4DYVA

Crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
237
structure length
213
Chain Sequence
KKIAIVTGAGSGVGRAVAVALAGAGYGVALAGRRLDALQETAAEIGDDALCVPTDVTDPDSVRALFTATVEKFGRVDVLFNNAGTGAPAIPMEDLTFAQWKQVVDTNLTGPFLCTQEAFRVMKAQEPRGGRIINNGSISATSPRPYSAPYTATKHAITGLTKSTSLDGRVHDIACGQIDIGNAMDVAHVASAVVYMASLPLDANVQFMTIMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a short-chain dehydrogenase/reductase SDR from Xanthobacter autotrophicus Py2
rcsb
source organism Xanthobacter autotrophicus
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
total genus 73
structure length 213
sequence length 237
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dyvA00
3C3XA 5DZSA 2FOIA 1KEWA 4A10A 3JYLA 3STHA 3F5QA 3DZBA 3S2GA 2PNFA 1Y6JA 4RGBA 4HXYA 1HDXA 3GFGA 4E30A 5JY6A 1GQQA 3DO5A 2X22A 3G3EA 1EE9A 8ADHA 2D8AA 1GZ6A 3TZHA 4HFMA 4CMIA 2NVUB 3RQSA 3TWOA 4E31A 5CPFA 5B1YA 1P33A 1E7YA 2O3QA 1LRJA 2VHXA 5K0ZA 5BQFA 2OMEA 3DZIA 2CVOA 1BSVA 4MIEA 1DC5A 3SX2A 3WYBA 1T1RA 5DBIA 5KJEA 3ZWAA 5BNIA 4OKIA 2CVZA 3GMSA 3ICCA 1YWGO 1NWHA 2R2GA 3L6OO 1FDTA 1HE3A 3WMWA 4E3ZA 3ZHBA 1L1FA 1BXGA 1E0DA 5A4DA 3U09A 3QWAA 4B3IA 4BO9A 3UXYA 1B14A 4EUHA 1ADFA 3ZW9A 2R00A 2D3TA 1Z75A 3GAFA 3SJUA 3TPCA 1RYEA 4H3VA 1K6JA 5IFLA 1CWUA 1XYGA 4I5EA 2VZ8A 3GGOA 3GAZA 2WD8A 2Y67A 4QT0A 1C1DB 1GL3A 5KKAA 3WX0A 3CEAA 4YJHB 1DO8A 1T4DA 1ISFA 1LXCA 3ONDA 4LGVA 4CV0A 4KWIA 2C5AA 3RUIA 4KWHA 4Y67A 1YL5A 5C7LO 4NK4A 4XIYA 4RQTA 3V8BA 5C7OO 2WYWA 3FWZA 3FNFA 1Q0HA 3IMFA 2BH9A 3L6EA 1KOLA 2AEMA 4EBFA 2YUTA 3D5QA 3HFSA 3MOGA 1LI4A 3VPXA 1N9GA 3WYEA 1GCOA 1A7KA 1LDBA 1WLYA 1XSEA 3W1VA 1GPDG 2Y0DA 1Z7BA 2BRUA 2VYNA 4B4OA 1ZIDA 3WDSA 4QEDA 5BR7A 1NVTA 3D0OA 3OJLA 2RHRA 1W73A 3GRPA 5HS6A 5DNAA 1UP4A 3KLMX 4NPCA 4YPOA 4FOSA 2HRZA 1CQJA 1DPGA 4DMLA 4Q9NA 2C5EA 5EPOA 2CZCA 1UAYA 2CDCA 2OZPA 4WLUA 6ADHA 3DZGA 4LCJA 1QMGA 4MP8A 2VOEA 3GDGA 1PTJA 4XQCA 4W7IA 3HJAA 5C3MA 3DZFA 4AJ2A 2DBZA 2Q46A 3WG9A 4KZPA 5IXYA 3WGQA 1XU7A 4WOKA 4ZN6A 4OXKA 3D5TA 5IG2A 3CIFA 3PHGA 5IJZA 4M89A 1L7DA 3QWFA 1UXKA 2GRAA 4Z9XA 4CV3A 4DC0A 3VTZA 3E5MA 5IDXA 3N74A 1NQ5A 3GVPA 3BIOA 3IIEA 5KWEA 2G1UA 2VYVA 4ND2A 1T2EA 5LDGA 1V9LA 1PL6A 1ORRA 5THQA 3SLKA 4EW6A 4EUEA 3U5TA 4ZVVA 4Z6KA 2GZ1A 3RI3A 3MZ0A 5HTOA 1ADGA 1V3UA 2AQKA 5A5FA 5EINA 1K6IA 4EJ6A 4D42A 4BMSA 1PWXA 2RAFA 4RZHA 3KEOA 4B8ZA 5IZCA 5KIAA 3GDOA 1Q7CA 3MTGA 3I1JA 2FR8A 1QYVA 4IDEA 1NFFA 4TVOA 1NPDA 4RVUA 3RUCA 3IC5A 4OXYA 4BNJA 1F8FA 3PQFA 1JWBB 2EP7A 3H3FA 4RVHA 4FB5A 4I9NA 1E3EA 1LLUA 5TRTA 1ZK0A 4WPGA 4DRYA 4GWGA 3DMYA 3PGJA 2O3SA 3GRKA 3ZGYA 4JBHA 3RUAA 1U7HA 3BMCA 3AY6A 4WK6A 2DAPA 4JBGA 1E77A 1CYDA 2AEFA 3D3EA 3QWBA 3R6DA 1BMDA 1F12A 5CG2A 1RM3A 2JFFA 1ZZEA 3GA0A 1H6CA 4Z3KA 4ALLA 3EYWA 1PJ4A 5F5NA 4ZQGA 1KVQA 2FR0A 4BQRA 1E1MA 5L95A 1SAYA 1L7EA 1N1EA 4UAGA 1E7QA 3BMOB 2CDBA 3DOCA 2GSDA 4PLTA 5L53A 3EUWA 3V2GA 4E2ZA 1LDGA 1YJQA 3L77A 3WS7A 4B7CA 2I3AA 3V1TC 1X0VA 1TVEA 3IKTA 3UF0A 4QECA 3VPFA 3SBOA 1JDJA 4UEJA 4YQYA 3MTJA 4CLRB 1I32A 4OL9A 2VWPA 3CPSA 3LT1A 3OA0A 4A7PA 4AJHA 4O5OA 2ZTLA 1X14A 2Q4EA 3WGTA 4IQ8A 3RAJA 5JCJD 2RH8A 4PLWA 2O3TA 4PRKA 4JCOA 2GERA 3OHSX 2D4AA 4CMEA 2I9PA 4JNKA 4QTZA 3A14A 4WCDA 3OQ6A 4HNGA 4JP2A 4R9RA 4G2NA 4NBTA 3DBRB 4CLXA 3JQEA 4ALJA 3IAHA 2P2SA 3WBFA 4IDFA 3QVSA 5K6AC 2UUPA 1T26A 4YTEA 4EJ0A 4RPKA 2YJZA 2WD7B 2Y1EA 3RU9A 3GZNA 4XYMA 4DA9A 1R66A 1CETA 2DBQA 5G0TA 2J6IA 4YEDA 3VTFA 3OECA 3L9WA 1P1HA 2GCGA 2W98A 3K31A 3ETEA 1N5DA 2X7HA 3JCZA 1N9GB 3BMQB 2XPCA 4Z9YA 1EQ2A 3TL2A 2PH5A 4G65A 3U3XA 5JAMA 5L4SA 3H9GA 5DOVA 4D41A 3AUTA 2YV1A 3LSYA 2B35A 3LU1A 4GGPA 1V3TA 4XCVA 5B4TA 3H65A 2ZQZA 2ZATA 4MKRA 3ETDA 5TX7A 3M6IA 2PD6A 4XYLA 1PGOA 1YH3A 4NBRA 3HN7A 3KYCA 3U4DA 4A03A 4XYGA 1PQWA 3OJFA 1KERA 2JD1A 4FOOA 1C1DA 2PA3A 4XWYA 1NWCA 2P68A 3NTRA 2I99A 4PLYA 3BA1A 4YAEA 2QQ5A 4BGIA 4XRGA 1ZSVA 4DL9A 1WWKA 4F6LA 3BHIA 4AJEA 2Q45A 4H15A 2EJVA 2GN8A 3HSKA 3WGZA 5DCYA 3K92A 4WOJA 4Y8VA 1R16A 4UVEA 3ETGA 4J1SA 4A2CA 4CM4B 3PQDA 2I66A 2Q1WA 5AXAA 4FGWA 4ALKA 4Q3DA 1YL6A 2NVUA 3DHEA 3I9LA 2R6JA 3PWZA 4GKBA 4OSOA 4RPJA 5AVOA 3TN7A 2WE8A 1EEHA 4YJHA 5JAIA 3UN1A 2QZZA 2B4QA 3HB4X 4K6FA 1MA0A 4PVCA 1N7HA 4HFRA 4YT8A 1GEGA 4MPDA 5ES3A 4NNJA 2JCYA 5L7YA 4FCCA 3ZV6A 4Q3CA 2VUUA 1D1TA 3UW3A 1NPYA 3EDMA 3F4BA 3KUXA 4D3FA 1T25A 3ON5A 2W2KB 5KJFA 3EHEA 3DHYA 2EJWA 2J3KA 3H7AA 4IGEA 5IZ4A 1UP7A 3JD1A 1C0PA 1KY4A 3FSRA 1BG6A 1MV8A 2VN8A 1MFZA 3DBLB 4N5MA 1PQPA 1XDWA 2NVBA 2PZJA 3OICA 1GEEA 3QQPA 1A27A 5IAAA 3OQ1A 1ZXBA 4Q3AA 2NACA 1E92A 4C4OA 3JQAD 3UUWA 3JYNA 3TDKA 4FPXA 2FR1A 4U8GA 3Q11A 4FC6A 4DIOA 2AE2A 1VSVA 4HUJA 4P38A 2ZJ1A 1QSGA 1GY8A 3VPGA 4TSKA 3JQFA 5JMWA 1KYQA 1MP0A 2X23A 1HEUA 2VNAA 1MB4A 4NH4A 4OHUA 2DTEA 3LF2A 4BGEA 4YAKA 4EEZA 3KSZO 3H9JA 4DREA 3ZHYA 4CQLA 2CUKA 3PDJA 4DQVA 1DHRA 3DAPA 1QR6A 5ITVA 1DAOA 3ZU2A 4ND3A 1R0KA 4YACA 5L45A 3FI9A 3PHIA 2W90A 1ZJYA 3WGOA 3E9MA 4NJOA 4IY1A 1HT0A 4FSHA 3PYMA 2P9CA 2NADA 3OETA 2BLLA 1JAXA 3RUEA 4CM3A 5T8KA 5DN9A 5CG1A 3I6IA 3C24A 5A03A 5IXSA 4IMPA 3T7EA 4TRMA 2AEJA 2Y0CA 5EQDA 4W9NA 2B69A 3OFSA 1QYWA 4YT2A 1WAMA 2XAAA 2AG8A 2DVMA 2CFCA 3IP1A 2QX7A 1M75A 2ZYGA 4IPTA 4NI5A 1EVZA 3QSGA 4AJ1A 2DPHA 4NG5A 4ZA2A 3S55A 4G81A 3RSHA 1E3LA 5IN4A 1M6HA 1KVSA 2EKQA 1GCUA 1X1EA 4EJMA 1OMOA 2JAPA 1I8TA 2Q50A 4E32A 4P4GA 3PJDA 2CF6A 1ISIA 2HUNA 2C82A 2HKIA 2OBNA 3TZKA 4J6FA 4YBZA 4ND1A 1NASA 1ZEMA 4XIJA 3FRJA 3CZMA 1OAAA 4PCVA 3IUPA 4N5NA 5H82A 3RD5A 4IUYA 2Q2WA 4OIMA 4QSMA 1Y5RA 4LSWA 3E18A 3KO8A 4INAA 4TZKA 5A9SB 1NQTA 1PJCA 5L7WA 4I9HA 1X7DA 4KP7A 3WLFA 2CVQA 2R00C 4JN6B 1VL0A 2J5KA 2Q1TA 2FPIA 3K9QO 3O8QA 4YJDA 3V1UA 4DBVO 1R6DA 3F1LA 4A0SA 2VRCD 4BO7A 4YR9A 4PG6A 2SCUA 4E33A 1YBMA 3U49A 3RU7A 4XDYA 4TROA 1DOHA 3QIVA 1ZH8A 4PG5A 4ZHSA 2BF7A 4RF2A 1NFQA 3INRA 1N8KA 4IIUA 3FPCA 4L9RA 4N7RA 2E48A 3FNHA 4RVDA 3KYDA 5CDSA 3FHLA 1QKIA 3RFVA 3ZNPA 1HZZA 1LDNA 4HNHA 1H2BA 2P5UA 3ZNOA 3VZQA 1ZO8A 1T4BA 1XLTA 2QYTA 3CXRA 3FCOA 3M1AA 3C7AA 2NU8A 3BMCB 3ZWXA 4CLHA 2Q1UA 4TRRA 4MVJD 1HSOA 3KRTA 5EESA 1ARZA 1C1XA 4CJXA 4UVDA 2V65A 4BO0A 1YOVA 1NAIA 3L0DA 5FI3A 2O2YA 4DBZA 3PZBA 5IF3A 1U7TA 3BAZA 3BMQA 4M55A 4BNWA 4I1IA 3DBHB 4WEOA 5G0VA 2QRJA 1ZSYA 1Q7GA 1QRRA 3OMLA 4Y98A 4Z0PA 2HAEA 1I33A 4FN4A 4KMSA 4IQGA 2WD7A 1VI2A 4KDFA 4MKZA 4U7WA 5ITWA 4CLOA 1LTHR 5ICSA 3KXDA 3JD0A 5JE8A 5EL0A 1PR9A 2XF8A 4NFSA 4YA6A 1DRVA 4IDGA 3K5PA 4B4WA 1D8AA 4PLZA 2GD1O 2D2IA 1P0CA 2JL1A 4QXMA 4R69A 2Q2VA 8LDHA 3GVCA 3DAGA 4K28A 4MVJP 3LT2A 4GSKA 4CM8A 2PZLA 3GF4A 1XU9A 2NSDA 4IQ0A 3D64A 1Z82A 3DOJA 4BV8A 3EK2A 2B4TO 3ZWPA 4BQPA 3GGGA 5A3JA 1SO8A 2FRDA 1M2WA 1JVSA 4B3HA 1QV7A 1NHGA 1E7MA 1Y9EA 1H5QA 4NJMA 3UCFA 1EK5A 1U4OA 1WPQA 4XX0A 2VT3A 1A4IA 3DXFA 3ZWMA 1A9ZA 3ZCXA 3ZNQA 1U2DA 1BW9A 3NJ8A 4JJFA 1BHSA 4K6CA 4MVJF 4AJPA 4L4RA 2EKPA 2ZIZA 4OH1A 3JQ9A 1ZVMA 1HYHA 3D3WB 5CP8A 5G2OA 1EZ4A 1YBAA 3LZ6A 1YONA 5BSHA 4DPKA 2X5OA 3QVTA 5DBGA 4YAGA 4K1LA 2ZTUA 3WGYA 5JCXA 3TFOA 2ZTMA 4L0QA 4AG3A 2BD0A 2D5AA 4CM4A 1VE9A 3HG7A 1C0KA 4CMKA 4JBIA 5A05A 2Y1CA 2ZCVA 1B2LA 4AJIA 2GO1A 3A4VA 1Y8QA 4L4SA 5KVVA 2PLAA 3G1UA 1G6KA 3INTA 5LCXA 1R4NA 3RFXA 4ZICA 4NDNE 2G17A 3SEFA 4X54A 2CD9A 4EZBA 1EBUA 3AI2A 1DC3A 1SEPA 5TSDA 1W8DA 2PTGA 3PYXA 1GUYA 4FR5A 4WLVA 4EEXA 2HMVA 3PPIA 2JD2A 4OQZA 1A4UA 5B4VA 1PJ3A 3NAQA 5C37A 3UOGA 1RPNA 3LLSA 4ONEA 3Q0EA 4BNKA 1YQXA 1Z6ZA 4CUZA 1C3VA 4BNVA 4L73A 5BNTA 1M67A 4XB1A 5TLSA 2ZB8A 4NU5A 1AHIA 3I6QA 2UVDA 1KC3A 4OSPA 1OOEA 4YT5A 4LSMA 4RVGA 3UH1A 5B4UA 3E1KA 4IIVA 1HYGA 1NX6A 2X5JO 2NQTA 3PI7A 3ADPA 5JC8A 1GYQA 4CLEA 4FC7A 3BYZA 4NU6A 2H5LA 2W4QA 3GN2A 1PJBA 2VZ9A 3ZNNA 1P74A 1NHWA 1N7GA 2VYND 4IDCA 1E1LA 2GN6A 3VDRA 1BDMA 4PLCA 4BO3A 5AOVA 4U0KA 1K89A 3AOEC 3ZWVA 2X0NA 3L07A 3WTCA 1B3RA 1GDHA 3E9NA 2DQ4A 4XA8A 1I36A 1VKOA 3ASUA 4FFRA 4NBWA 1UZNA 4RDHA 1XIVA 3ITKA 5CDYA 5KJ1A 3B20A 1ZK1A 4GX2A 1TT5B 1HTBA 1V0JA 2X58A 3S2FA 3ZN2A 3JQAB 2PY6A 4EITA 1SB9A 3JQ8B 4BNMA 3F6YA 4LISA 3OA2A 3CE6A 4XYEA 2J8ZA 4RVFA 1A72A 2J3HA 4ZQFA 4ITUA 4R4JA 4IJKA 4R1NA 3WBBA 4DYDA 3GNTA 4RJTA 3ONFA 4RF5A 3GH3A 4D0RA 4J4BA 3HNPA 3RC9A 1LEHA 3RC7A 1XGKA 3NTOA 3JD2A 4B7XA 5U9CA 3FPLA 3K2BA 4HKTA 3BMNB 3BTOA 1RYDA 1UZLA 3JTMA 3Q2KA 4QO7A 4UUMA 5G4KA 4PLPA 3JYPA 1U8XX 2RBEA 3QWHA 2JCVA 2EKLA 4RL6A 3GUYA 4BNXA 1EDOA 3KM0A 5GZ6A 2DFDA 5HA5A 4XGIA 3H2ZA 3Q6IA 3PQEA 2FSSA 1VRWA 1KIFA 4DGSA 3JQ7A 2O3UA 5F3RA 4HV4A 1FDWA 1BXGB 1RM0A 3LQFA 5CDUA 5F1OA 5I9LA 3WJ7A 3GUCA 2B5VA 4BOYA 5A1TA 3INGA 3O9ZA 1C1XB 2AE1A 2O3RA 2VWHA 4M1QA 4OM8A 2DTXA 1DIHA 1I2ZA 5K6AA 2VOJA 4WKGA 5DP1A 3UKOA 3C1OA 2EV9A 1GFSA 3GDFA 4TQGA 4BNIA 1XELA 3KYDB 4BO5A 3QLJA 4XQEA 3NYWA 2IRWA 4J7CA 1IE3A 2PGJA 2X0IA 1CF2O 2HCTA 5MGBA 5I7EA 4R5HA 4QFCA 1NAHA 3IS3A 3WQRA 1DLIA 1RKXA 1Y8RA 3OP4A 4RPLA 2WWRA 1GD1O 1OZAA 2ZQYA 3DB2A 2IZZA 1EK6A 3PRJA 4UUNA 1Y1PA 4IZIA 4P8RA 5A04A 3HE3A 3DDNA 1S6YA 2IXBA 5ENVA 1ISGA 1NNUA 2P4QA 2YHIA 3PZRA 1ENYA 3MJSA 1PS8A 4R01A 3TOZA 6LDHA 1YL7A 2VT2A 1SOWA 4NFYA 2FHSA 1KEUA 3F46A 2WDZA 4H16A 4R1UA 4DLLA 1T2AA 3E82A 1O9BA 4U6SA 3FD8A 3WNVA 1JQBA 2C2YA 1HWYA 2FSVA 1YBVA 3E6AA 4CM5A 1UZMA 3JQDA 1PJSA 3A9WA 1J6UA 3VC7A 1P0FA 1EVYA 2OGUA 3ROKA 5KTKA 1KY5A 2FZEA 1VPDA 3FN4A 2A9FA 3LC7O 2WYVA 4LCEA 1KEVA 1U3UA 4BNTA 2VTDA 5BSGA 4IMRA 1K2WA 1DFGA 2VQ3A 2EW8A 4ID9A 3HDHA 4YT4A 5EQFA 1LSOA 2X0JA 3T4EA 3DOOA 2CNBA 4YB8A 3RBVA 5KVSA 2G0TA 4U5QA 1Y81A 2NV6A 3RIHA 4GVXA 1YOVB 1I24A 1DAPA 2FY8A 1I3MA 5T6BA 5JCJA 1HDRA 4D3SA 1I2CA 1Q1NA 1SC6A 4MVJM 5GMOA 4BS9A 5EJ2A 3CZRA 4E13A 2EW2A 1EQUA 1DB3A 5LDHA 3ANNA 2B4RO 1SEVA 4J9VA 4ZRNA 5TT0A 3PFFA 3TQHA 3K73O 4NMHA 1PL7A 4IJWA 5HM8A 3PXXA 1E5LA 3RBZA 3W6ZA 2UDPA 1YJ8A 5JC1A 3VDQA 3ZH2A 2WEKA 2YV3A 3WGHA 4R68A 1IB6A 1ZUD1 4R16A 1NYTA 2D59A 1RJWA 3KV3O 4XKJA 4E2XA 2F1KA 3C1AA 4L4XA 3VOSA 4CMHA 3AUUA 1HE4A 5FFFA 5KCZA 1ZKMA 3GNQA 1LDEA 3G0OA 3LLVA 5CHEA 1NQAO 3U4HA 1U3TA 3PLNA 1I3LA 2BGMA 2V6FA 1XCBA 3VPSA 1QLHA 1HLPA 2DBRA 4OO3A 3RROA 3JQAA 2DLDA 1LSJA 1HL3A 2YW9A 3AY7A 3F1KA 1KVTA 2C7GA 2DPGA 2Q2QA 5CPBA 2UV8A 3OBBA 2QIOA 3WYCA 4R5MA 3I52A 4QO8A 1FDSA 2HQ1A 1LUAA 2NU9A 3RUFA 4MVJE 1PZHA 4R1SA 4W6ZA 3PLRA 3QA9A 4J0EA 3TFQA 2J5QA 4YWJA 1PU2A 3GPDG 1LNQA 1NXQA 3RJ5A 1EFLA 2LDBA 1U5CA 3PGXA 1ZJZA 4BNUA 1SPXA 4D43A 1ZCJA 2O4UX 3DZJA 1MXFA 5JDCC 7MDHA 2O7SA 2C29D 3DMTC 4J90A 4NQZA 3PVZA 1IZ9A 4J7XA 2DFVA 1HDGO 3D7LA 1O89A 3LVFO 1ZW1A 3GOHA 4BGVA 1E3JA 1IZ0A 3EZYA 1T24A 3K96A 4ZU3A 1E3SA 1EE2A 1QP8A 1PJQA 1GQ2A 3H8VA 3O4RA 4EDFA 3O26A 4W82A 1DLJA 4MDHA 4ILKA 3SXPA 4E21A 2JD0A 2OL4A 3DHNA 4FJ1A 3GPIA 3NRCA 5COBA 1MLDA 2IYOA 3W8DA 1EVIA 1JU9A 1EUZA 1VKNA 3PJGA 2W8ZA 1JKIA 4HFNA 4YAJA 1I3KA 1SZJG 3ZWBA 2HLPA 1SBYA 2ZYAA 4PG4A 1KC1A 4CPDA 3MCVA 4YRBA 3KHUA 2RCYA 4E2YA 4O63O 4W99A 1IHYA 3BTSA 2ZYDA 3FTPA 2IYPA 4URFA 4WE3A 4IXTA 3WQSB 4E5KA 4D0SA 1JVBA 2EGHA 1U28A 4GLLA 5ER9A 2NWQA 3PWKA 4CUKA 1AGNA 3ASVA 3F5SA 1PQUA 4I5DA 4MIYA 4W4TA 3G17A 3QP9A 5JDIC 3DZKA 3NGLA 2QYSA 1XQ1A 4PLHA 1GYRA 1SMKA 3WR5A 5CAEA 1GV1A 1ZXLA 2Z5LA 1JW9B 3R3JA 1PGNA 3WXBA 1LBEA 4KUGA 5CFZA 2DTDA 3BHMA 4RORA 4D45A 3DTTA 4DMMA 1X15A 1SOVA 2JHGA 3Q9NA 2JJYA 4TKLA 1QYCA 2IEDA 3VZRA 3ST7A 2Y1OA 3X2FA 3DFZA 1TXGA 4ZQEA 1UAGA 3BXXA 1MXHA 1LC0A 2H9IA 4WLNA 5I7SA 1PEDA 5K9ZA 3C85A 3FNEA 2RH4A 3V2UA 4RF4A 4GAEA 1WMAA 1WXDA 3NDIA 5EIOA 3V1YA 2GZ3A 1PZGA 4WCFC 1NTOA 4HX5A 5DCWA 1WDMA 1Y8RB 3UHAA 3HQ4O 2V6BA 4XYBA 3ANMA 2BELA 4PG7A 3AM3A 1GADO 5AYVA 4BO4A 1UH5A 4F45A 4J43A 2X4GA 4RF3A 1ZEJA 4UVIA 3ZHZA 2BMAA 2H63A 1DIGA 1E6EA 2X9VA 4LN1A 2Y1FA 1T2FA 2HJRA 5B37A 3MOIA 1H9BA 5T5QA 1LLQA 1TA4A 4GX0A 5A9TA 2ZJ0A 1BGVA 1YVEI 1XKQA 3KBOA 2P4HX 3VAZA 3VVCA 3WMXA 1FDVA 2I3GA 4DLAA 3AOEA 4IBOA 1WVGA 1P77A 1R15A 3Q1LA 1H6BA 3KLPX 4J49A 3LT0A 3MJEA 4J2OA 1IY8A 1E7SA 2Z95A 2GN9A 2JHFA 4BKPA 3WICA 2C2XA 4J91A 4DXHA 2C59A 3JQ7B 1TLTA 4D7AA 1K5HA 4MVJH 1VM6A 5ADHA 2C7VA 1O6ZA 4Q39A 3DTYA 4XQ9A 2JFGA 1U5AA 4JK3A 1DFIA 3VH2A 2OP1A 3LDHA 2HU2A 1D7OA 2X8LA 3ZU3A 3GEMA 4WNIA 3MWEB 2ET6A 1AXEA 4JX8A 3VHRA 1PZFA 1A5ZA 1O95A 3OIFA 2DU8A 2X1HA 2I76A 1UDAA 1ZBQA 3HB5X 4NBUA 4GH5A 3C1TA 4MVJA 5G0SA 5IDWA 4YRDA 4Q3BA 3A06A 1GAEO 1U9JA 4F6CA 3F4LA 1PWZA 4PRLA 3HN2A 3OIDA 4YXFA 1R0LA 1TT7A 2YHUA 1DRWA 1Z74A 3WOHA 3H6KA 4XGKA 2B0JA 4N5LA 2WTBA 4LRSB 4IZHA 1MG5A 5G0UA 3V5NA 5KJCA 3GVHA 2IZ1A 3R1IA 1B0AA 3U0BA 1DC6A 2P9GA 3QW2A 1KEPA 3C7DB 1P44A 2DUWA 4OOEA 3JQGB 3HZZA 1WNTA 4DUPA 1ONOA 4O1MA 3I4CA 4Z9FA 3RKRA 1H9AA 3AWDA 2I5PO 3GQVA 4I08A 3KYCB 5ICMA 4MP3A 3B1FA 3ENKA 1O0SA 3GHYA 3EZLA 1LSUA 4WEQA 1J0XO 4NFHA 2E6UX 4NK5A 4H7PA 2EGGA 2BHLA 5KVQA 1ZK2A 1B8VA 3JQFC 4JP3A 4J9UE 4FFNA 2JAHA 4W7HA 4JJIA 1ONPA 4IDDA 2BGKA 1YXMA 3IKVA 3JYQA 1Y7TA 3CMCO 3EW7A 1Z7EA 2XXJA 4DPLA 4DQXA 3OSUA 4GL4A 1BXZA 2I65A 4UULA 4AJOA 3R3SA 2X9NA 4UUPA 3P7MA 1EBFA 3B6ZA 1ULSA 1MUUA 3P19A 1PJLA 4UVGA 3JQBC 4BHTA 2EWMA 2NU7A 4FBGA 4YJFA 4J3FA 5T57A 3JQCA 1PL8A 1QXSA 2AQIA 1X7GA 3VH3A 3LC1O 1MC4A 9LDTA 1H2HA 5JLAA 4O6VA 4OJNA 1T1SA 5L40A 2RHCA 2VUTA 1MFPA 3NX4A 5ILGA 2C07A 1B7GO 2ZB7A 2GZ2A 1HKUA 4W9NC 2POQX 2X9GA 1E3WB 3KTDA 4WLEA 2EEZA 1Q2XA 4AVYA 4CQLB 5I7FA 1GUZA 5KOIA 3OEWA 4DVJA 1H6DA 3GG2A 3HHPA 2PZMA 4N18A 3UVEA 2WM3A 4IINA 4B4VA 2Y05A 3G1TA 2XXBA 2O23A 1JKFA 4GWKA 2AQHA 2O2SA 1ENPA 1N92A 3G49A 3WIEA 3NDRA 4CL3A 3RUDA 2WE7A 3WFJA 1U4SA 1JTVA 5A06A 2ZTVA 3P2YA 3PFWO 3RUHA 2NTNA 4KUHA 4NZ9A 1ISJA 1ADBA 1JA9A 4JJGA 5L4LA 2Z1MA 3KYBA 1RM5A 3L9XA 3ULKA 1U2GA 2G82A 4R3WA 4GI2A 2BGLA 4AFNA 3RWBA 2Z1NA 4L75A 3U4CA 2DM6A 3PTZA 2E82A 3E03A 3WLEA 1CQIA 3DAFA 2Q99A 1CEQA 4MIOA 1IHXA 5HRUA 4YCAA 5EN4A 4WCFB 4JLWA 3RFTA 4R51A 3ZHXA 1O8CA 3O38A 1ZFNA 2D1YA 2Q3EA 3QVWA 3WJAA 2YYYA 2HK7A 3H3JA 5DDIP 3U9LA 3TZ6A 4CR7A 5A9SA 4AL4A 5L51A 5TC4A 4BV9A 4M49A 4KQXA 1DC4A 1I5RA 4IJVA 4TKMA 2PWZA 2PGDA 1DJNA 1LA2A 1XWFA 3ROMA 5CDGA 4XR9A 3FNGA 5T67A 1XHLA 1PGJA 2NTVA 3GLQA 4P22A 2ILTA 3H4VA 2OHXA 2VTEA 4A73A 4YQZA 2NLOA 4CMCA 4E12A 4GPD1 1YB5A 5KVCA 1C0LA 5KJ6A 1EVJA 1HRDA 1BTOA 5C7IO 4MO2A 2ZB3A 3K2EA 3ZV5A 1OC4A 4XEHA 3HDJA 4PIVA 4U0JA 1E5QA 4ND4A 5TNXA 3RASA 3P5SA 5BSEA 2HMSA 4CR6A 1E7WA 4FFLA 2P5YA 1P45A 2YZ7A 1NFRA 2H1SA 3NT4A 4GX5A 4JROA 3MJVA 2BFAA 3VKVA 3OJEA 1J49A 1P3DA 3DBHA 5THKA 1OI7A 1K0UA 3P2OA 5TGDA 3GNSA 2UYYA 1PGPA 2EP5A 2HDHA 1CDOA 2PZKA 2B5WA 2X5KO 1KVUA 1PR3A 3D4PA 1B8PA 4N54A 4MVJI 4R54A 3KB6A 4ROSA 2G5CA 5U1PA 1WP4A 3GG9A 3LT4A 2NVWA 1QG6A 4MJLA 2FZWA 3UICA 3NDJA 4RDIA 5BNFA 1NPTO 4A27A 1LX6A 3PDUA 2BI8A 2DC1A 3GK3A 4MVJG 5I7VA 3IDSA 2V6GA 4KTVE 5FF9A 2BI7A 1BVRA 4E4YA 4KDEA 3JQ9C 4AJKA 4RZIA 2EXXA 1ADCA 4IJUA 4XDZA 5FI5A 4BB5A 3NV9A 1UXJA 1DEHA 3C7CB 1VJ0A 3OM9A 1LSSA 5JAZA 4BKRA 4OAQA 4BNFA 4LW8A 5COQA 3O03A 5G4LA 2IE0A 4FFMA 3PIDA 3DEYX 4CMIB 1H6AA 3CSDA 3KOUA 4E5NA 4UVHA 3MJCA 2PKRA 4LRTB 4NHEA 2FMUA 2JKVA 1JLLA 1Q0QA 3I83A 1Y8QB 3EC7A 2A35A 4B79A 2O4CA 4JGBA 1ID1A 2B83A 2P91A 4AICA 4Y6SA 1DFHA 2BFMA 3EVTA 4GMGA 3I5MA 3B1KA 2WSBA 2VYVD 3S2EA 3X2EA 3E48A 4J0FA 4EYEA 1JN0A 3TNLA 2JCXA 4E6PA 4QUKA 3LK7A 2VHVA 4CM8B 1OFGA 2CMDA 3FBTA 3W8EA 2PD4A 5GZ3A 5F1KA 2EG9A 3JD3A 4L8VA 1CIVA 1YE3A 4TWRA 4GQAA 3NEPX 4BNLA 3AI3A 2ZK7A 1N1GA 2OBYA 2QW8A 3HDQA 1ISHA 4NJMB 1UXIA 4S1VA 2W2LA 3L4BA 3JQ8A 4E5MA 1GZ3A 1ZMTA 4DTIA 1VJ1A 3OEYA 5JDIA 4RPHA 4PGFA 1DHTA 2PKQP 4CUJA 5DOZA 1LU9A 3DONA 4P4LA 4J1NA 2HRBA 5B12A 3IJRA 4ZGWA 2IEBA 2YFQA 4XB2A 4CLDA 4EUFA 4YAIA 3AU8A 4OYRA 4R3NA 3TOXA 5EMHA 1EDZA 2A4KA 4FGSA 5BT9A 2OP0A 4U6QA 1GQYA 5A5EA 1LLCA 2CY0A 1PSDA 3DMTA 2I67A 1U8FO 1X13A 2ZKLA 1HYEA 1CRWG 5DULA 3ROQA 4BKQA 4NR0A 1VL8A 4Q3NA 5IDYA 4RVSA 3KETA 5FYDA 4ALNA 4E5PA 3Q2IA 4RV9A 5BSFA 2E49A 1VSUA 5JBIA 1HDOA 5EERA 1W4ZA 1TT5A 4DC1A 2DUUA 2Y68A 3EY4A 3TRIA 3TL3A 3QWIA 1G0OA 4Y9DA 2O3JA 1F0YA 1V35A 4YJGA 4TZTA 1XQ6A 2PD3A 1QV6A 4A5OA 5AXDA 5JSFA 4PZCA 1YQDA 3L4SO 2GR9A 3GFBA 1ZNQO 2Y1DA 3W4IA 1HDYA 4BL5A 5I9NA 2EERA 2IODA 1UJMA 3R0IA 1EMDA 1SCUA 1MG0A 2HK8A 4J7UA 3AFNA 4CV2A 3WGIA 1MX3A 1LDYA 1ZK4A 2Y1GA 4MKXA 1E6WA 3UCXA 3U4IA 3F9IA 1I3NA 1Y5MA 3QY9A 5LC1A 4CMJA 1BVUA 4B3JA 3KEQA 3SVTA 3HADA 2WMDA 2VWQA 3BHJA 1SB8A 2O48X 3ZDFA 1W6UA 2QHXA 2PV7A 2QRLA 1KVRA 1X7HA 4GSLA 2QRKA 3I3OA 3HFGA 5JXWA 3H5NA 1T2CA 3H5AA 1FF9A 4JXKA 3T4XA 4ALIA 5JYDA 2VNSA 5JO0A 1V6AA 5U4QA 3S8MA 3I9JA 3B1JA 2EIHA 1GPJA 1B3BA 3N7UA 1JWAB 1NR1A 1YB4A 2D0IA 1IULA 3ZI0A 4FFPA 3VZPA 5AQ1A 3HWRA 4WCFA 4BNZA 5JY1A 3OF2A 3ZZNA 3PHHA 4HFJA 2GN4A 3WB9A 4BMNA 1KBZA 1NBOA 2GF2A 3I9NA 2D5CA 3KZVA 5TQVA 4ESOA 2F00A 4J1TA 1YB1A 2C0CA 3B70A 2FPPA 1P9LA 1HXHA 4ND5A 4PZEA 4UREA 4XR4A 3U62A 4PFJA 2XOXA 1LQUA 3GZNB 5GZ1A 3PWSA 1J4AA 5I9MA 2GDZA 1IOLA 5JYEA 5FEUA 3KSUA 3PYLA 1V3VA 4O59O 3S1LA 1K3TA 1LDMA 2X86A 3IJPA 5JNLA 1B16A 1AXGA 2OFPA 1YGYA 3QHAA 4RPGA 3TF5A 3BTVA 3DC2A 3FWNA 3VZSA 4PLVA 3IL2A 1LRKA 2AXQA 1PIWA 3DBRA 4LMPA 1C0IA 3AFMA 2E4AA 1S7CA 5CEFA 3CH6A 2TMGA 3AK4A 2AW5A 1DJQA 3BMOA 4PVDA 3JYOA 5F1PA 1E1KA 3TZQA 3FBGA 1J5PA 4FW8A 1PJ2A 4PN3A 4A26A 3NJ4A 3NGXA 2HJSA 2NNLD 4J16A 4M86A 5DP2A 3WQQA 5L7TA 3CKYA 2VHZA 1DDOA 1I01A 1R4MB 2CF5A 4B8WA 4IS3A 3GEDA 1GV0A 2TMDA 2P9EA 1GU7A 4YYZA 1MC5A 3ZV4A 3RC1A 4B4UA 4FJ0A 4MP6A 2NTJA 4D46A 3DBLA 4YVFA 2QZ9A 2ZCUA 3SJ7A 5JPIA 1PS0A 3EVNA 1RM4A 2UUOA 4TMFA 1CERA 5J23A 3HUDA 4ZRMA 3LC2O 3OH8A 4HWKA 1A71A 2BFPA 2GUGA 1FDUA 4JIGA 5F5LA 2DT5A 3CUKA 3JQ6A 1Z45A 4E5YA 1ONNA 4R9SA 4QX6A 1YS4A 5DF1A 4I8XA 3M1LA 4P4NA 4KQWA 1W0CA 2YY7A 2RIRA 3GZ4A 4UEOA 2X0RA 5JFOA 1EUDA 3RBXA 5IN5A 3GEGA 2PFGA 4J4HA 1ENZA 2EF1A 3GT0A 3AOGA 3Q9UA 2GYYA 2A94A 4E0BA 1ENOA 3RC2A 4CL8A 1BRMA 3EAGA 2CDAA 2A92A 1R0SA 2YHIB 1WDKA 3PK0A 3FR7A 4DYVA 2B36A 5TS3A 3AM4A 7ADHA 4ZQHA 4KUEA 4PG8A 3CINA 1B26A 4IDAA 3I9KA 3SC4A 4HBGA 1OBFO 4ALMA 3GVXA 4QQRA 1G0NA 4R1TA 5KKCA 2PGLA 2AQ8A 2HMWA 5HBRA 4FD3A 1WZEA 4OGWA 4UUOA 3L6DA 4Z0TA 4AJJA 4D79A 3H2SA 4YJGB 5FWNA 1HLDA 3WIDA 2W2KA 1UDBA 4GVLA 4BKUA 4C7KA 4C7JA 3A28A 4CM9D 5L4NA 1JKJA 2FN7A 1HE5A 3UFXA 2Q4BA 4GLOA 4I5GA 5CEEA 1EFKA 3JQBA 3OQBA 5MDHA 4F46A 1FJHA 4G5HA 4FQ8A 1HDZA 3ZV3A 2NQ8A 4ZQBA 1GYPA 3NKLA 4FIZA 2PKQO 3I9MA 1WDLA 3AI1A 4Q3EA 4BO8A 1NM5A 2HMTA 2NU6A 2PR2A 1D3AA 4TRJA 4GGOA 5GY7A 1B15A 3PIIA 4J2HA 5JDCA 4K26A 1AN9A 4MINA 4XD2A 4XJSA 1WZIA 3LYLA 2J3IA 2O7QA 1UXHA 3QE3A 4BVAA 5TJ9A 5JW6A 3K6JA 1NP3A 3WTBA 3DWFA 4CQMB 3H9QA 3VKUA 3AUAA 2FWMX 1XR3A 2J3JA 3V2HA 2YDYA 1PGQA 5TJHA 3N58A 4KTTE 5KNLA 4XGNA 1PJTA 3DZHA 1XA0A 5JO9A 4J1QA 4K9DA 2EHDA 1ISMA 3M2TA 4WGGA 5T8KC 2GGSA 3T7CA 1D1SA 1SNYA 1GTMA 2WYUA 4OKNA 3W4JA 4II3A 1PZEA 3VH1A 1DRUA 4B7UA 4M87A 5A02A 1DSSG 2NM0A 4L76A 4XZ3A 2Y99A 2GLXA 1BWSA 1Q7BA 1HF3A 3QV1A 1T2DA 3NUGA 2HSDA 4CMBA 2H6EA 1U3WA 1MGOA 3BTUA 3K8ZA 3ZWNA 1I0ZA 1HETA 4FDAA 4FFOA 4WLFA 4Y6PA 1P1FA 2NUAA 4DIBA 4IDBA 3OIGA 2YFHA 4ZJUA 1IYZA 2PK3A 3E9QA 5CDTA 2DKNA 1YRLA 3O8QB 2VCYA 3SLGA 1TI7A 4IGFA 3NT2A 1F14A 1QLJA 2OUIA 1DXYA 4OXNA 3GY0A 4AJ4A 4XJTA 2AHRA 1P1KA 4L74A 3AUSA 2ZB4A 3FF4A 4IXWA 3H9UA 1M6WA 5JMPA 3AJRA 3PJFA 4CV1A 5HWSA 1R4MA 4GBJA 2JFHA 3PJEA 1F8GA 1D4FA 1V8BA 4CM9A 1VJTA 5AXBA 3PHLA 4RO0A 1ML3A 1EUCA 2PH3A 1JAYA 2VWGA 2X6TA 4PZDA 1LLDA 4DQUA 4HADA 2IDZA 2GASA 3JV7A 3MEQA 4GX1A 3QJ5A 4LMRA 5A9RA 2OOSA 2BKAA 4I9UA 1YQGA 2CSUA 1LJ8A 1E6UA 3PEFA 4Z3DA 2LDXA 3G79A 3ICPA 1YDEA 1RWBA 5DBFA 3HDYA 1HSZA 4PLGA 3ZWCA 1A7AA 3ZW8A 4CLOB 1R12A 3Q3CA 3D4OA 1X0XA 1YO6A 1H94A 3IUSA 2O50A 1NQOA 2WJPA 5COAA 3WWZA 5JS6A 3ROPA 3TJRA 3UAGA 3KVOA 5A3VA 3C8MA 3UCEA 3D1LA 3FTNA 1O94A 3I23A 3VPHA 5H81A 4I5FA 1N2SA 4XQGA 4RLHA 1HZJA 4HY3A 1YKFA 1E3IA 3FR8A 2VUSA 4WLOA 3ONEA 2V6MA 4D3DA 5ENDA 3RCBA 4BUCA 3ABIA 5L3ZA 3AU9A 3JQGA 3DL2A 3L4BC 3IQDB 2HK9A 4YRAA 4LVUA 1LQTA 3COSA 3S2IA 3VH4A 3W8FA 1E7RA 3JSAA 3M2PA 4M54A 1FXSA 2Q49A 3H9EO 4NBVA 4CODB 4FS3A 3ENNA 1KETA 4CMAA 1DIAA 1NR7A 1IL0A 2V7PA 5IZCC 1C14A 1NVMB 1GR0A 5TIIA 4AJLA 3EMKA 4OOFA 5AXCA 3SC6A 3NT5A 3RVDA 1IPEA 3ZWOA 5L9AA 3E8XA 1TB4A 4DWVA 4EGFA 4DIFA 2GPTA 3GC6A 1AUPA 2YDXA 3ITDA 4YDRA 5DCUA 3RKUA 1UP6A 3QVXA 4CM1A 4CMEC 3MJ4A 4RLSA 4CR8A 1X1TA 1FK8A 1BW9B 5TT1A 3F47A 3F3SA 3WSWA 4BO1A 1VLLA 1LC3A 4ZD6A 4GMFA 3PHJA 1XEAA 4TVBA 5G0WA 1AE1A 2YV2A 4CQMA 2FPGA 1XG5A 1UXGA 1LRLA 2VHWA 3ANLA 4NIMA 1YDWA 4MOWA 5F21A 3WGGA 1OC2A 1ULUA 3W6UA 5I8ZA 1A9YA 2C54A 4Z0HO 3E5RA 4QFDA 1GUFA 4DLBA 9LDBA 4GKVA 4BGUA 1U1IA 4O0LA 3GN1A 4F3YA 5HS4A 1CJCA 4LK3A 3DQPA 3WNQA 4Y6RA 1R4NB 1O5IA 1BXKA 2AMFA 3RJ9A 4CMGA 4HP8A 2DBVO 1ZSNA 4WUVA 2VHYA 3I9OA 2W2LD 4J4TA 2QG4A 5IDQA 5DT9A 2G76A 3DR3A 2OORA 2VRCA 4BO2A 3GGPA 4PLFA 1IUKA 1WMBA 3D3WA 4BB6A 2HMUA 1G1AA 2Y66A 3OJ0A 3WWYA 1K6XA 3AW9A 3ZU5A 4WNCA 2AG5A 4WJZA 1I30A 3EGOA 3KSDO 3OJOA 4IS2A 1VL6A 5JAQA 1I2BA 4WASA 2J5RA 4M8SA 1P1IA 3QVOA 3GR6A 5I8WA 3DBVO 2UAGA 3GMDA 3W4KA 3VVBA 3LF1A 4OQYA 1P1JA 4II2A 2AA3A 2VZ0A 3ZWWA 1QORA 2C20A 2OO5A 4TRNA 4BO6A 4AJNA 1E1NA 1FMCA 1ZK3A 2HO5A 1Y9AA 3WFIA 5C5IA 1PS9A 2I6TA 1I10A 3TZCA 2VRBA 4D44A 4RCVA 2YQ4A 1U3VA 3GVIA 1F06A 2Y93A 1B8UA 1TEHA 5T64A 2B37A 3BZUA 4XRRA 2Y0EA 4WECA 1F17A 2E37A 3ADOA 1QYXA 3AY3A 4DPMA 2FP4A 4E2WA 2OXIA 1M66A 2IZ0A 3BMNA 5G4KB 3H5RA 1QYDA 3UGKA 3CMMA 3QRWA 4YJFB 3ZWYA 4BMVA 3NTQA 5H83A 3IP3A 4BNHA 1DIRA 1UUFA 3MJTA 4CQMD 1HDCA 1AHHA 4UEKA 2GNAA 1Z73A 4CLRA 4S3MA 4BNGA 4BKOA 1UR5A 3MWDB 1R37A 3AM5A 3I4FA 1GZ4A 1H93A 1KS9A 3CTMA 4FJ2A 3GHHA 4LVCA 1E3WA 4R41A 5CEJA 4JQCA 1HE2A 3IOYA 1P1RA 1UDCA 3D4NA 5ER6A 1M76A 2BFOA 1H0KA 1ZMOA 3A1NA 4BIIA 4KOAA 4RQUA 2IXAA 1IPFA 1BDBA 4EI2A 4CM6A 4OMUA 3JD4A 1P31A 3TSCA 3WSVA 3ZU4A 4IM7A 4BNYA 5ILOA 1WW8A 1Q0LA 5TF4A 4CM7A 2Q1SA 3PP8A 3ORFA 1PX0A 3K30A 1NVGA 1VC2A 4BNNA 2YQ5A 3DFUA 1DIBA 1DBVO
chains in the Genus database with same CATH superfamily
1PL0A 1JEOA 3S4YA 4KGXA 3BK1A 3T4PA 4JOSA 1Y89A 3F5QA 2O07A 3G2NA 5EJEA 4R8SA 3SM3A 5ENZA 1BD3A 1TMGE 1Y6JA 4RGBA 4HTAA 5LOVA 3QUQA 4O02B 1FMFA 3TW4A 1XC7A 3G3EA 2CVFA 1QAMA 1DUIA 2V6JA 1TEVA 3NU1A 3R77A 4X97A 1Z0FA 4WXMA 4G84A 3W2HA 1X3SA 3F8WA 1GNVA 1LKZA 1RXCA 2WUDA 1SQFA 4R2MA 4V03A 4YYEA 4CMIA 1L7AA 2PIDA 3TWOA 4BEVA 4E31A 3T0IA 5CPFA 4LYJA 1QE3A 3MMPA 4B76A 3MS7A 1V1RA 1Z13A 1E7YA 4KPYA 2R7MA 1YT5A 4FXPA 5K0ZA 2OMEA 1UJ6A 2EQBA 2BH2A 1TEZA 1H5UA 5AK4A 1H05A 2EGUA 2CL6X 1R88A 3TFWA 3OSZA 4F5EA 1VMIA 2B4AA 1OZHA 1SIOA 3FPAA 5FJIA 1NE2A 3R7NA 3SX2A 3VR1A 1F2TA 1STOA 3I76A 1O03A 1PT7A 1QZZA 4XE5A 1TYAE 3EB9A 1WIWA 1ZDMA 1MPTA 2YUIA 3CVUA 3WMWA 4X00A 2ZLBA 1E0DA 5LBUA 5LYYA 1X7YA 3U09A 3QWAA 3THYB 3UXYA 3IOCA 2FXVA 4QXOA 4C0JA 3A10A 4ARIA 3IAM1 5JC1A 5A4JA 2J3DA 2ZVPX 2D3TA 1ZNZA 4OHFA 3SJUA 2JIRA 3WO1A 1BEEA 5KS2A 1K6JA 1XP5A 3LGAA 3RANA 4JQYA 3GLGB 5AI5A 3NM6B 4V2IA 1I3CA 1YACA 4L72A 4I1PA 5LU8A 3R0QA 4KRFA 4KNYA 4FYWA 4QT0A 1GPLA 3TD9A 5KKAA 2ZWOA 2YTZA 3WX0A 2JIZD 4R0NA 3COJA 1DO8A 5F2NA 5KSWB 2E4YA 2QN1A 3H5VA 1LXCA 1SBHA 3ONDA 4C2BA 4LGVA 3EF3A 4MULA 1Q16A 1NBHA 2HIGA 4HO1X 4QYXA 3C2QA 2J9YB 1C7FA 1GFIA 2WIDA 3CF4G 1BX0A 1W52X 2GPSA 1M2HA 4GQIA 4KWHA 1YL5A 3EJ6A 4RGQA 4URWR 3TBHA 3WLHA 4XIYA 2IIVA 2F3UA 1MR3F 2RJ3A 2WYWA 1X9HA 3VYVA 3GUVA 4TV9B 3REQB 1Q0HA 2OHJA 3G9QA 4YCDA 5AKXA 3T3GA 2FMIA 4EBFA 2AEMA 3D5QA 3HFSA 1S4MA 4NCXA 1YA4A 3S1AB 1XZMA 1KJIA 4Q47A 3WYEA 5CFLA 1LDBA 1XSEA 2EL9A 2O8VA 3GLHA 3U3OA 2QE7D 3W1VA 3O4IA 4D4LA 4QT4A 5J47A 4G0ZA 4B4OA 3ZZMA 1T91A 1L3CA 2P3SA 3KAKA 4L51A 2QVGA 4GUAA 5IABA 1BDHA 3NYQA 4BFYA 1XVLA 4NJEA 2H5EA 3WNCA 4MMYB 2O8FB 2IUUA 4AN1A 1W73A 3GRPA 4PCLA 1WF6A 3GZJA 4N5HX 4NPCA 4YPOA 2HRZA 1KK2A 3C1UA 3N07A 4J7AA 1HTWA 4ZALA 4ZC8A 3RLIA 2Y8EA 3QFSA 1CEYA 3CNNA 4MCAA 3GA5A 5EQTA 2I4TA 4FR0A 4PBRA 4HTFA 6ADHA 3FIJA 1MB9A 4HJRA 4CGYA 2C98A 2FHPA 2YC2C 2PBRA 1N6PA 3PQ7A 4IQFA 4M4SA 3O8LA 5JTUA 1PTJA 4AUEA 2JJQA 1EGMB 3HJAA 5C3MA 1U2QA 1L5KA 3IVXA 2QX8A 3WGQA 3D5TA 4ND6A 4EPRA 4KIJA 2V0GA 1L7DA 5CA0A 3GLUA 2YNMD 3SS9X 1UXKA 2O20A 3E5MA 1O97C 3VJKA 2GEBA 3OCXA 4ND2A 1JS1X 3T1NA 1PL6A 2XTNA 4IVNA 3ZTWA 4DQKA 1OXTA 5JD6A 4X41A 1TZMA 4EW6A 4FHEA 5CVJA 4Z6KA 4NXMB 4A6EA 4I66A 5FADA 2B7CA 2BY4A 3S27A 2OEPA 4J0QA 2XDQB 3IE1A 3HJFA 3HJCA 4TSRA 1U8TA 1QH9A 3P5BA 1E1RD 2FPMA 1ZD9A 4EJ6A 4BMSA 2NXWA 4LHEA 1Q0TA 4B8ZA 3KEOA 5KIAA 1LFAA 3MTGA 2E0IA 2X8BA 3OD1A 5I48A 4Q9LA 1JVNA 3GV0A 2PZAA 3CUEF 1NPDA 1R0BA 4NOJA 4REMA 3LFTA 4OXYA 5K3FB 3VC3A 3VNAA 2N3ZA 4BNJA 3LPCA 4ECEA 2EP7A 4FFWA 4CKZA 2E9SA 3QPCA 2IXTA 1TCVA 5JQGB 3I8OA 3ONWA 2Q4RA 4RGYA 4E2FA 3AR9A 5JOQA 4DV3B 1ZRHA 3MWYW 3CKLA 3E2PA 5E38A 4Z99A 1M34E 3DMYA 1V8OA 2C95A 4YRGA 3GMIA 1MAWA 2ZBRA 3AY6A 2DAPA 4A0HA 1OV4A 3LP8A 2WTAA 3G02A 1C9EA 1TIBA 3Q0TA 2VDVE 4XAQA 4CNBA 2XR1A 2V59A 1GPH1 3UT5B 3GCDA 5DM2A 3DBOB 2REQA 3B5EA 3CLTC 4H1WA 4QDJA 5CG2A 1RM3A 3GA0A 2IS4A 1H6CA 1J99A 1S8NA 4ALLA 3G2OA 3EYWA 1KTIA 4JLKA 3WDKA 4X9XA 4O08A 4ZQGA 2FR0A 3QVKA 2QLJA 1XCLA 2ENUA 4L22A 4ZVRA 2Y6UA 1E1MA 4GM4A 2XEDA 3R5XA 1HTTA 1YDMA 5C3UA 1U8AA 1UCFA 1VLVA 4UAGA 1E7QA 2CDBA 2GSDA 2BDUA 1GRNA 1OZFA 2WUWE 3QOYA 3L77A 1G2PA 1YJQA 3WS7A 2PUFA 3DEJA 3LG2A 4B7CA 1XA3A 3SF0A 3VPFA 1RQRA 1UF9A 2J59A 3IA2A 3T3PB 4DLVA 3ND8A 4GPZA 5HUHA 4WKCA 3SQXA 3RPEA 2LP4Y 4WKPA 2WSMA 4OBXA 2R8BA 1YJCA 1WO8A 1WUTA 3R5TA 3GW8A 4ITRC 2FEKA 4A7PA 4AJHA 4O5OA 2ACVA 2ZTLA 3E1SA 1NLFA 1BYUA 1IIRA 1RJ9A 2Q4EA 3E9RA 4DNXA 1F6DA 5FOSA 3ORRA 4YXWA 3ESYA 4I1SA 3QU7A 3KJGA 2O3TA 4PRKA 1DE0A 2R6GA 721PA 4I55B 1JH8A 3SIPA 1FFGA 3MAJA 3R74A 5IS2A 3KEMA 1Z8FA 3ND5A 1F5NA 2V74B 4D99A 2F1IA 1D1QA 4M1EA 4JP2A 1QQ7A 1V8PA 2MINB 1R8YA 4R9RA 2GKGA 3JQEA 3LOQA 4I46A 1L5HB 3IAHA 4J0GA 4XD7D 2Z43A 3QVSA 4D6PA 1U81A 5BRNA 4RTJA 2RHTA 4KVAA 3RYFB 3Q1KA 2O8BB 4F3RA 2HWYA 1YQQA 2VLBA 2Y1EA 4M0CA 3GZNA 4S2EA 4X91A 1XRLA 5B7PA 1Z4IA 1V6SA 1R66A 3PRKE 5DYNA 4YWHA 1E2UA 2J6IA 4AQDA 4F9TA 2YMQA 2AZ4A 2D0DA 1RCUA 3P9RA 3HR7A 3T5BA 3X1ZA 2GCGA 3OOJA 2WILA 2W98A 5IWCA 3K31A 4HLDA 4RAQA 1E5XA 3AIMA 2FWNA 2BGTA 2VNKA 3BMQB 3H04A 1EQ2A 3TL2A 5JAMA 2P3LA 1JR3E 2XMRA 3E1GA 5L4SA 4XDHA 3RABA 4RA6B 3EC2A 4D41A 1N8TA 3EXG1 1KIAA 1EGAA 3FDJA 3DYBA 5D5PA 3QEJA 1UEJA 4M88A 1V3TA 2OQRA 2FW1A 2ZIFA 4MKRA 1Z28A 2P40A 2QX6A 3M6IA 4PBTA 4RENA 1XCOA 1JQLB 4Q48A 3HV2A 1PGOA 3WLRA 4XYLA 2FUG6 3KYCA 1YQ9A 2ZQ5A 4XWTA 3KBBA 4XYGA 3SF8A 5LLDA 2UYCA 3LKDA 2JD1A 3NJRA 1C1DA 1NMYA 5B3KA 1N1MA 4WD3A 5AH0A 1J09A 4I99A 4NE2A 4XWYA 5E3JA 1RHRA 4LBWA 3OJCA 4PNEA 4YAEA 2H4WA 3I0ZA 5K5EA 4DL9A 1F0PA 4IRXA 4EY5A 3BHIA 2D6FA 5DNVA 5JYEA 2IS1A 2IFTA 1QGUB 3O4JA 2GN8A 4UUBA 1PK8A 3HSKA 2GCOA 4UE2A 4WN9B 1AY0A 1G4AE 4GP6A 4MQUA 4EFDA 2EZUA 2ZI7A 3ZDQA 1XDSA 3DT6A 3WMRA 3ZUPA 4Y6GB 1Z9BA 1JHMA 2HU5A 2W8BB 1T4CA 4D81A 3ZCSA 2C1EA 3I0MA 5BO5A 1ZVKA 3ZCTA 1FVHA 3TQOA 4ALKA 1ZM4A 3MTIA 1MQAA 1MABB 1YL6A 4LJLA 3SSAA 4ZCMA 2R6JA 3PWZA 1P9RA 3PDIB 4GKBA 4KSBA 4OSOA 2XY4A 4P7KA 2JFPA 4RPJA 5AVOA 3UN1A 3BCRA 2QZZA 4IHKA 2I2XB 3HB4X 4OXRA 1G63A 2AHOA 4K6FA 1MA0A 4X65B 4KPUB 2VAPA 1N7HA 1R8JA 1SQGA 3LWZA 5SZHB 1P4RA 1SN7A 1XHFA 1WCWA 4NNJA 4TMXA 3W7AA 4CKWB 4PTLA 4F56A 1AQ6A 1IHPA 3DWIA 3AVYA 1A8HA 3ZV6A 5IARA 4P58A 5C4IA 1E1CB 1YGPA 2PJDA 4N0QA 3X1XA 3EDMA 3E05A 3IPRA 4UMVA 1EFAA 2KBFA 3ZW7A 4BDTA 4S12A 3DZDA 5LD2B 4HDSA 3GT4A 3ZJ5A 1JXAA 3ADDA 1HK7A 1KO7A 1NI3A 1V7CA 3FSRA 4ETIA 1BG6A 4TTRA 1MFZA 1EM6A 2PZJA 2QMEA 3QQPA 4R98A 4Y7CA 3SXUA 5CB0A 5LWQA 4UDNA 2GPJA 2X1VA 3BQNB 2KPOA 5BQOA 4RYLA 2XE6A 3R6WA 4KIFA 4MQ5A 5IM5A 1NVEA 2ATCA 3JQAD 3GEEA 3UUWA 1IN6A 4P80A 4AF8A 3SC3A 3TDKA 4CF5A 1PKXA 3SMVA 4RIHA 3MG9A 4FC6A 2NAPA 3D4IA 3DE7X 1TLFA 4OL0A 4DIOA 1JJBA 2VAVA 1Q74A 4JVMA 1GY8A 4HXEB 3PNMA 4OGFA 3EXIA 4AZ0A 4HJXA 4Y2VA 5JXHA 4EYKA 5FTNA 5FQNA 2JW5A 3JQFA 3FGPA 1KYQA 3JZIA 4MGEA 4EH1A 2NSHA 2X23A 1EP9A 2R4QA 3KIPA 5J2UB 4CG1A 4G0QA 1YZUA 3BB1A 2PS9A 1UFKA 2PG3A 2DTEA 1N75A 3C3MA 1SD1A 1JEJA 4BGEA 1JA1A 4B6EA 5I5EA 4EEZA 3UTDA 3W6PA 3KKOA 3U1TA 3WYAA 5KTTA 2CUKA 3LKBA 3PDJA 1XJQA 2GWRA 4Q3LA 1RE1A 5SICE 1QFMA 3FI9A 2W90A 3WMGA 1B8NA 3CRQA 2HOQA 4IY1A 4HRAA 3EDOA 1UC9A 2WMYA 2X7XA 4MV5A 3R7DA 1JAXA 2PUJA 4O4LB 1M7HA 2X8WA 2XUKA 3RUEA 3LGSA 4CM3A 4ZHQA 5CG1A 3I3SR 1Y42X 3HKCA 3WK4A 2CV0A 3C24A 2OYRA 1GZVA 4TRMA 2AEJA 3KR2A 4BN4A 1I4WA 5LQRA 3HUTA 2FQ1A 3D2BA 1T0BA 1BCSA 1WU7A 4PZPA 3WB2A 2BGJA 2JF0A 2PX3A 3GJ6A 3UPTA 3FE2A 2OXFA 1U94A 2DVMA 4LXHA 1E2HA 2HFKA 2GDJA 3BXOA 3B9RA 3TINA 3OZVA 1IY1A 3IP1A 4TQUS 1YC2A 4IPTA 1EVZA 2NPFA 2ROQA 2OECA 3QSGA 2DPHA 4NG5A 4UDOA 4ZA2A 1EAYA 5EQJB 5C4MA 1SVKA 4MI6A 5FOTA 2AG0A 3WGMA 4G81A 4KIGA 3FOZA 1JQKA 1M6HA 4PC1A 1KVSA 4YGYA 1IHOA 2VQSA 3ZIAA 1X1EA 1OMOA 2JAPA 2OZLA 3GXOA 3NOQA 3TO5A 4AZVA 4P4GA 3BE5A 4ASUA 4K3UA 1QCCA 2A5GA 1V11B 1ISIA 2HUNA 3GA7A 2C82A 2PZGA 3L6UA 3TZKA 4ZEWA 4BU1A 3M1YA 2GSWA 3JZMA 4ND1A 3MWGA 1ZEMA 4RK1A 3UJNA 2JHAA 3FPHA 2VNJA 4BVLA 1MX5A 3KT3A 4N5NA 3ER6A 4ZT3A 3RD5A 3UK1A 2Q2WA 4QSMA 4BJHB 5J1SB 1SQ0A 1U9CA 4BVKA 4AY2A 2JHCA 1DRJA 3RYHA 5LA6A 5C1OA 2WKPA 1NQTA 1SKBA 3IH5A 3STTA 4I9HA 4KP7A 4ZU6X 3WLFA 2QTFA 3BZWA 2W11A 4DLZA 4JN6B 2R00C 1FDIA 1VL0A 2Q1TA 3BCUA 2GZRA 1ESDA 4IILA 1HH4A 2VRCD 3UFBA 4N49A 3CVYA 1CIPA 2SCUA 1EVKA 3JATB 4E33A 3U49A 2XVMA 4EOGA 3KJIA 3PTAA 4TROA 3F49S 4JLVA 3TD2A 3UWMA 4ZHSA 3I01M 3O8DA 4IIJA 2NUTB 1NFQA 1N8KA 4FS8A 2BDEA 2WLTA 1XMJA 3CVXA 4RETA 4FSXA 4EK9A 1W4AA 3IMKA 4GR4A 3FHLA 4DHWA 5D3QA 4X8MA 2Q3HA 3HVKA 4S1WA 1GG9A 1LDNA 1R2QA 1EX6A 1NN1A 2GUWA 1I0LA 2PHZA 1NKVA 2P5UA 2XRYA 2YBEA 2CCJA 3NASA 4G37A 4GZ3A 1W93A 3CXRA 1SKMA 1AGXA 1GPAA 3C7AA 3MSXA 3BMCB 1F2DA 3K2QA 3TSYA 4CKCB 4JZYA 1AB6A 1PWYE 1FFAA 3PPXA 4ISBA 1Q2UA 4RH1A 5EESA 5D3KA 2O0JA 4O4JA 3RTDA 4EYQA 2I80A 5B7GA 1DC7A 3Q7RA 2V3VA 3A27A 5AVQA 1LJUA 1TJPB 1TQ6A 4P32A 4UVDA 1SXJC 2VFAA 1Z0KA 3D2CA 4BO0A 1XTBA 1DXOA 2O2YA 3H4MA 2KE5A 1XD9A 1O3YA 3FHJA 1WTCA 1RR6A 4KH0A 5EIAA 4DB2A 5G0VA 1Q7GA 2EJBA 2BOVA 2QU7A 4YRJA 4OLAA 1WBBA 1PQ4A 4YLEA 3WNDA 3IA7A 4TVSA 3GIDA 5HKBA 2PYZA 1QX4A 3I92A 4MKZA 4U7WA 1G7CA 2CMHA 5M3BA 1ZUNA 3H4IA 1LTHR 3IIJA 1E2LA 2R1TA 3O8RA 5JE8A 1R64A 5EL0A 3NYIA 2MSDB 2GA8A 2OZEA 1XKXA 4HPXB 4NFSA 3AG5A 1N2CE 2BFCB 3R3WA 2CDRA 4KO2S 3X2SA 4QGSA 4QJ5A 4ERXA 2ST1A 1D8AA 1NA5A 1JMYA 2QMZA 3OF3A 4FN5A 5DI3B 5C8YA 1S8AA 1N2XA 3V1MA 5IC4A 1VKZA 3HCFA 4X3OA 5CNMA 5KHLB 2CCGA 1Y5NA 8LDHA 3DAGA 2AFHE 2IU0A 3KSRA 4EI7A 2BHTA 3BE4A 1GTZA 1DQZA 4PAOA 1C9KA 3GF4A 4XSVA 3OIUA 4BTVA 4GE0A 3ZU6A 1XPOA 4IQ0A 1QAOA 1Z82A 5F5XA 5H70A 1DJPA 1XQWA 3ZWPA 3B89A 4XVRA 1WEHA 3O2JA 1JVSA 2QPAA 4M0UA 2GVDC 4C0KA 4TV8B 3BT7A 1N2OA 2F3QA 1IOZA 3IVGA 3HL0A 1SBIA 4XX0A 4DJDC 5EJ7A 2VT3A 3ELDA 5FWAA 3TI9A 5JNTA 2P69A 5LXTA 1G8JA 3DXFA 3KP1A 4I19A 3ZCXA 5CVTA 1UBGA 2ANBA 2GYUA 3BL6A 2LCFA 3LZCA 4I4TA 3P9SA 4JJFA 4K6CA 4LNUA 1CULC 2GAIA 4MVJF 4OATA 3S70A 5JAUA 1US8A 4F3NA 4U2FA 1JIIA 5H4HA 5DHSA 2B78A 3VNQA 1E61A 3MRTA 5CP8A 5IMSA 4ANFA 5G2OA 4ZI3A 5KNBH 1XP8A 1YONA 2W6NA 3K3PA 3L46A 1E1DA 4QAQA 1CQWA 2ZYVX 1OI4A 4G1BA 3TAHA 4DIKA 2ZSEA 1DG9A 3AI7A 3IIMA 4O33A 4V0NA 1VCNA 2ZTMA 3WGYA 4WKOA 3MUNA 1OLSB 2Y2VA 3P52A 3K6SA 3KXKA 3TB4A 1ECBA 2XNHA 3KZNA 4NYMR 1SUIA 5JWOA 4A0FA 2Y1CA 3R5FA 1J7JA 1QBGA 3EGXB 3B5IA 5D85A 5H3LA 2ORIA 1B2LA 2VIIA 3A4VA 4WMLA 2GI4A 2GCNA 1XZAA 5ADWA 2XIQA 5CURA 1VMDA 1ZM2A 5JVDB 5LM3A 5FKJA 2KS6A 4NDNE 1L6IA 3I37X 3N8IA 4X54A 3SEFA 1EBUA 3M0EA 1DC3A 2LNDA 1HE1C 4N41A 3K5WA 1LBSA 1W8DA 1G21B 4DUGA 1UIRA 2XTJA 3BQMB 2HMVA 1KKMA 4IV5A 4WZAA 1Q84A 4D0NA 2JD2A 2RGXA 3FAZA 5B4VA 3LCJA 1PJ3A 3NAQA 4NQRA 3SJZA 3VUFA 3ZVMA 3UOGA 1RPNA 5EIBD 2XNCA 4QD3A 4AM8A 5C9ZA 4M7WA 4NPHA 2ORWA 5M29A 3GWGA 1C3VA 2ZANA 3NVMB 4G0OA 4L73A 3ZBUA 4AY6A 1UFQA 1M67A 1GLVA 3CRZA 1YTLA 4WT7A 1IC6A 4WZZA 1QANA 5CT8A 2UVDA 3QOWA 4X71A 1KC3A 1SVLA 2VDNB 3RSQA 2ZRCA 4OHOA 1UPAA 3UH1A 4TTVA 2Y9PB 2OCKA 4IIVA 1H5NA 1NX6A 2XUOA 3AP1A 1KMMA 2QY9A 4LBZA 4DR5B 4HNAB 1B6SA 4HQ6A 4KO8A 5J4YA 2IOYA 4CLEA 3H9CA 4M0EA 4N3AA 5JH7B 4NU6A 2R65A 2W4QA 2VZ9A 3AKZA 5K2MA 4RD6A 4PBSA 3CEJA 1CUYA 2JC3A 4X6LA 3TEFA 2ZSHA 1LK5A 1V4BA 3ZNNA 3SR4A 3VR4H 4OLBA 3NHBA 2VSNA 3D6MA 5FBVB 5FPKA 5FWYB 5EIXA 5DMHA 2NOAA 3FHOA 4Y0VA 4MVWA 1HPLA 3A3YA 1A04A 1FBNA 1NG1A 4BO3A 2PQ6A 1WA5A 1SQSA 3OEED 4YMSA 4G8BA 2X0NA 1Z07A 2R1UA 3F0TA 1AA6A 5LLSA 3MUOA 3VSDA 5EPEA 1KF0A 4QG7A 3UZUA 3ASUA 1BS9A 4ID3A 1Y1LA 1UZNA 1SBCA 5CDYA 2QA5A 4D8TA 4LJRA 4ZI2A 1INLA 5KEIA 5ITZB 2E55A 1AT1A 4XSGA 5D01A 1Y4SA 2HXGA 1JEDA 1EU1A 3DVLA 3LV8A 2PY6A 2YXDA 2CJWB 3JQ8B 1M8FA 4WXPA 4BNMA 4Z49A 221PA 2Q41A 3I2IA 2CLOB 1EPUA 1IY9A 3CE6A 5CUQA 1DWPA 2C97A 5IVDA 2GPNA 1RC1A 1RJFA 1XQ9A 2J0QA 1QBKC 1SH7A 4M1TA 3WYFA 3QBEA 4MW0A 4J94A 4RF5A 1WBDA 4MK4A 4NX2A 3S6JA 1K7XB 1KJQA 1APBA 2CNOA 1RLIA 2JAQA 4GVPA 1L7VC 1P29A 4DMKA 3FVTA 1MO4A 1N2CA 3PRHA 4ER0A 5HXAA 3NTOA 2R6CA 4B83A 5U9CA 2O54A 3FPLA 2VJNA 4Z4QA 1RYDA 3JTMA 2IKSA 2M6RA 3L1KA 3SBEA 4NYIQ 1WXGA 3JYPA 2X77A 4PLPA 5EJFA 2GAAA 1OXXK 5EMNA 3TQRA 2JCVA 1IUNA 5C1DA 3USZA 3GUYA 2ZS8A 4QARA 3ZXUB 4HQKA 4BB0A 3OT4A 4F4HA 3H4TA 3H2ZA 1VRWA 2A3RA 1KIFA 4G0VA 3C6QA 1DAGA 1ZGBA 2O3UA 3L8CA 2G6TA 6ABPA 5L3SB 5IT5A 2JG3A 5F3RA 2O8EB 5FTMA 4E5UA 2I1QA 1JPVA 3OZRA 5I9LA 4S04A 1KE2A 2EBHX 3VU8A 5HDQA 3P4UA 3WJ7A 1KOFA 3HVUA 3A4MA 3OEHD 4PYNA 3L0ZA 3KV1A 4EKGA 1BAPA 1C1XB 2HBZA 3A04A 1P0PA 3BK7A 3D1JA 4M1QA 3OE7D 1I2ZA 3U7IA 5K6AA 2VOJA 5DP1A 3C1OA 3D7NA 1Z4MA 3DVQX 3KZXA 4ZKEA 1GFSA 3GDFA 1DV2A 3LUGA 1XELA 3OTOB 2VJCA 2PMFA 5HIMA 3WMEA 3QLJA 2WOOA 4M1YA 4BQIA 1DJLA 2Z2JA 3GPCA 3DZCA 3ICVA 2X0IA 1CF2O 2AJDA 4RKFA 1TOAA 3Q8MA 4R5HA 3I8SA 4MVYA 1DLIA 4TS3A 1P4AA 2QK4A 1IMOA 1SC1A 4MWZA 2HA2A 4JBYA 2C1ZA 2IK8A 1EK6A 3AF4A 2G9VA 3HBNA 3ZVKA 4UUNA 5DEOA 3IBTA 1Y1PA 3WK7A 4IJ6A 2VS1A 3C41J 2H9AA 5EE3A 1JA0A 4LA4A 4KMMA 1KQNA 1NNUA 5FWXB 4FM9A 3BVPA 1PS8A 3TOZA 2ZEJA 2VT2A 1JWLA 4F4DA 1WETA 1JECA 2FHSA 3FH0A 4LDJA 3T3DA 4H6VA 2WDZA 2ZPUA 4PYKA 4N47A 1T2AA 3WLPA 4QM7A 1EP1B 3LYHA 2IJGX 3HKBB 4IUBS 4QYTA 3FAKA 1HRKA 3FD8A 3WNVA 3X1DA 4RK5A 4YT8A 3C97A 3MAAC 4AUKA 3JQDA 3TG8A 2IU4A 2PUBA 3A9WA 3DAOA 4TS1A 3HV0A 3Q3VA 5JVDA 4URHA 1SUDA 5AJUA 2P27A 3M89A 3OLZA 4HN2A 1EVYA 2O14A 3CH4B 4ODIA 3ROKA 1KY5A 2PWBA 3NH9A 3GP8A 3QEAZ 1I9GA 2PL3A 3FN4A 3CC8A 2D2FA 3EASA 3DFIA 3PNBA 4X94A 3GUHA 3V4VB 5FAXA 5LZ4A 2Q3FA 1KEVA 1U3UA 3ADKA 3JASB 4LCEA 3QX3A 3H2JA 3ITNA 1OXKB 5BV8A 1K2WA 1CQXA 1Y4UA 3X44A 1VCOA 4EAAA 2NZ8A 1M8PA 2FG5A 2H4FA 3AF3A 3ZE9A 4YT4A 5EQFA 2QUKA 3DOOA 2CNBA 3JY6A 2VJQA 2J0SA 3LX4A 1NUQA 2WFAA 2LCQA 4C4YA 2F43A 1PV1A 3DDOA 1NSFA 3NAZA 3OKFA 3TNYA 5KVSA 1Y81A 1R8XA 1U0NA 1NZFA 2NV6A 3KDPA 1MMFB 2FG6C 1FL9A 4JVNA 4GVXA 3UMVA 4BFZA 2VCHA 1KEKA 4HGQA 3MWFA 5T6BA 1MTOA 1FSGA 4UFPA 1HDRA 4D3SA 5K8CA 1YA8A 1K9VF 1I2CA 1TMOA 3T3OA 2C7PA 5ICFA 3O7MA 5LDHA 2OOKA 3ANNA 1C81A 1UEIA 2B4RO 2QNRA 4J9VA 4ZRNA 5TT0A 3PFFA 2CXTA 1E6LA 4NMHA 1CSEE 1PL7A 1DV1A 1RPZA 2NXCA 1D03A 1IH8A 5I47A 2UDPA 1ATIA 3WLJA 3E53A 4PPGA 3ACBA 3VDNB 3HGQA 1Z4OA 1W0JD 2HNAA 2JEZA 2I4NA 4BV2A 4RSRA 3RS9A 2P6NA 5GV8A 3KV3O 3K2IA 2KBEA 3MBKA 2PX0A 2F1KA 3MLAA 4Y9UA 5J5AA 4MMXB 4CF7A 5DHAA 3WVNA 1MRSA 2OYCA 4A92A 1ZKMA 5KNDA 1YA6A 3CF2A 3G0OA 3QLEA 2PAFA 4MQEA 4RQAA 3NRBA 4BQPA 1RTTA 3U4HA 4EO4A 5JIBA 4KFRA 2ZJ7A 2JKZA 3PLNA 2DERA 4Q7LA 2P3OA 3CLSC 2X9QA 1I3LA 4KBFA 4OB7A 4B48A 5L8VA 2JATA 1P2TA 5LZ9A 3R8FA 1NUUA 2QS9A 3J81k 2DBRA 1M5UA 2WBLC 2WWTA 2XCLA 4OO3A 5IG2A 4PONA 1OB5A 4BX3A 4HH1A 1PG0A 4CT5A 2L18A 1ODKA 1SVOA 2CD7A 3GJTA 5JSZA 4IVQA 2XDAA 3DLIA 1G16A 1Z26A 2QTLA 2YCBA 2YW9A 3HB1A 2BJVA 4HWSA 1YB6A 4LF9B 3F1KA 1I7QB 2C7GA 5JS7A 3A7DA 2Q2QA 4BECA 2PUEA 2QVBA 5CNJA 1NATA 3OBBA 3RS5A 4NONA 4EUSA 3FMVA 3WYCA 3SJBA 1XROA 3EGDA 1PSZA 1U7DA 3JWJA 4QO8A 3ESZA 3FB1A 1W2HA 4L8GA 3NVKI 1NVVQ 2RI0A 1J1UA 1WCXA 1NRIA 4CF3A 3QA9A 4XX1A 4YWJA 2B99A 2ZBDA 3GFOA 1OBHA 1P1BA 4M9CA 4Q02A 1VGVA 4B1FA 1RU3A 2QNIA 5SY4A 3K71B 3A4NA 1HOXA 3OFND 2RKOA 1KH2A 2RGNA 4OGGA 2GBIA 1KDYA 3LMKA 4FI3C 4LX8A 5DGIA 5HNKA 1RNLA 3TX6A 2GM4A 4J90A 4NQZA 3PVZA 2PUHA 2QT9A 2SKCA 4FCVA 4YMHA 1NR5A 2GK4A 3WZMA 3MGAA 3F6EX 1IZ0A 1CUZA 5ALUA 1EE2A 2MU1A 1L2TA 3FWYA 2A9PA 3WC4A 2CHVA 3DQZA 1FSZA 2IHZA 3O4RA 2IPOA 4FBLA 4D6YA 3W9YA 3FVVA 1K7CA 1KI2A 1TLLA 1XQXA 4Q9AA 2FNAA 1Z18A 2O6HA 2JD0A 1L7NA 2DWPA 1IZ7A 4U9IS 5COBA 2H2IA 2XT0A 2FPUA 2VL7A 3L2OB 1JU9A 1VKNA 3R3YA 4KLZA 4EYSA 1WOMA 3O4GA 5CM8B 3RODA 4JLDA 4P9NA 3RTGA 3ZD9A 5DM60 4YALA 2XH8A 4DIMA 2ZYAA 4D97A 1VCIA 4GSYA 3KYIB 3MCVA 2IYUA 1I6WA 1PAUA 3AYXB 3L1VA 3K6RA 4DLPA 1KNXA 4HDRA 1NNSA 2FN4A 3D7MA 1NUSA 3WQSB 1II8A 2ZYDA 1RXEA 2IYPA 1H69A 4URFA 4RTKA 1U28A 2BBWA 3FPSA 1XPUA 5JHGB 2V4ZA 2R7AA 1CDDA 4C4ZA 4ZKDA 3K8QA 3A1TA 1M1YE 2X13A 3OE5A 3HS3A 4ZVNA 5JDIC 1WLSA 3DZKA 3NGLA 3PUYA 3WR5A 4PSAA 4DCVA 1HMPA 4JUDX 3HCCA 4C0QC 5CB4B 2HSGA 5LJLA 1RI5A 5AM4A 2B1IA 4LS3A 1P3Y1 2O2CA 1R6BX 4C9BA 1EWKA 1FQKA 3EQ9A 2WTMA 2J0UB 2EP8A 3I2KA 2NZUG 1TVMA 2JHGA 4G0NA 1L4EA 2IEDA 1TC2A 4URZR 4A0RA 2XMGA 6GPBA 5CLGA 4FLFA 2WFZA 3WGJA 3W04A 4B6FA 4ZQEA 1M2FA 1QHYA 2R68A 1O96A 4YGXB 1U11A 3MD0A 3QY0A 2RH4A 4MA5A 3R75A 1CEEA 1KWGA 2BYTA 1IEWA 2A84A 4BY9E 4MCHA 1PZGA 1E2PA 3C14C 4QYIA 4MAMA 5BW6B 4HX5A 4B0OA 1QUEA 3U60B 4OCZA 1EUCB 4Q00A 2JLYA 4PC6A 1YE8A 1YHZA 3UHAA 3U56A 2V6BA 3M9WA 4XYBA 1X39A 1XFAA 2JJ2A 1O6FA 1VDZA 2AFVA 1IAQA 4BO4A 4F1KA 4K5QA 2O8DB 3DDCA 3KJNA 4RGVA 4XFJA 3U7HB 1KP9A 3IP7A 5K3EA 2G4CA 4H18A 1WTAA 1PT5A 3EPRA 4UVIA 2C4NA 5DASA 1T5IA 2HQSA 4K88A 5FNZA 4JXZA 4LN1A 4RPCA 2Y1FA 5EZQA 1T2FA 4I50B 5B37A 3TK1A 3M4ZA 1LLQA 2JI4A 1QKKA 5A9TA 2JCBA 4TN1A 3VVCA 2CWDA 2P4HX 3VAZA 2JFOA 4HNTA 1FDVA 4ENTA 1M2KA 4EATA 3PKZA 3NBFA 1RPTA 3KQKA 1P77A 4WTOA 1Q1EA 2H06A 1R15A 3Q1LA 1H6BA 2HX1A 5IH3A 5JVDF 2A5DA 2P9TA 3FZGA 5BWBA 1E7SA 1GPKA 1SPBS 2BKUA 2Z95A 4BLSA 4XVUA 2JHFA 5DNEA 1RZ3A 1Y3BE 3RT1A 1EFDN 2BBOA 3FI0A 2QN8A 3WGLA 4DC9A 5IXJA 1TLTA 4C6TB 1WB9A 4MVJH 2QIPA 5DO9A 3WRYA 3JWEA 4LUCA 3NP7A 3OWOA 4M7RA 4N0EA 1OFUA 4QAJA 3ZWQA 1DKNA 3UT0A 4JFRA 3DE4X 4YJHB 2FUKA 621PA 2AI1A 1LPNA 1QO9A 4QJIA 1P2FA 5JYCA 2QL9A 3ZU3A 3GEMA 2HF8A 1AVTA 2XJ9A 2V5UA 4ZFNA 3JVVA 4JX8A 3C3AA 3LPMA 1U0JA 2HXSA 2X1HA 4AKEA 3M6MD 2I76A 3PGMA 4O2AB 1FYXA 2A2ZA 3V8EA 1F4LA 2OD9A 3EDCA 5IDWA 4AQYB 3RRMA 4A6PA 1AV6A 1BKYA 1Q7EA 2KLHA 3A1EA 1CD5A 1GN9A 3A3NA 2FXIA 2ONYA 4G9BA 4OP3A 5DX8A 1HT1E 4KHZA 1BVYF 3AJAA 2YASA 5IK2D 4MVXA 4MHTA 4TTQA 1QGUA 2YHUA 3SHOA 4C7VA 1ZD4A 1GILA 2QQFA 1DRWA 1CQPA 3U3RA 1P73A 4TS4A 4OHKA 4DAOA 1ZITA 4XGKA 1WB5A 4AKSA 3P45A 3E8SA 1TADA 3V5NA 3DAHA 4HSEA 2ZJOA 3CLRD 2IHVA 4FYHA 3BDVA 3R1IA 2G08A 1B0AA 1CZOA 1SVSA 1E64A 4Q5IA 2P30A 2GNOA 2Q1YA 4GNRA 3TOVA 2XQIA 3EBPA 3GJ0A 1V37A 3GLRA 2DUWA 1KK1A 2B8NA 4A91A 5A5DA 3GOQA 3HZZA 3RJTA 1WNTA 4DUPA 3I32A 4TYWA 4O1MA 3I4CA 2J9GA 1E0AA 3BE6A 4UBKA 2O5CA 2UXBB 2H31A 4DM4A 1XTIA 4NZPA 1BOFA 4D9JA 1YCGA 5GV7A 4R71A 4J3NA 1FFCA 1YZFA 3SLRA 3B1FA 1O0SA 4ECAA 2E89A 4Y2RA 3SYKA 4EB3A 4TMTA 3LUKA 5EKSA 1UZUA 1W2WB 2O1SA 4H7PA 2H1WA 2QXTA 2BHLA 3NIBA 4HDSB 3N6VA 1QYRA 1B8VA 3IO5A 3FJ1A 4KXXA 2OPHA 1KPHA 2P2GA 3EGWA 1JSZA 1YMUA 3FKSA 4JJIA 4PICA 3C5VA 4HRVA 4TUYA 3FUTA 3CMCO 4DUZB 1Z7EA 1YD7A 2ZSUA 5M34A 1Y5LA 2XXJA 3STYA 2YIDA 2UUAB 4GL4A 3O84A 1GT6A 4UUPA 1SWVA 3JQBC 3K0CC 4PHGA 1JR3D 3T0FA 4FBGA 3CF4A 3HBJA 1PL8A 2AQIA 3JZAA 1IQPA 1R6XA 2WW8A 3RYTC 1KO1A 3EDQA 4E88A 1FFYA 1FTYA 1PT8A 3NDBB 2C4WA 5L40A 5EZYA 2VUTA 5NLLA 4KR9A 1RYMA 4AN0A 5HSGA 1EX9A 3I05A 3PEVA 4OMCA 5G02A 4OQXA 1OVMA 1UQUA 1NC3A 1C3OB 2POQX 5BUCA 1CS0B 4BKMA 1Q2XA 2OXCA 5EAIA 3G6KA 1NT2A 1GUZA 3TZEA 3OEWA 3LPNA 3WZ2A 3E7DA 2HA3A 4N18A 4C06A 3UUGA 4BEWA 1FNDA 1URPA 3WE7A 1MNQA 2P9JA 4TLEA 4IIHA 3O9MA 1N92A 4DUGD 4FONA 5KTNA 4W5WA 3RUDA 4J16C 3GLIB 1DEKA 4M46A 5JCZA 2HBQA 2HHJA 3ROTA 1H4QA 2WQ7A 2VPIA 2L69A 4WIAA 1QGZA 3RUHA 2O7NA 5TF0A 3N87A 1JA9A 2C3UA 1W0JA 2WSSD 4REQB 3T9BA 3KYBA 2RB5A 4E5DA 1RM5A 1XXHB 3LIPA 3OLVA 3TLYA 3FDFA 3OE1A 3ULKA 4D4MA 3U7FB 1EUYA 1E32A 4X66B 1K6MA 3V3TA 1KSFX 2HI0A 4DA7A 3QYFA 2QJTA 5KNDD 5KOJB 4PGAA 3EFOA 4BLRA 2P9QA 3U4CA 1X7XB 2QYHA 1PFUA 4A1FA 5AI4A 4BJ5A 2H4YA 2J31A 2I6SA 4AY3A 3A9SA 3IE0A 2LKCA 3WLEA 4YQFA 1CQIA 1WUYA 1QIJA 2Q99A 4DADA 3SHQA 1UBNA 2JFVA 5GINE 2XE7A 2IP2A 4LVNA 4EABA 3RARA 4O4IA 4NABA 2YKGA 2BM9A 4EGJA 4H31A 3LO5A 4Q4HA 5EN4A 1SXQA 3PLAE 4BRWA 5BYAA 3SN6A 4Q18A 1IUPA 5E6UA 5K0FA 1O8CA 5KO2A 2WAMA 3PCRB 5K3BA 1PHPA 2Q3EA 3QVWA 3P71T 4OP2A 1XPRA 1FYVA 3IBFA 3CX6A 5DDIP 1KQFA 3AVTA 3LUHA 3U9LA 2F6RA 3V8QA 4BV9A 2D7DA 4ZVTA 3PIRA 2G71A 4INPA 4RFSB 3D8BA 2ZBGA 1MJGM 4XCXA 2QRHA 1LD3A 3E9YA 3PR1A 1ZS9A 3PX2A 3N2KA 2CXXA 1X2BA 3PL1A 3WWDA 4ZVKA 5LUAA 1NF2A 3FNGA 1VKJA 4V02A 3PSAA 1OAOA 3GLQA 4P22A 4WHMA 3QITA 4A73A 2RGUA 1VA5A 1TMKA 1M5TA 5F77A 2NLOA 4CMCA 5A6SA 3U6BA 4HL6A 4ARZB 4E12A 5B3JC 1YB5A 2C78A 1PN3A 4EZEA 1E6CA 2QZJA 1YB7A 2NG1A 2ODWA 1V8DA 2FSHA 2ZJBA 3DKPA 1W1IA 2SKEA 1IBLB 1HRDA 1OGJA 5C7IO 1EP2B 2NNWB 4MO2A 4DVGA 1G38A 2NPIA 5I9BA 1CHNA 2ZB3A 3DMFA 4JJ6A 2HEGA 3K2EA 4LJ6A 4RY8A 2CLLB 2YXNA 3ZV5A 3VVLA 4B17A 2RGNC 4YJ3F 4BMPB 3M83A 4HEA1 4HRXA 1OJ7A 4BFLA 4WAUA 1E5QA 3CWQA 1CP3A 4JR1A 1UKEA 4TTJA 4XI9A 4RUKA 4RZQA 3WO0A 2ASEA 2HMSA 3C3BA 4LJ5A 4OXQA 4Y9TA 3ZK8A 3L0BA 3O8CA 2XCOA 1NDHA 4YCJA 2ZSAA 2YZ7A 3OLWA 5IT9A 5C8YB 4GX5A 4JROA 4QBGB 1JI3A 3QZUA