4DYVA

Crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
237
structure length
213
Chain Sequence
KKIAIVTGAGSGVGRAVAVALAGAGYGVALAGRRLDALQETAAEIGDDALCVPTDVTDPDSVRALFTATVEKFGRVDVLFNNAGTGAPAIPMEDLTFAQWKQVVDTNLTGPFLCTQEAFRVMKAQEPRGGRIINNGSISATSPRPYSAPYTATKHAITGLTKSTSLDGRVHDIACGQIDIGNAMDVAHVASAVVYMASLPLDANVQFMTIMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a short-chain dehydrogenase/reductase SDR from Xanthobacter autotrophicus Py2
rcsb
source organism Xanthobacter autotrophicus
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
total genus 73
structure length 213
sequence length 237
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dyvA00
1XLTA 2QZZA 1SNYA 4WLFA 4ALJA 5I9NA 1LDEA 4C7JA 2ZTVA 1UXIA 4XYEA 4G81A 1PJBA 2W98A 5JS6A 1P77A 4K1LA 4R41A 3DBRB 1B8UA 3WXBA 3OEYA 4E12A 3WSWA 3NGLA 3NEPX 4FDAA 5DBFA 4CJXA 3LSYA 4RLSA 1PS0A 3ONDA 2Y99A 2WSBA 3D64A 1U2GA 3WMWA 3L9XA 1L1FA 2ZATA 2VHWA 1BXGB 4HFMA 5I9MA 1OZAA 3VZRA 4F6CA 3GVIA 4BNJA 3T4EA 1DAPA 1E7MA 2Y93A 2NTJA 3L07A 2XXBA 4P38A 3LC2O 3BHJA 1YQDA 5A9SB 5J23A 2J8ZA 3TFOA 3AOGA 2YHIA 3HFGA 3NJ8A 5U1PA 2X9NA 3U09A 4IY1A 4CPDA 2ILTA 3ZCXA 5KKCA 2YW9A 5F1KA 1Y6JA 3VPGA 4XGNA 5LDHA 3MJEA 1CQJA 1IPEA 2EEZA 3LT1A 4HWKA 1KIFA 4TQGA 2GGSA 2PZLA 4FB5A 1U9JA 1GZ6A 3L4BA 3I9KA 4GLLA 2YZ7A 3G1UA 1Y81A 1VLLA 2WMDA 1KETA 5CG2A 1YL6A 3F5QA 1NQTA 2VHVA 1HDYA 2NADA 5CP8A 4L4RA 2YDXA 4LRTB 4BNIA 1CDOA 4OHUA 2CDAA 1PTJA 4FSHA 1E0DA 3M2TA 3GPIA 5CPFA 4OIMA 3FR8A 3FN4A 2AEFA 2HU2A 2PGDA 4KOAA 4NK5A 4QX6A 2Y1EA 3GGGA 4CM7A 4DWVA 4YDRA 1PJSA 4FPXA 3F3SA 3E9NA 5JC1A 2Q4BA 1UZLA 3AFMA 3DBRA 4UAGA 1ADBA 2FSSA 3OJOA 4JQCA 1IYZA 3VH1A 1HETA 3ST7A 4BQPA 4GX5A 3KYCB 5I7FA 1QYDA 1YOVB 4XDZA 1PGQA 4R68A 3MZ0A 1BSVA 4CMCA 4CR8A 1DIAA 5GZ6A 5TF4A 3PGJA 5CHEA 2RHCA 4UVGA 4NBVA 5COQA 1SMKA 2HMWA 3ASUA 4IGEA 4NNJA 3RJ9A 3WNQA 1GY8A 1UXJA 4BUCA 4FFLA 3BTOA 3DWFA 4AICA 1WDKA 4P4LA 3JQEA 3ZWNA 2PH3A 4CM9D 4NH4A 4INAA 2HAEA 4WCDA 1KY4A 1EMDA 1C0LA 2P91A 3DO5A 4BNMA 5BSEA 5DF1A 1YQGA 3U4HA 2RH8A 4JNKA 1LDGA 3BMQA 5JLAA 1XSEA 1T26A 2WE8A 1WPQA 1HRDA 3CINA 1SEPA 4NU6A 2JD0A 3PJDA 3TWOA 3DHNA 5CDSA 3FBGA 1MG0A 3PYMA 4AJHA 3LVFO 4MJLA 5ADHA 2ZTLA 1J49A 1ZK4A 3PEFA 2C2YA 2GNAA 4DGSA 4WNIA 3K2BA 4MP8A 4J2OA 1AN9A 4CR7A 3CIFA 4TKLA 2B35A 3QWBA 1AXGA 2AEJA 1EFLA 4U0KA 5K6AC 4ALKA 1WVGA 2X0NA 6LDHA 3DBHA 1PGJA 1JN0A 5B4UA 4UEOA 4WPGA 1BWSA 3P5SA 5IDXA 4H15A 1I2CA 3LU1A 4RPHA 3GR6A 1OC4A 4ZHSA 2QRJA 3GGOA 4PZCA 4DIFA 3HNPA 5ICMA 1T2EA 1T2AA 4WEOA 1I2BA 4XJTA 3VZSA 3TL3A 2O3JA 3WYCA 3IUSA 2NTNA 1UP4A 2HK9A 3QVXA 4L9RA 4ZQEA 5T8KC 5CEJA 3N74A 4FFNA 1ENZA 2GN6A 4D0RA 1FDWA 1PJCA 3AK4A 4JLWA 4A27A 4D3SA 5CFZA 4C7KA 1HT0A 4JXKA 3SJ7A 5TSDA 2XAAA 1ISJA 4JROA 3L6DA 4IIVA 4AJOA 4JJFA 5JXWA 1JAYA 5LCXA 3ASVA 1UAYA 1T24A 1ZK2A 4WLVA 5L40A 4HFJA 1YKFA 1HDOA 5BR7A 2C29D 3E5RA 3NV9A 1TA4A 4CR6A 2R2GA 3ZW8A 4DVJA 1QV7A 4KUEA 3V2HA 3WG9A 1OI7A 1EK6A 4HNGA 1VI2A 3GZNA 4F45A 4KTTE 3C1TA 4BKOA 1I30A 3GHYA 2GR9A 1S6YA 3W6UA 4WOKA 3ZW9A 1AGNA 3KVOA 5JDIA 3R6DA 4YT2A 4BV9A 4RDIA 3OMLA 1BDMA 1KVRA 1K3TA 4HV4A 1SCUA 3D0OA 3HN7A 3MTGA 3KEOA 5IFLA 4I5FA 1NFFA 4L74A 1MB4A 3GFGA 1X7DA 1YH3A 1KOLA 1ISFA 1N9GA 3OA0A 1Z6ZA 3M1AA 2X8LA 1NVTA 1ZNQO 4YQZA 1UP6A 2C5EA 4ZVVA 3ROMA 2OBYA 1MC4A 3ANNA 2IYPA 3TN7A 1SPXA 4E13A 2PZJA 1JAXA 4GX2A 1ENPA 3U9LA 2NVUB 3GNQA 3T4XA 2EG9A 1K89A 3R1IA 1PJTA 5DZSA 1IHXA 2E6UX 4ND5A 4BVAA 2NU7A 2AW5A 1R0SA 1YJ8A 3AU9A 5C7LO 1GL3A 5MDHA 4U8GA 2HQ1A 1TI7A 1DFIA 1QP8A 2CY0A 5K6AA 1T2CA 5JE8A 5DN9A 4GI2A 1NX6A 4FGSA 2NQTA 3OETA 3H7AA 2PGLA 1N1GA 3F9IA 2RAFA 4MVJH 3OM9A 3DFUA 2UVDA 1ZBQA 3ZWPA 1V8BA 2BMAA 4WCFA 1JWBB 1NQ5A 3LF1A 4BB6A 3LF2A 3Q1LA 2NWQA 3JQAB 1L7DA 4EJ6A 3NJ4A 4PLTA 4DBZA 5JYDA 5KNLA 2VRCD 1XKQA 3C7CB 2G76A 2DT5A 1HKUA 4LGVA 4A0SA 1IE3A 3RC7A 1QSGA 4IDCA 2B37A 3IJPA 4EEXA 3GH3A 2B4RO 3MWEB 4FC6A 3PVZA 2NM0A 3E48A 3I9JA 4HUJA 3GAZA 5JNLA 2Y0EA 4MO2A 1IPFA 2G1UA 1E6UA 3G1TA 1VJTA 2Q2QA 3HQ4O 3PXXA 5G0UA 3V2GA 3F46A 4DQXA 3IUPA 4LW8A 3AJRA 3JQFC 4WOJA 4MVJI 1MLDA 3B1FA 3KO8A 4X54A 3PPIA 1HDZA 4AFNA 1TXGA 3PZRA 1HEUA 1KVUA 1LDYA 1XWFA 3GA0A 3VC7A 4MDHA 3L4SO 2O7SA 1VE9A 4JGBA 2VYVA 4I1IA 4RVDA 3WQSB 3ON5A 4HBGA 2IZ0A 3C3XA 1R16A 4GSKA 4CM4B 4Y8VA 3CZMA 1E3IA 2IE0A 3BTUA 1JA9A 1EEHA 2DC1A 5JAIA 5IXSA 1DC4A 4AG3A 4U6QA 4AJKA 4YEDA 1H6AA 4ONEA 4H3VA 1DEHA 2BLLA 3QY9A 4WLEA 2ZQZA 5L53A 1P0CA 4AVYA 4G5HA 1NP3A 3WJ7A 4O5OA 3EDMA 3QQPA 2GZ3A 4IDBA 5JMWA 1HYHA 2IZZA 5HRUA 5F1PA 4BNUA 4E5KA 3QVWA 4NZ9A 2R00A 1PZFA 3DZKA 1ZXBA 4FC7A 3GF4A 1NWHA 3ZNQA 5AXAA 2EP5A 2O4CA 2H9IA 3UAGA 3FTPA 4NPCA 5C7OO 1WZEA 4HKTA 2HRBA 2ZYGA 4R51A 1BTOA 3OJ0A 4TSKA 2GASA 4IDEA 2DBQA 1R12A 1IZ0A 4Z9XA 4N5LA 3NT4A 2AQHA 1ZW1A 1ZXLA 1CWUA 2JHFA 4PZEA 5T57A 3DMTA 4CQLB 1C3VA 1MUUA 1SBYA 2O3SA 4YAGA 4NJMA 4ESOA 4Y6RA 4GH5A 3ZWYA 2V65A 1LLUA 2VN8A 1IOLA 1R4NB 4XR4A 4IDDA 4RPJA 5ER6A 1ML3A 4OSOA 3PHLA 2A4KA 1J0XO 4PN3A 1U3VA 1H5QA 3PI7A 4HP8A 1XHLA 2XXJA 5FEUA 3RBVA 1P1JA 5BNIA 4CLHA 3D3WB 3N58A 1QORA 3SVTA 4RO0A 2JKVA 1GEEA 1BXZA 4W7IA 5A5FA 5JYEA 2Z5LA 2ZTUA 4BMSA 1PL6A 4R01A 4RORA 3WB9A 4D44A 4PCVA 4Y67A 4Q3CA 4LVUA 5KJ6A 3OFSA 3QWIA 2VWPA 1ZH8A 1ADCA 1YOVA 1ZSNA 4M87A 3BHIA 4XR9A 2BFOA 1DOHA 1R4MA 3W8DA 9LDTA 4JK3A 2HO5A 2NSDA 2D4AA 3I9LA 1G1AA 2O3QA 1NPDA 4CMEA 2FP4A 1PR3A 3IQDB 4OGWA 5JAMA 2VOJA 3TSCA 4NFHA 2DBRA 1Z7EA 3CH6A 1C0PA 1LX6A 3U49A 1LXCA 4OKIA 1AXEA 2C59A 3H6KA 3NT5A 1LTHR 3OEWA 4CMBA 3H9GA 5EESA 5BSGA 3NYWA 4PLCA 2VHYA 1WNTA 1JTVA 1E7QA 4RF4A 1BXGA 1GQ2A 2C7GA 2VRCA 1LA2A 4F6LA 2V7PA 3TDKA 4WJZA 5A1TA 4J1TA 4J43A 5EERA 1ZMTA 3RUDA 4RLHA 3RU9A 4DMLA 4YCAA 4EGFA 1GZ3A 3RASA 4IIUA 1N8KA 2OGUA 1VJ0A 3IC5A 4YXFA 1ZFNA 2GERA 2DQ4A 3DC2A 3O26A 2IEBA 3QIVA 4BGVA 1R4NA 4BO3A 3AOEC 1V3UA 4MVJD 4L0QA 1C1XB 4ND2A 1CEQA 2BD0A 1E7RA 3S2FA 1EBUA 1PSDA 4I9NA 5BSFA 5EJ2A 1IB6A 4XX0A 3A28A 4IUYA 1EE2A 1HE2A 3VH4A 4B7CA 1E7SA 4DUPA 3DBVO 3E1KA 4RGBA 3C7DB 5JPIA 5ILOA 4WE3A 5A3JA 1Y8RB 4Q3NA 2W90A 1O0SA 5ITWA 2JFFA 3DAPA 4GMFA 3WQRA 1ZK3A 4YAIA 2DAPA 1I24A 3GG2A 4EUFA 2G0TA 2QQ5A 3HUDA 4XQEA 4B7XA 1QMGA 5K9ZA 2CUKA 3DMTC 1MFPA 4BNZA 4W9NC 2QW8A 2UUOA 3CMCO 3WFIA 4GLOA 3WMXA 3V5NA 4L76A 3WYBA 2H63A 5DCWA 4L4XA 2WDZA 2H1SA 1V9LA 3ZN2A 2D0IA 2YV2A 2WD7B 2PKQO 4MPDA 1LRJA 3AI3A 3DHEA 2JFGA 2OORA 3PJEA 4IS2A 3C24A 4JJGA 2JJYA 5TJ9A 4E21A 5DBGA 1F06A 2BGKA 1CQIA 2QHXA 3B20A 1SEVA 3G17A 5EL0A 3TZ6A 4PFJA 3EHEA 3JQ8A 1P1FA 2EP7A 4YACA 3S2IA 3FHLA 2PLAA 2HRZA 1X14A 2J3KA 3DL2A 4XJSA 3D4OA 2UAGA 1U3WA 3VHRA 1NASA 2EGHA 4R9RA 4R1UA 4MKZA 1JQBA 1I3NA 2NVBA 1M67A 1EUCA 1KYQA 2DBZA 3WIDA 3PDUA 2W2LD 3S8MA 3ZU3A 2Q1WA 3F47A 3WBBA 3O38A 3VZQA 2AQ8A 4GAEA 1GR0A 2WYWA 4LSWA 1HDXA 3M1LA 2J3HA 5TGDA 3ANLA 3SXPA 3ZHYA 1U4SA 2Y1GA 3GPDG 3ZWBA 2FPIA 1YS4A 3B1JA 1BMDA 3I9MA 3EYWA 2UDPA 1YVEI 3ETEA 4O0LA 1M2WA 4DC0A 3UCXA 1VC2A 2D5AA 3HWRA 5G0TA 5EINA 3DMYA 1GDHA 1DJQA 2JAHA 4XWYA 1QRRA 1B3RA 4CM5A 3Q2IA 4I9UA 4O1MA 4YA6A 4GGPA 4II3A 4YVFA 5HBRA 1DIBA 2Y67A 1PZEA 3IJRA 3EY4A 2QRLA 1YB1A 1C1XA 1DSSG 3VH2A 4II2A 4Y6PA 5DOZA 2PK3A 5FWNA 1UR5A 1IZ9A 2Q3EA 3U4CA 1HLDA 1MGOA 5ICSA 3A1NA 5IDQA 4CMJA 3PDJA 1U3UA 3GG9A 3OJEA 2X7HA 4MOWA 3PWKA 2EV9A 3W4KA 1P45A 4HNHA 2B36A 3GK3A 2FZWA 4BKRA 5A02A 1VRWA 4BO5A 1PGNA 4AJNA 3HZZA 4GVLA 5KVQA 3TJRA 4W99A 3ZH2A 3KYCA 4XRGA 5TJHA 4NFYA 3TPCA 2G17A 3PTZA 4F3YA 1N7HA 3ICPA 5I7EA 2CVZA 2J6IA 1ORRA 2NVWA 4U6SA 5TLSA 3HDYA 1SAYA 4OXKA 1I33A 4HADA 5IJZA 4IJKA 4HX5A 2C20A 2PD4A 3QVTA 4UULA 3K6JA 2O4UX 4URFA 3WGHA 4ZA2A 1ONNA 3HE3A 3FSRA 1XDWA 1Z7BA 4K6CA 3MEQA 2OFPA 3IOYA 3GAFA 1R66A 4TVBA 1A7KA 1H9AA 1YDWA 3ROKA 4MVJM 5A06A 1Q7GA 4DLLA 2C07A 4PVCA 3ZI0A 5HA5A 4DQVA 4XB1A 2I67A 1B8PA 1I3KA 5F5LA 4TWRA 1M66A 4UVIA 1HTBA 2RBEA 1A5ZA 3E9MA 4XQCA 3Q0EA 5BNFA 3JQBA 1HZJA 2DU8A 5TT0A 4L4SA 4EYEA 1QKIA 3F6YA 3JQ8B 1QLHA 4GGOA 1K5HA 2NVUA 2POQX 2EERA 4RPLA 5G0VA 2BHLA 3LC7O 2YHIB 5DULA 1E3JA 4E5MA 1U8XX 4BHTA 5IN5A 3H3FA 4BO6A 2EKLA 2C7VA 3PFFA 3F1LA 4OJNA 1PJLA 4NBTA 2Q1UA 1KY5A 1E3SA 2VHZA 3W6ZA 3ADOA 3QWHA 2I3AA 3LQFA 4FJ2A 1VM6A 1UDAA 5AXDA 3SLGA 3ZWWA 4YRDA 1X1EA 4BMNA 5CEEA 1O89A 4CQMA 5I7VA 1CERA 1MA0A 1F17A 3L4BC 3UFXA 4DBVO 4BKQA 3C85A 4P4NA 1Z75A 1ZCJA 1KVTA 4LMRA 4ZQHA 2PNFA 2IRWA 3WGZA 1LLDA 3FPCA 3ONFA 4QTZA 2SCUA 3CUKA 2NU6A 1VKNA 3BTVA 3RC2A 4UVEA 3UF0A 2LDBA 4JN6B 4CLDA 2LDXA 3AM4A 4IM7A 3BMCB 4J3FA 1SB9A 2PKQP 4DLBA 3NTOA 4RF5A 2DTXA 3H4VA 3WWZA 5HM8A 1WMAA 4Q3AA 3W4JA 4M89A 4IINA 2NUAA 4ILKA 3TZCA 3V2UA 4W82A 3D1LA 3VPHA 1W4ZA 2CZCA 2CDCA 1VJ1A 4UEJA 5JCXA 2C54A 4CLXA 1QYCA 3BXXA 4E33A 4BNKA 1DXYA 4R3NA 3TZKA 2ZB7A 3H5AA 1NVGA 4N54A 2HKIA 3KYDA 1PIWA 1E5QA 1U3TA 5COBA 4BO7A 3GY0A 2VWGA 3I3OA 1D1TA 1Q7BA 3VDRA 3VTZA 4BKUA 2D3TA 5CPBA 4BGUA 1PZHA 5EIOA 3DQPA 4UREA 2X0RA 3SBOA 1ZUD1 2EIHA 2EGGA 3E18A 3H2SA 3LDHA 4FS3A 1PWZA 2JL1A 1B0AA 4J1SA 4CV2A 3H9EO 2B69A 2W8ZA 3DZIA 3BTSA 3HJAA 5KJCA 4A73A 2CDBA 4CLOA 2GLXA 1P33A 2H6EA 1NYTA 2PY6A 3CZRA 4IMRA 1LLQA 4RQUA 4B8WA 2D5CA 4DYDA 2ZTMA 1Q1NA 2QZ9A 5TRTA 4BNNA 2AG5A 3RC9A 2RHRA 1WWKA 1ENOA 3GRKA 4EUEA 1E6EA 4O59O 4BGIA 2D1YA 3D3WA 5C5IA 1R6DA 3STHA 5L7YA 3DAFA 3HFSA 5DCUA 2EF1A 3DDNA 3HB4X 1HZZA 4PLWA 1ARZA 4WASA 3HDJA 1O6ZA 2ZYDA 4DLAA 5KOIA 2WE7A 1DRVA 3IKVA 4CM6A 3VH3A 1V0JA 2ZJ1A 4XRRA 4IXWA 4OKNA 4Y6SA 3OF2A 4RV9A 3ENKA 2AA3A 1RYEA 4J9VA 4W7HA 3UHAA 3TFQA 1H2HA 1V35A 3EMKA 2AE1A 4TZTA 4M8SA 1DB3A 3D4NA 5COAA 3JYOA 3IS3A 1N1EA 1LJ8A 3IIEA 3QWFA 4NJMB 1UXGA 3WBFA 2GN8A 1HE5A 4XA8A 4BL5A 3KRTA 4BNTA 4TRNA 1HLPA 4UVDA 4YJHB 5G2OA 1DPGA 3RUAA 1I0ZA 3KBOA 5A9SA 2ZB8A 1V3VA 2DLDA 1FMCA 4KZPA 1XQ1A 4R3WA 3EVTA 1PS9A 1X13A 4LISA 1H93A 2VOEA 2V6GA 3EGOA 3PLRA 3MOIA 4E2YA 1YJQA 1J5PA 1E3WB 2HUNA 5AQ1A 3I9NA 2Q99A 4XCVA 3N7UA 4K26A 1H6DA 1MXFA 2Y68A 1P44A 1EK5A 1ZSVA 4MIEA 4KWHA 4OSPA 5CEFA 1E7WA 3FNFA 2GD1O 1LUAA 3AI1A 3KYBA 3TRIA 1EQUA 1TB4A 4PG7A 5H82A 1KEWA 4R5HA 4DYVA 2VZ8A 3ZV5A 5IN4A 5MGBA 5A04A 3ETDA 1F8FA 1PU2A 3RFTA 2X22A 3RIHA 1NAIA 5C37A 1DRUA 3E9QA 4OAQA 4AJIA 4U0JA 1DDOA 2WJPA 4YPOA 4E2XA 2QX7A 2EJVA 4Q3BA 3UUWA 3ZHXA 1HF3A 1Z45A 2CMDA 4Y9DA 1N5DA 2O3UA 4L73A 3MOGA 7ADHA 3KXDA 4FQ8A 4NI5A 4CLRB 1XGKA 2BRUA 4ALIA 1KEVA 3IDSA 3RJ5A 2OO5A 3NTQA 3WR5A 3I4FA 5HS4A 3O03A 5DT9A 3OJLA 4S3MA 4Z3KA 4JIGA 4ZU3A 1QYVA 4OM8A 3WICA 5GZ3A 2BFMA 3D5TA 1DLIA 2P5YA 5JDCA 4QSMA 2P5UA 3WS7A 2Q1TA 1PQUA 4MP6A 2I76A 4I08A 2I65A 3LT4A 3ZZNA 3QWAA 1UZMA 1O8CA 2EXXA 3K8ZA 4QFCA 2HSDA 3ZDFA 1CJCA 3I5MA 3M2PA 5A03A 2FR8A 2HCTA 1HL3A 2Q46A 3V1UA 3SJUA 4TROA 1B8VA 1VL0A 3P7MA 5FF9A 3RUCA 4ZQBA 2VYND 5ITVA 3OBBA 4MVJE 1YONA 4MIOA 3X2EA 3U4IA 4DXHA 2FMUA 3C8MA 4WCFC 9LDBA 4CMIB 3PHJA 4Z3DA 2GCGA 1NPTO 4R16A 1M6WA 1P1KA 1EUZA 3GGPA 4KUGA 4XYBA 4D79A 1TLTA 1ZK0A 1LSUA 1MC5A 3CKYA 1XU7A 4J1QA 3GDFA 4QT0A 5G4LA 1O95A 4BKPA 4B4UA 3TF5A 4J2HA 4AJ1A 4E31A 3E8XA 3F5SA 3WNVA 4WLOA 3DBLA 1P9LA 4FOSA 5JSFA 4N18A 3S2EA 1ISMA 3FNEA 3WTBA 2WM3A 3RUFA 1A9YA 5ILGA 1EUDA 2A35A 4KP7A 1ADGA 3H5NA 2FHSA 3GVHA 3F4LA 4XEHA 3HB5X 4NBWA 4Z9YA 4YAEA 2Q4EA 1PWXA 2D8AA 3JYQA 1EZ4A 4CODB 3A06A 5BQFA 4MVJF 2HJSA 1VL6A 5JBIA 3E5MA 3NAQA 3RFXA 1C0KA 3ZWXA 3PRJA 1W6UA 2V6BA 3CE6A 2CNBA 1T1RA 3KETA 4XYMA 3E6AA 3KUXA 5IXYA 1K6JA 2E4AA 4J7CA 2HMSA 1GPJA 4N5NA 3VPSA 4NMHA 3ROQA 3PHGA 1NNUA 1PGPA 2IEDA 1BDBA 3NX4A 2OZPA 2PH5A 1EDZA 4B8ZA 2AXQA 5IZCA 1O5IA 5EQDA 2R00C 4CUZA 1A27A 4RVHA 3GVCA 3JCZA 1Y7TA 4IJUA 3OIFA 5L4LA 1X7HA 2TMGA 3JD4A 1PJQA 3L6EA 3TQHA 7MDHA 5JDCC 2VWQA 3RKUA 5CDYA 4R1SA 2BI7A 1B14A 6ADHA 4K9DA 2ZCVA 2J3IA 3D5QA 2P4HX 4D3DA 1D7OA 2WEKA 2VYVD 4YR9A 4Q3DA 2AMFA 2NNLD 3GEGA 2Y1OA 3H9UA 4RPKA 4AJJA 4E5PA 3WGTA 3VPFA 2DM6A 1DC3A 2NLOA 2I3GA 3K92A 1JKIA 5I8ZA 4CV1A 2G5CA 3LT2A 5B4VA 4B7UA 4E6PA 1NTOA 1DC6A 3FF4A 1LEHA 1FDTA 3LC1O 1GFSA 4I8XA 1E3LA 1ULSA 4K6FA 3UGKA 1A4IA 4CLOB 1Q0QA 3JQDA 4M55A 2B0JA 2ZJ0A 1A72A 4M1QA 3UN1A 2IDZA 5THQA 5DBIA 4FCCA 5LC1A 3WTCA 2W4QA 4RPGA 1AHHA 4TRJA 2OHXA 4BO2A 3GLQA 1UDBA 2ZB4A 1CETA 1U2DA 4LCJA 4XGKA 2ZYAA 3V1YA 3MJVA 5H83A 1HYGA 3C7AA 3U5TA 1XELA 2OXIA 4WECA 1GCUA 4XZ3A 3VKVA 3D7LA 5I9LA 3QJ5A 1I32A 3NDJA 4OMUA 5CDGA 4I9HA 4DIOA 1C1DB 4NJOA 1PGOA 4FIZA 3FD8A 1YDEA 4JX8A 4BB5A 2PD3A 3VZPA 1PL7A 2PTGA 1U5CA 4B4WA 3K30A 2I66A 2Q2VA 3ZWOA 1VKOA 1X0XA 2BH9A 3I83A 4CLRA 2AE2A 3OECA 4B79A 4CUJA 2PV7A 2C82A 2P9CA 3QVSA 1UXKA 1E1LA 4E3ZA 1NPYA 2AEMA 2GZ1A 4RVGA 1OOEA 2WWRA 3RC1A 4HY3A 3WGGA 2B4QA 2Q1SA 3OIGA 1JLLA 3JQGB 4UUPA 4BO8A 2C0CA 3RUHA 1EBFA 4OOEA 2IXBA 1H6CA 3U0BA 3JTMA 3DTYA 4A7PA 3JYLA 2DVMA 2PWZA 4XIYA 3ABIA 4XD2A 2NACA 5TQVA 3PP8A 3BHMA 2J5RA 4J9UE 5JFOA 4FFMA 4R5MA 3L77A 1Y9AA 3M6IA 4RL6A 5IDWA 3DBHB 3VOSA 1ZEJA 4YJFB 2YQ4A 1NXQA 4EW6A 5A05A 4WEQA 3OP4A 3GDGA 5EMHA 1C0IA 2VT2A 3I23A 2JCVA 4TMFA 2X5JO 1GCOA 5C3MA 3AFNA 3VVBA 2O7QA 2ZCUA 4M49A 4S1VA 4XIJA 1M75A 5B1YA 2R6JA 4JP3A 4BNVA 2FY8A 2VZ9A 3PHHA 1K2WA 4FN4A 3GMDA 3HHPA 2IXAA 1NHGA 2NV6A 4RZHA 3B1KA 2O23A 4L75A 4OYRA 4EITA 1P1RA 3LLSA 1XG5A 2FRDA 1ISGA 1GQYA 3K96A 4MVJA 1EVZA 1LSJA 3NT2A 1QYWA 3EVNA 1E3WA 3FBTA 3PGXA 4LSMA 3RWBA 3ZU2A 4BO0A 3F4BA 2EW2A 2EW8A 3PJFA 3OICA 2ZIZA 4FBGA 4I5GA 2FR1A 3PYLA 3JQ9C 3CMMA 3GHHA 2X58A 4OQYA 3UOGA 3CEAA 4CM9A 4QUKA 2PKRA 4ALLA 1E77A 2Y1FA 3ICCA 4CMIA 1GUFA 1E1KA 1UAGA 1Q0HA 2AQIA 1B15A 3IP3A 1OFGA 3VDQA 3HN2A 1ISIA 4FJ0A 1DFGA 3TOZA 4CQMD 2C2XA 1WDLA 2DPGA 1DHRA 3UW3A 4N5MA 3EUWA 4YJFA 5JY1A 1A71A 2XPCA 3I4CA 4CL3A 3E03A 3PZBA 2JD2A 2ZQYA 3RAJA 3PQDA 4P8RA 4MVJG 4E2WA 2X0JA 1SC6A 4YBZA 4DPLA 1OBFO 4B4OA 2GN9A 4IS3A 5T6BA 4PG8A 1N92A 3GVXA 1LDMA 5CG1A 1R0LA 1YL7A 2DTEA 5G4KA 2PD6A 3DR3A 3GC6A 3H9JA 3RQSA 4KDEA 1KC3A 5AXBA 1HE3A 4LCEA 1UXHA 2AHRA 5JAQA 2V6FA 3RUEA 1WMBA 1E1NA 5GY7A 1V3TA 5A4DA 1WW8A 4D42A 2X5KO 1UUFA 3JV7A 4LMPA 1NVMB 4ALMA 1HYEA 1YE3A 4J4HA 1DHTA 3SX2A 3BZUA 3WDSA 1XEAA 2A94A 4PLFA 4BQRA 3PYXA 3P2YA 3VKUA 5EQFA 4I5DA 5L45A 3CPSA 4Q39A 4RVSA 2HJRA 4JBGA 4NG5A 4A10A 5L95A 2Z1MA 3HADA 4RZIA 1AE1A 1EVYA 3OHSX 2IYOA 3FNHA 1ZMOA 2P9GA 5H81A 1H94A 2P68A 1PJ3A 4CQMB 4R69A 1F12A 3AW9A 5BSHA 4Z0HO 3JQCA 4FOOA 3JYPA 1B3BA 1TT5B 1K6XA 1NR1A 2BELA 3H2ZA 1W8DA 2CVOA 1KBZA 1R0KA 2Q49A 4AJLA 1YBAA 3QHAA 3I1JA 3DXFA 3EZYA 5GZ1A 3Q6IA 4A26A 4RF3A 2X4GA 2YYYA 3EZLA 1E5LA 5JMPA 4D41A 4YAJA 1LRKA 1RKXA 1ZVMA 2IZ1A 3BMOA 4W9NA 1HDGO 1QR6A 3BMCA 2BFAA 1BVRA 4PG6A 3C1AA 1TT5A 2Q45A 4F46A 3ONEA 1DIRA 4GQAA 1NHWA 2DFVA 3ZU5A 5L4SA 1XR3A 3QRWA 2BKAA 3OA2A 5U9CA 1C1DA 3ZHZA 3MCVA 4LVCA 4B3JA 4OL9A 2I99A 3ITKA 1RWBA 5TX7A 3H8VA 1TVEA 3G3EA 4Z0PA 2DBVO 1DRWA 1U1IA 1T1SA 1RJWA 4HXYA 4GPD1 4ROSA 4EI2A 4UEKA 4XYGA 4OO3A 1Z82A 3DOOA 2OBNA 3AUTA 3NGXA 3IKTA 2YFHA 4PLGA 4BNXA 1GPDG 4FW8A 1DO8A 2VCYA 3X2FA 1ZIDA 5C7IO 1GV1A 2GDZA 4NDNE 3TZHA 4CMHA 1D8AA 3COSA 4FGWA 4XQ9A 2D59A 3RFVA 4BNLA 3RKRA 1P31A 3KV3O 3NUGA 4CMKA 1ZK1A 2O3TA 2WTBA 2CF5A 3KLMX 1D4FA 2B5VA 3WGYA 4QFDA 1ISHA 1DC5A 1G0NA 4DA9A 4GWGA 1GAEO 1V6AA 2X1HA 3OJFA 4WNCA 4YT8A 5T67A 1C14A 1ZEMA 2O2YA 1U4OA 4G65A 1IULA 1B26A 3AUAA 1NAHA 1SOVA 4XGIA 3IMFA 3JQ7A 1Y5RA 1YB4A 3HG7A 3LYLA 5TT1A 4CM1A 2J5QA 1CYDA 4WLUA 3H5RA 3W8EA 3HDQA 1F0YA 1EQ2A 3DOCA 3K31A 4UUMA 3DONA 3GFBA 3JQGA 2JCXA 3DAGA 3WWYA 1Z73A 3QVOA 5CAEA 4HFNA 1I2ZA 2WD7A 3QE3A 1GUYA 3ORFA 4D43A 4W4TA 4DL9A 1P74A 4IZHA 2PZKA 3DEYX 1HSOA 2VWHA 5HTOA 3DZHA 3BIOA 1ZKMA 5L4NA 1F8GA 5TIIA 1XYGA 1YGYA 1T4BA 1EE9A 4GL4A 4NIMA 1PL8A 4WCFB 4ND3A 4YRAA 1MXHA 4XDYA 4NFSA 1Y8QB 4D46A 2ZK7A 8ADHA 1T2FA 4JJIA 5I8WA 3H65A 1DJNA 4LRSB 3WYEA 4YT5A 3DBLB 1LDNA 4ZQFA 1W73A 1G6KA 4WGGA 3GQVA 3PK0A 4XQGA 4ND4A 2I5PO 3AM3A 2ZB3A 4PLPA 4J0EA 4NR0A 4OQZA 3WIEA 4DQUA 1IUKA 3IP1A 3UXYA 3Q9NA 1ADFA 4GKVA 1LC0A 4NQZA 1PQWA 1UDCA 4XKJA 2IODA 2VTDA 3FPLA 1A4UA 4KTVE 4JBIA 4J7UA 3WFJA 5CDTA 5JDIC 3LZ6A 2GRAA 2B4TO 4Z9FA 5F21A 3LLVA 1DAOA 3HDHA 4DTIA 4DPKA 4IDFA 5KWEA 3OSUA 3RSHA 3ZV6A 1RPNA 2DUWA 1BHSA 5DDIP 3JYNA 4IXTA 3JQ7B 1CIVA 2VNSA 2GZ2A 1VPDA 2O48X 1NR7A 1U5AA 4YYZA 1R4MB 3EK2A 4R1TA 3TL2A 1FDVA 3ROPA 4Z6KA 5IZCC 1GQQA 3JQ6A 4FR5A 4AL4A 4QO7A 1PEDA 3OH8A 3AM5A 1X1TA 3PJGA 3RROA 1YB5A 4A2CA 1BG6A 3MJ4A 3AUUA 2X23A 1MG5A 2ET6A 1E3EA 1S7CA 3DZJA 4EJMA 2Y0CA 2VUTA 3K9QO 1XQ6A 4LN1A 4Z0TA 2PGJA 2VNAA 1ID1A 5F1OA 2VT3A 4J1NA 2QRKA 3RVDA 1GUZA 4BGEA 1RM5A 2JD1A 1QG6A 1E1MA 1LBEA 3FR7A 4PGFA 4WLNA 1ULUA 2GPTA 4GX0A 4FFPA 4PLVA 1MV8A 2FWMX 3V1TC 3TNLA 4E2ZA 1GEGA 3NDIA 5B4TA 1QYXA 1KS9A 4PVDA 2GN4A 1ZJYA 2FZEA 3P2OA 5I7SA 4JP2A 1LQUA 4TVOA 4B4VA 4MIYA 3K5PA 1TEHA 1ZJZA 2GF2A 1X0VA 1JWAB 1JU9A 1JKJA 1P3DA 2WD8A 2UV8A 3GUCA 4KDFA 4E32A 1BRMA 2OP0A 3ULKA 5JW6A 4PZDA 2NTVA 4U5QA 3W8FA 2GSDA 4J90A 3AUSA 3S2GA 2VHXA 3VVCA 5HWSA 3INTA 1Y5MA 5FFFA 2Y0DA 4YJGA 3WJAA 4IQGA 2Y1CA 4UUNA 5IF3A 2F1KA 3UCEA 1JW9B 2OMEA 4AJ2A 5L7TA 2DTDA 2VQ3A 1BGVA 3JSAA 3RCBA 3MJSA 3D3EA 4I5EA 2DPHA 3E82A 2P4QA 4P22A 2Q2WA 3RI3A 4WUVA 3JQFA 5EN4A 1BW9B 1FDUA 1O94A 4NK4A 1Y1PA 3QSGA 4MKXA 5AXCA 3IL2A 3PLNA 3PWSA 5JCJD 4KMSA 2QG4A 4PIVA 4IJWA 1RYDA 1KC1A 4J6FA 4QQRA 4IBOA 3QP9A 4KQXA 4TRRA 2BI8A 1SZJG 2J5KA 3R3JA 3KSDO 3WX0A 2HMVA 2YQ5A 3P19A 3U4DA 4PLHA 1M6HA 1IHYA 2DUUA 5KIAA 3AU8A 4NHEA 5DOVA 4NBUA 3KZVA 4RDHA 3ZNPA 3UH1A 2Q50A 3BMQB 1HWYA 2P9EA 5A9TA 1A7AA 1ZSYA 2P2SA 1PX0A 1OMOA 1EVIA 2RH4A 4R54A 3VTFA 4YAKA 1GD1O 5IG2A 5IAAA 4IDGA 1RM3A 2XOXA 4OXNA 1AUPA 3NKLA 4W6ZA 3U62A 5JC8A 2HK7A 5JAZA 1H9BA 1AHIA 2JHGA 2BFPA 3DFZA 4TZKA 1GZ4A 1Y9EA 2JFHA 1DIHA 2C5AA 4GBJA 1U7TA 4YQYA 1B7GO 2GUGA 4PG5A 3EW7A 5GMOA 4DRYA 1EVJA 3PIIA 3EAGA 4R4JA 1WXDA 1H6BA 1Q0LA 2HDHA 4BO4A 3IAHA 3GNTA 1U28A 4D0SA 1R15A 2VUSA 4ZQGA 2OP1A 4JCOA 1X15A 4DC1A 4ZD6A 1HXHA 3BA1A 4AJ4A 2CD9A 1B16A 1G0OA 1Q7CA 3T7CA 1Q2XA 5TC4A 1UZNA 4XYLA 3I6QA 1UJMA 2I6TA 4E5YA 2FN7A 3FTNA 3JD1A 5KJFA 4TKMA 3A4VA 4E0BA 2FOIA 4ZN6A 1QLJA 3BAZA 1FDSA 4CQLA 3ZNNA 4Y98A 5A5EA 1P1IA 1DBVO 4CM8B 5KTKA 3O4RA 4HFRA 4FFOA 3FI9A 2RCYA 5G0SA 1JVSA 1RM0A 3S55A 3ZNOA 2BF7A 1HE4A 2H5LA 5ER9A 3WQQA 5BNTA 1A9ZA 2W2LA 3INRA 2E82A 3BMNA 3WOHA 3GUYA 4ZGWA 1LQTA 2YV1A 4NBRA 3O9ZA 2ZKLA 3JD0A 2W2KB 1FK8A 1KEPA 3OQBA 3ZV3A 1O9BA 4IQ0A 1GTMA 5HS6A 2JCYA 4IJVA 4O63O 4KUHA 3ITDA 5TS3A 2NU8A 3V8BA 3DTTA 3RD5A 4GSLA 2OUIA 5L51A 3KTDA 2VZ0A 4GVXA 3ANMA 2NQ8A 3MTJA 4ITUA 4B3IA 1D1SA 5KVSA 4UVHA 1VSUA 3AY3A 2GYYA 3GMSA 1NWCA 3BMOB 5T5QA 2OL4A 5B37A 1Y8RA 4M86A 2NU9A 5AYVA 4BNWA 4OXYA 4A03A 3D4PA 3FRJA 2CFCA 2VUUA 4U7WA 1XU9A 1IY8A 3L6OO 2HK8A 3UICA 1QXSA 1H2BA 2I9PA 1WLYA 2O50A 4R9SA 3F1KA 4YJGB 3GN2A 3WLEA 2Y1DA 3OQ1A 8LDHA 5DCYA 3PQEA 1YBMA 2EKQA 2EHDA 4BMVA 1BVUA 1XIVA 1HDCA 4M54A 3WSVA 2E48A 3QLJA 4DMMA 3I52A 1CF2O 1L7EA 4RCVA 2X0IA 3CSDA 4ZRNA 4IZIA 5T8KA 2X86A 1DIGA 3R0IA 5EPOA 5LDGA 1X7GA 1B2LA 1P0FA 1WAMA 4PRLA 5ES3A 4EBFA 3I9OA 3W4IA 3I6IA 3R3SA 1WP4A 2O3RA 1YO6A 2O2SA 1LLCA 3S1LA 4MINA 1XCBA 2G82A 2B5WA 3GT0A 5IDYA 1RM4A 1LSOA 4IQ8A 4WKGA 1MP0A 4FD3A 5A9RA 1FJHA 5ENDA 2Z95A 4H16A 1I8TA 3Q2KA 3HSKA 1GYPA 1NQAO 3JD3A 1GV0A 1LRLA 4GMGA 1LDBA 3DZFA 3GZ4A 4ALNA 4QECA 4EUHA 3ENNA 3C1OA 4G2NA 4L8VA 4BNGA 5FI3A 4JBHA 4ID9A 4YTEA 3KHUA 2TMDA 2YHUA 1BW9A 1NQOA 5JO0A 2DKNA 3GRPA 3EC7A 1F14A 3SC4A 3NRCA 4H7PA 4J4BA 5THKA 2W2KA 1GU7A 1LNQA 2UUPA 2F00A 5KVCA 3PQFA 1K0UA 1HDRA 1KERA 2XF8A 5AOVA 3AI2A 3GEDA 3RU7A 2PFGA 3ZWMA 1M76A 2WYUA 1LU9A 1T25A 4OH1A 1NFQA 3AY7A 4P4GA 4TRMA 5KCZA 2CF6A 1U7HA 1N2SA 4GKBA 3WGQA 3GNSA 1VL8A 4XB2A 2YUTA 3ZU4A 4EDFA 3UCFA 1WDMA 3QA9A 3B6ZA 4RVUA 3VPXA 4LK3A 4J49A 4R1NA 1JKFA 2VYNA 3SEFA 1PR9A 4J4TA 4CLEA 1P1HA 5TNXA 2FR0A 1J4AA 4MP3A 3H9QA 5K0ZA 1DLJA 4IDAA 1MFZA 4ZRMA 3INGA 4EZBA 4YT4A 4CMEC 3G79A 4D3FA 3L9WA 4PLYA 2PR2A 5B12A 1H0KA 3GN1A 2QYTA 3UVEA 4AJPA 3ZWVA 1IL0A 2YV3A 3A9WA 2DFDA 3JQAA 4CM4A 5JCJA 2PA3A 4Q3EA 3MJCA 2BGLA 3GOHA 4EJ0A 5KJEA 3ADPA 3KM0A 1ENYA 1NBOA 3KOUA 2A9FA 2D2IA 2J3JA 5F3RA 4CV0A 3GEMA 4CV3A 1OC2A 3O8QB 5U4QA 4NU5A 4OOFA 2EKPA 2WYVA 1NM5A 3Q3CA 3WGOA 3G0OA 4J16A 1MX3A 4GWKA 3AOEA 5BT9A 2Z1NA 3ZWCA 3CXRA 3DOJA 2YY7A 1W0CA 1YRLA 4J91A 3UKOA 1PZGA 2A92A 3KB6A 3PWZA 2B83A 3DZGA 3TZQA 3SC6A 4UUOA 5G4KB 1KVQA 3FWNA 3KSZO 1I36A 4B3HA 3T7EA 4BV8A 1GYQA 4KQWA 4BNYA 4DIBA 2X9VA 3NTRA 1E6WA 2OOSA 1N7GA 1E7YA 1PJ2A 1U8FO 1KVSA 1UH5A 1UP7A 3KLPX 3AY6A 2HMUA 3KSUA 3JQBC 3G49A 2VRBA 2CSUA 3NDRA 4J7XA 4YWJA 1D3AA 5DP1A 1Y8QA 4E5NA 3ZGYA 3SLKA 3W1VA 3WLFA 4C4OA 1ZO8A 4WK6A 3K73O 1YL5A 3GZNB 1QV6A 2EJWA 1LC3A 4KWIA 4RJTA 3Q9UA 4YJHA 1I3LA 4FFRA 1EDOA 1SOWA 3RBXA 3OQ6A 1PQPA 3K2EA 1XA0A 1YQXA 4O6VA 1SO8A 5FYDA 1KEUA 2QYSA 4BNHA 3RBZA 4AJEA 4BS9A 3LK7A 2X5OA 4CMAA 4DPMA 4YB8A 5FI5A 4YRBA 1I3MA 2YFQA 2AG8A 3ETGA 5IZ4A 3LT0A 4BO1A 3GVPA 1T2DA 1I5RA 1J6UA 4QEDA 1T4DA 1N9GB 5AVOA 3ZHBA 4J0FA 2FPGA 2CVQA 4E30A 3PHIA 3KEQA 3MJTA 5T64A 5JY6A 2YJZA 4BO9A 1FXSA 1Z74A 4PLZA 1GYRA 3FWZA 2HMTA 4BNFA 4D45A 4RQTA 4BIIA 5L7WA 5L9AA 4FJ1A 1ZZEA 4CL8A 2UYYA 3GDOA 2GO1A 1JVBA 2PZMA 4RVFA 1PJ4A 1ONPA 5DNAA 4MVJP 1YXMA 3B70A 3PIDA 3QW2A 1PS8A 3H3JA 4EEZA 1VSVA 2YDYA 1HSZA 2RIRA 3JQAD 3MWDB 4GX1A 4MKRA 4Q9NA 1I01A 4D7AA 2EWMA 4K28A 1JDJA 3ZWAA 2FPPA 3OIDA 4DREA 3QV1A 3CTMA 3U3XA 2Y05A 2X6TA 1R37A 2E37A 4IPTA 4YJDA 5DP2A 1YWGO 3O8QA 4QXMA 4CUKA 1FF9A 4PG4A 1ONOA 2JAPA 1CRWG 1EFKA 4N7RA 3L0DA 4CMGA 3Q11A 3WGIA 1DFHA 2BGMA 3BMNB 5KVVA 2HLPA 4QO8A 5CDUA 1NFRA 1YBVA 3A14A 5A3VA 1WZIA 3AWDA 3JQ9A 3DZBA 3KYDB 1GADO 1LSSA 2Y66A 4IMPA 3FNGA 4BOYA 1I10A 3PFWO 5L3ZA 2X9GA 1TT7A 3BYZA 3JD2A 4CM3A 2E49A 2AQKA 3VAZA 4A5OA 2V6MA 4E4YA 1E92A 4ND1A 2VTEA 2QIOA 5JO9A 4IGFA 2FSVA 1LI4A 3FCOA 4PRKA 4ZICA 5ENVA 5KKAA 5KJ1A 5G0WA 4RF2A 1K6IA 4CM8A 4ZJUA 1BXKA 3ZV4A 5F5NA 3DHYA 1SB8A 3RUIA 1OAAA 3DB2A 3TOXA
chains in the Genus database with same CATH superfamily
4HN4B 1XLTA 1IUNA 1TZMA 3IP5A 1G6OA 2Q3CA 5CLIA 3ACBA 1UXIA 3N1UA 4G81A 4II7A 1PJBA 2QT1A 3LXXA 1QHXA 2Q2NA 3W05A 5BW5A 1RJ9A 3B1WA 3CZCA 1ESCA 1P77A 4HPWA 2XUFA 4IVRA 4R41A 1RMQA 4HXEB 1O6CA 3S2YA 1B8UA 1R27A 2GHQA 2QD4A 3AL2A 3WXBA 3ZS8A 4E12A 5J4HA 3GT4A 3PE3A 4FDLA 4B3GA 4CJXA 1MO5A 3LSYA 2QL6A 5JI3E 3MTDA 1NP7A 1MEJA 3UK7A 1VPWA 3COPA 2OD2A 2WSBA 2PMWB 3M6MD 1JA0A 3LE8A 4YH1A 2C58A 3MTBA 2FGJA 3BXPA 3HP4A 4RY8A 1L1FA 4BXOA 1BXGB 1T9GS 3H18A 4GXNA 1D0VA 2QE6A 3BEOA 2HXSA 3GLHE 1H2EA 2QMOA 2Q41A 1T6NA 2OGZA 4LPKA 5AK0A 3ZD8A 4F9GA 4LJ6A 3PC2A 1JA1A 2Y93A 2QRGA 1E2GA 2YIMA 4FHCA 2PKEA 2XXBA 4DXDA 1KK1A 2GAOA 4HDAA 1N0HA 4C89A 1AS0A 4WJKB 3THRA 5A9SB 2CXNA 2YWBA 2A9PA 2B2CA 3VSAA 4B09A 2VSFA 1Z8DA 3HFGA 3QEMA 1JU4A 3TW6A 2MSWA 4CPDA 4TS1A 1K7CA 3QVUA 3DNPA 3IT0A 3ZCXA 2P62A 5IJXA 2DBYA 4TXJA 1KO4A 1Y6JA 4FZJA 1AA6A 3QPVA 4XGNA 4QT4A 1CQJA 2EEZA 3LT1A 1UK7A 3PD7A 1EM8A 1VBKA 1KIFA 4J0IA 3WKAA 1HR0B 5EKXA 1QWOA 2PZLA 4FB5A 1U9JA 3T3OA 2JLQA 3FZNA 4HAVA 1Z56C 3LP6A 4HJRA 2YZ7A 1HORA 1M7HA 3G89A 3FUCA 1KETA 1L4GA 1YL6A 2HSGA 2PEZA 2VHVA 1ABEA 3F5QA 4G0ZA 1JIUA 1IN7A 4KN6A 5CP8A 1Z3CA 3GROA 1SRRA 3SPXA 4JYPA 4LRTB 1SXPA 2Q3HA 4MPJA 1JSCA 3DFIA 4F9TA 4ZVUA 4GR5A 5JD6A 1UDRA 1VP9A 2IU0A 3M2TA 3RH0A 4L5JA 2C9MA 1JYSA 3K9LA 3NOQA 3DKVA 1E63A 1DO0A 1EM8B 2AEFA 2AXEA 2N1BA 1FFBA 1YA8A 3TIGA 3G0DA 2XDWA 3GGGA 3TMYA 4YDRA 5IABA 3HKEB 4FPXA 3F3SA 4DV7B 1UZLA 1TQ6A 3AFMA 2BPOA 1ADBA 5GONF 4QTUB 1DKUA 3OJOA 4JQCA 2BEVB 3K9HA 1HETA 5LYJF 1SXJB 2W2VA 3O7MA 1ZD8A 3KYCB 5I7FA 1PGQA 2P6PA 4FYJA 5GZ6A 1T5SA 4R1PA 2RHCA 3PVSA 4RA6B 3I04A 4UVGA 1E9VA 2OG2A 4WK0B 5COQA 5EP3A 4C7BA 2ODEA 1MB3A 2VP9A 1LPSA 4FMBB 3MT0A 1GY8A 3ZVLA 4LJYA 1PRYA 2B1QA 4ENSA 2C3YA 2FH5B 2WT9A 4DV4B 4AICA 1LFAA 3GGJA 1RJDA 1PEAA 1WUYA 2REQA 3GRZA 1LPOA 2WVJA 3DYBA 3G88A 4L5CA 4NH4A 4X44A 5CIWA 4C0KA 1OYVA 4L85A 4M6WB 5ESWA 1ODTC 1EMDA 1G60A 2QM8A 3BHNA 5BSEA 2OCGA 3FHTA 1YQGA 1N8SA 3P8ZA 2QJOA 1EGAA 1I80A 3LPAA 4DIUA 1O58A 4FR2A 4G26A 5JLAA 4EB6A 1TQ4A 1XXLA 1T26A 2DE0X 2EYUA 2QQEA 2Z3ZA 2GCNA 3UTCA 2IS2A 1HRDA 4I55B 3VISA 3WMRA 3N7TA 4WUTA 3GXOA 3PD1A 3LVFO 2IHNA 4QOHA 3EG9A 2ERYA 4M0LA 2ZI3A 1INLA 1MQ9A 1UJCA 4YLGA 4S1WA 1AN9A 1JQ5A 3CIFA 3GJZA 4UXJA 4Z7OB 4TKLA 3ZK9A 4XLTA 4RIHA 2AEJA 2V98A 1SR8A 1A4XA 2GEFA 3CC8A 2D0PB 4MDYA 5DGCA 4LSZA 1TKRA 2WKWA 4OX9Y 1FSPA 3HEMA 3OE1A 4UTRA 2H29A 1PGJA 3D3JA 3AR6A 3DBHA 4OJTA 5HCUA 1WZNA 2ZJAA 4QA9A 1R8QA 1L4UA 1QC5B 1L5HA 4DCPA 4MWGA 1BWSA 2H4ZA 2PGAA 1CY6A 5CU7A 1B74A 5KNCA 4EQ6A 4ZHSA 3OZDA 3ANYB 3Q7RA 2IOFA 4FEGA 4PZCA 3FCEA 5I8PA 4G07A 4L6IA 2VPTA 4M98A 5ICMA 4RIFA 5DISB 5CITA 4YNBA 2H4FA 5T8KC 1ZN2A 1UP4A 2HK9A 3UGQA 1PSWA 4L9RA 1I7QB 2I2XB 5CFNA 3G85A 1IBCA 2GN6A 4REMA 4O4JF 4TL7A 4A27A 2BKVA 1CRQA 1XF9A 5CIQA 4JXKA 4BYMA 1NVVR 3A9VA 2VL7A 4R9UC 4YIHA 3RVSA 3TNJA 1NF2A 1A0OA 1ONSA 2XAAA 4MGZR 4DLVA 1E2LA 1RPJA 2J3LA 4W1PA 4DA6A 4IIVA 2HCRA 4OMDA 1EAYA 4QOIA 1RHJA 3ASVA 1Q57A 2I6FA 1T24A 3G8AA 2ZP1A 3HP7A 4HFJA 2VF4X 5FAKA 1HDOA 3E81A 4QYIA 3HCOA 4QWMA 4BJ3A 2C29D 4YCLA 2FFHA 2ZYVX 1V41E 1VSTA 3K1AA 4N5HX 5LP1A 5CVDA 1KWGA 1OF1A 2VPZA 3AW8A 2HRQA 1GDTA 3WZLA 4KO4S 1E6KA 2PO5A 3UJDA 1L7QA 4KUEA 4R1MA 5EHZA 5K5EA 1Z2CA 1OI7A 1ZUNA 1E2PA 2XKJE 2ZZKA 2NSYA 5FQNA 4HNGA 5TQ2B 4ARSA 4LF8B 1J00A 1N75A 2XF2A 2YMQA 3EDRA 2PBLA 4RD1A 4BKOA 3B48A 2ONYA 3LVRE 1T5HX 3FZGA 2QLLA 1S6YA 2ORED 2PZ8A 3O4FA 2CC2A 2VHEA 4W5JA 3W6UA 4C76A 3X1WA 3ZW9A 3KXPA 1TDJA 4EUSA 2JK1A 3E2IA 4BZWA 4KR2A 2ZIAA 2MIIA 2IV7A 4AYXA 3C2QA 4RBNA 1KVRA 4RABA 1K3TA 2V7TA 4HV4A 3D0OA 4WJLA 2V1XA 4CYMA 2H3EA 5DBOA 2PQ6A 2WNIA 5F4BA 4EKEA 3SE0A 4KIUA 2AN9A 3N05A 3GFGA 4HCJA 5DI9A 1YH3A 1N9GA 1XUOA 1Z6ZA 4UPVA 2QXUA 3IV7A 1D4AA 4KLRA 3ZIDA 3U4QB 1M2NA 1NVTA 3TTXA 1QM5A 1ZNQO 1XP5A 2XBLA 4ZVVA 4BAUA 1JEEA 3ROMA 1YCHA 3AKZA 2W7TA 4HYEA 1HOTA 1TVMA 3DEZA 1GNRA 1SPXA 4OBEA 2O2HA 2PZJA 5K0EA 2BGUA 2P9JA 1NXTA 2NXWA 2NVUB 5LQMA 3GNQA 2GLTA 4PPYA 5JVDF 5KDOA 5FEMA 1PJTA 3U1VA 5FTWA 2P3OA 2O8FA 1VBFA 2E6UX 2NZWA 1S3SA 2F2TA 2PSDA 4BVAA 5L3SA 1R0SA 4CZ2A 1G17A 2GETA 3B2NA 2H1HA 3PNYA 1OT5A 2H1CA 4EO9A 3IDQA 3QE0A 2HQ1A 4ZOLA 1HUQA 1QGOA 1LBSA 3GWZA 5K6AA 4MICA 1RHRA 3I5UA 4DE5A 1U0HC 3F0TA 5AVUA 4UHCA 1CJBA 2C2BA 3UJ7A 3ZDZB 4IR7A 2EZ8A 3WIVA 5AI8A 1NE2A 1XEWX 3KOYA 2VG8A 3JR3A 2XUIA 5B7QA 4G0MA 5K0TA 1G2OA 3DFUA 1SIWA 5E0OA 3TAUA 4D2IA 4MUMA 1EXWA 2G72A 3LQ2A 5ULLA 1E4EA 1NRWA 2ODBA 3LF1A 1EX7A 5ALUA 2NPFA 3UZUA 2NWQA 1ULAA 3ESDA 2BYTA 4TLLB 1KDZA 1L7DA 1Z4QA 3GCZA 3NJ4A 2Z8XA 3I39X 3KDSE 4L07A 1KH1A 3IKJA 4D4IA 4RHFA 2E5FA 3WWPA 2Y1KA 3C7CB 3REQB 2G76A 3UMBA 1DGQA 3IAUA 1F38A 4CRWB 2AH5A 3TMKA 4IDCA 2B37A 4EEXA 4AF7A 1WCIA 1A8QA 1QDEA 5K1ZA 2L82A 2ON6A 1U80A 3E48A 3I9JA 4IVPA 3S8YA 3CRZA 2F43A 2ECPA 2G1UA 5DMHA 1H1LA 4OHXA 4QJ3A 1KGSA 2J87A 4KOEC 1JG1A 1S0UA 5IASA 1E6UA 2XT9A 2Q2QA 1HPLA 4D5GA 3IUPA 3ELWA 3OZBA 1LI7A 1TZCA 3C15C 3UH0A 1A9QA 1RAIA 2Q9AA 4CCYB 1NVWQ 4LYHA 3CW9A 4P36A 3TK1A 4FUQA 3ZJVA 1T2NA 3CVWA 3VC7A 1L5HB 3GA0A 1J97A 4NYIR 1LLFA 3ZVNA 2VJOA 4HX9A 1XAGA 2O7SA 4JJAA 4ABTA 1GKIA 1W5BA 3IKMB 1PR1A 2HWXA 4PYRA 1VCOA 3CF0A 4GSKA 1QF9A 3H2KA 4Y9UA 5KWJA 2JLVA 5IU6A 2IA5A 3AESB 3CZMA 4ZYWA 1W7AA 1EEHA 3EVZA 5JAIA 1SKAA 1BO6A 3C41J 3PL5A 1U5BB 2HJHA 2VDUE 3SZLA 4UOEA 3CH5A 3F2IA 4AJKA 4EM6A 4UHEA 4H3VA 3QY9A 1F0PA 2XV1A 2ZQZA 5L53A 3LX5A 1O5TA 3C5CA 1NP3A 4R0VA 1UEXC 1T6ZA 5FUYA 3AL0C 1VKJA 3ZK7A 4BB9A 4H17A 1C8LA 1Z47A 1RD4A 2JZOA 2VJLA 4R9VA 5DHFA 3WMEA 4P7GA 4OHOA 1D2HA 4N8DA 5FFMA 5KCMA 3HJRA 2QROA 2B30A 2GAAA 4FXPA 4G9BA 4I55A 3WL5A 4YI3A 1PZFA 1KMHA 3VR3D 4JKIA 2RHOA 1NWHA 1OV4A 4HXGA 3ZNQA 1II0A 2EP5A 5HJ2A 4UHHA 3PD0A 2QUKA 2QL5A 4FWIB 4P4SA 1CS0B 2I33A 4KQMA 4NPCA 1CSEE 3LNTA 1DVRA 5KYGA 4TMKA 3WDLA 4RK0A 3ER8A 1BTOA 2XB4A 4O4JB 4TSKA 2YMMA 4UJ3A 2DBQA 1EE1A 2JEOA 1SGWA 3E7DA 3AIIA 1ZVQA 1NNI1 3NT4A 2Z5FA 2AQHA 4NH0A 5LWQA 4X24A 1YRWA 1T1GA 2G07A 2O5RA 3QOFA 4PZEA 1E98A 1T0UA 3R7AA 4B0PA 4C4YA 2Q1XA 1KAHA 4YR7A 5MN5A 1C3VA 4KC0A 1T5OA 5CVVA 2XT6A 2IH5A 2V9ZA 3FIUA 4B5KA 4Y6RA 4ESOA 3I45A 2VN8A 1EVQA 4ZP1A 3I01A 4TV8A 5AKYA 5TIIA 4D8XA 1FP4B 5ER6A 3OSZA 6CHYA 1V7QA 2FKNA 4L50A 4O4JA 4UATA 5CUQA 5LYYA 3I5AA 3A9RA 4PN3A 4JYZA 4HP8A 2QN8A 2XXJA 2J9XB 4NDZA 4WOCA 4AS3A 1XPJA 2V7EA 3WMFA 3N58A 1VDZA 1QORA 4AY4A 4RO0A 5A4AA 1GEEA 3SVTA 4GKKB 2XMBA 4HSEA 2ZTUA 3WNZA 4OA5A 5JLJA 4D26A 2IX9A 3OZ7A 3V8EA 4Y67A 4QL3A 4GEKA 3BVPA 4GF5A 2QTBA 1XK6A 5IAJA 3P97A 4ZU1X 1ZH8A 2OTCA 2O59A 1ZSNA 4XR9A 2ZRBA 4EGSA 3R09A 1M2GA 3DWGA 1Q0SA 1T5IA 2HO5A 3A1UA 4C3OB 5DRYA 2NSDA 2D4AA 5DXFA 4Q6BA 1P61B 3EGXB 1U0FA 2C4WA 3M82A 4ACAA 4DLPA 3DTVA 5B3JA 1JMKC 3TJZA 1NPDA 1QV9A 1VMIA 1PV1A 3DOUA 3G2IA 5JAMA 4OGWA 1G1MA 5BR1A 3TB6A 1Z7EA 5D84A 2ZJ5A 3FTEA 1EWYA 3F78A 3NBYC 4QGSA 2WFMA 1LXCA 1GGNA 2C59A 2B4YA 3A25A 3ABSB 3B6EA 3A3PA 1AA9A 3NT5A 3OEWA 3FOZA 2JBHA 3OU7A 3ZXUB 1DAIA 1NBWB 2DGDA 4PLCA 1R3UA 3N6XA 1ZINA 1BXGA 1JNXX 2C7GA 1LA2A 1U1CA 2VJDA 3EFOA 4ND6A 3TDKA 2FMKA 2R85A 4EEKA 2AZTA 5FLEX 5A1TA 3LCUA 3CX8A 4HYTA 1PDVA 3RUDA 1LBIA 4DMLA 2C61A 3USCS 4EGFA 3OT4A 1F5SA 4IIUA 1N8KA 1U1EA 4UOQA 1BA2A 3VDXA 1VJ0A 1ICIA 4XVUA 4ZYVA 2EZ4A 2QAGA 4F92B 1M2OB 1ZFNA 2IUSA 1DTWA 4XWAA 5AM4A 5FO1A 2IEBA 5A4MS 2HGSA 3QIVA 4JI4B 4BGVA 1XZBA 1R4NA 4V38A 2YVLA 1V3UA 2XX3A 3T7RA 2JDIA 2R1TB 1I51A 4IIJB 5JSKA 4PEVA 4UE3S 5B3KA 1CEQA 2DPYA 4UBMA 2VI5A 5EFOA 4WK2B 2JCBA 3S2FA 3LCRA 2G6TA 4KO8A 1DEKA 5ALHA 3EGWA 4LF5B 4FHEA 2ATEA 1E9SA 1HA3A 3A28A 3AG6A 4HQNA 2ZWPA 4IUYA 4YN3A 3VH4A 1AHPA 2HNBA 4GECA 2ZAGA 2BTEA 2ZUUA 3IULA 1JJVA 4Q4LA 4PX2A 3QF7A 3DBVO 1C7QA 1HURA 2ZRIA 4N01A 3VZBA 2VP2A 4DUPA 2FHPA 5CVJA 4LFBB 4WE3A 2DFLA 1NV8A 3GJSA 1EJ6A 2DQSA 3T0FA 2WA2A 2D0OB 2UKDA 3A11A 4RTOA 1I24A 5HX7A 3C87A 2G0TA 1W5FA 1QX4A 4V0NA 3OLZA 1NDQA 5E3JA 4U3JA 2CNDA 5FX2A 3A6PC 2CMFA 4TVKA 4W9NC 5E0KB 2XMZA 3SQWA 1TK2A 1B6TA 3CF6R 2BGGA 4JCCA 3K2QA 1J8QA 2WJIA 4L4XA 1FNNA 1H05A 2TYSB 5E1OA 3CZPA 5KX5B 2D0IA 3L06A 4LC9A 4ZU6X 4EFDA 4WV3A 4ARZA 3G2JA 4QHTA 1R00A 2QW0X 1CUBA 4MKHA 1FL9A 4MPDA 4P4TA 3X44A 3K0CA 1LRJA 3AI3A 4DQ0A 4H4CA 1I7LA 1TA0A 5CFMA 2ZYTX 1A69A 1P91A 4GBGA 3DHEA 2JFGA 2OORA 1FU7A 4Y0VA 4E21A 1SUFA 1Q0ZA 3I1FA 1W5AA 5FTJA 2BGKA 3IDFA 1CQIA 3B20A 1SEVA 2ZJ2A 2EHJA 5EL0A 3EPHA 1T4CA 4AN1A 1YKSA 1NI5A 2HU5A 4EY3A 4K6MA 4BRSA 1P1FA 3KYJB 1HNNA 2EP7A 2AFRA 2FWPA 4HMOA 2QA5A 2B3TA 3FHLA 4LDJA 4YACA 2PLAA 3SR4A 4HLCA 1GP2A 1M6EX 2YVQA 5CA1F 5C52B 1I2MA 3ANXA 1UM9A 4QOEA 1ZVVA 3KAPA 2W71A 1ZUWA 3OU6A 2UAGA 3R23A 4IIFA 1E5DA 2I6QA 2YINC 3C5WP 3LD9A 4V2UA 1JPJA 2EGHA 2C2HA 1SC1A 4FYHA 1DT3A 1JQBA 2VCEA 1TYBE 1I3NA 1ZESA 2H2DA 1Z0KA 3PUKA 621PA 5EJ5A 2GF0A 3OPMA 3WIDA 4AROA 5K01A 1CJSA 4R2IA 4L02A 3ZJYA 2A0KA 3E23A 1V6SA 2GVDC 4Z0NA 3TCNA 4Y2JA 2Y92A 3JARB 4P7FA 5F2OA 2HO4A 2Q1WA 1CLUA 4CEHA 4I2NA 2XNJA 2ZWIA 4F86A 4JV5B 4P0TA 2FFRA 4LSWA 2J33A 3C5EA 3M1LA 1APBA 2J3HA 3RGWS 1YI8A 4NKRA 2Q3MA 1I7SB 3ZWBA 3IESA 4EDHA 3UUFA 3OZEA 2N0SA 2FPIA 2YYSA 1YQ9A 3B1JA 3I9MA 3EYWA 4ZC1A 2P9HA 2UDPA 3KUCA 4JVMA 3ZHUA 1QTIA 1YVEI 1IAVA 1XN1A 2P6MA 1M2WA 2AN1A 3B5EA 2YWEA 3EE6A 2P0AA 1VC2A 4M53A 4RK7A 3UCXA 5EINA 1PR0A 2FK7A 2JAHA 1GITA 1UBSB 1S4MA 1WSWA 1RKVA 4FLMA 3DM9B 2YL2A 1XCJA 3Q2IA 3QELB 2O0KA 4O1MA 2FN9A 3SVLA 4YVFA 2NO1A 1DIBA 1P5RA 4RKWA 1PZEA 1Q5PA 2B7CA 3O84A 1DSSG 1K2VN 2SECE 1IUOA 5GVRA 2QDKA 3AB8A 1ULZA 1Z0ZA 3MUOA 3U4CA 3VYWA 1HLDA 1VE1A 2P77A 5ICSA 1HNZB 4J8PA 1Q12A 3TLMA 4PINA 5IDQA 3T5TA 2NP6A 3BGDA 1M3SA 3IAS1 1U3UA 5KYUA 4ND8A 1U7XA 2UZ0A 5HTKA 4MOWA 4RW0A 1EU1A 2VT7A 3PWKA 2FZLA 3CG4A 3MCUA 5CHYA 1P45A 4HNHA 2B36A 5GOTA 1LV7A 2FZWA 2O8VA 3QOWA 5ITZB 2MSNA 4X7BA 3WV4A 4BDTA 3S28A 1OXBB 1AM4D 2FZ4A 1NM5C 3HABA 3KYCA 4D6PA 4XRGA 5JSZA 4RFSA 2G17A 3PTZA 3PQ7A 1ORRA 4TOIA 2KHZA 2Z3WA 4OXKA 4RETA 5EE1A 3TLGA 1HT1E 4IJKA 3KXIA 3FOAA 2ODNA 3HNOA 4XFJA 2ID9A 3BWXA 3BA6A 1UWKA 3QVTA 4TUYA 3RG8A 3VR2D 3K6JA 2O4UX 5DI3B 4UJ5A 4ZA2A 3VBCA 4WDRA 3P9ZA 1XLTC 3FSRA 3HYCA 4DR3B 5IJ0B 1KPIA 1PFGA 2ZVQX 5BMVF 4K6CA 3OEHD 2V0NA 4WBNF 2DFNA 4FGJA 4F5YA 5IC4A 1EYZA 4MQEA 3UHJA 4Z7QB 1DBPA 4Q1EA 2YXNA 1XTZA 3OCUA 3ZGNA 3L7IA 4DLLA 2C07A 1XI2A 5HA5A 4XB1A 3OAAA 4DQVA 3CVUA 1CXZA 1I3KA 4TWRA 1HTBA 1YBHA 5BNFA 3PNVA 3QE2A 5IRCD 2R751 3UHFA 1L9KA 3WWDA 3R8CA 4URVR 4TWIA 2HSZA 4ZCIA 3J81A 1I14A 3JALB 5A71A 5KC9A 3U7GA 3IPRA 2H4JA 2NPIA 4GGOA 3E5NA 2HU7A 3ELUA 4E7OA 1IK4A 4U7PB 2HPZA 3RTGA 4CEJB 1XN4A 2G5TA 4BAZA 4DIMA 5JQGA 1O9HA 3AHGA 5EIBD 4AUMA 4PO1A 3KB1A 3SF0A 3K70D 2PX3A 3H2JA 3R6WA 4R7ZA 4PM4A 4E09A 1CTQA 4OJNA 3QLTA 1V5GA 4X00A 3C4QA 4HH4A 4U3JB 2QWXA 3LA6A 3TVTA 1KY5A 2K2QB 3DFKA 3WRVA 2WNSA 3TQCA 2QI9F 2LRHA 2I3AA 3LQFA 4BP1A 3TG2A 4KXQA 3HJUA 4WZBA 3ZWWA 5DNCA 2BL4A 1Y3BE 4CDGA 4CU5A 4MQFB 5LYJA 1UJBA 4QQFA 4CQMA 3K70B 1CERA 4LKRA 1E1QA 3LKZA 3MW8A 5FULA 1OIXA 2NV2B 3C85A 4FNOA 3D3NA 1R0BA 2DWUA 1Z75A 2H08A 4P4NA 4TTJA 4K88A 2I80A 3WGZA 2VSYA 1LLDA 1P0MA 1RQPA 3N76A 3LBHA 5FR2A 1WLSA 4P7JA 1GPLA 1ZN7A 3ZJUA 1ACMA 1G64A 2O0JA 2YOFA 4B43A 2LDBA 4JN6B 5H9VA 4GE3A 2LDXA 2G70A 3ETLA 3U0VA 3VR2A 4CLDA 5KX5F 4BCCA 1GCGA 3ABOB 4J3FA 5AD1A 2Z1DA 3Q5EA 1Z4JA 1SB9A 2AMYA 3FHJA 3NTOA 1Z16A 3H4VA 4IG9A 3R7WB 4CF4A 4JGGA 4HAXA 3SI7A 3C5VA 2VNIA 3P94A 1G38A 2BT4A 3CVJA 4IINA 4JJ4A 1WUHS 3GAMA 3V2UA 5HIKA 1GXSA 1VJ5A 1P29A 5D85A 3ZHSA 4ZAZA 1BCSA 1DV1A 1V96A 2H8GA 3HBLA 2D62A 3OAAD 4K0RA 2QM3A 5JCXA 1VIDA 2PHZA 3O8OA 3KHSA 2COUA 2Q9UA 1LS1A 1GNSA 2AX3A 2I1QA 2PRIA 2OR3A 3TZKA 2ZB7A 4AY6A 3SOZA 3NTLA 2QP4A 4YJ3A 3EPLA 2HKIA 3KYDA 4MULA 2QMQA 1E5QA 1K8QA 1KSFX 1G5FA 3RSFA 3GY0A 3SIRA 1D1TA 1Q7BA 1SZPA 5ICFA 3DG9A 1XXHB 3B52X 2PKWA 5TXGA 3AILA 2H18A 2QXYA 1P2SA 2CXSA 3SS8A 5FOTA 3IX7A 4ASUD 1DRJA 1YAJA 1UXOA 1WMFA 2DMRA 3E18A 3LDHA 4QNMA 5ECYA 3FMFA 5C5IA 1K98A 4PAMA 2BFEB 2B69A 1QFZA 2W8ZA 1WNFA 3H9EO 4RH0A 1H8ED 2F1OA 3HJAA 3M3DA 5KJCA 3SYTA 4A73A 3VSCA 1ECPA 3V55A 1T0BA 4TTQA 4IFTA 4CLOA 1P33A 1RC1A 1T9ZA 2PY6A 3L7AA 2XZTA 3BSFA 4RQUA 3P4XA 4Q7QA 2V6JA 3NATA 1V95A 3B85A 4DYDA 2QZ9A 3IV9A 4QDUA 1OCEA 3BRWD 4Q16A 5CX4A 4GR4A 4JYMA 4YAUA 2PL5A 1WWKA 5A7GA 1ZCAA 3C6QA 4FFBA 5F5XA 4D3YA 1CRPA 3GRKA 5EEGA 1QE5A 4O59O 2YJGA 4YRRA 3AEKB 3CZQA 1RTTA 4BGIA 2D1YA 5KNDH 5C35A 1NJSA 1R6DA 3DAFA 4YMVA 4NCIA 1QHEA 3HB4X 4DSOA 4WASA 4E3WA 3IVAA 5JMTA 2ZXUA 4JODA 3RT7A 2ZYDA 4B3XA 1KL7A 1JMYA 1JDZA 1O3YA 4JEHA 4NYIQ 2WE7A 1DRVA 4EG3A 4CM6A 4EJSA 3ZCRA 4LOJA 5CNKA 2C4UA 4C3VA 1A97A 1R6UA 3C4JA 4IXWA 3TLGB 4RV9A 1OXXK 1IXRC 1TVKA 2WVHA 3M3HA 4MJXA 1XD9A 2A0FA 3K0AB 2QSZA 5B58T 4RTNA 4W7HA 1H2HA 1UQTA 1DAHA 1VA4A 2B20A 3EMKA 3K1JA 3UH1A 4M8SA 3OKPA 2HADA 3D4NA 8MHTA 2PGNA 2HA5A 4HDKB 1T5LA 3W5JA 2V7VA 2WFLB 1N1EA 1KYVA 3IIEA 3MMSA 5EMJA 1UXGA 5C1DA 5HUHA 2PANA 4NX2A 5L6LB 3V80A 3DDZX 1KMNA 5KNDA 3KRTA 3CLUD 2ZM5A 3G9UA 1TEVA 2AYZA 3D02A 1OA0A 3V3TA 3VNSA 1BDJA 4UVDA 1B6RA 2ZJOA 3FX2A 1KYWA 3MT8A 4G0QA 3THWB 3CFYA 1I0ZA 2QR3A 1SM4A 3KBOA 3NC1C 5C81A 5HQ3A 4DMCA 4Q1DA 2ZB8A 1ZVJA 3BF7A 3PQ5A 1FTSA 2WP8J 4MAMA 1FMCA 2R6GA 4AULA 2IHJA 4NNOA 2LNDA 2VHUA 3EVTA 1PS9A 3ID6C 3KDAA 3LECA 4X71A 4BRUA 4QKQA 4X65B 2FUNB 2GD6A 3EGOA 4ODIA 4MQ5A 1XZCA 2ZWOA 3MC1A 4FDMA 4C1BA 1H8EA 5I4KA 1X1QA 1YQTA 3N7UA 2Y68A 4ITVA 1VHTA 1EK5A 1M2HA 1DARA 4BQOA 3CRRA 4EHBA 1YOBA 4B31A 5AVTA 4OKSA 1DG1G 2GD1O 1FRFS 4XFKA 3QLVA 1EQUA 1TB4A 1NYQA 4OCZA 4LMAA 3Q8MA 3N8GA 2B2XA 3BAFA 1ZL0A 3ETDA 4UUQA 4B6FA 1F8FA 1HYQA 4EO4A 1TJ5A 5JJBA 3ZTWA 4PZYA 3R5SA 1DDIA 2WNHA 3JVDA 2FZCA 4J0QA 1BGWA 4QVGA 4AJIA 1KMCA 4CE6A 3KEGA 4U0JA 5B1SA 1KTIA 1J5XA 1GUDA 1ZUHA 1RQLA 4G1VA 4PTLA 4CIYA 1N5DA 2VEOA 1Z22A 1D4ZA 1Z8NA 3MOGA 4W5QA 5KQRA 4FQ8A 4JAVC 5DNEA 3H2BA 4F2PA 4I9FA 4MUEA 4G8JA 1VE3A 4F9FA 3UUEA 1FDRA 3GLRA 4YAJA 5JSYA 2MYNA 4EKIA 1FPQA 4V39A 1HK7A 1Y4ZA 1W5TA 1QGYA 2OWEA 1W1WA 2G25A 1QVWA 4JIGA 4ZU3A 4JI6B 1KQFA 1TF5A 1MT0A 1GSAA 2WAAA 5HIMA 3WICA 2IYNA 3D5TA 3CS3A 4X93A 1RT9A 4QXPA 3WS7A 1L4BA 2WU8A 4PZLA 5EZSA 3AUYA 4UBNA 3HK2A 3P45A 4GP7A 4CEIB 1M34B 1UZMA 1NYLA 4FYMA 5ALOA 4DR1B 3ZJTA 3S1SA 2VSNA 5A03A 2Q27A 3BJIC 2FR8A 2HCTA 1HL3A 2OV4A 4HRAA 4MPTA 3VUFA 2B4AA 2WU4A 1HEYA 3TTYA 1DJOA 5EEHA 4F91B 1E9AA 1QANA 2W2XA 3GA5A 3OBBA 4WKPA 1KK2A 2Z4SA 3R3YA 4ZQBA 4Z4CA 4Z4FA 3WL3A 3JTEA 4LX8A 1VG0B 4MIOA 4GLJA 3OLXA 4QUDA 4DXHA 2FMUA 2GPBA 2YTZA 3AF0A 3IVGA 9LDBA 2QD3A 4Z3DA 1NPTO 2CXHA 4RM2A 1P1KA 4ENUA 1EUZA 3GGPA 4O2AA 4XYBA 5KSWB 1KWKA 3A2MA 3W3AH 1TLTA 4LXHA 3QTTA 3M6AA 4YUXA 5KQLA 1IY1A 3HJNA 1YIDA 4Z7JA 4J1QA 4E07A 5EP2A 1DZIA 3IP9A 2AVNA 1QJ4A 3CLRC 4B5LA 2DERA 3TF5A 4AJ1A 2QU7A 3PJRA 1XPRA 3CWZA 4WZBE 4FMCF 2FN3A 2P2YA 1A5BB 4JA2A 4AF8A 1Q7EA 1PFVA 3HCCA 1DDGA 2JGJA 3FNEA 1ORVA 1Z0JA 3WTBA 2BKUA 4C7XA 3WB0A 1U0LA 4LRQA 3RUFA 3ZY6A 1M2KA 2A35A 1CCWA 1XU4A 1VKZA 1ADGA 3GW8A 3D3QA 5AP9A 3BCUA 1IQUA 1QG0A 1UPAA 2BZ0A 5K8VA 1YJCA 5FWYA 4V2IA 5BV8A 1F48A 3U1TA 3K9FC 3JAKB 1YU6A 2DWOA 2HWWA 3MCTA 4HWTA 4WAUA 1E79D 5IM5A 5LL6P 5EKUA 5KQSA 5KU7A 1ZICA 3R3HA 3UG7A 4JEMA 3T5GA 1UBNA 2OT3B 5JZMA 2W48A 3RFXA 2MYUA 4M1OA 5FWAA 4F2HA 1KDRA 5HMLA 3U31A 2YN0A 2X2EA 3SC2B 5JATA 1IHOA 1SIOA 2CNBA 1T1RA 3HGMA 4QU0A 1PJAA 2ECOA 1K6JA 1THMA 3AFGA 5DTIA 1FMTA 2HMSA 2PKXA 3FFBA 3HWSA 2O8CA 3INNA 1T2UA 1ZR4A 2OPBA 4EG6A 3MINB 1GG5A 1EK1A 2X8JB 1W2WB 3DP9A 3J7TA 2EDAA 3LLMA 3NX4A 2OZPA 1EDZA 2VBIA 2Q4RA 1E58A 1BJKA 3HXLA 5JCOC 3VZDA 2GB4A 5HUJA 4LXXA 1J8MF 4FUTA 5L4LA 3D6HA 3NBQA 1X7HA 2TMGA 3EGXA 1O08A 1PJQA 9GPBA 3IA7A 3TL6A 3IPLA 1M34E 3ZHQA 7MDHA 2VWQA 4ISBA 5CDYA 1B14A 5DLPA 4K9DA 1T9BA 2B6HA 1MB9A 3SOPA 3FWKA 4DSZA 1TEZA 3V7FA 1Y48E 5LBUA 5HG0A 1U31A 1YZHA 4UBOA 4L2IB 3OLYA 4MQBA 4WX2B 5LIPA 3AB7A 3PFHA 2P27A 4UDXX 1N8TA 2BF4A 3R0ZA 5EAIA 4YR9A 2AMFA 1XTKA 5HNKA 1QZTA 4IKPA 3AFHA 2NU8B 5KTRA 1EDBA 2PT6A 3H9UA 3LH5A 3WSTA 5LBIA 2FFJA 3KFVA 2VSOA 4AG5A 4C5CA 4Z1OA 1DQPA 1JVNA 1GPKA 3LT2A 1FSFA 1V2GA 2A7QA 2C9DA 4B34A 3HO6A 4E6PA 3FF4A 2CEAA 4H0CA 1BE0A 1Q0RA 3B6JA 4JJ6A 1R0YA 2PZFA 3RRXA 4GI7A 4I8XA 4BGDA 3OLQA 3FPHA 5L3SB 4GM0A 3EBOA 1XTJA 3ZBUA 4N48A 3EZXA 3JQDA 2QN2A 4MV1A 4QJ5A 2ZVDA 1OFIA 2O07A 3MJHA 2VNJA 4X1YA 4ZZ3A 5THQA 5J2TA 1XTUA 4Q05A 4KRGA 1N5MA 2QUBA 3VGPA 4ZALA 1RRVA 1XEXA 3MM4A 1AHHA 4GYYA 5H0IA 1Z2OX 5ICGA 1QH9A 3A2KA 2FMXA 4G25A 4ETIA 2XCSB 1UDBA 4AY3A 2C2WA 2WVGA 3QFFA 1KZGB 1RLUA 5H83A 4YRLA 3UXHA 3FYUB 1ETUA 1Y63A 2GBLA 1AUVA 1CG6A 1HYGA 2ZITA 1J0EA 5E9AA 3W79A 1FDIA 4WECA 1GCUA 3KU4A 1VLVA 3VSDA 3W9YA 5FKJA 3CLRD 4H3KB 1D2AA 2H9YA 5PGMA 1QU2A 2I78A 3II6X 4MMYB 1EK2A 1YZGA 4GYJA 1B0UA 4OMUA 1SKBA 3L46A 2B94A 2ZPUA 4I9HA 2GEVA 4OP3A 3VTAA 4INZA 2ENWA 2I8CA 3WRYC 4JX8A 1S2IA 1YDEA 2FW1A 4K9SA 5EWMA 3FXAA 5K8IA 2PTGA 2Z6UA 2GZDA 3P9CA 4B4WA 1XNGA 2WJHA 5AKJA 3DZ8A 4OYHA 1V9SA 3RTCA 4LI3X 2EZTA 3KP1A 4FMDF 3O7WA 1VKOA 3I83A 4RSMA 1OXSC 1QS0B 3OECA 3C4VA 3HJBA 4B79A 4BLOA 4OD0A 1QPZA 2G5GX 2P9CA 3PUXA 1UXKA 1E1LA 4G1EB 1KARA 1JTEA 4RADA 2GZ1A 2WUEA 5DX1A 3IVXA 4ZAGA 5IC6A 3RC1A 1QDLB 1AZLA 4HY3A 3IAFA 4BEVA 3QGMA 1S2MA 1XRLA 2OHVA 4H4DA 1DC8A 3D7KA 2HXYA 1M0WA 3JQGB 4DAOA 4GSYA 2GM9A 4QYXA 4YMLA 5EIFA 2H2IA 2G80A 2IXBA 1H6CA 3ONNA 2NYAA 3LFHA 2BFDA 1C5KA 1OWLA 2PWZA 3GJRA 4XIYA 1GO2A 4D4HA 2NOAA 1LTQA 3Q8KA 3AHIA 2RI6A 5DWDA 1JG7A 3PP8A 5C8YF 3B5IA 1PJRA 4KQ6A 5J40A 3AJEA 5BWOA 5JFOA 4ZYYA 1ITZA 2XUQA 3DLPX 1Q1GA 3NV7A 5HDQA 4DCGA 3NHPA 1JLSA 2ZAYA 2ZRGA 1UBMS 3DBHB 3K94A 1L7VC 1XQWA 3OBIA 1AGPA 4C2AA 2Y1XA 5EHGA 4ZARA 5BYJA 3TZEA 1NXQA 4OXQA 4OVKA 4EW6A 3WLSA 4LS3A 4WBSA 1H85A 3C3JA 1PR2A 2C2MA 4WEQA 4ZREA 2W00A 4ZHQB 1WM1A 1IBSA 3UEOA 4PZUA 1C0IA 4B9EA 4GQIA 5DSXA 3I23A 4EYOA 4OTZA 3ND5A 1KY3A 2O19A 1OUMA 3JW8A 4HNVA 5IUJC 4PFQA 3C6YA 2FW7A 1NRJB 3AFNA 1J1ZA 3AR2A 3G2MA 2BR4A 4XOUA 3T9DA 3VVBA 1FE8A 5B1YA 1DEAA 4JP3A 4RFSB 4RUKA 5CRIA 2XGGA 2VZ9A 3RNLA 4FN4A 4M9SA 2NV6A 1NHGA 4GPAA 3G2PA 2YICA 2DUMA 4OIMA 1SIBE 4EITA 1GGFA 4C0BA 5K8UA 1UDWA 4B3FX 2AC7A 1OTYA 1ISGA 4MVJA 2LCFA 2FZGA 2NO0A 4UHDA 3U39A 3HJFA 2CXOA 1PLJA 3NT2A 2XMDA 2NZYA 1L5RA 3LUPA 3PGXA 1V71A 3OKFA 1NZDA 1USIA 2ACEA 2PRSA 2QX6A 4BO0A 3E9EA 1BYIA 1Z2NX 3PJFA 1HO3A 3ZD7A 1MOSA 2BI4A 1F0KA 2TECE 3GJ6A 4I5GA 3QVGB 3JQ9C 5IW8A 3MAAC 4G9GA 1RJFA 4GC9A 3TNFA 2VTKA 3UJHA 3BGSA 2APJA 3EZGA 1NIPA 1CQJB 1KI6B 4YRTA 3E15A 1RYHA 5DNYB 1I4EB 3FSGD 3S68A 4OQXA 3W5AA 1DKLA 4ALLA 3FPGA 4N8EA 1N36B 2ZRLA 1E77A 1TPYA 1YHYA 2Y1FA 2Z57A 1Z2DA 2OYCA 1NNSA 4JELA 4ENWA 1SCBA 1IN1A 5G41A 1UAGA 1E1KA 4BC1A 1GFZA 4AQYB 1VLMA 4KLCA 2CNKA 1E1QD 1W36C 2XHEA 4PBRA 5ITZA 1E0SA 1E8DA 1WDLA 1J5EB 1E4EB 3AQ4A 3V7WA 2O57A 3B9PA 1WSBA 2W6ZA 2ONKA 3D43A 5DVZA 2O05A 3I4CA 4N12A 2YJ3A 4RKRA 3GRVA 1SXJC 3IELA 4LDNA 4E2WA 4P8RA 3A1SA 3IO3A 3L6RA 1NNEA 2X0JA 4YBZA 3DHVA 4BRZA 1Q74A 2JGFA 3NKVA 3KQLA 5FLKA 1C9EA 2V58A 5LQUA 3AR3A 5B3JC 3C3KA 1XAJA 1W2HA 3GC6A 1W44A 1WF6A 2BMJA 1N2EA 1KC3A 3RFUA 3U4MA 1G8FA 1RZVA 1HBJA 2FUG6 4HN2A 4B6PA 3GLFE 2A14A 3DNFA 5JAQA 1WG8A 2V6FA 1YI1A 1MEEA 1E1NA 2BKLA 2I8AA 2MSDB 4FFVA 5GY7A 3VNQA 1E8NA 1IBLB 1KIMA 1JZQA 1UUFA 1XB2A 2JI6A 5GJCA 3S99A 1WB6A 3SYLA 4N8SA 2EWVA 4GXTA 1YE3A 4J4HA 2Z8YA 1VMEA 3DMGA 1ZOIA 2UZ1A 2QTMA 2A94A 4FINA 3N2ZB 5F12A 2FSHA 3NHLA 1O6BA 5F64A 2VDVE 4MLCA 5EQFA 3T35A 1KI4A 4L0MA 4PHCA 3VKUA 4CBVA 1Z0AA 4Q39A 3PC4A 5B5SA 2I2DA 3OCXA 2Z1MA 1H1DA 1U7OA 1VI6A 3HADA 2RB4A 3FNHA 3JZIA 4KKXB 4QIHA 4V0OA 4DJTA 2PWBA 2WAMA