4DYVA

Crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
237
structure length
213
Chain Sequence
b'KKIAIVTGAGSGVGRAVAVALAGAGYGVALAGRRLDALQETAAEIGDDALCVPTDVTDPDSVRALFTATVEKFGRVDVLFNNAGTGAPAIPMEDLTFAQWKQVVDTNLTGPFLCTQEAFRVMKAQEPRGGRIINNGSISATSPRPYSAPYTATKHAITGLTKSTSLDGRVHDIACGQIDIGNAMDVAHVASAVVYMASLPLDANVQFMTIMAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Crystal structure of a short-chain dehydrogenase/reductase SDR from Xanthobacter autotrophicus Py2
rcsb
source organism Xanthobacter autotrophicus
molecule tags Oxidoreductase
total genus 73
structure length 213
sequence length 237
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dyvA00
1E7QA 1GTMA 4NFYA 3LC1O 4OOFA 1AGNA 5CG1A 4OJNA 4IM7A 1YOVB 3JYLA 4DIOA 4TKMA 5H82A 3CXRA 4CLEA 4RVHA 3K92A 4IS3A 4WOJA 1B15A 4L4XA 3IL2A 4BNYA 4QQRA 4PLZA 4BNNA 4RCVA 3U4CA 1NP3A 3RCBA 2O48X 2HU2A 1SPXA 4GI2A 3LLVA 2PK3A 1B7GO 1VKOA 2X8LA 2Y0EA 2X9NA 1G0OA 4XD2A 5JE8A 3L6DA 3MJ4A 1A9ZA 1QYVA 4YT4A 3RJ5A 4F46A 1QV6A 4E21A 1PJCA 1GUZA 1NPTO 2O4UX 3I5MA 5HWSA 4IQGA 1E7YA 2HMWA 4GKBA 5CDSA 4BB6A 2JFGA 2G82A 1B3BA 1DIGA 3DMTA 5AXBA 1YONA 4UVGA 1D1SA 4AJ2A 4NU5A 3SX2A 3FNHA 3VH2A 4Z6KA 3ZHBA 1E6UA 5KIAA 4WCFC 4BKRA 2R00C 4XYBA 4XZ3A 4WASA 4FGSA 3H9JA 1PQWA 1ZVMA 5IXSA 3E8XA 3I4CA 3WWZA 3U3XA 3DONA 3GVIA 4DIBA 4QTZA 3PHLA 2P2SA 2AXQA 4J4HA 2DTEA 2P91A 2DPHA 1T26A 3ZU3A 1F17A 1PWXA 3DAGA 5K9ZA 3UKOA 2QRKA 4A0SA 1UH5A 1NBOA 3UH1A 1CRWG 1VJTA 1EVIA 2Y1GA 2B4RO 1X1EA 2EV9A 3FRJA 4PG4A 2D0IA 5JO9A 2UYYA 3AM5A 4PVCA 3ZN2A 3RIHA 5JDCA 1ADBA 2X9VA 5MGBA 2PLAA 4OXKA 4WCFB 1E7RA 2PNFA 4J7XA 3RD5A 3ULKA 3PVZA 4WLNA 3BMNA 3ZV3A 3C8MA 3GVCA 4FFRA 1U4SA 1NQAO 3UCEA 4CLHA 3PWZA 2ZKLA 2O3QA 3OP4A 1AN9A 4P4NA 2WE8A 3U49A 1RWBA 3ZGYA 1HXHA 4BNHA 1QYDA 3UXYA 2A94A 4RF2A 4BKOA 4PG8A 4EJMA 1DAPA 3H6KA 1AXEA 4XIYA 1YB1A 2NSDA 3F5SA 3DZBA 5U4QA 2NWQA 2G76A 2Y1FA 2H63A 1T1SA 4JP3A 3I3OA 3UN1A 3TF5A 4LVCA 4ZRNA 3Q1LA 4PG6A 5JCJA 2QHXA 4NFSA 3IC5A 3TZ6A 4JK3A 5A9SA 3G1UA 2YQ4A 3PEFA 1I10A 4IY1A 4R1TA 1LDEA 3F5QA 3RUFA 1NHWA 4CJXA 3PJDA 1NR7A 3PQDA 4B8ZA 3H3JA 4AJEA 1R16A 1SOVA 3F4BA 3MEQA 4U6QA 4RF5A 3TOXA 3JD0A 1YL5A 3NT4A 4BKPA 1Y6JA 4GPD1 1ZW1A 2P9EA 2WD7A 4PFJA 1JVSA 4MVJI 4WGGA 4BVAA 2VWQA 2BI7A 4II2A 2GNAA 1DDOA 5HRUA 2B83A 2O4CA 3KSZO 5L7WA 5JCJD 3QIVA 3GRKA 1W8DA 1K6JA 4RO0A 5A05A 3D0OA 5DOVA 2ZIZA 3VPHA 3RU9A 4IDAA 5F1KA 4Y6RA 1SOWA 1LDGA 4OXYA 3NRCA 1VC2A 3KETA 1JLLA 1GU7A 2PY6A 3G1TA 1LDBA 3BTOA 3AUAA 3U09A 1PGPA 3NJ8A 4PG7A 1ZBQA 4CMJA 1TVEA 4BGVA 2IDZA 1WP4A 4DLBA 4RVUA 5ES3A 3B1JA 1HDYA 4J1SA 5F5NA 1CF2O 2F1KA 2Z1MA 2VUTA 1H9AA 2H5LA 1VPDA 1MV8A 4OSPA 3PI7A 3PFFA 1Z6ZA 3G0OA 1DIAA 3RUHA 2VRCA 5ADHA 4TVOA 3OM9A 2I5PO 1A5ZA 2GN4A 2YJZA 2ZCUA 1RJWA 4BNGA 4GVXA 3OICA 5CG2A 2TMDA 1UXKA 4FCCA 3OIFA 2E4AA 5TT1A 1C1XA 2DM6A 1W4ZA 1YQXA 3GVHA 3VKVA 4L9RA 1GCOA 3NYWA 3QVXA 4RORA 2Q45A 2VNSA 3MOIA 4RGBA 1R37A 3BMQA 3HADA 5F1PA 3IKTA 2EW8A 2D1YA 4E5PA 1PJ3A 2IXAA 3N58A 4QX6A 1MA0A 3CMCO 3NDIA 2CY0A 4UREA 2VRCD 3ITDA 5JMPA 1XU9A 3MJTA 3FNFA 1IUKA 1GQQA 1XCBA 2EGGA 4YVFA 2HJRA 3AI3A 4J4BA 3DTTA 3I6IA 4D3FA 3ENKA 3FTPA 2HK7A 4KUGA 4MP8A 4DA9A 3K2BA 5CEEA 5KVCA 4MVJE 2B36A 1SMKA 4R3WA 4R4JA 1JWBB 4YRBA 2PGJA 1M76A 2JFFA 2W2LA 3PK0A 1ZO8A 4J0FA 4PZDA 1LLQA 3S55A 1RKXA 2J3IA 2VQ3A 3S8MA 3ZWMA 4P8RA 1GZ6A 1YJ8A 1Z7BA 2GN9A 4ND2A 5K6AC 3OQBA 5TLSA 4HKTA 1E3WA 1Y81A 5L53A 4BNLA 3HN7A 1ENOA 3JQ6A 1R4MA 4ID9A 1YQGA 1YXMA 1K0UA 3P2YA 3JYQA 4YQYA 3T7CA 2E37A 4EI2A 1BWSA 3RWBA 2OP0A 4YCAA 5TGDA 3ADPA 4BO5A 1IL0A 4M86A 4AJOA 3SLKA 1M75A 2BELA 4AJIA 4Z3KA 2WE7A 1DC6A 4CM6A 5CDYA 4RVGA 5IZCA 2W2LD 4HFJA 1ML3A 2HUNA 3AY7A 1PL8A 4HX5A 4N5LA 1E5QA 1EQUA 3H4VA 4J9VA 2C2XA 4XQGA 4YJGA 3GY0A 5DCYA 1QYWA 4FB5A 1XDWA 1CERA 1PQPA 1K2WA 1T2DA 4B4OA 3WMWA 4WJZA 3RBZA 3LC2O 1IYZA 3KXDA 2OHXA 4G81A 3GNQA 4RPJA 2EJVA 3A9WA 1LNQA 1ZIDA 3I83A 1JAYA 1PTJA 1HETA 2C5EA 3X2EA 3GPIA 5LC1A 1VM6A 2D3TA 2P4HX 3ZU4A 2Y1DA 3JTMA 1JU9A 2BGLA 2BH9A 2AQKA 3QA9A 4LCJA 4PLCA 2BHLA 4W9NA 3HDHA 3AJRA 2O3JA 1NASA 5FEUA 4L75A 3F4LA 3L0DA 4MPDA 1HE5A 3NJ4A 2V6FA 2NVWA 1NM5A 5K0ZA 2X0IA 2O3RA 3BHMA 4FD3A 1GZ4A 3H9QA 4W82A 1ISJA 1EDZA 3H9GA 3TJRA 3LT0A 3U4IA 4KP7A 3PZBA 4CM8A 3ZWOA 3UCXA 3DMTC 1KEPA 3EHEA 2VYNA 4FC7A 1EVJA 1LC3A 1VLLA 3D64A 2JCYA 2V6BA 5H81A 3WFJA 4RF4A 3ZNPA 4F6CA 3ZI0A 1OFGA 1NQOA 3WGYA 1V3UA 4BNTA 4GLOA 2I67A 1XU7A 3MOGA 4Z0PA 3HB4X 2QYSA 1ZSNA 2IE0A 3QWAA 5HA5A 4C4OA 4YXFA 4DPKA 1TXGA 3DFZA 2AE2A 4IJUA 4HXYA 3UFXA 2YFHA 5A02A 2DBZA 3ADOA 4IDDA 2Q49A 1I36A 2EJWA 4NMHA 5CHEA 3ZWAA 1I0ZA 3WOHA 4J6FA 4TRMA 1H5QA 1B3RA 1IB6A 4JNKA 1PGOA 1PR9A 4IXWA 1A7KA 3LQFA 2W2KA 3E9MA 3H5RA 3PHJA 3RI3A 1GPDG 3W1VA 3NTOA 1PR3A 1PZEA 3U4DA 3K2EA 4D3SA 1C0KA 2RHRA 2VYND 3DZKA 4XA8A 1RYDA 3IJPA 5KJFA 3UF0A 2IYOA 4UEJA 2VUUA 4KDFA 1ZK4A 5JMWA 3R3SA 4FOOA 4RPGA 1LSSA 3VZPA 3EGOA 3I9LA 5JDCC 1FF9A 3NAQA 2AE1A 2DFVA 1MP0A 3VTFA 1LU9A 1HE4A 4IBOA 2O2YA 4AJHA 3ZNQA 5JCXA 1LSUA 3GEGA 1LJ8A 1M2WA 1KIFA 1G0NA 4TRRA 2UUPA 4WE3A 3PLNA 1LA2A 2GN8A 2GASA 4MVJF 4BOYA 2G1UA 3I9JA 3HN2A 1R12A 1BTOA 3TN7A 2JD0A 2H1SA 3OECA 3WTCA 1J4AA 3LF1A 3I9OA 1N2SA 2V6MA 4DLLA 1VRWA 3RBVA 1I2CA 2I65A 2Y67A 3SC6A 2ZTUA 4K9DA 3Q6IA 3LSYA 3KM0A 4KDEA 4LVUA 4XIJA 1KVRA 1SB8A 1ISIA 1U7HA 3HFSA 4JCOA 4M54A 4EYEA 4FC6A 1KVUA 1G6KA 4YJHA 2PKRA 3BMNB 1HF3A 3PJEA 4KZPA 4UUMA 4CM4A 3ROMA 2FMUA 5GZ6A 1HL3A 4HNGA 1IULA 1JA9A 1L1FA 2X4GA 3QRWA 5ILOA 4B4WA 1U3TA 1ADGA 1LRLA 5JDIC 1XQ6A 1ZEJA 2YV1A 3HUDA 3IOYA 3WBFA 4ZD6A 3SJ7A 1GPJA 1Y8QA 4AJLA 2CUKA 5I9MA 1FMCA 1LLUA 2DLDA 5EERA 5TC4A 2PD4A 4E13A 5ICSA 1KETA 1XEAA 1TEHA 1JKIA 4RDIA 1K6XA 3OQ1A 3QSGA 5BSEA 4R1NA 4CMHA 4E33A 4R1SA 1IY8A 1KY5A 1GV1A 5A9SB 1NVMB 4UULA 4XRRA 4XDZA 4U7WA 5KJ6A 1NTOA 3GFBA 1Q0LA 2SCUA 7ADHA 5IAAA 4IDGA 1D8AA 3OJFA 2DTXA 1X0VA 1NPDA 3EVNA 1GYPA 4C7KA 3H2ZA 1E0DA 5ILGA 4JBGA 5A3VA 5GZ3A 3GQVA 3E1KA 3DOCA 3DHEA 2C0CA 3JQGA 5IFLA 1EVYA 4J7CA 5THQA 4QT0A 4CMGA 1NPYA 3WS7A 1LRKA 2DBRA 3PFWO 1JKJA 1Y5RA 1XHLA 4QO7A 3WYBA 3ABIA 4YAKA 1ISFA 3KYCA 4DMLA 2X22A 5GMOA 2HRBA 3NTQA 1ZZEA 2FY8A 1DB3A 4MJLA 1KY4A 5DT9A 4ZJUA 1U5CA 1P1JA 3D4PA 3RUCA 2PR2A 3CZRA 3WYEA 4NJMA 4BGEA 1N7HA 1ZH8A 3KYDA 5COBA 5B1YA 1N92A 1DEHA 3ON5A 5TIIA 4W4TA 1SNYA 1PGJA 1BXKA 2V7PA 4BO9A 1T2EA 5DF1A 1Q0HA 4TZKA 2DBVO 5L3ZA 4GSKA 4UVEA 3T7EA 2ZJ1A 5AVOA 4BNUA 4PLFA 4WECA 1M66A 1VL0A 2D5CA 3LDHA 5JY1A 1NNUA 4L74A 3PXXA 1ZK2A 1U8FO 2PV7A 1LEHA 2RH4A 4CMKA 3IMFA 4DYVA 2YW9A 2FWMX 3FTNA 3GGOA 4IIVA 3OH8A 3DHYA 1HDZA 5A5EA 4KUEA 1LLCA 4IJKA 5TRTA 3JQDA 3BMQB 1X13A 4E2XA 5U1PA 5KJCA 5EIOA 1NVTA 4OMUA 4OSOA 4YJFA 2QZZA 4J2OA 4P4GA 1IZ9A 1LC0A 3AUSA 3C24A 3JQ7A 4XEHA 5JAZA 5JFOA 2Q1SA 4R16A 1QR6A 3ETGA 3M1AA 4KWIA 3TWOA 5I8ZA 2FR8A 4I5EA 4ZQHA 3PIIA 3H9EO 1XQ1A 2VRBA 3FN4A 1DXYA 3RSHA 5LDHA 3QV1A 1B0AA 3JQBC 2DU8A 3G3EA 5IZCC 4UVHA 1TB4A 4IQ0A 4DREA 2EGHA 1ORRA 5JYEA 1EMDA 4PLWA 2CDCA 4MVJH 1C0IA 5F1OA 2R6JA 4HP8A 4WEQA 5BSFA 3CKYA 4DBVO 1N8KA 4PLVA 1OAAA 4WKGA 1XWFA 1E3WB 1JWAB 1C3VA 2AQIA 2GZ2A 3KSUA 3OETA 2NU8A 2XPCA 4U0JA 3VAZA 1NWHA 4TZTA 3GG2A 1M6WA 1R4MB 5I8WA 4TQGA 4YA6A 4BHTA 1DJQA 4FGWA 3GGPA 3K5PA 4DWVA 3W8FA 2PZJA 4BNWA 4A27A 1HWYA 3JQFA 4XGKA 2EKLA 4GKVA 3DXFA 3C85A 1R0KA 4OQYA 4W9NC 1T2AA 5DP2A 1YO6A 1SO8A 3ZWBA 1ZKMA 1W0CA 2DQ4A 3DZGA 1DFHA 1UZNA 5DULA 5G2OA 2IEDA 3RKRA 4XB1A 5IN5A 4J43A 2JL1A 1VJ1A 4DBZA 1G1AA 2C7GA 3ROPA 2CF5A 3OHSX 1MXHA 4BGUA 2X6TA 2J5RA 3JCZA 3P2OA 2PGLA 1MG0A 3E48A 1MXFA 3O03A 3QHAA 4I5DA 1H6DA 1UDAA 5KKCA 3WQRA 5EQDA 1R15A 5F3RA 4YWJA 2G0TA 3CTMA 4A73A 4CV3A 3H65A 1Y1PA 3JD4A 1ZXBA 3Q2IA 4GAEA 4XGNA 3KO8A 3SLGA 5A3JA 3OSUA 4B79A 3INTA 3PGXA 4M89A 3WDSA 4BMSA 1T1RA 4QECA 1I8TA 1H0KA 1DIHA 1KERA 1UXJA 2AA3A 1E3IA 3Q11A 3GZNA 3E5MA 3EZLA 4JN6B 1I30A 1X15A 2DFDA 2Q4EA 1PL7A 3P5SA 4CM8B 3ZHZA 3A1NA 4CL3A 2I99A 3R1IA 2AG5A 4L4RA 4IZHA 4OHUA 4Y8VA 1DC5A 1WZIA 2JHFA 4CODB 1DRUA 1Q0QA 2EEZA 1YL6A 3PP8A 4WUVA 4BNXA 1HKUA 3O8QA 3GR6A 2B4TO 4RVSA 1UUFA 4IXTA 2IODA 3D5QA 3RUEA 4G5HA 3Q2KA 3Q3CA 4LMPA 1TT5A 3QLJA 3L77A 1UAYA 1ZJZA 2NUAA 2BFAA 4YRAA 3VDQA 1HSZA 1ISMA 2FRDA 4ZGWA 2NU6A 2QYTA 1HE2A 1EE2A 2X86A 3KTDA 2ZTLA 5H83A 4E3ZA 2EG9A 2PD6A 4NQZA 4DVJA 2OBYA 2W2KB 1ADCA 1BG6A 2JJYA 3ASUA 3WJAA 5KVVA 4BNVA 4E5KA 3CMMA 5JBIA 4H15A 4EITA 2DBQA 3OA2A 1UZLA 3GLQA 1B16A 3HFGA 4EZBA 1BHSA 1WDLA 2VNAA 4A26A 5A1TA 2JHGA 3ETDA 3AFMA 1LXCA 5GZ1A 2J8ZA 2RH8A 3PQFA 1HDXA 1HDCA 1LUAA 5L45A 4CR8A 4LK3A 3ZWYA 5JPIA 1BDMA 3B20A 3FI9A 2XOXA 5A04A 2QRLA 3DBHA 4W7HA 1Y8RB 4GSLA 5C7IO 5MDHA 1H93A 3DO5A 2NTJA 3RC7A 3TNLA 1VKNA 4UVDA 2UV8A 3QE3A 4FW8A 4J0EA 3ZU5A 1UJMA 4U6SA 3IS3A 1R4NB 4IGFA 1QV7A 2YQ5A 1XA0A 1NVGA 4ND4A 1V9LA 3GMDA 4HV4A 3WB9A 2OZPA 1KEWA 2WJPA 3DC2A 2FR0A 1EBUA 3DFUA 4I8XA 4W7IA 4D45A 3RC2A 3L4BA 1FXSA 1UXIA 5EN4A 1XSEA 1LDMA 4YJHB 1S7CA 2CMDA 2XXBA 2EERA 4PLPA 1Z74A 3RFXA 3B1FA 3PYLA 4RDHA 1A4IA 3BA1A 1ZSVA 2J3KA 3OF2A 4ND5A 2YY7A 1EFKA 2IRWA 1DRVA 2D2IA 3D3WA 4INAA 4Y98A 1ZXLA 3L6EA 3S2GA 4E5NA 3P19A 3HJAA 3JD1A 4YJDA 5LDGA 3KV3O 2PZKA 5FI5A 4OGWA 4WK6A 1Y9EA 3ZWCA 4EJ0A 2B5WA 3WYCA 4ITUA 5EQFA 5CPFA 2I3AA 3RC1A 2JCVA 1YJQA 3U0BA 4C7JA 1BXGB 3WBBA 1NR1A 1N1GA 1GD1O 2E6UX 2ZB3A 3E6AA 5A03A 1SC6A 1LDYA 4XRGA 1T2FA 2E48A 1ADFA 4J16A 1GUFA 3IP3A 4FJ1A 4F45A 3FPCA 3VVBA 4AJ4A 1H6CA 2Y68A 1FJHA 1AHIA 2XAAA 4DQUA 2C5AA 3ONFA 3DHNA 4E2ZA 3BZUA 3TDKA 4DXHA 5JO0A 4CMCA 2RIRA 3FBGA 3JQGB 1YDEA 4HUJA 5EMHA 5A4DA 3GC6A 4U5QA 3VPSA 4CPDA 3I4FA 3CH6A 3FR8A 2CSUA 3VHRA 4FN4A 1HZJA 3WICA 1FDSA 3BTUA 1B2LA 3BXXA 4GLLA 1N5DA 2OUIA 1RM0A 3MZ0A 4O63O 1FDTA 4PLTA 1PSDA 2X7HA 1WVGA 3B1KA 1U5AA 4Q39A 4E30A 4NJMB 1VL6A 3KYDB 3L4SO 2B0JA 2OP1A 1HEUA 3GDFA 4TROA 1YBMA 4R9RA 4JBHA 4R41A 5TT0A 4IDBA 1GUYA 4GGPA 4ALLA 2NQTA 1S6YA 4UEKA 3FF4A 3WWYA 2PTGA 2GLXA 1JDJA 1WNTA 3WNQA 3WIDA 2VHYA 5G0WA 4BO2A 3NKLA 1PIWA 3FNGA 3DOJA 2JD1A 3BMOA 5BNIA 4A10A 2EHDA 4TMFA 3TRIA 4BNIA 4MP3A 1C14A 3PWKA 2WYUA 5TF4A 3ONDA 2VHXA 1DHTA 3HE3A 3JQCA 3ZCXA 3UUWA 3AWDA 4R54A 2VTEA 1WZEA 1CWUA 2Q2VA 4A7PA 3I9NA 3NT2A 4R69A 3K9QO 3VZSA 1M6HA 2RBEA 1OC4A 1ISGA 3WQQA 2IEBA 4M55A 2GO1A 4RVDA 5HM8A 4AFNA 3HDQA 4MO2A 3OIDA 3DZIA 5EJ2A 5CFZA 2TMGA 3AK4A 3M1LA 5JYDA 3JQ7B 3WLFA 2WSBA 4AL4A 2UDPA 2NVUA 4NK4A 4NBUA 1P1KA 4NBVA 3JQFC 2AHRA 2POQX 2AEFA 5G0VA 5C3MA 4CQMA 2UVDA 3PJFA 2EW2A 1TA4A 4JXKA 2UUOA 1ENZA 3V1UA 1EUZA 1F14A 1PJQA 2BMAA 3RAJA 1BW9B 3EC7A 5T8KC 3VKUA 1PZFA 1R6DA 5KVSA 3PWSA 1I32A 3QY9A 1AHHA 3GDGA 2P4QA 4FFLA 1D4FA 2ZTMA 1YGYA 3E03A 2HLPA 3ST7A 1Q7GA 1HLPA 3DZHA 4EBFA 1Y5MA 1U8XX 5T6BA 1Z7EA 4E0BA 3PIDA 4TVBA 1A4UA 4QEDA 2VWGA 4DL9A 2Z1NA 3TZCA 4DYDA 4CQMD 4CMEA 4YB8A 4J91A 3IAHA 4FFPA 4GWKA 2VWPA 2VOJA 4WLOA 5C7LO 1BSVA 4RZHA 1VE9A 2B5VA 5G4LA 4N5NA 4MKXA 1K89A 5DBGA 2RCYA 3W8EA 3WLEA 4LRTB 3UCFA 4CUZA 2O50A 2CVQA 3OEWA 5G4KA 4HFNA 3AU9A 1CQJA 1IOLA 5ITVA 4E32A 4ND3A 3NTRA 4E2WA 4E5MA 1B8PA 1H6AA 3WIEA 3K73O 2XF8A 4NBWA 3ROQA 1PJBA 1BDBA 3DBLA 5A5FA 1Y7TA 1LBEA 2WMDA 2CZCA 3S2EA 4D79A 2Q1TA 3OA0A 4LW8A 3DDNA 4IQ8A 4YPOA 1PS9A 3ZH2A 2HMUA 1QMGA 3VOSA 2B69A 2ZYGA 2IZZA 2YDYA 1ZK1A 4XQ9A 3ICPA 4BMNA 3QWHA 2HCTA 1I33A 3ZW9A 3AOEA 2NQ8A 1JW9B 3GZ4A 2ZQZA 4FJ2A 5CPBA 4U8GA 5KNLA 1KOLA 4A2CA 4YEDA 4XB2A 4QSMA 3GZNB 3GF4A 3R0IA 5JS6A 4JX8A 3UGKA 2GR9A 4S3MA 1YVEI 3MJCA 5L40A 1XLTA 2PZLA 3PHIA 3NUGA 1BMDA 4WLUA 2V65A 4P38A 3VZQA 4D0SA 4HFMA 4BV9A 2PWZA 4PG5A 4UUPA 1R0LA 4CM7A 1XELA 4Y9DA 2HK9A 4MVJP 3O8QB 1U1IA 1BVRA 4XYLA 5JLAA 4DIFA 2YUTA 3GDOA 4BQPA 4EGFA 4KQWA 4TWRA 2PA3A 1TT5B 3KUXA 4RF3A 4YAEA 2VT3A 1NX6A 3ANLA 3DTYA 5KTKA 2ZYAA 1CQIA 3ZW8A 1J6UA 3A4VA 1SEVA 2B35A 4IJWA 2W90A 5L4SA 4PVDA 1DO8A 1UDCA 4JIGA 1VL8A 3C1AA 4CV2A 1VI2A 4YBZA 2QX7A 2NTVA 4ZU3A 1H9BA 2B37A 3D1LA 2FSSA 4R68A 2WDZA 3CSDA 4RPLA 4KWHA 5IF3A 1P45A 1YBVA 3GAFA 1ONOA 1Q1NA 4HY3A 1EZ4A 4TSKA 3RUDA 4B8WA 4CQLA 4UUOA 1ZJYA 4EUEA 2ZJ0A 2PGDA 3GEMA 2ZQYA 4CM9A 4XYGA 3L4BC 4FFMA 4LGVA 4B3HA 5I9LA 1SBYA 4IIUA 2FOIA 3ZV4A 4L8VA 3JV7A 3WXBA 5EESA 2DAPA 3UICA 3DBHB 5HS4A 4JP2A 3BHIA 3R3JA 5A9TA 2FZWA 3JQAA 3OFSA 1PWZA 2R00A 1SZJG 5JSFA 3L07A 2GYYA 3V1TC 4P4LA 3RU7A 3F46A 3O26A 1XIVA 4IDCA 4ZQFA 4CMBA 3AI1A 1P0FA 4IUYA 1KC1A 2QZ9A 1NWCA 3F47A 1YH3A 4DQVA 1DOHA 4E31A 2WTBA 3GHYA 3HB5X 1MG5A 3VH4A 4AJPA 4CM9D 2BI8A 3EMKA 3DMYA 3EW7A 4XJSA 4CL8A 3D3EA 1YS4A 1QKIA 3RBXA 3BMCA 2GF2A 5JY6A 3F6YA 4EJ6A 4ZRMA 4E12A 2PKQO 5IZ4A 3JQAD 3I52A 5ENVA 1FK8A 4RPHA 2X1HA 3QW2A 2ZTVA 4RV9A 4WNIA 1E7MA 4BQRA 1P3DA 1WMAA 3KEOA 2C59A 2C82A 1W6UA 3OJOA 4MVJM 1DFGA 4L73A 4PZCA 2X23A 4Z9FA 5JC1A 1U3UA 2D5AA 4WLFA 1LSOA 4CLOA 1EE9A 1GZ3A 4FBGA 4GVLA 2WD7B 2C54A 1KEUA 2A9FA 3LT4A 2PZMA 3FPLA 2OXIA 3LT2A 3QWFA 2DUWA 1J49A 4FFOA 2BGKA 5BNFA 3WR5A 1HDGO 1LDNA 1T24A 2ZYDA 4O1MA 3E18A 4H16A 4ZVVA 1QXSA 2VUSA 1EK6A 1P31A 2D59A 3DEYX 4JGBA 3V5NA 1N1EA 5ER6A 4MINA 7MDHA 1DC3A 3RASA 1ZK3A 2EP5A 1WWKA 1X1TA 3W8DA 4BO6A 2P9CA 1Z45A 2ZB8A 3GEDA 3JQ8A 4QUKA 3UHAA 4GH5A 4IDFA 1BVUA 5HS6A 1U3VA 4Q3CA 1YB4A 5IN4A 4PLGA 4UVIA 1SCUA 4BNKA 4DC1A 2WYVA 2BF7A 1C1DA 3FSRA 3QWIA 1KBZA 2YHUA 4ZA2A 4CR6A 2ILTA 3B70A 1E1MA 3ENNA 5JAIA 3MJVA 4IMPA 3GN2A 4H3VA 4ONEA 4BV8A 1UDBA 1PJSA 3PYMA 3JD3A 3D4NA 1B8UA 5CAEA 1ULSA 3D4OA 1P1IA 5B4UA 4D7AA 3H5AA 2BD0A 3HQ4O 1U2GA 1UP6A 3K6JA 4OO3A 1HTBA 5BR7A 3M6IA 4Q3BA 4ZHSA 2NVBA 3HHPA 2J6IA 1OI7A 3ORFA 1GEGA 4YR9A 3C7CB 4U0KA 4BS9A 4PLYA 5DNAA 1ARZA 1C1XB 1I3KA 2Y0DA 3L9XA 4TKLA 2YV3A 3BTSA 1O95A 1H2BA 1MC5A 1PJTA 5FWNA 5C5IA 1DJNA 1V3VA 1ZCJA 2J5KA 5T57A 1UAGA 1DFIA 1SAYA 2HQ1A 2O7QA 2AEJA 1OZAA 3Q0EA 2P5UA 1AUPA 4M49A 2QQ5A 4K26A 3S2FA 2O7SA 4XKJA 3GRPA 4BNJA 4GL4A 4ALKA 1U3WA 1XKQA 4FR5A 4PGFA 4BO8A 1E5LA 1WAMA 4GMFA 3VZRA 2IYPA 3LT1A 3WTBA 1UXHA 4QFDA 1H6BA 3NGXA 2VWHA 1CETA 3AFNA 3VH1A 1FDVA 3MJEA 2P5YA 3R6DA 1SEPA 2WYWA 5DDIP 3BYZA 4DUPA 4XWYA 2E49A 1YQDA 1B14A 4D42A 4MIYA 4EUFA 2EXXA 3IUPA 3RUIA 1J5PA 3TPCA 5DN9A 1AE1A 2GUGA 3CEAA 4Z9YA 1QRRA 1MC4A 4NI5A 3FNEA 3WNVA 5DBFA 2O2SA 4H7PA 3V8BA 4CQMB 3DL2A 3LU1A 4FDAA 3FBTA 4NBRA 5L7YA 1KVSA 1ENPA 4NPCA 3VTZA 4G2NA 1OOEA 4GX5A 4UAGA 1ZMTA 2NU9A 4LSWA 1QSGA 1ZMOA 4KUHA 1W73A 5TQVA 1LQTA 3FWZA 4DPLA 5IG2A 3DBRA 4YAJA 5B12A 1QLHA 1MB4A 2YHIA 3WX0A 1GYQA 1PS8A 3H5NA 2BRUA 1RPNA 3K31A 4O0LA 3OEYA 4DLAA 5TS3A 5IDWA 3KBOA 4YJGB 3E82A 3GVPA 1KS9A 3E9NA 4PCVA 3ZDFA 4NDNE 4J4TA 5K6AA 2Q2WA 2LDBA 1YWGO 1Y9AA 4D46A 2JAPA 1B8VA 4KTTE 1L7EA 3AOEC 1NFRA 2QIOA 2HDHA 1PGNA 3PGJA 1I24A 2FR1A 2HMTA 4N7RA 5L4NA 3DAPA 3OJEA 3HSKA 5TNXA 3JQEA 4BB5A 2VN8A 1XYGA 3W4IA 3WGZA 2VHVA 3LC7O 3PJGA 3JD2A 5G4KB 4J1NA 1EK5A 4GGOA 4KOAA 4AICA 2G5CA 3EZYA 3I23A 2D8AA 3ZHXA 1X0XA 4B4VA 1RYEA 4IJVA 1I2ZA 1H2HA 2Y1EA 1BXZA 1GV0A 4YAGA 1F8FA 2DVMA 3SJUA 2Y93A 3EDMA 3ZWWA 5CEJA 3UW3A 2FZEA 4XYMA 3GHHA 3F9IA 4FIZA 2EF1A 3SXPA 4MVJA 3AUTA 4GBJA 2IZ0A 3HDJA 4NK5A 4GWGA 4I08A 1K5HA 4GMGA 1T25A 1V6AA 2XXJA 5FYDA 4A03A 5GY7A 1QG6A 1PX0A 2PD3A 3V2GA 1B26A 2X58A 1EUCA 1UZMA 1GY8A 4NJOA 1LLDA 3PLRA 1KVQA 4MIEA 4BKQA 4YT8A 4FFNA 3U5TA 4OOEA 2OBNA 4I1IA 4BO0A 4EW6A 5AXAA 9LDTA 4J1TA 1FDWA 3NV9A 2G17A 4EEZA 5L4LA 3EVTA 2J3HA 4RLHA 2Q99A 1H94A 4HFRA 1E1KA 1LRJA 3JYNA 3KLPX 4MVJD 4D3DA 5I9NA 1HYHA 3MTGA 2C2YA 1YL7A 3V2HA 4ND1A 4KMSA 2NV6A 3H8VA 5AXDA 2CVOA 3G79A 3ICCA 4BMVA 3C1TA 1HE3A 3RC9A 1KYQA 3GNTA 2OGUA 4LMRA 3EYWA 3PDUA 2X0JA 2BFOA 5BSHA 1NQ5A 4WEOA 2YV2A 4I5GA 1K3TA 2UAGA 3V1YA 5I7EA 4MDHA 4CQLB 5T67A 4BL5A 2HRZA 2YDXA 1WW8A 3ANMA 5KKAA 1QYCA 2W8ZA 1NAIA 2WEKA 3ZNOA 3OBBA 3H9UA 1EDOA 4AJJA 3CE6A 4EEXA 5BT9A 3Q9NA 3TZHA 1D3AA 1PJLA 4Q3DA 3RFTA 4ALMA 5ICMA 4MOWA 2I3GA 4YYZA 3WSWA 2JD2A 4CLRA 1HLDA 3LVFO 2GZ3A 1A7AA 1VSUA 1YB5A 2GGSA 4L0QA 3JQAB 3A06A 4B7XA 4GX2A 1MFZA 1P77A 3G17A 2DUUA 3GFGA 1L7DA 1PJ4A 4CM4B 2O23A 4M8SA 3EUWA 3HG7A 3O9ZA 5JW6A 4CV1A 1NYTA 1XG5A 5F5LA 3AUUA 1UP4A 3UOGA 4WLEA 4K6FA 5FI3A 3ZHYA 4B3JA 1VSVA 4MVJG 1Y8QB 4IS2A 3KYBA 3INGA 3PZRA 3D5TA 1NFFA 4PRKA 3U9LA 3B6ZA 4PIVA 3BIOA 1ENYA 4DTIA 1U9JA 3DZJA 1BGVA 3QVSA 3RKUA 3JYPA 2Y05A 3K30A 3BMCB 4JBIA 3TFOA 3AM3A 2X5KO 5ER9A 4D41A 1GQYA 2WWRA 2HMSA 1X14A 1QORA 3KEQA 1I3LA 1XR3A 1NHGA 2H9IA 4B7UA 4E5YA 2W4QA 1ISHA 2RAFA 4TRJA 1E6EA 4GQAA 4YTEA 4A5OA 4BGIA 2GERA 4ALNA 2PH5A 4J7UA 4RZIA 3AM4A 2YZ7A 4CLDA 2GDZA 4IINA 4FPXA 3FHLA 1V8BA 4CLOB 4O6VA 1CJCA 4N5MA 1JAXA 3H7AA 2VZ8A 4NHEA 4NFHA 2ET6A 3ONEA 3S2IA 5JDIA 4X54A 1O94A 1O6ZA 3ZV5A 3IJRA 1GL3A 4J49A 1C0PA 1GAEO 3LZ6A 5EPOA 4ZQBA 4CM1A 1ZSYA 4CUJA 3W4JA 5A06A 3RUAA 3GK3A 2VCYA 4PZEA 3KYCB 4WNCA 4Z9XA 4BO4A 4LRSB 3AY6A 4IMRA 2HAEA 3JQ8B 8ADHA 5IXYA 1NQTA 5JXWA 5JC8A 1WXDA 1P0CA 4ESOA 4MP6A 1N9GA 3UVEA 1E1NA 1C1DB 2AMFA 1BRMA 2RHCA 4XCVA 4EUHA 1E3LA 3F1LA 1GEEA 5IDYA 4NG5A 2P68A 2FPPA 2VZ9A 3RQSA 1ZK0A 4AG3A 4ZN6A 2BFPA 5KOIA 1ONNA 3WJ7A 3WQSB 1KEVA 2X5JO 6LDHA 4LISA 3QP9A 4W6ZA 4CMAA 1WLYA 1C0LA 2X0NA 4ILKA 3KRTA 5BNTA 1T4BA 1UXGA 3OJ0A 1JTVA 2FSVA 3E9QA 3KB6A 3PHGA 1P74A 2Y1OA 3INRA 2O3SA 2VHWA 4FQ8A 3U62A 5CDUA 3GNSA 5JNLA 5DBIA 4YJFB 3JQ9A 3WGTA 2GPTA 3KZVA 4D44A 4FOSA 4M87A 3IIEA 1HYGA 1I3NA 2QRJA 3PDJA 1JN0A 4FJ0A 4CMIA 4I9UA 1U28A 4R1UA 2Y99A 1I01A 2JKVA 3W6ZA 1Q7CA 1R0SA 3N7UA 3GH3A 1ZNQO 2AQ8A 1VJ0A 5C7OO 5DCUA 3ASVA 1DBVO 3JYOA 1PZGA 4ZQGA 5KVQA 3AOGA 4R51A 1CYDA 3ITKA 4JJIA 4R5HA 1PGQA 1LQUA 4M1QA 3EK2A 3IUSA 3G49A 1P44A 5KWEA 2VTDA 5ENDA 2IZ1A 2NU7A 4OH1A 5EL0A 2A35A 1YE3A 4NZ9A 4E2YA 3A28A 4RQTA 4QXMA 4IGEA 1D1TA 1DSSG 1GQ2A 1MFPA 3KHUA 4R01A 2I6TA 2AG8A 3HWRA 3FR7A 4O5OA 2Q1WA 5EINA 3JSAA 3KVOA 3GN1A 4J2HA 5L95A 3TL2A 1PJ2A 3NGLA 5U9CA 4XQCA 3DBRB 1Z75A 2YHIB 4B4UA 1WDKA 4OKNA 3VPFA 3VPXA 1R66A 3JQBA 4ROSA 1EUDA 1OMOA 2Q50A 3A14A 4EDFA 5TSDA 3CUKA 2VZ0A 2C29D 4HBGA 3WGGA 3WGQA 3KOUA 4CLXA 4YDRA 1LTHR 1T4DA 1ULUA 2NM0A 3F3SA 4BKUA 4RJTA 4XYEA 5BSGA 2VT2A 5THKA 3EAGA 3U4HA 5DP1A 3CINA 3GUYA 5CDGA 4I9NA 3AI2A 2EP7A 4L76A 4QO8A 2Q1UA 2V6GA 3VDRA 5L51A 4XDYA 3FWNA 2BFMA 5LCXA 4FS3A 2W98A 3FCOA 3MWDB 3N74A 1O9BA 2VOEA 1YOVA 3C7AA 4K28A 4LCEA 4QFCA 5TJ9A 5HTOA 2NNLD 3M2TA 3TSCA 2JCXA 4RQUA 5I7FA 1ID1A 1O5IA 1MLDA 3AW9A 3L6OO 4W99A 1TLTA 4KQXA 3WMXA 4S1VA 3QVTA 4AJ1A 3Q9UA 3FD8A 3HDYA 1IE3A 3S1LA 1KC3A 1X7DA 4D43A 2CF6A 4DGSA 3MWEB 3TOZA 3TFQA 3DAFA 5B37A 3GVXA 1A9YA 2GRAA 3GT0A 5DOZA 4GX1A 1ZUD1 4R5MA 4Y6PA 2QW8A 2WD8A 1UR5A 4WCDA 1WDMA 3GMSA 2B4QA 4G65A 1HT0A 4Z0TA 3RJ9A 4ALJA 1EQ2A 2PFGA 3MCVA 3NEPX 4DMMA 2I66A 3UAGA 5L7TA 1DRWA 2CDBA 2I9PA 5IJZA 2BKAA 4UUNA 3TL3A 3VVCA 3QQPA 1A71A 2HK8A 2JFHA 2NLOA 2ZB4A 1Q2XA 4LSMA 5TX7A 2GZ1A 3O4RA 4D0RA 4WOKA 3ZZNA 5T5QA 3AU8A 1DLJA 2Q3EA 5CP8A 3GPDG 2NADA 3LLSA 1P1RA 4Y6SA 1QLJA 1XGKA 3DBVO 3MJSA 3W4KA 1E3EA 2AQHA 2VHZA 3GOHA 3KLMX 2F00A 1K6IA 4WPGA 4R9SA 2VYVA 1IPFA 4BNMA 1E92A 1O89A 4HWKA 4CR7A 1DIRA 4Q3EA 4CV0A 3QJ5A 4NU6A 2DTDA 5TJHA 4BO1A 1JKFA 4NBTA 4TRNA 3I9MA 1N7GA 3SVTA 5JAMA 1U4OA 4J1QA 3ZWNA 4OYRA 1P9LA 3LK7A 5I7SA 1NAHA 1ZEMA 8LDHA 1YBAA 1A72A 3F1KA 2EWMA 4IDEA 9LDBA 1U2DA 2NACA 4BO3A 3GG9A 3I9KA 3NT5A 4AJNA 2FPIA 5FFFA 1T2CA 1X7GA 2P9GA 1RM4A 2ZCVA 2J5QA 3GGGA 3WGHA 3PYXA 2CFCA 5HBRA 1E77A 1DHRA 5AXCA 2GSDA 3D7LA 1GR0A 4DPMA 2VYVD 4E4YA 1HRDA 3PTZA 4OKIA 3DQPA 4BNFA 3WGIA 2Z95A 5AQ1A 2OOSA 5IDXA 1CDOA 1DPGA 4URFA 4IPTA 4UEOA 1JVBA 3PHHA 4WCFA 3CZMA 1Y8RA 2AEMA 4O59O 5KJEA 4DC0A 3SC4A 3ZWVA 3PRJA 4BIIA 4MIOA 3KSDO 4LN1A 3WGOA 4XQEA 1JQBA 3NDJA 1MX3A 1V3TA 1R4NA 3GA0A 1MUUA 3LF2A 4NNJA 3VPGA 3AY3A 1KVTA 2AW5A 2OMEA 1PZHA 1X7HA 2EKQA 4YT5A 1LI4A 3QVWA 2O3TA 4CLRB 5G0TA 4J9UE 1F0YA 5AYVA 2CDAA 3TZKA 3X2FA 3O38A 4Z3DA 3BAZA 1EBFA 1GDHA 4XX0A 1Z82A 3EY4A 3M2PA 1WPQA 4R3NA 1V0JA 1F12A 2WM3A 4OQZA 5G0UA 4ZQEA 3HZZA 1NXQA 3C3XA 3OIGA 3C1OA 2X5OA 3D3WB 4JJFA 1PL6A 2HSDA 4J90A 2ZATA 4DRYA 3WG9A 2Y0CA 1IPEA 5I7VA 2CNBA 4DQXA 2O3UA 3DZFA 1GADO 3IKVA 1I5RA 1EFLA 3QWBA 3QVOA 4J3FA 1NFQA 3I1JA 1EVZA 5T64A 3V2UA 2OFPA 3ZV6A 2A4KA 4OM8A 2D4AA 4P22A 3TQHA 3IQDB 2DPGA 1BXGA 1OBFO 1QYXA 2BGMA 1E7SA 3ETEA 3T4EA 3ZWPA 4JLWA 2H6EA 3BHJA 2PH3A 3DR3A 3DWFA 1HDOA 1IHYA 4YQZA 5KCZA 2E82A 5KJ1A 2FN7A 2HKIA 3C7DB 4AVYA 3TZQA 1Z73A 4CM5A 1FDUA 1U7TA 3GUCA 4BO7A 3VH3A 1GYRA 2DT5A 4Q9NA 5COAA 2Q4BA 4ALIA 1PU2A 1TI7A 1HZZA 4NR0A 4CUKA 2C20A 4II3A 1P1FA 1HDRA 5COQA 4ZICA 2HO5A 4JQCA 5C37A 1HSOA 2A92A 1IHXA 3RVDA 2FHSA 1D7OA 4F6LA 4RLSA 5J23A 2DKNA 4E6PA 3T4XA 1ZFNA 1N9GB 1YKFA 2ZB7A 4YACA 3JQ9C 4OAQA 3OJLA 1DC4A 1Q7BA 4YT2A 2BLLA 2GD1O 1EEHA 4OIMA 1AXGA 1O0SA 1DIBA 1CIVA 1F8GA 1M67A 2QG4A 3ZU2A 2HJSA 1PS0A 1HYEA 1PEDA 1A27A 4XR9A 4AJKA 2X9GA 3IDSA 4F3YA 4N54A 3SEFA 3BMOB 2ZK7A 2R2GA 4I9HA 3NX4A 2OO5A 4B3IA 3P7MA 4HNHA 3I6QA 2CVZA 3OQ6A 2DC1A 1P1HA 3IP1A 4K6CA 4XR4A 2OL4A 1DLIA 3WFIA 5CEFA 4JROA 4PRLA 1IZ0A 2CD9A 4N18A 1E3JA 1LSJA 2Y66A 2X0RA 3GAZA 1P33A 4XJTA 1SB9A 2C07A 4HADA 1GFSA 1LX6A 3CIFA 3DOOA 4Z0HO 4B7CA 4CMIB 4RL6A 2YFQA 2Q2QA 4JJGA 2NVUB 2OORA 2FP4A 2NTNA 2Y1CA 4CMEC 1QP8A 2EIHA 3DB2A 3RROA 2LDXA 5JAQA 4Q3AA 2Z5LA 3ZWXA 1E3SA 3WSVA 4FSHA 2Q46A 3SBOA 3LYLA 2EKPA 4MKRA 2C7VA 3L9WA 3RFVA 5DZSA 1MGOA 4KTVE 1J0XO 3COSA 3BTVA 2HMVA 1BW9A 5A9RA 3H3FA 1I2BA 1ONPA 1YDWA 3ANNA 1YRLA 4Y67A 1CEQA 1F06A 2GN6A 2IXBA 1UP7A 2J3JA 4GX0A 2FPGA 4OXNA 1OC2A 1DAOA 4RVFA 5B4TA 3STHA 3PPIA 4CM3A 4PN3A 4YAIA 5FF9A 3K8ZA 3K96A 5IDQA 5B4VA 5AOVA 2PKQP 1E6WA 1TT7A 2I76A 3H2SA 4BUCA 1O8CA 3MTJA 1RM5A 3PQEA 4YRDA 3ROKA 1PQUA 6ADHA 5BQFA 4L4SA 5DCWA 3OMLA 4NIMA 4K1LA 4XGIA 4BNZA 4OL9A 1I3MA 1V35A 2YYYA 4I5FA 5G0SA 2JAHA 1GCUA 1RM3A 1E1LA 4IZIA 4Q3NA 3NDRA 5T8KA 2GCGA 5CDTA 4MKZA 5L9AA 3HNPA 4PLHA 3W6UA 4WLVA 3VC7A 1E7WA 3DBLB 4RPKA 3CPSA 3E5RA 5ITWA 5F21A 3ZNNA 4NH4A 1WMBA
chains in the Genus database with same CATH superfamily
4NFYA 2CDNA 4HNQA 3DV2A 3EJ6A 4MGZR 4HLUC 2O2DA 4JUFA 5EKUA 4OFXA 1JFLA 4MTCA 3MCAA 4AMGA 4NONA 1GPLA 3NCTA 3AJAA 3CR3C 5KYXB 3BA6A 5CLHA 1FC0A 4I2NA 3HY4A 2YHSA 3CXRA 2CYBA 3PICA 2OFOA 1JSLA 3ACBA 3T3GA 2O1EA 1X39A 2Q21A 2Z09A 5CJJA 5ALQA 2NO9A 4X20A 4BNYA 4QQRA 3RDPA 3SY8A 7ABPA 1QJ4A 5FT9A 4BNNA 1NP3A 4C7MA 4GI2A 1IIRA 2R44A 3QELA 4ZCQA 5BSRA 3UBMA 4YCCA 3I2KA 1IXYA 1T9KA 1VKOA 2WSLA 2VSNA 2D0DA 2YW2A 3SGLA 1E4YA 1P7PA 1U2DC 1RQRA 3BGWA 3QKIA 1JR3D 4YT4A 3H1TA 1G5HA 4N3CA 4UMEA 1Q0RA 1SUAA 2P1DA 3MQ2A 1R0YA 2FSHA 3FJOA 5JPDA 2O4UX 2ZPUA 5TQ2A 4XSGA 1IHUA 3MT7A 5C51B 1PQ4A 1UBGA 1E7YA 2QE7A 3HUEA 4IQGA 4FK8A 2VL7A 5HKLA 3P0FA 2QDKA 3DMTA 3OLCX 4U7TB 3BG5A 3EGCA 2FUCA 3UJ7A 1T13A 3RVJA 5B3KA 4ZO7A 2KW5A 1VI6A 3KAPA 4NU5A 4AJ2A 5K8JB 4LDPA 2GS9A 3ZHBA 5KIAA 4OHPA 1JQ5A 2CYCA 1YIDA 4JLUA 1R27A 5EEHA 2Q5CA 4RABA 1DX9A 4WASA 1Z2AA 2YHBA 4OU5A 2JZCA 1XVTA 4FGSA 3H9JA 4A15A 1SG9A 3IJ5A 2YVUA 2QRUA 1EFPB 4G36A 1RACA 3LUAA 4MLPA 3U3XA 1Y98A 4PTLA 5IXSA 4QTZA 1P60A 4E08A 3UMVA 2AXQA 1S3GA 1JS1X 3MQ4A 3NWEA 2DPHA 3OZUA 4J4HA 2FEKA 4MQEA 3I5XA 5FI0B 3V34A 1PWXA 3QPAA 2Y8EA 5K9ZA 2NZ8A 3PKZA 2IV3A 5KPJA 3NHZA 1UH5A 1NBOA 1SHZA 3REFA 1V3QE 3K0CC 1UBLS 3RVRA 3ENQA 4P7BA 1J00A 3CVJA 3U3OA 5B6JA 3T7AA 2ZRNA 3WYAA 1Z33A 3BXPA 3NONA 4L2IB 3LD9A 2D0IA 2OZKA 4LBWA 5JO9A 3AM5A 3I01A 3VR1A 7REQB 1Z3CA 1H1LB 2FYTA 4ECEA 5BNWA 1ADBA 5JDCA 1QU3A 4TTIA 5EKDA 2PNFA 4BVFA 1FVFA 2Q6KA 1W4BA 1CF9A 4KJZA 1V1RB 4FMPA 4B6FA 1V4BA 1D4AA 1C7QA 4FDLA 1X9IA 3BMNA 1M1ZA 5CK4A 1KQNA 1DAEA 2XOEA 2A4MA 1FX1A 4TKUA 5AK3A 4HVAA 3LPLA 4AAYA 1WG8A 1ZXXA 1CU1A 4DFDA 1PR4A 4A5SA 2ZKLA 2I2BA 2FEMA 1MQAA 3OP4A 4KYTA 1AN9A 3DR5A 1T3TA 3S68A 2PSSA 1JFFB 3TR0A 1R6UA 2JARA 3IKLA 4BNHA 1KIAA 4WIAA 4AZWA 2P2ZA 4BKOA 3H6KA 3W6PA 3PXAA 4C06A 5HOEA 3N8DA 4O2AF 4XIYA 1Y4AE 1GO2A 3F5SA 4XX0B 1B8NA 2G76A 1R6BX 1Z5PA 1MX5A 1ZI6A 1DCTA 1Q14A 2A1TS 2GZMA 2JBHA 4L5CA 4RLFA 3Q1LA 4PG6A 2PN1A 5JCJA 4A6DA 2QHXA 2X0KA 2WM8A 2P6NA 4Y2RA 4ZARA 3TTTA 4Y1GA 1PT9A 4JK3A 2AFHB 3PEFA 1HDEA 1ZI9A 2PV0A 4P4UA 1BXRA 2MR5A 4TPKA 2K5UA 3F5QA 1Q12A 4GD3Q 5A7GA 2YX1A 1NHWA 3GJSA 4BFTA 4U2DA 2PUGA 1R16A 1UBSB 4EVRA 3F4BA 3LDUA 1E4OA 1R5BA 1TF7A 5FULA 5KKNB 1HZZC 1VIYA 3NT4A 4LOIA 3UOWA 5FV4A 4GPD1 2WD7A 4WGGA 3HBFA 4Y1FA 2AFIB 2BI7A 2HL6A 3E58A 1SUPA 1ZLYA 2P2CA 1Q3KA 2GCIA 1Y33E 4MMZB 4YMSA 2B83A 5P21A 1ZAYA 2R11A 4OTZA 1E2EA 3OTWA 1ZGZA 3KSZO 5L7WA 3CF2A 4K9NA 1L1RA 2TMKA 2QTVB 4ABTA 2ZYIA 4B2IA 4X6UA 2DLNA 3D0OA 3L7DA 5MN5A 1X8LA 3RU9A 3E9YA 4QULA 1AU9A 3NOVA 4IDAA 5CA1A 4Y6RA 1A95A 1LDGA 1V11A 4OXYA 2BEVA 2CCGA 2CNWD 1VC2A 5FWYA 1XRQA 4LVOA 1ECLA 4AZSA 5HGJA 4BV3A 3UJNA 3MTAA 2QMZA 2VSFA 4BASA 3MMXA 1YR1A 1TYCA 1Q20A 3AUAA 4C0AC 1E2LA 3B5JA 1TL7C 4ZOCA 2JIDA 3T1YB 4Q16A 1C9DB 4KE6A 4BGVA 4QPDA 4CMJA 3AZOA 4JAVC 2Z9DA 4PHFA 1O94D 1ZNWA 2C1XA 1GTL1 2ZDHA 3AR9A 3MCZA 4J1SA 3AUKA 4QASA 4RVUA 1CF2O 2VNIA 4GPTA 3LOUA 4GQBA 3T54A 2Z1MA 4MKFA 3LJKA 4B4DA 1QH1B 2H5LA 4H0CA 1CUCA 4WHMA 3UK7A 3NWBA 1P29A 1MV8A 4MUEA 4OSPA 5CX1B 1D07A 4ENTA 3TECE 3NHBA 1DIAA 3RUHA 2AL7A 2P9FA 3HCNA 4ZOLB 2LWIA 4JI2B 2H54A 2OGSA 4LKOA 2QN6A 3V1KA 1C7EA 1E2NA 1LPAB 4LXXA 3T94A 1WD7A 1OE0A 2IYZA 3JPYA 3ESBA 4GVXA 4X1KA 5F35A 4B81A 4EDHA 1ORDA 4YUAA 5CG2A 1KZ7B 1NVUQ 1RBZA 2E4AA 2DM6A 2O8DA 1Q21A 1MQ8B 1W4ZA 3MINA 4L9RA 2PZ8A 3I53A 3QVXA 4KWEA 3MOIA 3HO8A 6PFKA 2X9LA 3BMQA 2Y1KA 2YY6A 3IMKA 3VR5H 2J6BA 1G21A 3HVKA 4JLNA 4BLTA 3JZDA 2EW8A 5JYCA 1Z4KA 5L6LB 1DKRA 3GB9A 3PT9A 4MITA 2O8DB 2IXAA 3N58A 4GDMA 3CMCO 2BL4A 3NDIA 5AKJA 4BLOA 2CY0A 1YAJA 2VRCD 3ITDA 2V5UA 3MJTA 1QONA 4P7JA 1SD1A 3ITEA 5JWRA 1IUKA 1GQQA 2XRYA 3GRVA 3PRHA 2VHEA 5EZ5A 2X13A 2B8EA 2X40A 2ZWIA 4XGQA 3UUGA 3OZIA 3KOZA 4ACBA 3UHOA 3I6IA 4QUIA 1MN6A 5CEEA 4DA9A 5KVCA 2GTPA 1D0SA 3SZOA 1S2DA 2AB0A 2M32A 4JA2A 3DBIA 4R3WA 4CCSA 4UM9B 4R4JA 2DOKA 3S55A 3VYTB 1M2KA 2P9HA 4PZDA 1LLQA 3VR6H 2J3IA 1U1EA 2DH6A 1Y5IA 2VQ3A 4G63A 1NC1A 1YJ8A 4HRAA 1XZGA 2BM9A 3D3KA 3QVLA 4P8RA 1GUDA 2FQWA 1SBZA 3ILXA 2Z04A 4ND2A 3MGBA 1I6MA 4IH4A 1WVMA 1PF7E 2PFKA 2HMYB 3U1BA 4DDMA 1T9DA 1OXUA 3CX6A 4CKEA 5ECDA 4RH0A 3GGCA 3JQ6A 4Q4HB 4A82A 2Q3BA 4WBNA 1M8KA 1YXMA 3MWJA 3D1VA 3P2YA 1UDXA 4LI3X 3T7CA 1F4VA 1EP1B 2ATIA 4BMYA 3BH6A 3ADPA 4TTAA 4BO5A 5AICA 1S9DA 4BLSA 4R84A 2XYHA 3CCBA 3N2GA 1M75A 1BN7A 4AI6A 3N7AA 3WAJA 4FYYA 5CDYA 1H1TA 1JPNA 4NATA 2J1LA 4HFJA 5IZCA 2HUNA 4N5LA 4HX5A 2A9JA 3X43A 4FINA 1NUPA 3KKQA 4G8CA 4J9VA 1QZZA 2PZFA 3N7TA 4XQGA 2GESA 4EHKA 5F7XA 2WBLC 2FLWA 1BQ4A 5I7WA 3GV0A 4EG4A 3W2FA 1CUUA 4Z0NA 4FB5A 3V80A 2FMIA 4RWEA 1E0SA 3WMWA 3WGLA 1CHDA 3OKFA 3RBZA 4B4OA 2CLFB 1B0PA 4ODIA 1YI1A 4OHFA 1ZOPA 5JSYA 1CULC 1ORIA 3LCMA 1IYZA 3MS4A 3BJMA 4TN1A 4GLJA 4G81A 5EWMB 5K3FB 4PE5B 4JXXA 2FEOA 2FXVA 3I83A 4W5HA 4EZEA 4A91A 1T8UA 2YIMA 1JEQB 1T3GA 4V0SA 2AZ4A 2GOYA 3SVLA 3GPIA 1VM6A 2AUNA 4KGXA 4NDZA 4H0FA 2QZPA 3BE5A 5E6SA 1G2OA 2GAOA 2BGLA 4S1NA 5BUCA 2RONA 1HM5A 4FOTA 2D7CA 2FPLA 5K4AA 3HDHA 2DPXA 2PGXA 1NASA 1XMPA 4F21A 4DADA 3WKCA 4IX1A 4KW7A 4Z86A 1JECA 3HCFA 4LYAA 2VCHA 1RQ2A 4XWOA 2NVWA 2FWBA 3TX2A 5K0ZA 2Q9UA 3DCJA 1XXHE 3HCOA 4Q6BA 2H08A 2M1ZA 3ZLBA 2PJZA 4Q7QA 4W82A 1F20A 1C7ZA 1RYHA 3H9GA 3TJRA 3U4IA 4ZC8A 5BT8A 3G13A 1A4XA 1GZ7A 1C0EA 3UAVA 4Z54A 3EHEA 2VYNA 5IJ0A 1LC3A 2ZS7A 2ARKA 1W1WA 3GLRA 3I64A 3L1IA 4CTKA 1OFGA 3NVMB 2DHEA 3GFVA 1CY1A 1XZEA 3VI3B 1U2TA 4X20B 4AX4A 4RHXA 2BZ1A 1ZSNA 2AJDA 3IR7A 2DJ5A 3D6HA 5BRNA 1XDUA 5TMEA 3QELB 4QODA 1VKRA 3MM4A 3DFZA 2R6FA 3QXCA 2OCXA 3GRAA 4D9CA 2PCLA 3ADOA 4IDDA 3BK1A 1JR2A 1TIKA 4BKMA 2R1VA 2ZJ2A 2CUTA 1Y5LA 2P62A 4OI2A 2K87A 3MUNA 4TRMA 4WFIA 1L9KA 3VYUB 3UK2A 4DSNA 5FUYA 4I36A 5EJ5A 4DZRA 3JAKA 3FMGA 5TQ2B 3AG5A 3PE6A 2RGGA 1GPDG 3PHJA 4BAZA 3NTOA 1PR3A 5FPKA 3K2EA 3QVVA 1PVOA 3WLSA 5EIBC 5C8VA 2H29A 2VUUA 3NS7A 3DMPA 3R3SA 2NTEA 2WHXA 2AZMA 1ISRA 1WF6A 1LSSA 4FOOA 4MCJA 5GPBA 4ZWNA 2W70A 4YLEA 2DPYA 3SAJA 3UWKA 5K2OA 3NC4A 3FUCA 3OC6A 3C74A 1ZMBA 2BBSA 2DFVA 3OEHA 1MP0A 2WV7A 4PO8A 1LU9A 3K32A 4UASA 3AYZB 1T36B 5IAKA 2O2YA 2ZUUA 1RWPA 3USZA 2OVBA 2XRZA 3Q2OA 2J3LA 1LSUA 2QVCA 4OVKA 3G2PA 3ZK8A 5KQLA 4XD7A 3OJWA 2ONYA 3B1WA 5KUTA 5LNK1 2YJTD 1C5KA 2VQDA 1KIFA 2Y6VA 3OCJA 4JEIA 5D3ZA 3C43A 2PUEA 2C3OA 4MQEB 1LA2A 2GN8A 1ZVVA 4MVJF 3G1WA 2Q6VA 1DG1G 2BHNA 1PSZA 2XGMA 3CX3A 3MLBA 3TN7A 2H1SA 3OECA 3AF1A 3V1NA 2IPNA 2P4SA 2PYZA 1ECJA 1XYYA 2ETVA 1M34B 1N2SA 2QAGA 3KJFA 2D1FA 2VRWA 2A58A 3B3GA 1VRWA 2FHPA 5FOSA 3RBVA 4KMMA 1I2CA 4KQ2A 2QUJA 4MW1A 4X97A 5JMTA 3IUMA 4KXFB 4RGQA 2QXTA 4FMCB 3D1JA 4X7BA 1K5PA 3Q6IA 1Z4JA 2C94A 2F1OA 3KM0A 3LYHA 3OE7A 4AIRA 3L2OB 2WIKA 2YNMC 4EYEA 4NVRA 2ZFUA 4HAYA 1OIVA 4MYCA 5AJUA 2XLCA 3KEMA 4B5LA 3JRXA 4YJHA 5C1PA 3FHTA 1Y6ZA 3BMNB 1HF3A 4FZ5A 4UC0A 2BGRA 4TKUB 4B2LA 4F6RB 2ZROA 4CM4A 3OT5A 2PX3A 4PSDA 4WFJA 2FMUA 1E6MA 3I37X 5E3IA 4HNGA 3BULA 2EFHB 5ILOA 2VK4A 4B4WA 1U3TA 4O25A 1M5RA 1PR0A 1MIOA 4J0QA 3TFWA 4ZGGA 4QQ8A 4ZD6A 3IFSA 3SJ7A 2G04A 1GPJA 4AJLA 4BEVA 4DTCA 6CHYA 1FU8A 1ZZGA 1R5OA 5TC4A 1BEEA 1QK4A 4WXMA 1FRZA 4QDKA 4E13A 1T0HB 5AVKA 1TEHA 2CLLB 2ZYVX 4MRMA 2ONKA 5FRDA 1LPSA 3OC0A 4HC4A 2VF4X 4RDIA 1S4MA 2PMCA 2RAUA 3GCWA 3PFCA 2ZETA 3QSGA 5LL6P 2UZ3A 3I8SA 3KBBA 3TSWA 4C3ZA 5CTAA 1J9ZA 2OCYC 1MORA 1JV2B 3HCDA 2B1IA 1OVGA 1U0RA 2PG3A 3ECAA 4UULA 3V4ZA 3DDCA 4BE4A 4EIWA 1Z25A 4KBFA 2XOKD 3QVJA 5H7XA 3NNDA 3AVOA 2RAPA 4R9NA 5EE9A 2QA5A 4AQ7A 2H59A 1S8AA 4I4IA 4M8IA 3FI0A 1UOQA 3OJFA 4CG2A 4GZMA 4IUBS 2O8BB 4G0NA 1LBSA 2BHTA 2O7NA 5LUBA 2H7CA 3I73A 1Y8AA 4CHGA 1E0DA 1E6CA 1GKKA 4ZCLA 5GV7A 5ILGA 1OPRA 4EENA 3EZ2A 2O2CA 4TTVA 3B8HA 3DHEA 5IFLA 1SIWA 3VR4A 2H16A 4CMGA 2G5TA 3EDYA 3DF7A 5HR5A 3MSXA 3Q85A 1BJRE 2WPDA 1JKJA 1MAVA 4QO7A 1X8KA 2BFWA 1T91A 2JFVA 4K0RA 4DIKA 3C70A 1I1NA 1V37A 5AM5A 3SK0A 3LXMA 1GNPA 4AB1A 4YAKA 2BEVB 3KYCA 5FWYB 2G6BA 3QUAA 4R2JA 4GM4A 4W7SA 2CWDA 1JHMA 1ZZEA 2FY8A 2H4WA 2WF5A 1DB3A 3AB8A 4L50A 5DT9A 3JVUA 5ULLA 4ZYYA 2HIAA 1NMYA 4ZOBA 4NX2A 3RUCA 5EJFA 4ARAA 5GJWC 4B3GA 4BGEA 1E32A 2P3SA 2ZIGA 1N7HA 1NR5A 3GBPA 3RK0A 4Y6GB 3TLXA 4L6CA 2CZGA 3I45A 1LPNA 2NX2A 1DEHA 2X5XA 3ON5A 1K6MA 1RXIA 1TCCA 1SUDA 4G9BA 4HZUA 5K0GA 4JMPA 1C29B 3EPLA 2PVCA 2PKCA 4URUR 1PGJA 1RQPA 2VDVE 2RFLA 2ZYWX 1OYOA 2MYTA 4BO9A 4AF6A 1Q0HA 2DBVO 3ZHSA 1X9HA 2RHDA 1SVWA 5K1ZA 3LYAA 4PHHA 1IBCA 4NHOA 4QRDA 4PLFA 4BNUA 1AMUA 1FVXA 1M66A 1VL0A 2D5CA 4W1SA 1H0HA 4GYYA 1XPRA 1ZP6A 2J08A 4X1KB 4YLYA 2F4VB 1ZK2A 4MB0A 2RGXA 2P6RA 3HVJA 5F33A 3OH8A 2G09A 2W8BA 1DAFA 4KUEA 4Z7JA 2G06A 4NAVA 3C6QA 4IJKA 4CU5A 3BMQB 1MBZA 2HHHB 1LZKA 3D6UA 2QLFA 1B00A 1G21B 5EIOA 2H52A 4LX0A 2IY8A 1MW9X 3CE9A 2OYSA 2G70A 1V4NA 1KZ1A 2UVQA 1QP0A 4F9GA 2VZLA 3NM5A 2G77B 4OB6A 1YQTA 4KZKA 3WP1B 4MUIA 3C24A 1M5UA 5JFOA 3J7AC 4NNPA 2J9FA 2C4HA 1QR6A 3L0OA 4G5GA 4L4UA 3ETGA 3OTHA 4N6GA 3M1AA 1YRHA 4KWIA 5F9FA 3RQIA 2FR8A 3M0EA 4ZQHA 1C4KA 1XQ1A 5DTEA 5IM5A 1ATIA 2VSYA 1E8MA 4JKOA 1KOFA 4RAQA 3QV1A 1G5QA 1Q15A 3MCUA 2W2OA 3ZKWA 2GFIA 2GKGA 4D97A 2UUAB 2QZSA 1TB4A 2Q8QA 2F62A 3SBXA 4OG2A 4B33A 2IYWA 2EGHA 3DDUA 1NLZA 1KTVA 1K8ZB 2C2KA 5AM4A 5JYEA 4M53A 2WWVD 2I2WA 3QPVA 2NQ2C 4K0KB 4HP8A 3LX6A 3T3OA 2WOJA 3NRJA 1N8KA 2AJTA 3IX7A 4TKVA 4TTRA 1OGIA 4FI3F 4WKGA 1U04A 2GZ2A 1C3VA 2AQIA 3F7OA 3KSUA 2FLKA 4U0JA 1P2DA 3IRVA 4CKEB 1ZOIA 4LC1A 4TUYA 1PTJC 2JGEA 4WBNB 4IVPA 1RKBA 3K5PA 1SBTA 4LQLA 4DUGD 2PZJA 5BSKA 1VJCA 5BUQA 4A27A 1HWYA 1CTQA 2EKLA 2YIDA 1HFKA 4KH1A 1W581 3U17A 3V1MA 3DL0A 1R0KA 1KFCB 3N2GB 1T2AA 3GUZA 1VMKA 5DP2A 1F4LA 3GCZA 4NYJR 5AUOB 4X62B 4UPDA 3W6NA 1I3CA 2X3UA 1LW7A 1UZNA 4B4KA 4S24A 4EQ6A 1BQ3A 5E8RA 3HJNA 4KR9A 4JI6B 1DE0A 2Q6IA 5HE9A 4YRGA 1T0JB 3THSA 3W3AH 2RH9B 3RS7A 3W5SA 5JR3A 2BJWA 1G1AA 2C7GA 3ROPA 2CF5A 5M5BA 3OHSX 5TPWB 1MXHA 3TXYA 1TJNA 3DPUA 4FNGA 3IT3A 1V1MA 1X1BA 3P2OA 4KV9A 3PEYA 3FPHA 1TNDA 1ZY2A 3ELYA 3QHAA 2MYPA 2RBGA 3BK2A 3ZQKA 3NHRA 4E5UA 1Z29A 4F1WA 1R5JA 3LL4A 4ZT5A 1JG4A 4YWJA 2QMHA 1JJ7A 2GK6A 5E6SB 3H65A 1Y1PA 1ZXBA 3CLTC 1QO7A 2GLTA 3Q2IA 2WICA 3VVMA 5D2CA 4FDMA 2WWIA 4BYMA 3ER9A 2Z5VA 3SLGA 3OSUA 1VPWA 2HLDD 3INTA 1G42A 2IZ7A 3GJ6A 4M89A 1ZD9A 4URYR 5IBQA 4BQIA 2G9UA 1OFTA 3CH5A 1B0UA 4LBZA 5DTIA 3AR4A 2Z2YA 1H0KA 4D26A 1KERA 3A27A 1YQUA 2AA3A 2RGNA 1EDEA 3BEOA 5DW0A 3BGOS 4FUQA 2AG6A 2O05A 3VOAA 3VYSB 2O19A 3H75A 3LH5A 2VJQA 4TLDA 4UNPA 2JZOA 2VK8A 4X71A 3ZD6A 2ACVA 4LHYA 3FFXA 4EJ2A 4CTMA 2ZW9A 2X2OA 1OX4B 2BMVA 3ZHZA 5IRCD 4CL3A 2VDRB 3A25A 5IJ0B 1FRVA 3DKRA 4BXOB 4YMTA 3T9EA 3K20A 1PWEA 3SXJA 3ZE0B 4TL8A 4Y8VA 1WZIA 1L5QA 4BWVA 4Z4QA 1Q0QA 2EEZA 2JGAA 1YL6A 3BZWA 4COKA 4BNXA 1S3IA 3FTFA 3ZXYA 1U99A 2AFHE 5CXXA 4RVSA 1HI9A 1XHEA 3T5CA 4Q24A 4FNOA 4C6HA 3RSSA 3QKSA 4R6WA 1LWOA 5EHXA 1U98A 4NZZA 1UAYA 1ZJZA 1NZDA 4YRAA 1ISMA 1D0VA 1KAEA 2FRDA 4ZGWA 2QYTA 2R1VB 1HE2A 1DKLA 1EIZA 1U81A 2JK0A 4EI7A 2DHRA 3E2IA 3PU6A 3Q3HA 5KNBA 1U8YA 1ZMRA 1TQHA 2AFIE 3JAKB 4OP1A 5GONF 1Y0BA 4BNVA 1UINA 1SVNA 4CE6A 1EWQA 4V0NA 4HDRA 3NIBA 5JBIA 4J3NA 3ABSB 1YB7A 2P0EA 3E4DA 1UZLA 3OA2A 2XT6A 1CY6A 1M8PA 1CJKC 4QXRA 2FZ5A 2EU8A 1IQUA 1KKLA 1WDLA 2RGDA 2VNAA 3OU7A 4R9UC 2JHGA 3KPYA 4F7WA 2X8AA 4WKCA 1JNYA 1QMPA 4IHAA 1LXCA 4JLPA 4Y9UA 4RDXA 3SR0A 4WH0A 1FRNA 1C50A 1HDCA 1G3IA 1PJRA 3T5MA 4G41A 3TTXA 3QVKA 3H0KA 3ZWYA 3L1KA 1BDMA 3FYHA 2XOXA 1IRIA 1TZKA 3T9AA 2A0XA 3DO5A 4BQNA 5KQMA 2NTJA 2G0AA 2LCQA 3RC7A 2O1WA 2ZIXB 3WK8A 3QE3A 3LOPA 4FW8A 1J1UA 3AKCA 1T2UA 2M6KA 3A3YA 1XTUA 4G9EA 3GP8A 1BAPA 4NV0A 1B1CA 3PXUA 3D8TA 4X8MA 2GBLC 1QV7A 1C1YA 2EZ4A 2QAGB 3GPBA 1JHVA 3FVWA 3BGDA 4GXTA 4RFVA 3LSTA 3SM3A 1T4GA 1BIFA 2CLMB 1UK6A 3GMDA 4Z9BA 1JG2A 4O33A 4ICIA 2OZPA 3I0NA 1NVVQ 3DC2A 2R6DA 2RHLA 4I8XA 2FQXA 4D45A 1FS5A 1S2LA 2DX7A 2CHUA 1IY2A 4JZYA 1TRHA 3LHSA 4Q4DA 5CYFA 1IZ8A 4UHJA 4YJHB 1SC4A 1C8KA 1Y6GA 1NYLA 4N3BA 3NDBB 1Z74A 4F86A 1GAWA 1SWWA 3OESA 2PMFA 3TE6A 1K7CA 3PYLA 1EFVA 3KQLA 3BA1A 2JAWA 2J3KA 3H11A 3IQEA 4ND5A 2GMWA 1QQ7A 4O2BB 3LQYA 1DRVA 1VL5A 2YJ6A 3LA6A 4INAA 1RZRD 1XTPA 2GJSA 1P3Y1 1MIOB 1Z5UA 1TEVA 1UT5A 2IBMA 2R3SA 3P45A 3TL6A 4E5NA 4UQLA 1ESEA 2FV8A 3JD1A 2OHJA 2ZG6A 5FL7A 2XA2A 1AD2A 1U4NA 3WHKA 2GN2A 3AXTA 4IH9A 4U8HA 3ROEA 2GEBA 3ZWCA 1NLMA 4WK6A 2X76A 3JVVA 5BORA 2ZCJA 3HNOA 3T5BA 3WYCA 5CPFA 3DFMA 2I3AA 5EKXA 3R7DA 3RC1A 3FDJA 2II6A 3K6RA 3NHKA 1E69A 1E9EA 3HWWA 1N2EA 3TKAA 2R48A 3UG6A 3RFFA 1ZM4A 2WT8A 4XASA 4ZI7A 3UY4A 5A03A 5AVVA 2B4AA 2H0RA 4Z51A 1GCGA 3LWNA 4US0R 2Q4RA 3W5UA 2DQYA 1JG1A 3DW3X 1GUFA 4I50F 4EA6A 3MWGA 4JLMA 4FJ1A 4V03A 1XTKA 1KQFA 4Z2AA 4DRXB 4TQUS 2C7BA 1T1JA 2A88A 2NAFA 4DQUA 2MSCB 4D9KA 2KS6A 5JXGA 2CBXA 3BOSA 2HZBA 4E2ZA 5KPDA 1N0WA 4DXHA 2AK2A 1SIOA 3EVEA 1HV8A 4EGQA 4IDOA 4CFSA 4OBBA 5KNCH 1ORWA 1YC2A 2NYRA 1RVDA 2MSKA 3E1SA 2XWPA 3VHRA 4DW8A 1YHZA 5EHIA 4I4CA 2WUEA 2QUZA 1M2VA 4LK2A 3TIIA 1N5DA 1F2UA 2OUIA 2WF8A 3NB0A 4IJQA 4B8YA 3BCUA 1YFZA 1L7NA 2R79A 3MZ0A 3IQZA 3ZIAA 1FDTA 4L3WA 2EEPA 4HR7A 3HP1A 3QHQA 4PZ9A 2I33A 1OXTA 4QBGB 4BFVA 4EP1A 1DTEA 3LYUA 2ODTX 4IQ4A 4WZAA 4Y2SA 4E30A 2WIGA 5ARCA 2POCA 3TH5A 5IANA 2EZTA 1WX1A 1CG6A 5IX8A 2XWSA 3L4SO 3WKAA 1HEUA 1RE0A 2XCQA 1D1QA 1K5DA 2J0EA 4P2BA 1SHTX 5BSUA 4DA7A 3A4IA 1SZDA 3DCYA 1M73E 4JBHA 4HZUB 4IDBA 5IM4F 4ALLA 2NQTA 3FF4A 3WWYA 2PTGA 1RE1A 4HUQA 2WIAA 2EL7A 4ZAXA 1KE2A 2Z0MA 4L22A 2JD1A 3AR3A 4MQMA 2NZ2A 4H27A 4AKIA 1DNPA 3PFIA 1C9KA 5CDHA 2EHDA 4PS1A 4TMFA 1MAWA 1TZ2A 3C8ZA 3JQQA 3OFJA 4BWFB 3MHTA 3GJ0A 2YASA 4HPWA 5TF4A 3BRWD 4X44A 2EOAA 2XJ4A 3JQCA 3R23A 1EXNA 4Q9HA 1B6TA 4IIBA 3UUWA 2VTBA 1R0WA 1O2DA 2BPOA 2JI9A 3AWDA 4GI7A 2VTEA 3EEQA 1KAMA 4A7PA 3PNSA 4X6LA 3I6BA 2W8BB 3M33A 2DECA 3WK4A 2VG8A 5JZSA 1BCSA 1M6HA 2RBEA 2YWJA 1KI4A 5I9TA 1NDQA 4FLFA 3DT9A 2C58A 4NENA 5HCNA 4MQBA 1Y6RA 2AKEA 2IEBA 3CZPA 4R0MA 1EX1A 3HDQA 2B94A 3EOAI 3NOOA 3OIDA 5LQRA 5CFZA 4NQRA 1OWNA 3AK4A 4UDYX 2Q0SA 2P2YA 4ZYLA 3IQIX 2JGDA 5JANA 5AW5A 1QIFA 2UDPA 4RY8A 3HKDB 3IUNA 3V00A 2ZSFA 2YRXA 2ZVQX 5LQUA 1WB9A 2REQA 3C5WP 3ADBA 1EYZA 3ESRA 1D6SA 2JH3A 3KJNA 3AR6A 4JVMA 3PNBA 5ALMA 4R7ZA 4CGYA 4BTEA 3VNQA 5C8ZA 4I99A 4WBSA 4TWIA 4I4NA 4MV0A 1M7HA 1R00A 4HLQB 2H5JA 1IN5A 4KIUA 1VJRA 1JXOA 2XSZA 1TA4A 4JXKA 4OP3A 2HB6A 5TVGA 4LG1A 1ENZA 3D2AA 5KQGA 4KCGA 4AMZA 2H92A 5CFPA 4GR4A 1BW9B 5EMKA 1ZAKA 3VKUA 1PZFA 1L4HA 4F72A 3KJGA 4RIFA 5D51S 4TKVB 3PWSA 2B7LA 1YZKA 4UOQA 3TXXA 3Q6MA 1C2YA 1E2JA 3TIVA 4XE5A 3X44A 3R5HA 4RJ2A 2E87A 3RSCA 2R8OA 4JC5A 1USUA 3HCRA 721PA 2PL5A 4B09A 3RWMB 2ORED 1HLPA 2HA0A 1YZLA 4DLPA 1SXPA 4EBFA 1Y5MA 4TUYB 1U8XX 2HF7A 3OQHA 1NP6A 1ZCAA 5T6BA 4E0BA 2YMLA 1A4UA 5BOSB 2I6FA 2YWBA 3FOAA 4RAOA 2QRZA 4I0WB 5EE1A 3UKDA 1E6LA 1P4RA 1MIHA 5D8DA 4I2VA 4BFUA 5JFGA 1W36C 1QRDA 5DO9A 4PPQA 3H2BA 4J91A 1YS9A 4FFPA 1ZINA 4RACA 4WTOA 1DAGA 4IUCS 1QG0A 1PTKA 1UOOA 5ICCA 4OH7A 1XD2A 1KNXA 1NVFA 2B5VA 4KPFC 3VR5A 4G26A 5FBQB 4BY9E 2BFFA 5HQJA 3WLEA 2L19A 4EQ6B 3TW4A 2X6RA 3G2LA 1RXYA 3H1PA 3OEWA 5AM0A 4BQEA 4YRCA 4ZMRA 3T52A 1MB0A 2ZBQA 4KWTA 4GFDA 4HFNA 4F4CA 4N5DA 3TQOA 5BXYA 2GHQA 3TQRA 1VCMA 2OCBA 1LV8A 2XDQA 1KYWA 4XLTA 4E32A 3U39A 4E2WA 1V1MB 4C6SA 3KZKA 4DBLE 2FG6C 2IL1A 4HSGA 3ZDEA 1BDBA 3QEMA 3EEFA 5CM2Z 1M34E 3GLFA 1Y7TA 2JKYA 2W5UA 3AHEA 1ZOSA 1Z18A 4F5DA 4QPZA 2QX8A 2Q1TA 2AWNA 2CXOA 3CRVA 3V4OA 2BTQA 5E1BA 1RWOA 2W00A 4Y1EA 2XE7A 4YPOA 1QMGA 1GG8A 3ZE7A 3N59A 1UWCA 1ZK1A 3IULA 1YZQA 4J6EA 2JHCA 4UTRA 1ECCA 1BYUA 2P79A 3VR6A 3NHLA 2J3EA 5LZ8A 3GZ4A 4I1UA 2W6OA 3WGNA 1NQVA 3F5DA 3PFNA 1T35A 5LYYA 3PC4A 4LOLA 1MJGA 4U8GA 5D3MA 2O8VA 1Q2UA 1KOLA 3R7AA 4TLAA 3ND5A 4I7EA 5KHLB 3A9CA 3CO0S 3SZRA 1DG3A 3CVUA 1U1FA 4RKWA 4Z99A 3GF4A 3BREA 3FPJA 4W8GA 5DX1A 3JRWA 4HYEA 2OCDA 3MYYA 3GCXA 4JLAA 4JX8A 1OT3A 4R0NA 4S3MA 2BEUA 2Z98A 3DTVA 3MJCA 4PFKA 1XLTA 5EWJA 5L40A 2KM1A 5JWHA 1T9HA 2NYVA 4KN9S 4QARA 3VMFA 2V65A 4FB4A 4QBKA 4ASUA 1FP7A 2FRVA 2NUPA 1VPLA 2JIZA 4OI0A 1QVZA 4OQDA 2O0HA 2WRZA 2XUJA 1BHQ1 2IHVA 1JEEA 1LPBB 5FXMA 1RMTA 4CM7A 2A78A 5AJZA 3N3BC 3NPAA 4MVJP 3NAMA 3IDQA 1C3XA 5TDHA 1F8YA 2QVYX 1PEKE 1W0KD 2YICA 4D96A 4EMTA 3QKSB 2GCEA 2PA3A 4TWRA 4LWOA 2K6GA 2PZBA 4LY6A 2VT3A 5H59A 4GBED 3DMHA 1NBWB 3A9RA 4EL5A 1ND5A 3FUWA 5DT2A 3ZY2A 3ZW8A 4CIAA 3AKZA 3WGKA 1SEVA 1VL1A 3OCYA 1Z8DA 1LFAA 2J9XB 3EA0A 2W90A 3MGAA 5L4SA 1UDCA 1XDZA 2DETA 2QF7A 2FWIA 3S2ZA 2OY0A 3WK7A 1O9HA 4CV2A 4O2LA 1WA5A 2QLJA 2QRNA 2QX7A 4ZU3A 4C03A 4Z49A 3TR5A 1GFIA 1HRKA 4G97A 1CR1A 4F11A 4MR8B 4I1PA 1Q19A 3CSDA 5ALHA 4NS4A 4HDRB 4KWHA 3EGXA 1RD4A 1P45A 4TSKA 1ONOA 1NUHA 4B8WA 1ESCA 1SRQA 2C2ZA 2ZVPX 4EUEA 1XMXA 1NBEA 2BLNA 2ZJ0A 3D8HA 3NWOA 2R7KA 2IUUA 2Z58A 1BX0A 1NONA 1HK7A 4RK7A 3T1HB 2CL6X 3AR8A 1VGQA 3L4BC 4ZVUA 2C2OA 3FX2A 1UT6A 4L8VA 3JV7A 4RM3A 4F4UA 2B61A 2IEGA 3ENWA 2DAPA 4R9VA 4N0MA 5A9TA 3MTEA 3RF7A 1Y63A 4IW3B 4DDTA 2R00A 3U60B 1Q1GA 5JSFA 3HYLA 4WY5A 2GYYA 2ZSKA 1BMFA 5DYTA 1CZKA 2IGBA 2GBFA 4C2AA 4P4LA 1U0BB 3F46A 3VC2A 2AI3A 2HOQA 2MHCA 1QIJA 1XIVA 4IDCA 5FBRB 4CMBA 4DM7A 1AURA 1N2GA 1M8FA 1CP3A 3AI1A 3RSFA 4D9IA 1GRCA 1KC1A 3RAEC 1Y6QA 3QY0A 1K7YA 3NP9A 4UFOA 2PM8A 5AW7A 4DSZA 2ZPAA 1ZCFA 1Z15A 1M2FA 2JH9A 3TMYA 1W1IA 1SVSA 1ONSA 3DMYA 4CL8A 3IBCA 1PZNA 5JI3E 3IPLA 1WPXA 2ALJA 4M9UA 4GOJA 3BMCA 4EPVA 3IILA 3UMJA 4IOJA 4JI5B 1XZJA 3TGWA 4E12A 2GI4A 2RGAA 2XD9A 4LVNA 1AO3A 4G1CA 2X7XA 4M0MA 5IZ4A 1G21E 3NH9A 3H11B 1YUNA 1ZA2A 3TINA 3ZD7A 5ENVA 3N39C 1FK8A 5GIOE 1D4ZA 4P0QB 3I0MA 3FVRA 2XX3A 4A8JC 1QB7A 4BQRA 4DDWA 1RLIA 3ETLA 3CCFA 2BGGA 3DMDA 5CT8A 4PZCA 1W6UA 3ZE2B 1HQDA 3NDPA 3G59A 3W78A 2D5AA 1GQFA 3A2NA 1LB1B 1RCTE 1LSOA 3QU7A 4DVGA 1EE9A 3IAFA 4FBGA 4PR0A 5C7YA 1X7WA 2WT4A 4GVLA 4X3PA 3A36A 1P2GA 3DSRA 3OOHA 5DX8A 4F9FA 3PDCA 4P7GA 3E8SA 2BEWA 1ZGGA 3FPLA 2IC5A 3AILA 3DG9A 3QWFA 2DUWA 4DKXA 621PA 4QHYA 4ZI7B 1FJ2A 2GD0A 2Q0QA 4QXPA 3WR5A 4GKAA 5BSVA 1LDNA 1T24A 1ZUNA 3T1QA 3GLGA 1CV2A 3S7TA 1P2FA 1QXSA 3D0KA 1TTTA 2JVIA 1QPBA 1EK6A 2OYCA 2WVAA 4GRDA 4M22A 4BCBA 4JHXA 4G1FA 5T4EA 3SFVA 1KJNA 3ZUPA 2QVZX 3HBLA 1PI3A 3A7EA 3KOOA 3R0ZA 1T6NA 3C7TA 1X1TA 4Y0NA 3U4AA 3W8DA 4DCUA 3TRJA 1KWGA 4KPYA 1JLLB 1MZVA 1RJEA 1Z45A 4MLCA 1X87A 5JH7A 1KPHA 1KRXA 2ZR9A 2H48A 3FKSA 1A2QA 1RR6A 3MTDA 3OSZA 1BVUA 2O14A 4BEWA 2G9RA 2ZBDA 2FH5B 3BGSA 5IN4A 4OLHA 2VF5X 4DC1A 2WYVA 2BF7A 2PWBA 3P9KA 3ZS9A 1U7ZA 2YHUA 1KXJA 4G2TA 2QU8A 3RU2A 2DXIA 3B70A 1M2VB 1E1MA 1RCUA 1B41A 2VAWA 4JYPA 3HDGA 4MAMA 4PPGA 4XTRA 4Y2TA 4ARIA 4IFEA 2C5FA 2QUIA 2ZI7A 3FYUB 3G0DA 4H3VA 3ZIDA 3PYMA 4HMOA 1Y3HA 2G9QA 4LGCA 3D4OA 4K6MA 3LCJA 2NPOA 5B4UA 2FP3A 2BD0A 3H5AA 4WZAB 1NI4A 4ETWA 4FFBB 3K6JA 3QBDA 3FETA 1HTBA 5BR7A 1Q0TA 1BDHA 4ZHSA 1UAAA 1UPTA 3HHPA 2J6IA 2YZGA 1OI7A 4GLFA 1NY6A 4YR9A 2IFTA 5D3QA 1EPUA 1DMRA 4KNVA 4PLYA 2W2XA 3DXYA 5DNAA 5IKOA 1WQ3A 1PAUA 1XLVA 2ZZKA 2Y0DA 1WY5A 2VHTA 3KB1A 4E7PA 1JQAA 1SG0A 3DZ8A 1Q22A 4HUQB 3QIAA 1MC5A 1PJTA 3MLEA 4GIBA 4UJ5A 3V3TA 1GVNB 3P0JA 5I47A 1DJNA 1ZCJA 2OMKA 1JHOA 4M0UA 5JCZA 2VT7A 1L4MA 4I14A 4R05A 5FEMA 4HB2A 4A03A 2O7QA 2AEJA 1GGHA 1W5BA 1JSCA 2NUTB 2QRMA 3Q0EA 4HWTA 3WE7A 2OE2A 2V7WA 2P6OA 3OPNA 3QPWA 1WCV1 2RGBA 4ALKA 1XKQA 4L15A 4PGFA 2VTBB 3GAMA 1ZGJA 1L6IA 1VBKA 4GMFA 4C2BA 1JJVA 3ZVMA 1NN3A 1K9SA 1GNQA 3LT1A 3OD5A 4QUGA 5FQNA 1JNXX 3T34A 1IAQA 4F0JA 1B1AA 3P96A 2IYEA 2WIJA 5FA6A 2X4DA 2I91A 2VWHA 3AIIA 4FD2A 2AG0A 2XTJA 2GX6A 4GECA 2WF7A 3M5DA 3B53X 1EWRA 5TGTA 1Y1SA 1O95D 3R6DA 1DBIA 1RAHA 2WYWA 2VSQA 3BIJA