2W83A

Crystal structure of the arf6 gtpase in complex with a specific effector, jip4
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
161
structure length
161
Chain Sequence
MEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords ADP-RIBOSYLATION FACTOR 6
publication title The Structural Basis of Arf Effector Specificity: The Crystal Structure of Arf6 in a Complex with Jip4.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 161
sequence length 161
chains with identical sequence B, E
ec nomenclature
pdb deposition date 2009-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w83A00
1XWIA 2Q9CA 5KNCA 4RCYA 4CDGA 4IW3B 1E3MA 1US8B 3A37A 1UKEA 1W4CA 2F43A 2NOAA 2GCPA 2V7QD 1DBSA 3SR0A 3WBKA 2VHTA 3CZPA 4F92B 3VQTA 4BFSA 3QEJA 4PQFA 3T15A 3DO6A 5IHPA 4DUGA 2OO7A 1KI6A 1DO2A 1II9A 3ZVLA 521PA 4C2TA 2HDNB 3DDCA 4GBMA 1XMVA 3HYTA 1YZNA 2G1KA 4MGYR 1GITA 2J41A 2PBRA 1T5IA 3FGNA 2ZUCA 4DC9A 1MO3A 3UXMA 1GOTA 4M9ZA 1LFDB 3BB1A 4HUQA 1XP8A 3WNBA 4KODA 1E9SA 2WICA 1N5LA 2OE2A 1DAGA 1OJLA 4M9QA 1K6MA 4HAUA 4CYMA 1UEIA 4OYHA 4JT2A 4ON9A 1L8QA 5FUYA 2Q3HA 1T6NA 4V0KA 5FBWB 5GJCA 1KNXA 2FSIA 1ONBA 2D62A 4QBHA 3CLVA 3L43A 2YWEA 4RFVA 2IYUA 4MRRA 4ASUD 1YZGA 1U9IA 4OHZA 3B7GA 5JMTA 1DELA 1KOFA 4POAA 4DLUA 1E2KA 5IF9A 5IK2A 4TMKA 2WBLC 2MMGA 2VEDA 3BH6A 4OQXA 4TL7A 3L0IB 5EZ6B 3TUJC 2KI5A 1D2NA 3LXXA 3RRZA 2FPLA 1IN8A 3B2EA 4C0KA 1IN6A 4CEJA 1BIFA 3SBDA 2QT0A 1N6PA 2N46A 3OAAD 1OW3B 2QSZA 2ZJ8A 4AWXA 2FWRA 1ZM7A 2VF8A 4PQRA 2J0QA 1W1WA 1CULC 3HR7A 1KAGA 1YZQA 2C03A 4A8JA 3WHKA 2GXQA 1SVKA 2ZYTX 1E1QD 1NLZA 2CHGA 2ZVQX 4QL3A 5AJZA 4Q66C 1UKZA 2HF8A 2REXB 2GNOA 3B1VA 5JHHB 4DVGA 1M1YE 1FZQA 3HU1A 3AH8A 3QVUA 4PSAA 2ZYVX 3EZ9A 2B6HA 4JYCA 1JR3E 4JBWA 3RAPR 1DTSA 2Q3MA 5HCIA 3RS7A 3RSOA 3WRXC 3L0PA 1NLYA 2BMJA 4D4LA 3QSYA 2O0KA 3B85A 4LDJA 3O8RA 1KY3A 4FW9A 2Q21A 2VYFA 4BE7B 2J9RA 4B35A 4D0LB 3EWSA 2MSDB 3EZ6A 1XEWX 4B43A 4D26A 1FPMA 5BXQC 1B23P 2V55B 2ANCA 2ZRFA 1E0KA 3GLIE 1GILA 2V1XA 2ZU0C 3G82C 3BFVA 1ZNXA 2WZQA 1E2GA 3IPXA 4BLTA 1CU1A 1ZD8A 2UZIR 3I3SR 3TQFA 4P4SA 4XTCS 5AWFC 4KFSA 4PPNA 4Q9IA 1KK3A 3B8HA 1KMHB 3JZMA 4AD8A 1ZM9A 2GHIA 3W8RA 2D3WA 1Z08A 2ZROA 3DMDA 1TQ6A 1XB2A 4V0MA 2ZE8A 3FKQA 4F38A 1KDPA 1XNJA 4A82A 4TLEA 2XTMA 2XZPA 2WWGA 1RRPA 3K0AB 4MKFA 2J0UB 1IY0A 3QG5A 1JR3D 4TYNA 2GK6A 4Z8YA 1Z6XA 1E9AA 4M22A 4LJ8A 1HV8A 1E2QA 3OFND 4OQNA 2JJ1D 1WP9A 3TUIC 4W5HA 4URVR 3EC2A 1AA9A 1N6RA 3LH5A 1PLLA 1DAIA 2W58A 4RCZA 3ICQB 3A1WA 1OKKD 1XPOA 1VCOA 3THXA 2Z6VA 1E9CA 3B78A 3W3ZB 3SN6A 4R2HA 5EE0A 4DT1A 3NEJA 5JFGA 4B6EA 2P6NA 1NP6A 4F4CA 4OKSA 2WSMA 5CJPA 1S2MA 1Q22A 4IEIA 1YU9A 4PTLA 3I72A 1P73A 4LYFA 5E3HA 1M6NA 5H1YA 3GLFA 4P4TA 1XTJA 4L9SA 1ZIPA 2QY9A 4TT3D 1E2MA 3CKLA 4MGZR 5KU1A 4M9SA 3IIJA 1E99A 1H8EA 2BEKA 3CF2A 4OI4A 1E9EA 5FH9A 3K9GA 4XSHA 3A36A 5H8WA 1M34E 1J99A 4FIDA 5J4HA 2ZETA 1NLFA 2PL3A 4DCSA 2RGBA 1DARA 4Q1BA 5FPSA 4CF7A 4YDHB 4V03A 1NMYA 4EFMA 3GEIA 2VSOA 3A1SA 5AJWA 3CX8A 3OE7A 1N0VC 1RIFA 2VP0A 1WB9A 2C98A 3J81k 4M4SA 4GMXA 2C8VA 4F7WA 5CB6A 2QORA 2CLCX 2W2XA 4M1YA 3U5ZB 1YKSA 3EZFA 2H18A 3MAAC 4G5OA 2LWIA 2RKOA 2ODBA 2CK3A 2DFTA 3MJRA 4FMDB 2VSFA 2F3TA 2AKYA 1GNPA 4Q7JB 2FU5C 3U44B 4JLJA 4UNQA 2ATXA 4I4LA 4ZKEA 5KSOA 2J7PA 1ZAKA 3R9WA 2JASA 4UJ3A 4Z51A 3LO5A 1CJTC 5JWOA 4MRSA 1BS1A 2W6ID 2YINC 3CONA 3B13B 2XZLA 2ZS9A 5TV2A 1Q3HA 4LJ4A 2AR7A 2QL6A 3L0SA 3CNNA 3KB2A 5DNYB 1KZ7B 3B1WA 3RLFA 5B57C 1J2JA 2G3YA 1R6BX 1U2RA 4QG7A 1SXJA 2IYTA 3U6KA 2R44A 2FEOA 5JI2E 2QPAA 3ZIAD 5M04A 2CL0X 4NKRA 5L3VA 2FZLA 1FX0A 3W5IA 3EIQA 4JBYA 3UG7A 2R6AA 3E1SA 2WIBA 3FKSD 4Q4HA 4RFSB 3SHWA 3I61A 3IEVA 4HDOB 3QF4A 5JECA 1XEXB 2E1RA 2WKPA 5FL7D 4A15A 4Q00A 2IT1A 3KJIA 3THYA 5KDDA 3BAFA 1BOFA 1T3SA 3OEED 1D6JA 3IILA 5CM9C 3VU9B 4BGDA 5E7JA 5TY0A 1VYVA 4C3ZA 3QKRB 3I4LA 4DCVA 3FHCB 2EU8A 2OHFA 3NXSA 1DAEA 4V0OA 2ZXUA 4LJ6A 2HYDA 3O47A 2YNMA 1JB1A 1YQTA 2Z83A 1PZNA 4II7A 4DLSA 1K8RA 1OLOA 1NN5A 4HLUA 4QHYA 5JJKA 1NSFA 1DAKA 2JIZD 3TAUA 1AJEA 3IUYA 3GJ3A 1LVGA 1OFUX 1WQ1R 4RJLA 1G16A 1VG9B 3SEAA 5KPDA 1DPFA 1OXSC 5BYJA 2AK2A 1FMLA 3ZVRA 2IWHA 2FMXA 3E70C 2QM7A 4IJMA 1NVUQ 2ZM5A 5LBIA 1E9RA 1DAFA 1V5WA 1P2TA 2AXNA 2GZDA 3S1AA 2FGKA 5D3MB 2X19A 3SHFA 4HI0E 1E2PA 4B34A 2XXAB 2A2ZA 4EFLA 1XD2B 4A9AA 4EQ6B 4M1KA 1RFLA 2ORIA 3CRQA 1DE0A 1DVRA 1SXJE 2KB0A 2PT7A 3A58B 3ETLA 4TQUS 2EFEB 3X1YA 4IVPA 3U7EB 2H57A 4PC7A 4KCGA 2HT1A 4W7SA 1W5SA 1Z6YA 1ZUNB 1VYTA 1W2GA 3LBIA 5EP1A 2EFCB 1R2QA 3K1JA 4OI0A 1II8B 3NHAA 1AN0A 1HEIA 2CJWB 3KUCA 1Q1QA 2F1JA 2RHMA 5JWHA 1NN1A 4YXWA 3HPRA 3X1XA 2NIPA 4M1WA 3T34A 1W0KA 3OEHA 4JIMA 4ESVA 3CZQA 3R8CA 4PSVA 2GXUA 2ZI6A 2I3BA 4US0R 4MRPA 2DR3A 2PZEA 4C0LA 2IWRA 2CNWD 2W6JD 3B5JA 3M6AA 2ODNA 1GKIA 2IF0A 1G3RA 1TTTA 1S3SA 3AVQA 1T3HA 4FXPA 2QGNA 1ZIOA 4TTRA 3FE2A 3AP3A 2WJHA 3BJIC 2OAP1 1E79D 5TARA 1COWD 4N1AA 1SGWA 1HH4A 4KYUA 4Q9HA 2DCUA 3KXKA 3Q3JB 5AUPB 1KK1A 2ANBA 2PH1A 1IHUA 4XTRA 2Z0MA 4EAQA 4ERNA 4QBFA 3U61B 3AVYA 3MD0A 1HT1E 1ZCAA 3H84A 4EIWA 3U2QA 3P4YA 1XMJA 1TEVA 2BMDA 1UBEA 2GJ9A 4A6PA 4XJXA 4Q4JB 4EPXA 3RRMA 2GK7A 3QOFA 4ZCMA 4DLRA 1OH5A 3CIOA 2FNAA 4LV5B 4S2EA 4S35A 1XXHA 4LUCA 5BN3A 3T61A 1KGDA 2NPIA 1WBBA 1EGAA 3RRYA 1EFRD 1YZTA 1P2VA 1UF9A 3P26A 1AKEA 2CCJA 4MKGA 4CT5A 1WBDA 3MCAA 3W34A 4PHHA 4KV9A 4QBGB 2IYSA 4DBLC 2J3EA 4HLUC 4TTQA 3X1WA 3QKSB 4BLRA 2RHDA 3GLGA 1UM8A 4GL2A 4QFMA 3CUEF 4LBWA 3QXCA 1KI1A 4P3YA 4ZI3A 4OK6A 1AS2A 5DN6A 2EWVA 3O8DA 4I1VA 4NDZA 4WZAE 4G5SA 4DLWA 3VKHA 1VPLA 2BBOA 4DLZA 2HLDD 2OV2A 721PA 1P9WA 5CIWA 4P33A 2WWWA 4PSKA 2R65A 3AM1A 4Q19A 4M9XA 4GSYA 3I92A 2XSZD 2V54A 3CRMA 4XSGA 1N6IA 3WMFA 2ZIAA 4OBEA 4DJTA 2NO0A 2QBYA 4TLAA 3VR3A 1AS0A 2W2TA 1D5CA 3PEUA 5LPNA 5EUQB 1P6XA 4NONA 4WW0A 3ASYA 4TMZA 3SYKA 3KQKA 3U3KA 4NCKA 4UXJA 3RWMB 2GBLA 1CLUA 2EYQA 3SQWA 2WMOB 2QPTA 2RGDA 1XDBA 1G8HA 1QHXA 4LOAA 1OYWA 2IA5A 2CVHA 2V4ZA 1NL3A 3ZD7A 1E4VA 1GL9B 1XCGB 4TYWA 3K9NA 1FQJA 1S1CA 4F4IA 1G7SA 4PHGA 4M1OA 4NBSA 3BERA 3IIKA 5BYKA 4D0NA 1OH8A 3EPHA 3TK1A 2DHRA 2BHRA 1F5NA 1NNEA 1E2JA 1Q21A 3WHLA 1E94E 1NIJA 4BECA 3VNUA 2C9CA 2EYUA 1NMZA 4KFRA 2WTUA 1E2FA 2HXSA 4LC1A 4LYHA 1IBRA 4UNNA 3PUXA 1QHGA 2GZHA 4HAWA 2AXPA 3EA5A 1OIXA 4OL0A 1GRQA 4GMDA 4WOPA 4GNKA 4PAOA 3W9YA 4DEXA 4EPYA 1VHLA 5JSZA 4JVSB 2F9LA 2FEMA 4QXAA 3ECCA 2ZUDA 3PQCA 4FINA 1G3UA 4DIDA 1CJKC 1SVWA 4HATA 2C9OA 1SQ5A 2KBEA 3RS3A 4TMWA 4WIAA 3D3QA 1KKLA 3THWA 2GAAA 2OBLA 2GWHA 3GQBA 1QG4A 3KKPA 1EK0A 1YZLA 5CJ2A 2O8BA 4YMTA 3K70C 4D2IA 4CIDA 2HJGA 2P2LA 1EFHA 1EWRA 2QTVB 3IPYA 3VX4A 3A6PC 1TQ4A 2ZVPX 3GJ4A 1C9KA 4AYTA 5H68A 4JLVA 2R9VA 4CRWB 5LDDC 1N25A 1FW6A 3VX3A 3QIAA 4MRNA 3KZ1E 2R62A 1TNDA 2BM1A 3T1QA 1W49A 5KDLA 3QNUA 4PX9A 2BWJA 4PPQA 4LRWA 1RRGA 2OZEA 4CEHB 2MMCA 4QGGA 2O8CA 3UANA 5FPTA 3AV0B 4LHZA 2F43B 4XD7A 1XU4A 2JLSA 1YR6A 3FMFA 2ZJBA 4ZDWA 1TMKA 1IXRC 1IJFA 1KSFX 2J7KA 2G1JA 2QRNA 1M7GA 1UADA 2NGRA 3F3YA 1OHHA 4IXNA 3T12A 1KJYA 2ZANA 1Q3TA 2IW3A 4RD6A 1Z28A 2L0XA 1OH7A 5FBLB 1PUIA 2D2EA 3O8CA 2WJIA 4FCVA 2A30A 1KSGA 3VR1A 2WJVA 1Z6AA 3EPJA 3HYRA 3WYAA 4MDFA 4CGZA 2GBLC 3KXLA 3W3AA 4LV6A 3IGFA 3LW7A 4HLDA 2HYIC 3BORA 5KNDA 3R8FA 1OFHA 2XOKD 2B8TA 2IYWA 2EWWA 4U5XA 3QY0A 4IVQA 3ND8A 1JXOA 2X2EA 2BJWA 3AKDA 3LRPA 4JT4A 1GFIA 1UBGA 4I1UA 1XTKA 2VRWA 3AP2A 1GKYA 3W6NA 4C0AC 3K0SA 4TZ0A 1WF3A 2B7CA 2WAXA 4TQAA 3RANA 8OHMA 3IHLA 1XEWY 3OAAA 2AK3A 4QJ3A 2EFDB 2VBCA 4GP7A 3VKWA 5HKKD 5JS7A 2R6FA 1XPUA 3PUZA 2JJ2A 1IY2A 3C14C 3LBNA 3RC3A 2AD5A 3IBGA 4BFWA 1N0UA 3KUDA 4ARZA 2GAOA 5CB8A 2CLDX 2XNSA 2CE2X 4TLCA 3ZJYA 5DH9A 4AKEA 5AJVB 1CS4C 2QPOA 3LXRA 5GVRA 4B74A 5JCPA 3CX6A 2C77A 1R5BA 4PC2A 4A8JB 2ZRBA 4EFNA 2WIAA 2H1LA 1MRNA 3CWZA 2P0EA 3NG1A 4Q47A 3K0EA 3NBXX 1P60A 3TMKA 2OCAA 3JVUA 3K0CA 3TUZC 1NF3A 4D4KA 2FFAA 5JLJA 1XTIA 3ZVNA 2GESA 4NE2A 1JR6A 1DS6A 1W0JA 4BEBA 5GJBA 1ZU4A 1MO6A 2EFHB 2YC2C 4B2IA 1T0JB 5HZKA 3TR5A 1S0UA 2AKAB 4DDUA 4BPBA 2QQEA 2HF9A 4AIIA 2ODWA 2SHKA 4DKXA 2VL7A 3GEEA 4K46A 1SKYE 4ZIRB 1XTSA 4B3GA 1I2DA 2D7CA 3TKLA 2WSSD 2A5YB 2FJUA 3NC0C 3HP1A 5FTMA 1N6LA 2RGEA 4BWYA 4CEIB 4D4JA 1Z5ZA 4FMBB 1ANKA 1GDDA 1QHNA 2TMKA 5FPKA 2ZYUX 4G5QA 1GM5A 4KFTA 3U3RA 1ZRHA 4HZUB 2OBNA 4P4SB 2GVDC 3IQWA 1E6CA 3Q72A 4DCUA 3FFBA 4HDQB 3GJ0A 2DWPA 5DGXA 5SZIA 2I4IA 2QT1A 3AVWA 3C5HA 2ZRKA 3GLHE 5C4MA 1N0WA 2G83A 3KQNA 3KKMA 4A0FA 3UMFA 5E7IA 4YMWA 1TAGA 5F9HA 4BASA 4LK2A 4RD2A 1W2HA 1RJ9A 1NVWQ 3VAAA 2IHYA 3ZDQA 4F93B 3IBYA 4FWTA 3U3MA 1JECA 2E87A 4BLSA 5FBQB 1R8SA 1NY5A 4EPTA 3M4YA 3Q7PA 4JMPA 2ZYWX 4TTPA 1AQUA 4BZXA 2PZFA 4DLTA 3EZ7A 4KU4A 3HDTA 4MDEA 3KJHA 4QM6A 1BMFD 5LB2A 2BKUA 2JJ8A 4QGFA 2X77A 1YR7A 3IQXA 3W6OA 3THXB 3ZGXA 3PV0A 5BN5A 3UMSA 4URXR 4JLDA 1L7VC 4LBYA 1G19A 4UJ5A 3MLEA 2O8EA 1G8YA 1TQ2A 5JHGB 5J4LA 1G41A 5FOSA 2GKSA 4BLQA 3TSWA 4DCNA 3SFZA 2ZI3A 2XJ9A 4Z1MD 2NO7A 3PEWA 1S9DA 2VHCA 2HXYA 1LF0A 3MG9A 4A4DA 1BYIA 5EUMA 1KJWA 2ZE7A 2ZS7A 5HE9A 2BKEA 1SULA 1ZM4A 1KY2A 1ZP6A 4I81A 4NHOA 1MOZA 1E2DA 1X8JA 3SBEA 2XITA 4XH9B 4KO8A 4TQ9A 4B3DA 4I1OA 5HPYB 2XAUA 3BGWA 5FI0B 1VCNA 4D81A 4KITB 3A4NA 2GRJA 1VYUA 3BRWD 2WOJA 1VCMA 2Z4SA 2JAQA 3G0HA 3EXAA 2IUUA 1R0ZA 2IXGA 3LAWA 5TVKA 2ZI7A 3PITA 5LD2C 3B6EA 4LJYA 4IDNA 4Q7LA 4K8OA 3SJCA 3K0CC 2GEDA 4PHTA 5B64A 4LBZA 1P4SA 1RPZA 1AM4D 1G17A 1A7JA 3DKVA 4TZ6A 1ZU5A 2LKCA 5A0FA 4ACAA 1A1VA 3ASZA 3DM9B 2W6IA 5FTKA 2FFBA 4MGIR 3HWSA 3R20A 4DUGD 1P9NA 1YR9A 2QAGB 2YYZA 2OAQ1 5AR1A 1FP7A 2QRZA 5TDHA 3BWDD 4OK3A 2CCKA 1Z83A 4AY2A 1GL6A 1TU3A 3DOEA 2XX3A 2O5VA 1EG7A 4EJSB 4DSNA 1A82A 3NH9A 1CP2A 5L3QA 2EQBA 2DYKA 1NJFA 3KKNA 3C41J 4A0GA 1SXJB 2B7BA 2C5LA 1CTQA 4HYYA 4IRUB 1VIAA 4HEJA 2REBA 4LWZA 3AKCA 5FL7A 3KQHA 3VKGA 1DG3A 1T5LA 1D9XA 1FX0B 3AF3A 4KLNA 3D7MA 4PXAA 1S96A 2B21A 1AGRA 2QENA 4M1MA 4Q4HB 4QKQA 5JZVA 1P7CA 2IEZA 2OM2A 3TNFA 1IN4A 1ZVQA 2B8WA 3QE0A 1GKUB 3CBQA 2RB4A 3THYB 2QSYA 4NCHA 1FTSA 3BB3A 3FTQA 4G1UC 2ZRIA 4LV8B 1JJVA 2A5FA 3FFAA 3LLUA 4PR0A 1OXTA 4Q18A 5C1BA 3TW4A 1E2NA 4WAUA 5J4YA 5CIQA 4HZIA 1UEJA 5GJVC 3R7WB 1E9BA 2QI9C 1G5PA 3NTUA 2CLSA 1SHKA 2D2FA 1U94A 5KNBA 5IT5A 1JALA 4LHYA 5FTLA 2R2AA 3ICEA 4RKFA 4TSFA 3VMFA 2OT3B 4WA7A 1FL9A 2VTKA 5UKDA 1NG9A 4FD2A 1E0SA 3TSOA 4C2UA 1G20E 4MITA 4B2PA 4EPWA 3MRSA 1IY1A 3P27A 2J0VA 2R6GA 4DLYA 2QE7A 4V0ME 4NPHA 1AGPA 1JJ7A 4QHSA 1KSHA 1QHIA 1MV5A 4QGAA 1Z2CA 2X2FA 2C2HA 3QPWA 4IXMA 2O8DA 3ZZTA 1BYUA 4B33A 4ZO4A 3LVRE 4KSBA 1JXMA 5C2JB 1QZXA 3QXJA 1IM2A 4AC9A 1Q20A 3MWLA 4LHWA 3PXGA 3CNOA 4BFZA 2J59A 4U7DA 2IK8A 4R7ZA 4B6FA 2DBYA 4IDHA 3EPLA 4HAYA 2FH5B 2NPFA 1DEKA 1QHHB 1KKMA 3ZD6A 3GP8A 3QXHA 3TAHA 1S4QA 2WWHA 1WMSA 2WJYA 5FFMA 2Z4RA 5DYGA 3TH5A 1W4BA 1FNNA 1EESA 3ADCA 4Q7KA 2H5EA 1NN3A 2H8KA 2JDIA 3DZDA 3FMPB 2ZRLA 3GLFE 3U7GA 1IAQA 1F2TA 3H2YA 5GADl 1NKSA 4B47A 3QVVA 1CF4A 4QNMA 4TMVA 3PCRB 2GA8A 4X8MA 1Z63A 1C1YA 3VHLB 4KHZA 4FCTA 3T5DA 4J0QA 3UATA 2O8FA 4JSYA 5LB4A 1VIYA 1G6OA 4QJ5A 2FN4A 5TXGA 1JAHA 1E32A 1T8TA 2ZI5A 5A5GA 2NQ2C 2DPXA 4PPGA 4IFEA 2IX3A 1JQJC 4D0GA 3CH4B 1AS3A 2BVNA 2PT5A 3NBFA 1JNYA 2P6RA 1XCMA 3SYNA 3PVSA 3TR0A 5IDVA 3ZQ6A 4JLPA 1OE0A 1T0HB 1XEFA 1KYIA 2CMKA 1FUKA 4Q4AB 4Q9JA 4CZ2A 1WE2A 2W83A 2XNDD 2PCLA 4KVGA 4C9BA 2LKDA 4EKDA 5J4KA 1Q1EA 1NRJB 1EX6A 4US2R 4GOXA 1DAMA 1XFAA 4X8OA 5FOXA 4JL6A 1Q12A 3DVLA 3P32A 2PX3A 4YMUA 1U98A 3B1ZA 1Q1ZA 4PANA 2XZOA 3P4XA 3REFA 2ZEJA 1KO4A 1XXHB 4DIEA 5L3SA 3DPUA 2QP9X 4K81B 4MYUA 3EW9A 121PA 4BRUA 1ETUA 3K0FB 2GDJA 1R5OA 2GXAA 2ZRHA 1I4LD 2ZRGA 4O2LA 1H8ED 4A0HA 2KJQA 1IXSB 3AF0A 2OFXA 2PJZA 1S8FA 2QQ0A 1W7AA 2ORWA 2DFKB 4US1R 2CXXA 1VCIA 2GETA 2VP5A 2A5JA 4D25A 1TPZA 2R6CA 3N5CA 4LX0A 4MUBA 1E2IA 3RC8A 1K5GA 1AIPA 5DLQC 1P2UA 1C4OA 4LJ7A 1NG1A 1S3GA 4V0NA 4B32A 3OE7D 3X2SA 3ZH9B 3T1VA 1ZD1A 4EPRA 1B0UA 1GNQA 4KI0A 4RY2A 3DL0A 2GVZC 2QUZA 3B60A 5EE1A 1CRQA 4LY6A 1XD8A 3BIFA 1GSIA 1X1SA 2CK3D 2LCFA 4X8HA 2YKGA 1J90A 1KNQA 4LBVA 2QBYB 1SVMA 3IIMA 1NBMA 3CW2A 1ZUIA 3NKVA 2ZI4A 4CVNA 3MMPA 4HB3A 4TMXA 4QM7A 1LB1B 2PZGA 5JWRA 4TWZA 2OCBA 2J7PD 2JCSA 1UKVY 4WZBE 4FMCF 3BFXA 4RZXA 4LZZA 5CYPA 4E22A 2CEAA 3MJHA 3SNHA 2NTYC 3NDBB 3WRYC 4NU0A 4KSCA 1E2EA 2F7SA 4PO9A 6Q21A 3VHXA 4AG5A 4E5UA 2VA8A 1A2BA 2FFQA 2OLJA 3AVOA 4DZZA 3QG1A 1RRCA 1XF9A 4RD0A 5P21A 1SXJD 3AVVA 5EE5B 1XZPA 2VP9A 1DAHA 3AUXA 1XPRA 4WXRA 3C16C 2WPDD 1G8FA 4JJKA 4Z54A 1Q57A 2WJJA 3D6TB 3QXXA 2ZJ2A 1TUEA 3H0KA 1CR0A 5C46F 5C4GB 2ZJAA 3KXIA 5JJLA 3H86A 1KO5A 5EP2A 3W90A 5HZHA 4BEJA 1WDTA 3CRVA 4TL6A 3SZRA 1W36B 3P1JA 4MKIA 4DB2A 5F98A 1KI3A 1SKQA 4E07A 5K8LA 3WNCA 5E95A 1MO4A 3LLMA 2PLFA 2XEXA 4B76A 3DHWC 2ZRDA 4KBFA 3V9PA 4KFUA 2XTNA 1W47A 4EUNA 5FOTA 4A1FA 4QC2A 1IJEA 1RZ3A 4LJ5A 1F3OA 1VTKA 2F9MA 2J0SA 4PHFA 5G40A 2Q3FA 1FTNA 4LHXA 4IFBA 2Y8EA 3DM5A 3WP0A 4HB2A 2YOFA 3TE6A 2FDCA 3EC1A 1J70A 1WA5A 3FMIA 1LTQA 2C96A 4NP6A 1EFUA 4KAXA 5EQTA 3SS8A 4PFSA 2CE7A 2UKDA 2OG2A 3M0EA 1HY3A 3THWB 1A5TA 1Z07A 3AKYA 5D3MA 3RABA 1X8LA 3FYHA 1MO5A 1XJ0A 2WKRA 3IKJA 2GCOA 3SYLA 3ONWA 2O8BB 3CWQA 1AZSC 4BZPA 1HUQA 2W2VA 2ZSEA 1NIPA 1QBKC 2WM9B 2ZS8A 3UPUA 3EWAA 1FOEB 1ZW6A 3R9XA 2V6JA 2G6BA 1NVVQ 4YMVA 4BFXA 1II8A 4BQSA 2Q9BA 1H8HA 3U4QA 3REGA 3T06B 3CH5A 5CK5A 5EXSA 2PCJA 4ITRC 1D8TA 2VP2A 5J4VA 1ZCBA 1KDTA 1OV4A 4PC1A 2FE4A 2O8CB 4OQMA 3OIVA 4YXWD 3MWKA 1EFTA 1L4YA 3AEZA 4M0LA 2QMHA 4WZ6A 4PC3A 1L2TA 1G6HA 1D9ZA 4AYXA 1W0KD 3OEHD 2YOGA 4JL8A 1NVVR 1XXHE 2OEPA 3BC1A 1H65A 2WHXA 4P0TA 2BMEA 2EW1A 3JZAA 4MH0R 3Q5EA 1ZBDA 2D74A 2XB4A 2OBMA 1IN7A 1OPXA 2AL7A 4OK5A 1RKBA 4EDHA 3N2EA 4XOIA 5G53C 4N0DA 5FL3A 2OCPA 1F2UA 1UAAA 1IONA 3RS0A 2CVFA 1IOZA 3GLGE 2XB2A 5DIFA 2VSXA 1CJMA 2ZRAA 3GFPA 1UDWA 2QTHA 5FOVA 3RS4A 5JI3E 2IS2A 4QGHA 4DSTA 2FGJA 4NTZA 2PJRA 3LDAA 4URZR 1YHNA 1CRPA 4GZMA 1F6BA 1GAJA 1SKYB 4E09A 3U60B 2DWOA 3IDQA 1TEXA 2J87A 3RWOA 3UKDA 1G291 2FPKA 2D06A 2UVQA 1OT3A 5FPYA 2KWIA 4URWR 2QG6A 1N6OA 4U00A 3BD9A 3V4RA 2OSBA 1UKYA 1LF5A 1HURA 1Z0FA 3M1IA 2YHSA 1ZNZA 2ZRNA 4D4MA 1N5IA 1GG2A 1CKEA 1KK0A 4ZI2A 4A2PA 1KI9A 4IDQA 2IYZA 1AKYA 3LVQE 2F1IA 3GLHB 1KTVA 4JYBA 1QHSA 2FX3A 2ZRPA 3BB4A 5J40A 3SJAA 2OXRA 3TIFA 2G9NA 1OIWA 2VPPA 1KO1A 1HYQA 4AYWA 2ZQ5A 5AUQA 4IOJA 5KSPA 1X6VA 3EIHA 3GJXC 5JEDA 1X3SA 2GEVA 4HSEA 1MT0A 2ERXA 2DB3A 2V7QA 5FUWA 3VR4A 1GTVA 4JVLA 2I1QA 3NIBA 1JEDA 2ONKA 3CX7A 1X8KA 3SFVA 5DN6D 1NVXQ 3A1VA 4B71A 2GJAA 2HCBA 3QI2A 4JLMA 3T5GA 5E7MA 3L2OB 2XGJA 1X86B 4JKIA 1KI6B 3CRW1 2AHOA 5JBQA 1FQKA 2WSSA 2JLYA 2QTFA 4TN1A 2PMDA 1ZUHA 4M53A 4C7OA 4C4PA 3OF5A 4CW7A 1E2HA 3L8ZA 1OFTA 3OIYA 3DZ8A 2OLKA 5SZJA 1G18A 4A2WA 4HUQB 5J5CA 4KYIB 5KYKA 2AFHE 5JEEA 4A2QA 3GPLA 5AUOB 3LBHA 1CIPA 2AWOA 1SVLA 3KKQA 4JKYA 4ASUA 3NDPA 1LS1A 3LV8A 3OIWA 2ORVA 4DWJA 2JLUA 3TVTA 2GCNA 1Z0KA 1GL7A 2VP6A 4W9MC 3DOFA 2VP4A 4B3CA 3A4LA 4JLKA 2PX0A 4Q9LA 4AI6A 2YVUA 3B1YA 5DI3A 3WMEA 3PEYA 1RJ9B 4JZKA 1G3QA 2EVWX 3LFUA 1U0LA 1RVDA 4IDPA 3AKEA 4Q1CA 3TW8B 2W0SA 4DLVA 5AK0A 1N2CE 1ZC3A 2ZJ5A 5HR5A 4PZZA 4JSTA 2AWNA 4WXPA 4OJKA 1G7TA 1AQYA 2WKQA 4DDWA 2JLRA 2BBSA 2WWIA 2FV8A 3D8BA 3O8BA 1A2KC 3OZXA 4OI1A 2QMEA 2YWHA 4MGKR 1W44A 3WYGA 1RW4A 2AD1A 4CEJB 1ZINA 4BFTA 4BLPA 4HDCA 4OJQA 1E1QA 1M7BA 1P72A 1P2SA 1I2MA 4L16A 5EZ5A 2FF7A 3KQUA 1GUAA 1T9HA 3W8NA 1OFIA 2YZ2A 1A4RA 5FTJA 1SVSA 3L8YA 1CBUA 1NJGA 4KBGA 1ZM2A 1XJCA 1ZM3A 1HTWA 2IL1A 5KDOA 3AF4A 1VECA 2A5DA 5KUTA 4NCJA 1NY6A 3RYTC 3IO5A 1Z0DA 2BV3A 2WOOA 1QF9A 5F9FA 1U8YA 4C30A 3NHBA 2F3RA 1ZMXA 2ZAMA 5JCZA 2QN6A 4HLQB 4B44A 4NZYA 2JLWA 2NMVA 2BC9A 2A5GA 1U8ZA 1Q1BA 4X8LA 4GOKA 1NMXA 4AKIA 1S9HA 4BZQA 4OHVA 3R9IA 2ODEA 1P61B 4Q02A 2YV5A 2ECKA 3UK6A 2HT6A 3AB3A 4HB0A 2G88A 4NCIA 1EX7A 3KKOA 1M2OB 3LNCA 4CEHA 2BOVA 1ZNWA 1GP2A 4W5WA 3N70A 4TLDA 4DXAA 2PLRA 1OYYA 5FBVB 5DI9A 1KJZA 3CM0A 1X1RA 4LCBA 4PQYA 2F6RA 2O0HA 2VHJA 3VR2A 4ABYA 3N2IA 4ZDIA 4XD7D 5TB5A 4URUR 3EZ2A 3AVPA 3QJYA 3KDSE 3QBVA 4YC7A 2FSFA 5KHOC 3WNDA 5KSYA 2Z43A 3K53A 1OHHD 3DMNA 3SQXA 5HE8A 4BRWA 3KTAA 1JR3A 3I62A 3ADKA 1RRFA 2REOA 3OFNA 5JRJA 2JEOA 2JJ1A 2CHVA 1KDRA 1Z2AA 3NH6A 621PA 5J47A 4Q21A 1J8YF 2G77B 4PPFA 5AJYA 5H70A 4PO8A 5A4JA 2GF9A 1E1RD 5L3QB 4OHYA 2WWXA 2P5SA 3TBKA 3F0TA 1II0A 5TMPA 3OHMA 3BFKA 1OKKA 4MRVA 3VNVA 1E98A 1OXUA 3OIUA 3V00A 3WYFA 2FFHA 2OCYC 3RS5A 5BN4A 5KSZA 5KO2A 4WBSA 3F8TA 1NN0A 4FMDF 2IC5A 3GLIA 3HU3A 2ZRMA 5DSZA 3CR7A 4E03A 4DT1B 4L4UA 1P62B 2ZSAA 1AK2A 3AUYA 4NYIQ 4TT3A 2QP3A 3GEHA 2BJVA 2DFLA 5DISB 5ELXA 1TF7A 4YMSA 3T35A 4JVNA 4HLCA 4DEYA 3GLFB 1Z0IA 2DFNA 1Z47A 2E9SA 4FI3C 3WBJA 2JLZA 1DOAA 2ZTSA 4PZYA 3B9QA 3EASA 2IYRA 1KZGB 4G3XA 1MABA 3MWYW 4B3BA 3ND9A 4NL4H 2F55A 2JJ2D 5L8VA 2R8RA 2BM0A 3TVDA 4Q7MB 3CPJB 5GJWC 4DSOA 2IYVA 4NYJQ 3ZQJA 4DCTA 3KL4A 4NYIR 1MR3F 3QUSA 1TQDA 5G41A 1E2LA 4IOLA 1JEEA 1ESMA 2MSCB 1KI8A 2ASEA 3I8SA 2BBTA 1JQLB 1E69A 1US8A 4YONB 4JLBA 2NG1A 1YE8A 1XJQA 3T1OA 5JS8A 3FMOB 5FOWA 4TYPA 5CLLA 3UIEA 1W48A 5FUVA 2IF2A 1I4TD 1T91A 2O8DB 2HUPA 5B30A 4HUTA 1E4YA 1W0JD 4RKEA 5HTKA 3I1FA 4NYJR 2B92A 2C9YA 1UDXA 3CF0A 3P20A 4AKGA 1VG0B 5EXXA 3A4MA 2GF0A 3C5CA 2A3RA 4TMTA 4ZIRA 1E0AA 3B1XA 2OUKA 5EP4A 4JLAA 3KJEA 5CK4A 2IHBA 4CEIA 2W00A 3IHWA 4LPSA 2ZE5A 4GDFA 2P65A 4Q01A 4PAMA 3HR8A 3ZLJA 3ADDA 1U90A 3A8TA 3LW8A 3ZIAA 4Y0VA 2IS4A 1LNZA 1FFHA 1N6HA 4H1UA 4HZUA 3FKSA 5CYOA 5CITA 4QNRA 1SHZA 3B9PA 4RVCA 1RC8A 1KIMA 2ZREA 3QPUA 5HCNA 1EXMA 4ACBA 4KJZA 1F2TB 3GCGA 1F60A 3HJNA 1AZTA 1RYFA 1Z29A 1KI7A 2GTPA 3E5HA 3OEEA 3KQLA 4RSGA 3C15C 3RSLA 3QF4B 2IS6A 2BIFA 1QVAA 3GJ7A 4ZPXA 3Q8XB 3WXMA 4DHEA 2O8FB 2H92A 4A92A 1YRBA 3GJ6A 4FN5A 5K8UA 1Q44A 2CCGA 1N5JA 2ZITA 3H1TA 5FTNA 1HQCA 1Z22A 2YOHA 1FNMA 3TSZA 5IK2D 1VKJA 2XNDA 1M8PA 3PUWA 2JIZA 2C04A 4I99A 2KBFA 4D82A 1LY1A 2K5UA 3CRRA 4LHVA 4Q1DA 4UNPA 1O87A 1SVIA 2BBWA 4BLOA 5JRZA 3QXSA 3MGCA 3TRFA 3HPQA 4TLBA 2EFGA 3I8XA 2ZI9A 4LC0A 5KTYA 1U9IC 4IHQA 4ZCLA 1G64A 1SZPA 3QQ5A 5ANRB 1CR1A 1Z0JA 3EA0A 1F48A 3TJZA 4DDVA 2C78A 2AN9A 3UWOA 4C0SA 4UXHA 1V43A 4R98A 3SJBA 1XRJA 2HJVA 4Q1FA 4LSGA 2CL7X 5L3SB 2C99A 1KO8A 3PG5A 3S1AB 1CR2A 4CT4B 1E9DA 1ZYUA 4U02A 2G0TA 2Q9AA 4C0HA 2ZRJA 4PAQA 3UMRA 4RZUA 3JVVA 3K9LA 4YQFA 2HV8A 2BMFA 1R5NA 1D2MA 1HE8B 4RZ2A 4A8JC 1R4AA 3EPKA 2BEJA 4B3XA 4AG6A 821PA 1D2EA 3KFXA 3ZS9A 4YLGA 2QZ4A 1G21E 2OFOA 1FUUA 3SE0A 2ZPTX 3NBZC 1W36D 2GXSA 2VF7A 4JL5A 4KVAA 4XVRA 5EE9A 2PEYA 3FVQA 1T8UA 3F5FA 2CNWA 1G4AE 2W6JA 1HQYE 2VHQA 4R71A 4UKDA 4C0QC 1KMHA 4LYAA 4Q1AA 2FG5A 2QAGA 3DEFA 4LGMA 4Q4LA 1ESNA 2GJSA 3A1TA 3UWKA 1W5TA 1T4GA 1TX4B 5EXTA 3U7HB 4HAZA 2D7DA 1K5DA 2N1BA 4EJSA 1E79A 4JLNA 1COWA 2IYYA 3K0AA 2J0UA 1U0JA 1BKDR 1TUIA 1TU4A 2CDNA 3AF1A 1R0WA 3CPEA 3H4MA 3I32A 4HAVA 4NMMA 2WPDA 4TYYA 1YZKA 2IXFA 4N0EA 1W4RA 3PEVA 3RRNA 1DG1G 1Z6GA 4PC6A 2ONJA 1GVNB 3RS2A 1YZUA 3BBPA 3NVAA 2ZSFA 3AVXA 1XTRA 1Y63A 4WVFA 1YJ5A 4JS0A 2VLIA 1XMSA 3BH0A 1TF2A 4ZKDA 5C18A 3X1ZA 3LX5A 1EFRA 2WAYA 1CJVC 4F91B 1EFCA 1G8PA 4L15A 2XJ4A 221PA 4D6PA 4XWOA 3ZYCA 3K70B 5CM8B 4ZCIA 2Q6TA 1E9FA 3R7WA 1GIAA 3L0OA 1ZJ6A 2G0NA 1XX6A 2YWGA 3WY9A 3LQQA 4LJ9A 3AQ4A 2RAPA 3FPAA 1VDZA 2ZAOA 3MSXA 2NO6A 4H1VA 5FOUA 2V1UA 2IXEA 2P3SA 1Z06A 2AX4A 2ZR0A 2HEIA 4IKEA 3V4FA 3LA6A 4DDTA 3GLGB 1GRRA 4P31A 5DO9A 1N6KA 2F1RA 2HLDA 1UBFA 2Z5FA 1O3YA 1RYHA 2A9KA 3CPHA 4TSFD 3CR8A 2VH5R 3LWNA 4MQBA 1TF5A 4KLZA 2OFWA 3RNLA 4AURA 2I1VB 1QDEA 4ILEA 3E2IA 5KOYA 2V3CC 4C0JA 2IBMA 2XSZA 3NEYA 3TLXA 3GMTA 3T1TA 3LD9A 1VMAA 4NYMQ 2GCOB 2J45A 2QE7D 4NH0A 2PMKA 1MKYA 3U44A 2JLVA 1SVOA 1M7HA 2FPMA 1U8AA 2KE5A 3CF6R 3AGQA 1TADA 1N5KA 1S1MA 4GI7A 4GP6A 3UG6A 1QHHA 1VG1A 1J8MF 3U4QB 4AKHA 1KHTA 1PLJA 4ZV4A 2RGXA 1KK2A 1HA3A 4BFVA 2V9PA 1WCV1 3I73A 4A6XA 3MFYA 3FDIA 4NYMR 1JBKA 2BDTA 3C7KA 1G7CA 1WRBA 1XMIA 2QP4A 2RGNA 2Q0HA 3THOA 4RFSA 2O52A 1E0JA 2PEZA 1BH2A 3K09A 2D4HA 3NWJA 2JGNA 1KDOA 3VR6A 1XEXA 2QAGC 2JDID 3EG5A 3Q7QA 2CL6X 1GZSA 1U81A 2WWYA 4IOKA 2RMKA 5DE3A 1MRSA 1OXVA 3PUVA 1G1MA 3VU9A 4EJSC 4A0RA 1MH1A 1I4DD 2VHUA 4C0BA 3QKRA 1F2UB 2WVJA 1UBCA 3QKUA 2CBZA 2DWQA 1Z6TA 2JLQA 2ZUBA 1Y3AA 1IQPA 4EPVA 1BO6A 4GRAA 1SXJC 3PFIA 2JLXA 1VHTA 2BCGY 3ZZ0A 1Z3IX 4R2IA 4Q4AA 2GJKA 1PUJA 4IVRA 3W5JA 3CNLA 2ZSBA 4LYJA 4G01B 4G5GA 5JSZB 4QHTA 3Q9LA 4OHWA 1Q0UA 2R6DA 4ZDKA 3NC1C 4MYTA 4Q03A 1PV4A 4IDOA 1HT2E 4W5JA 4M1SA 4R9UC 4HAXA 1KI2A 2FSHA 2NZJA 3AVUA 4RD1A 1NBME 4QOSA 4G5RA 1PJRA 3ZS8A 4BUJA 3K0FA 3FOZA 2XXAA 4EQ6A 1XD2A 1M74A 2ZSDA 2GZAA 3EAQA 1JAIA 2O0JA 4UNRA 2N42A 3HU2A 1P75A 5EJEA 3VFDA 2JATA 2XTZA 4MUAA 4JVMA 1PVOA 2W0MA 3KX2A 4XVQA 2CJWA 2X8AA 3VR5A 2VQSA 2GJ8A 3QEOA 4JJZA 2ZR7A 3BK7A 4FWIB 3NBYC 1U99A 4DRZA 4DSUA 3FHTA 2QU8A 4IEEA 2YC4C 5K8TA 4OQFA 3IEUA 1J7KA 3PIRA 4Q9KA 4XVUA 2V8OA 3SJZA 3WP1B 4B73A 3GJ5A 3AF2A 5D3QA 3SU8A 3MWJA 1P9RA 4B2LA 1ZC4A 4HB4A 4Y0AA 1P5ZB 1G4UR 5BWMA 1P3JA 5FI1B 1T3LA 3U3OA 4M2LA 2ERYA 5B58C 4C7OB 2NZ8A 5FBRB 4ZDJA 1L4UA 4RD4A 1NBMD 4V02A 2QEQA 1G3IA 4UQOA 1IXZA 5CLQA 1Z0AA 1OF1A 4TL9A 1UFQA 4O2RA 2XOKA 4M1TA 1HE1C 2ZU6A 2MSEB 3EX7C 1LS6A 1ELOA 3PUYA 3FWYA 2RGCA 1ODFA 4P32A 4Q5IA 4QRHA 3I5XA 3C4JA 2OILA 3QPVA 5EE3A 1XCPA 4MKHA 1QG2A 4PO1A 4QJ4A 4O0MA 5DHFA 3G5UA 4RD3A 2FOLA 2WV9A 1R7RA 1QVRA 2WMNB 3Q85A 5DYIA 5AUNB 5JJIA 4GT1A 2RGNC 1KSJA 1XZQA 1GWNA 4O25A 4Z8XA 2ATVA 4Q4JA 2WJGA 2V6IA 3EIEA 3K09C 2H7VA 3LY5A 4ESHA 1OXXK 4QBIA 1XTQA 2IUSA 4D80A 2A7QA 2FA9A 5DI3B 1JPJA 1G3MA 5HKKA 4XIGS 1OSNA 3WMGA 3LX8A 4F4JA 5IRCD 3AVTA 5SZKB 4GPTA 2H16A 2QNRA 5EP3A 2QGZA 421PA 3TQCA 3U7FB 3U3JA 1LW7A 3Q5DA 1W4AA 3PENA 2ZR9A 3BOSA 2GILA 3QENA 4PZLA 4FCWA 3GFTA 3SOPA 3K70D 2OXCA 2A78A 1N3BA 4DLXA 2BCJQ 3LQRA 3RHFA 2QA5A 3K8YA 4KXFB 5FR1A 4ARZB 4BFUA 2NO1A 3FHOA 4OQLA 3QKSA 5CDFA 4MYCA 1KAOA 4XWKA 1DADA 3IO3A 5AJXA 4FMCB 4GFDA 5FUXA 1WXQA 2P6UA 3DKPA 4A36A 5FPHA 1GNRA 2H17A 2WWFA 5LD2B 3AP1A 1OIVA 3SDZA 5FR2A 1XBTA 4UNSA 4TYQA 3KB1A 1JPNA 2P67A 2F1HA 4JBXA 1JI0A 1QRAA 4AK9A 2HCJB 3AGPA 3GFOA 4Q48A 2FZ4A 5GVSA 1NI3A 1PLKA 2ZRCA 3OESA 3PR1A 3BS4A 4OHXA 5BW8A 1ZNYA 2P5TB 4XWAA 1KO7A 1NSTA 4UXIA 4B3FX 4OI2A 1CJUC 2IYLD 4BFYA 1G5RA 2DY1A 1RE0A 3D31A 3EARA 4URYR 3SI7A 3U6BA 1OH6A 2KSQA 4GOJA 4LI0A 5B2ZA 1R10A 3CB4A 2IYQA 4YDSA 1N6NA 2QM8A 2JA1A 5F3WB 4RZ3A 3BXZA 1KMQA 1H8HD 1Z8FA 3GD7A 4NCNA 2X1VA 3GJ8A 3KJGA 1LV7A 3W6PA 1UPTA 4DB4A 1YRAA 1UJ2A 2YJTD 4JLOA 3ZZUA 4V0LA 2RH5A 2IUTA 3C8UA 3QF7A 3CO5A 5BQ5A 2AFIE 2IEYA 3ADBA 4P4UA 3ZVMA 1G5TA 5KPJA 3TGPA 2YWFA 2NO9A 1CXZA 4LPKA 1G8GA 4B48A 4TL8A 1U0HC 3L82B 3VTKA 1E1RA 1W46A 2CHQA 3KTAB 2QMUA 4LJAA 5E4FA 2IYXA 5CDFE 2ZJZA 4L9WA 3SC3A 1BMFA 1R0YA 2UZ3A 1R8QA 4M8NE 4IOMA 4N3NA 2QAJA 3X1DA 1GRNA 1ZD9A 2FSGA 1FP6A 1CR4A 1XD9A 2ZE6A 3RDPA 2J46A 3QKTA 5SZHB 1R0XA 5K8IA 1NKTA 5DHAA 1EWQA 2J1LA 1IN5A 3FB4A 3BH7A 1OB5A 3K9HA 5G3YA 1YVDA 4M21A 3MUFA 3GLIB 2ZJYA 2J5XA 4MA4A 5G3ZA 4Z1MA 4O3MA 1KI4A 4H9GA 2RCNA 2QMOA 4L8GA 3B82A 2RGGA 2O8EB 2OESA 2QROA 1W36C 1DO0A 1VG8A 5EXPA 4G0NA 3RVBA 3GLHA 1TL7C 2VO1A 3QBTA 2RGAA 4I1SA 3I5YA 4Q1EA 2IS1A 1G7RA 1E96A 1QHYA 2GEUA 1MABB 1OB2A 3PJRA 1CEEA 5F2EA 2C95A 3A1UA 1G9XA 4L5BA 2VIIA 2ZJOA 5L3RA 1YR8A 3KFVA 4MYHA 4B75A 3BE4A 4GZLA 1FMJA
chains in the Genus database with same CATH superfamily
1E3SA 1A9TA 1SUFA 1XWIA 3G0GA 5KNCA 2EGGA 4RCYA 1UEXC 1V47A 4CDGA 4EX7A 4IW3B 5EJ4A 3BEDA 3W7VA 3ZHUA 1US8B 4LKOA 5A03A 3QEAZ 1D4ZA 1MC8A 4AT1A 1GAWA 2V7QD 2I4LA 3UHAA 1B6SA 3VR4D 3R1IA 2QZPA 3QEJA 8ADHA 1E1KA 4TX1A 3EXEA 4DUGA 2NUTA 1Z4NA 4BQPA 1A9RA 1YCHA 1XUOA 5TT1A 1SXPA 2OV8A 3URMA 521PA 4C2TA 2WIDA 4GBMA 3IVMA 1YZNA 2KHZA 4MGYR 2J41A 4F3KA 2IODA 1T5IA 2ZUCA 4DC9A 4Y6RA 2MWMA 1Y9JA 1Q74A 1GOTA 5ARCA 1LFDB 5TMBA 4BN0A 4DBZA 4EHBA 4DJJA 1O5IA 1Y8RB 3AHFA 3RIYA 4HRAA 4I4TA 2XADA 3GGCA 3UQZA 3I30X 3UN1A 3WNVA 4CYMA 1E62A 3GWZA 3K5HA 4OXNA 3U0BA 4JT2A 4XM1A 3UGTA 3HKEA 1T6NA 2VUIB 3DDNA 5BSRA 2EP5A 3FCUB 2QYSA 4X93A 4XUDA 5CX1B 5ITSA 3ESZA 2HAEA 2FSIA 2D62A 3WQQA 3FUCA 3QV1A 4FNMA 1WO8A 3CLVA 3L43A 4YV1A 5KWEA 3AJRA 4GYKA 1G21B 4K5QA 3LSYA 2GBIA 5LXTB 3I23A 1YZGA 2QVZX 3CXUA 2RK4A 3B7GA 3KUUA 3ME5A 4PAGA 1DELA 3IV7A 4Q24A 3T95A 3V2IA 1D5WA 3TW8A 3VVCA 5JMTA 1LVUA 1F51E 3F6BX 2ZJ4A 4GZ3A 1HDCA 4TV9A 3TLGA 5IK2A 1JLKA 2WBLC 4QG3A 2WJAA 3GGGA 3WVNA 5HP4A 1JQ5A 1Z0UA 3I04A 3GFFA 3I6BA 3ZN2A 2VNKA 1U1CA 3RRZA 3WLLA 1P39A 1IN8A 3B2EA 4K9NA 1BIFA 2QT0A 3JALA 3T5AA 3CVJA 1SBQA 3CLHA 3NR2A 1DIOB 1QQ5A 5EWLA 4PNPA 1PG5A 4QULA 5DP1A 5EHIA 1RXIA 2JBHA 3RVDA 4K2HA 1ZM7A 4PQRA 4N12A 2J0QA 1J22A 1W1WA 1EDBA 1W88B 1CULC 2GZRA 4JGGA 1KAGA 1YZQA 2QHXA 4A8JA 3L01A 2M98A 4R2MA 2ZT7A 1E1QD 1I1NA 1XROA 4YRMA 1Y3DE 3CNHA 3KEMA 4RBNA 1Z39A 4QL3A 2AMVA 3C98A 1UKZA 2HF8A 2PAAA 2GNOA 3B1VA 3AR9A 3D3EA 3DC2A 4LQ4A 4M98A 5JHHB 1F8YA 3CU5A 3AH8A 3OCZA 3QVUA 4U8GA 2CN1A 2CMGA 4I9HA 4MROA 2B6HA 1QK4A 3H7IA 4OYRA 3DBRA 1IATA 1A5ZA 3RS7A 4UU0A 3WRXC 4D4LA 3EIFA 4MRMA 1Z34A 1C9EA 4XUEA 2D8MA 5C3UA 3PXDA 1LDEA 4J4TA 3AIIA 2Q21A 2V5VA 4PGHA 5E6SA 2AOUA 3QX7A 3VDQA 3TQHA 1FJ2A 4D0LB 2QUJA 2MSDB 3Q8LA 1SRQA 2XQFA 3ZWPA 4BNDA 4CMGA 4GPZA 4RK5A 4D26A 3LUFA 2CDAA 2F4VB 2E4VA 2ZRFA 3FGZA 1EFPA 4K9OA 5DYYA 1TVMA 1XZFA 3DLAA 1GILA 1ISRA 4P34A 5KTRA 1F17A 4FFSA 2VK1A 1PFYA 1Z16A 2D0DA 8LDHA 1G60A 1ZNXA 2V4MA 1E2GA 2ZYIA 3DBIA 3IPXA 1KU6A 3NANA 1BD3A 4HS9A 3PYMA 1P80A 1WCIB 4P4SA 4XTCS 4YRNA 3IMGA 1AH2A 3IULA 4KFSA 1T8YA 1O4VA 3RVOA 2C2KA 4BBPA 3JZMA 2JAXA 4AY5A 3MINB 2QRKA 3W8RA 5A2QA 1VZ3A 1Z08A 4V0MA 3CUVA 3HVKA 1XB2A 2J3LA 5KBYA 2Z09A 3FKQA 4BC0A 1GGEA 4BVHA 1YBMA 2XZPA 3D6UA 3N53A 1JVNA 1JHMA 4M36A 3N8IA 1RRPA 4PRKA 2J0UB 4IXDA 4ZRNA 3EJWA 1YBVA 1PFQA 3BSSA 3Q3IA 1JR3D 1T29A 5M7EA 4AS3A 1Z6XA 3H8VA 4H6VA 1E2QA 1QZUA 1T6YA 2QRLA 1TT5B 1ZN2A 5JXGA 3FWHA 1PLLA 1DAIA 1BQ3A 2JK0A 4KGXA 4BAUA 4KNYA 1DBPA 3THXA 5JNWA 3KJQA 3TTVA 1IDN1 4WV3A 3E03A 4DT1A 1JJBA 4M0MA 1Y6RA 1XQ6A 1N2SA 4RM2A 2R1UA 3EVCA 4CMIA 3KOWA 1XEAA 3B3QA 3QLJA 5HBRA 3GYGA 3I72A 3LC2O 1GGJA 4LYFA 3UTCA 1X1AA 4X66B 1QVZA 2GPWA 5E3HA 3R0QA 4D97A 1P8JA 1C3VA 2RC5A 4R1NA 5EJIA 1U2ZA 4XDGA 4DC1A 1E2MA 3L1UA 4UUQA 4F6LA 3K5IA 1JLLA 3CF2A 4OI4A 5CAEB 1CDDA 4AY4A 5JMPA 3K9GA 4XSHA 2ZJFA 3A36A 1M34E 1J99A 1VJ0A 4LX8A 1E5TA 2JCXA 2RGBA 3D0RA 1Q3KA 1BE6A 4GLFA 4W8GA 3O8OB 2K6GA 2I03A 4Y1EA 1Q2XA 4HNGA 4CF7A 3GCZA 4LC9A 4EFMA 5IJWA 2E0IA 2P40A 5F2NA 5AJWA 3BBLA 5KI6A 4YCLA 5E8RA 3WB9A 1RIFA 3W78A 1WB9A 2C98A 2LGJA 1FS5A 4MINA 1ZD4A 3J81k 3SVLA 2M32A 1TM4E 2H31A 1BXKA 2GS9A 3M2TA 2VKTA 4KC0A 1KR5A 3QE3A 5KTPA 3MAAC 2Q5LA 1LC0A 2DTXA 4BDSA 1GAEO 3PCXA 5CFRA 2VNAA 2ZTVA 3DEKA 5T3UA 1PIWA 1Z25A 4EVSA 1GNPA 3CISA 1JVSA 2IDZA 3U44B 4JLJA 2XKKA 1EP1B 1W19A 2GLTA 4MIKA 4A10A 3TBFA 4I4LA 3VPXA 4ZKEA 1T2VA 3SC4A 4NBWA 1A69A 2JASA 1JDTA 4TS3A 4ARVA 5JWOA 1S89A 2WYUA 4CL8A 2DUUA 1CFZA 1BS1A 2W6ID 2C7RA 2VJPA 1XLTA 1QV6A 1EP3B 4F12A 2AC7A 1ZRSA 4FGUA 1E5DA 2VRBA 3PEEA 4FLMA 2VWPA 4M3NA 2BDEA 2QL6A 4ECAA 1XZLA 1KZ7B 1NQXA 3RLFA 1G0NA 1IM5A 3U6KA 2OHVA 1SXJA 1W73A 2VBFA 5AVOA 3R3UA 1CZKA 3TLCA 2Y67A 2VN8A 5HX7A 5JI2E 1ADBA 1Q17A 2FP4B 3TVYA 4PZUA 1NQUA 2BGMA 2CL0X 5JBIA 4IZIA 4MKRA 2NAFA 1TA0A 1TCAA 5L3VA 2FZLA 2IXTA 3PNYA 5TF4A 3BMQA 4ER7A 3UG7A 1FXUA 1YA8A 2PXXA 2R6AA 2WIBA 3B51X 3GFRA 4RFSB 1WETA 5FWXA 2R8XA 4DR4B 2V4UA 3Q6NA 4AIRA 1ULHA 2WKPA 2E1RA 4A15A 3O2NA 1PDWA 1BOFA 2QUIA 3OEED 5FJIA 5EL0A 3GP3A 5K05A 1D6JA 2Q3LA 1GYPA 2PNFA 4LDQA 3JWPA 4BGDA 1VSVA 1K4KA 5C52B 3HG7A 2CDBA 1P6UA 2AMJA 2J9FB 2PAFA 3PVCA 5EZYB 1CE8B 4Q9AA 2OHFA 4D0SA 1JH8A 2E5FA 2PJUA 1Y1LA 3BHJA 4QDKA 1IIRA 1Z5GA 1AF7A 1TDJA 4F46A 1MT3A 5CVEA 3TAUA 3VDNB 2Y05A 3OUTA 3IMKA 1LVGA 4A7PA 4R40A 1XNRB 5I8PA 3P0RA 3X1JA 1ZOOA 1FSGA 3QA9A 3A25A 4PHCA 3QWIA 1JEYB 1DPFA 3MC1A 1HI9A 2PX5A 3KKLA 3W04A 3E70C 2QM7A 2QZJA 4UATA 5CLGA 1NVUQ 1K2WA 5LBIA 1E9RA 1DAFA 4K1XA 1FP4A 1N8TA 3GJZA 2AXNA 3TFWA 1JSLA 4RELA 1RXSA 3BAZA 2WIGA 3E9EA 5CA1F 5D3MB 2X19A 4Q6BA 4C6HA 1N2ZA 3KVOA 1FFWA 4FS3A 1RJEA 3SHFA 3TMYA 4F5EA 2XXAB 1H6DA 2A2ZA 1IJKA 3FJOA 3I04M 3ENQA 1JSCA 4EFLA 4F06A 1RFLA 3LFTA 1E1CB 2BMVA 3P9QA 1DE0A 5J1TB 2KB0A 3ZGZA 3TIVA 1XK7A 2X8WA 2QRVA 2PSDA 4Z2YA 4IVPA 5K5EA 3O4VA 3EODA 3PDCA 4NESA 1FYVA 4KCGA 1BXGA 4XLTA 4EGJA 2WV7A 1D8AA 4G0ZA 4W7SA 1W2GA 3LBIA 1UINA 3K1JA 5G2OA 2PZJA 4YXWA 1Q1QA 3OOEA 2JCVA 1IQRA 2WIJA 4G1MB 4N3BA 4HNAA 3KG2A 1B2RA 1WPRA 4M1WA 3OEHA 4JIMA 3T34A 2E48A 1L5OA 5HUHA 1QO0D 4Y9DA 4RL6A 3B12A 1SCUB 2YY7A 2ZI6A 3GLTA 4RO0A 1QAMA 2BI8A 2Y68A 1IB0A 4QGBA 1UT5A 3AEKA 2NTEA 2PZEA 5LKAA 3LSTA 3AKZA 3SQDA 2AZDA 3O74A 4G0YA 2G36A 4YRZA 2ODNA 2PS1A 5IBCA 3LX6A 1TTTA 1X7YA 1S3SA 4QTUB 1QG6A 3UCEA 3G9ZA 4ATNA 2OUIA 3EC7A 3CVVA 3T7TA 1FP2A 1SZJG 1XLTC 1QE3A 4LRSB 2V65A 3BJIC 4D8XA 2ZIEA 4DMGA 1E79D 1CS0B 2QTBA 1U0EA 1SGWA 4FPXA 4Q9HA 4A6DA 3FOBA 4W5TA 5L53A 4PN7A 3ZWMA 3M6LA 5AUPB 1UFRA 2EHDA 2ANBA 1IHUA 4XTRA 3UHPA 4EAQA 3U61B 3LCUA 1X9GA 5BWLA 3AVYA 3JXEA 3DE3X 5CH5A 2QNBA 2NACA 1AURA 2ORYA 3FD8A 1IBLB 1DJPA 1CDEA 4Y7DA 5B53A 1HT1E 4MW6A 2X8BA 3GVXA 1S8AA 2DX7A 4C29A 2BMDA 5JYDA 1FK8A 9ATCA 1CD5A 2PN1A 1BEUB 2A0WA 2Y77A 4JYAB 2FMIA 4XLZA 1BVHA 4NNPA 4MSUA 3LWDA 3TJRA 1PJSA 1OH5A 2DFVA 4O33A 4MUGA 3ZE6A 2BEVA 5IT9A 3CLUD 3E58A 4EGSA 2GRUA 1A76A 3HS3A 1MEJA 2A1UB 1XXHA 4IHJF 4IRMA 4LUCA 4ZOBA 1FJXA 3L9XA 3RLIA 3KPUA 4X45A 4ZYLA 4CKWA 5DOZA 3CVUA 1DKMA 1DC3A 1GGNA 3DMTC 4HCJA 3WGTA 3LG2A 2X7HA 2FRVA 5KINB 4BGUA 3I34X 3F5SA 4RIEA 2G1AA 1DJMA 2IYEA 3DTVB 1WD7A 1OLXA 4P6VF 4MAAA 4LGVA 4A8HA 4DBLC 1R6TA 7ADHA 2J3EA 2HRQA 4JK3A 3NDJA 1TYAE 2RHDA 1UM8A 2I7XA 2ZCUA 3I5UA 3DFIA 2ZIGA 1GTG1 4FNGA 4LBWA 4D9BA 2VJMA 4UE3S 3DFFA 3JD4A 2V7PA 4AMGA 1HOTA 5AW3A 3NHMA 4B46A 1AS2A 5KTSA 3VKHA 4J7UA 2WM3A 2R7LA 4G5SA 5CCDA 1VPLA 1NVFA 3WC4A 2OV2A 4I55A 1E3TA 4HPXB 1QTRA 1ZZEA 5LZ2A 2WWWA 2R65A 4CFYA 4Q19A 4FQ5A 9GPBA 2IH2A 1SMKA 1M0SA 1VP9A 1GAQA 2ZVDA 1FTYA 1O8CA 1SOWA 2V54A 3DCJA 4XSGA 3T38A 1O0CA 3JZFA 4N0MA 2ZIAA 4OBEA 2NO0A 2B5OA 5J2UA 3DV2A 3PEUA 5LPNA 2MYUA 1RYZA 1ZJZA 2AQHA 4WW0A 5EUQB 3WFIA 3ASYA 1ZQ1A 3EEBA 4MVJD 5EIEA 3CYFA 2NYAA 5CT4A 2LBPA 3WWYA 3A9UA 3JQGA 1CLUA 1W93A 2K7ZA 4KXQA 3IV9A 1GA1A 1ZPDA 3A05A 2RGDA 4WDRA 3ANSA 3NM5A 2OXIA 1JKFA 4IZ6A 4KPUA 1BOOA 4X1KA 1R12A 2VATA 3N58A 5BMOA 1R16A 1EXWA 1LPMA 4OPMA 3S28A 2R1VA 2WA1A 1J8FA 2BM9A 2NV2B 4CLOB 5JY1A 3E2PA 4KGZA 3KELA 4ZOQI 3K9NA 2CJFA 1G2IA 1TMOA 2J67A 2AG6A 4CL2A 3ENNA 1V7QA 3DPIA 5BYKA 5C8VA 3PQDA 1H2WA 1NM5A 3EW7A 2VCYA 4X1IA 3TK1A 2DHRA 2VPZA 2OXTA 4ZXFA 4OG2A 1ZCJA 3ESBA 5D7BA 2OK8A 2CFTA 1GGKA 1NIJA 1Q91A 3JARA 3QVWA 4IILA 3NHUA 2Q8QA 3OT1B 4KFRA 4RANA 5JCJD 2WTUA 3RAJA 3SAJA 1IBRA 5FWDA 2Y1WA 4DMLA 2GZHA 4M54A 1NULA 4QXQA 1WNTA 4PAOA 3W9YA 5FXMA 3RTCA 3D6MA 1BDMA 4J9VA 4OFXA 4ZT4A 1QIJA 1SBIA 2ICAA 4F72A 5KOHB 4U5QA 3VKFA 2G9ZA 3IX7A 1SEVA 3NXKA 1JDNA 3PQCA 4WTOA 1G3UA 3QTTA 4LZOA 2BAGA 1D6NA 5FEMA 3P5BA 4HATA 1M0EA 2C9OA 1SQ5A 2H63A 2H5LA 3AR6A 4TMWA 4L4ZA 1N3LA 2PNJA 3S2GA 2YCLA 1ODSA 4ZT2A 3Q0TA 1V5EA 2BR3A 2PD4A 3ETJA 4DV4B 1E1NA 2W6PA 2Z1DA 2GWHA 3KKPA 2O8BA 3VH2A 1YZLA 2C2GA 4Q7QA 4JJIA 1G63A 1XG5A 1UIMA 4XB6B 4YI5A 4EHFA 1Q84A 1F0YA 3K70C 5JISA 2O3UA 3GFSA 2MIIA 4RIHA 5EYPB 1Z45A 4FD3A 3LKDA 1BMDA 4MJ3A 5HRAA 5CA0F 2R1TA 2VUHB 4QPCA 2PO7A 4H1WA 3K9FC 3P9PA 1J9GA 4GBJA 4MVYA 4EMSA 1NKVA 1XRNA 2F90A 3T7KA 3VX4A 3AHIA 5MFZA 1G38A 2ZVPX 4KXXA 2EX0A 1P1IA 2GLXA 2P2NA 2R48A 2BF7A 2VPXA 3KOUA 4RZSA 5AKHA 1CVRA 5H68A 1P1RA 2R9VA 5LDDC 3ZWCA 2CVOA 3JSXA 2I4TA 5LXTF 5KYNA 2BM1A 3RVKA 5B1DA 1W49A 1WCYA 5KDLA 3QNUA 4DREA 1PT5A 3QK7A 3PD1A 3RSGA 3OTWA 3SR4A 4ZWNA 4WLNA 2BZSA 3CW8X 4E12A 2MMCA 4QGGA 2O8CA 1UBLS 4EHLA 1Y82A 3SSOA 5ULLA 1V9CA 5JDIA 3DYBA 3O94A 4B2YA 1YR6A 2V98A 1L5WA 1FX1A 3WQHA 1EK1A 1QIDA 1YB2A 1KSFX 2G1JA 2J7KA 2IYPA 3QJ5A 4IXWA 1M7GA 1RCTE 4IXNA 2NUTB 4PAWA 2D1TA 3T12A 4EY5A 5JXWA 4QGSA 5IDXA 3QVMA 2LE0A 1TJ3A 1P9LA 4HBGA 3ZVNA 1GV0A 1AT1A 4GICA 1Z28A 1K98A 3G85A 2D2XA 4GSKA 1WDKA 3O8CA 2Z2YA 3KZVA 1WZIA 3R3WA 5IM5A 2Q1WA 4GXRA 1BZYA 1PRYA 4QXOA 4RTLA 5A62A 3PFGA 3HYRA 3EUEA 2ZM5A 4NZMA 4PX5A 4PSUA 4WEOA 4I4TB 2CVQA 4N03A 1TM3E 3SQLA 4OGFA 3EQ8A 1DSSG 3LW7A 1HZZC 1KDYA 4EF6A 1SD1A 2HYIC 5DTIA 3HSYA 2B8TA 1AO3A 1IUPA 3HKEB 4JHLA 4NNJA 1B14A 4U5XA 2WWRA 5KMGA 4IVQA 3P71T 3ND8A 1I1OA 1CHNA 1JXOA 2AJ8A 1YMUA 4CMKA 2VYVD 3NTOA 2Z6QA 4JT4A 2YX1A 4I1UA 4KPGA 4N8DA 3ZQUA 2ZIUB 2VRWA 3AP2A 3W05A 5J58A 3FJYA 4K6FA 2JZOA 2XTAA 3A6LA 1NM5C 4TZ0A 2B7CA 2J3MA 1PX0A 2WAXA 3N6XA 1NVKA 3FR7A 4KO2S 1LU9A 1CQJA 1MTZA 1PZXA 4TQAA 1GGVA 3GNSA 2HTFA 4LGCA 2D5IA 3E9DA 4EEKA 1DV1A 4GP7A 1QZ3A 5HKKD 2JJ2A 1L7EA 3C14C 3B6KA 3E53A 2FJ0A 3VVBA 3G6KA 1YS7A 2C59A 3O90A 1O9BA 4ARZA 5CB8A 2CB0A 3QHQA 3MMZA 2XNSA 5HF9A 4TLCA 3ZHYA 3ZJYA 5K6AA 1PHPA 2QPOA 1OGIA 3LXRA 4XJVA 4B74A 2XWBF 1XLVA 3SSAA 1QBGA 4A8JB 1T1JA 4ZGBA 5AOBA 5IN5A 3WLQA 1T1IA 3HBLA 1KQGA 2Y66A 2QRPA 5BP7A 1S2DA 3KR9A 3QE9Y 3UB4A 4RTNA 2G9RA 2GPNA 1XA3A 3NBXX 1P60A 2LVBA 3O2SB 4B0PA 3TUZC 1NF3A 4UBOA 3ZX5A 5JLJA 1HYBA 3H9EO 4MUJA 4NWIA 1EGHA 2GESA 3OH8A 3C3XA 5A6SA 3H19A 4M0CA 4X20A 2VH2A 3KHSA 1DS6A 2IW1A 4EJFA 4W9NC 2VQEB 3LWBA 3STVA 3O1HB 4MVJG 3OY7A 1KGSA 2XT6A 4N3GA 2YC2C 4B2IA 1T0JB 4J1SA 5GM1A 1E3LA 2F3QA 3ER6A 4CQMA 2Z6UA 1T6BY 4FB4A 1ISHA 3NNNA 4OQYA 3EQ9A 4KQ6A 2JI9A 4Q6WA 3SHTA 5E6SB 1MAHA 1MO2A 4FR0A 4P54A 2VL7A 4DKXA 2AOUB 2Y1LA 3GEEA 4K46A 4ZIRB 4M9CA 3GCWA 4WLEA 3EDOA 1CNFA 1I2DA 1PYDA 2D7CA 4BNDB 4ISBA 2A5YB 3HYCA 5LZ5A 1UJMA 3HP1A 4L73A 1ESDA 1N6LA 5I7WA 4XUCA 5C53B 4BWYA 1ODLA 1TJPB 3ILSA 3DE7X 1B6TA 4LE2A 3FRJA 5E38A 4E15A 3GA7A 5FPKA 2TMKA 3D4IA 4AXBA 4RE6A 1ZVMA 5IAOA 1GM5A 1NUSA 1EGQA 3BL8A 3EVAA 4HZUB 4P4SB 1OAAA 4BGIA 5JDIC 3TXAA 4EO9A 3B36A 3LGSA 4DCUA 5DRTA 3QE4A 1B2LA 3D8TA 4JQZA 1UBHS 3GGOA 5DGXA 1PKXA 3TG8A 3C5HA 4AJNA 5C4MA 1XAIA 3ORSA 2IVZA 5CTJA 5L40A 2OHHA 4JJ4A 5F9HA 2G5CA 2JVJA 4RD2A 2JKVA 2O6LA 2PUWA 3VAAA 3SXUA 1P2GA 4UCWA 1YDWA 2XZTA 3IBYA 1GKLA 4IFIA 3I53A 5B7GA 4OP1A 4TMFA 1QIKA 1R8SA 1J2YA 3PIDA 4IINA 3Q7PA 1AQUA 2FPPB 3JQEA 3D02A 3PD0A 4PZDA 3T7AA 4KU4A 3BGIA 3FLBA 5BO5A 4D43A 1MHTA 1BMFD 1YJCA 4PO3X 2BKUA 4QGFA 3DCYA 3LO8A 1B0PA 5J5VA 1DRJA 3AR4A 2ALJA 1D2AA 1EWYA 3PV0A 3ZGXA 3KJFA 5BN5A 2O4UX 3THXB 4URXR 4DDMA 5TS2A 5CYGA 4MV7A 1L8LA 3OJXA 5ALNA 2WJWA 1QGYA 2OCLA 4UJ5A 2IZ0A 1TZJA 2AN1A 1Q2UA 3MLEA 4B85A 2ZCJA 3L6UA 5JHGB 1I3CA 5J4LA 1GNVA 5KS2A 2GKSA 3T3IA 4YI3A 4R9NA 1T9CA 2ZI3A 4BZZA 3RK4A 3LYUA 2P0AA 5DLYA 4G25A 4JUAA 1AN9A 1IZ9A 4GI3A 2HXYA 2P9EA 4WKBA 3KVVA 3F46A 1HETA 2OTCA 3MQ4A 4IYJA 4OBWA 4FJ1A 1JLLB 2BKEA 1ZM4A 1KY2A 5IZCA 4I3FA 2JHCA 4DDHA 1Z17A 2XITA 4JB3A 5EAIA 1FCJA 1LFAA 4NS4A 3S4YA 4GM1A 3B2QA 1KFCB 4PEVA 3NPMA 3L18A 2GRJA 2ZSKA 1SZCA 1VYUA 1PFVA 2OV6A 3DO8A 4JVOA 3PWSA 5K6AC 1U8EA 1EKXA 1VCMA 2Z4SA 3A26A 2Z2JA 4KNVA 4M1ZA 3BM5A 4FFBB 4IDDA 3CZAA 2GH1A 4PTYA 1K1EA 3S2EA 4AWAA 2C8JA 2PUAA 3BXHA 4RKWA 1R0ZA 1G5HA 1XELA 2IXGA 3LAWA 3MLAA 1JL3A 3PITA 2PGDA 4P83A 3VC3A 3QY9A 4C3UA 2CXOA 5JQWA 3OIFA 4IDNA 5KREA 3B1KA 5LP1A 1E7YA 4GO1A 1IM8A 3ZR4B 4BWVA 5KC9A 3OT5A 1P4SA 5HGJA 2IV7A 1RPZA 3QW4B 3UV3A 3UWPA 3CTPA 3QU4A 2H9YA 2NT4A 3LVBA 1T6ZA 3A4VA 3CT4A 4RH0A 5KYXA 4ACAA 1A1VA 4D98A 4LF9B 2FSPA 2HFKA 2W6IA 3DM9B 4TRJA 4XFDA 5FTKA 2FFBA 3MGAA 1TUBA 1FDVA 3HWSA 2QAGB 1YR9A 3K5PA 3OZBA 4NAHA 2OYCA 1MZPA 4JP1A 5TDHA 2ATIA 3NJRA 3IRVA 1EEHA 4LRTB 5KJ1A 2GKOA 1EBBA 3I12A 1NURA 4GR5A 1GL6A 4CODB 5IXJA 3NOVA 4D8VA 5KU7A 3TZBA 4EJSB 1LSSA 4DSNA 1PBNA 3FJ1A 2FSUA 4K6HA 3ILHA 3WL4A 2RHHA 4XPIA 2HPZA 4RM3A 1BN7A 2HBRA 1QRUA 2QD2A 4BMOB 4YTEA 1U3WA 1SXJB 1OX4B 1RRMA 3C1AA 3PPVA 1AQNA 3R0IA 2C5LA 4S05A 1KJ8A 4X9XA 3KQHA 2YJ5A 3EDRA 3O8QB 2QRHA 1IAVA 3ZI4A 1D9XA 1YQWA 4CDMA 4B17A 1JR4A 3JVDA 4YYZA 4KLNA 1PNRA 4PXAA 3SY8A 3T7SA 3UOGA 1AGRA 4MW7A 4R01A 4EJ0A 1RM3A 3DJFA 1TVEA 4QKQA 4ZICA 2PBFA 3L0BA 2OG1A 4OP3A 2IEZA 1NW6A 3PFBA 4BB9A 2BGKA 2B8WA 1ZVQA 2G5TA 2PPLA 4TRRA 1GKUB 4PX2A 2PQ0A 2XD4A 1KH2A 2ZULA 3CBQA 1H3EA 1Y7PA 1FDIA 2PRZA 2J9ZB 3NDRA 3FTQA 1JFFB 4HSGA 4LV8B 4KMRA 5E0KB 4ESOA 4CM8B 3FFAA 2QTCA 1OXTA 1RP1A 4MO9A 2LIPA 5C1BA 1FU8A 3R5XA 4HGOA 5LA6B 3HSSA 3AF5A 5CIQA 1PR4A 2I91A 3FCEA 1NOKA 1R9MA 3C5EA 4KGDA 1X8XA 4NQZA 2CLSA 2RKBA 4FYVA 2XUFA 4NFHA 3MYRA 1KY5A 3C1OA 1QCDA 4J9UE 4EITA 4LHYA 1L9XA 5JS2A 3UJCA 5G02A 4TSFA 3ZJ5A 5JH7B 3H1FA 1SY7A 2Q4EA 4WA7A 1FL9A 2WIFA 4CMAA 1X1TA 2YVKA 3GRCA 3TSOA 4NSNA 3ZIDA 4C2UA 1G20E 3IRUA 4KR2A 5FNVF 2C31A 1L8OA 1V45E 4EECA 1SEPA 5TPZD 2XWQA 2Y92A 5CYFA 5DCWA 4MI1A 2J0VA 4DLYA 2QE7A 1QOPB 2I65A 4H7JA 1YC2A 1KSHA 1C30A 2D5BA 1FP4B 4G85A 2J31A 3TAXA 1UIRA 4C43A 2RK3A 4IXMA 1I0ZA 2MYTA 5AW9A 2XUZA 3TX6A 1DI0A 1ZHHA 1AKRA 2EQAA 1BYUA 1ZIDA 2ZB8A 4B33A 1JXMA 5IZCC 2W43A 1V8OA 4K9PA 5B2EA 3I01A 2Q5IA 2ZAGA 4RK4A 3DKKA 4J94A 1JG7A 3MWLA 1YVPA 1T2CA 3CNOA 4FYKA 4R7ZA 4D57A 2V96A 1BXGB 5K09A 2BFDA 4HAYA 2J4DA 1XZ8A 3V55A 2YWBA 2FH5B 2FW1A 3MUOA 3R23A 4G0WA 3GP8A 4EENA 4YP1A 4C2AA 4L2IA 2EEZA 5AO9A 2WWHA 3NAMA 1LRLA 4HNAB 4MUEA 5FFMA 5TR9A 2HU5A 3A11A 1W4BA 4L8WB 5T6BA 3UB2A 1EESA 3Q12A 3LC7O 3EF0A 1PEDA 2D0OB 2ZCVA 3IPRA 2ENWA 3PKZA 4ZREA 3TQIA 5BW4A 3DZDA 4LY0A 2BMAA 2WMYA 2WZCA 2ZRLA 3H1EA 7MHTA 1U2TA 1IAQA 3AEKB 3H2YA 3K16A 3ND7A 3OZCA 4B9AA 2QN2A 3V6MA 4B47A 4F9EA 1NRWA 2YZNA 4QNMA 4X8MA 4RV4A 3S2YA 1OASA 1F4LA 1Z63A 3VHLB 1JH9A 2O8FA 4J0QA 4E1BA 1X7YB 1HZJA 1V4VA 4RABA 2GFQA 5GAJA 5LB4A 1G6OA 2C5BA 3CS3A 4L95C 4BAGA 5TXGA 1WVIA 2GLUA 4PXSA 3L7KA 4MS3A 3K7EA 1LWOA 5A5GA 5TQJA 3WWDA 4JCOA 4LZLA 4ZXPA 4RVNA 5ICCA 1JQJC 3NBFA 1AS3A 4JEIA 4R69A 4CLXA 2OYSA 2Z1MA 2XMDA 4ZAZA 4DILA 3PVSA 5U9CA 3ZQ6A 7YASA 2QN3A 4JJ6A 4E11A 5IM4A 2ZWVA 4JLPA 3H42B 1OE0A 2F1KA 3WV5A 2LW7A 3SVZA 2Y99A 1PVVA 3GMIA 2W2OA 4BQRA 2JFVA 2PCLA 4WBNA 4EKDA 5J4KA 2PQ6A 3E3OA 1NRJB 2IP1A 4GOXA 2WFZA 2I6GA 4MA0A 3OQHA 1AXRA 1EU1A 5FOXA 4JL6A 1H66A 3DVLA 3LKZA 5IHXA 1ID1A 1KERA 3AESB 3COYA 1X2EA 3EOZA 1OGYA 5JSQA 2ZFUA 3REFA 3V34A 4M1EA 1XXHB 5CVJA 2ONCA 3L92A 1B8PA 2OCXA 2QP9X 4K81B 4MS4A 4CKWB 3BTOA 2P9TA 4QSMA 1EDDA 2GXAA 1C8BA 1R5OA 2HIMA 1I4LD 1LBTA 1WSAA 2PVPA 2RFLA 4J4BA 4O5OA 1PR9A 1M66A 2JAHA 2KJQA 4EVRA 1IXSB 4FGKA 4PZ0A 3C3EA 3TLMA 1OLXB 1SCJA 1W7AA 4NV3A 4US1R 1RKXA 4OF4A 4AL4A 1FDRA 1QJCA 5FHRA 5FUMA 3PI7A 1BU5A 1TVKA 4M37A 2BGRA 1MJNA 1G8SA 1TPZA 2A5JA 1URPA 2F8MA 5IAEA 4BBZA 1K5GA 1ODTC 1Q7RA 2HC9A 2RHRA 1EIWA 1LDYA 1C4OA 1WOMA 4LJ7A 1YDFA 1S3GA 2SCUA 3LFHA 3SX2A 3WYBA 1U3GA 5IAKA 4B32A 1YOBA 1QDLB 1Z4IA 5K6TA 1ZD1A 2FG6C 4KIJA 1TA9A 4MHSA 1GNQA 1SUDA 2HMTA 4I55B 4DPMA 4KI0A 4RY2A 4ZT7A 2E4XA 3DL0A 2GVZC 3OURA 5EE1A 2C1ZA 3QMMA 2ZB2A 1DT3A 1GSIA 5E4YA 5ALJA 2WB2A 1WU7A 2A9JA 3FB1A 1J90A 1CUFA 1VPVA 2AMFA 2EFYA 5EHZA 5AKLA 3O4HA 3FOEC 3AEQA 5HW0A 1NBMA 3NKVA 3UPTA 2OGZA 1XDDA 2CF5A 1FRZA 2EZTA 4TMXA 4CVNA 5ALVA 3EVBA 3DD5A 3ZWYA 1Y42X 4O0LA 1DX4A 5DNAA 5EJ6A 4RTMA 4E2WA 2QLNA 4WZBE 4FMCF 3BFXA 3MCZA 4ZARA 2CEAA 3JASA 3JQGB 1CF9A 3UQYS 1MOQA 4PO9A 2D54A 1T1GA 4X63A 4Q15A 4X1KB 3VHXA 4GYJA 3QOYA 2JG3A 2R1VB 3AXTA 3V7WA 3U4HA 3UJDA 3G1UA 5P21A 5HIAA 2B1GA 3MJDA 4BIMA 3EVZA 4G41A 4XGRA 2VP9A 2P2YA 3AUXA 3MAGA 2XUQA 2R3SA 3PC6A 4AMZA 1ZVKA 4JI3B 3K6KA 5CGZA 3QXGA 2KX7A 1HFJA 1MIOA 2HBYA 2ZJ2A 3FDFA 3UJ3X 3H0KA 1IZZA 3ROKA 4DBVO 2ZJAA 3VSBA 5JJLA 2P90A 1KO5A 3A6GA 3W90A 3Q6MA 4RKQA 4DNOA 2G80A 2YMMA 1R0LA 3MJCA 4FVTA 3TOVA 4AF8A 4UTPA 1W36B 4MKIA 4ER0A 4KN9S 3ZU5A 1KI3A 4E07A 1ZD3A 1JFRA 4OQEA 3WNCA 2P79A 1GPH1 1M8KA 4B76A 1M73E 4LI3X 3T9FA 2WG2A 4RHCA 1T3TA 2HA2A 1QFZA 2XTNA 4KFUA 5EZQA 4J0KA 4A1FA 1BHJA 4YRDA 5G40A 3JAKA 1CNMA 5KTMA 1FTNA 2EHJA 2JK1A 4WY5A 1NQAO 4CKBA 4R1TA 2AR0A 3TE6A 2C07A 2XUPA 1WA5A 2BLNA 1JQ3A 3HDQA 1SVNA 1CW2B 2BRUC 3BWBA 5JLAA 2BEWA 2VPIA 3QHPA 3SS8A 4AS1A 2VDKB 3GW8A 4W6QA 4B7XA 3ROFA 2UKDA 2OG2A 3A1FA 3LK6A 2GFHA 1HY3A 3M0EA 3RC1A 2IUEA 3FKJA 5E4TA 1E3WB 4KEAA 1ESCA 3FYHA 1MO5A 2O8BB 2GCOA 4M38A 1YRLA 4LW8A 3CWQA 2GAIA 2I2AA 4JXJA 5F51A 4BZPA 3JAMA 1R6UA 4I5FA 2I1LA 3HA3A 4CM6A 4AJEA 5F7JA 5AM4A 1FOEB 3RHZA 1ZW6A 2R1TB 5FOQA 3R9XA 2P9ZA 4QATA 2GVNA 2C1EA 3DOJA 4NBNA 2CUZA 3ODPA 4Q9DA 4MQ6A 4UFPA 3KQWA 3BX1A 3HJTA 2O1XA 1II8A 4I9NA 4YECA 5BN1A 4PCVA 4BQSA 2QD5A 1H8HA 4GOOD 3REGA 2ZTUA 4IP0A 3PC2A 3CH5A 3TZEA 2DVMA 1ECJA 1ZCBA 5KKCA 1KDTA 1XCJA 4J2OA 5DZSA 2O8CB 1V2HE 4ZYVA 1ZK2A 1USWA 3OIVA 3KC2A 3MWKA 5C80A 4K9KA 5SY9A 1WIWA 1SOVA 2BT4A 1C7ZA 2O2ZA 2PLWA 2QMHA 2WYHA 1L2TA 1QK3A 3I4CA 4PC3A 3ICPA 4MMZB 4NRDA 3K3PA 5CT9A 4AYXA 5CM2Z 1W0KD 1L6RA 4JL8A 2DBVO 1NVVR 5C8YF 2LNDA 2OEPA 3BC1A 4JELA 2NZXA 4P0TA 2FKNA 4OFZA 2JHAA 2R87A 4GZ5A 2L42A 1JDSA 3KD2A 1ZBDA 2WKWA 3GRPA 2XB4A 5BSUA 3K6SB 2OBMA 1UP4A 5ILOA 3LCJA 3S8EA 1OPXA 3TTUA 2AL7A 2IXAA 4OK5A 1RKBA 1OYOA 2IV3A 3I01M 4KE9A 4BVFA 3EIWA 3JVIA 3K72B 4N0DA 5CEJA 1J56A 5IJXA 4G5XA 1Y3BE 4HK4A 1H0RA 4RYDA 3W8DA 3I9LA 1V3TA 4AF7A 5CFLA 1ARZA 1P3Y1 3O38A 3RS4A 5JI3E 3C3WA 4IQ0A 2COUA 3QYJA 4NV0A 4X60A 4DSTA 4URZR 1YHNA 3S3TA 1KHHA 4ND8B 2P1DA 1ULSA 1D07A 1GQRA 2NNWB 3B7WA 3UGJA 1VDMA 5H80A 1F6BA 4E09A 1K3UB 3RFXA 2DWOA 5M3BA 2J3JA 1TEXA 2CEKA 3RWOA 3PHCA 2D13A 2JGMA 4DA9A 4YREA 1G291 2X0NA 1UBRS 3H5LA 3I1IA 3OFKA 5LDGA 3I3OA 2D06A 4I6EA 3EXHC 4GECA 4ZTUB 2I6SA