6A 2GJ8A 1ZP6A 4L9WA 3N2EA 1EXMA 1CLUA 2QTVB 3EASA 2A5JA 4CF7A 2ZROA 2CCKA 5A4JA 2ANBA 5IHPA 2CVFA 4V02A 4JLVA 3R7WA 2F1HA 1P4SA 4QGFA 1HE1C 2V4ZA 3GLGA 1OLOA 3I92A 1EX6A 1G16A 1CR4A 1NF3A 4A92A 3U2QA 4CYMA 3KXKA 3B9QA 2GJSA 3CF6R 4KBFA 5AUPB 2WIAA 2E87A 4TLAA 3MWJA 4QHYA 4TN1A 3EC1A 4HAUA 4R9UC 3R9XA 2HLDD 2B7CA 1EX7A 2G6BA 1K5GA 3DPUA 2WIBA 2P6RA 1EFUA 2VTKA 3A1WA 1W5SA 1TF2A 2IK8A 4LZZA 4DEXA 1ANKA 4MYTA 3TIFA 3TR5A 3QF4B 4EPYA 4M2LA 4MRRA 1C9KA 1EFCA 2IX3A 4KFRA 3AVWA 4L9SA 2RGGA 3CWZA 4IJMA 3R8CA 4DT1A 4Q01A 2GZDA 4HDQB 1ZINA 2QPTA 2RGXA 4PTLA 4Z51A 1FNMA 1GRNA 4NYIR 3THXB 4Q00A 3T1VA 1UPTA 3NEJA 3B1ZA 2RGNC 3AF3A 2CHVA 2ORWA 4URWR 3BE4A 5FUVA 3VHLB 1AM4D 2JLUA 1GKYA 1LS1A 4OI4A 5FI0B 1QHHA 4FD2A 4QBHA 4US1R 1XTRA 4LV8B 4XD7A 4MA4A 4N3NA 2JJ1A 3IPYA 4JLNA 2RMKA 3FHTA 5FUYA 1FUKA 4NL4H 4JJKA 3P1JA 4AWXA 1DAIA 2OCYC 1S1CA 1NMYA 1W4CA 2R6FA 2VBCA 3A1TA 3QVVA 4Q9HA 5BWMA 4Q48A 1OXSC 2IS6A 5TVKA 4MKGA 4UNNA 1G8YA 2ZIAA 3KQLA 3AP2A 2TMKA 2W0MA 4YXWD 5JWOA 3SI7A 2OV2A 4BQSA 3VX4A 1CR0A 2HV8A 4LHYA 3H2YA 1WP9A 3CH4B 2QNRA 1D2EA 1ZNZA 4GZMA 3ASYA 3WNBA 4AI6A 2V6IA 4DLVA 2P67A 4URZR 5HE8A 2G3YA 2LWIA 4TSFA 4M1MA 1E2NA 2PL3A 4U00A 5EE1A 5FPTA 1YZUA 1M74A 3U3RA 1YJ5A 2PEYA 4RJLA 5KSZA 1F2UB 3TLXA 3AF1A 3E2IA 2J41A 2PBRA 5EZ5A 3CZQA 1AS2A 2DB3A 1FUUA 3U44B 3ZD6A 5CIWA 1J8YF 3BS4A 3RRMA 5KUTA 4CIDA 5JLJA 1E9DA 1K5DA 2QEQA 3HYRA 2JLSA 3MWLA 5DYGA 4QC2A 5CDFE 4A2WA 1XU4A 1DADA 4LPSA 3DM9B 2IXEA 4YMVA 3KKOA 3SQXA 4DLYA 2BMDA 4JVNA 4BFTA 1G19A 1NVUQ 1O3YA 1Z6AA 4FMDB 4DLWA 5GVSA 2XSZD 2P5SA 1NLZA 1OV4A 3GJ6A 4M9QA 5CIQA 4L8GA 1M6NA 5CJPA 3THWA 1JBKA 1Q57A 2C99A 2O8DB 2ZRDA 3VR4A 3MLEA 1OIWA 3I8XA 2ZSAA 4HB3A 4ZKDA 1BIFA 1EGAA 1Q44A 2QTHA 2UZIR 3A1SA 3CPEA 2Q0HA 4IOKA 4PHTA 1EFRA 5G3ZA 1NVVQ 1S1MA 5FPHA 2QQ0A 2R6CA 3IKJA 3X1XA 4C0JA 4Q1DA 5F9HA 4A2PA 1G7CA 2RKOA 2WJYA 4DIDA 1N25A 4XVUA 3FMPB 1ZU4A 2N1BA 1G4UR 5DO9A 1AJEA 3A4MA 2ORIA 1JEDA 3W8NA 3PUYA 3ADCA 4Z54A 3W9YA 3LVRE 2I1QA 2CHGA 3W8RA 1KI4A 1OSNA 4TLDA 4EFLA 2QRZA 2A30A 1IN8A 2BMFA 5J40A 4P31A 1D2MA 1Z6YA 1E9FA 4N0EA 2QUZA 5EZ6B 2YOHA 2A7QA 1E1RD 1SVSA 5L8VA 1IN4A 5GJVC 3SEAA 4A8JB 5JEEA 3T1TA 3GLHA 2P6UA 4LHXA 2PX0A 4RZ2A 3TSZA 4H9GA 1VYUA 4Q19A 2QAGB 4HDCA 3EX7C 3LQRA 4MRNA 4YONB 3EZ6A 5TV2A 4EIWA 2PH1A 3K09A 4TT3A 1Z6GA 3OAAA 2Q9BA 1DG1G 4GOJA 1E2IA 3FFBA 1AS3A 1Z6TA 3ZZTA 1BOFA 1UBGA 1P6XA 2GEUA 3KQUA 2EQBA 2BKEA 2ECKA 4HB0A 5KYKA 2W58A 2B6HA 3GD7A 3TH5A 1U81A 3BH0A 1XD8A 3TE6A 4AIIA 3IHLA 4QM7A 3L0SA 2H8KA 1AGRA 4DUGA 1XPOA 4X8HA 4LX0A 2Q9CA 2IYUA 3BB4A 1KO4A 1TU3A 3C4JA 4IVPA 4MGIR 5JS7A 4PAOA 1PLLA 2IWRA 3SFZA 3UXMA 4IDHA 4NCKA 4ILEA 1NSFA 2FE4A 3MWYW 3KDSE 1XRJA 2CVHA 2FOLA 5DI9A 1WB9A 2ASEA 1YR8A 4KVGA 3TMKA 1YR9A 2D2FA 4B6EA 5FOSA 5CYPA 3FOZA 4K46A 1QDEA 3HWSA 2D4HA 4GZLA 4B6FA 1IM2A 2MSDB 2R6DA 4KCGA 2ZUDA 4Q4AA 1TNDA 3FKSD 3PUVA 4R2HA 1RC8A 4TTRA 3NBFA 4XSHA 1JQLB 4PAQA 3PV0A 2KI5A 2YINC 2OBNA 4L4UA 4WXPA 4RD4A 1FQJA 4YMWA 5DGXA 2R2AA 3RRYA 3TUJC 4ZDJA 3KTAB 4G5GA 4LJ7A 4OHZA 4Q1BA 4BFXA 5IK2D 3LAWA 2WVJA 4XTRA 4QFMA 3QXXA 1SVKA 1F60A 3HDTA 4AKIA 3W6OA 4Q7LA 4NHOA 4I4LA 4C9BA 1ZVQA 1WRBA 2XB2A 1E2HA 2R6AA 1C4OA 4ASUD 1MRSA 4UXJA 1U8YA 1NLFA 2WWFA 4BLQA 1W0KD 2D74A 1PUJA 4PO9A 1KIMA 1ZW6A 2AR7A 1LB1B 2AL7A 1M1YE 4X8LA 1GZSA 5JHGB 2EFGA 4OHVA 4C0BA 4URUR 1KKMA 3BBPA 2NO7A 1NIPA 1ZYUA 2WJHA 1II9A 1NLYA 3EARA 4DSOA 1SXJC 4D26A 5FBRB 2FMXA 3LXXA 3EIHA 2OXCA 4PC1A 3L8ZA 1VHTA 2ZE8A 1KI7A 4JLJA 2PJZA 1D8TA 5AJWA 2JLYA 1R0WA 4DB2A 3LD9A 1FMJA 2FFBA 5DYIA 1OW3B 3AP3A 2PLRA 2ZI6A 2HLDA 1F2TA 4EPTA 3C14C 3Q8XB 3ONWA 1N6KA 1DAEA 2CE7A 4TMXA 1E0SA 4C0HA 2IBMA 3S1AA 4UXHA 1XP8A 1GP2A 3GFTA 4QBIA 2FPKA 2FSGA 4AKEA 1NY6A 2IYVA 4BZXA 1OXTA 2FEMA 3KL4A 3TAHA 3N70A 4JSTA 2DWQA 2WMOB 4LRWA 1RFLA 3B85A 5KPDA 3W5JA 4NBSA 4W5HA 2OCAA 2W6JD 3AEZA 4OK6A 3SC3A 3KQNA 3DZ8A 1Z28A 1ZM3A 3PJRA 1E9EA 3B5JA 4DCVA 5FL7D 3C16C 4UJ5A 2UZ3A 2EYUA 3U6KA 2O8EA 1KZGB 1G8FA 1KMHB 4RD0A 5EXSA 3BH6A 2QT1A 4YDSA 2BEKA 3AKYA 3AKCA 5DHAA 1G291 1UJ2A 3HR8A 2WWWA 2J0SA 3L8YA 1OT3A 4CEJB 3RNLA 4JVSB 5HKKD 4B2IA 3JZAA 5B58C 2QZ4A 5DI3B 2DPXA 2ZRIA 4LBYA 3FYHA 2B8WA 2NZJA 1ZJ6A 3NH6A 4RD1A 3QKSA 2HDNB 4UNPA 1Z0AA 2RHMA 1VYVA 3PG5A 3WBKA 3GJ5A 4IW3B 5JMTA 3SYKA 4G5SA 1H8HD 1W49A 2G0TA 4KFTA 4HSEA 1OPXA 3LDAA 3TUZC 4C2TA 1NN3A 2J1LA 3EZ9A 1KY3A 1R8SA 4Q4JA 4ACBA 3KJEA 3HJNA 3G5UA 4LBVA 3DL0A 5JFGA 2ATXA 4PHFA 3Q72A 3KX2A 4D4MA 5FL3A 3ZD7A 4MGZR 3SHFA 2GJKA 2O8CB 5H68A 4EQ6B 2QAJA 2D06A 2KE5A 3HU2A 4GPTA 2VH5R 2RAPA 4HZUB 4NP6A 1AQUA 3ZH9B 3NIBA 4DZZA 1KSHA 1VPLA 1QF9A 2DFLA 2HJVA 3NEYA 4XWKA 1ZUNB 3I1FA 3WBJA 3U4QA 1Z63A 2QP9X 3A8TA 2QL6A 3PVSA 4Q66C 3TR0A 2PZEA 1UKEA 3LA6A 2QP4A 2XNDA 1YZKA 1OE0A 5J4VA 1UKZA 3TW8B 2IYTA 4MKHA 1VMAA 1Z2AA 5AUNB 1J90A 2GCPA 2GK7A 1IN7A 1KI6A 5KSOA 1RZ3A 4R7ZA 5KTYA 3ASZA 1FTSA 3P4YA 2G9NA 1XF9A 2ZE5A 2VSOA 5C4MA 2IEZA 2OEPA 3QNUA 2W0SA 4KXFB 3NBZC 4QJ3A 2Q3FA 4WXRA 4F7WA 3LFUA 2VP2A 5FPKA 4GOKA 4RZ3A 3SR0A 3U7FB 4RFSB 4KJZA 4TYYA 1UADA 3EPHA 4A15A 3WHLA 2XOKD 1KO7A 3X2SA 2IW3A 4U7DA 2ZSBA 2XSZA 3EZFA 5JCPA 1W5TA 2AXPA 2ZSDA 2ZVQX 2J0UB 1V43A 3FDIA 5KU1A 1N5IA 3CLVA 2KJQA 2P3SA 4NCNA 3X1WA 2XXAB 2AFHE 4C0AC 2REBA 3QG1A 2ZRFA 1G3RA 2QMUA 4TQ9A 3FB4A 3E5HA 2XEXA 4I99A 5EP2A 4PZLA 5BXQC 1OYWA 3REFA 1JEEA 2DYKA 4P4SB 1ZCAA 3VKHA 3GP8A 4QM6A 4FCTA 2CE2X 2ZJYA 3MAAC 2BOVA 4DRZA 2QT0A 2BMEA 1GL7A 5SZKB 2AWOA 3QVUA 4EPRA 1XJQA 8OHMA 4EFNA 1TUIA 1UDWA 3KFXA 3VKWA 1E1RA 1PJRA 4P4UA 2PMDA 3AVOA 4KHZA 3ND9A 1VIAA 4ZV4A 1CP2A 3LH5A 1GOTA 2BBSA 2IUTA 3KJHA 4YC7A 2VHJA 3I32A 1ZRHA 1G3UA 2RB4A 3IBYA 3QF7A 4TSFD 4BZPA 2F55A 3UWOA 1M34E 2QQEA 1GL9B 3KXIA 4HAVA 2CL0X 1E98A 4B44A 1Q22A 3T1QA 1E4VA 2IT1A 5KPJA 4LBZA 3WRXC 2GEVA 2PMKA 1R10A 3NHBA 1S96A 2YJTD 1J8MF 2Z83A 4P0TA 2VP5A 4B34A 1G3IA 3PR1A 1E94E 4Q7KA 2JGNA 3VAAA 3VTKA 3K0EA 3QEOA 2WWXA 1QHNA 2VSFA 2GVZC 3AF4A 4RZXA 1XCPA 1G7TA 1R0YA 5D3MA 4P33A 2JJ2A 4LI0A 2GWHA 3VU9B 4M8NE 3IUYA 3FVQA 1JR3E 1P72A 3AM1A 4B3XA 3LO5A 3CR8A 3U61B 3QOFA 5JWHA 2VP9A 4JKYA 2WZQA 1TEXA 1NJGA 4JLMA 3O8RA 1NVXQ 1II0A 1ZM7A 3BC1A 4A0RA 1EFRD 4AY2A 5C46F 1X8KA 1Z83A 3FKSA 4G1UC 2H7VA 2C03A 1D9ZA 1NVVR 1SGWA 2ZAOA 2LKCA 2DWOA 3DMNA 3PQCA 1OIVA 2WPDA 1EFHA 1EWRA 3VFDA 1DAGA 2VSXA 4F38A 5P21A 3Q7QA 2GKSA 3B7GA 3RS5A 1ZIOA 1CRPA 1NN5A 1XPUA 2BBWA 3AB3A 4QHSA 3CO5A 4JLOA 3KFVA 4Z8XA 4ZCLA 2ZJ5A 3U3KA 2R8RA 1N0VC 2OSBA 2ZYWX 4KBGA 1Q1EA 3CM0A 1G20E 5FBQB 1J2JA 4W5JA 2ZRHA 3BFVA 1W0KA 2QBYB 5DN6D 1H65A 2D7DA 4JT4A 2GF0A 4US0R 1W36D 5E7IA 421PA 2GAOA 4QJ4A 4D80A 1LW7A 2HF9A 1ZIPA 3OAAD 3MUFA 2GCOB 3JZMA 5FOTA 4A2QA 6Q21A 2QP3A 3AUXA 3CRQA 4C7OA 1CU1A 3RRNA 1NG9A 1UBCA 3K0AA 2F9MA 4XIGS 5AR1A 2A9KA 4D25A 3KUCA 1R6BX 2REXB 4ARZB 4LJYA 2VRWA 4PO1A 1OHHD 4YLGA 5AUQA 5FOUA 3T1OA 4LHWA 4XH9B 2DFTA 1DO2A 2F43B 4DUGD 1XD2B 2BJVA 4LJ4A 2VF7A 4MQBA 4BECA 4JMPA 1RIFA 5E95A 4RSGA 5UKDA 3ZVNA 1UKYA 4M1WA 3A37A 1T6NA 1J70A 2VF8A 1W47A 3T12A 4B71A 4KAXA 4OJKA 2G1KA 3BORA 5E7JA 5JECA 2JJ8A 2CEAA 2ATVA 4X8OA 1OFIA 4GRAA 3OIUA 1WMSA 2ZSEA 4Y0VA 3ND8A 1NBME 2O52A 3FFAA 4E22A 3WRYC 2ZM5A 3MJHA 3DOEA 1B0UA 1SXJB 1SXJE 2DCUA 1Q3TA 2W6JA 3I3SR 1V5WA 2NTYC 3LXRA 5G53C 2OCPA 1XWIA 2Q3MA 1E0AA 5FL7A 2ZE7A 2JAQA 4GP7A 2WWYA 2J7KA 3RYTC 2CCJA 2RGEA 1OXUA 3IGFA 4ZI3A 1D5CA 2XTZA 1W2HA 4R71A 5HCNA 3C5CA 4OK3A 1TMKA 4B3DA 1Z5ZA 1SHZA 1RPZA 2RGCA 2I1VB 3W5IA 4LJAA 3X1DA 4FMDF 2XITA 3W6NA 4DVGA 4RKFA 2QMHA 2FA9A 2IYLD 3GJ3A 3K70C 1N0WA 2FSHA 3QJYA 4OHXA 1KHTA 1G8HA 4V0OA 3K09C 2HT6A 2XZPA 2LKDA 3IQXA 4Q4HA 2RCNA 4M9SA 2IWHA 1E2MA 4B76A 4M1TA 2ZANA 5AJYA 4CEHB 1Z0KA 2XAUA 5TB5A 5HZKA 3ETLA 3IEUA 4D82A 1OYYA 3ZLJA 1NY5A 2GZAA 4UNSA 5FBLB 1VTKA 1DOAA 2AWNA 2BBOA 4JBXA 2R62A 221PA 2OLJA 4PZYA 4N0DA 2CLSA 1MO4A 1ZD8A 5B30A 1K6MA 1UF9A 3Q7PA 1CR1A 1CF4A 1VIYA 1QHGA 4PHGA 4TL9A 1CEEA 2J0VA 5BN4A 4FWTA 4KU4A 1KDTA 4B32A 1E4YA 5B64A 2QPAA 1XZPA 1OIXA 4CDGA 1CXZA 2QRNA 4BZQA 1OFUX 1HYQA 1U2RA 1AQYA 3FHOA 1QHXA 1KZ7B 5A0FA 4Q4LA 1VDZA 2WM9B 5TXGA 1QHYA 2O8BB 3LWNA 3ZVLA 1Z06A 1AZSC 2GTPA 3EZ2A 1U9IA 4I1SA 4C4PA 2P6NA 2N42A 2PLFA 4K8OA 4M1OA 4QKQA 1FQKA 2VLIA 4MUBA 4D81A 3BXZA 2G83A 2W83A 1Y3AA 1R5NA 3VNVA 2XOKA 3DOFA 1T5LA 4LGMA 5K8IA 5AK0A 4YMUA 3NDPA 2ONJA 3H84A 1JAIA 1HA3A 1OXVA 3CX6A 1YZQA 2C8VA 1YZLA 4LJ6A 2IA5A 3VR5A 3MGCA 2R44A 3QKRB 2B92A 4B75A 2XJ9A 4EKDA 3DM5A 4HI0E 4RZUA 4PC7A 1COWD 3U7GA 3VHXA 2EWVA 4TMVA 2Y8EA 5FUXA 4TL7A 1GNRA 3U6BA 2W00A 2CCGA 3ZGXA 4DDTA 2BIFA 1PLKA 4ERNA 1PZNA 4TQUS 1NRJB 4XWAA 2VP6A 3EPKA 1P5ZB 1N5KA 3PUZA 2PCJA 1M7BA 1DARA 5JSZA 3SE0A 2F1JA 2WAXA 1T3SA 3LNCA 1MV5A 1DE0A 5L3SB 3QXSA 1XEFA 3M1IA 4W5WA 1BMFA 2W2XA 1Q3HA 3VR2A 1W0JD 3RC8A 1AKYA 1XCGB 1YR7A 3OIWA 2D7CA 4G3XA 4E09A 2F9LA 4JBYA 4IOMA 4DJTA 2OFWA 4JLKA 3WMGA 1YRBA 1XXHB 1XXHE 3FMFA 3U3MA 1HE8B 2WKRA 4PSVA 1XEXA 2MSCB 1I2MA 3CW2A 2XNDD 3IQWA 1E2KA 4JJZA 3I5XA 4GMXA 5KHOC 1KJYA 4JKIA 1B23P 2OUKA 3EWAA 5HZHA 4RD6A 4S35A 1A1VA 5FTKA 2W2VA 3R7WB 2FZLA 3AVXA 1LY1A 1T9HA 1E0KA 3GLGE 3GLGB 2FG5A 3UWKA 4AK9A 1Q1QA 4KVAA 4AKHA 4ABYA 1DBSA 4PHHA 2WKPA 2ZRGA 3BD9A 4LWZA 1QG2A 4D0GA 4LYAA 3KKQA 1X8LA 2IXGA 1YQTA 2HXYA 2IL1A 2WMNB 4HB2A 4TLBA 2IS4A 1XCMA 1XMJA 2Z6VA 1G21E 2OFXA 4NCHA 2GK6A 4YDHB 1Z3IX 2F1IA 1KJWA 3PUXA 4JZKA 3ZVRA 2X19A 4C3ZA 1P2VA 2O0JA 1G64A 1GG2A 2JIZA 2H16A 2FEOA 4LDJA 4JBWA 1OH6A 1JI0A 3O8DA 1P2TA 3GMTA 4UKDA 4IRUB 4MRPA 1G8PA 4BFVA 2B7BA 2AHOA 2FU5C 2GBLA 3QBTA 1DG3A 3QPVA 4AG6A 4DT1B 621PA 4JS0A 4V0KA 1M2OB 3NVAA 2CDNA 4Q7MB 2IS2A 3WMFA 1NNEA 1CJUC 3KTAA 5FOXA 2VIIA 2EFDB 4WIAA 2JLWA 2QENA 4PPFA 3THYA 1KKLA 3ICEA 1E32A 4FWIB 4DSTA 2E9SA 2C2HA 5B57C 1AIPA 1P9RA 1QHHB 4OKSA 5G41A 1N3BA 1FX0A 1DEKA 3WXMA 4AURA 4URYR 4DWJA 1G7RA 3GCGA 1F3OA 5DN6A 3N5CA 4JLAA 1XMVA 2QI9C 2CLDX 3MG9A 5JWRA 4IKEA 1ZC3A 3B1XA 3B2EA 4LJ8A 4ESVA 4LJ5A 1WE2A 1UDXA 1YRAA 4Q1EA 5SZIA 3TK1A 3BGWA 3CH5A 2VL7A 5FH9A 2V7QD 3L2OB 2EU8A 3SHWA 1OHHA 2FPLA 4IOLA 5CLQA 4RD3A 5GADl 4TWZA 4D0NA 4C0SA 2IF2A 3RSLA 4DSNA 2IUUA 1FOEB 1FFHA 1E96A 2A5YB 4QNMA 4D4LA 2RGBA 2ODEA 4DDWA 4QNRA 4Z1MD 1RRGA 2IYSA 4NPHA 3KQKA 3ZJYA 1H8ED 1OB5A 4C0QC 5ELXA 1GVNB 2JJ2D 2VPPA 3F5FA 4B2LA 1ZMXA 1NN1A 2IYZA 4M9ZA 4IVQA 4ZCIA 5JJLA 4CEIA 1E9RA 1XTKA 2VA8A 3X1YA 1Z6XA 3DMDA 5CB8A 1Y63A 1S9HA 1VG0B 1IXZA 4JT2A 3CX7A 1LS6A 1NBMD 3AVVA 3ZS8A 4K81B 4JSYA 3AVQA 2BKUA 3I4LA 1T5IA 3HR7A 5L3QA 2R6GA 1G9XA 1W46A 1EG7A 3EC2A 1XEWY 4ZDKA 3EIQA 4OQXA 4HLUA 2P2LA 3A6PC 4LC1A 4DLTA 3RANA 2WPDD 1E2EA 3AH8A 1JJVA 2Q21A 4G01B 3WNDA 1GM5A 1TTTA 2LCFA 3M6AA 2NPIA 4OQLA 1M7HA 5LB2A 4D4JA 5FFMA 4LJ9A 1JQJC 2FFHA 3THWB 3IPXA 1MKYA 3A4NA 3TKLA 1MO5A 2CJWA 3AVPA 3DHWC 2AD5A 1G6HA 5DI3A 4BEJA 3LLMA 2ZU0C 2WJJA 3RS7A 3GLIA 4ON9A 1I2DA 1T91A 2C5LA 2C95A 5HCIA 1F6BA 1TF5A 1VG8A 2DR3A 4LBWA 1F48A 1N6IA 2R9VA 4RKEA 3IIJA 1MO3A 1F5NA 2FSFA 4MGKR 5EQTA 2QE7D 3RWOA 3DZDA 3E1SA 3QKTA 4M22A 1KY2A 5FOWA 3PFIA 4HUTA 4URVR 3VR1A 1NL3A 2WSSD 2ZRMA 3A1VA 1SQ5A 3PUWA 5J4KA 3QKUA 4BPBA 2GAAA 1AZTA 1GKIA 2X8AA 4MYCA 1TF7A 1G3MA 3T34A 1Z2CA 4TTQA 4BFWA 2ZPTX 2VHCA 1NG1A 4US2R 4NONA 4OHYA 5EE9A 1R7RA 1AKEA 4L15A 1KNXA 1ZU5A 3K70B 4PPNA 4LPKA 2KWIA 1XPRA 1KAGA 4UQOA 2HYIC 1W44A 1CULC 1G5PA 2B8TA 2REOA 3I8SA 4G5QA 3CRVA 1E6CA 1NMXA 3CNOA 3TSOA 5LDDC 1TPZA 1DVRA 4UJ3A 4F4IA 1OH8A 5FTMA 3W34A 4HEJA 3QI2A 2IF0A 3BERA 3PIRA 4Q47A 2ZUBA 1G5RA 2HUPA 1GDDA 1L4YA 1WA5A 5DLQC 3M0EA 2NGRA 2AK3A 1S2MA 4Y0AA 3WMEA 1MR3F 2G77B 3FWYA 4GBMA 3EA0A 1MABA 2EWWA 3KB2A 4IXNA 3ADKA 3W90A 2IYYA 3AUYA 1NSTA 1KDRA 1R5BA 1Z29A 4PC2A 2WV9A 4P4TA 4H1VA 1EESA 1ZM4A 1VCIA 5J47A 2BEJA 3IILA 1VHLA 2X2FA 1ZUHA 1KJZA 4A9AA 3B82A 3KJIA 1HV8A 5DISB 2XXAA 2ZRCA 4Q9LA 4P32A 3T15A 4Q4AB 1COWA 1XJCA 4ZIRA 3ZIAA 2ZYTX 4P4SA 1MT0A 4QGHA 4BEBA 2WJVA 4IDOA 5E4FA 2FZ4A 1XJ0A 1P61B 1SVOA 3RRZA 3RWMB 1T0JB 1ZC4A 4DCSA 5AJXA 4PANA 1DAMA 3TGPA 1IN5A 1AS0A 4U02A 5JI3E 3GPLA 2ZREA 4PX9A 4BRWA 2C77A 3EAQA 1D6JA 3I72A 4D0LB 1N0UA 2BWJA 1HEIA 1W0JA 3B60A 2V9PA 5HPYB 3SJAA 3NXSA 4EFMA 2J5XA 4ITRC 4PPGA 4WZ6A 3RS0A 1II8A 3E70C 4E03A 3O8BA 4GOXA 3QIAA
chains in the Genus database with same CATH superfamily
1ZXLA 4JL8A 5HE9A 3ZHYA 1TEVA 1YONA 5LP6A 3LHKA 4JIMA 2A92A 2Z5GA 3EZ7A 5ECWA 3AMVA 4GP6A 3KJGA 2JFYA 4MZDA 3Q2KA 4UEWA 1GCGA 1EBBA 1Z34A 2I34A 1T1SA 2BFFA 2H2WA 3E1KA 3K0BA 2HM7A 1VE9A 5KNDH 2AN9A 5HF5A 4KQJA 2XT0A 4BMNA 1FDUA 1JNXX 4C7KA 2HA7A 1D07A 1QB7A 1JFVA 1O87A 1RAHA 1VZ3A 2Q49A 3OPYB 5H02A 4DV4B 2QPOA 1Z74A 3L01A 4KRFA 1GZDA 2RGWA 3QQ5A 4OCZA 5SV2A 1NU6A 3VR3D 4YMGA 3MMZA 2JB9A 3RBZA 4UEJA 3M6LA 4P3PA 4CJXA 2XNJA 4LHZA 5CFQA 3D8UA 5KINB 2WWTA 1TAGA 1F2TB 5M5BA 1VJCA 2C78A 3OEHD 4LZPA 4MA0A 2JCXA 3FTCA 1O8CA 4JU9A 2VRCA 2G09A 2JHGA 5CYOA 4XQGA 3A06A 2ES4A 4RK0A 3TTSA 4LQLA 1L4MA 1SB8A 3EIEA 4O2AA 4O2LA 4HYYA 4OLHA 3FAKA 4QBFA 3V3KA 4R0NA 4BUJA 1AC5A 5IU6A 1FRQA 1NR7A 4KLRA 4MH0R 1U98A 3FVRA 1TZMA 2P69A 4MO2A 3W8DA 2EP5A 5IMSA 2V7VA 4KMRA 1QM5A 4M9XA 4REQA 3UOGA 4C07A 4J0JA 5I7WA 4DQ0A 3BUSA 1D3AA 5TRTA 4E4YA 3SQWA 3LBYA 4OMCA 3KZMA 5AKXA 2XB4A 3UK2A 1KMIY 2XDYA 3G9TA 3Q9NA 4Y9UA 3QVGB 3LY7A 1PI3A 4U7WA 3M3HA 2YY5A 4JENA 1KMNA 3V5NA 1FXSA 1ECCA 1N6OA 3KEFA 4Y2QA 1M72A 4NCIA 1FP2A 5FO0A 2G9ZA 4E3ZA 3R6LA 1H3NA 4L7VA 1LPPA 1BMFD 5JC8A 4J0GA 5EKSA 1O9HA 1CSEE 1U2EA 3MOIA 2ZSHA 4AECA 2R84A 5A3SA 5IJ9A 3FZYA 1MO6A 1I6KA 1HTBA 4E6EA 2BI4A 1ZGJA 1LLQA 1ZVMA 4LRTB 5EXEA 3RS3A 3DB1A 4DV2B 3NVKI 3VJLA 4XQ9A 5FOVA 2ZTSA 3GH3A 2GCEA 2QY9A 2C94A 2J5BA 3BE5A 5BV0A 1GSOA 5LA6F 4K9NA 5TT1A 5IF9A 2VNSA 1T35A 2FK8A 3IO5A 4PO8A 5KTMA 1A8UA 2DY0A 3S2SA 2F62A 1UJNA 4LK2A 5JAQA 3T7RA 4PRZA 3K0FA 3ONDA 3QSYA 1R66A 3P2JA 3B3QA 2I91A 4P34A 2YJZA 1L7DA 2P9JA 3MCTA 3PTZA 4TWBA 5DB4A 3NH9A 3JVIA 3JVUA 1EP2B 2KQUA 1GITA 3NJRA 2IYAA 4ID3A 4MWSA 2H5EA 4OBWA 3VMFA 2BN4A 4OHWA 4KGVA 3IP8A 4CT5A 5IWAB 4KXMA 4DJAA 1I7LA 2FXVA 2AJBA 3Q3IA 5B2EA 1IK4A 5DLEA 2WHYA 1JB1A 4DYDA 4FK8A 8ADHA 1KAEA 4NICA 4RLFA 2IZ1A 1HSOA 1XX6A 1N5LA 1X38A 5HBGA 2QTAA 4F8YA 2FR8A 2GTHA 4LQCA 4WBNF 3ROMA 1LNZA 3STTA 1KF0A 1V9CA 9ATCA 3UB4A 1P7ZA 4GKAA 1N5MA 1ONNA 4RM2A 4NV3A 2MSWA 3WLJA 4I66A 3UB3A 5I7OA 3PX7A 4YQFA 3WYCA 2EYQA 2HNAA 4FJ0A 4JL5A 4BVLA 5L6MB 1SUBA 2V9ZA 4UVDA 3KR0A 2ANCA 3LUKA 4BFYA 3KC2A 2OCGA 4FGZA 1H5QA 1Z62A 4HFJA 5CW2A 5L6LB 1FXWF 4WN9B 1MJHA 4EUEA 2FAXA 2XGJA 1D9XA 1ONBA 1N3LA 1UM8A 2H4WA 2R7MA 3AF2A 4LOKA 5LZ4A 3SF0A 3QFTA 1OWMA 2J9FA 4TZ0A 3QLUA 4FJ2A 4WDQA 2AX4A 3U26A 3SR3A 2BF7A 3DZJA 4XJVA 3ZU4A 4Y9DA 4G8BA 4CQMD 2HK7A 1UMDB 1J1ZA 1CZUA 2FKAA 2PZJA 2VNKA 2YVLA 4UUQA 1ONPA 1GPAA 1ULAA 2Z2JA 2PUCA 1FFEA 5AVRA 2QSYA 3T38A 3ID6C 1LEHA 3CQ9A 2Q1UA 1P2UA 4H0NA 4HP8A 4Q7QA 1ZUIA 3GJ4A 4TLCA 4FIZA 2CSUA 1KA9H 5LA6A 3SVZA 4GO1A 1GSIA 5JD6A 1EH5A 1IEXA 2A5FA 2XUKA 5E3HA 3RTGA 3ZQJA 3QEAZ 3WIVA 3WG9A 3LU1A 4D4HA 4PS0A 2SHKA 3S2EA 4HDMA 4X97A 2QMEA 4PLYA 2D59A 4FYHA 2QTVA 1SPBS 4C08A 2JDIA 1FY2A 3UO8B 4NAHA 2Q2VA 4DG9A 2G71A 1MV8A 2QRLA 5DK4A 1LQTA 2FN3A 3LSTA 1A1SA 4K9KA 2CLLB 3SLGA 5AVWA 2QW8A 4GOMD 4F2PA 2IODA 1GG5A 5KO2A 2FSVC 3FYUB 4G09A 3SHQA 2YFQA 4G2NA 5FUQA 1E20A 3BB3A 3I1YA 5TF0A 2Y1EA 3H5NA 2OD9A 1OH7A 4N82A 1VKZA 3DT9A 4LHSA 3WP0A 5G1NA 1TM5E 4KO1S 2WHPA 4QOSA 4WBNA 1Z7GA 1JT2A 1WF3A 3SJBA 1KQFA 4GSKA 1YZTA 2J3EA 5LXTF 1N6PA 4U5QA 4F3CA 2BMVA 3EEFA 3EVCA 3Q87B 4RHUA 5CLGA 4YDRA 2AFIB 2NTNA 1H2YA 1K2WA 2X4DA 3KCQA 1AD2A 3BRQA 5DGHA 1Z3CA 4FXPA 5F3WB 1MZVA 1VCOA 1V41E 1JZQA 1GHTA 3BOSA 4J6FA 4D2IA 2R25B 1TMGE 1FXWA 4N0QA 4QYSA 4RA9A 4UTXA 5AUOB 2GBLC 1DUIA 3KPWA 3KQMA 1UQUA 5JDCA 2WU3A 3RBXA 1X6VA 4HYQA 1T0IA 3KK0A 4MPTA 4UTOA 4MDEA 2VWHA 2CFTA 3Q15C 4Q39A 2NUPA 1JEQA 4Y1FA 4B2YA 2QYTA 3QTBA 2Z5FA 1O03A 1V16B 2HWKA 2OZVA 3DFKA 2UYQA 4KIGA 2XQJA 3F7NA 4IMIB 2JW5A 4L72A 4U2EA 2XA2A 5AK4A 4Z8YA 4DHWA 4K9PA 3H9EO 5EINA 2IH4A 4C6HA 1J42A 4LDPA 4BOYA 1RHUA 3EXHC 2HN9A 4GI7A 3KNZA 1U7HA 4OLFA 1KAMA 1SKQA 4V1CI 2XV1A 4OI1A 1K06A 3DBLB 4CMIB 5HGJA 1YDMA 2L0XA 2PKCA 5A5FA 1P73A 2XMQA 1Y42X 1UMCA 3A4TA 5LZ5A 3AM4A 2DUNA 3ECAA 2JJMA 3CLSD 4RL4A 5IXJA 5J4YA 3NDRA 2CNKA 1P33A 4CTOA 1KH2A 1KO1A 2C9ZA 4URHA 1FFDA 1KK0A 4QYXA 3GLVA 4ZRMA 3RD5A 1JSRA 2Z30A 4BY9E 1RCUA 4H3VA 5M2QA 3B3JA 5KVQA 1YBAA 3UA4A 3T8YA 4LXHA 4TYNA 4EKGA 3M6WA 4KL8S 4KTVE 2JAPA 3VPSA 1E3TA 3IPAA 4NNOA 3SNHA 1Z7BA 5DBFA 2CL5A 5LDHA 4IQFA 1IBMB 2QJFA 2QMOA 2O57A 5DM70 1XNRB 4NESA 4ZT5A 1P7PA 4W8HA 2Y0CA 5LXTA 1A9ZA 2ZIWB 1MJFA 4FUTA 1PUXA 1CNFA 2QN6A 2J3JA 4LHVA 2ZU6A 3FZQA 1ZH6A 1DMSA 3O8NA 4X1KA 3U4IA 3CBGA 3LBHA 2IQIA 3ENZA 4OGLA 2VG8A 5F77A 4BBZA 1H9AA 2IV3A 1J06A 5IVKA 4CT4B 5IP5A 4JOCA 4F2WA 5JU6A 2PUJA 4HRVA 1LVUA 1WDKA 5JFTA 3U44A 3OBBA 1Y4ZA 4HLCA 4IO0A 1N5RA 2ZPUA 4ZO7A 5A05A 5REQA 5IT5A 4Z4HA 1PLJA 2Q1TA 4Q3LA 1XZQA 1ORWA 4M3NA 3M5DA 3K6JA 4FMCB 1EK1A 4MLPA 2H1RA 5AI6A 1T4GA 4CM8A 3TO5A 3TCKA 2YX1A 4XLTA 4JSRA 1XA0A 3QBVA 3OJWA 3G59A 1ISHA 3TNJA 4BNVA 1QFSA 5F1PA 1AKUA 1U99A 2CBZA 2CLCX 3CW8X 3WYBA 3DJYA 4CI9A 1JLLB 1KI2A 3S2IA 4UVEA 3EPJA 1A96A 2HA6A 2Z3WA 1Z73A 1PQUA 1J0EA 2E82A 2GA9A 2YWHA 1TGYA 3G1UA 1A82A 4JYMA 4X45A 5LBIA 3U4DA 5FOQA 3GVIA 2ZT8A 4JYZA 3L0PA 1A4RA 2JZCA 3K2BA 2NXWA 3A05A 5IDVA 3O31A 1MEOA 1EHCA 3JQAD 1DAFA 3KUXA 2J9YB 2QVGA 4MUFA 4BVFA 5EI5A 1O96A 2PQ2A 4QAJA 1RZRD 1VMDA 5B7PA 2FZGA 1V0JA 4Y2UA 4XYLA 2PD4A 2Y1GA 1CRQA 2XNHA 3LVQE 5JCXA 4RVGA 2EDCA 4ZFNA 3S2UA 1UBSB 2CF5A 3MTQA 4KNVA 2G5CA 5MGBA 1PV2A 3Q10A 5KVSA 4OLJA 1HE3A 3L1UA 3R77A 1CJVC 4UUBA 4KFUA 3UW3A 4X3CA 1XEWX 2C82A 2R7NA 3B1WA 3DMRA 3HBNA 4LFAB 3W2HA 1PR4A 2NIPA 2CFCA 3B6IA 3C3XA 3I6IA 1LVGA 4ZPXA 3P9CA 1OLSA 1YOVB 3PHBE 1E8MA 4OQNA 4UXIA 5A0VA 4KNWA 5T64A 1WV0A 3TRFA 3KJQA 4X66B 1Z56C 1K7CA 2C00A 1IQPA 1E9BA 3MRVA 3CLHA 4CN8A 2V98A 5KNLA 3G89A 8LDHA 3RR2A 4A8JA 4ZT3A 2BI7A 5GAJA 2GETA 2YV4A 1A7UA 4NDZA 3FWNA 3OMXA 4CQJA 2C7PA 1N6HA 2HEGA 2Z0MA 2JC3A 2ZRAA 1L4UA 3E05A 2C42A 2IKSA 3WK4A 4YAGA 1RRCA 1EWQA 2XGSA 2EC5A 4EVSA 3FDZA 4GKKB 4E4RA 1KETA 4M1QA 3BK1A 4MCAA 5BOSA 3URKA 3JWEA 1PG0A 1SKUA 2G88A 5LOVF 3LPAA 2UAGA 5EQDA 1QC5A 4O3FA 1YZVA 3PJGA 5AW7A 2ZQ5A 3ROFA 4AUKA 3HU3A 1Q21A 3LUHA 3OQJA 3D02A 3JYHA 3PZBA 1NW8A 2BFBB 2WR8A 3NETA 2APJA 4JJ7A 4G07A 4PG7A 4W5NA 3JZFA 5JATA 1V8PA 3NC1C 3K8ZA 1GNQA 4D98A 2H4YA 3UMRA 1JG4A 4TLEA 5F98A 3TQFA 3QXJA 3KPUA 2ZR9A 2W2PA 5BN4B 4IG9A 3ZHUA 1BWQA 4C6TA 5L40A 4IDFA 2H1SA 1Z4PX 3HLYA 1L4GA 4FCWA 4QJIA 4DQDA 4PQFA 3ZY5A 1GNSA 5HKLA 1E2BA 4E13A 1B7GO 1RC0A 3TTYA 2P6MA 1QZZA 1JR3D 1VLJA 1FZQA 2RC5A 5D2CA 2RHGB 3QVSA 1Y7TA 2QSUA 3A4LA 3ZCUA 3AV0B 1KTIA 3U4MA 3GJSA 1G9TA 1VCMA 4JUDX 2FVXA 4KVFA 1MAAA 5HSGA 1DKNA 1C2YA 4WNAB 1EDBA 1TQ4A 1ZHOA 2WICA 3RJTA 3NI2A 3T41A 4LEIA 4I5IA 1L7OA 1Z16A 2H92A 4G1EB 4QUKA 3G5LA 4QEZA 2ATIA 4OQZA 2LXNA 1YMQA 1S8FA 2PUHA 3FM9A 1WBBA 2CLIB 2P7IA 4CKCB 2CVPA 2YJGA 3C2QA 3QA3E 3MT8A 2V3VA 2V1XA 4QXRA 2HEIA 4RO0A 3IVGA 3UKDA 4FB4A 3V8QA 4JT8A 3TGLA 3CUSA 1C5KA 4IGEA 2ZUFA 1KSJA 1O97D 2IPAB 1GQSA 2ECQA 1T9DA 4FYKA 2P68A 3B8HA 4LV5B 1N2CB 1N2CE 4QUHA 2AZXA 4RAOA 4ZOEA 1CR2A 3UCEA 3RTEA 3IOYA 3EFOA 1OAOA 1IXSB 2A9RA 2FH5B 2ODTX 2WBLC 4IDQA 3O1HB 5TGZA 4POOA 5IS2A 4IXTA 2VJKA 4ZHQF 3K9NA 1UOOA 3DO6A 4GDMA 4GFDA 5IC6A 2F7SA 1X1EA 2Q1YA 3CLTD 5LP6C 5CNMA 5DBGA 1VKRA 4OIFA 3TKYA 1R6VA 2YBEA 4JVMA 4KXXA 2PBLA 3OEED 4GMDA 1ZD4A 2K87A 3E1GA 5BRNA 3B89A 4LY6A 2AZTA 2D8MA 3ZDCA 3F3SA 4OA8A 1YZNA 5KKCA 1JPNA 4GSLA 3WAGA 1M6HA 1PL7A 1CLEA 1WABA 2HFKA 4YMTA 5JSZB 1ZA2A 4JYAB 1MRZA 5ISMA 4AKGA 1XAJA 2VJQA 3GUCA 2CFOA 3SC4A 5LQSA 1NSYA 3W3ZB 3PWTA 4BAGA 5CT9A 7AT1A 5JQGA 1CPYA 4Z49A 3W2TA 3UGKA 3EEQA 2ZZKA 2ZJ7A 3G02A 4HS4A 2OAP1 2ZVJA 4BDSA 4DSAA 2H1VA 4Z0HO 4EHNA 3G2IA 5EC8A 2R65A 4FKBA 4GL2A 1WSBA 2TS1A 5AH0A 4GGPA 2EZTA 3R5FA 4HRYA 4ER0A 1XEXB 3CLRC 5CT5A 1V25A 3BCUA 3ZDQA 5AKKA 1JIUA 1GGMA 4UTNA 4AYTA 5CB4F 2DF8A 5JASA 3GRFA 4N39A 4L08A 2W2KA 1G1MA 2GEDA 3T9DA 3GZJA 2DBRA 2Y93A 1NE7A 1S0UA 4MQEB 1L2TA 1LH0A 2B9VA 1E5XA 1F5SA 1KFCB 3GARA 3PVZA 4LF9B 1XFDA 4WPGA 2ENUA 1KOGA 5IAJA 3BEDA 3KS9A 3K0HA 4MITA 1LPSA 4RIEA 1Z8FA 1NMZA 3B78A 1WEHA 1OKKD 4MR8A 3VJMA 3DOUA 5B6PA 3V00A 1J21A 4V3BA 3OM8A 4EB8A 1KMHA 4D8UA 1T2UA 2XKAA 4NE2A 4E46A 1TCVA 3HEAA 4HH0A 4QODA 3GLQA 2E5WA 4L9AA 4ZHQA 3Q1LA 2QL5A 3QK7A 1R3UA 2FEPA 2JFPA 4GI1A 4L7QA 3UK6A 2GZHA 3H1BA 3OIYA 1J5EB 2EIXA 3H9UA 3LQYA 4ZYZA 1BXKA 2JFXA 3DOCA 1CVIA 2HCBA 1ULTA 4Y2RA 2FN4A 1ORDA 4JLPA 5JW6A 1GILA 4AYXA 3BF8A 3E3LA 4XYEA 4BNDA 4AJIA 2WSLA 3AR3A 3AL2A 4IH1A 4G0MA 3JVVA 3SBEA 1RYEA 4QXMA 1SBTA 2J59A 5KC9A 4AQ7A 2PRIA 3MJ4A 2Z6UA 1QK3A 2J87A 4OM7A 1YVPA 1MXHA 1D4ZA 2A0XA 2DU8A 1UWVA 2QD4A 5LBTA 4ETIA 3Q6IA 821PA 4IHKA 5DSZA 3DB2A 5ITSA 1EPUA 2Q6TA 3H13A 4KUGA 5BW6B 1O08A 2V54A 3ZGZA 5I45A 2FQXA 2I7DA 3C15C 1W59A 4MMXB 4Y2VA 3U16A 2PUAA 4MUYA 2X0RA 2H48A 1RRPA 1EM6A 2YN2A 5BWCA 1FNDA 1LK0A 1XTUA 1G4HA 2GN6A 1G6KA 3K5HA 1KDOA 1NWHA 3RVSA 3ZU3A 2V1UA 2ZS8A 5CB4A 1Y7IA 3H1PA 2XB9A 2GRAA 5IJZA 1W36B 2FR8C 5AKHA 5TPZA 2YS7A 3IAUA 3TXYA 5JH7F 4RTLA 4LV6A 1M8GA 3CEJA 1P74A 3L7LA 3RRFA 1ADJA 4DM3A 4NOMA 4OXKA 1PR6A 4J4TA 4RYDA 3WO1A 2W11A 3OLXA 6ADHA 3O75A 1RTTA 3EOAI 3STHA 1Z5NA 2JD1A 4Q93A 2GDJA 4K3VA 4I9UA 1N3IA 4JQSA 2QXTA 3J7TA 3RARA 1JFFA 4EPXA 3F71A 4C0KA 1ESNA 2RH8A 3FHLA 5KOJA 4ECEA 2P7HA 2BFCB 3QLUC 4YCMA 1EB8A 4UVGA 1TO6A 2GZRA 4YQZA 2Z04A 5FQOA 4CTNA 3EJ6A 5JJIA 4B85A 2SICE 1AKVA 4BMSA 1PBNA 1F20A 1OQAA 2C58A 4DCTA 1E79D 4PFJA 2J0UA 2R7KA 1OF1A 1MORA 4HN9A 2OAGA 4CR7A 3A26A 3FOAA 4MRSA 2WF8A 6YASA 3H2KA 3DEFA 2G5TA 4MINA 3K31A 4YV7A 3OQHA 3FG9A 4DM4A 2QLNA 2WE7A 2XCUA 1NKSA 2OOSA 3ICCA 4ODIA 1UFQA 1LBEA 1ESEA 2BHRA 2WD9A 3OSZA 4MWOA 1H22A 4KSCA 3UWSA 3WNVA 1MJGM 4YRDA 4PO3X 1Q20A 4EY7A 1WDTA 4NYIQ 5AJVB 4OYHA 2V59A 1WLYA 1VECA 1BE1A 3A10A 3DOHA 3MMPA 3CE6A 4ISBA 3BT7A 1Q1GA 4LXGA 2P78A 4X90A 3PGJA 4LCBA 4JUIA 3GLFA 1XTJA 1US8A 3IBFA 4MVJG 5PNTA 3OZVA 3T9CA 4F8JA 3MMNA 4H3SA 1M2VB 3U7EB 4EUNA 2QOEA 4Q82A 3VU3A 5IYZB 2PKEA 1IHOA 5HKOA 3IEMA 1MG5A 2HHAA 4YH1A 4CLDA 1EVIA 1L5VA 1Z4OA 5L3RA 4AJEA 5ALIA 2B69A 3A1CA 3D4BA 1XKLA 4ZVOA 3SFVA 1PS8A 3DMGA 5JH7A 4OFBA 2C04A 4OFXA 2WJZB 1Y8QA 4J7AA 1AQIA 2ZJZA 3T52A 3LUFA 2AF4C 3Q3VA 4G8DA 4QXOA 4XGQA 4EM6A 3PHLA 1E3JA 4D4IA 4W1QA 1NVGA 4OH1A 3FE2A 4WT7A 2ZRLA 1ECLA 3I6ZA 5C3MA 4RCYA 3OIGA 5HF6A 1VLQA 1L7PA 4BP8A 3I61A 3AEYA 4UAUA 4I8XA 3V4SA 1PVOA 4BX2A 2A35A 3F9RA 1AKTA 2JHFA 1K0FA 1OX6A 3QEMB 3QMMA 3R1IA 4YIKA 3FZGA 3E23A 4H6WA 2JASA 2QR5A 4O4JB 3VAZA 3ZYCA 4KITB 3O2QB 2GASA 3SC2A 4DPKA 3KKNA 4Z7OB 1SQ0A 3L0IB 3O38A 3KIPA 1VBNA 3M8KA 3X2FA 4D9HA 2C84A 3CVUA 2QDXA 5CFLA 4MKFA 1GAWA 3CG0A 3HB0A 4RCVA 5JG7A 3H5LA 1PWYE 4OL0A 1JJ7A 1CUJA 1XLTA 1SXQA 3MCAA 2CXHA 4PYOA 1IXRC 4WOPA 4LG1A 2QRQA 4NCJA 3VU9A 3ZBUA 3V4FA 1ZL0A 2YHSA 2CL6X 4FHEA 5ANRB 1S9DA 3FFTA 1I6WA 3TRIA 4QXPA 2DWUA 1SBQA 3PGMA 3SIRA 3E9RA 4CT0A 4J7XA 2C9BA 4WWHA 3IVXA 4GW3A 4ZI2A 1QP4A 4LF6B 4X20B 2WZCA 1TLLA 1T3TA 1W73A 2E89A 1POWA 2UZ1B 3I5UA 5CK5A 4DY4A 2VI5A 2ZAYA 3PUKA 3LPMA 4KDFA 4OP2A 1Z0ZA 2LE0A 4ZCPA 1GA1A 4PG6A 5BURA 6NULA 2H08A 3PHCA 5JANA 2QW1A 4JP1A 5ALGA 2N75A 2YC4C 3LX8A 3KZ1E 2NUTB 4PX3A 4Q3OA 3TZBA 4GYYA 4M9RA 1G42A 2HK6A 3FPCA 3MYRA 3NPAA 3MINA 3OUZA 4HTAA 4R1OA 1YZ3A 1CW2B 2ZP1A 1K75A 5K8UA 4QHTA 2AT1A 1Y3IA 3Q7EA 1NBHA 1E1QD 1JKMA 1M8KA 3QUBA 3VPAA 5EWLB 1QOQB 3ANTA 3WYAA 3P9SA 2A5GA 4PGGA 4U6NA 1K1EA 3K7EA 2OHFA 4EDFA 1EJ0A 1ZMBA 2W6PA 3ZGNA 5IDWA 1XDZA 1KDYA 1FLNA 4GZ3A 4IDDA 3SJZA 1IUOA 3H9JA 1YB4A 2PTGA 3KKZA 2QBYA 1I8TA 3BM5A 3HBLA 4O4IA 4WX2B 5GJCA 4S1PA 3BD6A 3X3HA 1BN7A 4HAWA 3AP1A 3ILVA 4KO2S 1RLMA 4E6PA 5BR1A 5KX5B 2FW1A 2WHQA 3KP1A 4CG3A 2DECA 4PIMA 1AKQA 5J9FA 4MNTA 1ZZEA 3OLWA 4JQYA 2Q7DA 2DKFA 1VLHA 3K4PA 4RFLA 2RD2A 4YJGB 1YU6A 1FP4A 2AUNA 2P2CA 4Y6PA 3SYLA 1RKUA 3FMIA 4O8ZA 4IKPA 2VQ6A 5EPOA 4CLRB 5IJ0A 1R8XA 2FNAA 4PS1A 4ZI5A 4V0LA 2EGUA 4HNUA 4EATA 1H9CA 2GVDC 1QRAA 1QZ3A 3QTLA 1SJ9A 5CT8A 3RHTA 3VR6A 2GBFA 1X3SA 3GT3A 1TM1E 3NOQA 3P2KA 4DLZA 1E2PA 4KPGA 1Q1AA 1QMGA 1Z35A 5BWBA 1SY7A 3S28A 2Q6LA 3CZMA 4R5HA 3O4RA 3FLMA 1L5RA 3BFKA 3F2IA 4FCVA 2BP7A 3F5DA 2F4NA 3P9XA 1Z5WA 2HQBA 4BQEA 2GUWA 4YJ2A 5CCBA 1XRRA 1Y1QA 4LXUA 2AXNA 3ZZ1A 4LN1A 5TPWA 4X6YA 3ZY2A 3DBIA 1L7NA 3GWGA 2X9GA 3PF9A 4BX8A 2IZ6A 2BPOA 8ATCA 4RORA 4EHIA 1Z9BA 3KB1A 2J3KA 1CKEA 3OF3A 4NMMA 4IIXA 5FR2A 3RADC 1J1UA 3DHYA 2P62A 3SM3A 4FB5A 4IOJA 2P9EA 4D4GA 3U62A 3AETB 5A3VA 4TZ6A 3AYZB 1HEUA 1VL1A 3C3WA 4FDTA 1TUBB 2TRSB 4L9RA 2XXBA 3UOAB 3WMRA 4BNIA 4W5OA 1Z08A 1AA9A 1K3TA 5EMKA 3QBEA 4A8JC 2UUAB 1S3SA 1USWA 3CPJB 3CLUC 1EWYA 3T15A 4ND3A 1SCQA 1YZYA 1CIPA 3AQIA 2O8VA 2HREA 4M7RA 3DWEX 4YMSA 2W2TA 2QLTA 4MDFA 5HK9A 3R8FA 4MGYR 2A5DA 2IV7A 4K5QA 4Y2SA 2JS7A 3DVLA 1S7CA 1C1HA 1T43A 5BT9A 1YGPA 4D41A 3B48A 2Q62A 3GGSA 4GHWA 4QUEA 2AEEA 3LBNA 4H1UA 4OI0A 4I81A 1TW2A 4IWXA 3G88A 4PLWA 1C9NA 1K9SA 2B34A 1XVAA 1OTYA 1UFRA 4HZIA 2YIVX 1JDSA 4XARA 4DC0A 2MJLA 5IK2A 5BYAA 2FDCA 1PJTA 3U09A 3DXYA 3VKUA 3ETHA 3CVJA 4EB0A 2AGVA 1Z15A 4RQUA 4LGYA 3PUHA 3QVJA 3W5AA 2EWMA 5GTDA 2ZVPX 1GTMA 3O1LA 3UMGA 5GY7A 1MVNA 4FYPA 1NBAA 3O7MA 1SBNE 3S1SA 4ASUA 2WYOA 3G82C 2Z2IA 5BSWA 3V34A 4K2AA 4CETA 1KGDA 4MYHA 3K70D 2FTKE 2GX6A 4JBNA 4L4ZA 4M53A 3FGNA 3M5WA 5FTNA 3MCVA 4HPXB 3EWSA 4L5BA 4L8LA 1IY2A 4XDZA 4ZT2A 4CQLA 5LSAA 3G8BA 4JD5A 3PYLA 1X7ZA 4LOLA 1YA4A 4RDIA 4UE6A 1QTQA 1RAEA 1TA4A 3OKCA 3RYHA 3R5HA 4HAXA 1KEEB 5HTOA 4BN5A 3QFHA 5DCYA 5JPIA 4FIDA 1IZ0A 1GPYA 3H05A 3H6HA 3SZUA 3EXAA 4N7JA 4ZTBA 4KQCA 1XJWA 4X00A 3DYVA 4U39A 1HO3A 3I6BA 5EXTA 3WLPA 4CLOA 3HCAA 5SYMA 2VHQA 2GNOA 1ECPA 4B33A 3JPWA 4PC6A 4YGYA 4BRUA 1JR6A 1X7YB 4ZJUA 1RJ9B 1OC2A 4IZIA 4JLSA 5KCZA 5TE9A 3E2MA 5C4IA 4MUAA 3NHPA 3IJEB 1EGQA 4UUMA 1ORTA 2PD6A 1IHDA 1P0IA 3OU2A 3SYTA 1C1XB 4DILA 2FPXA 2VDKB 5ALZA 3LW8A 4ERXA 2Q99A 3HGQA 2Z1DA 4MCHA 4MUGA 1KQ3A 1WHTA 4RHTA 1SUDA 1Y48E 2I80A 1L1RA 4N6GA 3FN4A 1HH4A 4ZYUA 2XGOA 1GUBA 2BYTA 1PS9A 3ISJA 4M38A 1ORVA 2FR1A 1M5RA 2XYQA 1D2CA 2FN9A 2FF5A 4R2KA 2NXNA 4IIBA 3TEMA 1IONA 2HBQA 1JG6A 3D8HA 3S7TA 4KQKA 3U3OA 4DJEC 8AT1A 5JNTA 3T5AA 1QIFA 1NRXA 3ESCA 5EKDA 1V11A 1KWGA 1N2XA 2WHXA 4Q9JA 1ZH8A 2I6SA 2QGNA 2ZI4A 4CRWB 4PZAA 2PNJA 3JASA 1GXSA 1SHUX 4R5MA 4BLSA 1T5TA 4UBIA 2O50A 4EYOA 2CFIA 4EEZA 2G0NA 3B9BA 1YHNA 2JPDA 2P5YA 3H0KA 5HKKA 4GH5A 5B6JA 3LHFA 1PT7A 4OLBA 2PPLA 2VP4A 4EVRA 2X0EA 5KYWB 1QFZA 3C1UA 2C1EA 1QS0A 3UAZA 1APBA 2Y66A 5L9AA 1OLUA 1TA0A 1IY0A 1C0PA 2BKXA 1Z4KA 2CLEB 2QAIA 5JLAA 1LJ8A 1QP0A 3AGQA 3F8WA 5DBHX 1DO0A 2J9RA 1VI5A 2BM9A 1P3Y1 2VPYA 4L8WB 4YA6A 3T7KA 3WQRA 4M9UA 4XZ3A 1E59A 6PFKA 1M2KA 2DP4E 3I4FA 3QZUA 1OROA 2ZROA 3GNSA 5COQA 3T7IA 4ZOLB 3GRRA 4V02A 2O3JA 4GECA 5CEFA 2XVXA 2ZTUA 2Z1MA 3U7QA 1KR5A 1V1RB 2NAFA 2QT9A 2V45A 2YY6A 3GF4A 3HVJA 3I2HA 1XKQA 3I92A 4KQ2A 2B1RA 2GUGA 4E31A 2IH2A 4A92A 3UFBA 3CF6R 3D3WB 1FU8A 2XHEA 3DR5A 1L4LA 3EC1A 1UL1X 3FLBA 3I5MA 3KD3A 3NBMA 4NS1A 1TC2A 2G8NA 3DPUA 3LRTA 2PM8A 3OVMA 4ND7A 4MHSA 5EJ6A 3WDSA 4LDQA 3QHAA 4LZZA 2IK8A 2Q07A 5CFNA 1ANKA 1R4NA 4MYTA 2FEKA 2O7NA 3C48A 4BXOB 2EJCA 4EPYA 3QFSA 1ODTC 1UJ6A 4UREA 4ZOQI 1I33A 1NV8A 3J81A 3B1FA 1Z26A 2FW6A 3NV7A 3AHHA 3WJ1A 4BO4A 4AY3A 2WF5A 4DT1A 1LNQA 2XB6A 1M2OA 2QPTA 4PYKA 2IVZA 5ER9A 1VGQA 3FJYA 3PXBA 1IDN1 5D87A 4Z51A 3DE3X 3HM9A 5AKZA 3D2CA 1GRNA 3LGAA 4HVTA 1ZRMA 3DOIA 2IIPA 4Q00A 4C4XA 4NPCA 2C2XA 2FR0A 2DPMA 3N9IA 3NEJA 5A6SA 3B1ZA 3LCMA 3LPNA 4RSRA 2JGRA 1GGFA 3RUIA 2MDTA 1LWNA 4URWR 2CHVA 3RW9A 3KDPA 5ABPA 3BE4A 4NOJA 1CUZA 1LS1A 1IG0A 3QQPA 3AOGA 4OI4A 1IOWA 1C9MA 4P0QB 4US1R 4LV8B 1XVLA 4ZVUA 3H75A 1WZ2A 2H6EA 3HYNA 2ZWPA 4RPGA 5FUYA 3AHJA 3FHTA 2VJMB 2QW0X 4CUJA 3T1HB 3EH2A 3P1JA 4U7TB 2W5UA 4PLCA 2OCYC 1S1CA 1W4CA 3HJHA 1XTZA 1M0WA 4AWXA 3T9EA 3U3XA 4Z53A 1GLNA 2MYTA 4MV5A 3WWYA 1A9RA 4MIKA 5AKYA 4QUJA 3ZV5A 3OC6A 1CHNA 1LRKA 1G8YA 2ZIAA 3O95A 3WLIA 2CLFB 4HNAA 1ULZA 4XGKA 5JWOA 1A5BB 1KY4A 3SI7A 2H52A 2OV2A 4JJ4A 3BGVA 1L1FA 5B3JA 3TB4A 1HLGA 2JAHA 2UVDA 3G8YA 4B82A 3RJMA 5A1TA 1T4BA 2IHVA 3B70A 4B9AA 5CEJA 4FNAA 5CIYA 4M89A 4Y67A 3LCVB 3PJDA 2VDVE 1VJ1A 1Y7LA 2B9EA 2CNBA 4LDZA 3OOSA 4URZR 1FMTA 2JARA 3ZX5A 4ZVQA 4JR1A 2QY6A 2Y71A 1ML4A 4ALMA 3TM4A 1M2HA 2PL3A 3DDOA 5EE1A 4IP0A 2OYRA 4YUAA 4LW8A 2ZQZA 4A73A 1TKCA 5CD1A 2VUTA 2X14A 4TZKA 4BE9A 3SZOA 2C7VA 1F2UB 3EEBA 3TOCA 2J41A 4PWYA 3COZA 1AS2A 2A33A 4JGIA 1J8YF 5K03A 5G0TA 4PGAA 3BS4A 4ABTA 3D4IA 4DUPA 3N7UA 2Y1LA 3AUUA 1TUGA 3UJ6A 3HBJA 1OV6A 1GNVA 1DQZA 2JLSA 3HZOA 2AS0A 4K6GA 1EVLA 4ENSA 5CDFE 4RXUA 3PSHA 3F46A 2BHSA 5ENZA 4YMVA 2K7ZA 3R6TA 4O4HA 3QNWA 3SQXA 5BUSA 3GRZA 2BMDA 1QIEA 2BGKA 3KOXA 1NVUQ 3R3WA 4BIMA 4RF2A 4EITA 1O3YA 1E3WA 1QIIA 2WJWA 4DLWA 4V1CA 1P44A 2P5SA 1NLZA 3GJ6A 1OTXA 4Q0MA 4KQMA 5DNVA 1W85B 4HR7A 2O8DB 2FHSA 3VR4A 3MLEA 1H2BA 1QPBA 2XVYA 2ZSAA 2XQFA 3AHEA 3DZBA 2UZIR 1LBHA 1WXWA 1KBZA 2HA3A 5ESXA 4NHEA 2Q0HA 2J6CA 2B4AA 1T4MA 2JFVA 2R8PA 1DFIA 1NVVQ 3KYDA 3ZNPA 4RVOA 2Q29A 5IF3A 2IQ5A 3H97A 4C0JA 3JWPA 4N4AA 4QEDA 4UVHA 1G7CA 3AXSA 1I36A 3L0DA 1N25A 3PT9A 2FOXA 1JEAA 4K0RA 5C8VA 2P9YA 3JQ6A 2EL9A 3A4MA 4L8YA 4BLOA 2ORIA 3GGCA 1AJEA 3ISVA 4KACA 4Z54A 2XBUA 3GPCA 4N3CA 3I6YA 1GCUA 1IVSA 1E1DA 3BA1A 1ZJZA 2CHGA 2I1QA 2PZBA 3QU2A 4RK1A 4YJ3F 1YI1A 2NU6A 1BJKA 1L6IA 4TLDA 4EFLA 1G5QA 3JWIA 1XUOA 1A7AA 4ND2A 1SBYA 3NWPA 1XPJA 1D2MA 1T0UA 4RHYA 2QUZA 4BO7A 4GX5A 5K3DA 3SEAA 4YT5A 1XLTC 4KXUA 2Z9BA 3LKBA 3QX7A 1MENA 1WCYA 3O91A 3HSSA 4RZ2A 1VYUA 2OP0A 2QAGB 3VO1A 3LC0A 1FJHA 2GSWA 3LQRA 4HEQA 1EFKA 1YR2A 1J0BA 3K09A 3L1VA 1KYQA 1T2DA 3C45A 3MXTA 1P1BA 1BKSB 1VRVA 2MR6A 3EZYA 3NRBA 3IOBA 2Q9BA 3HLKA 2NAPA 1DG1G 4FFOA 1FF9A 1E2IA 2AFRA 1YDFA 2Q5FA 4JYPA 4AX8A 1WB4A 3EGDA 2J5RA 3DV9A 4FFRA 2QRVA 1P6XA 2YV1A 1BMTA 4GWGA 5IARA 3TH5A 5AW5A 3V8RA 1XD8A 5FWXA 3TZ6A 4AIIA 2OGZA 1IYZA 1MD9A 1M9NA 2AOUB 3K8OE 2PLNA 3U1VA 1XPOA 3FI0A 2OGTA 3NEPX 1KO4A 1NVTA 1RWNA 4Z99A 1XZLA 3FPBA 3JR3A 4IVPA 1ZMRA 4MGIR 3ZV7A 5ALVA 3MWFA 2DFPA 4PAOA 4IZOA 3ROEA 1XDGA 3SFZA 3UXMA 5LMZA 1AQLA 2H51A 2GSDA 2QRPA 4TUYB 1WS6A 3LK7A 2FRDA 1NYLA 3AHCA 3MWYW