2W83A

Crystal structure of the arf6 gtpase in complex with a specific effector, jip4
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
161
structure length
161
Chain Sequence
b'MEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-RIBOSYLATION FACTOR 6
molecule tags Protein transport
source organism Homo sapiens
publication title The Structural Basis of Arf Effector Specificity: The Crystal Structure of Arf6 in a Complex with Jip4.
pubmed doi rcsb
total genus 59
structure length 161
sequence length 161
chains with identical sequence B, E
ec nomenclature
pdb deposition date 2009-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w83A00
2FZ4A 2BBOA 4O3MA 4UXIA 3VAAA 4AIIA 2F43B 2QA5A 1ETUA 4US1R 4A8JB 4BRUA 1E9FA 3ZIAD 3W8NA 1Z29A 3RS7A 1F2UB 3IQXA 1I4TD 3LQRA 1U8ZA 5FPTA 4BLQA 1A2KC 4TMXA 2XJ4A 5DGXA 2J46A 2P5SA 2W0SA 3ZZUA 1E9RA 3CRVA 3PQCA 4JLMA 1W47A 5HKKD 5JWHA 1P72A 3E1SA 2OT3B 2PJZA 1N5KA 5P21A 4OI0A 4NHOA 1QHGA 1XD9A 5JJIA 3C15C 1LF5A 3SN6A 2PLRA 4DLZA 1B23P 1KO1A 4G5GA 5HCIA 2ZPTX 3TH5A 2FH5B 2REBA 1XEXB 2QE7D 3GLGB 4HLUA 2ZUDA 2GCPA 2ZRDA 5AJYA 5CYOA 3RS0A 2JASA 4Q66C 5FOWA 2I1VB 2NZ8A 4G5OA 3EASA 3QG1A 4H1VA 221PA 5K8UA 2BOVA 4PX9A 3O8DA 4TSFA 3U5ZB 1OXXK 2AK3A 5CLQA 2IYTA 3I4LA 3OEHA 4GDFA 4ARZA 1FQJA 1XDBA 1ZBDA 2FPKA 2UZIR 4O2RA 2CVFA 3TR5A 3A1UA 3UKDA 1BO6A 5EZ5A 3OF5A 4RJLA 3ZVRA 2ONKA 3KQNA 1ZC4A 1PUJA 4DLSA 1E0AA 3ZZ0A 1G5RA 4JS0A 1XTQA 4B3DA 3QBTA 3WNBA 2XITA 1N6OA 1QDEA 4K46A 1TF7A 1E79A 2IYWA 1P7CA 4DUGD 5DN6A 1O3YA 2MMGA 3BC1A 3CW2A 3DEFA 3PUWA 1AQYA 2ZJAA 3N5CA 3QNUA 1OW3B 1KGDA 5DH9A 5GJVC 4OI2A 4QJ5A 5JSZB 2DFTA 1JEEA 2RGBA 4LJ4A 4DHEA 1TU3A 1CJKC 3H4MA 4IOMA 1OXSC 3LVRE 1VG8A 1OXUA 2PCLA 4LJ8A 4PPNA 4QM6A 2Q9CA 1W4AA 1E0KA 1XTJA 2OLJA 5J4YA 1IM2A 1WBBA 3K0AA 3HP1A 1GNQA 3L43A 4XIGS 5JSZA 4AI6A 5AUQA 1OSNA 3DOFA 2BVNA 2QT1A 2GA8A 2YC4C 3IGFA 4B2PA 2ZS9A 1FMLA 1W2HA 4BZXA 2W2XA 1QF9A 3EIQA 4TTRA 2ZU6A 5BW8A 4U5XA 4I99A 2N1BA 5CDFA 2ZREA 3LWNA 2BMFA 4DLYA 3AF4A 4F38A 1XTRA 1LVGA 4QXAA 3HWSA 3T1TA 3K70D 4ZV4A 4MKHA 3ONWA 1Z08A 2Z5FA 5CM8B 1NIPA 2CJWA 2DHRA 3RWMB 4B44A 3OHMA 2V1UA 2P6NA 2RGNC 2EWWA 5IDVA 2ZJ5A 2WWFA 2C78A 3JZMA 1Z6GA 4F4CA 4LYFA 1CULC 1CIPA 1XB2A 2MSCB 3ND8A 4NP6A 2RGEA 2ZRBA 2V1XA 4HLCA 3W3ZB 3CIOA 5CIQA 1WBDA 4DXAA 4JMPA 4D2IA 2C77A 3K9HA 4W7SA 4QGHA 3M4YA 1N0UA 2GJKA 5CJPA 4AYWA 1G8FA 5AWFC 4LJ5A 1OT3A 2V6JA 1NVVR 3UPUA 4AG6A 5B30A 2CL0X 4RCYA 1IN7A 2OSBA 3KKQA 3QPWA 3TVDA 3GJ7A 3THWA 3ZD7A 1GWNA 3WMGA 2OE2A 4FMCF 3TR0A 4B3FX 1ONBA 2Z4SA 1UKVY 4US2R 3F0TA 1OKKA 3P1JA 1N0WA 1R5NA 2VP2A 4CF7A 1HE1C 4NYMQ 5KSPA 3X1DA 4MYHA 1Q1EA 4Z8XA 4M9QA 3FMFA 3H84A 2BCJQ 4A8JC 2CNWD 3R20A 4Q7JB 3QJYA 1GL7A 2PCJA 4LBZA 2NPFA 2ZI3A 3VKWA 2QY9A 3BE4A 3RANA 3D8BA 1T6NA 1G5TA 4KU4A 5IK2A 3G5UA 2A9KA 5DLQC 2VHQA 2LKCA 4YLGA 3BORA 4Q1EA 5H68A 2IBMA 4U02A 1EFRD 1S8FA 4MGZR 1DAFA 1P6XA 5HCNA 1FNMA 4CEHB 4IEEA 4RVCA 4C7OB 1ZM7A 2R6AA 2NOAA 1EWQA 1HH4A 2FA9A 3CZPA 1EFHA 3KTAB 3MWJA 1YJ5A 2VP5A 1FW6A 4TQUS 2OCBA 2EW1A 4WZ6A 5KYKA 4XD7D 4Z1MA 3ZS8A 4TLCA 4TN1A 5L3VA 2XTNA 2A5YB 1T5LA 2H7VA 3CWZA 821PA 4XSHA 3NBFA 3KKOA 2IYRA 2RGXA 1OE0A 4EAQA 3Q7QA 4N1AA 4XWAA 4TLEA 2J45A 1GSIA 1W4CA 2R6CA 3KB1A 3L0OA 4LHYA 4K8OA 4OK6A 4QFMA 4M1SA 4QG7A 2KBFA 4ZI2A 2BEKA 1JR6A 3A6PC 1E2GA 2XSZD 1Z0IA 1NJGA 1Z3IX 3AGQA 3A1SA 1GTVA 3X1XA 1M74A 3KQUA 1YZGA 2H1LA 1EWRA 2QP4A 2VP9A 1BYUA 2IYVA 2VHTA 5DNYB 2IK8A 4OQMA 1CJTC 2EYQA 3VR6A 1VG1A 2Q6TA 1IHUA 1G6OA 5FBWB 4UQOA 3UK6A 4NCJA 1G64A 5E7IA 3EX7C 3KL4A 2Q9BA 4IHQA 1II8B 1ZIPA 2RGAA 3N2EA 4MKFA 2C9OA 2FEMA 3RDPA 3VKGA 1ELOA 3AVTA 1R7RA 3SE0A 1S9HA 3AKDA 1EX7A 2GJAA 5L3QB 2GILA 1ZCAA 3LXXA 1BKDR 4LHXA 2QBYA 1GNPA 2CNWA 2EFGA 1NJFA 2C98A 5CB8A 1NN3A 2QROA 3K70C 1OFHA 1IXRC 2YINC 4PZZA 4GMDA 4ZDKA 3QEOA 4GOKA 1YQTA 1W0JA 1XP8A 2KE5A 2ZJ2A 4QBHA 1G21E 4L8GA 4TLBA 3CPHA 3WMEA 4EKDA 3ICEA 1HV8A 5EXSA 4Y0AA 1ZUNB 1NI3A 1Q57A 4I1OA 2F9MA 4EUNA 2JLUA 4RFSB 4B2LA 5J5CA 2FSHA 4OHYA 2VSFA 5IT5A 5L8VA 4LYJA 1RYHA 1MABA 1OV4A 3I5XA 1LNZA 3Q8XB 2ATXA 1L4UA 2QI9C 4DEYA 3AVPA 3W6OA 3A8TA 5GVSA 4M8NE 3ND9A 3I72A 4IOLA 1DBSA 3DOEA 4UJ5A 2ZRJA 121PA 5C46F 4PXAA 4PC6A 1UDWA 2IXGA 4BPBA 2QQEA 1OH7A 1Z2CA 2G77B 3MJRA 2D7DA 2QTVB 1JQJC 2YVUA 4IDPA 4HLDA 3FWYA 2NZJA 1K6MA 3VQTA 3AH8A 4P31A 2D62A 4URXR 1CR1A 2JDIA 4Q4HB 2IUUA 1D2EA 2FJUA 1WQ1R 1MRSA 4CGZA 2V7QD 3A4LA 3DZ8A 1JEDA 3EA5A 4L16A 2GJ8A 4GMXA 1JAIA 3LFUA 4IKEA 2ZR9A 1T4GA 2OZEA 4LC1A 3NEJA 5DYGA 1FX0B 4HYYA 1N5IA 2FPLA 4MDEA 4BZPA 1JJVA 5K8TA 2GEVA 1U0HC 4CIDA 3QUSA 2W6IA 3W6PA 1OB5A 2CXXA 4DKXA 1MH1A 5FOXA 3QKSA 3W90A 1KJZA 2A5GA 3CPEA 4LPKA 4RFSA 2XZOA 4X8MA 2HEIA 2OEPA 2WAYA 5KSYA 1FTSA 3PV0A 4HB4A 2GXUA 2RKOA 4QBFA 2IHYA 4LBWA 3ZVNA 4NTZA 1AN0A 1E6CA 2QG6A 4B3CA 2D7CA 4Q9HA 2WKRA 1D9ZA 3GJ8A 5EP3A 4B3XA 5KSZA 3EPLA 3RWOA 1TEXA 2EFCB 4LC0A 1HTWA 2HV8A 3FDIA 4DSUA 2Q0HA 2QAGB 1TTTA 3K0FA 3SYLA 1Z63A 5TY0A 3OIYA 2IS1A 4B43A 1IN8A 4DT1B 5LDDC 3QF4B 5KNBA 3QXHA 2P5TB 1N3BA 1ZD1A 3X1ZA 1E2QA 1QVAA 4RCZA 4KHZA 4WOPA 3I73A 2C9YA 4GNKA 4HB2A 4CW7A 1T8UA 4NZYA 3GJ6A 4BZQA 3I62A 4CDGA 2CL6X 4PSKA 2OM2A 5LPNA 3CX8A 1KZ7B 2XZLA 2CCJA 1CF4A 2BM0A 2ZSBA 1XEFA 2SHKA 4DT1A 4GZMA 2ZYUX 1KJYA 4N0EA 1XPOA 2ZJZA 1RJ9A 2BJWA 3Q3JB 1Z6YA 1W7AA 1E9AA 2ORWA 3TUZC 2IYLD 1AGRA 1Z6AA 2JATA 4JYCA 2JLQA 3LVQE 3B9QA 1KK1A 3R9IA 3GLIB 2J5XA 1RRFA 1SXJD 2FG5A 4LYHA 4OHVA 3OE7D 4BFUA 1SVWA 1TNDA 1Z0JA 2VEDA 5DO9A 2XB4A 1DPFA 3GJXC 2AD1A 2GTPA 1SULA 1XTSA 3I1FA 4NCKA 5DHAA 4JZKA 3SQWA 3GEIA 1RYFA 4JVSB 2G9NA 1OB2A 4URZR 1F2TA 1HT1E 1VG9B 1Z6XA 3AUYA 1JBKA 4KFSA 3Q85A 4WW0A 3B82A 1G1MA 1P60A 3QKSB 3IIKA 4Q02A 1R6BX 1W0KA 1QHIA 3KB2A 1OXVA 2GXSA 4DWJA 4POAA 3RRMA 2F1JA 4M1MA 4QHYA 1SVSA 1IN6A 3EZFA 4I1SA 3TUIC 1E2IA 1P9NA 1DAEA 2IT1A 2OHFA 4I1UA 2ANCA 3WYGA 5BYKA 4FCTA 2R44A 1Z0AA 4V0OA 1UPTA 2F1RA 4TLDA 3EAQA 1F48A 4C0QC 5J4LA 4D6PA 2QAGA 1GITA 2WSSA 3PCRB 5JS7A 1CRPA 4GFDA 5LD2C 2ZETA 2F55A 5CITA 3LX8A 3C5HA 4A0RA 3NVAA 2OBLA 2RHDA 1XJ0A 1CP2A 4JVNA 2D2FA 2FOLA 1D8TA 2JCSA 2ZITA 1KO8A 4L9WA 2OCAA 4FMDB 4BE7B 1ZRHA 3HDTA 2XXAB 1F3OA 3F8TA 3W6NA 3NH6A 2ZI5A 2GHIA 1EGAA 1G6HA 2R6FA 4DDVA 2GXQA 3WBKA 4DBLC 3THYA 2P67A 4TLAA 5HTKA 1KY3A 3NHAA 2JLZA 4Q9LA 4MRNA 3ZDQA 2FE4A 2IW3A 4C0AC 2QM8A 1OPXA 2WJHA 4DLUA 3QXJA 2DFNA 4KJZA 3NIBA 1PV4A 5DHFA 3ZVLA 2WWIA 5EQTA 4C4PA 3GLFA 4BGDA 3MMPA 1P4SA 2CJWB 2IL1A 1FL9A 3AKEA 3HPQA 1IY1A 4B3BA 1G18A 1YRBA 1ZNZA 2F3TA 4ZKEA 2QPAA 1RC8A 1GFIA 3LAWA 2Q9AA 1S4QA 2BV3A 4TQ9A 3X1WA 3AKCA 4ACAA 4GSYA 2J87A 1DAHA 4V0LA 3TUJC 2JLYA 4ZIRA 2IYQA 2FN4A 5EJEA 4F4JA 1ESNA 4RSGA 1Z5ZA 2RMKA 1F60A 1NIJA 2ZRCA 2YWEA 4URUR 4NDZA 2GK6A 2FSFA 2L0XA 3FKQA 1LS1A 4PANA 4JBWA 4QGGA 5DI3A 2IC5A 2WM9B 2OFXA 1XCGB 2ZXUA 2ZANA 4KXFB 3LRPA 3H86A 3MAAC 3ZZTA 1H8HA 1MO5A 2XX3A 3K0AB 3QXCA 4NYJR 2XXAA 3GJ0A 4LZZA 2BHRA 5F9FA 4JT4A 1ZD9A 2XNDA 1CTQA 3VKHA 3TK1A 5BN5A 1SHZA 3TSOA 1VYVA 4YXWD 1F2TB 1KI1A 2W6JA 3B9PA 3GJ4A 2JJ2D 4RD4A 3VNUA 6Q21A 1ZM9A 4M22A 4PAQA 3EZ6A 3SHWA 2QORA 2YHSA 3SQXA 3LLUA 3EZ7A 2RGDA 3QVVA 1TQ6A 3T35A 1KOFA 1NVWQ 1BOFA 2DCUA 4WIAA 1UADA 4TYWA 3KX2A 1UEJA 4OK3A 3HJNA 3U3KA 1OFUX 4DC9A 3WYFA 2O8DA 1YVDA 2FMXA 5KDOA 5D3MA 5E7MA 5JJLA 4IDNA 3D31A 2J59A 1N0VC 4TZ0A 1E94E 3KKPA 3GD7A 4RZXA 3KTAA 3IPYA 4ARZB 4FIDA 1FUKA 1KIMA 4LJ9A 3OFNA 2ONJA 4CYMA 1NG9A 4CEHA 4P32A 2FSGA 1LTQA 1Y3AA 3BFVA 5EXPA 4ZKDA 1KI8A 4BFVA 3FE2A 1COWD 3C8UA 3PENA 4NPHA 2EU8A 3EW9A 1NVVQ 2A5DA 3AVYA 3ZYCA 1S9DA 4M9ZA 1Z6TA 2WICA 3R9WA 1R5OA 3LLMA 2B7BA 1G17A 4U00A 1NMZA 3QENA 1CRQA 1G4AE 1PLLA 3NEYA 3ZGXA 4LPSA 2PX3A 4BFWA 3GFTA 1XEXA 2ZS8A 4C0KA 4R7ZA 5GJCA 3JVUA 4RFVA 1CLUA 3H1TA 2NGRA 1BH2A 1YZUA 2ZTSA 3LV8A 2A5FA 4TTQA 2DWPA 3U7HB 3QIAA 5FBLB 5FTKA 4RD3A 3PVSA 5JRZA 5FUVA 1CR0A 1XCPA 3KQHA 4B32A 4XVRA 4M0LA 4OHXA 5EE5B 3I92A 4YXWA 2AXNA 2BWJA 2VHCA 3CNLA 3ZJYA 2NMVA 2XNSA 1TU4A 1GL6A 3BERA 1F2UA 2ZUCA 1YR7A 5G3YA 5KNDA 2OXCA 2QZ4A 4C2UA 1UBCA 2RGCA 3EA0A 1Z0DA 2JIZD 3B6EA 4ZI3A 3OZXA 4WBSA 3RS3A 4ZCMA 4N3NA 1WDTA 4B2IA 3TE6A 4IFEA 5L3SB 2GZDA 5JLJA 2GJ9A 5L3RA 2AFIE 2FPMA 4Q1CA 1F6BA 1G9XA 1NVUQ 1YKSA 3THXB 3NBYC 2ZROA 1R0YA 4TYNA 5FPKA 1TX4B 4OQXA 4M1TA 1GG2A 3ZLJA 4W9MC 2JJ8A 4B6FA 3HYTA 4YMTA 4P4SA 2XOKA 2VSOA 3VR4A 4G5RA 4K81B 2G88A 3L8ZA 2YOGA 1IONA 1PLKA 1Q12A 1XRJA 5FTLA 2NO1A 1XXHE 3T5DA 4TYYA 1IJFA 1R2QA 3SOPA 2YKGA 4ACBA 2JAQA 3BRWD 5J4HA 2LWIA 5EP1A 3BH6A 5BYJA 3AQ4A 4EFLA 3C5CA 5BN4A 1S2MA 2AWNA 2ZYWX 1W36D 2FNAA 3X2SA 3M1IA 4BWYA 1U98A 1E2DA 2Y8EA 5GJBA 1EFTA 3H0KA 2IWRA 3SBEA 4AC9A 2G3YA 4C0JA 5E4FA 1OFTA 1UM8A 4AY2A 3K9LA 3SC3A 2CLDX 3P4YA 2FX3A 3O47A 2O0KA 5E7JA 1UJ2A 1ZIOA 5KU1A 1N5LA 3D6TB 4FWTA 1XPRA 3P26A 2J0UB 4N0DA 2EFDB 2NPIA 4DLXA 2GVDC 1ZM4A 4PZYA 4Q7MB 4W5JA 5TARA 1M7GA 1SKYE 2B8WA 1QHSA 3V4RA 1PLJA 3CF2A 2YOFA 1CJVC 2IXFA 2ODWA 1QVRA 2KI5A 4JIMA 5DYIA 4UNQA 3BB4A 3I5YA 4Z54A 1U94A 4JBYA 3I3SR 4ZDJA 2J7KA 2DBYA 4BFXA 1XNJA 2QP9X 3GLHB 4BFSA 1XFAA 5SZKB 4X8HA 1WP9A 5AK0A 721PA 4NL4H 2Z0MA 4B47A 3LW8A 3QG5A 3SZRA 3FHCB 3VR3A 5FUYA 5JJKA 2NQ2C 3SHFA 3WP0A 1MO3A 5CDFE 1UKZA 3TSZA 4TMWA 3X1YA 4DLRA 2WMNB 3LH5A 1C9KA 1M8PA 4QM7A 1DEKA 1TL7C 4HAZA 2K5UA 1R10A 3L2OB 1W46A 1NKTA 5FL7A 5DISB 1T91A 5LB2A 1RRPA 3UANA 2MSDB 1DOAA 3SNHA 2GCOB 1KK3A 4JLBA 5FR2A 3CWQA 5KSOA 1OIWA 2WKQA 4JLOA 4JLAA 3VR1A 3QSYA 4XOIA 2ATVA 1TUEA 2XTMA 3RRZA 5HR5A 3KUDA 3IEVA 1KMHA 2Q3HA 4MDFA 1UFQA 5J4VA 2ORVA 3AKYA 4QGAA 4P0TA 1GOTA 1KKMA 5FTJA 1IY0A 2DWQA 3G0HA 3MSXA 1BIFA 1CR2A 3KXKA 2JEOA 4B33A 1ANKA 1P75A 2J0SA 3ADDA 2GBLA 4KV9A 5EUQB 1E2MA 1VIAA 1X86B 4Q4LA 2WSMA 1NLFA 2Q21A 3U6BA 1NBMA 2WIBA 3BOSA 4F92B 5EE9A 1N6KA 1DADA 1E32A 1SQ5A 1JB1A 4GOXA 1KK0A 2AKYA 4DSOA 1XWIA 1T0HB 3L8YA 5BWMA 5JHHB 2IYSA 3TRFA 2VO1A 3U4QA 1E4YA 3SYKA 4AYXA 4DCUA 4Q4JA 1U81A 2P6RA 1C1YA 4WVFA 2ZE7A 2AFHE 3DVLA 2BKUA 2HUPA 4KBFA 5G41A 4ZCIA 1TF5A 4L15A 1E2FA 1ZINA 4KFRA 4OK5A 1QZXA 4KSCA 5KPJA 4G5QA 2ZYTX 2P65A 2REOA 2XJ9A 4QL3A 4D4MA 2QP3A 4EJSB 1KTVA 1ZUIA 1Z83A 4AK9A 2DFKB 3VX3A 4NYMR 3L0PA 1N6IA 2BDTA 3RS5A 4A2WA 2KB0A 4D26A 2IS6A 4BECA 5ELXA 4EPXA 1IJEA 3DKPA 4EPTA 3U60B 4BFZA 4D0NA 3N2IA 2IEZA 3OESA 1JECA 1GKYA 2VYFA 2ZR7A 2VF8A 1Q3TA 4L4UA 5EE3A 1WF3A 3SJZA 4DJTA 2JLXA 1KMHB 1SVIA 1U8YA 4QKQA 5FOVA 2LKDA 3QKRB 2PMKA 2QRNA 4L5BA 2W6JD 1A4RA 4CT4B 2IYUA 2GCOA 3ZH9B 4C0BA 2O0JA 3ADBA 1JAHA 2DWOA 1QG2A 4YMWA 1W49A 4Q21A 5DE3A 3DO6A 4W5HA 1YR6A 4FN5A 3TQFA 4I81A 4E03A 3B8HA 2I1QA 4A0GA 4Q4HA 2PEYA 2AR7A 2QEQA 2O8FB 1JXOA 3CM0A 3FB4A 4OYHA 3HU1A 3S1AB 3VR5A 3CF6R 3LDAA 2HXYA 2G1KA 4BLSA 3L0IB 1AIPA 1M1YE 1U8AA 1P5ZB 1RE0A 1SVKA 4HDQB 1RZ3A 1VECA 2GAOA 4AWXA 3ZQJA 2J7PD 2VBCA 1FOEB 1MO4A 2F3RA 1ZMXA 2IYXA 2WMOB 3PEUA 2ZS7A 4A6PA 5C2JB 2MMCA 5FL7D 1AZTA 5IF9A 1E1QA 3OAAA 1Q21A 2BBTA 2GVZC 1P62B 4ESHA 5HZHA 5J47A 3KQKA 2FDCA 4TMZA 3MLEA 4IEIA 4JLDA 3R8CA 4C2TA 4GL2A 3HPRA 4IXMA 2WWYA 5SZHB 3PJRA 2QMUA 2YWGA 1X8JA 1RVDA 1DVRA 2WVJA 1VIYA 3MGCA 1KI6A 2PZGA 1UKYA 2QAGC 4FWIB 4MGYR 2ZSFA 2Z43A 1NSFA 4KVGA 2PZEA 3PFIA 5KDLA 3WMFA 3AVWA 1KHTA 2XSZA 1E2NA 1FFHA 1RIFA 2HLDA 5JS8A 4UNNA 2F1IA 3CB4A 4ON9A 3GLIA 2O8EB 1HQCA 4A0FA 1KSGA 2P3SA 4HDCA 1OF1A 1KDPA 2QM7A 4TMKA 3FHOA 2ODEA 5JI3E 1ZYUA 3VFDA 2BMJA 4B74A 1E79D 1JNYA 4WZBE 4DIDA 2HF9A 2X19A 3IO5A 1GP2A 1PZNA 2WKPA 3E2IA 3LQQA 2MSEB 2OXRA 4ZIRB 3F3YA 1CS4C 3UXMA 1LFDB 3T34A 3SS8A 3K70B 4NKRA 1ZAKA 4JJZA 2HT1A 1QBKC 3REGA 5J4KA 1KO5A 1RW4A 3DKVA 1GVNB 3AVVA 1TQ4A 3A58B 1KO7A 1A2BA 4KI0A 4PHHA 1LB1B 4Q1BA 1XU4A 3THYB 2QMOA 3BH7A 2V3CC 3LBNA 2JGNA 2ZRKA 2QGNA 2A3RA 2UVQA 4R9UC 4V0ME 3GLGA 1EESA 1PVOA 4P4UA 5A5GA 2N46A 2Z4RA 1HY3A 2UZ3A 4NU0A 2OAP1 2VRWA 4JT2A 2EQBA 5G53C 3P20A 1UEIA 3K0CA 5SZIA 1DG3A 3FYHA 4U7DA 3CRMA 1S1MA 2WSSD 3AF1A 2AWOA 3RVBA 3VU9A 4B48A 2ZRHA 2CE2X 1VDZA 5FOSA 3F5FA 4MA4A 4PHTA 3PIRA 1KNQA 2OO7A 1UBEA 1UKEA 5EP2A 3IBGA 2KWIA 3EG5A 4XVUA 2J1LA 1I4LD 3U44A 1WCV1 4EFNA 3A1TA 2AKAB 3LBIA 3BS4A 1LV7A 5AJXA 4X8LA 5CK5A 5FI1B 2BEJA 2X77A 1P3JA 1XTKA 1G8HA 2ZSDA 2CLCX 521PA 1NKSA 3ZS9A 3JZAA 2VHJA 4A9AA 2ORIA 2H5EA 3B1XA 8OHMA 4AKHA 4Q9JA 5SZJA 4HZUA 2FF7A 3L0SA 5FPSA 3Q72A 4Q7KA 1ZNYA 1J8YF 4A1FA 5KUTA 2VTKA 1D6JA 2QTHA 4FINA 4C30A 2WOOA 4XH9B 1L4YA 3PUVA 4Q00A 2AN9A 3CO5A 4QJ4A 3MFYA 3T15A 4US0R 1G8GA 4IVRA 1WE2A 4LJYA 3R7WA 4LI0A 5FOTA 1W36C 1EFRA 1Z47A 1SVMA 3A37A 1A5TA 1DS6A 2YOHA 1DAMA 1DO0A 2Z6VA 3AF3A 4B34A 4XTCS 4QHTA 2FFBA 3KJHA 3V4FA 3VU9B 4IXNA 3TGPA 2ZSEA 4F7WA 1G7TA 2WJGA 2X2FA 5DIFA 2ZRLA 2VIIA 2GDJA 3AVXA 2TMKA 4FMDF 3LY5A 2CK3A 1ZCBA 5EXTA 5JEEA 5A0FA 3I8XA 5IRCD 4NYJQ 3W34A 1N25A 2A5JA 2D4HA 3GP8A 1HEIA 4V0KA 1MO6A 1ZNXA 3AVQA 1SVOA 2ZRFA 4OI1A 2G0NA 3PEYA 1N6RA 4PC3A 1HYQA 4FMBB 3OEED 4JLNA 4ESVA 2IS2A 2RB4A 5FBQB 1P2VA 4LHZA 4ZPXA 3TKLA 1YR9A 4TZ6A 5F2EA 2W2TA 3B85A 2FFQA 2IX3A 2FV8A 4TMVA 2O8BA 5H1YA 1P73A 1H65A 2C03A 4I1VA 2VSXA 1ZP6A 4HLUC 4J0QA 2WJVA 4PC1A 4HB0A 1JALA 4MRRA 3BFXA 3ADCA 1COWA 1T9HA 4QBGB 2J41A 2JIZA 5EZ6B 1VYUA 1G41A 1VCOA 3CR7A 4KO8A 4HAYA 4PC2A 2GF0A 2Q3MA 1OHHA 2ZYVX 2W58A 3RC8A 1KYIA 3QKTA 1EFCA 4DSNA 4BLOA 4MRPA 5G3ZA 4EFMA 2ODBA 4MGIR 3LBHA 1K5GA 3UG6A 3PR1A 4WXPA 3MWKA 2R6GA 5CJ2A 3T12A 1Z2AA 1GL9B 5FH9A 1E99A 3MD0A 3K9GA 4B73A 4Q1AA 4AKEA 2ECKA 3HR7A 3ZVMA 4AKIA 5FUXA 1AJEA 2N42A 2DFLA 1KNXA 3FHTA 2OCYC 2ZVPX 3CRW1 1D2NA 2BMDA 1HURA 1NMYA 4MUBA 4RD6A 4EIWA 3S1AA 4KBGA 4OHZA 3AP1A 5ANRB 1SGWA 1FUUA 3BFKA 1X1RA 4E5UA 4EPVA 1W48A 1MRNA 3KKNA 4D0LB 2PLFA 4Q4AA 2WHXA 1OJLA 2R6DA 3SR0A 5L3SA 1QHHA 2CMKA 3KFVA 2V55B 4ILEA 3ICQB 2D06A 1W5TA 1KI7A 1W0KD 3TQCA 4UXJA 3TVTA 1FP6A 1YZQA 5B57C 2ODNA 4HEJA 5AUOB 3D3QA 5DSZA 3TSWA 3GQBA 1U90A 3NC0C 4YDSA 3ECCA 3U3JA 2F7SA 2VP4A 3FMIA 1DG1G 3AM1A 2IA5A 2R8RA 2C96A 3TW8B 1W4RA 4LGMA 3R9XA 3V00A 2IUSA 2H17A 4PQFA 4UNRA 1BMFA 4RZ2A 5FBRB 4A6XA 3CZQA 4R71A 1Q0UA 2J0VA 2JDID 4S35A 4Q18A 4DLTA 3UIEA 2YNMA 3E70C 1A82A 3EZ2A 1I2DA 1M6NA 4KSBA 1J90A 1ZU5A 1U0JA 4D4JA 2J9RA 4EPWA 1KI4A 1WXQA 3CRQA 1DO2A 4HUQB 1ZJ6A 1T8TA 2HDNB 1GIAA 2PMDA 5KDDA 3U4QB 1NL3A 4PPQA 4A2QA 3BB1A 1TPZA 3PG5A 4R2IA 1WB9A 1D9XA 3IHWA 3FOZA 3SYNA 3BJIC 2WIAA 3BK7A 4NH0A 1XJQA 4BEBA 1QHNA 1XMJA 4IJMA 1HT2E 1P61B 2GESA 2H57A 4IDHA 1QHYA 2ZI4A 5EP4A 4LYAA 3VHXA 1Q1BA 1M7BA 1GDDA 4H1UA 3AF2A 1E1RD 5TB5A 5JCPA 2DY1A 1E1QD 1Q44A 2X1VA 3OAAD 1G7CA 1DELA 4DDWA 3CBQA 2AXPA 1L7VC 1H8EA 4MKGA 4JLPA 1CJUC 3U3MA 2ZI9A 3IDQA 3QF4A 3WRXC 4RD2A 4PPGA 1OXTA 2QU8A 3DMNA 5EE1A 3RRNA 5E3HA 4P3YA 1X3SA 2EFHB 1JPNA 5M04A 3EC1A 4DB2A 2H8KA 3C4JA 2VF7A 3EIHA 2ZU0C 4ASUA 3EIEA 1G16A 2WJIA 3K0FB 4Q5IA 4BLTA 2ZRMA 4XD7A 5CLLA 3QQ5A 1BMFD 1DE0A 1US8A 3IBYA 4OQFA 4F4IA 4AYTA 5KNCA 5FR1A 4C3ZA 3G82C 1CBUA 1RRCA 2O8CA 3VNVA 4A4DA 2XTZA 5TV2A 4LK2A 1NLZA 1XZQA 4LSGA 1NNEA 2ASEA 2ZRIA 3H2YA 1KDRA 621PA 2C2HA 4XSGA 3KQLA 4UKDA 1P2UA 2NG1A 1AS3A 4RD1A 2D2EA 1L8QA 4HDOB 3QBVA 3TIFA 5HZKA 2C5LA 3LA6A 2G83A 3GLHA 2V7QA 4XJXA 1E2PA 3CH5A 4PR0A 1GAJA 3VMFA 3NDBB 5AJVB 2BMEA 1UBGA 1TQDA 1S0UA 4KVAA 5IHPA 1JPJA 4II7A 2ZJYA 1AK2A 1XMSA 1E0JA 4MGKR 1T3LA 3DMDA 4KLZA 4UNPA 5C4GB 3WBJA 2W00A 4HB3A 2HCJB 1G3MA 1B0UA 3AP2A 3RNLA 1ESMA 2QGZA 2VL7A 2R9VA 1E1RA 2JA1A 4PHFA 5JI2E 4GI7A 4LJ7A 1KAOA 4M21A 1ZC3A 2JLVA 2QN6A 5K8LA 2CCGA 4OI4A 4CEJA 2CLSA 4DEXA 2DB3A 3QXXA 1CXZA 2ZR0A 5JHGB 1NSTA 4QHSA 1XXHB 2NO9A 4QNRA 4R98A 2R2AA 4R2HA 4LV6A 2WWGA 1C4OA 1SXJE 2AHOA 3RRYA 2IYYA 2J3EA 2QMHA 3DHWC 5TVKA 4DCNA 2QSZA 1V5WA 3KZ1E 2B8TA 1JJ7A 1PUIA 2C04A 4O25A 1J99A 1GUAA 2XAUA 2WZQA 2JLWA 1R4AA 4OJKA 4TT3D 3AV0B 4DIEA 1E9SA 2HYDA 2O52A 2KSQA 5FTNA 1NBME 3Q5EA 4Q1DA 5C1BA 4D25A 3SFZA 2R62A 3CUEF 1KSJA 3EC2A 2QRZA 3U3OA 4HUTA 4M2LA 3ASZA 4GOJA 5H8WA 1MR3F 3GJ3A 4ZO4A 1H8ED 1VTKA 4O2LA 5DN6D 2XOKD 4AURA 1M7HA 1AS2A 3GLFB 4P33A 1EXMA 4E09A 2GNOA 4ERNA 1W44A 4TL7A 1Q3HA 1ZW6A 3SFVA 1R0ZA 2OBNA 2RCNA 3KJGA 2WPDD 3CKLA 4FXPA 3CONA 3IEUA 2WJJA 2ZIAA 4S2EA 3T1VA 3AF0A 3PEWA 2BJVA 4BQSA 4X8OA 2FSIA 2W2VA 4QBIA 3GLIE 3U7GA 2ZUBA 1OHHD 3BGWA 2NO7A 3OEHD 2AK2A 1F5NA 1II8A 3KFXA 4JLJA 2P2LA 4BFYA 2XB2A 3FVQA 4UJ3A 1R5BA 3SU8A 2V8OA 2DYKA 3FTQA 2D74A 2J7PA 4B76A 1AS0A 3NDPA 1NVXQ 4JBXA 3BWDD 2O8CB 3T61A 4EJSA 1XF9A 2JJ1D 1W0JD 3QOFA 5DI9A 2HF8A 4D81A 5CB6A 1O87A 5J40A 2QPTA 1US8B 2GETA 2ZSAA 3A1VA 3FKSA 5JMTA 3A4NA 3MG9A 1G7SA 2GRJA 1LF0A 5G40A 4PPFA 2QBYB 4LX0A 2C8VA 4DCTA 1AKYA 3Q5DA 3W8RA 1KI3A 2WWHA 3NTUA 3C7KA 1GRRA 3QKUA 4QNMA 4LRWA 4LUCA 1E2KA 3WYAA 3A36A 4KYUA 3CR8A 2QMEA 4P4TA 5AJZA 4MRVA 3MUFA 1VCNA 3GEHA 4IOJA 1K5DA 1TQ2A 3QXSA 2GXAA 2E9SA 3LX5A 4MH0R 2G0TA 4E22A 1VHTA 3QEJA 4B71A 4TL9A 1Q1ZA 2QT0A 1IN5A 3KKMA 3K1JA 3EARA 2ANBA 4ZDWA 2O8DB 1JR3D 1E69A 4KFTA 1DTSA 1BYIA 1QG4A 1E98A 2CEAA 3GMTA 5FPHA 3FGNA 2GCNA 1SXJC 3CNOA 4URYR 5KTYA 4EPRA 1RJ9B 2OAQ1 1T3HA 3RS2A 1XCMA 3NBXX 4OKSA 2F1HA 1N6HA 4ABYA 4B75A 3LW7A 4HZUB 1N6NA 4QOSA 1ODFA 4A15A 2JJ2A 5CK4A 4BUJA 3B7GA 4A2PA 4O0MA 1LS6A 1XPUA 4KODA 4BFTA 3BBPA 1J2JA 3K0SA 5F3WB 1NMXA 2AD5A 4YMUA 1T0JB 1NY6A 2ERYA 2GJSA 4HZIA 2YJTD 1SKYB 3MWYW 4PAMA 3RAPR 2NO6A 2RHMA 5CIWA 5KHOC 1OIVA 1E2EA 2J0QA 5D3QA 4W5WA 4MYUA 2F43A 3CRRA 3K09A 2R65A 2A30A 4L9SA 4KAXA 3SDZA 1EFUA 2ZAMA 1W1WA 4URWR 5LB4A 1MOZA 1RPZA 4KFUA 1J7KA 1KO4A 2HXSA 4IFBA 4Q4AB 4QC2A 3VHLB 1E2JA 2ZE8A 3MJHA 5TMPA 3VX4A 2OCPA 4JJKA 3A4MA 3KJEA 2C95A 2J0UA 4A36A 1G3QA 1V43A 3O8CA 3AP3A 1U0LA 2LCFA 3PUYA 1KSHA 3NKVA 5JWOA 2GBLC 4LBYA 2F6RA 2ZJ8A 1G3RA 5HE9A 5FUWA 2GZHA 1DAGA 2GAAA 3IUYA 3CH4B 2G6BA 5LD2B 1OYYA 1GILA 1I2MA 2OLKA 1ZU4A 4V0NA 3TLXA 4IDQA 2ZQ5A 4TL6A 4TSFD 1P2TA 4HAXA 4Q01A 3GPLA 3W9YA 421PA 4BASA 2ZVQX 2I4IA 2O5VA 1KDTA 1AZSC 4PSAA 3VR2A 5BXQC 4CEJB 3EWSA 1Z06A 3EPJA 1ZD8A 3CX7A 1X8KA 4TYQA 1GM5A 1S1CA 3U6KA 3EPHA 5EXXA 1N5JA 1G7RA 1YZNA 4Z8YA 2A78A 1J8MF 1FQKA 2VA8A 1KMQA 3UMFA 1I4DD 1HA3A 1II9A 3B2EA 3QY0A 3C16C 2O8BB 1LY1A 1OH6A 1RFLA 1N2CE 2QENA 1UF9A 2NTYC 5CM9C 1G20E 2BCGY 2QNRA 4MYTA 2H92A 4FD2A 2IXEA 3K0EA 1NN1A 1FTNA 3PUXA 4JKIA 4LHWA 1SZPA 3KJIA 3HU3A 3RSLA 3U7EB 4LBVA 5EE0A 3SJAA 3GFPA 2FWRA 4GRAA 3K0CC 1Z28A 3RYTC 5JFGA 3IQWA 3TMKA 3DM9B 1IBRA 4LHVA 4NBSA 1LW7A 1XZPA 2PL3A 1E2HA 1CEEA 2CHQA 4EPYA 4RY2A 4CRWB 1G4UR 1G3IA 4PHGA 3GLHE 4C9BA 2IS4A 2GK7A 1XD8A 4HAVA 2X8AA 3HU2A 3T1OA 2BBWA 3UMRA 3LNCA 4GT1A 4LDJA 1Q20A 4FCWA 3WNDA 4MRSA 3PXGA 4BLPA 4DUGA 4JYBA 1R8QA 2HYIC 3K9NA 5GADl 1RKBA 3R7WB 1NG1A 1P9RA 4FW9A 1NN0A 2CL7X 3DL0A 4UNSA 2FZLA 1G19A 4FMCB 3RLFA 5FL3A 1DARA 2H18A 5B58C 1IN4A 1OH8A 5H70A 2AX4A 2X2EA 4TL8A 3MWLA 2XNDD 2RAPA 4C7OA 1U9IC 4F93B 1KAGA 3WHKA 5BN3A 5C18A 1VYTA 1XMVA 2VPPA 3FFAA 3D7MA 3I61A 1TUIA 2PBRA 4D80A 2EFEB 2OUKA 4M9SA 4AG5A 3T5GA 1P2SA 2QSYA 3A1WA 3P4XA 4HUQA 4IDOA 4IW3B 2WWWA 1TF2A 4WAUA 1FP7A 1Z22A 3L82B 3IHLA 4EJSC 3QVUA 1E4VA 3QI2A 4M1OA 1XTIA 4JSTA 2ZJBA 4V02A 4DLVA 1KY2A 4DVGA 3NWJA 2REXB 2C9CA 2DPXA 4Y0VA 3RS4A 4RD0A 4TMTA 3U61B 2WWXA 1X8LA 1CJMA 3DM5A 1KDOA 4JLVA 1E0SA 4HAWA 4PQRA 2JJ1A 3KDSE 4TQAA 1SXJB 3MRSA 3U3RA 5A4JA 4NYIQ 2BM1A 3THOA 2FU5C 2EWVA 2VH5R 1XEWY 4TT3A 2PX0A 4AKGA 5F9HA 1VPLA 2KJQA 3FPAA 4YONB 3U44B 3AVUA 1HQYE 3EXAA 5FTMA 5DI3B 1M2OB 1YRAA 4EQ6B 2WAXA 1NP6A 4Q4JB 4B6EA 1CU1A 4PSVA 1QHHB 2V6IA 2H16A 2VQSA 1U9IA 2QAJA 1OYWA 2G1JA 4OJQA 4E07A 1GKUB 3K09C 2B6HA 2VP0A 4LY6A 4PQYA 1U2RA 3NC1C 2ZAOA 4ZCLA 4LJAA 1YZTA 3B13B 1FNNA 1XMIA 3B60A 1WMSA 1XD2A 4DDTA 3QE0A 1TEVA 2JLSA 4PC7A 1KJWA 3KUCA 1T3SA 4M1KA 2V4ZA 3TAHA 4A92A 3FKSD 1UAAA 1JXMA 1N6LA 3ZD6A 2FFAA 1NF3A 2O0HA 2IWHA 3IO3A 2XZPA 1QHXA 5FFMA 4A82A 5KO2A 1JI0A 3FMPB 1Q22A 1G8PA 3PITA 5LBIA 2HLDD 2YWHA 2NO0A 2YV5A 1E9DA 2GKSA 2BKEA 1W2GA 2FGKA 3UWOA 1Y63A 4NCIA 2IF2A 4YQFA 3BH0A 3R8FA 4C0SA 4JL8A 1NRJB 5AR1A 4DCVA 3U2QA 3B78A 3UG7A 2CHVA 1IXSB 3AUXA 3FFBA 1VCIA 4KITB 4PO9A 1ZVQA 1UDXA 4GP6A 3B1VA 2BC9A 2FEOA 5JZVA 1IXZA 3OIWA 4KCGA 1KZGB 3LD9A 2OESA 5F98A 2OV2A 4C0LA 3K8YA 3E5HA 3Q7PA 4NMMA 2OFOA 4GPTA 4QRHA 1S96A 2YWFA 3TBKA 4IVPA 4JL6A 1YHNA 4HAUA 3IILA 1XEWX 3JVVA 5HKKA 1JR3A 3CNNA 2O8EA 3I32A 1NLYA 3WHLA 2GF9A 2OFWA 1TADA 1MABB 4JSYA 4TWZA 5EUMA 5C4MA 4NYIR 3ZIAA 4G1UC 5HPYB 4Z1MD 3EWAA 4CEIB 1Z8FA 3C41J 1EX6A 4NCHA 3I8SA 5E95A 2YYZA 3RHFA 4PO1A 3VTKA 1N6PA 4CVNA 4XWOA 3IIJA 3SEAA 2Q3FA 3TNFA 1RRGA 1SHKA 3WNCA 2P6UA 1FZQA 2GWHA 5AUNB 4EDHA 4F91B 1KKLA 4PO8A 4D4KA 3U7FB 4V0MA 2PH1A 1E3MA 4RZUA 1X1SA 5FPYA 1ZM3A 3OIVA 4LV5B 3SBDA 3UATA 3M0EA 4IRUB 1A7JA 4RKFA 3M6AA 1IAQA 4YDHB 1KI2A 3UMSA 5AUPB 3BAFA 2VP6A 4MKIA 1VCMA 3NXSA 1KK2A 2W83A 4NONA 4JL5A 1IQPA 5CYPA 2DR3A 3RABA 2FFHA 2ZM5A 3BD9A 4TTPA 1QRAA 1VHLA 2V9PA 4NCNA 4URVR 3TW4A 4M4SA 3EZ9A 4RZ3A 1Z0FA 2V54A 5UKDA 2KBEA 1YE8A 1MV5A 3GJ5A 4BEJA 3QF7A 2ZRPA 4ZDIA 1AM4D 2I3BA 1JR3E 4QJ3A 1T5IA 4HATA 1D2MA 1Z0KA 1Q1QA 1M34E 1AGPA 2P0EA 4PTLA 4A8JA 1P9WA 1YU9A 3K53A 3QPVA 1TAGA 3QKRA 4D82A 3LXRA 1X6VA 5JBQA 2RGGA 4GP7A 3DZDA 2XGJA 2E1RA 4GBMA 3C14C 1YZKA 2D3WA 4H9GA 1NN5A 3AGPA 3WP1B 3EPKA 1GKIA 1AA9A 1G5PA 2PT5A 5HE8A 3TAUA 4G3XA 2PZFA 1HUQA 3MCAA 2C99A 2GEUA 1Z07A 3AB3A 4YC7A 1OLOA 1E9BA 1PJRA 4M9XA 3IKJA 4LOAA 1K8RA 3CPJB 2ZE5A 4MQBA 3TJZA 4IOKA 5FBVB 1GZSA 1JQLB 4G0NA 4DLWA 5FI0B 5TDHA 2HCBA 1TMKA 3THWB 2JLRA 4HSEA 4DRZA 1E96A 4DDUA 2CDNA 3W3AA 4Q48A 4Z51A 4RKEA 5GJWC 1ZNWA 5KPDA 4Q47A 2CCKA 5JRJA 5GVRA 3W5IA 2XEXA 2HT6A 5AJWA 2RH5A 3B5JA 2ZRNA 2VLIA 2W6ID 3PEVA 2PEZA 1UBFA 2OBMA 3QPUA 3WXMA 1FX0A 2A7QA 3ETLA 2CVHA 4KLNA 3V9PA 4B35A 3B1ZA 1OH5A 1CKEA 2PJRA 1VMAA 1FMJA 1U99A 2B21A 2IF0A 2WPDA 3NG1A 2QL6A 3GFOA 1R0WA 1E2LA 2CBZA 2YZ2A 2QTFA 4MYCA 2NIPA 1YR8A 3OFND 4WZAE 1H8HD 2WBLC 3KXLA 4GZLA 1KSFX 3Q9LA 3O8BA 1WRBA 4LJ6A 1XJCA 3GLGE 1EK0A 2F9LA 2Z83A 2WTUA 2AL7A 2OILA 1GRNA 4NE2A 2BBSA 2IEYA 1OIXA 2ERXA 1R0XA 1GRQA 4XWKA 3OIUA 3NBZC 3CF0A 4CEIA 4QGFA 1DAIA 1OKKD 2E87A 4IVQA 2PT7A 4UXHA 2ZRGA 5D3MB 3REFA 3T06B 4AD8A 1XX6A 5B64A 5K8IA 4A0HA 4I4LA 1R8SA 1DAKA 3NHBA 4DB4A 2B7CA 3T1QA 1VKJA 1XXHA 2A2ZA 4JVLA 3O8RA 2RGNA 2OG2A 4JVMA 1II0A 4DSTA 3N70A 1AQUA 3B1WA 1VG0B 1S3GA 1NY5A 2IYZA 1W36B 1D5CA 2GEDA 3SJCA 4Q1FA 1ZM2A 3BIFA 3FMOB 2UKDA 4LCBA 1CR4A 3B1YA 3HR8A 5BQ5A 3SJBA 2BIFA 4PAOA 2ZI6A 2WV9A 3ADKA 3P27A 4M1YA 4Q19A 4YMSA 3RSOA 3W5JA 5IK2D 2B92A 1J70A 1E9EA 1FPMA 2GZAA 4XTRA 4HI0E 1KI9A 4Q9KA 4ASUD 3GLFE 3AVOA 2YC2C 4PZLA 3CLVA 5FOUA 4G5SA 5JCZA 3PUZA 2ZRAA 4V03A 4CZ2A 4D4LA 3WRYC 5L3QA 1L2TA 4HLQB 3BB3A 2IHBA 4BLRA 4JLKA 4WXRA 3GEEA 1W5SA 4DZZA 2VHUA 1YZLA 1S3SA 1ZUHA 4D0GA 5JECA 4DCSA 2ZJOA 4M53A 4Q03A 2EYUA 4OQNA 3SI7A 4MITA 1KI6B 2WJYA 4FI3C 1G291 2CK3D 4M1WA 1NBMD 4G01B 4Q7LA 3IPXA 3LO5A 4OBEA 1XD2B 2CE7A 4Q9IA 2W0MA 3WY9A 5B2ZA 3BXZA 3HYRA 2WOJA 1G8YA 4CT5A 3UWKA 1E9CA 1XBTA 1MT0A 1SVLA 4MUAA 4LV8B 3RC3A 2IUTA 3DPUA 1IOZA 4TYPA 1MKYA 4ITRC 3THXA 2ZI7A 1SKQA 3CX6A 4FCVA 2ZEJA 2QUZA 1EG7A 1IY2A 4EQ6A 2CHGA 2HJVA 3AEZA 4BRWA 4B3GA 2HJGA 4KYIB 1A1VA 2QE7A 3NH9A 3IIMA 3GCGA 4OHWA 4OL0A 1HE8B 3J81k 3KXIA 4YMVA 5TXGA 2QPOA 2QQ0A 3DDCA 1AKEA 3OEEA 1BS1A 3OE7A 4XVQA 4LWZA 1SXJA 2ZE6A 1OFIA 4P4SB 2O8FA 2FGJA 4JKYA 3P32A 5JEDA 3ZQ6A 4OQLA 1GNRA 5JWRA 5KOYA 1G3UA 4C0HA 2EVWX 4WA7A 3ASYA 1WA5A 1W4BA 4PFSA
chains in the Genus database with same CATH superfamily
3AY0A 4LGVA 4K9MA 5ENVA 4FB4A 2BBOA 3DP7A 2VYVD 3JTMA 1L5LA 2P0AA 4UXIA 2AEEA 2R7MA 4K88A 2F43B 3L5OA 1JHRA 1PQWA 3C3MA 1Z9BA 2PX2A 4M46A 4TSRA 4A8JB 4BRUA 3RIEA 1LZLA 1PWHA 3L7AA 1OXBB 1BRTA 1EBBA 1ZOIA 3IQXA 3LQRA 3W8NA 1A2KC 1UZAA 4TMXA 3N86A 2XJ4A 1QLHA 4QU5A 1BROA 1DOHA 4UBJA 5FEUA 4OXNA 4A10A 4BO7A 3WL4A 4ALLA 2AVNA 1B8NA 4YT5A 2JIOA 1EVIA 3CVOA 4GHWA 4OHCA 4U2EA 4CKWB 2JL1A 3THSA 1QHGA 1XD9A 3ZCSA 4EG4A 2I2WA 3R5TA 3SN6A 5ALZA 3BFPA 4X20B 3D02A 2ZPTX 3ROQA 2VDRB 3WA7A 4JGGA 3ZPXA 1XEXB 3R6DA 1S6YA 1AY0A 2FW9A 3P2EA 4BKPA 3PXCX 5TQ0A 3L05A 3HVRA 1NJ6A 1U1GA 2W4MA 5LQKA 5AJYA 3VNRA 3RS0A 5CFRA 3FRIA 5EI5A 2BSAA 1BDMA 1SCKA 2I1VB 2NZ8A 4G5OA 3W9UA 2QDXA 2XH8A 2L69A 2CLKB 2Y1CA 3JYQA 4H31A 5D2CA 4Z0NA 4Q37A 2I9PA 2BOVA 1AOXA 1JSCA 5C7YA 1LDYA 2PUWA 3MUEA 3O8DA 5LUBA 3U5ZB 2AK3A 2P4SA 1E2BA 1KZYC 2NW6A 4O4IB 5CLQA 3WB9A 3QVGA 3I34X 4GC5A 4O8CA 3KXDA 1DCTA 2PVCA 3I4CA 1FQJA 5EXEA 2FPKA 3SQLA 4O2RA 2GX6A 3ZCXA 2Q5HA 4TKLA 1WB4A 1GTG1 1JAYA 2EW8A 3JR3A 2WA1A 4RJLA 2PA0A 3Q0EA 5CW2A 1PUJA 1UQTA 1E0AA 1Y4AE 3ZZ0A 2BUAA 2YR0A 1XR3A 3BJZA 2XITA 4OLAA 1KGSA 1QDEA 2QLFA 2HDOA 1FFBA 4OLBA 2IYWA 3IP1A 1CFZA 1ENZA 5DN6A 1YL7A 1AQYA 3ESBA 3KALA 4RKYA 4E21A 1NHWA 3WHIA 4UHBA 1OW3B 2WSBA 5JLAA 3AHIA 1KGDA 1KPIA 1ZKMA 3NV7A 4FFVA 4WLOA 4YECA 4ZEOA 5L4SA 1NBWB 4GKKB 3HA3A 3V34A 4BNDA 3H4MA 1V9CA 1XKLA 2EJCA 3LVRE 4LJ8A 4PPNA 4WZBA 4YJHA 5G4KA 3EUEA 3BDIA 3UT5B 5IASA 4MWSA 4BKMA 5AIBA 2EJBA 1L7DA 4WT7A 1VJTA 1JEQB 3SXPA 4LK3A 3AX6A 4OKIA 1EK1A 2WZCA 3B6ZA 1GARA 2YH2A 2WMYA 3DD5A 3G89A 1Y3BE 4FKZA 4IIJB 3U09A 5T67A 3IGFA 1W2WB 1L5HB 5B58T 4D43A 3CG0A 5EZYF 1FMLA 2ZKLA 4HNQA 3F97A 3TBFA 2W2XA 1NF9A 3EIQA 2IHVA 3L7JA 4LVUA 2O5EA 2B5OA 3COSA 4HWPA 1OWMA 2GPWA 3M2PA 1CUJA 1E6LA 4R3NA 4I99A 2N1BA 1L7QA 4XVHA 4CV2A 3HUEA 4ZQIA 3AM3A 4N7BA 1GL3A 1MT3A 3SC2B 1NULA 1KEKA 4B31A 2BLLA 2OCKA 1LZKA 1EUCB 2PX6A 3HWSA 3JQ9C 4ZAZA 4UDNA 5TMBA 3S2FA 3A9SA 2RHLA 3IR7A 5CT9A 3IUMA 5CM8B 1XMQB 4RMGA 4BMSA 3WGJA 3OJ0A 5CLFA 5K8CA 4I1PA 4Y2RA 4B44A 2I33A 3MLAA 5IDVA 1TYCA 1E5LA 2I2FA 2W6CX 3WVNA 4OYRA 4MPDA 3THRA 1X7HA 2O59A 3JYHA 4LYFA 5KJ6A 3BMOB 4X44A 1CIPA 1QGYA 3ZD8A 4P5PA 3IRVA 3LDGA 3TQQA 4B6QA 2ZRBA 4YP9A 4YHBA 4HLCA 4QVKA 4KAAA 5A4AA 4DA9A 2EKBA 4JMPA 1EVKA 2M6KA 4X64B 2DUUA 1DXHA 3K9HA 2ZFUA 4Y18A 1SXQA 2P7HA 1G8FA 2AE2A 1NQAO 4BN0A 3KT8A 2YYYA 2B34A 3RK0A 1ENYA 1HDYA 3R77A 2G72A 3KTOA 2OL4A 4LJ5A 2IDKA 4OGWA 3RUHA 1ZZEA 2HWWA 3TMAA 2A14A 5I7RA 1IN7A 3KKQA 3QPWA 1D07A 1P2GA 2ATEA 4P38A 4C7JA 1RWXA 3ZDXB 3TVDA 4ZREA 2H1WA 1GWNA 2SECE 3WMGA 5AVWA 2VWGA 3BSWA 3L6OO 3TR0A 4WBNF 5IH7A 3MJFA 1RD4A 2L18A 3VTZA 1G1AA 4D9CA 5LUAA 1N0WA 4N5NA 1HE1C 2AEJA 1KEPA 3BA1A 3MTEA 1OT5A 2CLFB 4RA6B 2HJRA 1Q1EA 1M67A 2IP1A 3U17A 1ARZA 1JYFA 4KQ9A 1N1GA 1GEGA 2ZTMA 3CTMA 3M4JA 1QAMA 1W93A 2CNWD 1IM5A 3SX0A 1RZVA 3N2KB 4WZZA 3QJYA 1T0IA 4N4AA 4ZAXA 3ZNPA 2NPFA 4KE8A 3T4XA 4X7BA 1KP2A 1SY7A 3P0FA 4F60A 3H2IA 2O14A 2WHQA 3V1YA 3RANA 1T6NA 2EX4A 4LXUA 2JIRA 5DASA 5IK2A 5T41A 4BVKA 3A9TA 3VHRA 2VHQA 1RRVA 1O0SA 1UJNA 1DBVO 4YLGA 4A0SA 2OLEA 4H3SA 2DVMA 1DZ3A 5CCXA 1MQ9A 3DONA 4N8SA 1S8FA 3B6KA 4R1NA 4U02A 5C1DA 3EQ6A 4JGIA 3IEPA 1T9CA 1GPLA 1ZM7A 2R6AA 2NOAA 4KP7A 2XYVA 4IILA 4NJMB 4ETIA 5BSMA 1HH4A 2FA9A 3GUZA 3MWJA 1EFHA 3RV3A 1NONA 4QPCA 1EVJA 1H1LA 2OOKA 2ZYDA 3GMDA 2EW1A 1CW2B 3O8OB 5B4TA 5KYKA 2R1TB 1I4EB 4NDAA 2BFFB 5L3VA 4H60A 1PEYA 5AVJA 5GZ1A 3PWKA 1L8OA 2H7VA 1NX9A 5AI6A 3ZQKA 4MW5A 3NBFA 1NWCA 4WV3A 4XSHA 3KE9A 2RGXA 1OE0A 4LSMA 5E3IA 4EAQA 4HQ0A 4TLEA 2J45A 1GSIA 4B6FA 3MQ4A 4L08A 3PI7A 2QYTA 1DV2A 5E3JA 4QG7A 4ZI2A 1DT3A 1QMPA 2HJHA 2XSZD 1SM4A 5ECGC 3TQHA 3N5KA 1YU6A 4FMPA 4ZV9A 1M74A 5ALVA 1BDHA 4O4JF 3RC1A 1YZGA 2FWMX 4WWHA 3TR6A 2VP9A 1RQPA 2A0WA 2QP4A 4PV7A 4TXLA 3TD9A 1BYUA 3ROTA 3WWEA 1GLVA 2IYVA 3RVLA 2G09A 5EJ6A 4OQMA 1MHPA 2H1FA 3QHAA 4H35A 1NTRA 3IX7A 4F8YA 1I6KA 1VG1A 1WPXA 2JGIA 2Q6TA 1QQ5A 1M2HA 3DA8A 1N5RA 2AUTA 4YTEA 2HK8A 3LUFA 2FZWA 5GY7A 3CE9A 3ASVA 2RGAA 4LWQA 4NS1A 2J6CA 1GLGA 2RHOA 4MWZA 1UBUS 1SHJA 2MU1A 2Z8YM 5IYZB 1EX7A 4NF2A 4AJPA 3LXXA 3VH2A 4BRSA 1IHDA 5M34A 2QBYA 5SICE 1UC9A 3DAOA 1IIRA 3TM5A 1NJFA 4JJGA 2MTBA 2C98A 1SZDA 2Y1KA 5CB8A 2QROA 2UV8A 1TIBA 1XN4A 3K70C 4GMDA 1GAXA 4UBKA 1VA4A 2I55A 5BV1A 4FHDA 4U5QA 4QBHA 2G9QA 4TLBA 5HGJA 3RPEA 3CPHA 4J8PA 4EKDA 2ZIGA 3RBZA 1EK6A 4CUZA 3MMNA 4K7JA 4QFDA 4Y0AA 4R83A 1Q57A 4AY4A 1I7QB 4RK4A 3HM2A 2WKWA 4RFSB 5DBEX 1FDVA 2WUVA 5CCBA 2OZLA 1ONSA 4NJEA 1UT5A 2QYHA 2VSFA 2YDYA 2C82A 1K97A 3BL6A 3VV3A 4GXRA 3VU8A 1OJ7A 5BR1A 4LYJA 5IT5A 1MABA 5AKZA 1LNZA 3DL7A 4YJFA 3T7CA 4CCSA 4ZMSA 2ATXA 1L4UA 4KQHA 1JJIA 4DEYA 3ZDAA 1KE2A 3AVPA 3I72A 2C07A 3G9ZA 4U7PB 4CHGA 1C30B 4E08A 4U6SA 5TGDA 5DEOA 1WLYA 3NQ41 4E88A 2P9FA 2AB0A 2X6QA 2ZBRA 3EHDA 1OH7A 3MJRA 6LDHA 1KEZA 3WLIA 5IVPA 4HLDA 1NAIA 1H2AS 3CEMA 2A9OA 4X63A 3VO2A 2Y6UA 1VE7A 3VQTA 3VYWA 1X42A 2HPVA 4FK8A 4P31A 1Q0ZA 4RANA 2C7PA 4Q4HB 1DHTA 2JDIA 5EJMA 3ZWWA 3DUWA 4KN9S 1DKLA 1ZUNA 5GM2A 4CKBA 2LR0A 2A84A 5EIHA 1I9CA 3T4UA 1KAEA 1H6CA 2V7QD 3DZ8A 1ZJZA 3UV7A 4MV1A 2VSNA 4FDVA 2G1AA 4DANA 2QLLA 4CWAA 2CT8A 2IVFA 2W43A 4IKEA 3MHTA 2ZR9A 3BXOA 2OZEA 4O02B 2Y6VA 1RI1A 5AVVA 2O23A 2Q2OA 1K9VF 2VATA 5K8VA 4M9CA 1WZEA 2Q1WA 3T0IA 2IPXA 2X7XA 4JASB 2IDMA 2WYWA 4KVFA 2ID4A 2Q7XA 4WFKA 3JD3A 5AXAA 5K8TA 4RY9A 4JMLA 3WBFA 2NACA 1ORDA 1QONA 1A8QA 1ATIA 1MH1A 2IV2X 3OJXA 1RAEA 4JH0A 4LN1A 4LXIA 2W2KB 1KJZA 4RAOA 2WAYA 2C84A 4MULA 3V2IA 5AKGA 1VGRA 1CNEA 3ELWA 5EAIA 5KNCD 2AOWA 1J23A 2RKOA 3R5KA 5LM3A 3L84A 3ELUA 3RYHB 3AR9A 3LCJA 1RLMA 4DTIA 1FUEA 1AN0A 1Y7HA 2BGGA 3WLHA 2D7CA 4Q9HA 2WKRA 3FA2A 3GJ8A 4C89A 5KSZA 5FO0A 1JDUA 3LQFA 3ZLUA 3PQ3A 2IZZA 2LGJA 5CBPA 5F2OA 2NV0A 1XCJA 4Q3CA 2QE6A 4WFJA 1QFZA 5GZ3A 1K0UA 3DHVA 2HIMA 1YDEA 2VJAA 5E1OA 3ZWYA 5TY0A 5KOHB 1Z63A 2G9UA 4RF5A 3ROZA 4N5IX 2IS1A 5DMHA 5F7JA 4IIGA 3OZFA 1IN8A 1GHTA 1MFZA 4WDRA 3QF4B 1GGVA 2Y1OA 5KNBA 4GE0A 3Q0IA 2P5TB 1E3IA 1ZD1A 2HMAA 2ZT8A 4BNKA 2J4FA 3AUAA 1E2QA 3N0XA 3I73A 1CZUA 2IY8A 4PLZA 4BV3A 3PFGA 1GLNA 4CW7A 5AVQA 2QG9A 2B4QA 4X5OA 2WTMA 4TLLB 1FP2A 1JG2A 1E8NA 3BIJA 4IIJF 1RTKA 7REQB 2QTLA 5FV4A 4L0QA 3QVLA 1KMCA 3PHBE 4KPEC 2H1OA 4HQLA 2E4XA 3IIIA 3VR5H 1CF4A 4ND2A 1PFQA 2J9YB 2WINI 4LFAB 2IYNA 1EINA 4OCZA 5K0LA 4AMUA 4Q6BA 3OZBA 1O08A 2XHEA 1AV6A 2ZYUX 3EFOA 2FRDA 4KQ2A 1XTBA 2CLHB 2HK7A 3K3PA 3MNFA 2ZJZA 5DOVA 4A0QA 3Q3JB 4B5KA 4QUEA 4DA7A 5HJ7A 1XPOA 4Y0NA 1W34A 3VM6A 2ORWA 3TUZC 4JYCA 3W06A 5I6DA 2YIJA 2JLQA 4Z4QA 1XWWA 1GSAA 3LVQE 2C3OA 1KK1A 1RCUA 2WYIA 1TLFA 4G1BA 1EZ4A 3PDCA 9MHTA 1TNDA 5IWCA 5MF6A 5JT1A 4E5VA 2CBXA 2PVSA 3IMGA 1VRVA 4LZWA 2XB4A 3UXEA 3WGHA 1A9PA 4GM4A 3LHKA 3K8QA 2BUCA 5GONF 3T95A 1KQOA 1VGVA 3PTLA 2O8VA 2WABA 3DEJA 4JVSB 4E5SA 5EYPA 4ZCTA 1Z8NA 3H04A 3PKZA 3L4KA 4PCUA 4BAUA 4CM3A 5GZ6A 1Z6XA 3RQIA 5HWSA 3S8YA 1PL7A 4HL6A 4WOBA 3OETA 1KQPA 3QKSB 1G1MA 3RUPA 1AHHA 1BWPA 4Z2YA 3I5UA 1RT9A 4F86A 4D41A 2HGSA 1ZSYA 2PD6A 1L7XA 2BFDB 2DJIA 5KIAA 2O5CA 5IBCA 3RKRA 3ANMA 5HM6A 1QTRA 1K92A 3DNMA 2F1JA 2VSQA 4MK4A 4PHCA 4QHYA 4I1SA 3N7TA 5A2QA 2BRUA 1E7WA 3N8DA 5CPBA 2OHFA 4RTJA 2ANCA 3M6XA 4FCTA 2VK8A 2Z2ZA 2IZ1A 2JGJA 3N75A 4OVKA 5JAOA 4XWWA 4R9NA 5J4LA 1FBNA 4DSAA 3EG9A 4E31A 4NV1A 1ZH8A 3UAVA 4BU0A 3RFUA 3QUCA 4BGIA 1L6IA 1C7JA 4JT8A 1CRPA 5I9IA 1WCWA 4LQ4A 1UJ5A 2G1PA 5EC8A 4WNCA 1PDOA 1BG6A 3NVAA 5AW3A 2AJ8A 2RHDA 4WCVA 3I9LA 4F3CA 5LWQA 2JCSA 3NBQA 4N5LA 4DY4A 1U7PA 4YASA 5KQLA 2IKSA 2XXAB 3UPDA 1F3OA 1NBAA 5AI5A 2AW5A 2GHIA 1DCKA 3K9CA 2TMYA 2R6FA 4GQIA 4M0PA 4D1YA 2W2KA 1QUFA 2GXQA 4O2BF 4P2GA 1J2UA 2YMPA 1JJBA 1FJ2A 4X93A 4CJXA 3WBKA 3ROPA 2R0QC 2FX5A 2C9BA 3EXEB 4CIWA 4TQGA 4QBKA 4QA9A 4QWMA 4M0DA 3ZDQA 2IW3A 1UUFA 1H6DA 2Y0DA 3QXJA 2DFNA 1M6VA 1PYDA 5LJLA 1PV4A 1NJ1A 3AR8A 3PTZA 4CR8A 2QN1A 3GLFA 3DQQA 3E35A 3OIGA 2IL1A 1PG0A 1B3BA 1H2HA 3R0XA 3IJRA 1YRBA 1HNWB 4K3VA 4DC1A 4Y1GA 1QO0A 2QPAA 1JLLB 3OQ6A 4LXYA 4UHKA 2Q9AA 1CQIB 5K1ZA 4KH0A 4ACAA 1JHUA 2J87A 4EF6A 1GUFA 3RTGA 2IYQA 1RI5A 1TK2A 1RPNA 5JTTA 3CNHA 4X94A 4X54A 4RTQA 1KZHA 1EA5A 1LPNA 4KAJA 1H94A 3UK1A 2Q0XA 2YWEA 2FKAA 4URUR 1TEHA 2I7CA 1ZSNA 3EMVA 4QUKA 2IELA 1T3GA 2JFYA 2QGFA 1LSSA 4JBWA 4L3VA 1EVEA 3IVMA 3RVKA 1P5FA 4PW0A 2FRXA 3OKCA 1U9YA 1H8HA 1DPGA 4KXQA 1UJMA 1LK5A 3JQCA 1VKOA 3QXCA 2WFLB 3GJ0A 3ACCA 2FWIA 4RHTA 1P4JA 1GUBA 1J5PA 3SHOA 1JZTA 2OZLB 3AI1A 1J2EA 4NJEB 2PFSA 1CTQA 1BJRE 1GTSA 3PDUA 5CFLA 2A7XA 4MZXA 2V97A 1VYVA 2ZB7A 1KI1A 4ZHQF 3OKFA 1CCWA 3GJ4A 4CQMA 4RACA 5BUZA 3AHCA 3DXZA 2XBMA 4RD4A 5DFAA 3URKA 1JEOA 1ZM9A 4M22A 4HUJA 3VC3A 2NTNA 4B9EA 3FR7A 3PNPA 4CTMA 3FXAA 4JB3A 4BO5A 4D96A 2IEAA 4Y6QA 5DNWA 3SQXA 5ERGB 5H82A 1LQ2A 3T35A 5AOVA 4CCYA 1HDXA 2OWDA 1BOFA 3D0OA 1UADA 1M8FA 2AI3A 2O3UA 1ZD3A 4TYWA 4L76A 3KX2A 2JVIA 1LFAA 3GGGA 3HJNA 1Z25A 4OK3A 1MCZA 1P0IA 2BI7A 4UZSA 3U3KA 3MS7A 5D3MA 4EGQA 2CLIB 2P8SA 4PNZA 3D3EA 3KKPA 3LSYA 4JX9A 5FWYB 1N2EA 4RZXA 4E3WA 1VQ1A 1L7AA 4ARZB 1ZXLA 3PHLA 2O06A 4FIDA 4LJ9A 3VR2D 1NLUA 3OFNA 4J49A 4CEHA 3U9SA 5EMKA 2CXTA 4MO2A 5L7YA 5ER9A 1SBYA 1SZJG 2QIPA 1LXCA 3E1GA 3K0HA 4ZKDA 4LF5B 3AR3A 1DEHA 3HDQA 3ODGA 5A4IS 3E9CA 1K3TA 4DW8A 1W75A 3EAGA 3GQVA 2EU8A 3VKFA 2A5DA 5LQAA 1GCAA 2ZYAA 1NW4A 2O1WA 3AVYA 3ZYCA 4M9ZA 2GEFA 2WICA 3QWBA 2PQMA 5EA2A 1HOTA 3R9WA 4QECA 1MQAA 4AMBA 3PLRA 1P9LA 1SC4A 3ZDZB 1NMZA 3QENA 1CRQA 4A5OA 3OSUA 1WUKS 3ZGXA 4BFWA 1XEXA 3GZ4A 4B8ZA 2QUIA 3DEAA 3FYUA 5GJCA 3G8DA 4C0KA 4CV1A 3G2JA 3LUJA 4B0PA 1IJKA 3H1TA 3LK6A 5B3AA 2AFHB 5AOBA 2NZWA 4RL4A 1BH2A 1EVLA 4FEYA 3D8TA 3V8MA 4F9GA 2O2DA 3L7OA 1GZVA 1NW6A 5FBLB 4EW3A 4C14A 2BFFA 2R48A 2RHBA 5FUVA 3EGXA 1U63A 4M0LA 2Y71A 2B35A 3I92A 1BX3A 5J1SB 3NYIA 3VHXB 4IX9A 1Y6GA 2NMVA 2I6SA 3M5WA 1LKZA 4IYJA 3R3HA 5FLXA 3WIEA 3F5MA 2ZUCA 1YR7A 4ND3A 4XYMA 3ZWBA 4EG6A 5HUJA 2H51A 3EA0A 1Z0DA 3EPRA 2BGWA 1F0PA 3K6RA 4WBSA 1OAAA 1L4KA 2WHPA 4GLLA 1U11A 1M0EA 4B3RB 1VE3A 4B2IA 2HO4A 1X1EA 3KKKA 3EPPA 5L3SB 2X9VA 5L3RA 4XM0A 1YJQA 3I6ZA 2RHRA 1NASA 5JCXA 1U0GA 4Q1CA 4BNIA 1NVUQ 2BUBA 3D7LA 4MIEA 3WJAA 1YVRA 4FUTA 5B1DA 4XCXA 5T8KC 3SM9A 5KCMA 4G0OA 4XUCA 3UCFA 4P4SA 5C0OE 3RAJA 4H08A 2A92A 4G5RA 3OPVA 3D6AA 4K81B 3L8ZA 1KIFA 2V5VA 3KWLA 2YOGA 2WU0A 1PLKA 1Q12A 1DMRA 1DBIA 2RIPA 2M6SA 3HCAA 4FJ2A 3L4BA 1BU5A 3JQ9A 3NHLA 5GTDA 1NUUA 1MA0A 2HQBA 3KAPA 4J0KA 4Q39A 2A9JA 3K35A 1RXYA 2OBFA 2JAQA 3BRWD 3RC7A 2UDPA 4E30A 1HO3A 2VC2B 1KP3A 3DMFA 1KH3A 4Q9AA 3RSCA 1S2MA 4B6GA 4RIIA 5IAJA 2EWMA 1WTCA 2FNAA 1YC5A 2E6KA 3BGIA 3IAM6 3O2SB 1E2DA 2X8LA 2JFXA 2P9GA 3DF7A 3SBEA 4KFCA 3A4VA 1OFTA 2VYVA 2FEXA 4LA4A 1IMOA 5EUBA 4A26A 3JAMA 4GWLA 2L2QA 5IMSA 2RD2A 4ZYZA 3D8HA 1LX6A 3OTQA 2QMZA 1GGHA 1U8FO 4FGZA 5KU1A 3MELA 1ZR4A 4AJ2A 2G25A 1N5LA 1FSPA 1AB5A 3BL5A 3P26A 4NRDA 4KR9A 1U4OA 2GF2A 2NPIA 2VJYA 4N0DA 2GVDC 4DLNA 4PZYA 5TARA 1SKYE 2AUMA 2XYRA 4R0NA 2W5UA 2IXFA 3GCXA 4K40A 3KOWA 5FV7A 3I5YA 3SOZA 4H7IA 3KPVA 3I3SR 4FC6A 3FJOA 1FS5A 2J7KA 2DBYA 5IVHA 1SKAA 2CWWA 3EDYA 1YTUA 1VJGA 3RD5A 1XVLA 5SZKB 1PAUA 1NR5A 1NT2A 2CF5A 3NNSA 4RHYA 3LP8A 1KFEB 3CNEA 4B8WA 2Z0MA 3LZDA 4DIMA 3QG5A 1RHJA 2PGOA 3PEFA 3C1UA 5LP6C 1LD3A 4RJ2A 4TXNA 2DHEA 2GPBA 1T4CA 2CN1A 3S3TA 1UKZA 1YB1A 4JA0A 1LDMA 3TSZA 1EJ2A 1M8PA 4Z1OA 1MJ5A 1QGUA 2V7UA 3RSZA 4BNXA 1C3LA 5FWAA 3OMLA 1DV1A 1QKIA 3ZDDA 1NKTA 5DISB 3CN7A 1T3ZA 2CDAA 2P2CA 3KVRA 4KQCA 4OOFA 3EAFA 2CDRA 2ZCUA 5K3SA 2Y92A 1OIWA 4DCPA 5I9NA 1TRHA 2B99A 2MWMA 4JLOA 5I5EA 2BH9A 1AB6A 1B4DA 1UJ4A 1JKJA 3BXXA 2ATVA 4U8GA 1G5FA 2WWRA 4JJEA 4V2UA 2C9ZA 3QLTA 3T5CA 5J4VA 1N8TA 3HXOA 1L8LA 4XVCA 4P0TA 2I2AA 1QYVA 3HBMA 4DCMA 4PLTA 4XR9A 3I1IA 3OZGA 3U80A 1DWQA 1KE1A 3MSXA 1C8KA 3DNFA 2NZUG 3KXKA 4XIJA 1ZJJA 3LYAA 1ANKA 5U1PA 3UWSA 4QEKA 4YX9A 5JQGB 2VHEA 2G80A 4KV9A 8ATCA 3DMTC 3KSZO 4YRNA 5TLSA 1P0PA 3IR6A 5BOSA 1X86B 4Q4LA 2WSMA 1P81A 2EKDA 3CLUD 1NLFA 4IG4A 1IZYA 4KX5A 4OEHA 1T2UA 1NBMA 3G8AA 5B4UA 3BPSA 2F9FA 2Q3BA 4DMRA 5KOIA 1TAUA 2Z56A 4QUHA 5K0BA 3P0RA 2GRAA 1KK0A 1D09A 1QGZA 1JSXA 4EFKA 5BWMA 4NSNA 1QM5A 3BMNA 3D4LA 3ISVA 1E4YA 3D7KA 13PKA 1V9LA 3BE8A 4MW4A 1YASA 2L17A 1EAMA 3GCZA 1GNLA 3M89A 4WVFA 2AFHE 5K0GA 3Q41A 3DVLA 4J0FA 4UTOA 4AO8A 5M5BA 4L15A 4EKYA 3MBIA 1ZINA 4G4GA 4BXOA 3SC4A 3C4VA 3DBLB 4G5QA 3V7FA 1G20B 2FYTA 4NFYA 4YJ2A 2QP3A 3ILYA 4PS0A 4K05A 3C6YA 1ZUIA 4JI3B 1OC2A 1OZFA 1IDOA 3L6RA 3RTEA 4HNUA 5BR7A 3OX2A 4CIYA 3RS5A 3F1LA 4D26A 1HE5A 1H2ZA 1NPDA 2IS6A 3EDQA 1NSYA 4EPXA 4G8JA 1IJEA 4ZGBA 1Z2OX 1XXLA 1Z5GA 4IJWA 2ZLBA 1SEVA 4FR5A 4NENA 2IEZA 1JECA 1Z6PA 5BSEA 2ZR7A 2VF8A 1O8BA 1Q3TA 2ZRQA 4L4UA 3FMVA 3RIGA 3JU3A 3SJZA 4DJTA 2LD4A 1U8YA 3W5SA 3IQIX 3QKRB 3PYLA 2QRNA 4L5BA 4E2YA 1ZXXA 3M6WA 4RH0A 4M7PA 4L3OA 2VHWA 4CMIB 4EG3A 1V3TA 4HVTA 4WK4B 1JVSA 3ADBA 2F4VB 2DWOA 1QG2A 2NT4A 1W49A 1QV7A 3GRZA 2BEWB 5LLSA 1GGEA 1RADA 1CPYA 4MI3A 2FPGB 5IAAA 3RHZA 1B76A 1XRSB 4EF5A 4I81A 2I1QA 2IGTA 3S2IA 4Q4HA 4A0GA 2PEYA 4E5KA 4IMJB 2QEQA 4E5YA 1GR1A 2NWQA 3FB4A 4M37A 4ALKA 1H2XA 2GO7A 2YNMD 4P82A 3CF6R 4MVXA 3VR5A 1LSJA 2W2PA 2HXYA 4JT9A 2AG5A 3L0IB 4NK5A 1W36C 1SVKA 1RZ3A 2ZDHA 1A7UA 1Y1LA 1Z36A 2AN1A 1XZIA 2I3AA 2LIPA 4EGSA 3CA8A 3L4JA 3ONEA 1XA0A 4O1MA 4CTJA 3L1IA 3QH4A 2C8LA 2F3RA 2X7HA 3KQSA 2DQ4A 3P2MA 1WL8A 1MENA 1L5VA 1TJNA 1O6ZA 2IYXA 3P7MA 2ZUTA 4A23A 1MEEA 5FAKA 4CG1A 2D7JA 1QCCA 3ENKA 4GMGA 1Q21A 4MVJH 4V2IA 2GVZC 2GS9A 1LLFA 1GQSA 2JFUA 3AZPA 3CW8X 1G2OA 5HZHA 1M0TA 1C2YA 3PR2B 3KQKA 4MCHA 3EMBA 4IHJA 1N2GA 1T5DX 1U65A 1HMPA 2NVWA 1E5XA 3MLEA 4IEIA 3R8CA 4JELA 3STUA 3UMJA 3AILA 4JC0A 2ZT6A 5IUNC 1D4AA 4D3DA 4RTMA 1X8JA 4OSEA 4ZQEA 1RVDA 4FE3A 1DVRA 2VLBA 3MGCA 3PE4A 2PZGA 3QWIA 2D0IA 4FWIB 4OA5A 1B16A 3WMFA 2PZEA 1BXRB 1BVHA 2ZBEA 3PD1A 5F5NA 4B6JA 4HNAB 1E2NA 1FFHA 1H66A 2ZIZA 2HLHA 5ES3A 4F45A 2RH8A 3LF1A 1OI3A 1V6AA 2F1IA 3AFNA 2I34A 3IULA 4C76A 4TKMA 4AY6A 1KSGA 4YJGB 1XTZA 2EGHA 3CFYA 3S55A 1E3WB 3GDOA 1M8GA 1M2VB 2Y1FA 4REQA 3KJNA 1ZYUA 5ADVA 4FU0A 4WZBE 1PSWA 2Y05A 5A5FA 3H2GA 2VDWA 4JEUA 2CLMB 3L0ZA 3LQQA 4BMVA 5A4MS 5C4IA 5LZ2A 4EX6A 1YBFA 4DAOA 1CS4C 3UJ9A 1E4EA 3ICCA 4NZOA 2WYHA 1PWZA 2GB4A 5D85A 1ZAKA 1YB7A 4JJZA 4EKEA 1JFLA 1K0FA 4X9XA 4DJDC 2HT1A 5EIBD 3REGA 2OPHA 5J4KA 1KO5A 1XQ1A 2XXBA 4MQUA 5F2NA 2PKXA 2PXHA 4X7PA 2BP7B 2EGGA 5IHPA 2VOEA 4OQDA 2IU3A 4RVUA 4YCJA 3DBIA 1YOVB 2PBLA 1T4MA 3FJ1A 3MMXA 1KO7A 1VE9A 3D6VA 1FDOA 3DG9A 4WVLA 3PSAA 5IJ0B 4GZ3A 4KHPB 4KO1S 3AEXA 5LQCA 2I2BA 4Q1BA 1XU4A 2P9QA 1WM1A 4QGBA 4TV9F 2CGEA 2QMOA 3BH7A 4ZOQI 1XKQA 2YDXA 2IHNA 4UVHA 1B74A 1Y5RA 2AEFA 2JGNA 3O91A 2QTMA 2UVQA 4R9UC 4V0ME 4J9UE 3GLGA 2YXNA 1AURA 1PR5A 1U8XX 3R5XA 4B82A 3BHIA 4TWBA 1PVOA 2N46A 2R1TA 4R51A 1ENOA 1U8UA 4NU0A 1LSUA 2OAP1 1ZSVA 3CMCO 4R4JA 1P1FA 3AV3A 1C2TA 1TUGA 3P20A 4Y9DA 1MQ8B 5FL7A 1OZAA 1M6HA 3GH1A 3ORRA 1NBOA 3T3OA 4AWAA 1UOEA 3MAGA 2DGDA 4YMIA 2WSSD 5M3BA 1KXJA 1D5WA 3QKWA 1BNCA 3AERB 5CD9A 1F06A 1Y9DA 4NDNE 1HDOA 1GTRA 1QFJA 4G09A 4BQPA 4I55A 4W6QA 5JD5A 2BE7A 4YVFA 4R1LA 3WLSA 2I67A 4PHTA 2EHDA 1KZ4A 4X60A 1UBEA 1UKEA 1IHPA 3FCUB 1D6MA 3UC5A 4NS4A 1WXEA 1OXKB 4YAJA 3EG5A 1MW8X 1I4LD 1SCBA 2AVDA 2R1UA 3A1TA 4K03A 3R7BA 2FZGA 2VH1A 3JD4A 3NB0A 1F7UA 1ISGA 5ALXA 5TQJA 4R6XA 3UEOA 1ICEA 2NV6A 2H7XA 3BTVA 5CW1A 1P3JA 5YASA 3U1TA 2CLCX 521PA 1NKSA 1YRYE 5KYWA 3M9XA 5JDCA 2RDMA 1YONA 1KEEA 1ADJA 4A9AA 2ORIA 3B1XA 3OA0A 3HBJA 3SYRA 3H5VA 5SZJA 2Z04A 4HZUA 2FF7A 2FWNA 4DNOA 4ZVPA 3M70A 4Q7KA 2Z09A 2QMQA 2VTKA 3DDZX 1D6JA 2QTHA 4NPAA 4OFXA 1CQZA 5IDYA 1I7SB 1DNPA 1LBHA 2DLNA 1L4YA 1X7XA 1UBOS 2WFMA 1K27A 4FYVA 3SEQA 2QVZX 1LI7A 3GXOA 4AX4A 1IUKA 3LI2A 4GGOA 1DC6A 5LYJB 5TQVA 2XE8A 1L5MA 3CGWA 1XZKA 3UA4A 1A5TA 4BNWA 1ZI6A 3QIVA 2YOHA 4K9OA 4B34A 3W5BA 1A9QA 4W5OA 1XJ5A 2ZXEA 4QHTA 3QVTA 4JUIA 3V1TC 4M6WB 4YCDA 4ZO7A 5TPWB 3WAGA 3VU9B 1UMCB 2JPDA 4E3ZA 1CV2A 2ZRLA 1D0IA 2GDJA 1LPAB 2BDEA 4CDRA 4FMDF 3HUTA 4GR5A 2X0IA 4BVJA 4ARBA 2B4KA 4ECAA 5EXTA 3EWNA 3I8XA 3IQZA 5A0FA 3I2HA 3CZ4A 1N25A 4IS2A 4ITVA 1YS4A 1HEIA 2IFTA 4V0KA 1USVA 1ZNXA 2A6PA 2MIIA 2F00A 1HWYA 3JD0A 3MGBA 2DBZA 3CKYA 3TKAA 1KL7A 1J0DA 5H83A 1Z5NA 1SVOA 2JFZA 3NT5A 2G0NA 3PZBA 4OI1A 4M1ZA 4UOZA 3AXSA 2YZMA 3LIIA 4QFCA 1SD2A 3F9RA 4WACA 4Z6KA 1NU6A 3D0QA 4X90A 4ESVA 3ABRB 1ZL0A 1Z2EA 5KHLB 2OTCA 4HN9A 2J8ZA 4WADA 5CG1A 1H3EA 3R0ZA 3HDYA 4MVJF 1XLUA 2IX3A 2GCIA 2ETVA 2FV8A 2XV1A 2BHSA 3K0KA 1GQYA 3D59A 1P73A 1UXGA 2WJVA 2X4IA 1AMOA 2VDUE 4WKCA 1NNI1 1V4NA 1COWA 2P8JA 3GLTA 1VSTA 1A9OA 3RYCB 2RBEA 4C4AA 1VYUA 5KCZA 3CC8A 3RYHA 4HAYA 1VB3A 3ZCUA 4GSLA 3A4YA 2GF0A 2V9CA 1E7YA 2Q3MA 4A8TA 2RE8A 2ZYVX 4PONA 5I4BA 2KW5A 2QPLA 3HJAA 3ELBA 3ZWAA 1KYIA 3QKTA 1EFCA 1CZLA 1SBNE 4Y2JA 4BFLA 5AM2A 4MRPA 3DKKA 4EFMA 2ODBA 5CT5A 4MGIR 3LBHA 1IBMB 1VI5A 4FS8A 4ARCA 2GBIA 4WXPA 4FX2A 3WMRA 1P3DA 2AKEA 2G17A 2NXEA 1GO2A 3G59A 3LC2O 3OJOA 4JYMA 2X4GA 5FH9A 1ZH6A 3OLVA 1GRVA 3FPJA 3IEXA 4AKEA 4EJ0A 1I32A 2H0RA 2BFMA 3HR7A 4CLRA 1U80A 5H0IA 1AJEA 2N42A 3SMVA 5JH7B 1LVUA 1AKVA 2ZB2A 1BDIA 3S81A 1DIBA 4ZAVA 3U48A 1D2NA 5JY6A 2AFIA 1NMYA 2PZLA 3NX4A 5ALUA 2BJHA 1YQXA 2J67A 4JOCA 2REQB 3CISA 4B7CA 5BMVA 4FNMA 3UHFA 1EG2A 4O4IA 5BVHB 2ZGVA 1VPWA 2WLTA 1W48A 4YCSA 1YUNA 1JAXA 2FPGA 4L6IA 2CLEB 1C50A 1Z5UA 4RWZA 1T34A 1T8WA 4OXYA 1XRMA 1BVUA 3SR0A 5L3SA 1B8UA 2CMKA 2EAUA 3I6QA 1B43A 3F8SA 1U0TA 4PFJA 2BZSA 3HA7A 3RF6A 3TQCA 1FP6A 5A7FA 2AC2A 1XTTA 4OOEA 1HZJA 5DSZA 3LC0A 2XKKA 2A9PA 2V6BA 4IXTA 4OB7A 3A11A 3ECCA 4I36A 1YQ9A 1E1DA 1OA1A 1G8SA 2NXJA 2DXIA 1HDIA 3NHUA 1MDFA 1W4RA 4C3VA 4LGMA 4ZQCB 2CXQA 3LY8A 2NO5A 4K9LA 4PQFA 3G7NA 1IZ9A 2Y4NA 3AOEC 5CT4A 3KOUA 3K6SB 2PE5A 1QOQB 5DXFA 3MB5A 4HXFB 1NC3A 5HP4A 3HK2A 5BRJA 4RS4A 5EJ2A 2IH2A 1Q0UA 4KQFA 2O6HA 2WF5A 3AONB 4Q18A 5AJUA 3UMYA 4YK7A 8ABPA 3E70C 1D1PA 2B1QA 4BUCA 1QIHA 2MSWA 3KZVA 3Q40A 3HN2A 4Z86A 4KSBA 5HA5A 5AKEA 5I9SA 3WYNA 2AOTA 4WTOA 1TCVA 5GOTA 2XQJA 2XTJA 1EGMB 2P2YA