4DYVA

Crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
237
structure length
213
Chain Sequence
KKIAIVTGAGSGVGRAVAVALAGAGYGVALAGRRLDALQETAAEIGDDALCVPTDVTDPDSVRALFTATVEKFGRVDVLFNNAGTGAPAIPMEDLTFAQWKQVVDTNLTGPFLCTQEAFRVMKAQEPRGGRIINNGSISATSPRPYSAPYTATKHAITGLTKSTSLDGRVHDIACGQIDIGNAMDVAHVASAVVYMASLPLDANVQFMTIMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Crystal structure of a short-chain dehydrogenase/reductase SDR from Xanthobacter autotrophicus Py2
rcsb
source organism Xanthobacter autotrophicus
total genus 73
structure length 213
sequence length 237
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dyvA00
5ENDA 2UUOA 2QRKA 2V6GA 1GDHA 1A72A 1U4SA 1HDRA 5A3VA 1ISMA 2PGLA 1HWYA 1LXCA 1PR9A 2FMUA 1F8FA 1R4NB 2PV7A 3OMLA 1VKNA 1ZJZA 2QRLA 2W98A 4LRTB 4XJTA 3H2SA 1F12A 1HETA 1SEPA 4G65A 1UH5A 2GN4A 3RUDA 1DO8A 4MVJG 1A27A 4YBZA 2Q50A 2W90A 2GCGA 1YB1A 3PQDA 2NV6A 2PY6A 4R4JA 4M86A 1YH3A 3DBLB 3X2EA 1KBZA 2CF6A 2H6EA 3KO8A 4RVFA 5JCXA 4C4OA 4R9SA 3GF4A 4ZGWA 3PXXA 3T7CA 3ZU4A 3TZQA 2YW9A 4DPLA 3N58A 2Q1WA 2DUUA 4CMEA 3S1LA 1TT7A 3H5NA 1W0CA 5C7OO 1QMGA 3ETDA 4YYZA 3GVPA 3FR7A 1EBFA 3QVWA 1D1TA 4KQWA 2DTXA 5TGDA 1YOVB 4KZPA 5IXSA 1ENYA 3O26A 3Q2KA 4UUPA 5DBFA 3FSRA 3NJ4A 3PHGA 4RPLA 4YEDA 3RIHA 4YT2A 5HTOA 4XJSA 4ND1A 3F4LA 4YACA 2DPGA 5TSDA 3O8QA 2VNSA 3WTCA 5KJFA 1DHTA 3GPIA 1BGVA 1Z73A 1IZ0A 2J3JA 1ADGA 4FFRA 2WWRA 3AI1A 1SEVA 1U2GA 2O48X 3LC2O 3QIVA 4YJHA 2QYSA 2EWMA 2NQTA 3WLFA 5B4UA 5CAEA 1EEHA 5I7FA 5BSEA 3VH4A 2YJZA 2WYUA 3ADOA 4ESOA 3K73O 2PKQO 1VE9A 2VN8A 5KNLA 1IB6A 4JCOA 3FBGA 3CSDA 2EXXA 3K2BA 3GA0A 4XGKA 1X7GA 2PA3A 3KLPX 4B3IA 1O0SA 4E2XA 5L4SA 4QTZA 3FNEA 4FOSA 3JQ9C 3PI7A 2ZB7A 3F9IA 3RU9A 2Q46A 1LLQA 2AE1A 5IDWA 5L7WA 1X1EA 5HS6A 3GAFA 5I9LA 4J7CA 2E6UX 3FWZA 3OJ0A 4BO6A 1U9JA 5JNLA 2AEJA 2HUNA 4NH4A 1WNTA 4CQMB 2VCYA 5F5LA 3ANNA 4ZRNA 3V1UA 3WR5A 3H9UA 1NHGA 1B8PA 4RVSA 1GD1O 3ZHZA 1DJNA 2VWGA 3RAJA 3L9WA 4RORA 1ZEJA 5CG2A 4CL3A 1JWAB 4AJLA 4YVFA 3OHSX 3IKTA 1Q0HA 4II2A 5G4KB 3MTGA 5L45A 4OO3A 1U28A 4LGVA 2VUUA 4ZD6A 1NYTA 2PD3A 2UDPA 3KTDA 4IM7A 3DC2A 2CDCA 5I9NA 1C0LA 2TMDA 1I3MA 3DFUA 4IDFA 3I52A 5EQDA 3DTYA 1GV0A 4FJ0A 2AEFA 2CZCA 1R15A 1OZAA 4CM6A 5J23A 2I6TA 3A9WA 5AQ1A 1OMOA 1H6AA 2PR2A 3WX0A 4K9DA 3GT0A 4E4YA 4GX1A 3TPCA 1N1EA 3QVXA 1E7MA 2I5PO 1E5LA 4CMKA 4DBZA 5I8WA 4CM9D 2GN8A 1B16A 2EKQA 1GCOA 5JDCA 3S8MA 2AQKA 4GSKA 4U5QA 1VRWA 2DBRA 4DMMA 4FFMA 1N9GB 3RQSA 1D8AA 5HM8A 5A3JA 5JAQA 2YDXA 1YB4A 5DULA 3R3SA 3ZWNA 1TT5B 3AJRA 1U7TA 4LSMA 5JYDA 4IIVA 1JKIA 3SXPA 4Z0PA 1ISGA 3KV3O 3OJFA 3JQFA 1GPDG 1SCUA 1VJTA 3MWEB 4GKVA 4J4BA 5EL0A 3ZHYA 4DBVO 4GGPA 1ZNQO 3AFMA 2FPPA 5FYDA 5FF9A 4L4XA 2PD4A 3CINA 3PFWO 4K28A 4LCJA 3C24A 4DXHA 2B69A 1MB4A 3H6KA 2FN7A 1VPDA 2P5YA 5GMOA 1DC6A 1DIAA 1ID1A 1K0UA 3WTBA 4DUPA 8ADHA 3MOGA 3JD2A 2Y1DA 4QO7A 4DQXA 2X4GA 1L1FA 4CMIB 4O6VA 3W4IA 5C7LO 3PYLA 3D5TA 1B3RA 5F1KA 1GADO 3DMTC 3O03A 5G2OA 4CM8A 1HF3A 5JAZA 5COAA 3GHHA 4ILKA 1EE2A 2PK3A 3VDRA 3QWAA 1BSVA 4A5OA 4NI5A 4R51A 3DZGA 1H6BA 4IZHA 3RC9A 3VKUA 4WLUA 9LDBA 1B3BA 4DC0A 5KVSA 2UAGA 3K96A 4HFNA 4RCVA 4E30A 5LDHA 1F14A 2C82A 1GTMA 3K31A 3ZWXA 2X86A 1E92A 1JVBA 1PJCA 3JD3A 3JTMA 3D3WA 3DAFA 2VZ0A 2WTBA 3OJOA 4NBRA 1PR3A 4QECA 1PJBA 3QA9A 4PLPA 2ZYAA 4PLTA 4BKOA 3DZJA 3TZCA 5IAAA 1E7RA 1P31A 4YCAA 1Q2XA 1K6JA 1U4OA 7ADHA 4NJMA 1H9AA 2PZMA 4WE3A 1HXHA 3H9GA 5BNFA 3I6IA 4I9UA 3NV9A 1G6KA 2Z1NA 4L73A 2Q4BA 4CM4B 2CMDA 5L7TA 3PLNA 1U3WA 1YONA 4AJNA 3DOOA 3UHAA 1J49A 1ZMOA 1Y5MA 4XYBA 1LEHA 1JVSA 3L07A 1DAOA 3H3JA 3JD4A 3L77A 3JQBC 2HK7A 4IJUA 4IY1A 4MVJA 1W73A 1BTOA 3LU1A 1K6XA 5JC8A 4OQYA 1W8DA 4Z0HO 1NX6A 4R9RA 2P68A 3L4SO 1M6HA 3PDUA 3HUDA 4W7IA 2XOXA 1ML3A 3QY9A 3MTJA 2C2XA 2HMUA 2O2YA 1YJQA 2X22A 1R4NA 4YTEA 5TRTA 1N7GA 1C0IA 5TT1A 4BNNA 4MJLA 2GZ2A 3WSVA 4BMNA 4Y6SA 2Y68A 4ALJA 2HLPA 3Q3CA 4EGFA 4OOEA 4WOKA 2E48A 3CH6A 4IGFA 4CUZA 4YJGB 1I10A 3ONDA 4BVAA 1KVQA 3SX2A 1VLLA 1LX6A 1DFHA 2CNBA 3DBLA 1TI7A 4TZKA 5GZ1A 3FR8A 2X0RA 4IJKA 4OSPA 5DCWA 3C3XA 3B1KA 2R6JA 3OJEA 3EDMA 1LSSA 4RZHA 4BO9A 3I3OA 1UJMA 3I9MA 1UXGA 4JJFA 1WZIA 1ENZA 1ZK3A 2IZ1A 4DL9A 4U6SA 1GL3A 1YOVA 1Q1NA 1YRLA 2X6TA 3JQ6A 4GBJA 1OFGA 2PZJA 3W6UA 3VZRA 5CFZA 5JSFA 1U5AA 4G5HA 2FR0A 3NJ8A 1DB3A 4CLOB 1HYGA 1NXQA 3IL2A 1IHYA 1NVTA 1DPGA 4ZQHA 4GI2A 1PEDA 3PLRA 4ZU3A 3ZNOA 3WSWA 4CMGA 4M89A 4TSKA 4Q39A 3AUSA 3K5PA 1YQXA 4ALKA 3JV7A 3TZHA 1YS4A 3L6DA 3GPDG 4BO1A 2EIHA 3WGGA 1LRKA 1QYXA 4U0KA 1W6UA 4DA9A 5L53A 1YDEA 2I9PA 1KEWA 4NJOA 1XEAA 2O3RA 2VUSA 3UICA 1I5RA 2DFVA 4F6CA 3B1JA 3FI9A 4PN3A 4ZQGA 1P45A 4I08A 1PQUA 1T2EA 3EVNA 2Y1FA 5KVCA 2O7QA 5JMWA 4U6QA 4XKJA 2G82A 2HJSA 1A71A 3PIIA 1DC5A 5TNXA 1R4MB 3K6JA 1H0KA 1SC6A 5F1PA 1KOLA 4IDDA 3ETEA 4E5PA 3MJTA 3RC1A 4D7AA 1HTBA 3HDQA 1SNYA 5A06A 3IUPA 2NTJA 2PKRA 4CQMA 1BDMA 3I23A 3GFBA 1ZSYA 2JJYA 3JQ8B 4FJ2A 2PGJA 3ZZNA 4AL4A 5JDIC 4J91A 1JA9A 5DNAA 4BO8A 4J2HA 3FRJA 4A73A 2J5QA 3B1FA 1LC3A 3WYEA 5BQFA 5A9SB 4NBVA 3E8XA 4YAEA 2GD1O 4WUVA 4YRDA 3ZU2A 5G4KA 1GQ2A 4IMPA 4NDNE 3QWFA 1EUZA 5ADHA 5BT9A 1H5QA 3TNLA 2W2LA 3AI3A 4E5MA 4EI2A 2HMTA 1BWSA 4IBOA 3AM4A 1KEUA 3NDRA 3L9XA 2ZB8A 2AE2A 4JLWA 4KP7A 4LW8A 1YXMA 1NWCA 3HNPA 4W99A 5G0SA 1IPFA 3FPCA 1SOWA 1NPDA 4GAEA 3I6QA 2C59A 3EZLA 2VOJA 1PZGA 2G5CA 3MWDB 4YAIA 1V8BA 3D3EA 3TQHA 3GUCA 1GEEA 3GDGA 4AJIA 3E9NA 2OZPA 3HADA 4NQZA 3HFGA 5TX7A 1Z6ZA 4NBTA 4ITUA 4QX6A 5HS4A 5AOVA 4BS9A 2O3TA 4HNGA 5EESA 3TZ6A 3FHLA 4YT5A 3UH1A 4HFRA 1TT5A 3Q9NA 5CDYA 4KDEA 2D5AA 2PLAA 2EP5A 3OF2A 2IZZA 4YA6A 3L6EA 5JY6A 1A9YA 2ZJ0A 4PLVA 4NZ9A 2Q3EA 2X8LA 2HRBA 4YAGA 2J8ZA 3HDYA 2VTDA 5DZSA 1PU2A 3E5RA 1JAYA 4JBIA 1QLHA 3LVFO 3KYBA 4IQ0A 1N5DA 2FR1A 3WQSB 3GG2A 3ZH2A 1EDOA 4AJ2A 4U8GA 2Y0EA 1TVEA 4CMIA 1KYQA 4A26A 3JQAB 1GYPA 4LRSB 1JKFA 4BL5A 2CF5A 1OI7A 4HBGA 3GDOA 3T7EA 1NAHA 2IE0A 3PDJA 4R54A 4PRKA 3V1TC 1CERA 4B7UA 1LQTA 2B5WA 4D42A 2RCYA 5FWNA 4YQYA 3KSZO 2OHXA 4ID9A 2D4AA 2QYTA 1MX3A 4PIVA 2PNFA 2Z5LA 3H8VA 4U7WA 4Z9XA 1Q7CA 5ITVA 4TQGA 1CYDA 1YKFA 3U4CA 1HYHA 1FMCA 1Y9AA 3MJVA 4TRJA 5EJ2A 1V3VA 1GAEO 2HDHA 3W8EA 2WD7B 1N2SA 5IDXA 2HQ1A 2UUPA 1IZ9A 1E3EA 2GLXA 4BUCA 1QG6A 3GVHA 3HZZA 5EIOA 3H3FA 3O9ZA 2HMVA 2JD1A 1PJ3A 3WGQA 4BKPA 2GGSA 1XU7A 2V6MA 1XR3A 4NFHA 4EEXA 4EDFA 2VRCD 3ABIA 3JYLA 2C5AA 5JPIA 4YT4A 4CMAA 3JD0A 2DPHA 5U4QA 1GFSA 2HJRA 2Y1EA 4BQPA 3OQBA 1JN0A 1NHWA 2H5LA 2B36A 1BXKA 4EJ6A 2ILTA 3OEWA 3PFFA 4CM4A 3U4IA 3LT4A 3GK3A 1UXHA 3D4OA 3EC7A 3SLKA 4FFPA 5EPOA 3DMYA 4R3NA 4MPDA 1E3SA 1LDGA 3UCEA 4NFSA 4WCFC 1DIGA 4TRRA 4IPTA 4D0SA 1UP6A 2B4TO 3DBHB 3ZWAA 2EKLA 3W4KA 3RUHA 1MC5A 3JQDA 3NTOA 5A04A 4CR6A 3E48A 3NDIA 4J9UE 1FDUA 4I9NA 1QXSA 1HLDA 3H2ZA 3DHEA 3GRKA 1NVMB 5L7YA 4R3WA 2VYVD 3LLSA 4LCEA 5LCXA 1XWFA 1SOVA 1MP0A 4DYDA 1PGOA 2DM6A 1LU9A 4W7HA 2VOEA 2E82A 2VUTA 3QHAA 3ZWBA 4RJTA 3VPSA 1EQUA 2GUGA 2D59A 3LT1A 1UR5A 1PS0A 1Q0LA 2C20A 4A03A 2FOIA 5A1TA 3U5TA 4KMSA 1KIFA 4Y8VA 1IOLA 1HSOA 3IC5A 4CV0A 1CJCA 1HE3A 2BGKA 3AOEC 4YJGA 4N18A 4XA8A 5ER6A 4P38A 1YL5A 1BRMA 2DTDA 2LDBA 4R5HA 1NAIA 4GWKA 1V9LA 3BMOB 3VC7A 1E6WA 4IS3A 4NJMB 3A28A 4ROSA 2QW8A 3QQPA 3JYQA 2GNAA 2AQHA 1NWHA 2BMAA 2P9GA 3F46A 1AXGA 2WYVA 2YFQA 4M55A 1E1LA 4WECA 3MCVA 5JLAA 3WYBA 4WNCA 1UAYA 4IXWA 4MVJM 4N7RA 4XCVA 1PL8A 3GRPA 1PTJA 1K3TA 5L3ZA 1OC4A 2DLDA 2JCXA 4CLOA 3N7UA 1NPTO 1NVGA 4WLVA 5BNIA 3DR3A 1W4ZA 4UEJA 1ARZA 1ZKMA 3I9OA 5MGBA 3CKYA 3BMNB 3C7DB 5B4VA 4IZIA 2D2IA 2EEZA 5KWEA 5THKA 3ADPA 4QSMA 4Q3DA 2AA3A 3CE6A 1NBOA 3PHLA 4MVJP 1LSJA 1DRWA 4CL8A 2NLOA 4GQAA 1T25A 2IXAA 4F45A 1XLTA 4P22A 1A9ZA 3W8DA 1NASA 3VHRA 1CQIA 1KVTA 4CQMD 3ROQA 1U3VA 3GLQA 3ZW8A 4WLNA 1DOHA 5CP8A 3VTFA 1XHLA 5KKAA 5TT0A 3AFNA 4Z6KA 1O95A 1ULUA 2X7HA 1Y81A 1ZJYA 3RKRA 5IFLA 3MZ0A 1R4MA 4OXKA 2GSDA 3DZIA 4N5MA 4J1SA 3JSAA 1NQAO 3EHEA 1ONOA 2CDBA 4D41A 3R1IA 1HRDA 1B2LA 3DAGA 1KETA 3L4BC 5B37A 1LUAA 3JQ8A 2FY8A 2VRBA 5JFOA 2CD9A 4WKGA 3JQ9A 4AJPA 4EJ0A 3GQVA 3NRCA 5JO9A 3ZGYA 4Q3EA 4HUJA 1T2DA 5A9SA 3C85A 3C1OA 3DDNA 2FZWA 4E5KA 2JCVA 4MOWA 4BNMA 1V3TA 1QYCA 4B7XA 1I2ZA 3DONA 4RF3A 3DZFA 1HDXA 3G3EA 4J1QA 3KOUA 4UVIA 3VVCA 5I9MA 1HSZA 3D1LA 3GR6A 2D3TA 4RQTA 2WE8A 2NWQA 3UW3A 3UFXA 3PHJA 2YV1A 5IZCC 4ND4A 1NR7A 5IG2A 2XF8A 2Q99A 3KSUA 4CV3A 1RPNA 3VH1A 4I8XA 1PL7A 2X5OA 2LDXA 1E5QA 1ZK2A 3ROKA 1LI4A 2AQ8A 5B1YA 2QZ9A 3S2FA 1PX0A 4NK4A 2X5JO 4K6CA 1UUFA 3F5QA 4BGVA 1R16A 1V3UA 2VTEA 3GHYA 3NTRA 4WJZA 3DFZA 1E7SA 3CTMA 4JBHA 3WBBA 3JCZA 2Q4EA 1N92A 3AWDA 4HFJA 3F6YA 4Q3BA 1U8FO 2X5KO 4ZICA 2PH3A 4G81A 1E1KA 4E32A 3I5MA 4INAA 2ZJ1A 4CMJA 1FDVA 3ASUA 3QSGA 1ADCA 2VWHA 2WYWA 4CLEA 5BNTA 1QRRA 3VH3A 1LNQA 4GKBA 3ZDFA 5CPFA 4PG8A 4J6FA 2AG5A 2IDZA 3WGOA 1P1IA 2O4CA 3HJAA 4ZVVA 2YHIB 5JYEA 1SAYA 4B4OA 4PG6A 1IYZA 4K26A 5JAIA 4YXFA 5ER9A 5FFFA 5IDQA 4UEOA 4NG5A 2EW2A 1UZMA 7MDHA 5DDIP 3PHHA 3NT5A 2DU8A 3V8BA 4BO7A 4B4UA 3JQAA 4DC1A 2CSUA 3GVXA 1RM5A 5IN4A 3I9NA 4B7CA 1MLDA 4CM7A 3ZWCA 1A7AA 1KVRA 1PJLA 2BD0A 2YHUA 3OM9A 1VL6A 1O6ZA 2WMDA 2D5CA 4PZEA 1RM3A 4ZA2A 4DLLA 4R16A 3VPHA 3DMTA 2R00C 5I7EA 2OUIA 5GY7A 3VZSA 3WWYA 1LSOA 4FCCA 1P74A 2CY0A 2XXBA 1EDZA 1SBYA 3NGXA 1BW9B 3LF1A 1XQ1A 1KC3A 3OH8A 5COBA 3PZRA 4CUJA 4TWRA 3JYNA 1MA0A 2WD7A 1P1KA 5DF1A 1DIHA 4DGSA 1R66A 1GZ3A 1GQQA 4O5OA 3A14A 4E2YA 4IJVA 2H9IA 4U0JA 1G0NA 2C5EA 3WXBA 4OKIA 2PKQP 2XXJA 4UVGA 4OXYA 5TS3A 4CM1A 5CEFA 4BB5A 2A9FA 4BNUA 3OIDA 1EMDA 2A35A 2X9VA 1TB4A 2BELA 1N8KA 1UZNA 5L40A 1D7OA 1NNUA 1YBVA 2VYND 3BMQB 4WASA 4BKQA 1LTHR 2BKAA 1P1JA 1B0AA 5TQVA 1RKXA 1JDJA 1P44A 1I3NA 4KWIA 3FNHA 4TMFA 1ONNA 2I3AA 3ONFA 3VVBA 1PQWA 1NPYA 3SJUA 4CV1A 3LC7O 4PLCA 3DTTA 4GWGA 4OGWA 5JO0A 4YAKA 3OIFA 4JP3A 4QO8A 3WNQA 1E7WA 3DBHA 5DCUA 3I83A 3Q2IA 3HQ4O 1AN9A 1JU9A 1LDBA 5EERA 4YAJA 5CEJA 5L4LA 2W8ZA 4O0LA 4D3SA 4B3JA 3ENNA 4NMHA 1O8CA 1Z7BA 4NFYA 2NU8A 4WCFB 3UF0A 1TEHA 1VC2A 3IKVA 2FSSA 2JL1A 3JQBA 3QJ5A 2RIRA 4NIMA 2PGDA 3ZWMA 3UOGA 2C07A 2GRAA 5G0WA 4D3DA 1S6YA 5TC4A 3EW7A 3UVEA 4R1NA 2P4HX 2RAFA 2JD0A 4R68A 3F1KA 4FOOA 1J6UA 1UDAA 2JAPA 2PH5A 1OBFO 1F0YA 3EMKA 2HMWA 2X0IA 1KY5A 4BV8A 4BNVA 2VHZA 1TA4A 4L76A 4B3HA 3BMOA 1B14A 4P4NA 1E6EA 4AVYA 2VT2A 1EQ2A 5A5EA 1NTOA 1ZCJA 2ZTMA 3Q1LA 3QP9A 1V0JA 3Q11A 4R01A 4C7JA 5L4NA 3L6OO 3RBZA 5ILGA 1VJ0A 2DUWA 4G2NA 4GH5A 4KTTE 4OQZA 1V6AA 1XU9A 5DOVA 1PJTA 1QR6A 4GLOA 3KBOA 1K5HA 3LDHA 2Y67A 1TLTA 1FF9A 1Z74A 3NTQA 1NQ5A 1P1RA 2AG8A 1DBVO 3D7LA 4PLFA 3BMNA 1GCUA 1H6DA 1H94A 3CUKA 1MGOA 1XA0A 4RVUA 4A2CA 1MFZA 1FJHA 4UUNA 1ZO8A 2VHXA 5JXWA 1WDLA 5T8KC 4XEHA 4CMCA 5A05A 3AUTA 4W6ZA 3RBXA 4RGBA 3RVDA 3ZV3A 5K6AC 4IINA 1KS9A 3RD5A 2A4KA 4OSOA 4D0RA 1IE3A 4RV9A 4DYVA 3GZNB 3PP8A 2PTGA 3QWIA 3OECA 3P5SA 4NU6A 1I2CA 5IDYA 2DAPA 4PLGA 3Q0EA 4J43A 3PGJA 4P8RA 4W9NC 4R1SA 4NU5A 3PRJA 4ZQFA 1PQPA 3ZCXA 3H5AA 4IDGA 4PLZA 1DXYA 3ZNQA 3D0OA 4E3ZA 4GX0A 3I9JA 4I5FA 4NBWA 4RZIA 1DEHA 1YL7A 1BXZA 3JQ7B 3KM0A 4RQUA 4XRRA 1MC4A 2I66A 5JS6A 4CR8A 2GYYA 3JYOA 1I30A 1R6DA 4FFOA 4J49A 1QKIA 1ZFNA 1NQTA 4RPJA 2CUKA 4CR7A 5CEEA 1A4IA 1I24A 3PGXA 4IDBA 3KB6A 4O63O 4NHEA 4XQEA 1PZFA 1NFFA 2Q1SA 3ZV4A 5ENVA 4Y9DA 4WPGA 2BFPA 2WDZA 3GN2A 4ALLA 5JDIA 1NR1A 2B5VA 1LC0A 2P4QA 3RWBA 4DIOA 4JN6B 4KDFA 1YVEI 1Q0QA 4DREA 4AJJA 3MJ4A 3KUXA 4J3FA 1HKUA 1ISJA 3QVOA 3EUWA 4J4HA 4S3MA 4P4LA 4M49A 4BV9A 2I99A 3AUUA 1GYRA 4J2OA 1LRJA 3GUYA 3ZU3A 3EGOA 4EEZA 4XQGA 5JBIA 1Y8QB 5FI5A 3TFQA 1T4BA 5TLSA 3IP3A 1T2FA 3M2PA 4Q3AA 2I67A 2CVZA 3HN7A 1J4AA 4BHTA 5KJCA 2GF2A 5MDHA 1NFQA 4AJOA 5CG1A 2AMFA 3D5QA 4TKMA 1XIVA 1GYQA 3U3XA 3GC6A 2NNLD 2BH9A 1NFRA 4HP8A 3HDHA 2IYPA 4JQCA 4Q3CA 3JD1A 1M75A 2V6BA 1ADBA 4IGEA 3PVZA 1PS9A 2RH4A 5DP1A 4I9HA 4PVCA 3W6ZA 3RC7A 3NUGA 3DBRB 3PZBA 5EN4A 2O3JA 4X54A 2WM3A 4AFNA 4AICA 5KCZA 3C1AA 2Y1OA 4FDAA 3JQAD 3Q6IA 2J5KA 4II3A 5ILOA 1ISHA 3PWSA 4PLYA 4EYEA 4F46A 3FCOA 3WGTA 2HKIA 3MJEA 1KERA 3V2GA 1JW9B 2YHIA 3TN7A 3RFXA 1Z7EA 3IDSA 4RDHA 4FB5A 4JP2A 2O3UA 1LDYA 3AI2A 4RVDA 1UXKA 4MVJI 3LK7A 3INRA 3BMCB 1O94A 1HT0A 3RUAA 4BO3A 2YY7A 3FN4A 5AXCA 1X14A 2NVUB 2IYOA 2AQIA 2V7PA 1CDOA 4AJHA 4CUKA 3GY0A 1J5PA 1L7DA 1PIWA 1CF2O 1XGKA 1LQUA 5DN9A 3WBFA 5T67A 5TJHA 4ALMA 1ZEMA 3E1KA 4QXMA 3ICPA 2ZIZA 5JMPA 5I7SA 4PG7A 3TL3A 3C7AA 1AHIA 5DBGA 3S2EA 1ZK0A 3JQEA 4TKLA 3VPGA 2OFPA 5CDGA 5COQA 1XDWA 1M6WA 1KC1A 4AG3A 1LLCA 4FFLA 4E0BA 1BW9A 4XD2A 4XR9A 4QFDA 1H2BA 3VPXA 4S1VA 4MKRA 2BGMA 3V2HA 3DZBA 3QRWA 4FGWA 3FF4A 3I9LA 4LN1A 1K6IA 2VNAA 1H93A 4ND3A 4FBGA 4KQXA 3CMCO 3E9MA 2O7SA 4YR9A 2YQ5A 4OYRA 1ZUD1 3BMQA 1P0FA 4UUOA 3WFIA 4J16A 5KIAA 3FBTA 3RCBA 3UCFA 1ZZEA 3LF2A 2NUAA 1ISFA 1IY8A 1MXHA 1WMAA 1R0SA 2QG4A 3KYCB 1SO8A 2UV8A 4KTVE 4ZRMA 4DMLA 2W2KB 3BYZA 3RUFA 1GZ6A 1PGNA 4UVDA 3WLEA 3EAGA 3ZN2A 4BNJA 2E49A 4J7XA 2YDYA 1DAPA 4GGOA 2JFHA 3LYLA 4AJEA 1P33A 1U3TA 3GZ4A 3M6IA 2I65A 1KVSA 3I4CA 1DDOA 3IQDB 4HWKA 4IQGA 5AXAA 3W4JA 3WICA 4BOYA 2UYYA 4IDEA 4OJNA 1K89A 1GEGA 2EF1A 4BNIA 2VHVA 1HE2A 4PCVA 4MKZA 2C54A 2OORA 4FC6A 5GZ6A 5LDGA 4WCFA 2EGHA 1HZJA 2G1UA 3FPLA 3UCXA 2POQX 1FXSA 1R37A 2OOSA 4OKNA 3S2IA 4UUMA 5G0VA 1EFLA 3WIDA 4FJ1A 1SB8A 5K9ZA 3ASVA 3QLJA 4GMGA 3OA2A 1D4FA 2DBQA 1T1SA 4Q3NA 2C29D 4Z9YA 3H4VA 1CEQA 1O9BA 2O4UX 3KLMX 3KYDB 1EE9A 1E7YA 3CPSA 1WVGA 3H9EO 3DL2A 4Z0TA 1AGNA 1WWKA 3OETA 3E03A 2DKNA 4OXNA 4EITA 4BNXA 3AUAA 2F00A 2WEKA 2FPGA 2WSBA 4A0SA 3AU9A 4XB2A 4CJXA 1UDCA 4IMRA 4D45A 3T4XA 2PWZA 3T4EA 2GN6A 3DOCA 4MVJD 1F06A 3AOEA 3IJPA 2YFHA 3RSHA 1NP3A 1DRUA 1YO6A 4D43A 1DFIA 2V65A 3COSA 3JYPA 4UVEA 1QLJA 4JJIA 1P1FA 3GEMA 3IOYA 2DTEA 3SLGA 3BHJA 2H1SA 3UN1A 5KJ6A 2Z1MA 4BGEA 2HRZA 5F1OA 1U2DA 2NSDA 4XQ9A 3UXYA 1X7HA 4CM9A 3RJ9A 1Z45A 5HA5A 3GGPA 3ST7A 2J3IA 5F3RA 1WDKA 1N7HA 4TRMA 4I5DA 3K8ZA 2Y0DA 4XDYA 1T1RA 1IHXA 3GG9A 4L8VA 3RBVA 2IRWA 3RU7A 5ITWA 3ZWWA 3HB4X 2YV2A 4E5YA 5BSHA 3M1AA 4DQVA 1LLUA 4OMUA 3PIDA 3GMSA 3KRTA 4E21A 5U9CA 4Y67A 2Y1CA 4BO5A 1MFPA 3G1TA 4R5MA 2DBZA 3OFSA 3WGIA 5L95A 4CMHA 3GZNA 1P3DA 4FN4A 3I1JA 4D46A 1DIRA 2IEBA 4PZCA 1WXDA 1PZHA 1PZEA 3WG9A 5A9TA 2PFGA 4UVHA 4YT8A 1DHRA 1QYWA 1OAAA 1KEPA 1P0CA 1IULA 1A4UA 2WE7A 4RL6A 4GSLA 4N54A 5DBIA 3HG7A 2C7VA 1RJWA 1WW8A 2VWQA 4LK3A 4BO4A 2FR8A 4XYEA 2JD2A 1JQBA 2JHGA 2NACA 1PJQA 1XYGA 1N1GA 1FK8A 2C2YA 1GV1A 3JQ7A 3OP4A 3PJEA 4GL4A 1X1TA 4XGIA 3VTZA 4XYGA 4BNFA 2W4QA 3R3JA 4XWYA 3TZKA 4BNZA 2FHSA 1SZJG 2OMEA 4ND2A 3WMWA 1EVIA 1QV7A 1VL8A 4CMBA 1EVJA 4Y98A 3L4BA 3PQEA 2EHDA 3DAPA 3MEQA 5KJEA 3U9LA 1CWUA 3PHIA 3WGYA 4DQUA 2EGGA 3V1YA 2CVQA 2B35A 2EV9A 4D3FA 3ROMA 1Y1PA 3SBOA 2Y1GA 3D4NA 2X23A 3L0DA 1ONPA 5JE8A 3OICA 3ANMA 4OM8A 4MKXA 4A10A 1Y8RB 4R69A 1C14A 2H63A 2RBEA 4E6PA 1R12A 1EK5A 2HK8A 2ET6A 4J7UA 4RPHA 2EERA 1EFKA 3INTA 1MUUA 4DLAA 3DBVO 5T64A 4XX0A 4BNYA 2D1YA 1Y8QA 1C0KA 1I3LA 2GR9A 2Y99A 4E13A 1E3IA 2ZYGA 4MDHA 1G0OA 4YB8A 1ORRA 4W4TA 3PJFA 4GX2A 2ZTLA 3ZU5A 3EY4A 4I1IA 2OP0A 4A7PA 4E31A 4OH1A 4BKRA 2NM0A 2J3HA 5IZCA 2FPIA 3U09A 3C8MA 2QRJA 5A9RA 4XYLA 4GVXA 4L4SA 3BHMA 3JQGB 1EK6A 4JXKA 1BXGB 5DT9A 3DBRA 3U4DA 4RF5A 4RLHA 2Q2VA 2ZK7A 4BIIA 1VL0A 1DLIA 2J6IA 2W2LD 4HXYA 3WNVA 1UP7A 4XIJA 2A92A 4BGUA 2VHWA 4PZDA 2GZ1A 4XZ3A 4O59O 1AXEA 1KY4A 4J0FA 4RF4A 4BB6A 4BNHA 6LDHA 1T24A 1IPEA 1Y7TA 1XG5A 1T26A 3SJ7A 3BMCA 1EBUA 1HDZA 4NBUA 2BLLA 3FNFA 4N5NA 1BDBA 2NVUA 2ZCVA 3PWZA 3EYWA 3RFVA 3E5MA 4MVJH 3A4VA 3WFJA 4BNKA 1YBAA 4J0EA 2YYYA 3IS3A 1WLYA 1ZXLA 3ON5A 1NQOA 1H9BA 2B0JA 3CMMA 1DC3A 3ORFA 4J4TA 3TFOA 3WB9A 4J90A 2XPCA 3E9QA 4CQLB 1PSDA 4EJMA 4WLFA 4IIUA 3K92A 1ZW1A 1LSUA 2PZKA 4QQRA 3O4RA 1I3KA 4OOFA 3BTOA 1LA2A 5C37A 3LLVA 1HE5A 3OIGA 4M8SA 4YRBA 1G1AA 2VQ3A 5CHEA 3U49A 3ZWYA 3LT2A 3P2OA 5H81A 5C5IA 3I4FA 4DTIA 1I0ZA 3AW9A 2OP1A 2R00A 4RLSA 4L4RA 3F47A 4ND5A 3GVCA 4MO2A 2GERA 4BQRA 3TF5A 5GZ3A 1PJ4A 2HAEA 5T5QA 1VKOA 4PLHA 2Q45A 3OQ6A 3FNGA 3WJAA 3ZWVA 6ADHA 3KYCA 4NNJA 3LQFA 2QQ5A 1BVRA 2W2KA 1U5CA 2E4AA 3PJGA 2BRUA 3F1LA 4CMEC 2X9GA 3WGHA 1HDYA 4PG4A 3N74A 1ULSA 4Z3KA 3VH2A 4DPMA 4EBFA 5IF3A 4FFNA 3SC6A 2P91A 5G0TA 4FC7A 5A03A 3KEOA 3DWFA 3KXDA 4L0QA 2P9CA 1YGYA 2NU6A 3C7CB 1VSVA 1GPJA 3E18A 1PJSA 3E6AA 1O5IA 1WPQA 3OSUA 2FP4A 5KVQA 3TWOA 4BNLA 4FQ8A 2WJPA 1ZIDA 4Q9NA 4BKUA 2C0CA 3WIEA 3G0OA 5A02A 1UZLA 1UP4A 3B70A 3NEPX 4XGNA 4DVJA 2V6FA 3BA1A 4WEQA 5BSFA 4QUKA 4B79A 1LDNA 1DFGA 2IZ0A 2ZB3A 4HNHA 4UAGA 3AY6A 3IJRA 3ONEA 4FGSA 3KYDA 5JAMA 3FTNA 2HU2A 4HX5A 1YBMA 3AY3A 1B26A 1PGPA 1U1IA 3GEGA 4L74A 4OHUA 1PWXA 4E33A 2OBYA 3F5SA 3A1NA 3KSDO 4MP8A 3OA0A 5I7VA 3NAQA 2NTVA 3PQFA 3W1VA 4CODB 2O3SA 1PGQA 5H83A 1EVYA 5KKCA 1I2BA 2EW8A 3FTPA 3INGA 2JFGA 3LZ6A 4FW8A 4PGFA 3GH3A 1HDGO 4YJFB 5IN5A 4IDAA 2FSVA 2Q1TA 1WDMA 1DRVA 1XSEA 3V2UA 3G17A 3PK0A 1QV6A 2AXQA 3RI3A 1GQYA 4AJ1A 4MVJE 2X1HA 4RF2A 4WCDA 5IJZA 3WS7A 2NVBA 4XIYA 3RUIA 3LC1O 5TF4A 2YUTA 2B37A 3TRIA 3R0IA 1JLLA 4MP6A 1M2WA 4WLOA 1E3WB 4LVCA 1R0LA 4MIOA 3DHNA 1GY8A 3ZW9A 4YJDA 1U3UA 1X7DA 1FDTA 5IZ4A 1ZH8A 1M67A 3WMXA 4CV2A 3ZNNA 3K30A 1P77A 1O89A 2J5RA 3BTVA 4XB1A 5JDCC 3NT2A 4WK6A 4C7KA 2OBNA 5LC1A 2BHLA 1EZ4A 3GGOA 5EQFA 3G1UA 3RKUA 3F4BA 4GMFA 1ZBQA 2ZYDA 2TMGA 4BMSA 5T8KA 4YRAA 2O2SA 2BFMA 2VT3A 3PEFA 4CLDA 1T2CA 3IP1A 3VDQA 5KTKA 3VZQA 4J9VA 5DP2A 3RROA 2GPTA 3PYXA 5K6AA 2DQ4A 5BR7A 3RUCA 1HDCA 4B8WA 4ZQEA 2GZ3A 3H9QA 2G0TA 3RASA 3WJ7A 1P9LA 3Q9UA 3S2GA 3NT4A 3WWZA 2CVOA 3K2EA 3JQFC 4ZHSA 4W9NA 1EUDA 1A5ZA 1VSUA 1OC2A 2IODA 2ZTVA 3U0BA 4GPD1 3TDKA 3MJSA 3A06A 2OGUA 5THQA 2VZ8A 4LMRA 3KVOA 5TJ9A 4E2ZA 3GN1A 5JCJA 1VI2A 3OJLA 4OAQA 2Y0CA 2O3QA 1KEVA 2HK9A 4HFMA 3EVTA 2GO1A 4YPOA 1E1NA 3H65A 2CFCA 4JJGA 4LMPA 1DSSG 2NQ8A 3QE3A 1CETA 4RVHA 2GN9A 1YDWA 3DQPA 3GMDA 2JAHA 2Y66A 3M2TA 2YZ7A 1I36A 1Y6JA 1Y8RA 2FWMX 1M76A 1F8GA 3H7AA 4Z9FA 1GR0A 4FS3A 1C1XB 3CZRA 4F6LA 5DCYA 1ISIA 4YWJA 2HCTA 4BGIA 5CDTA 3PTZA 2VRCA 4GLLA 1SB9A 1JWBB 3DO5A 3HWRA 4RPKA 1LDMA 4Y6PA 1Q7BA 3PWKA 1DC4A 3CXRA 4AJKA 4OIMA 3BZUA 1K2WA 3ANLA 3VKVA 3NDJA 2RHRA 4DIFA 1YQDA 2I3GA 2JHFA 3JQGA 1XQ6A 2DBVO 1BXGA 1GUYA 3B20A 3GAZA 1E3JA 2B4RO 5HRUA 1YB5A 5ICMA 2Q1UA 4MVJF 1DJQA 1JAXA 1ZMTA 3IUSA 1R0KA 2ZTUA 2VZ9A 4F3YA 5JC1A 4M87A 3ZV5A 3RFTA 4MIEA 1WAMA 1ZK1A 3VOSA 3GDFA 3HHPA 9LDTA 2VYVA 1IL0A 1GU7A 4JIGA 3ULKA 2CDAA 4IS2A 1C1DB 3UUWA 1MXFA 4IUYA 3EZYA 4QEDA 1ZXBA 1YL6A 1YE3A 2O50A 4TVOA 3WGZA 3SC4A 4DRYA 4WNIA 3IAHA 3BTUA 3KZVA 1YWGO 4DWVA 2QZZA 3HE3A 4IXTA 2HO5A 1EVZA 4HKTA 1PS8A 4EUFA 5AYVA 1E1MA 1SMKA 2AEMA 1VJ1A 4FR5A 2HSDA 5CDUA 3P2YA 3KEQA 3VZPA 1B8UA 1L7EA 1WP4A 5CPBA 1IUKA 4MIYA 1RYDA 3DXFA 3BTSA 4K1LA 5H82A 4CQLA 3I9KA 2BFOA 2X9NA 3ZHBA 4CLRB 3ZV6A 3DEYX 2EKPA 2AHRA 4A27A 1I01A 2QHXA 3PYMA 4DLBA 5CDSA 4EUHA 4ZJUA 4I5EA 1ZVMA 2QIOA 3JQCA 1ENPA 2Q2QA 3GNQA 4H16A 4H15A 3P7MA 5ES3A 1C3VA 4XYMA 4PFJA 5L9AA 3BAZA 3GVIA 4ZQBA 2BFAA 3WQQA 2ZCUA 3NX4A 4E12A 1MV8A 2D8AA 4R1UA 4BO0A 4K6FA 4M54A 4BNGA 1E77A 3H9JA 3P19A 1PGJA 1T2AA 3WDSA 5C7IO 4D79A 2UVDA 3ZWPA 1HEUA 4CM3A 2C7GA 2Q2WA 3D64A 3E82A 2NU9A 4WGGA 4DIBA 3TOZA 4XDZA 4NK5A 3BXXA 1AE1A 4UULA 5A5FA 1PWZA 1AHHA 3M1LA 3U4HA 3QW2A 3KETA 1DLJA 1HE4A 3CZMA 2P9EA 3QV1A 1ADFA 1Q7GA 1I32A 4JGBA 4HV4A 3VAZA 3R6DA 5FI3A 2A94A 1DIBA 3TL2A 2YV3A 5T6BA 4EW6A 5KVVA 2B4QA 3UGKA 5AXBA 2RH8A 4L9RA 2ZKLA 4B4WA 3LT0A 1RM0A 2FZEA 2ZATA 3ZI0A 4YQZA 4D44A 3BIOA 3MJCA 1Y9EA 1I33A 2D0IA 3ZWOA 5B12A 1BG6A 1AUPA 1HYEA 1ZK4A 2G17A 3AK4A 3DOJA 3O8QB 1P1HA 2O23A 3OQ1A 1PJ2A 5TIIA 4URFA 4IDCA 3G49A 4IQ8A 3C1TA 5EINA 1F17A 3DHYA 4YJHB 1GUZA 4L75A 2GDZA 3SEFA 1ZSVA 4KWHA 2J3KA 5L51A 2PD6A 5JW6A 1GZ4A 4BMVA 2G76A 2P2SA 1QYVA 4ALIA 1Z82A 1CRWG 1N9GA 2OL4A 2ZQZA 4BO2A 1RM4A 2I76A 4WLEA 5DOZA 2P5UA 3GNSA 3WQRA 4N5LA 1BVUA 4PG5A 1LDEA 1D1SA 1YJ8A 2NTNA 3TSCA 4B4VA 4YJFA 4H3VA 3LSYA 5HWSA 2BGLA 3GGGA 4NR0A 4TVBA 1NM5A 4KUEA 4R41A 1QORA 1X0VA 2FRDA 3DZKA 1E7QA 4B8ZA 3WOHA 8LDHA 3ITKA 1U7HA 5EMHA 4PVDA 3ICCA 1LBEA 1E3WA 1V35A 1VM6A 2AW5A 3QVSA 1QSGA 2OO5A 5T57A 4O1MA 5ICSA 1CIVA 2OXIA 1HL3A 4M1QA 2VWPA 5G0UA 3DB2A 3KHUA 1XCBA 1X15A 5F5NA 1HLPA 1SPXA 1QYDA 4MP3A 4AJ4A 2PZLA 4I5GA 3WYCA 2Y93A 1UDBA 3PJDA 4WEOA 1X0XA 4HY3A 2WD8A 3V5NA 4XR4A 2B83A 4FIZA 3S55A 3HDJA 4FSHA 3B6ZA 1ENOA 1HDOA 3K9QO 5JCJD 2F1KA 1YQGA 2BF7A 3X2FA 1Y5RA 3TOXA 1B7GO 1RYEA 3CIFA 4LISA 4JK3A 1WMBA 2BI7A 1H2HA 4FPXA 4H7PA 4TRNA 3OEYA 4ONEA 4W82A 4WOJA 3NGLA 3AY7A 1RWBA 1QP8A 2R2GA 4UEKA 4BNTA 1C0PA 5K0ZA 1M66A 1XELA 1FDWA 5I8ZA 1GUFA 2EG9A 3AU8A 1T4DA 4CLXA 1FDSA 3NYWA 3GOHA 3AM5A 3HSKA 5F21A 1CQJA 4RVGA 4RDIA 2VHYA 3UKOA 5KJ1A 2NADA 2EP7A 5C3MA 2JCYA 2X0JA 5HBRA 3BHIA 4EZBA 5IXYA 2ZQYA 4QFCA 2NU7A 3VPFA 1C1XA 3DZHA 1EUCA 4OL9A 1I8TA 3AM3A 1PL6A 5KOIA 2X58A 4TROA 4QT0A 3STHA 4JBGA 3FWNA 4MINA 2VYNA 4FD3A 4ZN6A 3SVTA 1KVUA 3D4PA 4NPCA 2BI8A 1BHSA 1MG0A 2GASA 2HMSA 4CM8B 1MG5A 3GNTA 5AVOA 4KUHA 1UAGA 2Z95A 4R1TA 1B8VA 3QVTA 3QWBA 4RO0A 1A7KA 1ZSNA 4XRGA 4CPDA 2YQ4A 1LRLA 2ZB4A 4PLWA 2QX7A 4JNKA 4GVLA 3O38A 2Q49A 3GFGA 2E37A 3HN2A 4IJWA 1UXJA 4ALNA 3W8FA 3G79A 1E3LA 2IEDA 3RJ5A 3HFSA 3H5RA 3QWHA 5FEUA 3NKLA 1JKJA 3RUEA 2RHCA 4E5NA 4YDRA 4Z3DA 4UREA 3PPIA 1X13A 4LVUA 3ITDA 3FD8A 4JROA 4P4GA 3D3WB 4BNWA 4JX8A 1U8XX 3GEDA 1C1DA 1TXGA 1UXIA 2SCUA 2Y05A 3RC2A 2DVMA 3ETGA 4RPGA 4XQCA 4CLHA 5AXDA 1H6CA 1Z75A 4J1NA 3HB5X 4DPKA 4E2WA 1BMDA 4KUGA 3OBBA 3ZHXA 3EK2A 3ROPA 4Y6RA 1E0DA 4PRLA 2DT5A 1JTVA 5B4TA 2EJWA 4GX5A 2IXBA 2DFDA 5A4DA 2X0NA 4CM5A 1HZZA 3ENKA 5G4LA 1B15A 3CEAA 3U62A 2JKVA 2XAAA 3MOIA 5BSGA 1XKQA 3IMFA 3IIEA 4TZTA 3UAGA 1LLDA 4KOAA 1J0XO 4CLRA 4J1TA 2EJVA 4HADA 1S7CA 5JY1A 2JFFA 3AOGA 2DC1A 2NVWA 1LJ8A 1D3AA 1WZEA 3TJRA 4LSWA 5U1PA 3F3SA 1OOEA 3ZNPA 4EUEA 1E6UA
chains in the Genus database with same CATH superfamily
2YRFA 2Z2IA 5ICEA 5ENDA 5FADA 1M6VB 4MW2A 1ZONA 4V24A 1GDHA 4HJXA 1BDHA 1UBNA 4KNWA 3TQTA 1BFUA 4XCXA 1OKKD 1HWYA 3P4UA 4KQCA 4U2FA 1PR9A 4J0DA 1F8FA 1XP8A 2XVXA 3MWKA 4JR0A 4XPIA 5AUPB 1OAOC 2FPOA 5KINB 1Z63A 3L1HA 1PFQA 1OASA 1SKYE 2QRLA 3NNDA 4KFRA 1NN1A 1PHPA 3RUDA 1UH5A 3JTEA 5BMOA 2A1UB 4FYKA 2XUIA 4MVJG 4QUDA 1D09A 2GYVA 3FFBA 4UU1A 4CU2A 3ZEIA 3DEZA 1EWRA 2VK4A 1J2RA 2GCGA 2B82A 3DUWA 2YY6A 3EPRA 1IOVA 1PTJC 2RGNA 4ZGGA 3VNBA 4C4OA 5CU7A 4HWRA 3TVTA 3K6RA 1QR2A 4OA5A 1OT5A 1XTQA 5CLQA 3T5CA 4CMEA 3JASA 4DPLA 5FPKA 1JDVA 3ETDA 1HKHA 3ACDA 1P9OA 3GJ6A 3GVPA 3HEMA 5KX5F 1X3LA 5JJBA 1EBFA 2IXTA 1M5RA 3GEPA 1XRMA 4KQWA 1MPTA 1Z5PA 1YOVB 2DY1A 3KS9A 1AO3A 4KZPA 5G3ZA 4KJXA 1KZ4A 5IXSA 1NW8A 1DINA 3X44A 4RPLA 3TW0A 1GPYA 1JU4A 3PHGA 1XEXA 1XDSA 1FTYA 1P6XA 2Q4OA 4I9FA 1C9JA 1AGPA 1J33A 2WJVA 1B93A 1JDTA 3WWEA 4BE7B 3CFYA 3ZLJA 2X7JA 4YACA 3GRFA 3O8QA 1U0NA 2VNSA 2IS4A 2WTNA 1G21B 1DHTA 4Q1VA 3BPSA 2JLZA 3L1KA 1Z2NX 2XRZA 4C43A 1BN7A 4FB4A 3FPGA 3AI1A 5BN3B 3GLHE 4XE5A 4OHXA 2QYSA 2EWMA 3MSCA 5AI0A 3WLFA 3HBFA 1PJRA 3WZMA 4DWOA 4DSAA 2ATXA 3VH4A 2OV8A 1GUAA 1O95C 3LKVA 3VQTA 3QKIA 4ESOA 4LE2A 3K73O 2FW1A 1JHPA 1ITZA 2H85A 1VE9A 5F77A 1R2QA 2NQ2C 3DT8A 4CUKA 2ZI3A 2GCOB 4YJ2A 2CZGA 2YZGA 4RMIA 3LFUA 3M83A 3KK0A 3W3AA 2VP0A 2V45A 5AMXA 5IP5A 3F2IA 1A5BB 1X7GA 3F6PA 1YA6A 4IV5A 3K09A 5L4SA 4QTZA 1Q0ZA 3FNEA 2IQ5A 3JQ9C 5TE9A 4MRRA 4CCAA 4D6XA 5JZVA 3GRAA 1ZLXA 1IQRA 1IHDA 4QEZA 4L5AA 4G0NA 1O4WA 1CJSA 1MQ8B 2CHQA 5PGMA 3RU9A 1Y82A 4MI3A 5IDWA 4EPTA 1MHTA 4J7CA 3H16A 4BWVA 1KQPA 4EVIA 4PO1A 2AEJA 4O2BF 4OBEA 2FGJA 3AIIA 1TU4A 3V1UA 1CNFA 3I58A 3N2GB 3I0ZA 4A91A 3NHYA 1B8PA 2PMFA 3ZHZA 4LJLA 1DJNA 3ZS8A 4D0GA 2VTBB 4KACA 5ALYA 3PCXA 5G41A 1DKOA 2JAQA 2AK3A 3OD1A 4EGQA 1SA0B 2HBRA 4HI0E 4TXMA 1JWAB 4AJLA 1PV4A 5CJJA 4LJ9A 3IKTA 2AYYA 3TIVA 5G4KB 1J2JA 1RSZA 3MTGA 4OO3A 2I6UA 1NYTA 2UDPA 5BSRA 1FFAA 3KVRA 3WO0A 2CDCA 5K99A 3JAMA 3PFCA 2TMDA 5AHXA 1ZMBA 3I52A 4AURA 1S8OA 4DARA 3DTYA 4FJ0A 3OU2A 1EWTA 1Q1GA 2AEFA 1KZYC 2CZCA 2HDNB 1Z8NA 5LU8A 3B5JA 5J23A 1GA6A 5AJXA 5BXYA 1GGJA 1UJ5A 2O20A 3TQQA 5BUSA 4EG5A 4K7JA 1H6AA 1JPJA 4D9GA 2Q7XA 4K9DA 3DAHA 1NVEA 1FSGA 2KM1A 1ICIA 1ECJA 2XSZA 3TOCA 1XCPA 2RGXA 2ZVJA 3QVXA 1E7MA 1X7YB 5LP6B 2UZ1A 1X3SA 2IEYA 1P6UA 4CM9D 2G5PA 5ARCA 2H1IA 1KTIA 2IGBA 3S8MA 3HY3A 1VI5A 1CNMA 3H5IA 3BGDA 2DBRA 1F9AA 3RYFA 3L8HA 1U04A 1N9GB 4YXWD 1K06A 3OIWA 4XOUA 4QYTA 2MWMA 3QE4A 1D8AA 3QNWA 3R41A 3NDBB 5EUCA 4HDMA 5A3JA 5JAQA 1QGYA 3RTCA 1VA4A 4LRXA 4TKVA 3NBMA 4NENB 2FMFA 3L5KA 1KI7A 4IIJF 3WNDA 1IHUA 4RM3A 4LSMA 3OSZA 1UMCB 3FYCA 1TVCA 1PFWA 2JC3A 3JQFA 4K86A 1VJTA 2JAWA 3R3UA 3LV8A 4GKVA 1UBOS 5DV9A 1T6ZA 3ZHYA 5IT5A 2YJ5A 3A0UA 5HIIA 5JTTA 4I4LA 1TIBA 4TLLB 2I4OA 3CINA 5D01A 4XXHA 4DUYB 1WLSA 1BC5A 3H6KA 1VIDA 3OOHA 2R25B 3QMVA 3QXJA 4RHUA 4UAVA 5J4YA 1SU6A 2GKSA 3MOGA 1IM5A 3B89A 4QO7A 5H02A 4WD3A 2X4GA 2Q5QA 4WKBA 4UEQA 3GMTA 4CMIB 2YIDA 4O6VA 3W4IA 1SIOA 1CB0A 3D5TA 4B8YA 5KOJA 3O03A 4EMTA 2XA2A 4FQ7A 4ILKA 1KFEB 4NCIA 4E11A 4W9MC 2HSEA 3JW8A 1L7NA 1FVFA 3M34A 4NI5A 4UBNA 4YMWA 4QPPA 3IT3A 4GD3Q 1JSLA 2CXTA 3P2EA 4XTRA 3VOAA 1H6BA 1BJRE 1A76A 1FSZA 2ZJFA 1L8AA 3QFRA 2J9FB 5CMLA 1B76A 1N2CE 5ISMA 3ZVRA 3AHEA 1N34B 1EVQA 1JQ3A 5KVSA 3OCJA 2BMFA 2UAGA 2WINI 4KW7A 2YV4A 4LMBA 4X7MA 1C3XA 3SNHA 3W78A 3ZX4A 4URHA 2CJXA 4MEJA 4LZWA 2AZXA 3ZWXA 3KL4A 3T5BA 3ZI4A 3IEMA 2JGIA 3JVIA 3P97A 4O5AA 1JVBA 3BJMA 3GJTA 3ZHCA 3O47A 5TQ2A 2JNWA 3ODPA 3QTBA 4ETMA 4F9EA 2VZ0A 5AW3A 4Y0NA 1W87A 3RJTA 5EUBA 3FCSB 3AG5A 1ZISA 4MUYA 4D2IA 5J1SB 2GH1A 4IV0A 3NWPA 5ICFA 2AN1A 4L28A 4EY6A 1Q2XA 4OP2A 1RAIA 1U4OA 3A1WA 3GRZA 4TTPA 1D2NA 2CVHA 4D9CA 3ESZA 2P6PA 5ALZA 4DNQA 5B6JA 4C29A 2CLFB 1ABFA 2FUG6 4G8JA 2RJ3A 4PYNA 3I6IA 4I9UA 5AI8A 4L15A 1T9GS 2GK4A 3V1MA 2WTXA 4QBIA 3DMNA 1N0IA 3V4FA 1GGMA 2KSQA 3T4PA 4CM4B 3PLNA 3Q8WA 3NANA 2FPXA 3PD7A 1Q84A 1DCFA 1L5MA 2C04A 4X1KB 2IIPA 5EY5B 1G6Q1 1WZUA 1YONA 4LUCA 3ZDYB 4ZDIA 3FE2A 1B0UA 2RJNA 4PBTA 3M3DA 3K0HA 3QEOA 1YFKA 2JDID 4PSKA 4WXPA 5AKXA 4ZVOA 3TLBA 5H9WA 2BLNA 1NT4A 2OSVA 3KT6A 3L07A 4K40A 1DAOA 3JQBC 2JBAB 2K7FA 2ATIA 4DILA 5LKRA 4A6XA 2A58A 3W5DA 2PLRA 3L7IA 1IXRC 4QGGA 5TEWA 3VPCA 1DTSA 3K9CA 1UBUS 1BTOA 5B64A 1ODIA 1X8LA 1YU9A 4G8CA 1CQXA 1W8DA 3FVQA 3GFRA 1VTKA 3W2HA 1MW8X 1UMKA 3FYUC 5DYNA 4I3HA 2F62A 1J07A 1G7RA 3C74A 1R5BA 4GNRA 1AA9A 2BZSA 2R1ZA 1J8YF 1WXQA 3MTJA 4GPEA 1WXWA 3Q9SA 3FLBA 3IDAA 1EXDA 1ADJA 1LBQA 2YJ6A 1C4OA 1TD1A 3B38A 3BWBA 4X1IB 3PDWA 3UJPA 4YTEA 1WMFA 4FYVA 2PUTA 3HY6A 5TT1A 1E62A 1N5KA 3P0JA 3IXLA 4L5BA 2OCBA 2VO1A 4FFVA 1ZP6A 2J3LA 3AH8A 3BD7A 3MNFA 4ALJA 4OOEA 4DLWA 3EA0A 1E1RA 2VXCA 1QK5A 1GAJA 3AP3A 3FOBA 3OY2A 2PPVA 3ANTA 4IIHA 3ERCA 4D0NA 4NXNB 1DFHA 2I2BA 5CGQB 2JFWA 4YP7A 3HI4A 4GHWA 1TI7A 5WRFA 4QUIA 4BP3A 1GN9A 3R3WA 3L0YA 5GZ1A 4OSPA 4IJKA 2BGUA 3AR7A 4ABYA 4ZC1A 5JH7A 3KWJA 1XJWA 2GJSA 4TYNA 1CUBA 1UJMA 5AIBA 5AFSA 1WZIA 3FOEC 2QTNA 1FVHA 3K94A 2ORYA 3FDFA 3H0CA 1P1BA 3P9CA 5D3ZA 3ELBA 1OFGA 2PZJA 2ZSJA 3DPUA 4X62B 2HLHA 3F3MA 2PKWA 3BREA 2A0WA 4B73A 1TRHA 3K4QA 3PCTA 4XUEA 1QUEA 4QGAA 2HBQA 1O1YA 1OU4A 1DPGA 2I6XA 1YJCA 1C4XA 4G4JA 1E96A 1T9GR 2WMOB 2ZRCA 3PLRA 4CMGA 1CIJA 4M89A 1MOZA 4MQ4A 4TSKA 4A8JC 4B0PA 5C8XA 4DMFA 2G0AA 3OTGA 4Q9JA 5H59A 5LUBA 3TZHA 1N2OA 1X70A 3GPDG 4XLLA 1WMEA 4P3NA 2E1RA 3RU2A 1N5LA 2OTCA 2RI1A 4I1UA 3N0TA 2CHEA 2X1MA 4I2NA 3WGGA 1TO1E 2BV3A 3CR8A 4CEHB 1IAVA 1NRJB 1PVDA 1K9SA 2EIXA 3KJZA 4F92B 1J5XA 2YKGA 1KEWA 1NVDA 4EBBA 4NJOA 2VUSA 3O8NA 5EFZA 4ESEA 1T8UA 1G59A 3G5LA 3FI9A 4ZVRA 4ZQGA 4HPJB 5IYZB 1CQIB 4L57A 3LUAA 4L4ZA 4C4AA 1T2EA 3LOQA 3DW1X 4FKBA 2BDUA 2Y1FA 2VDRB 3AUJB 5GV8A 1YJ5A 5KVCA 2N75A 1RI1A 1QC5A 1TK2A 2BP7A 2GEUA 3DHWC 3L92A 4H0NA 4XKJA 1VGQA 2ZKIA 3QE9Y 2ZI9A 3COWA 4UMDA 2I8LA 3C5HA 3DULA 3UUEA 1R10A 5JG7A 3EN0A 3U7QB 4PQFA 4WACA 3ZLVA 5E9JA 3ZWQA 4QOHA 3QBEA 3QEAZ 3RYCA 2QD1A 5IM5A 3IRVA 4D7AA 7REQA 5HTKA 4IL5A 5A06A 3IUPA 1IN5A 3SQOA 1L2TA 4MS1B 3T52A 3QUSA 2XIJA 5H1YA 3A4IA 3GFBA 1T43A 5JD5A 5A0VA 5DX8A 3LX8A 2PGJA 2QLMA 4QYXA 1VYVA 3CTPA 5JDIC 2P9TA 1YTLA 5DK6A 2ODEA 4AIRA 2VDOB 4A73A 4DAEA 4DVGA 1D7AA 1ZN2A 5CA1F 2X6QA 1M1YB 3H4MA 1LC3A 4AQ7A 1CUAA 3JZFA 3STYA 4DRXB 3GP8A 3AL0C 1P2GA 5IT4A 3ZGXA 2A33A 1FP4B 1Q21A 1ZD3A 2ERCA 3G7SA 3L6RA 1M5TA 4WUVA 3ZU2A 4BMXA 3ZE2B 1G8HA 1JYEA 1GQ2A 4IMPA 4NDNE 3ZVMA 4TUYA 2VJBA 4M37A 3IEVA 2WF8A 4UUAA 4CIVA 4RMJA 2FP3A 3KJIA 5BT9A 2UYHA 1EK0A 4L50A 1K4YA 3AI3A 4E5MA 1BWSA 5C5EA 4MR9A 3CNOA 4YAFA 4IVQA 1P9WA 2HZBA 3GLVA 4PX9A 3TEJA 2Z8YA 3KC2A 2XDQB 2AE2A 4KP7A 4P6VF 4UHJA 2XQGA 3R3YA 4X41A 4LW8A 1XCJA 1YXMA 1U8CB 3EOAI 1MR3F 4O4LF 4M0LA 3P2IA 1QH0A 3C1UA 3QPCA 4DMCA 3TTUA 1QHGA 2D00A 3EFEA 4BFYA 3UFXB 4GM4A 4RC9A 3R0ZA 4MICA 2IV2X 1O4VA 1ZD1A 2C59A 1J06A 2EZUA 2REBA 2VOJA 4YAIA 1E4YA 4CQNA 3WYNA 3MWJA 2W11A 3TQHA 2M6RA 1X7ZB 3NHZA 3SEQA 1JJFA 3MELA 4KN5A 1H2ZA 3Q6NA 3HCFA 1PBNA 2E89A 2XDYA 4AUMA 3UTDA 3ZTTA 3HFGA 3KJNA 1Z6ZA 4LNAA 2JAXA 4BWGA 3WDLA 5JZOA 2WTUA 2GBGA 3MT7A 2FJUA 3TZ6A 2IV7A 2Q8PA 3QXXA 2PJUA 4H7EA 1ZGBA 1UXOA 4ER6A 1OYWA 1IHPA 2FH5B 3DGEC 4C08A 4KDEA 2PLAA 5KQSA 3N53A 1GDDA 3Q5GA 5JY6A 2ZTSA 2ZJ0A 4P5PA 4U02A 5DK4A 4Z2YA 3UMVA 3HY4A 4LJ7A 3STUA 4ARZA 2EFYA 2EC5A 4H4EA 2R44A 4HH1A 5J58A 2YNMD 4BVEA 3GBPA 1JAYA 3O8CA 2QENA 1MNQA 1TCAA 2XOKD 3LVFO 3EGDB 1AB5A 2FR1A 3L0CA 3NH9A 4P7FA 1Z3CA 1T13A 4MV6A 4S2EA 4B82A 4KQ9A 1EKXA 4W6QA 4KR9A 4UHCA 3RC3A 3U4MA 2M6LA 3HBNA 1AS2A 4S0XA 5LQSA 2PT9A 4U8GA 1TVEA 5ADUS 3JZAA 2FZCA 2PBFA 3QKRB 4A2PA 3HKBA 3BFPA 3S2YA 1GYPA 2BMWA 1E5VA 1TU3A 3DKVA 5J9FA 3O0DA 5A7GA 4BL5A 2BM8A 2CF5A 1W35A 3GLKA 1OI7A 2BVNA 4RH3A 2EP8A 1NAHA 2C3UA 2B99A 2SICE 2W5UA 2EZ9A 2XECA 3G23A 4AKGA 1CZKA 3SKYA 3M5WA 2GB4A 3NWOA 2BMVA 3ZDXB 3H8WA 2H2FA 1H05A 3HSYA 2R6ZA 4WW0A 4D42A 3KSZO 3SIRA 4KHPB 2JH9A 4HAWA 4P31A 2OHXA 3H99A 4AJ9A 4NX2A 2D4AA 1TEZA 1MX3A 4PIVA 2FFHA 4TMKA 2C2HA 5ITVA 1CYDA 1YKFA 3U4CA 5CBKA 1G5TA 4CKWA 1HYHA 4EYKA 1Y9AA 4URWR 1DX4A 2YFYA 5CLLA 1JEEA 2JH8A 4PNEA 1R5NA 2F59A 3R76A 5ALJA 4FOLA 4J16C 2Q3BA 3ZCUA 4YJ3A 3TXYA 4C0WA 4HZIA 1C2TA 2PZGA 4IH9A 4OVKA 5IUKC 4B71A 3SSMA 5ICCA 2HQ1A 5IDXA 2ZSAA 2WHRA 5H0IA 3GVHA 3QVGB 1M2FA 4Z7QB 2PAAA 2HMVA 2DUNA 3P0EA 4X8LA 3TEMA 2JD1A 1LK5A 3Q88A 3F90A 4JT8A 1A2QA 4EDFA 1GU1A 2CNLA 3X1JA 4FDLA 2PMDA 2ZJ7A 3JYLA 4YT4A 2AX3A 4CMAA 3UAYA 1QU2A 2DKFA 3PFIA 3GRRA 2JLXA 2IEGA 3UMBA 2H0QA 1EHIA 2RMKA 1PNVA 2Z43A 3BH0A 3N6VA 3KOOA 4J8PA 4W5WA 2NPOA 2ZR7A 4DLYA 1FRVA 4EYQA 4LQ4A 2FWNA 1IG0A 3K15A 1P0PA 1FYDA 2IHVA 3GK3A 3MN1A 1GQOA 4M0MA 5JI2E 3EC7A 4HXEB 4UFNA 5F12A 4FFPA 2Q7OE 3DMYA 1N8NA 4MPDA 3TX2A 4A1OA 1LDGA 1P60A 1NDQA 2J30A 3M1YA 3QK7A 1DIGA 1H4SA 4OMCA 4L6AA 3QU4A 3L4EA 1I3CA 5LA6A 3THOA 4I6EA 4UTRA 1AQJA 3U9TA 2EKLA 4DA0A 5CCBA 4FK8A 5DWVA 1MAUA 4HVAA 3NDIA 4J9UE 1FDUA 3FWYA 3E3OA 3HP4A 1HLDA 2JGDA 3LY7A 4FYHA 1ISSA 5L7YA 1QFMA 2VYVD 3LLSA 1V47A 3OU7A 3GLRA 2JLBA 1BEUB 1XTZA 3OFVA 2DPLA 4Q9HA 4W7HA 4Q9IA 5K01A 3MIIA 2QW1A 3DOEA 3PDIB 4Y2RA 2H2GA 4BFUA 2FETA 3GXBA 3L43A 2ID7A 2REQB 1QBGA 3E5NA 3QHAA 5AW0A 1KKUA 2FVYA 1Z5ZA 3DWEX 2H07A 1J0DA 4GOXA 2QVYX 1RQ2A 1RJFA 2D59A 1ECGA 2C8VA 4LY6A 3OESA 2WG2A 4TV8F 4MYHA 1BOFA 1PLJA 2FOIA 3T5MA 1JKXA 1PVVA 5EXXA 2DWQA 1TK3A 1KR5A 2BGKA 2WJGA 2AMYA 3IC5A 3KPUA 3QG5A 4KIFA 1EM6A 4NSNA 4DMUB 2XWJI 5ER6A 1YL5A 2IF0A 4JLBA 4OMDA 4UZSA 1MB3A 3ZIDA 2QNRA 4CKEA 2GKGA 4QJ4A 3I45A 1YSCA 2LIVA 1JECA 2RGYA 5CA0F 3KWLA 3JYQA 4JUCA 3ZD8A 2PIAA 4WOBA 4JT9A 1NWHA 4LTDA 2BMAA 3TQFA 2P9GA 2R6FA 4M88A 3EHDA 3L7MA 2YFQA 1MAWA 1UZAA 2QPLA 5HIJA 2AI3A 1UAYA 1Z0FA 2ODPA 3GPCA 4L07A 4IHJA 2RHBA 3GRPA 2G9NA 2A5DA 1K3TA 3IPLA 4M7PA 3B8EA 3RYTC 4E6EA 2JCXA 1LF5A 3N7UA 1X1CA 3TE7A 3BL5A 4AN4A 4HVLA 1OX6A 3IQZA 3AJ9A 1HE1C 4BMOB 1JSZA 1T8SA 2ZB2A 5EP1A 1E1QA 1NIJA 3DR3A 2CWWA 4UEJA 3FVWA 3RR2A 3UMFA 1K5PA 1IBKB 5MGBA 2IDMA 2XXAA 2EJBA 2VR1A 1VDZA 1AY0A 4PGHA 4QLBA 3OY7A 3R5HA 4KLZA 4HDRB 4QSMA 3IVCA 4ZVPA 2C9MA 2NNWB 5IKOA 3ZXXA 5AM3A 3CE6A 3PHLA 1PFKA 2I6FA 3TUZC 1IHOA 5IC6A 4M0KA 3RYIB 4GQAA 1T25A 2IXAA 1DBQA 4KKXB 4EHLA 5IKPA 3PF9A 1N36B 2RFLA 3RHFA 4P22A 2J9GA 5AVTA 3W8DA 1YR3A 6ABPA 2J0VA 2WZCA 4CQMD 5FR2A 1SVUA 1U3VA 2B2NA 3ROQA 4AQDA 2J6BA 3A3KA 3OOSA 2WT8A 4WLNA 2OSBA 3HVRA 4REQA 4U2BA 4UDXX 1F38A 1KJJA 4Z6KA 4JLPA 3AKZA 1XNJA 4RS3A 5IFLA 3JWPA 5HP4A 1W36B 4YASA 1R4MA 3DFFA 4QM7A 1TAUA 4IOLA 3DAYA 5D86A 4EYSA 1ZRNA 2RHTA 2H2IA 1AX9A 4YLEA 1W9HA 2R1VB 4V0NA 2ACVA 5DNDA 1HRDA 1UWCA 3DAGA 3HKDB 5B37A 1QQAA 2RGRA 3AVYA 2JHPA 3DMFA 3PNOA 1OGIA 2VRBA 2CD9A 5C9ZA 1XBTA 4AJPA 4EJ0A 1D03A 4K2AA 1XD9A 5E6RB 2EL7A 2PX2A 3ED5A 4KJZA 4CF7A 4HUJA 3G8CA 4R8LA 1FNBA 3R44A 2PUGA 4HATA 2BL4A 3C1OA 1GSHA 3USES 4B6SA 2FZWA 2JFZA 4PYMA 3TR6A 2JASA 3I5YA 4N9WA 1NSYA 4BQEA 3WLNA 2CNWD 1V3TA 2JI8A 4DM4A 2QN9A 2TECE 3BE5A 3SJZA 5FP0A 3PPVA 5K20A 2I1QA 3Q87B 4LJAA 2JGLA 3ESDA 2IZ7A 2IP1A 2QW0X 3KOUA 4UBOA 3ZDRA 2A9RA 3H2BA 4FHFA 4UVIA 4B40A 5AESA 2UXDB 5CDGA 1GRQA 5BW6B 3DOHA 1UM8A 1WE2A 1TDJA 1QQTA 3MGCA 2D3TA 4RQTA 5HE8A 3ZKWB 4EPXA 2FWBA 3KU1A 2ZBDA 3JPWA 4RA6A 4I19A 2XF8A 4M0DA 5D8DA 1HO3A 3KSUA 3FRIA 5DWDA 3K53A 1AB6A 5AKIA 2LDXA 2IHYA 1E5QA 4MW6A 3LY8A 3T34A 3G6WA 5B1YA 1E79D 2QZ9A 2F43A 3ITNA 4Y2JA 3S2FA 1DUVG 1UJCA 2NOAA 4FCWA 1V3UA 2MDTA 3ABSB 1ABBA 5JQWA 3ZX5A 4FFBA 3JCZA 2Q4EA 1N92A 1U2TA 1DVRA 2BBWA 2EJUA 3AWDA 3GRUA 3LQ2A 4JYZA 1YJXA 2HA3A 2IBMA 2PL3A 2PWBA 2X5KO 5CJPA 1YFLA 3NVKI 2XMCA 3DVAA 1R0XA 3ZY6A 2SECE 1XD8A 3KHTA 3QHQA 1FUYB 5AK0A 1Y8ZA 5HJ5A 4TTAA 2DWOA 2WU1A 3QSGA 3NAMA 1TA0A 1CF9A 2I7DA 3FHOA 3SHFA 4QL3A 2R3SA 1EHYA 2WYWA 2QPOA 1WHSB 2YOHA 2PSEA 4EY5A 5BNTA 2X8BA 4MUHA 4C3VA 3STTA 3L8DA 5B57C 1G8MA 2IDZA 4ZDKA 1P1IA 3CX8A 4DLXA 2N0SA 5JYEA 1M3SA 1YDGA 4KWEA 2WWFA 2HPHA 1ZRMA 3ENVA 4M9UA 1K8YB 4HB2A 4IH1A 4B4OA 5ESWA 1E66A 2Z8YM 4K26A 4RA9B 2KYRA 3HVUA 5ER9A 4YJ2F 5FI1B 2L17A 2XMQA 3AR3A 4NG5A 3QTLA 1RIFA 3IAM6 3JALB 4Y7CA 2MIIA 1JRLA 2CFOA 2I71A 5EEGA 4KZKA 1ND5A 2CNOA 3UG6A 1RC0A 1Y42X 3M89A 4PC3A 3NHPA 4UTXA 5LYJB 1U63A 1QF9A 3JQAA 4U9HS 4QUEA 3B5IA 2Y6VA 3GVXA 4JZYA 4BJ1A 3LHSA 4C06A 2FSPA 4OX9Y 2DPYA 1MLDA 5AVRA 2A84A 1KVRA 1Y6QA 4EVRA 4ZCMA 5CVVA 2CN1A 4CW7A 1LK7A 4QBFA 4BDSA 1Z13A 1HYBA 3ZZUA 2D5CA 1SQ5A 3KB8A 2CMFA 5AI6A 4F5YA 1U5BA 3HCOA 3OU6A 3N6RA 3UMGA 3GLIE 2GPBA 4N7MA 2F9MA 2WFMA 5I7EA 1A2KC 1L4BA 2HD4A 5T3UA 5CIYA 1FP6A 2CY0A 1WCIB 2PL9A 2QZPA 1EDZA 3DUFB 2MU1A 2ZP1A 4JQSA 2D7DA 3HEAA 1AZLA 1KC3A 1JIUA 2IS6A 2P8JA 3LZCA 4CUJA 4HZGA 3MCAA 1SBCA 2WD7A 1P1KA 2QE6A 2ODBA 1ZZGA 3M5CA 4KMRA 3VSDA 1LVUA 1T9BA 4E2YA 4BZXA 1M1UA 2H9IA 2HHAA 3MS7A 2ST1A 1RRKA 2C5EA 2YWBA 4U0JA 5FUXA 5TS3A 1BNCA 4CM1A 2C5HA 2Q6KA 3BFJA 2E1PA 5CEFA 4BB5A 1L3BA 1T15A 4GKAA 1TB4A 2GJAA 2BELA 1UZNA 4I55A 3C6ZA 3DPIA 1D7OA 1NIPA 4FNOA 4YECA 4LI3X 1VL1A 3E70C 2H9YA 1JDJA 1SXPA 3RUPA 1I3NA 4TMFA 3MT0A 2IOYA 2NUAB 2AF3C 3VO2A 4YMGA 2I3AA 1A9TA 3BFKA 1A8HA 3G8YA 3L40A 4AMYA 3IO5A 2VBCA 3QMWA 2NN3C 4HWSA 2XMZA 1J2TA 1W0KD 2LV8A 4ENUA 4G85A 4PLCA 1TCBA 2PSJA 3DTTA 1QHHA 4PHCA 1ZRSA 2MHCA 3VSEA 4OGWA 3ZHQA 4KN6A 4LRQA 1CFJA 1YHNA 2F8SA 4RACA 2G4LA 5GJVC 4I5IA 4INJA 1E7WA 3I32A 2GYUA 2WM9B 3HQ4O 3K32A 1AN9A 1F2UB 1JU9A 2CFIA 2YTZA 3GDHA 4GLFA 3ZHRA 2WDPA 5L3SB 1Y1SA 3EG9B 5CEJA 1RC8A 1YVPA 3VM6A 4GOJA 1F2TB 5HF9A 3GJZA 1JSXA 2VXOA 4K9MA 3KZCA 1EI9A 1CEXA 1Z7BA 4NFYA 4RCZA 5DNCA 2RI0A 1TEHA 3N8IA 2WFLB 5JRDS 2FSSA 1BCRB 3EZFA 3R7SA 2HIHA 2RIRA 3OCCA 1XMSA 3OUTA 2Q8NA 4MUIA 4JX9A 5DBEX 3W5SA 2C07A 5HZGA 1LZKA 4B6EA 1U9YA 3JPYA 5JAUA 2YVQA 1T8YA 3CH7A 3O90A 1RWPA 3EW7A 4IEIA 1TUBB 5AW7A 1CVIA 1FTWA 1K7EB 4R68A 3KR9A 1UT6A 3N0VA 2Z6UA 1MAAA 4H7HA 1QQBA 5A4KA 1XAJA 1F60A 4PTYA 5L6MB 4YY3B 1RQGA 1ODFA 5IWCA 1J8QA 1F0YA 2HA6A 2XUAA 5EP3A 2HMWA 1K97A 2FW8A 1E9AA 2WU0A 1Z7WA 2VHZA 3THRA 2WTAA 1AZWA 5DYIA 5TPWB 1Z0SA 3LBNA 4B3HA 4C0AC 2P2GA 3FMIA 1E6EA 3OLCX 4MGHA 2FPGB 1JEAA 1NTOA 4YS6A 2ZTMA 1X7WB 4UE6A 1AF7A 5EYPA 4QLOA 4C7JA 3GH1A 3K5WA 5L4NA 2WYHA 3RBZA 3BGWA 1HTWA 2GHQA 2VHCA 4LXQA 4BZPA 2PUAA 5EVJA 1KA9H 3HL0A 3PE4A 4TWIA 1DJMA 1IVYA 1IAQA 1Q92A 4GH5A 1NBMA 2ZTHA 3D7RA 3IX7A 3EPJA 2PTHA 2YYAA 4F96A 3FGNA 4GRIA 4RPCA 3KAJA 1QX4A 2JG3A 2Y67A 2OQRA 1FF9A 2CJWB 1Q0SA 4HSEA 4O4JB 3O73A 3RRJA 5CDHA 5H8WA 1IDOA 1J9GA 1R00A 2AG8A 2IW3A 1VE7A 3C15C 2FPRA 3UJ6A 1W5EA 4PLFA 1UQTA 1H6DA 4KXLA 1P72A 2B92A 3AQ4A 2IVFA 3FSGA 5DGXA 3VGJA 3R9KA 1JGTA 1NP7A 2A8YA 3I5AA 4A2CA 2I6GA 3GD5A 1O95D 1SCAA 3LA6A 2PUEA 3UC9A 3EZ9A 5LQJA 1WDLA 4G0VA 2O54A 4OY3A 3BBLA 3IGFA 3FKJA 3TLYA 3AUTA 3O75A 4F4IA 1CY8A 1EVKA 1Q20A 3OFNA 4UXIA 1IU9A 4W6ZA 4QATA 2BZ1A 3CRW1 4BBAA 1NUUA 2A4KA 2HWXA 3GZNB 1LW7A 4MI1A 1PZMA 1V7ZA 2BJWA 2PTGA 4LHZA 4OK5A 3DG9A 1R88A 4D8VA 3P9QA 3P5SA 1WB4A 3NOVA 4YH1A 3EVBA 4NU6A 3ND9A 4YRKA 1AKMA 4ND8B 1C8LA 1Z6GA 2DAPA 1ZR2A 3PPYA 2FWIA 3PGJA 4P8RA 4R1SA 1RZRD 1BMFA 1LJUA 5PNTA 3EASA 3F9RA 2RAPA 4FDTA 3BORA 2ZR8A 3DMRA 3ORYA 3SC2A 4BEBA 3DT9A 5JAOA 5KYWA 1CYEA 4I3FA 4I5FA 4L0DA 3NONA 4NBWA 4DSTA 3O9VA 4XPZA 4QXRA 1FMJA 2Y9PB 3HL4A 1BXZA 2V58A 1KAEA 4GZ5A 3QU7A 4IOJA 1TO2E 2Z9CA 5H5JA 1DAKA 1MC4A 1ZYUA 3IODA 2GK7A 4MQLA 1DJPA 2IZOA 4CR7A 1R6DA 4J49A 3RWMB 3U44B 2WNHA 4RHYA 5KUTA 1Y1TA 5CEEA 4HC4A 2PUBA 2AVNA 1LTKA 2VP5A 3B2EA 2JIOA 1JHRA 1W85A 1QTRA 2W70A 3TAHA 2G83A 3VHXB 5HKKA 5F5XA 3S8YA 1PZFA 2QT1A 1KAGA 3FKSD 1DQPA 2PANA 5AHWA 3W79A 2YJTD 3G2IA 3ZV4A 1V9CA 2X40A 2AXPA 4WHMA 4WPGA 5ENVA 4E14A 1QHFA 3AFOA 5JVDF 2OLKA 2HWYA 4DIOA 1J24A 2BFFB 1XZPA 4ZC8A 1Q91A 4KDFA 3K0CC 1YVEI 1GPKA 5DXJA 8AT1A 1U94A 3KAKA 4AJJA 1BKSB 3E4CA 1YR1A 2OB1A 1WABA 3C39A 1GJRA 1A2BA 1OX4B 2YIJA 3M4YA 4DLUA 4HRXA 2FSGA 5E2IA 4J4HA 3WGNA 5H80A 2PDAA 1EGMB 3TLAA 1K6MA 4HQFA 4M49A 4P4LA 2WKSA 3FMVA 4Q34A 1G5RA 3SYKA 2OXFA 2QRVB 1E2LA 3O1IC 3WRXC 4CTKA 1YHYA 1FTGA 1XF1A 2AW3A 3GUYA 4QOGA 3ZU3A 1TQ8A 2DX7A 2LR0A 3KQLA 1RLIA 4K9QA 4XQGA 3P0RA 2HU8A 3CF4G 5FOSA 1T2FA 1O8BA 2XGMA 3AM1A 3DNFA 1DP4A 2AFHE 3AFIA 4B75A 1J4AA 3BC1A 1IXZA 2ZVQX 4LKOA 4BHTA 3HV0A 5KJCA 1XV5A 4I4TB 4TV9B 1KBOA 3BF8A 1XIVA 1GYQA 2CW5A 3U3XA 2AMLA 3HV2A 4EYGA 3ET4A 3JVDA 4UD6A 2X8WA 2X0DA 2PGNA 1T1IA 4PO9A 1TL7C 4Q0MA 3LP5A 3I62A 4C5BA 1PS9A 2RH4A 5DM2A 1KK3A 2ZRGA 2IHKA 5KX5B 1RXYA 3T9EA 4ITRC 4LX8A 3NUGA 3PZBA 2ZT6A 1YCFA 4QASA 5EN4A 2Q1XA 4WFIA 5KCZA 3NIDB 2BHNA 1E9BA 5JVDB 2J5KA 5ILOA 1SVLA 1ISHA 1NXXA 4FT2A 1V7CA 4PLYA 4C89A 4LJRA 2QQFA 4RKRA 3MJEA 3TLZA 1A8PA 1KERA 1E6CA 1ID8A 4PAOA 5JQGA 2YHIA 5DW3A 4WN3A 4NOMA 1X9IA 1YRQA 1BE6A 4R8VA 3GFQA 3VR5A 1B4DA 4RDHA 3TLXA 4C3OB 3H87A 4JHLA 1G20B 2Z09A 4OFXA 1U9IA 1PJZA 1YUBA 2I0FA 4MVJI 5EWMB 2NXNA 1CUHA 5CK4A 3LK7A 4BO3A 3BMCB 1O94A 5JPCA 1WG8A 2YY7A 2G06A 2ZSUA 3PKJA 5H70A 4ZCLA 1R6VA 4KGDA 2V7PA 2AQIA 4BE4A 4JXZA 4DZZA 2CXQA 2JLRA 2B3TA 1L7DA 1PIWA 2Q1YA 1LQUA 2ZW9A 1FFSA 3T8YA 3UV6A 2J0UA 1R3UA 2O7VA 3OQVA 5ALXA 2I9KA 1Z5OA 4ON9A 4BXOA 1FXWA 1UWKA 5I7SA 5SYAA 3C7AA 2HFKA 3T61A 1RS0A 2FA9A 1TA9A 1CE8B 1J39A 3G2LA 1ZK0A 3JQEA 1ZM7A 4RSGA 5K3CA 5JCOA 3UENA 3UWDA 3VPGA 4PAWA 2C2BA 4WFQA 4P9NA 1E3DA 4AG3A 1X1BA 4UMFA 1LLCA 2OCLA 1WPXA 1SQFA 1NMZA 2O0MA 4I46A 1EEXB 2C4VA 4XD2A 5EZYA 4JBXA 4KE9A 2JHCA 3MUEA 3TDMA 1XNGA 1KP2A 4MKRA 2BGMA 5JV5A 3QRWA 2GWRA 4O2BB 3I9LA 4LN1A 2BCEA 4Q6WA 2WJAA 1H93A 4ND3A 2C97A 5CYOA 3W8NA 1JH9A 3QXCA 3TTWA 3LOUA 3EDRA 1UBCA 3ZZ1A 4KXNA 1K3FA 1SKBA 3QQ5A 4TS1A 5E7MA 3CMCO 1LNZA 1AF4A 1WO8A 1UFVA 3C3BA 3HLYA 5SZKB 2Q3FA 4W5HA 5FBVB 2WMNB 1QH8B 3G0HA 3SZ3A 3EMDA 4EJSB 5KIAA 1VYUA 3UCFA 3TW8B 5GVSA 2RG1A 3RREA 1EX9A 3A2NA 1ISFA 1IY8A 1MXHA 3KYCB 3SBEA 1R8JA 5AHOA 2HO4A 5AJZA 4QBGB 5DNEA 2GESA 5A1JA 1Z07A 2NP6A 4FZVA 5SZJA 5HPYB 1PGNA 1SZDA 3DP9A 5EI5A 3ZN2A 1Z8HA 1I80A 3DTVB 2ZBRA 4YAOA 3HXOA 4BMDA 4EMSA 3R5JA 4C0KA 4O29A 4M6WA 1KF0A 1VE6A 2P3OA 1ULZA 2W6IA 2JFHA 3LUDA 3LYLA 4GGOA 5K8CA 1UBJS 4YO7A 1P33A 4RIEA 4ESHA 3GZ4A 5IJ9B 4OXRA 3WLAA 1QF7A 1FVOA 4Q1CA 4IQGA 3W4JA 4H1VA 4WERA 1A0OA 1J90A 2NU6B 1T3TA 2UYYA 3WICA 4EHJA 1K89A 1SXQA 2P2LA 1HEIA 2ZSBA 4PCVA 3RSZA 2VJAA 4MKZA 2W42A 2O2HA 2YWGA 4WXRA 4HQ0A 1EBBA 4YRMA 4WCFA 5KYYB 2W2QA 1M2VB 1MX5A 3UCXA 1P8AA 1AMUA 5LBUA 3D43A 3LPMA 2TS1A 3TZLA 3HP7A 3VX4A 4KR0A 2WJZB 5G0VA 4FJ1A 3UANA 3KWFA 5K9ZA 4X20B 3ASVA 4C4YA 4QTYA 1DAHA 3QLJA 4GMGA 4WZBE 4YDQA 4Q3NA 1T1SA 1VG1A 1W88B 3GNLA 2XDWA 1P4GA 4R2JA 3RRNA 4GE0A 4AQYB 1NI4A 4GXTA 1N3BA 2X2PA 3CPSA 3KT8A 3L8MA 4N03A 4C5CA 1KOJA 1AGNA 3H1TA 2WV7A 1G8AA 1V41E 2W48A 3WDMA 4NCJA 5DHFA 2F00A 3RB8A 1COWA 1Q2UA 3EQ8A 1EYZA 4XB2A 3AIKA 4CJXA 3OOJA 3VR4H 4N40A 3IILA 2PWZA 4IMIB 2Q0XA 1JHXA 3DOCA 4MVJD 4GXNA 4MR8B 1JHOA 3MS2A 1F06A 3LVBA 3IJPA 2WWWA 4AAYA 1DRUA 4D43A 2WF7A 4IWXA 4ID3A 4FOTA 4JJIA 4EHHA 3V4ZA 4W5JA 3BHJA 2H1SA 2QAGB 2UYOA 3R0JA 4WBXC 1JHAA 1OXUA 3SSOA 5CNMA 2AB0A 1B6SA 2OC4A 4HX9A 5KQLA 3EXHA 1VZ3A 1O6CA 2PQ0A 4H3KB 2OO5C 1KFBB 4EP1A 2AF4C 4XQ9A 1X7HA 2RBGA 1QHEA 5HA5A 1ORWA 5F3RA 4TKUA 1SXJC 4BV3A 3C14C 4RKQA 2RAUA 3P9NA 3SOPA 1L5WA 7ABPA 3QKUA 1YQQA 5BV8A 4JV5B 3RRMA 2VSNA 1JBKA 3A3OA 4NEGA 5ITWA 3QOYA 4QJ3A 3VTAA 5KU1A 4XFJA 3WWPA 1ZL0A 3AUXA 3B6JA 1TPZA 1CUYA 1SKUA 3CH4B 3ILVA 3PIDA 4OMUA 3OKPA 5HF6A 1WZCA 1QIGA 1TJNA 2COEA 1NUSA 3ADCA 4Y67A 3DKKA 3UMSA 4BO5A 3S2UA 5IDVA 1E9SA 4FSDA 2XYRA 1XRQA 3OFSA 2NO4A 3PFNA 3WGIA 3AHIA 2FUKA 4CMHA 4H1WA 2BBSA 4O4HF 3IR7A 2ZIUB 2KW5A