4DYVA

Crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
237
structure length
213
Chain Sequence
KKIAIVTGAGSGVGRAVAVALAGAGYGVALAGRRLDALQETAAEIGDDALCVPTDVTDPDSVRALFTATVEKFGRVDVLFNNAGTGAPAIPMEDLTFAQWKQVVDTNLTGPFLCTQEAFRVMKAQEPRGGRIINNGSISATSPRPYSAPYTATKHAITGLTKSTSLDGRVHDIACGQIDIGNAMDVAHVASAVVYMASLPLDANVQFMTIMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Crystal structure of a short-chain dehydrogenase/reductase SDR from Xanthobacter autotrophicus Py2
rcsb
source organism Xanthobacter autotrophicus
molecule tags Oxidoreductase
total genus 73
structure length 213
sequence length 237
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dyvA00
3VVCA 2PZMA 4J2OA 4GI2A 5B12A 3WGOA 4LN1A 4CQLB 5TRTA 4YJHA 1VL8A 1XLTA 3GDOA 3IAHA 2VCYA 4IGFA 1N9GB 4DPLA 5BSGA 3U4HA 5DN9A 4R51A 4NJMA 5G4KA 1UAGA 2AQ8A 4L73A 2D0IA 3MOIA 4JJFA 5FF9A 3LC1O 1DC4A 4E5NA 3H2SA 2Y0CA 3H6KA 6ADHA 1GQ2A 1JW9B 4CPDA 4KQXA 4PZCA 3GDFA 3I4CA 4BMNA 4ZJUA 2C07A 3WOHA 3EY4A 5EIOA 5I7EA 3KOUA 1U3VA 1YQDA 2HKIA 2Y93A 3H4VA 1P9LA 1DHRA 3JQ7B 3QWAA 5AVOA 2X5JO 3MOGA 3UCEA 3DR3A 1E5QA 4QECA 1NASA 4BV9A 4CLRB 4YRBA 4EW6A 5L4LA 3D4OA 1C3VA 1NHWA 2RAFA 1WDLA 4NZ9A 2P9CA 2VRCA 4EDFA 3KUXA 2FZWA 3KSUA 4II3A 4O0LA 4YJHB 5A03A 1Z82A 3TSCA 2VNAA 1KVUA 1R16A 4E0BA 2DTXA 2NACA 3TF5A 4BO1A 3F5QA 3O4RA 4UUPA 3EC7A 5DDIP 4NMHA 3FTPA 3W8FA 3ZWCA 2EW8A 4DBZA 2PK3A 5B1YA 2CF6A 3WJAA 1IYZA 1T2EA 5JXWA 3R0IA 2V65A 4Q3EA 1GCOA 3DZBA 3EVTA 1GQQA 5CFZA 4XDYA 3RJ5A 3HB5X 4OL9A 4R01A 4EYEA 2Z95A 1GY8A 3DAFA 4K6CA 2ZTMA 3UH1A 1E7SA 2HK8A 3Q11A 3H9GA 1ONPA 4N5MA 3WDSA 4IJKA 4BO9A 4JXKA 1J0XO 3WFIA 1XG5A 4HX5A 1DRUA 1RPNA 3ROPA 2V6MA 2Y0DA 3RC2A 3WS7A 4NH4A 1P1RA 1ZVMA 3WLFA 2O7SA 2IEDA 1KOLA 4BNNA 1ZFNA 3F4LA 1K6JA 2AW5A 3ZHBA 4LCJA 3U9LA 2PGJA 4B8WA 3N58A 1EVZA 4BV8A 3FRJA 3F6YA 3RUDA 1P1FA 2D4AA 1D1TA 1EUCA 1YB1A 4YEDA 1F0YA 3MJTA 4Y6SA 4CUZA 2CZCA 2HK7A 2IZ0A 5GY7A 2WYVA 5DCYA 4FQ8A 4B4OA 2X8LA 5T67A 1QSGA 1OZAA 2PKQP 4N5NA 3QHAA 3RWBA 3GMDA 1QV6A 1U28A 4TVOA 4QX6A 5KVVA 1C0IA 1CRWG 2PZKA 4GVLA 4IBOA 5LCXA 5JC1A 1XSEA 4I9UA 2OORA 2P9GA 3E9MA 4MVJI 2PLAA 3ZWNA 4CMCA 4KUEA 1I2CA 4OYRA 1V3VA 4BGEA 3F46A 1Y8RA 4NBRA 3DMTC 3C24A 3TRIA 3WGQA 2RHRA 3HSKA 3I9JA 1E7YA 3VZQA 3C7CB 2OP1A 1EVIA 4MVJD 1DFHA 4MIYA 2AG8A 1LU9A 2WSBA 1UXIA 1CF2O 5F5NA 1VRWA 4BO5A 3Q1LA 4GX1A 3ZI0A 1HXHA 3MCVA 1ZMOA 4ZA2A 2DPGA 1ZEMA 1O9BA 2ZQYA 3B20A 5JCJD 2OL4A 3AW9A 2C2YA 4BNFA 5I7SA 1HRDA 4E33A 1IZ9A 2EW2A 5IN4A 5C5IA 3EUWA 4WLOA 4WOKA 4R1NA 4YAEA 4HV4A 1L7EA 2LDBA 1YONA 5KJ6A 1NR7A 2AEJA 4ZRMA 1FDWA 1Y8RB 3VDQA 1YWGO 3RFXA 5I9LA 5L9AA 2P4QA 3F1LA 1DBVO 4I9NA 3QV1A 5A02A 3LDHA 3GEDA 2J3IA 1ULUA 1R4NA 4AFNA 4MVJE 1GZ3A 3ZV3A 1X13A 4GX5A 3H9UA 4B4WA 4IJUA 4GWKA 1EUDA 4KUGA 4HNHA 2HMUA 3T7EA 5BNFA 1U7HA 3GQVA 4LRSB 5IZ4A 3JQFC 5TIIA 3BHIA 5I9MA 3DZJA 1NQOA 3VTZA 2IEBA 5TJ9A 1EE9A 1RM5A 1PR3A 3VC7A 2NADA 4G5HA 4JP3A 3U5TA 3PHJA 3WQSB 1B8PA 1MC4A 4EZBA 3PYMA 1Z7BA 4FIZA 3D1LA 4WNCA 1JU9A 2A9FA 3PXXA 4OAQA 4OMUA 2D5AA 4R3WA 3RKUA 2Q99A 3UW3A 4IZIA 2CNBA 3WTCA 3PIIA 3JQBC 1HKUA 4L4RA 3VKVA 1LDGA 4WLEA 4UUMA 3GPIA 4BHTA 5CDTA 5IDWA 2EERA 2J3KA 3QVWA 1A9ZA 1LDBA 2BLLA 1SBYA 3QVSA 4GSKA 4OXKA 4YAKA 4FS3A 1B7GO 5ITVA 3I1JA 5IZCC 3X2EA 2QIOA 5KJ1A 1P77A 4YT2A 1LLDA 1VL0A 2HUNA 4L4XA 2O4UX 1PJ3A 3IC5A 5IN5A 2HK9A 1LSSA 3OF2A 4A7PA 1JVSA 2D2IA 4ND3A 1UDAA 5AOVA 2IRWA 3OJ0A 5KNLA 1T1SA 1WVGA 2XXJA 1AHIA 4QO7A 5A06A 3E18A 1VSUA 7ADHA 1I8TA 5IXSA 2DKNA 2EGGA 1ARZA 3D3WA 4RORA 5HA5A 1HZJA 1RYDA 5K9ZA 2WMDA 3ICCA 1ZK4A 3GZNA 1B2LA 4BO6A 3X2FA 1RM4A 3PYLA 2AQHA 5THKA 4DMLA 3OSUA 1LQTA 4PG7A 3UOGA 4ND4A 3U09A 1H2BA 1RYEA 4B7XA 2VYVD 4XGIA 2FR1A 3K9QO 1HF3A 3Q9UA 3GVHA 2X7HA 3IOYA 1HEUA 1LLUA 1YS4A 3GN1A 4BO4A 3WGIA 5A5EA 5JDIC 4YQYA 4JX8A 4FBGA 4ALIA 1EZ4A 2YHIA 2G76A 2NU6A 5G4LA 2VHYA 2DTEA 2VHZA 1E7QA 3FHLA 3BZUA 2FSVA 3W6ZA 5AQ1A 3OICA 2O3UA 1E0DA 2WE7A 2Y1EA 1I3LA 5B4VA 4CUKA 1UXGA 2AQIA 3D3WB 3I23A 1UH5A 1OFGA 2OUIA 3RKRA 4PG8A 3KETA 1HDYA 4IUYA 3GZNB 1ZK3A 4FJ1A 4DWVA 1E5LA 1WDMA 4RVHA 4CODB 2GGSA 1EDZA 4I08A 4BKUA 4R9SA 3NEPX 1PGOA 3AUAA 4OKNA 4CV3A 5KJEA 4UVDA 1VI2A 2GYYA 4ZICA 4CM3A 5K6AA 5FEUA 4UVGA 2I9PA 3PWKA 4MJLA 1QYDA 4EUHA 1HLDA 1PS0A 3FR8A 2EV9A 1BSVA 4GGOA 3VH1A 4IQGA 1O95A 1MP0A 3NT5A 4CM8A 4KTTE 5A9SA 4RDIA 1ADCA 2POQX 5AYVA 2PD3A 1RWBA 4G2NA 3GNTA 3KYBA 1KEWA 5JAMA 2J6IA 2XXBA 1LC3A 2O3JA 2RCYA 3TZ6A 5JMPA 4BO2A 9LDTA 4UEKA 3ZW9A 4FJ2A 5JDCC 2XAAA 2HO5A 5CP8A 3CPSA 3W1VA 1HDCA 4RDHA 5G0SA 1RJWA 4DLLA 4NFHA 4E5YA 2XOXA 5A3VA 3WICA 1LQUA 3FR7A 4D46A 1HDXA 1B16A 4L74A 1IULA 1NVMB 2G5CA 3GVCA 3VPSA 3MJ4A 4TKMA 2CDBA 3SX2A 3FBTA 1LC0A 4CMIA 4XQCA 4MOWA 5EQFA 5CDSA 3OIGA 4CM8B 3OIFA 4IDAA 2QG4A 1DC6A 4MKRA 3T7CA 5ILOA 1VE9A 3HUDA 4DTIA 1I2BA 4II2A 1NHGA 2PNFA 1F8FA 1EEHA 4E2WA 6LDHA 3RUHA 3RC9A 1CDOA 5I7VA 1AUPA 1E1KA 1PEDA 4XX0A 1R37A 1TT5B 2B5VA 2F1KA 1JN0A 5T8KC 1U2GA 3DOCA 3ETEA 4AJOA 3HB4X 2HMTA 1A9YA 4CMIB 1Z7EA 3CTMA 1H6AA 1QYCA 2Q1WA 4I5EA 3RAJA 4YVFA 4TRRA 1XHLA 1VPDA 4ZQHA 4YRAA 4R5MA 3UF0A 2DAPA 4J1NA 3VPFA 2AA3A 4WNIA 4K1LA 4BKPA 1FF9A 4AJHA 1PTJA 4Y6RA 5A04A 2JAPA 4WKGA 4IDGA 2G1UA 5F1PA 2C59A 3Q2IA 4RO0A 4D41A 3IP1A 1FK8A 1Y8QA 3OECA 1V3UA 3F47A 2Q46A 2ZB3A 3CE6A 3AY6A 2B35A 3BHJA 1OC2A 1TLTA 3KB6A 3AWDA 3JD3A 3GEMA 1ZKMA 3ROKA 3DXFA 1MXFA 1OC4A 1AXEA 3B1JA 3FF4A 1ULSA 2I6TA 3GZ4A 2D8AA 3NAQA 3QE3A 1CQIA 1E7WA 2Y68A 3PEFA 4J90A 3A9WA 3KRTA 5G0WA 1ENPA 1KBZA 3MJSA 1W73A 3ZNOA 3PVZA 1QRRA 2PD4A 1GPDG 1ZXLA 3F3SA 5CDUA 2JKVA 2RBEA 3WTBA 2I3GA 4XR9A 4CM9D 2GNAA 1VM6A 2QRKA 4PLZA 5ES3A 4CMAA 3MZ0A 1Q0LA 3F1KA 3IP3A 3GVXA 3IMFA 3CH6A 5KTKA 4IS2A 2AEMA 2AXQA 1I3NA 3UCXA 1P1IA 5CDYA 4D3SA 3DBLB 3I6QA 5JY1A 2OBYA 4BOYA 2A35A 3H9EO 4MVJG 4WLFA 4LSWA 3AUUA 4UVHA 2GPTA 4BNKA 3OA2A 3BHMA 1MX3A 7MDHA 4XYBA 5TC4A 3D64A 2QRLA 4HY3A 3NRCA 5IXYA 5EN4A 3H5RA 3NKLA 5ICMA 2CVQA 3IUPA 4ND2A 4Q39A 3ZWAA 4I1IA 2O23A 4TZTA 4UULA 3UVEA 1DXYA 3OEWA 5T64A 3QLJA 1KY4A 3IKVA 2HDHA 2X9NA 2WDZA 4XIJA 1EBUA 4R16A 4BGVA 1EVJA 1NXQA 3ZV5A 3V2UA 3CXRA 3HJAA 2A94A 1QR6A 1TEHA 3BMNA 2EF1A 4D3FA 4E21A 2HAEA 1LSOA 3U4IA 4Z3DA 2HLPA 1EK6A 4XB1A 3WIDA 4PCVA 5CEEA 3OQ1A 4R68A 5LC1A 1E3WA 4BUCA 4IXTA 1T2DA 1UXJA 4RVFA 3PQDA 1XA0A 3WWZA 2BI8A 1OOEA 4J43A 3VH2A 4CR6A 1UR5A 1EFLA 1HYGA 3G1TA 3GRKA 5JPIA 3VPGA 2B69A 2QQ5A 1H9BA 1DJNA 4JGBA 4AL4A 2HRBA 2R00C 2VNSA 4BNZA 4UREA 2NTNA 2IZZA 2VYNA 1PS8A 3DOOA 3LT4A 3PFFA 4IIVA 3ZU2A 3WJ7A 2UUPA 2FRDA 3WGTA 1UUFA 3Q3CA 1MG0A 4M87A 3RUCA 3LZ6A 1A71A 3BMNB 5JMWA 4GSLA 5JAZA 1A7AA 3WLEA 1EE2A 4DLBA 4R9RA 4LISA 3OJLA 1MG5A 4XWYA 2WTBA 3CINA 3ZN2A 3FNGA 4NG5A 4Y6PA 3WG9A 4CLOA 5K0ZA 1SOVA 2B4TO 4KMSA 4Z6KA 1JDJA 1CWUA 3D4PA 4PLPA 4NBUA 1LXCA 4BKOA 4ALMA 4L8VA 3K8ZA 4H3VA 1E1MA 4IDFA 1GCUA 1N7GA 3K5PA 2WD7A 1LX6A 4AJ1A 4FSHA 5BQFA 1GYPA 1U1IA 2DPHA 4RLHA 1TI7A 1D3AA 3GLQA 4DIFA 4RL6A 3TOXA 3WBFA 4MVJA 4MVJP 3ENNA 4DQVA 1C14A 2X6TA 2IE0A 3NJ8A 4PVDA 3GNSA 5HBRA 2Y1CA 4B3HA 2E82A 2JD1A 4WASA 4CLOB 5COBA 2Y1DA 1GEEA 4MPDA 3I9MA 1F14A 4B4VA 3M2TA 2NU8A 1KIFA 4CV0A 5JCXA 4OH1A 1KEVA 3KEQA 1T2CA 3VH3A 4EGFA 1DHTA 1P1JA 1I0ZA 3JQ9A 3ZV6A 4WLUA 4WLVA 2YQ5A 3HZZA 4DXHA 5TT0A 4RVGA 1ZBQA 3AFMA 2NQ8A 4GL4A 1ISFA 1I3MA 2WD7B 3U49A 4D44A 2ZJ1A 4D45A 5C7LO 1IUKA 1ISIA 2BF7A 2O50A 2GUGA 4CQLA 2UV8A 5TNXA 4WE3A 3A4VA 4TROA 5H81A 5TS3A 4XGKA 2DBVO 3OQ6A 3RI3A 5BR7A 1LRJA 2GF2A 1I2ZA 4BNTA 4MINA 5DBIA 2CDCA 2DVMA 4WPGA 2O4CA 3LF2A 4R1TA 5IJZA 1NR1A 2OP0A 4WCDA 3VZRA 4BKRA 4BMSA 5EMHA 5TGDA 3JD1A 1Q7BA 2RHCA 2JD0A 4J0FA 4JIGA 5CHEA 2PKQO 4E13A 1SO8A 3PI7A 1K89A 4N18A 3E03A 4PG5A 2FPPA 1A7KA 2XF8A 3WGGA 3PHLA 4E3ZA 1T1RA 3NGXA 3EHEA 3HHPA 5IFLA 1VKOA 1T24A 1WXDA 3DHNA 3PYXA 5EQDA 3KV3O 2FP4A 4F3YA 3S8MA 1VJTA 4OOEA 3C1OA 1PL7A 3VAZA 3E9NA 1K0UA 3TWOA 1YOVA 3D5QA 4HADA 1PJ4A 4E5PA 3W6UA 4HUJA 4J9UE 1Y9AA 4DPKA 2PR2A 1LI4A 4XB2A 4ND5A 4PLFA 4BNWA 2WWRA 1A72A 4H7PA 5G0UA 2CUKA 2B0JA 1R15A 1XR3A 4NK4A 5EERA 1M67A 1QLHA 4DUPA 3FBGA 4RZIA 1CERA 3H5AA 5L40A 3NYWA 2QX7A 3S2IA 2PFGA 2QYTA 1DOHA 2BMAA 4XYLA 1FDVA 1LRLA 5B37A 3WQQA 5DP2A 3JQDA 2FPGA 2G17A 1LBEA 5L7YA 5CDGA 4AICA 2C0CA 3HN7A 4WK6A 5KKCA 1MLDA 2NVUB 1YOVB 4ZHSA 1R6DA 4NPCA 3BIOA 4DA9A 2EJVA 4OIMA 1R4MA 4AJEA 4DL9A 2WYWA 1XU7A 4IY1A 1W0CA 3ASVA 2VYVA 4EITA 2GERA 3UUWA 4P38A 3L4BC 4NQZA 2VOEA 4EJ6A 1P0FA 1T26A 3TQHA 4RF3A 5TLSA 1A4IA 1ADGA 1M2WA 2NTJA 3ZV4A 3INGA 3GG9A 3ITKA 4JROA 3WFJA 3I9OA 3RBVA 5F21A 4MIOA 2GZ3A 1HYHA 3KYCB 4R1UA 2QZZA 1BW9A 4MVJF 1BXGA 1J5PA 2JFHA 3GH3A 4W4TA 3JSAA 1KS9A 1K6XA 1DSSG 3DEYX 3ABIA 3NX4A 4K9DA 3U4CA 4DGSA 3ONEA 1R4MB 1H6BA 2HJSA 2C54A 5EESA 4JBIA 1I33A 2YFHA 1XU9A 3E5RA 3ZU4A 1X15A 4DVJA 4NNJA 5FYDA 3GR6A 1HE4A 4RVSA 5KVCA 3WR5A 1VLLA 1DFGA 2O2YA 1ORRA 1UZMA 4NHEA 1J49A 1BW9B 1NVTA 4KWHA 2OHXA 4Z9YA 4TKLA 4AJJA 5TSDA 3DOJA 4XZ3A 1BXGB 2GZ1A 2PGLA 1PL6A 2V6GA 3PQEA 1F8GA 2FN7A 3W8EA 1D4FA 3D4NA 1NWHA 4Q3DA 4RPKA 5EL0A 1XDWA 4KP7A 5TX7A 4BB5A 1YL7A 1NWCA 3OJOA 4U8GA 5F3RA 1ZXBA 2G82A 4NJOA 3ZDFA 1ID1A 3NT4A 3KXDA 3ZU5A 3EYWA 1M6HA 3DQPA 2ILTA 3IS3A 4NFYA 1QKIA 1P3DA 1EQ2A 4NBTA 3AUSA 1Z75A 2EP7A 2WE8A 2ZB8A 4OSOA 3DMTA 2CSUA 4ROSA 4BGUA 2EKLA 2C5EA 3LQFA 3Q9NA 1LLCA 1Z74A 2DUUA 4WGGA 4Q3AA 3SJUA 3ZWWA 3KTDA 4DC0A 2UVDA 3GFBA 3ZGYA 1LA2A 3A1NA 1QYWA 3PJDA 4ID9A 1SMKA 3GPDG 4LSMA 5B4TA 1ADFA 1I30A 4Z0TA 4IXWA 1HE5A 3UGKA 3SJ7A 4BO7A 4Z3KA 4FD3A 4O59O 4PLHA 4YACA 2DBRA 3FTNA 4CL8A 4FOSA 5FFFA 2X22A 1BWSA 1GQYA 5DOVA 1JA9A 3P5SA 4FGWA 1GR0A 3BAZA 4HFNA 4YT8A 4CM6A 4CJXA 5KOIA 2DC1A 3V2HA 2EP5A 1KVTA 3AI2A 1YXMA 2W2LD 1R12A 1R0KA 3RFVA 3DBHA 3DZIA 2WJPA 1YBAA 4XJSA 4A26A 2NVBA 2TMDA 2FWMX 1MXHA 3RJ9A 3ZZNA 3GFGA 3OJEA 2BHLA 1DAOA 2OOSA 3JQ8A 1PJ2A 3JQFA 4B79A 2BKAA 3IL2A 3DAPA 4O63O 1HT0A 3DB2A 1NPYA 1E6UA 2CVOA 3ONDA 1EUZA 1NTOA 4TMFA 4YAGA 4WECA 3A06A 2D5CA 2E49A 2I3AA 4ALJA 4E12A 1PJBA 4YWJA 1T2AA 4K6FA 4JJGA 3AM5A 4J6FA 4YJDA 1Y9EA 1XGKA 2Y05A 5DT9A 1DJQA 3WIEA 4WCFC 3DO5A 2J3HA 3R1IA 3DBHB 4E31A 2ZK7A 2BGLA 4PRKA 3TZCA 1AE1A 1I32A 1PJTA 4FFRA 3P2YA 5A9TA 4CMGA 3S55A 5IZCA 4D7AA 1RKXA 4GX2A 3JQ8B 2P2SA 2D59A 1P0CA 4E4YA 4CM9A 1DIBA 2VOJA 1BHSA 5A5FA 3QP9A 1W6UA 1Q7GA 3KSDO 1B3BA 2VUUA 1HDGO 1MFPA 4YCAA 3DFZA 4M54A 4GKVA 2VHVA 4RF5A 5EINA 2W98A 2PWZA 3OIDA 3JQGA 4RF2A 1H0KA 2ZJ0A 2C5AA 4RGBA 3RIHA 4Q3NA 3PRJA 5L3ZA 4DLAA 2AMFA 2F00A 4WCFB 2VUSA 2NVWA 4QFDA 4MP6A 1BVUA 2GLXA 2P5UA 3KO8A 4TSKA 1NPTO 3HN2A 2HMVA 3FI9A 5L51A 5HRUA 4BNLA 4FR5A 3GDGA 1B8UA 2VHXA 4GBJA 1Z6ZA 4H15A 3RFTA 3IJRA 4GGPA 4HFJA 5JDIA 1FDTA 2H6EA 5COAA 1NQAO 4URFA 2BGKA 1XIVA 3OM9A 2Y1FA 3EZYA 1MA0A 1SB8A 3ZWOA 1NM5A 1P45A 3AM4A 3VZSA 3WBBA 4L75A 1WP4A 1YDEA 4YBZA 4LRTB 1K2WA 2P68A 3SLKA 2A92A 1ADBA 4BIIA 4M49A 1C1XA 3JQGB 1N1GA 2CMDA 3WMWA 4GLLA 4H16A 1CYDA 2AQKA 4GQAA 4GVXA 2NLOA 1F12A 1WWKA 3LSYA 4EJ0A 4F6CA 5IF3A 3ST7A 2PA3A 3M1LA 4J49A 4PN3A 4D3DA 1B14A 1KETA 4JCOA 1ZK2A 2TMGA 2VWHA 4RPHA 1PL8A 1UJMA 3V1YA 3TFOA 1YVEI 3ON5A 1E7MA 2Q1UA 1ZK1A 1PX0A 3GHYA 4S1VA 4BNMA 4CM4B 4UEOA 5COQA 2C20A 1D8AA 1TA4A 4XQ9A 5HTOA 1R66A 4IDDA 4HFRA 3GY0A 1YQGA 3PWZA 3T4XA 8LDHA 3FNHA 4DRYA 1JKJA 3K31A 3DBRA 1C1XB 3JQAD 2E48A 3B1FA 3AOGA 3S2FA 3C3XA 3JCZA 1JWBB 1DC5A 2O3SA 3AOEC 4ZVVA 5BSEA 4KWIA 2PH3A 1P31A 3ETGA 1W8DA 1BMDA 4EEXA 3HDHA 3ASUA 1NAHA 4J1TA 1O94A 1EMDA 1UAYA 1TT5A 3EVNA 3INTA 5JDCA 4JLWA 4ZRNA 3QWBA 4FC6A 2H5LA 3TZQA 1YBVA 2C82A 1LJ8A 5BT9A 5I8WA 1TVEA 5C7OO 2VWGA 3OBBA 2ZTVA 4GWGA 1E77A 5AXBA 2X58A 3BYZA 2I66A 3DBRB 3FWZA 3AY7A 1Y1PA 4KDFA 4G65A 4R1SA 2YZ7A 4ESOA 2YDYA 2ZATA 3ZWVA 4J91A 1E1NA 1Y7TA 1YH3A 3EAGA 1U3UA 1XELA 2JCVA 3A14A 3K30A 1KVSA 4FJ0A 4A03A 2RH4A 2P9EA 5LDGA 1W4ZA 2FSSA 3EZLA 4J4HA 4RPLA 4J16A 1YJQA 3H9JA 4L9RA 4YT4A 2NQTA 3FN4A 5HS6A 3OEYA 4JNKA 1AN9A 1HSOA 1CETA 4JQCA 3EDMA 5T8KA 5ADHA 2H63A 1NNUA 2VQ3A 4DYDA 5U4QA 3L77A 4NDNE 1E3SA 2C7VA 3PHGA 2O3RA 4FB5A 1M6WA 2PZLA 1HDZA 3AM3A 3LC2O 1O0SA 2JCXA 2GO1A 4ZGWA 4YR9A 3TL3A 4BQRA 1HYEA 2HCTA 3SBOA 1C1DA 3VKUA 4MKXA 3WMXA 2CY0A 1C0LA 2PTGA 3E1KA 4I8XA 4PZDA 2HJRA 3DBLA 3M2PA 4OQZA 1YB5A 2Q1SA 4AJLA 2JD2A 3FD8A 3DAGA 4FFOA 2Q45A 1DDOA 4CM1A 2ZCUA 4J3FA 3I83A 3LVFO 1N8KA 3RUAA 4AJPA 2GN6A 2FR8A 3QY9A 4BVAA 3U0BA 1IOLA 1HE2A 5IG2A 1I24A 3JTMA 1PZHA 1V0JA 1PR9A 4N5LA 1A5ZA 4RQUA 3H3FA 1ZJYA 2EG9A 1QYVA 4FOOA 1FJHA 3KBOA 4YQZA 1UP6A 3NTQA 3EGOA 1XQ1A 4CL3A 1O6ZA 2PH5A 4U7WA 3RVDA 4BO0A 5JE8A 3QVXA 1DRWA 2DQ4A 1DLJA 4E6PA 1C1DB 1NQ5A 4W99A 3NDIA 4UUNA 4B8ZA 3OH8A 2QZ9A 2O7QA 3E6AA 3QIVA 4CMEC 4Q3BA 4C4OA 2B4RO 4MO2A 4BKQA 4IJVA 2JCYA 3PWSA 1GYQA 2YV2A 4L76A 3G49A 2UAGA 3P2OA 3GHHA 2J5RA 2EWMA 3NTRA 2Z5LA 5BSFA 5J23A 5I8ZA 3IUSA 3ANLA 4Y67A 4TWRA 2VUTA 4RPGA 2X1HA 1E92A 3L4SO 3HE3A 1GFSA 1NYTA 3QA9A 3V2GA 3C1AA 1KC1A 4J4BA 3C85A 3I5MA 4E2ZA 1MC5A 1H6CA 1J4AA 3V1UA 5DBFA 2O2SA 4I5DA 3ZWBA 5MGBA 1C0KA 5A3JA 4FW8A 4LK3A 3OP4A 3KM0A 4FDAA 1CJCA 3LC7O 1EQUA 4ALNA 3ETDA 1PGNA 4QT0A 5DBGA 4CQMD 1VJ0A 4XRRA 1DPGA 4Q3CA 3RC7A 1V9LA 2GSDA 3B70A 3PZRA 4U0JA 4XDZA 1R0SA 4AJKA 1JKFA 5L53A 2I65A 5CG1A 3DHEA 5JSFA 5L4NA 4PG6A 2I67A 1KEPA 1LDMA 4PLTA 5DULA 3W4KA 3AUTA 4C7KA 2QYSA 3LK7A 4RPJA 1NX6A 2X0JA 4NU6A 3K92A 1YE3A 1NBOA 1Y5MA 4QXMA 2GCGA 1PZEA 1PIWA 2X23A 2C29D 3QWIA 4E2XA 2CF5A 4D0SA 2A4KA 2DBZA 4XCVA 2YW9A 5KVQA 1GYRA 2V6FA 3FNFA 3I3OA 1CIVA 4PLYA 4GMFA 2IDZA 2R00A 1UXKA 3AK4A 5JW6A 3ROQA 1B26A 5G0TA 1YL5A 4BQPA 1Z45A 5KKAA 2DFDA 3S2GA 1T4BA 3I9KA 2JHFA 5JC8A 3MJCA 3H8VA 5KJFA 1KEUA 4NIMA 3JD0A 1Q7CA 3E9QA 1NFFA 1N7HA 4B3IA 4M55A 3G17A 1FXSA 4NK5A 1V3TA 2NV6A 3Q6IA 5FWNA 1YJ8A 2I76A 3PGXA 4CV1A 3MEQA 2ZYAA 4P22A 3N7UA 4IQ8A 2VT2A 3VOSA 1OAAA 2GZ2A 3GAZA 1GPJA 1CEQA 3PJGA 4HBGA 2Z1NA 5IDYA 4XGNA 3BTSA 1HDRA 2ZQZA 4PLVA 3QSGA 4QEDA 3UHAA 3W8DA 4W9NC 1BTOA 1PU2A 4R54A 3FSRA 1ENZA 2QRJA 1KERA 3ZNPA 1QXSA 3P19A 2H1SA 3HDJA 1N2SA 3MTGA 1ENOA 2Q2QA 4E30A 4IMPA 5JCJA 4I5FA 1WZIA 2PZJA 3UCFA 2R2GA 1XEAA 1DRVA 2J3JA 3GGOA 1EBFA 3RD5A 3BMCB 4BL5A 1PZGA 3MJEA 3O38A 2GDZA 1E3EA 1EFKA 1GZ4A 3U4DA 1PWXA 4A0SA 4CM7A 1V35A 2ZIZA 4Z9FA 2FZEA 5BNTA 1HZZA 3HADA 4Y98A 4YJFA 2UUOA 4WEOA 4CMJA 1OBFO 3B1KA 1N92A 3K2EA 1GDHA 3W4JA 3KYDA 8ADHA 1YBMA 3JQ9C 5TJHA 3RBZA 2FPIA 4WUVA 2Q1TA 1GUYA 1BDMA 1DIAA 1ZJZA 4LW8A 1P33A 3AU9A 4UEJA 1TB4A 5JS6A 4M89A 4R3NA 4PVCA 4IGEA 2GN8A 2P4HX 2VTDA 2JFGA 2VT3A 1LDYA 1PJLA 1DC3A 3ZWMA 4GH5A 1BG6A 2X0IA 2NTVA 3TPCA 1X1TA 3DZKA 4FFLA 4G81A 4L0QA 5U9CA 3JD2A 1JLLA 4PIVA 5CPBA 3VZPA 5F5LA 4AG3A 1WAMA 2X5KO 4IIUA 4IDCA 1DIRA 4PLGA 3JD4A 4YJFB 4ZQEA 5JLAA 5JFOA 2I5PO 3AFNA 2W2KA 3KYDB 2HRZA 1DAPA 1ZSYA 2NSDA 1P74A 4HKTA 2VWPA 2DLDA 5G0VA 1BRMA 1GU7A 2NVUA 4GAEA 3M1AA 1TT7A 3I9LA 1HDOA 4N54A 4J9VA 2P91A 1KY5A 1ZEJA 1I10A 2YQ4A 3KSZO 2B83A 3INRA 1WW8A 1SAYA 4FC7A 1MFZA 4OQYA 4IDEA 3PPIA 1X0XA 4BNYA 2BFAA 5C3MA 1LDNA 2B5WA 3GUCA 4UUOA 4R5HA 3JYNA 3PHHA 4TRJA 4PFJA 3EW7A 3ADOA 3BMOA 1U8XX 1IPFA 3GVIA 3L9WA 4J1QA 3KYCA 1ZIDA 4U6QA 3HFSA 4F45A 4J7XA 2VRBA 5JYDA 2W2KB 3JQCA 4INAA 1GZ6A 4LMPA 4BS9A 1X1EA 3NDJA 3IDSA 1K3TA 5L4SA 4OXYA 4QSMA 4GX0A 4YA6A 2CVZA 5BSHA 4AJ4A 2PY6A 3I9NA 2OFPA 2X86A 2YHUA 1A4UA 4YXFA 2DUWA 2XPCA 4DPMA 1UDCA 2EKPA 3OJFA 2C2XA 2V7PA 3V5NA 1D7OA 1GL3A 3KHUA 3TL2A 3M6IA 4UAGA 4KOAA 2JFFA 4BNJA 3BMOB 3JYQA 2X5OA 3L4BA 3UAGA 4OHUA 4FFNA 1E3JA 2QW8A 4NJMB 5G4KB 2X0NA 1NP3A 4UVIA 4WOJA 3LLSA 5DCWA 2CD9A 1M76A 2GN9A 3MJVA 2Q49A 2HMWA 1H6DA 2EXXA 2IYOA 3GN2A 4QUKA 4BNXA 4BMVA 4J0EA 1T25A 2ZTUA 4HP8A 2AE2A 4FFPA 1UZLA 4IJWA 4AJNA 1SCUA 1PQPA 3MTJA 5TQVA 3ZHZA 4OJNA 1U4OA 1IL0A 1UDBA 3DFUA 4ZU3A 3TJRA 4NR0A 1ZUD1 3E8XA 2WD8A 1K6IA 3QJ5A 4BNIA 1YDWA 2PV7A 3GGPA 3RU7A 3QQPA 2ZYGA 3STHA 3DMYA 4ZD6A 1L7DA 2AE1A 3COSA 4NI5A 1Q1NA 3IQDB 5A4DA 1LUAA 4XYGA 3AU8A 3L0DA 1Y6JA 5HS4A 3WWYA 1IB6A 4XD2A 1H2HA 5C37A 2EHDA 4A5OA 4ZQBA 4U0KA 2VYND 4I5GA 4QTZA 3P7MA 4DIOA 1KC3A 4DREA 3FPCA 1PJQA 3AY3A 1I01A 3G3EA 3JQAA 1DO8A 2D1YA 3OQBA 4R4JA 4K26A 1DIGA 3DHYA 1WMAA 5AXDA 2DU8A 2J5QA 5IDXA 4MDHA 2X9VA 1U5CA 3H3JA 3LYLA 1N1EA 4KTVE 5T6BA 4JBGA 4MP3A 4PRLA 2J8ZA 4EJMA 1QLJA 2X4GA 1GADO 5DNAA 2OXIA 2C7GA 3U62A 2CDAA 3OHSX 3GVPA 1B15A 4TQGA 1F17A 1DB3A 3NT2A 4C7JA 2EIHA 2ZB4A 3RUFA 5L45A 1D1SA 3LLVA 3JQAB 3ZNQA 3WGHA 3WGYA 2VWQA 4DMMA 4BNUA 4WJZA 2PGDA 1ZO8A 4YJGA 4OGWA 4HWKA 4L4SA 3WSVA 4FN4A 5FI5A 2B4QA 1ISJA 1JTVA 2Z1MA 2IZ1A 4BNGA 1IE3A 1YKFA 4CLHA 2ZB7A 1DFIA 4J2HA 1SB9A 4ONEA 1B3RA 4LVUA 4OXNA 1LTHR 1NVGA 3BTUA 3DZHA 3CMCO 1JWAB 1EVYA 1U9JA 2HQ1A 5DOZA 5TT1A 4CLDA 2SCUA 1WLYA 3GEGA 3G0OA 3GGGA 1UZNA 3JYLA 3UFXA 2ZCVA 4TRNA 1BDBA 1UP7A 1KYQA 1P1KA 4XQGA 4OSPA 3WNQA 3GMSA 4D0RA 3TOZA 4ILKA 4ALKA 3WYCA 3ZNNA 2BD0A 1PQWA 3NJ4A 3RSHA 3ZWPA 4RZHA 4YJGB 5A05A 4XA8A 3LU1A 1ENYA 1PGJA 1U4SA 5DCUA 2BH9A 2GASA 4LGVA 1BVRA 4E5MA 3G1UA 4AJIA 1IZ0A 2AG5A 1ZNQO 4CMHA 4Q9NA 1ONOA 3JQBA 4A27A 1Z73A 3CUKA 3C8MA 3RBXA 5L7WA 4LVCA 3LT0A 4D79A 3GF4A 4B3JA 2WYUA 4WCFA 1H93A 3GG2A 3PK0A 3KLPX 3JQ6A 1ZK0A 4M86A 3ZWYA 4RVDA 1QG6A 1O8CA 1NAIA 4DYVA 4EBFA 3ITDA 1G6KA 1ONNA 4KUHA 1JVBA 4YRDA 1KVRA 3FNEA 1R4NB 3GT0A 5JYEA 4RJTA 4IM7A 4MVJM 4NU5A 1ISGA 3KEOA 3DDNA 3OETA 1LRKA 4FCCA 2BFOA 4MIEA 4JN6B 1M75A 3LT1A 1O89A 4P4LA 4RQTA 1VSVA 1QP8A 4CR7A 1MB4A 4B7CA 2Q50A 4JJIA 3RUIA 1XYGA 3NGLA 3BXXA 1VJ1A 1E6WA 3GC6A 4RV9A 3UKOA 3ENKA 4RVUA 3QW2A 2BFPA 5F1KA 3HNPA 1PGQA 3QWFA 1ISMA 1PZFA 1PSDA 1DEHA 1GUZA 3FCOA 3PIDA 4MKZA 1AXGA 3O03A 4GKBA 4NBVA 5BNIA 3GAFA 4BO8A 3FPLA 4IDBA 2VRCD 4E5KA 3CSDA 3SEFA 4PG4A 3UN1A 2B36A 4M8SA 3EMKA 2OGUA 1PGPA 5JO0A 1LSJA 2EGHA 3TFQA 1U3TA 4CM4A 3V8BA 4F6LA 3CZMA 1ZMTA 1T2FA 3ZHXA 4EUEA 1CQJA 3GK3A 4PZEA 1NPDA 1PJCA 2B37A 5DZSA 3DTTA 1X0VA 4IQ0A 4A73A 4TVBA 3AI1A 3D3EA 4ALLA 1X7GA 4CQMA 4EI2A 2DFVA 3D0OA 4GMGA 2NNLD 2VZ0A 3OA0A 1S6YA 3MWDB 4W82A 3O9ZA 4R41A 5JAQA 3K2BA 3NDRA 5EPOA 4D42A 1DLIA 5CG2A 3O26A 3Q0EA 4XJTA 1GUFA 4HXYA 5JNLA 2Y0EA 4W6ZA 5F1OA 4TRMA 5AXCA 1PWZA 3PZBA 3D7LA 4YPOA 2HU2A 4DBVO 3S1LA 4ZQGA 1H9AA 3QWHA 4Y8VA 5K6AC 2YV3A 3HFGA 4KZPA 4Z0HO 1T4DA 1G1AA 4B7UA 3DTYA 3H2ZA 3ROMA 4CQMB 4O1MA 2YHIB 3ZCXA 5KCZA 3WGZA 3ADPA 4R69A 5CEFA 3VDRA 1HSZA 2JAHA 5IAAA 2Y67A 1Q2XA 3SC6A 1KVQA 4BNVA 5L7TA 3AOEA 4PGFA 3IKTA 1O5IA 1P1HA 2O48X 2UDPA 3GOHA 3CIFA 3QVTA 1E1LA 1N5DA 3ONFA 1WDKA 4GLOA 1U8FO 3SLGA 1L1FA 1LSUA 4DIBA 3C7DB 1XQ6A 1HL3A 2NU7A 4NBWA 1S7CA 2ZYDA 2RH8A 4CLXA 5C7IO 1WMBA 5ENVA 1Y81A 4LMRA 1PJSA 1MV8A 1XCBA 2GN4A 4XRGA 3BTOA 2YFQA 3TN7A 4ZN6A 3F5SA 4RF4A 2JHGA 1DIHA 3ANNA 3DC2A 4ND1A 3L6EA 3PHIA 2E4AA 3KZVA 4A2CA 4XR4A 2O3QA 2Q4EA 3OMLA 1QMGA 3KVOA 1PS9A 3SXPA 3ZHYA 2BI7A 2VN8A 3DBVO 4J7CA 5A1TA 5CAEA 1JAXA 2OMEA 3DZFA 4P4NA 5A9RA 3S2EA 1UXHA 5EJ2A 3EK2A 1I3KA 5ILGA 5A9SB 3WYEA 5LDHA 1XWFA 1K5HA 1HLPA 3ZH2A 5FI3A 3PGJA 3PLRA 3K96A 1AHHA 3VPHA 4XEHA 1ZCJA 3WB9A 1IHXA 1BGVA 1G0OA 1U5AA 5AXAA 1B0AA 3RCBA 2G0TA 2W4QA 5THQA 4BB6A 3GRPA 3UICA 4CLEA 4O6VA 1HWYA 2FY8A 3HWRA 1GAEO 4GPD1 4X54A 3E48A 3D5TA 1PQUA 5KIAA 3NTOA 3CMMA 1G0NA 4HNGA 4Y9DA 1I36A 4P8RA 1QORA 3CKYA 2H9IA 1X7DA 1LDEA 4MVJH 5ENDA 4PLCA 3RASA 3K6JA 3PJEA 4U6SA 1JAYA 2DTDA 3ANMA 3NUGA 1AGNA 2OO5A 3I52A 1IHYA 3E5MA 4QFCA 3DWFA 1NFQA 1XKQA 1YO6A 3L07A 4UVEA 1TXGA 4B4UA 2OBNA 3VHRA 2BRUA 2NM0A 3C1TA 5U1PA 5KWEA 3N74A 4OM8A 1FDSA 1SC6A 1SEVA 1YL6A 2JJYA 4IPTA 5H83A 3H65A 4IMRA 3WXBA 4CV2A 4XYMA 5B4UA 3PP8A 4OO3A 4YAJA 4E32A 2BFMA 4M1QA 3O8QA 1SEPA 4I9HA 4BGIA 4JK3A 3BA1A 1JKIA 1SZJG 1SOWA 3LF1A 4FPXA 5I9NA 1RM3A 2QHXA 3ZW8A 4MP8A 2X9GA 2PD6A 5IDQA 1JQBA 4N7RA 3W4IA 4CMEA 4QO8A 2P5YA 1GV0A 2FR0A 3CEAA 3WNVA 3RC1A 4DC1A 2D3TA 2FOIA 4EUFA 2DBQA 5JY6A 4YB8A 1E3IA 1WNTA 3WSWA 3H9QA 1Y8QB 2YYYA 3B6ZA 1HE3A 1GV1A 1B8VA 2YJZA 2W8ZA 1OI7A 3V1TC 3JYOA 4J4TA 1ISHA 3JQEA 3TZHA 3H5NA 4CR8A 4XKJA 2CFCA 1NQTA 3O8QB 3K73O 4KDEA 5TF4A 3RQSA 3RUEA 1YB4A 4TZKA 3IIEA 4IINA 5KVSA 2NUAA 2HMSA 1LNQA 2HSDA 3C7AA 4D43A 1GEGA 3DZGA 1GD1O 5CEJA 2ZTLA 2FMUA 1P44A 4XYEA 3BMQA 4YAIA 5GZ3A 2FHSA 4IZHA 4J7UA 1LLQA 2PKRA 1MGOA 4NFSA 2VZ8A 4ZQFA 3UXYA 4CMKA 2ZKLA 1WZEA 3G79A 3VH4A 1BXZA 2I99A 2BELA 2GR9A 5JO9A 3ICPA 1SNYA 3HDYA 2Q2WA 9LDBA 5JBIA 2J5KA 5JAIA 4RLSA 4BNHA 2AEFA 2WEKA 2Y66A 3H7AA 3PLNA 5I7FA 4O5OA 3F4BA 3HDQA 4S3MA 3R3SA 1HTBA 3FWNA 2Q2VA 5HWSA 4CM5A 1VKNA 5H82A 1E6EA 4W7IA 4AVYA 4YTEA 1MUUA 4WLNA 2YUTA 3SC4A 1FMCA 3BMQB 3PQFA 4IS3A 5CPFA 4AJ2A 1F06A 3HG7A 1OMOA 5GZ6A 4LCEA 1GTMA 1ML3A 1IY8A 5HM8A 2NU9A 3SVTA 3BMCA 3F9IA 1YQXA 1RM0A 3LT2A 4Z9XA 3WYBA 4P4GA 3QVOA 3PDUA 3ORFA 1U2DA 3DL2A 2YV1A 2V6BA 3T4EA 3TNLA 1ZH8A 1WPQA 4F46A 1EDOA 1E3WB 3PTZA 4XQEA 5DP1A 3VTFA 1E7RA 4ITUA 2AHRA 5KJCA 3RU9A 2JL1A 4FFMA 2NWQA 1UP4A 3MWEB 3NV9A 5ER6A 2DT5A 4KQWA 2E6UX 1Q0HA 3WQRA 5GMOA 3AI3A 4YT5A 2UYYA 1VL6A 4W9NA 2EEZA 2WM3A 1SPXA 3AJRA 5L95A 2EKQA 2RIRA 2R6JA 3TZKA 1YGYA 1M66A 4U5QA 1Y5RA 3BTVA 1FDUA 1E3LA 3WX0A 1U7TA 4Z0PA 3VPXA 3PJFA 1C0PA 5T57A 5T5QA 2DM6A 5MDHA 4CMBA 4E2YA 5ICSA 3L9XA 4DQUA 5GZ1A 3ZWXA 1EK5A 4JP2A 3PDJA 4RCVA 3DONA 3GUYA 1U3WA 3JV7A 2EJWA 3HQ4O 3I4FA 1NFRA 1X7HA 1YRLA 1V6AA 2LDXA 2X0RA 1ZW1A 3U3XA 2E37A 1ZZEA 3CZRA 3PFWO 4DQXA 3QRWA 2W2LA 4YYZA 3R6DA 4BO3A 2Y1GA 4JBHA 3A28A 2VTEA 2ET6A 4OKIA 2OZPA 5ER9A 2YY7A 2Q4BA 4OOFA 2GRAA 4HFMA 4FGSA 1J6UA 2Q3EA 2O3TA 3GA0A 1Q0QA 1LEHA 1A27A 1H5QA 3R3JA 1N9GA 5ITWA 2VZ9A 2GD1O 3RROA 1VC2A 2IXBA 3VVBA 2IXAA 3L6DA 3JYPA 3TDKA 2W90A 4J1SA 1V8BA 1X14A 2Y1OA 4YDRA 4W7HA 5DF1A 3Q2KA 3E82A 3IJPA 4CUJA 2IODA 1R0LA 2IYPA 3GNQA 2YDXA 3ULKA 4PLWA 3ZU3A 1IPEA 1BXKA 1HETA 3OFSA 1H94A 1ZSVA 3I6IA 2Y99A 4QQRA 4XIYA 4A10A 3JQ7A 4K28A 4EEZA 1QV7A 1QYXA 1ZSNA 3KLMX 3L6OO 4CLRA 1I5RA 5G2OA 2BGMA 2VHWA 4WEQA
chains in the Genus database with same CATH superfamily
2C5FA 3D6FA 5JSHA 2XUIA 1SXGA 4LJ4A 1QS0B 3ESCA 4YJHA 3R75A 3RS4A 4DPLA 1T9ZA 3IAHA 1PCXA 4AZWA 1U0OC 4Y7CA 3U4HA 3ZXXA 4X8OA 4TS4A 4R51A 3ISJA 4RL4A 2LVBA 5CFLA 1BE0A 1YE8A 3VU9A 2PJRA 5AJVB 1TO1E 2IU4A 3T5AA 2IY8A 3SJAA 4E5NA 3H2SA 4QOSA 2HYDA 4Q15A 3RSZA 3CUWA 3VOAA 6ADHA 3G7NA 4CPDA 2IOQA 3CUYA 1X3LA 3R0VA 1QE5A 1SA0A 4QSHA 2J1LA 3A4LA 3QU9A 1VJDA 3FSEA 2C07A 3T3EA 5KPJA 1ZR4A 1EVLA 1FRVA 4ARVA 4MQUA 2W6IA 2XNHA 2MSDB 2GEVA 2Q9BA 5L3VA 3H4VA 1W36C 1P9LA 3LAWA 4N5IX 3T15A 2V4UA 3MCUA 3JQ7B 1WMFA 3IP9A 3MOGA 4QUDA 3DR3A 1E5QA 1NRWA 4XIFA 5D86A 4BV9A 5L4LA 2CWWA 2P41A 1K4MA 1NHWA 1UC8A 2JGMA 1AGRA 1AKMA 3WHPA 1T3GA 5T41A 2QX4A 2P9CA 4H4EA 3DT9A 4II3A 1RFLA 2WU1A 4MUAA 3RAFC 2IOFK 2ZBPA 2VNAA 3MBOA 3TSCA 3EEYA 5AK0A 3VKFA 3P0EA 1X80B 1J39A 3HP1A 4HQ6A 4NCKA 5DIFA 5D3MA 3TF5A 2GLUA 1N6IA 3F5QA 4GRDA 3W7BA 3EC7A 1V2GA 4CCAA 3IAS1 4HMQA 2EW8A 4UMFA 3UQYS 5CH8A 4JHXA 6YASA 3WJAA 4FE4A 3L1JA 3RT7A 1DCFA 1T2EA 2Q6IA 2VKTA 3HI6A 5EXPA 1NBIA 2V65A 4G4GA 2FE1A 4Q3EA 2EBWA 3NQ41 4YFYA 2XWPA 2G25A 4Q3LA 4YRFA 4MGZR 2VTBA 3RTCA 2DHDA 1MJNA 3K9GA 3O1HB 4LS3A 2WWXA 4R01A 1C7FA 1UBSB 2YN4A 2EFHB 3Q3HA 4DV4B 3G5MA 3CWZA 4AF7A 1OXVA 2W2PA 4B6QA 2JGDB 3UH1A 1RRVA 4MUMA 4DG9A 2CLEB 1XLVA 2VP0A 1OX5A 3P94A 2GAFA 2YWRA 4A82A 4N5MA 1FTGA 1U6IA 1C8BA 3D6MA 3H5VA 1GRNA 4IJKA 5LOVF 3QFTA 1K7YA 4HBZA 3HYLA 3BXGA 3LQYA 2ZW9A 3OLWA 2VSFA 4R0VA 1Z29A 2FPGB 3I42A 1J0XO 3L0SA 3DTVB 4BJ6A 3ZHVA 4HVTA 1PBNA 2APJA 4TXHA 1DRUA 2ZRKA 3IJ5A 4AKIA 1L7BA 3WLFA 1KOLA 1ZFNA 2TSYB 2AW5A 2RKWA 3CUSA 3FDIA 3U9LA 3T12A 2GAAA 2PGJA 5A0VA 3RE1A 2ZE6A 3T7AA 3O47A 2Q4OA 4V0RA 2C4NA 3T1QA 2GYVA 2QTRA 3F6YA 4Y2RA 3RUDA 3FDJA 3LH5A 3N53A 2P67A 2D4AA 4RJJA 2FN9A 4YEDA 3DOFA 1I4WA 2YINC 2CZCA 2ZBVA 3IAAA 2CV0A 2Z4SA 4BFVA 5DCYA 5JCOA 1XTIA 3C2QA 4FOTA 2DKOA 4L2IA 1X87A 2ECOA 5FRDA 2PKQP 4JBLA 2VKQA 1QV6A 1CUUA 3IDFA 3MQ2A 2VDQB 5KVVA 4MQMA 1HNWB 3A9TA 4YHHB 2F1JA 2QK4A 2O0KA 4YC7A 4D8UA 1C0IA 4BCBA 2W6CX 4M9ZA 5LCXA 3UJCA 4O4JB 1J2EA 2PSJA 1MENA 1SOAA 1XXHA 2AC2A 2W6PA 2O2GA 2P7HA 1RQLA 4I9UA 3SQNA 3AKCA 3E9MA 3UWKA 5LYYA 3THSA 3ZHRA 3ED1A 4MDFA 4YV0A 1SUCA 2FF7A 3DLHA 4N4AA 1K8QA 1ZAYA 4BGEA 1U7XA 5EG5A 4LDJA 2ZEJA 3RYIA 3T5PA 3LGAA 2ERXA 3BX1A 3C24A 4KXUA 2PWBA 4HSEA 4ZOLA 4F2HA 4QKQA 3I9JA 4F5YA 3VZQA 5CYOA 1QOZA 2OP1A 2X8AA 2XYGA 3C7CB 4KO8A 1DFHA 3H11B 2BTQA 1FEZA 1A88A 2TS1A 3JWHA 2ID8A 3RGGA 3ZJYA 4C4TA 4KG7A 4RKWA 4E1AA 4MW4A 1KRXA 1UXIA 2P75A 1CF2O 2R8PA 2J67A 1ZWLA 2ZE7A 4BO5A 2K7FA 2J7PA 1NF3A 4IQ4A 4LDAA 3SPXA 1ZMOA 2L69A 5DYTA 2XMQA 1YB2A 1O9BA 1UM9A 5L3QB 1Q5PA 1ZRHA 1WO8A 2B8TA 2RK4A 5JCJD 1MBZA 3GYBA 1U0LA 3TQIA 2VSNA 3RRJA 4B80A 4BNFA 4BUZA 5IVKA 2NP6A 1NF8A 1IZ9A 3NLLA 2WTEA 2LCQA 1RPTA 2QAGC 4YAEA 4ZTBA 1L7EA 2YOHA 3GRZA 3IR7A 2P2NA 3M9XA 3PQ3A 4GYKA 3V8NA 4QFBA 4D3ZA 1NR7A 4WVLA 4ZRMA 1GTVA 4WA8A 4R2KA 5ALHA 3RFXA 1A5BB 4A4DA 3FCXA 5CT6A 2WU8A 2XCSB 4I9NA 3QV1A 5BSTA 5K0CA 3MJRA 3GEDA 1HMYA 3B2NA 1IOVA 5BOSB 1P6UA 5FKJA 3ZV3A 2Z2XA 1N0HA 4MROA 3DXXA 5ALEA 3Q0TA 1EUDA 3MRVA 4KUGA 2IIVA 4MQEB 3HRIA 1ZJJA 1UBKS 1CE8A 1YZVA 1U7HA 2ZYVX 3FJOA 3O4HA 4LV6A 4Y2JA 1JMKC 2XTZA 3AH8A 3JQFC 3SKXA 4F71A 1U2ZA 1K9SA 4LNHA 2YJ5A 3BHIA 3RTEA 4F4DA 2L17A 4LXQA 4WAUA 2XXAA 2VYFA 1FS4A 3HVUA 1KFCB 1RM5A 2JKZA 1KMHA 1R9JA 2RBGA 4RIGA 3U5TA 3I5YA 4GOOD 1H2ZA 2XVAA 3PHJA 4JX9A 2AC7A 4OM7A 1UBRS 5CGQB 4N40A 3WQSB 1MC4A 4Q1FA 2HSWA 2ATIA 2NPIA 3PYMA 3D1LA 3LM8A 3RVNA 1ZOPA 2A9FA 3UW3A 4X66B 4DCOA 2LCIA 2R5WA 1Q12A 1S3IA 3OBIA 4ZHQA 5BNFA 4Z2AA 5JXWA 2G80A 1VL1A 5FOQA 4L4RA 3HB7A 4WLEA 3SYNA 1LI5A 4I66A 3AP3A 2BOVA 3EGWA 1A9ZA 4JA2A 3CNHA 5J4KA 1SBYA 3QVSA 3DZ8A 3OZCA 4FS3A 1OWNA 3BIFA 5KJ1A 1CPYA 5CM8B 2ALJA 4YT2A 3ANXA 4L4XA 2O4UX 1ULBA 1PJ3A 3LVQE 3QH4A 5F2OA 4BLRA 4DA7A 2PFSA 3IC5A 4MV9A 5J5VA 1GTZA 3HUTA 2BFNA 4YQEA 2JH3A 3V42A 1E9FA 3G9UA 2K4MA 3PITA 3Q2OA 4UFNA 4ZVUA 5K7SA 5K99A 1A1SA 4L3OA 1JVSA 5JOQA 1Y1TA 2E1PA 5A5GA 1I0LA 4G5RA 1K5PA 5FOUA 1T1SA 3GQBB 3T7TA 2I6FA 5BRJA 1H1LA 5IWCA 4DNXA 3FNRA 4IFIA 2ZPTX 5A06A 5C35A 4AP5A 3EX7C 1RXIA 1KY3A 5AK5A 7ADHA 1I8TA 2ECKA 3LL4A 1EE1A 4KU4A 2X4DA 2XMGA 5IXSA 2C4UA 5LN1A 3EY9A 1K97A 4CEHA 4TT8A 4HS4A 1GPBA 5A62A 3C1UA 4M22A 2CV2A 1H0RA 1LBQA 2JNWA 3ROZA 1RYDA 5K9ZA 4G9GA 4K05A 1R6BX 3GZNA 3P9NA 3UFBA 5HCIA 3FM9A 2QTVA 5HE8A 5I7WA 3U09A 1POXA 3LVBA 4PCAA 1Y3BE 4B7XA 1L4HA 4O2LA 3IT2A 2VYVD 2DT8A 1JI3A 1NLFA 4I36A 3D7NA 3K9QO 3Q9UA 5E2AA 2F3SA 1E2HA 3GVHA 4QYXA 3VDMA 3QVGB 5B1EA 4FYXA 2EATA 4OB8A 4MRMA 2C2KA 3SBXA 4A8JA 5EE1A 4ALIA 1DQSA 3HXLA 1CY2A 2JW5A 4JODA 1N5IA 5G1NA 1UEXC 3D6HA 1RABA 3FHLA 1PJRA 5E4YA 4RLQA 5ESXA 4DAOA 2O3UA 1E0DA 1VP3A 1Z0SA 2ZSFA 3EZ7A 5B4VA 4CUKA 1EEXB 1UXGA 3IP8A 3OIUA 4E4RA 3RF7A 1KS2A 1WPRA 3GI1A 3W7VA 1ZLYA 2IPNA 3U26A 1HDYA 1R0WA 2YNMD 5MFPA 2Q28A 3QNUA 5EPUA 4A0RA 4J7AA 4DWVA 3OLCX 2ZR9A 3JR7A 2ZJ5A 1DL5A 2IK8A 5CW2A 2BFBB 1YDHA 4OGKA 3NEPX 1PLLA 3C97A 4H59A 5BNWA 1PGOA 4DLXA 1KFBB 3Q7TA 3CEHA 5D3KA 1FU4A 3AHDA 2V3CC 4UTOA 2D1FA 1Y7HA 4JI5B 3RH0A 4F4HA 1BX1A 2M6RA 4Z1MA 5BV8A 5KC8A 4E4TA 2A88A 1VSTA 1GN9A 1SRRA 3A3KA 4K87A 3WIVA 4BB9A 3KJIA 1S9DA 2W4MA 4EUHA 1GKYA 2IBMA 3GJYA 5FO0A 1ZVKA 2EV9A 4NCBA 4BQEA 5KYVA 3UAOA 4F4UA 2Q9UA 3M6WA 4M99A 1MP0A 3NT5A 3ZZ0A 1XN4A 1NN1A 1UBFA 3FHOA 1XKLA 2R1TA 1A7UA 2VVTA 3FPGA 4Q02A 4RYLA 3AFIA 4QPNA 4JYBA 4RDIA 4MYUA 3DBIA 3AERA 3DFMA 3SD7A 3QXHA 1XHEA 3TGPA 3KYBA 1IY9A 3IURA 1PFUA 4TUYF 1J7KA 1GPLA 2J6IA 2PSFA 4GZ6A 4ASUA 3TZ6A 4BO2A 4UOQA 2EF0A 1O94C 4MUKA 1T43A 5AHRA 3OZSA 4I14A 2XAAA 4D81A 3JASA 1FLDA 4EY8A 3H8SA 4WADA 4DLLA 3LUKA 4JEIA 1TQ2A 4E5YA 5CITA 3HVIA 2HPAA 4HAWA 2BFDA 2XOXA 1DT3A 1WTAA 1LQUA 3FR7A 3QPUA 3GRCA 4OJKA 4RY9A 3I58A 3OKFA 3DMGA 4IEFB 1QLWA 4L74A 1IN6A 3PE4A 1RPJA 1GKIA 1DOZA 1LC0A 2KLHA 4CMIA 2OBLA 3C15C 3K9LA 3LUDA 2WUVA 3QUCA 4AM8A 5JVDF 1J70A 3W5HA 5CDSA 2AI1A 1YS7A 5CA1B 4Q18A 1XXHE 2OCIA 4IDAA 4G41A 1KDVA 4B82A 2WWYA 4N82A 2XY4A 3T7CA 5ILOA 2RG1A 1UKEA 3PT9A 4P3PA 3E81A 5JLJA 5I7AA 1KRHA 4FONA 3I62A 2HCRA 1QFXA 2PNFA 3EG9B 4UAJA 1W76A 4DV2B 1F8FA 4E2WA 2J45A 2PQ0A 5BYJA 3A3PA 4MWSA 1CDOA 4R9VA 4COKA 4V0NA 1QRUA 4J16C 1EK0A 4HWOA 4JWKA 4U2DA 1E1KA 5AW0A 3M3HA 1VCMA 3LVRE 1KWKA 1KZ4A 1IY0A 4Z99A 1KMNA 5FUBA 5T8KC 1XTPA 4L0DA 3DOCA 3ETEA 3R41A 2XZOA 2IS4A 1R8YA 4IG9A 1G21A 1QCZA 1XAHA 3CTMA 3NHJA 3NOXA 4GU5A 4NATA 3G0IA 1FS5A 4BFLA 1QYCA 1UBLS 1OZFA 5JZOA 1KTVA 3DVAB 3GPCA 2F4NA 2X7XA 1VPDA 4ZQHA 1ABBA 1JP7A 4YRAA 3UF0A 1II0A 2BFFA 1T13A 4J1NA 3L4JA 1W581 2YVUA 4FB4A 2VPZA 3P9ZA 2P9BA 2GBPA 3C5EA 1BHJA 1OX6A 4UAUA 5GIOE 4NBKA 3X1DA 1YA8A 3A1FA 1ESDA 2P35A 2A9RA 2PANA 3AL2A 3PC7A 4BLQA 3I1YA 3TMAA 1UJBA 4BMDA 2VPPA 3IP1A 5ALMA 1FK8A 2XT0A 1Y8QA 4DLTA 3FDFA 1SC4A 1OWPA 1V1MA 2FSUA 1VSQA 1QQAA 2UUBB 3TZLA 2V5AA 5AD1A 2ORED 3F47A 4RZ2A 5A0FA 4HNTA 1K3FA 3BHJA 1KP2A 4HQ0A 4QPJC 4RUKA 3GEMA 1FRNA 2PX2A 3VSEA 2JBAA 4E88A 1Z2DA 1OC4A 1WXEA 1WZNA 2Q8QA 5IRCD 2D8AA 2F3QA 3PB3A 3QE3A 2Y68A 5FADA 5K1ZA 2KHZA 4CFZA 2NX2A 4L9WA 2XZLA 2C3OA 2QEQA 1ENPA 2F8TA 3MJSA 1SQ0A 1E9EA 3S2ZA 5IVIA 2BBTA 4UQOA 1E3MA 3OOJA 1RVDA 3CUTA 3OPMA 4RHXA 3WTBA 4CM9D 2GNAA 16PKA 5CT4A 4YRIA 2QRKA 5ES3A 3MZ0A 1RHJA 3IP3A 3CVYA 1M0SA 1J23A 3TSYA 3IUYA 4UCWA 3KDSE 2QJTA 2IIBA 1I3NA 2ECQA 2XW6A 3UCXA 5IKEA 2A2ZA 3F5FA 2AMYA 3GGCA 3FKQA 5H5JA 4E7PA 5KEIA 1TCUA 1WBDA 2UUAB 2E3JA 4YHBA 1ZL2A 2A35A 1USKA 1WM1A 3DKIA 3FKSA 1X2BA 3AUUA 3PCTA 3QE0A 1G8HA 4LSWA 4UVHA 3ZE7A 2Y1WA 3K0KA 4XPIA 2E0IA 2IHBA 3UK7A 2GPTA 5AKKA 3OAAD 1MX3A 3NJRA 3D3JA 5IK2A 2O7NA 1ODLA 3NRCA 2ZIUB 3OM0A 1FFXB 3E9ZA 1QHYA 3ZXUB 3H5RA 2EIXA 1DAMA 2F2TA 3NKLA 3LNTA 4CBVA 1L8OA 4E3WA 1GU1A 2FSIA 5LP6C 2ABWA 4MEAA 4UULA 3NW9A 1PLKA 2QN9A 5D1HA 2WWVD 3ZXYA 1QIHA 5JROA 2GPSA 2HA5A 3B1WA 5T64A 2I34A 4PYKA 1KY4A 2UVPA 2WRZA 2X9NA 1M0TA 2BM1A 3M89A 1MNQA 1WV0A 2D2XA 2NQ2C 3EVAA 1EVJA 1IIRA 1NXQA 3HXTA 3OJWA 3CXRA 4BGVA 3IUBA 1NI3A 3LBNA 3LXUX 4GWLA 3SKVA 4GEKA 4E21A 2HAEA 1LSOA 3U4IA 3NHYA 2HLPA 1EK6A 4MXDA 3WIDA 1SKBA 4PCVA 4HPWA 4NEHB 3TSZA 1OCEA 1SXPA 1VYTA 1UXJA 3U13A 4AK9A 4TKVB 2KJQA 4KVZA 1ZM2A 4AJ9A 1ESEA 4IH9A 4R8SA 4D6XA 3CVUA 1O03A 1WHTA 4KQGA 1XA0A 1U8EA 3FMOB 3LUGA 2V7XA 2JJ1A 4CR6A 1Q57A 3C14C 4INZA 5JPIA 1DIOB 4FKZA 3VPGA 1Z5ZA 2QQ5A 5K3DA 4AL4A 1W1WA 1MPXA 2V9CA 3FFWA 3HA2A 2R00C 1E3QA 3LW7A 5CCEA 1QGAA 4AB1A 1YR2A 1TU0A 3HJRA 3MJDA 2GZHA 3LT4A 1JZSA 1AKNA 1SZDA 3PPWA 1L4YA 5J1TB 1TZ2A 2RG7A 4OQFA 3WJ7A 4ZMSA 2AZDA 3U80A 4NG4A 2FRDA 1JSZA 2VJCA 2ZRIA 4IO1A 1Y8AA 3V4ZA 3UGJA 3NNNA 3LZ6A 1A71A 3BMNB 1OVMA 2CW5A 2NVOA 3IIIA 4DLBA 2XQGA 1EDDA 4GI7A 1FB5A 4H08A 4JDPA 4QBHA 3HK2A 3OJLA 1W6RA 5KHLB 3SHQA 5LQJA 3D0RA 3TQSA 3ZN2A 5IANA 1GA4A 1C3OB 3FNGA 5FO1A 2DWQA 5K0ZA 1Z4LA 2ANBA 3JWEA 1VHWA 1JVNA 4KMSA 2J33A 5ALNA 2CJWA 5BN4B 4Y1GA 1JBEA 1QDUA 1Y1KE 3FPEA 1W48A 3EUAA 2VQDA 4DR2B 5DN6A 1LXCA 3O2SB 4E7OA 2PH1A 2O2HA 4L8VA 1BMQA 5LD2C 4EKNB 4N76A 3JR3A 4YUXA 2ACWA 1JHDA 4H3VA 1FDOA 1N7GA 3DEFA 3K5PA 4PWYA 5DJ5A 2XT6A 1SIUA 5BQFA 2J6BA 3RTBA 3CW2A 3TNYA 1DWOA 3CVJA 5AKEA 3LP8A 2MHCA 3GLQA 5TQ2A 3TOXA 2F4VB 4MVJA 4DQVA 3CV3A 1E9CA 3K09A 4F9FA 1GZ5A 3KE9A 3OCVA 2JVIA 1NN5A 4HB3A 3O21A 3VR4A 4M6WB 1YVDA 2JZOA 4ARUA 4IHQA 4CLOB 2HREA 4UEQA 2HV8A 1GEEA 1FRFS 3I9MA 4I46A 5G3YA 2NU8A 5JCXA 5A7HA 2VDNB 3M49A 3KEQA 2ZJ2A 3FCUB 4FFWA 4I55A 4J2TA 4OBBA 3PV0A 621PA 2VDKB 1P1JA 3WQBA 3R2JA 1HZZC 3RVSA 3ZV6A 3ES9A 3HACA 3Q5EA 4WLUA 2YQ5A 3KAKA 3ERCA 1WCIA 5DM4A 3W3AD 4EENA 3U49A 2LP4Y 4D44A 2WSSA 4G89A 3WRVA 2O50A 3O83A 4CQLA 1WKCA 1YI0A 4KLAA 2AVDA 1I7LA 4X62B 4B31A 3QXCA 4JUBA 4DMUB 4A9AA 1E79A 1KJYA 1XT6A 2DBVO 2PQMA 3PC8A 4KQ2A 1MAWA 1QHNA 2WILA 1XDUA 1YRWA 2F9LA 4LZJA 5H9WA 4BX0A 3TCKA 4N3CA 2CDCA 2DVMA 2FMIA 3HCRA 4WPGA 4C22A 2O4CA 2ROQA 2BEUA 1CY6A 4WESB 3VZRA 3NBQA 2FDXA 4BKRA 5HUJA 4CCSA 2ZJ6A 5E9QA 1XA4A 1Z8NA 2RHCA 1V2HE 3ZHUA 5ALZA 1D0IA 1ZL0A 4M1ZA 3PI7A 3HKBA 1RKUA 1K89A 3B3QA 3E03A 4HDAA 1MIOA 4H7HA 3WL7A 3IQZA 1NJ6A 1RRPA 3AC0A 1E64A 4N1AA 5EE0A 4LYDA 4E3ZA 4QGBA 1CLUA 1NKSA 3CCBA 2WOOA 4EEKA 3D3NA 3GLFB 3ZD7A 4EX7A 3QUSA 1G21E 1FRZA 1M34B 1WD7A 3PYXA 1ETHA 1RLIA 2FP4A 5HOQA 3S8MA 3KIPA 3TM5A 4RTNA 1VJTA 2O0LA 3PEUA 3THXA 4GDFA 1PL7A 2ZIXB 5A3QA 5CD1A 1JECA 1IN8A 1DOAA 1K0UA 2FPIB 2LPMA 2OCAA 2ZJZA 2WZBA 4FBMA 4HADA 1PJ4A 3IB6A 5SICE 5KTPA 2R65A 3E5NA 1ZAKA 1Y9AA 1CBUA 1E2LA 1V95A 3TXXA 1DBRA 1LI4A 4XB2A 4PRYA 1FP4B 4PLFA 1OT5A 4M53A 3TQQA 4BNWA 4P92A 1YD7A 3NTXA 2B98A 3M5CA 2R6HA 5H02A 1Y3HA 1D2HA 1YIDA 1ODFA 1PX2A 1XR3A 2PX3A 4NK4A 2OV8A 2XJ4A 2FZ4A 1HE8B 3Q8MA 2PUBA 2VA8A 3BD8A 3SEZA 1UJ6A 2D13A 2JC3A 2P40A 5SV2A 6Q21A 1LB1B 5GV7A 3VNVA 4DB2A 1LVUA 4TSRA 5HPYB 5K45A 2I7XA 4RA6B 1KBQA 2PFGA 2JGFA 3T7KA 2JHPA 4WZAB 4ZVRA 1ND5A 4XYLA 4DB4A 2EHJA 3NDBB 3HBFA 1XZJA 3WQQA 1NIJA 1Z83A 4NFLA 5DP2A 4CQJA 3JQDA 1WDTA 2PMEA 5CDGA 1H1DA 3K1TA 2RGXA 2F90A 2Y76A 3KB1A 3QEBZ 1MLDA 1V7CA 4UM7A 2BL4A 3WSTA 3HUEA 3BIOA 1ODIA 4BBPA 1G42A 2EJVA 1W44A 1Y98A 821PA 1R4MA 3H1FA 3ROTA 1CUJA 4CN8A 3PNQA 4IY1A 2LW7A 1W0CA 3SVLA 4GKJB 3TIFA 3PFBA 4QQ8A 4BZQA 3GARA 4EITA 1Q14A 2KSQA 3QVUA 4GBED 3O0DA 3UUWA 2W6ZA 4P38A 3L4BC 3WWPA 2G9RA 3K0BA 4RF3A 4UBJA 3DWGA 5A1JA 2IF0A 3HCFA 1K7EB 3O1JC 1SM4A 3ESYA 3I9OA 3N2EA 3VHXB 4J07A 5AJWA 1X1QA 2AJBA 3GLTA 5F21A 3RBVA 1A8PA 3ND7A 1D2GA 3RC8A 1OI4A 2B3DA 4ZWNA 2IJGX 3I0MA 2DE0X 1LWNA 2PDAA 3IVRA 1WXQA 2DY0A 3VR3A 1Z6QA 5KSYA 3UPTA 2DCMA 1ZU4A 2YS6A 1XXLA 2AOUA 3K53A 1BFUA 1ZWKA 2JFHA 2VHWA 3GH3A 5KYXB 1HNZB 3DEYX 1DSSG 1J2YA 1I6MA 4H6VA 2R6DA 1JKXA 4DGSA 1H6BA 1NR5A 3ZVKA 2HJSA 2J7KA 3MGBA 4JBIA 2RGNA 5ICFA 1J2UA 1WE2A 3KQVA 1GPMA 3C3CA 4L5AA 4EL0A 3IV6A 4QVIA 3E5RA 1JKMA 2OZLB 1G38A 1I1OA 1JILA 1K8XB 3KL2A 5FYDA 3E9YA 4HXEB 5HSGA 2NO5A 1HE4A 2JJ2D 3RSOA 1VZ3A 4RVSA 5KVCA 1VLLA 1FU7A 3NTVA 3INYA 3NYQA 4CCYA 2O2YA 1C9JA 2AD5A 4P7JA 3OPNA 1B42A 1BW9B 4Z9YA 3BXPA 4G5SA 4O8CA 5TSDA 1BXGB 5EKUA 1OB2A 2PGLA 4HWTA 2R6R1 3QOFA 1MJ5A 1W5SA 3OJCA 2R1VA 4F2GA 1D4FA 1NUTA 1KYWA 3LBIA 4XD7D 3O4VA 3BH7A 3PFHA 1XAJA 4ZYXA 5K0JA 1BS1A 2J0UB 4QOHA 1PEKE 4ZP1A 3RFCA 2BJHA 2HYIC 1ID1A 3ZU5A 3KXDA 4XVHA 3D2LA 2QTTA 4ZT6A 2ILTA 1JXAA 1S9HA 1A5SB 3ETLA 5J2UB 2X2PA 2EP7A 3C3AA 1PWEA 1E2FA 1Y3CE 4I4TF 1L4LA 1CUWA 3DMTA 4L51A 1DBSA 1A5AB 1Z74A 4RK1A 5BN4A 4XI9A 1Q77A 2JVKA 3GFBA 2F67A 3Q6MA 5DSZA 3ZGYA 3AEKA 1R0XA 1P0QA 4Q19A 1BGWA 3A1NA 3IVCA 5EYPB 3THOA 1SMKA 3GPDG 3PENA 4LSMA 5B4TA 3M83A 1UANA 1YK1A 2EKZA 4H7IA 1K63A 2QT9A 1CJBA 2BISA 6NULA 4IXWA 1Q6YA 4NYIR 1XVTA 4MULA 2GK4A 4A8HA 2GPAA 1KO1A 2Z8YA 4J94A 1TUBA 4BO7A 2QY9A 4Q4HA 3FTNA 4CL8A 4YECA 1QGED 4EO4A 1EXNA 3KB2A 2P69A 3I61A 1W2HA 1BWSA 5J4HA 4QATA 3TUIC 2AUTA 4GEGA 4QDTA 1P7VA 1JA9A 4EPXA 1J0BA 1R6UA 1MC8A 2QE6A 2YS7A 3BAZA 1N1DA 1R27A 2AFRA 2MIIA 2O1XA 2E55A 1E5VA 2VP2A 4I6JA 2WFZA 3SCZA 3BD6A 4CM6A 4BFYA 3UYKA 5IBRA 1S89A 1U63A 4KXQA 1KVTA 3AI2A 5B7QA 3F7TA 4YR7A 3IR6A 4AZ3B 1YBAA 4P0PB 2FOXA 4A26A 2FWMX 3LGXA 2QTNA 3UPDA 4F8JA 1KK0A 1VHJA 1ISPA 1JALA 3OJEA 4B0PA 3VM6A 1REQA 2OOSA 2YVQA 4NYJR 4RZSA 4NKRA 5D7BA 2BSQA 3HCOA 2BKAA 4JBXA 1BCRA 4TMXA 1JG3A 1SXJD 1E6UA 3ONDA 1KAMA 3RWMB 5BR4A 4KK3A 3GFVA 2NV2B 2NG1A 4WECA 3M4ZA 5IFKA 3SNKA 3DPUA 2EX1A 2EFDB 1W5FA 5C1DA 1U0TA 1PJBA 3H0KA 4YWJA 3JSXA 1T36B 4H77A 4JJGA 1I2DA 3GYGA 2WAYA 4J6FA 3U7QB 4ZYZA 3MQFA 1XZAA 2XRYA 3PUIA 4PZ0A 4EGCB 1Y9EA 1P9OA 3L7MA 1Y37A 5DT9A 5FR1A 5JVDA 1DJQA 1OA0A 5EGNA 4NBLA 2UXBB 4BLWA 3U1TA 2CDNA 2MMGA 4E31A 1XD9A 1L4NA 1ACLA 1OPRA 3H6GA 3TZCA 5K3EA 2FFHA 2UZ1A 4YXWD 1NVAA 3P2YA 1RYZA 2AOXA 5A9TA 3LY9A 5HM6A 5D84A 1C41A 5IBQA 4GX2A 2QX8A 1OGIA 3E4DA 4X3OA 1BMFD 4RCZA 4TV9B 3LKZA 4ZARA 4A0FA 3DDSA 2D59A 3DP9A 2FKAA 1EVQA 1P0CA 4EIWA 1P0PA 1SUDA 3FBWA 4ZTZB 5GJBA 2FUG1 1DIBA 1KH3A 4JQSA 1BHSA 4YRQA 3QP9A 2QMOA 2YHSA 3TVTA 5IHPA 1CZRA 2R87A 2QZPA 4KL8S 5GJWC 4Z53A 1JSRA 1QAMA 1DZIA 1MFPA 1RQ2A 3PICA 3K20A 1CXZA 4EHIA 4RF5A 1EJ0A 1P3JA 2W98A 3K15A 1WBBA 4RHCA 1U2SA 2D4HA 2P3OA 3JQGA 1TM5E 3I05A 4HRYA 1H0KA 1EX1A 1GTL1 2ZRLA 2W6ID 5NLLA 2C5AA 2L2QA 1YQUA 4RGBA 2WHPA 3T95A 5DBHX 4Q3NA 4O4HF 1ZS9A 4RTMA 5DV9A 1B76A 1SBIA 3FJ1A 4FZ5A 1EGHA 1KZ7B 2BKVA 1NRIA 2X6QA 3V4LA 2XUFA 5C52B 1Q0TA 3LXMA 5BQ5A 5HRUA 4BNLA 4FR5A 4GLBA 1ADJA 1DAKA 1Z6ZA 3KNZA 4B7AA 4P36A 3RFTA 1TJPB 1ZJ6A 3ASZA 4DVGA 5JDIA 1FDTA 2FPLA 1FXWF 5EQTA 1OBOA 3W6PA 4URFA 2BGKA 1N36B 2R1ZA 3OM9A 2N46A 1YRAA 1PJZA 4IV0A 4L75A 2OZEA 2QTMA 2HBRA 5DO9A 3VSBA 1V5GA 4M49A 4UARA 3KB8A 1EUQA 1CUYA 1XMVA 1ZC3A 5FL7A 1U8AA 3NHUA 4QASA 4R2MA 3WMWA 4UMDA 3WLRA 2GM9A 3QTTA 4LKOA 1CYDA 2AQKA 5JHHB 3U9TA 1H2WA 1XAIA 2Y4NA 1RPAA 2FWJA 3GFOA 4F6CA 4QTXA 3K9CA 4L5JA 3PUVA 4L5IA 1XMIA 1NQXA 5GAJA 2WTUA 3SC2B 4B34A 3G8AA 4FUQA 4D9HA 3PR1A 5AM5A 3H18A 1PL8A 1UJMA 1KDYA 3V1YA 3TFOA 5CFQA 3ON5A 4YLEA 1E7MA 5FH9A 1FNNA 3ZWKA 1G4HA 1VE5A 3F9RA 3GHYA 1C8VB 4ZT7A 2WJGA 3LUAA 3R8XA 4CM4B 2CLHB 3K70B 1W4CA 1RC0A 1TA4A 1W93A 4TQ9A 2FWIA 2JLVA 3PWZA 1CRLA 3ESDA 5CFMA 3I09A 4Q3OA 4F21A 4B17A 1Z3IX 4NJEB 4DRYA 3K31A 5LZ9A 3K32A 3E15A 2XXAB 3D3KA 2E48A 3E22B 4EL5A 4YREA 3AOGA 2F3PA 4LYEA 3ETHA 4MW9A 3TLEA 3L8DA 1DC5A 2RHGB 5FI0B 5DGXA 5DT2A 4HLCA 2QXYA 5K3BA 4ZVTA 1YT5A 4Z4QA 5JNVA 3ZDDA 2D3WA 2BKLA 2IHJA 2P3SA 3PPYA 4P0QB 3ETGA 4B1FA 1LGYA 4EEXA 3ASUA 4C5AA 3GB9A 1FYEA 3U7EB 2OV1A 4FGLA 4YMGA 5IVHA 3INTA 3EVNA 5LJLA 5B3AA 2QTFA 1E6CA 1H65A 2H5LA 1CJVC 2WT4A 4P3KA 2HU7A 4JP8A 2VWGA 1Q1EA 4V2IA 5TEWA 2ZTVA 4HWGA 2I3BA 5AXBA 4D2IA 3BL8A 2WUFA 3QLUA 2OFXA 3LS2A 1KKUA 2HA2A 3AEYA 4R1SA 4WV3A 4CGZA 1R7RA 4ZOCA 2BFWA 4PIMA 1GTG1 4RTOA 1E1NA 1Y7TA 2QR2A 3UHPA 3L6UA 4DLPA 1U3UA 1XELA 1M10A 2J7PD 1KVSA 1BWRA 4LF6B 1GGNA 5JZVA 1MT3A 1KO7A 1U0SY 3STXA 1CUIA 3T5TA 1QIIA 3AF2A 5LDGA 1W4ZA 2FSSA 3EZLA 5JZ9A 1I9GA 4YUYA 3UHJA 3EPHA 5CFOA 1SHKA 4YT4A 2PUVA 1GVNB 2JFQA 3FN4A 5JH7F 1NUUA 5EZ6B 2QTGA 4FZVA 4NAVA 1CETA 1TW3A 3QZUA 3EDMA 4DZZA 1XNJA 5ADHA 2BWJA 3UT5A 1NNUA 4W6QA 4BMOB 2I6GA 3A58B 4M1MA 5DGDA 3D8HA 3PXBA 1E3SA 2C7VA 4B4DA 2QTLA 1RIIA 3STUA 2C9DA 4F0JA 1TK9A 2GO1A 4YR9A 1Z62A 3KZ1E 4LRWA 3TL3A 4IVRA 2HCTA 3TR5A 4E5SA 3O3MB 2Q29A 1OLUA 2PKCA 1US8B 4JT2A 4I8XA 1ESMA 3FWYA 2Q1SA 4XGQA 4XOIA 3JAWB 2RSLA 4QWWA 4W9MC 1NOJA 3GGJA 4DFDA 1W29A 1GKLA 1MB3A 4YGYA 1N8KA 3RSCA 4DCGA 3RUAA 5EI5A 4AJPA 2IYNA 5IG2A 3RYCA 1V6SA 3VR4H 1EB9A 2V0GA 2C3UA 2PGOA 1IM8A 1B6GA 2P3LA 3OWXA 1A2OA 3H3FA 1ZJYA 2E4UA 3DHWC 3NBXX 4KLNA 2JH8A 1QYVA 2XNCA 5E6SB 1DS6A 3U3OA 1ECLA 3NRBA 1KI6A 2REBA 4YQZA 9ABPA 1UP6A 2NZXA 3EGOA 2GNOA 3QYAA 3LUBA 1OW3B 1M8GA 3CO5A 5EMLA 5I4IA 1OFHA 5JE8A 3QVXA 2DQ4A 4QPCA 2AH5A 1GUAA 4EUSA 1G55A 4YASA 3NDIA 2ANCA 3F7MA 4FDTA 2QV0A 2QZ9A 2IWRA 2O7QA 4MWBA 4QDOA 4L15A 3Q72A 4LJKA 121PA 4CMEC 4PTZA 4Q3BA 4C4OA 3HA5A 4D8WA 4PQYA 2JCYA 3ZBUA 3QKWA 1GYQA 2YV2A 1CUSA 4GC5A 5DM0A 5FLYA 3GHHA 3UJ9A 2JVJA 3O93A 4MV4A 1W46A 1TIKA 3DEJA 3NWBA 3WLQA 4C5CA 3K1AA 3GROA 1KORA 2AG1A 5LL6P 5I8ZA 2WIJA 4HB4A 2OXTA 3SQOA 2NT3A 5AM0A 3VR6A 1EDEA 1QZZA 2JIZA 3AF0A 3M1IA 4TWRA 5FPSA 1JYFA 4RPGA 1M2GA 3ABRB 2C77A 3KKQA 3L4SO 3L7AA 4IXNA 3SVZA 1AUXA 5IARA 1IZ7A 3GA7A 1N2OA 3H83A 1RWMA 3HE3A 5BRNA 3ZGZA 2ZANA 3PGKA 3PXGA 1XQ9A 2FAXA 4BBAA 1KC1A 2IVFA 4Y0VA 1ES9A 1Y9ZA 3I5MA 2NAFA 1KJIA 1NE2A 3BIJA 4KOEC 4E2ZA 2CK3D 5DBFA 3V1UA 2ZWIA 4ZYVA 3J80A 3OZXA 4PBSA 3A1DA 4Q9HA 3LCRA 1M2OA 1C0KA 4OREX 4C2BA 1I6LA 3E3NA 3CLRD 5J4YA 3IT0A 4TTPA 1YGPA 1W25A 5FJIA 4PZ9A 4DLVA 3IAS6 1CJCA 3KS9A 4FDAA 4G9BA 4YO8A 1WRBA 5GP1A 4R98A 4ALNA 3ETDA 3L40A 1T5IA 3FH0A 1JEQA 1QHHB 1DPGA 1E8MA 1P2SA 1T34A 4M9SA 4ZOAA 1HL7A 1ZGGA 3P96A 3RC7A 1PT5A 3GNLA 3UM9A 1AZSC 1KFJB 3FFXA 4MCJA 1Y1LA 5E0OA 3W9SA 4U0JA 2IYSA 5CNKA 1A8HA 1JKFA 4UDOA 5FA5A 1RQNA 2OC4A 1EG7A 4JI6B 4EABA 5CG1A 5L53A 4GM0A 4PLTA 2CCKA 2GFQA 3KZMA 4C08A 3IHWA 4G0XA 4BJ5A 4RPJA 5FTNA 4FMPA 3RLFA 1YE3A 1NBOA 1YI1A 1PIWA 3H9CA 2VJPA 4XCVA 3BF8A 4LV5B 1GYRA 2V6FA 4PYLA 3TW8B 3ZDEA 1TM2A 3GCXA 3RO7A 2WF9A 1LK5A 3EMVA 4GMFA 4OK3A 2O0MA 1CFZA 2GN2A 2Z04A 4IRUB 4JEHA 4LYJA 4Y2SA 5JW6A 1XQXA 4XDGA 5JAOA 5G0TA 3B6JA 2L19A 4HZUB 4P33A 3U3ZA 2NUAB 5BPFA 1OIXA 5BV1A 4K9KA 3LIIA 1C3EA 2WAAA 2ZUVA 1UPUA 2DFDA 1T91A 2GXSA 3EG5A 4GBGA 5IKXA 1WUJS 3UA3A 1ACJA 1ZI9A 2DX7A 4F60A 1ID8A 1VP9A 1EHYA 1SC9A 4O4IF 4OP2A 3K6KA 3A9SA 2O2DA 3JD0A 4ZTUB 1NFFA 3KPJA 3OM1A 1U2DC 2O1EA 4M55A 1ECFA 4OATA 4JB2A 2VK8A 2O1SA 3ZYCA 4A6XA 1UPTA 2Q5LA 1YJ8A 5D5PA 2I76A 4RVOA 1G3MA 3LYUA 5TQ0B 2FDRA 2QZSA 2ZYAA 4B3XA 4DYHA 1OUMA 1RCTE 2ZU6A 3OPXA 3PFGA 1OAAA 5I9IA 3SLRA 2H00A 2ZUFA 2VQSA 4D92A 3HYNA 4HBGA 4D9EA 5B55A 5EKXA 1XB2A 3ODGA 2K6GA 5DI3A 1SCDA 2REOA 3ECSA 4MI3A 3ZQJA 1N32B 4ZK2A 4C7VA 3QSGA 1SUEA 5A5VA 4WQMA 1FLVA 3C5HA 1BTOA 1RLTA 2R3SA 4HLUA 1NF9A 3AIOA 4R54A 3FSRA 2MCFA 2F17A 4C3OB 2QRJA 4YRMA 2FLWA 1QE3A 1QTNA 2H1SA 2FEOA 3AGPA 3S28A 3MTGA 3UJ6A 2H59A 4E30A 4I50A 5D01A 1UKAA 2PZJA 5WRFA 2R2GA 4JUCA 4Y2XA 1T3ZA 4C04A 4DSAA 4LUCA 4HNUA 1WY7A 3GUZA 1C5KA 1FL9A 2P0AA 3BMCB 5BN5B 5ED4A 4BL5A 3GJXC 3F98A 3PUZA 2HT6A 1HK7A 3KJNA 4P80A 1GNPA 2P4UA 5E1MA 1GZDA 4W8GA 1MA3A 1PFWA 1C9EA 1EFKA 5H7XA 4CM7A 5FPKA 1V35A 5BNTA 2QBYB 2BE9A 3U4QA 3B1KA 1N92A 2GCPA 1GDHA 3PFIA 2BTOA 5IF9A 1E4EA 2CZQA 1R6XA 2NTYC 5TJHA 4EY3A 2VC2B 4FHDA 1JJIA 3RBZA 4BKMA 1H05A 4BB5A 3IELA 2YBEA 1BDMA 1DIAA 4LW8A 4ZO9A 2GARA 3ZVRA 2FUEA 4M89A 2COKA 3I12A 3DR5A 1Z26A 1QVAA 5HMMA 1RWQA 2VTDA 4Y2GA 3HFRA 3WWCA 1NUPA 4D0NA