4DYVA

Crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
237
structure length
213
Chain Sequence
KKIAIVTGAGSGVGRAVAVALAGAGYGVALAGRRLDALQETAAEIGDDALCVPTDVTDPDSVRALFTATVEKFGRVDVLFNNAGTGAPAIPMEDLTFAQWKQVVDTNLTGPFLCTQEAFRVMKAQEPRGGRIINNGSISATSPRPYSAPYTATKHAITGLTKSTSLDGRVHDIACGQIDIGNAMDVAHVASAVVYMASLPLDANVQFMTIMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Crystal structure of a short-chain dehydrogenase/reductase SDR from Xanthobacter autotrophicus Py2
rcsb
source organism Xanthobacter autotrophicus
molecule tags Oxidoreductase
total genus 73
structure length 213
sequence length 237
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dyvA00
4HXYA 3GHYA 3IS3A 4YYZA 3IC5A 3AI1A 4PGFA 4RL6A 2FY8A 4BB5A 3HFSA 1LQUA 3RU7A 3DHEA 4L74A 4EYEA 1NAIA 3U4HA 1PJBA 2X22A 4GX0A 2OXIA 1LLCA 3IUPA 5EIOA 5A1TA 4PLCA 2O4CA 2V6GA 4DC1A 1CQIA 3V2UA 4BB6A 2SCUA 2PV7A 2TMGA 3CMMA 2O3TA 1WLYA 2Q2VA 1DIBA 2JFHA 1I30A 1MUUA 1BXGA 1LQTA 4IGEA 2CVQA 3D4PA 3EK2A 2BFMA 3OMLA 2NTVA 2VN8A 4CUZA 4LVUA 4FS3A 5DT9A 3EZLA 2YW9A 5L95A 2YHIA 3TZ6A 3RWBA 3OQBA 3FCOA 1KIFA 3JQFC 4CM6A 4MJLA 4XYEA 4XQ9A 4U0KA 4YJGA 4MIYA 1ZK0A 1PGJA 3P5SA 2TMDA 2GDZA 1NBOA 2BELA 2PZLA 3PI7A 4EUEA 9LDTA 4EZBA 3ST7A 4I9NA 3GF4A 5KVCA 3ZV6A 1X0VA 3BMNA 2V6MA 1AUPA 4CV1A 4ZRNA 3IOYA 3RROA 1HZJA 3GZNA 3Q6IA 1M6HA 4BNLA 5MGBA 1KOLA 3GVCA 4IZHA 4WCFA 5CPFA 2GUGA 4FIZA 1B2LA 2NQTA 1QG6A 3ASUA 2EEZA 4GMGA 1QSGA 3RU9A 1DC6A 4Z3KA 1DPGA 3HN2A 4J49A 2QX7A 4TRMA 2JJYA 1LRKA 3ZHYA 3MZ0A 4XA8A 4BOYA 5IG2A 2ZTMA 2ZCUA 1H93A 3RCBA 4HBGA 3U5TA 2HK8A 5ICSA 2I3AA 1Y5MA 4G2NA 4QFDA 3UF0A 1Y5RA 2PLAA 2BI7A 4M49A 5BQFA 3GT0A 2ZYGA 2EV9A 4QX6A 5EQFA 4YJDA 3DBRB 3JQ8B 1U2DA 3F1KA 4YJFA 3WJAA 1ONNA 3WX0A 3ZWOA 1BW9A 3KYDA 4FFLA 4PLYA 4CLRB 5JCJD 2W4QA 3BMOA 3UICA 5KKAA 2HUNA 1ZIDA 4XCVA 2DTEA 1C1DB 3T7EA 2PKQP 3ZWAA 4YEDA 1V35A 3AOGA 3DWFA 4ZD6A 4E0BA 4IDGA 4L0QA 4RVFA 3AW9A 1FMCA 1HF3A 4LCJA 2I5PO 3ROMA 2YJZA 4ZQGA 4A03A 1N92A 2HLPA 3VTZA 1P3DA 4BKPA 2RBEA 3PYMA 3SLGA 2J5RA 1KEVA 3TOXA 2VZ8A 4IZIA 3WGGA 3OECA 3JYQA 1ENYA 4J16A 2X86A 3PJDA 4B7CA 1RPNA 4IINA 3SVTA 1OAAA 2W98A 1B8UA 1P74A 4Z9XA 3HN7A 3WIEA 2GZ3A 4BQPA 3I9MA 1YBVA 2FSVA 4U7WA 3TFQA 5IN4A 2IE0A 5DBGA 3HE3A 1P0FA 3RI3A 3LC7O 5LC1A 3RJ5A 4PLZA 3DBLA 3LT1A 4J90A 5JDIC 5JLAA 3GMDA 1JDJA 4XQEA 5KVVA 5L7TA 3KBOA 2WE8A 5BSGA 3GPDG 1ZO8A 5GZ3A 1Z45A 2GN9A 3WQRA 1UP7A 1U3VA 1DIGA 4K6CA 4GVLA 4E5NA 3DMTC 2VHZA 3AUAA 1KVUA 3PHLA 1B7GO 1PS9A 1PJSA 1WVGA 4FC6A 2Z1MA 3P2OA 4D3SA 1GQ2A 2AG8A 2Y93A 4DL9A 2IEBA 1GY8A 5B37A 4NPCA 2VHWA 3ENNA 4AJEA 2BGKA 4J0FA 3KLPX 3UN1A 1JQBA 2YYYA 4XWYA 4GQAA 1XHLA 1HYGA 3PJFA 3FTNA 1E3IA 2Q2WA 1V6AA 5B1YA 4W6ZA 2WEKA 4JCOA 4ZQBA 3ADOA 1T24A 4TQGA 3TOZA 1ISHA 3RC7A 5I8WA 1GEGA 3NDIA 3WNVA 1R4MA 1Q7GA 1U5AA 4DLAA 3W6ZA 2E6UX 2X5JO 2ZQZA 4YR9A 5FI3A 1EE9A 3TN7A 3LLVA 1SB9A 3ROKA 4BNKA 2ZATA 5BSHA 1HE2A 2O7SA 2PR2A 3HG7A 4UUPA 1U8XX 1B3BA 1QXSA 3VZPA 4XRGA 4RVGA 3EC7A 2D3TA 2GLXA 4DIBA 1HYEA 3OIDA 2DFVA 1VPDA 4E31A 4JNKA 4NBVA 4RCVA 2EERA 2X9NA 4YDRA 5JCJA 3GDOA 1V3UA 3GMSA 1C0KA 4J4TA 3P7MA 5EMHA 4I5FA 4NBUA 3RIHA 4CMEC 1BXZA 2CNBA 1XR3A 2Y99A 4GKVA 1O6ZA 1H2HA 3AM4A 1NFFA 1AHHA 1YXMA 2D59A 3LK7A 5TGDA 4RPHA 1LSJA 1OZAA 1EBFA 3ANMA 2IZ0A 4R51A 2JFFA 2A35A 3DHYA 1XLTA 1C3VA 1TB4A 3GNTA 3PDJA 3ZU2A 2O2SA 3HDYA 4E21A 2PK3A 3KZVA 2RIRA 3EMKA 4N54A 4OQZA 1FXSA 1UXGA 3E8XA 4UUOA 3VAZA 3E03A 1XDWA 2QYTA 1JW9B 3D3EA 2EW8A 3H9GA 4IJWA 1R15A 4O1MA 1LU9A 2YDYA 5U4QA 1PS8A 1KETA 1W0CA 1WDMA 4OYRA 5G4KB 3DXFA 5C37A 4GPD1 4EEZA 4DBVO 1SMKA 3TWOA 4BKQA 1E0DA 3LZ6A 4WNIA 4JQCA 4BMNA 2ZTUA 3G3EA 4S3MA 5A5EA 1GADO 4PRKA 1P1IA 4Z9FA 5EQDA 2HMWA 1PWZA 4RF2A 1VKNA 5TT1A 3RJ9A 1U3WA 3PQFA 5KTKA 4A73A 2Y05A 3LU1A 4CM8B 4I8XA 3Q11A 1ARZA 3GOHA 5L9AA 3TF5A 1IZ0A 4A10A 5I9NA 3I6QA 1V9LA 4ZA2A 1U4SA 1MXFA 4HFJA 3GC6A 4GX1A 2UV8A 3JQAB 5IDQA 3OJEA 4WPGA 2VRCA 3AUTA 4I1IA 2YQ4A 3WMXA 4KTVE 3UHAA 1V8BA 3LT2A 1I3MA 3GUYA 1A9YA 4J1NA 3RUEA 3DOCA 2EKQA 4BNMA 4CUJA 3T4EA 4D0RA 4YB8A 2AW5A 4CV2A 2P9EA 3AJRA 4CM4A 2ZB7A 2WYWA 1WDKA 3RBXA 1OBFO 1DRWA 1VKOA 3B1KA 3PGJA 1P45A 2CVOA 3EDMA 3IJRA 1V3VA 4GKBA 5JMWA 4ZN6A 2ZYDA 2NSDA 1MFPA 2UAGA 3JTMA 3MOGA 3WMWA 4ALIA 4EUHA 2W2KB 4PG7A 1U9JA 2C5AA 4LRTB 3DZHA 1G6KA 1JU9A 1Q0HA 3JQFA 4B4UA 1ZW1A 3MJEA 3JQ9A 1VL8A 1CWUA 2DU8A 4GLOA 4UAGA 1U5CA 3BTOA 3BYZA 1I3KA 2PH3A 3PPIA 3K2EA 3VC7A 1BSVA 1ZK3A 1JKFA 5A9TA 4RF4A 3ICPA 5B4VA 1MB4A 1LLUA 4N5NA 1P33A 2CMDA 1E7RA 4P4GA 2P5UA 1X1TA 1N9GB 4YACA 3AFNA 1DSSG 1E3LA 2AE1A 2WJPA 2FR0A 1BHSA 1O94A 3U9LA 3QVTA 1K3TA 4W7IA 4NHEA 3O8QB 5KJ1A 3OIGA 1X15A 5B4UA 4ITUA 3BMCA 4TKLA 2FHSA 3DB2A 5I9MA 3GLQA 4Z3DA 3TDKA 4DC0A 2I66A 1E5QA 2B0JA 4JN6B 4CMJA 4J4BA 4NJMA 3ZI0A 2BI8A 1A27A 3FPLA 4URFA 1EEHA 3ROPA 1A4UA 1LEHA 3U4CA 5JY1A 3L6DA 1T26A 2VUTA 4CMIB 1QR6A 3MJCA 3OP4A 5JSFA 4PLHA 3JQ7B 2Q4BA 3QWAA 4UREA 3RUHA 3QSGA 1U1IA 4XDYA 4WEOA 1CIVA 3PYXA 2GGSA 4D3DA 2G0TA 4LSMA 1Z74A 3GVXA 4E4YA 3F4LA 2H6EA 1KYQA 3BTUA 1A9ZA 1N5DA 1RJWA 3B70A 3CE6A 4MP3A 4MOWA 3ZNQA 4TWRA 3AY6A 1W73A 2IZZA 4XKJA 4NR0A 1H6DA 2CDCA 3ETEA 4AVYA 6ADHA 1NVMB 4AICA 3X2EA 4BGVA 3WXBA 3G1TA 4EUFA 1ISMA 1EVYA 1EVJA 5G0UA 1ZSYA 4WLFA 5DCWA 1TEHA 3V8BA 2HMSA 1LI4A 4B8WA 2BGMA 2G82A 4BNXA 4RLSA 3W8EA 4BNUA 1C0IA 3AY7A 3C1AA 4QXMA 1OC4A 1MGOA 1FDUA 1WZEA 4LMPA 3NX4A 4WE3A 4EJ6A 1YJ8A 5AXCA 3QY9A 1DJQA 1KY4A 2D5AA 3GEDA 1YQDA 4NFSA 3MWDB 3OQ6A 3P19A 3FPCA 3KOUA 4HFMA 2IODA 4LK3A 4BGUA 1FK8A 3I9NA 4M87A 3WOHA 1R12A 3K73O 3ONDA 1PQUA 1Z75A 4MIOA 4TZKA 5JDIA 3SEFA 1PJ4A 4E30A 2O7QA 4XYBA 1ZEMA 5C7IO 1BWSA 3ENKA 1DFGA 4ALJA 4RV9A 1GAEO 2AA3A 1GTMA 4CV3A 1HE4A 1YDWA 4QQRA 8LDHA 3ZWCA 4BMVA 3D4NA 1X14A 1GQYA 1E1MA 3RFXA 1HDOA 4Y6SA 5TNXA 3K9QO 3DMTA 1YOVA 4UEOA 3WNQA 3WBBA 4BO6A 2WYVA 5JO9A 1YVEI 2GCGA 5T64A 2DAPA 3WWYA 3ITDA 4DPKA 3OEWA 3GEGA 5G0WA 4IDBA 3FBGA 1VE9A 2PFGA 5COBA 5U9CA 4Q3NA 5LCXA 2Y1OA 1LC0A 5EJ2A 3DAGA 2ZKLA 3VDQA 2NQ8A 5H83A 1LDGA 1H5QA 1UP6A 1MC5A 4TRJA 5IAAA 1PJTA 3GY0A 2IEDA 3GN2A 1K5HA 1LXCA 3AY3A 2HK7A 4GSLA 1HYHA 4XGKA 3RFTA 1PQPA 2VHXA 3HNPA 3GAFA 1LDEA 4ESOA 3OJOA 4U6SA 1C1DA 2FPIA 1O5IA 4QFCA 4NBRA 3ETDA 1HWYA 3PVZA 2YV2A 3GDFA 3JQEA 4L8VA 5CDYA 1ZMTA 2DBRA 1D3AA 1AGNA 4LCEA 3H9QA 4JK3A 3GEMA 1JN0A 1AXEA 2O50A 3KYCB 4XYMA 4MVJM 4HV4A 4GBJA 1F12A 1PJCA 1YQXA 3B6ZA 4LGVA 4BHTA 5ICMA 4Q3CA 1HLPA 3SC4A 4OXNA 5A06A 3M1LA 3C7AA 4PZCA 3FR7A 1DFIA 3C3XA 1EZ4A 4PLWA 1PS0A 4CMEA 3TZHA 1QLHA 4BNVA 5IDYA 4ZQHA 5JDCC 1QYVA 1Q0QA 3EY4A 2P68A 3HADA 5I8ZA 1MV8A 4DMLA 2VYNA 5G4LA 1EQ2A 3FF4A 4ONEA 3QWIA 4TVOA 2VZ9A 4BV9A 1S7CA 1CQJA 3HQ4O 3VZSA 3BIOA 1ZK1A 1GCUA 3G0OA 4LW8A 2J8ZA 4BNFA 4L4XA 3BXXA 4BNGA 2NVUB 2OOSA 1NFQA 4Q3DA 3RC9A 4WECA 5DBIA 2AEFA 3QV1A 4R3WA 4BO9A 4B7UA 1SEVA 1PZHA 2BH9A 3WLFA 3K2BA 2HQ1A 4O5OA 3E6AA 2JD1A 4OOFA 3UVEA 4C7JA 4UVEA 1O95A 2GO1A 4OXKA 1B8VA 4OH1A 4B4OA 1RYEA 3HUDA 4CM3A 2AMFA 1GZ4A 3E18A 2A4KA 4P4NA 2O3RA 1D7OA 3MJTA 2O4UX 1NWHA 1M67A 1QLJA 3S2EA 3CKYA 4BUCA 1Y81A 2VT3A 3QHAA 1CEQA 3F46A 4BNHA 4Y9DA 3QP9A 1HSOA 4CMBA 4CM1A 3B1FA 4ZVVA 3L6OO 2GF2A 1E3SA 1B26A 4TRRA 1ADFA 3AK4A 3FTPA 2R00A 4PVCA 4BO0A 4HWKA 2E4AA 3BA1A 1KY5A 4B4VA 2IZ1A 4CMCA 4XIYA 2C2XA 1K6XA 2ET6A 1LRJA 4MVJI 4BIIA 4NZ9A 4XRRA 2PKQO 4XR9A 3P2YA 3E5MA 1DHRA 1GUZA 6LDHA 3VKUA 1FDTA 1NR1A 1TI7A 1MP0A 4PLGA 2ZYAA 3D5QA 3D7LA 1ISJA 1IYZA 1E3WA 3DZBA 3GHHA 4J1QA 3UCEA 1PJ3A 3RBVA 4K9DA 3RASA 4OHUA 2IDZA 4IDCA 1WW8A 3A4VA 3AI2A 4EW6A 2FOIA 2PNFA 4KZPA 3L4BA 1MFZA 4KOAA 1PGQA 2AQHA 4TKMA 1T4BA 4R01A 3OJFA 4RZIA 3WGQA 1MXHA 1XGKA 3CTMA 4L4SA 4L76A 4R1TA 4EJ0A 1ZKMA 4YRDA 2W2LA 1PZGA 4BNZA 4ND4A 1F0YA 4XX0A 3BTVA 1K2WA 3QIVA 5AOVA 1ADGA 2P9CA 3ZCXA 5IZ4A 1K89A 5JO0A 1JLLA 4NMHA 1TT5B 1J6UA 3KV3O 4FB5A 1OI7A 4ALNA 5DNAA 3WSWA 4E2ZA 4WLUA 3D1LA 3RD5A 4FJ1A 1SEPA 3AU9A 3MJ4A 2H63A 4HNGA 1NQOA 3N74A 4YRBA 1ZK2A 3DOJA 2QG4A 1ZXLA 2Q46A 3ONFA 1NQTA 5JNLA 3H9JA 5TF4A 2OGUA 4IJKA 2VWHA 3DO5A 2Y0CA 4J4HA 1HXHA 3H9UA 3WWZA 4UVIA 3EHEA 3TJRA 4ND3A 4CM8A 2XPCA 1LSOA 1KVQA 3ONEA 4LSWA 4D79A 1JVSA 3JYNA 3RFVA 3B20A 1ISFA 1P9LA 4UEJA 3DBHB 2J5KA 1LC3A 5THKA 4ZJUA 3D5TA 3LF1A 2EWMA 4N18A 5C5IA 1NWCA 2GN8A 3ZWPA 1PTJA 1LDMA 1GYPA 1Y6JA 3OHSX 3PWSA 1A7KA 5IXSA 1S6YA 1T1RA 4B3IA 4OQYA 4ID9A 4FD3A 1YL7A 1F14A 2P4QA 2NACA 4LVCA 2P4HX 5TJ9A 2GN4A 5ITVA 2C59A 3M2PA 1EE2A 4R54A 1KC3A 2LDXA 5CHEA 4K1LA 4Y67A 3PLRA 5F5NA 4JJFA 4RDIA 3QA9A 4WLEA 3L77A 2P91A 1I33A 1X13A 2BMAA 3JQGA 2XXJA 3BMQB 1E6WA 3GG9A 4XEHA 3BHIA 1YONA 1DRVA 1GEEA 1Y8RB 4O0LA 1KEWA 2X0NA 1B15A 4D42A 2VT2A 3E9MA 5JC8A 4O63O 3I9LA 4C7KA 3C1TA 1X7HA 1E6EA 2I65A 4IM7A 5A4DA 1J4AA 4LRSB 5FF9A 3AU8A 1IULA 1UAGA 5JXWA 2OBNA 1A7AA 4GMFA 1SPXA 4E5MA 4EI2A 1MA0A 2VHVA 2VOJA 4JGBA 3NT2A 4XR4A 1ENZA 2J3HA 4F6CA 5A02A 5MDHA 3L9WA 3PHHA 5DP2A 1D8AA 1IY8A 1XWFA 3WSVA 1I8TA 2EGHA 4GX2A 3VTFA 1H6CA 2X23A 4R1UA 1PEDA 1J5PA 3OICA 3JD3A 2J3IA 3OBBA 5F1OA 3NDRA 5BNIA 5A05A 3QVXA 4J0EA 3AUUA 4WLNA 3IJPA 1N2SA 4WCDA 2Y1FA 3DONA 2IYPA 2Q99A 5ER9A 1W4ZA 4CQMD 1N8KA 3GH3A 2RH8A 4DGSA 1QRRA 3INRA 3ZGYA 2DUWA 5U1PA 3LT0A 3SLKA 3F9IA 5DDIP 4UUMA 2IXAA 4XQCA 1UR5A 5KOIA 4DMMA 3D4OA 1VJ1A 1R0LA 3ETGA 2LDBA 1VRWA 3CXRA 2EJVA 1LBEA 1B8PA 2C29D 2DQ4A 5JC1A 5AYVA 2HRZA 4FGSA 4I5EA 1GV1A 4E13A 9LDBA 3VPGA 1U3UA 3OM9A 3PHIA 3RVDA 2FN7A 5KKCA 3JD1A 3WYCA 3ZWWA 4HX5A 1ENOA 1XG5A 4EJMA 2Q2QA 4D45A 4R41A 2VZ0A 5TC4A 1C1XA 1BVRA 1IHYA 5CPBA 3JQBC 4CLOA 2I9PA 2ZQYA 3G49A 1VJ0A 4KUHA 5GMOA 1UAYA 4FSHA 4CQLB 4DQXA 1UZNA 3I9KA 2VCYA 5HM8A 3H4VA 2IRWA 2QRJA 3NDJA 1JVBA 1XYGA 4WLOA 2PY6A 1ONPA 1YJQA 3VH2A 2PZMA 5CDSA 5JDCA 3KEQA 3UCFA 3DZGA 3F4BA 4OOEA 1OC2A 5F1KA 5BNTA 2RHRA 4ROSA 4W9NC 1SC6A 4QT0A 4M1QA 2VRCD 3SJ7A 3H5AA 3NUGA 4W82A 3MJVA 3HWRA 3ZWYA 3PK0A 3Q0EA 5DOZA 3OIFA 5EINA 3RUDA 2G17A 3PIDA 3JQ6A 3HHPA 1N7GA 4FR5A 4I5DA 3IIEA 3OH8A 5G0VA 1GZ3A 2Y1CA 3F47A 3NT5A 3WGOA 5CEJA 2NU7A 3VZQA 4TRNA 4O6VA 5KVQA 5F21A 1XSEA 5GZ6A 1I10A 1I36A 1Z7EA 2I76A 2WD7B 3PHGA 4PZEA 3KSZO 1UDCA 4UVDA 4M54A 1Q2XA 2VOEA 2JHFA 3O38A 4GVXA 1Y8QB 3DQPA 2ZCVA 1HZZA 2GD1O 1ENPA 2JKVA 3S2FA 4KQXA 2WWRA 1B14A 3R3SA 3PZBA 1UXIA 2FSSA 1EUZA 2Y0EA 1HETA 5EPOA 3WGHA 1I32A 1YWGO 3QQPA 3PHJA 2Q49A 1I3NA 1A72A 1ZSNA 2X5KO 3NTQA 3VHRA 5FYDA 1NR7A 4CQMA 4NBWA 1ZBQA 2B5VA 4QUKA 4D0SA 5IFLA 2CZCA 5BR7A 3ZHBA 3E5RA 3W8FA 1QYWA 2JFGA 1DC5A 3WGTA 2OFPA 4WOJA 3RAJA 3ZV5A 2F1KA 4ZICA 2VQ3A 4LISA 5JAIA 4IJVA 4CM7A 4W4TA 5IJZA 1H9AA 4CJXA 1CYDA 1U7HA 1IUKA 1XKQA 3C8MA 4AJKA 4BNIA 3CUKA 1DIAA 3HDQA 1D1TA 2VUUA 4MKXA 3JQDA 3PP8A 3G17A 1IPEA 4RVSA 1NASA 1RM4A 4RZHA 5I7EA 4II2A 4DYDA 2D5CA 1TLTA 4ZQFA 2O3SA 4PLPA 4UEKA 1E7MA 1UXKA 2YY7A 5THQA 2ZK7A 4IJUA 4AJLA 3LDHA 2ZB3A 3JD4A 4IIVA 4BGIA 3VOSA 3PGXA 1YL6A 1GPDG 4NU6A 3PTZA 2QW8A 1UDAA 2NVUA 3KO8A 1R4NA 4AJNA 4JP3A 3RC2A 4PVDA 3I5MA 3ZWNA 5A9SA 1AN9A 4YJHA 3RUAA 1YRLA 3EAGA 4BKOA 2UUOA 4E5YA 2O3UA 4N7RA 1MX3A 3SXPA 1E1KA 1LLDA 1HDXA 1PGPA 3TL3A 4AFNA 3I4FA 1A4IA 1Y1PA 5J23A 4MPDA 5EN4A 2NV6A 3C85A 4RVUA 5G0SA 4KWIA 1BXKA 1IL0A 1I5RA 1KBZA 3KSUA 4YVFA 5TQVA 4E2WA 2C7GA 2X9GA 4R4JA 1BXGB 2AEMA 3TFOA 1YS4A 1E77A 1HL3A 4PG6A 4R16A 4YT5A 4XDZA 3NTRA 1LSUA 2YHIB 5TIIA 5I7FA 2QRKA 3DTTA 3X2FA 5IF3A 1YDEA 2Q1WA 4RPJA 5DULA 1CETA 1H0KA 4TMFA 2X58A 1CRWG 1GYRA 1P1HA 2P5YA 3HJAA 2Q3EA 3S55A 4JJIA 1VI2A 4TROA 4Q3AA 2QIOA 2FZEA 3COSA 5C7OO 4RPKA 1GUYA 1XQ1A 2EXXA 1GCOA 1GD1O 1LSSA 1P1KA 3HZZA 3IAHA 4FN4A 4WNCA 4WGGA 4H15A 2X7HA 4GSKA 2VTEA 4KWHA 3BMNB 1HLDA 1H9BA 4H7PA 3NT4A 4XB2A 4CL8A 3GVIA 3TL2A 4EEXA 2YQ5A 1VSVA 1XEAA 4DLBA 4R1SA 1LA2A 1HDZA 1D4FA 5TT0A 4WCFB 3GAZA 5TX7A 1T2CA 4AJHA 4DIOA 3KXDA 3S2GA 1PGNA 3L0DA 2Z5LA 4OGWA 2POQX 3NGXA 4J3FA 2WM3A 4TZTA 4WUVA 4DPLA 1ISGA 2H5LA 1DEHA 2B4RO 4IDDA 1VJTA 1C0LA 4NK4A 1SB8A 1XCBA 3WGYA 5L7YA 1Z7BA 4PRLA 1ZJZA 1BDBA 1TT5A 3G79A 4J9UE 1OFGA 4B79A 1BVUA 2Q50A 3TZQA 2WE7A 4KQWA 3LF2A 4BVAA 4R69A 2OBYA 1XU9A 1WP4A 1I2ZA 2PGDA 3GGPA 4YJFB 1WNTA 1Q0LA 4J7CA 3WBFA 3KYDB 5COQA 3ZN2A 1HE3A 4WJZA 1PX0A 3OJ0A 3W4KA 3F6YA 4MP8A 3H5NA 2G1UA 2OHXA 3BAZA 4OKIA 1T2DA 4HFNA 3WYEA 5H81A 2BHLA 3WG9A 1YBMA 3FRJA 1Y7TA 3JD2A 3WICA 3DFZA 5FEUA 4DYVA 2VYND 3IKVA 2X6TA 4AL4A 3DBHA 2DBVO 1J0XO 5T5QA 5JCXA 1NHGA 1B0AA 5JMPA 4DVJA 4KTTE 1F8FA 1LDBA 2NM0A 4KDEA 3C7DB 2EGGA 2XXBA 4PFJA 1DIRA 4GL4A 1M2WA 2G76A 1AXGA 1ML3A 1NFRA 2HMVA 2X0IA 3MTGA 3VPXA 4A0SA 3CPSA 1LUAA 3TRIA 1AE1A 3F3SA 1HT0A 1GPJA 4PG8A 1QV7A 3GUCA 5CDUA 5HS6A 2YV3A 4IDEA 1MG0A 1B16A 3DBLB 3OFSA 1DO8A 1YB5A 3JQBA 3IP1A 2CVZA 4RGBA 3VVCA 4MVJP 3I52A 4MO2A 4Y8VA 2CF6A 1N1EA 2AXQA 2ZJ1A 3GG2A 3IDSA 4WASA 2Y68A 4GWGA 4MDHA 1X7DA 4B3JA 2CUKA 1A5ZA 4IQ0A 2NWQA 4JXKA 5KJCA 2Q1UA 3WGIA 4W9NA 4H3VA 1U7TA 4IQGA 4BO1A 5HBRA 3PIIA 5LDGA 1YGYA 4YXFA 1LX6A 2YV1A 3QWBA 1T4DA 4IXTA 3WR5A 1NX6A 1E6UA 4UVHA 4IIUA 1RM0A 2R6JA 1KEPA 1ORRA 3KLMX 3LSYA 4IMRA 5EL0A 5A9RA 4IS3A 4PLTA 4XYLA 1F17A 3DBVO 4BNNA 4CUKA 4NK5A 1DJNA 1R16A 1I2BA 2B37A 4J1SA 2OMEA 3GN1A 2QRLA 4MVJH 4R5MA 3DBRA 3JQ8A 2YDXA 1EVIA 2AQIA 4CLRA 2NNLD 2C20A 5ER6A 2PWZA 3EUWA 1PL8A 2X5OA 4I9UA 1R4MB 1NQ5A 3LVFO 5JS6A 3ZU3A 3FNGA 1HSZA 1F06A 1DRUA 2DUUA 3V1TC 5H82A 3K6JA 3ZZNA 1SCUA 4BO2A 1UJMA 2GR9A 4NG5A 4QECA 4DBZA 4FOSA 3DZIA 1T1SA 4OL9A 1GU7A 3DTYA 5AXBA 5K9ZA 3DOOA 4JIGA 5A03A 5CEFA 4RDHA 2W2LD 1ADCA 1R6DA 1UDBA 2ZJ0A 5ILGA 5JBIA 3N58A 4BKRA 4D43A 3AWDA 4M89A 4H16A 1WWKA 3NEPX 4B4WA 2D8AA 3TNLA 1XQ6A 4FQ8A 4CMGA 3O4RA 4WKGA 1LDYA 3HFGA 4P4LA 5KIAA 4CM5A 1XIVA 4GH5A 3PJGA 3FWZA 1SAYA 1OOEA 3WTBA 5K0ZA 1ISIA 1DAPA 4IS2A 3R3JA 2QZ9A 3K8ZA 4DWVA 2AQ8A 4CLXA 3VVBA 1X1EA 3UKOA 2PA3A 2J3KA 2C7VA 3S2IA 2UDPA 2D4AA 3DEYX 2X8LA 1NM5A 4IDFA 5JFOA 3W8DA 4K6FA 1XELA 2NU8A 2H1SA 3KYBA 2P9GA 5KVSA 5ENVA 1ADBA 1QP8A 1ZH8A 3FWNA 1DB3A 2FPGA 3H3FA 3PYLA 4NNJA 3LQFA 1EUDA 3ZV4A 5IZCC 7ADHA 4CLHA 1G1AA 3PFWO 4F45A 3R6DA 3PEFA 4MKRA 1CF2O 2OL4A 4JROA 4QO8A 1GL3A 4FFRA 4YTEA 2VNAA 5FWNA 3E82A 5BT9A 4G65A 4IXWA 4XD2A 4G81A 5ES3A 4YAKA 3K92A 3WB9A 4PLFA 4DQUA 3HB5X 2CD9A 1DLJA 3AM5A 3GZ4A 4D46A 3HB4X 4BNTA 1CDOA 1EBUA 1Y8QA 3QVOA 4YAIA 5TSDA 2Y1EA 5CFZA 3JYPA 2FWMX 3ZHXA 4Z0TA 5L7WA 2PGJA 2DT5A 3TQHA 5KNLA 3PXXA 1ZFNA 4CM4B 3NJ4A 2GPTA 1WMBA 3RSHA 2FRDA 4ZGWA 3DAPA 4E2YA 3KHUA 3L9XA 2RH4A 3A14A 1DC3A 1JWAB 1SBYA 2BGLA 2OP0A 4LN1A 4PLVA 5CG1A 2ILTA 4CM9A 2NADA 2O2YA 2CDAA 1EVZA 3LC2O 5I9LA 2HMUA 1RM3A 3Q3CA 5CG2A 1K6JA 2J6IA 4BV8A 2D1YA 2WSBA 3FI9A 3KRTA 3OA0A 3RUIA 3MEQA 3L6EA 1T25A 3NRCA 2O3QA 4IBOA 4BGEA 4E12A 1KS9A 4WK6A 5L51A 1DFHA 1Y9EA 1PU2A 2JHGA 2HCTA 4J7XA 1ZVMA 2A9FA 4MVJA 1TA4A 3H7AA 4IDAA 2Y67A 4DTIA 4UULA 3E9NA 2C07A 4RPLA 4R3NA 2NVBA 5GZ1A 3SX2A 5G4KA 3NAQA 4ND1A 5KJ6A 3ITKA 4BO4A 1JKJA 4P38A 4Q3BA 2B4QA 3BMCB 3T4XA 3ORFA 1ULSA 1WDLA 4BO7A 1EMDA 5DCYA 1E5LA 3GDGA 2VTDA 5L3ZA 3NYWA 2RCYA 3B1JA 3M2TA 4BNWA 2OUIA 3D0OA 3O9ZA 2O48X 4BO3A 5FI5A 1DAOA 3PDUA 1YBAA 3DMYA 4HY3A 2FZWA 1EDZA 2DM6A 2HAEA 4GI2A 3QJ5A 3F5SA 2Q4EA 2BF7A 3RKRA 1ZMOA 2WDZA 4NH4A 4UVGA 8ADHA 4RQUA 4BO5A 1Z82A 4R1NA 3JQAA 4AJ4A 2V7PA 4B3HA 4XQGA 3UW3A 2GN6A 3OJLA 3RUCA 2DKNA 4B7XA 4D41A 3U0BA 4AJPA 2UVDA 1A71A 4PZDA 3PWZA 3U4DA 4JBHA 3GFGA 5T6BA 1WXDA 4GLLA 1BG6A 2AG5A 5HA5A 3V1YA 4QSMA 1NXQA 4KUGA 3ANNA 4BO8A 2JD0A 5DOVA 1PL6A 3E1KA 3KVOA 3GFBA 4MVJF 1YB4A 1ZZEA 3C1OA 3I1JA 3U3XA 3H3JA 2W2KA 4A2CA 2ZB8A 1K6IA 1UH5A 3E9QA 5C3MA 1PQWA 5L4SA 1G0NA 2NU6A 5A04A 2W90A 2PD3A 3GNQA 2O23A 4NQZA 4QTZA 4J91A 3KUXA 3JQ9C 4M8SA 1L7DA 4HUJA 4RLHA 1E3EA 1I24A 1T2FA 4DRYA 1M76A 4ALMA 5JW6A 1SO8A 5T57A 3M6IA 4DXHA 1NQAO 4NFYA 4BKUA 4I5GA 4XJTA 4DQVA 2HJSA 2X0RA 3ZWMA 4A5OA 5HTOA 1N9GA 4DREA 3O26A 3D3WB 3W6UA 5AXDA 1F8GA 1FJHA 3JYLA 3O8QA 1U28A 2EHDA 2AQKA 4OO3A 3VPFA 4MVJG 4CR7A 4Y98A 1R0SA 1LJ8A 2HMTA 2GASA 3OF2A 3GNSA 3ZNPA 4CMAA 3LLSA 3IP3A 4XJSA 3RUFA 5HRUA 1YOVB 3N7UA 3WIDA 1GYQA 1QMGA 3TPCA 3JSAA 1QYXA 4OSPA 4P8RA 3EW7A 2XOXA 4CMIA 3RQSA 1FDVA 1NAHA 4B8ZA 2QQ5A 3JQ7A 3Q9UA 1H6BA 4U5QA 1MG5A 2DC1A 4E32A 4D7AA 1E1NA 1K0UA 1P77A 2FP4A 2NLOA 3MOIA 3V2HA 1PR9A 2NUAA 5B12A 5KJFA 4RJTA 1M6WA 3I83A 4E3ZA 2EG9A 4JBGA 3KEOA 1NPYA 4BL5A 3HDJA 2AEJA 1FDWA 2HSDA 4FFNA 4KDFA 4BQRA 4E5KA 4NBTA 2E48A 3FBTA 4K28A 5L53A 4OKNA 1O89A 1TXGA 1X0XA 4E33A 3U62A 4FFMA 3BHMA 3CZRA 4FW8A 1VSUA 4YT2A 4ND2A 2Q1SA 4K26A 2AE2A 1ULUA 2VWGA 4Z0PA 5DZSA 5C7LO 1IB6A 1NHWA 3DDNA 2C82A 1W8DA 2BD0A 3SJUA 3RC1A 2ZTLA 3UGKA 5IXYA 4RPGA 3DC2A 5A3VA 4FDAA 4JJGA 5LDHA 5CP8A 1NNUA 3PQDA 1ZUD1 2JD2A 5KWEA 2DBQA 3CSDA 3TSCA 5CDTA 5GY7A 3RKUA 2GZ2A 4RORA 3I9JA 4BNYA 1DC4A 4RO0A 2Q45A 1IE3A 5A5FA 3KM0A 3IMFA 4JLWA 1YE3A 3EYWA 1E1LA 1X7GA 3PFFA 5I7SA 4JX8A 2BFPA 3H8VA 1YB1A 2VYVD 3DAFA 3NGLA 2X9VA 1IHXA 1E7WA 1GV0A 1PIWA 1Q7CA 4AJ1A 3ZHZA 4AJIA 3NKLA 5ILOA 4FJ0A 2B4TO 4GAEA 5IZCA 2BKAA 2Q1TA 3I6IA 3AM3A 4L73A 1H94A 2WTBA 4A27A 3INTA 3L4SO 1R0KA 3EVNA 4W7HA 1I01A 1RWBA 1M66A 4OJNA 4AJ2A 3PWKA 4YBZA 4E2XA 4W99A 4Z6KA 2B36A 1KERA 1M75A 2JCXA 3PJEA 3OEYA 1P44A 2F00A 2X0JA 1DOHA 1D1SA 4HFRA 1ZJYA 2DLDA 1I0ZA 3AI3A 3WDSA 2V6FA 2ZB4A 4ILKA 5IDWA 2DTXA 3U4IA 1JKIA 2CF5A 3DFUA 4FGWA 2C54A 5DF1A 5T8KC 4INAA 1VC2A 2DBZA 2X1HA 4YT4A 3JQCA 3NJ8A 3KYCA 4YPOA 1I3LA 2E49A 1OMOA 2JCVA 2WYUA 3DZFA 2GERA 4RF3A 2DPGA 3SBOA 3H2ZA 1I2CA 1PSDA 3H9EO 1NPTO 4OM8A 3QRWA 3S1LA 1QORA 3AFMA 4WOKA 4MVJE 3GQVA 3FR8A 2QHXA 1ZXBA 2RAFA 3Q9NA 1E3WB 2D2IA 2J3JA 1ID1A 2J5QA 4D3FA 4R9SA 4D44A 4N5LA 4UUNA 3FNHA 5CEEA 5DN9A 1LRLA 3MJSA 1VL0A 4XB1A 4J7UA 1WZIA 1E92A 4U0JA 3CIFA 4CR8A 1P31A 1C14A 2PZKA 4FC7A 4I9HA 3DZKA 3MCVA 2DPHA 4Y6PA 1PJQA 3UUWA 1FDSA 1CERA 1JTVA 3U09A 4NIMA 2C0CA 4CR6A 1KEUA 4XGIA 2VWQA 2UUPA 4YAJA 2C5EA 4PN3A 1V0JA 2EIHA 4NU5A 5I7VA 4GWKA 4LMRA 3V1UA 3WTCA 1IZ9A 5CAEA 3I4CA 1E3JA 5ITWA 1NPDA 2YFQA 2PH5A 4TSKA 1HDCA 2GSDA 5ADHA 1UP4A 1JA9A 1O8CA 3Q2IA 5FFFA 4Q39A 1T2AA 5JE8A 4YA6A 2FR1A 3A06A 5K6AC 3DHNA 4GGPA 3O03A 4J6FA 3ROQA 3VH3A 3NTOA 3VZRA 1PZEA 3DR3A 1QYCA 2VYVA 5F5LA 1RYDA 2ZTVA 4WLVA 5AVOA 4IGFA 4IPTA 3ZW8A 7MDHA 3V5NA 4KUEA 1LDNA 1P1RA 5A3JA 3IQDB 4Q9NA 5JAQA 1KVTA 1LTHR 4F46A 4L75A 3L07A 1UXJA 3CEAA 1N7HA 3FSRA 3H5RA 4R68A 1BTOA 2R00C 1YKFA 3UCXA 4YJGB 3AOEC 4P22A 4TVBA 4IUYA 1HKUA 5F1PA 3WFIA 3HSKA 1ZCJA 2CY0A 1SZJG 4S1VA 4R5HA 1U8FO 1JAYA 3ABIA 2EP7A 3JQGB 1Q1NA 2P2SA 3QWHA 4DUPA 2B5WA 3JCZA 1CJCA 3UFXA 3C24A 4F3YA 2W8ZA 3GZNB 3W4IA 4RVHA 5DCUA 5JY6A 1BMDA 4CODB 4PG5A 4ZRMA 1BRMA 3KTDA 3ZH2A 4GX5A 3OETA 2B69A 1Z73A 3L4BC 4U8GA 3FHLA 3QLJA 3ZW9A 2BLLA 3ZWBA 1HDYA 2EP5A 2H9IA 2HK9A 5JYEA 1B3RA 1WPQA 2X4GA 3Q2KA 2OZPA 1UXHA 1R37A 1AHIA 1P1FA 2E82A 3BHJA 3IUSA 3GRKA 3ON5A 4J9VA 4EBFA 3WYBA 2HJRA 4CL3A 1G0OA 1PJ2A 3A1NA 2A94A 2EW2A 5HS4A 3UXYA 1BW9B 3A28A 3FNEA 1YH3A 4ALKA 1HDRA 1KVRA 1U4OA 1IOLA 3BMOB 3KETA 4L4RA 2VWPA 3ADPA 1EFLA 3PQEA 1L7EA 3R1IA 1EK5A 4FOOA 2PD4A 4M86A 4ZHSA 5L4NA 3JYOA 5EESA 4AJJA 1HEUA 1LNQA 3FN4A 2YZ7A 2O3JA 1VLLA 2GYYA 3A9WA 4G5HA 4FFPA 2FR8A 3OA2A 1EDOA 3C7CB 1E7SA 2Y1GA 2IYOA 5L40A 1YO6A 2HKIA 1LLQA 1O0SA 3ZWXA 4J2HA 1NTOA 3KB6A 4DLLA 4FBGA 2I67A 1MLDA 1DBVO 2DFDA 1PZFA 4F6LA 4YQYA 3WLEA 1PJLA 2C2YA 2PZJA 4IY1A 2QYSA 3E48A 4GGOA 2HDHA 2PTGA 3PLNA 1GFSA 4XIJA 5KJEA 3U49A 3ZU5A 1O9BA 1UUFA 5BNFA 1NP3A 3NV9A 2EKPA 5B4TA 1VM6A 1YL5A 2OO5A 1MC4A 3BMQA 1NYTA 1RM5A 4CLDA 2GRAA 4CMKA 1C1XB 2OORA 1H6AA 2Y0DA 3K30A 4CLOB 1U2GA 1Y8RA 3LC1O 4J1TA 4OIMA 4EGFA 1N1GA 2I6TA 2E37A 3OSUA 1UZLA 4NJOA 3K5PA 2V6BA 4R9RA 4Z9YA 4WCFC 1XA0A 3KSDO 4J43A 4OMUA 4X54A 2XAAA 2XF8A 3QW2A 3EVTA 2GNAA 4IMPA 2V65A 1JAXA 4DIFA 4Z0HO 3D3WA 3F1LA 3FNFA 1GR0A 2VUSA 3UOGA 1HE5A 1IPFA 4PIVA 3ULKA 3ZNOA 1WAMA 3H65A 5L4LA 1HTBA 4XYGA 4ZQEA 4EITA 3JD0A 2HO5A 3ZNNA 1KVSA 3LT4A 3WFJA 4AG3A 4CMHA 4JBIA 3GR6A 5JPIA 3S8MA 3W4JA 4DA9A 1P0CA 3Q1LA 1W6UA 1L1FA 4YT8A 4CM9D 3M1AA 3WGZA 1J49A 5AQ1A 1EUCA 2JL1A 3AUSA 3PRJA 1GUFA 3VDRA 5BSEA 3GVHA 1P1JA 4WEQA 1YQGA 1Q7BA 2NVWA 5EERA 3H2SA 1Z6ZA 3TZCA 1GDHA 2EKLA 3GA0A 1SNYA 4FJ2A 2AHRA 2UYYA 4IQ8A 4M55A 2G5CA 3RBZA 3UH1A 4CPDA 2CFCA 3ZDFA 5TS3A 3ANLA 3JV7A 4O59O 5KCZA 2WMDA 3QE3A 4MVJD 4YAGA 3STHA 1UZMA 2Y66A 3DZJA 1TT7A 2PD6A 3CMCO 2JAPA 3MTJA 4FCCA 5G2OA 3ZWVA 5G0TA 5DP1A 1XU7A 4II3A 1ZSVA 4YRAA 5TLSA 1Y9AA 4E5PA 3K96A 1BDMA 3GVPA 1WMAA 1DDOA 2FPPA 5T8KA 1E7QA 4L9RA 4PCVA 3GPIA 4I08A 3I3OA 4CQMB 3CZMA 4JP2A 4YQZA 1EK6A 1C0PA 1NVTA 2JAHA 4YAEA 2B83A 3CH6A 4ZU3A 2ZIZA 2IXBA 4CQLA 1QV6A 3BTSA 2DVMA 3TZKA 4Y6RA 4Q3EA 4BNJA 3GGOA 2A92A 2Z95A 3QWFA 3VH1A 4HKTA 1SOWA 2I99A 4FFOA 3WS7A 5JYDA 1HRDA 2B35A 5DBFA 4NDNE 1ZNQO 4KP7A 3FD8A 4XGNA 2NTJA 3H6KA 3CINA 1PR3A 3JQAD 4PG4A 3UAGA 4J2OA 2YHUA 4MKZA 2EJWA 1NVGA 5AXAA 3WQQA 1EQUA 1JWBB 2HU2A 3PZRA 1BGVA 4HADA 1FF9A 1TVEA 4FPXA 4MIEA 4YWJA 5ENDA 4OAQA 5L45A 2HRBA 3ZU4A 2JCYA 3MWEB 4AJOA 1R4NB 2VNSA 4N5MA 4XZ3A 1QYDA 3ICCA 1GQQA 1SOVA 1DLIA 3DL2A 3I23A 3VH4A 5A9SB 3GGGA 3ASVA 3INGA 4YJHB 1PWXA 2OP1A 3LYLA 3K31A 2WD7A 3VPSA 4U6QA 4ALLA 4HNHA 1H2BA 3F5QA 1VL6A 4E6PA 5CDGA 3GK3A 1DXYA 4A26A 2DTDA 5K6AA 3VKVA 5TJHA 4RVDA 1PGOA 3OQ1A 4RQTA 1GZ6A 1E7YA 5F3RA 2VRBA 1EFKA 4NFHA 5IDXA 2WD8A 5JAMA 3T7CA 3EZYA 5TRTA 1DIHA 1DHTA 1ZK4A 1ZEJA 4BS9A 3HDHA 2YFHA 4ND5A 3IL2A 4YCAA 2BFAA 4CLEA 1ONOA 4MP6A 3R0IA 4OXYA 2RHCA 4KMSA 2PGLA 4CV0A 1KC1A 2I3GA 2BRUA 2D0IA 3G1UA 3AOEA 1HDGO 2EF1A 5COAA 4MINA 4QEDA 2GZ1A 2Y1DA 3D64A 2BFOA 2VHYA 4HP8A 3BZUA 4RF5A 4NI5A 4EDFA 3W1VA 4C4OA 4OSOA 3V2GA 5BSFA 1T2EA 5JAZA 2R2GA 1R66A 2Z1NA 3QVSA 5T67A 3WQSB 2FMUA 1QKIA 2QZZA 3IKTA 2YUTA 4BMSA 4QO7A 3ZV3A 3EGOA 1PL7A 2PKRA 1U3TA 2CDBA 3GRPA 4NJMB 2CSUA 3WJ7A 4DPMA 3SC6A 5HWSA 2NU9A 3VPHA 3I9OA 1V3TA 1RKXA 3QVWA 4A7PA 2NTNA 5IN5A
chains in the Genus database with same CATH superfamily
3IS3A 2B1IA 5IK2A 1O58A 3AI1A 1ORWA 4MLCA 2FLWA 4UNSA 4WKNA 4F21A 3FMOB 3RU7A 3BB4A 3DHEA 4Z2YA 2Y0PA 4L74A 2ONCA 3LCRA 2WAYA 2XWJI 2OXTA 4ZXPA 1P91A 5AW4A 2X22A 3EMBA 4YV2A 1EWYA 1Y48E 1G16A 4PZAA 3SK0A 4I3HA 5CXUA 4YGYA 2BEUB 2QS9A 1BX0A 2V7VA 2YUIA 5IAOA 1L7QA 2O4CA 1WW2A 5JIBA 1CQIA 2GWHA 2PV7A 2TMGA 2VNIA 3GFVA 5KX5B 1XD2B 3SFTA 2Q2VA 4KH0A 1M1ZA 2XD9A 3PTAA 1NMYA 2H5EA 3IILA 3TMKA 1DIBA 2AI2A 2FYTA 1UBSB 1I30A 1JPVA 3DNFA 2WMYA 1FUIA 1Y9JA 5AUQA 4IGEA 1IRXA 4ZI3A 1IWBB 2YMLA 4XW2A 4OFBA 4UHHA 2BFMA 1M0SA 2NTVA 2VDLB 1IN7A 4CUZA 1W5FA 4LVUA 1K7EB 2QVZX 1EEXB 3EZLA 4C3UA 5HKKA 2YW9A 5KCMA 4C0JA 4EATA 4LF4B 2R6HA 4XM0A 1GU1A 2AJDA 1KIFA 3U7QA 3DEAA 1NLMA 2O06A 4UNNA 1JJ7A 1HKHA 1H2FA 4MJLA 4X44A 4ETNA 4Q93A 4GKKB 2EX4A 2QDKA 4W1SA 1GZSA 4D4IA 3PQ7A 4YJGA 3VMFA 3R0QA 3RRYA 3P5SA 4NZZA 4PX5A 3SX4A 3U60B 1IN5A 1DV2A 3AVPA 3PD0A 2HF8A 4EZBA 1T2NA 2P1DA 3G0CA 4L7VA 3ST7A 1BCRB 2UU9B 3SR3A 1L8AA 3LLMA 1OX4A 1WIWA 2IOYA 3ZV6A 1X0VA 3ZX5A 4WWHA 1VDMA 2Z3WA 1TYEB 2DX7A 3BMNA 3WA7A 1R6TA 4D3YA 3L79A 1O94C 2HADA 3IOYA 4ZRNA 3Q6IA 1FA9A 1M6HA 3VOAA 4BB0A 5A5DA 4V1CA 4MWEA 5EI5A 4C1NA 1F0NA 2DHDA 1KU6A 1O97D 5CPFA 3TXXA 4WCFA 4MR7A 6YASA 3AVYA 2O54A 4FIZA 2ZIAA 3LKZA 2NQTA 5EGSA 2OECA 3FJ1A 4H7EA 2EEZA 1Z4NA 1QSGA 4GMGA 3RU9A 1MKYA 1DPGA 2J9XB 2QX7A 4LZWA 3ESCA 3ZHYA 5EE0A 3W2IA 4TLEA 3USZA 4DY6A 5EIAA 3ZJYA 1UIMA 2BEKA 4U3JB 3CO0S 4MQFA 3IBSA 2FFJA 5HJ2A 5KVAA 3RVQA 4AS3A 5AW2A 4QFDA 4BC0A 5CFPA 4O2AA 3ADKA 1TQ2A 2B78A 1Z6PA 4JD5A 3C8HA 1MQ9A 4AS2A 1ICEA 2OCLA 5I45A 4UM5A 2DWPA 3WFZA 2WHYA 3GT0A 5K0SA 1UJ6A 1A9PA 5EQFA 1C8BA 2PGOA 4YJFA 3F1KA 3WX0A 1SUBA 1ONNA 3W2FA 3G2JA 4FFLA 1NRIA 3I72A 3OFND 4KIJA 3DD1A 4COOA 3KBBA 3AVTA 2OFOA 1TF5A 4N8SA 4E6EA 4QU0A 2X3UA 5H8WA 3BZWA 1LPAB 1E8DA 2DTEA 3ANYB 4LJAA 1CRQA 2PKQP 4ZD6A 2WC1A 5GADl 4R2IA 4RVFA 3AW9A 1BGWA 2I5PO 3PXDA 4A03A 4UMFA 4D4LA 4D9CA 3DAHA 2W6JA 3EASA 4RNDB 4UHEA 3DKIA 4BKPA 2NYAA 2RBEA 5K0LA 2FRXA 3DWIA 1KEVA 2I3DA 4NABA 3BSYA 2VZ8A 4IZIA 1KMCA 2A0WA 5DM0A 3V33A 3JYQA 3U3DA 2X86A 1NP7A 3PJDA 1JXMA 2AVDA 1OAAA 2QG6A 2W98A 1BD3A 4JI3B 4TTPA 1ZMRA 1D0VA 4JJ6A 4X7RA 2PUWA 4C4AA 2J5BA 3K15A 3WIEA 2PKXA 3D6FA 4PX3A 4RY9A 1OASA 2QBYA 1XJCA 2ICAA 3FXAA 4ACBA 2FSVA 3TFQA 3IIIA 5IN4A 1FXWA 2IE0A 1MZVA 2WG1A 3HE3A 4NOLA 3LC7O 1WB5A 5LC1A 1DKOA 3RJ5A 4YUWA 3DBLA 4J90A 3KWJA 1CZUA 5JLAA 1JI0A 3AFHA 1J8MF 1JDJA 3AP1A 1VYTA 3BJRA 3GMDA 4FXOA 3B1WA 4X6UA 4XQEA 2M2IA 4EGCB 4LDQA 2FZCA 4EY3A 1N5LA 3NAZA 1FS6A 4CBVA 2HHHB 2BTEA 3JWGA 3I9FA 4MR8A 2PSHA 1Z45A 1L4EA 2GN9A 1CQJB 5LA6B 1ZVJA 3W1WA 3WGLA 3S1AA 5HW0A 2AC7A 1NC3A 3QGMA 1AZWA 1TLLA 1XU4A 3IIKA 1AKWA 1DIGA 2REOA 2NZ8A 4TUYA 3CZ5A 4YRCA 4LA4A 4FYPA 3RS0A 2VHZA 5GAJA 3I4LA 1TYBE 3PHLA 1B7GO 3PPWA 1Z56C 4PR0A 2VJQA 2XA9A 4D3SA 2QX8A 3DW1X 3FYSA 1Y5LA 1A1VA 1AKQA 2R68A 1BE0A 3CR7A 4DL9A 4H7JA 4NPCA 5DGHA 1EUDB 5CX1B 4KAAA 4D9NA 2VHWA 3ENNA 4FN5A 5F5XA 4EA8A 5EZQA 3IE1A 2CDRA 2GNOA 3NHWA 2V8OA 3IX7A 1GNQA 3CW9A 3VI4B 1JQBA 4DLPA 2YYYA 4L6IA 4XWYA 5EWJA 3CNNA 2C8VA 2XJ4A 1HYGA 1EJ6A 3PJFA 1NXSA 5AW1A 3KZ1E 4Z4EA 2VPWA 4HDRA 4W6ZA 2WEKA 1CLEA 1O0BA 3TOZA 1G66A 2RI6A 3MFYA 1GEGA 5E3HA 3FFXA 4KHZA 2WHQA 1R4MA 1Z4IA 5HQJA 2QLMA 2HQOA 3OCVA 3VUFA 4FUTA 1L5YA 4DLAA 1PDOA 4C2AA 1Q44A 1Z5OA 1RAGA 5JLJA 3VYUB 3R76A 2ZQZA 5FI3A 3BCSA 3TLCA 5AI8A 3TR0A 2JG3A 4DCUA 2WG2A 1J00A 3TN7A 2AWOA 3B53X 1YR7A 3LLVA 3EHDA 1E4OA 3DDOA 4UUPA 3WNBA 1PWEA 4C29A 5I4BA 4N0EA 1IONA 4Y67A 2UZ0A 1N4DA 5EWMB 5H59A 1QXSA 3ORRA 2VA9A 3H2IA 1NW6A 4XRGA 3UMMA 4B3GA 3RYCA 1C5KA 2J9FB 1YOBA 3F7TA 3W5UA 4ATNA 1WHTA 3OIVA 2RE8A 1YZYA 2NSJA 4RS3A 4HRXA 1B4DA 2EERA 1VOTA 4RCVA 3GDOA 1KAOA 4LFBB 1C0KA 1KPHA 1A04A 1NKVA 4H4EA 4M8IA 2ZE8A 3JVDA 2Z9DA 1VXOA 4KFTA 4P5EA 2BDTA 1PI3A 2YXEA 3DE4X 3HRIA 3OQIA 2XNDD 4KACA 1AHHA 5LQCA 1NMZA 1SVLA 2FLVA 3F7OA 4M46A 1UT8A 4J0GA 3I0MA 4RPHA 2VPZA 1EBFA 4HNSA 2F6RA 3RV3A 3I53A 2FQWA 3VDMA 4YFVA 1W5BA 1QCDA 3SS9X 1XLTA 2Q5CA 4DR4B 3PEVA 1C3VA 2FK8A 3OO1A 3L4KA 3GNTA 3W2EA 1YZKA 3M6VA 1AH2A 1RJFA 1UQTA 1QDLB 4LYHA 4ZU1X 4ENVA 3HDYA 2PBLA 2ZRAA 2PK3A 3WL8A 3FLAA 1CB0A 4MYSA 5F7XA 2OCYC 1GN9A 3ACDA 4OQZA 1AOXA 4LFCB 1UOEA 4P34A 2OGZA 3MIIA 1OXMA 5BY2A 5C4MA 1ST3A 3H9GA 5U4QA 3NGMA 2YDYA 5HJEA 1PS8A 1Q50A 3AJ8A 1W0CA 4OYRA 4N9QA 2IWRA 3DDWA 2XH8A 1IU9A 1JMKC 1V2HE 4GPD1 4TMZA 4YCDA 3U7JA 3KU4A 1RDFA 3TWOA 4DCSA 3FB1A 3LPMA 3H4TA 4RANA 3PFHA 1M1YE 4DG8A 4XVCA 4A8JB 2ZIXA 1P1IA 4Z9FA 5EQDA 1XMJA 2G04A 2WJYA 3X1JA 1ZNZA 3T5BA 4JLJA 3ZEIA 3WL4A 1O95C 3TLMA 5FUVA 1SCIA 3RJ9A 4R7GA 1JKXA 1V16A 1L5WA 3IUQA 3QMWA 4RV5A 4C3OB 2XE6A 4I8XA 4BTVA 1M6EX 3NHLA 4HJRA 1CJVC 2J0VA 4UZSA 3B78A 5AKJA 4RTOA 4PRZA 1L4UA 3FOAA 1U4SA 3FJOA 5M29A 4HFJA 5CFMA 3KG2A 4BNHA 2XNJA 1NSTA 1ONSA 1XQ9A 4JYAB 3S28A 2ZXEA 4BRUA 4W5OA 3DDUA 3L0YA 3WMXA 3HGTA 5HRAA 3GUYA 1MAVA 4DA0A 3WAJA 1S4QA 4J1NA 5BOSB 5BMVB 4WBNF 5BQXA 5KAPA 2Q9UA 3JPYA 2ZRNA 4KVAA 1XCJA 1AQ6A 3KQOA 4CKXA 3QEKA 3CFYA 4CM4A 4Q1EA 2PWYA 2ZB7A 2RKWA 1WDKA 2R8PA 2WJ3A 5K2MA 1OBFO 1DRWA 1R88A 1TVMA 1WKBA 1NLUA 2QJWA 2RI0A 2V7TA 3HKDA 5BQ3A 5K4GA 1RXEA 1V3VA 3ZH9B 5C1PA 4YPVA 2V8BA 3EIUA 5DMXA 3QE0A 4R71A 4ALIA 5AFSA 3BAFA 3KTAA 1N5RA 3CWQA 4N47A 1USVA 2C5AA 4LRTB 2P5TB 4EHJA 2V1UA 2ZZKA 1VYUA 4C2TA 1PR6A 1G6KA 1JU9A 2ZTHA 4KDRA 1ZH2A 2NSYA 1R9GA 2OVFA 2JCGA 3HLYA 3MJEA 2DLCX 1PEKE 1MQ8B 1KY3A 4HWRA 3QVJA 2DU8A 5AVWA 1U5CA 2X14A 3PPIA 1I3KA 2PH3A 2WIAA 3TPFA 1C9MA 1CUBA 2VDNB 5EEHA 4ZAVA 4A5SA 1BSVA 1IBKB 5ALSA 2C2GA 4G3XA 1T8TA 1PWYE 4FVTA 4MKHA 3LQQA 4AT1A 1CVRA 3COYA 1U63A 1P33A 1TJYA 1E3DA 3R7WA 3NP9A 2HTFA 4DV0B 2P5UA 3AFNA 1SKUA 1P0IA 2AE1A 4KE7A 4GLBA 1XD9A 2R0QC 1CTQA 4IIBA 2CHFA 4RJIA 8OHMA 3A9VA 1XO1A 3K6SB 1O94A 3KQNA 1MJGA 4E46A 3GJQA 2B21A 1ZIYA 2QRNA 3I04M 1E9EA 4NCBA 3RK4A 3OIGA 1WSWA 3QEJA 2O0LA 4JJEA 3JZAA 2Q7OE 2FHSA 3E61A 3ORHA 5I9MA 1Y4DE 1UWLA 2V59A 1W47A 3D4LA 4JN6B 4CMJA 3G82C 4ON9A 1DQNA 1MB9A 4G5FA 1A27A 821PA 3VNVA 4TTAA 3AEKA 1IHPA 1O03A 3ROPA 2N3ZA 1XXHA 3HI4A 1CUGA 4CIVA 4UTOA 1I2AA 1RRCA 3Q7IA 4N5IX 4R6WA 4M36A 2J09A 4FNMA 1XA4A 3VR3A 1E1CA 2PQMA 2VQDA 1K7FB 3F4KA 4MUIA 1Q6YA 4WEOA 2GGSA 3S4YA 3SR0A 2PIAA 5FOWA 2NUAB 1T0HB 1GQSA 2WLTA 2ZI5A 3EODA 4JA0A 4E4YA 3WKCA 2FJPA 1XRRA 4KR6A 3L4JA 3L41A 2FPUA 4PNZA 5FA8A 1A9ZA 3ZNQA 1UJ5A 2ZI3A 1W0JD 3B70A 3OFKA 1NI4B 4AQYB 1HNXB 3E27A 4XKJA 1EXVA 1FFEA 4PINA 5FJIA 1SKMA 2GD6A 4LQLA 3ETEA 5BQPA 5T4HA 4FHEA 3V4VB 2XBUA 2G72A 6ADHA 3VA7A 2Q6LA 3UWDA 4G9BA 3FLMA 1TNDA 2Z2IA 4XSHA 5C18A 1HNNA 1ISMA 1XFDA 1JDBC 2WTMA 4JT8A 1ZX1A 4QQKA 4WY8A 5FBHA 1RADA 5G0UA 1EM8A 4E07A 5CA1A 2OV4A 1GJRA 4FCWA 1OZGA 1T35A 2BGMA 4B6QA 5CT8A 4X5OA 3F2IA 4ZAXA 4F1KA 3T6KA 1NJ2A 3W8EA 4XWOA 1C0IA 1R0RE 4QXMA 2QENA 3IAAA 4W6QA 2RJNA 4MCAA 3I30X 4RD6A 2A57A 1E64A 2JI8A 3L8DA 3B36A 4UE6A 3ZJUA 2H85A 3URKA 2C7BA 2IUFA 3C14C 4MUJA 1Z0JA 4HQOA 1DJQA 1KY4A 2VDVE 5BURA 1RTTA 2ECQA 2P78A 3FPCA 3IAS1 4HFMA 2IP1A 2IODA 3LY9A 4L7QA 5EZ6B 4BGUA 5KNDH 1MIOA 3I9NA 4GMHA 3WOHA 4TZKA 3ONDA 4UJ3A 3V1MA 1A5BB 1K75A 4L02A 1Z9BA 1KJIA 3OF5A 3QXCA 3SEFA 2O7QA 1Y7HA 1VE5A 2WWFA 1FTYA 3FPKA 1QGZA 2C4MA 4DDKA 2YS7A 5DBHX 2XWQA 3FCSB 3SXUB 2V5AA 1NUSA 2JAOA 1JLRA 4CV3A 1M6VA 1YDWA 4GR9A 1RWVA 8LDHA 4JT9A 4UKDA 5DU2A 3UB4A 3WKDA 2DFPA 1X14A 2WTXA 4L27A 3RVBA 4QDXA 1XCOA 4P7JA 4BP1A 4BO6A 1DX4A 1RJ9B 5TNXA 1YOVA 4UEOA 3S7ZA 3DL7A 2CBGA 2WYVA 4RC9A 3W3AD 4ER7A 4GDFA 5LMUB 2E4YA 3AG5A 4K9LA 3VR6D 1MDFA 1NJGA 1ZRNA 2JFZA 4XFDA 5EHXA 2ARKA 3JWPA 3ETLA 1UKAA 2A1IA 4IDBA 5G0WA 1VE9A 4YDQA 1QP0A 4HJXA 4D81A 2O19A 1J21A 3AIKA 2PANA 4UHJA 1T34A 5LCXA 1KU0A 1LC0A 1PFKA 2A8YA 3K1JA 3PSAA 4NYIR 5EJ2A 3MMZA 1UBLS 3N5KA 3ZQUA 4K9QA 2YWGA 4AG6A 2NQ8A 4TLBA 4C6RA 1FX1A 1WMEA 1ZH0A 3PUZA 4B9EA 4DWWA 1Z3IX 1UP6A 4CF6A 1W93A 4H7IA 4QPZA 5IAEA 4KPYA 1PJTA 1VECA 1TTQB 1VIAA 1NNI1 2GX6A 3Q8WA 3WISA 3QE9Y 3LBHA 3H11A 4FR0A 5D5HA 4UOEA 7REQA 1W7AA 5DK6A 1BWRA 1FFBA 2HK7A 4XGKA 5IUJC 2VHXA 5TMPA 1VSBA 4L5YA 4OHFA 3GCXA 4JJAA 3P4XA 1VA5A 3OJOA 4TKZA 1B0UA 4BQNA 1O5IA 2X8WA 1RYYA 2GAIA 3CUSA 1IXKA 3LWDA 3O73A 3UC5A 4CW7A 1HWYA 3PVZA 4O4LB 2QVBA 1SD5A 3ZXSA 3JQEA 1FU8A 2OKGA 4D9EA 1DINA 3M6FA 3WWEA 5IP5A 1AGNA 1DJLA 4LCEA 4XFJA 2C83A 2FPMA 1J7JA 4UJ5A 3GYGA 3OEHD 3TECE 3KQWA 1HT1E 5FFMA 1G7RA 3RUPA 2R79A 1N78A 1F12A 1YQXA 2PX0A 3ENVA 5E9WA 2IUUA 1UBUS 3R09A 5IARA 4BHTA 4ETWA 2I8AA 3OP1A 1HLPA 1QRAA 4UXHA 3M1LA 4CETA 3KQVA 4CU5A 2WDPA 1D0SA 3FR7A 5C2JB 3KFLA 1UJ2A 1ZC4A 3NALA 2UZ1B 4LF5B 1QLHA 4AG5A 2HC9A 1ZIPA 3ENWA 5IDYA 4ZQHA 3BWXA 3GEIA 1IHDA 2C2WA 4X90A 3VSEA 4N4AA 3ZX4A 3D31A 1M5RA 1JFSA 5TS2A 1HO3A 2LW7A 4RK7A 1EQ2A 1V9CA 1GGJA 2HLNA 3F49S 2ZR0A 1UMBA 2RKOA 3FF4A 3QWIA 3NHFA 4FFWA 5JZVA 1HG1A 3IP5A 4B09A 3BCRA 2VZ9A 3QUTA 2VXBA 4RADA 4F1JA 3HQ4O 3VZSA 3N0VA 1JYEA 2BYTA 1J5XA 2MMGA 2J8ZA 1T6NA 2WSMA 2I2WA 2J1LA 3C3EA 3MPUA 2Q3MA 5JH7B 4BNGA 1ORIA 1NFQA 5T3YA 1T5BA 3RYFA 5F3DA 4Y1FA 3D7KA 3IJ5A 2FUKA 3X1KA 4BO9A 4GE3A 2CFRA 4E5DA 1KRHA 2XVXA 2L0XA 3K2BA 5DISB 5E6SA 3PFGA 4BAGA 2BKLA 1MPXA 2ETXA 2HRDA 2WVGA 2M1ZA 4ZO4A 3B12A 4OMCA 5ALKA 1JHXA 1O95A 1AZTA 1JZSA 3DVLA 1HEYA 3IEVA 3KOOA 2CCGA 2DB3A 4MITA 3ZD9A 4JLMA 1THGA 2P69A 1D7OA 2CCJA 3MJTA 1M67A 2XZPA 2Z5FA 3OY7A 4IAOA 2IV7A 1Z08A 3S2EA 4LGCA 2B20A 1DAIA 1N2BA 3F46A 7YASA 1ZW6A 5JS2A 2PJRA 3QP9A 1M2VB 3E2MA 4K9MA 2I1WA 2PU5A 5JADA 2AD1A 3H05A 2WWVD 3W5AA 3T9DA 4EG1A 1ZI9A 2GF2A 3NYRA 4JI8B 2H59A 3B3JA 3ZGLA 3CZ9A 7GPBA 2BW0A 4HXEB 4HWKA 5AVXA 2E4AA 3C8ZA 2XGMA 3AERA 3ZHRA 5JAHA 4EFNA 2LCFA 3LK6A 3AQIA 3ZIUA 2IZ1A 1D4OA 4CMCA 4CRWB 4F5YA 2ONYA 2WF9A 2C2XA 1K6XA 5CHYA 4BIIA 3R23A 2B30A 4NZ9A 1T9AA 1OFTA 3P2YA 3E5MA 4JVNA 2H7XA 1UAAA 2AXEA 4UM8B 1Q1EA 3FY4A 1FDTA 2PL3A 1X3LA 1UBMS 2FPXA 3PVCA 1YQWA 3A7EA 4MHSA 3GGJA 1RWNA 4FE4A 4KC0A 4U2DA 3MGCA 4WRRA 1FBTA 1JQDA 1E66A 3GIDA 1E3WA 3DZBA 3JTEA 4MS1B 3ZJ4A 2R85A 5KPJA 4L0MA 5FTWA 1DJOA 1E8MA 2HJ9A 3RBVA 3PG5A 3MF4A 4WXPA 2CYBA 4OHUA 3BQ9A 5CA0A 2AKEA 4JEUA 4OQXA 1SUAA 5C5CA 4IDCA 1WW8A 3FOBA 1UBOS 1L4NA 3BWCA 4EW6A 3KJXA 3BS4A 1DDIA 3O21A 2DYKA 5A4MS 1PGQA 2AQHA 1T4BA 1Q84A 3G88A 3KQMA 5ES4B 1MXHA 3AL0C 2E0IA 1XGKA 4L4SA 4BEJA 4R1TA 5FBKA 4DS3A 3L1HA 1XZGA 1ZUNA 4UE3S 3WIUA 6NULA 4E1BA 3BTVA 4KV9A 1ADGA 1JSLA 2P9CA 3T15A 5M2QA 1JHPA 1TT5B 3QOFA 2C2KA 1M1YA 4FB5A 4ECEA 4DSTA 4BRSA 2QD3A 1G2OA 3L6CA 4HX9A 4FJ1A 4RFLA 1QO0A 3HL4A 3I76A 3B3GA 3AHFA 4Q12A 2XZTA 4HNGA 4UTZA 1NQOA 3N74A 5K3AA 5BRAA 1ZK2A 3BD8A 2Q46A 1NQTA 5MN6A 3LUPA 3H9JA 2OGUA 3R6LA 1U2PA 2XF2A 1DBPA 5DN6A 1JLMA 2Y0CA 1V26A 2WFAA 3H9UA 2ONJA 4G0WA 3EHEA 3FDIA 4CM8A 2XMBA 2XPCA 3QTLA 1PLKA 1NLZA 1MVNA 3NBMA 2JGNA 4OJTA 5CLFA 2QAGB 1JVSA 2IHTA 2OQIA 1DBWA 4NZMA 4PYMA 1CUHA 5THKA 4ZT5A 3KQYA 1M7BA 2ECFA 1L7MA 2R96A 1L5NA 1RXCA 5C5IA 2IWHA 1OKKD 1NWCA 4KXYA 3TI7A 1CK4A 4KZKA 4FYVA 3OHSX 3LBYA 2R8XA 4JDUA 3PWSA 1A7KA 4O08A 4PGHA 4TS3A 1S6YA 4ZO7A 5IXSA 1U3DA 4FXPA 3C5WP 4Y2SA 1BYIA 1QDUA 2BY4A 3BWVA 1M7HA 1QHGA 2IIVA 3AR7A 3ZY5A 5CBPB 2H1IA 1DCFA 4FD3A 1F14A 2SKDA 2P4QA 3EFOA 4KN5A 4IJQA 3R3HA 1KIMA 2NACA 4LVCA 4TWAA 2P4HX 2J07A 2VKQA 4HH0A 1C7ZA 2GN4A 4EAAA 1DOAA 4X95A 3M2PA 4QPPA 2WIKA 3D7RA 1ZN2A 3TQSA 4EBBA 3HN6A 3U7GA 3HR8A 4V0ME 4JJFA 4IRXA 4LTDA 1H66A 3QA9A 4RDIA 3L77A 1X13A 1HYBA 4WLEA 1E6WA 3KTOA 3VC2A 3M4YA 4OB8A 5LOVA 1DRVA 3KCQA 4V1CI 3H1PA 3MTQA 4QQFA 2YFYA 5B1IA 4WJLA 1O77A 1V95A 1CY4A 2ZAYA 2ZRLA 4OXQA 5LZ9A 5ED4A 2VT2A 3KD3A 4DWOA 5JC8A 4TSRA 4C7KA 3KOWA 3C1TA 4N0QA 4A6XA 4YXWA 1E6EA 3E15A 3HO6A 4DJEC 2PRJA 4LRSB 4ZZ0A 4XB6B 4G1EB 1N5OX 4RVCA 4ZI5A 1LQ2A 5B1EA 3U2QA 4U9IS 5JXWA 4LJKA 2FSIA 2SBTA 4F5ZA 4GMFA 1SPXA 1Z0DA 2GAJA 1WZUA 2ZBUA 4HAOA 1HORA 2D5IA 5CTJA 5KMGA 2ZUBA 2G67A 2FFRA 3T5AA 3PHHA 4JQOA 3A05A 2IBMA 2JF0A 1YA4A 2ZRMA 3AEZA 3FA2A 4GX2A 4EB8A 1ECLA 4GKAA 3E1GA 4Z1OA 2ZIGA 3GLGE 5LPNA 3NDRA 2AWNA 4GZMA 4EVRA 2YHAA 3JY6A 3QVXA 4M2LA 4XM1A 4FHCA 1FSGA 4GVPA 3ZOKA 3SDSA 2ZSDA 1T8UA 5LLSA 3C4JA 2RGBA 1BJRE 4GLJA 1URPA 1OZHA 4WCDA 2PX5A 4IOJA 4QBGB 2Q99A 5JZOA 2W2OA 4EFLA 3HMKA 3N0XA 3EULA 1EUCB 2JGFA 1F1BA 3IDZA 3T7RA 2A33A 5ER9A 4ARUA 1ZN8A 3OCYA 1N8KA 1X92A 3IVGA 4G4SO 4R98A 4C7MA 3EX7C 1KKLA 2QWXA 1U4NA 4PZPA 1P2FA 2XR1A 5CM2Z 5HKBA 3KQUA 5K3FA 2EF0A 2XB2A 4LVNA 3LT0A 1G38A 3SLKA 3F9IA 5MHTA 4NU8X 2DWUA 5ARDA 1EB9A 4K6OA 4ZEVA 3RRNA 3D1JA 1SZDA 3GEHA 5EE9A 1F60A 2MYTA 4DMMA 3W5BA 4BP3A 2R1TB 4ED9A 1QGYA 2HPVA 2PGXA 1QHIA 2QVYX 4MV4A 2BI4A 4LF8B 4XSGA 1AA9A 1LBEA 1B8PA 1ZH6A 2BVNA 5FOVA 4B35A 5AYVA 5AM2A 2HRZA 5GONF 1JJFA 4HVTA 1RWMA 4E13A 2FDRA 1OPRA 1XZKA 1TK3A 2UZAA 3VPGA 2Q21A 4H60A 2Z8YA 1R8QA 4DJTA 3MMXA 3VM6A 2V3CC 3LLCA 5AVVA 3PUIA 1V8FA 2ATCA 2ZRIA 1F6DA 2HHAA 5CU7A 4EPVA 2FN7A 5KKCA 3DVQX 5JAUA 3BPSA 3JRWA 3EIQA 3T54A 4CLOA 3JQBC 1RRVA 1Y3BE 2P2CA 3QUQA 1VJ0A 4AXXA 5LYJA 5CM8B 5GMOA 1UBGA 4AZSA 3CVWA 5HFJA 3WV5A 1Q16A 1XEXA 5HM8A 1CY7A 3ZHTA 1Y1KE 4E88A 3IESA 4H2DA 2J9ZB 1E62A 3T3OA 5FORA 2QD4A 4F11A 5CDSA 2JI7A 3A6PC 4EJ2A 2RAVA 4FU0A 2YZMA 1OY1A 1V8PA 2IS4A 4FFDA 2B6HA 1YR3A 2NU8B 1SC6A 3NZEA 3QEOA 4HQ0A 4MA4A 4QT0A 3UJ3X 2VRCD 4DHWA 1EAMA 2P2LA 4M99A 4YJ3A 2VAMA 3H5AA 3PXGA 3FPSA 1FYDA 3P2MA 4FLFA 3ITNA 3IR5A 3HWRA 2A9QA 2B5OA 5KQRA 4UM7A 4LQDA 4BC1A 3UJCA 1TFUA 2W6MA 1Z13A 3CN9A 3PIDA 3JQ6A 5GQSA 3HHPA 3CEHA 2CD7A 5DB4A 4I5DA 1YVUA 3IIEA 3A1FA 1QO7A 2CWDA 3AHCA 1CE8A 1A8SA 3AEQB 3UAOA 4BVGA 4PYJA 1SELA 1GPLA 3HKBA 1GZ3A 4MRAA 1ESZA 4TOIA 3G02A 3F47A 1W19A 1GCGA 2JAUA 1SK9A 1WUJS 4OI1A 3IH5A 2VF5X 4QVGA 3CZAA 4O6VA 3SSAA 1Z6TA 5CFOA 4FZRA 2DQZA 3B52X 5MN5A 1LK5A 1SFRA 1N0VC 1UDRA 3UAZA 3G0GA 4INPA 1KAQA 2PUVA 3A0RB 2I76A 2Z04A 3FJYA 3FYCA 2FE4A 1UDCA 4RHYA 4O4IB 3EVBA 5BN3B 5B2ZA 4M54A 5AWFC 2IYLD 4FDVA 3HP7A 1VDZA 1GPH1 1G6Q1 3S2FA 2Q5EA 4YGXB 3IBGA 4GICA 1VPLA 4KQXA 1H2XA 4MVCA 5AK5A 5J2TF 4Q9IA 4BFZA 1DC7A 5AUPB 1V4NA 3ELWA 5I9IA 2Y0EA 5EPOA 3D3NA 5HQTA 4OG2A 3HYLA 4LPSA 1R9JA 2TRSB 5AJZA 4RGVA 3FYTA 4E4RA 1A72A 2HMAA 1PJ8A 2P75A 2Q27A 3HB0A 2ZWPA 3IIJA 2EGUA 3NTQA 4REQB 3ZCQA 1IUNA 1NVEA 2YNMC 3K4QA 4PSKA 2V98A 4NBWA 1ZBQA 3TDMA 2ZG6A 4W5RA 3EA0A 1G3RA 2CZCA 1EZZA 3I58A 5F51A 3GLUA 4XSVA 1OREA 3Q98A 4G23A 5E0OA 3W8FA 1QYWA 2JFGA 5LUBA 1DC5A 4DKXA 1VE6A 5GVSA 3HK2A 3AI7A 4ZICA 2F1KA 4G9EA 5B55A 2G8NA 5IJZA 4FMCB 4P4TA 2H4ZA 1F0KA 4R2LA 3WC4A 3V55A 3WP1B 4CJXA 5T4EA 1X1QA 3LVBA 1T6ZA 2HZBA 2W22A 2YN4A 3Q6MA 1TK9A 2JFYA 4J0KA 5CGZA 4BNIA 3IPCA 3CUKA 1ACJA 1DIAA 3EOAI 1D1TA 2VUUA 4YJ2B 3BXOA 3QU5A 4MKXA 3V4SA 3PP8A 1YFJA 3LCVB 1V1MB 3R3XA 4PYOA 4RWEA 1QVZA 4II2A 4RZHA 4XDGA 2D5CA 5JSKA 1L1RA 2O3SA 4PM4A 4HQ6A 2IGBA 3F6SA 4HN4B 5AVUA 3L40A 1E1RA 1JKJB 4LPKA 4ER6A 3T5MA 2OM6A 1RRMA 2ZK7A 1WBJB 2A0KA 4IVRA 3IP9A 1R3DA 1R3UA 1ZCAA 3KKMA 1G8FA 4F91B 4IRMA 3IEXA 3VOSA 5GJBA 2QYHA 3F6RA 1JQ5A 2QTWB 4NU6A 5ESXA 1J1IA 4KX3A 4QFBA 3KO8A 1BN7A 3L0OA 4HPJB 4AJNA 2F1RA 2GEDA 1J33A 3RC2A 5JECA 5IAGA 4KRGA 3ZJVA 3LWZA 1SVKA 1AN9A 2AI1A 2N0SA 2NXEA 3PFBA 4YJHA 3ZHSA 1YRLA 4NFLA 2SKCA 3WDLA 2PL5A 3MRSA 4ZJYA 1LPPA 4PPQA 2O3UA 3C74A 4Q00A 1E1KA 1LLDA 4AFNA 1WXQA 3TL3A 2CXXA 2CJWB 3I4FA 3KKEA 1CQXA 1A2QA 3E8MA 6CHYA 4MPDA 5EN4A 2NV6A 3DM9B 3PXAA 3FYUB 1H42A 3PGA1 2A1UA 3R0JA 3I64A 3S70A 1PCXA 1RRKA 4MQ5A 4B73A 4KIFA 4DF3A 1GLVA 3C2QA 4F4JA 4GPZA 5AVJA 3TMYA 1HQYE 1IRIA 2HLDD 4P35A 5M3BA 3KSUA 4CF4A 1L7XA 5TQVA 1VPWA 4EG3A 2Q5QA 3QHPA 3NM6B 1QTNA 2AEMA 4OBWA 4ENTA 3TFOA 1EB8A 1YS4A 1BQEA 5HCUA 1D5WA 1YS6A 2WWYA 3BKWA 1KK0A 1LSUA 5ALHA 1CXZA 4NCAA 1YHNA 1TFRA 2D1SA 4MS4B 3WQHA 4PYKA 3O6VA 1KE2A 1YDEA 2PSSA 1FOEB 5DULA 4Z4CA 1Z7WA 3L01A 3PNSA 5D86A 3W9YA 2GFIA 2XZLA 1Y1LA 3AKCA 4L3OA 5F52A 1WCIA 3AC0A 2X58A 1QNFA 1UPCA 2ZJ6A 4JI4B 2Q3EA 4MTLA 4N39A 2P6OA 4M0MA 1NONA 5GWXA 3S55A 1RLIA 2D8MA 4KITB 4Q3AA 1YQEA 4OUDB 5JJKA 4H1TA 3BE4A 1RYMA 4TM8A 1H85A 1XQ1A 2HF2A 1LSSA 1KA9H 3B60A 4FN4A 2W2VA 4IWXA 4WNCA 4WGGA 2VP3A 3OEED 4H15A 2PG3A 4M9SA 4GSKA 1QF6A 4ZZ2A 2P2ZA 1N7JA 2VTEA 1GTJ1 4BJ6A 2AN9A 3LHIA 3CUYA 4KWHA 4D9HA 2H1FA 2YIDA 4UCXA 5I9BA 2IEAA 3EIXA 2EKZA 3UA3A 3A6JA 1DT5A 3D2AA 2V0NA 3TL2A 3MB5A 3ZYZA 2XEXA 1XEAA 2XB9A 3WL7A 1WU7A 4AYXA 3B1YA 1LA2A 5TT0A 4DIOA 3SF8A 2I4MA 1IMOA 3C5EA 4L9SA 3L0DA 4BWGA 2JGJA 2POQX 3N2YA 4A8JC 4TZTA 2FMXA 1Q1BA 4WUVA 2H5LA 4IDDA 2QEQA 4NBNA 1VJTA 3TW4A 1JEAA 4BFTA 1ZITA 3VJLA 2AJ8A 2C95A 1V39A 3V34A 5JVDB 3ZBPA 1YNOA 2FWPA 2I54A 2FEXA 2GKSA 4Y2QA 4Y2UA 3P4YA 3RS3A 1K5DA 3VVLA 3HJFA 1UPAA 1NVVQ 1ZJZA 3V4FA 2E21A 3KZKA 4R8RA 2Z4RA 1H2ZA 3QXXA 1FUYB 2RGNC 3LKDA 4L4YA 2XOEA 4NEHB 4BVAA 2OAGA 5HVNA 2Q62A 4MW4A 4TMVA 1ZH4A 4V0QA 6REQB 3WBFA 3ZN2A 4LC9A 2GZAA 4X1YB 5J58A 4MYTA 3AZPA 3B1VA 4RD1A 1ZM4A 4Q7LA 4Q02A 4MP8A 4RIFA 1KI1A 4Y2VA 5BWNA 1X39A 1ZIXA 1XD2A 1KF0A 3NTUA 1Q5PA 1YFZA 3IQWA 3WYEA 4KKXB 1Q7RA 1FTWA 3C6ZA 2BHLA 2VP4A 4UU0A 4DV2B 3DFZA 5IT9A 3WNDA 5EJAA 2VYND 2OFFA 3IKVA 2X6TA 3K5WA 3SLRA 1NMQA 1D09A 3DBHA 2UUBB 4OATA 3TQTA 4M0EA 3NYQA 5EXDA 4EMBA 3DDZX 3D6AA 4I4TB 2OWDA 1A8HA 1B0AA 4NTZA 4EY4A 1IZYA 3OHPA 1LDBA 4GZ5A 2NM0A 3CHYA 5F1YA 2EGGA 4K46A 3UK7A 4MWSA 2BGIA 2DCMA 5BSRA 3RTCA 3HVHA 1DIRA 1M2WA 3CSUA 3WYAA 1JDTA 1L3CA 2X41A 4YP7A 1ML3A 2HMVA 2GVNA 1KY2A 3ANXA 3CPSA 3D54D 3K32A 4XTRA 1LUAA 2QY9A 1HT0A 1LBQA 3AF6A 5KQLA 4GIBA 5EUBA 2G9VA 2H3HA 2XB4A 4DM7A 3GUCA 2HF7A 2YV3A 3FMPB 1BCRA 2MDTA 2XMRA 1B16A 4OGFA 5IKXA 3QLEA 3OFSA 2BCEA 3JQBA 4MQLA 4M7PA 4RGBA 2CVZA 3KJZA 3VVCA 4AKGA 2EFEB 3E2PA 2R4TA 5H3CA 3T9CA 2CF6A 2QJFA 1N1EA 2AXQA 5HBGA 3IDSA 5T4FA 5AW3A 4FYMA 4J07A 4WASA 3DEFA 4AP6A 2O59A 3EDOA 4MDHA 4B6PA 3H8JA 1O1YA 3ISTA 3WGIA 5IYZB 2R6CA 1D0IA 1HTWA 2AT1A 3PIIA 4O1HA 4DT1B 5KNDD 1ZVVA 2ZETA 1LX6A 3JX9A 5JSYA 4EQZA 1T4DA 4U3JA 1AQUA 1OBOA 1KYTA 1E6UA 1VCNA 3BBLA 3WR5A 5BN1A 2WZQA 4A1OA 1KEPA 1QK4A 2P2GA 3KLMX 3LSYA 3OPYB 5AKXA 4AX8A 4E7OA 1F17A 4M6WB 3JAMA 3VO1A 5HZKA 4Q01A 4CUKA 2J08A 2TS1A 5EY5B 3X3HA 3R8FA 5AKIA 3IA2A 2OC9A 1QIJA 2Q41A 4GP9A 4QOGA 5EIBC 4R5MA 3T9EA 2C98A 3OTGA 4OJMX 2YDXA 1EVIA 2ZBRA 4DKJA 3B8EA 2IHYA 4IKOA 1IIRA 4RULA 1XPOA 4XX1A 1MVLA 1CUUA 2GXSA 2XGSA 2XB8A 4I9UA 4ZC8A 1W36B 1PR5A 1NQ5A 2JJ1A 3GUZA 3N2GB 1Z4QA 2IPLA 4RHCA 3RRMA 3RS8A 3OM1A 5FWYB 5F64A 1UM9A 3MCUA 5FYQA 3ZE9A 5FOTA 2PSDA 2ZLBA 1F4LA 5H82A 4Z8XA 2XTNA 3EAFA 3ZZNA 4BO2A 2XTAA 4XVHA 4AMGA 3E84A 4M7OA 4QECA 1OT5A 1RWQA 4U7FA 5DXAA 4FOSA 1IVNA 3DZIA 4OL9A 3T5PA 4CQNA 5IC4A 2VJLA 5A03A 5JD6A 4L72A 5EMNA 2W2LD 4B6OA 5ILGA 5IM5A 2N9UA 3FAZA 1NNEA 4LK2A 1TUIA 2ID4A 5K0BA 3AWDA 1I1HA 4M89A 2VK8A 3BFKA 2YNMA 4B4WA 3TLKA 2D8AA 3UGTA 3OHMA 2DH6A 3OE7A 4F5WA 1FSFA 1QRTA 4CMGA 3O4RA 5LP6B 2H2HA 3C6YA 2DHQA 3E9EA 4YQEA 3T3HA 1EIZA 4B5KA 5HIMA 2O57A 1NVAA 4P4LA 5IJ9B 2XB6A 3QYJA 3CR3C 1G55A 4Q7MB 1AK1A 4KWEA 4D8WA 3PJGA 5A6SB 1KJWA 1OOEA 1ZM2A 2IYUA 2I7TA 3BGVA 4Q4AB 3HJUA 2XECA 5E6UB 4O3MA 3HO8A 4RMGA 4KXFB 3O5AA 5K0ZA 5LA6A 3IAEA 3R3JA 2QZ9A 3DNPA 4HLUC 1V7CA 3EYAA 4NMLA 5EVJA 1X1EA 2PNJA 2WK1A 1B6TA 2C0QA 2J3KA 3BWYA 4FYHA 3V9PA 4C88A 2UDPA 3IAXA 3CCCA 3LGXA 3PEEA 1NUPA 4JC5A 4G0ZA 4N03A 1XELA 5EJIA 3WI7A 1EUQA 3V42A 1Z15A 4EW3A 4P3OA 2DSTA 4URUR 5ETJA 4DZRA 5BORA 3FWNA 4L5IA 1ORHA 3PYLA 3A70A 5DHTA 3WMGA 1EUDA 2E1RA 5KYTA 1N32B 1Z5GA 1C9JA 2PT6A 4JENA 4RNCA 3PFWO 4BN0A 2LTAA 4ZVRA 1ZNWA 2BE7A 2GZDA 2WUWE 3PEFA 4YRRA 4F45A 1JWLA 2BH2A 4DLZA 1CF2O 4ER0A 2HSJA 1GL3A 4BDTA 1UOOA 2JAXA 3PFCA 1F2TB 2F62A 4NMMA 1U5BA 3STWA 2NZYA 3EUEA 4A9AA